2IT1A

Structure of ph0203 protein from pyrococcus horikoshii
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
362
structure length
362
Chain Sequence
MVEIKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKDRNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVYYKPKYKFVGGFLGNPPMNFVEAKVEDGKLVITEKSKLPIPKQYVEIVKETGITEVIIGFRPHDAEIVKGEGEGIVGEVYSFEPLGREQIVTVSVNDSIVKVFAPEGEHFSFGEKVTIKVKEELLVLFDKKTEKALEFSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of PH0203 protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
molecule keywords 362aa long hypothetical maltose/maltodextrin transport ATP-b
total genus 98
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2it1A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2it1A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2it1A01
3GQBA 4IFDG 3ULLA 1VG9B 2QPTA 2ZRCA 5GADC 2ZRDA 3GMTA 1ZNXA 4MYTA 1PYBA 2VUMH 2NZOA 3QE0A 4TLEA 3SOPA 1F2TA 3NEYA 5JJLA 5E7MA 1QHXA 1VQ6A 3B82A 4Q66C 3SQXA 4HJ7A 3K0FA 2YNMA 3CONA 4JL6A 1SVWA 1X3FA 5FTMA 1NLZA 2D74A 2H57A 5BQ5A 4KODA 1PV4A 2A30A 4YHHL 4IOJA 2H7VA 5HKKA 1YE8A 2XGJA 1T0HB 2PEYA 1DBSA 2V6IA 1LVGA 3CWQA 4V0MA 4PMWA 1AZTA 1G6OA 4Q9HA 2ZRFA 4FN5A 3HOWG 1P75A 4DT1A 1E0SA 2J7PA 2PCJA 4JYBA 1GL6A 4JT2A 1Y3AA 4OJKA 1QHHB 1CXZA 1E9CA 2GZHA 2ODNA 5C0XH 3D0FA 4QM7A 3QBVA 1T5IA 2Z6VA 1V8QA 3GDEA 3K7AH 2IYSA 3QPVA 3R20A 4Z1MA 3VU9B 2J3EA 1H95A 4B34A 4EIWA 4XVUA 2ZI6A 2ONJA 4GRAA 1EOVA 1W36C 1DTSA 1II8B 1M1KC 3ZGXA 3DPUA 3LW7A 4AQYQ 3PEWA 3CW2C 2IUSA 1D9ZA 1ZP6A 3FPAA 1KDOA 1KL9A 2MO1A 2QP3A 3TAUA 5L3QA 1ZNZA 3QF4B 4LDJA 2EFGA 1U99A 4IDOA 5LMNL 2QAGC 4M1KA 2GRJA 3NIBA 1E22A 3I1FA 1Q44A 3JAMi 2EWVA 4DLTA 2IC5A 4A3KG 1E9AA 3FKIH 2WJYA 3GJ4A 1WI5A 4V0KA 1ZKOA 4L5TA 1G7TA 2CL6X 2QQEA 4AYWA 4CEIB 4NB3A 4P71A 1XMSA 4IDHA 2ODBA 1S96A 4IPGA 3AVTA 3RZOH 3QJYA 4AYBG 4K81B 4L9WA 1S3GA 2VF7A 3E9IA 3K0FB 4R2HA 1TEVA 4QQBX 4LK1C 2ZYVX 2ZRIA 2DNEA 1FR3A 2HJVA 4EQ6A 1CKMA 1YKSA 2XNDD 3VDYA 3W1BA 1ZD8A 1Q22A 4HB3A 4KBGA 4UP9A 1XMVA 1IBML 3VR3A 3B85A 3EQLC 1W44A 1CJUC 3I92A 2ZS7A 3D7MA 2QE7A 2VL6A 3PQCA 4PHFA 4Q47A 1HT2E 1DO2A 2JA7H 1OIWA 1Q0UA 4GDFA 1OT3A 1DCZA 1UM8A 2VYFA 4XD7D 3AEVA 4PC1A 2CWPA 1KI8A 5A5GA 3OE7D 4A3IH 1GUOA 1OXXK 4DDUA 1Z2CA 1NY5A 2QZ4A 3FWYA 3THYB 1UBFA 3M4YA 4JG2A 2XEXA 1IZ6A 3NC0C 1KRTA 4BBRH 3B1WA 4JZKA 2EJMA 2EFHB 1O87A 4GZLA 4IOCA 1MKYA 2Q9CA 2WBLC 3ZJYA 4C0LA 1I94L 1U8YA 2HYDA 3F5FA 4B3XA 1COWA 4CVNA 4IFBA 4JJZA 1YIJA 3AP2A 2V4DA 5CB8A 4JBJA 1WDTA 2AXPA 2P6NA 5D3QA 2PQAB 3EX7C 3FHCB 3Q5DA 4WZ6A 2YWEA 2GVDC 3EG5A 2QUZA 4QY7A 5GAGC 3FMIA 2XTIA 4I1OA 3CAMA 2AN9A 2JLVA 4GN4B 5FTNA 3D31A 3GPLA 2JGNA 5AUOB 2GJ9A 4G01B 3OFNA 4A3EG 1H9MA 4YCVA 2ZUBA 1N32Q 1EWQA 1F48A 1I5FA 3U3JA 5FTLA 2ZI3A 4F93B 1PVOA 1S1CA 2AX4A 1N8RC 2VRWA 2BA0A 2A78A 4HDCA 2PZGA 3JAMc 1H9SA 4IHQA 1BYIA 2VHQA 4P33A 4RFVA 2AWOA 1J6QA 3K0XA 1T3HA 3W6NA 2LCFA 5J5CA 4A3CH 1BS1A 4DCSA 4DDWA 2JEBI 3EIVA 1OFHA 2ZRJA 2ZSFA 2ZS8A 3BB3A 2BVNA 1XMQL 2ZI5A 2ID0A 4LJ9A 1Z06A 4MKGA 3TREA 3LAWA 2ORIA 3UG6A 3GJ3A 3GTPH 2BBWA 2WSMA 1NSTA 5HY6A 1GRQA 1AKYA 4YY3L 5JJIA 3THWA 2YJTD 3B6EA 1E2GA 3W34A 2ZJZA 4DEYA 1YVCA 5J3BA 3NWJA 1NIJA 3U2QA 1GOTA 1SXJB 4EQ6B 2V7QA 1LTLA 1N6OA 2JLQA 1CULC 1HQMC 1K8AC 1N6PA 2ATVA 2YINC 4DKXA 2OE2A 2FEMA 4YXWD 2O8DB 5SZHB 4AIIA 2W6IA 1KAGA 2DUDA 3A74A 2MSEB 3W3AA 4RKFA 3W5JA 2KCCA 3AEZA 3CF5A 3FGNA 4HAWA 4QOSA 5TVKA 2RB4A 5L8VA 4D82A 1RW4A 1Z8FA 2A6ED 5IP7H 1OFTA 4AKHA 4C7OA 3FMPB 1TWHH 2GTPA 5IT5A 4NP6A 2J0UB 1J5EQ 1WP9A 4KV9A 3ZLJA 3O8RA 3JC66 3B2EA 2J5XA 2A69C 2GZAA 2DHRA 2ODEA 4MA4A 3T1TA 4PC6A 1NIPA 1ZYRC 1NG1A 1YITA 3AF4A 3Q8XB 1W7AA 1K8OA 3ICQB 3CX6A 2J9RA 4A93G 1TX4B 2ZRHA 1JJ7A 3CPEA 1KK0A 3HOZG 4JI5Q 1XTQA 4LC0A 4X62Q 4OGQC 3GTJH 2WWGA 4POFA 1U81A 3GJ6A 4K46A 5EE1A 1DAKA 3U44B 4BLPA 1KO5A 1Q1BA 2C98A 2WWHA 2ZR9A 4LV8B 3IEVA 1WCMG 4KI0A 1G6PA 2QMUA 4POGA 2EXDA 1FX0A 2AKYA 3GLFB 3CX8A 4JLOA 4X66Q 1QZHA 1GKYA 3IPXA 3U3KA 1YHNA 1FP7A 1QVFA 3P32A 4ME3A 1DAIA 3NKVA 5IK2A 3ZD7A 4D81A 4R71A 1CTMA 5M3FH 3H0GG 2VH5R 3QUSA 1G1MA 2JJ8A 1WCV1 4HUQB 4IOMA 4NTZA 3ZS8A 4EFLA 2XTMA 4CW7A 3BOSA 1R5BA 1OH6A 2RH5A 4Z1MD 4UNPA 3AVVA 4KCGA 1IL2A 4DCNA 4TMWA 1DELA 4ZDKA 5SZKB 3CF6R 4I1UA 1TQDA 4NCKA 1IN8A 3DOFA 4IPCA 3LVQE 1TUEA 4LV6A 1MABA 4A8JA 1XEFA 3TW4A 1KJWA 1VQ8A 2CNWD 2DFKB 1L2FA 1S3SA 1NBMD 1SQ5A 2R6GA 2OBMA 3NVAA 3HDTA 1JR3E 2AHOA 2GHIA 2DB3A 2UUAQ 3A1SA 3TEHB 1FNNA 3VR4A 4UJ3A 4DR7Q 3PUXA 5C2JB 5IT9c 3EXAA 5JECA 2K5UA 2G83A 2XSZA 4GOPC 4A2WA 2NN6I 2RAPA 3MLEA 2WP8J 5FPTA 1HCZA 1XTRA 4GSYA 4ASUA 3ZIAA 4TLCA 3HOXG 4LYAA 3OTOQ 3R7WA 2V6JA 3MXUA 1XTDA 4W5WA 3CC7A 1GUAA 1N5JA 4IOKA 1K8GA 3SZRA 4E07A 3STBC 2CWAA 1KKMA 2BHRA 2Q9BA 1DO0A 1US8B 2CJWA 4RD3A 4H13C 1KMQA 3VMFA 4AKGA 1VQ7A 1FP6A 1VPLA 4CF7A 1XEWY 2J0QA 2O8FB 5EJEA 5GJBA 2CK3D 2GBLA 1FFHA 4Q4JA 5FBQB 2WPDA 1P6XA 2FZLA 4C7OB 3R8FA 5IWAQ 3A4NA 1KGDA 1C1YA 1E79D 1SHZA 3NDBB 1E1QD 3THOA 1A1VA 2WWWA 4HIKA 1TMKA 3NEMA 5ELNA 1DAEA 2UXCQ 2OZEA 1FYCA 1D2EA 1KO4A 3GO5A 3SJCA 3CC2A 5FI0B 3S24A 2OBNA 3B60A 4JV5Q 1NVWQ 2N8NA 3S1RH 1ZINA 4A3GH 1FOEB 