2IT1A

Structure of ph0203 protein from pyrococcus horikoshii
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
362
structure length
362
Chain Sequence
MVEIKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKDRNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVYYKPKYKFVGGFLGNPPMNFVEAKVEDGKLVITEKSKLPIPKQYVEIVKETGITEVIIGFRPHDAEIVKGEGEGIVGEVYSFEPLGREQIVTVSVNDSIVKVFAPEGEHFSFGEKVTIKVKEELLVLFDKKTEKALEFSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 362aa long hypothetical maltose/maltodextrin transport ATP-b
publication title Structure of PH0203 protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
total genus 98
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2it1A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2it1A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2it1A01
2JLSA 1AKEA 2Z4RA 2ZE6A 2PNHA 1HR0L 1VMAA 4WXPA 2IEYA 1KSGA 3UKDA 2NO0A 1JMCA 4Q03A 3PCOB 2KENA 1FL0A 4M0LA 3RS7A 4DUGA 2WAQE 1P2VA 2IYXA 3A8KE 1Q3TA 1VF7A 1GHKA 1C9KA 1VG1A 4G5OA 4OI4A 1PVOA 3A0JA 1JAIA 4HIDA 3S1NH 1EX7A 2QTVB 4JLDA 3EZ9A 4TL6A 1X3GA 3OYYA 3J7ZC 3VX4A 4YMVA 1WYDA 3K70C 5KNDA 2N8NA 3UANA 4LFBL 1M7HA 3CQZH 4LNQA 4EFMA 1DAFA 2AXPA 2H5EA 1E99A 1EFCA 1YRBA 3CWZA 4QHSA 3L7ZC 4G3XA 4AI6A 4BECA 4MKGA 5GADl 1UDXA 1NMYA 3KXIA 2QEXA 4WZBE 4TSFA 4UQOA 4BLTA 3S2DH 2BHRA 2Q9AA 3L0IB 4B3GA 1IZ6A 3A4NA 1W7AA 1DAMA 4LF8L 1G3MA 3K0XA 2XZLA 4JI0Q 3CO5A 4EIWA 2ZANA 3RS5A 5M5WH 1SVIA 2F3TA 2OXRA 3RC3A 1KK3A 4APVA 1ZYUA 4KVAA 3C15C 4HUQB 2B63H 4Q9KA 3P27A 3LWUA 1U8YA 4JI2L 3CXCA 1I5FA 3VU9A 1QUQB 2OCBA 4L9SA 1XFAA 1ZW6A 3WP1B 2JA1A 4WBSA 1E2DA 4DDVA 1N33Q 1LABA 1WJJA 5H70A 1Z2CA 1NY6A 2QT0A 3VX3A 2AUJD 4AK9A 4KJZA 2OILA 2JJQA 3QKRB 4EPWA 2HJVA 5KDDA 3U4ZA 3DZDA 1R5NA 5CB6A 4O2DA 1W0JA 1VQNA 2HHHL 3WWVA 3BAFA 5IYCG 1Q1ZA 1Y1VG 1L0WA 2P0EA 4DDWA 2J59A 3CW2A 1YZTA 4NKRA 4XVUA 2WIBA 4JBKA 3D0FA 3S1QH 3A1TA 2G6BA 1M6NA 5DSZA 1VG9B 3JZAA 3ZQ6A 5JBQA 3DZ8A 5L8VA 4TT3D 4DK6C 1ZNXA 4V0LA 5KOYA 1D6JA 2IS4A 2K4KA 2XB2A 3IBYA 1YBYA 1BVSA 4MZ9A 2JLUA 5LD2B 5JZVA 1EFHA 4A4DA 2RGEA 4IPDA 4PC7A 5TDHA 2F9LA 1NY5A 1Q44A 1E2HA 1P4SA 1BDOA 1XP8A 1R8SA 1ZUHA 3AVQA 3ECCA 3N2EA 4GI7A 1KJWA 4GKJQ 2OXCA 3I3SR 5KSPA 2IUUA 3R9WA 3B8HA 2ZRNA 1R5BA 5CITA 2IYWA 2PZEA 4BLRA 4IDPA 2J0QA 4Q1AA 4D0LB 3H3VH 2YOGA 1N6OA 2OFWA 4LC0A 1K3RA 2VA8A 1BMFA 3RLOA 4JL8A 1NJFA 2R6DA 4PSAA 821PA 2E76C 1H8EA 3CRW1 3UG7A 4GLVB 1P72A 4M4SA 4MRNA 2I5LX 2F9MA 4M1TA 4WOPA 2GN5A 3CCRA 4FMBB 4HDOB 4L4UA 4DLRA 3U61B 1IONA 2P2LA 4K8OA 4PTLA 3QY0A 1KOFA 5L3VA 2CLDX 3IO3A 4ZIRA 1HTWA 3B1XA 3LFUA 4Z1MA 2V7QD 1KQSA 3AEVA 4M1MA 2BDTA 2PJZA 4NHOA 4HLUC 2JA7G 1IN7A 1G17A 4R4OA 3THOA 1TEVA 2FSIA 1MRSA 3N70A 4Q1CA 4US1R 1XF9A 5FLXc 1ZU5A 2HXSA 5KTYA 3CNOA 2FV8A 2O8CB 4DDUA 3T12A 1VQ6A 3UK6A 4DR1Q 4ERNA 2KSQA 1FNNA 1QVGA 2FFAA 2ZUCA 4GOXA 2Q2TA 1DELA 2CLCX 3GLGA 1OFIA 4MKHA 2MFIA 2FPMA 4MRRA 3BORA 5C4GB 1P6XA 3H3VI 3SZRA 1LV7A 4BY7H 3KDFB 1ZD9A 3FPPA 3C5CA 1U9IC 4PHTA 2R93G 4FMCB 4D4JA 2IF0A 2ZRAA 1VQEA 4C0QC 2ZYVX 4Q66C 4AYTA 4EFLA 1N6KA 1E9DA 2CMKA 2VHJA 4GMDA 4TQAA 4KKTA 4IOAA 1N9WA 2ASBA 2XOKD 3AUYA 4N3NA 3OTOL 3H0GG 2CL7X 4FIDA 3KUDA 2R7DA 1NLZA 3CRKC 4LF9L 4QBIA 3P4XA 2O8BB 3HOVG 4Q1FA 2I5HA 2ZI3A 1IN6A 1WMSA 2HF8A 4BASA 4CRWB 2FEOA 1G4UR 2R6AA 3LLMA 5EXPA 4KMUC 2WKRA 3SQXA 2FG5A 2E1RA 1NTGA 5FI1B 3ICQB 1YNXA 4WIAA 4JL5A 2IT1A 4EJSB 1JAHA 1W36C 4NXMQ 3GJ3A 1BYIA 4GKKQ 4F93B 1XZPA 4OJKA 3I73A 2K5UA 2QBYB 4TMXA 4JI3Q 1XMQL 3HU2A 1VQFA 4A3CG 3H84A 5F9HA 1L2TA 4LHVA 3KF6A 2QORA 1VQ7A 1JQJC 3LQQA 4CEIA 4OKSA 2WWHA 1RZ3A 1J5EL 4ME3A 4Y7NH 4BLSA 4LJ5A 3THXB 4RD6A 5FUYA 2NMVA 4BEJA 2WP8J 1N32L 5J5CA 3WY9A 4DV1Q 1G5PA 4RD3A 1HR0W 2IW3A 2SHKA 4OK6A 3CR7A 5DE3A 2A69D 1F2UB 1BH2A 4O25A 3UG6A 4LCBA 2RKOA 3EIQA 4A0FA 3BXZA 5G40A 1AS3A 4NXNQ 1J8MF 1CLUA 1SHZA 4DV7Q 5TVKA 3C8UA 2PZGA 1OH6A 1CJVC 1PMRA 2RHDA 1HT1E 1NVVQ 2XTZA 3BFKA 1ZD8A 4I7ZC 3OHMA 2FSFA 2G88A 3FMPB 2ZI9A 1QHYA 4UKDA 5LMUL 4LFCQ 4DSTA 4HJ7A 5TY0A 3SYNA 4DV3L 3SEAA 3Q7PA 4JI6Q 2K5HA 1KMHA 4C30A 3QENA 1E2IA 5DI3A 1YJ9A 2MMCA 4LF7Q 5JJIA 2IA5A 1NBMD 4HZUB 4NL4H 3IKJA 2AHOB 2FZ4A 3UWOA 2VW9A 1JBKA 1WDTA 2ZYTX 4LZZA 3HKSA 3LAWA 4BFWA 3NBYC 2QTFA 1M2OB 2F7SA 1G6HA 4IDQA 4JI1L 1IQPA 1EFUA 2CVHA 1IN8A 1VKJA 2YJTD 3GTQH 4FINA 4LC1A 3P26A 1Z3IX 1IL2A 2Q2IA 1HCZA 3S2HH 1UEIA 2O0JA 1CKNB 3O47A 4JYBA 1QHHB 1YI2A 3SU8A 2WWIA 3RANA 3VQTA 3CH5A 1F3OA 3PEWA 2X8AA 1YZLA 4HJ5A 1PLJA 1T3LA 3IPYA 1XMOL 5B2ZA 2ZS8A 2V4ZA 3I7FA 1YHQA 4JYAQ 1HA3A 3KKMA 4JSYA 1NG9A 1HYQA 1N3BA 4TZ6A 3STBC 1L4YA 4K46A 2OTLA 3PF4A 1NSTA 1TUEA 4A3BG 2LWIA 3OOCA 2FSGA 3LBIA 1Z06A 4CW7A 3WDNA 3NBZC 4BFTA 2BDOA 2RF4A 5C4XG 1K6MA 1U5KA 1OKKA 2Z5FA 1HE1C 5KSYA 5M04A 2ZM6L 1R7RA 4Q9LA 1NMFA 2D4HA 2EYUA 2WZQA 2OV2A 3ZD6A 4GNXA 1JECA 2YINC 1MH1A 4MRPA 4Z51A 2QA4A 3TR5A 4AY2A 4LBYA 4EQ6B 1FP7A 5G3YA 1TF7A 2BM1A 3NBHB 2WICA 4JMPA 3G82C 3KJIA 3T35A 4EUNA 3U7GA 4IJMA 3PEVA 4A36A 1XMVA 2GZAA 3K9NA 3NBFA 4XD7D 4R1JA 3T06B 4QL5A 3ER0A 1GNPA 1OLOA 3EARA 1QZHA 3EZ6A 4B2IA 5A4JA 3B1WA 4DR6L 4GS3A 3RN5A 4PHFA 2H17A 2ZUBA 3SOPA 2J7PD 