4U68A

Crystal structure of rhino chromodomain in complex with h3k9me3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
EYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRLHRKAAAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhino
publication title Structural insights into Rhino-mediated germline piRNA cluster formation
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein binding
total genus 18
structure length 64
sequence length 64
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4u68A00
2NYZD 3I8ZA 5E4WC 4IUVA 1RTNA 3Q6SA 3FPUB 2MGSA 2B2UA 2K03A 1PFMA 1RJTA 1AZPA 2KOLA 3LWEA 1HA6A 1MSGA 4OIKA 1PFNA 2MJ8A 1EL0A 2B2VA 1MGSA 4MN3A 1BNZA 1IKMA 1HUNA 1CM9A 3P7JA 2J7ZA 3I3CA 4X3UA 4IURA 2L12A 1E0BA 1XX8A 2N55A 1U4PA 1JICA 5E4XA 1X32A 4HCSA 1X3PA 4O42A 4U68A 1G2SA 3DM1A 1F9QA 1QNKA 3MTSA 4X3SA 2M2LA 3KUPA 1HUMA 4DN4M 1DONA 1BF4A 2D9UA 1ILQA 1SSOA 4IUPA 2FINB 1PDQA 2Q8TA 4QUFA 1WTRA 1U4MA 1G6ZA 2FFKB 1J8IA 2FMMA 3G7LA 5D14A 1GUWA 2L9HA 2EE1A 5CBAE 4RWSC 4R9WA 1WTVA 3D6WA 1CA6A 1O7ZA 1WTXA 1DZ1A 2DY8A 2CVRA 1PLFA 1C8CA 5D65A 4IUTA 1U4LA 4XT1B 2HCIA 1G2TA 2K28A 5JJZA 1LV9A 1HHVA 3H91A 1HFGA 5CORA 2MP1A 3KBXA 1DOMA 1RODA 2XIWA 1PFBA 3TZDA 4UAIA 2Q8RE 5DNFA 3GV6A 2HUGA 5T1IA 2B2YC 1QG7A 1IL8A 1U4RA 1F9SA 2K01A 1ICWA 1F9PA 1NCVA 1SAPA 1B3AA 3F2UA 2N88A 2RA4A 5AFWA 5EQ0A 2IL8A 4ZKBB 4IUQA 1ESRA 5CBEE 1MSHA 2K1BA 2RSNA 5EPJA 2KECA 4CJ1B 1JE4A 1NR2A 3DEPA 2KEDA 4X3TA 3R93A 1S4ZA 1RTOA 3UI2A 4R8IA 1ILPA 4ZK9B 1O80A 4HAEA 4LMQD 2HDLA 2X6GA 3QO2A 2B2TC 2X6LA 2MPMA 5EPKA 2L4NA 2HDMA 2NWGA 1MI2A 1NR4A 4ZLTF 2EOTA 3FDTA 1B53A 4ZKCB 1WTPA 1AZQA 1SDFA 2HCCA 1F2LA 1QE6A 2VXWA 1CA5A 2BDNA 1A15A 4OIJA 1B2TA 3IFDA 1BBXC 4CJ0B 2R3ZA 4IUUA 1WTOA 4QUCA 1IKLA 4RAUC 1EIGA 1ZXTA 1O7YA 1Q3LA 2KVMA 2X69A 5CMDA 2KEEA 2B2UC 2FHTA 2RVLA 4X3KA 1AP0A 5EPLA 4ZAIA 1VMPA 1G91A 1ML0D 4XT3B 1J9OA 1WD1A 2FJ2A 1EQTA 1DOLA 2B2VC 5T1GA 3DEOA 2B2YA 1TVXA 2EPBA 2JP1A 1X3QA 1WD0A 2JYOA 1HFNA 5EKIA 3TN2A 2SDFA 3SVMA 2L11A 4HEDA 2NZ1D 1BO0A 1DOKA 1F9RA 1NAPA 2DY7A 3N52A 1B4OA 1WVLA 3I90A 2K04A 3HP3A 5EJWA 2B2WC 1HRJA 2H1EA 4MHEA 4CJ2C 1XYIA 1M8AA 1VMCA 1KNAA 1WTWA 1WTQA 2B2TA 3GV3A 2KUMA 5COYA 3IL8A 4NW2A 2B2WA 3I91A 2RSOA 3MWYW 1RHPA 2K05A 4XDXA 1EIHA 2L1BA 4RA8A 4HSVA 3ONAB 1B50A 1EOTA 1KNEA
chains in the Genus database with same CATH superfamily
2XWJB 5IGFA 4YHHL 1W3SA 4FXDA 5IGEA 1PFMA 1ET6A 4DV4L 3HOUG 2KOLA 3LWEA 3NENA 4R4IA 4R4CA 5GAEC 1QZHA 4JBWA 4A93B 4CBVA 2F0QA 4DV0L 1I4HA 1EU4A 1HUNA 4HN7A 2EY5A 3SK6A 3STBC 2EJFC 4B08A 4N8FA 1Q8IA 5DM73 4HSPA 2K5DA 4DXFA 2ZXPA 4K5VA 3MHBA 1DONA 1K83H 4KKSA 3HOVB 2VUMB 1BBWA 5D14A 4JI5L 1EFWA 1TWAB 1N33Q 2EDGA 2Y0SE 2DY8A 1AE2A 2F0PA 4IFDJ 1JCKB 1N34L 5GQOA 3ZYYX 1H9MA 1I50H 5AJ3L 3PUYA 2R7ZH 4IUQA 2K1BA 4CDFC 3J81j 4CJ1B 4JV5Q 2KEDA 1X65A 3DM3A 1RTOA 3CPFA 3J81i 3DUZA 1C9OA 1NSNS 1BBUA 5EBDA 5C0XG 2K7VA 4P73A 3GTKH 4DV2L 2IWHA 2NVYB 1CUKA 4JPBW 4P74A 4YIJA 2BDNA 3KLRA 1Y1VB 5DEHA 3WWVA 2YU9B 2SNSA 3LNNA 4B3ML 1BCPB 4OWXB 1Q81C 3HOWH 3WOEA 1C0AA 1QCBD 2ICEC 3TQYA 4H7BA 5JEAJ 5FJ8H 1VF5C 3GTPB 1A63A 1H9JA 1X3QA 4B3SQ 3FVQA 3H6MA 1YNND 5IT9E 4HEDA 3CC2A 1XJVA 3M4OB 2K04A 3J7YW 3CP0A 1VQ5A 3M4YA 3DWPA 3OTOQ 1NTGA 3A55A 1SNCA 4EQNA 5IODA 3WDNA 4RA8A 1K28A 2WKDA 1PTOH 1S72A 2E2JH 3I4NH 2WAQE 4IPCA 1V1PB 5C3WA 4Q0FA 1RJTA 1PZKD 2NVQB 1TWFH 2RDFA 3GO5A 5KGUA 4B9WA 1S5ED 3AMUA 2XNAC 3ZJYC 3SK8A 1L0YB 4O42A 2CCZA 3KDFB 2KHJA 3H3VC 5IYBG 2K52A 2JXMB 5IY0A 4K0KQ 4IUPA 1VQDA 4RGNA 1VQNA 2I46A 4WRDA 4B3RL 1CTMA 1I6VC 1WYDA 3Q8DA 1B7YB 1U4LA 4I65A 5IWAL 2WAQB 1YJNA 1MD2D 3E0EA 1WFQA 4G7ZC 1KL9A 1TR5A 4DAPA 1XMOQ 3I72A 3OWEB 1TWHH 2PI2A 4NMZA 2EQSA 4GN3B 1Y69U 4PZ6A 1ICWA 2NN6H 2RA4A 5AFWA 4ZKBB 3HOZB 1HR0L 1IW7C 4UPAA 1R4PB 5FLMH 4JI7L 1EYGA 3CCQA 1ENCA 3W3AA 2LSSA 1Z47A 5LMNW 2GVAA 3KJPA 4ME5A 1ILPA 4KD4A 2L4NA 1DD2A 3FDTA 5C6AA 1VQLA 2E5LQ 1LTAD 1TY0A 1A15A 1B2TA 5C44B 1UE7A 4A3EG 1ASYA 1II3A 3E9IA 4GS3A 1G291 1YEZA 5JOBA 5IP7G 4ZUIA 1WD1A 2L0CA 1FYCA 1LT3D 2D0PA 3Q0AA 1HZCA 2BA0A 4C1NI 4X6AH 1EU3A 3H0GB 3OHXC 1WD0A 2JYOA 3SK4A 2B8FA 1NMFA 2SDFA 1H9RA 1X3FA 1YNJC 3IKJA 1JJCB 5D3DA 5LMNQ 1KHIA 3NUCA 5ELFA 1N36Q 4DR2Q 2EYFA 3VR5A 3GP7A 3M4PA 3CPWA 2V1CC 1PH2A 1L1OC 1IBKL 1VQ9A 4J1MA 1WCMB 4A93G 2D5DA 2NUCA 1EY9A 4F8MA 2EY1A 1S5BD 2H4OA 4OELB 1RKNA 3NQTA 1Q1EA 3I8ZA 2LXJA 1XXGA 2YTXA 4JOIA 2B2UA 1SE3A 1VCIA 4A3GG 1HA6A 3M4QA 3GTOH 2TSSA 5I2YA 3W1GA 2LKVA 3F1ZA 2BOSA 2GVBA 4X65L 4KTAA 2K5VA 1JB3A 3RNUA 4LFAQ 3AQQA 1HQRD 4OWTB 1GOZA 4QCLA 1K0RA 4DN4M 4GKJQ 1HNZQ 5CV5A 1GM5A 1LT5D 1GUWA 2L9HA 2EE1A 3MFGA 4A3BH 4DR3Q 4A3JB 4RWSC 3UE1A 1XNQQ 2NN6I 2R92H 2EVBA 4RHRA 3X3MA 2K28A 1ICFB 2Q2HA 2JE6I 1VQOA 1KQSA 1BCPD 4J15A 1EQQA 4FDBA 4C3JB 1K0SA 3S2HB 4N9TA 4DF7A 3HOYH 4DR1Q 3T1HQ 1B3AA 4JYAL 3K5OA 3E9HA 1DGSA 1ESRA 1SJHD 3F8TA 1YHAA 1L2FA 2F0MA 2Y0SG 4R8IA 4I7AA 4LF4L 2B2TC 4HMJA 2KCTA 5FKAC 4LJZC 2VB3X 2BA1A 1LLRD 2JA8H 4IN3A 2A6EC 4C2MH 4A3MB 1ASZA 1FJGQ 4RAUC 2Q2TA 4LFBL 2E2DC 1PH6A 4U673 1G91A 1XPRA 4HCEA 2O2LD 5T1GA 1NBWA 2F0HA 2JSOA 4IALA 3K7UC 2IHFA 5HURA 1NAPA 4KY5A 1DYQA 2ZJRA 3GTGB 2QW7A 3S17H 1WVLA 4HR7B 4OONA 1HRJA 2D62A 3RN2A 1IXRA 4FVMA 3GTQB 2D0OA 3A8JE 4CGYB 1Q8KA 1NJIC 1PRTC 1H9SA 3MXGA 4A93H 4K14A 2CQOA 2KCMA 1EIHA 1IBML 2IY5B 4GN5A 3TZUA 1B50A 4AQYL 1EOTA 1JT8A 1TY2A 4R1JA 3T56B 4APVA 4DPGA 3FPUB 2PZTA 3IAYA 3AB9A 3K7AB 4QB4A 4YWKA 4DV3L 1WOCA 1I94L 1ZYRC 3EFXD 4P72A 3RD4A 4OHJA 1QB5D 1E2VA 1Y14B 1STYA 2F0EA 1IBLL 5C0XJ 2VUMH 3HOVH 3BG3A 4LUOA 4LF6Q 4U68A 1TWAH 5M5YH 4C3HB 1KRSA 3LX0A 3T13A 3T53B 5E7NA 3PIP3 4FP5D 4BXXG 1GKHA 5FOBB 4GNXB 1STGA 2WAQG 4IOCA 4DFAA 3R2IA 1G6ZA 2FFKB 1SMYC 5NUCA 4M1UB 1V1QA 2A68C 1PA6A 3J7AV 3A5UA 1GHKA 3D6WA 1CA6A 3TS2A 5CV9A 2UUBL 3HOXG 3T1YQ 3J80E 2VQFQ 4X66L 3DLLA 4ZRZA 2Z6KC 1J5EL 4A3FG 2N3SA 4LK1C 4C3IG 4GLAC 1A3VA 2EY6A 4L6TB 3FPPA 3TMEA 1D1KA 4NXMQ 2JA6G 3OIPA 4DUYQ 5M3MB 2PMZB 1NCVA 4C1NK 1EEID 4DV6Q 5GADC 2UU9Q 2RSNA 4BY1B 2NVYH 2KECA 4A75A 1VQHA 4GLVB 1SYFA 2PZUA 1Y1VH 1CKNB 5KNCA 2YU9H 3PV0A 4A3IB 5FLXE 1TWGH 4QQBX 2K5WA 1SNDA 4G4KA 1F2LA 1QE6A 3H0GG 2F4VL 1JOQA 2WB1E 3GTPH 1BBXC 4DR5Q 3JAMc 4BA2I 2KVMA 5CMDA 2KEEA 4X3KA 3TP7A 1KAAA 1C4QA 4HTHA 2OQ0A 3M4OH 2PI2E 4B3TQ 3MEHA 5E1FA 3KF8B 4NPSA 2UXBL 5IGBA 4YCUA 3J81L 3MZ5A 2UUAQ 1B4OA 2PW5A 4LF8L 1OXTA 1X9NA 1XYIA 3WOFA 4RKBA 1EWIA 4JI0L 3TSSA 2RSOA 4PQXA 1FVIA 2NVQH 4EQPA 3L3OC 3VR2A 4XXEA 2K75A 2F0DA 2SOBA 5M5WB 1SJED 1HNXL 2OEOA 3KF6B 2M9VA 4JI3L 3W1BA 2WIIB 1BCPF 1S5DD 3SGIA 1IYVA 3SXHA 1D8LA 1M1KC 4Z9CB 2B2VA 1M4VA 3P7JA 5EKKA 2UXCL 3U58A 4QMGA 1Q7YC 3GTLB 1CHQD 3H3VI 2VQEL 5BR8Q 5CYUA 3DM1A 1F9QA 4H44C 2E2IB 5C5MA 2WACA 4RCNA 5K36H 4NB3A 2KCCA 4BXXH 1FNVA 3G71A 3K5MA 2Q2UA 4XQJA 4O0AA 4ODGA 1I4QA 1FNWA 1KTKA 5A35A 3NP8A 1PMRA 3HOZH 2WINB 2ZTDA 2K33A 1D5XC 2BE5C 5DNFA 1XNRL 2IHEA 1VQKA 1IL8A 3M85A 2N88A 4LFCL 3H94A 4JI8Q 3K0YA 1PYBA 1XPOA 5C44H 3CF5A 1EY8A 2AUKA 4ZK9B 1O80A 2NB0A 1EQRA 2AMCB 5DLQE 3AU7A 1STAA 3NXWA 4KK7A 2DNEA 4NXNQ 3FP9A 3QOLA 2C5CA 1WTHA 1VDZA 1Y8NB 1Q90A 4YY3L 4A3KB 2L15A 3CCLA 1AP0A 5LHY1 2R7ZG 1K8MA 4OXPA 3NEMA 1SXTA 2R93B 3ERQA 2E2HB 5CV4A 2QCPX 1UE6A 1U5KA 3EN2A 4ID6A 5EKIA 1WCMH 1F2ZA 4RH6A 4DK1A 2HIXA 2K14A 1SE4A 4FF2A 4DK3C 2N8NA 1QJOA 2CWPA 3I90A 2B2WC 3VYUA 1BKBA 4J8QA 1WTQA 4IOAA 3TP6A 2QDBA 3GV3A 1IYUA 2F0NA 3BVGA 4KLKA 3I56A 4QIWE 3MWYW 4IZ8A 1SYGA 1CQFA 3CAMA 3CMEA 3FMCA 2EY2A 1I4XA 2JA7B 4A4IA 5IT9c 1SYCA 2F0GA 5FJ8G 2XWBB 4WJ4A 3HEJA 4JI1L 5JPNC 1PTOD 3A56A 2K03A 2OTJA 4C3HG 1NE3A 1EZ8A 4FO2A 1PH5A 2CW0D 2J0TD 4POFA 2EYOA 2NVTB 3NSWA 1I4GA 1G2SA 4RGMA 4A3JH 1STNA 4GKKL 2KENA 2PW7A 1P8LA 1SSOA 3K58A 4PMBA 3J7ZC 5JJIA 2HHHQ 1FGBD 3KBGA 3MXPA 4QIWB 4C3JH 5M3MG 3X3NA 5I6WA 3S2HH 3D0FA 2F0IA 5I6YA 2NTTA 3GD7A 1HHVA 3QJYA 1YNNC 2F0OA 4EGVA 2I07B 5IGDA 1EYDA 1PXUA 3A5ZB 3VYTA 2Q8RE 2M00A 5IOCA 2VW9A 5J1ZA 3F2UA 3O13A 4CKEA 5EGTA 4DK6C 2KBNA 2XVSA 1FL0A 2LS01 4O1NA 1KLUD 2PCFB 4A3MH 5M5YB 1O7LA 3QR8A 1BQQT 2OQKA 2K50A 3S16B 5ELBA 3V2TA 1W2BA 4AIMA 4DR7L 1T5XD 2N49A 2RKSA 4EVOA 5BN3A 3SDZA 2VXWA 2JQOA 5KRUA 1RIPA 2OXPA 2TMPA 4B9XA 4IUUA 3A74A 4LUVA 2YTVA 4MTNA 1N32Q 2NN6G 2R7DA 4JOIC 2B2UC 1LT4D 2A69D 4JI2L 2UXDQ 3MFYA 3GTGH 1UUPA 3BZKA 3NBIA 2ZM6Q 5FO8B 5FLMG 4GNXA 3U50C 3GTQH 1SR3A 3D4RA 2F1MA 3PQIA 4K2LA 1E2ZA 2IW3A 1EFID 4PNYA 1FNUA 3LGJA 2P5ZX 4ME3A 2IJ0A 2WB1G 4FXKC 1SE2A 3PIPA 2QILA 4YHHQ 5ELOA 3CHBD 5I9OA 3K7AH 4DV4Q 3KK7A 3S14B 1F2MA 1Z6HA 