3GTKH

Backtracked rna polymerase ii complex with 18mer rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
146
structure length
136
Chain Sequence
b'MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 15
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtkH00
4JI1L 3ICEA 5IP7H 1EOVA 3KF6B 4JI1Q 1TWCH 2Z6KC 3NELA 1P8LA 5IWAL 3RN5A 2ZTDA 3J7ZC 3H15A 4A3IG 2UU9Q 5GAHC 1G51A 3HOZH 2E5LQ 3GTPH 3J80c 2JEBI 2RF4A 3RZOH 2R93H 2GVBA 3UDIA 3M4QA 3GTLH 1X56A 3M7NA 1RIPA 2OQ0A 4BA1I 4A3IH 1K0RA 3HKSA 3CC7A 1Q7YC 1Q86C 1IBLQ 1WCMG 2BH8A 4A3LG 5HGQA 3HOUG 3S1RH 2JA6H 2PMZE 3TREA 2LXJA 4DV2L 3KDFA 2GN5A 2FXQA 2K75A 3B6YA 3M4PA 4JI0L 1KQSA 1HJPA 4GLVB 1HNXL 3U58A 3HOYH 4LFBL 4A3LH 1FGUA 2ID0A 2I5LX 3HOUH 3VDYA 2F4VL 4PZ7A 4LF8L 5IYCH 2K14A 1W3SA 4DR3L 4JI3L 4A3MG 4DR4L 1OXXK 1VQDA 3PUYA 1PH4A 3A5ZB 3PUZA 4P71A 4A3DH 3FKIG 4GOPC 1Y14B 1VCIA 4DR3Q 1KL9A 1YVCA 4DR4Q 2A1AA 4DAYB 1G291 1XPOA 1U0LA 3HOVH 1GD7A 2PQAA 4OXPA 1K73C 1PA6A 2PNHA 1CSPA 4BBSH 4GNXB 1C9OA 1GKHA 1WYDA 2N3SA 4IO9A 4NPSA 4MZ9A 5ELNA 5BR8L 3S14H 2PI2E 3NENA 1PH2A 4GKJL 5BR8Q 5M5YH 1VQBA 1GO3E 3M3YH 1IBMQ 3S1NH 4AQYQ 3JAMc 4GN3B 1WJJA 3AFPA 2K52A 4DV3L 1PYSB 2NVXH 4JBMA 2N8NA 4PZ8A 3CCSA 4JV5L 2UUCQ 2MO1A 3A74A 5IYDH 1X3EA 3U4ZA 3BU2A 4OWWB 3E9IA 4R4CA 4R4OA 4JI6L 2AMCB 3CCUA 3OYYA 1Y1WH 3M85A 2I0QA 5JJIA 3PIOA 4A76A 1NMGA 4BXXG 2VUMH 4QIWE 4BBRH 4JYAQ 2D62A 5FLXc 1YHQA 2ES2A 3CMAA 1G6PA 1QZHA 3E9HA 4JI4Q 4A3BG 3T1YQ 2CCZA 1K9MC 3H0GH 4IFDI 3H3VH 1PFSA 3EN2A 4BY1G 1VQKA 4GN4B 1KD1C 1E7ZA 3UE0A 3CC4A 4ME3A 4RG1A 3I4MH 2EQSA 4PG3A 3F2CA 4HJ5A 3S2HH 1PH8A 4O2DA 4UP7A 4AIMA 1IL2A 5GAEC 4GOPB 4X65Q 5LMNW 3W1GA 4IFDJ 2K5NA 1Q46A 3BZCA 1PH3A 2WAQG 3ERSX 1CKNB 1EWIA 1VS0A 4DUZQ 1HNZQ 2EIFA 1PVOA 1OXVA 4B3TL 2WB1E 3ULPA 1SN8A 1X55A 4LFAQ 3TRZA 1KXLA 1BBWA 4IPHA 2UUAL 4DR6Q 2C35B 2XGTA 4B3TQ 3I7FA 4OX9L 2GVAA 5ELOA 1HR0L 2UUBL 4GLAC 3KJOA 1AE3A 3CCMA 1D8LA 1YJ9A 1HR0Q 4RMFA 1SRUA 3WWVA 3CXCA 4X62Q 4LNQA 4JI8Q 4DV4L 1JMCA 2NN6I 1QVFA 2ASBA 4B3MQ 3ULLA 4A3GH 1CKOA 4DV4Q 1PH6A 3G4SA 1I3QH 3TEHB 3OTOL 1YIJA 3AYHB 5J3BA 3EBEA 2N49A 1VQCA 3CCRA 2E2IH 4GLXA 4IOAA 3F2DA 4QY7A 1LM0A 1HNWQ 4JOIC 1L1OC 1VQ6A 2RHSB 1EQQA 3CCEA 4UP8A 1KRTA 3STBD 2RHQB 2VNUD 2N78A 2B63H 5GAGC 1JJ2A 2QA4A 3JC66 1QUQB 5M3MH 5C4XG 3BJUA 4JI2L 1VQJA 3RNUA 2Q2UA 3E0EA 3FP9A 3UDXA 5LMNQ 1M1KC 1YHBA 2NN6G 3D0FA 4X66L 3RLNA 3GDEA 2AWOA 2CQOA 1HZAA 2IX1A 4LF4L 3KOJA 2K5HA 5IWAQ 5HY6A 1VQ8A 4B3RL 4LF6L 4L5QA 4AYBE 1OXUA 1X65A 5FLMG 4LF4Q 4K0KL 4LF5L 4GS3A 1KHIA 4B3RQ 1NY4A 2Q2IA 3A5UA 4PZ6A 2HT1A 4IPGA 1TWFH 2E8GA 4HIMA 4QL5A 4LF5Q 3I56A 5EAYA 1V1QA 1E3PA 3J81i 3GTMH 1XPRA 3I2ZA 1UEBA 3I55A 1HZCA 2IY5B 2WB1G 4DV2Q 1Q82C 5IYBG 1WCMH 2HIVA 4JI0Q 4OO1I 1FVIA 4YWLA 4C3IH 4ALPA 3CMEA 4DR5L 2IX0A 1HNXQ 1KRSA 1XMQL 4LFBQ 1N9WA 3PUVA 1YNXA 4A3JG 4L5RC 2F4VQ 3CAMA 3M4OH 3K7UC 4LF8Q 4DV7L 4A75A 1XMQQ 1NJIC 1IXRA 4JI3Q 1VQHA 1O7IA 3DM3A 3S24A 4POFA 4A3EG 2E2HH 4DV7Q 4A3MH 4KI0A 1AE2A 4JBKA 2PQAB 3FKIH 4GKKL 1IYJB 2YTXA 1Q12A 3TS0A 4DV1L 3I4NG 3PO2H 5JJLA 4YWMA 4R4IA 3L2PA 3M9BA 3W1BA 1L1OB 1VQOA 3ZJYC 4DV6L 1N36L 2UXCL 1R9TH 2JA7G 4OO1G 3L7ZC 3CPFA 2AHOB 1A0IA 4TVAB 4GKJQ 3K8AA 4HIDA 1N36Q 4KHZA 4EQ5A 1A62A 2UXCQ 2QGQA 2JA5G 2NZOA 2JA9A 2R92G 4IJLA 5C44G 4L5TA 1YBYA 1HH2P 3NBHB 4YWKA 2VQFL 3J81j 4DV0L 4DV3Q 2IHEA 4GNXA 1VQPA 1P16A 1VQNA 2VQFQ 4JV5Q 3OW2A 2R92H 1HR0W 4DV0Q 3S16H 3NEMA 1BVSA 4OWXB 4YY3L 2R7DA 2B3GA 1TXYA 2KCTA 1QZGA 1SROA 4JI6Q 2VZAA 2BA0A 2MFIA 2HQLA 1YJNA 4A93G 3S15H 1HZBA 2XTIA 4FDBA 1C7YA 1WI5A 4KHPL 2Z6KA 3KJPA 1LYLA 2CWPA 4NXNL 4BXXH 2VY3A 4JBWA 4AH6A 1ASYA 4KHPQ 5AJ3L 1MIUA 4NXNQ 4DV5L 1T9HA 1I5FA 1VQEA 3AQQA 1Q1EA 5DLQE 1N33L 4A3BH 5AJ3Q 1PH1A 1PHJA 3RZDH 1J5EL 3U4VA 1E1TA 1GVPA 4BY1H 1WFQA 3K0XA 4MTNA 1XNRL 1Q1BA 2LSSA 1XMOL 1J5EQ 1S72A 1C0AA 2IT1A 1PV4A 3PIPA 3CD6A 2V1CC 4QQBX 1LTLA 4C3JH 1KIXA 3CCQA 4QJFA 3RLOA 4IPDA 1XNQL 1YZ6A 2QEXA 2CFMA 4DAMA 4IOCA 1L2FA 1VQ5A 2WP8J 1XNQQ 4OX9Q 2NVTH 4Y52H 3K81C 2UUBQ 2JA8G 1Q8KA 4A3CG 1K83H 4GOPA 4GN5A 2YU9H 3HFZB 4UP9A 2I5HA 3TQYA 4LUZA 4IPCA 1CKNA 4B3SL 1CUKA 1XJVA 3U50C 5H1SE 1K8AC 3J81c 2HHHL 4LUVA 2D0PA 3PSIA 2JE6I 3CPWA 3CP0A 4APVA 4YCVA 4DNIA 2ZJPA 3CCVA 2K50A 3OTOQ 2NVYH 2VL6A 1W2BA 4BA2I 4WJ4A 1Y1VG 4JCVE 1B8AA 4A3FG 4UY8C 3PV0A 3PUXA 2IHFA 1JJCB 3CF5A 4A4IA 4KLKA 2R7ZG 2I5MX 2ZM6L 4JI7L 1BBUA 1N34L 3G71A 1QVCA 1K3RA 1I94L 2E2JH 1JT8A 4UPAA 2ZM6Q 3PGZA 2ZTEA 4JI7Q 1RL2A 4JI2Q 3S1QH 1N34Q 4X64L 2VW9A 2BH2A 2BA1A 2OQKA 1I94Q 1FL0A 1TWHH 3DLLA 4DKAC 2NZHA 4DR7L 5C4XH 3HOXG 2DGYA 1UE7A 1UE5A 1PH9A 1Z47A 2H5XA 4X66Q 1AH9A 2A8VA 5K36G 3PO2G 3AFQA 1VQ9A 2DUDA 1YITA 4DR7Q 5IY0A 4POGA 2YTVA 5C4JH 5IP7G 5LMUL 4A3KG 2K4KA 3GTKH 4LF6Q 1E22A 3I4OA 4DR1L 4LF9L 1QUQA 4K0KQ 3S17H 5LMUQ 3BZKA 5C0XG 3D31A 4DR1Q 5FLMH 4LF9Q 3KF6A 3KDFB 2UU9L 3HOZG 3LGJA 2ZJRA 4A3KH 1PH7A 1WOCA 1MKHA 5M5XH 2PI2A 2R93G 4DK6C 4OWTB 5E7NA 4HJ7A 1KC8C 4YCWA 2KCMA 2UXBL 2E5LL 1YEZA 2ZTCA 3PF4A 2ALYB 4X6AH 3G6EA 3KLWA 4HJ9A 2JA6G 1X3FA 3G48A 4HJ8A 3HKZE 1EFWA 4NB3A 3KFUA 2UXBQ 1H95A 1IBLL 4DR5Q 1M90C 4LWCA 1OXTA 4IJHA 5IYBH 2JEAI 3RLFA 2UXDL 1NTGA 3HOYG 1Z9FA 3EIVA 1MJEA 2YTYA 3IRBA 3KYHC 2VQEL 4A3JH 5IYCG 4YHHL 2ATWA 2UXDQ 1VQMA 3TS2A 2A19A 4A3DG 3CCJA 2F52A 1U5KA 2VQEQ 4YHHQ 4A3EH 4C3HH 4GKKQ 1CSQA 2Q2TA 4DV1Q 1NBWA 3GTJH 3F2BA 1B7YB 2KENA 3HOVG 3PCOB 2AKWB 2RCNA 2JK8A 2WFWA 3KF8B 1SMXA 4DV6Q 4P75A 3I4NH 4OONA 4BBSG 1S3OA 1YI2A 2WAQE 1XPUA 1XTDA 3ULJA 4JC0A 3K80C 4LF7L 2JA7H 4JG2A 3GO5A 1EIFA 3RR5A 1UE1A 4R4QA 1VQLA 4R1JA 4LF7Q 1JJGA 1MJCA 1L0WA 1PH5A 1JE5A 2JA5H 4LW1A 1Q81C 3PO3G 3S2DH 1D7QA 4JOIA 5C44H 1L1OA 1S40A 2K5VA 1YHAA 4JI5L 4HIKA 3S1MH 4O0AA 4DPGA 2YV5A 4HJAA 1JB7A 2D0OA 4AYBG 3J80i 5IT9c 2CWAA 4Y7NH 4AQYL 3STBC 1IBML 3H3VI 5JJKA 3W5OA 4JI5Q 1SFOH 1X54A 3PO3H 4YY3Q 5IYDG 1NE3A 1VQFA 3PF5A 1EYGA 2LXKA 2UUCL 2Q2HA 3FHWA 1V9PA 2F3IA 1B70B 1VQIA 1QVGA 1Y1WG 4P72A 2OWOA 1VQGA 4LFCL 4A93H 1OTCA 2YYZA 3GD7A 1VQ4A 2VUMG 4BBRG 3MXNB 3MEFA 2MO0A 4LFCQ 3UDFA 3ER0A 4XTCS 5FJ8G 5IE8A 4R4TA 2AWNA 2MQHA 4JYAL 3HKZG 2Y0SE 4DV5Q 4PMWA 3T1HL 3H0GG 4L5SA 4DR2L 1EIYB 1N33Q 2EXDA 3GTOH 4JI4L 4J15A 2CKZB 2L15A 1OXSC 5C3EG 3T1HQ 5FJ8H 3T1YL 3CCLA 3I4MG 1PYBA 5GADC 4DR2Q 1XNRQ 4YCUA 1XMOQ 1YJWA 4QGUA 4DK3C 1GM5A 2OTLA 4BY7G 2VS1A 1A8VA 3UE1A 2B29A 2KHJA 5C3EH 4DUYL 1IBKL 4X65L 1LUZA 3CQZH 4P73A 1FJGL 1SE8A 3GTQH 1BKBA 1HNZL 4NXML 3GTGH 4DUYQ 4P74A 4DUZL 1IBKQ 4BY7H 3JAMi 3L0OA 1FJGQ 1TWAH 4NXMQ 1SLJA 4LFAL 3RN2A 1I6HH 4DR6L 2JA8H 4LUOA 2KHIA 5GQOA 2ZJQA 1X6OA 5JEAJ 3F8TA 4B3SQ 3J7A5 2NVQH 4A3CH 1A63A 4HIOA 3PUWA 2HHHQ 2Z0SA 1KAWA 1HZ9A 1IZ6A 3AEVA 1TWGH 2UUAQ 5M3FG 4IFDG 4X62L 2JQOA 4JI8L 4A3GG 1SR3A 5IP9G 3HOWG 4WJ3M 4B3ML 5C0XI 1CKMA 2OCEA 3K7AH 1UE6A 3Q8DA 5M5WH 1VQAA 5JEAG 1X9NA 1Y1VH 1EUJA 1J6QA 4EX5A 3UDGA 4A3FH 1DGSA 1X3GA 4H02A 1E24A 1K8GA 5M3FH 2MNAA 3CC2A 1E1OA 3CW2C 4C2MH 5IP9H 2R7ZH 3HOWH 2OTJA 4MNOA 1NMFA 1V43A 4JBJA 1HNWL 5C0XJ 1UWVA 4X64Q 4GNXC 1ASZA 2JJQA 2B63G 5M3MG 4TQUS 1N32L 1N8RC 3SGIA 4XIGS 3A0JA 1VQ7A 2KBNA 1N32Q 3HOXH 2R6GA 2R7FA 1EQRA 1I50H 3F1ZA 5LMNL 2Y0SG 2HIXA 5GROA
chains in the Genus database with same CATH superfamily
5KNCA 2KCCA 1UUPA 5IP7H 1ENAA 1EOVA 1FNWA 3I91A 5ELBA 4ZKBB 4HCEA 3NELA 1GUTA 2ZTDA 4A3GB 2KEEA 2Z4HA 4RGTA 2F1MA 3OWFA 3GTPH 3J80c 2RF4A 1SYGA 5COYA 1EZ6A 2B8GA 1DZ1A 3TREA 2B63B 1CM9A 1KQSA 2AQ2B 4GLVB 4IN3A 2O2LD 5DM73 1B3QA 5IGEA 4LFBL 4A3LH 5JVH3 3HOUH 2F4VL 1EY7A 2K14A 4DR3L 1PH4A 2G9DA 3A5ZB 4P71A 4A3DH 3C2PA 1Y14B 1VCIA 4DR3Q 1KL9A 1YVCA 2A1AA 5A2QE 2H1EA 3HOVH 1LABA 1CSPA 1WYDA 3S14H 2PNRC 4N8FA 4FXDA 5FO8B 3NHHA 5FLXE 2CVRA 1NSNS 2DJFC 4AQYQ 2A68D 1WJJA 3Q6SA 3M4OB 2N8NA 4PZ8A 2UUCQ 1JOOA 3A74A 5IYDH 5BN4A 3OMGA 3A7LA 3FKIB 4R4OA 4K8JA 4JI6L 2AMCB 3CCUA 3M85A 2I0QA 3S9WA 3PIOA 1R9TB 2L5TA 2IX3A 5FLXc 1S5FD 4HSPA 1AEXA 4Z9CB 2QDBA 1G6PA 4UDUC 1U4LA 3T1YQ 2EYFA 3D3RA 4V0BA 1UNSA 1PH8A 4F87A 1KDAA 2F0SA 3S16B 4X65Q 4KY5A 5C3WA 3ERSX 4NMZA 1EWIA 2KOLA 4RGNA 4X3SA 4B3TL 1VDZA 1X55A 3TRZA 1SMYC 2C35B 3OHXC 5IIFA 4B3TQ 1LTID 4XDXA 2Z1CA 1HHVA 1SRUA 2NYZD 1DOMA 2PW5A 4J6HA 2NN6I 3ULLA 3MA2B 3A8KE 1HXYD 1O78A 4BS9A 2G9HD 1WVLA 5I4DA 2B2UA 3EBEA 3CCRA 4KKSA 1U4PA 1HNWQ 4MHEA 5CBEE 1CTMA 3K6OA 4FF4A 5D3DA 4FO2A 3BJUA 3RNUA 1GOZA 2X69A 1AZPA 2YU9B 1EYDA 4B9WA 5CV5A 5IWAQ 2L55A 3NBIA 4AYBE 1X65A 1HPCA 1A3VA 2XIWA 4L8JA 4IURA 1X3PA 4IPGA 4QL5A 3I56A 4JVZA 5T1GA 3I2ZA 2EJMA 1HZCA 4MN3A 3R93A 1FVIA 5IGGA 4ALPA 1TWHB 1Z7TA 4G4KA 4QCLA 2F0WA 4QIWB 1EU3A 3K7UC 2G5DA 4A75A 1NJIC 4JI3Q 4OELB 2NUCA 5DEHA 4DF7A 3PQIA 1YNJC 4A3EG 2RVLA 4C3HG 1JB3A 3NWTA 3S17B 4GKKL 1IYJB 2FINB 3OW7A 2HUGA 4PMBA 3BS1A 2DNCA 5JJLA 4NW2A 5C4ZA 4TRDA 5M5XB 4DV6L 4OO1G 3L7ZC 3CPFA 2AHOB 1A0IA 4TVAB 4KHZA 4EQ5A 2NZOA 3TP7A 4N9PA 1BCPF 5C44G 1STBA 3NBHB 1EYCA 4DV0L 2B2VC 3NSWA 3NWSA 4DV3Q 2IHEA 2FFKB 3MTSA 4GNXA 1P16A 2FMCA 2NZ1D 4DV0Q 4DXFA 1U4RA 2B3GA 4S3SA 1RTOA 1KNEA 2MFIA 2HQLA 4A93G 4CJ1B 3GTJB 3S15H 4G7ZC 1HZBA 2EY1A 2Z6KA 3KJPA 2CWPA 4NXNL 1DOKA 1PRTC 2EY5A 1ASYA 2HDLA 1AFPA 5AJ3L 4NXNQ 1PZID 3QOJA 1IW7C 1B53A 1I5FA 4A3BH 5DLQE 1A15A 5AJ3Q 1WD1A 1PHJA 3RZDH 1GVPA 4BY1H 2IL8A 4QB4A 1XNRL 2LSSA 1XMOL 2KA7A 1SFOB 1CK1A 4RKBA 5CV8A 5EGTA 1KIXA 3CCQA 3RMHA 4FF3A 1SNCA 3KBGA 2QEXA 3BYYB 1BF4A 2K5QA 2KVMA 3HG9A 