3GTKH

Backtracked rna polymerase ii complex with 18mer rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
146
structure length
136
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 15
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtkH00
1PV4A 5C3EH 3HOXG 5IWAQ 4HIKA 3HOWG 1HNZQ 3T1YQ 1VQLA 2KCMA 4NXNL 3U50C 3VDYA 2NVXH 1HH2P 3PO3H 4QIWE 4DV7Q 4AQYQ 1B7YB 3J7A5 3KF8B 1VQ6A 4DUYQ 4GOPC 4GN5A 2KBNA 1Q86C 2F4VL 4OXPA 5FLXc 1BBWA 1Y1WH 3S14H 2PQAB 4XIGS 4DPGA 1K3RA 2UU9L 5IYDG 4NXMQ 1CKNA 1IXRA 3J80i 1J5EL 2GVAA 2Q2UA 2JQOA 3GTJH 1PHJA 2UUAQ 3PGZA 5FLMH 4DV5Q 4A3GG 2Z0SA 3K7AH 1VQBA 4UP9A 5LMNQ 1PA6A 4L5RC 2UUBL 4LF4L 1XNRQ 1PYSB 4B3TQ 1TWHH 3CP0A 3HKZG 3NELA 1LTLA 1K8GA 2FXQA 2I5MX 3U4ZA 3MEFA 3TQYA 5JJLA 4POFA 4C3JH 2DGYA 3FHWA 3PIOA 2K75A 4DR4Q 4X64Q 2B63H 1IBLQ 3PSIA 1X65A 4JI2Q 1XPRA 3CC4A 4JI0Q 3HFZB 1IYJB 3A74A 3ER0A 3KFUA 1KRTA 2OCEA 1IBMQ 4B3SL 1FJGL 1JT8A 1CSPA 3PUWA 4KHPQ 2HQLA 1VQPA 3S15H 1TWFH 1YNXA 4DUZL 3E9HA 4LFBL 1HZAA 1PH3A 4JI6L 4QQBX 2KHJA 2Q2IA 4IPHA 1N34Q 5GAHC 5AJ3L 5JJIA 1PH5A 1A63A 4IFDJ 3RR5A 4JI5L 1HNWQ 1HNXL 2CWAA 3MXNB 4MZ9A 3RNUA 3NBHB 3CCMA 3H3VI 5IYBG 4HJ9A 1ASYA 4MNOA 4HJ7A 4JCVE 1HZBA 4NB3A 4A3JG 1CUKA 4LF6Q 1V1QA 1ASZA 4LF5Q 3T1HL 1K0RA 1G291 1IZ6A 5H1SE 1K9MC 3HOZG 3ULJA 4NPSA 1Q7YC 4B3ML 1NBWA 1KRSA 1TWAH 1QZHA 5C44H 2VY3A 1N9WA 4GN4B 3UDFA 3GTPH 2IHEA 4DV4L 4LF7L 2ASBA 1C9OA 1VQIA 1T9HA 2CKZB 2UXCL 5LMNW 4A3DG 2IY5B 1L1OA 3BZCA 5E7NA 1D7QA 5IP7G 1GVPA 2IX0A 2PMZE 2QGQA 3AFQA 3Q8DA 1X55A 4JBJA 2E5LL 5ELOA 3KLWA 1A8VA 4IJLA 1VQOA 3CCLA 3PF4A 4BXXH 3CQZH 3I55A 1A62A 1KAWA 1Q8KA 4GKKL 3TRZA 4QY7A 5BR8Q 4GKJL 3I2ZA 4HIMA 2YTYA 1YJWA 3I4NG 4A3BG 4K0KQ 2VS1A 4LNQA 2JA8H 4JC0A 1C0AA 4XTCS 1AE2A 3FKIH 3D0FA 1N32L 2HHHQ 1OXTA 1LYLA 2WB1G 3GDEA 4YWMA 3WWVA 4LFAL 1S40A 4KLKA 2MFIA 2QEXA 4DNIA 2VQFQ 4DR3L 2JA6G 4LUZA 4R4OA 3J81j 1XMOQ 4A3CH 4A3EG 3H0GH 3AFPA 5C0XJ 3KOJA 3GTOH 3E9IA 1KD1C 1HZCA 3OW2A 1E22A 5K36G 5JEAJ 1VQFA 3GD7A 3EBEA 1PVOA 2ZJRA 4O2DA 2R92G 4A3LG 4KI0A 1EYGA 1D8LA 3NENA 3CCVA 4ALPA 2UXDL 4X65L 1Q1BA 3S2HH 1M90C 2C35B 1HR0Q 3OTOQ 1Y1VH 2QA4A 3FP9A 3RN2A 4P71A 2ID0A 1AH9A 2JA5G 5C4XH 2WP8J 4DR5L 4POGA 1W3SA 4JBKA 3J7ZC 4OO1G 4QGUA 2WFWA 3RN5A 1Z9FA 2AWNA 1NE3A 4A3IH 1FL0A 2NZOA 1PH6A 4OX9Q 4HJAA 1I3QH 2AHOB 4BY1H 4DR7Q 2EXDA 5IP9H 4JI8L 1KC8C 3RLFA 3RZDH 3TS0A 2UXBQ 4IPDA 4NXML 3PUVA 1VQMA 1EOVA 1CKMA 1SFOH 1QUQA 4PMWA 2R7ZG 2RHQB 1SRUA 4DV5L 1YJ9A 4DV2Q 5LMNL 1VQCA 1BVSA 4DKAC 5M3FG 1YJNA 1N8RC 3HOUH 5IYCH 2VQEQ 2K50A 1L2FA 2OQ0A 4DV6Q 4BY7H 2LXKA 1YBYA 4BA1I 3HOXH 3HOWH 4JBWA 4YHHL 3PO2G 2NZHA 1SROA 2UUCL 1PH1A 1DGSA 1VQDA 1B70B 3L2PA 4X64L 2VL6A 4HIOA 1TWGH 4JI0L 3CCJA 1LUZA 4A3KH 4A75A 2I5LX 4C2MH 1IBML 4NXNQ 4TQUS 2L15A 2F52A 5M5YH 1EIYB 2OTLA 4X66Q 3H3VH 3NEMA 1UE5A 1RL2A 1OXUA 4BBRH 5IYDH 1XMQL 5GAEC 1QVFA 2JEAI 4A3FG 2B3GA 1YIJA 4OO1I 4PZ7A 4A3GH 1VQ9A 1O7IA 1KL9A 4LUVA 1XPUA 1K73C 2UU9Q 3W5OA 1EWIA 4DR6L 3TEHB 4LF9L 2NVTH 2JA9A 1XNQL 1J5EQ 3KDFA 4LFCL 2ZM6L 4H02A 3CCQA 4JI4Q 1K83H 2VUMG 4HJ8A 3S1RH 4RG1A 1P16A 1BKBA 4LF4Q 2UUBQ 2OTJA 2Z6KA 2WAQE 4GLXA 3I4MG 1NTGA 2YV5A 4BBSG 4JI3L 3BJUA 2K5VA 2ZJQA 1MJCA 1JMCA 1PH2A 3J81c 3PUZA 1EQRA 1NMGA 4YCUA 2R6GA 4LF5L 4LF8Q 1PYBA 2A19A 3W1BA 1PH9A 3CPWA 4DV0Q 1YZ6A 4IOCA 3UDIA 4JYAL 4GLVB 4DK6C 1X56A 2CWPA 1FJGQ 3M3YH 5ELNA 3IRBA 1KIXA 1JJGA 3ERSX 4JI1Q 4JBMA 4DUZQ 1JB7A 1R9TH 2N49A 2E2HH 3PF5A 4JV5L 5C44G 1I94Q 2A1AA 2IT1A 2NVQH 3U58A 3GTMH 2MO0A 5AJ3Q 2AMCB 2K5NA 2RF4A 4DV1L 1PH4A 4JI5Q 1CKOA 1HNXQ 2DUDA 5JJKA 3PV0A 1G6PA 1HZ9A 1UWVA 5M3MG 4JOIA 4A3JH 3ULPA 5GQOA 3AYHB 3TREA 3RLNA 4DV3Q 1QZGA 5GROA 1PH7A 3G71A 2ATWA 4AH6A 4GNXA 2JA7G 4APVA 4X62L 2NN6G 3K80C 1S72A 3HOZH 4GLAC 3EIVA 3ULLA 3K7UC 2BH2A 3HOYG 1N33L 2VW9A 2MO1A 4IPGA 4YWLA 4QL5A 4YCWA 2K52A 1QUQB 1OXSC 1X54A 5LMUL 3F1ZA 2N3SA 1XMOL 3ICEA 1UE7A 1A0IA 3HOVG 4B3MQ 3M7NA 4X6AH 1CKNB 3AQQA 4A3DH 3BU2A 4AIMA 1X3EA 3UE0A 5IP7H 1N36L 4A3CG 2PI2A 4DV4Q 4A3MG 4LF7Q 3W1GA 2UXCQ 2BA0A 1MIUA 1RIPA 2YTXA 2E5LQ 1E1OA 3PUYA 2CQOA 4KHZA 1JE5A 3I4NH 1E7ZA 1PFSA 3CXCA 3CCSA 4Y7NH 4PZ6A 3F2BA 1VQJA 1YI2A 3PCOB 4GOPA 1NJIC 4A93G 1FVIA 4GKJQ 1EFWA 3KJPA 1VQHA 4DR1L 2ES2A 3RZOH 3ZJYC 4B3RL 1E24A 3GO5A 2JA6H 3S1QH 1OXXK 1XPOA 4P75A 4YY3L 3CPFA 3KJOA 3S16H 4JI7L 4R4TA 4A4IA 3CMEA 4LFAQ 1WCMG 4DR2Q 2JK8A 1SE8A 2H5XA 4MTNA 1YHBA 3KDFB 1L0WA 4DR3Q 5IWAL 5C4XG 5FJ8G 2NN6I 4L5TA 3T1YL 2JEBI 1HNZL 1KHIA 3G4SA 1VQKA 4OX9L 2R93G 4Y52H 4DR7L 4C3IH 1Q1EA 5IT9c 4DV7L 1X6OA 4AQYL 4AYBE 3CCUA 5C3EG 2R92H 4DUYL 3S17H 1FGUA 3M9BA 5GAGC 1V43A 2ZTEA 1TXYA 2MQHA 1OXVA 3M85A 4OONA 3PO3G 2OQKA 3U4VA 2AKWB 5IP9G 3F2CA 1NY4A 4PG3A 4UPAA 2UXDQ 2R7FA 3JC66 4X65Q 1MKHA 3BZKA 3S24A 1Y1WG 2F3IA 2UUAL 2E2JH 5IY0A 2JA5H 3E0EA 2LXJA 1WYDA 2KHIA 1YVCA 3SGIA 1XNRL 2ZJPA 4EQ5A 3OYYA 4B3TL 3EN2A 1IBKQ 3M4PA 3M4QA 1K8AC 1SN8A 4R1JA 1EQQA 3D31A 5FLMG 4DR5Q 4HIDA 2WAQG 1MJEA 5HY6A 2LSSA 3JAMc 5GADC 1VQAA 5C0XG 5EAYA 4HJ5A 3AEVA 4DR4L 1L1OB 1GKHA 1IBLL 4R4CA 4X66L 1Q81C 1B8AA 1GD7A 3STBC 1HJPA 2VZAA 2JE6I 4JI2L 4A3KG 4OWXB 1UE1A 5JEAG 3F8TA 2N78A 2VNUD 4JG2A 1KQSA 4KHPL 4GNXB 2B63G 3KF6A 1SR3A 4JI8Q 4GN3B 1M1KC 2R7ZH 3CMAA 2F4VQ 2BA1A 1X3FA 4BBRG 2KENA 5M3FH 4LW1A 2A8VA 4WJ4A 1VQ8A 4DK3C 1N34L 1G51A 4JI4L 3GTLH 2IHFA 4YWKA 1HR0W 3PO2H 2BH8A 1HNWL 4DAMA 1V9PA 2E8GA 1VS0A 2AWOA 2EIFA 1YHAA 2I0QA 2RHSB 4QJFA 4YHHQ 1C7YA 2UUCQ 3K0XA 4LF8L 2N8NA 1SLJA 4A76A 2ZTCA 2V1CC 4DV0L 3K81C 2JJQA 4LF6L 1VQ7A 2GVBA 2IX1A 1SMXA 3KYHC 4IJHA 4IPCA 4A3FH 2KCTA 3CCEA 3DLLA 2YYZA 1WJJA 4GOPB 1I50H 4JI1L 4LWCA 1KXLA 4B3SQ 3UDXA 1XMQQ 4FDBA 4R4IA 5DLQE 4TVAB 3CAMA 2E2IH 1I94L 5C0XI 1OTCA 2EQSA 2D62A 5HGQA 2VUMH 5M5XH 3S1MH 4LFBQ 4DR6Q 4LF9Q 4JI6Q 3RLOA 1XNQQ 2CCZA 4A3LH 3I4MH 4LFCQ 2PNHA 4BBSH 2ZM6Q 5M5WH 5IYBH 2MNAA 1I5FA 2I5HA 1P8LA 2ZTDA 3HKZE 1WOCA 1XTDA 4L5QA 4DV3L 3H15A 2Q2HA 1QVCA 3PUXA 1S3OA 3CW2C 5BR8L 3CF5A 1VQ5A 4JI3Q 3B6YA 1VQNA 1I6HH 1UEBA 1X3GA 3L0OA 4K0KL 3I56A 4BXXG 1QVGA 2RCNA 2PQAA 3A0JA 2B29A 3LGJA 1Q46A 2HHHL 4JYAQ 1J6QA 3G48A 3JAMi 3T1HQ 1EIFA 2GN5A 3UDGA 2JA8G 3FKIG 2VQFL 3STBD 3I4OA 4UP8A 4WJ3M 3I7FA 2HT1A 2XTIA 3F2DA 4JV5Q 1U0LA 1W2BA 2YU9H 5M3MH 2HIVA 2Z6KC 1YHQA 1X9NA 3GTKH 4DV1Q 4IFDG 3CD6A 4O0AA 3L7ZC 3CCRA 4ME3A 4AYBG 1H95A 1GO3E 3H0GG 3J80c 2Q2TA 2XGTA 2K14A 1UE6A 2JA7H 4OWTB 1WFQA 4GS3A 2HIXA 4A3BH 3HOYH 4P74A 3S1NH 1Y14B 3A5ZB 2K5HA 4UP7A 3PIPA 1EUJA 1TWCH 1NMFA 4X62Q 4GKKQ 1HR0L 1BBUA 3OTOL 3KF6B 3HKSA 5J3BA 3HOVH 2ALYB 1VQEA 1N33Q 4YCVA 2Y0SG 4C3HH 5IE8A 1LM0A 4IOAA 4DR2L 1Q12A 1GM5A 5LMUQ 1N32Q 3UE1A 4A3EH 1Y1VG 1Q82C 3J81i 4A3MH 3K8AA 1IL2A 2NVYH 2YTVA 2OWOA 5C4JH 1L1OC 4P72A 4DAYB 4JOIC 3CC7A 1N36Q 1E1TA 4P73A 4RMFA 1YITA 4A3IG 4A93H 1Z47A 3TS2A 4L5SA 4IO9A 4GNXC 1YEZA 1XJVA 2UXBL 1VCIA 1VQGA 4BY1G 4EX5A 1AE3A 3G6EA 1E3PA 4PZ8A 2D0PA 1VQ4A 4LUOA 1JJ2A 3CC2A 4DV2L 4BA2I 4OWWB 4IFDI 4DR1Q 4R4QA 3M4OH 2CFMA 1JJCB 1WCMH 2K4KA 2VQEL 1IBKL 2R7DA 1CSQA 4B3RQ 2WB1E 2D0OA 2Y0SE 4DV6L 3S2DH 1U5KA 5FJ8H 3DM3A 4YY3Q 1PH8A 4JI7Q 2R93H 4J15A 3A5UA 3GTQH 3HOUG 5IYCG 1WI5A 4UY8C 4BY7G 3GTGH 2PI2E
chains in the Genus database with same CATH superfamily
1PV4A 3HOXG 1HPCA 3HOWG 1B1ZA 3OIPA 2KCMA 3U50C 3VDYA 1HH2P 3DHQA 5TSSA 1ICWA 1LV9A 4AQYQ 2A5HA 3J7A5 4GOPC 1Q86C 3LX0A 2O5JC 1K3RA 3OOCA 4NXMQ 1CKNA 2KOLA 1J5EL 1TWCB 2QCPX 2GVAA 4DV5Q 3K7AH 5LMNQ 4RHRA 5CR3A 3U4ZA 3MEFA 2A69C 5DNFA 4DAPA 3NHHA 3PIOA 2K75A 2F0FA 5C4JB 2B63H 1XPRA 4QIWB 5T1IA 3KFUA 1QB5D 1KRTA 1IBMQ 1FJGL 1CA5A 4A93B 4KHPQ 2R92B 3S15H 1TWFH 1S5FD 1KDCA 1TVXA 2EDGA 3Q0AA 3E9HA 2EY1A 1EWCA 1HZAA 2K5WA 5BN4A 5FOBB 2ZXOA 1PH5A 1A63A 3RR5A 1I4RA 1SE4A 2KEDA 3PQIA 4MNOA 5ELFA 2WINB 4A3JG 1V1QA 2EXZA 1ASZA 2NVXB 1K0RA 1SSOA 1KNEA 3E0JA 1K9MC 1CFMA 4FF2A 2J4XA 4NPSA 1RKNA 1TWAH 1QZHA 3K59A 3UDFA 2DJGC 1FNWA 4DV4L 2CKZB 2I07B 1ESRA 2E5LL 2IX0A 2F4IA 3R93A 5COYA 1TWHB 3I55A 1Q8KA 5KRUA 2HDMA 1DOMA 4HIMA 3DWQA 4C3JB 4A3BG 2AQ2B 2BOSA 4XTCS 1AE2A 5D3IB 3TBIB 3D0FA 1HXYD 1OXTA 2A69D 4YWMA 3F2UA 1PRTC 2MFIA 2GA4B 3I70A 2PNRC 4O1NA 2JA6G 4OIKA 3J81j 1XMOQ 1ESFA 2CHBD 3AFPA 3KOJA 3GV6A 5KNCA 2B2VC 1SDFA 5JEAJ 1E0BA 3NWSA 4O2DA 2ENBA 2P5ZX 1TU2B 1B2TA 3BDLA 3S2HH 4X3TA 4K8JA 1DZ1A 1KLUD 2EOTA 3RN2A 4P71A 2HCCA 2JA5G 5C4XH 4DR5L 4OO1G 4K5WA 4G7HC 3GTPB 3MC0B 3I72A 1ILQA 4BY1H 4DR7Q 3IAYA 1JWMD 4HTHA 4NXML 2SEBD 3BS1A 2RHQB 4DV5L 2R3ZA 1F2LA 5LMNL 4CDEC 1YJNA 3HOUH 2TSSA 3FKIB 4R8NA 1A3VA 4DV6Q 1YBYA 3HOXH 3HOWH 3PO2G 1VQDA 1B70B 4ILWA 4HIOA 2F3VA 4A75A 1IBML 4TQUS 2L15A 1PRTD 1EIYB 4X66Q 1IYVA 2PW5A 2NBFA 2O4XA 4BBRH 1MSGA 1QVFA 2B3GA 1YIJA 1VQ9A 1AEXA 1O7IA 2K7VA 2K6AA 1K73C 3KBXA 3OMCA 5K5PA 4DR6L 4NDXA 2EYJA 2NVTH 2JA9A 1XNQL 4LFCL 1Y1VB 2VUMG 4HJ8A 1HCZA 2Z6KA 3EFXD 1B4OA 4XQJA 4EGVA 4HEDA 1NMGA 1RCVD 4R8IA 1U4LA 4FNFA 1YZ6A 3ZYYX 4IOCA 3NK9A 4IUUA 3IRBA 1GUNA 2G5DA 4JI1Q 4JBMA 4DUZQ 2N49A 5D65A 4DGZA 2NVQH 2K5NA 5JOBA 1PH4A 4BY7B 1HZ9A 1G6PA 5M3MG 4A3JH 4X3SA 2WAQB 3TREA 1JOOA 3AYHB 3QG1A 1SXTA 3GV3A 1PH7A 2KVMA 1PDQA 4AH6A 5E1FA 3K80C 3L3OC 4A3KB 4GLAC 3K7UC 3HOYG 4IPGA 4YWLA 1G91A 2K52A 1KDBA 2N3SA 1XMOL 3M7NA 4X6AH 1F2ZA 4DN4M 4EQPA 1EY8A 3DUZA 3S15B 4ZAIA 1N36L 2PI2A 2F0KA 1BNZA 2JP1A 2RDGA 3SK8A 3PUYA 2BDOA 4KHZA 5I6YA 1SJED 3TZUA 3CXCA 4GZYC 4A93G 4PZ6A 2F0MA 1FVIA 1CK1A 4GKJQ 3SR1A 