4U68A

Crystal structure of rhino chromodomain in complex with h3k9me3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
b'EYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRLHRKAAAKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhino
publication title Structural insights into Rhino-mediated germline piRNA cluster formation
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein binding
total genus 18
structure length 64
sequence length 64
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4u68A00
4IUTA 1AP0A 4QUFA 2FJ2A 1KNAA 2B2VA 2K28A 3IFDA 1B4OA 1CA6A 1EOTA 2KEEA 1HRJA 4LMQD 4CJ1B 5T1GA 2H1EA 3FPUB 1U4MA 1U4PA 2DY7A 2NWGA 3FDTA 2K1BA 1RTOA 3D6WA 3I8ZA 2CVRA 1ILQA 2K01A 5EPLA 2EOTA 4ZKCB 2B2VC 1O7ZA 1AZPA 1BBXC 3KBXA 1IL8A 1DOKA 1ICWA 1RODA 4MN3A 4MHEA 5AFWA 4CJ2C 4IUUA 4ZKBB 4RA8A 1SDFA 4HSVA 1IKLA 4UAIA 1WTOA 1HHVA 1MI2A 1A15A 1S4ZA 3TZDA 1F9QA 5JJZA 3F2UA 1F2LA 5CORA 2XIWA 2NZ1D 3TN2A 2B2UA 2D9UA 1B50A 3GV6A 2M2LA 5EPJA 2L1BA 4IUVA 3UI2A 1NAPA 2K04A 3MTSA 1HFGA 2JYOA 1CM9A 5DNFA 3N52A 1J9OA 3R93A 2K03A 4CJ0B 1AZQA 4X3TA 5E4XA 1G2SA 3LWEA 2KVMA 1QNKA 4XT1B 4XDXA 2RSOA 4OIJA 1BF4A 4ZLTF 2DY8A 1E0BA 3I3CA 4IUPA 5T1IA 1F9RA 4U68A 1O80A 1QG7A 1F9PA 5D65A 1PFNA 2X6LA 1KNEA 2X6GA 1U4RA 1X3PA 1B2TA 2L12A 2B2TA 1EIGA 1HUMA 1PFMA 1HFNA 3Q6SA 1TVXA 1WTWA 2L9HA 1XX8A 1EIHA 4OIKA 4X3SA 2HCIA 3H91A 3G7LA 1MSGA 1WTRA 2B2WA 1J8IA 4O42A 1WVLA 1DOMA 1JE4A 3MWYW 2B2TC 2RA4A 1BO0A 1MGSA 1MSHA 2IL8A 1WD1A 1C8CA 1HA6A 4X3UA 5EJWA 1JICA 2RVLA 4IUQA 4R8IA 1WTXA 2FFKB 5E4WC 1X3QA 2MJ8A 2B2UC 2B2WC 3DEPA 3QO2A 1WTQA 1IKMA 1GUWA 2FINB 2RSNA 5EKIA 1X32A 1M8AA 4ZAIA 2N55A 2Q8RE 5CBEE 1G6ZA 5CMDA 2HUGA 2NYZD 2JP1A 4X3KA 2KOLA 1U4LA 2MGSA 4QUCA 5CBAE 4DN4M 1VMCA 1PDQA 2R3ZA 3KUPA 1DZ1A 1ESRA 4XT3B 3ONAB 2MP1A 1WD0A 4RAUC 2K05A 3SVMA 4R9WA 2HDMA 3IL8A 1PFBA 2J7ZA 2VXWA 1ZXTA 1Q3LA 1DOLA 1WTVA 1G2TA 1RHPA 2HDLA 3I90A 2FMMA 2FHTA 4ZK9B 3GV3A 4HCSA 4HAEA 2EPBA 1EL0A 5COYA 1DONA 1B3AA 1QE6A 2EE1A 2KUMA 1HUNA 1PLFA 2L4NA 1G91A 4HEDA 5EQ0A 1CA5A 2B2YA 1SSOA 1BNZA 1O7YA 4NW2A 1EQTA 1RTNA 2BDNA 2X69A 3HP3A 2L11A 4IURA 3I91A 3DM1A 5D14A 5EPKA 1LV9A 1NR2A 2Q8TA 2N88A 1B53A 1NCVA 3DEOA 2SDFA 4RWSC 1NR4A 2KECA 3P7JA 1RJTA 1SAPA 2HCCA 1XYIA 1WTPA 1ILPA 1F9SA 1ML0D 2B2YC 2MPMA 1VMPA 2KEDA
chains in the Genus database with same CATH superfamily
1O7IA 3K8AA 4H0LC 2WINB 1GKHA 4YIJA 4ID6A 2EVBA 5C0XJ 1NTGA 1Y14B 4RGNA 2JA8H 2NWGA 1RTOA 3D6WA 3I8ZA 2CVRA 2A74C 3RZDH 4V0BA 2HIXA 5EBDA 4YCVA 4QIWE 1K8GA 1CSPA 5CR3A 2F0TA 2CFMA 1XNRL 2F3IA 4ZUJA 1VF7A 1SFOH 2G9HD 2CW0C 2VQEL 3NSWA 2FXQA 5DNFA 3STBC 4DV0L 3NTIA 2ATWA 3TDQA 5M3MG 2Z0SA 1CUKA 2CKZB 3J7AV 4KY5A 2K5NA 3VR5A 1VQJA 2VZAA 3BVGA 4JVZA 3PUYA 5ELDA 1YI2A 4GN3B 1MSGA 3OW2A 1J8IA 3D4RA 1HA5A 3TP8A 1PH2A 4A75A 1JCKB 2DN8A 4FF1A 4A3DH 3BS1A 3SEBA 3VA5A 3BDLA 4ZAIA 4DUYL 1Z9FA 4DAVA 1ZYRC 3FEWX 4FXDA 1HZAA 4V190 2UUAQ 1VMCA 4X62Q 4HIKA 2MP1A 1YITA 4IPHA 2F0FA 4M8AA 5GAHC 2J7ZA 3NP8A 4JCVE 1HNWQ 1CZGA 2O4XA 1TWAH 2QEJC 4DXFA 3JAMc 1ZYRD 4P2CB 3FP9A 5DEHA 4HAEA 1X56A 2MNAA 3FHWA 5C0XI 2E5LL 2F0HA 2F3WA 3S24A 4DUZL 2KHIA 2EZVA 5LL6S 3GTGB 1UEAB 1HQRD 3RNUA 1Y8NB 1D5ZC 3EJIA 2EY1A 2XVSA 3M7NA 2B3GA 1STYA 3VYRA 1K83H 2UU9Q 4B08A 2IWHA 1LABA 3H6MA 4BBRB 3S2DH 5CV9A 2PNRC 1HH2P 4NB3A 2MFIA 1CHQD 1VQEA 3NXWA 2H1EA 3FPUB 1FGBD 2AUKA 2A6EC 5LHY1 2VB3X 1ICWA 3BZDB 3A5ZB 4KLKA 3AFQA 1A2UA 4MTKA 3NK9A 1V43A 1HHVA 4DV7L 3CF5A 4MIUA 4LJZC 1F9QA 5IT9E 2Z8LA 3EN2A 3PUVA 1DCZA 4KD3A 2A6ED 1R4PB 1EYDA 2B2UA 5D3DA 3J7A5 1GUNA 4JI1L 2DNEA 1CM9A 2I07B 4A3LH 1J9OA 4JI3L 1IYJB 5IT9L 1HNZQ 1O78A 1JB7A 4K8IA 1KDCA 1A3UA 5IP7H 3EQLC 3OMCA 1JQYD 1TXYA 4P73A 2GVAA 1BKBA 3I4NH 4NDXA 2G9DA 2X6GA 1FNWA 4BBSG 1EIGA 5JAVA 1TVXA 3U50C 3DXJC 1OO9B 2FMCA 2J0TD 2WB1G 3K5NA 4JI8Q 3SR1A 1Y8OB 1XMOQ 4ZQ3A 2DUDA 5AJ3Q 2NN6G 2CWPA 5FO7B 1KLGD 4BWGB 3IFTA 3D3RA 3ND8A 4JI7L 4JOIC 4RFBA 4X65L 1Q1BA 3K80C 1UE5A 2N55A 1OTCA 2HUGA 3MVVA 2BA0A 1U4LA 1JWUD 5KEEA 5C4JH 3QR8A 2IX0A 1PH1A 1T5EA 3GQBA 1I4HA 4H44C 2CHBD 2RDFA 1B3AA 1I94Q 1ESFA 2JA5G 3I4MG 4HEDA 1B1ZA 3J81E 4DR4L 1CZWA 1I6VC 4YCWA 1AE2A 5CV4A 1EQTA 2X69A 4BA2I 4Y52H 4LFCQ 3L7ZC 4UP7A 2QA4A 5E3FA 3J81L 1PV4A 2XWJB 3M4OH 1Z6HA 3TZUA 1ASYA 4K2LA 5IYCH 1LTID 4JI2Q 3VR2A 4CJ1B 5C4XH 3TBIB 4LFAQ 4CDEC 1VCIA 4DR6L 5KNBA 1I4QA 4HIOA 1AZPA 1OXVA 1JC7A 3J81i 4IFDH 1S5DD 4RA8A 1KRTA 5IP9G 2ASBA 1NMGA 3OWEB 5EKKA 5KRUA 2KCMA 2VQFL 1F2LA 1AFPA 2NZ1D 4DR1L 1QVGA 1YEZA 1TWHH 1I50B 1U5KA 2ALYB 2B63H 1EOVA 1IXRA 4IUVA 2JEBI 4YWKA 1A3TA 1SNDA 1TT2A 4DR2L 3DM3A 5E4XA 3W3AA 4DV6L 2MO0A 1DJRD 3RLOA 2WAQB 4KTAA 2K32A 1BR9A 4APVA 3A8IE 4OO1G 2X6LA 2Z6KC 1C0AA 2BOSA 5KNCA 1XMQQ 1GD7A 1I50H 3D4WA 2NZHA 5C3EB 1WTRA 3A0JA 1JMCA 2YTXA 2Q8IB 2KHJA 4OEMB 4R4OA 1LLRD 1JICA 3VYSA 3RN2A 1WCMG 2XSCA 2MJ8A 1J5EL 2F0WA 1BCPF 1LACA 1FNUA 1SE8A 4HJ8A 3A8KE 4MTNA 2KA7A 5FLXE 4B3TQ 3J80c 1SN8A 4LF4L 5K36H 3TP5A 1ESRA 1GM5A 4XQQA 1BDOA 4BS9A 1I3QB 1F2YA 2F0UA 4X66Q 2Y0SE 5JEAH 1M1KC 2BH8A 3HOWB 2VXWA 3DWAA 2F0KA 1IBML 2IX1A 3I90A 2KCTA 3TSSA 4ZK9B 5FLXL 3E9HA 1X3FA 3D8GA 4C3JB 1CKNB 4B9XA 2ZJQA 1PLFA 2WIIB 2B8FA 3V96A 1JB3A 2F03A 3GTPH 2L11A 2B8GA 4BXXG 4WFN3 2R93G 3K0XA 4C3HB 4RWSC 4LF6Q 2SDFA 3TS2A 3BZKA 1I3QH 4JI0Q 2XGTA 3T1HQ 2KEDA 1EWHA 1ONLA 2JA7H 3AQQA 1KL9A 2CQOA 1G291 5T1GA 1X55A 2JQOA 3D6CA 2EOTA 3RD4A 1EY6A 1JJ2A 1K73C 2JE6I 2R6GA 1DOKA 1YNNC 2F0LA 2EYMA 5IE8A 4AQYL 3KLSA 3E9IA 2WKDA 4YHHQ 4ALPA 3OW7A 3G48A 4KKSA 2XIWA 2ZT9C 1I6HB 1EYCA 1U0LA 3HOXB 1EY8A 1YNND 2B39A 3TP7A 1WJJA 2QILA 2YYZA 3PF5A 3W1BA 1CK1A 1QVFA 2TSSA 2XN9C 2Q2HA 4IN3A 2F0MA 3NHHA 1IBKQ 4XT1B 5HY6A 2DJGC 2QW7A 4JI8L 4KJNA 1XMOL 2K5QA 2ID0A 2D2CC 2B2TA 3HOYG 4MNOA 3K0YA 1CQFA 1TWGB 2EQSA 2QDLA 4WORA 5I9OA 1Y1VG 1DYQA 2K5DA 1UUPA 4KKUA 4G7HC 1TQOA 2RKSA 1X54A 2FFKB 3MZ5A 4AYBB 4DV5L 4A3EG 3AEVA 4R4IA 1X32A 3S2HH 4JYAL 1IW7C 2LKVA 4NXNL 3KUPA 1GOZA 1STGA 4R4TA 3U9SA 1WD0A 4A3FH 2AWNA 4O2DA 4A3GH 3VR6A 4DR7L 4DV1L 5C5LA 2BCOA 3NBHA 4X6AH 1DOLA 3NWSA 1EQQA 3T53B 4YY3Q 3H0GH 1IW7D 3K57A 1VQOA 1EU3A 1LM0A 1DM0B 2KQ3A 4FXGC 4G57A 3ULLA 2A1AA 2K52A 5EQ0A 3MXPA 1Q46A 1SYEA 1CA5A 4A3KB 4DV4L 1BNZA 3CC4A 3J81j 2BDNA 2EYOA 1D1KA 1PA6A 2JSOA 4LF9Q 4GKJQ 1STEA 1RJTA 2HCCA 1E2ZA 1YIJA 1Y1WB 1SNMA 2UUBQ 1KDBA 1VQGA 2KCNA 2B2VA 3W5OA 2R92H 2K1BA 3PUWA 5M5XH 1PRTF 3HOVB 2Q2TA 4PNYA 2R7ZH 4B3SL 4JBKA 1EWCA 1FJGL 1S5ED 1SDFA 1VQ4A 1IKLA 1EFWA 3M7GA 4KN4C 1PH9A 4BY7H 1TS2A 4AH6A 2L5TA 1RCVD 2AUJD 4JW0A 2UUCQ 4AIMA 5C0XH 3G6EA 5JVG3 3ERQA 2MQHA 2NVQB 3GTJB 3HOVH 2IX3A 3HOUB 3SK6A 3GTLB 2M00A 1O80A 1JT8A 3J7ZC 4A3IB 1CHPD 1B44D 1EQRA 3Q6SA 1EZ6A 4KHPQ 3CQZB 2BE5C 1GVPA 1D1IA 2ZM6L 1EEID 3T16A 1PZID 3GTJH 1C8CA 1T9HA 1QJOA 4B3RQ 2F0IA 4UP8A 2K5WA 1D8LA 1EYAA 4N9TA 2BE5D 5IWAL 1TWCH 3J7AF 1PHJA 3KK7A 2MGSA 4J15A 4DN4M 1L0XB 4C3IB 3UDIA 4HIDA 3BDCA 4KV6A 1GO3E 2C9OA 1CKMA 1I4XA 4POFA 2EJGC 3MFYA 1H9SA 1Q3LA 2HDLA 3MXGA 2OTJA 4DKAC 1NNXA 3HOZB 2A73B 4LF6L 2EE1A 1M4VA 5M3FB 4JV5Q 4NW2A 5C44B 5BN3A 3KJPA 2EYJA 4XYOA 4OELB 3P7JA 4L5RC 5A2QE 3CCSA 1PH6A 1ML0D 4JPBW 1RIPA 3K7UC 4BBRG 1Z47A 5KYLA 1FR3A 2CH4W 4L5TA 1AP0A 3FKIB 4K0KQ 3IFDA 1KNAA 2HT1A 1HRJA 3I70A 4C1NI 1XTCD 4LMQD 3KLWA 1LO5D 4OONA 5A2QL 2RQXA 1W2BA 3H94A 1XTDA 2JA8B 2NN6I 1G51A 3OPOA 4MN3A 2H4OA 4PQXA 4KD4A 1K9MC 3AFPA 4C2MH 1MBYA 2K4KA 1MI2A 3BG3A 2JEAI 1IYUA 4XYQA 1LT4D 2XRSD 1IBKL 3A7AB 4A3BH 3D31A 1W6JA 5JVH3 4B3ML 5BR8L 1PRTD 1SFOB 3BYTB 1J6QA 1BBWA 3I55A 4JBJA 1WI5A 4XTCS 1PMRA 5I4DA 3LWEA 2KVMA 3K59A 4PMCA 3DWQA 1E0BA 2F0VA 1XJVA 1ASZA 2VB2X 3EA6A 2WP8J 4RGTA 2DNCA 1JWSD 5FLMH 4BY1B 3G7LA 4DFAA 1CI3M 4O1NA 4Q0FA 1QNUA 1D2BA 2IL8A 4KK7A 3NBHB 2A19A 4JI5Q 3HG9A 5J3BA 1XNQL 4DNRB 5JOBA 2K50A 1WTXA 5E4WC 4A3DB 2F4VQ 3K58A 3V05A 4JI6L 1EFID 1W3SA 1PH7A 1Q8KA 1MIUA 1VQBA 5DM73 4BY1H 4OX9L 4DAPA 5IYBH 2K5HA 5IT9c 3QJYA 1ZXTA 1N33L 1SMYC 2RHSB 1A0IA 3S9WA 3CD6A 4XQJA 1TWAB 1QE6A 2JA9A 4KI0A 3HKZE 4ME3A 1TIID 1GXDC 3DMUA 2UUBL 3I2ZA 2RCNA 3PV0A 5EPKA 1SMYD 4UY8C 1PVOA 3D0FA 5CYUA 1YJ9A 3KFUA 5CGKA 5I6WA 4OO1I 1S5FD 4A3CG 2YTYA 1HXYD 1SMXA 1K83B 3WWVA 4PMBA 3G71A 5LMUQ 3S2DB 1YHQA 4NKLA 4FF2A 2I5LX 5J39A 2ZXPA 3S14H 4PZ6A 3S1RB 1KHIA 5C3XA 3PO2H 4OHJA 2PW7A 1STHA 5IODA 2E2JH 2AHOB 3AMUA 2VY3A 1VQ6A 1STBA 1K0RA 3S15H 4A3JH 5EAYA 1E2VA 3G6JB 1I4PA 4HJ9A 4QQBX 2JA6B 3A55A 1B3QA 1VQPA 1B9MA 2K03A 4CJ0B 1N36L 2WAQG 4LF5Q 1SJHD 3S1RH 2E2DC 1BF4A 3OMGA 4HJAA 1MJEA 5J22A 3MA2B 3QG1A 3J81c 