2IT1A

Structure of ph0203 protein from pyrococcus horikoshii
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
362
structure length
362
Chain Sequence
MVEIKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKDRNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVYYKPKYKFVGGFLGNPPMNFVEAKVEDGKLVITEKSKLPIPKQYVEIVKETGITEVIIGFRPHDAEIVKGEGEGIVGEVYSFEPLGREQIVTVSVNDSIVKVFAPEGEHFSFGEKVTIKVKEELLVLFDKKTEKALEFSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of PH0203 protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
molecule keywords 362aa long hypothetical maltose/maltodextrin transport ATP-b
total genus 98
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2it1A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2it1A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2it1A01
4LF5L 1XJ0A 4OHWA 1UKEA 4S35A 5P21A 5FH9A 2VA8A 4GLAC 1HTPA 1OB2A 3MRSA 1U8AA 1NMGA 4LW1A 5FTNA 4KKSA 4LFAL 2J46A 4OQFA 1O87A 4MGKR 2K50A 3A58B 4IRUB 2IYYA 3KFUA 2VQFQ 1PLLA 3VR6A 3CCEA 4FW9A 3SJAA 3BERA 4GPTA 1VF5C 4DV7L 2KBNA 3CPFA 1GL9B 2KJQA 3EZ7A 3W3AA 4QHTA 4V0ME 3AVWA 2X8AA 2W0SA 4MRPA 1DCZA 4LJAA 5H1YA 2UZIR 2ZUCA 3AKCA 1OH6A 2J0UA 1X55A 3CRLC 3J81i 1OIWA 1KO1A 4O0MA 4B74A 1UPTA 3RAPR 2OTLA 4I1UA 4TSFD 1Z63A 3KFVA 1R2QA 4MKFA 1DPFA 4BZPA 1E96A 3RNLA 3IPXA 5G3ZA 3PIRA 3CPJB 2JLUA 4PHHA 3G48A 4YY3Q 3PCRB 3ETLA 1X9NA 3X1XA 3BJIC 4HAWA 4PHFA 4C0AC 2CNWA 3CQZH 4C3JH 2R62A 1E69A 1IBLQ 3LDAA 3HOYG 1N34Q 1HNWL 4Q19A 4DR3Q 1OKKD 3EIEA 4LJ9A 4B43A 4Y0AA 1CKEA 3FMCA 4Q18A 2GNOA 2PEYA 4IFEA 2GVBA 2AFHE 2DNEA 1FYCA 3CRMA 3M6AA 5H68A 3U4QA 4M9ZA 1DO0A 4OQLA 4M0LA 4IJMA 4MYTA 1GL7A 2ZTCA 1W4RA 2D2EA 4RD6A 3VHLB 3AVVA 2O8BB 5L3SB 2CL7X 2FSIA 4DUZQ 1O7IA 5FPYA 5F2EA 1YI2A 3TMKA 2F7SA 3GEEA 2E5LL 3A5UA 1LTLA 1PLJA 1F3OA 3R9IA 1TX4B 2ZUBA 3GJ4A 4BGDA 2QGZA 1NN5A 1EFCA 1FNMA 4HDCA 2PQAA 1EXMA 2GBLA 2E8GA 3W6OA 4X66L 3RLNA 2NZHA 4JLPA 4LPSA 4KN7C 4V0NA 4DV2L 4RKFA 3HP1A 3ICEA 5E3HA 2OCAA 3I1FA 5CYPA 3KKOA 1A7JA 3G6EA 1UF9A 3NKVA 4XWKA 1NRJB 2WPDA 4GRAA 1E2HA 4DV7Q 1DXMA 4MH0R 3GJ5A 4GDFA 4JI1Q 4POFA 2JJ8A 4RVCA 1S9HA 4IPCA 3JAMc 4HJ7A 1KXLA 4XTCS 1NY6A 5CK4A 5AUPB 4MUBA 4ESHA 2JLYA 4NE2A 3MWYW 3BB1A 2WM9B 3X1YA 5JS7A 1FP6A 4F4JA 2K33A 2EFCB 1M2OB 4LHXA 4KO8A 1TF7A 2IWRA 3I5YA 4X8MA 3GJ8A 1OXVA 1TQ2A 1AE2A 3PXGA 3EZ2A 4GS3A 1P75A 1ETUA 3S1NH 5B2ZA 4NPSA 1TXYA 2OQKA 2IYQA 5FR1A 3WBKA 2QAGB 2QQ0A 4JC0A 3J81c 4PC6A 1E24A 3F3YA 1DD2A 1JMCA 4KYIB 3CC7A 1NVUQ 2WV9A 3QEJA 4DC9A 2C96A 2OTJA 2P6NA 3AB3A 4A6XA 1GUSA 1YITA 4F93B 1M90C 4O0AA 2NMVA 2W6ID 1BYIA 2OCEA 1G9XA 2JCSA 4HDOB 2IX1A 2Q0HA 1G6OA 3BB4A 4B3SQ 3W1BA 2DYKA 1NJFA 4V0MA 5DN6A 1QHNA 4GN4B 4AYXA 4HB2A 1KDOA 2REXB 3BDOA 4LDJA 4IJLA 4X8HA 3OFNA 2AKWB 2V55B 2WWWA 1OLOA 3SU8A 2VP0A 1W48A 3CF5A 2ZUDA 3RC8A 1VQEA 1D8LA 3TIFA 4LY6A 1G6PA 2F1HA 1AZSC 3TSZA 3SC3A 3AYHB 2RAPA 3QOFA 3ZQJA 4RFSB 4A92A 5DN6D 1T3HA 3EIVA 1AKEA 5JRJA 4PC1A 1E79D 1QG2A 1YZGA 2FX3A 3FKSA 1W5SA 4C0BA 3ZS8A 3AF1A 3SJZA 1S3SA 3AUYA 4BBSH 3VKWA 5KU1A 1RKBA 4L5BA 2VYFA 4EQ6B 4IDHA 2BDOA 4X64L 3QIAA 3DMDA 2WB1G 1JXMA 3I3SR 1IN5A 3OTOQ 3CW2C 4LHYA 1WMSA 4Q7MB 5GJVC 3LA6A 2QPOA 4L5QA 2IXGA 4MA4A 2NZ8A 1HR0Q 2EYQA 2JJ2D 5JJIA 4JI5Q 4MRSA 2GZAA 3GO5A 1NVXQ 5TDHA 3T06B 4DHEA 4BBSG 1FFHA 5JRZA 3PJRA 2IS6A 2WAQG 4FIDA 5DHAA 2I1VB 3QQ5A 4M1YA 3QBVA 2CMKA 4M1SA 2FMXA 3ZDQA 1ZIPA 3EWSA 1UKVY 3AM1A 3IO5A 3A8JE 3EXAA 2C03A 1HNZL 3HOVH 2XNDA 3LFUA 2W2XA 1XEXA 3CRRA 1R4AA 3EZ9A 1Z6XA 4KU4A 5HE8A 4XIGS 2OCPA 5HKKA 3BH6A 4A3EG 4N1AA 4R2IA 3W9YA 4URVR 4Q4HB 5KTYA 1SVKA 3G82C 1CSQA 5M3FG 3EC2A 2ODEA 1J99A 3BD9A 1WRBA 2OESA 3PUZA 3TSWA 3FYHA 4TTPA 2B8GA 4G7HC 1GKUB 5EE3A 3T1VA 3VDYA 2QPAA 4P32A 5AJXA 2F1MA 1GJXA 4DUZL 5IF9A 2AUJD 4KAXA 4ZKDA 3EARA 3SHWA 2GJKA 1H9SA 3AGQA 4A3EH 3UDFA 3L0IB 1HQYE 1SULA 4DR2Q 4XTRA 2AK2A 3RVBA 4EQ6A 4EPWA 1KO7A 3G5UA 4NYIR 4JLAA 2Y0SG 5IP9H 5M5XH 1IBKL 2DCUA 3U3OA 3RLFA 2R7ZH 2CE2X 2D5DA 2P2LA 2P3SA 3F2BA 1JI0A 5CM8B 2OLJA 2BKEA 3E2IA 2QNRA 1LF0A 1B8AA 3GTQH 5KNCA 2WOJA 4P0TA 2KHJA 2ZJPA 1ZUNB 4JL6A 5JEDA 1HR0W 4HYYA 1KI6A 3AP2A 4X65Q 1ZIOA 1CR2A 2D7CA 1G3RA 1ZMXA 2J59A 2Z6KA 2QY9A 2UXBQ 3PUWA 1NJIC 2WWXA 3B1YA 3I8XA 3LLMA 4DSTA 1E2DA 1G18A 4DSNA 1UWVA 4B33A 3LV8A 5J5CA 4DLTA 4BPBA 2O8EA 2IWHA 1NSFA 2IHYA 2ZJAA 1E2NA 2E2HH 2A19A 3CR7A 3L0SA 4DT1A 2IUSA 4DLWA 1NVVQ 4Q9JA 2DY1A 2PBRA 1UEBA 4DV3Q 2QGNA 3SEAA 3PEWA 4NCNA 4QHYA 3NH6A 1TU3A 2OV2A 4OI4A 4EFMA 4RCZA 5IYDH 1IJEA 2GETA 4JLOA 2BMEA 4EFLA 1EX6A 4OJQA 5IYCG 2LSSA 1X1SA 1WQ1R 1E1TA 2R93G 3I7FA 1RPZA 3EPHA 2Q2TA 2VSFA 3RS2A 4Q47A 5F9HA 3RN5A 4JS0A 4M1KA 2D74A 1H9RA 1WE2A 2JLXA 2NN6I 5C3EG 3PVSA 1ZU5A 1N33L 3EN2A 2B63G 3LXRA 1VQPA 3OIWA 1I2MA 5AJYA 2CHQA 1XMSA 3CW2A 4HJ9A 3FWYA 4OJKA 3TAUA 1N5KA 2B8FA 2FA9A 3I8SA 2R93H 2C77A 3DM5A 4NHOA 3VMFA 4ZCIA 1FL0A 3R8CA 3UWOA 1QVFA 4EUNA 1OHHD 5F3WB 1CBUA 1DG3A 4DR7L 3AV0B 1CU1A 3F8TA 4OX9L 1BO6A 4W5JA 2GK6A 3W6PA 5EJEA 2XTZA 1FTNA 5AUQA 1EIYB 1I6VC 2ZI7A 3B13B 2B63H 4URUR 2NO7A 2AWOA 2G1JA 5EUQB 3ICQB 1J2JA 2WAQE 4YCWA 3WHLA 1CS4C 3T1YQ 4B32A 1RC8A 1VKJA 3HYTA 1IXRC 