3GTKH

Backtracked rna polymerase ii complex with 18mer rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
146
structure length
136
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtkH00
5C44H 1G6PA 1S40A 2JA5H 2QEXA 5C3EH 2VZAA 2JEAI 1VQ4A 3W1GA 3I2ZA 3CCVA 1KIXA 1C7YA 4LF6Q 1N32L 4A3JG 3TREA 5M3FG 4B3ML 4YWLA 1HNZQ 3S2DH 3KF6A 4LFBL 4A3CH 4DUYQ 4PZ6A 3S2HH 2B29A 3NBHB 3TRZA 2ID0A 2ZTEA 3OTOQ 4LUZA 1OTCA 1Y1VH 1MJEA 3JC66 1QUQB 4L5SA 1AE2A 1PA6A 3PV0A 4DV0Q 4MTNA 1Q12A 2RF4A 1EIYB 1XNQQ 3S16H 4JOIA 5K36G 4DV2Q 3HOUH 4DAMA 1N8RC 1VQKA 4GKKQ 4OWTB 4FDBA 4DR6Q 4LF5L 4EX5A 3W5OA 1CUKA 1HH2P 4JI5Q 3CCRA 1N33L 4HJ7A 4IOAA 5C0XJ 4OO1G 4GLVB 3HOVG 3CW2C 2NN6G 2D0OA 5IYDG 4B3RL 3T1HQ 3M7NA 2I5MX 1QVFA 4L5TA 3I4OA 1XJVA 4IFDI 4MNOA 1WCMG 4R4TA 1XMQL 1IBML 1IBKL 4LWCA 2BH8A 1XNRL 2HHHL 5M3MG 2YTVA 1VQ8A 1VQIA 4A3DH 1L1OA 3CP0A 1P8LA 4PMWA 5C4JH 2YYZA 2NVXH 4AQYL 1OXVA 5C4XH 1HNWL 2GVAA 2E2IH 2L15A 1VQGA 1WOCA 2ZJPA 1YHQA 2JQOA 2EIFA 4KLKA 2UXCL 1YZ6A 1XPOA 3G4SA 1X6OA 1HR0W 4QIWE 3M4QA 5JEAJ 2H5XA 4DV4Q 3KJOA 1R9TH 4IPDA 2KCMA 5M3FH 4JYAQ 3CC4A 5IY0A 3CF5A 2VQFL 3KJPA 4OONA 1YI2A 1FGUA 1Q46A 3KF6B 3TS0A 1X55A 2JA6H 2CWAA 3F2DA 4JI8L 4DV7Q 1B70B 1NMGA 3T1YL 1MKHA 4DR1L 2UUAL 4YWMA 1HNXQ 2A8VA 1VQBA 4APVA 4HJAA 3M4PA 1LTLA 2UUBQ 3J7A5 2XTIA 2WB1G 1NBWA 2VY3A 5C3EG 1KHIA 2Q2UA 2JA5G 4J15A 4C2MH 4GNXC 2I0QA 5C44G 1OXTA 3GTLH 3PUVA 3TEHB 2QA4A 4QQBX 2K5NA 4DV6Q 2OQ0A 2K5VA 1BBUA 2VQEL 2JE6I 3RZOH 1HZ9A 4O2DA 4BXXG 3EBEA 1UE7A 5FLMG 3HOZG 2LXJA 4MZ9A 1MIUA 4YCVA 1VQLA 4Y52H 1Q1EA 2ZM6L 1VCIA 4NPSA 3HFZB 4A3IH 1B8AA 1KC8C 3HOYG 1GO3E 1PH7A 1Q8KA 1Y1WH 4A3FG 2UU9L 4LF4L 4HJ5A 2MFIA 2LXKA 2OTLA 3DM3A 3KDFB 3RR5A 3GTKH 2ZJRA 4DR4Q 3F2CA 1IBKQ 2MO1A 3S24A 4TVAB 1YVCA 4A3EH 1K83H 2PQAA 3PO3H 1Q7YC 1NJIC 4JI7L 1DGSA 1UE6A 5GADC 1E7ZA 2FXQA 5FJ8G 5JJIA 2PI2A 3J81j 5C4XG 5LMUQ 1HZBA 1C9OA 1CKNA 1HZCA 1VQAA 2F3IA 2YU9H 5M5XH 3S1RH 2K75A 3HOWH 3T1YQ 1EFWA 4BBSH 4X62L 4O0AA 1N34Q 1YIJA 2E2HH 1N9WA 3STBC 1XTDA 4QGUA 2WB1E 4LFCL 1IBLQ 1PH2A 1RIPA 5AJ3L 4DV1L 3FHWA 3BJUA 4PG3A 2KENA 3GDEA 5GAHC 5IYDH 3K80C 2VS1A 4C3HH 3F1ZA 1PH5A 4IJHA 2IX1A 3AQQA 3FKIG 4JI0Q 3CCSA 2EXDA 4A3LG 2VUMH 4DR7L 5GQOA 1QZGA 5IYBG 1YHBA 1TXYA 5IWAL 4LFAQ 4DV6L 4NXMQ 1NE3A 3K0XA 1Y1WG 2JA8H 2R93G 1O7IA 1T9HA 3BZKA 3PUWA 1SR3A 4DK6C 4A76A 1W2BA 4POGA 2ASBA 1XNRQ 1M90C 1EWIA 2Z0SA 1YEZA 1VQFA 1CSQA 3I56A 5LMUL 2UUCL 1VQOA 4LF9L 2ATWA 3D31A 4GN4B 1VS0A 1PYSB 2AWOA 4GN5A 4B3TL 3J7ZC 4L5RC 4OX9Q 1A63A 3RN5A 3PUZA 1BBWA 2RCNA 4AYBE 4A93G 2UXBL 2Q2HA 1V9PA 4IFDG 4DKAC 3KF8B 1SROA 2VL6A 4IFDJ 1EIFA 4ALPA 2Q2TA 2UUCQ 1G291 3UDXA 4LW1A 3PUXA 3TS2A 4DR6L 1D7QA 4UY8C 1VQJA 1K73C 4JI3L 1PH1A 2R92G 2VQFQ 3OW2A 3BU2A 4UPAA 3PIOA 4A3KH 5E7NA 3U4VA 4C3JH 3G48A 1HZAA 4X65L 2BA0A 2IHEA 5IWAQ 2OQKA 1UE5A 4OWXB 2ZJQA 4IJLA 2WAQE 2K50A 3RLOA 3CMEA 5IYCG 3U58A 5J3BA 4B3MQ 1GVPA 5BR8L 4PZ7A 4ME3A 4BY1G 4LF6L 3EIVA 3F2BA 1UEBA 1KAWA 5AJ3Q 4DV1Q 1VQCA 1IBLL 4BBRG 4RMFA 3NEMA 2XGTA 3I4NG 4GKJL 1EQQA 5GAGC 4JI3Q 4OWWB 3B6YA 1L1OB 1XMQQ 2PI2E 3A0JA 3JAMc 5DLQE 4X62Q 3Q8DA 1N34L 2N3SA 1KD1C 4YY3L 4GN3B 5IP7H 1KQSA 2R93H 1LUZA 2JA8G 3CXCA 1U5KA 3RLNA 2PQAB 2ES2A 1B7YB 2N78A 2ZTCA 5GROA 1K9MC 1X56A 1E24A 1EUJA 4JI5L 4LF5Q 5LMNL 1VQ9A 1YNXA 4NB3A 4LF9Q 3RNUA 4YY3Q 3GTMH 4X6AH 3K8AA 4DV2L 2HIVA 3K7UC 4A4IA 4LUVA 2Z6KA 2NVQH 4GNXB 3STBD 2D0PA 3EN2A 3CCQA 2K5HA 1Q82C 4BA1I 3AEVA 3OYYA 3LGJA 4GKJQ 1CKOA 3CQZH 3A5UA 4DV0L 2UU9Q 2JJQA 4LF4Q 3KYHC 4NXNQ 3I4MH 2AHOB 4BY7G 4HJ9A 1OXSC 3OTOL 4BBSG 3HOWG 2ZM6Q 4R4OA 1QUQA 2A1AA 2HQLA 4DK3C 1LM0A 4H02A 5ELNA 3PUYA 4X65Q 1K3RA 2KBNA 2YV5A 3I4MG 4JC0A 4JI2L 4A75A 3PO3G 3H0GG 1WJJA 2UXCQ 1U0LA 1OXXK 1PH4A 4K0KL 2R6GA 2I5LX 1BKBA 1QZHA 1J5EQ 1RL2A 3L7ZC 3CCEA 2ALYB 2VW9A 4LNQA 3K7AH 2KHIA 2R7ZH 3S14H 4YCWA 2PNHA 4A3IG 1GKHA 1YJWA 2YTXA 1SE8A 2K52A 1PH9A 3PCOB 3BZCA 4A3MG 2MO0A 1WYDA 2E5LQ 2OWOA 4OX9L 3PO2H 3S1NH 2MQHA 1Z47A 3PSIA 4R4QA 4DNIA 1HNXL 4DR1Q 1EYGA 2UUAQ 1JJGA 1YJNA 4R4CA 4A3BG 4PZ8A 4JI4Q 2PMZE 4Y7NH 1XNQL 1KXLA 1A0IA 3AYHB 3CPWA 1V1QA 3AFPA 3VDYA 2B63H 3CCLA 3FP9A 1GM5A 1AE3A 4NXML 4BY1H 2JK8A 1L2FA 3RN2A 4A3BH 1X3GA 5BR8Q 3GTOH 2N49A 3NELA 4B3SQ 2AMCB 1J6QA 2C35B 4GOPA 4DUYL 4LFBQ 1IXRA 4KHPQ 1E3PA 3RLFA 4EQ5A 5JJLA 2K14A 4DR5L 3U4ZA 3S1MH 2CWPA 4GOPC 2RHQB 3PIPA 3GTPH 5JJKA 2AWNA 1VQDA 2QGQA 5M5WH 1HNWQ 3I55A 4LFCQ 5C0XI 4DR3L 5IP9H 1YJ9A 1HJPA 4KHZA 2R92H 4P72A 3L2PA 2Y0SE 2KHJA 3CAMA 4YHHQ 3HOXG 1KL9A 2JA6G 1E1TA 1PHJA 4TQUS 1XMOL 1XPRA 1VQPA 2DUDA 2R7DA 4DV5L 4JI1L 4A3MH 1IBMQ 3PO2G 4JBWA 4QL5A 2AKWB 3L0OA 5IYBH 2UXBQ 4YCUA 4B3RQ 2UUBL 1SN8A 1QVCA 4DV3L 4IOCA 4B3TQ 1JE5A 3FKIH 2JA7H 4JI7Q 1FJGL 1IL2A 2R7FA 3MXNB 1M1KC 4BY7H 2K4KA 1W3SA 3G6EA 1EQRA 1YHAA 3CCUA 4GOPB 1N33Q 4DUZQ 1VQ5A 1FVIA 4POFA 4X66L 1K0RA 4DUZL 3K81C 4GLXA 1JB7A 2D62A 4A3DG 4LFAL 3M3YH 3PF4A 4JYAL 4QY7A 3M85A 2Y0SG 4RG1A 3J81i 3CD6A 4JOIC 4XTCS 1HR0Q 4DR7Q 4JI0L 2A19A 1I50H 4AYBG 5FJ8H 5GAEC 4GNXA 1Q86C 1ASYA 3J80i 4P74A 4JV5L 2NVTH 2GN5A 1N32Q 3ZJYC 4WJ3M 3DLLA 3HKZG 1CSPA 1WI5A 4JV5Q 3CC7A 2HHHQ 4LF7L 4QJFA 1X3EA 2YTYA 2JA7G 2NN6I 4JI6L 3H3VI 3HOUG 2NZOA 2UXDQ 4DR5Q 1I6HH 1Z9FA 2OTJA 2BH2A 1L0WA 1L1OC 4AIMA 5IYCH 1YITA 1HR0L 3TQYA 4P71A 3M4OH 1Y1VG 1I3QH 4LF8Q 1IZ6A 4A3CG 2JEBI 3ULPA 2B63G 2WFWA 4X64L 4C3IH 4A3KG 4HIMA 1EOVA 1FL0A 3W1BA 2N8NA 2F52A 3A74A 4DR4L 4X64Q 4JI4L 3GO5A 1MJCA 2NVYH 2OCEA 2NZHA 3MEFA 1LYLA 1PH3A 2CQOA 4IPCA 1I94Q 2CCZA 3CC2A 1TWAH 4R4IA 4DR2L 1FJGQ 3UDIA 3SGIA 2GVBA 2R7ZG 4DV4L 1P16A 4KI0A 1C0AA 3HOZH 3GTGH 4IO9A 1PVOA 1SFOH 5EAYA 4GS3A 4WJ4A 3GD7A 2UXDL 1HNZL 4LF7Q 2VQEQ 4YHHL 4AQYQ 4K0KQ 3KFUA 5IE8A 1I5FA 1A8VA 4HIKA 4DR3Q 1ASZA 1H95A 4JCVE 3A5ZB 2BA1A 1SLJA 4JI2Q 1VQMA 2IX0A 3I7FA 1VQHA 1YBYA 5ELOA 1TWGH 3PF5A 1Q81C 4HJ8A 1TWFH 1D8LA 1A62A 1X54A 2ZTDA 4L5QA 4HIOA 4KHPL 3HKSA 3E9IA 4A3GH 3T1HL 3E0EA 3U50C 4JBJA 2VUMG 3ULJA 4GLAC 1PFSA 4B3SL 1K8AC 2IT1A 2B3GA 3KDFA 4UP9A 4JBKA 2KCTA 3ICEA 1I94L 3G71A 4LUOA 1X9NA 4NXNL 4JI8Q 4DV7L 3H0GH 1VQ7A 1TWHH 1VQEA 3M9BA 1N36Q 2HT1A 2JA9A 3WWVA 1VQNA 4GKKL 2WP8J 5JEAG 2DGYA 2V1CC 1XPUA 2E2JH 1X3FA 5M3MH 4LF8L 1G51A 5LMNQ 2EQSA 1OXUA 4DV3Q 2E5LL 4A3LH 2WAQG 1VQ6A 2CFMA 1V43A 2RHSB 1UWVA 3JAMi 1PV4A 2I5HA 3UDFA 1JMCA 4AH6A 2VNUD 4JI1Q 4OO1I 1CKNB 1PYBA 1KRTA 1J5EL 4HIDA 2F4VL 1SMXA 3F8TA 3HOVH 2Q2IA 1Q1BA 5IT9c 5H1SE 1QVGA 3KOJA 3UDGA 3S15H 1KRSA 1Y14B 3I4NH 4BBRH 3E9HA 4R1JA 1WCMH 3HOYH 1JT8A 2CKZB 2IY5B 3PGZA 3CMAA 2F4VQ 3RZDH 3H15A 1E1OA 2HIXA 5C0XG 2MNAA 1PH6A 3HKZE 5IP7G 3D0FA 3S17H 1PH8A 5LMNW 4P75A 3S1QH 1S72A 4XIGS 3HOXH 4A3EG 5FLMH 3UE1A 3J81c 3GTQH 1IYJB 4UP8A 3ER0A 4DAYB 4A3GG 5IP9G 1X65A 1CKMA 2IHFA 4DR2Q 4X66Q 3IRBA 4A3JH 3KLWA 1WFQA 4IPHA 1BVSA 4YWKA 4A3FH 4JBMA 4BA2I 3ERSX 1N36L 1GD7A 1TWCH 4P73A 4DPGA 3ULLA 3CCMA 2LSSA 3CCJA 3UE0A 4JG2A 3CPFA 1JJ2A 5FLXc 1S3OA 4A93H 1E22A 1K8GA 4OXPA 4BXXH 4DV5Q 2E8GA 1NTGA 3GTJH 1XMOQ 1NMFA 4UP7A 1AH9A 3AFQA 1JJCB 2Z6KC 3NENA 1UE1A 3H3VH 5HY6A 5M5YH 4JI6Q 4IPGA 1SRUA 3J80c 5HGQA 1NY4A
chains in the Genus database with same CATH superfamily
1S40A 1STEA 2QEXA 2JEAI 2SEBD 4QUFA 5CV9A 3TDQA 1VQ4A 4A3JG 3NBIA 4ULLA 1ESRA 3S2DH 4DUYQ 3KLSA 2ZTEA 2B2TC 3OTOQ 4KTAA 3J80L 3PV0A 3P75A 1Q12A 2RF4A 3S17B 1PZJD 3S16H 2L55A 4DV2Q 4OO1G 4HJ7A 5C0XJ 5DNFA 4GLVB 2F03A 4BBRB 1DXMA 4XYOA 4B3RL 3T1HQ 2KECA 2E2HB 3I4OA 2ZT9C 3MXPA 5M5XB 1IBKL 2PCFB 2QEJC 2HHHL 5M3MG 2YTVA 1SYDA 4A3DH 3BDLA 4PMWA 2NVXH 1B53A 5C4XH 5IGGA 1ZXTA 2DNEA 4A3EB 3LX0A 2B2VA 1WOCA 1YHQA 5E4XA 4KLKA 1MI2A 3EFXD 4H44C 4RHSA 4RA8A 3M4QA 4DV4Q 1LTAD 1CA5A 3KJOA 2IPKD 4JYAQ 5M3FH 2D5DA 1ZYRD 5IY0A 3KJPA 4OONA 1FGUA 3KF6B 2JA6H 1RCVD 1NMGA 4LAAA 2PYKA 4YWMA 1HNXQ 2VXWA 5NUCA 1U4MA 3R93A 2DNCA 2X6LA 1LTLA 4HMIA 5KYIA 3CRLC 4IUUA 5ELDA 1IW7D 4Q5VA 4C2MH 1ENFA 4P2CB 3MEHA 1X3QA 1VF5C 2K5NA 4K2KA 3VR6A 2K5VA 2VQEL 3QG1A 4V0BA 3RZOH 3GP7A 4IUVA 4O2DA 2Q8IB 5D65A 1V1OA 4C3IB 2PO4A 1MIUA 1VQLA 1Q1EA 1BXTA 1GO3E 1WTQA 4A3FG 1LV9A 3KLSX 4IQZA 2OTLA 3DM3A 3RR5A 1GXDC 2XRSD 3F2CA 1A2TA 1YVCA 1B1ZA 1QNKA 2XN9C 3PO3H 1NJIC 1PZID 1KNEA 5GADC 1E7ZA 1EYCA 2NVTB 2PI2A 2F0LA 3P7JA 1HZBA 2F3IA 3S1RH 4OO1H 4O42A 4BBSH 3QB3A 4IURA 4O0AA 1G91A 1N34Q 3STBC 4CHTB 5AJ3L 4DV1L 4M8AA 3FHWA 2KENA 1D5MC 1JOQA 5IYDH 1S5BD 2KCNA 1PH5A 2IL8A 4IJHA 4K5XA 2EXDA 3HOUB 2CQAA 1O7YA 1PTOB 1QZGA 5IYBG 3J7AF 4E6IA 2JA7B 1EEID 1NE3A 3K0XA 4I65A 2BOSA 3BZKA 1SR3A 1XNRQ 3PMFA 2HCCA 3KF8A 3V05A 1IW7C 3GQBA 1YEZA 3DWAA 3E0JA 1VQOA 4LF9L 3IFDA 5KNBA 4OX9Q 5A2QE 2F0GA 4A93G 4DKAC 3VR4A 4DN4M 2UUCQ 1SAPA 1D7QA 1VQJA 4JI3L 1W6JA 2RCFA 4XQJA 2R92G 3BU2A 5E7NA 2FINB 1CHQD 3NP8A 4X65L 4FVMA 5CV5A 4DAVA 4Y7NB 4OWXB 1ILPA 2SDFA 4A3FB 5C0XH 1F2ZA 1GVPA 5EGTA 4BY1G 1QILA 3DXJC 1UEBA 5KGUA 1YNND 1B3AA 4JI3Q 3K7AB 4UAIA 3B6YA 1L1OB 3PIP3 3Q6SA 5IP7H 1KQSA 2R93H 1CA6A 4LK1C 3I4NB 3S15B 2RDGA 1I4HA 5LMNL 4LF9Q 2F0UA 3U9SA 4KKUA 1HTPA 2K6AA 1LT5D 3K8AA 4ZCKA 4DV2L 3K7UC 4LUVA 3Q0AA 3AEVA 2B39A 3LWEA 4BA1I 1J8IA 2PZWA 3KBXA 4DAPA 2UU9Q 4NXNQ 3I4MH 2Z1CA 5C4ZA 2AQ2B 4HJ9A 4R8NA 4Q0FA 3OTOL 3FMCA 2K1BA 2ZM6Q 4CKCA 1QUQA 2A1AA 4DK3C 1TWHB 4U673 5E3FA 1LM0A 4H02A 1K3RA 3MA2B 5CBAE 3I4MG 1M8AA 4JC0A 4A75A 3H0GG 1WJJA 1CK1A 2NUCA 2M2LA 1H9SB 1PFNA 1BOSA 1K3BC 4KKSA 2KHIA 3VYTA 1ZEQX 4A3IG 3CHBD 