4GNXB

Structure of u. maydis replication protein a bound to ssdna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
122
Chain Sequence
NTLRPVTIRQILNAEQPHPDAEFILDGAELGQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDASEIRNNVYVRVLGTLKSFQNRRSISSGHMRPVIDYNEVMFHRLEAVHAHLQVTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structure of
rcsb
source organism Ustilago maydis
molecule tags Dna binding protein/dna
total genus 31
structure length 122
sequence length 130
chains with identical sequence Y
ec nomenclature
pdb deposition date 2012-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gnxB00
2RCNA 3KJPA 4OXPA 2JA8G 3TRZA 2N3SA 3MEFA 3CMEA 1S3OA 4POFA 1SR3A 2R7ZH 4GOPC 4L5RC 4DR7Q 2KBNA 4POGA 3E0EA 1Y14B 4A3IH 2ASBA 5GQOA 4DV7Q 4A3BG 3E9HA 3CQZH 1I5FA 3PIPA 1PH7A 1KQSA 1XPRA 1HNXL 3S1NH 2E5LL 4DV3L 1Q1BA 2PI2A 4X66L 2K5VA 3CXCA 1EIFA 3PUXA 1IL2A 4O2DA 2VZAA 3HFZB 4DAMA 1SE8A 2VUMG 3HKSA 3M4PA 3PIOA 4B3SQ 1X54A 3EN2A 1UE1A 1L0WA 5GAEC 5LMNQ 2QGQA 4OWWB 4BBRG 4JI6L 1D7QA 1CKOA 2JA8H 2ALYB 1N34L 2OTLA 4KHZA 4GLXA 3F1ZA 4TVAB 3GTQH 2NVYH 4MNOA 2F3IA 3IRBA 4IJLA 1XPOA 1N8RC 5M5YH 2Z6KA 3H3VI 2VNUD 1NMFA 2HIVA 3D31A 3ULLA 3A5UA 1IZ6A 4AYBE 3EIVA 5BR8L 3J81c 2OQ0A 4LF4L 4AH6A 4HJ9A 3AYHB 1FVIA 2ES2A 2NVQH 1NTGA 2DUDA 3CW2C 2VUMH 4NXML 4A3JG 4GN5A 4L5SA 2Q2IA 2V1CC 2VL6A 3AFQA 3K80C 3RLNA 3NBHB 4DPGA 3OTOQ 1IBKQ 4KHPQ 4DAYB 4PZ6A 2HIXA 4UP9A 4BBRH 3G4SA 3CC2A 1KHIA 2GVBA 2K4KA 4DR7L 3GO5A 2YYZA 4J15A 5H1SE 4DV7L 1R9TH 4DR3Q 1IBMQ 4JI7Q 1Z47A 4APVA 3I4MG 1E1OA 3GTMH 4HIMA 2I5HA 2KENA 2CQOA 4LUZA 4IJHA 4FDBA 1E24A 1PH3A 2EIFA 4B3SL 4A3JH 2JA9A 1Y1VG 2Y0SG 1EQRA 5M3MG 1PVOA 5LMNL 3MXNB 3TREA 1XNQQ 3TS2A 3GDEA 1K3RA 2JE6I 1JMCA 1UEBA 3ZJYC 3L2PA 4IOAA 1TWCH 1Q7YC 5IP7G 1PHJA 4JBJA 3OYYA 4JI4Q 1XPUA 1PYSB 2IX0A 2ZTCA 1NY4A 3JC66 4A3GG 3I56A 1Q1EA 1H95A 2UUAQ 4JOIA 2MNAA 5HY6A 2UU9Q 1Q8KA 1EWIA 5FJ8G 4JI0Q 3TS0A 3G48A 3T1HQ 2MQHA 4LF6Q 4QIWE 3W1GA 4QY7A 1VQNA 4ME3A 3M9BA 1Y1VH 1IBKL 4P73A 1Y1WH 4A93H 4KHPL 1V43A 2VS1A 1C9OA 2L15A 3A5ZB 4A3MH 3M3YH 3PO2G 4BA2I 3HOXG 5IP7H 1YJNA 2A1AA 1IBLQ 1O7IA 4DR3L 1IBML 1I94Q 3H0GG 4JI7L 3AEVA 3PUWA 4A3GH 3HKZE 3S1MH 1B70B 5JJIA 4KI0A 4UP8A 4LFCQ 4LUOA 2NN6I 3L0OA 5FJ8H 5LMNW 4JBMA 3UE1A 2JJQA 3AFPA 3PSIA 5FLMG 4A76A 1P16A 3J81j 1VQMA 1N36Q 2XTIA 3HOYH 4BBSG 3I2ZA 2E5LQ 1SRUA 5JJLA 1XNQL 1OXUA 1YHQA 3K0XA 1W2BA 1G6PA 3CAMA 2MFIA 4YCVA 4C3JH 2WFWA 1TWHH 2BA0A 3PO2H 4PG3A 3HOXH 1K83H 1LM0A 4JI4L 1VCIA 3CC4A 1YBYA 1X3EA 1SROA 5IT9c 3H0GH 4PZ7A 1XJVA 2UUAL 2IHEA 2YTYA 4P74A 2UU9L 1W3SA 4JI0L 5GAGC 1KL9A 1C0AA 1AE2A 3T1HL 4LF6L 1N32Q 1X56A 1X6OA 5FLMH 4HJ7A 2UUBL 4BXXG 2QA4A 4DR1Q 4TQUS 3K7AH 1Q12A 1CKMA 2KHJA 4DNIA 3I55A 4HJ8A 1M1KC 1PH2A 1CUKA 3T1YQ 3W1BA 3J7ZC 3CCQA 4XTCS 4GNXC 1PH4A 3KF6B 5IYCG 1IBLL 3U58A 2B63G 3S17H 4JYAQ 2D0OA 2MO0A 4QGUA 1I94L 4GLAC 2ATWA 3HOVH 3RZOH 3S2DH 2WP8J 1X3FA 4LFCL 4DV6Q 1J5EQ 1OXSC 1P8LA 2DGYA 4PMWA 5K36G 4JI1Q 4JV5Q 2IX1A 3M7NA 2CWAA 3H3VH 1UE7A 4A4IA 3SGIA 2K75A 4BY7G 1KAWA 3CCSA 3M4QA 4RMFA 1L1OC 1SFOH 1PYBA 2HQLA 3K81C 1N36L 4A3DG 4OWTB 4R4CA 2H5XA 3RN2A 3I7FA 5LMUQ 2UUCQ 3K7UC 1J6QA 1CKNB 2BH2A 5IE8A 1JT8A 1IXRA 2B63H 2I0QA 5HGQA 4RG1A 1MJCA 2KCTA 1K0RA 2LSSA 5M5XH 2JA5G 2JEBI 1MKHA 4EX5A 4WJ4A 3BZCA 1N32L 1A62A 4JI8Q 3PUYA 3CC7A 1YJ9A 5C0XJ 4A3BH 1HNWQ 1WFQA 4DR1L 2VY3A 3FKIG 3A74A 3GTPH 3KDFB 3VDYA 4A3DH 3ERSX 4P72A 4B3ML 1BBUA 2HT1A 1HZAA 4R4QA 2QEXA 3F2DA 3T1YL 2UXDQ 4JYAL 4LF9Q 4YWMA 2WB1E 2VQEQ 1YITA 4K0KQ 3NEMA 1J5EL 4DV6L 1VQBA 1JJCB 3FP9A 2JA5H 4JI1L 1NJIC 5C4JH 4JV5L 2Z0SA 1PH8A 2Z6KC 3HOWG 2K5HA 1ASYA 5C4XG 1G51A 1YVCA 3OW2A 2CFMA 1OXVA 2NN6G 5C44G 4IPGA 4A3LG 4DR4Q 3FKIH 1QZGA 4A3KG 1E22A 2C35B 1NMGA 1X9NA 1XMOQ 5LMUL 2UUCL 1HZCA 4JC0A 1A63A 3UDFA 1B7YB 5C3EG 5IYDH 4C3HH 2EQSA 3CCUA 4KLKA 4GS3A 4AYBG 3A0JA 2FXQA 3KF6A 1OXTA 4LFAQ 1Q81C 4LF5Q 1JE5A 1FL0A 1VQJA 5C0XI 3G71A 3HOWH 3KF8B 4JI8L 1LYLA 4NPSA 1EOVA 5C4XH 1OTCA 2NZHA 4JG2A 4AIMA 1QVCA 3G6EA 1MIUA 2ZJPA 4JI3Q 1HNWL 3I4MH 4A3LH 1LTLA 1Z9FA 2YU9H 1YI2A 4DV2Q 4GOPB 4A3KH 4R4TA 3UE0A 2R7DA 2UXDL 3HOZG 2UUBQ 5C3EH 1GVPA 4LF9L 4X6AH 2N8NA 2VQEL 5M3MH 1CKNA 4JI5Q 4K0KL 2B3GA 5GAHC 1TWAH 1VQIA 2PMZE 3PUZA 4GKJQ 2JA7G 2HHHQ 2WAQE 1OXXK 2PI2E 4YHHQ 4DV1Q 1K9MC 3S14H 4JOIC 3I4OA 4YY3L 1TXYA 2PNHA 4A3EG 3CCRA 2PQAB 2F52A 4DR4L 3F2BA 5JEAG 5IYBG 1SN8A 1WCMG 1YHBA 3S1RH 1PH9A 2CCZA 2JEAI 4YWLA 1WYDA 1XMOL 3KDFA 1VQ4A 1CSQA 1YNXA 4BY1G 2RHSB 3HOZH 1M90C 4QL5A 1YEZA 2XGTA 5JEAJ 1KXLA 4Y52H 2E8GA 1U0LA 4LFAL 1GKHA 4HJAA 4LF5L 4IFDI 2Q2HA 2JA7H 3CCJA 4WJ3M 3DM3A 4LFBQ 4LUVA 2UXBQ 2ZJQA 4JBKA 3CPWA 4JI3L 1VQAA 3ER0A 4GN3B 4ALPA 4EQ5A 5IY0A 1KRSA 5IYBH 2ZTDA 1WCMH 2AWNA 4DV2L 2ZM6L 4OX9Q 2JA6G 3M4OH 3HKZG 2R93G 2ZTEA 4BBSH 2K5NA 4YCUA 1I6HH 1PFSA 4JI5L 1HZ9A 4HIDA 4HIOA 1PH6A 4NB3A 4IPDA 4B3MQ 2F4VQ 4DUYQ 2D0PA 3KLWA 2R92G 1N33Q 4GKJL 2MO1A 2E2IH 1QUQB 2N78A 2HHHL 1VQHA 4YHHL 2ID0A 5J3BA 4DV1L 5E7NA 1HR0Q 3PO3G 3FHWA 3TQYA 1EYGA 3UDXA 5DLQE 4GNXA 3EBEA 4P75A 1S40A 1DGSA 3E9IA 4LF7Q 1SLJA 3GD7A 4JCVE 4NXNQ 2AWOA 1HH2P 3PUVA 4A3IG 4DUZQ 3J7A5 2A8VA 4B3RQ 2GVAA 4GOPA 4BXXH 1S72A 2R93H 4OWXB 3JAMi 2LXKA 4P71A 1A8VA 4OO1I 1V9PA 2N49A 1RIPA 5AJ3Q 1JJGA 4LWCA 1Q82C 2K50A 1VQ6A 4LFBL 4IO9A 5IYCH 2UXBL 3CP0A 4B3TL 1XNRQ 3UDIA 3BU2A 3CCLA 3PO3H 5C0XG 1IYJB 3S1QH 3BJUA 1VQEA 3W5OA 4X64Q 1PV4A 1Q46A 2PQAA 3B6YA 1VQPA 4C3IH 3CCVA 4OX9L 3CD6A 3RNUA 4DR5Q 2VQFQ 1FJGQ 1AH9A 1QVGA 4BY7H 5JJKA 1LUZA 2AKWB 3STBC 2OQKA 2E2JH 3L7ZC 2F4VL 4DUYL 1VQLA 1K8GA 1N33L 1KD1C 1VQGA 2NVXH 2YTXA 1ASZA 4DR2Q 4YCWA 3BZKA 1HR0L 1NE3A 4H02A 5IWAQ 4JBWA 2R7FA 1YIJA 3S2HH 1CSPA 3KYHC 2CKZB 1HZBA 2K14A 1VS0A 3PCOB 4DV4Q 1RL2A 2E2HH 3J80c 4LF7L 1KIXA 4R1JA 2OWOA 4NXNL 1VQFA 2I5LX 2A19A 2YV5A 3AQQA 4GLVB 4YY3Q 1FGUA 4DUZL 1XMQQ 1EQQA 4R4OA 4B3RL 4GKKQ 2EXDA 2Y0SE 1VQCA 1L2FA 1XTDA 2D62A 3M85A 3GTJH 5AJ3L 2IHFA 2Q2UA 2I5MX 1XNRL 1U5KA 4DV0Q 1QVFA 1PH1A 2BH8A 1QUQA 4IFDG 1TWGH 1UE5A 1YHAA 4X64L 2K52A 1BKBA 1YZ6A 4O0AA 4IPCA 4UPAA 4JI2Q 3H15A 4AQYQ 4A3FG 4LF8Q 2WB1G 1B8AA 4GNXB 4QJFA 4IFDJ 2OCEA 5FLXc 4DR5L 2VQFL 1BVSA 1FJGL 3ULJA 3KOJA 5C44H 1HR0W 1V1QA 3S16H 3GTLH 2Q2TA 3KJOA 5ELOA 4A3CG 2NVTH 4MTNA 3PV0A 2R6GA 2ZM6Q 1GM5A 4UP7A 3GTGH 4DR2L 3WWVA 2KHIA 5IWAL 1HNZQ 1C7YA 1L1OB 2JK8A 1G291 5GADC 3NELA 1VQ5A 2UXCQ 3U50C 1Y1WG 4DR6Q 1QZHA 1YJWA 4DV4L 4A93G 5EAYA 4IPHA 4A3FH 3GTOH 4A3MG 1NBWA 4LNQA 2LXJA 1KRTA 3RLFA 4OO1G 1XMQL 2ZJRA 4R4IA 3TEHB 5IP9G 3I4NG 2OTJA 2BA1A 3PF5A 4GKKL 3JAMc 3LGJA 4A3CH 1T9HA 1TWFH 4UY8C 3J80i 3RN5A 1WI5A 4X62Q 1VQKA 4C2MH 1K73C 1N9WA 3UDGA 2AMCB 4IOCA 3CF5A 1PH5A 4XIGS 4DKAC 4DV0L 3RLOA 1E3PA 3OTOL 1K8AC 4OONA 1VQ8A 3HOYG 1MJEA 2YTVA 4QQBX 4JI2L 4L5QA 2NZOA 1E7ZA 3J81i 4AQYL 1VQ7A 4X65Q 3ICEA 3PF4A 1I3QH 2RF4A 3D0FA 4LF8L 4B3TQ 4DV5Q 4Y7NH 4A3EH 5IP9H 3I4NH 1X55A 2B29A 1VQ9A 4YWKA 3U4ZA 2WAQG 1SMXA 2RHQB 1HJPA 3U4VA 3CPFA 5M3FG 1JB7A 1UE6A 4BY1H 5GROA 3F2CA 2CWPA 1X65A 1I50H 1HNZL 1BBWA 1HNXQ 3K8AA 4BA1I 1E1TA 4DV3Q 2UXCL 2VW9A 1PA6A 3CCMA 4X66Q 4DR6L 2KCMA 3CMAA 3HOUG 2IY5B 3RR5A 2IT1A 5M5WH 1A0IA 5IYDG 1D8LA 4PZ8A 3KFUA 4MZ9A 1WJJA 3HOVG 3GTKH 4JI6Q 4L5TA 1N34Q 2AHOB 4DK6C 1Q86C 1GO3E 4X62L 2R7ZG 1KC8C 3PGZA 4GN4B 2JA6H 3DLLA 5M3FH 3CCEA 5ELNA 1EUJA 1WOCA 1JJ2A 1GD7A 1X3GA 4LW1A 3RZDH 1EIYB 3Q8DA 1EFWA 3S24A 1AE3A 2JQOA 5BR8Q 4A75A 1L1OA 3NENA 3STBD 1VQOA 4LF4Q 2R92H 4X65L 3HOUH 4HJ5A 3S15H 2GN5A 3F8TA 3ULPA 4NXMQ 4DK3C 4DV5L 1UWVA 1VQDA 4HIKA
chains in the Genus database with same CATH superfamily
3GV3A 4OXPA 2JA8G 3TRZA 3WOFA 1YNJD 2R7ZH 4L5RC 2KBNA 1Y14B 4A3IH 2JXMB 5EPJA 1KQSA 2X6LA 5KGUA 1I4XA 1F9PA 1Q1BA 2PI2A 3MVVA 2KUMA 2Z8LA 3PIOA 1X54A 1L0WA 4BBRG 4DK1A 4JI6L 1N34L 4HAEA 1IHZA 3DWAA 1EYDA 5D14A 3GTQH 1U9RA 4MNOA 2F3IA 3IRBA 1VF5C 1TWCB 2AQ3B 1AZQA 3H3VI 3CKIB 3A5UA 1IZ6A 1UAPA 2DNCA 1FVIA 3AYHB 4H7BA 2DUDA 1BF4A 3CW2C 4NXML 2Q2IA 3RLNA 3NHHA 1TY2A 5IT9L 4DAYB 1O80A 3G4SA 1GUOA 2K5QA 2K04A 1ILQA 3GO5A 4QCLA 2YYZA 4J15A 3M3YB 3IL8A 1R9TH 1NR4A 3I90A 5CV4A 4APVA 5I2XA 3I4MG 2K6AA 1EYCA 2NUCA 4QUCA 1B3AA 2WACA 4LUZA 4RKLA 1E24A 2EOTA 2FMMA 3KUPA 1PH3A 5IGCA 4A3JH 3VR4A 2A6HD 3NQIA 1EQRA 3TBIB 5LMNL 3TREA 3HGBA 2H1EA 2EYLA 3GDEA 3ITPA 4BWGB 1PHJA 3OYYA 2ZTCA 4JPBW 1H95A 1NY4A 1FD7D 4A3GG 1LT5D 2L55A 2UUAQ 4JOIA 3C2PA 2MNAA 1LT4D 2UU9Q 1Q8KA 5FJ8G 4JI0Q 5CBAE 3T1HQ 2A6HC 5E4WC 3C3LA 1A2TA 4ME3A 3M9BA 1LLRD 4KMUC 4P73A 1E0BA 2VS1A 2EYMA 4A3MH 3PO2G 4BA2I 4DAPA 1G6ZA 1JCKB 4EVOA 1IBML 4JI7L 1WTXA 3S1MH 1B70B 3BDLA 2NN6I 3S2DB 3SK6A 2FMCA 1P16A 4RGMA 3HOYH 2XTIA 4BBSG 5JVG3 1XNQL 1YHQA 3K0XA 1SFOB 2WV6D 3F2UA 3CAMA 3TP7A 2MFIA 4YCVA 2WFWA 1V1OA 3J80E 1YBYA 4IUVA 4V0BA 1X3EA 1SROA 3H0GH 1GHJA 1XJVA 2IHEA 1W3SA 2F0KA 1TS2A 1LO5D 2UUBL 4PNYA 2DJGC 4TQUS 1Q12A 3I55A 1M1KC 3NUCA 3MXNA 3BYTB 2J0TD 1BO0A 3H09A 3KF6B 2B63G 3S17H 1DXMA 2D0OA 2MO0A 5KYLA 3HOVH 2WP8J 1X3FA 4LFCL 4DV6Q 1HHVA 1P8LA 5HGTA 2IX1A 3M7NA 2CWAA 3H3VH 4U673 3M4QA 4RMFA 1L1OC 1PYBA 2HQLA 3X3NA 1KDAA 3K5NA 4OWTB 3RN2A 4HEDA 4EGVA 1J6QA 4DFAA 1IXRA 1MI2A 4RG1A 1MJCA 4ZKCB 1LTTD 4KKSA 5K36H 4EQOA 1CTMA 1N32L 1EU3A 1YJ9A 1SXTA 1HNWQ 2RA4A 2R61A 1WFQA 2VY3A 1EFID 3T56B 3GTPH 4A3DH 1Y8OB 1QOHA 3I4MB 4F87A 3T1YL 3D4DA 4G7HC 3IFDA 3LNNA 4K0KQ 1QB5D 1VQBA 1QNUA 2RCFA 1TWAB 4MN3A 5EBCA 1ILPA 1ASYA 3BS1A 1G51A 3BYYB 4IPGA 4A3LG 