2DNCA

Solution structure of rsgi ruh-054, a lipoyl domain from human 2-oxoacid dehydrogenase
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
GSSGSSGIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Pyruvate dehydrogenase protein X component
publication title Solution Structure of RSGI RUH-054, a lipoyl domain from human 2-oxoacid dehydrogenase
rcsb
source organism Homo sapiens
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2dncA01
1OXSC 3CRKC 4H13C 2KCCA 4KN4C 1IYVA 1Y8OB 1E2VA 1K8OA 1IW7C 1GUSA 3A8JE 3MFYA 2DN8A 2B8FA 2PCFB 4XTCS 2ZT9C 1CTMA 3L7ZC 3M4YA 4L8JA 2E76C 5A35A 2LMCB 2R6GA 1T5EA 3I73A 3QIAA 1E2WA 3DXJC 4KKSA 4OGQC 5C0XH 2O5JC 2AUJD 2BA1A 3T56B 4PV1C 3M7NA 5BN5A 1GUTA 2A69D 3T51B 1GUGA 5K36H 1YNNC 2EJFC 4OO1G 3CRLC 3LNNA 4LK1C 1Y69U 1HTPA 2EJMA 1ONLA 2K33A 1IYUA 4G7OC 3A7AB 1DXMA 1I6VC 1H9KA 2D2CC 1Y8NB 1YNJC 3D31A 3I72A 2E75C 1Q12A 4TKOB 2NN6H 4IQZA 4LJZC 1LABA 1HQMC 2A68C 2A6HD 2BA0A 3IKJA 3QJYA 2PPBC 5BN4A 1LACA 1BDOA 2D5DA 4KI0A 2V4DA 3IFTA 2YYZA 5K36G 1K8MA 2E74C 3VR5A 4BA1I 4BA2I 3GD7A 1IW7D 2BE5C 2K7VA 5KNBA 1GHJA 1Q1BA 1VCIA 3MXUA 3VR2A 3P20A 4KMUC 3NE5B 2QF7A 1PMRA 2F1MA 2DNEA 3LWUA 1GHKA 3SE0A 2CW0C 4XIGS 3FPPA 2Q8IB 1O7LA 2NN6G 1VF5C 1HPCA 3QG1A 1OXUA 2PNRC 1V43A 1VDZA 3A7LA 4TQUS 1A6XA 2JEAI 1H9MA 3BG3A 4JK1C 1EWHA 2IT1A 1GUNA 2JE6I 2A6EC 3OW7A 3PUZA 3WDNA 5C0XG 3ND9A 4GZYC 1TKWB 3OOCA 2JXMB 1ZYRC 2O5IC 1H9JA 1B9MA 4IFDH 1Q1EA 1OXVA 1QJOA 2A68D 2EJGC 1GJXA 3W3AA 2EDGA 3VR4A 1SMYC 1H9RA 1Z7TA 3ND8A 5JEAH 3T53B 4DK0A 5KNCA 1G291 1HCZA 3PV0A 3M85A 1TU2B 4G7HC 2BDOA 2BE5D 3A8KE 3VR3A 3VA7A 1OXXK 1B9NA 1FYCA 2EVBA 4KKTA 3SDZA 3I4LA 1Z6HA 1O78A 1VF7A 2AUKA 4H44C 4JBWA 4G7ZC 2D62A 3TZUA 1Q90A 1Y8PB 3GQBA 3RLFA 3PUXA 4IFDG 1CFMA 2A69C 3U9SA 1CI3M 2JEBI 3PUYA 2NN6I 4H0LC 4HR7B 4KN7C 4RCNA 4DK1A 4DNTB 1OXTA 1E2ZA 1H9SA 3FMCA 4DNRB 5JEAG 3HGBA 3A8IE 3PUWA 4KHZA 5KNDA 3PUVA 1DCZA 3BDOA 2A6ED 3H94A 4I7ZC 1H9SB 4KKUA 3KLRA 2DNCA 5BN3A 3D4RA 1FR3A 3AB9A 2K32A 2A6HC 3EQLC 3N6RA 2AWOA 2B8GA 2L5TA 1V8QA 4OO1H 1DD2A 2KA7A 3VR6A 1GUOA 1ZKOA 3OPOA
chains in the Genus database with same CATH superfamily
2KHIA 2EPBA 3CRKC 4JI3Q 2KCCA 4KN4C 4B3RQ 3I90A 2AHOB 2B63H 3ZJYC 3Q24A 2SOBA 1JWUD 3M4YA 4DR1Q 5D14A 1JORA 5DM63 1L1OC 4A75A 2G9DA 3DEOA 3T4AC 1KL9A 1N8RC 1PH2A 1CSQA 4ID6A 4K5XA 4X62Q 4A3FG 1CKOA 3I4NB 3A55A 3EFXD 4A3MH 1SYBA 4LK1C 4ME3A 2QA4A 1TS4A 3S1QH 3PCOB 5C6AA 2O2LD 1HNXQ 4ILWA 1I3QH 2VXWA 1WCMG 4DV2L 1SMYD 1WOCA 1SE3A 1VQKA 3NPPA 3TRZA 1HQMC 5IT9c 1HFGA 3IKJA 1A0IA 1AW7A 5M5XH 1LACA 3GD7A 4DK3C 1RCVD 1UEBA 4EQOA 1JB3A 3VYRA 1EIHA 5CYUA 1K83H 2KQ3A 2DNEA 5H1SE 1NMFA 4JC0A 1O7LA 4OONA 4BBSH 2NVTB 1G6PA 4I7AA 3VDYA 2GVAA 2EYOA 2FXQA 1HJPA 1I4HA 1X9NA 3A7LA 4IALA 4C2MB 2UUBL 3ERSX 3OW7A 1U4LA 4QB4A 1Q86C 5IGEA 4R4QA 3J81E 1HNZL 2JA6G 1PVOA 1IBLL 3EA6A 1EZ8A 3W3AA 3UDFA 4IURA 5C44B 2GA4B 2Y0SG 5C3EB 2CH4W 1EY5A 3M3YH 1TXYA 4BY1H 5EKIA 4EGVA 2UXBL 2FJ2A 3A54A 4H7BA 3RLOA 1VF7A 4M8AA 4H44C 4R8NA 1HA5A 1MI2A 1ESRA 3RLFA 1PZKD 4IUVA 1B2TA 2Z1CA 2CKZB 4LF9Q 2NN6I 4HR7B 3WWVA 4LFCQ 4BBRG 1K73C 3HGBA 4DUYQ 1VQ4A 1A62A 3VA5A 1BBWA 1FL0A 2K32A 4DAPA 4DUZQ 4LF8Q 1TT2A 4FF4A 2XWJB 4OL7A 3GO5A 5JAVA 4K0KL 3R3OA 2NVQB 2MFIA 3BZKA 3HKZE 4AYBB 2EZVA 2ZXOA 4TRDA 4BXXH 1B7YB 3RZDB 3FKIB 3CCUA 1AN8A 2HT1A 1RTNA 1SR3A 2K14A 4XYQA 3AU7A 1NSNS 4LF6Q 4MTKA 2F0TA 2LXJA 3FRPB 1QOHA 1EQQA 1T5XD 1A15A 4DAVA 2L4NA 2A5HA 3GV3A 2B63G 1X3QA 3IFDA 3I3CA 4YCWA 3NP8A 1TS2A 1FVIA 1EYGA 4A3EH 2AMCB 2I5HA 4A3CH 1VQLA 4N9PA 3IFTA 4C3HH 2ENBA 2M2LA 2K28A 2K7VA 2MO1A 4A3MG 3KOJA 5KRUA 1XPRA 3UI2A 3CC7A 2WB1B 1D7QA 1B1ZA 1YIJA 2WKDA 4CBVA 5IT9L 1SFOH 2CW0C 2KJXA 3S17H 3ULLA 3H0GB 4DV4L 2G9HD 5K5PA 3NBHA 2VW9A 4A3BG 4POGA 1SSOA 4KY5A 1PZID 4JI4Q 2JXMB 4QIWB 2JA8G 4P73A 1QUQB 1CA6A 4IOCA 1EY7A 1EEFD 2H1EA 5HGTA 1VQ5A 3EN2A 3KUPA 2K01A 2I5MX 3FDTA 4BBSG 4DR4Q 5CV4A 2F0GA 4QF4A 1EZ6A 1O78A 3RR5A 2QEJC 2OXPA 3HOXG 4APVA 4A76A 3S2HH 1R4PB 1PYWD 2WP8J 4JG2A 4FF1A 1KNAA 2AQ3B 4A3IB 1UE6A 1E3PA 5DM73 1PTOH 2KCNA 2V1CC 3BDOA 4BY1G 1WJJA 4DAMA 4IFDJ 2DY7A 3EQLC 3ICEA 4IJLA 3W5OA 1JJCB 1X3EA 1M8AA 3CXCA 2NVYH 4FP5D 1X65A 1BNZA 3RLNA 1T5EA 3DXJC 1JICA 2UUAQ 1MSGA 1HH2P 1UUPA 2GN5A 5CR3A 2A69D 2DY8A 1IZ6A 1RDPD 3UDIA 5CBEE 4YCUA 3LNNA 1EWIA 2NVXB 3HOWB 2F4IA 2EYJA 5EKLA 5T1GA 3G7LA 1I50B 2KVMA 1I94Q 2EY5A 4GLVB 1V1QA 1EYDA 1CKNA 2NN6H 4BXXG 1LT3D 2QKIC 1IXRA 5C5LA 2PPBC 1BDOA 4GKKQ 2PQAA 1PFNA 2IY5B 3VR5A 3TN2A 4DV0L 3HOUH 5KNBA 4CDFC 1K28A 2WAQG 2Z6KC 5GAHC 1NAPA 1Q7YC 4JI1Q 1EY0A 3HKSA 2F1MA 3KK7A 1VQEA 1BUVT 1D6EC 4EQPA 4A3KB 1PTOC 2B29A 1DGSA 1JCKB 4A3EG 4CJ1B 3P1HA 4A3CG 1CQVA 3SVMA 4HTHA 1DJRD 4OO1I 3OTOQ 2UXDQ 1Q8IA 2L15A 2E2JH 4R4TA 1PH9A 4NB3A 3H3VC 1KAAA 2M00A 3GTKB 3CPWA 1FJGL 3HS0C 5IOCA 4X66L 1RIPA 5E4XA 4DK0A 1LTSD 3P7JA 1D5XC 3OIQA 3KF8A 1TU2B 1VQAA 4NMZA 4JI8L 2B2WC 1IBML 2L11A 4TVAB 2OTJA 3DWAA 2B2TC 2OTLA 4Q5VA 1XWEA 2HIVA 1MJCA 5IT9E 4FNFA 3S1RH 4DAYA 4LFBL 1CFMA 1F9RA 2AKWB 1HR0Q 3D0FA 5IYCH 1E24A 3D3RA 2ATWA 1DZ1A 4A3FB 3PO3H 1Q46A 1UEAB 2HUGA 4FO2A 4C3JH 5C4JH 1VQOA 2G5DA 1TWFH 2AWNA 4A3JH 3J7AV 3HRZC 3OPOA 1YI2A 1WCMB 4GNXA 3HOVG 1K8OA 1IW7C 5NUCA 3I55A 4L63B 2KHSA 3IRBA 2FFKB 1STYA 1OTCA 1VMPA 1HR0W 2LKVA 3F2DA 1EQRA 3I73A 2X69A 1XNRL 3S2DH 3U9OA 3LX0A 4PV1C 4BY7H 2K5HA 2YU9B 1P8LA 3RUZA 1EY9A 2CQAA 1C4QA 1JJGA 3S15H 2TSSA 1SNMA 1K3BC 4LF5Q 1J6QA 3Q23A 2RHSB 2XRSD 2I46A 1HZCA 1GM5A 3QJYA 2VQEL 1BBXC 5AJ3Q 1K0RA 3J81i 1CZWA 2JA6B 1PHJA 3K7AH 1YHAA 4WJWA 4CKEA 1Q1BA 1VCIA 3VR2A 4F88A 1F2LA 3GTPB 2Y0SB 5TSSA 1TS3A 4U68A 1KNEA 4RGNA 4KY6A 4JI6L 2EYFA 1L1OB 5C3XA 2NN6G 1UE7A 5ELNA 1VQ6A 1PA6A 1S40A 1VDZA 4K6LA 3L9AX 3EVQA 2F3WA 2JE6I 1D5ZC 2K5WA 4ODGA 5C0XG 3HOUG 2L12A 4BBRB 1GVPA 4EVOA 5LMNL 2PZTA 1FNUA 2YTVA 2YTYA 3HP3A 4FF3A 3GP7A 3MC0B 4F87A 3CC2A 2MUYA 2F0WA 1Y1WH 3EROA 4A3LH 3I4LA 1Z6HA 5ELCA 2B2YA 3NTIA 4DR5Q 3H09A 4HJ9A 4JYAL 1BO0A 2DGYA 4DR7L 1ESFA 5CV6A 3T1YL 3W1BA 3NENA 2D0OA 4KLKA 3S24A 1NBWA 5M5YH 4JI2L 1J8IA 1ZYRD 1KRSA 3N6RA 1HZ9A 2AWOA 2ZJQA 2N3SA 1KDBA 4OO1H 3OW2A 2B63B 2J4XA 3MXNB 1E2VA 1G2SA 1Q82C 3GTJH 3J7A5 5D3IB 2E76C 3BVZA 5IYCG 1CHQD 4HJAA 3U58A 2NB0A 3KJOA 2K52A 3HOZG 3PO3G 4A3MB 4X65Q 2SDFA 3S1QB 3D6WA 3M7NA 1S5BD 4EQ5A 1GUTA 2Q2UA 1SROA 1DOLA 1A2TA 3J80i 1STNA 1I3QB 4ZUJA 5LMUL 4DV3Q 4QUFA 1BCPB 1EEID 3I72A 1I5FA 5C4HA 1Y8NB 5I2YA 1S5CD 1F77A 5CORA 3SK4A 1JOKA 4A3BB 3PMFA 4IUTA 2A6HD 4DV7L 3RN2A 2MQHA 3CCVA 2K6AA 2ID0A 4JI3L 4B3RL 2JA8B 4NXNL 4BA2I 1S5DD 1K83B 3ULPA 1SXTA 1L0XB 4P2CB 2F4VL 2EY1A 2QF7A 4BBSB 2WFWA 2JA7H 5FK9C 1GHKA 1S5FD 4X62L 1N34Q 2LY7A 1XX8A 1U4RA 1B44D 2FINB 2PZUA 1VQ7A 1F2YA 2WV6D 2KENA 3J81L 3HOXB 2JEAI 3KJPA 3FVQA 2A6EC 1XNQL 1PXUA 3ND9A 3CC4A 4GZYC 4YWLA 5T1IA 1QJOA 2B2VC 2RSOA 3M3YB 2EDGA 4BY1B 1WD0A 1Z7TA 5KNCA 3QR8A 4PZ6A 2E5LQ 4B9WA 3VR3A 2HD3A 4A93H 2RA4A 1N33L 2JJQA 4J6HA 1AE3A 4CDCC 1ML0D 3PUXA 3CF5A 2K75A 4DV6Q 1N36Q 4RGMA 4DKAC 1UAPA 3PIOA 5IP7G 2A73B 2WACA 2J0TD 4CJ2C 4NPSA 2R93H 4DV1Q 3GTGH 3PUVA 5DNFA 5EBCA 1V1PB 2JN4A 3LWEA 3CAMA 3AB9A 2HHHQ 2D9UA 4B3TL 2PYKA 2SEBD 3URYA 1SE4A 1IHZA 1EUJA 3NK9A 5JEAJ 4B3MQ 1LT4D 4DR2Q 2DN8A 2B8FA 1HUNA 2OQKA 5A35A 3PO2H 3PQIA 2ZM6Q 4BWGB 2XNAC 1PFSA 3T1HL 4FYDA 2XN9C 1Y1VH 2BA1A 2WAQB 1FNVA 1KABA 1PZJD 1PH1A 2N55A 4LF9L 3HFZB 4OO1G 1IL2A 3BDLA 4G7OC 4DUYL 3A7AB 3R8BA 4A3EB 1H9KA 1TWHB 1VQIA 1YNJC 2NTTA 4HIOA 1N9WA 2OQ0A 5IWAL 5FKAC 2FMCA 2QDLA 4HCEA 3TQYA 1CSPA 3KF6A 4GOPA 1K8MA 3J80L 3RZOH 1HHVA 4QQBX 4LUVA 3GTOH 2CH4A 1SFOB 1HXYD 1TWGH 4AQYL 3S17B 2F0QA 1QNKA 2K04A 2ICEC 1EQTA 1QB5D 5EAYA 1XMOL 4LF6L 4JBJA 3FPUB 1Y14B 4FXKC 4GN4B 4WRDA 5CGKA 3BJUA 4TQUS 3DUZA 3PIO3 4O2DA 2Z8LA 3BYYB 3I56A 4Y7NH 2O5IC 3STBC 4MN3A 1YJNA 1YHBA 4CKCA 2ZJPA 2JA7G 2NZOA 2QW7A 3HKZG 1BOSA 4ZK9B 1LTAD 3T53B 4YY3Q 1HCZA 2RCFA 1ICWA 1TWCH 5J39A 2F0JA 1EIYB 1NMGA 4LF7Q 1FYCA 1U0LA 4K8JA 4B3SQ 1VS0A 3HOVB 3MA2B 3F1ZA 3KDFA 4LF4L 2CW0D 4B08A 5JJLA 1PTOB 2M9VA 4RCOA 1ASYA 3BVMA 3I4MH 1HZAA 2VB2X 4M1UB 3A8IE 3ZYYX 2L0CA 5KNDA 3SHLA 5C4XH 5CMDA 5BR8Q 4JI4L 4A93G 4HMJA 2ALYB 3M4OH 2A74C 3A56A 2VQFL 1E1OA 4FDBA 1V8QA 4DN4M 4OX9Q 2Z0SA 3W2DA 1W3SA 2NVYB 2LS01 3G71A 2CQOA 2JA5H 1GUSA 4XTCS 2PI2A 1CTMA 3L7ZC 4L8JA 5M3FG 4QCLA 2R93G 2RVLA 5I6WA 3UE1A 1EWCA 2NUCA 4YHHQ 2PMZE 1BCPC 1B4OA 1E2WA 4XQNA 4O42A 2EYPA 1GUGA 5M3MH 4IFDI 4QL5A 1J5EQ 3PSIA 5DLQE 4DPGA 2L1BA 1Q12A 1IKLA 3PO2G 