4GNXB

Structure of u. maydis replication protein a bound to ssdna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
122
Chain Sequence
NTLRPVTIRQILNAEQPHPDAEFILDGAELGQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDASEIRNNVYVRVLGTLKSFQNRRSISSGHMRPVIDYNEVMFHRLEAVHAHLQVTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Putative uncharacterized protein
publication title Structure of
rcsb
source organism Ustilago maydis
total genus 31
structure length 122
sequence length 130
chains with identical sequence Y
ec nomenclature
pdb deposition date 2012-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gnxB00
3RZOH 3GD7A 1OXXK 4EX5A 2K52A 3SGIA 4XTCS 3KF6B 2MQHA 4QIWE 1X6OA 3KYHC 3CXCA 5C3EG 5M5YH 1PH3A 3M4OH 5K36G 4YY3Q 3J80i 4OO1G 3L7ZC 2K75A 1YVCA 1BKBA 1DGSA 2E8GA 4C3JH 4A3MH 4NXMQ 1J5EQ 1MKHA 4JV5Q 2Y0SG 1QVCA 1TXYA 4TVAB 1YJ9A 2JA5G 3LGJA 1CKNB 4DV3Q 4A3FH 1HNZQ 2LSSA 3E0EA 5IYBH 2B63H 1RIPA 4GLAC 3L0OA 2D0OA 3MXNB 2Q2UA 4LWCA 4A3CH 4Y52H 5BR8L 1BBUA 2Q2IA 3A5ZB 3K7AH 3GTJH 4AQYQ 1PH5A 1LYLA 3FHWA 3CP0A 5HGQA 1Y14B 1Y1WG 4LFBL 1C9OA 5IP7G 2N3SA 1FJGQ 1A63A 1E24A 2UXDQ 3PO3H 5M3FG 2OTJA 3GTGH 4A3EG 2NN6G 5IYDG 3S2HH 3HOUH 5GAGC 3S16H 5M5XH 2FXQA 4A3KH 2E5LL 3H3VH 1IBKQ 1EIYB 4JI6Q 3PIPA 4AYBG 4DR2L 1YHQA 1K73C 3PCOB 2HIVA 4DV0Q 1LM0A 4A3GH 4KHPQ 3EBEA 3ULLA 4X62Q 4JI5Q 2VY3A 2F4VQ 2JQOA 1X65A 4HIMA 1KD1C 1UEBA 1HNXQ 1XPOA 2MNAA 3CCRA 2VS1A 2JA7H 3HFZB 3H3VI 2AWOA 2GVAA 2ASBA 1Q8KA 2CWAA 3Q8DA 4A3JH 4JI3Q 2JEAI 1VQEA 3EN2A 3GTOH 3OW2A 1G6PA 4P73A 4AH6A 2K5NA 4YCVA 3U50C 1R9TH 2NVXH 1VQBA 3UDIA 4GLVB 1Z9FA 2VW9A 3AFPA 1SRUA 5FLMG 1XNQL 4FDBA 3NBHB 1SFOH 3GDEA 3I2ZA 1J6QA 1N8RC 1X54A 2WP8J 1PH1A 1UWVA 3KOJA 2LXKA 2A8VA 3J7A5 3PIOA 2PI2A 2VNUD 3TQYA 3K7UC 1KXLA 2R7ZH 4JI1Q 4POFA 2VUMG 3G71A 3HOWG 4BBRG 2QGQA 2OQ0A 4EQ5A 3NELA 2MFIA 4R4IA 5FJ8G 1QZGA 4A3IH 4BY7H 1IBMQ 3HOZG 4IFDJ 2I5LX 4LF7Q 1U5KA 5JJIA 4LFCL 3UE0A 3G6EA 3F2CA 4YCWA 2PNHA 1X3FA 1H95A 5LMUL 1JE5A 2UXBL 4LF9Q 2YTVA 1XTDA 3CCLA 2R7DA 1HZBA 3FKIG 5IY0A 4JI2L 5IWAQ 4JYAQ 3CAMA 5C44H 1CKOA 2K14A 4PG3A 1L1OB 5GROA 4DR5L 4B3MQ 3B6YA 3UDGA 4A3DG 3KF8B 1IL2A 1Q1EA 3JC66 1GM5A 3CD6A 3W5OA 1LTLA 4LUOA 3W1GA 5H1SE 4HIKA 4DV6Q 4BBSG 1PYBA 3K0XA 1BBWA 3PV0A 3HOXG 1KQSA 2UUAQ 2ZM6L 2HHHQ 2Z0SA 1GVPA 1YHBA 4MZ9A 3I4MG 1HR0L 2UUBQ 4YWLA 2WB1E 1VQFA 1L2FA 3U4VA 3KF6A 3PUYA 4XIGS 3CW2C 3PF4A 4OWXB 4PMWA 4HJAA 1XPUA 1B70B 1WCMG 4B3TQ 4DV7Q 1UE6A 1E1OA 1OTCA 4DR7L 2NZOA 4DR6Q 3ER0A 4YHHQ 2NVYH 1U0LA 1HNWQ 1UE7A 3PUXA 4A76A 4P75A 1WFQA 2L15A 1G51A 5J3BA 2BA1A 1N33L 4IPGA 3ULPA 2K5VA 3CC2A 4JI0L 4NXNQ 3PO2G 4APVA 4BXXH 5C0XJ 1XMOL 1CKNA 3FP9A 1I6HH 1NY4A 3F1ZA 4L5QA 4BY1G 4L5TA 3RLNA 4DUZL 3PGZA 4R1JA 1Y1VH 4DNIA 1VQAA 2C35B 5GAEC 1YNXA 4DV4L 1K9MC 4A4IA 1VQ6A 3E9HA 3AYHB 2CFMA 4LF5L 4IFDI 2NVTH 4OX9Q 1EUJA 4LF8Q 1PH6A 3HOVH 4JI8Q 4X66L 2Q2HA 1VCIA 3AEVA 2IHEA 1VS0A 2JA6G 3PO3G 1JJGA 4JBJA 4KHZA 4YY3L 4WJ4A 4LF4L 4X64Q 1VQ9A 4PZ6A 1PH4A 5C3EH 3TRZA 4DV2L 1IBLL 2AHOB 5AJ3Q 2JK8A 4NXML 2R93G 4LFAQ 2VQFQ 3UE1A 2CCZA 4C2MH 2VZAA 4JV5L 1HZAA 2A19A 4A3BG 4HIOA 3J7ZC 3CPWA 4RMFA 4UPAA 4DV3L 5IYCG 4A3MG 1PH2A 1HNZL 1TWHH 3W1BA 2JA5H 4JBKA 1AH9A 3M3YH 2KCTA 2N49A 1MJCA 3CCSA 1N34Q 3I56A 1VQDA 3GTMH 2OCEA 5ELNA 1N32Q 3RZDH 4O0AA 4A3FG 1GD7A 2H5XA 1NTGA 1VQCA 4OO1I 1KIXA 1SE8A 1FGUA 3M9BA 2DGYA 3HKZE 1JT8A 1PHJA 4HJ5A 4AQYL 1VQNA 1FVIA 4C3IH 3I55A 4IOCA 1CUKA 4A3CG 4DV1L 4UP7A 4DR4L 3PUVA 3CCQA 1MIUA 2UXDL 1QVFA 3CMEA 1B8AA 3J80c 5C0XI 2OWOA 3I4NG 1I50H 2JE6I 4A3EH 1IBKL 5IE8A 3KFUA 4JI6L 3M4QA 4LFBQ 3S17H 2RHSB 2LXJA 4IOAA 3T1HQ 1TWGH 4KHPL 1IZ6A 2VUMH 3HOUG 1AE3A 1D8LA 1CSPA 4A3KG 2E2IH 2JA8H 4HJ8A 2IX1A 3CPFA 4OONA 1EYGA 3JAMi 1GO3E 1AE2A 2CKZB 1HNXL 1WI5A 5M3MH 1K3RA 1YITA 2NN6I 1PV4A 1XJVA 1N36Q 4JI3L 4DUYQ 2E2HH 1SN8A 1GKHA 1K83H 1M90C 4P74A 5DLQE 2YTXA 4JBMA 1I94Q 1L1OA 4Y7NH 1B7YB 2YYZA 2KENA 1NMFA 2N8NA 4L5RC 4DPGA 2RCNA 4HJ7A 2YTYA 4TQUS 1E7ZA 3H0GG 4KI0A 1D7QA 1WOCA 4LF9L 4JI1L 2WFWA 4C3HH 4QQBX 3HKSA 4JOIA 2IT1A 1A62A 1PFSA 4UP9A 3D0FA 4QY7A 2KCMA 3M85A 1VQ5A 2UUCQ 1L1OC 4JI4Q 3U4ZA 3A0JA 3ZJYC 4IJLA 4X65L 5LMNW 2B29A 1IBML 5JJKA 4JI7Q 1KHIA 1MJEA 1OXTA 5EAYA 3KLWA 2A1AA 3PSIA 3HOZH 1VQIA 3K8AA 1XNRQ 3S24A 1KC8C 3A5UA 1PH9A 3T1YQ 2WAQE 3PUZA 3STBC 1CKMA 3AFQA 3JAMc 1CSQA 2OQKA 4DR1Q 2OTLA 4MNOA 5IWAL 4K0KL 1Q1BA 2EIFA 4JOIC 2Z6KC 4PZ8A 3FKIH 5JEAG 1XPRA 4B3ML 2D62A 1YJWA 4DR3L 5JJLA 3DLLA 4A3DH 2R6GA 3TEHB 1E1TA 3ULJA 3L2PA 1V43A 4LW1A 2UXBQ 4X6AH 1TWFH 1EWIA 2EQSA 5LMNQ 4DV6L 4DAMA 1VQ8A 2UU9Q 4DV5Q 4J15A 1NMGA 5GQOA 4GKKQ 2UUAL 4DR5Q 2HHHL 2UXCQ 4WJ3M 2MO0A 5IP9G 4LUVA 3OTOQ 1YJNA 4LF6Q 1OXVA 4RG1A 1KL9A 1K0RA 3F2DA 5HY6A 1NJIC 3A74A 4L5SA 4B3TL 3G4SA 1QUQB 2BH8A 3K81C 3CMAA 1FL0A 1PH8A 2HT1A 1KAWA 1WCMH 2AWNA 5IT9c 4DR6L 1X9NA 2ZTDA 3M7NA 4R4CA 2ZJPA 1XMQQ 2XGTA 3K80C 4DAYB 1IXRA 3AQQA 1Q12A 4HJ9A 2GN5A 4GKJQ 4P72A 5M5WH 1VQHA 4GOPB 1Q82C 2ID0A 1E22A 2R92H 4IFDG 3RNUA 3HOYH 2PMZE 3GTLH 2PQAB 4GS3A 2WB1G 3BZKA 4BY1H 4A93H 4B3SQ 4BXXG 4A3LH 1N33Q 2QA4A 2AMCB 4JI0Q 2NZHA 4A75A 2IHFA 5C4XG 3STBD 4OX9L 4LF8L 2VQEQ 4B3RQ 4JI8L 3PUWA 3OYYA 1VQJA 3H15A 1VQPA 1W2BA 3E9IA 4R4TA 4GNXB 3U58A 1ASZA 2HQLA 3HOVG 1J5EL 1O7IA 1YHAA 3KDFB 4X64L 1UE1A 1Q81C 2KHIA 1EFWA 3S15H 2B3GA 3GTPH 2BA0A 3CCMA 2I0QA 1YI2A 5AJ3L 1VQMA 2N78A 4X66Q 1WYDA 2VQFL 4LFAL 4JG2A 4IO9A 1LUZA 2D0PA 2HIXA 1JJ2A 1JB7A 2R93H 5C4JH 4QGUA 2RHQB 3UDXA 4LF4Q 4JCVE 3DM3A 4QL5A 4A3BH 1T9HA 3MEFA 1TWCH 2ZTCA 3RLFA 4DV2Q 1IBLQ 1A0IA 1VQGA 4PZ7A 3CQZH 5IYBG 5IYCH 3I4OA 2DUDA 1N34L 1VQ7A 2B63G 1HH2P 2E2JH 1N32L 4R4OA 4IPDA 1UE5A 4AYBE 2F3IA 3BU2A 3CC7A 1FJGL 1EQQA 1Y1WH 3GTKH 3EIVA 4GLXA 3ERSX 5IP7H 1VQOA 3BZCA 5BR8Q 5C0XG 4YWMA 5M3FH 4UP8A 2Q2TA 1C7YA 1WJJA 1NBWA 5IYDH 2ZJQA 2KBNA 4DV0L 3RN2A 1SR3A 4HIDA 1YEZA 4X62L 1OXUA 1S40A 1P8LA 4LNQA 1YZ6A 4P71A 1Z47A 4JI5L 3CF5A 1M1KC 2F4VL 4OXPA 4DV1Q 3T1HL 2KHJA 2E5LQ 3I4NH 1JJCB 3S14H 4DR4Q 4A3GG 2I5HA 4DR2Q 1VQLA 1Q86C 2K4KA 2YV5A 3HKZG 3CCJA 4O2DA 1I3QH 2RF4A 3CCUA 1W3SA 1EIFA 1N36L 4BA2I 2JA8G 3I7FA 2JA7G 5JEAJ 2BH2A 4DUYL 3RR5A 2XTIA 4A3JG 1PA6A 1JMCA 5M3MG 1V9PA 3TS0A 1X3GA 1I94L 1ASYA 2PI2E 4POGA 4IPHA 2IY5B 5FLMH 1P16A 1EQRA 2JJQA 1X56A 3S1RH 4DK3C 4IJHA 1Q46A 1PYSB 2ZTEA 1A8VA 4JBWA 4AIMA 3BJUA 2Z6KA 1OXSC 3J81i 1XNQQ 3KJOA 5ELOA 3H0GH 1NE3A 3HOWH 2CWPA 4BBRH 1VQ4A 2R7ZG 3VDYA 2UXCL 5FJ8H 4LF7L 5GADC 3RLOA 2F52A 2UUCL 4JI4L 4A3IG 4BY7G 1BVSA 1X55A 1QUQA 4NPSA 2VL6A 4BA1I 1K8GA 4JI7L 4OWWB 5FLXc 1KRTA 3CCEA 4JYAL 4GN3B 1XNRL 3G48A 3NENA 4LFCQ 3T1YL 3ICEA 1YBYA 3GO5A 4X65Q 4DR1L 4DK6C 3F2BA 5LMUQ 5E7NA 4GN5A 3KJPA 4JI2Q 4GOPA 1HR0W 5C44G 3F8TA 3NEMA 3D31A 1SLJA 3CCVA 3UDFA 1C0AA 2K50A 4BBSH 2PQAA 1G291 4YCUA 4DKAC 2EXDA 3HOXH 5LMNL 3PF5A 2NVQH 2QEXA 2UU9L 4LUZA 1HJPA 4DV5L 2UUBL 4K0KQ 2YU9H 3TS2A 2ATWA 4GKKL 4MTNA 1K8AC 3I4MH 3S2DH 4DR3Q 2ZJRA 2K5HA 4LF6L 3OTOL 1EOVA 1SROA 4DV7L 1I5FA 2JEBI 3J81c 2ZM6Q 2ES2A 4GOPC 3J81j 2WAQG 5IP9H 4IPCA 4GNXA 4YHHL 3RN5A 1HR0Q 1HNWL 4JC0A 1SMXA 4QJFA 1QVGA 1PH7A 3GTQH 3KDFA 3TREA 3S1MH 2I5MX 5GAHC 2ALYB 3WWVA 1X3EA 1TWAH 1E3PA 4NXNL 3CC4A 4ME3A 1XMQL 4H02A 1Q7YC 2CQOA 4GN4B 4ALPA 4R4QA 4DR7Q 3PO2H 1YIJA 1QZHA 1S3OA 4GKJL 2V1CC 1VQKA 1RL2A 1IYJB 1HZCA 4OWTB 1HZ9A 3M4PA 3S1NH 4GNXC 2IX0A 1XMOQ 1Y1VG 4B3SL 3S1QH 2Y0SE 2JA9A 4DUZQ 4KLKA 2R92G 4NB3A 2R7FA 4DV4Q 1S72A 4YWKA 1N9WA 3HOYG 1PVOA 4A93G 2AKWB 2MO1A 5C4XH 2VQEL 4UY8C 4A3LG 3IRBA 1L0WA 4LF5Q 4B3RL 2JA6H 2GVBA 1KRSA 1V1QA
chains in the Genus database with same CATH superfamily
1PRTB 1OXXK 2EYMA 1HRJA 3BYYB 3SGIA 3KF6B 1X6OA 5K36G 1AZPA 3M4OH 1YNNC 5FO7B 4YY3Q 1OO9B 2K75A 1ZYRD 1DZ1A 1GHKA 4NXMQ 4JV5Q 3MWYW 4G7ZC 3QIAA 4A3FH 1CKNB 1HNZQ 3E0EA 5IGDA 5EKIA 2K01A 3L0OA 1NUCA 2D0OA 3MXNB 3MVVA 1FGBD 1EYDA 1MHWC 4Y52H 4C3IG 3J80E 4AQYQ 3D6CA 1E2VA 1LYLA 2RDGA 3FHWA 3FMCA 4LAAA 5HGQA 1Y1WG 2B39A 3VA5A 4LFBL 4U673 1A63A 1E24A 1PRTD 2NN6G 2P5ZX 5IYDG 2J4XA 2E5LL 4JI6Q 3PIPA 4AYBG 4C3IB 3PIP3 2HIVA 4DV0Q 3BS1A 3EBEA 4X62Q 3DM1A 1Y1WB 4UHVA 1PRTF 3IAYA 2MNAA 3SK4A 4H13C 2JA7H 2AWOA 2ASBA 1D1KA 1DCZA 1VQEA 3NWTA 1S5ED 4AYBB 4CGYB 4AH6A 1Z9FA 1SRUA 4RHSA 1XNQL 4IUVA 3GDEA 2PPBC 1X54A 3J7A5 1BDOA 3TQYA 1H9RA 1KXLA 1STGA 2R7ZH 3G71A 4RFBA 4DAPA 1JC7A 4EQ5A 1D5ZC 4KKSA 4A3IH 1IBMQ 3L3OC 2DJGC 4IFDJ 2I5LX 3HP3A 4GZYC 4O42A 3G6EA 3F2CA 4YCWA 1SNOA 1GUWA 1PXUA 3A55A 4LF9Q 5IY0A 1WD0A 3OIPA 3ONAB 5IWAQ 3CAMA 1VDZA 4PG3A 3QG1A 2HUGA 1F2ZA 4KKUA 3UDGA 1BCPB 2A6EC 3CD6A 3W5OA 1LTLA 4LUOA 4HAEA 5H1SE 4DV6Q 4BBSG 3PV0A 1QG7A 4OELB 2Z0SA 1YHBA 4MZ9A 3ITPA 4F8MA 1HR0L 1S5CD 1L2FA 4WRDA 1RDPD 2B2TA 1KNAA 1XPUA 5EPJA 5I4DA 1XX8A 2NZOA 4BBSB 1LTAD 1U0LA 4A76A 4P75A 1WFQA 2YU9B 3ULPA 1SYDA 4CJ2C 2MUYA 4APVA 4BXXH 1XMOL 1FNVA 3FP9A 2VB2X 3RLNA 5IT9L 1Y1VH 1XYIA 5GAEC 4DV4L 1VQ6A 3MAQA 2GA4B 4LF5L 4OX9Q 1EUJA 3E3XA 4LF8Q 5C6AA 1UAPA 1VCIA 2JA6G 2KA7A 1JOOA 1PDQA 1VQ9A 4PZ6A 5C3EH 3BVZA 3W2DA 4DK1A 4DV2L 1BCPF 1IBLL 4LFAQ 4QUCA 4KN4C 3LNNA 3SR1A 1ICFB 1CQVA 2F0EA 4RMFA 4UPAA 1RTNA 3W1BA 1QE6A 2EYHA 2JA6B 3A8JE 4OIKA 2N49A 1MJCA 1MD2D 3I56A 3G6JB 3GTMH 4O0AA 4A3FG 2SDFA 3M9BA 5CYUA 1JT8A 4PMCA 1JOQA 1FVIA 3BG3A 2UXDL 1B8AA 2RA4A 1IBKL 4A3FB 2RHSB 2LXJA 3TP6A 5KYLA 2F0TA 4KHPL 1FNUA 3NWSA 5CMDA 1W6JA 2F0KA 2QDLA 3GP7A 2JA8H 3A56A 1UUPA 2QCPX 1SJHD 1EYGA 1SSOA 1AE2A 3MXPA 3F2UA 3MZ5A 