3FPAA 3SN6A 2ZJ8A 1C9KA 2CWAA 1IY2A 2R6CA 2YC2C 2JA5G 3L8YA 1G7TA 3ZIAA 4H44C 4DUGA 3QSYA 2K32A 1F2TA 2WMNB 2VSOA 4FCVA 3K8AA 3KLWA 1FQJA 5HZKA 5C0XJ 4HAXA 2ZJQA 3CNOA 4JOIA 3TZUA 1Q1ZA 3SYLA 2V4DA 3UDIA 3GTPH 3K0AA 3E9HA 1SN8A 1I6HH 3STBD 2IY5B 3DDCA 2G9NA 1SVWA 1YZQA 1EQQA 2W00A 4PQRA 3TUZC 5HR5A 3MGCA 3O47A 2PZGA 2VW9A 4JSYA 4DR4L 1UAAA 3R9WA 4RFVA 5FOSA 3DKVA 3MAAC 4TLAA 2ZU6A 2XXAA 2WWHA 1CF4A 3BZKA 1FX0A 1KSJA 1Y1VG 1QUQA 4IW3B 3EQLC 2XSZA 4UXHA 4WZAE 2IC5A 2GJ9A 4KMUC 1QVGA 1D2EA 2ZPTX 3TUIC 2Z6KC 1QZGA 4AG5A 5JFGA 3REFA 3W90A 4AH6A 3IRBA 4MRRA 5CIQA 4RY2A 4ASUD 2YU9H 3CF6R 4P4UA 4PQFA 1LV7A 2Q8IB 2J5XA 1Z7TA 2I0QA 3FMFA 2W6IA 4HB4A 2FSHA 1N2CE 4BQSA 3AFQA 3B1WA 1Z9FA 3WNCA 3EIQA 4Q1DA 4GKJL 5DLQC 4I4LA 1YHBA 1KKLA 4LF7Q 1IN6A 4LF6Q 3AF0A 4JJZA 1D2MA 1UM8A 3W5OA 4YWKA 4RD0A 2R9VA 2ZVQX 2ANCA 4B71A 1TUIA 1TMKA 2BEKA 1VDZA 3B60A 2H8KA 5GAEC 2N8NA 1DELA 2AR7A 2RHDA 4A15A 1NNEA 2AHOA 1XZPA 4TMZA 4JI7L 1WI5A 2HT1A 1FPMA 2YTYA 2KBEA 2X1VA 2ZREA 3CF2A 3P1JA 5DI3B 3FKIH 3KFXA 1VQMA 1K9MC 2J0VA 2FV8A 4GBMA 3RS3A 1YEZA 1T8UA 4IVQA 3O8BA 3TBKA 1XJQA 4X65L 3REGA 1XMIA 3Q7QA 3KL4A 4F91B 2TMKA 4ARZB 1S8FA 3UXMA 4F92B 4PO8A 3NEMA 3TNFA 4B3DA 1W4CA 3MSXA 3GLFE 3S2HH 1W0KD 3I92A 2JJ1A 5FOUA 1KIMA 2NVXH 2QTVB 1FGUA 1G4UR 2V1XA 3C15C 1M1YE 3LBIA 4ZI3A 3G0HA 3CZPA 3K80C 4DK0A 1S1CA 4Q7JB 3EA0A 4HZUB 1P72A 4NPHA 4KHZA 3CX7A 5B64A 2P6RA 3KJPA 1G291 4C3HH 121PA 3MLEA 1X6OA 4HJ8A 4F4CA 1ONBA 4UNPA 4JI8L 1LB1B 5EAYA 1N6PA 4TKOB 2ZTEA 2PZEA 2ZAMA 5JBQA 5J4KA 4TZ6A 5FBQB 3ZS9A 1B0UA 1P62B 621PA 4US2R 1HR0L 4OQNA 1P2TA 1W47A 4OQXA 1N0VC 4NYMQ 1A1VA 1PUIA 5EE9A 2V54A 1BH2A 5IYBH 2W6JA 2QMEA 1Q8KA 4DK1A 5IP9G 3LWNA 4PTLA 4MYCA 2Z83A 2X2FA 1HNZQ 4J15A 3C4JA 3PGZA 1AS2A 1KL9A 2D0PA 3K0XA 4UP8A 2I3BA 3SBEA 4HIOA 1PUJA 4PAQA 4ZDIA 2GCOA 1Q1EA 1W36C 2QRNA 4PFSA 4KLNA 3NC0C 4GOPA 4TTRA 3T34A 1WDTA 2YHSA 2FSGA 3NWJA 2UUAQ 4B2IA 2MFIA 4DK6C 4PAMA 3QKSB 4CZ2A 2F1JA 5J47A 5DI9A 1Z2CA 4LSGA 3H15A 5FI1B 3RZOH 1SVMA 3KYHC 4PAOA 4EPRA 3BG3A 1G8FA 3CKLA 3LRPA 5FUVA 3I56A 1W0JA 2JLWA 2O8FA 4Q4AB 4FD2A 3B82A 4A9AA 4CF7A 3L8ZA 3A1SA 3JZMA 3VQTA 3MG9A 3T56B 2V9PA 2ERXA 4U5XA 3HOZH 2CCKA 6Q21A 4JBJA 4MUAA 3K0AB 5L3VA 2UZ3A 2XITA 3GCGA 4LFBL 1E2EA 2A69C 3K0FA 3K1JA 5IYDG 1Q22A 2GXUA 1VIAA 2ZAOA 3NH9A 4Q4AA 3TKLA 2XZOA 3SNHA 2WAXA 5IYCH 1G3QA 3K0CC 1LUZA 1CEEA 4P33A 3SFZA 3A74A 4B3FX 3A37A 4BE7B 2FFQA 2XGJA 2W83A 1KK3A 4G7OC 1FMLA 3ND9A 4DR6Q 3WP0A 1RRCA 1A62A 1Z47A 1TF5A 2AUKA 3DVLA 2JA7G 1OE0A 3FTQA 5C3EH 2PCJA 1SQ5A 3K9GA 4K0KQ 2FGKA 3CP0A 2D06A 1MJCA 2MMCA 2OLKA 1WP9A 3FVQA 3LVQE 1E9CA 4ZIRB 4OQMA 3B85A 3EASA 4YDSA 3FPPA 4H9GA 2QP9X 4D25A 2ZI3A 2RGCA 4B35A 1VQNA 2Q9BA 1CIPA 4LUVA 3RZDH 1FZQA 3AKYA 3QE0A 1OH7A 3M7NA 1K8GA 1YZLA 3S17H 1KI8A 4HUQB 4DCNA 1J6QA 4MKGA 2JA7H 1JJ2A 3D31A 2H92A 4G5RA 4HB3A 4H1VA 3U3JA 3I62A 4BEJA 1OIXA 1VQLA 2VH5R 4HLUA 1XB2A 3IIJA 3HWSA 4A3CH 1KIXA 2CHGA 1NLFA 2ZEJA 1S72A 3BZCA 1K5DA 2H5XA 1S0UA 3M4PA 2OFWA 1GM5A 1E7ZA 5C0XH 1G7RA 1KJZA 1C1YA 1G19A 2G77B 1W44A 5JSZA 1RIPA 3BC1A 2JA5H 2ZE8A 4X66Q 4UNNA 4BZQA 5A4JA 3E0EA 3NG1A 1HA3A 1E2VA 1GVPA 2PLFA 4NCHA 5B57C 3H1TA 2ZS7A 4DR1Q 4TYWA 1AA9A 4CYMA 1Z6HA 4A0GA 1PA6A 2HJVA 2O0HA 3BXZA 3BU2A 4OHVA 4O3MA 1DAFA 2Z0MA 1QHIA 1HZBA 4FCTA 3ULPA 2OT3B 3D0FA 1E2IA 3GFPA 1DARA 3QVVA 4QBFA 3UK6A 4TYPA 1R5OA 2CW0C 4GOXA 4JCVE 4A0FA 3K0SA 3Q9LA 2C99A 4OKSA 4E03A 3DEFA 4E5UA 4HLCA 2BH2A 5KNDA 5G41A 1WBDA 3GLGA 4DLXA 4IPDA 2ALYB 3OTOL 4OO1I 2QSYA 3TQFA 1TWFH 2OAP1 2NVYH 1E32A 1XXHB 3UG6A 4C9BA 1VQ6A 1OT3A 3TS0A 2F9LA 2QBYA 4QG7A 1TKWB 3A4MA 2WWFA 3CRKC 3W8NA 4QKQA 1U0JA 2VSXA 1R9TH 2VP9A 4RCYA 1GUNA 1PH2A 1EFUA 2F3RA 2XNSA 3CO5A 1EIFA 3CPWA 3GLHA 3L0PA 1EWQA 4NYMR 2IYVA 2NIPA 1T5EA 1L2FA 2NQ2C 2Q21A 1Z0JA 3HR8A 3K0EA 2WHXA 2V6JA 4QC2A 4GLVB 4LF4L 5C18A 4DR2L 1XPUA 1KGDA 4QBGB 1YR6A 4WZBE 5DH9A 1KI7A 3VU9A 3W3ZB 1EQRA 4E09A 2IEYA 1VG0B 2VQFL 2A68D 2OSBA 3FMPB 1JPNA 4ZCLA 3PCOB 1AQYA 2XOKA 3PFIA 1TPZA 3QPWA 3GLIA 4LJYA 5K8UA 4AYBG 1N6LA 4J0QA 2ORWA 3EPKA 3Q85A 3RNUA 4A0RA 4AKEA 1PH8A 1MRSA 1X3EA 2GAAA 2YWGA 5FFMA 4NB3A 3PENA 2JE6I 2C35B 2BWJA 2WTUA 1ZM2A 4MNOA 3IHLA 4PHGA 1W49A 1JEDA 4HLDA 1CJKC 2V3CC 2PZFA 1GNPA 1UDWA 3BH0A 3Q3JB 2YOFA 1YHNA 2BEJA 4A36A 1L1OA 3H0KA 3TUJC 2BA1A 3P20A 1N6KA 1LVGA 3OIUA 1E0AA 2UUCL 1X3GA 4YMUA 4LBZA 2WICA 2NZOA 4JI0L 2BC9A 4JI0Q 2KA7A 4FI3C 2J87A 3NHAA 4M1TA 4R1JA 2QUZA 4CEIB 4QJ4A 4FWIB 1N5IA 5CDFE 2RHQB 1EUJA 4MKIA 4AK9A 5IRCD 1ZM4A 4C2TA 5E7IA 3TH5A 2MQHA 4GOPB 4GNKA 5EE1A 4KFUA 1YJNA 2VIIA 1W2BA 4I1VA 3TVDA 1JR3E 4AURA 4ESVA 3ADBA 2ZVPX 2O8CA 2ZQ5A 2REOA 2QF7A 1WYDA 4Y52H 2WSSA 1IAQA 4JI6Q 3I72A 2QE7D 5H8WA 1EWHA 3TQYA 2PJRA 4K46A 3GTOH 2GCPA 2VY3A 2ZJBA 1ZBDA 2CCZA 2PX3A 2O8CB 1YR7A 3RSLA 4YDHB 3TQCA 3T1HL 3BIFA 1NN0A 3HJNA 2BMFA 5CLQA 5TV2A 3LGJA 3EC1A 4ZI2A 1II8B 4A3IH 1Q20A 2W0MA 3RS0A 2C78A 4UNRA 1KOFA 4B48A 3J81j 1SKYB 3OF5A 1HH2P 1IXSB 3VTKA 4Q1BA 3A6PC 1TU2B 2P6UA 4Q1EA 3AB9A 3KLRA 1BKBA 2W2TA 4B2LA 5LPNA 4BECA 3K0FB 1ESMA 2XTMA 1E2FA 3I2ZA 2EFEB 1KI3A 1J90A 2V6IA 1P6XA 2A2ZA 4JLNA 4IDPA 2VQSA 