4RA8A

Structure analysis of the mip1a p8a mutant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
68
structure length
68
Chain Sequence
SLAADTATACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords C-C motif chemokine 3
publication title Structures of human CCL18, CCL3, and CCL4 reveal molecular determinants for quaternary structures and sensitivity to insulin-degrading enzyme.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 68
sequence length 68
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ra8A00
1CA5A 4UAIA 3I91A 2K01A 2M2LA 2NYZD 2B2YC 1WD1A 5JJZA 2B2WC 4QUFA 1JE4A 1RHPA 5DNFA 4ZKBB 1NR4A 1QE6A 2K04A 4ZAIA 2RA4A 2DY8A 2D9UA 2L1BA 5E4WC 2RVLA 1HUNA 1F9QA 1NR2A 2SDFA 1O7YA 1PDQA 2Q8RE 1J8IA 1EQTA 2KUMA 2B2YA 1G2SA 1A15A 1X3QA 4X3UA 4ZLTF 1B4OA 1RJTA 3DEOA 1F9SA 3R93A 4R8IA 1F9PA 2HDLA 1SSOA 4IUPA 4X3SA 2K28A 2KOLA 4MN3A 1AZQA 1BBXC 1O7ZA 2J7ZA 1J9OA 1B2TA 1HUMA 2EE1A 3I8ZA 1BO0A 2KVMA 4X3TA 1B3AA 4OIJA 1DOKA 1IL8A 2MGSA 2MP1A 2FHTA 1X32A 1PFMA 2X6GA 2NZ1D 2FINB 1PFNA 3IFDA 2MPMA 1WTOA 5EKIA 2FMMA 1DONA 1GUWA 1U4LA 2B2VC 1HFGA 4ZKCB 1PFBA 1G91A 2R3ZA 1E0BA 2HCCA 1DZ1A 4IUTA 2X69A 1MSHA 2L9HA 1C8CA 1HHVA 4MHEA 2RSOA 1WTPA 1HRJA 2K05A 1O80A 1QNKA 2HDMA 1ML0D 1MSGA 1S4ZA 2B2VA 2JP1A 2L4NA 4HCSA 5EPJA 1KNAA 1U4PA 1X3PA 1SAPA 1B53A 1EIGA 1RODA 4IUQA 1Q3LA 1ZXTA 4IUVA 4R9WA 1ICWA 1WVLA 1MI2A 1F9RA 4CJ1B 3N52A 3F2UA 2CVRA 4RWSC 2KECA 3KBXA 4CJ0B 2B2TC 1U4MA 2HUGA 1M8AA 2BDNA 4IUUA 2FFKB 5CBAE 1WTRA 1NAPA 1BNZA 5D65A 1IKMA 4X3KA 3SVMA 1EL0A 2B2UC 1SDFA 2B2TA 2L12A 3I90A 4IURA 1WTWA 1DOMA 3G7LA 4O42A 5EPLA 1WD0A 1BF4A 2RSNA 2XIWA 1HA6A 4QUCA 1MGSA 3Q6SA 5EJWA 2EPBA 3DEPA 1ESRA 4HEDA 1JICA 1F2LA 4XT1B 1WTQA 2H1EA 2B2UA 3D6WA 1U4RA 4HAEA 4RAUC 1PLFA 5T1IA 3TN2A 5CBEE 1AZPA 1ILQA 2FJ2A 1QG7A 2HCIA 2L11A 5EQ0A 4CJ2C 3DM1A 3GV6A 5EPKA 3ONAB 1VMPA 1CM9A 3GV3A 1DOLA 1EIHA 3P7JA 4RA8A 5AFWA 2K03A 1XYIA 1EOTA 1IKLA 1NCVA 5D14A 2N88A 1XX8A 1AP0A 3KUPA 4DN4M 5COYA 1B50A 1LV9A 3MWYW 2Q8TA 1HFNA 1KNEA 3UI2A 2IL8A 5E4XA 4ZK9B 1TVXA 4NW2A 3I3CA 2KEEA 1G2TA 2B2WA 1WTVA 2K1BA 2VXWA 3HP3A 4OIKA 5CMDA 1RTOA 1G6ZA 2EOTA 1CA6A 1RTNA 4XT3B 5CORA 1ILPA 1VMCA 2X6LA 3TZDA 4LMQD 4U68A 2KEDA 3IL8A 3FDTA 3H91A 3FPUB 3QO2A 4XDXA 2NWGA 2JYOA 3MTSA 4HSVA 2MJ8A 3LWEA 1WTXA 2N55A 5T1GA 2DY7A
chains in the Genus database with same CATH superfamily
4O0AA 5BR8Q 2F4IA 2B2YC 1I94L 4FNFA 3B6YA 3CC4A 4DPGA 1YITA 3G6JB 4A3MH 1EY0A 4DV3L 4LUZA 2NTTA 3K5NA 3I2ZA 4EGVA 3I4NH 1NTGA 4ZUJA 4WJ3M 2JE6I 5LHY1 4JBWA 2PZUA 5IWAQ 5A35A 2FINB 2ZM6Q 2B2VC 5BR8L 4LF7L 5DM63 3MHBA 1I50H 2HCCA 4XYQA 3DUZA 3TEHB 5KNBA 1FVIA 4C3IB 2AQ1B 1S4ZA 3RNUA 2M00A 3K58A 1SAPA 1RODA 4C1NI 1HTPA 4DAMA 2MQHA 2EVBA 1D8LA 1QUQA 4RWSC 4CJ0B 2HUGA 1F2ZA 1XJVA 1SMYD 2F3VA 5GAGC 1NAPA 3I4OA 3T1HQ 5LMUL 2OTLA 2ZM6L 4IPDA 4KI0A 1BCPB 3G7LA 1WD0A 4Q5VA 3V96A 2BOSA 4RHRA 1EY5A 2MNAA 1TWHB 4TVAB 3S2HH 3F1ZA 5C5LA 2JJQA 2H1EA 2YTYA 2E2IB 4I7AA 1X3FA 1A63A 4CJ2C 2FJ2A 4XIGS 2D5DA 3VR4A 3UDFA 3RD4A 1FD7D 3WDNA 3HOZG 2F0SA 3U9OA 3MXPA 3P7JA 1TWGB 4QJFA 4DFAA 1TXYA 4DAYB 1TIID 1LO5D 1TT2A 4BBSB 2IL8A 4NKLA 2WAQE 3EA6A 2RBMA 4C2MH 2HIXA 4X65Q 1YIJA 1N34L 5EAYA 3R8BA 1VQGA 3QIAA 4N9TA 3M4YA 4P74A 1HR0Q 1GJXA 1PTOB 1SE3A 4KD4A 2F0UA 4L5RC 1VQ7A 3C1EA 4A3KG 3C3LA 3MTSA 4A3CG 1Q8IA 2JA5B 2MJ8A 3K7AH 1WTXA 2I5HA 3S1QB 3I91A 2ZJPA 2JA9A 1TKWB 4HTHA 5I2YA 4HJ7A 3K59A 4N8X1 1PRTF 5DNFA 4ZAIA 1EY8A 1AFPA 1F9QA 3KLSX 1DYQA 4IN3A 3DEOA 3AEVA 2Z6BA 4FYDA 4X3SA 2H5XA 1HR0W 4KJOA 1B2TA 3K8AA 1GUSA 4RGTA 3VYTA 1HR0L 2JEAI 2VZAA 3VYSA 4TRDA 1VQBA 1EZ6A 1FR3A 3QJYA 5A2QE 3OTOL 1QVFA 1PFNA 3AFQA 5C6AA 1SE4A 1HFGA 2PQEA 4MTKA 1K8GA 5D3IB 1B70B 4ALPA 5ELBA 4A3JH 4P72A 5FLXE 2LKVA 4GZYC 3PCOB 1JT8A 3CCVA 5GQOA 3IRBA 1D5ZC 1SE8A 1PFSA 1PZKD 3F8TA 5TSSA 1FNUA 1KLUD 3PO2B 1J5EQ 1SYCA 4IPCA 1B9MA 2L12A 2E5LQ 4GN4B 3M3YH 2XN9C 1NSNS 1VQOA 2DNCA 3J7YW 1PRTD 5IT9L 3GTLB 3KDFA 1LUZA 1X54A 3H3VI 3D31A 3AYHB 1HZCA 1WFQA 1E2ZA 1E1TA 2XWJB 1J5EL 3I4LA 4JCVE 4GN3B 2B63G 1LV9A 3NUCA 3UI2A 4DK3C 2CW0C 1IYJB 3P20A 2E5LL 4BY7B 4H44C 1AE2A 3RZOB 4DNTB 2YYZA 1ICFB 1PH8A 4PZ7A 4TSSA 2UU9Q 4AYBG 2X6LA 2R7ZB 2QDLA 2JEBI 4ZRZA 1E3PA 2K50A 1IW7D 3SDZA 1B1ZA 2A6EC 4A3IB 3G4SA 3S14B 5JVG3 5JOBA 2B2WC 1A2UA 5FKAC 3MXNB 4A93G 4K14A 5C3XA 5IGCA 4A3DG 2EIFA 3I73A 1B4OA 1F9PA 3CPFA 3NBIA 1LYLA 2F1MA 1HUMA 2KVMA 2UU9L 3S24A 5I2XA 4YWMA 3R2IA 4PMCA 1H9SA 1L0WA 3KYHC 1LTRD 1DZ1A 1YHQA 4BY1B 2QDBA 5EKIA 2FMMA 3I72A 3J80E 1VS0A 5I6YA 5JPNC 3J7A5 1E1OA 1I4QA 2L9HA 1O78A 2VNUD 2EJMA 3CC2A 1HCZA 3STBC 1Y14B 2PQAA 4JI5L 4GN5A 1U4PA 3PO3G 2YU9B 1EIGA 1VCIA 1ZXTA 4JI0Q 1EFID 5EKLA 2K5HA 1F9RA 2SOBA 3DXJC 3MEHA 1E22A 2QW7A 2UXCQ 5ELNA 2UXBQ 4IOAA 1ENFA 3NQTA 5CBAE 5ELFA 4PG3A 3GDEA 4JK1C 5IT9c 4X3KA 1RKNA 1SROA 2IHEA 2XIWA 1MGSA 4GOPA 2EPBA 1F2MA 2WB1B 1PVOA 1TU2B 5M3FG 3E6ZX 5EQ0A 1DJRD 3EBEA 1SFOH 2IX1A 3GD7A 3HS0C 2EDGA 3H3VC 1TWHH 2ID0A 4JW0A 4CKBA 2R93B 4X64L 2UXCL 2EY1A 3R3OA 4BBRB 4L5TA 1JMCA 3EQLC 1NY4A 4PMWA 1MIUA 2F0GA 1LTSD 1TWGH 1G2TA 4HIMA 4RHSA 2RDGA 4A3EB 3T16A 4XQNA 1LTAD 3KF8A 2VQFL 1RIPA 1N33Q 4BBSH 4FXDA 1QILA 2IY5B 1YHAA 1PYBA 1U5KA 2JA8B 2VW9A 5FJ8H 3IKJA 1YZ6A 3Q24A 3I4MG 4YCVA 4CDEC 1LTLA 2PNRC 1PTOH 1XNQL 4HJ9A 