1MBYA 2XRSD 1E24A 3TDQA 3WOEA 2F0DA 3PIO3 2JA6H 3S1QH 4B08A 2K05A 2G9DA 5EGTA 4LFAQ 2K5QA 1SE8A 4EVOA 1CT1D 1YHBA 5F2DA 5L37A 1O7LA 4KY6A 5KYIA 4L5TA 3K0YA 2E2HB 2R93G 2EJFC 3P7JA 4DR7L 2PYKA 3TZDA 3CCUA 3GTMB 2EYHA 1ZKOA 3S17H 5EKIA 1AN8A 2CQAA 2Z9HA 3SK5A 5CV9A 2IJ0A 1RODA 4DK0A 4X65Q 4F7XA 1G6ZA 4XT1B 3HOZB 4G4KA 2JA5H 1WYDA 2F0IA 2KHIA 2OF1A 4CBVA 1XNRL 4NP5A 4EQ5A 3OYYA 2ZJPA 2B8GA 3EN2A 4OO1H 3M4QA 1G2TA 4R1JA 1EQQA 4N8FA 2B2YA 1UNSA 2FMMA 5EAYA 4DR4L 4A3DB 1L1OB 4X66L 1HRJA 4FYDA 3STBC 2FHTA 2JE6I 2OXPA 2VZAA 4OWXB 4C3JG 2MJ8A 4JI8Q 1SR3A 1GHKA 1M1KC 1LTTD 3MA2B 1DOKA 3M7GA 2DY7A 5IOCA 1PLFA 4ULLA 3GTLH 4YWKA 1SNQA 4P2CB 3PO2H 2WB1B 2Y0SB 3S2HB 1VS0A 1YHAA 3EVQA 2I0QA 2UUCQ 1LTID 2EJGC 3E6ZX 1SLJA 1XX8A 2V1CC 3C1FA 4LF6L 4QCLA 1SNDA 2IX1A 2KCTA 2IPKD 3HEJA 1WJJA 3VYRA 3H94A 4JI1L 2Q8TA 4BY1B 1M8AA 4B3SQ 2F0SA 4N9TA 1OTCA 2EQSA 2RVLA 2VUMH 5M5XH 4LF9Q 4JI6Q 4IUQA 3DEPA 3NTIA 2ZM6Q 3WDNA 5M5WH 1EWHA 2XVSA 1JWUD 3HKZE 1BQQT 4JI3Q 1PTOH 4WRDA 1BF4A 3HOWB 4I7ZC 1HA6A 1F9QA 1O80A 3I56A 1A2TA 1F77A 3A0JA 2B29A 3LGJA 1Q46A 1CZGA 2HHHL 3JAMi 1EIFA 2JA8G 5LHY1 3AU7A 3FKIG 4PV1C 1D5XC 3STBD 1JICA 4WJ3M 5M3FB 1H9RA 4HMJA 1U0LA 5M3MH 1BBXC 1YHQA 4DV1Q 4DXFA 3CD6A 3L7ZC 4AYBG 4DFAA 4EQOA 2XGTA 3A7LA 3TP8A 1PRTF 3HOYH 1Y14B 1AFPA 3NE5B 4LJZC 1TWCH 1BBUA 3MHBA 3KLSA 3OMGA 3MFYA 4J1MA 5IE8A 3Q22A 1KLGD 1BXTA 1X3QA 4M1UB 1I50B 1N32Q 1GUSA 1AW7A 1Y1VG 3Q24A 3MXNA 3K8AA 2YTVA 3NBHA 2OWOA 3H09A 1JORA 3NUCA 5C4JH 1WTQA 4KKUA 1SYEA 4JOIC 3CC7A 2PMZB 4A93H 3TS2A 1SE3A 4DAVA 4L5SA 1SNCA 3VR2A 4GNXC 4IO9A 2UXBL 3BZDB 1VCIA 3P75A 4KHVA 1K3BC 1I4XA 3S1MB 4OGQC 3MXUA 2D0PA 1S5CD 2LS01 3W3AA 4WORA 4OWWB 2NWGA 3BG3A 4YY3Q 3K5OA 2R93H 3A5UA 3GTQH 1WI5A 4BY7G 4XXEA 4B9WA 3Q23A 2D5DA 4RWSC 2NVXH 1TQOA 1PFNA 4H0LC 4QIWE 2YU9B 1LTGD 4DUYQ 4GN5A 2JA7B 5EKKA 3C3LA 4XIGS 4DPGA 2F1MA 4RKLA 4A3BB 3NBIA 2XSCA 1ZEQX 1RTOA 3J7AF 2CW0D 2QW7A 2Z0SA 3QIAA 1VQBA 1TWHH 3NELA 2I5MX 1PFBA 4A3MB 5JJLA 4C3JH 2D9UA 1IBLQ 4JI2Q 3E5SA 3HFZB 1IYJB 4B3SL 1JT8A 2EVBA 1B50A 1YNXA 4RH6A 2K03A 4JI6L 1ENAA 1F2YA 1NCVA 1N34Q 1EYCA 1NNXA 4DA2A 5AJ3L 1O7YA 3FDTA 4QUCA 1DONA 2KCNA 4JI5L 1HNWQ 3MXNB 4KD3A 3NBHB 5DEHA 4ZK9B 2HQEA 1NAPA 4JCVE 1HZBA 4NB3A 5D14A 3K57A 3VR3A 4NW2A 3PO3B 4FXDA 3I73A 1G291 3P20A 5H1SE 5KIXA 4ZKCB 3HOZG 4HAEA 1HUNA 2L5TA 5A35A 2XIWA 3GTPH 2K33A 2HD3A 2IHEA 1QCBD 4UDUC 4LF7L 3D6WA 2ASBA 1VQIA 1T9HA 2UXCL 4A3DG 3BZCA 2FINB 5E7NA 5IP7G 2QGQA 1X55A 3DWAA 5IODA 4IJLA 1A8VA 1VQOA 1DD2A 2I46A 3CCLA 1A62A 2NTSA 3BYTB 1PTOC 3I2ZA 2EE1A 4K0KQ 4MTKA 2JA8H 3FKIH 2CVRA 5IIFA 1N32L 4ZQ3A 2WB1G 3GDEA 1JOKA 4KLKA 4DNIA 1O78A 4DR3L 4IALA 4LUZA 2XRQD 1KDAA 1QILA 3LWEA 2WKDA 3O13A 3OPOA 4K2LA 2VUMB 5M5XB 1HZCA 5C5LA 1E22A 5K36G 2G9HD 1QNKA 1VQFA 1FD7D 3EBEA 1PVOA 1F9PA 5M5WB 3CRLC 4KI0A 1EYGA 1RF2D 3CCVA 2UXDL 4O42A 1Q1BA 3U9OA 3OTOQ 2ZXPA 1RJTA 1LT5D 1U4PA 1Y1VH 3FP9A 2QA4A 3I8ZA 4RGTA 1E2VA 3G7LA 1AH9A 1IHZA 4POGA 4XQQA 4H44C 3J7ZC 1LTBD 2WFWA 4B9XA 1A15A 1LT3D 3MWYW 1TT2A 4KJNA 4HJAA 3GP7A 1D5ZC 5M3MB 2X6GA 1KC8C 2Z1CA 3A55A 2C9OA 1TR5A 2PO4A 1PZKD 1QUQA 4C1NI 1SRUA 4R9WA 3HOYB 4DV2Q 4RA8A 3OHXC 5M3FG 1AZPA 1BVSA 3KLSX 5IGBA 4BY7H 4IZ8A 1PTOD 4G7ZC 4JBWA 4YHHL 2NZHA 1SROA 1CQVA 4BWGB 2VL6A 1SEBD 4KN4C 4A3KH 3D6CA 5CYUA 2I5LX 5CBAE 3A8KE 4NXNQ 5M5YH 3H3VH 2B39A 3NEMA 1UE5A 1RL2A 1HA5A 1I4HA 5CV8A 2PZUA 4FO2A 5JVH3 2QEJC 1DOLA 4LUVA 1XPUA 2UU9Q 1EIGA 1EWIA 2F3WA 4K2KA 3R2TA 3KDFA 3CCQA 4H02A 4JI4Q 2E2DC 3QJYA 1EYDA 5EPJA 1UEAB 2UUBQ 4LF4Q 4J8QA 2WAQE 4GLXA 1NTGA 2A74C 4BBSG 2K5VA 2ZJQA 2F0OA 4HMIA 1WVLA 4Q5VA 1PH2A 3GTQB 2R93B 1D6EC 5J1ZA 4YCUA 4LF8Q 1PH9A 3CPWA 5IT9L 4MIUA 4N8X1 2LFNA 2XWJB 3UDIA 4JYAL 1X56A 3RZDB 2RBMA 4JK1C 3SDZA 4KJOA 2E2HH 3PF5A 4JV5L 3DMUA 5C44G 1SFOB 1I94Q 2IT1A 2MP1A 4ID6A 3GTMH 4DNRB 1HTPA 1HNXQ 5JJKA 1FGBD 2AUKA 1NUCA 2KQ3A 5GQOA 5C4ZA 5J22A 2ATWA 2M9VA 4APVA 5CBEE 2NN6G 2JA7G 3HOZH 2L0CA 2BH2A 3EIVA 3ULLA 3NP8A 4CKEA 3R2IA 1N33L 4QL5A 1QUQB 1OXSC 3K5MA 3F1ZA 3ICEA 4B3MQ 1WTVA 1VF5C 1CKNB 5KNBA 2L55A 4A3DH 1KTKA 4AIMA 4A3GB 2L11A 1LTAD 3UE0A 4DNTB 5IP7H 4A3CG 4A3MG 1GJXA 2BA0A 1JE5A 2JYOA 1PFSA 4Y7NH 2MHVA 1DYQA 3T4AC 3I3CA 4OIJA 1RD9D 3KJPA 1LLRD 1VQHA 1EY9A 5IGFA 3SXHA 1XPOA 4RGOS 5E4XA 3VA5A 3KJOA 3EJIA 4JI7L 1ENCA 3QB3A 3M3YB 4YIJA 1F9RA 2JK8A 3KDFB 4OEMB 2K04A 1H9SA 1VQKA 2JEBI 1KHIA 2B8FA 5K36H 2KEEA 5IT9c 1X6OA 4AQYL 5G3LF 5LL6S 5GAGC 2ZTEA 3PO3G 1WD1A 5IP9G 2SNMA 4JVZA 1NY4A 1CQFA 1H9JA 3JC66 3BZKA 1BCPB 2F3IA 2E2JH 3QWNA 3E0EA 2LXJA 2JA8B 1EL0A 3M4PA 1K8AC 1SN8A 1F9SA 5FLMG 2B2TA 2F0PA 5CORA 4HIDA 1MJEA 5HY6A 3OWEB 4BS9A 1VQAA 5C0XG 1GKHA 1B8AA 4AYBB 1UE1A 3C46A 2N78A 2RCFA 3K6OA 2HUGA 4JG2A 4KHPL 2L1BA 3KF6A 3CMAA 4C1NK 1X3FA 5M3FH 1VQ8A 4DK3C 3D4DA 4TSSA 2EYPA 1G51A 4JI4L 2F0WA 2K01A 1PFMA 1V9PA 3S16B 3CU7A 1STYA 1C7YA 3I91A 1WTXA 4LF8L 2PQEA 2N8NA 1K8OA 1VQ7A 1IW7C 1IL8A 3DEOA 4WFN3 1FYCA 3H3VC 1BUVT 1I50H 1GUTA 2MPMA 2F0LA 4LWCA 1KXLA 3UDXA 1XMQQ 4R4IA 1I94L 1FR3A 4DU9A 5HGQA 3VYUA 4LFBQ 1Q3LA 4NMZA 1SMYC 4ZRZA 4BBSH 2MNAA 5EPLA 1H9SB 2ZTDA 1RHPA 1WOCA 4WJWA 3H15A 1QVCA 3PUXA 1S3OA 3S1MH 1X3GA 3L0OA 2K5DA 4BXXG 2N88A 3OWFA 2VB3X 2RCNA 2PQAA 1QVGA 2ICIA 4ZCKA 2RSOA 3G48A 3T1HQ 5M5YB 5FLXL 3UDGA 3A56A 1A2UA 4UP8A 2V4DA 1X3PA 2HT1A 1PTOF 2YU9H 2Z6KC 3MXPA 4IFDG 5E4WC 4ME3A 1EFID 1IKMA 1A6XA 2K14A 1J8IA 1UE6A 2JA7H 2O5IC 2NN6H 4OWTB 1WFQA 5FO7B 1S5BD 4A3BH 1CZWA 4UP7A 3SHLA 3PIPA 4G7OC 1EUJA 4GKKQ 4X62Q 5C3WA 3KF6B 1H9KA 3HKSA 5J3BA 3NSWA 4A3FB 4UAIA 3H91A 1GM5A 5LMUQ 1E2ZA 1Y8NB 3J81i 1IW7D 4A3MH 5IGDA 1HQMC 1TS4A 1XWEA 1DCZA 1L1OC 4P72A 1E1TA 4P73A 1EY7A 5EQ0A 5KYLA 4ZYSA 2J0TD 5IGEA 3I4MB 2EY2A 2Z6BA 5CGKA 1AE3A 3G6EA 1JE4A 1E3PA 4PZ8A 1VQ4A 3VYTA 1SMYD 1JJ2A 1SNPA 1LT4D 3BVZA 4DR1Q 2CFMA 2R7DA 4B3RQ 4DV6L 3S2DH 1WD0A 1U5KA 1PH8A 2L4NA 4IUNA 2M00A 5IYCG 3NTKA 5IWAQ 3W2DA 1HNZQ 3T1YQ 3PO3H 1WTOA 1GUWA 4DV7Q 3GTKB 1B7YB 2QKIC 1D2BA 3IFTA 5DM73 4XYQA 4OXPA 5FLXc 4F8MA 4HCEA 1BBWA 2F0GA 2O2LD 3S14H 2PQAB 3NXWA 3S1NB 1HTLD 4Y7NB 1IXRA 3URYA 3DM1A 4RFBA 3J80i 3J7AV 2Q2UA 2JQOA 2UUAQ 4A3GG 2JN4A 3PGZA 5FLMH 3HOVB 1I6HH 2IW3A 5C0XH 4C3HB 4B3TQ 3CP0A 4S3SA 3TQYA 4POFA 2DN8A 3MXGA 2DGYA 1GXDC 3FHWA 2KCCA 4X64Q 4FF3A 2OCEA 3TN2A 1KNAA 1W6JA 3PUWA 3G6JB 1DXMA 4DUZL 1L0YB 2B2WA 4LFBL 1U9RA 3EQLC 3Q6SA 4DXGA 4QQBX 4CDCC 2KHJA 4HSVA 4IPHA 5JJIA 5EJWA 1WTPA 3A7AB 4IFDJ 2B2YC 1WCMB 2CWAA 4MZ9A 1NSNS 2FMCA 2VB2X 2E2JB 4K5VA 2BCOA 5IYBG 1ASYA 2Q8RE 3T13A 4HJ7A 5C3EB 3VYSA 3T1HL 1MSHA 1IZ6A 2BE5C 5LL6X 3ULJA 1Q7YC 2B2UA 1I6VC 4F87A 2VY3A 1N9WA 4GN4B 1F2MA 3QOLA 4ZLTF 3I90A 3HG9A 3DXJC 3GTJB 4MN3A 3AFQA 4UHVA 5ELOA 2CW0C 3KLWA 3QO2A 3PF4A 4BXXH 4GKKL 1HUMA 3OSOA 1B53A 5BR8Q 3KBGA 4GKJL 2PZWA 2YTYA 2VS1A 1SNOA 3EA6A 4JC0A 1E2WA 1CTMA 1STEA 2AUJD 4K6DA 1LYLA 3WWVA 4LFAL 1S40A 1SYDA 4U673 4E6IA 2VQFQ 4R4OA 4IFDH 1TS3A 4A3EG 1V8QA 4QF4A 1BCPF 1SYFA 1H9MA 3GTOH 5FK9C 3E9IA 1KD1C 2KA7A 5AFWA 3GD7A 4BBSB 2ZJRA 2MGSA 3T16A 4L63B 1EY0A 3K5NA 1EYAA 3SE0A 2K28A 3NENA 3NWTA 3J81L 4X65L 3DWPA 3TSSA 2C35B 3AB9A 1TS2A 4ZUIA 1HR0Q 4ZKBB 1YNNC 2M2LA 1S5DD 2ID0A 2HCIA 1W3SA 2NTTA 4JBKA 5C44B 2AWNA 2BE5D 2NZOA 1II3A 1PH6A 4OX9Q 4KN7C 2EXDA 4JI8L 3RLFA 3RZDH 3TS0A 3T53B 4IPDA 2H4OA 3PUVA 3CQZB 1CKMA 1SFOH 2NZ1D 1YJ9A 1VQCA 5C3XA 5IYCH 2XN9C 2VQEQ 2K50A 2LXKA 4BA1I 1LTSD 2UUCL 5J39A 3L2PA 4X64L 3WOFA 1CI3M 1Y8OB 3J7YW 1MI2A 4KD4A 2EY5A 1OXUA 4OELB 1LT6D 4A3FG 4OO1I 3KUPA 1Q90A 4A3GH 2X6LA 2F03A 1ZXTA 4LF9L 3IKJA 4ZUJA 1J5EQ 2L12A 2ZM6L 4RG1A 2OTJA 3I4MG 4JI3L 3S2DB 3J81c 3PUZA 5G3LD 1YNND 2A19A 4A3IB 1CM9A 4DV0Q 5A2QL 1LACA 1SYGA 1I3QB 3SEBA 5JPMC 4GLVB 1I4QA 1EY5A 1FJGQ 2QILA 3M3YH 5ELNA 1D1IA 1S5ED 4L8JA 2KUMA 2A6EC 1JB7A 1AP0A 4H7BA 2A1AA 3S14B 3U58A 2MO0A 4DV1L 2AMCB 2RF4A 3R8BA 2DUDA 3PV0A 1UWVA 1I6HB 1QZGA 4DV3Q 3JAML 5GROA 3MZ5A 5JPNC 2LMCB 3MVVA 4X3UA 4ODGA 5DM63 1TWGB 3KLRA 4C2MB 5E3FA 4PNYA 2VW9A 2MO1A 4TRDA 4KKTA 4MHEA 4YCWA 1X54A 1U4RA 3R3OA 3HOVG 2OEOA 4C3HG 3AQQA 3BU2A 2J7ZA 2F0JA 1X3EA 3A8JE 4DV4Q 1M4VA 2NYZD 3W1GA 1IKLA 1MIUA 4K14A 1ET6A 3CRKC 1BOSA 4TKOB 2E5LQ 3S1RB 2E76C 5CV5A 3F2BA 1VQJA 1NJIC 3PCOB 4GOPA 1V1OA 1LO5D 2AQ3B 4XQNA 1SNMA 2EYMA 4V0BA 4XYOA 5A2QE 3BVGA 3ZJYC 2F0TA 3RMHA 2XWBB 1I4PA 4YY3L 3CPFA 3S16H 4A4IA 1S4ZA 1WCMG 4IUPA 4MTNA 2L9HA 4J6HA 5C4XG 1EZ8A 5FJ8G 2D2CC 4OX9L 3X3MA 4EQNA 4Y52H 3G4SA 1Q1EA 1DM0B 4AYBE 5C3EG 4DUYL 1FGUA 3M9BA 2A6ED 1V43A 4FF4A 1TXYA 1OXVA 1U4MA 3M85A 2F0QA 3U4VA 2AKWB 5BN3A 3JAME 1SYBA 4PG3A 2RKSA 3QR8A 3E3XA 3S24A 1Y1WG 4LAAA 3SK4A 5ELBA 2EY6A 3SGIA 1BO0A 3D31A 5KNDA 4DR5Q 3K5LA 5C6AA 3JAMc 1VMPA 4HJ5A 3AEVA 1HFGA 2OT2A 1IBLL 4R4CA 1Q81C 4JI2L 4K5XA 1HJPA 2EYOA 1EQVA 3VR6A 5JEAG 4L6TB 3F8TA 4PMBA 2VNUD 1FNUA 5CV7A 3GTOB 5I9OA 4C56C 5IGGA 2F4VQ 2A73B 4BBRG 3C2PA 3I4NB 2Z8LA 4WJ4A 1Q8IA 1N34L 3D3RA 1Y69U 1DJRD 1HR0W 1HNWL 3RZOB 1CHQD 1BR9A 4DAYA 2A68C 2ICEC 5C5MA 3CKIB 4DV0L 3CHBD 2JJQA 1VF7A 5CV4A 1SMXA 4C3IB 4IJHA 4IPCA 1TIID 4A3FH 3DLLA 2YYZA 4GOPB 3FPPA 5IGCA 2CH4W 5DLQE 4TVAB 4Z9CB 3OW7A 4CJ1B 2D62A 4DR6Q 1UUPA 3HP3A 1XNQQ 3I4MH 4LFCQ 2PNHA 3I4LA 1WTRA 1P8LA 3K58A 4DV3L 1XTDA 3NQTA 1UAPA 2B2VA 3KF8A 4CGYB 3B6YA 2E74C 2R61A 1TKWB 4K0KL 3V05A 1A3TA 2F0EA 3NQIA 3PMFA 1EZ6A 1QNUA 1STBA 4KMUC 4LMQD 1J6QA 2R7ZB 3I4OA 3I7FA 3F2DA 1CHPD 