1E22A 1GNQA 1YHQA 2FEMA 1JAHA 1FP7A 4HIMA 4DR3L 2Q3MA 4PSAA 2ZRGA 1IBLL 2WKQA 2PPBC 1GOTA 4A3MH 1HTWA 4LJZC 1LF5A 4ILEA 5G3YA 1LS6A 4A75A 4GSYA 2Z4RA 4WZ6A 4M9SA 3MXUA 3UG7A 4YY3L 4ITRC 3OYYA 2KBFA 3I4MG 2ZYWX 2G83A 1JB1A 5BQ5A 2IYUA 5FBRB 3I73A 2O5JC 1XTSA 4BWYA 4KVAA 5LD2C 1ASYA 4K8OA 1IBKQ 3IDQA 5FJ8H 2ODWA 2CLSA 4H13C 5DI3A 3TLXA 3UPUA 5GJBA 5EP4A 3EZFA 1ZCBA 2ZSEA 4KODA 2NZJA 5IK2D 1EFTA 4C4PA 4LNQA 2GVAA 3QJYA 4BY7H 4YCUA 2YTXA 2CNWD 2ZRBA 3I4MH 1KI2A 2VHUA 1UEJA 2VRWA 3DZ8A 4V02A 1LW7A 5DNYB 1YU9A 1E99A 1E2KA 4RD2A 4MZ9A 2A6HC 2NVTH 3GTMH 3TS2A 3NEYA 3NVAA 2K7VA 1TQ6A 3QXJA 1Y1WG 1EFWA 4B3TL 3FMIA 5FJ8G 4DUGD 1K8RA 4YMSA 1PH6A 3A5ZB 1RL2A 4JBMA 2KI5A 4RJLA 1OXXK 5DO9A 4B3BA 4AYTA 4OK6A 4PPFA 3B2EA 3DOEA 4GP7A 4WAUA 1H9KA 4HIKA 2MO0A 1KYIA 1XEXB 4X62L 3PO2G 2ZETA 3HOUH 3RN2A 3T35A 5KSYA 1KTVA 2A5JA 1Q86C 1K73C 4BXXG 1MABB 1KJWA 1Z6YA 5M5YH 2A5YB 2P5TB 2ZJYA 3AF2A 3K9NA 4C30A 1Z29A 5KSZA 4TVAB 4G5OA 3H86A 1VQ4A 3IO3A 1VPLA 1FTSA 4G5GA 1T5LA 3K70D 1UBFA 2Q3HA 3VKGA 5C0XG 3IFTA 3N70A 4DV6Q 3CX8A 1R5BA 4A4DA 2EQBA 1WBBA 1K83H 1G16A 5GQOA 1F60A 3CD6A 4Q1FA 4QIWE 1DAMA 3PG5A 4QGHA 4ZPXA 3SJBA 2E9SA 3K81C 3LBNA 1KDRA 2HF8A 4BLRA 2IW3A 1P73A 4K0KL 2AK3A 4M9XA 3UMRA 1WFQA 1BYUA 1XXHA 1NY4A 5FLMG 3PUYA 1Z83A 4BBRH 4ME3A 1N25A 1A2KC 3W5JA 1ZNXA 2UVQA 4GN5A 3OESA 1G1MA 3NDBB 1TEVA 1XTJA 2PI2E 3AVUA 1NN3A 2E2JH 2ODBA 4XVUA 2QAGA 4CEIA 2O8DB 4LYAA 2VUMH 2QEQA 4TN1A 1N5LA 2NN6H 1B9NA 3EZ6A 4CT4B 2PI2A 1ZYRC 1I50H 4I7ZC 2HT6A 2E2IH 3UMFA 1QZXA 1JE5A 2VLIA 3TR5A 2N42A 3J80c 1R10A 2O5IC 2VNUD 2YC4C 4KVGA 2N46A 2E1RA 2DR3A 3U44B 3M0EA 2IF2A 5HPYB 1UJ2A 1LNZA 2BA0A 3PR1A 4ACBA 4UJ3A 1Y8PB 1GG2A 1R8QA 1RRGA 3ER0A 2WOOA 4DLYA 2OQ0A 1FVIA 3CXCA 2J0SA 1S96A 4DV4L 2PQAB 1RW4A 2QT0A 1IN7A 3A1UA 4EDHA 3KJOA 5JJKA 4DV0L 3U5ZB 5C4JH 4MITA 1E6CA 3RANA 1DEKA 1W3SA 5IWAL 4LI0A 3P26A 4Q66C 3HOWG 4QNMA 5LMUQ 3SBDA 3A36A 4BLSA 2G0NA 2WWGA 3OEEA 3HPQA 1LM0A 1A4RA 1WOCA 3VNVA 5BN5A 4H0LC 2UUBQ 4NCKA 4X8OA 5K36H 3LO5A 1TWGH 4Z8YA 4QM6A 3D7MA 1CRQA 4B3XA 1G8YA 5H1SE 3WP1B 4TZ0A 3THYB 1OF1A 3WMFA 1KK2A 4F7WA 4DCSA 4LK2A 1VS0A 4P31A 2A5FA 1V43A 4AY2A 4YCVA 1XBTA 1BVSA 1LFDB 1FQKA 4A82A 3JZAA 3D6TB 2JA9A 2A5DA 2QBYB 2IHEA 1XCGB 2P67A 4KI0A 3ULJA 1NVWQ 2JDIA 4NH0A 2JA8G 3K09A 5F98A 3IQXA 3DOFA 3O8RA 4DUYL 4JYAL 4B2PA 3DXJC 3RSOA 1PH1A 3OW2A 2UU9Q 5FL7A 1QHXA 4JBWA 1AJEA 2G6BA 4DLUA 1ZKOA 2B92A 3SFVA 1U81A 5TVKA 2ZROA 3B6EA 4Q7LA 4W5WA 1OYYA 4LF9L 4Q4JA 5DISB 1T3SA 4DKXA 4CEHB 4NYJQ 4QNRA 4DJTA 2O52A 4LGMA 4LPKA 2OILA 5E95A 1IOZA 4M22A 3RHFA 2OAQ1 4DCVA 5IK2A 5FPSA 2GJ8A 2O8FB 1P16A 3DM3A 1K3RA 1IN4A 1NSTA 1KNQA 2YJTD 2WMOB 1CSPA 1EOVA 4TL7A 4JI7Q 1AK2A 1X8JA 5TXGA 1TWHH 2JA1A 3IIKA 5EZ6B 4BFSA 1Y69U 4LF4Q 1OH5A 2ZRJA 2BVNA 2ZYTX 1Y8OB 4QL3A 3ZD6A 1S4QA 2Y8EA 5H70A 3MWLA 1CR1A 2RH5A 3KKNA 4A3IG 4C0SA 4DDTA 1MV5A 4IFDG 1KD1C 5C4GB 3L2PA 1PH3A 4LF8Q 1S2MA 2RGNC 4LF6L 4BY1G 4HR7B 2F1RA 1VQIA 2CCJA 4LBVA 1ANKA 3D4RA 5M3MH 1U98A 721PA 1CRPA 4LFCL 1KI4A 1D8TA 5FTJA 3CX6A 2IS4A 1CTMA 4AYBE 1E1RA 1YQTA 1VQKA 2YWHA 3NEJA 1EFHA 4HIDA 3K0CA 2QMOA 2DWPA 3H3VH 2V8OA 4LFBQ 4IFDH 4NTZA 5FLXc 2EJFC 2MO1A 4A93H 1K6MA 2V7QD 4Q9KA 4YXWD 3OPOA 3L43A 2ZU0C 2O8DA 5L3QA 1WA5A 1YZTA 1HNXQ 2YINC 3FFBA 2ZITA 1MKHA 3K9LA 4GMXA 1N6HA 4DCUA 2D0OA 3CAMA 2R44A 4GKKQ 4ZDJA 1U9IA 2HCJB 1XU4A 4DR1L 1FW6A 2UXCL 4LFAQ 2FPLA 2KHIA 2OCYC 1GVNB 2VEDA 3B78A 1F2UA 3UWKA 3I4NG 1ZAKA 3T1HQ 4A3KH 1TTTA 2GWHA 4B47A 1E1QA 1VYUA 4CEJA 1BMFD 2W2VA 4C0HA 2K5NA 3PIPA 1GUOA 3NENA 4JI6L 3P32A 4ZCMA 2FSFA 1OJLA 1Z8FA 1KMQA 1UDXA 1WJJA 3E9IA 4OXPA 4AQYL 2PEZA 2B29A 3OFND 4LBYA 4YWMA 1EX7A 1SMYC 4RZ3A 2IYWA 3VKHA 2NO1A 3E70C 3R20A 4JZKA 5JWHA 1Y1WH 2FH5B 3GTLH 2JEAI 4UJ5A 1KSGA 1QJOA 1HQCA 4JT4A 4Q4HA 2J9RA 2RGBA 1II9A 1ZCAA 1I2DA 3CIOA 3J80i 3T1YL 2BM1A 3KX2A 4A3BH 4IEIA 4LHWA 4NL4H 3QG5A 1N0WA 5AJZA 1N9WA 1YVCA 3OE7A 4RZUA 5E4FA 3JC66 2HLDA 4U7DA 1E2JA 1GSIA 3CM0A 4RMFA 1QHGA 2WVJA 3DHWC 4PO9A 3EPJA 1N36Q 1E9EA 3CNNA 4XWOA 2QN6A 4P72A 3A4LA 5CB6A 1SVOA 3FHWA 1US8A 1WXQA 1C7YA 3OW7A 3KF6B 2A78A 1MO6A 2RGAA 1JT8A 2FFBA 1MH1A 4GOPC 4P4SB 2Q3FA 4JOIC 4XWAA 3U7HB 3T53B 3KDFA 4L4UA 1AGRA 1IM2A 4A3BG 1JPJA 4H1UA 2YV5A 1EK0A 4C7OA 1IBMQ 1CLUA 1I3QH 2N49A 3U58A 1FUKA 2JJ2A 4A3DH 5DLQE 4I81A 1GL6A 2ZRDA 1D5CA 3EPLA 5JEAG 4XVRA 1G5TA 4FMDB 2OM2A 3U3RA 2VHJA 2FDCA 2JIZA 4HUQA 2WWIA 2ES2A 3FE2A 4DLZA 3Q8DA 4B75A 3T1OA 1MRNA 1GUTA 3GLFB 3WYAA 1U99A 1G8GA 1AS3A 4P3YA 4TMVA 3UE1A 1VHLA 2GKSA 3H94A 4TYNA 1VHTA 4A3LG 2ASBA 1XRJA 1T4GA 3IBYA 3K8YA 3QNUA 4TQAA 3U50C 4EX5A 3GJ3A 5JEAH 1HE8B 5DHFA 1A6XA 2HF9A 3MEFA 5KSPA 1L2TA 1WCMG 3W6NA 1NJGA 3OEHD 5G40A 4IXMA 1XNRL 1IY1A 1GWNA 1TADA 2ZE7A 4MKHA 4AIIA 5JS8A 2BIFA 4GKJQ 4XH9B 4B3CA 4PANA 1QUQB 4GNXA 2ZRFA 2ZTDA 1W5TA 2IBMA 2ODNA 4NXNQ 5K8IA 4TL9A 4A3LH 4R4IA 5BR8Q 3GTKH 1DAHA 1XEFA 2JQOA 4YMVA 3IKJA 1O3YA 1VCNA 2VO1A 3FDIA 4TMTA 1SVLA 2NO6A 4O25A 2KENA 3GJXC 4ON9A 1WCMH 4UNSA 5CDFA 4BA1I 3NELA 1GP2A 4M1OA 4CW7A 4D0GA 3HU3A 1XNRQ 3PO3G 3A1VA 1NMYA 3R7WB 2Q9AA 4Y0VA 2ECKA 5TB5A 3X2SA 4AG6A 1DAGA 2OBNA 2PH1A 3LY5A 