3NK9A

Crystal structure of staphylococcal nuclease variant delta+phs v74a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEAEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Nuclease A
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nk9A00
3OSOA 1EZ8A 4RKBA 1ENAA 3BDLA 1SYFA 2LKVA 4B9WA 5I6WA 1JOKA 1EYDA 2F0IA 2PZUA 4G57A 3NUCA 3MZ5A 4J1MA 4DF7A 2F0SA 4S3SA 3P1HA 2F0PA 3EVQA 1SYCA 3NXWA 4HMIA 1KDCA 4KHVA 2NUCA 4K2LA 4K6DA 3SK4A 4WORA 5C3XA 4F7XA 5CV5A 1A3VA 5IGBA 2EY2A 5JAVA 4ZUJA 2PZTA 1STGA 2RBMA 4K5WA 3SHLA 3SR1A 4E6IA 5C5LA 4WRDA 4KV6A 5I9PA 3NQTA 4DFAA 3VA5A 3SK5A 2PZWA 1F2YA 1STAA 4EQOA 4ZQ3A 1A3UA 5I9OA 2OF1A 5J22A 3NHHA 3V2TA 3P75A 2F3VA 4I65A 3DHQA 1A2TA 1AEXA 2RDFA 3OMCA 4J6HA 4NKLA 1II3A 4QB4A 1EY8A 3HEJA 5C4ZA 4EQNA 3QOJA 4KJNA 4RKLA 3ERQA 3PMFA 1STNA 3U9OA 2QDBA 1SYDA 2SOBA 2F0MA 1SYEA 5CV4A 1U9RA 3C1FA 5DEHA 5JOBA 2EYMA 4EVOA 5HURA 3T13A 1EY4A 5K5PA 3S9WA 1SNQA 3MEHA 4TRDA 4K5VA 2EY5A 1RKNA 2F0KA 5IODA 2M00A 5KIXA 1TQOA 2F0TA 3OMGA 5C3WA 2F3WA 5EKLA 4DU9A 5CV9A 5KYIA 5J1ZA 1ENCA 4K8JA 5ISRA 5F2DA 3OWFA 1STHA 3R3OA 4K8IA 5M9OA 2ENBA 5KEEA 4HTHA 1F2MA 2OEOA 2F0GA 5IIFA 1SYGA 1EYCA 1TR5A 2F0JA 2F0QA 1A3TA 4IZ8A 3TP8A 1SNMA 2EYHA 4K14A 3TMEA 4EQPA 3MHBA 3TP6A 5KGUA 2F0WA 2PW7A 5KRUA 1EY5A 2EXZA 1STYA 2WACA 4IALA 4N9PA 4NMZA 5HGTA 5CV8A 3TP5A 3LX0A 5E1FA 2F0VA 4KTAA 2F0DA 1SNCA 4B9XA 5CGKA 1EZ6A 4LAAA 4K5XA 4KD3A 1SNDA 2EYJA 2KQ3A 4KY6A 1KDAA 5CV6A 4QMGA 1EQVA 5EGTA 4K2KA 4KD4A 5IOCA 4DGZA 3E5SA 2EYLA 1EYAA 4NDXA 1JORA 2F0FA 2PYKA 5IGGA 2F0UA 5IGFA 2O4XA 3QB3A 4KY7A 2F0OA 1F2ZA 4MIUA 5E3FA 5EKKA 2F0LA 2KHSA 3D6CA 3NP8A 4PMBA 2SNMA 5IGDA 2PW5A 2EYFA 2PQEA 2HQEA 3H6MA 3T16A 4R8NA 2EYOA 3EROA 3HZXA 5CV7A 4IUNA 4ODGA 3D8GA 3ITPA 4ME5A 1A2UA 1EY6A 4HMJA 1NSNS 3EJIA 3D4WA 3NK9A 3SXHA 5CC4A 5CR3A 3QOLA 4PNYA 4YIJA 4PMCA 4OL7A 3RUZA 3C1EA 2SNSA 5C5MA 3MXPA 4ZUIA 4H7BA 4F8MA 5KYLA 1SYBA 2F0NA 2OXPA 1JOOA 1SNPA 1SNOA 3BDCA 1EY9A 5I6YA 1KAAA 1EY7A 5IGEA 1KDBA 5NUCA 2EY6A 1NUCA 1STBA 5DAUA 2F0EA 2RKSA 3SK6A 1IHZA 5IGCA 4ID6A 3DMUA 2EYPA 5J39A 4N9TA 3TP7A 1EY0A 1TT2A 3D4DA 4QF4A 3SK8A 1JOQA 4NP5A 2F0HA 3MVVA 4KJOA 1KABA 5C4HA 4KY5A 5C6AA 2EY1A
chains in the Genus database with same CATH superfamily
2B29A 4C56C 1JOKA 5D14A 3MEFA 1D7QA 2XIWA 4WJ4A 2AHOB 1C7YA 4HJAA 3VYRA 1CKMA 2VS1A 4DV7L 1Q1BA 4WORA 4QL5A 1HNZQ 4RAUC 4IUPA 1J6QA 1JMCA 3UI2A 4GNXB 1PYWD 3NHHA 3V2TA 1PTOC 2R7DA 4WRDA 4R4QA 4QB4A 5D3DA 2IW3A 2NN6H 3JAMi 3RMHA 4EQNA 1X56A 2IHFA 1STNA 5C44G 1X3QA 2EYMA 2Z4IA 2DUDA 4O2DA 2WB1B 2F0KA 3CQZB 3S14B 1JB7A 2EXDA 4A3GH 1X54A 1AE2A 5LMUL 1PLFA 2JSOA 4C1NI 1LTAD 2NVQH 2B2TA 1V1OA 3CCRA 2ES2A 1S5BD 3D31A 1FJGQ 4HCEA 2EYHA 5HGTA 5EKIA 3HGBA 2L0CA 3NTKA 3H0GG 5KNBA 3M4PA 4UDUC 1HQRD 1XX8A 2K52A 1AZQA 1U0LA 1XTCD 3NELA 2VB2X 3J80i 3GTQH 1BBUA 1JCKB 4KD4A 1QB5D 1MSHA 4KI0A 3M4OB 4B3RQ 4JI6L 1D8LA 1HZCA 1GD7A 3CKIB 4KY7A 3RNUA 4P74A 4IFDI 3NPPA 5EKKA 3GTOH 3K0XA 4LF7Q 3CCQA 1CM9A 1DOMA 1Z6HA 3IL8A 3C2PA 2K03A 3HOZH 1SSOA 1X32A 1Z7TA 3M7GA 3I4NG 4X66Q 3HZXA 1VQLA 4L5SA 2E74C 4A3IB 3QO2A 1EUJA 1I6VC 4C2MH 2Q8RE 2SNSA 1NJIC 1SYBA 2OXPA 1ASYA 4U673 1SNPA 2ATWA 3HOWG 1KAAA 4DV1L 2VL6A 1H9SB 1GUWA 3L9AX 4C3HG 2FMCA 1YNXA 4POGA 4QF4A 2O5IC 1HXYD 1LACA 4NP5A 4C3IB 1VQOA 4C3JB 3D4DA 2B2WA 4H0LC 1C9OA 3S2DB 3BDLA 3T53B 1UNSA 5IP7G 1EYDA 2F0IA 2E2IB 1QJOA 5G3LD 4LF8Q 3T1HQ 1X3GA 1CHQD 3SK4A 4LFCL 1Q46A 4F7XA 4UHVA 5C0XG 5IP9G 4ZUJA 3JAME 1WTOA 5M3FG 4DV4Q 3LNNA 3ZYYX 4DV6L 1H95A 2LFNA 3CCUA 3QWNA 1GVPA 1EU3A 2R93B 4NKLA 5HGQA 1MBYA 4Y7NH 2K50A 4DK6C 5KRUA 1SFOB 3C1FA 1IKLA 3DEPA 4V0BA 1D6EC 1EEFD 2XTIA 3DM3A 1Y69U 1ENFA 1BDOA 3NBIA 2R7ZB 2NVXH 3TBIB 2IX3A 2F3IA 5C3EG 5ELBA 2F0GA 1HNXQ 3J80E 3D4RA 4TSSA 2F0WA 3CXCA 1LTGD 1ILPA 1G6PA 1PV4A 2Z6KA 5CGKA 4AQYL 2KQ3A 1VQ5A 4X3KA 4JCVE 1EYAA 2ZJRA 1S5FD 1S3OA 3CCSA 4FNFA 4A3FB 3FMCA 2MNAA 1BBXC 4QUFA 1FVIA 2E5LQ 1WOCA 2H5XA 1WCMB 2F0LA 5M5WB 3J7YW 4AH6A 3Q22A 4A3BG 2V4DA 4BY7B 1I6HB 2WB1G 2NWGA 2JN4A 3R2IA 3BU2A 3F2CA 4IO9A 4P2CB 4Y52H 1XMQL 3HOXB 3AYHB 1TU2B 2OQKA 3HKSA 2QEJC 5I2YA 3SE0A 5CORA 1K3BC 2MP1A 4O1NA 5J39A 4GLXA 1OXUA 1V1PA 2F0HA 4BBRH 3NSWA 2UXDL 2QDLA 2F03A 2HIXA 3HOVB 1I94L 3OSOA 1OXTA 4CDDC 1K3RA 4JVZA 1Z9FA 3NUCA 3K58A 2HD3A 1Y1WB 2HT1A 1PH5A 1A8VA 3M9BA 4IFDG 4L5QA 1XTDA 3PUXA 5CV5A 3VR3A 3MXNB 3S1QB 1O80A 1JJ2A 4DR3L 3JAMc 4DAPA 2B2VC 5JVG3 1DXMA 3MWYW 4X65Q 1X6OA 3OMCA 3OWEB 1XMOL 1GHKA 2IT1A 1SMYD 3G6JB 3HEJA 5M5XH 4A3IG 1X65A 1B8AA 3C46A 1B9NA 2MHVA 4IOAA 3T13A 2YTXA 4DV2Q 3MEHA 4K5VA 4RCNA 5IODA 1K28A 1HJPA 2M00A 4DU9A 1E0BA 1ENCA 3D6WA 4K8IA 2A69D 5IYBG 2UXBL 4DR7Q 4C3IG 2Z0SA 1XPOA 1YNNC 1Y14B 4EQPA 4RGMA 5KGUA 1N9WA 4A3GG 5CMDA 1LUZA 3J80c 2I5MX 5A2QL 4LW1A 2P5ZX 4DR2L 4GKJL 2EVBA 1IBLL 3UDIA 4JG2A 1YJWA 4B3MQ 1VDZA 2K6AA 5EGTA 2PQAA 3HS0C 1HHVA 2EYLA 3GTJB 2F4VL 3M3YH 1SROA 5KNCA 1N33L 3S15B 3CCLA 1B4OA 2F0OA 1F2ZA 2CH4W 2R93G 1G6ZA 2KOLA 2FHTA 2SNMA 2DY8A 2JA9A 4CDEC 5GADC 2RCNA 2Z1CA 4ODGA 3D8GA 3VR4A 1CQVA 2UUAL 3AEVA 3L7ZC 2SDFA 1XNRQ 3HOZG 4FVMA 1Q86C 5E7NA 3MXPA 4UP7A 1TWHH 4JI3Q 4WJ3M 1QUQB 4YY3L 5IWAQ 3J7A5 1SNOA 2I07B 5DAUA 4O42A 3K8AA 5LL6S 2H1EA 1IL2A 5GAGC 1GOZA 2WAQE 3W1GA 2D0OA 2DGYA 4X64L 2A68C 3BVMA 5AFWA 5T1GA 5C4HA 4LF9L 2KHJA 4JPBW 3S1RH 3PUZA 2B2YC 1HRJA 4LF6L 1SJED 2OT2A 2XWBB 1KRSA 4A3FG 4JOIC 2MPMA 4DKAC 1WCMG 1KDCA 2ZXOA 1M90C 1U4MA 3GTPH 2BDNA 1S4ZA 4NXNQ 1RIPA 1A0IA 4ZKBB 4BY7G 1MHWC 3F2BA 3I4MH 4OONA 1WD0A 2Y0SG 5C0XJ 3T4AC 1KHIA 3BZCA 1KTKA 2RDFA 1PHJA 1K8AC 2QF7A 3QOJA 4YHHQ 3TDQA 3ERQA 1RTOA 3U9OA 3CU7A 1SYDA 3RN5A 1LLRD 3HOXG 1EIGA 1I5FA 1SNQA 1VCIA 3OHXC 3DM1A 5LMUQ 2JA5H 1EIYB 2K5QA 4YCVA 4K8JA 1IYUA 4JI0L 4G4KA 1TWGH 1KIXA 1K8GA 2JE6I 3HOVG 1SNMA 3I2ZA 4HIOA 3T1YL 2E2HH 2RSOA 4X62L 1Y1WG 4OX9Q 1UE6A 1NY4A 2ZM6L 1SNCA 2K75A 4B9XA 1HFNA 2VXWA 1CTMA 2B2UA 4CKCA 4JI4L 1U4LA 2A73B 1CKOA 1SR3A 1EQVA 1SE2A 4IUVA 2NVYB 2B8FA 2EZVA 2RF4A 1O7YA 1BQQT 5JPMC 4GN4B 2QKIC 5IYCH 1VQ6A 5EBCA 2AQ2B 2PCFB 3QIAA 3ULPA 3Q8DA 3AQQA 2BE5C 3EQLC 4KMUC 5D3IB 1HA5A 3K5OA 1YZ6A 1TXYA 2L15A 3U50C 5IYDH 3KDFA 5JEAH 2CQOA 3CHBD 2R3ZA 5CV7A 2MO1A 1E2ZA 2A5HA 2EJMA 1EFID 1SE8A 3BVGA 3D4WA 4IJLA 4HJ7A 3QOLA 3JAML 1D1IA 3U4ZA 2HDLA 2CHBD 1S5ED 3G71A 4UY8C 3I4MB 4K6LA 5I6YA 3PO3H 4AYBB 3SVMA 1GJXA 1FNUA 2PMZE 2UUBQ 4NXMQ 1RCVD 1IHZA 1YNJC 1SDFA 2QCPX 3DEOA 3KJPA 3GTGH 1MSGA 2UU9L 5FO9B 4FF2A 4K0KL 1FD7D 1L0YB 4PZ8A 1K83H 4RKBA 3PSIA 2FXQA 3KLSA 4QGUA 4JI5Q 1F9SA 3C3LA 3ND8A 4HR7B 1I50H 3U58A 1WTPA 2B8GA 3SDZA 3NXWA 4RMFA 5LMNW 2K32A 3J80L 5JAVA 4DR4L 3HOUB 1L0WA 4DFAA 2AQ3B 3VR5A 4IFDJ 3IRBA 3CCEA 2XNAC 4A3JB 1YI2A 4HN7A 3ND9A 1A2TA 3K0YA 1II3A 3I4OA 2G9DA 2SOBA 5CV4A 5LMNQ 1V43A 3A54A 3PV0A 3S9WA 5KIXA 3WOFA 1I3QH 2F3WA 1E7ZA 3GD7A 4R8IA 1CT1D 2NZ1D 5M3MB 1XXGA 1GO3E 3PF5A 1D2BA 3MXUA 1PTOD 2AUJD 2QA4A 1XNQQ 3I72A 1DONA 3LX0A 3N52A 4AQYQ 1BF4A 4DR1L 2B63B 4JBWA 1LTID 1N8RC 3I4NB 4B3SQ 2BH2A 5GROA 3NENA 1YHBA 2F0FA 4B08A 4CHTB 3VYUA 3HOYH 1L1OA 1Y1VH 2ICEC 4HAEA 3NP8A 5IGDA 2Q2UA 1CZWA 2J0TD 5BN3A 1KLGD 2BOSA 1TY2A 3KF6A 4GLVB 1Z47A 3CP0A 2YTYA 3EJIA 4QUCA 1PH7A 3NK9A 1W2BA 4ME3A 3RUZA 1QWYA 1Y8NB 2K4KA 2NZHA 4HSPA 4JI1L 1N36Q 4GZYC 1STBA 2QILA 3MFYA 3F1ZA 4HJ5A 1ESFA 5JPNC 3CCMA 2HDMA 4ABNA 4IQZA 3HRZC 1TT2A 1UEBA 2MUYA 1K9MC 5M5YB 2WB1E 4L6TB 4YCWA 1I94Q 4DUYL 4DV5L 1CI3M 4RHSA 1HUMA 3MZ5A 3A0JA 2NVTH 4DNTB 3PIOA 1KAWA 4DF7A 2JA6H 1G2TA 1N32L 4YWKA 3I56A 1ICWA 3SHLA 4DR3Q 3KLRA 2ZT9C 2A6EC 1F2YA 3K5MA 2F1MA 3I55A 2DNCA 1XMOQ 1SBBB 2J7ZA 1PH8A 1L0XB 2HIVA 2F4IA 1QNUA 1MD2D 3I4MG 4AYBG 1AFPA 3OMGA 4KHPL 3PO2H 1FNVA 2WIIB 1WTVA 1CQFA 1C0AA 1AN8A 2UXBQ 1H9JA 2IPKD 4HTHA 4L5RC 5C4JB 1A3TA 2N3SA 3J7AV 4K14A 4DV3L 1T5XD 4NB3A 3B6YA 4DN4M 1RF2D 4DR2Q 1WVLA 1I4PA 2IWHA 5FLXc 1PTOB 4JI7L 4XXEA 4A3BB 4IUQA 2K28A 4MTKA 1GUTA 4DGZA 2KJXA 3P20A 3CW2C 2F4VQ 4B3TL 3A55A 3HOUG 1HQMC 1N33Q 1JORA 1O7LA 2F0UA 2DNEA 1DOLA 1GUGA 4ZKCB 4A93H 4A3JG 2RSNA 2XWJB 2A6HC 2E2JH 2JA8H 3FPPA 1QG7A 3H6MA 1PYBA 3GO5A 3RZDH 1JT8A 3A5ZB 4OWTB 2RDHA 4IUNA 2UUAQ 1E1TA 4ME5A 1FR3A 3O13A 1VQNA 4PV1C 4GS3A 3BG3A 5CR3A 3R93A 4JI8L 5M3MG 2EIFA 3RZOB 3RD4A 3CC4A 1JOOA 4F88A 1E24A 1IYJB 5I4DA 2GA4B 1QVGA 3NWTA 4X64Q 3J81j 2AUKA 4MNOA 2OWOA 4JYAL 2B63G 1BOSA 4KY5A 4POFA 1CZGA 2HHHL 4LF6Q 2LKVA 5I6WA 4P73A 4YCUA 2I46A 3GQBA 4DUZQ 1AH9A 1YJNA 4GNXA 4ALPA 2IHEA 2OTJA 4DAYB 4KKTA 1HPCA 3U4VA 1ILQA 5IT9E 4LK1C 2RBMA 4R4TA 1CKNB 3VA5A 1YITA 2NN6I 1O78A 3TZUA 1KLUD 4WFN3 4DR5L 