1W2BA 3ND8A 2HIVA 2K32A 2SOBA 1X9NA 3GTKH 4O0AA 3CCRA 3H0GG 1YNJC 2Q2TA 3QOJA 2A6HC 2RA4A 4GS3A 2EPBA 3S1NH 3A5ZB 2K5HA 3LWUA 3RD4A 1T5XD 1BCPC 3OTOL 2A68D 3HOVH 5IT9E 4YCVA 4C3HH 1HFNA 1LM0A 4IOAA 4V190 3FMCA 1T5EA 2HDLA 1EQTA 3UE1A 1Q82C 1IL2A 2NVYH 2E2IB 5CV6A 4KTAA 4DAYB 4QMGA 3HS0C 1D5MC 1N36Q 3P1HA 4X3KA 4A3IG 1STNA 2ZXRA 1Z47A 4KK7A 2IX3A 1XJVA 1D1KA 1VQGA 4M8AA 4F88A 5ELDA 2CH4A 4H13C 3CC2A 4DV2L 3ERQA 4R4QA 1JJCB 1WCMH 3SK6A 3HZXA 5EPKA 2WB1E 2Y0SE 5D3DA 3A54A 5FJ8H 3DM3A 1HQRD 1PRTB 3NTHA 2JXMB 4UY8C 1B3QA 3GTGH 2PI2E 5C3EH 4HIKA 1VQLA 2FJ2A 3MTSA 4NXNL 3BVMA 2RDHA 3KF8B 1VQ6A 1W6KA 2F4VL 2KBNA 3D8GA 1JQYD 1Y1WH 1JOQA 2JSOA 4OL7A 2UU9L 5IYDG 1YNJD 3FRPB 5CMDA 3GTJH 1PHJA 1NR4A 2A6HD 1MD2D 3BYYB 1G8ZD 1O7ZA 1HHVA 4UP9A 1PA6A 3NPPA 4L5RC 1XNRQ 4LF4L 2UUBL 1PYSB 1G2SA 1JC7A 3HKZG 1LTLA 1BCPD 4A3EB 2FXQA 1K8GA 1IYUA 5JEAH 3U9SA 4DR4Q 3PSIA 1X65A 3GQBA 3CC4A 4JI0Q 3ER0A 1JCKB 3A74A 3IFDA 1JR0D 3MAQA 1ML0D 1CSPA 2HQLA 4OHJA 1VQPA 2C5CA 2SNSA 4KV6A 1PH3A 1QE6A 2RSNA 2Q2IA 1LTRD 2N55A 1BDOA 2VXWA 5GAHC 1R4QB 2B2TC 1HNXL 3M4OB 2PW7A 4XDXA 3RNUA 3CCMA 3H3VI 4HJ9A 5M9OA 4I7AA 4IUTA 3FVQA 1VDZA 1R4PB 1CUKA 4FXGC 4HSPA 4LF6Q 4QUFA 4LF5Q 4IURA 1EY6A 2RDFA 4B3ML 1NBWA 1KRSA 5C44H 4PQXA 4PMCA 4HN7A 5FO9B 4RGNA 2Z4IA 5HURA 1C9OA 5LMNW 2IY5B 1D7QA 1L1OA 1B9NA 1GVPA 2PMZE 3Q8DA 3K7AB 4JBJA 4K8IA 3CQZH 1KAWA 3TRZA 4QY7A 1YJWA 1MHWC 3I4NG 4LNQA 1C0AA 2B63B 5C4HA 1CA6A 5T1GA 2HHHQ 1LABA 3TP6A 5ELCA 2QEXA 4G57A 1TWFB 3X3NA 4I65A 4A3CH 5ELEA 5I9PA 1V1PA 3H0GH 5C0XJ 1SBBB 1ZYRC 4FF1A 3T51B 3OW2A 4DK1A 4C3IG 2WIIB 2R92G 5DAUA 4A3LG 4U68A 1D8LA 4ALPA 3FPUB 1M90C 5I2YA 2PZTA 5I2XA 2WP8J 5FLXE 1OO9B 1TWAB 1GHJA 2BDNA 4QGUA 3RN5A 1Z9FA 4A3IH 1NE3A 1FL0A 3OIQA 4CDDC 1I3QH 2AHOB 4LK1C 4RCNA 5IP9H 2UXBQ 2QDBA 1AZQA 2Z4HA 4DF7A 2WV6D 1VQMA 1EOVA 3LNNA 1GOZA 4PMWA 2K1BA 2R7ZG 2EYFA 2F0UA 4KY7A 3D4RA 4DKAC 1RDPD 1N8RC 1QG7A 1L2FA 2OQ0A 1EEID 3TP5A 1PH1A 1DGSA 1EU4A 1TWGH 2E75C 4JI0L 4KY5A 3CCJA 1LUZA 2NVYB 4C2MH 4JPBW 2F52A 2OTLA 1B44D 5IYDH 2F0HA 1XMQL 5GAEC 5JVG3 2JEAI 1ILPA 4PZ7A 1KL9A 4FXKC 2H1EA 1ZYRD 3W5OA 3TEHB 2NB0A 1QWYA 1K83H 1XXGA 1KAAA 3HRZC 3S1RH 3S9WA 1P16A 1BKBA 1V1PB 1EOTA 1GUOA 2YV5A 1SYCA 3BJUA 5C4XB 1MJCA 1JMCA 1EQRA 2R6GA 4LF5L 1PYBA 3W1BA 2RQXA 3GTGB 2IWHA 1EU3A 4DK6C 2CWPA 4CHTB 1KIXA 1JJGA 1ICFB 4RAUC 3ERSX 1R9TH 4ABNA 5KEEA 5JJZA 1Y1WB 1EIHA 3ONAB 5AJ3Q 2PPBC 4JI5Q 1CKOA 4HR7B 3HOUB 5HGTA 1K8MA 4JOIA 2DNCA 3HOXB 3ULPA 1TY2A 2Q8IB 3RLNA 1PXUA 3G71A 4GNXA 2IL8A 5FO8B 4X62L 3N52A 1S72A 1Z6HA 1RTNA 1GUGA 1L0XB 2B2WC 5KGUA 1PYWD 2SDFA 1QJOA 5LMUL 3H6MA 2MUYA 3AMUA 4BBRB 1UE7A 1A0IA 5EKLA 5CC4A 3V96A 1EEFD 2DNEA 1XYIA 1XTCD 4LF7Q 2NVTB 2EYLA 2UXCQ 1TS5A 1RIPA 3KK7A 2YTXA 1E1OA 3ND9A 2CQOA 4XT3B 3I4NH 4RHSA 1E7ZA 3CCSA 1ENFA 2X69A 1YI2A 1NR2A 1J9OA 1EFWA 4DR1L 2ES2A 3RZOH 2B2UC 4B3RL 4NKLA 3GO5A 1OXXK 4P75A 4RCOA 4R4TA 3CMEA 1Y8PB 4DR2Q 2H5XA 1L0WA 4DR3Q 3MEHA 5IWAL 1HNZL 2NN6I 3T1YL 1KABA 3UI2A 5I4DA 4C3IH 4DV7L 2NVQB 2R92H 1K0SA 4A3LH 2MQHA 4OONA 2OQKA 1STGA 4A3JB 2QF7A 3F2CA 4UPAA 2UXDQ 5EBCA 2R7FA 1MKHA 3D4WA 2UUAL 5IY0A 2FFKB 5ISRA 1YVCA 4B3TL 1IBKQ 3M4YA 3BDCA 3TMEA 2WAQG 5BN5A 2LSSA 5GADC 4IQZA 2ZT9C 1GD7A 4A3KG 3H0GB 3MFGA 2EJMA 3J80L 3ITPA 2EZVA 1KQSA 2KECA 4GNXB 2B63G 4GN3B 2R7ZH 2BA1A 4RKBA 3C1EA 2KENA 4LW1A 2A8VA 1PMRA 4KKSA 3J81E 2IHFA 4CJ2C 2BH8A 4DAMA 2E8GA 2AWOA 3PIP3 2JA6B 2EIFA 1B3AA 3VR5A 3S1QB 5JAVA 2DY8A 2RHSB 4QJFA 4YHHQ 1C8CA 3K0XA 4A76A 1ONLA 2ZTCA 1Z7TA 3K81C 2XNAC 3VR4A 1B9MA 1QOHA 1WTHA 2GVBA 2QDLA 3KYHC 3IL8A 3CCEA 2WACA 2F0NA 3S17B 1SE2A 2TMPA 2NUCA 4FDBA 3CAMA 2E2IH 2LKVA 3RUZA 5C0XI 2KHSA 2PCFB 1TY0A 3RLOA 2CCZA 2JA5B 5IYBH 3HGBA 1I5FA 1STHA 2I5HA 4L5QA 2Q2HA 1VQNA 3CF5A 3CW2C 5BR8L 1VQ5A 1UEBA 5FKAC 1I4GA 1C4QA 1PZJD 4IN3A 4JYAQ 3BDOA 3J80E 3FEWX 2GN5A 2VQFL 3V2TA 2DJFC 1JB3A 2AQ1B 4Q0FA 1JWSD 2XTIA 4JV5Q 1K28A 5I6WA 3L9AX 1SAPA 3GTLB 3PO2B 1C48A 3TP7A 5EBDA 1H95A 1GO3E 3J80c 3HKZB 1K83B 4CKCA 2HIXA 1FNVA 2LY7A 1WTWA 4RGMA 4P74A 1VMCA 1X32A 4K6LA 5NUCA 1NMFA 4HCSA 1HR0L 3T56B 1ET9A 1VQEA 2ALYB 1N33Q 2Y0SG 3SVMA 4DR2L 1Q12A 3VA7A 4A3EH 1A3UA 3A8IE 4CJ0B 2KJXA 1R9TB 4N9PA 4FVMA 4RMFA 1YITA 1PZID 1YEZA 1EY4A 4IUVA 4CDFC 4BY1G 4EX5A 2WKCA 1PTOB 4LUOA 4JW0A 3N6RA 2F0VA 4BA2I 4IFDI 4FP5D 3M4OH 2K4KA 1IBKL 2VQEL 1CSQA 1STAA 4QB4A 2D0OA 4CKBA 3EROA 4ME5A 4JI7Q 4J15A 1SJHD 3HOUG 1MGSA
chains in the Genus database with same CATH topology
1PV4A 5C3EH 3HOXG 5IWAQ 4HIKA 3HOWG 1HNZQ 3T1YQ 1VQLA 2KCMA 4NXNL 3U50C 3VDYA 2NVXH 1HH2P 3PO3H 4QIWE 4DV7Q 4AQYQ 1B7YB 3J7A5 3KF8B 1VQ6A 4DUYQ 4GOPC 4GN5A 2KBNA 1Q86C 2F4VL 4OXPA 5FLXc 1BBWA 1Y1WH 3S14H 2PQAB 4XIGS 4DPGA 1K3RA 2UU9L 5IYDG 4NXMQ 1CKNA 1IXRA 3J80i 1J5EL 2GVAA 2Q2UA 2JQOA 3GTJH 1PHJA 2UUAQ 3PGZA 5FLMH 4DV5Q 4A3GG 2Z0SA 3K7AH 1VQBA 4UP9A 5LMNQ 1PA6A 4L5RC 2UUBL 4LF4L 1XNRQ 1PYSB 4B3TQ 1TWHH 3CP0A 3HKZG 3NELA 1LTLA 1K8GA 2FXQA 2I5MX 3U4ZA 3MEFA 3TQYA 5JJLA 4POFA 4C3JH 2DGYA 3FHWA 3PIOA 2K75A 4DR4Q 4X64Q 2B63H 1IBLQ 3PSIA 1X65A 4JI2Q 1XPRA 3CC4A 4JI0Q 3HFZB 1IYJB 3A74A 3ER0A 3KFUA 1KRTA 2OCEA 1IBMQ 4B3SL 1FJGL 1JT8A 1CSPA 3PUWA 4KHPQ 2HQLA 1VQPA 3S15H 1TWFH 1YNXA 4DUZL 3E9HA 4LFBL 1HZAA 1PH3A 4JI6L 4QQBX 2KHJA 2Q2IA 4IPHA 1N34Q 5GAHC 5AJ3L 5JJIA 1PH5A 1A63A 4IFDJ 3RR5A 4JI5L 1HNWQ 1HNXL 2CWAA 3MXNB 4MZ9A 3RNUA 3NBHB 3CCMA 3H3VI 5IYBG 4HJ9A 1ASYA 4MNOA 4HJ7A 4JCVE 1HZBA 4NB3A 4A3JG 1CUKA 4LF6Q 1V1QA 1ASZA 4LF5Q 3T1HL 1K0RA 1G291 1IZ6A 5H1SE 1K9MC 3HOZG 3ULJA 4NPSA 1Q7YC 4B3ML 1NBWA 1KRSA 1TWAH 1QZHA 5C44H 2VY3A 1N9WA 4GN4B 3UDFA 3GTPH 2IHEA 4DV4L 4LF7L 2ASBA 1C9OA 1VQIA 1T9HA 2CKZB 2UXCL 5LMNW 4A3DG 2IY5B 1L1OA 3BZCA 5E7NA 1D7QA 5IP7G 1GVPA 2IX0A 2PMZE 2QGQA 3AFQA 3Q8DA 1X55A 4JBJA 2E5LL 5ELOA 3KLWA 1A8VA 4IJLA 1VQOA 3CCLA 3PF4A 4BXXH 3CQZH 3I55A 1A62A 1KAWA 1Q8KA 4GKKL 3TRZA 4QY7A 5BR8Q 4GKJL 3I2ZA 4HIMA 2YTYA 1YJWA 3I4NG 4A3BG 4K0KQ 2VS1A 4LNQA 2JA8H 4JC0A 1C0AA 4XTCS 1AE2A 3FKIH 3D0FA 1N32L 2HHHQ 1OXTA 1LYLA 2WB1G 3GDEA 4YWMA 3WWVA 4LFAL 1S40A 4KLKA 2MFIA 2QEXA 4DNIA 2VQFQ 4DR3L 2JA6G 4LUZA 4R4OA 3J81j 1XMOQ 4A3CH 4A3EG 3H0GH 3AFPA 5C0XJ 3KOJA 3GTOH 3E9IA 1KD1C 1HZCA 3OW2A 1E22A 5K36G 5JEAJ 1VQFA 3GD7A 3EBEA 1PVOA 2ZJRA 4O2DA 2R92G 4A3LG 4KI0A 1EYGA 1D8LA 3NENA 3CCVA 4ALPA 2UXDL 4X65L 1Q1BA 3S2HH 1M90C 2C35B 1HR0Q 3OTOQ 1Y1VH 2QA4A 3FP9A 3RN2A 4P71A 2ID0A 1AH9A 2JA5G 5C4XH 2WP8J 4DR5L 4POGA 1W3SA 4JBKA 3J7ZC 4OO1G 4QGUA 2WFWA 3RN5A 1Z9FA 2AWNA 1NE3A 4A3IH 1FL0A 2NZOA 1PH6A 4OX9Q 4HJAA 1I3QH 2AHOB 4BY1H 4DR7Q 2EXDA 5IP9H 4JI8L 1KC8C 3RLFA 3RZDH 3TS0A 2UXBQ 4IPDA 4NXML 3PUVA 1VQMA 1EOVA 1CKMA 1SFOH 1QUQA 4PMWA 2R7ZG 2RHQB 1SRUA 4DV5L 1YJ9A 4DV2Q 5LMNL 1VQCA 1BVSA 4DKAC 5M3FG 1YJNA 1N8RC 3HOUH 5IYCH 2VQEQ 2K50A 1L2FA 2OQ0A 4DV6Q 4BY7H 2LXKA 1YBYA 4BA1I 3HOXH 3HOWH 4JBWA 4YHHL 3PO2G 2NZHA 1SROA 2UUCL 1PH1A 1DGSA 1VQDA 1B70B 3L2PA 4X64L 2VL6A 4HIOA 1TWGH 4JI0L 3CCJA 1LUZA 4A3KH 4A75A 2I5LX 4C2MH 1IBML 4NXNQ 4TQUS 2L15A 2F52A 5M5YH 1EIYB 2OTLA 4X66Q 3H3VH 3NEMA 1UE5A 1RL2A 1OXUA 4BBRH 5IYDH 1XMQL 5GAEC 1QVFA 2JEAI 4A3FG 2B3GA 1YIJA 4OO1I 4PZ7A 4A3GH 1VQ9A 1O7IA 1KL9A 4LUVA 1XPUA 1K73C 2UU9Q 3W5OA 1EWIA 4DR6L 3TEHB 4LF9L 2NVTH 2JA9A 1XNQL 1J5EQ 3KDFA 4LFCL 2ZM6L 4H02A 3CCQA 4JI4Q 1K83H 2VUMG 4HJ8A 3S1RH 4RG1A 1P16A 1BKBA 4LF4Q 2UUBQ 2OTJA 2Z6KA 2WAQE 4GLXA 3I4MG 1NTGA 2YV5A 4BBSG 4JI3L 3BJUA 2K5VA 2ZJQA 1MJCA 1JMCA 1PH2A 3J81c 3PUZA 1EQRA 1NMGA 4YCUA 2R6GA 4LF5L 4LF8Q 1PYBA 2A19A 3W1BA 1PH9A 3CPWA 4DV0Q 1YZ6A 4IOCA 3UDIA 4JYAL 4GLVB 4DK6C 1X56A 2CWPA 1FJGQ 3M3YH 5ELNA 3IRBA 1KIXA 1JJGA 3ERSX 4JI1Q 4JBMA 4DUZQ 1JB7A 1R9TH 2N49A 2E2HH 3PF5A 4JV5L 5C44G 1I94Q 2A1AA 2IT1A 2NVQH 3U58A 3GTMH 2MO0A 5AJ3Q 2AMCB 2K5NA 2RF4A 4DV1L 1PH4A 4JI5Q 1CKOA 1HNXQ 2DUDA 5JJKA 3PV0A 1G6PA 1HZ9A 1UWVA 5M3MG 4JOIA 4A3JH 3ULPA 5GQOA 3AYHB 3TREA 3RLNA 4DV3Q 1QZGA 5GROA 1PH7A 3G71A 2ATWA 4AH6A 4GNXA 2JA7G 4APVA 4X62L 2NN6G 3K80C 1S72A 3HOZH 4GLAC 3EIVA 3ULLA 3K7UC 2BH2A 3HOYG 1N33L 2VW9A 2MO1A 4IPGA 4YWLA 4QL5A 4YCWA 2K52A 1QUQB 1OXSC 1X54A 5LMUL 3F1ZA 2N3SA 1XMOL 3ICEA 1UE7A 1A0IA 3HOVG 4B3MQ 3M7NA 4X6AH 1CKNB 3AQQA 4A3DH 3BU2A 4AIMA 1X3EA 3UE0A 5IP7H 1N36L 4A3CG 2PI2A 4DV4Q 4A3MG 4LF7Q 3W1GA 2UXCQ 2BA0A 1MIUA 1RIPA 2YTXA 2E5LQ 1E1OA 3PUYA 2CQOA 4KHZA 1JE5A 3I4NH 1E7ZA 1PFSA 3CXCA 3CCSA 4Y7NH 4PZ6A 3F2BA 1VQJA 1YI2A 3PCOB 4GOPA 1NJIC 4A93G 1FVIA 4GKJQ 1EFWA 3KJPA 1VQHA 4DR1L 2ES2A 3RZOH 3ZJYC 4B3RL 1E24A 3GO5A 2JA6H 3S1QH 1OXXK 1XPOA 4P75A 4YY3L 3CPFA 3KJOA 3S16H 4JI7L 4R4TA 4A4IA 3CMEA 4LFAQ 1WCMG 4DR2Q 2JK8A 1SE8A 2H5XA 4MTNA 1YHBA 3KDFB 1L0WA 4DR3Q 5IWAL 5C4XG 5FJ8G 2NN6I 4L5TA 3T1YL 2JEBI 1HNZL 1KHIA 3G4SA 1VQKA 4OX9L 2R93G 4Y52H 4DR7L 4C3IH 1Q1EA 5IT9c 4DV7L 1X6OA 4AQYL 4AYBE 3CCUA 5C3EG 2R92H 4DUYL 3S17H 1FGUA 3M9BA 5GAGC 1V43A 2ZTEA 1TXYA 2MQHA 1OXVA 3M85A 4OONA 3PO3G 2OQKA 3U4VA 2AKWB 5IP9G 3F2CA 1NY4A 4PG3A 4UPAA 2UXDQ 2R7FA 3JC66 4X65Q 1MKHA 3BZKA 3S24A 1Y1WG 2F3IA 2UUAL 2E2JH 5IY0A 2JA5H 3E0EA 2LXJA 1WYDA 2KHIA 1YVCA 3SGIA 1XNRL 2ZJPA 4EQ5A 3OYYA 4B3TL 3EN2A 1IBKQ 3M4PA 3M4QA 1K8AC 1SN8A 4R1JA 1EQQA 3D31A 5FLMG 4DR5Q 4HIDA 2WAQG 1MJEA 5HY6A 2LSSA 3JAMc 5GADC 1VQAA 5C0XG 5EAYA 4HJ5A 3AEVA 4DR4L 1L1OB 1GKHA 1IBLL 4R4CA 4X66L 1Q81C 1B8AA 1GD7A 3STBC 1HJPA 2VZAA 2JE6I 4JI2L 4A3KG 4OWXB 1UE1A 5JEAG 3F8TA 