4U68A

Crystal structure of rhino chromodomain in complex with h3k9me3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
EYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRLHRKAAAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Rhino
publication title Structural insights into Rhino-mediated germline piRNA cluster formation
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 18
structure length 64
sequence length 64
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4u68A00
4X3TA 1M8AA 2HCCA 1X32A 5CMDA 5D65A 1EL0A 2B2UA 1XX8A 1TVXA 4RA8A 3TZDA 1DONA 1PFNA 2KVMA 2H1EA 4MN3A 1QE6A 1CA5A 1WVLA 3FDTA 3I3CA 2VXWA 3QO2A 1EIGA 2L4NA 2N55A 4XT3B 2K28A 1C8CA 2RVLA 1U4PA 1WTXA 1HFGA 3I91A 3DEOA 3MTSA 5AFWA 5EPLA 2HUGA 4R8IA 1AP0A 4ZLTF 1DZ1A 2M2LA 1RTOA 3DEPA 1J8IA 1B3AA 1J9OA 1SAPA 2JP1A 5T1GA 1Q3LA 4ZKCB 1WTWA 1ML0D 1NAPA 2RSOA 4R9WA 2X6LA 1ILPA 1HUNA 2J7ZA 2RA4A 2FHTA 2B2UC 3KBXA 1F2LA 1X3PA 1MI2A 1G2SA 2B2VC 2K04A 2B2WA 3I8ZA 2HDLA 1B50A 1F9PA 2IL8A 2L12A 3G7LA 3IFDA 2K03A 3FPUB 3ONAB 1S4ZA 4IUTA 2FINB 3H91A 4X3UA 4XT1B 5CORA 2KECA 5EPJA 4ZKBB 1DOKA 3F2UA 5EJWA 2L9HA 2R3ZA 4IUQA 4U68A 4RWSC 1BF4A 1JE4A 1ESRA 3D6WA 2EE1A 2EOTA 2K01A 1CM9A 1HUMA 2XIWA 3LWEA 1BBXC 1G2TA 1HFNA 1HHVA 2L11A 1LV9A 1RHPA 2X69A 1A15A 2DY8A 4HSVA 5DNFA 3IL8A 2B2WC 4HAEA 1BO0A 4O42A 1ILQA 1IKLA 2NZ1D 1NR2A 1X3QA 3HP3A 4ZAIA 5CBEE 1AZQA 2HDMA 3GV6A 4ZK9B 2B2TA 2NYZD 1MGSA 1VMPA 1BNZA 2K1BA 2SDFA 1E0BA 1JICA 2FMMA 4CJ1B 1WTRA 4XDXA 1RTNA 1IKMA 1B2TA 5D14A 1ICWA 2FFKB 2MGSA 3KUPA 1DOLA 2N88A 1F9RA 1AZPA 1EIHA 2D9UA 3Q6SA 1G6ZA 4QUCA 1U4LA 2BDNA 1MSGA 4OIJA 1XYIA 1NR4A 1PLFA 2KEDA 3GV3A 1O7YA 4LMQD 4HEDA 1KNAA 5E4XA 4X3SA 1CA6A 1WD1A 2KEEA 3I90A 1EOTA 2Q8TA 4RAUC 1RODA 1U4RA 1B4OA 1F9QA 4IUPA 5EQ0A 1WTPA 1IL8A 1GUWA 1O7ZA 3R93A 3MWYW 1G91A 4X3KA 1PDQA 3DM1A 4QUFA 4CJ2C 1KNEA 5COYA 1MSHA 1VMCA 3TN2A 4UAIA 1B53A 2JYOA 1PFMA 2B2YA 4NW2A 2B2VA 2X6GA 4IUVA 2HCIA 4DN4M 1SDFA 1WTQA 2FJ2A 1ZXTA 2EPBA 1NCVA 2MP1A 2DY7A 2KOLA 4HCSA 5JJZA 3SVMA 2MPMA 4MHEA 4CJ0B 4IUUA 2MJ8A 2NWGA 3P7JA 1F9SA 1SSOA 1QNKA 1WTVA 2B2TC 1EQTA 2L1BA 1WD0A 3N52A 3UI2A 5EPKA 5CBAE 1PFBA 2RSNA 5T1IA 1HA6A 4OIKA 2B2YC 2KUMA 1O80A 2CVRA 2Q8RE 2K05A 4IURA 1U4MA 1WTOA 1RJTA 1HRJA 1QG7A 1DOMA 5EKIA 5E4WC
chains in the Genus database with same CATH superfamily
4P2CB 1IBLL 5KRUA 4YWKA 2QW7A 1IW7C 1SYGA 4PMBA 1Z47A 1QB5D 4LK1C 2K5DA 1BKBA 3CCLA 2JA5H 2SEBD 3M3YH 3MC0B 1DGSA 1HFGA 2NN6H 1ENFA 2K6AA 3DEOA 1H9RA 2F0VA 4PQXA 2IX1A 1J8IA 4OO1G 1EY6A 4JI4L 4IPDA 4CDEC 3GTLH 4JYAL 1TKWB 3NBHB 4KD3A 2J7ZA 4ZUIA 5E1FA 4B3TL 3H91A 3OOCA 4OWXB 4A3MH 4DFAA 3PF4A 1ESRA 4A3BB 4CBVA 1TWFH 2XIWA 1E24A 1G2TA 3HOWB 1LV9A 5M5WB 1LT6D 3QJYA 4KKUA 4DK0A 1ILQA 3SK6A 4KY6A 4BY7G 1MGSA 3HOUG 1WTRA 2JJQA 3MEFA 1E1TA 1G6PA 4XYOA 1GHKA 3FEWX 4J1MA 4DNRB 2EYOA 1HQMC 2KHJA 2QILA 4IOAA 2AWOA 3QG1A 1U4RA 4KN4C 4B3MQ 3U9SA 3GTOH 3BZCA 4EQ5A 4KJOA 2O4XA 1E2WA 1R9TB 1VCIA 4KKSA 4CKEA 2BH2A 1STYA 2K75A 3CKIB 2HIVA 1HR0W 2ZM6Q 4KHZA 4G7ZC 3DXJC 4G57A 4QCLA 1WCMG 5HGTA 4A3EH 3HGBA 3I4LA 4KTAA 4OL7A 4ALPA 1PFBA 5FKAC 1U4MA 1KAWA 4A3BH 2WIIB 1LABA 4Z9CB 1KIXA 2WKCA 4DNTB 3MFGA 3J7AF 5E4WC 1XPUA 5J3BA 3HOWH 1DCZA 2JEBI 5M5WH 3OWEB 1EL0A 4HIDA 4ME3A 2H1EA 2C9OA 5D3DA 4G7OC 3FDTA 1KC8C 1HNXL 4OEMB 2VQEL 2N55A 4XT3B 2HQLA 4UDUC 1JR0D 1PH1A 5ELDA 1STGA 1MIUA 3HKZG 4JI5Q 4TVAB 4IFDJ 2JA5G 3OHXC 3C1FA 5T1GA 4ZKCB 2NN6G 3SE0A 1I94L 3W3AA 1FYCA 1WI5A 1V1PA 3PUVA 2L12A 1SN8A 4KN7C 1V9PA 4P75A 1UNSA 1BUVT 4DAMA 3F2UA 3TSSA 3MXPA 3NEMA 1PZID 2K01A 2Q2UA 1Q12A 4A3MG 3KBGA 1HFNA 3MHBA 3CCUA 5CYUA 5DNFA 2NVQB 1U9RA 4IUNA 1C7YA 4LUZA 1TU2B 4B3SQ 4JI2L 4JI5L 1VQGA 2IW3A 1R9TH 4DV0Q 1SYEA 3OWFA 5DEHA 4K5VA 2AHOB 4LF9Q 2PQEA 4N8FA 1PRTF 3ULJA 1XNRL 2OQ0A 3L2PA 3FKIB 4DR4Q 3BS1A 2JA6H 4HN7A 3NTIA 4Y52H 1IYJB 5KIXA 1QILA 5CV9A 3EN2A 3HOXB 4LF7L 5EQ0A 4ODGA 1IL8A 1SMYD 3CP0A 3ITPA 2F0LA 1STAA 2PI2A 5EGTA 4KY5A 1STNA 3CD6A 3A8JE 3S2DB 2B2VA 2YYZA 2GVBA 4GKJL 2PZUA 5KNBA 5BN5A 3O13A 3RN2A 2EPBA 4MZ9A 2KOLA 3I55A 2MPMA 5ELEA 2PZTA 1SFOB 4DR4L 2PW5A 3RD4A 1KL9A 4R4OA 5CBAE 4A3EG 2B8FA 1EY9A 3X3MA 3CQZB 1JC7A 2OQKA 3GTJB 5CV5A 5IE8A 1GVPA 1E2VA 2RHQB 3CF5A 1TVXA 4HJ7A 2NVQH 4A3BG 1FVIA 1Q81C 3CC2A 2ZT9C 4PMCA 1GUTA 1X9NA 3A7LA 3HOWG 4BXXH 3MXGA 1HXYD 1G8ZD 5M9OA 3MEHA 1ONLA 1HNZQ 4FF2A 1UEBA 2ZJRA 1NAPA 4JV5Q 4LFCL 1HUNA 1BDOA 3RLNA 1ZYRD 2B2VC 5EBCA 3RZDB 3FKIH 1L2FA 2G5DA 4F8MA 5IGEA 3K5OA 4O0AA 4DPGA 2A69C 2EIFA 3ERSX 5CC4A 2CCZA 4CHTB 3BDLA 3HOXH 1VF5C 3I73A 1JE5A 4FYDA 1CSPA 2I0QA 4FF1A 1PH5A 1L0WA 1RHPA 1V1OA 1LTBD 2PNHA 4O42A 5JVH3 2MNAA 4RKBA 3S2DH 1NTGA 4GLXA 4LFBQ 3BVGA 1ZEQX 5C5LA 1PRTD 1EIFA 4JV5L 2UXDL 1LTRD 1LT4D 4P74A 2IX0A 5IGCA 3HZXA 2PZWA 1SFOH 4NXNQ 1Q86C 3NWTA 4IJLA 4YHHQ 3J80i 4LF5Q 5ELFA 1KD1C 2MUYA 1QVCA 1H9KA 3H94A 4A3KB 4FXGC 1A63A 3GTPH 1A0IA 2VUMH 4DV2L 5JVG3 3KF6B 1UE5A 2A5HA 2JA6G 1O7YA 1SMYC 4IPCA 3GTJH 2A73B 1F9QA 3D4RA 5DM63 5ELCA 4DAYA 2K5NA 3MWYW 1EYAA 4QUFA 2ID0A 2YU9B 3FMCA 1BR9A 2CWAA 1NBWA 2H4OA 1FNWA 5I9PA 2DJFC 3J80L 3NELA 4C1NK 1PYWD 3I4NB 4DN4M 1N36Q 2EVBA 4PZ8A 1GM5A 3HS0C 2P5ZX 5NUCA 4AYBE 1QUQB 4YHHL 4IUUA 2NWGA 3RZDH 3GTGB 1I6VC 1M90C 2NVXB 3ULLA 2KENA 1QNKA 1EU4A 1K73C 3E3XA 3DWPA 2JSOA 3UDIA 2RSNA 5BN4A 5IGFA 3SK8A 1SJED 1N34Q 2HQEA 4A3DB 1K8AC 3NTHA 1DOMA 3JAME 3PIOA 3S1NB 4POFA 4ID6A 4DK6C 1Q7YC 3G4SA 1R4PB 3M7GA 3DMUA 2QCPX 4JG2A 1TS2A 4L5RC 1RF2D 1I50H 3I91A 1I4RA 4JPBW 4B3RQ 2M9VA 4BXXG 1K83B 1VQIA 1CT1D 4OWWB 1TS5A 1X3PA 1W6KA 2A6ED 3K5LA 2JA9A 2VNUD 1PH4A 4A3KH 1YJNA 2K5WA 3D0FA 1LTLA 1S4ZA 2RCFA 1HPCA 5IWAQ 3FKIG 2IPKD 3CW2C 3H09A 4Y7NB 4A3FH 3MZ5A 5HURA 2EE1A 2WFWA 2VY3A 3P20A 4HSVA 1A6XA 2V1CC 4XQQA 4NXML 3HOXG 3K58A 2YU9H 2ZJQA 4DF7A 1LUZA 5H1SE 1K8OA 3W1GA 4ZK9B 4B3RL 3I4NH 2XGTA 3VDYA 3R3OA 3A8KE 3NHHA 4YY3L 2EYFA 1JICA 2IHFA 3ND9A 4JBMA 3SDZA 1B44D 3NBHA 3GTGH 5D3IB 1ICWA 2F0FA 2WAQE 3MAQA 4GKKQ 2A68C 1X56A 2Z8LA 1K8MA 2PNRC 1SE4A 2AUKA 1U0LA 4N8X1 4A3DH 5DLQE 4LMQD 2EY2A 1KNAA 4X3SA 4F88A 5A2QE 2Q8TA 2VUMG 1CTMA 1S5FD 2F52A 3ERQA 4F7XA 1VQ9A 1IL2A 2N8NA 2LMCB 1E3PA 3R93A 1BXTA 2EZVA 5LMNQ 1PDQA 3S15B 3M4OB 2K33A 3T1YQ 2WKDA 2K5VA 2JYOA 1FJGQ 2F4IA 2Q2IA 3BZKA 4IUVA 4L8JA 1GUSA 2ICEC 3CMAA 2CH4A 3LX0A 4AQYL 4PV1C 1HZ9A 2C5CA 1K83H 1VQJA 1Q8IA 1SNOA 4CJ0B 1SSOA 2DUDA 2L1BA 3KDFB 3QR8A 2TMPA 1HH2P 2Y0SE 1H9SB 2R92B 3V2TA 4JOIC 4Y7NH 1SLJA 1WTOA 1KRSA 3VYRA 5LL6S 1RCVD 5C3EH 1U5KA 5LMNL 3IFTA 1KLGD 1XX8A 4LWCA 1PFNA 1TT2A 1SNPA 5FLXE 5JJKA 1P16A 1SNDA 1FJGL 1LLRD 2PQAB 2RVLA 1HTPA 1STEA 1SROA 4JI6Q 2O5JC 4UPAA 3NE5B 1B3AA 1SAPA 4RGMA 3T1HL 4BY1H 4X64L 3KBXA 2B2UC 3MVVA 1MI2A 3BG3A 5DAUA 3QWNA 4XTCS 3IFDA 1F2MA 5CORA 2D0OA 2Z1CA 3QOJA 3DWQA 2MQHA 3MXUA 4A3KG 1MKHA 4LNQA 3CC4A 1MD2D 3RR5A 2QEXA 1VQ4A 1X6OA 1IW7D 1FNVA 1ET9A 3IL8A 4A3FG 3W5OA 3S15H 3M4OH 4ZAIA 4IOCA 4KHPQ 2NZ1D 3PGZA 4JI8Q 2F0DA 2WB1B 1B70B 1E22A 1LYLA 3I4NG 1C0AA 1YNND 2MGSA 3DWAA 3OW2A 1BOSA 1I6HB 2UUCQ 4CDFC 4K5XA 1MSGA 1EYGA 2R92H 1KDAA 2PW7A 1LTGD 2LS01 2NTSA 4TQUS 1PVOA 1X3FA 4C3JB 1GUWA 2NB0A 4A3DG 2YTYA 1NSNS 4DV6L 4KHPL 3BVZA 1SRUA 2A1AA 3TN2A 2EJGC 2O5IC 1LTAD 4OELB 1VS0A 2ATWA 2EYHA 4R4TA 4DXFA 5J1ZA 5M3MH 4HCSA 3GDEA 3RLOA 3GP7A 3P7JA 2VL6A 2K52A 4NDXA 4XXEA 1GHJA 1PYBA 5I2XA 4DV7Q 2ZTEA 5EBDA 2CH4W 2B2YC 3D31A 1TWFB 1XJVA 1T5EA 4FF3A 3ZJYC 2MHVA 1XMQL 5GADC 5LMNW 4X62Q 1X32A 1NE3A 4RA8A 3F2BA 3OMCA 1N33Q 3ICEA 2F0PA 5C3EG 4R4QA 3ER0A 2NUCA 1EIGA 2K28A 3MA2B 1T9HA 2F0QA 3E9IA 2EDGA 1CKOA 2E2IB 2YTXA 3G71A 1WTWA 1HQRD 3CPWA 1F2LA 2XVSA 1D2BA 4BY1G 5C4ZA 1I6HH 3PIP3 1HZCA 4ZQ3A 3EFXD 1Q8KA 2LXJA 1DOKA 4LF6L 1EFWA 2L9HA 2F3IA 2NVYB 2UUBQ 1EWIA 3A5ZB 3GTOB 2EOTA 4C3JH 1FGUA 4JI3L 1Z7TA 2JXMB 4I65A 2TSSA 5EAYA 5KYIA 5GAEC 3J7AV 5M5XH 5HGQA 1TXYA 1YNNC 3AMUA 1E0BA 4A3EB 1VQHA 5KNDA 3PSIA 1IYUA 4DV5L 4K14A 1MHWC 1QOHA 1EEFD 5GAGC 2CQOA 4DR2Q 2YV5A 1CQVA 2XRSD 4P72A 5FLMH 3EA6A 1S5CD 2OEOA 2LY7A 1XYIA 2AKWB 3GV3A 4GNXC 1FL0A 1GUGA 5CR3A 1OO9B 1N32Q 1RODA 4IUPA 1WTPA 2R92G 1K3RA 4PNYA 1O7ZA 1TY2A 3JAML 1OXTA 1D5ZC 3R8BA 1A2UA 1NMFA 1OTCA 3Q8DA 1CI3M 4A3GH 4WJ4A 4FXKC 3NQTA 1PFMA 4UP7A 4NW2A 2F1MA 3T4AC 1SNMA 3FRPB 2HCIA 2HIXA 4L5SA 5IIFA 4GLVB 3K0YA 2E2IH 2GA4B 4K0KQ 1WTHA 2NTTA 2K4KA 1I4PA 5KGUA 5E7NA 3M4QA 3OTOQ 1HJPA 3NXWA 5M3MG 3HEJA 4A76A 1JJ2A 2C35B 4NP5A 5C0XH 5EPKA 3R2TA 1Y14B 3FHWA 2EYMA 4R1JA 3CCRA 3BDOA 2NVYH 3KF6A 4LUVA 3TRZA 1K9MC 3CRKC 1TS4A 2LKVA 1LACA 3TZDA 2KVMA 4DR3Q 