4U02A 3TAHA 3ZQJA 4B3TQ 1D8LA 1X6OA 4AIMA 1IN4A 2A3RA 3L43A 2O5VA 1JJVA 4GN3B 1CKMA 3A5UA 1CIPA 3BJUA 1LS1A 1UF9A 2CEAA 4DCSA 2EQSA 3HPRA 4KU4A 2QROA 1WF3A 4CEHB 1HZCA 2G77B 2ZXUA 5M3MG 2R6GA 1TWCH 1UM8A 3PF5A 2FFQA 2REXB 4V03A 5GJCA 1KAOA 1G7CA 1MJCA 4LJ7A 3BB3A 1HH4A 3A4MA 1X3EA 1Q21A 2JJ2A 4L16A 2I5MX 1SN8A 1W4BA 3SNHA 4JS0A 3PXGA 3U9SA 1Q46A 4DLTA 5F3WB 2OM2A 2RGNA 5BR8L 1DBSA 4YXWA 1KK0A 1FX0A 2AK2A 1QUQA 5DLQC 4PZ8A 2FE4A 2H5XA 3TRFA 1ZBDA 3EPKA 1A2BA 2DPXA 4FDBA 2GCNA 1HZ9A 1CRQA 4H02A 4KLNA 3M0EA 3T1QA 1U2RA 1NF3A 1I2DA 4L5TA 2OCYC 4A3KG 4LSGA 2V54A 5FR2A 1N6HA 3QKRA 5JWOA 1FMLA 1H9MA 3PUVA 3K80C 1D9ZA 2C35B 4G0NA 3ZS8A 2JJ8A 1Z0KA 4P33A 2UZIR 5JS7A 3FKQA 1QZGA 2VYFA 2LXKA 1JXOA 4LBZA 3AVTA 2K5NA 1UFQA 4IFDG 2AFIE 5E7NA 3AQQA 5FBRB 1KO4A 1VQMA 1B0UA 2Q3HA 4B47A 1H9JA 2JK8A 1E4YA 4M1YA 3K7UC 2ZRHA 1E9FA 1T3HA 2EW1A 3FOZA 3CRRA 2ZJ2A 3RRMA 3X1ZA 3CCQA 2C78A 3TSZA 1Y8NB 2Z0SA 1NMZA 1GOTA 4KBGA 1X6VA 4F38A 5FUXA 4A93G 1YR9A 4D2IA 3OW7A 3FKIG 2KA7A 3TREA 3Q8DA 3HOZG 1Z08A 1Y1WG 3K70B 2D2CC 3LO5A 1SVOA 2KCTA 5TMPA 4LF5L 1T5IA 2WB1G 1QVCA 1RFLA 1Z83A 2JGNA 4NCHA 4KFRA 1GKUB 1GKIA 2ZJ5A 3EZ2A 3OEHA 5FL7A 1I50H 4DLZA 4C0SA 1H65A 1PH4A 1ZCBA 1VECA 1ZIOA 2C5LA 3K8YA 5JLJA 2ZR0A 1E2EA 2ZSAA 3JVVA 1SZPA 2GZHA 4TYYA 4FI3C 1CUKA 2FX3A 4P3YA 2W6JA 4TVAB 3O8DA 2VP4A 4IDOA 5IYDG 4OQXA 1KDRA 2JA5G 4PMWA 1KO5A 4KODA 3SE0A 3GFTA 5H1YA 5CDFA 3GFOA 1W44A 3AF3A 1IXRA 2JASA 2QG6A 1KKMA 2FF7A 2VF8A 4X8MA 3RWMB 4LF4L 1LM0A 2XX3A 2O8CA 3HOYG 4TZ0A 3AF4A 3BBPA 4A3IH 5FBQB 2ASEA 1N0UA 1K8MA 1TEXA 3GJ8A 4D6PA 4CGZA 1CR2A 1E2MA 2FPLA 3F1ZA 1P2UA 4NONA 2FH5B 4R2IA 4GZYC 4M22A 5DYGA 4LF6Q 3NG1A 1K5GA 1GL9B 5LD2C 1E79A 4LJ6A 3OF5A 3Q5DA 4YY3L 3CAMA 4LI0A 1ONBA 4KHPL 2FWRA 3QG1A 2VHUA 2ZR7A 4Q9IA 1FTNA 2DB3A 1P9WA 2QMEA 1DS6A 4JLNA 1QHNA 3KXLA 4EPYA 1NJIC 4F91B 4A4IA 4RD4A 5IF9A 1UEJA 2QTHA 3M6AA 3WMGA 4JYCA 2OHFA 2L15A 1OH5A 1ZC3A 1A63A 1CSQA 3I1FA 3IPXA 3LWNA 5CDFE 3GTJH 3J81k 2A9KA 4OWWB 1F2TB 2GK7A 3NVAA 4RFVA 4BFZA 3O8BA 2UUAQ 1CJMA 1N5IA 1K8OA 4WA7A 1GRNA 1HT2E 3J81j 1V5WA 2A5GA 3HPQA 4CYMA 1IHUA 4BGDA 4UXIA 5GVSA 2EJFC 3CF5A 4HLDA 3QVVA 4G7ZC 1M7BA 5IK2A 4GOJA 1E1QA 2JIZA 2JA6G 4BXXH 2KWIA 3I55A 3IUYA 4MGKR 4EJSA 4JLKA 4DK0A 1SXJD 2B92A 5G3ZA 1E1RA 3BH0A 3GD7A 2IX0A 2HT6A 1ZU4A 1IBMQ 1KDTA 3LXRA 5EXXA 3W9YA 4B2LA 2QBYA 2VH5R 3B7GA 1B9NA 1MO4A 2OQ0A 5DISB 1G3RA 1D5CA 3VMFA 2VQEL 1DVRA 2QN6A 2DFNA 4OK5A 2ZRIA 4NYJR 1K8GA 1SHKA 2AKYA 5TARA 2K7VA 5J4VA 1US8B 2F6RA 3M85A 2V1CC 2TMKA 3RABA 2CDNA 1L1OB 3CWQA 1S1CA 3LXXA 3THXA 1VCNA 1Q20A 3DOEA 2Z0MA 2V3CC 3EWSA 2CL0X 4ZDKA 1VCOA 4XVRA 4OX9L 3CPJB 4B3ML 3AKCA 2A68D 1XJVA 1AZSC 4FD2A 1F2UA 1ELOA 1HNXQ 2YTVA 4KLZA 5IP7G 1X54A 2PCLA 1TQDA 4B3SQ 2BWJA 3IEUA 2F3IA 2ZVPX 3TUIC 3A1WA 2K14A 1DO2A 5C18A 4D26A 1FVIA 1PZNA 4PZLA 3M4OH 5F98A 2PMKA 2VNUD 1OIXA 3B9QA 3B60A 4Q4AB 2ANCA 4DNTB 5SZHB 4YMTA 1TWAH 3NIBA 1T91A 3U5ZB 1JPNA 1X1SA 2PT5A 3SBDA 1MKYA 2I1VB 1NY4A 1W0JD 2GK6A 4ZDWA 2CNWD 2AL7A 3LBHA 1JNYA 2I1QA 4DIDA 2NGRA 2CHGA 4HZUA 4LUOA 3KKQA 4XTCS 4E5UA 2GVBA 3AVUA 2AHOA 1OTCA 4IFBA 3M9BA 3L8ZA 2XZPA 1NE3A 4JKIA 3NDBB 4RFSB 3RZOH 2JLQA 3U3OA 2BBTA 3FMCA 2GILA 4JT2A 4PR0A 5FUVA 1S40A 1Q86C 2WIAA 2KJQA 2REOA 4H9GA 3I4LA 5JS8A 2Q9CA 3QBTA 1U0JA 4KCGA 1W36B 3HP1A 2X2EA 1VDZA 2GXAA 1N6RA 4IOLA 4QGFA 4HAXA 1OXTA 3S15H 4B6FA 1N34L 1J99A 1FYCA 4RMFA 1I94L 1QHHA 2PCJA 4Q00A 4AQYQ 1VQIA 4NB3A 3NTUA 4CT4B 3CNLA 1PV4A 2Y0SG 2R7ZG 2UUBL 5FOVA 5CB8A 1OFUX 4QIWE 1Y8OB 2A69C 2CHQA 1U99A 2IYZA 4XWKA 3KL4A 4BFYA 5F2EA 5AUPB 5KPJA 5AJ3Q 1XPUA 2DR3A 2WJJA 4DNIA 1ZVQA 1SULA 2VZAA 3QI2A 1B23P 4DCVA 2YNMA 5DN6D 1NN1A 4JLMA 1Q82C 4MRSA 3WYAA 1RL2A 3THWB 3KQNA 2DFKB 5A0FA 4A0HA 1NVUQ 3MMPA 4US2R 3AF0A 5IT5A 4R4TA 3GMTA 4QGAA 2JLWA 1RKBA 1XEWY 2ATVA 5DLQE 1KY3A 5EXTA 4X8HA 4P31A 1HEIA 2JJ1A 4JLOA 1HR0Q 4QQBX 1F6BA 4AYBG 4LFAL 1Z9FA 2BCJQ 4DAYB 1OXVA 4TL8A 1CEEA 1YE8A 4IOMA 2ZI5A 1SGWA 4UNQA 4UXJA 1K8RA 4B35A 3G6EA 4H0LC 2AKAB 5KUTA 5AJXA 1PH8A 4AKHA 4Q1DA 2O8FB 4RZ3A 4O2LA 5L3QB 5IYCH 4R2HA 1Y1VH 1I4DD 2VSXA 2Y0SE 3EBEA 1AIPA 3C7KA 4N1AA 2Y8EA 4JBJA 4PO8A 3F2BA 2ONJA 3ZH9B 4UNRA 3SYLA 1KL9A 3GLFB 1W3SA 5M5XH 1H95A 3A7AB 1MABB 4DLUA 3ICEA 1A62A 4Q9JA 3WYGA 2ZSEA 4K81B 4DC9A 3JVUA 1UEBA 3B13B 4JJZA 3I56A 5D3MB 4MGZR 2ZRMA 3GDEA 5LBIA 1JT8A 1NIPA 3OE7D 2IEZA 3CX7A 4HAWA 1EUJA 4Q4LA 4GZMA 4AWXA 4JVSB 2XJ4A 4IFDJ 1HNWL 4GRAA 4A15A 3I4MG 3KZ1E 4ZCIA 2IL1A 2QE7A 5TV2A 1S96A 5JRJA 4DT1B 1ZM9A 1UBGA 2IBMA 1VQJA 5CM9C 3D8BA 4DV4Q 3AF1A 1K9MC 2IYRA 4JI2Q 4AYBE 1EFRD 5EZ5A 4RKEA 4C7OA 3RLNA 3VHXA 4B44A 2QSYA 2E5LL 3PIOA 4GLAC 1SQ5A 3K9HA 2VP9A 4IVPA 2JLRA 2YWGA 2JXMB 3KXKA 3B5JA 1ZNYA 1P73A 4DK1A 3GTPH 3TSOA 3S24A 4FWTA 2CWAA 4FMDF 2AXNA 5L3SB 2IS2A 4TTQA 2BH2A 1P9NA 1YZUA 3B1YA 1IJFA 3CH4B 1W4AA 1E2VA 3W6OA 4A82A 1Z0IA 1JEEA 2MMGA 2XNDA 1O7IA 2JA7H 2NG1A 5JHHB 2HCJB 4JSTA 4KBFA 1CTQA 4QM7A 2WWGA 1KI6A 4RJLA 4LWCA 1HQYE 4GPTA 5FOWA 4A3FG 3MCAA 2CK3D 3RRZA 5LMNW 3EWAA 2V6IA 4IPHA 1YITA 1AKYA 1G5RA 2WJYA 4BBRG 1UKZA 3A8JE 2NVQH 2RB4A 4OK3A 1SRUA 3S1RH 4AH6A 4MUBA 2O8EB 1TNDA 3PEYA 