4RA8A

Structure analysis of the mip1a p8a mutant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
68
structure length
68
Chain Sequence
SLAADTATACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human CCL18, CCL3, and CCL4 reveal molecular determinants for quaternary structures and sensitivity to insulin-degrading enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords C-C motif chemokine 3
total genus 15
structure length 68
sequence length 68
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ra8A00
2FJ2A 1RTNA 1WTQA 1DONA 1HA6A 1ESRA 1MGSA 1LV9A 2MP1A 2KUMA 2RSOA 3MTSA 2DY7A 1O7ZA 1RTOA 3GV6A 4HAEA 1MSGA 1BNZA 2HDMA 4R9WA 5CORA 1CA5A 3TZDA 1X3PA 3I3CA 5DNFA 1WTXA 2X6GA 1F9RA 1F9SA 1X32A 4QUFA 1J8IA 5EQ0A 2HCCA 5EJWA 1DOKA 3FDTA 3G7LA 4IUVA 3R93A 2K28A 1CM9A 4QUCA 2B2WC 1ML0D 2KECA 3H91A 5EPJA 1QG7A 1A15A 2CVRA 2FMMA 2L9HA 5AFWA 1G2SA 2EOTA 3KBXA 1WVLA 3TN2A 5E4XA 1HUNA 1NR2A 1Q3LA 2D9UA 3UI2A 1F9QA 4IURA 1C8CA 1ILPA 1PDQA 1G6ZA 1U4LA 2FFKB 5T1GA 1QE6A 2HUGA 3P7JA 2B2VC 1B3AA 3DEOA 2K01A 5D14A 3F2UA 4ZK9B 1S4ZA 2RSNA 5T1IA 2J7ZA 4UAIA 2R3ZA 1M8AA 1EL0A 2IL8A 3N52A 5EPKA 1B50A 1VMCA 4U68A 2HCIA 5CMDA 1QNKA 2NZ1D 3IFDA 1KNAA 1DZ1A 2B2TC 3HP3A 1HFNA 1IKLA 2SDFA 2X69A 1XX8A 1JICA 1B53A 1KNEA 2KEEA 4IUQA 4XT3B 1IKMA 2B2VA 1GUWA 2KEDA 4ZKCB 4CJ0B 4CJ2C 2MJ8A 4RAUC 1O7YA 2KOLA 3DEPA 4IUTA 5CBAE 1PLFA 1EOTA 1WTRA 1TVXA 1BF4A 1NAPA 2H1EA 1PFBA 4R8IA 3I91A 4O42A 1HHVA 1E0BA 3MWYW 2HDLA 3IL8A 2NYZD 2L12A 2RA4A 1J9OA 1ZXTA 1EQTA 1NR4A 2FINB 2RVLA 5D65A 1MSHA 2NWGA 1SAPA 1IL8A 2XIWA 1WTWA 2EE1A 2L11A 1DOMA 2VXWA 3FPUB 1U4MA 1CA6A 2B2YC 4OIKA 4XT1B 1WTOA 4X3UA 5EKIA 3ONAB 2M2LA 1U4RA 3DM1A 4RWSC 5CBEE 2EPBA 2L4NA 1U4PA 4X3TA 1MI2A 2B2YA 4IUPA 4OIJA 1WTPA 2MPMA 1EIHA 1AP0A 3I8ZA 1BO0A 4ZLTF 2FHTA 4XDXA 1F2LA 1SSOA 3KUPA 5JJZA 2MGSA 1B2TA 1AZPA 2B2TA 4IUUA 1DOLA 2K05A 3Q6SA 5EPLA 1EIGA 2B2WA 3GV3A 1PFMA 4HEDA 4X3SA 1ICWA 3D6WA 5E4WC 1NCVA 1JE4A 2JP1A 4ZKBB 3QO2A 1HUMA 2K04A 2B2UC 1PFNA 2KVMA 4HCSA 2DY8A 2K03A 2N88A 2N55A 2B2UA 5COYA 1WTVA 1SDFA 4ZAIA 2Q8RE 1B4OA 3LWEA 1AZQA 1WD0A 1X3QA 4MHEA 4NW2A 1HRJA 1RHPA 4LMQD 2L1BA 4X3KA 2BDNA 2JYOA 1WD1A 2Q8TA 4DN4M 4HSVA 3SVMA 1G2TA 1BBXC 1RJTA 1ILQA 4CJ1B 1G91A 4RA8A 1XYIA 2K1BA 4MN3A 2X6LA 1RODA 3I90A 1F9PA 1HFGA 1VMPA 1O80A
chains in the Genus database with same CATH superfamily
1SNQA 2Z8LA 2NTSA 4NDXA 1HNXQ 2A19A 4B3SQ 4TSSA 3DHQA 4HAEA 3NTKA 1MIUA 4A3EB 2EY2A 3BVZA 3MXNA 1GOZA 3S1QH 1T9HA 1LACA 3D4WA 4GNXC 3VYSA 1Z7TA 3BVGA 1AE3A 3CQZB 4HIOA 5HGTA 3KBXA 1IYVA 1XTCD 4IZ8A 4DGZA 4CDEC 1W2BA 1WJJA 1KHIA 4LNQA 1X9NA 3HKZB 3CPWA 2DNCA 1EL0A 2R93B 1PMRA 1JJ2A 4K2KA 1MJCA 2F0UA 4FF4A 1HZCA 1TR5A 4OELB 1SYBA 1I4QA 3OW7A 4DNTB 4QF4A 5FOBB 3T1HL 2V1CC 3OHXC 1LTAD 1PLFA 2PCFB 3FKIG 3X3MA 4L5QA 1BDOA 4YCVA 4LF7L 1K83H 1KDCA 2YV5A 1LTRD 3S24A 2E8GA 2L12A 3H0GG 3GTMH 3S2DB 1J9OA 2E2DC 4KJNA 2Z1CA 1I4XA 4OO1H 2F0NA 5LMNW 2QCPX 4HIDA 2A6ED 1EEID 5IT9L 4NMZA 4LF5Q 2RCNA 3TMEA 4A3IH 1LLRD 1ZEQX 2O4XA 5HURA 3CRLC 1IYJB 1IBKL 2UUBL 3A5ZB 2MPMA 1WI5A 1K8GA 1PRTD 5IYCH 4LUVA 5I2YA 4P72A 4LF9L 3Q6SA 3BDCA 3VYTA 5EPLA 1STHA 5M3FB 1BKBA 1QUQB 1TS3A 2OCEA 4A3BH 1TWCH 4KV6A 3G48A 5C6AA 2JP1A 4HJ7A 3NK9A 3GTLB 1FVIA 1SDFA 1WTVA 4I7ZC 4L5SA 1ICFB 3WDNA 1GUOA 4GOPC 1HNXL 4IJHA 4CJ1B 4J15A 5FLXE 4A3KB 1Q90A 2IX0A 2EZVA 4DR7Q 4WORA 2LSSA 1IW7C 2MHVA 1BQQT 4A3GB 4I7AA 1Y1VG 1CKNA 4BBRH 4QUFA 2JA7B 1J8IA 1X65A 1Y1WB 2EY5A 3GTGH 1N9WA 3FDTA 4B3RQ 3I4LA 3CCMA 1VF7A 4ILWA 3CCSA 1PTOB 1GD7A 1SYDA 1F9QA 4DR2Q 3P75A 2ZM6Q 1U4LA 4RGNA 2MUYA 1YITA 1IBKQ 3HOZB 1VQLA 4ZK9B 3OMGA 5EGTA 4BXXH 1PHJA 4QL5A 1EWCA 1GUTA 1I4RA 1D5XC 3BZKA 3T1HQ 2Z4IA 1B9MA 4H0LC 4GKKL 5CC4A 2K50A 1VQHA 1CKMA 2EYPA 3L9AX 4LW1A 1IKMA 2PI2E 2I07B 2PZTA 4UP9A 3T1YL 1S72A 3H3VH 1A3VA 3R2TA 1Q46A 1S5CD 4PNYA 4CJ2C 3U9OA 2WV6D 2JA5G 1EOTA 2YTVA 2JA9A 1CQVA 1ET6A 1EY8A 5A35A 4A3LG 1PFBA 4IPDA 3MXPA 2JA5H 5DEHA 3K0YA 5ELFA 1B7YB 3PO2H 1VQBA 5FJ8H 4DNIA 3ULPA 2JEBI 4IFDG 4DAMA 3WOEA 2B2YC 2A69D 3DWAA 2GA4B 2TMPA 4IO9A 4N9TA 3W5OA 2QA4A 1W3SA 4OIJA 3HKZE 1VF5C 1F2MA 4KY6A 1HQRD 5C0XJ 1UWVA 2OF1A 2ZXPA 3KLRA 3I4MG 4A93H 2B2TA 1CZWA 2K05A 3I4NB 2Y0SB 3D4RA 1PFMA 2VL6A 4HJ5A 4JI3Q 2K5WA 1TIID 4A75A 3JAMi 4B3ML 1B70B 2SNMA 1HUMA 2L5TA 3I4OA 2N55A 4N8FA 5M3MG 3TEHB 4Q5VA 1Y1VH 2B39A 4BBRG 4MIUA 1YNJD 2E2HH 2IJ0A 3SVMA 4OO1I 4R4QA 4BY1H 3F2BA 2K1BA 2SEBD 3I90A 1EU3A 3C1FA 1STYA 1OXUA 5FLMH 4GS3A 1VQJA 4QY7A 1EWHA 1KIXA 3UDXA 3BJUA 1RCVD 5ELNA 4JI2L 3GTJH 1VQMA 3T13A 5C44B 4A3FH 2HHHL 2OWOA 2UXCL 2IY5B 1F9RA 4DV5L 1PRTB 4O1NA 1BR9A 2K5VA 3R93A 4ME5A 3AQQA 4DR4Q 3H91A 1UE6A 1U0LA 4K8IA 3A5UA 1GVPA 2H4OA 3K7AB 4BBSG 4L63B 3S14B 3PUVA 3JAML 1TWAB 2F3IA 1KD1C 4M8AA 2VW9A 2EY6A 2WIIB 2M9VA 4A3KG 5C4HA 3ERQA 2Y0SE 3NQTA 3J80E 3AB9A 1A2TA 2KHSA 4X64L 3VDYA 2QEXA 4H44C 4FXGC 3M4YA 4ZKCB 5I9OA 2JA7G 2I5LX 1VQ7A 1O78A 2JEAI 1HNWL 4R8IA 2R61A 1SJED 1GUNA 4FF1A 2RA4A 3P20A 4JOIC 4LUOA 4ABNA 3T4AC 1FD7D 4CDFC 5DM73 1S5ED 1L0YB 5BN4A 1WTOA 1SEBD 3I72A 4RGTA 2JA6G 2A68D 1R4QB 2V4DA 2OTLA 1VQ5A 1D1IA 4A3DH 1N36L 3J7AF 1JQYD 4JI7L 2YU9H 1PTOF 3NTHA 4CHTB 2NVXH 3MFYA 1TS5A 5KNCA 2F0OA 4C3HH 2E2JH 4C2MH 2EVBA 2KVMA 3FRPB 3A7AB 4NPSA 4CGYB 4DUYL 4NXNL 3M4OB 3F2CA 1K9MC 5M5YH 5BN3A 4ALPA 1HRJA 2EXDA 1KAAA 2C35B 2BDNA 3PMFA 5IP9H 3HOXG 2OT2A 4GNXB 1SMYD 5M5XB 1X3GA 4JI0L 4C3IG 4PG3A 1SNDA 1DONA 2LXKA 4PZ7A 4ZCKA 4X64Q 3PIPA 1XMOQ 2MP1A 4O2DA 1O7IA 4GN5A 4C3JG 4DV6L 4LF6L 3K0XA 3Q8DA 4DR6L 5DNFA 1A8VA 1D1KA 5IODA 1W6KA 2M00A 1SNOA 1X32A 2QILA 1ET9A 4PQXA 4B9XA 3FMCA 2FMMA 1HUNA 3F2DA 1S5FD 1SN8A 4OEMB 4UHVA 2DJGC 2KCTA 1EZ6A 1PDQA 1Q7YC 4WJ3M 4LFBQ 3BS1A 2FFKB 2ZJPA 2NZOA 1AN8A 2RSNA 3K58A 1N32L 1N36Q 3T56B 4JI7Q 2FMCA 1E3PA 4U68A 3PV0A 1LTTD 4P75A 2F1MA 1VQ9A 1SYGA 1I3QH 1JICA 4KHPQ 1SJHD 5BR8L 1VQIA 4RGMA 5JEAJ 4QGUA 1NTGA 1YNJC 4J1MA 4DV2L 1UEBA 1Q1EA 1STNA 1NE3A 3DEPA 3OOCA 3RZDH 2IHFA 2Z6KC 2H5XA 1EY7A 3OSOA 1I6VC 4RMFA 4JI5L 1EFWA 1Q8IA 2JN4A 2D2CC 3TQYA 3WOFA 4IOAA 5D65A 5AJ3L 3SR1A 5M3MH 1IBLL 4L6TB 3S16H 3FEWX 4ZUIA 2A1AA 3CW2C 3PO3G 5EKIA 5C4XH 1RL2A 4P2CB 2CW0C 1I94L 1HTLD 3C2PA 3K8AA 3GTQH 1JWSD 1VS0A 3KUPA 2SNSA 1J6QA 4JI4L 4A3CG 2MGSA 2A73B 4NXNQ 1B2TA 1AZPA 1TWFB 4FF3A 1XPUA 2B2WA 4A3EH 4G7OC 2EQSA 4R4IA 1LTLA 5GROA 4DUZQ 3I2ZA 3EQLC 2ZT9C 3MFGA 3VA7A 3HOVB 4KHZA 3KF6B 4K6LA 2E5LL 2EJFC 4BY7H 2L1BA 4LFAQ 4JI1Q 3QOLA 1JT8A 2O5IC 5IGCA 3M4PA 2FXQA 1RKNA 5DLQE 2BCOA 1WTQA 4JI8Q 3STBD 4DF7A 1K73C 1EZ8A 5DM63 2PQAA 4B3TL 2K5HA 1IL2A 2F0PA 2R7ZH 1QOHA 2UUCQ 3J7A5 5JVG3 3H3VI 2NVYH 4EQOA 1V43A 2IX3A 2HT1A 1WTXA 4FVMA 5CV5A 2X6GA 2F4IA 4KJOA 4YY3L 2SOBA 2K28A 4BXXG 5EPJA 1B8AA 1FNUA 4ZYSA 1EFID 1NBWA 1CHPD 4HCEA 1K83B 1R9TB 1A2UA 4JBKA 4RCOA 4IUNA 1XNQQ 1Q1BA 3S2DH 2B2VC 1WOCA 4YCWA 1II3A 4NB3A 1YIJA 4KD4A 3AFPA 1M8AA 2RDFA 1TY0A 5CV9A 1V8QA 1WCMB 2KCMA 3HP3A 1SYCA 1D8LA 5D3DA 3K5OA 2B2VA 2WB1B 3CCJA 3I70A 5CV4A 3HFZB 1TY2A 2UXDL 1GM5A 1TVXA 1VQNA 3RR5A 1FL0A 2F0HA 1MHWC 5FO7B 4IPCA 4DV0L 3IL8A 5IGGA 2Z6KA 2FINB 2E75C 2K4KA 1PRTC 1N8RC 4QCLA 1SAPA 4GOPB 3D6CA 3HOYG 1QCBD 3S1RB 1WTPA 2DN8A 3BVMA 4ZLTF 4R4OA 3A56A 5IYCG 1SFOH 3UDGA 3DLLA 1UEAB 1AE2A 4JV5Q 2R7FA 3GV3A 1ENCA 1F2YA 2MO0A 4IOCA 3C46A 1CT1D 3NPPA 4DNRB 1YNNC 2WINB 1BOSA 4C3JH 2K5DA 4A4IA 5M9OA 5LMNL 3H0GH 3I4MB 4GLXA 1PYSB 2KHJA 1K0RA 1JJCB 3I4NG 2F0QA 1F2ZA 2JA6B 1DD2A 2NZHA 2CH4A 3GTOB 3FKIH 2X6LA 1DCZA 3EIVA 1H9RA 4PMWA 4H02A 2IX1A 3GTPB 2ID0A 1TQOA 1RDPD 5LL6S 1O7ZA 4LF9Q 2UXDQ 3K80C 5IYBH 3I3CA 5KNBA 2ZXOA 3CKIB 3M7GA 4FDBA 5EQ0A 3S1MB 4DV4Q 4X6AH 3TSSA 1A15A 5JJLA 4KKSA 2JA5B 3K59A 4B08A 2EDGA 1KAWA 4XQJA 3PO2B 1EQVA 2XRQD 5I6WA 2J7ZA 3QWNA 1QVFA 1HZ9A 2JA8H 3CD6A 2NVQH 5G3LD 1SRUA 2NZ1D 3S1NB 2CHBD 1LT4D 3OTOL 3OIPA 1SNMA 2BOSA 2B3GA 3TS2A 4LJZC 2KOLA 4JPBW 4CDDC 3NE5B 2KCCA 4H7BA 3DUZA 3PQIA 4MNOA 3ICEA 1SBBB 2EE1A 1Q86C 4Y7NH 1UAPA 2JE6I 4L8JA 5KIXA 4RWSC 3PUYA 2JA8G 4X3TA 2LKVA 1EOVA 2FHTA 1A3UA 1F2LA 5C4JB 3HGBA 4KY7A 3IFTA 5JJZA 5C3EG 2OQKA 4IUUA 2XNAC 1EUJA 4X3SA 1OXSC 1K8OA 2F52A 1NCVA 3TP6A 1Q82C 1IW7D 4HIMA 4JOIA 1JWUD 1S40A 1IBML 1PTOC 1YBYA 2N88A 4X66Q 4FP5D 4DAYB 2BH2A 2XWBB 2JYOA 4JW0A 3K7AH 3VR2A 2B8FA 1G2TA 4OX9Q 1KRTA 1H9KA 2IHEA 1X54A 3CCQA 2ES2A 2CWAA 1PTOD 3HEJA 3IAYA 2F0MA 1QB5D 2FJ2A 4MTKA 1Y8PB 1MGSA 5JVH3 2PPBC 1DYQA 4IFDI 1QUQA 3KJOA 2EYMA 5I4DA 2QKIC 3TZDA 4LF7Q 2A69C 3E3XA 5KYIA 1A3TA 1FGBD 3N6RA 3G7LA 1ZKOA 3STBC 5C0XH 4F8MA 1XPOA 1YHBA 4KMUC 