3GTKH

Backtracked rna polymerase ii complex with 18mer rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
146
structure length
136
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 15
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtkH00
1NTGA 3GTOH 3CCRA 3CC4A 2N49A 2RCNA 1P8LA 4IOCA 4JI2Q 1WJJA 1HR0W 2PI2A 1HJPA 1SFOH 1Q46A 2R7FA 3BZCA 4HJAA 4LF8L 3CD6A 4BXXG 5GAHC 1YZ6A 4DUYQ 4K0KL 2RF4A 4LF4L 1QZGA 5K36G 3HOZH 2ZTDA 1JB7A 1I6HH 3HOYG 4AQYQ 1AE2A 4JI6Q 1QUQB 1NMGA 2BA1A 2Z6KA 1KIXA 5FJ8H 4LNQA 3HOVH 4AH6A 4DV7L 4JI0Q 4EQ5A 3CCSA 5C44H 1KC8C 3PO2H 4A3LH 4APVA 1KAWA 4QGUA 5M3MG 3G48A 3HOWG 3ULLA 1Q7YC 1RL2A 1YJNA 4DV0L 2KHJA 4LF7Q 2MO1A 4UP9A 3RLOA 1Q81C 1GD7A 1U5KA 4A3DG 1CSPA 5IWAQ 4DR4Q 4JBMA 2LSSA 2DGYA 3W1GA 1XPRA 1SMXA 3D31A 1K3RA 3GDEA 4WJ4A 1V9PA 3CCQA 4KHPQ 4DAYB 5M5XH 1KRTA 1N32L 2RHQB 1L0WA 3CCJA 1G291 1VQIA 4H02A 3FP9A 2CQOA 2ZTEA 4DR7L 1IZ6A 4DK6C 3PF4A 3F8TA 3K7AH 1A0IA 1IBKL 1PH2A 1JMCA 4GS3A 3S24A 4YHHQ 1BBUA 5FLMG 4OO1I 4QL5A 5JJKA 2R6GA 4JI1L 2ZM6L 3HKZE 4ALPA 2AKWB 1HNZQ 2YU9H 4BBSG 3AEVA 2QGQA 4YWLA 1UE1A 4OX9Q 3H3VI 2N78A 2Z6KC 4LFCL 1PH9A 1IBML 4P71A 5IYDH 3I4NG 1Q8KA 4UP8A 3S15H 1FGUA 3ERSX 4C3IH 1XNRQ 1X3GA 3K0XA 2Q2IA 4QJFA 4A3FH 4LF6L 4A3CG 2F52A 4X64L 2IX0A 4LUZA 2NVXH 2UUAL 4R4OA 2AHOB 1YJ9A 5IYBG 3S17H 1W3SA 5IP7H 4OONA 4DV4Q 2UUCQ 4BBSH 1VQCA 4JI5Q 3CF5A 1E24A 4R1JA 1PH1A 4LF9L 2JA7G 4QY7A 2VL6A 3HFZB 4NXNQ 3S1RH 4X66L 3CCMA 2KBNA 4GLAC 5IYCH 4LF5L 3AQQA 4XTCS 3KJOA 4R4TA 2OTJA 4LW1A 4EX5A 1PH7A 3EN2A 4DR5L 2ZJQA 3HKZG 1CUKA 3U50C 1PH6A 3S2HH 2UU9Q 4LFAL 1PFSA 1YIJA 1VQJA 3UDFA 4GN4B 1X3FA 4C3HH 5IY0A 3CMEA 1L1OA 2L15A 4YWKA 1HNXQ 4B3RL 1C9OA 2B63G 1QVGA 1HZAA 2WFWA 3W5OA 2AWOA 1J5EL 1IBLL 2E2JH 3GTGH 2F3IA 3S1NH 3UE1A 4DNIA 4DR6Q 1EIFA 1HZBA 1GO3E 2GN5A 4UPAA 4LFBL 1WFQA 1N36Q 3AFQA 2NN6I 2RHSB 3RZOH 1NY4A 2HHHL 3HOZG 2N3SA 1R9TH 1HNWQ 3PV0A 1PH3A 4GN3B 3J7ZC 1EYGA 1LTLA 2B3GA 3HOVG 4A76A 1Q1EA 4DV3L 1FVIA 3A74A 5C44G 1FJGQ 4A3LG 1PH8A 1WYDA 2IHFA 1PH4A 5FLXc 2JA5H 4A3GH 4R4CA 1N34L 2D62A 2K5NA 1Q12A 4YY3L 4LF4Q 2R7ZH 1RIPA 1VS0A 1I94L 3L2PA 4B3MQ 4A3BG 2A19A 3RZDH 2KENA 4JBWA 1XMOL 4AYBE 1TWHH 1L1OC 3K80C 3NBHB 4DV6L 2BA0A 1CKMA 3G6EA 1Q1BA 1VCIA 3FHWA 4P75A 5C3EG 2IY5B 1G6PA 4UP7A 4C3JH 4DV2L 3HKSA 4JG2A 4KLKA 2JA8G 3RN2A 3WWVA 1HR0Q 2E2HH 2BH2A 3PUZA 3W1BA 1PVOA 1HZ9A 1QVCA 5IE8A 3E9IA 4DR3L 4A4IA 2UUBL 2VQFQ 5LMNW 2ZJRA 3EBEA 3T1HL 4B3TQ 2R92H 1MKHA 3HOXG 3PUXA 4BY1G 3G71A 4NPSA 2K52A 3F2DA 1D7QA 1CSQA 2K75A 4DR7Q 4JC0A 4HIKA 4HIOA 3TQYA 4L5RC 3JAMc 4WJ3M 4DV5L 3MXNB 5BR8L 4HJ8A 3DM3A 4JI3L 3S1QH 1IYJB 1WI5A 4JI1Q 4AYBG 1CKNA 3G4SA 3J80c 4A3JG 1N8RC 3MEFA 5IP7G 1LM0A 2HQLA 4JYAQ 1NJIC 3K7UC 4LFCQ 4O0AA 2MFIA 3KF8B 4JI4L 2VUMH 4JI7L 1EUJA 4NB3A 1VQ7A 2R93H 4DK3C 1X65A 4DR1L 4JI8L 5LMNL 3J81i 3PCOB 4X64Q 1UE5A 4Y52H 3CPWA 2ZTCA 1N33Q 3CAMA 4DAMA 2LXJA 1VQ4A 4IOAA 2EXDA 3GO5A 3OTOL 2YYZA 2WAQE 3S2DH 2ZJPA 2UXCL 2UXDQ 1YNXA 4LUOA 1TWGH 4X62L 2UXBQ 4MNOA 4KI0A 4LF5Q 2A8VA 5LMUQ 3M7NA 3I2ZA 1NE3A 1K73C 3NELA 2OCEA 3RLFA 2MQHA 3M4QA 3TS0A 3PF5A 1VQ9A 1XNQQ 1I5FA 2GVAA 4GNXA 2VZAA 2K4KA 5J3BA 1A8VA 4GOPA 1I50H 3STBC 3CPFA 4X65Q 4AIMA 3KLWA 1AH9A 1M90C 3EIVA 1KXLA 4DV1Q 4OWXB 1Q82C 1GKHA 4PMWA 1GM5A 4B3SL 1VQ5A 4IFDG 4GKJQ 4YCWA 2JJQA 3KDFA 2JA5G 2ID0A 3GTQH 4A3GG 1VQOA 1JJ2A 4LFBQ 3KF6A 3RR5A 1XMQL 1Y1WH 2EIFA 3D0FA 4A3KH 2E5LL 2V1CC 4MTNA 4NXMQ 1B8AA 4JI2L 2I5HA 3E9HA 3AYHB 2D0PA 1E7ZA 1B70B 2K50A 2N8NA 1TXYA 4LWCA 4DUYL 3UE0A 3CCLA 4ME3A 2LXKA 4TVAB 3KFUA 1T9HA 2F4VQ 1BKBA 1N9WA 4AQYL 1VQMA 4JI6L 4JV5Q 2OWOA 1OXVA 3U4ZA 3A0JA 3GTMH 4JI0L 4QIWE 4DUZL 4GNXC 2YV5A 4XIGS 3STBD 4GOPC 1YHQA 5DLQE 4GKKQ 1OXUA 3RLNA 1QZHA 2Q2UA 1C0AA 4A3IH 2R7DA 1X6OA 3F2CA 5C0XG 3TREA 4LF7L 3H0GH 1YJWA 4DV2Q 3HOYH 2NVTH 3OYYA 1MJEA 4IFDJ 4BA1I 2YTXA 3SGIA 1K8AC 5HY6A 1KD1C 3T1YQ 2PI2E 4GOPB 4O2DA 1VQ6A 3Q8DA 5M3MH 1XTDA 1PH5A 1GVPA 2UUBQ 4X6AH 4P72A 3M4PA 1E1OA 3FKIH 5FJ8G 3KJPA 4YHHL 4A3MH 2VUMG 4A3DH 3CC2A 3PO2G 1J6QA 1KL9A 3E0EA 4POGA 5IP9H 1IL2A 2R93G 1QVFA 1VQHA 1S40A 1VQKA 4LF8Q 1EOVA 4HIDA 5M3FH 4OX9L 4K0KQ 1EIYB 1VQ8A 3BJUA 1G51A 2K5HA 4OWWB 4JBKA 1HH2P 2JA9A 2ES2A 5E7NA 2QEXA 4IJLA 3CMAA 4DV7Q 1E1TA 1PV4A 5EAYA 1C7YA 1VQPA 4JI7Q 3NENA 4GLVB 5C0XJ 3CW2C 4YCUA 5LMNQ 1SRUA 2CCZA 1OXSC 2HIVA 4C2MH 2UUCL 2VNUD 5GAEC 4JI5L 3CQZH 4DV0Q 1QUQA 2NZOA 4J15A 4NXNL 1YHBA 3NEMA 4A93H 3PO3H 3OTOQ 3RNUA 4JCVE 1L1OB 4L5TA 4RG1A 4A3CH 2B29A 4DPGA 2UXCQ 1TWFH 1BBWA 1MJCA 3I7FA 3ZJYC 1Z9FA 1N32Q 1L2FA 1Z47A 3I4OA 5ELNA 3CCEA 2IX1A 1X55A 1UWVA 5IYDG 1TWAH 1YBYA 3CCUA 1IBKQ 4BBRH 1YEZA 5GAGC 4A3FG 4HJ9A 2XGTA 1EWIA 5M5YH 3U4VA 1U0LA 4A3KG 1Y1VH 1DGSA 2ZM6Q 4DR6L 1MIUA 1EQQA 2Q2HA 3M85A 3M9BA 3LGJA 2VW9A 3UDXA 1IBMQ 3RN5A 2JQOA 2YTYA 4IPHA 1WOCA 3ULPA 2KCTA 2IT1A 2ATWA 1KRSA 1B7YB 5IYCG 2B63H 2VS1A 1UE6A 1HNWL 4LF6Q 2VQEL 2JA6H 4DR2L 2UUAQ 1K8GA 4A75A 2I5LX 2PQAA 1E22A 1HZCA 2E5LQ 3KYHC 1JE5A 1FJGL 3S14H 5JJIA 3TEHB 2D0OA 2H5XA 3ER0A 5GROA 2ALYB 2YTVA 1V43A 3H3VH 1O7IA 2WB1E 3K8AA 4A3IG 4LF9Q 2MO0A 2I5MX 3GTLH 1P16A 4X66Q 3H0GG 1S72A 2Y0SE 4DKAC 1Y14B 3CCVA 3PIOA 4B3ML 2HT1A 3OW2A 1X9NA 1VQBA 4BA2I 4MZ9A 5H1SE 4DUZQ 4DR5Q 3GTKH 5HGQA 5C0XI 4LFAQ 1VQEA 4BY7H 4HJ5A 4JOIA 3I4MH 2CKZB 1SE8A 3L0OA 4UY8C 1XPOA 3IRBA 4PZ8A 2QA4A 4L5SA 4B3RQ 5AJ3L 1OXTA 3KOJA 4A3MG 3FKIG 1J5EQ 1HR0L 1IBLQ 4A3BH 4L5QA 2EQSA 4PZ7A 1K0RA 1VQNA 1JT8A 4GLXA 4HJ7A 2K5VA 5IP9G 1OTCA 1YI2A 2Q2TA 1SN8A 5C4XH 2Z0SA 3HOUH 2BH8A 2VQFL 3PUYA 4IPCA 5M3FG 4B3TL 1XPUA 4QQBX 5C3EH 2HHHQ 4LUVA 1PHJA 4P74A 1CKNB 2WB1G 3A5UA 1WCMH 4A3EH 2WAQG 2R7ZG 1VQFA 3PGZA 3DLLA 2I0QA 2JA8H 1KQSA 3ULJA 1XJVA 2Y0SG 4DV3Q 4POFA 1ASYA 1IXRA 4R4IA 3I56A 2OQKA 1H95A 1N34Q 3CC7A 4JYAL 2PQAB 1OXXK 3HOXH 1A62A 4YY3Q 1YITA 1Q86C 4BY1H 1I94Q 4OWTB 5ELOA 2WP8J 5GADC 3U58A 4A93G 2JE6I 1CKOA 4IJHA 3PO3G 3B6YA 2JEAI 3JAMi 1XMOQ 4JOIC 4BXXH 1M1KC 4DV6Q 4IPGA 1N33L 4PZ6A 1EFWA 2KHIA 2NZHA 3J80i 4A3JH 2R92G 3BU2A 1D8LA 3UDGA 3CP0A 5IWAL 4DR4L 3S1MH 1E3PA 1NMFA 1YHAA 5GQOA 4GNXB 1VQDA 3BZKA 4BBRG 2C35B 2AWNA 2UXDL 4YCVA 4KHPL 1W2BA 2UXBL 1FL0A 5LMUL 1Y1VG 4KHZA 3I55A 2FXQA 3HOWH 1LYLA 4DR3Q 2KCMA 1XNQL 2K14A 3T1HQ 1ASZA 2E2IH 3PSIA 2OQ0A 1JJCB 2XTIA 5JEAG 4R4QA 1AE3A 1UEBA 3GTPH 2MNAA 3KDFB 1BVSA 4X65L 4HIMA 4JBJA 2E8GA 1HNZL 1A63A 4DV1L 3KF6B 4OXPA 3J81c 5BR8Q 4DV5Q 3CXCA 4JI3Q 1SR3A 2JA6G 4OO1G 2A1AA 3AFPA 3JC66 4GKJL 2VY3A 3TS2A 1X56A 1EQRA 4RMFA 2ASBA 1XNRL 3GTJH 4JI4Q 2AMCB 3ICEA 5JJLA 5FLMH 2NVQH 2CWAA 3F1ZA 1X3EA 3UDIA 4GN5A 1V1QA 1VQAA 3F2BA 1K83H 2JEBI 4JI8Q 4DR1Q 1SROA 2VQEQ 4NXML 2PMZE 4DV4L 4DR2Q 4IO9A 4Y7NH 1VQGA 2OTLA 2GVBA 4TQUS 3I4NH 3J7A5 1NBWA 3GD7A 4BY7G 5M5WH 2NVYH 2PNHA 3I4MG 2F4VL 4JV5L 1PYBA 1TWCH 4X62Q 1LUZA 5IT9c 4P73A 3S16H 5JEAJ 5IYBH 3M3YH 3PUWA 3M4OH 2IHEA 2UU9L 1X54A 1PA6A 1YVCA 2DUDA 4GKKL 1HNXL 1S3OA 2CFMA 2JA7H 3HOUG 5C4XG 3J81j 1K9MC 1VQLA 1Y1WG 4A3EG 3PUVA 1WCMG 2JK8A 4IPDA 2HIXA 4IFDI 2CWPA 1UE7A 1I3QH 3L7ZC 4PG3A 5AJ3Q 3H15A 3T1YL 1JJGA 1PYSB 4FDBA 3VDYA 4B3SQ 1N36L 3K81C 3PIPA 3A5ZB 5C4JH 1SLJA 3TRZA 4YWMA 1KHIA 1XMQQ 2NN6G
chains in the Genus database with same CATH superfamily
1KTKA 2F1MA 1NTGA 2N49A 5ELFA 5M5YB 3AB9A 2PI2A 3J7AF 1Y1VB 5CORA 4BXXG 5FOBB 2IJ0A 2RDGA 2ZTDA 5E1FA 3TP7A 2NTTA 2EYOA 4AQYQ 4JI6Q 5C4JB 3D6WA 2Z6KA 5I9PA 2B2YC 2C5CA 5C44H 4FXGC 2QW7A 1F2LA 3VR3A 2K32A 5M3MG 1Q7YC 1YJNA 1TIID 2F0FA 1SFOB 3RLOA 4A3DG 4DR4Q 2PZUA 4JBMA 1T5EA 1SMXA 3D31A 3GDEA 2EZVA 1RKNA 4WJ4A 1RTOA 1V9PA 4KHPQ 5M5XH 4JW0A 1LTSD 3FP9A 1ET9A 2F0HA 3GV6A 2ZTEA 1RHPA 3NPPA 4DK6C 3F8TA 1A0IA 1IBKL 1GUNA 4HMIA 5CV9A 3S24A 1TS2A 2P5ZX 4QL5A 1H9MA 5JJKA 4JI1L 2ZM6L 2YU9H 3AEVA 1AP0A 4YWLA 1KDCA 4P71A 2B8FA 2DY7A 5CV6A 4C3IH 1DCZA 2JA8B 4A3CG 3K7AB 2EDGA 2AHOB 2SOBA 4CKCA 5A2QE 1W3SA 2DJGC 1RF2D 3KBGA 4ODGA 3CF5A 3K57A 5EGTA 4LF9L 2MPMA 4QY7A 2L0CA 3S1RH 4R9WA 3HOXB 3I91A 3AQQA 4ZCKA 2K33A 4R4TA 2EYLA 3QG1A 2WACA 3EN2A 4K2LA 3U50C 1Z6HA 4LFAL 4ZLTF 4ZAIA 1XWEA 3UDFA 4GN4B 5G3LF 5IY0A 1YIJA 1HNXQ 5I6YA 4YWKA 1HA6A 3O13A 4UHVA 1IW7C 1J5EL 1MI2A 3G7LA 3UE1A 3K5LA 2K5DA 4DNIA 1F2ZA 4NMZA 1IYVA 1PLFA 2IPKD 3NTHA 5I9OA 4LFBL 3AFQA 2NN6I 1NY4A 3G6JB 3S2HB 3J7ZC 1EYGA 1LTLA 2B3GA 1SE4A 4TKOB 1PRTB 3HRZC 1PH8A 1PH4A 2XN9C 4R4CA 2JSOA 1STEA 3D3RA 4YY3L 1RIPA 4RA8A 2CW0D 2PO4A 3RZDH 3RMHA 4FF4A 4JBWA 1K83B 1TWHH 2PQEA 4IUVA 2A6HC 2BA0A 3G6EA 1IW7D 1Q1BA 3FHWA 4RHRA 1G6PA 4C3JH 3HKSA 4JG2A 2JA8G 3RN2A 1W6JA 1HR0Q 2BH2A 3LWUA 3W1BA 1E2WA 1IHZA 1PVOA 1QVCA 3LWEA 2OXPA 4DR3L 1BQQT 3OIPA 5C0XH 2HDLA 3EBEA 1MKHA 3OHXC 3HOXG 3G71A 2K52A 2ZT9C 3P75A 4X3SA 3J7YW 5JVH3 4JI3L 2K5QA 1IYJB 4JI1Q 5CGKA 1QJOA 3H94A 3K7UC 3NP8A 3A8IE 2A6HD 1EY5A 4DK3C 1F2MA 4DR1L 2Z6BA 2KHSA 3NQTA 4DAMA 1PFMA 1BDOA 3GO5A 2WAQE 3S2DH 5KYLA 1BOSA 1A3UA 5DM73 4LUOA 3K6OA 4X62L 1QCBD 2HCIA 4MNOA 2EYJA 5LMUQ 3I2ZA 3OWEB 4FXKC 5CBEE 3RLFA 1XNQQ 2OT2A 2J7ZA 2K4KA 3I90A 4GOPA 2H4OA 4X65Q 1HFNA 4ILWA 1M90C 4DV1Q 1GKHA 3QB3A 1SYCA 1CA6A 4YCWA 4V190 3KDFA 1JJ2A 4LFBQ 3KF6A 2Z8LA 1Y1WH 2EIFA 1TVXA 1WTHA 3VYTA 1B8AA 1STNA 1E7ZA 2K50A 2YU9B 3SVMA 3CCLA 4ME3A 2LXKA 3KFUA 1J9OA 2F0JA 1BKBA 1N9WA 1VQMA 2OWOA 1FGBD 4JI0L 4A3KB 2VB2X 4J1MA 3WOEA 1NR4A 4C1NK 1BCPB 3RLNA 4A3IH 2R7DA 1X6OA 1ZYRC 5ELDA 3H0GH 1LABA 3OYYA 1V8QA 3S1RB 2YTXA 2KJXA 5IGEA 