3PO3H 1XXGA 1KAAA 3I4NB 1S5CD 4JBMA 1EIHA 5C3EG 2PMZE 1Z7TA 1E3PA 5KYIA 3EROA 2B2TC 4ULLA 3T1YQ 4XIGS 2JA6H 2D62A 2RVLA 1UE7A 5JPNC 4XXEA 1WTQA 3P1HA 4LUZA 1TWFB 5CBEE 3CCVA 2IHFA 4ZRZA 2C5CA 1EQVA 2PO4A 3I73A 3TREA 1SLJA 1SRUA 1PTOH 2R3ZA 1PDQA 4Z9CB 4HSPA 3KDFA 1EIYB 3CCUA 1PTOF 3HOWG 3KF8A 3S17H 2SEBD 4DAYA 5IYDH 3ICEA 4JV5L 3S1QH 2EIFA 2FMMA 5C4JB 1OXSC 3GV3A 5CV6A 3MAQA 4C3JG 3GTKH 1DD2A 4X64Q 1E1OA 3K5OA 5ELEA 4FP5D 1TWFH 5IGEA 4C3HG 4K0KL 4PZ8A 5D14A 1UEBA 1NR2A 2PCFB 4CDCC 3M3YH 1JOOA 1N34Q 2YU9H 2MUYA 3N6RA 1KQSA 3O13A 1VMPA 5C4ZA 2GA4B 3M4OB 1TR5A 4JI4Q 2DY7A 1EY0A 1PYBA 3MEHA 4GNXA 2IY5B 5C4XB 3IRBA 1QZGA 1B8AA 2F52A 1VQAA 2B2VC 1WYDA 3KBXA 1RODA 2O5JC 2XRQD 1LTRD 1SNPA 2F0PA 1NE3A 1C7YA 5IOCA 4HN7A 1R4QB 2P5ZX 2VL6A 1A15A 2E8GA 1FL0A 2ZJRA 4YCUA 5FLXc 3HOXG 5FK9C 5I2YA 3T4AC 3TMEA 1TWHB 3Q8DA 3PCOB 1NAPA 2PQAA 3M4YA 2PYKA 2JYOA 2B63B 1K3BC 1ET6A 4KY7A 4GKKQ 3CCJA 4MZ9A 5M3MH 2F0DA 1SE2A 4L5QA 1GUOA 1YNJC 5D65A 5M5WH 2N3SA 3MXNA 3SK4A 4KHVA 4P71A 3T13A 3R3OA 1XX8A 4DR5Q 1SNQA 1X9NA 4LNQA 1STNA 2HD3A 1YNJD 4KN7C 1BUVT 1BQQT 1EYGA 3DHQA 4AYBG 1S3OA 3BVZA 3I7FA 3VYTA 2UXDQ 5GAEC 1DGSA 4EVOA 4K5XA 5ELFA 4EQ5A 1BCPB 3E3XA 3QB3A 5H1SE 5GAGC 5FO8B 3U4VA 3CCMA 2EY6A 2EY5A 4FO2A 1L1OA 3OTOQ 3CCRA 2UXBQ 3M4QA 4KKTA 1N9WA 4RAUC 1N32Q 4E6IA 4K8JA 4R9WA 3G4SA 2V4DA 4WRDA 1NY4A 1WTVA 4O0AA 1VQ8A 4K5VA 3ERSX 1K8AC 1UE6A 5CV5A 3S1MH 3V2TA 1NJIC 1YNXA 4LUOA 2KUMA 3FPPA 2UUAL 4A3KG 4X62L 1KDAA 2HHHQ 2VNUD 2B2YA 2VW9A 4LFBQ 2F0JA 4IURA 3HKSA 2NVYH 1LTSD 3GTOB 2Z4IA 3GTPB 3LGJA 1HNWL 4BA1I 1Y1WG 4OL7A 1VQCA 4QUFA 4A3MB 3SHLA 2FJ2A 3K7AH 3X3NA 2JA7B 3RLFA 1TS5A 3KF6A 4DV3Q 4GLXA 3E0EA 3HOVG 1PYSB 5JJLA 1IHZA 1TKWB 3CHBD 2CCZA 2UU9L 2A8VA 3GTOH 1EY9A 4CDDC 3HEJA 1SYFA 1VQ5A 4RKBA 5JPMC 4A3MH 3BDOA 5J1ZA 1O7LA 3I72A 1E24A 5IY0A 5EPJA 4DV2Q 1K0SA 1RKNA 2ZTCA 1YHAA 4OWWB 3PF4A 1X6OA 3H3VH 3HOUG 3S1NH 4XDXA 1VQMA 2RSOA 3RR5A 5T1IA 3U9OA 4A3IG 2XWBB 5G3LF 1KNEA 2NBFA 5C3WA 4BBSH 2SOBA 1OXTA 1BVSA 2N78A 2SNMA 1HFNA 2L9HA 3A5UA 3NTKA 3OIQA 2H5XA 3H91A 4FDBA 4ABNA 1HNZL 3KDFB 3KF8B 2RA4A 4DAYB 2E2IH 4KY6A 1MSHA 1HA6A 3C46A 4IOCA 3T56B 3F2CA 2RDGA 1FVIA 4A93B 1PH8A 2RSNA 1QVCA 4LF7Q 4LF8Q 1KAWA 4ZUIA 4C3IG 4GZYC 4DNIA 5AJ3L 3S2HB 4NXMQ 2RHQB 1HR0Q 3MEFA 2EXZA 1P16A 2LS01 2K05A 3BZCA 1PH4A 2IPKD 2WV6D 2GVBA 4C1NK 1PFBA 2QCPX 4A3FB 4FF3A 4A3GB 1XPRA 1RHPA 3CPWA 2F0OA 5DLQE 3VYUA 2WACA 3HOZG 2KBNA 2PPBC 1PYWD 3CPFA 1OXXK 5M3FG 1IL2A 3H0GB 2JA5H 3I4MH 4A93H 4CKCA 4GNXB 3ZJYC 1EIFA 3ITPA 5C44G 1LT5D 2LFNA 3F8TA 1BCPC 1HPCA 4QIWB 2ZTEA 1WTPA 2A68C 1F9SA 4QB4A 3FKIG 2MPMA 2OXPA 1I94L 1SNOA 1CTMA 2D5DA 3J80L 3S16H 1CA6A 3CMAA 2ICIA 5CC4A 1BCPD 2JA8G 5EBCA 2QGQA 4F88A 4LFCL 2R92B 5DAUA 1G8ZD 1PRTB 3HZXA 2A68D 3AU7A 4RGOS 1IL8A 5M5XB 4GLVB 2VQEQ 5HGQA 2R7ZB 4DV0Q 4HSVA 2RF4A 5IP9H 2F1MA 4JI2L 4HTHA 3K81C 4BY7B 1BOSA 4LFAL 1STAA 1VQDA 1MJCA 2D9UA 2PW5A 3GV6A 4JOIA 3BJUA 4R4CA 3ULPA 1IZ6A 4UPAA 5BN4A 1YZ6A 4PV1C 3ER0A 4GLAC 5GROA 5HGTA 1HCZA 3NUCA 4OO1H 4FVMA 3HKZB 3H3VC 1FYCA 3PIPA 2E76C 5KGUA 4BY1G 4CGYB 1WTWA 1A62A 1JOQA 4A76A 5E7NA 1BXTA 2UXDL 1L1OB 2PZUA 4K2KA 1E1TA 3NENA 4O42A 1D7QA 1ENFA 1YBYA 1MGSA 4RHRA 3UDGA 2WAQE 2SNSA 1WCMH 3CAMA 2OT2A 3MHBA 4A3DG 1YVCA 4UHVA 5DM63 2K6AA 2B2UC 1HTPA 1XMQL 1GUWA 2G5DA 2Q8RE 1TWCB 4DK6C 2F3VA 3AB9A 2E5LQ 4DUZQ 3PUXA 1T5XD 5KNDA 4GN4B 1Q82C 3QWNA 1WOCA 3D4DA 4WJWA 1JJCB 1QOHA 3MXUA 4G7ZC 4WJ3M 3OHXC 1CSQA 2R61A 4DK1A 2YV5A 1ENCA 4I7AA 1NBWA 1MD2D 1Q1EA 1HTLD 2K7VA 2WFWA 1SR3A 3KF6B 3TQYA 5M5YH 4B3TL 1SSOA 4X66L 1RTNA 1VDZA 5C6AA 4BXXH 2R93H 1XYIA 4JBWA 2WB1E 1ILPA 2D0OA 1HZBA 1SYCA 1CFMA 1PFSA 2K28A 2NB0A 4DV7Q 4TVAB 2XTIA 1GHKA 2NVTH 3NWTA 2QEXA 4RHSA 4JI1Q 1O7ZA 1Q7YC 1LYLA 4JI0L 4KJOA 1VQ9A 3T1HL 4JI3Q 4DF7A 2K75A 4PMWA 4GNXC 3M4PA 3CRLC 2EXDA 1H9RA 4Y7NH 4C2MB 4TSSA 2M2LA 1A8VA 2A69D 1HFGA 2JA6G 4A3BB 2RDHA 4JC0A 4A3LG 4YHHL 3A56A 5IP7G 3URYA 3SE0A 1QWYA 5CV8A 4OWTB 1V9PA 3KOJA 1C48A 3OYYA 1PRTC 3I4NG 3MC0B 4H7BA 1FNVA 2PI2E 1W6KA 5ELCA 4JI7Q 1L2FA 1V8QA 3T51B 4X65Q 1Y1VH 1CKOA 1Q90A 1C4QA 2WKCA 3MWYW 2ZXOA 1R9TH 1F2MA 1KXLA 4A3EH 3RZOB 2CH4A 1V1QA 3W2DA 3DEPA 3QO2A 2B29A 3GTQB 2AQ1B 1SYBA 1V1PA 1LUZA 2VUMB 1JE5A 3I4LA 3PIOA 3SXHA 4IOAA 3K5MA 2F0EA 3E6ZX 4ZYSA 3H15A 1H9KA 1HQMC 3VR3A 4R1JA 5E1FA 1E22A 5KIXA 2JJQA 2LMCB 4AYBE 3RMHA 4FNFA 4RMFA 1L1OC 1VF5C 4HCSA 4IPDA 3RZOH 1EL0A 2VS1A 5COYA 1Y69U 5EGTA 3KBGA 3TS0A 3C2PA 3GTQH 5M9OA 2MO1A 2EJFC 4IJHA 4L63B 2VUMH 4DR6Q 5FO9B 4QCLA 2N88A 1B53A 1EZ8A 1XPUA 3VA7A 2ZXRA 4YY3L 1SE3A 4DPGA 3QOJA 1VQHA 2B2YC 4LW1A 4CBVA 3Q0AA 2LXJA 5IYCG 1JORA 1B4OA 3CMEA 2VQFQ 1YJNA 2EYFA 5C4XG 4DR1Q 5IGFA 1MKHA 4LF9L 1VQIA 3GTMB 4GKJL 3S14B 1SROA 1KRSA 2E74C 2I0QA 4C56C 3JC66 3HGBA 4IFDG 4GOPA 1VQFA 4CDFC 4DR2Q 1ZKOA 2CW0D 3STBD 4DV6Q 3PO2B 1EY4A 3AYHB 2LY7A 2E2JB 2OQ0A 3CCEA 4CKBA 3KLRA 4F87A 2QKIC 2B63G 2L1BA 3S15B 2K04A 3MTSA 4A3JB 4L5SA 3NEMA 1NSNS 3N52A 4IZ8A 4N9PA 3EBEA 2OWOA 3R93A 3GTMH 2JXMB 1FGUA 4K5WA 4OIJA 3LWUA 3I3CA 5LMNQ 1G6PA 2F0QA 5JJIA 4IQZA 1ENAA 2UUCL 1K8OA 1PFNA 4RG1A 1I4RA 1X3GA 1B70B 2PZWA 1J5EQ 3PO3B 5IGCA 1SEBD 3Q22A 1NMFA 4OIKA 2IJ0A 3OOCA 4L8JA 1YJWA 3VR4A 2B2WA 1WVLA 1JE4A 4LF4Q 2Y0SB 2KHSA 3PGZA 3L9AX 5IIFA 4Q5VA 3UE1A 1IBMQ 1EY5A 1F77A 4KHPL 1IKMA 2FINB 3IAYA 5EKIA 2V1CC 3OSOA 1A3VA 2OCEA 3R2TA 5EKLA 2JP1A 2HIVA 3NBIA 5FJ8H 4OGQC 3BU2A 1L0WA 1AE3A 5K36G 1EU4A 5F2DA 4B3RL 5ISRA 4UDUC 1PTOB 3SVMA 3NE5B 4HJ5A 5JEAG 3IL8A 2AQ3B 1H9JA 4TRDA 3S17B 1X65A 2J4XA 1CKNA 2FHTA 5LL6X 3S1QB 2RBMA 5ELOA 1H9SB 1F2ZA 2EPBA 3J7YW 4J8QA 3UE0A 3GTGH 2UXCQ 3GTKB 1G91A 4KMUC 3M9BA 4QMGA 1KC8C 1TS4A 3LNNA 1HR0W 1LV9A 2Q8TA 4P74A 5EJWA 2KECA 4WJ4A 3M3YB 4AQYQ 2AMCB 4BBRH 1U9RA 4A3MG 2YU9B 2EY2A 2JA7G 1HJPA 2F0NA 4ME5A 4P75A 4EX5A 1EOTA 2CQAA 3CKIB 1WFQA 1KTKA 4NMZA 3A54A 3L3OC 2ZTDA 3CCLA 3C3LA 5AFWA 4CJ2C 3C1FA 4H02A 2ICEC 2PI2A 4XQNA 5JJZA 2EJMA 2Q2IA 3F2UA 1HZ9A 3TN2A 3RN5A 2Z6BA 3JAME 1CQVA 4DGZA 1X3EA 1XWEA 2O2LD 1GJXA 3E0JA 4U673 1JWMD 4ILWA 5D3IB 1AZQA 4LK1C 1G2SA 1RD9D 4IALA 5IGGA 3P20A 3JAML 5M3MB 1JR0D 1F9RA 1D5XC 4U68A 2K33A 3EVQA 4I7ZC 2O5IC 5K5PA 4DV5Q 2HQEA 4R8NA 1V1PB 3WOFA 4G4KA 5M5WB 1VQKA 3U58A 1D5MC 3TP6A 4JYAQ 1UWVA 4NXNQ 3JAMi 2I5HA 1WD1A 2EYPA 4DR7Q 4DV1Q 4A93G 1SXTA 3W1GA 4J6HA 1ICFB 1M8AA 1TS3A 4LWCA 4RH6A 4QUCA 5CBAE 1PH3A 1DZ1A 3Q24A 4GS3A 4RCNA 3PUZA 1PZKD 4JI5L 3RUZA 4DV4Q 4A3FG 3NQIA 5FKAC 4A3GG 2DJFC 4RKLA 2RCFA 4P72A 1LT3D 2F4VL 3NTHA 1A2TA 3SGIA 2A6HC 4DR3Q 2C35B 3H0GG 4QJFA 3A8JE 1QUQA 2IHEA 3CXCA 3S1MB 3TRZA 2L4NA 4K14A 1QZHA 1HNXQ 2KENA 4UP9A 1I5FA 3GDEA 4J1MA 1H9MA 4KHZA 2EYHA 3PQIA 2A6HD 3KYHC 2L0CA 1SAPA 2NVYB 4GOPB 4B3SQ 4PZ7A 2IW3A 1N8RC 4NPSA 3WOEA 3SK8A 4A3CH 1FJGQ 1S5BD 1EWIA 1PTOC 2KEEA 4F7XA 1AEXA 3K7AB 2R92G 2OF1A 4S3SA 4HJ7A 1LTLA 1ILQA 3MFGA 2I46A 1BBXC 2AKWB 2R7ZG 5IGBA 2OEOA 3OWFA 2NZOA 1PTOD 3EFXD 4FXKC 5LMUL 1WTOA 4BY7G 4TKOB 5GADC 3F2DA 1SYDA 2PZTA 4N8X1 1UNSA 2L15A 2AWOA 5C0XG 4DAMA 2BH2A 5LMNL 3C1EA 3ULJA 2NTSA 2ZM6Q 2DY8A 3HKZG 1PH5A 1L0YB 3S1NB 1U4RA 2MHVA 1ZEQX 5A35A 5IWAQ 1CT1D 5ELBA 4BBSB 5C3EH 1LTGD 1SE4A 2HCIA 4LF5L 2N49A 2WB1B 1KD1C 1FD7D 1DXMA 3QIAA 2OQKA 4R4QA 1Q8IA 3SK5A 4X3UA 2K5VA 2E2IB 5L37A 1II3A 3CU7A 2OTLA 2A5HA 3CC7A 1C9OA 3GP7A 3U4ZA 3HS0C 4L6TB 4EQNA 2NYZD 2AQ2B 3KJOA 3DUZA 3DLLA 1UE1A 1LTAD 2M9VA 3TEHB 1RL2A 3T1YL 1S40A 3X3MA 2XNAC 3HOWH 2UXCL 2E75C 4TQUS 1IBLQ 2HQLA 1G2TA 2NN6H 3M85A 4DNTB 3NPPA 4C3JH 3EIVA 3PMFA 1DONA 2F4IA 2NUCA 1A63A 1AH9A 5I9PA 1A6XA 2JA5B 3I4MB 1E2WA 4C3HH 1MHWC 3DM1A 1QILA 1TU2B 4IJLA 4IFDJ 3ZYYX 4HCEA 4FYDA 3F1ZA 2GN5A 5I6YA 5IGDA 4X64L 4QGUA 1IYVA 3I4OA 2D0PA 3H09A 4IUTA 2TMPA 3K6OA 1PXUA 4HR7B 1VS0A 3S16B 1NUCA 3LX0A 4G7OC 1LTTD 1U4MA 1U4PA 4EQOA 3CW2C 3FDTA 4DK0A 4HMIA 2K01A 2K14A 5EPLA 1PZJD 1VQNA 4B3MQ 4ZKCB 5BR8Q 1Y8PB 1N34L 2L55A 3PIP3 1SYGA 4MHEA 1YHBA 1JJGA 3J80E 4POGA 4K6LA 2PQEA 4RCOA 2QF7A 5CV7A 1I6HH 2R7FA 3FRPB 1HZCA 3TZDA 4JI4L 3HOXH 1RF2D 1B50A 3HRZC 4GOPC 3NELA 4A3BG 4RGMA 3UI2A 2KCCA 2LSSA 1OXUA 1XNRQ 3SDZA 2IT1A 1VQ7A 2PQAB 1XPOA 1RDPD 1E7ZA 1QNKA 1SJED 4QY7A 2E2HB 4IUPA 5C5MA 2BDOA 2CWAA 4EQPA 1XNQQ 1F9PA 1B2TA 3UDXA 1X3PA 3J80i 3ND9A 1TWGH 1PFMA 3BYYB 1VQLA 5FLMG 4JI6Q 4X3SA 3RLNA 4YWMA 4GKKL 3MXNB 3E5SA 1Q86C 1EUJA 5JEAJ 2QDBA 1H95A 2JN4A 1BO0A 5HURA 4GN5A 4OX9Q 3L0OA 3VDYA 4R8IA 5LMNW 1GUSA 2B2WC 1WCMB 2E2HH 1N33Q 1EEFD 1QUQB 4CKEA 1LT6D 4DR5L 2VUMG 1G6ZA 4HMJA 3CCQA 4X3KA 1K3RA 1GHJA 4OXPA 3KLSX 4DR3L 3ONAB 3QOLA 4IFDI 3GO5A 1KABA 2ZJPA 3CRKC 5IYBG 4DUYQ 2HDMA 4FF4A 1HNXL 3IKJA 5ELNA 3R2IA 1K8MA 3CP0A 4PG3A 3A74A 1P8LA 5JJKA 4F8MA 4JK1C 5G3LD 4A3KH 2UXBL 3OTOL 3OIPA 1GUTA 5TSSA 2Z9HA 2JK8A 5M5YB 1N32L 4HIMA 2F0SA 3P75A 3I91A 4OWXB 1UAPA 2R93B 1NR4A 1KIXA 1Y1WH 4B9WA 4DA2A 1QCBD 2R7DA 4IUNA 4LUVA 2Z4HA 1KLUD 1B7YB 1I4GA 2LXKA 2HHHL 4LFBL 2EDGA 3L2PA 3UDFA 4I65A 2NVTB 4A4IA 4IUUA 3WDNA 4ZKBB 1Q81C 2F0GA 1N36Q 1S72A 1V1OA 4UAIA 4EGVA 3PO2G 4QF4A 4ZCKA 1S4ZA 1B9NA 1Q12A 5CORA 4DV3L 4H13C 4Y7NB 3DWPA 4A3JG 3K5LA 2NVQH 4IPGA 2PMZB 2NVXB 2Z6KA 3HOUH 4X3TA 4JG2A 4NP5A 3B6YA 3GTLH 5FOBB 4ZLTF 2PNHA 3PIO3 4A3IH 1QG7A 2A69C 3GD7A 2Q2UA 1D6EC 3PO3G 5FJ8G 2L12A 3CQZH 2KJXA 1HUMA 3I56A 4DV2L 4IO9A 2BA1A 4QL5A 3HOYB 2EYLA 5C4HA 1TY2A 2YTVA 2Z1CA 2Y0SG 1DOMA 1SNCA 4DK3C 2NVXH 1Y1VB 4IUQA 3BVMA 4DU9A 1R9TB 1X3QA 3NQTA 1EY7A 4A3EB 2ENBA 1BBUA 3H3VI 5CMDA 4C3IH 1IBLL 3HFZB 2KOLA 1QB5D 1ET9A 2N8NA 1AW7A 1SBBB 4XT3B 3FMCA 3CC2A 5BN5A 3HOYH 3R8BA 1K28A 5IYDG 3FVQA 1M90C 4CHTB 1TY0A 1LTBD 1AN8A 4LF7L 3HOZH 2NTTA 4DXGA 4LF8L 2I5MX 4M1UB 5GQOA 4IPCA 5M3FH 1HUNA 4NXML 1GUGA 3PSIA 3F2BA 5I2XA 1HR0L 3A7LA 3RZDB 5C44H 4LAAA 1JOKA 1O7YA 4YWLA 3HP3A 4K6DA 5NUCA 4ODGA 1NCVA 3DEOA 3Q23A 2DGYA 4N8FA 4DR4Q 3FKIH 2ES2A 1WTHA