3HOWB 3AU7A 4HN7A 5E4XA 5TSSA 5C3WA 2WAQB 2WB1G 3HKSA 4HJAA 1Q81C 1QE6A 4Q0FA 5CR3A 3EN2A 5GAHC 1CZGA 1UNSA 2K01A 3DEOA 3F2UA 3J81j 1S3OA 4JBJA 1SMYC 1KTKA 2WAQE 4IPHA 3OTOQ 4I65A 2I5HA 1BCPB 1YNXA 4A3DB 1DZ1A 4JI2Q 2HQEA 4GNXA 2VNUD 1XX8A 1V9PA 2CQOA 1C0AA 2ASBA 1CHQD 2Z0SA 3AMUA 1Y8OB 1YHAA 3A74A 3IRBA 1PVOA 2E2JB 1EYDA 3G6JB 1BF4A 1K8MA 1TT2A 2IT1A 5M5YB 1NR4A 1LTID 2XSCA 4DV1L 1C48A 2NWGA 4DR5L 3Q23A 1WTWA 1CA6A 2XN9C 3QIAA 2NVTB 3HOYB 4XIGS 1VDZA 4R8NA 4V190 2O2LD 3U50C 4XQQA 2ZJRA 3CAMA 1X3EA 2NUCA 2C9OA 1Y14B 2DJFC 2DNEA 3D31A 4EQPA 1ICWA 3K5LA 2BDOA 1BVSA 4YWMA 2PI2A 4RCNA 4OX9L 3HOXB 3CC4A 1LT6D 1NSNS 3F8TA 1WD0A 4NW2A 3E5SA 5KRUA 3RUZA 3TREA 4DU9A 3MC0B 4HSVA 4MZ9A 2F0EA 5CV7A 3T1YQ 1I50H 4DV3Q 2R7ZG 3O13A 4R1JA 4RA8A 1XYIA 1J5EQ 1O80A 3J81i 3TP8A 2EYJA 4FXDA 3DM3A 5CV6A 5K36G 3MTSA 1MSGA 1TKWB 3NBHA 1K8AC 2VQFL 1CA5A 1ONLA 2GVBA 2QF7A 4A3BG 3KFUA 1VQ6A 1ASYA 1AH9A 2RF4A 1VQCA 1CM9A 4DV1Q 5I6YA 5KGUA 4DR5Q 4FXKC 3J80L 4A3EG 4CKEA 1JOOA 1SE3A 5A2QE 1M4VA 1XJVA 4HJ9A 3S17H 2D5DA 4EQ5A 5M3MB 5T1IA 3PIP3 3PIOA 4O0AA 3JAME 4JI3L 3TP5A 2XVSA 1QVGA 4DAVA 2AQ3B 5C4XB 3UDIA 4QQBX 4DK1A 2OEOA 3GO5A 3UE0A 4XQNA 1I6HH 4KHVA 2ICEC 4DFAA 1KC8C 3B6YA 1CKOA 3RMHA 5C3EB 3GTQB 2SDFA 1TWHB 4NP5A 1GUGA 3U9SA 5M3FG 4CJ0B 2RQXA 2KA7A 2VUMB 2LMCB 3A7LA 3J81c 1C9OA 2ZJQA 4UPAA 1KDBA 3C1EA 2IW3A 1EYGA 3V96A 3HOVH 4G7ZC 2BE5C 4BY7B 2LS01 1YNND 1SE8A 3SK4A 2VY3A 1PV4A 1TS4A 4K8JA 3TZUA 1U4RA 1V1QA 2AMCB 2EPBA 5FO9B 2E2IH 3HRZC 2VQFQ 2F03A 1P16A 1SNCA 4KHPL 5BR8Q 2HD3A 3DMUA 2Z6BA 4CBVA 4G57A 3KBGA 4DPGA 1M1KC 4QB4A 2B8GA 4GZYC 3D3RA 5ELEA 4ZKBB 3L0OA 1ZYRC 5IIFA 3CQZH 1C7YA 2G5DA 1RF2D 3E6ZX 3E0JA 3OWEB 3PCOB 3NWTA 1ASZA 3SE0A 3W2DA 2B63G 1TWGB 4YHHQ 1ILQA 1F77A 2LXJA 4DR4L 4MN3A 2B63H 1HFGA 3ND9A 1H9SA 1HA6A 1VQGA 4JBWA 3I7FA 5LMUQ 2R93H 3VR5A 1WCMH 2EYHA 2KBNA 4JCVE 3J7AV 2K75A 2ATWA 4DK3C 4BBSH 1PA6A 4RHRA 2QW7A 1RIPA 2CFMA 1QG7A 1T5XD 1D6EC 4OWWB 2CVRA 3T51B 3TN2A 2VQEL 4JG2A 1Q3LA 2EJGC 1PXUA 4Z9CB 3J81E 3GTMB 3J80i 3P7JA 1QVCA 4K5WA 2CH4W 3RLOA 1N34L 1HZBA 4DR2L 4LF8L 4DAPA 4A3IB 4K0KQ 1EY4A 3KLSX 3CU7A 5IYBG 4ODGA 2HCIA 5M5WH 2F3WA 2KENA 1CK1A 4BY1G 5EBDA 5M3FH 1K0SA 4A3BB 1NMGA 3EFXD 5CBAE 2F4VQ 4AH6A 2R92B 2D0OA 3OYYA 1WTRA 4C3JB 3H3VC 5J22A 1XNQL 2EYLA 5A2QL 3SDZA 1GHKA 2RVLA 4BA2I 1B9NA 3I4MH 3FPUB 1UUPA 4RG1A 4X3UA 5FKAC 2E74C 3FKIB 4X65L 4DV6Q 4A3KH 4LF6Q 1MI2A 1VQOA 2PMZE 3OIQA 2CCZA 5JJKA 2F3VA 2MFIA 4YCUA 1STBA 1PH1A 1XNRQ 1D5MC 5FK9C 1V1PB 3G4SA 1E22A 1VCIA 5E4WC 5FJ8G 1SE2A 4HEDA 1QZHA 2VQEQ 3KJPA 4QMGA 3QJYA 3QO2A 1SLJA 4DV0Q 1OO9B 1PH9A 4DXGA 2F0IA 5C5MA 1E2WA 4K6DA 4PV1C 1RHPA 2PYKA 4LMQD 4GN4B 5LMNQ 4LF8Q 2Q8TA 2ZTCA 2L55A 3S15B 1BBXC 5LMUL 5ISRA 1DJRD 1MD2D 5IT9E 2HQLA 4V0BA 4AQYQ 2J0TD 4FF2A 1CTMA 3SK5A 1KLGD 5GQOA 3GD7A 4WRDA 1XMQQ 2NVQB 2DY7A 1PYWD 3CF5A 1FNWA 3S1NH 3D8GA 4TVAB 1B44D 5EKKA 4JC0A 4NXMQ 4LAAA 3R2IA 1JOQA 4IUVA 4A3MG 1LT5D 3AYHB 2B2WC 3GTLH 1JMCA 2K7VA 2RDHA 2Q8IB 4MTNA 2MO1A 3HZXA 3TRZA 3G6EA 3KK7A 1SYEA 1B3AA 4HSPA 4RHSA 4LFCQ 3NEMA 3AEVA 1XTDA 1VQAA 4Y7NB 1YJ9A 3H09A 1B50A 1K3RA 2WAQG 4YIJA 5CMDA 2PW7A 1KNAA 2B2TC 4A3GH 4DUZL 3K5NA 4IFDH 1CKNB 2KEEA 5ELDA 2A74C 2AHOB 4BBRB 3GTGB 2C5CA 4K2LA 4A93B 1JOKA 1I94Q 1BCPF 2XTIA 4J8QA 2PO4A 4A3LH 1PTOH 3S2HH 1E1TA 1X6OA 3RZOB 4K5XA 1HXYD 2HDLA 2NYZD 2QGQA 2WKCA 3RLNA 1WFQA 3U58A 4HR7B 4BY7G 2K5NA 1P8LA 4IFDJ 1Y1VB 3Q24A 3CCVA 3M7NA 2XIWA 4A76A 1L1OA 5IT9c 1PZID 3HOUB 3DM1A 2K6AA 1QILA 2WKDA 4IUPA 1PH3A 3F1ZA 1PZKD 1OTCA 4A3JH 4A3CH 1JC7A 1SSOA 4X62L 5C0XG 3FP9A 1V1PA 3M85A 1L1OB 3HS0C 4E6IA 3V2TA 5IGDA 3CCEA 5KYLA 2B2UC 3PGZA 4A3MH 2K03A 3VYRA 3RLFA 5COYA 4DKAC 1HNZQ 3LWEA 2PQAB 3HOWH 4ULLA 2PNHA 1T5EA 4AQYL 4UY8C 4RGOS 4X3KA 2NN6I 5E7NA 3JAMc 2HIXA 3P1HA 2R6GA 3SHLA 2NB0A 3J7YW 1UE1A 1HH2P 2HIVA 2EIFA 2KUMA 2PQEA 2RSOA 1CSQA 1QWYA 2A68C 4DK6C 1Q12A 1PRTF 2F0JA 1EY0A 1X3PA 2WFWA 3H94A 1PH4A 1LO5D 2BA0A 1EWIA 1IBMQ 4XYOA 4XTCS 4QUCA 2BA1A 3PF4A 2AKWB 2ICIA 1KL9A 3BZDB 1Z6HA 1KQSA 1PH2A 2WACA 4WJ4A 5LHY1 2E2HB 1QNUA 3NTIA 4QIWB 3K81C 1S4ZA 3CHBD 1HJPA 2F0SA 4UAIA 2NVTH 1ZYRD 5JPNC 3L7ZC 3M3YH 2F0KA 1IZ6A 1KABA 4JV5L 1EQQA 1HZAA 3GTJB 1HFNA 2X69A 1JB3A 1KNEA 3D0FA 5GAGC 2Y0SG 4CKCA 5J1ZA 4B3SL 4IUTA 4XYQA 4C3IH 2OTJA 3A55A 2Q2UA 2H1EA 4C2MB 2I0QA 1G51A 1IXRA 2D0PA 5EKLA 1AEXA 1Z47A 4K14A 3HOXH 4GOPA 3M4OH 1S5DD 4N8X1 1ZXTA 2ZTEA 3HOUG 3S14H 2EYOA 3MHBA 1K3BC 3EROA 1TWAH 4P74A 2F0GA 4X62Q 1UE5A 2RHQB 3KLSA 5ELCA 3ONAB 5M5XH 3KYHC 4JI6L 5AJ3Q 1VQFA 4PMCA 2Q2HA 4EVOA 2F0LA 4Y52H 5IGBA 3ITPA 2D62A 4DV4L 1Z9FA 2PZWA 4N9PA 4A3DG 5HY6A 3IKJA 4LUZA 4TKOB 1X56A 1DM0B 5FLXL 1CUKA 1OXXK 2N49A 2G9DA 2ZTDA 4ID6A 4MHEA 2CW0D 1BBWA 3RN2A 1JJGA 4DN4M 3VR4A 3U4ZA 1RJTA 3KF8B 1I4HA 2P5ZX 3KF6A 4DV3L 2E5LQ 1HCZA 1RODA 3NELA 1VMPA 3LWUA 4DR1L 3GTKB 1GO3E 1RTNA 2VB2X 2AUJD 2JJQA 3PO3B 4DV5Q 2VB3X 5CGKA 3GQBA 1I6HB 3Q22A 2GN5A 3A54A 3A8KE 3K5MA 1I3QB 1TWHH 3OPOA 4F88A 3QR8A 1FJGL 4JK1C 3A8IE 2HCCA 3BDOA 2XRSD 2AWNA 2L9HA 3CRKC 3NUCA 3NHHA 3OWFA 4DR7L 2VUMG 3UI2A 2F0TA 4OXPA 1ILPA 4P71A 1B1ZA 5T1GA 1OXTA 4F7XA 5JEAH 2AQ2B 1FGUA 4TRDA 3H6MA 1D5ZC 1YZ6A 1VQDA 1JR0D 3CP0A 4L5TA 2R3ZA 1WYDA 3ULJA 3N52A 5EPKA 2NN6G 4A3FG 1STAA 4X66L 2YTYA 3IFDA 3UDFA 3BYTB 2WP8J 4IUQA 3FVQA 4M1UB 4QJFA 1EEFD 3HOVG 1MJEA 1TWFH 5FLMG 3TP7A 3URYA 4KLKA 3LNNA 3QG1A 1PH8A 1VQ4A 1HQMC 4JI6Q 4POGA 4GKKQ 3U4VA 3FHWA 1EQTA 4UP7A 2JXMB 5I9PA 1Y8NB 4GN3B 2VXWA 2B29A 4LK1C 1TWGH 3R8BA 3SGIA 3NENA 1VQ8A 4KN7C 5CBEE 2L4NA 2B63B 4A93G 2KCNA 4YWLA 1BO0A 4DA2A 4DR3L 1AW7A 2R7ZB 4A3JG 1E2ZA 1EYAA 1DOLA 1SROA 3PF5A 4OWTB 3RNUA 2A6EC 4RKBA 1L2FA 1IYUA 1L0WA 1FYCA 2GVAA 2DY8A 2R7DA 1MBYA 2Q8RE 2F0DA 1KRSA 2OXPA 1R9TH 1D2BA 1WD1A 1XWEA 1XMOL 3KDFB 2UU9L 3L2PA 2EYFA 4U673 1FJGQ 1I5FA 3KOJA 3ER0A 3GP7A 3PUWA 1G8ZD 1RTOA 2JK8A 3E9IA 4A3GG 2YYZA 5M5WB 4G7HC 4YWKA 1H9SB 2CWPA 2AWOA 2K52A 1M90C 2K32A 1PH6A 1ML0D 1TXYA 2KECA 2R92H 4IALA 1G2SA 1R4PB 1O7LA 3BDLA 1G6ZA 5K5PA 3BG3A 4R4CA 1YI2A 1YJWA 1JWMD 1YEZA 2HUGA 4OGQC 4BS9A 3FPPA 4ZUJA 4KKTA 2N78A 2PW5A 4GKJL 1G6PA 2YTXA 2A5HA 2UUBQ 2G9HD 2QEJC 4QIWE 1PFSA 3QOJA 3S1RH 3NBHB 3CMEA 1IHZA 2NVYB 1B3QA 1NJIC 3MVVA 1PH5A 3S1QB 3ZYYX 2ZXRA 3DWPA 2MJ8A 4RAUC 5CYUA 1N33Q 4JYAQ 3BZCA 4RH6A 1DXMA 2F4VL 2CQAA 2HHHQ 2PZUA 3LX0A 4HIKA 1HHVA 3MWYW 4JVZA 2NN6H 1MKHA 1U5KA 2UU9Q 3H0GB 1IL8A 3LGJA 1N34Q 1NMFA 1SXTA 5EAYA 3CMAA 3S15H 2Z4HA 2NTTA 5JEAG 2M2LA 3GTOH 1VQEA 1TU2B 4J6HA 5JJIA 3ERSX 4IPGA 3GTPH 4XDXA 2DGYA 3PUZA 1PYBA 2I5MX 3TDQA 3A8JE 4ME3A 1J5EL 1EIGA 2CKZB 5IY0A 1EIFA 1OXVA 2BH8A 3HKZG 4LFAL 3VA5A 3EBEA 4B3RL 4KTAA 4ZAIA 1KXLA 4OO1G 1AZQA 3PSIA 4G4KA 3BYYB 3W1BA 4DXFA 1Y1WG 1CFMA 1E7ZA 2XGTA 1TS2A 2KJXA 2XWJB 1STEA 3MXUA 4KKUA 1F9PA 3NWSA 4HJ8A 3G71A 5IP9G 5E1FA 1HNWQ 1SYFA 2JA8B 4OHJA 1ENAA 3T16A 1SFOB 4KN4C 4BWGB 1N33L 4IQZA 4JYAL 2HDMA 4R9WA 1TWCB 1JB7A 4AYBB 4C3HG 5EJWA 2F0VA 1KDAA 4FNFA 4JI0Q 2UXBQ 1D7QA 5AFWA 1ENFA 3S2HB 1NUCA 3RZOH 1NR2A 4GKJQ 1GXDC 3M4QA 4B9WA 2ZM6L 2AUKA 1PH7A 1C8CA 4LF4L 4AYBE 2JA6H 1JCKB 3OMCA 1LUZA 4IN3A 2MNAA 5D14A 4DR6Q 1STGA 2KHIA 4UP8A 1SR3A 3TS0A 2N8NA 1BBUA 5D3IB 3J81L 3VR3A 1XPRA 3HOUH 3J80c 2OQ0A 3I73A 2K33A 2EJMA 3ULLA 4A3JB 2A8VA 5ELOA 5C4JH 3V05A 4P73A 2JA7H 4HMJA 4HTHA 4WJWA 2Q2IA 1Y1WH 1GUWA 1H9MA 4CDCC 4LWCA 3S1MH 3MXGA 2ALYB 4KI0A 1N32Q 4C56C 1BUVT 1NAPA 3ZJYC 4YHHL 3I91A 4B3MQ 3M9BA 1E0BA 3NQIA 4A3MB 1VQKA 2QDBA 1EU4A 3HOZH 2A6HD 1U9RA 5IYDG 2E76C 2J4XA 1V1OA 2NBFA 4LFBL 1E24A 4DV2Q 1NNXA 2B2YA 2AQ1B 4PZ8A 1AP0A 5LL6X 3SK8A 3HG9A 3CPFA 1XXGA 4H13C 5IGEA 4DV7L 3KF8A 1IBLQ 4EX5A 1LABA 5JAVA 1H9JA 3MXNB 3PUXA 1L0XB 1PFNA 2K5QA 5F2DA 4OWXB 3K57A 1B4OA 1YJNA 1HNZL 1FR3A 3EVQA 4XXEA 1E1OA 3EJIA 2PMZB 4JI5Q 4FO2A 4GLVB 4EGVA 1I4PA 1SMXA 1ESRA 3HOWG 3M3YB 3CCUA 1QZGA 1LV9A 1GKHA 2TSSA 3MA2B 5DAUA 3WWVA 4F87A 3RN5A 3GV6A 2RBMA 2UXBL 5GAEC 3I4NH 1A62A 1KLUD 2UXCQ 1GHJA 2O5JC 3I56A 4LF4Q 4K0KL 1QJOA 4K5VA 1DOKA 3MZ5A 5FLXc 4JI4Q 2N3SA 4C3IB 2WB1E 1SE4A 5C0XI 5G3LF 1BCPD 2D9UA 2VS1A 4IURA 3CCLA 4DAYA 4X65Q 3E0EA 1CSPA 2Z9HA 1UE7A 4BY1B 5IP7G 1HTPA 1JE5A 4CKBA 2UUAQ 3NSWA 4TQUS 3W3AA 3HOYH 3PO2G 2IL8A 1AFPA 1VMCA 4S3SA 4DV7Q 5NUCA 3J7ZC 5JOBA 2EXZA 5KEEA 1IKLA 4XT3B 1S5BD 4ZQ3A 5C44H 4A3FB 1L1OC 1SNPA 4JI1L 5K36H 2PNRC 3K6OA 4BA1I 4WFN3 4OONA 4JBMA 1C4QA 1Y69U 2L0CA 3KLWA 4UDUC 5CV8A 1K28A 4JI8L 5H1SE 4O42A 1VQPA 2I46A 5JPMC 4DUYQ 2LFNA 1XMQL 1HA5A 4POFA 1MSHA 4APVA 1YVCA 3AFQA 1DOMA 1U4MA 5IWAQ 3SXHA 4NXML 3W1GA 2IWHA 1EY5A 3Q0AA 1U4PA 2ENBA 4L5RC 3MEHA 5C3XA 1EIYB 1A6XA 3GTKH 3H15A 3DXJC 3PO3H 1WTHA 5IE8A 1H95A 3S9WA 3D6WA 5EBCA 5IOCA 1JE4A 3I55A 2R92G 1PZJD 2K04A 4HCSA 2B2UA 3NP8A 1EY6A 1X3QA 1Q8KA 4LFCL 3D4DA 2VZAA 1EYCA 2UUAL 2F0FA 5BN5A 4FYDA 4KY5A 1E2VA 2EY1A 3S17B 5J3BA 3MEFA 3MAQA 3K7UC 1G91A 1X3FA 2BE5D 1X55A 5E3FA 1RD9D 3EA6A 4DR1Q 2YU9B 5C4ZA 1LT3D 2NVXB 1LYLA 3QB3A 4R4TA 2F0WA 2MQHA 3SEBA 5C44G 2RHSB 5GADC 1BNZA 5FO8B 5CORA 4AYBG 4C3HB 2A6HC 3ND8A 4GLAC 1F9SA 1YHQA 4DK0A 4PZ6A 1A0IA 2LY7A 1EY9A 3A0JA 5IP7H 4KK7A 4AIMA 2EOTA 1WVLA 1CQFA 4ZRZA 4KD3A 2JQOA 3TBIB 1I50B 1JORA 4A3IG 3JC66 5ELBA 1HR0L 3RD4A 2KQ3A 5IGFA 1GUSA 3CXCA 5C4XG 1DGSA 1QNKA 2E2IB 4EQNA 5I2XA 1B53A 3PIO3 2RDGA 3KDFA 1I4GA 2KEDA 3VYUA 1O7YA 4C1NI 4IJLA 1NY4A 4RFBA 3OW2A 1ESFA 2RCFA 3CC2A 3VR6A 5IWAL 2IPKD 1LTBD 4OL7A 3T53B 4NKLA 2DUDA 3X3NA 2L11A 3GDEA 4OIKA 4XT1B 1CI3M 4HMIA 2QDLA 1BXTA 3BU2A 1FNVA 1EIHA 3I8ZA 4C1NK 3L3OC 5C3EH 2K14A 1BCPC 4DR3Q 1G291 4B3TQ 3E9HA 4PMBA 5HGQA 2UUCL 3CC7A 2Q2TA 1HPCA 2VUMH 3RZDB 1EQRA 1LTSD 1XNRL 1W6JA 3SK6A 5KNDA 4BBSB 1GJXA 3NXWA 3R3OA 5L37A 3DWQA 1WCMG 4YY3Q 1LM0A 1LTGD 3CCRA 5IYDH 2R93G 3HOZG 3UE1A 5J39A 1HR0Q 3C3LA 5C5LA 3S16B 1A63A 2JSOA 3NBIA 1HR0W 2RKSA 2L15A 4RKLA 4LF5L