3CBQA 1MKHA 2WAQG 2N42A 2ZUDA 1DEKA 4IDHA 3UE1A 2UXDL 5C4MA 3PVSA 2R93H 3C16C 5GAGC 4B3RL 2E75C 3FP9A 4RKFA 3R7WB 2OWOA 1Z8FA 3AB9A 4ACBA 4NCIA 1OH7A 3RVBA 3H0GH 4MDFA 2UXBQ 1R6BX 4X64Q 2C98A 2I4IA 1KYIA 4OQMA 3CCUA 1S3OA 3HOVH 2QSZA 2D06A 2GXSA 1KTVA 4KITB 5JI2E 3GCGA 2K50A 2OCAA 3GJXC 2WOJA 1ESMA 2GCOB 4NTZA 4JVLA 4HATA 1E2JA 1T0HB 5JECA 1XB2A 1ZM2A 4GBMA 3EZFA 1EQRA 2FFBA 1B7YB 2R9VA 4V0MA 3DXJC 3SGIA 1Y69U 4L5SA 3RNLA 1B9MA 4JJKA 1J2JA 2CHVA 3TKLA 1Q0UA 2WPDA 4M8NE 4M9QA 1GAJA 3QNUA 1W4RA 2CWPA 4M1OA 3VTKA 4Q7JB 2VP5A 2PH1A 2A6ED 1TUIA 4A3CH 3W1BA 3M4YA 2VHQA 3DMDA 4W5HA 3GO5A 1BKDR 4URZR 5B57C 4PC3A 4H1UA 4HR7B 3PO3G 5GJBA 2B8WA 4A76A 2VP0A 3MWJA 3CCJA 3QE0A 2AKWB 2H18A 5LPNA 3SHWA 1RRFA 2X77A 1IBKL 4DR7L 1E96A 1IYJB 1OFHA 3CF2A 1RE0A 2F3RA 1SVSA 2MO1A 1MO6A 1OKKD 1JALA 4TN1A 1WFQA 5LB4A 3GP8A 1KAGA 1P60A 4HB3A 1F2TA 2ODBA 3AYHB 4JI5L 4RCZA 3OTOQ 3RSLA 1YNJC 4G7OC 1O87A 4IHQA 3TGPA 1QVRA 4JKYA 3KQLA 4LF9Q 4M21A 1K0RA 3U3KA 5M3FG 3REFA 3UPUA 4NCNA 4XIGS 2VF7A 5HKKA 3TQCA 1PLKA 4TQ9A 4NBSA 2I3BA 3FPAA 3RNUA 3UWKA 1KDPA 1HE8B 1DG1G 3SFVA 3ADBA 3B78A 4PPNA 3MEFA 1M90C 3NDPA 5JMTA 4WZAE 1SMYC 1E2FA 2GAAA 1Z6AA 5M5YH 5DI9A 4X6AH 5BWMA 5FI0B 4TTRA 3TUZC 4DIEA 3TS2A 1PJRA 3QEJA 2F4VL 2DN8A 3A5ZB 2QAGC 3VR6A 1IBLQ 1OHHD 2ZJZA 4PANA 1HZBA 1VCIA 5JJKA 3H2YA 1YQTA 3SJBA 4HLUA 2IXFA 4JLAA 4TL7A 3IQWA 4UNPA 3KKOA 4E22A 4F4CA 5J4KA 2O52A 4B32A 1G64A 721PA 4HAVA 1J5EQ 2XTIA 1KIMA 2UUCL 1OB5A 2P5SA 3A37A 3FTQA 3THYB 4A3JG 3KQKA 1L8QA 3EA0A 1N32Q 1E9AA 1XNQL 1GNQA 3I62A 2ANBA 3BFVA 2JQOA 3FVQA 4I4LA 4QL3A 3GLIB 3GJ6A 3KQUA 3CIOA 2YWFA 4RZUA 1XTDA 3QIAA 3RC8A 2ZI4A 2Z6VA 2HIVA 3I2ZA 1XTIA 4X8LA 3TVDA 1CP2A 2OG2A 3NEJA 4YMUA 4LHZA 4D81A 1U9IA 2QZ4A 3WMFA 3FGNA 2ZIAA 2P67A 3NH9A 4A3BH 5CLQA 1FOEB 5DNYB 4M9XA 2NTYC 2BCGY 3HOXG 2ZTDA 1EWHA 1UKVY 1P16A 3QQ5A 5C4XH 3I32A 4WAUA 3CD6A 3V00A 4TQUS 3WNCA 4FN5A 1COWD 1SVWA 2GKSA 3S17H 4TMTA 5LMUQ 1SXJC 1XCMA 3FE2A 4L8GA 4A0GA 4DV3Q 1SMXA 1P2SA 1T4GA 3B2EA 5K36G 1E3PA 1QVFA 4Y0AA 3K9LA 3T61A 3IEVA 3A6PC 3X1WA 1NSFA 3K7AH 2ZI6A 1B70B 4YMSA 2JDIA 2JEBI 2HLDA 2J7KA 2NVTH 2WAXA 2WTUA 1NBME 3D3QA 2NO9A 4JI4L 4UY8C 1AA9A 3REGA 4A8JB 5JSZA 2R44A 3MWKA 3NENA 4PQYA 5CJPA 2E2IH 4K0KL 3BU2A 1JJ2A 1XJ0A 1ZCAA 4Z8XA 1L1OC 1XD2B 2YC4C 4D4LA 1CKEA 5FPTA 2BMDA 3CF6R 4B2PA 4JI7L 2AFHE 3A4LA 2A68C 4C3JH 4L5RC 4MKIA 5M3MH 2PL3A 1XJCA 4BBSG 3SBEA 1GILA 1NG1A 2WKPA 2DNEA 1PYBA 1R9TH 4NP6A 3FYHA 5F9FA 3ZVNA 4JC0A 1NN5A 4ZI3A 1T6NA 4D80A 1CI3M 3CRQA 3HOUG 2GJ9A 3Q5EA 1Q1EA 3H86A 1BKBA 2DHRA 2A7QA 4OONA 2R8RA 2W6JD 1C1YA 2YVUA 2ZSFA 2OO7A 2Z4SA 2C2HA 4GFDA 1UKYA 3C5HA 2PNRC 621PA 2LXJA 2OBNA 3H1TA 3MFYA 3NH6A 3T1YL 3EQLC 3RN2A 1OF1A 3T1OA 4LYJA 2FN4A 2Q3FA 2ZAMA 4QHYA 5DHFA 1FQKA 1OFTA 1UE7A 4P0TA 1KI1A 2H92A 4NPSA 4A3KH 1EWRA 2QA5A 1N5LA 1OV4A 3TMKA 3ZD7A 4JV5Q 1ZNWA 2ODEA 4DSNA 5L3QA 3N6RA 4O2RA 1P7CA 1CSPA 2DUDA 1Q1QA 1GKYA 2CL6X 5DO9A 4DR2Q 2Z83A 3IQXA 4UXHA 1N8RC 2AN9A 3RRNA 5AJVB 1OJLA 4IFDH 3NEYA 3OEED 3ZZ0A 1JR3D 1SVMA 4XOIA 3GLFA 1RVDA 1S9DA 1TXYA 3M7NA 1A4RA 1EWIA 1VCMA 4UP8A 5D3MA 3NEMA 4BWYA 4PZZA 2KCCA 2R7FA 2OE2A 1ZINA 3U58A 2WWWA 4KKUA 3IDQA 3QVUA 2QP9X 2NZHA 1E0KA 3AFQA 1Q8KA 1TPZA 4A93H 2KB0A 2GEDA 3J81c 3FKIH 4X62L 3HOZH 1CJKC 5IYBG 1DG3A 3B9PA 1Y1WH 1XEFA 3BH6A 3QXJA 4BFSA 5JSZB 4DT1A 2HJGA 2LKDA 3S14H 1RW4A 3BB4A 1ZIPA 3V9PA 2HUPA 5BR8Q 2ORVA 5FOSA 1IW7D 1E1QD 3S1AA 3FKSD 1D2MA 2KHJA 2JCSA 2ZS9A 5EP2A 4LBVA 3H4MA 3I5XA 3F0TA 4Q4HB 4MNOA 2NZJA 2VSOA 2VO1A 4KFUA 4KO8A 2IHBA 2WOOA 2B8FA 2WJVA 5CM8B 4A0RA 3BD9A 1QDEA 2E2HH 4C3HH 2FJUA 2QPTA 4DRZA 5HPYB 3DEFA 5L3SA 5IYDH 1S72A 5AR1A 2JA5H 4HEJA 3WYFA 2O8DB 1E0AA 2IX3A 4IFDI 3ETLA 1AN0A 5SZJA 5C3EG 3OIYA 1WA5A 3NC1C 4KI0A 3RR5A 2YOFA 3HYRA 2NVYH 2ZR9A 3HOYH 3MRSA 5TB5A 1NN3A 4ASUA 1LFDB 1P3JA 1N2CE 3VFDA 3DOFA 2EQBA 3K9GA 4JLBA 2IUSA 1XMSA 1CFMA 1SKQA 2R6FA 3W1GA 3U7EB 5AJZA 3G0HA 2O8EA 1KZGB 1HPCA 2QRNA 2EIFA 1GG2A 2JAQA 5ELNA 1I4LD 1ZKOA 1M8PA 2ZRJA 3I8XA 2C77A 3K1JA 2QPAA 1UJ2A 2RAPA 2LSSA 3TK1A 1P62B 4TWZA 4LF5Q 3NC0C 2R2AA 2YOHA 4DWJA 1TWHH 1Y14B 1G21E 4DXAA 5AWFC 2YV5A 3IHWA 1II8B 4XJXA 2RGGA 3LVQE 4NMMA 3PG5A 2BE5C 4B73A 2OLKA 4DUZL 2W0SA 3BFXA 2P5TB 3KUCA 4ZIRB 1AM4D 2ORIA 3KOJA 3SI7A 4EFNA 5ELXA 4HIKA 3E5HA 4ZPXA 4ZDIA 4LY6A 2GCOA 4D4MA 1QHSA 2B3GA 1XJQA 3OAAD 4TMKA 2GEUA 3O8RA 4X65Q 1W0KD 3AVVA 4PZ6A 2JA6H 1DAKA 4QJ5A 1C4OA 2IYVA 2D0OA 1F60A 2XAUA 4BZXA 3I4NG 1G19A 4MYTA 1TWGH 1QHXA 4LOAA 4PHGA 2FNAA 4U5XA 5IDVA 3VKHA 3L0OA 4DR1L 2JLVA 2ZQ5A 1J6QA 1N6IA 2I0QA 1HNZQ 4V0ME 4Y0VA 2Q6TA 2IUTA 2REBA 4CIDA 1YU9A 4LX0A 3J81i 3GLFE 2UKDA 4LHYA 4JK1C 1XCGB 3HFZB 4R71A 2Q8IB 1G7SA 1UAAA 1CRPA 2JEAI 1MV5A 4Q1EA 1YIJA 4QY7A 1VQLA 4WJ3M 1Y63A 1NKTA 3QF4B 3WMEA 2N49A 2E2JH 4BQSA 1NLYA 1C9OA 1NLFA 3WRYC 4DDTA 1ZRHA 1FUKA 3KTAB 3ZVRA 5J47A 1EXMA 2EFDB 3UDXA 1LVGA 4L5BA 3PIPA 1DARA 2XTMA 1FJGL 3FHCB 5KDOA 4B33A 5IP7H 4KKSA 1X65A 3EW9A 1II0A 4XH9B 4URXR 2ZE5A 4PC2A 5FTMA 2CFMA 3AEZA 4EPTA 1XCPA 2J0VA 3OIVA 1NMGA 2NVXH 3EZ7A 4IEIA 5H68A 3HKZE 2BOVA 2LKCA 2YHSA 1TL7C 5LMNQ 1VQPA 2GRJA 1DAIA 3AP2A 