5COYA 1SBBB 1X9NA 1J8IA 5LMUL 4UAIA 1A63A 4CKCA 1HUMA 3PMFA 2J4XA 3HRZC 2VB2X 1O7YA 4AYBG 1OXTA 2F0HA 1JE5A 1FL0A 3KF8B 5C4XH 4JI3Q 4AIMA 1D1IA 2NN6H 1Z9FA 1X3QA 4GOPB 5FO7B 2UXDL 1KNEA 1ML0D 1NSNS 5C3XA 1AZPA 1B2TA 2B3GA 1KTKA 4BBSB 5J1ZA 1HTPA 2WAQE 4YHHQ 4A3EG 3U9OA 1LV9A 4DR4L 3SEBA 5JEAG 4R9WA 5IYBG 3F2BA 1YHBA 4BS9A 5I4DA 1XMOL 3KDFA 1M90C 1MD2D 4QB4A 4LFAL 2R93B 3BVGA 1HTLD 4XT1B 3T16A 2JA7H 3DM3A 2UXBQ 1W6JA 2NBFA 2X6GA 3C1FA 1STBA 2ZTDA 3IFTA 1WCMH 1DZ1A 1BCPB 3HKZG 4C3IB 4YCUA 1I6HH 3TDQA 1PFSA 1HZ9A 2IX3A 2D0PA 3KLWA 4GKJL 1PMRA 2XRSD 3L3OC 4DV1L 4XQQA 3TQYA 1EYGA 5DLQE 4LF7Q 1AFPA 4FO2A 4HMIA 2F0WA 5G3LD 2KECA 4P71A 1A15A 1A8VA 1NNXA 4KKUA 3A54A 3OIPA 5JVH3 4KD4A 1RIPA 1JJGA 4ME5A 3PQIA 1Q82C 2K50A 4IO9A 1ET9A 3CP0A 5FO8B 1CT1D 3PO3H 5C0XG 2F0VA 1PV4A 1WTOA 3SK5A 4ZKBB 3CCVA 4OX9L 3DWQA 1ET6A 1YNND 4H13C 3QOJA 2H4OA 2F4VL 4DUYL 3CHBD 1K8GA 1VQGA 1EQVA 2YTXA 5J39A 4ILWA 4PMCA 3S2HH 3KYHC 1VS0A 1J9OA 5M9OA 3J80c 2PCFB 1KIXA 5ELFA 2XWJB 2I5LX 4XT3B 4QF4A 4GKKQ 1EYAA 1L2FA 2JP1A 1JWSD 2N55A 3M85A 3E3XA 1ENFA 4C2MB 2I5MX 1A3VA 1QVFA 1PH1A 1QUQA 4IFDG 3QG1A 1UE5A 1YHAA 2K52A 4A3FG 4IPCA 5IT9E 1VMPA 5T1GA 2WB1G 1ZYRC 1B8AA 3ND9A 4GNXB 1HCZA 4QJFA 1XWEA 1DD2A 2G9DA 4DR5L 1PFMA 1SMYD 4K8IA 3KOJA 3UI2A 5C44H 1HR0W 4Y7NB 1B3QA 5ELOA 4A3EB 2NVTH 1TR5A 3PV0A 2XN9C 3QJYA 2ZM6Q 4UP7A 1WD1A 3VR6A 2KHIA 2M00A 2DY7A 2JK8A 2V4DA 5GADC 3NELA 1Y1WG 1RF2D 1L0YB 4C56C 4DV4L 3DWPA 3M4YA 1NBWA 2B2WC 3VR5A 4F88A 3NXWA 2OTJA 2BA1A 5M5WB 3SK4A 1T9HA 4FXKC 1WI5A 3RN5A 2XWBB 1N9WA 3KLSA 2AMCB 3NWSA 4IOCA 1Q3LA 1PH5A 1F2YA 2K32A 1K8AC 2LS01 1S4ZA 3OHXC 4JI2L 2NZOA 1DYQA 3J81i 1VQ7A 3K57A 3J80L 5I2YA 2F0NA 5IP9H 2B29A 4ODGA 2C5CA 4KN4C 3NWTA 2XIWA 1PRTD 1RHPA 4C1NK 5GROA 4BY1H 1HNZL 3KBXA 3K8AA 4BA1I 1E1TA 4DV3Q 3QIAA 3SVMA 5IGGA 4DR6L 3S1NB 3CMAA 5E1FA 1NAPA 5K5PA 4CKEA 1A0IA 3V96A 3KFUA 2PW7A 2F0LA 4L5TA 3BZDB 1Q86C 2F03A 3DLLA 1G2SA 5ELNA 1WOCA 4LW1A 1G91A 3A8IE 3LWEA 1AE3A 3HOUH 5C4ZA 2GN5A 4KKTA 4ULLA 2QDBA 3AMUA 2K5DA 1EIHA 5GQOA 2VUMB 1CZGA 4NDXA 2RCNA 3MEFA 4GOPC 4POGA 4CJ0B 2Z1CA 2ASBA 1B50A 2A6ED 3CQZH 5A35A 1HNXL 2AQ1B 4X66L 2K5VA 1Y8PB 5DNFA 3GTMB 1IL2A 2KEEA 1MSGA 3TMEA 2QGQA 1SE2A 4ZLTF 1D7QA 1CKOA 2JA8H 2OTLA 1STGA 4HSVA 4GLXA 4ZQ3A 1K8MA 4TVAB 1VMCA 3ZYYX 2EY1A 1ZKOA 2TMPA 3SHLA 5M5YH 5IODA 2Z6KA 3MAQA 1NMFA 1PTOD 3ULLA 4LF4L 4AYBE 4FF3A 3KK7A 2ES2A 4HCSA 3MXGA 3J7YW 4GN5A 2V1CC 2VL6A 1STYA 1IBKQ 1JOOA 4KHPQ 4PZ6A 5EJWA 4BBRH 1Y1VB 1Y1WB 2GVBA 2K4KA 4DR7L 1BCPC 2M2LA 3A7AB 1PDQA 4DV7L 4DR3Q 4KJOA 2EE1A 2I5HA 3H91A 2CQOA 4H0LC 4IJHA 1SAPA 4FDBA 5KNBA 2G9HD 5C3WA 4B3SL 2KJXA 2FINB 5M3MG 3MXNB 3L2PA 4L63B 4IOAA 5IP7G 4JBJA 1K8OA 1U4PA 4CDDC 4JI4Q 1PYSB 3I56A 1Q1EA 3HOXB 5HY6A 3DMUA 2PMZB 1K28A 3G48A 1HQRD 2MQHA 2CH4W 4XYQA 4YIJA 4A93H 3TP8A 5L37A 3K7AB 3A5ZB 2R3ZA 2IPKD 4IUUA 2L9HA 4A3GH 3HKZE 4UP8A 1GHKA 4LUOA 1JC7A 5LMNW 1EEID 5FJ8H 3KLRA 2JJQA 2MHVA 5FLMG 4A76A 4B9WA 1EWCA 1N36Q 2E5LQ 1OXUA 4WFN3 3D4WA 3NBHA 4C3JH 3PO2H 1TWHH 4PG3A 4IALA 1K83H 3V05A 2D5DA 5IT9c 3P20A 3TZDA 1PLFA 1C0AA 1AE2A 4LF6L 1F9QA 1X6OA 4BXXG 1V8QA 1CQVA 2KHJA 2Q8TA 4B9XA 1U4RA 4RHSA 1JWUD 4GNXC 4JYAQ 1IBLL 4J1MA 3OPOA 1I94L 4GLAC 3RZOH 1J5EQ 1OXSC 4PMWA 4JI1Q 5DEHA 5FK9C 2PPBC 2F0IA 2JA5B 1UE7A 4BY7G 4IQZA 2EVBA 3PIP3 1EQTA 1S5ED 1IW7C 4ABNA 2UUCQ 3K7UC 4XQJA 2BH2A 5IE8A 1SDFA 2B63H 1Y8NB 1OO9B 2KCTA 2VXWA 3AB9A 5M5XH 1MKHA 1G8ZD 2K03A 1A62A 1PTOH 3CC7A 3PUYA 4A3BH 1D5ZC 5C0XJ 3W3AA 2KOLA 4DR1L 3HOWB 3VA5A 5KIXA 3KDFB 5BN5A 3EA6A 3ERSX 1EOTA 1STHA 4P72A 1BBUA 1HZAA 4R4QA 2EJFC 4A3KB 3BVMA 4LF9Q 4ZUJA 2WB1E 5EKKA 2VQEQ 1YITA 5C3EB 5T1IA 2EYPA 4CDFC 3NEMA 5M3MB 1JJCB 3FP9A 3P1HA 1NJIC 4JV5L 5C4JH 4FF2A 2VB3X 3BG3A 2KHSA 2CFMA 2F0SA 1SYFA 3P7JA 1RKNA 1GOZA 1LABA 2F0EA 3HOZB 4GS3A 3A0JA 3NQTA 1Q81C 4LF5Q 1PXUA 2SOBA 2BOSA 3BDOA 5C0XI 4OEMB 3G71A 1SYGA 3OWEB 2RDHA 4JI8L 4NPSA 2EYFA 2NZHA 2PW5A 4A3LH 2ZXPA 4HCEA 2YU9H 5EQ0A 1H9MA 2KVMA 2BCOA 3N52A 1RCVD 1CM9A 3DUZA 1IKLA 2A68C 2SNMA 2MUYA 4JI5Q 4P2CB 4F8MA 4M1UB 2PMZE 2A5HA 4HN7A 1S5FD 1WVLA 3GTGB 3R2TA 3NTHA 1K9MC 4MHEA 3S14H 4RH6A 1TS5A 2KCNA 1LACA 3I4OA 4JOIC 1Y69U 3CCRA 4Q5VA 1BNZA 2CW0C 1SN8A 3MWYW 3S1RH 4YWLA 2ZXRA 1CSQA 4I65A 4RA8A 4QL5A 4N8FA 4Y52H 2L1BA 2EZVA 4IFDI 4WORA 4WJ3M 1EY7A 4LFBQ 1VQAA 1FNUA 4EQ5A 5IY0A 5IYBH 2AWNA 4DV2L 2ZM6L 3M4OH 2OEOA 2R93G 3SR1A 4HTHA 3HEJA 4HIOA 4BY7B 4NB3A 2R92G 1N33Q 2MO1A 2F0JA 5EKIA 2E2IH 1QUQB 2HHHL 1STEA 2ID0A 5J3BA 5I9OA 1HR0Q 2B2UA 2NVXB 2QW7A 4PMBA 5FLXL 1D6EC 3EFXD 3UDXA 4P75A 1GUTA 3E9IA 2L5TA 1I4QA 4CDCC 4C3IG 1SYDA 4A3IG 4B3RQ 4DUZQ 3J7A5 3D6WA 1QE6A 3VA7A 1S72A 4DU9A 3JAMi 4NP5A 1DONA 2FHTA 1V9PA 3C1EA 3DEPA 4UDUC 5DM63 2KEDA 2K5WA 2EDGA 5AJ3Q 5IYCH 2DNEA 3GTJB 4WRDA 3BU2A 3Q22A 3S1QH 5NUCA 4TSSA 3TP6A 1Q46A 1TWGB 3B6YA 1VQPA 3IKJA 4CJ2C 4KTAA 1AH9A 5BN4A 5EGTA 4K6LA 4KN7C 2OQKA 2E2JH 3S16B 3D3RA 1X32A 3K5OA 4IUTA 5C6AA 2O5IC 1KABA 4DR2Q 5IWAQ 3X3MA 4JBWA 2BDNA 5C0XH 2K14A 2XSCA 1KDCA 3PCOB 1RL2A 2E2HH 4R1JA 5CORA 2F0GA 4NXNL 1C48A 4GLVB 2HD3A 2EYJA 1FGUA 1EQQA 4R4OA 5EKLA 4E6IA 1KNAA 2EXDA 1VQCA 4OL7A 3MFYA 4XXEA 2IHFA 3Q23A 4L8JA 1XNRL 2G5DA 4DV0Q 1B1ZA 2BH8A 4N9PA 4X64L 4LK1C 1BKBA 4O0AA 4UPAA 3S9WA 3H15A 4AQYQ 2EXZA 1L0XB 2VQFL 1FJGL 4CKBA 3IAYA 2WKCA 4CJ1B 3GTLH 4DK0A 4OIKA 3KJOA 5JAVA 2Q2TA 3I4NB 4X3TA 5LHY1 2R6GA 3SXHA 5FOBB 3WWVA 2Q8RE 3I3CA 3NPPA 4IFDH 3U50C 1I50B 2K01A 4A3FH 3GTOH 4A3MG 2WIIB 4QIWB 1KRTA 3RLFA 4I7AA 4IURA 1XMQL 3TEHB 1X3PA 1LTRD 2E2DC 3LGJA 4KD3A 4UY8C 1TWFH 1XTCD 2ICIA 4X62Q 3E6ZX 2Z6BA 5IGEA 1G2TA 5M3FB 3HOYG 4K5VA 3RZDB 1C8CA 2DY8A 1E7ZA 3J7AF 3PF4A 1I3QH 4LF8L 2R92B 3MHBA 4B3TQ 4DV5Q 3S15B 1RJTA 2B2TA 1VQ9A 1VF7A 2L0CA 1GUSA 1SMXA 1HJPA 2MGSA 2Z9HA 3D6CA 3J81L 1FGBD 3T51B 2R7ZB 4HMJA 1X65A 1BBWA 4A3IB 2UXCL 3EROA 4HR7B 2KCMA 2F1MA 5IYDG 4PZ8A 4Q0FA 2EYOA 1S5BD 4KY7A 3HOVG 3GTKH 4JI6Q 1PFNA 1N34Q 3C46A 1GO3E 1U4LA 1KC8C 2PQEA 3PGZA 4GN4B 2JA6H 3CCEA 1EUJA 1S5DD 3I91A 3GTQB 4KK7A 2JQOA 1K3BC 3EVQA 1RD9D 4X65L 2EY5A 4NXMQ 2Z4HA 2RDFA 4HIKA 3K5MA 3KJPA 3U9SA 1BXTA 2N3SA 3KLSX 3CMEA 4POFA 1CZWA 3HP3A 3E0EA 4O1NA 1I5FA 3NK9A 4JVZA 2LKVA 1TKWB 1XPRA 1B4OA 2E5LL 1R9TB 1V1PB 2F0OA 3CXCA 3BDCA 4O2DA 2VZAA 3HFZB 4RFBA 2IJ0A 2VUMG 2WINB 4M8AA 1ENCA 1UE1A 1ESFA 5GAEC 5LMNQ 4OWWB 4A3JB 4FVMA 2ALYB 1AEXA 4JW0A 1EU4A 2NVYH 5DM73 1ZYRD 2RKSA 1JE4A 1UNSA 2HIVA 3GQBA 5BR8L 2OQ0A 4AH6A 2NVQH 1NTGA 2N88A 1DJRD 1EY4A 4DPGA 3AFQA 3NBHB 2DN8A 2HIXA 4RGOS 3NTKA 1SNPA 4UP9A 4A3MB 5H1SE 1IBMQ 4JI7Q 1Z47A 4HSPA 5EPLA 4HIMA 4K14A 3S1MB 1B44D 3T13A 3AU7A 1Y1VG 2Y0SG 1PVOA 2BE5C 4ZUIA 1XNQQ 3TS2A 3HOYB 4FNFA 1K3RA 1UEBA 3ZJYC 2OT2A 1FYCA 3LWUA 1TWCH 1WTRA 3JC66 5A2QL 2AQ2B 3H6MA 3H0GB 3TS0A 1HRJA 5E4XA 4J6HA 4QIWE 2RQXA 5KYIA 1SE3A 2EYHA 1A6XA 3RMHA 3R3OA 3HZXA 3M3YH 1SYEA 5IGBA 3HOXG 5IP7H 2A1AA 4ZYSA 3S17B 1CHQD 5JJIA 4KI0A 4LFCQ 3L0OA 4JBMA 3HOVB 3PSIA 1ICFB 1SRUA 5JJLA 1SNQA 1O78A 3MZ5A 1W2BA 1G6PA 3FMCA 2BA0A 1LM0A 3CC4A 3A8KE 4PZ7A 2UUAL 2QCPX 5KNCA 2YTYA 4P74A 2UU9L 4JI0L 1TY0A 3T1HL 1N32Q 5BN3A 1X56A 1O7LA 3OMCA 5FLMH 2QA4A 3A55A 1QILA 1CKMA 4DNIA 2PNRC 4HJ8A 3R8BA 3GTPB 4A3DB 3T1YQ 3J7ZC 4DGZA 3U58A 2ATWA 3TN2A 3S2DH 1HUNA 1EY5A 3KF8A 5FLXE 3K0YA 4G7OC 1TS4A 1E2WA 2SDFA 4A4IA 2IWHA 1WD0A 2K75A 3CCSA 1Z6HA 1SFOH 3K81C 1D5XC 5CGKA 1H9RA 2H5XA 1SJHD 4R4CA 5LMUQ 3ERQA 3MXPA 1H9SA 2C9OA 1JT8A 2HDMA 1SE4A 3PIO3 1B9MA 1EY8A 5HGQA 3QOLA 1K0RA 2B2YA 1QWYA 4U68A 2JA5G 4EX5A 1JWMD 1BCPD 4DA2A 1SNMA 3FKIG 5JPMC 5C4XB 3VDYA 3VR2A 2QEXA 2UXDQ 1QCBD 5C4HA 3F2DA 4C3HG 5ISRA 1ENAA 1F9RA 3E5SA 4QMGA 1PZKD 2Y0SB 4DV6L 2RDGA 1HQMC 1PH8A 2Z6KC 3HOWG 2RSNA 1BDOA 1SNCA 2K5HA 4MIUA 1RTOA 1HFNA 1YVCA 1A2UA 5C44G 1JOQA 4DR4Q 2EY2A 2ZXOA 2F0MA 1EWHA 4A3KG 1NMGA 1XX8A 3MC0B 4LJZC 1XMOQ 4JC0A 3UDFA 1B7YB 5C3EG 2EQSA 3CCUA 2FXQA 4V190 4K6DA 2B2VA 4LFAQ 3DXJC 1SEBD 2TSSA 3T53B 2L12A 1W6KA 1OTCA 1LYLA 2JA7B 1EOVA 4JG2A 1HNWL 4H44C 3G6EA 1MIUA 3HS0C 4IN3A 3I4MH 1STNA 2F3WA 1YI2A 4KY6A 4R4TA 3UE0A 1WCMB 3HOZG 3Q6SA 5JPNC 4X6AH 2A69C 1CKNA 4K0KL 1EIGA 5GAHC 1TWAH 1I6HB 1VQIA 4GKJQ 1KLUD 2LMCB 2PI2E 4DV1Q 1ZXTA 2WKDA 1TVXA 2PYKA 1WTQA 4LAAA 3NP8A 5CR3A 2JEAI 1PH9A 3NSWA 1VQ4A 1YNXA 4BY1G 2SNSA 3OMGA 1EEFD 5JEAJ 1KXLA 3NE5B 2E8GA 2XRQD 2K28A 1GKHA 1TIID 2J7ZA 4FF4A 2K1BA 3EQLC 2ZJQA 1I4PA 4JI3L 1DOKA 5CMDA 3ER0A 4GN3B 4X3KA 3PO3B 1NR2A 1IYVA 4OX9Q 4QUFA 3J81E 4F7XA 4BBSH 4TRDA 2K5NA 1PZID 4HIDA 1PH6A 4B3MQ 4IPDA 2F4VQ 4DUYQ 4OIJA 2N78A 1TU2B 1VQHA 1IW7D 4YHHL 1NUCA 3FHWA 4GNXA 1PFBA 3A56A 3S2HB 1DGSA 1F9SA 1SLJA 4JCVE 2AWOA 1HH2P 3PUVA 2GVAA 2A74C 1FR3A 2R93H 4OWXB 2LXKA 3FKIB 4LWCA 3W2DA 1DOMA 1DOLA 1VQ6A 2UXBL 4B3TL 4OGQC 4C3HB 2RVLA 1LT6D 3W5OA 3JAML 2PQAA 4C3IH 3CD6A 5F2DA 3QWNA 4DR5Q 5JJKA 1S5CD 2AKWB 3STBC 5C44B 1SSOA 1KD1C 2NVTB 1ASZA 1U4MA 4YCWA 3BZKA 1NE3A 1BOSA 1RDPD 1I4HA 2R7FA 3NBIA 3Q24A 1CSPA 2CKZB 1YNJC 4DV4Q 1NCVA 3K59A 2JSOA 2OWOA 4LF7L 1VQFA 4DXFA 2A19A 3AQQA 4YY3Q 3H3VC 1CA6A 2Y0SE 1XXGA 3URYA 3OW7A 4N8X1 2Q2UA 2KA7A 1U5KA 4RCNA 1HA6A 2A68D 3H94A 4JI2Q 3DEOA 3WDNA 4K2LA 5KRUA 4K5WA 3FRPB 4IFDJ 1QG7A 2OCEA 5FLXc 2I46A 1BVSA 4CGYB 1H9JA 3ULJA 1V1QA 4K5XA 4A3CG 2ICEC 2CW0D 5IGDA 1GM5A 1HNZQ 4BY1B 1R4QB 1VQ5A 2GA4B 1QNKA 4DR6Q 4A93G 1YJWA 3FVQA 5EAYA 4J8QA 1CQFA 1LT3D 2LXJA 3TP5A 2HCCA 2L11A 3I4NG 3I4LA 2EY6A 4IZ8A 3PF5A 