1YJWA 2HUGA 3BZCA 2OWOA 1B2TA 2MQHA 4R4QA 3PSIA 4MTKA 4WFN3 2XRQD 2BE5D 2F4IA 1KXLA 3CPWA 4KKTA 3TBIB 2EY2A 1PTOF 3HZXA 4C56C 1GM5A 4A3BH 5C4HA 4BY1H 3CRKC 4A3KB 3GTOH 5BR8Q 2N49A 4B3SQ 4LFBQ 3SVMA 3PQIA 1TIID 3K57A 1E3PA 4DR5L 3S1MH 5JJKA 4XQQA 5M5WH 1TU2B 2R92H 1HJPA 2HD3A 4NW2A 1TY2A 4TQUS 2DN8A 4DV5L 2R7DA 5I9PA 1LT6D 1MD2D 2AKWB 3D8GA 4L63B 2UXBQ 2CHBD 1SN8A 1QVCA 5L37A 5M9OA 3FKIH 4JI7Q 1LTTD 1A3TA 2R7FA 3MXNB 4BY7H 1W3SA 1N33Q 1VQ5A 2EJFC 1O7ZA 4PV1C 4CKEA 4DUZL 4C3HB 2A69D 1CFMA 3M3YH 4JYAL 2JYOA 2Y0SG 3CD6A 4DF7A 1I50H 1KTKA 2MUYA 5JEAH 1PTOC 2YU9B 1PZKD 2VB2X 4DU9A 1SJED 3HKZG 1CSPA 1WI5A 3J81E 4IN3A 2HHHQ 2YTYA 3HOUG 2NZOA 1I6HH 1CTMA 5CGKA 4AIMA 5IYCH 2F0PA 4P71A 1Y1VG 1I3QH 1STNA 4A3IB 4LF8Q 4A3CG 3S1MB 4A3KG 3W1BA 1L0XB 2F52A 3ERQA 3TP5A 3VR2A 5KIXA 4JI4L 3GO5A 1I94Q 3MHBA 1LYLA 4RGTA 1PH3A 2CCZA 3CC2A 2OXPA 4R4IA 2G5DA 3SGIA 4A3BB 3A8IE 1P16A 1JQYD 3NXWA 3GTLB 3HOZH 3GTGH 3LNNA 5EAYA 4WJ4A 2UXDL 2TSSA 2JP1A 4LF7Q 3KFUA 5I9OA 1A8VA 2EYHA 1VF7A 3UI2A 2V4DA 2BH2A 1SNPA 4X3KA 1TWGH 1MGSA 3KLRA 2ZTDA 2OEOA 2B2YA 4H13C 5FO9B 3HKSA 1PRTC 3OIQA 3E0EA 3U50C 3ULJA 4GLAC 5I2XA 4B3SL 4DNRB 1B9NA 3G71A 1KDAA 3VA7A 3TP6A 5EKKA 4FO2A 4GKKL 2F0EA 3A55A 5JEAG 2E2IB 1X3FA 5T1IA 1G51A 2EQSA 4DV3Q 4RHRA 4DXFA 1AZQA 4KMUC 1V43A 1DJRD 4AH6A 2VNUD 4JI1Q 1PYBA 1EEFD 2NN6H 4OEMB 3HOVH 1LABA 1QVGA 3OSOA 3U9OA 3I4NH 3NWTA 3CU7A 1NCVA 2R93B 3AB9A 3N6RA 1KDBA 2CKZB 3PGZA 3CMAA 2EPBA 2HIXA 5DAUA 3D4DA 4ME5A 4FNFA 1Q3LA 3HOXH 5FLMH 1S5FD 3GTQH 4A3GG 4DAYB 1I6VC 1Y1VB 5IP9G 1PMRA 4IPHA 4BA2I 1OO9B 3GV3A 3ERSX 1FNUA 1STBA 4U68A 3MAQA 2RVLA 3CCMA 2NBFA 1F2LA 1LLRD 1JJ2A 2DJGC 1K8GA 4X3TA 3DUZA 1XMOQ 1NMFA 1JCKB 3AFQA 1JJCB 4RWSC 1UE1A 5A35A 1SE3A 2A6HC 3KK7A 2O5IC 3NWSA 2JA5H 3I2ZA 3TREA 2HQEA 1HNZQ 2WKCA 3E5SA 1XYIA 3NBHB 1EL0A 2F3WA 1MSGA 5CORA 3K5OA 3JAML 4MTNA 1XNQQ 5K36G 3HOUH 4LMQD 1STGA 2L4NA 5CV7A 4LF5L 1HCZA 4R9WA 1WCMB 4JI5Q 1N33L 5KNDA 3HOVG 1BR9A 2NN6G 1EZ6A 5IYDG 1U4RA 3FPPA 1WTVA 1H9JA 4IALA 4S3SA 3HOWB 2KVMA 2K5QA 1O7LA 1XNRL 1EWCA 1V1PB 1VQ8A 1VQIA 5ELCA 4PNYA 1DCZA 1HHVA 3T53B 3SK6A 2GVAA 3QIAA 2A5HA 2JQOA 2EIFA 1YZ6A 3G4SA 1X6OA 1Y1WB 5C3XA 1HR0W 3C3LA 2H5XA 3OWFA 4WORA 3R2TA 2PMZB 5ELEA 1EIGA 3J81L 1YI2A 2PZTA 1Q46A 4A3GB 5EPJA 1SYBA 3TS0A 3F2DA 1S5DD 4B08A 1TWGB 1MKHA 3RZOB 1CQFA 4APVA 5D3DA 3M4PA 4CBVA 3L3OC 3SE0A 1NBWA 5EJWA 4C2MB 2VY3A 1KHIA 4RGNA 2NTSA 1TQOA 3HOZB 3K6OA 1OXTA 4HSVA 2B2YC 2OF1A 1B9MA 2P5ZX 5G3LD 1WTWA 2OQ0A 3MWYW 4H0LC 1HZ9A 2EYOA 3EBEA 5FLMG 2F0JA 3PIO3 2H4OA 4MZ9A 4YCVA 5F2DA 4G4KA 2ZM6L 4ODGA 5M3FB 4ZYSA 1KC8C 1BBXC 1PH7A 2UU9L 3GTKH 2MFIA 2LXKA 4DR4Q 3KDFB 2ZJRA 3SK8A 1W6KA 4K5VA 4A3EH 2PQAA 3BVZA 1DGSA 3Q23A 5C4JB 5EQ0A 2FXQA 4A3DB 5C4XG 1HZCA 1VQAA 2L9HA 2QDBA 5AFWA 5M5XH 1JC7A 1EFWA 3KBGA 3DEOA 1N9WA 1XTDA 2WB1E 1UNSA 2ICIA 3D3RA 3M3YB 1DM0B 4PG3A 4CJ0B 1II3A 3F1ZA 5KRUA 2LMCB 1TVXA 4DR7L 1TT2A 1QCBD 5GQOA 1YHBA 1TXYA 3FKIB 3QOJA 3VR3A 4NXMQ 1B3QA 1Y1WG 2R93G 3G6JB 4QUCA 2AUJD 3DM1A 2Z0SA 1SJHD 2F0HA 1CT1D 5LMUL 2UUCL 3E3XA 2RDHA 3D31A 4GZYC 4L5RC 3J7ZC 4XT3B 1BBWA 1V9PA 4IFDG 5KNCA 2D2CC 4IFDJ 1RTNA 4HMJA 2RA4A 4F8MA 4UY8C 1HUMA 1K73C 4A93B 3NQTA 2VQFQ 1JB3A 3OW2A 3GTOB 1LTBD 1B4OA 2ZXOA 4A3KH 2DY8A 3U4VA 1BCPB 3A56A 4C3JH 4OIKA 1HZAA 2F0OA 1BNZA 4IJLA 1HFNA 5IYCG 1FYCA 3MZ5A 3NPPA 5JVH3 4ME3A 3S1NB 4RCOA 3EIVA 3F2BA 1KAWA 5AJ3Q 2A73B 4DV1Q 3NEMA 1CHPD 1SEBD 3K5LA 4J1MA 3S14B 4OWWB 1N34L 1AZPA 3JAMc 3CKIB 1V1PA 3Q8DA 1KD1C 4GN3B 5D3IB 3MC0B 1ENAA 1T5EA 3CXCA 1R4PB 5FO7B 3RLNA 4K8IA 1B7YB 4RKBA 1K9MC 2F1MA 3RNUA 3OIPA 4YY3Q 1R4QB 1WTHA 1LT3D 4CGYB 2HIVA 2JN4A 4A4IA 2D0PA 4GKJQ 3CCQA 4DV0L 1EIHA 2AHOB 2O4XA 4JVZA 1S4ZA 2KUMA 1B44D 3HOWG 3P20A 1A3VA 4KHVA 2F0NA 3VA5A 2YV5A 2EY1A 2ZXPA 3A7AB 1HUNA 3H6MA 5FOBB 2QF7A 1PH4A 2E2DC 1EWHA 2I5LX 2PW7A 3OWEB 5E1FA 2X6GA 1TWFB 2B2TA 4KJNA 3K7AH 2A74C 5HGTA 1EY7A 4A3MG 2E5LQ 1WYDA 3PO2H 2I07B 4DNIA 2XNAC 1HNXL 4A3BG 1L0YB 4JI4Q 4Y7NH 1I4PA 1A0IA 3AYHB 1V1QA 5BN5A 3J7AV 2B63H 3CCLA 1F2MA 3NK9A 3RN2A 1L2FA 1X3GA 1X3PA 2FJ2A 3NELA 3V2TA 5FO8B 1ICWA 2LFNA 5CMDA 4FP5D 4KHPQ 4EQ5A 5JJLA 1IYVA 3AMUA 1CQVA 1GOZA 4LFCQ 2EDGA 4DR3L 1YJ9A 3M4OB 1G2TA 2KCCA 1SYEA 1RD9D 1EYAA 2BE5C 3PO2G 4IFDH 5IYBH 1Y69U 4B3RQ 2UUBL 1SSOA 4TRDA 1FJGL 4PQXA 5JOBA 2A6EC 5BN4A 3G6EA 1EQRA 1HXYD 4GOPB 4DUZQ 1K0RA 4OHJA 2PZUA 4A3DG 4QF4A 3FPUB 1D6EC 4QY7A 3M85A 1JORA 4RG1A 3BYYB 4DR7Q 1GUGA 2EYJA 3NQIA 4DA2A 4AYBG 5FJ8H 1ASYA 3FEWX 2Y0SB 1K28A 2Z4HA 3A54A 2GN5A 1EYDA 3DLLA 1GHJA 1MBYA 1JICA 4WJWA 2K5WA 1X3EA 4K6LA 2JA7G 2NN6I 4JI6L 2HDMA 1PLFA 3EA6A 4DR5Q 1FR3A 2WIIB 1HR0L 1L1OC 5TSSA 3M4OH 1E0BA 3ZYYX 1C8CA 4O1NA 1MSHA 4C3IH 1STYA 1FL0A 2N55A 1CM9A 2N8NA 3A74A 4X64Q 4DR4L 1E2VA 2F0IA 2J4XA 2NVYH 2CQOA 1TWAH 4G7OC 3UDIA 3NBHA 1ET6A 3FDTA 3TZUA 1HRJA 3T13A 1C0AA 1SFOH 4G7HC 4C1NI 1XTCD 2G9HD 2SNSA 4AQYQ 4FXDA 3Q22A 3PO2B 3BDCA 1I5FA 1H95A 4JCVE 2BA1A 1SLJA 3DHQA 3FVQA 4CJ2C 1VQHA 5ELOA 3PF5A 2RKSA 4HJ8A 3E6ZX 1NNXA 3E9IA 2X69A 1S5ED 4JBJA 4C1NK 2IT1A 2B3GA 4UP9A 5JPMC 1R9TB 4JBKA 5IGFA 4IUTA 5IIFA 4LUOA 1SYFA 1H9RA 4NXNL 1VQ7A 2KEDA 1VQEA 2HT1A 4DAYA 3WWVA 5I2YA 5IGCA 2WP8J 4RCNA 4ZRZA 2V1CC 1XPUA 2E2JH 5M3MH 5LMNQ 4N9TA 2NVXB 3MXNA 2RHSB 3JAMi 1PV4A 2I5HA 4OO1I 2J7ZA 1J9OA 1KRTA 4HIDA 1SMXA 1VMPA 3F8TA 2Q2IA 1EZ8A 1HA6A 1GJXA 4IZ8A 3MFGA 1TS3A 5E4WC 3KOJA 4NMZA 1SE2A 5EKLA 2MHVA 1SYGA 4BBRH 4IUQA 4R1JA 2CVRA 2BCOA 1JT8A 1YNJD 3RZDH 3H15A 2F4VQ 5C0XG 3S17H 1PH8A 1S72A 3UE1A 5BN3A 2Z8LA 3J81c 1F9PA 2IHFA 1CKMA 4A3JH 3IRBA 3KLWA 1WFQA 2M9VA 1BVSA 3IL8A 2EJGC 1N36L 1PRTF 3M4YA 3MTSA 2LSSA 4FXGC 1Y8NB 1Z7TA 3UE0A 4JG2A 4UDUC 1GUOA 4OXPA 2WINB 4ZLTF 2E8GA 1NTGA 1EY6A 3NENA 2F0TA 4KJOA 2R7ZH 4IPGA 4KD4A 1SRUA 5HGQA 5C44H 3I73A 1SNOA 3BDOA 1HA5A 4F7XA 3JAME 5C3EH 1QNUA 1C7YA 1N32L 5C5LA 4LF6Q 2J0TD 4HR7B 5M3FG 4B3ML 4YWLA 3HEJA 3KF6A 4PZ6A 2B29A 4A3JB 4LUZA 2TMPA 1QUQB 1PA6A 4V190 3S1QB 4KN4C 3W3AA 1N8RC 3EVQA 4FDBA 4DR6Q 5IGBA 4EX5A 3W5OA 1GUWA 3CCRA 1HPCA 1QE6A 5DM73 4C3HG 2MP1A 1GHKA 3M7NA 3NTKA 1EU3A 1QVFA 2EJMA 4L5TA 1WVLA 4IFDI 4MNOA 1VDZA 1WCMG 4H7BA 4R4TA 1XMQL 4PMCA 1IBML 1D1KA 4LWCA 3O13A 2EY6A 1LTSD 1L1OA 3CP0A 1P8LA 2LKVA 4CKBA 2YYZA 5C4JH 4JPBW 3R3OA 5JVG3 1OXVA 4AQYL 1DD2A 5DM63 5M3MB 2E2JB 1VQGA 1T5XD 1XPOA 3GTKB 3EQLC 1JE4A 5C6AA 4QIWE 5JEAJ 2EVBA 4EGVA 4IPDA 1R9TH 2NTTA 1X55A 2PNRC 1Q90A 1B70B 1SMYC 2OT2A 3M7GA 1QJOA 1STHA 1CZGA 4HJAA 2PPBC 4XDXA 4KK7A 3J7A5 2BDNA 2MJ8A 2WB1G 1SFOB 2JA5G 3C1EA 4GNXC 2I0QA 3C46A 5JAVA 2QA4A 2F3VA 1ZYRC 4DV6Q 1O78A 1DOKA 1BBUA 1D2BA 3Q24A 4BXXG 3TN2A 3HOZG 4K2LA 2LXJA 4L8JA 4Y52H 2RDFA 1VCIA 4NPSA 2QILA 1LTRD 1Q8KA 5IT9E 1Y1WH 4HJ5A 1F9RA 3MXGA 3QO2A 1IBKQ 2MO1A 4TVAB 2KOLA 1Q7YC 3T56B 1F77A 1IL8A 5FJ8G 3MXUA 1G2SA 4ZQ3A 5LMUQ 1C9OA 1CKNA 1PDQA 1FGBD 4X3UA 3HOWH 3T1YQ 1YNJC 4X62L 2SNMA 3S9WA 1YIJA 3NUCA 4QGUA 2EOTA 1Q8IA 4MIUA 4LFCL 5ISRA 1HTLD 1RIPA 1AFPA 3BJUA 3GDEA 5GAHC 2VS1A 2Z4IA 3CCSA 4A3LG 2ZXRA 3RD4A 2VUMH 4DV6L 2JA8H 1O7IA 3PUWA 4KY7A 1W2BA 2E76C 4POGA 3D4WA 3R8BA 1EWIA 3MFYA 4A3MB 3S2HB 2RQXA 1CSQA 2EY5A 2AQ1B 2ATWA 2IJ0A 1VS0A 1A63A 1UUPA 3RN5A 2JA5B 3PUZA 4AYBE 2UXBL 3HG9A 3GTPB 5M5YB 4NDXA 4ALPA 1UEAB 2Q2TA 3TMEA 3UDXA 4LW1A 4CDEC 3GTJB 4B9XA 1PH1A 3PIOA 3G48A 1IHZA 2BA0A 2HDLA 5IWAQ 1TWCB 4ZUIA 2Z6BA 2ZJQA 2WAQE 2K50A 3CMEA 2H1EA 3U58A 1K8MA 5BR8L 1A3UA 1VMCA 3GTQB 2FHTA 1ILQA 2JXMB 3HOXB 1IBLL 4BBRG 4RMFA 2XGTA 4GKJL 1EQQA 5GAGC 1XMQQ 2PI2E 5HURA 5DLQE 2F0DA 4YY3L 4XXEA 1LUZA 4EQNA 1H9MA 3BS1A 1Z6HA 1U5KA 2ES2A 2PQAB 2N78A 2ZTCA 4HSPA 1EUJA 3TP8A 4CDCC 3GTMH 1VQ9A 4NB3A 1SNMA 3NTHA 1RTOA 5CBEE 2Z6KA 1Q82C 3STBD 3EN2A 1AH9A 3A5UA 1KLGD 4LF4Q 2JJQA 4FYDA 3KYHC 1DOMA 1WD1A 3CQZB 2KEEA 2CW0D 1LTID 2DY7A 4QIWB 5JJZA 1HQRD 2F0WA 2PQEA 3IFTA 2L11A 4JI2L 1U0LA 4K0KL 2HCIA 2VB3X 1BKBA 1QZHA 1J5EQ 3CCEA 2ALYB 1TKWB 4LNQA 3S14H 1KAAA 4YCWA 4CDFC 2PNHA 2YTXA 1SE8A 1PH9A 4ZK9B 2MO0A 2NWGA 4XYQA 2AQ3B 3S1NH 1Z47A 1Y8PB 1G6ZA 4DR1Q 1EYGA 2MPMA 1DYQA 1YJNA 2UUAQ 2L0CA 4K8JA 1SNCA 1MHWC 1XNQL 3GTGB 4DNTB 5LHY1 2GA4B 3AFPA 3FP9A 4NXML 2JK8A 4C3JB 1ICFB 1J6QA 1CZWA 1IXRA 2R61A 1RHPA 3RLFA 1BCPF 1JWMD 2K14A 3U4ZA 1EY8A 3PIPA 4LJZC 3SDZA 4CDDC 4FF1A 5CC4A 1HNWQ 5C0XI 5IP9H 4KHZA 4N8X1 4P72A 2Y0SE 1JWSD 2KHJA 1F9QA 3CAMA 4YHHQ 3HOXG 1JWUD 1KL9A 1PHJA 1DZ1A 1XMOL 1XPRA 1VQPA 1NAPA 1HQMC 2DUDA 4JBWA 5IOCA 4QL5A 2K28A 3L0OA 2F0KA 4IOCA 1AEXA 4HAEA 1SNQA 4ZAIA 1IL2A 1M1KC 2ENBA 4TKOB 4G57A 3K81C 5FLXL 2WAQB 2EYMA 1RODA 2D62A 4FF3A 3I4LA 4ID6A 4BS9A 3PF4A 5LL6S 3I90A 4JOIC 1WTXA 2WACA 3HS0C 3IAYA 2B2UA 2A19A 5FK9C 5IGEA 5GAEC 1Q86C 2F0VA 3RMHA 1XWEA 4BY7B 3J80i 3ITPA 2F0MA 4JV5L 1Y8OB 3ZJYC 1RJTA 4OELB 4JV5Q 1ML0D 4EQOA 4QJFA 1BCPC 1K83B 5K36H 3H94A 2C9OA 3FRPB 3J7YW 1SDFA 4DGZA 1Z9FA 3R2IA 1L0WA 1YITA 3TQYA 1K0SA 1EY9A 1PYWD 4XQNA 1IZ6A 1TS4A 2B63G 3V96A 4X64L 3VYRA 4C3JG 4HIMA 3GV6A 1IKMA 1MJCA 2OCEA 2NZHA 3C1FA 2K03A 4DR2L 2GVBA 4BY1B 1HFGA 2Q8TA 1G8ZD 4IO9A 1PVOA 4GS3A 1PFBA 3NTIA 3T16A 3ONAB 5FKAC 3ND9A 2VQEQ 3QR8A 4YHHL 4IUPA 2XWBB 3A5ZB 2IX0A 3I7FA 1Q81C 4HIOA 4L5QA 1D8LA 1A62A 1X54A 3TSSA 2AUKA 1WTPA 1A15A 1NR4A 3K0YA 4A3GH 3J80E 2QKIC 4MHEA 2NB0A 3KDFA 3NE5B 1I94L 1B50A 4DXGA 4UHVA 2D9UA 1X9NA 3H0GH 1TWHH 1N36Q 2JA9A 4DK1A 1VQNA 4QCLA 2DGYA 2FMCA 1ESFA 4LF8L 