3OMCA 4PV1C 2F0LA 2K5DA 2NVTH 4OX9Q 3H09A 1ET9A 2F0GA 1Q8KA 3IFTA 1K83H 4A3CG 4GN5A 1YNND 1XJVA 1K8AC 2P5ZX 1NNXA 2D0PA 3LNNA 2F0VA 1DM0B 4RGMA 2JE6I 4YCVA 3TMEA 2NVYH 3OTOQ 4WJ4A 2EYMA 3EQLC 4A3FG 2RDFA 4ZRZA 1DCZA 3GV3A 1VF5C 1GHJA 1JJCB 1ENCA 4KLKA 4P2CB 4H13C 4JI7L 1S5ED 2E2JH 5KYIA 1K3RA 4JI7Q 1SBBB 4H7BA 2VW9A 2OQKA 1PRTB 2E74C 5C4XH 3ITPA 1I6HB 1AH9A 2DUDA 5ELEA 2F0PA 2NVQB 4POGA 5C4JH 3GTKH 2K4KA 4LF6Q 3A8JE 1Q90A 3DUZA 4K0KQ 4DU9A 5M5WB 1A3TA 4KJOA 3KDFB 5C5LA 3LGJA 4A3KH 3MAQA 1PTOF 2B2TA 2EYLA 4HJ7A 5M3FB 4YCWA 2UXBL 4C2MB 3HOWB 3PF4A 2M2LA 4HJ9A 3SK5A 4X6AH 2JA6G 1X3FA 2UXBQ 1EFWA 3GV6A 5EBDA 1IBLL 1OXTA 4IJHA 2EJGC 1DD2A 1Z9FA 3EIVA 1E2WA 2X6GA 1MJEA 3IRBA 4A3JH 2ATWA 1PTOC 4YHHL 2O5IC 3PO2B 4O42A 1MSGA 1HFGA 4A3KB 4RHRA 4YHHQ 4CGYB 3HEJA 1A2TA 2KEDA 2M9VA 3PIP3 3F2BA 2AKWB 3I4NH 3KF8B 1IYUA 4KKUA 3HOZB 2WAQE 3RZOB 2R93B 4QMGA 3K80C 3A54A 3RR5A 1UE1A 2EVBA 2A69C 1JJGA 2HCCA 2JA5H 1I4PA 4LW1A 3S2DH 2I46A 4JOIA 1HFNA 1YHAA 4DPGA 1IBML 2D0OA 3H3VC 4IOAA 4FYDA 3W5OA 4K6LA 1PTOH 3PO3H 4YY3Q 1VQFA 1EYGA 1LT5D 1HCZA 4EQOA 1S5BD 1QVGA 1OTCA 2VUMG 3UDFA 5FJ8G 5IE8A 4R4TA 2MQHA 3HKZG 4PMWA 3H0GG 4DR2L 2I07B 2L15A 3PO3B 3I4MG 2K32A 3TBIB 5GADC 4DR2Q 3VR2A 3SR1A 1D1IA 3UE1A 3NK9A 5ELCA 4DUYL 3TP5A 1LUZA 5CMDA 1JWSD 1HNZL 4G7OC 4DUYQ 4DUZL 2RQXA 3C1FA 1Y1WB 1H9SA 4LFAL 4BBRB 4B3SQ 5IT9L 3DM1A 5DNFA 2HHHQ 1LTBD 1KAWA 2JP1A 3AEVA 1TWGH 5M3FG 4JI8L 1X3QA 3HOWG 4WJ3M 2XWBB 2FHTA 4QUFA 1DOLA 2B39A 1Y1VH 4KTAA 1X9NA 4JW0A 3G7LA 1E24A 3FPUB 1ILQA 3CW2C 4KN7C 3MXUA 4J1MA 4MNOA 1NMFA 4XXEA 3I70A 4X64Q 2LFNA 4TQUS 1Q3LA 3R2TA 3Q0AA 1VQ7A 3H6MA 3NXWA 4HR7B 1F2MA 1L0YB 2JSOA 3VA5A 5GROA 2F0JA 3WOFA 4FXGC 1TWCH 5CR3A 1P8LA 2F0FA 3IKJA 3DWPA 3J7ZC 1I3QB 4OIJA 5C0XH 1PXUA 1RF2D 2E5LQ 3E6ZX 2JEBI 2OXPA 2GVBA 3UDIA 3M4QA 3GTLH 1SYBA 3HKSA 2NBFA 3DHQA 4R8IA 1IKMA 1WCMG 1JE4A 3S1RH 4C3IG 1GUGA 3P1HA 5M3MB 2GN5A 3B6YA 5FK9C 1LO5D 3EROA 4DGZA 3HOYH 1A3UA 2I5LX 3VDYA 2Y0SB 2F3VA 5IYCH 4A3MG 3JAME 4FF1A 4KKTA 4FVMA 3NUCA 1V8QA 1LTGD 4RA8A 1U0LA 3BG3A 2PQAA 2PNHA 5CGKA 2RSOA 4BBSH 1GKHA 2N3SA 5TSSA 4NPSA 1G8ZD 3GTMB 2PI2E 3KUPA 2NWGA 4GKJL 5M5YH 2BDOA 1EOTA 1GO3E 3S1NH 1KABA 4FF2A 3JAMc 4OIKA 1ET6A 2Z6BA 1K28A 1PYSB 3J80L 1EWHA 3MWYW 2J7ZA 3U4ZA 2EYOA 3E9IA 1V1PA 1AW7A 3OYYA 3NTHA 1B4OA 5JJIA 2NTTA 1NMGA 2ENBA 4JYAQ 2D62A 2F0TA 1YHQA 2R3ZA 4XQJA 1QZHA 3E9HA 1HRJA 4IUQA 1K9MC 1VQKA 4RFBA 1SYDA 4ME3A 4RG1A 2EQSA 3F2CA 4HJ5A 3S2HH 4I65A 3R3OA 4UP7A 3SXHA 3SE0A 1IL2A 2A6ED 2R92B 1FNUA 4C3JG 5CBAE 3E3XA 2K1BA 1HTLD 1CKNB 1VS0A 3IAYA 4UAIA 1Y8PB 3TSSA 2WB1E 2E76C 1SN8A 4DA2A 2EYJA 2F4IA 2NTSA 2XGTA 3N6RA 3I7FA 5ELOA 1HR0L 1UAPA 2J0TD 2UUBL 1EY9A 2RCFA 3VR3A 3CU7A 3CCMA 3FEWX 1Y69U 1HR0Q 3FMCA 3N52A 3CXCA 4X62Q 4LNQA 1A2UA 5A2QL 2PMZB 1JMCA 4IFDH 1F2LA 2XN9C 3OWEB 4A3GH 1PH6A 4ILWA 4MTKA 3G4SA 3W2DA 1YIJA 3SDZA 1TS4A 2N49A 1VQCA 1FR3A 3F2DA 4QY7A 1L1OC 4L6TB 5FLXL 1EQQA 1BOSA 3CCEA 1KRTA 3IL8A 1ZYRD 2RBMA 2B63H 1JJ2A 2O5JC 3JC66 1QUQB 5K5PA 1EY6A 1NR4A 2QILA 4JI2L 2Q2UA 3FP9A 3UDXA 3TN2A 4CJ0B 1M1KC 1YHBA 2NN6G 1B44D 3RLNA 2IX1A 3I73A 4LF4L 2WV6D 2K5HA 4RWSC 3SK4A 1K8MA 4LF4Q 1TQOA 4LF5L 2Q2IA 4PMCA 4XYOA 4KD3A 4PZ6A 3Q23A 5I6WA 3MVVA 4HIMA 1K0SA 4LF5Q 2AQ1B 5EAYA 1W6JA 4EQPA 3I55A 4NDXA 5IYBG 2HIVA 3KBXA 4YWLA 3CMEA 1SE2A 2IX0A 5I9OA 5CV9A 4LFBQ 2F4VQ 2CQAA 3M4OH 5C5MA 1C4QA 5EPJA 1IXRA 4V190 3D4WA 4K5VA 3DM3A 4POFA 1EY5A 5JJZA 4C1NI 1AE2A 2PQAB 3FKIH 2TSSA 2DY7A 4DV1L 2PPBC 4YWMA 4R4IA 1VQOA 1L1OB 1SDFA 3ZJYC 1R9TH 2JA7G 2WINB 1FYCA 2N55A 2PQEA 1JOKA 4ABNA 2QGQA 1STNA 2JA9A 4DAYA 2R92G 5T1IA 3HP3A 4CDEC 4M8AA 2VB2X 2VQFL 3X3NA 1S5CD 1SSOA 4CKEA 5IGDA 2M00A 5ELDA 1VQPA 1C48A 2VQFQ 3QG1A 1HR0W 3S16H 1MHWC 3NEMA 1BVSA 4A3EB 1QZGA 2KCTA 1FD7D 4C3HB 3HS0C 4JI6Q 2BA0A 3K57A 5I2YA 1YJNA 3L3OC 4H44C 1RKNA 3X3MA 1WI5A 1LYLA 4BXXH 1K8OA 2VY3A 4JBWA 1HA6A 1SE3A 3QJYA 3A55A 1NUCA 4DV5L 1T9HA 2H4OA 1PH1A 2DJGC 1B3AA 5C44B 2L11A 3T13A 1WFQA 1ML0D 3J81E 2FJ2A 4CJ2C 1Q1BA 2MUYA 5JVG3 1PV4A 2V1CC 3T53B 1PZKD 1YZ6A 3SVMA 4IUVA 4A93B 3K81C 4LJZC 4N8X1 1BR9A 2JA8G 4GOPA 2YU9H 1ZXTA 5IOCA 2HD3A 3HFZB 3TQYA 1AN8A 4IPCA 1IKLA 3J81c 1SYCA 1SNOA 4LUVA 1RDPD 3GTOB 3PSIA 3CPWA 4APVA 4BA2I 2R61A 1W2BA 2K50A 1F2YA 1BQQT 2CH4W 2VL6A 4UY8C 3PUXA 2CW0D 4XT1B 2IHFA 1LTSD 3CF5A 2R7ZG 3DWQA 2A74C 4F7XA 1N34L 3G71A 3GTQB 2D5DA 3GTGB 4K6DA 1N34Q 3L9AX 2BA1A 1TR5A 1TWHH 2EDGA 1TWAB 2NZHA 3HOXG 2DGYA 1NR2A 1UE5A 3QO2A 2H5XA 2L1BA 5K36G 1SEBD 5AFWA 4Q0FA 1LT4D 5IP7G 2BE5D 2RDHA 3I4OA 4DR1L 2EOTA 4B9XA 3S17H 3C46A 1QE6A 4KY7A 4IZ8A 4DR1Q 5FLMH 2Q8IB 3KF6A 2UU9L 3BDLA 2ZJRA 4A3FB 5M5XH 2PI2A 5E7NA 1YEZA 2C9OA 4ME5A 2ALYB 3G48A 4HJ8A 1STAA 3ND9A 2D9UA 4LWCA 5EKIA 1STEA 2A6EC 1Y8NB 2UXDL 5L37A 1I50B 2FMMA 5HURA 2UXDQ 2KQ3A 3HRZC 5E3FA 2A19A 4A3DG 4TKOB 2QKIC 4GKKQ 3WOEA 2K28A 2Q2TA 1MD2D 3V2TA 3GTJH 3HOVG 2KENA 1HUNA 3W3AA 4DV6Q 4P75A 4OONA 3KK7A 4JC0A 4LF7L 1RTNA 3AB9A 3NP8A 4JG2A 3SHLA 1EIFA 2A6HD 4R4QA 2TMPA 2JA6B 2B2UC 4LF7Q 1PH5A 1D7QA 3OIPA 1PRTF 4HIKA 4HJAA 3J80i 1SNMA 3WDNA 5JJKA 2K5WA 1SFOH 3V05A 5IYDG 2LXKA 3TDQA 1HTPA 3O13A 1V9PA 2F3IA 1VQIA 3T51B 4LFCL 2RA4A 1VQ4A 1F9SA 1G6ZA 3MEFA 2MO0A 4LFCQ 1U4MA 4XTCS 5KNDA 1BXTA 3T1HL 3LWEA 3BDCA 4ZK9B 4XT3B 2VXWA 2QEJC 4JI4L 5D14A 5CV7A 2CKZB 3MZ5A 3T1HQ 3M3YB 5FJ8H 1AP0A 1XNRQ 4DK0A 1D5ZC 1XMOQ 2C5CA 4QGUA 3D4DA 1GM5A 2NVXB 4G57A 4KD4A 2VS1A 4BY7G 5CV4A 3P75A 2B29A 2KHJA 1IBKL 1JC7A 1F2ZA 1FJGL 1BKBA 2Z9HA 4NXML 2A73B 4P74A 2K01A 1IBKQ 1FJGQ 4NXMQ 3C1EA 3RN2A 2B2WA 1I6HH 4DR6L 2VUMB 1IL8A 3J7A5 1A63A 5JEAJ 2NVQH 4HIOA 3PUWA 2PZWA 2Z0SA 3HKZB 3H0GB 2SDFA 2JQOA 1SR3A 5IP9G 5IGBA 4B3ML 2OCEA 5M5WH 1KDBA 3I4MB 2A68C 3IFDA 1J6QA 3UDGA 4ID6A 4KK7A 1EFID 3KLSX 2WKDA 1WTVA 5M3FH 4MIUA 1K8GA 1E1OA 1M4VA 4C2MH 3HOWH 2OTJA 1V43A 1KNAA 2Z8LA 4JBJA 1UWVA 4GNXC 2N88A 5J1ZA 1T5EA 1N8RC 1NCVA 3A0JA 1WTPA 5LHY1 2R6GA 5LMNL 1B2TA 3CKIB 2HIXA 3PO2H 1EZ8A 3EVQA 5EPLA 3NTIA 1R4QB 2ZXPA 3ICEA 3KF6B 3VA7A 4PQXA 4CHTB 2Z6KC 1JWMD 4U68A 3QIAA 4NP5A 4A3IG 3OIQA 4IALA 1F9RA 5GAHC 1G51A 5J22A 3HOZH 3RZOH 2R93H 3M7NA 3QB3A 1RIPA 2OQ0A 2KHSA 1QOHA 1K0RA 2ICIA 2QCPX 4BA1I 3CC7A 1Q7YC 1Q86C 1IBLQ 5HGQA 2E2DC 4DV2L 1QCBD 2FXQA 4JI0L 3NTKA 1HNXL 2EPBA 3U58A 3QOLA 1J9OA 2ID0A 4PZ7A 2HCIA 4LF8L 2KECA 2HDMA 4DR4L 1EEID 3A7AB 4CDCC 5CC4A 1LTAD 4DR4Q 5F2DA 4IQZA 3FRPB 1W6KA 1XPOA 4BWGB 1GD7A 4OXPA 1K73C 2F0NA 1TWFB 4RKLA 2CH4A 4JK1C 4GNXB 5ELNA 4RAUC 3NENA 1XTCD 2EY2A 1PH2A 1WCMB 1RCVD 2CW0C 4C3IB 1VQBA 1IBMQ 4GN3B 5DM63 2K52A 4JBMA 1EEFD 4JV5L 4A3MB 2IW3A 4N9TA 4R4CA 4ZQ3A 1Y1WH 3D4RA 2BE5C 4QIWE 4BBRH 1PLFA 3J7AF 3VYRA 4HN7A 4A3BG 5ELFA 3H3VH 1PFSA 4BY1G 2B2TC 3BDOA 4GN4B 1Z6HA 3UE0A 4EQNA 5C6AA 1SXTA 5ISRA 3MXNA 1TS5A 2QF7A 1PFBA 4O2DA 4CBVA 1MBYA 2VB3X 4FXKC 4HEDA 5LMNW 1G2TA 3W1GA 4PNYA 3M7GA 1Q46A 1QJOA 3BZCA 1HNZQ 4E6IA 4DUZQ 2EIFA 1IHZA 1OXVA 1I4QA 3ULPA 4LFAQ 1OO9B 4IPHA 2LMCB 2GVAA 3NQIA 3JAML 1EYAA 4GLAC 5FOBB 3KJOA 2PW7A 4RMFA 5A35A 3V96A 3WWVA 4JI8Q 2ASBA 4WRDA 3P7JA 1CKOA 1I3QH 4ZKCB 2F0EA 5I6YA 2Q8TA 3AYHB 3FVQA 5J3BA 2E2IH 4GLXA 4I7ZC 4C3JB 4JOIC 5J39A 1EWCA 4DNTB 2NB0A 1EY4A 4UP8A 3STBD 2VNUD 3HGBA 5M3MH 5C4XG 4WORA 1VQJA 1KLGD 2KJXA 1BNZA 4XYQA 4X66L 3GDEA 1TIID 3AMUA 1HZAA 3KOJA 5HY6A 1VQ8A 4B3RL 1C8CA 5E4XA 2PYKA 4L5QA 2E2IB 1KDCA 1KHIA 4B3RQ 2HT1A 1LT6D 3GTMH 1XPRA 4WFN3 1UEBA 3PIO3 2SNSA 2IY5B 2WB1G 1Q82C 3S1QB 1I4XA 3TZUA 4DR5L 5JPNC 1XMQL 1N9WA 2DN8A 3PUVA 1YNXA 4A3JG 4L5RC 3CAMA 1TY0A 3MXPA 4ZYSA 3OPOA 3K5NA 4DV7L 1XMQQ 1VQHA 1O7IA 1YNNC 2E2HH 4DV7Q 5JAVA 4M1UB 4KI0A 4DFAA 1GUNA 4JBKA 1JCKB 2AQ3B 2YTXA 1SMYD 3I4NG 1HA5A 4OGQC 3EFXD 2RKSA 3L2PA 2UXCL 1ICFB 1EIGA 5KNBA 4GKJQ 2UXCQ 4HIDA 1D5MC 1A62A 2LKVA 4ULLA 2JA5G 3FPPA 4IJLA 2B2YA 2HQEA 1YBYA 2E2HB 1VQNA 1NAPA 3OW2A 2R92H 4K8IA 4RCNA 4OWXB 2R7DA 1O80A 1TXYA 1SROA 4OL7A 2VZAA 2JYOA 4QUCA 1I6VC 2K33A 4FDBA 1C7YA 1CA6A 2XSCA 3M4YA 2JA7B 2L9HA 4AH6A 1H9KA 4HAEA 3VYTA 1MIUA 4CDDC 1VQEA 2ZT9C 3T4AC 1JICA 1Q1EA 1ONLA 1N33L 3TP6A 3U4VA 3E5SA 3S1MB 4MTNA 1C0AA 1H9SB 1TU2B 3BZDB 1JOQA 2IT1A 1E2VA 1V1OA 1M8AA 4RCOA 1EY8A 4K5XA 3PIPA 1LTLA 1QNUA 1STGA 4AYBB 2CFMA 4JPBW 4IOCA 1F9PA 4Y52H 2UUBQ 1WTHA 4LUZA 1YNJD 5KEEA 1JQYD 1A6XA 2V4DA 3U50C 5H1SE 2MGSA 1GHKA 4DNIA 2ZJPA 3CCVA 2UUAL 5NUCA 1Y1VG 4EGVA 1B8AA 1CQFA 1WD0A 3PV0A 1D6EC 3CRKC 2I5MX 5C3EB 3SEBA 1XXGA 1BBUA 2WACA 1GUWA 1JWUD 1QVCA 1JT8A 2XNAC 4UPAA 3PGZA 2ZTEA 1RL2A 5EJWA 3BVZA 4JI2Q 2BH2A 4K2LA 3DLLA 2A5HA 3OSOA 4DR7L 2A8VA 2JA8B 2WIIB 2EZVA 2K6AA 4DR7Q 1D1KA 5LMUL 3A8IE 1CHPD 1E22A 4O1NA 4LF9L 1WTWA 1BCPD 2BDNA 3T16A 5LMUQ 4ZAIA 5C0XG 3K7AB 4KJNA 4LF9Q 1F9QA 1PH7A 1WOCA 1PRTD 4OWTB 1KC8C 1I4RA 2R7ZB 3QWNA 2ZTCA 1RD9D 5BN3A 1IW7D 3KFUA 4NB3A 1H95A 2AUKA 3J81L 1M90C 2JEAI 4K14A 1NTGA 3HOYG 3ZYYX 3HOXB 1PYWD 2YTYA 3E0JA 5G3LF 5IYCG 5E4WC 1VQMA 1II3A 1AZQA 2F52A 3Q22A 4A3EH 4C3HH 4DV1Q 3PCOB 2WFWA 4BBSG 1XPUA 3GTPB 2XRSD 3NPPA 5KYLA 2D2CC 4OO1H 3GO5A 4NKLA 1VQLA 4R1JA 1MJCA 1XX8A 1L0WA 1JE5A 1Q81C 3MXGA 5C44H 1S40A 2K5VA 1V1PB 4I7AA 1CZGA 2YV5A 3I4LA 4AYBG 4Y7NH 4AQYL 3H3VI 3STBC 3HOUB 1LTRD 1X54A 4B08A 5KGUA 1CFMA 1NE3A 3PF5A 4A3DB 2UUCL 1LLRD 4WJWA 3NBHA 1B70B 4P72A 1VQGA 4A93H 1CA5A 2RSNA 3HOVB 3EA6A 1X32A 4DN4M 1BO0A 2AWNA 3S14B 2Y0SE 4DV5Q 3PMFA 5CV6A 5IODA 4Y7NB 2EXDA 3GTOH 