1K8AC 4RWSC 4ZKCB 4GOPB 2LS01 1XTDA 2PW5A 1PMRA 1T5XD 3MZ5A 1EWCA 2XWJB 4P72A 3KJPA 4KTAA 1EIHA 1J6QA 3E0EA 3DMUA 5ELCA 2A5HA 1VQHA 4LF8Q 1EOVA 4HIDA 5M3FH 1Y8NB 3NBIA 2F0SA 3TSSA 1EIYB 4MN3A 3TMEA 3WOFA 4KJOA 2QEXA 1H9JA 4I7ZC 2F0NA 1ZYRD 5EKLA 3DWQA 3RUZA 4GLVB 4N9PA 5C0XJ 4A3MB 3CW2C 4DNTB 2CCZA 1OXSC 2UUCL 1B44D 1UNSA 3BZDB 2NZOA 1LACA 4J15A 4HEDA 1UUPA 4JCVE 1L1OB 5C6AA 1BBWA 2Y0SB 2NB0A 1Y8PB 1TWHB 1L2FA 1Z47A 5ELNA 1UWVA 1D6EC 3ND9A 1ENFA 4C3JB 4BBRH 3NWTA 5GAGC 5EJWA 4CKBA 1EWIA 1FNVA 2BE5C 3U4VA 4A3KG 1DGSA 4DR6L 1EQQA 1IL8A 5JEAH 2VW9A 1VDZA 2CH4A 5M9OA 2Z1CA 2A69C 3J81E 1RTNA 2VQEL 4DR2L 2UUAQ 1K8GA 4A75A 1HZCA 3KYHC 1JE5A 1FJGL 5JJIA 3TEHB 2D0OA 1V43A 3VYRA 3K8AA 1VF5C 1STAA 1B4OA 4X66Q 4ZRZA 3UI2A 1S72A 2Y0SE 4DKAC 5JAVA 3C2PA 3HP3A 2F3WA 4KN7C 3BVMA 1RD9D 4BA2I 3Q22A 2A74C 1HUNA 5JOBA 3GTKH 2I46A 5HGQA 2BE5D 3S14B 4DK1A 4JOIA 4RHSA 3I4MH 3FDTA 4B9XA 1SE8A 3L0OA 1O78A 5IT9E 4PZ8A 1AZPA 2WIIB 4A3MG 2XSCA 4L5QA 2EQSA 1C8CA 1K0RA 2NBFA 5IP9G 1B53A 2Z0SA 1SYFA 2VQFL 5IGFA 1WVLA 4B3TL 5C3EH 1PHJA 4P74A 3A5UA 2RDHA 1VQFA 3PGZA 4UAIA 3DLLA 3DHQA 2I0QA 1KQSA 2WV6D 1S5DD 1XJVA 2Y0SG 4DV3Q 4POFA 2K05A 4R4IA 4EVOA 1ASYA 1X3QA 4L6TB 3CC7A 4C3JG 4JYAL 2QKIC 3FEWX 1YITA 1CFMA 2Q8TA 4DGZA 5GADC 5ELOA 1I94Q 4HMJA 2B2WA 1Y1WB 3B6YA 4OELB 4JK1C 4BXXH 4DV6Q 1EY9A 1KAAA 4CGYB 1GHKA 4PZ6A 1EFWA 1JR0D 2KHIA 3J80i 5KGUA 1WTQA 1NSNS 2RVLA 5T1IA 2QEJC 5FKAC 3S1MH 1HQMC 3P1HA 2RDFA 1RDPD 3V05A 4YCVA 1HTLD 2HUGA 1KLUD 2FXQA 1E2ZA 3T1HQ 3PSIA 5CV7A 1SYDA 4R4QA 1AE3A 1KABA 3H0GB 1DOMA 2L4NA 4DV5Q 1K0SA 2JA6G 4KN4C 4G7HC 1PRTC 1X56A 2ASBA 4IUTA 2AMCB 5JJLA 3MXNA 2DNEA 2CWAA 3F1ZA 1V1QA 1SROA 2VQEQ 4JPBW 4DR2Q 3BVZA 2B2TC 2OTLA 3LX0A 1PFNA 5FLXL 4F87A 1GHJA 3N6RA 3MVVA 5KNDA 1TWCH 1D2BA 1Y8OB 2F4IA 5JEAJ 2JXMB 1S3OA 2CFMA 1TU2B 2XNAC 4NDXA 1GUSA 1MSGA 3ND8A 1K9MC 1Y1WG 4A3EG 3T53B 1PRTD 1UE7A 2NVYB 3H15A 3VDYA 5JJZA 2LY7A 1N36L 3S16B 3MFGA 5C4JH 1SLJA 1SMYC 1WTVA 4YWMA 2NN6G 4ULLA 3CC4A 4JI2Q 4U68A 5KYIA 1EU3A 1SFOH 4HJAA 1I3QB 4JVZA 5GAHC 4K0KL 3J80L 1B9NA 1QZGA 5K36G 3OOCA 1GUOA 1JB7A 3NTIA 1IYUA 4LNQA 5FJ8H 4DV7L 3OW7A 5CC4A 3PO2H 2F0MA 4APVA 3TZDA 4QGUA 3ULLA 4K6LA 3KBXA 2QF7A 1LT6D 2A73B 2DGYA 1SMYD 2Z4HA 4RAUC 2AUKA 3HOVB 2Z4IA 3GTKB 1IZ6A 4R8NA 2G9DA 3K7AH 1K8OA 4YHHQ 1ICFB 1ZEQX 4MTKA 1CTMA 2TSSA 4OX9Q 3H91A 4LFCL 3E3XA 4G7OC 5C3EB 3JAME 3TDQA 1LV9A 4LF6L 2IX0A 1TR5A 4LUZA 4R4OA 1YJ9A 5IYBG 2NUCA 3PIP3 4G57A 1BCPC 3HFZB 2F0DA 3CCMA 4LF5L 5L37A 2XIWA 2OTJA 4EX5A 5F2DA 1PH7A 3BDOA 1AZQA 3S2HH 5JPNC 3S17B 4C3HH 2ZXOA 1SDFA 1X3PA 5IIFA 3E5SA 4B3RL 1QVGA 2WFWA 3CKIB 3IFTA 3W5OA 3GTGH 2O2LD 2H1EA 2IW3A 1H9SA 5CV4A 4RGTA 1KDAA 1HFGA 4UPAA 1WFQA 1N36Q 1FNWA 1YNJD 1HNWQ 2O5JC 1PH3A 4UDUC 3HOVG 2EJFC 3S1NB 1WYDA 2B8GA 1Q90A 2M9VA 5FLXc 1N34L 2D62A 5ELEA 3RZOB 3SE0A 2A19A 1BF4A 1L1OC 3K80C 1VCIA 5C3EG 2IY5B 4A3GB 4C56C 1STGA 1II3A 2E2HH 1TWCB 2WKDA 4FYDA 2XRSD 4A4IA 1O7YA 2UUBL 1F77A 2EJMA 2ZJRA 5LMNW 2R92H 2ICIA 4FNFA 1V1PA 4NPSA 4KHVA 1I4GA 2K75A 1Y69U 5EKIA 3T56B 4HIOA 1ONLA 4L5RC 1EY6A 4ZQ3A 1PTOF 1GUTA 5FO8B 3DM3A 3D4DA 4WRDA 1N8RC 5I2XA 4XQJA 3J80c 1S5BD 3AMUA 4LFCQ 4JI4L 1SYBA 3MXUA 1VQ7A 4KV6A 4JI8L 4Y52H 4IUPA 2IX3A 2MGSA 2EY5A 3CAMA 3BDCA 1B1ZA 3S1QB 4IOAA 1EWHA 3OTOL 2ZJPA 2B2VA 2J4XA 1TWGH 2UXBQ 2VUMB 4LF5Q 2A8VA 3PO2B 5BN5A 3M7GA 2R93B 1M4VA 3TS0A 1VQ9A 5EQ0A 1I5FA 4GNXA 3X3MA 3CRKC 3KLWA 1AH9A 4OWXB 3C46A 4HCEA 2LKVA 1VQ5A 3R3OA 4A3GG 4EQPA 3MC0B 1VQOA 3GQBA 1XMQL 1LTID 3L9AX 4A3KH 4Z9CB 4NXMQ 3E9HA 2KECA 1GOZA 4DUYL 1ILQA 4TVAB 1CA5A 3A56A 3EA6A 1WTRA 4MIUA 1TKWB 3DWAA 3TP5A 1C0AA 3KLRA 2Q2UA 3S9WA 4DA2A 1PDQA 2EPBA 4ZUJA 3TREA 4LF7L 1YJWA 1U4PA 5DEHA 3HOYH 3CHBD 3K59A 3SGIA 4DAVA 2PI2E 2ENBA 1LT3D 2KQ3A 2PNRC 1LTBD 5IGCA 1HA5A 1KNEA 1F9PA 4DN4M 2UUBQ 4X6AH 3GV3A 1A15A 1UAPA 4C3HB 1STYA 1C48A 1E1OA 5FJ8G 4A3MH 2VUMG 2TMPA 3SK4A 3CC2A 2L55A 3PO2G 2R93G 5EBCA 5IP9H 1D5XC 3GTGB 4KD4A 4XQNA 1S40A 4TRDA 1SNQA 3K5NA 1VQ8A 3BJUA 3EROA 4I7AA 1G51A 2K5HA 4OWWB 2ES2A 1ENCA 5IGBA 5EAYA 3J7AV 1S5CD 1EIGA 1PTOB 3FKIB 1IKLA 2VNUD 2KEEA 5GAEC 1SNMA 4JI5L 1F9RA 1QUQA 3R8BA 4NXNL 3URYA 4RKLA 1WTWA 3OTOQ 2WAQB 4KMUC 4L5TA 2B29A 4DPGA 3I7FA 1Z9FA 3CCEA 5KEEA 1QWYA 3PMFA 1X55A 3BS1A 3VYSA 1YBYA 4C2MB 1IBKQ 4RFBA 1CM9A 1YEZA 4HJ9A 2XGTA 4DAYA 2E2HB 2XVSA 2ZM6Q 4PMBA 2O4XA 2Q2HA 2K04A 1TS5A 3IL8A 3M9BA 3M85A 3UDXA 1TWFB 2YTYA 2ZXRA 4DXGA 2R92B 5I2YA 4RGOS 1SYGA 2K5WA 4E6IA 2B63H 1EY8A 1TWAB 5K5PA 2JA6H 1E22A 2D5DA 1HTPA 2A68C 3S14H 5DNFA 3ER0A 4WFN3 2ALYB 2YTVA 3D8GA 2F0EA 4C3HG 1TS3A 4LF9Q 1TT2A 1X32A 4DNRB 5EPJA 2C9OA 4B3ML 3Q6SA 1PFBA 3I4LA 1M8AA 4LFAQ 1O7ZA 5IGDA 4F88A 4HJ5A 1JORA 1XPOA 3IRBA 1SNDA 3KOJA 1J5EQ 3FKIG 3GTLB 4PZ7A 1TWGB 2K5VA 1OTCA 2F0VA 2HD3A 1XPUA 3VR2A 2BDOA 2QDBA 2EJGC 3FRPB 1SJED 4A3EH 2A68D 3NXWA 2WAQG 4OL7A 5KIXA 4OIKA 2X6LA 1IXRA 3Q24A 1W6KA 2AQ1B 2EYPA 1H95A 2NN6H 4IALA 5C4XB 4YY3Q 3HOUB 4OWTB 3U58A 1EL0A 1QG7A 4PQXA 4K5VA 2JEAI 1EY4A 2CVRA 1M1KC 1N33L 2NZHA 3BG3A 5E4XA 4A3JH 2R92G 1C4QA 5K36H 3RD4A 1D8LA 3CP0A 5IWAL 3FMCA 4XYQA 1NMFA 3EJIA 4L8JA 1VQDA 3BZKA 2UXDL 3NBHA 3I70A 2JYOA 1I4XA 1B3AA 3V96A 1LYLA 4DR3Q 1ASZA 2B2UC 2OQ0A 1SSOA 2XTIA 4GZYC 2D9UA 1DM0B 1NNXA 1UEBA 2MNAA 4QUFA 3KDFB 1BVSA 4JBJA 3HOYB 1SNPA 3KF6B 3CRLC 4JI3Q 4RGNA 4GKJL 2VY3A 3OMGA 3GTJH 3UDIA 1HHVA 4GN5A 1H9KA 1VQAA 4DR1Q 2PMZE 2HCCA 4IO9A 1VQGA 3GD7A 2RKSA 2NVYH 2BOSA 2PNHA 2F0GA 2F4VL 4QUCA 3MHBA 4JV5L 1PYBA 1O7LA 4X62Q 3S16H 5IYBH 2UU9L 1X54A 5LL6S 4GKKL 2B2YA 4XDXA 3SDZA 1B2TA 3VR5A 5C4XG 3HOUG 3PUVA 3I4NB 2HIXA 5EPKA 1XTCD 3C3LA 3GP7A 4F8MA 4PG3A 1I3QH 3T1YL 1AFPA 3K81C 2EY6A 1I4PA 1JICA 2QDLA 3M4OB 3TRZA 5COYA 4CDDC 2JA7B 4ID6A 3GTOH 2NZ1D 4M8AA 3CCRA 3DEPA 3DWPA 1P8LA 1HR0W 1WJJA 5I4DA 4K14A 1Q46A 2R7FA 4EGVA 1YZ6A 2J0TD 3HKZB 4KJNA 1MBYA 5A2QL 1I6HH 3HOYG 2BA1A 4IQZA 1KIXA 3HOVH 2KA7A 4JI0Q 2B63B 2JA6B 1EYDA 1S5ED 2K1BA 1FYCA 3I3CA 3G48A 3HOWG 1RL2A 3QOLA 4DV0L 2K6AA 2CQAA 1Q81C 2F0OA 3CU7A 5IWAQ 2LSSA 3W1GA 2A69D 1XPRA 1K3RA 2KEDA 1KRTA 1N32L 1L0WA 1G291 1VQIA 4H02A 5NUCA 2CQOA 1TQOA 2OF1A 4DR7L 3PF4A 1JMCA 1NR2A 4GS3A 1BBUA 4OO1I 4XT3B 2R6GA 3MWYW 3HKZE 4ALPA 2AKWB 4BBSG 1DJRD 5CV5A 1TS4A 2PZTA 3QIAA 3H3VI 2Z6KC 1K3BC 1H9RA 1PH9A 1IBML 5IYDH 5J22A 3I4NG 1Q8KA 4UP8A 1FGUA 4A3EB 1X3GA 3K0XA 4WORA 2F52A 4DAPA 4X64L 3S17H 1JC7A 3HS0C 3I72A 5LL6X 2UUCQ 2KCNA 1E24A 1PH1A 2JA7G 1MD2D 2VL6A 1GXDC 2KBNA 3BYYB 4XTCS 3QJYA 5CV8A 4DR5L 3HKZG 1CUKA 1HPCA 2UU9Q 4AYBB 4A3JB 1RCVD 1VQJA 1X3FA 3W3AA 3PIO3 1C9OA 2B63G 3IFDA 4FF3A 1HZAA 1IBLL 3S1NH 4DR6Q 1EIFA 1LTGD 5IODA 2SEBD 1QNUA 1HQRD 2EY2A 2F0WA 2GN5A 2SNSA 3RZOH 2HHHL 2JN4A 3HOZG 3NWSA 4FP5D 1B50A 3PV0A 1V1OA 4A76A 1Q1EA 2ZXPA 1FVIA 3KF8A 4KKSA 1FJGQ 2PZWA 4A3LG 1PTOC 4A3GH 5DAUA 2K5NA 1VS0A 3GTJB 4K8IA 1R9TB 1XMOL 3VYUA 4AYBE 1CKMA 2LMCB 2KOLA 2PW7A 4UP7A 4DV2L 2MJ8A 4MHEA 4V0BA 2JA5B 3OIQA 3PUZA 4CJ0B 1CK1A 3E9IA 3H6MA 2QCPX 3DUZA 2EOTA 2VQFQ 4B3TQ 5LHY1 2BDNA 4LAAA 1EQTA 4DR7Q 1A2UA 1LLRD 4HIKA 3TQYA 2Q8IB 3MXNB 1VMCA 5BR8L 4HJ8A 1PZID 3S1QH 2R3ZA 4AYBG 1CKNA 4A3JG 3MEFA 4KY5A 5IP7G 1LM0A 2HQLA 5T1GA 4JYAQ 1I4QA 2DNCA 4O0AA 2MFIA 1G91A 3KF8B 2VUMH 1E0BA 1EUJA 3GTOB 2R93H 1X65A 5KNBA 1U4RA 3J81i 3PCOB 1BBXC 4X64Q 4OO1H 1UE5A 1A6XA 2K03A 1ESRA 1Q3LA 1VQ4A 3HZXA 5DM63 1I6HB 4CJ1B 2UXCL 1YNXA 3QR8A 2PPBC 1NE3A 2F0LA 1K73C 3PF5A 3FVQA 4U673 2GVAA 4HN7A 3STBC 3CPFA 4KD3A 4PMCA 3EIVA 1LO5D 1O80A 2WKCA 1U9RA 1GM5A 4B3SL 4IFDG 1LT5D 2JA5G 3RR5A 3T51B 5FO7B 3D0FA 2E5LL 4BWGB 2B2UA 4K5XA 3T13A 2FMCA 1TXYA 2PYKA 3K5OA 4LWCA 1BUVT 2O5IC 3QWNA 1MSHA 2MHVA 1NAPA 4LMQD 2L1BA 4AQYL 4JI6L 4IUQA 1D1KA 3A0JA 1YNNC 1B3QA 2YV5A 2FJ2A 3STBD 4GOPC 1YHQA 5DLQE 1OXUA 1SXTA 3DEOA 3F2CA 2RSOA 1EZ6A 5E3FA 1PZKD 4DV2Q 1AN8A 4KK7A 4BA1I 1FNUA 1KD1C 2DN8A 2VB3X 4O2DA 3GTMB 1PH5A 2KVMA 1GVPA 1EU4A 2KCCA 3M4PA 1PTOH 3FKIH 1BCPD 1AW7A 2G5DA 1KL9A 4POGA 4DXFA 2SDFA 2NVTB 3J81L 1VQKA 2E76C 4G4KA 1A2TA 4K0KQ 3P20A 1YNND 4JBKA 1HH2P 1L0YB 4ZK9B 5E7NA 3KLSA 4IJLA 1MHWC 5C5MA 4DV7Q 1CQFA 1C7YA 3NENA 4J8QA 4FVMA 1ZXTA 1STBA 1SRUA 4C2MH 4QCLA 3NEMA 3E0JA 3BYTB 3FPUB 4RG1A 1JB3A 3D4WA 4XXEA 2UXCQ 1STHA 1TWFH 5IT9L 3ZJYC 3I4OA 1CT1D 1EY7A 4DFAA 5IYDG 1H9SB 1TWAH 5JVG3 1MGSA 3EVQA 3F2UA 3IAYA 5EKKA 1U0LA 4HTHA 4A93B 4C1NI 1MIUA 3PO3B 3LGJA 4PNYA 3MEHA 1PRTF 3RN5A 4IPHA 4DF7A 2E75C 2KCTA 2ATWA 4YIJA 1B7YB 1SE2A 2VS1A 4HSPA 4LF6Q 3I8ZA 5J1ZA 4M1UB 4F7XA 1DXMA 2PQAA 2E5LQ 2AQ2B 1NUCA 5GROA 1O7IA 2QILA 2Z9HA 3A8JE 2I5MX 3GTLH 1EFID 1Y14B 1X9NA 1TY2A 1SBBB 2XWBB 5H1SE 5IOCA 5C0XI 4H7BA 3TP6A 1VQEA 1SE3A 4X3KA 4XQQA 4B3RQ 1PZJD 2QA4A 3V2TA 1V1PB 1HR0L 4A3BH 2OEOA 4GLXA 5KRUA 4HJ7A 2B39A 5C4XH 4QB4A 3HOUH 1G6ZA 2BH8A 3PUYA 4QQBX 5FK9C 3OPOA 4BY7B 1QOHA 2G9HD 1LTTD 3ULJA 1JWSD 3I56A 1XX8A 2L5TA 3VA5A 1RODA 3IKJA 1N34Q 2M00A 2DJFC 2PQAB 1A62A 1Q86C 4BY1H 5CR3A 2WP8J 4A93G 4IJHA 1CKOA 2F0TA 3T16A 3PO3G 3K0YA 1WCMB 3JAMi 4JOIC 2FMMA 1E3PA 2B2TA 4GNXB 1KDBA 2AWNA 4P2CB 3VR6A 3U9OA 4L63B 1W2BA 2A6EC 5LMUL 1Y1VG 4KHZA 3I55A 3HOWH 2KUMA 1XNQL 2KCMA 2SNMA 5HURA 1JJCB 1DD2A 2CW0C 3GTPH 3OSOA 4X65L 1JWUD 2E8GA 4NW2A 5CBAE 3NE5B 5TSSA 1HNZL 1A63A 4DV1L 3J81c 1AEXA 4CDEC 5KNCA 3CXCA 4RH6A 2PCFB 4OO1G 3AFPA 2FFKB 3SHLA 1Q8IA 3JC66 1BO0A 3TS2A 2NTSA 2B2WC 3MAQA 1EQRA 2MP1A 2NYZD 4RMFA 1XNRL 4JI4Q 2E2IB 2NVQH 2L11A 3F2BA 3LNNA 2BCOA 4JI8Q 4BBSH 4DV4L 1EOTA 4R8IA 3I4NH 3J7A5 1BCPF 4KY6A 4BY7G 2A6ED 1JOQA 4ZUIA 1Z7TA 4IUUA 5IT9c 5EBDA 5C3WA 3M4OH 1PA6A 2DUDA 5HGTA 2JA7H 3SK6A 4Y7NB 1S5FD 4B9WA 1WCMG 3MFYA 4IFDI 5M5WB 2JP1A 5E4WC 1JJGA 4FDBA 2RBMA 3M3YB 3A5ZB 1BXTA 5C4ZA 3MTSA 1KHIA 1XMQQ 2RA4A 3TZUA 1HCZA 2RCNA 4RKBA 4IOCA 3JAML 1EZ8A 2F0QA 1HJPA 3BZCA 4LF8L 3CD6A 1XXGA 5FO9B 2MUYA 4DUYQ 2RF4A 4LF4L 3HOZH 1AE2A 1I6VC 1QUQB 1NMGA 2V4DA 4OGQC 1IKMA 4AH6A 1FD7D 4EQ5A 3CCSA 5FLXE 1KC8C 4A3LH 1B9MA 2RCFA 1KAWA 1ICWA 4QMGA 2KHJA 5CMDA 4LF7Q 2MO1A 4UP9A 1GD7A 1U5KA 5JPMC 1CSPA 4FF1A 1G2SA 4OIJA 3CCQA 4DAYB 2RHQB 3K5MA 3CCJA 2WINB 5C44B 4LJZC 1QILA 5A35A 1ESFA 1PH2A 3QO2A 1HUMA 5FLMG 4OHJA 4A3BB 1HNZQ 3P7JA 3PQIA 2QGQA 1UE1A 2N78A 5M5XB 3QOJA 4O1NA 1U4MA 2NWGA 2FHTA 3S15H 3ERSX 1HXYD 1F9QA 1WD0A 1XNRQ 2Q2IA 4QJFA 4A3FH 2N88A 2EVBA 3J80E 4QF4A 2NVXH 4IUNA 2UUAL 3U9SA 3BVGA 1CZGA 1PYWD 1HRJA 2CHBD 2PMZB 4WJWA 1I4RA 4OONA 5IP7H 4DV4Q 1VQCA 4JI5Q 1U4LA 4R1JA 3ONAB 4NXNQ 4HAEA 4X66L 3A7AB 4BY1B 4GLAC 1QB5D 3A55A 5IYCH 3KJOA 2F0KA 1JOKA 1G8ZD 2F0PA 4LW1A 4C3IB 2ZJQA 1PH6A 1PFSA 2RQXA 4I65A 4ME5A 3CMEA 1L1OA 2L15A 3NUCA 4NKLA 2AWOA 2E2JH 2F3IA 3TBIB 1HZBA 1WD1A 1GO3E 4HR7B 3HOWB 3C1EA 2RHSB 3KUPA 4ABNA 2E74C 3HEJA 5D3DA 2N3SA 1R9TH 1XYIA 3GTPB 4GN3B 1EEID 4RCOA 3HG9A 4DV3L 4IFDH 3A74A 5C44G 2EYHA 2IHFA 3D4RA 3X3NA 2JA5H 1FR3A 2HQEA 1KLGD 5D3IB 1Q12A 5IGGA 4LF4Q 4DU9A 2R7ZH 4BS9A 1I94L 3L2PA 2NVQB 4B3MQ 4A3BG 2F0UA 4XYOA 2KENA 4BBSB 4DV6L 3NBHB 4IZ8A 3I73A 4P75A 2GA4B 4KLKA 1ENAA 2ICEC 3WWVA 1HZ9A 1GUGA 3ITPA 4KKTA 5IE8A 2L12A 1ML0D 1JE4A 3RZDB 3T1HL 3PUXA 4BY1G 3F2DA 1D7QA 1CSQA 3OMCA 5J39A 4JC0A 4C3IG 3SR1A 3JAMc 4WJ3M 4DV5L 2CH4W 3K58A 1WI5A 3G4SA 1NJIC 3MXPA 4JI7L 3R93A 3NK9A 5AFWA 4NB3A 4K6DA 1SNCA 3HGBA 4FXDA 5LMNL 3C1FA 3CPWA 2ZTCA 1N33Q 3KK7A 1QNKA 2LXJA 2EXDA 2L9HA 3HOZB 2YYZA 2DY8A 2UXDQ 3H3VC 4FF2A 4KI0A 3M7NA 4O42A 2E2DC 3NELA 2OCEA 2MQHA 3M4QA 4QIWB 2R61A 5C3XA 5C5LA 2VZAA 1DZ1A 5J3BA 1A8VA 4EQNA 1A3VA 1I50H 5BN4A 4AIMA 2IWHA 1KXLA 3SK8A 2IL8A 1Q82C 3S2DB 1CZWA 4PMWA 2F3VA 4GKJQ 3R2TA 2JJQA 3MA2B 4RGMA 3GTQH 2ID0A 2XRQD 4X3UA 4N8FA 4IURA 2V1CC 4MTNA 2LFNA 4JI2L 1ZKOA 2I5HA 3TP8A 3AYHB 2D0PA 1B70B 2K28A 2N8NA 2B2VC 3UE0A 4HCSA 4PV1C 3NHHA 1T9HA 2F4VQ 3S15B 4JV5Q 1OXVA 3U4ZA 2F0IA 3GTMH 2M2LA 1L0XB 4A3FB 4QIWE 4DUZL 4GNXC 2EE1A 2NVXB 4XIGS 4GKKQ 3AU7A 1A3TA 2EXZA 1QZHA 4CJ2C 5I6WA 5C0XG 1R4PB 3ERQA 4CHTB 1DYQA 1DOKA 2NVTH 1EYCA 1MJEA 4IFDJ 1RJTA 4H0LC 5HY6A 3T1YQ 1S4ZA 1VQ6A 3VR4A 3Q8DA 5M3MH 3T4AC 3E6ZX 4A3IB 4A3DH 4K2KA 4YHHL 2K7VA 4OEMB 1IL2A 1DONA 2E2JB 2X6GA 4S3SA 4FO2A 1QVFA 3L3OC 3SEBA 4OX9L 1NCVA 2JA9A 3CMAA 1WTXA 1E1TA 1PV4A 3DXJC 4JI7Q 3W2DA 1VQPA 1D5MC 4YCUA 5LMNQ 4DK0A 2HIVA 3CQZH 4DV0Q 4B08A 3Q23A 5M3FB 4A93H 1YHBA 1LTAD 1LTRD 3MXGA 3PO3H 2K01A 2WB1B 2R7ZB 3RNUA 4A3CH 1OO9B 1MJCA 5ELBA 1N32Q 1KNAA 2F03A 2VXWA 2IX1A 2EY1A 1ILPA 1SEBD 1R4QB 3CCUA 1PTOD 2FINB 4K8JA 2AUJD 4LK1C 4A3FG 5M5YH 1Y1VH 1PXUA 3R2IA 4Q0FA 3EQLC 1IBMQ 1EYAA 4CDCC 2JQOA 3Q0AA 1WOCA 1DOLA 3ULPA 1JWMD 2IT1A 1KRSA 5IYCG 1GUWA 1HNWL 1UE6A 2X69A 3OWFA 3A8KE 4BBRB 1E2VA 2I5LX 2D2CC 2H5XA 1K28A 3H3VH 2WB1E 1WTOA 1CQVA 1D5ZC 4A3IG 2N55A 2I07B 3EFXD 2MO0A 4EQOA 1F2YA 1P16A 3H0GG 3CCVA 3PIOA 3H09A 4KY7A 2HT1A 3OW2A 1VQBA 3KLSX 4MZ9A 4DUZQ 4DR5Q 1GJXA 4BY7H 2CKZB 4UY8C 1JCKB 1BR9A 4L5SA 5AJ3L 1OXTA 1IBLQ 1VMPA 4G7ZC 1VQNA 1JT8A 1YI2A 1K8MA 3ZYYX 1SN8A 2Q2TA 1F9SA 1JOOA 4IPCA 5M3FG 2HHHQ 4LUVA 2R7ZG 1VF7A 1CKNB 2WB1G 1WCMH 3WDNA 2JA8H 1I50B 3I4MB 2Q8RE 3NQIA 2HDMA 2OQKA 1CI3M 3A7LA 1EEFD 3GTQB 3DM1A 1OXXK 3HOXH 5D14A 1CHQD 1EY0A 5CYUA 4NP5A 2JE6I 5G3LD 2RSNA 1XMOQ 5ISRA 1I4HA 4IPGA 4N9TA 5BN3A 3FPPA 1EQVA 1J8IA 3BU2A 4KKUA 1YNJC 4N8X1 3UDGA 1TY0A 4H13C 4DR4L 1YHAA 5GQOA 4BBRG 2C35B 4KHPL 4CKEA 2UXBL 3N52A 1FL0A 2EYFA 2K14A 2E2IH 5JEAG 1UEAB 4K5WA 4HIMA 3VA7A 4CBVA 3S1MB 4OXPA 5BR8Q 1D1IA 1SR3A 2A1AA 3M4YA 4CDFC 3SK5A 3NTKA 5M3MB 1G2TA 5D65A 3ICEA 5C4HA 5FLMH 1ET6A 1X3EA 1SJHD 4Q5VA 4A3DB 3BDLA 1K83H 2JEBI 1LT4D 4NXML 3D6CA 4TSSA 3SXHA 4X3TA 4Y7NH 4XT1B 1SNOA 2AQ3B 1CHPD 2GVBA 4TQUS 2EYMA 1NBWA 5M5WH 3I4MG 1QE6A 3TN2A 1LUZA 4P73A 1SYEA 1WTPA 3M3YH 3PUWA 2IHEA 1YVCA 1HNXL 3J81j 3CQZB 4J6HA 4ZYSA 1VQLA 4HSVA 1BNZA 2JK8A 4IPDA 4RCNA 2CWPA 4H44C 3L7ZC 5AJ3Q 1SAPA 1PYSB 4B3SQ 3NSWA 3A54A 4IN3A 3PIPA 1JQYD 4ZKBB 5EPLA
chains in the Genus database with same CATH topology
1NTGA 3GTOH 3CCRA 3CC4A 2N49A 2RCNA 1P8LA 4IOCA 4JI2Q 1WJJA 1HR0W 2PI2A 1HJPA 1SFOH 1Q46A 2R7FA 3BZCA 4HJAA 4LF8L 3CD6A 4BXXG 5GAHC 1YZ6A 4DUYQ 4K0KL 2RF4A 4LF4L 1QZGA 5K36G 3HOZH 2ZTDA 1JB7A 1I6HH 3HOYG 4AQYQ 1AE2A 4JI6Q 1QUQB 1NMGA 2BA1A 2Z6KA 1KIXA 5FJ8H 4LNQA 3HOVH 4AH6A 4DV7L 4JI0Q 4EQ5A 3CCSA 5C44H 1KC8C 3PO2H 4A3LH 4APVA 1KAWA 4QGUA 5M3MG 3G48A 3HOWG 3ULLA 1Q7YC 1RL2A 1YJNA 4DV0L 2KHJA 4LF7Q 2MO1A 4UP9A 3RLOA 1Q81C 1GD7A 1U5KA 4A3DG 1CSPA 5IWAQ 4DR4Q 4JBMA 2LSSA 2DGYA 3W1GA 1XPRA 1SMXA 3D31A 1K3RA 3GDEA 4WJ4A 1V9PA 3CCQA 4KHPQ 4DAYB 5M5XH 1KRTA 1N32L 2RHQB 1L0WA 3CCJA 1G291 1VQIA 4H02A 3FP9A 2CQOA 2ZTEA 4DR7L 1IZ6A 4DK6C 3PF4A 3F8TA 3K7AH 1A0IA 1IBKL 1PH2A 1JMCA 4GS3A 3S24A 4YHHQ 1BBUA 5FLMG 4OO1I 4QL5A 5JJKA 2R6GA 4JI1L 2ZM6L 3HKZE 4ALPA 2AKWB 1HNZQ 2YU9H 4BBSG 3AEVA 2QGQA 4YWLA 1UE1A 4OX9Q 3H3VI 2N78A 2Z6KC 4LFCL 1PH9A 1IBML 4P71A 5IYDH 3I4NG 1Q8KA 4UP8A 3S15H 1FGUA 3ERSX 4C3IH 1XNRQ 1X3GA 3K0XA 2Q2IA 4QJFA 4A3FH 4LF6L 4A3CG 2F52A 4X64L 2IX0A 4LUZA 2NVXH 2UUAL 4R4OA 2AHOB 1YJ9A 5IYBG 3S17H 1W3SA 5IP7H 4OONA 4DV4Q 2UUCQ 4BBSH 1VQCA 4JI5Q 3CF5A 1E24A 4R1JA 1PH1A 4LF9L 2JA7G 4QY7A 2VL6A 3HFZB 4NXNQ 3S1RH 4X66L 3CCMA 2KBNA 4GLAC 5IYCH 4LF5L 3AQQA 4XTCS 3KJOA 4R4TA 2OTJA 4LW1A 4EX5A 1PH7A 3EN2A 4DR5L 2ZJQA 3HKZG 1CUKA 3U50C 1PH6A 3S2HH 2UU9Q 4LFAL 1PFSA 1YIJA 1VQJA 3UDFA 4GN4B 1X3FA 4C3HH 5IY0A 3CMEA 1L1OA 2L15A 4YWKA 1HNXQ 4B3RL 1C9OA 2B63G 1QVGA 1HZAA 2WFWA 3W5OA 2AWOA 1J5EL 1IBLL 2E2JH 3GTGH 2F3IA 3S1NH 3UE1A 4DNIA 4DR6Q 1EIFA 1HZBA 1GO3E 2GN5A 4UPAA 4LFBL 1WFQA 1N36Q 3AFQA 2NN6I 2RHSB 3RZOH 1NY4A 2HHHL 3HOZG 2N3SA 1R9TH 1HNWQ 3PV0A 1PH3A 4GN3B 3J7ZC 1EYGA 1LTLA 2B3GA 3HOVG 4A76A 1Q1EA 4DV3L 1FVIA 3A74A 5C44G 1FJGQ 4A3LG 1PH8A 1WYDA 2IHFA 1PH4A 5FLXc 2JA5H 4A3GH 4R4CA 1N34L 2D62A 2K5NA 1Q12A 4YY3L 4LF4Q 2R7ZH 1RIPA 1VS0A 1I94L 3L2PA 4B3MQ 4A3BG 2A19A 3RZDH 2KENA 4JBWA 1XMOL 4AYBE 1TWHH 1L1OC 3K80C 3NBHB 4DV6L 2BA0A 1CKMA 3G6EA 1Q1BA 1VCIA 3FHWA 4P75A 5C3EG 2IY5B 1G6PA 4UP7A 4C3JH 4DV2L 3HKSA 4JG2A 4KLKA 2JA8G 3RN2A 3WWVA 1HR0Q 2E2HH 2BH2A 3PUZA 3W1BA 1PVOA 1HZ9A 1QVCA 5IE8A 3E9IA 4DR3L 4A4IA 2UUBL 2VQFQ 5LMNW 2ZJRA 3EBEA 3T1HL 4B3TQ 2R92H 1MKHA 3HOXG 3PUXA 4BY1G 3G71A 4NPSA 2K52A 3F2DA 1D7QA 1CSQA 2K75A 4DR7Q 4JC0A 4HIKA 4HIOA 3TQYA 4L5RC 3JAMc 4WJ3M 4DV5L 3MXNB 5BR8L 4HJ8A 3DM3A 4JI3L 3S1QH 1IYJB 1WI5A 4JI1Q 4AYBG 1CKNA 3G4SA 3J80c 4A3JG 1N8RC 3MEFA 5IP7G 1LM0A 2HQLA 4JYAQ 1NJIC 3K7UC 4LFCQ 4O0AA 2MFIA 3KF8B 4JI4L 2VUMH 4JI7L 1EUJA 4NB3A 1VQ7A 2R93H 4DK3C 1X65A 4DR1L 4JI8L 5LMNL 3J81i 3PCOB 4X64Q 1UE5A 4Y52H 3CPWA 2ZTCA 1N33Q 3CAMA 4DAMA 2LXJA 1VQ4A 4IOAA 2EXDA 3GO5A 3OTOL 2YYZA 2WAQE 3S2DH 2ZJPA 2UXCL 2UXDQ 1YNXA 4LUOA 1TWGH 4X62L 2UXBQ 4MNOA 4KI0A 4LF5Q 2A8VA 5LMUQ 3M7NA 3I2ZA 1NE3A 1K73C 3NELA 2OCEA 3RLFA 2MQHA 3M4QA 3TS0A 3PF5A 1VQ9A 1XNQQ 1I5FA 2GVAA 4GNXA 2VZAA 2K4KA 5J3BA 1A8VA 4GOPA 1I50H 3STBC 3CPFA 4X65Q 4AIMA 3KLWA 1AH9A 1M90C 3EIVA 1KXLA 4DV1Q 4OWXB 1Q82C 1GKHA 4PMWA 1GM5A 4B3SL 1VQ5A 4IFDG 4GKJQ 4YCWA 2JJQA 3KDFA 2JA5G 2ID0A 3GTQH 4A3GG 1VQOA 1JJ2A 4LFBQ 3KF6A 3RR5A 1XMQL 1Y1WH 2EIFA 3D0FA 4A3KH 2E5LL 2V1CC 4MTNA 4NXMQ 1B8AA 4JI2L 2I5HA 3E9HA 3AYHB 2D0PA 1E7ZA 1B70B 2K50A 2N8NA 1TXYA 4LWCA 4DUYL 3UE0A 3CCLA 4ME3A 2LXKA 4TVAB 3KFUA 1T9HA 2F4VQ 1BKBA 1N9WA 4AQYL 1VQMA 4JI6L 4JV5Q 2OWOA 1OXVA 3U4ZA 3A0JA 3GTMH 4JI0L 4QIWE 4DUZL 4GNXC 2YV5A 4XIGS 3STBD 4GOPC 1YHQA 5DLQE 4GKKQ 1OXUA 3RLNA 1QZHA 2Q2UA 1C0AA 4A3IH 2R7DA 1X6OA 3F2CA 5C0XG 3TREA 4LF7L 3H0GH 1YJWA 4DV2Q 3HOYH 2NVTH 3OYYA 1MJEA 4IFDJ 4BA1I 2YTXA 3SGIA 1K8AC 5HY6A 1KD1C 3T1YQ 2PI2E 4GOPB 4O2DA 1VQ6A 3Q8DA 5M3MH 1XTDA 1PH5A 1GVPA 2UUBQ 4X6AH 4P72A 3M4PA 1E1OA 3FKIH 5FJ8G 3KJPA 4YHHL 4A3MH 2VUMG 4A3DH 3CC2A 3PO2G 1J6QA 1KL9A 3E0EA 4POGA 5IP9H 1IL2A 2R93G 1QVFA 1VQHA 1S40A 1VQKA 4LF8Q 1EOVA 4HIDA 5M3FH 4OX9L 4K0KQ 1EIYB 1VQ8A 3BJUA 1G51A 2K5HA 4OWWB 4JBKA 1HH2P 2JA9A 2ES2A 5E7NA 2QEXA 4IJLA 3CMAA 4DV7Q 1E1TA 1PV4A 5EAYA 1C7YA 1VQPA 4JI7Q 3NENA 4GLVB 5C0XJ 3CW2C 4YCUA 5LMNQ 1SRUA 2CCZA 1OXSC 2HIVA 4C2MH 2UUCL 2VNUD 5GAEC 4JI5L 3CQZH 4DV0Q 1QUQA 2NZOA 4J15A 4NXNL 1YHBA 3NEMA 4A93H 3PO3H 3OTOQ 3RNUA 4JCVE 1L1OB 4L5TA 4RG1A 4A3CH 2B29A 4DPGA 2UXCQ 1TWFH 1BBWA 1MJCA 3I7FA 3ZJYC 1Z9FA 1N32Q 1L2FA 1Z47A 3I4OA 5ELNA 3CCEA 2IX1A 1X55A 1UWVA 5IYDG 1TWAH 1YBYA 3CCUA 1IBKQ 4BBRH 1YEZA 5GAGC 4A3FG 4HJ9A 2XGTA 1EWIA 5M5YH 3U4VA 1U0LA 4A3KG 1Y1VH 1DGSA 2ZM6Q 4DR6L 1MIUA 1EQQA 2Q2HA 3M85A 3M9BA 3LGJA 2VW9A 3UDXA 1IBMQ 3RN5A 2JQOA 2YTYA 4IPHA 1WOCA 3ULPA 2KCTA 2IT1A 2ATWA 1KRSA 1B7YB 5IYCG 2B63H 2VS1A 1UE6A 1HNWL 4LF6Q 2VQEL 2JA6H 4DR2L 2UUAQ 1K8GA 4A75A 2I5LX 2PQAA 1E22A 1HZCA 2E5LQ 3KYHC 1JE5A 1FJGL 3S14H 5JJIA 3TEHB 2D0OA 2H5XA 3ER0A 5GROA 2ALYB 2YTVA 1V43A 3H3VH 1O7IA 2WB1E 3K8AA 4A3IG 4LF9Q 2MO0A 2I5MX 3GTLH 1P16A 4X66Q 3H0GG 1S72A 