4RA8A

Structure analysis of the mip1a p8a mutant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
68
structure length
68
Chain Sequence
SLAADTATACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 3
publication title Structures of human CCL18, CCL3, and CCL4 reveal molecular determinants for quaternary structures and sensitivity to insulin-degrading enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 15
structure length 68
sequence length 68
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ra8A00
1MSHA 3IFDA 1HA6A 2JYOA 2L12A 2Q8RE 2KUMA 1A15A 2MP1A 4OIKA 4CJ2C 4IUUA 5EKIA 1BNZA 3UI2A 1G2SA 2MJ8A 2RSNA 5E4XA 4ZK9B 4QUCA 4X3SA 1ESRA 1WD0A 1MGSA 2MGSA 3I8ZA 4HAEA 4QUFA 1CA6A 1G2TA 3G7LA 1TVXA 2SDFA 1M8AA 1O7YA 2M2LA 1BO0A 1SDFA 2K28A 1F9SA 1SSOA 1U4LA 1G6ZA 1B2TA 2DY7A 5DNFA 5CMDA 4HEDA 4OIJA 3N52A 1ICWA 1XX8A 1E0BA 1O80A 2EOTA 2KVMA 1WTOA 5D14A 1RTNA 4IUQA 4X3UA 4XDXA 3R93A 3H91A 1HFNA 1QNKA 2L1BA 5AFWA 3QO2A 4CJ0B 1ZXTA 3I91A 2BDNA 4UAIA 5CORA 4ZKCB 1AP0A 1KNEA 4RAUC 1B3AA 1PDQA 5EPKA 3D6WA 3KBXA 1WTXA 2IL8A 1WTRA 5CBEE 1JE4A 1PFMA 1C8CA 1ILPA 1BF4A 1WTPA 1KNAA 4XT1B 2FFKB 1HUNA 1J9OA 2DY8A 2HCIA 1WTVA 1IKLA 3P7JA 4IUTA 3TN2A 2K03A 2FHTA 3DEPA 3FPUB 1EL0A 1U4PA 2L11A 2FMMA 3DEOA 2HDMA 5EPJA 3GV6A 1ILQA 1NR4A 2RA4A 1BBXC 2J7ZA 4R9WA 5D65A 2KECA 1QE6A 1B4OA 4ZKBB 5COYA 1PLFA 3MTSA 1ML0D 5EJWA 4DN4M 1NR2A 2HUGA 2B2YA 3I3CA 1CA5A 1RHPA 2B2YC 3F2UA 2K04A 1DZ1A 2K01A 2K05A 4U68A 2RSOA 2Q8TA 1HRJA 2X6GA 1SAPA 1CM9A 1S4ZA 2B2VA 3IL8A 1O7ZA 1F9PA 2B2VC 1MI2A 2H1EA 1QG7A 1MSGA 1RJTA 2MPMA 2X6LA 4CJ1B 1X3QA 4HCSA 1DOKA 1F9RA 1LV9A 1G91A 2VXWA 2B2TA 2HCCA 5CBAE 4IURA 2B2TC 1XYIA 1WD1A 1X3PA 2X69A 3TZDA 1RODA 3LWEA 1HUMA 4O42A 1Q3LA 2HDLA 2D9UA 1B53A 4HSVA 1AZQA 1PFBA 3SVMA 1HHVA 1DOMA 2EPBA 2B2WA 2RVLA 1B50A 2K1BA 2B2WC 2FJ2A 2B2UA 2B2UC 4XT3B 1AZPA 4X3TA 1EIHA 5T1IA 1VMCA 2N55A 3Q6SA 4IUPA 2JP1A 3KUPA 2EE1A 1JICA 2FINB 3MWYW 5EQ0A 1WTWA 2NYZD 1IL8A 4ZLTF 4X3KA 2CVRA 1F2LA 3FDTA 5EPLA 4RWSC 4MN3A 2NWGA 3ONAB 3HP3A 1EQTA 1EOTA 1NCVA 2L9HA 3GV3A 1U4RA 1X32A 5T1GA 4IUVA 4NW2A 1GUWA 4MHEA 1F9QA 2KEEA 1J8IA 1PFNA 2KEDA 1IKMA 1U4MA 4RA8A 1DONA 1HFGA 2KOLA 5E4WC 2L4NA 2R3ZA 1NAPA 3I90A 2NZ1D 1VMPA 2XIWA 4LMQD 4ZAIA 1WTQA 3DM1A 2N88A 5JJZA 1WVLA 1EIGA 1RTOA 4R8IA 1DOLA
chains in the Genus database with same CATH superfamily
4UDUC 2ZM6L 1D5ZC 3CCSA 1DXMA 4B3TQ 3KF6A 1JB3A 1MBYA 2OXPA 4NKLA 1TU2B 3J81j 3MC0B 4B3ML 3Q22A 1BCPB 1E22A 4UHVA 2MGSA 3I8ZA 4KD3A 3KDFA 5D3DA 3X3MA 1GHKA 3A7LA 3MA2B 4TVAB 3GTLH 1WTOA 2EYJA 3PUXA 4XDXA 1PH2A 1PZID 2F0VA 4L5SA 2AWOA 3MXNA 3U9OA 4JV5L 4BWGB 4RAUC 4PZ6A 2ENBA 1FJGL 3CC7A 2GVAA 2VL6A 3PSIA 3K57A 1P16A 1G291 5C0XJ 1IZ6A 4RGOS 2NVYB 2B63B 4CBVA 5KEEA 3TZUA 1CHQD 1H9JA 2FFKB 3NTHA 3HKZB 3U9SA 4GOPC 2UU9L 1I6HB 1IYVA 1E24A 3CMEA 2PPBC 1Y1VH 1TS4A 3HOZH 2GN5A 2PW7A 3H0GH 4GN4B 1QZHA 1SYDA 4A3JH 2PQAA 3CCRA 5EPJA 4RGNA 4C3JG 1FGUA 2NUCA 3G4SA 2HD3A 1PZKD 1CZWA 2FMCA 2OQKA 4BXXH 1UNSA 1WJJA 1NR2A 3MXUA 2EY1A 3HOYB 1BBWA 4JBMA 3NHHA 3SGIA 1GXDC 1MJCA 2TSSA 1QG7A 1VF7A 2X6LA 4KY7A 3I70A 1VQHA 1I50B 4A3MH 1EY4A 5M3MG 4GKKQ 5M5WB 1X3PA 3LWEA 3S1RB 5FLMG 1TWFB 3E9HA 3JAMi 4POGA 5IGBA 1JCKB 1F2ZA 1M4VA 1S5ED 1K9MC 3A56A 1WI5A 4A93B 1VQMA 3KUPA 4A3LH 3R2IA 2EJFC 2E2IB 2AUKA 2NYZD 4QCLA 4FF2A 3K5LA 1J8IA 3DMUA 4JBKA 3C2PA 1DM0B 3E9IA 1ZYRD 3V2TA 3DEOA 4GNXA 1PRTB 5I6YA 4OIKA 2XWJB 4IUUA 1HJPA 1L0YB 4CKCA 4U673 4QL5A 2K5DA 1F2MA 1STAA 5KGUA 1YJNA 2JA5H 3S15H 1RF2D 1IBLQ 2UXBL 2WV6D 1X55A 2E2HB 1IBKQ 2EOTA 4K0KQ 4K8IA 4C3HG 4DV7L 4TKOB 2UXDQ 2IX3A 4OHJA 4LFAQ 1KNEA 2B8FA 4A3DG 1VQGA 2UUCL 3NQTA 3CCLA 4A3BB 1S72A 3T13A 2HT1A 1I5FA 5ELDA 3RD4A 5K36G 4NMZA 4LUZA 5CV5A 5JOBA 3TN2A 4IUTA 1IBMQ 3DEPA 2KJXA 1EY7A 3GTJH 2JA6H 1B9MA 5CV8A 3TREA 1HR0W 1Y8NB 1IHZA 3BVMA 3LNNA 4A75A 1CI3M 2N8NA 1LTRD 1QVFA 1EYCA 3NELA 1TWAH 3KFUA 3M7GA 1SE2A 3I3CA 4H02A 1RHPA 1HQMC 1Q46A 1Y1WB 2I5HA 4BBSG 3D4WA 4Y52H 3CHBD 4B08A 2X6GA 5GAGC 1D1KA 3CCUA 1RDPD 3ULJA 4DR5Q 1QILA 2LSSA 3V96A 1LV9A 4IN3A 1XYIA 4ABNA 1WD1A 1BQQT 4LF9L 1TIID 4HIMA 1CTMA 3S2HH 1HUMA 5IYBG 2D9UA 1JWUD 1SN8A 1PTOC 4G7ZC 1D5MC 3VR2A 1EIHA 3RZOB 1S40A 2QDBA 1CFMA 4GOPB 1LABA 2XGTA 4X3KA 5LMUL 4MN3A 2VW9A 1SXTA 1H9SA 1VQ4A 4CHTB 2JA6G 4OO1G 3HOUH 5C4XB 2JXMB 1KLUD 5G3LD 2NVXH 1HFGA 4P75A 4FXGC 3TRZA 2DJFC 4L5RC 3FVQA 1E2WA 1LT5D 2GVBA 3M4YA 2B63G 3I4NB 2MJ8A 4KKSA 5C4JH 4JOIC 1W3SA 1VQ6A 4CJ2C 1BNZA 3K5NA 4KLKA 3NEMA 2EYFA 3P1HA 1MGSA 1OXVA 1TKWB 3OYYA 2B8GA 1LTBD 1OO9B 4KKTA 1VQPA 1IYUA 4A3EB 3J81E 3EBEA 4UPAA 4LF4Q 3HOYG 3K6OA 3GQBA 1R4QB 5D14A 3OW7A 1LT4D 4DR3Q 1Q8KA 2FXQA 4RKBA 3PQIA 3AMUA 1NY4A 1B3AA 3E0EA 2F4IA 2R93H 4DV6L 3KBGA 5I6WA 5IP7H 3L2PA 3NQIA 1PYSB 1KNAA 1NTGA 4CDCC 3SXHA 4HJ8A 4A93G 2ASBA 3FKIB 3HOWB 1CKNB 2BCOA 2R61A 2UXDL 2XRSD 2FMMA 3KOJA 4K5WA 1EIFA 4BBRH 2A6EC 3DWAA 1RIPA 1MHWC 3O13A 1NR4A 1SNDA 4R9WA 1IW7D 3S1QB 5COYA 2WACA 1STEA 4QIWB 1Q81C 2K04A 4X66Q 1H9RA 3MEHA 2EYHA 2F0FA 4JK1C 2ES2A 2PQEA 5DLQE 3I56A 1Q1BA 3QG1A 3K80C 3DUZA 4FXKC 3KJPA 4YIJA 5DM63 1STYA 3KK7A 1L2FA 1BVSA 3H3VH 3A55A 2CWAA 1HTLD 4HSVA 3S24A 1HPCA 2ATWA 2ZXPA 3WWVA 5IGEA 2EDGA 4X62L 5IP7G 2PCFB 4OEMB 2PNHA 1VMCA 5M5YH 1TWCH 4ZUIA 1GD7A 1A62A 1HCZA 3M3YH 4WFN3 3PO3B 3A74A 1EY9A 4RHRA 4G57A 2EZVA 3SE0A 3CCVA 4JI6Q 4IO9A 3DXJC 1QZGA 2Z6KC 3A8JE 3TP8A 4A3BG 1VCIA 5ELBA 1S5BD 5HY6A 5KYLA 2NBFA 5IGCA 5EKIA 4FYDA 4PQXA 3VYRA 4P74A 4JI0Q 3RR5A 3MHBA 3MAQA 2AUJD 3VR5A 2JA8B 4DV2L 4NXNL 2E2JH 1SDFA 1SSOA 4LAAA 3I4MB 1N32Q 3PCOB 4UP9A 1HNXL 3R93A 4Z9CB 4NXMQ 4I7AA 1YIJA 2VB3X 3HKSA 3I4OA 1CKOA 2K5QA 2F0UA 2KHJA 4JI1L 3H3VI 1YHBA 4R4TA 2L5TA 3HKZE 1WTXA 3KBXA 1CZGA 3P20A 5CBEE 3BZKA 3F1ZA 2IX1A 2RHQB 1WOCA 3CAMA 3H09A 2HHHL 2HCIA 1KXLA 1JORA 2K03A 2QCPX 3ND8A 5C5MA 1Z9FA 4IOAA 2UXCL 5GADC 3JC66 3OIPA 4DR7Q 2DNCA 2HDMA 2LKVA 1WCMG 1SNOA 3CQZB 1STBA 5D65A 3A5UA 3NPPA 1V1PB 5JAVA 3M7NA 1SRUA 3I4NG 1SMYC 2MPMA 3ZYYX 1KHIA 4JI2L 2UUBQ 1NNXA 5LMNW 4K6DA 1I4PA 4UP7A 1RODA 3BZDB 2ICIA 3ICEA 5C0XH 2YTVA 1KL9A 3GD7A 1E3PA 1EUJA 1X3FA 4A3EG 4CDEC 4KK7A 4X3TA 4LFCQ 2YTYA 2JE6I 3H15A 2PYKA 4GN5A 1I3QB 4X6AH 5BR8L 4KY6A 2NWGA 1CSQA 3ONAB 3VDYA 4KY5A 4YWMA 1PH5A 3G71A 4DAYA 1XWEA 4DV0L 2R92H 1BCPD 1NAPA 1VQJA 1SFOB 1HQRD 3J7YW 5IWAL 3QJYA 4A3KH 1MSHA 3IFDA 4FO2A 2KUMA 3FKIG 3L3OC 1EQQA 3HOWG 1JOKA 3W2DA 1GHJA 1PH8A 1EEID 3CRKC 2E5LQ 3J80c 4QUCA 3D8GA 4LUOA 1UE1A 1A63A 2PZTA 3J80L 4C3JB 4B3MQ 2DNEA 4BY7H 1F77A 1O7YA 2HQEA 3ER0A 3MFGA 3T56B 4QQBX 1ICFB 3ITPA 1VQCA 2EYPA 3UDFA 4JBJA 3FRPB 1AP0A 1OXTA 5EPKA 3GTLB 2K33A 5C0XI 2CCZA 3ERQA 1L1OA 3HS0C 5D3IB 2LMCB 5I9PA 3S14H 3T4AC 4GLVB 1FJGQ 1J9OA 3S2DH 2WIIB 1JWSD 1LLRD 4A3FH 1YJ9A 4NXML 5IT9c 3F8TA 2UU9Q 3STBD 1LO5D 3MXNB 2CW0D 3OPOA 5IYCH 1OTCA 3TEHB 1W2BA 1Y1VB 3H0GB 2RHSB 1WTHA 4A3JB 1YITA 2QILA 4OWXB 2OCEA 4LW1A 3KJOA 3DHQA 4DR7L 5GAEC 2UUAL 1HXYD 2Z9HA 2IPKD 2PQAB 4WORA 2B2TC 2RQXA 3K7AH 3VYTA 4JC0A 4K5VA 3SK4A 2IW3A 2PI2E 2KA7A 1N34Q 2B2WA 2OF1A 2RVLA 4A3MB 3E3XA 2WB1E 2I5MX 2OTJA 1UAPA 1ENFA 2XN9C 5FLXE 5IGGA 1L0WA 3HEJA 1TS3A 1JICA 1PRTC 2I07B 3VR4A 3PIO3 1BCPF 1PRTD 2CVRA 3FDTA 4Q5VA 3TMEA 1E2ZA 1X32A 2KEEA 4V190 2V1CC 4ZYSA 2NZ1D 3L9AX 3T1YL 1CUKA 1QVGA 1VMPA 5FO7B 1S5FD 1RTOA 3PIPA 2M2LA 4HJ5A 2JYOA 2JEBI 3TP6A 1STNA 4BY1H 1U9RA 4HAEA 5EKLA 1OXUA 4DPGA 4IPCA 1B44D 2ZTEA 4ODGA 1TQOA 2EQSA 2K32A 1F9SA 5DNFA 2UXBQ 2JA5B 3S15B 5EBCA 1E0BA 1U5KA 5C3WA 1LTID 1Q1EA 1T5XD 1JB7A 2KCTA 3PO2H 1HFNA 5I2XA 1HNWL 4ME5A 1WFQA 2BA1A 3JAME 1HZAA 4EQ5A 4DAPA 1FNWA 1LUZA 4DV7Q 4LUVA 3D6WA 3ND9A 3G6EA 1VQLA 2NB0A 3RMHA 1NJIC 3W1GA 1WTPA 4J1MA 4XT1B 2UUCQ 2DY8A 1D5XC 3OW2A 3CMAA 3IFTA 4K2LA 4QIWE 1E2VA 4UP8A 2MFIA 4EQPA 2J4XA 1QE6A 1B4OA 3BDOA 4EQNA 3I55A 2I5LX 3GTJB 2JA6B 2F0IA 4DN4M 2B2YC 1DZ1A 1GOZA 5JPNC 2E76C 4CJ1B 1S5CD 2RKSA 1X3QA 3J80i 1Q7YC 3MZ5A 5DM73 3BZCA 2Z6KA 2AQ3B 1GUTA 2XRQD 3MEFA 3TZDA 5KRUA 1NUCA 1SE4A 4MIUA 1Q3LA 2HDLA 4KTAA 2EPBA 4LF9Q 1B50A 1PFSA 3HOVH 3ULLA 2K7VA 4X65L 3S2HB 2FINB 3A0JA 2JA9A 4UY8C 4KHZA 1EQTA 3KF8A 5LMUQ 2NVQH 3U58A 1N34L 1XPUA 3RUZA 4ZCKA 1XJVA 2XWBB 1SMXA 2PMZB 4TSSA 2E8GA 4C2MH 3HOUB 2NVXB 4DR2L 3URYA 1HA6A 1QUQA 1B3QA 1II3A 2JA7H 1XXGA 1YBYA 3PGZA 1K8GA 1JJ2A 4HIOA 5E4XA 4LWCA 4PZ8A 2EYOA 4ZK9B 1NE3A 4IFDJ 5C4JB 1Y1VG 5TSSA 4X64L 3HOZG 1UUPA 3H0GG 2YU9H 3SR1A 4A3JG 4WJWA 4POFA 1NMGA 3BVGA 4OWWB 3T53B 2M9VA 3HG9A 2DUDA 4M8AA 4ILWA 4A3IH 1T9HA 3A8IE 4BXXG 1AEXA 1ZEQX 3EN2A 2KQ3A 