chains in the Genus database with same CATH topology
4H0LC 2WINB 4YIJA 4ID6A 2EVBA 5C0XJ 4RGNA 2NWGA 1RTOA 3D6WA 3I8ZA 2CVRA 2A74C 4V0BA 5EBDA 5CR3A 2F0TA 4ZUJA 1VF7A 2G9HD 2CW0C 3NSWA 5DNFA 3NTIA 3TDQA 3J7AV 4KY5A 3VR5A 3BVGA 3PUYA 5ELDA 1MSGA 1J8IA 3D4RA 1HA5A 3TP8A 1JCKB 2DN8A 4FF1A 3BS1A 3SEBA 3VA5A 3BDLA 4ZAIA 4DAVA 1ZYRC 3FEWX 4FXDA 4V190 1VMCA 2MP1A 2F0FA 4M8AA 2J7ZA 3NP8A 1CZGA 2O4XA 2QEJC 4DXFA 1ZYRD 4P2CB 5DEHA 4HAEA 5C0XI 2F0HA 2F3WA 2EZVA 5LL6S 3GTGB 1UEAB 1HQRD 1Y8NB 1D5ZC 3EJIA 2EY1A 2XVSA 3M7NA 1STYA 3VYRA 4B08A 2IWHA 1LABA 3H6MA 4BBRB 5CV9A 2PNRC 1CHQD 3NXWA 2H1EA 3FPUB 1FGBD 2AUKA 2A6EC 5LHY1 2VB3X 1ICWA 3BZDB 1A2UA 3NK9A 1V43A 1HHVA 4MIUA 4LJZC 1F9QA 5IT9E 2Z8LA 5D3DA 1DCZA 3PUVA 2A6ED 1R4PB 1EYDA 2B2UA 4KD3A 1GUNA 2DNEA 1CM9A 2I07B 1J9OA 5IT9L 1O78A 4K8IA 1KDCA 1A3UA 3EQLC 3OMCA 1JQYD 4NDXA 2G9DA 2X6GA 1FNWA 1EIGA 5JAVA 1TVXA 3DXJC 1OO9B 2FMCA 2J0TD 3K5NA 3SR1A 1Y8OB 4ZQ3A 2NN6G 5FO7B 1KLGD 4BWGB 3IFTA 3D3RA 3ND8A 4RFBA 1Q1BA 2N55A 2HUGA 3MVVA 2BA0A 1U4LA 1JWUD 5KEEA 2IX0A 1T5EA 3GQBA 1I4HA 4H44C 2CHBD 2RDFA 1B3AA 1ESFA 4HEDA 1B1ZA 3J81E 1CZWA 1I6VC 5CV4A 1EQTA 2X69A 4BA2I 3L7ZC 5E3FA 3J81L 2XWJB 1Z6HA 3TZUA 4K2LA 1LTID 3VR2A 4CJ1B 3TBIB 1VCIA 5KNBA 1I4QA 1AZPA 1OXVA 1JC7A 4IFDH 1S5DD 4RA8A 3OWEB 5EKKA 5KRUA 1F2LA 1AFPA 2NZ1D 1I50B 4IUVA 2JEBI 1A3TA 1SNDA 1TT2A 5E4XA 3W3AA 1DJRD 2WAQB 4KTAA 2K32A 1BR9A 3A8IE 4OO1G 2X6LA 2BOSA 5KNCA 3D4WA 1WTRA 5C3EB 2Q8IB 1LLRD 1JICA 3VYSA 2XSCA 2MJ8A 2F0WA 1BCPF 1LACA 1FNUA 3A8KE 2KA7A 5FLXE 5K36H 3TP5A 1ESRA 4XQQA 1BDOA 4BS9A 1I3QB 1F2YA 2F0UA 5JEAH 3HOWB 2VXWA 3DWAA 2F0KA 2IX1A 3I90A 3TSSA 4ZK9B 5FLXL 3D8GA 4C3JB 4B9XA 1PLFA 2WIIB 2B8FA 3V96A 1JB3A 2F03A 2L11A 2B8GA 4WFN3 4C3HB 4RWSC 2SDFA 2KEDA 1EWHA 1ONLA 1G291 5T1GA 3D6CA 2EOTA 3RD4A 1EY6A 2JE6I 2R6GA 1DOKA 1YNNC 2F0LA 2EYMA 3KLSA 2WKDA 3OW7A 4KKSA 2XIWA 2ZT9C 1I6HB 1EYCA 3HOXB 1EY8A 1YNND 2B39A 3TP7A 2QILA 2YYZA 1CK1A 2TSSA 2XN9C 4IN3A 2F0MA 3NHHA 4XT1B 4KJNA 2K5QA 2ID0A 2D2CC 2B2TA 3K0YA 1CQFA 1TWGB 4WORA 5I9OA 1DYQA 2K5DA 1UUPA 4KKUA 4G7HC 1TQOA 2RKSA 2FFKB 3MZ5A 4AYBB 1X32A 1IW7C 2LKVA 3KUPA 1GOZA 1STGA 3U9SA 1WD0A 2AWNA 3VR6A 5C5LA 2BCOA 3NBHA 1DOLA 3NWSA 3T53B 1IW7D 3K57A 1EU3A 2KQ3A 1DM0B 4FXGC 4G57A 5EQ0A 3MXPA 1SYEA 1CA5A 4A3KB 1BNZA 2BDNA 2EYOA 1D1KA 2JSOA 1STEA 1RJTA 2HCCA 1E2ZA 1Y1WB 1SNMA 1KDBA 2KCNA 2B2VA 2K1BA 3PUWA 1PRTF 3HOVB 4PNYA 1EWCA 1S5ED 1SDFA 1IKLA 3M7GA 4KN4C 1TS2A 2L5TA 1RCVD 2AUJD 5C0XH 5JVG3 3ERQA 2NVQB 3GTJB 2IX3A 3HOUB 3SK6A 3GTLB 2M00A 1O80A 4A3IB 1CHPD 1B44D 3Q6SA 1EZ6A 3CQZB 2BE5C 1D1IA 1EEID 3T16A 1PZID 1C8CA 1QJOA 2F0IA 2K5WA 1EYAA 4N9TA 2BE5D 3J7AF 3KK7A 2MGSA 4DN4M 1L0XB 4C3IB 3BDCA 4KV6A 2C9OA 1I4XA 2EJGC 3MFYA 1H9SA 1Q3LA 2HDLA 3MXGA 3HOZB 2A73B 2EE1A 1M4VA 5M3FB 4NW2A 5C44B 5BN3A 2EYJA 4XYOA 3P7JA 5A2QE 1ML0D 1Z47A 5KYLA 1FR3A 1AP0A 3FKIB 3IFDA 1KNAA 1HRJA 3I70A 4C1NI 1XTCD 4LMQD 1LO5D 5A2QL 2RQXA 3H94A 2JA8B 2NN6I 3OPOA 4MN3A 2H4OA 4PQXA 4KD4A 1MBYA 3BG3A 1MI2A 2JEAI 1IYUA 4XYQA 1LT4D 2XRSD 3A7AB 3D31A 1W6JA 5JVH3 1PRTD 1SFOB 3BYTB 4XTCS 1PMRA 5I4DA 3LWEA 2KVMA 3K59A 4PMCA 3DWQA 1E0BA 2F0VA 2VB2X 3EA6A 2WP8J 4RGTA 2DNCA 1JWSD 4BY1B 3G7LA 4DFAA 1CI3M 4O1NA 4Q0FA 1QNUA 1D2BA 2IL8A 4KK7A 3HG9A 4DNRB 5JOBA 1WTXA 5E4WC 4A3DB 3K58A 3V05A 1EFID 5DM73 4DAPA 3QJYA 1ZXTA 1SMYC 3S9WA 4XQJA 1TWAB 1QE6A 4KI0A 1TIID 1GXDC 3DMUA 3PV0A 5EPKA 1SMYD 5CYUA 5CGKA 5I6WA 4OO1I 1S5FD 1HXYD 1K83B 4PMBA 3S2DB 4NKLA 4FF2A 5J39A 2ZXPA 3S1RB 5C3XA 4OHJA 2PW7A 1STHA 5IODA 3AMUA 1STBA 1E2VA 3G6JB 1I4PA 2JA6B 3A55A 1B9MA 2K03A 4CJ0B 1SJHD 2E2DC 1BF4A 3OMGA 5J22A 3MA2B 3QG1A 1XXGA 1KAAA 3I4NB 1S5CD 1EIHA 1Z7TA 5KYIA 3EROA 2B2TC 4ULLA 4XIGS 2D62A 2RVLA 5JPNC 4XXEA 1WTQA 3P1HA 1TWFB 5CBEE 4ZRZA 2C5CA 1EQVA 2PO4A 3I73A 1PTOH 2R3ZA 1PDQA 4Z9CB 4HSPA 1PTOF 3KF8A 2SEBD 4DAYA 2FMMA 5C4JB 1OXSC 3GV3A 5CV6A 3MAQA 4C3JG 1DD2A 3K5OA 5ELEA 4FP5D 5IGEA 4C3HG 5D14A 1NR2A 2PCFB 1JOOA 2MUYA 3N6RA 3O13A 1VMPA 5C4ZA 2GA4B 3M4OB 1TR5A 2DY7A 1EY0A 3MEHA 5C4XB 2B2VC 3KBXA 1RODA 2O5JC 2XRQD 1LTRD 1SNPA 2F0PA 5IOCA 4HN7A 1R4QB 1A15A 5FK9C 5I2YA 3T4AC 3TMEA 1TWHB 1NAPA 3M4YA 2PYKA 2JYOA 2B63B 1ET6A 4KY7A 2F0DA 1SE2A 1GUOA 1YNJC 5D65A 3MXNA 3SK4A 4KHVA 3T13A 1XX8A 3R3OA 1SNQA 1STNA 1YNJD 4KN7C 1BUVT 1BQQT 3DHQA 3BVZA 3VYTA 4EVOA 4K5XA 5ELFA 1BCPB 3QB3A 5FO8B 2EY6A 2EY5A 4FO2A 4KKTA 4RAUC 4E6IA 4K8JA 4R9WA 2V4DA 4WRDA 1WTVA 4K5VA 5CV5A 3V2TA 2KUMA 3FPPA 1KDAA 2VNUD 2B2YA 2F0JA 4IURA 1LTSD 3GTOB 2Z4IA 3GTPB 4BA1I 4OL7A 4QUFA 4A3MB 3SHLA 2FJ2A 3X3NA 2JA7B 3RLFA 1TS5A 1IHZA 1TKWB 3CHBD 1EY9A 3HEJA 1SYFA 4RKBA 5JPMC 3BDOA 5J1ZA 1O7LA 3I72A 5EPJA 1RKNA 4XDXA 2RSOA 5T1IA 3U9OA 2XWBB 5G3LF 1KNEA 2NBFA 5C3WA 2SOBA 1OXTA 2SNMA 1HFNA 2L9HA 3NTKA 3OIQA 3H91A 4ABNA 2RA4A 4KY6A 1MSHA 1HA6A 3C46A 3T56B 2RDGA 4A93B 2RSNA 4ZUIA 4C3IG 4GZYC 3S2HB 2EXZA 2LS01 2K05A 2IPKD 2WV6D 4C1NK 1PFBA 2QCPX 4A3FB 4FF3A 4A3GB 1RHPA 2F0OA 3VYUA 2WACA 2PPBC 1PYWD 1OXXK 3H0GB 4CKCA 3ITPA 1LT5D 2LFNA 1BCPC 1HPCA 4QIWB 1WTPA 2A68C 1F9SA 4QB4A 2MPMA 2OXPA 1SNOA 1CTMA 2D5DA 3J80L 1CA6A 2ICIA 5CC4A 1BCPD 5EBCA 4F88A 2R92B 5DAUA 1G8ZD 1PRTB 3HZXA 2A68D 3AU7A 4RGOS 1IL8A 5M5XB 2R7ZB 4HSVA 2F1MA 4HTHA 4BY7B 1BOSA 1STAA 2D9UA 2PW5A 3GV6A 5BN4A 4PV1C 5HGTA 1HCZA 3NUCA 4OO1H 4FVMA 3HKZB 3H3VC 1FYCA 2E76C 5KGUA 4CGYB 1WTWA 1JOQA 1BXTA 4K2KA 2PZUA 4O42A 1ENFA 1MGSA 4RHRA 2SNSA 3MHBA 2OT2A 5DM63 2K6AA 2B2UC 1HTPA 1GUWA 2Q8RE 1TWCB 2F3VA 3AB9A 3PUXA 1T5XD 5KNDA 3QWNA 4WJWA 3D4DA 1QOHA 3MXUA 4G7ZC 3OHXC 2R61A 4DK1A 1ENCA 1MD2D 1Q1EA 1HTLD 2K7VA 1SSOA 5C6AA 1RTNA 1VDZA 1XYIA 4JBWA 1ILPA 1SYCA 1CFMA 2K28A 2NB0A 1GHKA 3NWTA 4RHSA 1O7ZA 4KJOA 4DF7A 4PMWA 3CRLC 1H9RA 4C2MB 4TSSA 2M2LA 2A69D 1HFGA 4A3BB 2RDHA 3A56A 3URYA 3SE0A 1QWYA 5CV8A 1C48A 1PRTC 3MC0B 4H7BA 1FNVA 1W6KA 5ELCA 1V8QA 3T51B 1Q90A 1C4QA 2WKCA 3MWYW 2ZXOA 1F2MA 3RZOB 3W2DA 3DEPA 3QO2A 3GTQB 2AQ1B 1SYBA 1V1PA 2VUMB 3I4LA 3SXHA 3K5MA 2F0EA 3E6ZX 4ZYSA 1H9KA 1HQMC 3VR3A 5E1FA 5KIXA 2LMCB 3RMHA 4FNFA 1VF5C 4HCSA 1EL0A 5COYA 1Y69U 5EGTA 3KBGA 3C2PA 5M9OA 2EJFC 4L63B 5FO9B 4QCLA 2N88A 1B53A 1EZ8A 3VA7A 2ZXRA 1SE3A 3QOJA 2B2YC 4CBVA 3Q0AA 1JORA 1B4OA 2EYFA 5IGFA 3GTMB 3S14B 2E74C 4C56C 3HGBA 4IFDG 1ZKOA 2CW0D 3PO2B 1EY4A 2LY7A 2E2JB 4CKBA 3KLRA 4F87A 2QKIC 2L1BA 3S15B 2K04A 3MTSA 4A3JB 1NSNS 3N52A 4IZ8A 4N9PA 3R93A 2JXMB 4K5WA 4OIJA 3LWUA 3I3CA 2F0QA 4IQZA 1ENAA 1K8OA 1PFNA 1I4RA 2PZWA 3PO3B 5IGCA 1SEBD 3Q22A 4OIKA 2IJ0A 3OOCA 4L8JA 3VR4A 2B2WA 1WVLA 1JE4A 2Y0SB 2KHSA 3L9AX 5IIFA 4Q5VA 1EY5A 1F77A 1IKMA 2FINB 3IAYA 5EKIA 3OSOA 1A3VA 3R2TA 5EKLA 2JP1A 3NBIA 4OGQC 5K36G 1EU4A 5F2DA 5ISRA 4UDUC 1PTOB 3SVMA 3NE5B 5JEAG 3IL8A 2AQ3B 1H9JA 4TRDA 3S17B 2J4XA 2FHTA 5LL6X 3S1QB 2RBMA 1H9SB 1F2ZA 2EPBA 3J7YW 4J8QA 3GTKB 1G91A 4KMUC 4QMGA 1TS4A 3LNNA 1LV9A 2Q8TA 5EJWA 2KECA 3M3YB 1U9RA 2YU9B 2EY2A 2F0NA 4ME5A 1EOTA 2CQAA 3CKIB 1KTKA 4NMZA 3A54A 3L3OC 3C3LA 5AFWA 4CJ2C 3C1FA 2ICEC 4XQNA 5JJZA 2EJMA 3F2UA 3TN2A 3JAME 1CQVA 4DGZA 1XWEA 2O2LD 1GJXA 3E0JA 4U673 1JWMD 4ILWA 5D3IB 1AZQA 4LK1C 1G2SA 1RD9D 4IALA 5IGGA 3P20A 3JAML 5M3MB 1JR0D 1F9RA 1D5XC 4U68A 2K33A 3EVQA 4I7ZC 2O5IC 5K5PA 2HQEA 4R8NA 1V1PB 3WOFA 4G4KA 5M5WB 