4KLKA

Phage-related protein duf2815 from enterococcus faecalis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
174
structure length
166
Chain Sequence
TKVITNQVRLSFVHVLEPHAMEEGQEKKYSCMLIIPKDDKETLKAMKEAIKTAYEGAKFERLKTTLRDGDEEMDTEERPEFENAMFINVSSKTKPQVVKREDGVLVKTDDPDEVYSGVYAIASINFYAYSTAGNKGVTAGLNNILTLCKGDFLGGRANAESDFGDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Phage-related protein DUF2815
publication title Phage-related protein DUF2815 from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
total genus 32
structure length 166
sequence length 174
ec nomenclature
pdb deposition date 2013-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4klkA00
1W3SA 1M90C 1I3QH 2I0QA 3J7A5 3K7AH 4LFAL 4O2DA 4B3RQ 1PYBA 4IPDA 4NXNL 1Y14B 5BR8L 5IE8A 1SMXA 2I5HA 2DGYA 4R4TA 3CPFA 3GD7A 5GAHC 1IBLQ 4DR1Q 3RLOA 3HOVH 4QIWE 2NZHA 3RZOH 2GVBA 2F4VQ 2Z0SA 1XMOQ 4QGUA 4BA2I 3S15H 4GKKQ 3WWVA 4A3JG 2LXKA 3NBHB 4JC0A 2OQ0A 1EUJA 3CCRA 1PA6A 2VW9A 1YBYA 1TWFH 2JA6H 2ID0A 4OWXB 3ULLA 2UUAQ 4DR2L 2UU9Q 1TWCH 5GAGC 4DV0Q 3D31A 2FXQA 1G291 2UUCL 2R93G 2AWNA 1J5EL 2KHIA 3S2DH 1PH2A 4IJHA 2B63H 4HJ9A 4JV5L 4YWLA 3UDXA 5IP9G 1EQQA 1YJNA 2WB1E 4O0AA 5M5WH 3HOXG 3UDIA 5LMNQ 3I4MH 1OTCA 5FJ8G 1D8LA 1HH2P 5M3FG 4X64Q 3CXCA 2K50A 4B3ML 3M85A 4X65Q 5FLXc 1HNXQ 1BVSA 2CFMA 1XTDA 2IHFA 3PGZA 5JEAG 3PIOA 1XMQQ 4DPGA 2KCMA 4IO9A 4JYAL 4PMWA 2UUBL 5K36G 5JJKA 5IYCH 2ASBA 2KCTA 1FGUA 4XTCS 1X56A 4K0KL 5IP7H 3DLLA 5AJ3L 4HJAA 5JJIA 3CW2C 2UXDQ 2JA5H 1VQ7A 2ZTEA 3J81c 4QJFA 4HJ7A 2B29A 4DK3C 4DV5L 1L1OC 2N49A 4QL5A 1XPRA 3M7NA 1A63A 1NMGA 1HR0Q 1SN8A 3GTOH 2PMZE 1IYJB 4Y7NH 4EX5A 2YYZA 3F8TA 2A8VA 4YY3Q 4LFCQ 4ALPA 1W2BA 2VQFL 2MFIA 2QA4A 3PF5A 1V1QA 1J6QA 3JAMi 2ZM6Q 2H5XA 2UXBL 2E8GA 1YJWA 1N32Q 1E24A 3A5UA 1O7IA 4DV2Q 1N34Q 1NY4A 1UWVA 3KOJA 3T1HL 2C35B 4C2MH 2YTXA 4UPAA 4GLAC 1PH8A 1FL0A 1X54A 3K0XA 3KF6A 2XGTA 1N9WA 3RNUA 4A3MH 3RLNA 1IBMQ 4EQ5A 1CSQA 1A62A 3OTOL 4A75A 4GN4B 4OXPA 4LUZA 3RLFA 1L0WA 4UY8C 1N8RC 3J81j 1VQJA 2JA8G 1SRUA 4RMFA 3ULPA 1PH7A 2K75A 2JA7G 3DM3A 3ERSX 1B8AA 3OYYA 5M3MH 2Q2TA 4QQBX 4DUZQ 2CWAA 3I4OA 1A8VA 5C3EH 1E1TA 4JBWA 3MEFA 4ME3A 4NB3A 4X66L 2VQEL 2VZAA 1GO3E 4LF6L 1X3FA 1VQHA 4JBKA 3GTPH 3HOWH 1HZBA 2K52A 5C0XJ 4DR4L 3M9BA 1KC8C 4JBJA 1SE8A 4GNXA 4DUYL 1S3OA 1KQSA 4DR6L 4JI5L 3EBEA 4QY7A 3U4VA 2LSSA 2JEBI 3UDFA 4BBRG 2QGQA 3H15A 1N33L 3CD6A 4OX9L 4AQYL 3TRZA 3BZCA 5IWAL 1E7ZA 1IL2A 1C0AA 2IT1A 3K7UC 1BKBA 5LMUQ 1IBKQ 1AH9A 1U5KA 2BA0A 3PO2G 1YHBA 1UEBA 1I94Q 1GKHA 3GTMH 4P73A 4MNOA 1SFOH 5J3BA 4A4IA 5M5YH 4DV3L 3KF6B 4DNIA 4DV6L 3S1MH 3K80C 1MKHA 1N36L 4LF8Q 3S16H 1FJGL 4GKJQ 2F52A 1E1OA 5ELOA 4B3TQ 2VUMH 5IY0A 4JCVE 2JA9A 2Z6KC 2UXCQ 5IYDH 3HOZG 4A3EG 1OXXK 1YZ6A 1KHIA 4LF4L 1Z47A 4P75A 4IPHA 2ZTDA 2MO1A 1S40A 4JI2L 4A93G 2K5NA 4FDBA 4YHHQ 3T1YQ 4A3KG 4LF7Q 1X3GA 1VQGA 1PFSA 1IZ6A 1VQNA 3TS2A 1MJEA 2RCNA 1X6OA 5GADC 4GNXB 4HIOA 1XNRQ 3GO5A 3H3VH 2F3IA 1Q12A 4BY1G 2D0PA 1S72A 1VQCA 4A3IG 1OXSC 2PI2A 2E2IH 3BU2A 4TQUS 4GS3A 3K8AA 5HGQA 2Q2IA 3PV0A 4DK6C 4LFAQ 3GTJH 3TREA 4NXNQ 3HFZB 3KJOA 1YJ9A 1VQ5A 1NTGA 2JJQA 1VQ8A 1BBUA 2OTLA 1Y1WG 3W1GA 3AQQA 2MO0A 1ASZA 3PUYA 3KDFB 4OONA 3STBC 4A3BG 4WJ4A 1WFQA 2DUDA 2NVYH 4L5RC 2YTYA 1K73C 1JMCA 1YIJA 2RHSB 1K8AC 2PQAA 4DR2Q 3F1ZA 1VS0A 4P71A 3GDEA 2NVTH 5FLMG 3M4QA 4A3CG 1YVCA 4C3IH 4BBSH 2UUCQ 4A3JH 2VNUD 1J5EQ 1CKNA 4JV5Q 2D0OA 3KF8B 3S24A 1Q1BA 4R4IA 3ZJYC 4X62L 3UE0A 3IRBA 1JJ2A 1WCMH 1KXLA 3NEMA 3VDYA 2E5LL 2EXDA 4UP8A 4A76A 2R93H 4JI8Q 4DV1L 1XNQL 2IX1A 1VQOA 3F2DA 2HIXA 3E0EA 4B3MQ 4HJ8A 4JI1L 1B70B 2Y0SE 1TWAH 2NVXH 4KHPL 3TEHB 3HOYH 4JYAQ 2UUBQ 2KENA 4DR5L 4RG1A 5HY6A 4HIDA 4GOPA 3M4PA 5M3FH 4IFDJ 3RR5A 3EIVA 1UE6A 5H1SE 4DR3L 4K0KQ 1MIUA 5AJ3Q 4NPSA 5E7NA 3OW2A 1Q86C 3CC2A 4DAYB 2KBNA 4DR7L 2A19A 3CCUA 2WAQG 3H0GH 5IYCG 3CMEA 3CCVA 1SR3A 2PQAB 2XTIA 4DV5Q 2IHEA 4YCVA 5IP7G 3CCQA 4JI0L 4B3SL 1CUKA 1K0RA 4AYBG 1CKNB 2VQFQ 4DV4L 1I6HH 1K9MC 4PZ8A 4LF5L 1VQAA 1VQMA 4BY7G 1PH4A 4POFA 3PSIA 2BA1A 1VCIA 2PNHA 3I55A 3T1HQ 2HT1A 2R92G 1IXRA 4IJLA 1I5FA 1UE1A 4BA1I 2HHHL 3CAMA 2CCZA 3I4NH 3S14H 2JQOA 1P16A 2E2JH 4A3LG 3PO3G 4HIKA 3J80i 1VQKA 4APVA 4Y52H 3OTOQ 4GOPB 3BJUA 4KLKA 1PH5A 4JG2A 5IYBG 1V43A 2A1AA 2ATWA 1HZCA 4LFBQ 4A3MG 3RN2A 3HOUG 3I7FA 4JI6L 4A3FG 1LTLA 3FKIH 3PUXA 2VQEQ 4DV6Q 4KHZA 4KI0A 4DV7L 4GNXC 4X66Q 4LF6Q 1AE2A 1HJPA 1VQPA 1GD7A 1PH9A 4AH6A 3W1BA 1VQ9A 3CC4A 3KYHC 3UDGA 1K83H 3GTGH 2IX0A 5IT9c 4L5SA 2JA7H 4HJ5A 2GVAA 4JI4L 5C3EG 4DUYQ 4DR4Q 2B3GA 3W5OA 3G6EA 4JI5Q 3NENA 4DR6Q 1N33Q 1X55A 2RHQB 4OX9Q 4LNQA 4AQYQ 2CWPA 2YV5A 5IWAQ 4A3DG 1YHAA 3S17H 1Q1EA 3A74A 3CCJA 4IPGA 2WAQE 5C4XG 2ZJRA 3D0FA 3L7ZC 4GLXA 4POGA 3KFUA 3ER0A 4DV3Q 4BY7H 1HZAA 1WOCA 1N36Q 3CP0A 4YCUA 4AYBE 3JC66 3KDFA 1XPUA 1FJGQ 5C44H 3PO2H 1H95A 4LF9L 4IOAA 3CF5A 4HIMA 1KD1C 1C9OA 1UE7A 2K4KA 5LMNW 1Q8KA 4BXXG 3F2CA 4A3GG 5LMUL 1IBKL 1RL2A 2OCEA 3FHWA 3PUZA 4LF4Q 3Q8DA 2YU9H 1U0LA 3S1RH 3PUVA 1MJCA 2CKZB 3L0OA 4JI2Q 5JJLA 4YCWA 2RF4A 1I50H 3U4ZA 4NXML 2N8NA 1Y1VG 2V1CC 4LF8L 3HOZH 5EAYA 1EQRA 4IFDG 1TWGH 2WB1G 1C7YA 1KRSA 1HNWL 2R7ZH 3PF4A 1NMFA 3JAMc 3E9IA 4A3KH 3STBD 4JI3L 4OO1I 1PV4A 1HNZL 2ZJQA 3U58A 2KHJA 3GTQH 3UE1A 5BR8Q 1EIFA 3CCSA 1HR0W 5C4JH 3S2HH 4C3HH 4BY1H 1G6PA 1QUQA 4L5TA 3CQZH 3HKSA 1OXVA 1G51A 2PI2E 4L5QA 4C3JH 1PH3A 4JI7L 2BH2A 3B6YA 4OO1G 2K5HA 1PYSB 3CPWA 3HOVG 1WYDA 1Q46A 4B3RL 1Y1WH 2MQHA 4JOIA 4MZ9A 1Q7YC 4WJ3M 3A5ZB 1IBLL 2ZTCA 1QZGA 2JA6G 5ELNA 4DR1L 4A3BH 3S1QH 1E22A 1SLJA 2F4VL 2NN6G 4AIMA 5C0XI 4R1JA 1XMOL 4GKKL 4IPCA 2WP8J 4X62Q 2R7DA 3RZDH 2E5LQ 4BBSG 2B63G 2VS1A 1VQ4A 4A3CH 5FLMH 1CKOA 2N78A 2UUAL 3S1NH 2L15A 4DV1Q 2UU9L 1XNQQ 4DV0L 5IP9H 2D62A 1WCMG 1UE5A 1GM5A 3PCOB 4GOPC 5DLQE 4JI1Q 1WJJA 5C0XG 2EIFA 3HOXH 3I4MG 2N3SA 3LGJA 3KLWA 3G71A 3RN5A 1T9HA 5FJ8H 2I5LX 2E2HH 1QZHA 4KHPQ 1QUQB 1PVOA 4DR5Q 2JK8A 2NVQH 1FVIA 3EN2A 5LMNL 1JB7A 4DR3Q 2R6GA 4JI8L 3HOYG 1JJGA 2YTVA 4X64L 3G4SA 1YI2A 1Z9FA 2AMCB 4DR7Q 1HNXL 4X65L 4LWCA 1AE3A 1XMQL 2JA5G 2AKWB 3GTLH 4P74A 3M3YH 4JI0Q 2BH8A 4B3SQ 2I5MX 3H0GG 4LUOA 1Q81C 4DV4Q 2UXBQ 5GROA 4MTNA 4LF5Q 4YWKA 2UXDL 1EWIA 4DAMA 2JE6I 1CKMA 2HIVA 1LUZA 4R4QA 1LM0A 4UP9A 1DGSA 3CC7A 1YHQA 1VQ6A 1M1KC 4R4OA 3PIPA 1HR0L 1OXUA 4PZ6A 1K8GA 2HHHQ 2R7FA 1PH1A 4YY3L 4LFCL 3KJPA 4LW1A 1Q82C 4OWWB 3GTKH 2WFWA 2OQKA 1L1OA 1KAWA 1VQDA 5GAEC 3F2BA 2IY5B 2ZM6L 1N32L 2R92H 4DV2L 3I4NG 1D7QA 4YWMA 1N34L 4XIGS 1GVPA 3HKZG 1HZ9A 1BBWA 3I2ZA 1QVGA 2JEAI 3CCMA 2OTJA 1QVFA 3AEVA 4JI6Q 3PO3H 1L2FA 4A3LH 1R9TH 2EQSA 3A0JA 1KL9A 1VQIA 2GN5A 4DV7Q 2JA8H 3MXNB 4TVAB 5M3MG 4J15A 5IYBH 1IBML 1EIYB 2R7ZG 1B7YB 3HOUH 3TQYA 3K81C 4JBMA 4JI4Q 2K14A 3FKIG 1LYLA 4A3FH 1NJIC 2Q2HA 1EFWA 3HOWG 3AFQA 4PG3A 4UP7A 4R4CA 2VL6A 3BZKA 1KRTA 2ZJPA 1NE3A 4DUZL 3ICEA 4LFBL 2AWOA 1VQEA 1KIXA 1QVCA 4BBRH 1X9NA 2K5VA 4GN5A 1XJVA 2OWOA 3I56A 5JEAJ 3J7ZC 4A3DH 4GLVB 3CMAA 1L1OB 1X65A 1X3EA 1JJCB 1NBWA 5C4XH 4LF9Q 3CCEA 4IFDI 2AHOB 1XPOA 3M4OH 5M5XH 2Q2UA 2ALYB 3SGIA 1CSPA 2VUMG 4OWTB 2LXJA 1ASYA 1I94L 1EOVA 5GQOA 5C44G 1TWHH 2CQOA 4P72A 5IYDG 1EYGA 1P8LA 1PHJA 2NZOA 2HQLA 3TS0A 3H3VI 4A3EH 2MNAA 1E3PA 4GKJL 4NXMQ 3AFPA 3G48A 3ULJA 4B3TL 4BXXH 3U50C 3J81i 4DKAC 1K3RA 1VQFA 4A3GH 1JE5A 1SROA 3E9HA 2QEXA 4H02A 4A93H 1HNWQ 3FP9A 2UXCL 1A0IA 1OXTA 1VQLA 1JT8A 3HKZE 1YITA 4JI3Q 4LUVA 4GN3B 1HNZQ 1Y1VH 1YNXA 2Z6KA 1V9PA 1VQBA 4YHHL 3T1YL 2Y0SG 4LF7L 3PUWA 4A3IH 3CCLA 3L2PA 4PZ7A 4X6AH 1YEZA 3NELA 1XNRL 2ES2A 4JI7Q 1WI5A 1RIPA 1TXYA 2NN6I 1PH6A 3J80c 2VY3A 4IOCA 4JOIC 3AYHB
chains in the Genus database with same CATH superfamily
1M90C 2TSSA 4IQZA 4B3RQ 1PYBA 1PFBA 2HCCA 2A68D 2I5HA 2MJ8A 1IBLQ 4OEMB 4GZYC 3RLOA 4OIJA 2NZHA 3ONAB 5DEHA 3SE0A 3RZOH 2GVBA 2Z0SA 1XMOQ 4QGUA 3Q23A 4K5XA 1HXYD 3NBHB 3R2IA 1PA6A 2A73B 2VW9A 1YBYA 1TWFH 2ID0A 2UU9Q 5GAGC 2JSOA 1BCPC 2FXQA 1O7YA 2NN6H 4BWGB 2AWNA 2EY5A 4IJHA 2JA7B 4IALA 1KNEA 4U673 1BF4A 3HOXG 3OMCA 5JJZA 3CXCA 1ZYRC 2K50A 1B1ZA 1BVSA 2CFMA 1XTDA 4RHRA 4IO9A 4JYAL 3V05A 5JJKA 3KUPA 1PTOD 3PQIA 5ELCA 1X56A 3CW2C 1JE4A 2ZTEA 5IGFA 2ZT9C 5J22A 3J81c 4HJ7A 4DK3C 2DJGC 1EZ8A 4DV5L 1L1OC 2EYFA 2N49A 5D14A 2ZXOA 4IUQA 1A63A 1NMGA 4ABNA 3QO2A 2A8VA 1IYJB 3A7AB 3F8TA 3HOZB 4LFCQ 4ALPA 1M8AA 2MFIA 3PF5A 2NWGA 1TWGB 2X6GA 4R8IA 3AU7A 2UXBL 1DYQA 2B8FA 4B9WA 4CDCC 2PNRC 3D6CA 1O7IA 3BVMA 2XWBB 4DAVA 2YTXA 3MXUA 4UPAA 5BN4A 1ML0D 2E76C 4EQ5A 1CSQA 1A62A 4OGQC 3RLFA 1L0WA 2JA8G 1SRUA 3DM3A 3BZDB 2FJ2A 2Q2TA 3SK6A 1HQMC 2CWAA 3I4OA 4DUZQ 2L55A 1E1TA 2E2DC 3MEFA 3DWAA 2IWHA 4X66L 2VQEL 1GO3E 4A3BB 3R2TA 4N8X1 1GXDC 2A5HA 1STYA 3RZDB 2IW3A 1I4GA 4QY7A 4ODGA 1CA6A 2K6AA 2QGQA 1NAPA 1DOKA 3BZCA 2EY2A 2M2LA 3K7UC 1H9RA 1BKBA 5LMUQ 2E75C 2IX3A 1CI3M 2BA0A 3PO2G 1AH9A 1UEBA 1IKLA 5BN3A 4A4IA 5M5YH 2K32A 3S2DB 3S1MH 3P1HA 3K80C 1N36L 3S16H 1XTCD 2F52A 3D6WA 5ELOA 3SDZA 2VUMH 4CHTB 1C8CA 1AFPA 2J7ZA 3I72A 4PMBA 1OXXK 2PO4A 3VR3A 4K2KA 4EVOA 4IFDH 1Z47A 2ZTDA 2MO1A 2B2TC 1G2SA 3CHBD 1X3GA 1VQNA 3TS2A 1MJEA 2RCNA 4I65A 3OPOA 2F3IA 2RDGA 1RKNA 2H4OA 2D0PA 3VYUA 1B50A 3BU2A 5HGQA 2Q2IA 3TREA 3KJOA 1VQ5A 1AN8A 2JJQA 1FNWA 1Y1WG 2KCNA 1D6EC 1ASZA 3STBC 4ZYSA 4WJ4A 1TKWB 3FVQA 2O2LD 1K73C 4DNTB 1VS0A 3GDEA 4C3IH 1SNOA 2QDBA 2F3VA 5K5PA 4RAUC 2X69A 2O4XA 3HOUB 3S24A 1Q1BA 2K28A 2RA4A 4R4IA 4ULLA 3UE0A 1JJ2A 1A3VA 4UP8A 2M9VA 1XNQL 3KLSA 1B70B 4JYAQ 