5C3EG 3T1YL 3CCLA 4LK1C 5JOBA 3U9SA 4YCUA 4DK3C 1H9RA 1TKWB 1LV9A 1PMRA 4X65L 3CQZH 1SYFA 3GTQH 3GTGH 2PZTA 1KLUD 2Z4IA 4BY7H 3JAMi 1TWAH 4X3KA 5DAUA 1SLJA 3C3LA 3HZXA 1PTOD 2KHIA 5GQOA 2ZJQA 1X6OA 4A3CH 2K03A 5KRUA 1IYVA 4J8QA 1HZ9A 1I4HA 1IZ6A 1G2SA 4IUNA 4IFDG 4A3GG 4UHVA 3T56B 5C0XI 1CKMA 3Q8DA 1TVXA 2MHVA 4DXGA 1VQAA 3LX0A 5JEAG 3CQZB 4EX5A 4A3FH 1DGSA 1E2ZA 4HSVA 3MFYA 1QG7A 3K5OA 3CC2A 4BY7B 5IP9H 1FGBD 3BVGA 4ZCKA 2B2VA 2A69D 1K3BC 1HNWL 1SJED 5C0XJ 1RJTA 1QB5D 2B63G 1ASZA 2JJQA 5D3IB 1T5XD 4XIGS 2WAQB 1EQRA 1I50H 3CHBD 3F1ZA 2AWOA 4JI1L 1O7LA 4JI1Q 3AU7A 5C3XA 5IWAL 3RN5A 3H15A 2UU9Q 1QWYA 3ND8A 1CQVA 1MI2A 1ICWA 1X56A 3DXJC 4A3IH 2BH8A 4A3LG 4CKBA 2EYPA 3HOUG 1QILA 2JA6H 4KN4C 5FO7B 2PMZE 2LXJA 3KDFA 3M4PA 2K75A 4F8MA 1HJPA 3MC0B 1FGUA 4FP5D 4LMQD 1W3SA 4JI3L 4GZYC 1OXXK 1PDQA 1VQDA 3PUYA 3PUZA 4RH6A 3RUZA 3FKIG 4GOPC 2MJ8A 5JPMC 4DAYB 1G291 4A3IB 3U9OA 5EKKA 2L4NA 1PA6A 3MFGA 4ZLTF 1EU4A 1C9OA 4IO9A 1U9RA 5BR8L 4MZ9A 1CZWA 1O7ZA 1ZKOA 5BR8Q 1ZYRC 4H0LC 4ZUIA 3KF8A 3M3YH 3AFPA 4DV3L 2NVXH 2EE1A 3CCSA 1LACA 2MO1A 1X3EA 3NE5B 3BU2A 4OWWB 4XQQA 4KHVA 4A76A 4BXXG 2VUMH 1BCPC 1JORA 3TZDA 2ES2A 4KY6A 3CMAA 4X3UA 1SE4A 1BUVT 4JI4Q 2CCZA 2XVSA 3H0GH 5FKAC 4IFDI 1SYEA 3EN2A 3VR5A 2F0KA 1KD1C 1E7ZA 3CC4A 2EJFC 3I4MH 4PG3A 3BVMA 1D5XC 4AIMA 5GAEC 4GOPB 3P20A 4OEMB 4IFDJ 2K5NA 1PH3A 2WAQG 4ODGA 1ENFA 1VMCA 2EXZA 1PVOA 1RODA 1SNPA 3S15B 1KXLA 1BBWA 2K7VA 4DR6Q 4DAPA 4OX9L 2B8FA 1AE3A 1WTQA 1VMPA 2OT2A 3UI2A 1D8LA 1YJ9A 1ZEQX 2F0OA 1MSHA 4DV4L 1QVFA 4A3BB 4B3MQ 3K59A 3DEPA 2IWHA 3Q24A 3RZDB 5HGTA 4BY1B 4DV4Q 3TEHB 5LL6X 3OTOL 1G91A 1B9NA 2F0HA 2RDGA 2ZXRA 1LM0A 3ERQA 1EQVA 1VQ6A 2RHSB 2PCFB 2RHQB 2N78A 5GAGC 2QA4A 1S4ZA 2L0CA 1BCPB 2NVTB 3E0EA 5LMNQ 1K83B 3D0FA 1UEAB 2F3WA 2CQOA 1XWEA 2GA4B 2F0UA 2MP1A 3K0YA 4HCSA 1ESRA 4LF6L 2PO4A 3NQTA 1OXUA 2NVYB 5FLMG 4K0KL 4GS3A 1NY4A 3A5UA 2Q8RE 1O7YA 1TWFH 2E8GA 1V1QA 1E3PA 3J81i 2E2JB 4R9WA 3BYTB 4DV2Q 2BCOA 3DWAA 5EPKA 1WCMH 4JI0Q 4OO1I 4C3IH 1HNXQ 1KRSA 1B1ZA 2EYHA 5C4XB 4CDFC 4LF8Q 2DNEA 1KAAA 4IUPA 3S24A 5C4JB 3GTKB 3J7AV 1J8IA 1JR0D 4A3MH 2B2WC 1Q12A 2IPKD 4HMJA 3VR4A 5FO9B 3TS0A 2QDLA 3M9BA 1PFNA 3W1BA 1N36L 3K8AA 1N36Q 2LY7A 2WB1B 4L5TA 1HH2P 1KTKA 4YWKA 4R8NA 3J81j 5EBCA 3D8GA 4A3JB 1H9MA 2XRQD 4JV5Q 1STYA 3I90A 1D2BA 4YY3L 4G7HC 3R2IA 3I4NB 2XTIA 2XWJB 3H94A 3I8ZA 4KHPL 2L12A 2SEBD 3LWUA 1B9MA 1GUOA 4KHPQ 2QW7A 3SK6A 2CHBD 2MPMA 2JA5B 2SOBA 2JXMB 3AQQA 3TP8A 3S2DB 1J5EL 1E1TA 3K0XA 2OF1A 1J5EQ 1GUSA 1S72A 4IUUA 1SAPA 1PTOB 1Y8OB 4QQBX 4DK1A 3CD6A 4C3JH 3K58A 4QJFA 3RLOA 1EQTA 4IPDA 1XNQL 1ESFA 4DAMA 1EL0A 4RHSA 1L2FA 1VQ5A 2WP8J 1XNQQ 4XQNA 4L63B 4UP9A 2I5HA 2DY8A 3K5LA 1CKNA 4B3SL 1CUKA 5M9OA 2HHHL 2ZXOA 1WTXA 2A6HC 3MEHA 1TS3A 3CP0A 1S5DD 4JCVE 2X6LA 3RD4A 1ILPA 4DAVA 4A4IA 4DNRB 2ZM6L 5IGCA 1LTTD 3OOCA 1HUMA 1I94L 1DJRD 1Q8IA 5G3LD 2ZM6Q 3S1QH 4X64L 1I94Q 1FL0A 2KUMA 1EY0A 4OHJA 4DKAC 1UE7A 5IGFA 1Z47A 1PH9A 4X66Q 1XYIA 5D65A 3PO2G 3AFQA 1VQ9A 3A56A 1YITA 3H91A 2NN6H 3QR8A 5IY0A 2YTVA 4A3KG 3EJIA 1TWGB 3DMUA 3GP7A 1WTOA 1QUQA 4LAAA 3BZKA 3D31A 1HQRD 1DYQA 5BN5A 3HOZG 1Y1VB 3URYA 2KCNA 1GXDC 1MKHA 1STHA 1BBXC 2R93G 4DK6C 2KCMA 2E5LL 1SJHD 1SNQA 3G6EA 3KLWA 3VYSA 3HKZE 5C4HA 2F0MA 4Q5VA 4DR5Q 2BOSA 5IYBH 1LT3D 3RLFA 1L0XB 4C1NK 2IJ0A 5E1FA 3R8BA 3KYHC 2VQEL 3ONAB 1GJXA 3TS2A 1FNVA 1I4GA 1MGSA 3CCJA 1B50A 1U5KA 2VQEQ 5IT9E 1TWCB 1CSQA 2F0IA 1NBWA 1B7YB 1CHQD 2K04A 2RCNA 2JK8A 1VF7A 1SMXA 3MHBA 2F03A 1S3OA 1YI2A 1XTDA 3ULJA 3GTLB 2JA7H 4C56C 4TSSA 1R4PB 1TT2A 3S1RB 4F88A 3PO3G 2AUJD 1L1OA 4JI5L 4IUTA 3S1MH 3DEOA 4X3TA 4O0AA 1WTRA 1JB7A 3HOYB 5IT9c 2CWAA 2F0QA 1PZJD 5EKLA 4JI5Q 5LL6S 4CKCA 5I9PA 5CORA 1QNKA 4QF4A 1SNDA 2Q2HA 3FHWA 3VR6A 2E75C 3I72A 4EVOA 5EQ0A 1Y1WG 2OWOA 2ICEC 4ZUJA 2YYZA 3F2UA 3GD7A 1F77A 4BBRG 3MXNB 5KIXA 4BBSB 3ER0A 3I3CA 4JYAL 1E0BA 4K5WA 4L5SA 1N33Q 1EIYB 4RGOS 2OEOA 5M5YB 4J15A 1OXSC 4HMIA 1PYBA 3S1NB 1TS2A 1YJWA 2SNMA 3VYUA 2O4XA 4U673 2OTLA 1EIHA 1H9JA 1A8VA 1BDOA 2F0DA 4KMUC 1RHPA 5C3EH 2PZUA 4P73A 1SE8A 4YIJA 1PFMA 1TY2A 3KLRA 3D6CA 3SK8A 3FDTA 3L0OA 2LS01 3K5MA 2JA8H 4LUOA 5I2XA 5CYUA 3F8TA 3GQBA 1DONA 2WKCA 2UUAQ 1CI3M 4KV6A 4X62L 3K7AH 1UE6A 4FNFA 3J7YW 3G6JB 3S2HB 4K2KA 1EUJA 3KLSA 3D6WA 2EY6A 4H02A 1X3GA 2MNAA 2B2YC 2J4XA 2R7ZH 1DXMA 5JEAH 3J80E 5M3MG 1N32L 1HQMC 2JN4A 3SGIA 1CT1D 4HTHA 3CRLC 2KBNA 1N32Q 3HOXH 2R7FA 2Y0SG 5K36H 2K05A
chains in the Genus database with same CATH topology
4JI1L 3ICEA 5IP7H 1EOVA 3KF6B 4JI1Q 1TWCH 2Z6KC 3NELA 1P8LA 5IWAL 3RN5A 2ZTDA 3J7ZC 3H15A 4A3IG 2UU9Q 5GAHC 1G51A 3HOZH 2E5LQ 3GTPH 3J80c 2JEBI 2RF4A 3RZOH 2R93H 2GVBA 3UDIA 3M4QA 3GTLH 1X56A 3M7NA 1RIPA 2OQ0A 4BA1I 4A3IH 1K0RA 3HKSA 3CC7A 1Q7YC 1Q86C 1IBLQ 1WCMG 2BH8A 4A3LG 5HGQA 3HOUG 3S1RH 2JA6H 2PMZE 3TREA 2LXJA 4DV2L 3KDFA 2GN5A 2FXQA 2K75A 3B6YA 3M4PA 4JI0L 1KQSA 1HJPA 4GLVB 1HNXL 3U58A 3HOYH 4LFBL 4A3LH 1FGUA 2ID0A 2I5LX 3HOUH 3VDYA 2F4VL 4PZ7A 4LF8L 5IYCH 2K14A 1W3SA 4DR3L 4JI3L 4A3MG 4DR4L 1OXXK 1VQDA 3PUYA 1PH4A 3A5ZB 3PUZA 4P71A 4A3DH 3FKIG 4GOPC 1Y14B 1VCIA 4DR3Q 1KL9A 1YVCA 4DR4Q 2A1AA 4DAYB 1G291 1XPOA 1U0LA 3HOVH 1GD7A 2PQAA 4OXPA 1K73C 1PA6A 2PNHA 1CSPA 4BBSH 4GNXB 1C9OA 1GKHA 1WYDA 2N3SA 4IO9A 4NPSA 4MZ9A 5ELNA 5BR8L 3S14H 2PI2E 3NENA 1PH2A 4GKJL 5BR8Q 5M5YH 1VQBA 1GO3E 3M3YH 1IBMQ 3S1NH 4AQYQ 3JAMc 4GN3B 1WJJA 3AFPA 2K52A 4DV3L 1PYSB 2NVXH 4JBMA 2N8NA 4PZ8A 3CCSA 4JV5L 2UUCQ 2MO1A 3A74A 5IYDH 1X3EA 3U4ZA 3BU2A 4OWWB 3E9IA 4R4CA 4R4OA 4JI6L 2AMCB 3CCUA 3OYYA 1Y1WH 3M85A 2I0QA 5JJIA 3PIOA 4A76A 1NMGA 4BXXG 2VUMH 4QIWE 4BBRH 4JYAQ 2D62A 5FLXc 1YHQA 2ES2A 3CMAA 1G6PA 1QZHA 3E9HA 4JI4Q 4A3BG 3T1YQ 2CCZA 1K9MC 3H0GH 4IFDI 3H3VH 1PFSA 3EN2A 4BY1G 1VQKA 4GN4B 1KD1C 1E7ZA 3UE0A 3CC4A 4ME3A 4RG1A 3I4MH 2EQSA 4PG3A 3F2CA 4HJ5A 3S2HH 1PH8A 4O2DA 4UP7A 4AIMA 1IL2A 5GAEC 4GOPB 4X65Q 5LMNW 3W1GA 4IFDJ 2K5NA 1Q46A 3BZCA 1PH3A 2WAQG 3ERSX 1CKNB 1EWIA 1VS0A 4DUZQ 1HNZQ 2EIFA 1PVOA 1OXVA 4B3TL 2WB1E 3ULPA 1SN8A 1X55A 4LFAQ 3TRZA 1KXLA 1BBWA 4IPHA 2UUAL 4DR6Q 2C35B 2XGTA 4B3TQ 3I7FA 4OX9L 2GVAA 5ELOA 1HR0L 2UUBL 4GLAC 3KJOA 1AE3A 3CCMA 1D8LA 1YJ9A 1HR0Q 4RMFA 1SRUA 3WWVA 3CXCA 4X62Q 4LNQA 4JI8Q 4DV4L 1JMCA 2NN6I 1QVFA 2ASBA 4B3MQ 3ULLA 4A3GH 1CKOA 4DV4Q 1PH6A 3G4SA 1I3QH 3TEHB 3OTOL 1YIJA 3AYHB 5J3BA 3EBEA 2N49A 1VQCA 3CCRA 2E2IH 4GLXA 4IOAA 3F2DA 4QY7A 1LM0A 1HNWQ 4JOIC 1L1OC 1VQ6A 2RHSB 1EQQA 3CCEA 4UP8A 1KRTA 3STBD 2RHQB 2VNUD 2N78A 2B63H 5GAGC 1JJ2A 2QA4A 3JC66 1QUQB 5M3MH 5C4XG 3BJUA 4JI2L 1VQJA 3RNUA 2Q2UA 3E0EA 3FP9A 3UDXA 5LMNQ 1M1KC 1YHBA 2NN6G 3D0FA 4X66L 3RLNA 3GDEA 2AWOA 2CQOA 1HZAA 2IX1A 4LF4L 3KOJA 2K5HA 5IWAQ 5HY6A 1VQ8A 4B3RL 4LF6L 4L5QA 4AYBE 1OXUA 1X65A 5FLMG 4LF4Q 4K0KL 4LF5L 4GS3A 1KHIA 4B3RQ 1NY4A 2Q2IA 3A5UA 4PZ6A 2HT1A 4IPGA 1TWFH 2E8GA 4HIMA 4QL5A 4LF5Q 3I56A 5EAYA 1V1QA 1E3PA 3J81i 3GTMH 1XPRA 3I2ZA 1UEBA 3I55A 1HZCA 2IY5B 2WB1G 4DV2Q 1Q82C 5IYBG 1WCMH 2HIVA 4JI0Q 4OO1I 1FVIA 4YWLA 4C3IH 4ALPA 3CMEA 4DR5L 2IX0A 1HNXQ 1KRSA 1XMQL 4LFBQ 1N9WA 3PUVA 1YNXA 4A3JG 4L5RC 2F4VQ 3CAMA 3M4OH 3K7UC 4LF8Q 4DV7L 4A75A 1XMQQ 1NJIC 1IXRA 4JI3Q 1VQHA 1O7IA 3DM3A 3S24A 4POFA 4A3EG 2E2HH 4DV7Q 4A3MH 4KI0A 1AE2A 4JBKA 2PQAB 3FKIH 4GKKL 1IYJB 2YTXA 1Q12A 3TS0A 4DV1L 3I4NG 3PO2H 5JJLA 4YWMA 4R4IA 3L2PA 3M9BA 3W1BA 1L1OB 1VQOA 3ZJYC 4DV6L 1N36L 2UXCL 1R9TH 2JA7G 4OO1G 3L7ZC 3CPFA 2AHOB 1A0IA 4TVAB 4GKJQ 3K8AA 4HIDA 1N36Q 4KHZA 4EQ5A 1A62A 2UXCQ 2QGQA 2JA5G 2NZOA 2JA9A 2R92G 4IJLA 5C44G 4L5TA 1YBYA 1HH2P 3NBHB 4YWKA 2VQFL 3J81j 4DV0L 4DV3Q 2IHEA 4GNXA 1VQPA 1P16A 1VQNA 2VQFQ 4JV5Q 3OW2A 2R92H 1HR0W 4DV0Q 3S16H 3NEMA 1BVSA 4OWXB 4YY3L 2R7DA 2B3GA 1TXYA 2KCTA 1QZGA 1SROA 4JI6Q 2VZAA 2BA0A 2MFIA 2HQLA 1YJNA 4A93G 3S15H 1HZBA 2XTIA 4FDBA 1C7YA 1WI5A 4KHPL 2Z6KA 3KJPA 1LYLA 2CWPA 4NXNL 4BXXH 2VY3A 4JBWA 4AH6A 1ASYA 4KHPQ 5AJ3L 1MIUA 4NXNQ 4DV5L 1T9HA 1I5FA 1VQEA 3AQQA 1Q1EA 5DLQE 1N33L 4A3BH 5AJ3Q 1PH1A 1PHJA 3RZDH 1J5EL 3U4VA 1E1TA 1GVPA 4BY1H 1WFQA 3K0XA 4MTNA 1XNRL 1Q1BA 2LSSA 1XMOL 1J5EQ 1S72A 1C0AA 2IT1A 1PV4A 3PIPA 3CD6A 2V1CC 4QQBX 1LTLA 4C3JH 1KIXA 3CCQA 4QJFA 3RLOA 4IPDA 1XNQL 1YZ6A 2QEXA 2CFMA 4DAMA 4IOCA 1L2FA 1VQ5A 2WP8J 1XNQQ 4OX9Q 2NVTH 4Y52H 3K81C 2UUBQ 2JA8G 1Q8KA 4A3CG 1K83H 4GOPA 4GN5A 2YU9H 3HFZB 4UP9A 2I5HA 3TQYA 4LUZA 4IPCA 1CKNA 4B3SL 1CUKA 1XJVA 3U50C 5H1SE 1K8AC 3J81c 2HHHL 4LUVA 2D0PA 3PSIA 2JE6I 3CPWA 3CP0A 4APVA 4YCVA 4DNIA 2ZJPA 3CCVA 2K50A 3OTOQ 2NVYH 2VL6A 1W2BA 4BA2I 4WJ4A 1Y1VG 4JCVE 1B8AA 4A3FG 4UY8C 3PV0A 3PUXA 2IHFA 1JJCB 3CF5A 4A4IA 4KLKA 2R7ZG 2I5MX 2ZM6L 4JI7L 1BBUA 1N34L 3G71A 1QVCA 1K3RA 1I94L 2E2JH 1JT8A 4UPAA 2ZM6Q 3PGZA 2ZTEA 4JI7Q 1RL2A 4JI2Q 3S1QH 1N34Q 4X64L 2VW9A 2BH2A 2BA1A 2OQKA 1I94Q 1FL0A 1TWHH 3DLLA 4DKAC 2NZHA 4DR7L 5C4XH 3HOXG 2DGYA 1UE7A 1UE5A 1PH9A 1Z47A 2H5XA 4X66Q 1AH9A 2A8VA 5K36G 3PO2G 3AFQA 1VQ9A 2DUDA 1YITA 4DR7Q 5IY0A 4POGA 2YTVA 5C4JH 5IP7G 5LMUL 4A3KG 2K4KA 3GTKH 4LF6Q 1E22A 3I4OA 4DR1L 4LF9L 1QUQA 4K0KQ 3S17H 5LMUQ 3BZKA 5C0XG 3D31A 4DR1Q 5FLMH 4LF9Q 3KF6A 3KDFB 2UU9L 3HOZG 3LGJA 2ZJRA 4A3KH 1PH7A 1WOCA 1MKHA 5M5XH 2PI2A 2R93G 4DK6C 4OWTB 5E7NA 4HJ7A 1KC8C 4YCWA 2KCMA 2UXBL 2E5LL 1YEZA 2ZTCA 3PF4A 2ALYB 4X6AH 3G6EA 3KLWA 4HJ9A 2JA6G 1X3FA 3G48A 4HJ8A 3HKZE 1EFWA 4NB3A 3KFUA 2UXBQ 1H95A 1IBLL 4DR5Q 1M90C 4LWCA 1OXTA 