3NK9A

Crystal structure of staphylococcal nuclease variant delta+phs v74a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEAEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclease A
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nk9A00
3MEHA 5I9PA 4QB4A 4F7XA 4HMJA 5IGGA 3LX0A 1JOKA 5J22A 3TP6A 2SNMA 1EY7A 5JAVA 4DF7A 5KYLA 4KY5A 2EYFA 5IODA 1EY9A 4MIUA 3DHQA 5CV5A 1EQVA 3D6CA 2NUCA 3DMUA 1NUCA 1SYCA 2F0JA 4ZQ3A 3SK5A 4N9TA 1A3TA 1IHZA 4NDXA 1EY5A 3P75A 4KY6A 1SYFA 5EKLA 4ME5A 2EYJA 4KJOA 1STNA 2EYPA 1U9RA 4HTHA 1SNCA 4PMBA 5CGKA 1ENCA 2PW7A 3NQTA 4K2KA 4YIJA 1SNDA 3E5SA 3MXPA 4WORA 1SNPA 4KJNA 4ZUJA 4EQPA 1EY0A 1F2YA 2F0GA 2F0WA 2F3WA 2PZTA 2RBMA 2EY6A 5KGUA 2F3VA 4WRDA 1EZ6A 4PMCA 3QOLA 1KDAA 1TT2A 2PZUA 4H7BA 5CV8A 4B9XA 4IALA 4F8MA 1A3UA 2RDFA 5C4HA 4I65A 5DEHA 5IGBA 2F0TA 3D4WA 3TP7A 3RUZA 2OEOA 5I6YA 2F0OA 3OMCA 2PW5A 4K8JA 3D8GA 3C1EA 1KDBA 2F0NA 4K5VA 5HURA 4K6DA 3U9OA 2F0EA 1SNOA 1STGA 5CV9A 5J1ZA 2ENBA 4RKLA 5I6WA 5ISRA 2SNSA 5C5MA 3C1FA 2PYKA 5NUCA 2WACA 1SYGA 3OMGA 5EKKA 4HMIA 4K2LA 1F2MA 4DU9A 5IGFA 3NXWA 1SNMA 2F0KA 3P1HA 4S3SA 2HQEA 5K5PA 3NUCA 2F0DA 1STYA 3QOJA 2PQEA 2F0SA 1TR5A 4J6HA 5C3WA 5KEEA 2SOBA 4KHVA 2OF1A 4NP5A 4B9WA 5IIFA 2EYHA 4K5XA 4KV6A 5CV6A 4E6IA 3BDLA 3EVQA 1EY8A 1SNQA 5CR3A 1A3VA 2F0QA 5DAUA 4IUNA 1EY4A 5C5LA 3T13A 3MVVA 1SYDA 3EJIA 3SK4A 1EZ8A 3SR1A 3HEJA 1JOQA 4EVOA 4N9PA 5I9OA 2EY1A 2F0HA 5IGEA 1STAA 4ID6A 3BDCA 1SYBA 2RKSA 1KAAA 4RKBA 3V2TA 5CV4A 5CC4A 4OL7A 5C6AA 1II3A 2QDBA 4TRDA 4DGZA 3SK8A 1JORA 3MHBA 1SYEA 4PNYA 3MZ5A 1TQOA 4QF4A 5IGDA 3NHHA 1STBA 5M9OA 3OWFA 2M00A 4G57A 4QMGA 5KRUA 3NK9A 1KDCA 3SXHA 2OXPA 1NSNS 4ODGA 4K5WA 1RKNA 2EYOA 2F0FA 2KHSA 4K8IA 3SK6A 4EQNA 2F0IA 5JOBA 1STHA 2F0MA 3T16A 1AEXA 5HGTA 3NP8A 5KYIA 2LKVA 2KQ3A 2PZWA 2EY5A 1EYCA 5KIXA 1KABA 4EQOA 2F0VA 5E1FA 5J39A 2EY2A 4DFAA 5C3XA 3EROA 4R8NA 1A2UA 5IOCA 1A2TA 3D4DA 5C4ZA 2F0UA 4K14A 4J1MA 4KY7A 2EXZA 5EGTA 3TP8A 3OSOA 4ZUIA 4KD3A 2O4XA 4KTAA 1JOOA 1EYAA 3HZXA 1ENAA 1F2ZA 3ERQA 4IZ8A 1EYDA 2EYMA 3ITPA 3H6MA 3PMFA 3R3OA 4NKLA 5CV7A 3QB3A 3S9WA 2F0PA 1EY6A 3SHLA 2EYLA 4NMZA 4LAAA 3TMEA 4KD4A 3TP5A 2F0LA 3VA5A 5E3FA 5IGCA 5F2DA
chains in the Genus database with same CATH superfamily
2Z9HA 5LMUL 2JA5G 2SNMA 3K7AB 1ASZA 3DM1A 4UP7A 3E9IA 4AYBB 1EWHA 2KOLA 4GOPA 3F8TA 4QIWE 4LF8Q 1IHZA 1Y1WB 2EIFA 1WTQA 4DV2Q 4AQYQ 1D6EC 2IWHA 3CC2A 1C7YA 1E0BA 1SNDA 1CA5A 3F1ZA 1S3OA 4OWWB 1HR0L 4DR2Q 2NVTB 4C3IB 1I5FA 1VS0A 5I2YA 2KA7A 2IY5B 1GKHA 1EYGA 4QIWB 4BY1G 1FL0A 4P71A 4B3TL 1EUJA 3M4OB 3CW2C 2WB1E 1JJGA 1SNOA 3HOWH 3K6OA 3PGZA 3L3OC 2F4IA 3J7ZC 1VQEA 3VA7A 2VUMB 1DCZA 4KKTA 1MIUA 2K28A 1WI5A 2L11A 2UUAL 3CRKC 1B4OA 2Z4IA 1PLFA 4KHVA 5GAGC 4P73A 3CPFA 4R4OA 3ICEA 2WB1B 1EY8A 3I4MG 2HIVA 1SYDA 3EJIA 4DXGA 5CYUA 5KNBA 3R8BA 1H95A 1P16A 2K75A 5T1GA 1C0AA 4ID6A 5FJ8H 5LHY1 1ET6A 1WTWA 2EQSA 4P75A 3M7GA 3HOZB 1SYEA 3STBC 5IGDA 2R7DA 1STBA 4JV5L 1S5CD 5ELBA 3OW2A 2NVQH 4BBSH 1IKMA 3F2CA 1K9MC 4N8X1 1G2TA 1CQVA 1HTPA 2JA6B 1VQ5A 1SAPA 1G6PA 3JAML 1J6QA 2EY5A 2IL8A 2HDLA 4A93H 1KABA 4KKSA 3HRZC 1VCIA 3MFYA 4A3EB 1JE4A 1KNAA 5C3XA 1OO9B 1FYCA 3CCVA 3E9HA 3VYTA 2A5HA 2V4DA 1H9SA 1T5XD 2LSSA 1LTLA 3ERSX 3R3OA 2FXQA 4H02A 4LAAA 3NUCA 4HSVA 1R9TH 1PFNA 4U673 1YI2A 1V1OA 1OXUA 3X3MA 3J81i 1CI3M 5JAVA 2IPKD 3AB9A 1D8LA 1LTTD 3CCQA 3S17B 4FF4A 3DWPA 3I70A 4X62L 4DXFA 1EFWA 2ZM6L 4BY7B 3GTOH 1PA6A 2F0JA 2RHQB 4N9TA 1A3TA 3S2HH 1JJCB 4LFCL 2I5LX 1OXTA 5EPKA 3NEMA 3J81c 1BUVT 4LUOA 2GA4B 4RG1A 5IP7G 2F0GA 1IKLA 5ELNA 4DV7Q 3S1RH 1VQCA 4JI8Q 1BDOA 2WKCA 1EZ6A 1Y69U 2PZUA 1A63A 1BCPD 3A0JA 1KAWA 2B29A 4DV0L 3DLLA 2UXDQ 2DNCA 4K8JA 3BJUA 3UDXA 1S5BD 3DXJC 3S1MB 2VB2X 1I4RA 2FJ2A 2FMCA 3FKIH 4C56C 1VQAA 1X55A 2HIXA 1DM0B 1HFGA 4S3SA 3P1HA 3MXUA 2F0DA 5I4DA 2BE5D 4YY3L 1BBWA 3S16H 4N8FA 1HZAA 1EQQA 1JWUD 3BDLA 4WFN3 2F0QA 1GXDC 1YEZA 1LTSD 3MVVA 5FJ8G 2FINB 5M5XB 1EZ8A 4J8QA 4JI0Q 5A35A 2UXCL 5FO7B 1MHWC 4IFDG 2NN6G 1TQOA 1I3QB 4O0AA 3WOEA 4DNRB 3K5LA 1PRTD 2HUGA 2VXWA 3NQIA 3PUVA 4QGUA 1F9PA 5JPNC 1F2LA 3RMHA 3QWNA 1MJEA 5DM73 5C3EG 1PTOB 3NP8A 2CH4A 3EIVA 3I4NH 1YNNC 3WOFA 1A2UA 2GN5A 4JI1L 1ICWA 1B9MA 1O7IA 2WP8J 2E2IH 5M5YB 1N34Q 1EYDA 1WCMH 2KHJA 3GDEA 5H1SE 2ATWA 3DEOA 4TQUS 3U4VA 3BYYB 1O80A 2KECA 5E3FA 1DOKA 1UUPA 5IGCA 3RZOB 4DN4M 5BN3A 5IWAQ 3CP0A 3LX0A 5C44G 4A3GB 4C3HH 3GTKH 4B3SQ 1QE6A 3M4YA 4KHPQ 4MIUA 3F2UA 3D6CA 2NUCA 1PFBA 2XRSD 4HCSA 3K7AH 1WTHA 1PVOA 4DK1A 1A62A 2JQOA 1SR3A 3QR8A 4UDUC 4KJNA 1WTXA 2ASBA 3MA2B 3K0XA 1Y1WH 4R4CA 1CQFA 3S15B 4IUUA 4F8MA 5J3BA 1KIXA 4DNIA 1KD1C 2TSSA 2OEOA 1RCVD 4X64L 3C1EA 1K8OA 4A3JG 1XNRQ 5HURA 1V1PB 4A3CH 5BN4A 3N52A 4C3IH 2NVTH 1H9SB 3S1QH 3NE5B 2I07B 2F03A 1AN8A 1ESFA 2A73B 3C2PA 1HNZL 5K5PA 3T1HQ 2KCMA 4GKJL 1ZYRC 2N88A 3CC4A 1K83H 3MXNA 1PZID 1WJJA 3TEHB 3SE0A 2JEAI 3J7AF 4JI2L 2JJQA 3A5UA 4XTCS 4HIKA 2E2JB 1SE8A 3CD6A 3A5ZB 2NYZD 1PZJD 2A1AA 3CU7A 2YTYA 5AJ3Q 1YNJD 1NAPA 3AFPA 3ZJYC 3JAMi 3MHBA 4LF7L 4HJ7A 1CSQA 3OWFA 1UE7A 4YHHL 3U4ZA 2B8GA 4P2CB 1HPCA 1MI2A 4EQNA 3I4NG 1H9JA 3HOZH 1I4GA 5KYIA 5IYBH 4KI0A 1B53A 4DV5Q 3PUXA 1N8RC 4HEDA 2NWGA 1JWMD 3HFZB 4AH6A 3C3LA 1TVXA 4K14A 2B63H 2R93H 2N55A 2JA6H 3A8KE 5M3MB 1CKOA 4MTNA 1F2ZA 3S9WA 1KC8C 2EE1A 1MSGA 4A3EH 1OXXK 3A55A 3TP5A 3TZDA 4DV4L 3LWUA 4QJFA 4XT1B 3E0JA 2G9DA 2J0TD 5KYLA 4IFDI 4FXGC 1AZPA 2X6GA 1A15A 1EY9A 4JCVE 3T53B 2A69C 4DAVA 3FDTA 2NBFA 2KCCA 1IZ6A 2QDLA 5C4XB 3HOUH 4HTHA 3HOXB 4V0BA 1G8ZD 3S17H 1EIFA 4A3KH 4FF3A 4FNFA 4CBVA 1L1OB 1Z7TA 2PZTA 2KEDA 2ZJPA 4WRDA 3W1GA 1A3UA 2F0TA 4JYAL 5C0XJ 4DR4Q 1PH8A 5IYCG 4K6DA 4GKKL 4RGOS 2F3IA 4ZLTF 5D14A 4LF5L 3R2TA 1STEA 3P20A 5E4WC 4B3RL 2M9VA 5LL6S 5GROA 1T9HA 2AQ3B 2CW0C 3KJOA 1QJOA 2SOBA 1C4QA 1LTRD 1TWFH 2H4OA 1PH6A 2VUMG 4A3DB 2Q2HA 4UP8A 4DK6C 4GOPC 4X66Q 2LFNA 5G3LF 2QGQA 4ILWA 3PIO3 1CK1A 1HA6A 4RHRA 2JYOA 1MJCA 1X3EA 3E6ZX 1IBMQ 1PFMA 3FEWX 3GTMB 1F9RA 2JK8A 1VQDA 2CVRA 1UEAB 4L5RC 4YCWA 3W3AA 1NSNS 5A2QE 3CKIB 1C9OA 4QUFA 3F2BA 2PPBC 4DUYL 2JA7H 2MNAA 1Q82C 1UE5A 3BVGA 2NZHA 4JI7L 3KYHC 5LMNL 3G4SA 3CQZB 4J1MA 4IO9A 4OX9L 3RNUA 1E3PA 1VQNA 3IKJA 1RHPA 1W2BA 2VL6A 1GO3E 1Q3LA 2D9UA 2ZTDA 3A7AB 1YNND 1ZXTA 1VQ8A 2EYFA 1S4ZA 5KNCA 5EBDA 4HAEA 1SYCA 1B8AA 4CKCA 5COYA 1SMYC 1KQSA 4DA2A 1SFOH 4ME5A 2B2WA 4BY7G 3OOCA 2K03A 1PH2A 2UUBL 5CBEE 5JEAJ 5C44B 2K1BA 3MXPA 5JJIA 2NVXB 4EQPA 2A74C 1F2YA 1HJPA 2K5QA 2VQFQ 3U50C 3CCUA 2Y0SG 4X3UA 2E2HB 1HQRD 2PCFB 4DR3Q 2AQ1B 3GTQB 4LMQD 3C46A 4H44C 4LFBL 3IFDA 4BA1I 1IBKQ 1I4QA 4IN3A 1ASYA 2GVAA 2EOTA 2CWAA 3OMGA 4JI4L 1JQYD 2LXJA 5FLMG 3CXCA 5L37A 1XMQL 4PZ8A 4X65L 4LF6Q 1ENFA 3EQLC 4P72A 1LT4D 1EU3A 2IHFA 3GO5A 3BZDB 1JOQA 1EEFD 4N9PA 1EWCA 4JI3Q 3IFTA 3NTIA 4BY1H 1W6KA 1TWGH 3ND8A 3TZUA 4JI5L 4Y52H 1JORA 4R4TA 4DUZQ 3H3VI 3J7AV 1ZYRD 2E2JH 1N32L 4QMGA 2ZT9C 1U0LA 3I55A 3SXHA 2EXDA 1P8LA 2ICIA 2HHHL 3J7YW 3KBGA 3T4AC 4FF1A 2WIIB 4CJ1B 5KNDA 3G6EA 5BR8L 4R8NA 1D5MC 3G7LA 1YJWA 1XNQQ 3I4MH 2BOSA 4XYOA 3OSOA 2RA4A 1NBWA 2O4XA 3HZXA 4QUCA 2N8NA 2HCCA 1VF7A 1TS5A 5EKIA 4DAMA 4NPSA 3V05A 3A7LA 1JT8A 4R4QA 4A3LH 4HMJA 3M7NA 3NELA 1JOKA 2HCIA 4PMWA 3VR2A 3J81E 1FGUA 2YTVA 4HIDA 1HH2P 2RDHA 2K50A 3I3CA 4B3TQ 1J5EQ 4A3GG 2AMCB 4EX5A 4HIOA 4CDEC 3P7JA 4YCVA 3UE0A 2O5JC 5D3IB 4B3ML 1STNA 3LGJA 1TWCH 1RD9D 1VQIA 4OWXB 4LUVA 2UUAQ 3WDNA 3UDFA 2JP1A 1KDAA 4B9XA 5IODA 1K0RA 2V1CC 2E2DC 3SDZA 2NTSA 5CMDA 3I73A 2VY3A 4BWGB 2ALYB 3I4OA 1KL9A 2A6EC 3EFXD 1YJ9A 1O7ZA 1VQFA 1F2MA 4FVMA 4DAPA 1UE1A 1LTGD 2PMZE 4LF4L 1UNSA 1TWHB 3A56A 4B9WA 4LJZC 5IP7H 3HGBA 4K5XA 3OWEB 5DAUA 1EFID 4JK1C 1MD2D 3AU7A 4RH6A 1DJRD 4ZAIA 3X3NA 1ML0D 1S5DD 1KRTA 1EWIA 1X3GA 2K5WA 4A3DH 2PMZB 5C4JB 3S2DB 3W1BA 1CZGA 2UUCL 1QVGA 2CW0D 2R6GA 3MC0B 2B2UA 3HS0C 4ODGA 3T56B 5CBAE 1HQMC 2HD3A 5JOBA 2IW3A 2FFKB 1LTAD 1EYCA 2D0PA 3GTMH 4X62Q 4DR7L 1AP0A 4XQJA 3MXGA 4K6LA 4A3FG 1DONA 2N49A 1EIGA 2CH4W 4NKLA 2K05A 3CMEA 4A3LG 1F9QA 4IFDH 1EY6A 2EYLA 2NN6H 1IYVA 5M3MG 1GOZA 4QB4A 1UAPA 3CCEA 1B70B 4G7OC 4C3JG 2NVYB 4ULLA 2C35B 4RCOA 3L2PA 4A3IB 1JICA 4OO1G 1SXTA 5C3EH 3NBHB 2JXMB 4LF8L 4DR6Q 2RVLA 3K0YA 1V1PA 3T1YQ 1TY2A 4DV2L 2PI2E 1MSHA 3CCJA 4AQYL 4PQXA 2RSNA 4KKUA 4IUVA 1I50H 2QILA 1KTKA 1VQPA 4WORA 2VZAA 4DR2L 5C4XG 3HOVG 4O1NA 3HOXG 5TSSA 3GD7A 1TT2A 3QOLA 4JI6Q 2Y0SE 4J15A 3GTJB 3L0OA 5C44H 1SMYD 3D8GA 1SLJA 1GD7A 2NVXH 1OTCA 2K32A 4C2MB 4KMUC 2UXCQ 2D2CC 4OGQC 4RKLA 1RTOA 3KF8A 2HQLA 3BZKA 2CKZB 3GTGB 3GTQH 1PH5A 2F0KA 1MKHA 2Y0SB 1TR5A 2E5LQ 1LT5D 