1LYLA 4CKEA 3WWVA 3M4YA 4P75A 1AEXA 2EOTA 1OTCA 1STEA 3LWUA 1SLJA 2KCNA 1O7IA 2M9VA 3KK7A 1PZID 2UUCL 5DEHA 5C4XH 2KHIA 2F0MA 4A3GB 1F9PA 2HUGA 2CKZB 1HZ9A 1UE1A 2NVQB 1HFGA 4GN5A 1BCPC 4JI0Q 4MTNA 2E76C 5F2DA 1BCPB 4ZYSA 1ESRA 2KCCA 1EQQA 4XTCS 5IIFA 1TR5A 2F0JA 2F0QA 1PDQA 1MJEA 1LT6D 1T5EA 4RCOA 3T1YQ 2NTTA 4X62Q 2WACA 1YHQA 3MA2B 3GV6A 3GTQB 2ZM6Q 2HQLA 3A8IE 3PIP3 2ZXRA 2AWNA 1VQBA 4RGTA 4RHRA 1IW7C 5CV6A 5EAYA 2A1AA 1I4XA 5IOCA 4HSVA 1W6JA 3WDNA 3PF4A 1T9HA 1YVCA 3V96A 2ALYB 5IGGA 3GTOB 1VQDA 1YNND 2PPBC 1PH2A 3HOZB 2L4NA 1BNZA 2K5HA 4A3MH 3BS1A 3K7AH 2BH8A 1RODA 1EIFA 4JBKA 2MO0A 3E3XA 1H9SA 1UEAB 4LF4L 2R92H 1I4HA 1NCVA 1VMCA 4C2MB 5FLMH 1OXVA 3PGZA 2LY7A 4A76A 4PMCA 3KJOA 2IY5B 4H7BA 1JB3A 4Z9CB 4RGOS 1VQPA 5ELCA 1VQGA 1TVXA 1B1ZA 3VYTA 2JA7H 2GVAA 1UWVA 1QZHA 2Q8TA 4CJ1B 1C4QA 4IOCA 1KXLA 4RGNA 4OIKA 4X6AH 1Q1EA 1IBMQ 4HIKA 5BR8L 1JQYD 4KJOA 5JJIA 3BYTB 2DN8A 2EY1A 4A3DH 2E2DC 1PZJD 1IYVA 2TSSA 1VQKA 2Y0SB 1I4RA 1D5ZC 3GTMH 1F77A 4MHEA 4DV0L 4DR6L 3RLOA 3X3NA 3GDEA 2JXMB 1K0RA 3A8JE 3Q6SA 4K2LA 4JV5Q 2A74C 4DR4Q 2VZAA 3TSSA 1CSPA 1ZEQX 5IT9c 2B39A 4Y7NB 1VS0A 4A3CH 2A68D 3H09A 1JC7A 1K8MA 4M1UB 1W3SA 1YBYA 1EY8A 3CCJA 1R9TH 4KKSA 3S16H 1NR4A 1IBKL 1QVFA 3TQYA 3GV3A 3T56B 2NVXB 1RKNA 3HP3A 1FL0A 1BUVT 1IZ6A 4ZCKA 4QY7A 5K36H 5KEEA 1BXTA 1JWMD 1NMFA 3M85A 3MHBA 4BBSH 2EXZA 1B2TA 1OO9B 1PZKD 1TWAH 2X6LA 4EQ5A 1DGSA 3FRPB 3PQIA 3R8BA 2I0QA 4KN4C 4XQNA 1BO0A 2KCMA 2V1CC 4CKBA 4Q5VA 1I4GA 5FOBB 2NN6G 1NTGA 2YTVA 2A19A 4RG1A 3CMAA 4G7HC 4OIJA 1GM5A 3J7ZC 4OHJA 2HQEA 5CBEE 2CFMA 3S17H 3ONAB 3TEHB 3CCVA 1MI2A 1GUSA 4A93G 2VQFQ 3Q0AA 3OTOL 1CSQA 3ITPA 1ET9A 4CJ0B 1VQ9A 2JA8G 1NBWA 1X3PA 3AU7A 1X9NA 4N8X1 1B50A 3EA6A 1E22A 3C1EA 5C5MA 1IL8A 3I70A 4ZUIA 1PMRA 1YEZA 4A3EH 2BE5D 3BDCA 4JI1Q 4QCLA 1AP0A 1FGUA 3WOEA 4L5TA 4BBRB 3E0EA 1QE6A 3HG9A 4ID6A 1E2VA 2AKWB 2R7FA 5C6AA 1Q12A 4KK7A 4DUYQ 4UPAA 2DJGC 3MXNA 1NNXA 1J8IA 2K5WA 4R4IA 1LTTD 1YJ9A 1N34Q 2VUMH 3PCOB 1TS4A 4KHVA 5KYLA 3J81c 1YNJD 5JJKA 3W5OA 4KKUA 1FJGL 2CW0C 5M5XB 3E0JA 5DM63 3FKIH 2H4OA 2J4XA 4LMQD 5AJ3L 1J9OA 1R4QB 1KC8C 3R2TA 5FJ8H 4GLAC 2D62A 3SGIA 5JOBA 1SYEA 1JICA 4EVOA 3KLSX 4KHPQ 5CBAE 5ELNA 3KOJA 3DWPA 2HCIA 1Y8OB 5G3LF 3AMUA 4DV7Q 5TSSA 5L37A 2B2UC 4UP8A 4B3RL 2VY3A 2G5DA 4DV3Q 2AQ1B 2GVBA 4ULLA 4GOPC 4LF7L 1UAPA 4GOPB 2EJGC 3AFQA 4X66L 4JI7Q 1ML0D 1EL0A 1SNDA 3BZKA 3M3YB 3M7NA 4FO2A 5ELEA 4B3TQ 3A7AB 1VF7A 4A4IA 3STBC 1K73C 2O4XA 4G7ZC 2E75C 3AFPA 3UDXA 1QVCA 3W2DA 2JEAI 4OWXB 2N8NA 1AZPA 2EPBA 1B70B 1QUQA 1U5KA 3KUPA 3TS0A 3EROA 4I7ZC 1JWUD 1V9PA 1TWHB 4JBJA 3NBHB 2WINB 1TS3A 5IT9L 3T1HL 2KBNA 1TWCH 2CVRA 2F0NA 4JI6Q 1EY9A 3K59A 3OW7A 1UE5A 4DV4L 1K8OA 1F9QA 1HA6A 1JR0D 1V1QA 3DMUA 3S1RB 2A8VA 4JYAQ 1WTWA 3MC0B 3MVVA 4J15A 4OXPA 4PMBA 2HHHQ 4LUOA 2JA7G 1ENAA 1HH2P 1DZ1A 1W6KA 4G7OC 3CRLC 1VF5C 3UE1A 3GTPB 2QGQA 4BXXH 3ERSX 1Q82C 4ZLTF 5LL6X 1G91A 4K6DA 1G2SA 3H0GH 3UDFA 2FJ2A 3A8KE 4P72A 4DV1Q 4LF5L 4LFAL 3SR1A 1HNXL 1RTNA 1DJRD 4EQOA 4XYOA 1B9MA 3CMEA 1GUNA 4BS9A 1MIUA 4DXGA 5C4ZA 5JJLA 1GKHA 1EQRA 2KEEA 2JA5B 1PH9A 1IXRA 4TRDA 1TWGB 1Q8IA 2IL8A 4BBRG 5KYIA 4LFCQ 3GTLH 2E2HB 2A6ED 1B53A 2AWOA 3MXGA 5D65A 1RJTA 1ZXTA 3QR8A 4DV6Q 2IJ0A 2Q2HA 1OXXK 1JOQA 3A56A 3VYSA 4NMZA 1KNAA 2SEBD 2OCEA 1EEID 1SJHD 4NW2A 4IJHA 3HOWH 2C5CA 1L1OC 1EZ6A 4FP5D 4KY6A 3S2HH 1PRTC 3I73A 4C3HH 4IPGA 3HKZB 1EOTA 1S5DD 4YWMA 1JWSD 5IGFA 1AW7A 2K5DA 1DOKA 4MIUA 5IP7H 1TWFH 3L3OC 1Q81C 4TQUS 3KF8B 2VQEL 4RA8A 2N49A 2OTLA 5FLXE 5CYUA 2GN5A 1WFQA 4XIGS 4LUZA 3T51B 4FXDA 5C0XH 5IP9H 5M3FH 4HMJA 1X3EA 3PO3B 4BA2I 4YIJA 3P7JA 4JI2L 3GTGB 1VQEA 4JBMA 3RLFA 3QG1A 2A6HD 1QNKA 1F9RA 3MAQA 3Q24A 4HIDA 1SN8A 2L12A 1KNEA 1JE4A 4DAVA 5IGCA 1K83B 3AB9A 1U4RA 3K5NA 2EYPA 4N9TA 1XPUA 5BR8Q 2R61A 2WFWA 1I50B 2YU9H 3PUWA 4BY1H 3I90A 2NZOA 5ELOA 3EIVA 4ZAIA 1G8ZD 3OYYA 4IPHA 5C3EH 1EYGA 1QZGA 4CDCC 2K1BA 3D3RA 2Q8IB 1WTHA 4DV2L 4DR6Q 2WV6D 3FHWA 4FYDA 4X3UA 1XMQQ 2NUCA 1SE4A 2L55A 1STGA 2BA0A 4DR7L 1RHPA 3U9SA 4XT3B 3KBGA 4DK1A 1STAA 1EIHA 4JC0A 4ZRZA 1NR2A 2UXDQ 3CD6A 1Q7YC 1I4QA 1I3QB 4RKLA 1JJCB 3IKJA 4X3SA 5JJZA 4B3ML 3FKIG 2EY5A 2D9UA 4X3TA 4FF3A 3OW2A 4CBVA 4IN3A 2ENBA 3CQZH 3S14H 1M1KC 1D5XC 3LGJA 4F87A 5C0XI 3TP6A 2PW7A 2RQXA 2F52A 2NYZD 4CDFC 5EJWA 1HTLD 2B2TC 2KENA 3VR6A 1S72A 4QMGA 3LWEA 1BCPD 4K2KA 1XNRL 3FP9A 1PYSB 3HOYB 5COYA 2C35B 1Y1VB 4O0AA 3G48A 4AIMA 2LS01 3S1MH 1TS5A 4PMWA 2C9OA 2TMPA 4OO1H 1ET6A 4QJFA 3K6OA 2KHSA 3M4OH 4OGQC 2L11A 1QOHA 2FINB 2JA5G 4PZ6A 1ZKOA 4R8NA 4IFDH 4GKJQ 2PNRC 3OTOQ 1IW7D 1IKMA 1IBLQ 2XGTA 1E2WA 1PH4A 4DA2A 2K14A 2N78A 1U4PA 2NBFA 2PI2E 2JYOA 1EWIA 4C1NK 3H3VH 5E4XA 4A75A 3ULLA 5NUCA 4QIWB 2EY6A 4A3IH 1NUCA 1D5MC 5FO8B 4NXNL 4GNXC 4LJZC 1EOVA 1VQ4A 1UE7A 2ICIA 2B3GA 3X3MA 1BR9A 4FXGC 5IYCG 2NVTB 2EJFC 4MZ9A 3HKZG 1O7ZA 3NE5B 4B9WA 4YHHL 2JA6B 1ZYRC 5IYBH 2PZUA 4C3IH 4C3JH 1EQTA 3K7UC 2LSSA 2JEBI 3S2DH 1VQIA 2X6GA 3EVQA 1SYCA 5H1SE 5IYDG 2B2WC 1XJVA 5JEAG 2K01A 4YY3Q 1PFNA 2E2IH 5IGBA 5EPLA 2EY2A 2O5JC 1VQ7A 1A15A 1ASZA 4KHZA 5C5LA 2ZTCA 4BXXG 1A3UA 2OF1A 2RHQB 5AJ3Q 3P75A 4LF9Q 4OX9L 3PO3G 1M8AA 2ASBA 3OIPA 1X55A 2RCFA 1HR0L 4OEMB 3S1MB 3PO2B 4UP9A 1PH6A 4IPDA 4OO1I 2R93H 5HURA 5K5PA 1EY4A 1VQ8A 1DM0B 2X69A 1CA6A 1SFOH 4LUVA 2DY7A 2PO4A 1F2MA 5GQOA 1KL9A 5DM73 1LTLA 2R7ZH 3J81i 2D2CC 4KTAA 4A3LH 1SEBD 3UDGA 1WD1A 3H3VC 4K5XA 2IX0A 2FFKB 4PG3A 1A63A 4ILWA 2M2LA 3H3VI 1RDPD 3CC7A 3DLLA 4A93B 4DK3C 2Z6KC 2E2JB 2BA1A 2JA8B 4GKKL 2UUBL 2RA4A 2XN9C 3I4LA 3RZDB 4NXML 1A6XA 5DNFA 3D6CA 4A3FH 1S40A 2Y0SE 1PTOF 1WCMH 2G9HD 2QW7A 5ELFA 3IFDA 4JI4Q 4JI5L 2NTSA 5M5WH 5FKAC 1B3AA 4BY7H 3GTKH 1I6HH 1KQSA 2ZXPA 1F2LA 4YWLA 3ICEA 4IUUA 2VNUD 2L1BA 1HCZA 4MN3A 5I2XA 2QEXA 2K5VA 2RKSA 1HZAA 1Y8PB 3L2PA 3HOXH 3W1BA 3KYHC 4DAYA 3H91A 1E1OA 4NPSA 3L0OA 1A62A 1CKNA 1H9RA 3HOYG 1Y1VG 2PI2A 5LMNL 4J1MA 3MTSA 3HOVH 4BY1G 5T1IA 1V1PB 1QCBD 2Z9HA 3H94A 4LFAQ 1WTQA 1Y1WH 4LF5Q 4HEDA 2KUMA 4E6IA 1WI5A 2Z4HA 3NQTA 3PIPA 4R9WA 2RVLA 4ZQ3A 1J5EL 4XDXA 3G4SA 1XNQL 5C4XB 2UU9Q 3ZJYC 3S1QH 2F3VA 4I65A 4K0KQ 2IX1A 2RHSB 3M4QA 5BN4A 1PH3A 4KJNA 2I5HA 2AMCB 2QDBA 3SEBA 1RL2A 3KLWA 1WTRA 4FF4A 4QQBX 3CF5A 3OIQA 4B3SL 3J81E 4JW0A 2WKDA 2XRSD 3OWFA 3NQIA 5M9OA 2CW0D 3EN2A 4CGYB 2L9HA 1PXUA 3TP8A 5FLXL 3DXJC 3TMEA 2Z6BA 4DPGA 3G7LA 1PFMA 1XYIA 4DK0A 2JA6G 1LO5D 1EY5A 5J3BA 3EFXD 3QJYA 5E1FA 3GTKB 2F0DA 1FYCA 2K7VA 2KEDA 1BCPF 4R4CA 4A3MB 3K7AB 2PYKA 1SMXA 4R1JA 5FK9C 4BA1I 1N36L 5E3FA 1NAPA 4KLKA 1HNWL 3GTJH 4APVA 2R92B 2VQEQ 1BKBA 3S15H 1L2FA 2PQAB 3PO2G 2E8GA 4OO1G 3TN2A 4EGVA 2UXCL 4DR1Q 1EY6A 1NSNS 1ICFB 1GHJA 3STBD 3SXHA 3S1NH 1LT3D 3IAYA 4JI2Q 2JA7B 1KRTA 1VQMA 3JC66 1VQHA 2ZTDA 4HCSA 1D1KA 1G291 4XQJA 3NTIA 3K80C 1Q8KA 1SE3A 4R4OA 1KD1C 4A3DB 3TS2A 1G51A 3GTMB 4LFBL 2MGSA 4PZ7A 1KABA 4N8FA 5J1ZA 4DXFA 4L63B 1NE3A 5IE8A 1K0SA 4XYQA 2ZJQA 3K5LA 5ELDA 3P1HA 4FF1A 1JJGA 2F0PA 4JK1C 5C3XA 4CJ2C 4A3KH 1FNWA 1HNZL 2PZTA 2ID0A 4C3JG 2KECA 4H02A 1R9TB 5LHY1 5JEAJ 2KVMA 1SXTA 3S16B 2OQ0A 3URYA 1CK1A 4J6HA 4PQXA 2YYZA 4DV5Q 2N88A 3N6RA 1PVOA 3ULJA 5FO7B 2BDOA 2D0PA 5GAHC 1C48A 4OWWB 1GXDC 2B2VA 5CV9A 1N32Q 1C8CA 1HZBA 4FXKC 4BBSB 4HJ8A 4DNRB 3ER0A 2CQAA 1EFWA 1TWAB 2OEOA 3FEWX 2WP8J 1YIJA 4N9PA 3UE0A 5CV8A 1WJJA 3TP5A 3S1NB 2Q2TA 4IPCA 2CWAA 2EYJA 4Q0FA 3GP7A 2R7ZG 2NB0A 1OXSC 4NDXA 4TKOB 1LM0A 2R6GA 1DCZA 4A3LG 1LV9A 2NVYH 3OOCA 5C4XG 4OELB 3S17B 2FMMA 3W3AA 3FVQA 2PW5A 1AE3A 2K33A 4RFBA 2EYOA 5IY0A 1PRTD 4DUZL 4A3KB 3MFGA 4J8QA 1B44D 4A3EB 1SAPA 3H15A 4AYBE 5CC4A 3CC2A 1CFMA 3DWQA 2O2LD 1VQFA 1ONLA 3KDFB 1KDBA 1PFBA 3F2DA 1EWCA 3SK6A 3E9IA 1DD2A 4TVAB 1WTXA 1S5CD 2EDGA 2EE1A 3FDTA 5EKLA 2VUMB 1TKWB 1SRUA 1EZ8A 1LT5D 2K04A 4GN3B 2Q2IA 5EPKA 1SYFA 3F2UA 4A3MG 1SMYC 4G57A 3A7LA 2MJ8A 4JI8Q 1HR0W 1TS2A 4V190 4LF8L 1UUPA 2K5NA 5HY6A 3TRZA 2R92G 1A3VA 3FKIB 1VQCA 5FLMG 4K5WA 3BZDB 5I9PA 2A69C 2B2YA 2PZWA 1MJCA 5C44H 2EQSA 2XVSA 4JOIA 3HOUH 3I8ZA 3HKZE 2I5LX 1HR0Q 3TREA 2DJFC 4XT1B 5JVH3 1JE5A 4A3JH 1U9RA 2WAQB 3CPFA 1DYQA 3OPOA 4U68A 2CH4A 1TQOA 2F0TA 4GOPA 1LTRD 3KFUA 4A3DG 5A35A 3K81C 3R3OA 4HIMA 4M8AA 3BJUA 1CUKA 1V8QA 3NTHA 1SYGA 4HJ9A 4DR5Q 3EBEA 1M4VA 1STYA 5E4WC 1MKHA 5M3MH 1B3QA 1BVSA 1TIID 2F0VA 1EU4A 1RD9D 2UUCQ 2LXJA 4LNQA 4KD3A 1P16A 2RDGA 1KDAA 4IUTA 4A3CG 3E5SA 4RH6A 3I7FA 5KNDA 4GKKQ 2B63H 1LTSD 3RN2A 2JP1A 3VDYA 3I4NH 4I7AA 3PUVA 3NBHA 2E5LL 1Q90A 4H44C 3I91A 3VA7A 2D5DA 2PQEA 3KBXA 1E3PA 3CRKC 1IBML 3T16A 5K36G 1CA5A 2KCTA 3G6EA 3Q23A 2VW9A 3NWSA 1TWCB 2JJQA 4IURA 4WJWA 2MQHA 4BBSG 1L1OB 5GAEC 4EX5A 2L5TA 3DUZA 2ZJPA 1PRTB 4KN7C 1WYDA 4OL7A 5C44B 3K57A 3CAMA 2CWPA 1PH1A 4JV5L 1PFSA 3E6ZX 5IGEA 1EY7A 2JQOA 1CHPD 2VB3X 3V05A 1XWEA 5EQ0A 2BCOA 3KF6B 1HTPA 3S24A 3TP7A 1EY0A 2ZTEA 3A74A 1VQJA 2XSCA 2MFIA 1R4PB 4LF4Q 2WKCA 4DAMA 5M5YH 3H0GB 5EPJA 3J81L 3D0FA 5DLQE 1FGBD 2HCCA 2F0SA 4H13C 4S3SA 4HMIA 3CPWA 4KV6A 2CCZA 3SK5A 1J5EQ 4DNIA 3FPUB 5I9OA 5J22A 1VQAA 4A3KG 2XRQD 3DHQA 2PMZB 1ZYRD 4A3EG 4X65L 3HFZB 3PMFA 4F8MA 2K05A 4P71A 3GTLB 2JK8A 4DV0Q 1LABA 3IFTA 1XPRA 5C3WA 2LXKA 1QILA 3I3CA 2Z8LA 1P8LA 5BN5A 1STHA 3PIO3 3RLNA 1VMPA 4IZ8A 1EYCA 1YHAA 2VUMG 4FDBA 4RWSC 3HOWB 2KA7A 2PNHA 4IALA 3J7AF 3S2HB 1GUOA 5C4JH 4C3HB 2VQFL 2YV5A 3A5UA 4LAAA 2LMCB 1IBKQ 1BBWA 1HUNA 4XQQA 4QIWE 3KF8A 1PTOH 4LWCA 1TWFB 1X3FA 3BYYB 3RR5A 2N55A 4A3BH 1B7YB 3QB3A 5FJ8G 1HNWQ 4BWGB 3BVZA 3NEMA 2EYFA 5M3FB 2WAQG 4UAIA 1LT4D 4ZK9B 1MGSA 3BDOA 3TZDA 2UXCQ 1PRTF 1A2UA 3VR2A 5A2QE 1N34L 1H9KA 4PNYA 3E9HA 4L8JA 1PA6A 5ISRA 4JI3L 5EBDA 1TY0A 5IWAL 1Q3LA 3PUYA 2YU9B 1H9MA 2F0EA 4BY1B 1NMGA 3RZOH 3DWAA 1LTBD 4LFBQ 5C3EB 3SK8A 3F8TA 1EWHA