4DNRB 1NR4A 4HMJA 5E4WC 3J81j 2JA5H 3S1QH 3S16H 1G2SA 1GUNA 2WB1E 4DUZQ 4Y52H 3U50C 4K8IA 3NENA 3W1BA 1SSOA 1O7ZA 2J7ZA 1CZGA 2EE1A 4CDDC 1BO0A 5KEEA 1MBYA 1N33L 1AE3A 1DOKA 3W5OA 1QZGA 1SEBD 3CXCA 1K0RA 2K32A 2A19A 3F2DA 3LGJA 3HOXG 2ZJQA 1BQQT 3TP5A 1E0BA 2IWHA 5JJLA 3ND8A 4LUVA 3DWQA 1VF5C 2LSSA 3HOYB 4IFDI 4JYAQ 4J6HA 2IT1A 3HOVB 1I6VC 2D0PA 1CKNA 3T4AC 2K33A 1EYAA 4C3JB 2HHHQ 1KL9A 3K80C 4LUOA 3A8JE 4KN7C 4L6TB 1GHKA 2MFIA 1BNZA 2K7VA 3AFPA 3SVMA 5IGFA 1L2FA 1I5FA 5E3FA 1S3OA 5EPLA 2IX0A 4U673 3PO2H 1K0SA 5EJWA 3Q6SA 1V43A 2ENBA 2NN6I 1SNCA 4JYAL 5M3MB 1S5FD 1KRTA 1A62A 2BH8A 3FMCA 4OEMB 5A2QL 5IYBG 2O2LD 3LNNA 4KK7A 2LXJA 1AEXA 1S40A 1YJNA 4DAPA 4JI6Q 2E2JB 2OQKA 3AB9A 1CSQA 4XYOA 2D0OA 1XX8A 5M5WH 3HOWG 5FLXL 3GTLH 2Y0SB 5KNCA 1L1OB 3O13A 5JVH3 2I5MX 5LL6X 4O2DA 5C44G 1Y8PB 1SNOA 4XT3B 3G6EA 1HNZQ 3H0GB 2K4KA 3R2TA 3TZDA 2R92G 1KTKA 3IL8A 1Z7TA 2QEJC 3A0JA 4QIWB 3RZOH 4IALA 1VQHA 4JI6L 3NQIA 4O1NA 4ZKBB 2K04A 2NN6G 2ZTCA 1NR2A 1EQTA 2JA7B 3D4RA 4A3IH 5CV7A 1RJTA 1VQ4A 1STBA 4J15A 3ERSX 2NTSA 1G291 2TMPA 2V4DA 1UE1A 1OXSC 4IJLA 4DR4L 1JJ2A 2IHFA 1HNZL 1Y1WG 1IZ6A 4DGZA 3TRZA 2ZJRA 2YTVA 2AQ2B 2FHTA 1X32A 1YNJD 2G9HD 1C4QA 2NZ1D 5CYUA 5IODA 3NWSA 2PMZE 1N36L 2FMCA 2KBNA 2LFNA 1N8RC 3MXUA 4M8AA 2MHVA 1Q82C 1SYEA 2F0VA 4BY1H 3CRKC 1QVCA 3C1FA 1CUKA 1UE6A 4APVA 3ULLA 4IFDH 1WVLA 4EQ5A 5C0XJ 2B3GA 3PV0A 4QIWE 1RCVD 4DU9A 2C9OA 3EFXD 3RN5A 4GS3A 2YU9H 4N9PA 4A75A 2CFMA 5D65A 1Q90A 2OQ0A 2RCFA 4Y7NB 1OXTA 4O42A 4F8MA 2OTJA 1M4VA 1S5BD 1TWFB 3OWFA 2F3IA 3MZ5A 3SK8A 4DV5Q 3T1YQ 1JCKB 3D6WA 1YVCA 2K6AA 1TR5A 2K14A 2HCIA 2L11A 1PH2A 3PUYA 3M4OB 5IIFA 1VQPA 3J80L 2CH4W 1LTTD 3LWUA 3VR3A 4P75A 4A3MG 2PW5A 2SEBD 3S2DB 2BE5D 3I4NG 2N8NA 2EQSA 2I07B 1CQVA 4LWCA 1PRTB 5ELCA 1LTBD 3J7ZC 3P75A 3HP3A 2PZTA 1BR9A 4K5VA 4ILWA 1YBYA 4DV5L 2UXDQ 3QOJA 1MJCA 4BBRH 1H9MA 2KEDA 3BJUA 3FDTA 1HZAA 1V1QA 4JBMA 2K5QA 1IBML 3MXGA 1A3VA 2DY7A 1VQNA 3HKZB 1QNUA 4A3EH 3JAMc 4POGA 1SLJA 1KRSA 3SR1A 3Q22A 1QOHA 1R9TH 4FF3A 2JQOA 2B8FA 4DV7L 3GTJH 4RKBA 2EYFA 4JOIC 5EBCA 2JA8H 4PZ6A 5FO8B 3QR8A 5GADC 1YJ9A 2E2HH 4DV2Q 1JQYD 4A3BH 4MN3A 2AQ3B 1ZYRD 2EYLA 2Z9HA 1TWCB 4RCOA 2UUBQ 1NE3A 1VQLA 3CCUA 4DAYA 4DR5Q 1WTHA 5C4JB 2A8VA 5KGUA 1CI3M 3W3AA 4V0BA 4H7BA 5I4DA 1N32Q 4R4TA 1HZBA 3MA2B 4BA1I 1STGA 4DV6Q 1GKHA 5JEAJ 2K05A 2JP1A 3J7AF 2JA6B 4RCNA 4DV2L 4LF8Q 2D2CC 1M90C 5FLMH 4AQYL 1D7QA 3PGZA 5IP7H 4FDBA 1FYCA 3HKZE 4JI4L 4DR5L 1K9MC 4GOPC 2OT2A 3HOVH 4JBJA 1NBWA 1N32L 4DUYQ 1TS4A 4KHZA 3J80c 4C3JH 1PXUA 2KCTA 1XNRQ 2RSNA 4KHPQ 4NPSA 1I3QB 4QUCA 4DV6L 1PH1A 1OXXK 3DEPA 4K8JA 3J80i 1TY2A 1BBUA 2MUYA 2VUMB 2O5IC 1F2YA 2WKCA 3GV3A 4XQJA 3NBHB 1WI5A 1SBBB 3RLFA 3C2PA 3FP9A 2GVBA 5D14A 5IWAL 4A3FB 3GTPH 1JWUD 3CHBD 3MWYW 2F0JA 4JI7Q 1HFNA 2MO1A 2R7DA 4DUYL 1I4GA 1I4HA 3TP7A 2E2JH 2KEEA 4P73A 4DV4Q 1XNRL 5IYDH 2VXWA 4KHPL 1EIYB 5K36G 3PUZA 4ZQ3A 4AYBB 5CORA 4BA2I 1ILPA 3RUZA 1H9RA 2L15A 4KLKA 2ES2A 1QVGA 4HSVA 3LWEA 4CKCA 4KKSA 3K5OA 5C3WA 4OO1I 1CFMA 3FRPB 3UE1A 1TS3A 3T56B 3H0GH 2CWPA 1U0LA 2WACA 3VR6A 3HOUH 3MEFA 4P2CB 3X3MA 1O7LA 3T1HL 4A3DB 4KHVA 1JR0D 1CKOA 4JI7L 3PUVA 2PPBC 4R8IA 3MC0B 5C4XG 1Q46A 4DV4L 2PYKA 1X65A 4CGYB 1A3UA 5IP9H 2ZT9C 2RDFA 5FO9B 4PNYA 4B3SQ 1ET6A 3NXWA 5IGDA 1RDPD 2JA7H 4C56C 4HR7B 3J81E 3IFDA 1WTOA 5C0XH 3L2PA 2CH4A 4GNXC 4LAAA 2R3ZA 4G7HC 2F3WA 2N3SA 2HT1A 1HTLD 1SRUA 1IHZA 4K0KQ 1HRJA 3MVVA 3GTGH 5IY0A 3DLLA 1QNKA 3VA7A 2ATWA 1ML0D 4X66Q 2OF1A 1KNAA 4X65L 4DR3Q 3FKIB 2NVXB 1BXTA 1EWIA 2K52A 3IFTA 2JN4A 3EN2A 1E24A 2KECA 5H1SE 5ELDA 3MAQA 2PI2E 3MXNA 5C3EB 1RD9D 4LF5Q 5HGQA 2N49A 1Y69U 3S1NB 4A3GH 3QB3A 5CGKA 4LF6Q 3ULPA 1FJGQ 3KLRA 4K0KL 3PF5A 4C1NK 2EJGC 4DR7Q 1RL2A 1JICA 2AHOB 1JOOA 3CAMA 4DR3L 2BH2A 4OONA 2ZXOA 1MHWC 3DMUA 4Y7NH 2F0FA 3A8KE 3QWNA 4DR6Q 2J0TD 1TWFH 1HQRD 4WFN3 1QUQB 2A68C 1G51A 4LJZC 2DJFC 1X3EA 3DM3A 4LF5L 5EGTA 5IYCH 4PQXA 3M4OH 2F0QA 1KNEA 4HJ8A 1WCMB 4LF6L 1YHBA 2RHSB 1JE5A 1FJGL 5CMDA 4OIKA 3TQYA 3S2DH 2VQEQ 1NMFA 4IPGA 3W1GA 3VR2A 2H4OA 1HNWQ 3KF6B 4V190 3BZDB 4JC0A 5CV6A 1K28A 2N55A 4DR6L 3HZXA 2M9VA 1Q1BA 3OPOA 5GAHC 1WOCA 4FVMA 1BOSA 3QG1A 1STEA 4OO1H 3KK7A 1QE6A 4JVZA 5CV4A 3J7AV 3Q8DA 1PH7A 1J8IA 2WAQG 2Q2HA 4HMIA 3UDXA 3OMGA 4YIJA 4DR2Q 5JEAH 4P71A 1DD2A 3TSSA 1KDBA 1GXDC 1YI2A 3M9BA 3F2BA 3QOLA 2F4VQ 2O5JC 4QB4A 1DONA 3ITPA 1TWCH 4F7XA 2QF7A 3CMEA 1HA5A 1LTID 4OHJA 3CW2C 2CW0D 5C4JH 3ER0A 3NWTA 2Z6KA 3T51B 5BN5A 3OSOA 3CCLA 1CKMA 4CHTB 2ASBA 4DR2L 3TS2A 2BA1A 3F2UA 3Q0AA 4B9XA 3L9AX 3SE0A 1JOKA 1W3SA 2A6ED 2F4VL 3SK4A 2JA6H 2FXQA 4FXKC 3IAYA 1K3RA 3A7AB 3D6CA 1W2BA 4IURA 1EIFA 1B44D 1GUGA 4BBSG 5DLQE 1J6QA 1Q8KA 1T5EA 2CCZA 1V1PB 1Y1VB 5ELEA 2ICEC 4XXEA 2F0DA 2NZOA 4KD3A 4S3SA 5C4HA 5FJ8G 4RAUC 3TN2A 5CBEE 3T53B 3BVGA 2Z4IA 4DK6C 1H95A 3PF4A 2V1CC 1PHJA 1I3QH 3ONAB 5I9PA 2JA5G 4C3IH 4KY6A 4OX9Q 4RGMA 2EYPA 4RA8A 5AFWA 2JXMB 1RF2D 1JC7A 1XWEA 4DR1Q 1CSPA 2VUMH 4RFBA 3NTIA 1EOVA 3KJOA 1D2BA 1HNXQ 2F0EA 3STBD 1BKBA 4R4QA 3S1MB 1SNQA 1G6ZA 4YWKA 5C44B 5IGGA 1RTOA 4IZ8A 1CHPD 4A3FH 1BCPC 1VQDA 1CQFA 5IGEA 3QO2A 4JI0L 1XMQQ 2K75A 1JB3A 5T1GA 3ZJYC 2UUAQ 1VQEA 2M2LA 4OX9L 2F0NA 2UXBL 2E2IH 1EZ8A 3V2TA 2KCCA 4OXPA 2RA4A 2F0WA 3VDYA 3CP0A 1HNXL 2HDLA 3L7ZC 4NDXA 1C48A 2KJXA 1AZQA 5M5YB 3HEJA 