4CKEA 2IHFA 1SNMA 3F2CA 2F0MA 5F2DA 3KLSX 1D8LA 3AEVA 3R8BA 4A3MG 4B3RL 4DV6Q 2R93B 2FHTA 5J1ZA 4GZYC 1TY2A 2QEJC 2DGYA 4OWTB 1TWGH 2E2DC 3RNUA 1XPRA 3BS1A 3NXWA 4A3LG 4RMFA 2E74C 1H9MA 4IUNA 1QCBD 1R9TB 4DR6L 3F2UA 4QY7A 3PIP3 4EVOA 1Q12A 3BG3A 4BBRB 3C3LA 2B2VC 2H1EA 3A5ZB 1DD2A 3OIQA 1K73C 3OWEB 4HCSA 4DUZQ 3CP0A 3L7ZC 1B9NA 2CWPA 1MJEA 1X9NA 4QB4A 1EU4A 4IURA 2R7FA 1V9PA 2QDLA 3S1NH 5JPMC 3S17B 4KMUC 1PFBA 1X3GA 3BU2A 5M3FH 4FF4A 3S16H 3AFPA 2F0DA 4YWLA 5A2QL 2WKDA 2B3GA 3EROA 2VQEL 2NZOA 2JA5G 4AYBB 2F4VL 4X62Q 2YV5A 1A0IA 2BE5C 1X56A 4XXEA 3GO5A 3HOXH 2BE5D 2D2CC 2HIXA 1J5EL 4IUVA 3SK8A 5M5YB 1TWCB 3N6RA 4ID6A 3CC2A 1GUSA 2R3ZA 4LF7Q 4IZ8A 1XMOL 3M3YB 1ASZA 2DN8A 4KI0A 2N88A 5IYDH 4OELB 1EY8A 4H0LC 3OHXC 3EFXD 1LACA 2AQ2B 1PTOD 2BA0A 1Q82C 3OMCA 1E1TA 1K8AC 5C4HA 3IKJA 1WCMB 1A3UA 2QKIC 5HURA 5FOBB 4XTCS 5FJ8H 1LM0A 4NDXA 5CMDA 2D0OA 5M3FG 4DNTB 3TDQA 4DV2Q 4NXNQ 2G9DA 3P75A 5I4DA 1Q90A 3NE5B 2E2JB 4K5XA 3H6MA 4H44C 2VUMH 1I50H 1HNXQ 1PDQA 1Y8PB 1SNCA 1PFMA 2F0JA 1G6PA 4JI1Q 1TWFH 4B9WA 4DV1L 4NP5A 1HZCA 1YNJC 3WDNA 1BKBA 2H4OA 2LY7A 3G48A 4KJNA 4PZ7A 4XIGS 4JI8Q 2HHHQ 1JQYD 4IOCA 4EX5A 2UXCQ 1XNQQ 4OONA 1X6OA 1NMFA 4TQUS 1PMRA 2MO0A 4QF4A 2IWHA 5LHY1 1S4ZA 3NBHA 5CYUA 3HOUG 1MI2A 3LWUA 4AIMA 1PH7A 1EQRA 2I46A 3CCQA 2PNRC 5J3BA 1T5EA 1IL2A 1TXYA 5KYIA 2KHIA 5EGTA 2X69A 3FP9A 2CH4W 1VF5C 1FL0A 4JI2Q 1AZQA 4KD4A 4S3SA 1HHVA 2LS01 2AHOB 2A6ED 3EJIA 2B2UC 3UDGA 1D7QA 2K5HA 1DGSA 1SE8A 4DUZL 5C4ZA 1TT2A 2ZXOA 4Y7NH 1EOTA 4DUYL 4H7BA 1DYQA 2L0CA 2B39A 1GUWA 2F0QA 5FK9C 1IXRA 4XQNA 2Y0SB 5BR8Q 1IKMA 3GTGH 3GTMH 5DAUA 1PTOF 1QWYA 4IQZA 4FDBA 3VR3A 4DV0Q 4FVMA 4IPHA 4GS3A 1KDCA 2A6HC 3PUWA 3U4ZA 2R93G 2R92B 2A6HD 5IWAQ 1G2SA 2RDGA 2RSNA 5G3LF 3CCJA 1KABA 4YHHL 2ZJRA 1ESRA 4G4KA 1L0XB 4KHVA 4DAYB 4L8JA 2R7ZH 4LF7L 2SDFA 1EU3A 1TS5A 1A2UA 4JYAQ 3CRLC 3KYHC 4BBRG 5M9OA 4OIJA 4NB3A 1Y1WH 4LF8Q 1GUGA 4F8MA 1V1QA 1SJHD 2ID0A 4DK3C 1YJWA 5ELFA 3CXCA 1KRSA 2L1BA 1G51A 4BY7B 3C1EA 3GTPB 3E6ZX 1YNNC 1K8MA 3NUCA 2O4XA 1QVCA 3F2BA 2CKZB 3OMGA 3A8KE 1VQNA 2PI2A 2A19A 3PMFA 4GOPA 1K28A 2F0TA 2ZTCA 4J15A 2F0OA 1WTVA 1O7IA 3P7JA 4DV3L 3RZOH 4AYBG 2CHBD 3RN5A 2XVSA 1EL0A 5LL6X 1R4PB 2NN6I 1NSNS 3LX0A 4ALPA 3MVVA 4AQYQ 3S14B 3D0FA 4DV5Q 3S2DB 1O78A 4HJ7A 4A3FB 5C44H 1C4QA 1EIYB 1L1OB 1TS2A 3TP7A 1OXXK 2QGQA 1ET6A 3K7UC 3RZDH 4WJ4A 3SVMA 1F9PA 1MSGA 5IGDA 3NBIA 1JR0D 4JI8L 5C5LA 1SJED 1XNQL 2EY6A 2EXDA 1I6VC 2UUAQ 3QOJA 1VQFA 4QMGA 4N8FA 2K1BA 2JEAI 3DWPA 2DJGC 3K7AB 3QR8A 4PNYA 3Q6SA 1D1IA 4DR1L 5C3XA 1VQ7A 4JPBW 4P71A 3Q0AA 4P72A 4OXPA 1FGBD 1ZKOA 4ZLTF 3OSOA 3PV0A 2L9HA 2ZTDA 1SMYD 2F3IA 2K5NA 1K8OA 1UE5A 2L4NA 4ZRZA 1B70B 3C1FA 4DA2A 2CQOA 1CKNA 2BOSA 3W1BA 3GTOH 5JEAJ 1K0SA 4Q0FA 1PXUA 4GNXC 3BDLA 2L12A 3T1YQ 1VQAA 3FPPA 5CC4A 2VB2X 2OTLA 1HNZQ 3D3RA 4MTNA 4X3SA 1K3BC 3BDCA 2XTIA 4LFBL 3Q23A 1AN8A 3G7LA 3S1QH 4GLAC 3Q8DA 3SHLA 1A6XA 4K6LA 3VA5A 3N52A 1ICWA 1B1ZA 4BY1B 3M85A 1LT6D 5GAHC 3T1HL 1QNKA 2A5HA 2BDNA 1VQ8A 3QOLA 3IAYA 3UE0A 2IL8A 1D2BA 1HNWQ 4JBWA 3PO2B 1JE4A 1EWHA 1U0LA 4GKJL 5HGTA 1C8CA 4A3CH 4JI4L 4JYAL 3R3OA 1X65A 1X54A 4IJLA 2NTSA 4LF8L 1IKLA 1KD1C 2K50A 2MHVA 5ELEA 5J39A 5C0XG 1BR9A 2F0GA 5LL6S 4BA1I 2F1MA 2A1AA 1KDBA 3VA7A 4DV4L 1ILQA 4DR4L 3FMCA 4IFDH 2A8VA 3UDXA 2A68C 2EJMA 1SNPA 3KF6B 5KNBA 2Y0SG 3U4VA 3S9WA 5KNCA 1CA5A 1KDAA 2K01A 2K05A 1PH3A 3DWQA 2K5WA 3CPWA 1C48A 1Z7TA 1RJTA 3GTKH 3KDFB 2JK8A 4F7XA 2R92G 5BN4A 4JVZA 4AQYL 4DV5L 4EQOA 5CV4A 4A3GH 4A3KG 2F0LA 4CDDC 2IT1A 1B53A 4K14A 4AYBE 5IT9L 1CKMA 2GA4B 3Q24A 2L15A 2JJQA 3HOZB 3AU7A 3NENA 1EY0A 1PH9A 2JA8H 5EQ0A 1QB5D 5IP9H 1YEZA 1PTOH 3DLLA 2A69C 3HOVB 1A2TA 4BY7G 1FR3A 3HP3A 4LK1C 4X65Q 1F9QA 4HR7B 4KN7C 2EY2A 4DU9A 3S1MH 1U4MA 4WJ3M 1DONA 1PYBA 2RCFA 2SNSA 2AWNA 4JOIA 1UE6A 3OTOQ 2NVQB 1N36L 3TQYA 3BYTB 4HMIA 4TRDA 1V1PA 4IFDI 4DR2Q 4C2MB 2OWOA 1K83H 4B3SL 1WD0A 3KF8B 1Z6HA 1CA6A 2O5IC 1TR5A 4A3FG 1PYWD 2VS1A 2JA7B 1SROA 2NTTA 1G6ZA 4X64Q 1XTCD 3WOFA 3LGJA 5IYCG 2KVMA 3RLNA 3I7FA 2Z4HA 4MZ9A 1HR0Q 4CJ0B 2NVTH 2RDHA 1ZXTA 3I91A 2YU9B 2EY5A 1MIUA 4HIKA 3ULPA 1HNZL 1TWHH 1I94L 4DXFA 3I72A 4A3IB 2Q2IA 1H95A 1BF4A 5FKAC 2AKWB 4RGMA 4B9XA 1SYCA 3FPUB 3K58A 4B3RQ 2V4DA 2MO1A 4GNXB 5K5PA 4HIDA 1V1OA 3K81C 1V8QA 4K8JA 1LTLA 4ZKBB 3D31A 1AH9A 3CKIB 3NSWA 2WKCA 2OEOA 4HTHA 1CM9A 3IL8A 4R4OA 3H3VC 4DR6Q 4YY3L 4YCWA 3V05A 2VY3A 4C3IH 2OQ0A 3TS0A 4E6IA 4DAVA 5JVG3 5E3FA 5HGQA 4XQJA 1PV4A 3K0XA 2Z1CA 5GROA 4PG3A 5J22A 3EVQA 2F0NA 5NUCA 1DOMA 1HA5A 2SOBA 1VQOA 1Y8OB 4OX9L 4C3JH 3BVZA 3S1NB 2Q2TA 4BY1G 4XQQA 3I73A 1IL8A 2Y0SE 5EPLA 5M3FB 3S16B 5IOCA 1EY5A 2I0QA 2VQEQ 1HZ9A 1TWAB 2F0EA 5M5XH 1UEBA 2F4VQ 4JI5L 1DCZA 1XNRQ 1JOOA 2O5JC 2KOLA 2JSOA 3I90A 4FXDA 3PO2G 5M3MH 1J5EQ 3TSSA 1PH1A 3HOXB 3DM1A 5JJZA 1Q8IA 1YI2A 4J6HA 4ME3A 1JT8A 5FLMH 1PRTF 1CQFA 3M4OH 1FNVA 2Q8RE 4DF7A 1XMOQ 4HJ9A 3UI2A 2IY5B 2Z6BA 4C3IG 1M90C 5IODA 3K5OA 4RCNA 1ASYA 1I4RA 1STHA 2WAQB 3K0YA 2F3WA 1M8AA 2K28A 3AFQA 5CV7A 4JI7L 1VQEA 1B2TA 4HEDA 4YWKA 1UWVA 3CCEA 4JI3Q 3OTOL 2KCMA 3GTQH 4MNOA 2EYMA 5AFWA 3NWTA 5C3EH 3T51B 3CD6A 3PF5A 4KJOA 2ZT9C 2VQFL 2C9OA 1BBUA 2XNAC 1H9SB 2YTXA 2CH4A 1SBBB 3PF4A 1W6JA 3BYYB 4O0AA 2L55A 4C56C 2VUMB 1XTDA 4R4QA 2EXZA 1HR0L 1U4PA 3C46A 4DV1Q 4KHPL 1PH6A 4LNQA 3HOVG 3CF5A 2RA4A 4C3HH 2KECA 1ENCA 1PLFA 1D6EC 1V43A 4HMJA 1A3TA 3B6YA 4OL7A 1XMQL 4FF1A 1EWCA 4A4IA 1GUNA 2M00A 2N78A 4U68A 2HQLA 2Q8TA 4A3DH 2SNMA 3UDIA 4ZUJA 5KNDA 2KCCA 3BJUA 2Q2HA 4IALA 1I4GA 1ZYRC 5K36H 1LTAD 1JE5A 1I4QA 3ZJYC 4EGVA 3HGBA 1ONLA 5EAYA 1GVPA 5C3EG 1B7YB 2CFMA 1A3VA 2JA7G 1TY0A 1YVCA 4N9TA 2F0SA 2YYZA 5FO9B 1SYFA 3MFYA 3NBHB 3J7A5 4DNRB 4HCEA 4BBSH 4FP5D 4IPDA 2MQHA 1NCVA 3EIVA 2LXKA 2QA4A 4R1JA 4LF6Q 3T16A 4L5QA 4LF5Q 3PUYA 2K5VA 1AFPA 5E4WC 3NTKA 3PUZA 4V0BA 1C9OA 4A3IG 2N49A 4DUYQ 3D6CA 4Y7NB 1WTQA 4B3TL 3SK6A 1F2YA 3KLSA 2D5DA 1EIGA 1KQSA 2D0PA 5IYBH 4RFBA 5ELCA 5IGFA 1GM5A 3GTGB 3UE1A 2ZJQA 3GTMB 3ERSX 3H94A 4FF3A 5JVH3 3J81c 1PHJA 5IIFA 3I4MG 1XNRL 4DGZA 5ISRA 1VQKA 4QJFA 3J81L 1S5DD 2AMCB 1G2TA 2N3SA 3PUVA 4YHHQ 3SDZA 4F87A 1Q86C 3KLWA 3L0OA 4OO1H 4L5TA 3M4PA 4O1NA 4HSPA 1O80A 2R7ZB 1SNQA 1EYDA 1BXTA 2NVYH 4UAIA 2B63H 5CORA 1I6HH 5ELNA 1VQ9A 1SYEA 4KKUA 3FHWA 1LTSD 3CC4A 1O7LA 1RCVD 2EVBA 5E1FA 1L1OC 1PVOA 1GO3E 3K5MA 4JI3L 5JEAH 3GDEA 1LYLA 2LXJA 2BDOA 1VQ5A 1ENAA 3AYHB 5LMNQ 3HOYH 1MKHA 3DM3A 4OGQC 3GV6A 4K2KA 2F0WA 4DV3Q 2EJGC 5CV9A 1EFID 3QWNA 3MTSA 4ULLA 1PH4A 2LFNA 5M5WH 2ALYB 3HOXG 2WB1B 4GKKL 2P5ZX 4YCUA 3S1RH 2PZUA 2WFWA 2ZJPA 5C44B 5EBDA 1F9RA 1YZ6A 1Z47A 4NPSA 2VXWA 2B2TA 2HCCA 1EWIA 4A93H 1EOVA 3RZDB 1RL2A 3OWFA 5CGKA 5IYDG 1YNJD 5KIXA 2E2IH 2EIFA 1LTGD 1KAWA 3HKZG 4HJAA 2WAQG 4A76A 4OO1I 2R7DA 2B2WC 2IHEA 4G7OC 2Z8LA 1UEAB 2N55A 1EEFD 3D4DA 4IUPA 4RG1A 3A7AB 5A2QE 5JEAG 1AE2A 1NBWA 5T1GA 3J7ZC 4DR1Q 4CKBA 5FJ8G 1STGA 3SEBA 4NW2A 4MHEA 1CT1D 4FNFA 2O2LD 2K4KA 3G6JB 1CK1A 2TMPA 2XIWA 1MD2D 4LMQD 4APVA 2RDFA 3M9BA 3NTIA 2VNUD 3VYSA 1AW7A 2VUMG 1DOLA 3EA6A 1EYAA 4PMWA 2HIVA 2QF7A 1IBLL 2F03A 2BH2A 2E2HH 1IBKL 4LF6L 3GTOB 3SK5A 4LF5L 4I65A 4QUFA 2H5XA 4K0KL 2NN6H 4RGTA 1TVXA 4P2CB 1U4LA 1R9TH 2DY7A 4LFAL 1IW7C 4LFBQ 2Z0SA 1RTNA 4X3UA 4A3BH 3H91A 1YNXA 2EYLA 3QO2A 1KC8C 1JOQA 2Q2UA 1KAAA 2QW7A 5JJIA 3T1HQ 4BA2I 3HFZB 2ICEC 1IBML 5BN5A 3K8AA 4WRDA 1ILPA 3S17H 3AQQA 4A3KB 4RCOA 2JQOA 4GKJQ 3J7AV 1CSPA 5C6AA 2E75C 3CW2C 3RN2A 4RKLA 4JI4Q 4PMCA 1KIXA 5CV6A 1G8ZD 1FVIA 2WP8J 1CHPD 1ML0D 4DV4Q 2HUGA 4DR5L 2B2YA 2VZAA 1EFWA 4DR4Q 5GQOA 1YNND 4C1NI 2NN6G 1I4HA 3CPFA 3EQLC 3J81i 3GP7A 3E0JA 4CGYB 4IJHA 5LMNL 1JMCA 4C1NK 1J6QA 1SLJA 1K3RA 3GTKB 3CU7A 4HN7A 2J0TD 1WCMH 4QGUA 1P8LA 4XT3B 1AZPA 5T1IA 5C4XH 4GN3B 4A3GB 2EE1A 3MWYW 2D62A 2C35B 2A73B 2G9HD 1F2LA 2XSCA 4JCVE 4JG2A 4RWSC 2R7ZG 3X3NA 3I4NH 1SE3A 4F88A 2SEBD 3U50C 1Y1WG 4H13C 5H1SE 3OOCA 5JJKA 1PTOB 3PIOA 4R8IA 2OT2A 2MUYA 5AJ3Q 1KRTA 1JJCB 3HZXA 4RHSA 3RLFA 1N8RC 3S1MB 2WAQE 4A3EH 3E5SA 4LJZC 1HTPA 3I4LA 5CR3A 1H9KA 1N36Q 4LF4L 1VQDA 1VDZA 1FYCA 1BUVT 1Y14B 2K6AA 4B3SQ 2PMZE 1BO0A 1ESFA 4DR3L 5DEHA 1K83B 2WINB 2RBMA 1XX8A 2WB1G 1RKNA 4IUQA 1SYBA 5C44G 1JJGA 5C4XG 1IYJB 2KENA 4ZKCB 2F52A 2A74C 4YCVA 1PZJD 3FKIH 1AE3A 4MTKA 3HOWH 5L37A 1FNUA 4J8QA 2NVTB 1SEBD 1I94Q 1TWHB 2F0KA 4R4IA 1SYGA 3TS2A 1K0RA 5IE8A 1C0AA 3KLRA 1C7YA 1EYGA 3NP8A 1HH2P 1VQBA 2C5CA 4X66L 1M1KC 2PZWA 1LT3D 3AB9A 4GLXA 4IPGA 1HRJA 2AQ1B 3J7AF 4PMBA 2B2VA 1PA6A 4N8X1 5E7NA 1BCPC 4DAMA 1G91A 1CQVA 2KHSA 2KCNA 2F0PA 1N33Q 3HRZC 4YY3Q 4RH6A 5FLXc 3D4RA 4O42A 1I4XA 4C3IB 3A54A 2RCNA 5FLXL 2FJ2A 1A8VA 3PO3H 1QNUA 2A68D 2JP1A 2BH8A 2ZM6Q 1WTWA 4DXGA 2G5DA 2JN4A 4OX9Q 4JW0A 4JI6L 1S3OA 3WOEA 4R4CA 2F3VA 3GTPH 3F2DA 1PFNA 4RA8A 1KLGD 2K75A 3VR6A 1JC7A 2R6GA 4I7ZC 4JI5Q 5BN3A 5IY0A 5M5XB 5A35A 2B29A 3NK9A 4JI0L 2PO4A 1A15A 1BDOA 2MP1A 5M3MB 1GJXA 4A3CG 4DNIA 3I4MH 4JV5Q 1E7ZA 1BOSA 1RD9D 3M4OB 3CCMA 1N32L 2K52A 4N9PA 1YHAA 2A69D 4PV1C 3STBC 5I2YA 4G7HC 3JAMc 2CW0C 3W5OA 1LTTD 4KN4C 2NZHA 5AJ3L 5EKKA 4IFDG 3QIAA 3TP5A 1B8AA 4M1UB 3JAML 3PO3G 5I9OA 4JI7Q 3R2TA 3I2ZA 1ET9A 1GKHA 4DK6C 4R8NA 2IJ0A 1GUOA 1XPOA 1X3EA 2IX0A 3GTQB 1WTRA 2Q8IB 3MXPA 2CQAA 1KTKA 5C3EB 3K59A 5ELOA 2VQFQ 1HUNA 3CQZH 4O2DA 2F0HA 4DK1A 2MNAA 4A3GG 3M4QA 3J80E 2L11A 4AH6A 4XYOA 1JWMD 1QUQB 2J7ZA 1BBXC 2JA8G 5JJLA 1EQVA 1W6KA 1YHQA 4KHPQ 5EJWA 5IP9G 3RLOA 3IRBA 2K14A 4BS9A 2RSOA 2QEXA 3TBIB 1SAPA 2UUBL 4C3HB 1XMQQ 3QB3A 1O7ZA 1EZ6A 2RF4A 1SR3A 3NWSA 1DOKA 2Z4IA 5CBAE 4ZQ3A 1DJRD 3MXGA 1EY6A 4A3DB 1EZ8A 1QOHA 1I3QH 4LFCL 4L63B 3W3AA 2ZXRA 1E1OA 4DK0A 1N9WA 1OXSC 2B2UA 4DKAC 4CDFC 1FD7D 5IT9E 1HZBA 5FO8B 1UE7A 1TWGB 4XYQA 1Y69U 1SFOH 3GV3A 3FEWX 1U4RA 1N33L 1QJOA 1VQIA 4L6TB 1WYDA 2KBNA 2KEDA 4KV6A 3VYUA 4BBSB 1VS0A 4P73A 4DFAA 4ZAIA 1WVLA 2E5LL 2PW5A