5FJ8H 3CQZH 1NCVA 2GVBA 4ALPA 3NBIA 3HOUB 1PFMA 1Y1VG 2D5DA 5ELEA 1HUMA 2OCEA 3TZDA 1S72A 1PYBA 1E7ZA 1WTWA 3HG9A 3CU7A 2F0IA 2WIIB 3CKIB 3NTKA 4FXGC 5LHY1 2UUAL 4ME5A 5KIXA 1SYGA 5LL6S 1AZPA 1G8ZD 2E2JB 5IODA 2UU9Q 1C9OA 1ICFB 1VQCA 1EWHA 1I94L 3CP0A 4GLXA 1KAWA 1TKWB 5FO8B 1SYDA 1H9JA 1EOTA 3SK8A 2MO0A 4UDUC 5FO7B 1WTQA 4GKKL 1SMYC 2N88A 3J80E 4DV2Q 3T16A 1IKMA 5CBAE 4JI1L 1PRTB 3S1RB 1I4RA 2PI2E 4C3IH 4GN3B 3I91A 2D62A 3TZUA 4LUZA 1PTOD 4C1NI 2ZTCA 2PO4A 4X3UA 3HOZB 4H0LC 4KN7C 1MBYA 1PFBA 3CCLA 3TP5A 3PO3B 3CPFA 2UXDL 3NQIA 5C4JB 2HQLA 5JVG3 4UPAA 5M5WH 3L0OA 3C3LA 4A3JB 4I7ZC 3H94A 4IPCA 1SBBB 2ES2A 1FR3A 4OIKA 4LNQA 1JJ2A 2IW3A 4V0BA 4O0AA 5J3BA 4IOAA 4N8X1 3RN5A 1JE5A 4DR6Q 3H6MA 1IBLQ 1C0AA 1I4PA 3I4MG 1GO3E 3S2DB 1ILQA 3K58A 1B8AA 3A74A 4BY7B 2RDFA 5C4XG 1NR4A 1A2UA 2E2HH 1LT6D 4IN3A 4IZ8A 3JC66 3T51B 2B2UC 3AFPA 4NKLA 5GQOA 1LUZA 3NWSA 4N9TA 2JA5G 1RHPA 3K81C 5GAGC 3BZCA 4GN5A 4DV5Q 4JOIC 4OXPA 1W2BA 2QCPX 2R7DA 4IQZA 1LABA 2A68C 1WTPA 1PH7A 2YV5A 3K5LA 1TQOA 1GOZA 5E3FA 4L5RC 1JC7A 4ZCKA 3CCJA 5M3MG 1IW7D 2LSSA 4G4KA 3SXHA 4XT1B 2PW7A 3NE5B 5KGUA 5C0XJ 1VQMA 2R7FA 2SNMA 3IL8A 5FJ8G 1TR5A 1OXUA 1HNWQ 1SE8A 1FNWA 1JOOA 4XQJA 1EFWA 3NELA 4N8FA 1DM0B 2F0MA 2N49A 3KBXA 4EQNA 4R4OA 2JP1A 1GXDC 5EBDA 1RKNA 1X55A 4KJNA 4IFDH 1E1TA 2EXDA 1Q1EA 1OXVA 3VYTA 1YBYA 3DM3A 4NDXA 5AJ3L 3F2BA 4WFN3 1VQJA 3AEVA 3M4PA 5CV8A 4RGTA 3NWTA 5I9OA 3K8AA 3SEBA 2Q8RE 1QZHA 1X54A 4JBWA 3DLLA 4C3HG 2EY2A 2BH2A 1G6ZA 4QMGA 5CV5A 1CZGA 5M5YB 1PTOF 5CV9A 3V96A 4P71A 4ZRZA 4DF7A 4DV4Q 1H9SB 1CK1A 2DNCA 3A0JA 1TIID 2F0DA 1FGBD 2UUCL 1ET9A 3I2ZA 3GTJB 3J81j 3CCQA 2IX0A 4LFAL 4X6AH 1SYCA 3Q0AA 3DHQA 3MFYA 2JK8A 4FVMA 1XTDA 2CHBD 4DXGA 1PH4A 5C5MA 3WOEA 4LAAA 2LMCB 2RF4A 1R9TH 2F3IA 2F0KA 2XSCA 4UP9A 2Z4IA 5BN5A 1RD9D 2VY3A 1ET6A 2F0EA 2Z9HA 1Y69U 5LL6X 5CC4A 4XQQA 1PLFA 1ZEQX 1IYUA 2IX1A 4XYOA 3GTQH 3TBIB 3JAMc 2XVSA 1B3AA 3H15A 1C7YA 3PF4A 4OWWB 4GKJQ 2IJ0A 5BN4A 3J7AF 1EOVA 2K03A 4ZLTF 2EY6A 2MNAA 2C5CA 4H02A 2JA7B 4C1NK 4DR3Q 2K50A 3HKZB 1WTOA 3OHXC 2IX3A 3OSOA 5ELOA 1M90C 3TDQA 4X65L 3J7YW 4RWSC 2B2YC 1VQ8A 2MJ8A 1SDFA 3TSSA 1ASZA 1HPCA 3QG1A 1PH5A 4KHPL 1A3UA 1PH8A 4XXEA 2B39A 2RHQB 1KIXA 1STHA 1MKHA 2F0HA 1PRTC 3S9WA 4B9XA 5FLMH 2UXCL 3W1GA 4A93B 1EY4A 1K8AC 5HGQA 3F2UA 4KKTA 1XYIA 4JI7L 3MXPA 4G7ZC 1TVXA 1HTLD 4KD3A 3E0JA 5M3FB 1N34L 4IFDG 2R93B 2B2TA 3GTGB 1UE5A 3KYHC 4NXML 4HAEA 4QGUA 4HIMA 1ENFA 1STBA 1F9PA 1SN8A 4RKBA 3I8ZA 1KXLA 2A6ED 2K5NA 3HEJA 4JV5L 2MP1A 5A2QE 2IL8A 4RHRA 2JYOA 2Q2TA 2F3VA 3HOWH 1I50H 1IYVA 1Y8OB 3PO2B 2JA9A 2E5LL 2F0OA 1M1KC 4A3DH 1K0SA 1MJEA 1V9PA 1Y1VB 1BKBA 5GAEC 2A1AA 4HCSA 1MGSA 4KJOA 4RHSA 1N36L 4R4IA 4DV6L 4RGOS 1LTLA 1IBMQ 1YNNC 3CMAA 1L0WA 3GTMH 3BU2A 5EPJA 3CRLC 3EBEA 2I0QA 5KYLA 2OT2A 4LFBQ 1I6VC 5IGDA 2PNHA 1KC8C 1X32A 3PF5A 2HHHL 5L37A 2LFNA 1LYLA 2R92H 1YHQA 3KLSA 1PDQA 3GTOB 4HSPA 1EL0A 1TWGB 2OEOA 2E74C 2HQEA 1VQ9A 4IO9A 1X3PA 4NP5A 1SNOA 1GHJA 4MHEA 5IYDH 4C3JG 5J1ZA 2PQEA 3JAML 1ZXTA 4JI5L 4A3JG 3F8TA 4L5SA 3TS2A 2VZAA 3SE0A 3ERQA 5JPMC 2CVRA 3GTLH 3TS0A 1V43A 4YWMA 4HMIA 5M5XB 4Y7NB 2NZ1D 1A6XA 1H9MA 1QUQA 3SK6A 1YNJD 3NBHB 3L2PA 4BY7G 3D4DA 2LXKA 3HOYH 2IHEA 2R7ZH 3WOFA 4DR1L 1U4MA 1SYFA 4A3FH 4DU9A 1RODA 1LTTD 4AYBE 1OXXK 1B9NA 2MPMA 2VQEQ 1PH6A 5EJWA 3N52A 1O7IA 1IBKQ 3I4MB 1O80A 2E8GA 4R1JA 1HNXL 4KTAA 3MFGA 2EXZA 4AH6A 5C4XB 5FLMG 4JPBW 3KFUA 3G48A 4JI6Q 3M4OB 3F2CA 5M9OA 1KLGD 3GV6A 3X3MA 4DFAA 1KHIA 3STBD 2YU9H 2JA5B 3OWEB 3CW2C 3S14H 3S16H 3L3OC 1BXTA 1SRUA 5LMNQ 2N8NA 5DEHA 4LF7L 1UWVA 4K2KA 5E7NA 3OMGA 2WB1E 1D8LA 3E9HA 4J15A 5M3MB 4KKSA 4OGQC 1O7ZA 2JA6H 3NQTA 3DWQA 3C2PA 1M4VA 2X6LA 4Z9CB 1Y1WG 2HDLA 4A3LG 3CQZB 5EPKA 5BR8L 2ASBA 1QG7A 4A3DG 4QIWE 1VQHA 2CWPA 1SNPA 1BBUA 4TKOB 4UP7A 5LMNW 4MZ9A 3T1YQ 1N32Q 1STEA 4JI0Q 2BA0A 1GD7A 4ZAIA 4P72A 5D65A 1LTRD 1CKNB 4KI0A 4CDEC 3QB3A 2AQ2B 3E3XA 1II3A 4K6DA 3I4OA 2BE5C 3Q22A 5G3LD 1I6HH 5IIFA 2PQAB 2CWAA 4F8MA 4LFCL 3NSWA 1BCPD 2ZXPA 3OWFA 4HEDA 1SAPA 2R92G 1VF5C 2Q2IA 1J9OA 1J5EL 3NUCA 1NR2A 1TY2A 3K5OA 4C3HB 4DUZL 3C1FA 4LF8L 1KLUD 1JQYD 1B70B 3AFQA 1RF2D 1E0BA 5JJIA 3KLWA 1GJXA 3BVGA 1EIGA 5JOBA 3ULJA 3PIPA 3DM1A 2KECA 5JEAH 2VUMH 3PV0A 5E1FA 2B2VA 1MD2D 5IGBA 2FHTA 2F0VA 4DV7Q 1CA5A 2EVBA 2RDHA 2IWHA 2AQ1B 3JAME 3KF8B 4NXNQ 2AUKA 2NWGA 1CT1D 4A3GB 4RMFA 1Q90A 4J8QA 4K5VA 4DNIA 2F4VQ 2KOLA 4OHJA 3Q6SA 3U4ZA 5M5WB 2UU9L 3HOYG 2R7ZG 4DAYB 1NUCA 1LT5D 2VS1A 5IGCA 4DGZA 4A3GH 1STGA 2R3ZA 3K57A 1FGUA 2B8GA 2L5TA 2N78A 2P5ZX 2L55A 1GUOA 1XNQQ 4QY7A 1G51A 3S2HB 3E5SA 4YWKA 2PCFB 1IL8A 4WORA 2E2HB 3CHBD 4GNXB 3PGZA 1X56A 3CCSA 4A3BH 1U5KA 4HJ5A 3MTSA 2IHFA 5IP9H 1EFID 4X64Q 3T56B 1AEXA 4CKBA 2JA8H 1N33Q 2F0PA 3C1EA 3VYUA 1XMQQ 3S1NH 3E9IA 4RA8A 1X6OA 2MHVA 3G6EA 1DXMA 4FF2A 3OMCA 3RMHA 5ELBA 2ZTEA 1C48A 4LUOA 4J1MA 2J7ZA 2EYMA 2JQOA 4DR4L 1G91A 4ZQ3A 2K1BA 2A19A 3D6CA 2KCMA 1X3GA 1AFPA 3H3VI 1XTCD 1SJED 3HOXH 4DR6L 1NNXA 4KD4A 3B6YA 4B3TQ 2BDNA 3K80C 3MXUA 2CFMA 1D1IA 1QE6A 3BDCA 4AIMA 3PIP3 3V2TA 1L1OA 4XDXA 3UE0A 5G3LF 1B53A 4JBMA 4QJFA 1WVLA 4POFA 3K0YA 4ZYSA 2IPKD 4IUNA 1BCPF 5ELFA 3T1HQ 2NBFA 1PYSB 4DV5L 2D0PA 3AYHB 1AZQA 2VB3X 3P75A 3D4WA 2A68D 1WI5A 4IUQA 2R61A 1F9QA 5C0XI 3ND8A 5ISRA 4O1NA 5IWAQ 4HSVA 3M85A 3RNUA 3S1MH 2Q2HA 3SDZA 1SLJA 1KDCA 1Z47A 3FEWX 1TWAH 3GQBA 2PW5A 4JBKA 3SK5A 2ZTDA 3VYSA 2E2IH 1CI3M 1HNWL 4AQYQ 2RQXA 4PMWA 1E2ZA 4MTNA 5JEAG 2VUMG 2NTSA 1B50A 4KHZA 4RH6A 4RAUC 1I4XA 1XMOQ 3KLRA 3K6OA 3MXNA 1T9HA 2KEEA 2KCTA 4I65A 3OIPA 4H13C 3M4QA 1SYEA 1TWHH 2K5VA 1D2BA 1EU4A 1R9TB 2Y0SE 4QUCA 1EY6A 3MHBA 2EQSA 4RFBA 4L6TB 4OWXB 1UE1A 3OTOL 2O5JC 2AUJD 4P75A 1JT8A 4DXFA 4C3JB 1LTID 5K36H 1Z9FA 3KBGA 1TWFB 1P16A 1XPUA 4YCVA 3GTQB 2H4OA 1O7YA 4PNYA 2QEXA 5DAUA 4LF4Q 1SNCA 3I4NH 2UUBQ 3TP8A 4HJ7A 4KY7A 2VNUD 4HN7A 1VQFA 1LV9A 2YTXA 3AQQA 2EOTA 5FOBB 1A3TA 1HNZQ 1SNQA 4MIUA 5IP9G 4U673 2V4DA 2F0SA 4K5WA 1JWMD 4PZ7A 3GDEA 4BA1I 1WTRA 1EIFA 2NZHA 3TMEA 1WD1A 2VQFQ 3TEHB 2UXBQ 4KMUC 1HR0L 5GROA 3TREA 3S15B 1QWYA 1BVSA 3DEPA 1D5MC 4S3SA 1GKHA 1A63A 2Q8IB 3I7FA 5COYA 3UDGA 1JOQA 5EPLA 1CUKA 1QVCA 3HOVH 2ZJRA 2NVTH 3K7AB 3WDNA 4DA2A 1HA6A 1KD1C 4C2MH 1QNUA 1DYQA 4G57A 2EJGC 4UP8A 4GKJL 2XRQD 1XPOA 3VR4A 5IGGA 1WTHA 1JWSD 3NEMA 4K0KQ 5JPNC 4IPHA 4DR3L 2BDOA 3BS1A 5C44H 3UDXA 5C3EH 2PZWA 5JVH3 3H3VH 1MIUA 3ONAB 1A8VA 2NYZD 4LF5L 3U9SA 1CHPD 1VQGA 3V05A 2K4KA 5FLXc 5FO9B 3U4VA 4DK1A 5A2QL 1V1PA 4MNOA 4P74A 3NXWA 4IPDA 2HCCA 5I2XA 1AE2A 3I70A 4JW0A 1YITA 4IUPA 4KKUA 2EYHA 4GNXC 4CGYB 1Y1WB 1PRTD 3LGJA 2L9HA 4A3DB 1QVGA 1ZKOA 3M9BA 1OXSC 4ULLA 1HFNA 4Q0FA 1L0YB 1A3VA 1EYAA 1W6KA 3A8JE 2ZT9C 2BCOA 1EY8A 3K7UC 1NJIC 2RDGA 1JMCA 2NVQH 5C0XH 3GTMB 3QIAA 3NHHA 2K05A 1WTVA 3FHWA 4KHVA 3FKIH 4R9WA 3RZDH 5EKKA 1HTPA 2EJMA 3RD4A 4C3IG 3SR1A 2B2UA 2D2CC 2R92B 1EQVA 2RKSA 5IYBH 3IAYA 3MXGA 1WYDA 5HY6A 3A5UA 4A3GG 3ER0A 4JOIA 4UHVA 4IUUA 1QCBD 1V1OA 2A8VA 5K36G 4DR5L 4C56C 1ENAA 3KF6B 3K59A 1SE2A 3TP7A 4GOPB 1U9RA 2F0NA 3P20A 1Q3LA 1CM9A 3I4NG 1JR0D 5GADC 3GTLB 1LO5D 2PMZB 1AP0A 1I4QA 4X3SA 2SNSA 2C9OA 3JAMi 3FPPA 3MAQA 4WJ3M 1YNND 2ZXRA 2TMPA 3R2TA 4ZKBB 1S5ED 1WFQA 3ITPA 4LMQD 2KBNA 3H0GH 3E6ZX 5IY0A 4ZUIA 3HOYB 3K5MA 4K8IA 2F0FA 2R7ZB 2CCZA 1DOMA 3MEFA 3OOCA 2F0UA 1B9MA 3QOLA 3BZDB 1EU3A 3HOZH 3CCEA 1H95A 1QILA 4G7HC 1E22A 2Z6KA 4PMBA 2ICIA 3CMEA 1K8GA 1HRJA 3MZ5A 1BQQT 4HIKA 1VMCA 3E0EA 2WAQE 4DV3L 1NTGA 4X3TA 3MEHA 5JJZA 2MGSA 3M7GA 2A69C 3O13A 3KDFB 2Z4HA 2QILA 4GS3A 4DNTB 3TP6A 4F7XA 1K9MC 1F9SA 2K5DA 3S14B 3S16B 5C44G 4LWCA 1IYJB 2X6GA 4A3IH 4PG3A 5C3EG 1YVCA 3Q8DA 3QWNA 4IPGA 5ELDA 5I9PA 4BS9A 5FLXL 4KV6A 1SEBD 4TSSA 1PRTF 3G4SA 4DV0Q 2B2WA 1XXGA 2I5LX 1TY0A 3C46A 4CJ0B 1IBKL 4E6IA 2RSNA 4A4IA 3J81c 1UNSA 3EJIA 2XIWA 1RL2A 3CCRA 4XT3B 4OELB 1QZGA 5HURA 1ONLA 1ILPA 3D31A 5IE8A 3MWYW 2NVXH 3D8GA 3QOJA 1DOKA 4ZKCB 3J7ZC 1TS5A 1Q8KA 4LJZC 1F2MA 4AYBG 1I6HB 2WINB 1FJGQ 1Q81C 4DK6C 2YYZA 3K5NA 4X66Q 1L2FA 2JSOA 3FKIG 3U50C 5IP7H 2UUCQ 2OWOA 4JI8Q 2HIXA 4LFAQ 4OIJA 3BYTB 1MSHA 2XTIA 4DV1L 1NY4A 5J22A 5IYBG 3R2IA 4X3KA 4A3KH 2XWBB 3KLSX 1QVFA 1AH9A 1SMXA 3X3NA 1G2TA 3BG3A 4JK1C 3T13A 4R8IA 3RZOB 2BOSA 3PUZA 4R4CA 3AMUA 2DUDA 4HJ8A 1N32L 4LW1A 4B3ML 4JI0L 4DR2L 2VUMB 1CQFA 1B3QA 1D1KA 2KEDA 1LTBD 2XGTA 2ZM6L 3K0XA 2WB1G 1VQPA 2HCIA 1G291 2H5XA 1MHWC 1CKMA 3GTKH 2BE5D 4K2LA 3VA7A 5AFWA 4L5QA 3H0GG 3H91A 1KDAA 4UAIA 1XNRQ 4PMCA 4HIDA 1YEZA 4PZ8A 2B3GA 2JEBI 1JE4A 4JVZA 1VQDA 5KYIA 2F03A 4CHTB 1OXTA 3FMCA 2EE1A 1TWCB 1DCZA 1SJHD 5IGFA 1BF4A 4KHPQ 4OWTB 1I4GA 5BN3A 3D4RA 1HZBA 5KEEA 3J80c 4FXDA 5I6YA 2Q8TA 2EYLA 1PH3A 3CCMA 2K5QA 3DMUA 1WCMH 4EX5A 2HDMA 2UXCQ 5D3DA 3SGIA 1U4PA 1STAA 4YIJA 2R6GA 3S1NB 4V190 4L5TA 4A3IG 4RG1A 2EJFC 4JI7Q 2OF1A 1R4QB 1BR9A 2E2DC 2K33A 3DWPA 1YZ6A 2F52A 1VQBA 1GUWA 1NE3A 3HZXA 4NXMQ 4YY3L 2E75C 4ABNA 4PQXA 4GOPC 2DJFC 4OEMB 2KHJA 4B3SL 4UY8C 5FLXE 4JV5Q 1KTKA 1WTXA 4JCVE 2I07B 5JJKA 2O4XA 3EIVA 5I4DA 1PMRA 1OO9B 4X64L 1X3FA 3LWUA 3HOWG 3OYYA 1VQNA 4JYAQ 1YJWA 3GTPH 4XIGS 1XMQL 1EYCA 1W6JA 5EGTA 2PNRC 2DJGC 4DR7Q 1XJVA 2QGQA 3QO2A 2KUMA 2WKCA 4OX9L 1S3OA 5EQ0A 2IT1A 1GUNA 1KQSA 3NTHA 3R93A 2EIFA 5M3FH 1ZYRC 5F2DA 4JI2Q 3MVVA 2FMMA 2RCNA 1S4ZA 3G6JB 4BBRH 3S1MB 1H9RA 4KK7A 1SNDA 2C35B 4IJHA 4YHHL 1YNXA 1KRTA 4A3KG 5C3WA 3A8KE 1DONA 1TWAB 1ENCA 4NW2A 2QDBA 1C8CA 5E4WC 1K3RA 4K14A 2E2IB 2F0LA 5C4ZA 1Y8PB 3A5ZB 1JB7A 1LTGD 4RKLA 1PV4A 1F2ZA 2VL6A 3PUYA 2BH8A 4RCNA 4CDDC 4JI5Q 5IYDG 1RJTA 4Y52H 1H9SA 4DNRB 3PUWA 5LMUQ 1FD7D 1LLRD 1YJ9A 1RTOA 3FP9A 3CD6A 4GLAC 1LM0A 2RBMA 4C3IB 2A6HC 4WJ4A 2Z6BA 1HQRD 1DD2A 2KA7A 3VR6A 5CV7A
