2IT1A

Structure of ph0203 protein from pyrococcus horikoshii
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
362
structure length
362
Chain Sequence
b'MVEIKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKDRNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVYYKPKYKFVGGFLGNPPMNFVEAKVEDGKLVITEKSKLPIPKQYVEIVKETGITEVIIGFRPHDAEIVKGEGEGIVGEVYSFEPLGREQIVTVSVNDSIVKVFAPEGEHFSFGEKVTIKVKEELLVLFDKKTEKALEFSKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 362aa long hypothetical maltose/maltodextrin transport ATP-b
publication title Structure of PH0203 protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
total genus 98
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2it1A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2it1A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2it1A01
1Z0KA 4F93B 4LRWA 4LF5L 5FR1A 4RD1A 3AB9A 2OO7A 2YHSA 1XF9A 4JLJA 5DGXA 1V8QA 3V00A 4EPYA 2NO0A 4DZZA 2ZJ5A 3KB2A 1SRUA 5KOYA 4DR3Q 4DT1A 4C7OB 4DAMA 4FMCF 4DUZQ 1CJUC 2DFKB 2OG2A 3E2IA 1ZD8A 2LCFA 1P75A 4DLYA 2F1HA 2ZJBA 4RCYA 2OM2A 4JLOA 2QAGB 4PO1A 5FH9A 1WE2A 1HH4A 3K80C 4G7HC 2WMOB 3W6PA 3BJIC 4KBGA 1OHHA 3SQWA 1IN6A 1K9MC 4DR5Q 5A35A 1N34L 5BN3A 2ZREA 1VCOA 1CKNB 1I4LD 2QGNA 1KI2A 4GZLA 4UNSA 4L8GA 3LA6A 1XCGB 3EAQA 3U50C 1PLJA 3I62A 2FN4A 3AGQA 2AUKA 1IYUA 3VX4A 4EQ6B 4DVGA 2OV2A 3CNLA 2CLDX 3ZVMA 1OB2A 4DR1Q 1WCV1 3CCMA 1IJEA 2CLCX 2IUSA 4UKDA 1IW7C 1X8JA 1ZNWA 3CH4B 4QKQA 2YJTD 3G6EA 4YWMA 2AK3A 4LFCL 3LDAA 2A9KA 1KAWA 2A5JA 3D7MA 5FOTA 1I6HH 1EFTA 1VYUA 3QVVA 4MRVA 5AJXA 2RCNA 3LQRA 3A7AB 1M8PA 4AWXA 4AIMA 2GF0A 3KJEA 4Q4JA 1WYDA 4HJ9A 2ASBA 1A2BA 1T0JB 2ZJAA 3W3AA 2QA4A 2IYYA 4EQ5A 1K5DA 2QF7A 2J41A 1NBME 4JL8A 2HUPA 5FUWA 3O8BA 2QP9X 4KLNA 3SOPA 3LLUA 5EP1A 2GJAA 4B6FA 4URXR 2ZUBA 2ZTSA 4TTRA 2QU8A 4TQUS 4FCTA 4BFWA 2VUMG 4DV4Q 4PZ6A 3MGCA 3FWYA 4CVNA 1D6JA 2BEKA 3KQKA 2PZEA 4A3KH 3K9GA 1GP2A 3M85A 3CC7A 1D8LA 2FZLA 2IL1A 4IKEA 4A4DA 2PQAB 3F0TA 2GCPA 3EQLC 2EJMA 5DI9A 1J2JA 4KMUC 4JLPA 1G1MA 2FH5B 1Q1QA 4GP6A 1IQPA 1OW3B 2OUKA 4D2IA 4GN5A 4DLSA 4R4QA 4BWYA 2AMCB 3M4QA 1PMRA 2F3RA 4B2PA 5G40A 2JLQA 3VAAA 4DV3L 2YZ2A 1RL2A 4H13C 2N1BA 1OLOA 4NB3A 4OO1I 1VG0B 1Z6AA 2EYQA 3CPHA 1EG7A 5HGQA 1F5NA 2QG6A 1A8VA 1UE1A 4O2RA 1Q1EA 4A3EG 1ZW6A 3WNDA 2P3SA 3RLOA 4I81A 3VNUA 3KKNA 2GJSA 1W2GA 3EZ9A 1G6OA 4LJ6A 4O0MA 3GFOA 2FEMA 2OQ0A 2C95A 1ZM2A 3CWZA 2R65A 2FSHA 2WWWA 1OF1A 1FX0B 4TMVA 5IP7G 3IKJA 5LMNL 1IBML 3IQXA 4LCBA 1RFLA 2FFHA 1IJFA 1UEJA 3EZ7A 1KMQA 2Q8IB 5BR8Q 1Q21A 2H18A 3EZFA 4WA7A 1CKEA 3LVRE 4TT3D 5CJPA 4Q7LA 3AVVA 3T1HQ 3RRZA 4LF9L 1DAHA 5H70A 3G0HA 4OO1G 3LX5A 1I6VC 3TVTA 1EQRA 3GD7A 5FLXc 2VQFL 2UZIR 2BKEA 2BMFA 1SULA 3P27A 2WKRA 4PFSA 1LYLA 2QM7A 3OEED 4KO8A 2D62A 2NVTH 4OGQC 1X3EA 1NNEA 4A3DG 5IE8A 1Q20A 1ZC4A 3RANA 1Z07A 5FFMA 3DM9B 4G7ZC 1W36D 5FJ8H 5M3FH 3U2QA 1JB7A 1SE8A 2WOOA 2YOHA 4JLDA 5F2EA 3L8ZA 3OIYA 5FOXA 1G18A 5TMPA 2A6ED 1XD8A 1ZNYA 5KDLA 4CZ2A 2ZITA 2O8DA 1VTKA 5E3HA 4JZKA 2ZM6Q 2IS4A 3R7WA 2YTYA 4Q19A 4JI4Q 1VQKA 2RHSB 2R92H 2WWHA 3WHLA 1UE7A 2V1CC 3HOWG 1T3SA 4Z1MA 2IW3A 4QJ4A 4XTCS 2UXDQ 2ORWA 2EDGA 1Z0AA 1TTTA 4JT4A 1R8QA 2GRJA 4A3JG 5JEAH 4PC2A 2V1UA 2XNDA 3HOVG 3ULLA 4A3GG 1E2FA 2FE4A 3K0CC 5E95A 2ZPTX 3CPEA 5FPHA 3AVUA 2VP4A 1TUEA 2RHDA 3EZ2A 2C9YA 3AF1A 5F9FA 1RRFA 1XEFA 2H1LA 2KHJA 1M2OB 2B7BA 2O8EB 421PA 1Z2CA 2JA6G 3CNNA 1E3PA 4JBMA 3BBPA 1YNJC 1CTQA 1X3SA 4FWIB 4LBWA 4LF8L 4XVRA 3VMFA 3M3YH 1NVVQ 2IF0A 3I32A 4DSNA 4B6EA 4TYYA 3W1BA 1NTGA 5IYDG 1PUIA 3L43A 4B44A 3LWNA 3B60A 3FDIA 1B0UA 4JI8L 4II7A 1G8PA 1AKEA 1IN4A 1TU4A 4DC9A 4QM6A 2XB4A 5D3QA 1M7BA 1LVGA 3KX2A 2YWFA 1KDTA 3P4XA 2PZFA 1YZ6A 1F2UA 3OTOL 5L3VA 1MKHA 5K36H 2ZRDA 3AKEA 1GUAA 1Z8FA 2QP3A 4FCWA 3MFYA 2BJVA 3NHAA 3IHWA 1XTDA 2WPDA 3KKQA 1ZRHA 3HOXH 2NVXH 4G01B 5E4FA 2ZVPX 5C2JB 1W47A 2PL3A 2BKUA 2R93G 2D74A 3CRMA 4CGZA 3C4JA 1YBYA 3KLWA 3HKZE 4C3ZA 1P60A 4AG6A 3S1QH 1NRJB 1W1WA 4LJ5A 5HE8A 3UATA 3ZLJA 4M9ZA 4A3BG 4MKHA 5LB2A 1Q86C 3N2IA 4M1OA 2WJVA 1VF5C 2K75A 4LHXA 4LSGA 4KLKA 1QG2A 1N32L 4P73A 1VQ6A 3S2DH 2R2AA 5KO2A 1U94A 2BWJA 4MNOA 1IN5A 1HQYE 1VDZA 3LRPA 2VTKA 3CH5A 1FJGL 2QBYA 1ZIOA 3B5JA 3H0KA 1E4VA 4IFBA 2CQOA 1S9HA 3EZ6A 1T8TA 2DNEA 1M7HA 4AYWA 4DLRA 5FTKA 4DCNA 1H9SB 4US1R 4D80A 4HAWA 5LMUQ 1S40A 1TL7C 3MJRA 2DUDA 3H0GG 3BGWA 4IQZA 1XFAA 1VECA 1HZCA 1FYCA 1WMSA 1XWIA 2CHGA 2UUBL 2GK6A 3IQWA 2A7QA 1DD2A 1E9RA 1ASZA 4TMTA 1XZPA 2YC2C 4NYMQ 3AUYA 4XOIA 5GAEC 5CM8B 2WB1G 4PAOA 4EFLA 3R7WB 4K0KQ 4H0LC 1RPZA 3GTQH 4V0LA 1FTNA 1XD2A 4LX0A 3QKTA 4B48A 3CF5A 3FKIH 1O87A 4NCJA 3I4MH 1LW7A 3FKSA 4A82A 3RRYA 1W2HA 4YHHL 2NO6A 3OEHA 3W8RA 1XEWY 3DPUA 3KUCA 3QEOA 3EIVA 4BBRG 4X62L 3HOYG 4JVLA 4TLCA 2I3BA 3MWKA 4A4IA 3C8UA 1EQQA 1HV8A 2OXCA 4D4LA 3TW4A 4PC7A 4DDTA 4QHYA 1JJ7A 4DR6L 5G3ZA 1X8LA 3I8SA 2NOAA 5EZ5A 2EW1A 1P6XA 2XXAA 2DWQA 1IZ6A 4H44C 5KNCA 3RWMB 2JIZA 4URZR 4HJ8A 5EJEA 4G5GA 3GJ4A 5SZKB 4DV7L 1NMFA 4KAXA 1K3RA 2QUZA 1HA3A 4DV6Q 2ZI4A 2R6CA 1G3QA 2ZRHA 5IT5A 2VL7A 5CITA 5KTYA 1WI5A 3ONWA 3FOZA 3ZD7A 2WKPA 4B2IA 2RF4A 2ZAMA 5JS7A 2YC4C 5IWAL 