1WVLA 1FGBD 4MTNA 3TREA 4K6DA 1C8CA 4RG1A 5KEEA 2HUGA 1DZ1A 5JJLA 3H0GB 1TWGB 4DUYQ 1QVGA 3OSOA 1H9JA 2UU9Q 2WB1G 3OTOL 2JA6B 3R2IA 4IPHA 1QUQA 2RA4A 2GVAA 1B50A 2K04A 1F9PA 3ONAB 1NY4A 4B3ML 1Y1WH 4X66Q 4NB3A 4X3UA 4ZKBB 4ZCKA 1A3UA 2E5LQ 4IUQA 3VYSA 4C56C 2ZXPA 4DR3L 1D1KA 1LT5D 1XNQQ 4C3JG 2ZM6L 1NR2A 1X3QA 2IT1A 4DR5Q 4G7HC 4K5WA 1D7QA 4DUYL 3EBEA 4DAPA 1HTLD 4EX5A 2SDFA 4KHVA 4OWTB 4NMZA 5ELBA 3CAMA 3UE0A 3VR6A 1O7IA 4E6IA 3HOZB 3PQIA 3TMEA 4X66L 2OTLA 2V4DA 3L3OC 4QUCA 4RH6A 5C5MA 4DXGA 1G6ZA 2XN9C 2BDNA 4MTKA 3NP8A 2A69D 4CKBA 3S1RH 2F0IA 3I90A 5FLMG 4HIMA 3EVQA 3K6OA 4CGYB 5C3XA 5A35A 4HJ9A 5COYA 4L5TA 1SR3A 4A4IA 4QIWE 5FLXL 2F0KA 1STHA 3H0GH 4A3GG 1TWGH 5IOCA 2FJ2A 3HOYB 1ZXTA 1L0YB 3WWVA 4XQJA 4MHEA 2IHEA 5M3FH 1QJOA 2F0JA 2R6GA 1PA6A 5IGDA 4L6TB 3I70A 1EZ8A 1B9NA 1J6QA 4C3IB 1HRJA 3W2DA 5C0XG 4B3SL 3CC7A 4DV0L 2DN8A 2HCCA 3TQYA 2KCTA 1GO3E 2K5QA 4LF9L 2D62A 2R7ZH 1EY7A 2CW0C 4JCVE 1VQEA 1TY0A 2VXWA 2VZAA 2L5TA 3QO2A 5AFWA 4GNXB 3URYA 2UXCQ 1VQBA 3C1EA 4UY8C 3J81E 3LNNA 1DXMA 2JP1A 1I5FA 5EKKA 1ML0D 4KMUC 1R4QB 4R9WA 1BCPB 1L0XB 3GTPB 1ILPA 5ELOA 2VUMB 3HOZH 1C4QA 2Z9HA 4ABNA 3KDFA 1LO5D 4LUOA 3KLSA 1GD7A 1H9SA 3SEBA 3VR5A 1ASYA 5IYBH 2LSSA 2R7DA 3D6WA 1Y1WG 2HT1A 3RLFA 4AYBB 4CDDC 1ZKOA 1HHVA 1A62A 1KHIA 3PUXA 5C0XI 5IT9E 2PQAA 5ELNA 2IWHA 1PTOC 3JAMc 3OIQA 5BR8Q 4DUZQ 3HOYH 2CFMA 4V0BA 4RGNA 4JBJA 4CKCA 5LHY1 5HY6A 4PZ6A 3CCQA 1YITA 5I9OA 4ULLA 1PH8A 1RKNA 5IP9H 1U4LA 3NTKA 4C3IH 1B3QA 4FVMA 1JWSD 1VQ5A 2A74C 3AEVA 4B08A 1HA6A 2D2CC 2Z4IA 3KLWA 2BDOA 2Z6BA 4JC0A 1DJRD 1I50B 3CRLC 2XWJB 2PYKA 1HNZL 2UUAQ 3V96A 2Q2HA 1AE2A 1VQPA 1Q46A 3PMFA 1GJXA 1K0RA 4LF8Q 2DY7A 5JJZA 3H0GG 3ND8A 5IP7H 2M00A 2RDHA 5I6YA 4OONA 2A68D 1B8AA 3RZOH 1QZGA 1M4VA 3S1QH 1EQTA 1HA5A 1EQQA 5M3FG 2D0PA 4A3FB 2I07B 1VQKA 4JBWA 3B6YA 3NBIA 3EQLC 2PCFB 3RN5A 3WDNA 4AIMA 4LFBL 1SE3A 2F4VQ 3G48A 1DONA 2WAQB 4RCOA 1QE6A 1V1QA 3KF8B 4JK1C 2CQAA 3I3CA 3GO5A 4PMWA 3I72A 4IZ8A 4NXNL 4LF8L 4LF5L 2R7ZG 1FD7D 3RMHA 3U9OA 1SXTA 4HR7B 1CQFA 3PF5A 3S17H 3I7FA 3HKSA 3S2HB 3K7AB 3GD7A 4XIGS 1L1OC 2E2JB 3BJUA 2A6HC 4QB4A 5EPJA 3HOZG 4YCUA 3A7AB 2KHIA 4DKAC 5LL6X 1S5ED 1I4HA 2NZHA 1N36L 2X69A 4WRDA 5IYBG 4Q0FA 1ENAA 4LF4Q 1YJWA 4DV3Q 2EY5A 2Y0SB 3TS0A 2KJXA 2NYZD 4BA2I 2NVTB 2F0TA 4WORA 5FLXc 1N34L 3HOYG 3KUPA 1B9MA 3KLSX 4K2LA 2JN4A 2WINB 3Q6SA 2L15A 5FOBB 1W3SA 1G51A 3S1MB 5C3EB 3F1ZA 2E2HB 4JI7Q 1S5BD 4UP9A 5IP9G 5CV7A 4X65Q 1PFSA 4HSPA 1VQ7A 4RAUC 4C3IG 5C44B 4DR1Q 1PH7A 2I46A 2KBNA 3M9BA 4UAIA 1B53A 4EQOA 3WOFA 2H5XA 3S14B 1UE7A 1KABA 4BY1B 3H3VI 4JOIA 1AE3A 4IFDH 3A55A 2JA7H 5IYDH 1UWVA 5IWAL 1CKMA 2Q8IB 1IYVA 1AEXA 3S2HH 3K7AH 3K80C 2QF7A 1JOQA 1OXSC 3D4WA 2F0EA 1SE2A 2E2JH 1F77A 4V190 3CHBD 4EVOA 5IP7G 5T1IA 4JI7L 1PTOB 3PO3B 3DHQA 3C3LA 4JI1Q 1KRTA 1VQMA 5EKIA 4DV4Q 3C46A 1AH9A 1PH6A 4X3TA 2B2UA 1W2BA 2YTVA 1XPRA 1RDPD 4AYBG 1PXUA 2K32A 2B3GA 4BWGB 1U4PA 4RHSA 2F0OA 4R8IA 2NVTH 4GKKL 5EPLA 3PO2B 4ZLTF 1C48A 2M2LA 3CPFA 4WFN3 3OMGA 1SYCA 2RSOA 3NQIA 1MJEA 2ZTCA 3G7LA 3CCVA 4OXPA 4JI1L 4DV1Q 2NZOA 2R7FA 3S1MH 2E2HH 2XRQD 1XMOQ 2AWNA 4K8IA 3TP8A 4OX9Q 3PV0A 3T1YL 1JE4A 4BBSB 5C44H 3U58A 3OIPA 1C9OA 2DY8A 2B2WC 2K50A 1JMCA 3EJIA 5M3MB 3S14H 1EOVA 1VMPA 3NWSA 3T51B 3VR4A 1PYSB 3TP5A 5AJ3Q 3VR2A 2FFKB 3L9AX 1JWMD 2N88A 1AZPA 1F9RA 5IY0A 1LTSD 3E5SA 2QGQA 1XMOL 2DJGC 5FJ8H 1PTOH 3PO3H 1E1OA 1QNUA 3VR3A 2KCMA 5E4XA 3STBC 4ME5A 5CV4A 4BBRB 3LWUA 3I4MB 1J5EQ 1TWCB 3BYTB 4JI6L 1L1OB 3P1HA 5C3WA 2QKIC 2IY5B 3M4YA 1VQOA 2WAQG 4K8JA 2B2YA 2X6GA 1Y8OB 3PO2H 3K57A 3SGIA 1JOKA 3CCMA 1Y1VH 1NCVA 3ZYYX 5CV8A 3X3NA 4IFDG 2LFNA 3Q24A 3J81L 2JA7G 5IYDG 1RD9D 4J15A 5CV6A 5I4DA 2PI2E 2RDGA 4DR7Q 2ZTDA 3N52A 1FR3A 2LXKA 1Z9FA 3K81C 5IYCH 1K28A 1WYDA 3BZDB 4TSSA 2Q8RE 1VF7A 1YZ6A 4HTHA 4JI8L 4BBSH 3KK7A 1M8AA 4B9WA 1XPOA 1BCPD 5M5XB 1PZJD 4RHRA 1IBKQ 2JK8A 4RMFA 4KD4A 1X54A 2VS1A 1QCBD 4M1UB 2ICIA 2B8GA 2KCNA 1XTDA 1NUCA 2BOSA 1EY8A 2SNSA 5IT9L 2Y0SG 1RTOA 4TKOB 3CCSA 4UHVA 1K0SA 2UUCL 3QIAA 4Q5VA 4DR7L 4JI0Q 5M5YH 4KLKA 1Y8NB 3NUCA 1VQ8A 4IUTA 1HR0Q 4FP5D 1GUNA 3AQQA 1YEZA 2KCCA 4EQPA 1STBA 2Z4HA 4IFDI 4IN3A 5L37A 2JEAI 1II3A 4BBRH 2RF4A 5C4XH 3CCEA 1CM9A 2KHSA 3I4MH 3G6JB 1TWCH 4A3GB 4JBKA 3J81j 2RHSB 1NNXA 4A3IH 1BF4A 3H3VC 2OXPA 2HHHQ 5CBEE 5C44G 4MIUA 1IBLQ 2GN5A 4GNXA 3K59A 2EYPA 4DV7L 3HG9A 5JEAH 4A3JB 1PH2A 2FMMA 4RKLA 3DLLA 4HJAA 4JI0L 1K8GA 1S5DD 1A3TA 2VW9A 4C2MH 1EFID 2KA7A 4X62L 4JI4Q 2OCEA 4IO9A 2AQ2B 3S24A 5TSSA 4JYAQ 1EYDA 2QDLA 1N33L 1A2TA 4OIJA 4B3TQ 4HEDA 4U673 1WD1A 2KEEA 5FJ8G 1LTTD 3PO3G 1B4OA 3OYYA 4IJHA 3J7ZC 3VYUA 1BBUA 2EYLA 3IKJA 3K7UC 2BE5C 2F0WA 1TQOA 3JAMi 1GOZA 1VQDA 3LGJA 2AMCB 4B9XA 3J80E 4QMGA 1WJJA 1WTQA 1PTOF 1I4QA 1Q1BA 4GN4B 3PO2G 2UUBL 1F2YA 1Y1WB 1N9WA 1HNWQ 1BBWA 1Y1VG 3HKZE 1NMGA 2K14A 1G291 1V8QA 4OIKA 3K5NA 1KLUD 1MJCA 3QOLA 2D5DA 4IURA 2J4XA 1BCPC 5J39A 2B29A 3N6RA 5IYCG 4K2KA 2I5HA 4GLAC 1CHQD 3DUZA 4BBSG 4MN3A 3NENA 1HCZA 3KFUA 5K5PA 3L0OA 1PZKD 3J7YW 1CZGA 1PH3A 4OGQC 5GAHC 4DR2L 4A3JH 1D6EC 3F8TA 5JAVA 1HNWL 4GZYC 3TP7A 5KYLA 3MXNB 3GTQB 1Q1EA 1HZBA 1G2SA 1UE6A 2Q2TA 3GTMB 1N32L 4A75A 4QIWB 2KQ3A 1CZWA 1YNJD 3S1RB 1JCKB 2RQXA 3Q22A 2O2LD 1S3OA 1CSQA 4P73A 3C2PA 3KYHC 4DU9A 2E76C 4OO1I 2F0HA 1TS3A 1BBXC 4BBRG 5C4XG 2PO4A 2CW0D 3I4MG 3KF8A 4K0KL 1IKLA 4RGTA 1EQVA 4KV6A 1XTCD 4HJ5A 3HOVB 4A3IG 2ALYB 5M3FB 1OXXK 1VQNA 4H44C 4FF4A 5JPMC 5F2DA 3I2ZA 4GN5A 4KK7A 1DD2A 1HNXQ 1TWAB 4KJNA 2VQEQ 5G3LF 5D14A 3K8AA 5EKLA 5JEAG 2VQFQ 4O1NA 1OXVA 1EY4A 1Z6HA 2QA4A 2ENBA 4QL5A 3D3RA 4J8QA 1I94Q 1SEBD 3J81c 5A2QL 1KTKA 3TEHB 3CXCA 3M7NA 4XYQA 2R7ZB 1S72A 3TZUA 2MFIA 5ISRA 2UU9L 4BS9A 1KNEA 1MSHA 3V05A 2PMZB 3HRZC 4ZRZA 1PTOD 4RFBA 4A3CH 1EYCA 4FXDA 4G4KA 4DA2A 2MP1A 2FMCA 3FP9A 4JI2Q 1NJIC 2E5LL 3SXHA 2VQFL 3GTQH 4PZ7A 2L0CA 2QEJC 3GTMH 3PUYA 5IT9c 1XWEA 2K5HA 2FXQA 1ASZA 1JJCB 3VA7A 1XNRQ 1XNQL 3PIPA 4DR5L 2I5MX 3SR1A 5CMDA 3UDXA 3RUZA 4POGA 3T16A 4KI0A 2HD3A 4DK1A 2ZXRA 3K0XA 3U50C 5JPNC 3L7ZC 3HOVH 4LF7Q 2L55A 3CMEA 2PPBC 2N49A 4JVZA 3VA5A 2BH8A 4LAAA 3OPOA 4DNIA 1Q3LA 1TWAH 4H0LC 4HJ8A 1PH9A 3NSWA 1YHQA 3NPPA 1YNJC 4A3JG 2IJ0A 4GKJQ 1CKNB 1I4GA 4A93B 4XT1B 2F0UA 1E7ZA 2I5LX 3PIO3 4GN3B 3P75A 4AH6A 4U68A 3Q0AA 3A56A 1PHJA 1ET6A 3LWEA 2L11A 2NN6I 3UDFA 3U4VA 4WJ3M 3MFYA 2F0NA 3TDQA 2DNCA 1LT3D 3T53B 5K36H 1PMRA 3SK4A 2DNEA 1AZQA 1SYFA 1Y69U 1X55A 1EIYB 4RCNA 3W1BA 1D8LA 5E3FA 3RZOB 5G3LD 1KDBA 3S1QB 4C1NI 1JWUD 4O2DA 2UXBQ 2JA8B 2PMZE 3H3VH 1EZ6A 1UUPA 1ICFB 4DR6Q 2ZJPA 2A6HD 1S40A 4NKLA 1KDCA 4LFCQ 1KAAA 1NR4A 2JQOA 2KEDA 4H7BA 3I4OA 1EOTA 3IAYA 2QDBA 4YCWA 2UXCL 4RGOS 1G91A 2DGYA 3I56A 1EY0A 2JE6I 4KKTA 4H13C 4ILWA 3S17B 5FK9C 2F3WA 4QJFA 2EXZA 2UXBL 3PUWA 2EYJA 4YCVA 1H95A 2BA0A 4A3CG 4DR6L 1WTVA 1M1KC 4A93H 1B1ZA 2BCOA 5JOBA 2UXDQ 2N78A 1K3BC 2VB3X 1O80A 2CVRA 4L5QA 1JB7A 2XSCA 3G6EA 1IBMQ 2SNMA 1A3VA 5D65A 2AUJD 4DV2Q 1CUKA 1CK1A 1L1OA 5BR8L 4DUZL 1GXDC 2CKZB 1JT8A 2L4NA 3WOEA 1WTXA 3MTSA 3SHLA 1AP0A 1JORA 1WOCA 1EUJA 1BQQT 2F03A 1SYBA 3HOVG 1QZHA 1XXGA 3S16B 3H15A 1SE8A 2JA8H 3GTKB 4L63B 1AFPA 2IL8A 4X6AH 1KXLA 1LTID 5I6WA 5KNCA 2R61A 2UUAL 1O7LA 1VQ6A 1IBML 2WACA 4HIOA 3A5UA 1Y8PB 4WJWA 1JB3A 1A15A 3CQZH 2XWBB 4UP8A 3ULPA 4APVA 3BYYB 4HAEA 3HP3A 2JA7B 3EROA 2HDMA 3GV6A 1DYQA 1V43A 5K36G 1UAPA 1CHPD 2F0SA 2MO0A 4QQBX 2B63B 1SNCA 1IKMA 1B2TA 4GOPA 3KLRA 2D9UA 2OF1A 4HMIA 5JEAJ 3PCOB 1EWCA 3E0EA 1QVFA 1D5XC 2F4VL 1JOOA 1YNXA 1GKHA 3T56B 1CA6A 2XNAC 3AFQA 5DM73 4C3HB 3SK5A 2EJFC 4IQZA 4DK3C 2AQ1B 4X3KA 3DM1A 5BN3A 3EIVA 1UEAB 4NXMQ 3S16H 2EY1A 4LJZC 3HFZB 1CFMA 3GTKH 1X3EA 1H9MA 1V1PB 1ZYRC 4S3SA 1QWYA 3M4PA 3UI2A 4YY3Q 2WV6D 1SNQA 2KUMA 3A54A 3AFPA 2F3VA 3STBD 4A93G 4LF4L 5LMUQ 2R93B 4GOPC 4DV3L 4H02A 1JJGA 1EU3A 1O78A 3F2CA 1CA5A 1OXUA 2VB2X 1DM0B 1FNUA 4DGZA 2F0GA 1KQSA 1TIID 3DEPA 1PRTC 1BVSA 3TBIB 2B63H 1F2ZA 3AYHB 1YVCA 4X65L 1SYDA 2B2WA 2HDLA 2J0TD 5GQOA 2N3SA 4AQYQ 3FPUB 4N9PA 1PV4A 3T13A 4F87A 2JA8G 5C0XJ 1YHBA 1Q90A 4ZYSA 5LMUL 3BU2A 4DR1L 2NVXH 3OW7A 2WP8J 3AU7A 4RWSC 2ES2A 2RBMA 3J7A5 1EQRA 1BCPF 4C3HH 1HUMA 4ZUJA 1YI2A 5IODA 3S1NH 3D8GA 1YHAA 1Y1VB 3S9WA 2E8GA 2B2TA 4QF4A 4EGVA 1BNZA 2K1BA 1N8RC 2Z6KA 1RTNA 4FO2A 2E74C 2EY6A 3MXNA 4DAVA 4M8AA 1EEID 1DOLA 4DV4L 4KY7A 5JJIA 3U4ZA 4K6LA 1P8LA 1YBYA 1IZ6A 3PUZA 4R4IA 3T1HQ 4J6HA 4A3LH 3D4DA 2RDFA 1X65A 4X64Q 2R93H 4PG3A 4YWLA 3E9HA 5J22A 3E6ZX 1TWHB 3H6MA 2A19A 2B39A 4BA1I 4FDBA 3KJOA 1TR5A 4BY7B 2IX3A 3K5MA 4CJ2C 4I7ZC 1D1IA 3HOUB 2OT2A 5FO9B 3BVMA 2EQSA 3VYTA 3CCJA 2E75C 3RNUA 3BDCA 2MO1A 5M5YB 5C4JB 2A8VA 4DV1L 5C6AA 3SVMA 4OX9L 1B7YB 1SBBB 2MJ8A 3UDGA 1F9SA 4IPGA 4FNFA 2A6EC 4P71A 2B2TC 5GROA 2OWOA 3J81i 5IGBA 1Q82C 1E2ZA 4NPSA 5C4XB 2Z6KC 2EJMA 2K05A 2AQ3B 1IHZA 1QG7A 4A3IB 1VQLA 4IALA 3IRBA 4QGUA 3D6CA 1WFQA 4XQNA 2ASBA 2BE5D 5AJ3L 3NK9A 1I3QB 4OO1H 3TS2A 3FVQA 3KJPA 3A74A 4DV6Q 4HIKA 1J9OA 1WCMB 2K7VA 3AB9A 4C2MB 4TRDA 2E2DC 2X6LA 4HCEA 2FHTA 3I8ZA 3QB3A 3F2DA 2B63G 2K03A 1J5EL 1YJ9A 2CHBD 2ZXOA 2FINB 3CU7A 3GQBA 3J80c 2G9DA 2KECA 5EJWA 3E0JA 2R3ZA 1IXRA 4R4CA 3A8IE 2EXDA 1LM0A 2F0MA 1TWHH 4DAYB 1ESFA 3KOJA 1EWHA 4N9TA 3JC66 1SJHD 4BY7H 3FPPA 4I7AA 4C3HG 3HKZB 1BO0A 3A0JA 1XMQQ 2CWPA 3HOUH 2BA1A 1RL2A 1VQAA 2JA5B 3M3YB 1MBYA 4LW1A 4GOPB 1UE1A 2G9HD 4R8NA 5C4JH 4GS3A 4CJ1B 4XDXA 3GTLB 1EIHA 2NBFA 4HMJA 4YIJA 1CKNA 1AW7A 1RIPA 3TP6A 1W6JA 3M85A 1YIJA 4LFAQ 2RKSA 1PRTB 4A3MB 1PLFA 1IBKL 4YWMA 3Q23A 1VQCA 4A3LG 2XTIA 2R93G 1VQFA 4MNOA 5I2YA 4EQNA 2RCNA 4LF6Q 1AN8A 1VMCA 1I3QH 4QY7A 1SMXA 4OHJA 1T5XD 5IGGA 4JI3Q 2OTJA 1SDFA 1WCMH 1HR0L 2SOBA 5CGKA 4JW0A 5FO8B 1A8VA 5C4HA 1GUOA 1EY5A 4CDCC 1WD0A 1VDZA 2Z0SA 4LFAL 1D5MC 3DM3A 1HZAA 2WB1E 1JQYD 1RJTA 3UE1A 1I4XA 1ENCA 4DV5Q 2HHHL 1X3GA 5FO7B