1I4PA 5HY6A 4GOPA 5M3FH 4XYQA 4IFDJ 3RR5A 1SNCA 5H1SE 5DNFA 2EJMA 4NPSA 5JEAH 1U4RA 1Q86C 2BOSA 2HDMA 2KBNA 1QE6A 3H0GH 3CMEA 1SR3A 4DV5Q 2DJFC 1BCPF 3SK8A 1IYVA 2XIWA 1CUKA 3OW7A 4CDDC 5I2XA 4KV6A 4WFN3 1ESFA 1B44D 4LF5L 1VQAA 5EPKA 1SYGA 1VQMA 4CGYB 5CMDA 1QNKA 2NBFA 2K5QA 2VXWA 2LMCB 2BA1A 4MIUA 2R92G 2R3ZA 4IJLA 2HHHL 3S14H 1EYDA 4ZUJA 5IGBA 4A3IB 4A3LG 3PO3G 4HIKA 4GOPB 2RVLA 4KLKA 2MP1A 5IYBG 2A1AA 1HZCA 3AMUA 3R3OA 1MGSA 2VQEQ 2EDGA 4KI0A 4X66Q 1EU4A 2MUYA 4KMUC 1PH9A 4AH6A 1SYDA 1AZQA 4L5SA 5ELEA 2B3GA 3G6EA 1X55A 1U9RA 1I6VC 1Q8IA 2CWPA 2YV5A 3E6ZX 3I90A 1TWCB 3A74A 1NNXA 1EL0A 5C4XG 4HMJA 3D0FA 1PXUA 4GLXA 1N36Q 4YCUA 2HD3A 1MI2A 3I4MB 4HIMA 4UHVA 1QG7A 4A3GG 1MSHA 3FHWA 3PUZA 4IUNA 3VA5A 3S1RH 5T1GA 5JJLA 2PCFB 4NXML 4LF8L 4JVZA 4IFDG 2VB3X 2JA5B 4I7AA 1NMFA 3E9IA 3MXPA 1D5XC 1LTAD 4MHEA 4A3KH 4HTHA 5BR8Q 1EY4A 2F0KA 4BY1H 2EYHA 2WKDA 3HKSA 1G51A 2BH2A 1YNNC 4C3JH 4OO1G 2K5HA 5CV8A 3SVMA 4IZ8A 5EKIA 2PZUA 2BE5C 4CKBA 2PW5A 1TIID 1WTPA 4JOIA 1ZYRD 2H1EA 4WJ3M 5L37A 4DR1L 4ZQ3A 5C0XI 1ENAA 4GKKL 2R7DA 4C3IG 1VQ4A 4KY7A 1CKOA 1A3TA 5M3MB 2N78A 3S1NH 1XNQQ 1GUTA 4DV0L 3CU7A 3GTPB 1TY0A 1JCKB 1HA5A 1ZKOA 4GOPC 5IT9E 1GM5A 1D1KA 2EIFA 3I4LA 2N3SA 5BN5A 3RN5A 1WTOA 4RGMA 5FJ8H 3EQLC 1PVOA 1O7LA 2JK8A 2NVQH 2VB2X 5LMNL 4HSVA 4TRDA 1O7ZA 5HURA 1T5EA 3KLSX 1PTOH 1JJGA 1F9SA 1FD7D 4K8JA 1HNXL 4LWCA 4N9PA 4F7XA 2NTTA 1TS3A 3QOLA 2BH8A 5IGDA 1EIHA 5JVH3 3H0GG 4LUOA 1B9NA 5GROA 1K8OA 4LF5Q 4YWKA 3SK5A 2UXDL 1LV9A 1CKMA 2HIVA 4R4QA 1LM0A 5D65A 5CYUA 2OXPA 1HR0L 1LT5D 2HHHQ 1PH1A 1I50B 4YY3L 3KJPA 4LW1A 1Q82C 1STBA 4OWWB 2WFWA 4RCOA 1VQDA 4FXGC 4MN3A 1HTPA 4KKUA 4ILWA 4CKEA 1CZWA 4YWMA 1N34L 1HZ9A 2JYOA 3ERQA 3I2ZA 1QVGA 2JEAI 3CCMA 1SSOA 1RJTA 1L2FA 3A0JA 3NWTA 2GN5A 3O13A 3S2HB 1JWMD 1EU3A 1HUMA 2R7ZG 1JORA 3TQYA 3QR8A 2K14A 3D8GA 2NVYB 4G4KA 2Q8IB 1SE4A 3CKIB 4PG3A 3BZKA 1KRTA 1NE3A 3DEPA 1QVCA 4BBRH 2K5VA 4GN5A 3WOFA 3H09A 3W3AA 3J7ZC 4A3DH 1WCMB 3TDQA 3N52A 2RSNA 1CSPA 3K58A 4OWTB 4XQNA 1ASYA 2K33A 5EBDA 3NTIA 3VR5A 2NVXB 3HOYB 4QUCA 1WTRA 1RCVD 4A3EH 4ZKCB 2K03A 1E3PA 2MNAA 4GKJL 3LWUA 4NXMQ 1ENCA 2E2HB 5CBEE 1VQFA 5TSSA 2QF7A 4QMGA 3DUZA 3BDOA 4A93H 5EBCA 1A0IA 1OXTA 1K0SA 2PZTA 1YITA 1BXTA 1V9PA 2KEEA 4IURA 1VQBA 5COYA 2Y0SG 4QUFA 3L2PA 4X6AH 1XNRL 4EQPA 4IUUA 1WI5A 1STHA 2NN6I 4ZCKA 3J80c 4JOIC 1W3SA 2EVBA 4NXNL 2FMMA 5IE8A 1SMXA 2D9UA 4K6LA 4R4TA 5GAHC 2QDLA 1FGBD 4DR1Q 2N55A 1WD0A 3HOVH 4JW0A 4RGOS 3S15H 4GKKQ 4A3JG 2B2UC 2LXKA 2JA6H 3FKIB 3K6OA 4DV0Q 1X32A 5JVG3 3D31A 3DXJC 3C1FA 2R93G 3SHLA 2KHIA 1K83B 4OHJA 2B63H 4DF7A 1WTQA 1YJNA 4ZLTF 1XWEA 5CV9A 5M5WH 3S17B 3UDIA 5LMNQ 5C0XH 4HN7A 4L6TB 5FJ8G 4N8FA 5IGEA 4EQNA 1HNXQ 2IHFA 1U4PA 2I07B 3PGZA 1HFNA 4PMWA 2CVRA 5C44B 3PO2B 1SYEA 4DFAA 2KCTA 4XTCS 5IP7H 2UXDQ 1VQ7A 2YU9B 3J80L 4QL5A 1XPRA 4HR7B 1HR0Q 3GTOH 3NTHA 4Y7NH 1LT6D 4EX5A 2O5IC 4YY3Q 1PZJD 5I4DA 1EWCA 2AUKA 1I4HA 3D3RA 4DXGA 1YJWA 1DONA 1E24A 1Y69U 1N34Q 1ET9A 1NY4A 1UWVA 2B2VA 2C35B 4C2MH 4GLAC 5C4JB 1FL0A 4C3HB 4Z9CB 3QJYA 1B4OA 3NBIA 2XNAC 4A3MH 3RLNA 2Z4HA 1SNDA 5KYIA 5A2QL 4LUZA 4EQOA 2AUJD 2SDFA 2SOBA 1CHQD 1VF5C 2F0LA 2OEOA 3C3LA 1Y1WB 3K5LA 4ME3A 4LF6L 2VZAA 1X3FA 4JBKA 3HOWH 5C0XJ 3M9BA 3RZOB 1S3OA 5JAVA 1KQSA 4DR6L 4JI5L 3OMGA 3UDFA 2JEBI 4BBRG 3H15A 2L11A 2B8GA 2NZ1D 4OX9L 2PPBC 4AQYL 2N88A 1IL2A 4FF4A 3R8BA 1D5MC 1IBKQ 4CJ2C 1K28A 4FXDA 4WORA 1YHBA 5LL6S 2Z8LA 1SFOH 1TR5A 1MKHA 4GKJQ 1HPCA 1YNND 2JA9A 2DNEA 4A3EG 2AQ2B 2G9DA 4K6DA 1S5FD 4M1UB 1PZID 2BE5D 4P75A 1S40A 3J7AF 4A93G 4KN7C 4TSSA 2G5DA 2Z1CA 1KDAA 1X6OA 3QB3A 1XNRQ 3MVVA 1C48A 3NK9A 3QG1A 1Q12A 1BUVT 1HUNA 1OXSC 3GQBA 4DK6C 2KCCA 2XSCA 4NXNQ 2EZVA 5KNCA 2F03A 2FHTA 5T1IA 2OTLA 2R92B 2E74C 3PUYA 4H0LC 4DAYA 4XYOA 3X3MA 1L0XB 2YTYA 1JMCA 3PO3B 1K8AC 4P71A 2CW0C 2NVTH 4XQJA 2F0HA 2K01A 3K5OA 4BBSH 4A3CG 1CKNA 3Q6SA 2D0OA 2NTSA 3KF8B 1H9KA 3IRBA 1MSGA 3NEMA 3A55A 2EXDA 3J7AV 2IX1A 2LY7A 5I9OA 4X3KA 1SYFA 4HEDA 4HIDA 5C4XB 3EIVA 2EJGC 3OW2A 5E7NA 4FVMA 4DAYB 4DR7L 2A19A 1DM0B 3CCUA 1BNZA 4RH6A 5IP7G 1B9MA 1O80A 1W6JA 5ELBA 1K0RA 4AYBG 1CKNB 1G6ZA 3S16B 4A3GB 4DV4L 1I6HH 1CT1D 2B2VC 4BY7G 4POFA 1VCIA 1HFGA 1IXRA 1Z6HA 1I5FA 5EGTA 1NR4A 3H91A 3I4NH 1EY7A 2L4NA 1P16A 1E2ZA 2D5DA 3J80i 1VQKA 1MHWC 2F4IA 1STGA 3BJUA 1JWSD 1LTBD 1I3QB 3FEWX 4LFBQ 4A3MG 3RN2A 1Y8NB 3Q0AA 3I7FA 4NP5A 4R8NA 4A3FG 3C46A 3QIAA 1LACA 4LF6Q 1GUGA 1VQPA 2JA7H 1BOSA 1ICFB 3FPUB 4HJ5A 4JI4L 4K5VA 4DR6Q 3W5OA 4JI5Q 3NENA 1A15A 4OX9Q 4AQYQ 1YHAA 1BDOA 1Q1EA 4CJ0B 3CCJA 4IPGA 3J81L 1TS5A 1J9OA 3L7ZC 3ER0A 1HZAA 1WOCA 3BDLA 4F8MA 2RCFA 4LF9L 5FLXE 1C9OA 1JQYD 5I9PA 1C4QA 4BXXG 1EQVA 1RL2A 5DAUA 3MXGA 4CDFC 3NXWA 2XVSA 1EYAA 3Q8DA 1U0LA 3PUVA 2D2CC 2CKZB 3L0OA 3EFXD 3U4ZA 1Y1VG 3HOZH 5JPMC 1HRJA 1EQRA 1II3A 1TWGH 2F0PA 1EIGA 4HAEA 4J6HA 3LNNA 3JAMc 3PF4A 2I46A 3FRPB 1ICWA 3H0GB 1HNZL 1HCZA 1EFID 3UE1A 1TT2A 1TS2A 1KLUD 1G6PA 4XXEA 4K14A 5CV5A 3PIP3 1PLFA 1SNMA 2MGSA 1EEID 1CQFA 5EKKA 1Q46A 1DOLA 1STAA 2MQHA 4H7BA 5I6YA 1QZGA 2F0GA 5ELNA 4A3BH 4X3TA 2NN6G 2DY7A 3RZDH 2KOLA 1SEBD 4BBSG 5FLMH 3TP8A 1RDPD 5C3EB 2R7ZB 4DNRB 5IP9H 1EZ6A 5DLQE 2CH4A 3LGJA 1T9HA 1QZHA 2ZXPA 4WJWA 3IL8A 1F77A 3CRKC 2QKIC 3HS0C 4QIWB 4JI8L 1LLRD 2ENBA 4CJ1B 4X64L 5FOBB 4DR7Q 2AMCB 2HUGA 4X65L 3GTMB 3Q22A 1GJXA 3MXNA 1XMQL 4P74A 4EGVA 2A6EC 2UXBQ 4DV4Q 3QOJA 4MTNA 1L0YB 3MZ5A 4DAMA 1EY5A 4DA2A 4H44C 2WB1B 2XN9C 1LTID 3GV6A 4FF1A 1LTSD 1K8GA 2EYOA 1N32L 5EQ0A 3I4NG 1D7QA 4XIGS 2E2IB 1GVPA 3HKZG 2EXZA 3DM1A 3KK7A 3GTJB 2OTJA 5C3XA 3AEVA 2EQSA 3SR1A 3MXNB 3A8IE 3HRZC 3MWYW 3HOUH 5EPLA 4JI4Q 1LYLA 2Q2HA 1EFWA 3BDCA 4UAIA 3SK4A 4UP7A 4R4CA 3I70A 3P20A 1S4ZA 1FR3A 2AWOA 3KLRA 4A3JB 1X9NA 2C9OA 2OWOA 2F0OA 4NMZA 2QEJC 4OELB 5JEAJ 3A54A 4GLVB 3P75A 4IUPA 4FF2A 2NUCA 1QCBD 1X3EA 1HHVA 2R93B 4LF9Q 2DY8A 2AHOB 2Q2UA 1JC7A 5LL6X 2VUMG 1D5ZC 2LXJA 3T56B 1TWAB 4P72A 3ITPA 1P8LA 1HTLD 2NZOA 4ZUIA 5IOCA 4K2LA 4NKLA 3J81i 3A8KE 3FP9A 2UXCL 1VQLA 3T51B 1TQOA 4M8AA 1HNZQ 5KRUA 1IW7C 3H94A 2CW0D 4YHHL 4LF7L 4FXKC 4A3IH 5IGCA 1YEZA 4OL7A 2ES2A 3K5MA 1QJOA 1RIPA 1TXYA 5J1ZA 1BBXC 2OT2A 3AYHB 1WTVA 3EJIA 3K7AH 4LFAL 1QB5D 1VMPA 3NSWA 2E2JB 3L3OC 2DGYA 5E4XA 3GD7A 4QIWE 3DEOA 4JC0A 2F1MA 2OQ0A 1EYCA 3S9WA 2B2UA 4OWXB 3ULLA 1TWCH 3H3VC 1G291 1QNUA 5CC4A 3GTGB 1PH2A 4JV5L 4HJ9A 4YWLA 2JXMB 3UDXA 5IP9G 1EQQA 2WB1E 1DD2A 4O0AA 3I4MH 3HG9A 3MFYA 5M3FG 4X64Q 3M85A 4X65Q 5FLXc 2KEDA 5JEAG 1XMQQ 2A6HC 3F2UA 4DPGA 4F88A 2UUBL 4B08A 1NCVA 5C3WA 5IYCH 2ASBA 1D2BA 1FGUA 1JB3A 5AJ3L 5JJIA 1R4QB 2JA5H 1JOQA 2A74C 4QJFA 2KUMA 2B29A 3WDNA 2YYZA 1W2BA 2VQFL 2QA4A 4RKBA 3JAMi 3EA6A 2E8GA 1N32Q 1ZEQX 4PV1C 4WRDA 2FFKB 3T1HL 2EOTA 3KBXA 3GTQB 1U4MA 1X54A 3KF6A 2XGTA 2SEBD 3T16A 1N9WA 3CQZB 3RNUA 1DOMA 2ZXRA 4QB4A 1V1PA 4OXPA 5EJWA 3WOEA 3J81j 3DWQA 3ULPA 1PH7A 2K75A 4IN3A 1WD1A 3TP6A 5M3MH 2WINB 4KJOA 1A8VA 4JBWA 2J4XA 4NB3A 1F9PA 3GTPH 2CHBD 3S1QB 2EPBA 3I8ZA 3TBIB 4DR4L 1KC8C 4JBJA 5C4ZA 3EBEA 1N33L 3CD6A 1AW7A 2IPKD 2ICEC 1E7ZA 1IKMA 2IT1A 1RODA 1U5KA 2LS01 3HOXB 2R61A 4P73A 1EY6A 5J3BA 4DV3L 1CHPD 3KF6B 4DNIA 4LF8Q 2KQ3A 1FJGL 1E1OA 5IY0A 1V1PB 2IJ0A 5JPNC 2UXCQ 5IYDH 2HDLA 5FO8B 2EE1A 1YZ6A 1KHIA 4LF4L 4CBVA 3GTLB 4IPHA 4JI2L 2K5NA 4YHHQ 4A3KG 4LF7Q 2F0DA 5CBAE 1PFSA 1IZ6A 3GO5A 3J81E 4BY1G 1KNAA 2Z9HA 4A3IG 4AYBB 2L1BA 3K8AA 1F2MA 4C3JG 4JPBW 3PV0A 4LFAQ 4BY7B 2EJFC 3GTKB 1F2YA 3SXHA 1BBUA 3P7JA 3AQQA 2MO0A 3KDFB 4OONA 2DUDA 2NVYH 1FNUA 4L5RC 1PRTB 2L5TA 1YIJA 2RHSB 1R9TB 2JA8B 3M4QA 4N9TA 3E0JA 5IIFA 1NR2A 4JV5Q 4A3FB 2A6ED 1WCMH 2B2WA 2E5LL 3VDYA 1A3UA 2KA7A 5ELDA 1WTXA 2LKVA 1VQOA 1PFNA 2HIXA 3E0EA 3VA7A 4DK0A 4JI1L 4ME5A 2A69C 2NVXH 3HOYH 3EVQA 2UUBQ 2KENA 4DXFA 1LABA 3M4OB 4DR3L 5M5XB 1MIUA 5AJ3Q 1K3BC 2WAQG 1TWHB 5IYCG 3IFTA 2XTIA 4P2CB 3CCQA 1Y8PB 4JI0L 1FNVA 5CV7A 2VQFQ 3MC0B 5E4WC 1SBBB 2PNHA 3I55A 3T1HQ 1Y1VB 4XT3B 1S5DD 2K1BA 1H9JA 2JQOA 3R93A 4APVA 4Y52H 4PMCA 1BCPB 3TMEA 3TP5A 1TS4A 2ATWA 4YIJA 2Z6BA 5D3IB 1LTLA 3FKIH 4ZK9B 4DV7L 2SNMA 4RCNA 1GD7A 3W1BA 3KYHC 2XRQD 1K83H 5C6AA 2IX0A 5ISRA 5IT9c 4DR4Q 2GVAA 1N33Q 2K5DA 1TWFB 2K7VA 2RHQB 4LNQA 4A3DG 3S17H 1CZGA 4C1NK 2Q8TA 5J39A 1IW7D 1BR9A 4FNFA 4POGA 3VYTA 4DV3Q 3T13A 1SJED 3CP0A 1PRTC 4AYBE 3JC66 3VR2A 1FJGQ 5C44H 3PO2H 4X3SA 4IOAA 4FO2A 1S5BD 1AEXA 2F0QA 2GA4B 1Q8KA 2K4KA 5LMNW 5LMUL 4JK1C 3GP7A 1E0BA 4LF4Q 1UAPA 4S3SA 2YU9H 2F0FA 1MJCA 3KF8A 4JI2Q 3G7LA 1H9SA 2MHVA 5EAYA 2FMCA 2ICIA 3EROA 3LX0A 1HNWL 4CKCA 1QWYA 4G7HC 3T4AC 1CFMA 5FO7B 4OO1I 1MBYA 4E6IA 1PV4A 2AQ1B 2ZJQA 1LTTD 3U58A 1DZ1A 2KHJA 2M00A 3NPPA 2MPMA 1EIFA 3CCSA 1HR0W 5C4JH 4C3HH 1QUQA 4L5TA 4L5QA 3HP3A 4TKOB 1PYSB 3CPWA 3HOVG 1WYDA 1DXMA 4RFBA 5D3DA 3DWPA 3TP7A 2RKSA 1Y1WH 1CQVA 2F0VA 2QCPX 4MZ9A 3I4NB 1Q7YC 3A5ZB 2B2WC 2JA6G 3HKZB 2A6HD 2F4VL 1H9SB 4AIMA 4R1JA 4IPCA 1CK1A 2E5LQ 2B63G 1Y8OB 1EY8A 2UUAL 3RMHA 1WCMG 3PCOB 1IL8A 4JI1Q 5C0XG 1WJJA 2RDHA 3KLWA 3G71A 3SEBA 3D4WA 1QUQB 4L8JA 3A7LA 4I7ZC 4HCEA 1LT3D 1FVIA 3EN2A 3V96A 1CA5A 4DR3Q 4FP5D 2R6GA 3HOYG 1DJRD 1KLGD 5K36H 1YI2A 1Z9FA 1SYBA 1LT4D 4R9WA 5M5YB 1AE3A 1D1IA 3S1MB 3M3YH 5ELFA 4JI0Q 5IODA 3L9AX 3FDTA 2I5MX 2VUMB 1ILPA 1Q81C 1IYUA 1PDQA 1EWIA 3DHQA 1LUZA 2QILA 4NW2A 1KAAA 4R4OA 3FPPA 1OXUA 3ND8A 4PZ6A 2R7FA 5G3LF 3NQIA 5EKLA 2F0MA 3F2BA 2IY5B 2ZM6L 2L0CA 1SE3A 2R92H 1B2TA 4DV2L 4NDXA 2F0IA 5KIXA 5E3FA 1QVFA 3PO3H 4A3LH 