2Y0SE 4DKAC 1Y14B 3CCVA 3PIOA 4B3ML 2HT1A 3OW2A 1X9NA 1VQBA 4BA2I 4MZ9A 5H1SE 4DUZQ 4DR5Q 3GTKH 5HGQA 5C0XI 4LFAQ 1VQEA 4BY7H 4HJ5A 4JOIA 3I4MH 2CKZB 1SE8A 3L0OA 4UY8C 1XPOA 3IRBA 4PZ8A 2QA4A 4L5SA 4B3RQ 5AJ3L 1OXTA 3KOJA 4A3MG 3FKIG 1J5EQ 1HR0L 1IBLQ 4A3BH 4L5QA 2EQSA 4PZ7A 1K0RA 1VQNA 1JT8A 4GLXA 4HJ7A 2K5VA 5IP9G 1OTCA 1YI2A 2Q2TA 1SN8A 5C4XH 2Z0SA 3HOUH 2BH8A 2VQFL 3PUYA 4IPCA 5M3FG 4B3TL 1XPUA 4QQBX 5C3EH 2HHHQ 4LUVA 1PHJA 4P74A 1CKNB 2WB1G 3A5UA 1WCMH 4A3EH 2WAQG 2R7ZG 1VQFA 3PGZA 3DLLA 2I0QA 2JA8H 1KQSA 3ULJA 1XJVA 2Y0SG 4DV3Q 4POFA 1ASYA 1IXRA 4R4IA 3I56A 2OQKA 1H95A 1N34Q 3CC7A 4JYAL 2PQAB 1OXXK 3HOXH 1A62A 4YY3Q 1YITA 1Q86C 4BY1H 1I94Q 4OWTB 5ELOA 2WP8J 5GADC 3U58A 4A93G 2JE6I 1CKOA 4IJHA 3PO3G 3B6YA 2JEAI 3JAMi 1XMOQ 4JOIC 4BXXH 1M1KC 4DV6Q 4IPGA 1N33L 4PZ6A 1EFWA 2KHIA 2NZHA 3J80i 4A3JH 2R92G 3BU2A 1D8LA 3UDGA 3CP0A 5IWAL 4DR4L 3S1MH 1E3PA 1NMFA 1YHAA 5GQOA 4GNXB 1VQDA 3BZKA 4BBRG 2C35B 2AWNA 2UXDL 4YCVA 4KHPL 1W2BA 2UXBL 1FL0A 5LMUL 1Y1VG 4KHZA 3I55A 2FXQA 3HOWH 1LYLA 4DR3Q 2KCMA 1XNQL 2K14A 3T1HQ 1ASZA 2E2IH 3PSIA 2OQ0A 1JJCB 2XTIA 5JEAG 4R4QA 1AE3A 1UEBA 3GTPH 2MNAA 3KDFB 1BVSA 4X65L 4HIMA 4JBJA 2E8GA 1HNZL 1A63A 4DV1L 3KF6B 4OXPA 3J81c 5BR8Q 4DV5Q 3CXCA 4JI3Q 1SR3A 2JA6G 4OO1G 2A1AA 3AFPA 3JC66 4GKJL 2VY3A 3TS2A 1X56A 1EQRA 4RMFA 2ASBA 1XNRL 3GTJH 4JI4Q 2AMCB 3ICEA 5JJLA 5FLMH 2NVQH 2CWAA 3F1ZA 1X3EA 3UDIA 4GN5A 1V1QA 1VQAA 3F2BA 1K83H 2JEBI 4JI8Q 4DR1Q 1SROA 2VQEQ 4NXML 2PMZE 4DV4L 4DR2Q 4IO9A 4Y7NH 1VQGA 2OTLA 2GVBA 4TQUS 3I4NH 3J7A5 1NBWA 3GD7A 4BY7G 5M5WH 2NVYH 2PNHA 3I4MG 2F4VL 4JV5L 1PYBA 1TWCH 4X62Q 1LUZA 5IT9c 4P73A 3S16H 5JEAJ 5IYBH 3M3YH 3PUWA 3M4OH 2IHEA 2UU9L 1X54A 1PA6A 1YVCA 2DUDA 4GKKL 1HNXL 1S3OA 2CFMA 2JA7H 3HOUG 5C4XG 3J81j 1K9MC 1VQLA 1Y1WG 4A3EG 3PUVA 1WCMG 2JK8A 4IPDA 2HIXA 4IFDI 2CWPA 1UE7A 1I3QH 3L7ZC 4PG3A 5AJ3Q 3H15A 3T1YL 1JJGA 1PYSB 4FDBA 3VDYA 4B3SQ 1N36L 3K81C 3PIPA 3A5ZB 5C4JH 1SLJA 3TRZA 4YWMA 1KHIA 1XMQQ 2NN6G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTG A;  3GTO H;  3CCR A;  3CC4 A;  2N49 A;  2RCN A;  1P8L A;  4IOC A;  4JI2 Q;  1WJJ A;  1HR0 W;  2PI2 A;  1HJP A;  1SFO H;  1Q46 A;  2R7F A;  3BZC A;  4HJA A;  4LF8 L;  3CD6 A;  4BXX G;  5GAH C;  1YZ6 A;  4DUY Q;  4K0K L;  2RF4 A;  4LF4 L;  1QZG A;  5K36 G;  3HOZ H;  2ZTD A;  1JB7 A;  1I6H H;  3HOY G;  4AQY Q;  1AE2 A;  4JI6 Q;  1QUQ B;  1NMG A;  2BA1 A;  2Z6K A;  1KIX A;  5FJ8 H;  4LNQ A;  3HOV H;  4AH6 A;  4DV7 L;  4JI0 Q;  4EQ5 A;  3CCS A;  5C44 H;  1KC8 C;  3PO2 H;  4A3L H;  4APV A;  1KAW A;  4QGU A;  5M3M G;  3G48 A;  3HOW G;  3ULL A;  1Q7Y C;  1RL2 A;  1YJN A;  4DV0 L;  2KHJ A;  4LF7 Q;  2MO1 A;  4UP9 A;  3RLO A;  1Q81 C;  1GD7 A;  1U5K A;  4A3D G;  1CSP A;  5IWA Q;  4DR4 Q;  4JBM A;  2LSS A;  2DGY A;  3W1G A;  1XPR A;  1SMX A;  3D31 A;  1K3R A;  3GDE A;  4WJ4 A;  1V9P A;  3CCQ A;  4KHP Q;  4DAY B;  5M5X H;  1KRT A;  1N32 L;  2RHQ B;  1L0W A;  3CCJ A;  1G29 1;  1VQI A;  4H02 A;  3FP9 A;  2CQO A;  2ZTE A;  4DR7 L;  1IZ6 A;  4DK6 C;  3PF4 A;  3F8T A;  3K7A H;  1A0I A;  1IBK L;  1PH2 A;  1JMC A;  4GS3 A;  3S24 A;  4YHH Q;  1BBU A;  5FLM G;  4OO1 I;  4QL5 A;  5JJK A;  2R6G A;  4JI1 L;  2ZM6 L;  3HKZ E;  4ALP A;  2AKW B;  1HNZ Q;  2YU9 H;  4BBS G;  3AEV A;  2QGQ A;  4YWL A;  1UE1 A;  4OX9 Q;  3H3V I;  2N78 A;  2Z6K C;  4LFC L;  1PH9 A;  1IBM L;  4P71 A;  5IYD H;  3I4N G;  1Q8K A;  4UP8 A;  3S15 H;  1FGU A;  3ERS X;  4C3I H;  1XNR Q;  1X3G A;  3K0X A;  2Q2I A;  4QJF A;  4A3F H;  4LF6 L;  4A3C G;  2F52 A;  4X64 L;  2IX0 A;  4LUZ A;  2NVX H;  2UUA L;  4R4O A;  2AHO B;  1YJ9 A;  5IYB G;  3S17 H;  1W3S A;  5IP7 H;  4OON A;  4DV4 Q;  2UUC Q;  4BBS H;  1VQC A;  4JI5 Q;  3CF5 A;  1E24 A;  4R1J A;  1PH1 A;  4LF9 L;  2JA7 G;  4QY7 A;  2VL6 A;  3HFZ B;  4NXN Q;  3S1R H;  4X66 L;  3CCM A;  2KBN A;  4GLA C;  5IYC H;  4LF5 L;  3AQQ A;  4XTC S;  3KJO A;  4R4T A;  2OTJ A;  4LW1 A;  4EX5 A;  1PH7 A;  3EN2 A;  4DR5 L;  2ZJQ A;  3HKZ G;  1CUK A;  3U50 C;  1PH6 A;  3S2H H;  2UU9 Q;  4LFA L;  1PFS A;  1YIJ A;  1VQJ A;  3UDF A;  4GN4 B;  1X3F A;  4C3H H;  5IY0 A;  3CME A;  1L1O A;  2L15 A;  4YWK A;  1HNX Q;  4B3R L;  1C9O A;  2B63 G;  1QVG A;  1HZA A;  2WFW A;  3W5O A;  2AWO A;  1J5E L;  1IBL L;  2E2J H;  3GTG H;  2F3I A;  3S1N H;  3UE1 A;  4DNI A;  4DR6 Q;  1EIF A;  1HZB A;  1GO3 E;  2GN5 A;  4UPA A;  4LFB L;  1WFQ A;  1N36 Q;  3AFQ A;  2NN6 I;  2RHS B;  3RZO H;  1NY4 A;  2HHH L;  3HOZ G;  2N3S A;  1R9T H;  1HNW Q;  3PV0 A;  1PH3 A;  4GN3 B;  3J7Z C;  1EYG A;  1LTL A;  2B3G A;  3HOV G;  4A76 A;  1Q1E A;  4DV3 L;  1FVI A;  3A74 A;  5C44 G;  1FJG Q;  4A3L G;  1PH8 A;  1WYD A;  2IHF A;  1PH4 A;  5FLX c;  2JA5 H;  4A3G H;  4R4C A;  1N34 L;  2D62 A;  2K5N A;  1Q12 A;  4YY3 L;  4LF4 Q;  2R7Z H;  1RIP A;  1VS0 A;  1I94 L;  3L2P A;  4B3M Q;  4A3B G;  2A19 A;  3RZD H;  2KEN A;  4JBW A;  1XMO L;  4AYB E;  1TWH H;  1L1O C;  3K80 C;  3NBH B;  4DV6 L;  2BA0 A;  1CKM A;  3G6E A;  1Q1B A;  1VCI A;  3FHW A;  4P75 A;  5C3E G;  2IY5 B;  1G6P A;  4UP7 A;  4C3J H;  4DV2 L;  3HKS A;  4JG2 A;  4KLK A;  2JA8 G;  3RN2 A;  3WWV A;  1HR0 Q;  2E2H H;  2BH2 A;  3PUZ A;  3W1B A;  1PVO A;  1HZ9 A;  1QVC A;  5IE8 A;  3E9I A;  4DR3 L;  4A4I A;  2UUB L;  2VQF Q;  5LMN W;  2ZJR A;  3EBE A;  3T1H L;  4B3T Q;  2R92 H;  1MKH A;  3HOX G;  3PUX A;  4BY1 G;  3G71 A;  4NPS A;  2K52 A;  3F2D A;  1D7Q A;  1CSQ A;  2K75 A;  4DR7 Q;  4JC0 A;  4HIK A;  4HIO A;  3TQY A;  4L5R C;  3JAM c;  4WJ3 M;  4DV5 L;  3MXN B;  5BR8 L;  4HJ8 A;  3DM3 A;  4JI3 L;  3S1Q H;  1IYJ B;  1WI5 A;  4JI1 Q;  4AYB G;  1CKN A;  3G4S A;  3J80 c;  4A3J G;  1N8R C;  3MEF A;  5IP7 G;  1LM0 A;  2HQL A;  4JYA Q;  1NJI C;  3K7U C;  4LFC Q;  4O0A A;  2MFI A;  3KF8 B;  4JI4 L;  2VUM H;  4JI7 L;  1EUJ A;  4NB3 A;  1VQ7 A;  2R93 H;  4DK3 C;  1X65 A;  4DR1 L;  4JI8 L;  5LMN L;  3J81 i;  3PCO B;  4X64 Q;  1UE5 A;  4Y52 H;  3CPW A;  2ZTC A;  1N33 Q;  3CAM A;  4DAM A;  2LXJ A;  1VQ4 A;  4IOA A;  2EXD A;  3GO5 A;  3OTO L;  2YYZ A;  2WAQ E;  3S2D H;  2ZJP A;  2UXC L;  2UXD Q;  1YNX A;  4LUO A;  1TWG H;  4X62 L;  2UXB Q;  4MNO A;  4KI0 A;  4LF5 Q;  2A8V A;  5LMU Q;  3M7N A;  3I2Z A;  1NE3 A;  1K73 C;  3NEL A;  2OCE A;  3RLF A;  2MQH A;  3M4Q A;  3TS0 A;  3PF5 A;  1VQ9 A;  1XNQ Q;  1I5F A;  2GVA A;  4GNX A;  2VZA A;  2K4K A;  5J3B A;  1A8V A;  4GOP A;  1I50 H;  3STB C;  3CPF A;  4X65 Q;  4AIM A;  3KLW A;  1AH9 A;  1M90 C;  3EIV A;  1KXL A;  4DV1 Q;  4OWX B;  1Q82 C;  1GKH A;  4PMW A;  1GM5 A;  4B3S L;  1VQ5 A;  4IFD G;  4GKJ Q;  4YCW A;  2JJQ A;  3KDF A;  2JA5 G;  2ID0 A;  3GTQ H;  4A3G G;  1VQO A;  1JJ2 A;  4LFB Q;  3KF6 A;  3RR5 A;  1XMQ L;  1Y1W H;  2EIF A;  3D0F A;  4A3K H;  2E5L L;  2V1C C;  4MTN A;  4NXM Q;  1B8A A;  4JI2 L;  2I5H A;  3E9H A;  3AYH B;  2D0P A;  1E7Z A;  1B70 B;  2K50 A;  2N8N A;  1TXY A;  4LWC A;  4DUY L;  3UE0 A;  3CCL A;  4ME3 A;  2LXK A;  4TVA B;  3KFU A;  1T9H A;  2F4V Q;  1BKB A;  1N9W A;  4AQY L;  1VQM A;  4JI6 L;  4JV5 Q;  2OWO A;  1OXV A;  3U4Z A;  3A0J A;  3GTM H;  4JI0 L;  4QIW E;  4DUZ L;  4GNX C;  2YV5 A;  4XIG S;  3STB D;  4GOP C;  1YHQ A;  5DLQ E;  4GKK Q;  1OXU A;  3RLN A;  1QZH A;  2Q2U A;  1C0A A;  4A3I H;  2R7D A;  1X6O A;  3F2C A;  5C0X G;  3TRE A;  4LF7 L;  3H0G H;  1YJW A;  4DV2 Q;  3HOY H;  2NVT H;  3OYY A;  1MJE A;  4IFD J;  4BA1 I;  2YTX A;  3SGI A;  1K8A C;  5HY6 A;  1KD1 C;  3T1Y Q;  2PI2 E;  4GOP B;  4O2D A;  1VQ6 A;  3Q8D A;  5M3M H;  1XTD A;  1PH5 A;  1GVP A;  2UUB Q;  4X6A H;  4P72 A;  3M4P A;  1E1O A;  3FKI H;  5FJ8 G;  3KJP A;  4YHH L;  4A3M H;  2VUM G;  4A3D H;  3CC2 A;  3PO2 G;  1J6Q A;  1KL9 A;  3E0E A;  4POG A;  5IP9 H;  1IL2 A;  2R93 G;  1QVF A;  1VQH A;  1S40 A;  1VQK A;  4LF8 Q;  1EOV A;  4HID A;  5M3F H;  4OX9 L;  4K0K Q;  1EIY B;  1VQ8 A;  3BJU A;  1G51 A;  2K5H A;  4OWW B;  4JBK A;  1HH2 P;  2JA9 A;  2ES2 A;  5E7N A;  2QEX A;  4IJL A;  3CMA A;  4DV7 Q;  1E1T A;  1PV4 A;  5EAY A;  1C7Y A;  1VQP A;  4JI7 Q;  3NEN A;  4GLV B;  5C0X J;  3CW2 C;  4YCU A;  5LMN Q;  1SRU A;  2CCZ A;  1OXS C;  2HIV A;  4C2M H;  2UUC L;  2VNU D;  5GAE C;  4JI5 L;  3CQZ H;  4DV0 Q;  1QUQ A;  2NZO A;  4J15 A;  4NXN L;  1YHB A;  3NEM A;  4A93 H;  3PO3 H;  3OTO Q;  3RNU A;  4JCV E;  1L1O B;  4L5T A;  4RG1 A;  4A3C H;  2B29 A;  4DPG A;  2UXC Q;  1TWF H;  1BBW A;  1MJC A;  3I7F A;  3ZJY C;  1Z9F A;  1N32 Q;  1L2F A;  1Z47 A;  3I4O A;  5ELN A;  3CCE A;  2IX1 A;  1X55 A;  1UWV A;  5IYD G;  1TWA H;  1YBY A;  3CCU A;  1IBK Q;  4BBR H;  1YEZ A;  5GAG C;  4A3F G;  4HJ9 A;  2XGT A;  1EWI A;  5M5Y H;  3U4V A;  1U0L A;  4A3K G;  1Y1V H;  1DGS A;  2ZM6 Q;  4DR6 L;  1MIU A;  1EQQ A;  2Q2H A;  3M85 A;  3M9B A;  3LGJ A;  2VW9 A;  3UDX A;  1IBM Q;  3RN5 A;  2JQO A;  2YTY A;  4IPH A;  1WOC A;  3ULP A;  2KCT A;  2IT1 A;  2ATW A;  1KRS A;  1B7Y B;  5IYC G;  2B63 H;  2VS1 A;  1UE6 A;  1HNW L;  4LF6 Q;  2VQE L;  2JA6 H;  4DR2 L;  2UUA Q;  1K8G A;  4A75 A;  2I5L X;  2PQA A;  1E22 A;  1HZC A;  2E5L Q;  3KYH C;  1JE5 A;  1FJG L;  3S14 H;  5JJI A;  3TEH B;  2D0O A;  2H5X A;  3ER0 A;  5GRO A;  2ALY B;  2YTV A;  1V43 A;  3H3V H;  1O7I A;  2WB1 E;  3K8A A;  4A3I G;  4LF9 Q;  2MO0 A;  2I5M X;  3GTL H;  1P16 A;  4X66 Q;  3H0G G;  1S72 