chains in the Genus database with same CATH topology
2EPBA 3CRKC 2KCCA 4KN4C 3I90A 3Q24A 2SOBA 1JWUD 3M4YA 5D14A 1JORA 5DM63 2G9DA 3DEOA 3T4AC 4ID6A 4K5XA 3I4NB 3A55A 3EFXD 1SYBA 4LK1C 1TS4A 5C6AA 2O2LD 4ILWA 2VXWA 1SMYD 1SE3A 3NPPA 1HQMC 1HFGA 3IKJA 1AW7A 1LACA 3GD7A 1RCVD 4EQOA 1JB3A 3VYRA 1EIHA 5CYUA 2KQ3A 2DNEA 1O7LA 2NVTB 2EYOA 1I4HA 3A7LA 4IALA 4C2MB 3OW7A 1U4LA 4QB4A 5IGEA 3J81E 3EA6A 1EZ8A 3W3AA 4IURA 5C44B 2GA4B 5C3EB 1EY5A 5EKIA 4EGVA 2FJ2A 3A54A 4H7BA 1VF7A 4M8AA 4H44C 4R8NA 1HA5A 1MI2A 1ESRA 3RLFA 1PZKD 4IUVA 1B2TA 2Z1CA 2NN6I 4HR7B 3HGBA 3VA5A 2K32A 4DAPA 1TT2A 4FF4A 2XWJB 4OL7A 3GO5A 5JAVA 3R3OA 2NVQB 4AYBB 2EZVA 2ZXOA 4TRDA 3RZDB 3FKIB 1AN8A 1RTNA 4XYQA 3AU7A 1NSNS 2F0TA 3FRPB 1QOHA 1T5XD 1A15A 4DAVA 2L4NA 2A5HA 3GV3A 1X3QA 3IFDA 3I3CA 3NP8A 1TS2A 4N9PA 3IFTA 2ENBA 2M2LA 2K28A 2K7VA 5KRUA 3UI2A 2WB1B 1B1ZA 2WKDA 4CBVA 5IT9L 2CW0C 2KJXA 3H0GB 2G9HD 5K5PA 3NBHA 1SSOA 4KY5A 1PZID 2JXMB 4QIWB 1CA6A 1EY7A 1EEFD 2H1EA 5HGTA 3KUPA 2K01A 3FDTA 5CV4A 2F0GA 4QF4A 1EZ6A 1O78A 2QEJC 2OXPA 1R4PB 1PYWD 2WP8J 4FF1A 1KNAA 2AQ3B 4A3IB 5DM73 1PTOH 2KCNA 3BDOA 4IFDJ 2DY7A 3EQLC 1M8AA 4FP5D 1BNZA 1T5EA 3DXJC 1JICA 1MSGA 1UUPA 5CR3A 2A69D 2DY8A 1RDPD 5CBEE 3LNNA 2NVXB 3HOWB 2F4IA 2EYJA 5EKLA 5T1GA 3G7LA 1I50B 2KVMA 2EY5A 1EYDA 2NN6H 1LT3D 2QKIC 5C5LA 2PPBC 1BDOA 1PFNA 3VR5A 3TN2A 5KNBA 1NAPA 1EY0A 2F1MA 3KK7A 4A3KB 1BUVT 1D6EC 4EQPA 1PTOC 1JCKB 4CJ1B 3P1HA 1CQVA 3SVMA 4HTHA 1DJRD 4OO1I 1Q8IA 3H3VC 1KAAA 2M00A 3GTKB 3HS0C 5IOCA 5E4XA 4DK0A 1LTSD 3P7JA 1D5XC 3OIQA 3KF8A 1TU2B 4NMZA 2B2WC 2L11A 3DWAA 2B2TC 4Q5VA 1XWEA 5IT9E 4FNFA 4DAYA 1CFMA 1F9RA 1DZ1A 3D3RA 4A3FB 1UEAB 2HUGA 4FO2A 2AWNA 3J7AV 3HRZC 3OPOA 1WCMB 1K8OA 1IW7C 5NUCA 4L63B 2KHSA 2FFKB 1STYA 1VMPA 2LKVA 3I73A 2X69A 3U9OA 3LX0A 4PV1C 2YU9B 3RUZA 1EY9A 2CQAA 1C4QA 2TSSA 1SNMA 3Q23A 2XRSD 2I46A 3QJYA 1BBXC 1CZWA 2JA6B 4WJWA 4CKEA 4F88A 1Q1BA 1VCIA 3VR2A 1F2LA 3GTPB 2Y0SB 5TSSA 1TS3A 4U68A 1KNEA 4RGNA 4KY6A 2EYFA 5C3XA 2NN6G 1VDZA 4K6LA 3L9AX 3EVQA 2F3WA 2JE6I 1D5ZC 2K5WA 4ODGA 5C0XG 2L12A 4BBRB 4EVOA 2PZTA 1FNUA 3HP3A 4FF3A 3GP7A 3MC0B 4F87A 2MUYA 2F0WA 3EROA 3I4LA 1Z6HA 5ELCA 2B2YA 3NTIA 3H09A 1BO0A 1ESFA 5CV6A 1J8IA 1ZYRD 3N6RA 2AWOA 1KDBA 4OO1H 2B63B 2J4XA 1E2VA 1G2SA 5D3IB 2E76C 3BVZA 1CHQD 2NB0A 4A3MB 2SDFA 3S1QB 3D6WA 3M7NA 1S5BD 1GUTA 1DOLA 1A2TA 1STNA 1I3QB 4ZUJA 4QUFA 1BCPB 1EEID 3I72A 5C4HA 1Y8NB 5I2YA 1S5CD 1F77A 5CORA 3SK4A 1JOKA 4A3BB 3PMFA 4IUTA 2A6HD 2K6AA 2ID0A 2JA8B 4BA2I 1S5DD 1K83B 1SXTA 1L0XB 4P2CB 2EY1A 2QF7A 4BBSB 5FK9C 1GHKA 1S5FD 2LY7A 1XX8A 1U4RA 1B44D 2FINB 2PZUA 1F2YA 2WV6D 3J81L 3HOXB 2JEAI 3FVQA 2A6EC 1PXUA 3ND9A 4GZYC 5T1IA 1QJOA 2B2VC 2RSOA 3M3YB 2EDGA 4BY1B 1WD0A 1Z7TA 5KNCA 4B9WA 3VR3A 2RA4A 4J6HA 1ML0D 3PUXA 4RGMA 1UAPA 2A73B 2WACA 2J0TD 4CJ2C 3PUVA 5DNFA 5EBCA 1V1PB 3LWEA 3AB9A 2D9UA 2PYKA 2SEBD 3URYA 1SE4A 1IHZA 3NK9A 5JEAJ 1LT4D 1HUNA 2DN8A 2B8FA 5A35A 4BWGB 2XNAC 4FYDA 2XN9C 2BA1A 2WAQB 1FNVA 1KABA 1PZJD 2N55A 4OO1G 3BDLA 4G7OC 3A7AB 3R8BA 4A3EB 1H9KA 1TWHB 1YNJC 2NTTA 5FKAC 2FMCA 4HCEA 1K8MA 3J80L 1HHVA 1SFOB 1HXYD 3S17B 2F0QA 1QNKA 2K04A 2ICEC 1EQTA 1QB5D 3FPUB 4FXKC 4WRDA 5CGKA 4TQUS 3DUZA 3PIO3 2Z8LA 3BYYB 2O5IC 4MN3A 4CKCA 1BOSA 4ZK9B 1LTAD 3T53B 1HCZA 1ICWA 5J39A 2F0JA 1FYCA 4K8JA 3HOVB 3MA2B 2CW0D 4B08A 1PTOB 2M9VA 4RCOA 3BVMA 2VB2X 4M1UB 3A8IE 3ZYYX 2L0CA 5KNDA 3SHLA 5CMDA 4HMJA 2A74C 3A56A 1V8QA 4DN4M 3W2DA 2NVYB 2LS01 1GUSA 4XTCS 1CTMA 3L7ZC 4L8JA 4QCLA 2RVLA 5I6WA 1EWCA 2NUCA 1BCPC 1B4OA 1E2WA 4XQNA 4O42A 2EYPA 1GUGA 4IFDI 2L1BA 1Q12A 1IKLA 1NCVA 3NBIA 3HOUB 1PFMA 2D5DA 5ELEA 1HUMA 3TZDA 1WTWA 3HG9A 3CU7A 2F0IA 2WIIB 3CKIB 3NTKA 4FXGC 5LHY1 4ME5A 5KIXA 1SYGA 5LL6S 1AZPA 1G8ZD 2E2JB 5IODA 1EWHA 1TKWB 5FO8B 1SYDA 1H9JA 1EOTA 3SK8A 4UDUC 5FO7B 1WTQA 1SMYC 2N88A 3J80E 3T16A 1IKMA 5CBAE 1PRTB 3S1RB 1I4RA 3I91A 2D62A 3TZUA 1PTOD 4C1NI 2PO4A 4X3UA 3HOZB 4H0LC 4KN7C 1MBYA 1PFBA 3PO3B 3TP5A 3NQIA 5C4JB 5JVG3 3C3LA 4A3JB 4I7ZC 3H94A 1SBBB 1FR3A 4OIKA 2IW3A 4V0BA 3H6MA 1I4PA 3S2DB 1ILQA 3K58A 4BY7B 2RDFA 1NR4A 1A2UA 1LT6D 4IN3A 4IZ8A 3T51B 2B2UC 4NKLA 3NWSA 4N9TA 1RHPA 2QCPX 4IQZA 1LABA 2A68C 1WTPA 3K5LA 1TQOA 1GOZA 5E3FA 1JC7A 1IW7D 4G4KA 3SXHA 4XT1B 2PW7A 3NE5B 5KGUA 5C0XJ 2SNMA 3IL8A 1TR5A 1OXUA 1FNWA 1JOOA 4XQJA 1DM0B 2F0MA 4EQNA 3KBXA 2JP1A 1GXDC 5EBDA 1RKNA 4KJNA 4IFDH 1Q1EA 1OXVA 3VYTA 4NDXA 4WFN3 5CV8A 4RGTA 3NWTA 5I9OA 3SEBA 2Q8RE 4JBWA 4C3HG 2EY2A 1G6ZA 4QMGA 5CV5A 1CZGA 5M5YB 1PTOF 5CV9A 3V96A 4DF7A 4ZRZA 1H9SB 1CK1A 2DNCA 1TIID 2F0DA 1FGBD 1ET9A 3GTJB 2IX0A 1SYCA 3Q0AA 3DHQA 3MFYA 4FVMA 4DXGA 2CHBD 5C5MA 3WOEA 4LAAA 2LMCB 2F0KA 2XSCA 2Z4IA 5BN5A 1RD9D 1ET6A 2F0EA 1Y69U 5LL6X 5CC4A 4XQQA 1PLFA 1ZEQX 1IYUA 2IX1A 4XYOA 3TBIB 2XVSA 1B3AA 2IJ0A 5BN4A 3J7AF 2K03A 4ZLTF 2EY6A 2C5CA 2JA7B 4C1NK 3HKZB 1WTOA 3OHXC 2IX3A 3OSOA 3TDQA 3J7YW 4RWSC 2B2YC 2MJ8A 1SDFA 3TSSA 1HPCA 3QG1A 1A3UA 4XXEA 2B39A 1STHA 2F0HA 1PRTC 3S9WA 4B9XA 4A93B 1EY4A 3F2UA 4KKTA 1XYIA 3MXPA 4G7ZC 1TVXA 1HTLD 4KD3A 3E0JA 5M3FB 4IFDG 2R93B 2B2TA 3GTGB 4HAEA 1ENFA 1STBA 1F9PA 4RKBA 3I8ZA 2A6ED 3HEJA 2MP1A 5A2QE 2IL8A 4RHRA 2JYOA 2F3VA 1IYVA 1Y8OB 3PO2B 2F0OA 1Y1VB 4HCSA 1MGSA 4KJOA 4RHSA 4RGOS 1YNNC 5EPJA 3CRLC 5KYLA 2OT2A 1I6VC 5IGDA 1X32A 2LFNA 3KLSA 1PDQA 3GTOB 4HSPA 1EL0A 1TWGB 2OEOA 2E74C 2HQEA 1X3PA 4NP5A 1SNOA 1GHJA 4MHEA 4C3JG 5J1ZA 2PQEA 3JAML 1ZXTA 3SE0A 3ERQA 5JPMC 2CVRA 1V43A 4HMIA 5M5XB 4Y7NB 2NZ1D 1A6XA 1H9MA 3SK6A 1YNJD 3D4DA 3WOFA 1U4MA 1SYFA 4DU9A 1RODA 1LTTD 1OXXK 1B9NA 2MPMA 5EJWA 3N52A 3I4MB 1O80A 4KTAA 3MFGA 2EXZA 5C4XB 3M4OB 5M9OA 1KLGD 3GV6A 3X3MA 4DFAA 2JA5B 3OWEB 3L3OC 1BXTA 5DEHA 4K2KA 3OMGA 5M3MB 4KKSA 4OGQC 1O7ZA 3NQTA 3DWQA 3C2PA 1M4VA 2X6LA 4Z9CB 2HDLA 3CQZB 5EPKA 1QG7A 1SNPA 4TKOB 1STEA 2BA0A 4ZAIA 5D65A 1LTRD 4KI0A 3QB3A 2AQ2B 1II3A 4K6DA 2BE5C 3Q22A 5G3LD 5IIFA 4F8MA 3NSWA 1BCPD 2ZXPA 3OWFA 4HEDA 1SAPA 1VF5C 1J9OA 3NUCA 1NR2A 1TY2A 3K5OA 4C3HB 3C1FA 1KLUD 1JQYD 1RF2D 1E0BA 1GJXA 3BVGA 1EIGA 5JOBA 3DM1A 2KECA 5JEAH 3PV0A 5E1FA 2B2VA 1MD2D 5IGBA 2FHTA 2F0VA 1CA5A 2EVBA 2RDHA 2IWHA 2AQ1B 3JAME 2AUKA 2NWGA 1CT1D 4A3GB 1Q90A 4J8QA 4K5VA 2KOLA 4OHJA 3Q6SA 5M5WB 1NUCA 1LT5D 5IGCA 4DGZA 1STGA 2R3ZA 3K57A 2B8GA 2L5TA 2L55A 1GUOA 3S2HB 3E5SA 2PCFB 1IL8A 4WORA 2E2HB 3CHBD 3MTSA 1EFID 3T56B 1AEXA 4CKBA 2F0PA 3C1EA 3VYUA 4RA8A 2MHVA 1DXMA 4FF2A 3OMCA 3RMHA 5ELBA 1C48A 4J1MA 2J7ZA 2EYMA 1G91A 4ZQ3A 2K1BA 3D6CA 1AFPA 1XTCD 1SJED 4KD4A 2BDNA 3MXUA 3BDCA 1D1IA 1QE6A 3PIP3 3V2TA 4XDXA 5G3LF 1B53A 1WVLA 3K0YA 4ZYSA 2IPKD 4IUNA 1BCPF 5ELFA 2NBFA 1AZQA 2VB3X 3P75A 3D4WA 2A68D 4IUQA 2R61A 1F9QA 5C0XI 3ND8A 5ISRA 4O1NA 4HSVA 3M85A 3SDZA 1KDCA 1Z47A 3FEWX 3GQBA 2PW5A 3SK5A 3VYSA 1CI3M 2RQXA 4PMWA 1E2ZA 5JEAG 2NTSA 1B50A 4KHZA 4RH6A 4RAUC 1I4XA 3KLRA 3K6OA 3MXNA 2KEEA 4I65A 3OIPA 4H13C 1SYEA 1D2BA 1EU4A 1R9TB 4QUCA 1EY6A 3MHBA 4RFBA 4L6TB 2O5JC 2AUJD 4DXFA 4C3JB 1LTID 5K36H 3KBGA 1TWFB 3GTQB 2H4OA 1O7YA 4PNYA 5DAUA 1SNCA 3TP8A 4KY7A 2VNUD 4HN7A 1LV9A 2EOTA 5FOBB 1A3TA 1SNQA 4MIUA 4U673 2V4DA 2F0SA 4K5WA 1JWMD 4BA1I 1WTRA 3TMEA 1WD1A 4KMUC 3S15B 1QWYA 3DEPA 1D5MC 4S3SA 2Q8IB 5COYA 1JOQA 5EPLA 3K7AB 3WDNA 4DA2A 1HA6A 1QNUA 1DYQA 4G57A 2EJGC 2XRQD 3VR4A 5IGGA 1JWSD 5JPNC 2BDOA 3BS1A 2PZWA 