3P20A 1SFOH 1HT1E 3LRPA 4C2UA 3VKGA 2FFHA 1NI3A 1QUQB 3FKIG 1VYVA 1SVSA 2CKZB 3AF3A 1P3JA 2G0NA 1Y8NB 4LF9L 3QNUA 4CYMA 3GLHA 1OH8A 1H9KA 3A5ZB 2NPIA 1N0VC 2OESA 1SMXA 4GL2A 5FI1B 4BY1H 2Z43A 4Q18A 4XWOA 3SBDA 4DNIA 1H8EA 2A5JA 1G3RA 1P60A 1TWCH 1Y1VH 2JDID 3L8YA 1Z6GA 4C0JA 1Q3TA 4GOPA 3CPJB 2F52A 1VHLA 4HB2A 1GG2A 1YR6A 5JRJA 3LLMA 4EUNA 1TL7C 1E2ZA 3H0KA 2JJQA 5HE8A 4D4JA 1XCPA 1LFDB 2QSYA 1G7CA 1NRJB 4I81A 3T5GA 3A6PC 1E3MA 4A0HA 1Q8KA 3AFPA 2JLZA 1JPJA 4OQLA 2OEPA 4OHZA 1U94A 4HIOA 3TRZA 1U0JA 4YHHQ 4ALPA 3LX8A 3X1YA 1X54A 1L1OC 2ZSDA 621PA 4YMVA 4JT4A 1P9RA 1YR9A 5KSYA 1GAJA 4A3DH 2A19A 2HF8A 3EZ2A 1J2JA 2CW0C 4U5XA 2CMKA 4QRHA 5K36H 3I7FA 3IHWA 3ZZTA 6Q21A 4MNOA 3EIQA 3IIJA 5EP1A 1UBCA 3HOVG 1YU9A 4ARZA 4LF5L 1S40A 2WM9B 3IO3A 2LSSA 4B3BA 4TMZA 5EE9A 3NH6A 5KPJA 4LI0A 3HU3A 2OCBA 2GF0A 2J41A 2RGXA 2ZPTX 1K3RA 1SN8A 3VR2A 1IYJB 2LKCA 3A0JA 5A0FA 3U4QB 3M85A 3JZMA 1E2WA 4JBXA 2EVBA 3TQYA 2ZM6Q 4B3CA 1NBWA 4B2LA 2BE5C 4ABYA 2P5TB 5FOSA 1EWRA 3OZXA 4HLUA 3S1MH 4DVGA 3DL0A 2BWJA 5D3MB 3ZIAD 1QBKC 3E1SA 2QGZA 1C7YA 2QU8A 1QHSA 1Z6AA 5IP9H 5CYPA 1X8JA 3S1QH 4C9BA 4O2DA 1T3SA 2OM2A 1QHIA 3CRRA 4GZMA 4DCUA 4QHSA 2PQAA 1X9NA 4LF8L 1XMJA 5EQTA 5JSZB 1PH4A 5CK4A 1WQ1R 3BK7A 1AS0A 1ZC3A 4CT4B 1MJCA 2IUTA 5FTJA 1XPRA 1EFRD 4NL4H 4PXAA 2Q21A 3HPQA 3T1YQ 2WAQG 5HR5A 2BEKA 1XEWX 3TBKA 3M7NA 3F0TA 2I3BA 3M1IA 3MWKA 4R4IA 1G8GA 4D0NA 4B3SL 4M1TA 2RHQB 4NZYA 5FJ8H 1VQAA 1IN7A 3WRYC 2Z5FA 1NVVR 1ZU4A 1IBLQ 4G3XA 5IK2D 2VA8A 2XGTA 1OFIA 4QJ5A 1FJGL 2N42A 3AP3A 3W6PA 3PF4A 4B2IA 2J1LA 4XTRA 1EFUA 3EWAA 1GO3E 3K0EA 2VQFL 3OEHD 1GTVA 5G40A 5AJZA 5A35A 1IY2A 4LF7Q 1JJ2A 2OBLA 2QT1A 3BS4A 1W5SA 3C4JA 3CZQA 3GJ8A 4CGZA 4AKIA 3A7AB 3MJHA 1E9DA 1XJQA 1VYTA 1EYGA 3EIEA 5DLQC 1L1OB 2JLWA 4DV7Q 1O78A 1AE3A 4KKSA 4MYCA 4X8MA 4A3LG 4QGAA 5HE9A 1GDDA 4PPGA 2BM1A 1IN5A 3L2OB 4DR5Q 3EA5A 3TSZA 3UE1A 4B3RQ 3T53B 1ANKA 1VMAA 3NXSA 2ZAMA 3U44A 2J0SA 2H8KA 4FMCB 3B1ZA 1A5TA 3CH4B 2IS4A 5AJ3Q 2Q2IA 4OQXA 3DLLA 2ZI7A 2EW1A 2KHJA 1YQTA 2B7BA 4FWTA 1AKEA 2P0EA 3QXJA 5LB2A 5P21A 3U3OA 5CM8B 4JLJA 3JZAA 4XSGA 5AJXA 1AGPA 2NO7A 3PXGA 4FDBA 4IDQA 3VU9A 5DISB 4IEEA 3JVUA 2W83A 5EP3A 1VQDA 2K75A 2IXGA 4PTLA 3J7A5 4PQFA 4DUGD 4L8JA 3LWNA 4A3JG 5LB4A 1E2KA 2OAQ1 3UPUA 3NBXX 1A6XA 3AVPA 1RJ9B 2ZYWX 1W2HA 2AUKA 3RZDH 4HR7B 3IHLA 3S14H 3OIVA 3TE6A 1R2QA 2F3RA 5UKDA 4PZZA 4UNQA 4ZIRA 1LW7A 4MYHA 1FMLA 4IVPA 4DIDA 5C0XG 4LF4L 5J40A 1RE0A 4YMSA 3D4RA 3OIWA 4LJYA 4YDSA 4NCNA 2MSCB 2JK8A 4DV2L 1KI6B 5A4JA 1E0KA 3TUIC 2Q2UA 2AD1A 1GSIA 3KX2A 2DY1A 4DV6L 4RZXA 2XNDA 1XWIA 5FPYA 1IXSB 2PH1A 1RC8A 4Q9LA 2WAYA 1JT8A 4KHPL 2ATXA 2BCGY 4TL6A 1WB9A 5C18A 4FMDF 1UEJA 3HOUH 2NG1A 2ASBA 3KUDA 3UANA 2DN8A 1MR3F 4LF4Q 3N5CA 2PLRA 2YU9H 3U7EB 5DO9A 1GITA 3C7KA 2BKUA 2XJ4A 5L3SB 2QENA 1ZC4A 2K7VA 3NBZC 4KSBA 4LX0A 4X62L 4AURA 3RAPR 1AN0A 1CRQA 3TIFA 3M4OH 1S0UA 1Z08A 4APVA 4YDHB 4XVQA 4OQMA 2AL7A 4YONB 1NY4A 2QEXA 3KKMA 3I5XA 4QM6A 2ZRBA 1CI3M 4EJSC 1R8QA 5C44G 4W5HA 5FBVB 4RSGA 4LPSA 2HYIC 2MQHA 2D62A 1GNPA 4PC2A 1KI4A 4LV5B 5LMNW 4AYBE 1J5EL 1AQYA 2B8FA 2D7DA 3TLXA 1NBMA 1XCMA 2UVQA 2XXAB 3A4MA 4KU4A 3SFVA 4GNXB 2VPPA 3LDAA 1S72A 1T6NA 3KKOA 2K4KA 5M3MG 3T06B 1ZM7A 5AJ3L 2BMFA 3UKDA 4QJ3A 4K0KQ 3RRMA 1CUKA 1GRNA 3HOZH 3PSIA 4Q5IA 4DK1A 3FMCA 4TLAA 2K5NA 2IF2A 1FUKA 1KZGB 1D8TA 4JI2Q 4RFSB 3K9NA 3E2IA 5F9FA 2FNAA 4HAUA 4A0RA 4JC0A 1W0KA 5KDDA 1Q12A 3K70B 5LMUQ 3BH0A 1SROA 1KMHB 2GA8A 1CS4C 2JE6I 3D8BA 2R7ZH 3T12A 5JSZA 4JL5A 2J0VA 1B8AA 2NQ2C 3W5OA 2PMZE 1CJKC 2O8EB 2E9SA 3ZVLA 1EFWA 2W6ID 1MH1A 4D0LB 3KQKA 2P6UA 1GRRA 121PA 3GLIE 1G17A 2QPOA 4PG3A 2Z4SA 1K5GA 2MFIA 5IWAL 2GETA 2R65A 4FCTA 1Q20A 3DZ8A 1U2RA 5M5XH 4JKYA 2OFOA 2O8CA 3SHWA 3T1YL 2UUAL 2B8WA 3EAQA 1QVAA 1JBKA 2ZJOA 3QKRA 4A76A 1BOFA 1FVIA 1RRPA 3G6EA 4URUR 2XZLA 1ZNYA 5JEAG 2PMKA 4DUZQ 1W0KD 3SC3A 3TUJC 3U7HB 5AUPB 2DWQA 1MKHA 4LF8Q 1EK0A 2ZRMA 3OEEA 1NVXQ 4QGFA 4WZBE 1LM0A 3SR0A 1G5RA 4TQUS 2A6HC 4MGZR 5BYKA 1VG8A 1DAGA 1XFAA 2FA9A 4KFSA 3G4SA 4ZDWA 2XAUA 2N46A 4X64Q 1WE2A 3FOZA 3KKPA 3SYLA 1U0LA 3I4MG 1P4SA 4LWZA 4B35A 1K8RA 2ZYTX 5IYDG 3H4MA 3FMOB 4H0LC 2R92H 1E69A 1N33L 1OLOA 2W58A 2VSXA 2KHIA 3S17H 3NBFA 4LBWA 2I0QA 4LHWA 3WXMA 5CITA 4NYIQ 4QNRA 3RABA 2B8GA 1IYVA 1EGAA 2A2ZA 2A69D 1G3MA 3EZ9A 3BFVA 3AVQA 3WMEA 5GAHC 1GD7A 3ULPA 2W0MA 4JBYA 2FPLA 2W2TA 2N49A 2E5LL 1QG2A 2BV3A 4BASA 3VA7A 1LS6A 1L7VC 2JASA 4OXPA 1HQYE 5TV2A 3U5ZB 4HJAA 2AK2A 3CXCA 2GJ8A 4BLRA 1E0AA 3MG9A 1YZQA 2JEOA 4GZYC 4KBFA 4Q7JB 4R4TA 4URYR 1G291 4OI1A 3GLFA 2FG5A 2F4VL 1FQKA 3AKCA 2PJZA 3S16H 4OWXB 2A5DA 2CDNA 2ATWA 1L2TA 3TKLA 3U4VA 1AS3A 5JJKA 4DR4Q 1R6BX 1XNJA 2FFBA 3OE7A 1HNXQ 3PEUA 4XSHA 2QMHA 3WMFA 4DLZA 4N3NA 1N2CE 5EZ5A 5KDOA 3PUZA 2R6CA 1VTKA 3AVWA 1VYUA 1DGSA 2CCGA 1GUTA 3UDXA 4V03A 3RR5A 3NDPA 3GTGH 2JLXA 1XD9A 4LJZC 4JI1L 3OEHA 3WY9A 3KLWA 2PX3A 1OXVA 3FFBA 3KXKA 1GNRA 4DJTA 3EPKA 5E7JA 4QL3A 2UUBQ 4GKKL 3TSOA 1KXLA 1P7CA 2W2VA 4PC7A 3AF1A 2SHKA 2V8OA 2JLSA 4Q7MB 2IS6A 4GMDA 1QVGA 4JV5L 1ZUIA 3CPHA 4BLTA 1CR0A 4EKDA 1GUSA 4DV6Q 4HIMA 1LB1B 4DLXA 1IN6A 4X6AH 5JI2E 2ZIAA 