chains in the Genus database with same CATH topology
1SNQA 2Z8LA 2NTSA 4NDXA 4TSSA 3DHQA 4HAEA 3NTKA 4A3EB 2EY2A 3BVZA 3MXNA 1GOZA 3D4WA 1LACA 3VYSA 1Z7TA 3BVGA 3CQZB 5HGTA 3KBXA 1IYVA 1XTCD 4IZ8A 4DGZA 3HKZB 2DNCA 1EL0A 2R93B 1PMRA 4K2KA 2F0UA 4FF4A 1TR5A 1SYBA 1I4QA 3OW7A 4DNTB 4QF4A 5FOBB 3OHXC 1LTAD 1PLFA 2PCFB 3X3MA 1BDOA 1KDCA 1LTRD 3S2DB 2L12A 1J9OA 2E2DC 4KJNA 2Z1CA 1I4XA 4OO1H 2F0NA 2QCPX 2A6ED 1EEID 5IT9L 4NMZA 3TMEA 1LLRD 1ZEQX 2O4XA 5HURA 3CRLC 2MPMA 1PRTD 5I2YA 3Q6SA 3BDCA 3VYTA 5EPLA 1STHA 5M3FB 1TS3A 4KV6A 5C6AA 2JP1A 3NK9A 3GTLB 1WTVA 1SDFA 4I7ZC 3WDNA 1GUOA 4CJ1B 5FLXE 4A3KB 1Q90A 2IX0A 2EZVA 4WORA 1IW7C 2MHVA 1BQQT 4A3GB 2JA7B 4QUFA 1J8IA 1Y1WB 2EY5A 3FDTA 3I4LA 1VF7A 4ILWA 1PTOB 1SYDA 1F9QA 3P75A 1U4LA 4RGNA 2MUYA 3HOZB 4ZK9B 3OMGA 5EGTA 1EWCA 1GUTA 1I4RA 1D5XC 2Z4IA 1B9MA 4H0LC 5CC4A 2EYPA 3L9AX 1IKMA 2I07B 2PZTA 1A3VA 3R2TA 4PNYA 1S5CD 4CJ2C 3U9OA 2WV6D 1EOTA 1CQVA 1ET6A 1EY8A 5A35A 1PFBA 3MXPA 5DEHA 3K0YA 5ELFA 2JEBI 4IFDG 3WOEA 2B2YC 2A69D 3DWAA 2GA4B 2TMPA 4N9TA 4OIJA 1VF5C 1F2MA 4KY6A 1HQRD 5C0XJ 2OF1A 2ZXPA 3KLRA 2B2TA 1CZWA 2K05A 3I4NB 2Y0SB 3D4RA 1PFMA 2K5WA 1TIID 1HUMA 2SNMA 2L5TA 2N55A 4Q5VA 2B39A 4MIUA 1YNJD 2IJ0A 3SVMA 4OO1I 2K1BA 2SEBD 3I90A 1EU3A 3C1FA 1STYA 1OXUA 1EWHA 1RCVD 3T13A 5C44B 1F9RA 1PRTB 4O1NA 1BR9A 3R93A 4ME5A 3H91A 4K8IA 2H4OA 3K7AB 4L63B 3S14B 3PUVA 3JAML 1TWAB 4M8AA 2EY6A 2WIIB 2M9VA 5C4HA 3ERQA 3NQTA 3J80E 3AB9A 1A2TA 2KHSA 4H44C 4FXGC 3M4YA 4ZKCB 5I9OA 1O78A 2JEAI 4R8IA 2R61A 1SJED 1GUNA 4FF1A 2RA4A 3P20A 4ABNA 3T4AC 1FD7D 5DM73 1S5ED 1L0YB 5BN4A 1WTOA 1SEBD 3I72A 4RGTA 2A68D 1R4QB 2V4DA 1D1IA 3J7AF 1JQYD 1PTOF 3NTHA 4CHTB 3MFYA 1TS5A 5KNCA 2F0OA 2EVBA 2KVMA 3FRPB 3A7AB 4CGYB 3M4OB 5BN3A 1HRJA 1KAAA 2BDNA 3PMFA 2OT2A 1SMYD 5M5XB 4C3IG 1SNDA 1DONA 2MP1A 4C3JG 5DNFA 1D1KA 5IODA 1W6KA 2M00A 1SNOA 1X32A 2QILA 1ET9A 4PQXA 4B9XA 3FMCA 2FMMA 1HUNA 1S5FD 1EZ6A 1PDQA 3BS1A 2FFKB 1AN8A 2RSNA 3K58A 3T56B 2FMCA 4U68A 3PV0A 1LTTD 2F1MA 1SYGA 1JICA 1SJHD 4RGMA 5JEAJ 1YNJC 4J1MA 1Q1EA 1STNA 3DEPA 3OOCA 1EY7A 3OSOA 1I6VC 1Q8IA 2D2CC 3WOFA 5D65A 3SR1A 4L6TB 3FEWX 4ZUIA 5EKIA 4P2CB 2CW0C 1HTLD 3C2PA 1JWSD 3KUPA 2SNSA 2MGSA 2A73B 1B2TA 1AZPA 1TWFB 4FF3A 2B2WA 4G7OC 3EQLC 2ZT9C 3MFGA 3VA7A 3HOVB 4KHZA 4K6LA 2EJFC 2L1BA 3QOLA 2O5IC 5IGCA 1RKNA 2BCOA 1WTQA 4DF7A 1EZ8A 5DM63 2F0PA 1QOHA 5JVG3 4EQOA 1V43A 2IX3A 1WTXA 4FVMA 5CV5A 2X6GA 2F4IA 4KJOA 2SOBA 2K28A 5EPJA 1FNUA 4ZYSA 1EFID 1CHPD 4HCEA 1K83B 1R9TB 1A2UA 4RCOA 4IUNA 1Q1BA 2B2VC 1II3A 4KD4A 1M8AA 2RDFA 1TY0A 5CV9A 1V8QA 1WCMB 3HP3A 1SYCA 5D3DA 3K5OA 2B2VA 2WB1B 3I70A 5CV4A 1TY2A 1TVXA 2F0HA 5FO7B 3IL8A 5IGGA 2FINB 2E75C 1PRTC 4QCLA 1SAPA 3D6CA 1QCBD 3S1RB 1WTPA 2DN8A 3BVMA 4ZLTF 3A56A 1UEAB 1ENCA 1F2YA 3GV3A 3C46A 1CT1D 3NPPA 4DNRB 1YNNC 2WINB 1BOSA 2K5DA 5M9OA 3I4MB 2F0QA 1F2ZA 2JA6B 1DD2A 3GTOB 2X6LA 1DCZA 1H9RA 4PMWA 2IX1A 3GTPB 2ID0A 1TQOA 1RDPD 5LL6S 1O7ZA 3I3CA 5KNBA 2ZXOA 3CKIB 3M7GA 5EQ0A 3S1MB 3TSSA 1A15A 4KKSA 2JA5B 3K59A 4B08A 2EDGA 4XQJA 3PO2B 1EQVA 2XRQD 5I6WA 2J7ZA 3QWNA 5G3LD 2NZ1D 3S1NB 2CHBD 1LT4D 3OIPA 1SNMA 2BOSA 4LJZC 2KOLA 3NE5B 2KCCA 4H7BA 3DUZA 1SBBB 2EE1A 1UAPA 2JE6I 4L8JA 5KIXA 4RWSC 3PUYA 4X3TA 2LKVA 2FHTA 1A3UA 1F2LA 5C4JB 3HGBA 4KY7A 3IFTA 5JJZA 4IUUA 2XNAC 4X3SA 1OXSC 1K8OA 1NCVA 3TP6A 1IW7D 1JWUD 1PTOC 2N88A 4FP5D 2XWBB 2JYOA 3VR2A 2B8FA 1G2TA 1H9KA 1PTOD 3HEJA 3IAYA 2F0MA 1QB5D 2FJ2A 1Y8PB 1MGSA 5JVH3 2PPBC 1DYQA 4IFDI 2EYMA 5I4DA 2QKIC 3TZDA 2A69C 5KYIA 1A3TA 1FGBD 3N6RA 3G7LA 1ZKOA 5C0XH 4F8MA 4KMUC 3HOWB 3AU7A 4HN7A 5E4XA 5TSSA 5C3WA 2WAQB 1QE6A 4Q0FA 5CR3A 1CZGA 1UNSA 2K01A 3DEOA 3F2UA 1SMYC 1KTKA 4I65A 1BCPB 4A3DB 1DZ1A 2HQEA 2VNUD 1XX8A 1CHQD 3AMUA 1Y8OB 2E2JB 1EYDA 3G6JB 1BF4A 1K8MA 1TT2A 2IT1A 5M5YB 1NR4A 1LTID 2XSCA 1C48A 2NWGA 3Q23A 1WTWA 1CA6A 2XN9C 3QIAA 2NVTB 3HOYB 4XIGS 1VDZA 4R8NA 4V190 2O2LD 4XQQA 2NUCA 2C9OA 2DNEA 3D31A 4EQPA 1ICWA 3K5LA 2BDOA 4RCNA 3HOXB 1LT6D 1NSNS 1WD0A 4NW2A 3E5SA 5KRUA 3RUZA 4DU9A 3MC0B 4HSVA 2F0EA 5CV7A 3O13A 4RA8A 1XYIA 1O80A 3TP8A 2EYJA 4FXDA 5CV6A 5K36G 3MTSA 1MSGA 1TKWB 3NBHA 1CA5A 1ONLA 2QF7A 1CM9A 5I6YA 5KGUA 4FXKC 3J80L 4CKEA 1JOOA 1SE3A 5A2QE 1M4VA 2D5DA 5M3MB 5T1IA 3PIP3 3JAME 3TP5A 2XVSA 4DAVA 2AQ3B 5C4XB 4DK1A 2OEOA 3GO5A 4XQNA 4KHVA 2ICEC 4DFAA 3GTQB 3RMHA 5C3EB 2SDFA 1TWHB 4NP5A 1GUGA 3U9SA 4CJ0B 2RQXA 2KA7A 2VUMB 2LMCB 3A7LA 1KDBA 3C1EA 2IW3A 3V96A 4G7ZC 2BE5C 4BY7B 2LS01 1YNND 3SK4A 1TS4A 4K8JA 3TZUA 1U4RA 2EPBA 5FO9B 3HRZC 2F03A 1SNCA 3DMUA 4CBVA 4G57A 3KBGA 4QB4A 2B8GA 4GZYC 4ZKBB 3D3RA 5ELEA 1ZYRC 5IIFA 1RF2D 3E6ZX 3E0JA 3OWEB 3NWTA 3SE0A 3W2DA 1TWGB 1ILQA 1F77A 4MN3A 1HFGA 3ND9A 1H9SA 1HA6A 4JBWA 3VR5A 2EYHA 3J7AV 4RHRA 1QG7A 1T5XD 1D6EC 2CVRA 3T51B 3TN2A 1Q3LA 2EJGC 1PXUA 4Z9CB 3J81E 3GTMB 3P7JA 4K5WA 4DAPA 4A3IB 1EY4A 3KLSX 3CU7A 4ODGA 2HCIA 2F3WA 1CK1A 5EBDA 4A3BB 3EFXD 5CBAE 2R92B 1WTRA 4C3JB 3H3VC 5J22A 2EYLA 5A2QL 3SDZA 1GHKA 2RVLA 4BA2I 1B9NA 3FPUB 1UUPA 4X3UA 5FKAC 2E74C 3FKIB 1MI2A 3OIQA 2F3VA 1STBA 1D5MC 5FK9C 1V1PB 1VCIA 5E4WC 1SE2A 4HEDA 4QMGA 3QJYA 3QO2A 1OO9B 4DXGA 2F0IA 5C5MA 1E2WA 4K6DA 4PV1C 1RHPA 2PYKA 4LMQD 2Q8TA 2L55A 3S15B 1BBXC 5ISRA 1DJRD 1MD2D 5IT9E 4V0BA 2J0TD 4FF2A 1CTMA 3SK5A 1KLGD 3GD7A 4WRDA 2NVQB 2DY7A 1PYWD 1FNWA 3D8GA 1B44D 5EKKA 4LAAA 3R2IA 1JOQA 4IUVA 1LT5D 2B2WC 2K7VA 2RDHA 2Q8IB 3HZXA 3KK7A 1SYEA 1B3AA 4HSPA 4RHSA 4Y7NB 3H09A 1B50A 4YIJA 5CMDA 2PW7A 1KNAA 2B2TC 3K5NA 4IFDH 2KEEA 5ELDA 2A74C 4BBRB 3GTGB 2C5CA 4K2LA 4A93B 1JOKA 1BCPF 4J8QA 2PO4A 1PTOH 3RZOB 4K5XA 1HXYD 2HDLA 2NYZD 2WKCA 4HR7B 4IFDJ 1Y1VB 3Q24A 3M7NA 2XIWA 1PZID 3HOUB 3DM1A 2K6AA 1QILA 2WKDA 4IUPA 1PZKD 1JC7A 1SSOA 5C0XG 1V1PA 3M85A 3HS0C 4E6IA 3V2TA 5IGDA 5KYLA 2B2UC 2K03A 3VYRA 3RLFA 5COYA 3LWEA 4ULLA 1T5EA 4RGOS 4X3KA 2NN6I 3P1HA 2R6GA 3SHLA 2NB0A 3J7YW 2KUMA 2PQEA 2RSOA 1QWYA 2A68C 1Q12A 1PRTF 2F0JA 1EY0A 1X3PA 3H94A 1LO5D 2BA0A 4XYOA 4XTCS 4QUCA 2BA1A 2ICIA 3BZDB 1Z6HA 2WACA 5LHY1 2E2HB 1QNUA 3NTIA 4QIWB 1S4ZA 3CHBD 2F0SA 4UAIA 1ZYRD 5JPNC 3L7ZC 2F0KA 1KABA 3GTJB 1HFNA 2X69A 1JB3A 1KNEA 4CKCA 5J1ZA 4IUTA 4XYQA 3A55A 2H1EA 4C2MB 5EKLA 1AEXA 1Z47A 4K14A 1S5DD 1ZXTA 2EYOA 3MHBA 3EROA 2F0GA 3KLSA 5ELCA 3ONAB 4PMCA 4EVOA 2F0LA 5IGBA 3ITPA 2D62A 2PZWA 4N9PA 3IKJA 4TKOB 1DM0B 5FLXL 1OXXK 2G9DA 4ID6A 4MHEA 2CW0D 4DN4M 3VR4A 1RJTA 1I4HA 1HCZA 1RODA 1VMPA 3LWUA 3GTKB 1RTNA 2VB2X 2AUJD 3PO3B 2VB3X 5CGKA 3GQBA 1I6HB 3Q22A 3A54A 3A8KE 3K5MA 1I3QB 3OPOA 4F88A 4JK1C 3A8IE 2HCCA 3BDOA 2XRSD 2AWNA 2L9HA 3CRKC 3NUCA 3NHHA 3OWFA 3UI2A 2F0TA 1ILPA 1B1ZA 5T1GA 1OXTA 4F7XA 5JEAH 2AQ2B 4TRDA 3H6MA 1D5ZC 1JR0D 2R3ZA 3N52A 5EPKA 2NN6G 1STAA 3IFDA 3BYTB 2WP8J 4IUQA 3FVQA 4M1UB 1EEFD 3TP7A 3URYA 3LNNA 3QG1A 1HQMC 1EQTA 5I9PA 2JXMB 1Y8NB 2VXWA 4LK1C 3R8BA 4KN7C 5CBEE 2L4NA 2B63B 2KCNA 1BO0A 4DA2A 1AW7A 2R7ZB 1E2ZA 1EYAA 1DOLA 2A6EC 4RKBA 1IYUA 1FYCA 2DY8A 1MBYA 2Q8RE 2F0DA 2OXPA 1D2BA 1WD1A 1XWEA 2EYFA 4U673 3GP7A 3PUWA 1G8ZD 1RTOA 2YYZA 5M5WB 4G7HC 1H9SB 2AWOA 2K32A 1ML0D 2KECA 4IALA 1G2SA 1R4PB 1O7LA 3BDLA 1G6ZA 5K5PA 3BG3A 1JWMD 2HUGA 4OGQC 4BS9A 3FPPA 4ZUJA 4KKTA 2PW5A 2A5HA 2G9HD 2QEJC 3QOJA 1IHZA 2NVYB 3MVVA 3S1QB 3ZYYX 2ZXRA 3DWPA 2MJ8A 4RAUC 