5JVH3 3ONAB 2NYZD 3U9SA 1CHPD 3V05A 5FO9B 4DK1A 5A2QL 1V1PA 3NXWA 2HCCA 5I2XA 3I70A 4IUPA 4KKUA 2EYHA 4CGYB 1Y1WB 1PRTD 2L9HA 4A3DB 1ZKOA 1OXSC 4ULLA 1HFNA 4Q0FA 1L0YB 1A3VA 1EYAA 1W6KA 3A8JE 2ZT9C 2BCOA 1EY8A 2RDGA 5C0XH 3GTMB 3QIAA 3NHHA 2K05A 1WTVA 4KHVA 4R9WA 5EKKA 1HTPA 2EJMA 3RD4A 4C3IG 3SR1A 2B2UA 2D2CC 2R92B 1EQVA 2RKSA 3IAYA 3MXGA 4IUUA 1QCBD 1V1OA 5K36G 4C56C 1ENAA 3K59A 1SE2A 3TP7A 1U9RA 2F0NA 3P20A 1Q3LA 1CM9A 1JR0D 3GTLB 1LO5D 2PMZB 1AP0A 1I4QA 4X3SA 2SNSA 2C9OA 3FPPA 3MAQA 1YNND 2ZXRA 2TMPA 3R2TA 4ZKBB 1S5ED 3ITPA 4LMQD 3E6ZX 4ZUIA 3HOYB 3K5MA 4K8IA 2F0FA 2R7ZB 1DOMA 3OOCA 2F0UA 1B9MA 3QOLA 3BZDB 1EU3A 1QILA 4G7HC 4PMBA 2ICIA 1HRJA 3MZ5A 1BQQT 1VMCA 4X3TA 3MEHA 5JJZA 2MGSA 3M7GA 2A69C 3O13A 2Z4HA 2QILA 4DNTB 3TP6A 4F7XA 1F9SA 2K5DA 3S14B 3S16B 2X6GA 3QWNA 5ELDA 5I9PA 4BS9A 5FLXL 4KV6A 1SEBD 4TSSA 1PRTF 2B2WA 1XXGA 1TY0A 3C46A 4CJ0B 4E6IA 2RSNA 1UNSA 3EJIA 2XIWA 4XT3B 5HURA 1ONLA 1ILPA 3D31A 3MWYW 3D8GA 3QOJA 1DOKA 4ZKCB 1TS5A 4LJZC 1F2MA 1I6HB 2WINB 2YYZA 3K5NA 2JSOA 4OIJA 3BYTB 1MSHA 5J22A 3R2IA 4X3KA 2XWBB 3KLSX 3X3NA 1G2TA 3BG3A 4JK1C 3T13A 4R8IA 3RZOB 2BOSA 3PUZA 3AMUA 2VUMB 1CQFA 1D1KA 2KEDA 1LTBD 2HCIA 1G291 2BE5D 4K2LA 3VA7A 5AFWA 3H91A 1KDAA 4UAIA 4PMCA 2JEBI 1JE4A 2F03A 5KYIA 4CHTB 1OXTA 3FMCA 2EE1A 1TWCB 1DCZA 1SJHD 5IGFA 1BF4A 1I4GA 5BN3A 3D4RA 5KEEA 4FXDA 5I6YA 2Q8TA 2EYLA 2K5QA 3DMUA 2HDMA 5D3DA 1U4PA 1STAA 4YIJA 2R6GA 3S1NB 4V190 2EJFC 2OF1A 1R4QB 1BR9A 2E2DC 2K33A 3DWPA 1GUWA 3HZXA 2E75C 4ABNA 4PQXA 5FLXE 1KTKA 1WTXA 2I07B 2O4XA 5I4DA 1PMRA 1OO9B 3LWUA 4XIGS 1EYCA 1W6JA 5EGTA 2PNRC 3QO2A 2KUMA 2WKCA 5EQ0A 2IT1A 1GUNA 3NTHA 3R93A 1ZYRC 5F2DA 3MVVA 2FMMA 1S4ZA 3G6JB 3S1MB 1H9RA 4KK7A 1SNDA 5C3WA 3A8KE 1DONA 1TWAB 1ENCA 4NW2A 2QDBA 1C8CA 5E4WC 4K14A 2E2IB 2F0LA 5C4ZA 1Y8PB 1LTGD 4RKLA 1F2ZA 3PUYA 4RCNA 1RJTA 1H9SA 4DNRB 3PUWA 1FD7D 1LLRD 1RTOA 2RBMA 4C3IB 2A6HC 1HQRD 1DD2A 2KA7A 3VR6A 5CV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXS C;  3CRK C;  4H13 C;  2KCC A;  4KN4 C;  1IYV A;  1Y8O B;  1E2V A;  1K8O A;  1IW7 C;  1GUS A;  3A8J E;  3MFY A;  2DN8 A;  2B8F A;  2PCF B;  4XTC S;  2ZT9 C;  1CTM A;  3L7Z C;  3M4Y A;  4L8J A;  2E76 C;  5A35 A;  2LMC B;  2R6G A;  1T5E A;  3I73 A;  3QIA A;  1E2W A;  3DXJ C;  4KKS A;  4OGQ C;  5C0X H;  2O5J C;  2AUJ D;  2BA1 A;  3T56 B;  4PV1 C;  3M7N A;  5BN5 A;  1GUT A;  2A69 D;  3T51 B;  1GUG A;  5K36 H;  1YNN C;  2EJF C;  4OO1 G;  3CRL C;  3LNN A;  4LK1 C;  1Y69 U;  1HTP A;  2EJM A;  1ONL A;  2K33 A;  1IYU A;  4G7O C;  3A7A B;  1DXM A;  1I6V C;  1H9K A;  2D2C C;  1Y8N B;  1YNJ C;  3D31 A;  3I72 A;  2E75 C;  1Q12 A;  4TKO B;  2NN6 H;  4IQZ A;  4LJZ C;  1LAB A;  1HQM C;  2A68 C;  2A6H D;  2BA0 A;  3IKJ A;  3QJY A;  2PPB C;  5BN4 A;  1LAC A;  1BDO A;  2D5D A;  4KI0 A;  2V4D A;  3IFT A;  2YYZ A;  5K36 G;  1K8M A;  2E74 C;  3VR5 A;  4BA1 I;  4BA2 I;  3GD7 A;  1IW7 D;  2BE5 C;  2K7V A;  5KNB A;  1GHJ A;  1Q1B A;  1VCI A;  3MXU A;  3VR2 A;  3P20 A;  4KMU C;  3NE5 B;  2QF7 A;  1PMR A;  2F1M A;  2DNE A;  3LWU A;  1GHK A;  3SE0 A;  2CW0 C;  4XIG S;  3FPP A;  2Q8I B;  1O7L A;  2NN6 G;  1VF5 C;  1HPC A;  3QG1 A;  1OXU A;  2PNR C;  1V43 A;  1VDZ A;  3A7L A;  4TQU S;  1A6X A;  2JEA I;  1H9M A;  3BG3 A;  4JK1 C;  1EWH A;  2IT1 A;  1GUN A;  2JE6 I;  2A6E C;  3OW7 A;  3PUZ A;  3WDN A;  5C0X G;  3ND9 A;  4GZY C;  1TKW B;  3OOC A;  2JXM B;  1ZYR C;  2O5I C;  1H9J A;  1B9M A;  4IFD H;  1Q1E A;  1OXV A;  1QJO A;  2A68 D;  2EJG C;  1GJX A;  3W3A A;  2EDG A;  3VR4 A;  1SMY C;  1H9R A;  1Z7T A;  3ND8 A;  5JEA H;  3T53 B;  4DK0 A;  5KNC A;  1G29 1;  1HCZ A;  3PV0 A;  3M85 A;  1TU2 B;  4G7H C;  2BDO A;  2BE5 D;  3A8K E;  3VR3 A;  3VA7 A;  1OXX K;  1B9N A;  1FYC A;  2EVB A;  4KKT A;  3SDZ A;  3I4L A;  1Z6H A;  1O78 A;  1VF7 A;  2AUK A;  4H44 C;  4JBW A;  4G7Z C;  2D62 A;  3TZU A;  1Q90 A;  1Y8P B;  3GQB A;  3RLF A;  3PUX A;  4IFD G;  1CFM A;  2A69 C;  3U9S A;  1CI3 M;  2JEB I;  3PUY A;  2NN6 I;  4H0L C;  4HR7 B;  4KN7 C;  4RCN A;  4DK1 A;  4DNT B;  1OXT A;  1E2Z A;  1H9S A;  3FMC A;  4DNR B;  5JEA G;  3HGB A;  3A8I E;  3PUW A;  4KHZ A;  5KND A;  3PUV A;  1DCZ A;  3BDO A;  2A6E D;  3H94 A;  4I7Z C;  1H9S B;  4KKU A;  3KLR A;  2DNC A;  5BN3 A;  3D4R A;  1FR3 A;  3AB9 A;  2K32 A;  2A6H C;  3EQL C;  3N6R A;  2AWO A;  2B8G A;  2L5T A;  1V8Q A;  4OO1 H;  1DD2 A;  2KA7 A;  3VR6 A;  1GUO A;  1ZKO A;  3OPO A; 
#chains in the Genus database with same CATH topology
 2KHI A;  2EPB A;  3CRK C;  4JI3 Q;  2KCC A;  4KN4 C;  4B3R Q;  3I90 A;  2AHO B;  2B63 H;  3ZJY C;  3Q24 A;  2SOB A;  1JWU D;  3M4Y A;  4DR1 Q;  5D14 A;  1JOR A;  5DM6 3;  1L1O C;  4A75 A;  2G9D A;  3DEO A;  3T4A C;  1KL9 A;  1N8R C;  1PH2 A;  1CSQ A;  4ID6 A;  4K5X A;  4X62 Q;  4A3F G;  1CKO A;  3I4N B;  3A55 A;  3EFX D;  4A3M H;  1SYB A;  4LK1 C;  4ME3 A;  2QA4 A;  1TS4 A;  3S1Q H;  3PCO B;  5C6A A;  2O2L D;  1HNX Q;  4ILW A;  1I3Q H;  2VXW A;  1WCM G;  4DV2 L;  1SMY D;  1WOC A;  1SE3 A;  1VQK A;  3NPP A;  3TRZ A;  1HQM C;  5IT9 c;  1HFG A;  3IKJ A;  1A0I A;  1AW7 A;  5M5X H;  1LAC A;  3GD7 A;  4DK3 C;  1RCV D;  1UEB A;  4EQO A;  1JB3 A;  3VYR A;  1EIH A;  5CYU A;  1K83 H;  2KQ3 A;  2DNE A;  5H1S E;  1NMF A;  4JC0 A;  1O7L A;  4OON A;  4BBS H;  2NVT B;  1G6P A;  4I7A A;  3VDY A;  2GVA A;  2EYO A;  2FXQ A;  1HJP A;  1I4H A;  1X9N A;  3A7L A;  4IAL A;  4C2M B;  2UUB L;  3ERS X;  3OW7 A;  1U4L A;  4QB4 A;  1Q86 C;  5IGE A;  4R4Q A;  3J81 E;  1HNZ L;  2JA6 G;  1PVO A;  1IBL L;  3EA6 A;  1EZ8 A;  3W3A A;  3UDF A;  4IUR A;  5C44 B;  2GA4 B;  2Y0S G;  5C3E B;  2CH4 W;  1EY5 A;  3M3Y H;  1TXY A;  4BY1 H;  5EKI A;  4EGV A;  2UXB L;  2FJ2 A;  3A54 A;  4H7B A;  3RLO A;  1VF7 A;  4M8A A;  4H44 C;  4R8N A;  1HA5 A;  1MI2 A;  1ESR A;  3RLF A;  1PZK D;  4IUV A;  1B2T A;  2Z1C A;  2CKZ B;  4LF9 Q;  2NN6 I;  4HR7 B;  3WWV A;  4LFC Q;  4BBR G;  1K73 C;  3HGB A;  4DUY Q;  1VQ4 A;  1A62 A;  3VA5 A;  1BBW A;  1FL0 A;  2K32 A;  4DAP A;  4DUZ Q;  4LF8 Q;  1TT2 A;  4FF4 A;  2XWJ B;  4OL7 A;  3GO5 A;  5JAV A;  4K0K L;  3R3O A;  2NVQ B;  2MFI A;  3BZK A;  3HKZ E;  4AYB B;  2EZV A;  2ZXO A;  4TRD A;  4BXX H;  1B7Y B;  3RZD B;  3FKI B;  3CCU A;  1AN8 A;  2HT1 A;  1RTN A;  1SR3 A;  2K14 A;  4XYQ A;  3AU7 A;  1NSN S;  4LF6 Q;  4MTK A;  2F0T A;  2LXJ A;  3FRP B;  1QOH A;  1EQQ A;  1T5X D;  1A15 A;  4DAV A;  2L4N A;  2A5H A;  3GV3 A;  2B63 G;  1X3Q A;  3IFD A;  3I3C A;  4YCW A;  3NP8 A;  1TS2 A;  1FVI A;  1EYG A;  4A3E H;  2AMC B;  2I5H A;  4A3C H;  1VQL A;  4N9P A;  3IFT A;  4C3H H;  2ENB A;  2M2L A;  2K28 A;  2K7V A;  2MO1 A;  4A3M G;  3KOJ A;  5KRU A;  1XPR A;  3UI2 A;  3CC7 A;  2WB1 B;  1D7Q A;  1B1Z A;  1YIJ A;  2WKD A;  4CBV A;  5IT9 L;  1SFO H;  2CW0 C;  2KJX A;  3S17 H;  3ULL A;  3H0G B;  4DV4 L;  2G9H D;  5K5P A;  3NBH A;  2VW9 A;  4A3B G;  4POG A;  1SSO A;  4KY5 A;  1PZI D;  4JI4 Q;  2JXM B;  4QIW B;  2JA8 G;  4P73 A;  1QUQ B;  1CA6 A;  4IOC A;  1EY7 A;  1EEF D;  2H1E A;  5HGT A;  1VQ5 A;  3EN2 A;  3KUP A;  2K01 A;  2I5M X;  3FDT A;  4BBS G;  4DR4 Q;  5CV4 A;  2F0G A;  4QF4 A;  1EZ6 A;  1O78 A;  3RR5 A;  2QEJ C;  2OXP A;  3HOX G;  4APV A;  4A76 A;  3S2H H;  1R4P B;  1PYW D;  2WP8 J;  4JG2 A;  4FF1 A;  1KNA A;  2AQ3 B;  4A3I B;  1UE6 A;  1E3P A;  5DM7 3;  1PTO H;  2KCN A;  2V1C C;  3BDO A;  4BY1 G;  1WJJ A;  4DAM A;  4IFD J;  2DY7 A;  3EQL C;  3ICE A;  4IJL A;  3W5O A;  1JJC B;  1X3E A;  1M8A A;  3CXC A;  2NVY H;  4FP5 D;  1X65 A;  1BNZ A;  3RLN A;  1T5E A;  3DXJ C;  1JIC A;  2UUA Q;  1MSG A;  1HH2 P;  1UUP A;  2GN5 A;  5CR3 A;  2A69 D;  2DY8 A;  1IZ6 A;  1RDP D;  3UDI A;  5CBE E;  4YCU A;  3LNN A;  1EWI A;  2NVX B;  3HOW B;  2F4I A;  2EYJ A;  5EKL A;  5T1G A;  3G7L A;  1I50 B;  2KVM A;  1I94 Q;  2EY5 A;  4GLV B;  1V1Q A;  1EYD A;  1CKN A;  2NN6 H;  4BXX G;  1LT3 D;  2QKI C;  1IXR A;  5C5L A;  2PPB C;  1BDO A;  4GKK Q;  2PQA A;  1PFN A;  2IY5 B;  3VR5 A;  3TN2 A;  4DV0 L;  3HOU H;  5KNB A;  4CDF C;  1K28 A;  2WAQ G;  2Z6K C;  5GAH C;  1NAP A;  1Q7Y C;  4JI1 Q;  1EY0 A;  3HKS A;  2F1M A;  3KK7 A;  1VQE A;  1BUV T;  1D6E C;  4EQP A;  4A3K B;  1PTO C;  2B29 A;  1DGS A;  1JCK B;  4A3E G;  4CJ1 B;  3P1H A;  4A3C G;  1CQV A;  3SVM A;  4HTH A;  1DJR D;  4OO1 I;  3OTO Q;  2UXD Q;  1Q8I A;  2L15 A;  2E2J H;  4R4T A;  1PH9 A;  4NB3 A;  3H3V C;  1KAA A;  2M00 A;  3GTK