4A3LH 1EFID 2WAQG 1VQ6A 4BWGB 3I4MB 3OMCA 3P1HA 1UWVA 1AP0A 2JSOA 1BCPD 4QB4A 4DK0A 4R8IA 1J5EL 2F4VL 3HP3A 1TS2A 1BDOA 5IT9c 2Z9HA 5H1SE 2QDLA 2ICEC 3S15H 3DEPA 3E9HA 2A6HD 1WCMH 5CV4A 3NHHA 3HOYH 1E1OA 5IP7G 5LMNW 4P75A 2SOBA 3ER0A 2K01A 4OIJA 1X65A 4DR2Q 1SNDA 5EPLA 3T4AC 4WRDA 4A3FH 4JW0A 4JBMA 1GD7A 1KDCA 2WB1B 1TWCH 3ULLA 2FMMA 2K7VA 2B2WC 4BXXH 4DV5Q 3GTJH 4UP7A 4ILWA 3H3VH 5M5YH 4A76A 5FLXE 1G6PA 1CI3M 2VZAA 3W1GA 3CCVA 1KIXA 1KNAA 1NR2A 3WOEA 4LFBL 4A3CH 1PRTD 3S2HH 3TRZA 2ID0A 1F2YA 1OTCA 1Y1VH 1MJEA 3JC66 1PFMA 4L5SA 1AE2A 4HTHA 4EVOA 3ND8A 4DV0Q 1PTOH 1EIYB 1U4LA 4JOIA 2VUMB 1XXGA 3K5MA 4DAMA 3SR1A 1VQKA 4TSSA 5IODA 4OWTB 4GKKQ 1PXUA 2B2UC 1BQQT 3HOYB 1CUKA 1HH2P 4IOAA 1NUCA 2N88A 3CW2C 2D0OA 5COYA 5ELFA 3TZDA 3K58A 3HKZB 4HN7A 2I5MX 3HOVB 5K5PA 4RKLA 1XJVA 2NYZD 1JR0D 1M4VA 3S1RB 2BH8A 1BO0A 2MGSA 4AYBB 3A8KE 2K33A 1HNWL 3D4RA 2E2IH 2L15A 1A2UA 4F87A 2ZJPA 3H0GB 3RUZA 2BDOA 2KCMA 1I4XA 3CC4A 3CF5A 1I4QA 2A68C 2L5TA 2VQFL 3EJIA 4CJ1B 2CWAA 5J1ZA 2C5CA 4JI8L 4DV7Q 3T1YL 4DR1L 2UUAL 3QOLA 4NP5A 3X3NA 2A8VA 1VQBA 2Q8RE 2UUBQ 1EU4A 4N9PA 2XTIA 2RSNA 3I70A 1E2WA 2QW7A 5C3EG 2Q2UA 4J15A 3URYA 5C44G 3GTLH 1JOKA 3PUVA 3T51B 1STAA 3OOCA 1WTRA 3TEHB 1I4RA 2WKDA 4OGQC 4QQBX 4J6HA 4EQPA 2JE6I 1D1IA 1TR5A 1UE7A 2JA6B 3HGBA 4Z9CB 3HFZB 1I3QB 4A3IH 1B8AA 4J8QA 5CYUA 3HOYG 2RBMA 4LF4L 1I6HB 3S24A 1K83H 2EZVA 5G3LF 2A68D 2M00A 4JI7L 2FFKB 1UE6A 5JJIA 5J22A 3J81j 4QMGA 1WD0A 2B8GA 4ZUJA 2YU9H 1SMYD 1TS5A 2K75A 3IKJA 5C3WA 1SXTA 1H9KA 4KD3A 1I50B 5EBDA 1PRTB 2E2HH 5J39A 3I3CA 1IBLQ 1PH2A 3BVMA 3L9AX 3K80C 4C3HH 3X3MA 2IX1A 3AQQA 3FKIG 4G7ZC 4JI0Q 4FF2A 5A2QL 5IWAL 4LFAQ 2R3ZA 1T9HA 2ASBA 1ONLA 4DK6C 2G9DA 2B2WA 1QB5D 4FXKC 1FNWA 1M90C 2KQ3A 3S2DB 1VQFA 1U9RA 1JOOA 3I56A 5CV8A 3N52A 4GN4B 4GN5A 1PYSB 2AWOA 4B3TL 5C3EB 5KYLA 2R92B 2RCNA 5C44B 2Q2HA 5M5WB 4IUNA 4L6TB 4XT1B 2R7ZB 1IKLA 3KF8B 1SROA 2VL6A 1EIFA 3SK4A 1GUSA 1EOTA 1G291 4DR6L 3PUXA 3TS2A 3DMUA 3QWNA 5DEHA 4DFAA 3I91A 4UPAA 2IW3A 1E2ZA 1TY0A 2IHEA 2OQKA 1UE5A 5I4DA 2L1BA 3RLOA 3H09A 2XWJB 5J3BA 4B3MQ 3F2UA 4PZ7A 4LF6L 1BF4A 2XVSA 4K14A 3W2DA 4ZKCB 1VQCA 4FF4A 4C3IG 3I4NG 5IT9L 2F0FA 3A0JA 4X62Q 3RZDB 1S5CD 2N3SA 5KEEA 4HCSA 2O2LD 2JA8G 3BZDB 1SBBB 4KN7C 2XIWA 5GROA 1X56A 1E24A 1FNVA 2K05A 2KHSA 4JI5L 3EROA 1IYUA 4LF5Q 1YNXA 2CH4A 4X6AH 3C2PA 3OMGA 2LS01 2NVQH 4GNXB 2UXCL 3K59A 2K5HA 3OYYA 3LGJA 1CKOA 3CQZH 1GUTA 4BY7G 5JPNC 1OXSC 1QG7A 3WOFA 4BBSG 4R4OA 2HQLA 1AW7A 5CR3A 5ELNA 3GTMB 3PUYA 2E75C 2EE1A 4X65Q 2KBNA 2I46A 3PO3G 1SYCA 2UXCQ 1D5XC 1OXXK 1DONA 2R6GA 3OW7A 1RL2A 3L7ZC 3H3VC 2EYLA 2K04A 2VW9A 1GKHA 2K52A 3PCOB 2A69C 4OX9L 1H9SA 4RAUC 2K32A 4RGOS 1LACA 1JJGA 4R4CA 4PZ8A 2PMZE 2LY7A 3VDYA 4JK1C 1AE3A 4I7AA 1TWAB 4OL7A 3BVGA 2AMCB 2C35B 3BYTB 2NVYB 3KUPA 4K6DA 4GOPA 4DUYL 4ABNA 1QWYA 2IX3A 3BG3A 2CWPA 4GOPC 2RHQB 3GTPH 2AWNA 4F88A 1VQDA 2QGQA 3I55A 1A6XA 4HCEA 3SXHA 3VR5A 3L2PA 1NSNS 2JA6G 1E1TA 3VYUA 4KY5A 1IBMQ 4JI1L 4A3MH 1F9SA 4KV6A 4YCUA 4DV3L 2JA8B 4B3TQ 1JE5A 4N8FA 5D14A 2JA7H 2K4KA 1LO5D 1EY4A 2WV6D 1YHAA 4YIJA 5EKIA 3CCUA 2XSCA 1FVIA 4POFA 4X66L 3HRZC 4RFBA 4RGMA 4GLXA 3D6WA 1JB7A 3QJYA 4LFAL 2QCPX 3J81i 3H91A 4XTCS 1XX8A 1HR0Q 5C5MA 4JI0L 1QOHA 4BBSB 1U4PA 4GNXA 1KABA 4P74A 1N32Q 2NVTH 4WJ3M 3D6CA 2IWHA 3CC7A 1EY5A 1EQTA 1EQVA 2A6ED 3PO3B 4LF7L 2UXDQ 3H3VI 1C48A 2DJFC 2OTJA 2O5JC 2CH4W 3TP7A 1ENCA 2B2VC 2JEBI 1D5ZC 3ULPA 2WFWA 5IGDA 1EOVA 3MEFA 4IPCA 2NZ1D 1ET9A 1LT4D 1FJGQ 5I6YA 2R7ZG 4DV4L 2B63B 4KI0A 2EYFA 3AU7A 3DWQA 3GD7A 1YNNC 1HNZL 4K0KQ 5IE8A 1K8OA 4HIKA 4DR3Q 1ASZA 1UAPA 4JI2Q 4HEDA 1VQMA 4I7ZC 1YBYA 1TWFH 3OPOA 3I72A 4KHPL 3T1HL 2CW0C 2VUMG 4MN3A 1PFSA 1RF2D 1K8AC 2F0QA 2KCTA 3WDNA 3ICEA 2KA7A 2L12A 5T1GA 3SEBA 4M1UB 4JI8Q 4DV7L 1WTOA 5I6WA 1I4GA 3DWPA 3M9BA 3SK5A 2EXZA 3OHXC 5C4XB 1PTOD 2B8FA 1GUNA 1OXUA 2E5LL 1FD7D 2CFMA 3A7LA 1ZKOA 1JMCA 3UDFA 2NVQB 1CKNB 4KY6A 1Q1BA 1AN8A 5EPKA 3UDGA 1KRSA 1Y14B 4ZKBB 2EYPA 1KLUD 3G7LA 1EY0A 5EBCA 5CV6A 4B9WA 4PMBA 2IY5B 3VYSA 4K5WA 1LTGD 2RSOA 2MNAA 1PH6A 3HKZE 3S16B 3D0FA 3S1QH 4X3SA 3K5NA 4XIGS 4A3EG 1IYJB 4UP8A 3MVVA 4NKLA 1C4QA 4X66Q 1DOLA 3SHLA 4YWKA 1X32A 1RDPD 1SE4A 1RKNA 1O80A 3A8JE 4P73A 1V8QA 3NSWA 5ELBA 4DPGA 3CCJA 2E74C 3CPFA 2KJXA 4RH6A 5FLXc 1S3OA 4A93H 1E22A 3I8ZA 3LWUA 5LL6X 2F0SA 2Z6KC 2PW5A 1BUVT 5HY6A 4JI6Q 2K5DA 3J80c 1NY4A
chains in the Genus database with same CATH topology
5C44H 1G6PA 1S40A 2JA5H 2QEXA 5C3EH 2VZAA 2JEAI 1VQ4A 3W1GA 3I2ZA 3CCVA 1KIXA 1C7YA 4LF6Q 1N32L 4A3JG 3TREA 5M3FG 4B3ML 4YWLA 1HNZQ 3S2DH 3KF6A 4LFBL 4A3CH 4DUYQ 4PZ6A 3S2HH 2B29A 3NBHB 3TRZA 2ID0A 2ZTEA 3OTOQ 4LUZA 1OTCA 1Y1VH 1MJEA 3JC66 1QUQB 4L5SA 1AE2A 1PA6A 3PV0A 4DV0Q 4MTNA 1Q12A 2RF4A 1EIYB 1XNQQ 3S16H 4JOIA 5K36G 4DV2Q 3HOUH 4DAMA 1N8RC 1VQKA 4GKKQ 4OWTB 4FDBA 4DR6Q 4LF5L 4EX5A 3W5OA 1CUKA 1HH2P 4JI5Q 3CCRA 1N33L 4HJ7A 4IOAA 5C0XJ 4OO1G 4GLVB 3HOVG 3CW2C 2NN6G 2D0OA 5IYDG 4B3RL 3T1HQ 3M7NA 2I5MX 1QVFA 4L5TA 3I4OA 1XJVA 4IFDI 4MNOA 1WCMG 4R4TA 1XMQL 1IBML 1IBKL 4LWCA 2BH8A 1XNRL 2HHHL 5M3MG 2YTVA 1VQ8A 1VQIA 4A3DH 1L1OA 3CP0A 1P8LA 4PMWA 5C4JH 2YYZA 2NVXH 4AQYL 1OXVA 5C4XH 1HNWL 2GVAA 2E2IH 2L15A 1VQGA 1WOCA 2ZJPA 1YHQA 2JQOA 2EIFA 4KLKA 2UXCL 1YZ6A 1XPOA 3G4SA 1X6OA 1HR0W 4QIWE 3M4QA 5JEAJ 2H5XA 4DV4Q 3KJOA 1R9TH 4IPDA 2KCMA 5M3FH 4JYAQ 3CC4A 5IY0A 3CF5A 2VQFL 3KJPA 4OONA 1YI2A 1FGUA 1Q46A 3KF6B 3TS0A 1X55A 2JA6H 2CWAA 3F2DA 4JI8L 4DV7Q 1B70B 1NMGA 3T1YL 1MKHA 4DR1L 2UUAL 4YWMA 1HNXQ 2A8VA 1VQBA 4APVA 4HJAA 3M4PA 1LTLA 2UUBQ 3J7A5 2XTIA 2WB1G 1NBWA 2VY3A 5C3EG 1KHIA 2Q2UA 2JA5G 4J15A 4C2MH 4GNXC 2I0QA 5C44G 1OXTA 3GTLH 3PUVA 3TEHB 2QA4A 4QQBX 2K5NA 4DV6Q 2OQ0A 2K5VA 1BBUA 2VQEL 2JE6I 3RZOH 1HZ9A 4O2DA 4BXXG 3EBEA 1UE7A 5FLMG 3HOZG 2LXJA 4MZ9A 1MIUA 4YCVA 1VQLA 4Y52H 1Q1EA 2ZM6L 1VCIA 4NPSA 3HFZB 4A3IH 1B8AA 1KC8C 3HOYG 1GO3E 1PH7A 1Q8KA 1Y1WH 4A3FG 2UU9L 4LF4L 4HJ5A 2MFIA 2LXKA 2OTLA 3DM3A 3KDFB 3RR5A 3GTKH 2ZJRA 4DR4Q 3F2CA 1IBKQ 2MO1A 3S24A 4TVAB 1YVCA 4A3EH 1K83H 2PQAA 3PO3H 1Q7YC 1NJIC 4JI7L 1DGSA 1UE6A 5GADC 1E7ZA 2FXQA 5FJ8G 5JJIA 2PI2A 3J81j 5C4XG 5LMUQ 1HZBA 1C9OA 1CKNA 1HZCA 1VQAA 2F3IA 2YU9H 5M5XH 3S1RH 2K75A 3HOWH 3T1YQ 1EFWA 4BBSH 4X62L 4O0AA 1N34Q 1YIJA 2E2HH 1N9WA 3STBC 1XTDA 4QGUA 2WB1E 4LFCL 1IBLQ 1PH2A 1RIPA 5AJ3L 4DV1L 3FHWA 3BJUA 4PG3A 2KENA 3GDEA 5GAHC 5IYDH 3K80C 2VS1A 4C3HH 3F1ZA 1PH5A 4IJHA 2IX1A 3AQQA 3FKIG 4JI0Q 3CCSA 2EXDA 4A3LG 2VUMH 4DR7L 5GQOA 1QZGA 5IYBG 1YHBA 1TXYA 5IWAL 4LFAQ 4DV6L 4NXMQ 1NE3A 3K0XA 1Y1WG 2JA8H 2R93G 1O7IA 1T9HA 3BZKA 3PUWA 1SR3A 4DK6C 4A76A 1W2BA 4POGA 2ASBA 1XNRQ 1M90C 1EWIA 2Z0SA 1YEZA 1VQFA 1CSQA 3I56A 5LMUL 2UUCL 1VQOA 4LF9L 2ATWA 3D31A 4GN4B 1VS0A 1PYSB 2AWOA 4GN5A 4B3TL 3J7ZC 4L5RC 4OX9Q 1A63A 3RN5A 3PUZA 1BBWA 2RCNA 4AYBE 4A93G 2UXBL 2Q2HA 1V9PA 4IFDG 4DKAC 3KF8B 1SROA 2VL6A 4IFDJ 1EIFA 4ALPA 2Q2TA 2UUCQ 1G291 3UDXA 4LW1A 3PUXA 3TS2A 4DR6L 1D7QA 4UY8C 1VQJA 1K73C 4JI3L 1PH1A 2R92G 2VQFQ 3OW2A 3BU2A 4UPAA 3PIOA 4A3KH 5E7NA 3U4VA 4C3JH 3G48A 1HZAA 4X65L 2BA0A 2IHEA 5IWAQ 2OQKA 1UE5A 4OWXB 2ZJQA 4IJLA 2WAQE 2K50A 3RLOA 3CMEA 5IYCG 3U58A 5J3BA 4B3MQ 1GVPA 5BR8L 4PZ7A 4ME3A 4BY1G 4LF6L 3EIVA 3F2BA 1UEBA 1KAWA 5AJ3Q 4DV1Q 1VQCA 1IBLL 4BBRG 4RMFA 3NEMA 2XGTA 3I4NG 4GKJL 1EQQA 5GAGC 4JI3Q 4OWWB 3B6YA 1L1OB 1XMQQ 2PI2E 3A0JA 3JAMc 5DLQE 4X62Q 3Q8DA 1N34L 2N3SA 1KD1C 4YY3L 4GN3B 5IP7H 1KQSA 2R93H 1LUZA 2JA8G 3CXCA 1U5KA 3RLNA 2PQAB 2ES2A 1B7YB 2N78A 2ZTCA 5GROA 1K9MC 1X56A 1E24A 1EUJA 4JI5L 4LF5Q 5LMNL 1VQ9A 1YNXA 4NB3A 4LF9Q 3RNUA 4YY3Q 3GTMH 4X6AH 3K8AA 4DV2L 2HIVA 3K7UC 4A4IA 4LUVA 2Z6KA 2NVQH 4GNXB 3STBD 2D0PA 3EN2A 3CCQA 2K5HA 1Q82C 4BA1I 3AEVA 3OYYA 3LGJA 4GKJQ 1CKOA 3CQZH 3A5UA 4DV0L 2UU9Q 2JJQA 4LF4Q 3KYHC 4NXNQ 3I4MH 2AHOB 4BY7G 4HJ9A 1OXSC 3OTOL 4BBSG 3HOWG 2ZM6Q 4R4OA 1QUQA 2A1AA 2HQLA 4DK3C 1LM0A 4H02A 5ELNA 3PUYA 4X65Q 1K3RA 2KBNA 2YV5A 3I4MG 4JC0A 4JI2L 4A75A 3PO3G 3H0GG 1WJJA 2UXCQ 1U0LA 1OXXK 1PH4A 4K0KL 2R6GA 2I5LX 1BKBA 1QZHA 1J5EQ 1RL2A 3L7ZC 3CCEA 2ALYB 2VW9A 4LNQA 3K7AH 2KHIA 2R7ZH 3S14H 4YCWA 2PNHA 4A3IG 1GKHA 1YJWA 2YTXA 1SE8A 2K52A 1PH9A 3PCOB 3BZCA 4A3MG 2MO0A 1WYDA 2E5LQ 2OWOA 4OX9L 3PO2H 3S1NH 2MQHA 1Z47A 3PSIA 4R4QA 4DNIA 1HNXL 4DR1Q 1EYGA 2UUAQ 1JJGA 1YJNA 4R4CA 4A3BG 4PZ8A 4JI4Q 2PMZE 4Y7NH 1XNQL 1KXLA 1A0IA 3AYHB 3CPWA 1V1QA 3AFPA 3VDYA 2B63H 3CCLA 3FP9A 1GM5A 1AE3A 4NXML 4BY1H 2JK8A 1L2FA 3RN2A 4A3BH 1X3GA 5BR8Q 3GTOH 2N49A 3NELA 4B3SQ 2AMCB 1J6QA 2C35B 4GOPA 4DUYL 4LFBQ 1IXRA 4KHPQ 1E3PA 3RLFA 4EQ5A 5JJLA 2K14A 4DR5L 3U4ZA 3S1MH 2CWPA 4GOPC 2RHQB 3PIPA 3GTPH 5JJKA 2AWNA 1VQDA 2QGQA 5M5WH 1HNWQ 3I55A 4LFCQ 5C0XI 4DR3L 5IP9H 1YJ9A 1HJPA 4KHZA 2R92H 4P72A 3L2PA 2Y0SE 2KHJA 3CAMA 4YHHQ 3HOXG 1KL9A 2JA6G 1E1TA 1PHJA 4TQUS 1XMOL 1XPRA 1VQPA 2DUDA 2R7DA 4DV5L 4JI1L 4A3MH 1IBMQ 3PO2G 4JBWA 4QL5A 2AKWB 3L0OA 5IYBH 2UXBQ 4YCUA 4B3RQ 2UUBL 1SN8A 1QVCA 4DV3L 4IOCA 4B3TQ 1JE5A 3FKIH 2JA7H 4JI7Q 1FJGL 1IL2A 2R7FA 3MXNB 1M1KC 4BY7H 2K4KA 1W3SA 3G6EA 1EQRA 1YHAA 3CCUA 4GOPB 1N33Q 4DUZQ 1VQ5A 1FVIA 4POFA 4X66L 1K0RA 4DUZL 3K81C 4GLXA 1JB7A 2D62A 4A3DG 4LFAL 3M3YH 3PF4A 4JYAL 4QY7A 3M85A 2Y0SG 4RG1A 3J81i 3CD6A 4JOIC 4XTCS 1HR0Q 4DR7Q 4JI0L 2A19A 1I50H 4AYBG 5FJ8H 5GAEC 4GNXA 1Q86C 1ASYA 3J80i 4P74A 4JV5L 2NVTH 2GN5A 1N32Q 3ZJYC 4WJ3M 3DLLA 3HKZG 1CSPA 