2N78A 2VNUD 4JG2A 1KQSA 4KHPL 4GNXB 2B63G 3KF6A 1SR3A 4JI8Q 4GN3B 1M1KC 2R7ZH 3CMAA 2F4VQ 2BA1A 1X3FA 4BBRG 2KENA 5M3FH 4LW1A 2A8VA 4WJ4A 1VQ8A 4DK3C 1N34L 1G51A 4JI4L 3GTLH 2IHFA 4YWKA 1HR0W 3PO2H 2BH8A 1HNWL 4DAMA 1V9PA 2E8GA 1VS0A 2AWOA 2EIFA 1YHAA 2I0QA 2RHSB 4QJFA 4YHHQ 1C7YA 2UUCQ 3K0XA 4LF8L 2N8NA 1SLJA 4A76A 2ZTCA 2V1CC 4DV0L 3K81C 2JJQA 4LF6L 1VQ7A 2GVBA 2IX1A 1SMXA 3KYHC 4IJHA 4IPCA 4A3FH 2KCTA 3CCEA 3DLLA 2YYZA 1WJJA 4GOPB 1I50H 4JI1L 4LWCA 1KXLA 4B3SQ 3UDXA 1XMQQ 4FDBA 4R4IA 5DLQE 4TVAB 3CAMA 2E2IH 1I94L 5C0XI 1OTCA 2EQSA 2D62A 5HGQA 2VUMH 5M5XH 3S1MH 4LFBQ 4DR6Q 4LF9Q 4JI6Q 3RLOA 1XNQQ 2CCZA 4A3LH 3I4MH 4LFCQ 2PNHA 4BBSH 2ZM6Q 5M5WH 5IYBH 2MNAA 1I5FA 2I5HA 1P8LA 2ZTDA 3HKZE 1WOCA 1XTDA 4L5QA 4DV3L 3H15A 2Q2HA 1QVCA 3PUXA 1S3OA 3CW2C 5BR8L 3CF5A 1VQ5A 4JI3Q 3B6YA 1VQNA 1I6HH 1UEBA 1X3GA 3L0OA 4K0KL 3I56A 4BXXG 1QVGA 2RCNA 2PQAA 3A0JA 2B29A 3LGJA 1Q46A 2HHHL 4JYAQ 1J6QA 3G48A 3JAMi 3T1HQ 1EIFA 2GN5A 3UDGA 2JA8G 3FKIG 2VQFL 3STBD 3I4OA 4UP8A 4WJ3M 3I7FA 2HT1A 2XTIA 3F2DA 4JV5Q 1U0LA 1W2BA 2YU9H 5M3MH 2HIVA 2Z6KC 1YHQA 1X9NA 3GTKH 4DV1Q 4IFDG 3CD6A 4O0AA 3L7ZC 3CCRA 4ME3A 4AYBG 1H95A 1GO3E 3H0GG 3J80c 2Q2TA 2XGTA 2K14A 1UE6A 2JA7H 4OWTB 1WFQA 4GS3A 2HIXA 4A3BH 3HOYH 4P74A 3S1NH 1Y14B 3A5ZB 2K5HA 4UP7A 3PIPA 1EUJA 1TWCH 1NMFA 4X62Q 4GKKQ 1HR0L 1BBUA 3OTOL 3KF6B 3HKSA 5J3BA 3HOVH 2ALYB 1VQEA 1N33Q 4YCVA 2Y0SG 4C3HH 5IE8A 1LM0A 4IOAA 4DR2L 1Q12A 1GM5A 5LMUQ 1N32Q 3UE1A 4A3EH 1Y1VG 1Q82C 3J81i 4A3MH 3K8AA 1IL2A 2NVYH 2YTVA 2OWOA 5C4JH 1L1OC 4P72A 4DAYB 4JOIC 3CC7A 1N36Q 1E1TA 4P73A 4RMFA 1YITA 4A3IG 4A93H 1Z47A 3TS2A 4L5SA 4IO9A 4GNXC 1YEZA 1XJVA 2UXBL 1VCIA 1VQGA 4BY1G 4EX5A 1AE3A 3G6EA 1E3PA 4PZ8A 2D0PA 1VQ4A 4LUOA 1JJ2A 3CC2A 4DV2L 4BA2I 4OWWB 4IFDI 4DR1Q 4R4QA 3M4OH 2CFMA 1JJCB 1WCMH 2K4KA 2VQEL 1IBKL 2R7DA 1CSQA 4B3RQ 2WB1E 2D0OA 2Y0SE 4DV6L 3S2DH 1U5KA 5FJ8H 3DM3A 4YY3Q 1PH8A 4JI7Q 2R93H 4J15A 3A5UA 3GTQH 3HOUG 5IYCG 1WI5A 4UY8C 4BY7G 3GTGH 2PI2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PV4 A;  5C3E H;  3HOX G;  5IWA Q;  4HIK A;  3HOW G;  1HNZ Q;  3T1Y Q;  1VQL A;  2KCM A;  4NXN L;  3U50 C;  3VDY A;  2NVX H;  1HH2 P;  3PO3 H;  4QIW E;  4DV7 Q;  4AQY Q;  1B7Y B;  3J7A 5;  3KF8 B;  1VQ6 A;  4DUY Q;  4GOP C;  4GN5 A;  2KBN A;  1Q86 C;  2F4V L;  4OXP A;  5FLX c;  1BBW A;  1Y1W H;  3S14 H;  2PQA B;  4XIG S;  4DPG A;  1K3R A;  2UU9 L;  5IYD G;  4NXM Q;  1CKN A;  1IXR A;  3J80 i;  1J5E L;  2GVA A;  2Q2U A;  2JQO A;  3GTJ H;  1PHJ A;  2UUA Q;  3PGZ A;  5FLM H;  4DV5 Q;  4A3G G;  2Z0S A;  3K7A H;  1VQB A;  4UP9 A;  5LMN Q;  1PA6 A;  4L5R C;  2UUB L;  4LF4 L;  1XNR Q;  1PYS B;  4B3T Q;  1TWH H;  3CP0 A;  3HKZ G;  3NEL A;  1LTL A;  1K8G A;  2FXQ A;  2I5M X;  3U4Z A;  3MEF A;  3TQY A;  5JJL A;  4POF A;  4C3J H;  2DGY A;  3FHW A;  3PIO A;  2K75 A;  4DR4 Q;  4X64 Q;  2B63 H;  1IBL Q;  3PSI A;  1X65 A;  4JI2 Q;  1XPR A;  3CC4 A;  4JI0 Q;  3HFZ B;  1IYJ B;  3A74 A;  3ER0 A;  3KFU A;  1KRT A;  2OCE A;  1IBM Q;  4B3S L;  1FJG L;  1JT8 A;  1CSP A;  3PUW A;  4KHP Q;  2HQL A;  1VQP A;  3S15 H;  1TWF H;  1YNX A;  4DUZ L;  3E9H A;  4LFB L;  1HZA A;  1PH3 A;  4JI6 L;  4QQB X;  2KHJ A;  2Q2I A;  4IPH A;  1N34 Q;  5GAH C;  5AJ3 L;  5JJI A;  1PH5 A;  1A63 A;  4IFD J;  3RR5 A;  4JI5 L;  1HNW Q;  1HNX L;  2CWA A;  3MXN B;  4MZ9 A;  3RNU A;  3NBH B;  3CCM A;  3H3V I;  5IYB G;  4HJ9 A;  1ASY A;  4MNO A;  4HJ7 A;  4JCV E;  1HZB A;  4NB3 A;  4A3J G;  1CUK A;  4LF6 Q;  1V1Q A;  1ASZ A;  4LF5 Q;  3T1H L;  1K0R A;  1G29 1;  1IZ6 A;  5H1S E;  1K9M C;  3HOZ G;  3ULJ A;  4NPS A;  1Q7Y C;  4B3M L;  1NBW A;  1KRS A;  1TWA H;  1QZH A;  5C44 H;  2VY3 A;  1N9W A;  4GN4 B;  3UDF A;  3GTP H;  2IHE A;  4DV4 L;  4LF7 L;  2ASB A;  1C9O A;  1VQI A;  1T9H A;  2CKZ B;  2UXC L;  5LMN W;  4A3D G;  2IY5 B;  1L1O A;  3BZC A;  5E7N A;  1D7Q A;  5IP7 G;  1GVP A;  2IX0 A;  2PMZ E;  2QGQ A;  3AFQ A;  3Q8D A;  1X55 A;  4JBJ A;  2E5L L;  5ELO A;  3KLW A;  1A8V A;  4IJL A;  1VQO A;  3CCL A;  3PF4 A;  4BXX H;  3CQZ H;  3I55 A;  1A62 A;  1KAW A;  1Q8K A;  4GKK L;  3TRZ A;  4QY7 A;  5BR8 Q;  4GKJ L;  3I2Z A;  4HIM A;  2YTY A;  1YJW A;  3I4N G;  4A3B G;  4K0K Q;  2VS1 A;  4LNQ A;  2JA8 H;  4JC0 A;  1C0A A;  4XTC S;  1AE2 A;  3FKI H;  3D0F A;  1N32 L;  2HHH Q;  1OXT A;  1LYL A;  2WB1 G;  3GDE A;  4YWM A;  3WWV A;  4LFA L;  1S40 A;  4KLK A;  2MFI A;  2QEX A;  4DNI A;  2VQF Q;  4DR3 L;  2JA6 G;  4LUZ A;  4R4O A;  3J81 j;  1XMO Q;  4A3C H;  4A3E G;  3H0G H;  3AFP A;  5C0X J;  3KOJ A;  3GTO H;  3E9I A;  1KD1 C;  1HZC A;  3OW2 A;  1E22 A;  5K36 G;  5JEA J;  1VQF A;  3GD7 A;  3EBE A;  1PVO A;  2ZJR A;  4O2D A;  2R92 G;  4A3L G;  4KI0 A;  1EYG A;  1D8L A;  3NEN A;  3CCV A;  4ALP A;  2UXD L;  4X65 L;  1Q1B A;  3S2H H;  1M90 C;  2C35 B;  1HR0 Q;  3OTO Q;  1Y1V H;  2QA4 A;  3FP9 A;  3RN2 A;  4P71 A;  2ID0 A;  1AH9 A;  2JA5 G;  5C4X H;  2WP8 J;  4DR5 L;  4POG A;  1W3S A;  4JBK A;  3J7Z C;  4OO1 G;  4QGU A;  2WFW A;  3RN5 A;  1Z9F A;  2AWN A;  1NE3 A;  4A3I H;  1FL0 A;  2NZO A;  1PH6 A;  4OX9 Q;  4HJA A;  1I3Q H;  2AHO B;  4BY1 H;  4DR7 Q;  2EXD A;  5IP9 H;  4JI8 L;  1KC8 C;  3RLF A;  3RZD H;  3TS0 A;  2UXB Q;  4IPD A;  4NXM L;  3PUV A;  1VQM A;  1EOV A;  1CKM A;  1SFO H;  1QUQ A;  4PMW A;  2R7Z G;  2RHQ B;  1SRU A;  4DV5 L;  1YJ9 A;  4DV2 Q;  5LMN L;  1VQC A;  1BVS A;  4DKA C;  5M3F G;  1YJN A;  1N8R C;  3HOU H;  5IYC H;  2VQE Q;  2K50 A;  1L2F A;  2OQ0 A;  4DV6 Q;  4BY7 H;  2LXK A;  1YBY A;  4BA1 I;  3HOX H;  3HOW H;  4JBW A;  4YHH L;  3PO2 G;  2NZH A;  1SRO A;  2UUC L;  1PH1 A;  1DGS A;  1VQD A;  1B70 B;  3L2P A;  4X64 L;  2VL6 A;  4HIO A;  1TWG H;  4JI0 L;  3CCJ A;  1LUZ A;  4A3K H;  4A75 A;  2I5L X;  4C2M H;  1IBM L;  4NXN Q;  4TQU S;  2L15 A;  2F52 A;  5M5Y H;  1EIY B;  2OTL A;  4X66 Q;  3H3V H;  3NEM A;  1UE5 A;  1RL2 A;  1OXU A;  4BBR H;  5IYD H;  1XMQ L;  5GAE C;  1QVF A;  2JEA I;  4A3F G;  2B3G A;  1YIJ A;  4OO1 I;  4PZ7 A;  4A3G H;  1VQ9 A;  1O7I A;  1KL9 A;  4LUV A;  1XPU A;  1K73 C;  2UU9 Q;  3W5O A;  1EWI A;  4DR6 L;  3TEH B;  4LF9 L;  2NVT H;  2JA9 A;  1XNQ L;  1J5E Q;  3KDF A;  4LFC L;  2ZM6 L;  4H02 A;  3CCQ A;  4JI4 Q;  1K83 H;  2VUM G;  4HJ8 A;  3S1R H;  4RG1 A;  1P16 A;  1BKB A;  4LF4 Q;  2UUB Q;  2OTJ A;  2Z6K A;  2WAQ E;  4GLX A;  3I4M G;  1NTG A;  2YV5 A;  4BBS G;  4JI3 L;  3BJU A;  2K5V A;  2ZJQ A;  1MJC A;  1JMC A;  1PH2 A;  3J81 c;  3PUZ A;  1EQR A;  1NMG A;  4YCU A;  2R6G A;  4LF5 L;  4LF8 Q;  1PYB A;  2A19 A;  3W1B A;  1PH9 A;  3CPW A;  4DV0 Q;  1YZ6 A;  4IOC A;  3UDI A;  4JYA L;  4GLV B;  4DK6 C;  1X56 A;  2CWP A;  1FJG Q;  3M3Y H;  5ELN A;  3IRB A;  1KIX A;  1JJG A;  3ERS X;  4JI1 Q;  4JBM A;  4DUZ Q;  1JB7 A;  1R9T H;  2N49 A;  2E2H H;  3PF5 A;  4JV5 L;  5C44 G;  1I94 Q;  2A1A A;  2IT1 A;  2NVQ H;  3U58 A;  3GTM H;  2MO0 A;  5AJ3 Q;  2AMC B;  2K5N A;  2RF4 A;  4DV1 L;  1PH4 A;  4JI5 Q;  1CKO A;  1HNX Q;  2DUD A;  5JJK A;  3PV0 A;  1G6P A;  1HZ9 A;  1UWV A;  5M3M G;  4JOI A;  4A3J H;  3ULP A;  5GQO A;  3AYH B;  3TRE A;  3RLN A;  4DV3 Q;  1QZG A;  5GRO A;  1PH7 A;  3G71 A;  2ATW A;  4AH6 A;  4GNX A;  2JA7 G;  4APV A;  4X62 L;  2NN6 G;  3K80 C;  1S72 A;  3HOZ H;  4GLA C;  3EIV A;  3ULL A;  3K7U C;  2BH2 A;  3HOY G;  1N33 L;  2VW9 A;  2MO1 A;  4IPG A;  4YWL A;  4QL5 A;  4YCW A;  2K52 A;  1QUQ B;  1OXS C;  1X54 A;  5LMU L;  3F1Z A;  2N3S A;  1XMO L;  3ICE A;  1UE7 A;  1A0I A;  3HOV G;  4B3M Q;  3M7N A;  4X6A H;  1CKN B;  3AQQ A;  4A3D H;  3BU2 A;  4AIM A;  1X3E A;  3UE0 A;  5IP7 H;  1N36 L;  4A3C G;  2PI2 A;  4DV4 Q;  4A3M G;  4LF7 Q;  3W1G A;  2UXC Q;  2BA0 A;  1MIU A;  1RIP A;  2YTX A;  2E5L Q;  1E1O A;  3PUY A;  2CQO A;  4KHZ A;  1JE5 A;  3I4N H;  1E7Z A;  1PFS A;  3CXC A;  3CCS A;  4Y7N H;  4PZ6 A;  3F2B A;  1VQJ A;  1YI2 A;  3PCO B;  4GOP A;  1NJI C;  4A93 G;  1FVI A;  4GKJ Q;  1EFW A;  3KJP A;  1VQH A;  4DR1 L;  2ES2 A;  3RZO H;  3ZJY C;  4B3R L;  1E24 A;  3GO5 A;  2JA6 H;  3S1Q H;  1OXX K;  1XPO A;  4P75 A;  4YY3 L;  3CPF A;  3KJO A;  3S16 H;  4JI7 L;  4R4T A;  4A4I A;  3CME A;  4LFA Q;  1WCM G;  4DR2 Q;  2JK8 A;  1SE8 A;  2H5X A;  4MTN A;  1YHB A;  3KDF B;  1L0W A;  4DR3 Q;  5IWA L;  5C4X G;  5FJ8 G;  2NN6 I;  4L5T A;  3T1Y L;  2JEB I;  1HNZ L;  1KHI A;  3G4S A;  1VQK A;  4OX9 L;  2R93 G;  4Y52 H;  4DR7 L;  4C3I H;  1Q1E A;  5IT9 c;  4DV7 L;  1X6O A;  4AQY L;  4AYB E;  3CCU A;  5C3E G;  2R92 H;  4DUY L;  3S17 H;  1FGU A;  3M9B A;  5GAG C;  1V43 A;  2ZTE A;  1TXY A;  2MQH A;  1OXV A;  3M85 A;  4OON A;  3PO3 G;  2OQK A;  3U4V A;  2AKW B;  5IP9 G;  3F2C A;  1NY4 A;  4PG3 A;  4UPA A;  2UXD Q;  2R7F A;  3JC6 6;  4X65 Q;  1MKH A;  3BZK A;  3S24 A;  1Y1W G;  2F3I A;  2UUA L;  2E2J H;  5IY0 A;  2JA5 H;  3E0E A;  2LXJ A;  1WYD A;  2KHI A;  1YVC A;  3SGI A;  1XNR L;  2ZJP A;  4EQ5 A;  3OYY A;  4B3T L;  3EN2 A;  1IBK Q;  3M4P A;  3M4Q A;  1K8A C;  1SN8 A;  4R1J A;  1EQQ A;  3D31 A;  5FLM G;  4DR5 Q;  4HID A;  2WAQ G;  1MJE A;  5HY6 A;  2LSS A;  3JAM c;  5GAD C;  1VQA A;  5C0X G;  5EAY A;  4HJ5 A;  3AEV A;  4DR4 L;  1L1O B;  1GKH A;  1IBL L;  4R4C A;  4X66 L;  1Q81 C;  1B8A A;  1GD7 A;  3STB C;  1HJP A;  2VZA A;  2JE6 I;  4JI2 L;  4A3K G;  4OWX B;  1UE1 A;  5JEA G;  