B;  3CPW A;  1FJG L;  3HS0 C;  5IOC A;  4X66 L;  1RIP A;  5E4X A;  4DK0 A;  1LTS D;  3P7J A;  1D5X C;  3OIQ A;  3KF8 A;  1TU2 B;  1VQA A;  4NMZ A;  4JI8 L;  2B2W C;  1IBM L;  2L11 A;  4TVA B;  2OTJ A;  3DWA A;  2B2T C;  2OTL A;  4Q5V A;  1XWE A;  2HIV A;  1MJC A;  5IT9 E;  4FNF A;  3S1R H;  4DAY A;  4LFB L;  1CFM A;  1F9R A;  2AKW B;  1HR0 Q;  3D0F A;  5IYC H;  1E24 A;  3D3R A;  2ATW A;  1DZ1 A;  4A3F B;  3PO3 H;  1Q46 A;  1UEA B;  2HUG A;  4FO2 A;  4C3J H;  5C4J H;  1VQO A;  2G5D A;  1TWF H;  2AWN A;  4A3J H;  3J7A V;  3HRZ C;  3OPO A;  1YI2 A;  1WCM B;  4GNX A;  3HOV G;  1K8O A;  1IW7 C;  5NUC A;  3I55 A;  4L63 B;  2KHS A;  3IRB A;  2FFK B;  1STY A;  1OTC A;  1VMP A;  1HR0 W;  2LKV A;  3F2D A;  1EQR A;  3I73 A;  2X69 A;  1XNR L;  3S2D H;  3U9O A;  3LX0 A;  4PV1 C;  4BY7 H;  2K5H A;  2YU9 B;  1P8L A;  3RUZ A;  1EY9 A;  2CQA A;  1C4Q A;  1JJG A;  3S15 H;  2TSS A;  1SNM A;  1K3B C;  4LF5 Q;  1J6Q A;  3Q23 A;  2RHS B;  2XRS D;  2I46 A;  1HZC A;  1GM5 A;  3QJY A;  2VQE L;  1BBX C;  5AJ3 Q;  1K0R A;  3J81 i;  1CZW A;  2JA6 B;  1PHJ A;  3K7A H;  1YHA A;  4WJW A;  4CKE A;  1Q1B A;  1VCI A;  3VR2 A;  4F88 A;  1F2L A;  3GTP B;  2Y0S B;  5TSS A;  1TS3 A;  4U68 A;  1KNE A;  4RGN A;  4KY6 A;  4JI6 L;  2EYF A;  1L1O B;  5C3X A;  2NN6 G;  1UE7 A;  5ELN A;  1VQ6 A;  1PA6 A;  1S40 A;  1VDZ A;  4K6L A;  3L9A X;  3EVQ A;  2F3W A;  2JE6 I;  1D5Z C;  2K5W A;  4ODG A;  5C0X G;  3HOU G;  2L12 A;  4BBR B;  1GVP A;  4EVO A;  5LMN L;  2PZT A;  1FNU A;  2YTV A;  2YTY A;  3HP3 A;  4FF3 A;  3GP7 A;  3MC0 B;  4F87 A;  3CC2 A;  2MUY A;  2F0W A;  1Y1W H;  3ERO A;  4A3L H;  3I4L A;  1Z6H A;  5ELC A;  2B2Y A;  3NTI A;  4DR5 Q;  3H09 A;  4HJ9 A;  4JYA L;  1BO0 A;  2DGY A;  4DR7 L;  1ESF A;  5CV6 A;  3T1Y L;  3W1B A;  3NEN A;  2D0O A;  4KLK A;  3S24 A;  1NBW A;  5M5Y H;  4JI2 L;  1J8I A;  1ZYR D;  1KRS A;  3N6R A;  1HZ9 A;  2AWO A;  2ZJQ A;  2N3S A;  1KDB A;  4OO1 H;  3OW2 A;  2B63 B;  2J4X A;  3MXN B;  1E2V A;  1G2S A;  1Q82 C;  3GTJ H;  3J7A 5;  5D3I B;  2E76 C;  3BVZ A;  5IYC G;  1CHQ D;  4HJA A;  3U58 A;  2NB0 A;  3KJO A;  2K52 A;  3HOZ G;  3PO3 G;  4A3M B;  4X65 Q;  2SDF A;  3S1Q B;  3D6W A;  3M7N A;  1S5B D;  4EQ5 A;  1GUT A;  2Q2U A;  1SRO A;  1DOL A;  1A2T A;  3J80 i;  1STN A;  1I3Q B;  4ZUJ A;  5LMU L;  4DV3 Q;  4QUF A;  1BCP B;  1EEI D;  3I72 A;  1I5F A;  5C4H A;  1Y8N B;  5I2Y A;  1S5C D;  1F77 A;  5COR A;  3SK4 A;  1JOK A;  4A3B B;  3PMF A;  4IUT A;  2A6H D;  4DV7 L;  3RN2 A;  2MQH A;  3CCV A;  2K6A A;  2ID0 A;  4JI3 L;  4B3R L;  2JA8 B;  4NXN L;  4BA2 I;  1S5D D;  1K83 B;  3ULP A;  1SXT A;  1L0X B;  4P2C B;  2F4V L;  2EY1 A;  2QF7 A;  4BBS B;  2WFW A;  2JA7 H;  5FK9 C;  1GHK A;  1S5F D;  4X62 L;  1N34 Q;  2LY7 A;  1XX8 A;  1U4R A;  1B44 D;  2FIN B;  2PZU A;  1VQ7 A;  1F2Y A;  2WV6 D;  2KEN A;  3J81 L;  3HOX B;  2JEA I;  3KJP A;  3FVQ A;  2A6E C;  1XNQ L;  1PXU A;  3ND9 A;  3CC4 A;  4GZY C;  4YWL A;  5T1I A;  1QJO A;  2B2V C;  2RSO A;  3M3Y B;  2EDG A;  4BY1 B;  1WD0 A;  1Z7T A;  5KNC A;  3QR8 A;  4PZ6 A;  2E5L Q;  4B9W A;  3VR3 A;  2HD3 A;  4A93 H;  2RA4 A;  1N33 L;  2JJQ A;  4J6H A;  1AE3 A;  4CDC C;  1ML0 D;  3PUX A;  3CF5 A;  2K75 A;  4DV6 Q;  1N36 Q;  4RGM A;  4DKA C;  1UAP A;  3PIO A;  5IP7 G;  2A73 B;  2WAC A;  2J0T D;  4CJ2 C;  4NPS A;  2R93 H;  4DV1 Q;  3GTG H;  3PUV A;  5DNF A;  5EBC A;  1V1P B;  2JN4 A;  3LWE A;  3CAM A;  3AB9 A;  2HHH Q;  2D9U A;  4B3T L;  2PYK A;  2SEB D;  3URY A;  1SE4 A;  1IHZ A;  1EUJ A;  3NK9 A;  5JEA J;  4B3M Q;  1LT4 D;  4DR2 Q;  2DN8 A;  2B8F A;  1HUN A;  2OQK A;  5A35 A;  3PO2 H;  3PQI A;  2ZM6 Q;  4BWG B;  2XNA C;  1PFS A;  3T1H L;  4FYD A;  2XN9 C;  1Y1V H;  2BA1 A;  2WAQ B;  1FNV A;  1KAB A;  1PZJ D;  1PH1 A;  2N55 A;  4LF9 L;  3HFZ B;  4OO1 G;  1IL2 A;  3BDL A;  4G7O C;  4DUY L;  3A7A B;  3R8B A;  4A3E B;  1H9K A;  1TWH B;  1VQI A;  1YNJ C;  2NTT A;  4HIO A;  1N9W A;  2OQ0 A;  5IWA L;  5FKA C;  2FMC A;  2QDL A;  4HCE A;  3TQY A;  1CSP A;  3KF6 A;  4GOP A;  1K8M A;  3J80 L;  3RZO H;  1HHV A;  4QQB X;  4LUV A;  3GTO H;  2CH4 A;  1SFO B;  1HXY D;  1TWG H;  4AQY L;  3S17 B;  2F0Q A;  1QNK A;  2K04 A;  2ICE C;  1EQT A;  1QB5 D;  5EAY A;  1XMO L;  4LF6 L;  4JBJ A;  3FPU B;  1Y14 B;  4FXK C;  4GN4 B;  4WRD A;  5CGK A;  3BJU A;  4TQU S;  3DUZ A;  3PIO 3;  4O2D A;  2Z8L A;  3BYY B;  3I56 A;  4Y7N H;  2O5I C;  3STB C;  4MN3 A;  1YJN A;  1YHB A;  4CKC A;  2ZJP A;  2JA7 G;  2NZO A;  2QW7 A;  3HKZ G;  1BOS A;  4ZK9 B;  1LTA D;  3T53 B;  4YY3 Q;  1HCZ A;  2RCF A;  1ICW A;  1TWC H;  5J39 A;  2F0J A;  1EIY B;  1NMG A;  4LF7 Q;  1FYC A;  1U0L A;  4K8J A;  4B3S Q;  1VS0 A;  3HOV B;  3MA2 B;  3F1Z A;  3KDF A;  4LF4 L;  2CW0 D;  4B08 A;  5JJL A;  1PTO B;  2M9V A;  4RCO A;  1ASY A;  3BVM A;  3I4M H;  1HZA A;  2VB2 X;  4M1U B;  3A8I E;  3ZYY X;  2L0C A;  5KND A;  3SHL A;  5C4X H;  5CMD A;  5BR8 Q;  4JI4 L;  4A93 G;  4HMJ A;  2ALY B;  3M4O H;  2A74 C;  3A56 A;  2VQF L;  1E1O A;  4FDB A;  1V8Q A;  4DN4 M;  4OX9 Q;  2Z0S A;  3W2D A;  1W3S A;  2NVY B;  2LS0 1;  3G71 A;  2CQO A;  2JA5 H;  1GUS A;  4XTC S;  2PI2 A;  1CTM A;  3L7Z C;  4L8J A;  5M3F G;  4QCL A;  2R93 G;  2RVL A;  5I6W A;  3UE1 A;  1EWC A;  2NUC A;  4YHH Q;  2PMZ E;  1BCP C;  1B4O A;  1E2W A;  4XQN A;  4O42 A;  2EYP A;  1GUG A;  5M3M H;  4IFD I;  4QL5 A;  1J5E Q;  3PSI A;  5DLQ E;  4DPG A;  2L1B A;  1Q12 A;  1IKL A;  3PO2 G;  5FJ8 H;  3CQZ H;  1NCV A;  2GVB A;  4ALP A;  3NBI A;  3HOU B;  1PFM A;  1Y1V G;  2D5D A;  5ELE A;  1HUM A;  2OCE A;  3TZD A;  1S72 A;  1PYB A;  1E7Z A;  1WTW A;  3HG9 A;  3CU7 A;  2F0I A;  2WII B;  3CKI B;  3NTK A;  4FXG C;  5LHY 1;  2UUA L;  4ME5 A;  5KIX A;  1SYG A;  5LL6 S;  1AZP A;  1G8Z D;  2E2J B;  5IOD A;  2UU9 Q;  1C9O A;  1ICF B;  1VQC A;  1EWH A;  1I94 L;  3CP0 A;  4GLX A;  1KAW A;  1TKW B;  5FO8 B;  1SYD A;  1H9J A;  1EOT A;  3SK8 A;  2MO0 A;  4UDU C;  5FO7 B;  1WTQ A;  4GKK L;  1SMY C;  2N88 A;  3J80 E;  4DV2 Q;  3T16 A;  1IKM A;  5CBA E;  4JI1 L;  1PRT B;  3S1R B;  1I4R A;  2PI2 E;  4C3I H;  4GN3 B;  3I91 A;  2D62 A;  3TZU A;  4LUZ A;  1PTO D;  4C1N I;  2ZTC A;  2PO4 A;  4X3U A;  3HOZ B;  4H0L C;  4KN7 C;  1MBY A;  1PFB A;  3CCL A;  3TP5 A;  3PO3 B;  3CPF A;  2UXD L;  3NQI A;  5C4J B;  2HQL A;  5JVG 3;  4UPA A;  5M5W H;  3L0O A;  3C3L A;  4A3J B;  4I7Z C;  3H94 A;  4IPC A;  1SBB B;  2ES2 A;  1FR3 A;  4OIK A;  4LNQ A;  1JJ2 A;  2IW3 A;  4V0B A;  4O0A A;  5J3B A;  4IOA A;  4N8X 1;  3RN5 A;  1JE5 A;  4DR6 Q;  3H6M A;  1IBL Q;  1C0A A;  1I4P A;  3I4M G;  1GO3 E;  3S2D B;  1ILQ A;  3K58 A;  1B8A A;  3A74 A;  4BY7 B;  2RDF A;  5C4X G;  1NR4 A;  1A2U A;  2E2H H;  1LT6 D;  4IN3 A;  4IZ8 A;  3JC6 6;  3T51 B;  2B2U C;  3AFP A;  4NKL A;  5GQO A;  1LUZ A;  3NWS A;  4N9T A;  2JA5 G;  1RHP A;  3K81 C;  5GAG C;  3BZC A;  4GN5 A;  4DV5 Q;  4JOI C;  4OXP A;  1W2B A;  2QCP X;  2R7D A;  4IQZ A;  1LAB A;  2A68 C;  1WTP A;  1PH7 A;  2YV5 A;  3K5L A;  1TQO A;  1GOZ A;  5E3F A;  4L5R C;  1JC7 A;  4ZCK A;  3CCJ A;  5M3M G;  1IW7 D;  2LSS A;  4G4K A;  3SXH A;  4XT1 B;  2PW7 A;  3NE5 B;  5KGU A;  5C0X J;  1VQM A;  2R7F A;  2SNM A;  3IL8 A;  5FJ8 G;  1TR5 A;  1OXU A;  1HNW Q;  1SE8 A;  1FNW A;  1JOO A;  4XQJ A;  1EFW A;  3NEL A;  4N8F A;  1DM0 B;  2F0M A;  2N49 A;  3KBX A;  4EQN A;  4R4O A;  2JP1 A;  1GXD C;  5EBD A;  1RKN A;  1X55 A;  4KJN A;  4IFD H;  1E1T A;  2EXD A;  1Q1E A;  1OXV A;  3VYT A;  1YBY A;  3DM3 A;  4NDX A;  5AJ3 L;  3F2B A;  4WFN 3;  1VQJ A;  3AEV A;  3M4P A;  5CV8 A;  4RGT A;  3NWT A;  5I9O A;  3K8A A;  3SEB A;  2Q8R E;  1QZH A;  1X54 A;  4JBW A;  3DLL A;  4C3H G;  2EY2 A;  2BH2 A;  1G6Z A;  4QMG A;  5CV5 A;  1CZG A;  5M5Y B;  1PTO F;  5CV9 A;  3V96 A;  4P71 A;  4ZRZ A;  4DF7 A;  4DV4 Q;  1H9S B;  1CK1 A;  2DNC A;  3A0J A;  1TII D;  2F0D A;  1FGB D;  2UUC L;  1ET9 A;  3I2Z A;  3GTJ B;  3J81 j;  3CCQ A;  2IX0 A;  4LFA L;  4X6A H;  1SYC A;  3Q0A A;  3DHQ A;  3MFY A;  2JK8 A;  4FVM A;  1XTD A;  2CHB D;  4DXG A;  1PH4 A;  5C5M A;  3WOE A;  4LAA A;  2LMC B;  2RF4 A;  1R9T H;  2F3I A;  2F0K A;  2XSC A;  4UP9 A;  2Z4I A;  5BN5 A;  1RD9 D;  2VY3 A;  1ET6 A;  2F0E A;  2Z9H A;  1Y69 U;  5LL6 X;  5CC4 A;  4XQQ A;  1PLF A;  1ZEQ X;  1IYU A;  2IX1 A;  4XYO A;  3GTQ H;  3TBI B;  3JAM c;  2XVS A;  1B3A A;  3H15 A;  1C7Y A;  3PF4 A;  4OWW B;  4GKJ Q;  2IJ0 A;  5BN4 