chains in the Genus database with same CATH topology
4UDUC 1D5ZC 1DXMA 1JB3A 1MBYA 2OXPA 4NKLA 1TU2B 3MC0B 3Q22A 1BCPB 2MGSA 3I8ZA 4KD3A 5D3DA 3X3MA 1GHKA 3A7LA 3MA2B 1WTOA 2EYJA 3PUXA 4XDXA 1PZID 2F0VA 2AWOA 3MXNA 3U9OA 4BWGB 4RAUC 2ENBA 3K57A 5C0XJ 1G291 4RGOS 2NVYB 2B63B 4CBVA 5KEEA 3TZUA 1CHQD 1H9JA 2FFKB 3NTHA 3HKZB 3U9SA 1I6HB 1IYVA 2PPBC 1TS4A 2PW7A 1SYDA 5EPJA 4RGNA 4C3JG 2NUCA 1PZKD 1CZWA 2FMCA 1UNSA 1NR2A 3MXUA 2EY1A 3HOYB 3NHHA 1GXDC 2TSSA 1QG7A 1VF7A 2X6LA 4KY7A 3I70A 1I50B 1EY4A 5M5WB 1X3PA 3LWEA 3S1RB 1TWFB 5IGBA 1JCKB 1F2ZA 1M4VA 1S5ED 3A56A 4A93B 3KUPA 3R2IA 2EJFC 2E2IB 2AUKA 2NYZD 4QCLA 4FF2A 3K5LA 1J8IA 3DMUA 3C2PA 1DM0B 1ZYRD 3V2TA 3DEOA 1PRTB 5I6YA 4OIKA 2XWJB 4IUUA 1L0YB 4CKCA 4U673 2K5DA 1F2MA 1STAA 5KGUA 1RF2D 2WV6D 2E2HB 2EOTA 4K8IA 4C3HG 4TKOB 2IX3A 4OHJA 1KNEA 2B8FA 3NQTA 4A3BB 3T13A 5ELDA 3RD4A 5K36G 4NMZA 5JOBA 5CV5A 3TN2A 4IUTA 3DEPA 2KJXA 1EY7A 1B9MA 5CV8A 1Y8NB 1IHZA 3BVMA 3LNNA 1CI3M 1LTRD 1EYCA 3M7GA 1SE2A 3I3CA 1RHPA 1HQMC 1Y1WB 3D4WA 3CHBD 4B08A 2X6GA 1D1KA 1RDPD 1QILA 3V96A 1LV9A 4IN3A 1XYIA 4ABNA 1WD1A 1BQQT 1TIID 1CTMA 1HUMA 2D9UA 1JWUD 1PTOC 4G7ZC 1D5MC 3VR2A 1EIHA 3RZOB 2QDBA 1CFMA 1LABA 4X3KA 4MN3A 1SXTA 1H9SA 4CHTB 4OO1G 5C4XB 2JXMB 1KLUD 5G3LD 1HFGA 4FXGC 3FVQA 1E2WA 1LT5D 3M4YA 3I4NB 2MJ8A 4KKSA 4CJ2C 1BNZA 3K5NA 2EYFA 3P1HA 1MGSA 1OXVA 1TKWB 2B8GA 1LTBD 1OO9B 4KKTA 1IYUA 4A3EB 3J81E 3K6OA 3GQBA 1R4QB 5D14A 3OW7A 1LT4D 4RKBA 3AMUA 1B3AA 2F4IA 3KBGA 5I6WA 3NQIA 1KNAA 3SXHA 3FKIB 3HOWB 2BCOA 2R61A 2XRSD 2FMMA 4K5WA 2A6EC 3DWAA 3O13A 1NR4A 1SNDA 4R9WA 1IW7D 3S1QB 5COYA 2WACA 1STEA 4QIWB 2K04A 1H9RA 3MEHA 2EYHA 2F0FA 4JK1C 2PQEA 1Q1BA 3QG1A 4FXKC 3DUZA 4YIJA 5DM63 1STYA 3KK7A 3A55A 1HTLD 4HSVA 1HPCA 2ZXPA 5IGEA 2EDGA 2PCFB 1VMCA 4ZUIA 1HCZA 4WFN3 3PO3B 1EY9A 4RHRA 4G57A 2EZVA 3SE0A 3DXJC 3A8JE 3TP8A 1VCIA 5ELBA 1S5BD 5KYLA 2NBFA 5IGCA 5EKIA 4FYDA 4PQXA 3VYRA 3MHBA 3MAQA 2AUJD 3VR5A 2JA8B 1SDFA 1SSOA 4LAAA 3I4MB 3R93A 4Z9CB 2VB3X 2K5QA 2F0UA 2L5TA 1WTXA 3KBXA 1CZGA 3P20A 5CBEE 2IX1A 3H09A 2HCIA 1JORA 2K03A 2QCPX 3ND8A 5C5MA 3OIPA 2DNCA 2HDMA 2LKVA 1SNOA 3CQZB 1STBA 5D65A 3NPPA 1V1PB 5JAVA 3M7NA 1SMYC 2MPMA 3ZYYX 4K6DA 1I4PA 1RODA 3BZDB 2ICIA 5C0XH 3GD7A 4KK7A 4X3TA 2JE6I 2PYKA 1I3QB 4KY6A 2NWGA 3ONAB 4KY5A 4DAYA 1XWEA 1BCPD 1NAPA 1SFOB 1HQRD 3J7YW 3QJYA 1MSHA 3IFDA 4FO2A 2KUMA 3L3OC 1JOKA 3W2DA 1GHJA 1EEID 3CRKC 4QUCA 3D8GA 2PZTA 3J80L 4C3JB 2DNEA 1F77A 1O7YA 2HQEA 3MFGA 3T56B 3ITPA 2EYPA 3FRPB 1AP0A 1OXTA 5EPKA 3GTLB 2K33A 5C0XI 3ERQA 3HS0C 5D3IB 2LMCB 5I9PA 3T4AC 1J9OA 2WIIB 1JWSD 1LLRD 1LO5D 2CW0D 3OPOA 1Y1VB 3H0GB 4A3JB 2QILA 3DHQA 1HXYD 2IPKD 4WORA 2B2TC 2RQXA 3VYTA 4K5VA 3SK4A 2IW3A 2KA7A 2B2WA 2OF1A 2RVLA 4A3MB 1UAPA 1ENFA 2XN9C 5IGGA 5FLXE 3VR4A 3HEJA 1TS3A 1JICA 1PRTC 2I07B 3PIO3 1BCPF 1PRTD 2CVRA 3FDTA 4Q5VA 3TMEA 1E2ZA 1X32A 2KEEA 4V190 4ZYSA 2NZ1D 3L9AX 1VMPA 5FO7B 1S5FD 1RTOA 2M2LA 2JYOA 2JEBI 3TP6A 1STNA 1U9RA 4HAEA 5EKLA 1OXUA 1B44D 4ODGA 1TQOA 2K32A 1F9SA 5DNFA 2JA5B 3S15B 5EBCA 1E0BA 5C3WA 1LTID 1Q1EA 1T5XD 1HFNA 5I2XA 4ME5A 2BA1A 3JAME 4DAPA 1FNWA 3D6WA 3ND9A 2NB0A 3RMHA 1WTPA 4J1MA 4XT1B 2DY8A 1D5XC 3IFTA 4K2LA 1E2VA 4EQPA 2J4XA 1QE6A 1B4OA 3BDOA 4EQNA 3GTJB 2JA6B 2F0IA 4DN4M 2B2YC 1DZ1A 1GOZA 5JPNC 2E76C 4CJ1B 1S5CD 2RKSA 1X3QA 3MZ5A 5DM73 2AQ3B 1GUTA 2XRQD 3TZDA 5KRUA 1NUCA 1SE4A 4MIUA 1Q3LA 2HDLA 4KTAA 2EPBA 1B50A 2K7VA 3S2HB 2FINB 4KHZA 1EQTA 3KF8A 3RUZA 2XWBB 2PMZB 4TSSA 3HOUB 2NVXB 3URYA 1HA6A 1II3A 1XXGA 5E4XA 2EYOA 4ZK9B 4IFDJ 5C4JB 5TSSA 1UUPA 3SR1A 4WJWA 3BVGA 3T53B 2M9VA 3HG9A 4M8AA 4ILWA 3A8IE 1AEXA 1ZEQX 2KQ3A 4CKEA 1SNMA 2F0MA 5F2DA 3KLSX 3R8BA 2R93B 2FHTA 5J1ZA 4GZYC 1TY2A 2QEJC 2E2DC 3BS1A 3NXWA 2E74C 1H9MA 4IUNA 1QCBD 1R9TB 3F2UA 3PIP3 4EVOA 1Q12A 3BG3A 4BBRB 3C3LA 2B2VC 2H1EA 1DD2A 3OIQA 3OWEB 4HCSA 3L7ZC 1B9NA 4QB4A 1EU4A 4IURA 5JPMC 3S17B 4KMUC 1PFBA 4FF4A 2F0DA 5A2QL 2WKDA 3EROA 4AYBB 2BE5C 4XXEA 3GO5A 2BE5D 2D2CC 4IUVA 3SK8A 5M5YB 1TWCB 3N6RA 4ID6A 1GUSA 2R3ZA 4IZ8A 3M3YB 2DN8A 4KI0A 2N88A 1EY8A 4H0LC 3OHXC 3EFXD 1LACA 2AQ2B 1PTOD 2BA0A 3OMCA 5C4HA 3IKJA 1WCMB 1A3UA 2QKIC 5HURA 5FOBB 4XTCS 4NDXA 5CMDA 4DNTB 3TDQA 2G9DA 3P75A 5I4DA 1Q90A 3NE5B 2E2JB 4K5XA 3H6MA 4H44C 1PDQA 1Y8PB 1SNCA 1PFMA 2F0JA 4B9WA 4NP5A 1YNJC 3WDNA 2H4OA 2LY7A 4KJNA 4XIGS 1JQYD 4TQUS 1PMRA 4QF4A 2IWHA 5LHY1 1S4ZA 3NBHA 5CYUA 1MI2A 3LWUA 2I46A 2PNRC 1T5EA 5KYIA 5EGTA 2X69A 1VF5C 1AZQA 4KD4A 4S3SA 1HHVA 2LS01 2A6ED 3EJIA 2B2UC 5C4ZA 1TT2A 2ZXOA 1EOTA 4H7BA 1DYQA 2L0CA 2B39A 1GUWA 2F0QA 5FK9C 4XQNA 2Y0SB 1IKMA 5DAUA 1PTOF 1QWYA 4IQZA 3VR3A 4FVMA 1KDCA 2A6HC 3PUWA 2R92B 2A6HD 1G2SA 2RDGA 2RSNA 5G3LF 1KABA 1ESRA 4G4KA 1L0XB 4KHVA 4L8JA 2SDFA 1EU3A 1TS5A 1A2UA 3CRLC 5M9OA 4OIJA 1GUGA 4F8MA 1SJHD 2ID0A 5ELFA 2L1BA 4BY7B 3C1EA 3GTPB 3E6ZX 1YNNC 1K8MA 3NUCA 2O4XA 3OMGA 3A8KE 3PMFA 2F0TA 2F0OA 1WTVA 3P7JA 2CHBD 2XVSA 1EL0A 5LL6X 1R4PB 2NN6I 1NSNS 3LX0A 3MVVA 3S14B 3S2DB 1O78A 4A3FB 1C4QA 1TS2A 3TP7A 1OXXK 1ET6A 3SVMA 1F9PA 1MSGA 5IGDA 3NBIA 1JR0D 5C5LA 1SJED 2EY6A 1I6VC 3QOJA 4QMGA 2K1BA 2JEAI 3DWPA 3K7AB 4PNYA 3Q6SA 1D1IA 5C3XA 3Q0AA 1FGBD 1ZKOA 4ZLTF 3OSOA 3PV0A 2L9HA 1SMYD 1K8OA 2L4NA 4ZRZA 3C1FA 4DA2A 2BOSA 5JEAJ 4Q0FA 1PXUA 3BDLA 2L12A 3FPPA 5CC4A 2VB2X 3D3RA 4X3SA 3BDCA 3Q23A 1AN8A 3G7LA 1A6XA 3SHLA 4K6LA 3VA5A 3N52A 1ICWA 1B1ZA 4BY1B 3M85A 1LT6D 1QNKA 2A5HA 2BDNA 3QOLA 3IAYA 2IL8A 1D2BA 4JBWA 3PO2B 1JE4A 1EWHA 5HGTA 1C8CA 3R3OA 2NTSA 1IKLA 2MHVA 5ELEA 5J39A 5C0XG 1BR9A 2F0GA 5LL6S 4BA1I 2F1MA 1KDBA 3VA7A 1ILQA 3FMCA 4IFDH 2A68C 2EJMA 1SNPA 5KNBA 3S9WA 5KNCA 1CA5A 1KDAA 2K01A 2K05A 3DWQA 2K5WA 1C48A 1Z7TA 1RJTA 4F7XA 5BN4A 4EQOA 5CV4A 2F0LA 2IT1A 1B53A 4K14A 5IT9L 2GA4B 3Q24A 3HOZB 3AU7A 1EY0A 5EQ0A 1QB5D 1PTOH 2A69C 3HOVB 1A2TA 1FR3A 3HP3A 4LK1C 1F9QA 4HR7B 4KN7C 2EY2A 4DU9A 1U4MA 1DONA 2SNSA 2AWNA 2NVQB 3BYTB 4HMIA 4TRDA 1V1PA 4IFDI 4C2MB 1WD0A 1Z6HA 1CA6A 2O5IC 1TR5A 1PYWD 2JA7B 2NTTA 1G6ZA 1XTCD 3WOFA 2KVMA 2Z4HA 4CJ0B 2RDHA 1ZXTA 3I91A 2YU9B 2EY5A 4DXFA 3I72A 4A3IB 1BF4A 5FKAC 4RGMA 4B9XA 1SYCA 3FPUB 3K58A 2V4DA 5K5PA 1V1OA 1V8QA 4K8JA 4ZKBB 3D31A 3CKIB 3NSWA 2WKCA 2OEOA 4HTHA 1CM9A 3IL8A 3H3VC 3V05A 4E6IA 4DAVA 5JVG3 5E3FA 4XQJA 2Z1CA 5J22A 3EVQA 2F0NA 5NUCA 1DOMA 1HA5A 2SOBA 1Y8OB 3BVZA 3S1NB 4XQQA 3I73A 1IL8A 5EPLA 5M3FB 3S16B 5IOCA 1EY5A 1TWAB 2F0EA 1DCZA 1JOOA 2O5JC 2KOLA 2JSOA 3I90A 4FXDA 3TSSA 3HOXB 3DM1A 5JJZA 1Q8IA 4J6HA 1PRTF 1CQFA 1FNVA 2Q8RE 4DF7A 3UI2A 4C3IG 5IODA 3K5OA 4RCNA 1I4RA 1STHA 2WAQB 3K0YA 2F3WA 1M8AA 2K28A 5CV7A 1B2TA 4HEDA 2EYMA 5AFWA 3NWTA 3T51B 4KJOA 2ZT9C 2C9OA 2XNAC 1H9SB 1SBBB 1W6JA 3BYYB 2L55A 4C56C 2VUMB 2EXZA 1U4PA 3C46A 2RA4A 2KECA 1ENCA 1PLFA 1D6EC 1V43A 4HMJA 1A3TA 4OL7A 4FF1A 1EWCA 1GUNA 2M00A 4U68A 2Q8TA 2SNMA 4ZUJA 5KNDA 2KCCA 4IALA 1I4GA 1ZYRC 5K36H 1LTAD 1I4QA 4EGVA 3HGBA 1ONLA 1A3VA 1TY0A 4N9TA 2F0SA 2YYZA 5FO9B 1SYFA 3MFYA 4DNRB 4HCEA 4FP5D 1NCVA 3T16A 3PUYA 1AFPA 5E4WC 3NTKA 3PUZA 4V0BA 3D6CA 4Y7NB 1WTQA 3SK6A 1F2YA 3KLSA 2D5DA 1EIGA 4RFBA 5ELCA 5IGFA 3GTGB 3GTMB 3H94A 4FF3A 5JVH3 5IIFA 4DGZA 5ISRA 3J81L 1S5DD 1G2TA 3PUVA 3SDZA 4F87A 4OO1H 4O1NA 4HSPA 1O80A 2R7ZB 1SNQA 1EYDA 1BXTA 4UAIA 5CORA 1SYEA 4KKUA 