1D5MC 3TP6A 1WD1A 2EYPA 1SXTA 4J6HA 1M8AA 1TS3A 4RH6A 4QUCA 5CBAE 1DZ1A 3Q24A 4RCNA 3PUZA 1PZKD 3RUZA 3NQIA 5FKAC 4RKLA 1LT3D 3NTHA 1A2TA 2A6HC 3A8JE 3S1MB 2L4NA 4K14A 4J1MA 1H9MA 4KHZA 2EYHA 2A6HD 2L0CA 1SAPA 2NVYB 2IW3A 3WOEA 3SK8A 1S5BD 1PTOC 2KEEA 4F7XA 1AEXA 3K7AB 2OF1A 4S3SA 1ILQA 3MFGA 2I46A 1BBXC 5IGBA 2OEOA 3OWFA 1PTOD 3EFXD 4FXKC 1WTOA 4TKOB 1SYDA 2PZTA 1UNSA 2AWOA 5C0XG 3C1EA 2NTSA 2DY8A 1L0YB 3S1NB 1U4RA 2MHVA 1ZEQX 5A35A 1CT1D 5ELBA 4BBSB 1LTGD 1SE4A 2HCIA 2WB1B 1FD7D 1DXMA 3QIAA 1Q8IA 3SK5A 4X3UA 2E2IB 1II3A 3CU7A 2A5HA 3GP7A 3HS0C 4L6TB 4EQNA 2NYZD 2AQ2B 3DUZA 2M9VA 1LTAD 3X3MA 2XNAC 2E75C 4TQUS 1G2TA 2NN6H 3M85A 4DNTB 3NPPA 3PMFA 1DONA 2F4IA 2NUCA 5I9PA 1A6XA 2JA5B 3I4MB 1E2WA 3DM1A 1QILA 1TU2B 4IFDJ 3ZYYX 4HCEA 4FYDA 5I6YA 5IGDA 1IYVA 3H09A 4IUTA 2TMPA 3K6OA 1PXUA 4HR7B 3S16B 1NUCA 3LX0A 4G7OC 1LTTD 1U4MA 1U4PA 4EQOA 3FDTA 4DK0A 4HMIA 2K01A 5EPLA 1PZJD 4ZKCB 1Y8PB 2L55A 3PIP3 1SYGA 4MHEA 3J80E 4K6LA 2PQEA 4RCOA 2QF7A 5CV7A 3FRPB 3TZDA 1RF2D 1B50A 3HRZC 4RGMA 3UI2A 2KCCA 1OXUA 3SDZA 2IT1A 1RDPD 1QNKA 1SJED 2E2HB 4IUPA 5C5MA 2BDOA 4EQPA 1F9PA 1B2TA 1X3PA 3ND9A 1PFMA 3BYYB 4X3SA 3E5SA 5JEAJ 2QDBA 5HURA 1BO0A 4R8IA 1GUSA 2B2WC 1WCMB 1EEFD 4CKEA 1LT6D 1G6ZA 4HMJA 4X3KA 1GHJA 3KLSX 3ONAB 3QOLA 4IFDI 3GO5A 1KABA 3CRKC 2HDMA 4FF4A 3IKJA 3R2IA 1K8MA 4F8MA 4JK1C 5G3LD 3OIPA 1GUTA 5TSSA 5M5YB 2F0SA 3P75A 3I91A 1UAPA 2R93B 1NR4A 4B9WA 4DA2A 1QCBD 4IUNA 2Z4HA 1KLUD 1I4GA 2EDGA 4I65A 2NVTB 4IUUA 3WDNA 4ZKBB 2F0GA 1V1OA 4UAIA 4EGVA 4QF4A 1S4ZA 1B9NA 1Q12A 5CORA 4H13C 4Y7NB 3DWPA 3K5LA 2PMZB 2NVXB 4X3TA 4NP5A 5FOBB 4ZLTF 3PIO3 1QG7A 2A69C 3GD7A 1D6EC 2L12A 2KJXA 1HUMA 2BA1A 3HOYB 2EYLA 5C4HA 1TY2A 2Z1CA 1DOMA 1SNCA 1Y1VB 4IUQA 3BVMA 4DU9A 1R9TB 1X3QA 3NQTA 1EY7A 4A3EB 2ENBA 5CMDA 2KOLA 1QB5D 1ET9A 1AW7A 1SBBB 4XT3B 3FMCA 5BN5A 3R8BA 3FVQA 4CHTB 1TY0A 1LTBD 1AN8A 2NTTA 4DXGA 4M1UB 1HUNA 1GUGA 5I2XA 3A7LA 3RZDB 4LAAA 1JOKA 1O7YA 3HP3A 4K6DA 5NUCA 4ODGA 1NCVA 3DEOA 3Q23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUT A;  1AP0 A;  4QUF A;  2FJ2 A;  1KNA A;  2B2V A;  2K28 A;  3IFD A;  1B4O A;  1CA6 A;  1EOT A;  2KEE A;  1HRJ A;  4LMQ D;  4CJ1 B;  5T1G A;  2H1E A;  3FPU B;  1U4M A;  1U4P A;  2DY7 A;  2NWG A;  3FDT A;  2K1B A;  1RTO A;  3D6W A;  3I8Z A;  2CVR A;  1ILQ A;  2K01 A;  5EPL A;  2EOT A;  4ZKC B;  2B2V C;  1O7Z A;  1AZP A;  1BBX C;  3KBX A;  1IL8 A;  1DOK A;  1ICW A;  1ROD A;  4MN3 A;  4MHE A;  5AFW A;  4CJ2 C;  4IUU A;  4ZKB B;  4RA8 A;  1SDF A;  4HSV A;  1IKL A;  4UAI A;  1WTO A;  1HHV A;  1MI2 A;  1A15 A;  1S4Z A;  3TZD A;  1F9Q A;  5JJZ A;  3F2U A;  1F2L A;  5COR A;  2XIW A;  2NZ1 D;  3TN2 A;  2B2U A;  2D9U A;  1B50 A;  3GV6 A;  2M2L A;  5EPJ A;  2L1B A;  4IUV A;  3UI2 A;  1NAP A;  2K04 A;  3MTS A;  1HFG A;  2JYO A;  1CM9 A;  5DNF A;  3N52 A;  1J9O A;  3R93 A;  2K03 A;  4CJ0 B;  1AZQ A;  4X3T A;  5E4X A;  1G2S A;  3LWE A;  2KVM A;  1QNK A;  4XT1 B;  4XDX A;  2RSO A;  4OIJ A;  1BF4 A;  4ZLT F;  2DY8 A;  1E0B A;  3I3C A;  4IUP A;  5T1I A;  1F9R A;  4U68 A;  1O80 A;  1QG7 A;  1F9P A;  5D65 A;  1PFN A;  2X6L A;  1KNE A;  2X6G A;  1U4R A;  1X3P A;  1B2T A;  2L12 A;  2B2T A;  1EIG A;  1HUM A;  1PFM A;  1HFN A;  3Q6S A;  1TVX A;  1WTW A;  2L9H A;  1XX8 A;  1EIH A;  4OIK A;  4X3S A;  2HCI A;  3H91 A;  3G7L A;  1MSG A;  1WTR A;  2B2W A;  1J8I A;  4O42 A;  1WVL A;  1DOM A;  1JE4 A;  3MWY W;  2B2T C;  2RA4 A;  1BO0 A;  1MGS A;  1MSH A;  2IL8 A;  1WD1 A;  1C8C A;  1HA6 A;  4X3U A;  5EJW A;  1JIC A;  2RVL A;  4IUQ A;  4R8I A;  1WTX A;  2FFK B;  5E4W C;  1X3Q A;  2MJ8 A;  2B2U C;  2B2W C;  3DEP A;  3QO2 A;  1WTQ A;  1IKM A;  1GUW A;  2FIN B;  2RSN A;  5EKI A;  1X32 A;  1M8A A;  4ZAI A;  2N55 A;  2Q8R E;  5CBE E;  1G6Z A;  5CMD A;  2HUG A;  2NYZ D;  2JP1 A;  4X3K A;  2KOL A;  1U4L A;  2MGS A;  4QUC A;  5CBA E;  4DN4 M;  1VMC A;  1PDQ A;  2R3Z A;  3KUP A;  1DZ1 A;  1ESR A;  4XT3 B;  3ONA B;  2MP1 A;  1WD0 A;  4RAU C;  2K05 A;  3SVM A;  4R9W A;  2HDM A;  3IL8 A;  1PFB A;  2J7Z A;  2VXW A;  1ZXT A;  1Q3L A;  1DOL A;  1WTV A;  1G2T A;  1RHP A;  2HDL A;  3I90 A;  2FMM A;  2FHT A;  4ZK9 B;  3GV3 A;  4HCS A;  4HAE A;  2EPB A;  1EL0 A;  5COY A;  1DON A;  1B3A A;  1QE6 A;  2EE1 A;  2KUM A;  1HUN A;  1PLF A;  2L4N A;  1G91 A;  4HED A;  5EQ0 A;  1CA5 A;  2B2Y A;  1SSO A;  1BNZ A;  1O7Y A;  4NW2 A;  1EQT A;  1RTN A;  2BDN A;  2X69 A;  3HP3 A;  2L11 A;  4IUR A;  3I91 A;  3DM1 A;  5D14 A;  5EPK A;  1LV9 A;  1NR2 A;  2Q8T A;  2N88 A;  1B53 A;  1NCV A;  3DEO A;  2SDF A;  4RWS C;  1NR4 A;  2KEC A;  3P7J A;  1RJT A;  1SAP A;  2HCC A;  1XYI A;  1WTP A;  1ILP A;  1F9S A;  1ML0 D;  2B2Y C;  2MPM A;  1VMP A;  2KED A; 
#chains in the Genus database with same CATH topology
 1O7I A;  3K8A A;  4H0L C;  2WIN B;  1GKH A;  4YIJ A;  4ID6 A;  2EVB A;  5C0X J;  1NTG A;  1Y14 B;  4RGN A;  2JA8 H;  2NWG A;  1RTO A;  3D6W A;  3I8Z A;  2CVR A;  2A74 C;  3RZD H;  4V0B A;  2HIX A;  5EBD A;  4YCV A;  4QIW E;  1K8G A;  1CSP A;  5CR3 A;  2F0T A;  2CFM A;  1XNR L;  2F3I A;  4ZUJ A;  1VF7 A;  1SFO H;  2G9H D;  2CW0 C;  2VQE L;  3NSW A;  2FXQ A;  5DNF A;  3STB C;  4DV0 L;  3NTI A;  2ATW A;  3TDQ A;  5M3M G;  2Z0S A;  1CUK A;  2CKZ B;  3J7A V;  4KY5 A;  2K5N A;  3VR5 A;  1VQJ A;  2VZA A;  3BVG A;  4JVZ A;  3PUY A;  5ELD A;  1YI2 A;  4GN3 B;  1MSG A;  3OW2 A;  1J8I A;  3D4R A;  1HA5 A;  3TP8 A;  1PH2 A;  4A75 A;  1JCK B;  2DN8 A;  4FF1 A;  4A3D H;  3BS1 A;  3SEB A;  3VA5 A;  3BDL A;  4ZAI A;  4DUY L;  1Z9F A;  4DAV A;  1ZYR C;  3FEW X;  4FXD A;  1HZA A;  4V19 0;  2UUA Q;  1VMC A;  4X62 Q;  4HIK A;  2MP1 A;  1YIT A;  4IPH A;  2F0F A;  4M8A A;  5GAH C;  2J7Z A;  3NP8 A;  4JCV E;  1HNW Q;  1CZG A;  2O4X A;  1TWA H;  2QEJ C;  4DXF A;  3JAM c;  1ZYR D;  4P2C B;  3FP9 A;  5DEH A;  4HAE A;  1X56 A;  2MNA A;  3FHW A;  5C0X I;  2E5L L;  2F0H A;  2F3W A;  3S24 A;  4DUZ L;  2KHI A;  2EZV A;  5LL6 S;  3GTG B;  1UEA B;  1HQR D;  3RNU A;  1Y8N B;  1D5Z C;  3EJI A;  2EY1 A;  2XVS A;  3M7N A;  2B3G A;  1STY A;  3VYR A;  1K83 H;  2UU9 Q;  4B08 A;  2IWH A;  1LAB A;  3H6M A;  4BBR B;  3S2D H;  5CV9 A;  2PNR C;  1HH2 P;  4NB3 A;  2MFI A;  1CHQ D;  1VQE A;  3NXW A;  2H1E A;  3FPU B;  1FGB D;  2AUK A;  2A6E C;  5LHY 1;  2VB3 X;  1ICW A;  3BZD B;  3A5Z B;  4KLK A;  3AFQ A;  1A2U A;  4MTK A;  3NK9 A;  1V43 A;  1HHV A;  4DV7 L;  3CF5 A;  4MIU A;  4LJZ C;  1F9Q A;  5IT9 E;  2Z8L A;  3EN2 A;  3PUV A;  1DCZ A;  4KD3 A;  2A6E D;  1R4P B;  1EYD A;  2B2U A;  5D3D A;  3J7A 5;  1GUN A;  4JI1 L;  2DNE A;  1CM9 A;  2I07 B;  4A3L H;  1J9O A;  4JI3 L;  1IYJ B;  5IT9 L;  1HNZ Q;  1O78 A;  1JB7 A;  4K8I A;  1KDC A;  1A3U A;  5IP7 H;  3EQL C;  3OMC A;  1JQY D;  1TXY A;  4P73 A;  2GVA A;  1BKB A;  3I4N H;  4NDX A;  2G9D A;  2X6G A;  1FNW A;  4BBS G;  1EIG A;  5JAV A;  1TVX A;  3U50 C;  3DXJ C;  1OO9 B;  2FMC A;  2J0T D;  2WB1 G;  3K5N A;  4JI8 Q;  3SR1 A;  1Y8O B;  1XMO Q;  4ZQ3 A;  2DUD A;  5AJ3 Q;  2NN6 G;  2CWP A;  5FO7 B;  1KLG D;  4BWG B;  3IFT A;  3D3R A;  3ND8 A;  4JI7 L;  4JOI C;  4RFB A;  4X65 L;  1Q1B A;  3K80 C;  1UE5 A;  2N55 A;  1OTC A;  2HUG A;  3MVV A;  2BA0 A;  1U4L A;  1JWU D;  5KEE A;  5C4J H;  3QR8 A;  2IX0 A;  1PH1 A;  1T5E A;  3GQB A;  1I4H A;  4H44 C;  2CHB D;  2RDF A;  1B3A A;  1I94 Q;  1ESF A;  2JA5 G;  3I4M G;  4HED A;  1B1Z A;  3J81 E;  4DR4 L;  1CZW A;  1I6V C;  4YCW A;  1AE2 A;  5CV4 A;  1EQT A;  2X69 A;  4BA2 I;  4Y52 H;  4LFC Q;  3L7Z C;  4UP7 A;  2QA4 A;  5E3F A;  3J81 L;  1PV4 A;  2XWJ B;  3M4O H;  1Z6H A;  3TZU A;  1ASY A;  4K2L A;  5IYC H;  1LTI D;  4JI2 Q;  3VR2 A;  4CJ1 B;  5C4X H;  3TBI B;  4LFA Q;  4CDE C;  1VCI A;  4DR6 L;  5KNB A;  1I4Q A;  4HIO A;  1AZP A;  1OXV A;  1JC7 A;  3J81 i;  4IFD H;  1S5D D;  4RA8 A;  1KRT A;  5IP9 G;  2ASB A;  1NMG A;  3OWE B;  5EKK A;  5KRU A;  2KCM A;  2VQF L;  1F2L A;  1AFP A;  2NZ1 D;  4DR1 L;  1QVG A;  1YEZ A;  1TWH H;  1I50 B;  1U5K A;  2ALY B;  2B63 H;  1EOV A;  1IXR A;  4IUV A;  2JEB I;  4YWK A;  1A3T A;  1SND A;  1TT2 A;  4DR2 L;  3DM3 A;  5E4X A;  3W3A A;  4DV6 L;  2MO0 A;  1DJR D;  3RLO A;  2WAQ B;  4KTA A;  2K32 A;  1BR9 A;  4APV A;  3A8I E;  4OO1 G;  2X6L A;  2Z6K C;  1C0A A;  2BOS A;  5KNC A;  1XMQ Q;  1GD7 A;  1I50 H;  3D4W A;  2NZH A;  5C3E B;  1WTR A;  3A0J A;  1JMC A;  2YTX A;  2Q8I B;  2KHJ A;  4OEM B;  4R4O A;  1LLR D;  1JIC A;  3VYS A;  3RN2 A;  1WCM G;  2XSC A;  2MJ8 A;  1J5E L;  