1N36Q 2N55A 1XJVA 4JI3L 2E2HH 4M1UB 4P74A 4TSSA 3Q24A 4KTAA 2IL8A 4L5RC 1JR0D 3MFGA 4IUPA 4DPGA 1I3QB 2EXZA 2A68C 1E0BA 2OEOA 1CZGA 3WOFA 2WFWA 3NQIA 3D0FA 2KCMA 2UUCQ 3H91A 4G7OC 3A0JA 3ZJYC 4IJLA 2B29A 1IW7D 1OXTA 3PSIA 1VQIA 3S24A 1KC8C 1PH9A 3PUZA 1NAPA 1HUNA 1C48A 4K0KL 1Q1BA 4PZ8A 5IGGA 5JEAG 1Q90A 3R2IA 2D62A 4BS9A 5FLXL 3K5LA 4A3DH 2R6GA 3ULJA 1E1TA 4X6AH 1MI2A 2UXBQ 3NK9A 4DAMA 4DN4M 1VQ8A 2LFNA 4OGQC 5GQOA 4GKKQ 1K0SA 2UXCQ 2RCFA 5IP9G 1SYBA 5D3DA 1K0RA 1I4QA 5HY6A 2WIIB 3G4SA 2BH8A 3K81C 1FL0A 4PNYA 3NSWA 2AWNA 1TS5A 2PCFB 3EVQA 5IGEA 2F3WA 4HJ9A 4P72A 1Q82C 1NCVA 4OHJA 3RNUA 3GTQB 2PMZE 4XDXA 2WB1G 1SJED 1EL0A 4BXXG 4X3TA 3IKJA 1N33Q 1STBA 2AMCB 1CZWA 1V1PB 2EJMA 1VQPA 4IUNA 3KBGA 3U58A 1I6VC 1RKNA 2HQLA 1ASZA 3DMUA 1O7IA 1YHAA 4X64L 1UE1A 2WB1B 4QF4A 3S15H 2BA0A 3A8KE 1YI2A 3M4YA 1VQMA 4X66Q 1WYDA 2D0PA 2K5DA 4QGUA 3DWQA 3UDXA 4A3BH 3MEFA 2Q8TA 3G7LA 3HZXA 3SK6A 5IYBG 5IYCH 3K57A 1N32L 2OXPA 4IPDA 2CHBD 4NMZA 2F3IA 3BU2A 3CC7A 1K8OA 3GTKH 4KY6A 5IP7H 3BZCA 1WTQA 4UP8A 1FD7D 2Q2TA 2F0WA 3VR3A 1S5BD 4HIDA 1XXGA 3BDLA 4LNQA 4JI5L 3I4NH 4DV1Q 1ONLA 2KHJA 4P2CB 2SOBA 4HEDA 3I3CA 3GTMB 3ERQA 2YV5A 3HKZG 1STYA 5EBCA 2FINB 4RGNA 2I46A 5E3FA 2AUKA 3K5OA 2JA8G 2CQAA 3L9AX 1B3QA 5JEAJ 3RR5A 2XTIA 4A3JG 5BN3A 1ASYA 2MGSA 2PI2E 3VYSA 1X56A 3HKZB 3FRPB 4JBWA 4AIMA 1OXSC 2JA8B 1VQ4A 3EROA 4RA8A 3SK8A 4A3JB 5FJ8H 4LF7L 4JI4L 5C3XA 4BY7G 1X55A 1HQMC 1XNRL 2XVSA 2LKVA 2AQ2B 3ICEA 4X65Q 4F88A 2XNAC 3KJPA 5C44G 5DM73 3F8TA 3NEMA 1SE3A 1UEAB 1U4MA 1C0AA 4BY7B 1GUSA 1G291 4V0BA 3PF5A 2NTTA 4DV5L 3OMGA 3TS2A 1K8AC 3I4MH 4DR3Q 3OHXC 4DV7L 2ES2A 1I5FA 3J81c 2ZM6Q 2D9UA 3J81j 2WAQG 5C44B 4YHHL 3TREA 2I5MX 1JWUD 1E3PA 1Q7YC 4GN4B 4R4QA 4CDDC 2F3VA 2M9VA 4DA2A 1IL8A 3I91A 2K5WA 5LL6S 2JN4A 1IYJB 4OWTB 4QB4A 2WAQB 3M4PA 4N8X1 4GNXC 2IX0A 1RODA 4M8AA 2Y0SE 2JA9A 2BE5D 5E4XA 2R7FA 1PVOA 2AKWB 2VQEL 4B3RL 1EEFD 2L9HA 5BN5A 1V1QA 1I6HB 5J22A 4XTCS 5D3IB 4DNTB 2NYZD 3P7JA 2WKCA 3CXCA 5M5YH 2C5CA 4OO1G 4KY7A 4C3JH 2PQEA 1DXMA 4OEMB 4A3MH 3K59A 1J5EQ 1MKHA 4JPBW 3M7GA 2Y0SG 1QVCA 1TXYA 2PW5A 4TVAB 1YJ9A 2JA5G 3LGJA 4DV3Q 4CKCA 2B63H 2Q2UA 1JWSD 4LWCA 1BQQT 1JWMD 4K2LA 4DXGA 1D6EC 1PZJD 1GUGA 2Y0SB 1TY2A 1BO0A 5IP7G 2N3SA 1TS2A 2QEJC 2JA5B 2BDOA 3M3YB 3I4LA 2OTJA 4A3EG 3RZDB 3LWEA 3HOUH 3S16H 3S2HH 2B2UC 1T5XD 1EIYB 4DGZA 5T1GA 4A3GH 2KVMA 3GTKB 2F4VQ 1VF7A 1HNXQ 5I2YA 2OF1A 3CCRA 4A3EB 2GVAA 1R4QB 2CWAA 4K5WA 3TDQA 1D5XC 3EN2A 1R9TH 2E2IB 1VQBA 3ND9A 4GLVB 5EQ0A 2VW9A 3AFPA 2F0PA 1TU2B 1LT6D 1J6QA 2LS01 4I7ZC 2WP8J 1PH1A 1RCVD 2LXKA 3KOJA 1M4VA 1IKMA 1ZEQX 2VNUD 1TQOA 5JPMC 2VUMG 4Y7NB 1H9SA 1BOSA 3QJYA 3CRLC 5FJ8G 2LMCB 2O5IC 3HOZG 1U5KA 5JVH3 5JJIA 3UE0A 2PNHA 1CT1D 1JE5A 4JI2L 3CCLA 3SXHA 2VUMB 4JYAQ 2CH4A 4B3MQ 1L1OB 3IL8A 1ZYRC 2F0GA 3B6YA 3JC66 1SE2A 1GM5A 2KUMA 3HOZB 4HIKA 2AQ1B 3K0XA 1BBWA 1KQSA 1TS4A 3QO2A 4CDCC 4CDFC 2HHHQ 2CW0C 5IT9E 3QOLA 4ZKCB 3I4MG 3DEOA 2UUBQ 3SEBA 1VQFA 3S9WA 3CW2C 3PF4A 4OWXB 1UE6A 4HMJA 1E1OA 1SAPA 1HXYD 1Y8PB 2A74C 3ER0A 1HNWQ 1UE7A 2F0HA 4XXEA 3E6ZX 1G51A 2BA1A 2BCOA 4JI0L 1CTMA 1PRTC 4NXNQ 3I4MB 2K1BA 5DAUA 4L5TA 4DUZL 4R1JA 1VQAA 2C35B 1F9SA 1YNXA 1K9MC 4MIUA 4RCOA 1BF4A 1B2TA 2HQEA 2I07B 1WTHA 3HOVH 5AFWA 2IHEA 1JJGA 3EFXD 4KHZA 4YY3L 4LF4L 1PH4A 1QJOA 3OSOA 2BDNA 2JK8A 4NXML 2R93G 2QDBA 2CW0D 4JV5L 3KUPA 1F9PA 1BUVT 3T4AC 4A3MG 1HNZL 3MC0B 1TWHH 1N34Q 3GTPB 4EQNA 5C0XH 4YIJA 2HCIA 1B50A 4HJ5A 4AQYL 5EPKA 2R93B 3CU7A 3T51B 1WTXA 3PQIA 3NBHA 4Z9CB 1F2LA 4A3MB 3CMEA 1L0XB 5C0XI 4DU9A 4JI6L 4LFBQ 3S17H 4NP5A 1O78A 4IOAA 3T1HQ 3A54A 3HOUG 4UAIA 1AE3A 1D8LA 1Y69U 1I4PA 1HPCA 4OONA 3C3LA 2A6HD 1YITA 3MTSA 1JORA 1PTOB 4DUYQ 5M9OA 1SN8A 1K83H 3T13A 5DLQE 5ISRA 4JBMA 3S2HB 3HOUB 3S16B 3KF8A 2K05A 5KNBA 2YTYA 3H0GG 4RAUC 4KI0A 2FJ2A 1D7QA 3R93A 1CI3M 5FLXE 1WOCA 1TS3A 4QQBX 1O7ZA 1PFNA 1KNEA 1A62A 1PFSA 3M85A 1VQ5A 3S1RB 5LMNW 3KLSX 1IBML 1KHIA 1BCPC 2KECA 1LO5D 3KLWA 2L11A 1R9TB 3H0GB 3K8AA 3DUZA 4KJOA 3T1YQ 4LF9L 3JAMc 3K5NA 1CSQA 5IWAL 2EIFA 3FKIH 1PTOD 1U4RA 5KIXA 1R4PB 1PYWD 1EWIA 1TWFH 2EQSA 4DV6L 2RKSA 3RD4A 1SNDA 3KLRA 1EU3A 3DEPA 4K6DA 5DNFA 4EGVA 5L37A 2AQ3B 3PMFA 3FDTA 1YJNA 5J39A 3DHQA 1PTOF 2O5JC 1OXVA 1PZID 4RG1A 1KL9A 4RCNA 4X3SA 2ICEC 3VR5A 2L5TA 2M00A 1WCMH 1X9NA 3S2DB 1H9SB 4R4CA 3J81L 3AQQA 4ZUJA 4BWGB 2GN5A 5EKKA 5M5WH 2PZUA 4GOPB 1QILA 4G57A 2ID0A 1E22A 1BCPD 3GTLH 2PQAB 3BZKA 4BY1H 4A93H 4B3SQ 2H1EA 2QA4A 2NZHA 2IHFA 4OX9L 2F0LA 4LJZC 4LF8L 2B8FA 3BDOA 4OL7A 3PUWA 1F77A 3OYYA 3H15A 4QMGA 1LTID 1ZKOA 4H7BA 3HOVG 2KHIA 2L4NA 2B3GA 5IGCA 2I0QA 5I2XA 2N78A 4LFAL 4ABNA 4JG2A 4XQJA 1LUZA 3QB3A 2N88A 5C4JH 3DM3A 4QL5A 2ZTCA 4ME5A 4DV2Q 1IBLQ 1EIHA 1A0IA 1VQGA 4PZ7A 1EY6A 3CQZH 2DUDA 1VQ7A 2ZXRA 3HOVB 3M4OB 5KEEA 2F0MA 1KLUD 2K03A 1IW7C 2LY7A 1FJGL 2F1MA 3ERSX 5BR8Q 5C0XG 3D6WA 4YWMA 1G2TA 2PNRC 4K5VA 1NBWA 1WJJA 4TKOB 1EU4A 2ZJQA 2J0TD 2KBNA 4C56C 2NB0A 4WJ4A 1YEZA 1OXUA 1P8LA 2WACA 5CV4A 1M1KC 3S14H 1SBBB 1TWHB 4OXPA 4DR2Q 1VQLA 1ML0D 2F0VA 2QW7A 1EIFA 1N36L 2JA7G 1U9RA 1SNPA 1SXTA 1XTCD 1V9PA 3TS0A 1E2ZA 2JJQA 2KJXA 2B2WC 1PYSB 2ZTEA 3Q6SA 1WTVA 3VR4A 2Z6KA 4HTHA 2F0UA 1NE3A 3HOWH 2CWPA 2JA7B 4FP5D 2R7ZG 3VA7A 3RLOA 2UUCL 2NTSA 2Z4IA 4FF4A 4A3IG 1K8GA 1QUQA 3CCEA 4Q0FA 2Z4HA 1PZKD 2EDGA 3G48A 4LFCQ 4DAYA 3GO5A 3F2BA 2R7ZB 5LMUQ 5BN4A 2MP1A 1HR0W 1Y8NB 2HDMA 4CJ0B 5ELBA 2A73B 2K50A 4A3IB 2NVQH 4YCUA 4DKAC 3HOXH 4LUZA 4K0KQ 4GKKL 4MN3A 2ZJRA 2K5HA 1EOVA 1SROA 2TSSA 1G6ZA 4GNXA 1B9MA 3NE5B 3S1MH 3KDFA 4NDXA 3VYTA 2ALYB 1TWAH 5C4ZA 2KEEA 4DR7Q 4ALPA 3PO2H 1F9RA 1QZHA 1TWFB 3ZYYX 5IOCA 3TMEA 1RL2A 1TIID 1O7LA 1HZCA 1HZ9A 3S1NH 1Y1VG 3BVGA 2JYOA 2CVRA 4QCLA 4NB3A 1NR4A 1S72A 1N9WA 1RJTA 1RF2D 4A93G 1U4PA 5C4XH 1L0WA 2R3ZA 3RZOH 2K52A 2EPBA 4QIWE 5M5WB 1Y1VB 3KYHC 5C3EG 1PH3A 1GJXA 2QF7A 1FNWA 3L7ZC 2B2YC 1BKBA 2E8GA 3MFYA 3EQLC 4A93B 2KQ3A 1HA6A 1SMYC 1HCZA 3RMHA 2EJFC 3AU7A 1B53A 4ZAIA 2LSSA 3SK5A 1KTKA 4GLAC 3I90A 1HTLD 5C3EB 1EY0A 1X32A 2PMZB 4EQPA 2B2UA 4PMBA 1BBUA 2Q2IA 3A5ZB 1PH5A 5COYA 1Y14B 3V2TA 1B44D 1CQFA 2XRQD 5C4JB 2V4DA 1VMPA 3GTGH 4CKEA 2F0DA 2EYOA 1FYCA 5GAGC 3H3VC 5M5XH 4A3KH 3CQZB 1S5DD 3PCOB 1WD1A 5I9PA 1LM0A 1O80A 2QILA 1BBXC 3ULLA 1FR3A 5HGTA 4JI5Q 4FYDA 3Q23A 1X65A 1A3TA 2R61A 3A7LA 2VS1A 3QR8A 5JVG3 1Q8KA 3EJIA 2KCCA 1SMYD 3CRKC 1G6PA 2IW3A 2K5NA 3U50C 2NVXH 3U9SA 3S14B 1RHPA 2WV6D 3UDIA 1CFMA 4WJWA 1A15A 1SFOH 1N8RC 2A8VA 1EWCA 3PIOA 3TZUA 2E2HB 3H6MA 3K7UC 4JI1Q 4POFA 1D5MC 1WVLA 2BE5C 3HOWG 1X3PA 4S3SA 4ZK9B 3NELA 2MFIA 4R4IA 1WTWA 3OW7A 3I73A 2G5DA 4RGTA 1DM0B 4LF7Q 2HDLA 4XYOA 2Q8RE 4ILWA 4ZYSA 1WTPA 1X3FA 1CA5A 2L1BA 1XTDA 3VYUA 3HOWB 4DR5L 1CKOA 4A3DG 2CH4W 4R8NA 3N6RA 5CBEE 4DAVA 1Q1EA 2EOTA 5I9OA 1PYBA 3JAML 3HOXG 1C8CA 2UUAQ 1EEID 2ZM6L 3D8GA 4J8QA 1C4QA 3KF6A 3PUYA 4A3DB 4B3TQ 4RGOS 4DV7Q 4EVOA 1OTCA 3A8IE 3LX0A 4DR6Q 4YHHQ 2NVYH 3HOXB 3PUXA 5ELCA 2AUJD 4IFDH 4RHRA 2L15A 5J3BA 1SNQA 4IPGA 5C4HA 3PO2G 1CKNA 3F1ZA 4L5QA 1SDFA 4DNIA 1HQRD 1TY0A 3MXNA 2K33A 4A4IA 2KOLA 4FXKC 1SNMA 2CFMA 4IFDI 1TWAB 2RSNA 4JI8Q 3PO2B 3KLSA 2EZVA 2Q2HA 1E2WA 1LT5D 2KCNA 4JBJA 1CHQD 3OWFA 4RKLA 5AJ3Q 2VQFQ 2CCZA 4LK1C 2VZAA 1HZAA 4A3BG 2EY5A 2K04A 5C5MA 3I70A 4HIOA 3D3RA 1QOHA 3CPWA 4DV3L 5IYCG 4B9XA 1EWHA 1AH9A 2KCTA 3CCSA 3S15B 2MHVA 3RZOB 3KBXA 2H5XA 1VQCA 1SEBD 4KHVA 1SYGA 1PHJA 2D5DA 1VQNA 4C3IH 3I55A 4A3BB 1PFBA 1CUKA 1RD9D 2IX3A 5FO9B 1KABA 4DR4L 3CCQA 5A2QL 1ET6A 2F03A 2QKIC 1NSNS 3J80c 4K2KA 3X3NA 2OWOA 3I4NG 1I50H 2NN6H 3P20A 5IE8A 3M4QA 3MXUA 5LL6X 1TWGH 1G2SA 4L8JA 4QUFA 4A3KG 2OT2A 1AEXA 2F0SA 3CPFA 1GO3E 4IUQA 2CKZB 2F0JA 1HNXL 4I7AA 1WI5A 5M3MH 1K3RA 4O1NA 3SVMA 2NN6I 4KN7C 3I4NB 2HD3A 1L0YB 1M8AA 2MJ8A 3OIQA 1M90C 3GTGB 2YTXA 1I94Q 1B7YB 1YNJD 2KENA 5M5XB 4A3KB 1NMFA 2EVBA 1J8IA 2RCNA 1KDAA 2VXWA 1EY9A 1E7ZA 5KYIA 2FMMA 3MXGA 5NUCA 4C3HH 1QCBD 3T56B 3HKSA 2IT1A 2SNMA 4UP9A 5F2DA 4QY7A 1GOZA 1L1OC 4OIJA 1Z7TA 3D4RA 5JJKA 4JI7Q 5CORA 5EAYA 2A1AA 1IYVA 2NVXB 2H4OA 3A5UA 2Z6BA 1AFPA 1CKMA 3AFQA 4DR1Q 2OQKA 2OTLA 1SFOB 1MGSA 4JOIC 4B3ML 1T5EA 1XPRA 3J7YW 1YJWA 5JJLA 3DLLA 3J81E 3TEHB 3NUCA 4LW1A 5LMNQ 5JPNC 2UU9Q 2EYJA 1NMGA 2J7ZA 2HHHL 4WJ3M 2MO0A 4LF6Q 3OTOQ 3K6OA 4DK0A 3OMCA 1I4GA 4CJ1B 3NBIA 4L6TB 4L5SA 1K8MA 3OWEB 3CMAA 1KAWA 1DOMA 2ZTDA 2ZJPA 1XMQQ 4C1NK 3K80C 1IXRA 2E74C 2EYLA 1Q12A 2G9HD 2KHSA 5C5LA 3T16A 4GKJQ 1VQHA 4IURA 1SYFA 3NXWA 1H9KA 2R92H 4IFDG 3HOYH 1HTPA 1EY7A 4A3LH 4HMIA 4JI0Q 4A75A 4FVMA 2ZXPA 1SYEA 4MTKA 4PQXA 3V05A 3URYA 5EKLA 5HURA 2A6HC 1VQJA 1BXTA 4NW2A 1STNA 4R4TA 4X3KA 5D14A 5KGUA 1Q81C 1BR9A 1EFWA 3CCMA 4C3JG 3AMUA 2FFKB 1VF5C 2Z8LA 1JB7A 2HIXA 4EQOA 5I6YA 1JJ2A 1PMRA 4LF4Q 1K28A 3BDCA 4JCVE 1T9HA 3RLFA 1TWCH 2B63G 1N34L 2E2JH 5M5YB 3D4WA 1A6XA 3MHBA 1UE5A 4AYBE 1ENAA 4C3JB 1II3A 1EQQA 2MPMA 3EIVA 4GLXA 2PW7A 1VQOA 2XWBB 1EYAA 1X3QA 5M3FH 2JXMB 3FPUB 5IGBA 4DV0L 3RN2A 2B63B 1H9JA 4HSPA 1SR3A 4X62L 1PTOC 2JEAI 4P71A 2F0NA 3CF5A 3X3MA 2EY1A 3T1HL 2E5LQ 1LTTD 1CK1A 4A3GG 1Q86C 2K4KA 2B2WA 2RDHA 1I3QH 2RF4A 1DOLA 2FMCA 4BA2I 3I7FA 2ZT9C 2WKDA 5G3LD 4DUYL 1GUOA 1PA6A 1JMCA 5M3MG 1X3GA 3U9OA 5D65A 4A3GB 4IPHA 1YNND 5FLMH 2IY5B 1EQRA 1I50B 5JOBA 1JB3A 1Q46A 4IJHA 1KAAA 1TWGB 1PFMA 3BJUA 1XNQQ 3J81i 3KJOA 5ELOA 5G3LF 4BBRH 4KK7A 5EPLA 3VDYA 5EBDA 2F52A 5M3MB 4C3HG 1BVSA 4NPSA 1JQYD 3H94A 4N8FA 4BA1I 4RGMA 2HCCA 4GN3B 2A5HA 