1X8LA 4DLSA 2ZAOA 1UBGA 1YVDA 2H92A 2XTZA 3NEJA 5H1YA 3SYNA 3QIAA 4GI7A 3KFUA 1M1YE 4TMTA 1M7GA 4DC9A 4JSYA 4OL0A 2NTYC 1P73A 1WBBA 1JNYA 1SVMA 1VQNA 1EUJA 4Q9KA 1QG4A 3GLIB 3QVVA 3WNBA 1WYDA 2VHCA 2ZR0A 3U6BA 4JVNA 1KD1C 5DGXA 1PJRA 2FZ4A 2UZ3A 1Q1EA 3K80C 1A7JA 3QXCA 3DXJC 2BM0A 3CQZH 2QY9A 5JFGA 1FW6A 3R9WA 4TSFA 1J90A 1FUUA 2JA6G 3I62A 4M53A 1YNXA 4BFZA 3WP1B 3T1VA 4DCVA 4Z8YA 3LXXA 3LX5A 4DBLC 1JB1A 2YVUA 3LQQA 1NMXA 1EWIA 4L5RC 2ZJAA 1AA9A 2RMKA 2DWPA 5FLXc 1ZRHA 4B3ML 3SJBA 4OWTB 3RLOA 1NMYA 2E87A 3EBEA 2YZ2A 3BFKA 3IKJA 1T3LA 2VP4A 5F98A 1NJFA 4EJSB 2F55A 2ZE7A 1HZBA 1LYLA 1G6HA 1UKVY 1HR0W 3KB1A 2O8BA 1P5ZB 1RIFA 1EXMA 5CB6A 5IP9G 1BMFD 1SGWA 1XTSA 4HAVA 4DCTA 2ZM5A 4R2IA 2H5EA 1TKWB 4JBMA 2C9OA 2YOGA 3SBEA 4M9ZA 4PZLA 5DNYB 1FL9A 5JHHB 1PH6A 4HJ8A 3RS2A 1XNRL 3KJEA 1R5NA 3VFDA 1ZNWA 2ZVQX 1DVRA 4AY2A 4GNXA 4E22A 2BH2A 3CCVA 3KF6B 2ZM6L 1EQQA 3MJRA 4BBSG 1BYUA 3KJPA 1Q81C 2O0JA 1QHNA 4WIAA 2OWOA 1KO1A 4ERNA 2OG2A 5IY0A 1HA3A 5JEAH 1EWHA 3C16C 1RRFA 5FH9A 1XMQQ 1Z0AA 1TQ4A 2HUPA 1Q82C 3J81c 4RZ3A 3B7GA 2F1IA 2JLYA 1WXQA 2HIVA 1IN4A 2OTLA 1HYQA 3L82B 4IFDJ 4NU0A 2OILA 4HJ9A 1T5LA 3QOFA 4BFWA 1B7YB 2VNUD 2EFDB 3ASZA 4B6EA 1XZQA 2QTFA 4MKHA 1E6CA 4OONA 1KK3A 1XBTA 1ZYUA 1KK2A 1N6KA 3AKYA 2J45A 2A1AA 2WOOA 1XU4A 2E75C 5C4XH 1II9A 1FJGQ 1KSFX 3QVUA 1X1RA 4A82A 5J4VA 4ZKEA 2V1UA 3DM5A 4DNRB 2VLIA 4AIMA 1LACA 1IJEA 2VBCA 2PEZA 4LHYA 3RWOA 2BE5D 4ZDJA 5GVSA 2HXSA 2QG6A 4JSTA 4LUCA 2VEDA 1E32A 3CF0A 5KSPA 4LFAL 5C4MA 3GLHE 5BR8L 5E95A 3K70D 2EFCB 2IL1A 4JI5L 3LV8A 4NCIA 5AR1A 2DPXA 2GCPA 2O0KA 1E4YA 4MUBA 2FJUA 3X2SA 2NZJA 4B3RL 4B43A 4LF6L 1I4TD 1VG0B 2F1RA 3RC8A 1C9KA 3NENA 1EFCA 5E7NA 3H0GH 3RYTC 4I99A 3BG3A 1IAQA 4JLMA 3PG5A 5HTKA 1OV4A 1A0IA 2NPFA 4BLOA 2R7FA 1N6HA 4O3MA 4Q9JA 4O0AA 2OSBA 3UWOA 2C77A 1YRAA 2REOA 3CMEA 4Q1AA 5TARA 8OHMA 5J4KA 4IFDH 1RZ3A 2IWRA 2ZSBA 4LF5Q 1V5WA 3K8YA 4QJFA 2H5XA 1JXOA 3THYA 1CR2A 2IYQA 3FYHA 1ONLA 2AHOB 4M4SA 5SZJA 2BMDA 5ELOA 3P27A 1YJ9A 1HNWQ 3SE0A 3PITA 4ZI2A 3STBD 1BVSA 2WKQA 4WAUA 3CCQA 1XP8A 3FKQA 5G3YA 3QPUA 3GD7A 2MO0A 4LC1A 4Q1FA 3G5UA 4RCNA 4JK1C 1T9HA 3PO3H 3EC2A 4DSNA 4XIGS 4X64L 3IQWA 4TYNA 5D3MA 4BQSA 1OIXA 2R9VA 1CJVC 3C15C 4GNXC 3NG1A 2DGYA 1EX6A 4ZCMA 4TZ6A 1VQBA 3I4LA 4A3IG 1OKKA 1Z5ZA 2N78A 3C8UA 2FH5B 3BRWD 4TYQA 1XJCA 4CEHA 4KO8A 1M2OB 2JA9A 2OT3B 4DLVA 3T35A 4PO9A 1Z6XA 2Y8EA 3F2BA 3UDIA 4JOIC 3U4QA 1JQJC 3CX7A 4C3HH 3L7ZC 2P65A 2EYUA 2LXJA 1WF3A 4IXNA 4BZQA 3VAAA 4GOKA 4JYAL 3V00A 4B32A 3KDFB 4BGDA 4Q48A 4KVAA 4BA1I 3J80i 4M8NE 2O8DA 2HLDA 2I5HA 3RN5A 2CLCX 3REFA 1UE6A 1DS6A 3B5JA 1G7RA 3ER0A 4L5BA 5SZIA 4PQRA 1UE1A 5C3EH 4TL8A 1HNZQ 4IO9A 3WHLA 1ZIPA 3U60B 3H1TA 2WJHA 2YWFA 1KHIA 1XXHE 3ASYA 1ZUNB 2PMDA 1E2LA 2ZRKA 2ZXUA 1IBKL 4EPRA 2JLRA 5KHOC 4QIWE 1XMOL 3TVTA 2I4IA 2PBRA 4Q1DA 3HKZE 4OWWB 4IJMA 1YBYA 4IRUB 3KTAA 1ZAKA 4UP7A 1I6VC 3SQWA 4P31A 1N5KA 1HEIA 1HTWA 2RHMA 5TY0A 3SI7A 1E0JA 3J81j 2BBSA 4BLSA 2OQKA 3P4YA 1JALA 3DHWC 4A8JC 3P26A 3OPOA 5F9HA 3CB4A 4JIMA 3GFTA 2BIFA 3ND9A 1L4UA 2QAGA 3EARA 1SKYB 1GKHA 4UY8C 4U02A 3HOWH 3TNFA 1WOCA 5HGQA 3HGBA 5F2EA 3TK1A 3MXNB 2I1QA 1MO3A 1VECA 1YR8A 4DV3L 3LFUA 4Q01A 4S2EA 1PUJA 2ZE6A 1EG7A 3LD9A 4JBWA 5C4GB 2IEZA 5IYBH 3A36A 4RZUA 5TDHA 5GJCA 4V0OA 5G41A 1RL2A 4BXXG 2IYZA 3O8DA 4II7A 3EPHA 4D25A 4P3YA 2GEUA 1SLJA 3BGWA 4B74A 2HCJB 2ZT9C 4K0KL 2IW3A 3N2EA 2K5HA 2KJQA 2REXB 1ZMXA 2ZITA 4P75A 5KNBA 2KI5A 3KZ1E 4Q02A 4R98A 4H1VA 1IY0A 2J0UA 4MRSA 1XNRQ 1G4UR 5FFMA 4BLQA 4TZ0A 4RFSA 1KAOA 4OO1H 3HOXH 2G88A 1XD2B 3EC1A 4NHOA 3F2DA 4NXNQ 1W2GA 4C0AC 3I4OA 3CCJA 4Q1EA 1K6MA 4BPBA 1W5TA 4EPYA 5H8WA 4W7SA 4Y0AA 2EJFC 2BMJA 5C4JH 2QNRA 2A8VA 2IS2A 1DAMA 1CFMA 3KF6A 1CEEA 2UUCL 3QSYA 3I4NG 3CCSA 1OPXA 2BEJA 3LW8A 4Q4HA 4F91B 2RGAA 5HZKA 4BY7H 4TTRA 3I5YA 3TUZC 5BN4A 3OEED 2HLDD 3QKSA 1G8HA 4A3KH 4RCYA 2CFMA 1FPMA 5FL7A 1H8HD 4PV1C 1N25A 2OLJA 2QEQA 1UF9A 1BKDR 3MWYW 4KFUA 1JJVA 1OE0A 2OCEA 4LJAA 4M9QA 2WFWA 2WMNB 4DR6Q 2WICA 3PV0A 1OJLA 1VIYA 4LRWA 2LKDA 1P2SA 3Q72A 2ZTEA 4IEIA 4Y0VA 1U5KA 1KI9A 2CLSA 4HATA 2OLKA 4XOIA 3W1GA 2QF7A 1DG1G 1ZCAA 2ANBA 4OI4A 2GVZC 1CIPA 2P3SA 3BERA 2DCUA 5IYCH 2A68D 1F5NA 1G8YA 4UXJA 4Q00A 3U6KA 3ZYCA 4EX5A 2C78A 2QBYB 4D26A 1LTQA 1N5LA 4KYUA 4TMVA 3WBJA 1WFQA 2RGDA 3MAAC 2PJRA 2GILA 1CKEA 4AWXA 1ETUA 1B70B 1KYIA 2OUKA 4JLKA 4O25A 3U7GA 1PLLA 3ULJA 2GNOA 2QTVB 1XRJA 4FCVA 1TF5A 1PH8A 2A5YB 3ADDA 2OAP1 3B78A 4MUAA 4OYHA 3QI2A 3PVSA 4RCZA 2Q8IB 4IPHA 4TMXA 4Q9IA 5LBIA 1E2QA 1RYHA 2FPKA 4HLQB 2XZOA 3RLNA 1J7KA 2CEAA 5KDLA 4FI3C 1LABA 4M1SA 3F8TA 3J80c 4BXXH 1KSGA 2X2EA 1DPFA 1ODFA 3KTAB 4OK6A 1FL0A 3HPRA 4CDGA 1E2PA 4TVAB 4M9SA 1WRBA 4X66L 2FMXA 1LUZA 1SXJD 4C0SA 4MZ9A 1OFUX 4EPXA 5JWRA 5JLJA 4R7ZA 4B3MQ 2NZHA 4LFBL 2IF0A 4W5JA 5FUWA 1XPOA 1W48A 3AVXA 4KN4C 2E74C 2X19A 1E1RA 1E2IA 3CBQA 1DG3A 1OYWA 4IDNA 2BDOA 2OV2A 2GJKA 2JAQA 1F2UB 1G41A 3S2DH 2FU5C 2VP2A 2ZREA 3A1WA 4JKIA 4N0DA 3HFZB 1JAHA 2WTUA 2D2EA 2RCNA 1BBWA 4JI3Q 2PX0A 1RIPA 4DT1B 4ZI3A 2PNHA 4YCWA 1TADA 3B9PA 2WV9A 4FW9A 2PI2A 4XWKA 4TYWA 2O0HA 1IBLL 3H15A 2IY5B 2F7SA 1A2BA 