4IJHA 5IYBH 2JEAI 3RLFA 2UXDL 1NTGA 3HOYG 1Z9FA 3EIVA 1MJEA 2YTYA 3IRBA 3KYHC 2VQEL 4A3JH 5IYCG 4YHHL 2ATWA 2UXDQ 1VQMA 3TS2A 2A19A 4A3DG 3CCJA 2F52A 1U5KA 2VQEQ 4YHHQ 4A3EH 4C3HH 4GKKQ 1CSQA 2Q2TA 4DV1Q 1NBWA 3GTJH 3F2BA 1B7YB 2KENA 3HOVG 3PCOB 2AKWB 2RCNA 2JK8A 2WFWA 3KF8B 1SMXA 4DV6Q 4P75A 3I4NH 4OONA 4BBSG 1S3OA 1YI2A 2WAQE 1XPUA 1XTDA 3ULJA 4JC0A 3K80C 4LF7L 2JA7H 4JG2A 3GO5A 1EIFA 3RR5A 1UE1A 4R4QA 1VQLA 4R1JA 4LF7Q 1JJGA 1MJCA 1L0WA 1PH5A 1JE5A 2JA5H 4LW1A 1Q81C 3PO3G 3S2DH 1D7QA 4JOIA 5C44H 1L1OA 1S40A 2K5VA 1YHAA 4JI5L 4HIKA 3S1MH 4O0AA 4DPGA 2YV5A 4HJAA 1JB7A 2D0OA 4AYBG 3J80i 5IT9c 2CWAA 4Y7NH 4AQYL 3STBC 1IBML 3H3VI 5JJKA 3W5OA 4JI5Q 1SFOH 1X54A 3PO3H 4YY3Q 5IYDG 1NE3A 1VQFA 3PF5A 1EYGA 2LXKA 2UUCL 2Q2HA 3FHWA 1V9PA 2F3IA 1B70B 1VQIA 1QVGA 1Y1WG 4P72A 2OWOA 1VQGA 4LFCL 4A93H 1OTCA 2YYZA 3GD7A 1VQ4A 2VUMG 4BBRG 3MXNB 3MEFA 2MO0A 4LFCQ 3UDFA 3ER0A 4XTCS 5FJ8G 5IE8A 4R4TA 2AWNA 2MQHA 4JYAL 3HKZG 2Y0SE 4DV5Q 4PMWA 3T1HL 3H0GG 4L5SA 4DR2L 1EIYB 1N33Q 2EXDA 3GTOH 4JI4L 4J15A 2CKZB 2L15A 1OXSC 5C3EG 3T1HQ 5FJ8H 3T1YL 3CCLA 3I4MG 1PYBA 5GADC 4DR2Q 1XNRQ 4YCUA 1XMOQ 1YJWA 4QGUA 4DK3C 1GM5A 2OTLA 4BY7G 2VS1A 1A8VA 3UE1A 2B29A 2KHJA 5C3EH 4DUYL 1IBKL 4X65L 1LUZA 3CQZH 4P73A 1FJGL 1SE8A 3GTQH 1BKBA 1HNZL 4NXML 3GTGH 4DUYQ 4P74A 4DUZL 1IBKQ 4BY7H 3JAMi 3L0OA 1FJGQ 1TWAH 4NXMQ 1SLJA 4LFAL 3RN2A 1I6HH 4DR6L 2JA8H 4LUOA 2KHIA 5GQOA 2ZJQA 1X6OA 5JEAJ 3F8TA 4B3SQ 3J7A5 2NVQH 4A3CH 1A63A 4HIOA 3PUWA 2HHHQ 2Z0SA 1KAWA 1HZ9A 1IZ6A 3AEVA 1TWGH 2UUAQ 5M3FG 4IFDG 4X62L 2JQOA 4JI8L 4A3GG 1SR3A 5IP9G 3HOWG 4WJ3M 4B3ML 5C0XI 1CKMA 2OCEA 3K7AH 1UE6A 3Q8DA 5M5WH 1VQAA 5JEAG 1X9NA 1Y1VH 1EUJA 1J6QA 4EX5A 3UDGA 4A3FH 1DGSA 1X3GA 4H02A 1E24A 1K8GA 5M3FH 2MNAA 3CC2A 1E1OA 3CW2C 4C2MH 5IP9H 2R7ZH 3HOWH 2OTJA 4MNOA 1NMFA 1V43A 4JBJA 1HNWL 5C0XJ 1UWVA 4X64Q 4GNXC 1ASZA 2JJQA 2B63G 5M3MG 4TQUS 1N32L 1N8RC 3SGIA 4XIGS 3A0JA 1VQ7A 2KBNA 1N32Q 3HOXH 2R6GA 2R7FA 1EQRA 1I50H 3F1ZA 5LMNL 2Y0SG 2HIXA 5GROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 L;  3ICE A;  5IP7 H;  1EOV A;  3KF6 B;  4JI1 Q;  1TWC H;  2Z6K C;  3NEL A;  1P8L A;  5IWA L;  3RN5 A;  2ZTD A;  3J7Z C;  3H15 A;  4A3I G;  2UU9 Q;  5GAH C;  1G51 A;  3HOZ H;  2E5L Q;  3GTP H;  3J80 c;  2JEB I;  2RF4 A;  3RZO H;  2R93 H;  2GVB A;  3UDI A;  3M4Q A;  3GTL H;  1X56 A;  3M7N A;  1RIP A;  2OQ0 A;  4BA1 I;  4A3I H;  1K0R A;  3HKS A;  3CC7 A;  1Q7Y C;  1Q86 C;  1IBL Q;  1WCM G;  2BH8 A;  4A3L G;  5HGQ A;  3HOU G;  3S1R H;  2JA6 H;  2PMZ E;  3TRE A;  2LXJ A;  4DV2 L;  3KDF A;  2GN5 A;  2FXQ A;  2K75 A;  3B6Y A;  3M4P A;  4JI0 L;  1KQS A;  1HJP A;  4GLV B;  1HNX L;  3U58 A;  3HOY H;  4LFB L;  4A3L H;  1FGU A;  2ID0 A;  2I5L X;  3HOU H;  3VDY A;  2F4V L;  4PZ7 A;  4LF8 L;  5IYC H;  2K14 A;  1W3S A;  4DR3 L;  4JI3 L;  4A3M G;  4DR4 L;  1OXX K;  1VQD A;  3PUY A;  1PH4 A;  3A5Z B;  3PUZ A;  4P71 A;  4A3D H;  3FKI G;  4GOP C;  1Y14 B;  1VCI A;  4DR3 Q;  1KL9 A;  1YVC A;  4DR4 Q;  2A1A A;  4DAY B;  1G29 1;  1XPO A;  1U0L A;  3HOV H;  1GD7 A;  2PQA A;  4OXP A;  1K73 C;  1PA6 A;  2PNH A;  1CSP A;  4BBS H;  4GNX B;  1C9O A;  1GKH A;  1WYD A;  2N3S A;  4IO9 A;  4NPS A;  4MZ9 A;  5ELN A;  5BR8 L;  3S14 H;  2PI2 E;  3NEN A;  1PH2 A;  4GKJ L;  5BR8 Q;  5M5Y H;  1VQB A;  1GO3 E;  3M3Y H;  1IBM Q;  3S1N H;  4AQY Q;  3JAM c;  4GN3 B;  1WJJ A;  3AFP A;  2K52 A;  4DV3 L;  1PYS B;  2NVX H;  4JBM A;  2N8N A;  4PZ8 A;  3CCS A;  4JV5 L;  2UUC Q;  2MO1 A;  3A74 A;  5IYD H;  1X3E A;  3U4Z A;  3BU2 A;  4OWW B;  3E9I A;  4R4C A;  4R4O A;  4JI6 L;  2AMC B;  3CCU A;  3OYY A;  1Y1W H;  3M85 A;  2I0Q A;  5JJI A;  3PIO A;  4A76 A;  1NMG A;  4BXX G;  2VUM H;  4QIW E;  4BBR H;  4JYA Q;  2D62 A;  5FLX c;  1YHQ A;  2ES2 A;  3CMA A;  1G6P A;  1QZH A;  3E9H A;  4JI4 Q;  4A3B G;  3T1Y Q;  2CCZ A;  1K9M C;  3H0G H;  4IFD I;  3H3V H;  1PFS A;  3EN2 A;  4BY1 G;  1VQK A;  4GN4 B;  1KD1 C;  1E7Z A;  3UE0 A;  3CC4 A;  4ME3 A;  4RG1 A;  3I4M H;  2EQS A;  4PG3 A;  3F2C A;  4HJ5 A;  3S2H H;  1PH8 A;  4O2D A;  4UP7 A;  4AIM A;  1IL2 A;  5GAE C;  4GOP B;  4X65 Q;  5LMN W;  3W1G A;  4IFD J;  2K5N A;  1Q46 A;  3BZC A;  1PH3 A;  2WAQ G;  3ERS X;  1CKN B;  1EWI A;  1VS0 A;  4DUZ Q;  1HNZ Q;  2EIF A;  1PVO A;  1OXV A;  4B3T L;  2WB1 E;  3ULP A;  1SN8 A;  1X55 A;  4LFA Q;  3TRZ A;  1KXL A;  1BBW A;  4IPH A;  2UUA L;  4DR6 Q;  2C35 B;  2XGT A;  4B3T Q;  3I7F A;  4OX9 L;  2GVA A;  5ELO A;  1HR0 L;  2UUB L;  4GLA C;  3KJO A;  1AE3 A;  3CCM A;  1D8L A;  1YJ9 A;  1HR0 Q;  4RMF A;  1SRU A;  3WWV A;  3CXC A;  4X62 Q;  4LNQ A;  4JI8 Q;  4DV4 L;  1JMC A;  2NN6 I;  1QVF A;  2ASB A;  4B3M Q;  3ULL A;  4A3G H;  1CKO A;  4DV4 Q;  1PH6 A;  3G4S A;  1I3Q H;  3TEH B;  3OTO L;  1YIJ A;  3AYH B;  5J3B A;  3EBE A;  2N49 A;  1VQC A;  3CCR A;  2E2I H;  4GLX A;  4IOA A;  3F2D A;  4QY7 A;  1LM0 A;  1HNW Q;  4JOI C;  1L1O C;  1VQ6 A;  2RHS B;  1EQQ A;  3CCE A;  4UP8 A;  1KRT A;  3STB D;  2RHQ B;  2VNU D;  2N78 A;  2B63 H;  5GAG C;  1JJ2 A;  2QA4 A;  3JC6 6;  1QUQ B;  5M3M H;  5C4X G;  3BJU A;  4JI2 L;  1VQJ A;  3RNU A;  2Q2U A;  3E0E A;  3FP9 A;  3UDX A;  5LMN Q;  1M1K C;  1YHB A;  2NN6 G;  3D0F A;  4X66 L;  3RLN A;  3GDE A;  2AWO A;  2CQO A;  1HZA A;  2IX1 A;  4LF4 L;  3KOJ A;  2K5H A;  5IWA Q;  5HY6 A;  1VQ8 A;  4B3R L;  4LF6 L;  4L5Q A;  4AYB E;  1OXU A;  1X65 A;  5FLM G;  4LF4 Q;  4K0K L;  4LF5 L;  4GS3 A;  1KHI A;  4B3R Q;  1NY4 A;  2Q2I A;  3A5U A;  4PZ6 A;  2HT1 A;  4IPG A;  1TWF H;  2E8G A;  4HIM A;  4QL5 A;  4LF5 Q;  3I56 A;  5EAY A;  1V1Q A;  1E3P A;  3J81 i;  3GTM H;  1XPR A;  3I2Z A;  1UEB A;  3I55 A;  1HZC A;  2IY5 B;  2WB1 G;  4DV2 Q;  1Q82 C;  5IYB G;  1WCM H;  2HIV A;  4JI0 Q;  4OO1 I;  1FVI A;  4YWL A;  4C3I H;  4ALP A;  3CME A;  4DR5 L;  2IX0 A;  1HNX Q;  1KRS A;  1XMQ L;  4LFB Q;  1N9W A;  3PUV A;  1YNX A;  4A3J G;  4L5R C;  2F4V Q;  3CAM A;  3M4O H;  3K7U C;  4LF8 Q;  4DV7 L;  4A75 A;  1XMQ Q;  1NJI C;  1IXR A;  4JI3 Q;  1VQH A;  1O7I A;  3DM3 A;  3S24 A;  4POF A;  4A3E G;  2E2H H;  4DV7 Q;  4A3M H;  4KI0 A;  1AE2 A;  4JBK A;  2PQA B;  3FKI H;  4GKK L;  1IYJ B;  2YTX A;  1Q12 A;  3TS0 A;  4DV1 L;  3I4N G;  3PO2 H;  5JJL A;  4YWM A;  4R4I A;  3L2P A;  3M9B A;  3W1B A;  1L1O B;  1VQO A;  3ZJY C;  4DV6 L;  1N36 L;  2UXC L;  1R9T H;  2JA7 G;  4OO1 G;  3L7Z C;  3CPF A;  2AHO B;  1A0I A;  4TVA B;  4GKJ Q;  3K8A A;  4HID A;  1N36 Q;  4KHZ A;  4EQ5 A;  1A62 A;  2UXC Q;  2QGQ A;  2JA5 G;  2NZO A;  2JA9 A;  2R92 G;  4IJL A;  5C44 G;  4L5T A;  1YBY A;  1HH2 P;  3NBH B;  4YWK A;  2VQF L;  3J81 j;  4DV0 L;  4DV3 Q;  2IHE A;  4GNX A;  1VQP A;  1P16 A;  1VQN A;  2VQF Q;  4JV5 Q;  3OW2 A;  2R92 H;  1HR0 W;  4DV0 Q;  3S16 H;  3NEM A;  1BVS A;  4OWX B;  4YY3 L;  2R7D A;  2B3G A;  1TXY A;  2KCT A;  1QZG A;  1SRO A;  4JI6 Q;  2VZA A;  2BA0 A;  2MFI A;  2HQL A;  1YJN A;  4A93 G;  3S15 H;  1HZB A;  2XTI A;  4FDB A;  1C7Y A;  1WI5 A;  4KHP L;  2Z6K A;  3KJP A;  1LYL A;  2CWP A;  4NXN L;  4BXX H;  2VY3 A;  4JBW A;  4AH6 A;  1ASY A;  4KHP Q;  5AJ3 L;  1MIU A;  4NXN Q;  4DV5 L;  1T9H A;  1I5F A;  1VQE A;  3AQQ A;  1Q1E A;  5DLQ E;  1N33 L;  4A3B H;  5AJ3 Q;  1PH1 A;  1PHJ A;  3RZD H;  1J5E L;  3U4V A;  1E1T A;  1GVP A;  4BY1 H;  1WFQ A;  3K0X A;  4MTN A;  1XNR L;  1Q1B A;  2LSS A;  1XMO L;  1J5E Q;  1S72 A;  1C0A A;  2IT1 A;  1PV4 A;  3PIP A;  3CD6 A;  2V1C C;  4QQB X;  1LTL A;  4C3J H;  1KIX A;  3CCQ A;  4QJF A;  3RLO A;  4IPD A;  1XNQ L;  1YZ6 A;  2QEX A;  2CFM A;  4DAM A;  4IOC A;  1L2F A;  1VQ5 A;  2WP8 J;  1XNQ Q;  4OX9 Q;  2NVT H;  4Y52 H;  3K81 C;  2UUB Q;  2JA8 G;  1Q8K A;  4A3C G;  1K83 H;  4GOP A;  4GN5 A;  2YU9 H;  3HFZ B;  4UP9 A;  2I5H A;  3TQY A;  4LUZ A;  4IPC A;  1CKN A;  4B3S L;  1CUK A;  1XJV A;  3U50 C;  5H1S E;  1K8A C;  3J81 c;  2HHH L;  4LUV A;  2D0P A;  3PSI A;  2JE6 I;  3CPW A;  3CP0 A;  4APV A;  4YCV A;  4DNI A;  2ZJP A;  3CCV A;  2K50 A;  3OTO Q;  2NVY H;  2VL6 A;  1W2B A;  4BA2 I;  4WJ4 A;  1Y1V G;  4JCV E;  1B8A A;  4A3F G;  4UY8 C;  3PV0 A;  3PUX A;  2IHF A;  1JJC B;  3CF5 A;  4A4I A;  4KLK A;  2R7Z G;  2I5M X;  2ZM6 L;  4JI7 L;  1BBU A;  1N34 L;  3G71 A;  1QVC A;  1K3R A;  1I94 L;  2E2J H;  1JT8 A;  4UPA A;  2ZM6 Q;  3PGZ A;  2ZTE A;  4JI7 Q;  1RL2 A;  4JI2 Q;  3S1Q H;  1N34 Q;  4X64 L;  2VW9 A;  2BH2 A;  2BA1 A;  2OQK A;  1I94 Q;  1FL0 A;  1TWH H;  3DLL A;  4DKA C;  2NZH A;  4DR7 L;  5C4X H;  3HOX G;  2DGY A;  1UE7 A;  1UE5 A;  1PH9 A;  1Z47 A;  2H5X A;  4X66 Q;  1AH9 A;  2A8V A;  5K36 G;  3PO2 G;  3AFQ A;  1VQ9 A;  2DUD A;  1YIT A;  4DR7 Q;  5IY0 A;  4POG A;  2YTV A;  5C4J H;  5IP7 G;  5LMU L;  4A3K G;  2K4K A;  3GTK H;  4LF6 Q;  1E22 A;  3I4O A;  4DR1 L;  4LF9 L;  1QUQ A;  4K0K Q;  3S17 H;  5LMU Q;  3BZK A;  5C0X G;  3D31 A;  4DR1 Q;  5FLM H;  4LF9 Q;  3KF6 A;  3KDF B;  2UU9 L;  3HOZ G;  3LGJ A;  2ZJR A;  4A3K H;  1PH7 A;  1WOC A;  1MKH A;  5M5X H;  2PI2 A;  2R93 G;  4DK6 C;  4OWT B;  5E7N A;  4HJ7 A;  1KC8 C;  4YCW A;  2KCM A;  2UXB L;  2E5L L;  1YEZ A;  2ZTC A;  3PF4 A;  2ALY B;  4X6A H;  3G6E A;  3KLW A;  4HJ9 A;  2JA6 G;  1X3F A;  3G48 A;  4HJ8 A;  3HKZ E;  1EFW A;  4NB3 A;  3KFU A;  2UXB Q;  1H95 A;  1IBL L;  4DR5 Q;  1M90 C;  4LWC A;  1OXT A;  4IJH A;  5IYB