4G01B 4HUQA 1S3SA 2OLJA 2ZROA 4DUYL 3TLXA 1N5JA 1TU4A 1LYLA 1Z28A 1UKEA 1ZAKA 4HAUA 1HUQA 3AF2A 4DSUA 4IO9A 2NPIA 4N0EA 4YWKA 4GKKL 2QM7A 3OIWA 1MR3F 3K0CC 2AUKA 1BBWA 1KJYA 1PHJA 3X1YA 2P6NA 1N6PA 5JEDA 2HT1A 4OXPA 1SLJA 1SXJE 4JI3L 3QXHA 5EE0A 5EP4A 1PFSA 1OXSC 3D31A 4DV0Q 3CPFA 2BA1A 2UXCQ 2GZDA 1IN5A 1XEXB 4G5RA 5KSOA 4LUVA 1MO5A 2R92G 1NI3A 2EJGC 2D2FA 1ASZA 3Q72A 3ULLA 5IWAQ 4QXAA 2XJ9A 1X3FA 4EAQA 5AUNB 2R62A 3A7LA 3MD0A 5JHGB 5FOXA 1NNEA 1UBFA 1W49A 1JJGA 2VL6A 2HIXA 4OX9Q 1DGSA 2JE6I 2H8KA 1SROA 2R7ZH 2XEXA 4Q19A 2VTKA 3TW4A 5IHPA 2CKZB 1VYVA 2GEVA 2B21A 1E2ZA 2GETA 4DV7L 1DPFA 1E0JA 2ZI7A 1DO0A 4A3MG 4B3BA 4LBWA 2ZEJA 1YR7A 1YEZA 1QHIA 2IYYA 1KSFX 1W47A 2CE2X 4ESVA 3PUWA 3BZKA 2D74A 4LHXA 1IOZA 1YJNA 3NHBA 2A2ZA 2NN6G 4LFCL 2ZJQA 2PLRA 3PQCA 2EWVA 3VNUA 5C4JH 4Q7MB 1GO3E 5DHAA 2D3WA 3EAQA 3IGFA 2WHXA 3LX5A 4JBYA 1V43A 2IXGA 2XNDD 1WE2A 3OFND 5FBWB 1JPJA 3ZS9A 4BUJA 4ZKDA 5H8WA 3P1JA 2O5JC 1KD1C 2L5TA 4A92A 3X1DA 4QNMA 1E24A 3GTGH 4DR4L 3H0KA 4FMDB 1MRNA 3ERSX 1P2TA 1AGRA 1BIFA 2ZE8A 3W5OA 4LK1C 1CXZA 3RS4A 4F92B 1IY2A 1ETUA 1XD2A 4F4JA 2AWNA 2EWWA 1O7LA 1OIVA 3FFBA 1LF0A 2QT1A 4OYHA 1W48A 1V8QA 2PX3A 1PH3A 4QM6A 4DR5Q 1K8AC 4ZO4A 1LTQA 2QAGB 1QRAA 1GHJA 3ZIAD 1H8HD 1KI2A 1I6VC 4IJLA 4JYAL 1VHLA 2J9RA 3RDPA 4MITA 3K0FB 1HV8A 4JBXA 2R6CA 4O0MA 1G41A 1OPXA 1UWVA 2F43B 3HU3A 4OHWA 1EOVA 4OBEA 5P21A 4J0QA 2VP6A 1N6NA 3HJNA 4EQ5A 2WSSD 3I4MH 1E2WA 3KDFA 4BA1I 1S4QA 2G3YA 3DHWC 3EIVA 2ES2A 3FB4A 3IBGA 3PFIA 4DB2A 2XOKA 1R5OA 4NYJQ 4MGYR 2WM9B 3QOFA 1R0WA 5H1SE 4LJYA 5FPYA 4NPHA 2GXUA 2A6HD 3Q8XB 4A2WA 5HZKA 3QJYA 2ZJ8A 3H15A 1IBRA 4DKXA 1R8QA 2F1IA 2XGTA 3E0EA 1X55A 2WBLC 1IY0A 3QPWA 3LW8A 3QF7A 4KVGA 3MXUA 3GJ4A 3SR0A 2O8BA 1VPLA 2VHTA 4URYR 1Z6GA 3ZDQA 4LFAQ 3KJOA 2ZS7A 2AMCB 2EFHB 3KF8B 2BH8A 4LDJA 3DVLA 4CEJB 1DXMA 4DUGD 4M1WA 2KCMA 2HYDA 4B3TL 5IRCD 4DV2L 2C9CA 3RS0A 1SXJB 2QEQA 4DKAC 1AH9A 1KO7A 2VBCA 2ZJRA 3QEOA 5E7IA 4MRVA 3I72A 3RHFA 2ID0A 2VUMG 5CYOA 4I81A 2FSHA 4I1UA 3BK7A 4OQFA 3T1HQ 3LVRE 3NELA 4JI8L 4L5QA 4FCTA 2IS6A 1GIAA 2K75A 1T0JB 4YQFA 1GUSA 1AQUA 4JLVA 3TUJC 3W3AA 4A3FH 1KSHA 1S3GA 1X8KA 4A3GG 1IYUA 1XTJA 1KHIA 4A3DG 4PSVA 1OXUA 2UU9Q 2QF7A 1W5SA 4TSFD 4ZI2A 4BBRH 1JEDA 4D25A 2FZLA 3K0EA 2WWFA 3AH8A 1Z0FA 4P4SB 3F8TA 4XWOA 2ZT9C 1HNWQ 2Q2HA 4B3FX 4JOIC 2BMEA 3GEIA 3F5FA 3Q9LA 5KPDA 3AM1A 4AKGA 2K52A 2A1AA 3WHLA 1W46A 2WJGA 5HKKD 2EDGA 2EFCB 2VL7A 2FMXA 4UNSA 4PFSA 3W6NA 2GJKA 2EXDA 4TLAA 4Q4HA 3N2IA 4Q01A 2WV9A 1T9HA 3FHTA 1CF4A 2OQKA 2E5LQ 1GUTA 2J87A 4OHZA 3U4VA 5EP1A 5FH9A 1E2NA 1KI3A 1MO3A 4R9UC 3TIFA 3DPUA 2JA8G 2OTJA 4U7DA 3AV0B 4BZQA 1VQHA 1KI4A 1WCV1 5DGXA 4TYNA 1WCMG 3PR1A 2RCNA 1YRAA 2GJAA 5GJWC 1CBUA 1KC8C 3EXAA 4D4KA 5J4YA 4YLGA 3AUXA 1NBMA 5JJLA 4QGGA 4YHHQ 2GAOA 5EJEA 1EX6A 5IT9c 4CF7A 1KJZA 5AJYA 3SDZA 2RHSB 1GRRA 2PZFA 1OSNA 4R98A 3W5IA 3PO3H 4DSOA 4GL2A 3C4JA 2B7BA 1I2MA 1OYWA 1UBCA 2BBSA 4AG6A 3PJRA 3VKGA 2H1LA 4PXAA 3PO2G 5GAHC 2RGAA 1GDDA 1ASYA 1Z29A 4RD1A 3SN6A 3W34A 4BLQA 1CKNA 1GUGA 1RYHA 1II9A 2CCJA 5KO2A 3J80c 1VQBA 1II8A 3A8IE 1OW3B 3U3RA 1FPMA 1IW7C 3DM3A 4ALPA 2ZTEA 3ULPA 5CIQA 3SYKA 3A8TA 4GOKA 1BMFD 1D7QA 2ZE7A 3K09C 4LUZA 4HLQB 1X86B 2P6UA 1H9SB 1H8ED 3OZXA 521PA 3LNNA 3WBJA 1QJOA 1I6HH 5M3FH 1L2FA 1G8HA 2FU5C 3U44B 5BXQC 3CF0A 3DDCA 2JDID 4L9WA 2HLDD 2DNCA 3DKPA 3IIJA 4ZCMA 1AK2A 1Z6TA 4RVCA 2RHMA 5JFGA 4N0DA 1NMXA 1VIYA 2JATA 4LJ4A 3C14C 2C9OA 4Z1MD 2W2XA 2R65A 1U94A 2W83A 3CLVA 4W5WA 4KV9A 4EQ6A 1BO6A 4PQFA 3QSYA 3BERA 4GP6A 1E9RA 4IOKA 1SR3A 1NRJB 4XD7A 2LMCB 3H94A 4I1SA 1E9SA 2NO7A 4B43A 2ZETA 4HUTA 5FR1A 5A5GA 2RGDA 2B6HA 3WXMA 1IXSB 4AYXA 4LF6L 2GTPA 2J7PA 1ZUNB 1L4UA 3QF4A 4OL0A 1EG7A 1KXLA 2Q9BA 4JIMA 3CCVA 4B71A 4DV5L 2ZJOA 1V9PA 2OBMA 1GTVA 3E2IA 3KTAA 2ALYB 3KX2A 4P4TA 2Q0HA 4IOCA 4A3JH 4DR7Q 2NZ8A 2ZRKA 1N36L 3KKPA 1DTSA 4LFBQ 1KI8A 4QBHA 3SHFA 1GUOA 2CBZA 2QQEA 2XSZA 4URWR 5TXGA 4IVRA 2H7VA 2V1UA 3ULJA 2VHCA 1HZAA 4MA4A 2OAP1 3T1VA 4BRUA 2QGNA 3CCMA 1RRCA 4RY2A 4M9ZA 3TAUA 3ND8A 4DAMA 2DFTA 5FUWA 1WRBA 4JI5Q 1FP6A 2DY1A 4ZKEA 2PCFB 2BVNA 1D2EA 4LF8Q 2C95A 1LB1B 1XTKA 5J4HA 3VKWA 2VS1A 3EASA 4DLYA 3ZJYC 3HOXH 2D5DA 3B6YA 1G8GA 1QBKC 1XRJA 4JG2A 3LY5A 4I99A 1R0ZA 1JB1A 6Q21A 2DFLA 1B8AA 1IBML 2OCPA 1BS1A 5HCNA 3RLFA 2RH5A 2ZJBA 4PC6A 4E09A 2JLYA 2IS1A 3AGQA 3N5CA 5C2JB 1XTQA 1WOCA 2PMDA 1FR3A 1O3YA 1T5LA 5K36H 1PH9A 3LD9A 5FJ8G 1ZM7A 4GN4B 2ZTSA 3OESA 4DK3C 1U98A 1XNRL 3HOWG 4NYMQ 4NU0A 5JI3E 2RGBA 3W3ZB 2YC2C 2D62A 5EXSA 2VEDA 3KF6B 1JJ7A 5C44G 1GITA 5JWRA 3T34A 2QQ0A 4URVR 1J70A 2HHHQ 3A1SA 1G16A 2CJWB 4IFEA 4HAZA 4DNRB 1JQLB 3MJHA 4AIIA 5BN4A 1AE3A 3ADCA 2JEOA 2LCFA 1HJPA 3LQRA 1HNXL 2UZ3A 4OWXB 3LDAA 1XNQQ 1VQGA 1AZTA 1IAQA 2JLZA 3ADDA 4B3SL 2GBLA 2J41A 1KO1A 4R4IA 1OIWA 3PENA 2J0UB 5IP9G 5GROA 4BBSH 3DL0A 4FCWA 1K5DA 4PG3A 4R4CA 3CMEA 2MSDB 2KHIA 3CB4A 4DV6L 1UE6A 1DE0A 4HB4A 1A5TA 1FNMA 5GJVC 5KNBA 3GLIE 2C9YA 1A0IA 3HOUH 2UVQA 4BY1G 1KK2A 4JVMA 3ZZUA 5BYKA 1SKYB 2DYKA 4NYMR 1NJGA 4QGHA 3TH5A 4LJ8A 3CX6A 5KDLA 2BEKA 1P61B 3NWJA 2QGQA 1HY3A 2YWEA 4NDZA 4P71A 1G20E 1ZNZA 2FOLA 1GWNA 1LY1A 