1LTSD 1O7LA 1RCVD 2EVBA 5E1FA 3K5MA 5JEAH 2BDOA 1ENAA 4OGQC 3GV6A 4K2KA 2F0WA 2EJGC 5CV9A 1EFID 3QWNA 3MTSA 4ULLA 2LFNA 2WB1B 2PZUA 5C44B 5EBDA 1F9RA 1Z47A 2VXWA 2B2TA 2HCCA 3RZDB 3OWFA 5CGKA 1YNJD 5KIXA 1LTGD 4OO1I 2B2WC 4G7OC 2Z8LA 1UEAB 2N55A 1EEFD 3D4DA 4IUPA 3A7AB 5A2QE 5JEAG 5T1GA 4CKBA 1STGA 3SEBA 4NW2A 4MHEA 1CT1D 4FNFA 2O2LD 3G6JB 1CK1A 2TMPA 2XIWA 1MD2D 4LMQD 2RDFA 3NTIA 2VNUD 3VYSA 1AW7A 1DOLA 3EA6A 1EYAA 4PMWA 2QF7A 2F03A 3GTOB 3SK5A 4I65A 4QUFA 2NN6H 4RGTA 1TVXA 4P2CB 1U4LA 2DY7A 1IW7C 1RTNA 4X3UA 3H91A 2EYLA 3QO2A 1JOQA 1KAAA 4BA2I 2ICEC 5BN5A 4WRDA 1ILPA 4A3KB 4RCOA 3J7AV 5C6AA 2E75C 4RKLA 4PMCA 5CV6A 1G8ZD 2WP8J 1CHPD 1ML0D 2HUGA 2B2YA 1YNND 4C1NI 2NN6G 1I4HA 3EQLC 3GP7A 3E0JA 4CGYB 4C1NK 3GTKB 3CU7A 4HN7A 2J0TD 4XT3B 1AZPA 5T1IA 4A3GB 2EE1A 3MWYW 2D62A 2A73B 2G9HD 1F2LA 2XSCA 4RWSC 3X3NA 1SE3A 4F88A 2SEBD 4H13C 3OOCA 1PTOB 4R8IA 2OT2A 2MUYA 3S1MB 3HZXA 4RHSA 3RLFA 3E5SA 4LJZC 1HTPA 3I4LA 5CR3A 1H9KA 1VDZA 1FYCA 1BUVT 2K6AA 1BO0A 1ESFA 5DEHA 1K83B 2WINB 2RBMA 1XX8A 1RKNA 4IUQA 1SYBA 4ZKCB 2A74C 1PZJD 1FNUA 4J8QA 2NVTB 1SEBD 1TWHB 2F0KA 1SYGA 3KLRA 3NP8A 2C5CA 2PZWA 1LT3D 3AB9A 1HRJA 2AQ1B 3J7AF 4PMBA 2B2VA 1BCPC 1G91A 1CQVA 2KHSA 2KCNA 2F0PA 3HRZC 4RH6A 3D4RA 4O42A 1I4XA 4C3IB 3A54A 5FLXL 2FJ2A 1QNUA 2A68D 2JP1A 1WTWA 4DXGA 3WOEA 2F3VA 1PFNA 4RA8A 1KLGD 3VR6A 1JC7A 2R6GA 4I7ZC 5BN3A 5M5XB 5A35A 3NK9A 2PO4A 1A15A 1BDOA 2MP1A 5M3MB 1GJXA 1BOSA 1RD9D 3M4OB 4N9PA 2A69D 4PV1C 4G7HC 5I2YA 2CW0C 1LTTD 4KN4C 4IFDG 5EKKA 3QIAA 3TP5A 3JAML 4M1UB 5I9OA 3R2TA 1ET9A 4R8NA 2IJ0A 1GUOA 2IX0A 3GTQB 1WTRA 2Q8IB 3MXPA 2CQAA 1KTKA 5C3EB 3K59A 1HUNA 2F0HA 4DK1A 3J80E 2L11A 4XYOA 1JWMD 1BBXC 2J7ZA 1EQVA 1W6KA 5EJWA 4BS9A 2RSOA 3TBIB 1SAPA 4C3HB 1O7ZA 1EZ6A 3QB3A 3NWSA 1DOKA 2Z4IA 5CBAE 4ZQ3A 1DJRD 3MXGA 1EY6A 4A3DB 1EZ8A 1QOHA 4L63B 3W3AA 2ZXRA 4DK0A 1OXSC 2B2UA 1FD7D 5IT9E 5FO8B 1TWGB 4XYQA 1Y69U 3GV3A 3FEWX 1U4RA 1QJOA 4L6TB 4KV6A 2KEDA 3VYUA 4BBSB 4DFAA 4ZAIA 1WVLA 2PW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSH A;  3IFD A;  1HA6 A;  2JYO A;  2L12 A;  2Q8R E;  2KUM A;  1A15 A;  2MP1 A;  4OIK A;  4CJ2 C;  4IUU A;  5EKI A;  1BNZ A;  3UI2 A;  1G2S A;  2MJ8 A;  2RSN A;  5E4X A;  4ZK9 B;  4QUC A;  4X3S A;  1ESR A;  1WD0 A;  1MGS A;  2MGS A;  3I8Z A;  4HAE A;  4QUF A;  1CA6 A;  1G2T A;  3G7L A;  1TVX A;  2SDF A;  1M8A A;  1O7Y A;  2M2L A;  1BO0 A;  1SDF A;  2K28 A;  1F9S A;  1SSO A;  1U4L A;  1G6Z A;  1B2T A;  2DY7 A;  5DNF A;  5CMD A;  4HED A;  4OIJ A;  3N52 A;  1ICW A;  1XX8 A;  1E0B A;  1O80 A;  2EOT A;  2KVM A;  1WTO A;  5D14 A;  1RTN A;  4IUQ A;  4X3U A;  4XDX A;  3R93 A;  3H91 A;  1HFN A;  1QNK A;  2L1B A;  5AFW A;  3QO2 A;  4CJ0 B;  1ZXT A;  3I91 A;  2BDN A;  4UAI A;  5COR A;  4ZKC B;  1AP0 A;  1KNE A;  4RAU C;  1B3A A;  1PDQ A;  5EPK A;  3D6W A;  3KBX A;  1WTX A;  2IL8 A;  1WTR A;  5CBE E;  1JE4 A;  1PFM A;  1C8C A;  1ILP A;  1BF4 A;  1WTP A;  1KNA A;  4XT1 B;  2FFK B;  1HUN A;  1J9O A;  2DY8 A;  2HCI A;  1WTV A;  1IKL A;  3P7J A;  4IUT A;  3TN2 A;  2K03 A;  2FHT A;  3DEP A;  3FPU B;  1EL0 A;  1U4P A;  2L11 A;  2FMM A;  3DEO A;  2HDM A;  5EPJ A;  3GV6 A;  1ILQ A;  1NR4 A;  2RA4 A;  1BBX C;  2J7Z A;  4R9W A;  5D65 A;  2KEC A;  1QE6 A;  1B4O A;  4ZKB B;  5COY A;  1PLF A;  3MTS A;  1ML0 D;  5EJW A;  4DN4 M;  1NR2 A;  2HUG A;  2B2Y A;  3I3C A;  1CA5 A;  1RHP A;  2B2Y C;  3F2U A;  2K04 A;  1DZ1 A;  2K01 A;  2K05 A;  4U68 A;  2RSO A;  2Q8T A;  1HRJ A;  2X6G A;  1SAP A;  1CM9 A;  1S4Z A;  2B2V A;  3IL8 A;  1O7Z A;  1F9P A;  2B2V C;  1MI2 A;  2H1E A;  1QG7 A;  1MSG A;  1RJT A;  2MPM A;  2X6L A;  4CJ1 B;  1X3Q A;  4HCS A;  1DOK A;  1F9R A;  1LV9 A;  1G91 A;  2VXW A;  2B2T A;  2HCC A;  5CBA E;  4IUR A;  2B2T C;  1XYI A;  1WD1 A;  1X3P A;  2X69 A;  3TZD A;  1ROD A;  3LWE A;  1HUM A;  4O42 A;  1Q3L A;  2HDL A;  2D9U A;  1B53 A;  4HSV A;  1AZQ A;  1PFB A;  3SVM A;  1HHV A;  1DOM A;  2EPB A;  2B2W A;  2RVL A;  1B50 A;  2K1B A;  2B2W C;  2FJ2 A;  2B2U A;  2B2U C;  4XT3 B;  1AZP A;  4X3T A;  1EIH A;  5T1I A;  1VMC A;  2N55 A;  3Q6S A;  4IUP A;  2JP1 A;  3KUP A;  2EE1 A;  1JIC A;  2FIN B;  3MWY W;  5EQ0 A;  1WTW A;  2NYZ D;  1IL8 A;  4ZLT F;  4X3K A;  2CVR A;  1F2L A;  3FDT A;  5EPL A;  4RWS C;  4MN3 A;  2NWG A;  3ONA B;  3HP3 A;  1EQT A;  1EOT A;  1NCV A;  2L9H A;  3GV3 A;  1U4R A;  1X32 A;  5T1G A;  4IUV A;  4NW2 A;  1GUW A;  4MHE A;  1F9Q A;  2KEE A;  1J8I A;  1PFN A;  2KED A;  1IKM A;  1U4M A;  4RA8 A;  1DON A;  1HFG A;  2KOL A;  5E4W C;  2L4N A;  2R3Z A;  1NAP A;  3I90 A;  2NZ1 D;  1VMP A;  2XIW A;  4LMQ D;  4ZAI A;  1WTQ A;  3DM1 A;  2N88 A;  5JJZ A;  1WVL A;  1EIG A;  1RTO A;  4R8I A;  1DOL A; 
#chains in the Genus database with same CATH topology
 4UDU C;  2ZM6 L;  1D5Z C;  3CCS A;  1DXM A;  4B3T Q;  3KF6 A;  1JB3 A;  1MBY A;  2OXP A;  4NKL A;  1TU2 B;  3J81 j;  3MC0 B;  4B3M L;  3Q22 A;  1BCP B;  1E22 A;  4UHV A;  2MGS A;  3I8Z A;  4KD3 A;  3KDF A;  5D3D A;  3X3M A;  1GHK A;  3A7L A;  3MA2 B;  4TVA B;  3GTL H;  1WTO A;  2EYJ A;  3PUX A;  4XDX A;  1PH2 A;  1PZI D;  2F0V A;  4L5S A;  2AWO A;  3MXN A;  3U9O A;  4JV5 L;  4BWG B;  4RAU C;  4PZ6 A;  2ENB A;  1FJG L;  3CC7 A;  2GVA A;  2VL6 A;  3PSI A;  3K57 A;  1P16 A;  1G29 1;  5C0X J;  1IZ6 A;  4RGO S;  2NVY B;  2B63 B;  4CBV A;  5KEE A;  3TZU A;  1CHQ D;  1H9J A;  2FFK B;  3NTH A;  3HKZ B;  3U9S A;  4GOP C;  2UU9 L;  1I6H B;  1IYV A;  1E24 A;  3CME A;  2PPB C;  1Y1V H;  1TS4 A;  3HOZ H;  2GN5 A;  2PW7 A;  3H0G H;  4GN4 B;  1QZH A;  1SYD A;  4A3J H;  2PQA A;  3CCR A;  5EPJ A;  4RGN A;  4C3J G;  1FGU A;  2NUC A;  3G4S A;  2HD3 A;  1PZK D;  1CZW A;  2FMC A;  2OQK A;  4BXX H;  1UNS A;  1WJJ A;  1NR2 A;  3MXU A;  2EY1 A;  3HOY B;  1BBW A;  4JBM A;  3NHH A;  3SGI A;  1GXD C;  1MJC A;  2TSS A;  1QG7 A;  1VF7 A;  2X6L A;  4KY7 A;  3I70 A;  1VQH A;  1I50 B;  4A3M H;  1EY4 A;  5M3M G;  4GKK Q;  5M5W B;  1X3P A;  3LWE A;  3S1R B;  5FLM G;  1TWF B;  3E9H A;  3JAM i;  4POG A;  5IGB A;  1JCK B;  1F2Z A;  1M4V A;  1S5E D;  1K9M C;  3A56 A;  1WI5 A;  4A93 B;  1VQM A;  3KUP A;  4A3L H;  3R2I A;  2EJF C;  2E2I B;  2AUK A;  2NYZ D;  4QCL A;  4FF2 A;  3K5L A;  1J8I A;  3DMU A;  4JBK A;  3C2P A;  1DM0 B;  3E9I A;  1ZYR D;  3V2T A;  3DEO A;  4GNX A;  1PRT B;  5I6Y A;  4OIK A;  2XWJ B;  4IUU A;  1HJP A;  1L0Y B;  4CKC A;  4U67 3;  4QL5 A;  2K5D A;  1F2M A;  1STA A;  5KGU A;  1YJN A;  2JA5 H;  3S15 H;  1RF2 D;  1IBL Q;  2UXB L;  2WV6 D;  1X55 A;  2E2H B;  1IBK Q;  2EOT A;  4K0K Q;  4K8I A;  4C3H G;  4DV7 L;  4TKO B;  2UXD Q;  2IX3 A;  4OHJ A;  4LFA Q;  1KNE A;  2B8F A;  4A3D G;  1VQG A;  2UUC L;  3NQT A;  3CCL A;  4A3B B;  1S72 A;  3T13 A;  2HT1 A;  1I5F A;  5ELD A;  3RD4 A;  5K36 G;  4NMZ A;  4LUZ A;  5CV5 A;  5JOB A;  3TN2 A;  4IUT A;  1IBM Q;  3DEP A;  2KJX A;  1EY7 A;  3GTJ H;  2JA6 H;  1B9M A;  5CV8 A;  3TRE A;  1HR0 W;  1Y8N B;  1IHZ A;  3BVM A;  3LNN A;  4A75 A;  1CI3 M;  2N8N A;  1LTR D;  1QVF A;  1EYC A;  3NEL A;  1TWA H;  3KFU A;  3M7G A;  1SE2 A;  3I3C A;  4H02 A;  1RHP A;  1HQM C;  1Q46 A;  1Y1W B;  2I5H A;  4BBS G;  3D4W A;  4Y52 H;  3CHB D;  4B08 A;  2X6G A;  5GAG C;  1D1K A;  3CCU A;  1RDP D;  3ULJ A;  4DR5 Q;  1QIL A;  2LSS A;  3V96 A;  1LV9 A;  4IN3 A;  1XYI A;  4ABN A;  1WD1 A;  1BQQ T;  4LF9 L;  1TII D;  4HIM A;  1CTM A;  3S2H H;  1HUM A;  5IYB G;  2D9U A;  1JWU D;  1SN8 A;  1PTO C;  4G7Z C;  1D5M C;  3VR2 A;  1EIH A;  3RZO B;  1S40 A;  2QDB A;  1CFM A;  4GOP B;  1LAB A;  2XGT A;  4X3K A;  5LMU L;  4MN3 A;  2VW9 A;  1SXT A;  1H9S A;  1VQ4 A;  4CHT B;  2JA6 G;  4OO1 G;  3HOU H;  5C4X B;  2JXM B;  1KLU D;  5G3L D;  2NVX H;  1HFG A;  4P75 A;  4FXG C;  3TRZ A;  2DJF C;  4L5R C;  3FVQ A;  1E2W A;  1LT5 D;  2GVB A;  3M4Y A;  2B63 G;  3I4N B;  2MJ8 A;  4KKS A;  5C4J H;  4JOI C;  1W3S A;  1VQ6 A;  4CJ2 C;  1BNZ A;  3K5N A;  4KLK A;  3NEM A;  2EYF A;  3P1H A;  1MGS A;  1OXV A;  1TKW B;  3OYY A;  2B8G A;  1LTB D;  1OO9 B;  4KKT A;  1VQP A;  1IYU A;  4A3E B;  3J81 E;  3EBE A;  4UPA A;  4LF4 Q;  3HOY G;  3K6O A;  3GQB A;  1R4Q B;  5D14 A;  3OW7 A;  1LT4 D;  4DR3 Q;  1Q8K A;  2FXQ A;  4RKB A;  3PQI A;  3AMU A;  1NY4 A;  1B3A A;  3E0E A;  2F4I A;  2R93 H;  4DV6 L;  3KBG A;  5I6W A;  5IP7 H;  3L2P A;  3NQI A;  1PYS B;  1KNA A;  1NTG A;  4CDC C;  3SXH A;  4HJ8 A;  4A93 G;  2ASB A;  3FKI B;  3HOW B;  1CKN B;  2BCO A;  2R61 A;  2UXD L;  2XRS D;  2FMM A;  