2YV5A 1EIYB 4J6HA 1ZKOA 1TWGB 3ONAB 4DV0Q 4RGTA 2B29A 3UDIA 1FD7D 1XTDA 2A6HD 4C3HH 1YJWA 4K0KL 1MHWC 1RDPD 4HMIA 1BNZA 2C9OA 4GLXA 1CKNA 5JJKA 3TEHB 3R3OA 4JI5Q 1LTSD 3OOCA 1VQ6A 4FF1A 2M2LA 1HUMA 5C4JB 3I2ZA 5KNBA 3L7ZC 3L0OA 4V0BA 3V05A 3RR5A 5GAGC 1JWSD 4FYDA 5CBAE 4K5XA 1N34Q 1AEXA 2NZOA 1V43A 1LM0A 4HJAA 4KJNA 4IUTA 5M3MH 3KF8A 1LTTD 2L55A 4A76A 1HFGA 1L1OB 4BY1H 1K3BC 3S1QB 5K5PA 3CQZB 4KD3A 3U4ZA 4L5RC 5DAUA 1SYEA 1TS5A 2CQAA 4A3IH 4ILWA 3A7LA 4MZ9A 2G9DA 1Q86C 4WORA 1SBBB 1UEBA 4A3BG 4TQUS 3OIQA 3RLFA 4DNTB 2QA4A 2SNMA 1EYAA 4A3KG 2JEBI 1A2UA 3KF6A 2XSCA 4LMQD 4DAMA 2R92G 1UNSA 4IUNA 3U9SA 3E3XA 1JWMD 2Q8IB 1WTPA 3MVVA 1HTLD 1PTOF 4K5WA 3JAML 1YHBA 5LMNL 3BU2A 3FEWX 1GUOA 2JA5B 1N36L 3HOYG 3SEBA 1HA5A 5IYDH 1D7QA 3ITPA 1SFOB 2UUCL 1RL2A 1RCVD 3UDFA 2Z4IA 2H5XA 4LW1A 1B44D 1JB7A 1PH8A 2EYPA 3E0JA 4BS9A 4L5TA 4GOPB 1N8RC 2EJMA 5M5WH 3BS1A 1FGUA 2D2CC 5EJWA 4DAYA 4EQ5A 2JA8G 1AW7A 5KYIA 3EQLC 3IL8A 3MXUA 3OWFA 4KI0A 4RG1A 4XDXA 4G7HC 1K8OA 3TREA 4LFAL 2A5HA 2NYZD 2PQAB 4KMUC 1STEA 3A54A 3NELA 4BBRB 3CRKC 3GTLH 3CCMA 3DWQA 1VQIA 3OMGA 2MJ8A 2ZXOA 1QUQB 2R7FA 2E2IH 1IKMA 1PHJA 3TS0A 1HR0W 1XX8A 1CKMA 4DNIA 1CSQA 1HPCA 5IGCA 4L8JA 4DR3L 3HKZB 1U4PA 3NBHB 3P75A 3D4WA 2JJQA 2KHIA 2F0JA 4E6IA 2FINB 4HJ8A 1XMQL 4HIKA 2ZTEA 1TIID 3C46A 4DR1L 4GN4B 2RHSB 3T51B 1EY0A 5CV7A 1L0XB 3J81E 2VUMG 3HOVG 1YI2A 1HR0Q 1UWVA 1PRTB 1K8GA 2E74C 2EYHA 1A8VA 4LF9L 1TWCB 2B63B 3S1RB 3OMCA 4R4TA 5LMUL 5FO7B 3J80c 3K59A 1P16A 1GUTA 4A3KH 1KC8C 4A3DB 1D1IA 3DWAA 5I2XA 2HCCA 1CA5A 1OTCA 2R93H 2E8GA 2E2HH 1IW7D 4OWWB 1QVGA 1Q3LA 2BH2A 2EZVA 4JG2A 1VQAA 1AE3A 4XT3B 3BZDB 2A73B 2B39A 1MBYA 4KY7A 2B2VC 5FLXc 2VNUD 1Y1VG 1IBKQ 1TXYA 4CDEC 4JCVE 3CC7A 3BVMA 3FRPB 3TP5A 4JVZA 1G51A 4WFN3 2MFIA 4DV1L 2JA7H 1CSPA 1CQVA 4LF5Q 1OXXK 1STBA 5JAVA 1XWEA 2DGYA 3CCVA 1I6HB 2AHOB 2EXDA 1EY4A 3EIVA 2L1BA 4IO9A 2Z4HA 3NPPA 3SHLA 5IT9L 2ALYB 1ONLA 3W2DA 1JJ2A 4LF6L 2NVTH 3PO3B 3J7AF 1A3TA 4ZQ3A 3VYRA 1MSGA 4RGOS 1QILA 1C48A 3W5OA 2OCEA 1MGSA 3A8IE 3GQBA 4MN3A 3K5NA 4X62Q 4X3UA 4KKTA 1VQPA 1LTLA 3T16A 4AYBB 1Y1WB 1EYCA 3K0XA 1Y8PB 2F0VA 2VQFL 4RMFA 1V9PA 1ILQA 2Q8TA 2F0FA 2NBFA 1U4MA 2WFWA 1J8IA 3PCOB 5CR3A 1XPUA 1HQMC 1WTVA 2PZWA 3M3YB 1QVFA 2K32A 1SEBD 1X54A 4AH6A 4I7ZC 2AKWB 5M3FB 1SE8A 2MO1A 1BXTA 2PMZE 4C56C 5C3EB 4JYAQ 4JI4Q 1QVCA 2BCOA 4UAIA 2PYKA 3CCEA 4X64Q 4LF4Q 1TQOA 5A2QE 5K36G 3A8KE 4LNQA 3S16H 3HGBA 5DM63 1JC7A 2IL8A 1MSHA 4BY7B 1GXDC 4XIGS 5H1SE 2K6AA 1BUVT 4X3TA 1AH9A 2I5MX 1H9KA 5IGGA 4R4QA 1I4PA 3H3VH 3PIO3 4LFBQ 4P75A 1SDFA 3HOZG 3JAMi 1B9MA 1ZXTA 5C4XB 2J4XA 3ND8A 2FHTA 4UP9A 1D5MC 4S3SA 1PH9A 3E5SA 2EYLA 5CV8A 5KNDA 1LTRD 1U0LA 2B2YA 2PNRC 4BA1I 5C44G 4R8NA 1SN8A 1EEFD 1LUZA 3HZXA 1BO0A 3FKIB 1DJRD 1DOKA 1V1PA 2A6ED 5D3IB 3S14H 1RF2D 4QY7A 1IBMQ 4AQYQ 1E2WA 1HTPA 2KA7A 4LAAA 2F0UA 4IQZA 3HOUB 3CC4A 3K5LA 2BDOA 1HZAA 3Q22A 4GZYC 2VY3A 4H13C 1I94Q 1PVOA 1GJXA 4HSVA 1PZID 4K2KA 4RHSA 3VA7A 3KDFA 1B1ZA 1BVSA 2XRSD 1NNXA 2MGSA 1IBLQ 1WCMG 3QIAA 1AZPA 3KLSX 4CKCA 2F52A 2EYJA 4OX9L 1PRTD 3F2BA 3IFTA 5C4JH 3I55A 4DGZA 1A2TA 2L12A 2JN4A 2CH4W 1GO3E 3GTJB 4HCSA 4A3CH 4JW0A 2F0TA 4JI6L 1G8ZD 1BF4A 2QF7A 3NWTA 3BDOA 4DXGA 3G6EA 3AFQA 1ZYRD 4X66Q 1J5EQ 3G7LA 3S1QH 1R4QB 3KLSA 2E75C 3CQZH 2CVRA 1Z7TA 3L9AX 2RDGA 2ZTCA 1KDBA 3VR3A 4GOPA 5J39A 1PFBA 4A3JG 3RMHA 2AUJD 1YVCA 1T5EA 2A68D 3PSIA 5TSSA 3D4DA 4A3DG 1A3UA 5L37A 4G57A 3S1NH 3C3LA 5EQ0A 4YCWA 2A74C 2F4VQ 2B8GA 4C3JG 2Q2IA 4DV5L 4IFDH 2JA5H 4XQNA 2PPBC 5IYCH 4DR4Q 1PTOC 4IPDA 4DUZQ 1NR4A 3A7AB 4K8JA 1GUGA 4H0LC 1SFOH 1QUQA 4CJ0B 3G48A 4OO1H 3FHWA 1S5FD 4KHPL 2UXBQ 3OSOA 1EIGA 1YBYA 4ZUJA 5EPLA 2ZJQA 3ICEA 3NBHA 4LF7Q 4LF8Q 2EPBA 4A3MG 4JI0Q 3KYHC 1XTCD 1MKHA 4DV7L 3SVMA 4P71A 3L2PA 1HNWL 1D5ZC 3M7NA 2DY7A 5C4HA 2H1EA 3ULJA 1WTWA 1E22A 4JI3Q 5COYA 4BBRH 1ET9A 3AYHB 1JJGA 2QGQA 5ELCA 2CWAA 2NZHA 5JEAH 3MEFA 3GTMB 1TS2A 2G9HD 4HIDA 2LMCB 1FR3A 2YTYA 2MQHA 4IUVA 1Y1WG 2CH4A 1JORA 2NTSA 1O78A 1BR9A 2VQEQ 3PF4A 1LABA 1I5FA 1KDAA 3BDCA 4JK1C 3HFZB 4L63B 4TSSA 1SNPA 4IJHA 4UHVA 1X32A 1SROA 1X3PA 1VQBA 2ZXRA 5M3FG 1PH7A 5C3EG 1K73C 2VS1A 3R2TA 4ULLA 2CKZB 3C2PA 2XN9C 1OXVA 1UE1A 4H02A 1DZ1A 1VQCA 4Q5VA 1PLFA 3S24A 5BN5A 5E3FA 1LV9A 1MIUA 2OWOA 3PF5A 4BY7G 1VQFA 1K8AC 1TWCH 1VQJA 1OXSC 2MP1A 2B63H 3KBXA 1DOMA 4IFDI 2VZAA 4WJWA 2MUYA 3I4OA 3S1RH 3G4SA 1N33L 2Z6KA 3I70A 1LTID 1U4RA 5JVG3 3P1HA 3ULLA 3HG9A 4PV1C 3S9WA 1PV4A 3KFUA 4A3DH 1IHZA 5EPJA 4CDCC 3CU7A 4OO1I 3J80L 1JE4A 4DR6Q 1N32L 3MA2B 2E76C 1S4ZA 3UI2A 1EZ6A 3E6ZX 4A3EB 5GAHC 3MXNB 2HDLA 4YY3Q 1YJ9A 4K6LA 3EA6A 1E7ZA 2X6LA 1JQYD 4ZCKA 1IZ6A 5ELEA 2BE5D 2ICIA 4BY1G 3QG1A 1N9WA 2IX0A 4JV5L 2A6HC 2SEBD 1B8AA 4DAVA 4DA2A 2EIFA 2I0QA 2R3ZA 3FKIG 4A3IG 1QWYA 4L5SA 2K5NA 4ZAIA 1PRTF 1UE5A 1R9TB 1EQTA 1SYBA 3CD6A 5FLXL 3DEOA 2JP1A 3OPOA 1K3RA 2JA9A 3BVZA 2IX1A 1I6HH 3DXJC 5LL6X 4UDUC 4RFBA 1X55A 3VR6A 2FXQA 1H95A 1LT6D 4YCVA 4MNOA 4B3SL 4JI1Q 5IP9H 3PO3H 4A3GB 4NW2A 2NVXB 5IYDG 1DCZA 2F0LA 3MAQA 5M9OA 2KJXA 5CC4A 1KNEA 1GVPA 5E4WC 3SE0A 3OTOL 1E3PA 4FF3A 1Y1WH 2RBMA 3PO2B 3BZCA 2AWNA 4OIKA 1PFNA 4BBSH 1X3EA 2WV6D 3RZDB 3UDXA 4GKKQ 1H9SB 1CM9A 2J7ZA 3S2DB 1JMCA 3VYSA 2R6GA 2N55A 3D6CA 3RZOB 2MHVA 4IJLA 4KY6A 3M3YH 1QOHA 5M3FH 5C3EH 3PIOA 2Z9HA 1GHJA 4R9WA 4OL7A 4F88A 4A3LG 5IE8A 4Y52H 2F4IA 1VQ7A 4CDDC 3JC66 5FO9B 4Y7NH 3M7GA 1S3OA 2F03A 1V1OA 4BY7H 4L5QA 2XIWA 2Y0SB 2AQ1B 2Z1CA 2DJFC 5CGKA 5T1IA 1HCZA 1QG7A 2ID0A 2K01A 1F9PA 1EIFA 2GN5A 5EBCA 4QL5A 3KOJA 4LWCA 5IIFA 4DR7Q 4MTKA 2F3WA 1XMOL 2V4DA 2ES2A 4QJFA 3STBD 3J81c 1VQ8A 1KABA 3BJUA 5C4XH 4KHVA 4JI2Q 4ZLTF 1B53A 2A8VA 1YIJA 5AJ3Q 4XTCS 1L0WA 1EUJA 2RF4A 3FKIH 2QDLA 4ALPA 1VMPA 1KRTA 1ENFA 4NKLA 4PZ7A 4DV2Q 2E5LL 4M8AA 2L5TA 1HZBA 1VQ4A 1D6EC 3HOUH 2L11A 2HT1A 4YWLA 1CZWA 3N52A 1GUSA 3S1NB 4B3MQ 2R93G 5EKLA 1M8AA 1KNAA 2HIVA 1CT1D 1AFPA 1E1OA 2B2WA 3NWSA 2K05A 3EJIA 1KLGD 3KJOA 4DR2L 2LFNA 5G3LD 3HP3A 3CRLC 4K8IA 1V8QA 2K5QA 3H15A 1X56A 2K5HA 2AQ3B 1CFMA 3HKZE 3GTJH 3NTKA 3AEVA 1CZGA 2XTIA 1PH1A 3BDLA 2JK8A 3S15B 1WJJA 2JA7G 3PUZA 4TRDA 3RLOA 3CMAA 4IURA 1K9MC 1OO9B 4N9PA 1CI3M 5JPMC 1Z9FA 5KEEA 3KUPA 3HOXB 1UAPA 1VQEA 1BCPC 2D9UA 2HQLA 1PYSB 1PDQA 1AN8A 4A3FB 3EBEA 4ZYSA 2G5DA 4C3IB 5KIXA 2JA6B 1O7ZA 4GKJL 2EJGC 1HNZL 4A3LH 1G6PA 1HH2P 2ATWA 5C0XH 3VDYA 1IYJB 4XT1B 1G2TA 3C1FA 5CORA 3CXCA 1M90C 5ELDA 1XNQL 4B3RQ 3GV6A 2HUGA 2B2YC 4DKAC 2WKCA 1HJPA 2OF1A 5CBEE 5C3XA 3BYYB 3TDQA 5IWAQ 1JR0D 1NR2A 3J80i 5LL6S 4JC0A 1TT2A 1Q82C 3T4AC 2X6GA 3QO2A 3T1HL 5EPKA 1MI2A 2EOTA 2UUCQ 3I4MB 1A0IA 1X3GA 1IKLA 1O7YA 4JI7Q 2X69A 2RVLA 4LF5L 4HJ7A 4EX5A 3CCJA 1DOLA 1TVXA 1FJGL 1Q1BA 1HFNA 1A6XA 4IPGA 3U9OA 1Y8OB 5GROA 1SYDA 1VS0A 1S5CD 2QEXA 3GTMH 3AFPA 3DHQA 4P2CB 1I4RA 3BYTB 3K6OA 2O4XA 3PO2G 1I3QB 3NTIA 5M5XB 4HJ5A 1TKWB 1RHPA 1YITA 3SK5A 4X62L 3ULPA 2AQ2B 5IYBH 4R4OA 1B70B 4FXGC 3Q6SA 3S1MB 2I5HA 4AYBE 5CV6A 4NDXA 4GOPC 2OTLA 2F3IA 1DXMA 3F2DA 2F0KA 3GDEA 3MXNA 1JOKA 2I5LX 4RKLA 4CHTB 2KQ3A 1XMQQ 1HZ9A 3D8GA 3DMUA 2KHSA 2IX3A 2WP8J 4DNRB 4HIOA 1IL2A 5C0XI 3MTSA 4WJ3M 2O5JC 1E1TA 3QOJA 4O2DA 2RHQB 4ABNA 4XQQA 4JI4L 1WTRA 1YNJD 3HRZC 4K6DA 1MJEA 1EOVA 1EWHA 1W6JA 2XRQD 5F2DA 4X65Q 1LTBD 4X64L 4UP7A 5KYLA 1K83B 3C1EA 1SNQA 4LUZA 4IPHA 1SRUA 1C8CA 3PGZA 3TRZA 2HCIA 3PMFA 4YWMA 1WI5A 1W6KA 4LF9Q 3EROA 1RODA 4A3CG 4UP8A 1NUCA 5LMUQ 1YNXA 1EY5A 4BBSB 4A3EH 3T1YL 2MO0A 1F9SA 3M9BA 5IP7H 1F2YA 2ZT9C 3UDGA 2VB2X 3H09A 5JVH3 1BOSA 3VR4A 4NXML 4DUYL 4HAEA 3ERSX 3D31A 1I50B 4DV6L 2NWGA 2R7ZB 2UU9L 2RQXA 2IPKD 5G3LF 1R9TH 3F2CA 2LY7A 4PMCA 3ND9A 4QUCA 3NE5B 1TU2B 3GTKB 4HIMA 3IRBA 1U9RA 4TKOB 1DM0B 2IT1A 3RN5A 4Y7NB 3CW2C 5ISRA 4DV1Q 2ENBA 3LWUA 5BN4A 4DR5L 4IFDG 4A3GH 2C35B 3K8AA 2JA5G 2NVXH 5IYCG 1EWCA 1F9RA 3HOWB 4CKBA 1VF7A 1PZJD 3P20A 4B3TL 1LACA 3NHHA 1VMCA 2XGTA 4OO1G 3I73A 3B6YA 4KKUA 4V190 1SNMA 4XYQA 3PO2H 2UUAL 4KHZA 3NTHA 2RCFA 3I4LA 4KN4C 3RZDH 1S40A 1JWUD 3S2DH 1TS3A 2O5IC 5EAYA 3I7FA 4FNFA 4XYOA 1T9HA 2K4KA 3TP8A 1JE5A 3RZOH 1PTOB 1EL0A 2E2JB 3NQIA 3I4NB 2F0WA 1CK1A 1UEAB 5ELNA 4BBRG 3OYYA 2ZJPA 1TWFB 4G7OC 1QNKA 3K80C 5JEAG 4DV3Q 3QWNA 2EXZA 1L1OA 2F3VA 3PUVA 2Z0SA 1Q12A 3HKZG 5BR8L 4KV6A 1STHA 2QEJC 4JBMA 3K57A 1KDCA 3CCUA 1ZEQX 2FMCA 5HGTA 2PO4A 5JJZA 3H91A 4JBKA 5J22A 4KN7C 1OXUA 3CCSA 3RUZA 1SNOA 4DR4L 2QKIC 1HXYD 5C4ZA 1KAWA 5I9PA 4DUZL 3URYA 2UUBQ 3I4MG 4KJOA 3R8BA 1X6OA 2N78A 5J3BA 2KCNA 1TWHB 1RD9D 3NK9A 1CKOA 1E24A 2MPMA 4LF7L 2Z8LA 4F7XA 1QNUA 1AZQA 4POGA 3CCRA 5HY6A 4ZKCB 1EY6A 2OT2A 2B63G 4JI8L 4OIJA 3IFDA 1SMYD 1KXLA 4GNXC 1ML0D 4NXNL 3V96A 2FJ2A 2WB1B 1D2BA 2GA4B 3G6JB 4MIUA 3TN2A 1EY7A 2LXKA 2NZ1D 4RCOA 2PQAA 1YZ6A 1O7IA 2DJGC 3VA5A 1MJCA 3D3RA 1PH4A 3CKIB 3PUWA 2BH8A 3EVQA 1TS4A 3Q23A 2B2TA 1GUNA 1F77A 5I4DA 4OEMB 1SLJA 3I91A 2CW0C 2Z6BA 2CHBD 4UY8C 1JOOA 3Q24A 4OX9Q 2MNAA 3S15H 1EQVA 4FF4A 4PMWA 1RTNA 3KLWA 1PYWD 4DAYB 3MC0B 2DN8A 4JI6Q 3U4VA 1A62A 4PZ8A 1VQGA 2DNCA 3HOXH 3I3CA 3ER0A 1E0BA 2VL6A 5IP9G 4A3FH 1HNXQ 3PO3G 1JICA 5E4XA 3GTOB 4C3IH 4BWGB 1KD1C 4X3SA 2JA6H 2HD3A 1B3QA 2DUDA 3QB3A 2R61A 2PQEA 4QUFA 1KIXA 3HKSA 2UXCQ 2FMMA 4AYBG 4QF4A 3RLNA 1J6QA 4BBSG 1LTGD 2F0SA 1WTXA 4QGUA 1PFSA 2JEAI 5D65A 1LYLA 1VQMA 1QZGA 4DR6L 2HHHL 3UE0A 3SR1A 3H0GH 4A3BB 2YYZA 3TZDA 1B9NA 4DV5Q 2R92B 2ASBA 2PNHA 1SAPA 3OW2A 3HS0C 3JAME 2B3GA 4F87A 3I4MH 3DEPA 1Q46A 5C5LA 3R93A 2A69C 3J7A5 1BDOA 4KHPQ 4PG3A 3HOYB 3A0JA 1PH3A 2HDMA 1XNRQ 2A19A 4NP5A 2AWOA 1C7YA 4N8X1 5A2QL 3TBIB 4DK0A 4DU9A 4LFCQ 3PUXA 1WTOA 3HOWG 4DV7Q 4HJ9A 1HNWQ 1NMGA 2RCNA 4EQOA 1J9OA 4OGQC 1ENAA 2JA8B 1SMXA 4C2MB 4TVAB 1YHQA 2A1AA 5HGQA 1ESFA 1I3QH 5M5XH 5C4XG 1CHPD 2EYMA 2RDHA 2UXDL 1NY4A 2HQEA 3N6RA 2ZM6L 4MHEA 4CJ2C 5FK9C 1GD7A 2KUMA 1LO5D 4JBJA 3S1MH 5JJLA 2CFMA 3I4NG 3S17B 3K81C 3OW7A