5CYUA 4RH6A 1DXMA 2CQAA 2PZUA 3LX0A 1HHVA 3MWYW 2NN6H 3H0GB 1IL8A 1SXTA 2Z4HA 2NTTA 5JEAG 2M2LA 1TU2B 4J6HA 4XDXA 3PUZA 3TDQA 3A8JE 1EIGA 1OXVA 3VA5A 4KTAA 4ZAIA 4OO1G 1AZQA 4G4KA 3BYYB 4DXFA 1CFMA 1TS2A 2KJXA 2XWJB 1STEA 3MXUA 4KKUA 1F9PA 3NWSA 5E1FA 1SYFA 2JA8B 4OHJA 1ENAA 3T16A 1SFOB 4KN4C 4BWGB 4IQZA 2HDMA 4R9WA 1TWCB 4AYBB 4C3HG 5EJWA 2F0VA 1KDAA 4FNFA 5AFWA 1ENFA 3S2HB 1NUCA 1NR2A 1GXDC 4B9WA 1C8CA 2AUKA 1JCKB 3OMCA 4IN3A 5D14A 1STGA 5D3IB 3J81L 3VR3A 3I73A 2K33A 2EJMA 4A3JB 3V05A 4HMJA 4HTHA 4WJWA 1GUWA 1H9MA 3MXGA 4KI0A 4C56C 1BUVT 1NAPA 3I91A 1E0BA 3NQIA 4A3MB 2QDBA 1EU4A 2A6HD 1U9RA 2E76C 2J4XA 1V1OA 2NBFA 2B2YA 2AQ1B 1AP0A 5LL6X 3SK8A 3HG9A 1XXGA 4H13C 5IGEA 3KF8A 1LABA 5JAVA 1H9JA 1L0XB 1PFNA 2K5QA 3PUXA 5F2DA 3K57A 1B4OA 1FR3A 3EVQA 4XXEA 3EJIA 2PMZB 4FO2A 4EGVA 1I4PA 1ESRA 3M3YB 1LV9A 2TSSA 3MA2B 5DAUA 4F87A 3GV6A 2RBMA 1KLUD 1GHJA 2O5JC 1QJOA 4K5VA 1DOKA 3MZ5A 4C3IB 1SE4A 5C0XI 5G3LF 1BCPD 2D9UA 4IURA 4DAYA 4BY1B 1HTPA 4CKBA 3NSWA 4TQUS 3W3AA 2IL8A 1AFPA 1VMCA 4S3SA 5NUCA 5JOBA 2EXZA 5KEEA 1IKLA 4A3FB 1S5BD 4XT3B 4ZQ3A 1SNPA 5K36H 2PNRC 3K6OA 4BA1I 4WFN3 1C4QA 1Y69U 2L0CA 4UDUC 5CV8A 4O42A 2I46A 5JPMC 2LFNA 1HA5A 1MSHA 1DOMA 1U4MA 3SXHA 2IWHA 1EY5A 3Q0AA 1U4PA 2ENBA 3MEHA 5C3XA 1A6XA 3DXJC 3S9WA 3D6WA 5EBCA 5IOCA 1JE4A 1PZJD 2K04A 4HCSA 2B2UA 3NP8A 1EY6A 1X3QA 3D4DA 1EYCA 5BN5A 2F0FA 4FYDA 4KY5A 1E2VA 2EY1A 3S17B 3MAQA 1G91A 2BE5D 5E3FA 1RD9D 3EA6A 2YU9B 5C4ZA 1LT3D 2NVXB 3QB3A 2F0WA 3SEBA 1BNZA 5FO8B 5CORA 4C3HB 2A6HC 3ND8A 1F9SA 4DK0A 2LY7A 1EY9A 4KK7A 1WVLA 2EOTA 1CQFA 4ZRZA 4KD3A 3TBIB 1I50B 1JORA 5ELBA 3RD4A 2KQ3A 5IGFA 1GUSA 1QNKA 2E2IB 4EQNA 5I2XA 1B53A 3PIO3 2RDGA 1I4GA 2KEDA 3VYUA 1O7YA 4C1NI 4RFBA 1ESFA 3VR6A 2IPKD 1LTBD 4OL7A 3T53B 4NKLA 3X3NA 2L11A 4OIKA 4XT1B 1CI3M 4HMIA 1BXTA 1FNVA 1EIHA 3I8ZA 4C1NK 3L3OC 1BCPC 1G291 4PMBA 1HPCA 3RZDB 1LTSD 1W6JA 3SK6A 5KNDA 4BBSB 1GJXA 3NXWA 3R3OA 3DWQA 1LTGD 5J39A 3C3LA 5C5LA 3S16B 2JSOA 3NBIA 2RKSA 4RKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJ2 A;  1RTN A;  1WTQ A;  1DON A;  1HA6 A;  1ESR A;  1MGS A;  1LV9 A;  2MP1 A;  2KUM A;  2RSO A;  3MTS A;  2DY7 A;  1O7Z A;  1RTO A;  3GV6 A;  4HAE A;  1MSG A;  1BNZ A;  2HDM A;  4R9W A;  5COR A;  1CA5 A;  3TZD A;  1X3P A;  3I3C A;  5DNF A;  1WTX A;  2X6G A;  1F9R A;  1F9S A;  1X32 A;  4QUF A;  1J8I A;  5EQ0 A;  2HCC A;  5EJW A;  1DOK A;  3FDT A;  3G7L A;  4IUV A;  3R93 A;  2K28 A;  1CM9 A;  4QUC A;  2B2W C;  1ML0 D;  2KEC A;  3H91 A;  5EPJ A;  1QG7 A;  1A15 A;  2CVR A;  2FMM A;  2L9H A;  5AFW A;  1G2S A;  2EOT A;  3KBX A;  1WVL A;  3TN2 A;  5E4X A;  1HUN A;  1NR2 A;  1Q3L A;  2D9U A;  3UI2 A;  1F9Q A;  4IUR A;  1C8C A;  1ILP A;  1PDQ A;  1G6Z A;  1U4L A;  2FFK B;  5T1G A;  1QE6 A;  2HUG A;  3P7J A;  2B2V C;  1B3A A;  3DEO A;  2K01 A;  5D14 A;  3F2U A;  4ZK9 B;  1S4Z A;  2RSN A;  5T1I A;  2J7Z A;  4UAI A;  2R3Z A;  1M8A A;  1EL0 A;  2IL8 A;  3N52 A;  5EPK A;  1B50 A;  1VMC A;  4U68 A;  2HCI A;  5CMD A;  1QNK A;  2NZ1 D;  3IFD A;  1KNA A;  1DZ1 A;  2B2T C;  3HP3 A;  1HFN A;  1IKL A;  2SDF A;  2X69 A;  1XX8 A;  1JIC A;  1B53 A;  1KNE A;  2KEE A;  4IUQ A;  4XT3 B;  1IKM A;  2B2V A;  1GUW A;  2KED A;  4ZKC B;  4CJ0 B;  4CJ2 C;  2MJ8 A;  4RAU C;  1O7Y A;  2KOL A;  3DEP A;  4IUT A;  5CBA E;  1PLF A;  1EOT A;  1WTR A;  1TVX A;  1BF4 A;  1NAP A;  2H1E A;  1PFB A;  4R8I A;  3I91 A;  4O42 A;  1HHV A;  1E0B A;  3MWY W;  2HDL A;  3IL8 A;  2NYZ D;  2L12 A;  2RA4 A;  1J9O A;  1ZXT A;  1EQT A;  1NR4 A;  2FIN B;  2RVL A;  5D65 A;  1MSH A;  2NWG A;  1SAP A;  1IL8 A;  2XIW A;  1WTW A;  2EE1 A;  2L11 A;  1DOM A;  2VXW A;  3FPU B;  1U4M A;  1CA6 A;  2B2Y C;  4OIK A;  4XT1 B;  1WTO A;  4X3U A;  5EKI A;  3ONA B;  2M2L A;  1U4R A;  3DM1 A;  4RWS C;  5CBE E;  2EPB A;  2L4N A;  1U4P A;  4X3T A;  1MI2 A;  2B2Y A;  4IUP A;  4OIJ A;  1WTP A;  2MPM A;  1EIH A;  1AP0 A;  3I8Z A;  1BO0 A;  4ZLT F;  2FHT A;  4XDX A;  1F2L A;  1SSO A;  3KUP A;  5JJZ A;  2MGS A;  1B2T A;  1AZP A;  2B2T A;  4IUU A;  1DOL A;  2K05 A;  3Q6S A;  5EPL A;  1EIG A;  2B2W A;  3GV3 A;  1PFM A;  4HED A;  4X3S A;  1ICW A;  3D6W A;  5E4W C;  1NCV A;  1JE4 A;  2JP1 A;  4ZKB B;  3QO2 A;  1HUM A;  2K04 A;  2B2U C;  1PFN A;  2KVM A;  4HCS A;  2DY8 A;  2K03 A;  2N88 A;  2N55 A;  2B2U A;  5COY A;  1WTV A;  1SDF A;  4ZAI A;  2Q8R E;  1B4O A;  3LWE A;  1AZQ A;  1WD0 A;  1X3Q A;  4MHE A;  4NW2 A;  1HRJ A;  1RHP A;  4LMQ D;  2L1B A;  4X3K A;  2BDN A;  2JYO A;  1WD1 A;  2Q8T A;  4DN4 M;  4HSV A;  3SVM A;  1G2T A;  1BBX C;  1RJT A;  1ILQ A;  4CJ1 B;  1G91 A;  4RA8 A;  1XYI A;  2K1B A;  4MN3 A;  2X6L A;  1ROD A;  3I90 A;  1F9P A;  1HFG A;  1VMP A;  1O80 A; 
#chains in the Genus database with same CATH topology
 1SNQ A;  2Z8L A;  2NTS A;  4NDX A;  1HNX Q;  2A19 A;  4B3S Q;  4TSS A;  3DHQ A;  4HAE A;  3NTK A;  1MIU A;  4A3E B;  2EY2 A;  3BVZ A;  3MXN A;  1GOZ A;  3S1Q H;  1T9H A;  1LAC A;  3D4W A;  4GNX C;  3VYS A;  1Z7T A;  3BVG A;  1AE3 A;  3CQZ B;  4HIO A;  5HGT A;  3KBX A;  1IYV A;  1XTC D;  4IZ8 A;  4DGZ A;  4CDE C;  1W2B A;  1WJJ A;  1KHI A;  4LNQ A;  1X9N A;  3HKZ B;  3CPW A;  2DNC A;  1EL0 A;  2R93 B;  1PMR A;  1JJ2 A;  4K2K A;  1MJC A;  2F0U A;  4FF4 A;  1HZC A;  1TR5 A;  4OEL B;  1SYB A;  1I4Q A;  3OW7 A;  4DNT B;  4QF4 A;  5FOB B;  3T1H L;  2V1C C;  3OHX C;  1LTA D;  1PLF A;  2PCF B;  3FKI G;  3X3M A;  4L5Q A;  1BDO A;  4YCV A;  4LF7 L;  1K83 H;  1KDC A;  2YV5 A;  1LTR D;  3S24 A;  2E8G A;  2L12 A;  3H0G G;  3GTM H;  3S2D B;  1J9O A;  2E2D C;  4KJN A;  2Z1C A;  1I4X A;  4OO1 H;  2F0N A;  5LMN W;  2QCP X;  4HID A;  2A6E D;  1EEI D;  5IT9 L;  4NMZ A;  4LF5 Q;  2RCN A;  3TME A;  4A3I H;  1LLR D;  1ZEQ X;  2O4X A;  5HUR A;  3CRL C;  1IYJ B;  1IBK L;  2UUB L;  3A5Z B;  2MPM A;  1WI5 A;  1K8G A;  1PRT D;  5IYC H;  4LUV A;  5I2Y A;  4P72 A;  4LF9 L;  3Q6S A;  3BDC A;  3VYT A;  5EPL A;  1STH A;  5M3F B;  1BKB A;  1QUQ B;  1TS3 A;  2OCE A;  4A3B H;  1TWC H;  4KV6 A;  3G48 A;  5C6A A;  2JP1 A;  4HJ7 A;  3NK9 A;  3GTL B;  1FVI A;  1SDF A;  1WTV A;  4I7Z C;  4L5S A;  1ICF B;  3WDN A;  1GUO A;  4GOP C;  1HNX L;  4IJH A;  4CJ1 B;  4J15 A;  5FLX E;  4A3K B;  1Q90 A;  2IX0 A;  2EZV A;  4DR7 Q;  4WOR A;  2LSS A;  1IW7 C;  2MHV A;  1BQQ T;  4A3G B;  4I7A A;  1Y1V G;  1CKN A;  4BBR H;  4QUF A;  2JA7 B;  1J8I A;  1X65 A;  1Y1W B;  2EY5 A;  3GTG H;  1N9W A;  3FDT A;  4B3R Q;  3I4L A;  3CCM A;  1VF7 A;  4ILW A;  3CCS A;  1PTO B;  1GD7 A;  1SYD A;  1F9Q A;  4DR2 Q;  3P75 A;  2ZM6 Q;  1U4L A;  4RGN A;  2MUY A;  1YIT A;  1IBK Q;  3HOZ B;  1VQL A;  4ZK9 B;  3OMG A;  5EGT A;  4BXX H;  1PHJ A;  4QL5 A;  1EWC A;  1GUT A;  1I4R A;  1D5X C;  3BZK A;  3T1H Q;  2Z4I A;  1B9M A;  4H0L C;  4GKK L;  5CC4 A;  2K50 A;  1VQH A;  1CKM A;  2EYP A;  3L9A X;  4LW1 A;  1IKM A;  2PI2 E;  2I07 B;  2PZT A;  4UP9 A;  3T1Y L;  1S72 A;  3H3V H;  1A3V A;  3R2T A;  1Q46 A;  1S5C D;  4PNY A;  4CJ2 C;  3U9O A;  2WV6 D;  2JA5 G;  1EOT A;  2YTV A;  2JA9 A;  1CQV A;  1ET6 A;  1EY8 A;  5A35 A;  4A3L G;  1PFB A;  4IPD A;  3MXP A;  2JA5 H;  5DEH A;  3K0Y A;  5ELF A;  1B7Y B;  3PO2 H;  1VQB A;  5FJ8 H;  4DNI A;  3ULP A;  2JEB I;  4IFD G;  4DAM A;  3WOE A;  2B2Y C;  2A69 D;  3DWA A;  2GA4 B;  2TMP A;  4IO9 A;  4N9T A;  3W5O A;  2QA4 A;  1W3S A;  4OIJ A;  3HKZ E;  1VF5 C;  1F2M A;  4KY6 A;  1HQR D;  5C0X J;  1UWV A;  2OF1 A;  2ZXP A;  3KLR A;  3I4M G;  4A93 H;  2B2T A;  1CZW A;  2K05 A;  3I4N B;  2Y0S B;  3D4R A;  1PFM A;  2VL6 A;  4HJ5 A;  4JI3 Q;  2K5W A;  1TII D;  4A75 A;  3JAM i;  4B3M L;  1B70 B;  2SNM A;  1HUM A;  2L5T A;  3I4O A;  2N55 A;  4N8F A;  5M3M G;  3TEH B;  4Q5V A;  1Y1V H;  2B39 A;  4BBR G;  4MIU A;  1YNJ D;  2E2H H;  2IJ0 A;  3SVM A;  4OO1 I;  4R4Q A;  4BY1 H;  3F2B A;  2K1B A;  2SEB D;  3I90 A;  1EU3 A;  3C1F A;  1STY A;  1OXU A;  5FLM H;  4GS3 A;  1VQJ A;  4QY7 A;  1EWH A;  1KIX A;  3UDX A;  3BJU A;  1RCV D;  5ELN A;  4JI2 L;  3GTJ H;  1VQM A;  3T13 A;  5C44 B;  4A3F H;  2HHH L;  2OWO A;  2UXC L;  2IY5 B;  1F9R A;  4DV5 L;  1PRT B;  4O1N A;  1BR9 A;  2K5V A;  3R93 A;  4ME5 A;  3AQQ A;  4DR4 Q;  3H91 A;  1UE6 A;  1U0L A;  4K8I A;  3A5U A;  1GVP A;  2H4O A;  3K7A B;  4BBS G;  4L63 B;  3S14 B;  3PUV A;  3JAM L;  1TWA B;  2F3I A;  1KD1 C;  4M8A A;  2VW9 A;  2EY6 A;  2WII B;  2M9V A;  4A3K G;  5C4H A;  3ERQ A;  2Y0S E;  3NQT A;  3J80 E;  3AB9 A;  1A2T A;  2KHS A;  4X64 L;  3VDY