2F0W A;  1BCP F;  1LAC A;  1FNU A;  1SE8 A;  4HJ8 A;  3A8K E;  4MTN A;  2KA7 A;  5FLX E;  4B3T Q;  3J80 c;  1SN8 A;  4LF4 L;  5K36 H;  3TP5 A;  1ESR A;  1GM5 A;  4XQQ A;  1BDO A;  4BS9 A;  1I3Q B;  1F2Y A;  2F0U A;  4X66 Q;  2Y0S E;  5JEA H;  1M1K C;  2BH8 A;  3HOW B;  2VXW A;  3DWA A;  2F0K A;  1IBM L;  2IX1 A;  3I90 A;  2KCT A;  3TSS A;  4ZK9 B;  5FLX L;  3E9H A;  1X3F A;  3D8G A;  4C3J B;  1CKN B;  4B9X A;  2ZJQ A;  1PLF A;  2WII B;  2B8F A;  3V96 A;  1JB3 A;  2F03 A;  3GTP H;  2L11 A;  2B8G A;  4BXX G;  4WFN 3;  2R93 G;  3K0X A;  4C3H B;  4RWS C;  4LF6 Q;  2SDF A;  3TS2 A;  3BZK A;  1I3Q H;  4JI0 Q;  2XGT A;  3T1H Q;  2KED A;  1EWH A;  1ONL A;  2JA7 H;  3AQQ A;  1KL9 A;  2CQO A;  1G29 1;  5T1G A;  1X55 A;  2JQO A;  3D6C A;  2EOT A;  3RD4 A;  1EY6 A;  1JJ2 A;  1K73 C;  2JE6 I;  2R6G A;  1DOK A;  1YNN C;  2F0L A;  2EYM A;  5IE8 A;  4AQY L;  3KLS A;  3E9I A;  2WKD A;  4YHH Q;  4ALP A;  3OW7 A;  3G48 A;  4KKS A;  2XIW A;  2ZT9 C;  1I6H B;  1EYC A;  1U0L A;  3HOX B;  1EY8 A;  1YNN D;  2B39 A;  3TP7 A;  1WJJ A;  2QIL A;  2YYZ A;  3PF5 A;  3W1B A;  1CK1 A;  1QVF A;  2TSS A;  2XN9 C;  2Q2H A;  4IN3 A;  2F0M A;  3NHH A;  1IBK Q;  4XT1 B;  5HY6 A;  2DJG C;  2QW7 A;  4JI8 L;  4KJN A;  1XMO L;  2K5Q A;  2ID0 A;  2D2C C;  2B2T A;  3HOY G;  4MNO A;  3K0Y A;  1CQF A;  1TWG B;  2EQS A;  2QDL A;  4WOR A;  5I9O A;  1Y1V G;  1DYQ A;  2K5D A;  1UUP A;  4KKU A;  4G7H C;  1TQO A;  2RKS A;  1X54 A;  2FFK B;  3MZ5 A;  4AYB B;  4DV5 L;  4A3E G;  3AEV A;  4R4I A;  1X32 A;  3S2H H;  4JYA L;  1IW7 C;  2LKV A;  4NXN L;  3KUP A;  1GOZ A;  1STG A;  4R4T A;  3U9S A;  1WD0 A;  4A3F H;  2AWN A;  4O2D A;  4A3G H;  3VR6 A;  4DR7 L;  4DV1 L;  5C5L A;  2BCO A;  3NBH A;  4X6A H;  1DOL A;  3NWS A;  1EQQ A;  3T53 B;  4YY3 Q;  3H0G H;  1IW7 D;  3K57 A;  1VQO A;  1EU3 A;  1LM0 A;  1DM0 B;  2KQ3 A;  4FXG C;  4G57 A;  3ULL A;  2A1A A;  2K52 A;  5EQ0 A;  3MXP A;  1Q46 A;  1SYE A;  1CA5 A;  4A3K B;  4DV4 L;  1BNZ A;  3CC4 A;  3J81 j;  2BDN A;  2EYO A;  1D1K A;  1PA6 A;  2JSO A;  4LF9 Q;  4GKJ Q;  1STE A;  1RJT A;  2HCC A;  1E2Z A;  1YIJ A;  1Y1W B;  1SNM A;  2UUB Q;  1KDB A;  1VQG A;  2KCN A;  2B2V A;  3W5O A;  2R92 H;  2K1B A;  3PUW A;  5M5X H;  1PRT F;  3HOV B;  2Q2T A;  4PNY A;  2R7Z H;  4B3S L;  4JBK A;  1EWC A;  1FJG L;  1S5E D;  1SDF A;  1VQ4 A;  1IKL A;  1EFW A;  3M7G A;  4KN4 C;  1PH9 A;  4BY7 H;  1TS2 A;  4AH6 A;  2L5T A;  1RCV D;  2AUJ D;  4JW0 A;  2UUC Q;  4AIM A;  5C0X H;  3G6E A;  5JVG 3;  3ERQ A;  2MQH A;  2NVQ B;  3GTJ B;  3HOV H;  2IX3 A;  3HOU B;  3SK6 A;  3GTL B;  2M00 A;  1O80 A;  1JT8 A;  3J7Z C;  4A3I B;  1CHP D;  1B44 D;  1EQR A;  3Q6S A;  1EZ6 A;  4KHP Q;  3CQZ B;  2BE5 C;  1GVP A;  1D1I A;  2ZM6 L;  1EEI D;  3T16 A;  1PZI D;  3GTJ H;  1C8C A;  1T9H A;  1QJO A;  4B3R Q;  2F0I A;  4UP8 A;  2K5W A;  1D8L A;  1EYA A;  4N9T A;  2BE5 D;  5IWA L;  1TWC H;  3J7A F;  1PHJ A;  3KK7 A;  2MGS A;  4J15 A;  4DN4 M;  1L0X B;  4C3I B;  3UDI A;  4HID A;  3BDC A;  4KV6 A;  1GO3 E;  2C9O A;  1CKM A;  1I4X A;  4POF A;  2EJG C;  3MFY A;  1H9S A;  1Q3L A;  2HDL A;  3MXG A;  2OTJ A;  4DKA C;  1NNX A;  3HOZ B;  2A73 B;  4LF6 L;  2EE1 A;  1M4V A;  5M3F B;  4JV5 Q;  4NW2 A;  5C44 B;  5BN3 A;  3KJP A;  2EYJ A;  4XYO A;  4OEL B;  3P7J A;  4L5R C;  5A2Q E;  3CCS A;  1PH6 A;  1ML0 D;  4JPB W;  1RIP A;  3K7U C;  4BBR G;  1Z47 A;  5KYL A;  1FR3 A;  2CH4 W;  4L5T A;  1AP0 A;  3FKI B;  4K0K Q;  3IFD A;  1KNA A;  2HT1 A;  1HRJ A;  3I70 A;  4C1N I;  1XTC D;  4LMQ D;  3KLW A;  1LO5 D;  4OON A;  5A2Q L;  2RQX A;  1W2B A;  3H94 A;  1XTD A;  2JA8 B;  2NN6 I;  1G51 A;  3OPO A;  4MN3 A;  2H4O A;  4PQX A;  4KD4 A;  1K9M C;  3AFP A;  4C2M H;  1MBY A;  2K4K A;  1MI2 A;  3BG3 A;  2JEA I;  1IYU A;  4XYQ A;  1LT4 D;  2XRS D;  1IBK L;  3A7A B;  4A3B H;  3D31 A;  1W6J A;  5JVH 3;  4B3M L;  5BR8 L;  1PRT D;  1SFO B;  3BYT B;  1J6Q A;  1BBW A;  3I55 A;  4JBJ A;  1WI5 A;  4XTC S;  1PMR A;  5I4D A;  3LWE A;  2KVM A;  3K59 A;  4PMC A;  3DWQ A;  1E0B A;  2F0V A;  1XJV A;  1ASZ A;  2VB2 X;  3EA6 A;  2WP8 J;  4RGT A;  2DNC A;  1JWS D;  5FLM H;  4BY1 B;  3G7L A;  4DFA A;  1CI3 M;  4O1N A;  4Q0F A;  1QNU A;  1D2B A;  2IL8 A;  4KK7 A;  3NBH B;  2A19 A;  4JI5 Q;  3HG9 A;  5J3B A;  1XNQ L;  4DNR B;  5JOB A;  2K50 A;  1WTX A;  5E4W C;  4A3D B;  2F4V Q;  3K58 A;  3V05 A;  4JI6 L;  1EFI D;  1W3S A;  1PH7 A;  1Q8K A;  1MIU A;  1VQB A;  5DM7 3;  4BY1 H;  4OX9 L;  4DAP A;  5IYB H;  2K5H A;  5IT9 c;  3QJY A;  1ZXT A;  1N33 L;  1SMY C;  2RHS B;  1A0I A;  3S9W A;  3CD6 A;  4XQJ A;  1TWA B;  1QE6 A;  2JA9 A;  4KI0 A;  3HKZ E;  4ME3 A;  1TII D;  1GXD C;  3DMU A;  2UUB L;  3I2Z A;  2RCN A;  3PV0 A;  5EPK A;  1SMY D;  4UY8 C;  1PVO A;  3D0F A;  5CYU A;  1YJ9 A;  3KFU A;  5CGK A;  5I6W A;  4OO1 I;  1S5F D;  4A3C G;  2YTY A;  1HXY D;  1SMX A;  1K83 B;  3WWV A;  4PMB A;  3G71 A;  5LMU Q;  3S2D B;  1YHQ A;  4NKL A;  4FF2 A;  2I5L X;  5J39 A;  2ZXP A;  3S14 H;  4PZ6 A;  3S1R B;  1KHI A;  5C3X A;  3PO2 H;  4OHJ A;  2PW7 A;  1STH A;  5IOD A;  2E2J H;  2AHO B;  3AMU A;  2VY3 A;  1VQ6 A;  1STB A;  1K0R A;  3S15 H;  4A3J H;  5EAY A;  1E2V A;  3G6J B;  1I4P A;  4HJ9 A;  4QQB X;  2JA6 B;  3A55 A;  1B3Q A;  1VQP A;  1B9M A;  2K03 A;  4CJ0 B;  1N36 L;  2WAQ G;  4LF5 Q;  1SJH D;  3S1R H;  2E2D C;  1BF4 A;  3OMG A;  4HJA A;  1MJE A;  5J22 A;  3MA2 B;  3QG1 A;  3J81 c;  3PO3 H;  1XXG A;  1KAA A;  3I4N B;  1S5C D;  4JBM A;  1EIH A;  5C3E G;  2PMZ E;  1Z7T A;  1E3P A;  5KYI A;  3ERO A;  2B2T C;  4ULL A;  3T1Y Q;  4XIG S;  2JA6 H;  2D62 A;  2RVL A;  1UE7 A;  5JPN C;  4XXE A;  1WTQ A;  3P1H A;  4LUZ A;  1TWF B;  5CBE E;  3CCV A;  2IHF A;  4ZRZ A;  2C5C A;  1EQV A;  2PO4 A;  3I73 A;  3TRE A;  1SLJ A;  1SRU A;  1PTO H;  2R3Z A;  1PDQ A;  4Z9C B;  4HSP A;  3KDF A;  1EIY B;  3CCU A;  1PTO F;  3HOW G;  3KF8 A;  3S17 H;  2SEB D;  4DAY A;  5IYD H;  3ICE A;  4JV5 L;  3S1Q H;  2EIF A;  2FMM A;  5C4J B;  1OXS C;  3GV3 A;  5CV6 A;  3MAQ A;  4C3J G;  3GTK H;  1DD2 A;  4X64 Q;  1E1O A;  3K5O A;  5ELE A;  4FP5 D;  1TWF H;  5IGE A;  4C3H G;  4K0K L;  4PZ8 A;  5D14 A;  1UEB A;  1NR2 A;  2PCF B;  4CDC C;  3M3Y H;  1JOO A;  1N34 Q;  2YU9 H;  2MUY A;  3N6R A;  1KQS A;  3O13 A;  1VMP A;  5C4Z A;  2GA4 B;  3M4O B;  1TR5 A;  4JI4 Q;  2DY7 A;  1EY0 A;  1PYB A;  3MEH A;  4GNX A;  2IY5 B;  5C4X B;  3IRB A;  1QZG A;  1B8A A;  2F52 A;  1VQA A;  2B2V C;  1WYD A;  3KBX A;  1ROD A;  2O5J C;  2XRQ D;  1LTR D;  1SNP A;  2F0P A;  1NE3 A;  1C7Y A;  5IOC A;  4HN7 A;  1R4Q B;  2P5Z X;  2VL6 A;  1A15 A;  2E8G A;  1FL0 A;  2ZJR A;  4YCU A;  5FLX c;  3HOX G;  5FK9 C;  5I2Y A;  3T4A C;  3TME A;  1TWH B;  3Q8D A;  3PCO B;  1NAP A;  2PQA A;  3M4Y A;  2PYK A;  2JYO A;  2B63 B;  1K3B C;  1ET6 A;  4KY7 A;  4GKK Q;  3CCJ A;  4MZ9 A;  5M3M H;  2F0D A;  1SE2 A;  4L5Q A;  1GUO A;  1YNJ C;  5D65 A;  5M5W H;  2N3S A;  3MXN A;  3SK4 A;  4KHV A;  4P71 A;  3T13 A;  3R3O A;  1XX8 A;  4DR5 Q;  1SNQ A;  1X9N A;  4LNQ A;  1STN A;  2HD3 A;  1YNJ D;  4KN7 C;  1BUV T;  1BQQ T;  1EYG A;  3DHQ A;  4AYB G;  1S3O A;  3BVZ A;  3I7F A;  3VYT A;  2UXD Q;  5GAE C;  1DGS A;  4EVO A;  4K5X A;  5ELF A;  4EQ5 A;  1BCP B;  3E3X A;  3QB3 A;  5H1S E;  5GAG C;  5FO8 B;  3U4V A;  3CCM A;  2EY6 A;  2EY5 A;  4FO2 A;  1L1O A;  3OTO Q;  3CCR A;  2UXB Q;  3M4Q A;  4KKT A;  1N9W A;  4RAU C;  1N32 Q;  4E6I A;  4K8J A;  4R9W A;  3G4S A;  2V4D A;  4WRD A;  1NY4 A;  1WTV A;  4O0A A;  1VQ8 A;  4K5V A;  3ERS X;  1K8A C;  1UE6 A;  5CV5 A;  3S1M H;  3V2T A;  1NJI C;  1YNX A;  4LUO A;  2KUM A;  3FPP A;  2UUA L;  4A3K G;  4X62 L;  1KDA A;  2HHH Q;  2VNU D;  2B2Y A;  2VW9 A;  4LFB Q;  2F0J A;  4IUR A;  3HKS A;  2NVY H;  1LTS D;  3GTO B;  2Z4I A;  3GTP B;  3LGJ A;  1HNW L;  4BA1 I;  1Y1W G;  4OL7 A;  1VQC A;  4QUF A;  4A3M B;  3SHL A;  2FJ2 A;  3K7A H;  3X3N A;  2JA7 B;  3RLF A;  1TS5 A;  3KF6 A;  4DV3 Q;  4GLX A;  3E0E A;  3HOV G;  1PYS B;  5JJL A;  1IHZ A;  1TKW B;  3CHB D;  2CCZ A;  2UU9 L;  2A8V A;  3GTO H;  1EY9 A;  4CDD C;  3HEJ A;  1SYF A;  1VQ5 A;  4RKB A;  5JPM C;  4A3M H;  3BDO A;  5J1Z A;  1O7L A;  3I72 A;  1E24 A;  5IY0 A;  5EPJ A;  4DV2 Q;  1K0S A;  1RKN A;  2ZTC A;  1YHA A;  4OWW B;  3PF4 A;  1X6O A;  3H3V H;  3HOU G;  3S1N H;  4XDX A;  1VQM A;  2RSO A;  3RR5 A;  5T1I A;  3U9O A;  4A3I G;  2XWB B;  5G3L F;  1KNE A;  2NBF A;  5C3W A;  4BBS H;  2SOB A;  1OXT A;  1BVS A;  2N78 