chains in the Genus database with same CATH topology
4P2CB 5KRUA 1IW7C 1SYGA 4PMBA 1Z47A 1QB5D 4LK1C 2K5DA 2SEBD 3MC0B 1HFGA 2NN6H 1ENFA 2K6AA 3DEOA 1H9RA 2F0VA 4PQXA 2IX1A 1J8IA 4OO1G 1EY6A 1TKWB 4KD3A 2J7ZA 4ZUIA 5E1FA 3H91A 3OOCA 4DFAA 1ESRA 4A3BB 4CBVA 2XIWA 1G2TA 3HOWB 1LV9A 5M5WB 1LT6D 3QJYA 4KKUA 4DK0A 1ILQA 3SK6A 4KY6A 1MGSA 1WTRA 4XYOA 1GHKA 3FEWX 4J1MA 4DNRB 2EYOA 1HQMC 2QILA 2AWOA 3QG1A 1U4RA 4KN4C 3U9SA 4KJOA 2O4XA 1E2WA 1R9TB 1VCIA 4KKSA 4CKEA 1STYA 3CKIB 4KHZA 4G7ZC 3DXJC 4G57A 4QCLA 5HGTA 3HGBA 3I4LA 4KTAA 4OL7A 1PFBA 5FKAC 1U4MA 2WIIB 1LABA 4Z9CB 2WKCA 4DNTB 3MFGA 3J7AF 5E4WC 1DCZA 2JEBI 1EL0A 3OWEB 2H1EA 2C9OA 5D3DA 4G7OC 3FDTA 2N55A 4XT3B 4UDUC 1JR0D 5ELDA 1STGA 4IFDJ 3OHXC 3C1FA 5T1GA 4ZKCB 2NN6G 3SE0A 3W3AA 1FYCA 1V1PA 3PUVA 2L12A 4KN7C 1UNSA 1BUVT 3F2UA 3TSSA 3MXPA 1PZID 2K01A 1Q12A 1HFNA 3KBGA 3MHBA 5CYUA 5DNFA 2NVQB 1U9RA 4IUNA 1TU2B 2IW3A 1SYEA 3OWFA 5DEHA 4K5VA 2PQEA 1PRTF 3FKIB 3BS1A 4HN7A 3NTIA 5KIXA 1QILA 5CV9A 3HOXB 5EQ0A 4ODGA 1IL8A 1SMYD 3ITPA 2F0LA 1STAA 5EGTA 4KY5A 1STNA 3A8JE 3S2DB 2B2VA 2YYZA 2PZUA 5KNBA 5BN5A 3O13A 2EPBA 2KOLA 2MPMA 5ELEA 2PZTA 1SFOB 2PW5A 3RD4A 5CBAE 2B8FA 1EY9A 3X3MA 3CQZB 1JC7A 3GTJB 5CV5A 1E2VA 1TVXA 2ZT9C 4PMCA 1GUTA 3A7LA 3MXGA 1HXYD 1G8ZD 5M9OA 3MEHA 1ONLA 4FF2A 1NAPA 1HUNA 1BDOA 1ZYRD 2B2VC 5EBCA 3RZDB 4F8MA 5IGEA 3K5OA 2A69C 5CC4A 4CHTB 3BDLA 1VF5C 3I73A 4FYDA 4FF1A 1RHPA 1V1OA 1LTBD 4O42A 5JVH3 4RKBA 3BVGA 1ZEQX 5C5LA 1PRTD 1LTRD 1LT4D 2IX0A 5IGCA 3HZXA 2PZWA 3NWTA 5ELFA 2MUYA 1H9KA 3H94A 4A3KB 4FXGC 5JVG3 2A5HA 1O7YA 1SMYC 2A73B 1F9QA 3D4RA 5DM63 5ELCA 4DAYA 3MWYW 1EYAA 4QUFA 2ID0A 2YU9B 3FMCA 1BR9A 2H4OA 1FNWA 5I9PA 3J80L 4C1NK 1PYWD 3I4NB 4DN4M 2EVBA 3HS0C 5NUCA 4IUUA 2NWGA 3GTGB 1I6VC 2NVXB 1QNKA 1EU4A 3DWPA 2JSOA 2RSNA 5BN4A 5IGFA 3SK8A 1SJED 2HQEA 4A3DB 3NTHA 1DOMA 3JAME 3S1NB 4ID6A 1R4PB 3M7GA 3DMUA 2QCPX 1TS2A 1RF2D 3I91A 1I4RA 2M9VA 1K83B 1CT1D 1TS5A 1X3PA 1W6KA 2A6ED 3K5LA 2VNUD 2K5WA 1S4ZA 1HPCA 2IPKD 3H09A 4Y7NB 3MZ5A 5HURA 2EE1A 3P20A 4HSVA 1A6XA 4XQQA 3K58A 4DF7A 1K8OA 4ZK9B 3R3OA 3A8KE 3NHHA 2EYFA 1JICA 3ND9A 3SDZA 1B44D 3NBHA 5D3IB 1ICWA 2F0FA 3MAQA 2A68C 2Z8LA 1K8MA 2PNRC 1SE4A 2AUKA 4LMQD 2EY2A 1KNAA 4X3SA 4F88A 5A2QE 2Q8TA 1CTMA 1S5FD 3ERQA 4F7XA 2LMCB 3R93A 1BXTA 2EZVA 1PDQA 3S15B 3M4OB 2K33A 2WKDA 2JYOA 2F4IA 4IUVA 4L8JA 1GUSA 2ICEC 3LX0A 4PV1C 2C5CA 1Q8IA 1SNOA 4CJ0B 1SSOA 2L1BA 2TMPA 1H9SB 2R92B 3V2TA 1WTOA 3VYRA 5LL6S 1RCVD 3IFTA 1KLGD 1XX8A 1PFNA 1TT2A 1SNPA 5FLXE 1SNDA 1LLRD 2RVLA 1HTPA 1STEA 2O5JC 3NE5B 1B3AA 1SAPA 4RGMA 3KBXA 2B2UC 3MVVA 1MI2A 3BG3A 5DAUA 3QWNA 4XTCS 3IFDA 1F2MA 5CORA 2Z1CA 3QOJA 3DWQA 3MXUA 1MD2D 1IW7D 1FNVA 1ET9A 3IL8A 4ZAIA 2NZ1D 2F0DA 2WB1B 1YNND 2MGSA 3DWAA 1BOSA 1I6HB 4K5XA 1MSGA 1KDAA 2PW7A 1LTGD 2LS01 2NTSA 4TQUS 4C3JB 1GUWA 2NB0A 1NSNS 3BVZA 3TN2A 2EJGC 2O5IC 1LTAD 2EYHA 4DXFA 5J1ZA 4HCSA 3GP7A 3P7JA 4NDXA 4XXEA 1GHJA 5I2XA 5EBDA 2B2YC 3D31A 1TWFB 1T5EA 4FF3A 2MHVA 1X32A 4RA8A 3OMCA 2F0PA 2NUCA 1EIGA 2K28A 3MA2B 2F0QA 2EDGA 2E2IB 1WTWA 1HQRD 1F2LA 2XVSA 1D2BA 5C4ZA 3PIP3 4ZQ3A 3EFXD 1DOKA 2L9HA 2NVYB 3GTOB 2EOTA 1Z7TA 2JXMB 4I65A 2TSSA 5KYIA 3J7AV 1YNNC 3AMUA 1E0BA 4A3EB 5KNDA 1IYUA 4K14A 1QOHA 1EEFD 1CQVA 2XRSD 3EA6A 1S5CD 2OEOA 2LY7A 1XYIA 3GV3A 1GUGA 5CR3A 1OO9B 1RODA 4IUPA 1WTPA 4PNYA 1O7ZA 1TY2A 3JAML 1OXTA 1D5ZC 3R8BA 1A2UA 1CI3M 4FXKC 3NQTA 1PFMA 4NW2A 2F1MA 3T4AC 1SNMA 3FRPB 2HCIA 5IIFA 3K0YA 2GA4B 2NTTA 1I4PA 5KGUA 3NXWA 3HEJA 4NP5A 5C0XH 5EPKA 3R2TA 2EYMA 3BDOA 3CRKC 1TS4A 2LKVA 1LACA 3TZDA 2KVMA 1WVLA 1FGBD 4K6DA 1C8CA 5KEEA 2HUGA 1DZ1A 3H0GB 1TWGB 3OSOA 1H9JA 2JA6B 3R2IA 2RA4A 1B50A 2K04A 1F9PA 3ONAB 4X3UA 4ZKBB 1A3UA 4IUQA 3VYSA 4C56C 2ZXPA 1D1KA 1LT5D 4C3JG 1NR2A 1X3QA 2IT1A 4G7HC 4K5WA 4DAPA 1HTLD 2SDFA 4KHVA 4NMZA 5ELBA 3VR6A 4E6IA 3HOZB 3TMEA 2V4DA 3L3OC 4QUCA 4RH6A 5C5MA 4DXGA 1G6ZA 2XN9C 2BDNA 3NP8A 2A69D 4CKBA 2F0IA 3I90A 3EVQA 3K6OA 4CGYB 5C3XA 5A35A 5COYA 5FLXL 2F0KA 1STHA 5IOCA 2FJ2A 3HOYB 1ZXTA 1L0YB 4XQJA 4MHEA 1QJOA 2F0JA 2R6GA 5IGDA 4L6TB 3I70A 1EZ8A 1B9NA 4C3IB 1HRJA 3W2DA 5C0XG 2DN8A 2HCCA 2K5QA 2D62A 1EY7A 2CW0C 1TY0A 2VXWA 3QO2A 2L5TA 5AFWA 3URYA 3C1EA 3J81E 3LNNA 1DXMA 2JP1A 5EKKA 1ML0D 4KMUC 1R4QB 4R9WA 1BCPB 1L0XB 3GTPB 1ILPA 2VUMB 1C4QA 4ABNA 1LO5D 3KLSA 1H9SA 3SEBA 3VR5A 3D6WA 3RLFA 4AYBB 1ZKOA 1HHVA 3PUXA 5C0XI 5IT9E 2IWHA 1PTOC 3OIQA 4V0BA 4RGNA 4CKCA 5LHY1 5I9OA 4ULLA 1RKNA 1U4LA 3NTKA 4FVMA 1JWSD 2A74C 4B08A 1HA6A 2D2CC 2Z4IA 2BDOA 1DJRD 1I50B 3CRLC 2XWJB 2PYKA 3V96A 3PMFA 1GJXA 2DY7A 5JJZA 3ND8A 2M00A 2RDHA 5I6YA 2A68D 1M4VA 1EQTA 1HA5A 4A3FB 2I07B 4JBWA 3NBIA 3EQLC 2PCFB 3WDNA 1SE3A 1DONA 2WAQB 4RCOA 1QE6A 4JK1C 2CQAA 3I3CA 3GO5A 4PMWA 3I72A 4IZ8A 1FD7D 3RMHA 3U9OA 1SXTA 4HR7B 1CQFA 3S2HB 3K7AB 3GD7A 4XIGS 2E2JB 2A6HC 4QB4A 5EPJA 3A7AB 5LL6X 1S5ED 1I4HA 2X69A 4WRDA 4Q0FA 1ENAA 2EY5A 2Y0SB 2KJXA 2NYZD 4BA2I 2NVTB 2F0TA 4WORA 3KUPA 1B9MA 3KLSX 4K2LA 2WINB 3Q6SA 5FOBB 3S1MB 5C3EB 2E2HB 1S5BD 5CV7A 4HSPA 4RAUC 4C3IG 5C44B 2I46A 4UAIA 1B53A 4EQOA 3WOFA 3S14B 1KABA 4BY1B 4IFDH 3A55A 2Q8IB 1IYVA 1AEXA 2QF7A 1JOQA 1OXSC 3D4WA 2F0EA 1SE2A 1F77A 4V190 3CHBD 4EVOA 5T1IA 1PTOB 3PO3B 3DHQA 3C3LA 5EKIA 3C46A 4X3TA 2B2UA 1RDPD 1PXUA 2K32A 4BWGB 1U4PA 4RHSA 2F0OA 4R8IA 5EPLA 3PO2B 4ZLTF 1C48A 2M2LA 4WFN3 3OMGA 1SYCA 2RSOA 3NQIA 3G7LA 2XRQD 2AWNA 4K8IA 3TP8A 3PV0A 1JE4A 4BBSB 3OIPA 2DY8A 2B2WC 3EJIA 5M3MB 1VMPA 3NWSA 3T51B 3VR4A 3TP5A 3VR2A 2FFKB 3L9AX 1JWMD 2N88A 1AZPA 1F9RA 1LTSD 3E5SA 1PTOH 1QNUA 3VR3A 5E4XA 4ME5A 5CV4A 4BBRB 3LWUA 3I4MB 1TWCB 3BYTB 3P1HA 5C3WA 2QKIC 3M4YA 4K8JA 2B2YA 2X6GA 1Y8OB 3K57A 1JOKA 1NCVA 3ZYYX 5CV8A 3X3NA 4IFDG 2LFNA 3Q24A 3J81L 1RD9D 5CV6A 5I4DA 2RDGA 3N52A 1FR3A 3BZDB 4TSSA 2Q8RE 1VF7A 4HTHA 3KK7A 1M8AA 4B9WA 1BCPD 5M5XB 1PZJD 4RHRA 4KD4A 1QCBD 4M1UB 2ICIA 2B8GA 2KCNA 1NUCA 2BOSA 1EY8A 2SNSA 5IT9L 4TKOB 1RTOA 3QIAA 4Q5VA 1Y8NB 3NUCA 4IUTA 4FP5D 1GUNA 2KCCA 4EQPA 1STBA 2Z4HA 4IFDI 4IN3A 2JEAI 1II3A 1CM9A 2KHSA 3G6JB 4A3GB 1BF4A 3H3VC 2OXPA 5CBEE 4MIUA 3K59A 2EYPA 3HG9A 5JEAH 4A3JB 2FMMA 4RKLA 1S5DD 1A3TA 1EFID 2KA7A 2AQ2B 5TSSA 1EYDA 1A2TA 4OIJA 4HEDA 4U673 1WD1A 2KEEA 1LTTD 1B4OA 3VYUA 2EYLA 3IKJA 2BE5C 2F0WA 1TQOA 1GOZA 4B9XA 3J80E 4QMGA 1WTQA 1PTOF 1I4QA 1Q1BA 1F2YA 1Y1WB 1G291 1V8QA 4OIKA 3K5NA 1KLUD 3QOLA 2D5DA 4IURA 2J4XA 1BCPC 5J39A 3N6RA 4K2KA 1CHQD 3DUZA 4MN3A 1HCZA 5K5PA 1PZKD 3J7YW 1CZGA 4OGQC 1D6EC 5JAVA 4GZYC 3TP7A 5KYLA 3GTQB 1Q1EA 1G2SA 3GTMB 4QIWB 2KQ3A 1CZWA 1YNJD 3S1RB 1JCKB 2RQXA 3Q22A 2O2LD 3C2PA 4DU9A 2E76C 4OO1I 2F0HA 1TS3A 1BBXC 2PO4A 2CW0D 3KF8A 1IKLA 4RGTA 1EQVA 4KV6A 1XTCD 3HOVB 5M3FB 1OXXK 4H44C 4FF4A 5JPMC 5F2DA 4KK7A 1DD2A 1TWAB 4KJNA 5G3LF 5D14A 5EKLA 5JEAG 4O1NA 1OXVA 1EY4A 1Z6HA 2ENBA 3D3RA 4J8QA 1SEBD 5A2QL 1KTKA 3M7NA 4XYQA 2R7ZB 3TZUA 5ISRA 4BS9A 1KNEA 1MSHA 3V05A 2PMZB 3HRZC 4ZRZA 1PTOD 4RFBA 1EYCA 4FXDA 4G4KA 4DA2A 2MP1A 2FMCA 3SXHA 2L0CA 2QEJC 3PUYA 1XWEA 3VA7A 3SR1A 5CMDA 3RUZA 3T16A 4KI0A 4DK1A 2ZXRA 5JPNC 3L7ZC 2L55A 2PPBC 3VA5A 4LAAA 3OPOA 1Q3LA 4H0LC 3NSWA 3NPPA 1YNJC 2IJ0A 1I4GA 4A93B 4XT1B 2F0UA 3PIO3 3P75A 4U68A 3Q0AA 3A56A 1ET6A 3LWEA 2L11A 2NN6I 3MFYA 2F0NA 3TDQA 2DNCA 1LT3D 3T53B 5K36H 1PMRA 3SK4A 