3GTKH

Backtracked rna polymerase ii complex with 18mer rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
146
structure length
136
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 15
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtkH00
5IP7H 4DAMA 1VQJA 5J3BA 5IWAQ 3U4VA 2UXDQ 3I55A 3F2CA 1IBLQ 1K8AC 4DR5Q 2UXCQ 4GOPC 2R92G 3IRBA 4OO1I 4DV2L 1X65A 4LF9Q 1P16A 2E2HH 4HJ7A 1Q12A 2R6GA 2Y0SE 4BY1H 2E8GA 2WB1G 2F4VQ 3UE1A 4A3IG 2K50A 2UXBL 2R7ZH 1OXTA 4XTCS 2R7ZG 1EWIA 2I5HA 2V1CC 4GLAC 5C0XG 2CWAA 2VQFQ 1QZHA 4JI4L 1GVPA 4DV1Q 1NJIC 4QQBX 4KHPL 1A63A 5C4JH 2YYZA 1GD7A 4IJHA 4HJAA 3TS0A 1Z9FA 4JI2Q 3G4SA 3RN5A 2YU9H 4LF7L 1CUKA 2DGYA 4NXML 4GS3A 1YIJA 4DR5L 1NE3A 1EUJA 2UU9L 2PQAB 4JI1L 4A3EH 1G51A 4A3EG 4KLKA 1QUQA 1H95A 5FJ8G 1BBUA 1WOCA 4LUZA 3JAMc 3UDIA 2I0QA 2OTLA 1VQNA 2F4VL 4KHZA 4DV5Q 1IYJB 2JA8H 2R93H 2R93G 2JA8G 4BBRG 4BY7H 1I50H 4DV1L 2JE6I 5M5WH 1R9TH 2JA5G 2BA1A 3PCOB 4TVAB 4HIMA 4DR3Q 4P73A 2Q2UA 3U4ZA 1HH2P 4A93H 5K36G 1NBWA 4JBJA 1KRSA 2CCZA 2UUAQ 4JI7L 2VY3A 3T1YL 3CCSA 5FLMH 4DR2Q 1YJNA 1XPRA 2Y0SG 1AH9A 5FLMG 2N3SA 5AJ3Q 4A3MH 1HNWQ 4JI6Q 3AFPA 1E22A 4X65Q 1N36L 4B3TL 3CPFA 1E1TA 3CC7A 1YI2A 1VQ6A 4HIKA 5GROA 1GKHA 4IPGA 4P72A 4A76A 3M4OH 4DR1Q 3CAMA 1C0AA 2I5MX 4Y7NH 3K80C 3STBD 1E3PA 2PMZE 2VNUD 3PO2G 1KC8C 2KENA 4A3KH 2YTVA 4DR6Q 2HIXA 5IYDH 2Z0SA 3UE0A 4DV7Q 4C3HH 1NTGA 1JB7A 2HQLA 1VQDA 4R4IA 5GAGC 1QVGA 3CCVA 1K3RA 4UP7A 3BU2A 3K81C 1YITA 5M5YH 3F2DA 3A74A 3GO5A 3M9BA 2JA9A 2VQEL 4NXNL 1VQ9A 5C44G 4LF8L 2K4KA 3CMEA 3OYYA 3T1HQ 2NN6G 3HFZB 2B63G 4X66L 1XMOL 4LF5L 3ULJA 5IYCH 3J81c 3I2ZA 2IT1A 4PG3A 5IYCG 5LMUL 3GTLH 4YHHQ 2ES2A 1AE3A 3AQQA 2A1AA 4OX9L 2H5XA 3A5ZB 4BA2I 4X64Q 4UPAA 3TQYA 1Q1EA 4O2DA 4RG1A 2K5NA 1L1OB 3S1RH 5LMNL 5JJIA 3MXNB 1PFSA 1JE5A 4DKAC 5JJLA 1UE1A 3HKZE 3J80i 3H3VH 2JA6G 2OQ0A 3EN2A 1VQOA 4DNIA 2ZM6Q 3W1BA 4JV5Q 2PQAA 5IYBH 1IBML 2EQSA 3DM3A 4A3BH 1L0WA 2E5LQ 1VQGA 4A3BG 4B3RL 1WCMG 3S17H 1SN8A 2K14A 1TWGH 4R4OA 4X62L 2AMCB 2N49A 3U50C 1VQAA 1N8RC 3K8AA 4HJ8A 4HJ9A 1YVCA 2D0PA 3AEVA 1BBWA 1LTLA 1RIPA 2F3IA 1PH7A 4AIMA 3SGIA 1OTCA 4L5RC 1K9MC 4JI5Q 4QL5A 1VQ7A 1EQQA 3KF8B 1YHQA 1X55A 1N9WA 4JI3L 5C3EH 4JV5L 1X3EA 5E7NA 4DV2Q 3KYHC 5C3EG 2C35B 1HR0W 2ZTDA 1XNQL 2KBNA 4UP9A 3ERSX 2JEBI 1FJGQ 1S40A 5JJKA 5M3MH 1E1OA 1KL9A 5M3MG 1V43A 4IOAA 3S15H 1J5EQ 3HKZG 3ZJYC 1VQIA 1A62A 2UXBQ 1BKBA 4JI4Q 3D31A 4JC0A 4HIDA 2HHHL 4IPHA 4C3IH 1C9OA 1LM0A 1I94L 4KHPQ 3RR5A 4PZ6A 3D0FA 3M85A 4JOIA 1XJVA 2AWOA 4JI5L 2QGQA 4GOPB 4LF7Q 4NXMQ 2RF4A 2R92H 4UY8C 5M5XH 2UU9Q 2E2JH 5GQOA 4R4QA 4JI1Q 3S2HH 4WJ3M 3S1QH 4LWCA 1PA6A 4HIOA 1D7QA 3F8TA 1XPOA 2NVTH 1FJGL 4A3IH 1VQEA 4A3DH 1PHJA 4LF6L 2IX0A 4A3DG 4DUYQ 3KF6A 1Q82C 1PH8A 1CKOA 1J5EL 4DUZL 2OTJA 4DV3L 1VQ5A 4QIWE 4GLXA 2NVQH 3HOUH 1HZAA 1Y1VG 4DPGA 2EIFA 3HOUG 3CQZH 1PH6A 5GAHC 2OCEA 4LW1A 4JI7Q 3T1YQ 3I7FA 1XPUA 4WJ4A 4B3SL 1YNXA 5JEAJ 1MIUA 5FJ8H 2D62A 4DV4L 2WFWA 2ID0A 4GNXA 1N36Q 4B3TQ 1SFOH 4LFAL 1CKNB 2I5LX 3L0OA 3H0GG 4DUYL 1PH9A 4DR7L 5IY0A 4BBRH 1E24A 4DV0L 4LNQA 5H1SE 2JA5H 1WJJA 3KJPA 4PMWA 1KQSA 4QGUA 4DK6C 1N32L 1DGSA 1NY4A 2HIVA 3JC66 4LUOA 1V1QA 4A3JH 2R7DA 1IL2A 1TWHH 2RCNA 3PV0A 4A3JG 2UUBL 2VUMG 3KDFB 2OWOA 1G291 1MJEA 1UWVA 3I4OA 3PO3H 2DUDA 1B7YB 3PO3G 5HGQA 1SMXA 3S1NH 3M3YH 3HOYH 3RZDH 2ZJQA 3HOYG 1WFQA 1T9HA 1VQLA 2KCTA 2LXJA 2VW9A 1QZGA 2AKWB 4GN4B 1AE2A 2VQEQ 4LF8Q 4NXNQ 2KCMA 2A8VA 3HOWH 3PF4A 3HOWG 1S3OA 2PNHA 3PO2H 3G48A 3PUWA 4X66Q 3CPWA 1Y1WG 1XMOQ 4LF5Q 2ASBA 1SE8A 3HKSA 1HZBA 5LMUQ 1VQ4A 4J15A 5IE8A 2K52A 1OXSC 1IBKL 4OX9Q 2NZOA 1UE7A 1MJCA 3BJUA 4OWWB 3ICEA 4UP8A 3OTOL 4JYAL 5LMNQ 1EIYB 1KD1C 5M3FG 2F52A 1VQPA 3NELA 1A8VA 3FKIG 5C44H 5GADC 3PF5A 1HNZL 3RZOH 4GLVB 3ULPA 1B70B 1M1KC 2B63H 2EXDA 3LGJA 4GOPA 1KRTA 3EBEA 4JOIC 1QVCA 1VS0A 3CCLA 1IBMQ 1PH3A 1U5KA 4LF4Q 4BBSG 3CMAA 2K5VA 1W3SA 1VQKA 1PH5A 4B3RQ 4IFDJ 4JCVE 2ALYB 4X62Q 5HY6A 4OWTB 1Q1BA 2MNAA 4DV6L 3HOVH 1SR3A 4GKKL 4YWLA 3CC4A 2CWPA 3HOVG 2MO1A 2JA6H 2B29A 2A19A 1PVOA 3FP9A 2CQOA 3GTOH 4DR4L 3NBHB 5IT9c 1N34Q 1PYSB 4JG2A 4MTNA 1OXVA 4GKJL 4OONA 4LFBQ 4JI3Q 1I5FA 3AYHB 3TREA 2BH2A 1XNQQ 3GD7A 4LF4L 1YHAA 1WCMH 4K0KQ 1JMCA 1XNRL 2E2IH 1LUZA 3EIVA 3STBC 5LMNW 1GM5A 3WWVA 4GNXC 3I56A 4YY3L 2HHHQ 1Q86C 3ER0A 5EAYA 1I94Q 1I3QH 4YWMA 1P8LA 5C0XJ 2MO0A 4MNOA 3J7ZC 1NMGA 1WYDA 2QA4A 4B3ML 3HOZG 2WAQE 1N34L 1UE5A 3HOXG 4ME3A 1VQMA 4POGA 2N8NA 3J80c 2JJQA 4AQYL 3F2BA 4LFBL 1PYBA 3RLOA 2LSSA 5ELOA 4K0KL 1SLJA 3H15A 1EYGA 3E9IA 1ASYA 2JEAI 3FHWA 4LF6Q 2GN5A 1YHBA 4P75A 2QEXA 2JA7H 1S72A 4DUZQ 4GN3B 4YCUA 4DV3Q 2JA7G 4A3CH 4A3CG 3ULLA 3CXCA 2ZTEA 2YTXA 1K83H 5BR8Q 3KJOA 2GVBA 3I4MG 4R1JA 1VQ8A 1I6HH 4B3SQ 2NVYH 3M4PA 4IPCA 3G6EA 3B6YA 3CP0A 1CKMA 1HJPA 1RL2A 4DV4Q 1UE6A 2LXKA 4LFAQ 2UUCL 4RMFA 1NMFA 4JBKA 5C4XG 1U0LA 2Q2HA 3I4NH 4DR7Q 3I4NG 3BZCA 4OXPA 3H3VI 3J7A5 4DV0Q 4QJFA 3CCQA 1XMQL 2CKZB 1Y1VH 3NENA 4NPSA 1B8AA 2WAQG 1C7YA 5BR8L 2Z6KA 4L5SA 4AH6A 1N32Q 1X56A 5IP7G 1CSPA 1JJGA 1KXLA 2JK8A 1FGUA 3JAMi 3CCRA 2UUBQ 4A4IA 1YBYA 3UDFA 1QVFA 1CSQA 2XTIA 3PUXA 4PZ7A 3RLNA 1SRUA 1XTDA 3UDXA 3H0GH 3GTJH 2NZHA 3UDGA 1HNXL 1L2FA 4BY1G 1G6PA 1L1OA 1VQHA 2MQHA 3S1MH 1KHIA 2HT1A 2AWNA 1PH4A 3PSIA 4IFDI 3A5UA 1OXXK 4A3FH 4QY7A 4A3FG 4APVA 3PGZA 4JBWA 2IY5B 3L7ZC 2XGTA 5IWAL 3CCEA 1Q7YC 3MEFA 4BA1I 1X3GA 4HJ5A 2VUMH 2UXDL 1UEBA 3CCJA 1IBLL 2UXCL 1VQCA 2ZJPA 4IPDA 1IBKQ 2VZAA 4LF9L 1O7IA 1WI5A 3K7AH 3S14H 3OTOQ 3W1GA 4JYAQ 3KOJA 4LFCQ 3CCUA 3K7UC 1Q46A 4X6AH 2VL6A 4IJLA 1HNZQ 2PI2E 2FXQA 2VQFL 4JBMA 4BY7G 3M4QA 1Y1WH 2IX1A 4EQ5A 4A93G 3GTMH 1XNRQ 4JI2L 2JQOA 3TEHB 1EQRA 1TWCH 4YCVA 2RHQB 3GTKH 2KHJA 4DK3C 1PH1A 5C0XI 3PUVA 3TS2A 2RHSB 3BZKA 4A3MG 4AYBE 3DLLA 4JI0Q 1A0IA 1FVIA 1GO3E 4C3JH 3KLWA 3S24A 2MFIA 4LFCL 5M3FH 1YZ6A 4DV6Q 3M7NA 1Y14B 3FKIH 4DV5L 4GKKQ 2GVAA 1TXYA 1FL0A 3CC2A 1X9NA 2NVXH 3J81i 4DR3L 1EIFA 1K73C 3KFUA 5IP9H 5JEAG 3U58A 5IP9G 4R4CA 2UUAL 5DLQE 4P71A 1N33Q 1LYLA 1K0RA 4L5TA 4BBSH 4GKJQ 4DR2L 1JJ2A 4A3KG 5AJ3L 2N78A 1D8LA 1KIXA 4JI6L 1HNWL 4X65L 4FDBA 3CCMA 3CD6A 3GTQH 3A0JA 4JI0L 3Q8DA 5FLXc 5IYDG 4C2MH 1TWAH 4JI8Q 3J81j 3OW2A 3KF6B 4YY3Q 4OWXB 3RN2A 3NEMA 4IO9A 3E9HA 3GDEA 4DR4Q 4DR1L 4B3MQ 4KI0A 1PH2A 2D0OA 2ATWA 3RLFA 2Z6KC 1Q8KA 2VS1A 1N33L 1YJ9A 1X3FA 4AQYQ 4XIGS 4AYBG 1X6OA 4IOCA 1QUQB 1W2BA 4DR6L 2B3GA 4GNXB 1SROA 1X54A 4ALPA 1CKNA 1HR0Q 2KHIA 4DAYB 3GTGH 4DV7L 2L15A 4JI8L 1MKHA 3RNUA 2Q2TA 5ELNA 1BVSA 1Q81C 4A75A 1L1OC 1J6QA 4LUVA 3F1ZA 3HOZH 2BH8A 2R7FA 1VCIA 2BA0A 1IZ6A 3PIPA 1TWFH 3HOXH 3T1HL 2K5HA 2ZTCA 2Q2IA 4P74A 4O0AA 2YV5A 3K0XA 3W5OA 1JT8A 1EFWA 4Y52H 3KDFA 4MZ9A 2IHEA 1K8GA 4YHHL 3S16H 2UUCQ 5IYBG 1HZCA 1HR0L 4H02A 3PIOA 1EOVA 2PI2A 4X64L 1PV4A 2NN6I 4NB3A 2ZJRA 2K75A 1XMQQ 3GTPH 3CW2C 4A3LH 1M90C 4A3LG 4OO1G 2WB1E 4PZ8A 1OXUA 1E7ZA 5GAEC 3CF5A 3I4MH 3PUZA 3AFQA 1VQBA 4L5QA 1VQFA 1YJWA 3G71A 2AHOB 2IHFA 4EX5A 3E0EA 1JJCB 2ZM6L 4A3GH 4BXXH 4IFDG 4TQUS 1Z47A 4A3GG 4YWKA 3S2DH 2YTYA 4POFA 5C4XH 4BXXG 4GN5A 2E5LL 1KAWA 4R4TA 2CFMA 1HNXQ 1IXRA 1V9PA 3VDYA 3L2PA 1YEZA 3PUYA 4YCWA 1HZ9A 1ASZA 3TRZA 2OQKA 2WP8J
chains in the Genus database with same CATH superfamily
5IWAQ 3QOJA 2QDBA 1BCPD 1K8AC 1KLGD 5IGCA 4HJ7A 1HTLD 1NCVA 4BY1H 3RZDB 1IHZA 3A56A 4A3IG 3VR3A 3BVGA 2UXBL 1OXTA 1PFBA 4XTCS 4JI4L 4QQBX 1NJIC 2A69C 5C4JH 4IJHA 3J81E 3D3RA 3TS0A 3G4SA 2YU9H 1CUKA 2DGYA 4J8QA 3VR6A 2O4XA 1EOTA 4JI1L 1YNND 3CU7A 1Y8OB 5HGTA 1H95A 1CTMA 2ENBA 3BYYB 2I0QA 2F4VL 1G91A 2Q8TA 1I4QA 1IYJB 5M5YB 4IUUA 2R93G 3GQBA 1KNEA 3MZ5A 4TVAB 2GA4B 2P5ZX 5K36G 3U4ZA 1HH2P 1NBWA 2VY3A 3T1YL 1LTAD 3NHHA 1YJNA 1WTQA 3L3OC 3RUZA 5FLMG 5AJ3Q 1T5EA 1RODA 1HNWQ 3AFPA 3SK8A 1E22A 5KYIA 1N36L 1A2TA 2Z4IA 5JOBA 2K1BA 1E1TA 1LTGD 4ID6A 1F2MA 1GKHA 4IPGA 4DAVA 2I5MX 5JEAH 1E3PA 2VNUD 4A3KH 2OT2A 3UE0A 1LV9A 4C3HG 1ILPA 1YITA 1GUGA 3A74A 4FF2A 1Y8NB 2A6EC 4LF8L 2L12A 3T1HQ 3HFZB 2KUMA 1XMOL 3J81c 1TY0A 3I2ZA 2IT1A 4PG3A 4YHHQ 1FNUA 2H5XA 3QR8A 3TN2A 5CV9A 3IL8A 1Q1EA 4O2DA 3S15B 1UEAB 2K5NA 2XN9C 1PFSA 1JE5A 4DA2A 3HKZE 1L0YB 4ZK9B 3H3VH 2OQ0A 1G6ZA 2F0JA 3HP3A 2NVYB 3W1BA 2DNCA 1CQFA 2Q8IB 1WTOA 1I4XA 1O78A 1WCMG 4A3DB 1TVXA 4OO1H 2PW7A 3GV3A 4FNFA 4RWSC 2SNMA 1BBWA 2F3IA 5CGKA 3SGIA 4RHRA 3P75A 4QL5A 5CBAE 1X55A 3HRZC 5C3EH 4JV5L 1HCZA 5E7NA 2ZTDA 2Z1CA 1FJGQ 3GTJB 2LKVA 3H0GB 5JJKA 5M3MH 3ND9A 1V43A 3R2TA 1Q90A 4G7HC 2F0GA 1VQIA 1A62A 4JC0A 2A5HA 4C3IH 1LM0A 1SYGA 3RR5A 3M85A 4LF7Q 4NXMQ 3BDLA 1EY9A 5M5XH 1M4VA 3S2HH 5L37A 3F8TA 1VF7A 1XPOA 2NVTH 1VQEA 4RA8A 1Q82C 1PH8A 1J5EL 1SYDA 2K01A 1I4HA 2F0VA 1FD7D 1QE6A 1ESRA 1HZAA 3HOUG 3HOWB 2OCEA 4LW1A 4JI7Q 1XPUA 5JEAJ 1LACA 2F0TA 1IKLA 4DV4L 5J1ZA 3GTKB 1BOSA 2WFWA 1DYQA 2ID0A 4B3TQ 5M3FB 4DR7L 5DNFA 4C1NK 4DUYL 1PH9A 5A2QL 5H1SE 3AMUA 1WJJA 4PMWA 1KQSA 2K7VA 3BDOA 4WFN3 1DGSA 3R8BA 4FP5D 2HIVA 3JC66 1YNJC 2R7DA 1IL2A 4A3JG 2O5JC 1F2ZA 2OWOA 1G291 2G9DA 3I4OA 3PO3G 5HGQA 3HOYH 3RZDH 1LT6D 3RD4A 1I4PA 4F87A 1ET9A 1LT4D 4GN4B 3TP8A 3PF4A 1RF2D 1S5FD 2PNHA 5C5MA 5LMUQ 1EU3A 2K52A 4OWWB 3ICEA 4UP8A 4JYAL 5LMNQ 4FXKC 2OF1A 1WTWA 2RBMA 3DUZA 1BBXC 1IKMA 3PF5A 5HURA 2PW5A 4GLVB 1M1KC 2B63H 1AW7A 1ZYRD 3NK9A 1IBMQ 3VYSA 1I4RA 2NTSA 4BBSG 2ICIA 1CT1D 5I4DA 1W3SA 4B3RQ 4NDXA 2NZ1D 1R4PB 2B2YA 1I4GA 4F88A 4X62Q 1MSHA 5HY6A 2JA7B 2MNAA 4H44C 1EWCA 4GKKL 