A;  3J7A F;  1EOV A;  2K03 A;  4ZLT F;  2EY6 A;  2MNA A;  2C5C A;  4H02 A;  2JA7 B;  4C1N K;  4DR3 Q;  2K50 A;  3HKZ B;  1WTO A;  3OHX C;  2IX3 A;  3OSO A;  5ELO A;  1M90 C;  3TDQ A;  4X65 L;  3J7Y W;  4RWS C;  2B2Y C;  1VQ8 A;  2MJ8 A;  1SDF A;  3TSS A;  1ASZ A;  1HPC A;  3QG1 A;  1PH5 A;  4KHP L;  1A3U A;  1PH8 A;  4XXE A;  2B39 A;  2RHQ B;  1KIX A;  1STH A;  1MKH A;  2F0H A;  1PRT C;  3S9W A;  4B9X A;  5FLM H;  2UXC L;  3W1G A;  4A93 B;  1EY4 A;  1K8A C;  5HGQ A;  3F2U A;  4KKT A;  1XYI A;  4JI7 L;  3MXP A;  4G7Z C;  1TVX A;  1HTL D;  4KD3 A;  3E0J A;  5M3F B;  1N34 L;  4IFD G;  2R93 B;  2B2T A;  3GTG B;  1UE5 A;  3KYH C;  4NXM L;  4HAE A;  4QGU A;  4HIM A;  1ENF A;  1STB A;  1F9P A;  1SN8 A;  4RKB A;  3I8Z A;  1KXL A;  2A6E D;  2K5N A;  3HEJ A;  4JV5 L;  2MP1 A;  5A2Q E;  2IL8 A;  4RHR A;  2JYO A;  2Q2T A;  2F3V A;  3HOW H;  1I50 H;  1IYV A;  1Y8O B;  3PO2 B;  2JA9 A;  2E5L L;  2F0O A;  1M1K C;  4A3D H;  1K0S A;  1MJE A;  1V9P A;  1Y1V B;  1BKB A;  5GAE C;  2A1A A;  4HCS A;  1MGS A;  4KJO A;  4RHS A;  1N36 L;  4R4I A;  4DV6 L;  4RGO S;  1LTL A;  1IBM Q;  1YNN C;  3CMA A;  1L0W A;  3GTM H;  3BU2 A;  5EPJ A;  3CRL C;  3EBE A;  2I0Q A;  5KYL A;  2OT2 A;  4LFB Q;  1I6V C;  5IGD A;  2PNH A;  1KC8 C;  1X32 A;  3PF5 A;  2HHH L;  5L37 A;  2LFN A;  1LYL A;  2R92 H;  1YHQ A;  3KLS A;  1PDQ A;  3GTO B;  4HSP A;  1EL0 A;  1TWG B;  2OEO A;  2E74 C;  2HQE A;  1VQ9 A;  4IO9 A;  1X3P A;  4NP5 A;  1SNO A;  1GHJ A;  4MHE A;  5IYD H;  4C3J G;  5J1Z A;  2PQE A;  3JAM L;  1ZXT A;  4JI5 L;  4A3J G;  3F8T A;  4L5S A;  3TS2 A;  2VZA A;  3SE0 A;  3ERQ A;  5JPM C;  2CVR A;  3GTL H;  3TS0 A;  1V43 A;  4YWM A;  4HMI A;  5M5X B;  4Y7N B;  2NZ1 D;  1A6X A;  1H9M A;  1QUQ A;  3SK6 A;  1YNJ D;  3NBH B;  3L2P A;  4BY7 G;  3D4D A;  2LXK A;  3HOY H;  2IHE A;  2R7Z H;  3WOF A;  4DR1 L;  1U4M A;  1SYF A;  4A3F H;  4DU9 A;  1ROD A;  1LTT D;  4AYB E;  1OXX K;  1B9N A;  2MPM A;  2VQE Q;  1PH6 A;  5EJW A;  3N52 A;  1O7I A;  1IBK Q;  3I4M B;  1O80 A;  2E8G A;  4R1J A;  1HNX L;  4KTA A;  3MFG A;  2EXZ A;  4AH6 A;  5C4X B;  5FLM G;  4JPB W;  3KFU A;  3G48 A;  4JI6 Q;  3M4O B;  3F2C A;  5M9O A;  1KLG D;  3GV6 A;  3X3M A;  4DFA A;  1KHI A;  3STB D;  2YU9 H;  2JA5 B;  3OWE B;  3CW2 C;  3S14 H;  3S16 H;  3L3O C;  1BXT A;  1SRU A;  5LMN Q;  2N8N A;  5DEH A;  4LF7 L;  1UWV A;  4K2K A;  5E7N A;  3OMG A;  2WB1 E;  1D8L A;  3E9H A;  4J15 A;  5M3M B;  4KKS A;  4OGQ C;  1O7Z A;  2JA6 H;  3NQT A;  3DWQ A;  3C2P A;  1M4V A;  2X6L A;  4Z9C B;  1Y1W G;  2HDL A;  4A3L G;  3CQZ B;  5EPK A;  5BR8 L;  2ASB A;  1QG7 A;  4A3D G;  4QIW E;  1VQH A;  2CWP A;  1SNP A;  1BBU A;  4TKO B;  4UP7 A;  5LMN W;  4MZ9 A;  3T1Y Q;  1N32 Q;  1STE A;  4JI0 Q;  2BA0 A;  1GD7 A;  4ZAI A;  4P72 A;  5D65 A;  1LTR D;  1CKN B;  4KI0 A;  4CDE C;  3QB3 A;  2AQ2 B;  3E3X A;  1II3 A;  4K6D A;  3I4O A;  2BE5 C;  3Q22 A;  5G3L D;  1I6H H;  5IIF A;  2PQA B;  2CWA A;  4F8M A;  4LFC L;  3NSW A;  1BCP D;  2ZXP A;  3OWF A;  4HED A;  1SAP A;  2R92 G;  1VF5 C;  2Q2I A;  1J9O A;  1J5E L;  3NUC A;  1NR2 A;  1TY2 A;  3K5O A;  4C3H B;  4DUZ L;  3C1F A;  4LF8 L;  1KLU D;  1JQY D;  1B70 B;  3AFQ A;  1RF2 D;  1E0B A;  5JJI A;  3KLW A;  1GJX A;  3BVG A;  1EIG A;  5JOB A;  3ULJ A;  3PIP A;  3DM1 A;  2KEC A;  5JEA H;  2VUM H;  3PV0 A;  5E1F A;  2B2V A;  1MD2 D;  5IGB A;  2FHT A;  2F0V A;  4DV7 Q;  1CA5 A;  2EVB A;  2RDH A;  2IWH A;  2AQ1 B;  3JAM E;  3KF8 B;  4NXN Q;  2AUK A;  2NWG A;  1CT1 D;  4A3G B;  4RMF A;  1Q90 A;  4J8Q A;  4K5V A;  4DNI A;  2F4V Q;  2KOL A;  4OHJ A;  3Q6S A;  3U4Z A;  5M5W B;  2UU9 L;  3HOY G;  2R7Z G;  4DAY B;  1NUC A;  1LT5 D;  2VS1 A;  5IGC A;  4DGZ A;  4A3G H;  1STG A;  2R3Z A;  3K57 A;  1FGU A;  2B8G A;  2L5T A;  2N78 A;  2P5Z X;  2L55 A;  1GUO A;  1XNQ Q;  4QY7 A;  1G51 A;  3S2H B;  3E5S A;  4YWK A;  2PCF B;  1IL8 A;  4WOR A;  2E2H B;  3CHB D;  4GNX B;  3PGZ A;  1X56 A;  3CCS A;  4A3B H;  1U5K A;  4HJ5 A;  3MTS A;  2IHF A;  5IP9 H;  1EFI D;  4X64 Q;  3T56 B;  1AEX A;  4CKB A;  2JA8 H;  1N33 Q;  2F0P A;  3C1E A;  3VYU A;  1XMQ Q;  3S1N H;  3E9I A;  4RA8 A;  1X6O A;  2MHV A;  3G6E A;  1DXM A;  4FF2 A;  3OMC A;  3RMH A;  5ELB A;  2ZTE A;  1C48 A;  4LUO A;  4J1M A;  2J7Z A;  2EYM A;  2JQO A;  4DR4 L;  1G91 A;  4ZQ3 A;  2K1B A;  2A19 A;  3D6C A;  2KCM A;  1X3G A;  1AFP A;  3H3V I;  1XTC D;  1SJE D;  3HOX H;  4DR6 L;  1NNX A;  4KD4 A;  3B6Y A;  4B3T Q;  2BDN A;  3K80 C;  3MXU A;  2CFM A;  1D1I A;  1QE6 A;  3BDC A;  4AIM A;  3PIP 3;  3V2T A;  1L1O A;  4XDX A;  3UE0 A;  5G3L F;  1B53 A;  4JBM A;  4QJF A;  1WVL A;  4POF A;  3K0Y A;  4ZYS A;  2IPK D;  4IUN A;  1BCP F;  5ELF A;  3T1H Q;  2NBF A;  1PYS B;  4DV5 L;  2D0P A;  3AYH B;  1AZQ A;  2VB3 X;  3P75 A;  3D4W A;  2A68 D;  1WI5 A;  4IUQ A;  2R61 A;  1F9Q A;  5C0X I;  3ND8 A;  5ISR A;  4O1N A;  5IWA Q;  4HSV A;  3M85 A;  3RNU A;  3S1M H;  2Q2H A;  3SDZ A;  1SLJ A;  1KDC A;  1Z47 A;  3FEW X;  1TWA H;  3GQB A;  2PW5 A;  4JBK A;  3SK5 A;  2ZTD A;  3VYS A;  2E2I H;  1CI3 M;  1HNW L;  4AQY Q;  2RQX A;  4PMW A;  1E2Z A;  4MTN A;  5JEA G;  2VUM G;  2NTS A;  1B50 A;  4KHZ A;  4RH6 A;  4RAU C;  1I4X A;  1XMO Q;  3KLR A;  3K6O A;  3MXN A;  1T9H A;  2KEE A;  2KCT A;  4I65 A;  3OIP A;  4H13 C;  3M4Q A;  1SYE A;  1TWH H;  2K5V A;  1D2B A;  1EU4 A;  1R9T B;  2Y0S E;  4QUC A;  1EY6 A;  3MHB A;  2EQS A;  4RFB A;  4L6T B;  4OWX B;  1UE1 A;  3OTO L;  2O5J C;  2AUJ D;  4P75 A;  1JT8 A;  4DXF A;  4C3J B;  1LTI D;  5K36 H;  1Z9F A;  3KBG A;  1TWF B;  1P16 A;  1XPU A;  4YCV A;  3GTQ B;  2H4O A;  1O7Y A;  4PNY A;  2QEX A;  5DAU A;  4LF4 Q;  1SNC A;  3I4N H;  2UUB Q;  3TP8 A;  4HJ7 A;  4KY7 A;  2VNU D;  4HN7 A;  1VQF A;  1LV9 A;  2YTX A;  3AQQ A;  2EOT A;  5FOB B;  1A3T A;  1HNZ Q;  1SNQ A;  4MIU A;  5IP9 G;  4U67 3;  2V4D A;  2F0S A;  4K5W A;  1JWM D;  4PZ7 A;  3GDE A;  4BA1 I;  1WTR A;  1EIF A;  2NZH A;  3TME A;  1WD1 A;  2VQF Q;  3TEH B;  2UXB Q;  4KMU C;  1HR0 L;  5GRO A;  3TRE A;  3S15 B;  1QWY A;  1BVS A;  3DEP A;  1D5M C;  4S3S A;  1GKH A;  1A63 A;  2Q8I B;  3I7F A;  5COY A;  3UDG A;  1JOQ A;  5EPL A;  1CUK A;  1QVC A;  3HOV H;  2ZJR A;  2NVT H;  3K7A B;  3WDN A;  4DA2 A;  1HA6 A;  1KD1 C;  4C2M H;  1QNU A;  1DYQ A;  4G57 A;  2EJG C;  4UP8 A;  4GKJ L;  2XRQ D;  1XPO A;  3VR4 A;  5IGG A;  1WTH A;  1JWS D;  3NEM A;  4K0K Q;  5JPN C;  4IPH A;  4DR3 L;  2BDO A;  3BS1 A;  5C44 H;  3UDX A;  5C3E H;  2PZW A;  5JVH 3;  3H3V H;  1MIU A;  3ONA B;  1A8V A;  2NYZ D;  4LF5 L;  3U9S A;  1CHP D;  1VQG A;  3V05 A;  2K4K A;  5FLX c;  5FO9 B;  3U4V A;  4DK1 A;  5A2Q L;  1V1P A;  4MNO A;  4P74 A;  3NXW A;  4IPD A;  2HCC A;  5I2X A;  1AE2 A;  3I70 A;  4JW0 A;  1YIT A;  4IUP A;  4KKU A;  2EYH A;  4GNX C;  4CGY B;  1Y1W B;  1PRT D;  3LGJ A;  2L9H A;  4A3D B;  1QVG A;  1ZKO A;  3M9B A;  1OXS C;  4ULL A;  1HFN A;  4Q0F A;  1L0Y B;  1A3V A;  1EYA A;  1W6K A;  3A8J E;  2ZT9 C;  2BCO A;  1EY8 A;  3K7U C;  1NJI C;  2RDG A;  1JMC A;  2NVQ H;  5C0X H;  3GTM B;  3QIA A;  3NHH A;  2K05 A;  1WTV A;  3FHW A;  4KHV A;  3FKI H;  4R9W A;  3RZD H;  5EKK A;  1HTP A;  2EJM A;  3RD4 A;  4C3I G;  3SR1 A;  2B2U A;  2D2C C;  2R92 B;  1EQV A;  2RKS A;  5IYB H;  3IAY A;  3MXG A;  1WYD A;  5HY6 A;  3A5U A;  4A3G G;  3ER0 A;  4JOI A;  4UHV A;  4IUU A;  1QCB D;  1V1O A;  2A8V A;  5K36 G;  4DR5 L;  4C56 C;  1ENA A;  3KF6 B;  3K59 A;  1SE2 A;  3TP7 A;  4GOP B;  1U9R A;  2F0N A;  3P20 A;  1Q3L A;  1CM9 A;  3I4N G;  1JR0 D;  5GAD C;  3GTL B;  1LO5 D;  2PMZ B;  1AP0 A;  1I4Q A;  4X3S A;  2SNS A;  2C9O A;  3JAM i;  3FPP A;  3MAQ A;  4WJ3 M;  1YNN D;  2ZXR A;  2TMP A;  3R2T A;  4ZKB B;  1S5E D;  1WFQ A;  3ITP A;  4LMQ D;  2KBN A;  3H0G H;  3E6Z X;  5IY0 A;  4ZUI A;  3HOY B;  3K5M A;  4K8I A;  2F0F A;  2R7Z B;  2CCZ A;  1DOM A;  3MEF A;  3OOC A;  2F0U A;  1B9M A;  3QOL A;  3BZD B;  1EU3 A;  3HOZ H;  3CCE A;  1H95 A;  1QIL A;  4G7H C;  1E22 A;  2Z6K A;  4PMB A;  2ICI A;  3CME A;  1K8G A;  1HRJ A;  3MZ5 A;  1BQQ T;  4HIK A;  1VMC A;  3E0E A;  2WAQ E;  4DV3 L;  1NTG A;  4X3T A;  3MEH A;  5JJZ A;  2MGS A;  3M7G A;  2A69 C;  3O13 A;  3KDF B;  2Z4H A;  2QIL A;  4GS3 A;  4DNT B;  3TP6 A;  4F7X A;  1K9M C;  1F9S A;  2K5D A;  3S14 B;  3S16 B;  5C44 G;  4LWC A;  1IYJ B;  2X6G A;  4A3I H;  4PG3 A;  5C3E G;  1YVC A;  3Q8D A;  3QWN A;  4IPG A;  