A;  2QEX A;  4H44 C;  4FXG C;  3M4Y A;  4ZKC B;  5I9O A;  2JA7 G;  2I5L X;  1VQ7 A;  1O78 A;  2JEA I;  1HNW L;  4R8I A;  2R61 A;  1SJE D;  1GUN A;  4FF1 A;  2RA4 A;  3P20 A;  4JOI C;  4LUO A;  4ABN A;  3T4A C;  1FD7 D;  4CDF C;  5DM7 3;  1S5E D;  1L0Y B;  5BN4 A;  1WTO A;  1SEB D;  3I72 A;  4RGT A;  2JA6 G;  2A68 D;  1R4Q B;  2V4D A;  2OTL A;  1VQ5 A;  1D1I A;  4A3D H;  1N36 L;  3J7A F;  1JQY D;  4JI7 L;  2YU9 H;  1PTO F;  3NTH A;  4CHT B;  2NVX H;  3MFY A;  1TS5 A;  5KNC A;  2F0O A;  4C3H H;  2E2J H;  4C2M H;  2EVB A;  2KVM A;  3FRP B;  3A7A B;  4NPS A;  4CGY B;  4DUY L;  4NXN L;  3M4O B;  3F2C A;  1K9M C;  5M5Y H;  5BN3 A;  4ALP A;  1HRJ A;  2EXD A;  1KAA A;  2C35 B;  2BDN A;  3PMF A;  5IP9 H;  3HOX G;  2OT2 A;  4GNX B;  1SMY D;  5M5X B;  1X3G A;  4JI0 L;  4C3I G;  4PG3 A;  1SND A;  1DON A;  2LXK A;  4PZ7 A;  4ZCK A;  4X64 Q;  3PIP A;  1XMO Q;  2MP1 A;  4O2D A;  1O7I A;  4GN5 A;  4C3J G;  4DV6 L;  4LF6 L;  3K0X A;  3Q8D A;  4DR6 L;  5DNF A;  1A8V A;  1D1K A;  5IOD A;  1W6K A;  2M00 A;  1SNO A;  1X32 A;  2QIL A;  1ET9 A;  4PQX A;  4B9X A;  3FMC A;  2FMM A;  1HUN A;  3F2D A;  1S5F D;  1SN8 A;  4OEM B;  4UHV A;  2DJG C;  2KCT A;  1EZ6 A;  1PDQ A;  1Q7Y C;  4WJ3 M;  4LFB Q;  3BS1 A;  2FFK B;  2ZJP A;  2NZO A;  1AN8 A;  2RSN A;  3K58 A;  1N32 L;  1N36 Q;  3T56 B;  4JI7 Q;  2FMC A;  1E3P A;  4U68 A;  3PV0 A;  1LTT D;  4P75 A;  2F1M A;  1VQ9 A;  1SYG A;  1I3Q H;  1JIC A;  4KHP Q;  1SJH D;  5BR8 L;  1VQI A;  4RGM A;  5JEA J;  4QGU A;  1NTG A;  1YNJ C;  4J1M A;  4DV2 L;  1UEB A;  1Q1E A;  1STN A;  1NE3 A;  3DEP A;  3OOC A;  3RZD H;  2IHF A;  2Z6K C;  2H5X A;  1EY7 A;  3OSO A;  1I6V C;  4RMF A;  4JI5 L;  1EFW A;  1Q8I A;  2JN4 A;  2D2C C;  3TQY A;  3WOF A;  4IOA A;  5D65 A;  5AJ3 L;  3SR1 A;  5M3M H;  1IBL L;  4L6T B;  3S16 H;  3FEW X;  4ZUI A;  2A1A A;  3CW2 C;  3PO3 G;  5EKI A;  5C4X H;  1RL2 A;  4P2C B;  2CW0 C;  1I94 L;  1HTL D;  3C2P A;  3K8A A;  3GTQ H;  1JWS D;  1VS0 A;  3KUP A;  2SNS A;  1J6Q A;  4JI4 L;  4A3C G;  2MGS A;  2A73 B;  4NXN Q;  1B2T A;  1AZP A;  1TWF B;  4FF3 A;  1XPU A;  2B2W A;  4A3E H;  4G7O C;  2EQS A;  4R4I A;  1LTL A;  5GRO A;  4DUZ Q;  3I2Z A;  3EQL C;  2ZT9 C;  3MFG A;  3VA7 A;  3HOV B;  4KHZ A;  3KF6 B;  4K6L A;  2E5L L;  2EJF C;  4BY7 H;  2L1B A;  4LFA Q;  4JI1 Q;  3QOL A;  1JT8 A;  2O5I C;  5IGC A;  3M4P A;  2FXQ A;  1RKN A;  5DLQ E;  2BCO A;  1WTQ A;  4JI8 Q;  3STB D;  4DF7 A;  1K73 C;  1EZ8 A;  5DM6 3;  2PQA A;  4B3T L;  2K5H A;  1IL2 A;  2F0P A;  2R7Z H;  1QOH A;  2UUC Q;  3J7A 5;  5JVG 3;  3H3V I;  2NVY H;  4EQO A;  1V43 A;  2IX3 A;  2HT1 A;  1WTX A;  4FVM A;  5CV5 A;  2X6G A;  2F4I A;  4KJO A;  4YY3 L;  2SOB A;  2K28 A;  4BXX G;  5EPJ A;  1B8A A;  1FNU A;  4ZYS A;  1EFI D;  1NBW A;  1CHP D;  4HCE A;  1K83 B;  1R9T B;  1A2U A;  4JBK A;  4RCO A;  4IUN A;  1XNQ Q;  1Q1B A;  3S2D H;  2B2V C;  1WOC A;  4YCW A;  1II3 A;  4NB3 A;  1YIJ A;  4KD4 A;  3AFP A;  1M8A A;  2RDF A;  1TY0 A;  5CV9 A;  1V8Q A;  1WCM B;  2KCM A;  3HP3 A;  1SYC A;  1D8L A;  5D3D A;  3K5O A;  2B2V A;  2WB1 B;  3CCJ A;  3I70 A;  5CV4 A;  3HFZ B;  1TY2 A;  2UXD L;  1GM5 A;  1TVX A;  1VQN A;  3RR5 A;  1FL0 A;  2F0H A;  1MHW C;  5FO7 B;  4IPC A;  4DV0 L;  3IL8 A;  5IGG A;  2Z6K A;  2FIN B;  2E75 C;  2K4K A;  1PRT C;  1N8R C;  4QCL A;  1SAP A;  4GOP B;  3D6C A;  3HOY G;  1QCB D;  3S1R B;  1WTP A;  2DN8 A;  3BVM A;  4ZLT F;  4R4O A;  3A56 A;  5IYC G;  1SFO H;  3UDG A;  3DLL A;  1UEA B;  1AE2 A;  4JV5 Q;  2R7F A;  3GV3 A;  1ENC A;  1F2Y A;  2MO0 A;  4IOC A;  3C46 A;  1CT1 D;  3NPP A;  4DNR B;  1YNN C;  2WIN B;  1BOS A;  4C3J H;  2K5D A;  4A4I A;  5M9O A;  5LMN L;  3H0G H;  3I4M B;  4GLX A;  1PYS B;  2KHJ A;  1K0R A;  1JJC B;  3I4N G;  2F0Q A;  1F2Z A;  2JA6 B;  1DD2 A;  2NZH A;  2CH4 A;  3GTO B;  3FKI H;  2X6L A;  1DCZ A;  3EIV A;  1H9R A;  4PMW A;  4H02 A;  2IX1 A;  3GTP B;  2ID0 A;  1TQO A;  1RDP D;  5LL6 S;  1O7Z A;  4LF9 Q;  2UXD Q;  3K80 C;  5IYB H;  3I3C A;  5KNB A;  2ZXO A;  3CKI B;  3M7G A;  4FDB A;  5EQ0 A;  3S1M B;  4DV4 Q;  4X6A H;  3TSS A;  1A15 A;  5JJL A;  4KKS A;  2JA5 B;  3K59 A;  4B08 A;  2EDG A;  1KAW A;  4XQJ A;  3PO2 B;  1EQV A;  2XRQ D;  5I6W A;  2J7Z A;  3QWN A;  1QVF A;  1HZ9 A;  2JA8 H;  3CD6 A;  2NVQ H;  5G3L D;  1SRU A;  2NZ1 D;  3S1N B;  2CHB D;  1LT4 D;  3OTO L;  3OIP A;  1SNM A;  2BOS A;  2B3G A;  3TS2 A;  4LJZ C;  2KOL A;  4JPB W;  4CDD C;  3NE5 B;  2KCC A;  4H7B A;  3DUZ A;  3PQI A;  4MNO A;  3ICE A;  1SBB B;  2EE1 A;  1Q86 C;  4Y7N H;  1UAP A;  2JE6 I;  4L8J A;  5KIX A;  4RWS C;  3PUY A;  2JA8 G;  4X3T A;  2LKV A;  1EOV A;  2FHT A;  1A3U A;  1F2L A;  5C4J B;  3HGB A;  4KY7 A;  3IFT A;  5JJZ A;  5C3E G;  2OQK A;  4IUU A;  2XNA C;  1EUJ A;  4X3S A;  1OXS C;  1K8O A;  2F52 A;  1NCV A;  3TP6 A;  1Q82 C;  1IW7 D;  4HIM A;  4JOI A;  1JWU D;  1S40 A;  1IBM L;  1PTO C;  1YBY A;  2N88 A;  4X66 Q;  4FP5 D;  4DAY B;  2BH2 A;  2XWB B;  2JYO A;  4JW0 A;  3K7A H;  3VR2 A;  2B8F A;  1G2T A;  4OX9 Q;  1KRT A;  1H9K A;  2IHE A;  1X54 A;  3CCQ A;  2ES2 A;  2CWA A;  1PTO D;  3HEJ A;  3IAY A;  2F0M A;  1QB5 D;  2FJ2 A;  4MTK A;  1Y8P B;  1MGS A;  5JVH 3;  2PPB C;  1DYQ A;  4IFD I;  1QUQ A;  3KJO A;  2EYM A;  5I4D A;  2QKI C;  3TZD A;  4LF7 Q;  2A69 C;  3E3X A;  5KYI A;  1A3T A;  1FGB D;  3N6R A;  3G7L A;  1ZKO A;  3STB C;  5C0X H;  4F8M A;  1XPO A;  1YHB A;  4KMU C;  3HOW B;  3AU7 A;  4HN7 A;  5E4X A;  5TSS A;  5C3W A;  2WAQ B;  2WB1 G;  3HKS A;  4HJA A;  1Q81 C;  1QE6 A;  4Q0F A;  5CR3 A;  3EN2 A;  5GAH C;  1CZG A;  1UNS A;  2K01 A;  3DEO A;  3F2U A;  3J81 j;  1S3O A;  4JBJ A;  1SMY C;  1KTK A;  2WAQ E;  4IPH A;  3OTO Q;  4I65 A;  2I5H A;  1BCP B;  1YNX A;  4A3D B;  1DZ1 A;  4JI2 Q;  2HQE A;  4GNX A;  2VNU D;  1XX8 A;  1V9P A;  2CQO A;  1C0A A;  2ASB A;  1CHQ D;  2Z0S A;  3AMU A;  1Y8O B;  1YHA A;  3A74 A;  3IRB A;  1PVO A;  2E2J B;  1EYD A;  3G6J B;  1BF4 A;  1K8M A;  1TT2 A;  2IT1 A;  5M5Y B;  1NR4 A;  1LTI D;  2XSC A;  4DV1 L;  1C48 A;  2NWG A;  4DR5 L;  3Q23 A;  1WTW A;  1CA6 A;  2XN9 C;  3QIA A;  2NVT B;  3HOY B;  4XIG S;  1VDZ A;  4R8N A;  4V19 0;  2O2L D;  3U50 C;  4XQQ A;  2ZJR A;  3CAM A;  1X3E A;  2NUC A;  2C9O A;  1Y14 B;  2DJF C;  2DNE A;  3D31 A;  4EQP A;  1ICW A;  3K5L A;  2BDO A;  1BVS A;  4YWM A;  2PI2 A;  4RCN A;  4OX9 L;  3HOX B;  3CC4 A;  1LT6 D;  1NSN S;  3F8T A;  1WD0 A;  4NW2 A;  3E5S A;  5KRU A;  3RUZ A;  3TRE A;  4DU9 A;  3MC0 B;  4HSV A;  4MZ9 A;  2F0E A;  5CV7 A;  3T1Y Q;  1I50 H;  4DV3 Q;  2R7Z G;  3O13 A;  4R1J A;  4RA8 A;  1XYI A;  1J5E Q;  1O80 A;  3J81 i;  3TP8 A;  2EYJ A;  4FXD A;  3DM3 A;  5CV6 A;  5K36 G;  3MTS A;  1MSG A;  1TKW B;  3NBH A;  1K8A C;  2VQF L;  1CA5 A;  1ONL A;  2GVB A;  2QF7 A;  4A3B G;  3KFU A;  1VQ6 A;  1ASY A;  1AH9 A;  2RF4 A;  1VQC A;  1CM9 A;  4DV1 Q;  5I6Y A;  5KGU A;  4DR5 Q;  4FXK C;  3J80 L;  4A3E G;  4CKE A;  1JOO A;  1SE3 A;  5A2Q E;  1M4V A;  1XJV A;  4HJ9 A;  3S17 H;  2D5D A;  4EQ5 A;  5M3M B;  5T1I A;  3PIP 3;  3PIO A;  4O0A A;  3JAM E;  4JI3 L;  3TP5 A;  2XVS A;  1QVG A;  4DAV A;  2AQ3 B;  5C4X B;  3UDI A;  4QQB X;  4DK1 A;  2OEO A;  3GO5 A;  3UE0 A;  4XQN A;  1I6H H;  4KHV A;  2ICE C;  4DFA A;  1KC8 C;  3B6Y A;  1CKO A;  3RMH A;  5C3E B;  3GTQ B;  2SDF A;  1TWH B;  4NP5 A;  1GUG A;  3U9S A;  5M3F G;  4CJ0 B;  2RQX A;  2KA7 A;  2VUM B;  2LMC B;  3A7L A;  3J81 c;  1C9O A;  2ZJQ A;  4UPA A;  1KDB A;  3C1E A;  2IW3 A;  1EYG A;  3V96 A;  3HOV H;  4G7Z C;  2BE5 C;  4BY7 B;  2LS0 1;  1YNN D;  1SE8 A;  3SK4 A;  2VY3 A;  1PV4 A;  1TS4 A;  4K8J A;  3TZU A;  1U4R A;  1V1Q A;  2AMC B;  2EPB A;  5FO9 B;  2E2I H;  3HRZ C;  2VQF Q;  2F03 A;  1P16 A;  1SNC A;  4KHP L;  5BR8 Q;  2HD3 A;  3DMU A;  2Z6B A;  4CBV A;  4G57 A;  3KBG A;  4DPG A;  1M1K C;  4QB4 A;  2B8G A;  4GZY C;  3D3R A;  5ELE A;  4ZKB B;  3L0O A;  1ZYR C;  5IIF A;  3CQZ H;  1C7Y A;  2G5D A;  1RF2 D;  3E6Z X;  3E0J A;  3OWE B;  3PCO B;  3NWT A;  1ASZ A;  3SE0 A;  3W2D A;  2B63 G;  1TWG B;  4YHH Q;  1ILQ A;  1F77 A;  2LXJ A;  4DR4 L;  4MN3 A;  2B63 H;  1HFG A;  3ND9 A;  1H9S A;  1HA6 A;  1VQG A;  4JBW A;  3I7F A;  5LMU Q;  2R93 H;  3VR5 A;  1WCM H;  2EYH A;  2KBN A;  4JCV E;  3J7A V;  2K75 A;  2ATW A;  4DK3 C;  4BBS H;  1PA6 A;  4RHR A;  2QW7 A;  1RIP A;  2CFM A;  1QG7 A;  1T5X D;  1D6E C;  4OWW B;  2CVR A;  3T51 B;  3TN2 A;  2VQE L;  4JG2 A;  1Q3L A;  2EJG C;  1PXU A;  