4L9WA 1A62A 1XPUA 2GESA 3BH6A 3WNCA 2NO9A 3NH9A 1PH4A 3A1TA 3ERSX 5JI2E 3OZXA 4F92B 1VQPA 1PV4A 3ADCA 1G3IA 2R44A 3X1XA 1VG8A 1U0JA 1F2UB 3SDZA 1F3OA 1JPJA 1NSFA 3CO5A 5BN4A 2ANBA 2UXBQ 1S96A 3OIUA 3LFUA 1Z06A 2WWFA 3MD0A 1VQJA 1NIJA 2KBNA 1W4CA 3IIJA 4NKRA 4UNPA 2IWHA 1JR6A 4JSTA 4M2LA 1CKMA 4GBMA 1NG9A 1GFIA 3EARA 3R9WA 1J70A 4KODA 1O78A 3A8TA 3L0PA 4PPQA 4LHZA 4L16A 2D2FA 4BFXA 4DUYL 1GNRA 1ZBDA 3KZ1E 4X65L 1ZUIA 3NC0C 3H4MA 1KI1A 2ODBA 2QTVB 2FMXA 4IFEA 4IOJA 5KSOA 1AK2A 1SVIA 1W3SA 3K9NA 4LV5B 1N6HA 2FPLA 4V0MA 1JI0A 1XTSA 4A6PA 4DSUA 3T1YQ 4PSAA 1EUJA 4B76A 2X2EA 1NI3A 2YWHA 4MKFA 4ACAA 3RYTC 4C0LA 1RJ9A 3PUWA 1G19A 2BA0A 3A8JE 1TADA 4HEJA 4PHHA 2ZRNA 1JB1A 3DM3A 1JXMA 1TWGH 4BEJA 3CXCA 2R7ZH 4ZIRA 3PIOA 5C4GB 3JZAA 2GN5A 4LNQA 1G8GA 2B21A 3GEHA 1D5CA 1RE0A 3AKDA 2B8TA 5JJIA 2CVFA 2BJWA 5KNDA 2PMZE 1NMZA 3IHLA 2FV8A 5JS8A 5CB6A 1EFUA 1YJ5A 4FN5A 3AQ4A 4JLBA 1CXZA 1CR1A 3IPYA 1PH9A 4LWCA 1H9RA 4B3SL 4HDCA 2G9NA 1XMQL 2J3EA 3IIMA 1UE6A 3AP2A 2K14A 4B33A 3VHLB 4IXNA 2Z4RA 3PR1A 1G6PA 1XU4A 1ONBA 4BLSA 2C98A 2PX3A 4PSKA 1TEVA 3DM5A 3HYRA 1COWD 3P20A 5D3MA 1XNQL 1Z22A 2BHRA 3VQTA 1NJIC 3U4ZA 4JYAQ 1TMKA 1UBCA 2MQHA 4TTPA 2BMEA 3NE5B 4NHOA 4ZCIA 3PJRA 2C2HA 4AKGA 3GFPA 1E9AA 2N49A 1S1MA 3NBXX 3OF5A 2RGEA 1RRCA 3B8HA 2K4KA 3PCOB 2J9RA 2V55B 4LPSA 4B3XA 4JT2A 2P5TB 3R9IA 1H65A 4M1MA 3SZRA 4NYIQ 3LH5A 2XXAB 3Q7PA 1G51A 1PYBA 4A3FG 3GTOH 3PO3H 2Q2IA 2OT3B 3LLMA 1MV5A 3KB1A 4B43A 2RGNC 4DNRB 2IF2A 3GTPH 2QMOA 5DN6D 5JWRA 5CIWA 4JLAA 5SZJA 2F3IA 4BXXH 4PPNA 5FL3A 1CJTC 3TR0A 3PVSA 2CLSA 2DFLA 2QE7A 3RNLA 221PA 2BBSA 3PEVA 5EUQB 2GVAA 1N0VC 1HPCA 1QHGA 1GVPA 1T6NA 3KJHA 2VF8A 1VHLA 4OKSA 2ATWA 3FHCB 1AJEA 4MGKR 4Q66C 3AVWA 2XB2A 3SHWA 3QF7A 2ZI5A 3CUEF 1VQAA 1UPTA 1OTCA 3HDTA 3KFVA 1GILA 3GJXC 1N0WA 1UBEA 5B57C 5JRJA 4UY8C 3PFIA 4OHYA 4OWTB 1BIFA 1ZIPA 3CF0A 5L3QA 3U3KA 2ZRAA 3HU1A 2IS1A 4HJ5A 4OX9Q 2IYWA 4IDHA 3CRLC 4A2WA 2NMVA 4A9AA 1GNQA 3CWQA 3NWJA 1H8EA 5J4LA 4FWTA 3KUDA 4C0JA 4QFMA 1YZLA 2B8GA 2DY1A 4RCZA 4P4UA 2WHXA 3BS4A 1RKBA 4LZZA 3FPPA 2UZ3A 4KYUA 2RB4A 1PUJA 2XTIA 1F48A 2PMKA 1T0HB 1NJGA 1IN7A 4HAXA 5GAHC 1LV7A 2H7VA 2HLDA 1YZGA 3TE6A 2C9CA 2VW9A 2AKWB 1EX6A 4Q47A 4ZPXA 1Q57A 3NHBA 4R4CA 4H1UA 3EW9A 1G64A 1Q81C 4ALPA 1E32A 1Y8NB 3NBZC 4B3RL 4NONA 5BN5A 4X66L 1RJ9B 3CRRA 4QL5A 4NYJR 1E7ZA 1YNXA 5HE9A 1LUZA 5C1BA 2L0XA 1IXRC 1SGWA 4DUGD 2VP6A 3Q7QA 1FQJA 1LS6A 2XJ9A 3FHWA 1SROA 1QVFA 5GJCA 2KSQA 2GVDC 5AJ3L 3W6OA 4AYXA 1NLZA 4R7ZA 4Q1EA 2C5LA 2F43A 5FTNA 2WJGA 4I1UA 3UXMA 2RGNA 1QF9A 3VR2A 3AEVA 1HNWL 3Q3JB 4LJAA 3QG5A 4B3ML 3AYHB 3EG5A 3RS3A 4HJ7A 5BQ5A 1G4UR 2Z0MA 1T91A 1GL7A 4UP8A 1YEZA 2ZROA 1R6BX 4L5TA 2VS1A 3Q5DA 1J5EQ 3VR5A 3I2ZA 4NCHA 4BECA 3A37A 4DLXA 5ELNA 3EN2A 2EU8A 4HJAA 2ZVQX 5D3MB 2VSOA 1I4TD 3SFZA 1XMIA 1ZU5A 1Q90A 1XJQA 2HYDA 4ZO4A 2QSYA 3LBIA 4HAZA 4WVFA 4HLDA 1KKLA 3FMPB 4UNRA 1R5NA 5IP9H 3QPVA 4GOXA 1CR2A 5JHGB 1E94E 5M3MG 2Q9CA 1CI3M 5K8LA 1G4AE 1HT1E 2WMNB 5B64A 4CEIB 3S17H 1ZMXA 2RH5A 1EOVA 1WJJA 3H3VH 2P5SA 1BKDR 5KNBA 1MO5A 1OKKD 3GO5A 4QL3A 1E1RA 4HIOA 3BB4A 3MWJA 3EPKA 2G88A 5HY6A 1OFIA 3D8BA 1W44A 4FDBA 4ZDWA 3T1VA 4Q21A 3CMAA 4AQYL 2WAQG 4RJLA 3VX3A 1G3MA 1YHAA 4HLQB 4M1KA 4RD2A 4JLKA 2J87A 2WOJA 1XEXA 2P6UA 1GUGA 1Y14B 1DAGA 5DISB 1Z29A 1PZNA 2E5LQ 1KYIA 2J46A 3KJIA 3HU2A 3M0EA 1KK3A 3MAAC 4IO9A 1E2IA 3CMEA 3ADKA 4X8LA 2D0OA 3FMCA 2ZJOA 4TSFD 2QNRA 1AM4D 4EJSA 3CW2C 4IOAA 1MH1A 4AKIA 3KQUA 1XNJA 1QVAA 2VZAA 2E2IH 4GNXA 2EQSA 2OFXA 2VHCA 1I2MA 3TAHA 3M7NA 1E79D 3KTAB 3KOJA 2PI2A 1MRNA 2IS2A 1NBMD 4C30A 4GLXA 1KGDA 5KU1A 1ONLA 4DUGA 3CR7A 3Q85A 4Y52H 4D6PA 1XTQA 3KLRA 1U81A 3QJYA 2A69C 2HCBA 3KDFA 2F9MA 4FW9A 4QBIA 4LFBQ 1P16A 5FI0B 5DIFA 2O8CA 5LPNA 3W6NA 1MIUA 4Q02A 2OCYC 5CJ2A 1Z6XA 4NCKA 4C0KA 4DJTA 4NP6A 5IRCD 1E2KA 4MRSA 4A15A 3I8XA 2PCLA 2W6JA 1A0IA 1LTLA 1VQBA 1NN0A 3NELA 4A3LG 5IYBG 2W6ID 4DR7Q 3RRNA 3GTMH 1IBRA 1XX6A 4ESVA 4GDFA 1VPLA 4JKIA 2WSMA 4G5OA 1Z0FA 4NDZA 1E2EA 3ZQJA 4TL7A 2F43B 1MKYA 2W2XA 4HLCA 1W5SA 2QAGA 4PZ8A 3IILA 4DK0A 4FINA 3UMRA 1VYVA 1XMJA 4Q1DA 4GOJA 3LWUA 3D0FA 3RN2A 4KFSA 4R9UC 3A1VA 2PMDA 1AGRA 3K7UC 1CKNA 2HCJB 4HSEA 3SBEA 1NN3A 3H1TA 3TSOA 2AKYA 4GKJQ 2AR7A 3STBD 2SHKA 4EQ6A 1A6XA 4QG7A 2VP0A 2Z4SA 4DR4Q 4AKHA 2VO1A 2LXKA 1A5TA 1U98A 3REFA 1DAFA 3LY5A 1ZD1A 1YNNC 3IFTA 1JQLB 1XJ0A 2HXSA 1UWVA 2ASEA 3RLFA 2WSSA 3AEZA 4QNMA 4AI6A 1LB1B 1S9DA 2A2ZA 3ZIAA 4JV5L 3PF5A 4ZI2A 2CL7X 2BCJQ 2NN6I 3A4MA 2YVUA 1OHHD 4PAQA 2FFQA 2G6BA 2QPTA 3DEFA 3HPRA 2XAUA 5DO9A 4A3EH 4OQXA 2JLSA 1NE3A 1AZTA 2NZ8A 3QOFA 4QXAA 5DHFA 5JRZA 2W0MA 4MKIA 3B9QA 3Q9LA 5EZ6B 3UK6A 3DVLA 4ASUA 4IDOA 2F9LA 1GSIA 1R5OA 2GXSA 2WJYA 1HZ9A 5GVRA 4JL6A 5IT9c 3A4NA 1VCMA 5IP7H 1IHUA 5FOWA 3U61B 1IBLL 2AWNA 4XWAA 3W8NA 4AD8A 1I4DD 3MUFA 4BLRA 3VHXA 2VSXA 1US8A 4Q1AA 4Z8XA 2IBMA 5ANRB 3WYAA 1BYIA 2RGDA 4YMTA 2N3SA 3ECCA 4FMDF 2Q3FA 2QGZA 2NN6G 4OO1H 1NMGA 4B3GA 3L2PA 3QUSA 5KPDA 3OFNA 3A8KE 1TAGA 1WRBA 1I94Q 3A1WA 4XH9B 4M1YA 4HAVA 4A3DH 1S3SA 1TXYA 2GEDA 2A30A 2N78A 2J7PA 3I4LA 4HIKA 2OAQ1 1E1OA 4PHTA 1P9WA 3LBHA 1PH8A 2Q0HA 4DLZA 1NL3A 