2DNEA 1AZQA 1SYFA 1Y69U 4RCNA 5E3FA 3RZOB 5G3LD 1KDBA 3S1QB 4C1NI 1JWUD 2JA8B 1EZ6A 1UUPA 2A6HD 4NKLA 1KDCA 1KAAA 1NR4A 2KEDA 4H7BA 1EOTA 3IAYA 2QDBA 4RGOS 1G91A 1EY0A 2JE6I 4KKTA 4H13C 4ILWA 3S17B 5FK9C 2F3WA 2EXZA 3PUWA 2EYJA 2BA0A 1WTVA 1B1ZA 2BCOA 5JOBA 2VB3X 1O80A 2CVRA 2XSCA 2SNMA 1A3VA 5D65A 2AUJD 1CK1A 1GXDC 2L4NA 3WOEA 1WTXA 3MTSA 3SHLA 1AP0A 1JORA 1BQQT 2F03A 1SYBA 1XXGA 3S16B 3GTKB 4L63B 1AFPA 2IL8A 1LTID 5I6WA 5KNCA 2R61A 1O7LA 2WACA 1Y8PB 4WJWA 1JB3A 1A15A 2XWBB 3BYYB 4HAEA 3HP3A 2JA7B 3EROA 2HDMA 3GV6A 1DYQA 1V43A 5K36G 1UAPA 1CHPD 2F0SA 2B63B 1SNCA 1IKMA 1B2TA 3KLRA 2D9UA 2OF1A 4HMIA 5JEAJ 1EWCA 1D5XC 1JOOA 3T56B 1CA6A 2XNAC 5DM73 4C3HB 3SK5A 2EJFC 4IQZA 2AQ1B 4X3KA 3DM1A 5BN3A 1UEAB 2EY1A 4LJZC 1CFMA 1H9MA 1V1PB 1ZYRC 4S3SA 1QWYA 3UI2A 2WV6D 1SNQA 2KUMA 3A54A 2F3VA 2R93B 1EU3A 1O78A 1CA5A 1OXUA 2VB2X 1DM0B 1FNUA 4DGZA 2F0GA 1TIID 3DEPA 1PRTC 3TBIB 1F2ZA 1SYDA 2B2WA 2HDLA 2J0TD 3FPUB 4N9PA 3T13A 4F87A 5C0XJ 1Q90A 4ZYSA 3OW7A 2WP8J 3AU7A 4RWSC 2RBMA 1BCPF 1HUMA 4ZUJA 5IODA 3D8GA 1Y1VB 3S9WA 2B2TA 4QF4A 4EGVA 1BNZA 2K1BA 1RTNA 4FO2A 2E74C 2EY6A 3MXNA 4DAVA 4M8AA 1EEID 1DOLA 4KY7A 4K6LA 3PUZA 4J6HA 3D4DA 2RDFA 5J22A 3E6ZX 1TWHB 3H6MA 2B39A 4BA1I 1TR5A 4BY7B 2IX3A 3K5MA 4CJ2C 4I7ZC 1D1IA 3HOUB 2OT2A 5FO9B 3BVMA 3VYTA 2E75C 3BDCA 5M5YB 5C4JB 5C6AA 3SVMA 1SBBB 2MJ8A 1F9SA 4FNFA 2A6EC 2B2TC 5IGBA 1E2ZA 5C4XB 2EJMA 2K05A 2AQ3B 1IHZA 1QG7A 4A3IB 4IALA 3D6CA 4XQNA 2BE5D 3NK9A 1I3QB 4OO1H 3FVQA 1J9OA 1WCMB 2K7VA 3AB9A 4C2MB 4TRDA 2E2DC 2X6LA 4HCEA 2FHTA 3I8ZA 3QB3A 2K03A 2CHBD 2ZXOA 2FINB 3CU7A 3GQBA 2G9DA 2KECA 5EJWA 3E0JA 2R3ZA 3A8IE 2F0MA 1ESFA 1EWHA 4N9TA 1SJHD 3FPPA 4C3HG 3HKZB 1BO0A 2BA1A 2JA5B 3M3YB 1MBYA 2G9HD 4R8NA 4CJ1B 4XDXA 3GTLB 1EIHA 2NBFA 4HMJA 4YIJA 1AW7A 3TP6A 1W6JA 3M85A 2RKSA 1PRTB 4A3MB 1PLFA 3Q23A 5I2YA 4EQNA 1AN8A 1VMCA 4OHJA 1T5XD 5IGGA 1SDFA 2SOBA 5CGKA 5FO8B 5C4HA 1GUOA 1EY5A 1WD0A 1VDZA 1D5MC 1JQYD 1RJTA 1I4XA 1ENCA 5FO7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3T A;  1M8A A;  2HCC A;  1X32 A;  5CMD A;  5D65 A;  1EL0 A;  2B2U A;  1XX8 A;  1TVX A;  4RA8 A;  3TZD A;  1DON A;  1PFN A;  2KVM A;  2H1E A;  4MN3 A;  1QE6 A;  1CA5 A;  1WVL A;  3FDT A;  3I3C A;  2VXW A;  3QO2 A;  1EIG A;  2L4N A;  2N55 A;  4XT3 B;  2K28 A;  1C8C A;  2RVL A;  1U4P A;  1WTX A;  1HFG A;  3I91 A;  3DEO A;  3MTS A;  5AFW A;  5EPL A;  2HUG A;  4R8I A;  1AP0 A;  4ZLT F;  1DZ1 A;  2M2L A;  1RTO A;  3DEP A;  1J8I A;  1B3A A;  1J9O A;  1SAP A;  2JP1 A;  5T1G A;  1Q3L A;  4ZKC B;  1WTW A;  1ML0 D;  1NAP A;  2RSO A;  4R9W A;  2X6L A;  1ILP A;  1HUN A;  2J7Z A;  2RA4 A;  2FHT A;  2B2U C;  3KBX A;  1F2L A;  1X3P A;  1MI2 A;  1G2S A;  2B2V C;  2K04 A;  2B2W A;  3I8Z A;  2HDL A;  1B50 A;  1F9P A;  2IL8 A;  2L12 A;  3G7L A;  3IFD A;  2K03 A;  3FPU B;  3ONA B;  1S4Z A;  4IUT A;  2FIN B;  3H91 A;  4X3U A;  4XT1 B;  5COR A;  2KEC A;  5EPJ A;  4ZKB B;  1DOK A;  3F2U A;  5EJW A;  2L9H A;  2R3Z A;  4IUQ A;  4U68 A;  4RWS C;  1BF4 A;  1JE4 A;  1ESR A;  3D6W A;  2EE1 A;  2EOT A;  2K01 A;  1CM9 A;  1HUM A;  2XIW A;  3LWE A;  1BBX C;  1G2T A;  1HFN A;  1HHV A;  2L11 A;  1LV9 A;  1RHP A;  2X69 A;  1A15 A;  2DY8 A;  4HSV A;  5DNF A;  3IL8 A;  2B2W C;  4HAE A;  1BO0 A;  4O42 A;  1ILQ A;  1IKL A;  2NZ1 D;  1NR2 A;  1X3Q A;  3HP3 A;  4ZAI A;  5CBE E;  1AZQ A;  2HDM A;  3GV6 A;  4ZK9 B;  2B2T A;  2NYZ D;  1MGS A;  1VMP A;  1BNZ A;  2K1B A;  2SDF A;  1E0B A;  1JIC A;  2FMM A;  4CJ1 B;  1WTR A;  4XDX A;  1RTN A;  1IKM A;  1B2T A;  5D14 A;  1ICW A;  2FFK B;  2MGS A;  3KUP A;  1DOL A;  2N88 A;  1F9R A;  1AZP A;  1EIH A;  2D9U A;  3Q6S A;  1G6Z A;  4QUC A;  1U4L A;  2BDN A;  1MSG A;  4OIJ A;  1XYI A;  1NR4 A;  1PLF A;  2KED A;  3GV3 A;  1O7Y A;  4LMQ D;  4HED A;  1KNA A;  5E4X A;  4X3S A;  1CA6 A;  1WD1 A;  2KEE A;  3I90 A;  1EOT A;  2Q8T A;  4RAU C;  1ROD A;  1U4R A;  1B4O A;  1F9Q A;  4IUP A;  5EQ0 A;  1WTP A;  1IL8 A;  1GUW A;  1O7Z A;  3R93 A;  3MWY W;  1G91 A;  4X3K A;  1PDQ A;  3DM1 A;  4QUF A;  4CJ2 C;  1KNE A;  5COY A;  1MSH A;  1VMC A;  3TN2 A;  4UAI A;  1B53 A;  2JYO A;  1PFM A;  2B2Y A;  4NW2 A;  2B2V A;  2X6G A;  4IUV A;  2HCI A;  4DN4 M;  1SDF A;  1WTQ A;  2FJ2 A;  1ZXT A;  2EPB A;  1NCV A;  2MP1 A;  2DY7 A;  2KOL A;  4HCS A;  5JJZ A;  3SVM A;  2MPM A;  4MHE A;  4CJ0 B;  4IUU A;  2MJ8 A;  2NWG A;  3P7J A;  1F9S A;  1SSO A;  1QNK A;  1WTV A;  2B2T C;  1EQT A;  2L1B A;  1WD0 A;  3N52 A;  3UI2 A;  5EPK A;  5CBA E;  1PFB A;  2RSN A;  5T1I A;  1HA6 A;  4OIK A;  2B2Y C;  2KUM A;  1O80 A;  2CVR A;  2Q8R E;  2K05 A;  4IUR A;  1U4M A;  1WTO A;  1RJT A;  1HRJ A;  1QG7 A;  1DOM A;  5EKI A;  5E4W C; 
#chains in the Genus database with same CATH topology
 4P2C B;  1IBL L;  5KRU A;  4YWK A;  2QW7 A;  1IW7 C;  1SYG A;  4PMB A;  1Z47 A;  1QB5 D;  4LK1 C;  2K5D A;  1BKB A;  3CCL A;  2JA5 H;  2SEB D;  3M3Y H;  3MC0 B;  1DGS A;  1HFG A;  2NN6 H;  1ENF A;  2K6A A;  3DEO A;  1H9R A;  2F0V A;  4PQX A;  2IX1 A;  1J8I A;  4OO1 G;  1EY6 A;  4JI4 L;  4IPD A;  4CDE C;  3GTL H;  4JYA L;  1TKW B;  3NBH B;  4KD3 A;  2J7Z A;  4ZUI A;  5E1F A;  4B3T L;  3H91 A;  3OOC A;  4OWX B;  4A3M H;  4DFA A;  3PF4 A;  1ESR A;  4A3B B;  4CBV A;  1TWF H;  2XIW A;  1E24 A;  1G2T A;  3HOW B;  1LV9 A;  5M5W B;  1LT6 D;  3QJY A;  4KKU A;  4DK0 A;  1ILQ A;  3SK6 A;  4KY6 A;  4BY7 G;  1MGS A;  3HOU G;  1WTR A;  2JJQ A;  3MEF A;  1E1T A;  1G6P A;  4XYO A;  1GHK A;  3FEW X;  4J1M A;  4DNR B;  2EYO A;  1HQM C;  2KHJ A;  2QIL A;  4IOA A;  2AWO A;  3QG1 A;  1U4R A;  4KN4 C;  4B3M Q;  3U9S A;  3GTO H;  3BZC A;  4EQ5 A;  4KJO A;  2O4X A;  1E2W A;  1R9T B;  1VCI A;  4KKS A;  4CKE A;  2BH2 A;  1STY A;  2K75 A;  3CKI B;  2HIV A;  1HR0 W;  2ZM6 Q;  4KHZ A;  4G7Z C;  3DXJ C;  4G57 A;  4QCL A;  1WCM G;  5HGT A;  4A3E H;  3HGB A;  3I4L A;  4KTA A;  4OL7 A;  4ALP A;  1PFB A;  5FKA C;  1U4M A;  1KAW A;  4A3B H;  2WII B;  1LAB A;  4Z9C B;  1KIX A;  2WKC A;  4DNT B;  3MFG A;  3J7A F;  5E4W C;  1XPU A;  5J3B A;  3HOW H;  1DCZ A;  2JEB I;  5M5W H;  3OWE B;  1EL0 A;  4HID A;  4ME3 A;  2H1E A;  2C9O A;  5D3D A;  4G7O C;  3FDT A;  1KC8 C;  1HNX L;  4OEM B;  2VQE L;  2N55 A;  4XT3 B;  2HQL A;  4UDU C;  1JR0 D;  1PH1 A;  5ELD A;  1STG A;  1MIU A;  3HKZ G;  4JI5 Q;  4TVA B;  4IFD J;  2JA5 G;  3OHX C;  3C1F A;  5T1G A;  4ZKC B;  2NN6 G;  3SE0 A;  1I94 L;  3W3A A;  1FYC A;  1WI5 A;  1V1P A;  3PUV A;  2L12 A;  1SN8 A;  4KN7 C;  1V9P A;  4P75 A;  1UNS A;  1BUV T;  4DAM A;  3F2U A;  3TSS A;  3MXP A;  3NEM A;  1PZI D;  2K01 A;  2Q2U A;  1Q12 A;  4A3M G;  3KBG A;  1HFN A;  3MHB A;  3CCU A;  5CYU A;  5DNF A;  2NVQ B;  1U9R A;  4IUN A;  1C7Y A;  4LUZ A;  1TU2 B;  4B3S Q;  4JI2 L;  4JI5 L;  1VQG A;  2IW3 A;  1R9T H;  4DV0 Q;  1SYE A;  3OWF A;  5DEH A;  4K5V A;  2AHO B;  4LF9 Q;  2PQE A;  4N8F A;  1PRT F;  3ULJ A;  1XNR L;  2OQ0 A;  3L2P A;  3FKI B;  4DR4 Q;  3BS1 A;  2JA6 H;  4HN7 A;  3NTI A;  4Y52 H;  1IYJ B;  5KIX A;  1QIL A;  5CV9 A;  3EN2 A;  3HOX B;  4LF7 L;  5EQ0 A;  4ODG A;  1IL8 A;  1SMY D;  3CP0 A;  3ITP A;  2F0L A;  1STA A;  2PI2 A;  5EGT A;  4KY5 A;  1STN A;  3CD6 A;  3A8J E;  3S2D B;  2B2V A;  2YYZ A;  2GVB A;  4GKJ L;  2PZU A;  5KNB A;  5BN5 A;  3O13 A;  3RN2 A;  2EPB A;  4MZ9 A;  2KOL A;  3I55 A;  2MPM A;  5ELE A;  2PZT A;  1SFO B;  4DR4 L;  2PW5 A;  3RD4 A;  1KL9 A;  4R4O A;  5CBA E;  4A3E G;  2B8F A;  1EY9 A;  3X3M A;  3CQZ B;  1JC7 A;  2OQK A;  3GTJ B;  5CV5 A;  5IE8 A;  1GVP A;  1E2V A;  2RHQ B;  3CF5 A;  1TVX A;  4HJ7 A;  2NVQ H;  4A3B G;  1FVI A;  1Q81 C;  3CC2 A;  2ZT9 C;  4PMC A;  1GUT A;  1X9N A;  3A7L A;  3HOW G;  4BXX H;  3MXG A;  1HXY D;  1G8Z D;  5M9O A;  3MEH A;  1ONL A;  1HNZ Q;  4FF2 A;  1UEB A;  2ZJR A;  1NAP A;  4JV5 Q;  4LFC L;  1HUN A;  1BDO A;  3RLN A;  1ZYR D;  2B2V C;  5EBC A;  3RZD B;  3FKI H;  1L2F A;  2G5D A;  4F8M A;  5IGE A;  3K5O A;  4O0A A;  4DPG A;  2A69 C;  2EIF A;  3ERS X;  5CC4 A;  2CCZ A;  4CHT B;  3BDL A;  3HOX H;  1VF5 C;  3I73 A;  1JE5 A;  4FYD A;  1CSP A;  2I0Q A;  4FF1 A;  1PH5 A;  1L0W A;  1RHP A;  1V1O A;  1LTB D;  2PNH A;  4O42 A;  5JVH 3;  2MNA A;  4RKB A;  3S2D H;  1NTG A;  4GLX A;  4LFB Q;  3BVG A;  1ZEQ X;  5C5L A;  1PRT D;  1EIF A;  4JV5 L;  2UXD L;  1LTR D;  1LT4 D;  4P74 A;  2IX0 A;  5IGC A;  3HZX A;  2PZW A;  1SFO H;  4NXN Q;  1Q86 C;  3NWT A;  4IJL A;  4YHH Q;  3J80 i;  4LF5 Q;  5ELF A;  1KD1 C;  2MUY A;  