2A19A 3FPUB 4UP9A 1BBUA 3A8IE 2AKWB 4DR1L 5HY6A 1AH9A 4NB3A 1EY4A 5C5LA 2JE6I 3SR1A 4BBRG 5EJWA 4EVOA 2K04A 2B8FA 4A3DG 3G6JB 4L8JA 1GUWA 1STAA 4CHTB 1SYBA 5CC4A 4DR5Q 2PNHA 5G3LD 1XJVA 2A68C 1II3A 3JAME 4GNXB 4A3JH 4KN7C 2DUDA 5AFWA 2R61A 1CZWA 1S5FD 1N36Q 2XRQD 5ELOA 1HNXQ 3T16A 1XMOQ 1QUQB 1J9OA 1G2SA 3S24A 4UY8C 4OWTB 3CF5A 3FVQA 3KOJA 1A2TA 3D4DA 5C4ZA 4KY7A 1CKMA 1Q1EA 2CFMA 4XYQA 3ERQA 3ZYYX 2SEBD 2XWBB 4I7ZC 3EBEA 3GQBA 3M9BA 4YWMA 3VDYA 2F0LA 3I2ZA 1L1OA 1QG7A 2L4NA 3OTOQ 1YHQA 1EY7A 1Q7YC 3WWVA 1WTVA 3VR3A 1MGSA 3H0GB 3SK5A 1VQ6A 4X6AH 2C5CA 3M3YH 4JC0A 4Q5VA 4LF9L 4MHEA 3F2DA 2MHVA 1HNZQ 1Y1VB 4L6TB 2WINB 4DV7L 4GKJQ 1YNXA 5GAEC 2F3WA 1PH1A 5CV8A 3M4PA 1TS3A 1BVSA 2UXDL 4DV1Q 5LMNW 2XGTA 2RDFA 2PO4A 1E2ZA 5DEHA 1N33Q 1GHKA 1VQKA 3S1NB 3RUZA 1SMXA 1SN8A 2DJGC 2K5DA 2F0EA 2HDMA 4XXEA 4IOAA 3H3VC 4JBMA 4V190 2L9HA 2ZJRA 3RN5A 4K2LA 1ESRA 2HQEA 3PQIA 1E2VA 1G51A 1C8CA 1DZ1A 2L0CA 1XXGA 2LXKA 1HUNA 2I5MX 4E6IA 2GVBA 5FK9C 3H3VH 1SDFA 4UAIA 3A8JE 3HKZG 3TN2A 2B2WC 2A6ED 2XVSA 5GQOA 5IGEA 1TWHH 3KUPA 1SBBB 1CHQD 1V43A 2B3GA 5IYCH 1NR4A 2KEEA 1S5ED 5M9OA 5IP9G 1VMCA 1QZGA 5JEAH 2R7ZG 2JA8G 3M4OH 1CFMA 1QB5D 4KLKA 1G291 2QCPX 2EYOA 3PV0A 2KHSA 4ZK9B 2AQ2B 2F4VL 5C4JH 5C0XG 3AMUA 1EIYB 3S2DH 4RCNA 1K8GA 2VUMH 1HFNA 3I91A 1AW7A 4RMFA 1BCPB 2DNEA 2BA0A 3MWYW 4QQBX 4RHSA 1ENAA 3KF8B 5JJLA 5T1IA 3OW7A 1L0WA 1BO0A 1DXMA 2UXBL 3PF4A 5IWAL 2CHBD 4H0LC 2WFWA 1PV4A 2CCZA 4LK1C 5IGGA 2D0OA 2J7ZA 4F88A 2X6LA 1RDPD 4KHPL 1H9KA 4A3FB 5IT9L 5CV5A 1HNWQ 1I4HA 4XQQA 1CSPA 1K8MA 4GKKQ 4L5QA 1PTOF 1EY5A 3P75A 3PSIA 3STBD 2NVYH 4K2KA 1WTRA 2X69A 3E5SA 2DY8A 4C3JB 2DN8A 2SDFA 1B2TA 2A6HC 3PUYA 1LYLA 3E3XA 1JE5A 4U68A 1PRTB 2NB0A 3OPOA 4Y7NB 2NN6I 1GVPA 1BBXC 3KLSX 5FO9B 4RFBA 1STGA 1KLGD 5I6WA 2PYKA 5NUCA 3HOVB 1BQQT 3T1HL 2XWJB 5M3FB 3SVMA 3MTSA 1WOCA 4BY7H 4B08A 3U58A 3GTPB 2MPMA 2OF1A 3ULPA 4GZYC 3GTLB 3VR4A 3GTGH 1I6VC 4NW2A 1RTNA 4IURA 1G6ZA 2RDGA 4NXMQ 3KFUA 4P74A 2WAQB 1ICFB 5AJ3L 4O2DA 2F0HA 4F87A 3PF5A 3BDCA 5LMNQ 3V2TA 1JB3A 2L15A 5GAHC 5JEAG 4OX9Q 1UEBA 1GUOA 3EA6A 2M00A 4K0KQ 1RIPA 1D5ZC 4OONA 1GJXA 4HJ8A 2NTTA 4A3BG 2VQEL 1GUGA 3S1MH 4BBRB 1AEXA 5FLMH 4DV5L 1B1ZA 2PZWA 2ES2A 1S40A 1N9WA 4NXNQ 3I4LA 2R92G 1HZBA 2QEXA 1H9MA 3CC7A 1PH7A 2A68D 2F0UA 3CPWA 2ZTEA 4DV3Q 2EXZA 2Z6KA 1HR0W 3ITPA 2R3ZA 3K57A 1KNEA 4GLXA 5M5XH 3G71A 1PTOC 1V9PA 1PYBA 4DV6Q 3NWSA 2RHSB 3J80L 4OIJA 4UPAA 1I3QH 4A3MG 3DMUA 2EVBA 4ZQ3A 4A3IG 4NDXA 4MTKA 1DOLA 2B2UC 3AQQA 4JBWA 5CGKA 1PTOH 2BDNA 2PW7A 2ZXPA 1VDZA 1XTDA 3H94A 4LFAQ 1JR0D 3H15A 4ZUJA 3CAMA 4CKEA 1Q8IA 2E75C 4DKAC 3H0GH 3EN2A 3L9AX 4LUZA 2KHIA 2IX3A 1GHJA 1JWSD 3IL8A 5M5YH 1QILA 3TP7A 1R4QB 4OELB 2NVQB 4DR4L 2N3SA 2PW5A 1KDBA 1Y1VH 2WKDA 4PV1C 1PRTF 3RZOH 2Q8TA 3K58A 5JVH3 4A93B 4A3GH 3PIP3 5JJZA 4R9WA 3S1NH 1EU4A 3CCLA 3KDFA 3QOJA 2MP1A 1ZEQX 2ZXOA 2K6AA 1XTCD 3PIOA 1E7ZA 4BXXG 2HHHQ 4FDBA 4X66L 4WJ3M 2EYHA 5IY0A 1IYUA 5K36H 1BXTA 1OXSC 1V8QA 4DAYB 1I94Q 3IRBA 3UE1A 2E76C 3HKZE 4XQNA 1CTMA 1R9TB 4GN5A 2RKSA 1YITA 5CV4A 2K33A 1VQ4A 1IBML 3S15H 4A4IA 1FJGQ 4JW0A 4PNYA 3GTOB 1XX8A 1KDCA 4IUPA 3AFQA 5ELDA 2FHTA 4CJ0B 4R8IA 3S2HB 2OTJA 2CWPA 3L7ZC 4K8IA 3SK6A 3MAQA 3HKZB 1HZ9A 3ULJA 2ZTCA 4EQOA 1PH3A 2RF4A 5FLXL 2UU9Q 4IQZA 1E24A 2L55A 3NBHA 3VYUA 2A8VA 5CORA 2OQKA 3K5MA 1IBLQ 1VQLA 1TS2A 1WTPA 3TRZA 1NCVA 5EGTA 2MO0A 4JBJA 2BCOA 2R7ZB 4KTAA 2JA8B 1B3AA 1HZCA 1IYJB 2JSOA 4A76A 4NMZA 1DD2A 2BE5C 3Q6SA 1WVLA 1A8VA 5M5WB 3NPPA 5J22A 2I0QA 1K8AC 5LMUQ 1SE2A 2LS01 1UE6A 3ULLA 2MGSA 1LTBD 1YZ6A 1GM5A 2PI2A 5IT9c 3DHQA 1EL0A 1NUCA 4IJHA 2K4KA 5JVG3 1L0XB 3KF6A 3UDGA 1D1KA 2EDGA 1SNCA 4L5SA 4A3FH 3H0GG 1SNPA 1PRTC 4DK0A 2YU9B 4POFA 1KLUD 5KRUA 4DR3L 1HR0Q 3R93A 5IYDG 3LWEA 3HP3A 5M3MH 1Y1VG 3Q24A 3D4WA 3TREA 1E2WA 2EJMA 5EPLA 1IBKL 4FO2A 4C3JH 2D5DA 2YYZA 1FVIA 5BN5A 4OO1H 2O2LD 2ENBA 4G7ZC 5ISRA 3CCMA 4HIMA 3PO3G 4GNXA 2WACA 1L1OC 4JOIA 1SNMA 3TBIB 1I4PA 2A6HD 2AUKA 4J6HA 2Z0SA 3KK7A 1EQTA 5K36G 4NP5A 2E2IB 1Y8NB 3O13A 1QUQA 4LW1A 1WCMB 5CV6A 4GN3B 5C4XH 3EVQA 1QNKA 3HOVH 3HOYG 1JJ2A 4IUNA 3HOXH 3SK4A 3RLFA 2A69D 4JI3L 4GLVB 3GTPH 1Y14B 4DUZL 5C6AA 3GTKB 1D2BA 3SK8A 3M85A 3GTLH 1HUMA 1IXRA 4JV5Q 1TWAB 3OHXC 1UWVA 3BYTB 1M90C 3K5OA 4K5WA 2KJXA 5HGTA 4L5TA 3N6RA 3Q23A 1TU2B 4IPCA 3GV6A 3BDOA 3FRPB 1XNQL 1CM9A 4HCEA 4LWCA 3KLWA 4RAUC 2B2YA 3J80i 1AZQA 4L63B 4BBRH 3MEFA 1JOOA 2AUJD 2E74C 4IZ8A 4A3BB 2PNRC 3QB3A 2F0PA 4GLAC 4DNTB 5ELCA 4KD4A 3VA5A 3KDFB 5ELFA 5KIXA 5F2DA 1JCKB 3S1QB 2OT2A 2MFIA 3TP6A 2ICEC 1PZKD 1LACA 3M4QA 4DF7A 3J80c 2R92B 1DGSA 1WD1A 1J5EL 2KCTA 3K8AA 4A75A 3AEVA 1BF4A 2ZM6Q 1K83B 4PZ6A 1Z47A 2AHOB 1YNJC 2ZXRA 5EKLA 4ZRZA 2EYJA 1OXVA 2WV6D 3BVZA 4LFCQ 1PTOD 3V96A 3CMAA 1C48A 2F0WA 2QW7A 5DM63 3CCSA 4H7BA 4A3MB 3CQZH 5C4HA 4IALA 4IUTA 4DR1Q 3DUZA 4KHZA 4DV0Q 1LT6D 1E1TA 3K80C 1VQBA 1U5KA 3D6WA 2MJ8A 2SNSA 4JVZA 5C5MA 3D3RA 1K3RA 1Y8PB 1NTGA 5IGFA 1SJED 4OIKA 3PO2G 3GP7A 2XSCA 1YVCA 3CRLC 1U4RA 2PQEA 3U9SA 2Q8RE 2R93B 1PDQA 4YY3Q 3QO2A 2B63B 3A74A 5M3FG 4KV6A 1PHJA 1LT3D 1SNQA 1A3VA 2OWOA 3T13A 4CJ2C 1QNUA 1NMGA 5I9OA 3VYRA 2LY7A 2E8GA 2IHEA 4RKBA 2QDBA 3KF6B 3TDQA 1GUSA 3D4RA 2WAQG 2E2HH 4QF4A 2G9HD 1TS4A 2KUMA 1PH4A 3GV3A 4UHVA 1Q1BA 3PUZA 3TQYA 1EIHA 1TIID 1X3QA 1LM0A 1YIJA 1DYQA 1ILQA 2QKIC 3URYA 1DOMA 1PXUA 1PYWD 3HOUB 2NZOA 1JC7A 3TS2A 1D5XC 2AWNA 2MQHA 4A3KB 1SJHD 3IAYA 1NNXA 3AYHB 5FLXc 3EROA 1A0IA 2QEJC 3FMCA 4JI1Q 3RZDB 2H5XA 2IT1A 4ABNA 3TP8A 2RCNA 2ID0A 2L1BA 4FXDA 4LF9Q 1Z6HA 2FMMA 1X3PA 2K7VA 4KN4C 4JBKA 3W2DA 3MEHA 1FGBD 5IP9H 1YHAA 1HXYD 2R7ZH 1QVCA 2JA8H 3NTHA 1Z9FA 4XT3B 1X9NA 1QVFA 3HOWG 2Q8IB 2N78A 2IX1A 4DR6L 3T1YL 2KBNA 1EQVA 5C0XH 2AWOA 1TWFB 3RR5A 3NBIA 4KY6A 4RGNA 5EQ0A 5M5WH 4LNQA 1YHBA 1ET9A 2MO1A 4FF2A 2EYPA 1U9RA 4FYDA 1CHPD 1PYSB 3PUWA 1SE3A 3DWQA 3RN2A 5FOBB 1M4VA 1YBYA 1HRJA 1D1IA 2EZVA 2EJGC 4JI6L 2EY6A 1Q86C 4JG2A 2B2TA 1NJIC 4YWKA 2B2VA 1CUKA 5E4XA 2VNUD 1LABA 3OMCA 4APVA 4AIMA 4GOPB 1T5EA 1VF5C 4X3SA 1XPUA 2Z6KC 4X64Q 3CCRA 2YU9H 1S72A 5J1ZA 1B3QA 4BBSG 2JA7B 3C1FA 2NZ1D 4TVAB 4ZYSA 1LLRD 4G4KA 2E5LL 2I46A 3J7A5 2F0SA 4A93G 4JI8L 4EGVA 1KHIA 4ZCKA 5I2XA 3S14B 2F4VQ 1ZKOA 3UDIA 4JI2Q 5ELEA 1X56A 2PQAA 3PO3B 5DNFA 3ND9A 4WJ4A 1VQMA 4DR5L 4CDDC 5GADC 2EPBA 3FP9A 3NWTA 2J4XA 3MZ5A 4LF7Q 3QIAA 3UI2A 1W3SA 4G57A 4GN4B 2L12A 1X32A 4R4IA 1XPOA 2UXBQ 1LTID 2OXPA 1N36L 1KRSA 4OO1I 4YHHQ 1HNXL 3HOYB 5JJKA 1RODA 1XMOL 1SFOB 2KENA 1XPRA 2DGYA 2KCNA 1STHA 2M2LA 1SSOA 2JEBI 1TWAH 5J39A 4JI0L 5EPJA 3I72A 3QG1A 2Q2UA 1EOTA 4KD3A 2K01A 3FHWA 1JB7A 4C1NK 4HR7B 2JA5B 5EAYA 3Q0AA 1K73C 1FNWA 4I7AA 4IOCA 1X3FA 3OTOL 4F7XA 1AE3A 4DV4Q 5IE8A 3KLRA 2IJ0A 4XDXA 5JPMC 4A3BH 3K59A 1HTLD 1WFQA 3G48A 3H91A 3FKIG 1V1QA 4IPGA 1NMFA 2EJFC 2H1EA 4QCLA 1SE4A 1F77A 2ZJQA 1IW7C 4X3KA 2R92H 4IFDJ 4ZKBB 1N34L 3Q8DA 3PCOB 4PMBA 4HJ5A 1ENCA 3NQTA 5EBCA 3R2IA 1O7YA 1Y8OB 4BY1B 1TWGB 5HGQA 3QJYA 4DV1L 2F3VA 4PMCA 1N33L 5D3DA 2VW9A 1B44D 2I5HA 4I65A 5IGBA 4B3SL 1JMCA 1E1OA 5I6YA 4DAYA 4JYAQ 1NY4A 3OIPA 3U9OA 3B6YA 1W6JA 4OXPA 3K7UC 4Z9CB 4A3MH 4DU9A 4LF5Q 4HMIA 4A3IH 1A6XA 1WD0A 3NXWA 4B3RQ 1J8IA 2JN4A 2F52A 3D31A 4DK3C 1PH9A 1STYA 1F9SA 3NENA 3A54A 1BR9A 1SEBD 3BU2A 5KEEA 3I4MB 2XIWA 2VQEQ 5IIFA 3BG3A 1I6HB 3JAMc 2Q2TA 4OEMB 4M8AA 1FR3A 1SRUA 1R4PB 1XNRL 1QCBD 1WCMG 2EY1A 2VS1A 3DWAA 1HA5A 2JA9A 4RGTA 1EEID 3PO2B 4OL7A 2XN9C 4QL5A 4TRDA 2O5IC 2WAQE 4IPHA 3NHHA 3GTJH 4G7HC 4C3HG 4EQ5A 2L5TA 3TSSA 1RKNA 2F0FA 2KVMA 4C2MH 2F0MA 1WTOA 1TWCB 3MFGA 4DUYQ 1QZHA 4BXXH 2Z1CA 2VB3X 5IOCA 4BA2I 4GNXC 4JI7Q 2OCEA 5A2QL 4JOIC 5LL6X 1RF2D 4AYBG 2IX0A 1NR2A 3K5NA 1BNZA 4HSPA 2BH8A 1Y1WG 5IT9E 4WJWA 1MBYA 4FP5D 2DJFC 3VYSA 1Q81C 3NSWA 3RZDH 3K81C 4A3CG 1L2FA 1HNWL 4MNOA 4C3IG 4BS9A 2PQAB 3NTKA 3FPPA 4TKOB 1X54A 1LV9A 4IJLA 1SYFA 3D0FA 1K28A 1LO5D 3ONAB 4KJOA 4PG3A 5FO8B 1U4MA 2CQAA 4YIJA 2XTIA 2UUBQ 1BCPF 1I4XA 1X6OA 3SEBA 2F1MA 3Q22A 4XIGS 5E7NA 1EY0A 2RBMA 3HOWB 1TY0A 2QA4A 1HHVA 4YCUA 1E22A 1CKNA 4JPBW 1VQOA 4IPDA 2B2YC 2F0OA 1QWYA 1QOHA 5D65A 4LFBQ 4DPGA 4CGYB 2WB1G 1BKBA 2BH2A 4ZKCB 2OQ0A 2HT1A 3ER0A 5EKKA 2K5HA 4MZ9A 4JI4Q 2DY7A 4CDFC 5C0XI 3HOZG 1B50A 5IYBG 4RWSC 3KJPA 1LUZA 2RQXA 5FKAC 1XMQQ 4X65Q 1CT1D 4H13C 4NXML 1K3BC 4CKBA 2R93G 2B63G 1XWEA 1VQ7A 2JA6G 4BBSB 3HEJA 5IYDH 1YJNA 3T51B 1VQJA 4A3EG 1TXYA 3S14H 1RL2A 1RJTA 4JI5Q 1B9NA 4K0KL 3RLNA 4CDCC 5C3EB 1N32Q 3PO3H 1AE2A 5DLQE 3MXNB 1KXLA 2K5NA 1B7YB 2LMCB 1K0SA 1I50B 1Q8KA 2KQ3A 2LKVA 3DM3A 2F0VA 4NXNL 3OIQA 4YWLA 2BDOA 1M8AA 3HOUG 4DV3L 5BR8Q 3HOYH 1IL8A 3VR5A 1O7LA 4A3KG 3J80E 4ZUIA 1PMRA 2K52A 1EYAA 4HJ9A 2EYMA 1H9RA 3H6MA 5CV7A 3RD4A 3W5OA 4HN7A 3SHLA 3TMEA 2C9OA 2QF7A 5I9PA 4DV6L 1IL2A 2YTXA 4IUQA 2R7FA 4KY5A 3BVMA 4KK7A 1BCPC 2JA5H 1VQHA 4TSSA 3J81j 1M1KC 3S1RB 2MUYA 2Q2IA 1VMPA 2Z8LA 1U4LA 2K5VA 3J81L 4B3MQ 4LFAL 1FNUA 3KBXA 1XYIA 2OTLA 4QY7A 5KGUA 4MN3A 2XNAC 4A3JB 3E0EA 4FXKC 3HG9A 3FKIB 3CHBD 4POGA 4ALPA 4OHJA 3PIPA 3I56A 3VR6A 2K14A 1TKWB 1X65A 3JC66 3RLOA 3HKSA 2F0NA 4K5VA 3S16B 1IW7D 1GUTA 5CV9A 1PFSA 4ME3A 1SYGA 2YV5A 4X3TA 4PZ7A 3DEPA 1WYDA 2JA7G 2VQFL 5C3WA 3I90A 4LF4Q 2Z4HA 2BA1A 4RA8A 2B39A 1G91A 3I8ZA 1I94L 5CR3A 1AFPA 1Q90A 4GS3A 2D62A 1CA6A 1U4PA 1D7QA 1GUNA 1KAAA 1BOSA 4M1UB 1FJGL 1FNVA 3BS1A 1I6HH 1O78A 4DGZA 3TS0A 3I4NB 2UUCQ 5FLXE 3NK9A 1Q12A 2RCFA 4Y7NH 2B2TC 1ILPA 4R1JA 2B2VC 1VQ9A 3SGIA 3M3YB 4LF6L 1EOVA 3PO2H 2F0IA 3H09A 4HJAA 1SROA 4Q0FA 3BZCA 1CKNB 3LNNA 2Z6BA 3I7FA 1VQGA 1NE3A 2UU9L 4C1NI 5E1FA 1ONLA 1HCZA 5M3FH 2EY2A 3OYYA 4DFAA 1IBLL 1EQRA 2G5DA 4DR7Q 2CQOA 4AYBE 1FD7D 3KLSA 1Q46A 1L0YB 4RGMA 4C3HB 2P5ZX 2TMPA 3PMFA 4O42A 2RSOA