1WI5A 4JV5Q 3CC7A 2HHHQ 4LF7L 4QJFA 1X3EA 2YTYA 2JA7G 2NN6I 4JI6L 3H3VI 3HOUG 2NZOA 2UXDQ 4DR5Q 1I6HH 1Z9FA 2OTJA 2BH2A 1L0WA 1L1OC 4AIMA 5IYCH 1YITA 1HR0L 3TQYA 4P71A 3M4OH 1Y1VG 1I3QH 4LF8Q 1IZ6A 4A3CG 2JEBI 3ULPA 2B63G 2WFWA 4X64L 4C3IH 4A3KG 4HIMA 1EOVA 1FL0A 3W1BA 2N8NA 2F52A 3A74A 4DR4L 4X64Q 4JI4L 3GO5A 1MJCA 2NVYH 2OCEA 2NZHA 3MEFA 1LYLA 1PH3A 2CQOA 4IPCA 1I94Q 2CCZA 3CC2A 1TWAH 4R4IA 4DR2L 1FJGQ 3UDIA 3SGIA 2GVBA 2R7ZG 4DV4L 1P16A 4KI0A 1C0AA 3HOZH 3GTGH 4IO9A 1PVOA 1SFOH 5EAYA 4GS3A 4WJ4A 3GD7A 2UXDL 1HNZL 4LF7Q 2VQEQ 4YHHL 4AQYQ 4K0KQ 3KFUA 5IE8A 1I5FA 1A8VA 4HIKA 4DR3Q 1ASZA 1H95A 4JCVE 3A5ZB 2BA1A 1SLJA 4JI2Q 1VQMA 2IX0A 3I7FA 1VQHA 1YBYA 5ELOA 1TWGH 3PF5A 1Q81C 4HJ8A 1TWFH 1D8LA 1A62A 1X54A 2ZTDA 4L5QA 4HIOA 4KHPL 3HKSA 3E9IA 4A3GH 3T1HL 3E0EA 3U50C 4JBJA 2VUMG 3ULJA 4GLAC 1PFSA 4B3SL 1K8AC 2IT1A 2B3GA 3KDFA 4UP9A 4JBKA 2KCTA 3ICEA 1I94L 3G71A 4LUOA 1X9NA 4NXNL 4JI8Q 4DV7L 3H0GH 1VQ7A 1TWHH 1VQEA 3M9BA 1N36Q 2HT1A 2JA9A 3WWVA 1VQNA 4GKKL 2WP8J 5JEAG 2DGYA 2V1CC 1XPUA 2E2JH 1X3FA 5M3MH 4LF8L 1G51A 5LMNQ 2EQSA 1OXUA 4DV3Q 2E5LL 4A3LH 2WAQG 1VQ6A 2CFMA 1V43A 2RHSB 1UWVA 3JAMi 1PV4A 2I5HA 3UDFA 1JMCA 4AH6A 2VNUD 4JI1Q 4OO1I 1CKNB 1PYBA 1KRTA 1J5EL 4HIDA 2F4VL 1SMXA 3F8TA 3HOVH 2Q2IA 1Q1BA 5IT9c 5H1SE 1QVGA 3KOJA 3UDGA 3S15H 1KRSA 1Y14B 3I4NH 4BBRH 3E9HA 4R1JA 1WCMH 3HOYH 1JT8A 2CKZB 2IY5B 3PGZA 3CMAA 2F4VQ 3RZDH 3H15A 1E1OA 2HIXA 5C0XG 2MNAA 1PH6A 3HKZE 5IP7G 3D0FA 3S17H 1PH8A 5LMNW 4P75A 3S1QH 1S72A 4XIGS 3HOXH 4A3EG 5FLMH 3UE1A 3J81c 3GTQH 1IYJB 4UP8A 3ER0A 4DAYB 4A3GG 5IP9G 1X65A 1CKMA 2IHFA 4DR2Q 4X66Q 3IRBA 4A3JH 3KLWA 1WFQA 4IPHA 1BVSA 4YWKA 4A3FH 4JBMA 4BA2I 3ERSX 1N36L 1GD7A 1TWCH 4P73A 4DPGA 3ULLA 3CCMA 2LSSA 3CCJA 3UE0A 4JG2A 3CPFA 1JJ2A 5FLXc 1S3OA 4A93H 1E22A 1K8GA 4OXPA 4BXXH 4DV5Q 2E8GA 1NTGA 3GTJH 1XMOQ 1NMFA 4UP7A 1AH9A 3AFQA 1JJCB 2Z6KC 3NENA 1UE1A 3H3VH 5HY6A 5M5YH 4JI6Q 4IPGA 1SRUA 3J80c 5HGQA 1NY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C44 H;  1G6P A;  1S40 A;  2JA5 H;  2QEX A;  5C3E H;  2VZA A;  2JEA I;  1VQ4 A;  3W1G A;  3I2Z A;  3CCV A;  1KIX A;  1C7Y A;  4LF6 Q;  1N32 L;  4A3J G;  3TRE A;  5M3F G;  4B3M L;  4YWL A;  1HNZ Q;  3S2D H;  3KF6 A;  4LFB L;  4A3C H;  4DUY Q;  4PZ6 A;  3S2H H;  2B29 A;  3NBH B;  3TRZ A;  2ID0 A;  2ZTE A;  3OTO Q;  4LUZ A;  1OTC A;  1Y1V H;  1MJE A;  3JC6 6;  1QUQ B;  4L5S A;  1AE2 A;  1PA6 A;  3PV0 A;  4DV0 Q;  4MTN A;  1Q12 A;  2RF4 A;  1EIY B;  1XNQ Q;  3S16 H;  4JOI A;  5K36 G;  4DV2 Q;  3HOU H;  4DAM A;  1N8R C;  1VQK A;  4GKK Q;  4OWT B;  4FDB A;  4DR6 Q;  4LF5 L;  4EX5 A;  3W5O A;  1CUK A;  1HH2 P;  4JI5 Q;  3CCR A;  1N33 L;  4HJ7 A;  4IOA A;  5C0X J;  4OO1 G;  4GLV B;  3HOV G;  3CW2 C;  2NN6 G;  2D0O A;  5IYD G;  4B3R L;  3T1H Q;  3M7N A;  2I5M X;  1QVF A;  4L5T A;  3I4O A;  1XJV A;  4IFD I;  4MNO A;  1WCM G;  4R4T A;  1XMQ L;  1IBM L;  1IBK L;  4LWC A;  2BH8 A;  1XNR L;  2HHH L;  5M3M G;  2YTV A;  1VQ8 A;  1VQI A;  4A3D H;  1L1O A;  3CP0 A;  1P8L A;  4PMW A;  5C4J H;  2YYZ A;  2NVX H;  4AQY L;  1OXV A;  5C4X H;  1HNW L;  2GVA A;  2E2I H;  2L15 A;  1VQG A;  1WOC A;  2ZJP A;  1YHQ A;  2JQO A;  2EIF A;  4KLK A;  2UXC L;  1YZ6 A;  1XPO A;  3G4S A;  1X6O A;  1HR0 W;  4QIW E;  3M4Q A;  5JEA J;  2H5X A;  4DV4 Q;  3KJO A;  1R9T H;  4IPD A;  2KCM A;  5M3F H;  4JYA Q;  3CC4 A;  5IY0 A;  3CF5 A;  2VQF L;  3KJP A;  4OON A;  1YI2 A;  1FGU A;  1Q46 A;  3KF6 B;  3TS0 A;  1X55 A;  2JA6 H;  2CWA A;  3F2D A;  4JI8 L;  4DV7 Q;  1B70 B;  1NMG A;  3T1Y L;  1MKH A;  4DR1 L;  2UUA L;  4YWM A;  1HNX Q;  2A8V A;  1VQB A;  4APV A;  4HJA A;  3M4P A;  1LTL A;  2UUB Q;  3J7A 5;  2XTI A;  2WB1 G;  1NBW A;  2VY3 A;  5C3E G;  1KHI A;  2Q2U A;  2JA5 G;  4J15 A;  4C2M H;  4GNX C;  2I0Q A;  5C44 G;  1OXT A;  3GTL H;  3PUV A;  3TEH B;  2QA4 A;  4QQB X;  2K5N A;  4DV6 Q;  2OQ0 A;  2K5V A;  1BBU A;  2VQE L;  2JE6 I;  3RZO H;  1HZ9 A;  4O2D A;  4BXX G;  3EBE A;  1UE7 A;  5FLM G;  3HOZ G;  2LXJ A;  4MZ9 A;  1MIU A;  4YCV A;  1VQL A;  4Y52 H;  1Q1E A;  2ZM6 L;  1VCI A;  4NPS A;  3HFZ B;  4A3I H;  1B8A A;  1KC8 C;  3HOY G;  1GO3 E;  1PH7 A;  1Q8K A;  1Y1W H;  4A3F G;  2UU9 L;  4LF4 L;  4HJ5 A;  2MFI A;  2LXK A;  2OTL A;  3DM3 A;  3KDF B;  3RR5 A;  3GTK H;  2ZJR A;  4DR4 Q;  3F2C A;  1IBK Q;  2MO1 A;  3S24 A;  4TVA B;  1YVC A;  4A3E H;  1K83 H;  2PQA A;  3PO3 H;  1Q7Y C;  1NJI C;  4JI7 L;  1DGS A;  1UE6 A;  5GAD C;  1E7Z A;  2FXQ A;  5FJ8 G;  5JJI A;  2PI2 A;  3J81 j;  5C4X G;  5LMU Q;  1HZB A;  1C9O A;  1CKN A;  1HZC A;  1VQA A;  2F3I A;  2YU9 H;  5M5X H;  3S1R H;  2K75 A;  3HOW H;  3T1Y Q;  1EFW A;  4BBS H;  4X62 L;  4O0A A;  1N34 Q;  1YIJ A;  2E2H H;  1N9W A;  3STB C;  1XTD A;  4QGU A;  2WB1 E;  4LFC L;  1IBL Q;  1PH2 A;  1RIP A;  5AJ3 L;  4DV1 L;  3FHW A;  3BJU A;  4PG3 A;  2KEN A;  3GDE A;  5GAH C;  5IYD H;  3K80 C;  2VS1 A;  4C3H H;  3F1Z A;  1PH5 A;  4IJH A;  2IX1 A;  3AQQ A;  3FKI G;  4JI0 Q;  3CCS A;  2EXD A;  4A3L G;  2VUM H;  4DR7 L;  5GQO A;  1QZG A;  5IYB G;  1YHB A;  1TXY A;  5IWA L;  4LFA Q;  4DV6 L;  4NXM Q;  1NE3 A;  3K0X A;  1Y1W G;  2JA8 H;  2R93 G;  1O7I A;  1T9H A;  3BZK A;  3PUW A;  1SR3 A;  4DK6 C;  4A76 A;  1W2B A;  4POG A;  2ASB A;  1XNR Q;  1M90 C;  1EWI A;  2Z0S A;  1YEZ A;  1VQF A;  1CSQ A;  3I56 A;  5LMU L;  2UUC L;  1VQO A;  4LF9 L;  2ATW A;  3D31 A;  4GN4 B;  1VS0 A;  1PYS B;  2AWO A;  4GN5 A;  4B3T L;  3J7Z C;  4L5R C;  4OX9 Q;  1A63 A;  3RN5 A;  3PUZ A;  1BBW A;  2RCN A;  4AYB E;  4A93 G;  2UXB L;  2Q2H A;  1V9P A;  4IFD G;  4DKA C;  3KF8 B;  1SRO A;  2VL6 A;  4IFD J;  1EIF A;  4ALP A;  2Q2T A;  2UUC Q;  1G29 1;  3UDX A;  4LW1 A;  3PUX A;  3TS2 A;  4DR6 L;  1D7Q A;  4UY8 C;  1VQJ A;  1K73 C;  4JI3 L;  1PH1 A;  2R92 G;  2VQF Q;  3OW2 A;  3BU2 A;  4UPA A;  3PIO A;  4A3K H;  5E7N A;  3U4V A;  4C3J H;  3G48 A;  1HZA A;  4X65 L;  2BA0 A;  2IHE A;  5IWA Q;  2OQK A;  1UE5 A;  4OWX B;  2ZJQ A;  4IJL A;  2WAQ E;  2K50 A;  3RLO A;  3CME A;  5IYC G;  3U58 A;  5J3B A;  4B3M Q;  1GVP A;  5BR8 L;  4PZ7 A;  4ME3 A;  4BY1 G;  4LF6 L;  3EIV A;  3F2B A;  1UEB A;  1KAW A;  5AJ3 Q;  4DV1 Q;  1VQC A;  1IBL L;  4BBR G;  4RMF A;  3NEM A;  2XGT A;  3I4N G;  4GKJ L;  1EQQ A;  5GAG C;  4JI3 Q;  4OWW B;  3B6Y A;  1L1O B;  1XMQ Q;  2PI2 E;  3A0J A;  3JAM c;  5DLQ E;  4X62 Q;  3Q8D A;  1N34 L;  2N3S A;  1KD1 C;  4YY3 L;  4GN3 B;  5IP7 H;  1KQS A;  2R93 H;  1LUZ A;  2JA8 G;  3CXC A;  1U5K A;  3RLN A;  2PQA B;  2ES2 A;  1B7Y B;  2N78 A;  2ZTC A;  5GRO A;  1K9M C;  1X56 A;  1E24 A;  1EUJ A;  4JI5 L;  4LF5 Q;  5LMN L;  1VQ9 A;  1YNX A;  4NB3 A;  4LF9 Q;  3RNU A;  4YY3 Q;  3GTM H;  4X6A H;  3K8A A;  4DV2 L;  2HIV A;  3K7U C;  4A4I A;  4LUV A;  2Z6K A;  2NVQ H;  4GNX B;  3STB D;  2D0P A;  3EN2 A;  3CCQ A;  2K5H A;  1Q82 C;  4BA1 I;  3AEV A;  3OYY A;  3LGJ A;  4GKJ Q;  1CKO A;  3CQZ H;  3A5U A;  4DV0 L;  2UU9 Q;  2JJQ A;  4LF4 Q;  3KYH C;  4NXN Q;  3I4M H;  2AHO B;  4BY7 G;  4HJ9 A;  1OXS C;  3OTO L;  4BBS G;  3HOW G;  2ZM6 Q;  4R4O A;  1QUQ A;  2A1A A;  2HQL A;  4DK3 C;  1LM0 A;  4H02 A;  5ELN A;  3PUY A;  4X65 Q;  1K3R A;  2KBN A;  2YV5 A;  3I4M G;  4JC0 A;  4JI2 L;  4A75 A;  3PO3 G;  3H0G G;  1WJJ A;  2UXC Q;  1U0L A;  1OXX K;  1PH4 A;  4K0K L;  2R6G A;  2I5L X;  1BKB A;  1QZH A;  1J5E Q;  1RL2 A;  3L7Z C;  3CCE A;  2ALY B;  2VW9 A;  4LNQ A;  3K7A H;  2KHI A;  2R7Z H;  3S14 H;  4YCW A;  2PNH A;  4A3I G;  1GKH A;  1YJW A;  2YTX A;  1SE8 A;  2K52 A;  1PH9 A;  3PCO B;  3BZC A;  4A3M G;  2MO0 A;  1WYD A;  2E5L Q;  2OWO A;  4OX9 L;  3PO2 H;  3S1N H;  2MQH A;  1Z47 A;  3PSI A;  4R4Q A;  4DNI A;  1HNX L;  4DR1 Q;  1EYG A;  2UUA Q;  1JJG A;  1YJN A;  4R4C A;  4A3B G;  4PZ8 A;  4JI4 Q;  2PMZ E;  4Y7N H;  1XNQ L;  1KXL A;  1A0I A;  3AYH B;  3CPW A;  1V1Q A;  3AFP A;  3VDY A;  2B63 H;  3CCL A;  3FP9 A;  1GM5 A;  1AE3 A;  4NXM L;  4BY1 H;  2JK8 A;  1L2F A;  3RN2 A;  4A3B H;  1X3G A;  5BR8 Q;  3GTO H;  2N49 A;  3NEL A;  4B3S Q;  2AMC B;  1J6Q A;  2C35 B;  4GOP A;  4DUY L;  4LFB Q;  1IXR A;  4KHP Q;  1E3P A;  3RLF A;  4EQ5 A;  5JJL A;  2K14 A;  4DR5 L;  3U4Z A;  3S1M H;  2CWP A;  4GOP C;  2RHQ B;  3PIP A;  3GTP H;  5JJK A;  2AWN A;  1VQD A;  2QGQ A;  5M5W H;  1HNW Q;  3I55 A;  4LFC Q;  5C0X I;  4DR3 L;  5IP9 H;  1YJ9 A;  1HJP A;  4KHZ A;  2R92 H;  4P72 A;  3L2P A;  2Y0S E;  2KHJ A;  3CAM A;  4YHH Q;  3HOX G;  1KL9 A;  2JA6 G;  1E1T A;  1PHJ A;  4TQU S;  1XMO L;  1XPR A;  1VQP A;  2DUD A;  2R7D A;  4DV5 L;  4JI1 L;  4A3M H;  1IBM Q;  3PO2 G;  4JBW A;  4QL5 A;  2AKW B;  3L0O A;  5IYB H;  2UXB Q;  4YCU A;  4B3R Q;  2UUB L;  1SN8 A;  1QVC A;  4DV3 L;  4IOC A;  4B3T Q;  1JE5 A;  3FKI H;  2JA7 H;  4JI7 Q;  1FJG L;  1IL2 A;  2R7F A;  3MXN B;  1M1K C;  4BY7 H;  2K4K A;  1W3S A;  3G6E A;  1EQR A;  1YHA A;  3CCU A;  4GOP B;  1N33 Q;  4DUZ Q;  1VQ5 A;  1FVI A;  4POF A;  4X66 L;  1K0R A;  4DUZ L;  3K81 C;  4GLX A;  1JB7 A;  2D62 A;  4A3D G;  4LFA L;  3M3Y H;  3PF4 A;  4JYA L;  4QY7 A;  3M85 A;  2Y0S G;  4RG1 A;  3J81 i;  3CD6 A;  4JOI C;  4XTC S;  1HR0 Q;  4DR7 Q;  4JI0 L;  2A19 A;  1I50 H;  4AYB G;  5FJ8 H;  5GAE C;  4GNX A;  1Q86 C;  1ASY A;  3J80 i;  4P74 A;  4JV5 L;  2NVT H;  2GN5 A;  1N32 Q;  3ZJY C;  4WJ3 M;  3DLL