1KDOA 1EGAA 2OBNA 4RZXA 4DUZL 4NL4H 3I1FA 5FL7A 1NKSA 1TF5A 5DNYB 1OH7A 3QE0A 2OFOA 1XTJA 2CJWB 2V4ZA 3FYHA 3KDFB 2XEXA 5C0XI 1T5LA 1I2DA 3DO6A 1XPRA 2HF9A 2NQ2C 3C16C 4PX9A 2G3YA 4WXRA 5DSZA 2O8CB 1X86B 2VQEQ 1S4QA 1LACA 2MMCA 4Q1CA 1JJVA 4IPGA 3S1MH 3RZOH 2C9OA 4YCWA 4V0NA 1DG1G 3JVUA 3HOVH 4A3GH 4JCVE 1Q22A 1Z0DA 2AFHE 3AF3A 5KDOA 1S1CA 4DR1L 1E1QA 3S1AA 3SJBA 2Q21A 4I99A 1UADA 1XTKA 1T5EA 2KBFA 4M9SA 1PYSB 2AN9A 3ICEA 4K8OA 3F1ZA 3GTJH 1DPFA 1RRPA 1G17A 1M34E 3JAMi 1AA9A 3MWLA 1JEDA 1SXJC 4JLNA 2BV3A 1FNNA 4IPDA 3GJ6A 3P32A 4KSCA 1DBSA 3TVDA 5KSYA 2AL7A 1VQCA 3QBTA 1VQ7A 3VKHA 4DV0Q 1KO5A 1NLFA 2GJKA 3THYA 3UPUA 5C0XG 5FPTA 3KF8B 1FGUA 4IFDI 4DV1Q 3PO2G 4RD3A 5IYDH 4OQFA 4U5XA 3QPWA 5FPKA 4A2QA 4AK9A 4LJ9A 2QZ4A 2VP2A 4RZ3A 2A5GA 4BE7B 3CRVA 3FFBA 4HDOB 3NH6A 5LBIA 2JQOA 3CR8A 5FOUA 1MABB 3HKSA 3RLNA 4YLGA 2KCTA 4DCVA 2X8AA 2QQ0A 3A36A 4KKSA 4NYMR 2IYQA 4XVUA 4GZMA 2XTNA 2O8FA 2ECKA 3WP0A 2B29A 2AHOA 4LUZA 4R1JA 1G8HA 2AUJD 2WB1E 1OXTA 2ZANA 4DV4L 3C14C 3RDPA 1PHJA 5M04A 1YRBA 4BRUA 2VBCA 4I4LA 4WJ3M 1C9KA 1K6MA 1N6RA 4IVPA 3U7FB 1PFSA 1AH9A 1MRSA 3K09C 3PUVA 3C5HA 3QVUA 2XZPA 3EASA 4I1SA 4HB4A 4IFDG 3WNBA 721PA 3RWOA 2R93H 4D4MA 1RIFA 4TYNA 4EFNA 4WBSA 4TQ9A 5FUVA 2CNWA 1A1VA 2ZE7A 3FKQA 2R8RA 3DHWC 4LF7Q 4A3BH 1J6QA 3B1VA 2CDNA 3GLGA 2O8EA 1V1QA 3P26A 1EFHA 1IAQA 1HZAA 1P8LA 1W0JA 2IEZA 2CMKA 5M5WH 3R20A 3TUJC 4Z1MD 4XWKA 5FBQB 3LV8A 1US8B 1KSJA 2PNRC 1GTVA 2NG1A 1YZKA 1U8ZA 1DO2A 1D2MA 1RRGA 2QRZA 2ZETA 2XNDD 3K0AB 2ZU6A 3QKSB 3BZKA 4PO8A 3SI7A 2CHQA 1KNQA 4YONB 4XTRA 1QHHA 4MRPA 5SZHB 1G291 2IK8A 2ZRMA 3ZVNA 2BE5D 3LQQA 1PH7A 3PV0A 4G5QA 2E87A 3NEJA 1UBFA 1UKVY 4WZ6A 2JLZA 3GLFE 4QM7A 4Z51A 2RKOA 3H0GH 1VIAA 1G6HA 1YHBA 1A82A 2LMCB 1SXJA 2BIFA 5BR8L 2NPIA 2KWIA 2Z83A 3QXXA 1PJRA 5AUPB 2BC9A 3WBKA 3T1HL 3T51B 3MXNB 1MJCA 2FXQA 5CK5A 4ABYA 1VQOA 4Q9JA 3GLFB 3RC8A 4HLUC 3RVBA 4JI7Q 5GADl 5FOVA 4D0LB 4TTQA 1G16A 3B1YA 2ZRFA 2FF7A 3NC1C 1NVXQ 2P2LA 1NVWQ 2VQSA 5EXXA 2J0UA 4DB2A 3QXSA 4IW3B 5CLLA 4DIEA 4CF7A 4NCNA 2WM9B 4KJZA 1N5KA 4TMXA 3VR3A 4LYHA 3U4QA 1TPZA 5JSZB 1FTSA 3C5CA 2UUAQ 2FFBA 2QAJA 3HOYH 2ZSBA 4XIGS 2ZM6L 1N6IA 1VG1A 4JOIC 2JDIA 2WPDD 2BMJA 1KHTA 4JI4L 1Y69U 1G3RA 3S1AB 4A3MG 1Q3HA 1HY3A 4KFRA 4UNNA 5CYPA 3UMSA 2JJ2A 2I5HA 2ZUDA 5IYCH 3TR5A 5JHHB 2OWOA 2UXDL 3KQNA 1RVDA 5C44G 1YQTA 3GJ7A 1VYTA 3TW8B 2GILA 2AXNA 1H9SA 4IVQA 1VQGA 3G48A 1OJLA 1U5KA 4B34A 3THYB 1WP9A 4BY7G 1XTIA 1GWNA 2CE7A 4PSVA 2QEQA 2DYKA 4DR2Q 3B85A 1R9TH 2GXQA 4OHZA 3FE2A 5G3YA 4IDPA 1DCZA 3PIPA 3VDYA 3S1RH 3KKOA 4A0HA 1YVDA 2I0QA 4UNQA 1K73C 1E2DA 2O52A 2QENA 1N6PA 1U99A 1QJOA 4P71A 2C8VA 2UXCQ 4JI0Q 2FGJA 2QT1A 1FMJA 5EXPA 4ACBA 2CK3A 1P2VA 1FQKA 2H17A 3UANA 2AHOB 2IYZA 3P4YA 4U00A 4DPGA 5AJVB 4BLPA 1NY6A 5H8WA 4QBHA 2E2JH 4JYBA 2H57A 4OYHA 4Q9IA 1CIPA 1OIVA 3RSOA 3QXHA 3GLGE 2WVJA 2EFCB 5TARA 4MZ9A 4CT4B 2R9VA 4OJKA 2A3RA 1E9FA 4B3TQ 3HOZG 1E2NA 2E9SA 3TUIC 4BZPA 1U90A 3NBYC 2A6HC 4HLUA 3K53A 3TMKA 3GLGB 1TQ4A 2OESA 3FB4A 3U60B 4J0QA 1KI8A 1VG9B 2RGBA 3B6YA 4IJMA 3QNUA 4QGGA 3KFUA 3D31A 2K52A 2DR3A 3FKSD 3GCGA 3OEHD 3SFVA 3ADDA 4JL5A 1BMFA 1NSTA 1SXJE 4TL9A 2REBA 1KTVA 5LB4A 5KPJA 4ILEA 3GTKH 4WAUA 2ZSAA 4YY3Q 1QHHB 5EXSA 5HCNA 2WAYA 5BXQC 1ZU4A 3U58A 1K83H 2RMKA 2QEXA 2QQEA 4LUOA 4HAYA 3NEMA 1SXJB 2JIZD 5EP4A 1K8GA 5KSPA 6Q21A 5SZIA 1G7SA 4GOPC 5E7NA 1PH1A 3B7GA 4CEJA 2VL6A 2CXXA 3W90A 4LC0A 3ZH9B 3PEUA 1ZYRC 2OCAA 1HJPA 3AKCA 2G1KA 4G5RA 4K81B 3TKLA 1W7AA 2KENA 1KK1A 3T53B 4RD6A 2KE5A 5JLJA 5LMUL 1SMYC 2PLFA 2J0UB 2VP9A 4D4KA 1CSQA 2IYUA 4DHEA 4M1TA 4QC2A 3K0SA 5C4JH 3AP1A 2V1XA 3ZZUA 3SHFA 3U4QB 3UE0A 2NTYC 4WW0A 5GADC 2ZR0A 4DK6C 4B47A 1LS1A 4WJ4A 2O5IC 1XP8A 1UBGA 4K0KL 3G82C 3K0FB 5JZVA 5DE3A 3S2HH 4QOSA 1KSGA 2DN8A 4IXMA 3K0CA 2IX1A 2ZE8A 1RYFA 3DOEA 2DNCA 1VQLA 3CM0A 5HZHA 4HB3A 4MKGA 1KI9A 1O3YA 4G0NA 3T5DA 2ZQ5A 2JEAI 2AFIE 1J90A 4EPWA 1KRSA 2O0KA 4LV6A 2QTHA 5GQOA 1QHYA 4JK1C 2IYRA 4E22A 4EPRA 1YI2A 4OHXA 4N1AA 3GLIE 1GITA 2JA1A 1PVOA 4HYYA 3GDEA 4FMBB 1D9ZA 2ZU0C 4MDFA 3GQBA 4YDSA 3PUXA 4JI6Q 521PA 2FJUA 2YKGA 4MRRA 4LJZC 1CKOA 1FNMA 1RW4A 2BEJA 5C4XG 4JBWA 1UF9A 2MSEB 2VH5R 4LJ4A 4A1FA 1SMXA 3CP0A 4P75A 4DV6L 4CIDA 3GLIB 3AVOA 4HUQA 5AR1A 4KHPQ 1E2MA 3HR7A 5G41A 3OW2A 2P0EA 2K5UA 1FL0A 1JAHA 1EWQA 2D2CC 4OXPA 1ZM4A 3SYLA 4D25A 1ZUNB 4JVNA 2C99A 2NZHA 2LKCA 4GSYA 1ZYUA 1E9DA 4GOPA 1D8TA 1SVMA 1H95A 3BJUA 3J81i 3CCRA 4D0NA 3RN5A 1C0AA 1CJVC 1P9RA 2UXBL 1ZVQA 1Q8KA 4HZUA 2E76C 4C0HA 1E9SA 2QT0A 3F3YA 4N3NA 2YU9H 3I92A 2B8WA 2EWWA 2OBMA 3K70C 2F3TA 1CRQA 4Q18A 3CB4A 2ZRIA 1E22A 4EPVA 4E03A 4B2LA 1HR0W 3DDCA 4C2MH 2CL6X 2NGRA 4LPKA 4Q03A 3U3MA 1M6NA 4F4JA 1L1OC 3BD9A 3L0OA 3ULPA 2CHVA 2QPAA 2H8KA 4LFAQ 2OLJA 5J40A 2WAQE 1G8YA 1QVGA 1CS4C 1XMSA 1YU9A 2XTZA 4UJ3A 2P6RA 1QHSA 3W34A 3T1YL 3W5IA 4HI0E 2YWEA 4BLTA 2OILA 3KYHC 3BFKA 1XPOA 2V3CC 2MMGA 4CEJB 4BY1G 2X1VA 4Q1FA 1KDPA 2V7QA 3IBGA 3B78A 2JK8A 3HPQA 4IDQA 5AK0A 4JLMA 1ZKOA 4G1UC 821PA 2QE7D 1WB9A 1Q3TA 1WF3A 2XJ4A 2VSFA 2ZJYA 4EPTA 5FJ8G 5M3FG 3MXUA 1QHNA 2F6RA 2OCBA 2XOKA 5HCIA 3ZVLA 2AWOA 1TU3A 1V5WA 2QMUA 