chains in the Genus database with same CATH topology
4C56C 1JOKA 5D14A 2XIWA 3VYRA 1Q1BA 4WORA 4RAUC 4IUPA 3UI2A 1PYWD 3NHHA 3V2TA 1PTOC 4WRDA 4QB4A 5D3DA 2IW3A 2NN6H 3RMHA 4EQNA 1STNA 1X3QA 2EYMA 2Z4IA 2WB1B 2F0KA 3CQZB 3S14B 1PLFA 2JSOA 4C1NI 1LTAD 2B2TA 1V1OA 1S5BD 3D31A 4HCEA 2EYHA 5HGTA 5EKIA 3HGBA 2L0CA 3NTKA 5KNBA 4UDUC 1HQRD 1XX8A 1AZQA 1XTCD 2VB2X 1JCKB 4KD4A 1QB5D 1MSHA 4KI0A 3M4OB 3CKIB 4KY7A 4IFDI 3NPPA 5EKKA 3C2PA 1CM9A 1DOMA 1Z6HA 3IL8A 2K03A 1SSOA 1X32A 1Z7TA 3M7GA 3HZXA 2E74C 4A3IB 3QO2A 1I6VC 2Q8RE 2SNSA 1SYBA 2OXPA 4U673 1SNPA 1KAAA 1H9SB 1GUWA 3L9AX 4C3HG 2FMCA 4QF4A 2O5IC 1HXYD 1LACA 4NP5A 4C3IB 4C3JB 3D4DA 2B2WA 4H0LC 3S2DB 3BDLA 3T53B 1UNSA 1EYDA 2F0IA 2E2IB 1QJOA 5G3LD 1CHQD 3SK4A 4F7XA 5C0XG 4ZUJA 3JAME 1WTOA 3LNNA 3ZYYX 2LFNA 3QWNA 1EU3A 2R93B 4NKLA 1MBYA 5KRUA 1SFOB 3C1FA 1IKLA 3DEPA 4V0BA 1D6EC 1EEFD 1Y69U 1ENFA 1BDOA 3NBIA 2R7ZB 3TBIB 2IX3A 5ELBA 2F0GA 3J80E 3D4RA 4TSSA 2F0WA 1LTGD 1ILPA 5CGKA 2KQ3A 4X3KA 1EYAA 1S5FD 4FNFA 4A3FB 3FMCA 1BBXC 4QUFA 1WCMB 2F0LA 5M5WB 3J7YW 3Q22A 2V4DA 4BY7B 1I6HB 2NWGA 3R2IA 4P2CB 3HOXB 1TU2B 2QEJC 5I2YA 3SE0A 5CORA 2MP1A 4O1NA 5J39A 1OXUA 1V1PA 2F0HA 3NSWA 2F03A 3HOVB 3OSOA 1OXTA 3NUCA 3K58A 1Y1WB 4IFDG 3PUXA 5CV5A 3VR3A 3S1QB 1O80A 4DAPA 2B2VC 5JVG3 1DXMA 3MWYW 3OMCA 3OWEB 1GHKA 2IT1A 1SMYD 3G6JB 3HEJA 3C46A 1B9NA 2MHVA 3T13A 3MEHA 4K5VA 4RCNA 5IODA 2M00A 4DU9A 1E0BA 1ENCA 3D6WA 4K8IA 2A69D 4C3IG 1YNNC 4EQPA 4RGMA 5KGUA 5CMDA 5A2QL 2EVBA 1VDZA 2K6AA 5EGTA 3HS0C 1HHVA 2EYLA 3GTJB 5KNCA 3S15B 1B4OA 2F0OA 1F2ZA 1G6ZA 2KOLA 2FHTA 2SNMA 2DY8A 2Z1CA 4ODGA 3D8GA 3VR4A 1CQVA 3L7ZC 2SDFA 4FVMA 3MXPA 1SNOA 2I07B 5DAUA 4O42A 5LL6S 2H1EA 1GOZA 5T1GA 5C4HA 2A68C 3BVMA 5AFWA 3PUZA 2B2YC 1HRJA 1SJED 2OT2A 2XWBB 2MPMA 1KDCA 2ZXOA 1U4MA 2BDNA 1S4ZA 4ZKBB 1WD0A 5C0XJ 3T4AC 1KTKA 2RDFA 2QF7A 3QOJA 3TDQA 3ERQA 1RTOA 3U9OA 3CU7A 1SYDA 1LLRD 1EIGA 1VCIA 1SNQA 3OHXC 3DM1A 2K5QA 4K8JA 1IYUA 4G4KA 2JE6I 1SNMA 2RSOA 1SNCA 4B9XA 1HFNA 2VXWA 1CTMA 2B2UA 4CKCA 1U4LA 2A73B 1EQVA 1SE2A 4IUVA 2NVYB 2B8FA 2EZVA 1O7YA 1BQQT 5JPMC 2QKIC 5EBCA 2AQ2B 2PCFB 3QIAA 2BE5C 3EQLC 4KMUC 5D3IB 1HA5A 3K5OA 5JEAH 3CHBD 2R3ZA 5CV7A 1E2ZA 2A5HA 2EJMA 1EFID 3BVGA 3D4WA 3QOLA 3JAML 1D1IA 2HDLA 2CHBD 1S5ED 3I4MB 4K6LA 5I6YA 4AYBB 3SVMA 1GJXA 1FNUA 1RCVD 1IHZA 1YNJC 1SDFA 2QCPX 3DEOA 1MSGA 5FO9B 4FF2A 1FD7D 1L0YB 4RKBA 3KLSA 1F9SA 3C3LA 3ND8A 4HR7B 1WTPA 2B8GA 3SDZA 3NXWA 2K32A 3J80L 5JAVA 3HOUB 4DFAA 2AQ3B 3VR5A 4IFDJ 2XNAC 4A3JB 4HN7A 3ND9A 1A2TA 3K0YA 1II3A 2G9DA 2SOBA 5CV4A 1V43A 3A54A 3PV0A 3S9WA 5KIXA 3WOFA 2F3WA 3GD7A 4R8IA 1CT1D 2NZ1D 5M3MB 1XXGA 1D2BA 3MXUA 1PTOD 2AUJD 3I72A 1DONA 3LX0A 3N52A 1BF4A 2B63B 4JBWA 1LTID 3I4NB 2F0FA 4B08A 4CHTB 3VYUA 2ICEC 4HAEA 3NP8A 5IGDA 1CZWA 2J0TD 5BN3A 1KLGD 2BOSA 1TY2A 1Z47A 3EJIA 4QUCA 3NK9A 3RUZA 1QWYA 1Y8NB 4HSPA 4GZYC 1STBA 2QILA 3MFYA 1ESFA 5JPNC 2HDMA 4ABNA 4IQZA 3HRZC 1TT2A 5M5YB 2MUYA 4L6TB 1CI3M 4RHSA 1HUMA 3MZ5A 4DNTB 4DF7A 1G2TA 1ICWA 3SHLA 3KLRA 2ZT9C 2A6EC 1F2YA 3K5MA 2F1MA 2DNCA 1SBBB 2J7ZA 1L0XB 2F4IA 1QNUA 1MD2D 1AFPA 3OMGA 1FNVA 2WIIB 1WTVA 1CQFA 1AN8A 1H9JA 2IPKD 4HTHA 5C4JB 1A3TA 3J7AV 4K14A 1T5XD 4DN4M 1RF2D 1WVLA 1I4PA 2IWHA 1PTOB 4XXEA 4A3BB 4IUQA 2K28A 1GUTA 4DGZA 2KJXA 3P20A 3A55A 1HQMC 1JORA 1O7LA 2F0UA 2DNEA 1DOLA 1GUGA 4ZKCB 2RSNA 2XWJB 2A6HC 3FPPA 1QG7A 3H6MA 3GO5A 2RDHA 4IUNA 4ME5A 1FR3A 3O13A 4PV1C 3BG3A 5CR3A 3R93A 3RZOB 3RD4A 1JOOA 4F88A 5I4DA 2GA4B 3NWTA 2AUKA 1BOSA 4KY5A 1CZGA 2LKVA 5I6WA 2I46A 3GQBA 4KKTA 1HPCA 1ILQA 5IT9E 4LK1C 2RBMA 3VA5A 2NN6I 1O78A 3TZUA 1KLUD 4WFN3 4CKEA 3M4YA 1AEXA 2EOTA 1STEA 2KCNA 2M9VA 3LWUA 3KK7A 1PZID 5DEHA 4A3GB 2F0MA 1F9PA 2HUGA 2NVQB 1HFGA 1BCPC 2E76C 5F2DA 1BCPB 4ZYSA 1ESRA 2KCCA 4XTCS 5IIFA 1TR5A 2F0JA 2F0QA 1PDQA 1LT6D 1T5EA 4RCOA 2NTTA 2WACA 3MA2B 3GV6A 3GTQB 3A8IE 3PIP3 2ZXRA 2AWNA 4RGTA 4RHRA 1IW7C 5CV6A 1I4XA 5IOCA 4HSVA 1W6JA 3WDNA 3V96A 5IGGA 3GTOB 2PPBC 1YNND 3HOZB 2L4NA 1BNZA 3BS1A 1RODA 1H9SA 1UEAB 1I4HA 1NCVA 1VMCA 4C2MB 1OXVA 2LY7A 4PMCA 4H7BA 1JB3A 4Z9CB 4RGOS 5ELCA 1TVXA 1B1ZA 3VYTA 2Q8TA 4CJ1B 1C4QA 4RGNA 4OIKA 1Q1EA 1JQYD 4KJOA 3BYTB 2DN8A 2EY1A 2E2DC 1PZJD 1IYVA 2TSSA 2Y0SB 1I4RA 1D5ZC 1F77A 4MHEA 3X3NA 2JXMB 3A8JE 4K2LA 3Q6SA 2A74C 3TSSA 1ZEQX 2B39A 4Y7NB 2A68D 3H09A 1JC7A 1K8MA 4M1UB 1EY8A 4KKSA 1NR4A 3GV3A 3T56B 2NVXB 1RKNA 3HP3A 1BUVT 5K36H 5KEEA 1BXTA 1JWMD 3M85A 3MHBA 2EXZA 1B2TA 1OO9B 1PZKD 2X6LA 3FRPB 3R8BA 4KN4C 4XQNA 1BO0A 4CKBA 4Q5VA 1I4GA 5FOBB 2NN6G 4G7HC 4OIJA 4OHJA 2HQEA 5CBEE 3ONAB 1MI2A 1GUSA 3Q0AA 3ITPA 1ET9A 4CJ0B 1X3PA 3AU7A 1B50A 3EA6A 3C1EA 5C5MA 1IL8A 3I70A 4ZUIA 1PMRA 4QCLA 2BE5D 3BDCA 1AP0A 3WOEA 4BBRB 1QE6A 3HG9A 4ID6A 1E2VA 5C6AA 4KK7A 1Q12A 3MXNA 1J8IA 2K5WA 1LTTD 1TS4A 4KHVA 5KYLA 1YNJD 4KKUA 2CW0C 5M5XB 3E0JA 5DM63 2H4OA 2J4XA 4LMQD 1J9OA 1R4QB 3R2TA 2D62A 5JOBA 1SYEA 1JICA 4EVOA 3KLSX 5CBAE 3DWPA 2HCIA 1Y8OB 5G3LF 3AMUA 5TSSA 2B2UC 2AQ1B 4ULLA 1UAPA 2EJGC 1ML0D 1EL0A 1SNDA 3M3YB 3M7NA 4FO2A 5ELEA 3A7AB 1VF7A 2O4XA 4G7ZC 2E75C 3W2DA 2JEAI 1AZPA 2EPBA 3KUPA 3EROA 4I7ZC 1JWUD 1TWHB 2WINB 1TS3A 5IT9L 2CVRA 2F0NA 1EY9A 3K59A 3OW7A 1K8OA 1F9QA 1HA6A 1JR0D 3DMUA 3S1RB 1WTWA 3MC0B 3MVVA 4PMBA 1ENAA 1DZ1A 1W6KA 4G7OC 3CRLC 1VF5C 3GTPB 4ZLTF 5LL6X 1G91A 4K6DA 1G2SA 2FJ2A 3A8KE 3SR1A 1RTNA 1DJRD 4EQOA 4XYOA 1B9MA 1GUNA 4BS9A 5C4ZA 4DXGA 2KEEA 2JA5B 4TRDA 1TWGB 1Q8IA 2IL8A 5KYIA 2E2HB 2A6ED 1B53A 2AWOA 3MXGA 5D65A 1RJTA 1ZXTA 2IJ0A 1OXXK 1JOQA 3A56A 3VYSA 4NMZA 1KNAA 2SEBD 1EEID 1SJHD 4NW2A 2C5CA 1EZ6A 4FP5D 4KY6A 1PRTC 3I73A 3HKZB 1EOTA 1S5DD 1JWSD 5IGFA 1AW7A 2K5DA 1DOKA 4MIUA 3L3OC 4TQUS 4RA8A 5FLXE 5CYUA 4XIGS 3T51B 4FXDA 5C0XH 4HMJA 3PO3B 4BA2I 4YIJA 3P7JA 3GTGB 3RLFA 3QG1A 2A6HD 1QNKA 1F9RA 3MAQA 3Q24A 2L12A 1KNEA 1JE4A 4DAVA 5IGCA 1K83B 3AB9A 1U4RA 3K5NA 2EYPA 4N9TA 2R61A 1I50B 3PUWA 3I90A 4ZAIA 1G8ZD 2K1BA 3D3RA 2Q8IB 2WV6D 4FYDA 4X3UA 2NUCA 1SE4A 2L55A 1STGA 2BA0A 1RHPA 3U9SA 4XT3B 3KBGA 4DK1A 1STAA 1EIHA 4ZRZA 1NR2A 1I4QA 1I3QB 4RKLA 3IKJA 4X3SA 5JJZA 2EY5A 2D9UA 4X3TA 4FF3A 4CBVA 4IN3A 2ENBA 1D5XC 4F87A 5C0XI 3TP6A 2PW7A 2RQXA 2NYZD 5EJWA 1HTLD 2B2TC 3VR6A 4QMGA 3LWEA 1BCPD 4K2KA 3HOYB 5COYA 1Y1VB 2LS01 1TS5A 4PMWA 2C9OA 2TMPA 4OO1H 1ET6A 3K6OA 2KHSA 4OGQC 2L11A 1QOHA 2FINB 1ZKOA 4R8NA 4IFDH 1IKMA 2PNRC 1IW7D 1E2WA 4DA2A 1U4PA 2NBFA 2JYOA 4C1NK 5E4XA 5NUCA 4QIWB 2EY6A 1NUCA 1D5MC 5FO8B 4LJZC 2ICIA 3X3MA 1BR9A 4FXGC 2NVTB 2EJFC 3NE5B 1O7ZA 2JA6B 4B9WA 1ZYRC 2PZUA 1EQTA 2JEBI 2X6GA 3EVQA 1SYCA 2B2WC 5JEAG 2K01A 1PFNA 5IGBA 5EPLA 2EY2A 2O5JC 1A15A 4KHZA 5C5LA 1A3UA 2OF1A 3P75A 1M8AA 3OIPA 3PO2B 3S1MB 4OO1I 5HURA 5K5PA 1EY4A 1DM0B 2X69A 1CA6A 2DY7A 2PO4A 1F2MA 5DM73 2D2CC 4KTAA 1SEBD 1WD1A 3H3VC 4K5XA 2IX0A 2FFKB 4ILWA 2M2LA 1RDPD 4A93B 2E2JB 2BA1A 2JA8B 2RA4A 2XN9C 3I4LA 3RZDB 1A6XA 5DNFA 3D6CA 1PTOF 2G9HD 5ELFA 3IFDA 2NTSA 5FKAC 1B3AA 2ZXPA 1F2LA 4IUUA 2VNUD 2L1BA 1HCZA 4MN3A 5I2XA 2RKSA 1Y8PB 4DAYA 3H91A 1H9RA 4J1MA 3MTSA 5T1IA 1V1PB 1QCBD 1WTQA 3H94A 4HEDA 2KUMA 4E6IA 2Z4HA 3NQTA 4R9WA 2RVLA 4ZQ3A 4XDXA 5C4XB 2F3VA 4I65A 2IX1A 5BN4A 4KJNA 2QDBA 3SEBA 1WTRA 4FF4A 3OIQA 3J81E 2WKDA 2XRSD 3OWFA 3NQIA 5M9OA 2CW0D 4CGYB 2L9HA 1PXUA 3TP8A 5FLXL 3DXJC 3TMEA 3G7LA 1PFMA 1XYIA 4DK0A 1LO5D 1EY5A 3GTKB 3EFXD 3QJYA 5E1FA 2F0DA 1FYCA 2K7VA 2KEDA 1BCPF 4A3MB 3K7AB 2PYKA 5FK9C 4BA1I 5E3FA 1NAPA 2R92B 