1LT3D 3NENA 3T1YL 1D1IA 1B9NA 2EE1A 4GN5A 4V190 4KD4A 4XT1B 2DNEA 5JEAH 3UDFA 3MEHA 4C3HB 2WINB 3NHHA 2EXDA 1Q3LA 2QEXA 1A2TA 3P1HA 2ATWA 1J9OA 3CHBD 2DNCA 4FNFA 1V1PA 3OOCA 4GOPC 5IP9H 2F0FA 2EJGC 3K0YA 1SE4A 3RN5A 1HR0Q 4QJFA 1QVGA 1PH7A 3GTQH 4JVZA 3CC4A 2B2VC 2EY2A 4K6LA 4ME3A 3Q0AA 2CQOA 1MSGA 3QWNA 1YIJA 2L55A 4KJNA 3D4DA 1VQKA 5A35A 4KD3A 2F0OA 2X6GA 1ILQA 1XMOQ 4B3SL 3S1QH 1O7YA 5DM63 1EFID 2RDFA 4KLKA 1HFGA 2R92G 2IPKD 2B2YA 4DV4Q 4YWKA 3HOYG 2RVLA 1AZQA 2MO1A 4A3LG 4LF5Q 2GVBA 1KRSA 3PO3H 3GD7A 1LLRD 4EX5A 2D2CC 3R3OA 3R2TA 2MQHA 5CV6A 3J80i 5E1FA 2R92B 1YVCA 1DGSA 3HOYB 3GQBA 3GV6A 2A6ED 1CA6A 1SNCA 3I72A 2XSCA 3DWAA 5IYBH 1RIPA 3NP8A 1B1ZA 4IZ8A 3FVQA 4A3CH 1WTRA 5BR8L 2NUCA 3K7AH 3GTJH 3J7AF 3CP0A 4HSVA 1WTOA 1C9OA 4KMUC 1XWEA 4DF7A 1FJGQ 3HG9A 2UXDQ 5M3FG 2EYFA 4ODGA 1TWCB 3SDZA 3V96A 1W6KA 1JOKA 2FXQA 3H3VH 4WFN3 1DJRD 1IBKQ 2SNSA 4DR2L 1YHQA 1K73C 2E2JB 3K58A 4KHPQ 3NTKA 1A2UA 2VY3A 3IFDA 3J80L 2JQOA 4HIMA 1KD1C 1UEBA 4HCSA 1XPOA 5M3FB 2F0IA 4E6IA 5JJZA 3KK7A 4JK1C 4RKBA 3UI2A 3H3VI 3HFZB 3S17B 3Q8DA 4A3JH 4JI3Q 5IIFA 2JP1A 5CV8A 3TN2A 3TP8A 3GTOH 3OW2A 4P73A 1DONA 4YCVA 2A69C 5FLMG 4FDBA 1SYCA 3NBHB 3I8ZA 4ZQ3A 1GUTA 1PLFA 3I2ZA 2IWHA 3C46A 1LTSD 4HN7A 1UWVA 5FK9C 2PI2A 2ICIA 3TZDA 1K83B 3HEJA 4XQNA 4BBRG 2QGQA 1ZXTA 2OQ0A 3JAME 1QZGA 4BY7H 3FPPA 3EA6A 1U4LA 1QNKA 4LFCL 2K5QA 1STHA 5KNCA 1DD2A 2X6LA 1H95A 3HRZC 5IGFA 5LMUL 2UXBL 2YTVA 2R7DA 1HZBA 3FKIG 4C1NI 4RWSC 4BBRB 5C44H 2K14A 5GROA 2UXCL 1G8ZD 3KF8B 2DY7A 5CR3A 1IL2A 1TVXA 2JSOA 3W1GA 1D2BA 1S4ZA 1EOTA 1I4XA 2Z9HA 3NTIA 4ULLA 2K28A 1AN8A 3VR2A 1TT2A 1GVPA 3FKIB 3WOEA 4YWLA 2WB1E 3U4VA 4XIGS 1I4RA 5T1IA 5K5PA 4R8IA 2A69D 4PMWA 4PV1C 2RQXA 4HJAA 1B70B 1WCMG 3OPOA 1HFNA 1ESFA 4DR7L 4FF3A 4X3UA 3GV3A 2A68D 2Q8IB 1N33L 2L0CA 2K5VA 3CC2A 5C0XJ 1I6HH 1NY4A 2B2TC 3BZDB 3C1EA 1JICA 4KKTA 4BY1G 2K32A 2E76C 4CKBA 3PGZA 1WCMB 4I65A 3SE0A 1QNUA 3H09A 3E9HA 4TRDA 3AYHB 5ELEA 2SEBD 3AB9A 5CGKA 2NVTH 1PH6A 4X66L 5IODA 3AEVA 1VS0A 2M2LA 3GTLB 4BY1B 1GXDC 4CDEC 3PO3G 2DN8A 3VR6A 4K8IA 4DFAA 4X64Q 2G9DA 1LT4D 5LHY1 3TRZA 2DY8A 5TSSA 2XIWA 4OO1H 2AHOB 4IALA 3S1QB 5A2QE 3UE1A 4IQZA 4C2MH 3TBIB 4B08A 2A19A 4LMQD 1BNZA 3O13A 1HUMA 3J7ZC 1PH2A 3FEWX 3TP7A 3TP5A 1G91A 2JA5H 4JBKA 1EY4A 1HHVA 3M3YH 1K3BC 2XWJB 4KV6A 3PO3B 4N9PA 1VQDA 2OCEA 5ELNA 1N32Q 1LTBD 3RZDH 1ICWA 4OO1I 5CV5A 1GD7A 1NTGA 1KIXA 1SE8A 1FGUA 1B3AA 2DGYA 2K6AA 1A3UA 3HKZE 3NPPA 4H44C 2F0QA 4IOCA 4ZRZA 4KY5A 4A3CG 1ENFA 4DV1L 4UP7A 3PUVA 1MIUA 1QVFA 4U68A 2X69A 2JE6I 4QIWB 4A3EH 1ET9A 3KFUA 4L63B 2PZTA 1IZ6A 2ZXOA 2B8GA 1CSPA 2FHTA 3QOJA 4K14A 2E2IH 1KLGD 4HJ8A 1JE4A 2IX1A 3K7AB 3JAMi 3GTJB 1LTGD 4G4KA 1PV4A 1NR2A 1AP0A 2NBFA 1GKHA 1L1OA 4Y7NH 2YYZA 4ZKBB 1V8QA 2N8NA 1EQVA 3PIO3 2RSOA 4HJ7A 4FXGC 4TQUS 5FOBB 2E2DC 1EZ8A 1IYUA 4WORA 4JI1L 4JOIA 4MHEA 4R9WA 2VUMH 4JI4Q 3NQTA 3U4ZA 4X65L 2E75C 1MJEA 1ENCA 3GTOB 3HOZH 1XNRQ 3K5MA 5J1ZA 2WAQE 3STBC 3IFTA 4MNOA 2Z6KC 4J6HA 2Z1CA 4DR3L 3RUZA 1GUNA 3L2PA 1V43A 1H9MA 5ELDA 5CBAE 1IKLA 4DV5Q 2PYKA 4J15A 2UUAL 4DR5Q 4IUUA 2EY6A 4LUVA 4UDUC 4FO2A 3F2DA 1Q8IA 1NJIC 3A74A 2NVQB 4B3TL 1QUQB 1PH8A 5CC4A 2HT1A 5IT9c 5I6WA 4DR6L 2BOSA 3M7NA 2XGTA 4DAYB 1LV9A 1B4OA 5FO8B 2O2LD 5DEHA 3P75A 3LWUA 3S1MB 2F4IA 2RBMA 4ZUIA 4GS3A 1QB5D 4Q5VA 5C4XG 1TR5A 1RTOA 5CV7A 3STBD 3HGBA 3BYTB 4J1MA 5JAVA 3MA2B 2VQEQ 4B3RQ 4JI8L 3S1NB 1W2BA 5K36H 3E9IA 4GNXB 1IHZA 1J5EL 3WDNA 3KDFB 1LABA 2XRSD 4FF1A 3GTPH 1YNJC 2C9OA 3ND8A 5AJ3L 1LACA 3DXJC 2VQFL 1EZ6A 3VYRA 5C4XB 4F7XA 4IO9A 2R93H 3N52A 2RHQB 2O4XA 2EYPA 1CHPD 4F87A 2NVTB 3I4OA 1HH2P 5KRUA 4R4OA 4ID6A 4FF2A 3W3AA 4FXDA 1Y1WH 2TMPA 1TKWB 3Q22A 4DXFA 4H0LC 1C7YA 5IYDH 4C2MB 5EJWA 4DNRB 5KNDA 1Y8OB 1S40A 3J7AV 1YZ6A 1Z47A 1PTOH 2F4VL 4DR4Q 1HA5A 1JJCB 5CV9A 2I5HA 1EY8A 4NKLA 4CHTB 3CCJA 3R8BA 1MSHA 4HCEA 1EIGA 4O2DA 3CCUA 1ESRA 1W3SA 5EGTA 3T53B 2L12A 4HR7B 1CM9A 4CBVA 2BH2A 3C2PA 3CKIB 1A3VA 1F9QA 4XT3B 1QWYA 1I94L 4POGA 1P16A 1MBYA 3S1RH 4DK3C 1EQTA 3DWPA 2IJ0A 1A8VA 2VB3X 1STEA 2DJFC 3HS0C 1S5FD 4ZLTF 3H0GH 1KDCA 4K8JA 5GADC 3BVMA 1AW7A 3E0JA 4JI7L 2VL6A 1GHJA 1EYCA 4N9TA 4RH6A 1KRTA 5FLXc 4OWWB 2K7VA 4JYAL 1STAA 3A7AB 4IUTA 1YBYA 4DR1L 1I4HA 4DK6C 1NNXA 2NZ1D 5E7NA 4GOPA 4JI2Q 3D31A 1SLJA 3CCVA 1UNSA 4K5XA 4BBSH 1LTRD 2PQAA 4G7HC 5C3WA 5LMNL 2UU9L 1HJPA 2UUBL 2B2VA 2YU9H 4B9WA 3E5SA 1DYQA 4MTNA 3S2DH 1F2MA 2PO4A 4ZCKA 4LF6L 3OTOL 2XN9C 2JEBI 4XYQA 3TSSA 1VMCA 2PZWA 3C1FA 4IPCA 1HNWL 4JC0A 4XQQA 1SMXA 5GAHC 3WWVA 1X3EA 2ENBA 4NXNL 1ILPA 1DOKA 3SHLA 1XMQL 4H02A 5ELFA 4IN3A 1KDBA 1JCKB 1S3OA 4GKJL 2V1CC 5FKAC 1EY5A 2NWGA 4JW0A 4DUZQ 2NVYB 3NTHA 1F2YA 2KEDA 1V1OA 1Z6HA 5E4WC 3IRBA 4UY8C 2JA6H
chains in the Genus database with same CATH topology
3RZOH 3GD7A 1OXXK 4EX5A 2K52A 3SGIA 4XTCS 3KF6B 2MQHA 4QIWE 1X6OA 3KYHC 3CXCA 5C3EG 5M5YH 1PH3A 3M4OH 5K36G 4YY3Q 3J80i 4OO1G 3L7ZC 2K75A 1YVCA 1BKBA 1DGSA 2E8GA 4C3JH 4A3MH 4NXMQ 1J5EQ 1MKHA 4JV5Q 2Y0SG 1QVCA 1TXYA 4TVAB 1YJ9A 2JA5G 3LGJA 1CKNB 4DV3Q 4A3FH 1HNZQ 2LSSA 3E0EA 5IYBH 2B63H 1RIPA 4GLAC 3L0OA 2D0OA 3MXNB 2Q2UA 4LWCA 4A3CH 4Y52H 5BR8L 1BBUA 2Q2IA 3A5ZB 3K7AH 3GTJH 4AQYQ 1PH5A 1LYLA 3FHWA 3CP0A 5HGQA 1Y14B 1Y1WG 4LFBL 1C9OA 5IP7G 2N3SA 1FJGQ 1A63A 1E24A 2UXDQ 3PO3H 5M3FG 2OTJA 3GTGH 4A3EG 2NN6G 5IYDG 3S2HH 3HOUH 5GAGC 3S16H 5M5XH 2FXQA 4A3KH 2E5LL 3H3VH 1IBKQ 1EIYB 4JI6Q 3PIPA 4AYBG 4DR2L 1YHQA 1K73C 3PCOB 2HIVA 4DV0Q 1LM0A 4A3GH 4KHPQ 3EBEA 3ULLA 4X62Q 4JI5Q 2VY3A 2F4VQ 2JQOA 1X65A 4HIMA 1KD1C 1UEBA 1HNXQ 1XPOA 2MNAA 3CCRA 2VS1A 2JA7H 3HFZB 3H3VI 2AWOA 2GVAA 2ASBA 1Q8KA 2CWAA 3Q8DA 4A3JH 4JI3Q 2JEAI 1VQEA 3EN2A 3GTOH 3OW2A 1G6PA 4P73A 4AH6A 2K5NA 4YCVA 3U50C 1R9TH 2NVXH 1VQBA 3UDIA 4GLVB 1Z9FA 2VW9A 3AFPA 1SRUA 5FLMG 1XNQL 4FDBA 3NBHB 1SFOH 3GDEA 3I2ZA 1J6QA 1N8RC 1X54A 2WP8J 1PH1A 1UWVA 3KOJA 2LXKA 2A8VA 3J7A5 3PIOA 2PI2A 2VNUD 3TQYA 3K7UC 1KXLA 2R7ZH 4JI1Q 4POFA 2VUMG 3G71A 3HOWG 4BBRG 2QGQA 2OQ0A 4EQ5A 3NELA 2MFIA 4R4IA 5FJ8G 1QZGA 4A3IH 4BY7H 1IBMQ 3HOZG 4IFDJ 2I5LX 4LF7Q 1U5KA 5JJIA 4LFCL 3UE0A 3G6EA 3F2CA 4YCWA 2PNHA 1X3FA 1H95A 5LMUL 1JE5A 2UXBL 4LF9Q 2YTVA 1XTDA 3CCLA 2R7DA 1HZBA 3FKIG 5IY0A 4JI2L 5IWAQ 4JYAQ 3CAMA 5C44H 1CKOA 2K14A 4PG3A 1L1OB 5GROA 4DR5L 4B3MQ 3B6YA 3UDGA 4A3DG 3KF8B 1IL2A 1Q1EA 3JC66 1GM5A 3CD6A 3W5OA 1LTLA 4LUOA 3W1GA 5H1SE 4HIKA 4DV6Q 4BBSG 1PYBA 3K0XA 1BBWA 3PV0A 3HOXG 1KQSA 2UUAQ 2ZM6L 2HHHQ 2Z0SA 1GVPA 1YHBA 4MZ9A 3I4MG 1HR0L 2UUBQ 4YWLA 2WB1E 1VQFA 1L2FA 3U4VA 3KF6A 3PUYA 4XIGS 3CW2C 3PF4A 4OWXB 4PMWA 4HJAA 1XPUA 1B70B 1WCMG 4B3TQ 4DV7Q 1UE6A 1E1OA 1OTCA 4DR7L 2NZOA 4DR6Q 3ER0A 4YHHQ 2NVYH 1U0LA 1HNWQ 1UE7A 3PUXA 4A76A 4P75A 1WFQA 2L15A 1G51A 5J3BA 2BA1A 1N33L 4IPGA 3ULPA 2K5VA 3CC2A 4JI0L 4NXNQ 3PO2G 4APVA 4BXXH 5C0XJ 1XMOL 1CKNA 3FP9A 1I6HH 1NY4A 3F1ZA 4L5QA 4BY1G 4L5TA 3RLNA 4DUZL 3PGZA 4R1JA 1Y1VH 4DNIA 1VQAA 2C35B 5GAEC 1YNXA 4DV4L 1K9MC 4A4IA 1VQ6A 3E9HA 3AYHB 2CFMA 4LF5L 4IFDI 2NVTH 4OX9Q 1EUJA 4LF8Q 1PH6A 3HOVH 4JI8Q 4X66L 2Q2HA 1VCIA 3AEVA 2IHEA 1VS0A 2JA6G 3PO3G 1JJGA 4JBJA 4KHZA 4YY3L 4WJ4A 4LF4L 4X64Q 1VQ9A 4PZ6A 1PH4A 5C3EH 3TRZA 4DV2L 1IBLL 2AHOB 5AJ3Q 2JK8A 4NXML 2R93G 4LFAQ 2VQFQ 3UE1A 2CCZA 4C2MH 2VZAA 4JV5L 1HZAA 2A19A 4A3BG 4HIOA 3J7ZC 3CPWA 4RMFA 4UPAA 4DV3L 5IYCG 4A3MG 1PH2A 1HNZL 1TWHH 3W1BA 2JA5H 4JBKA 1AH9A 3M3YH 2KCTA 2N49A 1MJCA 3CCSA 1N34Q 3I56A 1VQDA 3GTMH 2OCEA 5ELNA 1N32Q 3RZDH 4O0AA 4A3FG 1GD7A 2H5XA 1NTGA 1VQCA 4OO1I 1KIXA 1SE8A 1FGUA 3M9BA 2DGYA 3HKZE 1JT8A 1PHJA 4HJ5A 4AQYL 1VQNA 1FVIA 4C3IH 3I55A 4IOCA 1CUKA 4A3CG 4DV1L 4UP7A 4DR4L 3PUVA 3CCQA 1MIUA 2UXDL 1QVFA 3CMEA 1B8AA 3J80c 5C0XI 2OWOA 3I4NG 1I50H 2JE6I 4A3EH 1IBKL 5IE8A 3KFUA 4JI6L 3M4QA 4LFBQ 3S17H 2RHSB 2LXJA 4IOAA 3T1HQ 1TWGH 4KHPL 1IZ6A 2VUMH 3HOUG 1AE3A 1D8LA 1CSPA 4A3KG 2E2IH 2JA8H 4HJ8A 2IX1A 3CPFA 4OONA 1EYGA 3JAMi 1GO3E 1AE2A 2CKZB 1HNXL 1WI5A 5M3MH 1K3RA 1YITA 2NN6I 1PV4A 1XJVA 1N36Q 4JI3L 4DUYQ 2E2HH 1SN8A 1GKHA 1K83H 1M90C 4P74A 5DLQE 2YTXA 4JBMA 1I94Q 1L1OA 4Y7NH 1B7YB 2YYZA 2KENA 1NMFA 2N8NA 4L5RC 4DPGA 2RCNA 4HJ7A 2YTYA 4TQUS 1E7ZA 3H0GG 4KI0A 1D7QA 1WOCA 4LF9L 4JI1L 2WFWA 4C3HH 4QQBX 3HKSA 4JOIA 2IT1A 1A62A 1PFSA 4UP9A 3D0FA 4QY7A 2KCMA 3M85A 1VQ5A 2UUCQ 1L1OC 4JI4Q 3U4ZA 3A0JA 3ZJYC 4IJLA 4X65L 5LMNW 2B29A 1IBML 5JJKA 4JI7Q 1KHIA 1MJEA 1OXTA 5EAYA 3KLWA 2A1AA 3PSIA 3HOZH 1VQIA 3K8AA 1XNRQ 3S24A 1KC8C 3A5UA 1PH9A 3T1YQ 2WAQE 3PUZA 3STBC 1CKMA 3AFQA 3JAMc 1CSQA 2OQKA 4DR1Q 2OTLA 4MNOA 5IWAL 4K0KL 1Q1BA 2EIFA 4JOIC 2Z6KC 4PZ8A 3FKIH 5JEAG 1XPRA 4B3ML 2D62A 1YJWA 4DR3L 5JJLA 3DLLA 4A3DH 2R6GA 3TEHB 1E1TA 3ULJA 3L2PA 1V43A 4LW1A 2UXBQ 4X6AH 1TWFH 1EWIA 2EQSA 5LMNQ 4DV6L 4DAMA 1VQ8A 2UU9Q 4DV5Q 4J15A 1NMGA 5GQOA 4GKKQ 2UUAL 4DR5Q 2HHHL 2UXCQ 4WJ3M 2MO0A 5IP9G 4LUVA 3OTOQ 1YJNA 4LF6Q 1OXVA 4RG1A 1KL9A 1K0RA 3F2DA 5HY6A 1NJIC 3A74A 4L5SA 4B3TL 3G4SA 1QUQB 2BH8A 3K81C 3CMAA 1FL0A 1PH8A 2HT1A 1KAWA 1WCMH 2AWNA 5IT9c 4DR6L 1X9NA 2ZTDA 3M7NA 4R4CA 2ZJPA 1XMQQ 2XGTA 3K80C 4DAYB 1IXRA 3AQQA 1Q12A 4HJ9A 2GN5A 4GKJQ 4P72A 5M5WH 1VQHA 4GOPB 1Q82C 2ID0A 1E22A 2R92H 4IFDG 3RNUA 3HOYH 2PMZE 3GTLH 2PQAB 4GS3A 2WB1G 3BZKA 4BY1H 4A93H 4B3SQ 4BXXG 4A3LH 1N33Q 2QA4A 2AMCB 4JI0Q 2NZHA 4A75A 2IHFA 5C4XG 3STBD 4OX9L 4LF8L 2VQEQ 4B3RQ 4JI8L 3PUWA 3OYYA 1VQJA 3H15A 1VQPA 1W2BA 3E9IA 4R4TA 4GNXB 3U58A 1ASZA 2HQLA 3HOVG 1J5EL 1O7IA 1YHAA 3KDFB 