1KL9A 1VQIA 4DV7Q 4J15A 5IYBH 1B53A 1IBML 1KABA 1ONLA 3K81C 3AB9A 3FKIG 1NJIC 2C5CA 2PMZB 3HOWG 1I4XA 2CQAA 3C1EA 2VL6A 1GUWA 3ICEA 4C3IB 3NWSA 3KBGA 2DNCA 1JWUD 3BVGA 1I4QA 2EYPA 1M4VA 3CMAA 1X65A 1NBWA 1R4PB 2F0EA 5C4XH 1YNJC 3NE5B 2ALYB 4FYDA 1I94L 5GQOA 5C44G 1I4RA 1PYWD 2CQOA 4C1NI 1PHJA 3H3VI 1E2VA 4K8IA 4KKTA 1SNQA 5M3FB 3AFPA 2KJXA 3ULJA 4B3TL 1EWHA 1KDBA 2EYMA 4XDXA 4DKAC 1JE5A 1SROA 3E9HA 4A3GH 1QOHA 1HNWQ 1EY0A 1JT8A 1EEFD 3HKZE 1DCZA 1VDZA 2QW7A 1MD2D 4LUVA 3A56A 1YNXA 2Z6KA 1PFMA 2PW7A 3T1YL 3IAYA 3PUWA 1WTWA 4FF3A 3OHXC 3CCLA 5DM73 3MA2B 3NELA 1STNA 1PRTF 4ZRZA 3OOCA 3MTSA 2F0JA 1PH6A 2VY3A 3K59A 4C3HG 3W2DA 1I3QH 2I0QA 3J7A5 1S5ED 3FMCA 4O2DA 3S14B 4IPDA 1Y14B 5BR8L 4OO1H 2TMPA 1JICA 1PZKD 3CPFA 5G3LD 5JOBA 2A69D 3MEHA 4KKSA 2F4VQ 4IUVA 3WWVA 3D4DA 3CCRA 1EUJA 2L12A 2UUAQ 1GUSA 4DR2L 2B39A 1GUNA 2UUCL 3K0YA 5M9OA 1J5EL 3S2DH 3H6MA 1H9MA 5FO9B 1OTCA 3VR4A 1D8LA 1HH2P 5EPJA 3JAML 3I91A 4B3ML 4V190 3PIOA 4LK1C 1B3QA 1F2LA 2KCMA 2Q8RE 4QF4A 5K36G 4G57A 4RGNA 2K5WA 1J8IA 5CR3A 1F9RA 4K0KL 3DLLA 4HJAA 1LTRD 3I73A 3S1RB 1G8ZD 1VF7A 1Q3LA 1GUOA 1SN8A 2PMZE 3J7YW 1T5XD 1V1QA 1J6QA 1SJHD 2ZM6Q 2H5XA 2Y0SB 3A5UA 4DV2Q 5F2DA 4A3KB 3X3NA 3KOJA 2F0NA 1JR0D 4L63B 5NUCA 1PH8A 4LJZC 3MFGA 3K0XA 4BY1B 5FK9C 5C5MA 1IBMQ 4C3JB 2G9HD 1ET6A 3J80E 3OTOL 2CH4W 4A75A 4GN4B 1PRTD 2X6LA 4UY8C 1N8RC 3HEJA 1VQJA 4RMFA 4IUTA 2PYKA 5C5LA 2JA7G 3ERSX 1B8AA 3OYYA 4DGZA 4CDEC 3K7AB 4QQBX 1OO9B 5C3EH 2F0UA 2F0TA 4DV6L 2R7ZH 3M7NA 1VQHA 1AZPA 1HZBA 2K52A 1RTNA 1SE8A 4F87A 4DUYL 4GNXA 4ZKBB 1NSNS 3U4VA 2LSSA 2WACA 1V1OA 4J1MA 3S1NB 1K8MA 5IWAL 3TRZA 1TVXA 1C0AA 2HCIA 2LFNA 1UUPA 5A2QE 4K5WA 1FYCA 2BDOA 1I94Q 4O42A 1GKHA 3GTMH 4MNOA 4KD3A 2V4DA 2NVQB 4B3TQ 4JCVE 1NUCA 4H13C 1XX8A 1PTOB 2Z6KC 1B3AA 3HOZG 4O1NA 1GOZA 4PQXA 4MTKA 4DU9A 2KECA 4FDBA 3T1YQ 1VQGA 4HSPA 2WAQB 3IFDA 5GADC 4GNXB 4HIOA 3H3VH 2NYZD 1S72A 1VQCA 4RGTA 2PI2A 2E2IH 4TQUS 4GS3A 2P5ZX 3GTJH 3HFZB 1YJ9A 1LO5D 1NTGA 1VQ8A 1BCPD 2SNSA 4KY5A 1SMYC 2KHSA 3W1GA 5KGUA 4UDUC 1SXTA 4A3BG 4V0BA 1WFQA 1LTGD 3D4RA 1SDFA 3N6RA 1JOOA 2PQAA 4DR2Q 1Q90A 3LWEA 3F1ZA 5FLMG 1YVCA 2UUCQ 4A3JH 2VNUD 1J5EQ 2XWJB 3TN2A 3ZJYC 4X62L 1KXLA 1SAPA 3VR6A 4A76A 2R93H 4JI8Q 4DV1L 4XT1B 4KN4C 1WTHA 2RQXA 3F2DA 2A68C 4BBRB 2F0WA 3HZXA 4B3MQ 4HJ8A 1G91A 1V8QA 2Y0SE 1TWAH 4A3DB 4KHPL 3TEHB 2WKCA 5CGKA 1IHZA 4DR5L 4RG1A 4RKLA 5AFWA 3M4PA 4PNYA 1UE6A 2BDNA 4K0KQ 3CC2A 3CCVA 2PQAB 2IHEA 4YCVA 4B9XA 4A3EB 2WIIB 3MAQA 4B3SL 2J0TD 3PMFA 1K9MC 4A93B 4PZ8A 4KD4A 3BYYB 1PH4A 4HCSA 3PSIA 2HT1A 1QILA 1UE1A 2RBMA 3TZDA 4BA1I 1KDCA 3CAMA 3M4YA 1HQRD 2B2YA 2CCZA 2E2JH 1PTOC 1UNSA 1RTOA 3OTOQ 1PH5A 4JG2A 1V43A 1U4LA 4XQQA 1CM9A 1YNJD 3HOUG 4JI6L 4KK7A 3PUXA 4DV6Q 4GNXC 4KHZA 5I2YA 1AE2A 1HJPA 1VQ9A 4BA2I 3CC4A 3HOVB 5FLXL 2EYJA 4RA8A 3UDGA 3GTGH 1ZXTA 5E1FA 3S15B 5C3EG 4DUYQ 1X3QA 2JA6B 5DM63 3M7GA 5IWAQ 1X3PA 2EY6A 4ZAIA 5IGGA 4G7ZC 1AP0A 2WAQE 2ZJRA 2B63B 4QCLA 3NQTA 3ND9A 1SE2A 3KFUA 1XPUA 4RWSC 3RD4A 3KDFA 1BQQT 3I3CA 5M5WB 3OIPA 1H95A 3DMUA 3CF5A 1KD1C 1F9QA 1UE7A 2IL8A 3F2CA 1IBKL 2F0SA 2JN4A 2OCEA 1ILQA 4HMIA 1A2UA 4YCWA 2RF4A 1I50H 3CRLC 2N8NA 2V1CC 2WB1G 1C7YA 1KRSA 4Q5VA 3TZUA 3A8JE 3OWEB 3PIO3 1A6XA 1F2ZA 4KHVA 3STBD 4JI3L 5A35A 3GTQH 3GTOB 4Y7NB 4LAAA 3T53B 2NB0A 3K5NA 3BS1A 3S2HH 3CQZH 5KYLA 1OXVA 2PI2E 1PH3A 4JI7L 2EYLA 3B6YA 3Q24A 3E5SA 1RD9D 3E3XA 4C2MB 1W6KA 1PMRA 5C4HA 3ZYYX 4B3RL 2L9HA 4LMQD 1IBLL 2ZTCA 1SYCA 4A3MB 5CV4A 3S1QH 1E22A 1SLJA 4DN4M 1XMOL 2WP8J 4X62Q 2VS1A 3VYRA 4A3CH 5KNBA 1KTKA 4C56C 4DK1A 2L15A 1TY2A 4DV1Q 2UU9L 2D62A 1UE5A 3I4MG 3HOWB 3HOXH 5CORA 4KHPQ 2I5LX 2E2HH 1TU2B 3NTKA 3TSSA 4G7OC 2PZWA 4DR5Q 4KJNA 1GHJA 2KVMA 3NUCA 1JB7A 2YTVA 3VYSA 3G4SA 1SFOB 4X3UA 2JA5G 2AKWB 3NHHA 5CV6A 2JP1A 3C2PA 3IKJA 3GTLH 2RDFA 4B3SQ 1RHPA 2AQ3B 3GV3A 3U9SA 4DAPA 1XXGA 2JE6I 2B2YC 1EQTA 3RUZA 4U68A 4UP9A 1DGSA 3CC7A 1YHQA 1VQ6A 1A2TA 1M1KC 3G6JB 3PIPA 3V2TA 2PQEA 1ENFA 2EY1A 4BY7H 4LFCL 5HGTA 5I6WA 3GTKH 2OQKA 1L1OA 1KAWA 5GAEC 3JAME 1EOTA 4Q0FA 3U9OA 1BBWA 1O78A 2DN8A 4JI6Q 1R9TH 3QWNA 1WVLA 3MHBA 2JA8H 2FINB 4TVAB 5M3MG 1EIYB 1STEA 1B7YB 1EY9A 2HQEA 3NP8A 2O5JC 3HGBA 4JBMA 4A3FH 2K05A 3BG3A 4BS9A 3AFQA 1GHKA 3URYA 4LFBL 2ZJPA 4DUZL 1E2WA 2NVTB 1CTMA 4BBSB 1VQEA 1KIXA 2XRSD 1XJVA 3I56A 3OWFA 5FKAC 1PTOF 3UI2A 3OSOA 1L1OB 3BYTB 4KTAA 5KNDA 1UEAB 1JJCB 3CCEA 2BCOA 4IFDI 4ID6A 1XPOA 3M4OH 5M5XH 1S5CD 3SGIA 1SNPA 3K57A 5KEEA 1EOVA 1TWHH 4J8QA 5IYDG 1EYGA 1VMCA 2HQLA 4KY6A 3TS0A 2RSOA 5LHY1 3G48A 1JOKA 3BVZA 4BXXH 3U50C 1K3RA 3NBHA 1SMYD 4RHSA 2QEXA 4H02A 1HA6A 3OIQA 1ESRA 2K04A 4JI3Q 4GN3B 2OF1A 1Y1VH 1Z7TA 1BO0A 2Z4IA 3M3YB 1G2TA 1I6HB 4PZ7A 4OIKA 2B2TA 1XYIA 4JI7Q 2WV6D 5IT9L 1RF2D 2F3WA 4IOCA
chains in the Genus database with same CATH topology
1W3SA 1M90C 1I3QH 2I0QA 3J7A5 3K7AH 4LFAL 4O2DA 4B3RQ 1PYBA 4IPDA 4NXNL 1Y14B 5BR8L 5IE8A 1SMXA 2I5HA 2DGYA 4R4TA 3CPFA 3GD7A 5GAHC 1IBLQ 4DR1Q 3RLOA 3HOVH 4QIWE 2NZHA 3RZOH 2GVBA 2F4VQ 2Z0SA 1XMOQ 4QGUA 4BA2I 3S15H 4GKKQ 3WWVA 4A3JG 2LXKA 3NBHB 4JC0A 2OQ0A 1EUJA 3CCRA 1PA6A 2VW9A 1YBYA 1TWFH 2JA6H 2ID0A 4OWXB 3ULLA 2UUAQ 4DR2L 2UU9Q 1TWCH 5GAGC 4DV0Q 3D31A 2FXQA 1G291 2UUCL 2R93G 2AWNA 1J5EL 2KHIA 3S2DH 1PH2A 4IJHA 2B63H 4HJ9A 4JV5L 4YWLA 3UDXA 5IP9G 1EQQA 1YJNA 2WB1E 4O0AA 5M5WH 3HOXG 3UDIA 5LMNQ 3I4MH 1OTCA 5FJ8G 1D8LA 1HH2P 5M3FG 4X64Q 3CXCA 2K50A 4B3ML 3M85A 4X65Q 5FLXc 1HNXQ 1BVSA 2CFMA 1XTDA 2IHFA 3PGZA 5JEAG 3PIOA 1XMQQ 4DPGA 2KCMA 4IO9A 4JYAL 4PMWA 2UUBL 5K36G 5JJKA 5IYCH 2ASBA 2KCTA 1FGUA 4XTCS 1X56A 4K0KL 5IP7H 3DLLA 5AJ3L 4HJAA 5JJIA 3CW2C 2UXDQ 2JA5H 1VQ7A 2ZTEA 3J81c 4QJFA 4HJ7A 2B29A 4DK3C 4DV5L 1L1OC 2N49A 4QL5A 1XPRA 3M7NA 1A63A 1NMGA 1HR0Q 1SN8A 3GTOH 2PMZE 1IYJB 4Y7NH 4EX5A 2YYZA 3F8TA 2A8VA 4YY3Q 4LFCQ 4ALPA 1W2BA 2VQFL 2MFIA 2QA4A 3PF5A 1V1QA 1J6QA 3JAMi 2ZM6Q 2H5XA 2UXBL 2E8GA 1YJWA 1N32Q 1E24A 3A5UA 1O7IA 4DV2Q 1N34Q 1NY4A 1UWVA 3KOJA 3T1HL 2C35B 4C2MH 2YTXA 4UPAA 4GLAC 1PH8A 1FL0A 1X54A 3K0XA 3KF6A 2XGTA 1N9WA 3RNUA 4A3MH 3RLNA 1IBMQ 4EQ5A 1CSQA 1A62A 3OTOL 4A75A 4GN4B 4OXPA 4LUZA 3RLFA 1L0WA 4UY8C 1N8RC 3J81j 1VQJA 2JA8G 1SRUA 4RMFA 3ULPA 1PH7A 2K75A 2JA7G 3DM3A 3ERSX 1B8AA 3OYYA 5M3MH 2Q2TA 4QQBX 4DUZQ 2CWAA 3I4OA 1A8VA 5C3EH 1E1TA 4JBWA 3MEFA 4ME3A 4NB3A 4X66L 2VQEL 2VZAA 1GO3E 4LF6L 1X3FA 1VQHA 4JBKA 3GTPH 3HOWH 1HZBA 2K52A 5C0XJ 4DR4L 3M9BA 1KC8C 4JBJA 1SE8A 4GNXA 4DUYL 1S3OA 1KQSA 4DR6L 4JI5L 3EBEA 4QY7A 3U4VA 2LSSA 2JEBI 3UDFA 4BBRG 2QGQA 3H15A 1N33L 3CD6A 4OX9L 4AQYL 3TRZA 3BZCA 5IWAL 1E7ZA 1IL2A 1C0AA 2IT1A 3K7UC 1BKBA 5LMUQ 1IBKQ 1AH9A 1U5KA 2BA0A 3PO2G 1YHBA 1UEBA 1I94Q 1GKHA 3GTMH 4P73A 4MNOA 1SFOH 5J3BA 4A4IA 5M5YH 4DV3L 3KF6B 4DNIA 4DV6L 3S1MH 3K80C 1MKHA 1N36L 4LF8Q 3S16H 1FJGL 4GKJQ 2F52A 1E1OA 5ELOA 4B3TQ 2VUMH 5IY0A 4JCVE 2JA9A 2Z6KC 2UXCQ 5IYDH 3HOZG 4A3EG 1OXXK 1YZ6A 1KHIA 4LF4L 1Z47A 4P75A 4IPHA 2ZTDA 2MO1A 1S40A 4JI2L 4A93G 2K5NA 4FDBA 4YHHQ 3T1YQ 4A3KG 4LF7Q 1X3GA 1VQGA 1PFSA 1IZ6A 1VQNA 3TS2A 1MJEA 2RCNA 1X6OA 5GADC 4GNXB 4HIOA 1XNRQ 3GO5A 3H3VH 2F3IA 1Q12A 4BY1G 2D0PA 1S72A 1VQCA 4A3IG 1OXSC 2PI2A 2E2IH 3BU2A 4TQUS 4GS3A 3K8AA 5HGQA 2Q2IA 3PV0A 4DK6C 4LFAQ 3GTJH 3TREA 4NXNQ 3HFZB 3KJOA 1YJ9A 1VQ5A 1NTGA 2JJQA 1VQ8A 1BBUA 2OTLA 1Y1WG 3W1GA 3AQQA 2MO0A 1ASZA 3PUYA 3KDFB 4OONA 3STBC 4A3BG 4WJ4A 1WFQA 2DUDA 2NVYH 4L5RC 2YTYA 1K73C 1JMCA 1YIJA 2RHSB 1K8AC 2PQAA 4DR2Q 3F1ZA 1VS0A 4P71A 3GDEA 2NVTH 5FLMG 3M4QA 4A3CG 1YVCA 4C3IH 4BBSH 2UUCQ 4A3JH 2VNUD 1J5EQ 1CKNA 4JV5Q 2D0OA 3KF8B 3S24A 1Q1BA 4R4IA 3ZJYC 4X62L 3UE0A 3IRBA 1JJ2A 1WCMH 1KXLA 3NEMA 3VDYA 2E5LL 2EXDA 4UP8A 4A76A 2R93H 4JI8Q 4DV1L 1XNQL 2IX1A 1VQOA 3F2DA 2HIXA 3E0EA 4B3MQ 4HJ8A 4JI1L 1B70B 2Y0SE 1TWAH 2NVXH 4KHPL 3TEHB 3HOYH 4JYAQ 2UUBQ 2KENA 4DR5L 4RG1A 5HY6A 4HIDA 4GOPA 3M4PA 5M3FH 4IFDJ 3RR5A 3EIVA 1UE6A 5H1SE 4DR3L 4K0KQ 1MIUA 5AJ3Q 4NPSA 5E7NA 3OW2A 1Q86C 3CC2A 4DAYB 2KBNA 4DR7L 2A19A 3CCUA 2WAQG 3H0GH 5IYCG 3CMEA 3CCVA 1SR3A 2PQAB 2XTIA 4DV5Q 2IHEA 4YCVA 5IP7G 3CCQA 4JI0L 4B3SL 1CUKA 1K0RA 4AYBG 1CKNB 2VQFQ 4DV4L 1I6HH 1K9MC 4PZ8A 4LF5L 1VQAA 1VQMA 4BY7G 1PH4A 4POFA 3PSIA 2BA1A 1VCIA 2PNHA 3I55A 3T1HQ 2HT1A 2R92G 1IXRA 4IJLA 1I5FA 1UE1A 4BA1I 2HHHL 3CAMA 2CCZA 3I4NH 3S14H 2JQOA 1P16A 2E2JH 4A3LG 3PO3G 4HIKA 3J80i 1VQKA 4APVA 4Y52H 3OTOQ 4GOPB 3BJUA 4KLKA 1PH5A 4JG2A 5IYBG 1V43A 2A1AA 2ATWA 1HZCA 4LFBQ 4A3MG 3RN2A 3HOUG 3I7FA 4JI6L 4A3FG 1LTLA 3FKIH 3PUXA 2VQEQ 4DV6Q 4KHZA 4KI0A 4DV7L 4GNXC 4X66Q 4LF6Q 1AE2A 1HJPA 1VQPA 1GD7A 1PH9A 4AH6A 3W1BA 1VQ9A 3CC4A 3KYHC 3UDGA 1K83H 3GTGH 2IX0A 5IT9c 4L5SA 2JA7H 4HJ5A 2GVAA 4JI4L 5C3EG 4DUYQ 4DR4Q 2B3GA 3W5OA 3G6EA 4JI5Q 3NENA 4DR6Q 1N33Q 1X55A 2RHQB 4OX9Q 4LNQA 4AQYQ 2CWPA 2YV5A 5IWAQ 4A3DG 1YHAA 3S17H 1Q1EA 3A74A 3CCJA 4IPGA 2WAQE 5C4XG 2ZJRA 3D0FA 3L7ZC 4GLXA 4POGA 3KFUA 3ER0A 4DV3Q 4BY7H 1HZAA 1WOCA 1N36Q 3CP0A 4YCUA 4AYBE 3JC66 3KDFA 1XPUA 1FJGQ 5C44H 3PO2H 1H95A 4LF9L 4IOAA 3CF5A 4HIMA 1KD1C 1C9OA 1UE7A 2K4KA 5LMNW 1Q8KA 4BXXG 3F2CA 4A3GG 5LMUL 1IBKL 1RL2A 2OCEA 3FHWA 3PUZA 4LF4Q 3Q8DA 2YU9H 1U0LA 3S1RH 3PUVA 1MJCA 2CKZB 3L0OA 4JI2Q 5JJLA 4YCWA 2RF4A 1I50H 3U4ZA 4NXML 2N8NA 1Y1VG 2V1CC 4LF8L 3HOZH 5EAYA 1EQRA 4IFDG 1TWGH 2WB1G 1C7YA 1KRSA 1HNWL 2R7ZH 3PF4A 1NMFA 3JAMc 3E9IA 4A3KH 3STBD 4JI3L 4OO1I 1PV4A 1HNZL 2ZJQA 3U58A 2KHJA 3GTQH 3UE1A 5BR8Q 1EIFA 3CCSA 1HR0W 5C4JH 3S2HH 4C3HH 