4Z9C B;  3J81 E;  3GTM B;  3J80 i;  3P7J A;  1QVC A;  4K5W A;  2CH4 W;  3RLO A;  1N34 L;  1HZB A;  4DR2 L;  4LF8 L;  4DAP A;  4A3I B;  4K0K Q;  1EY4 A;  3KLS X;  3CU7 A;  5IYB G;  4ODG A;  2HCI A;  5M5W H;  2F3W A;  2KEN A;  1CK1 A;  4BY1 G;  5EBD A;  5M3F H;  1K0S A;  4A3B B;  1NMG A;  3EFX D;  5CBA E;  2F4V Q;  4AH6 A;  2R92 B;  2D0O A;  3OYY A;  1WTR A;  4C3J B;  3H3V C;  5J22 A;  1XNQ L;  2EYL A;  5A2Q L;  3SDZ A;  1GHK A;  2RVL A;  4BA2 I;  1B9N A;  3I4M H;  3FPU B;  1UUP A;  4RG1 A;  4X3U A;  5FKA C;  2E74 C;  3FKI B;  4X65 L;  4DV6 Q;  4A3K H;  4LF6 Q;  1MI2 A;  1VQO A;  2PMZ E;  3OIQ A;  2CCZ A;  5JJK A;  2F3V A;  2MFI A;  4YCU A;  1STB A;  1PH1 A;  1XNR Q;  1D5M C;  5FK9 C;  1V1P B;  3G4S A;  1E22 A;  1VCI A;  5E4W C;  5FJ8 G;  1SE2 A;  4HED A;  1QZH A;  2VQE Q;  3KJP A;  4QMG A;  3QJY A;  3QO2 A;  1SLJ A;  4DV0 Q;  1OO9 B;  1PH9 A;  4DXG A;  2F0I A;  5C5M A;  1E2W A;  4K6D A;  4PV1 C;  1RHP A;  2PYK A;  4LMQ D;  4GN4 B;  5LMN Q;  4LF8 Q;  2Q8T A;  2ZTC A;  2L55 A;  3S15 B;  1BBX C;  5LMU L;  5ISR A;  1DJR D;  1MD2 D;  5IT9 E;  2HQL A;  4V0B A;  4AQY Q;  2J0T D;  4FF2 A;  1CTM A;  3SK5 A;  1KLG D;  5GQO A;  3GD7 A;  4WRD A;  1XMQ Q;  2NVQ B;  2DY7 A;  1PYW D;  3CF5 A;  1FNW A;  3S1N H;  3D8G A;  4TVA B;  1B44 D;  5EKK A;  4JC0 A;  4NXM Q;  4LAA A;  3R2I A;  1JOQ A;  4IUV A;  4A3M G;  1LT5 D;  3AYH B;  2B2W C;  3GTL H;  1JMC A;  2K7V A;  2RDH A;  2Q8I B;  4MTN A;  2MO1 A;  3HZX A;  3TRZ A;  3G6E A;  3KK7 A;  1SYE A;  1B3A A;  4HSP A;  4RHS A;  4LFC Q;  3NEM A;  3AEV A;  1XTD A;  1VQA A;  4Y7N B;  1YJ9 A;  3H09 A;  1B50 A;  1K3R A;  2WAQ G;  4YIJ A;  5CMD A;  2PW7 A;  1KNA A;  2B2T C;  4A3G H;  4DUZ L;  3K5N A;  4IFD H;  1CKN B;  2KEE A;  5ELD A;  2A74 C;  2AHO B;  4BBR B;  3GTG B;  2C5C A;  4K2L A;  4A93 B;  1JOK A;  1I94 Q;  1BCP F;  2XTI A;  4J8Q A;  2PO4 A;  4A3L H;  1PTO H;  3S2H H;  1E1T A;  1X6O A;  3RZO B;  4K5X A;  1HXY D;  2HDL A;  2NYZ D;  2QGQ A;  2WKC A;  3RLN A;  1WFQ A;  3U58 A;  4HR7 B;  4BY7 G;  2K5N A;  1P8L A;  4IFD J;  1Y1V B;  3Q24 A;  3CCV A;  3M7N A;  2XIW A;  4A76 A;  1L1O A;  5IT9 c;  1PZI D;  3HOU B;  3DM1 A;  2K6A A;  1QIL A;  2WKD A;  4IUP A;  1PH3 A;  3F1Z A;  1PZK D;  1OTC A;  4A3J H;  4A3C H;  1JC7 A;  1SSO A;  4X62 L;  5C0X G;  3FP9 A;  1V1P A;  3M85 A;  1L1O B;  3HS0 C;  4E6I A;  3V2T A;  5IGD A;  3CCE A;  5KYL A;  2B2U C;  3PGZ A;  4A3M H;  2K03 A;  3VYR A;  3RLF A;  5COY A;  4DKA C;  1HNZ Q;  3LWE A;  2PQA B;  3HOW H;  4ULL A;  2PNH A;  1T5E A;  4AQY L;  4UY8 C;  4RGO S;  4X3K A;  2NN6 I;  5E7N A;  3JAM c;  2HIX A;  3P1H A;  2R6G A;  3SHL A;  2NB0 A;  3J7Y W;  1UE1 A;  1HH2 P;  2HIV A;  2EIF A;  2KUM A;  2PQE A;  2RSO A;  1CSQ A;  1QWY A;  2A68 C;  4DK6 C;  1Q12 A;  1PRT F;  2F0J A;  1EY0 A;  1X3P A;  2WFW A;  3H94 A;  1PH4 A;  1LO5 D;  2BA0 A;  1EWI A;  1IBM Q;  4XYO A;  4XTC S;  4QUC A;  2BA1 A;  3PF4 A;  2AKW B;  2ICI A;  1KL9 A;  3BZD B;  1Z6H A;  1KQS A;  1PH2 A;  2WAC A;  4WJ4 A;  5LHY 1;  2E2H B;  1QNU A;  3NTI A;  4QIW B;  3K81 C;  1S4Z A;  3CHB D;  1HJP A;  2F0S A;  4UAI A;  2NVT H;  1ZYR D;  5JPN C;  3L7Z C;  3M3Y H;  2F0K A;  1IZ6 A;  1KAB A;  4JV5 L;  1EQQ A;  1HZA A;  3GTJ B;  1HFN A;  2X69 A;  1JB3 A;  1KNE A;  3D0F A;  5GAG C;  2Y0S G;  4CKC A;  5J1Z A;  4B3S L;  4IUT A;  4XYQ A;  4C3I H;  2OTJ A;  3A55 A;  2Q2U A;  2H1E A;  4C2M B;  2I0Q A;  1G51 A;  1IXR A;  2D0P A;  5EKL A;  1AEX A;  1Z47 A;  4K14 A;  3HOX H;  4GOP A;  3M4O H;  1S5D D;  4N8X 1;  1ZXT A;  2ZTE A;  3HOU G;  3S14 H;  2EYO A;  3MHB A;  1K3B C;  3ERO A;  1TWA H;  4P74 A;  2F0G A;  4X62 Q;  1UE5 A;  2RHQ B;  3KLS A;  5ELC A;  3ONA B;  5M5X H;  3KYH C;  4JI6 L;  5AJ3 Q;  1VQF A;  4PMC A;  2Q2H A;  4EVO A;  2F0L A;  4Y52 H;  5IGB A;  3ITP A;  2D62 A;  4DV4 L;  1Z9F A;  2PZW A;  4N9P A;  4A3D G;  5HY6 A;  3IKJ A;  4LUZ A;  4TKO B;  1X56 A;  1DM0 B;  5FLX L;  1CUK A;  1OXX K;  2N49 A;  2G9D A;  2ZTD A;  4ID6 A;  4MHE A;  2CW0 D;  1BBW A;  3RN2 A;  1JJG A;  4DN4 M;  3VR4 A;  3U4Z A;  1RJT A;  3KF8 B;  1I4H A;  2P5Z X;  3KF6 A;  4DV3 L;  2E5L Q;  1HCZ A;  1ROD A;  3NEL A;  1VMP A;  3LWU A;  4DR1 L;  3GTK B;  1GO3 E;  1RTN A;  2VB2 X;  2AUJ D;  2JJQ A;  3PO3 B;  4DV5 Q;  2VB3 X;  5CGK A;  3GQB A;  1I6H B;  3Q22 A;  2GN5 A;  3A54 A;  3A8K E;  3K5M A;  1I3Q B;  1TWH H;  3OPO A;  4F88 A;  3QR8 A;  1FJG L;  4JK1 C;  3A8I E;  2HCC A;  3BDO A;  2XRS D;  2AWN A;  2L9H A;  3CRK C;  3NUC A;  3NHH A;  3OWF A;  4DR7 L;  2VUM G;  3UI2 A;  2F0T A;  4OXP A;  1ILP A;  4P71 A;  1B1Z A;  5T1G A;  1OXT A;  4F7X A;  5JEA H;  2AQ2 B;  1FGU A;  4TRD A;  3H6M A;  1D5Z C;  1YZ6 A;  1VQD A;  1JR0 D;  3CP0 A;  4L5T A;  2R3Z A;  1WYD A;  3ULJ A;  3N52 A;  5EPK A;  2NN6 G;  4A3F G;  1STA A;  4X66 L;  2YTY A;  3IFD A;  3UDF A;  3BYT B;  2WP8 J;  4IUQ A;  3FVQ A;  4M1U B;  4QJF A;  1EEF D;  3HOV G;  1MJE A;  1TWF H;  5FLM G;  3TP7 A;  3URY A;  4KLK A;  3LNN A;  3QG1 A;  1PH8 A;  1VQ4 A;  1HQM C;  4JI6 Q;  4POG A;  4GKK Q;  3U4V A;  3FHW A;  1EQT A;  4UP7 A;  2JXM B;  5I9P A;  1Y8N B;  4GN3 B;  2VXW A;  2B29 A;  4LK1 C;  1TWG H;  3R8B A;  3SGI A;  3NEN A;  1VQ8 A;  4KN7 C;  5CBE E;  2L4N A;  2B63 B;  4A93 G;  2KCN A;  4YWL A;  1BO0 A;  4DA2 A;  4DR3 L;  1AW7 A;  2R7Z B;  4A3J G;  1E2Z A;  1EYA A;  1DOL A;  1SRO A;  3PF5 A;  4OWT B;  3RNU A;  2A6E C;  4RKB A;  1L2F A;  1IYU A;  1L0W A;  1FYC A;  2GVA A;  2DY8 A;  2R7D A;  1MBY A;  2Q8R E;  2F0D A;  1KRS A;  2OXP A;  1R9T H;  1D2B A;  1WD1 A;  1XWE A;  1XMO L;  3KDF B;  2UU9 L;  3L2P A;  2EYF A;  4U67 3;  1FJG Q;  1I5F A;  3KOJ A;  3ER0 A;  3GP7 A;  3PUW A;  1G8Z D;  1RTO A;  2JK8 A;  3E9I A;  4A3G G;  2YYZ A;  5M5W B;  4G7H C;  4YWK A;  1H9S B;  2CWP A;  2AWO A;  2K52 A;  1M90 C;  2K32 A;  1PH6 A;  1ML0 D;  1TXY A;  2KEC A;  2R92 H;  4IAL A;  1G2S A;  1R4P B;  1O7L A;  3BDL A;  1G6Z A;  5K5P A;  3BG3 A;  4R4C A;  1YI2 A;  1YJW A;  1JWM D;  1YEZ A;  2HUG A;  4OGQ C;  4BS9 A;  3FPP A;  4ZUJ A;  4KKT A;  2N78 A;  2PW5 A;  4GKJ L;  1G6P A;  2YTX A;  2A5H A;  2UUB Q;  2G9H D;  2QEJ C;  4QIW E;  1PFS A;  3QOJ A;  3S1R H;  3NBH B;  3CME A;  1IHZ A;  2NVY B;  1B3Q A;  1NJI C;  3MVV A;  1PH5 A;  3S1Q B;  3ZYY X;  2ZXR A;  3DWP A;  2MJ8 A;  4RAU C;  5CYU A;  1N33 Q;  4JYA Q;  3BZC A;  4RH6 A;  1DXM A;  2F4V L;  2CQA A;  2HHH Q;  2PZU A;  3LX0 A;  4HIK A;  1HHV A;  3MWY W;  4JVZ A;  2NN6 H;  1MKH A;  1U5K A;  2UU9 Q;  3H0G B;  1IL8 A;  3LGJ A;  1N34 Q;  1NMF A;  1SXT A;  5EAY A;  3CMA A;  3S15 H;  2Z4H A;  2NTT A;  5JEA G;  2M2L A;  3GTO H;  1VQE A;  1TU2 B;  4J6H A;  5JJI A;  3ERS X;  4IPG A;  3GTP H;  4XDX A;  2DGY A;  3PUZ A;  1PYB A;  2I5M X;  3TDQ A;  3A8J E;  4ME3 A;  1J5E L;  1EIG A;  2CKZ B;  5IY0 A;  1EIF A;  1OXV A;  2BH8 A;  3HKZ G;  4LFA L;  3VA5 A;  3EBE A;  4B3R L;  4KTA A;  4ZAI A;  1KXL A;  4OO1 G;  1AZQ A;  3PSI A;  4G4K A;  3BYY B;  3W1B A;  4DXF A;  1Y1W G;  1CFM A;  1E7Z A;  2XGT A;  1TS2 A;  2KJX A;  2XWJ B;  1STE A;  3MXU A;  4KKU A;  1F9P A;  3NWS A;  4HJ8 A;  3G71 A;  5IP9 G;  5E1F A;  1HNW Q;  1SYF A;  2JA8 B;  4OHJ A;  1ENA A;  3T16 A;  1SFO B;  4KN4 C;  4BWG B;  1N33 L;  4IQZ A;  4JYA L;  2HDM A;  4R9W A;  1TWC B;  1JB7 A;  4AYB B;  4C3H G;  5EJW A;  2F0V A;  1KDA A;  4FNF A;  4JI0 Q;  2UXB Q;  1D7Q A;  5AFW A;  1ENF A;  3S2H B;  1NUC A;  3RZO H;  1NR2 A;  4GKJ Q;  1GXD C;  3M4Q A;  4B9W A;  2ZM6 L;  2AUK A;  1PH7 A;  1C8C A;  4LF4 L;  4AYB E;  2JA6 H;  1JCK B;  3OMC A;  1LUZ A;  4IN3 A;  2MNA A;  5D14 A;  4DR6 Q;  1STG A;  2KHI A;  4UP8 A;  1SR3 A;  3TS0 A;  2N8N A;  1BBU A;  5D3I B;  3J81 L;  3VR3 A;  1XPR A;  3HOU H;  3J80 c;  2OQ0 A;  3I73 A;  2K33 A;  2EJM A;  3ULL A;  4A3J B;  2A8V A;  5ELO A;  5C4J H;  3V05 A;  4P73 A;  2JA7 H;  4HMJ A;  4HTH A;  4WJW A;  2Q2I A;  1Y1W H;  1GUW A;  1H9M A;  4CDC C;  4LWC A;  3S1M H;  3MXG A;  2ALY B;  4KI0 A;  1N32 Q;  4C56 C;  1BUV T;  1NAP A;  3ZJY C;  4YHH L;  3I91 A;  4B3M Q;  3M9B A;  1E0B A;  3NQI A;  4A3M B;  1VQK A;  2QDB A;  1EU4 A;  3HOZ H;  2A6H D;  1U9R A;  5IYD G;  2E76 C;  2J4X A;  1V1O A;  2NBF A;  4LFB L;  1E24 A;  4DV2 Q;  1NNX A;  2B2Y A;  2AQ1 B;  4PZ8 A;  1AP0 A;  5LL6 X;  3SK8 A;  3HG9 A;  3CPF A;  1XXG A;  4H13 C;  5IGE A;  4DV7 L;  3KF8 A;  1IBL Q;  4EX5 A;  1LAB A;  5JAV A;  1H9J A;  3MXN B;  3PUX A;  1L0X B;  1PFN A;  2K5Q A;  5F2D A;  4OWX B;  3K57 A;  1B4O A;  1YJN