2AD5A 4WXRA 1YVDA 3AP1A 3T56B 1KMHB 2IWRA 3ASZA 1Z6HA 2VLIA 2AX4A 4RG1A 4F7WA 4BPBA 2EVWX 2GDJA 2XZOA 1L7VC 2ZSBA 1H9RA 2DGYA 3UMFA 2WWYA 5AJWA 2WJIA 4OWTB 3TVTA 2WAYA 3K53A 3K81C 2IYLD 2WJHA 1CS4C 3QKUA 4RD0A 2FEMA 3FHOA 1XXHE 4K0KQ 2EYQA 3E1SA 1AS2A 3CCSA 2QAGA 5K8LA 4H44C 3LRPA 1XD9A 1G7RA 1UDWA 3K0FA 1FTSA 1ZD1A 1VQAA 4PO9A 1KIXA 5AJ3L 1G1MA 4NZYA 3ZZTA 1FL9A 4G5GA 3MWYW 3UIEA 1J90A 3S1MH 4YCWA 2CCKA 1TQ4A 2GBLC 3NBXX 4MUAA 1NBWA 5IYBH 4LJAA 1G18A 1M7GA 3A1UA 2GJ8A 3AQ4A 2G1JA 5K8UA 5L3RA 3MWLA 1T8TA 1PH6A 4QJ4A 1IYVA 1S0UA 2KBFA 2Q3MA 3LBNA 4TLCA 4QHTA 3SC3A 4DCUA 3LLUA 2KI5A 4GNXB 2QP3A 3GJ5A 1WP9A 1JJCB 3T1YQ 1Z47A 3MLEA 2K5VA 4YONB 5FOTA 4V0KA 1RC8A 1KNQA 1TKWB 1Z6XA 3U7HB 3X2SA 4OQNA 1P5ZB 1ZYRC 1LNZA 4KLKA 4CEJA 3TE6A 2QP4A 5HE9A 4QJFA 1E1OA 5C0XG 1SXJA 2HCBA 3GEEA 5DIFA 4OI1A 1OB2A 1AJEA 4WJ4A 1FQJA 2HQLA 1TQ6A 5C3EH 1E0SA 4B3XA 1H9KA 2WMNB 3L0PA 3UDGA 3L82B 4A8JC 2Z6KC 1FZQA 2GJSA 1G7TA 1JR3E 2XITA 3WNDA 2NO1A 3E9IA 2WSMA 4LK2A 2BJVA 1XX6A 4IJHA 4HJ8A 1XMQQ 1US8A 4C0KA 4C2UA 1YZQA 1L1OA 2K32A 2GVAA 4JBWA 4P4SA 2JJ2D 5EAYA 2AD1A 1E22A 4OO1G 1J8YF 3B1ZA 1DOAA 4X62Q 1NIJA 1YKSA 2V1XA 5EUMA 3ZYCA 4BLPA 3R8FA 3ZLJA 4OHYA 3RS3A 3MSXA 3CNNA 4C3ZA 4DV4L 1R0YA 2BMFA 1JI0A 4TKOB 3GLHB 4HDQB 3KLRA 4QBGB 1E69A 3SS8A 4A9AA 4GLXA 4YXWD 1FX0B 2GWHA 2XTNA 3K0AB 1SVKA 1NVXQ 3W5JA 2B7CA 3GQBA 3EPJA 3ZVMA 2A6HC 2OCEA 4HIOA 3JC66 4A3EG 3J7A5 4Y52H 4NCKA 4ARZB 4X66L 4DR3L 5G41A 4LWZA 3UE0A 4HJ9A 3QUSA 1E7ZA 4IXMA 4Q4AA 3T1TA 3JAMc 2P6RA 4JT4A 4BZPA 2A5DA 4TTPA 1KO8A 2CNWA 3LA6A 2VPPA 3T5DA 1A82A 1FGUA 1IXZA 4B34A 3PV0A 4EPXA 1TWFH 4PPFA 1EWQA 4QGUA 3I4NH 1E3MA 5EE5B 5E95A 2W6IA 5AK0A 5GVRA 3CPWA 4PV1C 1NP6A 3CRMA 2VQFL 4RFSA 3I5YA 4Q18A 1X9NA 1JR6A 1N0VC 1JE5A 1OE0A 1S8FA 3CKLA 1N5KA 1XXHB 2OSBA 4LYHA 1RJ9B 2QPOA 4GP7A 4HSEA 1VG0B 3QPVA 4PZYA 1GL7A 4JI1Q 1J7KA 4KFTA 2IYSA 4F4IA 1G8PA 1CR4A 3Q3JB 1KHTA 4PAOA 1GVPA 2CCZA 2QMUA 2ZPTX 3AB3A 2F1HA 2HDNB 4WVFA 3HWSA 5DH9A 4AYWA 4BFVA 5KNCA 1GRQA 4TLDA 2AWOA 1NKSA 5D3QA 4ESHA 5FL7D 4MH0R 5HCIA 1BYUA 1TADA 2UXBL 1E9BA 4X64L 1W1WA 1H9SA 1XEWX 1G4AE 3KDSE 4W7SA 4D82A 1I3QH 1XMOQ 1HURA 2FGJA 4BEBA 3OEHD 4DUZQ 5DN6A 1RRPA 4GN5A 2PT7A 3U44A 3CX8A 1YHBA 2V55B 1OT3A 4A1FA 4GDFA 4BA2I 3WBKA 4HLCA 3THWA 4A3LG 5UKDA 3VR2A 1AS0A 5K8TA 4AD8A 3LNCA 1ZUIA 1U90A 1LW7A 1P75A 2ZYWX 4KYUA 1G9XA 1WB9A 1X56A 1ZJ6A 1RYFA 5KHOC 2ZM6Q 1QHGA 4GNKA 1ODFA 4TMVA 3U6BA 1VF5C 2YTYA 1WXQA 4I1VA 1ONLA 3CW2C 4MTNA 1VQ4A 1G3QA 3OIUA 1PA6A 3M1IA 5FOUA 4ABYA 2P65A 1Y8PB 2ERYA 4C9BA 1UPTA 2C96A 3G48A 4HJAA 1I4TD 3WRXC 4CDGA 5FPKA 4EX5A 2R92H 2O8FA 1UE5A 3O8CA 1EFWA 1PYSB 1KNXA 4TYPA 1KKLA 5FBLB 1VHTA 3A36A 3ONWA 4DR6Q 2W00A 4EKDA 1S1MA 2RMKA 2BKEA 1E79D 2QY9A 2PPBC 3B85A 4C2MH 4LPKA 1EESA 1T5EA 2QENA 1MABA 1HQCA 3IRBA 2ZAOA 3ZVLA 1XU4A 1YR6A 2X2FA 5FLMG 1E2LA 3BZCA 1XMJA 3KJHA 1FJGQ 2W0MA 3OE7A 4US0R 4UJ5A 1GUAA 2VRWA 4XSGA 2G83A 4A3MH 1VQCA 3JAMi 4JI0L 3NKVA 4RZ2A 2CCGA 5BN5A 2GVDC 4HI0E 3W8RA 3L2OB 1E32A 4GOPB 2N46A 1KMQA 3NHAA 3CRLC 1M1KC 1KRTA 3IILA 5JEAG 1UBEA 3VHLB 1EFRA 2NN6H 1HQMC 1BBUA 4DUYQ 3HYTA 4X8OA 5IK2D 1PH1A 3CR8A 1VQ5A 2JIZD 1QG4A 5ANRB 1EYGA 3TNFA 5CIWA 1VS0A 5EP3A 4C3IH 2A5JA 3OW2A 1N33L 1E1RD 1G51A 3RZDH 2GNOA 3IIKA 4NYIQ 3TZUA 3HGBA 5CLLA 3WNBA 4WZ6A 4B3DA 3KQHA 5GQOA 1IBLL 1UADA 1YJWA 4MGIR 4LYAA 1KI7A 3ASYA 1TQ2A 4OJQA 5LB2A 1HH2P 1XPOA 1S2MA 4Z54A 2CJWA 2BBOA 2E8GA 3LX8A 1TF2A 1CULC 1QF9A 1W2GA 5J3BA 5FFMA 4RZXA 4IOJA 2YU9H 3TR0A 1A2KC 2CLSA 5FTKA 3FWYA 4LRWA 4PX9A 2CK3A 3AFPA 3AKYA 2A19A 2N3SA 3KJPA 2ERXA 3MUFA 5HGQA 4G7HC 4P73A 2J0UA 4JLPA 2DWPA 2EFEB 2F55A 3CM0A 4B48A 4Q1BA 4KYIB 1CU1A 2IF2A 1YZNA 3F3YA 2L0XA 4FXPA 4Q5IA 4CVNA 4GKJL 1DAHA 1T8UA 4NYIR 2GHIA 4YC7A 2KE5A 5G53C 3U3JA 2AK3A 4Q47A 1LS6A 4OGQC 3DM5A 3R8CA 1TU3A 1V1QA 2NN6I 4M53A 2B63G 3HU1A 2X19A 1EIYB 1QG2A 3SJZA 2IYUA 1AQYA 3PGZA 1YZKA 3R7WA 3UXMA 4AC9A 5JEEA 1ZC4A 1CJUC 4P72A 2PI2E 5HY6A 3B82A 4S35A 3W6PA 2ZRDA 4A6XA 4DEXA 4TMWA 1ZM3A 2IY5B 2OAQ1 2J3EA 1QVAA 4XSHA 1XZQA 3WP0A 2D7DA 3EPLA 4KFSA 4Q4JB 3D7MA 1WBBA 4DR4Q 4Q9HA 4A2PA 4P75A 4LW1A 2QU8A 3I92A 3QKSB 3PEUA 4G1UC 1TX4B 3BJIC 3CZPA 3K0CA 4IQZA 4IKEA 3UMRA 1R2QA 3RS2A 3HKZG 3KKNA 1U0LA 5AUQA 4YWLA 3BRWD 2VUMH 3W8NA 2MNAA 2C8VA 1NVVR 3L8YA 1E94E 5EE3A 2HEIA 4MYCA 4NE2A 3TQFA 2NZOA 4LF4Q 2V8OA 2BEJA 1FUUA 4TMZA 3RRYA 5HR5A 4ZDJA 4YMWA 2J0SA 3PSIA 3ZGXA 1IY1A 2NPFA 4A3GH 5C0XJ 4A3DH 4DCTA 2A8VA 2ZVQX 8OHMA 5JCPA 5J4LA 3U60B 4P32A 3KYHC 4JL6A 2OT3B 1GL6A 1KRSA 1KAWA 4YY3Q 1E98A 1N6LA 2HYIC 4YWMA 4KHPQ 1N25A 1WQ1R 2QNRA 3GTMH 5BYJA 121PA 2D7CA 4NCJA 4QFMA 3SJCA 4YCVA 2BC9A 2O5IC 4S2EA 4EPRA 2KBEA 4FWIB 3VR5A 1CKOA 4V0NA 1F48A 2RGXA 5K8IA 4AURA 4Q48A 3MAAC 3P20A 1NVWQ 2Z43A 4BLOA 2IYTA 4JV5L 4HB0A 5HE8A 2JJ1D 3R9IA 5E7JA 3K0SA 3M3YH 3GTLH 4CZ2A 2QM8A 2B29A 1PH2A 2JA8H 4DR2L 1QZXA 4CEHA 5EE1A 1D8TA 2ONKA 4DV2Q 1W2BA 4HZIA 5CJ2A 1WCMH 4NXML 2A5FA 3C41J 2N78A 2C99A 1MJEA 1G6PA 2ZRGA 4PAMA 3TEHB 1OHHA 4EPVA 4JI8Q 2QAJA 3EIEA 4P4UA 2XSZD 2VIIA 5JRZA 3KJGA 2VQEQ 4LJZC 4ZCLA 4IRUB 1GP2A 4W5JA 4B3CA 2A6EC 3SFZA 3M4PA 4A75A 4IXNA 