1Y1WB 3I8ZA 3I70A 1VQ6A 1D5MC 2VY3A 1KC8C 1XMQL 2EYJA 4IUNA 4CDCC 1PTOC 3G48A 2UUAL 1L1OA 5IE8A 3CD6A 1E2VA 2LMCB 2CQAA 2F0TA 3TS0A 1OO9B 2AUKA 2RSOA 2PW7A 5HGTA 1GVPA 4WJ4A 1SYGA 5AJ3Q 4KKUA 5DM73 4DAVA 2BA0A 4UPAA 1MI2A 1K73C 3ND9A 1EYGA 3N52A 3RLNA 2D62A 2R61A 2ZXPA 1YNNC 3FKIH 2NVXH 4H0LC 4MIUA 3I56A 1DXMA 2NVYB 1TWAB 1EL0A 5JJKA 4QF4A 4B9WA 4JG2A 2KHJA 4TQUS 4LF4Q 1AH9A 5C3EH 3CMAA 4RGOS 5JAVA 3TBIB 3X3NA 2RCNA 1C9OA 3J81L 4DUZL 4HCEA 1EFWA 1H9KA 1S5ED 4YWLA 3DHQA 1SNPA 2WP8J 1EIHA 2Q2TA 1L0YB 3SEBA 2RDHA 3GP7A 1KABA 1SNDA 2PO4A 4A4IA 4DN4M 3I55A 1EY6A 2NBFA 4ZK9B 5FOBB 4ZYSA 4LNQA 1DCZA 3K57A 4WJWA 4A3LH 1RTNA 1H9JA 3CCQA 1VMCA 1ZKOA 2WV6D 3E9HA 1PV4A 4BXXH 4XQQA 1XTDA 1A8VA 1WCMH 2NWGA 5IGBA 1SMXA 3OMCA 2HHHL 4BY1G 1TS2A 1HPCA 1GOZA 1WD1A 1NNXA 2QA4A 2RHQB 1RHPA 1FGUA 4IFDG 3MFYA 2L1BA 4ODGA 3RLOA 1Z6HA 4IJHA 1OTCA 4ZLTF 1KIXA 3H15A 3SHLA 2KOLA 3ICEA 3CRLC 3BYYB 4LW1A 2BDOA 3GTOB 4B3MQ 1SYBA 1KDCA 4C3HB 4BY7H 2X6GA 4JI1Q 1CHQD 3PSIA 3RZDB 4MNOA 4FF2A 3VYUA 4NP5A 1YNXA 2R7ZH 2YTXA 1R4PB 3S15B 5J39A 1C8CA 4MHEA 3N6RA 1HQMC 1XMOQ 2DJGC 4TKOB 5GROA 4F88A 3S14H 4JI2Q 2WB1G 3PMFA 4GLXA 1SR3A 3ERQA 1ICWA 2ZTEA 1G8ZD 5JJIA 1IYUA 1LT5D 2CVRA 3TMEA 4DV1Q 3S1RB 1IL2A 2JK8A 1NJIC 2C5CA 2B39A 4JI1L 4L5SA 1IKMA 3DWPA 2LS01 4BBRG 4RKLA 5EKKA 2Y0SE 1DOMA 4K5WA 1TS5A 3J81i 4POFA 3BVZA 2EY5A 3FEWX 3BYTB 3S9WA 1ESRA 1VQ5A 1XMOL 4A3EG 1F2LA 2MO0A 4G7ZC 1EU3A 4GNXB 2NUCA 1B9NA 4GLAC 5EPKA 5ELOA 1YJWA 1OXVA 4EQNA 1Y1VH 4J8QA 2G5DA 4DV1L 5DEHA 1LLRD 3S17B 4A3BG 4JI8Q 5CV5A 4LFCQ 5IOCA 3E9IA 1GUOA 4OWTB 5E4XA 2A5HA 1TVXA 2EZVA 4NW2A 2SNSA 3I3CA 2B2WA 1WTVA 1SE2A 2CQOA 4ZCKA 4UDUC 1II3A 3HFZB 3RN2A 5FLXc 4JPBW 5LMNQ 1N9WA 4KJNA 4DNIA 2QILA 4RH6A 2A74C 4XDXA 2A69C 3HOZB 1GO3E 1KHIA 1LABA 4XTCS 5C44H 1ESFA 1CA5A 2HD3A 3URYA 1S5DD 4OELB 1LT6D 5JJZA 3L0OA 1VQCA 3PIPA 5HURA 3E5SA 2EXDA 2Q2IA 3LX0A 4JI8L 5FLMG 2Z8LA 3D4DA 4QCLA 4GLVB 1JJGA 2F0MA 5C4XB 2R93H 3A54A 1X55A 3T1YL 3OYYA 3HOVG 3HRZC 3A8IE 2WFWA 4JI3Q 1EY9A 1Y8OB 3NBHA 4A3KB 2A6HC 1SJHD 4C3JG 2MGSA 4DKAC 3ULJA 1PFMA 1JORA 4DXGA 2Z6KC 2OWOA 1GUWA 5M5YH 2EY6A 1G91A 2AMCB 3KFUA 4IUTA 1WTPA 4DA2A 4HJAA 3CKIB 2KCNA 3C46A 1LACA 3TDQA 4R9WA 1Z9FA 2XWBB 2B8GA 3CCRA 2PI2A 3PIP3 2UXDL 1LT4D 4WORA 4JI3L 4CJ1B 2O4XA 2L55A 4UP9A 5C0XI 2BCOA 1M8AA 5M9OA 2Z4HA 3F2CA 3V05A 5M5XB 2HQEA 1STYA 2DNEA 2ZTDA 3HGBA 3GTMB 4XT1B 3WOEA 1EQQA 3K5MA 4M1UB 2E76C 1U4RA 3U58A 1TWAH 1XPRA 3DM1A 3HOUG 3OIQA 2UUBL 3HOYH 1STAA 2RKSA 4LF7Q 4BS9A 1UWVA 2XNAC 1XYIA 1DGSA 1UEAB 1UUPA 3VYRA 3KUPA 4HIOA 4IPHA 4OL7A 1ASYA 5IP9G 1PZID 3K6OA 2JA7G 3CCSA 2F52A 3NHHA 1VQMA 3D8GA 5C0XG 5J22A 3D4WA 1WJJA 4PMBA 4LF8L 3KLWA 2QKIC 3GTQB 1ENCA 1EQRA 4UAIA 3CCEA 5LMUQ 1SMYC 1PH5A 1I4RA 5M3MH 2B63B 1VQ9A 2D9UA 4H13C 4CKEA 2WAQB 2SDFA 1KD1C 2L0CA 2F0PA 1X3QA 1F9SA 1EYDA 2CHBD 3TP8A 1KQSA 3A74A 2ZXRA 1EY7A 1J9OA 1L1OC 3NELA 1XPOA 2VB2X 2OXPA 5CV8A 4A3GG 3OW2A 3H09A 1IL8A 4RG1A 4MZ9A 2KENA 3U4ZA 2E75C 4A3JG 2MPMA 4KTAA 4N8FA 3PUWA 1QZHA 4EX5A 4ZKCB 4RGNA 4A93B 1EY4A 1N34Q 1SFOB 3GTOH 4QQBX 1GUTA 5J1ZA 3CF5A 5JPMC 4C3HH 3M7NA 2A1AA 3HKSA 3PIOA 2L4NA 1E7ZA 5EPJA 3RZDH 3KF6A 1X3PA 4K5XA 1PMRA 5C4ZA 1S72A 2G9DA 3S15H 4QL5A 5IYCG 3BU2A 3H6MA 3EROA 3KBXA 2AUJD 4FF4A 4NXNQ 3M85A 3WWVA 2XTIA 2OCEA 1X6OA 5KNDA 2NVTB 4J1MA 2B2TA 1KAAA 2R6GA 3S1RH 1BF4A 1KLGD 1PH6A 3NSWA 1NUCA 3PO3B 3VR5A 4AYBE 2K5DA 1ILQA 1FGBD 4OO1G 1GM5A 4FXGC 3OTOQ 3S16B 1DOLA 4KV6A 4B3SL 3HKZG 3PIO3 1EWCA 1JJCB 3A5UA 5CV9A 4A76A 3E0EA 4NXNL 1IKLA 1NCVA 5JEAG 2XVSA 3AQQA 5COYA 3GO5A 5DAUA 5NUCA 4DV0Q 1B50A 4UP7A 2KHSA 1PH4A 5ISRA 1W6JA 3FPPA 3NPPA 2EOTA 5E1FA 3S17H 1P16A 1V1OA 5M3FB 1I6HB 5C5MA 4X66L 2F03A 3FPUB 3AU7A 5K5PA 5K36H 3ZYYX 3FVQA 2K01A 3BZCA 4L63B 1V1PA 4DF7A 3HG9A 2KA7A 2IW3A 3HOZH 3KOJA 4DV0L 1U9RA 2KUMA 4X3UA 1V8QA 2P5ZX 5BN3A 1BBXC 1EQVA 2JA6G 2EY2A 1VQFA 4DR7L 3GTKB 3BS1A 3E0JA 1PRTC 1B3AA 2IJ0A 4L8JA 2NB0A 2ALYB 1IYVA 4PZ8A 5GAEC 5C4XH 1TQOA 2QGQA 3I4MB 2A68D 4IOCA 4K6DA 4A3KH 1UAPA 4UY8C 4A3CH 4HN7A 2ICIA 5LL6S 4C3IG 4HIKA 1G6PA 1ASZA 1STNA 5M5WB 4QY7A 4ZUIA 2LXKA 2VQEL 2VUMG 3JAME 3A55A 1Q86C 4NXMQ 1C0AA 1HNWL 1IW7C 1ENAA 3MFGA 3HOXB 4A3FG 1SDFA 5D3DA 1WTWA 3SXHA 1KXLA 4HJ5A 1BUVT 4LFAQ 3CC7A 4X6AH 2RQXA 5KIXA 5M5XH 2A73B 1JWMD 1WTQA 4BWGB 2B2UA 5T1IA 1XPUA 3OHXC 4B08A 4NB3A 1UE7A 1CM9A 4DXFA 4NXML 3GTMH 1EOTA 1EEID 2XRQD 1BCPF 3E3XA 3K0YA 2N88A 4OGQC 1AP0A 4QMGA 3OWEB 2Q8TA 4G4KA 4MTNA 4JI5Q 3EIVA 2K5VA 3I7FA 4L5QA 1STHA 4LFAL 2HQLA 1PYWD 5CR3A 2NVQB 2KQ3A 5KRUA 3CPWA 4GKKQ 1VQKA 4JOIA 3K81C 4KMUC 5EBDA 2F0OA 3M4PA 2XGTA 3WOFA 3G71A 4E6IA 2E8GA 4NMZA 2NYZD 1CK1A 3HOWB 4YHHQ 4ABNA 1VF7A 2I5LX 2RVLA 3GTQH 4FO2A 2B2YA 3NTKA 1A15A 1PTOF 4ME5A 1D6EC 4IUPA 3FKIG 2B63H 3PQIA 2EXZA 1X9NA 1XXGA 2R92B 3NE5B 1EU4A 3K0XA 4GKKL 4X64Q 1IBKQ 2HIVA 2MP1A 5KYLA 1VQAA 3KDFB 5I9OA 1UNSA 5C3EG 1QWYA 3AMUA 3KJPA 1PFBA 2DGYA 1P8LA 2IPKD 4YHHL 1K83B 2X69A 4DR1L 1MSHA 1EYCA 1XTCD 4I65A 1HHVA 4IFDJ 4YCUA 1O80A 2PNHA 1O7IA 2Z1CA 2GN5A 2B2VA 4HCSA 2VQFQ 2WKDA 2DN8A 3CQZB 1K8AC 3KLSA 1BCPD 1SXTA 1Q3LA 2UUCQ 4HSPA 4IUVA 4A93H 1Q81C 3VA5A 4R8NA 4A3DH 1HJPA 4R4CA 3EJIA 1MJEA 1FL0A 3TREA 1XNQQ 3H3VH 2FFKB 1IBKL 1A0IA 3PO2G 3BDCA 2L5TA 1WTRA 2K5WA 2CKZB 4A3LG 1UEBA 1CT1D 3I90A 