2IT1A

Structure of ph0203 protein from pyrococcus horikoshii
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
362
structure length
362
Chain Sequence
MVEIKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKDRNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVYYKPKYKFVGGFLGNPPMNFVEAKVEDGKLVITEKSKLPIPKQYVEIVKETGITEVIIGFRPHDAEIVKGEGEGIVGEVYSFEPLGREQIVTVSVNDSIVKVFAPEGEHFSFGEKVTIKVKEELLVLFDKKTEKALEFSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords 362aa long hypothetical maltose/maltodextrin transport ATP-b
publication title Structure of PH0203 protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
total genus 98
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2it1A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2it1A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2it1A01
2ZTDA 1A6XA 2IX1A 2FU5C 3PG5A 4QHTA 3R8CA 3U7HB 3BJUA 4I7ZC 1Q1EA 4DR5Q 1FFHA 4JMPA 1OFTA 5GAHC 1Q22A 5HY6A 3PEVA 2GXUA 5C4MA 4Y0VA 4U00A 2ECKA 4DAYB 1R5NA 4E07A 1OXUA 3M4OH 2YOHA 4A3BH 1JB1A 2UUAL 1GZSA 2AHOA 2EQBA 2QENA 5HTKA 2FMXA 3RAPR 1VHLA 3CLVA 2HHHQ 1Q90A 2YV5A 4JI1Q 5LMNL 5JJKA 1RJ9A 3OFND 1TF2A 3D8BA 2LMCB 1E2EA 2VPPA 2QL6A 2JA7H 1IBRA 4IQZA 4LWCA 1A5TA 4BFSA 2R6AA 4LBWA 1TWAH 2H5EA 4TWZA 3ZVLA 2IS1A 2R2AA 1KO4A 3CCVA 5AWFC 3VX3A 2O0JA 3CCRA 3J81c 3UIEA 1D7QA 2D3WA 4Q4AB 2HF9A 4DV2Q 1EFRA 4HAUA 2JLYA 2BDTA 1F2TA 2B8WA 4QFMA 3DXJC 1Z22A 2I0QA 4NXNL 4CEHB 2FZLA 3HR7A 1GSIA 1XD8A 5F9HA 2AR7A 2ZRGA 1YZQA 4AG6A 2FNAA 2VO1A 2JLZA 4B3FX 3I92A 1VQGA 4EDHA 5KSZA 3HKZE 1HE8B 1B8AA 2R93H 3U44B 3OW2A 1P5ZB 1Q3TA 2V1CC 1DARA 1Y8NB 1JR3E 4EPXA 1YZNA 2ODWA 4GZLA 1SRUA 4MRPA 5TXGA 2K50A 3ZVRA 3T1QA 2MNAA 4AKGA 3H0KA 4HJ9A 1CR0A 2Q3MA 3E9IA 2HV8A 2N8NA 5EE5B 2GA8A 4D2IA 4ESHA 1VQ9A 1IBLQ 2JXMB 4Q1EA 2A78A 4FWIB 1W47A 1U81A 1IONA 1GOTA 2ZYWX 4GOXA 2IYRA 1V5WA 5M3FH 2F43B 5P21A 4OK6A 5J4VA 2E8GA 2W6JA 4OXPA 1E2IA 1XRJA 4LHZA 2ZAMA 3TUZC 4YHHQ 1KSFX 4JI6Q 1Z6HA 3A7LA 1G5PA 4JJKA 3NIBA 2WSSD 4KN4C 4JBJA 1T8TA 1MO4A 5LMUL 2N46A 4K81B 5FTKA 3U3KA 3LAWA 3G71A 2ZE5A 4EFLA 4A3MG 1K0RA 3K8AA 1PLLA 3IQWA 2Z6KC 3CBQA 1H65A 5DLQC 1O87A 2OAQ1 4HJ5A 3QG1A 5FBQB 1K8OA 3ER0A 3HOXG 1HNZQ 2AXNA 5TB5A 4XIGS 4GNXA 4DUGD 2B6HA 2HJGA 2NGRA 4A0FA 3CC2A 1N33Q 2E2IH 5IYDH 2JEBI 4GLVB 2GDJA 1W36B 2PX0A 4GN3B 4D0LB 3U4QB 1TXYA 1AH9A 3GLHE 4DUYL 4WVFA 2J0QA 2PNHA 4F91B 3QXCA 4L5QA 3W1BA 4QQBX 1QBKC 2PZFA 2Q21A 1DEKA 3T1YL 3PUVA 2ZAOA 3CNOA 1N5JA 3NHAA 3SFZA 4QIWE 2R6GA 2ZSDA 2OBLA 2NVYH 1ETUA 1Z6TA 5FFMA 3KOJA 1T3SA 4Q4JA 3D4RA 1N9WA 4LJZC 2UZ3A 2Q9AA 2J45A 1AIPA 4Q5IA 4FW9A 4KI0A 4DNRB 4IJHA 5CLLA 3AGPA 4G7ZC 2JLVA 4OQLA 4JC0A 2V1XA 3KJOA 2BMJA 4C2MH 2QAGB 3TREA 4BBSG 3PSIA 2J7PA 3PFIA 3U2QA 3ICQB 4WAUA 1IBLL 3I4MH 2ZI7A 2PPBC 3GTPH 1MH1A 1K83H 4AG5A 4BPBA 4BY7H 3HOWH 4PO9A 4P71A 2O8FA 4IFDH 1KI7A 1M7HA 2KCCA 4PSKA 5JRJA 5AUPB 4R71A 1FQJA 4P3YA 1RC8A 1F48A 2J1LA 1YE8A 4JI6L 3EPKA 1SVWA 2GXSA 2YKGA 2PEYA 1ODFA 1XD2B 1XTQA 2ZR0A 2BV3A 5E3HA 4D4KA 4JLBA 4EQ5A 3LBNA 4DR3Q 4BZPA 4ZKEA 3EZ7A 1TU2B 4A3EG 2GJSA 4NMMA 4Q03A 3W6NA 3VDYA 4JBKA 3DHWC 1VF7A 5FJ8H 4X66Q 4V0MA 1FNNA 2ONKA 2G9NA 3BRWD 1TL7C 4E09A 5CDFE 3RN2A 2C78A 2WIBA 2DWPA 4DSUA 2QBYA 1KO5A 4PFSA 4ARZB 1BYIA 3LXRA 2NQ2C 5C4GB 5M3MG 4LW1A 4L5SA 2IYTA 1WMSA 1NLFA 1WA5A 1BMFA 3L0SA 5TDHA 3GDEA 2R92H 1OYYA 3CRVA 2X2EA 1KYIA 3TQFA 1LVGA 3DLLA 4U7DA 1QG2A 1YKSA 4EJSA 4NYJQ 3SEAA 2XZLA 2DFLA 4TL6A 1HNXL 1PMRA 1Q57A 1ZW6A 2GVZC 3NBZC 1XJVA 2PT7A 1N6KA 4LZZA 5B58C 3QY0A 4LF8Q 1CP2A 3V4FA 2EYUA 1A2KC 5K8LA 5AJ3Q 3DZ8A 3GFOA 1Z47A 4KODA 1DG1G 4GT1A 1H8HD 3QUSA 1X86B 3QBVA 2ZQ5A 4TQAA 1HT1E 3TAHA 1W36D 4NCHA 5L3RA 2CEAA 1CS4C 2FA9A 5B30A 2ZJZA 1PHJA 1AN0A 3KLWA 2ZE7A 3FB4A 3VR5A 2C9YA 3IUYA 2GK6A 3ULJA 3WWVA 3K70B 1ZUIA 3AF2A 3B6YA 3B1ZA 2IYSA 1N36Q 4AKEA 4UNPA 3J81k 1VQJA 1VIYA 2ZJRA 2WVJA 3HP1A 1VYTA 1SVKA 2ODBA 2JGNA 4UNNA 3QXHA 3TK1A 4GP7A 1YZTA 2JA1A 3NBXX 4HLCA 3U7EB 1OXSC 2V4ZA 2GHIA 2IS4A 4DV5L 3TS0A 1W3SA 1E22A 1YZKA 3X1YA 2JLXA 2UU9L 2GCOB 4DDVA 5C44G 4DLUA 4QC2A 4CEIB 4YDHB 1N5KA 2FSIA 3W34A 3K0SA 1I2DA 3EA5A 4LV6A 1E9AA 1PYSB 2QPOA 3GMTA 1BIFA 4BASA 4KHZA 1LFDB 1UEIA 4BBRH 1SXJA 4PQRA 4OK5A 4JVNA 5FTLA 1Z0JA 3B85A 5JEEA 4GOPC 2ZRPA 3S15H 1B7YB 4O2RA 2IS2A 4KFRA 5M5YH 4WJ4A 2CWAA 2J9RA 5C4XH 3D6TB 4LF9Q 1VG1A 1X6VA 1FQKA 4DPGA 1W46A 4D25A 2W83A 1P60A 4NYMQ 2AFIE 1YVDA 4DNIA 2ZE8A 5D3MA 4NCNA 1VPLA 2XGTA 2PCLA 1VQKA 2DWQA 3K0EA 3QKSA 2EW1A 2R6CA 5GADC 1F2UB 1A63A 4AC9A 1E69A 1NIPA 2N42A 3CPHA 1EESA 1HURA 2D06A 5JHGB 3QBTA 4WBSA 3RABA 4LYAA 3FKSD 1CEEA 4L8GA 4I1SA 1ANKA 3WRYC 4M1KA 3KQNA 2CJWA 2FSHA 2ZJ5A 2ZT9C 2KHIA 3OF5A 4JVLA 3F1ZA 3K0CA 3ZD7A 1GNQA 3KQKA 3RS2A 1PV4A 3FFBA 3H4MA 2DR3A 4A3JG 1GUNA 3SBEA 1UBGA 2ZRKA 2PH1A 3R8FA 1ZNWA 1NMZA 4PZ8A 4KFSA 4PPQA 4C0AC 3EZFA 1NP6A 1RZ3A 2GESA 3GLGA 3K70D 3UDXA 4NYIR 2FSFA 3TSWA 4CEJB 2JQOA 2C8VA 4BRWA 4URVR 1OLOA 1XNJA 1G4AE 1OIXA 1ZVQA 4S2EA 1NI3A 1KJZA 2HLDA 4A1FA 1DCZA 3ADBA 4PHHA 4QGGA 4M1OA 1DELA 1N5LA 4IJLA 2MSCB 2VHTA 1JJVA 2VNUD 1N6NA 1KZ7B 2FXQA 4EUNA 1NF3A 1NMGA 3RS0A 3AVYA 2W2XA 