4BY1H 1G6PA 1QUQA 4L5TA 3CQZH 3HKSA 1OXVA 1G51A 2PI2E 4L5QA 4C3JH 1PH3A 4JI7L 2BH2A 3B6YA 4OO1G 2K5HA 1PYSB 3CPWA 3HOVG 1WYDA 1Q46A 4B3RL 1Y1WH 2MQHA 4JOIA 4MZ9A 1Q7YC 4WJ3M 3A5ZB 1IBLL 2ZTCA 1QZGA 2JA6G 5ELNA 4DR1L 4A3BH 3S1QH 1E22A 1SLJA 2F4VL 2NN6G 4AIMA 5C0XI 4R1JA 1XMOL 4GKKL 4IPCA 2WP8J 4X62Q 2R7DA 3RZDH 2E5LQ 4BBSG 2B63G 2VS1A 1VQ4A 4A3CH 5FLMH 1CKOA 2N78A 2UUAL 3S1NH 2L15A 4DV1Q 2UU9L 1XNQQ 4DV0L 5IP9H 2D62A 1WCMG 1UE5A 1GM5A 3PCOB 4GOPC 5DLQE 4JI1Q 1WJJA 5C0XG 2EIFA 3HOXH 3I4MG 2N3SA 3LGJA 3KLWA 3G71A 3RN5A 1T9HA 5FJ8H 2I5LX 2E2HH 1QZHA 4KHPQ 1QUQB 1PVOA 4DR5Q 2JK8A 2NVQH 1FVIA 3EN2A 5LMNL 1JB7A 4DR3Q 2R6GA 4JI8L 3HOYG 1JJGA 2YTVA 4X64L 3G4SA 1YI2A 1Z9FA 2AMCB 4DR7Q 1HNXL 4X65L 4LWCA 1AE3A 1XMQL 2JA5G 2AKWB 3GTLH 4P74A 3M3YH 4JI0Q 2BH8A 4B3SQ 2I5MX 3H0GG 4LUOA 1Q81C 4DV4Q 2UXBQ 5GROA 4MTNA 4LF5Q 4YWKA 2UXDL 1EWIA 4DAMA 2JE6I 1CKMA 2HIVA 1LUZA 4R4QA 1LM0A 4UP9A 1DGSA 3CC7A 1YHQA 1VQ6A 1M1KC 4R4OA 3PIPA 1HR0L 1OXUA 4PZ6A 1K8GA 2HHHQ 2R7FA 1PH1A 4YY3L 4LFCL 3KJPA 4LW1A 1Q82C 4OWWB 3GTKH 2WFWA 2OQKA 1L1OA 1KAWA 1VQDA 5GAEC 3F2BA 2IY5B 2ZM6L 1N32L 2R92H 4DV2L 3I4NG 1D7QA 4YWMA 1N34L 4XIGS 1GVPA 3HKZG 1HZ9A 1BBWA 3I2ZA 1QVGA 2JEAI 3CCMA 2OTJA 1QVFA 3AEVA 4JI6Q 3PO3H 1L2FA 4A3LH 1R9TH 2EQSA 3A0JA 1KL9A 1VQIA 2GN5A 4DV7Q 2JA8H 3MXNB 4TVAB 5M3MG 4J15A 5IYBH 1IBML 1EIYB 2R7ZG 1B7YB 3HOUH 3TQYA 3K81C 4JBMA 4JI4Q 2K14A 3FKIG 1LYLA 4A3FH 1NJIC 2Q2HA 1EFWA 3HOWG 3AFQA 4PG3A 4UP7A 4R4CA 2VL6A 3BZKA 1KRTA 2ZJPA 1NE3A 4DUZL 3ICEA 4LFBL 2AWOA 1VQEA 1KIXA 1QVCA 4BBRH 1X9NA 2K5VA 4GN5A 1XJVA 2OWOA 3I56A 5JEAJ 3J7ZC 4A3DH 4GLVB 3CMAA 1L1OB 1X65A 1X3EA 1JJCB 1NBWA 5C4XH 4LF9Q 3CCEA 4IFDI 2AHOB 1XPOA 3M4OH 5M5XH 2Q2UA 2ALYB 3SGIA 1CSPA 2VUMG 4OWTB 2LXJA 1ASYA 1I94L 1EOVA 5GQOA 5C44G 1TWHH 2CQOA 4P72A 5IYDG 1EYGA 1P8LA 1PHJA 2NZOA 2HQLA 3TS0A 3H3VI 4A3EH 2MNAA 1E3PA 4GKJL 4NXMQ 3AFPA 3G48A 3ULJA 4B3TL 4BXXH 3U50C 3J81i 4DKAC 1K3RA 1VQFA 4A3GH 1JE5A 1SROA 3E9HA 2QEXA 4H02A 4A93H 1HNWQ 3FP9A 2UXCL 1A0IA 1OXTA 1VQLA 1JT8A 3HKZE 1YITA 4JI3Q 4LUVA 4GN3B 1HNZQ 1Y1VH 1YNXA 2Z6KA 1V9PA 1VQBA 4YHHL 3T1YL 2Y0SG 4LF7L 3PUWA 4A3IH 3CCLA 3L2PA 4PZ7A 4X6AH 1YEZA 3NELA 1XNRL 2ES2A 4JI7Q 1WI5A 1RIPA 1TXYA 2NN6I 1PH6A 3J80c 2VY3A 4IOCA 4JOIC 3AYHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3S A;  1M90 C;  1I3Q H;  2I0Q A;  3J7A 5;  3K7A H;  4LFA L;  4O2D A;  4B3R Q;  1PYB A;  4IPD A;  4NXN L;  1Y14 B;  5BR8 L;  5IE8 A;  1SMX A;  2I5H A;  2DGY A;  4R4T A;  3CPF A;  3GD7 A;  5GAH C;  1IBL Q;  4DR1 Q;  3RLO A;  3HOV H;  4QIW E;  2NZH A;  3RZO H;  2GVB A;  2F4V Q;  2Z0S A;  1XMO Q;  4QGU A;  4BA2 I;  3S15 H;  4GKK Q;  3WWV A;  4A3J G;  2LXK A;  3NBH B;  4JC0 A;  2OQ0 A;  1EUJ A;  3CCR A;  1PA6 A;  2VW9 A;  1YBY A;  1TWF H;  2JA6 H;  2ID0 A;  4OWX B;  3ULL A;  2UUA Q;  4DR2 L;  2UU9 Q;  1TWC H;  5GAG C;  4DV0 Q;  3D31 A;  2FXQ A;  1G29 1;  2UUC L;  2R93 G;  2AWN A;  1J5E L;  2KHI A;  3S2D H;  1PH2 A;  4IJH A;  2B63 H;  4HJ9 A;  4JV5 L;  4YWL A;  3UDX A;  5IP9 G;  1EQQ A;  1YJN A;  2WB1 E;  4O0A A;  5M5W H;  3HOX G;  3UDI A;  5LMN Q;  3I4M H;  1OTC A;  5FJ8 G;  1D8L A;  1HH2 P;  5M3F G;  4X64 Q;  3CXC A;  2K50 A;  4B3M L;  3M85 A;  4X65 Q;  5FLX c;  1HNX Q;  1BVS A;  2CFM A;  1XTD A;  2IHF A;  3PGZ A;  5JEA G;  3PIO A;  1XMQ Q;  4DPG A;  2KCM A;  4IO9 A;  4JYA L;  4PMW A;  2UUB L;  5K36 G;  5JJK A;  5IYC H;  2ASB A;  2KCT A;  1FGU A;  4XTC S;  1X56 A;  4K0K L;  5IP7 H;  3DLL A;  5AJ3 L;  4HJA A;  5JJI A;  3CW2 C;  2UXD Q;  2JA5 H;  1VQ7 A;  2ZTE A;  3J81 c;  4QJF A;  4HJ7 A;  2B29 A;  4DK3 C;  4DV5 L;  1L1O C;  2N49 A;  4QL5 A;  1XPR A;  3M7N A;  1A63 A;  1NMG A;  1HR0 Q;  1SN8 A;  3GTO H;  2PMZ E;  1IYJ B;  4Y7N H;  4EX5 A;  2YYZ A;  3F8T A;  2A8V A;  4YY3 Q;  4LFC Q;  4ALP A;  1W2B A;  2VQF L;  2MFI A;  2QA4 A;  3PF5 A;  1V1Q A;  1J6Q A;  3JAM i;  2ZM6 Q;  2H5X A;  2UXB L;  2E8G A;  1YJW A;  1N32 Q;  1E24 A;  3A5U A;  1O7I A;  4DV2 Q;  1N34 Q;  1NY4 A;  1UWV A;  3KOJ A;  3T1H L;  2C35 B;  4C2M H;  2YTX A;  4UPA A;  4GLA C;  1PH8 A;  1FL0 A;  1X54 A;  3K0X A;  3KF6 A;  2XGT A;  1N9W A;  3RNU A;  4A3M H;  3RLN A;  1IBM Q;  4EQ5 A;  1CSQ A;  1A62 A;  3OTO L;  4A75 A;  4GN4 B;  4OXP A;  4LUZ A;  3RLF A;  1L0W A;  4UY8 C;  1N8R C;  3J81 j;  1VQJ A;  2JA8 G;  1SRU A;  4RMF A;  3ULP A;  1PH7 A;  2K75 A;  2JA7 G;  3DM3 A;  3ERS X;  1B8A A;  3OYY A;  5M3M H;  2Q2T A;  4QQB X;  4DUZ Q;  2CWA A;  3I4O A;  1A8V A;  5C3E H;  1E1T A;  4JBW A;  3MEF A;  4ME3 A;  4NB3 A;  4X66 L;  2VQE L;  2VZA A;  1GO3 E;  4LF6 L;  1X3F A;  1VQH A;  4JBK A;  3GTP H;  3HOW H;  1HZB A;  2K52 A;  5C0X J;  4DR4 L;  3M9B A;  1KC8 C;  4JBJ A;  1SE8 A;  4GNX A;  4DUY L;  1S3O A;  1KQS A;  4DR6 L;  4JI5 L;  3EBE A;  4QY7 A;  3U4V A;  2LSS A;  2JEB I;  3UDF A;  4BBR G;  2QGQ A;  3H15 A;  1N33 L;  3CD6 A;  4OX9 L;  4AQY L;  3TRZ A;  3BZC A;  5IWA L;  1E7Z A;  1IL2 A;  1C0A A;  2IT1 A;  3K7U C;  1BKB A;  5LMU Q;  1IBK Q;  1AH9 A;  1U5K A;  2BA0 A;  3PO2 G;  1YHB A;  1UEB A;  1I94 Q;  1GKH A;  3GTM H;  4P73 A;  4MNO A;  1SFO H;  5J3B A;  4A4I A;  5M5Y H;  4DV3 L;  3KF6 B;  4DNI A;  4DV6 L;  3S1M H;  3K80 C;  1MKH A;  1N36 L;  4LF8 Q;  3S16 H;  1FJG L;  4GKJ Q;  2F52 A;  1E1O A;  5ELO A;  4B3T Q;  2VUM H;  5IY0 A;  4JCV E;  2JA9 A;  2Z6K C;  2UXC Q;  5IYD H;  3HOZ G;  4A3E G;  1OXX K;  1YZ6 A;  1KHI A;  4LF4 L;  1Z47 A;  4P75 A;  4IPH A;  2ZTD A;  2MO1 A;  1S40 A;  4JI2 L;  4A93 G;  2K5N A;  4FDB A;  4YHH Q;  3T1Y Q;  4A3K G;  4LF7 Q;  1X3G A;  1VQG A;  1PFS A;  1IZ6 A;  1VQN A;  3TS2 A;  1MJE A;  2RCN A;  1X6O A;  5GAD C;  4GNX B;  4HIO A;  1XNR Q;  3GO5 A;  3H3V H;  2F3I A;  1Q12 A;  4BY1 G;  2D0P A;  1S72 A;  1VQC A;  4A3I G;  1OXS C;  2PI2 A;  2E2I H;  3BU2 A;  4TQU S;  4GS3 A;  3K8A A;  5HGQ A;  2Q2I A;  3PV0 A;  4DK6 C;  4LFA Q;  3GTJ H;  3TRE A;  4NXN Q;  3HFZ B;  3KJO A;  1YJ9 A;  1VQ5 A;  1NTG A;  2JJQ A;  1VQ8 A;  1BBU A;  2OTL A;  1Y1W G;  3W1G A;  3AQQ A;  2MO0 A;  1ASZ A;  3PUY A;  3KDF B;  4OON A;  3STB C;  4A3B G;  4WJ4 A;  1WFQ A;  2DUD A;  2NVY H;  4L5R C;  2YTY A;  1K73 C;  1JMC A;  1YIJ A;  2RHS B;  1K8A C;  2PQA A;  4DR2 Q;  3F1Z A;  1VS0 A;  4P71 A;  3GDE A;  2NVT H;  5FLM G;  3M4Q A;  4A3C G;  1YVC A;  4C3I H;  4BBS H;  2UUC Q;  4A3J H;  2VNU D;  1J5E Q;  1CKN A;  4JV5 Q;  2D0O A;  3KF8 B;  3S24 A;  1Q1B A;  4R4I A;  3ZJY C;  4X62 L;  3UE0 A;  3IRB A;  1JJ2 A;  1WCM H;  1KXL A;  3NEM A;  3VDY A;  2E5L L;  2EXD A;  4UP8 A;  4A76 A;  2R93 H;  4JI8 Q;  4DV1 L;  1XNQ L;  2IX1 A;  1VQO A;  3F2D A;  2HIX A;  3E0E A;  4B3M Q;  4HJ8 A;  4JI1 L;  1B70 B;  2Y0S E;  1TWA H;  2NVX H;  4KHP L;  3TEH B;  3HOY H;  4JYA Q;  2UUB Q;  2KEN A;  4DR5 L;  4RG1 A;  5HY6 A;  4HID A;  4GOP A;  3M4P A;  5M3F H;  4IFD J;  3RR5 A;  3EIV A;  1UE6 A;  5H1S E;  4DR3 L;  4K0K Q;  1MIU A;  5AJ3 Q;  4NPS A;  5E7N A;  3OW2 A;  1Q86 C;  3CC2 A;  4DAY B;  2KBN A;  4DR7 L;  2A19 A;  3CCU A;  2WAQ G;  3H0G H;  5IYC G;  3CME A;  3CCV A;  1SR3 A;  2PQA B;  2XTI A;  4DV5 Q;  2IHE A;  4YCV A;  5IP7 G;  3CCQ A;  4JI0 L;  4B3S L;  1CUK A;  1K0R A;  4AYB G;  1CKN B;  2VQF Q;  4DV4 L;  1I6H H;  1K9M C;  4PZ8 A;  4LF5 L;  1VQA A;  1VQM A;  4BY7 G;  1PH4 A;  4POF A;  3PSI A;  2BA1 A;  1VCI A;  2PNH A;  3I55 A;  3T1H Q;  2HT1 A;  2R92 G;  1IXR A;  4IJL A;  1I5F A;  1UE1 A;  4BA1 I;  2HHH L;  3CAM A;  2CCZ A;  3I4N H;  3S14 H;  2JQO A;  1P16 A;  2E2J H;  4A3L G;  3PO3 G;  4HIK A;  3J80 i;  1VQK A;  4APV A;  4Y52 H;  3OTO Q;  4GOP B;  3BJU A;  4KLK A;  1PH5 A;  4JG2 A;  5IYB G;  1V43 A;  2A1A A;  2ATW A;  1HZC A;  4LFB Q;  4A3M G;  3RN2 A;  3HOU G;  3I7F A;  4JI6 L;  4A3F G;  1LTL A;  3FKI H;  3PUX A;  2VQE Q;  4DV6 Q;  4KHZ A;  4KI0 A;  4DV7 L;  4GNX C;  4X66 Q;  4LF6 Q;  1AE2 A;  1HJP A;  1VQP A;  1GD7 A;  1PH9 A;  4AH6 A;  3W1B A;  1VQ9 A;  3CC4 A;  3KYH C;  3UDG A;  1K83 H;  3GTG H;  2IX0 A;  5IT9 c;  4L5S A;  2JA7 H;  4HJ5 A;  2GVA A;  4JI4 L;  5C3E G;  4DUY Q;  4DR4 Q;  2B3G A;  3W5O A;  3G6E A;  4JI5 Q;  3NEN A;  4DR6 Q;  1N33 Q;  1X55 A;  2RHQ B;  4OX9 Q;  4LNQ A;  4AQY Q;  2CWP A;  2YV5 A;  5IWA Q;  4A3D G;  1YHA A;  3S17 H;  1Q1E A;  3A74 A;  3CCJ A;  4IPG A;  2WAQ E;  5C4X G;  2ZJR A;  3D0F A;  3L7Z C;  4GLX A;  4POG A;  3KFU A;  3ER0 A;  4DV3 Q;  4BY7 H;  1HZA A;  1WOC A;  1N36 Q;  3CP0 A;  4YCU A;  4AYB E;  3JC6 6;  3KDF A;  1XPU A;  1FJG Q;  5C44 H;  3PO2 H;  1H95 A;  4LF9 L;  4IOA A;  3CF5 A;  4HIM A;  1KD1 C;  1C9O A;  1UE7 A;  2K4K A;  5LMN W;  1Q8K A;  4BXX G;  3F2C A;  4A3G G;  5LMU L;  1IBK L;  1RL2 A;  2OCE A;  3FHW A;  3PUZ A;  4LF4 Q;  3Q8D A;  2YU9 H;  1U0L A;  3S1R H;  3PUV A;  1MJC A;  2CKZ B;  3L0O A;  4JI2 Q;  5JJL A;  4YCW A;  2RF4 A;  1I50 H;  3U4Z A;  4NXM L;  2N8N A;  1Y1V G;  2V1C C;  4LF8 L;  3HOZ H;  5EAY A;  1EQR A;  4IFD G;  1TWG H;  2WB1 G;  1C7Y A;  1KRS A;  1HNW L;  2R7Z H;  3PF4 A;  1NMF A;  3JAM c;  3E9I A;  4A3K H;  3STB D;  4JI3 L;  4OO1 I;  1PV4 A;  1HNZ L;  2ZJQ A;  3U58 A;  2KHJ A;  3GTQ H;  3UE1 A;  5BR8 Q;  1EIF A;  3CCS A;  1HR0 W;  5C4J H;  3S2H H;  4C3H H;  4BY1 H;  1G6P A;  1QUQ A;  4L5T A;  3CQZ H;  3HKS A;  1OXV A;  1G51 A;  2PI2 E;  4L5Q A;  4C3J H;  1PH3 A;  4JI7 L;  2BH2 A;  3B6Y A;  4OO1 G;  2K5H A;  1PYS B;  3CPW A;  3HOV G;  