5ELD A;  5I9P A;  4BS9 A;  5FLX L;  4KV6 A;  1SEB D;  4TSS A;  1PRT F;  3G4S A;  4DV0 Q;  2B2W A;  1XXG A;  2I5L X;  1TY0 A;  3C46 A;  4CJ0 B;  1IBK L;  4E6I A;  2RSN A;  4A4I A;  3J81 c;  1UNS A;  3EJI A;  2XIW A;  1RL2 A;  3CCR A;  4XT3 B;  4OEL B;  1QZG A;  5HUR A;  1ONL A;  1ILP A;  3D31 A;  5IE8 A;  3MWY W;  2NVX H;  3D8G A;  3QOJ A;  1DOK A;  4ZKC B;  3J7Z C;  1TS5 A;  1Q8K A;  4LJZ C;  1F2M A;  4AYB G;  1I6H B;  2WIN B;  1FJG Q;  1Q81 C;  4DK6 C;  2YYZ A;  3K5N A;  4X66 Q;  1L2F A;  2JSO A;  3FKI G;  3U50 C;  5IP7 H;  2UUC Q;  2OWO A;  4JI8 Q;  2HIX A;  4LFA Q;  4OIJ A;  3BYT B;  1MSH A;  2XTI A;  4DV1 L;  1NY4 A;  5J22 A;  5IYB G;  3R2I A;  4X3K A;  4A3K H;  2XWB B;  3KLS X;  1QVF A;  1AH9 A;  1SMX A;  3X3N A;  1G2T A;  3BG3 A;  4JK1 C;  3T13 A;  4R8I A;  3RZO B;  2BOS A;  3PUZ A;  4R4C A;  3AMU A;  2DUD A;  4HJ8 A;  1N32 L;  4LW1 A;  4B3M L;  4JI0 L;  4DR2 L;  2VUM B;  1CQF A;  1B3Q A;  1D1K A;  2KED A;  1LTB D;  2XGT A;  2ZM6 L;  3K0X A;  2WB1 G;  1VQP A;  2HCI A;  1G29 1;  2H5X A;  1MHW C;  1CKM A;  3GTK H;  2BE5 D;  4K2L A;  3VA7 A;  5AFW A;  4L5Q A;  3H0G G;  3H91 A;  1KDA A;  4UAI A;  1XNR Q;  4PMC A;  4HID A;  1YEZ A;  4PZ8 A;  2B3G A;  2JEB I;  1JE4 A;  4JVZ A;  1VQD A;  5KYI A;  2F03 A;  4CHT B;  1OXT A;  3FMC A;  2EE1 A;  1TWC B;  1DCZ A;  1SJH D;  5IGF A;  1BF4 A;  4KHP Q;  4OWT B;  1I4G A;  5BN3 A;  3D4R A;  1HZB A;  5KEE A;  3J80 c;  4FXD A;  5I6Y A;  2Q8T A;  2EYL A;  1PH3 A;  3CCM A;  2K5Q A;  3DMU A;  1WCM H;  4EX5 A;  2HDM A;  2UXC Q;  5D3D A;  3SGI A;  1U4P A;  1STA A;  4YIJ A;  2R6G A;  3S1N B;  4V19 0;  4L5T A;  4A3I G;  4RG1 A;  2EJF C;  4JI7 Q;  2OF1 A;  1R4Q B;  1BR9 A;  2E2D C;  2K33 A;  3DWP A;  1YZ6 A;  2F52 A;  1VQB A;  1GUW A;  1NE3 A;  3HZX A;  4NXM Q;  4YY3 L;  2E75 C;  4ABN A;  4PQX A;  4GOP C;  2DJF C;  4OEM B;  2KHJ A;  4B3S L;  4UY8 C;  5FLX E;  4JV5 Q;  1KTK A;  1WTX A;  4JCV E;  2I07 B;  5JJK A;  2O4X A;  3EIV A;  5I4D A;  1PMR A;  1OO9 B;  4X64 L;  1X3F A;  3LWU A;  3HOW G;  3OYY A;  1VQN A;  4JYA Q;  1YJW A;  3GTP H;  4XIG S;  1XMQ L;  1EYC A;  1W6J A;  5EGT A;  2PNR C;  2DJG C;  4DR7 Q;  1XJV A;  2QGQ A;  3QO2 A;  2KUM A;  2WKC A;  4OX9 L;  1S3O A;  5EQ0 A;  2IT1 A;  1GUN A;  1KQS A;  3NTH A;  3R93 A;  2EIF A;  5M3F H;  1ZYR C;  5F2D A;  4JI2 Q;  3MVV A;  2FMM A;  2RCN A;  1S4Z A;  3G6J B;  4BBR H;  3S1M B;  1H9R A;  4KK7 A;  1SND A;  2C35 B;  4IJH A;  4YHH L;  1YNX A;  1KRT A;  4A3K G;  5C3W A;  3A8K E;  1DON A;  1TWA B;  1ENC A;  4NW2 A;  2QDB A;  1C8C A;  5E4W C;  1K3R A;  4K14 A;  2E2I B;  2F0L A;  5C4Z A;  1Y8P B;  3A5Z B;  1JB7 A;  1LTG D;  4RKL A;  1PV4 A;  1F2Z A;  2VL6 A;  3PUY A;  2BH8 A;  4RCN A;  4CDD C;  4JI5 Q;  5IYD G;  1RJT A;  4Y52 H;  1H9S A;  4DNR B;  3PUW A;  5LMU Q;  1FD7 D;  1LLR D;  1YJ9 A;  1RTO A;  3FP9 A;  3CD6 A;  4GLA C;  1LM0 A;  2RBM A;  4C3I B;  2A6H C;  4WJ4 A;  2Z6B A;  1HQR D;  1DD2 A;  2KA7 A;  3VR6 A;  5CV7 A; 
#chains in the Genus database with same CATH homology
 2EPB A;  3CRK C;  2KCC A;  4KN4 C;  3I90 A;  3Q24 A;  2SOB A;  1JWU D;  3M4Y A;  5D14 A;  1JOR A;  5DM6 3;  2G9D A;  3DEO A;  3T4A C;  4ID6 A;  4K5X A;  3I4N B;  3A55 A;  3EFX D;  1SYB A;  4LK1 C;  1TS4 A;  5C6A A;  2O2L D;  4ILW A;  2VXW A;  1SMY D;  1SE3 A;  3NPP A;  1HQM C;  1HFG A;  3IKJ A;  1AW7 A;  1LAC A;  3GD7 A;  1RCV D;  4EQO A;  1JB3 A;  3VYR A;  1EIH A;  5CYU A;  2KQ3 A;  2DNE A;  1O7L A;  2NVT B;  2EYO A;  1I4H A;  3A7L A;  4IAL A;  4C2M B;  3OW7 A;  1U4L A;  4QB4 A;  5IGE A;  3J81 E;  3EA6 A;  1EZ8 A;  3W3A A;  4IUR A;  5C44 B;  2GA4 B;  5C3E B;  1EY5 A;  5EKI A;  4EGV A;  2FJ2 A;  3A54 A;  4H7B A;  1VF7 A;  4M8A A;  4H44 C;  4R8N A;  1HA5 A;  1MI2 A;  1ESR A;  3RLF A;  1PZK D;  4IUV A;  1B2T A;  2Z1C A;  2NN6 I;  4HR7 B;  3HGB A;  3VA5 A;  2K32 A;  4DAP A;  1TT2 A;  4FF4 A;  2XWJ B;  4OL7 A;  3GO5 A;  5JAV A;  3R3O A;  2NVQ B;  4AYB B;  2EZV A;  2ZXO A;  4TRD A;  3RZD B;  3FKI B;  1AN8 A;  1RTN A;  4XYQ A;  3AU7 A;  1NSN S;  2F0T A;  3FRP B;  1QOH A;  1T5X D;  1A15 A;  4DAV A;  2L4N A;  2A5H A;  3GV3 A;  1X3Q A;  3IFD A;  3I3C A;  3NP8 A;  1TS2 A;  4N9P A;  3IFT A;  2ENB A;  2M2L A;  2K28 A;  2K7V A;  5KRU A;  3UI2 A;  2WB1 B;  1B1Z A;  2WKD A;  4CBV A;  5IT9 L;  2CW0 C;  2KJX A;  3H0G B;  2G9H D;  5K5P A;  3NBH A;  1SSO A;  4KY5 A;  1PZI D;  2JXM B;  4QIW B;  1CA6 A;  1EY7 A;  1EEF D;  2H1E A;  5HGT A;  3KUP A;  2K01 A;  3FDT A;  5CV4 A;  2F0G A;  4QF4 A;  1EZ6 A;  1O78 A;  2QEJ C;  2OXP A;  1R4P B;  1PYW D;  2WP8 J;  4FF1 A;  1KNA A;  2AQ3 B;  4A3I B;  5DM7 3;  1PTO H;  2KCN A;  3BDO A;  4IFD J;  2DY7 A;  3EQL C;  1M8A A;  4FP5 D;  1BNZ A;  1T5E A;  3DXJ C;  1JIC A;  1MSG A;  1UUP A;  5CR3 A;  2A69 D;  2DY8 A;  1RDP D;  5CBE E;  3LNN A;  2NVX B;  3HOW B;  2F4I A;  2EYJ A;  5EKL A;  5T1G A;  3G7L A;  1I50 B;  2KVM A;  2EY5 A;  1EYD A;  2NN6 H;  1LT3 D;  2QKI C;  5C5L A;  2PPB C;  1BDO A;  1PFN A;  3VR5 A;  3TN2 A;  5KNB A;  1NAP A;  1EY0 A;  2F1M A;  3KK7 A;  4A3K B;  1BUV T;  1D6E C;  4EQP A;  1PTO C;  1JCK B;  4CJ1 B;  3P1H A;  1CQV A;  3SVM A;  4HTH A;  1DJR D;  4OO1 I;  1Q8I A;  3H3V C;  1KAA A;  2M00 A;  3GTK B;  3HS0 C;  5IOC A;  5E4X A;  4DK0 A;  1LTS D;  3P7J A;  1D5X C;  3OIQ A;  3KF8 A;  1TU2 B;  4NMZ A;  2B2W C;  2L11 A;  3DWA A;  2B2T C;  4Q5V A;  1XWE A;  5IT9 E;  4FNF A;  4DAY A;  1CFM A;  1F9R A;  1DZ1 A;  3D3R A;  4A3F B;  1UEA B;  2HUG A;  4FO2 A;  2AWN A;  3J7A V;  3HRZ C;  3OPO A;  1WCM B;  1K8O A;  1IW7 C;  5NUC A;  4L63 B;  2KHS A;  2FFK B;  1STY A;  1VMP A;  2LKV A;  3I73 A;  2X69 A;  3U9O A;  3LX0 A;  4PV1 C;  2YU9 B;  3RUZ A;  1EY9 A;  2CQA A;  1C4Q A;  2TSS A;  1SNM A;  3Q23 A;  2XRS D;  2I46 A;  3QJY A;  1BBX C;  1CZW A;  2JA6 B;  4WJW A;  4CKE A;  4F88 A;  1Q1B A;  1VCI A;  3VR2 A;  1F2L A;  3GTP B;  2Y0S B;  5TSS A;  1TS3 A;  4U68 A;  1KNE A;  4RGN A;  4KY6 A;  2EYF A;  5C3X A;  2NN6 G;  1VDZ A;  4K6L A;  3L9A X;  3EVQ A;  2F3W A;  2JE6 I;  1D5Z C;  2K5W A;  4ODG A;  5C0X G;  2L12 A;  4BBR B;  4EVO A;  2PZT A;  1FNU A;  3HP3 A;  4FF3 A;  3GP7 A;  3MC0 B;  4F87 A;  2MUY A;  2F0W A;  3ERO A;  3I4L A;  1Z6H A;  5ELC A;  2B2Y A;  3NTI A;  3H09 A;  1BO0 A;  1ESF A;  5CV6 A;  1J8I A;  1ZYR D;  3N6R A;  2AWO A;  1KDB A;  4OO1 H;  2B63 B;  2J4X A;  1E2V A;  1G2S A;  5D3I B;  2E76 C;  3BVZ A;  1CHQ D;  2NB0 A;  4A3M B;  2SDF A;  3S1Q B;  3D6W A;  3M7N A;  1S5B D;  1GUT A;  1DOL A;  1A2T A;  1STN A;  1I3Q B;  4ZUJ A;  4QUF A;  1BCP B;  1EEI D;  3I72 A;  5C4H A;  1Y8N B;  5I2Y A;  1S5C D;  1F77 A;  5COR A;  3SK4 A;  1JOK A;  4A3B B;  3PMF A;  4IUT A;  2A6H D;  2K6A A;  2ID0 A;  2JA8 B;  4BA2 I;  1S5D D;  1K83 B;  1SXT A;  1L0X B;  4P2C B;  2EY1 A;  2QF7 A;  4BBS B;  5FK9 C;  1GHK A;  1S5F D;  2LY7 A;  1XX8 A;  1U4R A;  1B44 D;  2FIN B;  2PZU A;  1F2Y A;  2WV6 D;  3J81 L;  3HOX B;  2JEA I;  3FVQ A;  2A6E C;  1PXU A;  3ND9 A;  4GZY C;  5T1I A;  1QJO A;  2B2V C;  2RSO A;  3M3Y B;  2EDG A;  4BY1 B;  1WD0 A;  1Z7T A;  5KNC A;  4B9W A;  3VR3 A;  2RA4 A;  4J6H A;  1ML0 D;  3PUX A;  4RGM A;  1UAP A;  2A73 B;  2WAC A;  2J0T D;  4CJ2 C;  3PUV A;  5DNF A;  5EBC A;  1V1P B;  3LWE A;  3AB9 A;  2D9U A;  2PYK A;  2SEB D;  3URY A;  1SE4 A;  1IHZ A;  3NK9 A;  5JEA J;  1LT4 D;  1HUN A;  2DN8 A;  2B8F A;  5A35 A;  4BWG B;  2XNA C;  4FYD A;  2XN9 C;  2BA1 A;  2WAQ B;  1FNV A;  1KAB A;  1PZJ D;  2N55 A;  4OO1 G;  3BDL A;  4G7O C;  3A7A B;  3R8B A;  4A3E B;  1H9K A;  1TWH B;  1YNJ C;  2NTT A;  5FKA C;  2FMC A;  4HCE A;  1K8M A;  3J80 L;  1HHV A;  1SFO B;  1HXY D;  3S17 B;  2F0Q A;  1QNK A;  2K04 A;  2ICE C;  1EQT A;  1QB5 D;  3FPU B;  4FXK C;  4WRD A;  5CGK A;  4TQU S;  3DUZ A;  3PIO 3;  2Z8L A;  3BYY B;  2O5I C;  4MN3 A;  4CKC A;  1BOS A;  4ZK9 B;  1LTA D;  3T53 B;  1HCZ A;  1ICW A;  5J39 A;  2F0J A;  1FYC A;  4K8J A;  3HOV B;  3MA2 B;  2CW0 D;  4B08 A;  1PTO B;  2M9V A;  4RCO A;  3BVM A;  2VB2 X;  4M1U B;  3A8I E;  3ZYY X;  2L0C A;  5KND A;  3SHL A;  5CMD A;  4HMJ A;  2A74 C;  3A56 A;  1V8Q A;  4DN4 M;  3W2D A;  2NVY B;  2LS0 1;  1GUS A;  4XTC S;  1CTM A;  3L7Z C;  4L8J A;  4QCL A;  2RVL A;  5I6W A;  1EWC A;  2NUC A;  1BCP C;  1B4O A;  1E2W A;  4XQN A;  4O42 A;  2EYP A;  1GUG A;  4IFD I;  2L1B A;  1Q12 A;  1IKL A;  1NCV A;  3NBI A;  3HOU B;  1PFM A;  2D5D A;  5ELE A;  1HUM A;  