4X64L 1UE1A 1Q81C 2KHIA 1EFWA 3S15H 2B3GA 3GTPH 2BA0A 3CCMA 2I0QA 1YI2A 5AJ3L 1VQMA 2N78A 4X66Q 1WYDA 2VQFL 4LFAL 4JG2A 4IO9A 1LUZA 2D0PA 2HIXA 1JJ2A 1JB7A 2R93H 5C4JH 4QGUA 2RHQB 3UDXA 4LF4Q 4JCVE 3DM3A 4QL5A 4A3BH 1T9HA 3MEFA 1TWCH 2ZTCA 3RLFA 4DV2Q 1IBLQ 1A0IA 1VQGA 4PZ7A 3CQZH 5IYBG 5IYCH 3I4OA 2DUDA 1N34L 1VQ7A 2B63G 1HH2P 2E2JH 1N32L 4R4OA 4IPDA 1UE5A 4AYBE 2F3IA 3BU2A 3CC7A 1FJGL 1EQQA 1Y1WH 3GTKH 3EIVA 4GLXA 3ERSX 5IP7H 1VQOA 3BZCA 5BR8Q 5C0XG 4YWMA 5M3FH 4UP8A 2Q2TA 1C7YA 1WJJA 1NBWA 5IYDH 2ZJQA 2KBNA 4DV0L 3RN2A 1SR3A 4HIDA 1YEZA 4X62L 1OXUA 1S40A 1P8LA 4LNQA 1YZ6A 4P71A 1Z47A 4JI5L 3CF5A 1M1KC 2F4VL 4OXPA 4DV1Q 3T1HL 2KHJA 2E5LQ 3I4NH 1JJCB 3S14H 4DR4Q 4A3GG 2I5HA 4DR2Q 1VQLA 1Q86C 2K4KA 2YV5A 3HKZG 3CCJA 4O2DA 1I3QH 2RF4A 3CCUA 1W3SA 1EIFA 1N36L 4BA2I 2JA8G 3I7FA 2JA7G 5JEAJ 2BH2A 4DUYL 3RR5A 2XTIA 4A3JG 1PA6A 1JMCA 5M3MG 1V9PA 3TS0A 1X3GA 1I94L 1ASYA 2PI2E 4POGA 4IPHA 2IY5B 5FLMH 1P16A 1EQRA 2JJQA 1X56A 3S1RH 4DK3C 4IJHA 1Q46A 1PYSB 2ZTEA 1A8VA 4JBWA 4AIMA 3BJUA 2Z6KA 1OXSC 3J81i 1XNQQ 3KJOA 5ELOA 3H0GH 1NE3A 3HOWH 2CWPA 4BBRH 1VQ4A 2R7ZG 3VDYA 2UXCL 5FJ8H 4LF7L 5GADC 3RLOA 2F52A 2UUCL 4JI4L 4A3IG 4BY7G 1BVSA 1X55A 1QUQA 4NPSA 2VL6A 4BA1I 1K8GA 4JI7L 4OWWB 5FLXc 1KRTA 3CCEA 4JYAL 4GN3B 1XNRL 3G48A 3NENA 4LFCQ 3T1YL 3ICEA 1YBYA 3GO5A 4X65Q 4DR1L 4DK6C 3F2BA 5LMUQ 5E7NA 4GN5A 3KJPA 4JI2Q 4GOPA 1HR0W 5C44G 3F8TA 3NEMA 3D31A 1SLJA 3CCVA 3UDFA 1C0AA 2K50A 4BBSH 2PQAA 1G291 4YCUA 4DKAC 2EXDA 3HOXH 5LMNL 3PF5A 2NVQH 2QEXA 2UU9L 4LUZA 1HJPA 4DV5L 2UUBL 4K0KQ 2YU9H 3TS2A 2ATWA 4GKKL 4MTNA 1K8AC 3I4MH 3S2DH 4DR3Q 2ZJRA 2K5HA 4LF6L 3OTOL 1EOVA 1SROA 4DV7L 1I5FA 2JEBI 3J81c 2ZM6Q 2ES2A 4GOPC 3J81j 2WAQG 5IP9H 4IPCA 4GNXA 4YHHL 3RN5A 1HR0Q 1HNWL 4JC0A 1SMXA 4QJFA 1QVGA 1PH7A 3GTQH 3KDFA 3TREA 3S1MH 2I5MX 5GAHC 2ALYB 3WWVA 1X3EA 1TWAH 1E3PA 4NXNL 3CC4A 4ME3A 1XMQL 4H02A 1Q7YC 2CQOA 4GN4B 4ALPA 4R4QA 4DR7Q 3PO2H 1YIJA 1QZHA 1S3OA 4GKJL 2V1CC 1VQKA 1RL2A 1IYJB 1HZCA 4OWTB 1HZ9A 3M4PA 3S1NH 4GNXC 2IX0A 1XMOQ 1Y1VG 4B3SL 3S1QH 2Y0SE 2JA9A 4DUZQ 4KLKA 2R92G 4NB3A 2R7FA 4DV4Q 1S72A 4YWKA 1N9WA 3HOYG 1PVOA 4A93G 2AKWB 2MO1A 5C4XH 2VQEL 4UY8C 4A3LG 3IRBA 1L0WA 4LF5Q 4B3RL 2JA6H 2GVBA 1KRSA 1V1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZO H;  3GD7 A;  1OXX K;  4EX5 A;  2K52 A;  3SGI A;  4XTC S;  3KF6 B;  2MQH A;  4QIW E;  1X6O A;  3KYH C;  3CXC A;  5C3E G;  5M5Y H;  1PH3 A;  3M4O H;  5K36 G;  4YY3 Q;  3J80 i;  4OO1 G;  3L7Z C;  2K75 A;  1YVC A;  1BKB A;  1DGS A;  2E8G A;  4C3J H;  4A3M H;  4NXM Q;  1J5E Q;  1MKH A;  4JV5 Q;  2Y0S G;  1QVC A;  1TXY A;  4TVA B;  1YJ9 A;  2JA5 G;  3LGJ A;  1CKN B;  4DV3 Q;  4A3F H;  1HNZ Q;  2LSS A;  3E0E A;  5IYB H;  2B63 H;  1RIP A;  4GLA C;  3L0O A;  2D0O A;  3MXN B;  2Q2U A;  4LWC A;  4A3C H;  4Y52 H;  5BR8 L;  1BBU A;  2Q2I A;  3A5Z B;  3K7A H;  3GTJ H;  4AQY Q;  1PH5 A;  1LYL A;  3FHW A;  3CP0 A;  5HGQ A;  1Y14 B;  1Y1W G;  4LFB L;  1C9O A;  5IP7 G;  2N3S A;  1FJG Q;  1A63 A;  1E24 A;  2UXD Q;  3PO3 H;  5M3F G;  2OTJ A;  3GTG H;  4A3E G;  2NN6 G;  5IYD G;  3S2H H;  3HOU H;  5GAG C;  3S16 H;  5M5X H;  2FXQ A;  4A3K H;  2E5L L;  3H3V H;  1IBK Q;  1EIY B;  4JI6 Q;  3PIP A;  4AYB G;  4DR2 L;  1YHQ A;  1K73 C;  3PCO B;  2HIV A;  4DV0 Q;  1LM0 A;  4A3G H;  4KHP Q;  3EBE A;  3ULL A;  4X62 Q;  4JI5 Q;  2VY3 A;  2F4V Q;  2JQO A;  1X65 A;  4HIM A;  1KD1 C;  1UEB A;  1HNX Q;  1XPO A;  2MNA A;  3CCR A;  2VS1 A;  2JA7 H;  3HFZ B;  3H3V I;  2AWO A;  2GVA A;  2ASB A;  1Q8K A;  2CWA A;  3Q8D A;  4A3J H;  4JI3 Q;  2JEA I;  1VQE A;  3EN2 A;  3GTO H;  3OW2 A;  1G6P A;  4P73 A;  4AH6 A;  2K5N A;  4YCV A;  3U50 C;  1R9T H;  2NVX H;  1VQB A;  3UDI A;  4GLV B;  1Z9F A;  2VW9 A;  3AFP A;  1SRU A;  5FLM G;  1XNQ L;  4FDB A;  3NBH B;  1SFO H;  3GDE A;  3I2Z A;  1J6Q A;  1N8R C;  1X54 A;  2WP8 J;  1PH1 A;  1UWV A;  3KOJ A;  2LXK A;  2A8V A;  3J7A 5;  3PIO A;  2PI2 A;  2VNU D;  3TQY A;  3K7U C;  1KXL A;  2R7Z H;  4JI1 Q;  4POF A;  2VUM G;  3G71 A;  3HOW G;  4BBR G;  2QGQ A;  2OQ0 A;  4EQ5 A;  3NEL A;  2MFI A;  4R4I A;  5FJ8 G;  1QZG A;  4A3I H;  4BY7 H;  1IBM Q;  3HOZ G;  4IFD J;  2I5L X;  4LF7 Q;  1U5K A;  5JJI A;  4LFC L;  3UE0 A;  3G6E A;  3F2C A;  4YCW A;  2PNH A;  1X3F A;  1H95 A;  5LMU L;  1JE5 A;  2UXB L;  4LF9 Q;  2YTV A;  1XTD A;  3CCL A;  2R7D A;  1HZB A;  3FKI G;  5IY0 A;  4JI2 L;  5IWA Q;  4JYA Q;  3CAM A;  5C44 H;  1CKO A;  2K14 A;  4PG3 A;  1L1O B;  5GRO A;  4DR5 L;  4B3M Q;  3B6Y A;  3UDG A;  4A3D G;  3KF8 B;  1IL2 A;  1Q1E A;  3JC6 6;  1GM5 A;  3CD6 A;  3W5O A;  1LTL A;  4LUO A;  3W1G A;  5H1S E;  4HIK A;  4DV6 Q;  4BBS G;  1PYB A;  3K0X A;  1BBW A;  3PV0 A;  3HOX G;  1KQS A;  2UUA Q;  2ZM6 L;  2HHH Q;  2Z0S A;  1GVP A;  1YHB A;  4MZ9 A;  3I4M G;  1HR0 L;  2UUB Q;  4YWL A;  2WB1 E;  1VQF A;  1L2F A;  3U4V A;  3KF6 A;  3PUY A;  4XIG S;  3CW2 C;  3PF4 A;  4OWX B;  4PMW A;  4HJA A;  1XPU A;  1B70 B;  1WCM G;  4B3T Q;  4DV7 Q;  1UE6 A;  1E1O A;  1OTC A;  4DR7 L;  2NZO A;  4DR6 Q;  3ER0 A;  4YHH Q;  2NVY H;  1U0L A;  1HNW Q;  1UE7 A;  3PUX A;  4A76 A;  4P75 A;  1WFQ A;  2L15 A;  1G51 A;  5J3B A;  2BA1 A;  1N33 L;  4IPG A;  3ULP A;  2K5V A;  3CC2 A;  4JI0 L;  4NXN Q;  3PO2 G;  4APV A;  4BXX H;  5C0X J;  1XMO L;  1CKN A;  3FP9 A;  1I6H H;  1NY4 A;  3F1Z A;  4L5Q A;  4BY1 G;  4L5T A;  3RLN A;  4DUZ L;  3PGZ A;  4R1J A;  1Y1V H;  4DNI A;  1VQA A;  2C35 B;  5GAE C;  1YNX A;  4DV4 L;  1K9M C;  4A4I A;  1VQ6 A;  3E9H A;  3AYH B;  2CFM A;  4LF5 L;  4IFD I;  2NVT H;  4OX9 Q;  1EUJ A;  4LF8 Q;  1PH6 A;  3HOV H;  4JI8 Q;  4X66 L;  2Q2H A;  1VCI A;  3AEV A;  2IHE A;  1VS0 A;  2JA6 G;  3PO3 G;  1JJG A;  4JBJ A;  4KHZ A;  4YY3 L;  4WJ4 A;  4LF4 L;  4X64 Q;  1VQ9 A;  4PZ6 A;  1PH4 A;  5C3E H;  3TRZ A;  4DV2 L;  1IBL L;  2AHO B;  5AJ3 Q;  2JK8 A;  4NXM L;  2R93 G;  4LFA Q;  2VQF Q;  3UE1 A;  2CCZ A;  4C2M H;  2VZA A;  4JV5 L;  1HZA A;  2A19 A;  4A3B G;  4HIO A;  3J7Z C;  3CPW A;  4RMF A;  4UPA A;  4DV3 L;  5IYC G;  4A3M G;  1PH2 A;  1HNZ L;  1TWH H;  3W1B A;  2JA5 H;  4JBK A;  1AH9 A;  3M3Y H;  2KCT A;  2N49 A;  1MJC A;  3CCS A;  1N34 Q;  3I56 A;  1VQD A;  3GTM H;  2OCE A;  5ELN A;  1N32 Q;  3RZD H;  4O0A A;  4A3F G;  1GD7 A;  2H5X A;  1NTG A;  1VQC A;  4OO1 I;  1KIX A;  1SE8 A;  1FGU A;  3M9B A;  2DGY A;  3HKZ E;  1JT8 A;  1PHJ A;  4HJ5 A;  4AQY L;  1VQN A;  1FVI A;  4C3I H;  3I55 A;  4IOC A;  1CUK A;  4A3C G;  4DV1 L;  4UP7 A;  4DR4 L;  3PUV A;  3CCQ A;  1MIU A;  2UXD L;  1QVF A;  3CME A;  1B8A A;  3J80 c;  5C0X I;  2OWO A;  3I4N G;  1I50 H;  2JE6 I;  4A3E H;  1IBK L;  5IE8 A;  3KFU A;  4JI6 L;  3M4Q A;  4LFB Q;  3S17 H;  2RHS B;  2LXJ A;  4IOA A;  3T1H Q;  1TWG H;  4KHP L;  1IZ6 A;  2VUM H;  3HOU G;  1AE3 A;  1D8L A;  1CSP A;  4A3K G;  2E2I H;  2JA8 H;  4HJ8 A;  2IX1 A;  3CPF A;  4OON A;  1EYG A;  3JAM i;  1GO3 E;  1AE2 A;  2CKZ B;  1HNX L;  1WI5 A;  5M3M H;  1K3R A;  1YIT A;  2NN6 I;  1PV4 A;  1XJV A;  1N36 Q;  4JI3 L;  4DUY Q;  2E2H H;  1SN8 A;  1GKH A;  1K83 H;  1M90 C;  4P74 A;  5DLQ E;  2YTX A;  4JBM A;  1I94 Q;  1L1O A;  4Y7N H;  1B7Y B;  2YYZ A;  2KEN A;  1NMF A;  2N8N A;  4L5R C;  4DPG A;  2RCN A;  4HJ7 A;  2YTY A;  4TQU S;  1E7Z A;  3H0G G;  4KI0 A;  1D7Q A;  1WOC A;  4LF9 L;  4JI1 L;  2WFW A;  4C3H H;  4QQB X;  3HKS A;  4JOI A;  2IT1 A;  1A62 A;  1PFS A;  4UP9 A;  3D0F A;  4QY7 A;  2KCM A;  3M85 A;  1VQ5 A;  2UUC Q;  1L1O C;  4JI4 Q;  3U4Z A;  3A0J A;  3ZJY C;  4IJL A;  4X65 L;  5LMN W;  2B29 A;  1IBM L;  5JJK A;  4JI7 Q;  1KHI A;  1MJE A;  1OXT A;  5EAY A;  3KLW A;  2A1A A;  3PSI A;  3HOZ H;  1VQI A;  3K8A A;  1XNR Q;  3S24 A;  1KC8 C;  3A5U A;  1PH9 A;  3T1Y Q;  2WAQ E;  3PUZ A;  3STB C;  1CKM A;  3AFQ A;  3JAM c;  1CSQ A;  2OQK A;  4DR1 Q;  2OTL A;  4MNO A;  5IWA L;  4K0K L;  1Q1B A;  2EIF A;  4JOI C;  2Z6K C;  4PZ8 A;  3FKI H;  5JEA G;  1XPR A;  4B3M L;  2D62 A;  1YJW A;  4DR3 L;  5JJL A;  3DLL A;  4A3D H;  2R6G A;  3TEH B;  1E1T A;  3ULJ A;  3L2P A;  1V43 A;  4LW1 A;  2UXB Q;  4X6A H;  1TWF H;  1EWI A;  2EQS A;  5LMN Q;  4DV6 L;  4DAM A;  1VQ8 A;  2UU9 Q;  4DV5 Q;  4J15 A;  1NMG A;  5GQO A;  4GKK Q;  2UUA L;  4DR5 Q;  2HHH L;  2UXC Q;  4WJ3 M;  2MO0 A;  5IP9 G;  4LUV A;  3OTO Q;  1YJN A;  4LF6 Q;  1OXV A;  4RG1 A;  1KL9 A;  1K0R A;  3F2D A;  5HY6 A;  1NJI C;  3A74 A;  4L5S A;  4B3T L;  3G4S A;  1QUQ B;  2BH8 A;  3K81 C;  3CMA A;  1FL0 A;  1PH8 A;  2HT1 A;  1KAW A;  1WCM H;  2AWN A;  5IT9 c;  4DR6 L;  1X9N A;  2ZTD A;  3M7N A;  4R4C A;  2ZJP A;  1XMQ Q;  2XGT A;  3K80 C;  4DAY B;  1IXR A;  3AQQ A;  1Q12 A;  4HJ9 A;  2GN5 A;  4GKJ Q;  4P72 A;  5M5W H;  1VQH A;  4GOP B;  1Q82 C;  2ID0 A;  1E22 A;  2R92 H;  4IFD G;  3RNU A;  3HOY H;  2PMZ E;  3GTL H;  2PQA B;  4GS3 A;  2WB1 G;  3BZK A;  4BY1 H;  4A93 H;  4B3S Q;  4BXX G;  4A3L H;  1N33 Q;  2QA4 A;  2AMC B;  4JI0 Q;  2NZH A;  4A75 A;  2IHF A;  5C4X G;  3STB D;  4OX9 L;  4LF8 L;  2VQE Q;  4B3R Q;  4JI8 L;  3PUW A;  3OYY A;  1VQJ A;  3H15 A;  1VQP A;  1W2B A;  3E9I A;  4R4T A;  4GNX B;  3U58 A;  1ASZ A;  2HQL A;  3HOV G;  1J5E L;  1O7I A;  1YHA A;  3KDF B;  4X64 L;  1UE1 A;  1Q81 C;  2KHI A;  1EFW A;  3S15 H;  2B3G A;  3GTP H;  2BA0 A;  3CCM A;  2I0Q A;  1YI2 A;  5AJ3 L;  1VQM A;  2N78 A;  4X66 Q;  1WYD A;  2VQF