1WYD A;  1Q46 A;  4B3R L;  1Y1W H;  2MQH A;  4JOI A;  4MZ9 A;  1Q7Y C;  4WJ3 M;  3A5Z B;  1IBL L;  2ZTC A;  1QZG A;  2JA6 G;  5ELN A;  4DR1 L;  4A3B H;  3S1Q H;  1E22 A;  1SLJ A;  2F4V L;  2NN6 G;  4AIM A;  5C0X I;  4R1J A;  1XMO L;  4GKK L;  4IPC A;  2WP8 J;  4X62 Q;  2R7D A;  3RZD H;  2E5L Q;  4BBS G;  2B63 G;  2VS1 A;  1VQ4 A;  4A3C H;  5FLM H;  1CKO A;  2N78 A;  2UUA L;  3S1N H;  2L15 A;  4DV1 Q;  2UU9 L;  1XNQ Q;  4DV0 L;  5IP9 H;  2D62 A;  1WCM G;  1UE5 A;  1GM5 A;  3PCO B;  4GOP C;  5DLQ E;  4JI1 Q;  1WJJ A;  5C0X G;  2EIF A;  3HOX H;  3I4M G;  2N3S A;  3LGJ A;  3KLW A;  3G71 A;  3RN5 A;  1T9H A;  5FJ8 H;  2I5L X;  2E2H H;  1QZH A;  4KHP Q;  1QUQ B;  1PVO A;  4DR5 Q;  2JK8 A;  2NVQ H;  1FVI A;  3EN2 A;  5LMN L;  1JB7 A;  4DR3 Q;  2R6G A;  4JI8 L;  3HOY G;  1JJG A;  2YTV A;  4X64 L;  3G4S A;  1YI2 A;  1Z9F A;  2AMC B;  4DR7 Q;  1HNX L;  4X65 L;  4LWC A;  1AE3 A;  1XMQ L;  2JA5 G;  2AKW B;  3GTL H;  4P74 A;  3M3Y H;  4JI0 Q;  2BH8 A;  4B3S Q;  2I5M X;  3H0G G;  4LUO A;  1Q81 C;  4DV4 Q;  2UXB Q;  5GRO A;  4MTN A;  4LF5 Q;  4YWK A;  2UXD L;  1EWI A;  4DAM A;  2JE6 I;  1CKM A;  2HIV A;  1LUZ A;  4R4Q A;  1LM0 A;  4UP9 A;  1DGS A;  3CC7 A;  1YHQ A;  1VQ6 A;  1M1K C;  4R4O A;  3PIP A;  1HR0 L;  1OXU A;  4PZ6 A;  1K8G A;  2HHH Q;  2R7F A;  1PH1 A;  4YY3 L;  4LFC L;  3KJP A;  4LW1 A;  1Q82 C;  4OWW B;  3GTK H;  2WFW A;  2OQK A;  1L1O A;  1KAW A;  1VQD A;  5GAE C;  3F2B A;  2IY5 B;  2ZM6 L;  1N32 L;  2R92 H;  4DV2 L;  3I4N G;  1D7Q A;  4YWM A;  1N34 L;  4XIG S;  1GVP A;  3HKZ G;  1HZ9 A;  1BBW A;  3I2Z A;  1QVG A;  2JEA I;  3CCM A;  2OTJ A;  1QVF A;  3AEV A;  4JI6 Q;  3PO3 H;  1L2F A;  4A3L H;  1R9T H;  2EQS A;  3A0J A;  1KL9 A;  1VQI A;  2GN5 A;  4DV7 Q;  2JA8 H;  3MXN B;  4TVA B;  5M3M G;  4J15 A;  5IYB H;  1IBM L;  1EIY B;  2R7Z G;  1B7Y B;  3HOU H;  3TQY A;  3K81 C;  4JBM A;  4JI4 Q;  2K14 A;  3FKI G;  1LYL A;  4A3F H;  1NJI C;  2Q2H A;  1EFW A;  3HOW G;  3AFQ A;  4PG3 A;  4UP7 A;  4R4C A;  2VL6 A;  3BZK A;  1KRT A;  2ZJP A;  1NE3 A;  4DUZ L;  3ICE A;  4LFB L;  2AWO A;  1VQE A;  1KIX A;  1QVC A;  4BBR H;  1X9N A;  2K5V A;  4GN5 A;  1XJV A;  2OWO A;  3I56 A;  5JEA J;  3J7Z C;  4A3D H;  4GLV B;  3CMA A;  1L1O B;  1X65 A;  1X3E A;  1JJC B;  1NBW A;  5C4X H;  4LF9 Q;  3CCE A;  4IFD I;  2AHO B;  1XPO A;  3M4O H;  5M5X H;  2Q2U A;  2ALY B;  3SGI A;  1CSP A;  2VUM G;  4OWT B;  2LXJ A;  1ASY A;  1I94 L;  1EOV A;  5GQO A;  5C44 G;  1TWH H;  2CQO A;  4P72 A;  5IYD G;  1EYG A;  1P8L A;  1PHJ A;  2NZO A;  2HQL A;  3TS0 A;  3H3V I;  4A3E H;  2MNA A;  1E3P A;  4GKJ L;  4NXM Q;  3AFP A;  3G48 A;  3ULJ A;  4B3T L;  4BXX H;  3U50 C;  3J81 i;  4DKA C;  1K3R A;  1VQF A;  4A3G H;  1JE5 A;  1SRO A;  3E9H A;  2QEX A;  4H02 A;  4A93 H;  1HNW Q;  3FP9 A;  2UXC L;  1A0I A;  1OXT A;  1VQL A;  1JT8 A;  3HKZ E;  1YIT A;  4JI3 Q;  4LUV A;  4GN3 B;  1HNZ Q;  1Y1V H;  1YNX A;  2Z6K A;  1V9P A;  1VQB A;  4YHH L;  3T1Y L;  2Y0S G;  4LF7 L;  3PUW A;  4A3I H;  3CCL A;  3L2P A;  4PZ7 A;  4X6A H;  1YEZ A;  3NEL A;  1XNR L;  2ES2 A;  4JI7 Q;  1WI5 A;  1RIP A;  1TXY A;  2NN6 I;  1PH6 A;  3J80 c;  2VY3 A;  4IOC A;  4JOI C;  3AYH B; 
#chains in the Genus database with same CATH topology
 1M90 C;  2TSS A;  4IQZ A;  4B3R Q;  1PYB A;  1PFB A;  2HCC A;  2A68 D;  2I5H A;  2MJ8 A;  1IBL Q;  4OEM B;  4GZY C;  3RLO A;  4OIJ A;  2NZH A;  3ONA B;  5DEH A;  3SE0 A;  3RZO H;  2GVB A;  2Z0S A;  1XMO Q;  4QGU A;  3Q23 A;  4K5X A;  1HXY D;  3NBH B;  3R2I A;  1PA6 A;  2A73 B;  2VW9 A;  1YBY A;  1TWF H;  2ID0 A;  2UU9 Q;  5GAG C;  2JSO A;  1BCP C;  2FXQ A;  1O7Y A;  2NN6 H;  4BWG B;  2AWN A;  2EY5 A;  4IJH A;  2JA7 B;  4IAL A;  1KNE A;  4U67 3;  1BF4 A;  3HOX G;  3OMC A;  5JJZ A;  3CXC A;  1ZYR C;  2K50 A;  1B1Z A;  1BVS A;  2CFM A;  1XTD A;  4RHR A;  4IO9 A;  4JYA L;  3V05 A;  5JJK A;  3KUP A;  1PTO D;  3PQI A;  5ELC A;  1X56 A;  3CW2 C;  1JE4 A;  2ZTE A;  5IGF A;  2ZT9 C;  5J22 A;  3J81 c;  4HJ7 A;  4DK3 C;  2DJG C;  1EZ8 A;  4DV5 L;  1L1O C;  2EYF A;  2N49 A;  5D14 A;  2ZXO A;  4IUQ A;  1A63 A;  1NMG A;  4ABN A;  3QO2 A;  2A8V A;  1IYJ B;  3A7A B;  3F8T A;  3HOZ B;  4LFC Q;  4ALP A;  1M8A A;  2MFI A;  3PF5 A;  2NWG A;  1TWG B;  2X6G A;  4R8I A;  3AU7 A;  2UXB L;  1DYQ A;  2B8F A;  4B9W A;  4CDC C;  2PNR C;  3D6C A;  1O7I A;  3BVM A;  2XWB B;  4DAV A;  2YTX A;  3MXU A;  4UPA A;  5BN4 A;  1ML0 D;  2E76 C;  4EQ5 A;  1CSQ A;  1A62 A;  4OGQ C;  3RLF A;  1L0W A;  2JA8 G;  1SRU A;  3DM3 A;  3BZD B;  2FJ2 A;  2Q2T A;  3SK6 A;  1HQM C;  2CWA A;  3I4O A;  4DUZ Q;  2L55 A;  1E1T A;  2E2D C;  3MEF A;  3DWA A;  2IWH A;  4X66 L;  2VQE L;  1GO3 E;  4A3B B;  3R2T A;  4N8X 1;  1GXD C;  2A5H A;  1STY A;  3RZD B;  2IW3 A;  1I4G A;  4QY7 A;  4ODG A;  1CA6 A;  2K6A A;  2QGQ A;  1NAP A;  1DOK A;  3BZC A;  2EY2 A;  2M2L A;  3K7U C;  1H9R A;  1BKB A;  5LMU Q;  2E75 C;  2IX3 A;  1CI3 M;  2BA0 A;  3PO2 G;  1AH9 A;  1UEB A;  1IKL A;  5BN3 A;  4A4I A;  5M5Y H;  2K32 A;  3S2D B;  3S1M H;  3P1H A;  3K80 C;  1N36 L;  3S16 H;  1XTC D;  2F52 A;  3D6W A;  5ELO A;  3SDZ A;  2VUM H;  4CHT B;  1C8C A;  1AFP A;  2J7Z A;  3I72 A;  4PMB A;  1OXX K;  2PO4 A;  3VR3 A;  4K2K A;  4EVO A;  4IFD H;  1Z47 A;  2ZTD A;  2MO1 A;  2B2T C;  1G2S A;  3CHB D;  1X3G A;  1VQN A;  3TS2 A;  1MJE A;  2RCN A;  4I65 A;  3OPO A;  2F3I A;  2RDG A;  1RKN A;  2H4O A;  2D0P A;  3VYU A;  1B50 A;  3BU2 A;  5HGQ A;  2Q2I A;  3TRE A;  3KJO A;  1VQ5 A;  1AN8 A;  2JJQ A;  1FNW A;  1Y1W G;  2KCN A;  1D6E C;  1ASZ A;  3STB C;  4ZYS A;  4WJ4 A;  1TKW B;  3FVQ A;  2O2L D;  1K73 C;  4DNT B;  1VS0 A;  3GDE A;  4C3I H;  1SNO A;  2QDB A;  2F3V A;  5K5P A;  4RAU C;  2X69 A;  2O4X A;  3HOU B;  3S24 A;  1Q1B A;  2K28 A;  2RA4 A;  4R4I A;  4ULL A;  3UE0 A;  1JJ2 A;  1A3V A;  4UP8 A;  2M9V A;  1XNQ L;  3KLS A;  1B70 B;  4JYA Q;  1I4P A;  5HY6 A;  4GOP A;  5M3F H;  4XYQ A;  4IFD J;  3RR5 A;  1SNC A;  5H1S E;  5DNF A;  2EJM A;  4NPS A;  5JEA H;  1U4R A;  1Q86 C;  2BOS A;  2HDM A;  2KBN A;  1QE6 A;  3H0G H;  3CME A;  1SR3 A;  4DV5 Q;  2DJF C;  1BCP F;  3SK8 A;  1IYV A;  2XIW A;  1CUK A;  3OW7 A;  4CDD C;  5I2X A;  4KV6 A;  4WFN 3;  1ESF A;  1B44 D;  4LF5 L;  1VQA A;  5EPK A;  1SYG A;  1VQM A;  4CGY B;  5CMD A;  1QNK A;  2NBF A;  2K5Q A;  2VXW A;  2LMC B;  2BA1 A;  4MIU A;  2R92 G;  2R3Z A;  4IJL A;  2HHH L;  3S14 H;  1EYD A;  4ZUJ A;  5IGB A;  4A3I B;  4A3L G;  3PO3 G;  4HIK A;  4GOP B;  2RVL A;  4KLK A;  2MP1 A;  5IYB G;  2A1A A;  1HZC A;  3AMU A;  3R3O A;  1MGS A;  2VQE Q;  2EDG A;  4KI0 A;  4X66 Q;  1EU4 A;  2MUY A;  4KMU C;  1PH9 A;  4AH6 A;  1SYD A;  1AZQ A;  4L5S A;  5ELE A;  2B3G A;  3G6E A;  1X55 A;  1U9R A;  1I6V C;  1Q8I A;  2CWP A;  2YV5 A;  3E6Z X;  3I90 A;  1TWC B;  3A74 A;  1NNX A;  1EL0 A;  5C4X G;  4HMJ A;  3D0F A;  1PXU A;  4GLX A;  1N36 Q;  4YCU A;  2HD3 A;  1MI2 A;  3I4M B;  4HIM A;  4UHV A;  1QG7 A;  4A3G G;  1MSH A;  3FHW A;  3PUZ A;  4IUN A;  3VA5 A;  3S1R H;  5T1G A;  5JJL A;  2PCF B;  4NXM L;  4LF8 L;  4JVZ A;  4IFD G;  2VB3 X;  2JA5 B;  4I7A A;  1NMF A;  3E9I A;  3MXP A;  1D5X C;  1LTA D;  4MHE A;  4A3K H;  4HTH A;  5BR8 Q;  1EY4 A;  2F0K A;  4BY1 H;  2EYH A;  2WKD A;  3HKS A;  1G51 A;  2BH2 A;  1YNN C;  4C3J H;  4OO1 G;  2K5H A;  5CV8 A;  3SVM A;  4IZ8 A;  5EKI A;  2PZU A;  2BE5 C;  4CKB A;  2PW5 A;  1TII D;  1WTP A;  4JOI A;  1ZYR D;  2H1E A;  4WJ3 M;  5L37 A;  4DR1 L;  4ZQ3 A;  5C0X I;  1ENA A;  4GKK L;  2R7D A;  4C3I G;  1VQ4 A;  4KY7 A;  1CKO A;  1A3T A;  5M3M B;  2N78 A;  3S1N H;  1XNQ Q;  1GUT A;  4DV0 L;  3CU7 A;  3GTP B;  1TY0 A;  1JCK B;  1HA5 A;  1ZKO A;  4GOP C;  5IT9 E;  1GM5 A;  1D1K A;  2EIF A;  3I4L A;  2N3S A;  5BN5 A;  3RN5 A;  1WTO A;  4RGM A;  5FJ8 H;  3EQL C;  1PVO A;  1O7L A;  2JK8 A;  2NVQ H;  2VB2 X;  5LMN L;  4HSV A;  4TRD A;  1O7Z A;  5HUR A;  1T5E A;  3KLS X;  1PTO H;  1JJG A;  1F9S A;  1FD7 D;  4K8J A;  1HNX L;  4LWC A;  4N9P A;  4F7X A;  2NTT A;  1TS3 A;  3QOL A;  2BH8 A;  5IGD A;  1EIH A;  5JVH 3;  3H0G G;  4LUO A;  1B9N A;  5GRO A;  1K8O A;  4LF5 Q;  4YWK A;  3SK5 A;  2UXD L;  1LV9 A;  1CKM A;  2HIV A;  4R4Q A;  1LM0 A;  5D65 A;  5CYU A;  2OXP A;  1HR0 L;  1LT5 D;  2HHH Q;  1PH1 A;  1I50 B;  4YY3 L;  3KJP A;  4LW1 A;  1Q82 C;  1STB A;  4OWW B;  2WFW A;  4RCO A;  1VQD A;  4FXG C;  4MN3 A;  1HTP A;  4KKU A;  4ILW A;  4CKE A;  1CZW A;  4YWM A;  1N34 L;  1HZ9 A;  2JYO A;  3ERQ A;  3I2Z A;  1QVG A;  2JEA I;  3CCM A;  1SSO A;  1RJT A;  1L2F A;  3A0J A;  3NWT A;  2GN5 A;  3O13 A;  3S2H B;  1JWM D;  1EU3 A;  1HUM A;  2R7Z G;  1JOR A;  3TQY A;  3QR8 A;  2K14 A;  3D8G A;  2NVY B;  4G4K A;  2Q8I B;  1SE4 A;  3CKI B;  4PG3 A;  3BZK A;  1KRT A;  1NE3 A;  3DEP A;  1QVC A;  4BBR H;  2K5V A;  4GN5 A;  3WOF A;  3H09 A;  3W3A A;  3J7Z C;  4A3D H;  1WCM B;  3TDQ A;  3N52 A;  2RSN A;  1CSP A;  3K58 A;  4OWT B;  4XQN A;  1ASY A;  2K33 A;  5EBD A;  3NTI A;  3VR5 A;  2NVX B;  3HOY B;  4QUC A;  1WTR A;  1RCV D;  4A3E H;  4ZKC B;  2K03 A;  1E3P A;  2MNA A;  4GKJ L;  3LWU A;  4NXM Q;  1ENC A;  2E2H B;  5CBE E;  1VQF A;  5TSS A;  2QF7 A;  4QMG A;  3DUZ A;  3BDO A;  4A93 H;  5EBC A;  1A0I A;  1OXT A;  1K0S A;  2PZT A;  1YIT A;  1BXT A;  1V9P A;  2KEE A;  4IUR A;  1VQB A;  5COY A;  2Y0S G;  4QUF A;  