chains in the Genus database with same CATH topology
2XWJB 5IGFA 4FXDA 5IGEA 1PFMA 1ET6A 2KOLA 3LWEA 4JBWA 4A93B 4CBVA 2F0QA 1I4HA 1EU4A 1HUNA 4HN7A 2EY5A 3SK6A 2EJFC 4B08A 5DM73 1Q8IA 4HSPA 2K5DA 4DXFA 2ZXPA 4K5VA 3MHBA 1DONA 4KKSA 3HOVB 2VUMB 5D14A 1TWAB 2EDGA 2DY8A 2F0PA 4IFDJ 1JCKB 3ZYYX 1H9MA 3PUYA 4IUQA 2K1BA 4CJ1B 2KEDA 1RTOA 3DUZA 5EBDA 1NSNS 5C0XG 2K7VA 2IWHA 2NVYB 4YIJA 2BDNA 3KLRA 1Y1VB 5DEHA 2YU9B 2SNSA 3LNNA 1BCPB 3WOEA 1QCBD 2ICEC 4H7BA 5JEAJ 3GTPB 1VF5C 1H9JA 1X3QA 3FVQA 3H6MA 1YNND 5IT9E 4HEDA 3M4OB 2K04A 3J7YW 3M4YA 3DWPA 3A55A 1SNCA 4EQNA 5IODA 3WDNA 4RA8A 2WKDA 1PTOH 1V1PB 5C3WA 4Q0FA 1RJTA 1PZKD 2NVQB 2RDFA 3GO5A 5KGUA 4B9WA 1S5ED 3AMUA 2XNAC 3SK8A 1L0YB 4O42A 3H3VC 2JXMB 4IUPA 4RGNA 2I46A 4WRDA 1CTMA 1I6VC 1U4LA 4I65A 2WAQB 1MD2D 4G7ZC 1TR5A 4DAPA 3I72A 3OWEB 4NMZA 1Y69U 1ICWA 2NN6H 2RA4A 5AFWA 4ZKBB 3HOZB 1IW7C 1R4PB 1ENCA 3W3AA 1ILPA 1Z47A 4ME5A 4KD4A 2L4NA 1DD2A 3FDTA 5C6AA 1LTAD 1TY0A 1A15A 1B2TA 5C44B 1II3A 1G291 5JOBA 4ZUIA 1WD1A 2L0CA 1FYCA 1LT3D 3Q0AA 2BA0A 4C1NI 1EU3A 3H0GB 3OHXC 1WD0A 2JYOA 3SK4A 2B8FA 2SDFA 1H9RA 1YNJC 3IKJA 5D3DA 3NUCA 5ELFA 2EYFA 3VR5A 3GP7A 4J1MA 1WCMB 2D5DA 2NUCA 1EY9A 4F8MA 2EY1A 1S5BD 2H4OA 1RKNA 3NQTA 1Q1EA 3I8ZA 1XXGA 2B2UA 1SE3A 1VCIA 1HA6A 2TSSA 5I2YA 2LKVA 2BOSA 4KTAA 1JB3A 1HQRD 1GOZA 4QCLA 4DN4M 5CV5A 1LT5D 1GUWA 2L9HA 2EE1A 3MFGA 4A3JB 4RWSC 2NN6I 2EVBA 4RHRA 3X3MA 2K28A 2JE6I 1BCPD 4C3JB 3S2HB 4N9TA 4DF7A 1B3AA 3K5OA 1ESRA 1SJHD 2F0MA 4R8IA 2B2TC 4HMJA 5FKAC 4LJZC 2VB3X 2BA1A 1LLRD 4IN3A 2A6EC 4A3MB 4RAUC 2E2DC 4U673 1G91A 4HCEA 2O2LD 5T1GA 2JSOA 2F0HA 4IALA 5HURA 1NAPA 4KY5A 1DYQA 3GTGB 1WVLA 4HR7B 1HRJA 2D62A 4FVMA 3GTQB 3A8JE 4CGYB 1PRTC 1H9SA 3MXGA 4K14A 1EIHA 3TZUA 1B50A 1EOTA 1TY2A 3T56B 3FPUB 2PZTA 3IAYA 3AB9A 3K7AB 4QB4A 1ZYRC 3EFXD 3RD4A 4OHJA 1QB5D 1E2VA 1STYA 2F0EA 5C0XJ 3BG3A 4U68A 4C3HB 3LX0A 3T13A 3T53B 3PIP3 4FP5D 5FOBB 1STGA 4DFAA 3R2IA 1G6ZA 2FFKB 1SMYC 5NUCA 4M1UB 2A68C 3J7AV 1GHKA 3D6WA 1CA6A 5CV9A 3J80E 4ZRZA 4LK1C 4C3IG 1A3VA 2EY6A 4L6TB 3FPPA 3TMEA 1D1KA 3OIPA 5M3MB 2PMZB 1NCVA 4C1NK 1EEID 2RSNA 4BY1B 2KECA 1SYFA 2PZUA 5KNCA 3PV0A 4A3IB 5FLXE 2K5WA 1SNDA 4G4KA 1F2LA 1QE6A 1JOQA 1BBXC 4BA2I 2KVMA 5CMDA 2KEEA 4X3KA 3TP7A 1KAAA 1C4QA 4HTHA 3MEHA 5E1FA 5IGBA 3J81L 3MZ5A 1B4OA 2PW5A 1OXTA 1XYIA 3WOFA 4RKBA 3TSSA 2RSOA 4PQXA 4EQPA 3L3OC 3VR2A 4XXEA 2SOBA 2F0DA 5M5WB 1SJED 2OEOA 2M9VA 2WIIB 1BCPF 1S5DD 1IYVA 3SXHA 4Z9CB 2B2VA 1M4VA 3P7JA 5EKKA 4QMGA 3GTLB 1CHQD 5CYUA 3DM1A 1F9QA 4H44C 2E2IB 5C5MA 2WACA 4RCNA 5K36H 2KCCA 1FNVA 3K5MA 4XQJA 4ODGA 1I4QA 1FNWA 1KTKA 5A35A 3NP8A 1PMRA 2WINB 2K33A 1D5XC 2BE5C 5DNFA 1IL8A 3M85A 2N88A 3H94A 3K0YA 1EY8A 2AUKA 4ZK9B 1O80A 2NB0A 3AU7A 1STAA 3NXWA 4KK7A 2DNEA 3QOLA 2C5CA 1VDZA 1Y8NB 1Q90A 4A3KB 1AP0A 5LHY1 1K8MA 1SXTA 2R93B 3ERQA 2E2HB 5CV4A 2QCPX 4ID6A 5EKIA 1F2ZA 4DK1A 4RH6A 1SE4A 4FF2A 1QJOA 3I90A 2B2WC 3VYUA 4J8QA 1WTQA 3TP6A 2QDBA 3GV3A 1IYUA 2F0NA 3BVGA 3MWYW 4IZ8A 1SYGA 1CQFA 3FMCA 2EY2A 1I4XA 2JA7B 1SYCA 2F0GA 2XWBB 3HEJA 5JPNC 1PTOD 3A56A 2K03A 4C3HG 1EZ8A 4FO2A 2CW0D 2J0TD 2EYOA 2NVTB 3NSWA 1I4GA 1G2SA 4RGMA 1STNA 2PW7A 1SSOA 3K58A 4PMBA 1FGBD 3KBGA 3MXPA 4QIWB 3X3NA 5I6WA 2F0IA 5I6YA 2NTTA 3GD7A 1HHVA 3QJYA 1YNNC 2F0OA 4EGVA 2I07B 5IGDA 1EYDA 1PXUA 3VYTA 2Q8RE 2M00A 5IOCA 5J1ZA 3F2UA 3O13A 4CKEA 5EGTA 2XVSA 2LS01 4O1NA 1KLUD 2PCFB 5M5YB 1O7LA 1BQQT 3S16B 5ELBA 3V2TA 1T5XD 2RKSA 4EVOA 5BN3A 3SDZA 2VXWA 5KRUA 2OXPA 2TMPA 4B9XA 4IUUA 2NN6G 2B2UC 1LT4D 2A69D 3MFYA 1UUPA 3NBIA 5FO8B 3D4RA 2F1MA 4K2LA 1E2ZA 2IW3A 1EFID 4PNYA 1FNUA 2IJ0A 4FXKC 1SE2A 2QILA 3CHBD 5I9OA 3S14B 3KK7A 1F2MA 1Z6HA 4J6HA 1ZKOA 1TWGB 3ONAB 4RGTA 1FD7D 2A6HD 1RDPD 4HMIA 1BNZA 2C9OA 3R3OA 1LTSD 3OOCA 4FF1A 2M2LA 1HUMA 5C4JB 5KNBA 3L7ZC 3V05A 4V0BA 1JWSD 4FYDA 5CBAE 4K5XA 1AEXA 1V43A 4KJNA 4IUTA 3KF8A 1LTTD 2L55A 1HFGA 3S1QB 5K5PA 3CQZB 4KD3A 5DAUA 1SYEA 1TS5A 2CQAA 4ILWA 3A7LA 2G9DA 4WORA 1SBBB 4TQUS 3OIQA 3RLFA 4DNTB 2SNMA 1EYAA 2JEBI 1A2UA 4LMQD 2XSCA 1UNSA 3U9SA 4IUNA 1JWMD 2Q8IB 1WTPA 3MVVA 1HTLD 1PTOF 4K5WA 3JAML 3FEWX 1GUOA 2JA5B 3SEBA 1HA5A 3ITPA 1SFOB 1RCVD 2Z4IA 1B44D 2EYPA 3E0JA 4BS9A 2EJMA 3BS1A 2D2CC 5EJWA 4DAYA 1AW7A 5KYIA 3EQLC 3IL8A 3MXUA 3OWFA 4KI0A 4XDXA 4G7HC 1K8OA 2A5HA 2NYZD 4KMUC 1STEA 3A54A 4BBRB 3CRKC 3DWQA 3OMGA 2MJ8A 2ZXOA 1IKMA 1XX8A 5IGCA 1HPCA 4L8JA 3HKZB 1U4PA 3P75A 3D4WA 2F0JA 4E6IA 2FINB 1TIID 3C46A 3T51B 1EY0A 5CV7A 1L0XB 3J81E 1PRTB 2E74C 2EYHA 1TWCB 2B63B 3S1RB 3OMCA 5FO7B 3K59A 1GUTA 4A3DB 1D1IA 3DWAA 5I2XA 2HCCA 1CA5A 1IW7D 1Q3LA 2EZVA 4XT3B 3BZDB 2A73B 2B39A 1MBYA 4KY7A 2B2VC 2VNUD 3BVMA 3FRPB 3TP5A 4WFN3 1CQVA 1OXXK 1STBA 5JAVA 1XWEA 1I6HB 1EY4A 2L1BA 2Z4HA 3NPPA 3SHLA 5IT9L 1ONLA 3W2DA 3PO3B 3J7AF 1A3TA 4ZQ3A 3VYRA 1MSGA 4RGOS 1QILA 1C48A 1MGSA 3A8IE 3GQBA 4MN3A 3K5NA 4X3UA 4KKTA 3T16A 4AYBB 1Y1WB 1EYCA 1Y8PB 2F0VA 1ILQA 2Q8TA 2F0FA 2NBFA 1U4MA 1J8IA 5CR3A 1HQMC 1WTVA 2PZWA 3M3YB 2K32A 1SEBD 4I7ZC 5M3FB 5C3EB 1BXTA 4C56C 2BCOA 4UAIA 2PYKA 1TQOA 5A2QE 5K36G 3A8KE 3HGBA 5DM63 1JC7A 2IL8A 1MSHA 4BY7B 1GXDC 4XIGS 2K6AA 1BUVT 4X3TA 1H9KA 5IGGA 1I4PA 3PIO3 1SDFA 1B9MA 1ZXTA 5C4XB 2J4XA 3ND8A 2FHTA 1D5MC 4S3SA 3E5SA 2EYLA 5CV8A 5KNDA 1LTRD 2B2YA 2PNRC 4BA1I 4R8NA 1EEFD 3HZXA 1BO0A 3FKIB 1DJRD 1DOKA 1V1PA 2A6ED 5D3IB 1RF2D 1E2WA 1HTPA 2KA7A 4LAAA 2F0UA 4IQZA 3HOUB 3K5LA 2BDOA 3Q22A 4GZYC 4H13C 1GJXA 4HSVA 1PZID 4K2KA 4RHSA 3VA7A 1B1ZA 2XRSD 2MGSA 3QIAA 1AZPA 3KLSX 4CKCA 2EYJA 1PRTD 3IFTA 4DGZA 1A2TA 2L12A 3GTJB 4HCSA 2F0TA 1G8ZD 1BF4A 2QF7A 3NWTA 3BDOA 4DXGA 1ZYRD 3G7LA 1R4QB 3KLSA 2E75C 2CVRA 1Z7TA 3L9AX 2RDGA 1KDBA 3VR3A 5J39A 1PFBA 3RMHA 2AUJD 1T5EA 2A68D 5TSSA 3D4DA 1A3UA 4G57A 3C3LA 5EQ0A 2A74C 2B8GA 4C3JG 4IFDH 2PPBC 4XQNA 1PTOC 1NR4A 3A7AB 4K8JA 1GUGA 4H0LC 4CJ0B 4OO1H 1S5FD 3OSOA 1EIGA 4ZUJA 5EPLA 3NBHA 2EPBA 1XTCD 3SVMA 1D5ZC 3M7NA 2DY7A 5C4HA 2H1EA 1WTWA 5COYA 1ET9A 5ELCA 5JEAH 3GTMB 1TS2A 2G9HD 2LMCB 1FR3A 4IUVA 1JORA 2NTSA 1O78A 1BR9A 1LABA 1KDAA 3BDCA 4JK1C 4L63B 4TSSA 1SNPA 1X32A 1X3PA 2ZXRA 3R2TA 4ULLA 3C2PA 2XN9C 1OXVA 1DZ1A 4Q5VA 1PLFA 5BN5A 5E3FA 1LV9A 2MP1A 1OXSC 3KBXA 1DOMA 4IFDI 4WJWA 2MUYA 3I70A 1LTID 1U4RA 5JVG3 3P1HA 3HG9A 4PV1C 3S9WA 1IHZA 5EPJA 4OO1I 3CU7A 3J80L 1JE4A 3MA2B 2E76C 1S4ZA 3UI2A 1EZ6A 3E6ZX 4A3EB 2HDLA 4K6LA 3EA6A 2X6LA 1JQYD 5ELEA 2BE5D 2ICIA 3QG1A 2IX0A 2A6HC 2SEBD 4DAVA 4DA2A 2R3ZA 1QWYA 4ZAIA 1PRTF 1R9TB 1EQTA 1SYBA 5FLXL 3DEOA 2JP1A 3OPOA 3BVZA 2IX1A 3DXJC 5LL6X 4UDUC 4RFBA 3VR6A 1LT6D 4A3GB 4NW2A 2NVXB 1DCZA 2F0LA 3MAQA 5M9OA 2KJXA 5CC4A 1KNEA 5E4WC 3SE0A 4FF3A 2RBMA 3PO2B 2AWNA 4OIKA 1PFNA 2WV6D 3RZDB 1H9SB 1CM9A 2J7ZA 3S2DB 3VYSA 2R6GA 2N55A 3D6CA 3RZOB 2MHVA 4KY6A 1QOHA 1GHJA 4R9WA 4OL7A 4F88A 2F4IA 5FO9B 3M7GA 2F03A 1V1OA 2XIWA 2Y0SB 2AQ1B 2Z1CA 5CGKA 5T1IA 1HCZA 1QG7A 2ID0A 2K01A 1F9PA 5EBCA 5IIFA 2F3WA 2V4DA 1KABA 4KHVA 4ZLTF 1B53A 4XTCS 1VMPA 1ENFA 4NKLA 4M8AA 2L5TA 1D6EC 2L11A 1CZWA 3N52A 1GUSA 3S1NB 5EKLA 1M8AA 1KNAA 1CT1D 1AFPA 2B2WA 2K05A 3NWSA 3EJIA 1KLGD 2LFNA 5G3LD 3HP3A 3CRLC 4K8IA 1V8QA 2K5QA 2AQ3B 1CFMA 3NTKA 1CZGA 3BDLA 3S15B 3PUZA 4TRDA 4IURA 1OO9B 4N9PA 1CI3M 5JPMC 5KEEA 3KUPA 3HOXB 1UAPA 2D9UA 1BCPC 1PDQA 1AN8A 4A3FB 