4GKKL 4RGTA 3T4AC 4EQNA 2P5ZX 5A2QE 4C2MH 1VQKA 4ZRZA 2WAQB 3OSOA 4DKAC 4OO1G 4EQPA 5C5LA 4QQBX 3ICEA 3NTIA 4C3JG 2RF4A 2DJFC 3HOUB 4Y7NH 1RTNA 2JN4A 1I6VC 3D4RA 4A3EH 1X55A 3VR3A 1RODA 5JEAH 4YWKA 2ZT9C 1MSHA 2NTSA 2RHQB 3CPFA 5M3FG 1JB7A 1K0SA 1UE6A 4XQNA 4CDEC 1HNXQ 2VW9A 3CQZB 3CCMA 1EZ6A 4X66Q 3OOCA 1WTVA 1E2VA 3FEWX 5ELEA 3RR5A 2IT1A 5M5WH 4MZ9A 1WJJA 2JYOA 5EBDA 5ELCA 2AHOB 2R7ZG 2OF1A 2JA8B 2O2LD 1SNOA 1JJ2A 1GD7A 2AUKA 2B8GA 2F0UA 2QILA 3Q8DA 3MFGA 5KEEA 1EFWA 4NMZA 5M5YB 2PO4A 4LF4Q 1L1OA 2HQEA 4FYDA 1MHWC 2B2UC 3GP7A 3N6RA 4HJ5A 1D2BA 4DXGA 3F8TA 3ULPA 1UWVA 5IYDH 3OWFA 1S3OA 1SR3A 4BBRB 4DR7Q 3MXUA 4DV7Q 4A3BG 1BQQT 3E9HA 3PIPA 1PH7A 4LMQD 3S1NH 4KY5A 1I4GA 4DV3L 5JJZA 1EIFA 2F0PA 3PUXA 4DAMA 1SE8A 3HKSA 1IYUA 3CRKC 3M4PA 2HDLA 4B3SQ 3J7AV 3EN2A 1LTGD 2AUJD 3E0JA 1F2MA 1BR9A 4KHZA 3F1ZA 2O4XA 1XPOA 2MJ8A 4IJLA 1N8RC 2O5JC 2VNUD 3D31A 1JICA 3EIVA 3J81c 4HJ9A 2VUMH 4A3JG 4L5SA 3K80C 3OTOQ 1ONLA 3CC2A 1KHIA 4A93B 5IIFA 5CV8A 1E1OA 3GTMH 4X3SA 2CVRA 4DF7A 4N9TA 2KENA 4A3GB 1PRTB 4DAVA 1B53A 1CHPD 2EIFA 2JA9A 4NW2A 1JMCA 2JE6I 3LX0A 3OIQA 2Z4IA 5D65A 4FXGC 1II3A 1Q7YC 1XPUA 4C3JB 3PO2B 2IX0A 1TWHB 4RKBA 4CBVA 1I4RA 1K83B 2FJ2A 1EWIA 5EPKA 3TSSA 3ONAB 4LF6Q 3W1GA 1E2ZA 4QY7A 1VQNA 1UUPA 5I6WA 1Y1VH 1IBKL 1Y1WH 1D1KA 5I9PA 4KHPL 1H9SB 1V43A 1F77A 1C9OA 2L15A 3A8JE 1XYIA 3FDTA 1YJNA 1IBLQ 1O7IA 4DR3L 1I94Q 3H0GG 4PV1C 3AEVA 3PUWA 4G4KA 4WJWA 3VYSA 3RZOB 3UE1A 3AFPA 1ESRA 1ICWA 3J81j 1VQMA 2X69A 2EJMA 2A73B 2MPMA 3I2ZA 3K5LA 4O42A 2PZUA 1FNWA 3HG9A 4DAYA 3HOXH 2B2TC 1VCIA 4JI4L 4RWSC 4FP5D 2CHBD 2B63B 4ID6A 4TKOB 5GAGC 1KL9A 1GXDC 4JK1C 4S3SA 2NYZD 3FPPA 4ZCKA 5KNDA 5M5XB 4HJ7A 2FFKB 4DR1Q 1PTOB 4A3BB 3R93A 3K7AH 4KJNA 1T5EA 2F0DA 4R8IA 1WTPA 5CV7A 1PH2A 1CK1A 1CUKA 1ZEQX 3W1BA 3CCQA 4XTCS 1PH4A 5IYCG 3I70A 1GUWA 4QGUA 1M4VA 5K36G 2DGYA 4JV5Q 4KV6A 1T5XD 4XYOA 3P75A 2L4NA 5C4JB 2RSOA 3SGIA 1KAWA 1N36L 4FF1A 4A3DG 2B39A 1TQOA 1EY6A 3I7FA 1EY0A 1CKNB 5I6YA 1CFMA 2I0QA 4FXDA 5LL6S 1JORA 2LSSA 4L6TB 3G6JB 4WJ4A 2JEBI 3BZCA 3JAME 5JOBA 1O7ZA 4JI8Q 1IL8A 2NZ1D 4OELB 3A74A 1MGSA 4PQXA 4B3ML 1GJXA 2EPBA 1Q8IA 2HT1A 2YU9B 4G57A 5CV5A 4JYAL 4YWMA 2K05A 5CBEE 2BE5D 1M8AA 2F0QA 3M7GA 3SE0A 4AYBB 1MBYA 1J5EL 1HA5A 4JI1L 2JA5H 2Z0SA 5G3LF 5J22A 1YNNC 3CRLC 5C4XG 1HXYD 1EZ8A 1KDBA 2NWGA 3OW2A 2EJGC 1OXVA 2NN6G 3S14B 3A7LA 1BUVT 3FKIH 1A3TA 1QZGA 1E22A 5ELDA 2C35B 1JR0D 2UUCL 1HZCA 3S1RB 4C3HH 4RCOA 2LY7A 4KLKA 3VYRA 4B08A 1QJOA 2E76C 3KF6A 1VQJA 5CV9A 3HOWH 2B2WA 1VDZA 1QVCA 2F3VA 4IUPA 2ZJPA 3I8ZA 1LTLA 3R2IA 2B8FA 1EY9A 4DV2Q 4A3KH 4R8NA 2D2CC 2R7DA 4DNTB 2UUBQ 4MTKA 5C3EH 1GVPA 4LF9L 1STAA 3M4OB 2N8NA 2D9UA 5M3MH 2VQEL 2CQAA 3L9AX 4RGNA 1F2LA 3PUZA 4ZAIA 2JA7G 2HHHQ 1HFGA 1OXXK 1SMYC 4YY3L 2E2IB 1TXYA 2PNHA 4ZK9B 2PQAB 2F52A 2NTTA 3G7LA 4C1NI 5IOCA 5D3DA 1WCMG 1B9NA 2CCZA 1WYDA 1A3UA 2RHSB 3HOZH 1YEZA 2XGTA 4DN4M 1U0LA 3HKZB 4GZYC 4HJAA 4LF5L 2Q2HA 3MEHA 3QO2A 1UEAB 4CHTB 4K2KA 3CCJA 2PZTA 1CA5A 3I72A 4LUVA 1D5MC 4JBKA 3CPWA 2HCIA 4ALPA 1KRSA 3S1QB 1SYCA 2K7VA 2JA6G 1SNDA 2ZTEA 2CH4A 1H9KA 1PZJD 4JI5L 1LTBD 3VYTA 3GTGH 1Q90A 2E2JB 2SEBD 4I7ZC 5E7NA 1FNVA 1JQYD 3PO3G 5E3FA 5FO9B 1BBXC 3EBEA 3MTSA 1S40A 4IUNA 1PRTC 3GD7A 4X3UA 4NXNQ 3QB3A 2E2HB 2A8VA 3O13A 4GOPA 4BXXH 3ND8A 1KLGD 1GUGA 1SJED 4OO1I 2PZWA 2N49A 1LTSD 4LFBL 4UHVA 1XNRQ 3UDIA 1PRTF 3CCLA 1IYJB 3BJUA 1VQEA 4X64Q 3BVZA 2NB0A 3D8GA 3RNUA 2VQFQ 1FJGQ 1QVGA 1AN8A 2KQ3A 4BY7H 3VYUA 1LUZA 2IL8A 1JOKA 2HUGA 2Q8IB 3L7ZC 1VQLA 3GTLB 1N33L 2NVXH 2MP1A 1HR0L 4H02A 2B2YC 1YIJA 5CC4A 3RUZA 1HZBA 1JB3A 2IW3A 3WOEA 1IKMA 1HPCA 2A6EC 4A3FB 3GTOB 2YV5A 1XMQQ 4DUZL 4B3RL 3KBGA 2WB1B 3K6OA 4NKLA 2KCCA 4OHJA 5CV6A 1XTDA 2D62A 5ELBA 3Q0AA 2LFNA 3GTJH 1TWFB 5AJ3L 2F4IA 1TWGH 2A69D 1YZ6A 1Z7TA 4RAUC 4LF8Q 1DM0B 1GUNA 1I3QB 1PYWD 1CI3M 1PTOC 3S16H 5TSSA 2QDLA 1C4QA 4MTNA 1LTAD 2ENBA 4DR2L 5IWAL 2B2VC 4IUQA 1C7YA 1L1OB 2UXCQ 1G291 1LTID 1QZHA 2QF7A 1BCPF 4IPHA 5D3IB 1PTOF 4LNQA 3SK8A 2ZJRA 2E75C 2QEJC 4R4IA 5DAUA 5IP9G 1WTWA 3K58A 3JAMc 1AW7A 4A3CH 3J80i 3GTKB 4Z9CB 3CU7A 1K73C 3FPUB 1V1PA 3UDGA 5C5MA 3CF5A 2JA6B 4XIGS 4DV0L 3RLOA 1E3PA 2RBMA 3OTOL 4OONA 1VQ8A 1MJEA 2YTVA 1EL0A 1SYBA 4L5QA 4DNRB 5IGFA 4AQYL 4X65Q 4XDXA 3SDZA 3D0FA 3TZUA 2BDOA 1DCZA 3DM1A 4RHRA 3I4NH 1F2ZA 3U4ZA 2WAQG 1KAAA 4G7ZC 3U4VA 3DHQA 5FKAC 5LL6X 3F2CA 2CWPA 1I50H 4OO1H 3QR8A 1PA6A 1AP0A 1R4PB 2XVSA 3HOUG 4KHVA 2IY5B 2OXPA 1D8LA 2K33A 3GV6A 3I73A 4K8JA 5CYUA 1TT2A 2I07B 4DK6C 5HURA 4X62L 1WTHA 5M3FH 2F0FA 2M9VA 1X3GA 3RZDH 1EIYB 2NVYB 3EJIA 3S24A 2F0TA 2E74C 1TS3A 2QKIC 5BR8Q 3STBD 3NENA 4A75A 1VQOA 3RD4A 2R92H 3MA2B 3S15H 5AFWA 3V2TA 2XNAC 4DK3C 4DV5L 2NVQB 1VQDA
chains in the Genus database with same CATH topology
2RCNA 3KJPA 4OXPA 2JA8G 3TRZA 2N3SA 3MEFA 3CMEA 1S3OA 4POFA 1SR3A 2R7ZH 4GOPC 4L5RC 4DR7Q 2KBNA 4POGA 3E0EA 1Y14B 4A3IH 2ASBA 5GQOA 4DV7Q 4A3BG 3E9HA 3CQZH 1I5FA 3PIPA 1PH7A 1KQSA 1XPRA 1HNXL 3S1NH 2E5LL 4DV3L 1Q1BA 2PI2A 4X66L 2K5VA 3CXCA 1EIFA 3PUXA 1IL2A 4O2DA 2VZAA 3HFZB 4DAMA 1SE8A 2VUMG 3HKSA 3M4PA 3PIOA 4B3SQ 1X54A 3EN2A 1UE1A 1L0WA 5GAEC 5LMNQ 2QGQA 4OWWB 4BBRG 4JI6L 1D7QA 1CKOA 2JA8H 2ALYB 1N34L 2OTLA 4KHZA 4GLXA 3F1ZA 4TVAB 3GTQH 2NVYH 4MNOA 2F3IA 3IRBA 4IJLA 1XPOA 1N8RC 5M5YH 2Z6KA 3H3VI 2VNUD 1NMFA 2HIVA 3D31A 3ULLA 3A5UA 1IZ6A 4AYBE 3EIVA 5BR8L 3J81c 2OQ0A 4LF4L 4AH6A 4HJ9A 3AYHB 1FVIA 2ES2A 2NVQH 1NTGA 2DUDA 3CW2C 2VUMH 4NXML 4A3JG 4GN5A 4L5SA 2Q2IA 2V1CC 2VL6A 3AFQA 3K80C 3RLNA 3NBHB 4DPGA 3OTOQ 1IBKQ 4KHPQ 4DAYB 4PZ6A 2HIXA 4UP9A 4BBRH 3G4SA 3CC2A 1KHIA 2GVBA 2K4KA 4DR7L 3GO5A 2YYZA 4J15A 5H1SE 4DV7L 1R9TH 4DR3Q 1IBMQ 4JI7Q 1Z47A 4APVA 3I4MG 1E1OA 3GTMH 4HIMA 2I5HA 2KENA 2CQOA 4LUZA 4IJHA 4FDBA 1E24A 1PH3A 2EIFA 4B3SL 4A3JH 2JA9A 1Y1VG 2Y0SG 1EQRA 5M3MG 1PVOA 5LMNL 3MXNB 3TREA 1XNQQ 3TS2A 3GDEA 1K3RA 2JE6I 1JMCA 1UEBA 3ZJYC 3L2PA 4IOAA 1TWCH 1Q7YC 5IP7G 1PHJA 4JBJA 3OYYA 4JI4Q 1XPUA 1PYSB 2IX0A 2ZTCA 1NY4A 3JC66 4A3GG 3I56A 1Q1EA 1H95A 2UUAQ 4JOIA 2MNAA 5HY6A 2UU9Q 1Q8KA 1EWIA 5FJ8G 4JI0Q 3TS0A 3G48A 3T1HQ 2MQHA 4LF6Q 4QIWE 3W1GA 4QY7A 1VQNA 4ME3A 3M9BA 1Y1VH 1IBKL 4P73A 1Y1WH 4A93H 4KHPL 1V43A 2VS1A 1C9OA 2L15A 3A5ZB 4A3MH 3M3YH 3PO2G 4BA2I 3HOXG 5IP7H 1YJNA 2A1AA 1IBLQ 1O7IA 4DR3L 1IBML 1I94Q 3H0GG 4JI7L 3AEVA 3PUWA 4A3GH 3HKZE 3S1MH 1B70B 5JJIA 4KI0A 4UP8A 4LFCQ 4LUOA 2NN6I 3L0OA 5FJ8H 5LMNW 4JBMA 3UE1A 2JJQA 3AFPA 3PSIA 5FLMG 4A76A 1P16A 3J81j 1VQMA 1N36Q 2XTIA 3HOYH 4BBSG 3I2ZA 2E5LQ 1SRUA 5JJLA 1XNQL 1OXUA 1YHQA 3K0XA 1W2BA 1G6PA 3CAMA 2MFIA 4YCVA 4C3JH 2WFWA 1TWHH 2BA0A 3PO2H 4PG3A 3HOXH 1K83H 1LM0A 4JI4L 1VCIA 3CC4A 1YBYA 1X3EA 1SROA 5IT9c 3H0GH 4PZ7A 1XJVA 2UUAL 2IHEA 2YTYA 4P74A 2UU9L 1W3SA 4JI0L 5GAGC 1KL9A 1C0AA 1AE2A 3T1HL 4LF6L 1N32Q 1X56A 1X6OA 5FLMH 4HJ7A 2UUBL 4BXXG 2QA4A 4DR1Q 4TQUS 3K7AH 1Q12A 1CKMA 2KHJA 4DNIA 3I55A 4HJ8A 1M1KC 1PH2A 1CUKA 3T1YQ 3W1BA 3J7ZC 3CCQA 4XTCS 4GNXC 1PH4A 3KF6B 5IYCG 1IBLL 3U58A 2B63G 3S17H 4JYAQ 2D0OA 2MO0A 4QGUA 1I94L 4GLAC 2ATWA 3HOVH 3RZOH 3S2DH 2WP8J 1X3FA 4LFCL 4DV6Q 1J5EQ 1OXSC 1P8LA 2DGYA 4PMWA 5K36G 4JI1Q 4JV5Q 2IX1A 3M7NA 2CWAA 3H3VH 1UE7A 4A4IA 3SGIA 2K75A 4BY7G 1KAWA 3CCSA 3M4QA 4RMFA 1L1OC 1SFOH 1PYBA 2HQLA 3K81C 1N36L 4A3DG 4OWTB 4R4CA 2H5XA 3RN2A 3I7FA 5LMUQ 2UUCQ 3K7UC 1J6QA 1CKNB 2BH2A 5IE8A 1JT8A 1IXRA 2B63H 2I0QA 5HGQA 4RG1A 1MJCA 2KCTA 1K0RA 2LSSA 5M5XH 2JA5G 2JEBI 1MKHA 4EX5A 4WJ4A 3BZCA 1N32L 1A62A 4JI8Q 3PUYA 3CC7A 1YJ9A 5C0XJ 4A3BH 1HNWQ 1WFQA 4DR1L 2VY3A 3FKIG 3A74A 3GTPH 3KDFB 3VDYA 4A3DH 3ERSX 4P72A 4B3ML 1BBUA 2HT1A 1HZAA 4R4QA 2QEXA 3F2DA 3T1YL 2UXDQ 4JYAL 4LF9Q 4YWMA 2WB1E 2VQEQ 1YITA 4K0KQ 3NEMA 1J5EL 4DV6L 1VQBA 1JJCB 3FP9A 2JA5H 4JI1L 1NJIC 5C4JH 4JV5L 2Z0SA 1PH8A 2Z6KC 3HOWG 2K5HA 1ASYA 5C4XG 1G51A 1YVCA 3OW2A 2CFMA 1OXVA 2NN6G 5C44G 4IPGA 4A3LG 4DR4Q 3FKIH 1QZGA 4A3KG 1E22A 2C35B 1NMGA 1X9NA 1XMOQ 5LMUL 2UUCL 1HZCA 4JC0A 1A63A 3UDFA 1B7YB 5C3EG 5IYDH 4C3HH 2EQSA 3CCUA 4KLKA 4GS3A 4AYBG 3A0JA 2FXQA 3KF6A 1OXTA 4LFAQ 1Q81C 4LF5Q 1JE5A 1FL0A 1VQJA 5C0XI 3G71A 3HOWH 3KF8B 4JI8L 1LYLA 4NPSA 1EOVA 5C4XH 1OTCA 2NZHA 4JG2A 4AIMA 1QVCA 3G6EA 1MIUA 2ZJPA 4JI3Q 1HNWL 3I4MH 4A3LH 1LTLA 1Z9FA 2YU9H 1YI2A 4DV2Q 4GOPB 4A3KH 4R4TA 3UE0A 2R7DA 2UXDL 3HOZG 2UUBQ 5C3EH 1GVPA 4LF9L 4X6AH 2N8NA 2VQEL 5M3MH 1CKNA 4JI5Q 4K0KL 2B3GA 5GAHC 1TWAH 1VQIA 2PMZE 3PUZA 4GKJQ 2JA7G 2HHHQ 2WAQE 1OXXK 2PI2E 4YHHQ 4DV1Q 1K9MC 3S14H 4JOIC 3I4OA 4YY3L 1TXYA 2PNHA 4A3EG 3CCRA 2PQAB 2F52A 4DR4L 3F2BA 5JEAG 5IYBG 1SN8A 1WCMG 1YHBA 3S1RH 1PH9A 2CCZA 2JEAI 4YWLA 1WYDA 1XMOL 3KDFA 1VQ4A 1CSQA 1YNXA 4BY1G 2RHSB 3HOZH 1M90C 4QL5A 1YEZA 2XGTA 5JEAJ 1KXLA 4Y52H 2E8GA 1U0LA 4LFAL 1GKHA 4HJAA 4LF5L 4IFDI 2Q2HA 2JA7H 3CCJA 4WJ3M 3DM3A 4LFBQ 4LUVA 2UXBQ 2ZJQA 4JBKA 3CPWA 4JI3L 1VQAA 3ER0A 4GN3B 4ALPA 4EQ5A 5IY0A 1KRSA 5IYBH 2ZTDA 1WCMH 2AWNA 4DV2L 2ZM6L 4OX9Q 2JA6G 3M4OH 3HKZG 2R93G 2ZTEA 4BBSH 2K5NA 4YCUA 1I6HH 1PFSA 4JI5L 1HZ9A 4HIDA 4HIOA 1PH6A 4NB3A 4IPDA 4B3MQ 2F4VQ 4DUYQ 2D0PA 3KLWA 2R92G 1N33Q 4GKJL 2MO1A 2E2IH 1QUQB 2N78A 2HHHL 1VQHA 4YHHL 2ID0A 5J3BA 4DV1L 5E7NA 1HR0Q 3PO3G 3FHWA 3TQYA 1EYGA 3UDXA 5DLQE 4GNXA 3EBEA 4P75A 1S40A 1DGSA 3E9IA 4LF7Q 1SLJA 3GD7A 4JCVE 4NXNQ 2AWOA 1HH2P 3PUVA 4A3IG 4DUZQ 3J7A5 2A8VA 4B3RQ 2GVAA 4GOPA 4BXXH 1S72A 2R93H 4OWXB 3JAMi 2LXKA 4P71A 1A8VA 4OO1I 1V9PA 2N49A 1RIPA 5AJ3Q 1JJGA 4LWCA 