1KZ7B 2J3EA 3AQQA 2VBCA 5CYOA 4EJSA 4AKHA 3DKPA 4BLPA 4CDGA 3TSOA 1EGAA 1KC8C 1KK0A 2I1QA 1XNQQ 1G8HA 1KJYA 2QU8A 1SHKA 4M9QA 5JI3E 2JA6G 3RLOA 5L3RA 2ZM5A 2ZR7A 4KKTA 2F55A 4NCIA 2V1UA 4LUZA 4NCJA 3SQXA 2YYZA 1KHIA 3S1QH 3PO3H 1EFRD 3BGWA 1H9JA 4JV5Q 3WHKA 3IEUA 1SLJA 1SMXA 3X1ZA 1OFIA 1VQ7A 5JEAJ 5LMNQ 1E1RD 4M1WA 1XTIA 1SXJA 2ZJ2A 5C0XI 1GO3E 2PNHA 3E1SA 2R92H 1G41A 2H7VA 3BWDD 4XSGA 4B6EA 3AH8A 2IEZA 2SHKA 2BCGY 2E87A 1SXJB 2CVFA 4WVFA 1E79A 4GOKA 4PG3A 4L5RC 1XWIA 1Z22A 2XJ4A 3BFXA 4Q00A 4WBSA 1X8LA 4HLUC 1XTRA 4MGZR 1N36L 1G5RA 3TREA 4JKIA 2GCNA 5HCNA 1XMQQ 1P9NA 3H4MA 2F4VQ 5IP7H 4GZYC 2HIXA 2G88A 2XTNA 4JBKA 2IK8A 1EWRA 1WCV1 3OIVA 1NBME 3B1XA 3C8UA 1I4LD 3CONA 4NZYA 4PZ6A 4EIWA 3JAMi 4JJKA 2BOVA 1GKHA 2CDNA 4V0KA 4TLBA 1ZNWA 5FOVA 3U7FB 1QBKC 3ZZ0A 4LK1C 1KO4A 2RHMA 2VL7A 3HOYH 4L9WA 4RD4A 5GROA 3NBXX 1KRSA 4DK3C 1R0ZA 3FGNA 3IHWA 1Z6TA 4ZDWA 3GLIE 3PQCA 1ZD8A 4AI6A 2ZJZA 4DLVA 1KI9A 4C0JA 1E9DA 1XD2A 2YNMA 1XFAA 4PMWA 2IYZA 1GUAA 1FOEB 1G4AE 2Q2HA 1NLYA 1T0HB 1HCZA 4JLDA 4GN3B 2QPTA 1U8ZA 3HR7A 4RZ2A 4MRNA 1OPXA 2VS1A 4YHHL 4BY1H 2P5SA 1H8HA 4CEJB 3OE7D 2OHFA 2ZRNA 4YLGA 3F2DA 3AKEA 4OI0A 4OONA 2QM8A 4IFDJ 4B73A 1BBUA 2NTYC 4II7A 4OK3A 2UXCQ 2CFMA 1QVRA 2FG5A 4GLXA 4LYJA 1Q46A 4US1R 3VR5A 4D26A 1F2TB 3IILA 1UFQA 4GKKL 1R0WA 3MD0A 3LBHA 2IXEA 4TYYA 2DN8A 1HPCA 1F5NA 2D62A 4A3GG 2HJGA 1U0HC 3Q8XB 2QTHA 4GOJA 3BE4A 1HNXL 5EXTA 3IPYA 5LBIA 1LABA 4A93G 3IIMA 4YHHQ 5L3QB 1JALA 2QP3A 3CH4B 4QHSA 1LYLA 3BK7A 3K9HA 4X8LA 3U3MA 2O0KA 3QPVA 4M21A 4ACAA 1CXZA 4LJ7A 2MNAA 1PJRA 5AWFC 3RABA 1OSNA 2DWQA 1VQFA 3LAWA 4D0NA 1HT1E 2DWOA 3AVQA 2XXAB 1W1WA 3TR0A 4NP6A 2LXKA 2UXBL 1SZPA 3AP1A 4GP6A 4KLZA 4O2LA 2FU5C 4RKEA 5EE0A 1BOFA 4IOLA 2ZTSA 5HGQA 3GLIB 4IDQA 4QXAA 2BV3A 4L9SA 2ONJA 1VQJA 3A0JA 3KF8B 3CMAA 4G01B 1NIJA 4PPGA 1QHSA 1T0JB 4LHZA 5K8LA 3F5FA 3LQRA 4D4JA 3CC2A 3GDEA 2HQLA 1E1OA 3W1GA 1IBRA 5IY0A 4DPGA 3NXSA 1KNXA 2FN4A 1XMQL 2XSZD 3KDSE 4AYWA 5SZHB 2ANBA 3KJHA 2OXCA 4BLQA 4DV6L 1OV4A 3QXSA 5TY0A 2H16A 3KQNA 3K70B 4OHZA 2QRZA 3M3YH 3JVUA 1E2GA 2Z43A 2ZRAA 1QDEA 1L1OC 1E1QD 1OFHA 3UANA 4UP9A 2IS1A 4WA7A 3GQBA 5A35A 3CCSA 1OXUA 3KOJA 4LC1A 3CCLA 4A76A 1HE1C 1VYTA 4HATA 4ALPA 2GVDC 4ZIRA 1J8MF 2WJHA 4JVNA 3E5HA 5FPKA 1BKDR 1MR3F 3ASZA 1A0IA 1YNXA 3RRYA 3VHXA 5JECA 3WYFA 2XX3A 3IEVA 1ZJ6A 4WOPA 5FPHA 2GHIA 4Q4JB 1XNQL 3RYTC 5HE9A 1E98A 2K52A 1NP6A 4BEBA 1ZINA 3I32A 4PV1C 4A3DG 1H8ED 2B3GA 3LH5A 4ARZA 4A6PA 2EJGC 3KTAA 4IVPA 5CM9C 4CEHA 1TL7C 2VHTA 4JLVA 1Y14B 4JI5L 4LJ6A 5IT9c 1E0KA 2GA8A 4ZKEA 4LYFA 1H65A 3ECCA 1Z2AA 1VQGA 4A3FG 2OE2A 3N2EA 4Q9LA 4YMWA 4HAVA 4JLKA 2LMCB 3RR5A 2R7DA 3EW9A 4U02A 1N34L 2AXPA 1VQCA 1W0JD 2WIBA 5EP1A 3BFVA 3H3VI 2ZS8A 1SVSA 3HYRA 2FPMA 4IJHA 3TRFA 2NGRA 5J4YA 3PEUA 2D2CC 2LKDA 1B9MA 3L82B 5FBLB 3ADDA 4BUJA 4M8NE 3AQ4A 3A8IE 3GP8A 1IW7D 3TW4A 4K81B 1O78A 2JIZD 1UE7A 5KPJA 1YZ6A 221PA 2NVQH 2VPPA 3ZIAD 3GLGE 3FKIG 821PA 2CK3D 3AVYA 4PO1A 3LWUA 5KNBA 4PX9A 4TSFA 2NPFA 1UKZA 4DR4Q 1Q3TA 4G0NA 3H0GH 2BJWA 1RJ9B 3KZ1E 4Q4LA 2UXDL 3A7LA 2OCBA 4QBHA 1XTKA 1SKYE 1CULC 4JI3L 1NI3A 2ERYA 3IBGA 4GI7A 4D0LB 3CMEA 1N32L 2GRJA 3O8DA 4HAZA 4QRHA 2W6JD 3LVRE 2XZLA 1AM4D 2C98A 2VP4A 4KHPQ 3PIOA 3QKUA 2AKYA 1II0A 4B3GA 1G64A 1Q0UA 5B58C 1NY5A 2RGGA 4TWZA 2Q2IA 1KY2A 2YOHA 4Q9HA 4EAQA 5KDDA 1OH8A 1KDTA 1HV8A 1MKYA 4JT2A 4LF5Q 1G5PA 1GRQA 1PLKA 1JB7A 2CHVA 2PLRA 1YJWA 3H0GG 1MO5A 1HURA 4IOMA 1Z6GA 4A8JB 1K8MA 2OUKA 4NONA 2J7PA 2UU9L 5C44H 3ZJYC 1E2QA 3Q5DA 1L4UA 2F3IA 1RRPA 3AUXA 3GMTA 1W7AA 5F9FA 1X3FA 4UP7A 3UDXA 1J8YF 1E2LA 1NBMA 2BKUA 1A82A 3B7GA 5FOXA 3K53A 4B76A 5J4HA 1NKSA 3FFAA 2ZXUA 4LBWA 2R6AA 4LV6A 2YTVA 2A69D 2IXFA 2XJ9A 3EA5A 3KB2A 1JECA 1C9OA 4R98A 2NG1A 1G3MA 5EP2A 2I5LX 4C3ZA 2YVUA 5BWMA 4UQOA 4HI0E 2AWNA 2RHSB 5JCZA 5M3FH 3GLGB 1FMJA 1P60A 2NPIA 4PPQA 3L0OA 2FFHA 4JI1L 2EFDB 4QOSA 5DYIA 5GVRA 2ZJ5A 5IT5A 1TF2A 1IN8A 2WJIA 3R7WA 3WDNA 1KMHB 2UUBL 3WMEA 3S1RH 3F2CA 2OG2A 4O2RA 5IP7G 1IXZA 4PR0A 4P75A 4IDOA 1QHHA 4D4MA 4MDFA 3THWA 3P4YA 2WSMA 3D8BA 1AQUA 2F52A 2DNCA 2I4IA 3T12A 3G4SA 4DV2Q 4IPHA 4HJAA 1PZNA 2L0XA 2GK7A 3I61A 2K75A 2RGEA 4HB0A 5EXPA 3ZVLA 4IVRA 2CEAA 4B3TQ 3PF4A 2J7KA 5CB8A 1CFMA 3F1ZA 2G3YA 2K5HA 3CUEF 1ZYUA 3U3KA 1NTGA 2FF7A 1N32Q 2RCNA 1T91A 3ZVMA 4D2IA 4BFXA 2YKGA 3KDFB 1X8KA 5A5GA 5DYGA 4RCNA 5AJ3Q 4DNTB 4OBEA 5FTMA 2R6GA 2ZYUX 5JCPA 1V5WA 2QA4A 3LW8A 4DXAA 3FOZA 4X6AH 4OL0A 3QXCA 2HEIA 3CC4A 2Q9CA 3H2YA 5EP3A 2DGYA 2FGJA 2IYTA 5J4VA 4DB2A 4JI2L 1IONA 4IO9A 4A3GH 4B34A 5J3BA 1U5KA 1BMFA 1VMAA 1XEWY 2REBA 4TQ9A 2VP5A 4JYBA 1L1OB 1E2PA 5IE8A 2VHCA 2H17A 3SZRA 4CGZA 2JLQA 1P8LA 3EWAA 1JQJC 2WPDD 1GAJA 1SKQA 4DEYA 4UXIA 4BRUA 2XB2A 4BZXA 3WY9A 4Q01A 4B3ML 5JI2E 1Z0FA 2LCFA 4JSTA 3RS4A 2D4HA 2F6RA 1M1KC 2HV8A 2PL3A 2WIAA 5KHOC 4R9UC 1AN0A 4A3CG 1N5JA 1IW7C 3N5CA 1I4TD 3QF4A 1XNJA 3MXNB 3ZLJA 4N0EA 5GAGC 1NL3A 1E9FA 2EU8A 5M04A 3BAFA 2HLDD 4C2UA 2F3TA 5KYKA 1IQPA 1RYFA 4LUCA 1Z0AA 2HHHL 3GLHB 5DSZA 4URYR 2LXJA 1BIFA 1VECA 5GJWC 3NBYC 2GVZC 2GJAA 5FTKA 2GAOA 2OEPA 2QP4A 2BE5C 4JVSB 2C9CA 3RC3A 2G1KA 1I5FA 4DLRA 5FBVB 5JMTA 