4ZYSA 4C3IB 5KIXA 2JA6B 1O7ZA 2EJGC 5C0XH 4XT1B 1G2TA 3C1FA 5CORA 5ELDA 3GV6A 2HUGA 2B2YC 2WKCA 2OF1A 5CBEE 5C3XA 3BYYB 3TDQA 1JR0D 1NR2A 5LL6S 1TT2A 3T4AC 2X6GA 3QO2A 5EPKA 1MI2A 2EOTA 3I4MB 1IKLA 1O7YA 2X69A 2RVLA 1DOLA 1TVXA 1Q1BA 1HFNA 1A6XA 3U9OA 1Y8OB 1SYDA 1S5CD 3DHQA 4P2CB 1I4RA 3BYTB 3K6OA 2O4XA 1I3QB 3NTIA 5M5XB 1TKWB 1RHPA 3SK5A 2AQ2B 4FXGC 3Q6SA 3S1MB 5CV6A 4NDXA 1DXMA 2F0KA 3MXNA 1JOKA 4RKLA 4CHTB 2KQ3A 3D8GA 3DMUA 2KHSA 2IX3A 2WP8J 4DNRB 5C0XI 3MTSA 2O5JC 3QOJA 4ABNA 4XQQA 1WTRA 1YNJD 3HRZC 4K6DA 1EWHA 1W6JA 2XRQD 5F2DA 1LTBD 5KYLA 1K83B 3C1EA 1SNQA 1C8CA 2HCIA 3PMFA 1W6KA 3EROA 1RODA 1NUCA 1EY5A 4BBSB 1F9SA 1F2YA 2ZT9C 2VB2X 3H09A 5JVH3 1BOSA 3VR4A 4HAEA 3D31A 1I50B 2NWGA 2R7ZB 2RQXA 2IPKD 5G3LF 2LY7A 4PMCA 3ND9A 4QUCA 3NE5B 1TU2B 3GTKB 1U9RA 4TKOB 1DM0B 2IT1A 4Y7NB 5ISRA 2ENBA 3LWUA 5BN4A 4IFDG 1EWCA 1F9RA 3HOWB 4CKBA 1VF7A 1PZJD 3P20A 1LACA 3NHHA 1VMCA 4OO1G 3I73A 4V190 4KKUA 1SNMA 4XYQA 4KHZA 3NTHA 3I4LA 4KN4C 1JWUD 1TS3A 2O5IC 4FNFA 4XYOA 3TP8A 1PTOB 1EL0A 2E2JB 3NQIA 3I4NB 2F0WA 1CK1A 1UEAB 1TWFB 4G7OC 1QNKA 5JEAG 3QWNA 2EXZA 2F3VA 3PUVA 1Q12A 4KV6A 1STHA 2QEJC 3K57A 1KDCA 1ZEQX 2FMCA 5HGTA 2PO4A 5JJZA 3H91A 5J22A 4KN7C 1OXUA 3RUZA 1SNOA 2QKIC 1HXYD 5C4ZA 5I9PA 3URYA 4KJOA 3R8BA 2KCNA 1TWHB 1RD9D 3NK9A 2MPMA 2Z8LA 4F7XA 1QNUA 1AZQA 4ZKCB 1EY6A 2OT2A 4OIJA 3IFDA 1SMYD 1ML0D 3V96A 2FJ2A 2WB1B 1D2BA 2GA4B 3G6JB 4MIUA 3TN2A 1EY7A 2NZ1D 4RCOA 3VA5A 3D3RA 3CKIB 3PUWA 3EVQA 1TS4A 3Q23A 2B2TA 1GUNA 1F77A 5I4DA 3I91A 2CW0C 2CHBD 1JOOA 3Q24A 1EQVA 4FF4A 4PMWA 1RTNA 1PYWD 3MC0B 2DN8A 2DNCA 3I3CA 1E0BA 1JICA 5E4XA 3GTOB 4BWGB 4X3SA 3QB3A 2R61A 2PQEA 4QUFA 2FMMA 4QF4A 1LTGD 2F0SA 1WTXA 2JEAI 5D65A 3SR1A 4A3BB 2YYZA 3TZDA 1B9NA 2R92B 1SAPA 3HS0C 3JAME 4F87A 3DEPA 5C5LA 3R93A 2A69C 1BDOA 3HOYB 2HDMA 4NP5A 2AWOA 5A2QL 3TBIB 4DK0A 4DU9A 3PUXA 1WTOA 4EQOA 1J9OA 4OGQC 1ENAA 2JA8B 4C2MB 1ESFA 1CHPD 2EYMA 2RDHA 2HQEA 3N6RA 4MHEA 4CJ2C 5FK9C 2KUMA 1LO5D 3S17B 3OW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYZ D;  3I8Z A;  5E4W C;  4IUV A;  1RTN A;  3Q6S A;  3FPU B;  2MGS A;  2B2U A;  2K03 A;  1PFM A;  1RJT A;  1AZP A;  2KOL A;  3LWE A;  1HA6 A;  1MSG A;  4OIK A;  1PFN A;  2MJ8 A;  1EL0 A;  2B2V A;  1MGS A;  4MN3 A;  1BNZ A;  1IKM A;  1HUN A;  1CM9 A;  3P7J A;  2J7Z A;  3I3C A;  4X3U A;  4IUR A;  2L12 A;  1E0B A;  1XX8 A;  2N55 A;  1U4P A;  1JIC A;  5E4X A;  1X32 A;  4HCS A;  1X3P A;  4O42 A;  4U68 A;  1G2S A;  3DM1 A;  1F9Q A;  1QNK A;  3MTS A;  4X3S A;  2M2L A;  3KUP A;  1HUM A;  4DN4 M;  1DON A;  1BF4 A;  2D9U A;  1ILQ A;  1SSO A;  4IUP A;  2FIN B;  1PDQ A;  2Q8T A;  4QUF A;  1WTR A;  1U4M A;  1G6Z A;  2FFK B;  1J8I A;  2FMM A;  3G7L A;  5D14 A;  1GUW A;  2L9H A;  2EE1 A;  5CBA E;  4RWS C;  4R9W A;  1WTV A;  3D6W A;  1CA6 A;  1O7Z A;  1WTX A;  1DZ1 A;  2DY8 A;  2CVR A;  1PLF A;  1C8C A;  5D65 A;  4IUT A;  1U4L A;  4XT1 B;  2HCI A;  1G2T A;  2K28 A;  5JJZ A;  1LV9 A;  1HHV A;  3H91 A;  1HFG A;  5COR A;  2MP1 A;  3KBX A;  1DOM A;  1ROD A;  2XIW A;  1PFB A;  3TZD A;  4UAI A;  2Q8R E;  5DNF A;  3GV6 A;  2HUG A;  5T1I A;  2B2Y C;  1QG7 A;  1IL8 A;  1U4R A;  1F9S A;  2K01 A;  1ICW A;  1F9P A;  1NCV A;  1SAP A;  1B3A A;  3F2U A;  2N88 A;  2RA4 A;  5AFW A;  5EQ0 A;  2IL8 A;  4ZKB B;  4IUQ A;  1ESR A;  5CBE E;  1MSH A;  2K1B A;  2RSN A;  5EPJ A;  2KEC A;  4CJ1 B;  1JE4 A;  1NR2 A;  3DEP A;  2KED A;  4X3T A;  3R93 A;  1S4Z A;  1RTO A;  3UI2 A;  4R8I A;  1ILP A;  4ZK9 B;  1O80 A;  4HAE A;  4LMQ D;  2HDL A;  2X6G A;  3QO2 A;  2B2T C;  2X6L A;  2MPM A;  5EPK A;  2L4N A;  2HDM A;  2NWG A;  1MI2 A;  1NR4 A;  4ZLT F;  2EOT A;  3FDT A;  1B53 A;  4ZKC B;  1WTP A;  1AZQ A;  1SDF A;  2HCC A;  1F2L A;  1QE6 A;  2VXW A;  1CA5 A;  2BDN A;  1A15 A;  4OIJ A;  1B2T A;  3IFD A;  1BBX C;  4CJ0 B;  2R3Z A;  4IUU A;  1WTO A;  4QUC A;  1IKL A;  4RAU C;  1EIG A;  1ZXT A;  1O7Y A;  1Q3L A;  2KVM A;  2X69 A;  5CMD A;  2KEE A;  2B2U C;  2FHT A;  2RVL A;  4X3K A;  1AP0 A;  5EPL A;  4ZAI A;  1VMP A;  1G91 A;  1ML0 D;  4XT3 B;  1J9O A;  1WD1 A;  2FJ2 A;  1EQT A;  1DOL A;  2B2V C;  5T1G A;  3DEO A;  2B2Y A;  1TVX A;  2EPB A;  2JP1 A;  1X3Q A;  1WD0 A;  2JYO A;  1HFN A;  5EKI A;  3TN2 A;  2SDF A;  3SVM A;  2L11 A;  4HED A;  2NZ1 D;  1BO0 A;  1DOK A;  1F9R A;  1NAP A;  2DY7 A;  3N52 A;  1B4O A;  1WVL A;  3I90 A;  2K04 A;  3HP3 A;  5EJW A;  2B2W C;  1HRJ A;  2H1E A;  4MHE A;  4CJ2 C;  1XYI A;  1M8A A;  1VMC A;  1KNA A;  1WTW A;  1WTQ A;  2B2T A;  3GV3 A;  2KUM A;  5COY A;  3IL8 A;  4NW2 A;  2B2W A;  3I91 A;  2RSO A;  3MWY W;  1RHP A;  2K05 A;  4XDX A;  1EIH A;  2L1B A;  4RA8 A;  4HSV A;  3ONA B;  1B50 A;  1EOT A;  1KNE A; 
#chains in the Genus database with same CATH topology
 2XWJ B;  5IGF A;  4YHH L;  1W3S A;  4FXD A;  5IGE A;  1PFM A;  1ET6 A;  4DV4 L;  3HOU G;  2KOL A;  3LWE A;  3NEN A;  4R4I A;  4R4C A;  5GAE C;  1QZH A;  4JBW A;  4A93 B;  4CBV A;  2F0Q A;  4DV0 L;  1I4H A;  1EU4 A;  1HUN A;  4HN7 A;  2EY5 A;  3SK6 A;  3STB C;  2EJF C;  4B08 A;  4N8F A;  1Q8I A;  5DM7 3;  4HSP A;  2K5D A;  4DXF A;  2ZXP A;  4K5V A;  3MHB A;  1DON A;  1K83 H;  4KKS A;  3HOV B;  2VUM B;  1BBW A;  5D14 A;  4JI5 L;  1EFW A;  1TWA B;  1N33 Q;  2EDG A;  2Y0S E;  2DY8 A;  1AE2 A;  2F0P A;  4IFD J;  1JCK B;  1N34 L;  5GQO A;  3ZYY X;  1H9M A;  1I50 H;  5AJ3 L;  3PUY A;  2R7Z H;  4IUQ A;  2K1B A;  4CDF C;  3J81 j;  4CJ1 B;  4JV5 Q;  2KED A;  1X65 A;  3DM3 A;  1RTO A;  3CPF A;  3J81 i;  3DUZ A;  1C9O A;  1NSN S;  1BBU A;  5EBD A;  5C0X G;  2K7V A;  4P73 A;  3GTK H;  4DV2 L;  2IWH A;  2NVY B;  1CUK A;  4JPB W;  4P74 A;  4YIJ A;  2BDN A;  3KLR A;  1Y1V B;  5DEH A;  3WWV A;  2YU9 B;  2SNS A;  3LNN A;  4B3M L;  1BCP B;  4OWX B;  1Q81 C;  3HOW H;  3WOE A;  1C0A A;  1QCB D;  2ICE C;  3TQY A;  4H7B A;  5JEA J;  5FJ8 H;  1VF5 C;  3GTP B;  1A63 A;  1H9J A;  1X3Q A;  4B3S Q;  3FVQ A;  3H6M A;  1YNN D;  5IT9 E;  4HED A;  3CC2 A;  1XJV A;  3M4O B;  2K04 A;  3J7Y W;  3CP0 A;  1VQ5 A;  3M4Y A;  3DWP A;  3OTO Q;  1NTG A;  3A55 A;  1SNC A;  4EQN A;  5IOD A;  3WDN A;  4RA8 A;  1K28 A;  2WKD A;  1PTO H;  1S72 A;  2E2J H;  3I4N H;  2WAQ E;  4IPC A;  1V1P B;  5C3W A;  4Q0F A;  1RJT A;  1PZK D;  2NVQ B;  1TWF H;  2RDF A;  3GO5 A;  5KGU A;  4B9W A;  1S5E D;  3AMU A;  2XNA C;  3ZJY C;  3SK8 A;  1L0Y B;  4O42 A;  2CCZ A;  3KDF B;  2KHJ A;  3H3V C;  5IYB G;  2K52 A;  2JXM B;  5IY0 A;  4K0K Q;  4IUP A;  1VQD A;  4RGN A;  1VQN A;  2I46 A;  4WRD A;  4B3R L;  1CTM A;  1I6V C;  1WYD A;  3Q8D A;  1B7Y B;  1U4L A;  4I65 A;  5IWA L;  2WAQ B;  1YJN A;  1MD2 D;  3E0E A;  1WFQ A;  4G7Z C;  1KL9 A;  1TR5 A;  4DAP A;  1XMO Q;  3I72 A;  3OWE B;  1TWH H;  2PI2 A;  4NMZ A;  2EQS A;  4GN3 B;  1Y69 U;  4PZ6 A;  1ICW A;  2NN6 H;  2RA4 A;  5AFW A;  4ZKB B;  3HOZ B;  1HR0 L;  1IW7 C;  4UPA A;  1R4P B;  5FLM H;  4JI7 L;  1EYG A;  3CCQ A;  1ENC A;  3W3A A;  2LSS A;  1Z47 A;  5LMN W;  2GVA A;  3KJP A;  4ME5 A;  1ILP A;  4KD4 A;  2L4N A;  1DD2 A;  3FDT A;  5C6A A;  1VQL A;  2E5L Q;  1LTA D;  1TY0 A;  1A15 A;  1B2T A;  5C44 B;  1UE7 A;  4A3E G;  1ASY A;  1II3 A;  3E9I A;  4GS3 A;  1G29 1;  1YEZ A;  5JOB A;  5IP7 G;  4ZUI A;  1WD1 A;  2L0C A;  1FYC A;  1LT3 D;  2D0P A;  3Q0A A;  1HZC A;  2BA0 A;  4C1N I;  4X6A H;  1EU3 A;  3H0G B;  3OHX C;  1WD0 A;  2JYO A;  3SK4 A;  2B8F A;  1NMF A;  2SDF A;  1H9R A;  1X3F A;  1YNJ C;  3IKJ A;  1JJC B;  5D3D A;  5LMN Q;  1KHI A;  3NUC A;  5ELF A;  1N36 Q;  4DR2 Q;  2EYF A;  3VR5 A;  3GP7 A;  3M4P A;  3CPW A;  2V1C C;  1PH2 A;  1L1O C;  1IBK L;  1VQ9 A;  4J1M A;  1WCM B;  4A93 G;  2D5D A;  2NUC A;  1EY9 A;  4F8M A;  2EY1 A;  1S5B D;  2H4O A;  4OEL B;  1RKN A;  3NQT A;  1Q1E A;  3I8Z A;  2LXJ A;  1XXG A;  2YTX A;  4JOI A;  2B2U A;  1SE3 A;  1VCI A;  4A3G G;  1HA6 A;  3M4Q A;  3GTO H;  2TSS A;  5I2Y A;  3W1G A;  2LKV A;  3F1Z A;  2BOS A;  2GVB A;  4X65 L;  4KTA A;  2K5V A;  1JB3 A;  3RNU A;  4LFA Q;  3AQQ A;  1HQR D;  4OWT B;  1GOZ A;  4QCL A;  1K0R A;  4DN4 M;  4GKJ Q;  1HNZ Q;  5CV5 A;  1GM5 A;  1LT5 D;  1GUW A;  2L9H A;  2EE1 A;  3MFG A;  4A3B H;  4DR3 Q;  4A3J B;  4RWS C;  3UE1 A;  1XNQ Q;  2NN6 I;  2R92 H;  2EVB A;  4RHR A;  3X3M A;  2K28 A;  1ICF B;  2Q2H A;  2JE6 I;  1VQO A;  1KQS A;  1BCP D;  4J15 A;  1EQQ A;  4FDB A;  4C3J B;  1K0S A;  3S2H B;  4N9T A;  4DF7 A;  3HOY H;  4DR1 Q;  3T1H Q;  1B3A A;  4JYA L;  3K5O A;  3E9H A;  1DGS A;  1ESR A;  