1Q82C 2K50A 1VQ6A 4LFBL 4IO9A 5IYCH 2UXBL 3CP0A 4B3TL 1XNRQ 3UDIA 3BU2A 3CCLA 3PO3H 5C0XG 1IYJB 3S1QH 3BJUA 1VQEA 3W5OA 4X64Q 1PV4A 1Q46A 2PQAA 3B6YA 1VQPA 4C3IH 3CCVA 4OX9L 3CD6A 3RNUA 4DR5Q 2VQFQ 1FJGQ 1AH9A 1QVGA 4BY7H 5JJKA 1LUZA 2AKWB 3STBC 2OQKA 2E2JH 3L7ZC 2F4VL 4DUYL 1VQLA 1K8GA 1N33L 1KD1C 1VQGA 2NVXH 2YTXA 1ASZA 4DR2Q 4YCWA 3BZKA 1HR0L 1NE3A 4H02A 5IWAQ 4JBWA 2R7FA 1YIJA 3S2HH 1CSPA 3KYHC 2CKZB 1HZBA 2K14A 1VS0A 3PCOB 4DV4Q 1RL2A 2E2HH 3J80c 4LF7L 1KIXA 4R1JA 2OWOA 4NXNL 1VQFA 2I5LX 2A19A 2YV5A 3AQQA 4GLVB 4YY3Q 1FGUA 4DUZL 1XMQQ 1EQQA 4R4OA 4B3RL 4GKKQ 2EXDA 2Y0SE 1VQCA 1L2FA 1XTDA 2D62A 3M85A 3GTJH 5AJ3L 2IHFA 2Q2UA 2I5MX 1XNRL 1U5KA 4DV0Q 1QVFA 1PH1A 2BH8A 1QUQA 4IFDG 1TWGH 1UE5A 1YHAA 4X64L 2K52A 1BKBA 1YZ6A 4O0AA 4IPCA 4UPAA 4JI2Q 3H15A 4AQYQ 4A3FG 4LF8Q 2WB1G 1B8AA 4GNXB 4QJFA 4IFDJ 2OCEA 5FLXc 4DR5L 2VQFL 1BVSA 1FJGL 3ULJA 3KOJA 5C44H 1HR0W 1V1QA 3S16H 3GTLH 2Q2TA 3KJOA 5ELOA 4A3CG 2NVTH 4MTNA 3PV0A 2R6GA 2ZM6Q 1GM5A 4UP7A 3GTGH 4DR2L 3WWVA 2KHIA 5IWAL 1HNZQ 1C7YA 1L1OB 2JK8A 1G291 5GADC 3NELA 1VQ5A 2UXCQ 3U50C 1Y1WG 4DR6Q 1QZHA 1YJWA 4DV4L 4A93G 5EAYA 4IPHA 4A3FH 3GTOH 4A3MG 1NBWA 4LNQA 2LXJA 1KRTA 3RLFA 4OO1G 1XMQL 2ZJRA 4R4IA 3TEHB 5IP9G 3I4NG 2OTJA 2BA1A 3PF5A 4GKKL 3JAMc 3LGJA 4A3CH 1T9HA 1TWFH 4UY8C 3J80i 3RN5A 1WI5A 4X62Q 1VQKA 4C2MH 1K73C 1N9WA 3UDGA 2AMCB 4IOCA 3CF5A 1PH5A 4XIGS 4DKAC 4DV0L 3RLOA 1E3PA 3OTOL 1K8AC 4OONA 1VQ8A 3HOYG 1MJEA 2YTVA 4QQBX 4JI2L 4L5QA 2NZOA 1E7ZA 3J81i 4AQYL 1VQ7A 4X65Q 3ICEA 3PF4A 1I3QH 2RF4A 3D0FA 4LF8L 4B3TQ 4DV5Q 4Y7NH 4A3EH 5IP9H 3I4NH 1X55A 2B29A 1VQ9A 4YWKA 3U4ZA 2WAQG 1SMXA 2RHQB 1HJPA 3U4VA 3CPFA 5M3FG 1JB7A 1UE6A 4BY1H 5GROA 3F2CA 2CWPA 1X65A 1I50H 1HNZL 1BBWA 1HNXQ 3K8AA 4BA1I 1E1TA 4DV3Q 2UXCL 2VW9A 1PA6A 3CCMA 4X66Q 4DR6L 2KCMA 3CMAA 3HOUG 2IY5B 3RR5A 2IT1A 5M5WH 1A0IA 5IYDG 1D8LA 4PZ8A 3KFUA 4MZ9A 1WJJA 3HOVG 3GTKH 4JI6Q 4L5TA 1N34Q 2AHOB 4DK6C 1Q86C 1GO3E 4X62L 2R7ZG 1KC8C 3PGZA 4GN4B 2JA6H 3DLLA 5M3FH 3CCEA 5ELNA 1EUJA 1WOCA 1JJ2A 1GD7A 1X3GA 4LW1A 3RZDH 1EIYB 3Q8DA 1EFWA 3S24A 1AE3A 2JQOA 5BR8Q 4A75A 1L1OA 3NENA 3STBD 1VQOA 4LF4Q 2R92H 4X65L 3HOUH 4HJ5A 3S15H 2GN5A 3F8TA 3ULPA 4NXMQ 4DK3C 4DV5L 1UWVA 1VQDA 4HIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RCN A;  3KJP A;  4OXP A;  2JA8 G;  3TRZ A;  2N3S A;  3MEF A;  3CME A;  1S3O A;  4POF A;  1SR3 A;  2R7Z H;  4GOP C;  4L5R C;  4DR7 Q;  2KBN A;  4POG A;  3E0E A;  1Y14 B;  4A3I H;  2ASB A;  5GQO A;  4DV7 Q;  4A3B G;  3E9H A;  3CQZ H;  1I5F A;  3PIP A;  1PH7 A;  1KQS A;  1XPR A;  1HNX L;  3S1N H;  2E5L L;  4DV3 L;  1Q1B A;  2PI2 A;  4X66 L;  2K5V A;  3CXC A;  1EIF A;  3PUX A;  1IL2 A;  4O2D A;  2VZA A;  3HFZ B;  4DAM A;  1SE8 A;  2VUM G;  3HKS A;  3M4P A;  3PIO A;  4B3S Q;  1X54 A;  3EN2 A;  1UE1 A;  1L0W A;  5GAE C;  5LMN Q;  2QGQ A;  4OWW B;  4BBR G;  4JI6 L;  1D7Q A;  1CKO A;  2JA8 H;  2ALY B;  1N34 L;  2OTL A;  4KHZ A;  4GLX A;  3F1Z A;  4TVA B;  3GTQ H;  2NVY H;  4MNO A;  2F3I A;  3IRB A;  4IJL A;  1XPO A;  1N8R C;  5M5Y H;  2Z6K A;  3H3V I;  2VNU D;  1NMF A;  2HIV A;  3D31 A;  3ULL A;  3A5U A;  1IZ6 A;  4AYB E;  3EIV A;  5BR8 L;  3J81 c;  2OQ0 A;  4LF4 L;  4AH6 A;  4HJ9 A;  3AYH B;  1FVI A;  2ES2 A;  2NVQ H;  1NTG A;  2DUD A;  3CW2 C;  2VUM H;  4NXM L;  4A3J G;  4GN5 A;  4L5S A;  2Q2I A;  2V1C C;  2VL6 A;  3AFQ A;  3K80 C;  3RLN A;  3NBH B;  4DPG A;  3OTO Q;  1IBK Q;  4KHP Q;  4DAY B;  4PZ6 A;  2HIX A;  4UP9 A;  4BBR H;  3G4S A;  3CC2 A;  1KHI A;  2GVB A;  2K4K A;  4DR7 L;  3GO5 A;  2YYZ A;  4J15 A;  5H1S E;  4DV7 L;  1R9T H;  4DR3 Q;  1IBM Q;  4JI7 Q;  1Z47 A;  4APV A;  3I4M G;  1E1O A;  3GTM H;  4HIM A;  2I5H A;  2KEN A;  2CQO A;  4LUZ A;  4IJH A;  4FDB A;  1E24 A;  1PH3 A;  2EIF A;  4B3S L;  4A3J H;  2JA9 A;  1Y1V G;  2Y0S G;  1EQR A;  5M3M G;  1PVO A;  5LMN L;  3MXN B;  3TRE A;  1XNQ Q;  3TS2 A;  3GDE A;  1K3R A;  2JE6 I;  1JMC A;  1UEB A;  3ZJY C;  3L2P A;  4IOA A;  1TWC H;  1Q7Y C;  5IP7 G;  1PHJ A;  4JBJ A;  3OYY A;  4JI4 Q;  1XPU A;  1PYS B;  2IX0 A;  2ZTC A;  1NY4 A;  3JC6 6;  4A3G G;  3I56 A;  1Q1E A;  1H95 A;  2UUA Q;  4JOI A;  2MNA A;  5HY6 A;  2UU9 Q;  1Q8K A;  1EWI A;  5FJ8 G;  4JI0 Q;  3TS0 A;  3G48 A;  3T1H Q;  2MQH A;  4LF6 Q;  4QIW E;  3W1G A;  4QY7 A;  1VQN A;  4ME3 A;  3M9B A;  1Y1V H;  1IBK L;  4P73 A;  1Y1W H;  4A93 H;  4KHP L;  1V43 A;  2VS1 A;  1C9O A;  2L15 A;  3A5Z B;  4A3M H;  3M3Y H;  3PO2 G;  4BA2 I;  3HOX G;  5IP7 H;  1YJN A;  2A1A A;  1IBL Q;  1O7I A;  4DR3 L;  1IBM L;  1I94 Q;  3H0G G;  4JI7 L;  3AEV A;  3PUW A;  4A3G H;  3HKZ E;  3S1M H;  1B70 B;  5JJI A;  4KI0 A;  4UP8 A;  4LFC Q;  4LUO A;  2NN6 I;  3L0O A;  5FJ8 H;  5LMN W;  4JBM A;  3UE1 A;  2JJQ A;  3AFP A;  3PSI A;  5FLM G;  4A76 A;  1P16 A;  3J81 j;  1VQM A;  1N36 Q;  2XTI A;  3HOY H;  4BBS G;  3I2Z A;  2E5L Q;  1SRU A;  5JJL A;  1XNQ L;  1OXU A;  1YHQ A;  3K0X A;  1W2B A;  1G6P A;  3CAM A;  2MFI A;  4YCV A;  4C3J H;  2WFW A;  1TWH H;  2BA0 A;  3PO2 H;  4PG3 A;  3HOX H;  1K83 H;  1LM0 A;  4JI4 L;  1VCI A;  3CC4 A;  1YBY A;  1X3E A;  1SRO A;  5IT9 c;  3H0G H;  4PZ7 A;  1XJV A;  2UUA L;  2IHE A;  2YTY A;  4P74 A;  2UU9 L;  1W3S A;  4JI0 L;  5GAG C;  1KL9 A;  1C0A A;  1AE2 A;  3T1H L;  4LF6 L;  1N32 Q;  1X56 A;  1X6O A;  5FLM H;  4HJ7 A;  2UUB L;  4BXX G;  2QA4 A;  4DR1 Q;  4TQU S;  3K7A H;  1Q12 A;  1CKM A;  2KHJ A;  4DNI A;  3I55 A;  4HJ8 A;  1M1K C;  1PH2 A;  1CUK A;  3T1Y Q;  3W1B A;  3J7Z C;  3CCQ A;  4XTC S;  4GNX C;  1PH4 A;  3KF6 B;  5IYC G;  1IBL L;  3U58 A;  2B63 G;  3S17 H;  4JYA Q;  2D0O A;  2MO0 A;  4QGU A;  1I94 L;  4GLA C;  2ATW A;  3HOV H;  3RZO H;  3S2D H;  2WP8 J;  1X3F A;  4LFC L;  4DV6 Q;  1J5E Q;  1OXS C;  1P8L A;  2DGY A;  4PMW A;  5K36 G;  4JI1 Q;  4JV5 Q;  2IX1 A;  3M7N A;  2CWA A;  3H3V H;  1UE7 A;  4A4I A;  3SGI A;  2K75 A;  4BY7 G;  1KAW A;  3CCS A;  3M4Q A;  4RMF A;  1L1O C;  1SFO H;  1PYB A;  2HQL A;  3K81 C;  1N36 L;  4A3D G;  4OWT B;  4R4C A;  2H5X A;  3RN2 A;  3I7F A;  5LMU Q;  2UUC Q;  3K7U C;  1J6Q A;  1CKN B;  2BH2 A;  5IE8 A;  1JT8 A;  1IXR A;  2B63 H;  2I0Q A;  5HGQ A;  4RG1 A;  1MJC A;  2KCT A;  1K0R A;  2LSS A;  5M5X H;  2JA5 G;  2JEB I;  1MKH A;  4EX5 A;  4WJ4 A;  3BZC A;  1N32 L;  1A62 A;  4JI8 Q;  3PUY A;  3CC7 A;  1YJ9 A;  5C0X J;  4A3B H;  1HNW Q;  1WFQ A;  4DR1 L;  2VY3 A;  3FKI G;  3A74 A;  3GTP H;  3KDF B;  3VDY A;  4A3D H;  3ERS X;  4P72 A;  4B3M L;  1BBU A;  2HT1 A;  1HZA A;  4R4Q A;  2QEX A;  3F2D A;  3T1Y L;  2UXD Q;  4JYA L;  4LF9 Q;  4YWM A;  2WB1 E;  2VQE Q;  1YIT A;  4K0K Q;  3NEM A;  1J5E L;  4DV6 L;  1VQB A;  1JJC B;  3FP9 A;  2JA5 H;  4JI1 L;  1NJI C;  5C4J H;  4JV5 L;  2Z0S A;  1PH8 A;  2Z6K C;  3HOW G;  2K5H A;  1ASY A;  5C4X G;  1G51 A;  1YVC A;  3OW2 A;  2CFM A;  1OXV A;  2NN6 G;  5C44 G;  4IPG A;  4A3L G;  4DR4 Q;  3FKI H;  1QZG A;  4A3K G;  1E22 A;  2C35 B;  1NMG A;  1X9N A;  1XMO Q;  5LMU L;  2UUC L;  1HZC A;  4JC0 A;  1A63 A;  3UDF A;  1B7Y B;  5C3E G;  5IYD H;  4C3H H;  2EQS A;  3CCU A;  4KLK A;  4GS3 A;  4AYB G;  3A0J A;  2FXQ A;  3KF6 A;  1OXT A;  4LFA Q;  1Q81 C;  4LF5 Q;  1JE5 A;  1FL0 A;  1VQJ A;  5C0X I;  3G71 A;  3HOW H;  3KF8 B;  4JI8 L;  1LYL A;  4NPS A;  1EOV A;  5C4X H;  1OTC A;  2NZH A;  4JG2 A;  4AIM A;  1QVC A;  3G6E A;  1MIU A;  2ZJP A;  4JI3 Q;  1HNW L;  3I4M H;  4A3L H;  1LTL A;  1Z9F A;  2YU9 H;  1YI2 A;  4DV2 Q;  4GOP B;  4A3K H;  4R4T A;  3UE0 A;  2R7D A;  2UXD L;  3HOZ G;  2UUB Q;  5C3E H;  1GVP A;  4LF9 L;  4X6A H;  2N8N A;  2VQE L;  5M3M H;  1CKN A;  4JI5 Q;  4K0K L;  2B3G A;  5GAH C;  1TWA H;  1VQI A;  2PMZ E;  3PUZ A;  4GKJ Q;  2JA7 G;  2HHH Q;  2WAQ E;  1OXX K;  2PI2 E;  4YHH Q;  4DV1 Q;  1K9M C;  3S14 H;  4JOI C;  3I4O A;  4YY3 L;  1TXY A;  2PNH A;  4A3E G;  3CCR A;  2PQA B;  2F52 A;  4DR4 L;  3F2B A;  5JEA G;  5IYB G;  1SN8 A;  1WCM G;  1YHB A;  3S1R H;  1PH9 A;  2CCZ A;  2JEA I;  4YWL A;  1WYD A;  1XMO L;  3KDF A;  1VQ4 A;  1CSQ A;  1YNX A;  4BY1 G;  2RHS B;  3HOZ H;  1M90 C;  4QL5 A;  1YEZ A;  2XGT A;  5JEA J;  1KXL A;  4Y52 H;  2E8G A;  1U0L A;  4LFA L;  1GKH A;  4HJA A;  4LF5 L;  4IFD I;  2Q2H A;  2JA7 H;  3CCJ A;  4WJ3 M;  3DM3 A;  4LFB Q;  4LUV A;  2UXB Q;  2ZJQ A;  4JBK A;  3CPW A;  4JI3 L;  1VQA A;  3ER0 A;  4GN3 B;  4ALP A;  4EQ5 A;  5IY0 A;  1KRS A;  5IYB H;  2ZTD A;  1WCM H;  2AWN A;  4DV2 L;  2ZM6 L;  4OX9 Q;  2JA6 G;  3M4O H;  3HKZ G;  2R93 G;  2ZTE A;  4BBS H;  2K5N A;  4YCU A;  1I6H H;  1PFS A;  4JI5 L;  1HZ9 A;  4HID A;  4HIO A;  1PH6 A;  4NB3 A;  4IPD A;  4B3M Q;  2F4V Q;  4DUY Q;  2D0P A;  3KLW A;  2R92 G;  1N33 Q;  4GKJ L;  2MO1 A;  2E2I H;  1QUQ B;  2N78 A;  2HHH L;  1VQH A;  4YHH L;  2ID0 A;  5J3B A;  4DV1 L;  5E7N A;  1HR0 Q;  3PO3 G;  3FHW A;  3TQY A;  1EYG A;  3UDX A;  5DLQ E;  4GNX A;  3EBE A;  4P75 A;  1S40 A;  1DGS A;  3E9I A;  4LF7 Q;  1SLJ A;  3GD7 A;  4JCV E;  4NXN Q;  2AWO A;  1HH2 P;  3PUV A;  4A3I G;  4DUZ Q;  3J7A 5;  2A8V A;  4B3R Q;  2GVA A;  4GOP A;  4BXX H;  1S72 A;  2R93 H;  4OWX B;  3JAM i;  2LXK A;  4P71 A;  1A8V A;  4OO1 I;  1V9P A;  2N49 A;  1RIP A;  5AJ3 Q;  1JJG A;  4LWC A;  1Q82 C;  2K50 A;  1VQ6 A;  4LFB L;  4IO9 A;  5IYC H;  2UXB L;  3CP0 A;  4B3T L;  1XNR Q;  3UDI A;  3BU2 A;  3CCL A;  3PO3 H;  5C0X G;  1IYJ B;  3S1Q H;  3BJU