3LNNA 1ZU4A 3MWKA 3TJZA 3PUVA 2BHRA 5C4MA 3U6KA 2BMDA 1M7GA 5LMUL 5FPTA 4Z1MD 2QT1A 3R8FA 2E5LQ 1OXSC 3U4VA 1A63A 3QEOA 1J7KA 4EFNA 1Z3IX 3AP3A 5DGXA 4UPAA 2QI9C 2ZT9C 4TT3A 1XF9A 3UE0A 3SYNA 3J7ZC 2CBZA 1OFTA 1OIVA 5BN4A 3BFKA 4E07A 2QMUA 3GJ0A 3T1QA 2A8VA 2XOKD 1YR9A 2R6DA 2JXMB 3TE6A 2GJSA 1HQMC 1PYSB 1JJGA 1HEIA 4C2MH 3C14C 2JEBI 1MOZA 1AGPA 1FJGL 1JXOA 1QF9A 4GZLA 2IA5A 3MUFA 4FMBB 421PA 2HXYA 3BORA 2A7QA 2QAGC 2QL6A 1P5ZB 4KFRA 3K7UC 2OO7A 4JI2Q 3LNCA 3RRMA 3WRXC 1E3MA 1DE0A 4A2QA 3CLVA 2VQEQ 5SZJA 3SJCA 2VQEL 5L8VA 3WMGA 4A3FH 1V1QA 4HAUA 1TWCH 4Q5IA 1Y1VH 1RIFA 1Y3AA 2RB4A 2GTPA 2MSCB 4L5TA 2ZJOA 3EAQA 4LHVA 4QBIA 2IX0A 1Q81C 4FMDF 5JHGB 4URXR 3M85A 3RRZA 1XDBA 4RD1A 2Q6TA 5LB4A 4FWTA 1IJFA 1O7LA 1NBWA 5L3SA 3Q72A 4M2LA 4E22A 4A8JC 1UE6A 1U8YA 2WJVA 3JVVA 3T5GA 4G1UC 4DT1B 3ZZUA 4XD7D 1ESNA 1NMZA 1SGWA 2AD5A 2CCGA 1Q82C 2RGXA 3B5JA 2QROA 3NBZC 1Z28A 2A1AA 1XP8A 2CL0X 1MIUA 3CCRA 3KUDA 2EWWA 4JLMA 1EG7A 4LC0A 5FUWA 4BRWA 1IHUA 1J5EL 3TK1A 5EXXA 1G7CA 4YMTA 4B3SL 1ZD1A 5D3QA 3RWOA 5GADC 2WZQA 2HCBA 4EPXA 1II8A 4QM7A 2EQSA 1QZHA 3OOCA 2O0JA 1HT2E 3CWQA 4NYIQ 3X1WA 1YR8A 4ABYA 1VCMA 3MFYA 1JBKA 3VX3A 2YWFA 3U44A 4V03A 3KTAB 4CVNA 2QTFA 2CQOA 1E0SA 1GUGA 1GRNA 1ZM9A 3B1VA 5FL3A 1YIJA 1XD8A 5G53C 1UBCA 4KBFA 2FE4A 2J0UB 2B7BA 5A0FA 3HDTA 2E76C 2GEUA 3PSIA 2NOAA 4HEJA 3ZYCA 4TTQA 2Y0SE 4OHYA 2K4KA 1RZ3A 2QMHA 2F9MA 2Q2UA 4JIMA 1TEXA 1IYJB 2R8RA 4P74A 5C44G 2OBMA 3OAAA 4Z1MA 2ZSAA 4M4SA 4JI3Q 2KCTA 2V4ZA 4KYUA 3BB3A 4A2WA 1X3SA 2CXXA 2E75C 3HKZG 2ZIAA 3IUYA 3MJRA 3NBFA 4KSCA 3RDPA 3WRYC 1VQHA 1PVOA 2VP2A 4TLEA 3RWMB 4DDWA 1KY3A 1N6NA 3GJ6A 2ZI6A 3GPLA 4WJ4A 1DS6A 2GF0A 5FUXA 4JI4Q 4HSEA 4TMXA 5DIFA 2ZRPA 4TL6A 2GCOB 4EPTA 1XEWX 1X56A 1KAWA 1VQ9A 2GN5A 2ZRCA 4DZZA 3KB1A 4I99A 3VR1A 5DE3A 4APVA 1YRBA 3P4XA 5CITA 1P2UA 2R7ZG 2ZJRA 1ASZA 1SRUA 1I4DD 1J70A 1YZKA 4R4QA 4KHPL 5LD2B 4IHQA 1QHHB 2WFWA 4W5HA 5FL7D 2FJUA 3HOZG 1Q90A 4PSKA 2EJMA 2DPXA 1F6BA 3CZQA 3N2IA 5KOYA 4G3XA 1D2NA 1A5TA 1Q44A 2VF7A 3KKQA 4FN5A 2H1LA 1RFLA 1I94L 1I94Q 2MMGA 3MMPA 4XSHA 4ERNA 3W5IA 2WWYA 2RGNA 4BFVA 5E7NA 5C46F 4JL5A 1EWIA 4YWLA 3B8HA 3LW7A 1HYQA 4LF7L 1VQAA 3STBC 1E2MA 4YQFA 3GTGH 1AIPA 1JNYA 4JBYA 4LYHA 3SHFA 4LZZA 1OB5A 2K5VA 3SS8A 4D4KA 3Q7PA 3PF5A 4LF9Q 2XTIA 3LLUA 4DLSA 4MTNA 1SXJD 2DHRA 4NXNL 1X1RA 3AEZA 1T8TA 3C5CA 3KKPA 4B3RQ 4OO1H 1GNRA 3NDPA 2B7CA 1CTQA 1MT0A 2ZRMA 2KB0A 4JKYA 1XZQA 5JJLA 4BY7G 3VNUA 2WJJA 3ZVNA 2DFNA 4BFYA 4D82A 2A68C 4DUYQ 4JYAQ 1R6BX 1KMHA 1HZCA 2QEXA 5FTLA 3U4ZA 2PT5A 2ZSFA 2JLSA 1UE5A 3AVPA 5CK5A 1GD7A 1MJEA 1CUKA 1VQBA 1AH9A 3BBPA 4KJZA 3A1WA 4DV5Q 1E0JA 3AEVA 1SXJC 2ZANA 4HZIA 2ASEA 3THXB 3CCMA 1PV4A 2ATXA 4QJ5A 2UUAL 4B3MQ 2IT1A 1K8OA 1TQ4A 3K7AH 5HTKA 1Q3HA 1L7VC 1VIYA 4LWZA 3LX8A 4HAYA 3HOUG 4DSOA 2J41A 1HJPA 3OAAD 3PV0A 2AHOB 4DIDA 1YRAA 2XGTA 1ZW6A 3MJHA 3Q5EA 4C3IH 2O5VA 2XAUA 3B9QA 1F48A 1Z0DA 1IBML 3EBEA 2OBLA 4O2DA 2GF9A 2GZHA 3NIBA 2EXDA 1GDDA 4PZZA 4RZXA 3WNDA 4DWJA 3CB4A 1FL9A 4R4OA 5ELOA 3EG5A 1XX6A 4DB4A 4Q02A 4TYQA 3IQWA 2X19A 2ZM6L 2C9YA 2ZSDA 3ADCA 3SGIA 4NXMQ 1UADA 4FCWA 1G21E 2NO0A 2ORVA 5LB2A 2AN9A 4POAA 3L7ZC 1JR3D 1S1MA 4RG1A 3IGFA 4TLCA 4QJ3A 3CCJA 1H8EA 1GITA 4DV4Q 2UUCQ 1UBGA 1ZNYA 5AUOB 3I4LA 1OHHA 4Q48A 5FLMH 1QVAA 2DFTA 2ZR0A 1WB9A 4L8JA 5AJ3L 2IYSA 4QJFA 1M74A 1VCOA 4QGUA 1R5NA 2UXDQ 1NG9A 5J4LA 4HUTA 4A4IA 3S1MH 1G6HA 4IKEA 1G17A 2UKDA 1GHKA 1V9PA 4LX0A 2VUMG 4DR7Q 2NO9A 3C41J 1TWAH 2N78A 3TGPA 1G8PA 5JEEA 4V0LA 1KAOA 5EUMA 1VTKA 2H18A 3PEVA 1UEIA 1T5IA 1ZC3A 2WSSD 3QI2A 3J81k 4HZUA 3WXMA 1HH4A 2A6ED 4W9MC 3NE5B 2C9OA 1GTVA 1VG1A 3VFDA 5EZ5A 1KAGA 5JWOA 4LJ8A 1ZP6A 4BA2I 4DAYB 5C1BA 4DNIA 4KN4C 4DAMA 2MSEB 4LOAA 4YONB 1UBEA 4OWWB 3RRNA 1SXJE 2AXNA 1Z5ZA 2ATVA 5SZKB 3SQWA 2JLRA 4QY7A 3GLHE 3CF0A 1Q21A 1VF7A 4A3JH 2GESA 4IEEA 4KBGA 3HOWH 3SR0A 2BM0A 1CP2A 1E94E 1KSHA 1LTQA 1KDPA 2WAYA 4MGIR 5AK0A 3PUXA 3CCUA 4LRWA 2IS2A 1DG1G 5GAHC 3NBHB 4PPNA 1XJVA 1W2GA 2CVHA 3S2DH 2R6FA 4EKDA 3VU9B 2YOGA 2GZDA 1MO4A 4N3NA 4RD3A 2IHFA 4QQBX 2DBYA 3QG1A 2N3SA 1PH4A 2DFKB 4LV5B 4N0DA 2YWEA 3AF4A 4DCTA 4LV8B 1SE8A 4R7ZA 4A3JG 2FFAA 3QBTA 4D4LA 2YZ2A 1SR3A 1GILA 2HIVA 1KHTA 3MWJA 2AKAB 1CKNA 2QG6A 3GFOA 4ASUA 5JLJA 4JMPA 1Z08A 4NYJR 1E2ZA 2A9KA 2WP8J 4LF8L 2J7PD 4US0R 3FHTA 3GEIA 1NG1A 2ATWA 2JA8H 4JV5L 4JI8Q 2EFHB 3QF4B 4D6PA 2GXAA 4R4TA 3GFTA 1MO3A 4BASA 2VP6A 1KZGB 3KQUA 2GXQA 2F4VL 1QVCA 3QUSA 2N1BA 2JJQA 4XD7A 3ZQ6A 3CRW1 2QZ4A 1VQDA 4OWXB 2OXRA 2XZPA 2ZI9A 3OZXA 4OYHA 4TMKA 2QM7A 5IDVA 3THWB 4AKGA 5ANRB 4XJXA 1VQOA 1P61B 2EWVA 2ZRKA 5HZHA 4DNRB 1Q1QA 2H57A 3LXXA 1R8SA 2OWOA 2WJYA 5HCIA 3DM9B 1GZSA 1GRRA 4OWTB 4FXPA 1M6NA 4JLJA 2MSDB 3S14H 3CWZA 1VCIA 2WJGA 3T5DA 3LQQA 4DR6L 3F0TA 2IF0A 3QENA 2WKRA 4PZYA 3VAAA 4S2EA 3S1AA 5FR2A 2PCLA 4IOKA 3THXA 3MCAA 1E3PA 1ZRHA 3V4FA 1E2WA 2EFGA 2P65A 5M5WH 3ZGXA 4JYCA 2I5HA 4UY8C 2VF8A 3UKDA 1CR0A 4DIEA 5TMPA 2F1IA 4GNXB 5BYJA 4BFTA 2KCCA 3RS5A 5IYBG 2PNRC 3B6YA 1L0WA 1M8PA 4DR5Q 4C0QC 4KCGA 3CNLA 1CI3M 1B70B 1NMFA 1YE8A 4URWR 2JJ1D 4KXFB 1S3GA 1KO8A 4KFSA 4A0HA 2DFLA 2J45A 2QORA 1OYWA 1JQLB 