1SJH D;  3F8T A;  1YHA A;  1L2F A;  2F0M A;  2Y0S G;  4R8I A;  4I7A A;  4LF4 L;  2B2T C;  4HMJ A;  2KCT A;  5FKA C;  4LJZ C;  2VB3 X;  2BA1 A;  1LLR D;  2JA8 H;  4IN3 A;  2A6E C;  4C2M H;  4A3M B;  1ASZ A;  1FJG Q;  4RAU C;  2Q2T A;  4LFB L;  2E2D C;  1PH6 A;  4U67 3;  1G91 A;  1XPR A;  4HCE A;  2O2L D;  5T1G A;  1NBW A;  2F0H A;  2JSO A;  4IAL A;  3K7U C;  2IHF A;  5HUR A;  1NAP A;  4KY5 A;  1DYQ A;  2ZJR A;  3GTG B;  2QW7 A;  3S17 H;  1WVL A;  4HR7 B;  4OON A;  1HRJ A;  2D62 A;  3RN2 A;  1IXR A;  4FVM A;  3GTQ B;  2D0O A;  3A8J E;  4CGY B;  1Q8K A;  1NJI C;  1PRT C;  1H9S A;  3MXG A;  4A93 H;  4K14 A;  2CQO A;  2KCM A;  1EIH A;  1IBM L;  2IY5 B;  4GN5 A;  3TZU A;  1B50 A;  4AQY L;  1EOT A;  1JT8 A;  1TY2 A;  4R1J A;  3T56 B;  4APV A;  4DPG A;  3FPU B;  2PZT A;  3IAY A;  3AB9 A;  3K7A B;  4QB4 A;  4YWK A;  4DV3 L;  1WOC A;  1I94 L;  1ZYR C;  3EFX D;  4P72 A;  3RD4 A;  4OHJ A;  1QB5 D;  1E2V A;  1Y14 B;  1STY A;  2F0E A;  1IBL L;  5C0X J;  2VUM H;  3HOV H;  3BG3 A;  4LUO A;  4LF6 Q;  4U68 A;  1TWA H;  5M5Y H;  4C3H B;  1KRS A;  3LX0 A;  3T13 A;  3T53 B;  5E7N A;  3PIP 3;  4FP5 D;  4BXX G;  1GKH A;  5FOB B;  4GNX B;  1STG A;  2WAQ G;  4IOC A;  4DFA A;  3R2I A;  1G6Z A;  2FFK B;  1SMY C;  5NUC A;  4M1U B;  1V1Q A;  2A68 C;  1PA6 A;  3J7A V;  3A5U A;  1GHK A;  3D6W A;  1CA6 A;  3TS2 A;  5CV9 A;  2UUB L;  3HOX G;  3T1Y Q;  3J80 E;  2VQF Q;  4X66 L;  3DLL A;  4ZRZ A;  2Z6K C;  1J5E L;  4A3F G;  2N3S A;  4LK1 C;  4C3I G;  4GLA C;  1A3V A;  2EY6 A;  4L6T B;  3FPP A;  3TME A;  1D1K A;  4NXM Q;  2JA6 G;  3OIP A;  4DUY Q;  5M3M B;  2PMZ B;  1NCV A;  4C1N K;  1EEI D;  4DV6 Q;  5GAD C;  2UU9 Q;  2RSN A;  4BY1 B;  2NVY H;  2KEC A;  4A75 A;  1VQH A;  4GLV B;  1SYF A;  2PZU A;  1Y1V H;  1CKN B;  5KNC A;  2YU9 H;  3PV0 A;  4A3I B;  5FLX E;  1TWG H;  4QQB X;  2K5W A;  1SND A;  4G4K A;  1F2L A;  1QE6 A;  3H0G G;  2F4V L;  1JOQ A;  2WB1 E;  3GTP H;  1BBX C;  4DR5 Q;  3JAM c;  4BA2 I;  2KVM A;  5CMD A;  2KEE A;  4X3K A;  3TP7 A;  1KAA A;  1C4Q A;  4HTH A;  2OQ0 A;  3M4O H;  2PI2 E;  4B3T Q;  3MEH A;  5E1F A;  3KF8 B;  4NPS A;  2UXB L;  5IGB A;  4YCU A;  3J81 L;  3MZ5 A;  2UUA Q;  1B4O A;  2PW5 A;  4LF8 L;  1OXT A;  1X9N A;  1XYI A;  3WOF A;  4RKB A;  1EWI A;  4JI0 L;  3TSS A;  2RSO A;  4PQX A;  1FVI A;  2NVQ H;  4EQP A;  3L3O C;  3VR2 A;  4XXE A;  2K75 A;  2F0D A;  2SOB A;  5M5W B;  1SJE D;  1HNX L;  2OEO A;  3KF6 B;  2M9V A;  4JI3 L;  3W1B A;  2WII B;  1BCP F;  1S5D D;  3SGI A;  1IYV A;  3SXH A;  1D8L A;  1M1K C;  4Z9C B;  2B2V A;  1M4V A;  3P7J A;  5EKK A;  2UXC L;  3U58 A;  4QMG A;  1Q7Y C;  3GTL B;  1CHQ D;  3H3V I;  2VQE L;  5BR8 Q;  5CYU A;  3DM1 A;  1F9Q A;  4H44 C;  2E2I B;  5C5M A;  2WAC A;  4RCN A;  5K36 H;  4NB3 A;  2KCC A;  4BXX H;  1FNV A;  3G71 A;  3K5M A;  2Q2U A;  4XQJ A;  4O0A A;  4ODG A;  1I4Q A;  1FNW A;  1KTK A;  5A35 A;  3NP8 A;  1PMR A;  3HOZ H;  2WIN B;  2ZTD A;  2K33 A;  1D5X C;  2BE5 C;  5DNF A;  1XNR L;  2IHE A;  1VQK A;  1IL8 A;  3M85 A;  2N88 A;  4LFC L;  3H94 A;  4JI8 Q;  3K0Y A;  1PYB A;  1XPO A;  5C44 H;  3CF5 A;  1EY8 A;  2AUK A;  4ZK9 B;  1O80 A;  2NB0 A;  1EQR A;  2AMC B;  5DLQ E;  3AU7 A;  1STA A;  3NXW A;  4KK7 A;  2DNE A;  4NXN Q;  3FP9 A;  3QOL A;  2C5C A;  1WTH A;  1VDZ A;  1Y8N B;  1Q90 A;  4YY3 L;  4A3K B;  2L15 A;  3CCL A;  1AP0 A;  5LHY 1;  2R7Z G;  1K8M A;  4OXP A;  3NEM A;  1SXT A;  2R93 B;  3ERQ A;  2E2H B;  5CV4 A;  2QCP X;  1UE6 A;  1U5K A;  3EN2 A;  4ID6 A;  5EKI A;  1WCM H;  1F2Z A;  4RH6 A;  4DK1 A;  2HIX A;  2K14 A;  1SE4 A;  4FF2 A;  4DK3 C;  2N8N A;  1QJO A;  2CWP A;  3I90 A;  2B2W C;  3VYU A;  1BKB A;  4J8Q A;  1WTQ A;  4IOA A;  3TP6 A;  2QDB A;  3GV3 A;  1IYU A;  2F0N A;  3BVG A;  4KLK A;  3I56 A;  4QIW E;  3MWY W;  4IZ8 A;  1SYG A;  1CQF A;  3CAM A;  3CME A;  3FMC A;  2EY2 A;  1I4X A;  2JA7 B;  4A4I A;  5IT9 c;  1SYC A;  2F0G A;  5FJ8 G;  2XWB B;  4WJ4 A;  3HEJ A;  4JI1 L;  5JPN C;  1PTO D;  3A56 A;  2K03 A;  2OTJ A;  4C3H G;  1NE3 A;  1EZ8 A;  4FO2 A;  1PH5 A;  2CW0 D;  2J0T D;  4POF A;  2EYO A;  2NVT B;  3NSW A;  1I4G A;  1G2S A;  4RGM A;  4A3J H;  1STN A;  4GKK L;  2KEN A;  2PW7 A;  1P8L A;  1SSO A;  3K58 A;  4PMB A;  3J7Z C;  5JJI A;  2HHH Q;  1FGB D;  3KBG A;  3MXP A;  4QIW B;  4C3J H;  5M3M G;  3X3N A;  5I6W A;  3S2H H;  3D0F A;  2F0I A;  5I6Y A;  2NTT A;  3GD7 A;  1HHV A;  3QJY A;  1YNN C;  2F0O A;  4EGV A;  2I07 B;  5IGD A;  1EYD A;  1PXU A;  3A5Z B;  3VYT A;  2Q8R E;  2M00 A;  5IOC A;  2VW9 A;  5J1Z A;  3F2U A;  3O13 A;  4CKE A;  5EGT A;  4DK6 C;  2KBN A;  2XVS A;  1FL0 A;  2LS0 1;  4O1N A;  1KLU D;  2PCF B;  4A3M H;  5M5Y B;  1O7L A;  3QR8 A;  1BQQ T;  2OQK A;  2K50 A;  3S16 B;  5ELB A;  3V2T A;  1W2B A;  4AIM A;  4DR7 L;  1T5X D;  2N49 A;  2RKS A;  4EVO A;  5BN3 A;  3SDZ A;  2VXW A;  2JQO A;  5KRU A;  1RIP A;  2OXP A;  2TMP A;  4B9X A;  4IUU A;  3A74 A;  4LUV A;  2YTV A;  4MTN A;  1N32 Q;  2NN6 G;  2R7D A;  4JOI C;  2B2U C;  1LT4 D;  2A69 D;  4JI2 L;  2UXD Q;  3MFY A;  3GTG H;  1UUP A;  3BZK A;  3NBI A;  2ZM6 Q;  5FO8 B;  5FLM G;  4GNX A;  3U50 C;  3GTQ H;  1SR3 A;  3D4R A;  2F1M A;  3PQI A;  4K2L A;  1E2Z A;  2IW3 A;  1EFI D;  4PNY A;  1FNU A;  3LGJ A;  2P5Z X;  4ME3 A;  2IJ0 A;  2WB1 G;  4FXK C;  1SE2 A;  3PIP A;  2QIL A;  4YHH Q;  5ELO A;  3CHB D;  5I9O A;  3K7A H;  4DV4 Q;  3KK7 A;  3S14 B;  1F2M A;  1Z6H A;  2YV5 A;  1EIY B;  4J6H A;  1ZKO A;  1TWG B;  3ONA B;  4DV0 Q;  4RGT A;  2B29 A;  3UDI A;  1FD7 D;  1XTD A;  2A6H D;  4C3H H;  1YJW A;  4K0K L;  1MHW C;  1RDP D;  4HMI A;  1BNZ A;  2C9O A;  4GLX A;  1CKN A;  5JJK A;  3TEH B;  3R3O A;  4JI5 Q;  1LTS D;  3OOC A;  1VQ6 A;  4FF1 A;  2M2L A;  1HUM A;  5C4J B;  3I2Z A;  5KNB A;  3L7Z C;  3L0O A;  4V0B A;  3V05 A;  3RR5 A;  5GAG C;  1JWS D;  4FYD A;  5CBA E;  4K5X A;  1N34 Q;  1AEX A;  2NZO A;  1V43 A;  1LM0 A;  4HJA A;  4KJN A;  4IUT A;  5M3M H;  3KF8 A;  1LTT D;  2L55 A;  4A76 A;  1HFG A;  1L1O B;  4BY1 H;  1K3B C;  3S1Q B;  5K5P A;  3CQZ B;  4KD3 A;  3U4Z A;  4L5R C;  5DAU A;  1SYE A;  1TS5 A;  2CQA A;  4A3I H;  4ILW A;  3A7L A;  4MZ9 A;  2G9D A;  1Q86 C;  4WOR A;  1SBB B;  1UEB A;  4A3B G;  4TQU S;  3OIQ A;  3RLF A;  4DNT B;  2QA4 A;  2SNM A;  1EYA A;  4A3K G;  2JEB I;  1A2U A;  3KF6 A;  2XSC A;  4LMQ D;  4DAM A;  2R92 G;  1UNS A;  4IUN A;  3U9S A;  3E3X A;  1JWM D;  2Q8I B;  1WTP A;  3MVV A;  1HTL D;  1PTO F;  4K5W A;  3JAM L;  1YHB A;  5LMN L;  3BU2 A;  3FEW X;  1GUO A;  2JA5 B;  1N36 L;  3HOY G;  3SEB A;  1HA5 A;  5IYD H;  1D7Q A;  3ITP A;  1SFO B;  2UUC L;  1RL2 A;  1RCV D;  3UDF A;  2Z4I A;  2H5X A;  4LW1 A;  1B44 D;  1JB7 A;  1PH8 A;  2EYP A;  3E0J A;  4BS9 A;  4L5T A;  4GOP B;  1N8R C;  2EJM A;  5M5W H;  3BS1 A;  1FGU A;  2D2C C;  5EJW A;  4DAY A;  4EQ5 A;  2JA8 G;  1AW7 A;  5KYI A;  3EQL C;  3IL8 A;  3MXU A;  3OWF A;  4KI0 A;  4RG1 A;  4XDX A;  4G7H C;  1K8O A;  3TRE A;  4LFA L;  2A5H A;  2NYZ D;  2PQA B;  4KMU C;  1STE A;  3A54 A;  3NEL A;  4BBR B;  3CRK C;  3GTL H;  3CCM A;  3DWQ A;  1VQI A;  3OMG A;  2MJ8 A;  2ZXO A;  1QUQ B;  2R7F A;  2E2I H;  1IKM A;  1PHJ A;  3TS0 A;  1HR0 W;  1XX8 A;  1CKM A;  4DNI A;  1CSQ A;  1HPC A;  5IGC A;  4L8J A;  4DR3 L;  3HKZ B;  1U4P A;  3NBH B;  3P75 A;  3D4W A;  2JJQ A;  2KHI A;  2F0J A;  4E6I A;  2FIN B;  4HJ8 A;  1XMQ L;  4HIK A;  2ZTE A;  1TII D;  3C46 A;  4DR1 L;  4GN4 B;  2RHS B;  3T51 B;  1EY0 A;  5CV7 A;  1L0X B;  3J81 E;  2VUM G;  3HOV G;  1YI2 A;  1HR0 Q;  1UWV A;  1PRT B;  1K8G A;  2E74 C;  2EYH A;  1A8V A;  4LF9 L;  1TWC B;  2B63 B;  3S1R B;  3OMC A;  4R4T A;  5LMU L;  5FO7 B;  3J80 c;  3K59 A;  1P16 A;  1GUT A;  4A3K H;  1KC8 C;  4A3D B;  1D1I A;  3DWA A;  5I2X A;  2HCC A;  1CA5 A;  1OTC A;  2R93 H;  2E8G A;  2E2H H;  1IW7 D;  4OWW B;  1QVG A;  1Q3L A;  2BH2 A;  2EZV A;  4JG2 A;  1VQA A;  1AE3 A;  4XT3 B;  3BZD B;  2A73 B;  2B39 A;  1MBY A;  4KY7 A;  2B2V C;  5FLX c;  2VNU D;  1Y1V G;  1IBK Q;  1TXY A;  4CDE C;  4JCV E;  3CC7 A;  3BVM A;  3FRP B;  3TP5 A;  4JVZ A;  1G51 A;  4WFN 3;  2MFI A;  4DV1 L;  2JA7 H;  1CSP A;  1CQV A;  4LF5 Q;  1OXX K;  1STB A;  5JAV A;  1XWE A;  2DGY A;  3CCV A;  1I6H B;  2AHO B;  2EXD A;  1EY4 A;  3EIV A;  2L1B A;  4IO9 A;  2Z4H A;  3NPP A;  3SHL A;  5IT9 L;  2ALY B;  1ONL A;  3W2D A;  1JJ2 A;  4LF6 L;  2NVT H;  3PO3 B;  3J7A F;  1A3T A;  4ZQ3 A;  3VYR A;  1MSG A;  4RGO S;  1QIL A;  1C48 A;  3W5O