2FFAA 3X1DA 1WJJA 1OF1A 1P2TA 5DYIA 3DM9B 4KLKA 1SVOA 3W90A 3I55A 2O8BB 2R93G 2JATA 1E1QA 2WAXA 2WJJA 2RHDA 2CLDX 2OHFA 3O8BA 2P2LA 1DE0A 2WVJA 5FOVA 1S3OA 3CNOA 1XEXA 4LFCQ 4R4CA 3K0CC 4QFMA 1NNEA 4MRRA 2FXQA 4BA2I 2WZQA 5CM9C 1XJVA 4KFTA 4YY3Q 1VQ9A 4DR1Q 4ZCIA 2FDCA 3GLGB 5CJPA 3TJZA 4ARZB 3ZDQA 3UXMA 2ZETA 5C0XJ 4LYFA 2QN6A 1I94Q 3CIOA 5DLQE 2RHSB 2YYZA 3RANA 4E03A 4LYJA 3SNHA 4UJ5A 1G64A 2FFQA 1NKSA 521PA 2IT1A 1J99A 3WWVA 4DUYQ 1Q7YC 3AVOA 3G0HA 3I61A 1PH1A 2L15A 3PUVA 1E99A 1XD2A 5CLLA 4BY7G 1Y1VG 3CR8A 1F6BA 5EE0A 2UZIR 1NJGA 1UKYA 4MQBA 1MO6A 1W47A 2XB2A 1KC8C 4NCHA 4A2PA 1VQEA 4XTCS 3MEFA 5AJYA 2P6RA 1XMOQ 2ZQ5A 1SXJA 3UATA 4N1AA 4C3JH 4OJQA 3E0EA 3CC4A 1ESNA 4UQOA 3KLRA 2UUCQ 1P2UA 1YZUA 3J81i 3HOYG 3SDZA 2QMEA 2JA5H 2ZJ2A 4P72A 1TNDA 2OFXA 4A3FH 1I4LD 5KUTA 2RF4A 2WIBA 4AI6A 4A3DG 3WNCA 4OK5A 1J8MF 4FD2A 1R0YA 4URVR 4CEJA 4OHYA 3RS7A 4ZPXA 2F6RA 3IIKA 3QF7A 4IJHA 4HAXA 5IHPA 2IX0A 1Q86C 2R93H 1BO6A 5FL3A 1DOAA 4QKQA 3PO2G 5LDDC 1M8PA 3IBYA 3KJGA 3K09A 4LFAQ 4H9GA 5DI3A 5KNCA 4C0BA 3E5HA 1O3YA 4FXPA 3SS8A 4UNNA 3AQ4A 3THXB 2QI9C 3AM1A 4DK0A 4B2PA 4QGUA 3OOCA 1DXMA 1CKOA 3M9BA 2ZJ5A 3LLUA 3DEFA 4QXAA 2IWHA 4NH0A 1IOZA 3FB4A 4M1YA 4QC2A 4CEHB 1SMYC 4JYAQ 4IQZA 1E96A 4IVRA 3V9PA 1N9WA 1M34E 2YV5A 2CHGA 1RRCA 1ONBA 1J70A 1US8A 1ZJ6A 2CE7A 2CJWB 2ZUDA 1U9IA 3LA6A 5FR2A 5DE3A 4DDVA 2BBTA 4DUYL 4G5OA 2GK7A 4HB4A 1D9XA 2YHSA 2L0XA 3AUXA 3HYRA 1GUNA 2XOKA 2C8VA 2ZR7A 4KSCA 5DH9A 2XXAA 2NO9A 1A63A 2G0TA 3HP1A 2O5JC 3T34A 2DFNA 1LV7A 3S2HH 3LQRA 4B48A 2ORWA 1GKUB 2QPAA 3Q3JB 4G7HC 3Q9LA 3PEYA 4A8JB 1LF0A 4A4IA 3M3YH 1E98A 1R0ZA 1TWGH 3PIOA 1Y63A 3D6TB 4J0QA 1GKIA 4LBYA 2OXCA 4JLPA 4H44C 2YTXA 3CF2A 1HZCA 1HNZL 2BBOA 3GLFE 5LD2B 1CKNA 1E2DA 4DDTA 3KQUA 4JI7Q 1DARA 3CD6A 1GIAA 1XF9A 2FSIA 1YNNC 3OAAA 1OHHA 1XEXB 1IYUA 1A62A 4JI2L 2IHBA 4HYYA 1UEBA 4DR3Q 2ES2A 3A8KE 4B3TL 1L8QA 1VQMA 2PT5A 4D0GA 5JEEA 1JEDA 1KDPA 4WOPA 4AK9A 4F4IA 2AR7A 3KDFA 1VF5C 1R7RA 1RYFA 3GJ5A 2GK6A 3K53A 4C2MH 4QG7A 5KPDA 4DB4A 1V43A 5FL7D 5BR8Q 2NO0A 3K09C 3TS2A 5EUMA 1GHKA 4A3BG 4OBEA 1JJGA 3KYHC 3JVVA 2TMKA 4ILEA 4Q4LA 1KOFA 4ZV4A 2BA1A 1AQUA 1M7HA 3TMKA 4WBSA 4EQ5A 1CKNB 3T5DA 2FX3A 3FHTA 5C4XG 2E8GA 3BJIC 4RD6A 2VSOA 1TF2A 4X8LA 4JVSB 1TU4A 1RRGA 1DAFA 1XX6A 3MD0A 1W4BA 2J7PD 2PCLA 5FUVA 5JS8A 1OIVA 3OFND 1Q90A 2WWFA 2IYYA 4KYIB 1SRUA 2QTHA 2CHQA 1VS0A 1KY3A 4TSFD 4DV2Q 1KI7A 5DYGA 2V3CC 4PAOA 3CRMA 2IA5A 4EPVA 4BFSA 1NN0A 3W6OA 3K0AA 4R1JA 4Q4HB 1IONA 1T4GA 3ZZUA 2GJAA 4FMCF 2XX3A 3CZPA 3VHLB 2RGBA 1E9FA 5FUYA 1KAWA 4C3IH 2FF7A 1YR7A 3P1JA 4ACBA 1B23P 5FLMG 1W2BA 1QRAA 1K0RA 1OSNA 1X8KA 4LFCL 4ITRC 3UMRA 1Q1ZA 2GCOB 1UFQA 5H1SE 4G5RA 1IW7D 4TLDA 4QHYA 5GJVC 4HUQA 2O8CB 4BE7B 1BIFA 3IFTA 2MNAA 2VQEL 1IXRA 1KK1A 1UBEA 1YZNA 3MGCA 1NN1A 4HIDA 1MO4A 1X3EA 4UPAA 1KO8A 1R10A 1TXYA 5JBQA 1XTJA 2ZI4A 2GWHA 1E2MA 3QEJA 3NBHB 4NONA 1FX0B 2REBA 3RVBA 4F38A 2WWXA 5EP4A 1G4AE 5TMPA 3GTLH 4FIDA 2FSGA 4PHTA 5FBRB 4JI3L 4W9MC 4QJ4A 3SYKA 2IEYA 2HHHL 4Q4AB 1E2HA 1IQPA 3PENA 4B44A 4QBHA 1CF4A 2WMOB 1II0A 3TQFA 1DAHA 2JA8G 2WWIA 3IILA 1VG1A 3AF2A 4PPQA 5FUXA 2BDTA 4BFYA 2D0OA 2ZJYA 1XPUA 1VQOA 5JHGB 1H9SB 1OB5A 3T51B 4RG1A 3CCRA 1KNXA 2FSHA 3ERSX 4GS3A 2QA4A 221PA 1U90A 3C5HA 2CHVA 2GXQA 4HEJA 4L16A 5JCZA 1E1RD 1H65A 5J4YA 3K70C 5ANRB 1NL3A 1N0UA 1B0UA 2ASEA 4AYXA 1SKQA 1QJOA 1T8UA 5IF9A 5M3FG 2N1BA 3KFVA 4HZUB 4DRZA 4F4CA 1I3QH 2KBFA 3LBIA 2G3YA 1VCOA 4NCJA 1KRSA 4JBKA 3HKSA 1WBDA 3KKNA 1U9IC 4IKEA 2D5DA 4DLUA 2OFWA 1M7BA 2KA7A 4V0NA 4D6PA 2OXRA 4QL5A 2P5SA 2B21A 3GJ0A 5AJVB 2IHFA 3W5IA 1VQHA 3K9LA 5KYKA 5JEDA 4MYUA 3I72A 2MMCA 5AJWA 3TSWA 4DAYB 3P4XA 4JI1Q 1FMJA 3F2CA 1HQCA 3Q7PA 3RS3A 3S1AA 3AVYA 1IJFA 2G1JA 2B7CA 3AGPA 1E4VA 4DHEA 1HR0L 4V0LA 2RKOA 3DVLA 2HDNB 1Z07A 3S1AB 4B73A 3THWB 2UXBL 1ZM4A 3DMDA 1XNQQ 3U9SA 4RD0A 1GJXA 2G9NA 3QBTA 4DEXA 1N32L 4PQYA 4PZ6A 3IEUA 4URZR 1N0WA 4JYCA 5GJWC 4O2RA 3NE5B 2ZYUX 2WB1G 1H8ED 1UPTA 2GESA 3A37A 4MKFA 1WMSA 4ESHA 1G3QA 2YC2C 1M90C 4DSUA 1HJPA 4BFXA 3BZCA 3TR0A 4KLNA 2DWOA 4C0KA 3SU8A 1ZBDA 3CMAA 2FE4A 3O47A 1TU3A 2JA5G 3AP1A 3ZVMA 2PNRC 1IBRA 2DBYA 2YWGA 3CPFA 2PI2E 2BH8A 2CVHA 2JLUA 2AFHE 4Q7KA 4PO1A 3LGJA 4H02A 4KMUC 2CE2X 1VHTA 4BFUA 2Q0HA 5BWMA 4HJ5A 1FTNA 3SGIA 4BFTA 1PH3A 2VZAA 1G3IA 3PR1A 2IUUA 2WPDD 2OO7A 2PT7A 5LD2C 2QP9X 3CRKC 4LCBA 1UKEA 1UE7A 2H18A 3Q5EA 4L15A 3UMSA 4EJSA 3G71A 2UUBL 4OHWA 1IBMQ 2NGRA 4IXMA 1BBUA 1ZU5A 2XNSA 4YQFA 3NBYC 1Z0DA 4PZ8A 2IYWA 2V1XA 3A8JE 4LUOA 4LW1A 2V55B 4ZDIA 3J81k 1YZTA 2Z6KC 2HEIA 4JVLA 4NYJR 5FOWA 1OXTA 3UWKA 3X1XA 1CTQA 4DR2Q 1NMZA 2VP9A 2AD5A 3CWZA 3H2YA 1OB2A 4L5SA 1JECA 4C2TA 3OW7A 3OW2A 3HJNA 3RSOA 3KKQA 3PIPA 5KU1A 2JA6H 3PJRA 4LSGA 3FTQA 3HR8A 3UK6A 1H9JA 4B76A 2A6EC 2W6JD 4RVCA 4DNTB 4MRNA 3H3VH 3FKSD 4LJ4A 4OX9Q 4NMMA 5IDVA 4YMUA 1P9NA 3QG1A 2WSSA 2WJIA 1Z83A 5B58C 3RS5A 2CL7X 1SVLA 2VHTA 3FE2A 1W0JD 4RD2A 5KO2A 2B8TA 1YNJC 1S9HA 5KSOA 2E2HH 2ZRNA 3W8RA 4ZIRB 4MRPA 4IFDI 1ELOA 3M4QA 1SULA 4QBFA 2HXYA 4DAMA 2E2IH 4MGIR 3R9IA 1GILA 1UEIA 4BFVA 1HE8B 4A0GA 3GTQH 4WXPA 1GL7A 1KI3A 2F1JA 2IHEA 1I2MA 2GKSA 