5JWHA 5J40A 4MKFA 2ZJPA 3GJ7A 4A6PA 1U8AA 4NH0A 3THYA 1IJEA 4QBFA 3R9XA 4BY7G 1Z6YA 2GF0A 4DV1L 1PH7A 3PO2H 3GLHA 5CK5A 4DHEA 2XB4A 4W9MC 4TT3A 4LV5B 2QE7D 2YYZA 3K0AA 3DMNA 4B3MQ 5LDDC 4HAYA 3GLIA 2ECKA 4BFUA 4ARZA 4C7OB 3VR4A 1YR8A 4HB2A 3ND9A 4NXNL 1Y3AA 3GFPA 3SQWA 4DB4A 1WI5A 1C7YA 4GNXC 1EFTA 1MT0A 1M74A 2BJWA 2F1RA 2GXQA 2PBRA 2V9PA 3A58B 3KFXA 5A35A 1DAGA 4Q7LA 5E3HA 3FHWA 3LH5A 1XWIA 4E03A 2IX1A 1E2PA 1RRGA 3DO6A 4HDCA 4BRWA 3QXCA 1RPZA 2XXAB 4TYWA 1Z0AA 3MXNB 1NL3A 1COWA 1X3SA 3U4QB 1EK0A 2PQAB 1E9EA 2ZRFA 3BG3A 2E74C 2V4DA 2GF9A 4LUCA 3G5UA 4JI6L 1E2GA 1Q1BA 1KSJA 1N0WA 4LF7L 2H57A 3D6TB 1LACA 1AGPA 3EA5A 3CC7A 2J45A 2IHEA 2BA0A 3CPEA 2FPKA 1KI6B 4LGMA 2P3SA 2RHQB 3EN2A 4TLEA 3KB1A 1XXHA 4PAQA 1RJ9A 1A6XA 3MJRA 4KN7C 2V6JA 2VY3A 3VDYA 1Q57A 2V7QA 2G9NA 4A8JA 5C46F 4DLWA 4KHZA 4URUR 1KI9A 1D9XA 2OUKA 2WKQA 3AVWA 1P8LA 1Q90A 4RD2A 4ZV4A 3K70D 5EQTA 3E9HA 4PSKA 1EQQA 4POAA 4YDSA 4AKIA 3M4QA 2C03A 1GKHA 1N34Q 2GA8A 1I94Q 2ZJYA 5SZIA 2RGCA 1PUIA 2RGNC 2ZRBA 3HDTA 4FMCF 4C0LA 2QRZA 3VR3A 2UUBQ 1EIFA 4CT5A 1XPRA 1E4VA 1VQDA 1KZ7B 2C04A 2ZU0C 3BGWA 5FTNA 1GD7A 4JOIA 3CP0A 2QI9C 3W90A 5EE9A 4V02A 4DLXA 4X65L 5IE8A 2OBLA 1VQKA 4H1VA 4TL9A 1WBDA 4JVNA 4FW9A 4D0NA 2XGJA 5FPHA 2X1VA 2W2VA 1GZSA 3EG5A 3NE5B 3PUZA 4M1SA 1VTKA 4ON9A 5B64A 1U8ZA 1XNJA 2PMZE 1HNZL 1XD8A 2WPDD 5FJ8H 2VQSA 3AVOA 3KB2A 3GEHA 3CC4A 1G291 3HOWH 3RWOA 1ESNA 2HV8A 2IC5A 2ZYUX 4QOSA 4TYQA 4MDEA 4IDNA 2WB1E 5JEAJ 5DYIA 4DVGA 4II7A 5C44H 1DADA 2EJMA 4Q02A 3GTKH 2GVZC 3OEEA 1JR3A 3U7FB 5CK4A 3KJEA 4B76A 4KXFB 4KSCA 5GAEC 4A2QA 4DV5Q 4V0OA 4IVQA 1S9HA 2CXXA 1O78A 3D4RA 1IM2A 1KGDA 3I4OA 4LV6A 3GLGE 4JCVE 1YHNA 1VYUA 1N36Q 2IXEA 2NQ2C 4YDHB 3AKEA 4H13C 2CQOA 1GM5A 2F52A 3AVPA 3P32A 3TBKA 3U2QA 3GPLA 1A1VA 1BOFA 3BIFA 1DD2A 5BN3A 5IP9H 3S16H 1R4AA 1OYYA 1Z2AA 3KFVA 5FPSA 3T53B 3AVYA 3I8SA 3BDOA 2JA9A 4GOPA 5LMNL 2ZTCA 2G1KA 1ANKA 221PA 4BE7B 3CMAA 1G6OA 2WMOB 1C0AA 3CUEF 3TSWA 2BMJA 4BY1H 1XTRA 3A1VA 3FKSA 1CTMA 3BB1A 2ORWA 2A5YB 3PITA 3K09A 3A74A 5AUOB 2O0HA 2ZJAA 1LTLA 1UE1A 3TW8B 3R20A 3VU9B 1TU2B 3LV8A 3OPOA 3QXXA 3DM9B 2Q21A 4DV0L 1IXRC 4GMXA 4ITRC 2UXCL 1NN0A 4POFA 3AP3A 3VNVA 3SJAA 4RCNA 4DLSA 3GJ0A 4KN4C 1XNRQ 1X8JA 2DBYA 3AVXA 5IWAL 4Q7KA 1TTTA 4QG7A 2O8DA 4LV8B 2IYQA 1VQOA 2EU8A 1Q7YC 4IEEA 2D2EA 1G3UA 4JBMA 4DLVA 1FW6A 1Z22A 1M1YE 3AGPA 1Q3HA 2YWHA 4HYYA 5BW8A 2F1MA 2F1JA 3TRZA 4UNNA 5KYKA 4PPGA 2AR7A 3UMSA 2BM0A 1DAEA 1Z0JA 1PLLA 1XMIA 3PCRB 4ACAA 1GSIA 4DV6Q 1Z5ZA 2PLFA 3RYTC 4L8JA 1YHAA 3UDFA 3FMOB 1GUNA 4M2LA 2OEPA 3IFTA 5FBVB 2O0KA 3CPHA 4PQRA 4GOPC 3WHKA 1R10A 4DJTA 2QL6A 2ZRPA 3U3MA 2UXDQ 2J46A 2PJRA 4AG5A 5KU1A 3QBVA 4B3RQ 1SKYE 2IHYA 4MQBA 4LYFA 4MYHA 4MYUA 3JZMA 2WFWA 3HR8A 3RAPR 1PUJA 2BV3A 4EJSC 4DBLC 1G3IA 4C0JA 1XBTA 1ZP6A 421PA 4OI0A 3PUXA 2MSCB 2W6ID 1JXMA 4KAXA 4Q4JA 2A78A 5FTLA 3OAAA 3ZJYA 2OZEA 1GVNB 3QPUA 4I1OA 1W0KA 2BBWA 3QKSA 2W2TA 1EGAA 1D2NA 4HIMA 3ADKA 5CYPA 2B8GA 4EDHA 3QG5A 2HF9A 2NO6A 1P9RA 2CW0C 5C0XH 3T51B 4P74A 3G71A 1CJTC 2CVFA 2BIFA 2OESA 2N1BA 2ZU6A 4POGA 2IK8A 5E4FA 3T5GA 1W36D 4O3MA 3F2CA 4GT1A 3TQYA 3FFAA 4DR5L 4XWAA 3NXSA 4R7ZA 1OH8A 4XTRA 3QXSA 4C0HA 3V4RA 4RCYA 3IHLA 3L2PA 3GTOH 1T3SA 4YCUA 1A7JA 3QKTA 1K83H 4Z8YA 1LF5A 4UPAA 4G5SA 4U00A 5SZKB 2NOAA 3DKVA 5HTKA 2E9SA 3GLGB 4OO1H 2EFGA 4Q21A 5C1BA 1TMKA 1W4CA 2ZRCA 4DPGA 4M9SA 2QMOA 3BS4A 2A30A 4OI2A 2FGKA 1IBKQ 1A8VA 2OFXA 4FCVA 2VSFA 3EC1A 3PIRA 1Z63A 3HR7A 2H16A 4DZZA 2D0PA 3G4SA 4OQLA 4LJ9A 1U81A 1SE8A 4A3EH 2MSEB 2UUAL 2PX0A 1R0XA 2WVJA 3IO5A 1E2KA 2HXYA 1K73C 1AE2A 2FXQA 1KY2A 1VYTA 4PC1A 5EUQB 3LGJA 3X1XA 5C0XI 3TS0A 4C4PA 3I61A 3L0SA 3DLLA 1MIUA 2ZRLA 4KSBA 3UDIA 3LW7A 1CR0A 2GCPA 2YTXA 4OHVA 4OHXA 1HTPA 2ODWA 3T1HL 4ILEA 1JB7A 1FFHA 2ZREA 4JZKA 4QJ3A 1GJXA 2G0NA 3FMFA 3VR1A 1G8FA 3V4FA 5JCZA 1Q12A 1LUZA 4A3IG 4C2TA 4R4QA 1TAGA 1XEXA 3AKDA 2K33A 2UU9L 4QNRA 3CC2A 2DWOA 3EC2A 5HZHA 2GESA 2F4VQ 2FDCA 5KSZA 4PZ7A 1VQ8A 2FFHA 1YJ5A 2ODNA 2IWHA 4C0BA 2KBNA 4OO1I 4CEIB 1YVCA 3P4YA 2CE7A 4XVQA 4IPCA 3T15A 3BH7A 1VQ9A 2MQHA 3J80i 2UUCQ 1E2QA 2G0TA 3BE4A 1XTSA 3CCEA 4IW3B 1Q81C 1RIPA 1VIAA 5B58C 1KDOA 3S1AB 1ZM4A 2BE5D 2FA9A 4RSGA 1SFOH 3IIMA 1G5TA 2ZSDA 1YZGA 3CRVA 1E1TA 1KK1A 3F2DA 3GLHE 4QKQA 3RSOA 3STBD 4M1KA 1SVLA 1Z07A 2E87A 5FTJA 5E7MA 4X66Q 4DR3Q 1GFIA 4IPGA 1G8YA 2QGZA 5EZ6B 3UATA 4B74A 1OXXK 1YZ6A 4UP7A 2XXAA 3FDIA 2J1LA 5IY0A 2WWXA 2PI2A 3U50C 4A3LH 2W58A 4JLJA 2PQAA 2OFOA 1XDBA 2XNSA 4AKEA 4BXXG 3U4QA 3VA7A 4UJ3A 2BKUA 2YZ2A 3EIHA 1ZMXA 5ELOA 1W2HA 2VP2A 3B6EA 3OFNA 3EX7C 3B1VA 1PH5A 2Q2UA 3CONA 4YHHL 4QC2A 4LPSA 4DCNA 2DWQA 2YKGA 5DI3B 2ZITA 1E6CA 2PEZA 1VG8A 2EVBA 2VQFQ 5B30A 4PHHA 2J5XA 4ASUD 1RIFA 4G5QA 4PPQA 3E70C 4TLBA 1M34E 4J15A 1X1RA 4D0GA 3U6KA 1TF5A 2MO0A 4JI4Q 4E07A 3EPHA 4QRHA 3CZQA 1Z7TA 1X8LA 3VAAA 2Z6KA 3CCLA 5BQ5A 3TJZA 2JLXA 1Q22A 2B8TA 3ZIAA 3K8AA 4DEYA 4AQYL 2ATWA 1H8HA 3BWDD 4PO1A 1F5NA 4C0AC 2ZM5A 1FMJA 4GSYA 4WW0A 3KFUA 2NIPA 4L15A 5FL3A 1E9CA 4GZLA 3PUYA 4JI7Q 3Q85A 5FLMH 4B75A 3Q7QA 3BC1A 4B6EA 2F43A 2QMHA 1DCZA 3BOSA 4LHWA 2WSSA 2QUZA 4BFXA 1U0HC 4UP9A 3MG9A 1YNNC 2IHFA 5GADC 1MOZA 1W5TA 1CR1A 2DCUA 5JEAH 3KLWA 4O0AA 1Z0DA 1GNRA 2PEYA 3FMIA 2ATXA 3MGCA