4OO1G 3TN2A 4EGVA 1EY6A 1NSNS 1GHJA 3SXHA 1LT3D 3IAYA 2JA7B 4HCSA 1D1KA 1G291 4XQJA 3NTIA 1SE3A 4A3DB 3GTMB 2MGSA 1KABA 5J1ZA 4DXFA 4L63B 4XYQA 3K5LA 5ELDA 3P1HA 4FF1A 2F0PA 4JK1C 5C3XA 4CJ2C 1FNWA 2PZTA 2ID0A 4C3JG 2KECA 1R9TB 5LHY1 5JEAJ 2KVMA 1SXTA 3S16B 3URYA 1CK1A 4J6HA 4PQXA 2YYZA 2N88A 3N6RA 5FO7B 2BDOA 1C48A 1GXDC 2B2VA 5CV9A 1C8CA 4FXKC 4BBSB 4DNRB 2CQAA 1TWAB 2OEOA 3FEWX 2WP8J 4N9PA 5CV8A 3TP5A 3S1NB 2EYJA 4Q0FA 3GP7A 2NB0A 1OXSC 4NDXA 4TKOB 2R6GA 1DCZA 1LV9A 3OOCA 3S17B 2FMMA 3W3AA 3FVQA 2PW5A 2K33A 4RFBA 2EYOA 1PRTD 4A3KB 3MFGA 4J8QA 1B44D 4A3EB 1SAPA 5CC4A 1CFMA 3DWQA 2O2LD 1ONLA 1KDBA 1PFBA 1EWCA 3SK6A 1DD2A 1WTXA 1S5CD 2EDGA 2EE1A 3FDTA 5EKLA 2VUMB 1TKWB 1EZ8A 1LT5D 2K04A 5EPKA 1SYFA 3F2UA 1SMYC 4G57A 3A7LA 2MJ8A 1TS2A 4V190 1UUPA 1A3VA 3FKIB 4K5WA 3BZDB 5I9PA 2A69C 2B2YA 2PZWA 2XVSA 3I8ZA 4XT1B 5JVH3 1U9RA 2WAQB 1DYQA 3OPOA 4U68A 1TQOA 2F0TA 1LTRD 5A35A 3R3OA 4M8AA 1V8QA 3NTHA 1SYGA 1M4VA 1STYA 5E4WC 1TIID 2F0VA 1EU4A 1RD9D 4KD3A 2RDGA 1KDAA 4IUTA 3E5SA 4RH6A 5KNDA 1LTSD 2JP1A 3PUVA 3NBHA 1Q90A 4H44C 3I91A 3VA7A 2D5DA 2PQEA 3KBXA 3CRKC 3T16A 5K36G 1CA5A 3Q23A 3NWSA 1TWCB 4IURA 4WJWA 2L5TA 3DUZA 1PRTB 4KN7C 4OL7A 5C44B 3K57A 3E6ZX 5IGEA 1EY7A 1CHPD 2VB3X 3V05A 1XWEA 5EQ0A 2BCOA 1HTPA 3TP7A 1EY0A 2XSCA 1R4PB 2WKCA 3H0GB 5EPJA 3J81L 1FGBD 2HCCA 2F0SA 4H13C 4S3SA 4HMIA 4KV6A 3SK5A 3FPUB 5I9OA 5J22A 2XRQD 3DHQA 2PMZB 1ZYRD 3PMFA 4F8MA 2K05A 3GTLB 1LABA 3IFTA 5C3WA 3I3CA 1QILA 2Z8LA 5BN5A 1STHA 3PIO3 1VMPA 4IZ8A 1EYCA 4RWSC 3HOWB 2KA7A 4IALA 3J7AF 3S2HB 1GUOA 4C3HB 4LAAA 2LMCB 1HUNA 4XQQA 3KF8A 1PTOH 1TWFB 3BYYB 2N55A 3QB3A 4BWGB 3BVZA 2EYFA 5M3FB 4UAIA 1LT4D 4ZK9B 1MGSA 3BDOA 3TZDA 1PRTF 1A2UA 3VR2A 5A2QE 1H9KA 4PNYA 4L8JA 5ISRA 5EBDA 1TY0A 1Q3LA 3PUYA 2YU9B 1H9MA 2F0EA 4BY1B 3DWAA 1LTBD 5C3EB 3SK8A 1EWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSO A;  1EZ8 A;  4RKB A;  1ENA A;  3BDL A;  1SYF A;  2LKV A;  4B9W A;  5I6W A;  1JOK A;  1EYD A;  2F0I A;  2PZU A;  4G57 A;  3NUC A;  3MZ5 A;  4J1M A;  4DF7 A;  2F0S A;  4S3S A;  3P1H A;  2F0P A;  3EVQ A;  1SYC A;  3NXW A;  4HMI A;  1KDC A;  4KHV A;  2NUC A;  4K2L A;  4K6D A;  3SK4 A;  4WOR A;  5C3X A;  4F7X A;  5CV5 A;  1A3V A;  5IGB A;  2EY2 A;  5JAV A;  4ZUJ A;  2PZT A;  1STG A;  2RBM A;  4K5W A;  3SHL A;  3SR1 A;  4E6I A;  5C5L A;  4WRD A;  4KV6 A;  5I9P A;  3NQT A;  4DFA A;  3VA5 A;  3SK5 A;  2PZW A;  1F2Y A;  1STA A;  4EQO A;  4ZQ3 A;  1A3U A;  5I9O A;  2OF1 A;  5J22 A;  3NHH A;  3V2T A;  3P75 A;  2F3V A;  4I65 A;  3DHQ A;  1A2T A;  1AEX A;  2RDF A;  3OMC A;  4J6H A;  4NKL A;  1II3 A;  4QB4 A;  1EY8 A;  3HEJ A;  5C4Z A;  4EQN A;  3QOJ A;  4KJN A;  4RKL A;  3ERQ A;  3PMF A;  1STN A;  3U9O A;  2QDB A;  1SYD A;  2SOB A;  2F0M A;  1SYE A;  5CV4 A;  1U9R A;  3C1F A;  5DEH A;  5JOB A;  2EYM A;  4EVO A;  5HUR A;  3T13 A;  1EY4 A;  5K5P A;  3S9W A;  1SNQ A;  3MEH A;  4TRD A;  4K5V A;  2EY5 A;  1RKN A;  2F0K A;  5IOD A;  2M00 A;  5KIX A;  1TQO A;  2F0T A;  3OMG A;  5C3W A;  2F3W A;  5EKL A;  4DU9 A;  5CV9 A;  5KYI A;  5J1Z A;  1ENC A;  4K8J A;  5ISR A;  5F2D A;  3OWF A;  1STH A;  3R3O A;  4K8I A;  5M9O A;  2ENB A;  5KEE A;  4HTH A;  1F2M A;  2OEO A;  2F0G A;  5IIF A;  1SYG A;  1EYC A;  1TR5 A;  2F0J A;  2F0Q A;  1A3T A;  4IZ8 A;  3TP8 A;  1SNM A;  2EYH A;  4K14 A;  3TME A;  4EQP A;  3MHB A;  3TP6 A;  5KGU A;  2F0W A;  2PW7 A;  5KRU A;  1EY5 A;  2EXZ A;  1STY A;  2WAC A;  4IAL A;  4N9P A;  4NMZ A;  5HGT A;  5CV8 A;  3TP5 A;  3LX0 A;  5E1F A;  2F0V A;  4KTA A;  2F0D A;  1SNC A;  4B9X A;  5CGK A;  1EZ6 A;  4LAA A;  4K5X A;  4KD3 A;  1SND A;  2EYJ A;  2KQ3 A;  4KY6 A;  1KDA A;  5CV6 A;  4QMG A;  1EQV A;  5EGT A;  4K2K A;  4KD4 A;  5IOC A;  4DGZ A;  3E5S A;  2EYL A;  1EYA A;  4NDX A;  1JOR A;  2F0F A;  2PYK A;  5IGG A;  2F0U A;  5IGF A;  2O4X A;  3QB3 A;  4KY7 A;  2F0O A;  1F2Z A;  4MIU A;  5E3F A;  5EKK A;  2F0L A;  2KHS A;  3D6C A;  3NP8 A;  4PMB A;  2SNM A;  5IGD A;  2PW5 A;  2EYF A;  2PQE A;  2HQE A;  3H6M A;  3T16 A;  4R8N A;  2EYO A;  3ERO A;  3HZX A;  5CV7 A;  4IUN A;  4ODG A;  3D8G A;  3ITP A;  4ME5 A;  1A2U A;  1EY6 A;  4HMJ A;  1NSN S;  3EJI A;  3D4W A;  3NK9 A;  3SXH A;  5CC4 A;  5CR3 A;  3QOL A;  4PNY A;  4YIJ A;  4PMC A;  4OL7 A;  3RUZ A;  3C1E A;  2SNS A;  5C5M A;  3MXP A;  4ZUI A;  4H7B A;  4F8M A;  5KYL A;  1SYB A;  2F0N A;  2OXP A;  1JOO A;  1SNP A;  1SNO A;  3BDC A;  1EY9 A;  5I6Y A;  1KAA A;  1EY7 A;  5IGE A;  1KDB A;  5NUC A;  2EY6 A;  1NUC A;  1STB A;  5DAU A;  2F0E A;  2RKS A;  3SK6 A;  1IHZ A;  5IGC A;  4ID6 A;  3DMU A;  2EYP A;  5J39 A;  4N9T A;  3TP7 A;  1EY0 A;  1TT2 A;  3D4D A;  4QF4 A;  3SK8 A;  1JOQ A;  4NP5 A;  2F0H A;  3MVV A;  4KJO A;  1KAB A;  5C4H A;  4KY5 A;  5C6A A;  2EY1 A; 
#chains in the Genus database with same CATH topology
 2B29 A;  4C56 C;  1JOK A;  5D14 A;  3MEF A;  1D7Q A;  2XIW A;  4WJ4 A;  2AHO B;  1C7Y A;  4HJA A;  3VYR A;  1CKM A;  2VS1 A;  4DV7 L;  1Q1B A;  4WOR A;  4QL5 A;  1HNZ Q;  4RAU C;  4IUP A;  1J6Q A;  1JMC A;  3UI2 A;  4GNX B;  1PYW D;  3NHH A;  3V2T A;  1PTO C;  2R7D A;  4WRD A;  4R4Q A;  4QB4 A;  5D3D A;  2IW3 A;  2NN6 H;  3JAM i;  3RMH A;  4EQN A;  1X56 A;  2IHF A;  1STN A;  5C44 G;  1X3Q A;  2EYM A;  2Z4I A;  2DUD A;  4O2D A;  2WB1 B;  2F0K A;  3CQZ B;  3S14 B;  1JB7 A;  2EXD A;  4A3G H;  1X54 A;  1AE2 A;  5LMU L;  1PLF A;  2JSO A;  4C1N I;  1LTA D;  2NVQ H;  2B2T A;  1V1O A;  3CCR A;  2ES2 A;  1S5B D;  3D31 A;  1FJG Q;  4HCE A;  2EYH A;  5HGT A;  5EKI A;  3HGB A;  2L0C A;  3NTK A;  3H0G G;  5KNB A;  3M4P A;  4UDU C;  1HQR D;  1XX8 A;  2K52 A;  1AZQ A;  1U0L A;  1XTC D;  3NEL A;  2VB2 X;  3J80 i;  3GTQ H;  1BBU A;  1JCK B;  4KD4 A;  1QB5 D;  1MSH A;  4KI0 A;  3M4O B;  4B3R Q;  4JI6 L;  1D8L A;  1HZC A;  1GD7 A;  3CKI B;  4KY7 A;  3RNU A;  4P74 A;  4IFD I;  3NPP A;  5EKK A;  3GTO H;  3K0X A;  4LF7 Q;  3CCQ A;  1CM9 A;  1DOM A;  1Z6H A;  3IL8 A;  3C2P A;  2K03 A;  3HOZ H;  1SSO A;  1X32 A;  1Z7T A;  3M7G A;  3I4N G;  4X66 Q;  3HZX A;  1VQL A;  4L5S A;  2E74 C;  4A3I B;  3QO2 A;  1EUJ A;  1I6V C;  4C2M H;  2Q8R E;  2SNS A;  1NJI C;  1SYB A;  2OXP A;  1ASY A;  4U67 3;  1SNP A;  2ATW A;  3HOW G;  1KAA A;  4DV1 L;  2VL6 A;  1H9S B;  1GUW A;  3L9A X;  4C3H G;  2FMC A;  1YNX A;  4POG A;  4QF4 A;  2O5I C;  1HXY D;  1LAC A;  4NP5 A;  4C3I B;  1VQO A;  4C3J B;  3D4D A;  2B2W A;  4H0L C;  1C9O A;  3S2D B;  3BDL A;  3T53 B;  1UNS A;  5IP7 G;  1EYD A;  2F0I A;  2E2I B;  1QJO A;  5G3L D;  4LF8 Q;  3T1H Q;  1X3G A;  1CHQ D;  3SK4 A;  4LFC L;  1Q46 A;  4F7X A;  4UHV A;  5C0X G;  5IP9 G;  4ZUJ A;  3JAM E;  1WTO A;  5M3F G;  4DV4 Q;  3LNN A;  3ZYY X;  4DV6 L;  1H95 A;  2LFN A;  3CCU A;  3QWN A;  1GVP A;  1EU3 A;  2R93 B;  4NKL A;  5HGQ A;  1MBY A;  4Y7N H;  2K50 A;  4DK6 C;  5KRU A;  1SFO B;  3C1F A;  1IKL A;  3DEP A;  4V0B A;  1D6E C;  1EEF D;  2XTI A;  3DM3 A;  1Y69 U;  1ENF A;  1BDO A;  3NBI A;  2R7Z B;  2NVX H;  3TBI B;  2IX3 A;  2F3I A;  5C3E G;  5ELB A;  2F0G A;  1HNX Q;  3J80 E;  3D4R A;  4TSS A;  2F0W A;  3CXC A;  1LTG D;  1ILP A;  1G6P A;  1PV4 A;  2Z6K A;  5CGK A;  4AQY L;  2KQ3 A;  1VQ5 A;  4X3K A;  4JCV E;  1EYA A;  2ZJR A;  1S5F D;  1S3O A;  3CCS A;  4FNF A;  4A3F B;  3FMC A;  2MNA A;  1BBX C;  4QUF A;  1FVI A;  2E5L Q;  1WOC A;  2H5X A;  1WCM B;  2F0L A;  5M5W B;  3J7Y W;  4AH6 A;  3Q22 A;  4A3B G;  2V4D A;  4BY7 B;  1I6H B;  2WB1 G;  2NWG A;  2JN4 A;  3R2I A;  3BU2 A;  3F2C A;  4IO9 A;  4P2C B;  4Y52 H;  1XMQ L;  3HOX B;  3AYH B;  1TU2 B;  2OQK A;  3HKS A;  2QEJ C;  5I2Y A;  3SE0 A;  5COR A;  1K3B C;  2MP1 A;  4O1N A;  5J39 A;  4GLX A;  1OXU A;  1V1P A;  2F0H A;  4BBR H;  3NSW A;  2UXD L;  2QDL A;  2F03 A;  2HIX A;  3HOV B;  1I94 L;  3OSO A;  1OXT A;  4CDD C;  1K3R A;  4JVZ A;  1Z9F A;  3NUC A;  3K58 A;  2HD3 A;  1Y1W B;  2HT1 A;  1PH5 A;  1A8V A;  3M9B A;  4IFD G;  4L5Q A;  1XTD A;  3PUX A;  5CV5 A;  3VR3 A;  3MXN B;  3S1Q B;  1O80 A;  1JJ2 A;  4DR3 L;  3JAM c;  4DAP A;  2B2V C;  5JVG 3;  1DXM A;  3MWY W;  4X65 Q;  1X6O A;  3OMC A;  3OWE B;  1XMO L;  1GHK A;  2IT1 A;  1SMY D;  3G6J B;  3HEJ A;  5M5X H;  4A3I G;  1X65 A;  1B8A A;  3C46 A;  1B9N A;  2MHV A;  4IOA A;  3T13 A;  2YTX A;  4DV2 Q;  3MEH A;  4K5V A;  4RCN A;  5IOD A;  1K28 A;  1HJP A;  2M00 A;  4DU9 A;  1E0B A;  1ENC A;  3D6W A;  4K8I A;  2A69 D;  5IYB G;  2UXB L;  4DR7 Q;  4C3I G;  2Z0S A;  1XPO A;  1YNN C;  1Y14 B;  4EQP