3KOJ A;  4K5W A;  1EIF A;  4BBR H;  2A6E C;  3DWA A;  1RIP A;  1MHW C;  3O13 A;  1NR4 A;  1SND A;  4R9W A;  1IW7 D;  3S1Q B;  5COY A;  2WAC A;  1STE A;  4QIW B;  1Q81 C;  2K04 A;  4X66 Q;  1H9R A;  3MEH A;  2EYH A;  2F0F A;  4JK1 C;  2ES2 A;  2PQE A;  5DLQ E;  3I56 A;  1Q1B A;  3QG1 A;  3K80 C;  3DUZ A;  4FXK C;  3KJP A;  4YIJ A;  5DM6 3;  1STY A;  3KK7 A;  1L2F A;  1BVS A;  3H3V H;  3A55 A;  2CWA A;  1HTL D;  4HSV A;  3S24 A;  1HPC A;  2ATW A;  2ZXP A;  3WWV A;  5IGE A;  2EDG A;  4X62 L;  5IP7 G;  2PCF B;  4OEM B;  2PNH A;  1VMC A;  5M5Y H;  1TWC H;  4ZUI A;  1GD7 A;  1A62 A;  1HCZ A;  3M3Y H;  4WFN 3;  3PO3 B;  3A74 A;  1EY9 A;  4RHR A;  4G57 A;  2EZV A;  3SE0 A;  3CCV A;  4JI6 Q;  4IO9 A;  3DXJ C;  1QZG A;  2Z6K C;  3A8J E;  3TP8 A;  4A3B G;  1VCI A;  5ELB A;  1S5B D;  5HY6 A;  5KYL A;  2NBF A;  5IGC A;  5EKI A;  4FYD A;  4PQX A;  3VYR A;  4P74 A;  4JI0 Q;  3RR5 A;  3MHB A;  3MAQ A;  2AUJ D;  3VR5 A;  2JA8 B;  4DV2 L;  4NXN L;  2E2J H;  1SDF A;  1SSO A;  4LAA A;  3I4M B;  1N32 Q;  3PCO B;  4UP9 A;  1HNX L;  3R93 A;  4Z9C B;  4NXM Q;  4I7A A;  1YIJ A;  2VB3 X;  3HKS A;  3I4O A;  1CKO A;  2K5Q A;  2F0U A;  2KHJ A;  4JI1 L;  3H3V I;  1YHB A;  4R4T A;  2L5T A;  3HKZ E;  1WTX A;  3KBX A;  1CZG A;  3P20 A;  5CBE E;  3BZK A;  3F1Z A;  2IX1 A;  2RHQ B;  1WOC A;  3CAM A;  3H09 A;  2HHH L;  2HCI A;  1KXL A;  1JOR A;  2K03 A;  2QCP X;  3ND8 A;  5C5M A;  1Z9F A;  4IOA A;  2UXC L;  5GAD C;  3JC6 6;  3OIP A;  4DR7 Q;  2DNC A;  2HDM A;  2LKV A;  1WCM G;  1SNO A;  3CQZ B;  1STB A;  5D65 A;  3A5U A;  3NPP A;  1V1P B;  5JAV A;  3M7N A;  1SRU A;  3I4N G;  1SMY C;  2MPM A;  3ZYY X;  1KHI A;  4JI2 L;  2UUB Q;  1NNX A;  5LMN W;  4K6D A;  1I4P A;  4UP7 A;  1ROD A;  3BZD B;  2ICI A;  3ICE A;  5C0X H;  2YTV A;  1KL9 A;  3GD7 A;  1E3P A;  1EUJ A;  1X3F A;  4A3E G;  4CDE C;  4KK7 A;  4X3T A;  4LFC Q;  2YTY A;  2JE6 I;  3H15 A;  2PYK A;  4GN5 A;  1I3Q B;  4X6A H;  5BR8 L;  4KY6 A;  2NWG A;  1CSQ A;  3ONA B;  3VDY A;  4KY5 A;  4YWM A;  1PH5 A;  3G71 A;  4DAY A;  1XWE A;  4DV0 L;  2R92 H;  1BCP D;  1NAP A;  1VQJ A;  1SFO B;  1HQR D;  3J7Y W;  5IWA L;  3QJY A;  4A3K H;  1MSH A;  3IFD A;  4FO2 A;  2KUM A;  3FKI G;  3L3O C;  1EQQ A;  3HOW G;  1JOK A;  3W2D A;  1GHJ A;  1PH8 A;  1EEI D;  3CRK C;  2E5L Q;  3J80 c;  4QUC A;  3D8G A;  4LUO A;  1UE1 A;  1A63 A;  2PZT A;  3J80 L;  4C3J B;  4B3M Q;  2DNE A;  4BY7 H;  1F77 A;  1O7Y A;  2HQE A;  3ER0 A;  3MFG A;  3T56 B;  4QQB X;  1ICF B;  3ITP A;  1VQC A;  2EYP A;  3UDF A;  4JBJ A;  3FRP B;  1AP0 A;  1OXT A;  5EPK A;  3GTL B;  2K33 A;  5C0X I;  2CCZ A;  3ERQ A;  1L1O A;  3HS0 C;  5D3I B;  2LMC B;  5I9P A;  3S14 H;  3T4A C;  4GLV B;  1FJG Q;  1J9O A;  3S2D H;  2WII B;  1JWS D;  1LLR D;  4A3F H;  1YJ9 A;  4NXM L;  5IT9 c;  3F8T A;  2UU9 Q;  3STB D;  1LO5 D;  3MXN B;  2CW0 D;  3OPO A;  5IYC H;  1OTC A;  3TEH B;  1W2B A;  1Y1V B;  3H0G B;  2RHS B;  1WTH A;  4A3J B;  1YIT A;  2QIL A;  4OWX B;  2OCE A;  4LW1 A;  3KJO A;  3DHQ A;  4DR7 L;  5GAE C;  2UUA L;  1HXY D;  2Z9H A;  2IPK D;  2PQA B;  4WOR A;  2B2T C;  2RQX A;  3K7A H;  3VYT A;  4JC0 A;  4K5V A;  3SK4 A;  2IW3 A;  2PI2 E;  2KA7 A;  1N34 Q;  2B2W A;  2OF1 A;  2RVL A;  4A3M B;  3E3X A;  2WB1 E;  2I5M X;  2OTJ A;  1UAP A;  1ENF A;  2XN9 C;  5FLX E;  5IGG A;  1L0W A;  3HEJ A;  1TS3 A;  1JIC A;  1PRT C;  2I07 B;  3VR4 A;  3PIO 3;  1BCP F;  1PRT D;  2CVR A;  3FDT A;  4Q5V A;  3TME A;  1E2Z A;  1X32 A;  2KEE A;  4V19 0;  2V1C C;  4ZYS A;  2NZ1 D;  3L9A X;  3T1Y L;  1CUK A;  1QVG A;  1VMP A;  5FO7 B;  1S5F D;  1RTO A;  3PIP A;  2M2L A;  4HJ5 A;  2JYO A;  2JEB I;  3TP6 A;  1STN A;  4BY1 H;  1U9R A;  4HAE A;  5EKL A;  1OXU A;  4DPG A;  4IPC A;  1B44 D;  2ZTE A;  4ODG A;  1TQO A;  2EQS A;  2K32 A;  1F9S A;  5DNF A;  2UXB Q;  2JA5 B;  3S15 B;  5EBC A;  1E0B A;  1U5K A;  5C3W A;  1LTI D;  1Q1E A;  1T5X D;  1JB7 A;  2KCT A;  3PO2 H;  1HFN A;  5I2X A;  1HNW L;  4ME5 A;  1WFQ A;  2BA1 A;  3JAM E;  1HZA A;  4EQ5 A;  4DAP A;  1FNW A;  1LUZ A;  4DV7 Q;  4LUV A;  3D6W A;  3ND9 A;  3G6E A;  1VQL A;  2NB0 A;  3RMH A;  1NJI C;  3W1G A;  1WTP A;  4J1M A;  4XT1 B;  2UUC Q;  2DY8 A;  1D5X C;  3OW2 A;  3CMA A;  3IFT A;  4K2L A;  4QIW E;  1E2V A;  4UP8 A;  2MFI A;  4EQP A;  2J4X A;  1QE6 A;  1B4O A;  3BDO A;  4EQN A;  3I55 A;  2I5L X;  3GTJ B;  2JA6 B;  2F0I A;  4DN4 M;  2B2Y C;  1DZ1 A;  1GOZ A;  5JPN C;  2E76 C;  4CJ1 B;  1S5C D;  2RKS A;  1X3Q A;  3J80 i;  1Q7Y C;  3MZ5 A;  5DM7 3;  3BZC A;  2Z6K A;  2AQ3 B;  1GUT A;  2XRQ D;  3MEF A;  3TZD A;  5KRU A;  1NUC A;  1SE4 A;  4MIU A;  1Q3L A;  2HDL A;  4KTA A;  2EPB A;  4LF9 Q;  1B50 A;  1PFS A;  3HOV H;  3ULL A;  2K7V A;  4X65 L;  3S2H B;  2FIN B;  3A0J A;  2JA9 A;  4UY8 C;  4KHZ A;  1EQT A;  3KF8 A;  5LMU Q;  2NVQ H;  3U58 A;  1N34 L;  1XPU A;  3RUZ A;  4ZCK A;  1XJV A;  2XWB B;  1SMX A;  2PMZ B;  4TSS A;  2E8G A;  4C2M H;  3HOU B;  2NVX B;  4DR2 L;  3URY A;  1HA6 A;  1QUQ A;  1B3Q A;  1II3 A;  2JA7 H;  1XXG A;  1YBY A;  3PGZ A;  1K8G A;  1JJ2 A;  4HIO A;  5E4X A;  4LWC A;  4PZ8 A;  2EYO A;  4ZK9 B;  1NE3 A;  4IFD J;  5C4J B;  1Y1V G;  5TSS A;  4X64 L;  3HOZ G;  1UUP A;  3H0G G;  2YU9 H;  3SR1 A;  4A3J G;  4WJW A;  4POF A;  1NMG A;  3BVG A;  4OWW B;  3T53 B;  2M9V A;  3HG9 A;  2DUD A;  4M8A A;  4ILW A;  4A3I H;  1T9H A;  3A8I E;  4BXX G;  1AEX A;  1ZEQ X;  3EN2 A;  2KQ3 A;  4CKE A;  2IHF A;  1SNM A;  3F2C A;  2F0M A;  5F2D A;  3KLS X;  1D8L A;  3AEV A;  3R8B A;  4A3M G;  4B3R L;  4DV6 Q;  2R93 B;  2FHT A;  5J1Z A;  4GZY C;  1TY2 A;  2QEJ C;  2DGY A;  4OWT B;  1TWG H;  2E2D C;  3RNU A;  1XPR A;  3BS1 A;  3NXW A;  4A3L G;  4RMF A;  2E74 C;  1H9M A;  4IUN A;  1QCB D;  1R9T B;  4DR6 L;  3F2U A;  4QY7 A;  3PIP 3;  4EVO A;  1Q12 A;  3BG3 A;  4BBR B;  3C3L A;  2B2V C;  2H1E A;  3A5Z B;  1DD2 A;  3OIQ A;  1K73 C;  3OWE B;  4HCS A;  4DUZ Q;  3CP0 A;  3L7Z C;  1B9N A;  2CWP A;  1MJE A;  1X9N A;  4QB4 A;  1EU4 A;  4IUR A;  2R7F A;  1V9P A;  2QDL A;  3S1N H;  5JPM C;  3S17 B;  4KMU C;  1PFB A;  1X3G A;  3BU2 A;  5M3F H;  4FF4 A;  3S16 H;  3AFP A;  2F0D A;  4YWL A;  5A2Q L;  2WKD A;  2B3G A;  3ERO A;  2VQE L;  2NZO A;  2JA5 G;  4AYB B;  2F4V L;  4X62 Q;  2YV5 A;  1A0I A;  2BE5 C;  1X56 A;  4XXE A;  3GO5 A;  3HOX H;  2BE5 D;  2D2C C;  2HIX A;  1J5E L;  4IUV A;  3SK8 A;  5M5Y B;  1TWC B;  3N6R A;  4ID6 A;  3CC2 A;  1GUS A;  2R3Z A;  4LF7 Q;  4IZ8 A;  1XMO L;  3M3Y B;  1ASZ A;  2DN8 A;  4KI0 A;  2N88 A;  5IYD H;  4OEL B;  1EY8 A;  4H0L C;  3OHX C;  3EFX D;  1LAC A;  2AQ2 B;  1PTO D;  2BA0 A;  1Q82 C;  3OMC A;  1E1T A;  1K8A C;  5C4H A;  3IKJ A;  1WCM B;  1A3U A;  2QKI C;  5HUR A;  5FOB B;  4XTC S;  5FJ8 H;  1LM0 A;  4NDX A;  5CMD A;  2D0O A;  5M3F G;  4DNT B;  3TDQ A;  4DV2 Q;  4NXN Q;  2G9D A;  3P75 A;  5I4D A;  1Q90 A;  3NE5 B;  2E2J B;  4K5X A;  3H6M A;  4H44 C;  2VUM H;  1I50 H;  1HNX Q;  1PDQ A;  1Y8P B;  1SNC A;  1PFM A;  2F0J A;  1G6P A;  4JI1 Q;  1TWF H;  4B9W A;  4DV1 L;  4NP5 A;  1HZC A;  1YNJ C;  3WDN A;  1BKB A;  2H4O A;  2LY7 A;  3G48 A;  4KJN A;  4PZ7 A;  4XIG S;  4JI8 Q;  2HHH Q;  1JQY D;  4IOC A;  4EX5 A;  2UXC Q;  1XNQ Q;  4OON A;  1X6O A;  1NMF A;  4TQU S;  1PMR A;  2MO0 A;  4QF4 A;  2IWH A;  5LHY 1;  1S4Z A;  3NBH A;  5CYU A;  3HOU G;  1MI2 A;  3LWU A;  4AIM A;  1PH7 A;  1EQR A;  2I46 A;  3CCQ A;  2PNR C;  5J3B A;  1T5E A;  1IL2 A;  1TXY A;  5KYI A;  2KHI A;  5EGT A;  2X69 A;  3FP9 A;  2CH4 W;  1VF5 C;  1FL0 A;  4JI2 Q;  1AZQ A;  4KD4 A;  4S3S A;  1HHV A;  2LS0 1;  2AHO B;  2A6E D;  3EJI A;  2B2U C;  3UDG A;  1D7Q A;  2K5H A;  1DGS A;  1SE8 A;  4DUZ L;  5C4Z A;  1TT2 A;  2ZXO A;  4Y7N H;  1EOT A;  4DUY L;  4H7B A;  1DYQ A;  2L0C A;  2B39 A;  1GUW A;  2F0Q A;  5FK9 C;  1IXR A;  4XQN A;  2Y0S B;  5BR8 Q;  1IKM A;  3GTG H;  3GTM H;  5DAU A;  1PTO F;  1QWY A;  4IQZ A;  4FDB A;  3VR3 A;  4DV0 Q;  4FVM A;  4IPH A;  4GS3 A;  1KDC A;  2A6H C;  3PUW A;  3U4Z A;  2R93 G;  2R92 B;  2A6H D;  5IWA Q;  1G2S A;  2RDG A;  2RSN A;  5G3L F;  3CCJ A;  1KAB A;  4YHH L;  2ZJR A;  1ESR A;  4G4K A;  1L0X B;  4KHV A;  4DAY B;  4L8J A;  2R7Z H;  4LF7 L;  2SDF A;  1EU3 A;  1TS5 A;  1A2U A;  4JYA Q;  3CRL C;  3KYH C;  4BBR G;  5M9O A;  4OIJ A;  4NB3 A;  1Y1W H;  4LF8 Q;  1GUG A;  4F8M A;  1V1Q A;  1SJH D;  2ID0 A;  4DK3 C;  1YJW A;  5ELF A;  3CXC A;  1KRS A;  2L1B A;  1G51 A;  4BY7 B;  3C1E A;  3GTP B;  3E6Z X;  1YNN