2F55A 2ZEJA 5A0FA 1DAEA 2ZI3A 2IYXA 2EFGA 4TKOB 3B82A 2BH2A 1Z0IA 1UFQA 1GUNA 4W5JA 2PJRA 4BRWA 3S1NH 1JE5A 2AD1A 4IHQA 2O0HA 4KBFA 2HF8A 2J0QA 3GTLH 2BMDA 5CM9C 3T1TA 5K8IA 5B2ZA 3KXLA 4BUJA 1L2FA 5C0XJ 4KXFB 4MGYR 3TNFA 5JI3E 3Q8XB 2B7CA 4DRZA 4F7WA 1H8ED 1CULC 2ES2A 1JALA 3AF0A 3FHOA 5IF9A 4C2UA 4DNTB 4IDNA 1L2TA 3BC1A 1FFHA 2OBLA 2JLVA 1T8UA 3QQ5A 3CRQA 4DV5Q 3NDPA 1HR0Q 4JYAL 3F2CA 1BDOA 4A75A 1UKZA 3VU9B 5HZKA 2LXJA 1OPXA 5A5GA 2HLDD 2B92A 2N8NA 1ZM7A 3FPAA 4RD0A 1R2QA 2EIFA 4OI1A 5AJYA 1TQDA 1EIFA 4A8JC 2EJFC 4ZDIA 4QRHA 3O8DA 2A1AA 4O0AA 1R0WA 3B13B 4TZ6A 4PC3A 5TDHA 2O8FB 1DXMA 3I4NG 2Z6KC 4A3CH 1JR3A 2I1VB 3AUXA 4OWWB 4IFDJ 1NY5A 1VQ9A 4B3FX 1BYUA 4HUQB 3THWA 4KI0A 5M5XH 3ASZA 2ZSDA 3TZUA 5FPYA 2WKQA 2HQLA 1QRAA 1T4GA 2X77A 3TREA 3PG5A 4LOAA 3O47A 1U2RA 3IBYA 4GMDA 3CBQA 4RZ2A 1NBWA 1YITA 1B23P 1WCMH 4GOPB 2F1MA 1E2JA 3T12A 1MR3F 3CNOA 3V4FA 1L4UA 3CAMA 5K36G 4QHSA 4A92A 1ESNA 4DLWA 1P2TA 1NKTA 1LABA 4BFYA 3CD6A 2B63G 5FBRB 1W49A 1MT0A 4QY7A 1E0JA 3J81k 3HGBA 3CRKC 4O2LA 2GEUA 2EFHB 2A19A 2QORA 4JBKA 4HZUB 4R98A 4RSGA 4B35A 3WMFA 3BOSA 2IC5A 1MO3A 4ZCMA 2ATXA 4OX9L 2WP8J 2VP5A 5JEDA 2A68D 3VA7A 1MO6A 1L7VC 2MSDB 5HTKA 1VQDA 3K8AA 2XZLA 1GNPA 3WDNA 2QMHA 4NXMQ 2BBOA 3NBHB 1CJKC 2IXEA 4KCGA 2IHYA 1CP2A 4PZZA 5AWFC 1OXXK 4M22A 4GPTA 4F4IA 4IPHA 1IYJB 2YYZA 1AE2A 3M9BA 1TWAH 1KIXA 2MNAA 4L5SA 2ZRCA 5CDFA 4I7ZC 1VHTA 5IYBH 4PHFA 1IN8A 1XMOQ 1GRQA 1CLUA 4Q9LA 1IBKQ 1OFUX 2N42A 3WRXC 3WY9A 3DOFA 1JBKA 3CF2A 3TLXA 4C3JH 4NPHA 4EDHA 5JJLA 3UWOA 5HR5A 1N6OA 2MFIA 1M7GA 1E1RD 3DMNA 4PQYA 1ANKA 2I5MX 1KJWA 1SVWA 3K70D 3KJPA 5J4HA 3SN6A 4GKKQ 3IUYA 2Q6TA 1N6KA 1SZPA 4BFUA 4BBSH 1N25A 2NZOA 2JCSA 3KTAA 3QKRB 1Q46A 1SVKA 1V9PA 1XZQA 2JA7G 2F1RA 4TN1A 4DSTA 1SLJA 1X6OA 1Z9FA 2OHFA 1OH8A 1FP6A 2PEZA 2ZM5A 2Z6KA 1G5RA 1DADA 2TMKA 3PEWA 4HATA 1KO4A 1E69A 3EC2A 4OK3A 1IOZA 1XMVA 2G0NA 1C7YA 2LKDA 2B6HA 2OFWA 4AURA 1Q1BA 3AVXA 2IYSA 3FKIG 2HXYA 2RHMA 1X3FA 2HHHQ 1YZUA 4LYJA 1CBUA 1J5EL 3FMOB 4C0QC 3A7LA 2ODWA 1DGSA 1XCPA 4LJYA 4PTLA 4XD7A 5FPSA 4HR7B 1E9EA 4M1WA 1X65A 1EXMA 4YMUA 3UG7A 2ANCA 4KU4A 4DV2L 4P72A 5H1YA 3SC3A 1KD1C 2CVHA 3ZQ6A 4CW7A 3SS8A 1HNXQ 1JR3E 4FMCB 5FTMA 3P1JA 2QP4A 4GS3A 4OI2A 3AH8A 3TJZA 1OXVA 4PC6A 4QJ3A 3K70B 1AE3A 1KO1A 2I1QA 2WAXA 4YC7A 3B1WA 4OHVA 1JPNA 1XEWX 5F9HA 1GHKA 4KSBA 5HKKA 1Y8OB 1TUIA 2D5DA 2Q2TA 1L1OB 1OT3A 4B32A 2W6JD 3FGNA 5KYKA 2RGXA 4LJ7A 4A3IH 3WYFA 1KL9A 4Q7KA 4TLBA 5KUTA 3MG9A 4LF4Q 5LD2C 3THWB 1GKHA 3ZJYC 2V54A 3BERA 3GJ0A 2GKSA 3WHKA 5JEEA 1JJCB 1MOZA 1QHIA 1FVIA 1YR7A 3DMDA 3ETLA 4PAMA 1HZBA 4R2IA 4DV2Q 3VKWA 3NG1A 2CL0X 5HPYB 2PJZA 1Y1VG 4YCUA 4U02A 2NO1A 2E5LL 2E2HH 3KJOA 1HEIA 4KVAA 3SEAA 3GPLA 2WFWA 2ORVA 4WZAE 4R2HA 1YJ9A 2WV9A 4ZKDA 4ARZA 1LFDB 3KFXA 3K8YA 1Q0UA 4LUVA 2GDJA 1BH2A 2ZI7A 3NDBB 4HUTA 1E96A 1HNZQ 1H8HA 4FD2A 1TWFH 3JZMA 2EXDA 2ZJPA 1G3UA 4QHTA 4D0GA 2Q3HA 5CDFE 3L7ZC 4DCSA 5JMTA 3AF2A 1G5PA 2ZT9C 2K5VA 4QGHA 4OQLA 2WSSD 2F1IA 3TIFA 4BZXA 2BDTA 4R71A 1BKBA 4DKAC 2ZJQA 1CR4A 4Q4HB 4F91B 3ZIAD 3B6EA 4X8MA 2ZXUA 2D7CA 4Q48A 2VHQA 4JI5Q 1W0KA 3TS0A 2E1RA 3U3OA 3GEIA 4BEBA 4MDEA 4HB2A 4OQNA 4CEIA 4OI4A 4LFBL 2A78A 1UEBA 4UPAA 1TWCH 2P6NA 3S24A 1YR8A 2R6DA 3DKVA 2BM0A 2ZTDA 1B9NA 1IXRA 2J7KA 3DLLA 2ZR9A 3UKDA 3ZYCA 3VR1A 1EYGA 1AS2A 2R7ZG 5C0XH 4J15A 2YV5A 2HV8A 4Q00A 3O8RA 1Y3AA 3KL4A 4LBVA 1WBBA 3PO2H 2PX0A 4DAYB 1G20E 5AUQA 1TQ2A 5DYIA 4PZ7A 4DR7L 4GLVB 3JAMc 1FZQA 4JI3Q 1CSPA 4F38A 2GBLC 1O7LA 3IEVA 1LNZA 3T35A 3VNVA 2KB0A 1P72A 3RRMA 1VQNA 1II9A 2JEBI 2WBLC 3QPUA 4M21A 4URWR 1BBUA 1HQCA 3D6TB 3OE7A 1HH2P 5FOSA 2JAQA 1FP7A 2ZSEA 3OFND 1Z08A 4XSHA 2CJWA 1TU2B 2FX3A 1KK2A 2BM1A 2OE2A 4DNIA 3EWAA 3U3JA 5BW8A 4POFA 1PA6A 1Q7YC 1DAIA 2J7PD 2WWGA 3FTQA 4OQMA 4KKUA 2BBTA 5KSZA 3E9IA 1DO0A 3AB3A 4GKJL 3KQHA 3SR0A 2GAAA 4GL2A 3L8YA 5TB5A 1CFMA 4DR4L 4HB0A 4NTZA 3UWKA 5FL7D 1E9CA 2G83A 3KKPA 3FVQA 1HUQA 3WMGA 4TLDA 2XTMA 2OEPA 1G7RA 1LY1A 8OHMA 2EFEB 3A5ZB 3A5UA 3PO3G 4JJKA 5L3RA 1KO7A 4B3CA 3CIOA 1ZUHA 4JKYA 1M90C 3QBVA 4ZDJA 2ATVA 2VUMH 2F4VQ 3LW7A 1M74A 1X1SA 2RGGA 3THOA 3U4VA 2W00A 4Y0VA 4YCVA 2GETA 4Q1BA 1Z7TA 1RC8A 5F98A 1HQMC 4RFVA 5J3BA 2GVBA 1E1QD 3LBNA 2FFAA 2WWYA 3ZVRA 1MABA 2UVQA 2W2VA 2BH8A 4LGMA 2JLYA 2Z5FA 3PUZA 1PH6A 1XNRQ 4DKXA 4JMPA 3ND9A 3Q72A 4LHWA 1KZ7B 2ZRPA 3PENA 3AFPA 2UKDA 3SYKA 4EIWA 2JA5G 1G21E 3ER0A 1DARA 2R6FA 4OJQA 2ZYVX 1SKQA 4PANA 3CW2A 3E70C 4YXWA 3TQFA 4DBLC 1QDEA 2AXPA 4B3DA 3EX7C 1SFOH 2PNHA 4IOLA 3D4RA 1I94L 2E74C 3KF6A 5GJWC 1FUUA 3L82B 4ARZB 2HIVA 2GBLA 3WRYC 2IYVA 3IDQA 3TBKA 4JI1Q 2ERYA 1TKWB 2Y0SG 2ZJRA 1U0HC 3QEJA 4QGUA 2GCOA 3C41J 2ZJZA 1N2CE 4NXNQ 4LDJA 1N36L 3CC2A 3F8TA 1R0YA 5TV2A 4C0BA 3RC3A 4DDVA 3MMPA 2GVZC 4G7OC 4FI3C 4ERNA 3A58B 2ZS7A 4JVSB 2OSBA 1OH6A 2F7SA 5KDDA 4A3MH 3FP9A 4GMXA 3K0AA 3STBC 3QKSA 1KI7A 1NVVR 2ZYUX 4IOMA 4TLEA 5BYJA 2HYIC 1N5JA 5FBWB 1P7CA 2VQEL 3HOUG 1UE5A 3L2OB 4TMZA 4AC9A 1IYVA 5C44H 2UUCQ 2CNWD 4DLTA 4OI0A 4W9MC 3WMEA 3U44B 4BY7H 2E8GA 4C3HH 4L5RC 4IVRA 3EPHA 1R0ZA 1IY1A 3I5XA 1W0JD 1ZINA 4DEYA 4Y7NH 3ZS9A 1N36Q 1XBTA 1UKEA 1EFCA 3N2EA 