3KQHA 3TZUA 2VUMG 2GBLC 3OIYA 5AUNB 5KTYA 1YHAA 3S1NH 2O5VA 1N33Q 3DMNA 1N6IA 2OQ0A 3V4FA 4LYHA 4G7ZC 3ZS9A 3QQ5A 5B57C 1Q57A 1PMRA 3UDGA 1IBKQ 2QP4A 4LBVA 2VS1A 2OTJA 4P4SA 1BKBA 2XITA 3WYGA 2NMVA 3T1HQ 2EWWA 3U3MA 5B30A 4A3LH 1JPNA 2NO1A 3VQTA 1TAGA 3QKSB 3CRQA 2A5GA 1VQ4A 4ZO4A 1YHQA 4Y7NH 3FHOA 3RRNA 2CBZA 1II8A 4YC7A 3I56A 2NO6A 2FN4A 1L4YA 5GADl 3F3YA 3K7UC 4DV4L 5FOTA 1E24A 3DZDA 2IYRA 2CCJA 1HH2P 4BBRG 3BD9A 4ZKDA 2KBEA 1Y8PB 4YWKA 2C35B 3EASA 3NELA 5J4HA 2R6FA 1RFLA 1EIYB 2DFTA 1VQCA 3X1WA 3GTMH 4A9AA 5C46F 4NYJQ 5K8IA 2QBYA 1NBME 3NTUA 3GEEA 1G9XA 3OTOL 3GTKH 1U8ZA 1Z0IA 2OCAA 4MTNA 1JR3D 4GOXA 3WP0A 3ZQJA 3THXA 5C0XI 4EPTA 3HU2A 5EXSA 3HOYH 3DO6A 5M04A 1IHUA 1SKYE 1KQSA 1GZSA 1XXHB 4K8OA 5FR1A 1OH7A 2D06A 4MGKR 4CT5A 2RGNC 1Y1WH 1X6VA 3AV0B 2AK3A 4LOAA 3TGPA 2ZROA 1MJEA 4JL8A 2DNCA 4DK3C 1HR0Q 1KNQA 1PUIA 1CLUA 1W0JA 1XJ0A 1HNWL 1G5PA 2J59A 2X1VA 4RD4A 1W36B 1VQLA 3BZKA 4BUJA 2JJ1D 4GT1A 1G18A 2J7KA 3B1YA 3I8XA 4TWZA 1BDOA 4BEBA 1ZM3A 2C96A 2I5LX 3I8SA 3NHBA 4BWYA 3B9QA 3K0CA 3QY0A 4EFNA 1NVUQ 4AG6A 1VQFA 1N6RA 4TTQA 1IY1A 3I4NH 2PZEA 4B3FX 1KKLA 3AQQA 1LNZA 2JDIA 3VX3A 4DV7L 2F9LA 2JJ2D 4US2R 2ZSAA 4GP6A 5KNDA 4A0FA 1FTSA 3ADKA 3I4MH 4F92B 2EU8A 2ZRGA 3WYFA 4JI6L 4BZPA 5EE3A 5LMUL 1JMCA 1XDBA 2C99A 3HU1A 3PEVA 2A68C 2DR3A 3ADCA 4LF7L 1H9RA 3K8AA 1NF3A 4LJ8A 3B8HA 4KHZA 4US0R 5B64A 3OIUA 4ESVA 1R8SA 3VR1A 1Q3HA 2VHUA 4KN7C 1Z63A 1IXZA 2EVWX 4IOAA 3U7FB 3TQCA 5GAEC 2C2HA 2F9MA 2WJGA 4DV5L 1TWAH 1S4QA 2PZFA 3Q85A 3CPWA 1VQ5A 2ZSEA 4XVRA 1AM4D 5DSZA 2ECKA 2GCNA 1YI2A 3L0PA 1XXHA 1A82A 1E79A 4M22A 4B47A 5JWOA 2CCZA 2IXEA 4GBMA 4V02A 1HNXL 3GTOH 4KLZA 3CCEA 4PPFA 3RLFA 1P16A 2Q2TA 1M6NA 1ZD9A 1AGRA 4JJKA 1W49A 2GEVA 5DN6A 5M3MH 2ZJPA 4LK2A 2X8AA 3GP8A 1ZVQA 2EDGA 4IDPA 3L8ZA 3OAAD 1GVNB 4DV0L 1AZSC 1NE3A 2JCSA 2K50A 1YHBA 3N2IA 4YMTA 5H70A 1UE5A 2E5LQ 4WJ3M 2R62A 1ZD1A 5HPYB 4EFMA 4JI8L 4DR5L 1HTPA 4B3TQ 3I2ZA 1KI6A 2FGJA 2ZVPX 3LBNA 2WIAA 1O7LA 4PPNA 1EFTA 2D2CC 4L5QA 1YZLA 3DKPA 2QRZA 2W0SA 4JMPA 4JLBA 1AJEA 5G3ZA 2OCPA 3UG7A 2G6BA 5J4LA 3C5CA 1PLKA 1F2UA 3DOEA 2UKDA 4BECA 2EQBA 4FCWA 1G3UA 2QL6A 4R4OA 4GOPB 3KJHA 4C30A 3IQXA 1YJ5A 4DWJA 3H86A 2IYTA 3A8TA 4HDOB 1T8TA 2A9KA 2IX3A 4OKSA 2WB1E 4L8GA 4JI0Q 3TH5A 2ZTDA 3W8NA 1JE5A 3AH8A 5IYBG 1X86B 2K32A 2ODWA 3CRW1 1YRBA 5GVRA 1JQLB 2RGEA 1ZW6A 4DUZL 3ZZ0A 2NVYH 1X1SA 2J46A 3B1XA 1I2DA 1GUGA 3AKEA 5J47A 421PA 2GAAA 4WA7A 5IRCD 4PZYA 3LNNA 1L0WA 4Q4AA 2VHJA 4EDHA 5CYOA 2GZDA 4B71A 5FPHA 2FEOA 1OYYA 2DYKA 4UNSA 2ZUCA 2AMCB 3B13B 4H1UA 1F3OA 3SHFA 2ZE8A 4NPHA 1JR6A 1F60A 4RD1A 721PA 4LJ7A 5CLQA 1PHJA 2DFLA 4TL9A 1NSFA 2FPMA 2ZJRA 2YOFA 1NMFA 4DV5Q 2CQOA 4FMDB 2Q3FA 5B2ZA 4POAA 2O5IC 4Q1BA 4CIDA 4DZZA 4XD7A 1N6NA 5G53C 4QBIA 3HYTA 3H3VI 4I1SA 3FVQA 1PH5A 1R4AA 3BB4A 4DSTA 3HR7A 4TT3D 2L5TA 3HOVH 5HKKD 1CSPA 5EXXA 4D4MA 2MSDB 2ZJQA 3CCUA 1UAAA 1Y69U 5CIQA 4CZ2A 4IOLA 1X56A 2NVQH 2W00A 1KDRA 1EX7A 5CK5A 3FPPA 2B63G 3ND8A 2CK3A 3BAFA 3QF4A 2WHXA 3KQLA 3PUWA 3U3RA 5IP7G 4BBSH 3FHWA 3CUEF 4A6PA 1Z6HA 1IXRC 4A3JH 5K8TA 1JI0A 1IW7C 2GXSA 4C4PA 3TRFA 1UJ2A 1OHHD 1SZPA 2ZS9A 4TMKA 1PA6A 3RC3A 4OX9L 1MV5A 4A36A 3J7ZC 3BB1A 1X65A 4N0EA 4LHVA 1EQRA 4A3MH 2VP5A 2NIPA 2F3IA 4Q1CA 4WXRA 1XTIA 4O2LA 5M5WH 2PL3A 1I6HH 2X2FA 2VO1A 4LPKA 1VQJA 1E94E 2E1RA 1T5EA 4KJZA 3OESA 3PIRA 1S2MA 4P4TA 4A6XA 4PANA 2BJVA 4EAQA 3LXRA 3K1JA 1GNQA 1UDWA 1X55A 3GCGA 4A3BH 3KUCA 3UMFA 3IRBA 2G1KA 3BDOA 4XWAA 5DI3B 2D3WA 4JI0L 2BKEA 2JXMB 4Z8XA 5EXTA 2HV8A 3AB9A 4GMXA 1G19A 4TQAA 1CBUA 1OXUA 1GWNA 1P61B 1NLFA 4YWLA 4DR2L 1G51A 4GN3B 1P62B 1D2MA 1GVPA 3DM3A 4BY1G 1SR3A 1YZ6A 2NVTH 2QRNA 3H94A 1KMHA 2P67A 4UXIA 4DUGA 4DV4Q 2IYUA 2F43A 4JS0A 4DKAC 1Y14B 1G5TA 3FP9A 2D2FA 2W6JA 3X1ZA 5FPKA 2IS1A 2Z4RA 1BH2A 3IO5A 3L2PA 5TB5A 3O8CA 3Q7QA 3REGA 3EN2A 4PR0A 2QAGB 4NXMQ 4KITB 4G7OC 2BCJQ 4DV0Q 2YTVA 2Z0SA 4DK6C 4GLXA 1W4CA 4HLUC 3KF8B 1W36D 3ZVRA 1WCMH 4GFDA 1Z28A 4B33A 3CW2A 3A5UA 4A92A 3SFZA 1XZPA 4QGHA 3IPYA 2A6HD 1Z0KA 2H1LA 2IYLD 2ZU6A 4LJ6A 3RS4A 3IUYA 5AUQA 1GHJA 2WAQE 4F4JA 1JR3A 3VTKA 2HIXA 4E5UA 2I1VB 2QA5A 4L9SA 1K73C 2JJ2A 2QT0A 4OQFA 1U0HC 1NN3A 1KHTA 4BRUA 2BJWA 1S9DA 1C4OA 4UNRA 1E9BA 1G20E 1VKJA 2FWRA 3N70A 4IW3B 4PFSA 2F1HA 1N36L 2KCTA 2ZRPA 4A2QA 4Z51A 3QPWA 2UXDL 4KHPQ 1I4DD 3GLHB 4HUTA 5JRZA 4MDEA 4HDQB 1XNQL 4LUZA 3CRLC 1LY1A 2JJ1A 3TS0A 2Z6KA 2ZRAA 3QKTA 5CJ2A 3T1OA 4NYMQ 1A4RA 5CIWA 4A4DA 4Z54A 5JCPA 3PGZA 5IE8A 2PPBC 2UXCL 1KJZA 1NY6A 1EFHA 1TPZA 2Q9AA 2V7QD 3DKVA 3A4LA 3RN2A 3KJOA 2C5LA 3D3QA 4B3DA 4B3GA 2O8FA 2XZPA 1Q46A 1FZQA 2VP6A 5DI9A 3MWLA 2GN5A 1K83H 1D6JA 2ZE5A 1A8VA 1E2VA 1G21E 1Q1QA 2IXFA 4LF9Q 4RZ2A 4QHTA 1YJWA 1P9WA 4S35A 4P32A 3A1TA 2N3SA 3A8IE 1LF5A 3A58B 1R0XA 3M6AA 2IBMA 2R44A 3K81C 1JEEA 4JLVA 4Q21A 5C1BA 1C9OA 1HE1C 1XB2A 2CNWA 4M1MA 5H68A 1TTTA 1TQ6A 2VQSA 4YCUA 2GCOA 2ZJ8A 1NN5A 5BW8A 1RVDA 3S15H 3GLGE 3UDFA 2KCMA 2J87A 1YEZA 1ESMA 3LY5A 3K9HA 3H84A 4TYPA 4C0QC 4JI8Q 2HT1A 4NE2A 4RY2A 4P4SB 4G0NA 1CRPA 821PA 2ZI9A 1Z29A 4LHZA 1SXJC 4HSEA 5JEAJ 1OKKD 1CU1A 1QF9A 3CCLA 4XJXA 3U4ZA 5AWFC 3ADBA 1CJTC 5TXGA 