3ERSX 3A1TA 1KK1A 2KE5A 4PZLA 3THYA 3VR2A 4IFDI 1OW3B 3AKDA 3UMSA 3QXXA 2BMJA 2IYXA 1PH5A 3P27A 1IYVA 1D9XA 2C2HA 2ZRHA 4M1MA 1JJ7A 4X64Q 1YJ5A 2C5LA 4P71A 2XEXA 5IHPA 4LJ4A 2BBWA 3GJ7A 5FI0B 1ZNZA 2LWIA 1YZNA 4JL8A 1OKKA 3PITA 4Z51A 3KQKA 3I55A 1Z06A 5AJWA 4IFBA 4BFUA 1N6OA 1QRAA 3A7AB 3I4NH 2OFOA 5BYKA 3KF6A 4AKIA 3WYGA 1YKSA 3NHBA 5GADl 4G7ZC 2F43B 3AVOA 4A3MG 3KQLA 3C16C 1G7SA 1LY1A 1SROA 4OO1G 2L15A 2ZSBA 1X54A 1T6NA 3UIEA 4DBLC 4PZ8A 1JR6A 1IYUA 3ZVRA 4DV3L 3U60B 1PFSA 3TAHA 3ZJYA 1DAEA 1CKMA 1GFIA 1CJUC 3RS7A 2GBLC 4I1SA 3NTUA 3TVTA 4DEXA 4Z54A 1P9WA 4AIMA 3HU1A 3DL0A 5AR1A 4P4TA 5JSZB 3KJGA 1E9RA 3OHMA 2ZM6Q 2FOLA 2CLDX 3CRVA 3CR8A 4UNQA 3M1IA 4D81A 1ONLA 1DVRA 4AQYQ 4TLDA 5BW8A 3QKTA 4RFSA 4UKDA 5LMNL 4JVLA 1TU4A 4PC7A 1EYGA 1U0LA 5LMNW 4Q7KA 1T3LA 4DSUA 3SDZA 1ELOA 3S15H 1AKYA 2G0TA 3HU2A 1GKYA 1N6RA 1CKNB 2ZYVX 4TT3D 1FX0B 3OEHA 2KCMA 3TEHB 1W4BA 1NMXA 2BJVA 1NE3A 5UKDA 2K14A 2ZI5A 1T9HA 2CE7A 3KXLA 1K8AC 1RE0A 4M53A 5FOWA 3PO2H 1TNDA 2FPKA 2QENA 4ZDKA 5HY6A 1P2SA 2XNDD 1ZUIA 5LDDC 1X86B 4BXXH 4QGGA 3A4NA 521PA 5JZVA 3AVTA 3FHOA 5KDOA 4NMMA 1U2RA 1DO2A 1YZUA 2PT7A 4KSBA 3HOXG 1L8QA 4U00A 4KLKA 2J1LA 1NVVR 2B8TA 2W58A 4NU0A 1W4AA 1ZD9A 3THOA 1VG8A 1FUUA 3ND8A 4AD8A 4POGA 2WBLC 2RF4A 1Q12A 1QHYA 3VA7A 5ELXA 2QAJA 4P4SA 2J0QA 1S3OA 2C95A 2RMKA 4DV1Q 1OFUX 4WXPA 5KPDA 2JEOA 3FKQA 4LCBA 2JLVA 1IL2A 4BLOA 1US8B 2GEDA 5EXSA 1XJCA 4BBRG 1XTQA 3GD7A 2O8EB 2AMCB 2FXQA 1R7RA 2D2FA 4WJ3M 1EFRA 2JLZA 1XCMA 4IPGA 1B7YB 1A2BA 1JEEA 2Z6VA 4A8JA 5JWRA 1FNNA 3QKRA 4TQUS 2PJZA 1M7HA 4OGQC 1D6JA 1UKYA 5K36G 3AGPA 4JK1C 1NLZA 3KUCA 1Q7YC 1ZM7A 3QKSA 4W7SA 5AJVB 4CT5A 4DV1L 1U9IC 5K8TA 1KKMA 8OHMA 4FDBA 1CR4A 1XMVA 4KFTA 4Q21A 1G3IA 4IQZA 3CCQA 1W0KA 5FOTA 3CPHA 2HUPA 4GFDA 4LFCQ 4I1OA 3EX7C 1R0YA 1XPRA 4NKRA 3VX4A 4TMWA 2GXSA 4CRWB 4PQYA 5KO2A 1GIAA 1W46A 2WB1E 2RGDA 3BOSA 1E4VA 1XCPA 2ZI4A 3I4OA 2PCFB 1COWD 1N3BA 2A6HD 1ZC4A 2ZS9A 1TQDA 3M9BA 4Q03A 3QPUA 2JA6H 1AZTA 4OI1A 4QGFA 3V9PA 1D7QA 1JJVA 2EW1A 2XB4A 1Y63A 1IXRA 2A30A 2A3RA 4XVQA 2BBSA 4JLBA 5SZIA 4CIDA 1N0UA 2IX3A 5D3MA 4GZMA 1NIPA 1Z0KA 3FB4A 5J40A 4NDZA 4G5SA 5EQTA 1P2VA 4HJ5A 4QGAA 3S1AB 4MYUA 2QSZA 2FEOA 4YC7A 2A6EC 1ODFA 5AUNB 1SHZA 2F43A 4H02A 4L15A 2D7DA 1NF3A 1PMRA 3HGBA 4GMDA 4EJSB 4XOIA 2VHQA 2CKZB 1YVDA 3U9SA 1E4YA 2GDJA 1SVIA 5TARA 3WBJA 1D9ZA 4DDVA 4Q9IA 5HKKD 4IOJA 4OX9Q 4DKAC 1C4OA 1G20E 4MRVA 2R65A 3KKMA 4JG2A 1DAKA 4IOAA 2E74C 3ASYA 4OK5A 1HY3A 3KJEA 1P7CA 4FMCB 4IXNA 4ZV4A 3U4QB 5BR8L 3AF3A 1RYHA 1PH9A 3K09C 4DDUA 3DZDA 4C0KA 1YNNC 1N33Q 1KQSA 1BS1A 1AS0A 1XPOA 5IWAQ 1F2UB 2AX4A 3NC1C 4JBXA 3LX5A 1BDOA 1CJMA 1E9BA 3VR3A 1L4YA 2GEVA 4PSVA 4DV0Q 1GHJA 3HKSA 1CJTC 1DTSA 2I5MX 2FNAA 3DMNA 1OTCA 4V0OA 5BN3A 5M3MG 1J5EQ 2IL1A 3W34A 2PMZE 3ZZTA 3BJUA 2H5EA 1N8RC 1Q1BA 3D3QA 3S24A 1DOAA 3FMOB 4MGYR 4L5SA 5ELNA 5KSOA 1P9RA 4DV5L 2GILA 1PHJA 4MQBA 5FUYA 1LACA 1H95A 2EDGA 3S16H 1X65A 1RRFA 1P3JA 1KSFX 2IUTA 4RSGA 3BRWD 5D3MB 2FZLA 4ZO4A 3M4OH 4KKUA 1IZ6A 1KI1A 3ZD7A 1W36D 5CIWA 2Z4SA 1FR3A 2VL6A 4D80A 5BXQC 1A8VA 4BFZA 1R0XA 1RJ9A 3V4RA 3U7EB 1V8QA 3LD9A 1KO5A 4PHTA 5B30A 3ULLA 1G51A 3BS4A 4OI2A 3UDGA 1KI6B 4R4CA 2V7QA 2QE7A 1SFOH 1W2HA 4A3KG 3C7KA 1FJGQ 2HDNB 4EPYA 4F38A 4KITB 5GVSA 4LWCA 1Z07A 5FBWB 2QQEA 4YXWA 4EPVA 3PEYA 4DR5L 4GT1A 1ZVQA 1M34E 2JK8A 1XMOL 3WNBA 1DADA 1S9DA 2BBOA 3HPRA 1DBSA 5JHHB 3KXKA 2EYUA 1QG4A 3GEHA 1HNWQ 1Q57A 3G71A 4NXML 1P4SA 1PYBA 2C04A 2ZE6A 1HUQA 3TRZA 3C5HA 3KJIA 1G3UA 2Z5FA 3KXIA 3QF7A 4LJ5A 1HZ9A 2ZRLA 4PC3A 3UATA 3ONWA 2DB3A 1TUEA 2B6HA 3L2OB 2X2EA 2X77A 3J7A5 4WXRA 3W8RA 2RKOA 3A8KE 1K5GA 4OHXA 3V00A 3FHCB 3AFPA 4B6FA 1NN1A 1B23P 2ZRIA 4Q1AA 1ZM3A 2IUUA 4R71A 1C0AA 2HHHQ 5KDLA 4AC9A 4Q1CA 1JJCB 2JATA 3OIYA 2LKCA 2AFIE 3R9XA 2HXSA 2BE5D 4P73A 2V1CC 2KSQA 3T1TA 1N6IA 2FZ4A 2A5GA 3U2QA 3OEED 1KRTA 1DAIA 2OFXA 5EE5B 4GL2A 2WKPA 4PXAA 1YBYA 3U61B 1WF3A 1NKTA 2ONKA 1TAGA 1BBWA 4FMCF 4MDEA 1GKIA 4KV9A 2Z0SA 3SOPA 2CWPA 1CJVC 2IYRA 4B3RL 5C4XG 3GTJH 3K70C 2AD1A 5KUTA 3T15A 4IOCA 3T51B 1DGSA 1HZAA 4QFMA 2O8BA 3QKRB 2C8VA 1VG9B 2CK3A 3FP9A 4WW0A 1U94A 2B21A 2EIFA 3QY0A 3TW8B 1VQ8A 3CRQA 3WWVA 3B9PA 4IDNA 3U7GA 2IYLD 2JDID 3SYKA 4BLTA 1H9MA 3HKZE 1Y8NB 2VZAA 1E9AA 1XTDA 3HOXH 1Z0IA 5E7MA 1YNJC 4B44A 3VR4A 5C4XH 2ZE5A 5CJ2A 1LS1A 2K5UA 4GNXC 3ZH9B 4PZ7A 4BFWA 1XMOQ 1XMJA 1CKOA 3N6RA 4EQ5A 3AVXA 3B1ZA 2NN6G 1M7BA 3ADKA 3CBQA 3H84A 4AWXA 3GLFA 1E9SA 1YHAA 3CH5A 4R2HA 1JAIA 2BCJQ 1MABA 2HYDA 2KWIA 3A8TA 4DVGA 4A1FA 4WIAA 4JVMA 4URZR 3KQHA 1UE1A 1NBMD 4L16A 3DPUA 4PC2A 2CLCX 5CLLA 4LUOA 1W36B 1H9SB 3CCVA 4L8GA 3X1DA 4HLQB 1K0RA 4EJSC 3DLLA 2IHBA 5CJPA 1VQ5A 1OXTA 2CJWA 4C0LA 1U90A 2QA5A 4FINA 4JI4L 2BDTA 2DUDA 2R7FA 1X6VA 2EVBA 3CPEA 1ZUHA 4MYHA 4QL5A 2D3WA 2HYIC 1H8HD 2BH8A 3U6BA 2JAQA 2QGQA 2OZEA 4NBSA 2EVWX 2CJWB 4HDQB 3I5XA 2L5TA 1JR3A 2ID0A 1RVDA 2JASA 2FWRA 4A2PA 3HOVG 1AE3A 1XD2B 3EIHA 4UXJA 2PMDA 2CL6X 2B8WA 2R92G 3SE0A 1EESA 3HFZB 1VYVA 2PMKA 2PX0A 3QVUA 3T61A 5E7JA 4TL8A 4G5QA 1S40A 3O8CA 2R2AA 3M4QA 2ORIA 1YJ9A 3SI7A 3BH7A 1Z6AA 2VTKA 4C7OB 4DRZA 1XD9A 5C2JB 2JGNA 4Z8XA 3QXHA 4Y7NH 4F4IA 1IY0A 1XXHE 3DO6A 3M4YA 4X62Q 3FKSD 2P0EA 2AL7A 5GJCA 1PH7A 2BBTA 1COWA 2ZR9A