chains in the Genus database with same CATH superfamily
5L7WA 3FTEA 3UKDA 4FSXA 1SYEA 3ZX5A 2X0JA 5LZ8A 2FKAA 3OD5A 4G5OA 3VX4A 4WV3A 4XFDA 5KSWB 2F62A 1DAFA 1CB0A 1XA4A 1IBKB 4DR7B 3N5KA 2QTLA 2RGWA 1U7PA 2L18A 5EIOA 3RS5A 4GLBA 3SM9A 2FZCA 2DRIA 1STYA 1Y4UA 2YTZA 3CXCA 1ORTA 1LABA 2BHTA 1I2BA 1U3VA 3TIVA 2JJQA 2EFYA 5IYCG 3LVFO 2P0EA 4NKRA 3D0FA 1G4HA 3HUFA 4Z1OA 1XWEA 1M34B 1FDRA 3OZSA 1CPYA 1V25A 4A4DA 1TYDE 1XP8A 1MW8X 2V6BA 3ZDEA 1C7IA 5BSKA 4JL8A 4IV8A 1RYZA 4JIGA 2OL4A 5GM1A 2WVGA 4Q4DA 3HWX1 4MAAA 5IKMA 3AC0A 4M1MA 5AW7A 2AEMA 1PX0A 1U7HA 5DEIA 1P31A 2VP3A 1ECGA 3PUKA 3T12A 4MPPA 4R8IA 1T0UA 1N2OA 1XZHA 2Y1FA 5FLEX 1YA6A 3FB1A 3VI3B 3RSZA 4N3NA 3AUYA 2F3SA 2L55A 4LF9L 4MMYB 5EIFA 3LLMA 1UBKS 1KLUD 4LWPA 2WKRA 1WVMA 3LPMA 4K6CA 2V96A 3ST7A 4IJKA 1H0SA 4KO1S 2FVXA 4N12A 1XOIA 4CEIA 4U6NA 1PIWA 1ZD2P 2I78A 1TLFA 3THXB 2YZKA 1RD4A 2JVJA 5M3FB 4EHJA 4MYDA 4AF7A 4QODA 1B3QA 3MELA 1CLUA 2FAXA 2ZUVA 1J21A 5LMUL 5AW1A 4KYTA 4MUNA 4IGKA 4E4YA 5CA1B 4P08A 4UEJA 2XMCA 4HMPA 1M2OB 1QWSA 4WY5A 1W94A 2Y66A 3NRBA 4Y8VA 3UA4A 3GTQH 1Z3IX 4MA0A 1U2EA 1CKNB 4ZK9B 3NP8A 1L1RA 4G0PA 3R7SA 1P3Y1 5HFJA 3AI3A 1HA3A 4YACA 4UNIA 3DWEX 4WKPA 1CZUA 4A3BG 2LWIA 1NW8A 1KVRA 1K6MA 4IDBA 4HY3A 1R8XA 4HNSA 4HWTA 1A1SA 3AHHA 2GUGA 1YULA 3CS3A 2AVDA 3E9ZA 3L43A 3GOQA 2F00A 5K0BA 5T8KA 4GN3B 1LS1A 2H1EA 4DR6B 1TAUA 4KU4A 1HLFA 1WF3A 3PF5A 1YDGA 2HBQA 4CN8A 4JPBW 2XCOA 1Q21A 2YJ5A 2K2WA 1X7YB 1G42A 1DBSA 1SEVA 1NW4A 4DAEA 1CVIA 4JC8A 4LSGA 3VAZA 2FCAA 2M6LA 5F1YA 3V8QA 2VHYA 2P77A 4KXXA 2AFIE 2XW6A 4QUKA 3QYJA 4HD8A 1ISJA 1GG9A 2VCEA 4L50A 4I4TF 1UWKA 2Y3IA 1OOEA 1H9CA 4WK6A 2QJFA 1V47A 4UDYX 4FMPA 3RCBA 2JVIA 2GI4A 3D2AA 1RM4A 2OKGA 4IDOA 4WGFA 1IULA 2WB2A 1GTRA 2Q4OA 1R8YA 4ZQFA 4D96A 4TZ0A 1K88A 4D6PA 4K14A 4C4XA 3NG1A 1K5GA 2EF1A 4YY3L 4MO2A 3TLBA 3QWNA 3CVVA 1JWBB 3ZR4B 2RI6A 4HH4A 1EZZA 1UEJA 2ONYA 2PJUA 2L15A 1CSQA 1K7CA 3J81k 5EIBD 2UUAQ 3HPQA 2A5GA 3WLAA 4UXIA 4AULA 1CUVA 3CF5A 4G7ZC 4MGKR 2KWIA 3BVGA 3BH0A 3HNOA 2LNDA 2IHNA 5IEJA 3PP8A 2R8PA 3QNMA 4KIGA 1H6CA 3ISJA 3PC8C 1S1CA 1RWPA 4WY8A 4MIYA 3EMKA 1XJVA 5EGTA 5HGXA 3L6BA 2AN3A 3LC2O 5D00A 5CP8A 2W22A 4JBHA 4DNTB 1MKYA 3MZ5A 3LBHA 3TZBA 4HZUA 5L45A 1U9CA 1VPEA 5BRJA 4H9GA 3SXUB 4A3MB 1UPBA 4HQKA 1WBBA 1XAIA 2Y0SG 5CV7A 3QV2A 2RSLA 1OFUX 2IYZA 1U99A 3IUQA 5F2EA 1VBFA 5J1TB 2WJJA 2IHJA 4I9NA 3QR8A 1Q82C 3AIMA 4ENTA 4JGBA 4N7JA 3GMTA 3SC6A 2X1MA 1X7XA 3UMGA 3F71A 1F6BA 3V7FA 1YE8A 1STHA 3PWKA 2WINI 1CY1A 3C7KA 1F9RA 1PGQA 2C1EA 1H95A 4DMFA 1DBRA 2OG1A 1NIPA 4DHWA 4Q4LA 4B46A 1AHIA 4GRAA 1HNWL 2PXAA 3RO7A 3I4MG 4K1XA 1YO6A 3AF1A 3EIFA 3C48A 1NJ5A 5CCDA 2GM3A 2XE7A 3QX3A 1U6KA 4WLVA 1CTQA 2YVAA 2DPLA 4ZYTA 3VZCA 4UVIA 3CZCA 2WJYA 3PJDA 4OK3A 5CVCA 3EJIA 5GZ3A 4JBLA 5GAGC 5KKNB 3OCCA 3R7WB 1Z8FA 1C9JA 1OH7A 3RVBA 5FKAC 2UXBQ 5CD1A 3CCUA 3AZQA 4JVLA 1T0HB 1QH8A 3ZXYA 2X6GA 3SGIA 4WT7A 3ROQA 5ESDA 5F1KA 1AMOA 1W4RA 3UA3A 2WKSA 1SBQA 2B8WA 4W5TA 5EA2A 2H18A 2XADA 3UB4A 1E96A 4FZ3A 1TT5A 1ZVJA 1RE0A 4BCBA 1B15A 4RCZA 4EW6A 1YNJC 5CVEA 1K0RA 3ZWXA 1DJPA 5AKKA 2CWDA 1F3LA 1HE8B 1DG1G 1BJRE 2VDVE 3MZ0A 2I22A 3DKRA 3D6HA 4UBIA 4PANA 5B7QA 3O8QA 4HLUA 3OC0A 3THYB 4KRGA 4A3JG 3IAM1 4H7FA 3O1HB 3WRVA 1MOSA 5KX5B 2HIVA 5CVTA 1TAQA 4UQLA 1QAQA 1N2JA 3G2KA 5CLQA 1USGA 2NTYC 1UBOS 4JEHA 3OA0A 3V00A 2RIRA 1KQGA 2Y0PA 3QOYA 1CRZA 1MU0A 3B2EA 4MMXB 2DUJA 3Q5GA 3JASA 1NBME 5CJPA 5LQCA 1NTOA 1L5GB 1L1OC 3RU2A 2F0FA 2OP0A 4ZPJA 3S2UA 1ICEA 4OJMX 2A68C 4ID3A 3FYHA 4H16A 3ICPA 3QLVA 1V5FA 1CI3M 4G4KA 2GJ9A 2A7QA 2YVUA 4DMRA 3PPWA 3MFYA 4PIVA 2IYNA 3E48A 4O4HF 1FQKA 3M2PA 4P7JA 3HCOA 4C29A 3IJPA 2EQ5A 1WMAA 1IQUA 2A33A 2ODEA 4HNQA 4HTFA 5A7HA 4D4JA 3VNQA 5K0EA 1PT5A 5A5FA 5FI3A 1GYQA 3EXFB 3ZU4A 5DF1A 4YRFA 4M1EA 4L4SA 1Y3IA 3FKSD 2ZS9A 5CGZA 3NWTA 4FFVA 4MNOA 3S15B 4KO8A 4FN4A 1O08A 1PGOA 5HPYB 1XCLA 1UC8A 2O6LA 1RZRA 4FQ7A 1DEOA 2C4KA 1X2EA 1CF9A 5HZGA 2FB9A 1IY9A 5JH7F 5KEEA 3OTQA 2EQBA 2IHVA 2ZRJA 2QRNA 2F0DA 3BYTB 3QVGB 1G21E 3KPVA 1FNSA 2OHGA 4DM3A 1A04A 4B73A 1NUTA 3OPVA 1GEGA 4TMKA 4JVZA 2BLNA 2JA6H 2IP1A 3DFFA 4G81A 2IYVA 4U5XA 3OX2A 2O0MA 2CNOA 4EMUA 4AP5A 3M34A 1M10A 2Y4NA 1RU3A 3RE1A 4Z4IA 1YIJA 4X1YB 1ISMA 3M82A 3RC2A 1DARA 3I01A 1HSOA 3RUCA 1T3ZA 4IEIA 1SQFA 5LMNQ 1R4ZA 2W6NA 3Q4GA 4IMIB 2PLWA 1ZD3A 3TQOA 4OXPA 3QXHA 1LT6D 2FRDA 2B2TC 3BXHA 3VTAA 4G5RA 1EXVA 2EJBA 4MA5A 1ASZA 3NANA 2PNJA 1UBFA 3NUQA 4DYHA 1SOUA 2A4KA 1DPFA 5J63A 3FVTA 2XF2A 3EAQA 2O2EA 4ZKDA 4HYTA 2F0JA 1JFLA 3RS4A 4RZHA 4R9RA 4CIAA 1OIVA 5IUKC 4KXYA 3BJRA 3AWIA 4DMHA 4ZO4A 1WCIA 2IZZA 4DF7A 3FKJA 3C1TA 2BPOA 2WM8A 2G3YA 3V4VB 1GPUA 4EYKA 2ES2A 1K3BC 4PYJA 3ESCA 2WBLC 5KJFA 1FU8A 2IE8A 3RC9A 3ZDQA 1GPNA 3AIKA 3NT5A 3KUXA 1FYXA 5EEHA 4DA7A 4PMCA 2G71A 5F3RA 4ENPA 2JLBA 1VJ1A 4II2A 5C5CA 3K0EA 3OU7A 5I4IA 1JHPA 3AEUA 4LTNA 5LZ5A 2GJKA 1QKJA 2O54A 3GQBB 1BDIA 3T7JA 3U4VA 1NQOA 4B6JA 1D6SA 3QU9A 3S8YA 3EB9A 2DFPA 1CBUA 3H4VA 3G6WA 8ATCA 2GAOA 1KJZA 3O4GA 4R8RA 4U3JA 4ZAGA 1JHAA 