H;  2JEA I;  3RLF A;  2UXD L;  1NTG A;  3HOY G;  1Z9F A;  3EIV A;  1MJE A;  2YTY A;  3IRB A;  3KYH C;  2VQE L;  4A3J H;  5IYC G;  4YHH L;  2ATW A;  2UXD Q;  1VQM A;  3TS2 A;  2A19 A;  4A3D G;  3CCJ A;  2F52 A;  1U5K A;  2VQE Q;  4YHH Q;  4A3E H;  4C3H H;  4GKK Q;  1CSQ A;  2Q2T A;  4DV1 Q;  1NBW A;  3GTJ H;  3F2B A;  1B7Y B;  2KEN A;  3HOV G;  3PCO B;  2AKW B;  2RCN A;  2JK8 A;  2WFW A;  3KF8 B;  1SMX A;  4DV6 Q;  4P75 A;  3I4N H;  4OON A;  4BBS G;  1S3O A;  1YI2 A;  2WAQ E;  1XPU A;  1XTD A;  3ULJ A;  4JC0 A;  3K80 C;  4LF7 L;  2JA7 H;  4JG2 A;  3GO5 A;  1EIF A;  3RR5 A;  1UE1 A;  4R4Q A;  1VQL A;  4R1J A;  4LF7 Q;  1JJG A;  1MJC A;  1L0W A;  1PH5 A;  1JE5 A;  2JA5 H;  4LW1 A;  1Q81 C;  3PO3 G;  3S2D H;  1D7Q A;  4JOI A;  5C44 H;  1L1O A;  1S40 A;  2K5V A;  1YHA A;  4JI5 L;  4HIK A;  3S1M H;  4O0A A;  4DPG A;  2YV5 A;  4HJA A;  1JB7 A;  2D0O A;  4AYB G;  3J80 i;  5IT9 c;  2CWA A;  4Y7N H;  4AQY L;  3STB C;  1IBM L;  3H3V I;  5JJK A;  3W5O A;  4JI5 Q;  1SFO H;  1X54 A;  3PO3 H;  4YY3 Q;  5IYD G;  1NE3 A;  1VQF A;  3PF5 A;  1EYG A;  2LXK A;  2UUC L;  2Q2H A;  3FHW A;  1V9P A;  2F3I A;  1B70 B;  1VQI A;  1QVG A;  1Y1W G;  4P72 A;  2OWO A;  1VQG A;  4LFC L;  4A93 H;  1OTC A;  2YYZ A;  3GD7 A;  1VQ4 A;  2VUM G;  4BBR G;  3MXN B;  3MEF A;  2MO0 A;  4LFC Q;  3UDF A;  3ER0 A;  4XTC S;  5FJ8 G;  5IE8 A;  4R4T A;  2AWN A;  2MQH A;  4JYA L;  3HKZ G;  2Y0S E;  4DV5 Q;  4PMW A;  3T1H L;  3H0G G;  4L5S A;  4DR2 L;  1EIY B;  1N33 Q;  2EXD A;  3GTO H;  4JI4 L;  4J15 A;  2CKZ B;  2L15 A;  1OXS C;  5C3E G;  3T1H Q;  5FJ8 H;  3T1Y L;  3CCL A;  3I4M G;  1PYB A;  5GAD C;  4DR2 Q;  1XNR Q;  4YCU A;  1XMO Q;  1YJW A;  4QGU A;  4DK3 C;  1GM5 A;  2OTL A;  4BY7 G;  2VS1 A;  1A8V A;  3UE1 A;  2B29 A;  2KHJ A;  5C3E H;  4DUY L;  1IBK L;  4X65 L;  1LUZ A;  3CQZ H;  4P73 A;  1FJG L;  1SE8 A;  3GTQ H;  1BKB A;  1HNZ L;  4NXM L;  3GTG H;  4DUY Q;  4P74 A;  4DUZ L;  1IBK Q;  4BY7 H;  3JAM i;  3L0O A;  1FJG Q;  1TWA H;  4NXM Q;  1SLJ A;  4LFA L;  3RN2 A;  1I6H H;  4DR6 L;  2JA8 H;  4LUO A;  2KHI A;  5GQO A;  2ZJQ A;  1X6O A;  5JEA J;  3F8T A;  4B3S Q;  3J7A 5;  2NVQ H;  4A3C H;  1A63 A;  4HIO A;  3PUW A;  2HHH Q;  2Z0S A;  1KAW A;  1HZ9 A;  1IZ6 A;  3AEV A;  1TWG H;  2UUA Q;  5M3F G;  4IFD G;  4X62 L;  2JQO A;  4JI8 L;  4A3G G;  1SR3 A;  5IP9 G;  3HOW G;  4WJ3 M;  4B3M L;  5C0X I;  1CKM A;  2OCE A;  3K7A H;  1UE6 A;  3Q8D A;  5M5W H;  1VQA A;  5JEA G;  1X9N A;  1Y1V H;  1EUJ A;  1J6Q A;  4EX5 A;  3UDG A;  4A3F H;  1DGS A;  1X3G A;  4H02 A;  1E24 A;  1K8G A;  5M3F H;  2MNA A;  3CC2 A;  1E1O A;  3CW2 C;  4C2M H;  5IP9 H;  2R7Z H;  3HOW H;  2OTJ A;  4MNO A;  1NMF A;  1V43 A;  4JBJ A;  1HNW L;  5C0X J;  1UWV A;  4X64 Q;  4GNX C;  1ASZ A;  2JJQ A;  2B63 G;  5M3M G;  4TQU S;  1N32 L;  1N8R C;  3SGI A;  4XIG S;  3A0J A;  1VQ7 A;  2KBN A;  1N32 Q;  3HOX H;  2R6G A;  2R7F A;  1EQR A;  1I50 H;  3F1Z A;  5LMN L;  2Y0S G;  2HIX A;  5GRO A; 
#chains in the Genus database with same CATH topology
 5KNC A;  2KCC A;  1UUP A;  5IP7 H;  1ENA A;  1EOV A;  1FNW A;  3I91 A;  5ELB A;  4ZKB B;  4HCE A;  3NEL A;  1GUT A;  2ZTD A;  4A3G B;  2KEE A;  2Z4H A;  4RGT A;  2F1M A;  3OWF A;  3GTP H;  3J80 c;  2RF4 A;  1SYG A;  5COY A;  1EZ6 A;  2B8G A;  1DZ1 A;  3TRE A;  2B63 B;  1CM9 A;  1KQS A;  2AQ2 B;  4GLV B;  4IN3 A;  2O2L D;  5DM7 3;  1B3Q A;  5IGE A;  4LFB L;  4A3L H;  5JVH 3;  3HOU H;  2F4V L;  1EY7 A;  2K14 A;  4DR3 L;  1PH4 A;  2G9D A;  3A5Z B;  4P71 A;  4A3D H;  3C2P A;  1Y14 B;  1VCI A;  4DR3 Q;  1KL9 A;  1YVC A;  2A1A A;  5A2Q E;  2H1E A;  3HOV H;  1LAB A;  1CSP A;  1WYD A;  3S14 H;  2PNR C;  4N8F A;  4FXD A;  5FO8 B;  3NHH A;  5FLX E;  2CVR A;  1NSN S;  2DJF C;  4AQY Q;  2A68 D;  1WJJ A;  3Q6S A;  3M4O B;  2N8N A;  4PZ8 A;  2UUC Q;  1JOO A;  3A74 A;  5IYD H;  5BN4 A;  3OMG A;  3A7L A;  3FKI B;  4R4O A;  4K8J A;  4JI6 L;  2AMC B;  3CCU A;  3M85 A;  2I0Q A;  3S9W A;  3PIO A;  1R9T B;  2L5T A;  2IX3 A;  5FLX c;  1S5F D;  4HSP A;  1AEX A;  4Z9C B;  2QDB A;  1G6P A;  4UDU C;  1U4L A;  3T1Y Q;  2EYF A;  3D3R A;  4V0B A;  1UNS A;  1PH8 A;  4F87 A;  1KDA A;  2F0S A;  3S16 B;  4X65 Q;  4KY5 A;  5C3W A;  3ERS X;  4NMZ A;  1EWI A;  2KOL A;  4RGN A;  4X3S A;  4B3T L;  1VDZ A;  1X55 A;  3TRZ A;  1SMY C;  2C35 B;  3OHX C;  5IIF A;  4B3T Q;  1LTI D;  4XDX A;  2Z1C A;  1HHV A;  1SRU A;  2NYZ D;  1DOM A;  2PW5 A;  4J6H A;  2NN6 I;  3ULL A;  3MA2 B;  3A8K E;  1HXY D;  1O78 A;  4BS9 A;  2G9H D;  1WVL A;  5I4D A;  2B2U A;  3EBE A;  3CCR A;  4KKS A;  1U4P A;  1HNW Q;  4MHE A;  5CBE E;  1CTM A;  3K6O A;  4FF4 A;  5D3D A;  4FO2 A;  3BJU A;  3RNU A;  1GOZ A;  2X69 A;  1AZP A;  2YU9 B;  1EYD A;  4B9W A;  5CV5 A;  5IWA Q;  2L55 A;  3NBI A;  4AYB E;  1X65 A;  1HPC A;  1A3V A;  2XIW A;  4L8J A;  4IUR A;  1X3P A;  4IPG A;  4QL5 A;  3I56 A;  4JVZ A;  5T1G A;  3I2Z A;  2EJM A;  1HZC A;  4MN3 A;  3R93 A;  1FVI A;  5IGG A;  4ALP A;  1TWH B;  1Z7T A;  4G4K A;  4QCL A;  2F0W A;  4QIW B;  1EU3 A;  3K7U C;  2G5D A;  4A75 A;  1NJI C;  4JI3 Q;  4OEL B;  2NUC A;  5DEH A;  4DF7 A;  3PQI A;  1YNJ C;  4A3E G;  2RVL A;  4C3H G;  1JB3 A;  3NWT A;  3S17 B;  4GKK L;  1IYJ B;  2FIN B;  3OW7 A;  2HUG A;  4PMB A;  3BS1 A;  2DNC A;  5JJL A;  4NW2 A;  5C4Z A;  4TRD A;  5M5X B;  4DV6 L;  4OO1 G;  3L7Z C;  3CPF A;  2AHO B;  1A0I A;  4TVA B;  4KHZ A;  4EQ5 A;  2NZO A;  3TP7 A;  4N9P A;  1BCP F;  5C44 G;  1STB A;  3NBH B;  1EYC A;  4DV0 L;  2B2V C;  3NSW A;  3NWS A;  4DV3 Q;  2IHE A;  2FFK B;  3MTS A;  4GNX A;  1P16 A;  2FMC A;  2NZ1 D;  4DV0 Q;  4DXF A;  1U4R A;  2B3G A;  4S3S A;  1RTO A;  1KNE A;  2MFI A;  2HQL A;  4A93 G;  4CJ1 B;  3GTJ B;  3S15 H;  4G7Z C;  1HZB A;  2EY1 A;  2Z6K A;  3KJP A;  2CWP A;  4NXN L;  1DOK A;  1PRT C;  2EY5 A;  1ASY A;  2HDL A;  1AFP A;  5AJ3 L;  4NXN Q;  1PZI D;  3QOJ A;  1IW7 C;  1B53 A;  1I5F A;  4A3B H;  5DLQ E;  1A15 A;  5AJ3 Q;  1WD1 A;  1PHJ A;  3RZD H;  1GVP A;  4BY1 H;  2IL8 A;  4QB4 A;  1XNR L;  2LSS A;  1XMO L;  2KA7 A;  1SFO B;  1CK1 A;  4RKB A;  5CV8 A;  5EGT A;  1KIX A;  3CCQ A;  3RMH A;  4FF3 A;  1SNC A;  3KBG A;  2QEX A;  3BYY B;  1BF4 A;  2K5Q A;  2KVM A;  3HG9 A;  3OMC A;  4PV1 C;  2F0L A;  2K5D A;  2NVT H;  4OX9 Q;  3H09 A;  1ET9 A;  2F0G A;  1Q8K A;  3IFT A;  1K83 H;  4A3C G;  4GN5 A;  1YNN D;  1XJV A;  1K8A C;  2P5Z X;  1NNX A;  2D0P A;  3LNN A;  2F0V A;  1DM0 B;  4RGM A;  2JE6 I;  4YCV A;  3TME A;  2NVY H;  3OTO Q;  4WJ4 A;  2EYM A;  3EQL C;  4A3F G;  2RDF A;  4ZRZ A;  1DCZ A;  3GV3 A;  1VF5 C;  1GHJ A;  1JJC B;  1ENC A;  4KLK A;  4P2C B;  4H13 C;  4JI7 L;  1S5E D;  2E2J H;  5KYI A;  1K3R A;  4JI7 Q;  1SBB B;  4H7B A;  2VW9 A;  2OQK A;  1PRT B;  2E74 C;  5C4X H;  3ITP A;  1I6H B;  1AH9 A;  2DUD A;  5ELE A;  2F0P A;  2NVQ B;  4POG A;  5C4J H;  3GTK H;  2K4K A;  4LF6 Q;  3A8J E;  1Q90 A;  3DUZ A;  4K0K Q;  4DU9 A;  5M5W B;  1A3T A;  4KJO A;  3KDF B;  5C5L A;  3LGJ A;  4A3K H;  3MAQ A;  1PTO F;  2B2T A;  2EYL A;  4HJ7 A;  5M3F B;  4YCW A;  2UXB L;  4C2M B;  3HOW B;  3PF4 A;  2M2L A;  4HJ9 A;  3SK5 A;  4X6A H;  2JA6 G;  1X3F A;  2UXB Q;  1EFW A;  3GV6 A;  5EBD A;  1IBL L;  1OXT A;  4IJH A;  2EJG C;  1DD2 A;  1Z9F A;  3EIV A;  1E2W A;  2X6G A;  1MJE A;  3IRB A;  4A3J H;  2ATW A;  1PTO C;  4YHH L;  2O5I C;  3PO2 B;  4O42 A;  1MSG A;  1HFG A;  4A3K B;  4RHR A;  4YHH Q;  4CGY B;  3HEJ A;  1A2T A;  2KED A;  2M9V A;  3PIP 3;  3F2B A;  2AKW B;  3I4N H;  3KF8 B;  1IYU A;  4KKU A;  3HOZ B;  2WAQ E;  3RZO B;  2R93 B;  4QMG A;  3K80 C;  3A54 A;  3RR5 A;  1UE1 A;  2EVB A;  2A69 C;  1JJG A;  2HCC A;  2JA5 H;  1I4P A;  4LW1 A;  3S2D H;  2I46 A;  4JOI A;  1HFN A;  1YHA A;  4DPG A;  1IBM L;  2D0O A;  3H3V C;  4IOA A;  4FYD A;  3W5O A;  4K6L A;  1PTO H;  3PO3 H;  4YY3 Q;  1VQF A;  1EYG A;  1LT5 D;  1HCZ A;  4EQO A;  1S5B D;  1QVG A;  1OTC A;  2VUM G;  3UDF A;  5FJ8 G;  5IE8 A;  4R4T A;  2MQH A;  3HKZ G;  4PMW A;  3H0G G;  4DR2 L;  2I07 B;  2L15 A;  3PO3 B;  3I4M G;  2K32 A;  3TBI B;  5GAD C;  4DR2 Q;  3VR2 A;  3SR1 A;  1D1I A;  3UE1 A;  3NK9 A;  5ELC A;  4DUY L;  3TP5 A;  1LUZ A;  5CMD A;  1JWS D;  1HNZ L;  4G7O C;  4DUY Q;  4DUZ L;  2RQX A;  3C1F A;  1Y1W B;  1H9S A;  4LFA L;  4BBR B;  4B3S Q;  5IT9 L;  3DM1 A;  5DNF A;  2HHH Q;  1LTB D;  1KAW A;  2JP1 A;  3AEV A;  1TWG H;  5M3F G;  4JI8 L;  1X3Q A;  3HOW G;  4WJ3 M;  2XWB B;  2FHT A;  4QUF A;  1DOL A;  2B39 A;  1Y1V H;  4KTA A;  1X9N A;  4JW0 A;  3G7L A;  1E24 A;  3FPU B;  1ILQ A;  3CW2 C;  4KN7 C;  3MXU A;  4J1M A;  4MNO A;  1NMF A;  4XXE A;  3I70 A;  4X64 Q;  2LFN A;  4TQU S;  1Q3L A;  3R2T A;  3Q0A A;  1VQ7 A;  3H6M A;  3NXW A;  4HR7 B;  1F2M A;  1L0Y B;  2JSO A;  3VA5 A;  5GRO A;  2F0J A;  3WOF A;  4FXG C;  1TWC H;  5CR3 A;  1P8L A;  2F0F A;  3IKJ A;  3DWP A;  3J7Z C;  1I3Q B;  4OIJ A;  5C0X H;  1PXU A;  1RF2 D;  2E5L Q;  3E6Z X;  2JEB I;  2OXP A;  2GVB A;  3UDI A;  3M4Q A;  3GTL H;  1SYB A;  3HKS A;  2NBF A;  3DHQ A;  4R8I A;  1IKM A;  1WCM G;  1JE4 A;  3S1R H;  4C3I G;  1GUG A;  3P1H A;  5M3M B;  2GN5 A;  3B6Y A;  5FK9 C;  1LO5 D;  3ERO A;  4DGZ A;  3HOY H;  1A3U A;  2I5L X;  3VDY A;  2Y0S B;  2F3V A;  5IYC H;  4A3M G;  3JAM E;  4FF1 A;  4KKT A;  4FVM