3HOVG 1SYBA 1EYAA 2B29A 5C4HA 1ENFA 2KVMA 3E0JA 1CHQD 1A3VA 1PYSB 3VR4A 4I7ZC 1I5FA 3T56B 1F2YA 3DWAA 5I9OA 5LMNW 1A3UA 1VF5C 1II3A 2WAQB 3BG3A 1Z7TA 2FMCA 5EAYA 1STNA 3HOZG 2D2CC 2RDHA 1N34L 3NUCA 1UE5A 3C2PA 4XQNA 2N8NA 4Q5VA 4KMUC 3RLOA 4K0KL 1SSOA 2EJGC 3D4DA 3H15A 4LF6Q 3VA7A 4KHVA 4GN3B 4PV1C 4DV3Q 1UNSA 3ULLA 1X3PA 3KJOA 1QCBD 2PZWA 1VQ8A 2NVYH 3K57A 3B6YA 3CP0A 3HEJA 1UE6A 1ICWA 1O80A 2IJ0A 1VMPA 1CHPD 5E1FA 2UUCL 4RMFA 1NMFA 2KQ3A 2F0DA 1TKWB 5C4XG 3I4NH 2C5CA 1RD9D 3H3VI 2J4XA 4DV0Q 2CKZB 1O7ZA 4BY7B 1PZID 2B2UA 5IODA 5IP7G 1CSPA 1TS4A 3NXWA 5F2DA 1SMYC 3JAMi 1EYDA 2UUBQ 1R4QB 2FJ2A 1CSQA 1C4QA 2B8GA 3K58A 3K5OA 3GTJH 3H0GH 5J22A 2MQHA 2CW0C 5J39A 1KHIA 1S5BD 4HSVA 5KYLA 2I46A 2SDFA 3A5UA 4QF4A 1VMCA 4A3FG 5IWAL 2F3VA 4HJ5A 1X3GA 1UEBA 2IX3A 2A6ED 2VZAA 3GTQB 1PRTB 3C1EA 1BCPB 4QMGA 3W1GA 2D9UA 2R61A 2QEJC 3M4QA 3J80E 1TS2A 3T53B 2JQOA 3QOLA 3OWEB 2RHQB 4YCVA 3GTKH 5JPNC 2ZXOA 1DOLA 1E2ZA 4KJOA 3DLLA 3TZUA 4C3JH 5M3FH 3KLWA 4DV6Q 1Y14B 3AB9A 1Q3LA 1LO5D 1AEXA 3M7GA 1FL0A 2KEEA 4RH6A 2WKDA 4R9WA 5FO7B 1PTOC 4K5WA 4R4CA 4P71A 4L5TA 3VYRA 5LL6X 1GUNA 2K32A 4MN3A 5AJ3L 1HNWL 1KIXA 3CCMA 3S17B 3A0JA 4JI0L 2IW3A 5IYDG 1KTKA 1HQRD 4XDXA 3ZYYX 1GUWA 2AQ3B 4B3MQ 3SHLA 3RLFA 4OGQC 2FINB 5DAUA 1YJ9A 4XIGS 4HMIA 4AYBG 5I6YA 4IOCA 1QUQB 1W2BA 4FF4A 4GNXB 1SROA 4ALPA 2L4NA 2KHIA 2L15A 1IW7D 4ZQ3A 5ELNA 1Q81C 2WINB 3F1ZA 2CQAA 4FXDA 2BA0A 1H9SB 3T1HL 2R92B 4P74A 2YV5A 3K0XA 3P1HA 4Y52H 1XYIA 2EY6A 2IHEA 3EFXD 3GV6A 4YHHL 3S16H 1S4ZA 2F0EA 2WB1B 4G7ZC 5IYBG 3DWPA 1JICA 4H02A 5CBEE 1UAPA 3PIOA 2PI2A 5BN4A 2EJFC 1PV4A 2NN6I 3NBIA 5EPKA 1M90C 1HUMA 4A3LG 2NB0A 3CF5A 2QCPX 4L5QA 1VQBA 1FNWA 3OPOA 1YJWA 2AHOB 1D5XC 1H9MA 2E74C 1ESFA 3KLSX 4EGVA 4A3GG 2YTYA 1HQMC 2NWGA 2LFNA 2F0OA 1V9PA 1YNJD 2RSNA 3L2PA 1YEZA 5COYA 1HZ9A 1TR5A 4DFAA 4HSPA 2QW7A 2EJMA 5J3BA 1HFNA 2Y0SB 3F2CA 1IBLQ 4GOPC 3IRBA 1I6VC 1X65A 2E2HH 1DONA 3D4WA 4I65A 3M3YB 1BF4A 3JAML 3UE1A 2F0SA 1NSNS 2XIWA 1EEID 2V1CC 2VQFQ 1EY4A 5JPMC 4DV1Q 1BO0A 2B2WA 2EPBA 5E4WC 3RN5A 4LF7L 5CV5A 4NXML 1YIJA 4DR5L 3BVMA 2PQAB 1EZ6A 1K28A 4A3EG 1QUQA 1B9MA 4LUZA 3O13A 3FPUB 3LNNA 4DV5Q 2R93H 4ZCKA 3SR1A 2JA8G 3CKIB 4HCSA 4BY7H 1R9TH 2EOTA 2BA1A 4A93H 2Q2UA 5K36H 1H9SA 4JBJA 2UUAQ 1KRSA 4JI7L 2L9HA 3CCSA 5FLMH 1XPRA 1A3TA 5BN5A 4X65Q 4M1UB 4B3TL 3CPFA 2J7ZA 1LTTD 1NAPA 3CC7A 1LLRD 2K5WA 2EE1A 2PMZB 2LY7A 3DMUA 3M4OH 1STGA 1A6XA 4CJ2C 1DXMA 3TP7A 3NTIA 4DR6Q 2HIXA 4KY5A 4C3HH 4R8NA 1CI3M 1NTGA 1JB7A 1VQDA 4UHVA 3A54A 4UAIA 1KLUD 4DK1A 3K81C 1CM9A 2JA9A 5C44G 4Z9CB 1EFID 1GXDC 4OEMB 2RCFA 5C3EB 1JCKB 5LMUL 1MBYA 1SNDA 5KEEA 5I6WA 3AQQA 4BWGB 5M3MB 4X64Q 1B44D 1L1OB 3S1RH 5LMNL 1CA6A 3RMHA 3ITPA 2E76C 2WV6D 3SDZA 1U4PA 5M9OA 3WOEA 4O1NA 5M5XB 2ZM6Q 3S2HB 2KCNA 1GHJA 3I3CA 2PQAA 4XT1B 1IBML 2A68C 2Z4HA 3H91A 2E5LQ 4A3BG 4B3RL 3S17H 1SN8A 3BS1A 4NW2A 4X62L 1SMYD 2AMCB 2N49A 3EA6A 2XNAC 1N8RC 3K8AA 4HJ8A 4HJ9A 1YVCA 3L9AX 4CBVA 4DK0A 3J7AV 1LTLA 1FGBD 4IQZA 2WACA 3MC0B 4IALA 1K9MC 4JI5Q 1VQ7A 1JB3A 2CW0D 4JK1C 3I72A 1N9WA 2TMPA 4WJWA 1X3EA 4G57A 4DV2Q 4DN4M 3HGBA 2KBNA 1S40A 1KL9A 1PRTF 3HKZG 3ZJYC 3S1MB 1BCPF 1D5ZC 1BKBA 5ISRA 2MUYA 4IPHA 4N8FA 3MEHA 4PZ6A 4WORA 4PMCA 3DHQA 4JOIA 1PRTD 2OXPA 2RF4A 2R92H 1MI2A 4K2LA 2VUMB 2UU9Q 5CYUA 4WJ3M 4FF3A 3S1QH 2QKIC 4LWCA 1PA6A 1D7QA 3HOYB 5D3DA 3S14B 4LF6L 2DJFC 2IX0A 2R3ZA 3R2IA 3KF6A 5C0XH 3X3NA 4DV3L 2F0FA 4GLXA 2NVQH 3HOUH 1Y1VG 1Y1WB 3GTMB 3I7FA 1YNXA 1MIUA 5FJ8H 3V96A 2PCFB 4ZRZA 4JW0A 2A74C 5DEHA 3DXJC 2G5DA 4BBRH 3FKIB 4DV0L 4JVZA 2JA5H 3KJPA 4QGUA 1SJHD 2B63B 4CGYB 1NY4A 2KEDA 4A3JH 1XTCD 2RCNA 3CRLC 2UUBL 3KDFB 1MJEA 1L0XB 1Y8PB 3BYTB 3D6CA 3PO3H 3S1NH 3QJYA 5ELDA 3M3YH 2ZJQA 1WFQA 1VQLA 2AUJD 1QZGA 2VQEQ 4NXNQ 3K5MA 3PO2H 5T1IA 3CPWA 4LF5Q 4XYOA 2ASBA 5EPLA 3HKSA 1VQ4A 2Q8RE 4J15A 4KD4A 1ONLA 1STAA 4OX9Q 2NZOA 1MJCA 2B2VA 1KD1C 5FLXL 4C56C 3NELA 3BZDB 3MAQA 4L8JA 3Q23A 3RZOH 3ULPA 1B70B 1TWFB 1XXGA 3HOXB 2WIIB 3LGJA 1KRTA 2JSOA 1QG7A 3MFGA 4DNTB 1PH3A 2XWJB 1LT3D 1Y69U 2K33A 4HCEA 1PH5A 1VQKA 3IAYA 4IFDJ 1RCVD 3N6RA 2ALYB 1Q1BA 3IFDA 4DV6L 3HOVH 2JA6H 1GJXA 2A19A 1PVOA 3S9WA 1HA5A 3V2TA 2CQOA 3GTOH 1AFPA 2PO4A 4JG2A 4JI3Q 3VYUA 2BH2A 1STYA 5EKLA 1YHAA 3I91A 4LF4L 4CDFC 3I4NB 4U68A 2X69A 3I56A 2F4IA 2HHHQ 1PLFA 1Q86C 1I94Q 1AP0A 1I3QH 2N88A 1P8LA 5C0XJ 2MO0A 4B3ML 2K04A 2WAQE 4ME3A 4LFBL 2LSSA 4B08A 2GN5A 2QEXA 4HAEA 1S72A 2F0LA 4A3CG 1KABA 2GVBA 3I4MG 3IFTA 3EROA 3MXPA 4IPCA 2EDGA 3R3OA 1CKMA 1RL2A 5EQ0A 3PIO3 1RDPD 1H9KA 5K5PA 2LXKA 1J9OA 4LFAQ 2Q2HA 1K3BC 5DM73 2CH4A 3OSOA 4CHTB 1C7YA 1T5XD 5BR8L 2Z6KA 2KA7A 3A8JE 4YIJA 2F0WA 4A4IA 5EBDA 4MIUA 3HG9A 4A3MB 5FK9C 3PUXA 4PZ7A 1XTDA 5EPJA 3TMEA 4C3JB 3UDGA 4BY1G 1G6PA 2B2YC 3S1MH 4CDCC 3P7JA 1RHPA 4LMQD 1EZ8A 1PH4A 4IFDI 1OXXK 4A3FH 3OHXC 4FXGC 3D4RA 2IY5B 2XGTA 2V4DA 3T4AC 1Q7YC 3MEFA 2M2LA 5C3WA 2VUMH 3ONAB 1SE4A 1IBLL 1VQCA 5KNBA 5CV4A 1IBKQ 2DY7A 1O7IA 1X3QA 4X3SA 5IGGA 3S14H 2L5TA 3KOJA 1NUCA 1HUNA 3K7UC 1Q46A 5I2XA 2VL6A 4IJLA 2PI2E 2FXQA 2VQFL 4JBMA 1PZKD 1Y1WH 4DNRB 3GTMH 3SK5A 3TEHB 1EQRA 5I9PA 3TBIB 5C0XI 3PUVA 5LL6S 1LTID 1U4LA 1A0IA 1GO3E 3KLSA 4LFCL 3EVQA 3FKIH 4DV5L 4CKBA 2DN8A 2JP1A 4B9WA 3CC2A 3K6OA 1EIFA 3KFUA 5JEAG 1XNRL 5IP9G 2UUAL 5DLQE 1LYLA 1K0RA 1V1OA 3S16B 4A3KG 4X65L 3K59A 3CD6A 3MWYW 3QB3A 2L11A 2FMMA 1KDBA 1TWAH 4JI8Q 2BCOA 3DWQA 3OW2A 4YY3Q 3RN2A 3NEMA 4CJ0B 3E9HA 3GDEA 5IGBA 4DR4Q 5CV7A 3P20A 3D8GA 4KI0A 1PH2A 2B2UC 1Q8KA 2VS1A 4XQQA 5KIXA 1N33L 3TSSA 1X3FA 4AQYQ 1TIID 3SK6A 3DEPA 4HMJA 4HN7A 5C6AA 4DR6L 1X54A 1HR0Q 4DAYB 3RNUA 2AQ2B 1LTRD 2Q2TA 1BVSA 4A75A 4IZ8A 1J6QA 4LUVA 2IWHA 2BH8A 2R7FA 1IZ6A 1TWFH 3HOXH 5IIFA 1EY0A 4O0AA 3W5OA 4NP5A 1K8GA 2A69D 4L6TB 4K2KA 2E2HB 1EOVA 4X64L 1BDOA 1PMRA 3PIP3 1XMQQ 4A3LH 1ILQA 4OO1G 2WB1E 4PZ8A 2KOLA 1TT2A 2PZUA 3AFQA 1MSGA 4LK1C 2PPBC 4ZAIA 2XRSD 2IHFA 4EX5A 3E0EA 2ZM6L 1SE3A 4A3GH 4BXXG 4KN7C 5D65A 2E5LL 2O2LD 2A73B 3TRZA 2R93B 3J7AF 3TP5A 3DM1A 1R9TB 4A93B 2BDNA 4DAMA 4C3IG 3ERQA 3U4VA 3I55A 1TWHB 4OO1I 3Q24A 4DV2L 2R6GA 2EYLA 2Y0SE 3A7LA 3QG1A 2F4VQ 1EY8A 2R7ZG 1SE2A 1HA6A 3M4OB 4QCLA 5E3FA 2CWAA 1A63A 1GVPA 2ZT9C 1DCZA 2YYZA 1QOHA 1Z9FA 3MFYA 4K6LA 4JI2Q 2F0QA 4N8X1 4N9TA 2UU9L 4A3EH 4H0LC 1G51A 3NE5B 4KLKA 1B9NA 3NWTA 5D3IB 1WOCA 3JAMc 3Q22A 1M8AA 4C3HB 3A8IE 4DAYA 4KHZA 1FYCA 1RTNA 3TDQA 3VR2A 3I73A 2JA8H 5M5WH 4HIMA 4P73A 2CCZA 2NUCA 1AH9A 4KY7A 3SXHA 3NSWA 4A3MH 4H13C 3I4LA 2RQXA 3S1RB 1YI2A 1VQ6A 4HIKA 1PTOB 4K8JA 2F0PA 2J0TD 1C0AA 5KRUA 4Y7NH 2RSOA 2PYKA 2PMZE 2YTVA 2N55A 1WCMB 3CHBD 2Z0SA 2E2IB 4DV7Q 2HQLA 5ELBA 5GAGC 4R4IA 4UP7A 3BU2A 3AU7A 3F2DA 4I7AA 3GO5A 3M9BA 4E6IA 2VQEL 4NXNL 1YNNC 2K4KA 3K0YA 2F0KA 3CMEA 2PQEA 2NN6G 1IYUA 2B63G 4LF5L 3ULJA 1F9PA 5IYCG 3GTLH 2ES2A 1AE3A 1CFMA 1QB5D 2EYHA 4OX9L 4BA2I 3MXGA 4UPAA 1JWUD 2EY5A 4RG1A 5JJIA 3MXNB 1EIHA 5KGUA 4DKAC 5JJLA 4KD3A 1UE1A 3J80i 3A8KE 3EN2A 1JOOA 1I6HB 4F7XA 2C9OA 3S1QB 4JV5Q 3DM3A 4A3BH 1JC7A 2KECA 2BOSA 3U50C 2XWBB 1IYVA 2CVRA 3HOUB 2NVQB 5JJZA 2K5DA 4ZLTF 1OTCA 4L5RC 2HDMA 4M8AA 3KF8B 1YHQA 3V05A 3MXUA 5AFWA 4JI3L 1CA5A 2C35B 2VXWA 2B2TA 3ERSX 4IURA 1E1OA 4IOAA 4BBRB 1J5EQ 2JA5B 3D31A 2HHHL 1C9OA 4RCNA 1I94L 4KHPQ 3M4YA 3D0FA 1XJVA 2AWOA 2QGQA 4GOPB 4A3JB 5GQOA 1JE4A 4CDDC 1DJRD 3PO3B 3S1NB 4C1NI 1FJGL 4QIWB 5T1GA 4A3IH 1PHJA 4A3DG 3HZXA 5ELCA 4DUYQ 1CKOA 3SE0A 4XYQA 4L63B 1VQ5A 3KK7A 1S5CD 2JYOA 4DPGA 2EIFA 1PH6A 3PO2B 1EY6A 4RKLA 3OMCA 1H9JA 1D2BA 3PQIA 1WTVA 1XWEA 1JOKA 3H6MA 4GNXA 1WVLA 4LFAL 1CKNB 2ICEC 3L0OA 3H0GG 2MPMA 5IY0A 1BQQT 3FDTA 3MXNA 3RZOB 4Q0FA 1O7LA 4R8IA 4RGNA 1V8QA 1C48A 4LUOA 4UDUC 1EQTA 1TWHH 3PV0A 1UWVA 3Q6SA 2JN4A 1H9RA 3HOVB 4ZYSA 2FFKB 2KCTA 3W3AA 2VW9A 4RCOA 2JA6B 5KNDA 1AE2A 3GTOB 2A8VA 3HOWG 1S3OA 3G48A 3PUWA 4X66Q 3KF8A 1SE8A 5FKAC 1AZPA 1DD2A 4DXGA 2SOBA 5IE8A 3J7YW 1IBKL 1U9RA 3GTGB 4XQJA 1SDFA 5M3FG 2F52A 1QNKA 1I3QB 5GADC 3KBXA 4RGMA 2EXDA 4KKSA 1NR4A 4GOPA 3H3VC 4JPBW 4JOIC 1QVCA 1VS0A 4QUCA 5IT9L 3CCLA 5CV6A 1S5ED 2E2DC 4JCVE 4B9XA 3GTPB 2ZXRA 1EL0A 1SR3A 2CWPA 1PTOH 3H09A 5EGTA 1F9SA 1F2LA 2ZXPA 4U673 5C4ZA 3NBHB 1D6EC 1N34Q 5CORA 4MTNA 1OXVA 1SBBB 1MHWC 3TREA 3S2DB 1XNQQ 3J80L 5C4XB 1WCMH 4K0KQ 1B1ZA 2XSCA 2Z9HA 2HCIA 2E2IH 3STBC 1W6JA 2H4OA 3WWVA 4OELB 4YY3L 3ER0A 4DR4L 2QA4A 1NMGA 4OIKA 1VQMA 4POGA 4AQYL 2JJQA 3F2BA 5A35A 4OHJA 5A2QE 1SLJA 1EYGA 3E9IA 3KUPA 2JEAI 3FHWA 1ML0D 1ENCA 1ZYRC 4FYDA 3VA5A 4J6HA 4DUZQ 4YCUA 5DM63 4HEDA 2JA7G 4A3CH 1D5MC 1SYEA 3CXCA 4A3FB 2YTXA 1K83H 4TSSA 2MJ8A 1A2UA 5IGDA 1I6HH 4B3SQ 3M4PA 1TQOA 1STHA 3NTHA 1Z6HA 1U0LA 3J7A5 5CR3A 3CRKC 1XMQL 4QJFA 3I70A 3EJIA 1B8AA 2WAQG 2B2VC 4L5SA 1N32Q 2I07B 3NP8A 1PTOF 4X3TA 1DM0B 4ILWA 1JJGA 2JK8A 3CCRA 2F0UA 1YBYA 5EBCA 3UDFA 1QVFA 3RLNA 2XTIA 1PTOD 5FO8B 3UDXA 2NZHA 1L2FA 1L1OA 1B53A 1G2TA 1VQHA 2RVLA 3PSIA 4S3SA 3QWNA 3PGZA 4JBWA 3NBHA 3CCEA 4BA1I 1OO9B 1RTOA 1F77A 4RGTA 5FO9B 4DGZA 4IPDA 4EQOA 1NNXA 3K7AH 1TWAB 4KK7A 3OTOQ 1B3QA 2B39A 2TSSA 4HR7B 4X6AH 1STBA 4K5VA 5C3XA 1HNZQ 4KKTA 4BY7G 4RFBA 2IX1A 2EVBA 4A93G 4AYBB 4JI2L 1WTXA 3MTSA 1GUTA 2KHJA 3SEBA 4DK3C 2RHSB 3HS0C 3C3LA 1KAAA 4JI0Q 1FVIA 3S24A 2EY2A 3M7NA 1V1PB 3K5LA 2NVXH 3J81i 5CMDA 1K73C 2K03A 5I2YA 5IP9H 3U58A 4GKJQ 1TU2B 3FPPA 4BBSH 2KJXA 1O7YA 4IUPA 1PYWD 1D8LA 1UUPA 4FDBA 5TSSA 1TWGB 3OIPA 