3JC66 1F77A 4BXXG 4K2LA 5I6WA 1WCMG 1S5CD 1HA6A 4KKTA 5FK9C 1K8MA 4R4IA 4G7OC 2K5NA 2EYMA 3P1HA 1K8OA 2NVTH 4HAEA 4K2KA 4JBKA 1R9TB 3RR5A 1E2WA 3GV6A 2UUCL 1YEZA 2F0LA 2JSOA 3GTJB 4K6LA 1B7YB 1PTOD 1QJOA 3PO3H 1UE5A 4F87A 2YV5A 2VS1A 4AIMA 4A3BB 2E2HB 2NZHA 1NMGA 4IO9A 1H9SB 1BDOA 2J4XA 4GKJQ 3TP6A 4I7ZC 1LT3D 2DUDA 3NP8A 2AWOA 2E2DC 2K1BA 4BY7G 1CA6A 3DWAA 1T9HA 3A56A 3TZUA 2PQAB 1JB7A 3S1NH 4LMQD 4U68A 5AJ3L 1PZJD 3H91A 2R7ZG 1M1KC 4ME3A 1YNND 4A3MB 4FF1A 5M3FH 4A3IG 1I6HH 3I4NB 1OXUA 1HUNA 4DK0A 4GKJL 1BVSA 2EJFC 1FNWA 1O7YA 1PDQA 2Q8RE 5J3BA 4GNXA 2EYHA 5BN4A 1ONLA 1Q1EA 2QEXA 4LF4L 5E7NA 5G3LF 4X62Q 2TSSA 4PV1C 4WRDA 4GOPB 1A2TA 1I50B 2R7FA 4X3TA 1GD7A 1VQ8A 4G57A 5KYIA 4RMFA 3U4VA 3D0FA 1IBLQ 3GTKH 1QCBD 1D5XC 1ZEQX 2F0KA 2Z0SA 3OIPA 3L3OC 5L37A 1CZWA 3M4QA 1Q12A 1MSGA 1Y1VG 2SNMA 4ULLA 5HY6A 4HIDA 2OEOA 3I4MH 4Q0FA 1MD2D 3K7UC 1B53A 4KY7A 3GTPB 4JV5Q 2GA4B 4X62L 3A7LA 3SK6A 3CCMA 2B2TC 3KF8B 2BDNA 4YY3Q 4IUUA 1ET9A 2PMZB 2I0QA 3K5LA 3S2HB 3NEMA 4FP5D 4CDFC 1VDZA 3GQBA 1CTMA 4Z9CB 1IBLL 1A6XA 5CC4A 5FO7B 3NTHA 3Q23A 4YCWA 3U9SA 4DR4Q 4HEDA 3HOXH 3SK5A 2B29A 1AZPA 1I4XA 3HOUB 1QG7A 2GVAA 4JV5L 1W6KA 1VMPA 4LFBQ 4C2MB 1Q7YC 1N36Q 4B3ML 1SYFA 2K03A 1AN8A 1YNJC 2R93G 3BVMA 4AH6A 5G3LD 4YY3L 3UE0A 3J81c 2C35B 3NK9A 3K7AB 1IXRA 1GHJA 1C7YA 3JAML 4B3TQ 3SGIA 1LM0A 1L0XB 3W2DA 1Z47A 4IQZA 4JI2L 2VB3X 1T5XD 1SNMA 4DK1A 1Y8NB 1EWHA 3GTGB 1A3TA 3BZKA 1CKNB 4UP8A 4LFBL 1PA6A 3KBGA 1SJED 4R1JA 1SN8A 2JA8G 1JOQA 2NVQH 5IYBH 4QUFA 1B8AA 2RF4A 1JE4A 1D1KA 1FNVA 2DY8A 2I46A 2F0HA 3UDIA 1HZ9A 1DM0B 1PH3A 3BDLA 3R93A 3UDGA 3HOWH 3OOCA 2K28A 2QCPX 4EVOA 4H02A 4B3TL 4A3GB 1PH9A 1HH2P 4UHVA 1D1IA 2PZWA 4OIJA 4A3JB 3S1MH 1VQJA 5IT9E 1U4LA 2XSCA 4CBVA 2WIIB 2R92H 1SYDA 2BE5C 3BG3A 4B3RQ 1JWSD 2AKWB 4EQOA 4KY5A 1QB5D 4LFCL 4ID6A 1VQIA 1LTGD 2HDMA 3HOYG 2CWAA 5IP7G 2KHIA 3H94A 1EUJA 1I4PA 3PUXA 2VL6A 4IUQA 2N78A 1IBMQ 2NN6H 1K83H 4R4OA 4OWWB 5LMNW 2A69D 1WYDA 3FHWA 5LMNL 1MKHA 1U4MA 1V9PA 3M3YB 4LK1C 3CQZH 2Q8IB 2F0IA 4LF9Q 4QGUA 1B3QA 1KDAA 3RMHA 4DV7Q 3EVQA 1Y1WH 2B2UC 3CU7A 2PCFB 4B3RL 1X3GA 1X56A 2E74C 1PLFA 5M3MG 3A5ZB 1EEFD 1ZYRC 3M7GA 2A6HD 1K3BC 4OWXB 2EYOA 1TY0A 2WINB 1I94Q 1BBWA 5IYDG 1PYSB 4EQPA 2Q2UA 1HXYD 4LF9L 3JAMi 2Y0SG 3BDOA 4DV3Q 1R4QB 3OW7A 4AQYQ 2LY7A 3D3RA 2KCMA 3H0GG 2NVYH 4KN4C 4JI4Q 2AWNA 3CCJA 2IX3A 2JYOA 2XRSD 3T13A 5F2DA 1AW7A 4C3HG 1KAWA
chains in the Genus database with same CATH topology
2F4IA 2B2YC 4FNFA 3G6JB 1EY0A 2NTTA 3K5NA 4EGVA 4ZUJA 2JE6I 5LHY1 4JBWA 2PZUA 5A35A 2FINB 2B2VC 5DM63 3MHBA 2HCCA 4XYQA 3DUZA 5KNBA 4C3IB 2AQ1B 1S4ZA 2M00A 3K58A 1SAPA 1RODA 4C1NI 1HTPA 2EVBA 4RWSC 4CJ0B 2HUGA 1F2ZA 1SMYD 2F3VA 1NAPA 4KI0A 1BCPB 3G7LA 1WD0A 4Q5VA 3V96A 2BOSA 4RHRA 1EY5A 1TWHB 5C5LA 2H1EA 2E2IB 4CJ2C 2FJ2A 4XIGS 2D5DA 3VR4A 3RD4A 1FD7D 3WDNA 2F0SA 3U9OA 3MXPA 3P7JA 1TWGB 4DFAA 1TIID 1LO5D 1TT2A 4BBSB 2IL8A 4NKLA 3EA6A 2RBMA 3R8BA 3QIAA 4N9TA 3M4YA 1GJXA 1PTOB 1SE3A 4KD4A 2F0UA 3C1EA 3C3LA 3MTSA 1Q8IA 2JA5B 2MJ8A 1WTXA 3S1QB 3I91A 1TKWB 4HTHA 5I2YA 3K59A 1PRTF 5DNFA 4ZAIA 1EY8A 1AFPA 1F9QA 3KLSX 1DYQA 4IN3A 3DEOA 4FYDA 4X3SA 4KJOA 1B2TA 1GUSA 4RGTA 3VYTA 2JEAI 3VYSA 4TRDA 1EZ6A 1FR3A 3QJYA 5A2QE 1PFNA 5C6AA 1SE4A 1HFGA 2PQEA 5D3IB 5ELBA 5FLXE 2LKVA 4GZYC 1D5ZC 1PZKD 5TSSA 1FNUA 1KLUD 3PO2B 1SYCA 1B9MA 2L12A 2XN9C 1NSNS 2DNCA 3J7YW 1PRTD 5IT9L 3GTLB 3D31A 1E2ZA 2XWJB 3I4LA 1LV9A 3NUCA 3UI2A 2CW0C 3P20A 4BY7B 4H44C 3RZOB 4DNTB 2YYZA 4TSSA 2X6LA 2R7ZB 2JEBI 4ZRZA 1IW7D 3SDZA 1B1ZA 2A6EC 4A3IB 3S14B 5JVG3 5JOBA 2B2WC 1A2UA 5FKAC 4K14A 5C3XA 5IGCA 3I73A 1B4OA 1F9PA 3NBIA 2F1MA 1HUMA 2KVMA 5I2XA 3R2IA 4PMCA 1H9SA 1LTRD 1DZ1A 4BY1B 2QDBA 5EKIA 2FMMA 3I72A 3J80E 5I6YA 5JPNC 1I4QA 2L9HA 1O78A 2VNUD 2EJMA 1HCZA 1U4PA 2YU9B 1EIGA 1VCIA 1ZXTA 1EFID 5EKLA 1F9RA 2SOBA 3DXJC 3MEHA 1ENFA 3NQTA 5CBAE 5ELFA 4JK1C 4X3KA 1RKNA 2XIWA 1MGSA 2EPBA 1F2MA 2WB1B 1TU2B 3E6ZX 5EQ0A 1DJRD 2IX1A 3GD7A 3HS0C 2EDGA 3H3VC 2ID0A 4CKBA 2R93B 2EY1A 3R3OA 4BBRB 3EQLC 4PMWA 2F0GA 1LTSD 1G2TA 4RHSA 2RDGA 4A3EB 3T16A 4XQNA 1LTAD 3KF8A 4FXDA 1QILA 2JA8B 3Q24A 3IKJA 2PNRC 1PTOH 4DNRB 1NR4A 4HMJA 5E4WC 1G2SA 1GUNA 4K8IA 1SSOA 1O7ZA 2J7ZA 1CZGA 2EE1A 5KEEA 1BO0A 1MBYA 1DOKA 1SEBD 2K32A 1BQQT 3TP5A 1E0BA 2IWHA 3ND8A 3DWQA 1VF5C 3HOYB 4IFDI 4J6HA 2IT1A 3HOVB 1I6VC 3T4AC 2K33A 1EYAA 4C3JB 3A8JE 4KN7C 4L6TB 1GHKA 1BNZA 2K7VA 3SVMA 5IGFA 5E3FA 5EPLA 2IX0A 4U673 5EJWA 3Q6SA 1V43A 2ENBA 2NN6I 1SNCA 5M3MB 1S5FD 3FMCA 5A2QL 2O2LD 3LNNA 4KK7A 1AEXA 4DAPA 2E2JB 3AB9A 4XYOA 1XX8A 5FLXL 2Y0SB 5KNCA 3O13A 5JVH3 5LL6X 1Y8PB 1SNOA 4XT3B 3H0GB 3R2TA 3TZDA 1KTKA 3IL8A 1Z7TA 2QEJC 4QIWB 4IALA 3NQIA 4O1NA 4ZKBB 2K04A 2NN6G 1NR2A 1EQTA 2JA7B 3D4RA 5CV7A 1RJTA 1STBA 2NTSA 1G291 2TMPA 2V4DA 1OXSC 4DGZA 2AQ2B 2FHTA 1X32A 1YNJD 2G9HD 1C4QA 2NZ1D 5CYUA 5IODA 3NWSA 2FMCA 2LFNA 3MXUA 4M8AA 2MHVA 1SYEA 2F0VA 3CRKC 3C1FA 4IFDH 1WVLA 5C0XJ 3PV0A 4DU9A 1RCVD 2C9OA 3EFXD 4N9PA 5D65A 1Q90A 4Y7NB 1OXTA 4O42A 4F8MA 1M4VA 1S5BD 1TWFB 3OWFA 3SK8A 3MZ5A 1JCKB 3D6WA 2K6AA 1TR5A 2HCIA 2L11A 3PUYA 3M4OB 5IIFA 3J80L 3LWUA 1LTTD 3VR3A 2PW5A 2SEBD 3S2DB 2BE5D 2I07B 1CQVA 1PRTB 5ELCA 1LTBD 3P75A 3HP3A 2PZTA 1BR9A 4K5VA 4ILWA 3QOJA 1H9MA 2KEDA 3FDTA 2K5QA 3MXGA 1A3VA 2DY7A 3HKZB 