A;  2SNM A;  1HFN A;  2L9H A;  3A5U A;  3NTK A;  3OIQ A;  2H5X A;  3H91 A;  4FDB A;  4ABN A;  1HNZ L;  3KDF B;  3KF8 B;  2RA4 A;  4DAY B;  2E2I H;  4KY6 A;  1MSH A;  1HA6 A;  3C46 A;  4IOC A;  3T56 B;  3F2C A;  2RDG A;  1FVI A;  4A93 B;  1PH8 A;  2RSN A;  1QVC A;  4LF7 Q;  4LF8 Q;  1KAW A;  4ZUI A;  4C3I G;  4GZY C;  4DNI A;  5AJ3 L;  3S2H B;  4NXM Q;  2RHQ B;  1HR0 Q;  3MEF A;  2EXZ A;  1P16 A;  2LS0 1;  2K05 A;  3BZC A;  1PH4 A;  2IPK D;  2WV6 D;  2GVB A;  4C1N K;  1PFB A;  2QCP X;  4A3F B;  4FF3 A;  4A3G B;  1XPR A;  1RHP A;  3CPW A;  2F0O A;  5DLQ E;  3VYU A;  2WAC A;  3HOZ G;  2KBN A;  2PPB C;  1PYW D;  3CPF A;  1OXX K;  5M3F G;  1IL2 A;  3H0G B;  2JA5 H;  3I4M H;  4A93 H;  4CKC A;  4GNX B;  3ZJY C;  1EIF A;  3ITP A;  5C44 G;  1LT5 D;  2LFN A;  3F8T A;  1BCP C;  1HPC A;  4QIW B;  2ZTE A;  1WTP A;  2A68 C;  1F9S A;  4QB4 A;  3FKI G;  2MPM A;  2OXP A;  1I94 L;  1SNO A;  1CTM A;  2D5D A;  3J80 L;  3S16 H;  1CA6 A;  3CMA A;  2ICI A;  5CC4 A;  1BCP D;  2JA8 G;  5EBC A;  2QGQ A;  4F88 A;  4LFC L;  2R92 B;  5DAU A;  1G8Z D;  1PRT B;  3HZX A;  2A68 D;  3AU7 A;  4RGO S;  1IL8 A;  5M5X B;  4GLV B;  2VQE Q;  5HGQ A;  2R7Z B;  4DV0 Q;  4HSV A;  2RF4 A;  5IP9 H;  2F1M A;  4JI2 L;  4HTH A;  3K81 C;  4BY7 B;  1BOS A;  4LFA L;  1STA A;  1VQD A;  1MJC A;  2D9U A;  2PW5 A;  3GV6 A;  4JOI A;  3BJU A;  4R4C A;  3ULP A;  1IZ6 A;  4UPA A;  5BN4 A;  1YZ6 A;  4PV1 C;  3ER0 A;  4GLA C;  5GRO A;  5HGT A;  1HCZ A;  3NUC A;  4OO1 H;  4FVM A;  3HKZ B;  3H3V C;  1FYC A;  3PIP A;  2E76 C;  5KGU A;  4BY1 G;  4CGY B;  1WTW A;  1A62 A;  1JOQ A;  4A76 A;  5E7N A;  1BXT A;  2UXD L;  1L1O B;  2PZU A;  4K2K A;  1E1T A;  3NEN A;  4O42 A;  1D7Q A;  1ENF A;  1YBY A;  1MGS A;  4RHR A;  3UDG A;  2WAQ E;  2SNS A;  1WCM H;  3CAM A;  2OT2 A;  3MHB A;  4A3D G;  1YVC A;  4UHV A;  5DM6 3;  2K6A A;  2B2U C;  1HTP A;  1XMQ L;  1GUW A;  2G5D A;  2Q8R E;  1TWC B;  4DK6 C;  2F3V A;  3AB9 A;  2E5L Q;  4DUZ Q;  3PUX A;  1T5X D;  5KND A;  4GN4 B;  1Q82 C;  3QWN A;  1WOC A;  3D4D A;  4WJW A;  1JJC B;  1QOH A;  3MXU A;  4G7Z C;  4WJ3 M;  3OHX C;  1CSQ A;  2R61 A;  4DK1 A;  2YV5 A;  1ENC A;  4I7A A;  1NBW A;  1MD2 D;  1Q1E A;  1HTL D;  2K7V A;  2WFW A;  1SR3 A;  3KF6 B;  3TQY A;  5M5Y H;  4B3T L;  1SSO A;  4X66 L;  1RTN A;  1VDZ A;  5C6A A;  4BXX H;  2R93 H;  1XYI A;  4JBW A;  2WB1 E;  1ILP A;  2D0O A;  1HZB A;  1SYC A;  1CFM A;  1PFS A;  2K28 A;  2NB0 A;  4DV7 Q;  4TVA B;  2XTI A;  1GHK A;  2NVT H;  3NWT A;  2QEX A;  4RHS A;  4JI1 Q;  1O7Z A;  1Q7Y C;  1LYL A;  4JI0 L;  4KJO A;  1VQ9 A;  3T1H L;  4JI3 Q;  4DF7 A;  2K75 A;  4PMW A;  4GNX C;  3M4P A;  3CRL C;  2EXD A;  1H9R A;  4Y7N H;  4C2M B;  4TSS A;  2M2L A;  1A8V A;  2A69 D;  1HFG A;  2JA6 G;  4A3B B;  2RDH A;  4JC0 A;  4A3L G;  4YHH L;  3A56 A;  5IP7 G;  3URY A;  3SE0 A;  1QWY A;  5CV8 A;  4OWT B;  1V9P A;  3KOJ A;  1C48 A;  3OYY A;  1PRT C;  3I4N G;  3MC0 B;  4H7B A;  1FNV A;  2PI2 E;  1W6K A;  5ELC A;  4JI7 Q;  1L2F A;  1V8Q A;  3T51 B;  4X65 Q;  1Y1V H;  1CKO A;  1Q90 A;  1C4Q A;  2WKC A;  3MWY W;  2ZXO A;  1R9T H;  1F2M A;  1KXL A;  4A3E H;  3RZO B;  2CH4 A;  1V1Q A;  3W2D A;  3DEP A;  3QO2 A;  2B29 A;  3GTQ B;  2AQ1 B;  1SYB A;  1V1P A;  1LUZ A;  2VUM B;  1JE5 A;  3I4L A;  3PIO A;  3SXH A;  4IOA A;  3K5M A;  2F0E A;  3E6Z X;  4ZYS A;  3H15 A;  1H9K A;  1HQM C;  3VR3 A;  4R1J A;  5E1F A;  1E22 A;  5KIX A;  2JJQ A;  2LMC B;  4AYB E;  3RMH A;  4FNF A;  4RMF A;  1L1O C;  1VF5 C;  4HCS A;  4IPD A;  3RZO H;  1EL0 A;  2VS1 A;  5COY A;  1Y69 U;  5EGT A;  3KBG A;  3TS0 A;  3C2P A;  3GTQ H;  5M9O A;  2MO1 A;  2EJF C;  4IJH A;  4L63 B;  2VUM H;  4DR6 Q;  5FO9 B;  4QCL A;  2N88 A;  1B53 A;  1EZ8 A;  1XPU A;  3VA7 A;  2ZXR A;  4YY3 L;  1SE3 A;  4DPG A;  3QOJ A;  1VQH A;  2B2Y C;  4LW1 A;  4CBV A;  3Q0A A;  2LXJ A;  5IYC G;  1JOR A;  1B4O A;  3CME A;  2VQF Q;  1YJN A;  2EYF A;  5C4X G;  4DR1 Q;  5IGF A;  1MKH A;  4LF9 L;  1VQI A;  3GTM B;  4GKJ L;  3S14 B;  1SRO A;  1KRS A;  2E74 C;  2I0Q A;  4C56 C;  3JC6 6;  3HGB A;  4IFD G;  4GOP A;  1VQF A;  4CDF C;  4DR2 Q;  1ZKO A;  2CW0 D;  3STB D;  4DV6 Q;  3PO2 B;  1EY4 A;  3AYH B;  2LY7 A;  2E2J B;  2OQ0 A;  3CCE A;  4CKB A;  3KLR A;  4F87 A;  2QKI C;  2B63 G;  2L1B A;  3S15 B;  2K04 A;  3MTS A;  4A3J B;  4L5S A;  3NEM A;  1NSN S;  3N52 A;  4IZ8 A;  4N9P A;  3EBE A;  2OWO A;  3R93 A;  3GTM H;  2JXM B;  1FGU A;  4K5W A;  4OIJ A;  3LWU A;  3I3C A;  5LMN Q;  1G6P A;  2F0Q A;  5JJI A;  4IQZ A;  1ENA A;  2UUC L;  1K8O A;  1PFN A;  4RG1 A;  1I4R A;  1X3G A;  1B70 B;  2PZW A;  1J5E Q;  3PO3 B;  5IGC A;  1SEB D;  3Q22 A;  1NMF A;  4OIK A;  2IJ0 A;  3OOC A;  4L8J A;  1YJW A;  3VR4 A;  2B2W A;  1WVL A;  1JE4 A;  4LF4 Q;  2Y0S B;  2KHS A;  3PGZ A;  3L9A X;  5IIF A;  4Q5V A;  3UE1 A;  1IBM Q;  1EY5 A;  1F77 A;  4KHP L;  1IKM A;  2FIN B;  3IAY A;  5EKI A;  2V1C C;  3OSO A;  1A3V A;  2OCE A;  3R2T A;  5EKL A;  2JP1 A;  2HIV A;  3NBI A;  5FJ8 H;  4OGQ C;  3BU2 A;  1L0W A;  1AE3 A;  5K36 G;  1EU4 A;  5F2D A;  4B3R L;  5ISR A;  4UDU C;  1PTO B;  3SVM A;  3NE5 B;  4HJ5 A;  5JEA G;  3IL8 A;  2AQ3 B;  1H9J A;  4TRD A;  3S17 B;  1X65 A;  2J4X A;  1CKN A;  2FHT A;  5LL6 X;  3S1Q B;  2RBM A;  5ELO A;  1H9S B;  1F2Z A;  2EPB A;  3J7Y W;  4J8Q A;  3UE0 A;  3GTG H;  2UXC Q;  3GTK B;  1G91 A;  4KMU C;  3M9B A;  4QMG A;  1KC8 C;  1TS4 A;  3LNN A;  1HR0 W;  1LV9 A;  2Q8T A;  4P74 A;  5EJW A;  2KEC A;  4WJ4 A;  3M3Y B;  4AQY Q;  2AMC B;  4BBR H;  1U9R A;  4A3M G;  2YU9 B;  2EY2 A;  2JA7 G;  1HJP A;  2F0N A;  4ME5 A;  4P75 A;  4EX5 A;  1EOT A;  2CQA A;  3CKI B;  1WFQ A;  1KTK A;  4NMZ A;  3A54 A;  3L3O C;  2ZTD A;  3CCL A;  3C3L A;  5AFW A;  4CJ2 C;  3C1F A;  4H02 A;  2ICE C;  2PI2 A;  4XQN A;  5JJZ A;  2EJM A;  2Q2I A;  3F2U A;  1HZ9 A;  3TN2 A;  3RN5 A;  2Z6B A;  3JAM E;  1CQV A;  4DGZ A;  1X3E A;  1XWE A;  2O2L D;  1GJX A;  3E0J A;  4U67 3;  1JWM D;  4ILW A;  5D3I B;  1AZQ A;  4LK1 C;  1G2S A;  1RD9 D;  4IAL A;  5IGG A;  3P20 A;  3JAM L;  5M3M B;  1JR0 D;  1F9R A;  1D5X C;  4U68 A;  2K33 A;  3EVQ A;  4I7Z C;  2O5I C;  5K5P A;  4DV5 Q;  2HQE A;  4R8N A;  1V1P B;  3WOF A;  4G4K A;  5M5W B;  1VQK A;  3U58 A;  1D5M C;  3TP6 A;  4JYA Q;  1UWV A;  4NXN Q;  3JAM i;  2I5H A;  1WD1 A;  2EYP A;  4DR7 Q;  4DV1 Q;  4A93 G;  1SXT A;  3W1G A;  4J6H A;  1ICF B;  1M8A A;  1TS3 A;  4LWC A;  4RH6 A;  4QUC A;  5CBA E;  1PH3 A;  1DZ1 A;  3Q24 A;  4GS3 A;  4RCN A;  3PUZ A;  1PZK D;  4JI5 L;  3RUZ A;  4DV4 Q;  4A3F G;  3NQI A;  5FKA C;  4A3G G;  2DJF C;  4RKL A;  2RCF A;  4P72 A;  1LT3 D;  2F4V L;  3NTH A;  1A2T A;  3SGI A;  2A6H C;  4DR3 Q;  2C35 B;  3H0G G;  4QJF A;  3A8J E;  1QUQ A;  2IHE A;  3CXC A;  3S1M B;  3TRZ A;  2L4N A;  4K14 A;  1QZH A;  1HNX Q;  2KEN A;  4UP9 A;  1I5F A;  3GDE A;  4J1M A;  1H9M A;  4KHZ A;  2EYH A;  3PQI A;  2A6H D;  3KYH C;  2L0C A;  1SAP A;  2NVY B;  4GOP B;  4B3S Q;  4PZ7 A;  2IW3 A;  1N8R C;  4NPS A;  3WOE A;  3SK8 A;  4A3C H;  1FJG Q;  1S5B D;  1EWI A;  1PTO C;  2KEE A;  4F7X A;  1AEX A;  3K7A B;  2R92 G;  2OF1 A;  4S3S A;  4HJ7 A;  1LTL A;  1ILQ A;  3MFG A;  2I46 A;  1BBX C;  2AKW B;  2R7Z G;  5IGB A;  2OEO A;  3OWF A;  2NZO A;  1PTO D;  3EFX D;  4FXK C;  5LMU L;  1WTO A;  4BY7 G;  4TKO B;  5GAD C;  3F2D A;  1SYD A;  2PZT A;  4N8X 1;  1UNS A;  2L15 A;  2AWO A;  5C0X G;  4DAM A;  2BH2 A;  5LMN L;  3C1E A;  3ULJ A;  2NTS A;  2ZM6 Q;  2DY8 A;  3HKZ G;  1PH5 A;  1L0Y B;  3S1N B;  1U4R A;  2MHV A;  1ZEQ X;  5A35 A;  5IWA Q;  1CT1 D;  5ELB A;  4BBS B;  5C3E H;  1LTG D;  1SE4 A;  2HCI A;  4LF5 L;  2N49 A;  2WB1 B;  1KD1 C;  1FD7 D;  1DXM A;  3QIA A;  2OQK A;  4R4Q A;  1Q8I A;  3SK5 A;  4X3U A;  2K5V A;  2E2I B;  5L37 A;  1II3 A;  3CU7 A;  2OTL A;  2A5H A;  3CC7 A;  1C9O A;  3GP7 A;  3U4Z A;  3HS0 C;  4L6T B;  4EQN A;  2NYZ D;  2AQ2 B;  3KJO A;  3DUZ A;  3DLL A;  1UE1 A;  1LTA D;  2M9V A;  3TEH B;  1RL2 A;  3T1Y L;  1S40 A;  3X3M A;  2XNA C;  3HOW H;  2UXC L;  2E75 C;  4TQU S;  1IBL Q;  2HQL A;  1G2T A;  2NN6 H;  3M85 A;  4DNT B;  3NPP A;  4C3J H;  3EIV A;  3PMF A;  1DON A;  2F4I A;  2NUC A;  1A63 A;  1AH9 A;  5I9P A;  1A6X A;  2JA5 B;  3I4M B;  1E2W A;  4C3H H;  1MHW C;  3DM1 A;  1QIL A;  1TU2 B;  4IJL A;  4IFD J;  3ZYY X;  4HCE A;  4FYD A;  3F1Z A;  2GN5 A;  5I6Y A;  5IGD A;  4X64 L;  4QGU A;  1IYV A;  3I4O A;  2D0P A;  3H09 A;  4IUT A;  2TMP A;  3K6O A;  1PXU A;  