A;  3NUC A;  1V8Q A;  1LTG D;  4RA8 A;  1U0L A;  3BG3 A;  2PQA A;  2PNH A;  5CGK A;  2RSO A;  4BBS H;  1GKH A;  2N3S A;  5TSS A;  4NPS A;  1G8Z D;  3GTM B;  2PI2 E;  3KUP A;  2NWG A;  4GKJ L;  5M5Y H;  2BDO A;  1EOT A;  1GO3 E;  3S1N H;  1KAB A;  4FF2 A;  3JAM c;  4OIK A;  1ET6 A;  2Z6B A;  1K28 A;  1PYS B;  3J80 L;  1EWH A;  3MWY W;  2J7Z A;  3U4Z A;  2EYO A;  3E9I A;  1V1P A;  1AW7 A;  3OYY A;  3NTH A;  1B4O A;  5JJI A;  2NTT A;  1NMG A;  2ENB A;  4JYA Q;  2D62 A;  2F0T A;  1YHQ A;  2R3Z A;  4XQJ A;  1QZH A;  3E9H A;  1HRJ A;  4IUQ A;  1K9M C;  1VQK A;  4RFB A;  1SYD A;  4ME3 A;  4RG1 A;  2EQS A;  3F2C A;  4HJ5 A;  3S2H H;  4I65 A;  3R3O A;  4UP7 A;  3SXH A;  3SE0 A;  1IL2 A;  2A6E D;  2R92 B;  1FNU A;  4C3J G;  5CBA E;  3E3X A;  2K1B A;  1HTL D;  1CKN B;  1VS0 A;  3IAY A;  4UAI A;  1Y8P B;  3TSS A;  2WB1 E;  2E76 C;  1SN8 A;  4DA2 A;  2EYJ A;  2F4I A;  2NTS A;  2XGT A;  3N6R A;  3I7F A;  5ELO A;  1HR0 L;  1UAP A;  2J0T D;  2UUB L;  1EY9 A;  2RCF A;  3VR3 A;  3CU7 A;  3CCM A;  3FEW X;  1Y69 U;  1HR0 Q;  3FMC A;  3N52 A;  3CXC A;  4X62 Q;  4LNQ A;  1A2U A;  5A2Q L;  2PMZ B;  1JMC A;  4IFD H;  1F2L A;  2XN9 C;  3OWE B;  4A3G H;  1PH6 A;  4ILW A;  4MTK A;  3G4S A;  3W2D A;  1YIJ A;  3SDZ A;  1TS4 A;  2N49 A;  1VQC A;  1FR3 A;  3F2D A;  4QY7 A;  1L1O C;  4L6T B;  5FLX L;  1EQQ A;  1BOS A;  3CCE A;  1KRT A;  3IL8 A;  1ZYR D;  2RBM A;  2B63 H;  1JJ2 A;  2O5J C;  3JC6 6;  1QUQ B;  5K5P A;  1EY6 A;  1NR4 A;  2QIL A;  4JI2 L;  2Q2U A;  3FP9 A;  3UDX A;  3TN2 A;  4CJ0 B;  1M1K C;  1YHB A;  2NN6 G;  1B44 D;  3RLN A;  2IX1 A;  3I73 A;  4LF4 L;  2WV6 D;  2K5H A;  4RWS C;  3SK4 A;  1K8M A;  4LF4 Q;  1TQO A;  4LF5 L;  2Q2I A;  4PMC A;  4XYO A;  4KD3 A;  4PZ6 A;  3Q23 A;  5I6W A;  3MVV A;  4HIM A;  1K0S A;  4LF5 Q;  2AQ1 B;  5EAY A;  1W6J A;  4EQP A;  3I55 A;  4NDX A;  5IYB G;  2HIV A;  3KBX A;  4YWL A;  3CME A;  1SE2 A;  2IX0 A;  5I9O A;  5CV9 A;  4LFB Q;  2F4V Q;  2CQA A;  3M4O H;  5C5M A;  1C4Q A;  5EPJ A;  1IXR A;  4V19 0;  3D4W A;  4K5V A;  3DM3 A;  4POF A;  1EY5 A;  5JJZ A;  4C1N I;  1AE2 A;  2PQA B;  3FKI H;  2TSS A;  2DY7 A;  4DV1 L;  2PPB C;  4YWM A;  4R4I A;  1VQO A;  1L1O B;  1SDF A;  3ZJY C;  1R9T H;  2JA7 G;  2WIN B;  1FYC A;  2N55 A;  2PQE A;  1JOK A;  4ABN A;  2QGQ A;  1STN A;  2JA9 A;  4DAY A;  2R92 G;  5T1I A;  3HP3 A;  4CDE C;  4M8A A;  2VB2 X;  2VQF L;  3X3N A;  1S5C D;  1SSO A;  4CKE A;  5IGD A;  2M00 A;  5ELD A;  1VQP A;  1C48 A;  2VQF Q;  3QG1 A;  1HR0 W;  3S16 H;  1MHW C;  3NEM A;  1BVS A;  4A3E B;  1QZG A;  2KCT A;  1FD7 D;  4C3H B;  3HS0 C;  4JI6 Q;  2BA0 A;  3K57 A;  5I2Y A;  1YJN A;  3L3O C;  4H44 C;  1RKN A;  3X3M A;  1WI5 A;  1LYL A;  4BXX H;  1K8O A;  2VY3 A;  4JBW A;  1HA6 A;  1SE3 A;  3QJY A;  3A55 A;  1NUC A;  4DV5 L;  1T9H A;  2H4O A;  1PH1 A;  2DJG C;  1B3A A;  5C44 B;  2L11 A;  3T13 A;  1WFQ A;  1ML0 D;  3J81 E;  2FJ2 A;  4CJ2 C;  1Q1B A;  2MUY A;  5JVG 3;  1PV4 A;  2V1C C;  3T53 B;  1PZK D;  1YZ6 A;  3SVM A;  4IUV A;  4A93 B;  3K81 C;  4LJZ C;  4N8X 1;  1BR9 A;  2JA8 G;  4GOP A;  2YU9 H;  1ZXT A;  5IOC A;  2HD3 A;  3HFZ B;  3TQY A;  1AN8 A;  4IPC A;  1IKL A;  3J81 c;  1SYC A;  1SNO A;  4LUV A;  1RDP D;  3GTO B;  3PSI A;  3CPW A;  4APV A;  4BA2 I;  2R61 A;  1W2B A;  2K50 A;  1F2Y A;  1BQQ T;  2CH4 W;  2VL6 A;  4UY8 C;  3PUX A;  2CW0 D;  4XT1 B;  2IHF A;  1LTS D;  3CF5 A;  2R7Z G;  3DWQ A;  2A74 C;  4F7X A;  1N34 L;  3G71 A;  3GTQ B;  2D5D A;  3GTG B;  4K6D A;  1N34 Q;  3L9A X;  2BA1 A;  1TR5 A;  1TWH H;  2EDG A;  1TWA B;  2NZH A;  3HOX G;  2DGY A;  1NR2 A;  1UE5 A;  3QO2 A;  2H5X A;  2L1B A;  5K36 G;  1SEB D;  5AFW A;  4Q0F A;  1LT4 D;  5IP7 G;  2BE5 D;  2RDH A;  3I4O A;  4DR1 L;  2EOT A;  4B9X A;  3S17 H;  3C46 A;  1QE6 A;  4KY7 A;  4IZ8 A;  4DR1 Q;  5FLM H;  2Q8I B;  3KF6 A;  2UU9 L;  3BDL A;  2ZJR A;  4A3F B;  5M5X H;  2PI2 A;  5E7N A;  1YEZ A;  2C9O A;  4ME5 A;  2ALY B;  3G48 A;  4HJ8 A;  1STA A;  3ND9 A;  2D9U A;  4LWC A;  5EKI A;  1STE A;  2A6E C;  1Y8N B;  2UXD L;  5L37 A;  1I50 B;  2FMM A;  5HUR A;  2UXD Q;  2KQ3 A;  3HRZ C;  5E3F A;  2A19 A;  4A3D G;  4TKO B;  2QKI C;  4GKK Q;  3WOE A;  2K28 A;  2Q2T A;  1MD2 D;  3V2T A;  3GTJ H;  3HOV G;  2KEN A;  1HUN A;  3W3A A;  4DV6 Q;  4P75 A;  4OON A;  3KK7 A;  4JC0 A;  4LF7 L;  1RTN A;  3AB9 A;  3NP8 A;  4JG2 A;  3SHL A;  1EIF A;  2A6H D;  4R4Q A;  2TMP A;  2JA6 B;  2B2U C;  4LF7 Q;  1PH5 A;  1D7Q A;  3OIP A;  1PRT F;  4HIK A;  4HJA A;  3J80 i;  1SNM A;  3WDN A;  5JJK A;  2K5W A;  1SFO H;  3V05 A;  5IYD G;  2LXK A;  3TDQ A;  1HTP A;  3O13 A;  1V9P A;  2F3I A;  1VQI A;  3T51 B;  4LFC L;  2RA4 A;  1VQ4 A;  1F9S A;  1G6Z A;  3MEF A;  2MO0 A;  4LFC Q;  1U4M A;  4XTC S;  5KND A;  1BXT A;  3T1H L;  3LWE A;  3BDC A;  4ZK9 B;  4XT3 B;  2VXW A;  2QEJ C;  4JI4 L;  5D14 A;  5CV7 A;  2CKZ B;  3MZ5 A;  3T1H Q;  3M3Y B;  5FJ8 H;  1AP0 A;  1XNR Q;  4DK0 A;  1D5Z C;  1XMO Q;  2C5C A;  4QGU A;  3D4D A;  1GM5 A;  2NVX B;  4G57 A;  4KD4 A;  2VS1 A;  4BY7 G;  5CV4 A;  3P75 A;  2B29 A;  2KHJ A;  1IBK L;  1JC7 A;  1F2Z A;  1FJG L;  1BKB A;  2Z9H A;  4NXM L;  2A73 B;  4P74 A;  2K01 A;  1IBK Q;  1FJG Q;  4NXM Q;  3C1E A;  3RN2 A;  2B2W A;  1I6H H;  4DR6 L;  2VUM B;  1IL8 A;  3J7A 5;  1A63 A;  5JEA J;  2NVQ H;  4HIO A;  3PUW A;  2PZW A;  2Z0S A;  3HKZ B;  3H0G B;  2SDF A;  2JQO A;  1SR3 A;  5IP9 G;  5IGB A;  4B3M L;  2OCE A;  5M5W H;  1KDB A;  3I4M B;  2A68 C;  3IFD A;  1J6Q A;  3UDG A;  4ID6 A;  4KK7 A;  1EFI D;  3KLS X;  2WKD A;  1WTV A;  5M3F H;  4MIU A;  1K8G A;  1E1O A;  1M4V A;  4C2M H;  3HOW H;  2OTJ A;  1V43 A;  1KNA A;  2Z8L A;  4JBJ A;  1UWV A;  4GNX C;  2N88 A;  5J1Z A;  1T5E A;  1N8R C;  1NCV A;  3A0J A;  1WTP A;  5LHY 1;  2R6G A;  5LMN L;  1B2T A;  3CKI B;  2HIX A;  3PO2 H;  1EZ8 A;  3EVQ A;  5EPL A;  3NTI A;  1R4Q B;  2ZXP A;  3ICE A;  3KF6 B;  3VA7 A;  4PQX A;  4CHT B;  2Z6K C;  1JWM D;  4U68 A;  3QIA A;  4NP5 A;  4A3I G;  3OIQ A;  4IAL A;  1F9R A;  5GAH C;  1G51 A;  5J22 A;  3HOZ H;  3RZO H;  2R93 H;  3M7N A;  3QB3 A;  1RIP A;  2OQ0 A;  2KHS A;  1QOH A;  1K0R A;  2ICI A;  2QCP X;  4BA1 I;  3CC7 A;  1Q7Y C;  1Q86 C;  1IBL Q;  5HGQ A;  2E2D C;  4DV2 L;  1QCB D;  2FXQ A;  4JI0 L;  3NTK A;  1HNX L;  2EPB A;  3U58 A;  3QOL A;  1J9O A;  2ID0 A;  4PZ7 A;  2HCI A;  4LF8 L;  2KEC A;  2HDM A;  4DR4 L;  1EEI D;  3A7A B;  4CDC C;  5CC4 A;  1LTA D;  4DR4 Q;  5F2D A;  4IQZ A;  3FRP B;  1W6K A;  1XPO A;  4BWG B;  1GD7 A;  4OXP A;  1K73 C;  2F0N A;  1TWF B;  4RKL A;  2CH4 A;  4JK1 C;  4GNX B;  5ELN A;  4RAU C;  3NEN A;  1XTC D;  2EY2 A;  1PH2 A;  1WCM B;  1RCV D;  2CW0 C;  4C3I B;  1VQB A;  1IBM Q;  4GN3 B;  5DM6 3;  2K52 A;  4JBM A;  1EEF D;  4JV5 L;  4A3M B;  2IW3 A;  4N9T A;  4R4C A;  4ZQ3 A;  1Y1W H;  3D4R A;  2BE5 C;  4QIW E;  4BBR H;  1PLF A;  3J7A F;  3VYR A;  4HN7 A;  4A3B G;  5ELF A;  3H3V H;  1PFS A;  4BY1 G;  2B2T C;  3BDO A;  4GN4 B;  1Z6H A;  3UE0 A;  4EQN A;  5C6A A;  1SXT A;  5ISR A;  3MXN A;  1TS5 A;  2QF7 A;  1PFB A;  4O2D A;  4CBV A;  1MBY A;  2VB3 X;  4FXK C;  4HED A;  5LMN W;  1G2T A;  3W1G A;  4PNY A;  3M7G A;  1Q46 A;  1QJO A;  3BZC A;  1HNZ Q;  4E6I A;  4DUZ Q;  2EIF A;  1IHZ A;  1OXV A;  1I4Q A;  3ULP A;  4LFA Q;  1OO9 B;  4IPH A;  2LMC B;  2GVA A;  3NQI A;  3JAM L;  1EYA A;  4GLA C;  5FOB B;  3KJO A;  2PW7 A;  4RMF A;  5A35 A;  3V96 A;  3WWV A;  4JI8 Q;  2ASB A;  4WRD A;  3P7J A;  1CKO A;  1I3Q H;  4ZKC B;  2F0E A;  5I6Y A;  2Q8T A;  3AYH B;  3FVQ A;  5J3B A;  2E2I H;  4GLX A;  4I7Z C;  4C3J B;  4JOI C;  5J39 A;  1EWC A;  4DNT B;  2NB0 A;  1EY4 A;  4UP8 A;  3STB D;  2VNU D;  3HGB A;  5M3M H;  5C4X G;  4WOR A;  1VQJ A;  1KLG D;  2KJX A;  1BNZ A;  4XYQ A;  4X66 L;  3GDE A;  1TII D;  3AMU A;  1HZA A;  3KOJ A;  5HY6 A;  1VQ8 A;  4B3R L;  1C8C A;  5E4X A;  2PYK A;  4L5Q A;  2E2I B;  1KDC A;  1KHI A;  4B3R Q;  2HT1 A;  1LT6 D;  3GTM H;  1XPR A;  4WFN 3;  1UEB A;  3PIO 3;  2SNS A;  2IY5 B;  2WB1 G;  1Q82 C;  3S1Q B;  1I4X A;  3TZU A;  4DR5 L;  5JPN C;  1XMQ L;  1N9W A;  2DN8 A;  3PUV A;  1YNX A;  4A3J G;  4L5R C;  3CAM A;  1TY0 A;  3MXP A;  4ZYS A;  3OPO A;  3K5N A;  4DV7 L;  1XMQ Q;  1VQH A;  1O7I A;  1YNN C;  2E2H H;  4DV7 Q;  5JAV A;  4M1U B;  4KI0 A;  4DFA A;  1GUN A;  4JBK A;  1JCK B;  2AQ3 B;  2YTX A;  1SMY D;  3I4N G;  1HA5 A;  4OGQ C;  3EFX D;  2RKS A;  3L2P A;  2UXC L;  1ICF B;  1EIG A;  5KNB A;  4GKJ Q;  2UXC Q;  4HID A;  1D5M C;  1A62 A;  2LKV A;  4ULL A;  2JA5 G;  3FPP A;  4IJL A;  2B2Y A;  2HQE A;  1YBY A;  2E2H B;  1VQN A;  1NAP A;  3OW2 A;  2R92 H;  4K8I A;  4RCN A;  4OWX B;  2R7D A;  1O80 A;  1TXY A;  1SRO A;  4OL7 A;  2VZA A;  2JYO A;  4QUC A;  1I6V C;  2K33 A;  4FDB A;  1C7Y A;  1CA6 A;  2XSC A;  3M4Y A;  2JA7 B;  2L9H A;  4AH6 A;  1H9K A;  4HAE A;  3VYT A;  1MIU A;  4CDD C;  1VQE A;  2ZT9 C;  3T4A C;  1JIC A;  1Q1E A;  1ONL A;  1N33 L;  3TP6 A;  3U4V A;  3E5S A;  3S1M B;  4MTN A;  1C0A A;  1H9S B;  1TU2 B;  3BZD B;  1JOQ A;  2IT1 A;  1E2V A;  1V1O A;  1M8A A;  4RCO A;  1EY8 A;  4K5X A;  3PIP A;  1LTL A;  1QNU A;  1STG A;  4AYB B;  2CFM A;  4JPB W;  4IOC A;  1F9P A;  4Y52 H;  2UUB Q;  1WTH A;  4LUZ A;  1YNJ D;  5KEE A;  1JQY D;  1A6X A;  2V4D A;  3U50 C;  