1QVC A;  1H9K A;  3H94 A;  4A3K B;  4FXG C;  1A63 A;  3GTP H;  1A0I A;  2VUM H;  4DV2 L;  5JVG 3;  3KF6 B;  1UE5 A;  2A5H A;  2JA6 G;  1O7Y A;  1SMY C;  4IPC A;  3GTJ H;  2A73 B;  1F9Q A;  3D4R A;  5DM6 3;  5ELC A;  4DAY A;  2K5N A;  3MWY W;  1EYA A;  4QUF A;  2ID0 A;  2YU9 B;  3FMC A;  1BR9 A;  2CWA A;  1NBW A;  2H4O A;  1FNW A;  5I9P A;  2DJF C;  3J80 L;  3NEL A;  4C1N K;  1PYW D;  3I4N B;  4DN4 M;  1N36 Q;  2EVB A;  4PZ8 A;  1GM5 A;  3HS0 C;  2P5Z X;  5NUC A;  4AYB E;  1QUQ B;  4YHH L;  4IUU A;  2NWG A;  3RZD H;  3GTG B;  1I6V C;  1M90 C;  2NVX B;  3ULL A;  2KEN A;  1QNK A;  1EU4 A;  1K73 C;  3E3X A;  3DWP A;  2JSO A;  3UDI A;  2RSN A;  5BN4 A;  5IGF A;  3SK8 A;  1SJE D;  1N34 Q;  2HQE A;  4A3D B;  1K8A C;  3NTH A;  1DOM A;  3JAM E;  3PIO A;  3S1N B;  4POF A;  4ID6 A;  4DK6 C;  1Q7Y C;  3G4S A;  1R4P B;  3M7G A;  3DMU A;  2QCP X;  4JG2 A;  1TS2 A;  4L5R C;  1RF2 D;  1I50 H;  3I91 A;  1I4R A;  4JPB W;  4B3R Q;  2M9V A;  4BXX G;  1K83 B;  1VQI A;  1CT1 D;  4OWW B;  1TS5 A;  1X3P A;  1W6K A;  2A6E D;  3K5L A;  2JA9 A;  2VNU D;  1PH4 A;  4A3K H;  1YJN A;  2K5W A;  3D0F A;  1LTL A;  1S4Z A;  2RCF A;  1HPC A;  5IWA Q;  3FKI G;  2IPK D;  3CW2 C;  3H09 A;  4Y7N B;  4A3F H;  3MZ5 A;  5HUR A;  2EE1 A;  2WFW A;  2VY3 A;  3P20 A;  4HSV A;  1A6X A;  2V1C C;  4XQQ A;  4NXM L;  3HOX G;  3K58 A;  2YU9 H;  2ZJQ A;  4DF7 A;  1LUZ A;  5H1S E;  1K8O A;  3W1G A;  4ZK9 B;  4B3R L;  3I4N H;  2XGT A;  3VDY A;  3R3O A;  3A8K E;  3NHH A;  4YY3 L;  2EYF A;  1JIC A;  2IHF A;  3ND9 A;  4JBM A;  3SDZ A;  1B44 D;  3NBH A;  3GTG H;  5D3I B;  1ICW A;  2F0F A;  2WAQ E;  3MAQ A;  4GKK Q;  2A68 C;  1X56 A;  2Z8L A;  1K8M A;  2PNR C;  1SE4 A;  2AUK A;  1U0L A;  4N8X 1;  4A3D H;  5DLQ E;  4LMQ D;  2EY2 A;  1KNA A;  4X3S A;  4F88 A;  5A2Q E;  2Q8T A;  2VUM G;  1CTM A;  1S5F D;  2F52 A;  3ERQ A;  4F7X A;  1VQ9 A;  1IL2 A;  2N8N A;  2LMC B;  1E3P A;  3R93 A;  1BXT A;  2EZV A;  5LMN Q;  1PDQ A;  3S15 B;  3M4O B;  2K33 A;  3T1Y Q;  2WKD A;  2K5V A;  2JYO A;  1FJG Q;  2F4I A;  2Q2I A;  3BZK A;  4IUV A;  4L8J A;  1GUS A;  2ICE C;  3CMA A;  2CH4 A;  3LX0 A;  4AQY L;  4PV1 C;  1HZ9 A;  2C5C A;  1K83 H;  1VQJ A;  1Q8I A;  1SNO A;  4CJ0 B;  1SSO A;  2DUD A;  2L1B A;  3KDF B;  3QR8 A;  2TMP A;  1HH2 P;  2Y0S E;  1H9S B;  2R92 B;  3V2T A;  4JOI C;  4Y7N H;  1SLJ A;  1WTO A;  1KRS A;  3VYR A;  5LL6 S;  1RCV D;  5C3E H;  1U5K A;  5LMN L;  3IFT A;  1KLG D;  1XX8 A;  4LWC A;  1PFN A;  1TT2 A;  1SNP A;  5FLX E;  5JJK A;  1P16 A;  1SND A;  1FJG L;  1LLR D;  2PQA B;  2RVL A;  1HTP A;  1STE A;  1SRO A;  4JI6 Q;  2O5J C;  4UPA A;  3NE5 B;  1B3A A;  1SAP A;  4RGM A;  3T1H L;  4BY1 H;  4X64 L;  3KBX A;  2B2U C;  3MVV A;  1MI2 A;  3BG3 A;  5DAU A;  3QWN A;  4XTC S;  3IFD A;  1F2M A;  5COR A;  2D0O A;  2Z1C A;  3QOJ A;  3DWQ A;  2MQH A;  3MXU A;  4A3K G;  1MKH A;  4LNQ A;  3CC4 A;  1MD2 D;  3RR5 A;  2QEX A;  1VQ4 A;  1X6O A;  1IW7 D;  1FNV A;  1ET9 A;  3IL8 A;  4A3F G;  3W5O A;  3S15 H;  3M4O H;  4ZAI A;  4IOC A;  4KHP Q;  2NZ1 D;  3PGZ A;  4JI8 Q;  2F0D A;  2WB1 B;  1B70 B;  1E22 A;  1LYL A;  3I4N G;  1C0A A;  1YNN D;  2MGS A;  3DWA A;  3OW2 A;  1BOS A;  1I6H B;  2UUC Q;  4CDF C;  4K5X A;  1MSG A;  1EYG A;  2R92 H;  1KDA A;  2PW7 A;  1LTG D;  2LS0 1;  2NTS A;  4TQU S;  1PVO A;  1X3F A;  4C3J B;  1GUW A;  2NB0 A;  4A3D G;  2YTY A;  1NSN S;  4DV6 L;  4KHP L;  3BVZ A;  1SRU A;  2A1A A;  3TN2 A;  2EJG C;  2O5I C;  1LTA D;  4OEL B;  1VS0 A;  2ATW A;  2EYH A;  4R4T A;  4DXF A;  5J1Z A;  5M3M H;  4HCS A;  3GDE A;  3RLO A;  3GP7 A;  3P7J A;  2VL6 A;  2K52 A;  4NDX A;  4XXE A;  1GHJ A;  1PYB A;  5I2X A;  4DV7 Q;  2ZTE A;  5EBD A;  2CH4 W;  2B2Y C;  3D31 A;  1TWF B;  1XJV A;  1T5E A;  4FF3 A;  3ZJY C;  2MHV A;  1XMQ L;  5GAD C;  5LMN W;  4X62 Q;  1X32 A;  1NE3 A;  4RA8 A;  3F2B A;  3OMC A;  1N33 Q;  3ICE A;  2F0P A;  5C3E G;  4R4Q A;  3ER0 A;  2NUC A;  1EIG A;  2K28 A;  3MA2 B;  1T9H A;  2F0Q A;  3E9I A;  2EDG A;  1CKO A;  2E2I B;  2YTX A;  3G71 A;  1WTW A;  1HQR D;  3CPW A;  1F2L A;  2XVS A;  1D2B A;  4BY1 G;  5C4Z A;  1I6H H;  3PIP 3;  1HZC A;  4ZQ3 A;  3EFX D;  1Q8K A;  2LXJ A;  1DOK A;  4LF6 L;  1EFW A;  2L9H A;  2F3I A;  2NVY B;  2UUB Q;  1EWI A;  3A5Z B;  3GTO B;  2EOT A;  4C3J H;  1FGU A;  4JI3 L;  1Z7T A;  2JXM B;  4I65 A;  2TSS A;  5EAY A;  5KYI A;  5GAE C;  3J7A V;  5M5X H;  5HGQ A;  1TXY A;  1YNN C;  3AMU A;  1E0B A;  4A3E B;  1VQH A;  5KND A;  3PSI A;  1IYU A;  4DV5 L;  4K14 A;  1MHW C;  1QOH A;  1EEF D;  5GAG C;  2CQO A;  4DR2 Q;  2YV5 A;  1CQV A;  2XRS D;  4P72 A;  5FLM H;  3EA6 A;  1S5C D;  2OEO A;  2LY7 A;  1XYI A;  2AKW B;  3GV3 A;  4GNX C;  1FL0 A;  1GUG A;  5CR3 A;  1OO9 B;  1N32 Q;  1ROD A;  4IUP A;  1WTP A;  2R92 G;  1K3R A;  4PNY A;  1O7Z A;  1TY2 A;  3JAM L;  1OXT A;  1D5Z C;  3R8B A;  1A2U A;  1NMF A;  1OTC A;  3Q8D A;  1CI3 M;  4A3G H;  4WJ4 A;  4FXK C;  3NQT A;  1PFM A;  4UP7 A;  4NW2 A;  2F1M A;  3T4A C;  1SNM A;  3FRP B;  2HCI A;  2HIX A;  4L5S A;  5IIF A;  4GLV B;  3K0Y A;  2E2I H;  2GA4 B;  4K0K Q;  1WTH A;  2NTT A;  2K4K A;  1I4P A;  5KGU A;  5E7N A;  3M4Q A;  3OTO Q;  1HJP A;  3NXW A;  5M3M G;  3HEJ A;  4A76 A;  1JJ2 A;  2C35 B;  4NP5 A;  5C0X H;  5EPK A;  3R2T A;  1Y14 B;  3FHW A;  2EYM A;  4R1J A;  3CCR A;  3BDO A;  2NVY H;  3KF6 A;  4LUV A;  3TRZ A;  1K9M C;  3CRK C;  1TS4 A;  2LKV A;  1LAC A;  3TZD A;  2KVM A;  4DR3 Q;  1WVL A;  1FGB D;  4MTN A;  3TRE A;  4K6D A;  1C8C A;  4RG1 A;  5KEE A;  2HUG A;  1DZ1 A;  5JJL A;  3H0G B;  1TWG B;  4DUY Q;  1QVG A;  3OSO A;  1H9J A;  2UU9 Q;  2WB1 G;  3OTO L;  2JA6 B;  3R2I A;  4IPH A;  1QUQ A;  2RA4 A;  2GVA A;  1B50 A;  2K04 A;  1F9P A;  3ONA B;  1NY4 A;  4B3M L;  1Y1W H;  4X66 Q;  4NB3 A;  4X3U A;  4ZKB B;  4ZCK A;  1A3U A;  2E5L Q;  4IUQ A;  3VYS A;  4C56 C;  2ZXP A;  4DR3 L;  1D1K A;  1LT5 D;  1XNQ Q;  4C3J G;  2ZM6 L;  1NR2 A;  1X3Q A;  2IT1 A;  4DR5 Q;  4G7H C;  4K5W A;  1D7Q A;  4DUY L;  3EBE A;  4DAP A;  1HTL D;  4EX5 A;  2SDF A;  4KHV A;  4OWT B;  4NMZ A;  5ELB A;  3CAM A;  3UE0 A;  3VR6 A;  1O7I A;  4E6I A;  3HOZ B;  3PQI A;  3TME A;  4X66 L;  2OTL A;  2V4D A;  3L3O C;  4QUC A;  4RH6 A;  5C5M A;  4DXG A;  1G6Z A;  2XN9 C;  2BDN A;  4MTK A;  3NP8 A;  2A69 D;  4CKB A;  3S1R H;  2F0I A;  3I90 A;  5FLM G;  4HIM A;  3EVQ A;  3K6O A;  4CGY B;  5C3X A;  5A35 A;  4HJ9 A;  5COY A;  4L5T A;  1SR3 A;  4A4I A;  4QIW E;  5FLX L;  2F0K A;  1STH A;  3H0G H;  4A3G G;  1TWG H;  5IOC A;  2FJ2 A;  3HOY B;  1ZXT A;  1L0Y B;  3WWV A;  4XQJ A;  4MHE A;  2IHE A;  5M3F H;  1QJO A;  2F0J A;  2R6G A;  1PA6 A;  5IGD A;  4L6T B;  3I70 A;  1EZ8 A;  1B9N A;  1J6Q A;  4C3I B;  1HRJ A;  3W2D A;  5C0X G;  4B3S L;  3CC7 A;  4DV0 L;  2DN8 A;  2HCC A;  3TQY A;  2KCT A;  1GO3 E;  2K5Q A;  4LF9 L;  2D62 A;  2R7Z H;  1EY7 A;  2CW0 C;  4JCV E;  1VQE A;  1TY0 A;  2VXW A;  2VZA A;  2L5T A;  3QO2 A;  5AFW A;  4GNX B;  3URY A;  2UXC Q;  1VQB A;  3C1E A;  4UY8 C;  3J81 E;  3LNN A;  1DXM A;  2JP1 A;  1I5F A;  5EKK A;  1ML0 D;  4KMU C;  1R4Q B;  4R9W A;  1BCP B;  1L0X B;  3GTP B;  1ILP A;  5ELO A;  2VUM B;  3HOZ H;  1C4Q A;  2Z9H A;  4ABN A;  3KDF A;  1LO5 D;  4LUO A;  3KLS A;  1GD7 A;  1H9S A;  3SEB A;  3VR5 A;  1ASY A;  5IYB H;  2LSS A;  2R7D A;  3D6W A;  1Y1W G;  2HT1 A;  3RLF A;  4AYB B;  4CDD C;  1ZKO A;  1HHV A;  1A62 A;  1KHI A;  3PUX A;  5C0X I;  5IT9 E;  2PQA A;  5ELN A;  2IWH A;  1PTO C;  3JAM c;  3OIQ A;  5BR8 Q;  4DUZ Q;  3HOY H;  2CFM A;  4V0B A;  4RGN A;  4JBJ A;  4CKC A;  5LHY 1;  5HY6 A;  4PZ6 A;  3CCQ A;  1YIT A;  5I9O A;  4ULL A;  1PH8 A;  1RKN A;  5IP9 H;  1U4L A;  3NTK A;  4C3I H;  1B3Q A;  4FVM A;  1JWS D;  1VQ5 A;  2A74 C;  3AEV A;  4B08 A;  1HA6 A;  2D2C C;  2Z4I A;  3KLW A;  2BDO A;  2Z6B A;  4JC0 A;  1DJR D;  1I50 B;  3CRL C;  2XWJ B;  2PYK A;  1HNZ L;  2UUA Q;  3V96 A;  2Q2H A;  1AE2 A;  1VQP A;  1Q46 A;  3PMF A;  1GJX A;  1K0R A;  4LF8 Q;  2DY7 A;  5JJZ A;  3H0G G;  3ND8 A;  5IP7 H;  2M00 A;  2RDH A;  5I6Y A;  4OON A;  2A68 D;  1B8A A;  3RZO H;  1QZG A;  1M4V A;  3S1Q H;  1EQT A;  1HA5 A;  1EQQ A;  5M3F G;  2D0P A;  4A3F B;  2I07 B;  1VQK A;  4JBW A;  3B6Y A;  3NBI A;  3EQL C;  2PCF B;  3RN5 A;  3WDN A;  4AIM A;  4LFB L;  1SE3 A;  2F4V Q;  3G48 A;  1DON A;  2WAQ B;  4RCO A;  1QE6 A;  1V1Q A;  3KF8 B;  4JK1 C;  2CQA A;  3I3C A;  3GO5 A;  4PMW A;  3I72 A;  4IZ8 A;  4NXN L;  4LF8 L;  4LF5 