A;  2Y0S E;  4DKA C;  1Y14 B;  3CCV A;  3PIO A;  4B3M L;  2HT1 A;  3OW2 A;  1X9N A;  1VQB A;  4BA2 I;  4MZ9 A;  5H1S E;  4DUZ Q;  4DR5 Q;  3GTK H;  5HGQ A;  5C0X I;  4LFA Q;  1VQE A;  4BY7 H;  4HJ5 A;  4JOI A;  3I4M H;  2CKZ B;  1SE8 A;  3L0O A;  4UY8 C;  1XPO A;  3IRB A;  4PZ8 A;  2QA4 A;  4L5S A;  4B3R Q;  5AJ3 L;  1OXT A;  3KOJ A;  4A3M G;  3FKI G;  1J5E Q;  1HR0 L;  1IBL Q;  4A3B H;  4L5Q A;  2EQS A;  4PZ7 A;  1K0R A;  1VQN A;  1JT8 A;  4GLX A;  4HJ7 A;  2K5V A;  5IP9 G;  1OTC A;  1YI2 A;  2Q2T A;  1SN8 A;  5C4X H;  2Z0S A;  3HOU H;  2BH8 A;  2VQF L;  3PUY A;  4IPC A;  5M3F G;  4B3T L;  1XPU A;  4QQB X;  5C3E H;  2HHH Q;  4LUV A;  1PHJ A;  4P74 A;  1CKN B;  2WB1 G;  3A5U A;  1WCM H;  4A3E H;  2WAQ G;  2R7Z G;  1VQF A;  3PGZ A;  3DLL A;  2I0Q A;  2JA8 H;  1KQS A;  3ULJ A;  1XJV A;  2Y0S G;  4DV3 Q;  4POF A;  1ASY A;  1IXR A;  4R4I A;  3I56 A;  2OQK A;  1H95 A;  1N34 Q;  3CC7 A;  4JYA L;  2PQA B;  1OXX K;  3HOX H;  1A62 A;  4YY3 Q;  1YIT A;  1Q86 C;  4BY1 H;  1I94 Q;  4OWT B;  5ELO A;  2WP8 J;  5GAD C;  3U58 A;  4A93 G;  2JE6 I;  1CKO A;  4IJH A;  3PO3 G;  3B6Y A;  2JEA I;  3JAM i;  1XMO Q;  4JOI C;  4BXX H;  1M1K C;  4DV6 Q;  4IPG A;  1N33 L;  4PZ6 A;  1EFW A;  2KHI A;  2NZH A;  3J80 i;  4A3J H;  2R92 G;  3BU2 A;  1D8L A;  3UDG A;  3CP0 A;  5IWA L;  4DR4 L;  3S1M H;  1E3P A;  1NMF A;  1YHA A;  5GQO A;  4GNX B;  1VQD A;  3BZK A;  4BBR G;  2C35 B;  2AWN A;  2UXD L;  4YCV A;  4KHP L;  1W2B A;  2UXB L;  1FL0 A;  5LMU L;  1Y1V G;  4KHZ A;  3I55 A;  2FXQ A;  3HOW H;  1LYL A;  4DR3 Q;  2KCM A;  1XNQ L;  2K14 A;  3T1H Q;  1ASZ A;  2E2I H;  3PSI A;  2OQ0 A;  1JJC B;  2XTI A;  5JEA G;  4R4Q A;  1AE3 A;  1UEB A;  3GTP H;  2MNA A;  3KDF B;  1BVS A;  4X65 L;  4HIM A;  4JBJ A;  2E8G A;  1HNZ L;  1A63 A;  4DV1 L;  3KF6 B;  4OXP A;  3J81 c;  5BR8 Q;  4DV5 Q;  3CXC A;  4JI3 Q;  1SR3 A;  2JA6 G;  4OO1 G;  2A1A A;  3AFP A;  3JC6 6;  4GKJ L;  2VY3 A;  3TS2 A;  1X56 A;  1EQR A;  4RMF A;  2ASB A;  1XNR L;  3GTJ H;  4JI4 Q;  2AMC B;  3ICE A;  5JJL A;  5FLM H;  2NVQ H;  2CWA A;  3F1Z A;  1X3E A;  3UDI A;  4GN5 A;  1V1Q A;  1VQA A;  3F2B A;  1K83 H;  2JEB I;  4JI8 Q;  4DR1 Q;  1SRO A;  2VQE Q;  4NXM L;  2PMZ E;  4DV4 L;  4DR2 Q;  4IO9 A;  4Y7N H;  1VQG A;  2OTL A;  2GVB A;  4TQU S;  3I4N H;  3J7A 5;  1NBW A;  3GD7 A;  4BY7 G;  5M5W H;  2NVY H;  2PNH A;  3I4M G;  2F4V L;  4JV5 L;  1PYB A;  1TWC H;  4X62 Q;  1LUZ A;  5IT9 c;  4P73 A;  3S16 H;  5JEA J;  5IYB H;  3M3Y H;  3PUW A;  3M4O H;  2IHE A;  2UU9 L;  1X54 A;  1PA6 A;  1YVC A;  2DUD A;  4GKK L;  1HNX L;  1S3O A;  2CFM A;  2JA7 H;  3HOU G;  5C4X G;  3J81 j;  1K9M C;  1VQL A;  1Y1W G;  4A3E G;  3PUV A;  1WCM G;  2JK8 A;  4IPD A;  2HIX A;  4IFD I;  2CWP A;  1UE7 A;  1I3Q H;  3L7Z C;  4PG3 A;  5AJ3 Q;  3H15 A;  3T1Y L;  1JJG A;  1PYS B;  4FDB A;  3VDY A;  4B3S Q;  1N36 L;  3K81 C;  3PIP A;  3A5Z B;  5C4J H;  1SLJ A;  3TRZ A;  4YWM A;  1KHI A;  1XMQ Q;  2NN6 G; 
#chains in the Genus database with same CATH topology
 1KTK A;  2F1M A;  1NTG A;  2N49 A;  5ELF A;  5M5Y B;  3AB9 A;  2PI2 A;  3J7A F;  1Y1V B;  5COR A;  4BXX G;  5FOB B;  2IJ0 A;  2RDG A;  2ZTD A;  5E1F A;  3TP7 A;  2NTT A;  2EYO A;  4AQY Q;  4JI6 Q;  5C4J B;  3D6W A;  2Z6K A;  5I9P A;  2B2Y C;  2C5C A;  5C44 H;  4FXG C;  2QW7 A;  1F2L A;  3VR3 A;  2K32 A;  5M3M G;  1Q7Y C;  1YJN A;  1TII D;  2F0F A;  1SFO B;  3RLO A;  4A3D G;  4DR4 Q;  2PZU A;  4JBM A;  1T5E A;  1SMX A;  3D31 A;  3GDE A;  2EZV A;  1RKN A;  4WJ4 A;  1RTO A;  1V9P A;  4KHP Q;  5M5X H;  4JW0 A;  1LTS D;  3FP9 A;  1ET9 A;  2F0H A;  3GV6 A;  2ZTE A;  1RHP A;  3NPP A;  4DK6 C;  3F8T A;  1A0I A;  1IBK L;  1GUN A;  4HMI A;  5CV9 A;  3S24 A;  1TS2 A;  2P5Z X;  4QL5 A;  1H9M A;  5JJK A;  4JI1 L;  2ZM6 L;  2YU9 H;  3AEV A;  1AP0 A;  4YWL A;  1KDC A;  4P71 A;  2B8F A;  2DY7 A;  5CV6 A;  4C3I H;  1DCZ A;  2JA8 B;  4A3C G;  3K7A B;  2EDG A;  2AHO B;  2SOB A;  4CKC A;  5A2Q E;  1W3S A;  2DJG C;  1RF2 D;  3KBG A;  4ODG A;  3CF5 A;  3K57 A;  5EGT A;  4LF9 L;  2MPM A;  4QY7 A;  2L0C A;  3S1R H;  4R9W A;  3HOX B;  3I91 A;  3AQQ A;  4ZCK A;  2K33 A;  4R4T A;  2EYL A;  3QG1 A;  2WAC A;  3EN2 A;  4K2L A;  3U50 C;  1Z6H A;  4LFA L;  4ZLT F;  4ZAI A;  1XWE A;  3UDF A;  4GN4 B;  5G3L F;  5IY0 A;  1YIJ A;  1HNX Q;  5I6Y A;  4YWK A;  1HA6 A;  3O13 A;  4UHV A;  1IW7 C;  1J5E L;  1MI2 A;  3G7L A;  3UE1 A;  3K5L A;  2K5D A;  4DNI A;  1F2Z A;  4NMZ A;  1IYV A;  1PLF A;  2IPK D;  3NTH A;  5I9O A;  4LFB L;  3AFQ A;  2NN6 I;  1NY4 A;  3G6J B;  3S2H B;  3J7Z C;  1EYG A;  1LTL A;  2B3G A;  1SE4 A;  4TKO B;  1PRT B;  3HRZ C;  1PH8 A;  1PH4 A;  2XN9 C;  4R4C A;  2JSO A;  1STE A;  3D3R A;  4YY3 L;  1RIP A;  4RA8 A;  2CW0 D;  2PO4 A;  3RZD H;  3RMH A;  4FF4 A;  4JBW A;  1K83 B;  1TWH H;  2PQE A;  4IUV A;  2A6H C;  2BA0 A;  3G6E A;  1IW7 D;  1Q1B A;  3FHW A;  4RHR A;  1G6P A;  4C3J H;  3HKS A;  4JG2 A;  2JA8 G;  3RN2 A;  1W6J A;  1HR0 Q;  2BH2 A;  3LWU A;  3W1B A;  1E2W A;  1IHZ A;  1PVO A;  1QVC A;  3LWE A;  2OXP A;  4DR3 L;  1BQQ T;  3OIP A;  5C0X H;  2HDL A;  3EBE A;  1MKH A;  3OHX C;  3HOX G;  3G71 A;  2K52 A;  2ZT9 C;  3P75 A;  4X3S A;  3J7Y W;  5JVH 3;  4JI3 L;  2K5Q A;  1IYJ B;  4JI1 Q;  5CGK A;  1QJO A;  3H94 A;  3K7U C;  3NP8 A;  3A8I E;  2A6H D;  1EY5 A;  4DK3 C;  1F2M A;  4DR1 L;  2Z6B A;  2KHS A;  3NQT A;  4DAM A;  1PFM A;  1BDO A;  3GO5 A;  2WAQ E;  3S2D H;  5KYL A;  1BOS A;  1A3U A;  5DM7 3;  4LUO A;  3K6O A;  4X62 L;  1QCB D;  2HCI A;  4MNO A;  2EYJ A;  5LMU Q;  3I2Z A;  3OWE B;  4FXK C;  5CBE E;  3RLF A;  1XNQ Q;  2OT2 A;  2J7Z A;  2K4K A;  3I90 A;  4GOP A;  2H4O A;  4X65 Q;  1HFN A;  4ILW A;  1M90 C;  4DV1 Q;  1GKH A;  3QB3 A;  1SYC A;  1CA6 A;  4YCW A;  4V19 0;  3KDF A;  1JJ2 A;  4LFB Q;  3KF6 A;  2Z8L A;  1Y1W H;  2EIF A;  1TVX A;  1WTH A;  3VYT A;  1B8A A;  1STN A;  1E7Z A;  2K50 A;  2YU9 B;  3SVM A;  3CCL A;  4ME3 A;  2LXK A;  3KFU A;  1J9O A;  2F0J A;  1BKB A;  1N9W A;  1VQM A;  2OWO A;  1FGB D;  4JI0 L;  4A3K B;  2VB2 X;  4J1M A;  3WOE A;  1NR4 A;  4C1N K;  1BCP B;  3RLN A;  4A3I H;  2R7D A;  1X6O A;  1ZYR C;  5ELD A;  3H0G H;  1LAB A;  3OYY A;  1V8Q A;  3S1R B;  2YTX A;  2KJX A;  5IGE A;  1K8A C;  4RWS C;  4ZKC B;  4GOP B;  2LS0 1;  1XTD A;  2PW5 A;  1PMR A;  1T5X D;  3MZ5 A;  1EWC A;  2XWJ B;  4P72 A;  3KJP A;  4KTA A;  1EIH A;  1J6Q A;  3E0E A;  3DMU A;  5ELC A;  2A5H A;  1VQH A;  4LF8 Q;  1EOV A;  4HID A;  5M3F H;  1Y8N B;  3NBI A;  2F0S A;  3TSS A;  1EIY B;  4MN3 A;  3TME A;  3WOF A;  4KJO A;  2QEX A;  1H9J A;  4I7Z C;  2F0N A;  1ZYR D;  5EKL A;  3DWQ A;  3RUZ A;  4GLV B;  4N9P A;  5C0X J;  4A3M B;  3CW2 C;  4DNT B;  2CCZ A;  1OXS C;  2UUC L;  1B44 D;  1UNS A;  3BZD B;  2NZO A;  1LAC A;  4J15 A;  4HED A;  1UUP A;  4JCV E;  1L1O B;  5C6A A;  1BBW A;  2Y0S B;  2NB0 A;  1Y8P B;  1TWH B;  1L2F A;  1Z47 A;  5ELN A;  1UWV A;  1D6E C;  3ND9 A;  1ENF A;  4C3J B;  4BBR H;  3NWT A;  5GAG C;  5EJW A;  4CKB A;  1EWI A;  1FNV A;  2BE5 C;  3U4V A;  4A3K G;  1DGS A;  4DR6 L;  1EQQ A;  1IL8 A;  5JEA H;  2VW9 A;  1VDZ A;  2CH4 A;  5M9O A;  2Z1C A;  2A69 C;  3J81 E;  1RTN A;  2VQE L;  4DR2 L;  2UUA Q;  1K8G A;  4A75 A;  1HZC A;  3KYH C;  1JE5 A;  1FJG L;  5JJI A;  3TEH B;  2D0O A;  1V43 A;  3VYR A;  3K8A A;  1VF5 C;  1STA A;  1B4O A;  4X66 Q;  4ZRZ A;  3UI2 A;  1S72 A;  2Y0S E;  4DKA C;  5JAV A;  3C2P A;  3HP3 A;  2F3W A;  4KN7 C;  3BVM A;  1RD9 D;  4BA2 I;  3Q22 A;  2A74 C;  1HUN A;  5JOB A;  3GTK H;  2I46 A;  5HGQ A;  2BE5 D;  3S14 B;  4DK1 A;  4JOI A;  4RHS A;  3I4M H;  3FDT A;  4B9X A;  1SE8 A;  3L0O A;  1O78 A;  5IT9 E;  4PZ8 A;  1AZP A;  2WII B;  4A3M G;  2XSC A;  4L5Q A;  2EQS A;  1C8C A;  1K0R A;  2NBF A;  5IP9 G;  1B53 A;  2Z0S A;  1SYF A;  2VQF L;  5IGF A;  1WVL A;  4B3T L;  5C3E H;  1PHJ A;  4P74 A;  3A5U A;  2RDH A;  1VQF A;  3PGZ A;  4UAI A;  3DLL A;  3DHQ A;  2I0Q A;  1KQS A;  2WV6 D;  1S5D D;  1XJV A;  2Y0S G;  4DV3 Q;  4POF A;  2K05 A;  4R4I A;  4EVO A;  1ASY A;  1X3Q A;  4L6T B;  3CC7 A;  4C3J G;  4JYA L;  2QKI C;  3FEW X;  1YIT A;  1CFM A;  2Q8T A;  4DGZ A;  5GAD C;  5ELO A;  1I94 Q;  4HMJ A;  2B2W A;  1Y1W B;  3B6Y A;  4OEL B;  4JK1 C;  4BXX H;  4DV6 Q;  1EY9 A;  1KAA A;  4CGY B;  1GHK A;  4PZ6 A;  1EFW A;  1JR0 D;  2KHI A;  3J80 i;  5KGU A;  1WTQ A;  1NSN S;  2RVL A;  5T1I A;  2QEJ C;  5FKA C;  3S1M H;  1HQM C;  3P1H A;  2RDF A;  1RDP D;  3V05 A;  4YCV A;  1HTL D;  2HUG A;  1KLU D;  2FXQ A;  1E2Z A;  3T1H Q;  3PSI A;  5CV7 A;  1SYD A;  4R4Q A;  1AE3 A;  1KAB A;  3H0G B;  1DOM A;  2L4N A;  4DV5 Q;  1K0S A;  2JA6 G;  4KN4 C;  4G7H C;  1PRT C;  1X56 A;  2ASB A;  4IUT A;  2AMC B;  5JJL A;  3MXN A;  2DNE A;  2CWA A;  3F1Z A;  1V1Q A;  1SRO A;  2VQE Q;  4JPB W;  4DR2 Q;  3BVZ A;  2B2T C;  2OTL A;  3LX0 A;  1PFN A;  5FLX L;  4F87 A;  1GHJ A;  3N6R A;  3MVV A;  5KND A;  1TWC H;  1D2B A;  1Y8O B;  2F4I A;  5JEA J;  2JXM B;  1S3O A;  2CFM A;  1TU2 B;  2XNA C;  4NDX A;  1GUS A;  1MSG A;  3ND8 A;  1K9M C;  1Y1W G;  4A3E G;  3T53 B;  1PRT D;  1UE7 A;  2NVY B;  3H15 A;  3VDY A;  5JJZ A;  2LY7 A;  1N36 L;  3S16 B;  3MFG A;  5C4J H;  1SLJ A;  1SMY C;  1WTV A;  4YWM A;  2NN6 G;  4ULL A;  3CC4 A;  4JI2 Q;  4U68 