1QNUA 3SR1A 3Q22A 1QOHA 4FF3A 2B8FA 4RKBA 2EYFA 5EBCA 5FO8B 1JQYD 4MN3A 2AQ3B 1ZYRD 2EYLA 1TWCB 4RCOA 4DAYA 5C4JB 5KGUA 1CI3M 3W3AA 4V0BA 4H7BA 5I4DA 3MA2B 4BA1I 1STGA 5JEAJ 2K05A 2JP1A 3J7AF 2JA6B 4RCNA 2D2CC 1FYCA 2OT2A 1TS4A 4KHZA 1PXUA 2RSNA 1I3QB 4QUCA 1OXXK 3DEPA 4K8JA 1TY2A 2MUYA 2VUMB 2O5IC 1F2YA 2WKCA 3GV3A 4XQJA 1SBBB 3RLFA 3C2PA 5D14A 4A3FB 1JWUD 3CHBD 3MWYW 2F0JA 1HFNA 1I4GA 1I4HA 3TP7A 2KEEA 2VXWA 5K36G 3PUZA 4ZQ3A 4AYBB 5CORA 4BA2I 1ILPA 3RUZA 1H9RA 4HSVA 3LWEA 4CKCA 4KKSA 3K5OA 5C3WA 4OO1I 1CFMA 3FRPB 1TS3A 3T56B 2WACA 3VR6A 4P2CB 3X3MA 1O7LA 4A3DB 4KHVA 1JR0D 3PUVA 2PPBC 4R8IA 3MC0B 2PYKA 4CGYB 1A3UA 2ZT9C 2RDFA 5FO9B 4PNYA 1ET6A 3NXWA 5IGDA 1RDPD 4C56C 4HR7B 3J81E 3IFDA 1WTOA 5C0XH 4LAAA 2R3ZA 4G7HC 2F3WA 1HTLD 1IHZA 1HRJA 3MVVA 1QNKA 3VA7A 1ML0D 2OF1A 1KNAA 3FKIB 2NVXB 1BXTA 3IFTA 2KECA 5ELDA 3MAQA 3MXNA 5C3EB 1RD9D 1Y69U 3S1NB 3QB3A 5CGKA 3KLRA 4C1NK 2EJGC 1JICA 1JOOA 2ZXOA 3DMUA 2F0FA 3A8KE 3QWNA 2J0TD 1HQRD 4WFN3 2A68C 4LJZC 5EGTA 4PQXA 2F0QA 1KNEA 1WCMB 5CMDA 4OIKA 3VR2A 2H4OA 4V190 3BZDB 5CV6A 2N55A 3HZXA 2M9VA 1Q1BA 3OPOA 4FVMA 1BOSA 3QG1A 1STEA 4OO1H 3KK7A 1QE6A 5CV4A 3J7AV 1J8IA 4HMIA 3OMGA 4YIJA 5JEAH 1DD2A 3TSSA 1KDBA 1GXDC 3QOLA 2O5JC 4QB4A 1DONA 3ITPA 4F7XA 2QF7A 1HA5A 1LTID 4OHJA 2CW0D 3NWTA 3T51B 5BN5A 3OSOA 4CHTB 2BA1A 3F2UA 3Q0AA 4B9XA 3L9AX 3SE0A 1JOKA 2A6ED 3SK4A 4FXKC 3IAYA 3A7AB 3D6CA 4IURA 1B44D 1GUGA 1T5EA 1V1PB 1Y1VB 5ELEA 2ICEC 4XXEA 2F0DA 4KD3A 4S3SA 5C4HA 4RAUC 3TN2A 5CBEE 3T53B 3BVGA 2Z4IA 3ONAB 5I9PA 4KY6A 4RGMA 2EYPA 4RA8A 5AFWA 2JXMB 1RF2D 1JC7A 1XWEA 4RFBA 3NTIA 1D2BA 2F0EA 3S1MB 1SNQA 1G6ZA 5C44B 5IGGA 1RTOA 4IZ8A 1CHPD 1BCPC 1CQFA 5IGEA 3QO2A 5T1GA 1JB3A 2M2LA 2F0NA 1EZ8A 3V2TA 2KCCA 2RA4A 2F0WA 2HDLA 3L7ZC 4NDXA 1C48A 2KJXA 1AZQA 5M5YB 3HEJA 1Y1WB 3I8ZA 3I70A 1D5MC 2EYJA 4IUNA 1PTOC 1E2VA 2LMCB 2CQAA 2F0TA 1OO9B 2AUKA 2RSOA 2PW7A 5HGTA 1SYGA 4KKUA 5DM73 4DAVA 2BA0A 1MI2A 3ND9A 3N52A 2D62A 2R61A 2ZXPA 1YNNC 4H0LC 4MIUA 1DXMA 2NVYB 1TWAB 1EL0A 4QF4A 4B9WA 4TQUS 4RGOS 5JAVA 3TBIB 3X3NA 3J81L 4HCEA 1H9KA 1S5ED 3DHQA 1SNPA 2WP8J 1EIHA 1L0YB 3SEBA 2RDHA 3GP7A 1KABA 1SNDA 2PO4A 4DN4M 5FOBB 1EY6A 2NBFA 4ZK9B 4ZYSA 1DCZA 3K57A 4WJWA 1RTNA 1H9JA 1VMCA 1ZKOA 2WV6D 4XQQA 2NWGA 5IGBA 3OMCA 1TS2A 1HPCA 1GOZA 1WD1A 1RHPA 4IFDG 3MFYA 2L1BA 4ODGA 1Z6HA 4ZLTF 3SHLA 2KOLA 3CRLC 3BYYB 2BDOA 3GTOB 1SYBA 1KDCA 4C3HB 2X6GA 1CHQD 3RZDB 4FF2A 3VYUA 4NP5A 1R4PB 3S15B 5J39A 1C8CA 4MHEA 3N6RA 1HQMC 4TKOB 4F88A 3PMFA 3ERQA 1ICWA 1G8ZD 1IYUA 1LT5D 2CVRA 3TMEA 3S1RB 2C5CA 2B39A 1IKMA 3DWPA 2LS01 4RKLA 5EKKA 1DOMA 4K5WA 1TS5A 3BVZA 2EY5A 3FEWX 3BYTB 3S9WA 1ESRA 1F2LA 4G7ZC 1EU3A 2NUCA 1B9NA 5EPKA 1OXVA 4EQNA 4J8QA 5DEHA 1LLRD 3S17B 5CV5A 5IOCA 1GUOA 5E4XA 2A5HA 1TVXA 2EZVA 4NW2A 2SNSA 3I3CA 2B2WA 1WTVA 1SE2A 4UDUC 1II3A 4KJNA 2QILA 4RH6A 2A74C 4XDXA 2A69C 3HOZB 1LABA 4XTCS 1ESFA 1CA5A 3URYA 1S5DD 1LT6D 5JJZA 5HURA 3E5SA 3LX0A 2Z8LA 3D4DA 4QCLA 2F0MA 5C4XB 3A54A 3HRZC 3A8IE 1EY9A 1Y8OB 3NBHA 4A3KB 2A6HC 1SJHD 4C3JG 2MGSA 1PFMA 1JORA 4DXGA 1GUWA 2EY6A 1G91A 4IUTA 1WTPA 4DA2A 3CKIB 2KCNA 3C46A 1LACA 3TDQA 4R9WA 2XWBB 2B8GA 3PIP3 1LT4D 4WORA 4CJ1B 2O4XA 2L55A 5C0XI 2BCOA 1M8AA 5M9OA 2Z4HA 3V05A 5M5XB 2HQEA 1STYA 2DNEA 3HGBA 3GTMB 4XT1B 3WOEA 3K5MA 4M1UB 2E76C 1U4RA 3DM1A 3OIQA 1STAA 2RKSA 4BS9A 2XNAC 1XYIA 1UEAB 1UUPA 3VYRA 3KUPA 4OL7A 1PZID 3K6OA 3NHHA 3D8GA 5C0XG 5J22A 3D4WA 4PMBA 3GTQB 2QKIC 1ENCA 4UAIA 1SMYC 1I4RA 2B63B 2D9UA 4H13C 4CKEA 2WAQB 2SDFA 2L0CA 2F0PA 1X3QA 1F9SA 1EYDA 2CHBD 3TP8A 2ZXRA 1EY7A 1J9OA 2VB2X 2OXPA 5CV8A 3H09A 1IL8A 2E75C 2MPMA 4KTAA 3PUWA 4ZKCB 4RGNA 4A93B 1EY4A 1SFOB 1GUTA 5J1ZA 5JPMC 3M7NA 2L4NA 5EPJA 1X3PA 4K5XA 1PMRA 5C4ZA 2G9DA 3H6MA 3EROA 3KBXA 2AUJD 4FF4A 3M85A 5KNDA 2NVTB 4J1MA 2B2TA 1KAAA 2R6GA 1BF4A 1KLGD 3NSWA 1NUCA 3PO3B 3VR5A 2K5DA 1ILQA 1FGBD 4OO1G 4FXGC 3S16B 1DOLA 4KV6A 3PIO3 1EWCA 5CV9A 1IKLA 1NCVA 5JEAG 2XVSA 5COYA 3GO5A 5DAUA 5NUCA 1B50A 2KHSA 5ISRA 1W6JA 3FPPA 3NPPA 2EOTA 5E1FA 1V1OA 5M3FB 1I6HB 5C5MA 2F03A 3FPUB 3AU7A 5K5PA 5K36H 3ZYYX 3FVQA 2K01A 4L63B 1V1PA 4DF7A 3HG9A 2KA7A 2IW3A 1U9RA 2KUMA 4X3UA 1V8QA 5BN3A 1BBXC 1EQVA 2EY2A 3GTKB 3BS1A 3E0JA 1PRTC 1B3AA 2IJ0A 4L8JA 2NB0A 1IYVA 1TQOA 3I4MB 2A68D 4K6DA 1UAPA 4HN7A 2ICIA 5LL6S 4C3IG 1STNA 5M5WB 4ZUIA 3JAME 3A55A 1IW7C 1ENAA 3MFGA 3HOXB 1SDFA 5D3DA 1WTWA 3SXHA 1BUVT 2RQXA 5KIXA 2A73B 1JWMD 1WTQA 4BWGB 2B2UA 5T1IA 3OHXC 4B08A 1CM9A 4DXFA 1EOTA 1EEID 2XRQD 1BCPF 3K0YA 2N88A 4OGQC 1AP0A 4QMGA 3OWEB 2Q8TA 4G4KA 1STHA 5CR3A 1PYWD 2NVQB 2KQ3A 5KRUA 4KMUC 5EBDA 2F0OA 3WOFA 4E6IA 4NMZA 2NYZD 1CK1A 3HOWB 4ABNA 1VF7A 2RVLA 4FO2A 2B2YA 3NTKA 1A15A 1PTOF 4ME5A 1D6EC 4IUPA 2EXZA 1XXGA 2R92B 3NE5B 1EU4A 2MP1A 5KYLA 5I9OA 1UNSA 1QWYA 3AMUA 1PFBA 2IPKD 1K83B 2X69A 1MSHA 1EYCA 1XTCD 4I65A 1HHVA 4IFDJ 1O80A 2Z1CA 2B2VA 4HCSA 2WKDA 2DN8A 3CQZB 3KLSA 1BCPD 1SXTA 1Q3LA 4HSPA 4IUVA 3VA5A 4R8NA 3EJIA 2FFKB 3BDCA 2L5TA 1WTRA 2K5WA 1CT1D 3I90A 1F77A 4K2LA 5I6WA 1HA6A 1S5CD 4KKTA 5FK9C 1K8MA 4G7OC 1K8OA 2EYMA 3P1HA 4HAEA 4K2KA 1R9TB 1E2WA 3GV6A 2JSOA 2F0LA 3GTJB 4K6LA 1PTOD 1QJOA 4F87A 4A3BB 2E2HB 1H9SB 1BDOA 2J4XA 3TP6A 4I7ZC 1LT3D 3NP8A 2AWOA 2E2DC 2K1BA 1CA6A 3DWAA 3A56A 3TZUA 4LMQD 4U68A 1PZJD 3H91A 1YNND 4A3MB 