chains in the Genus database with same CATH superfamily
2I4RA 2JG3A 1NKVA 4S35A 1Y1WB 3AR8A 5EI5A 5KYWB 1XZ8A 4GLAC 3C2QA 1Y6ZA 5T4BA 2MSLA 4KHVA 1OX6A 3EQ8A 2CQAA 4NFYA 4KKSA 1PG5A 5BNTA 4WLNA 3KD3A 1SAYA 3BD8A 1U7ZA 2P77A 4OHOA 4L78A 2VQFQ 3ZK7A 1PLLA 1WMFA 2VK4A 4DBZA 5IABA 3DWQA 3C6KA 4PCUA 3SYRA 4GPTA 5CYPA 2X76A 4WKPA 1GL9B 5AW9A 1TDJA 1QWYA 4FYJA 1WSWA 1NTOA 4MRPA 2NZXA 1IBLB 1XZEA 1FRFS 2UZIR 5BQOA 3EEYA 2J0UA 3CRLC 3MT7A 4O4HA 1QUEA 5IVHA 3O75A 2D8MA 5IBCA 4EQPA 2CXOA 2J4XA 3HCEA 4TSFD 3AL2A 1U7PA 4Y6SA 6AT1A 1R2QA 2WAQB 1J09A 3CJRA 3S4YA 3IPXA 1M5RA 2WJZB 5J1ZA 4AX4A 1TK3A 3CPJB 4ZI7F 3G48A 5FUBA 3X1XA 5I7RA 2Q45A 3BJIC 4HAWA 4A3SA 3NWBA 1CQPA 4O4IF 4PHFA 5AVKA 3VBEA 4C0AC 3HVHA 5KYXB 3T5BA 2R62A 4FKBA 1IBLQ 1NP7A 3FOZA 4LCEA 4O1IA 4Q19A 2MCFA 1GZ4A 2P1ZA 3K0YA 4YXFA 3QHPA 4Y0AA 4UOZA 2GKOA 2G7ZA 4LGVA 4ZVMA 2Y0BA 2I7TA 2PEYA 1FXSA 2GVBA 2VJAA 3L7IA 5H68A 1ADCA 2AB0A 3SX2A 3WNZA 1STGA 3NHHA 1DO0A 5DRTA 4O1HA 3LYHA 4CF4A 4CIBA 4MYTA 1UZNA 4IJMA 2O8BB 2D2EA 4WACA 1NR4A 5JS2A 2KQUA 1FVHA 1VB5A 3KSZO 3BMNA 3REOA 4JR0A 4DUZQ 5DRYA 5DCUA 2PHZA 3R44A 4BGIA 4KFCA 3OHPA 1TW3A 1K6XA 2JCBA 2ZUBA 5BWBA 1SOVA 3GJ4A 5JRDS 4BGDA 4ROSA 1DRVA 2CSUA 2RARA 3UHFA 1CDDA 2V7EA 3H8WA 1FNMA 1IBMB 3OKCA 3TRHA 4X66L 2R5FA 1G20A 2OY0A 3RLNA 3E0XA 4Z0TA 1EU3A 4LPSA 2VCHA 1A5AB 1PR3A 2Z8XA 3O7WA 4V0NA 4RKFA 3HP1A 3RFXA 3TNYA 2D5AA 1RJTA 3I1FA 3F7TA 3FR8A 4ND8B 1A7JA 1PNQA 3NKVA 4GAEA 1JCKB 1V35A 1C9YA 1Q0SA 4J29A 3I53A 2VTBA 3E0JA 1E2HA 4JQOA 4DV7Q 2JFWA 4MH0R 2QAIA 3GJ5A 4JI1Q 1C0LA 1LLDA 1NUHA 2ETXA 2JJ8A 2QRQA 4RVCA 4HJ7A 3JAMc 1UUPA 1KEVA 1NY6A 1TZBA 1XAGA 2AJTA 3IUEA 3HJAA 5DBGA 5B1SA 1KRXA 4J0EA 2D59A 1FP6A 1NLMA 3EHEA 2EJVA 4S3MA 2K33A 1B0AA 3SS7X 3T5PA 4Z9FA 3BRCA 4I5GA 1RQXA 3C5WP 4TLLB 2IWRA 1GQFA 2Q1WA 1EI9A 3GJ8A 1TQ2A 3L49A 1AE2A 1NNI1 1KQNA 4GS3A 4HNQA 1FYDA 4HWKA 3G23A 4OLHA 3S1NH 1ENYA 4NPSA 2ECQA 3KHTA 1JA0A 5A4AA 5DEIA 1Z5PA 1EEID 3FR7A 1E24A 5LZ2A 3D54D 4R8SA 1I4PA 4KYIB 3RJ9A 2OTJA 3VYTA 2P6NA 2XWSA 2HUNA 3AB3A 3HEBA 5CV9A 1YITA 4J16C 5H3HA 4MO2A 1JT2A 2W6ID 3S40A 4BNWA 4HDOB 3CG0A 3HGMA 1XVUA 3D7KA 3GGJA 4PE5B 3VM6A 4ECAA 1LT4D 4ENPA 1JWLA 2IZ5A 2DYKA 2EJTA 2YQ5A 3H16A 1EHCA 2B3DA 3E18A 4CHGA 2EARA 3OFNA 2AKWB 5BSMA 2E2HB 1Z15A 1OLOA 3K1YA 3SU8A 5K6AA 3O2JA 2FMTA 2J5KA 2ZUDA 2NLOA 1VQEA 2FKAA 2Y0SB 5B6PA 1D8LA 1EUZA 4MQ4A 3GHHA 1KP2A 3IL2A 1HNXB 1ZS9A 1B6GA 4UBKA 4I7EA 1SXPA 3BWVA 1QPBA 3DSRA 4JBNA 5DN6D 3RBAA 4F4HA 3A6DA 3P5BA 1T3HA 2QX6A 3ZKWA 4CKZA 1I0ZA 3CVWA 1Z8HA 4D8VA 4PC1A 4XM1A 1E79D 3HBMA 1KXJA 4NBWA 3FKSA 4C0BA 4N9TA 2G4LA 3O74A 1SHUX 3AF1A 4GH5A 2OKGA 4NULA 1J21A 4BLWA 4UPVA 4UHBA 1UC9A 2VYFA 3UK7A 1O5OA 1L1QA 2RHCA 3DMDA 4LF8B 1YHZA 1BS9A 1R64A 2V9ZA 1DQYA 4HVTA 3KYCB 1BH6A 3M4NA 3CW2C 3NQTA 1WMSA 2YICA 4UUBA 5JW6A 2H52A 3LA6A 3CRNA 4GSLA 4P1ZA 3ACBA 4S0XA 4L5QA 2IXGA 1M3SA 4MN3A 1HR0Q 2P5YA 4ZT6A 1Y5MA 2ZWVA 5BNIA 4JI5Q 3GO5A 4OHCA 1SAPA 4KN6A 4OP1A 3C48A 3NT4A 3KVVA 4DHEA 2HSZA 1ZQ9A 4C5CA 5JRZA 5LQJA 2WAQG 4FIDA 4UVGA 5DHAA 2C7QA 3PC7A 3Q3GE 3QV2A 4M1SA 2HMWA 2P4HX 5ECDA 3RTDA 4E31A 3R7FA 2ABWA 1Z3CA 5D2CA 3RJZA 1EMDA 3BXXA 2MYPA 2LIPA 3TD6A 1K7FB 1ZSYA 5JDCA 4DLAA 4CMBA 5K0BA 1XA3A 2C03A 4WADA 1EWYA 2XNDA 3IB3A 3LFUA 5CB0A 2E4XA 3IKVA 4KU4A 3WK7A 1EFVB 2BGUA 3ZYZA 3MK31 3NEPX 4IUTA 4URVR 2RE8A 1HM5A 1XK7A 2R87A 4XWTA 3VRHA 2PV0A 3G82C 8ABPA 3DBRB 1A5BB 1B6RA 1DBVO 5E9QA 1O7ZA 4E94A 2FHSA 3C98A 1BR9A 1LT5D 3PUZA 1WPGA 3FYHA 3LVBA 2Q5JA 5EAIA 3TSWA 3WQSB 4F1JA 1SEVA 3LPLA 3HI6A 3GJQA 1P2DA 3EDCA 3GDWA 4DUZL 3OT1B 4PAWA 5IF9A 2O7NA 2QUBA 1WTVA 4UOQA 1K6JA 1X7XA 3I83A 4GXQA 1H9SA 1WXDA 3MCTA 3UDFA 1Z38A 1KQOA 4NARA 5ALUA 4EQOA 2AK2A 4EQ6A 4FYVA 2FJ0A 3H3VC 3UKOA 4JLAA 2Y0SG 3JD4A 3WLAA 1HFEL 1KWGA 2DCUA 3JQ6A 2R7ZH 3PGXA 1N9GB 1Y4SA 4OQQA 3F2BA 3RVOA 2V74B 5D14A 1OAAA 1KEPA 2FWMX 2VG8A 5ALFA 1ZONA 2NUAA 5KNCA 1JW9B 4P0TA 4F9EA 3K9FC 2G80A 5JEDA 1NJ5A 1M33A 1GV1A 3HP3A 3JQFA 1PFUA 4X65Q 3GROA 2GAJA 3KZNA 1HLPA 1ZMXA 2Z6KA 3AI7A 3O4JA 3PUWA 2XN9C 3MJEA 4IQ0A 1QC5A 3LLMA 4MV9A 3GLTA 2PLWA 3OOYA 5ETJA 1ZQ1A 4X3UA 2XWBF 4AY5A 3HWX1 5IKOA 5J5CA 1X2BA 4B33A 2AV6A 4BPBA 2Q2WA 2IHYA 3G1WA 4JLWA 3F4BA 3WB2A 2XMDA 2OFFA 1K75A 1NVVQ 5DYWA 1IB6A 1SD1A 1HDIA 2DY1A 4BBPA 1FNWA 4WECA 4NCNA 4QQRA 4OI4A 3UF0A 5MGBA 4WNAB 4LW8A 3NOOA 3TCKA 1WL8A 4A3MB 3K2BA 3T9AA 1LPBB 4OJQA 5IJ9A 4MWTA 1Y3HA 2TMYA 3QZUA 1ZMRA 2C8JA 2HSGA 1N2GA 3IERA 3EPHA 5CA0B 3RS2A 1IVSA 2XAAA 2C2BA 4ZAZA 5AM1A 5F9HA 3S1NB 3DMRA 4JS0A 2D74A 4M1KA 1F8GA 1H9RA 2AC7A 2UZ1B 2NP7A 2NN6I 1CUFA 3I6QA 3W05A 3OIWA 3LGXA 5HKBA 1VQPA 1DX6A 3R5HA 5AFSA 3GEBA 2CHQA 3ET5A 1VZ2A 3R2TA 4OJKA 4MIKA 4JYAB 3V7UA 1KPGA 4KR9A 2C77A 3U4GA 3CE6A 5FV4A 2CKDA 3QEMB 4L9AA 4NEQA 3T4UA 2F0GA 2H51A 3VVMA 1J5PA 3CUSA 1Q0PA 1WSDA 1QVFA 4DIBA 1OHHD 3HB9A 5B4VA 3AV0B 5K0NA 1CU1A 4QJIA 4DV6B 3BYYB 1WXFA 4K1XA 3WRWA 5BVGB 2IY9A 1T9GR 2F0LA 1NI4A 4NZNA 2JH9A 3EMVA 4QPJC 4WERA 3GNTA 3M3DA 1ZJ5A 2AWOA 4DRXA 2G1JA 1IVYA 3IFSA 