5H1S E;  2MGS A;  1GHK A;  4DNI A;  2ZJP A;  3CCV A;  2UUA L;  5NUC A;  1Y1V G;  4EGV A;  1B8A A;  1CQF A;  1WD0 A;  3PV0 A;  1D6E C;  3CRK C;  2I5M X;  5C3E B;  3SEB A;  1XXG A;  1BBU A;  2WAC A;  1GUW A;  1JWU D;  1QVC A;  1JT8 A;  2XNA C;  4UPA A;  3PGZ A;  2ZTE A;  1RL2 A;  5EJW A;  3BVZ A;  4JI2 Q;  2BH2 A;  4K2L A;  3DLL A;  2A5H A;  3OSO A;  4DR7 L;  2A8V A;  2JA8 B;  2WII B;  2EZV A;  2K6A A;  4DR7 Q;  1D1K A;  5LMU L;  3A8I E;  1CHP D;  1E22 A;  4O1N A;  4LF9 L;  1WTW A;  1BCP D;  2BDN A;  3T16 A;  5LMU Q;  4ZAI A;  5C0X G;  3K7A B;  4KJN A;  4LF9 Q;  1F9Q A;  1PH7 A;  1WOC A;  1PRT D;  4OWT B;  1KC8 C;  1I4R A;  2R7Z B;  3QWN A;  2ZTC A;  1RD9 D;  5BN3 A;  1IW7 D;  3KFU A;  4NB3 A;  1H95 A;  2AUK A;  3J81 L;  1M90 C;  2JEA I;  4K14 A;  1NTG A;  3HOY G;  3ZYY X;  3HOX B;  1PYW D;  2YTY A;  3E0J A;  5G3L F;  5IYC G;  5E4W C;  1VQM A;  1II3 A;  1AZQ A;  2F52 A;  3Q22 A;  4A3E H;  4C3H H;  4DV1 Q;  3PCO B;  2WFW A;  4BBS G;  1XPU A;  3GTP B;  2XRS D;  3NPP A;  5KYL A;  2D2C C;  4OO1 H;  3GO5 A;  4NKL A;  1VQL A;  4R1J A;  1MJC A;  1XX8 A;  1L0W A;  1JE5 A;  1Q81 C;  3MXG A;  5C44 H;  1S40 A;  2K5V A;  1V1P B;  4I7A A;  1CZG A;  2YV5 A;  3I4L A;  4AYB G;  4Y7N H;  4AQY L;  3H3V I;  3STB C;  3HOU B;  1LTR D;  1X54 A;  4B08 A;  5KGU A;  1CFM A;  1NE3 A;  3PF5 A;  4A3D B;  2UUC L;  1LLR D;  4WJW A;  3NBH A;  1B70 B;  4P72 A;  1VQG A;  4A93 H;  1CA5 A;  2RSN A;  3HOV B;  3EA6 A;  1X32 A;  4DN4 M;  1BO0 A;  2AWN A;  3S14 B;  2Y0S E;  4DV5 Q;  3PMF A;  5CV6 A;  5IOD A;  4Y7N B;  2EXD A;  3GTO H;  5C3E G;  3T1Y L;  3CCL A;  4LK1 C;  5JOB A;  3U9S A;  4YCU A;  4DK3 C;  1H9R A;  1TKW B;  1LV9 A;  1PMR A;  4X65 L;  3CQZ H;  1SYF A;  3GTQ H;  3GTG H;  2PZT A;  1KLU D;  2Z4I A;  4BY7 H;  3JAM i;  1TWA H;  4X3K A;  5DAU A;  1SLJ A;  3C3L A;  3HZX A;  1PTO D;  2KHI A;  5GQO A;  2ZJQ A;  1X6O A;  4A3C H;  2K03 A;  5KRU A;  1IYV A;  4J8Q A;  1HZ9 A;  1I4H A;  1IZ6 A;  1G2S A;  4IUN A;  4IFD G;  4A3G G;  4UHV A;  3T56 B;  5C0X I;  1CKM A;  3Q8D A;  1TVX A;  2MHV A;  4DXG A;  1VQA A;  3LX0 A;  5JEA G;  3CQZ B;  4EX5 A;  4A3F H;  1DGS A;  1E2Z A;  4HSV A;  3MFY A;  1QG7 A;  3K5O A;  3CC2 A;  4BY7 B;  5IP9 H;  1FGB D;  3BVG A;  4ZCK A;  2B2V A;  2A69 D;  1K3B C;  1HNW L;  1SJE D;  5C0X J;  1RJT A;  1QB5 D;  2B63 G;  1ASZ A;  2JJQ A;  5D3I B;  1T5X D;  4XIG S;  2WAQ B;  1EQR A;  1I50 H;  3CHB D;  3F1Z A;  2AWO A;  4JI1 L;  1O7L A;  4JI1 Q;  3AU7 A;  5C3X A;  5IWA L;  3RN5 A;  3H15 A;  2UU9 Q;  1QWY A;  3ND8 A;  1CQV A;  1MI2 A;  1ICW A;  1X56 A;  3DXJ C;  4A3I H;  2BH8 A;  4A3L G;  4CKB A;  2EYP A;  3HOU G;  1QIL A;  2JA6 H;  4KN4 C;  5FO7 B;  2PMZ E;  2LXJ A;  3KDF A;  3M4P A;  2K75 A;  4F8M A;  1HJP A;  3MC0 B;  1FGU A;  4FP5 D;  4LMQ D;  1W3S A;  4JI3 L;  4GZY C;  1OXX K;  1PDQ A;  1VQD A;  3PUY A;  3PUZ A;  4RH6 A;  3RUZ A;  3FKI G;  4GOP C;  2MJ8 A;  5JPM C;  4DAY B;  1G29 1;  4A3I B;  3U9O A;  5EKK A;  2L4N A;  1PA6 A;  3MFG A;  4ZLT F;  1EU4 A;  1C9O A;  4IO9 A;  1U9R A;  5BR8 L;  4MZ9 A;  1CZW A;  1O7Z A;  1ZKO A;  5BR8 Q;  1ZYR C;  4H0L C;  4ZUI A;  3KF8 A;  3M3Y H;  3AFP A;  4DV3 L;  2NVX H;  2EE1 A;  3CCS A;  1LAC A;  2MO1 A;  1X3E A;  3NE5 B;  3BU2 A;  4OWW B;  4XQQ A;  4KHV A;  4A76 A;  4BXX G;  2VUM H;  1BCP C;  1JOR A;  3TZD A;  2ES2 A;  4KY6 A;  3CMA A;  4X3U A;  1SE4 A;  1BUV T;  4JI4 Q;  2CCZ A;  2XVS A;  3H0G H;  5FKA C;  4IFD I;  1SYE A;  3EN2 A;  3VR5 A;  2F0K A;  1KD1 C;  1E7Z A;  3CC4 A;  2EJF C;  3I4M H;  4PG3 A;  3BVM A;  1D5X C;  4AIM A;  5GAE C;  4GOP B;  3P20 A;  4OEM B;  4IFD J;  2K5N A;  1PH3 A;  2WAQ G;  4ODG A;  1ENF A;  1VMC A;  2EXZ A;  1PVO A;  1ROD A;  1SNP A;  3S15 B;  1KXL A;  1BBW A;  2K7V A;  4DR6 Q;  4DAP A;  4OX9 L;  2B8F A;  1AE3 A;  1WTQ A;  1VMP A;  2OT2 A;  3UI2 A;  1D8L A;  1YJ9 A;  1ZEQ X;  2F0O A;  1MSH A;  4DV4 L;  1QVF A;  4A3B B;  4B3M Q;  3K59 A;  3DEP A;  2IWH A;  3Q24 A;  3RZD B;  5HGT A;  4BY1 B;  4DV4 Q;  3TEH B;  5LL6 X;  3OTO L;  1G91 A;  1B9N A;  2F0H A;  2RDG A;  2ZXR A;  1LM0 A;  3ERQ A;  1EQV A;  1VQ6 A;  2RHS B;  2PCF B;  2RHQ B;  2N78 A;  5GAG C;  2QA4 A;  1S4Z A;  2L0C A;  1BCP B;  2NVT B;  3E0E A;  5LMN Q;  1K83 B;  3D0F A;  1UEA B;  2F3W A;  2CQO A;  1XWE A;  2GA4 B;  2F0U A;  2MP1 A;  3K0Y A;  4HCS A;  1ESR A;  4LF6 L;  2PO4 A;  3NQT A;  1OXU A;  2NVY B;  5FLM G;  4K0K L;  4GS3 A;  1NY4 A;  3A5U A;  2Q8R E;  1O7Y A;  1TWF H;  2E8G A;  1V1Q A;  1E3P A;  3J81 i;  2E2J B;  4R9W A;  3BYT B;  4DV2 Q;  2BCO A;  3DWA A;  5EPK A;  1WCM H;  4JI0 Q;  4OO1 I;  4C3I H;  1HNX Q;  1KRS A;  1B1Z A;  2EYH A;  5C4X B;  4CDF C;  4LF8 Q;  2DNE A;  1KAA A;  4IUP A;  3S24 A;  5C4J B;  3GTK B;  3J7A V;  1J8I A;  1JR0 D;  4A3M H;  2B2W C;  1Q12 A;  2IPK D;  4HMJ A;  3VR4 A;  5FO9 B;  3TS0 A;  2QDL A;  3M9B A;  1PFN A;  3W1B A;  1N36 L;  3K8A A;  1N36 Q;  2LY7 A;  2WB1 B;  4L5T A;  1HH2 P;  1KTK A;  4YWK A;  4R8N A;  3J81 j;  5EBC A;  3D8G A;  4A3J B;  1H9M A;  2XRQ D;  4JV5 Q;  1STY A;  3I90 A;  1D2B A;  4YY3 L;  4G7H C;  3R2I A;  3I4N B;  2XTI A;  2XWJ B;  3H94 A;  3I8Z A;  4KHP L;  2L12 A;  2SEB D;  3LWU A;  1B9M A;  1GUO A;  4KHP Q;  2QW7 A;  3SK6 A;  2CHB D;  2MPM A;  2JA5 B;  2SOB A;  2JXM B;  3AQQ A;  3TP8 A;  3S2D B;  1J5E L;  1E1T A;  3K0X A;  2OF1 A;  1J5E Q;  1GUS A;  1S72 A;  4IUU A;  1SAP A;  1PTO B;  1Y8O B;  4QQB X;  4DK1 A;  3CD6 A;  4C3J H;  3K58 A;  4QJF A;  3RLO A;  1EQT A;  4IPD A;  1XNQ L;  1ESF A;  4DAM A;  1EL0 A;  4RHS A;  1L2F A;  1VQ5 A;  2WP8 J;  1XNQ Q;  4XQN A;  4L63 B;  4UP9 A;  2I5H A;  2DY8 A;  3K5L A;  1CKN A;  4B3S L;  1CUK A;  5M9O A;  2HHH L;  2ZXO A;  1WTX A;  2A6H C;  3MEH A;  1TS3 A;  3CP0 A;  1S5D D;  4JCV E;  2X6L A;  3RD4 A;  1ILP A;  4DAV A;  4A4I A;  4DNR B;  2ZM6 L;  5IGC A;  1LTT D;  3OOC A;  1HUM A;  1I94 L;  1DJR D;  1Q8I A;  5G3L D;  2ZM6 Q;  3S1Q H;  4X64 L;  1I94 Q;  1FL0 A;  2KUM A;  1EY0 A;  4OHJ A;  4DKA C;  1UE7 A;  5IGF A;  1Z47 A;  1PH9 A;  4X66 Q;  1XYI A;  5D65 A;  3PO2 G;  3AFQ A;  1VQ9 A;  3A56 A;  1YIT A;  3H91 A;  2NN6 H;  3QR8 A;  5IY0 A;  2YTV A;  4A3K G;  3EJI A;  1TWG B;  3DMU A;  3GP7 A;  1WTO A;  1QUQ A;  4LAA A;  3BZK A;  3D31 A;  1HQR D;  1DYQ A;  5BN5 A;  3HOZ G;  1Y1V B;  3URY A;  2KCN A;  1GXD C;  1MKH A;  1STH A;  1BBX C;  2R93 G;  4DK6 C;  2KCM A;  2E5L L;  1SJH D;  1SNQ A;  3G6E A;  3KLW A;  3VYS A;  3HKZ E;  5C4H A;  2F0M A;  4Q5V A;  4DR5 Q;  2BOS A;  5IYB H;  1LT3 D;  3RLF A;  1L0X B;  4C1N K;  2IJ0 A;  5E1F A;  3R8B A;  3KYH C;  2VQE L;  3ONA B;  1GJX A;  3TS2 A;  1FNV A;  1I4G A;  1MGS A;  3CCJ A;  1B50 A;  1U5K A;  2VQE Q;  5IT9 E;  1TWC B;  1CSQ A;  2F0I A;  1NBW A;  1B7Y B;  1CHQ D;  2K04 A;  2RCN A;  2JK8 A;  1VF7 A;  1SMX A;  3MHB A;  2F03 A;  1S3O A;  1YI2 A;  1XTD A;  3ULJ A;  3GTL B;  2JA7 H;  4C56 C;  4TSS A;  1R4P B;  1TT2 A;  3S1R B;  4F88 A;  3PO3 G;  2AUJ D;  1L1O A;  4JI5 L;  4IUT A;  3S1M H;  3DEO A;  4X3T A;  4O0A A;  1WTR A;  1JB7 A;  3HOY B;  5IT9 c;  2CWA A;  2F0Q A;  1PZJ D;  5EKL A;  4JI5 Q;  5LL6 S;  4CKC A;  5I9P A;  5COR A;  1QNK A;  4QF4 A;  1SND A;  2Q2H A;  3FHW A;  3VR6 A;  2E75 C;  3I72 A;  4EVO A;  5EQ0 A;  1Y1W G;  2OWO A;  2ICE C;  4ZUJ A;  2YYZ A;  3F2U A;  3GD7 A;  1F77 A;  4BBR G;  3MXN B;  5KIX A;  4BBS B;  3ER0 A;  3I3C A;  4JYA L;  1E0B A;  4K5W A;  4L5S A;  1N33 Q;  1EIY B;  4RGO S;  2OEO A;  5M5Y B;  4J15 A;  1OXS C;  4HMI A;  1PYB A;  3S1N B;  1TS2 A;  1YJW A;  2SNM A;  3VYU A;  2O4X A;  4U67 3;  2OTL A;  1EIH A;  1H9J A;  1A8V A;  1BDO A;  2F0D A;  4KMU C;  1RHP A;  5C3E H;  2PZU A;  4P73 A;  1SE8 A;  4YIJ A;  1PFM A;  1TY2 A;  3KLR A;  3D6C A;  3SK8 A;  3FDT A;  3L0O A;  2LS0 1;  3K5M A;  2JA8 H;  4LUO A;  5I2X A;  5CYU A;  3F8T A;  3GQB A;  1DON A;  2WKC A;  2UUA Q;  1CI3 M;  4KV6 A;  4X62 L;  3K7A H;  1UE6 A;  4FNF A;  3J7Y W;  3G6J B;  3S2H B;  4K2K A;  1EUJ A;  3KLS A;  3D6W A;  2EY6 A;  4H02 A;  1X3G A;  2MNA A;  2B2Y C;  2J4X A;  2R7Z H;  1DXM A;  5JEA H;  3J80 E;  5M3M G;  1N32 L;  1HQM C;  2JN4 A;  3SGI A;  1CT1 D;  4HTH A;  3CRL C;  2KBN A;  1N32 Q;  3HOX H;  2R7F A;  2Y0S G;  5K36 H;  2K05 A; 
#chains in the Genus database with same CATH homology