5TY0A 1UJ2A 4EAQA 1XX6A 2RB4A 2ZRMA 5H8WA 4MTNA 1SVOA 4A75A 3PUXA 1U8AA 2EFHB 2VH5R 4ME3A 2ZRDA 3VTKA 2PI2A 4HDCA 2ZU6A 4DLVA 1UE5A 2R9VA 4IO9A 3UPUA 1YRBA 4JVSB 2D0OA 1A4RA 4V03A 5DIFA 5IP7H 2IEYA 3Q5EA 2OTLA 5AUNB 4A6XA 1I94Q 1D2EA 3OE7A 3QXXA 3THYB 3TVTA 3CH4B 4OYHA 1MABB 2IYQA 4M1MA 5DGXA 5FUWA 3S1AA 4TT3A 1JR6A 4M9QA 1Y1VG 1Z9FA 1UBEA 1Z08A 3EQLC 4DHEA 1MRSA 1OH6A 2C96A 4LPKA 3A74A 1F5NA 3W6OA 4B35A 3GJ3A 1CR4A 4TN1A 4RZUA 3CMAA 3AF4A 2TMKA 2ZRCA 5IWAQ 1OSNA 3SYKA 1S1MA 2NN6I 1Z0DA 1C1YA 5AK0A 5EE9A 2CVFA 4IXNA 4K46A 2OLJA 3RNUA 1XMOL 2X2FA 3B1VA 4X64L 3BB1A 3E70C 4YCWA 1D2MA 3K7UC 1HEIA 1GKYA 1VCIA 1XCMA 3CPEA 4B3MQ 3OZXA 2HUPA 4LK1C 3VR2A 4JSYA 3U5ZB 2FEMA 2BA0A 2XOKD 2EJMA 4URUR 4TZ0A 3HOVH 1ZIPA 1P6XA 2ZTSA 3LBHA 1T5LA 4Q4HA 3REGA 1FMLA 2VEDA 1Q46A 2A2ZA 2OAP1 1VQHA 3M1IA 4PPNA 2EVBA 5A0FA 5DN6D 3EZ2A 2RGEA 2X1VA 1HJPA 4IXMA 1UEJA 3ZZ0A 4JI3L 2P6NA 3W5IA 1YNXA 4DNTB 1MO3A 2BBTA 1Q1QA 1K5GA 3AB3A 3DVLA 4D4JA 4CEHA 1U99A 4NXMQ 1U2RA 2UKDA 5JHHB 2EVWX 1UBFA 2GEUA 4FINA 5DI3A 1MIUA 4R4QA 4DR6Q 2ZRFA 3WBKA 3R9XA 4C0BA 2HIVA 3A1VA 2O52A 2EJFC 4GN5A 1CKEA 3A36A 1WRBA 4HI0E 2A68C 3JAMi 4GMDA 4JLVA 2JA5G 1VKJA 2A3RA 1UAAA 2E1RA 5TVKA 3UXMA 4ACBA 2ZRAA 5BR8Q 2VP6A 2ZJBA 1F3OA 1RJ9B 4XD7A 2ZM6Q 2V54A 3BDOA 1U9IA 2WJHA 3CW2A 4IDOA 1XMQQ 4YONB 4ZV4A 2JA6H 1KKLA 2DYKA 1RFLA 4AURA 5IWAL 4IEIA 1KC8C 3FKQA 1AGPA 2VHQA 3IO5A 2JLQA 4NPHA 4BFYA 4M2LA 2ATVA 1HA3A 3ZS8A 1A1VA 1R7RA 3S1QH 2NVQH 3MWJA 4JSTA 3NBHB 4GPTA 1YZ6A 1RRCA 1XFAA 3QPUA 1F2TB 5BYKA 4RCYA 4HAYA 2X77A 3I56A 3G5UA 3Q7PA 2Q2IA 5C4JH 4UNSA 3K9GA 1G19A 4B44A 1N0UA 1GKUB 1JXMA 3VR4A 3AVUA 1NIJA 3QXJA 4A3KH 3GJXC 4CT4B 1UKVY 4IOCA 5AUOB 2G88A 2RH5A 3K9NA 2A69C 3S16H 1SHZA 2ONJA 3ZIAD 5C18A 1EOVA 4TYYA 2WAYA 5IP9H 3GLHB 1UPTA 4XTRA 3U58A 5J4LA 4HR7B 4AQYL 3BC1A 2F3IA 3UK6A 1BYUA 4Q7KA 2AUKA 2ES2A 1GL6A 1KK2A 3LV8A 4ZDIA 1TWHH 2WJIA 4JLNA 5B57C 1WBBA 2HF8A 5JZVA 4V0NA 4V0KA 3NEMA 4DAMA 4BFXA 2GAOA 3LGJA 2NZJA 3L0PA 2UXCL 1S96A 3QSYA 4DKXA 2C2HA 1R8QA 5CM9C 2JASA 821PA 4LHYA 1I4DD 1XBTA 2XZPA 2WTUA 1DXMA 1SVIA 1U0LA 1KI1A 1NSFA 5JSZA 2E2HH 2WP8J 1TQ4A 2EYQA 2WPDA 4M8NE 1ZNXA 1E0AA 4YWKA 3KLRA 1SZPA 1D8TA 4A3FG 1E9DA 3IGFA 1EFTA 3G82C 2E87A 2G3YA 4A15A 1P3JA 3BFKA 4O2LA 1II0A 3OIUA 4OI0A 1KHTA 1XEFA 4C2UA 4LF4L 1ZMXA 1SXJC 4GNXB 1W5TA 2IL1A 1GO3E 2IXFA 1VF5C 3MXUA 4OGQC 1VQEA 1RVDA 1Z0KA 3C5HA 1HZ9A 3CKLA 3LO5A 2O5IC 1DVRA 1S8FA 1XD2A 2NPFA 5F3WB 5M5WH 1ZC3A 5G40A 3S2DH 2QY9A 4XVUA 5KHOC 1L4UA 3B60A 3CZQA 3J7ZC 2KBEA 3PIPA 3IEVA 1XD9A 2DFTA 1XU4A 4IOLA 5IT5A 3ZYCA 2QA5A 3IIMA 2F4VQ 1P9RA 1EFRD 2BEKA 3U50C 1QRAA 1D8LA 1ZYUA 4HLDA 4QRHA 4A0RA 2V1UA 3FTQA 4BFWA 4GI7A 1GNRA 5EE3A 4OWTB 3GFPA 1B0UA 1NN5A 2WWGA 3GD7A 2JA6G 3KXLA 4HIKA 2VRWA 2KB0A 3RR5A 3TMKA 2L5TA 1SN8A 4A3DG 2G1KA 4FCVA 1KO1A 4DV7Q 3RSLA 4DSNA 5JI3E 4B3RQ 1I6HH 3K0CC 5FPHA 3LNNA 1T0JB 1Y1WH 5GJCA 4Z1MA 4A0HA 2OG2A 1CKMA 3FMOB 2ODNA 2PBRA 1YR6A 3SGIA 4P4TA 1E1RA 3WMEA 3IPXA 3KFUA 1DAHA 1EWHA 4LCBA 2DPXA 4B47A 3CP0A 3Q8XB 5FTNA 4GMXA 1NN1A 2RHMA 3A8IE 4P74A 3V4RA 2RCNA 3GPLA 1R6BX 2W2VA 2W6JD 1HYQA 1AM4D 4IRUB 2QRZA 1AS3A 4JLOA 5E7JA 4UP7A 5EUMA 3PEYA 3B82A 5FUXA 3HU3A 3GCGA 2CHQA 3M85A 1EQRA 3W8RA 1O7IA 5A35A 1P2UA 4RD3A 1PH5A 1WF3A 4OI1A 4OO1G 4Z54A 2BEJA 4DT1B 1PFSA 2R65A 4D0NA 1NNEA 2IWRA 3CRW1 4EJSB 3F2CA 1ZM3A 1PYBA 2ZTCA 1DE0A 1KI6B 2HT6A 4CEIA 2ZS8A 2DNEA 3RLFA 1S3OA 1EGAA 4HATA 2BCGY 2HDNB 4Y7NH 4DR4Q 3TIFA 4N3NA 1QHXA 2O8EB 4IKEA 1VQ6A 5GJBA 2H8KA 2WWFA 3HDTA 4P75A 3JVVA 5FTMA 1DD2A 3PO2G 1SROA 1KY3A 3DM5A 3SBDA 3T12A 4JV5L 4B6FA 5K8TA 2K5NA 3BBPA 2N49A 3M4PA 4M9ZA 3VA7A 4PPGA 4Q7JB 3AQ4A 3NDPA 5KOYA 1JAIA 3STBC 2X8AA 1G17A 3KQLA 1K5DA 2G83A 4IOKA 2B63G 1UDWA 4QHYA 1Q12A 4RZ3A 1SULA 4DIEA 3KJEA 1EX6A 1UF9A 1ZBDA 2OWOA 3NVAA 4DRZA 3BFVA 1ZD8A 4I1OA 1IN7A 3K09A 4PO8A 3S1MH 2J7PD 4KBFA 4GKJL 3CX6A 3EPJA 2OESA 1F2UA 1GL7A 4DR2L 4MYHA 4DXAA 3EASA 3CC7A 2GEDA 2BJVA 2H57A 4A3GG 4W5WA 1NKTA 2FWRA 2GWHA 4WIAA 2Z0MA 3CF5A 1P8LA 3BFXA 3T5DA 1D6JA 3LH5A 2CK3A 4MKIA 5DI9A 4NCIA 1NBMA 2NN6G 4TMVA 1N6LA 4JKIA 4KYIB 3F2DA 1ZP6A 3AVWA 2Y0SG 2QQEA 4TTQA 2OFOA 3X1XA 4GNKA 5CIWA 1XMVA 3H0GG 1C7YA 4TL8A 4P4UA 3GEHA 5FPYA 3UWOA 1EUJA 4LJAA 3CAMA 4F7WA 4CZ2A 2HYIC 5BN4A 3GTLH 1E32A 2XTIA 1GUAA 1ZCAA 4JLKA 3AKCA 3CO5A 4IPHA 1MRNA 1IN5A 2QUZA 3N2IA 3NKVA 4IOJA 4JBYA 4TLCA 3VAAA 3A0JA 2V7QA 2XNSA 3U3MA 5D3MB 4TL7A 1BMFD 2AWOA 1CBUA 1TUIA 4ZI3A 2ZJYA 4RCNA 3FP9A 3B5JA 1Z6GA 3QKSB 4EPYA 1FPMA 2AK2A 1HQCA 2RF4A 4LC1A 3A7AB 3J80i 3S14H 4JOIA 1LYLA 3DDCA 3H3VI 1E99A 5JJIA 3FPAA 4KFUA 3THXA 1JPJA 4PAOA 3K9HA 4L5BA 1YIJA 1XEXA 2WWYA 4I4LA 3FMFA 1Y63A 2R7DA 3CW2C 1J70A 4H44C 2CJWB 2JJ8A 4B76A 4DCVA 4YMVA 1ZKOA 1QHYA 2IHYA 2NO9A 2A69D 2R6DA 3DMNA 4LJ8A 2XTMA 3HGBA 2HT1A 4TMKA 6Q21A 2FDCA 1FUUA 2WOJA 4RVCA 2WFWA 1VCNA 2VBCA 4PC7A 3THYA 4LJ4A 3CX8A 4QY7A 3PITA 1NG1A 4KXFB 1GILA 3CPFA 1O7LA 1Z8FA 4JI2Q 3UDGA 2JCSA 3K0FA 2F1MA 4RKFA 4DLZA 3K0XA 2RHSB 4NPSA 2FF7A 5EUQB 4GLXA 4DR7Q 3RHFA 5IDVA 1PH9A 1R9TH 1KK0A 3AVPA 1H9JA 5JS8A 1TU3A 4F93B 5KNBA 2ZI9A 1TQ6A 1UKZA 2XZOA 5IRCD 2QEQA 