4FF1A 3I4NB 1OXUA 1HUNA 4DK0A 2EJFC 1FNWA 1O7YA 1PDQA 2Q8RE 2EYHA 5BN4A 1ONLA 1Q1EA 5G3LF 2TSSA 4PV1C 4WRDA 1A2TA 1I50B 4X3TA 4G57A 5KYIA 1QCBD 1D5XC 1ZEQX 2F0KA 3OIPA 3L3OC 1CZWA 1Q12A 1MSGA 2SNMA 4ULLA 2OEOA 4Q0FA 1MD2D 1B53A 4KY7A 3GTPB 2GA4B 3A7LA 3SK6A 2B2TC 2BDNA 4IUUA 1ET9A 2PMZB 3S2HB 3K5LA 4FP5D 1VDZA 3GQBA 1CTMA 4Z9CB 1A6XA 5CC4A 5FO7B 3NTHA 3Q23A 3U9SA 4HEDA 3SK5A 1AZPA 1I4XA 3HOUB 1QG7A 1W6KA 1VMPA 4C2MB 1SYFA 2K03A 1AN8A 1YNJC 3BVMA 5G3LD 3NK9A 3K7AB 1GHJA 3JAML 1L0XB 3W2DA 1Z47A 4IQZA 2VB3X 1T5XD 1SNMA 4DK1A 1Y8NB 1EWHA 3GTGB 1A3TA 3KBGA 1SJED 1JOQA 4QUFA 1JE4A 1D1KA 1FNVA 2DY8A 2I46A 2F0HA 1DM0B 3BDLA 3R93A 3OOCA 2K28A 2QCPX 4EVOA 4A3GB 1D1IA 2PZWA 4OIJA 4A3JB 5IT9E 1U4LA 2XSCA 4CBVA 2WIIB 1SYDA 2BE5C 3BG3A 1JWSD 4EQOA 4KY5A 1QB5D 4ID6A 1LTGD 2HDMA 3H94A 3PUXA 1I4PA 4IUQA 2NN6H 2A69D 1U4MA 3M3YB 4LK1C 2Q8IB 2F0IA 1KDAA 3RMHA 3EVQA 2B2UC 3CU7A 2PCFB 2E74C 1PLFA 1EEFD 1ZYRC 3M7GA 2A6HD 2EYOA 1TY0A 2WINB 4EQPA 1HXYD 3BDOA 1R4QB 3OW7A 2LY7A 3D3RA 4KN4C 2AWNA 2IX3A 2JYOA 2XRSD 3T13A 5F2DA 1AW7A 4C3HG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CA5 A;  4UAI A;  3I91 A;  2K01 A;  2M2L A;  2NYZ D;  2B2Y C;  1WD1 A;  5JJZ A;  2B2W C;  4QUF A;  1JE4 A;  1RHP A;  5DNF A;  4ZKB B;  1NR4 A;  1QE6 A;  2K04 A;  4ZAI A;  2RA4 A;  2DY8 A;  2D9U A;  2L1B A;  5E4W C;  2RVL A;  1HUN A;  1F9Q A;  1NR2 A;  2SDF A;  1O7Y A;  1PDQ A;  2Q8R E;  1J8I A;  1EQT A;  2KUM A;  2B2Y A;  1G2S A;  1A15 A;  1X3Q A;  4X3U A;  4ZLT F;  1B4O A;  1RJT A;  3DEO A;  1F9S A;  3R93 A;  4R8I A;  1F9P A;  2HDL A;  1SSO A;  4IUP A;  4X3S A;  2K28 A;  2KOL A;  4MN3 A;  1AZQ A;  1BBX C;  1O7Z A;  2J7Z A;  1J9O A;  1B2T A;  1HUM A;  2EE1 A;  3I8Z A;  1BO0 A;  2KVM A;  4X3T A;  1B3A A;  4OIJ A;  1DOK A;  1IL8 A;  2MGS A;  2MP1 A;  2FHT A;  1X32 A;  1PFM A;  2X6G A;  2NZ1 D;  2FIN B;  1PFN A;  3IFD A;  2MPM A;  1WTO A;  5EKI A;  2FMM A;  1DON A;  1GUW A;  1U4L A;  2B2V C;  1HFG A;  4ZKC B;  1PFB A;  1G91 A;  2R3Z A;  1E0B A;  2HCC A;  1DZ1 A;  4IUT A;  2X69 A;  1MSH A;  2L9H A;  1C8C A;  1HHV A;  4MHE A;  2RSO A;  1WTP A;  1HRJ A;  2K05 A;  1O80 A;  1QNK A;  2HDM A;  1ML0 D;  1MSG A;  1S4Z A;  2B2V A;  2JP1 A;  2L4N A;  4HCS A;  5EPJ A;  1KNA A;  1U4P A;  1X3P A;  1SAP A;  1B53 A;  1EIG A;  1ROD A;  4IUQ A;  1Q3L A;  1ZXT A;  4IUV A;  4R9W A;  1ICW A;  1WVL A;  1MI2 A;  1F9R A;  4CJ1 B;  3N52 A;  3F2U A;  2CVR A;  4RWS C;  2KEC A;  3KBX A;  4CJ0 B;  2B2T C;  1U4M A;  2HUG A;  1M8A A;  2BDN A;  4IUU A;  2FFK B;  5CBA E;  1WTR A;  1NAP A;  1BNZ A;  5D65 A;  1IKM A;  4X3K A;  3SVM A;  1EL0 A;  2B2U C;  1SDF A;  2B2T A;  2L12 A;  3I90 A;  4IUR A;  1WTW A;  1DOM A;  3G7L A;  4O42 A;  5EPL A;  1WD0 A;  1BF4 A;  2RSN A;  2XIW A;  1HA6 A;  4QUC A;  1MGS A;  3Q6S A;  5EJW A;  2EPB A;  3DEP A;  1ESR A;  4HED A;  1JIC A;  1F2L A;  4XT1 B;  1WTQ A;  2H1E A;  2B2U A;  3D6W A;  1U4R A;  4HAE A;  4RAU C;  1PLF A;  5T1I A;  3TN2 A;  5CBE E;  1AZP A;  1ILQ A;  2FJ2 A;  1QG7 A;  2HCI A;  2L11 A;  5EQ0 A;  4CJ2 C;  3DM1 A;  3GV6 A;  5EPK A;  3ONA B;  1VMP A;  1CM9 A;  3GV3 A;  1DOL A;  1EIH A;  3P7J A;  4RA8 A;  5AFW A;  2K03 A;  1XYI A;  1EOT A;  1IKL A;  1NCV A;  5D14 A;  2N88 A;  1XX8 A;  1AP0 A;  3KUP A;  4DN4 M;  5COY A;  1B50 A;  1LV9 A;  3MWY W;  2Q8T A;  1HFN A;  1KNE A;  3UI2 A;  2IL8 A;  5E4X A;  4ZK9 B;  1TVX A;  4NW2 A;  3I3C A;  2KEE A;  1G2T A;  2B2W A;  1WTV A;  2K1B A;  2VXW A;  3HP3 A;  4OIK A;  5CMD A;  1RTO A;  1G6Z A;  2EOT A;  1CA6 A;  1RTN A;  4XT3 B;  5COR A;  1ILP A;  1VMC A;  2X6L A;  3TZD A;  4LMQ D;  4U68 A;  2KED A;  3IL8 A;  3FDT A;  3H91 A;  3FPU B;  3QO2 A;  4XDX A;  2NWG A;  2JYO A;  3MTS A;  4HSV A;  2MJ8 A;  3LWE A;  1WTX A;  2N55 A;  5T1G A;  2DY7 A; 
#chains in the Genus database with same CATH topology
 4O0A A;  5BR8 Q;  2F4I A;  2B2Y C;  1I94 L;  4FNF A;  3B6Y A;  3CC4 A;  4DPG A;  1YIT A;  3G6J B;  4A3M H;  1EY0 A;  4DV3 L;  4LUZ A;  2NTT A;  3K5N A;  3I2Z A;  4EGV A;  3I4N H;  1NTG A;  4ZUJ A;  4WJ3 M;  2JE6 I;  5LHY 1;  4JBW A;  2PZU A;  5IWA Q;  5A35 A;  2FIN B;  2ZM6 Q;  2B2V C;  5BR8 L;  4LF7 L;  5DM6 3;  3MHB A;  1I50 H;  2HCC A;  4XYQ A;  3DUZ A;  3TEH B;  5KNB A;  1FVI A;  4C3I B;  2AQ1 B;  1S4Z A;  3RNU A;  2M00 A;  3K58 A;  1SAP A;  1ROD A;  4C1N I;  1HTP A;  4DAM A;  2MQH A;  2EVB A;  1D8L A;  1QUQ A;  4RWS C;  4CJ0 B;  2HUG A;  1F2Z A;  1XJV A;  1SMY D;  2F3V A;  5GAG C;  1NAP A;  3I4O A;  3T1H Q;  5LMU L;  2OTL A;  2ZM6 L;  4IPD A;  4KI0 A;  1BCP B;  3G7L A;  1WD0 A;  4Q5V A;  3V96 A;  2BOS A;  4RHR A;  1EY5 A;  2MNA A;  1TWH B;  4TVA B;  3S2H H;  3F1Z A;  5C5L A;  2JJQ A;  2H1E A;  2YTY A;  2E2I B;  4I7A A;  1X3F A;  1A63 A;  4CJ2 C;  2FJ2 A;  4XIG S;  2D5D A;  3VR4 A;  3UDF A;  3RD4 A;  1FD7 D;  3WDN A;  3HOZ G;  2F0S A;  3U9O A;  3MXP A;  3P7J A;  1TWG B;  4QJF A;  4DFA A;  1TXY A;  4DAY B;  1TII D;  1LO5 D;  1TT2 A;  4BBS B;  2IL8 A;  4NKL A;  2WAQ E;  3EA6 A;  2RBM A;  4C2M H;  2HIX A;  4X65 Q;  1YIJ A;  1N34 L;  5EAY A;  3R8B A;  1VQG A;  3QIA A;  4N9T A;  3M4Y A;  4P74 A;  1HR0 Q;  1GJX A;  1PTO B;  1SE3 A;  4KD4 A;  2F0U A;  4L5R C;  1VQ7 A;  3C1E A;  4A3K G;  3C3L A;  3MTS A;  4A3C G;  1Q8I