A;  3HKZ G;  1CSP A;  1WI5 A;  4JV5 Q;  3CC7 A;  2HHH Q;  4LF7 L;  4QJF A;  1X3E A;  2YTY A;  2JA7 G;  2NN6 I;  4JI6 L;  3H3V I;  3HOU G;  2NZO A;  2UXD Q;  4DR5 Q;  1I6H H;  1Z9F A;  2OTJ A;  2BH2 A;  1L0W A;  1L1O C;  4AIM A;  5IYC H;  1YIT A;  1HR0 L;  3TQY A;  4P71 A;  3M4O H;  1Y1V G;  1I3Q H;  4LF8 Q;  1IZ6 A;  4A3C G;  2JEB I;  3ULP A;  2B63 G;  2WFW A;  4X64 L;  4C3I H;  4A3K G;  4HIM A;  1EOV A;  1FL0 A;  3W1B A;  2N8N A;  2F52 A;  3A74 A;  4DR4 L;  4X64 Q;  4JI4 L;  3GO5 A;  1MJC A;  2NVY H;  2OCE A;  2NZH A;  3MEF A;  1LYL A;  1PH3 A;  2CQO A;  4IPC A;  1I94 Q;  2CCZ A;  3CC2 A;  1TWA H;  4R4I A;  4DR2 L;  1FJG Q;  3UDI A;  3SGI A;  2GVB A;  2R7Z G;  4DV4 L;  1P16 A;  4KI0 A;  1C0A A;  3HOZ H;  3GTG H;  4IO9 A;  1PVO A;  1SFO H;  5EAY A;  4GS3 A;  4WJ4 A;  3GD7 A;  2UXD L;  1HNZ L;  4LF7 Q;  2VQE Q;  4YHH L;  4AQY Q;  4K0K Q;  3KFU A;  5IE8 A;  1I5F A;  1A8V A;  4HIK A;  4DR3 Q;  1ASZ A;  1H95 A;  4JCV E;  3A5Z B;  2BA1 A;  1SLJ A;  4JI2 Q;  1VQM A;  2IX0 A;  3I7F A;  1VQH A;  1YBY A;  5ELO A;  1TWG H;  3PF5 A;  1Q81 C;  4HJ8 A;  1TWF H;  1D8L A;  1A62 A;  1X54 A;  2ZTD A;  4L5Q A;  4HIO A;  4KHP L;  3HKS A;  3E9I A;  4A3G H;  3T1H L;  3E0E A;  3U50 C;  4JBJ A;  2VUM G;  3ULJ A;  4GLA C;  1PFS A;  4B3S L;  1K8A C;  2IT1 A;  2B3G A;  3KDF A;  4UP9 A;  4JBK A;  2KCT A;  3ICE A;  1I94 L;  3G71 A;  4LUO A;  1X9N A;  4NXN L;  4JI8 Q;  4DV7 L;  3H0G H;  1VQ7 A;  1TWH H;  1VQE A;  3M9B A;  1N36 Q;  2HT1 A;  2JA9 A;  3WWV A;  1VQN A;  4GKK L;  2WP8 J;  5JEA G;  2DGY A;  2V1C C;  1XPU A;  2E2J H;  1X3F A;  5M3M H;  4LF8 L;  1G51 A;  5LMN Q;  2EQS A;  1OXU A;  4DV3 Q;  2E5L L;  4A3L H;  2WAQ G;  1VQ6 A;  2CFM A;  1V43 A;  2RHS B;  1UWV A;  3JAM i;  1PV4 A;  2I5H A;  3UDF A;  1JMC A;  4AH6 A;  2VNU D;  4JI1 Q;  4OO1 I;  1CKN B;  1PYB A;  1KRT A;  1J5E L;  4HID A;  2F4V L;  1SMX A;  3F8T A;  3HOV H;  2Q2I A;  1Q1B A;  5IT9 c;  5H1S E;  1QVG A;  3KOJ A;  3UDG A;  3S15 H;  1KRS A;  1Y14 B;  3I4N H;  4BBR H;  3E9H A;  4R1J A;  1WCM H;  3HOY H;  1JT8 A;  2CKZ B;  2IY5 B;  3PGZ A;  3CMA A;  2F4V Q;  3RZD H;  3H15 A;  1E1O A;  2HIX A;  5C0X G;  2MNA A;  1PH6 A;  3HKZ E;  5IP7 G;  3D0F A;  3S17 H;  1PH8 A;  5LMN W;  4P75 A;  3S1Q H;  1S72 A;  4XIG S;  3HOX H;  4A3E G;  5FLM H;  3UE1 A;  3J81 c;  3GTQ H;  1IYJ B;  4UP8 A;  3ER0 A;  4DAY B;  4A3G G;  5IP9 G;  1X65 A;  1CKM A;  2IHF A;  4DR2 Q;  4X66 Q;  3IRB A;  4A3J H;  3KLW A;  1WFQ A;  4IPH A;  1BVS A;  4YWK A;  4A3F H;  4JBM A;  4BA2 I;  3ERS X;  1N36 L;  1GD7 A;  1TWC H;  4P73 A;  4DPG A;  3ULL A;  3CCM A;  2LSS A;  3CCJ A;  3UE0 A;  4JG2 A;  3CPF A;  1JJ2 A;  5FLX c;  1S3O A;  4A93 H;  1E22 A;  1K8G A;  4OXP A;  4BXX H;  4DV5 Q;  2E8G A;  1NTG A;  3GTJ H;  1XMO Q;  1NMF A;  4UP7 A;  1AH9 A;  3AFQ A;  1JJC B;  2Z6K C;  3NEN A;  1UE1 A;  3H3V H;  5HY6 A;  5M5Y H;  4JI6 Q;  4IPG A;  1SRU A;  3J80 c;  5HGQ A;  1NY4 A; 
#chains in the Genus database with same CATH topology
 1S40 A;  1STE A;  2QEX A;  2JEA I;  2SEB D;  4QUF A;  5CV9 A;  3TDQ A;  1VQ4 A;  4A3J G;  3NBI A;  4ULL A;  1ESR A;  3S2D H;  4DUY Q;  3KLS A;  2ZTE A;  2B2T C;  3OTO Q;  4KTA A;  3J80 L;  3PV0 A;  3P75 A;  1Q12 A;  2RF4 A;  3S17 B;  1PZJ D;  3S16 H;  2L55 A;  4DV2 Q;  4OO1 G;  4HJ7 A;  5C0X J;  5DNF A;  4GLV B;  2F03 A;  4BBR B;  1DXM A;  4XYO A;  4B3R L;  3T1H Q;  2KEC A;  2E2H B;  3I4O A;  2ZT9 C;  3MXP A;  5M5X B;  1IBK L;  2PCF B;  2QEJ C;  2HHH L;  5M3M G;  2YTV A;  1SYD A;  4A3D H;  3BDL A;  4PMW A;  2NVX H;  1B53 A;  5C4X H;  5IGG A;  1ZXT A;  2DNE A;  4A3E B;  3LX0 A;  2B2V A;  1WOC A;  1YHQ A;  5E4X A;  4KLK A;  1MI2 A;  3EFX D;  4H44 C;  4RHS A;  4RA8 A;  3M4Q A;  4DV4 Q;  1LTA D;  1CA5 A;  3KJO A;  2IPK D;  4JYA Q;  5M3F H;  2D5D A;  1ZYR D;  5IY0 A;  3KJP A;  4OON A;  1FGU A;  3KF6 B;  2JA6 H;  1RCV D;  1NMG A;  4LAA A;  2PYK A;  4YWM A;  1HNX Q;  2VXW A;  5NUC A;  1U4M A;  3R93 A;  2DNC A;  2X6L A;  1LTL A;  4HMI A;  5KYI A;  3CRL C;  4IUU A;  5ELD A;  1IW7 D;  4Q5V A;  4C2M H;  1ENF A;  4P2C B;  3MEH A;  1X3Q A;  1VF5 C;  2K5N A;  4K2K A;  3VR6 A;  2K5V A;  2VQE L;  3QG1 A;  4V0B A;  3RZO H;  3GP7 A;  4IUV A;  4O2D A;  2Q8I B;  5D65 A;  1V1O A;  4C3I B;  2PO4 A;  1MIU A;  1VQL A;  1Q1E A;  1BXT A;  1GO3 E;  1WTQ A;  4A3F G;  1LV9 A;  3KLS X;  4IQZ A;  2OTL A;  3DM3 A;  3RR5 A;  1GXD C;  2XRS D;  3F2C A;  1A2T A;  1YVC A;  1B1Z A;  1QNK A;  2XN9 C;  3PO3 H;  1NJI C;  1PZI D;  1KNE A;  5GAD C;  1E7Z A;  1EYC A;  2NVT B;  2PI2 A;  2F0L A;  3P7J A;  1HZB A;  2F3I A;  3S1R H;  4OO1 H;  4O42 A;  4BBS H;  3QB3 A;  4IUR A;  4O0A A;  1G91 A;  1N34 Q;  3STB C;  4CHT B;  5AJ3 L;  4DV1 L;  4M8A A;  3FHW A;  2KEN A;  1D5M C;  1JOQ A;  5IYD H;  1S5B D;  2KCN A;  1PH5 A;  2IL8 A;  4IJH A;  4K5X A;  2EXD A;  3HOU B;  2CQA A;  1O7Y A;  1PTO B;  1QZG A;  5IYB G;  3J7A F;  4E6I A;  2JA7 B;  1EEI D;  1NE3 A;  3K0X A;  4I65 A;  2BOS A;  3BZK A;  1SR3 A;  1XNR Q;  3PMF A;  2HCC A;  3KF8 A;  3V05 A;  1IW7 C;  3GQB A;  1YEZ A;  3DWA A;  3E0J A;  1VQO A;  4LF9 L;  3IFD A;  5KNB A;  4OX9 Q;  5A2Q E;  2F0G A;  4A93 G;  4DKA C;  3VR4 A;  4DN4 M;  2UUC Q;  1SAP A;  1D7Q A;  1VQJ A;  4JI3 L;  1W6J A;  2RCF A;  4XQJ A;  2R92 G;  3BU2 A;  5E7N A;  2FIN B;  1CHQ D;  3NP8 A;  4X65 L;  4FVM A;  5CV5 A;  4DAV A;  4Y7N B;  4OWX B;  1ILP A;  2SDF A;  4A3F B;  5C0X H;  1F2Z A;  1GVP A;  5EGT A;  4BY1 G;  1QIL A;  3DXJ C;  1UEB A;  5KGU A;  1YNN D;  1B3A A;  4JI3 Q;  3K7A B;  4UAI A;  3B6Y A;  1L1O B;  3PIP 3;  3Q6S A;  5IP7 H;  1KQS A;  2R93 H;  1CA6 A;  4LK1 C;  3I4N B;  3S15 B;  2RDG A;  1I4H A;  5LMN L;  4LF9 Q;  2F0U A;  3U9S A;  4KKU A;  1HTP A;  2K6A A;  1LT5 D;  3K8A A;  4ZCK A;  4DV2 L;  3K7U C;  4LUV A;  3Q0A A;  3AEV A;  2B39 A;  3LWE A;  4BA1 I;  1J8I A;  2PZW A;  3KBX A;  4DAP A;  2UU9 Q;  4NXN Q;  3I4M H;  2Z1C A;  5C4Z A;  2AQ2 B;  4HJ9 A;  4R8N A;  4Q0F A;  3OTO L;  3FMC A;  2K1B A;  2ZM6 Q;  4CKC A;  1QUQ A;  2A1A A;  4DK3 C;  1TWH B;  4U67 3;  5E3F A;  1LM0 A;  4H02 A;  1K3R A;  3MA2 B;  5CBA E;  3I4M G;  1M8A A;  4JC0 A;  4A75 A;  3H0G G;  1WJJ A;  1CK1 A;  2NUC A;  2M2L A;  1H9S B;  1PFN A;  1BOS A;  1K3B C;  4KKS A;  2KHI A;  3VYT A;  1ZEQ X;  4A3I G;  3CHB D;  1YJW A;  2HUG A;  3BZC A;  2OWO A;  1B2T A;  2MQH A;  4R4Q A;  3PSI A;  4MTK A;  4WFN 3;  2XRQ D;  2BE5 D;  2F4I A;  1KXL A;  3CPW A;  4KKT A;  3TBI B;  2EY2 A;  1PTO F;  3HZX A;  4C56 C;  1GM5 A;  4A3B H;  5C4H A;  4BY1 H;  3CRK C;  4A3K B;  3GTO H;  5BR8 Q;  2N49 A;  4B3S Q;  4LFB Q;  3SVM A;  3PQI A;  1TII D;  3K57 A;  1E3P A;  4DR5 L;  3S1M H;  5JJK A;  4XQQ A;  5M5W H;  1TU2 B;  2R92 H;  1HJP A;  2HD3 A;  4NW2 A;  1TY2 A;  4TQU S;  2DN8 A;  4DV5 L;  2R7D A;  5I9P A;  1LT6 D;  1MD2 D;  2AKW B;  3D8G A;  4L63 B;  2UXB Q;  2CHB D;  1SN8 A;  1QVC A;  5L37 A;  5M9O A;  3FKI H;  4JI7 Q;  1LTT D;  1A3T A;  2R7F A;  3MXN B;  4BY7 H;  1W3S A;  1N33 Q;  1VQ5 A;  2EJF C;  1O7Z A;  4PV1 C;  4CKE A;  4DUZ L;  4C3H B;  2A69 D;  1CFM A;  3M3Y H;  4JYA L;  2JYO A;  2Y0S G;  3CD6 A;  4DF7 A;  1I50 H;  1KTK A;  2MUY A;  5JEA H;  1PTO C;  2YU9 B;  1PZK D;  2VB2 X;  4DU9 A;  1SJE D;  3HKZ G;  1CSP A;  1WI5 A;  3J81 E;  4IN3 A;  2HHH Q;  2YTY A;  3HOU G;  2NZO A;  1I6H H;  1CTM A;  5CGK A;  4AIM A;  5IYC H;  2F0P A;  4P71 A;  1Y1V G;  1I3Q H;  1STN A;  4A3I B;  4LF8 Q;  4A3C G;  3S1M B;  4A3K G;  3W1B A;  1L0X B;  2F52 A;  3ERQ A;  3TP5 A;  3VR2 A;  5KIX A;  4JI4 L;  3GO5 A;  1I94 Q;  3MHB A;  1LYL A;  4RGT A;  1PH3 A;  2CCZ A;  3CC2 A;  2OXP A;  4R4I A;  2G5D A;  3SGI A;  4A3B B;  3A8I E;  1P16 A;  1JQY D;  3NXW A;  3GTL B;  3HOZ H;  3GTG H;  3LNN A;  5EAY A;  4WJ4 A;  2UXD L;  2TSS A;  2JP1 A;  4LF7 Q;  3KFU A;  5I9O A;  1A8V A;  2EYH A;  1VF7 A;  3UI2 A;  2V4D A;  2BH2 A;  1SNP A;  4X3K A;  1TWG H;  1MGS A;  3KLR A;  2ZTD A;  2OEO A;  2B2Y A;  4H13 C;  5FO9 B;  3HKS A;  1PRT C;  3OIQ A;  3E0E A;  3U50 C;  3ULJ A;  4GLA C;  5I2X A;  4B3S L;  4DNR B;  1B9N A;  3G71 A;  1KDA A;  3VA7 A;  3TP6 A;  5EKK A;  4FO2 A;  4GKK L;  2F0E A;  3A55 A;  5JEA G;  2E2I B;  1X3F A;  5T1I A;  1G51 A;  2EQS A;  4DV3 Q;  4RHR A;  4DXF A;  1AZQ A;  4KMU C;  1V43 A;  1DJR D;  4AH6 A;  2VNU D;  4JI1 Q;  1PYB A;  1EEF D;  2NN6 H;  4OEM B;  3HOV H;  1LAB A;  1QVG A;  3OSO A;  3U9O A;  3I4N H;  3NWT A;  3CU7 A;  1NCV A;  2R93 B;  3AB9 A;  3N6R A;  1KDB A;  2CKZ B;  3PGZ A;  3CMA A;  2EPB A;  2HIX A;  5DAU A;  3D4D A;  4ME5 A;  4FNF A;  1Q3L A;  3HOX H;  5FLM H;  1S5F D;  3GTQ H;  4A3G G;  4DAY B;  1I6V C;  1Y1V B;  5IP9 G;  1PMR A;  4IPH A;  4BA2 I;  1OO9 B;  3GV3 A;  3ERS X;  1FNU A;  1STB A;  4U68 A;  3MAQ A;  2RVL A;  3CCM A;  2NBF A;  1F2L A;  1LLR D;  1JJ2 A;  2DJG C;  1K8G A;  4X3T A;  3DUZ A;  1XMO Q;  1NMF A;  1JCK B;  3AFQ A;  1JJC B;  4RWS C;  1UE1 A;  5A35 A;  1SE3 A;  2A6H C;  3KK7 A;  2O5I C;  3NWS A;  2JA5 H;  3I2Z A;  3TRE A;  2HQE A;  1HNZ Q;  2WKC A;  3E5S A;  1XYI A;  3NBH B;  1EL0 A;  2F3W A;  1MSG A;  5COR A;  3K5O A;  3JAM L;  4MTN A;  1XNQ Q;  5K36 G;  3HOU H;  4LMQ D;  1STG A;  2L4N A;  5CV7 A;  4LF5 L;  1HCZ A;  4R9W A;  1WCM B;  4JI5 Q;  1N33 L;  5KND A;  3HOV G;  1BR9 A;  2NN6 