3F8T A;  2N78 A;  2VNU D;  4JG2 A;  1KQS A;  4KHP L;  4GNX B;  2B63 G;  3KF6 A;  1SR3 A;  4JI8 Q;  4GN3 B;  1M1K C;  2R7Z H;  3CMA A;  2F4V Q;  2BA1 A;  1X3F A;  4BBR G;  2KEN A;  5M3F H;  4LW1 A;  2A8V A;  4WJ4 A;  1VQ8 A;  4DK3 C;  1N34 L;  1G51 A;  4JI4 L;  3GTL H;  2IHF A;  4YWK A;  1HR0 W;  3PO2 H;  2BH8 A;  1HNW L;  4DAM A;  1V9P A;  2E8G A;  1VS0 A;  2AWO A;  2EIF A;  1YHA A;  2I0Q A;  2RHS B;  4QJF A;  4YHH Q;  1C7Y A;  2UUC Q;  3K0X A;  4LF8 L;  2N8N A;  1SLJ A;  4A76 A;  2ZTC A;  2V1C C;  4DV0 L;  3K81 C;  2JJQ A;  4LF6 L;  1VQ7 A;  2GVB A;  2IX1 A;  1SMX A;  3KYH C;  4IJH A;  4IPC A;  4A3F H;  2KCT A;  3CCE A;  3DLL A;  2YYZ A;  1WJJ A;  4GOP B;  1I50 H;  4JI1 L;  4LWC A;  1KXL A;  4B3S Q;  3UDX A;  1XMQ Q;  4FDB A;  4R4I A;  5DLQ E;  4TVA B;  3CAM A;  2E2I H;  1I94 L;  5C0X I;  1OTC A;  2EQS A;  2D62 A;  5HGQ A;  2VUM H;  5M5X H;  3S1M H;  4LFB Q;  4DR6 Q;  4LF9 Q;  4JI6 Q;  3RLO A;  1XNQ Q;  2CCZ A;  4A3L H;  3I4M H;  4LFC Q;  2PNH A;  4BBS H;  2ZM6 Q;  5M5W H;  5IYB H;  2MNA A;  1I5F A;  2I5H A;  1P8L A;  2ZTD A;  3HKZ E;  1WOC A;  1XTD A;  4L5Q A;  4DV3 L;  3H15 A;  2Q2H A;  1QVC A;  3PUX A;  1S3O A;  3CW2 C;  5BR8 L;  3CF5 A;  1VQ5 A;  4JI3 Q;  3B6Y A;  1VQN A;  1I6H H;  1UEB A;  1X3G A;  3L0O A;  4K0K L;  3I56 A;  4BXX G;  1QVG A;  2RCN A;  2PQA A;  3A0J A;  2B29 A;  3LGJ A;  1Q46 A;  2HHH L;  4JYA Q;  1J6Q A;  3G48 A;  3JAM i;  3T1H Q;  1EIF A;  2GN5 A;  3UDG A;  2JA8 G;  3FKI G;  2VQF L;  3STB D;  3I4O A;  4UP8 A;  4WJ3 M;  3I7F A;  2HT1 A;  2XTI A;  3F2D A;  4JV5 Q;  1U0L A;  1W2B A;  2YU9 H;  5M3M H;  2HIV A;  2Z6K C;  1YHQ A;  1X9N A;  3GTK H;  4DV1 Q;  4IFD G;  3CD6 A;  4O0A A;  3L7Z C;  3CCR A;  4ME3 A;  4AYB G;  1H95 A;  1GO3 E;  3H0G G;  3J80 c;  2Q2T A;  2XGT A;  2K14 A;  1UE6 A;  2JA7 H;  4OWT B;  1WFQ A;  4GS3 A;  2HIX A;  4A3B H;  3HOY H;  4P74 A;  3S1N H;  1Y14 B;  3A5Z B;  2K5H A;  4UP7 A;  3PIP A;  1EUJ A;  1TWC H;  1NMF A;  4X62 Q;  4GKK Q;  1HR0 L;  1BBU A;  3OTO L;  3KF6 B;  3HKS A;  5J3B A;  3HOV H;  2ALY B;  1VQE A;  1N33 Q;  4YCV A;  2Y0S G;  4C3H H;  5IE8 A;  1LM0 A;  4IOA A;  4DR2 L;  1Q12 A;  1GM5 A;  5LMU Q;  1N32 Q;  3UE1 A;  4A3E H;  1Y1V G;  1Q82 C;  3J81 i;  4A3M H;  3K8A A;  1IL2 A;  2NVY H;  2YTV A;  2OWO A;  5C4J H;  1L1O C;  4P72 A;  4DAY B;  4JOI C;  3CC7 A;  1N36 Q;  1E1T A;  4P73 A;  4RMF A;  1YIT A;  4A3I G;  4A93 H;  1Z47 A;  3TS2 A;  4L5S A;  4IO9 A;  4GNX C;  1YEZ A;  1XJV A;  2UXB L;  1VCI A;  1VQG A;  4BY1 G;  4EX5 A;  1AE3 A;  3G6E A;  1E3P A;  4PZ8 A;  2D0P A;  1VQ4 A;  4LUO A;  1JJ2 A;  3CC2 A;  4DV2 L;  4BA2 I;  4OWW B;  4IFD I;  4DR1 Q;  4R4Q A;  3M4O H;  2CFM A;  1JJC B;  1WCM H;  2K4K A;  2VQE L;  1IBK L;  2R7D A;  1CSQ A;  4B3R Q;  2WB1 E;  2D0O A;  2Y0S E;  4DV6 L;  3S2D H;  1U5K A;  5FJ8 H;  3DM3 A;  4YY3 Q;  1PH8 A;  4JI7 Q;  2R93 H;  4J15 A;  3A5U A;  3GTQ H;  3HOU G;  5IYC G;  1WI5 A;  4UY8 C;  4BY7 G;  3GTG H;  2PI2 E; 
#chains in the Genus database with same CATH topology
 1PV4 A;  3HOX G;  1HPC A;  3HOW G;  1B1Z A;  3OIP A;  2KCM A;  3U50 C;  3VDY A;  1HH2 P;  3DHQ A;  5TSS A;  1ICW A;  1LV9 A;  4AQY Q;  2A5H A;  3J7A 5;  4GOP C;  1Q86 C;  3LX0 A;  2O5J C;  1K3R A;  3OOC A;  4NXM Q;  1CKN A;  2KOL A;  1J5E L;  1TWC B;  2QCP X;  2GVA A;  4DV5 Q;  3K7A H;  5LMN Q;  4RHR A;  5CR3 A;  3U4Z A;  3MEF A;  2A69 C;  5DNF A;  4DAP A;  3NHH A;  3PIO A;  2K75 A;  2F0F A;  5C4J B;  2B63 H;  1XPR A;  4QIW B;  5T1I A;  3KFU A;  1QB5 D;  1KRT A;  1IBM Q;  1FJG L;  1CA5 A;  4A93 B;  4KHP Q;  2R92 B;  3S15 H;  1TWF H;  1S5F D;  1KDC A;  1TVX A;  2EDG A;  3Q0A A;  3E9H A;  2EY1 A;  1EWC A;  1HZA A;  2K5W A;  5BN4 A;  5FOB B;  2ZXO A;  1PH5 A;  1A63 A;  3RR5 A;  1I4R A;  1SE4 A;  2KED A;  3PQI A;  4MNO A;  5ELF A;  2WIN B;  4A3J G;  1V1Q A;  2EXZ A;  1ASZ A;  2NVX B;  1K0R A;  1SSO A;  1KNE A;  3E0J A;  1K9M C;  1CFM A;  4FF2 A;  2J4X A;  4NPS A;  1RKN A;  1TWA H;  1QZH A;  3K59 A;  3UDF A;  2DJG C;  1FNW A;  4DV4 L;  2CKZ B;  2I07 B;  1ESR A;  2E5L L;  2IX0 A;  2F4I A;  3R93 A;  5COY A;  1TWH B;  3I55 A;  1Q8K A;  5KRU A;  2HDM A;  1DOM A;  4HIM A;  3DWQ A;  4C3J B;  4A3B G;  2AQ2 B;  2BOS A;  4XTC S;  1AE2 A;  5D3I B;  3TBI B;  3D0F A;  1HXY D;  1OXT A;  2A69 D;  4YWM A;  3F2U A;  1PRT C;  2MFI A;  2GA4 B;  3I70 A;  2PNR C;  4O1N A;  2JA6 G;  4OIK A;  3J81 j;  1XMO Q;  1ESF A;  2CHB D;  3AFP A;  3KOJ A;  3GV6 A;  5KNC A;  2B2V C;  1SDF A;  5JEA J;  1E0B A;  3NWS A;  4O2D A;  2ENB A;  2P5Z X;  1TU2 B;  1B2T A;  3BDL A;  3S2H H;  4X3T A;  4K8J A;  1DZ1 A;  1KLU D;  2EOT A;  3RN2 A;  4P71 A;  2HCC A;  2JA5 G;  5C4X H;  4DR5 L;  4OO1 G;  4K5W A;  4G7H C;  3GTP B;  3MC0 B;  3I72 A;  1ILQ A;  4BY1 H;  4DR7 Q;  3IAY A;  1JWM D;  4HTH A;  4NXM L;  2SEB D;  3BS1 A;  2RHQ B;  4DV5 L;  2R3Z A;  1F2L A;  5LMN L;  4CDE C;  1YJN A;  3HOU H;  2TSS A;  3FKI B;  4R8N A;  1A3V A;  4DV6 Q;  1YBY A;  3HOX H;  3HOW H;  3PO2 G;  1VQD A;  1B70 B;  4ILW A;  4HIO A;  2F3V A;  4A75 A;  1IBM L;  4TQU S;  2L15 A;  1PRT D;  1EIY B;  4X66 Q;  1IYV A;  2PW5 A;  2NBF A;  2O4X A;  4BBR H;  1MSG A;  1QVF A;  2B3G A;  1YIJ A;  1VQ9 A;  1AEX A;  1O7I A;  2K7V A;  2K6A A;  1K73 C;  3KBX A;  3OMC A;  5K5P A;  4DR6 L;  4NDX A;  2EYJ A;  2NVT H;  2JA9 A;  1XNQ L;  4LFC L;  1Y1V B;  2VUM G;  4HJ8 A;  1HCZ A;  2Z6K A;  3EFX D;  1B4O A;  4XQJ A;  4EGV A;  4HED A;  1NMG A;  1RCV D;  4R8I A;  1U4L A;  4FNF A;  1YZ6 A;  3ZYY X;  4IOC A;  3NK9 A;  4IUU A;  3IRB A;  1GUN A;  2G5D A;  4JI1 Q;  4JBM A;  4DUZ Q;  2N49 A;  5D65 A;  4DGZ A;  2NVQ H;  2K5N A;  5JOB A;  1PH4 A;  4BY7 B;  1HZ9 A;  1G6P A;  5M3M G;  4A3J H;  4X3S A;  2WAQ B;  3TRE A;  1JOO A;  3AYH B;  3QG1 A;  1SXT A;  3GV3 A;  1PH7 A;  2KVM A;  1PDQ A;  4AH6 A;  5E1F A;  3K80 C;  3L3O C;  4A3K B;  4GLA C;  3K7U C;  3HOY G;  4IPG A;  4YWL A;  1G91 A;  2K52 A;  1KDB A;  2N3S A;  1XMO L;  3M7N A;  4X6A H;  1F2Z A;  4DN4 M;  4EQP A;  1EY8 A;  3DUZ A;  3S15 B;  4ZAI A;  1N36 L;  2PI2 A;  2F0K A;  1BNZ A;  2JP1 A;  2RDG A;  3SK8 A;  3PUY A;  2BDO A;  4KHZ A;  5I6Y A;  1SJE D;  3TZU A;  3CXC A;  4GZY C;  4A93 G;  4PZ6 A;  2F0M A;  1FVI A;  1CK1 A;  4GKJ Q;  3SR1 A;  1MBY A;  2XRS D;  1E24 A;  3TDQ A;  3WOE A;  2F0D A;  3PIO 3;  2JA6 H;  3S1Q H;  4B08 A;  2K05 A;  2G9D A;  5EGT A;  4LFA Q;  2K5Q A;  1SE8 A;  4EVO A;  1CT1 D;  1YHB A;  5F2D A;  5L37 A;  1O7L A;  4KY6 A;  5KYI A;  4L5T A;  3K0Y A;  2E2H B;  2R93 G;  2EJF C;  3P7J A;  4DR7 L;  2PYK A;  3TZD A;  3CCU A;  3GTM B;  2EYH A;  1ZKO A;  3S17 H;  5EKI A;  1AN8 A;  2CQA A;  2Z9H A;  3SK5 A;  5CV9 A;  2IJ0 A;  1ROD A;  4DK0 A;  4X65 Q;  4F7X A;  1G6Z A;  4XT1 B;  3HOZ B;  4G4K A;  2JA5 H;  1WYD A;  2F0I A;  2KHI A;  2OF1 A;  4CBV A;  1XNR L;  4NP5 A;  4EQ5 A;  3OYY A;  2ZJP A;  2B8G A;  3EN2 A;  4OO1 H;  3M4Q A;  1G2T A;  4R1J A;  1EQQ A;  4N8F A;  2B2Y A;  1UNS A;  2FMM A;  5EAY A;  4DR4 L;  4A3D B;  1L1O B;  4X66 L;  1HRJ A;  4FYD A;  3STB C;  2FHT A;  2JE6 I;  2OXP A;  2VZA A;  4OWX B;  4C3J G;  2MJ8 A;  4JI8 Q;  1SR3 A;  1GHK A;  1M1K C;  1LTT D;  3MA2 B;  1DOK A;  3M7G A;  2DY7 A;  5IOC A;  1PLF A;  4ULL A;  3GTL H;  4YWK A;  1SNQ A;  4P2C B;  3PO2 H;  2WB1 B;  2Y0S B;  3S2H B;  1VS0 A;  1YHA A;  3EVQ A;  2I0Q A;  2UUC Q;  1LTI D;  2EJG C;  3E6Z X;  1SLJ A;  1XX8 A;  2V1C C;  3C1F A;  4LF6 L;  4QCL A;  1SND A;  2IX1 A;  2KCT A;  2IPK D;  3HEJ A;  1WJJ A;  3VYR A;  3H94 A;  4JI1 L;  2Q8T A;  4BY1 B;  1M8A A;  4B3S Q;  2F0S A;  4N9T A;  1OTC A;  2EQS A;  2RVL A;  2VUM H;  5M5X H;  4LF9 Q;  4JI6 Q;  4IUQ A;  3DEP A;  3NTI A;  2ZM6 Q;  3WDN A;  5M5W H;  1EWH A;  2XVS A;  1JWU D;  3HKZ E;  1BQQ T;  4JI3 Q;  1PTO H;  4WRD A;  1BF4 A;  3HOW B;  4I7Z C;  1HA6 A;  1F9Q A;  1O80 A;  3I56 A;  1A2T A;  1F77 A;  3A0J A;  2B29 A;  3LGJ A;  1Q46 A;  1CZG A;  2HHH L;  3JAM i;  1EIF A;  2JA8 G;  5LHY 1;  3AU7 A;  3FKI G;  4PV1 C;  1D5X C;  3STB D;  1JIC A;  4WJ3 M;  5M3F B;  1H9R A;  4HMJ A;  1U0L A;  5M3M H;  1BBX C;  1YHQ A;  4DV1 Q;  4DXF A;  3CD6 A;  3L7Z C;  4AYB G;  4DFA A;  4EQO A;  2XGT A;  3A7L A;  3TP8 A;  1PRT F;  3HOY H;  1Y14 B;  1AFP A;  3NE5 B;  4LJZ C;  1TWC H;  1BBU A;  3MHB A;  3KLS A;  3OMG A;  3MFY A;  4J1M A;  5IE8 A;  3Q22 A;  1KLG D;  1BXT A;  1X3Q A;  4M1U B;  1I50 B;  1N32 Q;  1GUS A;  1AW7 A;  1Y1V G;  3Q24 A;  3MXN A;  3K8A A;  2YTV A;  3NBH A;  2OWO A;  3H09 A;  1JOR A;  3NUC A;  5C4J H;  1WTQ A;  4KKU A;  1SYE A;  4JOI C;  3CC7 A;  2PMZ B;  4A93 H;  3TS2 A;  1SE3 A;  4DAV A;  4L5S A;  1SNC A;  3VR2 A;  4GNX C;  4IO9 A;  2UXB L;  3BZD B;  1VCI A;  3P75 A;  4KHV A;  1K3B C;  1I4X A;  3S1M B;  4OGQ C;  3MXU A;  2D0P A;  1S5C D;  2LS0 1;  3W3A A;  4WOR A;  4OWW B;  2NWG A;  3BG3 A;  4YY3 Q;  3K5O A;  2R93 H;  3A5U A;  3GTQ H;  1WI5 A;  4BY7 G;  4XXE A;  4B9W A;  3Q23 A;  2D5D A;  4RWS C;  2NVX H;  1TQO A;  1PFN A;  4H0L C;  4QIW E;  2YU9 B;  1LTG D;  4DUY Q;  4GN5 A;  2JA7 B;  5EKK A;  3C3L A;  4XIG S;  4DPG A;  2F1M A;  4RKL A;  4A3B B;  3NBI A;  2XSC A;  1ZEQ X;  1RTO A;  3J7A F;  2CW0 D;  2QW7 A;  2Z0S A;  3QIA A;  1VQB A;  1TWH H;  3NEL A;  2I5M X;  1PFB A;  4A3M B;  5JJL A;  4C3J H;  2D9U A;  1IBL Q;  4JI2 