4HR7 B;  1VS0 A;  3S16 B;  1NUC A;  3LX0 A;  4G7O C;  1LTT D;  1U4M A;  1U4P A;  4EQO A;  3CW2 C;  3FDT A;  4DK0 A;  4HMI A;  2K01 A;  2K14 A;  5EPL A;  1PZJ D;  1VQN A;  4B3M Q;  4ZKC B;  5BR8 Q;  1Y8P B;  1N34 L;  2L55 A;  3PIP 3;  1SYG A;  4MHE A;  1YHB A;  1JJG A;  3J80 E;  4POG A;  4K6L A;  2PQE A;  4RCO A;  2QF7 A;  5CV7 A;  1I6H H;  2R7F A;  3FRP B;  1HZC A;  3TZD A;  4JI4 L;  3HOX H;  1RF2 D;  1B50 A;  3HRZ C;  4GOP C;  3NEL A;  4A3B G;  4RGM A;  3UI2 A;  2KCC A;  2LSS A;  1OXU A;  1XNR Q;  3SDZ A;  2IT1 A;  1VQ7 A;  2PQA B;  1XPO A;  1RDP D;  1E7Z A;  1QNK A;  1SJE D;  4QY7 A;  2E2H B;  4IUP A;  5C5M A;  2BDO A;  2CWA A;  4EQP A;  1XNQ Q;  1F9P A;  1B2T A;  3UDX A;  1X3P A;  3J80 i;  3ND9 A;  1TWG H;  1PFM A;  3BYY B;  1VQL A;  5FLM G;  4JI6 Q;  4X3S A;  3RLN A;  4YWM A;  4GKK L;  3MXN B;  3E5S A;  1Q86 C;  1EUJ A;  5JEA J;  2QDB A;  1H95 A;  2JN4 A;  1BO0 A;  5HUR A;  4GN5 A;  4OX9 Q;  3L0O A;  3VDY A;  4R8I A;  5LMN W;  1GUS A;  2B2W C;  1WCM B;  2E2H H;  1N33 Q;  1EEF D;  1QUQ B;  4CKE A;  1LT6 D;  4DR5 L;  2VUM G;  1G6Z A;  4HMJ A;  3CCQ A;  4X3K A;  1K3R A;  1GHJ A;  4OXP A;  3KLS X;  4DR3 L;  3ONA B;  3QOL A;  4IFD I;  3GO5 A;  1KAB A;  2ZJP A;  3CRK C;  5IYB G;  4DUY Q;  2HDM A;  4FF4 A;  1HNX L;  3IKJ A;  5ELN A;  3R2I A;  1K8M A;  3CP0 A;  4PG3 A;  3A74 A;  1P8L A;  5JJK A;  4F8M A;  4JK1 C;  5G3L D;  4A3K H;  2UXB L;  3OTO L;  3OIP A;  1GUT A;  5TSS A;  2Z9H A;  2JK8 A;  5M5Y B;  1N32 L;  4HIM A;  2F0S A;  3P75 A;  3I91 A;  4OWX B;  1UAP A;  2R93 B;  1NR4 A;  1KIX A;  1Y1W H;  4B9W A;  4DA2 A;  1QCB D;  2R7D A;  4IUN A;  4LUV A;  2Z4H A;  1KLU D;  1B7Y B;  1I4G A;  2LXK A;  2HHH L;  4LFB L;  2EDG A;  3L2P A;  3UDF A;  4I65 A;  2NVT B;  4A4I A;  4IUU A;  3WDN A;  4ZKB B;  1Q81 C;  2F0G A;  1N36 Q;  1S72 A;  1V1O A;  4UAI A;  4EGV A;  3PO2 G;  4QF4 A;  4ZCK A;  1S4Z A;  1B9N A;  1Q12 A;  5COR A;  4DV3 L;  4H13 C;  4Y7N B;  3DWP A;  4A3J G;  3K5L A;  2NVQ H;  4IPG A;  2PMZ B;  2NVX B;  2Z6K A;  3HOU H;  4X3T A;  4JG2 A;  4NP5 A;  3B6Y A;  3GTL H;  5FOB B;  4ZLT F;  2PNH A;  3PIO 3;  4A3I H;  1QG7 A;  2A69 C;  3GD7 A;  2Q2U A;  1D6E C;  3PO3 G;  5FJ8 G;  2L12 A;  3CQZ H;  2KJX A;  1HUM A;  3I56 A;  4DV2 L;  4IO9 A;  2BA1 A;  4QL5 A;  3HOY B;  2EYL A;  5C4H A;  1TY2 A;  2YTV A;  2Z1C A;  2Y0S G;  1DOM A;  1SNC A;  4DK3 C;  2NVX H;  1Y1V B;  4IUQ A;  3BVM A;  4DU9 A;  1R9T B;  1X3Q A;  3NQT A;  1EY7 A;  4A3E B;  2ENB A;  1BBU A;  3H3V I;  5CMD A;  4C3I H;  1IBL L;  3HFZ B;  2KOL A;  1QB5 D;  1ET9 A;  2N8N A;  1AW7 A;  1SBB B;  4XT3 B;  3FMC A;  3CC2 A;  5BN5 A;  3HOY H;  3R8B A;  1K28 A;  5IYD G;  3FVQ A;  1M90 C;  4CHT B;  1TY0 A;  1LTB D;  1AN8 A;  4LF7 L;  3HOZ H;  2NTT A;  4DXG A;  4LF8 L;  2I5M X;  4M1U B;  5GQO A;  4IPC A;  5M3F H;  1HUN A;  4NXM L;  1GUG A;  3PSI A;  3F2B A;  5I2X A;  1HR0 L;  3A7L A;  3RZD B;  5C44 H;  4LAA A;  1JOK A;  1O7Y A;  4YWL A;  3HP3 A;  4K6D A;  5NUC A;  4ODG A;  1NCV A;  3DEO A;  3Q23 A;  2DGY A;  4N8F A;  4DR4 Q;  3FKI H;  2ES2 A;  1WTH A; 
#chains in the Genus database with same CATH homology
 4H0L C;  2WIN B;  4YIJ A;  4ID6 A;  2EVB A;  5C0X J;  4RGN A;  2NWG A;  1RTO A;  3D6W A;  3I8Z A;  2CVR A;  2A74 C;  4V0B A;  5EBD A;  5CR3 A;  2F0T A;  4ZUJ A;  1VF7 A;  2G9H D;  2CW0 C;  3NSW A;  5DNF A;  3NTI A;  3TDQ A;  3J7A V;  4KY5 A;  3VR5 A;  3BVG A;  3PUY A;  5ELD A;  1MSG A;  1J8I A;  3D4R A;  1HA5 A;  3TP8 A;  1JCK B;  2DN8 A;  4FF1 A;  3BS1 A;  3SEB A;  3VA5 A;  3BDL A;  4ZAI A;  4DAV A;  1ZYR C;  3FEW X;  4FXD A;  4V19 0;  1VMC A;  2MP1 A;  2F0F A;  4M8A A;  2J7Z A;  3NP8 A;  1CZG A;  2O4X A;  2QEJ C;  4DXF A;  1ZYR D;  4P2C B;  5DEH A;  4HAE A;  5C0X I;  2F0H A;  2F3W A;  2EZV A;  5LL6 S;  3GTG B;  1UEA B;  1HQR D;  1Y8N B;  1D5Z C;  3EJI A;  2EY1 A;  2XVS A;  3M7N A;  1STY A;  3VYR A;  4B08 A;  2IWH A;  1LAB A;  3H6M A;  4BBR B;  5CV9 A;  2PNR C;  1CHQ D;  3NXW A;  2H1E A;  3FPU B;  1FGB D;  2AUK A;  2A6E C;  5LHY 1;  2VB3 X;  1ICW A;  3BZD B;  1A2U A;  3NK9 A;  1V43 A;  1HHV A;  4MIU A;  4LJZ C;  1F9Q A;  5IT9 E;  2Z8L A;  5D3D A;  1DCZ A;  3PUV A;  2A6E D;  1R4P B;  1EYD A;  2B2U A;  4KD3 A;  1GUN A;  2DNE A;  1CM9 A;  2I07 B;  1J9O A;  5IT9 L;  1O78 A;  4K8I A;  1KDC A;  1A3U A;  3EQL C;  3OMC A;  1JQY D;  4NDX A;  2G9D A;  2X6G A;  1FNW A;  1EIG A;  5JAV A;  1TVX A;  3DXJ C;  1OO9 B;  2FMC A;  2J0T D;  3K5N A;  3SR1 A;  1Y8O B;  4ZQ3 A;  2NN6 G;  5FO7 B;  1KLG D;  4BWG B;  3IFT A;  3D3R A;  3ND8 A;  4RFB A;  1Q1B A;  2N55 A;  2HUG A;  3MVV A;  2BA0 A;  1U4L A;  1JWU D;  5KEE A;  2IX0 A;  1T5E A;  3GQB A;  1I4H A;  4H44 C;  2CHB D;  2RDF A;  1B3A A;  1ESF A;  4HED A;  1B1Z A;  3J81 E;  1CZW A;  1I6V C;  5CV4 A;  1EQT A;  2X69 A;  4BA2 I;  3L7Z C;  5E3F A;  3J81 L;  2XWJ B;  1Z6H A;  3TZU A;  4K2L A;  1LTI D;  3VR2 A;  4CJ1 B;  3TBI B;  1VCI A;  5KNB A;  1I4Q A;  1AZP A;  1OXV A;  1JC7 A;  4IFD H;  1S5D D;  4RA8 A;  3OWE B;  5EKK A;  5KRU A;  1F2L A;  1AFP A;  2NZ1 D;  1I50 B;  4IUV A;  2JEB I;  1A3T A;  1SND A;  1TT2 A;  5E4X A;  3W3A A;  1DJR D;  2WAQ B;  4KTA A;  2K32 A;  1BR9 A;  3A8I E;  4OO1 G;  2X6L A;  2BOS A;  5KNC A;  3D4W A;  1WTR A;  5C3E B;  2Q8I B;  1LLR D;  1JIC A;  3VYS A;  2XSC A;  2MJ8 A;  2F0W A;  1BCP F;  1LAC A;  1FNU A;  3A8K E;  2KA7 A;  5FLX E;  5K36 H;  3TP5 A;  1ESR A;  4XQQ A;  1BDO A;  4BS9 A;  1I3Q B;  1F2Y A;  2F0U A;  5JEA H;  3HOW B;  2VXW A;  3DWA A;  2F0K A;  2IX1 A;  3I90 A;  3TSS A;  4ZK9 B;  5FLX L;  3D8G A;  4C3J B;  4B9X A;  1PLF A;  2WII B;  2B8F A;  3V96 A;  1JB3 A;  2F03 A;  2L11 A;  2B8G A;  4WFN 3;  4C3H B;  4RWS C;  2SDF A;  2KED A;  1EWH A;  1ONL A;  1G29 1;  5T1G A;  3D6C A;  2EOT A;  3RD4 A;  1EY6 A;  2JE6 I;  2R6G A;  1DOK A;  1YNN C;  2F0L A;  2EYM A;  3KLS A;  2WKD A;  3OW7 A;  4KKS A;  2XIW A;  2ZT9 C;  1I6H B;  1EYC A;  3HOX B;  1EY8 A;  1YNN D;  2B39 A;  3TP7 A;  2QIL A;  2YYZ A;  1CK1 A;  2TSS A;  2XN9 C;  4IN3 A;  2F0M A;  3NHH A;  4XT1 B;  4KJN A;  2K5Q A;  2ID0 A;  2D2C C;  2B2T A;  3K0Y A;  1CQF A;  1TWG B;  4WOR A;  5I9O A;  1DYQ A;  2K5D A;  1UUP A;  4KKU A;  4G7H C;  1TQO A;  2RKS A;  2FFK B;  3MZ5 A;  4AYB B;  1X32 A;  1IW7 C;  2LKV A;  3KUP A;  1GOZ A;  1STG A;  3U9S A;  1WD0 A;  2AWN A;  3VR6 A;  5C5L A;  2BCO A;  3NBH A;  1DOL A;  3NWS A;  3T53 B;  1IW7 D;  3K57 A;  1EU3 A;  2KQ3 A;  1DM0 B;  4FXG C;  4G57 A;  5EQ0 A;  3MXP A;  1SYE A;  1CA5 A;  4A3K B;  1BNZ A;  2BDN A;  2EYO A;  1D1K A;  2JSO A;  1STE A;  1RJT A;  2HCC A;  1E2Z A;  1Y1W B;  1SNM A;  1KDB A;  2KCN A;  2B2V A;  2K1B A;  3PUW A;  1PRT F;  3HOV B;  4PNY A;  1EWC A;  1S5E D;  1SDF A;  1IKL A;  3M7G A;  4KN4 C;  1TS2 A;  2L5T A;  1RCV D;  2AUJ D;  5C0X H;  5JVG 3;  3ERQ A;  2NVQ B;  3GTJ B;  2IX3 A;  3HOU B;  3SK6 A;  3GTL B;  2M00 A;  1O80 A;  4A3I B;  1CHP D;  1B44 D;  3Q6S A;  1EZ6 A;  3CQZ B;  2BE5 C;  1D1I A;  1EEI D;  3T16 A;  1PZI D;  1C8C A;  1QJO A;  2F0I A;  2K5W A;  1EYA A;  4N9T A;  2BE5 D;  3J7A F;  3KK7 A;  2MGS A;  4DN4 M;  1L0X B;  4C3I B;  3BDC A;  4KV6 A;  2C9O A;  1I4X A;  2EJG C;  3MFY A;  1H9S A;  1Q3L A;  2HDL A;  3MXG A;  3HOZ B;  2A73 B;  2EE1 A;  1M4V A;  5M3F B;  4NW2 A;  5C44 B;  5BN3 A;  2EYJ A;  4XYO A;  3P7J A;  5A2Q E;  1ML0 D;  1Z47 A;  5KYL A;  1FR3 A;  1AP0 A;  3FKI B;  3IFD A;  1KNA A;  1HRJ A;  3I70 A;  4C1N I;  1XTC D;  4LMQ D;  1LO5 D;  5A2Q L;  2RQX A;  3H94 A;  2JA8 B;  2NN6 I;  3OPO A;  4MN3 A;  2H4O A;  4PQX A;  4KD4 A;  1MBY A;  3BG3 A;  1MI2 A;  2JEA I;  1IYU A;  4XYQ A;  1LT4 D;  2XRS D;  3A7A B;  3D31 A;  1W6J A;  5JVH 3;  1PRT D;  1SFO B;  3BYT B;  4XTC S;  1PMR A;  5I4D A;  3LWE A;  2KVM A;  3K59 A;  4PMC A;  3DWQ A;  1E0B A;  2F0V A;  2VB2 X;  3EA6 A;  2WP8 J;  4RGT A;  2DNC A;  1JWS D;  4BY1 B;  3G7L A;  4DFA A;  1CI3 M;  4O1N A;  4Q0F A;  1QNU A;  1D2B A;  2IL8 A;  4KK7 A;  3HG9 A;  4DNR B;  5JOB A;  1WTX A;  5E4W C;  4A3D B;  3K58 A;  3V05 A;  1EFI D;  5DM7 3;  4DAP A;  3QJY A;  1ZXT A;  1SMY C;  3S9W A;  4XQJ A;  1TWA B;  1QE6 A;  4KI0 A;  1TII D;  1GXD C;  3DMU A;  3PV0 A;  5EPK A;  1SMY D;  5CYU A;  5CGK A;  5I6W A;  4OO1 I;  1S5F D;  1HXY D;  1K83 B;  4PMB A;  3S2D B;  4NKL A;  4FF2 A;  5J39 A;  2ZXP A;  3S1R B;  5C3X A;  4OHJ A;  2PW7 A;  1STH A;  5IOD A;  3AMU A;  1STB A;  1E2V A;  3G6J B;  1I4P A;  2JA6 B;  3A55 A;  1B9M A;  2K03 A;  