1PDQA 1GOZA 3F2UA 4ME5A 1TS3A 1JWSD 4X3KA 1QWYA 2QF7A 2EYFA 2Z6KC 4PQXA 4A3GB 2HDLA 1GUOA 1X6OA 1E2WA 3GTGH 3VR5A 5LHY1 2RKSA 4DF7A 4DV7L 2X6LA 1MKHA 1GHKA 3T13A 4RGOS 3HOZH 2HD3A 2XVSA 2K5HA 2ZTCA 2FHTA 2Q2IA 1JT8A 4F8MA 1EFWA 2E2JB 3KDFA 4MZ9A 3TZDA 4K6DA 1HZCA 1JR0D 2BE5C 4IUQA 4NB3A 2EYJA 2K75A 1SNQA 3GTPH 3CW2C 3BDCA 5CC4A 4QUFA 2F0MA 2BDOA 2OEOA 1BXTA 1ZKOA 3CQZB 3FRPB 1JJCB 4A3EB 1WTPA 4BXXH 4IFDG 1Z47A 3S2DH 5NUCA 3IKJA 5C4XH 4GN5A 2AUKA 2CFMA 1SFOB 1HNXQ 2JA8B 1B2TA 1V1PA 3PUYA 4YCWA 1ASZA 4EQNA 5M5WB 2WP8J 3SVMA 5IP7H 1VQJA 2UXDQ 4IUVA 4DR5Q 4V190 2UXCQ 4DAPA 2R92G 1IW7C 2SEBD 4LF9Q 1P16A 2G9HD 1Q12A 1ZXTA 3N52A 4LJZC 2E8GA 2WB1G 4G4KA 4K8IA 2L1BA 2K50A 2R7ZH 1EWIA 2I5HA 4GLAC 5C0XG 1QZHA 3T16A 4Y7NB 5D14A 1MGSA 4KHPL 1GD7A 4HJAA 2MP1A 4N9PA 4GS3A 1NE3A 1EUJA 3G6JB 1KDCA 4RAUC 2PNRC 5FJ8G 1BBUA 3UDIA 2OTLA 1VQNA 4BBRG 5C44B 4CKEA 1EYCA 1I50H 2HQEA 3A55A 2JE6I 4DV1L 2JA5G 1X32A 3PCOB 5FOBB 2F0HA 3FMCA 4DR3Q 2K05A 1B50A 3GTLB 2F0IA 4DR2Q 1PFNA 2Y0SG 2N3SA 1LABA 3FVQA 4JI6Q 2O5IC 1HPCA 1EIGA 2NYZD 2D5DA 3QO2A 3X3MA 2A68D 5GROA 4P72A 4A76A 4DR1Q 3CAMA 5IGEA 3K5NA 3K80C 3STBD 4V0BA 3MA2B 3PO2G 1E2VA 1KC8C 2KENA 4A3BB 3J81L 5IYDH 5ELFA 2H1EA 1QVGA 3CCVA 1K3RA 5M5YH 3G7LA 2XRQD 1VQ9A 2NN6H 3W2DA 3OYYA 1W6KA 2QDLA 4P2CB 4X66L 1ET6A 5IYCH 1K0SA 1NR2A 3U9OA 2A1AA 3A5ZB 3HKZB 3TQYA 2KHSA 1CZWA 2HUGA 1HFGA 2M00A 3BVZA 1JORA 2EYPA 2JA6G 2JXMB 1VQOA 1XX8A 4IUNA 1U4MA 2HCCA 4DNIA 2EYOA 3JAME 1ENAA 1MD2D 3LWUA 3VYTA 2K5QA 5IYBH 2EQSA 3E3XA 1L0WA 1VQGA 4RHSA 4A3IB 2EZVA 4ZKCB 1C8CA 2K14A 3D6WA 1TWGH 4R4OA 1VQAA 1Y1VB 2D0PA 2RDGA 3AEVA 1RIPA 2PZTA 1IL8A 1PH7A 4AIMA 4XXEA 2IPKD 3I8ZA 2EXZA 1EQQA 1CQVA 4LAAA 1FR3A 1HR0W 3KYHC 5C3EG 5JVH3 1XNQL 2F0NA 4UP9A 2JEBI 1VDZA 2RA4A 4KJNA 5M3MG 3S15H 2UXBQ 5JVG3 2IL8A 3NTKA 4NKLA 4JI4Q 2F3WA 4HIDA 1LTSD 1TY2A 2LMCB 4JI5L 4KKUA 3SK4A 4UY8C 2E2JH 4R4QA 4JI1Q 3DEOA 4HIOA 4H7BA 3UI2A 4A3DH 1Q8IA 4IN3A 1U4RA 3WOFA 1CK1A 2OTJA 4DUZL 4OIJA 4QIWE 1EEFD 5EJWA 4MHEA 3CQZH 4CKCA 5GAHC 4ZUIA 3T1YQ 1CZGA 4WJ4A 1TWCB 4B3SL 4DU9A 2D62A 4J1MA 4FVMA 1N36Q 1SFOH 1F9QA 3C46A 2I5LX 1SYFA 1KNAA 4ZUJA 1E24A 2A6HC 4LNQA 4DXFA 2EYMA 1GUSA 1LTBD 2X6GA 1RJTA 3TP6A 4DK6C 5IT9E 1N32L 1DZ1A 1G8ZD 2F1MA 5EKIA 1V1QA 4TRDA 4BS9A 2VUMG 1EWHA 1A15A 1EQVA 1B7YB 2DUDA 1SMXA 3HOYG 4C2MB 1PRTC 1T9HA 2LXJA 1BCPC 2AKWB 3I90A 4LF8Q 2KCMA 3R93A 3HOWH 1Y1WG 1XMOQ 1HZBA 3OOCA 2M9VA 2E75C 2B8FA 1OXSC 1RKNA 1UE7A 3BJUA 3E5SA 2B2TC 4ZKBB 3OTOL 2NBFA 1EIYB 3MVVA 1HHVA 1VQPA 1A8VA 3FKIG 5C44H 1KDAA 1HNZL 4ABNA 2BE5D 1SNMA 3GP7A 1DOKA 3EBEA 4KV6A 5KNCA 1U5KA 4LF4Q 3CMAA 2K5VA 3QIAA 1HXYD 4OWTB 5JAVA 1E0BA 2VB2X 4YWLA 3CC4A 1K83B 3I4MB 2MO1A 3FP9A 3OIQA 5IT9c 4WRDA 1K8OA 2B2WC 4GKJL 4OONA 4LFBQ 4GZYC 5CV8A 3AYHB 3GD7A 1JMCA 3T51B 1LUZA 3EIVA 1GM5A 5ELEA 4GNXC 1WD0A 3NQIA 1JQYD 4YWMA 4MNOA 3J7ZC 1WYDA 2DY8A 3HOXG 3J80c 5E4XA 1PYBA 1BR9A 5ELOA 1D1KA 1ASYA 1QNUA 4X3UA 4BY1B 1PXUA 1YHBA 4P75A 4EVOA 1LT5D 4KTAA 2JA7H 2ZTEA 5BR8Q 5C4JB 4R1JA 4FO2A 4PMBA 2YU9B 3G6EA 4DV4Q 1HJPA 2CH4W 1J8IA 1BUVT 2K28A 2L55A 3K7AB 2MGSA 1S5DD 4JBKA 2KCCA 1WTHA 4FF1A 5EKKA 4DR7Q 1ICFB 3NPPA 3BZCA 4OXPA 3I4NG 1SYCA 3CCQA 1Y1VH 3NENA 4NPSA 4AH6A 1X56A 4NMZA 2QILA 1KXLA 1FGUA 2K6AA 2NTTA 5FLXE 1SRUA 4IUTA 1HNXL 1HTPA 1SXTA 3LWEA 2HT1A 2AWNA 2NVXB 2RDFA 4KY6A 3NQTA 3NWSA 4QY7A 4APVA 3L7ZC 4BBSB 2UXDL 4HTHA 4O42A 3CCJA 4A3KB 2UXCL 1DOMA 3FEWX 2ZJPA 4LF9L 4CJ1B 1WI5A 3URYA 1K8MA 2Z6BA 2LS01 5BN3A 3OWFA 4JYAQ 4G7OC 4LFCQ 3CCUA 3WDNA 3E6ZX 1AZQA 4OL7A 2VB3X 1JOQA 1G2SA 1FNVA 1TS5A 4EQ5A 1PFMA 4K5XA 1XNRQ 3EQLC 1WTRA 1TWCH 1PH1A 3TS2A 1D1IA 1STEA 3BZKA 4A3MG 4AYBE 1EY7A 3OMGA 2MFIA 4C3JG 1YZ6A 1B3AA 3A7AB 4GKKQ 4KN4C 4EQPA 2CHBD 2GVAA 1TXYA 3HOZB 3C1FA 1X9NA 1PZJD 4TKOB 3KLRA 4DR3L 1JWMD 1N33Q 1B4OA 3Q0AA 1HRJA 4DR2L 1EU4A 1JJ2A 2N78A 4JI6L 3OW7A 4PNYA 3GTQH 2WKCA 1SEBD 3Q8DA 5FLXc 4C2MH 3J81j 3KF6B 4OWXB 3ND8A 4IO9A 3LX0A 3MHBA 4DR1L 2MHVA 2D0OA 2ATWA 5IGFA 4ODGA 2Z8LA 1QILA 4RKBA 1SNOA 5G3LF 2DNEA 3H94A 2B3GA 1CKNA 4K14A 4JI8L 1WD1A 5G3LD 4C3IB 1L1OC 3PMFA 4ULLA 1VCIA 3KBGA 3PIPA 1SNCA 1SJED 1SNPA 2EY1A 4MTKA 2UUCQ 1EY5A 2NVTB 1HR0L 3U9SA 2ZJRA 2AQ1B 2R7ZB 1F9RA 1OXUA 1E7ZA 5GAEC 4XT3B 3I4MH 3PUZA 5IOCA 4CDEC 1VQFA 2SNSA 3G71A 1BNZA 4IFDH 2A6HD 1QJOA 2F03A 4TQUS 4YWKA 1AN8A 4POFA 1KAWA 4R4TA 1IXRA 1SAPA 3VDYA 2DJGC 4QB4A 2L0CA 1ZEQX 1I50B 5C5LA 2OQKA
chains in the Genus database with same CATH topology
5IP7H 4DAMA 1VQJA 5J3BA 5IWAQ 3U4VA 2UXDQ 3I55A 3F2CA 1IBLQ 1K8AC 4DR5Q 2UXCQ 4GOPC 2R92G 3IRBA 4OO1I 4DV2L 1X65A 4LF9Q 1P16A 2E2HH 4HJ7A 1Q12A 2R6GA 2Y0SE 4BY1H 2E8GA 2WB1G 2F4VQ 3UE1A 4A3IG 2K50A 2UXBL 2R7ZH 1OXTA 4XTCS 2R7ZG 1EWIA 2I5HA 2V1CC 4GLAC 5C0XG 2CWAA 2VQFQ 1QZHA 4JI4L 1GVPA 4DV1Q 1NJIC 4QQBX 4KHPL 1A63A 5C4JH 2YYZA 1GD7A 4IJHA 4HJAA 3TS0A 1Z9FA 4JI2Q 3G4SA 3RN5A 2YU9H 4LF7L 1CUKA 2DGYA 4NXML 4GS3A 1YIJA 4DR5L 1NE3A 1EUJA 2UU9L 2PQAB 4JI1L 4A3EH 1G51A 4A3EG 4KLKA 1QUQA 1H95A 5FJ8G 1BBUA 1WOCA 4LUZA 3JAMc 3UDIA 2I0QA 2OTLA 1VQNA 2F4VL 4KHZA 4DV5Q 1IYJB 2JA8H 2R93H 2R93G 2JA8G 4BBRG 4BY7H 1I50H 4DV1L 2JE6I 5M5WH 1R9TH 2JA5G 2BA1A 3PCOB 4TVAB 4HIMA 4DR3Q 4P73A 2Q2UA 3U4ZA 1HH2P 4A93H 5K36G 1NBWA 4JBJA 1KRSA 2CCZA 2UUAQ 4JI7L 2VY3A 3T1YL 3CCSA 5FLMH 4DR2Q 1YJNA 1XPRA 2Y0SG 1AH9A 5FLMG 2N3SA 5AJ3Q 4A3MH 1HNWQ 4JI6Q 3AFPA 1E22A 4X65Q 1N36L 4B3TL 3CPFA 1E1TA 3CC7A 1YI2A 1VQ6A 4HIKA 5GROA 1GKHA 4IPGA 4P72A 4A76A 3M4OH 4DR1Q 3CAMA 1C0AA 2I5MX 4Y7NH 3K80C 3STBD 1E3PA 2PMZE 2VNUD 3PO2G 1KC8C 2KENA 4A3KH 2YTVA 4DR6Q 2HIXA 5IYDH 2Z0SA 3UE0A 4DV7Q 4C3HH 1NTGA 1JB7A 2HQLA 1VQDA 4R4IA 5GAGC 1QVGA 3CCVA 1K3RA 4UP7A 3BU2A 3K81C 1YITA 5M5YH 3F2DA 3A74A 3GO5A 3M9BA 2JA9A 2VQEL 4NXNL 1VQ9A 5C44G 4LF8L 2K4KA 3CMEA 3OYYA 3T1HQ 2NN6G 3HFZB 2B63G 4X66L 1XMOL 4LF5L 3ULJA 5IYCH 3J81c 3I2ZA 2IT1A 4PG3A 5IYCG 5LMUL 3GTLH 4YHHQ 2ES2A 1AE3A 3AQQA 2A1AA 4OX9L 2H5XA 3A5ZB 4BA2I 4X64Q 4UPAA 3TQYA 1Q1EA 4O2DA 4RG1A 2K5NA 1L1OB 3S1RH 5LMNL 5JJIA 3MXNB 1PFSA 1JE5A 4DKAC 5JJLA 1UE1A 3HKZE 3J80i 3H3VH 2JA6G 2OQ0A 3EN2A 1VQOA 4DNIA 2ZM6Q 3W1BA 4JV5Q 2PQAA 5IYBH 1IBML 2EQSA 3DM3A 4A3BH 1L0WA 2E5LQ 1VQGA 4A3BG 4B3RL 1WCMG 3S17H 1SN8A 2K14A 1TWGH 4R4OA 4X62L 2AMCB 2N49A 3U50C 1VQAA 1N8RC 3K8AA 4HJ8A 4HJ9A 1YVCA 2D0PA 3AEVA 1BBWA 1LTLA 1RIPA 2F3IA 1PH7A 4AIMA 3SGIA 1OTCA 4L5RC 1K9MC 4JI5Q 4QL5A 1VQ7A 1EQQA 3KF8B 1YHQA 1X55A 1N9WA 4JI3L 5C3EH 4JV5L 1X3EA 5E7NA 4DV2Q 3KYHC 5C3EG 2C35B 1HR0W 2ZTDA 1XNQL 2KBNA 4UP9A 3ERSX 2JEBI 1FJGQ 1S40A 5JJKA 5M3MH 1E1OA 1KL9A 5M3MG 1V43A 4IOAA 3S15H 1J5EQ 3HKZG 3ZJYC 1VQIA 1A62A 2UXBQ 1BKBA 4JI4Q 3D31A 4JC0A 4HIDA 2HHHL 4IPHA 4C3IH 1C9OA 1LM0A 1I94L 4KHPQ 3RR5A 4PZ6A 3D0FA 3M85A 4JOIA 1XJVA 2AWOA 4JI5L 2QGQA 4GOPB 4LF7Q 4NXMQ 2RF4A 2R92H 4UY8C 5M5XH 2UU9Q 2E2JH 5GQOA 4R4QA 4JI1Q 3S2HH 4WJ3M 3S1QH 4LWCA 1PA6A 4HIOA 1D7QA 3F8TA 1XPOA 2NVTH 1FJGL 4A3IH 1VQEA 4A3DH 1PHJA 4LF6L 2IX0A 4A3DG 4DUYQ 3KF6A 1Q82C 1PH8A 1CKOA 1J5EL 4DUZL 2OTJA 4DV3L 1VQ5A 4QIWE 4GLXA 2NVQH 3HOUH 1HZAA 1Y1VG 4DPGA 2EIFA 3HOUG 3CQZH 1PH6A 5GAHC 2OCEA 4LW1A 4JI7Q 3T1YQ 3I7FA 1XPUA 4WJ4A 4B3SL 1YNXA 5JEAJ 1MIUA 5FJ8H 2D62A 4DV4L 2WFWA 2ID0A 4GNXA 1N36Q 4B3TQ 1SFOH 4LFAL 1CKNB 2I5LX 3L0OA 3H0GG 4DUYL 1PH9A 4DR7L 5IY0A 4BBRH 1E24A 4DV0L 4LNQA 5H1SE 2JA5H 1WJJA 3KJPA 4PMWA 1KQSA 4QGUA 4DK6C 1N32L 1DGSA 1NY4A 2HIVA 3JC66 4LUOA 1V1QA 4A3JH 2R7DA 1IL2A 1TWHH 2RCNA 3PV0A 4A3JG 2UUBL 2VUMG 3KDFB 2OWOA 1G291 1MJEA 1UWVA 3I4OA 3PO3H 2DUDA 1B7YB 3PO3G 5HGQA 1SMXA 3S1NH 3M3YH 3HOYH 3RZDH 2ZJQA 3HOYG 1WFQA 1T9HA 1VQLA 2KCTA 2LXJA 2VW9A 1QZGA 2AKWB 4GN4B 1AE2A 2VQEQ 4LF8Q 4NXNQ 2KCMA 2A8VA 3HOWH 3PF4A 3HOWG 1S3OA 2PNHA 3PO2H 3G48A 3PUWA 4X66Q 3CPWA 1Y1WG 1XMOQ 4LF5Q 2ASBA 1SE8A 3HKSA 1HZBA 5LMUQ 1VQ4A 4J15A 5IE8A 2K52A 1OXSC 1IBKL 4OX9Q 2NZOA 1UE7A 1MJCA 3BJUA 4OWWB 3ICEA 4UP8A 3OTOL 4JYAL 5LMNQ 1EIYB 1KD1C 5M3FG 2F52A 1VQPA 3NELA 1A8VA 3FKIG 5C44H 5GADC 3PF5A 1HNZL 3RZOH 4GLVB 3ULPA 1B70B 1M1KC 2B63H 2EXDA 3LGJA 4GOPA 1KRTA 3EBEA 4JOIC 1QVCA 1VS0A 3CCLA 1IBMQ 1PH3A 1U5KA 4LF4Q 4BBSG 3CMAA 2K5VA 1W3SA 1VQKA 1PH5A 4B3RQ 4IFDJ 4JCVE 2ALYB 4X62Q 5HY6A 4OWTB 1Q1BA 2MNAA 4DV6L 3HOVH 1SR3A 4GKKL 4YWLA 3CC4A 2CWPA 3HOVG 2MO1A 2JA6H 2B29A 2A19A 1PVOA 3FP9A 2CQOA 3GTOH 4DR4L 3NBHB 5IT9c 1N34Q 1PYSB 4JG2A 4MTNA 1OXVA 4GKJL 4OONA 4LFBQ 4JI3Q 1I5FA 3AYHB 3TREA 2BH2A 1XNQQ 3GD7A 4LF4L 1YHAA 1WCMH 4K0KQ 1JMCA 1XNRL 2E2IH 1LUZA 3EIVA 3STBC 5LMNW 1GM5A 3WWVA 4GNXC 3I56A 4YY3L 2HHHQ 1Q86C 3ER0A 5EAYA 1I94Q 1I3QH 4YWMA 1P8LA 5C0XJ 2MO0A 4MNOA 3J7ZC 1NMGA 1WYDA 2QA4A 4B3ML 3HOZG 2WAQE 1N34L 1UE5A 3HOXG 4ME3A 1VQMA 4POGA 2N8NA 3J80c 2JJQA 4AQYL 3F2BA 4LFBL 1PYBA 3RLOA 2LSSA 5ELOA 4K0KL 1SLJA 3H15A 1EYGA 3E9IA 1ASYA 2JEAI 3FHWA 4LF6Q 2GN5A 1YHBA 4P75A 2QEXA 2JA7H 1S72A 4DUZQ 4GN3B 4YCUA 4DV3Q 2JA7G 4A3CH 4A3CG 3ULLA 3CXCA 2ZTEA 2YTXA 1K83H 5BR8Q 3KJOA 2GVBA 3I4MG 4R1JA 1VQ8A 1I6HH 4B3SQ 2NVYH 3M4PA 4IPCA 3G6EA 3B6YA 3CP0A 1CKMA 1HJPA 1RL2A 4DV4Q 1UE6A 2LXKA 4LFAQ 2UUCL 4RMFA 1NMFA 4JBKA 5C4XG 1U0LA 2Q2HA 3I4NH 4DR7Q 3I4NG 3BZCA 4OXPA 3H3VI 3J7A5 4DV0Q 4QJFA 3CCQA 1XMQL 2CKZB 1Y1VH 3NENA 4NPSA 1B8AA 2WAQG 1C7YA 5BR8L 2Z6KA 4L5SA 4AH6A 1N32Q 1X56A 5IP7G 1CSPA 1JJGA 1KXLA 2JK8A 1FGUA 3JAMi 3CCRA 2UUBQ 4A4IA 1YBYA 3UDFA 1QVFA 1CSQA 2XTIA 3PUXA 4PZ7A 3RLNA 