A;  5KYI A;  1EU3 A;  1SFO H;  4HJA A;  1I3Q B;  4JVZ A;  5GAH C;  4K0K L;  3J80 L;  1B9N A;  1QZG A;  5K36 G;  3OOC A;  1GUO A;  1JB7 A;  3NTI A;  1IYU A;  4LNQ A;  5FJ8 H;  4DV7 L;  3OW7 A;  5CC4 A;  3PO2 H;  2F0M A;  4APV A;  3TZD A;  4QGU A;  3ULL A;  4K6L A;  3KBX A;  2QF7 A;  1LT6 D;  2A73 B;  2DGY A;  1SMY D;  2Z4H A;  4RAU C;  2AUK A;  3HOV B;  2Z4I A;  3GTK B;  1IZ6 A;  4R8N A;  2G9D A;  3K7A H;  1K8O A;  4YHH Q;  1ICF B;  1ZEQ X;  4MTK A;  1CTM A;  2TSS A;  4OX9 Q;  3H91 A;  4LFC L;  3E3X A;  4G7O C;  5C3E B;  3JAM E;  3TDQ A;  1LV9 A;  4LF6 L;  2IX0 A;  1TR5 A;  4LUZ A;  4R4O A;  1YJ9 A;  5IYB G;  2NUC A;  3PIP 3;  4G57 A;  1BCP C;  3HFZ B;  2F0D A;  3CCM A;  4LF5 L;  5L37 A;  2XIW A;  2OTJ A;  4EX5 A;  5F2D A;  1PH7 A;  3BDO A;  1AZQ A;  3S2H H;  5JPN C;  3S17 B;  4C3H H;  2ZXO A;  1SDF A;  1X3P A;  5IIF A;  3E5S A;  4B3R L;  1QVG A;  2WFW A;  3CKI B;  3IFT A;  3W5O A;  3GTG H;  2O2L D;  2H1E A;  2IW3 A;  1H9S A;  5CV4 A;  4RGT A;  1KDA A;  1HFG A;  4UPA A;  1WFQ A;  1N36 Q;  1FNW A;  1YNJ D;  1HNW Q;  2O5J C;  1PH3 A;  4UDU C;  3HOV G;  2EJF C;  3S1N B;  1WYD A;  2B8G A;  1Q90 A;  2M9V A;  5FLX c;  1N34 L;  2D62 A;  5ELE A;  3RZO B;  3SE0 A;  2A19 A;  1BF4 A;  1L1O C;  3K80 C;  1VCI A;  5C3E G;  2IY5 B;  4A3G B;  4C56 C;  1STG A;  1II3 A;  2E2H H;  1TWC B;  2WKD A;  4FYD A;  2XRS D;  4A4I A;  1O7Y A;  2UUB L;  1F77 A;  2EJM A;  2ZJR A;  5LMN W;  2R92 H;  2ICI A;  4FNF A;  1V1P A;  4NPS A;  4KHV A;  1I4G A;  2K75 A;  1Y69 U;  5EKI A;  3T56 B;  4HIO A;  1ONL A;  4L5R C;  1EY6 A;  4ZQ3 A;  1PTO F;  1GUT A;  5FO8 B;  3DM3 A;  3D4D A;  4WRD A;  1N8R C;  5I2X A;  4XQJ A;  3J80 c;  1S5B D;  3AMU A;  4LFC Q;  4JI4 L;  1SYB A;  3MXU A;  1VQ7 A;  4KV6 A;  4JI8 L;  4Y52 H;  4IUP A;  2IX3 A;  2MGS A;  2EY5 A;  3CAM A;  3BDC A;  1B1Z A;  3S1Q B;  4IOA A;  1EWH A;  3OTO L;  2ZJP A;  2B2V A;  2J4X A;  1TWG H;  2UXB Q;  2VUM B;  4LF5 Q;  2A8V A;  3PO2 B;  5BN5 A;  3M7G A;  2R93 B;  1M4V A;  3TS0 A;  1VQ9 A;  5EQ0 A;  1I5F A;  4GNX A;  3X3M A;  3CRK C;  3KLW A;  1AH9 A;  4OWX B;  3C46 A;  4HCE A;  2LKV A;  1VQ5 A;  3R3O A;  4A3G G;  4EQP A;  3MC0 B;  1VQO A;  3GQB A;  1XMQ L;  1LTI D;  3L9A X;  4A3K H;  4Z9C B;  4NXM Q;  3E9H A;  2KEC A;  1GOZ A;  4DUY L;  1ILQ A;  4TVA B;  1CA5 A;  3A56 A;  3EA6 A;  1WTR A;  4MIU A;  1TKW B;  3DWA A;  3TP5 A;  1C0A A;  3KLR A;  2Q2U A;  3S9W A;  4DA2 A;  1PDQ A;  2EPB A;  4ZUJ A;  3TRE A;  4LF7 L;  1YJW A;  1U4P A;  5DEH A;  3HOY H;  3CHB D;  3K59 A;  3SGI A;  4DAV A;  2PI2 E;  2ENB A;  1LT3 D;  2KQ3 A;  2PNR C;  1LTB D;  5IGC A;  1HA5 A;  1KNE A;  1F9P A;  4DN4 M;  2UUB Q;  4X6A H;  3GV3 A;  1A15 A;  1UAP A;  4C3H B;  1STY A;  1C48 A;  1E1O A;  5FJ8 G;  4A3M H;  2VUM G;  2TMP A;  3SK4 A;  3CC2 A;  2L55 A;  3PO2 G;  2R93 G;  5EBC A;  5IP9 H;  1D5X C;  3GTG B;  4KD4 A;  4XQN A;  1S40 A;  4TRD A;  1SNQ A;  3K5N A;  1VQ8 A;  3BJU A;  3ERO A;  4I7A A;  1G51 A;  2K5H A;  4OWW B;  2ES2 A;  1ENC A;  5IGB A;  5EAY A;  3J7A V;  1S5C D;  1EIG A;  1PTO B;  3FKI B;  1IKL A;  2VNU D;  2KEE A;  5GAE C;  1SNM A;  4JI5 L;  1F9R A;  1QUQ A;  3R8B A;  4NXN L;  3URY A;  4RKL A;  1WTW A;  3OTO Q;  2WAQ B;  4KMU C;  4L5T A;  2B29 A;  4DPG A;  3I7F A;  1Z9F A;  3CCE A;  5KEE A;  1QWY A;  3PMF A;  1X55 A;  3BS1 A;  3VYS A;  1YBY A;  4C2M B;  1IBK Q;  4RFB A;  1CM9 A;  1YEZ A;  4HJ9 A;  2XGT A;  4DAY A;  2E2H B;  2XVS A;  2ZM6 Q;  4PMB A;  2O4X A;  2Q2H A;  2K04 A;  1TS5 A;  3IL8 A;  3M9B A;  3M85 A;  3UDX A;  1TWF B;  2YTY A;  2ZXR A;  4DXG A;  2R92 B;  5I2Y A;  4RGO S;  1SYG A;  2K5W A;  4E6I A;  2B63 H;  1EY8 A;  1TWA B;  5K5P A;  2JA6 H;  1E22 A;  2D5D A;  1HTP A;  2A68 C;  3S14 H;  5DNF A;  3ER0 A;  4WFN 3;  2ALY B;  2YTV A;  3D8G A;  2F0E A;  4C3H G;  1TS3 A;  4LF9 Q;  1TT2 A;  1X32 A;  4DNR B;  5EPJ A;  2C9O A;  4B3M L;  3Q6S A;  1PFB A;  3I4L A;  1M8A A;  4LFA Q;  1O7Z A;  5IGD A;  4F88 A;  4HJ5 A;  1JOR A;  1XPO A;  3IRB A;  1SND A;  3KOJ A;  1J5E Q;  3FKI G;  3GTL B;  4PZ7 A;  1TWG B;  2K5V A;  1OTC A;  2F0V A;  2HD3 A;  1XPU A;  3VR2 A;  2BDO A;  2QDB A;  2EJG C;  3FRP B;  1SJE D;  4A3E H;  2A68 D;  3NXW A;  2WAQ G;  4OL7 A;  5KIX A;  4OIK A;  2X6L A;  1IXR A;  3Q24 A;  1W6K A;  2AQ1 B;  2EYP A;  1H95 A;  2NN6 H;  4IAL A;  5C4X B;  4YY3 Q;  3HOU B;  4OWT B;  3U58 A;  1EL0 A;  1QG7 A;  4PQX A;  4K5V A;  2JEA I;  1EY4 A;  2CVR A;  1M1K C;  1N33 L;  2NZH A;  3BG3 A;  5E4X A;  4A3J H;  2R92 G;  1C4Q A;  5K36 H;  3RD4 A;  1D8L A;  3CP0 A;  5IWA L;  3FMC A;  4XYQ A;  1NMF A;  3EJI A;  4L8J A;  1VQD A;  3BZK A;  2UXD L;  3NBH A;  3I70 A;  2JYO A;  1I4X A;  1B3A A;  3V96 A;  1LYL A;  4DR3 Q;  1ASZ A;  2B2U C;  2OQ0 A;  1SSO A;  2XTI A;  4GZY C;  2D9U A;  1DM0 B;  1NNX A;  1UEB A;  2MNA A;  4QUF A;  3KDF B;  1BVS A;  4JBJ A;  3HOY B;  1SNP A;  3KF6 B;  3CRL C;  4JI3 Q;  4RGN A;  4GKJ L;  2VY3 A;  3OMG A;  3GTJ H;  3UDI A;  1HHV A;  4GN5 A;  1H9K A;  1VQA A;  4DR1 Q;  2PMZ E;  2HCC A;  4IO9 A;  1VQG A;  3GD7 A;  2RKS A;  2NVY H;  2BOS A;  2PNH A;  2F0G A;  2F4V L;  4QUC A;  3MHB A;  4JV5 L;  1PYB A;  1O7L A;  4X62 Q;  3S16 H;  5IYB H;  2UU9 L;  1X54 A;  5LL6 S;  4GKK L;  2B2Y A;  4XDX A;  3SDZ A;  1B2T A;  3VR5 A;  5C4X G;  3HOU G;  3PUV A;  3I4N B;  2HIX A;  5EPK A;  1XTC D;  3C3L A;  3GP7 A;  4F8M A;  4PG3 A;  1I3Q H;  3T1Y L;  1AFP A;  3K81 C;  2EY6 A;  1I4P A;  1JIC A;  2QDL A;  3M4O B;  3TRZ A;  5COY A;  4CDD C;  2JA7 B;  4ID6 A;  3GTO H;  2NZ1 D;  4M8A A;  3CCR A;  3DEP A;  3DWP A;  1P8L A;  1HR0 W;  1WJJ A;  5I4D A;  4K14 A;  1Q46 A;  2R7F A;  4EGV A;  1YZ6 A;  2J0T D;  3HKZ B;  4KJN A;  1MBY A;  5A2Q L;  1I6H H;  3HOY G;  2BA1 A;  4IQZ A;  1KIX A;  3HOV H;  2KA7 A;  4JI0 Q;  2B63 B;  2JA6 B;  1EYD A;  1S5E D;  2K1B A;  1FYC A;  3I3C A;  3G48 A;  3HOW G;  1RL2 A;  3QOL A;  4DV0 L;  2K6A A;  2CQA A;  1Q81 C;  2F0O A;  3CU7 A;  5IWA Q;  2LSS A;  3W1G A;  2A69 D;  1XPR A;  1K3R A;  2KED A;  1KRT A;  1N32 L;  1L0W A;  1G29 1;  1VQI A;  4H02 A;  5NUC A;  2CQO A;  1TQO A;  2OF1 A;  4DR7 L;  3PF4 A;  1JMC A;  1NR2 A;  4GS3 A;  1BBU A;  4OO1 I;  4XT3 B;  2R6G A;  3MWY W;  3HKZ E;  4ALP A;  2AKW B;  4BBS G;  1DJR D;  5CV5 A;  1TS4 A;  2PZT A;  3QIA A;  3H3V I;  2Z6K C;  1K3B C;  1H9R A;  1PH9 A;  1IBM L;  5IYD H;  5J22 A;  3I4N G;  1Q8K A;  4UP8 A;  1FGU A;  4A3E B;  1X3G A;  3K0X A;  4WOR A;  2F52 A;  4DAP A;  4X64 L;  3S17 H;  1JC7 A;  3HS0 C;  3I72 A;  5LL6 X;  2UUC Q;  2KCN A;  1E24 A;  1PH1 A;  2JA7 G;  1MD2 D;  2VL6 A;  1GXD C;  2KBN A;  3BYY B;  4XTC S;  3QJY A;  5CV8 A;  4DR5 L;  3HKZ G;  1CUK A;  1HPC A;  2UU9 Q;  4AYB B;  4A3J B;  1RCV D;  1VQJ A;  1X3F A;  3W3A A;  3PIO 3;  1C9O A;  2B63 G;  3IFD A;  4FF3 A;  1HZA A;  1IBL L;  3S1N H;  4DR6 Q;  1EIF A;  1LTG D;  5IOD A;  2SEB D;  1QNU A;  1HQR D;  2EY2 A;  2F0W A;  2GN5 A;  2SNS A;  3RZO H;  2HHH L;  2JN4 A;  3HOZ G;  3NWS A;  4FP5 D;  1B50 A;  3PV0 A;  1V1O A;  4A76 A;  1Q1E A;  2ZXP A;  1FVI A;  3KF8 A;  4KKS A;  1FJG Q;  2PZW A;  4A3L G;  1PTO C;  4A3G H;  5DAU A;  2K5N A;  1VS0 A;  3GTJ B;  4K8I A;  1R9T B;  1XMO L;  3VYU A;  4AYB E;  1CKM A;  2LMC B;  2KOL A;  2PW7 A;  4UP7 A;  4DV2 L;  2MJ8 A;  4MHE A;  4V0B A;  2JA5 B;  3OIQ A;  3PUZ A;  4CJ0 B;  1CK1 A;  3E9I A;  3H6M A;  2QCP X;  3DUZ A;  2EOT A;  2VQF Q;  4B3T Q;  5LHY 1;  2BDN A;  4LAA A;  1EQT A;  4DR7 Q;  1A2U A;  1LLR D;  4HIK A;  3TQY A;  2Q8I B;  3MXN B;  1VMC A;  5BR8 L;  4HJ8 A;  1PZI D;  3S1Q H;  2R3Z A;  4AYB G;  1CKN A;  4A3J G;  3MEF A;  4KY5 A;  5IP7 G;  1LM0 A;  2HQL A;  5T1G A;  4JYA Q;  1I4Q A;  2DNC A;  4O0A A;  2MFI A;  1G91 A;  3KF8 B;  2VUM H;  1E0B A;  1EUJ A;  3GTO B;  2R93 H;  1X65 A;  5KNB A;  1U4R A;  3J81 i;  3PCO B;  1BBX C;  4X64 Q;  4OO1 H;  1UE5 A;  1A6X A;  2K03 A;  1ESR A;  1Q3L A;  1VQ4 A;  3HZX A;  5DM6 3;  1I6H B;  4CJ1 B;  2UXC L;  1YNX A;  3QR8 A;  2PPB C;  1NE3 A;  2F0L A;  1K73 C;  3PF5 A;  3FVQ A;  4U67 3;  2GVA A;  4HN7 A;  3STB C;  3CPF A;  4KD3 A;  4PMC A;  3EIV A;  1LO5 D;  1O80 A;  2WKC A;  1U9R A;  1GM5 A;  4B3S L;  4IFD G;  1LT5 D;  2JA5 G;  3RR5 A;  3T51 B;  5FO7 B;  3D0F A;  2E5L L;  4BWG B;  2B2U A;  4K5X A;  3T13 A;  2FMC A;  1TXY A;  2PYK A;  3K5O A;  4LWC A;  1BUV T;  2O5I C;  3QWN A;  1MSH A;  2MHV A;  1NAP A;  4LMQ D;  2L1B A;  4AQY L;  4JI6 L;  4IUQ A;  1D1K A;  3A0J A;  1YNN C;  1B3Q A;  2YV5 A;  2FJ2 A;  3STB D;  4GOP C;  1YHQ A;  5DLQ E;  1OXU A;  1SXT A;  3DEO A;  3F2C A;  2RSO A;  1EZ6 A;  5E3F A;  1PZK D;  4DV2 Q;  1AN8 A;  4KK7 A;  4BA1 I;  1FNU A;  1KD1 C;  2DN8 A;  2VB3 X;  4O2D A;  3GTM B;  1PH5 A;  2KVM A;  1GVP A;  1EU4 A;  2KCC A;  3M4P A;  1PTO H;  3FKI H;  1BCP D;  1AW7 A;  2G5D A;  1KL9 A;  4POG A;  4DXF A;  2SDF A;  2NVT B;  3J81 L;  1VQK A;  2E76 C;  4G4K A;  1A2T A;  4K0K Q;  3P20 A;  1YNN D;  4JBK A;  1HH2 P;  1L0Y B;  4ZK9 B;  5E7N A;  3KLS A;  4IJL A;  1MHW C;  5C5M A;  4DV7 Q;  1CQF A;  1C7Y A;  3NEN A;  4J8Q A;  4FVM A;  1ZXT A;  1STB A;  1SRU A;  4C2M H;  4QCL A;  3NEM A;  3E0J A;  3BYT B;  3FPU B;  4RG1 A;  1JB3 A;  3D4W A;  4XXE A;  2UXC Q;  1STH A;  1TWF H;  5IT9 L;  3ZJY C;  3I4O A;  1CT1 D;  1EY7 A;  4DFA A;  5IYD G;  1H9S