 4JI1 L;  3ICE A;  5IP7 H;  1EOV A;  3KF6 B;  4JI1 Q;  1TWC H;  2Z6K C;  3NEL A;  1P8L A;  5IWA L;  3RN5 A;  2ZTD A;  3J7Z C;  3H15 A;  4A3I G;  2UU9 Q;  5GAH C;  1G51 A;  3HOZ H;  2E5L Q;  3GTP H;  3J80 c;  2JEB I;  2RF4 A;  3RZO H;  2R93 H;  2GVB A;  3UDI A;  3M4Q A;  3GTL H;  1X56 A;  3M7N A;  1RIP A;  2OQ0 A;  4BA1 I;  4A3I H;  1K0R A;  3HKS A;  3CC7 A;  1Q7Y C;  1Q86 C;  1IBL Q;  1WCM G;  2BH8 A;  4A3L G;  5HGQ A;  3HOU G;  3S1R H;  2JA6 H;  2PMZ E;  3TRE A;  2LXJ A;  4DV2 L;  3KDF A;  2GN5 A;  2FXQ A;  2K75 A;  3B6Y A;  3M4P A;  4JI0 L;  1KQS A;  1HJP A;  4GLV B;  1HNX L;  3U58 A;  3HOY H;  4LFB L;  4A3L H;  1FGU A;  2ID0 A;  2I5L X;  3HOU H;  3VDY A;  2F4V L;  4PZ7 A;  4LF8 L;  5IYC H;  2K14 A;  1W3S A;  4DR3 L;  4JI3 L;  4A3M G;  4DR4 L;  1OXX K;  1VQD A;  3PUY A;  1PH4 A;  3A5Z B;  3PUZ A;  4P71 A;  4A3D H;  3FKI G;  4GOP C;  1Y14 B;  1VCI A;  4DR3 Q;  1KL9 A;  1YVC A;  4DR4 Q;  2A1A A;  4DAY B;  1G29 1;  1XPO A;  1U0L A;  3HOV H;  1GD7 A;  2PQA A;  4OXP A;  1K73 C;  1PA6 A;  2PNH A;  1CSP A;  4BBS H;  4GNX B;  1C9O A;  1GKH A;  1WYD A;  2N3S A;  4IO9 A;  4NPS A;  4MZ9 A;  5ELN A;  5BR8 L;  3S14 H;  2PI2 E;  3NEN A;  1PH2 A;  4GKJ L;  5BR8 Q;  5M5Y H;  1VQB A;  1GO3 E;  3M3Y H;  1IBM Q;  3S1N H;  4AQY Q;  3JAM c;  4GN3 B;  1WJJ A;  3AFP A;  2K52 A;  4DV3 L;  1PYS B;  2NVX H;  4JBM A;  2N8N A;  4PZ8 A;  3CCS A;  4JV5 L;  2UUC Q;  2MO1 A;  3A74 A;  5IYD H;  1X3E A;  3U4Z A;  3BU2 A;  4OWW B;  3E9I A;  4R4C A;  4R4O A;  4JI6 L;  2AMC B;  3CCU A;  3OYY A;  1Y1W H;  3M85 A;  2I0Q A;  5JJI A;  3PIO A;  4A76 A;  1NMG A;  4BXX G;  2VUM H;  4QIW E;  4BBR H;  4JYA Q;  2D62 A;  5FLX c;  1YHQ A;  2ES2 A;  3CMA A;  1G6P A;  1QZH A;  3E9H A;  4JI4 Q;  4A3B G;  3T1Y Q;  2CCZ A;  1K9M C;  3H0G H;  4IFD I;  3H3V H;  1PFS A;  3EN2 A;  4BY1 G;  1VQK A;  4GN4 B;  1KD1 C;  1E7Z A;  3UE0 A;  3CC4 A;  4ME3 A;  4RG1 A;  3I4M H;  2EQS A;  4PG3 A;  3F2C A;  4HJ5 A;  3S2H H;  1PH8 A;  4O2D A;  4UP7 A;  4AIM A;  1IL2 A;  5GAE C;  4GOP B;  4X65 Q;  5LMN W;  3W1G A;  4IFD J;  2K5N A;  1Q46 A;  3BZC A;  1PH3 A;  2WAQ G;  3ERS X;  1CKN B;  1EWI A;  1VS0 A;  4DUZ Q;  1HNZ Q;  2EIF A;  1PVO A;  1OXV A;  4B3T L;  2WB1 E;  3ULP A;  1SN8 A;  1X55 A;  4LFA Q;  3TRZ A;  1KXL A;  1BBW A;  4IPH A;  2UUA L;  4DR6 Q;  2C35 B;  2XGT A;  4B3T Q;  3I7F A;  4OX9 L;  2GVA A;  5ELO A;  1HR0 L;  2UUB L;  4GLA C;  3KJO A;  1AE3 A;  3CCM A;  1D8L A;  1YJ9 A;  1HR0 Q;  4RMF A;  1SRU A;  3WWV A;  3CXC A;  4X62 Q;  4LNQ A;  4JI8 Q;  4DV4 L;  1JMC A;  2NN6 I;  1QVF A;  2ASB A;  4B3M Q;  3ULL A;  4A3G H;  1CKO A;  4DV4 Q;  1PH6 A;  3G4S A;  1I3Q H;  3TEH B;  3OTO L;  1YIJ A;  3AYH B;  5J3B A;  3EBE A;  2N49 A;  1VQC A;  3CCR A;  2E2I H;  4GLX A;  4IOA A;  3F2D A;  4QY7 A;  1LM0 A;  1HNW Q;  4JOI C;  1L1O C;  1VQ6 A;  2RHS B;  1EQQ A;  3CCE A;  4UP8 A;  1KRT A;  3STB D;  2RHQ B;  2VNU D;  2N78 A;  2B63 H;  5GAG C;  1JJ2 A;  2QA4 A;  3JC6 6;  1QUQ B;  5M3M H;  5C4X G;  3BJU A;  4JI2 L;  1VQJ A;  3RNU A;  2Q2U A;  3E0E A;  3FP9 A;  3UDX A;  5LMN Q;  1M1K C;  1YHB A;  2NN6 G;  3D0F A;  4X66 L;  3RLN A;  3GDE A;  2AWO A;  2CQO A;  1HZA A;  2IX1 A;  4LF4 L;  3KOJ A;  2K5H A;  5IWA Q;  5HY6 A;  1VQ8 A;  4B3R L;  4LF6 L;  4L5Q A;  4AYB E;  1OXU A;  1X65 A;  5FLM G;  4LF4 Q;  4K0K L;  4LF5 L;  4GS3 A;  1KHI A;  4B3R Q;  1NY4 A;  2Q2I A;  3A5U A;  4PZ6 A;  2HT1 A;  4IPG A;  1TWF H;  2E8G A;  4HIM A;  4QL5 A;  4LF5 Q;  3I56 A;  5EAY A;  1V1Q A;  1E3P A;  3J81 i;  3GTM H;  1XPR A;  3I2Z A;  1UEB A;  3I55 A;  1HZC A;  2IY5 B;  2WB1 G;  4DV2 Q;  1Q82 C;  5IYB G;  1WCM H;  2HIV A;  4JI0 Q;  4OO1 I;  1FVI A;  4YWL A;  4C3I H;  4ALP A;  3CME A;  4DR5 L;  2IX0 A;  1HNX Q;  1KRS A;  1XMQ L;  4LFB Q;  1N9W A;  3PUV A;  1YNX A;  4A3J G;  4L5R C;  2F4V Q;  3CAM A;  3M4O H;  3K7U C;  4LF8 Q;  4DV7 L;  4A75 A;  1XMQ Q;  1NJI C;  1IXR A;  4JI3 Q;  1VQH A;  1O7I A;  3DM3 A;  3S24 A;  4POF A;  4A3E G;  2E2H H;  4DV7 Q;  4A3M H;  4KI0 A;  1AE2 A;  4JBK A;  2PQA B;  3FKI H;  4GKK L;  1IYJ B;  2YTX A;  1Q12 A;  3TS0 A;  4DV1 L;  3I4N G;  3PO2 H;  5JJL A;  4YWM A;  4R4I A;  3L2P A;  3M9B A;  3W1B A;  1L1O B;  1VQO A;  3ZJY C;  4DV6 L;  1N36 L;  2UXC L;  1R9T H;  2JA7 G;  4OO1 G;  3L7Z C;  3CPF A;  2AHO B;  1A0I A;  4TVA B;  4GKJ Q;  3K8A A;  4HID A;  1N36 Q;  4KHZ A;  4EQ5 A;  1A62 A;  2UXC Q;  2QGQ A;  2JA5 G;  2NZO A;  2JA9 A;  2R92 G;  4IJL A;  5C44 G;  4L5T A;  1YBY A;  1HH2 P;  3NBH B;  4YWK A;  2VQF L;  3J81 j;  4DV0 L;  4DV3 Q;  2IHE A;  4GNX A;  1VQP A;  1P16 A;  1VQN A;  2VQF Q;  4JV5 Q;  3OW2 A;  2R92 H;  1HR0 W;  4DV0 Q;  3S16 H;  3NEM A;  1BVS A;  4OWX B;  4YY3 L;  2R7D A;  2B3G A;  1TXY A;  2KCT A;  1QZG A;  1SRO A;  4JI6 Q;  2VZA A;  2BA0 A;  2MFI A;  2HQL A;  1YJN A;  4A93 G;  3S15 H;  1HZB A;  2XTI A;  4FDB A;  1C7Y A;  1WI5 A;  4KHP L;  2Z6K A;  3KJP A;  1LYL A;  2CWP A;  4NXN L;  4BXX H;  2VY3 A;  4JBW A;  4AH6 A;  1ASY A;  4KHP Q;  5AJ3 L;  1MIU A;  4NXN Q;  4DV5 L;  1T9H A;  1I5F A;  1VQE A;  3AQQ A;  1Q1E A;  5DLQ E;  1N33 L;  4A3B H;  5AJ3 Q;  1PH1 A;  1PHJ A;  3RZD H;  1J5E L;  3U4V A;  1E1T A;  1GVP A;  4BY1 H;  1WFQ A;  3K0X A;  4MTN A;  1XNR L;  1Q1B A;  2LSS A;  1XMO L;  1J5E Q;  1S72 A;  1C0A A;  2IT1 A;  1PV4 A;  3PIP A;  3CD6 A;  2V1C C;  4QQB X;  1LTL A;  4C3J H;  1KIX A;  3CCQ A;  4QJF A;  3RLO A;  4IPD A;  1XNQ L;  1YZ6 A;  2QEX A;  2CFM A;  4DAM A;  4IOC A;  1L2F A;  1VQ5 A;  2WP8 J;  1XNQ Q;  4OX9 Q;  2NVT H;  4Y52 H;  3K81 C;  2UUB Q;  2JA8 G;  1Q8K A;  4A3C G;  1K83 H;  4GOP A;  4GN5 A;  2YU9 H;  3HFZ B;  4UP9 A;  2I5H A;  3TQY A;  4LUZ A;  4IPC A;  1CKN A;  4B3S L;  1CUK A;  1XJV A;  3U50 C;  5H1S E;  1K8A C;  3J81 c;  2HHH L;  4LUV A;  2D0P A;  3PSI A;  2JE6 I;  3CPW A;  3CP0 A;  4APV A;  4YCV A;  4DNI A;  2ZJP A;  3CCV A;  2K50 A;  3OTO Q;  2NVY H;  2VL6 A;  1W2B A;  4BA2 I;  4WJ4 A;  1Y1V G;  4JCV E;  1B8A A;  4A3F G;  4UY8 C;  3PV0 A;  3PUX A;  2IHF A;  1JJC B;  3CF5 A;  4A4I A;  4KLK A;  2R7Z G;  2I5M X;  2ZM6 L;  4JI7 L;  1BBU A;  1N34 L;  3G71 A;  1QVC A;  1K3R A;  1I94 L;  2E2J H;  1JT8 A;  4UPA A;  2ZM6 Q;  3PGZ A;  2ZTE A;  4JI7 Q;  1RL2 A;  4JI2 Q;  3S1Q H;  1N34 Q;  4X64 L;  2VW9 A;  2BH2 A;  2BA1 A;  2OQK A;  1I94 Q;  1FL0 A;  1TWH H;  3DLL A;  4DKA C;  2NZH A;  4DR7 L;  5C4X H;  3HOX G;  2DGY A;  1UE7 A;  1UE5 A;  1PH9 A;  1Z47 A;  2H5X A;  4X66 Q;  1AH9 A;  2A8V A;  5K36 G;  3PO2 G;  3AFQ A;  1VQ9 A;  2DUD A;  1YIT A;  4DR7 Q;  5IY0 A;  4POG A;  2YTV A;  5C4J H;  5IP7 G;  5LMU L;  4A3K G;  2K4K A;  3GTK H;  4LF6 Q;  1E22 A;  3I4O A;  4DR1 L;  4LF9 L;  1QUQ A;  4K0K Q;  3S17 H;  5LMU Q;  3BZK A;  5C0X G;  3D31 A;  4DR1 Q;  5FLM H;  4LF9 Q;  3KF6 A;  3KDF B;  2UU9 L;  3HOZ G;  3LGJ A;  2ZJR A;  4A3K H;  1PH7 A;  1WOC A;  1MKH A;  5M5X H;  2PI2 A;  2R93 G;  4DK6 C;  4OWT B;  5E7N A;  4HJ7 A;  1KC8 C;  4YCW A;  2KCM A;  2UXB L;  2E5L L;  1YEZ A;  2ZTC A;  3PF4 A;  2ALY B;  4X6A H;  3G6E A;  3KLW A;  4HJ9 A;  2JA6 G;  1X3F A;  3G48 A;  4HJ8 A;  3HKZ E;  1EFW A;  4NB3 A;  3KFU A;  2UXB Q;  1H95 A;  1IBL L;  4DR5 Q;  1M90 C;  4LWC A;  1OXT A;  4IJH A;  5IYB H;  2JEA I;  3RLF A;  2UXD L;  1NTG A;  3HOY G;  1Z9F A;  3EIV A;  1MJE A;  2YTY A;  3IRB A;  3KYH C;  2VQE L;  4A3J H;  5IYC G;  4YHH L;  2ATW A;  2UXD Q;  1VQM A;  3TS2 A;  2A19 A;  4A3D G;  3CCJ A;  2F52 A;  1U5K A;  2VQE Q;  4YHH Q;  4A3E H;  4C3H H;  4GKK Q;  1CSQ A;  2Q2T A;  4DV1 Q;  1NBW A;  3GTJ H;  3F2B A;  1B7Y B;  2KEN A;  3HOV G;  3PCO B;  2AKW B;  2RCN A;  2JK8 A;  2WFW A;  3KF8 B;  1SMX A;  4DV6 Q;  4P75 A;  3I4N H;  4OON A;  4BBS G;  1S3O A;  1YI2 A;  2WAQ E;  1XPU A;  1XTD A;  3ULJ A;  4JC0 A;  3K80 C;  4LF7 L;  2JA7 H;  4JG2 A;  3GO5 A;  1EIF A;  3RR5 A;  1UE1 A;  4R4Q A;  1VQL A;  4R1J A;  4LF7 Q;  1JJG A;  1MJC A;  1L0W A;  1PH5 A;  1JE5 A;  2JA5 H;  4LW1 A;  1Q81 C;  3PO3 G;  3S2D H;  1D7Q A;  4JOI A;  5C44 H;  1L1O A;  1S40 A;  2K5V A;  1YHA A;  4JI5 L;  4HIK A;  3S1M H;  4O0A A;  4DPG A;  2YV5 A;  4HJA A;  1JB7 A;  2D0O A;  4AYB G;  3J80 i;  5IT9 c;  2CWA A;  4Y7N H;  4AQY L;  3STB C;  1IBM L;  3H3V I;  5JJK A;  3W5O A;  4JI5 Q;  1SFO H;  1X54 A;  3PO3 H;  4YY3 Q;  5IYD G;  1NE3 A;  1VQF A;  3PF5 A;  1EYG A;  2LXK A;  2UUC L;  2Q2H A;  3FHW A;  1V9P A;  2F3I A;  1B70 B;  1VQI A;  1QVG A;  1Y1W G;  4P72 A;  2OWO A;  1VQG A;  4LFC L;  4A93 H;  1OTC A;  2YYZ A;  3GD7 A;  1VQ4 A;  2VUM G;  4BBR G;  3MXN B;  3MEF A;  2MO0 A;  4LFC Q;  3UDF A;  3ER0 A;  4XTC S;  5FJ8 G;  5IE8 A;  4R4T A;  2AWN A;  2MQH A;  4JYA L;  3HKZ G;  2Y0S E;  4DV5 Q;  4PMW A;  3T1H L;  3H0G G;  4L5S A;  4DR2 L;  1EIY B;  1N33 Q;  2EXD A;  3GTO H;  4JI4 L;  4J15 A;  2CKZ B;  2L15 A;  1OXS C;  5C3E G;  3T1H Q;  5FJ8 H;  3T1Y L;  3CCL A;  3I4M G;  1PYB A;  5GAD C;  4DR2 Q;  1XNR Q;  4YCU A;  1XMO Q;  1YJW A;  4QGU A;  4DK3 C;  1GM5 A;  2OTL A;  4BY7 G;  2VS1 A;  1A8V A;  3UE1 A;  2B29 A;  2KHJ A;  5C3E H;  4DUY L;  1IBK L;  4X65 L;  1LUZ A;  3CQZ H;  4P73 A;  1FJG L;  1SE8 A;  3GTQ H;  1BKB A;  1HNZ L;  4NXM L;  3GTG H;  4DUY Q;  4P74 A;  4DUZ L;  1IBK Q;  4BY7 H;  3JAM i;  3L0O A;  1FJG Q;  1TWA H;  4NXM Q;  1SLJ A;  4LFA L;  3RN2 A;  1I6H H;  4DR6 L;  2JA8 H;  4LUO A;  2KHI A;  5GQO A;  2ZJQ A;  1X6O A;  5JEA J;  3F8T A;  4B3S Q;  3J7A 5;  2NVQ H;  4A3C H;  1A63 A;  4HIO A;  3PUW A;  2HHH Q;  2Z0S A;  1KAW A;  1HZ9 A;  1IZ6 A;  3AEV A;  1TWG H;  2UUA Q;  5M3F G;  4IFD G;  4X62 L;  2JQO A;  4JI8 L;  4A3G G;  1SR3 A;  5IP9 G;  3HOW G;  4WJ3 M;  4B3M L;  5C0X I;  1CKM A;  2OCE A;  3K7A H;  1UE6 A;  3Q8D A;  5M5W H;  1VQA A;  5JEA G;  1X9N A;  1Y1V H;  1EUJ A;  1J6Q A;  4EX5 A;  3UDG A;  4A3F H;  1DGS A;  1X3G A;  4H02 A;  1E24 A;  1K8G A;  5M3F H;  2MNA A;  3CC2 A;  1E1O A;  3CW2 C;  4C2M H;  5IP9 H;  2R7Z H;  3HOW H;  2OTJ A;  4MNO A;  1NMF A;  1V43 A;  4JBJ A;  1HNW L;  5C0X J;  1UWV A;  4X64 Q;  4GNX C;  1ASZ A;  2JJQ A;  2B63 G;  5M3M G;  4TQU S;  1N32 L;  1N8R C;  3SGI A;  4XIG S;  3A0J A;  1VQ7 A;  2KBN A;  1N32 Q;  3HOX H;  2R6G A;  2R7F A;  1EQR A;  1I50 H;  3F1Z A;  5LMN L;  2Y0S G;  2HIX A;  5GRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...