L;  2R7Z G;  1FD7 D;  3RMH A;  3U9O A;  1SXT A;  4HR7 B;  1CQF A;  3PF5 A;  3S17 H;  3I7F A;  3HKS A;  3S2H B;  3K7A B;  3GD7 A;  4XIG S;  1L1O C;  2E2J B;  3BJU A;  2A6H C;  4QB4 A;  5EPJ A;  3HOZ G;  4YCU A;  3A7A B;  2KHI A;  4DKA C;  5LL6 X;  1S5E D;  1I4H A;  2NZH A;  1N36 L;  2X69 A;  4WRD A;  5IYB G;  4Q0F A;  1ENA A;  4LF4 Q;  1YJW A;  4DV3 Q;  2EY5 A;  2Y0S B;  3TS0 A;  2KJX A;  2NYZ D;  4BA2 I;  2NVT B;  2F0T A;  4WOR A;  5FLX c;  1N34 L;  3HOY G;  3KUP A;  1B9M A;  3KLS X;  4K2L A;  2JN4 A;  2WIN B;  3Q6S A;  2L15 A;  5FOB B;  1W3S A;  1G51 A;  3S1M B;  5C3E B;  3F1Z A;  2E2H B;  4JI7 Q;  1S5B D;  4UP9 A;  5IP9 G;  5CV7 A;  4X65 Q;  1PFS A;  4HSP A;  1VQ7 A;  4RAU C;  4C3I G;  5C44 B;  4DR1 Q;  1PH7 A;  2I46 A;  2KBN A;  3M9B A;  4UAI A;  1B53 A;  4EQO A;  3WOF A;  2H5X A;  3S14 B;  1UE7 A;  1KAB A;  4BY1 B;  3H3V I;  4JOI A;  1AE3 A;  4IFD H;  3A55 A;  2JA7 H;  5IYD H;  1UWV A;  5IWA L;  1CKM A;  2Q8I B;  1IYV A;  1AEX A;  3S2H H;  3K7A H;  3K80 C;  2QF7 A;  1JOQ A;  1OXS C;  3D4W A;  2F0E A;  1SE2 A;  2E2J H;  1F77 A;  4V19 0;  3CHB D;  4EVO A;  5IP7 G;  5T1I A;  4JI7 L;  1PTO B;  3PO3 B;  3DHQ A;  3C3L A;  4JI1 Q;  1KRT A;  1VQM A;  5EKI A;  4DV4 Q;  3C46 A;  1AH9 A;  1PH6 A;  4X3T A;  2B2U A;  1W2B A;  2YTV A;  1XPR A;  1RDP D;  4AYB G;  1PXU A;  2K32 A;  2B3G A;  4BWG B;  1U4P A;  4RHS A;  2F0O A;  4R8I A;  2NVT H;  4GKK L;  5EPL A;  3PO2 B;  4ZLT F;  1C48 A;  2M2L A;  3CPF A;  4WFN 3;  3OMG A;  1SYC A;  2RSO A;  3NQI A;  1MJE A;  2ZTC A;  3G7L A;  3CCV A;  4OXP A;  4JI1 L;  4DV1 Q;  2NZO A;  2R7F A;  3S1M H;  2E2H H;  2XRQ D;  1XMO Q;  2AWN A;  4K8I A;  3TP8 A;  4OX9 Q;  3PV0 A;  3T1Y L;  1JE4 A;  4BBS B;  5C44 H;  3U58 A;  3OIP A;  1C9O A;  2DY8 A;  2B2W C;  2K50 A;  1JMC A;  3EJI A;  5M3M B;  3S14 H;  1EOV A;  1VMP A;  3NWS A;  3T51 B;  3VR4 A;  1PYS B;  3TP5 A;  5AJ3 Q;  3VR2 A;  2FFK B;  3L9A X;  1JWM D;  2N88 A;  1AZP A;  1F9R A;  5IY0 A;  1LTS D;  3E5S A;  2QGQ A;  1XMO L;  2DJG C;  5FJ8 H;  1PTO H;  3PO3 H;  1E1O A;  1QNU A;  3VR3 A;  2KCM A;  5E4X A;  3STB C;  4ME5 A;  5CV4 A;  4BBR B;  3LWU A;  3I4M B;  1J5E Q;  1TWC B;  3BYT B;  4JI6 L;  1L1O B;  3P1H A;  5C3W A;  2QKI C;  2IY5 B;  3M4Y A;  1VQO A;  2WAQ G;  4K8J A;  2B2Y A;  2X6G A;  1Y8O B;  3PO2 H;  3K57 A;  3SGI A;  1JOK A;  3CCM A;  1Y1V H;  1NCV A;  3ZYY X;  5CV8 A;  3X3N A;  4IFD G;  2LFN A;  3Q24 A;  3J81 L;  2JA7 G;  5IYD G;  1RD9 D;  4J15 A;  5CV6 A;  5I4D A;  2PI2 E;  2RDG A;  4DR7 Q;  2ZTD A;  3N52 A;  1FR3 A;  2LXK A;  1Z9F A;  3K81 C;  5IYC H;  1K28 A;  1WYD A;  3BZD B;  4TSS A;  2Q8R E;  1VF7 A;  1YZ6 A;  4HTH A;  4JI8 L;  4BBS H;  3KK7 A;  1M8A A;  4B9W A;  1XPO A;  1BCP D;  5M5X B;  1PZJ D;  4RHR A;  1IBK Q;  2JK8 A;  4RMF A;  4KD4 A;  1X54 A;  2VS1 A;  1QCB D;  4M1U B;  2ICI A;  2B8G A;  2KCN A;  1XTD A;  1NUC A;  2BOS A;  1EY8 A;  2SNS A;  5IT9 L;  2Y0S G;  1RTO A;  4TKO B;  3CCS A;  4UHV A;  1K0S A;  2UUC L;  3QIA A;  4Q5V A;  4DR7 L;  4JI0 Q;  5M5Y H;  4KLK A;  1Y8N B;  3NUC A;  1VQ8 A;  4IUT A;  1HR0 Q;  4FP5 D;  1GUN A;  3AQQ A;  1YEZ A;  2KCC A;  4EQP A;  1STB A;  2Z4H A;  4IFD I;  4IN3 A;  5L37 A;  2JEA I;  1II3 A;  4BBR H;  2RF4 A;  5C4X H;  3CCE A;  1CM9 A;  2KHS A;  3I4M H;  3G6J B;  1TWC H;  4A3G B;  4JBK A;  3J81 j;  2RHS B;  1NNX A;  4A3I H;  1BF4 A;  3H3V C;  2OXP A;  2HHH Q;  5CBE E;  5C44 G;  4MIU A;  1IBL Q;  2GN5 A;  4GNX A;  3K59 A;  2EYP A;  4DV7 L;  3HG9 A;  5JEA H;  4A3J B;  1PH2 A;  2FMM A;  4RKL A;  3DLL A;  4HJA A;  4JI0 L;  1K8G A;  1S5D D;  1A3T A;  2VW9 A;  4C2M H;  1EFI D;  2KA7 A;  4X62 L;  4JI4 Q;  2OCE A;  4IO9 A;  2AQ2 B;  3S24 A;  5TSS A;  4JYA Q;  1EYD A;  2QDL A;  1N33 L;  1A2T A;  4OIJ A;  4B3T Q;  4HED A;  4U67 3;  1WD1 A;  2KEE A;  5FJ8 G;  1LTT D;  3PO3 G;  1B4O A;  3OYY A;  4IJH A;  3J7Z C;  3VYU A;  1BBU A;  2EYL A;  3IKJ A;  3K7U C;  2BE5 C;  2F0W A;  1TQO A;  3JAM i;  1GOZ A;  1VQD A;  3LGJ A;  2AMC B;  4B9X A;  3J80 E;  4QMG A;  1WJJ A;  1WTQ A;  1PTO F;  1I4Q A;  1Q1B A;  4GN4 B;  3PO2 G;  2UUB L;  1F2Y A;  1Y1W B;  1N9W A;  1HNW Q;  1BBW A;  1Y1V G;  3HKZ E;  1NMG A;  2K14 A;  1G29 1;  1V8Q A;  4OIK A;  3K5N A;  1KLU D;  1MJC A;  3QOL A;  2D5D A;  4IUR A;  2J4X A;  1BCP C;  5J39 A;  2B29 A;  3N6R A;  5IYC G;  4K2K A;  2I5H A;  4GLA C;  1CHQ D;  3DUZ A;  4BBS G;  4MN3 A;  3NEN A;  1HCZ A;  3KFU A;  5K5P A;  3L0O A;  1PZK D;  3J7Y W;  1CZG A;  1PH3 A;  4OGQ C;  5GAH C;  4DR2 L;  4A3J H;  1D6E C;  3F8T A;  5JAV A;  1HNW L;  4GZY C;  3TP7 A;  5KYL A;  3MXN B;  3GTQ B;  1Q1E A;  1HZB A;  1G2S A;  1UE6 A;  2Q2T A;  3GTM B;  1N32 L;  4A75 A;  4QIW B;  2KQ3 A;  1CZW A;  1YNJ D;  3S1R B;  1JCK B;  2RQX A;  3Q22 A;  2O2L D;  1S3O A;  1CSQ A;  4P73 A;  3C2P A;  3KYH C;  4DU9 A;  2E76 C;  4OO1 I;  2F0H A;  1TS3 A;  1BBX C;  4BBR G;  5C4X G;  2PO4 A;  2CW0 D;  3I4M G;  3KF8 A;  4K0K L;  1IKL A;  4RGT A;  1EQV A;  4KV6 A;  1XTC D;  4HJ5 A;  3HOV B;  4A3I G;  2ALY B;  5M3F B;  1OXX K;  1VQN A;  4H44 C;  4FF4 A;  5JPM C;  5F2D A;  3I2Z A;  4GN5 A;  4KK7 A;  1DD2 A;  1HNX Q;  1TWA B;  4KJN A;  2VQE Q;  5G3L F;  5D14 A;  3K8A A;  5EKL A;  5JEA G;  2VQF Q;  4O1N A;  1OXV A;  1EY4 A;  1Z6H A;  2QA4 A;  2ENB A;  4QL5 A;  3D3R A;  4J8Q A;  1I94 Q;  1SEB D;  3J81 c;  5A2Q L;  1KTK A;  3TEH B;  3CXC A;  3M7N A;  4XYQ A;  2R7Z B;  1S72 A;  3TZU A;  2MFI A;  5ISR A;  2UU9 L;  4BS9 A;  1KNE A;  1MSH A;  3V05 A;  2PMZ B;  3HRZ C;  4ZRZ A;  1PTO D;  4RFB A;  4A3C H;  1EYC A;  4FXD A;  4G4K A;  4DA2 A;  2MP1 A;  2FMC A;  3FP9 A;  4JI2 Q;  1NJI C;  2E5L L;  3SXH A;  2VQF L;  3GTQ H;  4PZ7 A;  2L0C A;  2QEJ C;  3GTM H;  3PUY A;  5IT9 c;  1XWE A;  2K5H A;  2FXQ A;  1ASZ A;  1JJC B;  3VA7 A;  1XNR Q;  1XNQ L;  3PIP A;  4DR5 L;  2I5M X;  3SR1 A;  5CMD A;  3UDX A;  3RUZ A;  4POG A;  3T16 A;  4KI0 A;  2HD3 A;  4DK1 A;  2ZXR A;  3K0X A;  3U50 C;  5JPN C;  3L7Z C;  3HOV H;  4LF7 Q;  2L55 A;  3CME A;  2PPB C;  2N49 A;  4JVZ A;  3VA5 A;  2BH8 A;  4LAA A;  3OPO A;  4DNI A;  1Q3L A;  1TWA H;  4H0L C;  4HJ8 A;  1PH9 A;  3NSW A;  1YHQ A;  3NPP A;  1YNJ C;  4A3J G;  2IJ0 A;  4GKJ Q;  1CKN B;  1I4G A;  4A93 B;  4XT1 B;  2F0U A;  1E7Z A;  2I5L X;  3PIO 3;  4GN3 B;  3P75 A;  4AH6 A;  4U68 A;  3Q0A A;  3A56 A;  1PHJ A;  1ET6 A;  3LWE A;  2L11 A;  2NN6 I;  3UDF A;  3U4V A;  4WJ3 M;  3MFY A;  2F0N A;  3TDQ A;  2DNC A;  1LT3 D;  3T53 B;  5K36 H;  1PMR A;  3SK4 A;  2DNE A;  1AZQ A;  1SYF A;  1Y69 U;  1X55 A;  1EIY B;  4RCN A;  3W1B A;  1D8L A;  5E3F A;  3RZO B;  5G3L D;  1KDB A;  3S1Q B;  4C1N I;  1JWU D;  4O2D A;  2UXB Q;  2JA8 B;  2PMZ E;  3H3V H;  1EZ6 A;  1UUP A;  1ICF B;  4DR6 Q;  2ZJP A;  2A6H D;  1S40 A;  4NKL A;  1KDC A;  4LFC Q;  1KAA A;  1NR4 A;  2JQO A;  2KED A;  4H7B A;  3I4O A;  1EOT A;  3IAY A;  2QDB A;  4YCW A;  2UXC L;  4RGO S;  1G91 A;  2DGY A;  3I56 A;  1EY0 A;  2JE6 I;  4KKT A;  4H13 C;  4ILW A;  3S17 B;  5FK9 C;  2F3W A;  4QJF A;  2EXZ A;  2UXB L;  3PUW A;  2EYJ A;  4YCV A;  1H95 A;  2BA0 A;  4A3C G;  4DR6 L;  1WTV A;  1M1K C;  4A93 H;  1B1Z A;  2BCO A;  5JOB A;  2UXD Q;  2N78 A;  1K3B C;  2VB3 X;  1O80 A;  2CVR A;  4L5Q A;  1JB7 A;  2XSC A;  3G6E A;  1IBM Q;  2SNM A;  1A3V A;  5D65 A;  2AUJ D;  4DV2 Q;  1CUK A;  1CK1 A;  1L1O A;  5BR8 L;  4DUZ L;  1GXD C;  2CKZ B;  1JT8 A;  2L4N A;  3WOE A;  1WTX A;  3MTS A;  3SHL A;  1AP0 A;  1JOR A;  1WOC A;  1EUJ A;  1BQQ T;  2F03 A;  1SYB A;  3HOV G;  1QZH A;  1XXG A;  3S16 B;  3H15 A;  1SE8 A;  2JA8 H;  3GTK B;  4L63 B;  1AFP A;  2IL8 A;  4X6A H;  1KXL A;  1LTI D;  5I6W A;  5KNC A;  2R61 A;  2UUA L;  1O7L A;  1VQ6 A;  1IBM L;  2WAC A;  4HIO A;  3A5U A;  1Y8P B;  4WJW A;  1JB3 A;  1A15 A;  3CQZ H;  2XWB B;  4UP8 A;  3ULP A;  4APV A;  3BYY B;  4HAE A;  3HP3 A;  2JA7 B;  3ERO A;  2HDM A;  3GV6 A;  1DYQ A;  1V43 A;  5K36 G;  1UAP A;  1CHP D;  2F0S A;  2MO0 A;  4QQB X;  2B63 B;  1SNC A;  1IKM A;  1B2T A;  4GOP A;  3KLR A;  2D9U A;  2OF1 A;  4HMI A;  5JEA J;  3PCO B;  1EWC A;  3E0E A;  1QVF A;  1D5X C;  2F4V L;  1JOO A;  1YNX A;  1GKH A;  3T56 B;  1CA6 A;  2XNA C;  3AFQ A;  5DM7 3;  4C3H B;  3SK5 A;  2EJF C;  4IQZ A;  4DK3 C;  2AQ1 B;  4X3K A;  3DM1 A;  5BN3 A;  3EIV A;  1UEA B;  4NXM Q;  3S16 H;  2EY1 A;  4LJZ C;  3HFZ B;  1CFM A;  3GTK H;  1X3E A;  1H9M A;  1V1P B;  1ZYR C;  4S3S A;  1QWY A;  3M4P A;  3UI2 A;  4YY3 Q;  2WV6 D;  1SNQ A;  2KUM A;  3A54 A;  3AFP A;  2F3V A;  3STB D;  4A93 G;  4LF4 L;  5LMU Q;  2R93 B;  4GOP C;  4DV3 L;  4H02 A;  1JJG A;  1EU3 A;  1O78 A;  3F2C A;  1CA5 A;  1OXU A;  2VB2 X;  1DM0 B;  1FNU A;  4DGZ A;  2F0G A;  1KQS A;  1TII D;  3DEP A;  1PRT C;  1BVS A;  3TBI B;  2B63 H;  1F2Z A;  3AYH B;  1YVC A;  4X65 L;  1SYD A;  2B2W A;  2HDL A;  2J0T D;  5GQO A;  2N3S A;  4AQY Q;  3FPU B;  4N9P A;  1PV4 A;  3T13 A;  4F87 A;  2JA8 G;  5C0X J;  1YHB A;  1Q90 A;  4ZYS A;  5LMU L;  3BU2 A;  4DR1 L;  2NVX H;  3OW7 A;  2WP8 J;  3AU7 A;  4RWS C;  2ES2 A;  2RBM A;  3J7A 5;  1EQR A;  1BCP F;  4C3H H;  1HUM A;  4ZUJ A;  1YI2 A;  5IOD A;  3S1N H;  3D8G A;  1YHA A;  1Y1V B;  3S9W A;  2E8G A;  2B2T A;  4QF4 A;  4EGV A;  1BNZ A;  2K1B A;  1N8R C;  2Z6K A;  1RTN A;  4FO2 A;  2E74 C;  2EY6 A;  3MXN A;  4DAV A;  4M8A A;  1EEI D;  1DOL A;  4DV4 L;  4KY7 A;  5JJI A;  3U4Z A;  4K6L A;  1P8L A;  1YBY A;  1IZ6 A;  3PUZ A;  4R4I A;  3T1H Q;  4J6H A;  4A3L H;  3D4D A;  2RDF A;  1X65 A;  4X64 Q;  2R93 H;  4PG3 A;  4YWL A;  3E9H A;  5J22 A;  3E6Z X;  1TWH B;  3H6M A;  2A19 A;  2B39 A;  4BA1 I;  4FDB A;  3KJO A;  1TR5 A;  4BY7 B;  2IX3 A;  3K5M A;  4CJ2 C;  4I7Z C;  1D1I A;  3HOU B;  2OT2 A;  5FO9 B;  3BVM A;  2EQS A;  3VYT A;  3CCJ A;  2E75 C;  3RNU A;  3BDC A;  2MO1 A;  5M5Y B;  5C4J B;  2A8V A;  4DV1 L;  5C6A A;  3SVM A;  4OX9 L;  1B7Y B;  1SBB B;  2MJ8 A;  3UDG A;  1F9S A;  4IPG A;  4FNF A;  2A6E C;  4P71 A;  2B2T C;  5GRO A;  2OWO A;  3J81 i;  5IGB A;  1Q82 C;  1E2Z A;  4NPS A;  5C4X B;  2Z6K C;  2EJM A;  2K05 A;  2AQ3 B;  1IHZ A;  1QG7 A;  4A3I B;  1VQL A;  4IAL A;  3IRB A;  4QGU A;  3D6C A;  1WFQ A;  4XQN A;  2ASB A;  2BE5 D;  5AJ3 L;  3NK9 A;  1I3Q B;  4OO1 H;  3TS2 A;  3FVQ A;  3KJP A;  3A74 A;  4DV6 Q;  4HIK A;  1J9O A;  1WCM B;  2K7V A;  3AB9 A;  4C2M B;  4TRD A;  2E2D C;  2X6L A;  4HCE A;  2FHT A;  3I8Z A;  3QB3 A;  3F2D A;  2B63 G;  2K03 A;  1J5E L;  1YJ9 A;  2CHB D;  2ZXO A;  2FIN B;  3CU7 A;  3GQB A;  3J80 c;  2G9D A;  2KEC A;  5EJW A;  3E0J A;  2R3Z A;  1IXR A;  4R4C A;  3A8I E;  2EXD A;  1LM0 A;  2F0M A;  1TWH H;  4DAY B;  1ESF A;  3KOJ A;  1EWH A;  4N9T A;  3JC6 6;  1SJH D;  4BY7 H;  3FPP A;  4I7A A;  4C3H G;  3HKZ B;  1BO0 A;  3A0J A;  1XMQ Q;  2CWP A;  3HOU H;  2BA1 A;  1RL2 A;  1VQA A;  2JA5 B;  3M3Y B;  1MBY A;  4LW1 A;  4GOP B;  1UE1 A;  2G9H D;  4R8N A;  5C4J H;  4GS3 A;  4CJ1 B;  4XDX A;  3GTL B;  1EIH A;  2NBF A;  4HMJ A;  4YIJ A;  1CKN A;  1AW7 A;  1RIP A;  3TP6 A;  1W6J A;  3M85 A;  1YIJ A;  4LFA Q;  2RKS A;  1PRT B;  4A3M B;  1PLF A;  1IBK L;  4YWM A;  3Q23 A;  1VQC A;  4A3L G;  2XTI A;  2R93 G;  1VQF A;  4MNO A;  5I2Y A;  4EQN A;  2RCN A;  4LF6 Q;  1AN8 A;  1VMC A;  1I3Q H;  4QY7 A;  1SMX A;  4OHJ A;  1T5X D;  5IGG A;  4JI3 Q;  2OTJ A;  1SDF A;  1WCM H;  1HR0 L;  2SOB A;  5CGK A;  4JW0 A;  5FO8 B;  1A8V A;  5C4H A;  1GUO A;  1EY5 A;  4CDC C;  1WD0 A;  1VDZ A;  2Z0S A;  4LFA L;  1D5M C;  3DM3 A;  1HZA A;  2WB1 E;  1JQY D;  1RJT A;  3UE1 A;  1I4X A;  1ENC A;  4DV5 Q;  2HHH L;  1X3G A;  5FO7 B; 
#chains in the Genus database with same CATH homology
 4P2C B;  5KRU A;  1IW7 C;  1SYG A;  4PMB A;  1Z47 A;  1QB5 D;  4LK1 C;  2K5D A;  2SEB D;  3MC0 B;  1HFG A;  2NN6 H;  1ENF A;  2K6A A;  3DEO A;  1H9R A;  2F0V A;  4PQX A;  2IX1 A;  1J8I A;  4OO1 G;  1EY6 A;  1TKW B;  4KD3 A;  2J7Z A;  4ZUI A;  5E1F A;  3H91 A;  3OOC A;  4DFA A;  1ESR A;  4A3B B;  4CBV A;  2XIW A;  1G2T A;  3HOW B;  1LV9 A;  5M5W B;  1LT6 D;  3QJY A;  4KKU A;  4DK0 A;  1ILQ A;  3SK6 A;  4KY6 A;  1MGS A;  1WTR A;  4XYO A;  1GHK A;  3FEW X;  4J1M A;  4DNR B;  2EYO A;  1HQM C;  2QIL A;  2AWO A;  3QG1 A;  1U4R A;  4KN4 C;  3U9S A;  4KJO A;  2O4X A;  1E2W A;  1R9T B;  1VCI A;  4KKS A;  4CKE A;  1STY A;  3CKI B;  4KHZ A;  4G7Z C;  3DXJ C;  4G57 A;  4QCL A;  5HGT A;  3HGB A;  3I4L A;  4KTA A;  4OL7 A;  1PFB A;  5FKA C;  1U4M A;  2WII B;  1LAB A;  4Z9C B;  2WKC A;  4DNT B;  3MFG A;  3J7A F;  5E4W C;  1DCZ A;  2JEB I;  1EL0 A;  3OWE B;  2H1E A;  2C9O A;  5D3D A;  4G7O C;  3FDT A;  2N55 A;  4XT3 B;  4UDU C;  1JR0 D;  5ELD A;  1STG A;  4IFD J;  3OHX C;  3C1F A;  5T1G A;  4ZKC B;  2NN6 G;  3SE0 A;  3W3A A;  1FYC A;  1V1P A;  3PUV A;  2L12 A;  4KN7 C;  1UNS A;  1BUV T;  3F2U A;  3TSS A;  3MXP A;  1PZI D;  2K01 A;  1Q12 A;  1HFN A;  3KBG A;  3MHB A;  5CYU A;  5DNF A;  2NVQ B;  1U9R A;  4IUN A;  1TU2 B;  2IW3 A;  1SYE A;  3OWF A;  5DEH A;  4K5V A;  2PQE A;  1PRT F;  3FKI B;  3BS1 A;  4HN7 A;  3NTI A;  5KIX A;  1QIL A;  5CV9 A;  3HOX B;  5EQ0 A;  4ODG A;  1IL8 A;  1SMY D;  3ITP A;  2F0L A;  1STA A;  5EGT A;  4KY5 A;  1STN A;  3A8J E;  3S2D B;  2B2V A;  2YYZ A;  2PZU A;  5KNB A;  5BN5 A;  3O13 A;  2EPB A;  2KOL A;  2MPM A;  5ELE A;  2PZT A;  1SFO B;  2PW5 A;  3RD4 A;  5CBA E;  2B8F A;  1EY9 A;  3X3M A;  3CQZ B;  1JC7 A;  3GTJ B;  5CV5 A;  1E2V A;  1TVX A;  2ZT9 C;  4PMC A;  1GUT A;  3A7L A;  3MXG A;  1HXY D;  1G8Z D;  5M9O A;  3MEH A;  1ONL A;  4FF2 A;  1NAP A;  1HUN A;  1BDO A;  1ZYR D;  2B2V C;  5EBC A;  3RZD B;  4F8M A;  5IGE A;  3K5O A;  2A69 C;  5CC4 A;  4CHT B;  3BDL A;  1VF5 C;  3I73 A;  4FYD A;  4FF1 A;  1RHP A;  1V1O A;  1LTB D;  4O42 A;  5JVH 3;  4RKB A;  3BVG A;  1ZEQ X;  5C5L A;  1PRT D;  1LTR D;  1LT4 D;  2IX0 A;  5IGC A;  3HZX A;  2PZW A;  3NWT A;  5ELF A;  2MUY A;  1H9K A;  3H94 A;  4A3K B;  4FXG C;  5JVG 3;  2A5H A;  1O7Y A;  1SMY C;  2A73 B;  1F9Q A;  3D4R A;  5DM6 3;  5ELC A;  4DAY A;  3MWY W;  1EYA A;  4QUF A;  2ID0 A;  2YU9 B;  3FMC A;  1BR9 A;  2H4O A;  1FNW A;  5I9P A;  3J80 L;  4C1N K;  1PYW D;  3I4N B;  4DN4 M;  2EVB A;  3HS0 C;  5NUC A;  4IUU A;  2NWG A;  3GTG B;  1I6V C;  2NVX B;  1QNK A;  1EU4 A;  3DWP A;  2JSO A;  2RSN A;  5BN4 A;  5IGF A;  3SK8 A;  1SJE D;  2HQE A;  4A3D B;  3NTH A;  1DOM A;  3JAM E;  3S1N B;  4ID6 A;  1R4P B;  3M7G A;  3DMU A;  2QCP X;  1TS2 A;  1RF2 D;  3I91 A;  1I4R A;  2M9V A;  1K83 B;  1CT1 D;  1TS5 A;  1X3P A;  1W6K A;  2A6E D;  3K5L A;  2VNU D;  2K5W A;  1S4Z A;  1HPC A;  2IPK D;  3H09 A;  4Y7N B;  3MZ5 A;  5HUR A;  2EE1 A;  3P20 A;  4HSV A;  1A6X A;  4XQQ A;  3K58 A;  4DF7 A;  1K8O A;  4ZK9 B;  3R3O A;  3A8K E;  3NHH A;  2EYF A;  1JIC A;  3ND9 A;  3SDZ A;  1B44 D;  3NBH A;  5D3I B;  1ICW A;  2F0F A;  3MAQ A;  2A68 C;  2Z8L A;  1K8M A;  2PNR C;  1SE4 A;  2AUK A;  4LMQ D;  2EY2 A;  1KNA A;  4X3S A;  4F88 A;  5A2Q E;  2Q8T A;  1CTM A;  1S5F D;  3ERQ A;  4F7X A;  2LMC B;  3R93 A;  1BXT A;  2EZV A;  1PDQ A;  3S15 B;  3M4O B;  2K33 A;  2WKD A;  2JYO A;  2F4I A;  4IUV A;  4L8J A;  1GUS A;  2ICE C;  3LX0 A;  4PV1 C;  2C5C A;  1Q8I A;  1SNO A;  4CJ0 B;  1SSO A;  2L1B A;  2TMP A;  1H9S B;  2R92 B;  3V2T A;  1WTO A;  3VYR A;  5LL6 S;  1RCV D;  3IFT A;  1KLG D;  1XX8 A;  1PFN A;  1TT2 A;  1SNP A;  5FLX E;  1SND A;  1LLR D;  2RVL A;  1HTP A;  1STE A;  2O5J C;  3NE5 B;  1B3A A;  1SAP A;  4RGM A;  3KBX A;  2B2U C;  3MVV A;  1MI2 A;  3BG3 A;  5DAU A;  3QWN A;  4XTC S;  3IFD A;  1F2M A;  5COR A;  2Z1C A;  3QOJ A;  3DWQ A;  3MXU A;  1MD2 D;  1IW7 D;  1FNV A;  1ET9 A;  3IL8 A;  4ZAI A;  2NZ1 D;  2F0D A;  2WB1 B;  1YNN D;  2MGS A;  3DWA A;  1BOS A;  1I6H B;  4K5X A;  1MSG A;  1KDA A;  2PW7 A;  1LTG D;  2LS0 1;  2NTS A;  4TQU S;  4C3J B;  1GUW A;  2NB0 A;  1NSN S;  3BVZ A;  3TN2 A;  2EJG C;  2O5I C;  1LTA D;  2EYH A;  4DXF A;  5J1Z A;  4HCS A;  3GP7 A;  3P7J A;  4NDX A;  4XXE A;  1GHJ A;  5I2X A;  5EBD A;  2B2Y C;  3D31 A;  1TWF B;  1T5E A;  4FF3 A;  2MHV A;  1X32 A;  4RA8 A;  3OMC A;  2F0P A;  2NUC A;  1EIG A;  2K28 A;  3MA2 B;  2F0Q A;  2EDG A;  2E2I B;  1WTW A;  1HQR D;  1F2L A;  2XVS A;  1D2B A;  5C4Z A;  3PIP 3;  4ZQ3 A;  3EFX D;  1DOK A;  2L9H A;  2NVY B;  3GTO B;  2EOT A;  1Z7T A;  2JXM B;  4I65 A;  2TSS A;  5KYI A;  3J7A V;  1YNN C;  3AMU A;  1E0B A;  4A3E B;  5KND A;  1IYU A;  4K14 A;  1QOH A;  1EEF D;  1CQV A;  2XRS D;  3EA6 A;  1S5C D;  2OEO A;  2LY7 A;  1XYI A;  3GV3 A;  1GUG A;  5CR3 A;  1OO9 B;  1ROD A;  4IUP A;  1WTP A;  4PNY A;  1O7Z A;  1TY2 A;  3JAM L;  1OXT A;  1D5Z C;  3R8B A;  1A2U A;  1CI3 M;  4FXK C;  3NQT A;  1PFM A;  4NW2 A;  2F1M A;  3T4A C;  1SNM A;  3FRP B;  2HCI A;  5IIF A;  3K0Y A;  2GA4 B;  2NTT A;  1I4P A;  5KGU A;  3NXW A;  3HEJ A;  4NP5 A;  5C0X H;  5EPK A;  3R2T A;  2EYM A;  3BDO A;  3CRK C;  1TS4 A;  2LKV A;  1LAC A;  3TZD A;  2KVM A;  1WVL A;  1FGB D;  4K6D A;  1C8C A;  5KEE