A;  1HNZ L;  1FR3 A;  3EVQ A;  4XXE A;  1E1O A;  3EJI A;  2PMZ B;  4JI5 Q;  4FO2 A;  4GLV B;  4EGV A;  1I4P A;  1SMX A;  1ESR A;  3HOW G;  3M3Y B;  3CCU A;  1QZG A;  1LV9 A;  1GKH A;  2TSS A;  3MA2 B;  5DAU A;  3WWV A;  4F87 A;  3RN5 A;  3GV6 A;  2RBM A;  2UXB L;  5GAE C;  3I4N H;  1A62 A;  1KLU D;  2UXC Q;  1GHJ A;  2O5J C;  3I56 A;  4LF4 Q;  4K0K L;  1QJO A;  4K5V A;  1DOK A;  3MZ5 A;  5FLX c;  4JI4 Q;  2N3S A;  4C3I B;  2WB1 E;  1SE4 A;  5C0X I;  5G3L F;  1BCP D;  2D9U A;  2VS1 A;  4IUR A;  3CCL A;  4DAY A;  4X65 Q;  3E0E A;  1CSP A;  2Z9H A;  1UE7 A;  4BY1 B;  5IP7 G;  1HTP A;  1JE5 A;  4CKB A;  2UUA Q;  3NSW A;  4TQU S;  3W3A A;  3HOY H;  3PO2 G;  2IL8 A;  1AFP A;  1VMC A;  4S3S A;  4DV7 Q;  5NUC A;  3J7Z C;  5JOB A;  2EXZ A;  5KEE A;  1IKL A;  4XT3 B;  1S5B D;  4ZQ3 A;  5C44 H;  4A3F B;  1L1O C;  1SNP A;  4JI1 L;  5K36 H;  2PNR C;  3K6O A;  4BA1 I;  4WFN 3;  4OON A;  4JBM A;  1C4Q A;  1Y69 U;  2L0C A;  3KLW A;  4UDU C;  5CV8 A;  1K28 A;  4JI8 L;  5H1S E;  4O42 A;  1VQP A;  2I46 A;  5JPM C;  4DUY Q;  2LFN A;  1XMQ L;  1HA5 A;  4POF A;  1MSH A;  4APV A;  1YVC A;  3AFQ A;  1DOM A;  1U4M A;  5IWA Q;  3SXH A;  4NXM L;  3W1G A;  2IWH A;  1EY5 A;  3Q0A A;  1U4P A;  2ENB A;  4L5R C;  3MEH A;  5C3X A;  1EIY B;  1A6X A;  3GTK H;  3H15 A;  3DXJ C;  3PO3 H;  1WTH A;  5IE8 A;  1H95 A;  3S9W A;  3D6W A;  5EBC A;  5IOC A;  1JE4 A;  3I55 A;  2R92 G;  1PZJ D;  2K04 A;  4HCS A;  2B2U A;  3NP8 A;  1EY6 A;  1X3Q A;  1Q8K A;  4LFC L;  3D4D A;  2VZA A;  1EYC A;  2UUA L;  2F0F A;  5BN5 A;  4FYD A;  4KY5 A;  1E2V A;  2EY1 A;  3S17 B;  5J3B A;  3MEF A;  3MAQ A;  3K7U C;  1G91 A;  1X3F A;  2BE5 D;  1X55 A;  5E3F A;  1RD9 D;  3EA6 A;  4DR1 Q;  2YU9 B;  5C4Z A;  1LT3 D;  2NVX B;  1LYL A;  3QB3 A;  4R4T A;  2F0W A;  2MQH A;  3SEB A;  5C44 G;  2RHS B;  5GAD C;  1BNZ A;  5FO8 B;  5COR A;  4AYB G;  4C3H B;  2A6H C;  3ND8 A;  4GLA C;  1F9S A;  1YHQ A;  4DK0 A;  4PZ6 A;  1A0I A;  2LY7 A;  1EY9 A;  3A0J A;  5IP7 H;  4KK7 A;  4AIM A;  2EOT A;  1WVL A;  1CQF A;  4ZRZ A;  4KD3 A;  2JQO A;  3TBI B;  1I50 B;  1JOR A;  4A3I G;  3JC6 6;  5ELB A;  1HR0 L;  3RD4 A;  2KQ3 A;  5IGF A;  1GUS A;  3CXC A;  5C4X G;  1DGS A;  1QNK A;  2E2I B;  4EQN A;  5I2X A;  1B53 A;  3PIO 3;  2RDG A;  3KDF A;  1I4G A;  2KED A;  3VYU A;  1O7Y A;  4C1N I;  4IJL A;  1NY4 A;  4RFB A;  3OW2 A;  1ESF A;  2RCF A;  3CC2 A;  3VR6 A;  5IWA L;  2IPK D;  1LTB D;  4OL7 A;  3T53 B;  4NKL A;  2DUD A;  3X3N A;  2L11 A;  3GDE A;  4OIK A;  4XT1 B;  1CI3 M;  4HMI A;  2QDL A;  1BXT A;  3BU2 A;  1FNV A;  1EIH A;  3I8Z A;  4C1N K;  3L3O C;  5C3E H;  2K14 A;  1BCP C;  4DR3 Q;  1G29 1;  4B3T Q;  3E9H A;  4PMB A;  5HGQ A;  2UUC L;  3CC7 A;  2Q2T A;  1HPC A;  2VUM H;  3RZD B;  1EQR A;  1LTS D;  1XNR L;  1W6J A;  3SK6 A;  5KND A;  4BBS B;  1GJX A;  3NXW A;  3R3O A;  5L37 A;  3DWQ A;  1WCM G;  4YY3 Q;  1LM0 A;  1LTG D;  3CCR A;  5IYD H;  2R93 G;  3HOZ G;  3UE1 A;  5J39 A;  1HR0 Q;  3C3L A;  5C5L A;  3S16 B;  1A63 A;  2JSO A;  3NBI A;  1HR0 W;  2RKS A;  2L15 A;  4RKL A;  4LF5 L; 
#chains in the Genus database with same CATH homology
 1SNQ A;  2Z8L A;  2NTS A;  4NDX A;  4TSS A;  3DHQ A;  4HAE A;  3NTK A;  4A3E B;  2EY2 A;  3BVZ A;  3MXN A;  1GOZ A;  3D4W A;  1LAC A;  3VYS A;  1Z7T A;  3BVG A;  3CQZ B;  5HGT A;  3KBX A;  1IYV A;  1XTC D;  4IZ8 A;  4DGZ A;  3HKZ B;  2DNC A;  1EL0 A;  2R93 B;  1PMR A;  4K2K A;  2F0U A;  4FF4 A;  1TR5 A;  1SYB A;  1I4Q A;  3OW7 A;  4DNT B;  4QF4 A;  5FOB B;  3OHX C;  1LTA D;  1PLF A;  2PCF B;  3X3M A;  1BDO A;  1KDC A;  1LTR D;  3S2D B;  2L12 A;  1J9O A;  2E2D C;  4KJN A;  2Z1C A;  1I4X A;  4OO1 H;  2F0N A;  2QCP X;  2A6E D;  1EEI D;  5IT9 L;  4NMZ A;  3TME A;  1LLR D;  1ZEQ X;  2O4X A;  5HUR A;  3CRL C;  2MPM A;  1PRT D;  5I2Y A;  3Q6S A;  3BDC A;  3VYT A;  5EPL A;  1STH A;  5M3F B;  1TS3 A;  4KV6 A;  5C6A A;  2JP1 A;  3NK9 A;  3GTL B;  1WTV A;  1SDF A;  4I7Z C;  3WDN A;  1GUO A;  4CJ1 B;  5FLX E;  4A3K B;  1Q90 A;  2IX0 A;  2EZV A;  4WOR A;  1IW7 C;  2MHV A;  1BQQ T;  4A3G B;  2JA7 B;  4QUF A;  1J8I A;  1Y1W B;  2EY5 A;  3FDT A;  3I4L A;  1VF7 A;  4ILW A;  1PTO B;  1SYD A;  1F9Q A;  3P75 A;  1U4L A;  4RGN A;  2MUY A;  3HOZ B;  4ZK9 B;  3OMG A;  5EGT A;  1EWC A;  1GUT A;  1I4R A;  1D5X C;  2Z4I A;  1B9M A;  4H0L C;  5CC4 A;  2EYP A;  3L9A X;  1IKM A;  2I07 B;  2PZT A;  1A3V A;  3R2T A;  4PNY A;  1S5C D;  4CJ2 C;  3U9O A;  2WV6 D;  1EOT A;  1CQV A;  1ET6 A;  1EY8 A;  5A35 A;  1PFB A;  3MXP A;  5DEH A;  3K0Y A;  5ELF A;  2JEB I;  4IFD G;  3WOE A;  2B2Y C;  2A69 D;  3DWA A;  2GA4 B;  2TMP A;  4N9T A;  4OIJ A;  1VF5 C;  1F2M A;  4KY6 A;  1HQR D;  5C0X J;  2OF1 A;  2ZXP A;  3KLR A;  2B2T A;  1CZW A;  2K05 A;  3I4N B;  2Y0S B;  3D4R A;  1PFM A;  2K5W A;  1TII D;  1HUM A;  2SNM A;  2L5T A;  2N55 A;  4Q5V A;  2B39 A;  4MIU A;  1YNJ D;  2IJ0 A;  3SVM A;  4OO1 I;  2K1B A;  2SEB D;  3I90 A;  1EU3 A;  3C1F A;  1STY A;  1OXU A;  1EWH A;  1RCV D;  3T13 A;  5C44 B;  1F9R A;  1PRT B;  4O1N A;  1BR9 A;  3R93 A;  4ME5 A;  3H91 A;  4K8I A;  2H4O A;  3K7A B;  4L63 B;  3S14 B;  3PUV A;  3JAM L;  1TWA B;  4M8A A;  2EY6 A;  2WII B;  2M9V A;  5C4H A;  3ERQ A;  3NQT A;  3J80 E;  3AB9 A;  1A2T A;  2KHS A;  4H44 C;  4FXG C;  3M4Y A;  4ZKC B;  5I9O A;  1O78 A;  2JEA I;  4R8I A;  2R61 A;  1SJE D;  1GUN A;  4FF1 A;  2RA4 A;  3P20 A;  4ABN A;  3T4A C;  1FD7 D;  5DM7 3;  1S5E D;  1L0Y B;  5BN4 A;  1WTO A;  1SEB D;  3I72 A;  4RGT A;  2A68 D;  1R4Q B;  2V4D A;  1D1I A;  3J7A F;  1JQY D;  1PTO F;  3NTH A;  4CHT B;  3MFY A;  1TS5 A;  5KNC A;  2F0O A;  2EVB A;  2KVM A;  3FRP B;  3A7A B;  4CGY B;  3M4O B;  5BN3 A;  1HRJ A;  1KAA A;  2BDN A;  3PMF A;  2OT2 A;  1SMY D;  5M5X B;  4C3I G;  1SND A;  1DON A;  2MP1 A;  4C3J G;  5DNF A;  1D1K A;  5IOD A;  1W6K A;  2M00 A;  1SNO A;  1X32 A;  2QIL A;  1ET9 A;  4PQX A;  4B9X A;  3FMC A;  2FMM A;  1HUN A;  1S5F D;  1EZ6 A;  1PDQ A;  3BS1 A;  2FFK B;  1AN8 A;  2RSN A;  3K58 A;  3T56 B;  2FMC A;  4U68 A;  3PV0 A;  1LTT D;  2F1M A;  1SYG A;  1JIC A;  1SJH D;  4RGM A;  5JEA J;  1YNJ C;  4J1M A;  1Q1E A;  1STN A;  3DEP A;  3OOC A;  1EY7 A;  3OSO A;  1I6V C;  1Q8I A;  2D2C C;  3WOF A;  5D65 A;  3SR1 A;  4L6T B;  3FEW X;  4ZUI A;  5EKI A;  4P2C B;  2CW0 C;  1HTL D;  3C2P A;  1JWS D;  3KUP A;  2SNS A;  2MGS A;  2A73 B;  1B2T A;  1AZP A;  1TWF B;  4FF3 A;  2B2W A;  4G7O C;  3EQL C;  2ZT9 C;  3MFG A;  3VA7 A;  3HOV B;  4KHZ A;  4K6L A;  2EJF C;  2L1B A;  3QOL A;  2O5I C;  5IGC A;  1RKN A;  2BCO A;  1WTQ A;  4DF7 A;  1EZ8 A;  5DM6 3;  2F0P A;  1QOH A;  5JVG 3;  4EQO A;  1V43 A;  2IX3 A;  1WTX A;  4FVM A;  5CV5 A;  2X6G A;  2F4I A;  4KJO A;  2SOB A;  2K28 A;  5EPJ A;  1FNU A;  4ZYS A;  1EFI D;  1CHP D;  4HCE A;  1K83 B;  1R9T B;  1A2U A;  4RCO A;  4IUN A;  1Q1B A;  2B2V C;  1II3 A;  4KD4 A;  1M8A A;  2RDF A;  1TY0 A;  5CV9 A;  1V8Q A;  1WCM B;  3HP3 A;  1SYC A;  5D3D A;  3K5O A;  2B2V A;  2WB1 B;  3I70 A;  5CV4 A;  1TY2 A;  1TVX A;  2F0H A;  5FO7 B;  3IL8 A;  5IGG A;  2FIN B;  2E75 C;  1PRT C;  4QCL A;  1SAP A;  3D6C A;  1QCB D;  3S1R B;  1WTP A;  2DN8 A;  3BVM A;  4ZLT F;  3A56 A;  1UEA B;  1ENC A;  1F2Y A;  3GV3 A;  3C46 A;  1CT1 D;  3NPP A;  4DNR B;  1YNN C;  2WIN B;  1BOS A;  2K5D A;  5M9O A;  3I4M B;  2F0Q A;  1F2Z A;  2JA6 B;  1DD2 A;  3GTO B;  2X6L A;  1DCZ A;  1H9R A;  4PMW A;  2IX1 A;  3GTP B;  2ID0 A;  1TQO A;  1RDP D;  5LL6 S;  1O7Z A;  3I3C A;  5KNB A;  2ZXO A;  3CKI B;  3M7G A;  5EQ0 A;  3S1M B;  3TSS A;  1A15 A;  4KKS A;  2JA5 B;  3K59 A;  4B08 A;  2EDG A;  4XQJ A;  3PO2 B;  1EQV A;  2XRQ D;  5I6W A;  2J7Z A;  3QWN A;  5G3L D;  2NZ1 D;  3S1N B;  2CHB D;  1LT4 D;  3OIP A;  1SNM A;  2BOS A;  4LJZ C;  2KOL A;  3NE5 B;  2KCC A;  4H7B A;  3DUZ A;  1SBB B;  2EE1 A;  1UAP A;  2JE6 I;  4L8J A;  5KIX A;  4RWS C;  3PUY A;  4X3T A;  2LKV A;  2FHT A;  1A3U A;  1F2L A;  5C4J B;  3HGB A;  4KY7 A;  3IFT A;  5JJZ A;  4IUU A;  2XNA C;  4X3S A;  1OXS C;  1K8O A;  1NCV A;  3TP6 A;  1IW7 D;  1JWU D;  1PTO C;  2N88 A;  4FP5 D;  2XWB B;  2JYO A;  3VR2 A;  2B8F A;  1G2T A;  1H9K A;  1PTO D;  3HEJ A;  3IAY A;  2F0M A;  1QB5 D;  2FJ2 A;  1Y8P B;  1MGS A;  5JVH 3;  2PPB C;  1DYQ A;  4IFD I;  2EYM A;  5I4D A;  2QKI C;  3TZD A;  2A69 C;  5KYI A;  1A3T A;  1FGB D;  3N6R A;  3G7L A;  1ZKO A;  5C0X H;  4F8M A;  4KMU C;  3HOW B;  3AU7 A;  4HN7 A;  5E4X A;  5TSS A;  