A;  2OCE A;  1MGS A;  3A8I E;  3GQB A;  4MN3 A;  3K5N A;  4X62 Q;  4X3U A;  4KKT A;  1VQP A;  1LTL A;  3T16 A;  4AYB B;  1Y1W B;  1EYC A;  3K0X A;  1Y8P B;  2F0V A;  2VQF L;  4RMF A;  1V9P A;  1ILQ A;  2Q8T A;  2F0F A;  2NBF A;  1U4M A;  2WFW A;  1J8I A;  3PCO B;  5CR3 A;  1XPU A;  1HQM C;  1WTV A;  2PZW A;  3M3Y B;  1QVF A;  2K32 A;  1SEB D;  1X54 A;  4AH6 A;  4I7Z C;  2AKW B;  5M3F B;  1SE8 A;  2MO1 A;  1BXT A;  2PMZ E;  4C56 C;  5C3E B;  4JYA Q;  4JI4 Q;  1QVC A;  2BCO A;  4UAI A;  2PYK A;  3CCE A;  4X64 Q;  4LF4 Q;  1TQO A;  5A2Q E;  5K36 G;  3A8K E;  4LNQ A;  3S16 H;  3HGB A;  5DM6 3;  1JC7 A;  2IL8 A;  1MSH A;  4BY7 B;  1GXD C;  4XIG S;  5H1S E;  2K6A A;  1BUV T;  4X3T A;  1AH9 A;  2I5M X;  1H9K A;  5IGG A;  4R4Q A;  1I4P A;  3H3V H;  3PIO 3;  4LFB Q;  4P75 A;  1SDF A;  3HOZ G;  3JAM i;  1B9M A;  1ZXT A;  5C4X B;  2J4X A;  3ND8 A;  2FHT A;  4UP9 A;  1D5M C;  4S3S A;  1PH9 A;  3E5S A;  2EYL A;  5CV8 A;  5KND A;  1LTR D;  1U0L A;  2B2Y A;  2PNR C;  4BA1 I;  5C44 G;  4R8N A;  1SN8 A;  1EEF D;  1LUZ A;  3HZX A;  1BO0 A;  3FKI B;  1DJR D;  1DOK A;  1V1P A;  2A6E D;  5D3I B;  3S14 H;  1RF2 D;  4QY7 A;  1IBM Q;  4AQY Q;  1E2W A;  1HTP A;  2KA7 A;  4LAA A;  2F0U A;  4IQZ A;  3HOU B;  3CC4 A;  3K5L A;  2BDO A;  1HZA A;  3Q22 A;  4GZY C;  2VY3 A;  4H13 C;  1I94 Q;  1PVO A;  1GJX A;  4HSV A;  1PZI D;  4K2K A;  4RHS A;  3VA7 A;  3KDF A;  1B1Z A;  1BVS A;  2XRS D;  1NNX A;  2MGS A;  1IBL Q;  1WCM G;  3QIA A;  1AZP A;  3KLS X;  4CKC A;  2F52 A;  2EYJ A;  4OX9 L;  1PRT D;  3F2B A;  3IFT A;  5C4J H;  3I55 A;  4DGZ A;  1A2T A;  2L12 A;  2JN4 A;  2CH4 W;  1GO3 E;  3GTJ B;  4HCS A;  4A3C H;  4JW0 A;  2F0T A;  4JI6 L;  1G8Z D;  1BF4 A;  2QF7 A;  3NWT A;  3BDO A;  4DXG A;  3G6E A;  3AFQ A;  1ZYR D;  4X66 Q;  1J5E Q;  3G7L A;  3S1Q H;  1R4Q B;  3KLS A;  2E75 C;  3CQZ H;  2CVR A;  1Z7T A;  3L9A X;  2RDG A;  2ZTC A;  1KDB A;  3VR3 A;  4GOP A;  5J39 A;  1PFB A;  4A3J G;  3RMH A;  2AUJ D;  1YVC A;  1T5E A;  2A68 D;  3PSI A;  5TSS A;  3D4D A;  4A3D G;  1A3U A;  5L37 A;  4G57 A;  3S1N H;  3C3L A;  5EQ0 A;  4YCW A;  2A74 C;  2F4V Q;  2B8G A;  4C3J G;  2Q2I A;  4DV5 L;  4IFD H;  2JA5 H;  4XQN A;  2PPB C;  5IYC H;  4DR4 Q;  1PTO C;  4IPD A;  4DUZ Q;  1NR4 A;  3A7A B;  4K8J A;  1GUG A;  4H0L C;  1SFO H;  1QUQ A;  4CJ0 B;  3G48 A;  4OO1 H;  3FHW A;  1S5F D;  4KHP L;  2UXB Q;  3OSO A;  1EIG A;  1YBY A;  4ZUJ A;  5EPL A;  2ZJQ A;  3ICE A;  3NBH A;  4LF7 Q;  4LF8 Q;  2EPB A;  4A3M G;  4JI0 Q;  3KYH C;  1XTC D;  1MKH A;  4DV7 L;  3SVM A;  4P71 A;  3L2P A;  1HNW L;  1D5Z C;  3M7N A;  2DY7 A;  5C4H A;  2H1E A;  3ULJ A;  1WTW A;  1E22 A;  4JI3 Q;  5COY A;  4BBR H;  1ET9 A;  3AYH B;  1JJG A;  2QGQ A;  5ELC A;  2CWA A;  2NZH A;  5JEA H;  3MEF A;  3GTM B;  1TS2 A;  2G9H D;  4HID A;  2LMC B;  1FR3 A;  2YTY A;  2MQH A;  4IUV A;  1Y1W G;  2CH4 A;  1JOR A;  2NTS A;  1O78 A;  1BR9 A;  2VQE Q;  3PF4 A;  1LAB A;  1I5F A;  1KDA A;  3BDC A;  4JK1 C;  3HFZ B;  4L63 B;  4TSS A;  1SNP A;  4IJH A;  4UHV A;  1X32 A;  1SRO A;  1X3P A;  1VQB A;  2ZXR A;  5M3F G;  1PH7 A;  5C3E G;  1K73 C;  2VS1 A;  3R2T A;  4ULL A;  2CKZ B;  3C2P A;  2XN9 C;  1OXV A;  1UE1 A;  4H02 A;  1DZ1 A;  1VQC A;  4Q5V A;  1PLF A;  3S24 A;  5BN5 A;  5E3F A;  1LV9 A;  1MIU A;  2OWO A;  3PF5 A;  4BY7 G;  1VQF A;  1K8A C;  1TWC H;  1VQJ A;  1OXS C;  2MP1 A;  2B63 H;  3KBX A;  1DOM A;  4IFD I;  2VZA A;  4WJW A;  2MUY A;  3I4O A;  3S1R H;  3G4S A;  1N33 L;  2Z6K A;  3I70 A;  1LTI D;  1U4R A;  5JVG 3;  3P1H A;  3ULL A;  3HG9 A;  4PV1 C;  3S9W A;  1PV4 A;  3KFU A;  4A3D H;  1IHZ A;  5EPJ A;  4CDC C;  3CU7 A;  4OO1 I;  3J80 L;  1JE4 A;  4DR6 Q;  1N32 L;  3MA2 B;  2E76 C;  1S4Z A;  3UI2 A;  1EZ6 A;  3E6Z X;  4A3E B;  5GAH C;  3MXN B;  2HDL A;  4YY3 Q;  1YJ9 A;  4K6L A;  3EA6 A;  1E7Z A;  2X6L A;  1JQY D;  4ZCK A;  1IZ6 A;  5ELE A;  2BE5 D;  2ICI A;  4BY1 G;  3QG1 A;  1N9W A;  2IX0 A;  4JV5 L;  2A6H C;  2SEB D;  1B8A A;  4DAV A;  4DA2 A;  2EIF A;  2I0Q A;  2R3Z A;  3FKI G;  4A3I G;  1QWY A;  4L5S A;  2K5N A;  4ZAI A;  1PRT F;  1UE5 A;  1R9T B;  1EQT A;  1SYB A;  3CD6 A;  5FLX L;  3DEO A;  2JP1 A;  3OPO A;  1K3R A;  2JA9 A;  3BVZ A;  2IX1 A;  1I6H H;  3DXJ C;  5LL6 X;  4UDU C;  4RFB A;  1X55 A;  3VR6 A;  2FXQ A;  1H95 A;  1LT6 D;  4YCV A;  4MNO A;  4B3S L;  4JI1 Q;  5IP9 H;  3PO3 H;  4A3G B;  4NW2 A;  2NVX B;  5IYD G;  1DCZ A;  2F0L A;  3MAQ A;  5M9O A;  2KJX A;  5CC4 A;  1KNE A;  1GVP A;  5E4W C;  3SE0 A;  3OTO L;  1E3P A;  4FF3 A;  1Y1W H;  2RBM A;  3PO2 B;  3BZC A;  2AWN A;  4OIK A;  1PFN A;  4BBS H;  1X3E A;  2WV6 D;  3RZD B;  3UDX A;  4GKK Q;  1H9S B;  1CM9 A;  2J7Z A;  3S2D B;  1JMC A;  3VYS A;  2R6G A;  2N55 A;  3D6C A;  3RZO B;  2MHV A;  4IJL A;  4KY6 A;  3M3Y H;  1QOH A;  5M3F H;  5C3E H;  3PIO A;  2Z9H A;  1GHJ A;  4R9W A;  4OL7 A;  4F88 A;  4A3L G;  5IE8 A;  4Y52 H;  2F4I A;  1VQ7 A;  4CDD C;  3JC6 6;  5FO9 B;  4Y7N H;  3M7G A;  1S3O A;  2F03 A;  1V1O A;  4BY7 H;  4L5Q A;  2XIW A;  2Y0S B;  2AQ1 B;  2Z1C A;  2DJF C;  5CGK A;  5T1I A;  1HCZ A;  1QG7 A;  2ID0 A;  2K01 A;  1F9P A;  1EIF A;  2GN5 A;  5EBC A;  4QL5 A;  3KOJ A;  4LWC A;  5IIF A;  4DR7 Q;  4MTK A;  2F3W A;  1XMO L;  2V4D A;  2ES2 A;  4QJF A;  3STB D;  3J81 c;  1VQ8 A;  1KAB A;  3BJU A;  5C4X H;  4KHV A;  4JI2 Q;  4ZLT F;  1B53 A;  2A8V A;  1YIJ A;  5AJ3 Q;  4XTC S;  1L0W A;  1EUJ A;  2RF4 A;  3FKI H;  2QDL A;  4ALP A;  1VMP A;  1KRT A;  1ENF A;  4NKL A;  4PZ7 A;  4DV2 Q;  2E5L L;  4M8A A;  2L5T A;  1HZB A;  1VQ4 A;  1D6E C;  3HOU H;  2L11 A;  2HT1 A;  4YWL A;  1CZW A;  3N52 A;  1GUS A;  3S1N B;  4B3M Q;  2R93 G;  5EKL A;  1M8A A;  1KNA A;  2HIV A;  1CT1 D;  1AFP A;  1E1O A;  2B2W A;  3NWS A;  2K05 A;  3EJI A;  1KLG D;  3KJO A;  4DR2 L;  2LFN A;  5G3L D;  3HP3 A;  3CRL C;  4K8I A;  1V8Q A;  2K5Q A;  3H15 A;  1X56 A;  2K5H A;  2AQ3 B;  1CFM A;  3HKZ E;  3GTJ H;  3NTK A;  3AEV A;  1CZG A;  2XTI A;  1PH1 A;  3BDL A;  2JK8 A;  3S15 B;  1WJJ A;  2JA7 G;  3PUZ A;  4TRD A;  3RLO A;  3CMA A;  4IUR A;  1K9M C;  1OO9 B;  4N9P A;  1CI3 M;  5JPM C;  1Z9F A;  5KEE A;  3KUP A;  3HOX B;  1UAP A;  1VQE A;  1BCP C;  2D9U A;  2HQL A;  1PYS B;  1PDQ A;  1AN8 A;  4A3F B;  3EBE A;  4ZYS A;  2G5D A;  4C3I B;  5KIX A;  2JA6 B;  1O7Z A;  4GKJ L;  2EJG C;  1HNZ L;  4A3L H;  1G6P A;  1HH2 P;  2ATW A;  5C0X H;  3VDY A;  1IYJ B;  4XT1 B;  1G2T A;  3C1F A;  5COR A;  3CXC A;  1M90 C;  5ELD A;  1XNQ L;  4B3R Q;  3GV6 A;  2HUG A;  2B2Y C;  4DKA C;  2WKC A;  1HJP A;  2OF1 A;  5CBE E;  5C3X A;  3BYY B;  3TDQ A;  5IWA Q;  1JR0 D;  1NR2 A;  3J80 i;  5LL6 S;  4JC0 A;  1TT2 A;  1Q82 C;  3T4A C;  2X6G A;  3QO2 A;  3T1H L;  5EPK A;  1MI2 A;  2EOT A;  2UUC Q;  3I4M B;  1A0I A;  1X3G A;  1IKL A;  1O7Y A;  4JI7 Q;  2X69 A;  2RVL A;  4LF5 L;  4HJ7 A;  4EX5 A;  3CCJ A;  1DOL A;  1TVX A;  1FJG L;  1Q1B A;  1HFN A;  1A6X A;  4IPG A;  3U9O A;  1Y8O B;  5GRO A;  1SYD A;  1VS0 A;  1S5C D;  2QEX A;  3GTM H;  3AFP A;  3DHQ A;  4P2C B;  1I4R A;  3BYT B;  3K6O A;  2O4X A;  3PO2 G;  1I3Q B;  3NTI A;  5M5X B;  4HJ5 A;  1TKW B;  1RHP A;  1YIT A;  3SK5 A;  4X62 L;  3ULP A;  2AQ2 B;  5IYB H;  4R4O A;  1B70 B;  4FXG C;  3Q6S A;  3S1M B;  2I5H A;  4AYB E;  5CV6 A;  4NDX A;  4GOP C;  2OTL A;  2F3I A;  1DXM A;  3F2D A;  2F0K A;  3GDE A;  3MXN A;  1JOK A;  2I5L X;  4RKL A;  4CHT B;  2KQ3 A;  1XMQ Q;  1HZ9 A;  3D8G A;  3DMU A;  2KHS A;  2IX3 A;  2WP8 J;  4DNR B;  4HIO A;  1IL2 A;  5C0X I;  3MTS A;  4WJ3 M;  2O5J C;  1E1T A;  3QOJ A;  4O2D A;  2RHQ B;  4ABN A;  4XQQ A;  4JI4 L;  1WTR A;  1YNJ D;  3HRZ C;  4K6D A;  1MJE A;  1EOV A;  1EWH A;  1W6J A;  2XRQ D;  5F2D A;  4X65 Q;  1LTB D;  4X64 L;  4UP7 A;  5KYL A;  1K83 B;  3C1E A;  1SNQ A;  4LUZ A;  4IPH A;  1SRU A;  1C8C A;  3PGZ A;  3TRZ A;  2HCI A;  3PMF A;  4YWM A;  1WI5 A;  1W6K A;  4LF9 Q;  3ERO A;  1ROD A;  4A3C G;  4UP8 A;  1NUC A;  5LMU Q;  1YNX A;  1EY5 A;  4BBS B;  4A3E H;  3T1Y L;  2MO0 A;  1F9S A;  3M9B A;  5IP7 H;  1F2Y A;  2ZT9 C;  3UDG A;  2VB2 X;  3H09 A;  5JVH 3;  1BOS A;  3VR4 A;  4NXM L;  4DUY L;  4HAE A;  3ERS X;  3D31 A;  1I50 B;  4DV6 L;  2NWG A;  2R7Z B;  2UU9 L;  2RQX A;  2IPK D;  5G3L F;  1R9T H;  3F2C A;  2LY7 A;  4PMC A;  3ND9 A;  4QUC A;  3NE5 B;  1TU2 B;  3GTK B;  4HIM A;  3IRB A;  1U9R A;  4TKO B;  1DM0 B;  2IT1 A;  3RN5 A;  4Y7N B;  3CW2 C;  5ISR A;  4DV1 Q;  2ENB A;  3LWU A;  5BN4 A;  