A;  4RGM A;  5KGU A;  1N9W A;  4A3G G;  5CMD A;  1LUZ A;  3J80 c;  2I5M X;  5A2Q L;  4LW1 A;  2P5Z X;  4DR2 L;  4GKJ L;  2EVB A;  1IBL L;  3UDI A;  4JG2 A;  1YJW A;  4B3M Q;  1VDZ A;  2K6A A;  5EGT A;  2PQA A;  3HS0 C;  1HHV A;  2EYL A;  3GTJ B;  2F4V L;  3M3Y H;  1SRO A;  5KNC A;  1N33 L;  3S15 B;  3CCL A;  1B4O A;  2F0O A;  1F2Z A;  2CH4 W;  2R93 G;  1G6Z A;  2KOL A;  2FHT A;  2SNM A;  2DY8 A;  2JA9 A;  4CDE C;  5GAD C;  2RCN A;  2Z1C A;  4ODG A;  3D8G A;  3VR4 A;  1CQV A;  2UUA L;  3AEV A;  3L7Z C;  2SDF A;  1XNR Q;  3HOZ G;  4FVM A;  1Q86 C;  5E7N A;  3MXP A;  4UP7 A;  1TWH H;  4JI3 Q;  4WJ3 M;  1QUQ B;  4YY3 L;  5IWA Q;  3J7A 5;  1SNO A;  2I07 B;  5DAU A;  4O42 A;  3K8A A;  5LL6 S;  2H1E A;  1IL2 A;  5GAG C;  1GOZ A;  2WAQ E;  3W1G A;  2D0O A;  2DGY A;  4X64 L;  2A68 C;  3BVM A;  5AFW A;  5T1G A;  5C4H A;  4LF9 L;  2KHJ A;  4JPB W;  3S1R H;  3PUZ A;  2B2Y C;  1HRJ A;  4LF6 L;  1SJE D;  2OT2 A;  2XWB B;  1KRS A;  4A3F G;  4JOI C;  2MPM A;  4DKA C;  1WCM G;  1KDC A;  2ZXO A;  1M90 C;  1U4M A;  3GTP H;  2BDN A;  1S4Z A;  4NXN Q;  1RIP A;  1A0I A;  4ZKB B;  4BY7 G;  1MHW C;  3F2B A;  3I4M H;  4OON A;  1WD0 A;  2Y0S G;  5C0X J;  3T4A C;  1KHI A;  3BZC A;  1KTK A;  2RDF A;  1PHJ A;  1K8A C;  2QF7 A;  3QOJ A;  4YHH Q;  3TDQ A;  3ERQ A;  1RTO A;  3U9O A;  3CU7 A;  1SYD A;  3RN5 A;  1LLR D;  3HOX G;  1EIG A;  1I5F A;  1SNQ A;  1VCI A;  3OHX C;  3DM1 A;  5LMU Q;  2JA5 H;  1EIY B;  2K5Q A;  4YCV A;  4K8J A;  1IYU A;  4JI0 L;  4G4K A;  1TWG H;  1KIX A;  1K8G A;  2JE6 I;  3HOV G;  1SNM A;  3I2Z A;  4HIO A;  3T1Y L;  2E2H H;  2RSO A;  4X62 L;  1Y1W G;  4OX9 Q;  1UE6 A;  1NY4 A;  2ZM6 L;  1SNC A;  2K75 A;  4B9X A;  1HFN A;  2VXW A;  1CTM A;  2B2U A;  4CKC A;  4JI4 L;  1U4L A;  2A73 B;  1CKO A;  1SR3 A;  1EQV A;  1SE2 A;  4IUV A;  2NVY B;  2B8F A;  2EZV A;  2RF4 A;  1O7Y A;  1BQQ T;  5JPM C;  4GN4 B;  2QKI C;  5IYC H;  1VQ6 A;  5EBC A;  2AQ2 B;  2PCF B;  3QIA A;  3ULP A;  3Q8D A;  3AQQ A;  2BE5 C;  3EQL C;  4KMU C;  5D3I B;  1HA5 A;  3K5O A;  1YZ6 A;  1TXY A;  2L15 A;  3U50 C;  5IYD H;  3KDF A;  5JEA H;  2CQO A;  3CHB D;  2R3Z A;  5CV7 A;  2MO1 A;  1E2Z A;  2A5H A;  2EJM A;  1EFI D;  1SE8 A;  3BVG A;  3D4W A;  4IJL A;  4HJ7 A;  3QOL A;  3JAM L;  1D1I A;  3U4Z A;  2HDL A;  2CHB D;  1S5E D;  3G71 A;  4UY8 C;  3I4M B;  4K6L A;  5I6Y A;  3PO3 H;  4AYB B;  3SVM A;  1GJX A;  1FNU A;  2PMZ E;  2UUB Q;  4NXM Q;  1RCV D;  1IHZ A;  1YNJ C;  1SDF A;  2QCP X;  3DEO A;  3KJP A;  3GTG H;  1MSG A;  2UU9 L;  5FO9 B;  4FF2 A;  4K0K L;  1FD7 D;  1L0Y B;  4PZ8 A;  1K83 H;  4RKB A;  3PSI A;  2FXQ A;  3KLS A;  4QGU A;  4JI5 Q;  1F9S A;  3C3L A;  3ND8 A;  4HR7 B;  1I50 H;  3U58 A;  1WTP A;  2B8G A;  3SDZ A;  3NXW A;  4RMF A;  5LMN W;  2K32 A;  3J80 L;  5JAV A;  4DR4 L;  3HOU B;  1L0W A;  4DFA A;  2AQ3 B;  3VR5 A;  4IFD J;  3IRB A;  3CCE A;  2XNA C;  4A3J B;  1YI2 A;  4HN7 A;  3ND9 A;  1A2T A;  3K0Y A;  1II3 A;  3I4O A;  2G9D A;  2SOB A;  5CV4 A;  5LMN Q;  1V43 A;  3A54 A;  3PV0 A;  3S9W A;  5KIX A;  3WOF A;  1I3Q H;  2F3W A;  1E7Z A;  3GD7 A;  4R8I A;  1CT1 D;  2NZ1 D;  5M3M B;  1XXG A;  1GO3 E;  3PF5 A;  1D2B A;  3MXU A;  1PTO D;  2AUJ D;  2QA4 A;  1XNQ Q;  3I72 A;  1DON A;  3LX0 A;  3N52 A;  4AQY Q;  1BF4 A;  4DR1 L;  2B63 B;  4JBW A;  1LTI D;  1N8R C;  3I4N B;  4B3S Q;  2BH2 A;  5GRO A;  3NEN A;  1YHB A;  2F0F A;  4B08 A;  4CHT B;  3VYU A;  3HOY H;  1L1O A;  1Y1V H;  2ICE C;  4HAE A;  3NP8 A;  5IGD A;  2Q2U A;  1CZW A;  2J0T D;  5BN3 A;  1KLG D;  2BOS A;  1TY2 A;  3KF6 A;  4GLV B;  1Z47 A;  3CP0 A;  2YTY A;  3EJI A;  4QUC A;  1PH7 A;  3NK9 A;  1W2B A;  4ME3 A;  3RUZ A;  1QWY A;  1Y8N B;  2K4K A;  2NZH A;  4HSP A;  4JI1 L;  1N36 Q;  4GZY C;  1STB A;  2QIL A;  3MFY A;  3F1Z A;  4HJ5 A;  1ESF A;  5JPN C;  3CCM A;  2HDM A;  4ABN A;  4IQZ A;  3HRZ C;  1TT2 A;  1UEB A;  2MUY A;  1K9M C;  5M5Y B;  2WB1 E;  4L6T B;  4YCW A;  1I94 Q;  4DUY L;  4DV5 L;  1CI3 M;  4RHS A;  1HUM A;  3MZ5 A;  3A0J A;  2NVT H;  4DNT B;  3PIO A;  1KAW A;  4DF7 A;  2JA6 H;  1G2T A;  1N32 L;  4YWK A;  3I56 A;  1ICW A;  3SHL A;  4DR3 Q;  3KLR A;  2ZT9 C;  2A6E C;  1F2Y A;  3K5M A;  2F1M A;  3I55 A;  2DNC A;  1XMO Q;  1SBB B;  2J7Z A;  1PH8 A;  1L0X B;  2HIV A;  2F4I A;  1QNU A;  1MD2 D;  3I4M G;  4AYB G;  1AFP A;  3OMG A;  4KHP L;  3PO2 H;  1FNV A;  2WII B;  1WTV A;  1CQF A;  1C0A A;  1AN8 A;  2UXB Q;  1H9J A;  2IPK D;  4HTH A;  4L5R C;  5C4J B;  1A3T A;  2N3S A;  3J7A V;  4K14 A;  4DV3 L;  1T5X D;  4NB3 A;  3B6Y A;  4DN4 M;  1RF2 D;  4DR2 Q;  1WVL A;  1I4P A;  2IWH A;  5FLX c;  1PTO B;  4JI7 L;  4XXE A;  4A3B B;  4IUQ A;  2K28 A;  4MTK A;  1GUT A;  4DGZ A;  2KJX A;  3P20 A;  3CW2 C;  2F4V Q;  4B3T L;  3A55 A;  3HOU G;  1HQM C;  1N33 Q;  1JOR A;  1O7L A;  2F0U A;  2DNE A;  1DOL A;  1GUG A;  4ZKC B;  4A93 H;  4A3J G;  2RSN A;  2XWJ B;  2A6H C;  2E2J H;  2JA8 H;  3FPP A;  1QG7 A;  3H6M A;  1PYB A;  3GO5 A;  3RZD H;  1JT8 A;  3A5Z B;  4OWT B;  2RDH A;  4IUN A;  2UUA Q;  1E1T A;  4ME5 A;  1FR3 A;  3O13 A;  1VQN A;  4PV1 C;  4GS3 A;  3BG3 A;  5CR3 A;  3R93 A;  4JI8 L;  5M3M G;  2EIF A;  3RZO B;  3RD4 A;  3CC4 A;  1JOO A;  4F88 A;  1E24 A;  1IYJ B;  5I4D A;  2GA4 B;  1QVG A;  3NWT A;  4X64 Q;  3J81 j;  2AUK A;  4MNO A;  2OWO A;  4JYA L;  2B63 G;  1BOS A;  4KY5 A;  4POF A;  1CZG A;  2HHH L;  4LF6 Q;  2LKV A;  5I6W A;  4P73 A;  4YCU A;  2I46 A;  3GQB A;  4DUZ Q;  1AH9 A;  1YJN A;  4GNX A;  4ALP A;  2IHE A;  2OTJ A;  4DAY B;  4KKT A;  1HPC A;  3U4V A;  1ILQ A;  5IT9 E;  4LK1 C;  2RBM A;  4R4T A;  1CKN B;  3VA5 A;  1YIT A;  2NN6 I;  1O78 A;  3TZU A;  1KLU D;  4WFN 3;  4DR5 L;  1LYL A;  4CKE A;  3WWV A;  3M4Y A;  4P75 A;  1AEX A;  2EOT A;  1OTC A;  1STE A;  3LWU A;  1SLJ A;  2KCN A;  1O7I A;  2M9V A;  3KK7 A;  1PZI D;  2UUC L;  5DEH A;  5C4X H;  2KHI A;  2F0M A;  4A3G B;  1F9P A;  2HUG A;  2CKZ B;  1HZ9 A;  1UE1 A;  2NVQ B;  1HFG A;  4GN5 A;  1BCP C;  4JI0 Q;  4MTN A;  2E76 C;  5F2D A;  1BCP B;  4ZYS A;  1ESR A;  2KCC A;  1EQQ A;  4XTC S;  5IIF A;  1TR5 A;  2F0J A;  2F0Q A;  1PDQ A;  1MJE A;  1LT6 D;  1T5E A;  4RCO A;  3T1Y Q;  2NTT A;  4X62 Q;  2WAC A;  1YHQ A;  3MA2 B;  3GV6 A;  3GTQ B;  2ZM6 Q;  2HQL A;  3A8I E;  3PIP 3;  2ZXR A;  2AWN A;  1VQB A;  4RGT A;  4RHR A;  1IW7 C;  5CV6 A;  5EAY A;  2A1A A;  1I4X A;  5IOC A;  4HSV A;  1W6J A;  3WDN A;  3PF4 A;  1T9H A;  1YVC A;  3V96 A;  2ALY B;  5IGG A;  3GTO B;  1VQD A;  1YNN D;  2PPB C;  1PH2 A;  3HOZ B;  2L4N A;  1BNZ A;  2K5H A;  4A3M H;  3BS1 A;  3K7A H;  2BH8 A;  1ROD A;  1EIF A;  4JBK A;  2MO0 A;  3E3X A;  1H9S A;  1UEA B;  4LF4 L;  2R92 H;  1I4H A;  1NCV A;  1VMC A;  4C2M B;  5FLM H;  1OXV A;  3PGZ A;  2LY7 A;  4A76 A;  4PMC A;  3KJO A;  2IY5 B;  4H7B A;  1JB3 A;  4Z9C B;  4RGO S;  1VQP A;  5ELC A;  1VQG A;  1TVX A;  1B1Z A;  3VYT A;  2JA7 H;  2GVA A;  1UWV A;  1QZH A;  2Q8T A;  4CJ1 B;  1C4Q A;  4IOC A;  1KXL A;  4RGN A;  4OIK A;  4X6A H;  1Q1E A;  1IBM Q;  4HIK A;  5BR8 L;  1JQY D;  4KJO A;  5JJI A;  3BYT B;  2DN8 A;  2EY1 A;  4A3D H;  2E2D C;  1PZJ D;  1IYV A;  2TSS A;  1VQK A;  2Y0S B;  1I4R A;  1D5Z C;  3GTM H;  1F77 A;  4MHE A;  4DV0 L;  4DR6 L;  3RLO A;  3X3N A;  3GDE A;  2JXM B;  1K0R A;  3A8J E;  3Q6S A;  4K2L A;  4JV5 Q;  2A74 C;  4DR4 Q;  2VZA A;  3TSS A;  1CSP A;  1ZEQ X;  5IT9 c;  2B39 A;  4Y7N B;  1VS0 A;  4A3C H;  2A68 D;  3H09 A;  1JC7 A;  1K8M A;  4M1U B;  1W3S A;  1YBY A;  1EY8 A;  3CCJ A;  1R9T H;  4KKS A;  3S16 H;  1NR4 A;  1IBK L;  1QVF A;  3TQY A;  3GV3 A;  3T56 B;  2NVX B;  1RKN A;  3HP3 A;  1FL0 A;  1BUV T;  1IZ6 A;  4ZCK A;  4QY7 A;  5K36 H;  5KEE A;  1BXT A;  1JWM D;  1NMF A;  3M85 A;  3MHB A;  4BBS H;  2EXZ A;  1B2T A;  1OO9 B;  1PZK D;  1TWA H;  2X6L A;  4EQ5 A;  1DGS A;  3FRP B;  3PQI A;  3R8B A;  2I0Q A;  4KN4 C;  4XQN A;  1BO0 A;  2KCM A;  2V1C C;  4CKB A;  4Q5V A;  1I4G A;  5FOB B;  2NN6 G;  1NTG A;  2YTV A;  2A19 A;  4RG1 A;  3CMA A;  4G7H C;  4OIJ A;  1GM5 A;  3J7Z C;  4OHJ A;  2HQE A;  5CBE E;  2CFM A;  3S17 H;  3ONA B;  3TEH B;  3CCV A;  1MI2 A;  1GUS A;  4A93 G;  2VQF Q;  3Q0A A;  3OTO L;  1CSQ A;  3ITP A;  1ET9 A;  4CJ0 B;  1VQ9 A;  2JA8 G;  1NBW A;  1X3P A;  3AU7 A;  1X9N A;  4N8X 1;  1B50 A;  3EA6 A;  1E22 A;  3C1E A;  5C5M A;  1IL8 A;  3I70 A;  4ZUI A;  1PMR A;  1YEZ A;  4A3E H;  2BE5 D;  3BDC A;  4JI1 Q;  4QCL A;  1AP0 A;  1FGU A;  3WOE A;  4L5T A;  4BBR B;  3E0E A;  1QE6 