4IPCA 3A1UA 621PA 4Z8YA 1KJYA 3GLFA 4POAA 2A5YB 1GOTA 4A0FA 2FGKA 3W1GA 1CF4A 4DV0L 2Q3MA 1GUTA 5JEAJ 5IDVA 2N46A 1J8YF 2C04A 3K1JA 4DV1L 3AVQA 3RZDH 3HOWH 2VHUA 1AGPA 1E6CA 2AX4A 1ZCAA 2EWVA 2WIAA 4MA4A 2I5LX 1SXJD 2V8OA 5JSZA 4A3JH 5JWOA 2MSCB 4PXAA 5AUOB 1E4YA 3ULJA 3TGPA 1P62B 3TEHB 1XD9A 2X19A 4MTNA 4X64Q 2JJ1A 1N33Q 1AQUA 3CF6R 4QQBX 3R8CA 4X6AH 3ZS8A 1W5TA 3TS2A 4GN4B 2IY5B 2QI9C 2VA8A 3F2DA 1EFWA 4QJ5A 4RKFA 1Z63A 4D81A 3CPWA 3QG1A 1AS3A 1F6BA 5H1SE 1GO3E 2YOFA 5EXTA 1Y1WG 1EFRA 1GZSA 1UEIA 3PITA 2V6JA 1GD7A 2VHJA 3PGZA 2JA6H 3MLEA 3NXSA 3SNHA 2RGCA 3ADBA 4IOCA 2R6AA 4L15A 3QENA 1IW7D 3K0XA 1FPMA 3PF4A 4DK3C 2VRWA 2YNMA 3GJ8A 1YKSA 4C3IH 4NYJQ 4RY2A 3F5FA 1Z3IX 1D2EA 2UU9Q 4P33A 2W2TA 4UQOA 1BOFA 4LF7L 1KI3A 3OW7A 2JDID 2ZE6A 2ZS9A 1XXHE 2AKAB 3AP3A 3LO5A 2JJ2D 2XSZA 4PG3A 3PCRB 3M4PA 3WP1B 1VQ8A 2QM8A 1JAIA 2DBYA 1SVLA 3AKYA 1YJNA 1W2BA 5JBQA 1S3OA 5J47A 3Q8DA 3EC1A 4NZYA 1Z47A 1XXHB 4URYR 3WBJA 4XWOA 1GHJA 1VIYA 2JJ8A 4GZYC 5EUMA 5C46F 3T5GA 3KF6B 3I55A 1LF0A 4PR0A 4CT5A 3KXKA 3UIEA 1YE8A 4JI2Q 1HTWA 1P5ZB 2GCOB 4LF5Q 1E0KA 2CK3D 1XRJA 2D2EA 3I4OA 1R10A 2J59A 3K7AH 3TRFA 4EPXA 5C3EG 2YWGA 1GRRA 4OWXB 1TEXA 2Q2HA 4PQRA 1P73A 4AYBG 1CR0A 4JI7L 1SKYE 2P65A 5G53C 2NPFA 3R8FA 1P2SA 4BPBA 3AVTA 2GK7A 2H92A 1A2KC 1JXOA 3CX7A 3UG6A 3UMFA 5TVKA 4B74A 4BLQA 2H5XA 3AV0B 4DLVA 2JLWA 2E75C 4BFVA 4LF6L 1X56A 5IK2A 1VQHA 2G77B 2UUAL 1SKYB 2IXFA 1N34Q 3OIVA 1S8FA 3A8IE 3N6RA 1O7IA 1VCNA 4Q7JB 3LGJA 3GEEA 2G0TA 1HTPA 4JBJA 2IHBA 4XVQA 2CCZA 1WXQA 1OE0A 3S14H 1OB5A 1BMFD 4YMSA 1AN0A 3CCQA 4ZI3A 3U7GA 2GZHA 1CJMA 5C4XH 1UDXA 2DHRA 2O0JA 1K8OA 1KDRA 5J4YA 4JC0A 4LFCQ 3J80i 5FLMG 2EYUA 4LJ8A 4TL8A 3U5ZB 3VKGA 4UP9A 1ZNZA 1N5LA 4DR2L 4HIDA 1AKYA 1KMHB 4LF6Q 1Z5ZA 2VEDA 4HIMA 5LMNW 4V03A 2IT1A 3N5CA 4BBRH 1FUKA 2VPPA 2UXCL 4JI0L 2WJIA 2NO7A 4FXPA 4GNKA 1HT2E 3Q5EA 2W58A 1E2ZA 4Q9KA 2K5NA 2ZI6A 3HJNA 3K0FA 3K81C 4P4SB 5JWHA 1A63A 2CCKA 1N5IA 3VFDA 3K09A 4D82A 2FSFA 4S2EA 1GL6A 2BE5C 1DELA 1E2PA 4F4CA 1YJWA 2KI5A 5AUNB 4N0EA 1JECA 3RS2A 1W4BA 1K8MA 1LM0A 3KDSE 3J81c 2FOLA 3DXJC 1KAOA 2KCCA 1WBDA 4B3TL 4GN3B 1II8B 3NEYA 2LWIA 4KLZA 2QY9A 1M1YE 1OFHA 2OTLA 4TYPA 4AG5A 4ESHA 4P4TA 5FTLA 3ICQB 2O5JC 1KIMA 2H5EA 3B9PA 3A1SA 4GP7A 3M4OH 5EAYA 1P4SA 1D7QA 1SVOA 4TMWA 4DV3Q 1EWRA 4DT1B 4Z54A 1YIJA 5DHAA 5C4MA 4PHGA 1M1KC 5DLQC 3GLIA 1NN1A 3TSZA 2PLRA 4JBXA 3U6KA 2A6HD 5E7JA 4BY1H 3EA0A 1Z83A 3CC4A 3OAAD 4I1OA 4DEXA 2DWPA 2MO0A 4GT1A 5C18A 1CEEA 3E9HA 3IPXA 4YY3L 2GZDA 4H02A 2ODNA 5P21A 1OYYA 3T34A 4GRAA 4A93G 2ZRJA 4YMVA 3U9SA 4H1VA 2JA8G 1Y8PB 4TWZA 4UP7A 1E0SA 1E1TA 2FG5A 1W4AA 4C2TA 5LMNQ 1IBMQ 3T06B 2XGTA 1E24A 3TQCA 3ASYA 2QSZA 3HP1A 5JCZA 1OH5A 5L8VA 3MEFA 3I72A 3AF4A 5GJBA 2CW0C 1MO4A 1NJFA 2ALYB 1R4AA 2CEAA 1OYWA 4L5BA 4D4JA 4NYIR 4JJZA 2OCEA 1W36C 4LF9Q 3SU8A 4E09A 1G41A 3ND8A 3DZDA 2VQFQ 2Z43A 1Z2AA 2GJ9A 4CDGA 2A6EC 2PPBC 2REXB 1YZNA 4M8NE 4LWZA 1K8AC 1IY2A 4JOIA 4P0TA 2H16A 2FSGA 1JQJC 2GJ8A 2VF7A 4LUCA 4Q4JB 2V6IA 2VYFA 3MJHA 4L4UA 1VQMA 2R6GA 1FW6A 2NVYH 2EQBA 3H86A 4MYHA 3WWVA 3A0JA 4BA2I 2ID0A 1SN8A 1QZGA 3CRW1 2GA8A 3EA5A 3LVQE 3M6AA 2DCUA 2ORIA 1QHXA 1DE0A 2RAPA 3BXZA 3I4NH 3CLVA 3M1IA 1ZM3A 1ZAKA 1KSFX 2QL6A 2WICA 3OYYA 5FR2A 2CFMA 2C77A 2OAP1 4WXPA 3X2SA 4UJ5A 5CK4A 2ZYWX 4RZUA 4CRWB 4DSOA 2JXMB 1AQYA 1SHKA 4MYCA 1GJXA 2K32A 4JI6L 3IO3A 5B58C 1HE1C 3PUYA 1KAGA 2KA7A 1KZGB 2V7QD 5JECA 1N9WA 1N0UA 5FI1B 1EESA 2B63H 2WWXA 2JLUA 3BG3A 4OK5A 4JBYA 4LK2A 3SYNA 3H84A 4KHPL 3HYTA 4TT3A 3CCUA 5CYOA 4LF8Q 4A3FH 1OIXA 2IEYA 2XOKD 4NH0A 2X2FA 4DDUA 1VQ5A 3NBFA 1ZM9A 3VU9A 2Q9BA 3OEEA 1TX4B 1AZSC 5B30A 4TZ0A 5F3WB 3OAAA 4JI8Q 1KO8A 1Z0JA 1Y63A 4EKDA 1PH2A 2ZR7A 1YZQA 3GJ3A 2R7DA 4P3YA 4TLAA 2V4DA 1S0UA 2Y8EA 4Q4AA 4DB4A 4FIDA 4PPGA 2YINC 3CPFA 3KKMA 4JS0A 1G8FA 3OTOQ 3AGPA 2HJVA 3EPLA 1E2HA 2IS6A 2KHIA 2FPMA 4A3KG 4TYQA 5JCPA 4LW1A 1XJCA 5DH9A 2ZRKA 1NIPA 2GNOA 2D4HA 2VIIA 1JJ2A 2D0PA 4MITA 3K9HA 4RFSA 3N70A 4M9XA 3G71A 3I7FA 4P74A 4LFAL 1NMXA 1SHZA 2HT6A 3CZPA 3HU3A 3LD9A 1UKYA 4IOKA 2GCNA 3L0SA 4MGZR 4M1SA 4UXHA 1V43A 2JA7H 1D9XA 1E9BA 1F2TA 1KXLA 1NLYA 1DTSA 1JR3D 2AD5A 5H68A 2O8DB 1N32Q 3G5UA 1AS0A 1W48A 3T15A 4RMFA 4BFSA 1C9OA 1HE8B 3AVPA 4W7SA 2JGNA 4R4IA 4HAUA 1FJGQ 4TYWA 1P3JA 4QBGB 1S2MA 2FSIA 5GROA 1DOAA 4KYIB 4TVAB 1Q82C 4W5HA 4AH6A 5EP3A 3PXGA 4KKTA 1UJ2A 2WZQA 3SE0A 3QXCA 4MQBA 4URVR 4P32A 1VS0A 1YZTA 1NVUQ 4M0LA 4PPFA 2XZOA 2UUBQ 4EX5A 3BFVA 4DXAA 4GOKA 2IUUA 3KQLA 2OTJA 2ZTEA 1N6LA 5IYCG 2GF9A 4IJHA 4IEIA 5EP2A 1TWHH 1XTRA 1GDDA 1ZD9A 3S16H 2IX3A 1BVSA 4NU0A 3TQYA 4LV8B 4D26A 1N8RC 3U7EB 3KJGA 5FUXA 1TNDA 4RG1A 1S72A 4BASA 2XNSA 1ZJ6A 2J1LA 1X9NA 5DLQE 3QI2A 2IX0A 5FUYA 4DV5L 2F52A 1HR0L 3TK1A 2B8FA 1ZC3A 3QKRA 4O25A 4MRNA 4PZYA 5HKKD 2B3GA 2R62A 4BFTA 2C35B 4YHHQ 4QNRA 4QGAA 1S3GA 4IJLA 4X62Q 1GKYA 1XDBA 4JYCA 1KRTA 3TH5A 3I5YA 2ZI9A 3D3QA 3KXIA 4PC1A 2GZAA 2GXUA 1Z6HA 4KFUA 3IEUA 4EAQA 1KI6A 1DAKA 4DR6Q 1Y1VH 2R92G 4Y0AA 4URUR 1R8SA 4ME3A 1A7JA 1LTQA 4S35A 5M3MH 2K7VA 4PV1C 3RABA 5JEAG 2QMEA 5J4VA 4DV7Q 1YR9A 1PH3A 4WZBE 2GEVA 3E0EA 1N6NA 2ZRLA 1R0XA 3CONA 