4EL5A 3PO3H 4WKOA 3VKGA 1WY7A 1FU7A 1Z29A 5KO2A 4JBNA 2IBTA 3OSZA 3GJRA 2H9YA 1DJOA 1L2FA 2FU5C 2WNIA 4XYEA 3TOVA 3C14C 3ROZA 3AJDA 2AC7A 1W30A 4PQFA 1XCOA 5A2QL 3GYBA 1WV1A 1R4MB 4HUTA 3RS8A 2Q6IA 2RD2A 1GA4A 4ITVA 2PKYX 3KTAA 2NVWA 4EDFA 3I4CA 4U5QA 1EM8B 2DY1A 3FPLA 4PLHA 3AZPA 3SIWA 4MEBA 1XRJA 1P9OA 1WEKA 3SF8B 3OIGA 2IPMA 4YT5A 3TAXA 5G4KA 4DYVA 1XNRL 4LK3A 2LTAA 4RKQA 4FYKA 3V05A 3FSJX 3GPBA 1Y5IA 5BN4A 2LCFA 1HA5A 3M6IA 4QNNA 4Z49A 3PENA 5TMDA 4O4IA 4HB4A 4WCDA 1UIMA 1MD9A 1WDWB 4YJ2B 3AP1A 3LK6A 2AX3A 4RXMA 5HNKA 1YSCA 5CVJA 4D56A 4N8SA 2GZ2A 3KRTA 3K53A 1B74A 4NRDA 5ALXA 3W5DA 5TF4A 4EMTA 2JPDA 1I4PA 1G1MA 3UIEA 4YCWA 4XEUA 4ZQEA 1TA0A 2X0IA 1KH2A 3SC3A 2GQ0A 1U4SA 4RHXA 1Z47A 1Z34A 1KNQA 5GOZA 2MU1A 1ZYRC 4W9NC 4LZOA 1SCBA 4B3XA 4GPBA 5T4EA 3EYWA 4Q0MA 3QUBA 1RR6A 1E8NA 3V5NA 4HEHA 4C2UA 1YZQA 1FP2A 5BUCA 2PAAA 4UCWA 1DOAA 4X62Q 5I9BA 3RTBA 3ZYCA 5F7ZA 5CBPA 3CN7A 4OU4A 4GLXA 1BQQT 1IXYA 4JI2B 1VL1A 5ICEA 4EJ0A 5A6SA 4WQMA 1JOOA 3KPJA 4UVGA 4B34A 5E95A 4FSDA 3BIOA 3ANYB 3T4UA 5GVRA 1GNLA 4WY2A 4Q18A 1NW6A 2R6R1 1S8FA 3FYUB 4LYHA 1ZEMA 3QPVA 5HJEA 4NLLA 4Z2YA 4JJIA 3K5HA 2JBAB 4YQYA 3KDSE 4FU0A 4R16A 2VDUE 4RJTA 2RFLA 2B5VA 2KOLA 1ZAYA 2PV7A 3HLTA 4F9TA 4G24A 1E3LA 3G48A 1UE5A 1JMVA 4F7XA 1EXWA 3NSWA 1FP4A 4DJFC 1A9ZA 2DQKA 2RMKA 3JAMA 5JPDA 3M4OB 4LPKA 3AU9A 3HL0A 2QENA 1B4DA 1HM5A 3OHPA 4CPDA 1GO2A 2QZPA 3CCFA 4ALMA 3KJHA 2AW3A 1GUAA 4XSGA 2GAJA 3UH0A 1U9JA 2GVDC 3HKCB 3L2OB 4H6PA 4EABA 5IC5A 4O4LB 1HQMC 5IK2D 4KQ1A 4GQBA 4P3XA 2VH1A 5EIHA 3TRHA 2EY1A 5BMVF 1SB8A 4N40A 3LIIA 2BBOA 1LW6E 2W4IA 3TR0A 4NV3A 1RLJA 4RL4A 3LP8A 3BE6A 2F55A 3C98A 2QRVA 1MVLA 3LHKA 1GCAA 1SBYA 1JE1A 3UXMA 1CJUC 3I04A 4A3JB 2NXWA 6REQB 5D6OA 3U49A 5CT8A 2DUNA 4ZKCB 1ENAA 4CM8A 1U0LA 1LRKA 3W8NA 2OYCA 5EE3A 2O20A 1DBPA 3ZNQA 4Y6GB 2OZLA 5C0XJ 3KYHC 1VIMA 4CMEC 3UCXA 5E4WC 4YCVA 2P9FA 4CLOB 3AZOA 1NW7A 1K5HA 1NVWQ 2Q5EA 4JV5L 3BDAA 4LI3X 5FCDA 2ONKA 5CJ2A 1WXWA 1BN6A 3F78A 2QAJA 2NXEA 2VIIA 1FBNA 3GEDA 1HE3A 4W5JA 4B3CA 3LCUA 3UT5A 2INGX 3KCNA 2FPWA 3OWOA 1HYHA 4HWOA 4B3MQ 1DZ1A 1BE0A 3T0GA 1Y3AA 4EZEA 2BJWA 1N1GA 1Q83A 3RAFC 5BSFA 2ZRFA 5A7GA 5ILOA 3TM4A 1BXGB 1PTJA 2JHPA 4ZRMA 2PE5A 1L3CA 4TLEA 2OXIA 1Q57A 2HQOA 2WKQA 4F6RA 3K70D 2V98A 3A0UA 4PSKA 1TQ8A 1Y6ZA 4CIVA 5TF0A 4C3VA 1X1EA 3O2QB 3G8CA 4F85A 2EKPA 2RBGA 1RHUA 3WKCA 4Y6PA 2F59A 5K3AA 3GGGA 5FPHA 5CFPA 3ROMA 4IV5A 4M6WA 5ADVA 2PMZE 5FJ8H 2NU8A 3T1NA 3SK6A 4MDEA 2WB1E 5JEAJ 2R751 4PICA 2EJMA 3WK5A 1U0RA 4KXFB 4EB6A 5GAEC 4NOJA 1S2OA 1AB5A 2Q5IA 3GPLA 4Y2TA 4L3OA 4GOPA 221PA 3KLNA 1T2EA 3CUEF 3DWPA 3R44A 3FKSA 5L7YA 4QECA 1X7ZB 4GR4A 3W7VA 5EXEA 4AL4A 4ITRC 2UXCL 2CXQA 3WISA 4JHLA 4BVEA 5IWAL 1TTTA 2FPXA 3NGLA 1XQYA 4HG2A 2F1JA 5LU8A 3HG7A 3VSBA 4HDSA 1HO3A 2W8BB 2NPOA 5KU1A 3GP5A 3JZMA 1PTKA 1XBTA 1S2DA 1P9RA 1Y8ZA 2RH9B 4XKJA 4AMZA 4WJLA 1LRJA 4AZVA 4RCYA 1LF5A 1Z6ZA 4ESEA 3KZCA 2OFXA 3FNIA 2JA5B 4JYMA 1E20A 1KDZA 3ILXA 3T5AA 5HQTA 2VZLA 4ZOLF 3SLRA 1O4VA 2CXSA 2JZCA 2D8MA 3H9JA 1CR0A 3O4RA 1XEXA 1NVKA 5KSZA 3EGEA 1U3DA 3E3XA 2KBNA 2Q4BA 4FR0A 2H2AA 4HAIA 1XMPA 3AR8A 2UUCQ 3BE4A 1BQ4A 3T13A 1KZYC 3S1AB 4YUAA 5ULLA 4MVJF 2XXAA 3R1IA 2Z3ZA 5FULA 3LSYA 1VGRA 1BU5A 1R3DA 2IUFA 1QHFA 4LRYA 1FVOA 2H2IA 3RGWS 4DGZA 4QIWB 4CKEA 4AQYL 3P0JA 3EWIA 1O89A 2HCFA 3BDVA 3X44A 3G0BA 2ZSIA 1QZUA 4B3RB 4BFXA 3I9V6 3V48A 3UMVA 4F2DA 1VMAA 2P78A 2OO3A 1IM8A 4ZT3A 3RYHA 4JLDA 1P8JA 4YMVA 4GNRA 3K1AB 1EFCA 3ZVKA 4MKGA 2QEXA 2BI7A 3Q8WA 2CHBD 1VE9A 2EJTA 3RQSA 2JZOA 2G4LA 2OXRA 4V1CA 4RVOA 5K6AC 1U8YA 2YQZA 5IJ9B 2ADMA 2WJ6A 3GN2A 3EHDA 5IVPA 3AQIA 4WASA 3AR9A 2OCBA 4L9SA 1STEA 1RZUA 4WBSA 4K6OA 4D4IA 1BCSA 4KJZA 1RLUA 4AUKA 1E60A 4D3XA 2J59A 3OT5A 2X0EA 3HDVA 4FP9A 1FTYA 2Z3WA 4ILKA 2IS4A 1LLQA 1FNBA 4MW1A 2BCEA 1V7PC 1Q44A 1ZUHA 1XAJA 3W5UA 3CH6A 4TWJA 1DNPA 5LQDA 2J07A 2DTDA 4F6CA 5BSMA 1EUCA 3NM5A 2RA4A 3CRW1 2ZDGA 5IW8A 2XUKA 4FMBB 1IONA 3CNBA 1LLUA 4TVKA 3EWNA 2YFKA 2PJZA 1Q7TA 4US1R 4PZAA 4B85A 1PS0A 4G2TA 1FNNA 3IDFA 1N5OX 4R3WA 2K05A 3GLGA 4KQWA 4P93A 2P9HA 5C4GB 5F7OA 2QRJA 2BDEA 3K0HA 4PHTA 3BXOA 3KAQA 2XOKD 3G89A 3OX1A 3Q7IA 5EJGA 3R24A 3SQXA 5FI1B 5HFAA 1N2ZA 3GMSA 3I6MA 3WKAA 1E6KA 2YCBA 3GJ3A 1LX6A 3LHSA 2CY0A 2R79A 3Q22A 4A3CG 3H84A 3ADOA 3NTOA 3KF6A 2GN1A 4G0OA 4K5VA 2HQSA 1N7HA 4OK6A 5EFZA 1D2GA 4N8FA 5G40A 4WRDA 2PZGA 1APBA 4Q82A 2WV6D 4I7ZC 3AF5A 4U4AA 5DI3A 2AJTA 3NBYC 4FINA 2YUTA 4K2LA 4R7GA 1YZLA 5ARBA 1TYZA 4JENA 5TGTA 1JG6A 2JF0A 1M5TA 4K46A 1Z06A 3WDNA 1OKKA 3L1JA 4ALNA 4DNXA 1PZGA 3GUVA 3NBHB 5HUJA 4QJBA 1SBBB 1PQUA 3E2PA 3EARA 3F5QA 4LOJA 1RCFA 5BOVA 2BRUC 3OLYA 1P7VA 3RPEA 3C2QA 1QRUA 3OEWA 4K6GA 3UMYA 4IUUA 1RXIA 5JCJD 3KD2A 1RQ2A 4E1BA 4OIFA 1W4BA 3TOXA 3AEQB 2G06A 3U9SA 1TJ3A 1XLTC 2RHJA 4NI5A 4L27A 2HPHA 3W5HA 3PS9A 3GUHA 4AJPA 5M29A 2XSCA 3L01A 2OZVA 2LXKA 1JXOA 1TW2A 5CCXA 5FBRB 1VQMA 4KTVE 3K7UC 4QUHA 2CW5A 4Z86A 4DJDC 5F5LA 2VJPA 3FKIG 4Z53A 4UCQA 1U8TA 2ZJ5A 4HQNA 4QYMA 4ND8A 4ZJPA 1E2EA 1PFUA 4D3SA 1NR4A 2W6OA 1JTVA 3PFBA 2HNKA 1YQEA 4DOMA 1N4DA 5IULC 1S89A 1FTNA 4A4IA 2C9DA 4PX3A 5BORA 4LMRA <