Q;  3E5S A;  3HFZ B;  1IYJ B;  4B3S L;  1JT8 A;  2EVB A;  1B50 A;  1YNX A;  4RH6 A;  2K03 A;  4JI6 L;  1ENA A;  1F2Y A;  1NCV A;  1N34 Q;  1EYC A;  1NNX A;  4DA2 A;  5AJ3 L;  1O7Y A;  3FDT A;  4QUC A;  1DON A;  2KCN A;  4JI5 L;  1HNW Q;  3MXN B;  4KD3 A;  3NBH B;  5DEH A;  4ZK9 B;  2HQE A;  1NAP A;  4JCV E;  1HZB A;  4NB3 A;  5D14 A;  3K57 A;  3VR3 A;  4NW2 A;  3PO3 B;  4FXD A;  3I73 A;  1G29 1;  3P20 A;  5H1S E;  5KIX A;  4ZKC B;  3HOZ G;  4HAE A;  1HUN A;  2L5T A;  5A35 A;  2XIW A;  3GTP H;  2K33 A;  2HD3 A;  2IHE A;  1QCB D;  4UDU C;  4LF7 L;  3D6W A;  2ASB A;  1VQI A;  1T9H A;  2UXC L;  4A3D G;  3BZC A;  2FIN B;  5E7N A;  5IP7 G;  2QGQ A;  1X55 A;  3DWA A;  5IOD A;  4IJL A;  1A8V A;  1VQO A;  1DD2 A;  2I46 A;  3CCL A;  1A62 A;  2NTS A;  3BYT B;  1PTO C;  3I2Z A;  2EE1 A;  4K0K Q;  4MTK A;  2JA8 H;  3FKI H;  2CVR A;  5IIF A;  1N32 L;  4ZQ3 A;  2WB1 G;  3GDE A;  1JOK A;  4KLK A;  4DNI A;  1O78 A;  4DR3 L;  4IAL A;  4LUZ A;  2XRQ D;  1KDA A;  1QIL A;  3LWE A;  2WKD A;  3O13 A;  3OPO A;  4K2L A;  2VUM B;  5M5X B;  1HZC A;  5C5L A;  1E22 A;  5K36 G;  2G9H D;  1QNK A;  1VQF A;  1FD7 D;  3EBE A;  1PVO A;  1F9P A;  5M5W B;  3CRL C;  4KI0 A;  1EYG A;  1RF2 D;  3CCV A;  2UXD L;  4O42 A;  1Q1B A;  3U9O A;  3OTO Q;  2ZXP A;  1RJT A;  1LT5 D;  1U4P A;  1Y1V H;  3FP9 A;  2QA4 A;  3I8Z A;  4RGT A;  1E2V A;  3G7L A;  1AH9 A;  1IHZ A;  4POG A;  4XQQ A;  4H44 C;  3J7Z C;  1LTB D;  2WFW A;  4B9X A;  1A15 A;  1LT3 D;  3MWY W;  1TT2 A;  4KJN A;  4HJA A;  3GP7 A;  1D5Z C;  5M3M B;  2X6G A;  1KC8 C;  2Z1C A;  3A55 A;  2C9O A;  1TR5 A;  2PO4 A;  1PZK D;  1QUQ A;  4C1N I;  1SRU A;  4R9W A;  3HOY B;  4DV2 Q;  4RA8 A;  3OHX C;  5M3F G;  1AZP A;  1BVS A;  3KLS X;  5IGB A;  4BY7 H;  4IZ8 A;  1PTO D;  4G7Z C;  4JBW A;  4YHH L;  2NZH A;  1SRO A;  1CQV A;  4BWG B;  2VL6 A;  1SEB D;  4KN4 C;  4A3K H;  3D6C A;  5CYU A;  2I5L X;  5CBA E;  3A8K E;  4NXN Q;  5M5Y H;  3H3V H;  2B39 A;  3NEM A;  1UE5 A;  1RL2 A;  1HA5 A;  1I4H A;  5CV8 A;  2PZU A;  4FO2 A;  5JVH 3;  2QEJ C;  1DOL A;  4LUV A;  1XPU A;  2UU9 Q;  1EIG A;  1EWI A;  2F3W A;  4K2K A;  3R2T A;  3KDF A;  3CCQ A;  4H02 A;  4JI4 Q;  2E2D C;  3QJY A;  1EYD A;  5EPJ A;  1UEA B;  2UUB Q;  4LF4 Q;  4J8Q A;  2WAQ E;  4GLX A;  1NTG A;  2A74 C;  4BBS G;  2K5V A;  2ZJQ A;  2F0O A;  4HMI A;  1WVL A;  4Q5V A;  1PH2 A;  3GTQ B;  2R93 B;  1D6E C;  5J1Z A;  4YCU A;  4LF8 Q;  1PH9 A;  3CPW A;  5IT9 L;  4MIU A;  4N8X 1;  2LFN A;  2XWJ B;  3UDI A;  4JYA L;  1X56 A;  3RZD B;  2RBM A;  4JK1 C;  3SDZ A;  4KJO A;  2E2H H;  3PF5 A;  4JV5 L;  3DMU A;  5C44 G;  1SFO B;  1I94 Q;  2IT1 A;  2MP1 A;  4ID6 A;  3GTM H;  4DNR B;  1HTP A;  1HNX Q;  5JJK A;  1FGB D;  2AUK A;  1NUC A;  2KQ3 A;  5GQO A;  5C4Z A;  5J22 A;  2ATW A;  2M9V A;  4APV A;  5CBE E;  2NN6 G;  2JA7 G;  3HOZ H;  2L0C A;  2BH2 A;  3EIV A;  3ULL A;  3NP8 A;  4CKE A;  3R2I A;  1N33 L;  4QL5 A;  1QUQ B;  1OXS C;  3K5M A;  3F1Z A;  3ICE A;  4B3M Q;  1WTV A;  1VF5 C;  1CKN B;  5KNB A;  2L55 A;  4A3D H;  1KTK A;  4AIM A;  4A3G B;  2L11 A;  1LTA D;  3UE0 A;  4DNT B;  5IP7 H;  4A3C G;  4A3M G;  1GJX A;  2BA0 A;  1JE5 A;  2JYO A;  1PFS A;  4Y7N H;  2MHV A;  1DYQ A;  3T4A C;  3I3C A;  4OIJ A;  1RD9 D;  3KJP A;  1LLR D;  1VQH A;  1EY9 A;  5IGF A;  3SXH A;  1XPO A;  4RGO S;  5E4X A;  3VA5 A;  3KJO A;  3EJI A;  4JI7 L;  1ENC A;  3QB3 A;  3M3Y B;  4YIJ A;  1F9R A;  2JK8 A;  3KDF B;  4OEM B;  2K04 A;  1H9S A;  1VQK A;  2JEB I;  1KHI A;  2B8F A;  5K36 H;  2KEE A;  5IT9 c;  1X6O A;  4AQY L;  5G3L F;  5LL6 S;  5GAG C;  2ZTE A;  3PO3 G;  1WD1 A;  5IP9 G;  2SNM A;  4JVZ A;  1NY4 A;  1CQF A;  1H9J A;  3JC6 6;  3BZK A;  1BCP B;  2F3I A;  2E2J H;  3QWN A;  3E0E A;  2LXJ A;  2JA8 B;  1EL0 A;  3M4P A;  1K8A C;  1SN8 A;  1F9S A;  5FLM G;  2B2T A;  2F0P A;  5COR A;  4HID A;  1MJE A;  5HY6 A;  3OWE B;  4BS9 A;  1VQA A;  5C0X G;  1GKH A;  1B8A A;  4AYB B;  1UE1 A;  3C46 A;  2N78 A;  2RCF A;  3K6O A;  2HUG A;  4JG2 A;  4KHP L;  2L1B A;  3KF6 A;  3CMA A;  4C1N K;  1X3F A;  5M3F H;  1VQ8 A;  4DK3 C;  3D4D A;  4TSS A;  2EYP A;  1G51 A;  4JI4 L;  2F0W A;  2K01 A;  1PFM A;  1V9P A;  3S16 B;  3CU7 A;  1STY A;  1C7Y A;  3I91 A;  1WTX A;  4LF8 L;  2PQE A;  2N8N A;  1K8O A;  1VQ7 A;  1IW7 C;  1IL8 A;  3DEO A;  4WFN 3;  1FYC A;  3H3V C;  1BUV T;  1I50 H;  1GUT A;  2MPM A;  2F0L A;  4LWC A;  1KXL A;  3UDX A;  1XMQ Q;  4R4I A;  1I94 L;  1FR3 A;  4DU9 A;  5HGQ A;  3VYU A;  4LFB Q;  1Q3L A;  4NMZ A;  1SMY C;  4ZRZ A;  4BBS H;  2MNA A;  5EPL A;  1H9S B;  2ZTD A;  1RHP A;  1WOC A;  4WJW A;  3H15 A;  1QVC A;  3PUX A;  1S3O A;  3S1M H;  1X3G A;  3L0O A;  2K5D A;  4BXX G;  2N88 A;  3OWF A;  2VB3 X;  2RCN A;  2PQA A;  1QVG A;  2ICI A;  4ZCK A;  2RSO A;  3G48 A;  3T1H Q;  5M5Y B;  5FLX L;  3UDG A;  3A56 A;  1A2U A;  4UP8 A;  2V4D A;  1X3P A;  2HT1 A;  1PTO F;  2YU9 H;  2Z6K C;  3MXP A;  4IFD G;  5E4W C;  4ME3 A;  1EFI D;  1IKM A;  1A6X A;  2K14 A;  1J8I A;  1UE6 A;  2JA7 H;  2O5I C;  2NN6 H;  4OWT B;  1WFQ A;  5FO7 B;  1S5B D;  4A3B H;  1CZW A;  4UP7 A;  3SHL A;  3PIP A;  4G7O C;  1EUJ A;  4GKK Q;  4X62 Q;  5C3W A;  3KF6 B;  1H9K A;  3HKS A;  5J3B A;  3NSW A;  4A3F B;  4UAI A;  3H91 A;  1GM5 A;  5LMU Q;  1E2Z A;  1Y8N B;  3J81 i;  1IW7 D;  4A3M H;  5IGD A;  1HQM C;  1TS4 A;  1XWE A;  1DCZ A;  1L1O C;  4P72 A;  1E1T A;  4P73 A;  1EY7 A;  5EQ0 A;  5KYL A;  4ZYS A;  2J0T D;  5IGE A;  3I4M B;  2EY2 A;  2Z6B A;  5CGK A;  1AE3 A;  3G6E A;  1JE4 A;  1E3P A;  4PZ8 A;  1VQ4 A;  3VYT A;  1SMY D;  1JJ2 A;  1SNP A;  1LT4 D;  3BVZ A;  4DR1 Q;  2CFM A;  2R7D A;  4B3R Q;  4DV6 L;  3S2D H;  1WD0 A;  1U5K A;  1PH8 A;  2L4N A;  4IUN A;  2M00 A;  5IYC G;  3NTK A;  5IWA Q;  3W2D A;  1HNZ Q;  3T1Y Q;  3PO3 H;  1WTO A;  1GUW A;  4DV7 Q;  3GTK B;  1B7Y B;  2QKI C;  1D2B A;  3IFT A;  5DM7 3;  4XYQ A;  4OXP A;  5FLX c;  4F8M A;  4HCE A;  1BBW A;  2F0G A;  2O2L D;  3S14 H;  2PQA B;  3NXW A;  3S1N B;  1HTL D;  4Y7N B;  1IXR A;  3URY A;  3DM1 A;  4RFB A;  3J80 i;  3J7A V;  2Q2U A;  2JQO A;  2UUA Q;  4A3G G;  2JN4 A;  3PGZ A;  5FLM H;  3HOV B;  1I6H H;  2IW3 A;  5C0X H;  4C3H B;  4B3T Q;  3CP0 A;  4S3S A;  3TQY A;  4POF A;  2DN8 A;  3MXG A;  2DGY A;  1GXD C;  3FHW A;  2KCC A;  4X64 Q;  4FF3 A;  2OCE A;  3TN2 A;  1KNA A;  1W6J A;  3PUW A;  3G6J B;  1DXM A;  4DUZ L;  1L0Y B;  2B2W A;  4LFB L;  1U9R A;  3EQL C;  3Q6S A;  4DXG A;  4QQB X;  4CDC C;  2KHJ A;  4HSV A;  4IPH A;  5JJI A;  5EJW A;  1WTP A;  3A7A B;  4IFD J;  2B2Y C;  1WCM B;  2CWA A;  4MZ9 A;  1NSN S;  2FMC A;  2VB2 X;  2E2J B;  4K5V A;  2BCO A;  5IYB G;  1ASY A;  2Q8R E;  3T13 A;  4HJ7 A;  5C3E B;  3VYS A;  3T1H L;  1MSH A;  1IZ6 A;  2BE5 C;  5LL6 X;  3ULJ A;  1Q7Y C;  2B2U A;  1I6V C;  4F87 A;  2VY3 A;  1N9W A;  4GN4 B;  1F2M A;  3QOL A;  4ZLT F;  3I90 A;  3HG9 A;  3DXJ C;  3GTJ B;  4MN3 A;  3AFQ A;  4UHV A;  5ELO A;  2CW0 C;  3KLW A;  3QO2 A;  3PF4 A;  4BXX H;  4GKK L;  1HUM A;  3OSO A;  1B53 A;  5BR8 Q;  3KBG A;  4GKJ L;  2PZW A;  2YTY A;  2VS1 A;  1SNO A;  3EA6 A;  4JC0 A;  1E2W A;  1CTM A;  1STE A;  2AUJ D;  4K6D A;  1LYL A;  3WWV A;  4LFA L;  1S40 A;  1SYD A;  4U67 3;  4E6I A;  2VQF Q;  4R4O A;  4IFD H;  1TS3 A;  4A3E G;  1V8Q A;  4QF4 A;  1BCP F;  1SYF A;  1H9M A;  3GTO H;  5FK9 C;  3E9I A;  1KD1 C;  2KA7 A;  5AFW A;  3GD7 A;  4BBS B;  2ZJR A;  2MGS A;  3T16 A;  4L63 B;  1EY0 A;  3K5N A;  1EYA A;  3SE0 A;  2K28 A;  3NEN A;  3NWT A;  3J81 L;  4X65 L;  3DWP A;  3TSS A;  2C35 B;  3AB9 A;  1TS2 A;  4ZUI A;  1HR0 Q;  4ZKB B;  1YNN C;  2M2L A;  1S5D D;  2ID0 A;  2HCI A;  1W3S A;  2NTT A;  4JBK A;  5C44 B;  2AWN A;  2BE5 D;  2NZO A;  1II3 A;  1PH6 A;  4OX9 Q;  4KN7 C;  2EXD A;  4JI8 L;  3RLF A;  3RZD H;  3TS0 A;  3T53 B;  4IPD A;  2H4O A;  3PUV A;  3CQZ B;  1CKM A;  1SFO H;  2NZ1 D;  1YJ9 A;  1VQC A;  5C3X A;  5IYC H;  2XN9 C;  2VQE Q;  2K50 A;  2LXK A;  4BA1 I;  1LTS D;  2UUC L;  5J39 A;  3L2P A;  4X64 L;  3WOF A;  1CI3 M;  1Y8O B;  3J7Y W;  1MI2 A;  4KD4 A;  2EY5 A;  1OXU A;  4OEL B;  1LT6 D;  4A3F G;  4OO1 I;  3KUP A;  1Q90 A;  4A3G H;  2X6L A;  2F03 A;  1ZXT A;  4LF9 L;  3IKJ A;  4ZUJ A;  1J5E Q;  2L12 A;  2ZM6 L;  4RG1 A;  2OTJ A;  3I4M G;  4JI3 L;  3S2D B;  3J81 c;  3PUZ A;  5G3L D;  1YNN D;  2A19 A;  4A3I B;  1CM9 A;  4DV0 Q;  5A2Q L;  1LAC A;  1SYG A;  1I3Q B;  3SEB A;  5JPM C;  4GLV B;  1I4Q A;  1EY5 A;  1FJG Q;  2QIL A;  3M3Y H;  5ELN A;  1D1I A;  1S5E D;  4L8J A;  2KUM A;  2A6E C;  1JB7 A;  1AP0 A;  4H7B A;  2A1A A;  3S14 B;  3U58 A;  2MO0 A;  4DV1 L;  2AMC B;  2RF4 A;  3R8B A;  2DUD A;  3PV0 A;  1UWV A;  1I6H B;  1QZG A;  4DV3 Q;  3JAM L;  5GRO A;  3MZ5 A;  5JPN C;  2LMC B;  3MVV A;  4X3U A;  4ODG A;  5DM6 3;  1TWG B;  3KLR A;  4C2M B;  5E3F A;  4PNY A;  2VW9 A;  2MO1 A;  4TRD A;  4KKT A;  4MHE A;  4YCW A;  1X54 A;  1U4R A;  3R3O A;  3HOV G;  2OEO A;  4C3H G;  3AQQ A;  3BU2 A;  2J7Z A;  2F0J A;  1X3E A;  3A8J E;  4DV4 Q;  1M4V A;  2NYZ D;  3W1G A;  1IKL A;  1MIU A;  4K14 A;  1ET6 A;  3CRK C;  1BOS A;  4TKO B;  2E5L Q;  3S1R B;  2E76 C;  5CV5 A;  3F2B A;  1VQJ A;  1NJI C;  3PCO B;  4GOP A;  1V1O A;  1LO5 D;  2AQ3 B;  4XQN A;  1SNM A;  2EYM A;  4V0B A;  4XYO A;  5A2Q E;  3BVG A;  3ZJY