A;  2JA5 B;  2MJ8 A;  3K7A H;  1WTX A;  2I5H A;  3S1Q B;  3I91 A;  2ZJP A;  2JA9 A;  1TKW B;  4HTH A;  5I2Y A;  4HJ7 A;  3K59 A;  4N8X 1;  1PRT F;  5DNF A;  4ZAI A;  1EY8 A;  1AFP A;  1F9Q A;  3KLS X;  1DYQ A;  4IN3 A;  3DEO A;  3AEV A;  2Z6B A;  4FYD A;  4X3S A;  2H5X A;  1HR0 W;  4KJO A;  1B2T A;  3K8A A;  1GUS A;  4RGT A;  3VYT A;  1HR0 L;  2JEA I;  2VZA A;  3VYS A;  4TRD A;  1VQB A;  1EZ6 A;  1FR3 A;  3QJY A;  5A2Q E;  3OTO L;  1QVF A;  1PFN A;  3AFQ A;  5C6A A;  1SE4 A;  1HFG A;  2PQE A;  4MTK A;  1K8G A;  5D3I B;  1B70 B;  4ALP A;  5ELB A;  4A3J H;  4P72 A;  5FLX E;  2LKV A;  4GZY C;  3PCO B;  1JT8 A;  3CCV A;  5GQO A;  3IRB A;  1D5Z C;  1SE8 A;  1PFS A;  1PZK D;  3F8T A;  5TSS A;  1FNU A;  1KLU D;  3PO2 B;  1J5E Q;  1SYC A;  4IPC A;  1B9M A;  2L12 A;  2E5L Q;  4GN4 B;  3M3Y H;  2XN9 C;  1NSN S;  1VQO A;  2DNC A;  3J7Y W;  1PRT D;  5IT9 L;  3GTL B;  3KDF A;  1LUZ A;  1X54 A;  3H3V I;  3D31 A;  3AYH B;  1HZC A;  1WFQ A;  1E2Z A;  1E1T A;  2XWJ B;  1J5E L;  3I4L A;  4JCV E;  4GN3 B;  2B63 G;  1LV9 A;  3NUC A;  3UI2 A;  4DK3 C;  2CW0 C;  1IYJ B;  3P20 A;  2E5L L;  4BY7 B;  4H44 C;  1AE2 A;  3RZO B;  4DNT B;  2YYZ A;  1ICF B;  1PH8 A;  4PZ7 A;  4TSS A;  2UU9 Q;  4AYB G;  2X6L A;  2R7Z B;  2QDL A;  2JEB I;  4ZRZ A;  1E3P A;  2K50 A;  1IW7 D;  3SDZ A;  1B1Z A;  2A6E C;  4A3I B;  3G4S A;  3S14 B;  5JVG 3;  5JOB A;  2B2W C;  1A2U A;  5FKA C;  3MXN B;  4A93 G;  4K14 A;  5C3X A;  5IGC A;  4A3D G;  2EIF A;  3I73 A;  1B4O A;  1F9P A;  3CPF A;  3NBI A;  1LYL A;  2F1M A;  1HUM A;  2KVM A;  2UU9 L;  3S24 A;  5I2X A;  4YWM A;  3R2I A;  4PMC A;  1H9S A;  1L0W A;  3KYH C;  1LTR D;  1DZ1 A;  1YHQ A;  4BY1 B;  2QDB A;  5EKI A;  2FMM A;  3I72 A;  3J80 E;  1VS0 A;  5I6Y A;  5JPN C;  3J7A 5;  1E1O A;  1I4Q A;  2L9H A;  1O78 A;  2VNU D;  2EJM A;  3CC2 A;  1HCZ A;  3STB C;  1Y14 B;  2PQA A;  4JI5 L;  4GN5 A;  1U4P A;  3PO3 G;  2YU9 B;  1EIG A;  1VCI A;  1ZXT A;  4JI0 Q;  1EFI D;  5EKL A;  2K5H A;  1F9R A;  2SOB A;  3DXJ C;  3MEH A;  1E22 A;  2QW7 A;  2UXC Q;  5ELN A;  2UXB Q;  4IOA A;  1ENF A;  3NQT A;  5CBA E;  5ELF A;  4PG3 A;  3GDE A;  4JK1 C;  5IT9 c;  4X3K A;  1RKN A;  1SRO A;  2IHE A;  2XIW A;  1MGS A;  4GOP A;  2EPB A;  1F2M A;  2WB1 B;  1PVO A;  1TU2 B;  5M3F G;  3E6Z X;  5EQ0 A;  1DJR D;  3EBE A;  1SFO H;  2IX1 A;  3GD7 A;  3HS0 C;  2EDG A;  3H3V C;  1TWH H;  2ID0 A;  4JW0 A;  4CKB A;  2R93 B;  4X64 L;  2UXC L;  2EY1 A;  3R3O A;  4BBR B;  4L5T A;  1JMC A;  3EQL C;  1NY4 A;  4PMW A;  1MIU A;  2F0G A;  1LTS D;  1TWG H;  1G2T A;  4HIM A;  4RHS A;  2RDG A;  4A3E B;  3T16 A;  4XQN A;  1LTA D;  3KF8 A;  2VQF L;  1RIP A;  1N33 Q;  4BBS H;  4FXD A;  1QIL A;  2IY5 B;  1YHA A;  1PYB A;  1U5K A;  2JA8 B;  2VW9 A;  5FJ8 H;  3IKJ A;  1YZ6 A;  3Q24 A;  3I4M G;  4YCV A;  4CDE C;  1LTL A;  2PNR C;  1PTO H;  1XNQ L;  4HJ9 A;  4DNR B;  1NR4 A;  4HMJ A;  5E4W C;  3J81 j;  2JA5 H;  3S1Q H;  3S16 H;  1G2S A;  1GUN A;  2WB1 E;  4DUZ Q;  4Y52 H;  3U50 C;  4K8I A;  3NEN A;  3W1B A;  1SSO A;  1O7Z A;  2J7Z A;  1CZG A;  2EE1 A;  4CDD C;  1BO0 A;  5KEE A;  1MBY A;  1N33 L;  1AE3 A;  1DOK A;  3W5O A;  1QZG A;  1SEB D;  3CXC A;  1K0R A;  2K32 A;  2A19 A;  3F2D A;  3LGJ A;  3HOX G;  2ZJQ A;  1BQQ T;  3TP5 A;  1E0B A;  2IWH A;  5JJL A;  3ND8 A;  4LUV A;  3DWQ A;  1VF5 C;  2LSS A;  3HOY B;  4IFD I;  4JYA Q;  4J6H A;  2IT1 A;  3HOV B;  1I6V C;  2D0P A;  1CKN A;  3T4A C;  2K33 A;  1EYA A;  4C3J B;  2HHH Q;  1KL9 A;  3K80 C;  4LUO A;  3A8J E;  4KN7 C;  4L6T B;  1GHK A;  2MFI A;  1BNZ A;  2K7V A;  3AFP A;  3SVM A;  5IGF A;  1L2F A;  1I5F A;  5E3F A;  1S3O A;  5EPL A;  2IX0 A;  4U67 3;  3PO2 H;  1K0S A;  5EJW A;  3Q6S A;  1V43 A;  2ENB A;  2NN6 I;  1SNC A;  4JYA L;  5M3M B;  1S5F D;  1KRT A;  1A62 A;  2BH8 A;  3FMC A;  4OEM B;  5A2Q L;  5IYB G;  2O2L D;  3LNN A;  4KK7 A;  2LXJ A;  1AEX A;  1S40 A;  1YJN A;  4DAP A;  4JI6 Q;  2E2J B;  2OQK A;  3AB9 A;  1CSQ A;  4XYO A;  2D0O A;  1XX8 A;  5M5W H;  3HOW G;  5FLX L;  3GTL H;  2Y0S B;  5KNC A;  1L1O B;  3O13 A;  5JVH 3;  2I5M X;  5LL6 X;  4O2D A;  5C44 G;  1Y8P B;  1SNO A;  4XT3 B;  3G6E A;  1HNZ Q;  3H0G B;  2K4K A;  3R2T A;  3TZD A;  2R92 G;  1KTK A;  3IL8 A;  1Z7T A;  2QEJ C;  3A0J A;  4QIW B;  3RZO H;  4IAL A;  1VQH A;  4JI6 L;  3NQI A;  4O1N A;  4ZKB B;  2K04 A;  2NN6 G;  2ZTC A;  1NR2 A;  1EQT A;  2JA7 B;  3D4R A;  4A3I H;  5CV7 A;  1RJT A;  1VQ4 A;  1STB A;  4J15 A;  3ERS X;  2NTS A;  1G29 1;  2TMP A;  2V4D A;  1UE1 A;  1OXS C;  4IJL A;  4DR4 L;  1JJ2 A;  2IHF A;  1HNZ L;  1Y1W G;  1IZ6 A;  4DGZ A;  3TRZ A;  2ZJR A;  2YTV A;  2AQ2 B;  2FHT A;  1X32 A;  1YNJ D;  2G9H D;  1C4Q A;  2NZ1 D;  5CYU A;  5IOD A;  3NWS A;  2PMZ E;  1N36 L;  2FMC A;  2KBN A;  2LFN A;  1N8R C;  3MXU A;  4M8A A;  2MHV A;  1Q82 C;  1SYE A;  2F0V A;  4BY1 H;  3CRK C;  1QVC A;  3C1F A;  1CUK A;  1UE6 A;  4APV A;  3ULL A;  4IFD H;  1WVL A;  4EQ5 A;  5C0X J;  2B3G A;  3PV0 A;  4QIW E;  1RCV D;  4DU9 A;  2C9O A;  3EFX D;  3RN5 A;  4GS3 A;  2YU9 H;  4N9P A;  4A75 A;  2CFM A;  5D65 A;  1Q90 A;  2OQ0 A;  2RCF A;  4Y7N B;  1OXT A;  4O42 A;  4F8M A;  2OTJ A;  1M4V A;  1S5B D;  1TWF B;  3OWF A;  2F3I A;  3MZ5 A;  3SK8 A;  4DV5 Q;  3T1Y