4MUBA 1OF1A 1H9MA 3MSXA 1P61B 4OBEA 1E9BA 5FOSA 5EZ6B 3U6KA 2PMZE 1E1QA 4BLSA 2NVTH 4MA4A 2QTVB 5FBVB 5FPSA 3P26A 1W36C 5H1SE 1IBKQ 3AVXA 1TWFH 4B3DA 3CF2A 5HE9A 4YWMA 4DUZQ 1Q3HA 3VNVA 3RS5A 4DCTA 3WP0A 2ZRLA 3BWDD 4MNOA 2BA1A 2EWVA 5ELNA 1YHAA 1A7JA 4A3MH 1E2FA 2A7QA 2NO7A 3P20A 1MKHA 4HIOA 3EG5A 3R7WA 2QP9X 1A2BA 3UE0A 2NO0A 1IL2A 3MGCA 5KPJA 3P4YA 3HOXH 2A6HD 5FBWB 5HR5A 2PEZA 4P72A 4R2IA 2QAGC 3ZS9A 3E0EA 4EFMA 4GS3A 5AJYA 4JI5L 1N34Q 5M5XH 3X1WA 1G4UR 2H7VA 4DK1A 2CLCX 4LF7Q 4JLJA 1DBSA 4HDOB 1JR3A 1N6HA 1XZPA 3E2IA 4MYCA 5DO9A 4M0LA 3SJZA 3SJAA 1N32Q 2OZEA 5FOUA 4PSAA 3RNLA 2EFGA 3C15C 2ZI3A 2RGBA 3T5GA 1W4RA 4JLDA 3BD9A 3X1ZA 3U7GA 1CKOA 1G7TA 3UE1A 2XB4A 4DR7L 1PJRA 3HOZG 2ZYUX 3EAQA 5CB6A 3FHTA 1D5CA 1T3HA 1E2HA 2A5FA 2UUBL 1S3SA 2VQEQ 4BBSH 4Q4HB 1JXOA 3CNLA 5E4FA 1FL9A 4A2QA 2V6IA 3C41J 1XCGB 4Q66C 4DBLC 1Z7TA 2ID0A 3FVQA 4Q9KA 3PQCA 4LV5B 4C7OA 2UVQA 2QN6A 2AKYA 4HJAA 5ELOA 2HLDD 3UG7A 2LSSA 1X8KA 4M1TA 2YINC 3CX7A 3QI2A 4XWAA 3DM9B 5CM8B 5H68A 4TZ6A 2XNDA 1ZUHA 2IF0A 3BGWA 5DI3B 2DY1A 2JJQA 4A3EH 1XTRA 2ORIA 3BH7A 4YMTA 5E7NA 1S3GA 5HZHA 2V9PA 1Q82C 3IHLA 1E4VA 1N6OA 3NG1A 1EG7A 2F1HA 2WWWA 3AUYA 4G7OC 3KF8B 2ZRIA 3L8YA 1PH4A 1TEXA 1IHUA 1U8ZA 5M3MH 3B9PA 1HTPA 3GTKH 1OFIA 1OFUX 1IW7D 2G77B 3C14C 3GLHA 1EQQA 3CCSA 3QIAA 1DS6A 2Q2HA 1LF5A 1X3GA 4DR5L 4DLWA 2Z83A 5FOWA 1G5RA 2WJVA 4YC7A 1NLYA 3K70C 2C77A 2PNRC 3BERA 3OE7D 1QF9A 3SC3A 1E2VA 2QG6A 3OTOQ 3G0HA 3VQTA 3RZOH 4TT3D 1YNJC 4WJ3M 1DAGA 2VLIA 3B78A 3SYLA 4DCNA 4BFUA 2HHHL 2PT5A 4JI1L 3STBD 2OILA 1GRNA 2QORA 4OHVA 1Z3IX 1G3IA 3KB1A 4O2DA 1E2PA 1VYVA 2E2JH 2YWFA 4EPRA 1J6QA 4Y52H 4ABYA 1C4OA 5B2ZA 1MT0A 4ITRC 3DEFA 4BLRA 3D31A 3EC1A 1E9CA 2OQKA 4R7ZA 2ALYB 1GFIA 4QXAA 2DFNA 3AKDA 4YQFA 4XWKA 1ZNZA 1TKWB 4A8JB 2AL7A 3RS7A 2W6IA 5G53C 3I72A 2K75A 5GQOA 4DV2L 5JMTA 2R7ZG 1KDRA 4DK0A 4CYMA 1Q1ZA 1Q44A 1VDZA 3GO5A 1YITA 1D9XA 1SVSA 2F3TA 1E2NA 3EN2A 3KL4A 1Z0FA 2O8BB 1GIAA 2IYXA 5CDFA 2CHGA 2JJ1A 3S17H 1M1YE 4LV8B 1I6VC 4C3JH 3TRZA 4LUZA 1QJOA 3K81C 1HH4A 1PZNA 1ZIOA 2PMDA 4ZI2A 5FPKA 5JS7A 4BLTA 1K8GA 4APVA 5C44H 1CJVC 2RGNA 2WHXA 4RD1A 2KBNA 3R9WA 3TKLA 2EWWA 3WDNA 1HCZA 1R8SA 1YRAA 4PHFA 4B32A 2O8DA 4QNRA 4WZ6A 2IX0A 2R62A 4M1WA 1TX4B 1WI5A 5JSZB 1W2BA 4UJ5A 3THWA 2J0SA 3AVVA 5IY0A 4XJXA 2J0UA 3EBEA 3HOUH 1Y8OB 2YNMA 1NLZA 3UWKA 3KJGA 1E2KA 4XOIA 1VYUA 4EKDA 1IQPA 4V02A 2OQ0A 4G5RA 1CR1A 3U60B 1UKEA 1GM5A 1ZC4A 4IDQA 4D81A 4IFDJ 2FN4A 3AF0A 1VHTA 1GUTA 4ALPA 3CM0A 4YHHL 4XD7D 4US1R 4TQUS 4PR0A 5F98A 1CULC 1JECA 4H13C 5AJWA 3VU9B 1OTCA 2AWNA 3OEEA 1QVAA 1P9NA 1AZTA 3OEHA 3UDFA 4NONA 4LF6Q 3LQRA 1E1TA 5JBQA 1E79A 4Q9JA 4X8MA 5AJXA 2E5LQ 4JI0Q 1KNQA 3OAAA 3Q5DA 1HNZL 1ZM7A 2PL3A 4URZR 4XTCS 5JCZA 4B3BA 3LLUA 4FI3C 1EWIA 1JJCB 1N33L 4AIIA 2IHBA 2ZJ2A 4Q9LA 2GVDC 4WA7A 2VS1A 5LB2A 1GUSA 3DL0A 4A3JH 4DT1A 3AP3A 4Q01A 4PPFA 1X8JA 5HKKA 1KI6A 4JCVE 3L0OA 2B8TA 2YTVA 3BB3A 4DDUA 2VY3A 1C0AA 3I2ZA 2OHFA 4QJ3A 1I2MA 3HR8A 2O8EA 2VZAA 2I3BA 2FGKA 4OJQA 121PA 5H1YA 1DAKA 1UE1A 1VQ4A 2QT0A 4MRNA 4ZPXA 1TWCH 1E0KA 1NVVR 4D80A 2D7CA 4AYBE 4NE2A 3PUZA 1EIFA 1BO6A 1GRRA 2FG5A 1W48A 2JIZA 2Z43A 4HB2A 3AH8A 1TU4A 3AVQA 2C35B 5IYBG 4JI7Q 4ZCIA 3QKTA 5HE8A 1XEWX 1ZM4A 1MOZA 3NELA 2C5LA 4D4MA 1NMFA 2KWIA 3EWSA 3W8NA 2F1IA 4B3TQ 3T34A 4DEYA 1II8A 4JLAA 2V3CC 1Z2CA 3U6BA 2WPDD 4BLPA 1BVSA 5EAYA 4DR3L 4W7SA 3SYNA 3CUEF 4QL5A 5G3ZA 4X66L 2CDNA 3U61B 3KQUA 4LHVA 2ZIAA 2W58A 4DCSA 2HCBA 4EPVA 3M7NA 1XEWY 2B8GA 4JI0L 3CZPA 4XSGA 1YHNA 4F38A 4UJ3A 1Y1VH 4IEEA 3LA6A 3HU1A 3UMSA 3GLGE 3CPWA 2O5JC 2KSQA 2RGXA 1K8AC 1VQMA 3EPLA 1E4YA 3Q9LA 2JE6I 1TTTA 2IUTA 3HOUG 2EQSA 2GF0A 1KKMA 1W0KA 1XMIA 1ZAKA 1T9HA 1KGDA 4BQSA 5IYCG 4DK6C 4OL0A 4MKFA 4GDFA 1QZHA 1SLJA 4LF8L 4L5RC 1Q21A 2CW0C 1L1OA 4LF5Q 5AJ3L 4GOJA 1KI4A 4DSOA 1LS6A 4R2HA 3DM3A 2V8OA 1RYFA 3J81i 2VF7A 5GVSA 1JEDA 2GF9A 2WB1G 3QVUA 4UXJA 2F1JA 4KJZA 3K1JA 4DK3C 1M34E 1W2GA 5IF9A 1IZ6A 2C98A 3WBJA 4DLSA 4BUJA 1AK2A 2O5VA 2Z5FA 3TE6A 3NHBA 3SQXA 5L3SB 2XB2A 1PH7A 1IXZA 2WMOB 3HFZB 2GXQA 2WOOA 5FBLB 1RPZA 4L5TA 4Z1MD 3M6AA 3AF1A 1N36L 1E0JA 1R5OA 4DB2A 1W5SA 2Z4RA 4B3TL 3GTMH 2V4DA 1JNYA 1SVMA 5IK2A 2OUKA 5FL3A 4W9MC 3IPYA 1E1RD 4FWTA 3MXNB 1EX7A 3QENA 4BZQA 3FOZA 5UKDA 2DN8A 4MDEA 2CL7X 5M04A 1WXQA 2QU8A 4ZDJA 5KNCA 3E9HA 4I99A 4QG7A 5J4HA 4MKGA 2J7KA 2A5JA 4HJ7A 4MUAA 1VG0B 1WP9A 2WV9A 1KQSA 1N0WA 5K36G 4URXR 2JA5H 4RZ2A 4LNQA 2DB3A 3DKPA 3RRZA 4QM7A 3MJHA 1OH8A 1HQMC 2VUMG 4OO1I 3RC3A 1KO7A 4GSYA 1NRJB 3WXMA 4AKIA 2GBLA 1DPFA 4L15A 5GAGC 1XJQA 2C03A 2BWJA 2WJJA 1Z29A 3KB2A 4JKYA 1OIVA 2VIIA 2XEXA 4BLQA 1YR8A 2UXBQ 1N0VC 3NE5B 5FOVA 5TV2A 4PC6A 2ZEJA 2ZRNA 4UNRA 5CIQA 4A92A 2N3SA 3KKMA 2HEIA 3O47A 3THXB 1G5TA 3U7FB 4TSFA 4Q02A 2GCPA 1XEXB 4LF9L 5C0XJ 1E2DA 1QVFA 2J0VA 4CT5A 2E76C 4A3IG 3HKZG 4X8LA 3NC1C 4ZO4A 3HPRA 3PIOA 2FOLA 4H02A 1HT2E 3SZRA 1ONLA 3JC66 3H1TA 2Q3FA 1LACA 4A3LG 1UDXA 2NZ8A 4H1UA 4MRSA 4PZ7A 3PVSA 2ZJ8A 4X65Q 3FHWA 2BMFA 1XPOA 3L2OB 2ORVA 4IDNA 4II7A 4RZXA 3EIVA 1G3UA 3S1RH 1KMHA 3W5JA 3BH0A 1QHGA 1I5FA 5CK5A 4LUVA 3M3YH 1Z6YA 1X56A 2K5HA 2OFWA 3K0FB 2ZSFA 