3K0AB 1E9RA 4JLDA 3I73A 2K52A 2QM7A 3BIFA 2R8RA 4A15A 2F3TA 3QKUA 1NKTA 4KVGA 4A3GG 3T15A 2QMOA 1OH5A 2LMCB 3MCAA 4KKTA 1N6LA 5L3VA 1KY2A 3WDNA 4GPTA 3VKHA 2GVBA 3AYHB 3W9YA 4A93H 4DR7L 3VR5A 1FGUA 3T1QA 4TTPA 2AFIE 2B29A 1UWVA 5GROA 3QKRB 1T0JB 1NP6A 4DR6L 3T1HL 1MIUA 3HWSA 4G5QA 4MITA 4D4KA 3PUYA 4LBZA 2IYVA 1P8LA 3RRZA 3LNCA 5EP2A 3EPLA 2ERYA 3EZ7A 1MT0A 3AGQA 3QXSA 4NDZA 1VQGA 4QNMA 4DR3L 2NOAA 3EA0A 3EW9A 4B3SQ 3L43A 3RDPA 3FKSA 2R7DA 1P72A 2IX1A 4B6FA 3MSXA 1U8AA 2X77A 2ALYB 1Z6TA 4JI6Q 2FV8A 1Z0FA 4G5GA 1AS2A 5EAYA 2R6DA 3AVUA 5HCNA 2WKRA 4HI0E 2VQFQ 3RRYA 4DLWA 4MDFA 4PX9A 1E9EA 1DD2A 1P2VA 1Z3IX 4P73A 2NVXH 1G8PA 1E1OA 3Q8DA 3GJ7A 4IFEA 4URXR 2JA8H 2PCFB 1EESA 3VNVA 2GVAA 1ASYA 1Z6YA 4A3CG 4HAZA 2O52A 1X3SA 4JCVE 1JJCB 1W3SA 4PHHA 5AK0A 1HURA 1Z47A 2FSFA 2PLFA 4OI2A 4DIEA 3A1VA 4JOIA 3C14C 1ZIOA 3GEIA 3KXLA 2XSZD 4NYMR 4Q7LA 1QHYA 4JLNA 1HH4A 1CP2A 2QE7D 2H16A 1H8HA 4GNKA 4NYIR 3KFXA 4D80A 3ICEA 2NN6G 2F43B 4LUVA 4NXNL 5DIFA 1FQJA 2JQOA 1W4AA 4I4LA 4TT3A 4J15A 3W3ZB 2V9PA 3ETLA 4LJ5A 1MOZA 1T91A 1E9SA 2ZU0C 1KZ7B 3CRVA 2Z0MA 3HOUG 3IIMA 4O0MA 5LMNQ 2YKGA 2RGCA 1KIMA 1DEKA 3M4PA 1OW3B 2VIIA 1HUQA 4HZIA 1PH9A 1QUQA 3BJUA 2ZANA 4YXWA 4DLYA 2GF9A 2C9YA 4NKRA 4PSAA 5FBWB 5FPSA 5FLMH 3BE4A 2XB4A 3RS0A 2R92G 1RPZA 2K14A 4AQYL 3K9GA 1OXSC 1TUIA 4ACAA 3CLVA 1E7ZA 5FTKA 4GKJL 4JI7L 3BORA 3WHKA 3LWUA 4P74A 4DR4L 2V4ZA 2V1CC 1D7QA 4R4QA 4Q4JB 1E2FA 4TL7A 1W46A 3VHXA 2QM8A 4P0TA 1VCMA 4TYYA 1TEXA 1G16A 5BN3A 1Z9FA 2FOLA 1PZNA 4RMFA 3V4RA 3B1VA 1RJ9A 2AUJD 2QAJA 2GXUA 2FGKA 2AXNA 3VKWA 3IGFA 4BRWA 2CL0X 3GLIA 3CR7A 4PHGA 2NZ8A 4X65Q 1EFRA 4URWR 5DHAA 1HPCA 1YZKA 2JIZD 4XH9B 3RHFA 3CO5A 4M1WA 2B6HA 2QSZA 4IJLA 1N5IA 4D4LA 2KBNA 3R8CA 2QORA 1VCNA 4HZUA 1ZM2A 2F1MA 3IDQA 4LGMA 5E4FA 2YOHA 4WW0A 1S1MA 2WSSD 4UXHA 1J8YF 4DLRA 4GN5A 2JA1A 5E3HA 5L3QB 4JI4Q 4OK3A 1VDZA 4PAMA 2EFEB 4DV1L 3SN6A 1QHGA 1Q21A 3M0EA 4F7WA 3GEHA 5BXQC 1K9MC 2VL7A 2WJVA 3GJXC 4HAYA 5JS7A 2RGGA 4U7DA 1XMIA 4DR1L 2K5VA 2UU9Q 1D2NA 3LBHA 4DPGA 3ZJYC 2AKWB 2HQLA 1XCGB 2QQ0A 3ZVNA 1SE8A 5EE5B 1UDXA 3GLGA 1QHHA 2YWHA 2GDJA 2MMGA 2QGNA 4HB0A 1G8FA 1R9TH 1SXJE 1NVVQ 1KSHA 2G77B 4OQNA 4KKUA 4PSVA 2BMEA 4V0ME 4M9XA 4YMWA 1Z22A 3G82C 4JI4L 4Y52H 1V9PA 1VQKA 2ORVA 3GFPA 1YZGA 2HF9A 5DN6D 5IYDH 1U98A 3UE0A 5IYCG 2C95A 1PYSB 2KENA 2GJSA 3MWJA 2OCYC 5FOUA 4MH0R 4WJ4A 3I32A 4KAXA 1AE2A 1NG9A 4DB2A 4GP7A 4TQ9A 4M21A 1KDTA 1N34Q 3AF0A 5EZ6B 1L1OA 3KOJA 4RKEA 4TN1A 4GKJQ 4AC9A 4QBGB 2C03A 3BH6A 2VY3A 1MO5A 4OHVA 4Q03A 1I50H 2GEDA 4ON9A 3KJIA 1QDEA 1TF7A 3QXHA 4FWIB 1QVRA 2VSFA 2C04A 1GM5A 2Z83A 4CEIA 3OYYA 3E70C 4HLCA 2VW9A 3AFQA 5KSZA 3A1UA 1NMGA 3CNLA 2HHHQ 4RJLA 2EYQA 1MRNA 4R9UC 1SHKA 4AG5A 1RKBA 2XTNA 3U50C 4LF6Q 2XJ9A 1R0WA 2AKAB 2IHYA 2Q6TA 3PFIA 2E76C 1E2JA 5GQOA 1VCIA 3NHAA 1KJYA 4KFRA 4GLAC 2RGNA 3QEOA 4NPSA 3TVDA 3MUFA 3F1ZA 3G48A 3N6RA 3PCRB 1KI1A 1IM2A 1XTKA 2IYXA 3BU2A 3QXXA 2JA7G 3WYAA 2EJGC 4M1OA 5KOYA 4D2IA 1ASZA 1COWD 1TWFH 1KO7A 2CVFA 5K8LA 2GXAA 1JB7A 3ECCA 2D4HA 2UXBQ 4LWCA 4WVFA 4WZAE 2ZJBA 3ZQ6A 1D8LA 1PH2A 1F2TB 1Y8OB 3BH7A 2VF8A 2D0PA 3EIHA 3U58A 1HY3A 3KB2A 3VR6A 1CR4A 1GL9B 3KL4A 4A3EH 3SEAA 4A3MG 2R2AA 3L0SA 2HT6A 5LPNA 1VQPA 4B75A 3PCOB 1FNMA 3KDSE 1QZXA 2A7QA 1NLYA 3AUYA 3QENA 4LFBQ 2ONKA 5ELXA 4US1R 1E2EA 4E09A 3R9XA 5C44H 1W1WA 3CCMA 2VTKA 1TU2B 5BN5A 3GFOA 4A75A 4PO8A 4G5SA 4M2LA 4ZCLA 4YWMA 2EIFA 1Z7TA 2JEAI 1HZ9A 4LNQA 5K36G 1A2KC 1S8FA 2V54A 1SVIA 2R6AA 2O8EA 3HKZG 5C3EG 2CXXA 3BBPA 3RWMB 2B92A 2R7ZG 3PO3G 3DDCA 3WMGA 1Z2AA 4MKIA 1NJIC 3OF5A 3TW8B 3CM0A 2K33A 2VP0A 2ERXA 2LWIA 3BFXA 2ZEJA 3EZFA 4OHXA 2C9CA 3ONWA 1X3GA 4AH6A 1VF7A 1O7IA 3BC1A 3MMPA 1Y1WG 1PLJA 5JWHA 4C0HA 1XD8A 2D7CA 4AD8A 1HV8A 1QVCA 1K5DA 3FFAA 3LO5A 4FMBB 1VIAA 5CDFA 4LZZA 2H17A 3EZ6A 2KE5A 4A3FG 3LH5A 3T61A 3VNUA 2WKPA 1PH7A 1JAIA 4YLGA 4OO1I 3I3SR 4CRWB 2Q2HA 2QROA 1E3PA 3FDIA 4KXFB 3EWSA 1E1TA 4UP8A 1Z0JA 3NC1C 1AIPA 2VQEQ 3EPJA 3L0OA 4PZ7A 3C41J 1KIXA 5FOXA 3CH5A 3AKDA 4PC3A 3RSLA 1B9MA 3A7LA 1R5OA 2KWIA 3OHMA 2XOKD 3B6YA 3FMFA 3SJAA 1AK2A 4OI0A 1AH9A 1SVKA 4L4UA 4HLDA 2WWYA 2E2JH 2UXDQ 1ZM9A 4GKKQ 5JMTA 1G7SA 1JXMA 1WA5A 5BYJA 4A1FA 2HCBA 1W4RA 2ANCA 3T56B 2ZRLA 4M0LA 4Q19A 3RNLA 1HZAA 5K8UA 1LS1A 4C3ZA 1KI2A 3MFYA 5CDFE 3RNUA 2I5MX 4FINA 3KXIA 3TR5A 1YJNA 1GFIA 2YC4C 3BWDD 2QGQA 4GLVB 2KB0A 3NH9A 4IPDA 4I1VA 2B3GA 5FJ8G 1C0AA 1CR1A 1PFSA 1MRSA 3IBGA 4NBSA 4AKEA 4DXAA 4G1UC 3ZH9B 4X8OA 1EIFA 1BMFA 1V1QA 3AB3A 4X8HA 4GOJA 5L3RA 3U61B 2NN6H 2KSQA 4P4UA 2B63H 3WBKA 4JVMA 3QG5A 1CJMA 3CKLA 4LHXA 3CP0A 1CSQA 3MRSA 3UIEA 2YTYA 1GP2A 4NXML 4AYTA 5F3WB 2IK8A 1DADA 3SJZA 3R7WB 1ZUHA 4MRVA 4TLBA 1UKZA 1N34L 2Q3MA 1QZGA 1N3BA 5M5YH 4JLAA 5EUQB 1KTVA 4I7ZC 4DV1Q 2A3RA 4LY6A 3PO2H 3WRXC 3K0SA 2W2XA 2Q3HA 1TQ2A 4MGYR 1K8MA 2A5FA 3BXZA 4PSKA 5HZHA 3ZD6A 3TAHA 3LVRE 1ZCBA 1VQIA 4DSOA 4EPWA 2EQSA 3KQNA 1M74A 1D5CA 2ZTCA 4BZXA 5JZVA 2GAOA 2Y0SG 3VX4A 1NTGA 2Y0SE 1B9NA 1X6OA 3CNNA 1OTCA 4UKDA 5EXPA 4X65L 2BOVA 5FBLB 2AWNA 3WNDA 2F4VQ 4TKOB 4DV3Q 1KSJA 2UU9L 4OO1G 2HJGA 2LXKA 5DHFA 1N36Q 5HCIA 3PF5A 4QGGA 4BEJA 2WOJA 1UADA 4CEJB 2JIZA 4IVQA 5JI3E 3L0IB 2BC9A 3E9HA 5E7IA 5L3SA 2CCKA 1E2NA 4PAQA 1MABB 4U00A 4ASUD 2ZTSA