A;  1VQE A;  3W5O A;  4X64 Q;  1PV4 A;  1Q46 A;  2PQA A;  3B6Y A;  1VQP A;  4C3I H;  3CCV A;  4OX9 L;  3CD6 A;  3RNU A;  4DR5 Q;  2VQF Q;  1FJG Q;  1AH9 A;  1QVG A;  4BY7 H;  5JJK A;  1LUZ A;  2AKW B;  3STB C;  2OQK A;  2E2J H;  3L7Z C;  2F4V L;  4DUY L;  1VQL A;  1K8G A;  1N33 L;  1KD1 C;  1VQG A;  2NVX H;  2YTX A;  1ASZ A;  4DR2 Q;  4YCW A;  3BZK A;  1HR0 L;  1NE3 A;  4H02 A;  5IWA Q;  4JBW A;  2R7F A;  1YIJ A;  3S2H H;  1CSP A;  3KYH C;  2CKZ B;  1HZB A;  2K14 A;  1VS0 A;  3PCO B;  4DV4 Q;  1RL2 A;  2E2H H;  3J80 c;  4LF7 L;  1KIX A;  4R1J A;  2OWO A;  4NXN L;  1VQF A;  2I5L X;  2A19 A;  2YV5 A;  3AQQ A;  4GLV B;  4YY3 Q;  1FGU A;  4DUZ L;  1XMQ Q;  1EQQ A;  4R4O A;  4B3R L;  4GKK Q;  2EXD A;  2Y0S E;  1VQC A;  1L2F A;  1XTD A;  2D62 A;  3M85 A;  3GTJ H;  5AJ3 L;  2IHF A;  2Q2U A;  2I5M X;  1XNR L;  1U5K A;  4DV0 Q;  1QVF A;  1PH1 A;  2BH8 A;  1QUQ A;  4IFD G;  1TWG H;  1UE5 A;  1YHA A;  4X64 L;  2K52 A;  1BKB A;  1YZ6 A;  4O0A A;  4IPC A;  4UPA A;  4JI2 Q;  3H15 A;  4AQY Q;  4A3F G;  4LF8 Q;  2WB1 G;  1B8A A;  4GNX B;  4QJF A;  4IFD J;  2OCE A;  5FLX c;  4DR5 L;  2VQF L;  1BVS A;  1FJG L;  3ULJ A;  3KOJ A;  5C44 H;  1HR0 W;  1V1Q A;  3S16 H;  3GTL H;  2Q2T A;  3KJO A;  5ELO A;  4A3C G;  2NVT H;  4MTN A;  3PV0 A;  2R6G A;  2ZM6 Q;  1GM5 A;  4UP7 A;  3GTG H;  4DR2 L;  3WWV A;  2KHI A;  5IWA L;  1HNZ Q;  1C7Y A;  1L1O B;  2JK8 A;  1G29 1;  5GAD C;  3NEL A;  1VQ5 A;  2UXC Q;  3U50 C;  1Y1W G;  4DR6 Q;  1QZH A;  1YJW A;  4DV4 L;  4A93 G;  5EAY A;  4IPH A;  4A3F H;  3GTO H;  4A3M G;  1NBW A;  4LNQ A;  2LXJ A;  1KRT A;  3RLF A;  4OO1 G;  1XMQ L;  2ZJR A;  4R4I A;  3TEH B;  5IP9 G;  3I4N G;  2OTJ A;  2BA1 A;  3PF5 A;  4GKK L;  3JAM c;  3LGJ A;  4A3C H;  1T9H A;  1TWF H;  4UY8 C;  3J80 i;  3RN5 A;  1WI5 A;  4X62 Q;  1VQK A;  4C2M H;  1K73 C;  1N9W A;  3UDG A;  2AMC B;  4IOC A;  3CF5 A;  1PH5 A;  4XIG S;  4DKA C;  4DV0 L;  3RLO A;  1E3P A;  3OTO L;  1K8A C;  4OON A;  1VQ8 A;  3HOY G;  1MJE A;  2YTV A;  4QQB X;  4JI2 L;  4L5Q A;  2NZO A;  1E7Z A;  3J81 i;  4AQY L;  1VQ7 A;  4X65 Q;  3ICE A;  3PF4 A;  1I3Q H;  2RF4 A;  3D0F A;  4LF8 L;  4B3T Q;  4DV5 Q;  4Y7N H;  4A3E H;  5IP9 H;  3I4N H;  1X55 A;  2B29 A;  1VQ9 A;  4YWK A;  3U4Z A;  2WAQ G;  1SMX A;  2RHQ B;  1HJP A;  3U4V A;  3CPF A;  5M3F G;  1JB7 A;  1UE6 A;  4BY1 H;  5GRO A;  3F2C A;  2CWP A;  1X65 A;  1I50 H;  1HNZ L;  1BBW A;  1HNX Q;  3K8A A;  4BA1 I;  1E1T A;  4DV3 Q;  2UXC L;  2VW9 A;  1PA6 A;  3CCM A;  4X66 Q;  4DR6 L;  2KCM A;  3CMA A;  3HOU G;  2IY5 B;  3RR5 A;  2IT1 A;  5M5W H;  1A0I A;  5IYD G;  1D8L A;  4PZ8 A;  3KFU A;  4MZ9 A;  1WJJ A;  3HOV G;  3GTK H;  4JI6 Q;  4L5T A;  1N34 Q;  2AHO B;  4DK6 C;  1Q86 C;  1GO3 E;  4X62 L;  2R7Z G;  1KC8 C;  3PGZ A;  4GN4 B;  2JA6 H;  3DLL A;  5M3F H;  3CCE A;  5ELN A;  1EUJ A;  1WOC A;  1JJ2 A;  1GD7 A;  1X3G A;  4LW1 A;  3RZD H;  1EIY B;  3Q8D A;  1EFW A;  3S24 A;  1AE3 A;  2JQO A;  5BR8 Q;  4A75 A;  1L1O A;  3NEN A;  3STB D;  1VQO A;  4LF4 Q;  2R92 H;  4X65 L;  3HOU H;  4HJ5 A;  3S15 H;  2GN5 A;  3F8T A;  3ULP A;  4NXM Q;  4DK3 C;  4DV5 L;  1UWV A;  1VQD A;  4HIK A; 
#chains in the Genus database with same CATH topology
 3GV3 A;  4OXP A;  2JA8 G;  3TRZ A;  3WOF A;  1YNJ D;  2R7Z H;  4L5R C;  2KBN A;  1Y14 B;  4A3I H;  2JXM B;  5EPJ A;  1KQS A;  2X6L A;  5KGU A;  1I4X A;  1F9P A;  1Q1B A;  2PI2 A;  3MVV A;  2KUM A;  2Z8L A;  3PIO A;  1X54 A;  1L0W A;  4BBR G;  4DK1 A;  4JI6 L;  1N34 L;  4HAE A;  1IHZ A;  3DWA A;  1EYD A;  5D14 A;  3GTQ H;  1U9R A;  4MNO A;  2F3I A;  3IRB A;  1VF5 C;  1TWC B;  2AQ3 B;  1AZQ A;  3H3V I;  3CKI B;  3A5U A;  1IZ6 A;  1UAP A;  2DNC A;  1FVI A;  3AYH B;  4H7B A;  2DUD A;  1BF4 A;  3CW2 C;  4NXM L;  2Q2I A;  3RLN A;  3NHH A;  1TY2 A;  5IT9 L;  4DAY B;  1O80 A;  3G4S A;  1GUO A;  2K5Q A;  2K04 A;  1ILQ A;  3GO5 A;  4QCL A;  2YYZ A;  4J15 A;  3M3Y B;  3IL8 A;  1R9T H;  1NR4 A;  3I90 A;  5CV4 A;  4APV A;  5I2X A;  3I4M G;  2K6A A;  1EYC A;  2NUC A;  4QUC A;  1B3A A;  2WAC A;  4LUZ A;  4RKL A;  1E24 A;  2EOT A;  2FMM A;  3KUP A;  1PH3 A;  5IGC A;  4A3J H;  3VR4 A;  2A6H D;  3NQI A;  1EQR A;  3TBI B;  5LMN L;  3TRE A;  3HGB A;  2H1E A;  2EYL A;  3GDE A;  3ITP A;  4BWG B;  1PHJ A;  3OYY A;  2ZTC A;  4JPB W;  1H95 A;  1NY4 A;  1FD7 D;  4A3G G;  1LT5 D;  2L55 A;  2UUA Q;  4JOI A;  3C2P A;  2MNA A;  1LT4 D;  2UU9 Q;  1Q8K A;  5FJ8 G;  4JI0 Q;  5CBA E;  3T1H Q;  2A6H C;  5E4W C;  3C3L A;  1A2T A;  4ME3 A;  3M9B A;  1LLR D;  4KMU C;  4P73 A;  1E0B A;  2VS1 A;  2EYM A;  4A3M H;  3PO2 G;  4BA2 I;  4DAP A;  1G6Z A;  1JCK B;  4EVO A;  1IBM L;  4JI7 L;  1WTX A;  3S1M H;  1B70 B;  3BDL A;  2NN6 I;  3S2D B;  3SK6 A;  2FMC A;  1P16 A;  4RGM A;  3HOY H;  2XTI A;  4BBS G;  5JVG 3;  1XNQ L;  1YHQ A;  3K0X A;  1SFO B;  2WV6 D;  3F2U A;  3CAM A;  3TP7 A;  2MFI A;  4YCV A;  2WFW A;  1V1O A;  3J80 E;  1YBY A;  4IUV A;  4V0B A;  1X3E A;  1SRO A;  3H0G H;  1GHJ A;  1XJV A;  2IHE A;  1W3S A;  2F0K A;  1TS2 A;  1LO5 D;  2UUB L;  4PNY A;  2DJG C;  4TQU S;  1Q12 A;  3I55 A;  1M1K C;  3NUC A;  3MXN A;  3BYT B;  2J0T D;  1BO0 A;  3H09 A;  3KF6 B;  2B63 G;  3S17 H;  1DXM A;  2D0O A;  2MO0 A;  5KYL A;  3HOV H;  2WP8 J;  1X3F A;  4LFC L;  4DV6 Q;  1HHV A;  1P8L A;  5HGT A;  2IX1 A;  3M7N A;  2CWA A;  3H3V H;  4U67 3;  3M4Q A;  4RMF A;  1L1O C;  1PYB A;  2HQL A;  3X3N A;  1KDA A;  3K5N A;  4OWT B;  3RN2 A;  4HED A;  4EGV A;  1J6Q A;  4DFA A;  1IXR A;  1MI2 A;  4RG1 A;  1MJC A;  4ZKC B;  1LTT D;  4KKS A;  5K36 H;  4EQO A;  1CTM A;  1N32 L;  1EU3 A;  1YJ9 A;  1SXT A;  1HNW Q;  2RA4 A;  2R61 A;  1WFQ A;  2VY3 A;  1EFI D;  3T56 B;  3GTP H;  4A3D H;  1Y8O B;  1QOH A;  3I4M B;  4F87 A;  3T1Y L;  3D4D A;  4G7H C;  3IFD A;  3LNN A;  4K0K Q;  1QB5 D;  1VQB A;  1QNU A;  2RCF A;  1TWA B;  4MN3 A;  5EBC A;  1ILP A;  1ASY A;  3BS1 A;  1G51 A;  3BYY B;  4IPG A;  4A3L G;  5COY A;  1SBB B;  1X9N A;  1J8I A;  5LMU L;  4UAI A;  1A63 A;  4CKC A;  1HUM A;  3PMF A;  2J4X A;  3HRZ C;  2VB2 X;  1O7Y A;  4AYB G;  1OXT A;  2F0H A;  1JE5 A;  1FL0 A;  3KF8 B;  5C4X H;  4JI3 Q;  4AIM A;  1D1I A;  2NN6 H;  1Z9F A;  1X3Q A;  4GOP B;  5FO7 B;  2UXD L;  1KNE A;  1ML0 D;  1NSN S;  5C3X A;  1AZP A;  1B2T A;  2B3G A;  1KTK A;  4BBS B;  5J1Z A;  1HTP A;  2WAQ E;  4YHH Q;  4A3E G;  3U9O A;  1LV9 A;  4DR4 L;  3SEB A;  5JEA G;  4R9W A;  5IYB G;  3F2B A;  1YHB A;  4BS9 A;  5I4D A;  1XMO L;  3KDF A;  1M90 C;  1MD2 D;  4QB4 A;  4LFA L;  2R93 B;  3BVG A;  1HTL D;  4XT1 B;  3T16 A;  2JA7 H;  3DM3 A;  2UXB Q;  1W6J A;  2NBF A;  2X6G A;  3C1F A;  1STB A;  2ZTD A;  3IFT A;  1WCM H;  1DZ1 A;  1BCP B;  3HKZ G;  4C3I B;  4YCU A;  1I6H H;  3TDQ A;  1PFS A;  1HZ9 A;  2IX3 A;  2D0P A;  3KLW A;  4GKJ L;  1PMR A;  2XRS D;  3L3O C;  4DV1 L;  4XQQ A;  3TQY A;  1EYG A;  5DLQ E;  4LF7 Q;  1AFP A;  4FO2 A;  4HMI A;  2F0W A;  5G3L D;  2KEC A;  4P71 A;  1A15 A;  1A8V A;  1NNX A;  4KKU A;  3A54 A;  3OIP A;  5JVH 3;  4KD4 A;  1RIP A;  1JJG A;  4ME5 A;  3PQI A;  1Q82 C;  2K50 A;  4IO9 A;  1ET9 A;  3CP0 A;  5FO8 B;  1CT1 D;  3PO3 H;  5C0X G;  2F0V A;  1PV4 A;  1WTO A;  3SK5 A;  4ZKB B;  3CCV A;  4OX9 L;  3DWQ A;  1ET6 A;  1YNN D;  4H13 C;  3QOJ A;  2H4O A;  2F4V L;  4DUY L;  3CHB D;  1K8G A;  1VQG A;  1EQV A;  2YTX A;  5J39 A;  4ILW A;  4PMC A;  3S2H H;  3KYH C;  1VS0 A;  1J9O A;  5M9O A;  3J80 c;  2PCF B;  1KIX A;  5ELF A;  2XWJ B;  2I5L X;  4XT3 B;  4QF4 A;  4GKK Q;  1EYA A;  1L2F A;  2JP1 A;  1JWS D;  2N55 A;  3M85 A;  3E3X A;  1ENF A;  4C2M B;  2I5M X;  1A3V A;  1QVF A;  1PH1 A;  1QUQ A;  4IFD G;  3QG1 A;  1UE5 A;  1YHA A;  2K52 A;  4A3F G;  4IPC A;  5IT9 E;  1VMP A;  5T1G A;  2WB1 G;  1ZYR C;  1B8A A;  3ND9 A;  4GNX B;  1HCZ A;  4QJF A;  1XWE A;  1DD2 A;  2G9D A;  4DR5 L;  1PFM A;  1SMY D;  4K8I A;  3KOJ A;  3UI2 A;  5C44 H;  1HR0 W;  4Y7N B;  1B3Q A;  5ELO A;  4A3E B;  2NVT H;  1TR5 A;  3PV0 A;  2XN9 C;  3QJY A;  2ZM6 Q;  4UP7 A;  1WD1 A;  3VR6 A;  2KHI A;  2M00 A;  2DY7 A;  2JK8 A;  2V4D A;  5GAD C;  3NEL A;  1Y1W G;  1RF2 D;  1L0Y B;  4C56 C;  4DV4 L;  3DWP A;  3M4Y A;  1NBW A;  2B2W C;  3VR5 A;  4F88 A;  3NXW A;  2OTJ A;  2BA1 A;  5M5W B;  3SK4 A;  1T9H A;  4FXK C;  1WI5 A;  3RN5 A;  2XWB B;  1N9W A;  3KLS A;  2AMC B;  3NWS A;  4IOC A;  1Q3L A;  1PH5 A;  1F2Y A;  2K32 A;  1K8A C;  2LS0 1;  1S4Z A;  3OHX C;  4JI2 L;  2NZO A;  1DYQ A;  3J81 i;  1VQ7 A;  3K57 A;  3J80 L;  5I2Y A;  2F0N A;  5IP9 H;  2B29 A;  4ODG A;  2C5C A;  4KN4 C;  3NWT A;  2XIW A;  1PRT D;  1RHP A;  4C1N K;  5GRO A;  4BY1 H;  1HNZ L;  3KBX A;  3K8A A;  4BA1 I;  1E1T A;  4DV3 Q;  3QIA A;  3SVM A;  5IGG A;  4DR6 L;  3S1N B;  3CMA A;  5E1F A;  1NAP A;  5K5P A;  4CKE A;  1A0I A;  3V96 A;  3KFU A;  2PW7 A;  2F0L A;  4L5T A;  3BZD B;  1Q86 C;  2F03 A;  3DLL A;  1G2S A;  5ELN A;  1WOC A;  4LW1 A;  1G91 A;  3A8I E;  3LWE A;  1AE3 A;  3HOU H;  5C4Z A;  2GN5 A;  4KKT A;  4ULL A;  2QDB A;  3AMU A;  2K5D A;  1EIH A;  5GQO A;  2VUM B;  1CZG A;  4NDX A;  2RCN A;  3MEF A;  4GOP C;  4POG A;  4CJ0 B;  2Z1C A;  2ASB A;  1B50 A;  2A6E D;  3CQZ H;  5A35 A;  1HNX L;  2AQ1 B;  4X66 L;  2K5V A;  1Y8P B;  5DNF A;  3GTM B;  1IL2 A;  2KEE A;  1MSG A;  3TME A;  2QGQ A;  1SE2 A;  4ZLT F;  1D7Q A;  1CKO A;  2JA8 