1SRUA 1XTDA 3UDXA 3H0GH 3GTJH 2NZHA 3UDGA 1HNXL 1L2FA 4BY1G 1G6PA 1L1OA 1VQHA 2MQHA 3S1MH 1KHIA 2HT1A 2AWNA 1PH4A 3PSIA 4IFDI 3A5UA 1OXXK 4A3FH 4QY7A 4A3FG 4APVA 3PGZA 4JBWA 2IY5B 3L7ZC 2XGTA 5IWAL 3CCEA 1Q7YC 3MEFA 4BA1I 1X3GA 4HJ5A 2VUMH 2UXDL 1UEBA 3CCJA 1IBLL 2UXCL 1VQCA 2ZJPA 4IPDA 1IBKQ 2VZAA 4LF9L 1O7IA 1WI5A 3K7AH 3S14H 3OTOQ 3W1GA 4JYAQ 3KOJA 4LFCQ 3CCUA 3K7UC 1Q46A 4X6AH 2VL6A 4IJLA 1HNZQ 2PI2E 2FXQA 2VQFL 4JBMA 4BY7G 3M4QA 1Y1WH 2IX1A 4EQ5A 4A93G 3GTMH 1XNRQ 4JI2L 2JQOA 3TEHB 1EQRA 1TWCH 4YCVA 2RHQB 3GTKH 2KHJA 4DK3C 1PH1A 5C0XI 3PUVA 3TS2A 2RHSB 3BZKA 4A3MG 4AYBE 3DLLA 4JI0Q 1A0IA 1FVIA 1GO3E 4C3JH 3KLWA 3S24A 2MFIA 4LFCL 5M3FH 1YZ6A 4DV6Q 3M7NA 1Y14B 3FKIH 4DV5L 4GKKQ 2GVAA 1TXYA 1FL0A 3CC2A 1X9NA 2NVXH 3J81i 4DR3L 1EIFA 1K73C 3KFUA 5IP9H 5JEAG 3U58A 5IP9G 4R4CA 2UUAL 5DLQE 4P71A 1N33Q 1LYLA 1K0RA 4L5TA 4BBSH 4GKJQ 4DR2L 1JJ2A 4A3KG 5AJ3L 2N78A 1D8LA 1KIXA 4JI6L 1HNWL 4X65L 4FDBA 3CCMA 3CD6A 3GTQH 3A0JA 4JI0L 3Q8DA 5FLXc 5IYDG 4C2MH 1TWAH 4JI8Q 3J81j 3OW2A 3KF6B 4YY3Q 4OWXB 3RN2A 3NEMA 4IO9A 3E9HA 3GDEA 4DR4Q 4DR1L 4B3MQ 4KI0A 1PH2A 2D0OA 2ATWA 3RLFA 2Z6KC 1Q8KA 2VS1A 1N33L 1YJ9A 1X3FA 4AQYQ 4XIGS 4AYBG 1X6OA 4IOCA 1QUQB 1W2BA 4DR6L 2B3GA 4GNXB 1SROA 1X54A 4ALPA 1CKNA 1HR0Q 2KHIA 4DAYB 3GTGH 4DV7L 2L15A 4JI8L 1MKHA 3RNUA 2Q2TA 5ELNA 1BVSA 1Q81C 4A75A 1L1OC 1J6QA 4LUVA 3F1ZA 3HOZH 2BH8A 2R7FA 1VCIA 2BA0A 1IZ6A 3PIPA 1TWFH 3HOXH 3T1HL 2K5HA 2ZTCA 2Q2IA 4P74A 4O0AA 2YV5A 3K0XA 3W5OA 1JT8A 1EFWA 4Y52H 3KDFA 4MZ9A 2IHEA 1K8GA 4YHHL 3S16H 2UUCQ 5IYBG 1HZCA 1HR0L 4H02A 3PIOA 1EOVA 2PI2A 4X64L 1PV4A 2NN6I 4NB3A 2ZJRA 2K75A 1XMQQ 3GTPH 3CW2C 4A3LH 1M90C 4A3LG 4OO1G 2WB1E 4PZ8A 1OXUA 1E7ZA 5GAEC 3CF5A 3I4MH 3PUZA 3AFQA 1VQBA 4L5QA 1VQFA 1YJWA 3G71A 2AHOB 2IHFA 4EX5A 3E0EA 1JJCB 2ZM6L 4A3GH 4BXXH 4IFDG 4TQUS 1Z47A 4A3GG 4YWKA 3S2DH 2YTYA 4POFA 5C4XH 4BXXG 4GN5A 2E5LL 1KAWA 4R4TA 2CFMA 1HNXQ 1IXRA 1V9PA 3VDYA 3L2PA 1YEZA 3PUYA 4YCWA 1HZ9A 1ASZA 3TRZA 2OQKA 2WP8J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 H;  4DAM A;  1VQJ A;  5J3B A;  5IWA Q;  3U4V A;  2UXD Q;  3I55 A;  3F2C A;  1IBL Q;  1K8A C;  4DR5 Q;  2UXC Q;  4GOP C;  2R92 G;  3IRB A;  4OO1 I;  4DV2 L;  1X65 A;  4LF9 Q;  1P16 A;  2E2H H;  4HJ7 A;  1Q12 A;  2R6G A;  2Y0S E;  4BY1 H;  2E8G A;  2WB1 G;  2F4V Q;  3UE1 A;  4A3I G;  2K50 A;  2UXB L;  2R7Z H;  1OXT A;  4XTC S;  2R7Z G;  1EWI A;  2I5H A;  2V1C C;  4GLA C;  5C0X G;  2CWA A;  2VQF Q;  1QZH A;  4JI4 L;  1GVP A;  4DV1 Q;  1NJI C;  4QQB X;  4KHP L;  1A63 A;  5C4J H;  2YYZ A;  1GD7 A;  4IJH A;  4HJA A;  3TS0 A;  1Z9F A;  4JI2 Q;  3G4S A;  3RN5 A;  2YU9 H;  4LF7 L;  1CUK A;  2DGY A;  4NXM L;  4GS3 A;  1YIJ A;  4DR5 L;  1NE3 A;  1EUJ A;  2UU9 L;  2PQA B;  4JI1 L;  4A3E H;  1G51 A;  4A3E G;  4KLK A;  1QUQ A;  1H95 A;  5FJ8 G;  1BBU A;  1WOC A;  4LUZ A;  3JAM c;  3UDI A;  2I0Q A;  2OTL A;  1VQN A;  2F4V L;  4KHZ A;  4DV5 Q;  1IYJ B;  2JA8 H;  2R93 H;  2R93 G;  2JA8 G;  4BBR G;  4BY7 H;  1I50 H;  4DV1 L;  2JE6 I;  5M5W H;  1R9T H;  2JA5 G;  2BA1 A;  3PCO B;  4TVA B;  4HIM A;  4DR3 Q;  4P73 A;  2Q2U A;  3U4Z A;  1HH2 P;  4A93 H;  5K36 G;  1NBW A;  4JBJ A;  1KRS A;  2CCZ A;  2UUA Q;  4JI7 L;  2VY3 A;  3T1Y L;  3CCS A;  5FLM H;  4DR2 Q;  1YJN A;  1XPR A;  2Y0S G;  1AH9 A;  5FLM G;  2N3S A;  5AJ3 Q;  4A3M H;  1HNW Q;  4JI6 Q;  3AFP A;  1E22 A;  4X65 Q;  1N36 L;  4B3T L;  3CPF A;  1E1T A;  3CC7 A;  1YI2 A;  1VQ6 A;  4HIK A;  5GRO A;  1GKH A;  4IPG A;  4P72 A;  4A76 A;  3M4O H;  4DR1 Q;  3CAM A;  1C0A A;  2I5M X;  4Y7N H;  3K80 C;  3STB D;  1E3P A;  2PMZ E;  2VNU D;  3PO2 G;  1KC8 C;  2KEN A;  4A3K H;  2YTV A;  4DR6 Q;  2HIX A;  5IYD H;  2Z0S A;  3UE0 A;  4DV7 Q;  4C3H H;  1NTG A;  1JB7 A;  2HQL A;  1VQD A;  4R4I A;  5GAG C;  1QVG A;  3CCV A;  1K3R A;  4UP7 A;  3BU2 A;  3K81 C;  1YIT A;  5M5Y H;  3F2D A;  3A74 A;  3GO5 A;  3M9B A;  2JA9 A;  2VQE L;  4NXN L;  1VQ9 A;  5C44 G;  4LF8 L;  2K4K A;  3CME A;  3OYY A;  3T1H Q;  2NN6 G;  3HFZ B;  2B63 G;  4X66 L;  1XMO L;  4LF5 L;  3ULJ A;  5IYC H;  3J81 c;  3I2Z A;  2IT1 A;  4PG3 A;  5IYC G;  5LMU L;  3GTL H;  4YHH Q;  2ES2 A;  1AE3 A;  3AQQ A;  2A1A A;  4OX9 L;  2H5X A;  3A5Z B;  4BA2 I;  4X64 Q;  4UPA A;  3TQY A;  1Q1E A;  4O2D A;  4RG1 A;  2K5N A;  1L1O B;  3S1R H;  5LMN L;  5JJI A;  3MXN B;  1PFS A;  1JE5 A;  4DKA C;  5JJL A;  1UE1 A;  3HKZ E;  3J80 i;  3H3V H;  2JA6 G;  2OQ0 A;  3EN2 A;  1VQO A;  4DNI A;  2ZM6 Q;  3W1B A;  4JV5 Q;  2PQA A;  5IYB H;  1IBM L;  2EQS A;  3DM3 A;  4A3B H;  1L0W A;  2E5L Q;  1VQG A;  4A3B G;  4B3R L;  1WCM G;  3S17 H;  1SN8 A;  2K14 A;  1TWG H;  4R4O A;  4X62 L;  2AMC B;  2N49 A;  3U50 C;  1VQA A;  1N8R C;  3K8A A;  4HJ8 A;  4HJ9 A;  1YVC A;  2D0P A;  3AEV A;  1BBW A;  1LTL A;  1RIP A;  2F3I A;  1PH7 A;  4AIM A;  3SGI A;  1OTC A;  4L5R C;  1K9M C;  4JI5 Q;  4QL5 A;  1VQ7 A;  1EQQ A;  3KF8 B;  1YHQ A;  1X55 A;  1N9W A;  4JI3 L;  5C3E H;  4JV5 L;  1X3E A;  5E7N A;  4DV2 Q;  3KYH C;  5C3E G;  2C35 B;  1HR0 W;  2ZTD A;  1XNQ L;  2KBN A;  4UP9 A;  3ERS X;  2JEB I;  1FJG Q;  1S40 A;  5JJK A;  5M3M H;  1E1O A;  1KL9 A;  5M3M G;  1V43 A;  4IOA A;  3S15 H;  1J5E Q;  3HKZ G;  3ZJY C;  1VQI A;  1A62 A;  2UXB Q;  1BKB A;  4JI4 Q;  3D31 A;  4JC0 A;  4HID A;  2HHH L;  4IPH A;  4C3I H;  1C9O A;  1LM0 A;  1I94 L;  4KHP Q;  3RR5 A;  4PZ6 A;  3D0F A;  3M85 A;  4JOI A;  1XJV A;  2AWO A;  4JI5 L;  2QGQ A;  4GOP B;  4LF7 Q;  4NXM Q;  2RF4 A;  2R92 H;  4UY8 C;  5M5X H;  2UU9 Q;  2E2J H;  5GQO A;  4R4Q A;  4JI1 Q;  3S2H H;  4WJ3 M;  3S1Q H;  4LWC A;  1PA6 A;  4HIO A;  1D7Q A;  3F8T A;  1XPO A;  2NVT H;  1FJG L;  4A3I H;  1VQE A;  4A3D H;  1PHJ A;  4LF6 L;  2IX0 A;  4A3D G;  4DUY Q;  3KF6 A;  1Q82 C;  1PH8 A;  1CKO A;  1J5E L;  4DUZ L;  2OTJ A;  4DV3 L;  1VQ5 A;  4QIW E;  4GLX A;  2NVQ H;  3HOU H;  1HZA A;  1Y1V G;  4DPG A;  2EIF A;  3HOU G;  3CQZ H;  1PH6 A;  5GAH C;  2OCE A;  4LW1 A;  4JI7 Q;  3T1Y Q;  3I7F A;  1XPU A;  4WJ4 A;  4B3S L;  1YNX A;  5JEA J;  1MIU A;  5FJ8 H;  2D62 A;  4DV4 L;  2WFW A;  2ID0 A;  4GNX A;  1N36 Q;  4B3T Q;  1SFO H;  4LFA L;  1CKN B;  2I5L X;  3L0O A;  3H0G G;  4DUY L;  1PH9 A;  4DR7 L;  5IY0 A;  4BBR H;  1E24 A;  4DV0 L;  4LNQ A;  5H1S E;  2JA5 H;  1WJJ A;  3KJP A;  4PMW A;  1KQS A;  4QGU A;  4DK6 C;  1N32 L;  1DGS A;  1NY4 A;  2HIV A;  3JC6 6;  4LUO A;  1V1Q A;  4A3J H;  2R7D A;  1IL2 A;  1TWH H;  2RCN A;  3PV0 A;  4A3J G;  2UUB L;  2VUM G;  3KDF B;  2OWO A;  1G29 1;  1MJE A;  1UWV A;  3I4O A;  3PO3 H;  2DUD A;  1B7Y B;  3PO3 G;  5HGQ A;  1SMX A;  3S1N H;  3M3Y H;  3HOY H;  3RZD H;  2ZJQ A;  3HOY G;  1WFQ A;  1T9H A;  1VQL A;  2KCT A;  2LXJ A;  2VW9 A;  1QZG A;  2AKW B;  4GN4 B;  1AE2 A;  2VQE Q;  4LF8 Q;  4NXN Q;  2KCM A;  2A8V A;  3HOW H;  3PF4 A;  3HOW G;  1S3O A;  2PNH A;  3PO2 H;  3G48 A;  3PUW A;  4X66 Q;  3CPW A;  1Y1W G;  1XMO Q;  4LF5 Q;  2ASB A;  1SE8 A;  3HKS A;  1HZB A;  5LMU Q;  1VQ4 A;  4J15 A;  5IE8 A;  2K52 A;  1OXS C;  1IBK L;  4OX9 Q;  2NZO A;  1UE7 A;  1MJC A;  3BJU A;  4OWW B;  3ICE A;  4UP8 A;  3OTO L;  4JYA L;  5LMN Q;  1EIY B;  1KD1 C;  5M3F G;  2F52 A;  1VQP A;  3NEL A;  1A8V A;  3FKI G;  5C44 H;  5GAD C;  3PF5 A;  1HNZ L;  3RZO H;  4GLV B;  3ULP A;  1B70 B;  1M1K C;  2B63 H;  2EXD A;  3LGJ A;  4GOP A;  1KRT A;  3EBE A;  4JOI C;  1QVC A;  1VS0 A;  3CCL A;  1IBM Q;  1PH3 A;  1U5K A;  4LF4 Q;  4BBS G;  3CMA A;  2K5V A;  1W3S A;  1VQK A;  1PH5 A;  4B3R Q;  4IFD J;  4JCV E;  2ALY B;  4X62 Q;  5HY6 A;  4OWT B;  1Q1B A;  2MNA A;  4DV6 L;  3HOV H;  1SR3 A;  4GKK L;  4YWL A;  3CC4 A;  2CWP A;  3HOV G;  2MO1 A;  2JA6 H;  2B29 A;  2A19 A;  1PVO A;  3FP9 A;  2CQO A;  3GTO H;  4DR4 L;  3NBH B;  5IT9 c;  1N34 Q;  1PYS B;  4JG2 A;  4MTN A;  1OXV A;  4GKJ L;  4OON A;  4LFB Q;  4JI3 Q;  1I5F A;  3AYH B;  3TRE A;  2BH2 A;  1XNQ Q;  3GD7 A;  4LF4 L;  1YHA A;  1WCM H;  4K0K Q;  1JMC A;  1XNR L;  2E2I H;  1LUZ A;  3EIV A;  3STB C;  5LMN W;  1GM5 A;  3WWV A;  4GNX C;  3I56 A;  4YY3 L;  2HHH Q;  1Q86 C;  3ER0 A;  5EAY A;  1I94 Q;  1I3Q H;  4YWM A;  1P8L A;  5C0X J;  2MO0 A;  4MNO A;  3J7Z C;  1NMG A;  1WYD A;  2QA4 A;  4B3M L;  3HOZ G;  2WAQ E;  1N34 L;  1UE5 A;  3HOX G;  4ME3 A;  1VQM A;  4POG A;  2N8N A;  3J80 c;  2JJQ A;  4AQY L;  3F2B A;  4LFB L;  1PYB A;  3RLO A;  2LSS A;  5ELO A;  4K0K L;  1SLJ A;  3H15 A;  1EYG A;  3E9I A;  1ASY A;  2JEA I;  3FHW A;  4LF6 Q;  2GN5 A;  1YHB A;  4P75 A;  2QEX A;  2JA7 H;  1S72 A;  4DUZ Q;  4GN3 B;  4YCU A;  4DV3 Q;  2JA7 G;  4A3C H;  4A3C G;  3ULL A;  3CXC A;  2ZTE A;  2YTX A;  1K83 H;  5BR8 Q;  3KJO A;  2GVB A;  3I4M G;  4R1J A;  1VQ8 A;  1I6H H;  4B3S Q;  2NVY H;  3M4P A;  4IPC A;  3G6E A;  3B6Y A;  3CP0 A;  1CKM A;  1HJP A;  1RL2 A;  4DV4 Q;  1UE6 A;  2LXK A;  4LFA Q;  2UUC L;  4RMF A;  1NMF A;  4JBK A;  5C4X G;  1U0L A;  2Q2H A;  3I4N H;  4DR7 Q;  3I4N G;  3BZC A;  4OXP A;  3H3V I;  3J7A 5;  4DV0 Q;  4QJF A;  3CCQ A;  1XMQ L;  2CKZ B;  1Y1V H;  3NEN A;  4NPS A;  1B8A A;  2WAQ G;  1C7Y A;  5BR8 L;  2Z6K A;  4L5S A;  4AH6 A;  1N32 Q;  1X56 A;  5IP7 G;  1CSP A;  1JJG A;  1KXL A;  2JK8 A;  1FGU A;  3JAM i;  3CCR A;  2UUB Q;  4A4I A;  1YBY A;  3UDF A;  1QVF A;  1CSQ A;  2XTI A;  3PUX A;  4PZ7 A;  3RLN A;  1SRU