G;  1EZ6 A;  5IYD G;  1U4R A;  3FPP A;  1WTV A;  1H9J A;  4IAL A;  4S3S A;  3HOW B;  2KVM A;  2K5Q A;  1O7L A;  1XNR L;  1EWC A;  1V1P B;  1VQ8 A;  1VQI A;  5ELC A;  4PNY A;  1DCZ A;  1HHV A;  3T53 B;  3SK6 A;  2GVA A;  3QIA A;  2A5H A;  2JQO A;  2EIF A;  1YZ6 A;  3G4S A;  1X6O A;  1Y1W B;  5C3X A;  1HR0 W;  3C3L A;  2H5X A;  3OWF A;  4WOR A;  3R2T A;  2PMZ B;  5ELE A;  1EIG A;  3J81 L;  1YI2 A;  2PZT A;  1Q46 A;  4A3G B;  5EPJ A;  1SYB A;  3TS0 A;  3F2D A;  1S5D D;  4B08 A;  1TWG B;  1MKH A;  3RZO B;  1CQF A;  4APV A;  5D3D A;  3M4P A;  4CBV A;  3L3O C;  3SE0 A;  1NBW A;  5EJW A;  4C2M B;  2VY3 A;  1KHI A;  4RGN A;  2NTS A;  1TQO A;  3HOZ B;  3K6O A;  1OXT A;  4HSV A;  2B2Y C;  2OF1 A;  1B9M A;  2P5Z X;  5G3L D;  1WTW A;  2OQ0 A;  3MWY W;  4H0L C;  1HZ9 A;  2EYO A;  3EBE A;  5FLM G;  2F0J A;  3PIO 3;  2H4O A;  4MZ9 A;  4YCV A;  5F2D A;  4G4K A;  2ZM6 L;  4ODG A;  5M3F B;  4ZYS A;  1KC8 C;  1BBX C;  1PH7 A;  2UU9 L;  3GTK H;  2MFI A;  2LXK A;  4DR4 Q;  3KDF B;  2ZJR A;  3SK8 A;  1W6K A;  4K5V A;  4A3E H;  2PQA A;  3BVZ A;  1DGS A;  3Q23 A;  5C4J B;  5EQ0 A;  2FXQ A;  4A3D B;  5C4X G;  1HZC A;  1VQA A;  2L9H A;  2QDB A;  5AFW A;  5M5X H;  1JC7 A;  1EFW A;  3KBG A;  3DEO A;  1N9W A;  1XTD A;  2WB1 E;  1UNS A;  2ICI A;  3D3R A;  3M3Y B;  1DM0 B;  4PG3 A;  4CJ0 B;  1II3 A;  3F1Z A;  5KRU A;  2LMC B;  1TVX A;  4DR7 L;  1TT2 A;  1QCB D;  5GQO A;  1YHB A;  1TXY A;  3FKI B;  3QOJ A;  3VR3 A;  4NXM Q;  1B3Q A;  1Y1W G;  2R93 G;  3G6J B;  4QUC A;  2AUJ D;  3DM1 A;  2Z0S A;  1SJH D;  2F0H A;  1CT1 D;  5LMU L;  2UUC L;  3E3X A;  2RDH A;  3D31 A;  4GZY C;  4L5R C;  3J7Z C;  4XT3 B;  1BBW A;  1V9P A;  4IFD G;  5KNC A;  2D2C C;  4IFD J;  1RTN A;  4HMJ A;  2RA4 A;  4F8M A;  4UY8 C;  1HUM A;  1K73 C;  4A93 B;  3NQT A;  2VQF Q;  1JB3 A;  3OW2 A;  3GTO B;  1LTB D;  1B4O A;  2ZXO A;  4A3K H;  2DY8 A;  3U4V A;  1BCP B;  3A56 A;  4C3J H;  4OIK A;  1HZA A;  2F0O A;  1BNZ A;  4IJL A;  1HFN A;  5IYC G;  1FYC A;  3MZ5 A;  3NPP A;  5JVH 3;  4ME3 A;  3S1N B;  4RCO A;  3EIV A;  3F2B A;  1KAW A;  5AJ3 Q;  2A73 B;  4DV1 Q;  3NEM A;  1CHP D;  1SEB D;  3K5L A;  4J1M A;  3S14 B;  4OWW B;  1N34 L;  1AZP A;  3JAM c;  3CKI B;  1V1P A;  3Q8D A;  1KD1 C;  4GN3 B;  5D3I B;  3MC0 B;  1ENA A;  1T5E A;  3CXC A;  1R4P B;  5FO7 B;  3RLN A;  4K8I A;  1B7Y B;  4RKB A;  1K9M C;  2F1M A;  3RNU A;  3OIP A;  4YY3 Q;  1R4Q B;  1WTH A;  1LT3 D;  4CGY B;  2HIV A;  2JN4 A;  4A4I A;  2D0P A;  4GKJ Q;  3CCQ A;  4DV0 L;  1EIH A;  2AHO B;  2O4X A;  4JVZ A;  1S4Z A;  2KUM A;  1B44 D;  3HOW G;  3P20 A;  1A3V A;  4KHV A;  2F0N A;  3VA5 A;  2YV5 A;  2EY1 A;  2ZXP A;  3A7A B;  1HUN A;  3H6M A;  5FOB B;  2QF7 A;  1PH4 A;  2E2D C;  1EWH A;  2I5L X;  2PW7 A;  3OWE B;  5E1F A;  2X6G A;  1TWF B;  2B2T A;  4KJN A;  3K7A H;  2A74 C;  5HGT A;  1EY7 A;  4A3M G;  2E5L Q;  1WYD A;  3PO2 H;  2I07 B;  4DNI A;  2XNA C;  1HNX L;  4A3B G;  1L0Y B;  4JI4 Q;  4Y7N H;  1I4P A;  1A0I A;  3AYH B;  1V1Q A;  5BN5 A;  3J7A V;  2B63 H;  3CCL A;  1F2M A;  3NK9 A;  3RN2 A;  1L2F A;  1X3G A;  1X3P A;  2FJ2 A;  3NEL A;  3V2T A;  5FO8 B;  1ICW A;  2LFN A;  5CMD A;  4FP5 D;  4KHP Q;  4EQ5 A;  5JJL A;  1IYV A;  3AMU A;  1CQV A;  1GOZ A;  4LFC Q;  2EDG A;  4DR3 L;  1YJ9 A;  3M4O B;  1G2T A;  2KCC A;  1SYE A;  1RD9 D;  1EYA A;  2BE5 C;  3PO2 G;  4IFD H;  5IYB H;  1Y69 U;  4B3R Q;  2UUB L;  1SSO A;  4TRD A;  1FJG L;  4PQX A;  5JOB A;  2A6E C;  5BN4 A;  3G6E A;  1EQR A;  1HXY D;  4GOP B;  4DUZ Q;  1K0R A;  4OHJ A;  2PZU A;  4A3D G;  4QF4 A;  3FPU B;  1D6E C;  4QY7 A;  3M85 A;  1JOR A;  4RG1 A;  3BYY B;  4DR7 Q;  1GUG A;  2EYJ A;  3NQI A;  4DA2 A;  4AYB G;  5FJ8 H;  1ASY A;  3FEW X;  2Y0S B;  1K28 A;  2Z4H A;  3A54 A;  2GN5 A;  1EYD A;  3DLL A;  1GHJ A;  1MBY A;  1JIC A;  4WJW A;  2K5W A;  1X3E A;  4K6L A;  2JA7 G;  2NN6 I;  4JI6 L;  2HDM A;  1PLF A;  3EA6 A;  4DR5 Q;  1FR3 A;  2WII B;  1HR0 L;  1L1O C;  5TSS A;  3M4O H;  1E0B A;  3ZYY X;  1C8C A;  4O1N A;  1MSH A;  4C3I H;  1STY A;  1FL0 A;  2N55 A;  1CM9 A;  2N8N A;  3A74 A;  4X64 Q;  4DR4 L;  1E2V A;  2F0I A;  2J4X A;  2NVY H;  2CQO A;  1TWA H;  4G7O C;  3UDI A;  3NBH A;  1ET6 A;  3FDT A;  3TZU A;  1HRJ A;  3T13 A;  1C0A A;  1SFO H;  4G7H C;  4C1N I;  1XTC D;  2G9H D;  2SNS A;  4AQY Q;  4FXD A;  3Q22 A;  3PO2 B;  3BDC A;  1I5F A;  1H95 A;  4JCV E;  2BA1 A;  1SLJ A;  3DHQ A;  3FVQ A;  4CJ2 C;  1VQH A;  5ELO A;  3PF5 A;  2RKS A;  4HJ8 A;  3E6Z X;  1NNX A;  3E9I A;  2X69 A;  1S5E D;  4JBJ A;  4C1N K;  2IT1 A;  2B3G A;  4UP9 A;  5JPM C;  1R9T B;  4JBK A;  5IGF A;  4IUT A;  5IIF A;  4LUO A;  1SYF A;  1H9R A;  4NXN L;  1VQ7 A;  2KED A;  1VQE A;  2HT1 A;  4DAY A;  3WWV A;  5I2Y A;  5IGC A;  2WP8 J;  4RCN A;  4ZRZ A;  2V1C C;  1XPU A;  2E2J H;  5M3M H;  5LMN Q;  4N9T A;  2NVX B;  3MXN A;  2RHS B;  3JAM i;  1PV4 A;  2I5H A;  4OO1 I;  2J7Z A;  1J9O A;  1KRT A;  4HID A;  1SMX A;  1VMP A;  3F8T A;  2Q2I A;  1EZ8 A;  1HA6 A;  1GJX A;  4IZ8 A;  3MFG A;  1TS3 A;  5E4W C;  3KOJ A;  4NMZ A;  1SE2 A;  5EKL A;  2MHV A;  1SYG A;  4BBR H;  4IUQ A;  4R1J A;  2CVR A;  2BCO A;  1JT8 A;  1YNJ D;  3RZD H;  3H15 A;  2F4V Q;  5C0X G;  3S17 H;  1PH8 A;  1S72 A;  3UE1 A;  5BN3 A;  2Z8L A;  3J81 c;  1F9P A;  2IHF A;  1CKM A;  4A3J H;  3IRB A;  3KLW A;  1WFQ A;  2M9V A;  1BVS A;  3IL8 A;  2EJG C;  1N36 L;  1PRT F;  3M4Y A;  3MTS A;  2LSS A;  4FXG C;  1Y8N B;  1Z7T A;  3UE0 A;  4JG2 A;  4UDU C;  1GUO A;  4OXP A;  2WIN B;  4ZLT F;  2E8G A;  1NTG A;  1EY6 A;  3NEN A;  2F0T A;  4KJO A;  2R7Z H;  4IPG A;  4KD4 A;  1SRU A;  5HGQ A;  5C44 H;  3I73 A;  1SNO A;  3BDO A;  1HA5 A;  4F7X A;  3JAM E;  5C3E H;  1QNU A;  1C7Y A;  1N32 L;  5C5L A;  4LF6 Q;  2J0T D;  4HR7 B;  5M3F G;  4B3M L;  4YWL A;  3HEJ A;  3KF6 A;  4PZ6 A;  2B29 A;  4A3J B;  4LUZ A;  2TMP A;  1QUQ B;  1PA6 A;  4V19 0;  3S1Q B;  4KN4 C;  3W3A A;  1N8R C;  3EVQ A;  4FDB A;  4DR6 Q;  5IGB A;  4EX5 A;  3W5O A;  1GUW A;  3CCR A;  1HPC A;  1QE6 A;  5DM7 3;  4C3H G;  2MP1 A;  1GHK A;  3M7N A;  3NTK A;  1EU3 A;  1QVF A;  2EJM A;  4L5T A;  1WVL A;  4IFD I;  4MNO A;  1VDZ A;  1WCM G;  4H7B A;  4R4T A;  1XMQ L;  4PMC A;  1IBM L;  1D1K A;  4LWC A;  3O13 A;  2EY6 A;  1LTS D;  1L1O A;  3CP0 A;  1P8L A;  2LKV A;  4CKB A;  2YYZ A;  5C4J H;  4JPB W;  3R3O A;  5JVG 3;  1OXV A;  4AQY L;  1DD2 A;  5DM6 3;  5M3M B;  2E2J B;  1VQG A;  1T5X D;  1XPO A;  3GTK B;  3EQL C;  1JE4 A;  5C6A A;  4QIW E;  5JEA J;  2EVB A;  4EGV A;  4IPD A;  1R9T H;  2NTT A;  1X55 A;  2PNR C;  1Q90 A;  1B70 B;  1SMY C;  2OT2 A;  3M7G A;  1QJO A;  1STH A;  1CZG A;  4HJA A;  2PPB C;  4XDX A;  4KK7 A;  3J7A 5;  2BDN A;  2MJ8 A;  2WB1 G;  1SFO B;  2JA5 G;  3C1E A;  4GNX C;  2I0Q A;  3C46 A;  5JAV A;  2QA4 A;  2F3V A;  1ZYR C;  4DV6 Q;  1O78 A;  1DOK A;  1BBU A;  1D2B A;  3Q24 A;  4BXX G;  3TN2 A;  3HOZ G;  4K2L A;  2LXJ A;  4L8J A;  4Y52 H;  2RDF A;  1VCI A;  4NPS A;  2QIL A;  1LTR D;  1Q8K A;  5IT9 E;  1Y1W H;  4HJ5 A;  1F9R A;  3MXG A;  3QO2 A;  1IBK Q;  2MO1 A;  4TVA B;  2KOL A;  1Q7Y C;  3T56 B;  1F77 A;  1IL8 A;  5FJ8 G;  3MXU A;  1G2S A;  4ZQ3 A;  5LMU Q;  1C9O A;  1CKN A;  1PDQ A;  1FGB D;  4X3U A;  3HOW H;  3T1Y Q;  1YNJ C;  4X62 L;  2SNM A;  3S9W A;  1YIJ A;  3NUC A;  4QGU A;  2EOT A;  1Q8I A;  4MIU A;  4LFC L;  5ISR A;  1HTL D;  1RIP A;  1AFP A;  3BJU A;  3GDE A;  5GAH C;  2VS1 A;  2Z4I A;  3CCS A;  4A3L G;  2ZXR A;  3RD4 A;  2VUM H;  4DV6 L;  2JA8 H;  1O7I A;  3PUW A;  4KY7 A;  1W2B A;  2E76 C;  4POG A;  3D4W A;  3R8B A;  1EWI A;  3MFY A;  4A3M B;  3S2H B;  2RQX A;  1CSQ A;  2EY5 A;  2AQ1 B;  2ATW A;  2IJ0 A;  1VS0 A;  1A63 A;  1UUP A;  3RN5 A;  2JA5 B;  3PUZ A;  4AYB E;  2UXB L;  3HG9 A;  3GTP B;  5M5Y B;  4NDX A;  4ALP A;  1UEA B;  2Q2T A;  3TME A;  3UDX A;  4LW1 A;  4CDE C;  3GTJ B;  4B9X A;  1PH1 A;  3PIO A;  3G48 A;  1IHZ A;  2BA0 A;  2HDL A;  5IWA Q;  1TWC B;  4ZUI A;  2Z6B A;  2ZJQ A;  2WAQ E;  2K50 A;  3CME A;  2H1E A;  3U58 A;  1K8M A;  5BR8 L;  1A3U A;  1VMC A;  3GTQ B;  2FHT A;  1ILQ A;  2JXM B;  3HOX B;  1IBL L;  4BBR G;  4RMF A;  2XGT A;  4GKJ L;  1EQQ A;  5GAG C;  1XMQ Q;  2PI2 E;  5HUR A;  5DLQ E;  2F0D A;  4YY3 L;  4XXE A;  1LUZ A;  4EQN A;  1H9M A;  3BS1 A;  1Z6H A;  1U5K A;  2ES2 A;  2PQA B;  2N78 A;  2ZTC A;  4HSP A;  1EUJ A;  3TP8 A;  4CDC C;  3GTM H;  1VQ9 A;  4NB3 A;  1SNM A;  3NTH A;  1RTO A;  5CBE E;  2Z6K A;  1Q82 C;  3STB D;  3EN2 A;  1AH9 A;  3A5U A;  1KLG D;  4LF4 Q;  2JJQ A;  4FYD A;  3KYH C;  1DOM A;  1WD1 A;  3CQZ B;  2KEE A;  2CW0 D;  1LTI D;  2DY7 A;  4QIW B;  5JJZ A;  1HQR D;  2F0W A;  2PQE A;  3IFT A;  2L11 A;  4JI2 L;  1U0L A;  4K0K L;  2HCI A;  2VB3 X;  1BKB A;  1QZH A;  1J5E Q;  3CCE A;  2ALY B;  1TKW B;  4LNQ A;  3S14 H;  1KAA A;  4YCW A;  4CDF C;  2PNH A;  2YTX A;  1SE8 A;  1PH9 A;  4ZK9 B;  2MO0 A;  2NWG A;  4XYQ A;  2AQ3 B;  3S1N H;  1Z47 A;  1Y8P B;  1G6Z A;  4DR1 Q;  1EYG A;  2MPM A;  1DYQ A;  1YJN A;  2UUA Q;  2L0C A;  4K8J A;  1SNC A;  1MHW C;  1XNQ L;  3GTG B;  4DNT B;  5LHY 1;  2GA4 B;  3AFP A;  3FP9 A;  4NXM L;  2JK8 A;  4C3J B;  1ICF B;  1J6Q A;  1CZW A;  1IXR A;  2R61 A;  1RHP A;  3RLF A;  1BCP F;  1JWM D;  2K14 A;  3U4Z A;  1EY8 A;  3PIP A;  