4CJ0 B;  1SJH D;  2E2D C;  1BF4 A;  3OMG A;  5J22 A;  3MA2 B;  3QG1 A;  1XXG A;  1KAA A;  3I4N B;  1S5C D;  1EIH A;  1Z7T A;  5KYI A;  3ERO A;  2B2T C;  4ULL A;  4XIG S;  2D62 A;  2RVL A;  5JPN C;  4XXE A;  1WTQ A;  3P1H A;  1TWF B;  5CBE E;  4ZRZ A;  2C5C A;  1EQV A;  2PO4 A;  3I73 A;  1PTO H;  2R3Z A;  1PDQ A;  4Z9C B;  4HSP A;  1PTO F;  3KF8 A;  2SEB D;  4DAY A;  2FMM A;  5C4J B;  1OXS C;  3GV3 A;  5CV6 A;  3MAQ A;  4C3J G;  1DD2 A;  3K5O A;  5ELE A;  4FP5 D;  5IGE A;  4C3H G;  5D14 A;  1NR2 A;  2PCF B;  1JOO A;  2MUY A;  3N6R A;  3O13 A;  1VMP A;  5C4Z A;  2GA4 B;  3M4O B;  1TR5 A;  2DY7 A;  1EY0 A;  3MEH A;  5C4X B;  2B2V C;  3KBX A;  1ROD A;  2O5J C;  2XRQ D;  1LTR D;  1SNP A;  2F0P A;  5IOC A;  4HN7 A;  1R4Q B;  1A15 A;  5FK9 C;  5I2Y A;  3T4A C;  3TME A;  1TWH B;  1NAP A;  3M4Y A;  2PYK A;  2JYO A;  2B63 B;  1ET6 A;  4KY7 A;  2F0D A;  1SE2 A;  1GUO A;  1YNJ C;  5D65 A;  3MXN A;  3SK4 A;  4KHV A;  3T13 A;  1XX8 A;  3R3O A;  1SNQ A;  1STN A;  1YNJ D;  4KN7 C;  1BUV T;  1BQQ T;  3DHQ A;  3BVZ A;  3VYT A;  4EVO A;  4K5X A;  5ELF A;  1BCP B;  3QB3 A;  5FO8 B;  2EY6 A;  2EY5 A;  4FO2 A;  4KKT A;  4RAU C;  4E6I A;  4K8J A;  4R9W A;  2V4D A;  4WRD A;  1WTV A;  4K5V A;  5CV5 A;  3V2T A;  2KUM A;  3FPP A;  1KDA A;  2VNU D;  2B2Y A;  2F0J A;  4IUR A;  1LTS D;  3GTO B;  2Z4I A;  3GTP B;  4BA1 I;  4OL7 A;  4QUF A;  4A3M B;  3SHL A;  2FJ2 A;  3X3N A;  2JA7 B;  3RLF A;  1TS5 A;  1IHZ A;  1TKW B;  3CHB D;  1EY9 A;  3HEJ A;  1SYF A;  4RKB A;  5JPM C;  3BDO A;  5J1Z A;  1O7L A;  3I72 A;  5EPJ A;  1RKN A;  4XDX A;  2RSO A;  5T1I A;  3U9O A;  2XWB B;  5G3L F;  1KNE A;  2NBF A;  5C3W A;  2SOB A;  1OXT A;  2SNM A;  1HFN A;  2L9H A;  3NTK A;  3OIQ A;  3H91 A;  4ABN A;  2RA4 A;  4KY6 A;  1MSH A;  1HA6 A;  3C46 A;  3T56 B;  2RDG A;  4A93 B;  2RSN A;  4ZUI A;  4C3I G;  4GZY C;  3S2H B;  2EXZ A;  2LS0 1;  2K05 A;  2IPK D;  2WV6 D;  4C1N K;  1PFB A;  2QCP X;  4A3F B;  4FF3 A;  4A3G B;  1RHP A;  2F0O A;  3VYU A;  2WAC A;  2PPB C;  1PYW D;  1OXX K;  3H0G B;  4CKC A;  3ITP A;  1LT5 D;  2LFN A;  1BCP C;  1HPC A;  4QIW B;  1WTP A;  2A68 C;  1F9S A;  4QB4 A;  2MPM A;  2OXP A;  1SNO A;  1CTM A;  2D5D A;  3J80 L;  1CA6 A;  2ICI A;  5CC4 A;  1BCP D;  5EBC A;  4F88 A;  2R92 B;  5DAU A;  1G8Z D;  1PRT B;  3HZX A;  2A68 D;  3AU7 A;  4RGO S;  1IL8 A;  5M5X B;  2R7Z B;  4HSV A;  2F1M A;  4HTH A;  4BY7 B;  1BOS A;  1STA A;  2D9U A;  2PW5 A;  3GV6 A;  5BN4 A;  4PV1 C;  5HGT A;  1HCZ A;  3NUC A;  4OO1 H;  4FVM A;  3HKZ B;  3H3V C;  1FYC A;  2E76 C;  5KGU A;  4CGY B;  1WTW A;  1JOQ A;  1BXT A;  4K2K A;  2PZU A;  4O42 A;  1ENF A;  1MGS A;  4RHR A;  2SNS A;  3MHB A;  2OT2 A;  5DM6 3;  2K6A A;  2B2U C;  1HTP A;  1GUW A;  2Q8R E;  1TWC B;  2F3V A;  3AB9 A;  3PUX A;  1T5X D;  5KND A;  3QWN A;  4WJW A;  3D4D A;  1QOH A;  3MXU A;  4G7Z C;  3OHX C;  2R61 A;  4DK1 A;  1ENC A;  1MD2 D;  1Q1E A;  1HTL D;  2K7V A;  1SSO A;  5C6A A;  1RTN A;  1VDZ A;  1XYI A;  4JBW A;  1ILP A;  1SYC A;  1CFM A;  2K28 A;  2NB0 A;  1GHK A;  3NWT A;  4RHS A;  1O7Z A;  4KJO A;  4DF7 A;  4PMW A;  3CRL C;  1H9R A;  4C2M B;  4TSS A;  2M2L A;  2A69 D;  1HFG A;  4A3B B;  2RDH A;  3A56 A;  3URY A;  3SE0 A;  1QWY A;  5CV8 A;  1C48 A;  1PRT C;  3MC0 B;  4H7B A;  1FNV A;  1W6K A;  5ELC A;  1V8Q A;  3T51 B;  1Q90 A;  1C4Q A;  2WKC A;  3MWY W;  2ZXO A;  1F2M A;  3RZO B;  3W2D A;  3DEP A;  3QO2 A;  3GTQ B;  2AQ1 B;  1SYB A;  1V1P A;  2VUM B;  3I4L A;  3SXH A;  3K5M A;  2F0E A;  3E6Z X;  4ZYS A;  1H9K A;  1HQM C;  3VR3 A;  5E1F A;  5KIX A;  2LMC B;  3RMH A;  4FNF A;  1VF5 C;  4HCS A;  1EL0 A;  5COY A;  1Y69 U;  5EGT A;  3KBG A;  3C2P A;  5M9O A;  2EJF C;  4L63 B;  5FO9 B;  4QCL A;  2N88 A;  1B53 A;  1EZ8 A;  3VA7 A;  2ZXR A;  1SE3 A;  3QOJ A;  2B2Y C;  4CBV A;  3Q0A A;  1JOR A;  1B4O A;  2EYF A;  5IGF A;  3GTM B;  3S14 B;  2E74 C;  4C56 C;  3HGB A;  4IFD G;  1ZKO A;  2CW0 D;  3PO2 B;  1EY4 A;  2LY7 A;  2E2J B;  4CKB A;  3KLR A;  4F87 A;  2QKI C;  2L1B A;  3S15 B;  2K04 A;  3MTS A;  4A3J B;  1NSN S;  3N52 A;  4IZ8 A;  4N9P A;  3R93 A;  2JXM B;  4K5W A;  4OIJ A;  3LWU A;  3I3C A;  2F0Q A;  4IQZ A;  1ENA A;  1K8O A;  1PFN A;  1I4R A;  2PZW A;  3PO3 B;  5IGC A;  1SEB D;  3Q22 A;  4OIK A;  2IJ0 A;  3OOC A;  4L8J A;  3VR4 A;  2B2W A;  1WVL A;  1JE4 A;  2Y0S B;  2KHS A;  3L9A X;  5IIF A;  4Q5V A;  1EY5 A;  1F77 A;  1IKM A;  2FIN B;  3IAY A;  5EKI A;  3OSO A;  1A3V A;  3R2T A;  5EKL A;  2JP1 A;  3NBI A;  4OGQ C;  5K36 G;  1EU4 A;  5F2D A;  5ISR A;  4UDU C;  1PTO B;  3SVM A;  3NE5 B;  5JEA G;  3IL8 A;  2AQ3 B;  1H9J A;  4TRD A;  3S17 B;  2J4X A;  2FHT A;  5LL6 X;  3S1Q B;  2RBM A;  1H9S B;  1F2Z A;  2EPB A;  3J7Y W;  4J8Q A;  3GTK B;  1G91 A;  4KMU C;  4QMG A;  1TS4 A;  3LNN A;  1LV9 A;  2Q8T A;  5EJW A;  2KEC A;  3M3Y B;  1U9R A;  2YU9 B;  2EY2 A;  2F0N A;  4ME5 A;  1EOT A;  2CQA A;  3CKI B;  1KTK A;  4NMZ A;  3A54 A;  3L3O C;  3C3L A;  5AFW A;  4CJ2 C;  3C1F A;  2ICE C;  4XQN A;  5JJZ A;  2EJM A;  3F2U A;  3TN2 A;  3JAM E;  1CQV A;  4DGZ A;  1XWE A;  2O2L D;  1GJX A;  3E0J A;  4U67 3;  1JWM D;  4ILW A;  5D3I B;  1AZQ A;  4LK1 C;  1G2S A;  1RD9 D;  4IAL A;  5IGG A;  3P20 A;  3JAM L;  5M3M B;  1JR0 D;  1F9R A;  1D5X C;  4U68 A;  2K33 A;  3EVQ A;  4I7Z C;  2O5I C;  5K5P A;  2HQE A;  4R8N A;  1V1P B;  3WOF A;  4G4K A;  5M5W B;  1D5M C;  3TP6 A;  1WD1 A;  2EYP A;  1SXT A;  4J6H A;  1M8A A;  1TS3 A;  4RH6 A;  4QUC A;  5CBA E;  1DZ1 A;  3Q24 A;  4RCN A;  3PUZ A;  1PZK D;  3RUZ A;  3NQI A;  5FKA C;  4RKL A;  1LT3 D;  3NTH A;  1A2T A;  2A6H C;  3A8J E;  3S1M B;  2L4N A;  4K14 A;  4J1M A;  1H9M A;  4KHZ A;  2EYH A;  2A6H D;  2L0C A;  1SAP A;  2NVY B;  2IW3 A;  3WOE A;  3SK8 A;  1S5B D;  1PTO C;  2KEE A;  4F7X A;  1AEX A;  3K7A B;  2OF1 A;  4S3S A;  1ILQ A;  3MFG A;  2I46 A;  1BBX C;  5IGB A;  2OEO A;  3OWF A;  1PTO D;  3EFX D;  4FXK C;  1WTO A;  4TKO B;  1SYD A;  2PZT A;  1UNS A;  2AWO A;  5C0X G;  3C1E A;  2NTS A;  2DY8 A;  1L0Y B;  3S1N B;  1U4R A;  2MHV A;  1ZEQ X;  5A35 A;  1CT1 D;  5ELB A;  4BBS B;  1LTG D;  1SE4 A;  2HCI A;  2WB1 B;  1FD7 D;  1DXM A;  3QIA A;  1Q8I A;  3SK5 A;  4X3U A;  2E2I B;  1II3 A;  3CU7 A;  2A5H A;  3GP7 A;  3HS0 C;  4L6T B;  4EQN A;  2NYZ D;  2AQ2 B;  3DUZ A;  2M9V A;  1LTA D;  3X3M A;  2XNA C;  2E75 C;  4TQU S;  1G2T A;  2NN6 H;  3M85 A;  4DNT B;  3NPP A;  3PMF A;  1DON A;  2F4I A;  2NUC A;  5I9P A;  1A6X A;  2JA5 B;  3I4M B;  1E2W A;  3DM1 A;  1QIL A;  1TU2 B;  4IFD J;  3ZYY X;  4HCE A;  4FYD A;  5I6Y A;  5IGD A;  1IYV A;  3H09 A;  4IUT A;  2TMP A;  3K6O A;  1PXU A;  4HR7 B;  3S16 B;  1NUC A;  3LX0 A;  4G7O C;  1LTT D;  1U4M A;  1U4P A;  4EQO A;  3FDT A;  4DK0 A;  4HMI A;  2K01 A;  5EPL A;  1PZJ D;  4ZKC B;  1Y8P B;  2L55 A;  3PIP 3;  1SYG A;  4MHE A;  3J80 E;  4K6L A;  2PQE A;  4RCO A;  2QF7 A;  5CV7 A;  3FRP B;  3TZD A;  1RF2 D;  1B50 A;  3HRZ C;  4RGM A;  3UI2 A;  2KCC A;  1OXU A;  3SDZ A;  2IT1 A;  1RDP D;  1QNK A;  1SJE D;  2E2H B;  4IUP A;  5C5M A;  2BDO A;  4EQP A;  1F9P A;  1B2T A;  1X3P A;  3ND9 A;  1PFM A;  3BYY B;  4X3S A;  3E5S A;  5JEA J;  2QDB A;  5HUR A;  1BO0 A;  4R8I A;  1GUS A;  2B2W C;  1WCM B;  1EEF D;  4CKE A;  1LT6 D;  1G6Z A;  4HMJ A;  4X3K A;  1GHJ A;  3KLS X;  3ONA B;  3QOL A;  4IFD I;  3GO5 A;  1KAB A;  3CRK C;  2HDM A;  4FF4 A;  3IKJ A;  3R2I A;  1K8M A;  4F8M A;  4JK1 C;  5G3L D;  3OIP A;  1GUT A;  5TSS A;  5M5Y B;  2F0S A;  3P75 A;  3I91 A;  1UAP A;  2R93 B;  1NR4 A;  4B9W A;  4DA2 A;  1QCB D;  4IUN A;  2Z4H A;  1KLU D;  1I4G A;  2EDG A;  4I65 A;  2NVT B;  4IUU A;  3WDN A;  4ZKB B;  2F0G A;  1V1O A;  4UAI A;  4EGV A;  4QF4 A;  1S4Z A;  1B9N A;  1Q12 A;  5COR A;  4H13 C;  4Y7N B;  3DWP A;  3K5L A;  2PMZ B;  2NVX B;  4X3T A;  4NP5 A;  5FOB B;  4ZLT F;  3PIO 3;  1QG7 A;  2A69 C;  3GD7 A;  1D6E C;  2L12 A;  2KJX A;  1HUM A;  2BA1 A;  3HOY B;  2EYL A;  5C4H A;  1TY2 A;  2Z1C A;  1DOM A;  1SNC A;  1Y1V B;  4IUQ A;  3BVM A;  4DU9 A;  1R9T B;  1X3Q A;  3NQT A;  1EY7 A;  4A3E B;  2ENB A;  5CMD A;  2KOL A;  1QB5 D;  1ET9 A;  1AW7 A;  1SBB B;  4XT3 B;  3FMC A;  5BN5 A;  3R8B A;  3FVQ A;  4CHT B;  1TY0 A;  1LTB D;  1AN8 A;  2NTT A;  4DXG A;  4M1U B;  1HUN A;  1GUG A;  5I2X A;  3A7L A;  3RZD B;  4LAA A;  1JOK A;  1O7Y A;  3HP3 A;  4K6D A;  5NUC A;  4ODG A;  1NCV A;  3DEO A;  3Q23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...