H;  2OTL A;  1STG A;  4HSV A;  4GLX A;  4ZQ3 A;  1K8M A;  4TVA B;  1VMC A;  3ZYY X;  2EY1 A;  1ZKO A;  2TMP A;  3SHL A;  5M5Y H;  5IOD A;  2Z6K A;  3MAQ A;  1NMF A;  1PTO D;  3ULL A;  4LF4 L;  4AYB E;  4FF3 A;  3KK7 A;  2ES2 A;  4HCS A;  3MXG A;  3J7Y W;  4GN5 A;  2V1C C;  2VL6 A;  1STY A;  1IBK Q;  1JOO A;  4KHP Q;  4PZ6 A;  5EJW A;  4BBR H;  1Y1V B;  1Y1W B;  2GVB A;  2K4K A;  4DR7 L;  1BCP C;  2M2L A;  3A7A B;  1PDQ A;  4DV7 L;  4DR3 Q;  4KJO A;  2EE1 A;  2I5H A;  3H91 A;  2CQO A;  4H0L C;  4IJH A;  1SAP A;  4FDB A;  5KNB A;  2G9H D;  5C3W A;  4B3S L;  2KJX A;  2FIN B;  5M3M G;  3MXN B;  3L2P A;  4L63 B;  4IOA A;  5IP7 G;  4JBJ A;  1K8O A;  1U4P A;  4CDD C;  4JI4 Q;  1PYS B;  3I56 A;  1Q1E A;  3HOX B;  5HY6 A;  3DMU A;  2PMZ B;  1K28 A;  3G48 A;  1HQR D;  2MQH A;  2CH4 W;  4XYQ A;  4YIJ A;  4A93 H;  3TP8 A;  5L37 A;  3K7A B;  3A5Z B;  2R3Z A;  2IPK D;  4IUU A;  2L9H A;  4A3G H;  3HKZ E;  4UP8 A;  1GHK A;  4LUO A;  1JC7 A;  5LMN W;  1EEI D;  5FJ8 H;  3KLR A;  2JJQ A;  2MHV A;  5FLM G;  4A76 A;  4B9W A;  1EWC A;  1N36 Q;  2E5L Q;  1OXU A;  4WFN 3;  3D4W A;  3NBH A;  4C3J H;  3PO2 H;  1TWH H;  4PG3 A;  4IAL A;  1K83 H;  3V05 A;  2D5D A;  5IT9 c;  3P20 A;  3TZD A;  1PLF A;  1C0A A;  1AE2 A;  4LF6 L;  1F9Q A;  1X6O A;  4BXX G;  1V8Q A;  1CQV A;  2KHJ A;  2Q8T A;  4B9X A;  1U4R A;  4RHS A;  1JWU D;  4GNX C;  4JYA Q;  1IBL L;  4J1M A;  3OPO A;  1I94 L;  4GLA C;  3RZO H;  1J5E Q;  1OXS C;  4PMW A;  4JI1 Q;  5DEH A;  5FK9 C;  2PPB C;  2F0I A;  2JA5 B;  1UE7 A;  4BY7 G;  4IQZ A;  2EVB A;  3PIP 3;  1EQT A;  1S5E D;  1IW7 C;  4ABN A;  2UUC Q;  3K7U C;  4XQJ A;  2BH2 A;  5IE8 A;  1SDF A;  2B63 H;  1Y8N B;  1OO9 B;  2KCT A;  2VXW A;  3AB9 A;  5M5X H;  1MKH A;  1G8Z D;  2K03 A;  1A62 A;  1PTO H;  3CC7 A;  3PUY A;  4A3B H;  1D5Z C;  5C0X J;  3W3A A;  2KOL A;  4DR1 L;  3HOW B;  3VA5 A;  5KIX A;  3KDF B;  5BN5 A;  3EA6 A;  3ERS X;  1EOT A;  1STH A;  4P72 A;  1BBU A;  1HZA A;  4R4Q A;  2EJF C;  4A3K B;  3BVM A;  4LF9 Q;  4ZUJ A;  2WB1 E;  5EKK A;  2VQE Q;  1YIT A;  5C3E B;  5T1I A;  2EYP A;  4CDF C;  3NEM A;  5M3M B;  1JJC B;  3FP9 A;  3P1H A;  1NJI C;  4JV5 L;  5C4J H;  4FF2 A;  2VB3 X;  3BG3 A;  2KHS A;  2CFM A;  2F0S A;  1SYF A;  3P7J A;  1RKN A;  1GOZ A;  1LAB A;  2F0E A;  3HOZ B;  4GS3 A;  3A0J A;  3NQT A;  1Q81 C;  4LF5 Q;  1PXU A;  2SOB A;  2BOS A;  3BDO A;  5C0X I;  4OEM B;  3G71 A;  1SYG A;  3OWE B;  2RDH A;  4JI8 L;  4NPS A;  2EYF A;  2NZH A;  2PW5 A;  4A3L H;  2ZXP A;  4HCE A;  2YU9 H;  5EQ0 A;  1H9M A;  2KVM A;  2BCO A;  3N52 A;  1RCV D;  1CM9 A;  3DUZ A;  1IKL A;  2A68 C;  2SNM A;  2MUY A;  4JI5 Q;  4P2C B;  4F8M A;  4M1U B;  2PMZ E;  2A5H A;  4HN7 A;  1S5F D;  1WVL A;  3GTG B;  3R2T A;  3NTH A;  1K9M C;  4MHE A;  3S14 H;  4RH6 A;  1TS5 A;  2KCN A;  1LAC A;  3I4O A;  4JOI C;  1Y69 U;  3CCR A;  4Q5V A;  1BNZ A;  2CW0 C;  1SN8 A;  3MWY W;  3S1R H;  4YWL A;  2ZXR A;  1CSQ A;  4I65 A;  4RA8 A;  4QL5 A;  4N8F A;  4Y52 H;  2L1B A;  2EZV A;  4IFD I;  4WOR A;  4WJ3 M;  1EY7 A;  4LFB Q;  1VQA A;  1FNU A;  4EQ5 A;  5IY0 A;  5IYB H;  2AWN A;  4DV2 L;  2ZM6 L;  3M4O H;  2OEO A;  2R93 G;  3SR1 A;  4HTH A;  3HEJ A;  4HIO A;  4BY7 B;  4NB3 A;  2R92 G;  1N33 Q;  2MO1 A;  2F0J A;  5EKI A;  2E2I H;  1QUQ B;  2HHH L;  1STE A;  2ID0 A;  5J3B A;  5I9O A;  1HR0 Q;  2B2U A;  2NVX B;  2QW7 A;  4PMB A;  5FLX L;  1D6E C;  3EFX D;  3UDX A;  4P75 A;  1GUT A;  3E9I A;  2L5T A;  1I4Q A;  4CDC C;  4C3I G;  1SYD A;  4A3I G;  4B3R Q;  4DUZ Q;  3J7A 5;  3D6W A;  1QE6 A;  3VA7 A;  1S72 A;  4DU9 A;  3JAM i;  4NP5 A;  1DON A;  2FHT A;  1V9P A;  3C1E A;  3DEP A;  4UDU C;  5DM6 3;  2KED A;  2K5W A;  2EDG A;  5AJ3 Q;  5IYC H;  2DNE A;  3GTJ B;  4WRD A;  3BU2 A;  3Q22 A;  3S1Q H;  5NUC A;  4TSS A;  3TP6 A;  1Q46 A;  1TWG B;  3B6Y A;  1VQP A;  3IKJ A;  4CJ2 C;  4KTA A;  1AH9 A;  5BN4 A;  5EGT A;  4K6L A;  4KN7 C;  2OQK A;  2E2J H;  3S16 B;  3D3R A;  1X32 A;  3K5O A;  4IUT A;  5C6A A;  2O5I C;  1KAB A;  4DR2 Q;  5IWA Q;  3X3M A;  4JBW A;  2BDN A;  5C0X H;  2K14 A;  2XSC A;  1KDC A;  3PCO B;  1RL2 A;  2E2H H;  4R1J A;  5COR A;  2F0G A;  4NXN L;  1C48 A;  4GLV B;  2HD3 A;  2EYJ A;  1FGU A;  1EQQ A;  4R4O A;  5EKL A;  4E6I A;  1KNA A;  2EXD A;  1VQC A;  4OL7 A;  3MFY A;  4XXE A;  2IHF A;  3Q23 A;  4L8J A;  1XNR L;  2G5D A;  4DV0 Q;  1B1Z A;  2BH8 A;  4N9P A;  4X64 L;  4LK1 C;  1BKB A;  4O0A A;  4UPA A;  3S9W A;  3H15 A;  4AQY Q;  2EXZ A;  1L0X B;  2VQF L;  1FJG L;  4CKB A;  3IAY A;  2WKC A;  4CJ1 B;  3GTL H;  4DK0 A;  4OIK A;  3KJO A;  5JAV A;  2Q2T A;  3I4N B;  4X3T A;  5LHY 1;  2R6G A;  3SXH A;  5FOB B;  3WWV A;  2Q8R E;  3I3C A;  3NPP A;  4IFD H;  3U50 C;  1I50 B;  2K01 A;  4A3F H;  3GTO H;  4A3M G;  2WII B;  4QIW B;  1KRT A;  3RLF A;  4I7A A;  4IUR A;  1XMQ L;  3TEH B;  1X3P A;  1LTR D;  2E2D C;  3LGJ A;  4KD3 A;  4UY8 C;  1TWF H;  1XTC D;  2ICI A;  4X62 Q;  3E6Z X;  2Z6B A;  5IGE A;  1G2T A;  5M3F B;  3HOY G;  4K5V A;  3RZD B;  1C8C A;  2DY8 A;  1E7Z A;  3J7A F;  3PF4 A;  1I3Q H;  4LF8 L;  2R92 B;  3MHB A;  4B3T Q;  4DV5 Q;  3S15 B;  1RJT A;  2B2T A;  1VQ9 A;  1VF7 A;  2L0C A;  1GUS A;  1SMX A;  1HJP A;  2MGS A;  2Z9H A;  3D6C A;  3J81 L;  1FGB D;  3T51 B;  2R7Z B;  4HMJ A;  1X65 A;  1BBW A;  4A3I B;  2UXC L;  3ERO A;  4HR7 B;  2KCM A;  2F1M A;  5IYD G;  4PZ8 A;  4Q0F A;  2EYO A;  1S5B D;  4KY7 A;  3HOV G;  3GTK H;  4JI6 Q;  1PFN A;  1N34 Q;  3C46 A;  1GO3 E;  1U4L A;  1KC8 C;  2PQE A;  3PGZ A;  4GN4 B;  2JA6 H;  3CCE A;  1EUJ A;  1S5D D;  3I91 A;  3GTQ B;  4KK7 A;  2JQO A;  1K3B C;  3EVQ A;  1RD9 D;  4X65 L;  2EY5 A;  4NXM Q;  2Z4H A;  2RDF A;  4HIK A;  3K5M A;  3KJP A;  3U9S A;  1BXT A;  2N3S A;  3KLS X;  3CME A;  4POF A;  1CZW A;  3HP3 A;  3E0E A;  4O1N A;  1I5F A;  3NK9 A;  4JVZ A;  2LKV A;  1TKW B;  1XPR A;  1B4O A;  2E5L L;  1R9T B;  1V1P B;  2F0O A;  3CXC A;  3BDC A;  4O2D A;  2VZA A;  3HFZ B;  4RFB A;  2IJ0 A;  2VUM G;  2WIN B;  4M8A A;  1ENC A;  1UE1 A;  1ESF A;  5GAE C;  5LMN Q;  4OWW B;  4A3J B;  4FVM A;  2ALY B;  1AEX A;  4JW0 A;  1EU4 A;  2NVY H;  5DM7 3;  1ZYR D;  2RKS A;  1JE4 A;  1UNS A;  2HIV A;  3GQB A;  5BR8 L;  2OQ0 A;  4AH6 A;  2NVQ H;  1NTG A;  2N88 A;  1DJR D;  1EY4 A;  4DPG A;  3AFQ A;  3NBH B;  2DN8 A;  2HIX A;  4RGO S;  3NTK A;  1SNP A;  4UP9 A;  4A3M B;  5H1S E;  1IBM Q;  4JI7 Q;  1Z47 A;  4HSP A;  5EPL A;  4HIM A;  4K14 A;  3S1M B;  1B44 D;  3T13 A;  3AU7 A;  1Y1V G;  2Y0S G;  1PVO A;  2BE5 C;  4ZUI A;  1XNQ Q;  3TS2 A;  3HOY B;  4FNF A;  1K3R A;  1UEB A;  3ZJY C;  2OT2 A;  1FYC A;  3LWU A;  1TWC H;  1WTR A;  3JC6 6;  5A2Q L;  2AQ2 B;  3H6M A;  3H0G B;  3TS0 A;  1HRJ A;  5E4X A;  4J6H A;  4QIW E;  2RQX A;  5KYI A;  1SE3 A;  2EYH A;  1A6X A;  3RMH A;  3R3O A;  3HZX A;  3M3Y H;  1SYE A;  5IGB A;  3HOX G;  5IP7 H;  2A1A A;  4ZYS A;  3S17 B;  1CHQ D;  5JJI A;  4KI0 A;  4LFC Q;  3L0O A;  4JBM A;  3HOV B;  3PSI A;  1ICF B;  1SRU A;  5JJL A;  1SNQ A;  1O78 A;  3MZ5 A;  1W2B A;  1G6P A;  3FMC A;  2BA0 A;  1LM0 A;  3CC4 A;  3A8K E;  4PZ7 A;  2UUA L;  2QCP X;  5KNC A;  2YTY A;  4P74 A;  2UU9 L;  4JI0 L;  1TY0 A;  3T1H L;  1N32 Q;  5BN3 A;  1X56 A;  1O7L A;  3OMC A;  5FLM H;  2QA4 A;  3A55 A;  1QIL A;  1CKM A;  4DNI A;  2PNR C;  4HJ8 A;  3R8B A;  3GTP B;  4A3D B;  3T1Y Q;  3J7Z C;  4DGZ A;  3U58 A;  2ATW A;  3TN2 A;  3S2D H;  1HUN A;  1EY5 A;  3KF8 A;  5FLX E;  3K0Y A;  4G7O C;  1TS4 A;  1E2W A;  2SDF A;  4A4I A;  2IWH A;  1WD0 A;  2K75 A;  3CCS A;  1Z6H A;  1SFO H;  3K81 C;  1D5X C;  5CGK A;  1H9R A;  2H5X A;  1SJH D;  4R4C A;  5LMU Q;  3ERQ A;  3MXP A;  1H9S A;  2C9O A;  1JT8 A;  2HDM A;  1SE4 A;  3PIO 3;  1B9M A;  1EY8 A;  5HGQ A;  3QOL A;  1K0R A;  2B2Y A;  1QWY A;  4U68 A;  2JA5 G;  4EX5 A;  1JWM D;  1BCP D;  4DA2 A;  1SNM A;  3FKI G;  5JPM C;  5C4X B;  3VDY A;  3VR2 A;  2QEX A;  2UXD Q;  1QCB D;  5C4H A;  3F2D A;  4C3H G;  5ISR A;  1ENA A;  1F9R A;  3E5S A;  4QMG A;  1PZK D;  2Y0S B;  4DV6 L;  2RDG A;  1HQM C;  1PH8 A;  2Z6K C;  3HOW G;  2RSN A;  1BDO A;  1SNC A;  2K5H A;  4MIU A;  1RTO A;  1HFN A;  1YVC A;  1A2U A;  5C44 G;  1JOQ A;  4DR4 Q;  2EY2 A;  2ZXO A;  2F0M A;  1EWH A;  4A3K G;  1NMG A;  1XX8 A;  3MC0 B;  4LJZ C;  1XMO Q;  4JC0 A;  3UDF A;  1B7Y B;  5C3E G;  2EQS A;  3CCU A;  2FXQ A;  4V19 0;  4K6D A;  2B2V A;  4LFA Q;  3DXJ C;  1SEB D;  2TSS A;  3T53 B;  2L12 A;  1W6K A;  1OTC A;  1LYL A;  2JA7 B;  1EOV A;  4JG2 A;  1HNW L;  4H44 C;  3G6E A;  1MIU A;  3HS0 C;  4IN3 A;  3I4M H;  1STN A;  2F3W A;  1YI2 A;  4KY6 A;  4R4T A;  3UE0 A;  1WCM B;  3HOZ G;  3Q6S A;  5JPN C;  4X6A H;  2A69 C;  1CKN A;  4K0K L;  1EIG A;  5GAH C;  1TWA H;  1I6H B;  1VQI A;  4GKJ Q;  1KLU D;  2LMC B;  2PI2 E;  4DV1 Q;  1ZXT A;  2WKD A;  1TVX A;  2PYK A;  1WTQ A;  4LAA A;  3NP8 A;  5CR3 A;  2JEA I;  1PH9 A;  3NSW A;  1VQ4 A;  1YNX A;  4BY1 G;  2SNS A;  3OMG A;  1EEF D;  5JEA J;  1KXL A;  3NE5 B;  2E8G A;  2XRQ D;  2K28 A;  1GKH A;  1TII D;  2J7Z A;  4FF4 A;  2K1B A;  3EQL C;  2ZJQ A;  1I4P A;  4JI3 L;  1DOK A;  5CMD A;  3ER0 A;  4GN3 B;  4X3K A;  3PO3 B;  1NR2 A;  1IYV A;  4OX9 Q;  4QUF A;  3J81 E;  4F7X A;  4BBS H;  4TRD A;  2K5N A;  1PZI D;  4HID A;  1PH6 A;  4B3M Q;  4IPD A;  2F4V Q;  4DUY Q;  4OIJ A;  2N78 A;  1TU2 