3L2P A;  4X6A H;  1XNR L;  4EQP A;  4IUU A;  1WI5 A;  1STH A;  2NN6 I;  4ZCK A;  3J80 c;  4JOI C;  1W3S A;  2EVB A;  4NXN L;  2FMM A;  5IE8 A;  1SMX A;  2D9U A;  4K6L A;  4R4T A;  5GAH C;  2QDL A;  1FGB D;  4DR1 Q;  2N55 A;  1WD0 A;  3HOV H;  4JW0 A;  4RGO S;  3S15 H;  4GKK Q;  4A3J G;  2B2U C;  2LXK A;  2JA6 H;  3FKI B;  3K6O A;  4DV0 Q;  1X32 A;  5JVG 3;  3D31 A;  3DXJ C;  3C1F A;  2R93 G;  3SHL A;  2KHI A;  1K83 B;  4OHJ A;  2B63 H;  4DF7 A;  1WTQ A;  1YJN A;  4ZLT F;  1XWE A;  5CV9 A;  5M5W H;  3S17 B;  3UDI A;  5LMN Q;  5C0X H;  4HN7 A;  4L6T B;  5FJ8 G;  4N8F A;  5IGE A;  4EQN A;  1HNX Q;  2IHF A;  1U4P A;  2I07 B;  3PGZ A;  1HFN A;  4PMW A;  2CVR A;  5C44 B;  3PO2 B;  1SYE A;  4DFA A;  2KCT A;  4XTC S;  5IP7 H;  2UXD Q;  1VQ7 A;  2YU9 B;  3J80 L;  4QL5 A;  1XPR A;  4HR7 B;  1HR0 Q;  3GTO H;  3NTH A;  4Y7N H;  1LT6 D;  4EX5 A;  2O5I C;  4YY3 Q;  1PZJ D;  5I4D A;  1EWC A;  2AUK A;  1I4H A;  3D3R A;  4DXG A;  1YJW A;  1DON A;  1E24 A;  1Y69 U;  1N34 Q;  1ET9 A;  1NY4 A;  1UWV A;  2B2V A;  2C35 B;  4C2M H;  4GLA C;  5C4J B;  1FL0 A;  4C3H B;  4Z9C B;  3QJY A;  1B4O A;  3NBI A;  2XNA C;  4A3M H;  3RLN A;  2Z4H A;  1SND A;  5KYI A;  5A2Q L;  4LUZ A;  4EQO A;  2AUJ D;  2SDF A;  2SOB A;  1CHQ D;  1VF5 C;  2F0L A;  2OEO A;  3C3L A;  1Y1W B;  3K5L A;  4ME3 A;  4LF6 L;  2VZA A;  1X3F A;  4JBK A;  3HOW H;  5C0X J;  3M9B A;  3RZO B;  1S3O A;  5JAV A;  1KQS A;  4DR6 L;  4JI5 L;  3OMG A;  3UDF A;  2JEB I;  4BBR G;  3H15 A;  2L11 A;  2B8G A;  2NZ1 D;  4OX9 L;  2PPB C;  4AQY L;  2N88 A;  1IL2 A;  4FF4 A;  3R8B A;  1D5M C;  1IBK Q;  4CJ2 C;  1K28 A;  4FXD A;  4WOR A;  1YHB A;  5LL6 S;  2Z8L A;  1SFO H;  1TR5 A;  1MKH A;  4GKJ Q;  1HPC A;  1YNN D;  2JA9 A;  2DNE A;  4A3E G;  2AQ2 B;  2G9D A;  4K6D A;  1S5F D;  4M1U B;  1PZI D;  2BE5 D;  4P75 A;  1S40 A;  3J7A F;  4A93 G;  4KN7 C;  4TSS A;  2G5D A;  2Z1C A;  1KDA A;  1X6O A;  3QB3 A;  1XNR Q;  3MVV A;  1C48 A;  3NK9 A;  3QG1 A;  1Q12 A;  1BUV T;  1HUN A;  1OXS C;  3GQB A;  4DK6 C;  2KCC A;  2XSC A;  4NXN Q;  2EZV A;  5KNC A;  2F03 A;  2FHT A;  5T1I A;  2OTL A;  2R92 B;  2E74 C;  3PUY A;  4H0L C;  4DAY A;  4XYO A;  3X3M A;  1L0X B;  2YTY A;  1JMC A;  3PO3 B;  1K8A C;  4P71 A;  2CW0 C;  2NVT H;  4XQJ A;  2F0H A;  2K01 A;  3K5O A;  4BBS H;  4A3C G;  1CKN A;  3Q6S A;  2D0O A;  2NTS A;  3KF8 B;  1H9K A;  3IRB A;  1MSG A;  3NEM A;  3A55 A;  2EXD A;  3J7A V;  2IX1 A;  2LY7 A;  5I9O A;  4X3K A;  1SYF A;  4HED A;  4HID A;  5C4X B;  3EIV A;  2EJG C;  3OW2 A;  5E7N A;  4FVM A;  4DAY B;  4DR7 L;  2A19 A;  1DM0 B;  3CCU A;  1BNZ A;  4RH6 A;  5IP7 G;  1B9M A;  1O80 A;  1W6J A;  5ELB A;  1K0R A;  4AYB G;  1CKN B;  1G6Z A;  3S16 B;  4A3G B;  4DV4 L;  1I6H H;  1CT1 D;  2B2V C;  4BY7 G;  4POF A;  1VCI A;  1HFG A;  1IXR A;  1Z6H A;  1I5F A;  5EGT A;  1NR4 A;  3H91 A;  3I4N H;  1EY7 A;  2L4N A;  1P16 A;  1E2Z A;  2D5D A;  3J80 i;  1VQK A;  1MHW C;  2F4I A;  1STG A;  3BJU A;  1JWS D;  1LTB D;  1I3Q B;  3FEW X;  4LFB Q;  4A3M G;  3RN2 A;  1Y8N B;  3Q0A A;  3I7F A;  4NP5 A;  4R8N A;  4A3F G;  3C46 A;  3QIA A;  1LAC A;  4LF6 Q;  1GUG A;  1VQP A;  2JA7 H;  1BOS A;  1ICF B;  3FPU B;  4HJ5 A;  4JI4 L;  4K5V A;  4DR6 Q;  3W5O A;  4JI5 Q;  3NEN A;  1A15 A;  4OX9 Q;  4AQY Q;  1YHA A;  1BDO A;  1Q1E A;  4CJ0 B;  3CCJ A;  4IPG A;  3J81 L;  1TS5 A;  1J9O A;  3L7Z C;  3ER0 A;  1HZA A;  1WOC A;  3BDL A;  4F8M A;  2RCF A;  4LF9 L;  5FLX E;  1C9O A;  1JQY D;  5I9P A;  1C4Q A;  4BXX G;  1EQV A;  1RL2 A;  5DAU A;  3MXG A;  4CDF C;  3NXW A;  2XVS A;  1EYA A;  3Q8D A;  1U0L A;  3PUV A;  2D2C C;  2CKZ B;  3L0O A;  3EFX D;  3U4Z A;  1Y1V G;  3HOZ H;  5JPM C;  1HRJ A;  1EQR A;  1II3 A;  1TWG H;  2F0P A;  1EIG A;  4HAE A;  4J6H A;  3LNN A;  3JAM c;  3PF4 A;  2I46 A;  3FRP B;  1ICW A;  3H0G B;  1HNZ L;  1HCZ A;  1EFI D;  3UE1 A;  1TT2 A;  1TS2 A;  1KLU D;  1G6P A;  4XXE A;  4K14 A;  5CV5 A;  3PIP 3;  1PLF A;  1SNM A;  2MGS A;  1EEI D;  1CQF A;  5EKK A;  1Q46 A;  1DOL A;  1STA A;  2MQH A;  4H7B A;  5I6Y A;  1QZG A;  2F0G A;  5ELN A;  4A3B H;  4X3T A;  2NN6 G;  2DY7 A;  3RZD H;  2KOL A;  1SEB D;  4BBS G;  5FLM H;  3TP8 A;  1RDP D;  5C3E B;  2R7Z B;  4DNR B;  5IP9 H;  1EZ6 A;  5DLQ E;  2CH4 A;  3LGJ A;  1T9H A;  1QZH A;  2ZXP A;  4WJW A;  3IL8 A;  1F77 A;  3CRK C;  2QKI C;  3HS0 C;  4QIW B;  4JI8 L;  1LLR D;  2ENB A;  4CJ1 B;  4X64 L;  5FOB B;  4DR7 Q;  2AMC B;  2HUG A;  4X65 L;  3GTM B;  3Q22 A;  1GJX A;  3MXN A;  1XMQ L;  4P74 A;  4EGV A;  2A6E C;  2UXB Q;  4DV4 Q;  3QOJ A;  4MTN A;  1L0Y B;  3MZ5 A;  4DAM A;  1EY5 A;  4DA2 A;  4H44 C;  2WB1 B;  2XN9 C;  1LTI D;  3GV6 A;  4FF1 A;  1LTS D;  1K8G A;  2EYO A;  1N32 L;  5EQ0 A;  3I4N G;  1D7Q A;  4XIG S;  2E2I B;  1GVP A;  3HKZ G;  2EXZ A;  3DM1 A;  3KK7 A;  3GTJ B;  2OTJ A;  5C3X A;  3AEV A;  2EQS A;  3SR1 A;  3MXN B;  3A8I E;  3HRZ C;  3MWY W;  3HOU H;  5EPL A;  4JI4 Q;  1LYL A;  2Q2H A;  1EFW A;  3BDC A;  4UAI A;  3SK4 A;  4UP7 A;  4R4C A;  3I70 A;  3P20 A;  1S4Z A;  1FR3 A;  2AWO A;  3KLR A;  4A3J B;  1X9N A;  2C9O A;  2OWO A;  2F0O A;  4NMZ A;  2QEJ C;  4OEL B;  5JEA J;  3A54 A;  4GLV B;  3P75 A;  4IUP A;  4FF2 A;  2NUC A;  1QCB D;  1X3E A;  1HHV A;  2R93 B;  4LF9 Q;  2DY8 A;  2AHO B;  2Q2U A;  1JC7 A;  5LL6 X;  2VUM G;  1D5Z C;  2LXJ A;  3T56 B;  1TWA B;  4P72 A;  3ITP A;  1P8L A;  1HTL D;  2NZO A;  4ZUI A;  5IOC A;  4K2L A;  4NKL A;  3J81 i;  3A8K E;  3FP9 A;  2UXC L;  1VQL A;  3T51 B;  1TQO A;  4M8A A;  1HNZ Q;  5KRU A;  1IW7 C;  3H94 A;  2CW0 D;  4YHH L;  4LF7 L;  4FXK C;  4A3I H;  5IGC A;  1YEZ A;  4OL7 A;  2ES2 A;  3K5M A;  1QJO A;  1RIP A;  1TXY A;  5J1Z A;  1BBX C;  2OT2 A;  3AYH B;  1WTV A;  3EJI A;  3K7A H;  4LFA L;  1QB5 D;  1VMP A;  3NSW A;  2E2J B;  3L3O C;  2DGY A;  5E4X A;  3GD7 A;  4QIW E;  3DEO A;  4JC0 A;  2F1M A;  2OQ0 A;  1EYC A;  3S9W A;  2B2U A;  4OWX B;  3ULL A;  1TWC H;  3H3V C;  1G29 1;  1QNU A;  5CC4 A;  3GTG B;  1PH2 A;  4JV5 L;  4HJ9 A;  4YWL A;  2JXM B;  3UDX A;  5IP9 G;  1EQQ A;  2WB1 E;  1DD2 A;  4O0A A;  3I4M H;  3HG9 A;  3MFY A;  5M3F G;  4X64 Q;  3M85 A;  4X65 Q;  5FLX c;  2KED A;  5JEA G;  1XMQ Q;  2A6H C;  3F2U A;  4DPG A;  4F88 A;  2UUB L;  4B08 A;  1NCV A;  5C3W A;  5IYC H;  2ASB A;  1D2B A;  1FGU A;  1JB3 A;  5AJ3 L;  5JJI A;  1R4Q B;  2JA5 H;  1JOQ A;  2A74 C;  4QJF A;  2KUM A;  2B29 A;  3WDN A;  2YYZ A;  1W2B A;  2VQF L;  2QA4 A;  4RKB A;  3JAM i;  3EA6 A;  2E8G A;  1N32 Q;  1ZEQ X;  4PV1 C;  4WRD A;  2FFK B;  3T1H L;  2EOT A;  3KBX A;  3GTQ B;  1U4M A;  1X54 A;  3KF6 A;  2XGT A;  2SEB D;  3T16 A;  1N9W A;  3CQZ B;  3RNU A;  1DOM A;  2ZXR A;  4QB4 A;  1V1P A;  4OXP A;  5EJW A;  3WOE A;  3J81 j;  3DWQ A;  3ULP A;  1PH7 A;  2K75 A;  4IN3 A;  1WD1 A;  3TP6 A;  5M3M H;  2WIN B;  4KJO A;  1A8V A;  4JBW A;  2J4X A;  4NB3 A;  1F9P A;  3GTP H;  2CHB D;  3S1Q B;  2EPB A;  3I8Z A;  3TBI B;  4DR4 L;  1KC8 C;  4JBJ A;  5C4Z A;  3EBE A;  1N33 L;  3CD6 A;  1AW7 A;  2IPK D;  2ICE C;  1E7Z A;  1IKM A;  2IT1 A;  1ROD A;  1U5K A;  2LS0 1;  3HOX B;  2R61 A;  4P73 A;  1EY6 A;  5J3B A;  4DV3 L;  1CHP D;  3KF6 B;  4DNI A;  4LF8 Q;  2KQ3 A;  1FJG L;  1E1O A;  5IY0 A;  1V1P B;  2IJ0 A;  5JPN C;  2UXC Q;  5IYD H;  2HDL A;  5FO8 B;  2EE1 A;  1YZ6 A;  1KHI A;  4LF4 L;  4CBV A;  3GTL B;  4IPH A;  4JI2 L;  2K5N A;  4YHH Q;  4A3K G;  4LF7 Q;  2F0D A;  5CBA E;  1PFS A;  1IZ6 A;  3GO5 A;  3J81 E;  4BY1 G;  1KNA A;  2Z9H A;  4A3I G;  4AYB B;  2L1B A;  3K8A A;  1F2M A;  4C3J G;  4JPB W;  3PV0 A;  4LFA Q;  4BY7 B;  2EJF C;  3GTK B;  1F2Y A;  3SXH A;  1BBU A;  3P7J A;  3AQQ A;  2MO0 A;  3KDF B;  4OON A;  2DUD A;  2NVY H;  1FNU A;  4L5R C;  1PRT B;  2L5T A;  1YIJ A;  2RHS B;  1R9T B;  2JA8 B;  3M4Q A;  4N9T A;  3E0J A;  5IIF A;  1NR2 A;  4JV5 Q;  4A3F B;  2A6E D;  1WCM H;  2B2W A;  2E5L L;  3VDY A;  1A3U A;  2KA7 A;  5ELD A;  1WTX A;  2LKV A;  1VQO A;  1PFN A;  2HIX A;  3E0E A;  3VA7 A;  4DK0 A;  4JI1 L;  4ME5 A;  2A69 C;  2NVX H;  3HOY H;  3EVQ A;  2UUB Q;  2KEN A;  4DXF A;  1LAB A;  3M4O B;  4DR3 L;  5M5X B;  1MIU A;  5AJ3 Q;  1K3B C;  2WAQ G;  1TWH B;  5IYC G;  3IFT A;  2XTI A;  4P2C B;  3CCQ A;  1Y8P B;  4JI0 L;  1FNV A;  5CV7 A;  2VQF Q;  3MC0 B;  5E4W C;  1SBB B;  2PNH A;  3I55 A;  3T1H Q;  1Y1V B;  4XT3 B;  1S5D D;  2K1B A;  1H9J A;  2JQO A;  3R93 A;  4APV A;  4Y52 H;  4PMC A;  1BCP B;  3TME A;  3TP5 A;  1TS4 A;  2ATW A;  4YIJ A;  2Z6B A;  5D3I B;  1LTL A;  3FKI H;  4ZK9 B;  4DV7 L;  2SNM A;  4RCN A;  1GD7 A;  3W1B A;  3KYH C;  2XRQ D;  1K83 H;  5C6A A;  2IX0 A;  5ISR A;  5IT9 c;  4DR4 Q;  2GVA A;  1N33 Q;  2K5D A;  1TWF B;  2K7V A;  2RHQ B;  4LNQ A;  4A3D G;  3S17 H;  1CZG A;  4C1N K;  2Q8T A;  5J39 A;  1IW7 D;  1BR9 A;  4FNF A;  4POG A;  3VYT A;  4DV3 Q;  3T13 A;  1SJE D;  3CP0 A;  1PRT C;  4AYB E;  3JC6 6;  3VR2 A;  1FJG Q;  5C44 H;  3PO2 H;  4X3S A;  4IOA A;  4FO2 A;  1S5B D;  1AEX A;  2F0Q A;  2GA4 B;  1Q8K A;  2K4K A;  5LMN W;  5LMU L;  4JK1 C;  3GP7 A;  1E0B A;  4LF4 Q;  1UAP A;  4S3S A;  2YU9 H;  2F0F A;  1MJC A;  3KF8 A;  4JI2 Q;  3G7L A;  1H9S A;  2MHV A;  5EAY A;  2FMC A;  2ICI A;  3ERO A;  3LX0 A;  1HNW L;  4CKC A;  1QWY A;  4G7H C;  3T4A C;  1CFM A;  5FO7 B;  4OO1 I;  1MBY A;  4E6I A;  1PV4 A;  2AQ1 B;  2ZJQ A;  1LTT D;  