A;  3HG9 A;  4ID6 A;  1E2V A;  2AKW B;  2R7F A;  5C6A A;  1Q12 A;  4KK7 A;  4DUY Q;  4UPA A;  2DJG C;  3MXN A;  1NNX A;  1J8I A;  2K5W A;  4R4I A;  1LTT D;  1YJ9 A;  1N34 Q;  2VUM H;  3PCO B;  1TS4 A;  4KHV A;  5KYL A;  3J81 c;  1YNJ D;  5JJK A;  3W5O A;  4KKU A;  1FJG L;  2CW0 C;  5M5X B;  3E0J A;  5DM6 3;  3FKI H;  2H4O A;  2J4X A;  4LMQ D;  5AJ3 L;  1J9O A;  1R4Q B;  1KC8 C;  3R2T A;  5FJ8 H;  4GLA C;  2D62 A;  3SGI A;  5JOB A;  1SYE A;  1JIC A;  4EVO A;  3KLS X;  4KHP Q;  5CBA E;  5ELN A;  3KOJ A;  3DWP A;  2HCI A;  1Y8O B;  5G3L F;  3AMU A;  4DV7 Q;  5TSS A;  5L37 A;  2B2U C;  4UP8 A;  4B3R L;  2VY3 A;  2G5D A;  4DV3 Q;  2AQ1 B;  2GVB A;  4ULL A;  4GOP C;  4LF7 L;  1UAP A;  4GOP B;  2EJG C;  3AFQ A;  4X66 L;  4JI7 Q;  1ML0 D;  1EL0 A;  1SND A;  3BZK A;  3M3Y B;  3M7N A;  4FO2 A;  5ELE A;  4B3T Q;  3A7A B;  1VF7 A;  4A4I A;  3STB C;  1K73 C;  2O4X A;  4G7Z C;  2E75 C;  3AFP A;  3UDX A;  1QVC A;  3W2D A;  2JEA I;  4OWX B;  2N8N A;  1AZP A;  2EPB A;  1B70 B;  1QUQ A;  1U5K A;  3KUP A;  3TS0 A;  3ERO A;  4I7Z C;  1JWU D;  1V9P A;  1TWH B;  4JBJ A;  3NBH B;  2WIN B;  1TS3 A;  5IT9 L;  3T1H L;  2KBN A;  1TWC H;  2CVR A;  2F0N A;  4JI6 Q;  1EY9 A;  3K59 A;  3OW7 A;  1UE5 A;  4DV4 L;  1K8O A;  1F9Q A;  1HA6 A;  1JR0 D;  1V1Q A;  3DMU A;  3S1R B;  2A8V A;  4JYA Q;  1WTW A;  3MC0 B;  3MVV A;  4J15 A;  4OXP A;  4PMB A;  2HHH Q;  4LUO A;  2JA7 G;  1ENA A;  1HH2 P;  1DZ1 A;  1W6K A;  4G7O C;  3CRL C;  1VF5 C;  3UE1 A;  3GTP B;  2QGQ A;  4BXX H;  3ERS X;  1Q82 C;  4ZLT F;  5LL6 X;  1G91 A;  4K6D A;  1G2S A;  3H0G H;  3UDF A;  2FJ2 A;  3A8K E;  4P72 A;  4DV1 Q;  4LF5 L;  4LFA L;  3SR1 A;  1HNX L;  1RTN A;  1DJR D;  4EQO A;  4XYO A;  1B9M A;  3CME A;  1GUN A;  4BS9 A;  1MIU A;  4DXG A;  5C4Z A;  5JJL A;  1GKH A;  1EQR A;  2KEE A;  2JA5 B;  1PH9 A;  1IXR A;  4TRD A;  1TWG B;  1Q8I A;  2IL8 A;  4BBR G;  5KYI A;  4LFC Q;  3GTL H;  2E2H B;  2A6E D;  1B53 A;  2AWO A;  3MXG A;  5D65 A;  1RJT A;  1ZXT A;  3QR8 A;  4DV6 Q;  2IJ0 A;  2Q2H A;  1OXX K;  1JOQ A;  3A56 A;  3VYS A;  4NMZ A;  1KNA A;  2SEB D;  2OCE A;  1EEI D;  1SJH D;  4NW2 A;  4IJH A;  3HOW H;  2C5C A;  1L1O C;  1EZ6 A;  4FP5 D;  4KY6 A;  3S2H H;  1PRT C;  3I73 A;  4C3H H;  4IPG A;  3HKZ B;  1EOT A;  1S5D D;  4YWM A;  1JWS D;  5IGF A;  1AW7 A;  2K5D A;  1DOK A;  4MIU A;  5IP7 H;  1TWF H;  3L3O C;  1Q81 C;  4TQU S;  3KF8 B;  2VQE L;  4RA8 A;  2N49 A;  2OTL A;  5FLX E;  5CYU A;  2GN5 A;  1WFQ A;  4XIG S;  4LUZ A;  3T51 B;  4FXD A;  5C0X H;  5IP9 H;  5M3F H;  4HMJ A;  1X3E A;  3PO3 B;  4BA2 I;  4YIJ A;  3P7J A;  4JI2 L;  3GTG B;  1VQE A;  4JBM A;  3RLF A;  3QG1 A;  2A6H D;  1QNK A;  1F9R A;  3MAQ A;  3Q24 A;  4HID A;  1SN8 A;  2L12 A;  1KNE A;  1JE4 A;  4DAV A;  5IGC A;  1K83 B;  3AB9 A;  1U4R A;  3K5N A;  2EYP A;  4N9T A;  1XPU A;  5BR8 Q;  2R61 A;  2WFW A;  1I50 B;  2YU9 H;  3PUW A;  4BY1 H;  3I90 A;  2NZO A;  5ELO A;  3EIV A;  4ZAI A;  1G8Z D;  3OYY A;  4IPH A;  5C3E H;  1EYG A;  1QZG A;  4CDC C;  2K1B A;  3D3R A;  2Q8I B;  1WTH A;  4DV2 L;  4DR6 Q;  2WV6 D;  3FHW A;  4FYD A;  4X3U A;  1XMQ Q;  2NUC A;  1SE4 A;  2L55 A;  1STG A;  2BA0 A;  4DR7 L;  1RHP A;  3U9S A;  4XT3 B;  3KBG A;  4DK1 A;  1STA A;  1EIH A;  4JC0 A;  4ZRZ A;  1NR2 A;  2UXD Q;  3CD6 A;  1Q7Y C;  1I4Q A;  1I3Q B;  4RKL A;  1JJC B;  3IKJ A;  4X3S A;  5JJZ A;  4B3M L;  3FKI G;  2EY5 A;  2D9U A;  4X3T A;  4FF3 A;  3OW2 A;  4CBV A;  4IN3 A;  2ENB A;  3CQZ H;  3S14 H;  1M1K C;  1D5X C;  3LGJ A;  4F87 A;  5C0X I;  3TP6 A;  2PW7 A;  2RQX A;  2F52 A;  2NYZ D;  4CDF C;  5EJW A;  1HTL D;  2B2T C;  2KEN A;  3VR6 A;  1S72 A;  4QMG A;  3LWE A;  1BCP D;  4K2K A;  1XNR L;  3FP9 A;  1PYS B;  3HOY B;  5COY A;  2C35 B;  1Y1V B;  4O0A A;  3G48 A;  4AIM A;  2LS0 1;  3S1M H;  1TS5 A;  4PMW A;  2C9O A;  2TMP A;  4OO1 H;  1ET6 A;  4QJF A;  3K6O A;  2KHS A;  3M4O H;  4OGQ C;  2L11 A;  1QOH A;  2FIN B;  2JA5 G;  4PZ6 A;  1ZKO A;  4R8N A;  4IFD H;  4GKJ Q;  2PNR C;  3OTO Q;  1IW7 D;  1IKM A;  1IBL Q;  2XGT A;  1E2W A;  1PH4 A;  4DA2 A;  2K14 A;  2N78 A;  1U4P A;  2NBF A;  2PI2 E;  2JYO A;  1EWI A;  4C1N K;  3H3V H;  5E4X A;  4A75 A;  3ULL A;  5NUC A;  4QIW B;  2EY6 A;  4A3I H;  1NUC A;  1D5M C;  5FO8 B;  4NXN L;  4GNX C;  4LJZ C;  1EOV A;  1VQ4 A;  1UE7 A;  2ICI A;  2B3G A;  3X3M A;  1BR9 A;  4FXG C;  5IYC G;  2NVT B;  2EJF C;  4MZ9 A;  3HKZ G;  1O7Z A;  3NE5 B;  4B9W A;  4YHH L;  2JA6 B;  1ZYR C;  5IYB H;  2PZU A;  4C3I H;  4C3J H;  1EQT A;  3K7U C;  2LSS A;  2JEB I;  3S2D H;  1VQI A;  2X6G A;  3EVQ A;  1SYC A;  5H1S E;  5IYD G;  2B2W C;  1XJV A;  5JEA G;  2K01 A;  4YY3 Q;  1PFN A;  2E2I H;  5IGB A;  5EPL A;  2EY2 A;  2O5J C;  1VQ7 A;  1A15 A;  1ASZ A;  4KHZ A;  5C5L A;  2ZTC A;  4BXX G;  1A3U A;  2OF1 A;  2RHQ B;  5AJ3 Q;  3P75 A;  4LF9 Q;  4OX9 L;  3PO3 G;  1M8A A;  2ASB A;  3OIP A;  1X55 A;  2RCF A;  1HR0 L;  4OEM B;  3S1M B;  3PO2 B;  4UP9 A;  1PH6 A;  4IPD A;  4OO1 I;  2R93 H;  5HUR A;  5K5P A;  1EY4 A;  1VQ8 A;  1DM0 B;  2X69 A;  1CA6 A;  1SFO H;  4LUV A;  2DY7 A;  2PO4 A;  1F2M A;  5GQO A;  1KL9 A;  5DM7 3;  1LTL A;  2R7Z H;  3J81 i;  2D2C C;  4KTA A;  4A3L H;  1SEB D;  3UDG A;  1WD1 A;  3H3V C;  4K5X A;  2IX0 A;  2FFK B;  4PG3 A;  1A63 A;  4ILW A;  2M2L A;  3H3V I;  1RDP D;  3CC7 A;  3DLL A;  4A93 B;  4DK3 C;  2Z6K C;  2E2J B;  2BA1 A;  2JA8 B;  4GKK L;  2UUB L;  2RA4 A;  2XN9 C;  3I4L A;  3RZD B;  4NXM L;  1A6X A;  5DNF A;  3D6C A;  4A3F H;  1S40 A;  2Y0S E;  1PTO F;  1WCM H;  2G9H D;  2QW7 A;  5ELF A;  3IFD A;  4JI4 Q;  4JI5 L;  2NTS A;  5M5W H;  5FKA C;  1B3A A;  4BY7 H;  3GTK H;  1I6H H;  1KQS A;  2ZXP A;  1F2L A;  4YWL A;  3ICE A;  4IUU A;  2VNU D;  2L1B A;  1HCZ A;  4MN3 A;  5I2X A;  2QEX A;  2K5V A;  2RKS A;  1HZA A;  1Y8P B;  3L2P A;  3HOX H;  3W1B A;  3KYH C;  4DAY A;  3H91 A;  1E1O A;  4NPS A;  3L0O A;  1A62 A;  1CKN A;  1H9R A;  3HOY G;  1Y1V G;  2PI2 A;  5LMN L;  4J1M A;  3MTS A;  3HOV H;  4BY1 G;  5T1I A;  1V1P B;  1QCB D;  2Z9H A;  3H94 A;  4LFA Q;  1WTQ A;  1Y1W H;  4LF5 Q;  4HED A;  2KUM A;  4E6I A;  1WI5 A;  2Z4H A;  3NQT A;  3PIP A;  4R9W A;  2RVL A;  4ZQ3 A;  1J5E L;  4XDX A;  3G4S A;  1XNQ L;  5C4X B;  2UU9 Q;  3ZJY C;  3S1Q H;  2F3V A;  4I65 A;  4K0K Q;  2IX1 A;  2RHS B;  3M4Q A;  5BN4 A;  1PH3 A;  4KJN A;  2I5H A;  2AMC B;  2QDB A;  3SEB A;  1RL2 A;  3KLW A;  1WTR A;  4FF4 A;  4QQB X;  3CF5 A;  3OIQ A;  4B3S L;  3J81 E;  4JW0 A;  2WKD A;  2XRS D;  3OWF A;  3NQI A;  5M9O A;  2CW0 D;  3EN2 A;  4CGY B;  2L9H A;  1PXU A;  3TP8 A;  5FLX L;  3DXJ C;  3TME A;  2Z6B A;  4DPG A;  3G7L A;  1PFM A;  1XYI A;  4DK0 A;  2JA6 G;  1LO5 D;  1EY5 A;  5J3B A;  3EFX D;  3QJY A;  5E1F A;  3GTK B;  2F0D A;  1FYC A;  2K7V A;  2KED A;  1BCP F;  4R4C A;  4A3M B;  3K7A B;  2PYK A;  1SMX A;  4R1J A;  5FK9 C;  4BA1 I;  1N36 L;  5E3F A;  1NAP A;  4KLK A;  1HNW L;  3GTJ H;  4APV A;  2R92 B;  2VQE Q;  1BKB A;  3S15 H;  1L2F A;  2PQA B;  3PO2 G;  2E8G A;  4OO1 G;  3TN2 A;  4EGV A;  2UXC L;  4DR1 Q;  1EY6 A;  1NSN S;  1ICF B;  1GHJ A;  3STB D;  3SXH A;  3S1N H;  1LT3 D;  3IAY A;  4JI2 Q;  2JA7 B;  1KRT A;  1VQM A;  3JC6 6;  1VQH A;  2ZTD A;  4HCS A;  1D1K A;  1G29 1;  4XQJ A;  3NTI A;  3K80 C;  1Q8K A;  1SE3 A;  4R4O A;  1KD1 C;  4A3D B;  3TS2 A;  1G51 A;  3GTM B;  4LFB L;  2MGS A;  4PZ7 A;  1KAB A;  4N8F A;  5J1Z A;  4DXF A;  4L63 B;  1NE3 A;  5IE8 A;  1K0S A;  4XYQ A;  2ZJQ A;  3K5L A;  5ELD A;  3P1H A;  4FF1 A;  1JJG A;  2F0P A;  4JK1 C;  5C3X A;  4CJ2 C;  4A3K H;  1FNW A;  1HNZ L;  2PZT A;  2ID0 A;  4C3J G;  2KEC A;  4H02 A;  1R9T B;  5LHY 1;  5JEA J;  2KVM A;  1SXT A;  3S16 B;  2OQ0 A;  3URY A;  1CK1 A;  4J6H A;  4PQX A;  2YYZ A;  4DV5 Q;  2N88 A;  3N6R A;  1PVO A;  3ULJ A;  5FO7 B;  2BDO A;  2D0P A;  5GAH C;  1C48 A;  4OWW B;  1GXD C;  2B2V A;  5CV9 A;  1N32 Q;  1C8C A;  1HZB A;  4FXK C;  4BBS B;  4HJ8 A;  4DNR B;  3ER0 A;  2CQA A;  1EFW A;  1TWA B;  2OEO A;  3FEW X;  2WP8 J;  1YIJ A;  4N9P A;  3UE0 A;  5CV8 A;  1WJJ A;  3TP5 A;  3S1N B;  2Q2T A;  4IPC A;  2CWA A;  2EYJ A;  4Q0F A;  3GP7 A;  2R7Z G;  2NB0 A;  1OXS C;  4NDX A;  4TKO B;  1LM0 A;  2R6G A;  1DCZ A;  4A3L G;  1LV9 A;  2NVY H;  3OOC A;  5C4X G;  4OEL B;  3S17 B;  2FMM A;  3W3A A;  3FVQ A;  2PW5 A;  1AE3 A;  2K33 A;  4RFB A;  2EYO A;  5IY0 A;  1PRT D;  4DUZ L;  4A3K B;  3MFG A;  4J8Q A;  1B44 D;  4A3E B;  1SAP A;  3H15 A;  4AYB E;  5CC4 A;  3CC2 