chains in the Genus database with same CATH topology
2SNMA 3K7AB 3DM1A 4AYBB 1EWHA 2KOLA 1IHZA 1Y1WB 1WTQA 1D6EC 2IWHA 1E0BA 1SNDA 1CA5A 2NVTB 4C3IB 5I2YA 2KA7A 4QIWB 3M4OB 1SNOA 3K6OA 3L3OC 2F4IA 3VA7A 2VUMB 1DCZA 4KKTA 2K28A 2L11A 3CRKC 1B4OA 2Z4IA 1PLFA 4KHVA 2WB1B 1EY8A 1SYDA 3EJIA 4DXGA 5CYUA 5KNBA 3R8BA 5T1GA 4ID6A 5LHY1 1ET6A 1WTWA 3HOZB 3M7GA 1SYEA 5IGDA 1STBA 1S5CD 5ELBA 1IKMA 1G2TA 1CQVA 1HTPA 2JA6B 1SAPA 3JAML 2EY5A 2IL8A 2HDLA 1KABA 4KKSA 3HRZC 1VCIA 3MFYA 4A3EB 1JE4A 1KNAA 5C3XA 1OO9B 1FYCA 3VYTA 2A5HA 2V4DA 1H9SA 1T5XD 3R3OA 4LAAA 3NUCA 4HSVA 1PFNA 4U673 1V1OA 1OXUA 3X3MA 1CI3M 5JAVA 2IPKD 3AB9A 1LTTD 3S17B 4FF4A 3DWPA 3I70A 4DXFA 4BY7B 2F0JA 4N9TA 1A3TA 1OXTA 5EPKA 1BUVT 2GA4B 2F0GA 1IKLA 1BDOA 2WKCA 1EZ6A 1Y69U 2PZUA 1BCPD 2DNCA 4K8JA 1S5BD 3DXJC 3S1MB 2VB2X 1I4RA 2FJ2A 2FMCA 4C56C 1DM0B 1HFGA 4S3SA 3P1HA 3MXUA 2F0DA 5I4DA 2BE5D 1JWUD 3BDLA 4WFN3 2F0QA 1GXDC 1LTSD 3MVVA 2FINB 5M5XB 1EZ8A 4J8QA 5A35A 5FO7B 4IFDG 2NN6G 1TQOA 1I3QB 3WOEA 4DNRB 3K5LA 1PRTD 2HUGA 2VXWA 3NQIA 3PUVA 1F9PA 5JPNC 1F2LA 3RMHA 3QWNA 5DM73 1PTOB 3NP8A 1YNNC 3WOFA 1A2UA 1ICWA 1B9MA 2WP8J 5M5YB 1EYDA 3DEOA 4TQUS 3BYYB 1O80A 2KECA 5E3FA 5IGCA 1DOKA 1UUPA 3RZOB 4DN4M 5BN3A 3LX0A 4A3GB 1QE6A 3M4YA 4MIUA 3F2UA 3D6CA 2NUCA 1PFBA 2XRSD 4HCSA 4DK1A 4UDUC 4KJNA 1WTXA 3MA2B 1CQFA 3S15B 4IUUA 4F8MA 2TSSA 2OEOA 1RCVD 1K8OA 3C1EA 5HURA 1V1PB 5BN4A 3N52A 1H9SB 3NE5B 2I07B 2F03A 1AN8A 1ESFA 2A73B 3C2PA 5K5PA 1ZYRC 2N88A 3MXNA 1PZID 3SE0A 2JEAI 3J7AF 4XTCS 2E2JB 2NYZD 1PZJD 3CU7A 1YNJD 1NAPA 3MHBA 3OWFA 2B8GA 4P2CB 1HPCA 1MI2A 4EQNA 1H9JA 1I4GA 5KYIA 4KI0A 1B53A 3PUXA 4HEDA 2NWGA 1JWMD 3C3LA 1TVXA 4K14A 2N55A 3A8KE 5M3MB 1F2ZA 3S9WA 2EE1A 1MSGA 1OXXK 3A55A 3TP5A 3TZDA 3LWUA 4XT1B 3E0JA 2G9DA 2J0TD 5KYLA 4IFDI 4FXGC 1AZPA 2X6GA 1A15A 1EY9A 3T53B 2A69C 4DAVA 3FDTA 2NBFA 2KCCA 5C4XB 4HTHA 3HOXB 4V0BA 1G8ZD 4FF3A 4FNFA 4CBVA 1Z7TA 2PZTA 2KEDA 4WRDA 1A3UA 2F0TA 5C0XJ 4K6DA 4RGOS 4ZLTF 5D14A 3R2TA 1STEA 3P20A 5E4WC 2M9VA 5LL6S 2AQ3B 2CW0C 1QJOA 2SOBA 1C4QA 1LTRD 2H4OA 4A3DB 2LFNA 5G3LF 4ILWA 3PIO3 1CK1A 1HA6A 4RHRA 2JYOA 3E6ZX 1PFMA 3FEWX 3GTMB 1F9RA 2CVRA 1UEAB 3W3AA 1NSNS 5A2QE 3CKIB 4QUFA 2PPBC 3BVGA 3CQZB 4J1MA 3IKJA 1RHPA 1Q3LA 2D9UA 3A7AB 1YNND 1ZXTA 2EYFA 1S4ZA 5KNCA 5EBDA 4HAEA 1SYCA 4CKCA 5COYA 1SMYC 4DA2A 4ME5A 2B2WA 3OOCA 2K03A 5CBEE 5JEAJ 5C44B 2K1BA 3MXPA 2NVXB 4EQPA 2A74C 1F2YA 2K5QA 4X3UA 2E2HB 1HQRD 2PCFB 2AQ1B 3GTQB 4LMQD 3C46A 4H44C 3IFDA 4BA1I 1I4QA 4IN3A 2EOTA 3OMGA 1JQYD 1ENFA 3EQLC 1LT4D 1EU3A 3GO5A 3BZDB 1JOQA 1EEFD 4N9PA 1EWCA 3IFTA 3NTIA 1W6KA 3ND8A 3TZUA 1JORA 3J7AV 1ZYRD 4QMGA 2ZT9C 3SXHA 2ICIA 3J7YW 3KBGA 3T4AC 4FF1A 2WIIB 4CJ1B 5KNDA 4R8NA 1D5MC 3G7LA 2BOSA 4XYOA 3OSOA 2RA4A 2O4XA 3HZXA 4QUCA 2HCCA 1VF7A 1TS5A 5EKIA 3V05A 3A7LA 4HMJA 3M7NA 1JOKA 2HCIA 4PMWA 3VR2A 3J81E 2RDHA 3I3CA 3P7JA 2O5JC 5D3IB 1STNA 1RD9D 3WDNA 2JP1A 1KDAA 4B9XA 5IODA 2E2DC 3SDZA 2NTSA 5CMDA 3I73A 4BWGB 2A6EC 3EFXD 1O7ZA 1F2MA 4FVMA 4DAPA 1LTGD 1UNSA 1TWHB 3A56A 4B9WA 4LJZC 3HGBA 4K5XA 3OWEB 5DAUA 1EFID 4JK1C 1MD2D 3AU7A 4RH6A 1DJRD 4ZAIA 3X3NA 1ML0D 1S5DD 2K5WA 2PMZB 5C4JB 3S2DB 1CZGA 2CW0D 2R6GA 3MC0B 2B2UA 3HS0C 4ODGA 3T56B 5CBAE 1HQMC 5JOBA 2IW3A 2FFKB 1LTAD 1EYCA 1AP0A 4XQJA 3MXGA 4K6LA 1DONA 1EIGA 4NKLA 2K05A 4IFDH 1F9QA 1EY6A 2EYLA 2NN6H 1IYVA 1GOZA 4QB4A 1UAPA 4G7OC 4C3JG 2NVYB 4ULLA 4RCOA 4A3IB 1JICA 4OO1G 1SXTA 2JXMB 2RVLA 3K0YA 1V1PA 1TY2A 1MSHA 4PQXA 2RSNA 4KKUA 4IUVA 2QILA 1KTKA 4WORA 4O1NA 5TSSA 3GD7A 1TT2A 3QOLA 3GTJB 1SMYD 3D8GA 2K32A 4C2MB 4KMUC 2D2CC 4OGQC 4RKLA 1RTOA 3KF8A 3GTGB 2F0KA 2Y0SB 1TR5A 1LT5D 3FPUB 3A8IE 1EY4A 5C5LA 2JE6I 3SR1A 5EJWA 4EVOA 2K04A 2B8FA 3G6JB 4L8JA 1GUWA 1STAA 4CHTB 1SYBA 5CC4A 5G3LD 2A68C 1II3A 3JAME 4KN7C 5AFWA 2R61A 1CZWA 1S5FD 2XRQD 3T16A 1J9OA 1G2SA 3FVQA 1A2TA 3D4DA 5C4ZA 4KY7A 1Q1EA 4XYQA 3ERQA 3ZYYX 2SEBD 2XWBB 4I7ZC 3GQBA 2F0LA 1QG7A 2L4NA 1EY7A 1WTVA 3VR3A 1MGSA 3H0GB 3SK5A 2C5CA 4Q5VA 4MHEA 2MHVA 1Y1VB 4L6TB 2WINB 2F3WA 5CV8A 1TS3A 1GHKA 2RDFA 2PO4A 1E2ZA 5DEHA 3S1NB 3RUZA 2K5DA 2F0EA 2HDMA 4XXEA 3H3VC 4V190 2L9HA 4K2LA 1ESRA 2HQEA 1E2VA 1C8CA 1DZ1A 2L0CA 1XXGA 1HUNA 4E6IA 5FK9C 1SDFA 4UAIA 3A8JE 3TN2A 2B2WC 2A6ED 2XVSA 5IGEA 3KUPA 1SBBB 1CHQD 1V43A 1NR4A 2KEEA 1S5ED 5M9OA 1VMCA 5JEAH 1CFMA 1QB5D 1G291 2QCPX 2EYOA 3PV0A 2KHSA 4ZK9B 2AQ2B 5C0XG 3AMUA 4RCNA 1HFNA 3I91A 1AW7A 1BCPB 2DNEA 2BA0A 3MWYW 4RHSA 1ENAA 5T1IA 3OW7A 1BO0A 1DXMA 2CHBD 4H0LC 4LK1C 5IGGA 2J7ZA 4F88A 2X6LA 1RDPD 1H9KA 4A3FB 5IT9L 5CV5A 1I4HA 4XQQA 1K8MA 1PTOF 1EY5A 3P75A 4K2KA 1WTRA 2X69A 3E5SA 2DY8A 4C3JB 2DN8A 2SDFA 1B2TA 2A6HC 3PUYA 4U68A 1PRTB 2NB0A 3OPOA 4Y7NB 2NN6I 1BBXC 3KLSX 5FO9B 4RFBA 1STGA 1KLGD 5I6WA 2PYKA 5NUCA 3HOVB 1BQQT 2XWJB 5M3FB 3SVMA 3MTSA 4B08A 3GTPB 2MPMA 2OF1A 4GZYC 3GTLB 3VR4A 1I6VC 4NW2A 1RTNA 4IURA 1G6ZA 2RDGA 2WAQB 2F0HA 4F87A 3BDCA 3V2TA 1JB3A 5JEAG 1GUOA 3EA6A 2M00A 1D5ZC 1GJXA 2NTTA 1GUGA 4BBRB 1AEXA 1B1ZA 2PZWA 3I4LA 1H9MA 2A68D 2F0UA 2EXZA 3ITPA 2R3ZA 3K57A 1KNEA 1PTOC 3NWSA 3J80L 4OIJA 3DMUA 2EVBA 4ZQ3A 4NDXA 1DOLA 2B2UC 4JBWA 5CGKA 1PTOH 2BDNA 2PW7A 2ZXPA 1VDZA 3H94A 1JR0D 4ZUJA 4CKEA 1Q8IA 2E75C 3L9AX 2IX3A 1GHJA 1JWSD 3IL8A 1QILA 3TP7A 1R4QB 2NVQB 2PW5A 1KDBA 2WKDA 4PV1C 1PRTF 2Q8TA 3K58A 5JVH3 4A93B 3PIP3 5JJZA 4R9WA 1EU4A 3QOJA 2MP1A 1ZEQX 2ZXOA 2K6AA 1XTCD 2EYHA 1IYUA 5K36H 1BXTA 1OXSC 1V8QA 2E76C 4XQNA 1R9TB 1CTMA 2RKSA 5CV4A 2K33A 4PNYA 3GTOB 1XX8A 1KDCA 4IUPA 5ELDA 2FHTA 4CJ0B 4R8IA 3S2HB 3L7ZC 4K8IA 3SK6A 3MAQA 3HKZB 4EQOA 5FLXL 4IQZA 2L55A 3NBHA 3VYUA 5CORA 3K5MA 1TS2A 1WTPA 1NCVA 5EGTA 2BCOA 2R7ZB 4KTAA 2JA8B 1B3AA 2JSOA 4NMZA 1DD2A 2BE5C 3Q6SA 1WVLA 5M5WB 3NPPA 5J22A 1SE2A 2LS01 2MGSA 1LTBD 3DHQA 1EL0A 1NUCA 5JVG3 1L0XB 1D1KA 2EDGA 1SNCA 1SNPA 1PRTC 4DK0A 2YU9B 1KLUD 5KRUA 3R93A 3LWEA 3HP3A 3Q24A 3D4WA 1E2WA 2EJMA 5EPLA 4FO2A 2D5DA 2YYZA 5BN5A 4OO1H 2O2LD 2ENBA 4G7ZC 5ISRA 2WACA 1SNMA 3TBIB 1I4PA 2A6HD 2AUKA 4J6HA 3KK7A 1EQTA 5K36G 4NP5A 2E2IB 1Y8NB 3O13A 1WCMB 5CV6A 3EVQA 1QNKA 4IUNA 3SK4A 3RLFA 2A69D 5C6AA 3GTKB 1D2BA 3SK8A 3M85A 1HUMA 1TWAB 3OHXC 3BYTB 3K5OA 4K5WA 2KJXA 5HGTA 3N6RA 3Q23A 1TU2B 3GV6A 3BDOA 3FRPB 1CM9A 4HCEA 4RAUC 2B2YA 1AZQA 4L63B 1JOOA 2AUJD 2E74C 4IZ8A 4A3BB 2PNRC 3QB3A 4DNTB 2F0PA 5ELCA 4KD4A 3VA5A 5ELFA 5KIXA 5F2DA 1JCKB 3S1QB 2OT2A 3TP6A 2ICEC 1PZKD 1LACA 4DF7A 2R92B 1WD1A 1BF4A 1K83B 1Z47A 1YNJC 2ZXRA 5EKLA 4ZRZA 2EYJA 1OXVA 2WV6D 3BVZA 1PTOD 3V96A 1C48A 2F0WA 5DM63 4H7BA 4A3MB 5C4HA 4IALA 4IUTA 3DUZA 4KHZA 1LT6D 3D6WA 2MJ8A 2SNSA 5C5MA 3D3RA 1Y8PB 5IGFA 1SJED 4OIKA 3GP7A 2XSCA 3CRLC 1U4RA 2PQEA 3U9SA 2Q8RE 2R93B 1PDQA 2B63B 3QO2A 4KV6A 1LT3D 1SNQA 1A3VA 3T13A 4CJ2C 1QNUA 5I9OA 3VYRA 2LY7A 4RKBA 2QDBA 3TDQA 1GUSA 3D4RA 4QF4A 2G9HD 1TS4A 2KUMA 3GV3A 1Q1BA 3PUZA 1EIHA 1TIID 1X3QA 1DYQA 1ILQA 2QKIC 3URYA 1DOMA 1PXUA 1PYWD 3HOUB 1JC7A 1D5XC 2AWNA 4A3KB 1SJHD 3IAYA 3EROA 2QEJC 3FMCA 3RZDB 2IT1A 4ABNA 3TP8A 2ID0A 2L1BA 4FXDA 1Z6HA 2FMMA 1X3PA 2K7VA 4KN4C 3W2DA 3MEHA 1FGBD 1HXYD 3NTHA 4XT3B 2Q8IB 2IX1A 1EQVA 5C0XH 2AWOA 1TWFB 3NBIA 4KY6A 4RGNA 5EQ0A 1ET9A 4FF2A 2EYPA 1U9RA 4FYDA 1CHPD 3PUWA 1SE3A 3DWQA 5FOBB 1M4VA 1HRJA 1D1IA 2EZVA 2EJGC 2EY6A 2B2TA 2B2VA 5E4XA 2VNUD 1LABA 3OMCA 1T5EA 1VF5C 4X3SA 5J1ZA 2JA7B 3C1FA 2NZ1D 4ZYSA 1LLRD 4G4KA 2I46A 2F0SA 4EGVA 5I2XA 3S14B 1ZKOA 5ELEA 3PO3B 5DNFA 3ND9A 2EPBA 3NWTA 