A;  1XTD A;  3UDX A;  3H0G H;  3GTJ H;  2NZH A;  3UDG A;  1HNX L;  1L2F A;  4BY1 G;  1G6P A;  1L1O A;  1VQH A;  2MQH A;  3S1M H;  1KHI A;  2HT1 A;  2AWN A;  1PH4 A;  3PSI A;  4IFD I;  3A5U A;  1OXX K;  4A3F H;  4QY7 A;  4A3F G;  4APV A;  3PGZ A;  4JBW A;  2IY5 B;  3L7Z C;  2XGT A;  5IWA L;  3CCE A;  1Q7Y C;  3MEF A;  4BA1 I;  1X3G A;  4HJ5 A;  2VUM H;  2UXD L;  1UEB A;  3CCJ A;  1IBL L;  2UXC L;  1VQC A;  2ZJP A;  4IPD A;  1IBK Q;  2VZA A;  4LF9 L;  1O7I A;  1WI5 A;  3K7A H;  3S14 H;  3OTO Q;  3W1G A;  4JYA Q;  3KOJ A;  4LFC Q;  3CCU A;  3K7U C;  1Q46 A;  4X6A H;  2VL6 A;  4IJL A;  1HNZ Q;  2PI2 E;  2FXQ A;  2VQF L;  4JBM A;  4BY7 G;  3M4Q A;  1Y1W H;  2IX1 A;  4EQ5 A;  4A93 G;  3GTM H;  1XNR Q;  4JI2 L;  2JQO A;  3TEH B;  1EQR A;  1TWC H;  4YCV A;  2RHQ B;  3GTK H;  2KHJ A;  4DK3 C;  1PH1 A;  5C0X I;  3PUV A;  3TS2 A;  2RHS B;  3BZK A;  4A3M G;  4AYB E;  3DLL A;  4JI0 Q;  1A0I A;  1FVI A;  1GO3 E;  4C3J H;  3KLW A;  3S24 A;  2MFI A;  4LFC L;  5M3F H;  1YZ6 A;  4DV6 Q;  3M7N A;  1Y14 B;  3FKI H;  4DV5 L;  4GKK Q;  2GVA A;  1TXY A;  1FL0 A;  3CC2 A;  1X9N A;  2NVX H;  3J81 i;  4DR3 L;  1EIF A;  1K73 C;  3KFU A;  5IP9 H;  5JEA G;  3U58 A;  5IP9 G;  4R4C A;  2UUA L;  5DLQ E;  4P71 A;  1N33 Q;  1LYL A;  1K0R A;  4L5T A;  4BBS H;  4GKJ Q;  4DR2 L;  1JJ2 A;  4A3K G;  5AJ3 L;  2N78 A;  1D8L A;  1KIX A;  4JI6 L;  1HNW L;  4X65 L;  4FDB A;  3CCM A;  3CD6 A;  3GTQ H;  3A0J A;  4JI0 L;  3Q8D A;  5FLX c;  5IYD G;  4C2M H;  1TWA H;  4JI8 Q;  3J81 j;  3OW2 A;  3KF6 B;  4YY3 Q;  4OWX B;  3RN2 A;  3NEM A;  4IO9 A;  3E9H A;  3GDE A;  4DR4 Q;  4DR1 L;  4B3M Q;  4KI0 A;  1PH2 A;  2D0O A;  2ATW A;  3RLF A;  2Z6K C;  1Q8K A;  2VS1 A;  1N33 L;  1YJ9 A;  1X3F A;  4AQY Q;  4XIG S;  4AYB G;  1X6O A;  4IOC A;  1QUQ B;  1W2B A;  4DR6 L;  2B3G A;  4GNX B;  1SRO A;  1X54 A;  4ALP A;  1CKN A;  1HR0 Q;  2KHI A;  4DAY B;  3GTG H;  4DV7 L;  2L15 A;  4JI8 L;  1MKH A;  3RNU A;  2Q2T A;  5ELN A;  1BVS A;  1Q81 C;  4A75 A;  1L1O C;  1J6Q A;  4LUV A;  3F1Z A;  3HOZ H;  2BH8 A;  2R7F A;  1VCI A;  2BA0 A;  1IZ6 A;  3PIP A;  1TWF H;  3HOX H;  3T1H L;  2K5H A;  2ZTC A;  2Q2I A;  4P74 A;  4O0A A;  2YV5 A;  3K0X A;  3W5O A;  1JT8 A;  1EFW A;  4Y52 H;  3KDF A;  4MZ9 A;  2IHE A;  1K8G A;  4YHH L;  3S16 H;  2UUC Q;  5IYB G;  1HZC A;  1HR0 L;  4H02 A;  3PIO A;  1EOV A;  2PI2 A;  4X64 L;  1PV4 A;  2NN6 I;  4NB3 A;  2ZJR A;  2K75 A;  1XMQ Q;  3GTP H;  3CW2 C;  4A3L H;  1M90 C;  4A3L G;  4OO1 G;  2WB1 E;  4PZ8 A;  1OXU A;  1E7Z A;  5GAE C;  3CF5 A;  3I4M H;  3PUZ A;  3AFQ A;  1VQB A;  4L5Q A;  1VQF A;  1YJW A;  3G71 A;  2AHO B;  2IHF A;  4EX5 A;  3E0E A;  1JJC B;  2ZM6 L;  4A3G H;  4BXX H;  4IFD G;  4TQU S;  1Z47 A;  4A3G G;  4YWK A;  3S2D H;  2YTY A;  4POF A;  5C4X H;  4BXX G;  4GN5 A;  2E5L L;  1KAW A;  4R4T A;  2CFM A;  1HNX Q;  1IXR A;  1V9P A;  3VDY A;  3L2P A;  1YEZ A;  3PUY A;  4YCW A;  1HZ9 A;  1ASZ A;  3TRZ A;  2OQK A;  2WP8 J; 
#chains in the Genus database with same CATH topology
 5IWA Q;  3QOJ A;  2QDB A;  1BCP D;  1K8A C;  1KLG D;  5IGC A;  4HJ7 A;  1HTL D;  1NCV A;  4BY1 H;  3RZD B;  1IHZ A;  3A56 A;  4A3I G;  3VR3 A;  3BVG A;  2UXB L;  1OXT A;  1PFB A;  4XTC S;  4JI4 L;  4QQB X;  1NJI C;  2A69 C;  5C4J H;  4IJH A;  3J81 E;  3D3R A;  3TS0 A;  3G4S A;  2YU9 H;  1CUK A;  2DGY A;  4J8Q A;  3VR6 A;  2O4X A;  1EOT A;  4JI1 L;  1YNN D;  3CU7 A;  1Y8O B;  5HGT A;  1H95 A;  1CTM A;  2ENB A;  3BYY B;  2I0Q A;  2F4V L;  1G91 A;  2Q8T A;  1I4Q A;  1IYJ B;  5M5Y B;  4IUU A;  2R93 G;  3GQB A;  1KNE A;  3MZ5 A;  4TVA B;  2GA4 B;  2P5Z X;  5K36 G;  3U4Z A;  1HH2 P;  1NBW A;  2VY3 A;  3T1Y L;  1LTA D;  3NHH A;  1YJN A;  1WTQ A;  3L3O C;  3RUZ A;  5FLM G;  5AJ3 Q;  1T5E A;  1ROD A;  1HNW Q;  3AFP A;  3SK8 A;  1E22 A;  5KYI A;  1N36 L;  1A2T A;  2Z4I A;  5JOB A;  2K1B A;  1E1T A;  1LTG D;  4ID6 A;  1F2M A;  1GKH A;  4IPG A;  4DAV A;  2I5M X;  5JEA H;  1E3P A;  2VNU D;  4A3K H;  2OT2 A;  3UE0 A;  1LV9 A;  4C3H G;  1ILP A;  1YIT A;  1GUG A;  3A74 A;  4FF2 A;  1Y8N B;  2A6E C;  4LF8 L;  2L12 A;  3T1H Q;  3HFZ B;  2KUM A;  1XMO L;  3J81 c;  1TY0 A;  3I2Z A;  2IT1 A;  4PG3 A;  4YHH Q;  1FNU A;  2H5X A;  3QR8 A;  3TN2 A;  5CV9 A;  3IL8 A;  1Q1E A;  4O2D A;  3S15 B;  1UEA B;  2K5N A;  2XN9 C;  1PFS A;  1JE5 A;  4DA2 A;  3HKZ E;  1L0Y B;  4ZK9 B;  3H3V H;  2OQ0 A;  1G6Z A;  2F0J A;  3HP3 A;  2NVY B;  3W1B A;  2DNC A;  1CQF A;  2Q8I B;  1WTO A;  1I4X A;  1O78 A;  1WCM G;  4A3D B;  1TVX A;  4OO1 H;  2PW7 A;  3GV3 A;  4FNF A;  4RWS C;  2SNM A;  1BBW A;  2F3I A;  5CGK A;  3SGI A;  4RHR A;  3P75 A;  4QL5 A;  5CBA E;  1X55 A;  3HRZ C;  5C3E H;  4JV5 L;  1HCZ A;  5E7N A;  2ZTD A;  2Z1C A;  1FJG Q;  3GTJ B;  2LKV A;  3H0G B;  5JJK A;  5M3M H;  3ND9 A;  1V43 A;  3R2T A;  1Q90 A;  4G7H C;  2F0G A;  1VQI A;  1A62 A;  4JC0 A;  2A5H A;  4C3I H;  1LM0 A;  1SYG A;  3RR5 A;  3M85 A;  4LF7 Q;  4NXM Q;  3BDL A;  1EY9 A;  5M5X H;  1M4V A;  3S2H H;  5L37 A;  3F8T A;  1VF7 A;  1XPO A;  2NVT H;  1VQE A;  4RA8 A;  1Q82 C;  1PH8 A;  1J5E L;  1SYD A;  2K01 A;  1I4H A;  2F0V A;  1FD7 D;  1QE6 A;  1ESR A;  1HZA A;  3HOU G;  3HOW B;  2OCE A;  4LW1 A;  4JI7 Q;  1XPU A;  5JEA J;  1LAC A;  2F0T A;  1IKL A;  4DV4 L;  5J1Z A;  3GTK B;  1BOS A;  2WFW A;  1DYQ A;  2ID0 A;  4B3T Q;  5M3F B;  4DR7 L;  5DNF A;  4C1N K;  4DUY L;  1PH9 A;  5A2Q L;  5H1S E;  3AMU A;  1WJJ A;  4PMW A;  1KQS A;  2K7V A;  3BDO A;  4WFN 3;  1DGS A;  3R8B A;  4FP5 D;  2HIV A;  3JC6 6;  1YNJ C;  2R7D A;  1IL2 A;  4A3J G;  2O5J C;  1F2Z A;  2OWO A;  1G29 1;  2G9D A;  3I4O A;  3PO3 G;  5HGQ A;  3HOY H;  3RZD H;  1LT6 D;  3RD4 A;  1I4P A;  4F87 A;  1ET9 A;  1LT4 D;  4GN4 B;  3TP8 A;  3PF4 A;  1RF2 D;  1S5F D;  2PNH A;  5C5M A;  5LMU Q;  1EU3 A;  2K52 A;  4OWW B;  3ICE A;  4UP8 A;  4JYA L;  5LMN Q;  4FXK C;  2OF1 A;  1WTW A;  2RBM A;  3DUZ A;  1BBX C;  1IKM A;  3PF5 A;  5HUR A;  2PW5 A;  4GLV B;  1M1K C;  2B63 H;  1AW7 A;  1ZYR D;  3NK9 A;  1IBM Q;  3VYS A;  1I4R A;  2NTS A;  4BBS G;  2ICI A;  1CT1 D;  5I4D A;  1W3S A;  4B3R Q;  4NDX A;  2NZ1 D;  1R4P B;  2B2Y A;  1I4G A;  4F88 A;  4X62 Q;  1MSH A;  5HY6 A;  2JA7 B;  2MNA A;  4H44 C;  1EWC A;  4GKK L;  3HOV G;  1SYB A;  1EYA A;  2B29 A;  5C4H A;  1ENF A;  2KVM A;  3E0J A;  1CHQ D;  1A3V A;  1PYS B;  3VR4 A;  4I7Z C;  1I5F A;  3T56 B;  1F2Y A;  3DWA A;  5I9O A;  5LMN W;  1A3U A;  1VF5 C;  1II3 A;  2WAQ B;  3BG3 A;  1Z7T A;  2FMC A;  5EAY A;  1STN A;  3HOZ G;  2D2C C;  2RDH A;  1N34 L;  3NUC A;  1UE5 A;  3C2P A;  4XQN A;  2N8N A;  4Q5V A;  4KMU C;  3RLO A;  4K0K L;  1SSO A;  2EJG C;  3D4D A;  3H15 A;  4LF6 Q;  3VA7 A;  4KHV A;  4GN3 B;  4PV1 C;  4DV3 Q;  1UNS A;  3ULL A;  1X3P A;  3KJO A;  1QCB D;  2PZW A;  1VQ8 A;  2NVY H;  3K57 A;  3B6Y A;  3CP0 A;  3HEJ A;  1UE6 A;  1ICW A;  1O80 A;  2IJ0 A;  1VMP A;  1CHP D;  5E1F A;  2UUC L;  4RMF A;  1NMF A;  2KQ3 A;  2F0D A;  1TKW B;  5C4X G;  3I4N H;  2C5C A;  1RD9 D;  3H3V I;  2J4X A;  4DV0 Q;  2CKZ B;  1O7Z A;  4BY7 B;  1PZI D;  2B2U A;  5IOD A;  5IP7 G;  1CSP A;  1TS4 A;  3NXW A;  5F2D A;  1SMY C;  3JAM i;  1EYD A;  2UUB Q;  1R4Q B;  2FJ2 A;  1CSQ A;  1C4Q A;  2B8G A;  3K58 A;  3K5O A;  3GTJ H;  3H0G H;  5J22 A;  2MQH A;  2CW0 C;  5J39 A;  1KHI A;  1S5B D;  4HSV A;  5KYL A;  2I46 A;  2SDF A;  3A5U A;  4QF4 A;  1VMC A;  4A3F G;  5IWA L;  2F3V A;  4HJ5 A;  1X3G A;  1UEB A;  2IX3 A;  2A6E D;  2VZA A;  3GTQ B;  1PRT B;  3C1E A;  1BCP B;  4QMG A;  3W1G A;  2D9U A;  2R61 A;  2QEJ C;  3M4Q A;  3J80 E;  1TS2 A;  3T53 B;  2JQO A;  3QOL A;  3OWE B;  2RHQ B;  4YCV A;  3GTK H;  5JPN C;  2ZXO A;  1DOL A;  1E2Z A;  4KJO A;  3DLL A;  3TZU A;  4C3J H;  5M3F H;  3KLW A;  4DV6 Q;  1Y14 B;  3AB9 A;  1Q3L A;  1LO5 D;  1AEX A;  3M7G A;  1FL0 A;  2KEE A;  4RH6 A;  2WKD A;  4R9W A;  5FO7 B;  1PTO C;  4K5W A;  4R4C A;  4P71 A;  4L5T A;  3VYR A;  5LL6 X;  1GUN A;  2K32 A;  4MN3 A;  5AJ3 L;  1HNW L;  1KIX A;  3CCM A;  3S17 B;  3A0J A;  4JI0 L;  2IW3 A;  5IYD G;  1KTK A;  1HQR D;  4XDX A;  3ZYY X;  1GUW A;  2AQ3 B;  4B3M Q;  3SHL A;  3RLF A;  4OGQ C;  2FIN B;  5DAU A;  1YJ9 A;  4XIG S;  4HMI A;  4AYB G;  5I6Y A;  4IOC A;  1QUQ B;  1W2B A;  4FF4 A;  4GNX B;  1SRO A;  4ALP A;  2L4N A;  2KHI A;  2L15 A;  1IW7 D;  4ZQ3 A;  5ELN A;  1Q81 C;  2WIN B;  3F1Z A;  2CQA A;  4FXD A;  2BA0 A;  1H9S B;  3T1H L;  2R92 B;  4P74 A;  2YV5 A;  3K0X A;  3P1H A;  4Y52 H;  1XYI A;  2EY6 A;  2IHE A;  3EFX D;  3GV6 A;  4YHH L;  3S16 H;  1S4Z A;  2F0E A;  2WB1 B;  4G7Z C;  5IYB G;  3DWP A;  1JIC A;  4H02 A;  5CBE E;  1UAP A;  3PIO A;  2PI2 A;  5BN4 A;  2EJF C;  1PV4 A;  2NN6 I;  3NBI A;  5EPK A;  1M90 C;  1HUM A;  4A3L G;  2NB0 A;  3CF5 A;  2QCP X;  4L5Q A;  1VQB A;  1FNW A;  3OPO A;  1YJW A;  2AHO B;  1D5X C;  1H9M A;  2E74 C;  1ESF A;  3KLS X;  4EGV A;  4A3G G;  2YTY A;  1HQM C;  2NWG A;  2LFN A;  2F0O A;  1V9P A;  1YNJ D;  2RSN A;  3L2P A;  1YEZ A;  5COY A;  1HZ9 A;  1TR5 A;  4DFA A;  4HSP A;  2QW7 A;  2EJM A;  5J3B A;  1HFN A;  2Y0S B;  3F2C A;  1IBL Q;  4GOP C;  3IRB A;  1I6V C;  1X65 A;  2E2H H;  1DON A;  3D4W A;  4I65 A;  3M3Y B;  1BF4 A;  3JAM L;  3UE1 A;  2F0S A;  1NSN S;  2XIW A;  1EEI D;  2V1C C;  2VQF Q;  1EY4 