A;  2HUG A;  1DZ1 A;  3H0G B;  1TWG B;  3OSO A;  1H9J A;  2JA6 B;  3R2I A;  2RA4 A;  1B50 A;  2K04 A;  1F9P A;  3ONA B;  4X3U A;  4ZKB B;  1A3U A;  4IUQ A;  3VYS A;  4C56 C;  2ZXP A;  1D1K A;  1LT5 D;  4C3J G;  1NR2 A;  1X3Q A;  2IT1 A;  4G7H C;  4K5W A;  4DAP A;  1HTL D;  2SDF A;  4KHV A;  4NMZ A;  5ELB A;  3VR6 A;  4E6I A;  3HOZ B;  3TME A;  2V4D A;  3L3O C;  4QUC A;  4RH6 A;  5C5M A;  4DXG A;  1G6Z A;  2XN9 C;  2BDN A;  3NP8 A;  2A69 D;  4CKB A;  2F0I A;  3I90 A;  3EVQ A;  3K6O A;  4CGY B;  5C3X A;  5A35 A;  5COY A;  5FLX L;  2F0K A;  1STH A;  5IOC A;  2FJ2 A;  3HOY B;  1ZXT A;  1L0Y B;  4XQJ A;  4MHE A;  1QJO A;  2F0J A;  2R6G A;  5IGD A;  4L6T B;  3I70 A;  1EZ8 A;  1B9N A;  4C3I B;  1HRJ A;  3W2D A;  5C0X G;  2DN8 A;  2HCC A;  2K5Q A;  2D62 A;  1EY7 A;  2CW0 C;  1TY0 A;  2VXW A;  3QO2 A;  2L5T A;  5AFW A;  3URY A;  3C1E A;  3J81 E;  3LNN A;  1DXM A;  2JP1 A;  5EKK A;  1ML0 D;  4KMU C;  1R4Q B;  4R9W A;  1BCP B;  1L0X B;  3GTP B;  1ILP A;  2VUM B;  1C4Q A;  4ABN A;  1LO5 D;  3KLS A;  1H9S A;  3SEB A;  3VR5 A;  3D6W A;  3RLF A;  4AYB B;  1ZKO A;  1HHV A;  3PUX A;  5C0X I;  5IT9 E;  2IWH A;  1PTO C;  3OIQ A;  4V0B A;  4RGN A;  4CKC A;  5LHY 1;  5I9O A;  4ULL A;  1RKN A;  1U4L A;  3NTK A;  4FVM A;  1JWS D;  2A74 C;  4B08 A;  1HA6 A;  2D2C C;  2Z4I A;  2BDO A;  1DJR D;  1I50 B;  3CRL C;  2XWJ B;  2PYK A;  3V96 A;  3PMF A;  1GJX A;  2DY7 A;  5JJZ A;  3ND8 A;  2M00 A;  2RDH A;  5I6Y A;  2A68 D;  1M4V A;  1EQT A;  1HA5 A;  4A3F B;  2I07 B;  4JBW A;  3NBI A;  3EQL C;  2PCF B;  3WDN A;  1SE3 A;  1DON A;  2WAQ B;  4RCO A;  1QE6 A;  4JK1 C;  2CQA A;  3I3C A;  3GO5 A;  4PMW A;  3I72 A;  4IZ8 A;  1FD7 D;  3RMH A;  3U9O A;  1SXT A;  4HR7 B;  1CQF A;  3S2H B;  3K7A B;  3GD7 A;  4XIG S;  2E2J B;  2A6H C;  4QB4 A;  5EPJ A;  3A7A B;  5LL6 X;  1S5E D;  1I4H A;  2X69 A;  4WRD A;  4Q0F A;  1ENA A;  2EY5 A;  2Y0S B;  2KJX A;  2NYZ D;  4BA2 I;  2NVT B;  2F0T A;  4WOR A;  3KUP A;  1B9M A;  3KLS X;  4K2L A;  2WIN B;  3Q6S A;  5FOB B;  3S1M B;  5C3E B;  2E2H B;  1S5B D;  5CV7 A;  4HSP A;  4RAU C;  4C3I G;  5C44 B;  2I46 A;  4UAI A;  1B53 A;  4EQO A;  3WOF A;  3S14 B;  1KAB A;  4BY1 B;  4IFD H;  3A55 A;  2Q8I B;  1IYV A;  1AEX A;  2QF7 A;  1JOQ A;  1OXS C;  3D4W A;  2F0E A;  1SE2 A;  1F77 A;  4V19 0;  3CHB D;  4EVO A;  5T1I A;  1PTO B;  3PO3 B;  3DHQ A;  3C3L A;  5EKI A;  3C46 A;  4X3T A;  2B2U A;  1RDP D;  1PXU A;  2K32 A;  4BWG B;  1U4P A;  4RHS A;  2F0O A;  4R8I A;  5EPL A;  3PO2 B;  4ZLT F;  1C48 A;  2M2L A;  4WFN 3;  3OMG A;  1SYC A;  2RSO A;  3NQI A;  3G7L A;  2XRQ D;  2AWN A;  4K8I A;  3TP8 A;  3PV0 A;  1JE4 A;  4BBS B;  3OIP A;  2DY8 A;  2B2W C;  3EJI A;  5M3M B;  1VMP A;  3NWS A;  3T51 B;  3VR4 A;  3TP5 A;  3VR2 A;  2FFK B;  3L9A X;  1JWM D;  2N88 A;  1AZP A;  1F9R A;  1LTS D;  3E5S A;  1PTO H;  1QNU A;  3VR3 A;  5E4X A;  4ME5 A;  5CV4 A;  4BBR B;  3LWU A;  3I4M B;  1TWC B;  3BYT B;  3P1H A;  5C3W A;  2QKI C;  3M4Y A;  4K8J A;  2B2Y A;  2X6G A;  1Y8O B;  3K57 A;  1JOK A;  1NCV A;  3ZYY X;  5CV8 A;  3X3N A;  4IFD G;  2LFN A;  3Q24 A;  3J81 L;  1RD9 D;  5CV6 A;  5I4D A;  2RDG A;  3N52 A;  1FR3 A;  3BZD B;  4TSS A;  2Q8R E;  1VF7 A;  4HTH A;  3KK7 A;  1M8A A;  4B9W A;  1BCP D;  5M5X B;  1PZJ D;  4RHR A;  4KD4 A;  1QCB D;  4M1U B;  2ICI A;  2B8G A;  2KCN A;  1NUC A;  2BOS A;  1EY8 A;  2SNS A;  5IT9 L;  4TKO B;  1RTO A;  3QIA A;  4Q5V A;  1Y8N B;  3NUC A;  4IUT A;  4FP5 D;  1GUN A;  2KCC A;  4EQP A;  1STB A;  2Z4H A;  4IFD I;  4IN3 A;  2JEA I;  1II3 A;  1CM9 A;  2KHS A;  3G6J B;  4A3G B;  1BF4 A;  3H3V C;  2OXP A;  5CBE E;  4MIU A;  3K59 A;  2EYP A;  3HG9 A;  5JEA H;  4A3J B;  2FMM A;  4RKL A;  1S5D D;  1A3T A;  1EFI D;  2KA7 A;  2AQ2 B;  5TSS A;  1EYD A;  1A2T A;  4OIJ A;  4HED A;  4U67 3;  1WD1 A;  2KEE A;  1LTT D;  1B4O A;  3VYU A;  2EYL A;  3IKJ A;  2BE5 C;  2F0W A;  1TQO A;  1GOZ A;  4B9X A;  3J80 E;  4QMG A;  1WTQ A;  1PTO F;  1I4Q A;  1Q1B A;  1F2Y A;  1Y1W B;  1G29 1;  1V8Q A;  4OIK A;  3K5N A;  1KLU D;  3QOL A;  2D5D A;  4IUR A;  2J4X A;  1BCP C;  5J39 A;  3N6R A;  4K2K A;  1CHQ D;  3DUZ A;  4MN3 A;  1HCZ A;  5K5P A;  1PZK D;  3J7Y W;  1CZG A;  4OGQ C;  1D6E C;  5JAV A;  4GZY C;  3TP7 A;  5KYL A;  3GTQ B;  1Q1E A;  1G2S A;  3GTM B;  4QIW B;  2KQ3 A;  1CZW A;  1YNJ D;  3S1R B;  1JCK B;  2RQX A;  3Q22 A;  2O2L D;  3C2P A;  4DU9 A;  2E76 C;  4OO1 I;  2F0H A;  1TS3 A;  1BBX C;  2PO4 A;  2CW0 D;  3KF8 A;  1IKL A;  4RGT A;  1EQV A;  4KV6 A;  1XTC D;  3HOV B;  5M3F B;  1OXX K;  4H44 C;  4FF4 A;  5JPM C;  5F2D A;  4KK7 A;  1DD2 A;  1TWA B;  4KJN A;  5G3L F;  5D14 A;  5EKL A;  5JEA G;  4O1N A;  1OXV A;  1EY4 A;  1Z6H A;  2ENB A;  3D3R A;  4J8Q A;  1SEB D;  5A2Q L;  1KTK A;  3M7N A;  4XYQ A;  2R7Z B;  3TZU A;  5ISR A;  4BS9 A;  1KNE A;  1MSH A;  3V05 A;  2PMZ B;  3HRZ C;  4ZRZ A;  1PTO D;  4RFB A;  1EYC A;  4FXD A;  4G4K A;  4DA2 A;  2MP1 A;  2FMC A;  3SXH A;  2L0C A;  2QEJ C;  3PUY A;  1XWE A;  3VA7 A;  3SR1 A;  5CMD A;  3RUZ A;  3T16 A;  4KI0 A;  4DK1 A;  2ZXR A;  5JPN C;  3L7Z C;  2L55 A;  2PPB C;  3VA5 A;  4LAA A;  3OPO A;  1Q3L A;  4H0L C;  3NSW A;  3NPP A;  1YNJ C;  2IJ0 A;  1I4G A;  4A93 B;  4XT1 B;  2F0U A;  3PIO 3;  3P75 A;  4U68 A;  3Q0A A;  3A56 A;  1ET6 A;  3LWE A;  2L11 A;  2NN6 I;  3MFY A;  2F0N A;  3TDQ A;  2DNC A;  1LT3 D;  3T53 B;  5K36 H;  1PMR A;  3SK4 A;  2DNE A;  1AZQ A;  1SYF A;  1Y69 U;  4RCN A;  5E3F A;  3RZO B;  5G3L D;  1KDB A;  3S1Q B;  4C1N I;  1JWU D;  2JA8 B;  1EZ6 A;  1UUP A;  2A6H D;  4NKL A;  1KDC A;  1KAA A;  1NR4 A;  2KED A;  4H7B A;  1EOT A;  3IAY A;  2QDB A;  4RGO S;  1G91 A;  1EY0 A;  2JE6 I;  4KKT A;  4H13 C;  4ILW A;  3S17 B;  5FK9 C;  2F3W A;  2EXZ A;  3PUW A;  2EYJ A;  2BA0 A;  1WTV A;  1B1Z A;  2BCO A;  5JOB A;  2VB3 X;  1O80 A;  2CVR A;  2XSC A;  2SNM A;  1A3V A;  5D65 A;  2AUJ D;  1CK1 A;  1GXD C;  2L4N A;  3WOE A;  1WTX A;  3MTS A;  3SHL A;  1AP0 A;  1JOR A;  1BQQ T;  2F03 A;  1SYB A;  1XXG A;  3S16 B;  3GTK B;  4L63 B;  1AFP A;  2IL8 A;  1LTI D;  5I6W A;  5KNC A;  2R61 A;  1O7L A;  2WAC A;  1Y8P B;  4WJW A;  1JB3 A;  1A15 A;  2XWB B;  3BYY B;  4HAE A;  3HP3 A;  2JA7 B;  3ERO A;  2HDM A;  3GV6 A;  1DYQ A;  1V43 A;  5K36 G;  1UAP A;  1CHP D;  2F0S A;  2B63 B;  1SNC A;  1IKM A;  1B2T A;  3KLR A;  2D9U A;  2OF1 A;  4HMI A;  5JEA J;  1EWC A;  1D5X C;  1JOO A;  3T56 B;  1CA6 A;  2XNA C;  5DM7 3;  4C3H B;  3SK5 A;  2EJF C;  4IQZ A;  2AQ1 B;  4X3K A;  3DM1 A;  5BN3 A;  1UEA B;  2EY1 A;  4LJZ C;  1CFM A;  1H9M A;  1V1P B;  1ZYR C;  4S3S A;  1QWY A;  3UI2 A;  2WV6 D;  1SNQ A;  2KUM A;  3A54 A;  2F3V A;  2R93 B;  1EU3 A;  1O78 A;  1CA5 A;  1OXU A;  2VB2 X;  1DM0 B;  1FNU A;  4DGZ A;  2F0G A;  1TII D;  3DEP A;  1PRT C;  3TBI B;  1F2Z A;  1SYD A;  2B2W A;  2HDL A;  2J0T D;  3FPU B;  4N9P A;  3T13 A;  4F87 A;  5C0X J;  1Q90 A;  4ZYS A;  3OW7 A;  2WP8 J;  3AU7 A;  4RWS C;  2RBM A;  1BCP F;  1HUM A;  4ZUJ A;  5IOD A;  3D8G A;  1Y1V B;  3S9W A;  2B2T A;  4QF4 A;  4EGV A;  1BNZ A;  2K1B A;  1RTN A;  4FO2 A;  2E74 C;  2EY6 A;  3MXN A;  4DAV A;  4M8A A;  1EEI D;  1DOL A;  4KY7 A;  4K6L A;  3PUZ A;  4J6H A;  3D4D A;  2RDF A;  5J22 A;  3E6Z X;  1TWH B;  3H6M A;  2B39 A;  4BA1 I;  1TR5 A;  4BY7 B;  2IX3 A;  3K5M A;  4CJ2 C;  4I7Z C;  1D1I A;  3HOU B;  2OT2 A;  5FO9 B;  3BVM A;  3VYT A;  2E75 C;  3BDC A;  5M5Y B;  5C4J B;  5C6A A;  3SVM A;  1SBB B;  2MJ8 A;  1F9S A;  4FNF A;  2A6E C;  2B2T C;  5IGB A;  1E2Z A;  5C4X B;  2EJM A;  2K05 A;  2AQ3 B;  1IHZ A;  1QG7 A;  4A3I B;  4IAL A;  3D6C A;  4XQN A;  2BE5 D;  3NK9 A;  1I3Q B;  4OO1 H;  3FVQ A;  1J9O A;  1WCM B;  2K7V A;  3AB9 A;  4C2M B;  4TRD A;  2E2D C;  2X6L A;  4HCE A;  2FHT A;  3I8Z A;  3QB3 A;  2K03 A;  2CHB D;  2ZXO A;  2FIN B;  3CU7 A;  3GQB A;  2G9D A;  2KEC A;  5EJW A;  3E0J A;  2R3Z A;  3A8I E;  2F0M A;  1ESF A;  1EWH A;  4N9T A;  1SJH D;  3FPP A;  4C3H G;  3HKZ B;  1BO0 A;  2BA1 A;  2JA5 B;  3M3Y B;  1MBY A;  2G9H D;  4R8N A;  4CJ1 B;  4XDX A;  3GTL B;  1EIH A;  2NBF A;  4HMJ A;  4YIJ A;  1AW7 A;  3TP6 A;  1W6J A;  3M85 A;  2RKS A;  1PRT B;  4A3M B;  1PLF A;  3Q23 A;  5I2Y A;  4EQN A;  1AN8 A;  1VMC A;  4OHJ A;  1T5X D;  5IGG A;  1SDF A;  2SOB A;  5CGK A;  5FO8 B;  5C4H A;  1GUO A;  1EY5 A;  1WD0 A;  1VDZ A;  1D5M C;  1JQY D;  1RJT A;  1I4X A;  1ENC A;  5FO7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...