B;  1VQH A;  1IW7 D;  4YHH L;  1NUC A;  3FHW A;  4GNX A;  1PFB A;  3A56 A;  3S2H B;  1DGS A;  1F9S A;  1SLJ A;  4JCV E;  2AWO A;  1HH2 P;  3PUV A;  2GVA A;  2A74 C;  1FR3 A;  2R93 H;  4OWX B;  2LXK A;  3FKI B;  4LWC A;  3W2D A;  1DOM A;  1DOL A;  1VQ6 A;  2UXB L;  4B3T L;  4OGQ C;  4C3H B;  2RVL A;  1LT6 D;  3W5O A;  3JAM L;  2PQA A;  4C3I H;  3CD6 A;  5F2D A;  3QWN A;  4DR5 Q;  5JJK A;  1S5C D;  2AKW B;  3STB C;  5C44 B;  1SSO A;  1KD1 C;  2NVT B;  1ASZ A;  1U4M A;  4YCW A;  3BZK A;  1NE3 A;  1BOS A;  1RDP D;  1I4H A;  2R7F A;  3NBI A;  3Q24 A;  1CSP A;  2CKZ B;  1YNJ C;  4DV4 Q;  1NCV A;  3K59 A;  2JSO A;  2OWO A;  4LF7 L;  1VQF A;  4DXF A;  2A19 A;  3AQQ A;  4YY3 Q;  3H3V C;  1CA6 A;  2Y0S E;  1XXG A;  3URY A;  3OW7 A;  4N8X 1;  2Q2U A;  2KA7 A;  1U5K A;  4RCN A;  1HA6 A;  2A68 D;  3H94 A;  4JI2 Q;  3DEO A;  3WDN A;  4K2L A;  5KRU A;  4K5W A;  3FRP B;  4IFD J;  1QG7 A;  2OCE A;  5FLX c;  2I46 A;  1BVS A;  4CGY B;  1H9J A;  3ULJ A;  1V1Q A;  4K5X A;  4A3C G;  2ICE C;  2CW0 D;  5IGD A;  1GM5 A;  1HNZ Q;  4BY1 B;  1R4Q B;  1VQ5 A;  2GA4 B;  1QNK A;  4DR6 Q;  4A93 G;  1YJW A;  3FVQ A;  5EAY A;  4J8Q A;  1CQF A;  1LT3 D;  2LXJ A;  3TP5 A;  2HCC A;  2L11 A;  3I4N G;  3I4L A;  2EY6 A;  4IZ8 A;  3PF5 A;  4GKK L;  4RGT A;  3T4A C;  4EQN A;  2P5Z X;  5A2Q E;  4C2M H;  1VQK A;  4ZRZ A;  2WAQ B;  3OSO A;  4DKA C;  4OO1 G;  4EQP A;  5C5L A;  4QQB X;  3ICE A;  3NTI A;  4C3J G;  2RF4 A;  2DJF C;  3HOU B;  4Y7N H;  1RTN A;  2JN4 A;  1I6V C;  3D4R A;  4A3E H;  1X55 A;  3VR3 A;  1ROD A;  5JEA H;  4YWK A;  2ZT9 C;  1MSH A;  2NTS A;  2RHQ B;  3CPF A;  5M3F G;  1JB7 A;  1K0S A;  1UE6 A;  4XQN A;  4CDE C;  1HNX Q;  2VW9 A;  3CQZ B;  3CCM A;  1EZ6 A;  4X66 Q;  3OOC A;  1WTV A;  1E2V A;  3FEW X;  5ELE A;  3RR5 A;  2IT1 A;  5M5W H;  4MZ9 A;  1WJJ A;  2JYO A;  5EBD A;  5ELC A;  2AHO B;  2R7Z G;  2OF1 A;  2JA8 B;  2O2L D;  1SNO A;  1JJ2 A;  1GD7 A;  2AUK A;  2B8G A;  2F0U A;  2QIL A;  3Q8D A;  3MFG A;  5KEE A;  1EFW A;  4NMZ A;  5M5Y B;  2PO4 A;  4LF4 Q;  1L1O A;  2HQE A;  4FYD A;  1MHW C;  2B2U C;  3GP7 A;  3N6R A;  4HJ5 A;  1D2B A;  4DXG A;  3F8T A;  3ULP A;  1UWV A;  5IYD H;  3OWF A;  1S3O A;  1SR3 A;  4BBR B;  4DR7 Q;  3MXU A;  4DV7 Q;  4A3B G;  1BQQ T;  3E9H A;  3PIP A;  1PH7 A;  4LMQ D;  3S1N H;  4KY5 A;  1I4G A;  4DV3 L;  5JJZ A;  1EIF A;  2F0P A;  3PUX A;  4DAM A;  1SE8 A;  3HKS A;  1IYU A;  3CRK C;  3M4P A;  2HDL A;  4B3S Q;  3J7A V;  3EN2 A;  1LTG D;  2AUJ D;  3E0J A;  1F2M A;  1BR9 A;  4KHZ A;  3F1Z A;  2O4X A;  1XPO A;  2MJ8 A;  4IJL A;  1N8R C;  2O5J C;  2VNU D;  3D31 A;  1JIC A;  3EIV A;  3J81 c;  4HJ9 A;  2VUM H;  4A3J G;  4L5S A;  3K80 C;  3OTO Q;  1ONL A;  3CC2 A;  1KHI A;  4A93 B;  5IIF A;  5CV8 A;  1E1O A;  3GTM H;  4X3S A;  2CVR A;  4DF7 A;  4N9T A;  2KEN A;  4A3G B;  1PRT B;  4DAV A;  1B53 A;  1CHP D;  2EIF A;  2JA9 A;  4NW2 A;  1JMC A;  2JE6 I;  3LX0 A;  3OIQ A;  2Z4I A;  5D65 A;  4FXG C;  1II3 A;  1Q7Y C;  1XPU A;  4C3J B;  3PO2 B;  2IX0 A;  1TWH B;  4RKB A;  4CBV A;  1I4R A;  1K83 B;  2FJ2 A;  1EWI A;  5EPK A;  3TSS A;  3ONA B;  4LF6 Q;  3W1G A;  1E2Z A;  4QY7 A;  1VQN A;  1UUP A;  5I6W A;  1Y1V H;  1IBK L;  1Y1W H;  1D1K A;  5I9P A;  4KHP L;  1H9S B;  1V43 A;  1F77 A;  1C9O A;  2L15 A;  3A8J E;  1XYI A;  3FDT A;  1YJN A;  1IBL Q;  1O7I A;  4DR3 L;  1I94 Q;  3H0G G;  4PV1 C;  3AEV A;  3PUW A;  4G4K A;  4WJW A;  3VYS A;  3RZO B;  3UE1 A;  3AFP A;  1ESR A;  1ICW A;  3J81 j;  1VQM A;  2X69 A;  2EJM A;  2A73 B;  2MPM A;  3I2Z A;  3K5L A;  4O42 A;  2PZU A;  1FNW A;  3HG9 A;  4DAY A;  3HOX H;  2B2T C;  1VCI A;  4JI4 L;  4RWS C;  4FP5 D;  2CHB D;  2B63 B;  4ID6 A;  4TKO B;  5GAG C;  1KL9 A;  1GXD C;  4JK1 C;  4S3S A;  2NYZ D;  3FPP A;  4ZCK A;  5KND A;  5M5X B;  4HJ7 A;  2FFK B;  4DR1 Q;  1PTO B;  4A3B B;  3R93 A;  3K7A H;  4KJN A;  1T5E A;  2F0D A;  4R8I A;  1WTP A;  5CV7 A;  1PH2 A;  1CK1 A;  1CUK A;  1ZEQ X;  3W1B A;  3CCQ A;  4XTC S;  1PH4 A;  5IYC G;  3I70 A;  1GUW A;  4QGU A;  1M4V A;  5K36 G;  2DGY A;  4JV5 Q;  4KV6 A;  1T5X D;  4XYO A;  3P75 A;  2L4N A;  5C4J B;  2RSO A;  3SGI A;  1KAW A;  1N36 L;  4FF1 A;  4A3D G;  2B39 A;  1TQO A;  1EY6 A;  3I7F A;  1EY0 A;  1CKN B;  5I6Y A;  1CFM A;  2I0Q A;  4FXD A;  5LL6 S;  1JOR A;  2LSS A;  4L6T B;  3G6J B;  4WJ4 A;  2JEB I;  3BZC A;  3JAM E;  5JOB A;  1O7Z A;  4JI8 Q;  1IL8 A;  2NZ1 D;  4OEL B;  3A74 A;  1MGS A;  4PQX A;  4B3M L;  1GJX A;  2EPB A;  1Q8I A;  2HT1 A;  2YU9 B;  4G57 A;  5CV5 A;  4JYA L;  4YWM A;  2K05 A;  5CBE E;  2BE5 D;  1M8A A;  2F0Q A;  3M7G A;  3SE0 A;  4AYB B;  1MBY A;  1J5E L;  1HA5 A;  4JI1 L;  2JA5 H;  2Z0S A;  5G3L F;  5J22 A;  1YNN C;  3CRL C;  5C4X G;  1HXY D;  1EZ8 A;  1KDB A;  2NWG A;  3OW2 A;  2EJG C;  1OXV A;  2NN6 G;  3S14 B;  3A7L A;  1BUV T;  3FKI H;  1A3T A;  1QZG A;  1E22 A;  5ELD A;  2C35 B;  1JR0 D;  2UUC L;  1HZC A;  3S1R B;  4C3H H;  4RCO A;  2LY7 A;  4KLK A;  3VYR A;  4B08 A;  1QJO A;  2E76 C;  3KF6 A;  1VQJ A;  5CV9 A;  3HOW H;  2B2W A;  1VDZ A;  1QVC A;  2F3V A;  4IUP A;  2ZJP A;  3I8Z A;  1LTL A;  3R2I A;  2B8F A;  1EY9 A;  4DV2 Q;  4A3K H;  4R8N A;  2D2C C;  2R7D A;  4DNT B;  2UUB Q;  4MTK A;  5C3E H;  1GVP A;  4LF9 L;  1STA A;  3M4O B;  2N8N A;  2D9U A;  5M3M H;  2VQE L;  2CQA A;  3L9A X;  4RGN A;  1F2L A;  3PUZ A;  4ZAI A;  2JA7 G;  2HHH Q;  1HFG A;  1OXX K;  1SMY C;  4YY3 L;  2E2I B;  1TXY A;  2PNH A;  4ZK9 B;  2PQA B;  2F52 A;  2NTT A;  3G7L A;  4C1N I;  5IOC A;  5D3D A;  1WCM G;  1B9N A;  2CCZ A;  1WYD A;  1A3U A;  2RHS B;  3HOZ H;  1YEZ A;  2XGT A;  4DN4 M;  1U0L A;  3HKZ B;  4GZY C;  4HJA A;  4LF5 L;  2Q2H A;  3MEH A;  3QO2 A;  1UEA B;  4CHT B;  4K2K A;  3CCJ A;  2PZT A;  1CA5 A;  3I72 A;  4LUV A;  1D5M C;  4JBK A;  3CPW A;  2HCI A;  4ALP A;  1KRS A;  3S1Q B;  1SYC A;  2K7V A;  2JA6 G;  1SND A;  2ZTE A;  2CH4 A;  1H9K A;  1PZJ D;  4JI5 L;  1LTB D;  3VYT A;  3GTG H;  1Q90 A;  2E2J B;  2SEB D;  4I7Z C;  5E7N A;  1FNV A;  1JQY D;  3PO3 G;  5E3F A;  5FO9 B;  1BBX C;  3EBE A;  3MTS A;  1S40 A;  4IUN A;  1PRT C;  3GD7 A;  4X3U A;  4NXN Q;  3QB3 A;  2E2H B;  2A8V A;  3O13 A;  4GOP A;  4BXX H;  3ND8 A;  1KLG D;  1GUG A;  1SJE D;  4OO1 I;  2PZW A;  2N49 A;  1LTS D;  4LFB L;  4UHV A;  1XNR Q;  3UDI A;  1PRT F;  3CCL A;  1IYJ B;  3BJU A;  1VQE A;  4X64 Q;  3BVZ A;  2NB0 A;  3D8G A;  3RNU A;  2VQF Q;  1FJG Q;  1QVG A;  1AN8 A;  2KQ3 A;  4BY7 H;  3VYU A;  1LUZ A;  2IL8 A;  1JOK A;  2HUG A;  2Q8I B;  3L7Z C;  1VQL A;  3GTL B;  1N33 L;  2NVX H;  2MP1 A;  1HR0 L;  4H02 A;  2B2Y C;  1YIJ A;  5CC4 A;  3RUZ A;  1HZB A;  1JB3 A;  2IW3 A;  3WOE A;  1IKM A;  1HPC A;  2A6E C;  4A3F B;  3GTO B;  2YV5 A;  1XMQ Q;  4DUZ L;  4B3R L;  3KBG A;  2WB1 B;  3K6O A;  4NKL A;  2KCC A;  4OHJ A;  5CV6 A;  1XTD A;  2D62 A;  5ELB A;  3Q0A A;  2LFN A;  3GTJ H;  1TWF B;  5AJ3 L;  2F4I A;  1TWG H;  2A69 D;  1YZ6 A;  1Z7T A;  4RAU C;  4LF8 Q;  1DM0 B;  1GUN A;  1I3Q B;  1PYW D;  1CI3 M;  1PTO C;  3S16 H;  5TSS A;  2QDL A;  1C4Q A;  4MTN A;  1LTA D;  2ENB A;  4DR2 L;  5IWA L;  2B2V C;  4IUQ A;  1C7Y A;  1L1O B;  2UXC Q;  1G29 1;  1LTI D;  1QZH A;  2QF7 A;  1BCP F;  4IPH A;  5D3I B;  1PTO F;  4LNQ A;  3SK8 A;  2ZJR A;  2E75 C;  2QEJ C;  4R4I A;  5DAU A;  5IP9 G;  1WTW A;  3K58 A;  3JAM c;  1AW7 A;  4A3C H;  3J80 i;  3GTK B;  4Z9C B;  3CU7 A;  1K73 C;  3FPU B;  1V1P A;  3UDG A;  5C5M A;  3CF5 A;  2JA6 B;  4XIG S;  4DV0 L;  3RLO A;  1E3P A;  2RBM A;  3OTO L;  4OON A;  1VQ8 A;  1MJE A;  2YTV A;  1EL0 A;  1SYB A;  4L5Q A;  4DNR B;  5IGF A;  4AQY L;  4X65 Q;  4XDX A;  3SDZ A;  3D0F A;  3TZU A;  2BDO A;  1DCZ A;  3DM1 A;  4RHR A;  3I4N H;  1F2Z A;  3U4Z A;  2WAQ G;  1KAA A;  4G7Z C;  3U4V A;  3DHQ A;  5FKA C;  5LL6 X;  3F2C A;  2CWP A;  1I50 H;  4OO1 H;  3QR8 A;  1PA6 A;  1AP0 A;  1R4P B;  2XVS A;  3HOU G;  4KHV A;  2IY5 B;  2OXP A;  1D8L A;  2K33 A;  3GV6 A;  3I73 A;  4K8J A;  5CYU A;  1TT2 A;  2I07 B;  4DK6 C;  5HUR A;  4X62 L;  1WTH A;  5M3F H;  2F0F A;  2M9V A;  1X3G A;  3RZD H;  1EIY B;  2NVY B;  3EJI A;  3S24 A;  2F0T A;  2E74 C;  1TS3 A;  2QKI C;  5BR8 Q;  3STB D;  3NEN A;  4A75 A;  1VQO A;  3RD4 A;  2R92 H;  3MA2 B;  3S15 H;  5AFW A;  3V2T A;  2XNA C;  4DK3 C;  4DV5 L;  2NVQ B;  1VQD A; 
#chains in the Genus database with same CATH homology