2J4XA 3MZ5A 3QIAA 3UI2A 4G57A 2L12A 1X32A 1LTID 2OXPA 4OO1I 3HOYB 1RODA 1SFOB 2KCNA 1STHA 2M2LA 1SSOA 2JEBI 5J39A 5EPJA 3I72A 3QG1A 1EOTA 4KD3A 2K01A 4C1NK 4HR7B 2JA5B 3Q0AA 1FNWA 4F7XA 3KLRA 2IJ0A 4XDXA 5JPMC 3K59A 1HTLD 3H91A 2EJFC 2H1EA 4QCLA 1SE4A 1F77A 1IW7C 4X3KA 4IFDJ 4ZKBB 4PMBA 1ENCA 3NQTA 5EBCA 3R2IA 1O7YA 1Y8OB 4BY1B 1TWGB 3QJYA 2F3VA 4PMCA 5D3DA 1B44D 4I65A 5IGBA 5I6YA 4DAYA 3OIPA 3U9OA 1W6JA 4Z9CB 4DU9A 4HMIA 1A6XA 1WD0A 3NXWA 1J8IA 3D31A 1STYA 1F9SA 3A54A 1BR9A 1SEBD 5KEEA 3I4MB 2XIWA 5IIFA 3BG3A 1I6HB 4M8AA 1FR3A 1R4PB 1QCBD 2EY1A 3DWAA 1HA5A 4RGTA 1EEID 3PO2B 4OL7A 2XN9C 4TRDA 2O5IC 3NHHA 4G7HC 4C3HG 2L5TA 3TSSA 1RKNA 2F0FA 2KVMA 2F0MA 1WTOA 1TWCB 3MFGA 2Z1CA 2VB3X 5IOCA 4BA2I 5A2QL 5LL6X 1RF2D 2IX0A 1NR2A 3K5NA 1BNZA 4HSPA 5IT9E 4WJWA 1MBYA 4FP5D 3VYSA 3NSWA 4C3IG 4BS9A 3NTKA 3FPPA 4TKOB 1LV9A 1SYFA 1LO5D 3ONAB 4KJOA 5FO8B 1U4MA 2CQAA 4YIJA 1BCPF 1I4XA 3SEBA 2F1MA 3Q22A 4XIGS 1EY0A 2RBMA 3HOWB 1TY0A 1HHVA 2B2YC 2F0OA 1QWYA 1QOHA 5D65A 4CGYB 4ZKCB 5EKKA 2DY7A 5C0XI 1B50A 4RWSC 2RQXA 5FKAC 1CT1D 4H13C 4CKBA 1XWEA 4BBSB 3HEJA 3T51B 1RJTA 1B9NA 5C3EB 2LMCB 1I50B 2LKVA 2KQ3A 2F0VA 3OIQA 2BDOA 1M8AA 1IL8A 3VR5A 1O7LA 3J80E 4ZUIA 1PMRA 1EYAA 2EYMA 1H9RA 3H6MA 3RD4A 5CV7A 4HN7A 3SHLA 3TMEA 2C9OA 2QF7A 5I9PA 4IUQA 4KY5A 3BVMA 4KK7A 1BCPC 4TSSA 3S1RB 2MUYA 1VMPA 2Z8LA 1U4LA 3J81L 1FNUA 3KBXA 1XYIA 5KGUA 4MN3A 2XNAC 4A3JB 4FXKC 3HG9A 3FKIB 3CHBD 4OHJA 3VR6A 1TKWB 2F0NA 4K5VA 3S16B 1IW7D 1GUTA 5CV9A 1SYGA 4X3TA 3DEPA 5C3WA 3I90A 2Z4HA 2BA1A 4RA8A 2B39A 1G91A 3I8ZA 5CR3A 1AFPA 1Q90A 2D62A 1CA6A 1U4PA 1GUNA 1KAAA 1BOSA 4M1UB 1FNVA 3BS1A 1O78A 4DGZA 3I4NB 5FLXE 3NK9A 1Q12A 2B2TC 1ILPA 2B2VC 3M3YB 2F0IA 3H09A 4Q0FA 3LNNA 4C1NI 5E1FA 1ONLA 1HCZA 2EY2A 4DFAA 1FD7D 3KLSA 1L0YB 4RGMA 4C3HB 2TMPA 3PMFA 4O42A 2RSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEH A;  5I9P A;  4QB4 A;  4F7X A;  4HMJ A;  5IGG A;  3LX0 A;  1JOK A;  5J22 A;  3TP6 A;  2SNM A;  1EY7 A;  5JAV A;  4DF7 A;  5KYL A;  4KY5 A;  2EYF A;  5IOD A;  1EY9 A;  4MIU A;  3DHQ A;  5CV5 A;  1EQV A;  3D6C A;  2NUC A;  3DMU A;  1NUC A;  1SYC A;  2F0J A;  4ZQ3 A;  3SK5 A;  4N9T A;  1A3T A;  1IHZ A;  4NDX A;  1EY5 A;  3P75 A;  4KY6 A;  1SYF A;  5EKL A;  4ME5 A;  2EYJ A;  4KJO A;  1STN A;  2EYP A;  1U9R A;  4HTH A;  1SNC A;  4PMB A;  5CGK A;  1ENC A;  2PW7 A;  3NQT A;  4K2K A;  4YIJ A;  1SND A;  3E5S A;  3MXP A;  4WOR A;  1SNP A;  4KJN A;  4ZUJ A;  4EQP A;  1EY0 A;  1F2Y A;  2F0G A;  2F0W A;  2F3W A;  2PZT A;  2RBM A;  2EY6 A;  5KGU A;  2F3V A;  4WRD A;  1EZ6 A;  4PMC A;  3QOL A;  1KDA A;  1TT2 A;  2PZU A;  4H7B A;  5CV8 A;  4B9X A;  4IAL A;  4F8M A;  1A3U A;  2RDF A;  5C4H A;  4I65 A;  5DEH A;  5IGB A;  2F0T A;  3D4W A;  3TP7 A;  3RUZ A;  2OEO A;  5I6Y A;  2F0O A;  3OMC A;  2PW5 A;  4K8J A;  3D8G A;  3C1E A;  1KDB A;  2F0N A;  4K5V A;  5HUR A;  4K6D A;  3U9O A;  2F0E A;  1SNO A;  1STG A;  5CV9 A;  5J1Z A;  2ENB A;  4RKL A;  5I6W A;  5ISR A;  2SNS A;  5C5M A;  3C1F A;  2PYK A;  5NUC A;  2WAC A;  1SYG A;  3OMG A;  5EKK A;  4HMI A;  4K2L A;  1F2M A;  4DU9 A;  5IGF A;  3NXW A;  1SNM A;  2F0K A;  3P1H A;  4S3S A;  2HQE A;  5K5P A;  3NUC A;  2F0D A;  1STY A;  3QOJ A;  2PQE A;  2F0S A;  1TR5 A;  4J6H A;  5C3W A;  5KEE A;  2SOB A;  4KHV A;  2OF1 A;  4NP5 A;  4B9W A;  5IIF A;  2EYH A;  4K5X A;  4KV6 A;  5CV6 A;  4E6I A;  3BDL A;  3EVQ A;  1EY8 A;  1SNQ A;  5CR3 A;  1A3V A;  2F0Q A;  5DAU A;  4IUN A;  1EY4 A;  5C5L A;  3T13 A;  3MVV A;  1SYD A;  3EJI A;  3SK4 A;  1EZ8 A;  3SR1 A;  3HEJ A;  1JOQ A;  4EVO A;  4N9P A;  5I9O A;  2EY1 A;  2F0H A;  5IGE A;  1STA A;  4ID6 A;  3BDC A;  1SYB A;  2RKS A;  1KAA A;  4RKB A;  3V2T A;  5CV4 A;  5CC4 A;  4OL7 A;  5C6A A;  1II3 A;  2QDB A;  4TRD A;  4DGZ A;  3SK8 A;  1JOR A;  3MHB A;  1SYE A;  4PNY A;  3MZ5 A;  1TQO A;  4QF4 A;  5IGD A;  3NHH A;  1STB A;  5M9O A;  3OWF A;  2M00 A;  4G57 A;  4QMG A;  5KRU A;  3NK9 A;  1KDC A;  3SXH A;  2OXP A;  1NSN S;  4ODG A;  4K5W A;  1RKN A;  2EYO A;  2F0F A;  2KHS A;  4K8I A;  3SK6 A;  4EQN A;  2F0I A;  5JOB A;  1STH A;  2F0M A;  3T16 A;  1AEX A;  5HGT A;  3NP8 A;  5KYI A;  2LKV A;  2KQ3 A;  2PZW A;  2EY5 A;  1EYC A;  5KIX A;  1KAB A;  4EQO A;  2F0V A;  5E1F A;  5J39 A;  2EY2 A;  4DFA A;  5C3X A;  3ERO A;  4R8N A;  1A2U A;  5IOC A;  1A2T A;  3D4D A;  5C4Z A;  2F0U A;  4K14 A;  4J1M A;  4KY7 A;  2EXZ A;  5EGT A;  3TP8 A;  3OSO A;  4ZUI A;  4KD3 A;  2O4X A;  4KTA A;  1JOO A;  1EYA A;  3HZX A;  1ENA A;  1F2Z A;  3ERQ A;  4IZ8 A;  1EYD A;  2EYM A;  3ITP A;  3H6M A;  3PMF A;  3R3O A;  4NKL A;  5CV7 A;  3QB3 A;  3S9W A;  2F0P A;  1EY6 A;  3SHL A;  2EYL A;  4NMZ A;  4LAA A;  3TME A;  4KD4 A;  3TP5 A;  2F0L A;  3VA5 A;  5E3F A;  5IGC A;  5F2D A; 
#chains in the Genus database with same CATH topology
 2Z9H A;  5LMU L;  2JA5 G;  2SNM A;  3K7A B;  1ASZ A;  3DM1 A;  4UP7 A;  3E9I A;  4AYB B;  1EWH A;  2KOL A;  4GOP A;  3F8T A;  4QIW E;  4LF8 Q;  1IHZ A;  1Y1W B;  2EIF A;  1WTQ A;  4DV2 Q;  4AQY Q;  1D6E C;  2IWH A;  3CC2 A;  1C7Y A;  1E0B A;  1SND A;  1CA5 A;  3F1Z A;  1S3O A;  4OWW B;  1HR0 L;  4DR2 Q;  2NVT B;  4C3I B;  1I5F A;  1VS0 A;  5I2Y A;  2KA7 A;  2IY5 B;  1GKH A;  1EYG A;  4QIW B;  4BY1 G;  1FL0 A;  4P71 A;  4B3T L;  1EUJ A;  3M4O B;  3CW2 C;  2WB1 E;  1JJG A;  1SNO A;  3HOW H;  3K6O A;  3PGZ A;  3L3O C;  2F4I A;  3J7Z C;  1VQE A;  3VA7 A;  2VUM B;  1DCZ A;  4KKT A;  1MIU A;  2K28 A;  1WI5 A;  2L11 A;  2UUA L;  3CRK C;  1B4O A;  2Z4I A;  1PLF A;  4KHV A;  5GAG C;  4P73 A;  3CPF A;  4R4O A;  3ICE A;  2WB1 B;  1EY8 A;  3I4M G;  2HIV A;  1SYD A;  3EJI A;  4DXG A;  5CYU A;  5KNB A;  3R8B A;  1H95 A;  1P16 A;  2K75 A;  5T1G A;  1C0A A;  4ID6 A;  5FJ8 H;  5LHY 1;  1ET6 A;  1WTW A;  2EQS A;  4P75 A;  3M7G A;  3HOZ B;  1SYE A;  3STB C;  5IGD A;  2R7D A;  1STB A;  4JV5 L;  1S5C D;  5ELB A;  3OW2 A;  2NVQ H;  4BBS H;  1IKM A;  3F2C A;  1K9M C;  4N8X 1;  1G2T A;  1CQV A;  1HTP A;  2JA6 B;  1VQ5 A;  1SAP A;  1G6P A;  3JAM L;  1J6Q A;  2EY5 A;  2IL8 A;  2HDL A;  4A93 H;  1KAB A;  4KKS A;  3HRZ C;  1VCI A;  3MFY A;  4A3E B;  1JE4 A;  1KNA A;  5C3X A;  1OO9 B;  1FYC A;  3CCV A;  3E9H A;  3VYT A;  2A5H A;  2V4D A;  1H9S A;  1T5X D;  2LSS A;  1LTL A;  3ERS X;  3R3O A;  2FXQ A;  4H02 A;  4LAA A;  3NUC A;  4HSV A;  1R9T H;  1PFN A;  4U67 3;  1YI2 A;  1V1O A;  1OXU A;  3X3M A;  3J81 i;  1CI3 M;  5JAV A;  2IPK D;  3AB9 A;  1D8L A;  1LTT D;  3CCQ A;  3S17 B;  4FF4 A;  3DWP A;  3I70 A;  4X62 L;  4DXF A;  1EFW A;  2ZM6 L;  4BY7 B;  3GTO H;  1PA6 A;  2F0J A;  2RHQ B;  4N9T A;  1A3T A;  3S2H H;  1JJC B;  4LFC L;  2I5L X;  1OXT A;  5EPK A;  3NEM A;  3J81 c;  1BUV T;  4LUO A;  2GA4 B;  4RG1 A;  5IP7 G;  2F0G A;  1IKL A;  5ELN A;  4DV7 Q;  3S1R H;  1VQC A;  4JI8 Q;  1BDO A;  2WKC A;  1EZ6 A;  1Y69 U;  2PZU A;  1A63 A;  1BCP D;  3A0J A;  1KAW A;  2B29 A;  4DV0 L;  3DLL A;  2UXD Q;  2DNC A;  4K8J A;  3BJU A;  3UDX A;  1S5B D;  3DXJ C;  3S1M B;  2VB2 X;  1I4R A;  2FJ2 A;  2FMC A;  3FKI H;  4C56 C;  1VQA A;  1X55 A;  2HIX A;  1DM0 B;  1HFG A;  4S3S A;  3P1H A;  3MXU A;  2F0D A;  5I4D A;  2BE5 D;  4YY3 L;  1BBW A;  3S16 H;  4N8F A;  1HZA A;  1EQQ A;  1JWU D;  3BDL A;  4WFN 3;  2F0Q A;  1GXD C;  1YEZ A;  1LTS D;  3MVV A;  5FJ8 G;  2FIN B;  5M5X B;  1EZ8 A;  4J8Q A;  4JI0 Q;  5A35 A;  2UXC L;  5FO7 B;  1MHW C;  4IFD G;  2NN6 G;  1TQO A;  1I3Q B;  4O0A A;  3WOE A;  4DNR B;  3K5L A;  1PRT D;  2HUG A;  2VXW A;  3NQI A;  3PUV A;  4QGU A;  1F9P A;  5JPN C;  1F2L A;  3RMH A;  3QWN A;  1MJE A;  5DM7 3;  5C3E G;  1PTO B;  3NP8 A;  2CH4 A;  3EIV A;  3I4N H;  1YNN C;  3WOF A;  1A2U A;  2GN5 A;  4JI1 L;  1ICW A;  1B9M A;  1O7I A;  2WP8 J;  2E2I H;  5M5Y B;  1N34 Q;  1EYD A;  1WCM H;  2KHJ A;  3GDE A;  5H1S E;  2ATW A;  3DEO A;  4TQU S;  3U4V A;  3BYY B;  1O80 A;  2KEC A;  5E3F A;  1DOK A;  1UUP A;  5IGC A;  3RZO B;  4DN4 M;  5BN3 A;  5IWA Q;  3CP0 A;  3LX0 A;  5C44 G;  4A3G B;  4C3H H;  3GTK H;  4B3S Q;  1QE6 A;  3M4Y A;  4KHP Q;  4MIU A;  3F2U A;  3D6C A;  2NUC A;  1PFB A;  2XRS D;  4HCS A;  3K7A H;  1WTH A;  1PVO A;  4DK1 A;  1A62 A;  2JQO A;  1SR3 A;  3QR8 A;  4UDU C;  4KJN A;  1WTX A;  2ASB A;  3MA2 B;  3K0X A;  1Y1W H;  4R4C A;  1CQF A;  3S15 B;  4IUU A;  4F8M A;  5J3B A;  1KIX A;  4DNI A;  1KD1 C;  2TSS A;  2OEO A;  1RCV D;  4X64 L;  3C1E A;  1K8O A;  4A3J G;  1XNR Q;  5HUR A;  1V1P B;  4A3C H;  5BN4 A;  3N52 A;  