C;  2F0T A;  3RMH A;  2XWB B;  1I4P A;  4YY3 L;  3CPF A;  3S16 H;  4A4I A;  1S4Z A;  1WCM G;  4IUP A;  4MTN A;  2L9H A;  4J6H A;  5C4X G;  1EZ8 A;  5FJ8 G;  2D2C C;  4OX9 L;  3X3M A;  4EQN A;  4Y52 H;  3G4S A;  1Q1E A;  1DM0 B;  4AYB E;  5C3E G;  4DUY L;  1FGU A;  3M9B A;  2A6E D;  1V43 A;  4FF4 A;  1TXY A;  1OXV A;  1U4M A;  3M85 A;  2F0Q A;  3U4V A;  2AKW B;  5BN3 A;  3JAM E;  1SYB A;  4PG3 A;  2RKS A;  3QR8 A;  3E3X A;  3S24 A;  1Y1W G;  4LAA A;  3SK4 A;  5ELB A;  2EY6 A;  3SGI A;  1BO0 A;  3D31 A;  5KND A;  4DR5 Q;  3K5L A;  5C6A A;  3JAM c;  1VMP A;  4HJ5 A;  3AEV A;  1HFG A;  2OT2 A;  1IBL L;  4R4C A;  1Q81 C;  4JI2 L;  4K5X A;  1HJP A;  2EYO A;  1EQV A;  3VR6 A;  5JEA G;  4L6T B;  3F8T A;  4PMB A;  2VNU D;  1FNU A;  5CV7 A;  3GTO B;  5I9O A;  4C56 C;  5IGG A;  2F4V Q;  2A73 B;  4BBR G;  3C2P A;  3I4N B;  2Z8L A;  4WJ4 A;  1Q8I A;  1N34 L;  3D3R A;  1Y69 U;  1DJR D;  1HR0 W;  1HNW L;  3RZO B;  1CHQ D;  1BR9 A;  4DAY A;  2A68 C;  2ICE C;  5C5M A;  3CKI B;  4DV0 L;  3CHB D;  2JJQ A;  1VF7 A;  5CV4 A;  1SMX A;  4C3I B;  4IJH A;  4IPC A;  1TII D;  4A3F H;  3DLL A;  2YYZ A;  4GOP B;  3FPP A;  5IGC A;  2CH4 W;  5DLQ E;  4TVA B;  4Z9C B;  3OW7 A;  4CJ1 B;  2D62 A;  4DR6 Q;  1UUP A;  3HP3 A;  1XNQ Q;  3I4M H;  4LFC Q;  2PNH A;  3I4L A;  1WTR A;  1P8L A;  3K58 A;  4DV3 L;  1XTD A;  3NQT A;  1UAP A;  2B2V A;  3KF8 A;  4CGY B;  3B6Y A;  2E74 C;  2R61 A;  1TKW B;  4K0K L;  3V05 A;  1A3T A;  2F0E A;  3NQI A;  3PMF A;  1EZ6 A;  1QNU A;  1STB A;  4KMU C;  4LMQ D;  1J6Q A;  2R7Z B;  3I4O A;  3I7F A;  3F2D A;  1CHP D;  1W2B A;  3ND8 A;  2HIV A;  2K32 A;  2SOB A;  1X9N A;  3GTK H;  4O0A A;  3CCR A;  3H0G G;  1YNJ C;  2Q2T A;  3QOJ A;  2A6H C;  2RA4 A;  4GS3 A;  2EPB A;  3S1N H;  3A5Z B;  2K5H A;  3LWU A;  3RD4 A;  1T5X D;  1BCP C;  3OTO L;  2A68 D;  3HOV H;  5IT9 E;  4YCV A;  4C3H H;  1HFN A;  1LM0 A;  4IOA A;  4V19 0;  3FMC A;  1T5E A;  2HDL A;  1EQT A;  3UE1 A;  1Q82 C;  1IL2 A;  2NVY H;  2E2I B;  5CV6 A;  4KTA A;  4DAY B;  4QMG A;  3HS0 C;  1D5M C;  1N36 Q;  3P1H A;  4X3K A;  4A3I G;  1STN A;  2ZXR A;  1Z47 A;  4KK7 A;  2IX3 A;  1XJV A;  1D1K A;  1VQG A;  4M8A A;  4F88 A;  5ELD A;  2CH4 A;  4H13 C;  3CC2 A;  4DV2 L;  3ERQ A;  4R4Q A;  1JJC B;  1WCM H;  3SK6 A;  3HZX A;  5EPK A;  2WB1 E;  2Y0S E;  5D3D A;  3A54 A;  5FJ8 H;  3DM3 A;  1HQR D;  1PRT B;  3NTH A;  2JXM B;  4UY8 C;  1B3Q A;  3GTG H;  2PI2 E;  5C3E H;  4HIK A;  1VQL A;  2FJ2 A;  3MTS A;  4NXN L;  3BVM A;  2RDH A;  3KF8 B;  1VQ6 A;  1W6K A;  2F4V L;  2KBN A;  3D8G A;  1JQY D;  1Y1W H;  1JOQ A;  2JSO A;  4OL7 A;  2UU9 L;  5IYD G;  1YNJ D;  3FRP B;  5CMD A;  3GTJ H;  1PHJ A;  1NR4 A;  2A6H D;  1MD2 D;  3BYY B;  1G8Z D;  1O7Z A;  1HHV A;  4UP9 A;  1PA6 A;  3NPP A;  4L5R C;  1XNR Q;  4LF4 L;  2UUB L;  1PYS B;  1G2S A;  1JC7 A;  3HKZ G;  1LTL A;  1BCP D;  4A3E B;  2FXQ A;  1K8G A;  1IYU A;  5JEA H;  3U9S A;  4DR4 Q;  3PSI A;  1X65 A;  3GQB A;  3CC4 A;  4JI0 Q;  3ER0 A;  1JCK B;  3A74 A;  3IFD A;  1JR0 D;  3MAQ A;  1ML0 D;  1CSP A;  2HQL A;  4OHJ A;  1VQP A;  2C5C A;  2SNS A;  4KV6 A;  1PH3 A;  1QE6 A;  2RSN A;  2Q2I A;  1LTR D;  2N55 A;  1BDO A;  2VXW A;  5GAH C;  1R4Q B;  2B2T C;  1HNX L;  3M4O B;  2PW7 A;  4XDX A;  3RNU A;  3CCM A;  3H3V I;  4HJ9 A;  5M9O A;  4I7A A;  4IUT A;  3FVQ A;  1VDZ A;  1R4P B;  1CUK A;  4FXG C;  4HSP A;  4LF6 Q;  4QUF A;  4LF5 Q;  4IUR A;  1EY6 A;  2RDF A;  4B3M L;  1NBW A;  1KRS A;  5C44 H;  4PQX A;  4PMC A;  4HN7 A;  5FO9 B;  4RGN A;  2Z4I A;  5HUR A;  1C9O A;  5LMN W;  2IY5 B;  1D7Q A;  1L1O A;  1B9N A;  1GVP A;  2PMZ E;  3Q8D A;  3K7A B;  4JBJ A;  4K8I A;  3CQZ H;  1KAW A;  3TRZ A;  4QY7 A;  1YJW A;  1MHW C;  3I4N G;  4LNQ A;  1C0A A;  2B63 B;  5C4H A;  1CA6 A;  5T1G A;  2HHH Q;  1LAB A;  3TP6 A;  5ELC A;  2QEX A;  4G57 A;  1TWF B;  3X3N A;  4I65 A;  4A3C H;  5ELE A;  5I9P A;  1V1P A;  3H0G H;  5C0X J;  1SBB B;  1ZYR C;  4FF1 A;  3T51 B;  3OW2 A;  4DK1 A;  4C3I G;  2WII B;  2R92 G;  5DAU A;  4A3L G;  4U68 A;  1D8L A;  4ALP A;  3FPU B;  1M90 C;  5I2Y A;  2PZT A;  5I2X A;  2WP8 J;  5FLX E;  1OO9 B;  1TWA B;  1GHJ A;  2BDN A;  4QGU A;  3RN5 A;  1Z9F A;  4A3I H;  1NE3 A;  1FL0 A;  3OIQ A;  4CDD C;  1I3Q H;  2AHO B;  4LK1 C;  4RCN A;  5IP9 H;  2UXB Q;  2QDB A;  1AZQ A;  2Z4H A;  4DF7 A;  2WV6 D;  1VQM A;  1EOV A;  3LNN A;  1GOZ A;  4PMW A;  2K1B A;  2R7Z G;  2EYF A;  2F0U A;  4KY7 A;  3D4R A;  4DKA C;  1RDP D;  1N8R C;  1QG7 A;  1L2F A;  2OQ0 A;  1EEI D;  3TP5 A;  1PH1 A;  1DGS A;  1EU4 A;  1TWG H;  2E75 C;  4JI0 L;  4KY5 A;  3CCJ A;  1LUZ A;  2NVY B;  4C2M H;  4JPB W;  2F52 A;  2OTL A;  1B44 D;  5IYD H;  2F0H A;  1XMQ L;  5GAE C;  5JVG 3;  2JEA I;  1ILP A;  4PZ7 A;  1KL9 A;  4FXK C;  2H1E A;  1ZYR D;  3W5O A;  3TEH B;  2NB0 A;  1QWY A;  1K83 H;  1XXG A;  1KAA A;  3HRZ C;  3S1R H;  3S9W A;  1P16 A;  1BKB A;  1V1P B;  1EOT A;  1GUO A;  2YV5 A;  1SYC A;  3BJU A;  5C4X B;  1MJC A;  1JMC A;  1EQR A;  2R6G A;  4LF5 L;  1PYB A;  3W1B A;  2RQX A;  3GTG B;  2IWH A;  1EU3 A;  4DK6 C;  2CWP A;  4CHT B;  1KIX A;  1JJG A;  1ICF B;  4RAU C;  3ERS X;  1R9T H;  4ABN A;  5KEE A;  5JJZ A;  1Y1W B;  1EIH A;  3ONA B;  5AJ3 Q;  2PPB C;  4JI5 Q;  1CKO A;  4HR7 B;  3HOU B;  5HGT A;  1K8M A;  4JOI A;  2DNC A;  3HOX B;  3ULP A;  1TY2 A;  2Q8I B;  3RLN A;  1PXU A;  3G71 A;  4GNX A;  2IL8 A;  5FO8 B;  4X62 L;  3N52 A;  1S72 A;  1Z6H A;  1RTN A;  1GUG A;  1L0X B;  2B2W C;  5KGU A;  1PYW D;  2SDF A;  1QJO A;  5LMU L;  3H6M A;  2MUY A;  3AMU A;  4BBR B;  1UE7 A;  1A0I A;  5EKL A;  5CC4 A;  3V96 A;  1EEF D;  2DNE A;  1XYI A;  1XTC D;  4LF7 Q;  2NVT B;  2EYL A;  2UXC Q;  1TS5 A;  1RIP A;  3KK7 A;  2YTX A;  1E1O A;  3ND9 A;  2CQO A;  4XT3 B;  3I4N H;  4RHS A;  1E7Z A;  3CCS A;  1ENF A;  2X69 A;  1YI2 A;  1NR2 A;  1J9O A;  1EFW A;  4DR1 L;  2ES2 A;  3RZO H;  2B2U C;  4B3R L;  4NKL A;  3GO5 A;  1OXX K;  4P75 A;  4RCO A;  4R4T A;  3CME A;  1Y8P B;  4DR2 Q;  2H5X A;  1L0W A;  4DR3 Q;  3MEH A;  5IWA L;  1HNZ L;  2NN6 I;  3T1Y L;  1KAB A;  3UI2 A;  5I4D A;  4C3I H;  4DV7 L;  2NVQ B;  2R92 H;  1K0S A;  4A3L H;  2MQH A;  4OON A;  2OQK A;  1STG A;  4A3J B;  2QF7 A;  3F2C A;  4UPA A;  2UXD Q;  5EBC A;  2R7F A;  1MKH A;  3D4W A;  2UUA L;  5IY0 A;  2FFK B;  5ISR A;  1YVC A;  4B3T L;  1IBK Q;  3M4Y A;  3BDC A;  3TME A;  2WAQ G;  5BN5 A;  2LSS A;  5GAD C;  4IQZ A;  2ZT9 C;  1GD7 A;  4A3K G;  3H0G B;  3MFG A;  2EJM A;  3J80 L;  3ITP A;  2EZV A;  1KQS A;  2KEC A;  4GNX B;  2B63 G;  4GN3 B;  2R7Z H;  2BA1 A;  4RKB A;  3C1E A;  2KEN A;  4LW1 A;  2A8V A;  1PMR A;  4KKS A;  3J81 E;  2IHF A;  4CJ2 C;  2BH8 A;  4DAM A;  2E8G A;  2AWO A;  3PIP 3;  2JA6 B;  2EIF A;  1B3A A;  3VR5 A;  3S1Q B;  5JAV A;  2DY8 A;  2RHS B;  4QJF A;  4YHH Q;  1C8C A;  3K0X A;  4A76 A;  1ONL A;  2ZTC A;  1Z7T A;  3K81 C;  2XNA C;  3VR4 A;  1B9M A;  1QOH A;  1WTH A;  2GVB A;  2QDL A;  3KYH C;  3IL8 A;  3CCE A;  2WAC A;  2F0N A;  3S17 B;  1SE2 A;  2TMP A;  2NUC A;  4FDB A;  3CAM A;  2E2I H;  2LKV A;  3RUZ A;  5C0X I;  2KHS A;  2PCF B;  1TY0 A;  3RLO A;  2CCZ A;  2JA5 B;  5IYB H;  3HGB A;  1I5F A;  1STH A;  2I5H A;  4L5Q A;  2Q2H A;  1VQN A;  3CF5 A;  3CW2 C;  5BR8 L;  1VQ5 A;  1UEB A;  5FKA C;  1I4G A;  1C4Q A;  1PZJ D;  4IN3 A;  4JYA Q;  3BDO A;  3J80 E;  3FEW X;  2GN5 A;  2VQF L;  3V2T A;  2DJF C;  1JB3 A;  2AQ1 B;  4Q0F A;  1JWS D;  2XTI A;  4JV5 Q;  1K28 A;  5I6W A;  3L9A X;  1SAP A;  3GTL B;  3PO2 B;  1C48 A;  3TP7 A;  5EBD A;  1H95 A;  1GO3 E;  3J80 c;  3HKZ B;  1K83 B;  4CKC A;  2HIX A;  1FNV A;  2LY7 A;  1WTW A;  4RGM A;  4P74 A;  1VMC A;  1X32 A;  4K6L A;  5NUC A;  1NMF A;  4HCS A;  1HR0 L;  3T56 B;  1ET9 A;  1VQE A;  2ALY B;  1N33 Q;  2Y0S G;  3SVM A;  4DR2 L;  1Q12 A;  3VA7 A;  4A3E H;  1A3U A;  3A8I E;  4CJ0 B;  2KJX A;  1R9T B;  4N9P A;  4FVM A;  4RMF A;  1YIT A;  1PZI D;  1YEZ A;  1EY4 A;  4IUV A;  4CDF C;  4BY1 G;  4EX5 A;  2WKC A;  1PTO B;  4LUO A;  4JW0 A;  3N6R A;  2F0V A;  4BA2 I;  4IFD I;  4FP5 D;  3M4O H;  2K4K A;  1IBK L;  2VQE L;  1CSQ A;  1STA A;  4QB4 A;  2D0O A;  4CKB A;  3ERO A;  4ME5 A;  4JI7 Q;  4J15 A;  1SJH D;  3HOU G;  1MGS A; 
#chains in the Genus database with same CATH homology
 1PV4 A;  5C3E H;  3HOX G;  5IWA Q;  4HIK A;  3HOW G;  1HNZ Q;  3T1Y Q;  1VQL A;  2KCM A;  4NXN L;  3U50 C;  3VDY A;  2NVX H;  1HH2 P;  3PO3 H;  4QIW E;  4DV7 Q;  4AQY Q;  1B7Y B;  3J7A 5;  3KF8 B;  1VQ6 A;  4DUY Q;  4GOP C;  4GN5 A;  2KBN A;  1Q86 C;  2F4V L;  4OXP A;  5FLX c;  1BBW A;  1Y1W H;  3S14 H;  2PQA B;  4XIG S;  4DPG A;  1K3R A;  2UU9 L;  5IYD G;  4NXM Q;  1CKN A;  1IXR A;  3J80 i;  1J5E L;  2GVA A;  2Q2U A;  2JQO A;  3GTJ H;  1PHJ A;  2UUA Q;  3PGZ A;  5FLM H;  4DV5 Q;  4A3G G;  2Z0S A;  3K7A H;  1VQB A;  4UP9 A;  5LMN Q;  1PA6 A;  4L5R C;  2UUB L;  4LF4 L;  1XNR Q;  1PYS B;  4B3T Q;  1TWH H;  3CP0 A;  3HKZ G;  3NEL A;  1LTL A;  1K8G A;  2FXQ A;  2I5M X;  3U4Z A;  3MEF A;  3TQY A;  5JJL A;  4POF A;  4C3J H;  2DGY A;  3FHW A;  3PIO A;  2K75 A;  4DR4 Q;  4X64 Q;  2B63 H;  1IBL Q;  3PSI A;  1X65 A;  4JI2 Q;  1XPR A;  3CC4 A;  4JI0 Q;  3HFZ B;  1IYJ B;  3A74 A;  3ER0 A;  3KFU A;  1KRT A;  2OCE A;  1IBM Q;  4B3S L;  1FJG L;  1JT8 A;  1CSP A;  3PUW A;  4KHP Q;  2HQL A;  1VQP A;  3S15 H;  1TWF H;  1YNX A;  4DUZ L;  3E9H A;  4LFB L;  1HZA A;  1PH3 A;  4JI6 L;  4QQB X;  2KHJ A;  2Q2I A;  4IPH A;  1N34 Q;  5GAH C;  5AJ3 L;  5JJI A;  1PH5 A;  1A63 A;  4IFD J;  3RR5 A;  4JI5 L;  1HNW Q;  1HNX L;  2CWA A;  3MXN B;  4MZ9 A;  3RNU A;  3NBH B;  3CCM A;  3H3V I;  5IYB G;  4HJ9 A;  1ASY A;  4MNO A;  4HJ7 A;  4JCV E;  1HZB A;  4NB3 A;  4A3J G;  1CUK A;  4LF6 Q;  1V1Q A;  1ASZ A;  4LF5 Q;  3T1H L;  1K0R A;  1G29 1;  1IZ6 A;  5H1S E;  1K9M C;  3HOZ G;  3ULJ A;  4NPS A;  1Q7Y C;  4B3M L;  1NBW A;  1KRS A;  1TWA H;  1QZH A;  5C44 H;  2VY3 A;  1N9W A;  4GN4 B;  3UDF A;  3GTP H;  2IHE A;  4DV4 L;  4LF7 L;  2ASB A;  1C9O A;  1VQI A;  1T9H A;  2CKZ B;  2UXC L;  5LMN W;  4A3D G;  2IY5 B;  1L1O A;  3BZC A;  5E7N A;  1D7Q A;  5IP7 G;  1GVP A;  2IX0 A;  2PMZ E;  2QGQ A;  3AFQ A;  3Q8D A;  1X55 A;  4JBJ A;  2E5L L;  5ELO A;  3KLW A;  1A8V A;  4IJL A;  1VQO A;  3CCL A;  3PF4 A;  4BXX H;  3CQZ H;  3I55 A;  1A62 A;  1KAW A;  1Q8K A;  4GKK L;  3TRZ A;  4QY7 A;  5BR8 Q;  4GKJ L;  3I2Z A;  4HIM A;  2YTY A;  1YJW A;  3I4N G;  4A3B G;  4K0K Q;  2VS1 A;  4LNQ A;  2JA8 H;  4JC0 A;  1C0A A;  4XTC S;  1AE2 A;  3FKI H;  3D0F A;  1N32 L;  2HHH Q;  1OXT A;  1LYL A;  2WB1 G;  3GDE A;  4YWM A;  3WWV A;  4LFA L;  1S40 A;  4KLK A;  2MFI A;  2QEX A;  4DNI A;  2VQF Q;  4DR3 L;  2JA6 G;  4LUZ A;  4R4O A;  3J81 j;  1XMO Q;  4A3C H;  4A3E G;  3H0G H;  3AFP A;  5C0X J;  3KOJ A;  3GTO H;  3E9I A;  1KD1 C;  1HZC A;  3OW2 A;  1E22 A;  5K36 G;  5JEA J;  1VQF A;  3GD7 A;  3EBE A;  1PVO A;  2ZJR A;  4O2D A;  2R92 G;  4A3L G;  4KI0 A;  1EYG A;  1D8L A;  3NEN A;  3CCV A;  4ALP A;  2UXD L;  4X65 L;  1Q1B A;  3S2H H;  1M90 C;  2C35 B;  1HR0 Q;  3OTO Q;  1Y1V H;  2QA4 A;  3FP9 A;  3RN2 A;  4P71 A;  2ID0 A;  1AH9 A;  2JA5 G;  5C4X H;  2WP8 J;  4DR5 L;  4POG A;  1W3S A;  4JBK A;  3J7Z C;  4OO1 G;  4QGU A;  2WFW A;  3RN5 A;  1Z9F A;  2AWN A;  1NE3 A;  4A3I H;  1FL0 A;  2NZO A;  1PH6 A;  4OX9 Q;  4HJA A;  1I3Q H;  2AHO B;  4BY1 H;  4DR7 Q;  2EXD A;  5IP9 H;  4JI8 L;  1KC8 C;  3RLF A;  3RZD H;  3TS0 A;  2UXB Q;  4IPD A;  4NXM L;  3PUV A;  1VQM A;  1EOV A;  1CKM A;  1SFO H;  1QUQ A;  4PMW A;  2R7Z G;  2RHQ B;  1SRU A;  4DV5 L;  1YJ9 A;  4DV2 Q;  5LMN L;  1VQC A;  1BVS A;  4DKA C;  5M3F G;  1YJN A;  1N8R C;  3HOU H;  5IYC H;  2VQE Q;  2K50 A;  1L2F A;  2OQ0 A;  4DV6 Q;  4BY7 H;  2LXK A;  1YBY A;  4BA1 I;  3HOX H;  3HOW H;  4JBW A;  4YHH L;  3PO2 G;  2NZH A;  1SRO A;  2UUC L;  1PH1 A;  1DGS A;  1VQD A;  1B70 B;  3L2P A;  4X64 L;  2VL6 A;  4HIO A;  1TWG H;  4JI0 L;  3CCJ A;  1LUZ A;  4A3K H;  4A75 A;  2I5L X;  4C2M H;  1IBM L;  4NXN Q;  4TQU S;  2L15 A;  2F52 A;  5M5Y H;  1EIY B;  2OTL A;  4X66 Q;  3H3V H;  3NEM A;  1UE5 A;  1RL2 A;  1OXU A;  4BBR H;  5IYD H;  1XMQ L;  5GAE C;  1QVF A;  2JEA I;  4A3F G;  2B3G A;  1YIJ A;  4OO1 I;  4PZ7 A;  4A3G H;  1VQ9 A;  1O7I A;  1KL9 A;  4LUV A;  1XPU A;  1K73 C;  2UU9 Q;  3W5O A;  1EWI A;  4DR6 L;  3TEH B;  4LF9 L;  2NVT H;  2JA9 A;  1XNQ L;  1J5E Q;  3KDF A;  4LFC L;  2ZM6 L;  4H02 A;  3CCQ A;  4JI4 Q;  1K83 H;  2VUM G;  4HJ8 A;  3S1R H;  4RG1 A;  1P16 A;  1BKB A;  4LF4 Q;  2UUB Q;  2OTJ A;  2Z6K A;  2WAQ E;  4GLX A;  3I4M G;  1NTG A;  2YV5 A;  4BBS G;  4JI3 L;  3BJU A;  2K5V A;  2ZJQ A;  1MJC A;  1JMC A;  1PH2 A;  3J81 c;  3PUZ A;  1EQR A;  1NMG A;  4YCU A;  2R6G A;  4LF5 L;  4LF8 Q;  1PYB A;  2A19 A;  3W1B A;  1PH9 A;  3CPW A;  4DV0 Q;  1YZ6 A;  4IOC A;  3UDI A;  4JYA L;  4GLV B;  4DK6 C;  1X56 A;  2CWP A;  1FJG Q;  3M3Y H;  5ELN A;  3IRB A;  1KIX A;  1JJG A;  3ERS X;  4JI1 Q;  4JBM A;  4DUZ Q;  1JB7 A;  1R9T H;  2N49 A;  2E2H H;  3PF5 A;  4JV5 L;  5C44 G;  1I94 Q;  2A1A A;  2IT1 A;  2NVQ H;  3U58 A;  3GTM H;  2MO0 A;  5AJ3 Q;  2AMC B;  2K5N A;  2RF4 A;  4DV1 L;  1PH4 A;  4JI5 Q;  1CKO A;  1HNX Q;  2DUD A;  5JJK A;  3PV0 A;  1G6P A;  1HZ9 A;  1UWV A;  5M3M G;  4JOI A;  4A3J H;  3ULP A;  5GQO A;  3AYH B;  3TRE A;  3RLN A;  4DV3 Q;  1QZG A;  5GRO A;  1PH7 A;  3G71 A;  2ATW A;  4AH6 A;  4GNX A;  2JA7 G;  4APV A;  4X62 L;  2NN6 G;  3K80 C;  1S72 A;  3HOZ H;  4GLA C;  3EIV A;  3ULL A;  3K7U C;  2BH2 A;  3HOY G;  1N33 L;  2VW9 A;  2MO1 A;  4IPG A;  4YWL A;  4QL5 A;  4YCW A;  2K52 A;  1QUQ B;  1OXS C;  1X54 A;  5LMU L;  3F1Z A;  2N3S A;  1XMO L;  3ICE A;  1UE7 A;  1A0I A;  3HOV G;  4B3M Q;  3M7N A;  4X6A H;  1CKN B;  3AQQ A;  4A3D H;  3BU2 A;  4AIM A;  1X3E A;  3UE0 A;  5IP7 H;  1N36 L;  4A3C G;  2PI2 A;  4DV4 Q;  4A3M G;  4LF7 Q;  3W1G A;  2UXC Q;  2BA0 A;  1MIU A;  1RIP A;  2YTX A;  2E5L Q;  1E1O A;  3PUY A;  2CQO A;  4KHZ A;  1JE5 A;  3I4N H;  1E7Z A;  1PFS A;  3CXC A;  3CCS A;  4Y7N H;  4PZ6 A;  3F2B A;  1VQJ A;  1YI2 A;  3PCO B;  4GOP A;  1NJI C;  4A93 G;  1FVI A;  4GKJ Q;  1EFW A;  3KJP A;  1VQH A;  4DR1 L;  2ES2 A;  3RZO H;  3ZJY C;  4B3R L;  1E24 A;  3GO5 A;  2JA6 H;  3S1Q H;  1OXX K;  1XPO A;  4P75 A;  4YY3 L;  3CPF A;  3KJO A;  3S16 H;  4JI7 L;  4R4T A;  4A4I A;  3CME A;  4LFA Q;  1WCM G;  4DR2 Q;  2JK8 A;  1SE8 A;  2H5X A;  4MTN A;  1YHB A;  3KDF B;  1L0W A;  4DR3 Q;  5IWA L;  5C4X G;  5FJ8 G;  2NN6 I;  4L5T A;  3T1Y L;  2JEB I;  1HNZ L;  1KHI A;  3G4S A;  1VQK A;  4OX9 L;  2R93 G;  4Y52 H;  4DR7 L;  4C3I H;  1Q1E A;  5IT9 c;  4DV7 L;  1X6O A;  4AQY L;  4AYB E;  3CCU A;  5C3E G;  2R92 H;  4DUY L;  3S17 H;  1FGU A;  3M9B A;  5GAG C;  1V43 A;  2ZTE A;  1TXY A;  2MQH A;  1OXV A;  3M85 A;  4OON A;  3PO3 G;  2OQK A;  3U4V A;  2AKW B;  5IP9 G;  3F2C A;  1NY4 A;  4PG3 A;  4UPA A;  2UXD Q;  2R7F A;  3JC6 6;  4X65 Q;  1MKH A;  3BZK A;  3S24 A;  1Y1W G;  2F3I A;  2UUA L;  2E2J H;  5IY0 A;  2JA5 H;  3E0E A;  2LXJ A;  1WYD A;  2KHI A;  1YVC A;  3SGI A;  1XNR L;  2ZJP A;  4EQ5 A;  3OYY A;  4B3T L;  3EN2 A;  1IBK Q;  3M4P A;  3M4Q A;  1K8A C;  1SN8 A;  4R1J A;  1EQQ A;  3D31 A;  5FLM G;  4DR5 Q;  4HID A;  2WAQ G;  1MJE A;  5HY6 A;  2LSS A;  3JAM c;  5GAD C;  1VQA A;  5C0X G;  5EAY A;  4HJ5 A;  3AEV A;  4DR4 L;  1L1O B;  1GKH A;  1IBL L;  4R4C A;  4X66 L;  1Q81 C;  1B8A A;  1GD7 A;  3STB C;  1HJP A;  2VZA A;  2JE6 I;  4JI2 L;  4A3K G;  4OWX B;  1UE1 A;  5JEA G;  3F8T A;  2N78 A;  2VNU D;  4JG2 A;  1KQS A;  4KHP L;  4GNX B;  2B63 G;  3KF6 A;  1SR3 A;  4JI8 Q;  4GN3 B;  1M1K C;  2R7Z H;  3CMA A;  2F4V Q;  2BA1 A;  1X3F A;  4BBR G;  2KEN A;  5M3F H;  4LW1 A;  2A8V A;  4WJ4 A;  1VQ8 A;  4DK3 C;  1N34 L;  1G51 A;  4JI4 L;  3GTL H;  2IHF A;  4YWK A;  1HR0 W;  3PO2 H;  2BH8 A;  1HNW L;  4DAM A;  1V9P A;  2E8G A;  1VS0 A;  2AWO A;  2EIF A;  1YHA A;  2I0Q A;  2RHS B;  4QJF A;  4YHH Q;  1C7Y A;  2UUC Q;  3K0X A;  4LF8 L;  2N8N A;  1SLJ A;  4A76 A;  2ZTC A;  2V1C C;  4DV0 L;  3K81 C;  2JJQ A;  4LF6 L;  1VQ7 A;  2GVB A;  2IX1 A;  1SMX A;  3KYH C;  4IJH A;  4IPC A;  4A3F H;  2KCT A;  3CCE A;  3DLL A;  2YYZ A;  1WJJ A;  4GOP B;  1I50 H;  4JI1 L;  4LWC A;  1KXL A;  4B3S Q;  3UDX A;  1XMQ Q;  4FDB A;  4R4I A;  5DLQ E;  4TVA B;  3CAM A;  2E2I H;  1I94 L;  5C0X I;  1OTC A;  2EQS A;  2D62 A;  5HGQ A;  2VUM H;  5M5X H;  3S1M H;  4LFB Q;  4DR6 Q;  4LF9 Q;  4JI6 Q;  3RLO A;  1XNQ Q;  2CCZ A;  4A3L H;  3I4M H;  4LFC Q;  2PNH A;  4BBS H;  2ZM6 Q;  5M5W H;  5IYB H;  2MNA A;  1I5F A;  2I5H A;  1P8L A;  2ZTD A;  3HKZ E;  1WOC A;  1XTD A;  4L5Q A;  4DV3 L;  3H15 A;  2Q2H A;  1QVC A;  3PUX A;  1S3O A;  3CW2 C;  5BR8 L;  3CF5 A;  1VQ5 A;  4JI3 Q;  3B6Y A;  1VQN A;  1I6H H;  1UEB A;  1X3G A;  3L0O A;  4K0K L;  3I56 A;  4BXX G;  1QVG A;  2RCN A;  2PQA A;  3A0J A;  2B29 A;  3LGJ A;  1Q46 A;  2HHH L;  4JYA Q;  1J6Q A;  3G48 A;  3JAM i;  3T1H Q;  1EIF A;  2GN5 A;  3UDG A;  2JA8 G;  3FKI G;  2VQF L;  3STB D;  3I4O A;  4UP8 A;  4WJ3 M;  3I7F A;  2HT1 A;  2XTI A;  3F2D A;  4JV5 Q;  1U0L A;  1W2B A;  2YU9 H;  5M3M H;  2HIV A;  2Z6K C;  1YHQ A;  1X9N A;  3GTK H;  4DV1 Q;  4IFD G;  3CD6 A;  4O0A A;  3L7Z C;  3CCR A;  4ME3 A;  4AYB G;  1H95 A;  1GO3 E;  3H0G G;  3J80 c;  2Q2T A;  2XGT A;  2K14 A;  1UE6 A;  2JA7 H;  4OWT B;  1WFQ A;  4GS3 A;  2HIX A;  4A3B H;  3HOY H;  4P74 A;  3S1N H;  1Y14 B;  3A5Z B;  2K5H A;  4UP7 A;  3PIP A;  1EUJ A;  1TWC H;  1NMF A;  4X62 Q;  4GKK Q;  1HR0 L;  1BBU A;  3OTO L;  3KF6 B;  3HKS A;  5J3B A;  3HOV H;  2ALY B;  1VQE A;  1N33 Q;  4YCV A;  2Y0S G;  4C3H H;  5IE8 A;  1LM0 A;  4IOA A;  4DR2 L;  1Q12 A;  1GM5 A;  5LMU Q;  1N32 Q;  3UE1 A;  4A3E H;  1Y1V G;  1Q82 C;  3J81 i;  4A3M H;  3K8A A;  1IL2 A;  2NVY H;  2YTV A;  2OWO A;  5C4J H;  1L1O C;  4P72 A;  4DAY B;  4JOI C;  3CC7 A;  1N36 Q;  1E1T A;  4P73 A;  4RMF A;  1YIT A;  4A3I G;  4A93 H;  1Z47 A;  3TS2 A;  4L5S A;  4IO9 A;  4GNX C;  1YEZ A;  1XJV A;  2UXB L;  1VCI A;  1VQG A;  4BY1 G;  4EX5 A;  1AE3 A;  3G6E A;  1E3P A;  4PZ8 A;  2D0P A;  1VQ4 A;  4LUO A;  1JJ2 A;  3CC2 A;  4DV2 L;  4BA2 I;  4OWW B;  4IFD I;  4DR1 Q;  4R4Q A;  3M4O H;  2CFM A;  1JJC B;  1WCM H;  2K4K A;  2VQE L;  1IBK L;  2R7D A;  1CSQ A;  4B3R Q;  2WB1 E;  2D0O A;  2Y0S E;  4DV6 L;  3S2D H;  1U5K A;  5FJ8 H;  3DM3 A;  4YY3 Q;  1PH8 A;  4JI7 Q;  2R93 H;  4J15 A;  3A5U A;  3GTQ H;  3HOU G;  5IYC G;  1WI5 A;  4UY8 C;  4BY7 G;  3GTG H;  2PI2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...