3MLEA 3P27A 4K8OA 4KBGA 4NCJA 2VA8A 4V0OA 4DV1Q 4DV3Q 1AQUA 2P6RA 1EFHA 1YQTA 1UEBA 2OM2A 1W7AA 1UE6A 3RZDH 5JEAJ 2AX4A 1WCMG 1T91A 2ANCA 3EXAA 4GFDA 5G3YA 4TKOB 1HV8A 4KO8A 2FFQA 4GNXC 3W90A 3QPWA 4NCKA 3SNHA 2EJGC 2VQFQ 4AD8A 1MKYA 5BYJA 3CIOA 1VQBA 2CK3D 3A5UA 4XWOA 2QA4A 1NMYA 1NBMD 2G0NA 2GJ9A 4KKTA 5AUQA 4LUCA 3W3AA 5DYIA 4DSTA 5ANRB 1XTDA 2Q2TA 3I32A 2CMKA 1FX0A 2IYYA 4IVRA 5F9FA 2HCJB 5BWMA 2NIPA 1PH6A 4OX9Q 5SZJA 2QGNA 2F52A 2KHJA 4A3FH 1EK0A 1QHSA 2AK3A 2YC2C 3QJYA 3GFTA 3R7WB 5KDOA 4QJ4A 3W6PA 4DV6Q 1MO6A 2EFEB 5B64A 3AF3A 1GWNA 4AI6A 2H17A 2V7QD 2B21A 4OHXA 4EIWA 1I3QH 2VSXA 1KHIA 2IXEA 4A3CG 5C3EG 4TQ9A 3SU8A 3NTUA 4C3IH 3EPHA 5IT9c 4HJ8A 1T5EA 2F7SA 1I94L 3DO6A 1FP7A 2YVUA 1G1MA 1XNRQ 1VMAA 2ZRJA 4A9AA 4O0MA 4KHPQ 5CITA 2D7DA 2YYZA 3CCMA 4QGAA 4DVGA 4DEXA 3REFA 1IYVA 2QGQA 4EPWA 4DV1L 4QNMA 2ATXA 2OBNA 4Q4LA 2GXAA 1ZD9A 1Q1BA 2F9LA 1Z06A 1KL9A 3A4LA 3GJ6A 1T4GA 4CIDA 2H18A 4TYQA 3T61A 3CF6R 1U5KA 2OT3B 2JA8G 3JVUA 3JZAA 3SHWA 4D4LA 2QF7A 2P0EA 3OHMA 4LY6A 4I81A 4MGYR 4P33A 4ASUA 1CKNA 5HGQA 4A3DH 4CVNA 5J47A 3ZVNA 2QAJA 3NC0C 2VQFL 1G41A 1LY1A 4QBFA 5CLQA 3TLXA 1N2CE 5F2EA 2DNCA 2WSMA 4B3ML 3KDFB 4RFSA 3C7KA 1VQCA 4PO1A 1OJLA 1CI3M 5KO2A 1WOCA 4QGHA 1ZRHA 1LB1B 3V00A 1DGSA 1R10A 4AWXA 4EJSC 2BCJQ 521PA 1WQ1R 4GRAA 4A0GA 4D82A 2E9SA 3BJIC 4JI4Q 4R4IA 1G8PA 1AE3A 3KKPA 1OW3B 1E9EA 2ZYTX 4OQFA 1RE0A 2AMCB 1QZXA 2R7FA 1PH3A 3PO3G 3PR1A 2JEOA 1T8UA 1LM0A 1JBKA 4A8JA 1E1QD 4C3HH 2ZRBA 3UG6A 1KMQA 4OHYA 1Z83A 4F92B 3A1UA 1COWA 3SJBA 1JMCA 2W0SA 5C0XG 4AYTA 2C04A 2O8BA 2G0TA 4NXML 1J7KA 4NB3A 4JYAQ 2C95A 2D62A 4URYR 5FL7A 3LW8A 4OO1H 1L7VC 4DR6L 1BKDR 1FZQA 5LBIA 1IY2A 4RCZA 4ZIRB 1XNRL 1VQAA 1RL2A 5EP2A 4KHPL 1P75A 3QEJA 4IDHA 3A4NA 5BR8L 2KE5A 1UKYA 4M53A 3NBFA 1G8YA 2ZM6L 1ZJ6A 1H9RA 4LFBQ 1UE7A 4R4TA 2GVBA 3CCQA 3PO2H 1XMQL 1HR0Q 3HU2A 4HLUA 3WMFA 3LWNA 1JR3D 3K53A 2WJYA 3KTAB 2Q9CA 1XPRA 4FD2A 1W4CA 5EE1A 5JEAG 3NH9A 2H92A 2AUJD 3PV0A 2ASBA 2GTPA 4ZDWA 1ZYRC 1FVIA 1FL0A 1IJFA 2Q9BA 4D0GA 2B63H 1MV5A 2A5GA 3H94A 2OCPA 2QZ4A 2UXDQ 1LS1A 5J40A 3MFYA 4F4JA 4DV4Q 4MDFA 2NO6A 4G7HC 4JL5A 3VU9A 4HAXA 1GVPA 4HEJA 1K8MA 3HKSA 1KI2A 2ZTEA 1SR3A 3RN5A 1NTGA 1OT3A 2WM9B 3CNNA 2A6HC 3EIEA 3SN6A 4XVQA 1E3MA 4A3GH 2QSYA 1VQDA 3CCLA 4W5JA 1G3QA 2QM7A 1H9KA 4DLYA 2V55B 1GNPA 2IYUA 4B48A 5DNYB 4G5OA 5LPNA 2DFKB 2O8DB 2NN6H 1ZNYA 2AKAB 4HUQA 3I4NG 3LXXA 2GKSA 2XNDD 2QP4A 3THWB 1E9FA 4LBZA 3FYHA 5BXQC 2ZYVX 2J0UB 1S4QA 2NMVA 2CE2X 3H0GH 1PLJA 3KJIA 4HAWA 1HNWQ 4GOKA 4A76A 2F9MA 4YWLA 4YY3Q 3BU2A 3B1YA 3GTOH 3I1FA 1KIMA 5KNDA 2RHQB 2K32A 2CCKA 1KDPA 3BAFA 2ZJQA 2OFXA 3KXKA 5KTYA 3EIHA 2CCJA 1BBWA 3ZZTA 2ERYA 3I4LA 3KX2A 2XXAA 4QJ5A 2BIFA 3MEFA 1FR3A 5A5GA 5LD2B 1JPNA 4JK1C 2JATA 1OH5A 1X3FA 3FMCA 1EFWA 2JK8A 4KCGA 4QGFA 5DYGA 3CRMA 1G16A 1S72A 4BRUA 3B9QA 3AB9A 2WAXA 2ATWA 3DPUA 1FJGQ 2RGAA 1B70B 1KK3A 4WZAE 1TADA 4FCTA 3ZJYA 1K73C 3NBYC 3PF4A 4O25A 5FI1B 2CL6X 2PZGA 1CUKA 4DV0Q 3LX5A 4IJMA 1N5IA 4Q1FA 4BY1G 4A36A 2IUSA 3TSZA 2VHCA 4LYJA 4Y0AA 3G6EA 1F60A 2VP0A 4HUTA 4NZYA 3TJZA 4FMCB 3W1GA 1JQLB 4AYXA 2DHRA 2K5UA 1YR9A 1LTQA 3AV0B 4PC1A 3SE0A 2F4VL 1EXMA 2W6ID 1IW7C 4QBGB 5CK4A 1GUOA 2WBLC 3QXSA 2KI5A 5GADl 2LKDA 3M4QA 4RY2A 2WWXA 2CBZA 1BBUA 4OKSA 2JJ1D 1BOFA 2QNRA 5KSPA 1IYJB 3WHKA 4B33A 1KAOA 2K5VA 3OYYA 1RRGA 1XJ0A 3AGQA 3KUDA 1EWRA 3OIVA 4NYIQ 3H84A 4AH6A 5HZKA 4IPDA 3CRKC 2XSZA 4DV7L 4Z8YA 3DOFA 5FR1A 4B3RL 1E2MA 4TMTA 4TYPA 3VX4A 4B3SQ 2P3SA 1GKHA 2LCFA 2ZE6A 1L8QA 4LFAQ 4OJKA 3PEWA 5KDDA 1II8B 4IW3B 4OWXB 2BE5C 1UBCA 3CRQA 2PQAB 1M1KC 2Z6KA 3T35A 2IS6A 4BXXG 2PJRA 2ZPTX 2REOA 3PGZA 2IYWA 3T1VA 4BWYA 4DLXA 4ERNA 5A4JA 4KN7C 4O3MA 3CCUA 4L4UA 1VQ7A 1Q8KA 1DAIA 5L3SA 3F3YA 1VECA 1FJGL 4LSGA 2WIAA 3E1SA 2ZITA 2AKWB 2D2CC 4Q1DA 3IEUA 4A93G 2IX3A 3S1NH 3OIWA 1E2LA 2OCYC 4G3XA 1QVGA 3H15A 3EARA 1W4AA 3OW7A 4GLAC 2FPLA 3VHLB 3OEED 3L2PA 2ZM5A 2L15A 1EYGA 2F3RA 4WXRA 2BOVA 3OEHD 4DR1Q 1AKEA 3B13B 3GJ7A 4RD0A 1E79D 4PSVA 4QL3A 4ILEA 1RKBA 4MQBA 4UNQA 5JWRA 3OAAD 4DR4L 1ESMA 1L1OB 2RMKA 3C5CA 1GTVA 1P7CA 1I4TD 2HJVA 1ZINA 3IRBA 2B7BA 3TUIC 2JDID 2QI9C 4NYJR 3HOZH 1FP6A 5DHFA 1CU1A 1US8A 2GJ8A 1ONBA 2YZ2A 4OQNA 4UP9A 4OQMA 4PXAA 3RYTC 5HKKD 3EIQA 3IILA 2XTZA 5DLQE 1W44A 1W0JA 1VIAA 4C30A 3Q3JB 1BDOA 4RG1A 2MMGA 2VF8A 5FLMG 1U9IC 1E3PA 1GKIA 4BZXA 1M90C 1GAJA 2PJZA 5EXTA 1WE2A 2K7VA 1HZCA 2VW9A 1P2SA 2JIZD 3TR0A 2HIXA 2A30A 3MMPA 4HB4A 4JYBA 4LC0A 1TNDA 1GG2A 4PHTA 5KDLA 3ADCA 1I4LD 3KJHA 4MGIR 2RHDA 4CGZA 1NJIC 4LOAA 1Q0UA 4BEJA 5FI0B 4JI8Q 1VQLA 2OE2A 4LDJA 5EE0A 2MO0A 4X8HA 4R4OA 3AVTA 1AA9A 1E2QA 1NY6A 4HIDA 2B7CA 4IFBA 4LYFA 1AS0A 3ZLJA 1HQYE 4HAZA 1TAGA 4POFA 1G6OA 4PZZA 3GQBA 4L8JA 2G6BA 1X8LA 2NO1A 3CPJB 4A8JC 2ZSEA 4DR1L 3PEUA 2QSZA 3BZCA 3T1TA 2CLDX 3AKYA 1XZQA 2FFBA 5CB8A 2IBMA 3MWLA 3U3RA 4MKHA 3JZMA 2P6UA 3F5FA 3WHLA 1R0YA 4C0JA 3I61A 1N6RA 4A6PA 5L8VA 3MRSA 3QQ5A 4TMZA 5IHPA 4A4IA 3OPOA 2UUAQ 4KMUC 4GZMA 2NG1A 4B75A 1SHKA 2JLSA 3B7GA 1V1QA 5LMNQ 1W0KD 3K0AB 1GL9B 3RLNA 3ASYA 2PMKA 5J4KA 2IHEA 5BW8A 2HQLA 1Z5ZA 4NYMR 3EX7C 2D2EA 1S0UA 3U3OA 1SVLA 1KMHB 