L;  4LFA L;  4JG2 A;  4IO9 A;  1LUZ A;  2D0P A;  2HIX A;  1JJ2 A;  1JB7 A;  2R93 H;  5C4J H;  4QGU A;  2RHQ B;  3UDX A;  4LF4 Q;  4JCV E;  3DM3 A;  4QL5 A;  4A3B H;  1T9H A;  3MEF A;  1TWC H;  2ZTC A;  3RLF A;  4DV2 Q;  1IBL Q;  1A0I A;  1VQG A;  4PZ7 A;  3CQZ H;  5IYB G;  5IYC H;  3I4O A;  2DUD A;  1N34 L;  1VQ7 A;  2B63 G;  1HH2 P;  2E2J H;  1N32 L;  4R4O A;  4IPD A;  1UE5 A;  4AYB E;  2F3I A;  3BU2 A;  3CC7 A;  1FJG L;  1EQQ A;  1Y1W H;  3GTK H;  3EIV A;  4GLX A;  3ERS X;  5IP7 H;  1VQO A;  3BZC A;  5BR8 Q;  5C0X G;  4YWM A;  5M3F H;  4UP8 A;  2Q2T A;  1C7Y A;  1WJJ A;  1NBW A;  5IYD H;  2ZJQ A;  2KBN A;  4DV0 L;  3RN2 A;  1SR3 A;  4HID A;  1YEZ A;  4X62 L;  1OXU A;  1S40 A;  1P8L A;  4LNQ A;  1YZ6 A;  4P71 A;  1Z47 A;  4JI5 L;  3CF5 A;  1M1K C;  2F4V L;  4OXP A;  4DV1 Q;  3T1H L;  2KHJ A;  2E5L Q;  3I4N H;  1JJC B;  3S14 H;  4DR4 Q;  4A3G G;  2I5H A;  4DR2 Q;  1VQL A;  1Q86 C;  2K4K A;  2YV5 A;  3HKZ G;  3CCJ A;  4O2D A;  1I3Q H;  2RF4 A;  3CCU A;  1W3S A;  1EIF A;  1N36 L;  4BA2 I;  2JA8 G;  3I7F A;  2JA7 G;  5JEA J;  2BH2 A;  4DUY L;  3RR5 A;  2XTI A;  4A3J G;  1PA6 A;  1JMC A;  5M3M G;  1V9P A;  3TS0 A;  1X3G A;  1I94 L;  1ASY A;  2PI2 E;  4POG A;  4IPH A;  2IY5 B;  5FLM H;  1P16 A;  1EQR A;  2JJQ A;  1X56 A;  3S1R H;  4DK3 C;  4IJH A;  1Q46 A;  1PYS B;  2ZTE A;  1A8V A;  4JBW A;  4AIM A;  3BJU A;  2Z6K A;  1OXS C;  3J81 i;  1XNQ Q;  3KJO A;  5ELO A;  3H0G H;  1NE3 A;  3HOW H;  2CWP A;  4BBR H;  1VQ4 A;  2R7Z G;  3VDY A;  2UXC L;  5FJ8 H;  4LF7 L;  5GAD C;  3RLO A;  2F52 A;  2UUC L;  4JI4 L;  4A3I G;  4BY7 G;  1BVS A;  1X55 A;  1QUQ A;  4NPS A;  2VL6 A;  4BA1 I;  1K8G A;  4JI7 L;  4OWW B;  5FLX c;  1KRT A;  3CCE A;  4JYA L;  4GN3 B;  1XNR L;  3G48 A;  3NEN A;  4LFC Q;  3T1Y L;  3ICE A;  1YBY A;  3GO5 A;  4X65 Q;  4DR1 L;  4DK6 C;  3F2B A;  5LMU Q;  5E7N A;  4GN5 A;  3KJP A;  4JI2 Q;  4GOP A;  1HR0 W;  5C44 G;  3F8T A;  3NEM A;  3D31 A;  1SLJ A;  3CCV A;  3UDF A;  1C0A A;  2K50 A;  4BBS H;  2PQA A;  1G29 1;  4YCU A;  4DKA C;  2EXD A;  3HOX H;  5LMN L;  3PF5 A;  2NVQ H;  2QEX A;  2UU9 L;  4LUZ A;  1HJP A;  4DV5 L;  2UUB L;  4K0K Q;  2YU9 H;  3TS2 A;  2ATW A;  4GKK L;  4MTN A;  1K8A C;  3I4M H;  3S2D H;  4DR3 Q;  2ZJR A;  2K5H A;  4LF6 L;  3OTO L;  1EOV A;  1SRO A;  4DV7 L;  1I5F A;  2JEB I;  3J81 c;  2ZM6 Q;  2ES2 A;  4GOP C;  3J81 j;  2WAQ G;  5IP9 H;  4IPC A;  4GNX A;  4YHH L;  3RN5 A;  1HR0 Q;  1HNW L;  4JC0 A;  1SMX A;  4QJF A;  1QVG A;  1PH7 A;  3GTQ H;  3KDF A;  3TRE A;  3S1M H;  2I5M X;  5GAH C;  2ALY B;  3WWV A;  1X3E A;  1TWA H;  1E3P A;  4NXN L;  3CC4 A;  4ME3 A;  1XMQ L;  4H02 A;  1Q7Y C;  2CQO A;  4GN4 B;  4ALP A;  4R4Q A;  4DR7 Q;  3PO2 H;  1YIJ A;  1QZH A;  1S3O A;  4GKJ L;  2V1C C;  1VQK A;  1RL2 A;  1IYJ B;  1HZC A;  4OWT B;  1HZ9 A;  3M4P A;  3S1N H;  4GNX C;  2IX0 A;  1XMO Q;  1Y1V G;  4B3S L;  3S1Q H;  2Y0S E;  2JA9 A;  4DUZ Q;  4KLK A;  2R92 G;  4NB3 A;  2R7F A;  4DV4 Q;  1S72 A;  4YWK A;  1N9W A;  3HOY G;  1PVO A;  4A93 G;  2AKW B;  2MO1 A;  5C4X H;  2VQE L;  4UY8 C;  4A3L G;  3IRB A;  1L0W A;  4LF5 Q;  4B3R L;  2JA6 H;  2GVB A;  1KRS A;  1V1Q A; 
#chains in the Genus database with same CATH topology
 1PRT B;  1OXX K;  2EYM A;  1HRJ A;  3BYY B;  3SGI A;  3KF6 B;  1X6O A;  5K36 G;  1AZP A;  3M4O H;  1YNN C;  5FO7 B;  4YY3 Q;  1OO9 B;  2K75 A;  1ZYR D;  1DZ1 A;  1GHK A;  4NXM Q;  4JV5 Q;  3MWY W;  4G7Z C;  3QIA A;  4A3F H;  1CKN B;  1HNZ Q;  3E0E A;  5IGD A;  5EKI A;  2K01 A;  3L0O A;  1NUC A;  2D0O A;  3MXN B;  3MVV A;  1FGB D;  1EYD A;  1MHW C;  4Y52 H;  4C3I G;  3J80 E;  4AQY Q;  3D6C A;  1E2V A;  1LYL A;  2RDG A;  3FHW A;  3FMC A;  4LAA A;  5HGQ A;  1Y1W G;  2B39 A;  3VA5 A;  4LFB L;  4U67 3;  1A63 A;  1E24 A;  1PRT D;  2NN6 G;  2P5Z X;  5IYD G;  2J4X A;  2E5L L;  4JI6 Q;  3PIP A;  4AYB G;  4C3I B;  3PIP 3;  2HIV A;  4DV0 Q;  3BS1 A;  3EBE A;  4X62 Q;  3DM1 A;  1Y1W B;  4UHV A;  1PRT F;  3IAY A;  2MNA A;  3SK4 A;  4H13 C;  2JA7 H;  2AWO A;  2ASB A;  1D1K A;  1DCZ A;  1VQE A;  3NWT A;  1S5E D;  4AYB B;  4CGY B;  4AH6 A;  1Z9F A;  1SRU A;  4RHS A;  1XNQ L;  4IUV A;  3GDE A;  2PPB C;  1X54 A;  3J7A 5;  1BDO A;  3TQY A;  1H9R A;  1KXL A;  1STG A;  2R7Z H;  3G71 A;  4RFB A;  4DAP A;  1JC7 A;  4EQ5 A;  1D5Z C;  4KKS A;  4A3I H;  1IBM Q;  3L3O C;  2DJG C;  4IFD J;  2I5L X;  3HP3 A;  4GZY C;  4O42 A;  3G6E A;  3F2C A;  4YCW A;  1SNO A;  1GUW A;  1PXU A;  3A55 A;  4LF9 Q;  5IY0 A;  1WD0 A;  3OIP A;  3ONA B;  5IWA Q;  3CAM A;  1VDZ A;  4PG3 A;  3QG1 A;  2HUG A;  1F2Z A;  4KKU A;  3UDG A;  1BCP B;  2A6E C;  3CD6 A;  3W5O A;  1LTL A;  4LUO A;  4HAE A;  5H1S E;  4DV6 Q;  4BBS G;  3PV0 A;  1QG7 A;  4OEL B;  2Z0S A;  1YHB A;  4MZ9 A;  3ITP A;  4F8M A;  1HR0 L;  1S5C D;  1L2F A;  4WRD A;  1RDP D;  2B2T A;  1KNA A;  1XPU A;  5EPJ A;  5I4D A;  1XX8 A;  2NZO A;  4BBS B;  1LTA D;  1U0L A;  4A76 A;  4P75 A;  1WFQ A;  2YU9 B;  3ULP A;  1SYD A;  4CJ2 C;  2MUY A;  4APV A;  4BXX H;  1XMO L;  1FNV A;  3FP9 A;  2VB2 X;  3RLN A;  5IT9 L;  1Y1V H;  1XYI A;  5GAE C;  4DV4 L;  1VQ6 A;  3MAQ A;  2GA4 B;  4LF5 L;  4OX9 Q;  1EUJ A;  3E3X A;  4LF8 Q;  5C6A A;  1UAP A;  1VCI A;  2JA6 G;  2KA7 A;  1JOO A;  1PDQ A;  1VQ9 A;  4PZ6 A;  5C3E H;  3BVZ A;  3W2D A;  4DK1 A;  4DV2 L;  1BCP F;  1IBL L;  4LFA Q;  4QUC A;  4KN4 C;  3LNN A;  3SR1 A;  1ICF B;  1CQV A;  2F0E A;  4RMF A;  4UPA A;  1RTN A;  3W1B A;  1QE6 A;  2EYH A;  2JA6 B;  3A8J E;  4OIK A;  2N49 A;  1MJC A;  1MD2 D;  3I56 A;  3G6J B;  3GTM H;  4O0A A;  4A3F G;  2SDF A;  3M9B A;  5CYU A;  1JT8 A;  4PMC A;  1JOQ A;  1FVI A;  3BG3 A;  2UXD L;  1B8A A;  2RA4 A;  1IBK L;  4A3F B;  2RHS B;  2LXJ A;  3TP6 A;  5KYL A;  2F0T A;  4KHP L;  1FNU A;  3NWS A;  5CMD A;  1W6J A;  2F0K A;  2QDL A;  3GP7 A;  2JA8 H;  3A56 A;  1UUP A;  2QCP X;  1SJH D;  1EYG A;  1SSO A;  1AE2 A;  3MXP A;  3F2U A;  3MZ5 A;  1N36 Q;  2N55 A;  1XJV A;  4JI3 L;  2E2H H;  4M1U B;  4P74 A;  4TSS A;  3Q24 A;  4KTA A;  2IL8 A;  4L5R C;  1JR0 D;  3MFG A;  4IUP A;  4DPG A;  1I3Q B;  2EXZ A;  2A68 C;  1E0B A;  2OEO A;  1CZG A;  3WOF A;  2WFW A;  3NQI A;  3D0F A;  2KCM A;  2UUC Q;  3H91 A;  4G7O C;  3A0J A;  3ZJY C;  4IJL A;  2B29 A;  1IW7 D;  1OXT A;  3PSI A;  1VQI A;  3S24 A;  1KC8 C;  1PH9 A;  3PUZ A;  1NAP A;  1HUN A;  1C48 A;  4K0K L;  1Q1B A;  4PZ8 A;  5IGG A;  5JEA G;  1Q90 A;  3R2I A;  2D62 A;  4BS9 A;  5FLX L;  3K5L A;  4A3D H;  2R6G A;  3ULJ A;  1E1T A;  4X6A H;  1MI2 A;  2UXB Q;  3NK9 A;  4DAM A;  4DN4 M;  1VQ8 A;  2LFN A;  4OGQ C;  5GQO A;  4GKK Q;  1K0S A;  2UXC Q;  2RCF A;  5IP9 G;  1SYB A;  5D3D A;  1K0R A;  1I4Q A;  5HY6 A;  2WII B;  3G4S A;  2BH8 A;  3K81 C;  1FL0 A;  4PNY A;  3NSW A;  2AWN A;  1TS5 A;  2PCF B;  3EVQ A;  5IGE A;  2F3W A;  4HJ9 A;  4P72 A;  1Q82 C;  1NCV A;  4OHJ A;  3RNU A;  3GTQ B;  2PMZ E;  4XDX A;  2WB1 G;  1SJE D;  1EL0 A;  4BXX G;  4X3T A;  3IKJ A;  1N33 Q;  1STB A;  2AMC B;  1CZW A;  1V1P B;  2EJM A;  1VQP A;  4IUN A;  3KBG A;  3U58 A;  1I6V C;  1RKN A;  2HQL A;  1ASZ A;  3DMU A;  1O7I A;  1YHA A;  4X64 L;  1UE1 A;  2WB1 B;  4QF4 A;  3S15 H;  2BA0 A;  3A8K E;  1YI2 A;  3M4Y A;  1VQM A;  4X66 Q;  1WYD A;  2D0P A;  2K5D A;  4QGU A;  3DWQ A;  3UDX A;  4A3B H;  3MEF A;  2Q8T A;  3G7L A;  3HZX A;  3SK6 A;  5IYB G;  5IYC H;  3K57 A;  1N32 L;  2OXP A;  4IPD A;  2CHB D;  4NMZ A;  2F3I A;  3BU2 A;  3CC7 A;  1K8O A;  3GTK H;  4KY6 A;  5IP7 H;  3BZC A;  1WTQ A;  4UP8 A;  1FD7 D;  2Q2T A;  2F0W A;  3VR3 A;  1S5B D;  4HID A;  1XXG A;  3BDL A;  4LNQ A;  4JI5 L;  3I4N H;  4DV1 Q;  1ONL A;  2KHJ A;  4P2C B;  2SOB A;  4HED A;  3I3C A;  3GTM B;  3ERQ A;  2YV5 A;  3HKZ G;  1STY A;  5EBC A;  2FIN B;  4RGN A;  2I46 A;  5E3F A;  2AUK A;  3K5O A;  2JA8 G;  2CQA A;  3L9A X;  1B3Q A;  5JEA J;  3RR5 A;  2XTI A;  4A3J G;  5BN3 A;  1ASY A;  2MGS A;  2PI2 E;  3VYS A;  1X56 A;  3HKZ B;  3FRP B;  4JBW A;  4AIM A;  1OXS C;  2JA8 B;  1VQ4 A;  3ERO A;  4RA8 A;  3SK8 A;  4A3J B;  5FJ8 H;  4LF7 L;  4JI4 L;  5C3X A;  4BY7 G;  1X55 A;  1HQM C;  1XNR L;  2XVS A;  2LKV A;  2AQ2 B;  3ICE A;  4X65 Q;  4F88 A;  2XNA C;  3KJP A;  5C44 G;  5DM7 3;  3F8T A;  3NEM A;  1SE3 A;  1UEA B;  1U4M A;  1C0A A;  4BY7 B;  1GUS A;  1G29 1;  4V0B A;  3PF5 A;  2NTT A;  4DV5 L;  3OMG A;  3TS2 A;  1K8A C;  3I4M H;  4DR3 Q;  3OHX C;  4DV7 L;  2ES2 A;  1I5F A;  3J81 c;  2ZM6 Q;  2D9U A;  3J81 j;  2WAQ G;  5C44 B;  4YHH L;  3TRE A;  2I5M X;  1JWU D;  1E3P A;  1Q7Y C;  4GN4 B;  4R4Q A;  4CDD C;  2F3V A;  2M9V A;  4DA2 A;  1IL8 A;  3I91 A;  2K5W A;  5LL6 S;  2JN4 A;  1IYJ B;  4OWT B;  4QB4 A;  2WAQ B;  3M4P A;  4N8X 1;  4GNX C;  2IX0 A;  1ROD A;  4M8A A;  2Y0S E;  2JA9 A;  2BE5 D;  5E4X A;  2R7F A;  1PVO A;  2AKW B;  2VQE L;  4B3R L;  1EEF D;  2L9H A;  5BN5 A;  1V1Q A;  1I6H B;  5J22 A;  4XTC S;  5D3I B;  4DNT B;  2NYZ D;  3P7J A;  2WKC A;  3CXC A;  5M5Y H;  2C5C A;  4OO1 G;  4KY7 A;  4C3J H;  2PQE A;  1DXM A;  4OEM B;  4A3M H;  3K59 A;  1J5E Q;  1MKH A;  4JPB W;  3M7G A;  2Y0S G;  1QVC A;  1TXY A;  2PW5 A;  4TVA B;  1YJ9 A;  2JA5 G;  3LGJ A;  4DV3 Q;  4CKC A;  2B63 H;  2Q2U A;  1JWS D;  4LWC A;  1BQQ T;  1JWM D;  4K2L A;  4DXG A;  1D6E C;  1PZJ D;  1GUG A;  2Y0S B;  1TY2 A;  1BO0 A;  5IP7 G;  2N3S A;  1TS2 A;  