2JLXA 1EIYB 1X1RA 3UE1A 3OPOA 3NIBA 2J0VA 3LXXA 4NPSA 2OCPA 1VMAA 4V02A 1U0LA 3I56A 2IXGA 3IRBA 121PA 5IWAQ 1RYHA 2REOA 4A0GA 3IIKA 3VR4A 1W36B 4YQFA 4Q4AB 3NKVA 2D3WA 1E2VA 5GVSA 5AJZA 1K8RA 1NF3A 4BLOA 1B70B 4C0SA 3BZCA 1B8AA 4ITRC 1L1OA 2Q9AA 4XD7D 3AFQA 2QBYB 3RS5A 5EE1A 5J5CA 4DDWA 1KK0A 1KY2A 1L0WA 1IY0A 4NCIA 4NXML 2PT5A 2OQKA 2F1JA 3WXMA 2EJGC 4LBYA 4OBEA 4O2DA 1CUKA 2PZGA 1JJGA 1JMCA 2CE2X 4NBSA 4RFSB 3RS4A 4HDQB 4DUYQ 1NN5A 1XMOL 3E1SA 1KHIA 4X65Q 4O3MA 1IBKL 3EIHA 4RKEA 2QGQA 1X3GA 5ELOA 4BA1I 1F2TB 1B7YB 1Z6YA 1QZHA 5GJVC 5A4JA 3HOXG 2HT1A 1DG3A 3PSIA 1AIPA 5E7MA 1WFQA 3PEYA 4APVA 2JASA 4KVGA 5JJKA 4X8OA 4QGFA 4GKKL 1XD2B 1J7KA 3VTKA 2VLIA 1B9MA 1E2GA 3CCSA 4BGDA 1I50H 3EWSA 2Z0SA 2A5FA 4RCNA 3SJZA 2P67A 2Y0SE 3NTUA 4Q4HA 1L4YA 2JLRA 1GM5A 4M9QA 4MUAA 5CIQA 5BYKA 3W5OA 3CCJA 3CCEA 1C1YA 1ZNXA 2AK2A 3SQXA 4A3LH 3QY0A 3BORA 1FR3A 2FNAA 1VF7A 4GLAC 2PBRA 4FMDB 1KQSA 4OHWA 1RIPA 3FMFA 1G5TA 3X1ZA 1VQEA 3FHTA 1H8HD 2PH1A 4I1VA 4A6XA 2O8BA 1CTMA 3HFZB 2HHHL 1DEKA 3J7A5 1K5GA 2FEOA 3I73A 1XB2A 2QA5A 3BIFA 4B3SQ 4LYAA 4E5UA 2V9PA 2W0SA 1XMQQ 2YTVA 1KJZA 3CKLA 3REGA 1GUOA 1JNYA 3IGFA 1UAAA 3I61A 2JATA 5KHOC 4A8JA 1II0A 4US0R 3SBDA 1W0KD 4L5QA 1XNQQ 1HNXL 2EVWX 3BRWD 3PQCA 3UDXA 3RSLA 4EFMA 3V4RA 4KITB 5L3SA 4HZIA 3LX8A 4B71A 1BO6A 2A68C 1R7RA 2CBZA 4WOPA 4B75A 1SR3A 1MJEA 1KI6B 2JA5H 1ESMA 1ODFA 1VKJA 2FA9A 5CB8A 4A36A 2ZSFA 3JVVA 1U9IC 3LXRA 4IRUB 4Q9HA 5DI3A 3ZZTA 4U7DA 1X55A 3UDGA 1ELOA 3I4MG 3HKZG 1SVSA 1YRAA 1YVCA 2GTPA 2QTFA 3GTGH 1E3MA 2Q2UA 4LF4L 3H2YA 1D2NA 3LNCA 2OZEA 4K46A 2L15A 1X6VA 3X1DA 3QF4A 3OE7D 4V0ME 3EPJA 1R5BA 3MSXA 4V0OA 1GKUB 3SJAA 4QJFA 1E2QA 3CCVA 1Z6GA 1EK0A 1YHNA 1P2UA 5TXGA 2BOVA 1CRPA 1JEEA 2JA9A 2C78A 2WJJA 1J8MF 1VQIA 1X54A 2IYLD 4KHZA 2MO1A 2ZYTX 1WDTA 2QROA 2DPXA 1HNZL 2NN6H 1IXSB 4JG2A 1C4OA 3M4YA 4LYFA 4XJXA 5UKDA 3CQZH 1ETUA 3LAWA 4WIAA 2ZTCA 3HOUH 1U8YA 4ZDKA 2PEYA 2WIBA 1OSNA 2Z6VA 3IO5A 4QIWE 4TL6A 4YDHB 1E2LA 2J0SA 1FMLA 4TMKA 1EWIA 3MRSA 4ASUD 1BBWA 3OHMA 3T56B 1WA5A 3L0IB 4G5SA 4ZIRB 1DS6A 1GAJA 3RAPR 4EJSC 4M4SA 1NMYA 4UXIA 5LDDC 4JI5L 1COWA 1HURA 5J4KA 1DVRA 2J5XA 4KV9A 5K8TA 4GI7A 2DB3A 2BBWA 4GNXC 2FZ4A 2BA1A 2VHTA 4DCTA 2GXAA 1I3QH 1LF5A 4MGIR 5FTJA 3T1QA 4GFDA 2IWRA 3TUZC 5K8UA 2NVQH 2ZUCA 4P31A 3WYGA 3UDFA 1P9NA 4C0AC 3VR6A 3BH7A 1KNXA 2ZJ2A 4MH0R 1L8QA 1PLKA 4CEHA 1HCZA 2IA5A 2OLKA 2FDCA 4YWLA 4B3RQ 3CX8A 4X66Q 2K50A 3DL0A 1VQ4A 3O8CA 3RS7A 1GG2A 3BB3A 4JI3L 2CCGA 3EIEA 1T5IA 2K5HA 1Q44A 1BS1A 3NENA 5DN6A 4OONA 5M5YH 2RGAA 4DK1A 1KY3A 4PO9A 1ASYA 4LK1C 4YXWD 3JC66 1U9IA 2L5TA 2ZIAA 5AJ3Q 3EBEA 4Q01A 3BU2A 1Y1WH 3A74A 4AYBE 3BB1A 1HNWQ 4N0DA 3RHFA 4B3MQ 4EUNA 2W83A 2O8BB 1I5FA 1JT8A 5CLQA 4KN4C 4L8JA 3U6BA 4LHYA 4BZQA 3S15H 2QAGC 4Q5IA 3U44A 2QRNA 2IUTA 1HYQA 2XX3A 2A69D 4AYTA 3TSWA 3OIWA 3BDOA 2DFNA 3X1YA 1KKMA 4QBFA 4A8JB 2GAOA 1GUSA 1G9XA 1GKIA 1PH5A 2ZE5A 2WJHA 2K33A 2FPKA 2VY3A 3GJ5A 4PQFA 5L3SB 2D7DA 3B1XA 3GMTA 1E99A 4A3CG 4B3BA 2F4VL 4POGA 4LBZA 3ZZ0A 2DWOA 3A4LA 4MUBA 4YMWA 1YR6A 1QUQA 3G4SA 3GLHA 5DI3B 3ZJYA 3AM1A 2JE6I 1NY4A 2GHIA 5L3QB 3BWDD 3OESA 3ZD6A 4IFDH 4LC1A 4M53A 3H15A 3W9YA 3T61A 2KCMA 1WCMG 1XNRL 1TF7A 2RHQB 2JEOA 1GRNA 1IONA 4R4TA 3MWYW 3QF4B 2HDNB 3SJCA 4AQYQ 4DCUA 2J45A 2HIXA 1GVNB 1ZCBA 5GAGC 1XCMA 4LI0A 3RR5A 1J99A 4E07A 2C03A 1G7CA 4DLUA 3QKUA 3B2EA 5C3EH 3J7ZC 2BDOA 2IYTA 2GWHA 2G1JA 1TF2A 4FCVA 2ERXA 3CX6A 4B73A 4PMWA 1WOCA 3CCLA 1X8KA 4H9GA 1E0AA 3W5JA 5AJWA 3THXA 1NG1A 4L9SA 4AKEA 3FMIA 4JI1L 1FOEB 4BXXG 1QG4A 4NE2A 2JJ1D 2FWRA 3GFTA 3K9LA 4JIMA 4A0RA 4A2PA 4NXNL 1KOFA 3FFAA 4Q7MB 5EE3A 5ELXA 1U8AA 2NIPA 4ZCLA 4YWKA 4UXJA 3PIRA 1UDWA 1KC8C 2OXRA 2LSSA 1EFRD 3SGIA 4C7OA 2R7FA 2QPOA 1NP6A 3NVAA 3ZGXA 2I4IA 2XGJA 1F60A 1H9JA 3RS0A 2QN6A 2ONJA 1T3HA 1P61B 2A8VA 1XXHA 4MYUA 4BFZA 1IXZA 4LY6A 4TQAA 3A6PC 2UUCL 2XITA 4OL0A 2HEIA 1EWHA 1OFTA 5EE5B 1A4RA 5FLMH 1W46A 1YHQA 4BBSG 2ZRBA 4CEHB 4AY2A 3TAUA 2XSZD 1Z28A 3OOCA 3TRZA 1W4RA 3U7HB 4Q4LA 2PCJA 1CU1A 3EIQA 1OKKA 1T3LA 1QBKC 4A76A 3BK7A 1IL2A 2EVBA 1VCIA 1EX7A 3EXAA 3QSYA 4G3XA 4LHVA 3HR8A 1E98A 3J80c 2VNUD 3BFXA 5EQTA 3RNUA 1QVRA 3W3ZB 1DAMA 2ZJ8A 2HJGA 3MCAA 2JJQA 3GP8A 1OIWA 1T9HA 1QVCA 2CWPA 4JLVA 3LW8A 3CPJB 4R4OA 3B1ZA 1QZXA 2ZS8A 2D06A 3DKPA 4KN7C 5IY0A 3HWSA 4X64L 1ZP6A 4TSFA 1N33L 3T1OA 2ODEA 5EE0A 3R9XA 3C7KA 1H9MA 4ON9A 4NMMA 2CCJA 1WQ1R 1Z6TA 2EFDB 4BQSA 1Q12A 4ZV4A 4JSYA 4RD4A 1GIAA 3GLHE 1E79A 2C96A 4XSGA 1KI4A 4X8HA 2YTXA 3LNNA 1XEXB 1PLLA 3CZQA 1OXSC 3UDIA 1NBMA 1UM8A 2IHFA 3ZDQA 3H3VI 4JV5Q 4V0KA 4W5WA 3V9PA 5IK2D 2ZRGA 5E7IA 4ZKEA 1Q1ZA 3BE4A 5LD2B 2PI2E 5JFGA 2PQAA 4C4PA 1QUQB 4A3IG 3GLHB 1XJVA 2UU9L 5FBVB 1KMHA 1E2WA 3AVYA 4EJSB 3E5HA 2WTUA 2BCGY 2ONKA 4IEEA 2CKZB 4DIDA 5TY0A 1GL9B 4A93H 2FU5C 5BWMA 1N3BA 2DGYA 2JA8H 3HOZH 4GNXB 1G7TA 1H9KA 3BH0A 3QXJA 4DR3L 1RZ3A 4P4SA 1IBLQ 4MYTA 4C9BA 5IP9G 4CYMA 2NZJA 2YOGA 4DWJA 5FBLB 5IHPA 3F2BA 4OK6A 2ZAOA 3X1WA 2IHEA 3BAFA 4AIIA 1OV4A 2KBEA 2W6IA 2DFTA 2KJQA 2O5VA 3H94A 1FL9A 1KSHA 5DYGA 1OXUA 2CWAA 3J81j 2WWIA 3U3RA 2A5DA 3C15C 5EE9A 3K0EA 1SQ5A 4DR5L 3THXB 4PZLA 3DZ8A 3AQQA 3QIAA 1IM2A 1FX0A 1II8A 2BVNA 2PT7A 3I3SR 1TQ6A 1K0RA 4JI2L 4JVMA 4KFTA 4US2R 4RVCA 2PCFB 1VQFA