4DR5 L;  4IFD G;  4A3G H;  2C35 B;  3K8A A;  2JA5 G;  2NVX H;  5IYC G;  1EWC A;  1F9R A;  3HOW B;  4CKB A;  1VF7 A;  1PZJ D;  3P20 A;  4B3T L;  1LAC A;  3NHH A;  1VMC A;  2XGT A;  4OO1 G;  3I73 A;  3B6Y A;  4KKU A;  4V19 0;  1SNM A;  4XYQ A;  3PO2 H;  2UUA L;  4KHZ A;  3NTH A;  2RCF A;  3I4L A;  4KN4 C;  3RZD H;  1S40 A;  1JWU D;  3S2D H;  1TS3 A;  2O5I C;  5EAY A;  3I7F A;  4FNF A;  4XYO A;  1T9H A;  2K4K A;  3TP8 A;  1JE5 A;  3RZO H;  1PTO B;  1EL0 A;  2E2J B;  3NQI A;  3I4N B;  2F0W A;  1CK1 A;  1UEA B;  5ELN A;  4BBR G;  3OYY A;  2ZJP A;  1TWF B;  4G7O C;  1QNK A;  3K80 C;  5JEA G;  4DV3 Q;  3QWN A;  2EXZ A;  1L1O A;  2F3V A;  3PUV A;  2Z0S A;  1Q12 A;  3HKZ G;  5BR8 L;  4KV6 A;  1STH A;  2QEJ C;  4JBM A;  3K57 A;  1KDC A;  3CCU A;  1ZEQ X;  2FMC A;  5HGT A;  2PO4 A;  5JJZ A;  3H91 A;  4JBK A;  5J22 A;  4KN7 C;  1OXU A;  3CCS A;  3RUZ A;  1SNO A;  4DR4 L;  2QKI C;  1HXY D;  5C4Z A;  1KAW A;  5I9P A;  4DUZ L;  3URY A;  2UUB Q;  3I4M G;  4KJO A;  3R8B A;  1X6O A;  2N78 A;  5J3B A;  2KCN A;  1TWH B;  1RD9 D;  3NK9 A;  1CKO A;  1E24 A;  2MPM A;  4LF7 L;  2Z8L A;  4F7X A;  1QNU A;  1AZQ A;  4POG A;  3CCR A;  5HY6 A;  4ZKC B;  1EY6 A;  2OT2 A;  2B63 G;  4JI8 L;  4OIJ A;  3IFD A;  1SMY D;  1KXL A;  4GNX C;  1ML0 D;  4NXN L;  3V96 A;  2FJ2 A;  2WB1 B;  1D2B A;  2GA4 B;  3G6J B;  4MIU A;  3TN2 A;  1EY7 A;  2LXK A;  2NZ1 D;  4RCO A;  2PQA A;  1YZ6 A;  1O7I A;  2DJG C;  3VA5 A;  1MJC A;  3D3R A;  1PH4 A;  3CKI B;  3PUW A;  2BH8 A;  3EVQ A;  1TS4 A;  3Q23 A;  2B2T A;  1GUN A;  1F77 A;  5I4D A;  4OEM B;  1SLJ A;  3I91 A;  2CW0 C;  2Z6B A;  2CHB D;  4UY8 C;  1JOO A;  3Q24 A;  4OX9 Q;  2MNA A;  3S15 H;  1EQV A;  4FF4 A;  4PMW A;  1RTN A;  3KLW A;  1PYW D;  4DAY B;  3MC0 B;  2DN8 A;  4JI6 Q;  3U4V A;  1A62 A;  4PZ8 A;  1VQG A;  2DNC A;  3HOX H;  3I3C A;  3ER0 A;  1E0B A;  2VL6 A;  5IP9 G;  4A3F H;  1HNX Q;  3PO3 G;  1JIC A;  5E4X A;  3GTO B;  4C3I H;  4BWG B;  1KD1 C;  4X3S A;  2JA6 H;  2HD3 A;  1B3Q A;  2DUD A;  3QB3 A;  2R61 A;  2PQE A;  4QUF A;  1KIX A;  3HKS A;  2UXC Q;  2FMM A;  4AYB G;  4QF4 A;  3RLN A;  1J6Q A;  4BBS G;  1LTG D;  2F0S A;  1WTX A;  4QGU A;  1PFS A;  2JEA I;  5D65 A;  1LYL A;  1VQM A;  1QZG A;  4DR6 L;  2HHH L;  3UE0 A;  3SR1 A;  3H0G H;  4A3B B;  2YYZ A;  3TZD A;  1B9N A;  4DV5 Q;  2R92 B;  2ASB A;  2PNH A;  1SAP A;  3OW2 A;  3HS0 C;  3JAM E;  2B3G A;  4F87 A;  3I4M H;  3DEP A;  1Q46 A;  5C5L A;  3R93 A;  2A69 C;  3J7A 5;  1BDO A;  4KHP Q;  4PG3 A;  3HOY B;  3A0J A;  1PH3 A;  2HDM A;  1XNR Q;  2A19 A;  4NP5 A;  2AWO A;  1C7Y A;  4N8X 1;  5A2Q L;  3TBI B;  4DK0 A;  4DU9 A;  4LFC Q;  3PUX A;  1WTO A;  3HOW G;  4DV7 Q;  4HJ9 A;  1HNW Q;  1NMG A;  2RCN A;  4EQO A;  1J9O A;  4OGQ C;  1ENA A;  2JA8 B;  1SMX A;  4C2M B;  4TVA B;  1YHQ A;  2A1A A;  5HGQ A;  1ESF A;  1I3Q H;  5M5X H;  5C4X G;  1CHP D;  2EYM A;  2RDH A;  2UXD L;  1NY4 A;  2HQE A;  3N6R A;  2ZM6 L;  4MHE A;  4CJ2 C;  5FK9 C;  1GD7 A;  2KUM A;  1LO5 D;  4JBJ A;  3S1M H;  5JJL A;  2CFM A;  3I4N G;  3S17 B;  3K81 C;  3OW7 A; 
#chains in the Genus database with same CATH homology
 2XWJ B;  5IGF A;  4FXD A;  5IGE A;  1PFM A;  1ET6 A;  2KOL A;  3LWE A;  4JBW A;  4A93 B;  4CBV A;  2F0Q A;  1I4H A;  1EU4 A;  1HUN A;  4HN7 A;  2EY5 A;  3SK6 A;  2EJF C;  4B08 A;  5DM7 3;  1Q8I A;  4HSP A;  2K5D A;  4DXF A;  2ZXP A;  4K5V A;  3MHB A;  1DON A;  4KKS A;  3HOV B;  2VUM B;  5D14 A;  1TWA B;  2EDG A;  2DY8 A;  2F0P A;  4IFD J;  1JCK B;  3ZYY X;  1H9M A;  3PUY A;  4IUQ A;  2K1B A;  4CJ1 B;  2KED A;  1RTO A;  3DUZ A;  5EBD A;  1NSN S;  5C0X G;  2K7V A;  2IWH A;  2NVY B;  4YIJ A;  2BDN A;  3KLR A;  1Y1V B;  5DEH A;  2YU9 B;  2SNS A;  3LNN A;  1BCP B;  3WOE A;  1QCB D;  2ICE C;  4H7B A;  5JEA J;  3GTP B;  1VF5 C;  1H9J A;  1X3Q A;  3FVQ A;  3H6M A;  1YNN D;  5IT9 E;  4HED A;  3M4O B;  2K04 A;  3J7Y W;  3M4Y A;  3DWP A;  3A55 A;  1SNC A;  4EQN A;  5IOD A;  3WDN A;  4RA8 A;  2WKD A;  1PTO H;  1V1P B;  5C3W A;  4Q0F A;  1RJT A;  1PZK D;  2NVQ B;  2RDF A;  3GO5 A;  5KGU A;  4B9W A;  1S5E D;  3AMU A;  2XNA C;  3SK8 A;  1L0Y B;  4O42 A;  3H3V C;  2JXM B;  4IUP A;  4RGN A;  2I46 A;  4WRD A;  1CTM A;  1I6V C;  1U4L A;  4I65 A;  2WAQ B;  1MD2 D;  4G7Z C;  1TR5 A;  4DAP A;  3I72 A;  3OWE B;  4NMZ A;  1Y69 U;  1ICW A;  2NN6 H;  2RA4 A;  5AFW A;  4ZKB B;  3HOZ B;  1IW7 C;  1R4P B;  1ENC A;  3W3A A;  1ILP A;  1Z47 A;  4ME5 A;  4KD4 A;  2L4N A;  1DD2 A;  3FDT A;  5C6A A;  1LTA D;  1TY0 A;  1A15 A;  1B2T A;  5C44 B;  1II3 A;  1G29 1;  5JOB A;  4ZUI A;  1WD1 A;  2L0C A;  1FYC A;  1LT3 D;  3Q0A A;  2BA0 A;  4C1N I;  1EU3 A;  3H0G B;  3OHX C;  1WD0 A;  2JYO A;  3SK4 A;  2B8F A;  2SDF A;  1H9R A;  1YNJ C;  3IKJ A;  5D3D A;  3NUC A;  5ELF A;  2EYF A;  3VR5 A;  3GP7 A;  4J1M A;  1WCM B;  2D5D A;  2NUC A;  1EY9 A;  4F8M A;  2EY1 A;  1S5B D;  2H4O A;  1RKN A;  3NQT A;  1Q1E A;  3I8Z A;  1XXG A;  2B2U A;  1SE3 A;  1VCI A;  1HA6 A;  2TSS A;  5I2Y A;  2LKV A;  2BOS A;  4KTA A;  1JB3 A;  1HQR D;  1GOZ A;  4QCL A;  4DN4 M;  5CV5 A;  1LT5 D;  1GUW A;  2L9H A;  2EE1 A;  3MFG A;  4A3J B;  4RWS C;  2NN6 I;  2EVB A;  4RHR A;  3X3M A;  2K28 A;  2JE6 I;  1BCP D;  4C3J B;  3S2H B;  4N9T A;  4DF7 A;  1B3A A;  3K5O A;  1ESR A;  1SJH D;  2F0M A;  4R8I A;  2B2T C;  4HMJ A;  5FKA C;  4LJZ C;  2VB3 X;  2BA1 A;  1LLR D;  4IN3 A;  2A6E C;  4A3M B;  4RAU C;  2E2D C;  4U67 3;  1G91 A;  4HCE A;  2O2L D;  5T1G A;  2JSO A;  2F0H A;  4IAL A;  5HUR A;  1NAP A;  4KY5 A;  1DYQ A;  3GTG B;  1WVL A;  4HR7 B;  1HRJ A;  2D62 A;  4FVM A;  3GTQ B;  3A8J E;  4CGY B;  1PRT C;  1H9S A;  3MXG A;  4K14 A;  1EIH A;  3TZU A;  1B50 A;  1EOT A;  1TY2 A;  3T56 B;  3FPU B;  2PZT A;  3IAY A;  3AB9 A;  3K7A B;  4QB4 A;  1ZYR C;  3EFX D;  3RD4 A;  4OHJ A;  1QB5 D;  1E2V A;  1STY A;  2F0E A;  5C0X J;  3BG3 A;  4U68 A;  4C3H B;  3LX0 A;  3T13 A;  3T53 B;  3PIP 3;  4FP5 D;  5FOB B;  1STG A;  4DFA A;  3R2I A;  1G6Z A;  2FFK B;  1SMY C;  5NUC A;  4M1U B;  2A68 C;  3J7A V;  1GHK A;  3D6W A;  1CA6 A;  5CV9 A;  3J80 E;  4ZRZ A;  4LK1 C;  4C3I G;  1A3V A;  2EY6 A;  4L6T B;  3FPP A;  3TME A;  1D1K A;  3OIP A;  5M3M B;  2PMZ B;  1NCV A;  4C1N K;  1EEI D;  2RSN A;  4BY1 B;  2KEC A;  1SYF A;  2PZU A;  5KNC A;  3PV0 A;  4A3I B;  5FLX E;  2K5W A;  1SND A;  4G4K A;  1F2L A;  1QE6 A;  1JOQ A;  1BBX C;  4BA2 I;  2KVM A;  5CMD A;  2KEE A;  4X3K A;  3TP7 A;  1KAA A;  1C4Q A;  4HTH A;  3MEH A;  5E1F A;  5IGB A;  3J81 L;  3MZ5 A;  1B4O A;  2PW5 A;  1OXT A;  1XYI A;  3WOF A;  4RKB A;  3TSS A;  2RSO A;  4PQX A;  4EQP A;  3L3O C;  3VR2 A;  4XXE A;  2SOB A;  2F0D A;  5M5W B;  1SJE D;  2OEO A;  2M9V A;  2WII B;  1BCP F;  1S5D D;  1IYV A;  3SXH A;  4Z9C B;  2B2V A;  1M4V A;  3P7J A;  5EKK A;  4QMG A;  3GTL B;  1CHQ D;  5CYU A;  3DM1 A;  1F9Q A;  4H44 C;  2E2I B;  5C5M A;  2WAC A;  4RCN A;  5K36 H;  2KCC A;  1FNV A;  3K5M A;  4XQJ A;  4ODG A;  1I4Q A;  1FNW A;  1KTK A;  5A35 A;  3NP8 A;  1PMR A;  2WIN B;  2K33 A;  1D5X C;  2BE5 C;  5DNF A;  1IL8 A;  3M85 A;  2N88 A;  3H94 A;  3K0Y A;  1EY8 A;  2AUK A;  4ZK9 B;  1O80 A;  2NB0 A;  3AU7 A;  1STA A;  3NXW A;  4KK7 A;  2DNE A;  3QOL A;  2C5C A;  1VDZ A;  1Y8N B;  1Q90 A;  4A3K B;  1AP0 A;  5LHY 1;  1K8M A;  1SXT A;  2R93 B;  3ERQ A;  2E2H B;  5CV4 A;  2QCP X;  4ID6 A;  5EKI A;  1F2Z A;  4DK1 A;  4RH6 A;  1SE4 A;  4FF2 A;  1QJO A;  3I90 A;  2B2W C;  3VYU A;  4J8Q A;  1WTQ A;  3TP6 A;  2QDB A;  3GV3 A;  1IYU A;  2F0N A;  3BVG A;  3MWY W;  4IZ8 A;  1SYG A;  1CQF A;  3FMC A;  2EY2 A;  1I4X A;  2JA7 B;  1SYC A;  2F0G A;  2XWB B;  3HEJ A;  5JPN C;  1PTO D;  3A56 A;  2K03 A;  4C3H G;  1EZ8 A;  4FO2 A;  2CW0 D;  2J0T D;  2EYO A;  2NVT B;  3NSW A;  1I4G A;  1G2S A;  4RGM A;  1STN A;  2PW7 A;  1SSO A;  3K58 A;  4PMB A;  1FGB D;  3KBG A;  3MXP A;  4QIW B;  3X3N A;  5I6W A;  2F0I A;  5I6Y A;  2NTT A;  3GD7 A;  1HHV A;  3QJY A;  1YNN C;  2F0O A;  4EGV A;  2I07 B;  5IGD A;  1EYD A;  1PXU A;  3VYT A;  2Q8R E;  2M00 A;  5IOC A;  5J1Z A;  3F2U A;  3O13 A;  4CKE A;  5EGT A;  2XVS A;  2LS0 1;  4O1N A;  1KLU D;  2PCF B;  5M5Y B;  1O7L A;  1BQQ T;  3S16 B;  5ELB A;  3V2T A;  1T5X D;  2RKS A;  4EVO A;  5BN3 A;  3SDZ A;  2VXW A;  5KRU A;  2OXP A;  2TMP A;  4B9X A;  4IUU A;  2NN6 G;  2B2U C;  1LT4 D;  2A69 D;  3MFY A;  1UUP A;  3NBI A;  5FO8 B;  3D4R A;  2F1M A;  4K2L A;  1E2Z A;  2IW3 A;  1EFI D;  4PNY A;  