B;  1TWA H;  5JVG 3;  1MGS A;  3EVQ A;  3F2U A;  3IAY A;  5EKK A;  1U0L A;  4HTH A;  4A93 B;  4C1N I;  1MIU A;  3PO3 B;  3LGJ A;  4PNY A;  3MEH A;  1PRT F;  3RN5 A;  4IPH A;  4DF7 A;  2E75 C;  2KCT A;  2ATW A;  4YIJ A;  1B7Y B;  1SE2 A;  2VS1 A;  4HSP A;  4LF6 Q;  3I8Z A;  5J1Z A;  4M1U B;  4F7X A;  1DXM A;  2PQA A;  2E5L Q;  2AQ2 B;  1NUC A;  5GRO A;  1O7I A;  2QIL A;  2Z9H A;  3A8J E;  2I5M X;  3GTL H;  1EFI D;  1Y14 B;  1X9N A;  1TY2 A;  1SBB B;  2XWB B;  5H1S E;  5IOC A;  5C0X I;  4H7B A;  3TP6 A;  1VQE A;  1SE3 A;  4X3K A;  4XQQ A;  4B3R Q;  1PZJ D;  2QA4 A;  3V2T A;  1V1P B;  1HR0 L;  4A3B H;  2OEO A;  4GLX A;  5KRU A;  4HJ7 A;  2B39 A;  5C4X H;  4QB4 A;  3HOU H;  1G6Z A;  2BH8 A;  3PUY A;  4QQB X;  5FK9 C;  3OPO A;  4BY7 B;  1QOH A;  2G9H D;  1LTT D;  3ULJ A;  1JWS D;  3I56 A;  1XX8 A;  2L5T A;  3VA5 A;  1ROD A;  3IKJ A;  1N34 Q;  2M00 A;  2DJF C;  2PQA B;  1A62 A;  1Q86 C;  4BY1 H;  5CR3 A;  2WP8 J;  4A93 G;  4IJH A;  1CKO A;  2F0T A;  3T16 A;  3PO3 G;  3K0Y A;  1WCM B;  3JAM i;  4JOI C;  2FMM A;  1E3P A;  2B2T A;  4GNX B;  1KDB A;  2AWN A;  4P2C B;  3VR6 A;  3U9O A;  4L63 B;  1W2B A;  2A6E C;  5LMU L;  1Y1V G;  4KHZ A;  3I55 A;  3HOW H;  2KUM A;  1XNQ L;  2KCM A;  2SNM A;  5HUR A;  1JJC B;  1DD2 A;  2CW0 C;  3GTP H;  3OSO A;  4X65 L;  1JWU D;  2E8G A;  4NW2 A;  5CBA E;  3NE5 B;  5TSS A;  1HNZ L;  1A63 A;  4DV1 L;  3J81 c;  1AEX A;  4CDE C;  5KNC A;  3CXC A;  4RH6 A;  2PCF B;  4OO1 G;  3AFP A;  2FFK B;  3SHL A;  1Q8I A;  3JC6 6;  1BO0 A;  3TS2 A;  2NTS A;  2B2W C;  3MAQ A;  1EQR A;  2MP1 A;  2NYZ D;  4RMF A;  1XNR L;  4JI4 Q;  2E2I B;  2NVQ H;  2L11 A;  3F2B A;  3LNN A;  2BCO A;  4JI8 Q;  4BBS H;  4DV4 L;  1EOT A;  4R8I A;  3I4N H;  3J7A 5;  1BCP F;  4KY6 A;  4BY7 G;  2A6E D;  1JOQ A;  4ZUI A;  1Z7T A;  4IUU A;  5IT9 c;  5EBD A;  5C3W A;  3M4O H;  1PA6 A;  2DUD A;  5HGT A;  2JA7 H;  3SK6 A;  4Y7N B;  1S5F D;  4B9W A;  1WCM G;  3MFY A;  4IFD I;  5M5W B;  2JP1 A;  5E4W C;  1JJG A;  4FDB A;  2RBM A;  3M3Y B;  3A5Z B;  1BXT A;  5C4Z A;  3MTS A;  1KHI A;  1XMQ Q;  2RA4 A;  3TZU A;  1HCZ A;  2RCN A;  4RKB A;  4IOC A;  3JAM L;  1EZ8 A;  2F0Q A;  1HJP A;  3BZC A;  4LF8 L;  3CD6 A;  1XXG A;  5FO9 B;  2MUY A;  4DUY Q;  2RF4 A;  4LF4 L;  3HOZ H;  1AE2 A;  1I6V C;  1QUQ B;  1NMG A;  2V4D A;  4OGQ C;  1IKM A;  4AH6 A;  1FD7 D;  4EQ5 A;  3CCS A;  5FLX E;  1KC8 C;  4A3L H;  1B9M A;  2RCF A;  1KAW A;  1ICW A;  4QMG A;  2KHJ A;  5CMD A;  4LF7 Q;  2MO1 A;  4UP9 A;  1GD7 A;  1U5K A;  5JPM C;  1CSP A;  4FF1 A;  1G2S A;  4OIJ A;  3CCQ A;  4DAY B;  2RHQ B;  3K5M A;  3CCJ A;  2WIN B;  5C44 B;  4LJZ C;  1QIL A;  5A35 A;  1ESF A;  1PH2 A;  3QO2 A;  1HUM A;  5FLM G;  4OHJ A;  4A3B B;  1HNZ Q;  3P7J A;  3PQI A;  2QGQ A;  1UE1 A;  2N78 A;  5M5X B;  3QOJ A;  4O1N A;  1U4M A;  2NWG A;  2FHT A;  3S15 H;  3ERS X;  1HXY D;  1F9Q A;  1WD0 A;  1XNR Q;  2Q2I A;  4QJF A;  4A3F H;  2N88 A;  2EVB A;  3J80 E;  4QF4 A;  2NVX H;  4IUN A;  2UUA L;  3U9S A;  3BVG A;  1CZG A;  1PYW D;  1HRJ A;  2CHB D;  2PMZ B;  4WJW A;  1I4R A;  4OON A;  5IP7 H;  4DV4 Q;  1VQC A;  4JI5 Q;  1U4L A;  4R1J A;  3ONA B;  4NXN Q;  4HAE A;  4X66 L;  3A7A B;  4BY1 B;  4GLA C;  1QB5 D;  3A55 A;  5IYC H;  3KJO A;  2F0K A;  1JOK A;  1G8Z D;  2F0P A;  4LW1 A;  4C3I B;  2ZJQ A;  1PH6 A;  1PFS A;  2RQX A;  4I65 A;  4ME5 A;  3CME A;  1L1O A;  2L15 A;  3NUC A;  4NKL A;  2AWO A;  2E2J H;  2F3I A;  3TBI B;  1HZB A;  1WD1 A;  1GO3 E;  4HR7 B;  3HOW B;  3C1E A;  2RHS B;  3KUP A;  4ABN A;  2E74 C;  3HEJ A;  5D3D A;  2N3S A;  1R9T H;  1XYI A;  3GTP B;  4GN3 B;  1EEI D;  4RCO A;  3HG9 A;  4DV3 L;  4IFD H;  3A74 A;  5C44 G;  2EYH A;  2IHF A;  3D4R A;  3X3N A;  2JA5 H;  1FR3 A;  2HQE A;  1KLG D;  5D3I B;  1Q12 A;  5IGG A;  4LF4 Q;  4DU9 A;  2R7Z H;  4BS9 A;  1I94 L;  3L2P A;  2NVQ B;  4B3M Q;  4A3B G;  2F0U A;  4XYO A;  2KEN A;  4BBS B;  4DV6 L;  3NBH B;  4IZ8 A;  3I73 A;  4P75 A;  2GA4 B;  4KLK A;  1ENA A;  2ICE C;  3WWV A;  1HZ9 A;  1GUG A;  3ITP A;  4KKT A;  5IE8 A;  2L12 A;  1ML0 D;  1JE4 A;  3RZD B;  3T1H L;  3PUX A;  4BY1 G;  3F2D A;  1D7Q A;  1CSQ A;  3OMC A;  5J39 A;  4JC0 A;  4C3I G;  3SR1 A;  3JAM c;  4WJ3 M;  4DV5 L;  2CH4 W;  3K58 A;  1WI5 A;  3G4S A;  1NJI C;  3MXP A;  4JI7 L;  3R93 A;  3NK9 A;  5AFW A;  4NB3 A;  4K6D A;  1SNC A;  3HGB A;  4FXD A;  5LMN L;  3C1F A;  3CPW A;  2ZTC A;  1N33 Q;  3KK7 A;  1QNK A;  2LXJ A;  2EXD A;  2L9H A;  3HOZ B;  2YYZ A;  2DY8 A;  2UXD Q;  3H3V C;  4FF2 A;  4KI0 A;  3M7N A;  4O42 A;  2E2D C;  3NEL A;  2OCE A;  2MQH A;  3M4Q A;  4QIW B;  2R61 A;  5C3X A;  5C5L A;  2VZA A;  1DZ1 A;  5J3B A;  1A8V A;  4EQN A;  1A3V A;  1I50 H;  5BN4 A;  4AIM A;  2IWH A;  1KXL A;  3SK8 A;  2IL8 A;  1Q82 C;  3S2D B;  1CZW A;  4PMW A;  2F3V A;  4GKJ Q;  3R2T A;  2JJQ A;  3MA2 B;  4RGM A;  3GTQ H;  2ID0 A;  2XRQ D;  4X3U A;  4N8F A;  4IUR A;  2V1C C;  4MTN A;  2LFN A;  4JI2 L;  1ZKO A;  2I5H A;  3TP8 A;  3AYH B;  2D0P A;  1B70 B;  2K28 A;  2N8N A;  2B2V C;  3UE0 A;  4HCS A;  4PV1 C;  3NHH A;  1T9H A;  2F4V Q;  3S15 B;  4JV5 Q;  1OXV A;  3U4Z A;  2F0I A;  3GTM H;  2M2L A;  1L0X B;  4A3F B;  4QIW E;  4DUZ L;  4GNX C;  2EE1 A;  2NVX B;  4XIG S;  4GKK Q;  3AU7 A;  1A3T A;  2EXZ A;  1QZH A;  4CJ2 C;  5I6W A;  5C0X G;  1R4P B;  3ERQ A;  4CHT B;  1DYQ A;  1DOK A;  2NVT H;  1EYC A;  1MJE A;  4IFD J;  1RJT A;  4H0L C;  5HY6 A;  3T1Y Q;  1S4Z A;  1VQ6 A;  3VR4 A;  3Q8D A;  5M3M H;  3T4A C;  3E6Z X;  4A3I B;  4A3D H;  4K2K A;  4YHH L;  2K7V A;  4OEM B;  1IL2 A;  1DON A;  2E2J B;  2X6G A;  4S3S A;  4FO2 A;  1QVF A;  3L3O C;  3SEB A;  4OX9 L;  1NCV A;  2JA9 A;  3CMA A;  1WTX A;  1E1T A;  1PV4 A;  3DXJ C;  4JI7 Q;  3W2D A;  1VQP A;  1D5M C;  4YCU A;  5LMN Q;  4DK0 A;  2HIV A;  3CQZ H;  4DV0 Q;  4B08 A;  3Q23 A;  5M3F B;  4A93 H;  1YHB A;  1LTA D;  1LTR D;  3MXG A;  3PO3 H;  2K01 A;  2WB1 B;  2R7Z B;  3RNU A;  4A3C H;  1OO9 B;  1MJC A;  5ELB A;  1N32 Q;  1KNA A;  2F03 A;  2VXW A;  2IX1 A;  2EY1 A;  1ILP A;  1SEB D;  1R4Q B;  3CCU A;  1PTO D;  2FIN B;  4K8J A;  2AUJ D;  4LK1 C;  4A3F G;  5M5Y H;  1Y1V H;  1PXU A;  3R2I A;  4Q0F A;  3EQL C;  1IBM Q;  1EYA A;  4CDC C;  2JQO A;  3Q0A A;  1WOC A;  1DOL A;  3ULP A;  1JWM D;  2IT1 A;  1KRS A;  5IYC G;  1GUW A;  1HNW L;  1UE6 A;  2X69 A;  3OWF A;  3A8K E;  4BBR B;  1E2V A;  2I5L X;  2D2C C;  2H5X A;  1K28 A;  3H3V H;  2WB1 E;  1WTO A;  1CQV A;  1D5Z C;  4A3I G;  2N55 A;  2I07 B;  3EFX D;  2MO0 A;  4EQO A;  1F2Y A;  1P16 A;  3H0G G;  3CCV A;  3PIO A;  3H09 A;  4KY7 A;  2HT1 A;  3OW2 A;  1VQB A;  3KLS X;  4MZ9 A;  4DUZ Q;  4DR5 Q;  1GJX A;  4BY7 H;  2CKZ B;  4UY8 C;  1JCK B;  1BR9 A;  4L5S A;  5AJ3 L;  1OXT A;  1IBL Q;  1VMP A;  4G7Z C;  1VQN A;  1JT8 A;  1YI2 A;  1K8M A;  3ZYY X;  1SN8 A;  2Q2T A;  1F9S A;  1JOO A;  4IPC A;  5M3F G;  2HHH Q;  4LUV A;  2R7Z G;  1VF7 A;  1CKN B;  2WB1 G;  1WCM H;  3WDN A;  2JA8 H;  1I50 B;  3I4M B;  2Q8R E;  3NQI A;  2HDM A;  2OQK A;  1CI3 M;  3A7L A;  1EEF D;  3GTQ B;  3DM1 A;  1OXX K;  3HOX H;  5D14 A;  1CHQ D;  1EY0 A;  5CYU A;  4NP5 A;  2JE6 I;  5G3L D;  2RSN A;  1XMO Q;  5ISR A;  1I4H A;  4IPG A;  4N9T A;  5BN3 A;  3FPP A;  1EQV A;  1J8I A;  3BU2 A;  4KKU A;  1YNJ C;  4N8X 1;  3UDG A;  1TY0 A;  4H13 C;  4DR4 L;  1YHA A;  5GQO A;  4BBR G;  2C35 B;  4KHP L;  4CKE A;  2UXB L;  3N52 A;  1FL0 A;  2EYF A;  2K14 A;  2E2I H;  5JEA G;  1UEA B;  4K5W A;  4HIM A;  3VA7 A;  4CBV A;  3S1M B;  4OXP A;  5BR8 Q;  1D1I A;  1SR3 A;  2A1A A;  3M4Y A;  4CDF C;  3SK5 A;  3NTK A;  5M3M B;  1G2T A;  5D65 A;  3ICE A;  5C4H A;  5FLM H;  1ET6 A;  1X3E A;  1SJH D;  4Q5V A;  4A3D B;  3BDL A;  1K83 H;  2JEB I;  1LT4 D;  4NXM L;  3D6C A;  4TSS A;  3SXH A;  4X3T A;  4Y7N H;  4XT1 B;  1SNO A;  2AQ3 B;  1CHP D;  2GVB A;  4TQU S;  2EYM A;  1NBW A;  5M5W H;  3I4M G;  1QE6 A;  3TN2 A;  1LUZ A;  4P73 A;  1SYE A;  1WTP A;  3M3Y H;  3PUW A;  2IHE A;  1YVC A;  1HNX L;  3J81 j;  3CQZ B;  4J6H A;  4ZYS A;  1VQL A;  4HSV A;  1BNZ A;  2JK8 A;  4IPD A;  4RCN A;  2CWP A;  4H44 C;  3L7Z C;  5AJ3 Q;  1SAP A;  1PYS B;  4B3S Q;  3NSW A;  3A54 A;  4IN3 A;  3PIP A;  1JQY D;  4ZKB B;  5EPL A; 
#chains in the Genus database with same CATH homology