A;  1CFM A;  3DWQ A;  2O2L D;  1VQF A;  1ONL A;  3KDF B;  1KDB A;  1PFB A;  3F2D A;  1EWC A;  3SK6 A;  3E9I A;  1DD2 A;  4TVA B;  1WTX A;  1S5C D;  2EDG A;  2EE1 A;  3FDT A;  5EKL A;  2VUM B;  1TKW B;  1SRU A;  1EZ8 A;  1LT5 D;  2K04 A;  4GN3 B;  2Q2I A;  5EPK A;  1SYF A;  3F2U A;  4A3M G;  1SMY C;  4G57 A;  3A7L A;  2MJ8 A;  4JI8 Q;  1HR0 W;  1TS2 A;  4V19 0;  4LF8 L;  1UUP A;  2K5N A;  5HY6 A;  3TRZ A;  2R92 G;  1A3V A;  3FKI B;  1VQC A;  5FLM G;  4K5W A;  3BZD B;  5I9P A;  2A69 C;  2B2Y A;  2PZW A;  1MJC A;  5C44 H;  2EQS A;  2XVS A;  4JOI A;  3HOU H;  3I8Z A;  3HKZ E;  2I5L X;  1HR0 Q;  3TRE A;  2DJF C;  4XT1 B;  5JVH 3;  1JE5 A;  4A3J H;  1U9R A;  2WAQ B;  3CPF A;  1DYQ A;  3OPO A;  4U68 A;  2CH4 A;  1TQO A;  2F0T A;  4GOP A;  1LTR D;  3KFU A;  4A3D G;  5A35 A;  3K81 C;  3R3O A;  4HIM A;  4M8A A;  3BJU A;  1CUK A;  1V8Q A;  3NTH A;  1SYG A;  4HJ9 A;  4DR5 Q;  3EBE A;  1M4V A;  1STY A;  5E4W C;  1MKH A;  5M3M H;  1B3Q A;  1BVS A;  1TII D;  2F0V A;  1EU4 A;  1RD9 D;  2UUC Q;  2LXJ A;  4LNQ A;  4KD3 A;  1P16 A;  2RDG A;  1KDA A;  4IUT A;  4A3C G;  3E5S A;  4RH6 A;  3I7F A;  5KND A;  4GKK Q;  2B63 H;  1LTS D;  3RN2 A;  2JP1 A;  3VDY A;  3I4N H;  4I7A A;  3PUV A;  3NBH A;  2E5L L;  1Q90 A;  4H44 C;  3I91 A;  3VA7 A;  2D5D A;  2PQE A;  3KBX A;  1E3P A;  3CRK C;  1IBM L;  3T16 A;  5K36 G;  1CA5 A;  2KCT A;  3G6E A;  3Q23 A;  2VW9 A;  3NWS A;  1TWC B;  2JJQ A;  4IUR A;  4WJW A;  2MQH A;  4BBS G;  1L1O B;  5GAE C;  4EX5 A;  2L5T A;  3DUZ A;  2ZJP A;  1PRT B;  4KN7 C;  1WYD A;  4OL7 A;  5C44 B;  3K57 A;  3CAM A;  2CWP A;  1PH1 A;  4JV5 L;  1PFS A;  3E6Z X;  5IGE A;  1EY7 A;  2JQO A;  1CHP D;  2VB3 X;  3V05 A;  1XWE A;  5EQ0 A;  2BCO A;  3KF6 B;  1HTP A;  3S24 A;  3TP7 A;  1EY0 A;  2ZTE A;  3A74 A;  1VQJ A;  2XSC A;  2MFI A;  1R4P B;  4LF4 Q;  2WKC A;  4DAM A;  5M5Y H;  3H0G B;  5EPJ A;  3J81 L;  3D0F A;  5DLQ E;  1FGB D;  2HCC A;  2F0S A;  4H13 C;  4S3S A;  4HMI A;  3CPW A;  4KV6 A;  2CCZ A;  3SK5 A;  1J5E Q;  4DNI A;  3FPU B;  5I9O A;  5J22 A;  1VQA A;  4A3K G;  2XRQ D;  3DHQ A;  2PMZ B;  1ZYR D;  4A3E G;  4X65 L;  3HFZ B;  3PMF A;  4F8M A;  2K05 A;  4P71 A;  3GTL B;  2JK8 A;  4DV0 Q;  1LAB A;  3IFT A;  1XPR A;  5C3W A;  2LXK A;  1QIL A;  3I3C A;  2Z8L A;  1P8L A;  5BN5 A;  1STH A;  3PIO 3;  3RLN A;  1VMP A;  4IZ8 A;  1EYC A;  1YHA A;  2VUM G;  4FDB A;  4RWS C;  3HOW B;  2KA7 A;  2PNH A;  4IAL A;  3J7A F;  3S2H B;  1GUO A;  5C4J H;  4C3H B;  2VQF L;  2YV5 A;  3A5U A;  4LAA A;  2LMC B;  1IBK Q;  1BBW A;  1HUN A;  4XQQ A;  4QIW E;  3KF8 A;  1PTO H;  4LWC A;  1TWF B;  1X3F A;  3BYY B;  3RR5 A;  2N55 A;  4A3B H;  1B7Y B;  3QB3 A;  5FJ8 G;  1HNW Q;  4BWG B;  3BVZ A;  3NEM A;  2EYF A;  5M3F B;  2WAQ G;  4UAI A;  1LT4 D;  4ZK9 B;  1MGS A;  3BDO A;  3TZD A;  2UXC Q;  1PRT F;  1A2U A;  3VR2 A;  5A2Q E;  1N34 L;  1H9K A;  4PNY A;  3E9H A;  4L8J A;  1PA6 A;  5ISR A;  4JI3 L;  5EBD A;  1TY0 A;  5IWA L;  1Q3L A;  3PUY A;  2YU9 B;  1H9M A;  2F0E A;  4BY1 B;  1NMG A;  3RZO H;  3DWA A;  1LTB D;  4LFB Q;  5C3E B;  3SK8 A;  3F8T A;  1EWH A; 
#chains in the Genus database with same CATH homology
 4C56 C;  1JOK A;  5D14 A;  2XIW A;  3VYR A;  1Q1B A;  4WOR A;  4RAU C;  4IUP A;  3UI2 A;  1PYW D;  3NHH A;  3V2T A;  1PTO C;  4WRD A;  4QB4 A;  5D3D A;  2IW3 A;  2NN6 H;  3RMH A;  4EQN A;  1STN A;  1X3Q A;  2EYM A;  2Z4I A;  2WB1 B;  2F0K A;  3CQZ B;  3S14 B;  1PLF A;  2JSO A;  4C1N I;  1LTA D;  2B2T A;  1V1O A;  1S5B D;  3D31 A;  4HCE A;  2EYH A;  5HGT A;  5EKI A;  3HGB A;  2L0C A;  3NTK A;  5KNB A;  4UDU C;  1HQR D;  1XX8 A;  1AZQ A;  1XTC D;  2VB2 X;  1JCK B;  4KD4 A;  1QB5 D;  1MSH A;  4KI0 A;  3M4O B;  3CKI B;  4KY7 A;  4IFD I;  3NPP A;  5EKK A;  3C2P A;  1CM9 A;  1DOM A;  1Z6H A;  3IL8 A;  2K03 A;  1SSO A;  1X32 A;  1Z7T A;  3M7G A;  3HZX A;  2E74 C;  4A3I B;  3QO2 A;  1I6V C;  2Q8R E;  2SNS A;  1SYB A;  2OXP A;  4U67 3;  1SNP A;  1KAA A;  1H9S B;  1GUW A;  3L9A X;  4C3H G;  2FMC A;  4QF4 A;  2O5I C;  1HXY D;  1LAC A;  4NP5 A;  4C3I B;  4C3J B;  3D4D A;  2B2W A;  4H0L C;  3S2D B;  3BDL A;  3T53 B;  1UNS A;  1EYD A;  2F0I A;  2E2I B;  1QJO A;  5G3L D;  1CHQ D;  3SK4 A;  4F7X A;  5C0X G;  4ZUJ A;  3JAM E;  1WTO A;  3LNN A;  3ZYY X;  2LFN A;  3QWN A;  1EU3 A;  2R93 B;  4NKL A;  1MBY A;  5KRU A;  1SFO B;  3C1F A;  1IKL A;  3DEP A;  4V0B A;  1D6E C;  1EEF D;  1Y69 U;  1ENF A;  1BDO A;  3NBI A;  2R7Z B;  3TBI B;  2IX3 A;  5ELB A;  2F0G A;  3J80 E;  3D4R A;  4TSS A;  2F0W A;  1LTG D;  1ILP A;  5CGK A;  2KQ3 A;  4X3K A;  1EYA A;  1S5F D;  4FNF A;  4A3F B;  3FMC A;  1BBX C;  4QUF A;  1WCM B;  2F0L A;  5M5W B;  3J7Y W;  3Q22 A;  2V4D A;  4BY7 B;  1I6H B;  2NWG A;  3R2I A;  4P2C B;  3HOX B;  1TU2 B;  2QEJ C;  5I2Y A;  3SE0 A;  5COR A;  2MP1 A;  4O1N A;  5J39 A;  1OXU A;  1V1P A;  2F0H A;  3NSW A;  2F03 A;  3HOV B;  3OSO A;  1OXT A;  3NUC A;  3K58 A;  1Y1W B;  4IFD G;  3PUX A;  5CV5 A;  3VR3 A;  3S1Q B;  1O80 A;  4DAP A;  2B2V C;  5JVG 3;  1DXM A;  3MWY W;  3OMC A;  3OWE B;  1GHK A;  2IT1 A;  1SMY D;  3G6J B;  3HEJ A;  3C46 A;  1B9N A;  2MHV A;  3T13 A;  3MEH A;  4K5V A;  4RCN A;  5IOD A;  2M00 A;  4DU9 A;  1E0B A;  1ENC A;  3D6W A;  4K8I A;  2A69 D;  4C3I G;  1YNN C;  4EQP A;  4RGM A;  5KGU A;  5CMD A;  5A2Q L;  2EVB A;  1VDZ A;  2K6A A;  5EGT A;  3HS0 C;  1HHV A;  2EYL A;  3GTJ B;  5KNC A;  3S15 B;  1B4O A;  2F0O A;  1F2Z A;  1G6Z A;  2KOL A;  2FHT A;  2SNM A;  2DY8 A;  2Z1C A;  4ODG A;  3D8G A;  3VR4 A;  1CQV A;  3L7Z C;  2SDF A;  4FVM A;  3MXP A;  1SNO A;  2I07 B;  5DAU A;  4O42 A;  5LL6 S;  2H1E A;  1GOZ A;  5T1G A;  5C4H A;  2A68 C;  3BVM A;  5AFW A;  3PUZ A;  2B2Y C;  1HRJ A;  1SJE D;  2OT2 A;  2XWB B;  2MPM A;  1KDC A;  2ZXO A;  1U4M A;  2BDN A;  1S4Z A;  4ZKB B;  1WD0 A;  5C0X J;  3T4A C;  1KTK A;  2RDF A;  2QF7 A;  3QOJ A;  3TDQ A;  3ERQ A;  1RTO A;  3U9O A;  3CU7 A;  1SYD A;  1LLR D;  1EIG A;  1VCI A;  1SNQ A;  3OHX C;  3DM1 A;  2K5Q A;  4K8J A;  1IYU A;  4G4K A;  2JE6 I;  1SNM A;  2RSO A;  1SNC A;  4B9X A;  1HFN A;  2VXW A;  1CTM A;  2B2U A;  4CKC A;  1U4L A;  2A73 B;  1EQV A;  1SE2 A;  4IUV A;  2NVY B;  2B8F A;  2EZV A;  1O7Y A;  1BQQ T;  5JPM C;  2QKI C;  5EBC A;  2AQ2 B;  2PCF B;  3QIA A;  2BE5 C;  3EQL C;  4KMU C;  5D3I B;  1HA5 A;  3K5O A;  5JEA H;  3CHB D;  2R3Z A;  5CV7 A;  1E2Z A;  2A5H A;  2EJM A;  1EFI D;  3BVG A;  3D4W A;  3QOL A;  3JAM L;  1D1I A;  2HDL A;  2CHB D;  1S5E D;  3I4M B;  4K6L A;  5I6Y A;  4AYB B;  3SVM A;  1GJX A;  1FNU A;  1RCV D;  1IHZ A;  1YNJ C;  1SDF A;  2QCP X;  3DEO A;  1MSG A;  5FO9 B;  4FF2 A;  1FD7 D;  1L0Y B;  4RKB A;  3KLS A;  1F9S A;  3C3L A;  3ND8 A;  4HR7 B;  1WTP A;  2B8G A;  3SDZ A;  3NXW A;  2K32 A;  3J80 L;  5JAV A;  3HOU B;  4DFA A;  2AQ3 B;  3VR5 A;  4IFD J;  2XNA C;  4A3J B;  4HN7 A;  3ND9 A;  1A2T A;  3K0Y A;  1II3 A;  2G9D A;  2SOB A;  5CV4 A;  1V43 A;  3A54 A;  3PV0 A;  3S9W A;  5KIX A;  3WOF A;  2F3W A;  3GD7 A;  4R8I A;  1CT1 D;  2NZ1 D;  5M3M B;  1XXG A;  1D2B A;  3MXU A;  1PTO D;  2AUJ D;  3I72 A;  1DON A;  3LX0 A;  3N52 A;  1BF4 A;  2B63 B;  4JBW A;  1LTI D;  3I4N B;  2F0F A;  4B08 A;  4CHT B;  3VYU A;  2ICE C;  4HAE A;  3NP8 A;  5IGD A;  1CZW A;  2J0T D;  5BN3 A;  1KLG D;  2BOS A;  1TY2 A;  1Z47 A;  3EJI A;  4QUC A;  3NK9 A;  3RUZ A;  1QWY A;  1Y8N B;  4HSP A;  4GZY C;  1STB A;  2QIL A;  3MFY A;  1ESF A;  5JPN C;  2HDM A;  4ABN A;  4IQZ A;  3HRZ C;  1TT2 A;  5M5Y B;  2MUY A;  4L6T B;  1CI3 M;  4RHS A;  1HUM A;  3MZ5 A;  4DNT B;  4DF7 A;  1G2T A;  1ICW A;  3SHL A;  3KLR A;  2ZT9 C;  2A6E C;  1F2Y A;  3K5M A;  2F1M A;  2DNC A;  1SBB B;  2J7Z A;  1L0X B;  2F4I A;  1QNU A;  1MD2 D;  1AFP A;  3OMG A;  1FNV A;  2WII B;  1WTV A;  1CQF A;  1AN8 A;  1H9J A;  2IPK D;  4HTH A;  5C4J B;  1A3T A;  3J7A V;  4K14 A;  1T5X D;  4DN4 M;  1RF2 D;  1WVL A;  1I4P A;  2IWH A;  1PTO B;  4XXE A;  4A3B B;  4IUQ A;  2K28 A;  1GUT A;  4DGZ A;  2KJX A;  3P20 A;  3A55 A;  1HQM C;  1JOR A;  1O7L A;  2F0U A;  2DNE A;  1DOL A;  1GUG A;  4ZKC B;  2RSN A;  2XWJ B;  2A6H C;  3FPP A;  1QG7 A;  3H6M A;  3GO5 A;  2RDH A;  4IUN A;  4ME5 A;  1FR3 A;  3O13 A;  4PV1 C;  3BG3 A;  5CR3 A;  3R93 A;  3RZO B;  3RD4 A;  1JOO A;  4F88 A;  5I4D A;  2GA4 B;  3NWT A;  2AUK A;  1BOS A;  4KY5 A;  1CZG A;  2LKV A;  5I6W A;  2I46 A;  3GQB A;  4KKT A;  1HPC A;  1ILQ A;  5IT9 E;  4LK1 C;  2RBM A;  3VA5 A;  2NN6 I;  1O78 