C;  1K8M A;  3NUC A;  2O4X A;  1QVC A;  3F2B A;  2CKZ B;  3OMG A;  3A8K E;  1VQN A;  2PI2 A;  2A19 A;  3PMF A;  4GOP A;  1K28 A;  2F0T A;  2ZTC A;  4J15 A;  2F0O A;  1WTV A;  1O7I A;  3P7J A;  4DV3 L;  3RZO H;  4AYB G;  2CHB D;  3RN5 A;  2XVS A;  1EL0 A;  5LL6 X;  1R4P B;  2NN6 I;  1NSN S;  3LX0 A;  4ALP A;  3MVV A;  4AQY Q;  3S14 B;  3D0F A;  4DV5 Q;  3S2D B;  1O78 A;  4HJ7 A;  4A3F B;  5C44 H;  1C4Q A;  1EIY B;  1L1O B;  1TS2 A;  3TP7 A;  1OXX K;  2QGQ A;  1ET6 A;  3K7U C;  3RZD H;  4WJ4 A;  3SVM A;  1F9P A;  1MSG A;  5IGD A;  3NBI A;  1JR0 D;  4JI8 L;  5C5L A;  1SJE D;  1XNQ L;  2EY6 A;  2EXD A;  1I6V C;  2UUA Q;  3QOJ A;  1VQF A;  4QMG A;  4N8F A;  2K1B A;  2JEA I;  3DWP A;  2DJG C;  3K7A B;  3QR8 A;  4PNY A;  3Q6S A;  1D1I A;  4DR1 L;  5C3X A;  1VQ7 A;  4JPB W;  4P71 A;  3Q0A A;  4P72 A;  4OXP A;  1FGB D;  1ZKO A;  4ZLT F;  3OSO A;  3PV0 A;  2L9H A;  2ZTD A;  1SMY D;  2F3I A;  2K5N A;  1K8O A;  1UE5 A;  2L4N A;  4ZRZ A;  1B70 B;  3C1F A;  4DA2 A;  2CQO A;  1CKN A;  2BOS A;  3W1B A;  3GTO H;  5JEA J;  1K0S A;  4Q0F A;  1PXU A;  4GNX C;  3BDL A;  2L12 A;  3T1Y Q;  1VQA A;  3FPP A;  5CC4 A;  2VB2 X;  2OTL A;  1HNZ Q;  3D3R A;  4MTN A;  4X3S A;  1K3B C;  3BDC A;  2XTI A;  4LFB L;  3Q23 A;  1AN8 A;  3G7L A;  3S1Q H;  4GLA C;  3Q8D A;  3SHL A;  1A6X A;  4K6L A;  3VA5 A;  3N52 A;  1ICW A;  1B1Z A;  4BY1 B;  3M85 A;  1LT6 D;  5GAH C;  3T1H L;  1QNK A;  2A5H A;  2BDN A;  1VQ8 A;  3QOL A;  3IAY A;  3UE0 A;  2IL8 A;  1D2B A;  1HNW Q;  4JBW A;  3PO2 B;  1JE4 A;  1EWH A;  1U0L A;  4GKJ L;  5HGT A;  1C8C A;  4A3C H;  4JI4 L;  4JYA L;  3R3O A;  1X65 A;  1X54 A;  4IJL A;  2NTS A;  4LF8 L;  1IKL A;  1KD1 C;  2K50 A;  2MHV A;  5ELE A;  5J39 A;  5C0X G;  1BR9 A;  2F0G A;  5LL6 S;  4BA1 I;  2F1M A;  2A1A A;  1KDB A;  3VA7 A;  4DV4 L;  1ILQ A;  4DR4 L;  3FMC A;  4IFD H;  2A8V A;  3UDX A;  2A68 C;  2EJM A;  1SNP A;  3KF6 B;  5KNB A;  2Y0S G;  3U4V A;  3S9W A;  5KNC A;  1CA5 A;  1KDA A;  2K01 A;  2K05 A;  1PH3 A;  3DWQ A;  2K5W A;  3CPW A;  1C48 A;  1Z7T A;  1RJT A;  3GTK H;  3KDF B;  2JK8 A;  4F7X A;  2R92 G;  5BN4 A;  4JVZ A;  4AQY L;  4DV5 L;  4EQO A;  5CV4 A;  4A3G H;  4A3K G;  2F0L A;  4CDD C;  2IT1 A;  1B53 A;  4K14 A;  4AYB E;  5IT9 L;  1CKM A;  2GA4 B;  3Q24 A;  2L15 A;  2JJQ A;  3HOZ B;  3AU7 A;  3NEN A;  1EY0 A;  1PH9 A;  2JA8 H;  5EQ0 A;  1QB5 D;  5IP9 H;  1YEZ A;  1PTO H;  3DLL A;  2A69 C;  3HOV B;  1A2T A;  4BY7 G;  1FR3 A;  3HP3 A;  4LK1 C;  4X65 Q;  1F9Q A;  4HR7 B;  4KN7 C;  2EY2 A;  4DU9 A;  3S1M H;  1U4M A;  4WJ3 M;  1DON A;  1PYB A;  2RCF A;  2SNS A;  2AWN A;  4JOI A;  1UE6 A;  3OTO Q;  2NVQ B;  1N36 L;  3TQY A;  3BYT B;  4HMI A;  4TRD A;  1V1P A;  4IFD I;  4DR2 Q;  4C2M B;  2OWO A;  1K83 H;  4B3S L;  1WD0 A;  3KF8 B;  1Z6H A;  1CA6 A;  2O5I C;  1TR5 A;  4A3F G;  1PYW D;  2VS1 A;  2JA7 B;  1SRO A;  2NTT A;  1G6Z A;  4X64 Q;  1XTC D;  3WOF A;  3LGJ A;  5IYC G;  2KVM A;  3RLN A;  3I7F A;  2Z4H A;  4MZ9 A;  1HR0 Q;  4CJ0 B;  2NVT H;  2RDH A;  1ZXT A;  3I91 A;  2YU9 B;  2EY5 A;  1MIU A;  4HIK A;  3ULP A;  1HNZ L;  1TWH H;  1I94 L;  4DXF A;  3I72 A;  4A3I B;  2Q2I A;  1H95 A;  1BF4 A;  5FKA C;  2AKW B;  4RGM A;  4B9X A;  1SYC A;  3FPU B;  3K58 A;  4B3R Q;  2V4D A;  2MO1 A;  4GNX B;  5K5P A;  4HID A;  1V1O A;  3K81 C;  1V8Q A;  4K8J A;  1LTL A;  4ZKB B;  3D31 A;  1AH9 A;  3CKI B;  3NSW A;  2WKC A;  2OEO A;  4HTH A;  1CM9 A;  3IL8 A;  4R4O A;  3H3V C;  4DR6 Q;  4YY3 L;  4YCW A;  3V05 A;  2VY3 A;  4C3I H;  2OQ0 A;  3TS0 A;  4E6I A;  4DAV A;  5JVG 3;  5E3F A;  5HGQ A;  4XQJ A;  1PV4 A;  3K0X A;  2Z1C A;  5GRO A;  4PG3 A;  5J22 A;  3EVQ A;  2F0N A;  5NUC A;  1DOM A;  1HA5 A;  2SOB A;  1VQO A;  1Y8O B;  4OX9 L;  4C3J H;  3BVZ A;  3S1N B;  2Q2T A;  4BY1 G;  4XQQ A;  3I73 A;  1IL8 A;  2Y0S E;  5EPL A;  5M3F B;  3S16 B;  5IOC A;  1EY5 A;  2I0Q A;  2VQE Q;  1HZ9 A;  1TWA B;  2F0E A;  5M5X H;  1UEB A;  2F4V Q;  4JI5 L;  1DCZ A;  1XNR Q;  1JOO A;  2O5J C;  2KOL A;  2JSO A;  3I90 A;  4FXD A;  3PO2 G;  5M3M H;  1J5E Q;  3TSS A;  1PH1 A;  3HOX B;  3DM1 A;  5JJZ A;  1Q8I A;  1YI2 A;  4J6H A;  4ME3 A;  1JT8 A;  5FLM H;  1PRT F;  1CQF A;  3M4O H;  1FNV A;  2Q8R E;  4DF7 A;  1XMO Q;  4HJ9 A;  3UI2 A;  2IY5 B;  2Z6B A;  4C3I G;  1M90 C;  5IOD A;  3K5O A;  4RCN A;  1ASY A;  1I4R A;  1STH A;  2WAQ B;  3K0Y A;  2F3W A;  1M8A A;  2K28 A;  3AFQ A;  5CV7 A;  4JI7 L;  1VQE A;  1B2T A;  4HED A;  4YWK A;  1UWV A;  3CCE A;  4JI3 Q;  3OTO L;  2KCM A;  3GTQ H;  4MNO A;  2EYM A;  5AFW A;  3NWT A;  5C3E H;  3T51 B;  3CD6 A;  3PF5 A;  4KJO A;  2ZT9 C;  2VQF L;  2C9O A;  1BBU A;  2XNA C;  1H9S B;  2YTX A;  2CH4 A;  1SBB B;  3PF4 A;  1W6J A;  3BYY B;  4O0A A;  2L55 A;  4C56 C;  2VUM B;  1XTD A;  4R4Q A;  2EXZ A;  1HR0 L;  1U4P A;  3C46 A;  4DV1 Q;  4KHP L;  1PH6 A;  4LNQ A;  3HOV G;  3CF5 A;  2RA4 A;  4C3H H;  2KEC A;  1ENC A;  1PLF A;  1D6E C;  1V43 A;  4HMJ A;  1A3T A;  3B6Y A;  4OL7 A;  1XMQ L;  4FF1 A;  1EWC A;  4A4I A;  1GUN A;  2M00 A;  2N78 A;  4U68 A;  2HQL A;  2Q8T A;  4A3D H;  2SNM A;  3UDI A;  4ZUJ A;  5KND A;  2KCC A;  3BJU A;  2Q2H A;  4IAL A;  1I4G A;  1ZYR C;  5K36 H;  1LTA D;  1JE5 A;  1I4Q A;  3ZJY C;  4EGV A;  3HGB A;  1ONL A;  5EAY A;  1GVP A;  5C3E G;  1B7Y B;  2CFM A;  1A3V A;  2JA7 G;  1TY0 A;  1YVC A;  4N9T A;  2F0S A;  2YYZ A;  5FO9 B;  1SYF A;  3MFY A;  3NBH B;  3J7A 5;  4DNR B;  4HCE A;  4BBS H;  4FP5 D;  4IPD A;  2MQH A;  1NCV A;  3EIV A;  2LXK A;  2QA4 A;  4R1J A;  4LF6 Q;  3T16 A;  4L5Q A;  4LF5 Q;  3PUY A;  2K5V A;  1AFP A;  5E4W C;  3NTK A;  3PUZ A;  4V0B A;  1C9O A;  4A3I G;  2N49 A;  4DUY Q;  3D6C A;  4Y7N B;  1WTQ A;  4B3T L;  3SK6 A;  1F2Y A;  3KLS A;  2D5D A;  1EIG A;  1KQS A;  2D0P A;  5IYB H;  4RFB A;  5ELC A;  5IGF A;  1GM5 A;  3GTG B;  3UE1 A;  2ZJQ A;  3GTM B;  3ERS X;  3H94 A;  4FF3 A;  5JVH 3;  3J81 c;  1PHJ A;  5IIF A;  3I4M G;  1XNR L;  4DGZ A;  5ISR A;  1VQK A;  4QJF A;  3J81 L;  1S5D D;  2AMC B;  1G2T A;  2N3S A;  3PUV A;  4YHH Q;  3SDZ A;  4F87 A;  1Q86 C;  3KLW A;  3L0O A;  4OO1 H;  4L5T A;  3M4P A;  4O1N A;  4HSP A;  1O80 A;  2R7Z B;  1SNQ A;  1EYD A;  1BXT A;  2NVY H;  4UAI A;  2B63 H;  5COR A;  1I6H H;  5ELN A;  1VQ9 A;  1SYE A;  4KKU A;  3FHW A;  1LTS D;  3CC4 A;  1O7L A;  1RCV D;  2EVB A;  5E1F A;  1L1O C;  1PVO A;  1GO3 E;  3K5M A;  4JI3 L;  5JEA H;  3GDE A;  1LYL A;  2LXJ A;  2BDO A;  1VQ5 A;  1ENA A;  3AYH B;  5LMN Q;  3HOY H;  1MKH A;  3DM3 A;  4OGQ C;  3GV6 A;  4K2K A;  2F0W A;  4DV3 Q;  2EJG C;  5CV9 A;  1EFI D;  3QWN A;  3MTS A;  4ULL A;  1PH4 A;  2LFN A;  5M5W H;  2ALY B;  3HOX G;  2WB1 B;  4GKK L;  2P5Z X;  4YCU A;  3S1R H;  2PZU A;  2WFW A;  2ZJP A;  5C44 B;  5EBD A;  1F9R A;  1YZ6 A;  1Z47 A;  4NPS A;  2VXW A;  2B2T A;  2HCC A;  1EWI A;  4A93 H;  1EOV A;  3RZD B;  1RL2 A;  3OWF A;  5CGK A;  5IYD G;  1YNJ D;  5KIX A;  2E2I H;  2EIF A;  1LTG D;  1KAW A;  3HKZ G;  4HJA A;  2WAQ G;  4A76 A;  4OO1 I;  2R7D A;  2B2W C;  2IHE A;  4G7O C;  2Z8L A;  1UEA B;  2N55 A;  1EEF D;  3D4D A;  4IUP A;  4RG1 A;  3A7A B;  5A2Q E;  5JEA G;  1AE2 A;  1NBW A;  5T1G A;  3J7Z C;  4DR1 Q;  4CKB A;  5FJ8 G;  1STG A;  3SEB A;  4NW2 A;  4MHE A;  1CT1 D;  4FNF A;  2O2L D;  2K4K A;  3G6J B;  1CK1 A;  2TMP A;  2XIW A;  1MD2 D;  4LMQ D;  4APV A;  2RDF A;  3M9B A;  3NTI A;  2VNU D;  3VYS A;  1AW7 A;  2VUM G;  1DOL A;  3EA6 A;  1EYA A;  4PMW A;  2HIV A;  2QF7 A;  1IBL L;  2F03 A;  2BH2 A;  2E2H H;  1IBK L;  4LF6 L;  3GTO B;  3SK5 A;  4LF5 L;  4I65 A;  4QUF A;  2H5X A;  4K0K L;  2NN6 H;  4RGT A;  1TVX A;  4P2C B;  1U4L A;  1R9T H;  2DY7 A;  4LFA L;  1IW7 C;  4LFB Q;  2Z0S A;  1RTN A;  4X3U A;  4A3B H;  3H91 A;  1YNX A;  2EYL A;  3QO2 A;  1KC8 C;  1JOQ A;  2Q2U A;  1KAA A;  2QW7 A;  5JJI A;  3T1H Q;  4BA2 I;  3HFZ B;  2ICE C;  1IBM L;  5BN5 A;  3K8A A;  4WRD A;  1ILP A;  3S17 H;  3AQQ A;  4A3K B;  4RCO A;  2JQO A;  4GKJ Q;  3J7A V;  1CSP A;  5C6A A;  2E75 C;  3CW2 C;  3RN2 A;  4RKL A;  4JI4 Q;  4PMC A;  1KIX A;  5CV6 A;  1G8Z D;  1FVI A;  2WP8 J;  1CHP D;  1ML0 D;  4DV4 Q;  2HUG A;  4DR5 L;  2B2Y A;  2VZA A;  1EFW A;  4DR4 Q;  5GQO A;  1YNN D;  4C1N I;  2NN6 G;  1I4H A;  3CPF A;  3EQL C;  3J81 i;  3GP7 A;  3E0J A;  4CGY B;  4IJH A;  5LMN L;  1JMC A;  4C1N K;  1J6Q A;  1SLJ A;  1K3R A;  3GTK B;  3CU7 A;  4HN7 A;  2J0T D;  1WCM H;  4QGU A;  1P8L A;  4XT3 B;  1AZP A;  5T1I A;  5C4X H;  4GN3 B;  