4LJZ C;  3SDZ A;  4CDD C;  4FF1 A;  5CC4 A;  1HNW Q;  5C0X I;  5IP9 H;  4KHZ A;  4N8X 1;  4P72 A;  2Y0S E;  1JWS D;  2KHJ A;  1F9Q A;  3CAM A;  4YHH Q;  3HOX G;  1JWU D;  1KL9 A;  1PHJ A;  1DZ1 A;  1XMO L;  1XPR A;  1VQP A;  1NAP A;  1HQM C;  2DUD A;  4JBW A;  5IOC A;  4QL5 A;  2K28 A;  3L0O A;  2F0K A;  4IOC A;  1AEX A;  4HAE A;  1SNQ A;  4ZAI A;  1IL2 A;  1M1K C;  2ENB A;  4TKO B;  4G57 A;  3K81 C;  5FLX L;  2WAQ B;  2EYM A;  1ROD A;  2D62 A;  4FF3 A;  3I4L A;  4ID6 A;  4BS9 A;  3PF4 A;  5LL6 S;  3I90 A;  4JOI C;  1WTX A;  2WAC A;  3HS0 C;  3IAY A;  2B2U A;  2A19 A;  5FK9 C;  5IGE A;  5GAE C;  1Q86 C;  2F0V A;  3RMH A;  1XWE A;  4BY7 B;  3J80 i;  3ITP A;  2F0M A;  4JV5 L;  1Y8O B;  3ZJY C;  1RJT A;  4OEL B;  4JV5 Q;  1ML0 D;  4EQO A;  4QJF A;  1BCP C;  1K83 B;  5K36 H;  3H94 A;  2C9O A;  3FRP B;  3J7Y W;  1SDF A;  4DGZ A;  1Z9F A;  3R2I A;  1L0W A;  1YIT A;  3TQY A;  1K0S A;  1EY9 A;  1PYW D;  4XQN A;  1IZ6 A;  1TS4 A;  2B63 G;  3V96 A;  4X64 L;  3VYR A;  4C3J G;  4HIM A;  3GV6 A;  1IKM A;  1MJC A;  2OCE A;  2NZH A;  3C1F A;  2K03 A;  4DR2 L;  2GVB A;  4BY1 B;  1HFG A;  2Q8T A;  1G8Z D;  4IO9 A;  1PVO A;  4GS3 A;  1PFB A;  3NTI A;  3T16 A;  3ONA B;  5FKA C;  3ND9 A;  2VQE Q;  3QR8 A;  4YHH L;  4IUP A;  2XWB B;  3A5Z B;  2IX0 A;  3I7F A;  1Q81 C;  4HIO A;  4L5Q A;  1D8L A;  1A62 A;  1X54 A;  3TSS A;  2AUK A;  1WTP A;  1A15 A;  1NR4 A;  3K0Y A;  4A3G H;  3J80 E;  2QKI C;  4MHE A;  2NB0 A;  3KDF A;  3NE5 B;  1I94 L;  1B50 A;  4DXG A;  4UHV A;  2D9U A;  1X9N A;  3H0G H;  1TWH H;  1N36 Q;  2JA9 A;  4DK1 A;  1VQN A;  4QCL A;  2DGY A;  2FMC A;  1ESF A;  4LF8 L;  4A3L H;  1EFI D;  2WAQ G;  1VQ6 A;  4BWG B;  3I4M B;  3OMC A;  3P1H A;  1UWV A;  1AP0 A;  2JSO A;  1BCP D;  4QB4 A;  4DK0 A;  4R8I A;  1J5E L;  2F4V L;  3HP3 A;  1TS2 A;  1BDO A;  5IT9 c;  2Z9H A;  5H1S E;  2QDL A;  2ICE C;  3S15 H;  3DEP A;  3E9H A;  2A6H D;  1WCM H;  5CV4 A;  3NHH A;  3HOY H;  1E1O A;  5IP7 G;  5LMN W;  4P75 A;  2SOB A;  3ER0 A;  2K01 A;  4OIJ A;  1X65 A;  4DR2 Q;  1SND A;  5EPL A;  3T4A C;  4WRD A;  4A3F H;  4JW0 A;  4JBM A;  1GD7 A;  1KDC A;  2WB1 B;  1TWC H;  3ULL A;  2FMM A;  2K7V A;  2B2W C;  4BXX H;  4DV5 Q;  3GTJ H;  4UP7 A;  4ILW A;  3H3V H;  5M5Y H;  4A76 A;  5FLX E;  1G6P A;  1CI3 M;  2VZA A;  3W1G A;  3CCV A;  1KIX A;  1KNA A;  1NR2 A;  3WOE A;  4LFB L;  4A3C H;  1PRT D;  3S2H H;  3TRZ A;  2ID0 A;  1F2Y A;  1OTC A;  1Y1V H;  1MJE A;  3JC6 6;  1PFM A;  4L5S A;  1AE2 A;  4HTH A;  4EVO A;  3ND8 A;  4DV0 Q;  1PTO H;  1EIY B;  1U4L A;  4JOI A;  2VUM B;  1XXG A;  3K5M A;  4DAM A;  3SR1 A;  1VQK A;  4TSS A;  5IOD A;  4OWT B;  4GKK Q;  1PXU A;  2B2U C;  1BQQ T;  3HOY B;  1CUK A;  1HH2 P;  4IOA A;  1NUC A;  2N88 A;  3CW2 C;  2D0O A;  5COY A;  5ELF A;  3TZD A;  3K58 A;  3HKZ B;  4HN7 A;  2I5M X;  3HOV B;  5K5P A;  4RKL A;  1XJV A;  2NYZ D;  1JR0 D;  1M4V A;  3S1R B;  2BH8 A;  1BO0 A;  2MGS A;  4AYB B;  3A8K E;  2K33 A;  1HNW L;  3D4R A;  2E2I H;  2L15 A;  1A2U A;  4F87 A;  2ZJP A;  3H0G B;  3RUZ A;  2BDO A;  2KCM A;  1I4X A;  3CC4 A;  3CF5 A;  1I4Q A;  2A68 C;  2L5T A;  2VQF L;  3EJI A;  4CJ1 B;  2CWA A;  5J1Z A;  2C5C A;  4JI8 L;  4DV7 Q;  3T1Y L;  4DR1 L;  2UUA L;  3QOL A;  4NP5 A;  3X3N A;  2A8V A;  1VQB A;  2Q8R E;  2UUB Q;  1EU4 A;  4N9P A;  2XTI A;  2RSN A;  3I70 A;  1E2W A;  2QW7 A;  5C3E G;  2Q2U A;  4J15 A;  3URY A;  5C44 G;  3GTL H;  1JOK A;  3PUV A;  3T51 B;  1STA A;  3OOC A;  1WTR A;  3TEH B;  1I4R A;  2WKD A;  4OGQ C;  4QQB X;  4J6H A;  4EQP A;  2JE6 I;  1D1I A;  1TR5 A;  1UE7 A;  2JA6 B;  3HGB A;  4Z9C B;  3HFZ B;  1I3Q B;  4A3I H;  1B8A A;  4J8Q A;  5CYU A;  3HOY G;  2RBM A;  4LF4 L;  1I6H B;  3S24 A;  1K83 H;  2EZV A;  5G3L F;  2A68 D;  2M00 A;  4JI7 L;  2FFK B;  1UE6 A;  5JJI A;  5J22 A;  3J81 j;  4QMG A;  1WD0 A;  2B8G A;  4ZUJ A;  2YU9 H;  1SMY D;  1TS5 A;  2K75 A;  3IKJ A;  5C3W A;  1SXT A;  1H9K A;  4KD3 A;  1I50 B;  5EBD A;  1PRT B;  2E2H H;  5J39 A;  3I3C A;  1IBL Q;  1PH2 A;  3BVM A;  3L9A X;  3K80 C;  4C3H H;  3X3M A;  2IX1 A;  3AQQ A;  3FKI G;  4G7Z C;  4JI0 Q;  4FF2 A;  5A2Q L;  5IWA L;  4LFA Q;  2R3Z A;  1T9H A;  2ASB A;  1ONL A;  4DK6 C;  2G9D A;  2B2W A;  1QB5 D;  4FXK C;  1FNW A;  1M90 C;  2KQ3 A;  3S2D B;  1VQF A;  1U9R A;  1JOO A;  3I56 A;  5CV8 A;  3N52 A;  4GN4 B;  4GN5 A;  1PYS B;  2AWO A;  4B3T L;  5C3E B;  5KYL A;  2R92 B;  2RCN A;  5C44 B;  2Q2H A;  5M5W B;  4IUN A;  4L6T B;  4XT1 B;  2R7Z B;  1IKL A;  3KF8 B;  1SRO A;  2VL6 A;  1EIF A;  3SK4 A;  1GUS A;  1EOT A;  1G29 1;  4DR6 L;  3PUX A;  3TS2 A;  3DMU A;  3QWN A;  5DEH A;  4DFA A;  3I91 A;  4UPA A;  2IW3 A;  1E2Z A;  1TY0 A;  2IHE A;  2OQK A;  1UE5 A;  5I4D A;  2L1B A;  3RLO A;  3H09 A;  2XWJ B;  5J3B A;  4B3M Q;  3F2U A;  4PZ7 A;  4LF6 L;  1BF4 A;  2XVS A;  4K14 A;  3W2D A;  4ZKC B;  1VQC A;  4FF4 A;  4C3I G;  3I4N G;  5IT9 L;  2F0F A;  3A0J A;  4X62 Q;  3RZD B;  1S5C D;  2N3S A;  5KEE A;  4HCS A;  2O2L D;  2JA8 G;  3BZD B;  1SBB B;  4KN7 C;  2XIW A;  5GRO A;  1X56 A;  1E24 A;  1FNV A;  2K05 A;  2KHS A;  4JI5 L;  3ERO A;  1IYU A;  4LF5 Q;  1YNX A;  2CH4 A;  4X6A H;  3C2P A;  3OMG A;  2LS0 1;  2NVQ H;  4GNX B;  2UXC L;  3K59 A;  2K5H A;  3OYY A;  3LGJ A;  1CKO A;  3CQZ H;  1GUT A;  4BY7 G;  5JPN C;  1OXS C;  1QG7 A;  3WOF A;  4BBS G;  4R4O A;  2HQL A;  1AW7 A;  5CR3 A;  5ELN A;  3GTM B;  3PUY A;  2E75 C;  2EE1 A;  4X65 Q;  2KBN A;  2I46 A;  3PO3 G;  1SYC A;  2UXC Q;  1D5X C;  1OXX K;  1DON A;  2R6G A;  3OW7 A;  1RL2 A;  3L7Z C;  3H3V C;  2EYL A;  2K04 A;  2VW9 A;  1GKH A;  2K52 A;  3PCO B;  2A69 C;  4OX9 L;  1H9S A;  4RAU C;  2K32 A;  4RGO S;  1LAC A;  1JJG A;  4R4C A;  4PZ8 A;  2PMZ E;  2LY7 A;  3VDY A;  4JK1 C;  1AE3 A;  4I7A A;  1TWA B;  4OL7 A;  3BVG A;  2AMC B;  2C35 B;  3BYT B;  2NVY B;  3KUP A;  4K6D A;  4GOP A;  4DUY L;  4ABN A;  1QWY A;  2IX3 A;  3BG3 A;  2CWP A;  4GOP C;  2RHQ B;  3GTP H;  2AWN A;  4F88 A;  1VQD A;  2QGQ A;  3I55 A;  1A6X A;  4HCE A;  3SXH A;  3VR5 A;  3L2P A;  1NSN S;  2JA6 G;  1E1T A;  3VYU A;  4KY5 A;  1IBM Q;  4JI1 L;  4A3M H;  1F9S A;  4KV6 A;  4YCU A;  4DV3 L;  2JA8 B;  4B3T Q;  1JE5 A;  4N8F A;  5D14 A;  2JA7 H;  2K4K A;  1LO5 D;  1EY4 A;  2WV6 D;  1YHA A;  4YIJ A;  5EKI A;  3CCU A;  2XSC A;  1FVI A;  4POF A;  4X66 L;  3HRZ C;  4RFB A;  4RGM A;  4GLX A;  3D6W A;  1JB7 A;  3QJY A;  4LFA L;  2QCP X;  3J81 i;  3H91 A;  4XTC S;  1XX8 A;  1HR0 Q;  5C5M A;  4JI0 L;  1QOH A;  4BBS B;  1U4P A;  4GNX A;  1KAB A;  4P74 A;  1N32 Q;  2NVT H;  4WJ3 M;  3D6C A;  2IWH A;  3CC7 A;  1EY5 A;  1EQT A;  1EQV A;  2A6E D;  3PO3 B;  4LF7 L;  2UXD Q;  3H3V I;  1C48 A;  2DJF C;  2OTJ A;  2O5J C;  2CH4 W;  3TP7 A;  1ENC A;  2B2V C;  2JEB I;  1D5Z C;  3ULP A;  2WFW A;  5IGD A;  1EOV A;  3MEF A;  4IPC A;  2NZ1 D;  1ET9 A;  1LT4 D;  1FJG Q;  5I6Y A;  2R7Z G;  4DV4 L;  2B63 B;  4KI0 A;  2EYF A;  3AU7 A;  3DWQ A;  3GD7 A;  1YNN C;  1HNZ L;  4K0K Q;  5IE8 A;  1K8O A;  4HIK A;  4DR3 Q;  1ASZ A;  1UAP A;  4JI2 Q;  4HED A;  1VQM A;  4I7Z C;  1YBY A;  1TWF H;  3OPO A;  3I72 A;  4KHP L;  3T1H L;  2CW0 C;  2VUM G;  4MN3 A;  1PFS A;  1RF2 D;  1K8A C;  2F0Q A;  2KCT A;  3WDN A;  3ICE A;  2KA7 A;  2L12 A;  5T1G A;  3SEB A;  4M1U B;  4JI8 Q;  4DV7 L;  1WTO A;  5I6W A;  1I4G A;  3DWP A;  3M9B A;  3SK5 A;  2EXZ A;  3OHX C;  5C4X B;  1PTO D;  2B8F A;  1GUN A;  1OXU A;  2E5L L;  1FD7 D;  2CFM A;  3A7L A;  1ZKO A;  1JMC A;  3UDF A;  2NVQ B;  1CKN B;  4KY6 A;  1Q1B A;  1AN8 A;  5EPK A;  3UDG A;  1KRS A;  1Y14 B;  4ZKB B;  2EYP A;  1KLU D;  3G7L A;  1EY0 A;  5EBC A;  5CV6 A;  4B9W A;  4PMB A;  2IY5 B;  3VYS A;  4K5W A;  1LTG D;  2RSO A;  2MNA A;  1PH6 A;  3HKZ E;  3S16 B;  3D0F A;  3S1Q H;  4X3S A;  3K5N A;  4XIG S;  4A3E G;  1IYJ B;  4UP8 A;  3MVV A;  4NKL A;  1C4Q A;  4X66 Q;  1DOL A;  3SHL A;  4YWK A;  1X32 A;  1RDP D;  1SE4 A;  1RKN A;  1O80 A;  3A8J E;  4P73 A;  1V8Q A;  3NSW A;  5ELB A;  4DPG A;  3CCJ A;  2E74 C;  3CPF A;  2KJX A;  4RH6 A;  5FLX c;  1S3O A;  4A93 H;  1E22 A;  3I8Z A;  3LWU A;  5LL6 X;  2F0S A;  2Z6K C;  2PW5 A;  1BUV T;  5HY6 A;  4JI6 Q;  2K5D A;  3J80 c;  1NY4 A; 
#chains in the Genus database with same CATH homology