4C3I H;  2NVT H;  1H9S B;  3S1Q H;  3NE5 B;  2I07 B;  2F03 A;  1AN8 A;  1ESF A;  2A73 B;  3C2P A;  1HNZ L;  5K5P A;  3T1H Q;  2KCM A;  4GKJ L;  1ZYR C;  2N88 A;  3CC4 A;  1K83 H;  3MXN A;  1PZI D;  1WJJ A;  3TEH B;  3SE0 A;  2JEA I;  3J7A F;  4JI2 L;  2JJQ A;  3A5U A;  4XTC S;  4HIK A;  2E2J B;  1SE8 A;  3CD6 A;  3A5Z B;  2NYZ D;  1PZJ D;  2A1A A;  3CU7 A;  2YTY A;  5AJ3 Q;  1YNJ D;  1NAP A;  3AFP A;  3ZJY C;  3JAM i;  3MHB A;  4LF7 L;  4HJ7 A;  1CSQ A;  3OWF A;  1UE7 A;  4YHH L;  3U4Z A;  2B8G A;  4P2C B;  1HPC A;  1MI2 A;  4EQN A;  3I4N G;  1H9J A;  3HOZ H;  1I4G A;  5KYI A;  5IYB H;  4KI0 A;  1B53 A;  4DV5 Q;  3PUX A;  1N8R C;  4HED A;  2NWG A;  1JWM D;  3HFZ B;  4AH6 A;  3C3L A;  1TVX A;  4K14 A;  2B63 H;  2R93 H;  2N55 A;  2JA6 H;  3A8K E;  5M3M B;  1CKO A;  4MTN A;  1F2Z A;  3S9W A;  1KC8 C;  2EE1 A;  1MSG A;  4A3E H;  1OXX K;  3A55 A;  3TP5 A;  3TZD A;  4DV4 L;  3LWU A;  4QJF A;  4XT1 B;  3E0J A;  2G9D A;  2J0T D;  5KYL A;  4IFD I;  4FXG C;  1AZP A;  2X6G A;  1A15 A;  1EY9 A;  4JCV E;  3T53 B;  2A69 C;  4DAV A;  3FDT A;  2NBF A;  2KCC A;  1IZ6 A;  2QDL A;  5C4X B;  3HOU H;  4HTH A;  3HOX B;  4V0B A;  1G8Z D;  3S17 H;  1EIF A;  4A3K H;  4FF3 A;  4FNF A;  4CBV A;  1L1O B;  1Z7T A;  2PZT A;  2KED A;  2ZJP A;  4WRD A;  3W1G A;  1A3U A;  2F0T A;  4JYA L;  5C0X J;  4DR4 Q;  1PH8 A;  5IYC G;  4K6D A;  4GKK L;  4RGO S;  2F3I A;  4ZLT F;  5D14 A;  4LF5 L;  3R2T A;  1STE A;  3P20 A;  5E4W C;  4B3R L;  2M9V A;  5LL6 S;  5GRO A;  1T9H A;  2AQ3 B;  2CW0 C;  3KJO A;  1QJO A;  2SOB A;  1C4Q A;  1LTR D;  1TWF H;  2H4O A;  1PH6 A;  2VUM G;  4A3D B;  2Q2H A;  4UP8 A;  4DK6 C;  4GOP C;  4X66 Q;  2LFN A;  5G3L F;  2QGQ A;  4ILW A;  3PIO 3;  1CK1 A;  1HA6 A;  4RHR A;  2JYO A;  1MJC A;  1X3E A;  3E6Z X;  1IBM Q;  1PFM A;  3FEW X;  3GTM B;  1F9R A;  2JK8 A;  1VQD A;  2CVR A;  1UEA B;  4L5R C;  4YCW A;  3W3A A;  1NSN S;  5A2Q E;  3CKI B;  1C9O A;  4QUF A;  3F2B A;  2PPB C;  4DUY L;  2JA7 H;  2MNA A;  1Q82 C;  1UE5 A;  3BVG A;  2NZH A;  4JI7 L;  3KYH C;  5LMN L;  3G4S A;  3CQZ B;  4J1M A;  4IO9 A;  4OX9 L;  3RNU A;  1E3P A;  1VQN A;  3IKJ A;  1RHP A;  1W2B A;  2VL6 A;  1GO3 E;  1Q3L A;  2D9U A;  2ZTD A;  3A7A B;  1YNN D;  1ZXT A;  1VQ8 A;  2EYF A;  1S4Z A;  5KNC A;  5EBD A;  4HAE A;  1SYC A;  1B8A A;  4CKC A;  5COY A;  1SMY C;  1KQS A;  4DA2 A;  1SFO H;  4ME5 A;  2B2W A;  4BY7 G;  3OOC A;  2K03 A;  1PH2 A;  2UUB L;  5CBE E;  5JEA J;  5C44 B;  2K1B A;  3MXP A;  5JJI A;  2NVX B;  4EQP A;  2A74 C;  1F2Y A;  1HJP A;  2K5Q A;  2VQF Q;  3U50 C;  3CCU A;  2Y0S G;  4X3U A;  2E2H B;  1HQR D;  2PCF B;  4DR3 Q;  2AQ1 B;  3GTQ B;  4LMQ D;  3C46 A;  4H44 C;  4LFB L;  3IFD A;  4BA1 I;  1IBK Q;  1I4Q A;  4IN3 A;  1ASY A;  2GVA A;  2EOT A;  2CWA A;  3OMG A;  4JI4 L;  1JQY D;  2LXJ A;  5FLM G;  3CXC A;  5L37 A;  1XMQ L;  4PZ8 A;  4X65 L;  4LF6 Q;  1ENF A;  3EQL C;  4P72 A;  1LT4 D;  1EU3 A;  2IHF A;  3GO5 A;  3BZD B;  1JOQ A;  1EEF D;  4N9P A;  1EWC A;  4JI3 Q;  3IFT A;  3NTI A;  4BY1 H;  1W6K A;  1TWG H;  3ND8 A;  3TZU A;  4JI5 L;  4Y52 H;  1JOR A;  4R4T A;  4DUZ Q;  3H3V I;  3J7A V;  1ZYR D;  2E2J H;  1N32 L;  4QMG A;  2ZT9 C;  1U0L A;  3I55 A;  3SXH A;  2EXD A;  1P8L A;  2ICI A;  2HHH L;  3J7Y W;  3KBG A;  3T4A C;  4FF1 A;  2WII B;  4CJ1 B;  5KND A;  3G6E A;  5BR8 L;  4R8N A;  1D5M C;  3G7L A;  1YJW A;  1XNQ Q;  3I4M H;  2BOS A;  4XYO A;  3OSO A;  2RA4 A;  1NBW A;  2O4X A;  3HZX A;  4QUC A;  2N8N A;  2HCC A;  1VF7 A;  1TS5 A;  5EKI A;  4DAM A;  4NPS A;  3V05 A;  3A7L A;  1JT8 A;  4R4Q A;  4A3L H;  4HMJ A;  3M7N A;  3NEL A;  1JOK A;  2HCI A;  4PMW A;  3VR2 A;  3J81 E;  1FGU A;  2YTV A;  4HID A;  1HH2 P;  2RDH A;  2K50 A;  3I3C A;  4B3T Q;  1J5E Q;  4A3G G;  2AMC B;  4EX5 A;  4HIO A;  4CDE C;  3P7J A;  4YCV A;  3UE0 A;  2O5J C;  5D3I B;  4B3M L;  1STN A;  3LGJ A;  1TWC H;  1RD9 D;  1VQI A;  4OWX B;  4LUV A;  2UUA Q;  3WDN A;  3UDF A;  2JP1 A;  1KDA A;  4B9X A;  5IOD A;  1K0R A;  2V1C C;  2E2D C;  3SDZ A;  2NTS A;  5CMD A;  3I73 A;  2VY3 A;  4BWG B;  2ALY B;  3I4O A;  1KL9 A;  2A6E C;  3EFX D;  1YJ9 A;  1O7Z A;  1VQF A;  1F2M A;  4FVM A;  4DAP A;  1UE1 A;  1LTG D;  2PMZ E;  4LF4 L;  1UNS A;  1TWH B;  3A56 A;  4B9W A;  4LJZ C;  5IP7 H;  3HGB A;  4K5X A;  3OWE B;  5DAU A;  1EFI D;  4JK1 C;  1MD2 D;  3AU7 A;  4RH6 A;  1DJR D;  4ZAI A;  3X3N A;  1ML0 D;  1S5D D;  1KRT A;  1EWI A;  1X3G A;  2K5W A;  4A3D H;  2PMZ B;  5C4J B;  3S2D B;  3W1B A;  1CZG A;  2UUC L;  1QVG A;  2CW0 D;  2R6G A;  3MC0 B;  2B2U A;  3HS0 C;  4ODG A;  3T56 B;  5CBA E;  1HQM C;  2HD3 A;  5JOB A;  2IW3 A;  2FFK B;  1LTA D;  1EYC A;  2D0P A;  3GTM H;  4X62 Q;  4DR7 L;  1AP0 A;  4XQJ A;  3MXG A;  4K6L A;  4A3F G;  1DON A;  2N49 A;  1EIG A;  2CH4 W;  4NKL A;  2K05 A;  3CME A;  4A3L G;  1F9Q A;  4IFD H;  1EY6 A;  2EYL A;  2NN6 H;  1IYV A;  5M3M G;  1GOZ A;  4QB4 A;  1UAP A;  3CCE A;  1B70 B;  4G7O C;  4C3J G;  2NVY B;  4ULL A;  2C35 B;  4RCO A;  3L2P A;  4A3I B;  1JIC A;  4OO1 G;  1SXT A;  5C3E H;  3NBH B;  2JXM B;  4LF8 L;  4DR6 Q;  2RVL A;  3K0Y A;  1V1P A;  3T1Y Q;  1TY2 A;  4DV2 L;  2PI2 E;  1MSH A;  3CCJ A;  4AQY L;  4PQX A;  2RSN A;  4KKU A;  4IUV A;  1I50 H;  2QIL A;  1KTK A;  1VQP A;  4WOR A;  2VZA A;  4DR2 L;  5C4X G;  3HOV G;  4O1N A;  3HOX G;  5TSS A;  3GD7 A;  1TT2 A;  3QOL A;  4JI6 Q;  2Y0S E;  4J15 A;  3GTJ B;  3L0O A;  5C44 H;  1SMY D;  3D8G A;  1SLJ A;  1GD7 A;  2NVX H;  1OTC A;  2K32 A;  4C2M B;  4KMU C;  2UXC Q;  2D2C C;  4OGQ C;  4RKL A;  1RTO A;  3KF8 A;  2HQL A;  3BZK A;  2CKZ B;  3GTG B;  3GTQ H;  1PH5 A;  2F0K A;  1MKH A;  2Y0S B;  1TR5 A;  2E5L Q;  1LT5 D;  2A19 A;  3FPU B;  4UP9 A;  1BBU A;  3A8I E;  2AKW B;  4DR1 L;  5HY6 A;  1AH9 A;  4NB3 A;  1EY4 A;  5C5L A;  2JE6 I;  3SR1 A;  4BBR G;  5EJW A;  4EVO A;  2K04 A;  2B8F A;  4A3D G;  3G6J B;  4L8J A;  1GUW A;  1STA A;  4CHT B;  1SYB A;  5CC4 A;  4DR5 Q;  2PNH A;  5G3L D;  1XJV A;  2A68 C;  1II3 A;  3JAM E;  4GNX B;  4A3J H;  4KN7 C;  2DUD A;  5AFW A;  2R61 A;  1CZW A;  1S5F D;  1N36 Q;  2XRQ D;  5ELO A;  1HNX Q;  3T16 A;  1XMO Q;  1QUQ B;  1J9O A;  1G2S A;  3S24 A;  4UY8 C;  4OWT B;  3CF5 A;  3FVQ A;  3KOJ A;  1A2T A;  3D4D A;  5C4Z A;  4KY7 A;  1CKM A;  1Q1E A;  2CFM A;  4XYQ A;  3ERQ A;  3ZYY X;  2SEB D;  2XWB B;  4I7Z C;  3EBE A;  3GQB A;  3M9B A;  4YWM A;  3VDY A;  2F0L A;  3I2Z A;  1L1O A;  1QG7 A;  2L4N A;  3OTO Q;  1YHQ A;  1EY7 A;  1Q7Y C;  3WWV A;  1WTV A;  3VR3 A;  1MGS A;  3H0G B;  3SK5 A;  1VQ6 A;  4X6A H;  2C5C A;  3M3Y H;  4JC0 A;  4Q5V A;  4LF9 L;  4MHE A;  3F2D A;  2MHV A;  1HNZ Q;  1Y1V B;  4L6T B;  2WIN B;  4DV7 L;  4GKJ Q;  1YNX A;  5GAE C;  2F3W A;  1PH1 A;  5CV8 A;  3M4P A;  1TS3 A;  1BVS A;  2UXD L;  4DV1 Q;  5LMN W;  2XGT A;  2RDF A;  2PO4 A;  1E2Z A;  5DEH A;  1N33 Q;  1GHK A;  1VQK A;  3S1N B;  3RUZ A;  1SMX A;  1SN8 A;  2DJG C;  2K5D A;  2F0E A;  2HDM A;  4XXE A;  4IOA A;  3H3V C;  4JBM A;  4V19 0;  2L9H A;  2ZJR A;  3RN5 A;  4K2L A;  1ESR A;  2HQE A;  3PQI A;  1E2V A;  1G51 A;  1C8C A;  1DZ1 A;  2L0C A;  1XXG A;  2LXK A;  1HUN A;  2I5M X;  4E6I A;  2GVB A;  5FK9 C;  3H3V H;  1SDF A;  4UAI A;  3A8J E;  3HKZ G;  3TN2 A;  2B2W C;  2A6E D;  2XVS A;  5GQO A;  5IGE A;  1TWH H;  3KUP A;  1SBB B;  1CHQ D;  1V43 A;  2B3G A;  5IYC H;  1NR4 A;  2KEE A;  1S5E D;  5M9O A;  5IP9 G;  1VMC A;  1QZG A;  5JEA H;  2R7Z G;  2JA8 G;  3M4O H;  1CFM A;  1QB5 D;  4KLK A;  1G29 1;  2QCP X;  2EYO A;  3PV0 A;  2KHS A;  4ZK9 B;  2AQ2 B;  2F4V L;  5C4J H;  5C0X G;  3AMU A;  1EIY B;  3S2D H;  4RCN A;  1K8G A;  2VUM H;  1HFN A;  3I91 A;  1AW7 A;  4RMF A;  1BCP B;  2DNE A;  2BA0 A;  3MWY W;  4QQB X;  4RHS A;  1ENA A;  3KF8 B;  5JJL A;  5T1I A;  3OW7 A;  1L0W A;  1BO0 A;  1DXM A;  2UXB L;  3PF4 A;  5IWA L;  2CHB D;  4H0L C;  2WFW A;  1PV4 A;  2CCZ A;  4LK1 C;  5IGG A;  2D0O A;  2J7Z A;  4F88 A;  2X6L A;  1RDP D;  4KHP L;  1H9K A;  4A3F B;  5IT9 L;  5CV5 A;  1HNW Q;  1I4H A;  4XQQ A;  1CSP A;  1K8M A;  4GKK Q;  4L5Q A;  1PTO F;  1EY5 A;  3P75 A;  3PSI A;  3STB D;  2NVY H;  4K2K A;  1WTR A;  2X69 A;  3E5S A;  2DY8 A;  4C3J B;  2DN8 A;  2SDF A;  1B2T A;  2A6H C;  3PUY A;  1LYL A;  3E3X A;  1JE5 A;  4U68 A;  1PRT B;  2NB0 A;  3OPO A;  4Y7N B;  2NN6 I;  1GVP A;  1BBX C;  3KLS X;  5FO9 B;  4RFB A;  1STG A;  1KLG D;  5I6W A;  2PYK A;  5NUC A;  3HOV B;  1BQQ T;  3T1H L;  2XWJ B;  5M3F B;  3SVM A;  3MTS A;  