A;  3TZU A;  1KLU D;  4WFN 3;  4CKE A;  3M4Y A;  1AEX A;  2EOT A;  1STE A;  2KCN A;  2M9V A;  3LWU A;  3KK7 A;  1PZI D;  5DEH A;  4A3G B;  2F0M A;  1F9P A;  2HUG A;  2NVQ B;  1HFG A;  1BCP C;  2E76 C;  5F2D A;  1BCP B;  4ZYS A;  1ESR A;  2KCC A;  4XTC S;  5IIF A;  1TR5 A;  2F0J A;  2F0Q A;  1PDQ A;  1LT6 D;  1T5E A;  4RCO A;  2NTT A;  2WAC A;  3MA2 B;  3GV6 A;  3GTQ B;  3A8I E;  3PIP 3;  2ZXR A;  2AWN A;  4RGT A;  4RHR A;  1IW7 C;  5CV6 A;  1I4X A;  5IOC A;  4HSV A;  1W6J A;  3WDN A;  3V96 A;  5IGG A;  3GTO B;  2PPB C;  1YNN D;  3HOZ B;  2L4N A;  1BNZ A;  3BS1 A;  1ROD A;  1H9S A;  1UEA B;  1I4H A;  1NCV A;  1VMC A;  4C2M B;  1OXV A;  2LY7 A;  4PMC A;  4H7B A;  1JB3 A;  4Z9C B;  4RGO S;  5ELC A;  1TVX A;  1B1Z A;  3VYT A;  2Q8T A;  4CJ1 B;  1C4Q A;  4RGN A;  4OIK A;  1Q1E A;  1JQY D;  4KJO A;  3BYT B;  2DN8 A;  2EY1 A;  2E2D C;  1PZJ D;  1IYV A;  2TSS A;  2Y0S B;  1I4R A;  1D5Z C;  1F77 A;  4MHE A;  3X3N A;  2JXM B;  3A8J E;  4K2L A;  3Q6S A;  2A74 C;  3TSS A;  1ZEQ X;  2B39 A;  4Y7N B;  2A68 D;  3H09 A;  1JC7 A;  1K8M A;  4M1U B;  1EY8 A;  4KKS A;  1NR4 A;  3GV3 A;  3T56 B;  2NVX B;  1RKN A;  3HP3 A;  1BUV T;  5K36 H;  5KEE A;  1BXT A;  1JWM D;  3M85 A;  3MHB A;  2EXZ A;  1B2T A;  1OO9 B;  1PZK D;  2X6L A;  3FRP B;  3R8B A;  4KN4 C;  4XQN A;  1BO0 A;  4CKB A;  4Q5V A;  1I4G A;  5FOB B;  2NN6 G;  4G7H C;  4OIJ A;  4OHJ A;  2HQE A;  5CBE E;  3ONA B;  1MI2 A;  1GUS A;  3Q0A A;  3ITP A;  1ET9 A;  4CJ0 B;  1X3P A;  3AU7 A;  1B50 A;  3EA6 A;  3C1E A;  5C5M A;  1IL8 A;  3I70 A;  4ZUI A;  1PMR A;  4QCL A;  2BE5 D;  3BDC A;  1AP0 A;  3WOE A;  4BBR B;  1QE6 A;  3HG9 A;  4ID6 A;  1E2V A;  5C6A A;  4KK7 A;  1Q12 A;  3MXN A;  1J8I A;  2K5W A;  1LTT D;  1TS4 A;  4KHV A;  5KYL A;  1YNJ D;  4KKU A;  2CW0 C;  5M5X B;  3E0J A;  5DM6 3;  2H4O A;  2J4X A;  4LMQ D;  1J9O A;  1R4Q B;  3R2T A;  2D62 A;  5JOB A;  1SYE A;  1JIC A;  4EVO A;  3KLS X;  5CBA E;  3DWP A;  2HCI A;  1Y8O B;  5G3L F;  3AMU A;  5TSS A;  2B2U C;  2AQ1 B;  4ULL A;  1UAP A;  2EJG C;  1ML0 D;  1EL0 A;  1SND A;  3M3Y B;  3M7N A;  4FO2 A;  5ELE A;  3A7A B;  1VF7 A;  2O4X A;  4G7Z C;  2E75 C;  3W2D A;  2JEA I;  1AZP A;  2EPB A;  3KUP A;  3ERO A;  4I7Z C;  1JWU D;  1TWH B;  2WIN B;  1TS3 A;  5IT9 L;  2CVR A;  2F0N A;  1EY9 A;  3K59 A;  3OW7 A;  1K8O A;  1F9Q A;  1HA6 A;  1JR0 D;  3DMU A;  3S1R B;  1WTW A;  3MC0 B;  3MVV A;  4PMB A;  1ENA A;  1DZ1 A;  1W6K A;  4G7O C;  3CRL C;  1VF5 C;  3GTP B;  4ZLT F;  5LL6 X;  1G91 A;  4K6D A;  1G2S A;  2FJ2 A;  3A8K E;  3SR1 A;  1RTN A;  1DJR D;  4EQO A;  4XYO A;  1B9M A;  1GUN A;  4BS9 A;  5C4Z A;  4DXG A;  2KEE A;  2JA5 B;  4TRD A;  1TWG B;  1Q8I A;  2IL8 A;  5KYI A;  2E2H B;  2A6E D;  1B53 A;  2AWO A;  3MXG A;  5D65 A;  1RJT A;  1ZXT A;  2IJ0 A;  1OXX K;  1JOQ A;  3A56 A;  3VYS A;  4NMZ A;  1KNA A;  2SEB D;  1EEI D;  1SJH D;  4NW2 A;  2C5C A;  1EZ6 A;  4FP5 D;  4KY6 A;  1PRT C;  3I73 A;  3HKZ B;  1EOT A;  1S5D D;  1JWS D;  5IGF A;  1AW7 A;  2K5D A;  1DOK A;  4MIU A;  3L3O C;  4TQU S;  4RA8 A;  5FLX E;  5CYU A;  4XIG S;  3T51 B;  4FXD A;  5C0X H;  4HMJ A;  3PO3 B;  4BA2 I;  4YIJ A;  3P7J A;  3GTG B;  3RLF A;  3QG1 A;  2A6H D;  1QNK A;  1F9R A;  3MAQ A;  3Q24 A;  2L12 A;  1KNE A;  1JE4 A;  4DAV A;  5IGC A;  1K83 B;  3AB9 A;  1U4R A;  3K5N A;  2EYP A;  4N9T A;  2R61 A;  1I50 B;  3PUW A;  3I90 A;  4ZAI A;  1G8Z D;  2K1B A;  3D3R A;  2Q8I B;  2WV6 D;  4FYD A;  4X3U A;  2NUC A;  1SE4 A;  2L55 A;  1STG A;  2BA0 A;  1RHP A;  3U9S A;  4XT3 B;  3KBG A;  4DK1 A;  1STA A;  1EIH A;  4ZRZ A;  1NR2 A;  1I4Q A;  1I3Q B;  4RKL A;  3IKJ A;  4X3S A;  5JJZ A;  2EY5 A;  2D9U A;  4X3T A;  4FF3 A;  4CBV A;  4IN3 A;  2ENB A;  1D5X C;  4F87 A;  5C0X I;  3TP6 A;  2PW7 A;  2RQX A;  2NYZ D;  5EJW A;  1HTL D;  2B2T C;  3VR6 A;  4QMG A;  3LWE A;  1BCP D;  4K2K A;  3HOY B;  5COY A;  1Y1V B;  2LS0 1;  1TS5 A;  4PMW A;  2C9O A;  2TMP A;  4OO1 H;  1ET6 A;  3K6O A;  2KHS A;  4OGQ C;  2L11 A;  1QOH A;  2FIN B;  1ZKO A;  4R8N A;  4IFD H;  1IKM A;  2PNR C;  1IW7 D;  1E2W A;  4DA2 A;  1U4P A;  2NBF A;  2JYO A;  4C1N K;  5E4X A;  5NUC A;  4QIW B;  2EY6 A;  1NUC A;  1D5M C;  5FO8 B;  4LJZ C;  2ICI A;  3X3M A;  1BR9 A;  4FXG C;  2NVT B;  2EJF C;  3NE5 B;  1O7Z A;  2JA6 B;  4B9W A;  1ZYR C;  2PZU A;  1EQT A;  2JEB I;  2X6G A;  3EVQ A;  1SYC A;  2B2W C;  5JEA G;  2K01 A;  1PFN A;  5IGB A;  5EPL A;  2EY2 A;  2O5J C;  1A15 A;  4KHZ A;  5C5L A;  1A3U A;  2OF1 A;  3P75 A;  1M8A A;  3OIP A;  3PO2 B;  3S1M B;  4OO1 I;  5HUR A;  5K5P A;  1EY4 A;  1DM0 B;  2X69 A;  1CA6 A;  2DY7 A;  2PO4 A;  1F2M A;  5DM7 3;  2D2C C;  4KTA A;  1SEB D;  1WD1 A;  3H3V C;  4K5X A;  2IX0 A;  2FFK B;  4ILW A;  2M2L A;  1RDP D;  4A93 B;  2E2J B;  2BA1 A;  2JA8 B;  2RA4 A;  2XN9 C;  3I4L A;  3RZD B;  1A6X A;  5DNF A;  3D6C A;  1PTO F;  2G9H D;  5ELF A;  3IFD A;  2NTS A;  5FKA C;  1B3A A;  2ZXP A;  1F2L A;  4IUU A;  2VNU D;  2L1B A;  1HCZ A;  4MN3 A;  5I2X A;  2RKS A;  1Y8P B;  4DAY A;  3H91 A;  1H9R A;  4J1M A;  3MTS A;  5T1I A;  1V1P B;  1QCB D;  1WTQ A;  3H94 A;  4HED A;  2KUM A;  4E6I A;  2Z4H A;  3NQT A;  4R9W A;  2RVL A;  4ZQ3 A;  4XDX A;  5C4X B;  2F3V A;  4I65 A;  2IX1 A;  5BN4 A;  4KJN A;  2QDB A;  3SEB A;  1WTR A;  4FF4 A;  3OIQ A;  3J81 E;  2WKD A;  2XRS D;  3OWF A;  3NQI A;  5M9O A;  2CW0 D;  4CGY B;  2L9H A;  1PXU A;  3TP8 A;  5FLX L;  3DXJ C;  3TME A;  3G7L A;  1PFM A;  1XYI A;  4DK0 A;  1LO5 D;  1EY5 A;  3GTK B;  3EFX D;  3QJY A;  5E1F A;  2F0D A;  1FYC A;  2K7V A;  2KED A;  1BCP F;  4A3M B;  3K7A B;  2PYK A;  5FK9 C;  4BA1 I;  5E3F A;  1NAP A;  2R92 B;  4OO1 G;  3TN2 A;  4EGV A;  1EY6 A;  1NSN S;  1GHJ A;  3SXH A;  1LT3 D;  3IAY A;  2JA7 B;  4HCS A;  1D1K A;  1G29 1;  4XQJ A;  3NTI A;  1SE3 A;  4A3D B;  3GTM B;  2MGS A;  1KAB A;  5J1Z A;  4DXF A;  4L63 B;  4XYQ A;  3K5L A;  5ELD A;  3P1H A;  4FF1 A;  2F0P A;  4JK1 C;  5C3X A;  4CJ2 C;  1FNW A;  2PZT A;  2ID0 A;  4C3J G;  2KEC A;  1R9T B;  5LHY 1;  5JEA J;  2KVM A;  1SXT A;  3S16 B;  3URY A;  1CK1 A;  4J6H A;  4PQX A;  2YYZ A;  2N88 A;  3N6R A;  5FO7 B;  2BDO A;  1C48 A;  1GXD C;  2B2V A;  5CV9 A;  1C8C A;  4FXK C;  4BBS B;  4DNR B;  2CQA A;  1TWA B;  2OEO A;  3FEW X;  2WP8 J;  4N9P A;  5CV8 A;  3TP5 A;  3S1N B;  2EYJ A;  4Q0F A;  3GP7 A;  2NB0 A;  1OXS C;  4NDX A;  4TKO B;  2R6G A;  1DCZ A;  1LV9 A;  3OOC A;  3S17 B;  2FMM A;  3W3A A;  3FVQ A;  2PW5 A;  2K33 A;  4RFB A;  2EYO A;  1PRT D;  4A3K B;  3MFG A;  4J8Q A;  1B44 D;  4A3E B;  1SAP A;  5CC4 A;  1CFM A;  3DWQ A;  2O2L D;  1ONL A;  1KDB A;  1PFB A;  1EWC A;  3SK6 A;  1DD2 A;  1WTX A;  1S5C D;  2EDG A;  2EE1 A;  3FDT A;  5EKL A;  2VUM B;  1TKW B;  1EZ8 A;  1LT5 D;  2K04 A;  5EPK A;  1SYF A;  3F2U A;  1SMY C;  4G57 A;  3A7L A;  2MJ8 A;  1TS2 A;  4V19 0;  1UUP A;  1A3V A;  3FKI B;  4K5W A;  3BZD B;  5I9P A;  2A69 C;  2B2Y A;  2PZW A;  2XVS A;  3I8Z A;  4XT1 B;  5JVH 3;  1U9R A;  2WAQ B;  1DYQ A;  3OPO A;  4U68 A;  1TQO A;  2F0T A;  1LTR D;  5A35 A;  3R3O A;  4M8A A;  1V8Q A;  3NTH A;  1SYG A;  1M4V A;  1STY A;  5E4W C;  1TII D;  2F0V A;  1EU4 A;  1RD9 D;  4KD3 A;  2RDG A;  1KDA A;  4IUT A;  3E5S A;  4RH6 A;  5KND A;  1LTS D;  2JP1 A;  3PUV A;  3NBH A;  1Q90 A;  4H44 C;  3I91 A;  3VA7 A;  2D5D A;  2PQE A;  3KBX A;  3CRK C;  3T16 A;  5K36 G;  1CA5 A;  3Q23 A;  3NWS A;  1TWC B;  4IUR A;  4WJW A;  2L5T A;  3DUZ A;  1PRT B;  4KN7 C;  4OL7 A;  5C44 B;  3K57 A;  3E6Z X;  5IGE A;  1EY7 A;  1CHP D;  2VB3 X;  3V05 A;  1XWE A;  5EQ0 A;  2BCO A;  1HTP A;  3TP7 A;  1EY0 A;  2XSC A;  1R4P B;  2WKC A;  3H0G B;  5EPJ A;  3J81 L;  1FGB D;  2HCC A;  2F0S A;  4H13 C;  4S3S A;  4HMI A;  4KV6 A;  3SK5 A;  3FPU B;  5I9O A;  5J22 A;  2XRQ D;  3DHQ A;  2PMZ B;  1ZYR D;  3PMF A;  4F8M A;  2K05 A;  3GTL B;  1LAB A;  3IFT A;  5C3W A;  3I3C A;  1QIL A;  2Z8L A;  5BN5 A;  1STH A;  3PIO 3;  1VMP A;  4IZ8 A;  1EYC A;  4RWS C;  3HOW B;  2KA7 A;  4IAL A;  3J7A F;  3S2H B;  1GUO A;  4C3H B;  4LAA A;  2LMC B;  1HUN A;  4XQQ A;  3KF8 A;  1PTO H;  1TWF B;  3BYY B;  2N55 A;  3QB3 A;  4BWG B;  3BVZ A;  2EYF A;  5M3F B;  4UAI A;  1LT4 D;  4ZK9 B;  1MGS A;  3BDO A;  3TZD A;  1PRT F;  1A2U A;  3VR2 A;  5A2Q E;  1H9K A;  4PNY A;  4L8J A;  5ISR A;  5EBD A;  1TY0 A;  1Q3L A;  3PUY A;  2YU9 B;  1H9M A;  2F0E A;  4BY1 B;  3DWA A;  1LTB D;  5C3E B;  3SK8 A;  1EWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...