3QF7A 2WWHA 3PXGA 1R2QA 4PHGA 3LNCA 1S2MA 2FPMA 2R7ZH 4N0EA 4UQOA 4ESVA 3T1OA 1IBMQ 3BXZA 1P9WA 3NEYA 1Z28A 2GJAA 5E7MA 1Y14B 4LUOA 3QKRA 1T3LA 3CC4A 3TEHB 3I62A 1PUIA 4Q48A 1W4BA 2C99A 2QEXA 1R0XA 2ZR9A 4IVQA 3I3SR 2CNWA 1YBYA 2DWOA 1LABA 2QQ0A 4NXNQ 4P0TA 4RD4A 1N6IA 2B8FA 3RS4A 4H0LC 4CF7A 5K8IA 1SE8A 4JI2L 4IFDI 3CCJA 3GLIE 4HAVA 5IK2D 1WFQA 1A82A 3WY9A 1OHHA 3ICEA 4PTLA 3AP1A 4GOPA 2AFHE 3B2EA 3ADKA 3F2BA 3RANA 1FX0B 2ZJOA 3BE4A 3MAAC 3RSOA 4MRRA 2KJQA 2VL7A 3MD0A 2Z4SA 5EQTA 3BG3A 3T56B 2H16A 2WKQA 3FKIG 5FUYA 3O8DA 4DKAC 4PZYA 4PZLA 1XMSA 2Q3HA 1PH1A 2VP4A 3LY5A 1IBKL 3KDFA 5HCIA 2CCZA 3DZDA 1AJEA 1R0WA 2BHRA 2ORWA 1RYHA 2D4HA 3NXSA 4N1AA 4DUZL 1NVWQ 3LFUA 1VQPA 3QEOA 4FCWA 1B9NA 5TARA 1XTKA 2BDOA 2FEOA 2ZRHA 1CRPA 5JFGA 1Y69U 5J4YA 3GTQH 4P73A 2CE7A 4Q47A 4X8OA 4TSFD 5GJWC 3KJPA 4KU4A 3GTGH 3PUYA 5LMUQ 2UZIR 5EXXA 4F4IA 5FUVA 1NL3A 1G6PA 1YZUA 221PA 1QG4A 3ZZUA 4X62Q 1OV4A 1IBML 3VFDA 1RRPA 2JLWA 1PLKA 2J59A 1Q7YC 4UPAA 1N34L 2GK7A 2W00A 3NH6A 1J90A 3FMIA 4QBHA 4LF7L 1OXVA 4TLDA 4ZCLA 5DISB 1GP2A 2CVHA 3IKJA 1YJ5A 2OXRA 1N32L 5FOXA 1C9KA 4ZIRA 2OXCA 3ZJYC 3IDQA 3TGPA 1CKNB 1HY3A 2GAAA 4M21A 3HOYG 1GJXA 1QHNA 2VP5A 4KAXA 5CYPA 2WKRA 5EXSA 4OHZA 4DUYQ 3KFVA 4LWZA 5JEDA 3KZ1E 4KVGA 1KOFA 4RFSB 3H3VH 4PZ6A 3T1YQ 2IF2A 1P16A 2CCGA 4MYTA 1TF7A 3ULPA 1OH7A 4CW7A 1G51A 2VQEL 2BE5D 3KXIA 4BFZA 1DTSA 2BJWA 2ZUDA 3FMPB 1JT8A 3KTAA 4DWJA 2PCFB 5IYBH 1CF4A 1W1WA 1E2GA 3X2SA 4D6PA 3J7A5 2QE7A 1L0WA 1SGWA 3QF4B 1KSGA 1B23P 4PQYA 3GJ0A 1S40A 2PLFA 2EXDA 3TQYA 1FMJA 4QOSA 4Q1CA 4J15A 2ZI6A 3SI7A 3TR5A 4DLTA 2P5SA 2VL6A 1E0SA 2VHJA 1IXSB 2QT1A 3QPVA 4BLOA 4C2TA 2XGJA 2I4IA 3SR0A 4YCUA 1DAFA 3Q85A 1S9HA 4IVPA 4PAQA 1G21E 1XPUA 2AD1A 3TZUA 2NOAA 3DMDA 3FHOA 3TW4A 5AJVB 1DADA 3B1XA 4Q1BA 1V43A 4X62L 1DO0A 3CF0A 1II9A 3K09C 2GEVA 1AE2A 4EPTA 1UADA 3C16C 4LX0A 3RC8A 5FOTA 3I4OA 4WXPA 4FMDF 4BFVA 1WCV1 5JCPA 2BH8A 1LTLA 4K0KQ 1TWGH 1E98A 1KJWA 4WW0A 5IYCH 2XAUA 4LBVA 4PV1C 3OTOL 2RGCA 4P4SA 4HIMA 3RRYA 1V8QA 2IEZA 5CYOA 4E5UA 3BK7A 2H5XA 2ZROA 4KSBA 4EQ6B 3G4SA 1W49A 4PANA 1NY5A 1HNXQ 1E96A 1K9MC 2N1BA 4KFTA 4A3BG 2PLRA 1Z2AA 1E2ZA 3FWYA 3KDSE 5JECA 4TYNA 1E2JA 1KAGA 4POAA 4Q18A 1J8MF 2VTKA 3SOPA 2JEAI 1CTQA 1JI0A 4OWWB 4ASUD 1DAEA 3ZD6A 2JA7G 4Q9IA 1ZM2A 4JL6A 3TH5A 4BA1I 1XF9A 2RKOA 2J5XA 2L0XA 5KUTA 1OB2A 1IJEA 4MITA 3T15A 2F6RA 4M22A 2I1QA 4LHWA 2Q0HA 4TTRA 5DH9A 3UDIA 3VNUA 1JALA 3TS2A 4HUQB 2JDIA 1DG3A 4JOIC 4B34A 3BB4A 3BS4A 5SZHB 3MUFA 4RMFA 2RAPA 4JLPA 4PC3A 1U98A 5C0XI 4GZYC 2F1RA 2GRJA 2WICA 3BORA 5K36H 1WYDA 4KKSA 3H86A 4LPSA 1OXTA 4B43A 1OYWA 3CRRA 2BBWA 1G8HA 2VUMH 1IN8A 1YNNC 1G7SA 2VSFA 4DV5Q 1COWD 1ZU4A 3BOSA 4JJZA 3WYAA 5EZ5A 2R93G 2UU9Q 2XXAB 2ZUBA 1Q86C 3L82B 4IOMA 5FL7D 4A82A 4L16A 2ZJAA 4B2LA 2OCBA 3ASZA 3KUCA 4K0KL 1PVOA 1G20E 3D3QA 2YTXA 3CQZH 2IWHA 2I5MX 4LI0A 3EWAA 1N8RC 1IN6A 3ZGXA 3KYHC 4W5HA 4Q9HA 3JAMc 3WNCA 3RS3A 3SJCA 2BM1A 2ZETA 3N6RA 4A3IH 5BN3A 1PH8A 4Q19A 3GJ5A 1NN3A 2CLSA 4G1UC 4UY8C 2BMDA 2EDGA 3G48A 4U5XA 2PQAA 2XTNA 4Q7MB 5M3FG 1PH2A 3BZKA 4QKQA 5JRZA 2Z0SA 4A3LH 1IXRA 1ZM9A 2FV8A 5C1BA 4GBMA 2IC5A 2NPIA 1AGRA 3HYTA 1FYCA 4LF6L 4GKKQ 1HZBA 1G8FA 1KI8A 2GNOA 3I8SA 4U02A 2E5LL 1LNZA 2WAQG 1QHHA 2YHSA 5EJEA 3IIJA 4URWR 1NVXQ 3EZ9A 1C9OA 1RIFA 1XXHA 4D26A 4QJFA 4I1UA 1KZGB 5GJVC 4V0ME 5EXPA 3LVQE 3V9PA 2XJ4A 1KSJA 1YEZA 1XTSA 1Z6AA 1WCMH 3CONA 4BFTA 2GN5A 5IYDG 1FW6A 4B3GA 1CRQA 2VQSA 3DOEA 3ZH9B 2XX3A 2IYLD 4H1VA 2WWIA 1J2JA 4G5QA 3KF6A 3A1TA 3S2HH 1XTJA 3ERSX 3OIYA 1E9RA 4UP8A 1JQJC 1S1CA 2R6FA 3QOFA 3RVBA 3GP8A 1I50H 1IY1A 3IQXA 1NBWA 1K6MA 1P62B 2X19A 4JZKA 2A1AA 4M9SA 5HCNA 4JI7L 2K14A 1T0HB 3Q72A 1V9PA 4X6AH 1J8YF 1Y8PB 1ZU5A 2P5TB 1CJUC 2RGGA 3VHXA 2E75C 3IO3A 3AFPA 2A19A 2ERXA 4YCVA 3I4MG 4OQXA 4QGUA 1OKKD 3TUJC 2P65A 4BY7G 3HOWG 3EZ6A 5DHAA 1VCOA 1VS0A 2QMEA 1M2OB 4A3CH 1GVNB 1X65A 2KBFA 5C3EH 4IFDG 4UXIA 2YWGA 4AKHA 2Q8IB 1IY0A 5E95A 2VP2A 3TNFA 4BA2I 2LKCA 2PCJA 1XXHE 1X55A 1TPZA 1U0JA 4RFVA 4GKKL 4Q7LA 2CFMA 4QBIA 1X9NA 3T1HQ 1YJWA 1OPXA 2ASEA 4XH9B 2A9KA 2C9OA 1K8RA 5EP4A 3FFAA 5FJ8G 1CR2A 3MJRA 3WYFA 4HZUB 1HTWA 2O0HA 3AP2A 3O8RA 4DJTA 3GLFA 2D5DA 1T6NA 3IBGA 4RKEA 2K33A 1E2WA 2ZI5A 1US8B 3TW8B 3W9YA 3WYGA 1CIPA 4C0QC 2JA8H 4NH0A 3OFNA 2ZU0C 1E9SA 4YMUA 1Z07A 4ACAA 2Q2UA 2RGDA 2R92G 5C2JB 4LFCQ 4G5GA 3LRPA 3CCEA 4LF5L 3FDIA 4G0NA 4F4CA 1H9SA 2REBA 3VR3A 2CQOA 3F8TA 1QVCA 1N3BA 2C9CA 3GEIA 4DZZA 2CWPA 1P4SA 1SXJE 3QG5A 4OK3A 3PJRA 1SKQA 1M8PA 4P31A 5JWHA 2IUUA 2P2LA 3EA0A 1XMOQ 4KSCA 5ELXA 4X64Q 1VQFA 2IK8A 2IXGA 4HZIA 4KV9A 2CHVA 1KXLA 2ANBA 4L9WA 3K0AA 4NKRA 3AKEA 2XSZD 2GZHA 4JBMA 3PO3H 1MR3F 3CH5A 4C9BA 1YHBA 1TQ2A 2FGJA 2ZSBA 2MQHA 3RWOA 2QMUA 5GROA 1F6BA 2BMEA 1OB5A 5C0XH 2GVAA 2YTYA 2NZHA 1VQ8A 1CLUA 2MSDB 4JI3Q 3CXCA 2IYZA 3I8XA 4WZBE 4PMWA 1VQIA 1L4YA 3N70A 1XP8A 4M4SA 4R9UC 3GLIB 3GLFE 2QTHA 4B74A 2FFHA 1H8ED 3SS8A 3T1HL 5K8UA 1QUQB 1N6PA 2JLUA 4TLAA 2N78A 4B73A 2ZVPX 2BKUA 1WB9A 5DE3A 1J99A 2J41A 3LD9A 2Y8EA 3NWJA 5KU1A 4FXPA 4RD6A 2YOFA 2ZJPA 1X3EA 4HYYA 2UXBL 3RRMA 4US2R 2AN9A 1G291 2I5HA 1NE3A 2YWEA 1SKYE 1Z0AA 