5C3W A;  2WAQ B;  1QE6 A;  4Q0F A;  5CR3 A;  1CZG A;  1UNS A;  2K01 A;  3DEO A;  3F2U A;  1SMY C;  1KTK A;  4I65 A;  1BCP B;  4A3D B;  1DZ1 A;  2HQE A;  2VNU D;  1XX8 A;  1CHQ D;  3AMU A;  1Y8O B;  2E2J B;  1EYD A;  3G6J B;  1BF4 A;  1K8M A;  1TT2 A;  2IT1 A;  5M5Y B;  1NR4 A;  1LTI D;  2XSC A;  1C48 A;  2NWG A;  3Q23 A;  1WTW A;  1CA6 A;  2XN9 C;  3QIA A;  2NVT B;  3HOY B;  4XIG S;  1VDZ A;  4R8N A;  4V19 0;  2O2L D;  4XQQ A;  2NUC A;  2C9O A;  2DNE A;  3D31 A;  4EQP A;  1ICW A;  3K5L A;  2BDO A;  4RCN A;  3HOX B;  1LT6 D;  1NSN S;  1WD0 A;  4NW2 A;  3E5S A;  5KRU A;  3RUZ A;  4DU9 A;  3MC0 B;  4HSV A;  2F0E A;  5CV7 A;  3O13 A;  4RA8 A;  1XYI A;  1O80 A;  3TP8 A;  2EYJ A;  4FXD A;  5CV6 A;  5K36 G;  3MTS A;  1MSG A;  1TKW B;  3NBH A;  1CA5 A;  1ONL A;  2QF7 A;  1CM9 A;  5I6Y A;  5KGU A;  4FXK C;  3J80 L;  4CKE A;  1JOO A;  1SE3 A;  5A2Q E;  1M4V A;  2D5D A;  5M3M B;  5T1I A;  3PIP 3;  3JAM E;  3TP5 A;  2XVS A;  4DAV A;  2AQ3 B;  5C4X B;  4DK1 A;  2OEO A;  3GO5 A;  4XQN A;  4KHV A;  2ICE C;  4DFA A;  3GTQ B;  3RMH A;  5C3E B;  2SDF A;  1TWH B;  4NP5 A;  1GUG A;  3U9S A;  4CJ0 B;  2RQX A;  2KA7 A;  2VUM B;  2LMC B;  3A7L A;  1KDB A;  3C1E A;  2IW3 A;  3V96 A;  4G7Z C;  2BE5 C;  4BY7 B;  2LS0 1;  1YNN D;  3SK4 A;  1TS4 A;  4K8J A;  3TZU A;  1U4R A;  2EPB A;  5FO9 B;  3HRZ C;  2F03 A;  1SNC A;  3DMU A;  4CBV A;  4G57 A;  3KBG A;  4QB4 A;  2B8G A;  4GZY C;  4ZKB B;  3D3R A;  5ELE A;  1ZYR C;  5IIF A;  1RF2 D;  3E6Z X;  3E0J A;  3OWE B;  3NWT A;  3SE0 A;  3W2D A;  1TWG B;  1ILQ A;  1F77 A;  4MN3 A;  1HFG A;  3ND9 A;  1H9S A;  1HA6 A;  4JBW A;  3VR5 A;  2EYH A;  3J7A V;  4RHR A;  1QG7 A;  1T5X D;  1D6E C;  2CVR A;  3T51 B;  3TN2 A;  1Q3L A;  2EJG C;  1PXU A;  4Z9C B;  3J81 E;  3GTM B;  3P7J A;  4K5W A;  4DAP A;  4A3I B;  1EY4 A;  3KLS X;  3CU7 A;  4ODG A;  2HCI A;  2F3W A;  1CK1 A;  5EBD A;  4A3B B;  3EFX D;  5CBA E;  2R92 B;  1WTR A;  4C3J B;  3H3V C;  5J22 A;  2EYL A;  5A2Q L;  3SDZ A;  1GHK A;  2RVL A;  4BA2 I;  1B9N A;  3FPU B;  1UUP A;  4X3U A;  5FKA C;  2E74 C;  3FKI B;  1MI2 A;  3OIQ A;  2F3V A;  1STB A;  1D5M C;  5FK9 C;  1V1P B;  1VCI A;  5E4W C;  1SE2 A;  4HED A;  4QMG A;  3QJY A;  3QO2 A;  1OO9 B;  4DXG A;  2F0I A;  5C5M A;  1E2W A;  4K6D A;  4PV1 C;  1RHP A;  2PYK A;  4LMQ D;  2Q8T A;  2L55 A;  3S15 B;  1BBX C;  5ISR A;  1DJR D;  1MD2 D;  5IT9 E;  4V0B A;  2J0T D;  4FF2 A;  1CTM A;  3SK5 A;  1KLG D;  3GD7 A;  4WRD A;  2NVQ B;  2DY7 A;  1PYW D;  1FNW A;  3D8G A;  1B44 D;  5EKK A;  4LAA A;  3R2I A;  1JOQ A;  4IUV A;  1LT5 D;  2B2W C;  2K7V A;  2RDH A;  2Q8I B;  3HZX A;  3KK7 A;  1SYE A;  1B3A A;  4HSP A;  4RHS A;  4Y7N B;  3H09 A;  1B50 A;  4YIJ A;  5CMD A;  2PW7 A;  1KNA A;  2B2T C;  3K5N A;  4IFD H;  2KEE A;  5ELD A;  2A74 C;  4BBR B;  3GTG B;  2C5C A;  4K2L A;  4A93 B;  1JOK A;  1BCP F;  4J8Q A;  2PO4 A;  1PTO H;  3RZO B;  4K5X A;  1HXY D;  2HDL A;  2NYZ D;  2WKC A;  4HR7 B;  4IFD J;  1Y1V B;  3Q24 A;  3M7N A;  2XIW A;  1PZI D;  3HOU B;  3DM1 A;  2K6A A;  1QIL A;  2WKD A;  4IUP A;  1PZK D;  1JC7 A;  1SSO A;  5C0X G;  1V1P A;  3M85 A;  3HS0 C;  4E6I A;  3V2T A;  5IGD A;  5KYL A;  2B2U C;  2K03 A;  3VYR A;  3RLF A;  5COY A;  3LWE A;  4ULL A;  1T5E A;  4RGO S;  4X3K A;  2NN6 I;  3P1H A;  2R6G A;  3SHL A;  2NB0 A;  3J7Y W;  2KUM A;  2PQE A;  2RSO A;  1QWY A;  2A68 C;  1Q12 A;  1PRT F;  2F0J A;  1EY0 A;  1X3P A;  3H94 A;  1LO5 D;  2BA0 A;  4XYO A;  4XTC S;  4QUC A;  2BA1 A;  2ICI A;  3BZD B;  1Z6H A;  2WAC A;  5LHY 1;  2E2H B;  1QNU A;  3NTI A;  4QIW B;  1S4Z A;  3CHB D;  2F0S A;  4UAI A;  1ZYR D;  5JPN C;  3L7Z C;  2F0K A;  1KAB A;  3GTJ B;  1HFN A;  2X69 A;  1JB3 A;  1KNE A;  4CKC A;  5J1Z A;  4IUT A;  4XYQ A;  3A55 A;  2H1E A;  4C2M B;  5EKL A;  1AEX A;  1Z47 A;  4K14 A;  1S5D D;  1ZXT A;  2EYO A;  3MHB A;  3ERO A;  2F0G A;  3KLS A;  5ELC A;  3ONA B;  4PMC A;  4EVO A;  2F0L A;  5IGB A;  3ITP A;  2D62 A;  2PZW A;  4N9P A;  3IKJ A;  4TKO B;  1DM0 B;  5FLX L;  1OXX K;  2G9D A;  4ID6 A;  4MHE A;  2CW0 D;  4DN4 M;  3VR4 A;  1RJT A;  1I4H A;  1HCZ A;  1ROD A;  1VMP A;  3LWU A;  3GTK B;  1RTN A;  2VB2 X;  2AUJ D;  3PO3 B;  2VB3 X;  5CGK A;  3GQB A;  1I6H B;  3Q22 A;  3A54 A;  3A8K E;  3K5M A;  1I3Q B;  3OPO A;  4F88 A;  4JK1 C;  3A8I E;  2HCC A;  3BDO A;  2XRS D;  2AWN A;  2L9H A;  3CRK C;  3NUC A;  3NHH A;  3OWF A;  3UI2 A;  2F0T A;  1ILP A;  1B1Z A;  5T1G A;  1OXT A;  4F7X A;  5JEA H;  2AQ2 B;  4TRD A;  3H6M A;  1D5Z C;  1JR0 D;  2R3Z A;  3N52 A;  5EPK A;  2NN6 G;  1STA A;  3IFD A;  3BYT B;  2WP8 J;  4IUQ A;  3FVQ A;  4M1U B;  1EEF D;  3TP7 A;  3URY A;  3LNN A;  3QG1 A;  1HQM C;  1EQT A;  5I9P A;  2JXM B;  1Y8N B;  2VXW A;  4LK1 C;  3R8B A;  4KN7 C;  5CBE E;  2L4N A;  2B63 B;  2KCN A;  1BO0 A;  4DA2 A;  1AW7 A;  2R7Z B;  1E2Z A;  1EYA A;  1DOL A;  2A6E C;  4RKB A;  1IYU A;  1FYC A;  2DY8 A;  1MBY A;  2Q8R E;  2F0D A;  2OXP A;  1D2B A;  1WD1 A;  1XWE A;  2EYF A;  4U67 3;  3GP7 A;  3PUW A;  1G8Z D;  1RTO A;  2YYZ A;  5M5W B;  4G7H C;  1H9S B;  2AWO A;  2K32 A;  1ML0 D;  2KEC A;  4IAL A;  1G2S A;  1R4P B;  1O7L A;  3BDL A;  1G6Z A;  5K5P A;  3BG3 A;  1JWM D;  2HUG A;  4OGQ C;  4BS9 A;  3FPP A;  4ZUJ A;  4KKT A;  2PW5 A;  2A5H A;  2G9H D;  2QEJ C;  3QOJ A;  1IHZ A;  2NVY B;  3MVV A;  3S1Q B;  3ZYY X;  2ZXR A;  3DWP A;  2MJ8 A;  4RAU C;  5CYU A;  4RH6 A;  1DXM A;  2CQA A;  2PZU A;  3LX0 A;  1HHV A;  3MWY W;  2NN6 H;  3H0G B;  1IL8 A;  1SXT A;  2Z4H A;  2NTT A;  5JEA G;  2M2L A;  1TU2 B;  4J6H A;  4XDX A;  3PUZ A;  3TDQ A;  3A8J E;  1EIG A;  1OXV A;  3VA5 A;  4KTA A;  4ZAI A;  4OO1 G;  1AZQ A;  4G4K A;  3BYY B;  4DXF A;  1CFM A;  1TS2 A;  2KJX A;  2XWJ B;  1STE A;  3MXU A;  4KKU A;  1F9P A;  3NWS A;  5E1F A;  1SYF A;  2JA8 B;  4OHJ A;  1ENA A;  3T16 A;  1SFO B;  4KN4 C;  4BWG B;  4IQZ A;  2HDM A;  4R9W A;  1TWC B;  4AYB B;  4C3H G;  5EJW A;  2F0V A;  1KDA A;  4FNF A;  5AFW A;  1ENF A;  3S2H B;  1NUC A;  1NR2 A;  1GXD C;  4B9W A;  1C8C A;  2AUK A;  1JCK B;  3OMC A;  4IN3 A;  5D14 A;  1STG A;  5D3I B;  3J81 L;  3VR3 A;  3I73 A;  2K33 A;  2EJM A;  4A3J B;  3V05 A;  4HMJ A;  4HTH A;  4WJW A;  1GUW A;  1H9M A;  3MXG A;  4KI0 A;  4C56 C;  1BUV T;  1NAP A;  3I91 A;  1E0B A;  3NQI A;  4A3M B;  2QDB A;  1EU4 A;  2A6H D;  1U9R A;  2E76 C;  2J4X A;  1V1O A;  2NBF A;  2B2Y A;  2AQ1 B;  1AP0 A;  5LL6 X;  3SK8 A;  3HG9 A;  1XXG A;  4H13 C;  5IGE A;  3KF8 A;  1LAB A;  5JAV A;  1H9J A;  1L0X B;  1PFN A;  2K5Q A;  3PUX A;  5F2D A;  3K57 A;  1B4O A;  1FR3 A;  3EVQ A;  4XXE A;  3EJI A;  2PMZ B;  4FO2 A;  4EGV A;  1I4P A;  1ESR A;  3M3Y B;  1LV9 A;  2TSS A;  3MA2 B;  5DAU A;  4F87 A;  3GV6 A;  2RBM A;  1KLU D;  1GHJ A;  2O5J C;  1QJO A;  4K5V A;  1DOK A;  3MZ5 A;  4C3I B;  1SE4 A;  5C0X I;  5G3L F;  1BCP D;  2D9U A;  4IUR A;  4DAY A;  4BY1 B;  1HTP A;  4CKB A;  3NSW A;  4TQU S;  3W3A A;  2IL8 A;  1AFP A;  1VMC A;  4S3S A;  5NUC A;  5JOB A;  2EXZ A;  5KEE A;  1IKL A;  4A3F B;  1S5B D;  4XT3 B;  4ZQ3 A;  1SNP A;  5K36 H;  2PNR C;  3K6O A;  4BA1 I;  4WFN 3;  1C4Q A;  1Y69 U;  2L0C A;  4UDU C;  5CV8 A;  4O42 A;  2I46 A;  5JPM C;  2LFN A;  1HA5 A;  1MSH A;  1DOM A;  1U4M A;  3SXH A;  2IWH A;  1EY5 A;  3Q0A A;  1U4P A;  2ENB A;  3MEH A;  5C3X A;  1A6X A;  3DXJ C;  3S9W A;  3D6W A;  5EBC A;  5IOC A;  1JE4 A;  1PZJ D;  2K04 A;  4HCS A;  2B2U A;  3NP8 A;  1EY6 A;  1X3Q A;  3D4D A;  1EYC A;  5BN5 A;  2F0F A;  4FYD A;  4KY5 A;  1E2V A;  2EY1 A;  3S17 B;  3MAQ A;  1G91 A;  2BE5 D;  5E3F A;  1RD9 D;  3EA6 A;  2YU9 B;  5C4Z A;  1LT3 D;  2NVX B;  3QB3 A;  2F0W A;  3SEB A;  1BNZ A;  5FO8 B;  5COR A;  4C3H B;  2A6H C;  3ND8 A;  1F9S A;  4DK0 A;  2LY7 A;  1EY9 A;  4KK7 A;  1WVL A;  2EOT A;  1CQF A;  4ZRZ A;  4KD3 A;  3TBI B;  1I50 B;  1JOR A;  5ELB A;  3RD4 A;  2KQ3 A;  5IGF A;  1GUS A;  1QNK A;  2E2I B;  4EQN A;  5I2X A;  1B53 A;  3PIO 3;  2RDG A;  1I4G A;  2KED A;  3VYU A;  1O7Y A;  4C1N I;  4RFB A;  1ESF A;  3VR6 A;  2IPK D;  1LTB D;  4OL7 A;  3T53 B;  4NKL A;  3X3N A;  2L11 A;  4OIK A;  4XT1 B;  1CI3 M;  4HMI A;  1BXT A;  1FNV A;  1EIH A;  3I8Z A;  4C1N K;  3L3O C;  1BCP C;  1G29 1;  4PMB A;  1HPC A;  3RZD B;  1LTS D;  1W6J A;  3SK6 A;  5KND A;  4BBS B;  1GJX A;  3NXW A;  3R3O A;  3DWQ A;  1LTG D;  5J39 A;  3C3L A;  5C5L A;  3S16 B;  2JSO A;  3NBI A;  2RKS A;  4RKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...