 2RCN A;  3KJP A;  4OXP A;  2JA8 G;  3TRZ A;  2N3S A;  3MEF A;  3CME A;  1S3O A;  4POF A;  1SR3 A;  2R7Z H;  4GOP C;  4L5R C;  4DR7 Q;  2KBN A;  4POG A;  3E0E A;  1Y14 B;  4A3I H;  2ASB A;  5GQO A;  4DV7 Q;  4A3B G;  3E9H A;  3CQZ H;  1I5F A;  3PIP A;  1PH7 A;  1KQS A;  1XPR A;  1HNX L;  3S1N H;  2E5L L;  4DV3 L;  1Q1B A;  2PI2 A;  4X66 L;  2K5V A;  3CXC A;  1EIF A;  3PUX A;  1IL2 A;  4O2D A;  2VZA A;  3HFZ B;  4DAM A;  1SE8 A;  2VUM G;  3HKS A;  3M4P A;  3PIO A;  4B3S Q;  1X54 A;  3EN2 A;  1UE1 A;  1L0W A;  5GAE C;  5LMN Q;  2QGQ A;  4OWW B;  4BBR G;  4JI6 L;  1D7Q A;  1CKO A;  2JA8 H;  2ALY B;  1N34 L;  2OTL A;  4KHZ A;  4GLX A;  3F1Z A;  4TVA B;  3GTQ H;  2NVY H;  4MNO A;  2F3I A;  3IRB A;  4IJL A;  1XPO A;  1N8R C;  5M5Y H;  2Z6K A;  3H3V I;  2VNU D;  1NMF A;  2HIV A;  3D31 A;  3ULL A;  3A5U A;  1IZ6 A;  4AYB E;  3EIV A;  5BR8 L;  3J81 c;  2OQ0 A;  4LF4 L;  4AH6 A;  4HJ9 A;  3AYH B;  1FVI A;  2ES2 A;  2NVQ H;  1NTG A;  2DUD A;  3CW2 C;  2VUM H;  4NXM L;  4A3J G;  4GN5 A;  4L5S A;  2Q2I A;  2V1C C;  2VL6 A;  3AFQ A;  3K80 C;  3RLN A;  3NBH B;  4DPG A;  3OTO Q;  1IBK Q;  4KHP Q;  4DAY B;  4PZ6 A;  2HIX A;  4UP9 A;  4BBR H;  3G4S A;  3CC2 A;  1KHI A;  2GVB A;  2K4K A;  4DR7 L;  3GO5 A;  2YYZ A;  4J15 A;  5H1S E;  4DV7 L;  1R9T H;  4DR3 Q;  1IBM Q;  4JI7 Q;  1Z47 A;  4APV A;  3I4M G;  1E1O A;  3GTM H;  4HIM A;  2I5H A;  2KEN A;  2CQO A;  4LUZ A;  4IJH A;  4FDB A;  1E24 A;  1PH3 A;  2EIF A;  4B3S L;  4A3J H;  2JA9 A;  1Y1V G;  2Y0S G;  1EQR A;  5M3M G;  1PVO A;  5LMN L;  3MXN B;  3TRE A;  1XNQ Q;  3TS2 A;  3GDE A;  1K3R A;  2JE6 I;  1JMC A;  1UEB A;  3ZJY C;  3L2P A;  4IOA A;  1TWC H;  1Q7Y C;  5IP7 G;  1PHJ A;  4JBJ A;  3OYY A;  4JI4 Q;  1XPU A;  1PYS B;  2IX0 A;  2ZTC A;  1NY4 A;  3JC6 6;  4A3G G;  3I56 A;  1Q1E A;  1H95 A;  2UUA Q;  4JOI A;  2MNA A;  5HY6 A;  2UU9 Q;  1Q8K A;  1EWI A;  5FJ8 G;  4JI0 Q;  3TS0 A;  3G48 A;  3T1H Q;  2MQH A;  4LF6 Q;  4QIW E;  3W1G A;  4QY7 A;  1VQN A;  4ME3 A;  3M9B A;  1Y1V H;  1IBK L;  4P73 A;  1Y1W H;  4A93 H;  4KHP L;  1V43 A;  2VS1 A;  1C9O A;  2L15 A;  3A5Z B;  4A3M H;  3M3Y H;  3PO2 G;  4BA2 I;  3HOX G;  5IP7 H;  1YJN A;  2A1A A;  1IBL Q;  1O7I A;  4DR3 L;  1IBM L;  1I94 Q;  3H0G G;  4JI7 L;  3AEV A;  3PUW A;  4A3G H;  3HKZ E;  3S1M H;  1B70 B;  5JJI A;  4KI0 A;  4UP8 A;  4LFC Q;  4LUO A;  2NN6 I;  3L0O A;  5FJ8 H;  5LMN W;  4JBM A;  3UE1 A;  2JJQ A;  3AFP A;  3PSI A;  5FLM G;  4A76 A;  1P16 A;  3J81 j;  1VQM A;  1N36 Q;  2XTI A;  3HOY H;  4BBS G;  3I2Z A;  2E5L Q;  1SRU A;  5JJL A;  1XNQ L;  1OXU A;  1YHQ A;  3K0X A;  1W2B A;  1G6P A;  3CAM A;  2MFI A;  4YCV A;  4C3J H;  2WFW A;  1TWH H;  2BA0 A;  3PO2 H;  4PG3 A;  3HOX H;  1K83 H;  1LM0 A;  4JI4 L;  1VCI A;  3CC4 A;  1YBY A;  1X3E A;  1SRO A;  5IT9 c;  3H0G H;  4PZ7 A;  1XJV A;  2UUA L;  2IHE A;  2YTY A;  4P74 A;  2UU9 L;  1W3S A;  4JI0 L;  5GAG C;  1KL9 A;  1C0A A;  1AE2 A;  3T1H L;  4LF6 L;  1N32 Q;  1X56 A;  1X6O A;  5FLM H;  4HJ7 A;  2UUB L;  4BXX G;  2QA4 A;  4DR1 Q;  4TQU S;  3K7A H;  1Q12 A;  1CKM A;  2KHJ A;  4DNI A;  3I55 A;  4HJ8 A;  1M1K C;  1PH2 A;  1CUK A;  3T1Y Q;  3W1B A;  3J7Z C;  3CCQ A;  4XTC S;  4GNX C;  1PH4 A;  3KF6 B;  5IYC G;  1IBL L;  3U58 A;  2B63 G;  3S17 H;  4JYA Q;  2D0O A;  2MO0 A;  4QGU A;  1I94 L;  4GLA C;  2ATW A;  3HOV H;  3RZO H;  3S2D H;  2WP8 J;  1X3F A;  4LFC L;  4DV6 Q;  1J5E Q;  1OXS C;  1P8L A;  2DGY A;  4PMW A;  5K36 G;  4JI1 Q;  4JV5 Q;  2IX1 A;  3M7N A;  2CWA A;  3H3V H;  1UE7 A;  4A4I A;  3SGI A;  2K75 A;  4BY7 G;  1KAW A;  3CCS A;  3M4Q A;  4RMF A;  1L1O C;  1SFO H;  1PYB A;  2HQL A;  3K81 C;  1N36 L;  4A3D G;  4OWT B;  4R4C A;  2H5X A;  3RN2 A;  3I7F A;  5LMU Q;  2UUC Q;  3K7U C;  1J6Q A;  1CKN B;  2BH2 A;  5IE8 A;  1JT8 A;  1IXR A;  2B63 H;  2I0Q A;  5HGQ A;  4RG1 A;  1MJC A;  2KCT A;  1K0R A;  2LSS A;  5M5X H;  2JA5 G;  2JEB I;  1MKH A;  4EX5 A;  4WJ4 A;  3BZC A;  1N32 L;  1A62 A;  4JI8 Q;  3PUY A;  3CC7 A;  1YJ9 A;  5C0X J;  4A3B H;  1HNW Q;  1WFQ A;  4DR1 L;  2VY3 A;  3FKI G;  3A74 A;  3GTP H;  3KDF B;  3VDY A;  4A3D H;  3ERS X;  4P72 A;  4B3M L;  1BBU A;  2HT1 A;  1HZA A;  4R4Q A;  2QEX A;  3F2D A;  3T1Y L;  2UXD Q;  4JYA L;  4LF9 Q;  4YWM A;  2WB1 E;  2VQE Q;  1YIT A;  4K0K Q;  3NEM A;  1J5E L;  4DV6 L;  1VQB A;  1JJC B;  3FP9 A;  2JA5 H;  4JI1 L;  1NJI C;  5C4J H;  4JV5 L;  2Z0S A;  1PH8 A;  2Z6K C;  3HOW G;  2K5H A;  1ASY A;  5C4X G;  1G51 A;  1YVC A;  3OW2 A;  2CFM A;  1OXV A;  2NN6 G;  5C44 G;  4IPG A;  4A3L G;  4DR4 Q;  3FKI H;  1QZG A;  4A3K G;  1E22 A;  2C35 B;  1NMG A;  1X9N A;  1XMO Q;  5LMU L;  2UUC L;  1HZC A;  4JC0 A;  1A63 A;  3UDF A;  1B7Y B;  5C3E G;  5IYD H;  4C3H H;  2EQS A;  3CCU A;  4KLK A;  4GS3 A;  4AYB G;  3A0J A;  2FXQ A;  3KF6 A;  1OXT A;  4LFA Q;  1Q81 C;  4LF5 Q;  1JE5 A;  1FL0 A;  1VQJ A;  5C0X I;  3G71 A;  3HOW H;  3KF8 B;  4JI8 L;  1LYL A;  4NPS A;  1EOV A;  5C4X H;  1OTC A;  2NZH A;  4JG2 A;  4AIM A;  1QVC A;  3G6E A;  1MIU A;  2ZJP A;  4JI3 Q;  1HNW L;  3I4M H;  4A3L H;  1LTL A;  1Z9F A;  2YU9 H;  1YI2 A;  4DV2 Q;  4GOP B;  4A3K H;  4R4T A;  3UE0 A;  2R7D A;  2UXD L;  3HOZ G;  2UUB Q;  5C3E H;  1GVP A;  4LF9 L;  4X6A H;  2N8N A;  2VQE L;  5M3M H;  1CKN A;  4JI5 Q;  4K0K L;  2B3G A;  5GAH C;  1TWA H;  1VQI A;  2PMZ E;  3PUZ A;  4GKJ Q;  2JA7 G;  2HHH Q;  2WAQ E;  1OXX K;  2PI2 E;  4YHH Q;  4DV1 Q;  1K9M C;  3S14 H;  4JOI C;  3I4O A;  4YY3 L;  1TXY A;  2PNH A;  4A3E G;  3CCR A;  2PQA B;  2F52 A;  4DR4 L;  3F2B A;  5JEA G;  5IYB G;  1SN8 A;  1WCM G;  1YHB A;  3S1R H;  1PH9 A;  2CCZ A;  2JEA I;  4YWL A;  1WYD A;  1XMO L;  3KDF A;  1VQ4 A;  1CSQ A;  1YNX A;  4BY1 G;  2RHS B;  3HOZ H;  1M90 C;  4QL5 A;  1YEZ A;  2XGT A;  5JEA J;  1KXL A;  4Y52 H;  2E8G A;  1U0L A;  4LFA L;  1GKH A;  4HJA A;  4LF5 L;  4IFD I;  2Q2H A;  2JA7 H;  3CCJ A;  4WJ3 M;  3DM3 A;  4LFB Q;  4LUV A;  2UXB Q;  2ZJQ A;  4JBK A;  3CPW A;  4JI3 L;  1VQA A;  3ER0 A;  4GN3 B;  4ALP A;  4EQ5 A;  5IY0 A;  1KRS A;  5IYB H;  2ZTD A;  1WCM H;  2AWN A;  4DV2 L;  2ZM6 L;  4OX9 Q;  2JA6 G;  3M4O H;  3HKZ G;  2R93 G;  2ZTE A;  4BBS H;  2K5N A;  4YCU A;  1I6H H;  1PFS A;  4JI5 L;  1HZ9 A;  4HID A;  4HIO A;  1PH6 A;  4NB3 A;  4IPD A;  4B3M Q;  2F4V Q;  4DUY Q;  2D0P A;  3KLW A;  2R92 G;  1N33 Q;  4GKJ L;  2MO1 A;  2E2I H;  1QUQ B;  2N78 A;  2HHH L;  1VQH A;  4YHH L;  2ID0 A;  5J3B A;  4DV1 L;  5E7N A;  1HR0 Q;  3PO3 G;  3FHW A;  3TQY A;  1EYG A;  3UDX A;  5DLQ E;  4GNX A;  3EBE A;  4P75 A;  1S40 A;  1DGS A;  3E9I A;  4LF7 Q;  1SLJ A;  3GD7 A;  4JCV E;  4NXN Q;  2AWO A;  1HH2 P;  3PUV A;  4A3I G;  4DUZ Q;  3J7A 5;  2A8V A;  4B3R Q;  2GVA A;  4GOP A;  4BXX H;  1S72 A;  2R93 H;  4OWX B;  3JAM i;  2LXK A;  4P71 A;  1A8V A;  4OO1 I;  1V9P A;  2N49 A;  1RIP A;  5AJ3 Q;  1JJG A;  4LWC A;  1Q82 C;  2K50 A;  1VQ6 A;  4LFB L;  4IO9 A;  5IYC H;  2UXB L;  3CP0 A;  4B3T L;  1XNR Q;  3UDI A;  3BU2 A;  3CCL A;  3PO3 H;  5C0X G;  1IYJ B;  3S1Q H;  3BJU A;  1VQE A;  3W5O A;  4X64 Q;  1PV4 A;  1Q46 A;  2PQA A;  3B6Y A;  1VQP A;  4C3I H;  3CCV A;  4OX9 L;  3CD6 A;  3RNU A;  4DR5 Q;  2VQF Q;  1FJG Q;  1AH9 A;  1QVG A;  4BY7 H;  5JJK A;  1LUZ A;  2AKW B;  3STB C;  2OQK A;  2E2J H;  3L7Z C;  2F4V L;  4DUY L;  1VQL A;  1K8G A;  1N33 L;  1KD1 C;  1VQG A;  2NVX H;  2YTX A;  1ASZ A;  4DR2 Q;  4YCW A;  3BZK A;  1HR0 L;  1NE3 A;  4H02 A;  5IWA Q;  4JBW A;  2R7F A;  1YIJ A;  3S2H H;  1CSP A;  3KYH C;  2CKZ B;  1HZB A;  2K14 A;  1VS0 A;  3PCO B;  4DV4 Q;  1RL2 A;  2E2H H;  3J80 c;  4LF7 L;  1KIX A;  4R1J A;  2OWO A;  4NXN L;  1VQF A;  2I5L X;  2A19 A;  2YV5 A;  3AQQ A;  4GLV B;  4YY3 Q;  1FGU A;  4DUZ L;  1XMQ Q;  1EQQ A;  4R4O A;  4B3R L;  4GKK Q;  2EXD A;  2Y0S E;  1VQC A;  1L2F A;  1XTD A;  2D62 A;  3M85 A;  3GTJ H;  5AJ3 L;  2IHF A;  2Q2U A;  2I5M X;  1XNR L;  1U5K A;  4DV0 Q;  1QVF A;  1PH1 A;  2BH8 A;  1QUQ A;  4IFD G;  1TWG H;  1UE5 A;  1YHA A;  4X64 L;  2K52 A;  1BKB A;  1YZ6 A;  4O0A A;  4IPC A;  4UPA A;  4JI2 Q;  3H15 A;  4AQY Q;  4A3F G;  4LF8 Q;  2WB1 G;  1B8A A;  4GNX B;  4QJF A;  4IFD J;  2OCE A;  5FLX c;  4DR5 L;  2VQF L;  1BVS A;  1FJG L;  3ULJ A;  3KOJ A;  5C44 H;  1HR0 W;  1V1Q A;  3S16 H;  3GTL H;  2Q2T A;  3KJO A;  5ELO A;  4A3C G;  2NVT H;  4MTN A;  3PV0 A;  2R6G A;  2ZM6 Q;  1GM5 A;  4UP7 A;  3GTG H;  4DR2 L;  3WWV A;  2KHI A;  5IWA L;  1HNZ Q;  1C7Y A;  1L1O B;  2JK8 A;  1G29 1;  5GAD C;  3NEL A;  1VQ5 A;  2UXC Q;  3U50 C;  1Y1W G;  4DR6 Q;  1QZH A;  1YJW A;  4DV4 L;  4A93 G;  5EAY A;  4IPH A;  4A3F H;  3GTO H;  4A3M G;  1NBW A;  4LNQ A;  2LXJ A;  1KRT A;  3RLF A;  4OO1 G;  1XMQ L;  2ZJR A;  4R4I A;  3TEH B;  5IP9 G;  3I4N G;  2OTJ A;  2BA1 A;  3PF5 A;  4GKK L;  3JAM c;  3LGJ A;  4A3C H;  1T9H A;  1TWF H;  4UY8 C;  3J80 i;  3RN5 A;  1WI5 A;  4X62 Q;  1VQK A;  4C2M H;  1K73 C;  1N9W A;  3UDG A;  2AMC B;  4IOC A;  3CF5 A;  1PH5 A;  4XIG S;  4DKA C;  4DV0 L;  3RLO A;  1E3P A;  3OTO L;  1K8A C;  4OON A;  1VQ8 A;  3HOY G;  1MJE A;  2YTV A;  4QQB X;  4JI2 L;  4L5Q A;  2NZO A;  1E7Z A;  3J81 i;  4AQY L;  1VQ7 A;  4X65 Q;  3ICE A;  3PF4 A;  1I3Q H;  2RF4 A;  3D0F A;  4LF8 L;  4B3T Q;  4DV5 Q;  4Y7N H;  4A3E H;  5IP9 H;  3I4N H;  1X55 A;  2B29 A;  1VQ9 A;  4YWK A;  3U4Z A;  2WAQ G;  1SMX A;  2RHQ B;  1HJP A;  3U4V A;  3CPF A;  5M3F G;  1JB7 A;  1UE6 A;  4BY1 H;  5GRO A;  3F2C A;  2CWP A;  1X65 A;  1I50 H;  1HNZ L;  1BBW A;  1HNX Q;  3K8A A;  4BA1 I;  1E1T A;  4DV3 Q;  2UXC L;  2VW9 A;  1PA6 A;  3CCM A;  4X66 Q;  4DR6 L;  2KCM A;  3CMA A;  3HOU G;  2IY5 B;  3RR5 A;  2IT1 A;  5M5W H;  1A0I A;  5IYD G;  1D8L A;  4PZ8 A;  3KFU A;  4MZ9 A;  1WJJ A;  3HOV G;  3GTK H;  4JI6 Q;  4L5T A;  1N34 Q;  2AHO B;  4DK6 C;  1Q86 C;  1GO3 E;  4X62 L;  2R7Z G;  1KC8 C;  3PGZ A;  4GN4 B;  2JA6 H;  3DLL A;  5M3F H;  3CCE A;  5ELN A;  1EUJ A;  1WOC A;  1JJ2 A;  1GD7 A;  1X3G A;  4LW1 A;  3RZD H;  1EIY B;  3Q8D A;  1EFW A;  3S24 A;  1AE3 A;  2JQO A;  5BR8 Q;  4A75 A;  1L1O A;  3NEN A;  3STB D;  1VQO A;  4LF4 Q;  2R92 H;  4X65 L;  3HOU H;  4HJ5 A;  3S15 H;  2GN5 A;  3F8T A;  3ULP A;  4NXM Q;  4DK3 C;  4DV5 L;  1UWV A;  1VQD A;  4HIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...