2JJ2D 2RGNC 1PA6A 4US0R 1IYUA 2O8CB 4BBRG 3WNBA 3T53B 2WSSA 5JEAH 4LYHA 4LFCL 2EFDB 4C0LA 3T51B 2GETA 1ESNA 4EFNA 1G9XA 2ZI4A 1OIWA 4HB0A 5C4XG 4YMSA 2Y0SE 3I7FA 3QKRB 5L3QB 4DUGA 1NJGA 3LWUA 2R44A 2VSOA 3IIKA 4X65L 5HPYB 1SMXA 3U4VA 2FPKA 2DGYA 4OI4A 4B71A 1W0JD 2H1LA 5CJPA 3TRFA 2PI2E 1YU9A 1FTSA 3IFTA 4JT4A 3MG9A 4C3ZA 721PA 2ZS7A 1DOAA 1QHIA 1J5EQ 3FPPA 5LD2C 1MJEA 4DV3L 1CXZA 1R0ZA 3TAUA 4FMDB 3I4NH 4GOPB 2B92A 5KYKA 4Q4AA 4WOPA 1XDBA 1L2FA 3U4ZA 1KI3A 1YI2A 1U8YA 4LBYA 4B3XA 3GEEA 4HB3A 3UANA 2FX3A 4AQYQ 3QNUA 1VTKA 3T06B 3OESA 3K80C 3L0IB 5D3QA 5KSOA 3PIRA 1KD1C 4NL4H 1JB7A 1U90A 3MCAA 3U44A 2FZ4A 4L9SA 4N0DA 3J81j 4ZDKA 2UXCQ 1G18A 2K52A 4KLNA 4C7OB 4Q21A 4MGZR 2A5DA 3VMFA 2AHOB 2JLRA 3M9BA 2OEPA 4HSEA 4OX9L 3SFVA 4EX5A 2UUCQ 3E5HA 3LDAA 1AQYA 1HUQA 3O8CA 4TMWA 4V0LA 4DV6L 1NG9A 4MRVA 1SMYC 3P4XA 5DSZA 1KIXA 3QF4A 4HLQB 2EIFA 1G6HA 2WKPA 4O0AA 2ZREA 1GHJA 1KDOA 3KQHA 3UKDA 1YZLA 1TF5A 2BVNA 3ADDA 5AR1A 4NDZA 2F43A 2QTFA 1LV7A 3R20A 4BY1H 3AEZA 1MO5A 4LK2A 4LF4Q 1KRSA 4DC9A 2BM0A 1DO2A 2PZEA 3THOA 3J80c 8OHMA 3I55A 1Q81C 2A6EC 2IHFA 4AYBG 5IP7G 1HR0W 2YU9H 1NVUQ 2J87A 1JJGA 3UATA 3A1WA 3AVOA 3C4JA 1J5EL 3MWKA 3IBYA 1EFCA 4QHSA 2P67A 1IXRC 1GITA 1SQ5A 1XJCA 4M1YA 5JLJA 3ND9A 1SFOH 2J3EA 5BQ5A 3SDZA 2OTJA 3IHWA 1Y3AA 2CNWD 1Z6XA 3ZVMA 1H8HA 2A5YB 3UMRA 2LWIA 2MSEB 2QGZA 4P32A 3K9LA 4YXWD 5JJLA 3LBIA 4LJ7A 1K3RA 1KSHA 4IPGA 2QPAA 1OE0A 3LW7A 2G1JA 3TVDA 1AKYA 4EQ6A 3U4QA 2KCMA 4R4CA 1G3RA 1OXXK 3AEVA 1R4AA 1NVVQ 1OHHD 4ZKDA 5AJZA 4PG3A 3CR8A 1R5BA 4JT2A 4LRWA 2BH2A 1GD7A 1VQOA 1CSPA 3M4YA 2E74C 4BXXH 2WMNB 3N5CA 1CTMA 3UMFA 4JI4L 4FN5A 3QVVA 1AS2A 2UUCL 3S24A 1IN4A 1KK1A 1L1OC 4UXHA 2Z6VA 1ZD1A 2ODEA 3ONWA 2BC9A 4CRWB 2QAGA 3HOVG 4MYUA 3ZQJA 2QM8A 3I5YA 1OFHA 3W3ZB 5JWOA 5IE8A 5GAEC 1L2TA 4DCUA 2OLKA 2GCNA 3Q7QA 2VHUA 3X1DA 2OV2A 4A93H 4BGDA 3PCOB 4MH0R 4JYAL 2BKEA 2ZXUA 5J3BA 4BE7B 1WDTA 4KLZA 3PENA 2I5LX 4M9XA 4YLGA 5G41A 1ZUNB 4AY2A 3L43A 3VKGA 3A8KE 1RIPA 2B29A 4TTPA 3P1JA 4P4SB 1NJFA 3B6EA 3L8ZA 1P72A 1Z0IA 1ZCBA 1FUKA 1XB2A 621PA 1UM8A 1TQDA 3N2EA 1OKKA 1M6NA 2QP3A 3FE2A 4LFBL 1HR0L 1NMXA 2QMHA 4ARZA 4B3CA 3LLMA 4KKUA 3A8JE 1XMJA 2D2FA 1ASYA 1XWIA 2OSBA 1BH2A 2FE4A 4Q4JB 4BEBA 3RLOA 2O0KA 1MJCA 1VQ5A 4Q1AA 3LVRE 2KA7A 1O3YA 4JV5Q 3U3JA 2GBLC 1E1OA 1HH2P 3LX8A 5LDDC 3ZQ6A 1E94E 1KJYA 5FLMH 1JEEA 3CB4A 1GDDA 1IAQA 3HYRA 4R98A 1WJJA 2UXDL 1YJNA 1KDTA 4DV4L 4JS0A 1YZGA 5H70A 3KKOA 3FKSA 4C4PA 3SQWA 3VKHA 1GRQA 2O8FB 3A37A 4JIMA 4NP6A 4PX9A 4LJ5A 4TL9A 3PCRB 4IDPA 2DBYA 2YC4C 4TYWA 1RW4A 2NVXH 1LW7A 1T5IA 3EW9A 1FGUA 1E6CA 4Q00A 3GLGB 2QE7D 3GTJH 1QVRA 2D74A 4BECA 4GKJQ 1G64A 2OO7A 4J0QA 4S35A 4CDGA 1XTIA 4DR2Q 3AUXA 3B8HA 4IFEA 2EU8A 2ZANA 4A3KG 3WRXC 1N25A 2FH5B 2B3GA 4NBSA 4JL8A 2QBYB 2WJGA 1ASZA 3ZDQA 1D2NA 3QKUA 1FTNA 4DDTA 3WNDA 1A0IA 3KKQA 1NN0A 5IP9G 3BH6A 5BN5A 1HNWL 2YJTD 3NEJA 3CD6A 3GJ4A 4YY3L 1FNMA 1G7CA 3HJNA 2F55A 2EFCB 3A4MA 3F0TA 1VQNA 1CJTC 3CWQA 2GZDA 3ULLA 4QM6A 3KFXA 4JBWA 4OONA 4KLKA 2GCOA 5SZKB 4A4DA 4DIDA 5KPDA 1M74A 4UKDA 4OI2A 5C46F 4A2PA 2MO1A 3I5XA 4GP6A 1CSQA 3TQCA 2BBSA 2GJKA 2DUDA 4FDBA 4R1JA 2AXPA 2FJUA 1ELOA 2AD5A 4MGKR 5EP3A 4KYUA 3U9SA 1H8EA 1VG9B 4A2WA 3M0EA 3PUWA 3GJ8A 1P2VA 1QHHB 4AIMA 4PQFA 4OHWA 1HZAA 4TVAB 3W5OA 1RRFA 3KKNA 1CFMA 1XXHB 4DV0L 1IOZA 5FTJA 2OCEA 2REXB 2DCUA 3HWSA 4B2PA 1BKBA 2KENA 2QMOA 3VKWA 3D0FA 1KI9A 4E22A 2JJ2A 1Q20A 3LQQA 2ZR7A 4B2IA 1JE5A 2MFIA 4YDSA 3NDBB 4FIDA 1X3SA 2CKZB 4C0SA 4TMXA 1LUZA 1GUGA 3VR1A 3WP1B 4HZUA 1X1RA 1VCMA 4Z8XA 1KO8A 1DAMA 4JYCA 4LGMA 1JAHA 3KF6B 2MMCA 5FPTA 1M7GA 3RDPA 4LJ9A 4NTZA 4B6EA 2A68D 4AK9A 4IHQA 1PUJA 1CJMA 1D9ZA 3VR6A 4LHXA 2R8RA 1KRTA 2QROA 1GHKA 1TMKA 4FMBB 5FBRB 3AQQA 4RSGA 5TMPA 1EIYB 1M7BA 1SXJB 3FKIH 1YR7A 2XOKA 2JA9A 3K8YA 4NHOA 5GVRA 3EC2A 5KSYA 4B3SL 1AZSC 2IA5A 3SHFA 2WZQA 3R9IA 2FFAA 4DB4A 4LJ6A 4LFAL 5DN6A 3PF5A 2JAQA 4CEJA 1G8GA 4C0KA 2GILA 5E7IA 2SHKA 1KAWA 5L3VA 2Q6TA 1Y1WG 2IYVA 2OBMA 3P32A 2W2TA 3K7AH 1NY4A 3CMEA 3A5ZB 3ETLA 1XNQQ 1TUEA 2ZS9A 4E03A 2XJ9A 4IOAA 2IT1A 1YHQA 3RRNA 2NZOA 4M1SA 2LXKA 3AFQA 3NENA 4H9GA 2LXJA 2OCAA 1O78A 2HYDA 3TSOA 3A1SA 2A6ED 2QRNA 4PAMA 2BBOA 4HDQB 4XSHA 421PA 3CRLC 1YVCA 1G3MA 2GZAA 3GLFB 1LF0A 1A8VA 5J5CA 4DDWA 1B9MA 4PC2A 1G7RA 1HE1C 1TEVA 1UWVA 3HPQA 3GLIA 4C0HA 4Z51A 1Z63A 1E7ZA 2A8VA 2ZVQX 1W2HA 4JI5Q 1EWQA 2D0PA 1QUQA 1P73A 2HXYA 3A58B 3HOYH 3Q8DA 3MWYW 5EP1A 1FOEB 4JG2A 5FH9A 1BS1A 1NBME 5LMNW 1H9SB 2KCTA 1H95A 1VG8A 4FMCF 4G01B 4YMWA 1MABA 1SKYB 4ZCMA 3I73A 3AYHB 2IY5B 4DLRA 4MZ9A 1XCPA 2ZUCA 4KVAA 2NTYC 2W0MA 2YWHA 4RD2A 1S9DA 1E24A 4RJLA 2K4KA 3CR7A 3AM1A 2O8CA 4XVRA 3A8TA 3CWZA 1U0HC 5LB4A 2UUBQ 2WAQE 4LJYA 1QDEA 4AYWA 1X1SA 2VYFA 2YOGA 4HLUC 2CXXA 4NU0A 1IM2A 1X6OA 1KNXA 2IW3A 2ZSAA 1A62A 3FHCB 3ND8A 1JJ2A 3D7MA 2VP9A 5FR2A 4IPCA 1WBDA 3RWMB 3L7ZC 4POGA 3C8UA 3BIFA 3ZIAA 5L3QA 4GL2A 4ON9A 3OOCA 1XNQL 2J46A 4KITB 3QE0A 1JJ7A 1KTVA 1SXJD 2QPTA 1NKSA 3H2YA 4G5SA 4YXWA 3O8BA 3TBKA 3ECCA 1YJ9A 4GN4B 1NSTA 4JI8L 3A6PC 2V6JA 1HPCA 2PX3A 4TLEA 4JVMA 2XITA 2HXSA 4JLMA 1UFQA 3DKVA 4JBXA 5SZIA 4I1VA 5JI2E 1KY2A 1P2TA 2CL0X 3B1WA 3S1AB 1QZGA 2WB1E 1U94A 4TLBA 3FGNA 2I1VB 2FSGA 5CJ2A 5FLXc 1EFUA 3WMGA 1CJKC 1X54A