chains in the Genus database with same CATH superfamily
5B7QA 3CLUC 2JRCA 3K20A 4NS4A 5M3MB 1KJNA 2QPTA 2ZRCA 1EP2B 3LP6A 4IIUA 3SK0A 3ZLTA 1NZDA 3CRNA 4MYTA 3H65A 2NZOA 1A7UA 3QE0A 5B6PA 3VYWA 2KJXA 1IZYA 1WXWA 3NEYA 5CYUA 4DIOA 1T2AA 5K3FA 5KJ6A 1QHXA 2NTSA 3UJ8A 1UDBA 3B6IA 3EFOA 4MWCA 1SVWA 1X3FA 1YK0A 4K2HA 4LVUA 2D74A 3AYXB 5BQ5A 3NBIA 3DFFA 2CY0A 2ADOA 2ACKA 3PXUA 2H7VA 3AFOA 1RR6A 1ZJJA 1T0HB 2PEYA 2VDKB 3CWQA 1TCUA 1UJ6A 3PNBA 1Z5NA 2R84A 3HFGA 3OG9A 3WKDA 1FLVA 4MVJI 4P2BA 4JYBA 4JT2A 5FD8A 3WV5A 1TAHA 1Y3AA 3N2KB 4TXLA 1E9CA 3PPWA 3JQ8A 5BSWA 2J9FB 3D0FA 4RC9A 1EQAA 3QVKA 1OJ7A 1T5IA 1V8QA 2IYSA 2FZCA 2HU8A 4Z1MA 4CWAA 3ANXA 4PG8A 1C8CA 1H95A 4R8RA 2WUWE 5AW0A 1PEYA 4G85A 1DLJA 4X3CA 4AQYQ 1TTPB 3PEWA 3CW2C 2IUSA 3FPAA 2H3HA 3OPYA 1KL9A 4UMVA 3IUSA 4FE4A 5JNUA 3GX1A 4IDOA 2JGJA 4M1KA 2QAGC 1TYBE 2GZ1A 3LDHA 4X45A 4C56C 3L7BA 2QUAA 2F0SA 1WI5A 3LRTA 4V0KA 1GQFA 4YT8A 4L5TA 4QU9A 4AYWA 4CEIB 4NB3A 4P71A 1ZH0A 1DIAA 3JRNA 3I30X 4F3CA 1A77A 4EX6A 3QJYA 2ZCJA 1D2RA 4LECA 1S8OA 6NULA 5L4NA 3JAML 1QB5D 1NFRA 4QQBX 1TEVA 2ZYVX 1X2BA 4GW3A 4HFMA 4JVOA 4GG1A 5BSRA 4MP6A 4FEAA 1YKSA 3H1AA 2ICEC 1C9DB 4R31A 1J20A 3VDYA 4XARA 4QQFA 3TL3A 2WAAA 5ECYA 4XYLA 1R8JA 5A4MS 4L2IA 2FPPB 3GRCA 1XMVA 3D6UA 5C7YA 3UMBA 1IBML 1HWYA 3DL4A 1P45A 1CJUC 3I92A 2ZS7A 4PHFA 5HMMA 2QUKA 1ZR2A 4XM2A 2VYFA 1UM8A 3RVDA 1HNXB 3AL0C 1HFGA 1KI8A 1V95A 4DDUA 3RTBA 4UPDA 4XEUA 2ZWIA 4DWOA 1H1LB 1EEHA 4RY9A 3THYB 4DNPA 3ZQKA 4JG2A 2IPXA 2V3VA 1FDUA 5ITSA 2JN4A 5CUQA 1KRTA 4JZKA 3A28A 4GZLA 1XCLA 1CRZA 4IOCA 3ZBUA 5K2OA 4WE3A 4XAQA 1PNOA 2B2UA 1EDEA 2HYDA 2M1ZA 1COWA 4QCLA 1CQPA 1HLGA 1PFVA 4J0DA 3WA6A 5BWLA 2HO4A 1YIJA 3I83A 5A06A 2V4DA 1WDTA 2AXPA 2RB5A 3JQ9C 3T0FA 5KNCD 3EX7C 3FHCB 3ABSB 2YWEA 1UXGA 4QY7A 3ZOKA 3HXOA 2XTIA 1LZKA 2A7XA 4MKXA 3VOTA 2QJWA 3H87A 4OAOA 5FTNA 4MRMB 2IXDA 5AUOB 1XRMA 5K0EA 4G01B 3GBPA 2L19A 3K2QA 4U68A 4YCVA 1YJQA 2ZUBA 4V3CA 5ILGA 4MV1A 3THSA 3IEMA 1I5FA 1UBHS 3U3JA 3IJRA 2JIQA 5TGZA 1PTJC 1C7JA 1S1CA 5AVSA 1CQZA 2AX4A 2GTIA 2GM4A 3ELUA 1PNVA 5CBPB 4FYKA 1QQ6A 2QZJA 1BYIA 1NR7A 1XZNA 3ILHA 2AWOA 3K0XA 1E7YA 4LTNA 4YJGA 4YJKA 3W6NA 3TRHA 1VGVA 4A10A 4DCSA 2JEBI 1OAAA 3QMWA 1V8FA 4RM2A 5CB0A 4WECA 1IK4A 3NT4A 3DV0B 1VXRA 4LYDA 1R50A 1YB5A 3AC0A 3QE2A 2H54A 4GL4A 1RAIA 2AXQA 4RMNA 5E7QA 3UG6A 4CG3A 3IEIA 4IHKA 3C3YA 2PVPA 1ZAYA 1OY1A 3H5OA 1GRQA 4O1NA 3RFXA 3U4DA 3DXFA 3P2KA 5JJIA 4O2BB 2JBAB 2D5BA 3L1KA 4YAUA 1JDBC 4FYHA 1NQVA 4UD6A 2J5KA 1NIJA 2MSKA 3ICPA 2NTEA 4NBVA 1SXJB 2C92A 2DUNA 2LY7A 4OQQA 1LTLA 1N6OA 2GYYA 1CULC 3DJYA 1K8AC 2YINC 1L1RA 1JCKB 2BLLA 2KS6A 3WYDA 4BBAA 4YJ3F 2W6IA 4DGQA 4RGOS 4JCCA 3W3AA 4LISA 3BQNB 3C6BA 4PWZA 2DC1A 4U7HA 3EF1A 3FGNA 3TQHA 4EF5A 5KQRA 4DMHA 4KG7A 4XOIA 1BDIA 5A1TA 4D82A 3MFQA 4HH1A 2EJVA 3KOOA 4ETNA 2GTPA 4Y6LA 4L9AA 2XOXA 3AESA 4KV9A 2FFJA 5FK9C 1RWBA 1X1TA 4DS3A 4G5FA 4DY6A 2GSWA 2AR0A 1KMCA 2J5XA 1A3CA 2GZAA 2ODEA 3H8WA 1B15A 1RE1A 2YXEA 1NIPA 3K2EA 3T1TA 4DA7A 3AF4A 4UHJA 4M9RA 3ICQB 4K2KA 1PJ8A 2BEWB 3E9RA 2OCXA 3HHPA 3QU2A 2VDRB 4MROA 4UU0A 4DNQA 4YCMA 2FI1A 3FDXA 4JI5Q 2CYBA 2I6SA 4QLOA 3SSMA 3GTJH 5EE1A 2PH7A 4DYHA 3CHBD 2D8MA 2HIHA 3A2KA 2WV6D 3TL6A 1KO5A 1Q1BA 3OCXA 4C3OB 3DWPA 3COYA 4LV8B 4KI0A 4GBJA 1V47A 3TOSA 1G6PA 3WGOA 2OC9A 4HQKA 1DG9A 4O4JB 3EPJA 3B36A 2EXDA 2AKYA 4U3JA 2Y92A 1QZ3A 3FJYA 2X14A 5ALZA 4X66Q 4QQKA 5B5SA 3LRXA 3Q6MA 1OX6A 4FPXA 3P32A 4WFIA 1OBCA 1DAIA 3PQ8A 3Q7TA 3ZD7A 3H0EA 5DCWA 1DIOB 2YR0A 2H0AA 1NDQA 2HFJA 4EFLA 1CZGA 4Q3CA 1VQ1A 3VR6H 2ZB7A 2XUGA 3CVYA 4CW7A 1GU0A 5LLTA 3BOSA 3AVVA 5D5QA 4JP2A 4KCGA 1PTOB 2X41A 3FWHA 4TMWA 4EHDA 2V7TA 4EHLA 4ZDKA 1CNEA 1ODJA 1YONA 3GK3A 1RM0A 3OZFA 5ELBA 4KQJA 1ETHA 4M46A 4BMXA 2XA9A 1IN8A 3VBEA 4IPCA 4CV3A 1TUEA 3ZDBA 1ZXBA 4DCOA 5K2MA 4OIMA 3RVPA 1I6MA 2CNWD 3H2HA 3RQSA 2DFKB 1YMVA 2NVOA 1NBMD 5CVUA 1SQ5A 4YP0A 2R6GA 3NVAA 3T3EA 2B39A 1JR3E 2X13A 2AHOA 1P8JA 2O3RA 3GVCA 1PYDA 5ALRA 2H00A 2DB3A 4UJ3A 2Q1TA 3VR4A 4JU9A 4EKYA 1IOLA 3KELA 4RIFA 4W4TA 1BE8A 3EMKA 5TR9A 3TZEA 2K5UA 2QTNA 3TJRA 2H4WA 5ECGC 2NN6I 2RAPA 1J09A 3MLEA 1I51A 3HJTA 1ZSVA 4H16A 4CFYA 1HCZA 3I91A 1XTRA 4GSYA 1WB5A 2CC2A 3VNRA 2Q28A 1JHAA 5D65A 1EZ1A 4LYAA 4OHRA 1JFFB 3R7WA 3WWOA 2EOAA 3MXUA 2HHJA 5BMVA 3CC7A 2Z2XA 4R9NA 5TPWB 1I94B 2PX5A 1JIQA 3HWX1 4E07A 1A9XB 2AW3A 4WEOA 1KOGA 3RR2A 2Q9BA 1KKMA 2MR5A 3IFDA 2X69A 3WHKA 5JXGA 3QOJA 1GL3A 3WLQA 4LX8A 4HMQA 1FP6A 5ARDA 1MJGA 1YDFA 4CF7A 1CJBA 1FFHA 1K8QA 1QPBA 2WLSA 3G2QA 1KJJA 4OG2A 3AUUA 5IWAQ 3A4NA 1KGDA 1U7DA 2NVWA 4U1RA 1B73A 4C1BA 5J1SB 2GASA 4QOJA 2FTKE 2ZUFA 3NEMA 1YFKA 3R0IA 1D2EA 1KO4A 5CV8A 5EKDA 1BWRA 1K6JA 3B60A 1NVWQ 3BFPA 2N8NA 1D1QA 1PTKA 4NX2A 4OTZA 3T7CA 5IKPA 3LRPA 4OGLA 3P20A 2R7AA 4C2UA 3L84A 3D1LA 3L5OA 1NI3A 1QUQB 3RVNA 1VYVA 1SVSA 2R1VA 1X1EA 5BURA 1DGQA 3R2IA 3A27A 3D3WB 1U0NA 3RKSA 2B4QA 3AF6A 4HCSA 1H9KA 1F06A 2JAUA 2NPIA 2INGX 2Z30A 3BMNB 3E9NA 3OU2A 4ZEXA 3UJDA 3ZI7A 1W25A 2HNAA 1AN9A 1L5SA 1K86A 2QMZA 