A;  5JPM C;  4DV1 Q;  1BO0 A;  2B2W A;  2EPB A;  5E4W C;  3RN5 A;  4LF7 L;  5CV5 A;  4NXM L;  1YIJ A;  4DR5 L;  3BVM A;  2PQA B;  1EZ6 A;  1K28 A;  4A3E G;  1QUQ A;  1B9M A;  4LUZ A;  3O13 A;  3FPU B;  3LNN A;  4DV5 Q;  2R93 H;  4ZCK A;  3SR1 A;  2JA8 G;  3CKI B;  4HCS A;  4BY7 H;  1R9T H;  2EOT A;  2BA1 A;  4A93 H;  2Q2U A;  5K36 H;  1H9S A;  4JBJ A;  2UUA Q;  1KRS A;  4JI7 L;  2L9H A;  3CCS A;  5FLM H;  1XPR A;  1A3T A;  5BN5 A;  4X65 Q;  4M1U B;  4B3T L;  3CPF A;  2J7Z A;  1LTT D;  1NAP A;  3CC7 A;  1LLR D;  2K5W A;  2EE1 A;  2PMZ B;  2LY7 A;  3DMU A;  3M4O H;  1STG A;  1A6X A;  4CJ2 C;  1DXM A;  3TP7 A;  3NTI A;  4DR6 Q;  2HIX A;  4KY5 A;  4C3H H;  4R8N A;  1CI3 M;  1NTG A;  1JB7 A;  1VQD A;  4UHV A;  3A54 A;  4UAI A;  1KLU D;  4DK1 A;  3K81 C;  1CM9 A;  2JA9 A;  5C44 G;  4Z9C B;  1EFI D;  1GXD C;  4OEM B;  2RCF A;  5C3E B;  1JCK B;  5LMU L;  1MBY A;  1SND A;  5KEE A;  5I6W A;  3AQQ A;  4BWG B;  5M3M B;  4X64 Q;  1B44 D;  1L1O B;  3S1R H;  5LMN L;  1CA6 A;  3RMH A;  3ITP A;  2E76 C;  2WV6 D;  3SDZ A;  1U4P A;  5M9O A;  3WOE A;  4O1N A;  5M5X B;  2ZM6 Q;  3S2H B;  2KCN A;  1GHJ A;  3I3C A;  2PQA A;  4XT1 B;  1IBM L;  2A68 C;  2Z4H A;  3H91 A;  2E5L Q;  4A3B G;  4B3R L;  3S17 H;  1SN8 A;  3BS1 A;  4NW2 A;  4X62 L;  1SMY D;  2AMC B;  2N49 A;  3EA6 A;  2XNA C;  1N8R C;  3K8A A;  4HJ8 A;  4HJ9 A;  1YVC A;  3L9A X;  4CBV A;  4DK0 A;  3J7A V;  1LTL A;  1FGB D;  4IQZ A;  2WAC A;  3MC0 B;  4IAL A;  1K9M C;  4JI5 Q;  1VQ7 A;  1JB3 A;  2CW0 D;  4JK1 C;  3I72 A;  1N9W A;  2TMP A;  4WJW A;  1X3E A;  4G57 A;  4DV2 Q;  4DN4 M;  3HGB A;  2KBN A;  1S40 A;  1KL9 A;  1PRT F;  3HKZ G;  3ZJY C;  3S1M B;  1BCP F;  1D5Z C;  1BKB A;  5ISR A;  2MUY A;  4IPH A;  4N8F A;  3MEH A;  4PZ6 A;  4WOR A;  4PMC A;  3DHQ A;  4JOI A;  1PRT D;  2OXP A;  2RF4 A;  2R92 H;  1MI2 A;  4K2L A;  2VUM B;  2UU9 Q;  5CYU A;  4WJ3 M;  4FF3 A;  3S1Q H;  2QKI C;  4LWC A;  1PA6 A;  1D7Q A;  3HOY B;  5D3D A;  3S14 B;  4LF6 L;  2DJF C;  2IX0 A;  2R3Z A;  3R2I A;  3KF6 A;  5C0X H;  3X3N A;  4DV3 L;  2F0F A;  4GLX A;  2NVQ H;  3HOU H;  1Y1V G;  1Y1W B;  3GTM B;  3I7F A;  1YNX A;  1MIU A;  5FJ8 H;  3V96 A;  2PCF B;  4ZRZ A;  4JW0 A;  2A74 C;  5DEH A;  3DXJ C;  2G5D A;  4BBR H;  3FKI B;  4DV0 L;  4JVZ A;  2JA5 H;  3KJP A;  4QGU A;  1SJH D;  2B63 B;  4CGY B;  1NY4 A;  2KED A;  4A3J H;  1XTC D;  2RCN A;  3CRL C;  2UUB L;  3KDF B;  1MJE A;  1L0X B;  1Y8P B;  3BYT B;  3D6C A;  3PO3 H;  3S1N H;  3QJY A;  5ELD A;  3M3Y H;  2ZJQ A;  1WFQ A;  1VQL A;  2AUJ D;  1QZG A;  2VQE Q;  4NXN Q;  3K5M A;  3PO2 H;  5T1I A;  3CPW A;  4LF5 Q;  4XYO A;  2ASB A;  5EPL A;  3HKS A;  1VQ4 A;  2Q8R E;  4J15 A;  4KD4 A;  1ONL A;  1STA A;  4OX9 Q;  2NZO A;  1MJC A;  2B2V A;  1KD1 C;  5FLX L;  4C56 C;  3NEL A;  3BZD B;  3MAQ A;  4L8J A;  3Q23 A;  3RZO H;  3ULP A;  1B70 B;  1TWF B;  1XXG A;  3HOX B;  2WII B;  3LGJ A;  1KRT A;  2JSO A;  1QG7 A;  3MFG A;  4DNT B;  1PH3 A;  2XWJ B;  1LT3 D;  1Y69 U;  2K33 A;  4HCE A;  1PH5 A;  1VQK A;  3IAY A;  4IFD J;  1RCV D;  3N6R A;  2ALY B;  1Q1B A;  3IFD A;  4DV6 L;  3HOV H;  2JA6 H;  1GJX A;  2A19 A;  1PVO A;  3S9W A;  1HA5 A;  3V2T A;  2CQO A;  3GTO H;  1AFP A;  2PO4 A;  4JG2 A;  4JI3 Q;  3VYU A;  2BH2 A;  1STY A;  5EKL A;  1YHA A;  3I91 A;  4LF4 L;  4CDF C;  3I4N B;  4U68 A;  2X69 A;  3I56 A;  2F4I A;  2HHH Q;  1PLF A;  1Q86 C;  1I94 Q;  1AP0 A;  1I3Q H;  2N88 A;  1P8L A;  5C0X J;  2MO0 A;  4B3M L;  2K04 A;  2WAQ E;  4ME3 A;  4LFB L;  2LSS A;  4B08 A;  2GN5 A;  2QEX A;  4HAE A;  1S72 A;  2F0L A;  4A3C G;  1KAB A;  2GVB A;  3I4M G;  3IFT A;  3ERO A;  3MXP A;  4IPC A;  2EDG A;  3R3O A;  1CKM A;  1RL2 A;  5EQ0 A;  3PIO 3;  1RDP D;  1H9K A;  5K5P A;  2LXK A;  1J9O A;  4LFA Q;  2Q2H A;  1K3B C;  5DM7 3;  2CH4 A;  3OSO A;  4CHT B;  1C7Y A;  1T5X D;  5BR8 L;  2Z6K A;  2KA7 A;  3A8J E;  4YIJ A;  2F0W A;  4A4I A;  5EBD A;  4MIU A;  3HG9 A;  4A3M B;  5FK9 C;  3PUX A;  4PZ7 A;  1XTD A;  5EPJ A;  3TME A;  4C3J B;  3UDG A;  4BY1 G;  1G6P A;  2B2Y C;  3S1M H;  4CDC C;  3P7J A;  1RHP A;  4LMQ D;  1EZ8 A;  1PH4 A;  4IFD I;  1OXX K;  4A3F H;  3OHX C;  4FXG C;  3D4R A;  2IY5 B;  2XGT A;  2V4D A;  3T4A C;  1Q7Y C;  3MEF A;  2M2L A;  5C3W A;  2VUM H;  3ONA B;  1SE4 A;  1IBL L;  1VQC A;  5KNB A;  5CV4 A;  1IBK Q;  2DY7 A;  1O7I A;  1X3Q A;  4X3S A;  5IGG A;  3S14 H;  2L5T A;  3KOJ A;  1NUC A;  1HUN A;  3K7U C;  1Q46 A;  5I2X A;  2VL6 A;  4IJL A;  2PI2 E;  2FXQ A;  2VQF L;  4JBM A;  1PZK D;  1Y1W H;  4DNR B;  3GTM H;  3SK5 A;  3TEH B;  1EQR A;  5I9P A;  3TBI B;  5C0X I;  3PUV A;  5LL6 S;  1LTI D;  1U4L A;  1A0I A;  1GO3 E;  3KLS A;  4LFC L;  3EVQ A;  3FKI H;  4DV5 L;  4CKB A;  2DN8 A;  2JP1 A;  4B9W A;  3CC2 A;  3K6O A;  1EIF A;  3KFU A;  5JEA G;  1XNR L;  5IP9 G;  2UUA L;  5DLQ E;  1LYL A;  1K0R A;  1V1O A;  3S16 B;  4A3K G;  4X65 L;  3K59 A;  3CD6 A;  3MWY W;  3QB3 A;  2L11 A;  2FMM A;  1KDB A;  1TWA H;  4JI8 Q;  2BCO A;  3DWQ A;  3OW2 A;  4YY3 Q;  3RN2 A;  3NEM A;  4CJ0 B;  3E9H A;  3GDE A;  5IGB A;  4DR4 Q;  5CV7 A;  3P20 A;  3D8G A;  4KI0 A;  1PH2 A;  2B2U C;  1Q8K A;  2VS1 A;  4XQQ A;  5KIX A;  1N33 L;  3TSS A;  1X3F A;  4AQY Q;  1TII D;  3SK6 A;  3DEP A;  4HMJ A;  4HN7 A;  5C6A A;  4DR6 L;  1X54 A;  1HR0 Q;  4DAY B;  3RNU A;  2AQ2 B;  1LTR D;  2Q2T A;  1BVS A;  4A75 A;  4IZ8 A;  1J6Q A;  4LUV A;  2IWH A;  2BH8 A;  2R7F A;  1IZ6 A;  1TWF H;  3HOX H;  5IIF A;  1EY0 A;  4O0A A;  3W5O A;  4NP5 A;  1K8G A;  2A69 D;  4L6T B;  4K2K A;  2E2H B;  1EOV A;  4X64 L;  1BDO A;  1PMR A;  3PIP 3;  1XMQ Q;  4A3L H;  1ILQ A;  4OO1 G;  2WB1 E;  4PZ8 A;  2KOL A;  1TT2 A;  2PZU A;  3AFQ A;  1MSG A;  4LK1 C;  2PPB C;  4ZAI A;  2XRS D;  2IHF A;  4EX5 A;  3E0E A;  2ZM6 L;  1SE3 A;  4A3G H;  4BXX G;  4KN7 C;  5D65 A;  2E5L L;  2O2L D;  2A73 B;  3TRZ A;  2R93 B;  3J7A F;  3TP5 A;  3DM1 A;  1R9T B;  4A93 B;  2BDN A;  4DAM A;  4C3I G;  3ERQ A;  3U4V A;  3I55 A;  1TWH B;  4OO1 I;  3Q24 A;  4DV2 L;  2R6G A;  2EYL A;  2Y0S E;  3A7L A;  3QG1 A;  2F4V Q;  1EY8 A;  2R7Z G;  1SE2 A;  1HA6 A;  3M4O B;  4QCL A;  5E3F A;  2CWA A;  1A63 A;  1GVP A;  2ZT9 C;  1DCZ A;  2YYZ A;  1QOH A;  1Z9F A;  3MFY A;  4K6L A;  4JI2 Q;  2F0Q A;  4N8X 1;  4N9T A;  2UU9 L;  4A3E H;  4H0L C;  1G51 A;  3NE5 B;  4KLK A;  1B9N A;  3NWT A;  5D3I B;  1WOC A;  3JAM c;  3Q22 A;  1M8A A;  4C3H B;  3A8I E;  4DAY A;  4KHZ A;  1FYC A;  1RTN A;  3TDQ A;  3VR2 A;  3I73 A;  2JA8 H;  5M5W H;  4HIM A;  4P73 A;  2CCZ A;  2NUC A;  1AH9 A;  4KY7 A;  3SXH A;  3NSW A;  4A3M H;  4H13 C;  3I4L A;  2RQX A;  3S1R B;  1YI2 A;  1VQ6 A;  4HIK A;  1PTO B;  4K8J A;  2F0P A;  2J0T D;  1C0A A;  5KRU A;  4Y7N H;  2RSO A;  2PYK A;  2PMZ E;  2YTV A;  2N55 A;  1WCM B;  3CHB D;  2Z0S A;  2E2I B;  4DV7 Q;  2HQL A;  5ELB A;  5GAG C;  4R4I A;  4UP7 A;  3BU2 A;  3AU7 A;  3F2D A;  4I7A A;  3GO5 A;  3M9B A;  4E6I A;  2VQE L;  4NXN L;  1YNN C;  2K4K A;  3K0Y A;  2F0K A;  3CME A;  2PQE A;  2NN6 G;  1IYU A;  2B63 G;  4LF5 L;  3ULJ A;  1F9P A;  5IYC G;  3GTL H;  2ES2 A;  1AE3 A;  1CFM A;  1QB5 D;  2EYH A;  4OX9 L;  4BA2 I;  3MXG A;  4UPA A;  1JWU D;  2EY5 A;  4RG1 A;  5JJI A;  3MXN B;  1EIH A;  5KGU A;  4DKA C;  5JJL A;  4KD3 A;  1UE1 A;  3J80 i;  3A8K E;  3EN2 A;  1JOO A;  1I6H B;  4F7X A;  2C9O A;  3S1Q B;  4JV5 Q;  3DM3 A;  4A3B H;  1JC7 A;  2KEC A;  2BOS A;  3U50 C;  2XWB B;  1IYV A;  2CVR A;  3HOU B;  2NVQ B;  5JJZ A;  2K5D A;  4ZLT F;  1OTC A;  4L5R C;  2HDM A;  4M8A A;  3KF8 B;  1YHQ A;  3V05 A;  3MXU A;  5AFW A;  4JI3 L;  1CA5 A;  2C35 B;  2VXW A;  2B2T A;  3ERS X;  4IUR A;  1E1O A;  4IOA A;  4BBR B;  1J5E Q;  2JA5 B;  3D31 A;  2HHH L;  1C9O A;  4RCN A;  1I94 L;  4KHP Q;  3M4Y A;  3D0F A;  1XJV A;  2AWO A;  2QGQ A;  4GOP B;  4A3J B;  5GQO A;  1JE4 A;  4CDD C;  1DJR D;  3PO3 B;  3S1N B;  4C1N I;  1FJG L;  4QIW B;  5T1G A;  4A3I H;  1PHJ A;  4A3D G;  3HZX A;  5ELC A;  4DUY Q;  1CKO A;  3SE0 A;  4XYQ A;  4L63 B;  1VQ5 A;  3KK7 A;  1S5C D;  2JYO A;  4DPG A;  2EIF A;  1PH6 A;  3PO2 B;  1EY6 A;  4RKL A;  3OMC A;  1H9J A;  1D2B A;  3PQI A;  1WTV A;  1XWE A;  1JOK A;  3H6M A;  4GNX A;  1WVL A;  4LFA L;  1CKN B;  2ICE C;  3L0O A;  3H0G G;  2MPM A;  5IY0 A;  1BQQ T;  3FDT A;  3MXN A;  3RZO B;  4Q0F A;  1O7L A;  4R8I A;  4RGN A;  1V8Q A;  1C48 A;  4LUO A;  4UDU C;  1EQT A;  1TWH H;  3PV0 A;  1UWV A;  3Q6S A;  2JN4 A;  1H9R A;  3HOV B;  4ZYS A;  2FFK B;  2KCT A;  3W3A A;  2VW9 A;  4RCO A;  2JA6 B;  5KND A;  1AE2 A;  3GTO B;  2A8V A;  3HOW G;  1S3O A;  3G48 A;  3PUW A;  4X66 Q;  3KF8 A;  1SE8 A;  5FKA C;  1AZP A;  1DD2 A;  4DXG A;  2SOB A;  5IE8 A;  3J7Y W;  1IBK L;  1U9R A;  3GTG B;  4XQJ A;  1SDF A;  5M3F G;  2F52 A;  1QNK A;  1I3Q B;  5GAD C;  3KBX A;  4RGM A;  2EXD A;  4KKS A;  1NR4 A;  4GOP A;  3H3V C;  4JPB W;  4JOI C;  1QVC A;  1VS0 A;  4QUC A;  5IT9 L;  3CCL A;  5CV6 A;  1S5E D;  2E2D C;  4JCV E;  4B9X A;  3GTP B;  2ZXR A;  1EL0 A;  1SR3 A;  2CWP A;  1PTO H;  3H09 A;  5EGT A;  1F9S A;  1F2L A;  2ZXP A;  4U67 3;  5C4Z A;  3NBH B;  1D6E C;  1N34 Q;  5COR A;  4MTN A;  1OXV A;  1SBB B;  1MHW C;  3TRE A;  3S2D B;  1XNQ Q;  3J80 L;  5C4X B;  1WCM H;  4K0K Q;  1B1Z A;  2XSC A;  2Z9H A;  2HCI A;  2E2I