3U58 A;  1DZ1 A;  2KHJ A;  2M00 A;  3NPP A;  2MPM A;  1EIF A;  3CCS A;  1HR0 W;  5C4J H;  4C3H H;  1QUQ A;  4L5T A;  4L5Q A;  3HP3 A;  4TKO B;  1PYS B;  3CPW A;  3HOV G;  1WYD A;  1DXM A;  4RFB A;  5D3D A;  3DWP A;  3TP7 A;  2RKS A;  1Y1W H;  1CQV A;  2F0V A;  2QCP X;  4MZ9 A;  3I4N B;  1Q7Y C;  3A5Z B;  2B2W C;  2JA6 G;  3HKZ B;  2A6H D;  2F4V L;  1H9S B;  4AIM A;  4R1J A;  4IPC A;  1CK1 A;  2E5L Q;  2B63 G;  1Y8O B;  1EY8 A;  2UUA L;  3RMH A;  1WCM G;  3PCO B;  1IL8 A;  4JI1 Q;  5C0X G;  1WJJ A;  2RDH A;  3KLW A;  3G71 A;  3SEB A;  3D4W A;  1QUQ B;  4L8J A;  3A7L A;  4I7Z C;  4HCE A;  1LT3 D;  1FVI A;  3EN2 A;  3V96 A;  1CA5 A;  4DR3 Q;  4FP5 D;  2R6G A;  3HOY G;  1DJR D;  1KLG D;  5K36 H;  1YI2 A;  1Z9F A;  1SYB A;  1LT4 D;  4R9W A;  5M5Y B;  1AE3 A;  1D1I A;  3S1M B;  3M3Y H;  5ELF A;  4JI0 Q;  5IOD A;  3L9A X;  3FDT A;  2I5M X;  2VUM B;  1ILP A;  1Q81 C;  1IYU A;  1PDQ A;  1EWI A;  3DHQ A;  1LUZ A;  2QIL A;  4NW2 A;  1KAA A;  4R4O A;  3FPP A;  1OXU A;  3ND8 A;  4PZ6 A;  2R7F A;  5G3L F;  3NQI A;  5EKL A;  2F0M A;  3F2B A;  2IY5 B;  2ZM6 L;  2L0C A;  1SE3 A;  2R92 H;  1B2T A;  4DV2 L;  4NDX A;  2F0I A;  5KIX A;  5E3F A;  1QVF A;  3PO3 H;  4A3L H;  1KL9 A;  1VQI A;  4DV7 Q;  4J15 A;  5IYB H;  1B53 A;  1IBM L;  1KAB A;  1ONL A;  3K81 C;  3AB9 A;  3FKI G;  1NJI C;  2C5C A;  2PMZ B;  3HOW G;  1I4X A;  2CQA A;  3C1E A;  2VL6 A;  1GUW A;  3ICE A;  4C3I B;  3NWS A;  3KBG A;  2DNC A;  1JWU D;  3BVG A;  1I4Q A;  2EYP A;  1M4V A;  3CMA A;  1X65 A;  1NBW A;  1R4P B;  2F0E A;  5C4X H;  1YNJ C;  3NE5 B;  2ALY B;  4FYD A;  1I94 L;  5GQO A;  5C44 G;  1I4R A;  1PYW D;  2CQO A;  4C1N I;  1PHJ A;  3H3V I;  1E2V A;  4K8I A;  4KKT A;  1SNQ A;  5M3F B;  3AFP A;  2KJX A;  3ULJ A;  4B3T L;  1EWH A;  1KDB A;  2EYM A;  4XDX A;  4DKA C;  1JE5 A;  1SRO A;  3E9H A;  4A3G H;  1QOH A;  1HNW Q;  1EY0 A;  1JT8 A;  1EEF D;  3HKZ E;  1DCZ A;  1VDZ A;  2QW7 A;  1MD2 D;  4LUV A;  3A56 A;  1YNX A;  2Z6K A;  1PFM A;  2PW7 A;  3T1Y L;  3IAY A;  3PUW A;  1WTW A;  4FF3 A;  3OHX C;  3CCL A;  5DM7 3;  3MA2 B;  3NEL A;  1STN A;  1PRT F;  4ZRZ A;  3OOC A;  3MTS A;  2F0J A;  1PH6 A;  2VY3 A;  3K59 A;  4C3H G;  3W2D A;  1I3Q H;  2I0Q A;  3J7A 5;  1S5E D;  3FMC A;  4O2D A;  3S14 B;  4IPD A;  1Y14 B;  5BR8 L;  4OO1 H;  2TMP A;  1JIC A;  1PZK D;  3CPF A;  5G3L D;  5JOB A;  2A69 D;  3MEH A;  4KKS A;  2F4V Q;  4IUV A;  3WWV A;  3D4D A;  3CCR A;  1EUJ A;  2L12 A;  2UUA Q;  1GUS A;  4DR2 L;  2B39 A;  1GUN A;  2UUC L;  3K0Y A;  5M9O A;  1J5E L;  3S2D H;  3H6M A;  1H9M A;  5FO9 B;  1OTC A;  3VR4 A;  1D8L A;  1HH2 P;  5EPJ A;  3JAM L;  3I91 A;  4B3M L;  4V19 0;  3PIO A;  4LK1 C;  1B3Q A;  1F2L A;  2KCM A;  2Q8R E;  4QF4 A;  5K36 G;  4G57 A;  4RGN A;  2K5W A;  1J8I A;  5CR3 A;  1F9R A;  4K0K L;  3DLL A;  4HJA A;  1LTR D;  3I73 A;  3S1R B;  1G8Z D;  1VF7 A;  1Q3L A;  1GUO A;  1SN8 A;  2PMZ E;  3J7Y W;  1T5X D;  1V1Q A;  1J6Q A;  1SJH D;  2ZM6 Q;  2H5X A;  2Y0S B;  3A5U A;  4DV2 Q;  5F2D A;  4A3K B;  3X3N A;  3KOJ A;  2F0N A;  1JR0 D;  4L63 B;  5NUC A;  1PH8 A;  4LJZ C;  3MFG A;  3K0X A;  4BY1 B;  5FK9 C;  5C5M A;  1IBM Q;  4C3J B;  2G9H D;  1ET6 A;  3J80 E;  3OTO L;  2CH4 W;  4A75 A;  4GN4 B;  1PRT D;  2X6L A;  4UY8 C;  1N8R C;  3HEJ A;  1VQJ A;  4RMF A;  4IUT A;  2PYK A;  5C5L A;  2JA7 G;  3ERS X;  1B8A A;  3OYY A;  4DGZ A;  4CDE C;  3K7A B;  4QQB X;  1OO9 B;  5C3E H;  2F0U A;  2F0T A;  4DV6 L;  2R7Z H;  3M7N A;  1VQH A;  1AZP A;  1HZB A;  2K52 A;  1RTN A;  1SE8 A;  4F87 A;  4DUY L;  4GNX A;  4ZKB B;  1NSN S;  3U4V A;  2LSS A;  2WAC A;  1V1O A;  4J1M A;  3S1N B;  1K8M A;  5IWA L;  3TRZ A;  1TVX A;  1C0A A;  2HCI A;  2LFN A;  1UUP A;  5A2Q E;  4K5W A;  1FYC A;  2BDO A;  1I94 Q;  4O42 A;  1GKH A;  3GTM H;  4MNO A;  4KD3 A;  2V4D A;  2NVQ B;  4B3T Q;  4JCV E;  1NUC A;  4H13 C;  1XX8 A;  1PTO B;  2Z6K C;  1B3A A;  3HOZ G;  4O1N A;  1GOZ A;  4PQX A;  4MTK A;  4DU9 A;  2KEC A;  4FDB A;  3T1Y Q;  1VQG A;  4HSP A;  2WAQ B;  3IFD A;  5GAD C;  4GNX B;  4HIO A;  3H3V H;  2NYZ D;  1S72 A;  1VQC A;  4RGT A;  2PI2 A;  2E2I H;  4TQU S;  4GS3 A;  2P5Z X;  3GTJ H;  3HFZ B;  1YJ9 A;  1LO5 D;  1NTG A;  1VQ8 A;  1BCP D;  2SNS A;  4KY5 A;  1SMY C;  2KHS A;  3W1G A;  5KGU A;  4UDU C;  1SXT A;  4A3B G;  4V0B A;  1WFQ A;  1LTG D;  3D4R A;  1SDF A;  3N6R A;  1JOO A;  2PQA A;  4DR2 Q;  1Q90 A;  3LWE A;  3F1Z A;  5FLM G;  1YVC A;  2UUC Q;  4A3J H;  2VNU D;  1J5E Q;  2XWJ B;  3TN2 A;  3ZJY C;  4X62 L;  1KXL A;  1SAP A;  3VR6 A;  4A76 A;  2R93 H;  4JI8 Q;  4DV1 L;  4XT1 B;  4KN4 C;  1WTH A;  2RQX A;  3F2D A;  2A68 C;  4BBR B;  2F0W A;  3HZX A;  4B3M Q;  4HJ8 A;  1G91 A;  1V8Q A;  2Y0S E;  1TWA H;  4A3D B;  4KHP L;  3TEH B;  2WKC A;  5CGK A;  1IHZ A;  4DR5 L;  4RG1 A;  4RKL A;  5AFW A;  3M4P A;  4PNY A;  1UE6 A;  2BDN A;  4K0K Q;  3CC2 A;  3CCV A;  2PQA B;  2IHE A;  4YCV A;  4B9X A;  4A3E B;  2WII B;  3MAQ A;  4B3S L;  2J0T D;  3PMF A;  1K9M C;  4A93 B;  4PZ8 A;  4KD4 A;  3BYY B;  1PH4 A;  4HCS A;  3PSI A;  2HT1 A;  1QIL A;  1UE1 A;  2RBM A;  3TZD A;  4BA1 I;  1KDC A;  3CAM A;  3M4Y A;  1HQR D;  2B2Y A;  2CCZ A;  2E2J H;  1PTO C;  1UNS A;  1RTO A;  3OTO Q;  1PH5 A;  4JG2 A;  1V43 A;  1U4L A;  4XQQ A;  1CM9 A;  1YNJ D;  3HOU G;  4JI6 L;  4KK7 A;  3PUX A;  4DV6 Q;  4GNX C;  4KHZ A;  5I2Y A;  1AE2 A;  1HJP A;  1VQ9 A;  4BA2 I;  3CC4 A;  3HOV B;  5FLX L;  2EYJ A;  4RA8 A;  3UDG A;  3GTG H;  1ZXT A;  5E1F A;  3S15 B;  5C3E G;  4DUY Q;  1X3Q A;  2JA6 B;  5DM6 3;  3M7G A;  5IWA Q;  1X3P A;  2EY6 A;  4ZAI A;  5IGG A;  4G7Z C;  1AP0 A;  2WAQ E;  2ZJR A;  2B63 B;  4QCL A;  3NQT A;  3ND9 A;  1SE2 A;  3KFU A;  1XPU A;  4RWS C;  3RD4 A;  3KDF A;  1BQQ T;  3I3C A;  5M5W B;  3OIP A;  1H95 A;  3DMU A;  3CF5 A;  1KD1 C;  1F9Q A;  1UE7 A;  2IL8 A;  3F2C A;  1IBK L;  2F0S A;  2JN4 A;  2OCE A;  1ILQ A;  4HMI A;  1A2U A;  4YCW A;  2RF4 A;  1I50 H;  3CRL C;  2N8N A;  2V1C C;  2WB1 G;  1C7Y A;  1KRS A;  4Q5V A;  3TZU A;  3A8J E;  3OWE B;  3PIO 3;  1A6X A;  1F2Z A;  4KHV A;  3STB D;  4JI3 L;  5A35 A;  3GTQ H;  3GTO B;  4Y7N B;  4LAA A;  3T53 B;  2NB0 A;  3K5N A;  3BS1 A;  3S2H H;  3CQZ H;  5KYL A;  1OXV A;  2PI2 E;  1PH3 A;  4JI7 L;  2EYL A;  3B6Y A;  3Q24 A;  3E5S A;  1RD9 D;  3E3X A;  4C2M B;  1W6K A;  1PMR A;  5C4H A;  3ZYY X;  4B3R L;  2L9H A;  4LMQ D;  1IBL L;  2ZTC A;  1SYC A;  4A3M B;  5CV4 A;  3S1Q H;  1E22 A;  1SLJ A;  4DN4 M;  1XMO L;  2WP8 J;  4X62 Q;  2VS1 A;  3VYR A;  4A3C H;  5KNB A;  1KTK A;  4C56 C;  4DK1 A;  2L15 A;  1TY2 A;  4DV1 Q;  2UU9 L;  2D62 A;  1UE5 A;  3I4M G;  3HOW B;  3HOX H;  5COR A;  4KHP Q;  2I5L X;  2E2H H;  1TU2 B;  3NTK A;  3TSS A;  4G7O C;  2PZW A;  4DR5 Q;  4KJN A;  1GHJ A;  2KVM A;  3NUC A;  1JB7 A;  2YTV A;  3VYS A;  3G4S A;  1SFO B;  4X3U A;  2JA5 G;  2AKW B;  3NHH A;  5CV6 A;  2JP1 A;  3C2P A;  3IKJ A;  3GTL H;  2RDF A;  4B3S Q;  1RHP A;  2AQ3 B;  3GV3 A;  3U9S A;  4DAP A;  1XXG A;  2JE6 I;  2B2Y C;  1EQT A;  3RUZ A;  4U68 A;  4UP9 A;  1DGS A;  3CC7 A;  1YHQ A;  1VQ6 A;  1A2T A;  1M1K C;  3G6J B;  3PIP A;  3V2T A;  2PQE A;  1ENF A;  2EY1 A;  4BY7 H;  4LFC L;  5HGT A;  5I6W A;  3GTK H;  2OQK A;  1L1O A;  1KAW A;  5GAE C;  3JAM E;  1EOT A;  4Q0F A;  3U9O A;  1BBW A;  1O78 A;  2DN8 A;  4JI6 Q;  1R9T H;  3QWN A;  1WVL A;  3MHB A;  2JA8 H;  2FIN B;  4TVA B;  5M3M G;  1EIY B;  1STE A;  1B7Y B;  1EY9 A;  2HQE A;  3NP8 A;  2O5J C;  3HGB A;  4JBM A;  4A3F H;  2K05 A;  3BG3 A;  4BS9 A;  3AFQ A;  1GHK A;  3URY A;  4LFB L;  2ZJP A;  4DUZ L;  1E2W A;  2NVT B;  1CTM A;  4BBS B;  1VQE A;  1KIX A;  2XRS D;  1XJV A;  3I56 A;  3OWF A;  5FKA C;  1PTO F;  3UI2 A;  3OSO A;  1L1O B;  3BYT B;  4KTA A;  5KND A;  1UEA B;  1JJC B;  3CCE A;  2BCO A;  4IFD I;  4ID6 A;  1XPO A;  3M4O H;  5M5X H;  1S5C D;  3SGI A;  1SNP A;  3K57 A;  5KEE A;  1EOV A;  1TWH H;  4J8Q A;  5IYD G;  1EYG A;  1VMC A;  2HQL A;  4KY6 A;  3TS0 A;  2RSO A;  5LHY 1;  3G48 A;  1JOK A;  3BVZ A;  4BXX H;  3U50 C;  1K3R A;  3NBH A;  1SMY D;  4RHS A;  2QEX A;  4H02 A;  1HA6 A;  3OIQ A;  1ESR A;  2K04 A;  4JI3 Q;  4GN3 B;  2OF1 A;  1Y1V H;  1Z7T A;  1BO0 A;  2Z4I A;  3M3Y B;  1G2T A;  1I6H B;  4PZ7 A;  4OIK A;  2B2T A;  1XYI A;  4JI7 Q;  2WV6 D;  5IT9 L;  1RF2 D;  2F3W A;  4IOC A; 
#chains in the Genus database with same CATH homology