2QEJ C;  2JA5 B;  2BDO A;  3M3Y B;  3I4L A;  2OTJ A;  4A3E G;  3RZD B;  3LWE A;  3HOU H;  3S16 H;  3S2H H;  2B2U C;  1T5X D;  1EIY B;  4DGZ A;  5T1G A;  4A3G H;  2KVM A;  3GTK B;  2F4V Q;  1VF7 A;  1HNX Q;  5I2Y A;  2OF1 A;  3CCR A;  4A3E B;  2GVA A;  1R4Q B;  2CWA A;  4K5W A;  3TDQ A;  1D5X C;  3EN2 A;  1R9T H;  2E2I B;  1VQB A;  3ND9 A;  4GLV B;  5EQ0 A;  2VW9 A;  3AFP A;  2F0P A;  1TU2 B;  1LT6 D;  1J6Q A;  2LS0 1;  4I7Z C;  2WP8 J;  1PH1 A;  1RCV D;  2LXK A;  3KOJ A;  1M4V A;  1IKM A;  1ZEQ X;  2VNU D;  1TQO A;  5JPM C;  2VUM G;  4Y7N B;  1H9S A;  1BOS A;  3QJY A;  3CRL C;  5FJ8 G;  2LMC B;  2O5I C;  3HOZ G;  1U5K A;  5JVH 3;  5JJI A;  3UE0 A;  2PNH A;  1CT1 D;  1JE5 A;  4JI2 L;  3CCL A;  3SXH A;  2VUM B;  4JYA Q;  2CH4 A;  4B3M Q;  1L1O B;  3IL8 A;  1ZYR C;  2F0G A;  3B6Y A;  3JC6 6;  1SE2 A;  1GM5 A;  2KUM A;  3HOZ B;  4HIK A;  2AQ1 B;  3K0X A;  1BBW A;  1KQS A;  1TS4 A;  3QO2 A;  4CDC C;  4CDF C;  2HHH Q;  2CW0 C;  5IT9 E;  3QOL A;  4ZKC B;  3I4M G;  3DEO A;  2UUB Q;  3SEB A;  1VQF A;  3S9W A;  3CW2 C;  3PF4 A;  4OWX B;  1UE6 A;  4HMJ A;  1E1O A;  1SAP A;  1HXY D;  1Y8P B;  2A74 C;  3ER0 A;  1HNW Q;  1UE7 A;  2F0H A;  4XXE A;  3E6Z X;  1G51 A;  2BA1 A;  2BCO A;  4JI0 L;  1CTM A;  1PRT C;  4NXN Q;  3I4M B;  2K1B A;  5DAU A;  4L5T A;  4DUZ L;  4R1J A;  1VQA A;  2C35 B;  1F9S A;  1YNX A;  1K9M C;  4MIU A;  4RCO A;  1BF4 A;  1B2T A;  2HQE A;  2I07 B;  1WTH A;  3HOV H;  5AFW A;  2IHE A;  1JJG A;  3EFX D;  4KHZ A;  4YY3 L;  4LF4 L;  1PH4 A;  1QJO A;  3OSO A;  2BDN A;  2JK8 A;  4NXM L;  2R93 G;  2QDB A;  2CW0 D;  4JV5 L;  3KUP A;  1F9P A;  1BUV T;  3T4A C;  4A3M G;  1HNZ L;  3MC0 B;  1TWH H;  1N34 Q;  3GTP B;  4EQN A;  5C0X H;  4YIJ A;  2HCI A;  1B50 A;  4HJ5 A;  4AQY L;  5EPK A;  2R93 B;  3CU7 A;  3T51 B;  1WTX A;  3PQI A;  3NBH A;  4Z9C B;  1F2L A;  4A3M B;  3CME A;  1L0X B;  5C0X I;  4DU9 A;  4JI6 L;  4LFB Q;  3S17 H;  4NP5 A;  1O78 A;  4IOA A;  3T1H Q;  3A54 A;  3HOU G;  4UAI A;  1AE3 A;  1D8L A;  1Y69 U;  1I4P A;  1HPC A;  4OON A;  3C3L A;  2A6H D;  1YIT A;  3MTS A;  1JOR A;  1PTO B;  4DUY Q;  5M9O A;  1SN8 A;  1K83 H;  3T13 A;  5DLQ E;  5ISR A;  4JBM A;  3S2H B;  3HOU B;  3S16 B;  3KF8 A;  2K05 A;  5KNB A;  2YTY A;  3H0G G;  4RAU C;  4KI0 A;  2FJ2 A;  1D7Q A;  3R93 A;  1CI3 M;  5FLX E;  1WOC A;  1TS3 A;  4QQB X;  1O7Z A;  1PFN A;  1KNE A;  1A62 A;  1PFS A;  3M85 A;  1VQ5 A;  3S1R B;  5LMN W;  3KLS X;  1IBM L;  1KHI A;  1BCP C;  2KEC A;  1LO5 D;  3KLW A;  2L11 A;  1R9T B;  3H0G B;  3K8A A;  3DUZ A;  4KJO A;  3T1Y Q;  4LF9 L;  3JAM c;  3K5N A;  1CSQ A;  5IWA L;  2EIF A;  3FKI H;  1PTO D;  1U4R A;  5KIX A;  1R4P B;  1PYW D;  1EWI A;  1TWF H;  2EQS A;  4DV6 L;  2RKS A;  3RD4 A;  1SND A;  3KLR A;  1EU3 A;  3DEP A;  4K6D A;  5DNF A;  4EGV A;  5L37 A;  2AQ3 B;  3PMF A;  3FDT A;  1YJN A;  5J39 A;  3DHQ A;  1PTO F;  2O5J C;  1OXV A;  1PZI D;  4RG1 A;  1KL9 A;  4RCN A;  4X3S A;  2ICE C;  3VR5 A;  2L5T A;  2M00 A;  1WCM H;  1X9N A;  3S2D B;  1H9S B;  4R4C A;  3J81 L;  3AQQ A;  4ZUJ A;  4BWG B;  2GN5 A;  5EKK A;  5M5W H;  2PZU A;  4GOP B;  1QIL A;  4G57 A;  2ID0 A;  1E22 A;  1BCP D;  3GTL H;  2PQA B;  3BZK A;  4BY1 H;  4A93 H;  4B3S Q;  2H1E A;  2QA4 A;  2NZH A;  2IHF A;  4OX9 L;  2F0L A;  4LJZ C;  4LF8 L;  2B8F A;  3BDO A;  4OL7 A;  3PUW A;  1F77 A;  3OYY A;  3H15 A;  4QMG A;  1LTI D;  1ZKO A;  4H7B A;  3HOV G;  2KHI A;  2L4N A;  2B3G A;  5IGC A;  2I0Q A;  5I2X A;  2N78 A;  4LFA L;  4ABN A;  4JG2 A;  4XQJ A;  1LUZ A;  3QB3 A;  2N88 A;  5C4J H;  3DM3 A;  4QL5 A;  2ZTC A;  4ME5 A;  4DV2 Q;  1IBL Q;  1EIH A;  1A0I A;  1VQG A;  4PZ7 A;  1EY6 A;  3CQZ H;  2DUD A;  1VQ7 A;  2ZXR A;  3HOV B;  3M4O B;  5KEE A;  2F0M A;  1KLU D;  2K03 A;  1IW7 C;  2LY7 A;  1FJG L;  2F1M A;  3ERS X;  5BR8 Q;  5C0X G;  3D6W A;  4YWM A;  1G2T A;  2PNR C;  4K5V A;  1NBW A;  1WJJ A;  4TKO B;  1EU4 A;  2ZJQ A;  2J0T D;  2KBN A;  4C56 C;  2NB0 A;  4WJ4 A;  1YEZ A;  1OXU A;  1P8L A;  2WAC A;  5CV4 A;  1M1K C;  3S14 H;  1SBB B;  1TWH B;  4OXP A;  4DR2 Q;  1VQL A;  1ML0 D;  2F0V A;  2QW7 A;  1EIF A;  1N36 L;  2JA7 G;  1U9R A;  1SNP A;  1SXT A;  1XTC D;  1V9P A;  3TS0 A;  1E2Z A;  2JJQ A;  2KJX A;  2B2W C;  1PYS B;  2ZTE A;  3Q6S A;  1WTV A;  3VR4 A;  2Z6K A;  4HTH A;  2F0U A;  1NE3 A;  3HOW H;  2CWP A;  2JA7 B;  4FP5 D;  2R7Z G;  3VA7 A;  3RLO A;  2UUC L;  2NTS A;  2Z4I A;  4FF4 A;  4A3I G;  1K8G A;  1QUQ A;  3CCE A;  4Q0F A;  2Z4H A;  1PZK D;  2EDG A;  3G48 A;  4LFC Q;  4DAY A;  3GO5 A;  3F2B A;  2R7Z B;  5LMU Q;  5BN4 A;  2MP1 A;  1HR0 W;  1Y8N B;  2HDM A;  4CJ0 B;  5ELB A;  2A73 B;  2K50 A;  4A3I B;  2NVQ H;  4YCU A;  4DKA C;  3HOX H;  4LUZ A;  4K0K Q;  4GKK L;  4MN3 A;  2ZJR A;  2K5H A;  1EOV A;  1SRO A;  2TSS A;  1G6Z A;  4GNX A;  1B9M A;  3NE5 B;  3S1M H;  3KDF A;  4NDX A;  3VYT A;  2ALY B;  1TWA H;  5C4Z A;  2KEE A;  4DR7 Q;  4ALP A;  3PO2 H;  1F9R A;  1QZH A;  1TWF B;  3ZYY X;  5IOC A;  3TME A;  1RL2 A;  1TII D;  1O7L A;  1HZC A;  1HZ9 A;  3S1N H;  1Y1V G;  3BVG A;  2JYO A;  2CVR A;  4QCL A;  4NB3 A;  1NR4 A;  1S72 A;  1N9W A;  1RJT A;  1RF2 D;  4A93 G;  1U4P A;  5C4X H;  1L0W A;  2R3Z A;  3RZO H;  2K52 A;  2EPB A;  4QIW E;  5M5W B;  1Y1V B;  3KYH C;  5C3E G;  1PH3 A;  1GJX A;  2QF7 A;  1FNW A;  3L7Z C;  2B2Y C;  1BKB A;  2E8G A;  3MFY A;  3EQL C;  4A93 B;  2KQ3 A;  1HA6 A;  1SMY C;  1HCZ A;  3RMH A;  2EJF C;  3AU7 A;  1B53 A;  4ZAI A;  2LSS A;  3SK5 A;  1KTK A;  4GLA C;  3I90 A;  1HTL D;  5C3E B;  1EY0 A;  1X32 A;  2PMZ B;  4EQP A;  2B2U A;  4PMB A;  1BBU A;  2Q2I A;  3A5Z B;  1PH5 A;  5COY A;  1Y14 B;  3V2T A;  1B44 D;  1CQF A;  2XRQ D;  5C4J B;  2V4D A;  1VMP A;  3GTG H;  4CKE A;  2F0D A;  2EYO A;  1FYC A;  5GAG C;  3H3V C;  5M5X H;  4A3K H;  3CQZ B;  1S5D D;  3PCO B;  1WD1 A;  5I9P A;  1LM0 A;  1O80 A;  2QIL A;  1BBX C;  3ULL A;  1FR3 A;  5HGT A;  4JI5 Q;  4FYD A;  3Q23 A;  1X65 A;  1A3T A;  2R61 A;  3A7L A;  2VS1 A;  3QR8 A;  5JVG 3;  1Q8K A;  3EJI A;  2KCC A;  1SMY D;  3CRK C;  1G6P A;  2IW3 A;  2K5N A;  3U50 C;  2NVX H;  3U9S A;  3S14 B;  1RHP A;  2WV6 D;  3UDI A;  1CFM A;  4WJW A;  1A15 A;  1SFO H;  1N8R C;  2A8V A;  1EWC A;  3PIO A;  3TZU A;  2E2H B;  3H6M A;  3K7U C;  4JI1 Q;  4POF A;  1D5M C;  1WVL A;  2BE5 C;  3HOW G;  1X3P A;  4S3S A;  4ZK9 B;  3NEL A;  2MFI A;  4R4I A;  1WTW A;  3OW7 A;  3I73 A;  2G5D A;  4RGT A;  1DM0 B;  4LF7 Q;  2HDL A;  4XYO A;  2Q8R E;  4ILW A;  4ZYS A;  1WTP A;  1X3F A;  1CA5 A;  2L1B A;  1XTD A;  3VYU A;  3HOW B;  4DR5 L;  1CKO A;  4A3D G;  2CH4 W;  4R8N A;  3N6R A;  5CBE E;  4DAV A;  1Q1E A;  2EOT A;  5I9O A;  1PYB A;  3JAM L;  3HOX G;  1C8C A;  2UUA Q;  1EEI D;  2ZM6 L;  3D8G A;  4J8Q A;  1C4Q A;  3KF6 A;  3PUY A;  4A3D B;  4B3T Q;  4RGO S;  4DV7 Q;  4EVO A;  1OTC A;  3A8I E;  3LX0 A;  4DR6 Q;  4YHH Q;  2NVY H;  3HOX B;  3PUX A;  5ELC A;  2AUJ D;  4IFD H;  4RHR A;  2L15 A;  5J3B A;  1SNQ A;  4IPG A;  5C4H A;  3PO2 G;  1CKN A;  3F1Z A;  4L5Q A;  1SDF A;  4DNI A;  1HQR D;  1TY0 A;  3MXN A;  2K33 A;  4A4I A;  2KOL A;  4FXK C;  1SNM A;  2CFM A;  4IFD I;  1TWA B;  2RSN A;  4JI8 Q;  3PO2 B;  3KLS A;  2EZV A;  2Q2H A;  1E2W A;  1LT5 D;  2KCN A;  4JBJ A;  1CHQ D;  3OWF A;  4RKL A;  5AJ3 Q;  2VQF Q;  2CCZ A;  4LK1 C;  2VZA A;  1HZA A;  4A3B G;  2EY5 A;  2K04 A;  5C5M A;  3I70 A;  4HIO A;  3D3R A;  1QOH A;  3CPW A;  4DV3 L;  5IYC G;  4B9X A;  1EWH A;  1AH9 A;  2KCT A;  3CCS A;  3S15 B;  2MHV A;  3RZO B;  3KBX A;  2H5X A;  1VQC A;  1SEB D;  4KHV A;  1SYG A;  1PHJ A;  2D5D A;  1VQN A;  4C3I H;  3I55 A;  4A3B B;  1PFB A;  1CUK A;  1RD9 D;  2IX3 A;  5FO9 B;  1KAB A;  4DR4 L;  3CCQ A;  5A2Q L;  1ET6 A;  2F03 A;  2QKI C;  1NSN S;  3J80 c;  4K2K A;  3X3N A;  2OWO A;  3I4N G;  1I50 H;  2NN6 H;  3P20 A;  5IE8 A;  3M4Q A;  3MXU A;  5LL6 X;  1TWG H;  1G2S A;  4L8J A;  4QUF A;  4A3K G;  2OT2 A;  1AEX A;  2F0S A;  3CPF A;  1GO3 E;  4IUQ A;  2CKZ B;  2F0J A;  1HNX L;  4I7A A;  1WI5 A;  5M3M H;  1K3R A;  4O1N A;  3SVM A;  2NN6 I;  4KN7 C;  3I4N B;  2HD3 A;  1L0Y B;  1M8A A;  2MJ8 A;  3OIQ A;  1M90 C;  3GTG B;  2YTX A;  1I94 Q;  1B7Y B;  1YNJ D;  2KEN A;  5M5X B;  4A3K B;  1NMF A;  2EVB A;  1J8I A;  2RCN A;  1KDA A;  2VXW A;  1EY9 A;  1E7Z A;  5KYI A;  2FMM A;  3MXG A;  5NUC A;  4C3H H;  1QCB D;  3T56 B;  3HKS A;  2IT1 A;  2SNM A;  4UP9 A;  5F2D A;  4QY7 A;  1GOZ A;  1L1O C;  4OIJ A;  1Z7T A;  3D4R A;  5JJK A;  4JI7 Q;  5COR A;  5EAY A;  2A1A A;  1IYV A;  2NVX B;  2H4O A;  3A5U A;  2Z6B A;  1AFP A;  1CKM A;  3AFQ A;  4DR1 Q;  2OQK A;  2OTL A;  1SFO B;  1MGS A;  4JOI C;  4B3M L;  1T5E A;  1XPR A;  3J7Y W;  1YJW A;  5JJL A;  3DLL A;  3J81 E;  3TEH B;  3NUC A;  4LW1 A;  5LMN Q;  5JPN C;  2UU9 Q;  2EYJ A;  1NMG A;  2J7Z A;  2HHH L;  4WJ3 M;  2MO0 A;  4LF6 Q;  3OTO Q;  3K6O A;  4DK0 A;  3OMC A;  1I4G A;  4CJ1 B;  3NBI A;  4L6T B;  4L5S A;  1K8M A;  3OWE B;  3CMA A;  1KAW A;  1DOM A;  2ZTD A;  2ZJP A;  1XMQ Q;  4C1N K;  3K80 C;  1IXR A;  2E74 C;  2EYL A;  1Q12 A;  2G9H D;  2KHS A;  5C5L A;  3T16 A;  4GKJ Q;  1VQH A;  4IUR A;  1SYF A;  3NXW A;  1H9K A;  2R92 H;  4IFD G;  3HOY H;  1HTP A;  1EY7 A;  4A3L H;  4HMI A;  4JI0 Q;  4A75 A;  4FVM A;  2ZXP A;  1SYE A;  4MTK A;  4PQX A;  3V05 A;  3URY A;  5EKL A;  