chains in the Genus database with same CATH superfamily
1YB5A 5JS2A 4DR3Q 4JPBW 4Y2SA 1H5NA 3VPSA 2C9ZA 3SQWA 2DKNA 4KLCA 4R9RA 4WCVA 3JARB 3K16A 5I8WA 2VJMB 3W4KA 2FN4A 3AGQA 1OMOA 4FNMA 1WCV1 2DF8A 3H13A 3HU5A 4BKOA 4C43A 3LQRA 3IUSA 3DTYA 4F1WA 4TXMA 2QA4A 3ZTTA 3KHSA 2VXBA 3JQAD 2GK3A 2DOKA 2XMZA 4B6FA 3BGIA 3PTLA 4TQUS 5IM4A 5E4JA 4XRGA 1K7FB 1NNSA 2NADA 2IY9A 2GCPA 5J1ZA 1J2JA 4FJ1A 4OOEA 1ECJA 2D8MA 3PUJA 3NRBA 4O2RA 2ZAGA 5HGQA 4EEZA 4WHMA 4GM0A 1UE1A 4F2HA 1ZW6A 4D9KA 2W4QA 4CKZA 1GXSA 1G6OA 4B7AA 3WGIA 3D3WA 5JDCC 2Q1SA 4NBNA 1TRHA 3UI2A 4OELB 2V0GA 1Q74A 2Q1TA 2NVBA 2DWCA 5M7EA 1EIGA 5E9WA 2CXRA 3TVTA 1EQRA 3MUNA 1K1EA 5LL6P 2D62A 2NVTH 2WMYA 3T7SA 2OK7A 3II6X 4GW3A 5E3HA 3GTKB 5I9OA 4KYTA 2EDGA 3IURA 3KT8A 3CMCO 4ETIA 4KZKA 4FS3A 1TU0A 4L8FA 1NW4A 3U62A 2IBSA 4NMZA 4YDQA 1E3PA 5K6TA 1FUIA 3M3YH 1QK4A 4JB3A 2V5UA 5IYDG 4XGNA 1NBHA 4JI8L 1DDIA 3JYLA 1NMEA 2QX6A 1FFEA 4S2UA 5K0CA 4MROA 3UJNA 4EUKA 4BVJA 4YJHA 3W3AH 4G01B 2ZVPX 5C2JB 1J0AA 3CRMA 2PA0A 1LK0A 1NSNS 2GSDA 2CMDA 2AH5A 4ZU1X 3PPXA 3L8MA 2C92A 3HKZB 3LRPA 3GI1A 2CQOA 1HDYA 4YJGA 3BD7A 5EJ2A 1NQUA 3EWNA 2A7QA 4ARBA 5A4FS 3UCEA 1LDMA 1JFTA 3H5AA 3OPVA 3DAYA 2R8OA 1J0CA 3QKTA 1BCPD 5JATA 3PHGA 4PY2A 3DPUA 4W5OA 4JVLA 1SCUA 3I9NA 5JY1A 4KMOA 3S5JA 3C8DA 1U4LA 5EJEA 1XEAA 4GPIB 2QUAA 1PGJA 2JLBA 2VL7A 2WKPA 2ZAMA 1K2VN 3NH9A 3ERSX 3ADCA 1PV4A 4HX9A 1G3IA 1U6IA 2O0LA 3N05A 3FCCA 2VQ3A 2IU6A 2WWFA 3EOBI 4M2LA 4NAUA 1GFIA 3PHHA 2ZDHA 3R9WA 3BJEA 5I2YA 4BMZA 1O78A 4J91A 3ONNA 3K71B 3NC0C 1ZUIA 5IULC 3A6ZA 2ODBA 2H9AA 2PZUA 4YUZA 3KTFA 4I3GA 4LNQA 3PD0A 1YJ5A 2Z1NA 4HDCA 3PTAA 1G6PA 2DLNA 3HYRA 1XNQL 2R8ZA 1NJIC 5HZMA 3LUGA 1S1MA 4H3HB 2AX3A 1WUHS 3R9IA 3GTOH 2NO5A 4RGBA 4U3JA 3MINB 3ON5A 4PPNA 5FL3A 1JIJA 5FKAC 2JHFA 1ZD5A 4EF4A 2QI9F 1QHGA 1GVPA 3FN4A 5A04A 3I9V6 1QNKA 4A03A 1RAGA 2I6SA 3HDTA 3CWQA 3NWJA 1SK9A 4P4UA 4GEGA 4YJ2F 1F48A 4A3IB 3UV3A 1RQ7A 3EW9A 3KOZA 5TQ2A 1Y8NB 4KQ6A 4M0KA 3H4IA 2FZEA 3JVEA 1ISFA 5CC4A 2KSQA 5M2QA 5ITZA 1YE5A 2WJGA 4KOEC 2ZJ3A 2ZROA 1I7LA 2VUHB 1U2GA 1LFAA 2G25A 3PNPA 3F74A 1RTNA 3LBIA 1ZIDA 4YLEA 1ODJA 2E2IB 3JPYA 4H7BA 1P1FA 1USGA 5DP2A 1M6HA 4W7HA 3VX3A 1G3MA 1N8TA 3FNBA 4W1QA 4D41A 4CL0A 4WGFA 1P4GA 4N01A 1PZNA 2QJFA 1OPRA 2IYEA 1YCDA 2P77A 1LH0A 4D3YA 2WUEA 3A1DA 4GNXA 2EQSA 1ZK0A 3KAJA 2VUMB 2YCLA 1ONLA 2PH5A 3QU7A 5CJ2A 1Z6XA 5K0GA 1WQ3A 5IT0A 4OOFA 4REMA 3GF4A 1Z0FA 4NDZA 3PDJA 4X66B 3IILA 3KQOA 2WFAA 3E9EA 1IIRA 1I3KA 1CJSA 2VO1A 4UPVA 4Z0PA 3NT4A 2NN6I 3W5SA 2QPTA 3DEFA 1C2TA 2NZ8A 1FXUA 3SVZA 1VCMA 4U5QA 2O3UA 1J8FA 5B3KA 4A3JB 4Q1AA 3KOWA 4XR4A 1GGMA 5EIWA 2PQ0A 1JG6A 1PSWA 5EWLB 2Q0HA 3TXAA 5IM5A 5BV8A 1T5LA 2BGMA 1XPRA 4YUWA 2QN9A 5DNVA 1RM4A 3F9IA 3AO0B 1HOTA 3HOVH 2BMAA 1Q16A 1WVMA 1XMXA 4I99A 3WO0A 4M9SA 3L1IA 1C7JA 5IC5A 3Q10A 2E5WA 5KSYA 1DBSA 3SR3A 2MSKA 2Y0PA 3JD4A 5HEKA 4EY7A 5EBDA 4ENTA 3QPWA 3FFBA 4HDOB 3H3JA 4AQ7A 5JASA 1CEYA 3OM9A 2ECKA 1R6AA 5M04A 4BRUA 1O5OA 4HB4A 3KQTA 3CUVA 2X1LA 2IEZA 2CMKA 4F87A 2WNSA 3HDVA 4MLPA 1D2MA 2QRZA 2HQOA 2EBWA 3KZKA 3ZVNA 2WACA 1VJRA 3QV2A 4E46A 5A5VA 3HZXA 4BGVA 3GRVA 1MJCA 2FXQA 2XYRA 4D0LB 4EI7A 1HKHA 5FWYA 1DPGA 3GZTB 3TFWA 3M6LA 3MJTA 3LHFA 5I7EA 2WPDD 1DOMA 1QGDA 4OMFG 2ZUDA 3SK4A 4AU1A 1OJLA 4BY7G 1XTIA 1KIAA 2AZTA 3PC6A 4MQ6A 5AMXA 4OPMA 2QT1A 5EXPA 1K7XB 3ZLBA 1QOZA 3IJRA 3P4YA 1BQ3A 4JVOA 4B6PA 4K3UA 5KC8A 5HTOA 3TIGA 4IJVA 3QYPA 4RK4A 3DZCA 3F6BX 3I52A 2Z58A 1G98A 2DR3A 2RGRA 5LB4A 2QR2A 1D6NA 4JASB 5ICFA 4HCEA 3KZOA 4KPYA 3FCUB 4G5RA 4AP6A 1PZFA 4I6JA 3WL6A 1Q0TA 3HUDA 2QTVA 2NTYC 1Z7GA 1EQ2A 1IBCA 3D3EA 4I4CA 5KYUA 1XE3A 1G59A 1ZEJA 4QOSA 5AW5A 4I1RA 2PXCA 4WY8A 5HJ7A 2UXCB 8LDHA 2WZBA 5GQOA 3LTNC 4XQ9A 2EY6A 1JHUA 1T5HX 1IOLA 4MRRA 3S29A 2R8XA 3GLIB 2PUEA 1FL0A 2D2CC 4JVNA 2FK8A 2R6HA 4OXKA 1XL0A 4X3CA 4UM7A 2P9BA 2QT0A 4FGUA 1FP1D 3EXIA 4G9BA 4E03A 3VKFA 1QRRA 3IKTA 4FEYA 5FI5A 1ESCA 3OQIB 3WX0A 3AERA 3OU7A 3BREA 1PAUA 3UMCA 1WB9A 1Q3TA 1BXGB 2IEBA 1JEQB 4DTCA 3TMAA 1S7CA 3R3HA 5CRIA 4L4RA 1MCZA 3S1NH 2EIXA 3R40A 1Y3DE 5IJ0A 2NSHA 4GWGA 5HIIA 4F9EA 4UOZA 3TNFA 3FHOA 2JLVA 4L2IB 1T8UA 5HZKA 4TKMA 5A4AA 3BRCA 5DCWA 3V1NA 1TQDA 4RYDA 4W8OA 3LUKA 2R7MA 2OC4A 3PVZA 4WESA 4RJIA 4JX8A 3CBQA 5EPUA 1Q0QA 1SZDA 5DNEA 3B6IA 3BG5A 2B63G 1MT0A 3N2LA 1JLRA 4B35A 3VR5D 1MO3A 2H5JA 4IWNA 4J6FA 4J03A 2MSDB 3E9RA 4WZAA 2QMHA 2YS6A 2YUIA 3FPEA 1QIKA 3ICPA 1Z82A 1KOLA 1P1KA 5CGZA 4DLLA 5IYBH 1YNOA 4R81A 2LFNA 1U3TA 4RMNA 4PQYA 3KBXA 2CSXA 1NUCA 5SYMA 3IUYA 5IM4F 2OMEA 2Z09A 4MUJA 1INLA 2PEZA 5F77A 3F7MA 1KO4A 3I6MA 5JIBA 4L7QA 1TCUA 3ROMA 2RDGA 5HFNA 3RRBA 1GHTA 5I6DA 5EJAA 1L5HA 5G4KA 3T0FA 1SYFA 1GVHA 3WLNA 1P80A 4QSMA 1KO1A 1TZCA 4NLLA 2WHPB 4N5IX 3EDCA 2J8ZA 4G0UA 1OLUA 1AG9A 3OSZA 4OG2A 3ETLA 3S15B 1Y1VG 4E7OA 4Q37A 4BVEA 1WD1A 4ZVMA 1EZ6A 4D0GA 4IDEA 4C05A 2C2XA 3N58A 2BELA 3GEIA 1STHA 4PBRA 1QP0A 1JB3A 4TRRA 3UKDA 2CLLB 3QE4A 3FZEA 1F20A 1YQ9A 4H08A 4XARA 2KB0A 4URWR 2W2QA 4NOLA 5ARCA 2J33A 3N74A 5CPFA 