4A3G B;  2EE1 A;  3MWY W;  2D62 A;  2C35 B;  2A73 B;  2G9H D;  1F2L A;  2XSC A;  4JCV E;  4JG2 A;  4RWS C;  2R7Z G;  3X3N A;  3I4N H;  1SE3 A;  4F88 A;  2SEB D;  3U50 C;  1Y1W G;  4H13 C;  5H1S E;  3OOC A;  5JJK A;  1PTO B;  3PIO A;  4R8I A;  2OT2 A;  2MUY A;  5AJ3 Q;  1KRT A;  1JJC B;  3HZX A;  4RHS A;  3RLF A;  1N8R C;  3S1M B;  2WAQ E;  4A3E H;  3E5S A;  4LJZ C;  1HTP A;  3I4L A;  5CR3 A;  1H9K A;  1N36 Q;  4LF4 L;  1VQD A;  1VDZ A;  1FYC A;  1BUV T;  1Y14 B;  2K6A A;  4B3S Q;  2PMZ E;  1BO0 A;  1ESF A;  4DR3 L;  5DEH A;  1K83 B;  2WIN B;  2RBM A;  1XX8 A;  2WB1 G;  1RKN A;  4IUQ A;  1SYB A;  5C44 G;  1JJG A;  5C4X G;  1IYJ B;  2KEN A;  4ZKC B;  2F52 A;  2A74 C;  4YCV A;  1PZJ D;  3FKI H;  1AE3 A;  4MTK A;  3HOW H;  5L37 A;  1FNU A;  4J8Q A;  2NVT B;  1SEB D;  1I94 Q;  1TWH B;  2F0K A;  4R4I A;  1SYG A;  3TS2 A;  1K0R A;  5IE8 A;  1C0A A;  3KLR A;  1C7Y A;  1EYG A;  3NP8 A;  1HH2 P;  1VQB A;  2C5C A;  4X66 L;  1M1K C;  2PZW A;  1LT3 D;  3AB9 A;  4GLX A;  4IPG A;  1HRJ A;  2AQ1 B;  3J7A F;  4PMB A;  2B2V A;  1PA6 A;  4N8X 1;  5E7N A;  1BCP C;  4DAM A;  1G91 A;  1CQV A;  2KHS A;  2KCN A;  2F0P A;  1N33 Q;  3HRZ C;  4YY3 Q;  4RH6 A;  5FLX c;  3D4R A;  4O42 A;  1I4X A;  4C3I B;  3A54 A;  2RCN A;  5FLX L;  2FJ2 A;  1A8V A;  3PO3 H;  1QNU A;  2A68 D;  2JP1 A;  2BH8 A;  2ZM6 Q;  1WTW A;  4DXG A;  2G5D A;  2JN4 A;  4OX9 Q;  4JW0 A;  4JI6 L;  1S3O A;  3WOE A;  4R4C A;  2F3V A;  3GTP H;  3F2D A;  1PFN A;  4RA8 A;  1KLG D;  2K75 A;  3VR6 A;  1JC7 A;  2R6G A;  4I7Z C;  4JI5 Q;  5BN3 A;  5IY0 A;  5M5X B;  5A35 A;  2B29 A;  3NK9 A;  4JI0 L;  2PO4 A;  1A15 A;  1BDO A;  2MP1 A;  5M3M B;  1GJX A;  4A3C G;  4DNI A;  3I4M H;  4JV5 Q;  1E7Z A;  1BOS A;  1RD9 D;  3M4O B;  3CCM A;  1N32 L;  2K52 A;  4N9P A;  1YHA A;  2A69 D;  4PV1 C;  3STB C;  5I2Y A;  4G7H C;  3JAM c;  2CW0 C;  3W5O A;  1LTT D;  4KN4 C;  2NZH A;  5AJ3 L;  5EKK A;  4IFD G;  3QIA A;  3TP5 A;  1B8A A;  4M1U B;  3JAM L;  3PO3 G;  5I9O A;  4JI7 Q;  3R2T A;  3I2Z A;  1ET9 A;  1GKH A;  4DK6 C;  4R8N A;  2IJ0 A;  1GUO A;  1XPO A;  1X3E A;  2IX0 A;  3GTQ B;  1WTR A;  2Q8I B;  3MXP A;  2CQA A;  1KTK A;  5C3E B;  3K59 A;  5ELO A;  2VQF Q;  1HUN A;  3CQZ H;  4O2D A;  2F0H A;  4DK1 A;  2MNA A;  4A3G G;  3M4Q A;  3J80 E;  2L11 A;  4AH6 A;  4XYO A;  1JWM D;  1QUQ B;  2J7Z A;  1BBX C;  2JA8 G;  5JJL A;  1EQV A;  1W6K A;  1YHQ A;  4KHP Q;  5EJW A;  5IP9 G;  3RLO A;  3IRB A;  2K14 A;  4BS9 A;  2RSO A;  2QEX A;  3TBI B;  1SAP A;  2UUB L;  4C3H B;  1XMQ Q;  3QB3 A;  1O7Z A;  1EZ6 A;  2RF4 A;  1SR3 A;  3NWS A;  1DOK A;  2Z4I A;  5CBA E;  4ZQ3 A;  1DJR D;  3MXG A;  1EY6 A;  4A3D B;  1EZ8 A;  1QOH A;  1I3Q H;  4LFC L;  4L63 B;  3W3A A;  2ZXR A;  1E1O A;  4DK0 A;  1N9W A;  1OXS C;  2B2U A;  4DKA C;  4CDF C;  1FD7 D;  5IT9 E;  1HZB A;  5FO8 B;  1UE7 A;  1TWG B;  4XYQ A;  1Y69 U;  1SFO H;  3GV3 A;  3FEW X;  1U4R A;  1N33 L;  1QJO A;  1VQI A;  4L6T B;  1WYD A;  2KBN A;  2KED A;  4KV6 A;  3VYU A;  4BBS B;  1VS0 A;  4P73 A;  4DFA A;  4ZAI A;  1WVL A;  2E5L L;  2PW5 A; 
#chains in the Genus database with same CATH homology
 4UDU C;  1D5Z C;  1DXM A;  1JB3 A;  1MBY A;  2OXP A;  4NKL A;  1TU2 B;  3MC0 B;  3Q22 A;  1BCP B;  2MGS A;  3I8Z A;  4KD3 A;  5D3D A;  3X3M A;  1GHK A;  3A7L A;  3MA2 B;  1WTO A;  2EYJ A;  3PUX A;  4XDX A;  1PZI D;  2F0V A;  2AWO A;  3MXN A;  3U9O A;  4BWG B;  4RAU C;  2ENB A;  3K57 A;  5C0X J;  1G29 1;  4RGO S;  2NVY B;  2B63 B;  4CBV A;  5KEE A;  3TZU A;  1CHQ D;  1H9J A;  2FFK B;  3NTH A;  3HKZ B;  3U9S A;  1I6H B;  1IYV A;  2PPB C;  1TS4 A;  2PW7 A;  1SYD A;  5EPJ A;  4RGN A;  4C3J G;  2NUC A;  1PZK D;  1CZW A;  2FMC A;  1UNS A;  1NR2 A;  3MXU A;  2EY1 A;  3HOY B;  3NHH A;  1GXD C;  2TSS A;  1QG7 A;  1VF7 A;  2X6L A;  4KY7 A;  3I70 A;  1I50 B;  1EY4 A;  5M5W B;  1X3P A;  3LWE A;  3S1R B;  1TWF B;  5IGB A;  1JCK B;  1F2Z A;  1M4V A;  1S5E D;  3A56 A;  4A93 B;  3KUP A;  3R2I A;  2EJF C;  2E2I B;  2AUK A;  2NYZ D;  4QCL A;  4FF2 A;  3K5L A;  1J8I A;  3DMU A;  3C2P A;  1DM0 B;  1ZYR D;  3V2T A;  3DEO A;  1PRT B;  5I6Y A;  4OIK A;  2XWJ B;  4IUU A;  1L0Y B;  4CKC A;  4U67 3;  2K5D A;  1F2M A;  1STA A;  5KGU A;  1RF2 D;  2WV6 D;  2E2H B;  2EOT A;  4K8I A;  4C3H G;  4TKO B;  2IX3 A;  4OHJ A;  1KNE A;  2B8F A;  3NQT A;  4A3B B;  3T13 A;  5ELD A;  3RD4 A;  5K36 G;  4NMZ A;  5JOB A;  5CV5 A;  3TN2 A;  4IUT A;  3DEP A;  2KJX A;  1EY7 A;  1B9M A;  5CV8 A;  1Y8N B;  1IHZ A;  3BVM A;  3LNN A;  1CI3 M;  1LTR D;  1EYC A;  3M7G A;  1SE2 A;  3I3C A;  1RHP A;  1HQM C;  1Y1W B;  3D4W A;  3CHB D;  4B08 A;  2X6G A;  1D1K A;  1RDP D;  1QIL A;  3V96 A;  1LV9 A;  4IN3 A;  1XYI A;  4ABN A;  1WD1 A;  1BQQ T;  1TII D;  1CTM A;  1HUM A;  2D9U A;  1JWU D;  1PTO C;  4G7Z C;  1D5M C;  3VR2 A;  1EIH A;  3RZO B;  2QDB A;  1CFM A;  1LAB A;  4X3K A;  4MN3 A;  1SXT A;  1H9S A;  4CHT B;  4OO1 G;  5C4X B;  2JXM B;  1KLU D;  5G3L D;  1HFG A;  4FXG C;  3FVQ A;  1E2W A;  1LT5 D;  3M4Y A;  3I4N B;  2MJ8 A;  4KKS A;  4CJ2 C;  1BNZ A;  3K5N A;  2EYF A;  3P1H A;  1MGS A;  1OXV A;  1TKW B;  2B8G A;  1LTB D;  1OO9 B;  4KKT A;  1IYU A;  4A3E B;  3J81 E;  3K6O A;  3GQB A;  1R4Q B;  5D14 A;  3OW7 A;  1LT4 D;  4RKB A;  3AMU A;  1B3A A;  2F4I A;  3KBG A;  5I6W A;  3NQI A;  1KNA A;  3SXH A;  3FKI B;  3HOW B;  2BCO A;  2R61 A;  2XRS D;  2FMM A;  4K5W A;  2A6E C;  3DWA A;  3O13 A;  1NR4 A;  1SND A;  4R9W A;  1IW7 D;  3S1Q B;  5COY A;  2WAC A;  1STE A;  4QIW B;  2K04 A;  1H9R A;  3MEH A;  2EYH A;  2F0F A;  4JK1 C;  2PQE A;  1Q1B A;  3QG1 A;  4FXK C;  3DUZ A;  4YIJ A;  5DM6 3;  1STY A;  3KK7 A;  3A55 A;  1HTL D;  4HSV A;  1HPC A;  2ZXP A;  5IGE A;  2EDG A;  2PCF B;  1VMC A;  4ZUI A;  1HCZ A;  4WFN 3;  3PO3 B;  1EY9 A;  4RHR A;  4G57 A;  2EZV A;  3SE0 A;  3DXJ C;  3A8J E;  3TP8 A;  1VCI A;  5ELB A;  1S5B D;  5KYL A;  2NBF A;  5IGC A;  5EKI A;  4FYD A;  4PQX A;  3VYR A;  3MHB A;  3MAQ A;  2AUJ D;  3VR5 A;  2JA8 B;  1SDF A;  1SSO A;  4LAA A;  3I4M B;  3R93 A;  4Z9C B;  2VB3 X;  2K5Q A;  2F0U A;  2L5T A;  1WTX A;  3KBX A;  1CZG A;  3P20 A;  5CBE E;  2IX1 A;  3H09 A;  2HCI A;  1JOR A;  2K03 A;  2QCP X;  3ND8 A;  5C5M A;  3OIP A;  2DNC A;  2HDM A;  2LKV A;  1SNO A;  3CQZ B;  1STB A;  5D65 A;  3NPP A;  1V1P B;  5JAV A;  3M7N A;  1SMY C;  2MPM A;  3ZYY X;  4K6D A;  1I4P A;  1ROD A;  3BZD B;  2ICI A;  5C0X H;  3GD7 A;  4KK7 A;  4X3T A;  2JE6 I;  2PYK A;  1I3Q B;  4KY6 A;  2NWG A;  3ONA B;  4KY5 A;  4DAY A;  1XWE A;  1BCP D;  1NAP A;  1SFO B;  1HQR D;  3J7Y W;  3QJY A;  1MSH A;  3IFD A;  4FO2 A;  2KUM A;  3L3O C;  1JOK A;  3W2D A;  1GHJ A;  1EEI D;  3CRK C;  4QUC A;  3D8G A;  2PZT A;  3J80 L;  4C3J B;  2DNE A;  1F77 A;  1O7Y A;  2HQE A;  3MFG A;  3T56 B;  3ITP A;  2EYP A;  3FRP B;  1AP0 A;  1OXT A;  5EPK A;  3GTL B;  2K33 A;  5C0X I;  3ERQ A;  3HS0 C;  5D3I B;  2LMC B;  5I9P A;  3T4A C;  1J9O A;  2WII B;  1JWS D;  1LLR D;  1LO5 D;  2CW0 D;  3OPO A;  1Y1V B;  3H0G B;  4A3J B;  2QIL A;  3DHQ A;  1HXY D;  2IPK D;  4WOR A;  2B2T C;  2RQX A;  3VYT A;  4K5V A;  3SK4 A;  2IW3 A;  2KA7 A;  2B2W A;  2OF1 A;  2RVL A;  4A3M B;  1UAP A;  1ENF A;  2XN9 C;  5IGG A;  5FLX E;  3VR4 A;  3HEJ A;  1TS3 A;  1JIC A;  1PRT C;  2I07 B;  3PIO 3;  1BCP F;  1PRT D;  2CVR A;  3FDT A;  4Q5V A;  3TME A;  1E2Z A;  1X32 A;  2KEE A;  4V19 0;  4ZYS A;  2NZ1 D;  3L9A X;  1VMP A;  5FO7 B;  1S5F D;  1RTO A;  2M2L A;  2JYO A;  2JEB I;  3TP6 A;  1STN A;  1U9R A;  4HAE A;  5EKL A;  1OXU A;  1B44 D;  4ODG A;  1TQO A;  2K32 A;  1F9S A;  5DNF A;  2JA5 B;  3S15 B;  5EBC A;  1E0B A;  5C3W A;  1LTI D;  1Q1E A;  1T5X D;  1HFN A;  5I2X A;  4ME5 A;  2BA1 A;  3JAM E;  4DAP A;  1FNW A;  3D6W A;  3ND9 A;  2NB0 A;  3RMH A;  1WTP A;  4J1M A;  4XT1 B;  2DY8 A;  1D5X C;  3IFT A;  4K2L A;  1E2V A;  4EQP A;  2J4X A;  1QE6 A;  1B4O A;  3BDO A;  4EQN A;  3GTJ B;  2JA6 B;  2F0I A;  4DN4 M;  2B2Y C;  1DZ1 A;  1GOZ A;  5JPN C;  2E76 C;  4CJ1 B;  1S5C D;  2RKS A;  1X3Q A;  3MZ5 A;  5DM7 3;  2AQ3 B;  1GUT A;  2XRQ D;  3TZD A;  5KRU A;  1NUC A;  1SE4 A;  4MIU A;  1Q3L A;  2HDL A;  4KTA A;  2EPB A;  1B50 A;  2K7V A;  3S2H B;  2FIN B;  4KHZ A;  1EQT A;  3KF8 A;  3RUZ A;  2XWB B;  2PMZ B;  4TSS A;  3HOU B;  2NVX B;  3URY A;  1HA6 A;  1II3 A;  1XXG A;  5E4X A;  2EYO A;  4ZK9 B;  4IFD J;  5C4J B;  5TSS A;  1UUP A;  3SR1 A;  4WJW A;  3BVG A;  3T53 B;  2M9V A;  3HG9 A;  