chains in the Genus database with same CATH superfamily
3OM9A 4CDDC 4JMPA 4MDHA 5C4MA 4GI5A 2YYAA 4Y0VA 1R5NA 2AHOA 1HNNA 3HUEA 3QOJA 4QDOA 3FPEA 2JA7H 1A5TA 2H4WA 3I9MA 2R6AA 1JLSA 4QSMA 2B9EA 2ADFA 4C4ZA 2F0HA 3VI3B 2VWGA 2K7ZA 5GONF 3UBMA 1CUZA 1GU1A 2BF4A 2JFHA 4FFOA 3I4FA 4DY6A 1Q3TA 1RLUA 2I7CA 1PFUA 2K50A 3IVCA 1FU8A 2WYOA 3UJCA 3K72B 1OASA 3AYXB 1E2IA 1L5GB 1QONA 1Z6HA 1B93A 3OZCA 4LTDA 1FC0A 2TSSA 5LUBA 1EDDA 4XIJA 5LYJA 5TB5A 4LTMA 1AUXA 5BVGA 4D0LB 2EYHA 4M9CA 4BP9A 2OBLA 4EGAA 2ZCJA 4LJZC 4GD3Q 1AMUA 3SIWA 5JIBA 3L4BC 4C2MH 3KT3A 3K5WA 5JTUA 3FDJA 2YWDA 2OXTA 1KI7A 3OZRA 1EZ1A 2J1LA 1L1RA 2VJYA 1HETA 4JBKA 4X66Q 3D8RA 4X64B 1JWBB 3T5AA 2DWPA 1E89A 1ABBA 1PIWA 4CKBA 1U8FO 2GK4A 4I2VA 4ZQBA 3JQ9A 4QF4A 2P11A 3CNBA 3DULA 5B58C 5ALPA 3HVRA 4UTNA 3KOMA 2LFNA 2VPTA 4DFAA 4Y2VA 3Q8MA 4OYLA 4DG5A 3OO0A 5JC8A 2WUEA 1O95A 3V4VB 3HKCA 3OLWA 5KREA 2B2WC 3ONDA 4BQNA 5L3ZA 3L7BA 3ZCPA 3W0LB 1U1DA 4YJ3B 4DQUA 3D1JA 4MVJF 4TKVB 3K0EA 1GTG1 3H6GA 2HDHA 3S2YA 1UZLA 5D1HA 4GVXA 4IGKA 2ZJ5A 3FUXA 3ZD7A 4X93A 3FFBA 2UZ4A 4QULA 1P9OA 4XYBA 5C1IA 2RIPA 4U63A 2O3UA 2AUMA 4R9VA 5BNWA 2NYUA 4MEBA 1JQ5A 4QTTB 5F51A 1TWGB 1KNAA 3TOVA 1C3LA 1FXUA 1UE5A 2R9VA 5EESA 2CB0A 1XX8A 4IXWA 1TRKA 2IEYA 4RXMA 1GR0A 4YDRA 2OVBA 2JK0A 3ZOKA 5KINB 4DHEA 2VPWA 1F5NA 1CUVA 1JBQA 5CYFA 5IC6A 4HDAA 3D4DA 5KSWB 3UF0A 1GNSA 3NCTA 3CPEA 2X5OA 5K7SA 3ETNA 2ZTSA 3REGA 1IZ9A 3M1IA 3LUKA 4P3KA 4IIJA 1E20A 4DNTB 4D4JA 1UBFA 3WL6A 3WDMA 2JAUA 3IT0A 3UO8B 2FRDA 2ZRAA 5BR8Q 2VAPA 3DTVA 1O4VA 2C3PA 1KKLA 2M2IA 2OHXA 4QCLA 2JLQA 1ECPA 3NETA 1YS1X 2J3HA 1QRRA 3I2KA 5EMHA 2H8GA 3C24A 3MHPA 2ZAYA 4AQYL 3UK6A 4V0NA 2WKWA 1WTXA 2JVJA 3QWIA 4OHJA 3OCWA 4N5HX 1YC5A 3FCYA 1M8AA 3OZAA 3TINA 1NW7A 1GPYA 1U11A 3GHHA 1XEFA 2P1ZA 4HRYA 4AC9A 1C8LA 4BLVA 4PNHA 5EWLB 2MINA 3WJ2A 3JZDA 4XVUA 5BNTA 2QVYX 1EBBA 1TK9A 2WF5A 1M2NA 1EFRD 1N2EA 2QZPA 4OWTB 4ME6A 1NN5A 3WQQA 2J09A 1G5QA 2VRWA 1FSPA 3TMKA 3MWDA 5DHTA 2OUIA 4C6TA 3V1UA 3HFGA 2RHLA 4FXOA 4RHUA 1P7YA 4EJFA 1QBGA 4GVLA 3HCFA 2BEUB 2QRZA 2HN9A 3PEYA 3MT7A 3K9CA 2PAAA 4OI1A 2GFQA 2XCRB 1L4NA 4KKXB 1A7KA 3ZXUB 4HUJA 4QUGA 4B6FA 2WWVD 2P90A 2P5UA 3RT7A 2OLEA 3RT9A 2HCTA 4POOA 1UDWA 3M34A 1SULA 3TLMA 4DDMA 1J1IA 3LDGA 2H57A 3VV2A 2EHDA 4EW3A 3CF5A 3HA3A 1NBIA 1NQWA 3BXXA 1MI2A 1X13A 4C04A 2DOKA 1O6FA 2HYIC 3BSYA 1ZCAA 1PRTF 4LJ9A 1W5AA 5AVZA 3AETA 4UMEA 1V5EA 4MS3A 3DSRA 2G9RA 1JA0A 2ODAA 1X9IA 1LA2A 4EB6B 5I6DA 5KYLA 5LQDA 1UXHA 2O5CA 2IHYA 2A69D 4KQWA 2WQ6A 5EHQA 4HGZA 4UW9A 1PFBA 1JFFB 4G56A 1IRIA 3OA0A 5DOZA 3H3JA 2OV4A 4AZ3B 3N0RA 1BCPC 2ROQA 2I4MA 2FLKA 4BLSA 5FBVB 2PTGA 4IH9A 3F9CA 2EYPA 5KOJA 2ZW9A 4INPA 4XPIA 1YHAA 3ZNPA 3ZNNA 1DLIA 2I2BA 4ALLA 2HF2A 1RZUA 3KT0A 2DQ4A 4MYCA 5DO9A 3WQRA 4KAJA 3O8LA 1KEZA 1NI4B 3HOZG 2PQ2A 1IZ7A 1D2GA 2HLDD 4M1TA 4YRTA 3NJ4A 5H68A 4XGRA 4N5MA 3N3BC 3NG1A 1TEXA 1VZ3A 1P91A 3GLHA 1G5RA 3K70C 3DDSA 2VAVA 3L1HA 3VQTA 2ZWAA 4JY7A 3TD6A 5I7VA 4JI1L 2OILA 4OHVA 2ZB3A 2PO7A 5EZSA 3DEFA 3SY8A 4HC4A 5BWCA 4R1LA 5JVDB 1T0BA 1Z5PA 2O8BB 4Z3DA 3TRZA 1SDFA 1NUUA 1PZNA 1XZJA 3DDOA 2QU7A 3NTHA 1TFRA 1E58A 3B53X 2RFLA 4OGLA 3T9BA 4C1NK 2R62A 4AMUA 5JSZB 3W77A 4XJXA 3P7JA 3HOUH 4D3DA 1W87A 1FJ2A 1ONNA 3ZXXA 3KJGA 2YH2A 5KWIA 2FJPA 5ALLA 3KVNA 4KQJA 3LSTA 4AX4A 4KRYA 3OEEA 3AJ8A 4NONA 3UDFA 3QFCA 4FC6A 2WTBA 4JI0Q 2ZJ0A 1AHIA 3BWXA 1Q0HA 1P74A 3SE7A 1X8JA 4ILWA 2HV9A 4N49A 2VZAA 4J29A 2LIVA 3SC2B 5K45A 3ZDDA 1DIHA 4NOJA 2C35B 5HE8A 5G4KB 1N8SA 2WYHA 1ZSVA 3FSGA 1WABA 3WJ7A 1SPBS 3SXPA 1BVSA 5CA1A 3IC5A 3WKEA 2W58A 4YECA 5JXGA 1ZI6A 2EDAA 4WCFA 2AMJA 3CPWA 1VQMA 1RQLA 3V3TA 4RK6A 3I58A 2DX7A 4WBXC 3G02A 1J1UA 2C0PA 5ALQA 1I3LA 4LF5Q 4HGRA 1LDYA 3X3HA 4Y2TA 5K3DA 3WBJA 4KHPB 1IWOA 4N7BA 2WMOB 3HFZB 1T3GA 3BDVA 5FL3A 3IPYA 4CKWB 1SIUA 3FOZA 4ZK9B 1M0WA 5K36G 1S01A 2WF8A 3RUEA 2VRNA 3L6DA 3CMMA 1SVNA 4V2UA 1EA5A 4O5OA 5TV2A 4D8WA 4KXLA 1CZNA 4EUSA 1K6JA 2QN3A 4TSFA 1NFRA 5BUSA 4CT5A 3UK7A 4O33A 1X80A 4H7FA 1IIBA 2BMFA 1UDAA 4YUYA 1VI6A 1Z0ZA 4JHLA 3V55A 3A9WA 3P27A 2HIMA 2VA8A 4DV3Q 1BMQA 3AM4A 2BTQB 3NBKA 5LL6P 4FHCA 4GNXC 3SVLA 4RPKA 3B1KA 2NQTA 3DFUA 3KEOA 2ONCA 5AUQA 3S7ZA 3UOWA 1H6DA 2AE1A 2Q7OE 3GUHA 4KMSA 2PANA 1EINA 3HLYA 1YDFA 1QX3A 2X6TA 5CT6A 5IM5A 2DP4E 4C3IH 1KP3A 1KFBB 2C8KA 4YAGA 3GNSA 4O0MA 1OLUA 4DEXA 3V1MA 4DV1L 2AG5A 3D3EA 4QNMA 5C5CA 4JWTA 4YAEA 1JHYA 3QGMA 4FSXA 3CF6R 3JVUA 3EGIA 1WXEA 1NF9A 1G1AA 3RVSA 5IJ9A 2CF6A 2A67A 2EXZA 4Q9DA 3ZWCA 3TPCA 1QZXA 3C8DA 5A1JA 1SXIA 2QRKA 3P9KA 3UG6A 4BBRB 5MN6A 5C5IA 2NU6B 1L1EA 2VUUA 1L7VC 1EUCA 1FZQA 3ZE6A 4ZMBA 3A4NA 5FI5A 5IJ0B 1UFVA 1UE7A 2GVBA 1U6IA 3LWNA 3NEAA 3DWFA 5TJHA 2MGSA 5JEAG 5CNJA 5IUNC 2AUJD 4D9FA 4IYJA 4OXNA 3DVAB 1LS1A 1TVKA 2E4UA 4O42A 2NSLA 1GARA 3GX1A 4MDFA 5EIBD 1Z62A 4QDZA 4HAXA 3HRIA 3HKSA 3PFGA 2RSOA 4RU1A 3ZXIA 2V55B 5I51A 4YJ2F 2II6A 1GT91 4GOKA 5DMHA 1VI5A 5LR6A 5E6SB 3I09A 1BWSA 1C3OA 3JRNA 1RQGA 5LD2B 4RJJA 1ZEMA 1JPNA 4I9HA 3FMCA 4IR7A 5L7YA 4HYTA 4BRUA 1EVYA 