3TZD A;  1WTW A;  3HG9 A;  3CU7 A;  2F0I A;  2WII B;  3CKI B;  3NTK A;  4FXG C;  5LHY 1;  4ME5 A;  5KIX A;  1SYG A;  5LL6 S;  1AZP A;  1G8Z D;  2E2J B;  5IOD A;  1EWH A;  1TKW B;  5FO8 B;  1SYD A;  1H9J A;  1EOT A;  3SK8 A;  4UDU C;  5FO7 B;  1WTQ A;  1SMY C;  2N88 A;  3J80 E;  3T16 A;  1IKM A;  5CBA E;  1PRT B;  3S1R B;  1I4R A;  3I91 A;  2D62 A;  3TZU A;  1PTO D;  4C1N I;  2PO4 A;  4X3U A;  3HOZ B;  4H0L C;  4KN7 C;  1MBY A;  1PFB A;  3PO3 B;  3TP5 A;  3NQI A;  5C4J B;  5JVG 3;  3C3L A;  4A3J B;  4I7Z C;  3H94 A;  1SBB B;  1FR3 A;  4OIK A;  2IW3 A;  4V0B A;  3H6M A;  1I4P A;  3S2D B;  1ILQ A;  3K58 A;  4BY7 B;  2RDF A;  1NR4 A;  1A2U A;  1LT6 D;  4IN3 A;  4IZ8 A;  3T51 B;  2B2U C;  4NKL A;  3NWS A;  4N9T A;  1RHP A;  2QCP X;  4IQZ A;  1LAB A;  2A68 C;  1WTP A;  3K5L A;  1TQO A;  1GOZ A;  5E3F A;  1JC7 A;  1IW7 D;  4G4K A;  3SXH A;  4XT1 B;  2PW7 A;  3NE5 B;  5KGU A;  5C0X J;  2SNM A;  3IL8 A;  1TR5 A;  1OXU A;  1FNW A;  1JOO A;  4XQJ A;  1DM0 B;  2F0M A;  4EQN A;  3KBX A;  2JP1 A;  1GXD C;  5EBD A;  1RKN A;  4KJN A;  4IFD H;  1Q1E A;  1OXV A;  3VYT A;  4NDX A;  4WFN 3;  5CV8 A;  4RGT A;  3NWT A;  5I9O A;  3SEB A;  2Q8R E;  4JBW A;  4C3H G;  2EY2 A;  1G6Z A;  4QMG A;  5CV5 A;  1CZG A;  5M5Y B;  1PTO F;  5CV9 A;  3V96 A;  4DF7 A;  4ZRZ A;  1H9S B;  1CK1 A;  2DNC A;  1TII D;  2F0D A;  1FGB D;  1ET9 A;  3GTJ B;  2IX0 A;  1SYC A;  3Q0A A;  3DHQ A;  3MFY A;  4FVM A;  4DXG A;  2CHB D;  5C5M A;  3WOE A;  4LAA A;  2LMC B;  2F0K A;  2XSC A;  2Z4I A;  5BN5 A;  1RD9 D;  1ET6 A;  2F0E A;  1Y69 U;  5LL6 X;  5CC4 A;  4XQQ A;  1PLF A;  1ZEQ X;  1IYU A;  2IX1 A;  4XYO A;  3TBI B;  2XVS A;  1B3A A;  2IJ0 A;  5BN4 A;  3J7A F;  2K03 A;  4ZLT F;  2EY6 A;  2C5C A;  2JA7 B;  4C1N K;  3HKZ B;  1WTO A;  3OHX C;  2IX3 A;  3OSO A;  3TDQ A;  3J7Y W;  4RWS C;  2B2Y C;  2MJ8 A;  1SDF A;  3TSS A;  1HPC A;  3QG1 A;  1A3U A;  4XXE A;  2B39 A;  1STH A;  2F0H A;  1PRT C;  3S9W A;  4B9X A;  4A93 B;  1EY4 A;  3F2U A;  4KKT A;  1XYI A;  3MXP A;  4G7Z C;  1TVX A;  1HTL D;  4KD3 A;  3E0J A;  5M3F B;  4IFD G;  2R93 B;  2B2T A;  3GTG B;  4HAE A;  1ENF A;  1STB A;  1F9P A;  4RKB A;  3I8Z A;  2A6E D;  3HEJ A;  2MP1 A;  5A2Q E;  2IL8 A;  4RHR A;  2JYO A;  2F3V A;  1IYV A;  1Y8O B;  3PO2 B;  2F0O A;  1Y1V B;  4HCS A;  1MGS A;  4KJO A;  4RHS A;  4RGO S;  1YNN C;  5EPJ A;  3CRL C;  5KYL A;  2OT2 A;  1I6V C;  5IGD A;  1X32 A;  2LFN A;  3KLS A;  1PDQ A;  3GTO B;  4HSP A;  1EL0 A;  1TWG B;  2OEO A;  2E74 C;  2HQE A;  1X3P A;  4NP5 A;  1SNO A;  1GHJ A;  4MHE A;  4C3J G;  5J1Z A;  2PQE A;  3JAM L;  1ZXT A;  3SE0 A;  3ERQ A;  5JPM C;  2CVR A;  1V43 A;  4HMI A;  5M5X B;  4Y7N B;  2NZ1 D;  1A6X A;  1H9M A;  3SK6 A;  1YNJ D;  3D4D A;  3WOF A;  1U4M A;  1SYF A;  4DU9 A;  1ROD A;  1LTT D;  1OXX K;  1B9N A;  2MPM A;  5EJW A;  3N52 A;  3I4M B;  1O80 A;  4KTA A;  3MFG A;  2EXZ A;  5C4X B;  3M4O B;  5M9O A;  1KLG D;  3GV6 A;  3X3M A;  4DFA A;  2JA5 B;  3OWE B;  3L3O C;  1BXT A;  5DEH A;  4K2K A;  3OMG A;  5M3M B;  4KKS A;  4OGQ C;  1O7Z A;  3NQT A;  3DWQ A;  3C2P A;  1M4V A;  2X6L A;  4Z9C B;  2HDL A;  3CQZ B;  5EPK A;  1QG7 A;  1SNP A;  4TKO B;  1STE A;  2BA0 A;  4ZAI A;  5D65 A;  1LTR D;  4KI0 A;  3QB3 A;  2AQ2 B;  1II3 A;  4K6D A;  2BE5 C;  3Q22 A;  5G3L D;  5IIF A;  4F8M A;  3NSW A;  1BCP D;  2ZXP A;  3OWF A;  4HED A;  1SAP A;  1VF5 C;  1J9O A;  3NUC A;  1NR2 A;  1TY2 A;  3K5O A;  4C3H B;  3C1F A;  1KLU D;  1JQY D;  1RF2 D;  1E0B A;  1GJX A;  3BVG A;  1EIG A;  5JOB A;  3DM1 A;  2KEC A;  5JEA H;  3PV0 A;  5E1F A;  2B2V A;  1MD2 D;  5IGB A;  2FHT A;  2F0V A;  1CA5 A;  2EVB A;  2RDH A;  2IWH A;  2AQ1 B;  3JAM E;  2AUK A;  2NWG A;  1CT1 D;  4A3G B;  1Q90 A;  4J8Q A;  4K5V A;  2KOL A;  4OHJ A;  3Q6S A;  5M5W B;  1NUC A;  1LT5 D;  5IGC A;  4DGZ A;  1STG A;  2R3Z A;  3K57 A;  2B8G A;  2L5T A;  2L55 A;  1GUO A;  3S2H B;  3E5S A;  2PCF B;  1IL8 A;  4WOR A;  2E2H B;  3CHB D;  3MTS A;  1EFI D;  3T56 B;  1AEX A;  4CKB A;  2F0P A;  3C1E A;  3VYU A;  4RA8 A;  2MHV A;  1DXM A;  4FF2 A;  3OMC A;  3RMH A;  5ELB A;  1C48 A;  4J1M A;  2J7Z A;  2EYM A;  1G91 A;  4ZQ3 A;  2K1B A;  3D6C A;  1AFP A;  1XTC D;  1SJE D;  4KD4 A;  2BDN A;  3MXU A;  3BDC A;  1D1I A;  1QE6 A;  3PIP 3;  3V2T A;  4XDX A;  5G3L F;  1B53 A;  1WVL A;  3K0Y A;  4ZYS A;  2IPK D;  4IUN A;  1BCP F;  5ELF A;  2NBF A;  1AZQ A;  2VB3 X;  3P75 A;  3D4W A;  2A68 D;  4IUQ A;  2R61 A;  1F9Q A;  5C0X I;  3ND8 A;  5ISR A;  4O1N A;  4HSV A;  3M85 A;  3SDZ A;  1KDC A;  1Z47 A;  3FEW X;  3GQB A;  2PW5 A;  3SK5 A;  3VYS A;  1CI3 M;  2RQX A;  4PMW A;  1E2Z A;  5JEA G;  2NTS A;  1B50 A;  4KHZ A;  4RH6 A;  4RAU C;  1I4X A;  3KLR A;  3K6O A;  3MXN A;  2KEE A;  4I65 A;  3OIP A;  4H13 C;  1SYE A;  1D2B A;  1EU4 A;  1R9T B;  4QUC A;  1EY6 A;  3MHB A;  4RFB A;  4L6T B;  2O5J C;  2AUJ D;  4DXF A;  4C3J B;  1LTI D;  5K36 H;  3KBG A;  1TWF B;  3GTQ B;  2H4O A;  1O7Y A;  4PNY A;  5DAU A;  1SNC A;  3TP8 A;  4KY7 A;  2VNU D;  4HN7 A;  1LV9 A;  2EOT A;  5FOB B;  1A3T A;  1SNQ A;  4MIU A;  4U67 3;  2V4D A;  2F0S A;  4K5W A;  1JWM D;  4BA1 I;  1WTR A;  3TME A;  1WD1 A;  4KMU C;  3S15 B;  1QWY A;  3DEP A;  1D5M C;  4S3S A;  2Q8I B;  5COY A;  1JOQ A;  5EPL A;  3K7A B;  3WDN A;  4DA2 A;  1HA6 A;  1QNU A;  1DYQ A;  4G57 A;  2EJG C;  2XRQ D;  3VR4 A;  5IGG A;  1JWS D;  5JPN C;  2BDO A;  3BS1 A;  2PZW A;  5JVH 3;  3ONA B;  2NYZ D;  3U9S A;  1CHP D;  3V05 A;  5FO9 B;  4DK1 A;  5A2Q L;  1V1P A;  3NXW A;  2HCC A;  5I2X A;  3I70 A;  4IUP A;  4KKU A;  2EYH A;  4CGY B;  1Y1W B;  1PRT D;  2L9H A;  4A3D B;  1ZKO A;  1OXS C;  4ULL A;  1HFN A;  4Q0F A;  1L0Y B;  1A3V A;  1EYA A;  1W6K A;  3A8J E;  2ZT9 C;  2BCO A;  1EY8 A;  2RDG A;  5C0X H;  3GTM B;  3QIA A;  3NHH A;  2K05 A;  1WTV A;  4KHV A;  4R9W A;  5EKK A;  1HTP A;  2EJM A;  3RD4 A;  4C3I G;  3SR1 A;  2B2U A;  2D2C C;  2R92 B;  1EQV A;  2RKS A;  3IAY A;  3MXG A;  4IUU A;  1QCB D;  1V1O A;  5K36 G;  4C56 C;  1ENA A;  3K59 A;  1SE2 A;  3TP7 A;  1U9R A;  2F0N A;  3P20 A;  1Q3L A;  1CM9 A;  1JR0 D;  3GTL B;  1LO5 D;  2PMZ B;  1AP0 A;  1I4Q A;  4X3S A;  2SNS A;  2C9O A;  3FPP A;  3MAQ A;  1YNN D;  2ZXR A;  2TMP A;  3R2T A;  4ZKB B;  1S5E D;  3ITP A;  4LMQ D;  3E6Z X;  4ZUI A;  3HOY B;  3K5M A;  4K8I A;  2F0F A;  2R7Z B;  1DOM A;  3OOC A;  2F0U A;  1B9M A;  3QOL A;  3BZD B;  1EU3 A;  1QIL A;  4G7H C;  4PMB A;  2ICI A;  1HRJ A;  3MZ5 A;  1BQQ T;  1VMC A;  4X3T A;  3MEH A;  5JJZ A;  2MGS A;  3M7G A;  2A69 C;  3O13 A;  2Z4H A;  2QIL A;  4DNT B;  3TP6 A;  4F7X A;  1F9S A;  2K5D A;  3S14 B;  3S16 B;  2X6G A;  3QWN A;  5ELD A;  5I9P A;  4BS9 A;  5FLX L;  4KV6 A;  1SEB D;  4TSS A;  1PRT F;  2B2W A;  1XXG A;  1TY0 A;  3C46 A;  4CJ0 B;  4E6I A;  2RSN A;  1UNS A;  3EJI A;  2XIW A;  4XT3 B;  5HUR A;  1ONL A;  1ILP A;  3D31 A;  3MWY W;  3D8G A;  3QOJ A;  1DOK A;  4ZKC B;  1TS5 A;  4LJZ C;  1F2M A;  1I6H B;  2WIN B;  2YYZ A;  3K5N A;  2JSO A;  4OIJ A;  3BYT B;  1MSH A;  5J22 A;  3R2I A;  4X3K A;  2XWB B;  3KLS X;  3X3N A;  1G2T A;  3BG3 A;  4JK1 C;  3T13 A;  4R8I A;  3RZO B;  2BOS A;  3PUZ A;  3AMU A;  2VUM B;  1CQF A;  1D1K A;  2KED A;  1LTB D;  2HCI A;  1G29 1;  2BE5 D;  4K2L A;  3VA7 A;  5AFW A;  3H91 A;  1KDA A;  4UAI A;  4PMC A;  2JEB I;  1JE4 A;  2F03 A;  5KYI A;  4CHT B;  1OXT A;  3FMC A;  2EE1 A;  1TWC B;  1DCZ A;  1SJH D;  5IGF A;  1BF4 A;  1I4G A;  5BN3 A;  3D4R A;  5KEE A;  4FXD A;  5I6Y A;  2Q8T A;  2EYL A;  2K5Q A;  3DMU A;  2HDM A;  5D3D A;  1U4P A;  1STA A;  4YIJ A;  2R6G A;  3S1N B;  4V19 0;  2EJF C;  2OF1 A;  1R4Q B;  1BR9 A;  2E2D C;  2K33 A;  3DWP A;  1GUW A;  3HZX A;  2E75 C;  4ABN A;  4PQX A;  5FLX E;  1KTK A;  1WTX A;  2I07 B;  2O4X A;  5I4D A;  1PMR A;  1OO9 B;  3LWU A;  4XIG S;  1EYC A;  1W6J A;  5EGT A;  2PNR C;  3QO2 A;  2KUM A;  2WKC A;  5EQ0 A;  2IT1 A;  1GUN A;  3NTH A;  3R93 A;  1ZYR C;  5F2D A;  3MVV A;  2FMM A;  1S4Z A;  3G6J B;  3S1M B;  1H9R A;  4KK7 A;  1SND A;  5C3W A;  3A8K E;  1DON A;  1TWA B;  1ENC A;  4NW2 A;  2QDB A;  1C8C A;  5E4W C;  4K14 A;  2E2I B;  2F0L A;  5C4Z A;  1Y8P B;  1LTG D;  4RKL A;  1F2Z A;  3PUY A;  4RCN A;  1RJT A;  1H9S A;  4DNR B;  3PUW A;  1FD7 D;  1LLR D;  1RTO A;  2RBM A;  4C3I B;  2A6H C;  1HQR D;  1DD2 A;  2KA7 A;  3VR6 A;  5CV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...