1WOC A;  4BY7 H;  4B08 A;  3U58 A;  3GTP B;  2MPM A;  2OF1 A;  3ULP A;  4GZY C;  3GTL B;  3VR4 A;  3GTG H;  1I6V C;  4NW2 A;  1RTN A;  4IUR A;  1G6Z A;  2RDG A;  4NXM Q;  3KFU A;  4P74 A;  2WAQ B;  1ICF B;  5AJ3 L;  4O2D A;  2F0H A;  4F87 A;  3PF5 A;  3BDC A;  5LMN Q;  3V2T A;  1JB3 A;  2L15 A;  5GAH C;  5JEA G;  4OX9 Q;  1UEB A;  1GUO A;  3EA6 A;  2M00 A;  4K0K Q;  1RIP A;  1D5Z C;  4OON A;  1GJX A;  4HJ8 A;  2NTT A;  4A3B G;  2VQE L;  1GUG A;  3S1M H;  4BBR B;  1AEX A;  5FLM H;  4DV5 L;  1B1Z A;  2PZW A;  2ES2 A;  1S40 A;  1N9W A;  4NXN Q;  3I4L A;  2R92 G;  1HZB A;  2QEX A;  1H9M A;  3CC7 A;  1PH7 A;  2A68 D;  2F0U A;  3CPW A;  2ZTE A;  4DV3 Q;  2EXZ A;  2Z6K A;  1HR0 W;  3ITP A;  2R3Z A;  3K57 A;  1KNE A;  4GLX A;  5M5X H;  3G71 A;  1PTO C;  1V9P A;  1PYB A;  4DV6 Q;  3NWS A;  2RHS B;  3J80 L;  4OIJ A;  4UPA A;  1I3Q H;  4A3M G;  3DMU A;  2EVB A;  4ZQ3 A;  4A3I G;  4NDX A;  4MTK A;  1DOL A;  2B2U C;  3AQQ A;  4JBW A;  5CGK A;  1PTO H;  2BDN A;  2PW7 A;  2ZXP A;  1VDZ A;  1XTD A;  3H94 A;  4LFA Q;  1JR0 D;  3H15 A;  4ZUJ A;  3CAM A;  4CKE A;  1Q8I A;  2E75 C;  4DKA C;  3H0G H;  3EN2 A;  3L9A X;  4LUZ A;  2KHI A;  2IX3 A;  1GHJ A;  1JWS D;  3IL8 A;  5M5Y H;  1QIL A;  3TP7 A;  1R4Q B;  4OEL B;  2NVQ B;  4DR4 L;  2N3S A;  2PW5 A;  1KDB A;  1Y1V H;  2WKD A;  4PV1 C;  1PRT F;  3RZO H;  2Q8T A;  3K58 A;  5JVH 3;  4A93 B;  4A3G H;  3PIP 3;  5JJZ A;  4R9W A;  3S1N H;  1EU4 A;  3CCL A;  3KDF A;  3QOJ A;  2MP1 A;  1ZEQ X;  2ZXO A;  2K6A A;  1XTC D;  3PIO A;  1E7Z A;  4BXX G;  2HHH Q;  4FDB A;  4X66 L;  4WJ3 M;  2EYH A;  5IY0 A;  1IYU A;  5K36 H;  1BXT A;  1OXS C;  1V8Q A;  4DAY B;  1I94 Q;  3IRB A;  3UE1 A;  2E76 C;  3HKZ E;  4XQN A;  1CTM A;  1R9T B;  4GN5 A;  2RKS A;  1YIT A;  5CV4 A;  2K33 A;  1VQ4 A;  1IBM L;  3S15 H;  4A4I A;  1FJG Q;  4JW0 A;  4PNY A;  3GTO B;  1XX8 A;  1KDC A;  4IUP A;  3AFQ A;  5ELD A;  2FHT A;  4CJ0 B;  4R8I A;  3S2H B;  2OTJ A;  2CWP A;  3L7Z C;  4K8I A;  3SK6 A;  3MAQ A;  3HKZ B;  1HZ9 A;  3ULJ A;  2ZTC A;  4EQO A;  1PH3 A;  2RF4 A;  5FLX L;  2UU9 Q;  4IQZ A;  1E24 A;  2L55 A;  3NBH A;  3VYU A;  2A8V A;  5COR A;  2OQK A;  3K5M A;  1IBL Q;  1VQL A;  1TS2 A;  1WTP A;  3TRZ A;  1NCV A;  5EGT A;  2MO0 A;  4JBJ A;  2BCO A;  2R7Z B;  4KTA A;  2JA8 B;  1B3A A;  1HZC A;  1IYJ B;  2JSO A;  4A76 A;  4NMZ A;  1DD2 A;  2BE5 C;  3Q6S A;  1WVL A;  1A8V A;  5M5W B;  3NPP A;  5J22 A;  2I0Q A;  1K8A C;  5LMU Q;  1SE2 A;  2LS0 1;  1UE6 A;  3ULL A;  2MGS A;  1LTB D;  1YZ6 A;  1GM5 A;  2PI2 A;  5IT9 c;  3DHQ A;  1EL0 A;  1NUC A;  4IJH A;  2K4K A;  5JVG 3;  1L0X B;  3KF6 A;  3UDG A;  1D1K A;  2EDG A;  1SNC A;  4L5S A;  4A3F H;  3H0G G;  1SNP A;  1PRT C;  4DK0 A;  2YU9 B;  4POF A;  1KLU D;  5KRU A;  4DR3 L;  1HR0 Q;  3R93 A;  5IYD G;  3LWE A;  3HP3 A;  5M3M H;  1Y1V G;  3Q24 A;  3D4W A;  3TRE A;  1E2W A;  2EJM A;  5EPL A;  1IBK L;  4FO2 A;  4C3J H;  2D5D A;  2YYZ A;  1FVI A;  5BN5 A;  4OO1 H;  2O2L D;  2ENB A;  4G7Z C;  5ISR A;  3CCM A;  4HIM A;  3PO3 G;  4GNX A;  2WAC A;  1L1O C;  4JOI A;  1SNM A;  3TBI B;  1I4P A;  2A6H D;  2AUK A;  4J6H A;  2Z0S A;  3KK7 A;  1EQT A;  5K36 G;  4NP5 A;  2E2I B;  1Y8N B;  3O13 A;  1QUQ A;  4LW1 A;  1WCM B;  5CV6 A;  4GN3 B;  5C4X H;  3EVQ A;  1QNK A;  3HOV H;  3HOY G;  1JJ2 A;  4IUN A;  3HOX H;  3SK4 A;  3RLF A;  2A69 D;  4JI3 L;  4GLV B;  3GTP H;  1Y14 B;  4DUZ L;  5C6A A;  3GTK B;  1D2B A;  3SK8 A;  3M85 A;  3GTL H;  1HUM A;  1IXR A;  4JV5 Q;  1TWA B;  3OHX C;  1UWV A;  3BYT B;  1M90 C;  3K5O A;  4K5W A;  2KJX A;  5HGT A;  4L5T A;  3N6R A;  3Q23 A;  1TU2 B;  4IPC A;  3GV6 A;  3BDO A;  3FRP B;  1XNQ L;  1CM9 A;  4HCE A;  4LWC A;  3KLW A;  4RAU C;  2B2Y A;  3J80 i;  1AZQ A;  4L63 B;  4BBR H;  3MEF A;  1JOO A;  2AUJ D;  2E74 C;  4IZ8 A;  4A3B B;  2PNR C;  3QB3 A;  2F0P A;  4GLA C;  4DNT B;  5ELC A;  4KD4 A;  3VA5 A;  3KDF B;  5ELF A;  5KIX A;  5F2D A;  1JCK B;  3S1Q B;  2OT2 A;  2MFI A;  3TP6 A;  2ICE C;  1PZK D;  1LAC A;  3M4Q A;  4DF7 A;  3J80 c;  2R92 B;  1DGS A;  1WD1 A;  1J5E L;  2KCT A;  3K8A A;  4A75 A;  3AEV A;  1BF4 A;  2ZM6 Q;  1K83 B;  4PZ6 A;  1Z47 A;  2AHO B;  1YNJ C;  2ZXR A;  5EKL A;  4ZRZ A;  2EYJ A;  1OXV A;  2WV6 D;  3BVZ A;  4LFC Q;  1PTO D;  3V96 A;  3CMA A;  1C48 A;  2F0W A;  2QW7 A;  5DM6 3;  3CCS A;  4H7B A;  4A3M B;  3CQZ H;  5C4H A;  4IAL A;  4IUT A;  4DR1 Q;  3DUZ A;  4KHZ A;  4DV0 Q;  1LT6 D;  1E1T A;  3K80 C;  1VQB A;  1U5K A;  3D6W A;  2MJ8 A;  2SNS A;  4JVZ A;  5C5M A;  3D3R A;  1K3R A;  1Y8P B;  1NTG A;  5IGF A;  1SJE D;  4OIK A;  3PO2 G;  3GP7 A;  2XSC A;  1YVC A;  3CRL C;  1U4R A;  2PQE A;  3U9S A;  2Q8R E;  2R93 B;  1PDQ A;  4YY3 Q;  3QO2 A;  2B63 B;  3A74 A;  5M3F G;  4KV6 A;  1PHJ A;  1LT3 D;  1SNQ A;  1A3V A;  2OWO A;  3T13 A;  4CJ2 C;  1QNU A;  1NMG A;  5I9O A;  3VYR A;  2LY7 A;  2E8G A;  2IHE A;  4RKB A;  2QDB A;  3KF6 B;  3TDQ A;  1GUS A;  3D4R A;  2WAQ G;  2E2H H;  4QF4 A;  2G9H D;  1TS4 A;  2KUM A;  1PH4 A;  3GV3 A;  4UHV A;  1Q1B A;  3PUZ A;  3TQY A;  1EIH A;  1TII D;  1X3Q A;  1LM0 A;  1YIJ A;  1DYQ A;  1ILQ A;  2QKI C;  3URY A;  1DOM A;  1PXU A;  1PYW D;  3HOU B;  2NZO A;  1JC7 A;  3TS2 A;  1D5X C;  2AWN A;  2MQH A;  4A3K B;  1SJH D;  3IAY A;  1NNX A;  3AYH B;  5FLX c;  3ERO A;  1A0I A;  2QEJ C;  3FMC A;  4JI1 Q;  3RZD B;  2H5X A;  2IT1 A;  4ABN A;  3TP8 A;  2RCN A;  2ID0 A;  2L1B A;  4FXD A;  4LF9 Q;  1Z6H A;  2FMM A;  1X3P A;  2K7V A;  4KN4 C;  4JBK A;  3W2D A;  3MEH A;  1FGB D;  5IP9 H;  1YHA A;  1HXY D;  2R7Z H;  1QVC A;  2JA8 H;  3NTH A;  1Z9F A;  4XT3 B;  1X9N A;  1QVF A;  3HOW G;  2Q8I B;  2N78 A;  2IX1 A;  4DR6 L;  3T1Y L;  2KBN A;  1EQV A;  5C0X H;  2AWO A;  1TWF B;  3RR5 A;  3NBI A;  4KY6 A;  4RGN A;  5EQ0 A;  5M5W H;  4LNQ A;  1YHB A;  1ET9 A;  2MO1 A;  4FF2 A;  2EYP A;  1U9R A;  4FYD A;  1CHP D;  1PYS B;  3PUW A;  1SE3 A;  3DWQ A;  3RN2 A;  5FOB B;  1M4V A;  1YBY A;  1HRJ A;  1D1I A;  2EZV A;  2EJG C;  4JI6 L;  2EY6 A;  1Q86 C;  4JG2 A;  2B2T A;  1NJI C;  4YWK A;  2B2V A;  1CUK A;  5E4X A;  2VNU D;  1LAB A;  3OMC A;  4APV A;  4AIM A;  4GOP B;  1T5E A;  1VF5 C;  4X3S A;  1XPU A;  2Z6K C;  4X64 Q;  3CCR A;  2YU9 H;  1S72 A;  5J1Z A;  1B3Q A;  4BBS G;  2JA7 B;  3C1F A;  2NZ1 D;  4TVA B;  4ZYS A;  1LLR D;  4G4K A;  2E5L L;  2I46 A;  3J7A 5;  2F0S A;  4A93 G;  4JI8 L;  4EGV A;  1KHI A;  4ZCK A;  5I2X A;  3S14 B;  2F4V Q;  1ZKO A;  3UDI A;  4JI2 Q;  5ELE A;  1X56 A;  2PQA A;  3PO3 B;  5DNF A;  3ND9 A;  4WJ4 A;  1VQM A;  4DR5 L;  4CDD C;  5GAD C;  2EPB A;  3FP9 A;  3NWT A;  2J4X A;  3MZ5 A;  4LF7 Q;  3QIA A;  3UI2 A;  1W3S A;  4G57 A;  4GN4 B;  2L12 A;  1X32 A;  4R4I A;  1XPO A;  2UXB Q;  1LTI D;  2OXP A;  1N36 L;  1KRS A;  4OO1 I;  4YHH Q;  1HNX L;  3HOY B;  5JJK A;  1ROD A;  1XMO L;  1SFO B;  2KEN A;  1XPR A;  2DGY A;  2KCN A;  1STH A;  2M2L A;  1SSO A;  2JEB I;  1TWA H;  5J39 A;  4JI0 L;  5EPJ A;  3I72 A;  3QG1 A;  2Q2U A;  1EOT A;  4KD3 A;  2K01 A;  3FHW A;  1JB7 A;  4C1N K;  4HR7 B;  2JA5 B;  5EAY A;  3Q0A A;  1K73 C;  1FNW A;  4I7A A;  4IOC A;  1X3F A;  3OTO L;  4F7X A;  1AE3 A;  4DV4 Q;  5IE8 A;  3KLR A;  2IJ0 A;  4XDX A;  5JPM C;  4A3B H;  3K59 A;  1HTL D;  1WFQ A;  3G48 A;  3H91 A;  3FKI G;  1V1Q A;  4IPG A;  1NMF A;  2EJF C;  2H1E A;  4QCL A;  1SE4 A;  1F77 A;  2ZJQ A;  1IW7 C;  4X3K A;  2R92 H;  4IFD J;  4ZKB B;  1N34 L;  3Q8D A;  3PCO B;  4PMB A;  4HJ5 A;  1ENC A;  3NQT A;  5EBC A;  3R2I A;  1O7Y A;  1Y8O B;  4BY1 B;  1TWG B;  5HGQ A;  3QJY A;  4DV1 L;  2F3V A;  4PMC A;  1N33 L;  5D3D A;  2VW9 A;  1B44 D;  2I5H A;  4I65 A;  5IGB A;  4B3S L;  1JMC A;  1E1O A;  5I6Y A;  4DAY A;  4JYA Q;  1NY4 A;  3OIP A;  3U9O A;  3B6Y A;  1W6J A;  4OXP A;  3K7U C;  4Z9C B;  4A3M H;  4DU9 A;  4LF5 Q;  4HMI A;  4A3I H;  1A6X A;  1WD0 A;  3NXW A;  4B3R Q;  1J8I A;  2JN4 A;  2F52 A;  3D31 A;  4DK3 C;  1PH9 A;  1STY A;  1F9S A;  3NEN A;  3A54 A;  1BR9 A;  1SEB D;  3BU2 A;  5KEE A;  3I4M B;  2XIW A;  2VQE Q;  5IIF A;  3BG3 A;  1I6H B;  3JAM c;  2Q2T A;  4OEM B;  4M8A A;  1FR3 A;  1SRU A;  1R4P B;  1XNR L;  1QCB D;  1WCM G;  2EY1 A;  2VS1 A;  3DWA A;  1HA5 A;  2JA9 A;  4RGT A;  1EEI D;  3PO2 B;  4OL7 A;  2XN9 C;  4QL5 A;  4TRD A;  2O5I C;  2WAQ E;  4IPH A;  3NHH A;  3GTJ H;  4G7H C;  4C3H G;  4EQ5 A;  2L5T A;  3TSS A;  1RKN A;  2F0F A;  2KVM A;  4C2M H;  2F0M A;  1WTO A;  1TWC B;  3MFG A;  4DUY Q;  1QZH A;  4BXX H;  2Z1C