5JOBA 2WWGA 4KKUA 2BBTA 2YBDA 4NBUA 1H94A 5AKKA 2BTOA 4AWBA 1V47A 1RQNA 3WE7A 2OEPA 3GR6A 3PO3G 1QOQB 3U4VA 1T5OA 3GEMA 2UVQA 4A8TA 3EVEA 2FWBA 4F5EA 4EB8A 1NMQA 3ZCPA 5LLDA 3TQFA 4Z9FA 1SFOH 3D4RA 5GJWC 4HBZA 1JFLA 4JI1Q 1FMCA 1T6XA 2RH8A 4HSPA 1HRDA 3AZQA 3NKLA 4PO3X 5CV9A 2W6CX 4TLEA 1UE5A 3L2OB 1U8FO 4YYZA 4F6RB 2VK1A 2OWEA 3VSCA 4DEYA 3JAKA 2PRIA 1CZHA 2A4MA 2HZBA 3GLFA 1RWQA 4QYSA 2X0NA 1GAQA 2D4AA 3G2OA 4JQOA 1DIRA 1AQUA 1W5TA 1KL7A 1D6MA 5EXTA 3KLPX 1E1DA 5IHXA 2X6QA 2FF5A 1JWUD 2XXBA 3D8NA 1FPMA 3PF4A 4XUCA 4RWZA 1RAHA 1K8YB 2JL1A 2UVPB 2WJ3A 1XXHE 3S55A 1J42A 3WP1B 1S3FA 1I5OA 2C58A 3IVXA 4URYR 3WBJA 4D46A 1OYVA 1SBHA 2DBZA 3NUQA 3DV9A 1E0KA 2SKEA 2GFIA 4PQRA 3E58A 2OY0A 3D6JA 4J0JA 1M5UA 2X1MA 5IEBA 4O2BB 3LGJA 1N2EA 4KK7A 2ON6A 3C8ZA 3V5NA 1DHTA 5C5IA 2OO5C 3RYCA 1KDRA 4JC0A 1JCKB 4ABNA 2IP4A 1JQDA 4GDMA 1ZAYA 2VPPA 4BY1B 4JI0L 1W29A 1HT2E 4LS3A 2JAWA 2X0DA 2EX1A 1S2GA 2Q49A 5CFQA 1T8RA 2FOLA 4BIMA 3ROZA 1RXYA 4UHHA 2YRWA 5FTLA 2C83A 3B9PA 5D5PA 4MEAA 4OP1A 3UEOA 5CEFA 2IOHA 3UHFA 3ESYA 2J67A 5DDIP 1EEID 1QV6A 4A0QA 1ZI6A 1WTPA 2Z2XA 3LCRA 2QSZA 3TOXA 2Z9DA 1JI3A 3PGA1 4F3RA 1ZJWA 5KWVA 3TQQA 3E6AA 5KU7A 1A8UA 3MRVA 3RAFC 2VATA 1RHPA 1QHXA 2PQ6A 2G17A 3OYYA 4WXPA 2ZYWX 3RD4A 3GNSA 1OX4A 3PFGA 2VPYA 3Q12A 2GK4A 1U5BA 4OK5A 5BVGB 1KHHA 1SOMA 2JBAB 4D45A 4XX1A 3GJ3A 4FYKA 5FF9A 1OV6A 1HC7A 4DB4A 3UHOA 2HA4A 3T38A 4I3HA 4KWCA 3R2TA 2IS6A 2FPMA 4M0CA 4C4OA 3I7FA 1UKYA 1CE8B 5FQNA 1Q2XA 1JR3D 1XA0A 3W2HA 2ZWAA 4RMFA 1YA4A 1S2MA 2WZQA 3DHYA 1UBNA 1SQFA 4PPFA 4JKOA 1USIA 3TP6A 1DU4A 5EP2A 4BO0A 3STYA 1RLIA 3KJGA 4MRMA 2XNSA 3PQ7A 4P5EA 3EJWA 1OAKA 1GKYA 3ZIDA 4FYVA 1X2EA 2O54A 2R7ZB 4ZT6A 1RMYA 2O9JA 4CLXA 4R7GA 1PD1A 4WZBE 4HR7A 2J0VA 2P7HA 2D3WA 3JQDA 3QX8A 3MUEA 1DTWB 4L5IA 1JN0A 2FLKA 2QBYB 7MDHA 1SRQA 4QMGA 4HRVA 5JPCA 1JJGA 4BMNA 4X65Q 4RKEA 1IG0A 2FG6C 1LK7A 5A4JA 3U4IA 3TP5A 4KVGA 5KWSA 4E5DA 3R0XA 4B4DA 1YZ3A 1E6LA 2X23A 4UTNA 1IVSA 2Y0SE 1GM5A 1DWQA 5CIQA 5FULA 1XVIA 2EGHA 1HDOA 1I2ZA 4QUBA 2BUAA 4YQZA 3CEAA 3FA2A 2PBRA 4OHWA 3FMFA 5CVCA 2O8BA 1K5GA 4B3SQ 3GDHA 1KJZA 2Y93A 3KPJA 3FNRA 4OU4A 4MW0A 5L3SA 1RRVA 1B8NA 3UDGA 3E5MA 3GX1A 5K8VA 2GNAA 3OE7D 1V7CA 5CLIA 1UKCA 3GLQA 1EK0A 2BOVA 1O95A 1F0PA 4KAAA 4XA8A 2YASA 1UPCA 4YDHB 5BRAA 4U2GA 4DIBA 3TDKA 4WLUA 4ZIRB 1DS6A 3ZV6A 3PNVA 4W4TA 4WOBA 1YNSA 2NVQH 2RHTA 3RC2A 1G21A 5IAEA 1JYSA 3ZCVA 1BS1A 1VPEA 5ICSA 4X3PA 3JC66 2QK4A 2ZIAA 4ZJPA 3A74A 2G5TA 2XWJI 3U26A 1YB7A 3U44A 2IUTA 2A69D 1O7JA 3ZXUB 5C3EB 3TSWA 3EMDA 2GAOA 1WHTA 4WX2B 1O8CA 3MWDB 4A3CG 4POGA 1AQ6A 3QPCA 2RG7A 3AM1A 3BRQA 3MA2B 2LNDA 4BAUA 4R4TA 1QQ5A 3PCXA 3SJCA 4E07A 3C3CA 1G7CA 3ZV7A 5DTMA 4HQFA 4IPTA 5E3IA 1PTOC 3E3XA 1QG4A 5BSRA 2EBUA 5IJXA 4YWKA 1JKIA 5DGCA 5CVTA 4XYEA 3M6FA 3IQDB 3RSHA 1SPBS 4UE2A 3AW9A 1G6Q1 4N3GA 3E7DA 2WD7A 2XT0A 4YUXA 4EL0A 5C5LA 1H93A 3RK4A 3TECE 2PZTA 4RXTA 3K30A 4K9PA 3O3MB 1OIWA 3V2TA 3BMOA 4ZOAA 3T4EA 4R4OA 1IY9A 2FQ1A 3ORYA 3WADA 4TSFA 5H3CA 1GKLA 3D6VA 4GOOD 3CZAA 2C96A 2EFYA 2V0NA 3UDIA 4H1HA 2JF0A 5IK2D 5F78A 4AJ4A 3KELA 2RCFA 3IIIA 3G0CA 1PWEA 1N3BA 2YJ5A 2IH2A 4C9BA 3O91A 5FHQA 3F2BA 1M0SA 5LZ5A 5IJZA 2WWIA 4AZWA 3RREA 5HGXA 4PHFA 4U63A 3AEKA 4RD1A 3AB9A 3ZXIA 4IH4A 4FMCF 2LCFA 2CJXA 1ZN8A 5C37A 5B2FA 4FVMA 3G9UA 4DR5Q 5LQDA 4X7PA 2JRCA 1WABA 4L8GA 4BC1A 3I62A 1UOPA 2AUKA 2JK1A 4DR1Q 1QGUA 1NVTA 4L5AA 4HSVA 1STGA 3ROKA 4MOWA 4YWJA 1X7YB 3D7MA 5AJXA 1VYUA 3A7AB 4DA4A 3KJEA 2WJPA 2YDXA 4MTKA 1YC5A 3AW8A 1UQRA 2HEGA 2L0CA 1PTOB 4FCTA 2XUAA 5ALIA 2HK8A 2FZLA 4FW8A 4IKEA 4KQFA 3OMGA 3SSNA 4CL8A 1JAXA 4FHGA 2WTBA 1IQPA 1BA2A 1ICWA 4B2PA 2N1BA 3CPHA 2QG6A 4LQ4A 3A55A 4B87A 3K3PA 4UW9A 3TP8A 2GMWA 3VI3B 2RHWA 1REQB 3GFOA 4PBSA 3VNSA 3PUHA 3C1FA 1ZO8A 4QRIA 3PNSA 4LCBA 3SCZA 1S5BD 3G2QA 3IPAA 1KIFA 1GPH1 4ZZ2A 4LJSA 3PHIA 2Y1FA 3PQ6A 3RU3A 1ULUA 4PZUA 2CXQA 1GAXA 1WD0A 2YW2A 2OHOA 2ZJ0A 3ZDBA 2PO5A 4JLDA 4L8WB 3WOHA 1G18A 1E9VA 1ECCA 4NVRA 1VLQA 4QRDA 1QK5A 4Z1MA 3I70A 3WIVA 5KEIA 1G42A 1ZYRD 4A3GG 5F2OA 3AOGA 1TW3A 2VP4A 4XWGA 1RRFA 3CVXA 3UHJA 4CMJA 2H5LA 2F9FA 4Q3DA 1C4KA 3N0VA 1AXRA 1F2UA 1OA0A 4ZKCB 4XYOA 4BO5A 2EF0A 2N1MA 3DLAA 1W47A 4M8LA 3LZCA 3ZLJA 3HXKA 4PLVA 4B6JA 3N2IA 2ZZNA 4TV8A 3BTVA 1UT5A 4AMUA 1HQYE 1DL5A 3MCVA 1H5UA 3FIJA 3QPBA 1T8TA 4GR9A 2QILA 1YTLA 4US1R 4X9XA 3H0GG 3M9XA 2DHDA 1KBOA 4RDHA 1XZDA 2WB1G 2ILTA 4IDGA 1WSDA 4K0KQ 3NTOA 4TQGA 1JIIA 3HJTA 3ZTYA 3HO1A 1EQQA 3KUPA 3CLRC 3F6SA 5IDXA 3I8SA 4CL2A 2DWQA 5E1MA 1ZISA 2OD2A 1L6RA 4DZRA 4FFLA 5GP1A 5IT5A 1U02A 4MS4A 5BUCA 4LXUA 4YASA 3SS9X 3WNCA 5HWSA 5TEWA 1CV2A 4BVKA 1TQHA 1F3OA 3CO5A 1JTEA 3DYIA 2KBNA 3OJEA 4NKRA 1S5PA 2CDRA 1PDWA 1ISPA 4LHZA 3M81A 3BVMA 4BFXA 3DEJA 2JIPA 1XIVA 1L7AA 2FMXA 4CPDA 2XMSA 3PNYA 1SVIA 3ZLTA 4OB7A 4X6LA 3ORQA 3FZQA 4INAA 5BYAA 2SKCA 3LBAA 1O6FA 1XN1A 1UEXC 4G5FA 4D74A 3DL4A 2OL4A 3VHLB 3S1LA 1KS2A 1LLCA 4LDRA 1FNWA 3DM5A 3P20A 3AXTA 2BHRA 2EJUA 3GZ4A 1IHPA 1GLVA 2QD4A 4AWAA 4AKGA 3BMCB 4UHBA 1G51A 4JH0A 3L4KA 2IF2A 3O5AA 3G0OA 3L4JA 2XYQA 1GUYA 3HO6A 3RJ9A 3E4CA 1HDXA 3FWKA 4Y2RA 3GJXC 1F2YA 2IS1A 4R9WA