H;  3STB C;  1W6J A;  2H4O A;  3WWV A;  4OEL B;  4YY3 L;  3ER0 A;  4DR4 L;  2QA4 A;  1NMG A;  4OIK A;  1VQM A;  4POG A;  4AQY L;  2JJQ A;  3F2B A;  5A35 A;  4OHJ A;  5A2Q E;  1SLJ A;  1EYG A;  3E9I A;  3KUP A;  2JEA I;  3FHW A;  1ML0 D;  1ENC A;  1ZYR C;  4FYD A;  3VA5 A;  4J6H A;  4DUZ Q;  4YCU A;  5DM6 3;  4HED A;  2JA7 G;  4A3C H;  1D5M C;  1SYE A;  3CXC A;  4A3F B;  2YTX A;  1K83 H;  4TSS A;  2MJ8 A;  1A2U A;  5IGD A;  1I6H H;  4B3S Q;  3M4P A;  1TQO A;  1STH A;  3NTH A;  1Z6H A;  1U0L A;  3J7A 5;  5CR3 A;  3CRK C;  1XMQ L;  4QJF A;  3I70 A;  3EJI A;  1B8A A;  2WAQ G;  2B2V C;  4L5S A;  1N32 Q;  2I07 B;  3NP8 A;  1PTO F;  4X3T A;  1DM0 B;  4ILW A;  1JJG A;  2JK8 A;  3CCR A;  2F0U A;  1YBY A;  5EBC A;  3UDF A;  1QVF A;  3RLN A;  2XTI A;  1PTO D;  5FO8 B;  3UDX A;  2NZH A;  1L2F A;  1L1O A;  1B53 A;  1G2T A;  1VQH A;  2RVL A;  3PSI A;  4S3S A;  3QWN A;  3PGZ A;  4JBW A;  3NBH A;  3CCE A;  4BA1 I;  1OO9 B;  1RTO A;  1F77 A;  4RGT A;  5FO9 B;  4DGZ A;  4IPD A;  4EQO A;  1NNX A;  3K7A H;  1TWA B;  4KK7 A;  3OTO Q;  1B3Q A;  2B39 A;  2TSS A;  4HR7 B;  4X6A H;  1STB A;  4K5V A;  5C3X A;  1HNZ Q;  4KKT A;  4BY7 G;  4RFB A;  2IX1 A;  2EVB A;  4A93 G;  4AYB B;  4JI2 L;  1WTX A;  3MTS A;  1GUT A;  2KHJ A;  3SEB A;  4DK3 C;  2RHS B;  3HS0 C;  3C3L A;  1KAA A;  4JI0 Q;  1FVI A;  3S24 A;  2EY2 A;  3M7N A;  1V1P B;  3K5L A;  2NVX H;  3J81 i;  5CMD A;  1K73 C;  2K03 A;  5I2Y A;  5IP9 H;  3U58 A;  4GKJ Q;  1TU2 B;  3FPP A;  4BBS H;  2KJX A;  1O7Y A;  4IUP A;  1PYW D;  1D8L A;  1UUP A;  4FDB A;  5TSS A;  1TWG B;  3OIP A;  1PDQ A;  1GOZ A;  3F2U A;  4ME5 A;  1TS3 A;  1JWS D;  4X3K A;  1QWY A;  2QF7 A;  2EYF A;  2Z6K C;  4PQX A;  4A3G B;  2HDL A;  1GUO A;  1X6O A;  1E2W A;  3GTG H;  3VR5 A;  5LHY 1;  2RKS A;  4DF7 A;  4DV7 L;  2X6L A;  1MKH A;  1GHK A;  3T13 A;  4RGO S;  3HOZ H;  2HD3 A;  2XVS A;  2K5H A;  2ZTC A;  2FHT A;  2Q2I A;  1JT8 A;  4F8M A;  1EFW A;  2E2J B;  3KDF A;  4MZ9 A;  3TZD A;  4K6D A;  1HZC A;  1JR0 D;  2BE5 C;  4IUQ A;  4NB3 A;  2EYJ A;  2K75 A;  1SNQ A;  3GTP H;  3CW2 C;  3BDC A;  5CC4 A;  4QUF A;  2F0M A;  2BDO A;  2OEO A;  1BXT A;  1ZKO A;  3CQZ B;  3FRP B;  1JJC B;  4A3E B;  1WTP A;  4BXX H;  4IFD G;  1Z47 A;  3S2D H;  5NUC A;  3IKJ A;  5C4X H;  4GN5 A;  2AUK A;  2CFM A;  1SFO B;  1HNX Q;  2JA8 B;  1B2T A;  1V1P A;  3PUY A;  4YCW A;  1ASZ A;  4EQN A;  5M5W B;  2WP8 J;  3SVM A;  5IP7 H;  1VQJ A;  2UXD Q;  4IUV A;  4DR5 Q;  4V19 0;  2UXC Q;  4DAP A;  2R92 G;  1IW7 C;  2SEB D;  4LF9 Q;  1P16 A;  2G9H D;  1Q12 A;  1ZXT A;  3N52 A;  4LJZ C;  2E8G A;  2WB1 G;  4G4K A;  4K8I A;  2L1B A;  2K50 A;  2R7Z H;  1EWI A;  2I5H A;  4GLA C;  5C0X G;  1QZH A;  3T16 A;  4Y7N B;  5D14 A;  1MGS A;  4KHP L;  1GD7 A;  4HJA A;  2MP1 A;  4N9P A;  4GS3 A;  1NE3 A;  1EUJ A;  3G6J B;  1KDC A;  4RAU C;  2PNR C;  5FJ8 G;  1BBU A;  3UDI A;  2OTL A;  1VQN A;  4BBR G;  5C44 B;  4CKE A;  1EYC A;  1I50 H;  2HQE A;  3A55 A;  2JE6 I;  4DV1 L;  2JA5 G;  1X32 A;  3PCO B;  5FOB B;  2F0H A;  3FMC A;  4DR3 Q;  2K05 A;  1B50 A;  3GTL B;  2F0I A;  4DR2 Q;  1PFN A;  2Y0S G;  2N3S A;  1LAB A;  3FVQ A;  4JI6 Q;  2O5I C;  1HPC A;  1EIG A;  2NYZ D;  2D5D A;  3QO2 A;  3X3M A;  2A68 D;  5GRO A;  4P72 A;  4A76 A;  4DR1 Q;  3CAM A;  5IGE A;  3K5N A;  3K80 C;  3STB D;  4V0B A;  3MA2 B;  3PO2 G;  1E2V A;  1KC8 C;  2KEN A;  4A3B B;  3J81 L;  5IYD H;  5ELF A;  2H1E A;  1QVG A;  3CCV A;  1K3R A;  5M5Y H;  3G7L A;  2XRQ D;  1VQ9 A;  2NN6 H;  3W2D A;  3OYY A;  1W6K A;  2QDL A;  4P2C B;  4X66 L;  1ET6 A;  5IYC H;  1K0S A;  1NR2 A;  3U9O A;  2A1A A;  3A5Z B;  3HKZ B;  3TQY A;  2KHS A;  1CZW A;  2HUG A;  1HFG A;  2M00 A;  3BVZ A;  1JOR A;  2EYP A;  2JA6 G;  2JXM B;  1VQO A;  1XX8 A;  4IUN A;  1U4M A;  2HCC A;  4DNI A;  2EYO A;  3JAM E;  1ENA A;  1MD2 D;  3LWU A;  3VYT A;  2K5Q A;  5IYB H;  2EQS A;  3E3X A;  1L0W A;  1VQG A;  4RHS A;  4A3I B;  2EZV A;  4ZKC B;  1C8C A;  2K14 A;  3D6W A;  1TWG H;  4R4O A;  1VQA A;  1Y1V B;  2D0P A;  2RDG A;  3AEV A;  1RIP A;  2PZT A;  1IL8 A;  1PH7 A;  4AIM A;  4XXE A;  2IPK D;  3I8Z A;  2EXZ A;  1EQQ A;  1CQV A;  4LAA A;  1FR3 A;  1HR0 W;  3KYH C;  5C3E G;  5JVH 3;  1XNQ L;  2F0N A;  4UP9 A;  2JEB I;  1VDZ A;  2RA4 A;  4KJN A;  5M3M G;  3S15 H;  2UXB Q;  5JVG 3;  2IL8 A;  3NTK A;  4NKL A;  4JI4 Q;  2F3W A;  4HID A;  1LTS D;  1TY2 A;  2LMC B;  4JI5 L;  4KKU A;  3SK4 A;  4UY8 C;  2E2J H;  4R4Q A;  4JI1 Q;  3DEO A;  4HIO A;  4H7B A;  3UI2 A;  4A3D H;  1Q8I A;  4IN3 A;  1U4R A;  3WOF A;  1CK1 A;  2OTJ A;  4DUZ L;  4OIJ A;  4QIW E;  1EEF D;  5EJW A;  4MHE A;  3CQZ H;  4CKC A;  5GAH C;  4ZUI A;  3T1Y Q;  1CZG A;  4WJ4 A;  1TWC B;  4B3S L;  4DU9 A;  2D62 A;  4J1M A;  4FVM A;  1N36 Q;  1SFO H;  1F9Q A;  3C46 A;  2I5L X;  1SYF A;  1KNA A;  4ZUJ A;  1E24 A;  2A6H C;  4LNQ A;  4DXF A;  2EYM A;  1GUS A;  1LTB D;  2X6G A;  1RJT A;  3TP6 A;  4DK6 C;  5IT9 E;  1N32 L;  1DZ1 A;  1G8Z D;  2F1M A;  5EKI A;  1V1Q A;  4TRD A;  4BS9 A;  2VUM G;  1EWH A;  1A15 A;  1EQV A;  1B7Y B;  2DUD A;  1SMX A;  3HOY G;  4C2M B;  1PRT C;  1T9H A;  2LXJ A;  1BCP C;  2AKW B;  3I90 A;  4LF8 Q;  2KCM A;  3R93 A;  3HOW H;  1Y1W G;  1XMO Q;  1HZB A;  3OOC A;  2M9V A;  2E75 C;  2B8F A;  1OXS C;  1RKN A;  1UE7 A;  3BJU A;  3E5S A;  2B2T C;  4ZKB B;  3OTO L;  2NBF A;  1EIY B;  3MVV A;  1HHV A;  1VQP A;  1A8V A;  3FKI G;  5C44 H;  1KDA A;  1HNZ L;  4ABN A;  2BE5 D;  1SNM A;  3GP7 A;  1DOK A;  3EBE A;  4KV6 A;  5KNC A;  1U5K A;  4LF4 Q;  3CMA A;  2K5V A;  3QIA A;  1HXY D;  4OWT B;  5JAV A;  1E0B A;  2VB2 X;  4YWL A;  3CC4 A;  1K83 B;  3I4M B;  2MO1 A;  3FP9 A;  3OIQ A;  5IT9 c;  4WRD A;  1K8O A;  2B2W C;  4GKJ L;  4OON A;  4LFB Q;  4GZY C;  5CV8 A;  3AYH B;  3GD7 A;  1JMC A;  3T51 B;  1LUZ A;  3EIV A;  1GM5 A;  5ELE A;  4GNX C;  1WD0 A;  3NQI A;  1JQY D;  4YWM A;  4MNO A;  3J7Z C;  1WYD A;  2DY8 A;  3HOX G;  3J80 c;  5E4X A;  1PYB A;  1BR9 A;  5ELO A;  1D1K A;  1ASY A;  1QNU A;  4X3U A;  4BY1 B;  1PXU A;  1YHB A;  4P75 A;  4EVO A;  1LT5 D;  4KTA A;  2JA7 H;  2ZTE A;  5BR8 Q;  5C4J B;  4R1J A;  4FO2 A;  4PMB A;  2YU9 B;  3G6E A;  4DV4 Q;  1HJP A;  2CH4 W;  1J8I A;  1BUV T;  2K28 A;  2L55 A;  3K7A B;  2MGS A;  1S5D D;  4JBK A;  2KCC A;  1WTH A;  4FF1 A;  5EKK A;  4DR7 Q;  1ICF B;  3NPP A;  3BZC A;  4OXP A;  3I4N G;  1SYC A;  3CCQ A;  1Y1V H;  3NEN A;  4NPS A;  4AH6 A;  1X56 A;  4NMZ A;  2QIL A;  1KXL A;  1FGU A;  2K6A A;  2NTT A;  5FLX E;  1SRU A;  4IUT A;  1HNX L;  1HTP A;  1SXT A;  3LWE A;  2HT1 A;  2AWN A;  2NVX B;  2RDF A;  4KY6 A;  3NQT A;  3NWS A;  4QY7 A;  4APV A;  3L7Z C;  4BBS B;  2UXD L;  4HTH A;  4O42 A;  3CCJ A;  4A3K B;  2UXC L;  1DOM A;  3FEW X;  2ZJP A;  4LF9 L;  4CJ1 B;  1WI5 A;  3URY A;  1K8M A;  2Z6B A;  2LS0 1;  5BN3 A;  3OWF A;  4JYA Q;  4G7O C;  4LFC Q;  3CCU A;  3WDN A;  3E6Z X;  1AZQ A;  4OL7 A;  2VB3 X;  1JOQ A;  1G2S A;  1FNV A;  1TS5 A;  4EQ5 A;  1PFM A;  4K5X A;  1XNR Q;  3EQL C;  1WTR A;  1TWC H;  1PH1 A;  3TS2 A;  1D1I A;  1STE A;  3BZK A;  4A3M G;  4AYB E;  1EY7 A;  3OMG A;  2MFI A;  4C3J G;  1YZ6 A;  1B3A A;  3A7A B;  4GKK Q;  4KN4 C;  4EQP A;  2CHB D;  2GVA A;  1TXY A;  3HOZ B;  3C1F A;  1X9N A;  1PZJ D;  4TKO B;  3KLR A;  4DR3 L;  1JWM D;  1N33 Q;  1B4O A;  3Q0A A;  1HRJ A;  4DR2 L;  1EU4 A;  1JJ2 A;  2N78 A;  4JI6 L;  3OW7 A;  4PNY A;  3GTQ H;  2WKC A;  1SEB D;  3Q8D A;  5FLX c;  4C2M H;  3J81 j;  3KF6 B;  4OWX B;  3ND8 A;  4IO9 A;  3LX0 A;  3MHB A;  4DR1 L;  2MHV A;  2D0O A;  2ATW A;  5IGF A;  4ODG A;  2Z8L A;  1QIL A;  4RKB A;  1SNO A;  5G3L F;  2DNE A;  3H94 A;  2B3G A;  1CKN A;  4K14 A;  4JI8 L;  1WD1 A;  5G3L D;  4C3I B;  1L1O C;  3PMF A;  4ULL A;  1VCI A;  3KBG A;  3PIP A;  1SNC A;  1SJE D;  1SNP A;  2EY1 A;  4MTK A;  2UUC Q;  1EY5 A;  2NVT B;  1HR0 L;  3U9S A;  2ZJR A;  2AQ1 B;  2R7Z B;  1F9R A;  1OXU A;  1E7Z A;  5GAE C;  4XT3 B;  3I4M H;  3PUZ A;  5IOC A;  4CDE C;  1VQF A;  2SNS A;  3G71 A;  1BNZ A;  4IFD H;  2A6H D;  1QJO A;  2F03 A;  4TQU S;  4YWK A;  1AN8 A;  4POF A;  1KAW A;  4R4T A;  1IXR A;  1SAP A;  3VDY A;  2DJG C;  4QB4 A;  2L0C A;  1ZEQ X;  1I50 B;  5C5L A;  2OQK A; 
#chains in the Genus database with same CATH homology