1C9JA 1N92A 3FKJA 5ERGB 4YR9A 3TFQA 1QIIA 4MR8B 4PVDA 4C78A 1FIUA 1TWCH 3H2JA 4FFLA 5H3HA 4F06A 1JF8A 2XYQA 2F52A 2P1ZA 3W2IA 4YCAA 2ESRA 5JRJA 3S2EA 1E2ZA 2F0NA 2HCIA 1KBOA 2DEUA 4KIUA 1I4GA 1UT8A 1NVEA 1JB9A 3LUHA 4MQFA 1K06A 1C3XA 3T5TA 2JLZA 1JPJA 1P4JA 5DX0A 2AOUA 4QRDA 1U94A 4HIOA 2G4VA 3LT0A 1U0JA 3DBRB 2BHLA 3LX8A 2R8YA 2C82A 3RS9A 1BQQT 1X1BA 2Q5IA 4D46A 4MX8A 3TGLA 1TK9A 1OR8A 1P9RA 2IHTA 3KWJA 2H2WA 2ZJ3A 4PICA 1W93A 1JR0D 1GAJA 2A19A 2HDLA 3EZ2A 3PK0A 2CW0C 3J81E 1RJTA 1ISSA 4JUBA 4OD0A 4D4HA 4GYJA 4QRHA 1H0KA 2PXHA 3QWIA 4MNOA 3IIJA 3COVA 3HOVG 1EKXA 2I6GA 4I8XA 4JJ4A 4BC0A 5BSEA 3EULA 1FZTA 5JXWA 5T57A 1Y1TA 3BBLA 5KPJA 1TVKA 2X3FA 4LI0A 2OCBA 2DY0A 2ZPTX 2F3PA 2P0YA 3E05A 4CMKA 2WPNA 2OCDA 2WVAA 3VR2A 4QAQA 1TZMA 2OKGA 5G0UA 3A0JA 3WB1A 4L8LA 4XLLA 1E2WA 2DJ5A 1JB3A 3TQYA 2ZM6Q 1VLHA 4WKBA 3SZ3A 3DE4X 3U0VA 4K5XA 1PGPA 3K71B 3TEMA 4XB6B 3AFHA 5FOSA 2A6PA 4HLUA 2H8GA 1MB2A 2G17A 4DVGA 1MJGM 3HBAA 5CM2Z 5D3MB 3HXQA 3LIPA 5ADWA 1QBKC 3NHUA 1C7YA 2FPWA 2QU8A 4C3UA 3ZWPA 4PYMA 1T5BA 1X1DA 2BFWA 3IPLA 3O93A 5KJEA 3SX0A 1GQQA 1ET6A 1L7QA 1XA3A 4X3TA 1Z0UA 1RM3A 4IKOA 1WVGA 4UDUC 2C0CA 3UV6A 5DK6A 4XRRA 4U2CA 4YJ2B 4JH0A 4PNZA 4CR8A 1X9NA 2IHNA 3PI6A 4UAIA 2J31A 3T3IA 3BDLA 1L3BA 2FMHA 2Y1DA 1H2BA 5EQTA 1MP0A 2E21A 2ZSKA 1CVIA 3KYBA 3LHSA 1AS0A 1ZC3A 2HJSA 3OPYB 2CBXA 5DGHA 5F4BA 3OIQA 2VUSA 4KQXA 4TKVB 2IUTA 3BGDA 4OMCA 5IMBA 1XPRA 1BX1A 2E2DC 1P1IA 2BEKA 1X7DA 3CFYA 3HEMA 1E3WA 2XT9A 3M1IA 1JLMA 2ZIXB 4D0NA 2RHQB 1OLUA 4LGCA 4PHCA 4UEJA 5E3IA 1NNLA 4INAA 1GXSB 1MMFB 4MIYA 4F2DA 2Z5FA 3B20A 2AOVA 1NVVR 3UMYA 4RV4A 3L79A 2YY5A 5DYYA 2FWPA 1W4LA 4QJ5A 2LTAA 4BZPA 3W6PA 1YZYA 1GO3E 2I22A 1RZRD 1GTVA 5LDGA 5A35A 1IY2A 1ZWLA 2OBLA 1ZCFA 3EFEA 3TRDA 9ATCA 3ZNNA 4V1CI 4CGZA 2A9QA 3FB1A 1PFMA 2A8YA 1NRXA 1XYGA 4W1RA 4E3ZA 1M2OA 1RXWA 3MJHA 3EXHC 4Q0FA 1XJQA 1VYTA 1EYGA 1JYEA 2GYUA 5E6RB 1E6UA 4RVHA 3F9RA 5H59A 1ECPA 1K9SA 4ZHQA 3I76A 4FYMA 3SC2A 1SE2A 2RBGA 4C4OA 1QP7A 1IN5A 3TSZA 3EA5A 3HUDA 2P2SA 1LLUA 3UE1A 1PYGA 2XODA 2QX9A 4ZEMA 1CV2A 1WHSA 4R2WA 1FY2A 1ID8A 3T53B 2HCCA 1EM8B 1ANKA 1VMAA 1Z75A 2FZVA 2ZAMA 3NXSA 2H8KA 3U7RA 3U44A 2J0SA 2NSJA 4OQXA 1T6XA 1OTYA 2X76A 2ZI7A 1VB5A 2KHJA 4KN9S 3VU8A 1V8BA 3IAFA 1SOAA 2B7BA 3WTBA 1L5HA 2HBRA 2P6OA 5P21A 2O2CA 3JZAA 3A6LA 4I9HA 4PTZA 3PXGA 1R4PB 3VZCA 4WMLA 5AXCA 3JVUA 2W83A 4M1ZA 5IH7A 3DFKA 1YU6A 3IAS1 4GQIA 4LRYA 4FF2A 3J7A5 2JHAA 3LM8A 3BAZA 3AEKA 1JR2A 4A3JG 3LWNA 4NULA 3ZZ1A 2PK3A 3UJNA 3OKAA 3NBXX 1A6XA 1V4NA 3AVPA 4PZAA 3MJDA 5H82A 4KR6A 4MYRA 3E7FA 2I8AA 3KE8A 1W2HA 3GARA 4EF4A 4ER0A 5K0CA 2AUKA 3IHLA 3SC6A 3ETEA 1FTGA 5UKDA 4KDCA 3GAZA 4KO4S 3K4QA 4DIDA 2HUNA 2HMUA 2QL7A 4BQOA 4LSWA 1GSAA 4OYLA 4W63A 4D6YA 3LHIA 2J3MA 3VI4B 4YDSA 4NCNA 7YASA 1U65A 2JK8A 1MSGA 4H7FA 1J39A 2VYND 1Y89A 4XDXA 3WL4A 3WQHA 5CFMA 5ALFA 3R6GA 5TS3A 4N65A 3HM2A 1LUAA 1C1XB 4Q9LA 2WAYA 1JT8A 2YN4A 3L0CA 2HH9A 4GOOD 3GLTA 5FORA 5C18A 3DEZA 3QEMA 2ASBA 3RHSA 3OZ7A 1Y8QA 4DU9A 4LF4Q 5F52A 1EGHA 3IAAA 1DRVA 3N5CA 4KR7A 4OL9A 5DO9A 1OGIA 1H2AS 2BKUA 1Y8AA 2XJ4A 4V1CB 2PW5A 5K3OA 4GE0A 2K7VA 3FCSB 4FKMA 4QELA 1DQZA 4DOMA 3R4CA 2CXHA 1AN0A 2XR1A 3RAPR 3TIFA 4AUNA 1S5DD 2CVZA 4JASB 1GPJA 1PZJD 1WQ4A 2AL7A 4YONB 4DMRA 1Y82A 1QQAA 1CI3M 1GAXA 2FPIA 5C44G 2BI4A 4R2LA 2HYIC 4NCBA 2MQHA 1E1YA 3VZDA 4OMUA 5C4ZA 3ZJ5A 2PQ6A 3O26A 1D07A 1NBMA 1WP4A 2XXAB 1IZZA 1U7ZA 4KU4A 4DPLA 1GUDA 3AIIA 3BULA 3BUSA 3T5CA 3A26A 3RIYA 1S72A 2PFKA 3CKMA 3M5CA 1R64A 3HSKA 3KKOA 3UC5A 3W5SA 4XXHA 4WDRA 5I7WA 3T06B 1LVHA 5AM4A 5ICFA 2CNNA 4K0KQ 2QQGA 2YZNA 1E3TA 3EXFA 1SNDA 3OQVA 2PW7A 1GRNA 4J76A 2WZCA 5CRIA 4AQ7A 2PWZA 1F2YA 3PSIA 4DK1A 1T9ZA 1YBAA 2IYPA 3AM3A 3O1JC 1G9SA 4UEQA 2K5NA 2IF2A 4ZZ1A 2PAFA 1FF9A 3QFFA 3PDIB 1AXEA 5I5EA 3K9NA 3I2JA 3QVGA 5B7PA 1P1KA 3NQTA 4RELA 5KKAA 3UUEA 4TTAA 1X39A 2NV6A 3BH0A 1U0GA 2XUOA 2JE6I 2HNBA 2NNLD 3LYAA 1JR4A 3HVKA 4G2NA 4JL5A 1EYDA 1G98A 1N1GA 2VSYA 3CMCO 3DC7A 1WV1A 3W5OA 4UHVA 1CJKC 4RHCA 5BXYA 1EHYA 3T7DA 3ZVLA 2W6ID 1R4QB 3KYCB 1L8LA 2P6UA 4FBMA 3GLIE 2IYNA 2Y2UA 1B3QA 3DM1A 1K5GA 2PVSA 5BV8A 4LAAA 3TIGA 3VTZA 4FCTA 1KXZA 2B98A 4RHUA 4LCEA 2V4UA 2UV8A 4HVAA 1JDPA 1Y1SA 4I8IA 1R9NA 3GNSA 1BQEA 3JR3A 1UQUA 3T1YL 2UUAL 1DXQA 2EKPA 1QVAA 1JW9B 2HM7A 2NU7B 3E9CA 3EAQA 2JZCA 1HDXA 2FW8A 2ZJOA 4EGFA 1BOFA 4YRRA 2XZLA 2WB1B 4MUHA 4MR9A 5JEAG 2O8NA 3Q41A 3RU2A 5K01A 4QX6A 3TUJC 1J22A 2E2HB 3SC3A 1GTSA 3ROZA 2DWQA 3OEEA 1VMKA 1CFZA 2NXJA 5JBNA 5DOVA 4TV8F 1G5RA 3IP8A 2A6HC 3PO2B 2PG3A 4HDMB 1M5UA 1XFAA 2RK3A 3WKAA 3G4SA 2IQIA 1C80A 4ENVA 1SYBA 5C6AA 4X64Q 1C30A 3FWPA 1XJWA 3SYLA 2BR3A 3JQQA 1WMEA 3CCBA 3FMOB 1OLOA 3S17B 1N33L 3KT0A 4DE5A 2VSXA 2KHIA 3S17H 1O8BA 4RGBA 2FQ1A 4MJLA 4Z9AA 1TXGA 1IEXA 3GRVA 4NYIQ 3OFSA 4QNRA 3DZHA 2OPBA 2A69D 2F2TA 1R4NB 4RPHA 1MEJA 3AVQA 3M3DA 4PLHA 2W2TA 2C5BA 1DQPA 1F4PA 2I7DA 3R7NA 4BASA 2AJ8A 1L7VC 2VXOA 4B3RB 1HQYE 4CM8A 1JG1A 4PY2A 3RG8A 4HJAA 4MIOA 1QG0A 2EY6A 1YC2A 3HXTA 4BLRA 2JEOA 4ZYXA 4KBFA 2C00A 2QD2A 2VHXA 2WJ6A 3MMNA 1EI9A 2ZVDA 1G291 4UEOA 1EK6A 2FG5A 2AJLI 4P5EA 3GLFA 4IDBA 3DZGA