 1NTG A;  3GTO H;  3CCR A;  3CC4 A;  2N49 A;  2RCN A;  1P8L A;  4IOC A;  4JI2 Q;  1WJJ A;  1HR0 W;  2PI2 A;  1HJP A;  1SFO H;  1Q46 A;  2R7F A;  3BZC A;  4HJA A;  4LF8 L;  3CD6 A;  4BXX G;  5GAH C;  1YZ6 A;  4DUY Q;  4K0K L;  2RF4 A;  4LF4 L;  1QZG A;  5K36 G;  3HOZ H;  2ZTD A;  1JB7 A;  1I6H H;  3HOY G;  4AQY Q;  1AE2 A;  4JI6 Q;  1QUQ B;  1NMG A;  2BA1 A;  2Z6K A;  1KIX A;  5FJ8 H;  4LNQ A;  3HOV H;  4AH6 A;  4DV7 L;  4JI0 Q;  4EQ5 A;  3CCS A;  5C44 H;  1KC8 C;  3PO2 H;  4A3L H;  4APV A;  1KAW A;  4QGU A;  5M3M G;  3G48 A;  3HOW G;  3ULL A;  1Q7Y C;  1RL2 A;  1YJN A;  4DV0 L;  2KHJ A;  4LF7 Q;  2MO1 A;  4UP9 A;  3RLO A;  1Q81 C;  1GD7 A;  1U5K A;  4A3D G;  1CSP A;  5IWA Q;  4DR4 Q;  4JBM A;  2LSS A;  2DGY A;  3W1G A;  1XPR A;  1SMX A;  3D31 A;  1K3R A;  3GDE A;  4WJ4 A;  1V9P A;  3CCQ A;  4KHP Q;  4DAY B;  5M5X H;  1KRT A;  1N32 L;  2RHQ B;  1L0W A;  3CCJ A;  1G29 1;  1VQI A;  4H02 A;  3FP9 A;  2CQO A;  2ZTE A;  4DR7 L;  1IZ6 A;  4DK6 C;  3PF4 A;  3F8T A;  3K7A H;  1A0I A;  1IBK L;  1PH2 A;  1JMC A;  4GS3 A;  3S24 A;  4YHH Q;  1BBU A;  5FLM G;  4OO1 I;  4QL5 A;  5JJK A;  2R6G A;  4JI1 L;  2ZM6 L;  3HKZ E;  4ALP A;  2AKW B;  1HNZ Q;  2YU9 H;  4BBS G;  3AEV A;  2QGQ A;  4YWL A;  1UE1 A;  4OX9 Q;  3H3V I;  2N78 A;  2Z6K C;  4LFC L;  1PH9 A;  1IBM L;  4P71 A;  5IYD H;  3I4N G;  1Q8K A;  4UP8 A;  3S15 H;  1FGU A;  3ERS X;  4C3I H;  1XNR Q;  1X3G A;  3K0X A;  2Q2I A;  4QJF A;  4A3F H;  4LF6 L;  4A3C G;  2F52 A;  4X64 L;  2IX0 A;  4LUZ A;  2NVX H;  2UUA L;  4R4O A;  2AHO B;  1YJ9 A;  5IYB G;  3S17 H;  1W3S A;  5IP7 H;  4OON A;  4DV4 Q;  2UUC Q;  4BBS H;  1VQC A;  4JI5 Q;  3CF5 A;  1E24 A;  4R1J A;  1PH1 A;  4LF9 L;  2JA7 G;  4QY7 A;  2VL6 A;  3HFZ B;  4NXN Q;  3S1R H;  4X66 L;  3CCM A;  2KBN A;  4GLA C;  5IYC H;  4LF5 L;  3AQQ A;  4XTC S;  3KJO A;  4R4T A;  2OTJ A;  4LW1 A;  4EX5 A;  1PH7 A;  3EN2 A;  4DR5 L;  2ZJQ A;  3HKZ G;  1CUK A;  3U50 C;  1PH6 A;  3S2H H;  2UU9 Q;  4LFA L;  1PFS A;  1YIJ A;  1VQJ A;  3UDF A;  4GN4 B;  1X3F A;  4C3H H;  5IY0 A;  3CME A;  1L1O A;  2L15 A;  4YWK A;  1HNX Q;  4B3R L;  1C9O A;  2B63 G;  1QVG A;  1HZA A;  2WFW A;  3W5O A;  2AWO A;  1J5E L;  1IBL L;  2E2J H;  3GTG H;  2F3I A;  3S1N H;  3UE1 A;  4DNI A;  4DR6 Q;  1EIF A;  1HZB A;  1GO3 E;  2GN5 A;  4UPA A;  4LFB L;  1WFQ A;  1N36 Q;  3AFQ A;  2NN6 I;  2RHS B;  3RZO H;  1NY4 A;  2HHH L;  3HOZ G;  2N3S A;  1R9T H;  1HNW Q;  3PV0 A;  1PH3 A;  4GN3 B;  3J7Z C;  1EYG A;  1LTL A;  2B3G A;  3HOV G;  4A76 A;  1Q1E A;  4DV3 L;  1FVI A;  3A74 A;  5C44 G;  1FJG Q;  4A3L G;  1PH8 A;  1WYD A;  2IHF A;  1PH4 A;  5FLX c;  2JA5 H;  4A3G H;  4R4C A;  1N34 L;  2D62 A;  2K5N A;  1Q12 A;  4YY3 L;  4LF4 Q;  2R7Z H;  1RIP A;  1VS0 A;  1I94 L;  3L2P A;  4B3M Q;  4A3B G;  2A19 A;  3RZD H;  2KEN A;  4JBW A;  1XMO L;  4AYB E;  1TWH H;  1L1O C;  3K80 C;  3NBH B;  4DV6 L;  2BA0 A;  1CKM A;  3G6E A;  1Q1B A;  1VCI A;  3FHW A;  4P75 A;  5C3E G;  2IY5 B;  1G6P A;  4UP7 A;  4C3J H;  4DV2 L;  3HKS A;  4JG2 A;  4KLK A;  2JA8 G;  3RN2 A;  3WWV A;  1HR0 Q;  2E2H H;  2BH2 A;  3PUZ A;  3W1B A;  1PVO A;  1HZ9 A;  1QVC A;  5IE8 A;  3E9I A;  4DR3 L;  4A4I A;  2UUB L;  2VQF Q;  5LMN W;  2ZJR A;  3EBE A;  3T1H L;  4B3T Q;  2R92 H;  1MKH A;  3HOX G;  3PUX A;  4BY1 G;  3G71 A;  4NPS A;  2K52 A;  3F2D A;  1D7Q A;  1CSQ A;  2K75 A;  4DR7 Q;  4JC0 A;  4HIK A;  4HIO A;  3TQY A;  4L5R C;  3JAM c;  4WJ3 M;  4DV5 L;  3MXN B;  5BR8 L;  4HJ8 A;  3DM3 A;  4JI3 L;  3S1Q H;  1IYJ B;  1WI5 A;  4JI1 Q;  4AYB G;  1CKN A;  3G4S A;  3J80 c;  4A3J G;  1N8R C;  3MEF A;  5IP7 G;  1LM0 A;  2HQL A;  4JYA Q;  1NJI C;  3K7U C;  4LFC Q;  4O0A A;  2MFI A;  3KF8 B;  4JI4 L;  2VUM H;  4JI7 L;  1EUJ A;  4NB3 A;  1VQ7 A;  2R93 H;  4DK3 C;  1X65 A;  4DR1 L;  4JI8 L;  5LMN L;  3J81 i;  3PCO B;  4X64 Q;  1UE5 A;  4Y52 H;  3CPW A;  2ZTC A;  1N33 Q;  3CAM A;  4DAM A;  2LXJ A;  1VQ4 A;  4IOA A;  2EXD A;  3GO5 A;  3OTO L;  2YYZ A;  2WAQ E;  3S2D H;  2ZJP A;  2UXC L;  2UXD Q;  1YNX A;  4LUO A;  1TWG H;  4X62 L;  2UXB Q;  4MNO A;  4KI0 A;  4LF5 Q;  2A8V A;  5LMU Q;  3M7N A;  3I2Z A;  1NE3 A;  1K73 C;  3NEL A;  2OCE A;  3RLF A;  2MQH A;  3M4Q A;  3TS0 A;  3PF5 A;  1VQ9 A;  1XNQ Q;  1I5F A;  2GVA A;  4GNX A;  2VZA A;  2K4K A;  5J3B A;  1A8V A;  4GOP A;  1I50 H;  3STB C;  3CPF A;  4X65 Q;  4AIM A;  3KLW A;  1AH9 A;  1M90 C;  3EIV A;  1KXL A;  4DV1 Q;  4OWX B;  1Q82 C;  1GKH A;  4PMW A;  1GM5 A;  4B3S L;  1VQ5 A;  4IFD G;  4GKJ Q;  4YCW A;  2JJQ A;  3KDF A;  2JA5 G;  2ID0 A;  3GTQ H;  4A3G G;  1VQO A;  1JJ2 A;  4LFB Q;  3KF6 A;  3RR5 A;  1XMQ L;  1Y1W H;  2EIF A;  3D0F A;  4A3K H;  2E5L L;  2V1C C;  4MTN A;  4NXM Q;  1B8A A;  4JI2 L;  2I5H A;  3E9H A;  3AYH B;  2D0P A;  1E7Z A;  1B70 B;  2K50 A;  2N8N A;  1TXY A;  4LWC A;  4DUY L;  3UE0 A;  3CCL A;  4ME3 A;  2LXK A;  4TVA B;  3KFU A;  1T9H A;  2F4V Q;  1BKB A;  1N9W A;  4AQY L;  1VQM A;  4JI6 L;  4JV5 Q;  2OWO A;  1OXV A;  3U4Z A;  3A0J A;  3GTM H;  4JI0 L;  4QIW E;  4DUZ L;  4GNX C;  2YV5 A;  4XIG S;  3STB D;  4GOP C;  1YHQ A;  5DLQ E;  4GKK Q;  1OXU A;  3RLN A;  1QZH A;  2Q2U A;  1C0A A;  4A3I H;  2R7D A;  1X6O A;  3F2C A;  5C0X G;  3TRE A;  4LF7 L;  3H0G H;  1YJW A;  4DV2 Q;  3HOY H;  2NVT H;  3OYY A;  1MJE A;  4IFD J;  4BA1 I;  2YTX A;  3SGI A;  1K8A C;  5HY6 A;  1KD1 C;  3T1Y Q;  2PI2 E;  4GOP B;  4O2D A;  1VQ6 A;  3Q8D A;  5M3M H;  1XTD A;  1PH5 A;  1GVP A;  2UUB Q;  4X6A H;  4P72 A;  3M4P A;  1E1O A;  3FKI H;  5FJ8 G;  3KJP A;  4YHH L;  4A3M H;  2VUM G;  4A3D H;  3CC2 A;  3PO2 G;  1J6Q A;  1KL9 A;  3E0E A;  4POG A;  5IP9 H;  1IL2 A;  2R93 G;  1QVF A;  1VQH A;  1S40 A;  1VQK A;  4LF8 Q;  1EOV A;  4HID A;  5M3F H;  4OX9 L;  4K0K Q;  1EIY B;  1VQ8 A;  3BJU A;  1G51 A;  2K5H A;  4OWW B;  4JBK A;  1HH2 P;  2JA9 A;  2ES2 A;  5E7N A;  2QEX A;  4IJL A;  3CMA A;  4DV7 Q;  1E1T A;  1PV4 A;  5EAY A;  1C7Y A;  1VQP A;  4JI7 Q;  3NEN A;  4GLV B;  5C0X J;  3CW2 C;  4YCU A;  5LMN Q;  1SRU A;  2CCZ A;  1OXS C;  2HIV A;  4C2M H;  2UUC L;  2VNU D;  5GAE C;  4JI5 L;  3CQZ H;  4DV0 Q;  1QUQ A;  2NZO A;  4J15 A;  4NXN L;  1YHB A;  3NEM A;  4A93 H;  3PO3 H;  3OTO Q;  3RNU A;  4JCV E;  1L1O B;  4L5T A;  4RG1 A;  4A3C H;  2B29 A;  4DPG A;  2UXC Q;  1TWF H;  1BBW A;  1MJC A;  3I7F A;  3ZJY C;  1Z9F A;  1N32 Q;  1L2F A;  1Z47 A;  3I4O A;  5ELN A;  3CCE A;  2IX1 A;  1X55 A;  1UWV A;  5IYD G;  1TWA H;  1YBY A;  3CCU A;  1IBK Q;  4BBR H;  1YEZ A;  5GAG C;  4A3F G;  4HJ9 A;  2XGT A;  1EWI A;  5M5Y H;  3U4V A;  1U0L A;  4A3K G;  1Y1V H;  1DGS A;  2ZM6 Q;  4DR6 L;  1MIU A;  1EQQ A;  2Q2H A;  3M85 A;  3M9B A;  3LGJ A;  2VW9 A;  3UDX A;  1IBM Q;  3RN5 A;  2JQO A;  2YTY A;  4IPH A;  1WOC A;  3ULP A;  2KCT A;  2IT1 A;  2ATW A;  1KRS A;  1B7Y B;  5IYC G;  2B63 H;  2VS1 A;  1UE6 A;  1HNW L;  4LF6 Q;  2VQE L;  2JA6 H;  4DR2 L;  2UUA Q;  1K8G A;  4A75 A;  2I5L X;  2PQA A;  1E22 A;  1HZC A;  2E5L Q;  3KYH C;  1JE5 A;  1FJG L;  3S14 H;  5JJI A;  3TEH B;  2D0O A;  2H5X A;  3ER0 A;  5GRO A;  2ALY B;  2YTV A;  1V43 A;  3H3V H;  1O7I A;  2WB1 E;  3K8A A;  4A3I G;  4LF9 Q;  2MO0 A;  2I5M X;  3GTL H;  1P16 A;  4X66 Q;  3H0G G;  1S72 A;  2Y0S E;  4DKA C;  1Y14 B;  3CCV A;  3PIO A;  4B3M L;  2HT1 A;  3OW2 A;  1X9N A;  1VQB A;  4BA2 I;  4MZ9 A;  5H1S E;  4DUZ Q;  4DR5 Q;  3GTK H;  5HGQ A;  5C0X I;  4LFA Q;  1VQE A;  4BY7 H;  4HJ5 A;  4JOI A;  3I4M H;  2CKZ B;  1SE8 A;  3L0O A;  4UY8 C;  1XPO A;  3IRB A;  4PZ8 A;  2QA4 A;  4L5S A;  4B3R Q;  5AJ3 L;  1OXT A;  3KOJ A;  4A3M G;  3FKI G;  1J5E Q;  1HR0 L;  1IBL Q;  4A3B H;  4L5Q A;  2EQS A;  4PZ7 A;  1K0R A;  1VQN A;  1JT8 A;  4GLX A;  4HJ7 A;  2K5V A;  5IP9 G;  1OTC A;  1YI2 A;  2Q2T A;  1SN8 A;  5C4X H;  2Z0S A;  3HOU H;  2BH8 A;  2VQF L;  3PUY A;  4IPC A;  5M3F G;  4B3T L;  1XPU A;  4QQB X;  5C3E H;  2HHH Q;  4LUV A;  1PHJ A;  4P74 A;  1CKN B;  2WB1 G;  3A5U A;  1WCM H;  4A3E H;  2WAQ G;  2R7Z G;  1VQF A;  3PGZ A;  3DLL A;  2I0Q A;  2JA8 H;  1KQS A;  3ULJ A;  1XJV A;  2Y0S G;  4DV3 Q;  4POF A;  1ASY A;  1IXR A;  4R4I A;  3I56 A;  2OQK A;  1H95 A;  1N34 Q;  3CC7 A;  4JYA L;  2PQA B;  1OXX K;  3HOX H;  1A62 A;  4YY3 Q;  1YIT A;  1Q86 C;  4BY1 H;  1I94 Q;  4OWT B;  5ELO A;  2WP8 J;  5GAD C;  3U58 A;  4A93 G;  2JE6 I;  1CKO A;  4IJH A;  3PO3 G;  3B6Y A;  2JEA I;  3JAM i;  1XMO Q;  4JOI C;  4BXX H;  1M1K C;  4DV6 Q;  4IPG A;  1N33 L;  4PZ6 A;  1EFW A;  2KHI A;  2NZH A;  3J80 i;  4A3J H;  2R92 G;  3BU2 A;  1D8L A;  3UDG A;  3CP0 A;  5IWA L;  4DR4 L;  3S1M H;  1E3P A;  1NMF A;  1YHA A;  5GQO A;  4GNX B;  1VQD A;  3BZK A;  4BBR G;  2C35 B;  2AWN A;  2UXD L;  4YCV A;  4KHP L;  1W2B A;  2UXB L;  1FL0 A;  5LMU L;  1Y1V G;  4KHZ A;  3I55 A;  2FXQ A;  3HOW H;  1LYL A;  4DR3 Q;  2KCM A;  1XNQ L;  2K14 A;  3T1H Q;  1ASZ A;  2E2I H;  3PSI A;  2OQ0 A;  1JJC B;  2XTI A;  5JEA G;  4R4Q A;  1AE3 A;  1UEB A;  3GTP H;  2MNA A;  3KDF B;  1BVS A;  4X65 L;  4HIM A;  4JBJ A;  2E8G A;  1HNZ L;  1A63 A;  4DV1 L;  3KF6 B;  4OXP A;  3J81 c;  5BR8 Q;  4DV5 Q;  3CXC A;  4JI3 Q;  1SR3 A;  2JA6 G;  4OO1 G;  2A1A A;  3AFP A;  3JC6 6;  4GKJ L;  2VY3 A;  3TS2 A;  1X56 A;  1EQR A;  4RMF A;  2ASB A;  1XNR L;  3GTJ H;  4JI4 Q;  2AMC B;  3ICE A;  5JJL A;  5FLM H;  2NVQ H;  2CWA A;  3F1Z A;  1X3E A;  3UDI A;  4GN5 A;  1V1Q A;  1VQA A;  3F2B A;  1K83 H;  2JEB I;  4JI8 Q;  4DR1 Q;  1SRO A;  2VQE Q;  4NXM L;  2PMZ E;  4DV4 L;  4DR2 Q;  4IO9 A;  4Y7N H;  1VQG A;  2OTL A;  2GVB A;  4TQU S;  3I4N H;  3J7A 5;  1NBW A;  3GD7 A;  4BY7 G;  5M5W H;  2NVY H;  2PNH A;  3I4M G;  2F4V L;  4JV5 L;  1PYB A;  1TWC H;  4X62 Q;  1LUZ A;  5IT9 c;  4P73 A;  3S16 H;  5JEA J;  5IYB H;  3M3Y H;  3PUW A;  3M4O H;  2IHE A;  2UU9 L;  1X54 A;  1PA6 A;  1YVC A;  2DUD A;  4GKK L;  1HNX L;  1S3O A;  2CFM A;  2JA7 H;  3HOU G;  5C4X G;  3J81 j;  1K9M C;  1VQL A;  1Y1W G;  4A3E G;  3PUV A;  1WCM G;  2JK8 A;  4IPD A;  2HIX A;  4IFD I;  2CWP A;  1UE7 A;  1I3Q H;  3L7Z C;  4PG3 A;  5AJ3 Q;  3H15 A;  3T1Y L;  1JJG A;  1PYS B;  4FDB A;  3VDY A;  4B3S Q;  1N36 L;  3K81 C;  3PIP A;  3A5Z B;  5C4J H;  1SLJ A;  3TRZ A;  4YWM A;  1KHI A;  1XMQ Q;  2NN6 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...