2PNFA 2QL5A 4PFQA 4QOHA 1YS7A 4Q1FA 1AFPA 1WV0A 1A72A 2OB1A 3TP6A 3I2IA 1IW7C 4F3NA 5EKLA 3Q2OA 1TC2A 2LKDA 4X3KA 4KUHA 1QE6A 3EY4A 1EK5A 2WJAA 3EIXA 2AFIB 2ZE6A 4IW3B 3DE3X 1UBCA 3M70A 2FF5A 4NJEA 3F3YA 4J0FA 3GPBA 1ATIA 4Y7DA 2ZZNA 3F74A 3DWGA 3PI6A 2GERA 3J80A 3TW8A 4A3KB 3GCDA 3OJWA 4DTCA 5BOVA 1GPLA 4I46A 3ZCVA 3U7QB 4J6HA 2HLHA 4U7TB 3KVYA 2VW9A 3TD2A 4JYBA 1ZH8A 4CWAA 4MGIR 5A4IS 4MWOA 4JI8Q 4ESEA 4K8JA 5I2YA 2B2TC 1A5AB 4G57A 1X8LA 3BZCA 3T1TA 1MC8A 3LTEA 2KLBA 3I61A 1G8AA 4M1UB 4MHEA 5L8VA 2EYJA 1ILQA 1ORHA 3B7GA 1QR2A 2I2AA 4GMGA 4ZVOA 3EX7C 4P3XA 4UM9D 1QCBD 5JAIA 1HFJA 4RWEA 4JB3A 3PXGA 4AO6A 4UQOA 3CUUA 1Q14A 3P97A 2C99A 3ACBA 1VHQA 2X5XA 3RJ5A 1L5FA 3D4PA 1FX0B 3BE4A 3RGGA 1ZGGA 2VL7A 4QWMA 1BXGB 4XR9A 3DZDA 2JGEA 4WLEA 3M4NA 4FCWA 1Z56C 3D7RA 1YDMA 3E8SA 1Y69U 1UMKA 3GTGH 2H29A 4FE3A 4MUGA 1ISIA 3VFDA 1RRPA 2ADOA 4UPAA 4RHFA 1CHDA 1LPNA 5U9CA 5FOXA 1SXHA 2DT5A 2W5UA 1HY3A 4KAXA 1REQA 3S1MB 3B6KA 3UFXB 1TF7A 2A6PA 3KTAA 1YA6A 2GZSA 3TLAA 3DE7X 3K94A 4DHWA 1APBA 3GJ0A 2ORYA 1X7ZA 3R7AA 4WK6A 3CNQS 1G21E 3TW4A 2ZJ3A 4Q1BA 3U9OA 1QG6A 1II9A 4CIBA 1DYQA 1V4BA 2QD5A 2KECA 5FOTA 4IYRA 3EFXD 4K0KQ 3RRYA 3ZVMA 4EY8A 4EQ6B 3G4SA 5J43A 4MKRA 5C81A 3M9XA 4R0NA 2Q28A 4JL6A 4DADA 1IJEA 1VE5A 2VN8A 1PFQA 2I80A 1AEXA 3AUTA 4LFCB 3OU6A 1TWFB 4OH7A 1P5JA 2WVAA 2VUMH 4DV5Q 5DBFA 1G5HA 5I8WA 3NV7A 4B2LA 2Y99A 2NVUB 2WVHA 2I5MX 3JAMc 3ETDA 3HADA 2B8JA 1TQ8A 1WTPA 4J2HA 5JYDA 4R2XA 2ETVA 1UZNA 3BZKA 4GX5A 4EB0A 3U1BA 3LDHA 3M4JA 4OELB 5IKXA 3IAAA 2BUBA 3BDIA 1PX2A 1BHQ1 3DT9A 3PC8C 2C3MA 2CMHA 1IQUA 2VQSA 3FZEA 5CC4A 2W8BA 5ALGA 2DH5A 3GP8A 3T4PA 3TO5A 1T0HB 3PE3A 3R2IA 5KNDD 4NQZA 4NENA 3TUJC 2VDLB 1DJRD 5C3EH 3LT2A 1TPZA 1U0JA 3FYUC 1EZ6A 3WYFA 1YRWA 4HZUB 2O0HA 4RYDA 3W9YA 4I36A 5FUBA 1RHRA 2RGDA 4IFTA 4IWYA 1QVCA 1VA4A 4ZODA 4JYAB 3EA0A 4KSCA 5I9NA 2IXGA 4BBPA 4DIMA 2RCYA 3AKEA 3MIIA 3MGGA 4H3SA 4C9BA 1PNOA 2DUJA 3TP8A 4DJFC 4KTTE 4WZBE 1ZEQX 1DQYA 2IIVA 4B74A 1ILWA 2UXDB 1ZIXA 1Y4AE 2ODQA 1A7UA 4D4IA 1RFGE 2OYCA 3T51B 1QLWA 1XVLA 3AI1A 3KE8A 3NWEA 721PA 3IFTA 1DKMA 4ZICA 4NDAA 3TAUA 1SYFA 3KM0A 1CUFA 3K80C 2ZUSA 3D9QX 3FLBA 2OORC 3HNPA 5DM0A 2JLRA 1Q1GA 1FYWA 1L5ZA 5B1HA 1EU4A 3AK4A 5DTEA 5EIEA 3QF4A 4OHUA 4HNGA 3E0JA 5GOTA 7YASA 1TD1A 2JVIA 4EFDA 4B3SB 3ELWA 1WF6A 1EFCA 2PLWA 2Z57A 4RTJA 5DMXA 1PT9A 4HDKB 4R4CA 2WFLA 1C1XB 2V7BA 3UTDA 1Q83A 1FDVA 3BRSA 1WEHA 3R76A 1R4NB 5C80A 5IAJA 2IUFA 4MH0R 2ZXUA 4ZHQA 4LGVA 2VYNA 4B31A 2Q5CA 3P96A 1QX4A 4P4SB 2Q1YA 1QG0A 2NWQA 2V0NA 2XDQB 1HR0L 2D2FA 4WJZA 1SKBA 5FV4A 4DV4L 4URHA 5NLLA 3FKSA 3GNLA 2B2XA 1I4PA 1CP3A 4J0QA 3S44A 3LFTA 1Y3FE 3CEPB 4GXRA 2PV7A 3DKIA 2I33A 1D2NA 4DAEA 4O1MA 4I6EA 5BN5A 2I2FA 1TGYA 1VQNA 1QIFA 2HPVA 4LNAA 3QW2A 2GCOA 1UQUA 4UKDA 1PKXA 4NXNB 2DUDA 4U2EA 1Y98A 1SHLA 1ECCA 1ZAYA 3PUWA 4FUTA 1RRFA 4UU8A 3O7WA 1PCXA 1PR2A 1JQAA 2DCUA 3V7FA 4PLHA 1JG6A 1QCYA 3E48A 1EH5A 3NXKA 2J08A 3BCSA 5I45A 3H2BA 5FPTA 2MMCA 4F2PA 4BX3A 1YGPA 2C4KA 1EGVB 5TMPA 1SXJB 2DPHA 3SHFA 1M5RA 5DN6A 1ULZA 3QTBA 1LPSA 4Y2GA 3FTCA 4E03A 4Y6QA 1YHQA 3B36A 3OJEA 2J0EA 2LXKA 3WLIA 2IXDA 1Q6ZA 1MXHA 3A9UA 2A6ED 2Q4EA 1M3SA 1YVCA 1G3MA 1XYVA 2GZAA 2C7VA 4N03A 2QWXA 1F8GA 1VKNA 4LMBA 2QW0X 1QQAA 1QHFA 1RQ2A 1P6QA 1TAHA 1BS1A 3U4DA 3FPKA 4ZCMA 5DAUA 3NGXA 1YV9A 1ZSNA 1OMOA 1L6IA 1PL8A 1XL1A 2BRUA 4D96A 5IARA 7REQB 5DJ5A 4P3NA 1PNQA 1A62A 5KOHA 1XZ8A 3LX6A 2OECA 2H63A 3B1WA 3EFEA 3PJGA 1TJ5A 2ACWA 1V1OA 2IX1A 2WM8A 3JV7A 5CP8A 5AM5A 2QN8A 3RAPR 4GMHA 2G9QA 1IBRA 4B8ZA 3QPDA 4HAUA 3KYCA 2I0QA 1V16B 2FNAA 1T9KA 3ES9A 1ECGA 1OREA 5FPPA 3I9V1 1CR0A 4ETIA 2Q3MA 1B16A 4KJXA 1QWOA 3K0YA 2A78A 3I01M 2H5LA 2IIBA 4WCVA 2J4XA 3PYLA 5IN5A 1CZLA 2XBMA 5JDCA 1KEEB 2IV7A 3K8AA 1D1KA 5IC4A 4BIMA 2QTRA 2G71A 3QK7A 5ALYA 3DZHA 1SU6A 1RC1A 3NGLA 2HJGA 3A27A 3L0BA 2V4MA 1IHPA 5IYDH 1A3VA 4ZQFA 1DCMA 2G08A 4GN3B 3NVDA 2C0QA 4L5QA 4G0YA 1DEKA 4NESA 2NVYH 2R6HA 4DMLA 3L46A 1LU9A 1D1PA 1K6XA 2JAPA 4BPBA 3OT4A 4FNMA 1BW9A 2O8FA 3AV3A 2RDHA 1FQJA 3OY7A 5MN5A 5E3HA 5AM4A 3EZ7A 4ODGA 2IDJA 1XMOB 1L7XA 3KQYA 2XTAA 4ARZB 1D2AA 5FEMA 5C4GB 1N5DA 2XVZA 1B3RA 2FOIA 5IS2A 3EG9A 1WUJS 3E81A 3HDVA 1LVGA 4EJSA 3KKKA 5A9TA 1Z47A 4CCAA 2FEKA 3QUSA 1CE8A 1MH9A 3A2MA 3GAMA 5IANA 3IKLA 5B30A 5ENVA 2WMDA 3CLTC 2Z9BA 3RG8A 3WWVA 1FNSA 2BHSA 2HD3A 3PB3A 1VYTA 4ZO6A 4UNNA 4BS9A 1YZTA 3O84A 3TS0A 3OFVA 1Z37A 1YRLA 3BZBA 4HNRA 4DF3A 4XQGA 2QTZA 3M1LA 4JYZA 1PG5A 5ECWA 4NCNA 2XGTA 4HVAA 3D6AA 1GYQA 2AYYA 5GADC 1DHRA 1QIIA 3T4EA 3ZIUA 1ZS9A 3LUJA 2FSHA 3I6IA 1K8XB 2IZZA 1PS9A 4ND8A 4PPQA 4GLOA 3LC0A 4URVR 3HB4X 4CF5A 1NI3A 4MW4A 1JJVA 3H9CA 3SK6A 3TZDA 1Y1RA 4HX9A 3K6RA 1OR8A 2ZQZA 5DIFA 4EJ6A 5ALDA 1PV2A 3GLUA 3E9CA 4BN5A 1Z9FA 2HAEA 3AY3A 3W6OA 4B35A 1Y7IA 4B8WA 4B3JA 3ZX5A 4K46A 2OGTA 4B5KA 1BCSB 2HUPA 3MZ5A 3GGSA 1ZG3A 4AROA 1VQHA 3DFKA 2QZSA 1UEJA 4KKVA 4RHTA 3B89A 1K86A 1WIWA 4ZRMA 1SRRA 4W5NA 4GMDA 3ACCA 1HBJA 2GWRA 3G9XA 2V54A 3GZNA 5K5PA 3CW2A 3GP7A 2WKCA 4FPXA 3GN1A 4ZUIA 1KC8C 4CM1A 1AGPA 3FKQA 3PL1A 3RUAA 3S1QH 1KYXA 1XFAA 2HLPA 1K7CA 3WNQA 2Q41A 3AVUA 3S2EA 3S81A 1AZLA