5HUR A;  2A6H C;  1VQJ A;  1BXT A;  4NW2 A;  1STN A;  4R4T A;  4X3K A;  5D14 A;  5KGU A;  1Q81 C;  1BR9 A;  1EFW A;  3CCM A;  4C3J G;  3AMU A;  2FFK B;  1VF5 C;  2Z8L A;  1JB7 A;  2HIX A;  4EQO A;  5I6Y A;  1JJ2 A;  1PMR A;  4LF4 Q;  1K28 A;  3BDC A;  4JCV E;  1T9H A;  3RLF A;  1TWC H;  2B63 G;  1N34 L;  2E2J H;  5M5Y B;  3D4W A;  1A6X A;  3MHB A;  1UE5 A;  4AYB E;  1ENA A;  4C3J B;  1II3 A;  1EQQ A;  2MPM A;  3EIV A;  4GLX A;  2PW7 A;  1VQO A;  2XWB B;  1EYA A;  1X3Q A;  5M3F H;  2JXM B;  3FPU B;  5IGB A;  4DV0 L;  3RN2 A;  2B63 B;  1H9J A;  4HSP A;  1SR3 A;  4X62 L;  1PTO C;  2JEA I;  4P71 A;  2F0N A;  3CF5 A;  3X3M A;  2EY1 A;  3T1H L;  2E5L Q;  1LTT D;  1CK1 A;  4A3G G;  1Q86 C;  2K4K A;  2B2W A;  2RDH A;  1I3Q H;  2RF4 A;  1DOL A;  2FMC A;  4BA2 I;  3I7F A;  2ZT9 C;  2WKD A;  5G3L D;  4DUY L;  1GUO A;  1PA6 A;  1JMC A;  5M3M G;  1X3G A;  3U9O A;  5D65 A;  4A3G B;  4IPH A;  1YNN D;  5FLM H;  2IY5 B;  1EQR A;  1I50 B;  5JOB A;  1JB3 A;  1Q46 A;  4IJH A;  1KAA A;  1TWG B;  1PFM A;  3BJU A;  1XNQ Q;  3J81 i;  3KJO A;  5ELO A;  5G3L F;  4BBR H;  4KK7 A;  5EPL A;  3VDY A;  5EBD A;  2F52 A;  5M3M B;  4C3H G;  1BVS A;  4NPS A;  1JQY D;  3H94 A;  4N8F A;  4BA1 I;  4RGM A;  2HCC A;  4GN3 B;  2A5H A;  1LT3 D;  3NEN A;  3T1Y L;  1D1I A;  1B9N A;  2EE1 A;  4GN5 A;  4V19 0;  4KD4 A;  4XT1 B;  2DNE A;  5JEA H;  3UDF A;  3MEH A;  4C3H B;  2WIN B;  3NHH A;  2EXD A;  1Q3L A;  2QEX A;  1A2T A;  3P1H A;  2ATW A;  1J9O A;  3CHB D;  2DNC A;  4FNF A;  1V1P A;  3OOC A;  4GOP C;  5IP9 H;  2F0F A;  2EJG C;  3K0Y A;  1SE4 A;  3RN5 A;  1HR0 Q;  4QJF A;  1QVG A;  1PH7 A;  3GTQ H;  4JVZ A;  3CC4 A;  2B2V C;  2EY2 A;  4K6L A;  4ME3 A;  3Q0A A;  2CQO A;  1MSG A;  3QWN A;  1YIJ A;  2L55 A;  4KJN A;  3D4D A;  1VQK A;  5A35 A;  4KD3 A;  2F0O A;  2X6G A;  1ILQ A;  1XMO Q;  4B3S L;  3S1Q H;  1O7Y A;  5DM6 3;  1EFI D;  2RDF A;  4KLK A;  1HFG A;  2R92 G;  2IPK D;  2B2Y A;  4DV4 Q;  4YWK A;  3HOY G;  2RVL A;  1AZQ A;  2MO1 A;  4A3L G;  4LF5 Q;  2GVB A;  1KRS A;  3PO3 H;  3GD7 A;  1LLR D;  4EX5 A;  2D2C C;  3R3O A;  3R2T A;  2MQH A;  5CV6 A;  3J80 i;  5E1F A;  2R92 B;  1YVC A;  1DGS A;  3HOY B;  3GQB A;  3GV6 A;  2A6E D;  1CA6 A;  1SNC A;  3I72 A;  2XSC A;  3DWA A;  5IYB H;  1RIP A;  3NP8 A;  1B1Z A;  4IZ8 A;  3FVQ A;  4A3C H;  1WTR A;  5BR8 L;  2NUC A;  3K7A H;  3GTJ H;  3J7A F;  3CP0 A;  4HSV A;  1WTO A;  1C9O A;  4KMU C;  1XWE A;  4DF7 A;  1FJG Q;  3HG9 A;  2UXD Q;  5M3F G;  2EYF A;  4ODG A;  1TWC B;  3SDZ A;  3V96 A;  1W6K A;  1JOK A;  2FXQ A;  3H3V H;  4WFN 3;  1DJR D;  1IBK Q;  2SNS A;  4DR2 L;  1YHQ A;  1K73 C;  2E2J B;  3K58 A;  4KHP Q;  3NTK A;  1A2U A;  2VY3 A;  3IFD A;  3J80 L;  2JQO A;  4HIM A;  1KD1 C;  1UEB A;  4HCS A;  1XPO A;  5M3F B;  2F0I A;  4E6I A;  5JJZ A;  3KK7 A;  4JK1 C;  4RKB A;  3UI2 A;  3H3V I;  3HFZ B;  3S17 B;  3Q8D A;  4A3J H;  4JI3 Q;  5IIF A;  2JP1 A;  5CV8 A;  3TN2 A;  3TP8 A;  3GTO H;  3OW2 A;  4P73 A;  1DON A;  4YCV A;  2A69 C;  5FLM G;  4FDB A;  1SYC A;  3NBH B;  3I8Z A;  4ZQ3 A;  1GUT A;  1PLF A;  3I2Z A;  2IWH A;  3C46 A;  1LTS D;  4HN7 A;  1UWV A;  5FK9 C;  2PI2 A;  2ICI A;  3TZD A;  1K83 B;  3HEJ A;  4XQN A;  4BBR G;  2QGQ A;  1ZXT A;  2OQ0 A;  3JAM E;  1QZG A;  4BY7 H;  3FPP A;  3EA6 A;  1U4L A;  1QNK A;  4LFC L;  2K5Q A;  1STH A;  5KNC A;  1DD2 A;  2X6L A;  1H95 A;  3HRZ C;  5IGF A;  5LMU L;  2UXB L;  2YTV A;  2R7D A;  1HZB A;  3FKI G;  4C1N I;  4RWS C;  4BBR B;  5C44 H;  2K14 A;  5GRO A;  2UXC L;  1G8Z D;  3KF8 B;  2DY7 A;  5CR3 A;  1IL2 A;  1TVX A;  2JSO A;  3W1G A;  1D2B A;  1S4Z A;  1EOT A;  1I4X A;  2Z9H A;  3NTI A;  4ULL A;  2K28 A;  1AN8 A;  3VR2 A;  1TT2 A;  1GVP A;  3FKI B;  3WOE A;  4YWL A;  2WB1 E;  3U4V A;  4XIG S;  1I4R A;  5T1I A;  5K5P A;  4R8I A;  2A69 D;  4PMW A;  4PV1 C;  2RQX A;  4HJA A;  1B70 B;  1WCM G;  3OPO A;  1HFN A;  1ESF A;  4DR7 L;  4FF3 A;  4X3U A;  3GV3 A;  2A68 D;  2Q8I B;  1N33 L;  2L0C A;  2K5V A;  3CC2 A;  5C0X J;  1I6H H;  1NY4 A;  2B2T C;  3BZD B;  3C1E A;  1JIC A;  4KKT A;  4BY1 G;  2K32 A;  2E76 C;  4CKB A;  3PGZ A;  1WCM B;  4I65 A;  3SE0 A;  1QNU A;  3H09 A;  3E9H A;  4TRD A;  3AYH B;  5ELE A;  2SEB D;  3AB9 A;  5CGK A;  2NVT H;  1PH6 A;  4X66 L;  5IOD A;  3AEV A;  1VS0 A;  2M2L A;  3GTL B;  4BY1 B;  1GXD C;  4CDE C;  3PO3 G;  2DN8 A;  3VR6 A;  4K8I A;  4DFA A;  4X64 Q;  2G9D A;  1LT4 D;  5LHY 1;  3TRZ A;  2DY8 A;  5TSS A;  2XIW A;  4OO1 H;  2AHO B;  4IAL A;  3S1Q B;  5A2Q E;  3UE1 A;  4IQZ A;  4C2M H;  3TBI B;  4B08 A;  2A19 A;  4LMQ D;  1BNZ A;  3O13 A;  1HUM A;  3J7Z C;  1PH2 A;  3FEW X;  3TP7 A;  3TP5 A;  1G91 A;  2JA5 H;  4JBK A;  1EY4 A;  1HHV A;  3M3Y H;  1K3B C;  2XWJ B;  4KV6 A;  3PO3 B;  4N9P A;  1VQD A;  2OCE A;  5ELN A;  1N32 Q;  1LTB D;  3RZD H;  1ICW A;  4OO1 I;  5CV5 A;  1GD7 A;  1NTG A;  1KIX A;  1SE8 A;  1FGU A;  1B3A A;  2DGY A;  2K6A A;  1A3U A;  3HKZ E;  3NPP A;  4H44 C;  2F0Q A;  4IOC A;  4ZRZ A;  4KY5 A;  4A3C G;  1ENF A;  4DV1 L;  4UP7 A;  3PUV A;  1MIU A;  1QVF A;  4U68 A;  2X69 A;  2JE6 I;  4QIW B;  4A3E H;  1ET9 A;  3KFU A;  4L63 B;  2PZT A;  1IZ6 A;  2ZXO A;  2B8G A;  1CSP A;  2FHT A;  3QOJ A;  4K14 A;  2E2I H;  1KLG D;  4HJ8 A;  1JE4 A;  2IX1 A;  3K7A B;  3JAM i;  3GTJ B;  1LTG D;  4G4K A;  1PV4 A;  1NR2 A;  1AP0 A;  2NBF A;  1GKH A;  1L1O A;  4Y7N H;  2YYZ A;  4ZKB B;  1V8Q A;  2N8N A;  1EQV A;  3PIO 3;  2RSO A;  4HJ7 A;  4FXG C;  4TQU S;  5FOB B;  2E2D C;  1EZ8 A;  1IYU A;  4WOR A;  4JI1 L;  4JOI A;  4MHE A;  4R9W A;  2VUM H;  4JI4 Q;  3NQT A;  3U4Z A;  4X65 L;  2E75 C;  1MJE A;  1ENC A;  3GTO B;  3HOZ H;  1XNR Q;  3K5M A;  5J1Z A;  2WAQ E;  3STB C;  3IFT A;  4MNO A;  2Z6K C;  4J6H A;  2Z1C A;  4DR3 L;  3RUZ A;  1GUN A;  3L2P A;  1V43 A;  1H9M A;  5ELD A;  5CBA E;  1IKL A;  4DV5 Q;  2PYK A;  4J15 A;  2UUA L;  4DR5 Q;  4IUU A;  2EY6 A;  4LUV A;  4UDU C;  4FO2 A;  3F2D A;  1Q8I A;  1NJI C;  3A74 A;  2NVQ B;  4B3T L;  1QUQ B;  1PH8 A;  5CC4 A;  2HT1 A;  5IT9 c;  5I6W A;  4DR6 L;  2BOS A;  3M7N A;  2XGT A;  4DAY B;  1LV9 A;  1B4O A;  5FO8 B;  2O2L D;  5DEH A;  3P75 A;  3LWU A;  3S1M B;  2F4I A;  2RBM A;  4ZUI A;  4GS3 A;  1QB5 D;  4Q5V A;  5C4X G;  1TR5 A;  1RTO A;  5CV7 A;  3STB D;  3HGB A;  3BYT B;  4J1M A;  5JAV A;  3MA2 B;  2VQE Q;  4B3R Q;  4JI8 L;  3S1N B;  1W2B A;  5K36 H;  3E9I A;  4GNX B;  1IHZ A;  1J5E L;  3WDN A;  3KDF B;  1LAB A;  2XRS D;  4FF1 A;  3GTP H;  1YNJ C;  2C9O A;  3ND8 A;  5AJ3 L;  1LAC A;  3DXJ C;  2VQF L;  1EZ6 A;  3VYR A;  5C4X B;  4F7X A;  4IO9 A;  2R93 H;  3N52 A;  2RHQ B;  2O4X A;  2EYP A;  1CHP D;  4F87 A;  2NVT B;  3I4O A;  1HH2 P;  5KRU A;  4R4O A;  4ID6 A;  4FF2 A;  3W3A A;  4FXD A;  1Y1W H;  2TMP A;  1TKW B;  3Q22 A;  4DXF A;  4H0L C;  1C7Y A;  5IYD H;  4C2M B;  5EJW A;  4DNR B;  5KND A;  1Y8O B;  1S40 A;  3J7A V;  1YZ6 A;  1Z47 A;  1PTO H;  2F4V L;  4DR4 Q;  1HA5 A;  1JJC B;  5CV9 A;  2I5H A;  1EY8 A;  4NKL A;  4CHT B;  3CCJ A;  3R8B A;  1MSH A;  4HCE A;  1EIG A;  4O2D A;  3CCU A;  1ESR A;  1W3S A;  5EGT A;  3T53 B;  2L12 A;  4HR7 B;  1CM9 A;  4CBV A;  2BH2 A;  3C2P A;  3CKI B;  1A3V A;  1F9Q A;  4XT3 B;  1QWY A;  1I94 L;  4POG A;  1P16 A;  1MBY A;  3S1R H;  4DK3 C;  1EQT A;  3DWP A;  2IJ0 A;  1A8V A;  2VB3 X;  1STE A;  2DJF C;  3HS0 C;  1S5F D;  4ZLT F;  3H0G H;  1KDC A;  4K8J A;  5GAD C;  3BVM A;  1AW7 A;  3E0J A;  4JI7 L;  2VL6 A;  1GHJ A;  1EYC A;  4N9T A;  4RH6 A;  1KRT A;  5FLX c;  4OWW B;  2K7V A;  4JYA L;  1STA A;  3A7A B;  4IUT A;  1YBY A;  4DR1 L;  1I4H A;  4DK6 C;  1NNX A;  2NZ1 D;  5E7N A;  4GOP A;  4JI2 Q;  3D31 A;  1SLJ A;  3CCV A;  1UNS A;  4K5X A;  4BBS H;  1LTR D;  2PQA A;  4G7H C;  5C3W A;  5LMN L;  2UU9 L;  1HJP A;  2UUB L;  2B2V A;  2YU9 H;  4B9W A;  3E5S A;  1DYQ A;  4MTN A;  3S2D H;  1F2M A;  2PO4 A;  4ZCK A;  4LF6 L;  3OTO L;  2XN9 C;  2JEB I;  4XYQ A;  3TSS A;  1VMC A;  2PZW A;  3C1F A;  4IPC A;  1HNW L;  4JC0 A;  4XQQ A;  1SMX A;  5GAH C;  3WWV A;  1X3E A;  2ENB A;  4NXN L;  1ILP A;  1DOK A;  3SHL A;  1XMQ L;  4H02 A;  5ELF A;  4IN3 A;  1KDB A;  1JCK B;  1S3O A;  4GKJ L;  2V1C C;  5FKA C;  1EY5 A;  2NWG A;  4JW0 A;  4DUZ Q;  2NVY B;  3NTH A;  1F2Y A;  2KED A;  1V1O A;  1Z6H A;  5E4W C;  3IRB A;  4UY8 C;  2JA6 H; 
#chains in the Genus database with same CATH homology