 5IP7 H;  4DAM A;  1VQJ A;  5J3B A;  5IWA Q;  3U4V A;  2UXD Q;  3I55 A;  3F2C A;  1IBL Q;  1K8A C;  4DR5 Q;  2UXC Q;  4GOP C;  2R92 G;  3IRB A;  4OO1 I;  4DV2 L;  1X65 A;  4LF9 Q;  1P16 A;  2E2H H;  4HJ7 A;  1Q12 A;  2R6G A;  2Y0S E;  4BY1 H;  2E8G A;  2WB1 G;  2F4V Q;  3UE1 A;  4A3I G;  2K50 A;  2UXB L;  2R7Z H;  1OXT A;  4XTC S;  2R7Z G;  1EWI A;  2I5H A;  2V1C C;  4GLA C;  5C0X G;  2CWA A;  2VQF Q;  1QZH A;  4JI4 L;  1GVP A;  4DV1 Q;  1NJI C;  4QQB X;  4KHP L;  1A63 A;  5C4J H;  2YYZ A;  1GD7 A;  4IJH A;  4HJA A;  3TS0 A;  1Z9F A;  4JI2 Q;  3G4S A;  3RN5 A;  2YU9 H;  4LF7 L;  1CUK A;  2DGY A;  4NXM L;  4GS3 A;  1YIJ A;  4DR5 L;  1NE3 A;  1EUJ A;  2UU9 L;  2PQA B;  4JI1 L;  4A3E H;  1G51 A;  4A3E G;  4KLK A;  1QUQ A;  1H95 A;  5FJ8 G;  1BBU A;  1WOC A;  4LUZ A;  3JAM c;  3UDI A;  2I0Q A;  2OTL A;  1VQN A;  2F4V L;  4KHZ A;  4DV5 Q;  1IYJ B;  2JA8 H;  2R93 H;  2R93 G;  2JA8 G;  4BBR G;  4BY7 H;  1I50 H;  4DV1 L;  2JE6 I;  5M5W H;  1R9T H;  2JA5 G;  2BA1 A;  3PCO B;  4TVA B;  4HIM A;  4DR3 Q;  4P73 A;  2Q2U A;  3U4Z A;  1HH2 P;  4A93 H;  5K36 G;  1NBW A;  4JBJ A;  1KRS A;  2CCZ A;  2UUA Q;  4JI7 L;  2VY3 A;  3T1Y L;  3CCS A;  5FLM H;  4DR2 Q;  1YJN A;  1XPR A;  2Y0S G;  1AH9 A;  5FLM G;  2N3S A;  5AJ3 Q;  4A3M H;  1HNW Q;  4JI6 Q;  3AFP A;  1E22 A;  4X65 Q;  1N36 L;  4B3T L;  3CPF A;  1E1T A;  3CC7 A;  1YI2 A;  1VQ6 A;  4HIK A;  5GRO A;  1GKH A;  4IPG A;  4P72 A;  4A76 A;  3M4O H;  4DR1 Q;  3CAM A;  1C0A A;  2I5M X;  4Y7N H;  3K80 C;  3STB D;  1E3P A;  2PMZ E;  2VNU D;  3PO2 G;  1KC8 C;  2KEN A;  4A3K H;  2YTV A;  4DR6 Q;  2HIX A;  5IYD H;  2Z0S A;  3UE0 A;  4DV7 Q;  4C3H H;  1NTG A;  1JB7 A;  2HQL A;  1VQD A;  4R4I A;  5GAG C;  1QVG A;  3CCV A;  1K3R A;  4UP7 A;  3BU2 A;  3K81 C;  1YIT A;  5M5Y H;  3F2D A;  3A74 A;  3GO5 A;  3M9B A;  2JA9 A;  2VQE L;  4NXN L;  1VQ9 A;  5C44 G;  4LF8 L;  2K4K A;  3CME A;  3OYY A;  3T1H Q;  2NN6 G;  3HFZ B;  2B63 G;  4X66 L;  1XMO L;  4LF5 L;  3ULJ A;  5IYC H;  3J81 c;  3I2Z A;  2IT1 A;  4PG3 A;  5IYC G;  5LMU L;  3GTL H;  4YHH Q;  2ES2 A;  1AE3 A;  3AQQ A;  2A1A A;  4OX9 L;  2H5X A;  3A5Z B;  4BA2 I;  4X64 Q;  4UPA A;  3TQY A;  1Q1E A;  4O2D A;  4RG1 A;  2K5N A;  1L1O B;  3S1R H;  5LMN L;  5JJI A;  3MXN B;  1PFS A;  1JE5 A;  4DKA C;  5JJL A;  1UE1 A;  3HKZ E;  3J80 i;  3H3V H;  2JA6 G;  2OQ0 A;  3EN2 A;  1VQO A;  4DNI A;  2ZM6 Q;  3W1B A;  4JV5 Q;  2PQA A;  5IYB H;  1IBM L;  2EQS A;  3DM3 A;  4A3B H;  1L0W A;  2E5L Q;  1VQG A;  4A3B G;  4B3R L;  1WCM G;  3S17 H;  1SN8 A;  2K14 A;  1TWG H;  4R4O A;  4X62 L;  2AMC B;  2N49 A;  3U50 C;  1VQA A;  1N8R C;  3K8A A;  4HJ8 A;  4HJ9 A;  1YVC A;  2D0P A;  3AEV A;  1BBW A;  1LTL A;  1RIP A;  2F3I A;  1PH7 A;  4AIM A;  3SGI A;  1OTC A;  4L5R C;  1K9M C;  4JI5 Q;  4QL5 A;  1VQ7 A;  1EQQ A;  3KF8 B;  1YHQ A;  1X55 A;  1N9W A;  4JI3 L;  5C3E H;  4JV5 L;  1X3E A;  5E7N A;  4DV2 Q;  3KYH C;  5C3E G;  2C35 B;  1HR0 W;  2ZTD A;  1XNQ L;  2KBN A;  4UP9 A;  3ERS X;  2JEB I;  1FJG Q;  1S40 A;  5JJK A;  5M3M H;  1E1O A;  1KL9 A;  5M3M G;  1V43 A;  4IOA A;  3S15 H;  1J5E Q;  3HKZ G;  3ZJY C;  1VQI A;  1A62 A;  2UXB Q;  1BKB A;  4JI4 Q;  3D31 A;  4JC0 A;  4HID A;  2HHH L;  4IPH A;  4C3I H;  1C9O A;  1LM0 A;  1I94 L;  4KHP Q;  3RR5 A;  4PZ6 A;  3D0F A;  3M85 A;  4JOI A;  1XJV A;  2AWO A;  4JI5 L;  2QGQ A;  4GOP B;  4LF7 Q;  4NXM Q;  2RF4 A;  2R92 H;  4UY8 C;  5M5X H;  2UU9 Q;  2E2J H;  5GQO A;  4R4Q A;  4JI1 Q;  3S2H H;  4WJ3 M;  3S1Q H;  4LWC A;  1PA6 A;  4HIO A;  1D7Q A;  3F8T A;  1XPO A;  2NVT H;  1FJG L;  4A3I H;  1VQE A;  4A3D H;  1PHJ A;  4LF6 L;  2IX0 A;  4A3D G;  4DUY Q;  3KF6 A;  1Q82 C;  1PH8 A;  1CKO A;  1J5E L;  4DUZ L;  2OTJ A;  4DV3 L;  1VQ5 A;  4QIW E;  4GLX A;  2NVQ H;  3HOU H;  1HZA A;  1Y1V G;  4DPG A;  2EIF A;  3HOU G;  3CQZ H;  1PH6 A;  5GAH C;  2OCE A;  4LW1 A;  4JI7 Q;  3T1Y Q;  3I7F A;  1XPU A;  4WJ4 A;  4B3S L;  1YNX A;  5JEA J;  1MIU A;  5FJ8 H;  2D62 A;  4DV4 L;  2WFW A;  2ID0 A;  4GNX A;  1N36 Q;  4B3T Q;  1SFO H;  4LFA L;  1CKN B;  2I5L X;  3L0O A;  3H0G G;  4DUY L;  1PH9 A;  4DR7 L;  5IY0 A;  4BBR H;  1E24 A;  4DV0 L;  4LNQ A;  5H1S E;  2JA5 H;  1WJJ A;  3KJP A;  4PMW A;  1KQS A;  4QGU A;  4DK6 C;  1N32 L;  1DGS A;  1NY4 A;  2HIV A;  3JC6 6;  4LUO A;  1V1Q A;  4A3J H;  2R7D A;  1IL2 A;  1TWH H;  2RCN A;  3PV0 A;  4A3J G;  2UUB L;  2VUM G;  3KDF B;  2OWO A;  1G29 1;  1MJE A;  1UWV A;  3I4O A;  3PO3 H;  2DUD A;  1B7Y B;  3PO3 G;  5HGQ A;  1SMX A;  3S1N H;  3M3Y H;  3HOY H;  3RZD H;  2ZJQ A;  3HOY G;  1WFQ A;  1T9H A;  1VQL A;  2KCT A;  2LXJ A;  2VW9 A;  1QZG A;  2AKW B;  4GN4 B;  1AE2 A;  2VQE Q;  4LF8 Q;  4NXN Q;  2KCM A;  2A8V A;  3HOW H;  3PF4 A;  3HOW G;  1S3O A;  2PNH A;  3PO2 H;  3G48 A;  3PUW A;  4X66 Q;  3CPW A;  1Y1W G;  1XMO Q;  4LF5 Q;  2ASB A;  1SE8 A;  3HKS A;  1HZB A;  5LMU Q;  1VQ4 A;  4J15 A;  5IE8 A;  2K52 A;  1OXS C;  1IBK L;  4OX9 Q;  2NZO A;  1UE7 A;  1MJC A;  3BJU A;  4OWW B;  3ICE A;  4UP8 A;  3OTO L;  4JYA L;  5LMN Q;  1EIY B;  1KD1 C;  5M3F G;  2F52 A;  1VQP A;  3NEL A;  1A8V A;  3FKI G;  5C44 H;  5GAD C;  3PF5 A;  1HNZ L;  3RZO H;  4GLV B;  3ULP A;  1B70 B;  1M1K C;  2B63 H;  2EXD A;  3LGJ A;  4GOP A;  1KRT A;  3EBE A;  4JOI C;  1QVC A;  1VS0 A;  3CCL A;  1IBM Q;  1PH3 A;  1U5K A;  4LF4 Q;  4BBS G;  3CMA A;  2K5V A;  1W3S A;  1VQK A;  1PH5 A;  4B3R Q;  4IFD J;  4JCV E;  2ALY B;  4X62 Q;  5HY6 A;  4OWT B;  1Q1B A;  2MNA A;  4DV6 L;  3HOV H;  1SR3 A;  4GKK L;  4YWL A;  3CC4 A;  2CWP A;  3HOV G;  2MO1 A;  2JA6 H;  2B29 A;  2A19 A;  1PVO A;  3FP9 A;  2CQO A;  3GTO H;  4DR4 L;  3NBH B;  5IT9 c;  1N34 Q;  1PYS B;  4JG2 A;  4MTN A;  1OXV A;  4GKJ L;  4OON A;  4LFB Q;  4JI3 Q;  1I5F A;  3AYH B;  3TRE A;  2BH2 A;  1XNQ Q;  3GD7 A;  4LF4 L;  1YHA A;  1WCM H;  4K0K Q;  1JMC A;  1XNR L;  2E2I H;  1LUZ A;  3EIV A;  3STB C;  5LMN W;  1GM5 A;  3WWV A;  4GNX C;  3I56 A;  4YY3 L;  2HHH Q;  1Q86 C;  3ER0 A;  5EAY A;  1I94 Q;  1I3Q H;  4YWM A;  1P8L A;  5C0X J;  2MO0 A;  4MNO A;  3J7Z C;  1NMG A;  1WYD A;  2QA4 A;  4B3M L;  3HOZ G;  2WAQ E;  1N34 L;  1UE5 A;  3HOX G;  4ME3 A;  1VQM A;  4POG A;  2N8N A;  3J80 c;  2JJQ A;  4AQY L;  3F2B A;  4LFB L;  1PYB A;  3RLO A;  2LSS A;  5ELO A;  4K0K L;  1SLJ A;  3H15 A;  1EYG A;  3E9I A;  1ASY A;  2JEA I;  3FHW A;  4LF6 Q;  2GN5 A;  1YHB A;  4P75 A;  2QEX A;  2JA7 H;  1S72 A;  4DUZ Q;  4GN3 B;  4YCU A;  4DV3 Q;  2JA7 G;  4A3C H;  4A3C G;  3ULL A;  3CXC A;  2ZTE A;  2YTX A;  1K83 H;  5BR8 Q;  3KJO A;  2GVB A;  3I4M G;  4R1J A;  1VQ8 A;  1I6H H;  4B3S Q;  2NVY H;  3M4P A;  4IPC A;  3G6E A;  3B6Y A;  3CP0 A;  1CKM A;  1HJP A;  1RL2 A;  4DV4 Q;  1UE6 A;  2LXK A;  4LFA Q;  2UUC L;  4RMF A;  1NMF A;  4JBK A;  5C4X G;  1U0L A;  2Q2H A;  3I4N H;  4DR7 Q;  3I4N G;  3BZC A;  4OXP A;  3H3V I;  3J7A 5;  4DV0 Q;  4QJF A;  3CCQ A;  1XMQ L;  2CKZ B;  1Y1V H;  3NEN A;  4NPS A;  1B8A A;  2WAQ G;  1C7Y A;  5BR8 L;  2Z6K A;  4L5S A;  4AH6 A;  1N32 Q;  1X56 A;  5IP7 G;  1CSP A;  1JJG A;  1KXL A;  2JK8 A;  1FGU A;  3JAM i;  3CCR A;  2UUB Q;  4A4I A;  1YBY A;  3UDF A;  1QVF A;  1CSQ A;  2XTI A;  3PUX A;  4PZ7 A;  3RLN A;  1SRU A;  1XTD A;  3UDX A;  3H0G H;  3GTJ H;  2NZH A;  3UDG A;  1HNX L;  1L2F A;  4BY1 G;  1G6P A;  1L1O A;  1VQH A;  2MQH A;  3S1M H;  1KHI A;  2HT1 A;  2AWN A;  1PH4 A;  3PSI A;  4IFD I;  3A5U A;  1OXX K;  4A3F H;  4QY7 A;  4A3F G;  4APV A;  3PGZ A;  4JBW A;  2IY5 B;  3L7Z C;  2XGT A;  5IWA L;  3CCE A;  1Q7Y C;  3MEF A;  4BA1 I;  1X3G A;  4HJ5 A;  2VUM H;  2UXD L;  1UEB A;  3CCJ A;  1IBL L;  2UXC L;  1VQC A;  2ZJP A;  4IPD A;  1IBK Q;  2VZA A;  4LF9 L;  1O7I A;  1WI5 A;  3K7A H;  3S14 H;  3OTO Q;  3W1G A;  4JYA Q;  3KOJ A;  4LFC Q;  3CCU A;  3K7U C;  1Q46 A;  4X6A H;  2VL6 A;  4IJL A;  1HNZ Q;  2PI2 E;  2FXQ A;  2VQF L;  4JBM A;  4BY7 G;  3M4Q A;  1Y1W H;  2IX1 A;  4EQ5 A;  4A93 G;  3GTM H;  1XNR Q;  4JI2 L;  2JQO A;  3TEH B;  1EQR A;  1TWC H;  4YCV A;  2RHQ B;  3GTK H;  2KHJ A;  4DK3 C;  1PH1 A;  5C0X I;  3PUV A;  3TS2 A;  2RHS B;  3BZK A;  4A3M G;  4AYB E;  3DLL A;  4JI0 Q;  1A0I A;  1FVI A;  1GO3 E;  4C3J H;  3KLW A;  3S24 A;  2MFI A;  4LFC L;  5M3F H;  1YZ6 A;  4DV6 Q;  3M7N A;  1Y14 B;  3FKI H;  4DV5 L;  4GKK Q;  2GVA A;  1TXY A;  1FL0 A;  3CC2 A;  1X9N A;  2NVX H;  3J81 i;  4DR3 L;  1EIF A;  1K73 C;  3KFU A;  5IP9 H;  5JEA G;  3U58 A;  5IP9 G;  4R4C A;  2UUA L;  5DLQ E;  4P71 A;  1N33 Q;  1LYL A;  1K0R A;  4L5T A;  4BBS H;  4GKJ Q;  4DR2 L;  1JJ2 A;  4A3K G;  5AJ3 L;  2N78 A;  1D8L A;  1KIX A;  4JI6 L;  1HNW L;  4X65 L;  4FDB A;  3CCM A;  3CD6 A;  3GTQ H;  3A0J A;  4JI0 L;  3Q8D A;  5FLX c;  5IYD G;  4C2M H;  1TWA H;  4JI8 Q;  3J81 j;  3OW2 A;  3KF6 B;  4YY3 Q;  4OWX B;  3RN2 A;  3NEM A;  4IO9 A;  3E9H A;  3GDE A;  4DR4 Q;  4DR1 L;  4B3M Q;  4KI0 A;  1PH2 A;  2D0O A;  2ATW A;  3RLF A;  2Z6K C;  1Q8K A;  2VS1 A;  1N33 L;  1YJ9 A;  1X3F A;  4AQY Q;  4XIG S;  4AYB G;  1X6O A;  4IOC A;  1QUQ B;  1W2B A;  4DR6 L;  2B3G A;  4GNX B;  1SRO A;  1X54 A;  4ALP A;  1CKN A;  1HR0 Q;  2KHI A;  4DAY B;  3GTG H;  4DV7 L;  2L15 A;  4JI8 L;  1MKH A;  3RNU A;  2Q2T A;  5ELN A;  1BVS A;  1Q81 C;  4A75 A;  1L1O C;  1J6Q A;  4LUV A;  3F1Z A;  3HOZ H;  2BH8 A;  2R7F A;  1VCI A;  2BA0 A;  1IZ6 A;  3PIP A;  1TWF H;  3HOX H;  3T1H L;  2K5H A;  2ZTC A;  2Q2I A;  4P74 A;  4O0A A;  2YV5 A;  3K0X A;  3W5O A;  1JT8 A;  1EFW A;  4Y52 H;  3KDF A;  4MZ9 A;  2IHE A;  1K8G A;  4YHH L;  3S16 H;  2UUC Q;  5IYB G;  1HZC A;  1HR0 L;  4H02 A;  3PIO A;  1EOV A;  2PI2 A;  4X64 L;  1PV4 A;  2NN6 I;  4NB3 A;  2ZJR A;  2K75 A;  1XMQ Q;  3GTP H;  3CW2 C;  4A3L H;  1M90 C;  4A3L G;  4OO1 G;  2WB1 E;  4PZ8 A;  1OXU A;  1E7Z A;  5GAE C;  3CF5 A;  3I4M H;  3PUZ A;  3AFQ A;  1VQB A;  4L5Q A;  1VQF A;  1YJW A;  3G71 A;  2AHO B;  2IHF A;  4EX5 A;  3E0E A;  1JJC B;  2ZM6 L;  4A3G H;  4BXX H;  4IFD G;  4TQU S;  1Z47 A;  4A3G G;  4YWK A;  3S2D H;  2YTY A;  4POF A;  5C4X H;  4BXX G;  4GN5 A;  2E5L L;  1KAW A;  4R4T A;  2CFM A;  1HNX Q;  1IXR A;  1V9P A;  3VDY A;  3L2P A;  1YEZ A;  3PUY A;  4YCW A;  1HZ9 A;  1ASZ A;  3TRZ A;  2OQK A;  2WP8 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...