4M8A A;  4ILW A;  3A8I E;  1AEX A;  1ZEQ X;  2KQ3 A;  4CKE A;  1SNM A;  2F0M A;  5F2D A;  3KLS X;  3R8B A;  2R93 B;  2FHT A;  5J1Z A;  4GZY C;  1TY2 A;  2QEJ C;  2E2D C;  3BS1 A;  3NXW A;  2E74 C;  1H9M A;  4IUN A;  1QCB D;  1R9T B;  3F2U A;  3PIP 3;  4EVO A;  1Q12 A;  3BG3 A;  4BBR B;  3C3L A;  2B2V C;  2H1E A;  1DD2 A;  3OIQ A;  3OWE B;  4HCS A;  3L7Z C;  1B9N A;  4QB4 A;  1EU4 A;  4IUR A;  5JPM C;  3S17 B;  4KMU C;  1PFB A;  4FF4 A;  2F0D A;  5A2Q L;  2WKD A;  3ERO A;  4AYB B;  2BE5 C;  4XXE A;  3GO5 A;  2BE5 D;  2D2C C;  4IUV A;  3SK8 A;  5M5Y B;  1TWC B;  3N6R A;  4ID6 A;  1GUS A;  2R3Z A;  4IZ8 A;  3M3Y B;  2DN8 A;  4KI0 A;  2N88 A;  1EY8 A;  4H0L C;  3OHX C;  3EFX D;  1LAC A;  2AQ2 B;  1PTO D;  2BA0 A;  3OMC A;  5C4H A;  3IKJ A;  1WCM B;  1A3U A;  2QKI C;  5HUR A;  5FOB B;  4XTC S;  4NDX A;  5CMD A;  4DNT B;  3TDQ A;  2G9D A;  3P75 A;  5I4D A;  1Q90 A;  3NE5 B;  2E2J B;  4K5X A;  3H6M A;  4H44 C;  1PDQ A;  1Y8P B;  1SNC A;  1PFM A;  2F0J A;  4B9W A;  4NP5 A;  1YNJ C;  3WDN A;  2H4O A;  2LY7 A;  4KJN A;  4XIG S;  1JQY D;  4TQU S;  1PMR A;  4QF4 A;  2IWH A;  5LHY 1;  1S4Z A;  3NBH A;  5CYU A;  1MI2 A;  3LWU A;  2I46 A;  2PNR C;  1T5E A;  5KYI A;  5EGT A;  2X69 A;  1VF5 C;  1AZQ A;  4KD4 A;  4S3S A;  1HHV A;  2LS0 1;  2A6E D;  3EJI A;  2B2U C;  5C4Z A;  1TT2 A;  2ZXO A;  1EOT A;  4H7B A;  1DYQ A;  2L0C A;  2B39 A;  1GUW A;  2F0Q A;  5FK9 C;  4XQN A;  2Y0S B;  1IKM A;  5DAU A;  1PTO F;  1QWY A;  4IQZ A;  3VR3 A;  4FVM A;  1KDC A;  2A6H C;  3PUW A;  2R92 B;  2A6H D;  1G2S A;  2RDG A;  2RSN A;  5G3L F;  1KAB A;  1ESR A;  4G4K A;  1L0X B;  4KHV A;  4L8J A;  2SDF A;  1EU3 A;  1TS5 A;  1A2U A;  3CRL C;  5M9O A;  4OIJ A;  1GUG A;  4F8M A;  1SJH D;  2ID0 A;  5ELF A;  2L1B A;  4BY7 B;  3C1E A;  3GTP B;  3E6Z X;  1YNN C;  1K8M A;  3NUC A;  2O4X A;  3OMG A;  3A8K E;  3PMF A;  2F0T A;  2F0O A;  1WTV A;  3P7J A;  2CHB D;  2XVS A;  1EL0 A;  5LL6 X;  1R4P B;  2NN6 I;  1NSN S;  3LX0 A;  3MVV A;  3S14 B;  3S2D B;  1O78 A;  4A3F B;  1C4Q A;  1TS2 A;  3TP7 A;  1OXX K;  1ET6 A;  3SVM A;  1F9P A;  1MSG A;  5IGD A;  3NBI A;  1JR0 D;  5C5L A;  1SJE D;  2EY6 A;  1I6V C;  3QOJ A;  4QMG A;  2K1B A;  2JEA I;  3DWP A;  3K7A B;  4PNY A;  3Q6S A;  1D1I A;  5C3X A;  3Q0A A;  1FGB D;  1ZKO A;  4ZLT F;  3OSO A;  3PV0 A;  2L9H A;  1SMY D;  1K8O A;  2L4N A;  4ZRZ A;  3C1F A;  4DA2 A;  2BOS A;  5JEA J;  4Q0F A;  1PXU A;  3BDL A;  2L12 A;  3FPP A;  5CC4 A;  2VB2 X;  3D3R A;  4X3S A;  3BDC A;  3Q23 A;  1AN8 A;  3G7L A;  1A6X A;  3SHL A;  4K6L A;  3VA5 A;  3N52 A;  1ICW A;  1B1Z A;  4BY1 B;  3M85 A;  1LT6 D;  1QNK A;  2A5H A;  2BDN A;  3QOL A;  3IAY A;  2IL8 A;  1D2B A;  4JBW A;  3PO2 B;  1JE4 A;  1EWH A;  5HGT A;  1C8C A;  3R3O A;  2NTS A;  1IKL A;  2MHV A;  5ELE A;  5J39 A;  5C0X G;  1BR9 A;  2F0G A;  5LL6 S;  4BA1 I;  2F1M A;  1KDB A;  3VA7 A;  1ILQ A;  3FMC A;  4IFD H;  2A68 C;  2EJM A;  1SNP A;  5KNB A;  3S9W A;  5KNC A;  1CA5 A;  1KDA A;  2K01 A;  2K05 A;  3DWQ A;  2K5W A;  1C48 A;  1Z7T A;  1RJT A;  4F7X A;  5BN4 A;  4EQO A;  5CV4 A;  2F0L A;  2IT1 A;  1B53 A;  4K14 A;  5IT9 L;  2GA4 B;  3Q24 A;  3HOZ B;  3AU7 A;  1EY0 A;  5EQ0 A;  1QB5 D;  1PTO H;  2A69 C;  3HOV B;  1A2T A;  1FR3 A;  3HP3 A;  4LK1 C;  1F9Q A;  4HR7 B;  4KN7 C;  2EY2 A;  4DU9 A;  1U4M A;  1DON A;  2SNS A;  2AWN A;  2NVQ B;  3BYT B;  4HMI A;  4TRD A;  1V1P A;  4IFD I;  4C2M B;  1WD0 A;  1Z6H A;  1CA6 A;  2O5I C;  1TR5 A;  1PYW D;  2JA7 B;  2NTT A;  1G6Z A;  1XTC D;  3WOF A;  2KVM A;  2Z4H A;  4CJ0 B;  2RDH A;  1ZXT A;  3I91 A;  2YU9 B;  2EY5 A;  4DXF A;  3I72 A;  4A3I B;  1BF4 A;  5FKA C;  4RGM A;  4B9X A;  1SYC A;  3FPU B;  3K58 A;  2V4D A;  5K5P A;  1V1O A;  1V8Q A;  4K8J A;  4ZKB B;  3D31 A;  3CKI B;  3NSW A;  2WKC A;  2OEO A;  4HTH A;  1CM9 A;  3IL8 A;  3H3V C;  3V05 A;  4E6I A;  4DAV A;  5JVG 3;  5E3F A;  4XQJ A;  2Z1C A;  5J22 A;  3EVQ A;  2F0N A;  5NUC A;  1DOM A;  1HA5 A;  2SOB A;  1Y8O B;  3BVZ A;  3S1N B;  4XQQ A;  3I73 A;  1IL8 A;  5EPL A;  5M3F B;  3S16 B;  5IOC A;  1EY5 A;  1TWA B;  2F0E A;  1DCZ A;  1JOO A;  2O5J C;  2KOL A;  2JSO A;  3I90 A;  4FXD A;  3TSS A;  3HOX B;  3DM1 A;  5JJZ A;  1Q8I A;  4J6H A;  1PRT F;  1CQF A;  1FNV A;  2Q8R E;  4DF7 A;  3UI2 A;  4C3I G;  5IOD A;  3K5O A;  4RCN A;  1I4R A;  1STH A;  2WAQ B;  3K0Y A;  2F3W A;  1M8A A;  2K28 A;  5CV7 A;  1B2T A;  4HED A;  2EYM A;  5AFW A;  3NWT A;  3T51 B;  4KJO A;  2ZT9 C;  2C9O A;  2XNA C;  1H9S B;  1SBB B;  1W6J A;  3BYY B;  2L55 A;  4C56 C;  2VUM B;  2EXZ A;  1U4P A;  3C46 A;  2RA4 A;  2KEC A;  1ENC A;  1PLF A;  1D6E C;  1V43 A;  4HMJ A;  1A3T A;  4OL7 A;  4FF1 A;  1EWC A;  1GUN A;  2M00 A;  4U68 A;  2Q8T A;  2SNM A;  4ZUJ A;  5KND A;  2KCC A;  4IAL A;  1I4G A;  1ZYR C;  5K36 H;  1LTA D;  1I4Q A;  4EGV A;  3HGB A;  1ONL A;  1A3V A;  1TY0 A;  4N9T A;  2F0S A;  2YYZ A;  5FO9 B;  1SYF A;  3MFY A;  4DNR B;  4HCE A;  4FP5 D;  1NCV A;  3T16 A;  3PUY A;  1AFP A;  5E4W C;  3NTK A;  3PUZ A;  4V0B A;  3D6C A;  4Y7N B;  1WTQ A;  3SK6 A;  1F2Y A;  3KLS A;  2D5D A;  1EIG A;  4RFB A;  5ELC A;  5IGF A;  3GTG B;  3GTM B;  3H94 A;  4FF3 A;  5JVH 3;  5IIF A;  4DGZ A;  5ISR A;  3J81 L;  1S5D D;  1G2T A;  3PUV A;  3SDZ A;  4F87 A;  4OO1 H;  4O1N A;  4HSP A;  1O80 A;  2R7Z B;  1SNQ A;  1EYD A;  1BXT A;  4UAI A;  5COR A;  1SYE A;  4KKU A;  1LTS D;  1O7L A;  1RCV D;  2EVB A;  5E1F A;  3K5M A;  5JEA H;  2BDO A;  1ENA A;  4OGQ C;  3GV6 A;  4K2K A;  2F0W A;  2EJG C;  5CV9 A;  1EFI D;  3QWN A;  3MTS A;  4ULL A;  2LFN A;  2WB1 B;  2PZU A;  5C44 B;  5EBD A;  1F9R A;  1Z47 A;  2VXW A;  2B2T A;  2HCC A;  3RZD B;  3OWF A;  5CGK A;  1YNJ D;  5KIX A;  1LTG D;  4OO1 I;  2B2W C;  4G7O C;  2Z8L A;  1UEA B;  2N55 A;  1EEF D;  3D4D A;  4IUP A;  3A7A B;  5A2Q E;  5JEA G;  5T1G A;  4CKB A;  1STG A;  3SEB A;  4NW2 A;  4MHE A;  1CT1 D;  4FNF A;  2O2L D;  3G6J B;  1CK1 A;  2TMP A;  2XIW A;  1MD2 D;  4LMQ D;  2RDF A;  3NTI A;  2VNU D;  3VYS A;  1AW7 A;  1DOL A;  3EA6 A;  1EYA A;  4PMW A;  2QF7 A;  2F03 A;  3GTO B;  3SK5 A;  4I65 A;  4QUF A;  2NN6 H;  4RGT A;  1TVX A;  4P2C B;  1U4L A;  2DY7 A;  1IW7 C;  1RTN A;  4X3U A;  3H91 A;  2EYL A;  3QO2 A;  1JOQ A;  1KAA A;  4BA2 I;  2ICE C;  5BN5 A;  4WRD A;  1ILP A;  4A3K B;  4RCO A;  3J7A V;  5C6A A;  2E75 C;  4RKL A;  4PMC A;  5CV6 A;  1G8Z D;  2WP8 J;  1CHP D;  1ML0 D;  2HUG A;  2B2Y A;  1YNN D;  4C1N I;  2NN6 G;  1I4H A;  3EQL C;  3GP7 A;  3E0J A;  4CGY B;  4C1N K;  3GTK B;  3CU7 A;  4HN7 A;  2J0T D;  4XT3 B;  1AZP A;  5T1I A;  4A3G B;  2EE1 A;  3MWY W;  2D62 A;  2A73 B;  2G9H D;  1F2L A;  2XSC A;  4RWS C;  3X3N A;  1SE3 A;  4F88 A;  2SEB D;  4H13 C;  3OOC A;  1PTO B;  4R8I A;  2OT2 A;  2MUY A;  3S1M B;  3HZX A;  4RHS A;  3RLF A;  3E5S A;  4LJZ C;  1HTP A;  3I4L A;  5CR3 A;  1H9K A;  1VDZ A;  1FYC A;  1BUV T;  2K6A A;  1BO0 A;  1ESF A;  5DEH A;  1K83 B;  2WIN B;  2RBM A;  1XX8 A;  1RKN A;  4IUQ A;  1SYB A;  4ZKC B;  2A74 C;  1PZJ D;  1FNU A;  4J8Q A;  2NVT B;  1SEB D;  1TWH B;  2F0K A;  1SYG A;  3KLR A;  3NP8 A;  2C5C A;  2PZW A;  1LT3 D;  3AB9 A;  1HRJ A;  2AQ1 B;  3J7A F;  4PMB A;  2B2V A;  1BCP C;  1G91 A;  1CQV A;  2KHS A;  2KCN A;  2F0P A;  3HRZ C;  4RH6 A;  3D4R A;  4O42 A;  1I4X A;  4C3I B;  3A54 A;  5FLX L;  2FJ2 A;  1QNU A;  2A68 D;  2JP1 A;  1WTW A;  4DXG A;  3WOE A;  2F3V A;  1PFN A;  4RA8 A;  1KLG D;  3VR6 A;  1JC7 A;  2R6G A;  4I7Z C;  5BN3 A;  5M5X B;  5A35 A;  3NK9 A;  2PO4 A;  1A15 A;  1BDO A;  2MP1 A;  5M3M B;  1GJX A;  1BOS A;  1RD9 D;  3M4O B;  4N9P A;  2A69 D;  4PV1 C;  4G7H C;  5I2Y A;  2CW0 C;  1LTT D;  4KN4 C;  4IFD G;  5EKK A;  3QIA A;  3TP5 A;  3JAM L;  4M1U B;  5I9O A;  3R2T A;  1ET9 A;  4R8N A;  2IJ0 A;  1GUO A;  2IX0 A;  3GTQ B;  1WTR A;  2Q8I B;  3MXP A;  2CQA A;  1KTK A;  5C3E B;  3K59 A;  1HUN A;  2F0H A;  4DK1 A;  3J80 E;  2L11 A;  4XYO A;  1JWM D;  1BBX C;  2J7Z A;  1EQV A;  1W6K A;  5EJW A;  4BS9 A;  2RSO A;  3TBI B;  1SAP A;  4C3H B;  1O7Z A;  1EZ6 A;  3QB3 A;  3NWS A;  1DOK A;  2Z4I A;  5CBA E;  4ZQ3 A;  1DJR D;  3MXG A;  1EY6 A;  4A3D B;  1EZ8 A;  1QOH A;  4L63 B;  3W3A A;  2ZXR A;  4DK0 A;  1OXS C;  2B2U A;  1FD7 D;  5IT9 E;  5FO8 B;  1TWG B;  4XYQ A;  1Y69 U;  3GV3 A;  3FEW X;  1U4R A;  1QJO A;  4L6T B;  4KV6 A;  2KED A;  3VYU A;  4BBS B;  4DFA A;  4ZAI A;  1WVL A;  2PW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...