 3RZO H;  3GD7 A;  1OXX K;  4EX5 A;  2K52 A;  3SGI A;  4XTC S;  3KF6 B;  2MQH A;  4QIW E;  1X6O A;  3KYH C;  3CXC A;  5C3E G;  5M5Y H;  1PH3 A;  3M4O H;  5K36 G;  4YY3 Q;  3J80 i;  4OO1 G;  3L7Z C;  2K75 A;  1YVC A;  1BKB A;  1DGS A;  2E8G A;  4C3J H;  4A3M H;  4NXM Q;  1J5E Q;  1MKH A;  4JV5 Q;  2Y0S G;  1QVC A;  1TXY A;  4TVA B;  1YJ9 A;  2JA5 G;  3LGJ A;  1CKN B;  4DV3 Q;  4A3F H;  1HNZ Q;  2LSS A;  3E0E A;  5IYB H;  2B63 H;  1RIP A;  4GLA C;  3L0O A;  2D0O A;  3MXN B;  2Q2U A;  4LWC A;  4A3C H;  4Y52 H;  5BR8 L;  1BBU A;  2Q2I A;  3A5Z B;  3K7A H;  3GTJ H;  4AQY Q;  1PH5 A;  1LYL A;  3FHW A;  3CP0 A;  5HGQ A;  1Y14 B;  1Y1W G;  4LFB L;  1C9O A;  5IP7 G;  2N3S A;  1FJG Q;  1A63 A;  1E24 A;  2UXD Q;  3PO3 H;  5M3F G;  2OTJ A;  3GTG H;  4A3E G;  2NN6 G;  5IYD G;  3S2H H;  3HOU H;  5GAG C;  3S16 H;  5M5X H;  2FXQ A;  4A3K H;  2E5L L;  3H3V H;  1IBK Q;  1EIY B;  4JI6 Q;  3PIP A;  4AYB G;  4DR2 L;  1YHQ A;  1K73 C;  3PCO B;  2HIV A;  4DV0 Q;  1LM0 A;  4A3G H;  4KHP Q;  3EBE A;  3ULL A;  4X62 Q;  4JI5 Q;  2VY3 A;  2F4V Q;  2JQO A;  1X65 A;  4HIM A;  1KD1 C;  1UEB A;  1HNX Q;  1XPO A;  2MNA A;  3CCR A;  2VS1 A;  2JA7 H;  3HFZ B;  3H3V I;  2AWO A;  2GVA A;  2ASB A;  1Q8K A;  2CWA A;  3Q8D A;  4A3J H;  4JI3 Q;  2JEA I;  1VQE A;  3EN2 A;  3GTO H;  3OW2 A;  1G6P A;  4P73 A;  4AH6 A;  2K5N A;  4YCV A;  3U50 C;  1R9T H;  2NVX H;  1VQB A;  3UDI A;  4GLV B;  1Z9F A;  2VW9 A;  3AFP A;  1SRU A;  5FLM G;  1XNQ L;  4FDB A;  3NBH B;  1SFO H;  3GDE A;  3I2Z A;  1J6Q A;  1N8R C;  1X54 A;  2WP8 J;  1PH1 A;  1UWV A;  3KOJ A;  2LXK A;  2A8V A;  3J7A 5;  3PIO A;  2PI2 A;  2VNU D;  3TQY A;  3K7U C;  1KXL A;  2R7Z H;  4JI1 Q;  4POF A;  2VUM G;  3G71 A;  3HOW G;  4BBR G;  2QGQ A;  2OQ0 A;  4EQ5 A;  3NEL A;  2MFI A;  4R4I A;  5FJ8 G;  1QZG A;  4A3I H;  4BY7 H;  1IBM Q;  3HOZ G;  4IFD J;  2I5L X;  4LF7 Q;  1U5K A;  5JJI A;  4LFC L;  3UE0 A;  3G6E A;  3F2C A;  4YCW A;  2PNH A;  1X3F A;  1H95 A;  5LMU L;  1JE5 A;  2UXB L;  4LF9 Q;  2YTV A;  1XTD A;  3CCL A;  2R7D A;  1HZB A;  3FKI G;  5IY0 A;  4JI2 L;  5IWA Q;  4JYA Q;  3CAM A;  5C44 H;  1CKO A;  2K14 A;  4PG3 A;  1L1O B;  5GRO A;  4DR5 L;  4B3M Q;  3B6Y A;  3UDG A;  4A3D G;  3KF8 B;  1IL2 A;  1Q1E A;  3JC6 6;  1GM5 A;  3CD6 A;  3W5O A;  1LTL A;  4LUO A;  3W1G A;  5H1S E;  4HIK A;  4DV6 Q;  4BBS G;  1PYB A;  3K0X A;  1BBW A;  3PV0 A;  3HOX G;  1KQS A;  2UUA Q;  2ZM6 L;  2HHH Q;  2Z0S A;  1GVP A;  1YHB A;  4MZ9 A;  3I4M G;  1HR0 L;  2UUB Q;  4YWL A;  2WB1 E;  1VQF A;  1L2F A;  3U4V A;  3KF6 A;  3PUY A;  4XIG S;  3CW2 C;  3PF4 A;  4OWX B;  4PMW A;  4HJA A;  1XPU A;  1B70 B;  1WCM G;  4B3T Q;  4DV7 Q;  1UE6 A;  1E1O A;  1OTC A;  4DR7 L;  2NZO A;  4DR6 Q;  3ER0 A;  4YHH Q;  2NVY H;  1U0L A;  1HNW Q;  1UE7 A;  3PUX A;  4A76 A;  4P75 A;  1WFQ A;  2L15 A;  1G51 A;  5J3B A;  2BA1 A;  1N33 L;  4IPG A;  3ULP A;  2K5V A;  3CC2 A;  4JI0 L;  4NXN Q;  3PO2 G;  4APV A;  4BXX H;  5C0X J;  1XMO L;  1CKN A;  3FP9 A;  1I6H H;  1NY4 A;  3F1Z A;  4L5Q A;  4BY1 G;  4L5T A;  3RLN A;  4DUZ L;  3PGZ A;  4R1J A;  1Y1V H;  4DNI A;  1VQA A;  2C35 B;  5GAE C;  1YNX A;  4DV4 L;  1K9M C;  4A4I A;  1VQ6 A;  3E9H A;  3AYH B;  2CFM A;  4LF5 L;  4IFD I;  2NVT H;  4OX9 Q;  1EUJ A;  4LF8 Q;  1PH6 A;  3HOV H;  4JI8 Q;  4X66 L;  2Q2H A;  1VCI A;  3AEV A;  2IHE A;  1VS0 A;  2JA6 G;  3PO3 G;  1JJG A;  4JBJ A;  4KHZ A;  4YY3 L;  4WJ4 A;  4LF4 L;  4X64 Q;  1VQ9 A;  4PZ6 A;  1PH4 A;  5C3E H;  3TRZ A;  4DV2 L;  1IBL L;  2AHO B;  5AJ3 Q;  2JK8 A;  4NXM L;  2R93 G;  4LFA Q;  2VQF Q;  3UE1 A;  2CCZ A;  4C2M H;  2VZA A;  4JV5 L;  1HZA A;  2A19 A;  4A3B G;  4HIO A;  3J7Z C;  3CPW A;  4RMF A;  4UPA A;  4DV3 L;  5IYC G;  4A3M G;  1PH2 A;  1HNZ L;  1TWH H;  3W1B A;  2JA5 H;  4JBK A;  1AH9 A;  3M3Y H;  2KCT A;  2N49 A;  1MJC A;  3CCS A;  1N34 Q;  3I56 A;  1VQD A;  3GTM H;  2OCE A;  5ELN A;  1N32 Q;  3RZD H;  4O0A A;  4A3F G;  1GD7 A;  2H5X A;  1NTG A;  1VQC A;  4OO1 I;  1KIX A;  1SE8 A;  1FGU A;  3M9B A;  2DGY A;  3HKZ E;  1JT8 A;  1PHJ A;  4HJ5 A;  4AQY L;  1VQN A;  1FVI A;  4C3I H;  3I55 A;  4IOC A;  1CUK A;  4A3C G;  4DV1 L;  4UP7 A;  4DR4 L;  3PUV A;  3CCQ A;  1MIU A;  2UXD L;  1QVF A;  3CME A;  1B8A A;  3J80 c;  5C0X I;  2OWO A;  3I4N G;  1I50 H;  2JE6 I;  4A3E H;  1IBK L;  5IE8 A;  3KFU A;  4JI6 L;  3M4Q A;  4LFB Q;  3S17 H;  2RHS B;  2LXJ A;  4IOA A;  3T1H Q;  1TWG H;  4KHP L;  1IZ6 A;  2VUM H;  3HOU G;  1AE3 A;  1D8L A;  1CSP A;  4A3K G;  2E2I H;  2JA8 H;  4HJ8 A;  2IX1 A;  3CPF A;  4OON A;  1EYG A;  3JAM i;  1GO3 E;  1AE2 A;  2CKZ B;  1HNX L;  1WI5 A;  5M3M H;  1K3R A;  1YIT A;  2NN6 I;  1PV4 A;  1XJV A;  1N36 Q;  4JI3 L;  4DUY Q;  2E2H H;  1SN8 A;  1GKH A;  1K83 H;  1M90 C;  4P74 A;  5DLQ E;  2YTX A;  4JBM A;  1I94 Q;  1L1O A;  4Y7N H;  1B7Y B;  2YYZ A;  2KEN A;  1NMF A;  2N8N A;  4L5R C;  4DPG A;  2RCN A;  4HJ7 A;  2YTY A;  4TQU S;  1E7Z A;  3H0G G;  4KI0 A;  1D7Q A;  1WOC A;  4LF9 L;  4JI1 L;  2WFW A;  4C3H H;  4QQB X;  3HKS A;  4JOI A;  2IT1 A;  1A62 A;  1PFS A;  4UP9 A;  3D0F A;  4QY7 A;  2KCM A;  3M85 A;  1VQ5 A;  2UUC Q;  1L1O C;  4JI4 Q;  3U4Z A;  3A0J A;  3ZJY C;  4IJL A;  4X65 L;  5LMN W;  2B29 A;  1IBM L;  5JJK A;  4JI7 Q;  1KHI A;  1MJE A;  1OXT A;  5EAY A;  3KLW A;  2A1A A;  3PSI A;  3HOZ H;  1VQI A;  3K8A A;  1XNR Q;  3S24 A;  1KC8 C;  3A5U A;  1PH9 A;  3T1Y Q;  2WAQ E;  3PUZ A;  3STB C;  1CKM A;  3AFQ A;  3JAM c;  1CSQ A;  2OQK A;  4DR1 Q;  2OTL A;  4MNO A;  5IWA L;  4K0K L;  1Q1B A;  2EIF A;  4JOI C;  2Z6K C;  4PZ8 A;  3FKI H;  5JEA G;  1XPR A;  4B3M L;  2D62 A;  1YJW A;  4DR3 L;  5JJL A;  3DLL A;  4A3D H;  2R6G A;  3TEH B;  1E1T A;  3ULJ A;  3L2P A;  1V43 A;  4LW1 A;  2UXB Q;  4X6A H;  1TWF H;  1EWI A;  2EQS A;  5LMN Q;  4DV6 L;  4DAM A;  1VQ8 A;  2UU9 Q;  4DV5 Q;  4J15 A;  1NMG A;  5GQO A;  4GKK Q;  2UUA L;  4DR5 Q;  2HHH L;  2UXC Q;  4WJ3 M;  2MO0 A;  5IP9 G;  4LUV A;  3OTO Q;  1YJN A;  4LF6 Q;  1OXV A;  4RG1 A;  1KL9 A;  1K0R A;  3F2D A;  5HY6 A;  1NJI C;  3A74 A;  4L5S A;  4B3T L;  3G4S A;  1QUQ B;  2BH8 A;  3K81 C;  3CMA A;  1FL0 A;  1PH8 A;  2HT1 A;  1KAW A;  1WCM H;  2AWN A;  5IT9 c;  4DR6 L;  1X9N A;  2ZTD A;  3M7N A;  4R4C A;  2ZJP A;  1XMQ Q;  2XGT A;  3K80 C;  4DAY B;  1IXR A;  3AQQ A;  1Q12 A;  4HJ9 A;  2GN5 A;  4GKJ Q;  4P72 A;  5M5W H;  1VQH A;  4GOP B;  1Q82 C;  2ID0 A;  1E22 A;  2R92 H;  4IFD G;  3RNU A;  3HOY H;  2PMZ E;  3GTL H;  2PQA B;  4GS3 A;  2WB1 G;  3BZK A;  4BY1 H;  4A93 H;  4B3S Q;  4BXX G;  4A3L H;  1N33 Q;  2QA4 A;  2AMC B;  4JI0 Q;  2NZH A;  4A75 A;  2IHF A;  5C4X G;  3STB D;  4OX9 L;  4LF8 L;  2VQE Q;  4B3R Q;  4JI8 L;  3PUW A;  3OYY A;  1VQJ A;  3H15 A;  1VQP A;  1W2B A;  3E9I A;  4R4T A;  4GNX B;  3U58 A;  1ASZ A;  2HQL A;  3HOV G;  1J5E L;  1O7I A;  1YHA A;  3KDF B;  4X64 L;  1UE1 A;  1Q81 C;  2KHI A;  1EFW A;  3S15 H;  2B3G A;  3GTP H;  2BA0 A;  3CCM A;  2I0Q A;  1YI2 A;  5AJ3 L;  1VQM A;  2N78 A;  4X66 Q;  1WYD A;  2VQF L;  4LFA L;  4JG2 A;  4IO9 A;  1LUZ A;  2D0P A;  2HIX A;  1JJ2 A;  1JB7 A;  2R93 H;  5C4J H;  4QGU A;  2RHQ B;  3UDX A;  4LF4 Q;  4JCV E;  3DM3 A;  4QL5 A;  4A3B H;  1T9H A;  3MEF A;  1TWC H;  2ZTC A;  3RLF A;  4DV2 Q;  1IBL Q;  1A0I A;  1VQG A;  4PZ7 A;  3CQZ H;  5IYB G;  5IYC H;  3I4O A;  2DUD A;  1N34 L;  1VQ7 A;  2B63 G;  1HH2 P;  2E2J H;  1N32 L;  4R4O A;  4IPD A;  1UE5 A;  4AYB E;  2F3I A;  3BU2 A;  3CC7 A;  1FJG L;  1EQQ A;  1Y1W H;  3GTK H;  3EIV A;  4GLX A;  3ERS X;  5IP7 H;  1VQO A;  3BZC A;  5BR8 Q;  5C0X G;  4YWM A;  5M3F H;  4UP8 A;  2Q2T A;  1C7Y A;  1WJJ A;  1NBW A;  5IYD H;  2ZJQ A;  2KBN A;  4DV0 L;  3RN2 A;  1SR3 A;  4HID A;  1YEZ A;  4X62 L;  1OXU A;  1S40 A;  1P8L A;  4LNQ A;  1YZ6 A;  4P71 A;  1Z47 A;  4JI5 L;  3CF5 A;  1M1K C;  2F4V L;  4OXP A;  4DV1 Q;  3T1H L;  2KHJ A;  2E5L Q;  3I4N H;  1JJC B;  3S14 H;  4DR4 Q;  4A3G G;  2I5H A;  4DR2 Q;  1VQL A;  1Q86 C;  2K4K A;  2YV5 A;  3HKZ G;  3CCJ A;  4O2D A;  1I3Q H;  2RF4 A;  3CCU A;  1W3S A;  1EIF A;  1N36 L;  4BA2 I;  2JA8 G;  3I7F A;  2JA7 G;  5JEA J;  2BH2 A;  4DUY L;  3RR5 A;  2XTI A;  4A3J G;  1PA6 A;  1JMC A;  5M3M G;  1V9P A;  3TS0 A;  1X3G A;  1I94 L;  1ASY A;  2PI2 E;  4POG A;  4IPH A;  2IY5 B;  5FLM H;  1P16 A;  1EQR A;  2JJQ A;  1X56 A;  3S1R H;  4DK3 C;  4IJH A;  1Q46 A;  1PYS B;  2ZTE A;  1A8V A;  4JBW A;  4AIM A;  3BJU A;  2Z6K A;  1OXS C;  3J81 i;  1XNQ Q;  3KJO A;  5ELO A;  3H0G H;  1NE3 A;  3HOW H;  2CWP A;  4BBR H;  1VQ4 A;  2R7Z G;  3VDY A;  2UXC L;  5FJ8 H;  4LF7 L;  5GAD C;  3RLO A;  2F52 A;  2UUC L;  4JI4 L;  4A3I G;  4BY7 G;  1BVS A;  1X55 A;  1QUQ A;  4NPS A;  2VL6 A;  4BA1 I;  1K8G A;  4JI7 L;  4OWW B;  5FLX c;  1KRT A;  3CCE A;  4JYA L;  4GN3 B;  1XNR L;  3G48 A;  3NEN A;  4LFC Q;  3T1Y L;  3ICE A;  1YBY A;  3GO5 A;  4X65 Q;  4DR1 L;  4DK6 C;  3F2B A;  5LMU Q;  5E7N A;  4GN5 A;  3KJP A;  4JI2 Q;  4GOP A;  1HR0 W;  5C44 G;  3F8T A;  3NEM A;  3D31 A;  1SLJ A;  3CCV A;  3UDF A;  1C0A A;  2K50 A;  4BBS H;  2PQA A;  1G29 1;  4YCU A;  4DKA C;  2EXD A;  3HOX H;  5LMN L;  3PF5 A;  2NVQ H;  2QEX A;  2UU9 L;  4LUZ A;  1HJP A;  4DV5 L;  2UUB L;  4K0K Q;  2YU9 H;  3TS2 A;  2ATW A;  4GKK L;  4MTN A;  1K8A C;  3I4M H;  3S2D H;  4DR3 Q;  2ZJR A;  2K5H A;  4LF6 L;  3OTO L;  1EOV A;  1SRO A;  4DV7 L;  1I5F A;  2JEB I;  3J81 c;  2ZM6 Q;  2ES2 A;  4GOP C;  3J81 j;  2WAQ G;  5IP9 H;  4IPC A;  4GNX A;  4YHH L;  3RN5 A;  1HR0 Q;  1HNW L;  4JC0 A;  1SMX A;  4QJF A;  1QVG A;  1PH7 A;  3GTQ H;  3KDF A;  3TRE A;  3S1M H;  2I5M X;  5GAH C;  2ALY B;  3WWV A;  1X3E A;  1TWA H;  1E3P A;  4NXN L;  3CC4 A;  4ME3 A;  1XMQ L;  4H02 A;  1Q7Y C;  2CQO A;  4GN4 B;  4ALP A;  4R4Q A;  4DR7 Q;  3PO2 H;  1YIJ A;  1QZH A;  1S3O A;  4GKJ L;  2V1C C;  1VQK A;  1RL2 A;  1IYJ B;  1HZC A;  4OWT B;  1HZ9 A;  3M4P A;  3S1N H;  4GNX C;  2IX0 A;  1XMO Q;  1Y1V G;  4B3S L;  3S1Q H;  2Y0S E;  2JA9 A;  4DUZ Q;  4KLK A;  2R92 G;  4NB3 A;  2R7F A;  4DV4 Q;  1S72 A;  4YWK A;  1N9W A;  3HOY G;  1PVO A;  4A93 G;  2AKW B;  2MO1 A;  5C4X H;  2VQE L;  4UY8 C;  4A3L G;  3IRB A;  1L0W A;  4LF5 Q;  4B3R L;  2JA6 H;  2GVB A;  1KRS A;  1V1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...