 1W3S A;  1M90 C;  1I3Q H;  2I0Q A;  3J7A 5;  3K7A H;  4LFA L;  4O2D A;  4B3R Q;  1PYB A;  4IPD A;  4NXN L;  1Y14 B;  5BR8 L;  5IE8 A;  1SMX A;  2I5H A;  2DGY A;  4R4T A;  3CPF A;  3GD7 A;  5GAH C;  1IBL Q;  4DR1 Q;  3RLO A;  3HOV H;  4QIW E;  2NZH A;  3RZO H;  2GVB A;  2F4V Q;  2Z0S A;  1XMO Q;  4QGU A;  4BA2 I;  3S15 H;  4GKK Q;  3WWV A;  4A3J G;  2LXK A;  3NBH B;  4JC0 A;  2OQ0 A;  1EUJ A;  3CCR A;  1PA6 A;  2VW9 A;  1YBY A;  1TWF H;  2JA6 H;  2ID0 A;  4OWX B;  3ULL A;  2UUA Q;  4DR2 L;  2UU9 Q;  1TWC H;  5GAG C;  4DV0 Q;  3D31 A;  2FXQ A;  1G29 1;  2UUC L;  2R93 G;  2AWN A;  1J5E L;  2KHI A;  3S2D H;  1PH2 A;  4IJH A;  2B63 H;  4HJ9 A;  4JV5 L;  4YWL A;  3UDX A;  5IP9 G;  1EQQ A;  1YJN A;  2WB1 E;  4O0A A;  5M5W H;  3HOX G;  3UDI A;  5LMN Q;  3I4M H;  1OTC A;  5FJ8 G;  1D8L A;  1HH2 P;  5M3F G;  4X64 Q;  3CXC A;  2K50 A;  4B3M L;  3M85 A;  4X65 Q;  5FLX c;  1HNX Q;  1BVS A;  2CFM A;  1XTD A;  2IHF A;  3PGZ A;  5JEA G;  3PIO A;  1XMQ Q;  4DPG A;  2KCM A;  4IO9 A;  4JYA L;  4PMW A;  2UUB L;  5K36 G;  5JJK A;  5IYC H;  2ASB A;  2KCT A;  1FGU A;  4XTC S;  1X56 A;  4K0K L;  5IP7 H;  3DLL A;  5AJ3 L;  4HJA A;  5JJI A;  3CW2 C;  2UXD Q;  2JA5 H;  1VQ7 A;  2ZTE A;  3J81 c;  4QJF A;  4HJ7 A;  2B29 A;  4DK3 C;  4DV5 L;  1L1O C;  2N49 A;  4QL5 A;  1XPR A;  3M7N A;  1A63 A;  1NMG A;  1HR0 Q;  1SN8 A;  3GTO H;  2PMZ E;  1IYJ B;  4Y7N H;  4EX5 A;  2YYZ A;  3F8T A;  2A8V A;  4YY3 Q;  4LFC Q;  4ALP A;  1W2B A;  2VQF L;  2MFI A;  2QA4 A;  3PF5 A;  1V1Q A;  1J6Q A;  3JAM i;  2ZM6 Q;  2H5X A;  2UXB L;  2E8G A;  1YJW A;  1N32 Q;  1E24 A;  3A5U A;  1O7I A;  4DV2 Q;  1N34 Q;  1NY4 A;  1UWV A;  3KOJ A;  3T1H L;  2C35 B;  4C2M H;  2YTX A;  4UPA A;  4GLA C;  1PH8 A;  1FL0 A;  1X54 A;  3K0X A;  3KF6 A;  2XGT A;  1N9W A;  3RNU A;  4A3M H;  3RLN A;  1IBM Q;  4EQ5 A;  1CSQ A;  1A62 A;  3OTO L;  4A75 A;  4GN4 B;  4OXP A;  4LUZ A;  3RLF A;  1L0W A;  4UY8 C;  1N8R C;  3J81 j;  1VQJ A;  2JA8 G;  1SRU A;  4RMF A;  3ULP A;  1PH7 A;  2K75 A;  2JA7 G;  3DM3 A;  3ERS X;  1B8A A;  3OYY A;  5M3M H;  2Q2T A;  4QQB X;  4DUZ Q;  2CWA A;  3I4O A;  1A8V A;  5C3E H;  1E1T A;  4JBW A;  3MEF A;  4ME3 A;  4NB3 A;  4X66 L;  2VQE L;  2VZA A;  1GO3 E;  4LF6 L;  1X3F A;  1VQH A;  4JBK A;  3GTP H;  3HOW H;  1HZB A;  2K52 A;  5C0X J;  4DR4 L;  3M9B A;  1KC8 C;  4JBJ A;  1SE8 A;  4GNX A;  4DUY L;  1S3O A;  1KQS A;  4DR6 L;  4JI5 L;  3EBE A;  4QY7 A;  3U4V A;  2LSS A;  2JEB I;  3UDF A;  4BBR G;  2QGQ A;  3H15 A;  1N33 L;  3CD6 A;  4OX9 L;  4AQY L;  3TRZ A;  3BZC A;  5IWA L;  1E7Z A;  1IL2 A;  1C0A A;  2IT1 A;  3K7U C;  1BKB A;  5LMU Q;  1IBK Q;  1AH9 A;  1U5K A;  2BA0 A;  3PO2 G;  1YHB A;  1UEB A;  1I94 Q;  1GKH A;  3GTM H;  4P73 A;  4MNO A;  1SFO H;  5J3B A;  4A4I A;  5M5Y H;  4DV3 L;  3KF6 B;  4DNI A;  4DV6 L;  3S1M H;  3K80 C;  1MKH A;  1N36 L;  4LF8 Q;  3S16 H;  1FJG L;  4GKJ Q;  2F52 A;  1E1O A;  5ELO A;  4B3T Q;  2VUM H;  5IY0 A;  4JCV E;  2JA9 A;  2Z6K C;  2UXC Q;  5IYD H;  3HOZ G;  4A3E G;  1OXX K;  1YZ6 A;  1KHI A;  4LF4 L;  1Z47 A;  4P75 A;  4IPH A;  2ZTD A;  2MO1 A;  1S40 A;  4JI2 L;  4A93 G;  2K5N A;  4FDB A;  4YHH Q;  3T1Y Q;  4A3K G;  4LF7 Q;  1X3G A;  1VQG A;  1PFS A;  1IZ6 A;  1VQN A;  3TS2 A;  1MJE A;  2RCN A;  1X6O A;  5GAD C;  4GNX B;  4HIO A;  1XNR Q;  3GO5 A;  3H3V H;  2F3I A;  1Q12 A;  4BY1 G;  2D0P A;  1S72 A;  1VQC A;  4A3I G;  1OXS C;  2PI2 A;  2E2I H;  3BU2 A;  4TQU S;  4GS3 A;  3K8A A;  5HGQ A;  2Q2I A;  3PV0 A;  4DK6 C;  4LFA Q;  3GTJ H;  3TRE A;  4NXN Q;  3HFZ B;  3KJO A;  1YJ9 A;  1VQ5 A;  1NTG A;  2JJQ A;  1VQ8 A;  1BBU A;  2OTL A;  1Y1W G;  3W1G A;  3AQQ A;  2MO0 A;  1ASZ A;  3PUY A;  3KDF B;  4OON A;  3STB C;  4A3B G;  4WJ4 A;  1WFQ A;  2DUD A;  2NVY H;  4L5R C;  2YTY A;  1K73 C;  1JMC A;  1YIJ A;  2RHS B;  1K8A C;  2PQA A;  4DR2 Q;  3F1Z A;  1VS0 A;  4P71 A;  3GDE A;  2NVT H;  5FLM G;  3M4Q A;  4A3C G;  1YVC A;  4C3I H;  4BBS H;  2UUC Q;  4A3J H;  2VNU D;  1J5E Q;  1CKN A;  4JV5 Q;  2D0O A;  3KF8 B;  3S24 A;  1Q1B A;  4R4I A;  3ZJY C;  4X62 L;  3UE0 A;  3IRB A;  1JJ2 A;  1WCM H;  1KXL A;  3NEM A;  3VDY A;  2E5L L;  2EXD A;  4UP8 A;  4A76 A;  2R93 H;  4JI8 Q;  4DV1 L;  1XNQ L;  2IX1 A;  1VQO A;  3F2D A;  2HIX A;  3E0E A;  4B3M Q;  4HJ8 A;  4JI1 L;  1B70 B;  2Y0S E;  1TWA H;  2NVX H;  4KHP L;  3TEH B;  3HOY H;  4JYA Q;  2UUB Q;  2KEN A;  4DR5 L;  4RG1 A;  5HY6 A;  4HID A;  4GOP A;  3M4P A;  5M3F H;  4IFD J;  3RR5 A;  3EIV A;  1UE6 A;  5H1S E;  4DR3 L;  4K0K Q;  1MIU A;  5AJ3 Q;  4NPS A;  5E7N A;  3OW2 A;  1Q86 C;  3CC2 A;  4DAY B;  2KBN A;  4DR7 L;  2A19 A;  3CCU A;  2WAQ G;  3H0G H;  5IYC G;  3CME A;  3CCV A;  1SR3 A;  2PQA B;  2XTI A;  4DV5 Q;  2IHE A;  4YCV A;  5IP7 G;  3CCQ A;  4JI0 L;  4B3S L;  1CUK A;  1K0R A;  4AYB G;  1CKN B;  2VQF Q;  4DV4 L;  1I6H H;  1K9M C;  4PZ8 A;  4LF5 L;  1VQA A;  1VQM A;  4BY7 G;  1PH4 A;  4POF A;  3PSI A;  2BA1 A;  1VCI A;  2PNH A;  3I55 A;  3T1H Q;  2HT1 A;  2R92 G;  1IXR A;  4IJL A;  1I5F A;  1UE1 A;  4BA1 I;  2HHH L;  3CAM A;  2CCZ A;  3I4N H;  3S14 H;  2JQO A;  1P16 A;  2E2J H;  4A3L G;  3PO3 G;  4HIK A;  3J80 i;  1VQK A;  4APV A;  4Y52 H;  3OTO Q;  4GOP B;  3BJU A;  4KLK A;  1PH5 A;  4JG2 A;  5IYB G;  1V43 A;  2A1A A;  2ATW A;  1HZC A;  4LFB Q;  4A3M G;  3RN2 A;  3HOU G;  3I7F A;  4JI6 L;  4A3F G;  1LTL A;  3FKI H;  3PUX A;  2VQE Q;  4DV6 Q;  4KHZ A;  4KI0 A;  4DV7 L;  4GNX C;  4X66 Q;  4LF6 Q;  1AE2 A;  1HJP A;  1VQP A;  1GD7 A;  1PH9 A;  4AH6 A;  3W1B A;  1VQ9 A;  3CC4 A;  3KYH C;  3UDG A;  1K83 H;  3GTG H;  2IX0 A;  5IT9 c;  4L5S A;  2JA7 H;  4HJ5 A;  2GVA A;  4JI4 L;  5C3E G;  4DUY Q;  4DR4 Q;  2B3G A;  3W5O A;  3G6E A;  4JI5 Q;  3NEN A;  4DR6 Q;  1N33 Q;  1X55 A;  2RHQ B;  4OX9 Q;  4LNQ A;  4AQY Q;  2CWP A;  2YV5 A;  5IWA Q;  4A3D G;  1YHA A;  3S17 H;  1Q1E A;  3A74 A;  3CCJ A;  4IPG A;  2WAQ E;  5C4X G;  2ZJR A;  3D0F A;  3L7Z C;  4GLX A;  4POG A;  3KFU A;  3ER0 A;  4DV3 Q;  4BY7 H;  1HZA A;  1WOC A;  1N36 Q;  3CP0 A;  4YCU A;  4AYB E;  3JC6 6;  3KDF A;  1XPU A;  1FJG Q;  5C44 H;  3PO2 H;  1H95 A;  4LF9 L;  4IOA A;  3CF5 A;  4HIM A;  1KD1 C;  1C9O A;  1UE7 A;  2K4K A;  5LMN W;  1Q8K A;  4BXX G;  3F2C A;  4A3G G;  5LMU L;  1IBK L;  1RL2 A;  2OCE A;  3FHW A;  3PUZ A;  4LF4 Q;  3Q8D A;  2YU9 H;  1U0L A;  3S1R H;  3PUV A;  1MJC A;  2CKZ B;  3L0O A;  4JI2 Q;  5JJL A;  4YCW A;  2RF4 A;  1I50 H;  3U4Z A;  4NXM L;  2N8N A;  1Y1V G;  2V1C C;  4LF8 L;  3HOZ H;  5EAY A;  1EQR A;  4IFD G;  1TWG H;  2WB1 G;  1C7Y A;  1KRS A;  1HNW L;  2R7Z H;  3PF4 A;  1NMF A;  3JAM c;  3E9I A;  4A3K H;  3STB D;  4JI3 L;  4OO1 I;  1PV4 A;  1HNZ L;  2ZJQ A;  3U58 A;  2KHJ A;  3GTQ H;  3UE1 A;  5BR8 Q;  1EIF A;  3CCS A;  1HR0 W;  5C4J H;  3S2H H;  4C3H H;  4BY1 H;  1G6P A;  1QUQ A;  4L5T A;  3CQZ H;  3HKS A;  1OXV A;  1G51 A;  2PI2 E;  4L5Q A;  4C3J H;  1PH3 A;  4JI7 L;  2BH2 A;  3B6Y A;  4OO1 G;  2K5H A;  1PYS B;  3CPW A;  3HOV G;  1WYD A;  1Q46 A;  4B3R L;  1Y1W H;  2MQH A;  4JOI A;  4MZ9 A;  1Q7Y C;  4WJ3 M;  3A5Z B;  1IBL L;  2ZTC A;  1QZG A;  2JA6 G;  5ELN A;  4DR1 L;  4A3B H;  3S1Q H;  1E22 A;  1SLJ A;  2F4V L;  2NN6 G;  4AIM A;  5C0X I;  4R1J A;  1XMO L;  4GKK L;  4IPC A;  2WP8 J;  4X62 Q;  2R7D A;  3RZD H;  2E5L Q;  4BBS G;  2B63 G;  2VS1 A;  1VQ4 A;  4A3C H;  5FLM H;  1CKO A;  2N78 A;  2UUA L;  3S1N H;  2L15 A;  4DV1 Q;  2UU9 L;  1XNQ Q;  4DV0 L;  5IP9 H;  2D62 A;  1WCM G;  1UE5 A;  1GM5 A;  3PCO B;  4GOP C;  5DLQ E;  4JI1 Q;  1WJJ A;  5C0X G;  2EIF A;  3HOX H;  3I4M G;  2N3S A;  3LGJ A;  3KLW A;  3G71 A;  3RN5 A;  1T9H A;  5FJ8 H;  2I5L X;  2E2H H;  1QZH A;  4KHP Q;  1QUQ B;  1PVO A;  4DR5 Q;  2JK8 A;  2NVQ H;  1FVI A;  3EN2 A;  5LMN L;  1JB7 A;  4DR3 Q;  2R6G A;  4JI8 L;  3HOY G;  1JJG A;  2YTV A;  4X64 L;  3G4S A;  1YI2 A;  1Z9F A;  2AMC B;  4DR7 Q;  1HNX L;  4X65 L;  4LWC A;  1AE3 A;  1XMQ L;  2JA5 G;  2AKW B;  3GTL H;  4P74 A;  3M3Y H;  4JI0 Q;  2BH8 A;  4B3S Q;  2I5M X;  3H0G G;  4LUO A;  1Q81 C;  4DV4 Q;  2UXB Q;  5GRO A;  4MTN A;  4LF5 Q;  4YWK A;  2UXD L;  1EWI A;  4DAM A;  2JE6 I;  1CKM A;  2HIV A;  1LUZ A;  4R4Q A;  1LM0 A;  4UP9 A;  1DGS A;  3CC7 A;  1YHQ A;  1VQ6 A;  1M1K C;  4R4O A;  3PIP A;  1HR0 L;  1OXU A;  4PZ6 A;  1K8G A;  2HHH Q;  2R7F A;  1PH1 A;  4YY3 L;  4LFC L;  3KJP A;  4LW1 A;  1Q82 C;  4OWW B;  3GTK H;  2WFW A;  2OQK A;  1L1O A;  1KAW A;  1VQD A;  5GAE C;  3F2B A;  2IY5 B;  2ZM6 L;  1N32 L;  2R92 H;  4DV2 L;  3I4N G;  1D7Q A;  4YWM A;  1N34 L;  4XIG S;  1GVP A;  3HKZ G;  1HZ9 A;  1BBW A;  3I2Z A;  1QVG A;  2JEA I;  3CCM A;  2OTJ A;  1QVF A;  3AEV A;  4JI6 Q;  3PO3 H;  1L2F A;  4A3L H;  1R9T H;  2EQS A;  3A0J A;  1KL9 A;  1VQI A;  2GN5 A;  4DV7 Q;  2JA8 H;  3MXN B;  4TVA B;  5M3M G;  4J15 A;  5IYB H;  1IBM L;  1EIY B;  2R7Z G;  1B7Y B;  3HOU H;  3TQY A;  3K81 C;  4JBM A;  4JI4 Q;  2K14 A;  3FKI G;  1LYL A;  4A3F H;  1NJI C;  2Q2H A;  1EFW A;  3HOW G;  3AFQ A;  4PG3 A;  4UP7 A;  4R4C A;  2VL6 A;  3BZK A;  1KRT A;  2ZJP A;  1NE3 A;  4DUZ L;  3ICE A;  4LFB L;  2AWO A;  1VQE A;  1KIX A;  1QVC A;  4BBR H;  1X9N A;  2K5V A;  4GN5 A;  1XJV A;  2OWO A;  3I56 A;  5JEA J;  3J7Z C;  4A3D H;  4GLV B;  3CMA A;  1L1O B;  1X65 A;  1X3E A;  1JJC B;  1NBW A;  5C4X H;  4LF9 Q;  3CCE A;  4IFD I;  2AHO B;  1XPO A;  3M4O H;  5M5X H;  2Q2U A;  2ALY B;  3SGI A;  1CSP A;  2VUM G;  4OWT B;  2LXJ A;  1ASY A;  1I94 L;  1EOV A;  5GQO A;  5C44 G;  1TWH H;  2CQO A;  4P72 A;  5IYD G;  1EYG A;  1P8L A;  1PHJ A;  2NZO A;  2HQL A;  3TS0 A;  3H3V I;  4A3E H;  2MNA A;  1E3P A;  4GKJ L;  4NXM Q;  3AFP A;  3G48 A;  3ULJ A;  4B3T L;  4BXX H;  3U50 C;  3J81 i;  4DKA C;  1K3R A;  1VQF A;  4A3G H;  1JE5 A;  1SRO A;  3E9H A;  2QEX A;  4H02 A;  4A93 H;  1HNW Q;  3FP9 A;  2UXC L;  1A0I A;  1OXT A;  1VQL A;  1JT8 A;  3HKZ E;  1YIT A;  4JI3 Q;  4LUV A;  4GN3 B;  1HNZ Q;  1Y1V H;  1YNX A;  2Z6K A;  1V9P A;  1VQB A;  4YHH L;  3T1Y L;  2Y0S G;  4LF7 L;  3PUW A;  4A3I H;  3CCL A;  3L2P A;  4PZ7 A;  4X6A H;  1YEZ A;  3NEL A;  1XNR L;  2ES2 A;  4JI7 Q;  1WI5 A;  1RIP A;  1TXY A;  2NN6 I;  1PH6 A;  3J80 c;  2VY3 A;  4IOC A;  4JOI C;  3AYH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...