A;  2VB3 X;  5IOC A;  4BA2 I;  4GNX C;  4JI7 Q;  2OCE A;  5A2Q L;  4JOI C;  5LL6 X;  1RF2 D;  4AYB G;  2IX0 A;  1NR2 A;  3K5N A;  1BNZ A;  4HSP A;  2BH8 A;  1Y1W G;  5IT9 E;  4WJW A;  1MBY A;  4FP5 D;  2DJF C;  3VYS A;  1Q81 C;  3NSW A;  3RZD H;  3K81 C;  4A3C G;  1L2F A;  1HNW L;  4MNO A;  4C3I G;  4BS9 A;  2PQA B;  3NTK A;  3FPP A;  4TKO B;  1X54 A;  1LV9 A;  4IJL A;  1SYF A;  3D0F A;  1K28 A;  1LO5 D;  3ONA B;  4KJO A;  4PG3 A;  5FO8 B;  1U4M A;  2CQA A;  4YIJ A;  2XTI A;  2UUB Q;  1BCP F;  1I4X A;  1X6O A;  3SEB A;  2F1M A;  3Q22 A;  4XIG S;  5E7N A;  1EY0 A;  2RBM A;  3HOW B;  1TY0 A;  2QA4 A;  1HHV A;  4YCU A;  1E22 A;  1CKN A;  4JPB W;  1VQO A;  4IPD A;  2B2Y C;  2F0O A;  1QWY A;  1QOH A;  5D65 A;  4LFB Q;  4DPG A;  4CGY B;  2WB1 G;  1BKB A;  2BH2 A;  4ZKC B;  2OQ0 A;  2HT1 A;  3ER0 A;  5EKK A;  2K5H A;  4MZ9 A;  4JI4 Q;  2DY7 A;  4CDF C;  5C0X I;  3HOZ G;  1B50 A;  5IYB G;  4RWS C;  3KJP A;  1LUZ A;  2RQX A;  5FKA C;  1XMQ Q;  4X65 Q;  1CT1 D;  4H13 C;  4NXM L;  1K3B C;  4CKB A;  2R93 G;  2B63 G;  1XWE A;  1VQ7 A;  2JA6 G;  4BBS B;  3HEJ A;  5IYD H;  1YJN A;  3T51 B;  1VQJ A;  4A3E G;  1TXY A;  3S14 H;  1RL2 A;  1RJT A;  4JI5 Q;  1B9N A;  4K0K L;  3RLN A;  4CDC C;  5C3E B;  1N32 Q;  3PO3 H;  1AE2 A;  5DLQ E;  3MXN B;  1KXL A;  2K5N A;  1B7Y B;  2LMC B;  1K0S A;  1I50 B;  1Q8K A;  2KQ3 A;  2LKV A;  3DM3 A;  2F0V A;  4NXN L;  3OIQ A;  4YWL A;  2BDO A;  1M8A A;  3HOU G;  4DV3 L;  5BR8 Q;  3HOY H;  1IL8 A;  3VR5 A;  1O7L A;  4A3K G;  3J80 E;  4ZUI A;  1PMR A;  2K52 A;  1EYA A;  4HJ9 A;  2EYM A;  1H9R A;  3H6M A;  5CV7 A;  3RD4 A;  3W5O A;  4HN7 A;  3SHL A;  3TME A;  2C9O A;  2QF7 A;  5I9P A;  4DV6 L;  1IL2 A;  2YTX A;  4IUQ A;  2R7F A;  4KY5 A;  3BVM A;  4KK7 A;  1BCP C;  2JA5 H;  1VQH A;  4TSS A;  3J81 j;  1M1K C;  3S1R B;  2MUY A;  2Q2I A;  1VMP A;  2Z8L A;  1U4L A;  2K5V A;  3J81 L;  4B3M Q;  4LFA L;  1FNU A;  3KBX A;  1XYI A;  2OTL A;  4QY7 A;  5KGU A;  4MN3 A;  2XNA C;  4A3J B;  3E0E A;  4FXK C;  3HG9 A;  3FKI B;  3CHB D;  4POG A;  4ALP A;  4OHJ A;  3PIP A;  3I56 A;  3VR6 A;  2K14 A;  1TKW B;  1X65 A;  3JC6 6;  3RLO A;  3HKS A;  2F0N A;  4K5V A;  3S16 B;  1IW7 D;  1GUT A;  5CV9 A;  1PFS A;  4ME3 A;  1SYG A;  2YV5 A;  4X3T A;  4PZ7 A;  3DEP A;  1WYD A;  2JA7 G;  2VQF L;  5C3W A;  3I90 A;  4LF4 Q;  2Z4H A;  2BA1 A;  4RA8 A;  2B39 A;  1G91 A;  3I8Z A;  1I94 L;  5CR3 A;  1AFP A;  1Q90 A;  4GS3 A;  2D62 A;  1CA6 A;  1U4P A;  1D7Q A;  1GUN A;  1KAA A;  1BOS A;  4M1U B;  1FJG L;  1FNV A;  3BS1 A;  1I6H H;  1O78 A;  4DGZ A;  3TS0 A;  3I4N B;  2UUC Q;  5FLX E;  3NK9 A;  1Q12 A;  2RCF A;  4Y7N H;  2B2T C;  1ILP A;  4R1J A;  2B2V C;  1VQ9 A;  3SGI A;  3M3Y B;  4LF6 L;  1EOV A;  3PO2 H;  2F0I A;  3H09 A;  4HJA A;  1SRO A;  4Q0F A;  3BZC A;  1CKN B;  3LNN A;  2Z6B A;  3I7F A;  1VQG A;  1NE3 A;  2UU9 L;  4C1N I;  5E1F A;  1ONL A;  1HCZ A;  5M3F H;  2EY2 A;  3OYY A;  4DFA A;  1IBL L;  1EQR A;  2G5D A;  4DR7 Q;  2CQO A;  4AYB E;  1FD7 D;  3KLS A;  1Q46 A;  1L0Y B;  4RGM A;  4C3H B;  2P5Z X;  2TMP A;  3PMF A;  4O42 A;  2RSO A; 
#chains in the Genus database with same CATH homology
 2SNM A;  3K7A B;  3DM1 A;  4AYB B;  1EWH A;  2KOL A;  1IHZ A;  1Y1W B;  1WTQ A;  1D6E C;  2IWH A;  1E0B A;  1SND A;  1CA5 A;  2NVT B;  4C3I B;  5I2Y A;  2KA7 A;  4QIW B;  3M4O B;  1SNO A;  3K6O A;  3L3O C;  2F4I A;  3VA7 A;  2VUM B;  1DCZ A;  4KKT A;  2K28 A;  2L11 A;  3CRK C;  1B4O A;  2Z4I A;  1PLF A;  4KHV A;  2WB1 B;  1EY8 A;  1SYD A;  3EJI A;  4DXG A;  5CYU A;  5KNB A;  3R8B A;  5T1G A;  4ID6 A;  5LHY 1;  1ET6 A;  1WTW A;  3HOZ B;  3M7G A;  1SYE A;  5IGD A;  1STB A;  1S5C D;  5ELB A;  1IKM A;  1G2T A;  1CQV A;  1HTP A;  2JA6 B;  1SAP A;  3JAM L;  2EY5 A;  2IL8 A;  2HDL A;  1KAB A;  4KKS A;  3HRZ C;  1VCI A;  3MFY A;  4A3E B;  1JE4 A;  1KNA A;  5C3X A;  1OO9 B;  1FYC A;  3VYT A;  2A5H A;  2V4D A;  1H9S A;  1T5X D;  3R3O A;  4LAA A;  3NUC A;  4HSV A;  1PFN A;  4U67 3;  1V1O A;  1OXU A;  3X3M A;  1CI3 M;  5JAV A;  2IPK D;  3AB9 A;  1LTT D;  3S17 B;  4FF4 A;  3DWP A;  3I70 A;  4DXF A;  4BY7 B;  2F0J A;  4N9T A;  1A3T A;  1OXT A;  5EPK A;  1BUV T;  2GA4 B;  2F0G A;  1IKL A;  1BDO A;  2WKC A;  1EZ6 A;  1Y69 U;  2PZU A;  1BCP D;  2DNC A;  4K8J A;  1S5B D;  3DXJ C;  3S1M B;  2VB2 X;  1I4R A;  2FJ2 A;  2FMC A;  4C56 C;  1DM0 B;  1HFG A;  4S3S A;  3P1H A;  3MXU A;  2F0D A;  5I4D A;  2BE5 D;  1JWU D;  3BDL A;  4WFN 3;  2F0Q A;  1GXD C;  1LTS D;  3MVV A;  2FIN B;  5M5X B;  1EZ8 A;  4J8Q A;  5A35 A;  5FO7 B;  4IFD G;  2NN6 G;  1TQO A;  1I3Q B;  3WOE A;  4DNR B;  3K5L A;  1PRT D;  2HUG A;  2VXW A;  3NQI A;  3PUV A;  1F9P A;  5JPN C;  1F2L A;  3RMH A;  3QWN A;  5DM7 3;  1PTO B;  3NP8 A;  1YNN C;  3WOF A;  1A2U A;  1ICW A;  1B9M A;  2WP8 J;  5M5Y B;  1EYD A;  3DEO A;  4TQU S;  3BYY B;  1O80 A;  2KEC A;  5E3F A;  5IGC A;  1DOK A;  1UUP A;  3RZO B;  4DN4 M;  5BN3 A;  3LX0 A;  4A3G B;  1QE6 A;  3M4Y A;  4MIU A;  3F2U A;  3D6C A;  2NUC A;  1PFB A;  2XRS D;  4HCS A;  4DK1 A;  4UDU C;  4KJN A;  1WTX A;  3MA2 B;  1CQF A;  3S15 B;  4IUU A;  4F8M A;  2TSS A;  2OEO A;  1RCV D;  1K8O A;  3C1E A;  5HUR A;  1V1P B;  5BN4 A;  3N52 A;  1H9S B;  3NE5 B;  2I07 B;  2F03 A;  1AN8 A;  1ESF A;  2A73 B;  3C2P A;  5K5P A;  1ZYR C;  2N88 A;  3MXN A;  1PZI D;  3SE0 A;  2JEA I;  3J7A F;  4XTC S;  2E2J B;  2NYZ D;  1PZJ D;  3CU7 A;  1YNJ D;  1NAP A;  3MHB A;  3OWF A;  2B8G A;  4P2C B;  1HPC A;  1MI2 A;  4EQN A;  1H9J A;  1I4G A;  5KYI A;  4KI0 A;  1B53 A;  3PUX A;  4HED A;  2NWG A;  1JWM D;  3C3L A;  1TVX A;  4K14 A;  2N55 A;  3A8K E;  5M3M B;  1F2Z A;  3S9W A;  2EE1 A;  1MSG A;  1OXX K;  3A55 A;  3TP5 A;  3TZD A;  3LWU A;  4XT1 B;  3E0J A;  2G9D A;  2J0T D;  5KYL A;  4IFD I;  4FXG C;  1AZP A;  2X6G A;  1A15 A;  1EY9 A;  3T53 B;  2A69 C;  4DAV A;  3FDT A;  2NBF A;  2KCC A;  5C4X B;  4HTH A;  3HOX B;  4V0B A;  1G8Z D;  4FF3 A;  4FNF A;  4CBV A;  1Z7T A;  2PZT A;  2KED A;  4WRD A;  1A3U A;  2F0T A;  5C0X J;  4K6D A;  4RGO S;  4ZLT F;  5D14 A;  3R2T A;  1STE A;  3P20 A;  5E4W C;  2M9V A;  5LL6 S;  2AQ3 B;  2CW0 C;  1QJO A;  2SOB A;  1C4Q A;  1LTR D;  2H4O A;  4A3D B;  2LFN A;  5G3L F;  4ILW A;  3PIO 3;  1CK1 A;  1HA6 A;  4RHR A;  2JYO A;  3E6Z X;  1PFM A;  3FEW X;  3GTM B;  1F9R A;  2CVR A;  1UEA B;  3W3A A;  1NSN S;  5A2Q E;  3CKI B;  4QUF A;  2PPB C;  3BVG A;  3CQZ B;  4J1M A;  3IKJ A;  1RHP A;  1Q3L A;  2D9U A;  3A7A B;  1YNN D;  1ZXT A;  2EYF A;  1S4Z A;  5KNC A;  5EBD A;  4HAE A;  1SYC A;  4CKC A;  5COY A;  1SMY C;  4DA2 A;  4ME5 A;  2B2W A;  3OOC A;  2K03 A;  5CBE E;  5JEA J;  5C44 B;  2K1B A;  3MXP A;  2NVX B;  4EQP A;  2A74 C;  1F2Y A;  2K5Q A;  4X3U A;  2E2H B;  1HQR D;  2PCF B;  2AQ1 B;  3GTQ B;  4LMQ D;  3C46 A;  4H44 C;  3IFD A;  4BA1 I;  1I4Q A;  4IN3 A;  2EOT A;  3OMG A;  1JQY D;  1ENF A;  3EQL C;  1LT4 D;  1EU3 A;  3GO5 A;  3BZD B;  1JOQ A;  1EEF D;  4N9P A;  1EWC A;  3IFT A;  3NTI A;  1W6K A;  3ND8 A;  3TZU A;  1JOR A;  3J7A V;  1ZYR D;  4QMG A;  2ZT9 C;  3SXH A;  2ICI A;  3J7Y W;  3KBG A;  3T4A C;  4FF1 A;  2WII B;  4CJ1 B;  5KND A;  4R8N A;  1D5M C;  3G7L A;  2BOS A;  4XYO A;  3OSO A;  2RA4 A;  2O4X A;  3HZX A;  4QUC A;  2HCC A;  1VF7 A;  1TS5 A;  5EKI A;  3V05 A;  3A7L A;  4HMJ A;  3M7N A;  1JOK A;  2HCI A;  4PMW A;  3VR2 A;  3J81 E;  2RDH A;  3I3C A;  3P7J A;  2O5J C;  5D3I B;  1STN A;  1RD9 D;  3WDN A;  2JP1 A;  1KDA A;  4B9X A;  5IOD A;  2E2D C;  3SDZ A;  2NTS A;  5CMD A;  3I73 A;  4BWG B;  2A6E C;  3EFX D;  1O7Z A;  1F2M A;  4FVM A;  4DAP A;  1LTG D;  1UNS A;  1TWH B;  3A56 A;  4B9W A;  4LJZ C;  3HGB A;  4K5X A;  3OWE B;  5DAU A;  1EFI D;  4JK1 C;  1MD2 D;  3AU7 A;  4RH6 A;  1DJR D;  4ZAI A;  3X3N A;  1ML0 D;  1S5D D;  2K5W A;  2PMZ B;  5C4J B;  3S2D B;  1CZG A;  2CW0 D;  2R6G A;  3MC0 B;  2B2U A;  3HS0 C;  4ODG A;  3T56 B;  5CBA E;  1HQM C;  5JOB A;  2IW3 A;  2FFK B;  1LTA D;  1EYC A;  1AP0 A;  4XQJ A;  3MXG A;  4K6L A;  1DON A;  1EIG A;  4NKL A;  2K05 A;  4IFD H;  1F9Q A;  1EY6 A;  2EYL A;  2NN6 H;  1IYV A;  1GOZ A;  4QB4 A;  1UAP A;  4G7O C;  4C3J G;  2NVY B;  4ULL A;  4RCO A;  4A3I B;  1JIC A;  4OO1 G;  1SXT A;  2JXM B;  2RVL A;  3K0Y A;  1V1P A;  1TY2 A;  1MSH A;  4PQX A;  2RSN A;  4KKU A;  4IUV A;  2QIL A;  1KTK A;  4WOR A;  4O1N A;  5TSS A;  3GD7 A;  1TT2 A;  3QOL A;  3GTJ B;  1SMY D;  3D8G A;  2K32 A;  4C2M B;  4KMU C;  2D2C C;  4OGQ C;  4RKL A;  1RTO A;  3KF8 A;  3GTG B;  2F0K A;  2Y0S B;  1TR5 A;  1LT5 D;  3FPU B;  3A8I E;  1EY4 A;  5C5L A;  2JE6 I;  3SR1 A;  5EJW A;  4EVO A;  2K04 A;  2B8F A;  3G6J B;  4L8J A;  1GUW A;  1STA A;  4CHT B;  1SYB A;  5CC4 A;  5G3L D;  2A68 C;  1II3 A;  3JAM E;  4KN7 C;  5AFW A;  2R61 A;  1CZW A;  1S5F D;  2XRQ D;  3T16 A;  1J9O A;  1G2S A;  3FVQ A;  1A2T A;  3D4D A;  5C4Z A;  4KY7 A;  1Q1E A;  4XYQ A;  3ERQ A;  3ZYY X;  2SEB D;  2XWB B;  4I7Z C;  3GQB A;  2F0L A;  1QG7 A;  2L4N A;  1EY7 A;  1WTV A;  3VR3 A;  1MGS A;  3H0G B;  3SK5 A;  2C5C A;  4Q5V A;  4MHE A;  2MHV A;  1Y1V B;  4L6T B;  2WIN B;  2F3W A;  5CV8 A;  1TS3 A;  1GHK A;  2RDF A;  2PO4 A;  1E2Z A;  5DEH A;  3S1N B;  3RUZ A;  2K5D A;  2F0E A;  2HDM A;  4XXE A;  3H3V C;  4V19 0;  2L9H A;  4K2L A;  1ESR A;  2HQE A;  1E2V A;  1C8C A;  1DZ1 A;  2L0C A;  1XXG A;  1HUN A;  4E6I A;  5FK9 C;  1SDF A;  4UAI A;  3A8J E;  3TN2 A;  2B2W C;  2A6E D;  2XVS A;  5IGE A;  3KUP A;  1SBB B;  1CHQ D;  1V43 A;  1NR4 A;  2KEE A;  1S5E D;  5M9O A;  1VMC A;  5JEA H;  1CFM A;  1QB5 D;  1G29 1;  2QCP X;  2EYO A;  3PV0 A;  2KHS A;  4ZK9 B;  2AQ2 B;  5C0X G;  3AMU A;  4RCN A;  1HFN A;  3I91 A;  1AW7 A;  1BCP B;  2DNE A;  2BA0 A;  3MWY W;  4RHS A;  1ENA A;  5T1I A;  3OW7 A;  1BO0 A;  1DXM A;  2CHB D;  4H0L C;  4LK1 C;  5IGG A;  2J7Z A;  4F88 A;  2X6L A;  1RDP D;  1H9K A;  4A3F B;  5IT9 L;  5CV5 A;  1I4H A;  4XQQ A;  1K8M A;  1PTO F;  1EY5 A;  3P75 A;  4K2K A;  1WTR A;  2X69 A;  3E5S A;  2DY8 A;  4C3J B;  2DN8 A;  2SDF A;  1B2T A;  2A6H C;  3PUY A;  4U68 A;  1PRT B;  2NB0 A;  3OPO A;  4Y7N B;  2NN6 I;  1BBX C;  3KLS X;  5FO9 B;  4RFB A;  1STG A;  1KLG D;  5I6W A;  2PYK A;  5NUC A;  3HOV B;  1BQQ T;  2XWJ B;  5M3F B;  3SVM A;  3MTS A;  4B08 A;  3GTP B;  2MPM A;  2OF1 A;  4GZY C;  3GTL B;  3VR4 A;  1I6V C;  4NW2 A;  1RTN A;  4IUR A;  1G6Z A;  2RDG A;  2WAQ B;  2F0H A;  4F87 A;  3BDC A;  3V2T A;  1JB3 A;  5JEA G;  1GUO A;  3EA6 A;  2M00 A;  1D5Z C;  1GJX A;  2NTT A;  1GUG A;  4BBR B;  1AEX A;  1B1Z A;  2PZW A;  3I4L A;  1H9M A;  2A68 D;  2F0U A;  2EXZ A;  3ITP A;  2R3Z A;  3K57 A;  1KNE A;  1PTO C;  3NWS A;  3J80 L;  4OIJ A;  3DMU A;  2EVB A;  4ZQ3 A;  4NDX A;  1DOL A;  2B2U C;  4JBW A;  5CGK A;  1PTO H;  2BDN A;  2PW7 A;  2ZXP A;  1VDZ A;  3H94 A;  1JR0 D;  4ZUJ A;  4CKE A;  1Q8I A;  2E75 C;  3L9A X;  2IX3 A;  1GHJ A;  1JWS D;  3IL8 A;  1QIL A;  3TP7 A;  1R4Q B;  2NVQ B;  2PW5 A;  1KDB A;  2WKD A;  4PV1 C;  1PRT F;  2Q8T A;  3K58 A;  5JVH 3;  4A93 B;  3PIP 3;  5JJZ A;  4R9W A;  1EU4 A;  3QOJ A;  2MP1 A;  1ZEQ X;  2ZXO A;  2K6A A;  1XTC D;  2EYH A;  1IYU A;  5K36 H;  1BXT A;  1OXS C;  1V8Q A;  2E76 C;  4XQN A;  1R9T B;  1CTM A;  2RKS A;  5CV4 A;  2K33 A;  4PNY A;  3GTO B;  1XX8 A;  1KDC A;  4IUP A;  5ELD A;  2FHT A;  4CJ0 B;  4R8I A;  3S2H B;  3L7Z C;  4K8I A;  3SK6 A;  3MAQ A;  3HKZ B;  4EQO A;  5FLX L;  4IQZ A;  2L55 A;  3NBH A;  3VYU A;  5COR A;  3K5M A;  1TS2 A;  1WTP A;  1NCV A;  5EGT A;  2BCO A;  2R7Z B;  4KTA A;  2JA8 B;  1B3A A;  2JSO A;  4NMZ A;  1DD2 A;  2BE5 C;  3Q6S A;  1WVL A;  5M5W B;  3NPP A;  5J22 A;  1SE2 A;  2LS0 1;  2MGS A;  1LTB D;  3DHQ A;  1EL0 A;  1NUC A;  5JVG 3;  1L0X B;  1D1K A;  2EDG A;  1SNC A;  1SNP A;  1PRT C;  4DK0 A;  2YU9 B;  1KLU D;  5KRU A;  3R93 A;  3LWE A;  3HP3 A;  3Q24 A;  3D4W A;  1E2W A;  2EJM A;  5EPL A;  4FO2 A;  2D5D A;  2YYZ A;  5BN5 A;  4OO1 H;  2O2L D;  2ENB A;  4G7Z C;  5ISR A;  2WAC A;  1SNM A;  3TBI B;  1I4P A;  2A6H D;  2AUK A;  4J6H A;  3KK7 A;  1EQT A;  5K36 G;  4NP5 A;  2E2I B;  1Y8N B;  3O13 A;  1WCM B;  5CV6 A;  3EVQ A;  1QNK A;  4IUN A;  3SK4 A;  3RLF A;  2A69 D;  5C6A A;  3GTK B;  1D2B A;  3SK8 A;  3M85 A;  1HUM A;  1TWA B;  3OHX C;  3BYT B;  3K5O A;  4K5W A;  2KJX A;  5HGT A;  3N6R A;  3Q23 A;  1TU2 B;  3GV6 A;  3BDO A;  3FRP B;  1CM9 A;  4HCE A;  4RAU C;  2B2Y A;  1AZQ A;  4L63 B;  1JOO A;  2AUJ D;  2E74 C;  4IZ8 A;  4A3B B;  2PNR C;  3QB3 A;  4DNT B;  2F0P A;  5ELC A;  4KD4 A;  3VA5 A;  5ELF A;  5KIX A;  5F2D A;  1JCK B;  3S1Q B;  2OT2 A;  3TP6 A;  2ICE C;  1PZK D;  1LAC A;  4DF7 A;  2R92 B;  1WD1 A;  1BF4 A;  1K83 B;  1Z47 A;  1YNJ C;  2ZXR A;  5EKL A;  4ZRZ A;  2EYJ A;  1OXV A;  2WV6 D;  3BVZ A;  1PTO D;  3V96 A;  1C48 A;  2F0W A;  5DM6 3;  4H7B A;  4A3M B;  5C4H A;  4IAL A;  4IUT A;  3DUZ A;  4KHZ A;  1LT6 D;  3D6W A;  2MJ8 A;  2SNS A;  5C5M A;  3D3R A;  1Y8P B;  5IGF A;  1SJE D;  4OIK A;  3GP7 A;  2XSC A;  3CRL C;  1U4R A;  2PQE A;  3U9S A;  2Q8R E;  2R93 B;  1PDQ A;  2B63 B;  3QO2 A;  4KV6 A;  1LT3 D;  1SNQ A;  1A3V A;  3T13 A;  4CJ2 C;  1QNU A;  5I9O A;  3VYR A;  2LY7 A;  4RKB A;  2QDB A;  3TDQ A;  1GUS A;  3D4R A;  4QF4 A;  2G9H D;  1TS4 A;  2KUM A;  3GV3 A;  1Q1B A;  3PUZ A;  1EIH A;  1TII D;  1X3Q A;  1DYQ A;  1ILQ A;  2QKI C;  3URY A;  1DOM A;  1PXU A;  1PYW D;  3HOU B;  1JC7 A;  1D5X C;  2AWN A;  4A3K B;  1SJH D;  3IAY A;  3ERO A;  2QEJ C;  3FMC A;  3RZD B;  2IT1 A;  4ABN A;  3TP8 A;  2ID0 A;  2L1B A;  4FXD A;  1Z6H A;  2FMM A;  1X3P A;  2K7V A;  4KN4 C;  3W2D A;  3MEH A;  1FGB D;  1HXY D;  3NTH A;  4XT3 B;  2Q8I B;  2IX1 A;  1EQV A;  5C0X H;  2AWO A;  1TWF B;  3NBI A;  4KY6 A;  4RGN A;  5EQ0 A;  1ET9 A;  4FF2 A;  2EYP A;  1U9R A;  4FYD A;  1CHP D;  3PUW A;  1SE3 A;  3DWQ A;  5FOB B;  1M4V A;  1HRJ A;  1D1I A;  2EZV A;  2EJG C;  2EY6 A;  2B2T A;  2B2V A;  5E4X A;  2VNU D;  1LAB A;  3OMC A;  1T5E A;  1VF5 C;  4X3S A;  5J1Z A;  2JA7 B;  3C1F A;  2NZ1 D;  4ZYS A;  1LLR D;  4G4K A;  2I46 A;  2F0S A;  4EGV A;  5I2X A;  3S14 B;  1ZKO A;  5ELE A;  3PO3 B;  5DNF A;  3ND9 A;  2EPB A;  3NWT A;  2J4X A;  3MZ5 A;  3QIA A;  3UI2 A;  4G57 A;  2L12 A;  1X32 A;  1LTI D;  2OXP A;  4OO1 I;  3HOY B;  1ROD A;  1SFO B;  2KCN A;  1STH A;  2M2L A;  1SSO A;  2JEB I;  5J39 A;  5EPJ A;  3I72 A;  3QG1 A;  1EOT A;  4KD3 A;  2K01 A;  4C1N K;  4HR7 B;  2JA5 B;  3Q0A A;  1FNW A;  4F7X A;  3KLR A;  2IJ0 A;  4XDX A;  5JPM C;  3K59 A;  1HTL D;  3H91 A;  2EJF C;  2H1E A;  4QCL A;  1SE4 A;  1F77 A;  1IW7 C;  4X3K A;  4IFD J;  4ZKB B;  4PMB A;  1ENC A;  3NQT A;  5EBC A;  3R2I A;  1O7Y A;  1Y8O B;  4BY1 B;  1TWG B;  3QJY A;  2F3V A;  4PMC A;  5D3D A;  1B44 D;  4I65 A;  5IGB A;  5I6Y A;  4DAY A;  3OIP A;  3U9O A;  1W6J A;  4Z9C B;  4DU9 A;  4HMI A;  1A6X A;  1WD0 A;  3NXW A;  1J8I A;  3D31 A;  1STY A;  1F9S A;  3A54 A;  1BR9 A;  1SEB D;  5KEE A;  3I4M B;  2XIW A;  5IIF A;  3BG3 A;  1I6H B;  4M8A A;  1FR3 A;  1R4P B;  1QCB D;  2EY1 A;  3DWA A;  1HA5 A;  4RGT A;  1EEI D;  3PO2 B;  4OL7 A;  2XN9 C;  4TRD A;  2O5I C;  3NHH A;  4G7H C;  4C3H G;  2L5T A;  3TSS A;  1RKN A;  2F0F A;  2KVM A;  2F0M A;  1WTO A;  1TWC B;  3MFG A;  2Z1C A;  2VB3 X;  5IOC A;  4BA2 I;  5A2Q L;  5LL6 X;  1RF2 D;  2IX0 A;  1NR2 A;  3K5N A;  1BNZ A;  4HSP A;  5IT9 E;  4WJW A;  1MBY A;  4FP5 D;  3VYS A;  3NSW A;  4C3I G;  4BS9 A;  3NTK A;  3FPP A;  4TKO B;  1LV9 A;  1SYF A;  1LO5 D;  3ONA B;  4KJO A;  5FO8 B;  1U4M A;  2CQA A;  4YIJ A;  1BCP F;  1I4X A;  3SEB A;  2F1M A;  3Q22 A;  4XIG S;  1EY0 A;  2RBM A;  3HOW B;  1TY0 A;  1HHV A;  2B2Y C;  2F0O A;  1QWY A;  1QOH A;  5D65 A;  4CGY B;  4ZKC B;  5EKK A;  2DY7 A;  5C0X I;  1B50 A;  4RWS C;  2RQX A;  5FKA C;  1CT1 D;  4H13 C;  4CKB A;  1XWE A;  4BBS B;  3HEJ A;  3T51 B;  1RJT A;  1B9N A;  5C3E B;  2LMC B;  1I50 B;  2LKV A;  2KQ3 A;  2F0V A;  3OIQ A;  2BDO A;  1M8A A;  1IL8 A;  3VR5 A;  1O7L A;  3J80 E;  4ZUI A;  1PMR A;  1EYA A;  2EYM A;  1H9R A;  3H6M A;  3RD4 A;  5CV7 A;  4HN7 A;  3SHL A;  3TME A;  2C9O A;  2QF7 A;  5I9P A;  4IUQ A;  4KY5 A;  3BVM A;  4KK7 A;  1BCP C;  4TSS A;  3S1R B;  2MUY A;  1VMP A;  2Z8L A;  1U4L A;  3J81 L;  1FNU A;  3KBX A;  1XYI A;  5KGU A;  4MN3 A;  2XNA C;  4A3J B;  4FXK C;  3HG9 A;  3FKI B;  3CHB D;  4OHJ A;  3VR6 A;  1TKW B;  2F0N A;  4K5V A;  3S16 B;  1IW7 D;  1GUT A;  5CV9 A;  1SYG A;  4X3T A;  3DEP A;  5C3W A;  3I90 A;  2Z4H A;  2BA1 A;  4RA8 A;  2B39 A;  1G91 A;  3I8Z A;  5CR3 A;  1AFP A;  1Q90 A;  2D62 A;  1CA6 A;  1U4P A;  1GUN A;  1KAA A;  1BOS A;  4M1U B;  1FNV A;  3BS1 A;  1O78 A;  4DGZ A;  3I4N B;  5FLX E;  3NK9 A;  1Q12 A;  2B2T C;  1ILP A;  2B2V C;  3M3Y B;  2F0I A;  3H09 A;  4Q0F A;  3LNN A;  4C1N I;  5E1F A;  1ONL A;  1HCZ A;  2EY2 A;  4DFA A;  1FD7 D;  3KLS A;  1L0Y B;  4RGM A;  4C3H B;  2TMP A;  3PMF A;  4O42 A;  2RSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...