2PQMA 5CHYA 5EWJB 4YCWA 1E59A 4CCSA 1XPJA 3E8SA 3QLVC 1I5OA 1WJGA 4J07A 4J1SA 2ZJ8A 1PJ8A 4YTEA 5CFQA 3EUEA 2JYOA 2X0KA 3L8YA 4AN0A 4B3RB 4CMAA 1SKMA 1PL7A 3WFZA 2WMNB 3AOGA 3AHGA 5KINB 4FCVA 3K8AA 1FQJA 5HZKA 4HAXA 3CNOA 4JOIA 3TZUA 1SBTA 4LWQA 2V4DA 3ZDXB 4M1QA 5EZYB 1LK0A 3TW4A 5KNCD 1G8MA 1X94A 1B6TA 4BC1A 4I5FA 3E9HA 1GYQA 3RUPA 1I6HH 5K99A 2B2TA 2IY5B 1DIGA 2V7UA 4JU9A 2G9NA 1HKUA 4OATA 4C1NK 4BLUA 2COUA 1TJ3A 2CSXA 1TT2A 2VW9A 1J2EA 5AKXA 3Q0TA 3FRHA 1SOAA 2PWYA 5IJ0B 3R9WA 3C3BA 3DKVA 3ORRA 1R8XA 4GQIA 4JB8A 4W1SA 5DTQA 1U7DA 2HO4A 1CF4A 3EDQA 2R4QA 4EA9A 1QUQA 2QQ5A 3R6WA 2Z8ZA 4N49A 4NS4A 4QXPA 1YV9A 1ORTA 3CUUA 3OI7A 4P3PA 4X1IB 3FJ1A 2IKSA 4KMUC 1QONA 2PNJA 2G9QA 4Y30A 4DL9A 4G8JA 2ZPTX 4ZRNA 3CU7A 1M1XB 1O96B 1WMDA 2BT4A 3F5MA 3MD9A 1FPQA 2Z1NA 4K28A 3GH1A 1LC0A 3I1IA 1LTRD 3U4CA 3CO0S 3IR7A 1YNJD 1S2NA 3DAPA 4HH0A 4RY2A 5ALLA 4PLTA 3QVTA 4PQFA 1CHNA 3AT1A 3OQIB 1ZI6A 3HNOA 4QYIA 3V8NA 3IQHX 4Y2RA 3HVJA 4HB4A 2E2WA 1P39A 3GVHA 2FSHA 4XM2A 3DAGA 4JUBA 1RZRD 1AF4A 1M6HA 2W22A 4N65A 3WNCA 1PGPA 4DCOA 4GKJL 4I4LA 1KTKA 3JAML 1IN6A 1XLTC 1UMCB 3HZRA 5IKMA 3AXSA 4FBGA 4JJZA 1R6XA 1UM8A 2ZCVA 1CIJA 4YWKA 2AG6A 4RD0A 2CNOA 2R9VA 2ZVQX 4IG4A 3S5JA 4CT0A 1TYAE 3DYBA 4E5PA 1L3BA 2PUVA 4CMJA 4O1NA 2DH5A 3DNPA 2H8KA 3H2ZA 2CHEA 3LC0A 5KIXA 2AR7A 2CNKA 4E2XA 1W59A 1XZPA 3R4VA 1NRIA 1WI5A 1FPMA 4WOBA 1KLGD 2YTYA 1MC5A 2ZREA 5DI3B 5FNZA 3SXJA 3T7AA 5JDIA 3S27A 1A7AA 2XMQA 4EB6B 3NOQA 1KL7A 1MB4A 1YEZA 2QOEA 2FWPA 2VHZA 1FFWA 3O8BA 1YOVB 2X86A 4LHSA 1CDOA 2QTNA 3AJDA 1C81A 3DLIA 4NFHA 1SCIA 4OOFA 4EUFA 3I04A 3HDYA 3REGA 4H0CA 1ET9A 1C41A 2ZG6A 3Q7QA 2KVMA 2XYPA 1S8FA 3X1JA 4EMUA 1YWGO 2PFGA 1GGEA 3F8SA 4PO8A 3NEMA 1UMBA 1DKPA 2B34A 2PGLA 3FDJA 3AEQB 3L7LA 4YQYA 4B3DA 1T0IA 4YK7A 1W0KD 3I92A 4BO1A 5FADA 1KIMA 3LBIA 3RWBA 2Z9DA 3G0HA 3E8XA 4HCEA 3U26A 5MFZA 3K80C 5E1FA 2WF9A 1H0HA 4HZUB 2IU4A 3VDNB 2FP3A 1G291 1IAVA 121PA 1L7BA 1KZ4A 4RQUA 2HN9A 3TO5A 1X6OA 5JMWA 3W5BA 4UNPA 4AO8A 2Z2IA 1RT9A 5EAYA 2NYUA 5A4IS 3NWTA 4TKOB 2G0AA 3IP7A 5L6MB 4R51A 2EJWA 5LKAA 3NQIA 1ICFB 621PA 1OAOC 1QV9A 1HR0L 2DQSA 4PYKA 5EHQA 5A3QA 2IL8A 3G7LA 1LPMA 1VLHA 2C5SA 1ZSNA 3IVAA 3KKEA 4IQFA 4JEUA 1RKXA 2JFOA 4NYMQ 2VF2A 1BH2A 3K1AA 4GPEA 4GZ6A 2W6JA 4LOJA 2QMEA 1KDBA 1CW2B 3LWNA 2O3UA 5ITZB 3PC6A 5JMOA 2Z83A 2HA5A 4CI0B 4D9NA 2XT9A 1KL9A 3K0XA 1AS2A 4IWNA 4E14A 1GEGA 4JYPA 4HIOA 4UTNA 1PUJA 1T4CB 3JWJA 5IW8A 4EATA 5I4BA 3B48A 1H3FA 2GCOA 4CG0A 1VOTA 1Q1EA 2AFRA 3PS9A 1A9ZA 1RPAA 1O6BA 3KCQA 4TTRA 2M2LA 1WDTA 4BLVA 2BDEA 2FSGA 2XA1A 1MCZA 3NWJA 1EBUA 3H9QA 1R74A 1TKBA 4PAMA 2QVZX 4N3AA 1RWXA 4LSGA 4YCCA 4MV7A 2QJRA 5AKGA 1Z17A 1SVMA 4PAOA 2BFWA 1AK9A 3RUAA 2O8FA 2VDWB 2Y1FA 3I56A 2PUHA 3EXEB 2C7PA 2JLWA 4Q4AB 4RTPA 3B82A 1DHRA 1POXA 1WXXA 3L8ZA 4HDRB 5JVG3 3Q7EA 4RHXA 2E5LB 3C0KA 3MG9A 7YASA 3HOZH 4RQAA 5L3VA 4JBJA 1NXTA 1A2QA 2C92A 2HQ1A 2ZTUA 4LFBL 1E2EA 5IYDG 1Q22A 4ZTUB 4Q4AA 2XZOA 2D1SA 3TGWA 1G3QA 6ADHA 4IUYA 1LUZA 2DBVO 2HA4A 4KO2S 5K3FA 2C5CA 2Z6UA 3L4SO 1P80A 2OAGA 3A37A 4HN2A 4LMPA 3ZDZB 2ADOA 3RFUA 3W79A 1TJ4A 1CE8A 3ND9A 3WP0A 3P9NA 1TEHA 1RRCA 1LVUA 3AR5A 1JJBA 3TDQA 2H4OA 3DVLA 1EAMA 3MGBA 2CUTA 3E2PA 2FGKA 2Q4TA 1YF3A 2OLKA 3FVQA 3HACA 3NANA 1G59A 4ZIRB 3NM4A 4NFLA 4OQMA 3EMDA 4YAUA 1N2ZA 2DPHA 1RAHA 3P71T 2GPNA 1MAHA 3ZYYX 1MD9A 1Z5OA 4MQUA 4MX8A 5CT9A 1RKVA 4D25A 2TSYB 4B35A 4AI6A 1CIPA 1OH7A 3QE0A 2RAFA 3S17H 1KI8A 3K73O 4DFDA 1E1LA 1J6QA 1V7PC 1OLXA 4UZSA 3D31A 1AC5A 1XQVA 2H92A 4G5RA 3RH0A 3U3JA 3G1UA 2IVZA 5C80A 1VQLA 1OVGA 3ONEA 1Z62A 3QW4B 4QFCA 4TWRA 1F9AA 2FZ5A 1JR4A 3WGIA 1PFVA 2C5FA 3FXAA 1K5DA 3I5UA 3N8DA 2BMWA 5IJ9B 3M4PA 2GBIA 2OFWA 4GNRA 5ESDA 1QMGA 5C4IA 3NHRA 5AW0A 4X66Q 2FXVA 4UNNA 2IHUA 1VBFA 4P92A 3DBLB 1B3AA 3V8VA 3H13A 1HA3A 2QY6A 1GVPA 3H1TA 2ZS7A 2FINB 4ARUA 1R3DA 4HL6A 1QNLA 4A0GA 1PA6A 3F9CA 5AOAA 1UZMA 2Q1SA 3ZK8A 1DAFA 5DM73 1RR6A 2QW1A 3SX0A 1HZBA 2FUG1 4V3CA 2WK1A 1WD1A 3R0VA 1YR1A 2AJLI 3D0FA 1CERA 2FSPA 4WJKB 3WTBA 4QBFA 3WIDA 1UXHA 4CHTB 2O20A 2VHYA 3L0CA 3Q41A 4UULA 2EZVA 2Q07A 4A0FA 4PMCA 1T29A 2CF5A 2A1UA 3Q9LA 4XAQA 5EEHA 3NGLA 5LLSA 4QBKA 1FS6A 1GA4A 3DUFB 3D3WA 4IHJF 1WBDA 1RTOA 4CIWA 5C8YB 2PGDA 1G9SA 2QSYA 1FQWA 2CMHA 4BNTA 3WICA 3PD1A 3GFSA 1XXHB 4NJOA 1V9CA 1GN8A 1ZHOA 4QG7A 1TKWB 2HSWA 3A4MA 3D3WB 2WWFA 3CRKC 1FYVA 2AC4A 1WZUA 3MXNA 1U0JA 2GHRA 3A0RB 3OLXA 1KEUA 1PTOF 3F90A 1R9TH 3V80A 4CTMA 1EFUA 3GARA 2G1AA 3CO5A 2RSOA 2HMAA 5E4TA 5K4GA 3H2BA 2QZSA 1LTID 1H5QA 1T5EA 1NV9A 2NIPA 2NQ2C 1I4WA 1Z0JA 2Q21A 2WD7B 3HKEB 3IURA 3O8QA 3VDXA 1T26A 3QYFA 2Y6VA 2WFLB 2XWPA 1IWOA 3QUAA 1XPUA 4BKOA 3VZDA 1YR6A 5TLSA 4DV4B 1A04A 1D6MA 2LRHA 2YJGA 4N4AA 4RORA 1F2MA 2OZPA 3GU3A 1Y1QA 1NVEA 2IEYA 3IV6A 4OH1A 5EJMA 2AJCA 3A1DA 2VQFL 3LCJA 4WZBA 4UHFA 3ITNA 1RLMA 4DC0A 1BE8A 1SKBA 3S1RB 1DBWA 3TIVA 1TMOA 4Q5VA 3QPWA 4EKYA 1O97C 2EKQA 1H1LA 4LXYA 4M8LA 3WSWA 4G85A 4N0PA 3EPKA 3Q85A 4A0RA 4UAIA 1PH8A 2EZUA 1ZRMA 2GM5A 2AOUA 4NB3A 3FDZA 3R3HA 2JE6I 4Q7EA 3D7RA 2XVYA 5TEVA 3IP3A 2C35B 1GN9A 3OLYA 4MS3B 2Z4IA 4NMXB 5DTRA 1CJKC 5E3JA 2ST1A 2F62A 4L6TB