1FNU A;  2IJ0 A;  4FXK C;  1SE2 A;  2QIL A;  3CHB D;  5I9O A;  3S14 B;  3KK7 A;  1F2M A;  1Z6H A;  4J6H A;  1ZKO A;  1TWG B;  3ONA B;  4RGT A;  1FD7 D;  2A6H D;  1RDP D;  4HMI A;  1BNZ A;  2C9O A;  3R3O A;  1LTS D;  3OOC A;  4FF1 A;  2M2L A;  1HUM A;  5C4J B;  5KNB A;  3L7Z C;  3V05 A;  4V0B A;  1JWS D;  4FYD A;  5CBA E;  4K5X A;  1AEX A;  1V43 A;  4KJN A;  4IUT A;  3KF8 A;  1LTT D;  2L55 A;  1HFG A;  3S1Q B;  5K5P A;  3CQZ B;  4KD3 A;  5DAU A;  1SYE A;  1TS5 A;  2CQA A;  4ILW A;  3A7L A;  2G9D A;  4WOR A;  1SBB B;  4TQU S;  3OIQ A;  3RLF A;  4DNT B;  2SNM A;  1EYA A;  2JEB I;  1A2U A;  4LMQ D;  2XSC A;  1UNS A;  3U9S A;  4IUN A;  1JWM D;  2Q8I B;  1WTP A;  3MVV A;  1HTL D;  1PTO F;  4K5W A;  3JAM L;  3FEW X;  1GUO A;  2JA5 B;  3SEB A;  1HA5 A;  3ITP A;  1SFO B;  1RCV D;  2Z4I A;  1B44 D;  2EYP A;  3E0J A;  4BS9 A;  2EJM A;  3BS1 A;  2D2C C;  5EJW A;  4DAY A;  1AW7 A;  5KYI A;  3EQL C;  3IL8 A;  3MXU A;  3OWF A;  4KI0 A;  4XDX A;  4G7H C;  1K8O A;  2A5H A;  2NYZ D;  4KMU C;  1STE A;  3A54 A;  4BBR B;  3CRK C;  3DWQ A;  3OMG A;  2MJ8 A;  2ZXO A;  1IKM A;  1XX8 A;  5IGC A;  1HPC A;  4L8J A;  3HKZ B;  1U4P A;  3P75 A;  3D4W A;  2F0J A;  4E6I A;  2FIN B;  1TII D;  3C46 A;  3T51 B;  1EY0 A;  5CV7 A;  1L0X B;  3J81 E;  1PRT B;  2E74 C;  2EYH A;  1TWC B;  2B63 B;  3S1R B;  3OMC A;  5FO7 B;  3K59 A;  1GUT A;  4A3D B;  1D1I A;  3DWA A;  5I2X A;  2HCC A;  1CA5 A;  1IW7 D;  1Q3L A;  2EZV A;  4XT3 B;  3BZD B;  2A73 B;  2B39 A;  1MBY A;  4KY7 A;  2B2V C;  2VNU D;  3BVM A;  3FRP B;  3TP5 A;  4WFN 3;  1CQV A;  1OXX K;  1STB A;  5JAV A;  1XWE A;  1I6H B;  1EY4 A;  2L1B A;  2Z4H A;  3NPP A;  3SHL A;  5IT9 L;  1ONL A;  3W2D A;  3PO3 B;  3J7A F;  1A3T A;  4ZQ3 A;  3VYR A;  1MSG A;  4RGO S;  1QIL A;  1C48 A;  1MGS A;  3A8I E;  3GQB A;  4MN3 A;  3K5N A;  4X3U A;  4KKT A;  3T16 A;  4AYB B;  1Y1W B;  1EYC A;  1Y8P B;  2F0V A;  1ILQ A;  2Q8T A;  2F0F A;  2NBF A;  1U4M A;  1J8I A;  5CR3 A;  1HQM C;  1WTV A;  2PZW A;  3M3Y B;  2K32 A;  1SEB D;  4I7Z C;  5M3F B;  5C3E B;  1BXT A;  4C56 C;  2BCO A;  4UAI A;  2PYK A;  1TQO A;  5A2Q E;  5K36 G;  3A8K E;  3HGB A;  5DM6 3;  1JC7 A;  2IL8 A;  1MSH A;  4BY7 B;  1GXD C;  4XIG S;  2K6A A;  1BUV T;  4X3T A;  1H9K A;  5IGG A;  1I4P A;  3PIO 3;  1SDF A;  1B9M A;  1ZXT A;  5C4X B;  2J4X A;  3ND8 A;  2FHT A;  1D5M C;  4S3S A;  3E5S A;  2EYL A;  5CV8 A;  5KND A;  1LTR D;  2B2Y A;  2PNR C;  4BA1 I;  4R8N A;  1EEF D;  3HZX A;  1BO0 A;  3FKI B;  1DJR D;  1DOK A;  1V1P A;  2A6E D;  5D3I B;  1RF2 D;  1E2W A;  1HTP A;  2KA7 A;  4LAA A;  2F0U A;  4IQZ A;  3HOU B;  3K5L A;  2BDO A;  3Q22 A;  4GZY C;  4H13 C;  1GJX A;  4HSV A;  1PZI D;  4K2K A;  4RHS A;  3VA7 A;  1B1Z A;  2XRS D;  2MGS A;  3QIA A;  1AZP A;  3KLS X;  4CKC A;  2EYJ A;  1PRT D;  3IFT A;  4DGZ A;  1A2T A;  2L12 A;  3GTJ B;  4HCS A;  2F0T A;  1G8Z D;  1BF4 A;  2QF7 A;  3NWT A;  3BDO A;  4DXG A;  1ZYR D;  3G7L A;  1R4Q B;  3KLS A;  2E75 C;  2CVR A;  1Z7T A;  3L9A X;  2RDG A;  1KDB A;  3VR3 A;  5J39 A;  1PFB A;  3RMH A;  2AUJ D;  1T5E A;  2A68 D;  5TSS A;  3D4D A;  1A3U A;  4G57 A;  3C3L A;  5EQ0 A;  2A74 C;  2B8G A;  4C3J G;  4IFD H;  2PPB C;  4XQN A;  1PTO C;  1NR4 A;  3A7A B;  4K8J A;  1GUG A;  4H0L C;  4CJ0 B;  4OO1 H;  1S5F D;  3OSO A;  1EIG A;  4ZUJ A;  5EPL A;  3NBH A;  2EPB A;  1XTC D;  3SVM A;  1D5Z C;  3M7N A;  2DY7 A;  5C4H A;  2H1E A;  1WTW A;  5COY A;  1ET9 A;  5ELC A;  5JEA H;  3GTM B;  1TS2 A;  2G9H D;  2LMC B;  1FR3 A;  4IUV A;  1JOR A;  2NTS A;  1O78 A;  1BR9 A;  1LAB A;  1KDA A;  3BDC A;  4JK1 C;  4L63 B;  4TSS A;  1SNP A;  1X32 A;  1X3P A;  2ZXR A;  3R2T A;  4ULL A;  3C2P A;  2XN9 C;  1OXV A;  1DZ1 A;  4Q5V A;  1PLF A;  5BN5 A;  5E3F A;  1LV9 A;  2MP1 A;  1OXS C;  3KBX A;  1DOM A;  4IFD I;  4WJW A;  2MUY A;  3I70 A;  1LTI D;  1U4R A;  5JVG 3;  3P1H A;  3HG9 A;  4PV1 C;  3S9W A;  1IHZ A;  5EPJ A;  4OO1 I;  3CU7 A;  3J80 L;  1JE4 A;  3MA2 B;  2E76 C;  1S4Z A;  3UI2 A;  1EZ6 A;  3E6Z X;  4A3E B;  2HDL A;  4K6L A;  3EA6 A;  2X6L A;  1JQY D;  5ELE A;  2BE5 D;  2ICI A;  3QG1 A;  2IX0 A;  2A6H C;  2SEB D;  4DAV A;  4DA2 A;  2R3Z A;  1QWY A;  4ZAI A;  1PRT F;  1R9T B;  1EQT A;  1SYB A;  5FLX L;  3DEO A;  2JP1 A;  3OPO A;  3BVZ A;  2IX1 A;  3DXJ C;  5LL6 X;  4UDU C;  4RFB A;  3VR6 A;  1LT6 D;  4A3G B;  4NW2 A;  2NVX B;  1DCZ A;  2F0L A;  3MAQ A;  5M9O A;  2KJX A;  5CC4 A;  1KNE A;  5E4W C;  3SE0 A;  4FF3 A;  2RBM A;  3PO2 B;  2AWN A;  4OIK A;  1PFN A;  2WV6 D;  3RZD B;  1H9S B;  1CM9 A;  2J7Z A;  3S2D B;  3VYS A;  2R6G A;  2N55 A;  3D6C A;  3RZO B;  2MHV A;  4KY6 A;  1QOH A;  1GHJ A;  4R9W A;  4OL7 A;  4F88 A;  2F4I A;  5FO9 B;  3M7G A;  2F03 A;  1V1O A;  2XIW A;  2Y0S B;  2AQ1 B;  2Z1C A;  5CGK A;  5T1I A;  1HCZ A;  1QG7 A;  2ID0 A;  2K01 A;  1F9P A;  5EBC A;  5IIF A;  2F3W A;  2V4D A;  1KAB A;  4KHV A;  4ZLT F;  1B53 A;  4XTC S;  1VMP A;  1ENF A;  4NKL A;  4M8A A;  2L5T A;  1D6E C;  2L11 A;  1CZW A;  3N52 A;  1GUS A;  3S1N B;  5EKL A;  1M8A A;  1KNA A;  1CT1 D;  1AFP A;  2B2W A;  2K05 A;  3NWS A;  3EJI A;  1KLG D;  2LFN A;  5G3L D;  3HP3 A;  3CRL C;  4K8I A;  1V8Q A;  2K5Q A;  2AQ3 B;  1CFM A;  3NTK A;  1CZG A;  3BDL A;  3S15 B;  3PUZ A;  4TRD A;  4IUR A;  1OO9 B;  4N9P A;  1CI3 M;  5JPM C;  5KEE A;  3KUP A;  3HOX B;  1UAP A;  2D9U A;  1BCP C;  1PDQ A;  1AN8 A;  4A3F B;  4ZYS A;  4C3I B;  5KIX A;  2JA6 B;  1O7Z A;  2EJG C;  5C0X H;  4XT1 B;  1G2T A;  3C1F A;  5COR A;  5ELD A;  3GV6 A;  2HUG A;  2B2Y C;  2WKC A;  2OF1 A;  5CBE E;  5C3X A;  3BYY B;  3TDQ A;  1JR0 D;  1NR2 A;  5LL6 S;  1TT2 A;  3T4A C;  2X6G A;  3QO2 A;  5EPK A;  1MI2 A;  2EOT A;  3I4M B;  1IKL A;  1O7Y A;  2X69 A;  2RVL A;  1DOL A;  1TVX A;  1Q1B A;  1HFN A;  1A6X A;  3U9O A;  1Y8O B;  1SYD A;  1S5C D;  3DHQ A;  4P2C B;  1I4R A;  3BYT B;  3K6O A;  2O4X A;  1I3Q B;  3NTI A;  5M5X B;  1TKW B;  1RHP A;  3SK5 A;  2AQ2 B;  4FXG C;  3Q6S A;  3S1M B;  5CV6 A;  4NDX A;  1DXM A;  2F0K A;  3MXN A;  1JOK A;  4RKL A;  4CHT B;  2KQ3 A;  3D8G A;  3DMU A;  2KHS A;  2IX3 A;  2WP8 J;  4DNR B;  5C0X I;  3MTS A;  2O5J C;  3QOJ A;  4ABN A;  4XQQ A;  1WTR A;  1YNJ D;  3HRZ C;  4K6D A;  1EWH A;  1W6J A;  2XRQ D;  5F2D A;  1LTB D;  5KYL A;  1K83 B;  3C1E A;  1SNQ A;  1C8C A;  2HCI A;  3PMF A;  1W6K A;  3ERO A;  1ROD A;  1NUC A;  1EY5 A;  4BBS B;  1F9S A;  1F2Y A;  2ZT9 C;  2VB2 X;  3H09 A;  5JVH 3;  1BOS A;  3VR4 A;  4HAE A;  3D31 A;  1I50 B;  2NWG A;  2R7Z B;  2RQX A;  2IPK D;  5G3L F;  2LY7 A;  4PMC A;  3ND9 A;  4QUC A;  3NE5 B;  1TU2 B;  3GTK B;  1U9R A;  4TKO B;  1DM0 B;  2IT1 A;  4Y7N B;  5ISR A;  2ENB A;  3LWU A;  5BN4 A;  4IFD G;  1EWC A;  1F9R A;  3HOW B;  4CKB A;  1VF7 A;  1PZJ D;  3P20 A;  1LAC A;  3NHH A;  1VMC A;  4OO1 G;  3I73 A;  4V19 0;  4KKU A;  1SNM A;  4XYQ A;  4KHZ A;  3NTH A;  3I4L A;  4KN4 C;  1JWU D;  1TS3 A;  2O5I C;  4FNF A;  4XYO A;  3TP8 A;  1PTO B;  1EL0 A;  2E2J B;  3NQI A;  3I4N B;  2F0W A;  1CK1 A;  1UEA B;  1TWF B;  4G7O C;  1QNK A;  5JEA G;  3QWN A;  2EXZ A;  2F3V A;  3PUV A;  1Q12 A;  4KV6 A;  1STH A;  2QEJ C;  3K57 A;  1KDC A;  1ZEQ X;  2FMC A;  5HGT A;  2PO4 A;  5JJZ A;  3H91 A;  5J22 A;  4KN7 C;  1OXU A;  3RUZ A;  1SNO A;  2QKI C;  1HXY D;  5C4Z A;  5I9P A;  3URY A;  4KJO A;  3R8B A;  2KCN A;  1TWH B;  1RD9 D;  3NK9 A;  2MPM A;  2Z8L A;  4F7X A;  1QNU A;  1AZQ A;  4ZKC B;  1EY6 A;  2OT2 A;  4OIJ A;  3IFD A;  1SMY D;  1ML0 D;  3V96 A;  2FJ2 A;  2WB1 B;  1D2B A;  2GA4 B;  3G6J B;  4MIU A;  3TN2 A;  1EY7 A;  2NZ1 D;  4RCO A;  3VA5 A;  3D3R A;  3CKI B;  3PUW A;  3EVQ A;  1TS4 A;  3Q23 A;  2B2T A;  1GUN A;  1F77 A;  5I4D A;  3I91 A;  2CW0 C;  2CHB D;  1JOO A;  3Q24 A;  1EQV A;  4FF4 A;  4PMW A;  1RTN A;  1PYW D;  3MC0 B;  2DN8 A;  2DNC A;  3I3C A;  1E0B A;  1JIC A;  5E4X A;  3GTO B;  4BWG B;  4X3S A;  3QB3 A;  2R61 A;  2PQE A;  4QUF A;  2FMM A;  4QF4 A;  1LTG D;  2F0S A;  1WTX A;  2JEA I;  5D65 A;  3SR1 A;  4A3B B;  2YYZ A;  3TZD A;  1B9N A;  2R92 B;  1SAP A;  3HS0 C;  3JAM E;  4F87 A;  3DEP A;  5C5L A;  3R93 A;  2A69 C;  1BDO A;  3HOY B;  2HDM A;  4NP5 A;  2AWO A;  5A2Q L;  3TBI B;  4DK0 A;  4DU9 A;  3PUX A;  1WTO A;  4EQO A;  1J9O A;  4OGQ C;  1ENA A;  2JA8 B;  4C2M B;  1ESF A;  1CHP D;  2EYM A;  2RDH A;  2HQE A;  3N6R A;  4MHE A;  4CJ2 C;  5FK9 C;  2KUM A;  1LO5 D;  3S17 B;  3OW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...