 5C44 H;  1G6P A;  1S40 A;  2JA5 H;  2QEX A;  5C3E H;  2VZA A;  2JEA I;  1VQ4 A;  3W1G A;  3I2Z A;  3CCV A;  1KIX A;  1C7Y A;  4LF6 Q;  1N32 L;  4A3J G;  3TRE A;  5M3F G;  4B3M L;  4YWL A;  1HNZ Q;  3S2D H;  3KF6 A;  4LFB L;  4A3C H;  4DUY Q;  4PZ6 A;  3S2H H;  2B29 A;  3NBH B;  3TRZ A;  2ID0 A;  2ZTE A;  3OTO Q;  4LUZ A;  1OTC A;  1Y1V H;  1MJE A;  3JC6 6;  1QUQ B;  4L5S A;  1AE2 A;  1PA6 A;  3PV0 A;  4DV0 Q;  4MTN A;  1Q12 A;  2RF4 A;  1EIY B;  1XNQ Q;  3S16 H;  4JOI A;  5K36 G;  4DV2 Q;  3HOU H;  4DAM A;  1N8R C;  1VQK A;  4GKK Q;  4OWT B;  4FDB A;  4DR6 Q;  4LF5 L;  4EX5 A;  3W5O A;  1CUK A;  1HH2 P;  4JI5 Q;  3CCR A;  1N33 L;  4HJ7 A;  4IOA A;  5C0X J;  4OO1 G;  4GLV B;  3HOV G;  3CW2 C;  2NN6 G;  2D0O A;  5IYD G;  4B3R L;  3T1H Q;  3M7N A;  2I5M X;  1QVF A;  4L5T A;  3I4O A;  1XJV A;  4IFD I;  4MNO A;  1WCM G;  4R4T A;  1XMQ L;  1IBM L;  1IBK L;  4LWC A;  2BH8 A;  1XNR L;  2HHH L;  5M3M G;  2YTV A;  1VQ8 A;  1VQI A;  4A3D H;  1L1O A;  3CP0 A;  1P8L A;  4PMW A;  5C4J H;  2YYZ A;  2NVX H;  4AQY L;  1OXV A;  5C4X H;  1HNW L;  2GVA A;  2E2I H;  2L15 A;  1VQG A;  1WOC A;  2ZJP A;  1YHQ A;  2JQO A;  2EIF A;  4KLK A;  2UXC L;  1YZ6 A;  1XPO A;  3G4S A;  1X6O A;  1HR0 W;  4QIW E;  3M4Q A;  5JEA J;  2H5X A;  4DV4 Q;  3KJO A;  1R9T H;  4IPD A;  2KCM A;  5M3F H;  4JYA Q;  3CC4 A;  5IY0 A;  3CF5 A;  2VQF L;  3KJP A;  4OON A;  1YI2 A;  1FGU A;  1Q46 A;  3KF6 B;  3TS0 A;  1X55 A;  2JA6 H;  2CWA A;  3F2D A;  4JI8 L;  4DV7 Q;  1B70 B;  1NMG A;  3T1Y L;  1MKH A;  4DR1 L;  2UUA L;  4YWM A;  1HNX Q;  2A8V A;  1VQB A;  4APV A;  4HJA A;  3M4P A;  1LTL A;  2UUB Q;  3J7A 5;  2XTI A;  2WB1 G;  1NBW A;  2VY3 A;  5C3E G;  1KHI A;  2Q2U A;  2JA5 G;  4J15 A;  4C2M H;  4GNX C;  2I0Q A;  5C44 G;  1OXT A;  3GTL H;  3PUV A;  3TEH B;  2QA4 A;  4QQB X;  2K5N A;  4DV6 Q;  2OQ0 A;  2K5V A;  1BBU A;  2VQE L;  2JE6 I;  3RZO H;  1HZ9 A;  4O2D A;  4BXX G;  3EBE A;  1UE7 A;  5FLM G;  3HOZ G;  2LXJ A;  4MZ9 A;  1MIU A;  4YCV A;  1VQL A;  4Y52 H;  1Q1E A;  2ZM6 L;  1VCI A;  4NPS A;  3HFZ B;  4A3I H;  1B8A A;  1KC8 C;  3HOY G;  1GO3 E;  1PH7 A;  1Q8K A;  1Y1W H;  4A3F G;  2UU9 L;  4LF4 L;  4HJ5 A;  2MFI A;  2LXK A;  2OTL A;  3DM3 A;  3KDF B;  3RR5 A;  3GTK H;  2ZJR A;  4DR4 Q;  3F2C A;  1IBK Q;  2MO1 A;  3S24 A;  4TVA B;  1YVC A;  4A3E H;  1K83 H;  2PQA A;  3PO3 H;  1Q7Y C;  1NJI C;  4JI7 L;  1DGS A;  1UE6 A;  5GAD C;  1E7Z A;  2FXQ A;  5FJ8 G;  5JJI A;  2PI2 A;  3J81 j;  5C4X G;  5LMU Q;  1HZB A;  1C9O A;  1CKN A;  1HZC A;  1VQA A;  2F3I A;  2YU9 H;  5M5X H;  3S1R H;  2K75 A;  3HOW H;  3T1Y Q;  1EFW A;  4BBS H;  4X62 L;  4O0A A;  1N34 Q;  1YIJ A;  2E2H H;  1N9W A;  3STB C;  1XTD A;  4QGU A;  2WB1 E;  4LFC L;  1IBL Q;  1PH2 A;  1RIP A;  5AJ3 L;  4DV1 L;  3FHW A;  3BJU A;  4PG3 A;  2KEN A;  3GDE A;  5GAH C;  5IYD H;  3K80 C;  2VS1 A;  4C3H H;  3F1Z A;  1PH5 A;  4IJH A;  2IX1 A;  3AQQ A;  3FKI G;  4JI0 Q;  3CCS A;  2EXD A;  4A3L G;  2VUM H;  4DR7 L;  5GQO A;  1QZG A;  5IYB G;  1YHB A;  1TXY A;  5IWA L;  4LFA Q;  4DV6 L;  4NXM Q;  1NE3 A;  3K0X A;  1Y1W G;  2JA8 H;  2R93 G;  1O7I A;  1T9H A;  3BZK A;  3PUW A;  1SR3 A;  4DK6 C;  4A76 A;  1W2B A;  4POG A;  2ASB A;  1XNR Q;  1M90 C;  1EWI A;  2Z0S A;  1YEZ A;  1VQF A;  1CSQ A;  3I56 A;  5LMU L;  2UUC L;  1VQO A;  4LF9 L;  2ATW A;  3D31 A;  4GN4 B;  1VS0 A;  1PYS B;  2AWO A;  4GN5 A;  4B3T L;  3J7Z C;  4L5R C;  4OX9 Q;  1A63 A;  3RN5 A;  3PUZ A;  1BBW A;  2RCN A;  4AYB E;  4A93 G;  2UXB L;  2Q2H A;  1V9P A;  4IFD G;  4DKA C;  3KF8 B;  1SRO A;  2VL6 A;  4IFD J;  1EIF A;  4ALP A;  2Q2T A;  2UUC Q;  1G29 1;  3UDX A;  4LW1 A;  3PUX A;  3TS2 A;  4DR6 L;  1D7Q A;  4UY8 C;  1VQJ A;  1K73 C;  4JI3 L;  1PH1 A;  2R92 G;  2VQF Q;  3OW2 A;  3BU2 A;  4UPA A;  3PIO A;  4A3K H;  5E7N A;  3U4V A;  4C3J H;  3G48 A;  1HZA A;  4X65 L;  2BA0 A;  2IHE A;  5IWA Q;  2OQK A;  1UE5 A;  4OWX B;  2ZJQ A;  4IJL A;  2WAQ E;  2K50 A;  3RLO A;  3CME A;  5IYC G;  3U58 A;  5J3B A;  4B3M Q;  1GVP A;  5BR8 L;  4PZ7 A;  4ME3 A;  4BY1 G;  4LF6 L;  3EIV A;  3F2B A;  1UEB A;  1KAW A;  5AJ3 Q;  4DV1 Q;  1VQC A;  1IBL L;  4BBR G;  4RMF A;  3NEM A;  2XGT A;  3I4N G;  4GKJ L;  1EQQ A;  5GAG C;  4JI3 Q;  4OWW B;  3B6Y A;  1L1O B;  1XMQ Q;  2PI2 E;  3A0J A;  3JAM c;  5DLQ E;  4X62 Q;  3Q8D A;  1N34 L;  2N3S A;  1KD1 C;  4YY3 L;  4GN3 B;  5IP7 H;  1KQS A;  2R93 H;  1LUZ A;  2JA8 G;  3CXC A;  1U5K A;  3RLN A;  2PQA B;  2ES2 A;  1B7Y B;  2N78 A;  2ZTC A;  5GRO A;  1K9M C;  1X56 A;  1E24 A;  1EUJ A;  4JI5 L;  4LF5 Q;  5LMN L;  1VQ9 A;  1YNX A;  4NB3 A;  4LF9 Q;  3RNU A;  4YY3 Q;  3GTM H;  4X6A H;  3K8A A;  4DV2 L;  2HIV A;  3K7U C;  4A4I A;  4LUV A;  2Z6K A;  2NVQ H;  4GNX B;  3STB D;  2D0P A;  3EN2 A;  3CCQ A;  2K5H A;  1Q82 C;  4BA1 I;  3AEV A;  3OYY A;  3LGJ A;  4GKJ Q;  1CKO A;  3CQZ H;  3A5U A;  4DV0 L;  2UU9 Q;  2JJQ A;  4LF4 Q;  3KYH C;  4NXN Q;  3I4M H;  2AHO B;  4BY7 G;  4HJ9 A;  1OXS C;  3OTO L;  4BBS G;  3HOW G;  2ZM6 Q;  4R4O A;  1QUQ A;  2A1A A;  2HQL A;  4DK3 C;  1LM0 A;  4H02 A;  5ELN A;  3PUY A;  4X65 Q;  1K3R A;  2KBN A;  2YV5 A;  3I4M G;  4JC0 A;  4JI2 L;  4A75 A;  3PO3 G;  3H0G G;  1WJJ A;  2UXC Q;  1U0L A;  1OXX K;  1PH4 A;  4K0K L;  2R6G A;  2I5L X;  1BKB A;  1QZH A;  1J5E Q;  1RL2 A;  3L7Z C;  3CCE A;  2ALY B;  2VW9 A;  4LNQ A;  3K7A H;  2KHI A;  2R7Z H;  3S14 H;  4YCW A;  2PNH A;  4A3I G;  1GKH A;  1YJW A;  2YTX A;  1SE8 A;  2K52 A;  1PH9 A;  3PCO B;  3BZC A;  4A3M G;  2MO0 A;  1WYD A;  2E5L Q;  2OWO A;  4OX9 L;  3PO2 H;  3S1N H;  2MQH A;  1Z47 A;  3PSI A;  4R4Q A;  4DNI A;  1HNX L;  4DR1 Q;  1EYG A;  2UUA Q;  1JJG A;  1YJN A;  4R4C A;  4A3B G;  4PZ8 A;  4JI4 Q;  2PMZ E;  4Y7N H;  1XNQ L;  1KXL A;  1A0I A;  3AYH B;  3CPW A;  1V1Q A;  3AFP A;  3VDY A;  2B63 H;  3CCL A;  3FP9 A;  1GM5 A;  1AE3 A;  4NXM L;  4BY1 H;  2JK8 A;  1L2F A;  3RN2 A;  4A3B H;  1X3G A;  5BR8 Q;  3GTO H;  2N49 A;  3NEL A;  4B3S Q;  2AMC B;  1J6Q A;  2C35 B;  4GOP A;  4DUY L;  4LFB Q;  1IXR A;  4KHP Q;  1E3P A;  3RLF A;  4EQ5 A;  5JJL A;  2K14 A;  4DR5 L;  3U4Z A;  3S1M H;  2CWP A;  4GOP C;  2RHQ B;  3PIP A;  3GTP H;  5JJK A;  2AWN A;  1VQD A;  2QGQ A;  5M5W H;  1HNW Q;  3I55 A;  4LFC Q;  5C0X I;  4DR3 L;  5IP9 H;  1YJ9 A;  1HJP A;  4KHZ A;  2R92 H;  4P72 A;  3L2P A;  2Y0S E;  2KHJ A;  3CAM A;  4YHH Q;  3HOX G;  1KL9 A;  2JA6 G;  1E1T A;  1PHJ A;  4TQU S;  1XMO L;  1XPR A;  1VQP A;  2DUD A;  2R7D A;  4DV5 L;  4JI1 L;  4A3M H;  1IBM Q;  3PO2 G;  4JBW A;  4QL5 A;  2AKW B;  3L0O A;  5IYB H;  2UXB Q;  4YCU A;  4B3R Q;  2UUB L;  1SN8 A;  1QVC A;  4DV3 L;  4IOC A;  4B3T Q;  1JE5 A;  3FKI H;  2JA7 H;  4JI7 Q;  1FJG L;  1IL2 A;  2R7F A;  3MXN B;  1M1K C;  4BY7 H;  2K4K A;  1W3S A;  3G6E A;  1EQR A;  1YHA A;  3CCU A;  4GOP B;  1N33 Q;  4DUZ Q;  1VQ5 A;  1FVI A;  4POF A;  4X66 L;  1K0R A;  4DUZ L;  3K81 C;  4GLX A;  1JB7 A;  2D62 A;  4A3D G;  4LFA L;  3M3Y H;  3PF4 A;  4JYA L;  4QY7 A;  3M85 A;  2Y0S G;  4RG1 A;  3J81 i;  3CD6 A;  4JOI C;  4XTC S;  1HR0 Q;  4DR7 Q;  4JI0 L;  2A19 A;  1I50 H;  4AYB G;  5FJ8 H;  5GAE C;  4GNX A;  1Q86 C;  1ASY A;  3J80 i;  4P74 A;  4JV5 L;  2NVT H;  2GN5 A;  1N32 Q;  3ZJY C;  4WJ3 M;  3DLL A;  3HKZ G;  1CSP A;  1WI5 A;  4JV5 Q;  3CC7 A;  2HHH Q;  4LF7 L;  4QJF A;  1X3E A;  2YTY A;  2JA7 G;  2NN6 I;  4JI6 L;  3H3V I;  3HOU G;  2NZO A;  2UXD Q;  4DR5 Q;  1I6H H;  1Z9F A;  2OTJ A;  2BH2 A;  1L0W A;  1L1O C;  4AIM A;  5IYC H;  1YIT A;  1HR0 L;  3TQY A;  4P71 A;  3M4O H;  1Y1V G;  1I3Q H;  4LF8 Q;  1IZ6 A;  4A3C G;  2JEB I;  3ULP A;  2B63 G;  2WFW A;  4X64 L;  4C3I H;  4A3K G;  4HIM A;  1EOV A;  1FL0 A;  3W1B A;  2N8N A;  2F52 A;  3A74 A;  4DR4 L;  4X64 Q;  4JI4 L;  3GO5 A;  1MJC A;  2NVY H;  2OCE A;  2NZH A;  3MEF A;  1LYL A;  1PH3 A;  2CQO A;  4IPC A;  1I94 Q;  2CCZ A;  3CC2 A;  1TWA H;  4R4I A;  4DR2 L;  1FJG Q;  3UDI A;  3SGI A;  2GVB A;  2R7Z G;  4DV4 L;  1P16 A;  4KI0 A;  1C0A A;  3HOZ H;  3GTG H;  4IO9 A;  1PVO A;  1SFO H;  5EAY A;  4GS3 A;  4WJ4 A;  3GD7 A;  2UXD L;  1HNZ L;  4LF7 Q;  2VQE Q;  4YHH L;  4AQY Q;  4K0K Q;  3KFU A;  5IE8 A;  1I5F A;  1A8V A;  4HIK A;  4DR3 Q;  1ASZ A;  1H95 A;  4JCV E;  3A5Z B;  2BA1 A;  1SLJ A;  4JI2 Q;  1VQM A;  2IX0 A;  3I7F A;  1VQH A;  1YBY A;  5ELO A;  1TWG H;  3PF5 A;  1Q81 C;  4HJ8 A;  1TWF H;  1D8L A;  1A62 A;  1X54 A;  2ZTD A;  4L5Q A;  4HIO A;  4KHP L;  3HKS A;  3E9I A;  4A3G H;  3T1H L;  3E0E A;  3U50 C;  4JBJ A;  2VUM G;  3ULJ A;  4GLA C;  1PFS A;  4B3S L;  1K8A C;  2IT1 A;  2B3G A;  3KDF A;  4UP9 A;  4JBK A;  2KCT A;  3ICE A;  1I94 L;  3G71 A;  4LUO A;  1X9N A;  4NXN L;  4JI8 Q;  4DV7 L;  3H0G H;  1VQ7 A;  1TWH H;  1VQE A;  3M9B A;  1N36 Q;  2HT1 A;  2JA9 A;  3WWV A;  1VQN A;  4GKK L;  2WP8 J;  5JEA G;  2DGY A;  2V1C C;  1XPU A;  2E2J H;  1X3F A;  5M3M H;  4LF8 L;  1G51 A;  5LMN Q;  2EQS A;  1OXU A;  4DV3 Q;  2E5L L;  4A3L H;  2WAQ G;  1VQ6 A;  2CFM A;  1V43 A;  2RHS B;  1UWV A;  3JAM i;  1PV4 A;  2I5H A;  3UDF A;  1JMC A;  4AH6 A;  2VNU D;  4JI1 Q;  4OO1 I;  1CKN B;  1PYB A;  1KRT A;  1J5E L;  4HID A;  2F4V L;  1SMX A;  3F8T A;  3HOV H;  2Q2I A;  1Q1B A;  5IT9 c;  5H1S E;  1QVG A;  3KOJ A;  3UDG A;  3S15 H;  1KRS A;  1Y14 B;  3I4N H;  4BBR H;  3E9H A;  4R1J A;  1WCM H;  3HOY H;  1JT8 A;  2CKZ B;  2IY5 B;  3PGZ A;  3CMA A;  2F4V Q;  3RZD H;  3H15 A;  1E1O A;  2HIX A;  5C0X G;  2MNA A;  1PH6 A;  3HKZ E;  5IP7 G;  3D0F A;  3S17 H;  1PH8 A;  5LMN W;  4P75 A;  3S1Q H;  1S72 A;  4XIG S;  3HOX H;  4A3E G;  5FLM H;  3UE1 A;  3J81 c;  3GTQ H;  1IYJ B;  4UP8 A;  3ER0 A;  4DAY B;  4A3G G;  5IP9 G;  1X65 A;  1CKM A;  2IHF A;  4DR2 Q;  4X66 Q;  3IRB A;  4A3J H;  3KLW A;  1WFQ A;  4IPH A;  1BVS A;  4YWK A;  4A3F H;  4JBM A;  4BA2 I;  3ERS X;  1N36 L;  1GD7 A;  1TWC H;  4P73 A;  4DPG A;  3ULL A;  3CCM A;  2LSS A;  3CCJ A;  3UE0 A;  4JG2 A;  3CPF A;  1JJ2 A;  5FLX c;  1S3O A;  4A93 H;  1E22 A;  1K8G A;  4OXP A;  4BXX H;  4DV5 Q;  2E8G A;  1NTG A;  3GTJ H;  1XMO Q;  1NMF A;  4UP7 A;  1AH9 A;  3AFQ A;  1JJC B;  2Z6K C;  3NEN A;  1UE1 A;  3H3V H;  5HY6 A;  5M5Y H;  4JI6 Q;  4IPG A;  1SRU A;  3J80 c;  5HGQ A;  1NY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...