Q;  1JCK B;  3D6W A;  1YVC A;  2K6A A;  1TR5 A;  2K14 A;  2HCI A;  2L11 A;  1PH2 A;  3PUY A;  3M4O B;  5IIF A;  1VQP A;  3J80 L;  2CH4 W;  1LTT D;  3LWU A;  3VR3 A;  4P75 A;  4A3M G;  2PW5 A;  2SEB D;  3S2D B;  2BE5 D;  3I4N G;  2N8N A;  2EQS A;  2I07 B;  1CQV A;  4LWC A;  1PRT B;  5ELC A;  1LTB D;  3J7Z C;  3P75 A;  3HP3 A;  2PZT A;  1BR9 A;  4K5V A;  4ILW A;  1YBY A;  4DV5 L;  2UXD Q;  3QOJ A;  1MJC A;  4BBR H;  1H9M A;  2KED A;  3BJU A;  3FDT A;  1HZA A;  1V1Q A;  4JBM A;  2K5Q A;  1IBM L;  3MXG A;  1A3V A;  2DY7 A;  1VQN A;  3HKZ B;  1QNU A;  4A3E H;  3JAM c;  4POG A;  1SLJ A;  1KRS A;  3SR1 A;  3Q22 A;  1QOH A;  1R9T H;  4FF3 A;  2JQO A;  2B8F A;  4DV7 L;  3GTJ H;  4RKB A;  2EYF A;  4JOI C;  5EBC A;  2JA8 H;  4PZ6 A;  5FO8 B;  3QR8 A;  5GAD C;  1YJ9 A;  2E2H H;  4DV2 Q;  1JQY D;  4A3B H;  4MN3 A;  2AQ3 B;  1ZYR D;  2EYL A;  2Z9H A;  1TWC B;  4RCO A;  2UUB Q;  1NE3 A;  1VQL A;  3CCU A;  4DAY A;  4DR5 Q;  1WTH A;  5C4J B;  2A8V A;  5KGU A;  1CI3 M;  3W3A A;  4V0B A;  4H7B A;  5I4D A;  1N32 Q;  4R4T A;  1HZB A;  3MA2 B;  4BA1 I;  1STG A;  4DV6 Q;  1GKH A;  5JEA J;  2K05 A;  2JP1 A;  3J7A F;  2JA6 B;  4RCN A;  4DV2 L;  4LF8 Q;  2D2C C;  1M90 C;  5FLM H;  4AQY L;  1D7Q A;  3PGZ A;  5IP7 H;  4FDB A;  1FYC A;  3HKZ E;  4JI4 L;  4DR5 L;  1K9M C;  4GOP C;  2OT2 A;  3HOV H;  4JBJ A;  1NBW A;  1N32 L;  4DUY Q;  1TS4 A;  4KHZ A;  3J80 c;  4C3J H;  1PXU A;  2KCT A;  1XNR Q;  2RSN A;  4KHP Q;  4NPS A;  1I3Q B;  4QUC A;  4DV6 L;  1PH1 A;  1OXX K;  3DEP A;  4K8J A;  3J80 i;  1TY2 A;  1BBU A;  2MUY A;  2VUM B;  2O5I C;  1F2Y A;  2WKC A;  3GV3 A;  4XQJ A;  3NBH B;  1WI5 A;  1SBB B;  3RLF A;  3C2P A;  3FP9 A;  2GVB A;  5D14 A;  5IWA L;  4A3F B;  3GTP H;  1JWU D;  3CHB D;  3MWY W;  2F0J A;  4JI7 Q;  1HFN A;  2MO1 A;  2R7D A;  4DUY L;  1I4G A;  1I4H A;  3TP7 A;  2E2J H;  2KEE A;  4P73 A;  4DV4 Q;  1XNR L;  5IYD H;  2VXW A;  4KHP L;  1EIY B;  5K36 G;  3PUZ A;  4ZQ3 A;  4AYB B;  5COR A;  4BA2 I;  1ILP A;  3RUZ A;  1H9R A;  2L15 A;  4KLK A;  2ES2 A;  1QVG A;  4HSV A;  3LWE A;  4CKC A;  4KKS A;  3K5O A;  5C3W A;  4OO1 I;  1CFM A;  3FRP B;  3UE1 A;  1TS3 A;  3T56 B;  3H0G H;  2CWP A;  1U0L A;  2WAC A;  3VR6 A;  3HOU H;  3MEF A;  4P2C B;  3X3M A;  1O7L A;  3T1H L;  4A3D B;  4KHV A;  1JR0 D;  1CKO A;  4JI7 L;  3PUV A;  2PPB C;  4R8I A;  3MC0 B;  5C4X G;  1Q46 A;  4DV4 L;  2PYK A;  1X65 A;  4CGY B;  1A3U A;  5IP9 H;  2ZT9 C;  2RDF A;  5FO9 B;  4PNY A;  4B3S Q;  1ET6 A;  3NXW A;  5IGD A;  1RDP D;  2JA7 H;  4C56 C;  4HR7 B;  3J81 E;  3IFD A;  1WTO A;  5C0X H;  3L2P A;  2CH4 A;  4GNX C;  4LAA A;  2R3Z A;  4G7H C;  2F3W A;  2N3S A;  2HT1 A;  1HTL D;  1SRU A;  1IHZ A;  4K0K Q;  1HRJ A;  3MVV A;  3GTG H;  5IY0 A;  3DLL A;  1QNK A;  3VA7 A;  2ATW A;  1ML0 D;  4X66 Q;  2OF1 A;  1KNA A;  4X65 L;  4DR3 Q;  3FKI B;  2NVX B;  1BXT A;  1EWI A;  2K52 A;  3IFT A;  2JN4 A;  3EN2 A;  1E24 A;  2KEC A;  5H1S E;  5ELD A;  3MAQ A;  2PI2 E;  3MXN A;  5C3E B;  1RD9 D;  4LF5 Q;  5HGQ A;  2N49 A;  1Y69 U;  3S1N B;  4A3G H;  3QB3 A;  5CGK A;  4LF6 Q;  3ULP A;  1FJG Q;  3KLR A;  4K0K L;  3PF5 A;  4C1N K;  2EJG C;  4DR7 Q;  1RL2 A;  1JIC A;  2AHO B;  1JOO A;  3CAM A;  4DR3 L;  2BH2 A;  4OON A;  2ZXO A;  1MHW C;  3DMU A;  4Y7N H;  2F0F A;  3A8K E;  3QWN A;  4DR6 Q;  2J0T D;  1TWF H;  1HQR D;  4WFN 3;  1QUQ B;  2A68 C;  1G51 A;  4LJZ C;  2DJF C;  1X3E A;  3DM3 A;  4LF5 L;  5EGT A;  5IYC H;  4PQX A;  3M4O H;  2F0Q A;  1KNE A;  4HJ8 A;  1WCM B;  4LF6 L;  1YHB A;  2RHS B;  1JE5 A;  1FJG L;  5CMD A;  4OIK A;  3TQY A;  3S2D H;  2VQE Q;  1NMF A;  4IPG A;  3W1G A;  3VR2 A;  2H4O A;  1HNW Q;  3KF6 B;  4V19 0;  3BZD B;  4JC0 A;  5CV6 A;  1K28 A;  2N55 A;  4DR6 L;  3HZX A;  2M9V A;  1Q1B A;  3OPO A;  5GAH C;  1WOC A;  4FVM A;  1BOS A;  3QG1 A;  1STE A;  4OO1 H;  3KK7 A;  1QE6 A;  4JVZ A;  5CV4 A;  3J7A V;  3Q8D A;  1PH7 A;  1J8I A;  2WAQ G;  2Q2H A;  4HMI A;  3UDX A;  3OMG A;  4YIJ A;  4DR2 Q;  5JEA H;  4P71 A;  1DD2 A;  3TSS A;  1KDB A;  1GXD C;  1YI2 A;  3M9B A;  3F2B A;  3QOL A;  2F4V Q;  2O5J C;  4QB4 A;  1DON A;  3ITP A;  1TWC H;  4F7X A;  2QF7 A;  3CME A;  1HA5 A;  1LTI D;  4OHJ A;  3CW2 C;  2CW0 D;  5C4J H;  3ER0 A;  3NWT A;  2Z6K A;  3T51 B;  5BN5 A;  3OSO A;  3CCL A;  1CKM A;  4CHT B;  2ASB A;  4DR2 L;  3TS2 A;  2BA1 A;  3F2U A;  3Q0A A;  4B9X A;  3L9A X;  3SE0 A;  1JOK A;  1W3S A;  2A6E D;  2F4V L;  3SK4 A;  2JA6 H;  2FXQ A;  4FXK C;  3IAY A;  1K3R A;  3A7A B;  3D6C A;  1W2B A;  4IUR A;  1EIF A;  1B44 D;  1GUG A;  4BBS G;  5DLQ E;  1J6Q A;  1Q8K A;  1T5E A;  2CCZ A;  1V1P B;  1Y1V B;  5ELE A;  2ICE C;  4XXE A;  2F0D A;  2NZO A;  4KD3 A;  4S3S A;  5C4H A;  5FJ8 G;  4RAU C;  3TN2 A;  5CBE E;  3T53 B;  3BVG A;  2Z4I A;  4DK6 C;  1H95 A;  3PF4 A;  2V1C C;  1PHJ A;  1I3Q H;  3ONA B;  5I9P A;  2JA5 G;  4C3I H;  4KY6 A;  4OX9 Q;  4RGM A;  2EYP A;  4RA8 A;  5AFW A;  2JXM B;  1RF2 D;  1JC7 A;  1XWE A;  4DR1 Q;  1CSP A;  2VUM H;  4RFB A;  3NTI A;  1EOV A;  3KJO A;  1D2B A;  1HNX Q;  2F0E A;  3STB D;  1BKB A;  4R4Q A;  3S1M B;  1SNQ A;  1G6Z A;  4YWK A;  5C44 B;  5IGG A;  1RTO A;  4IZ8 A;  1CHP D;  4A3F H;  1BCP C;  1VQD A;  1CQF A;  5IGE A;  3QO2 A;  4JI0 L;  1XMQ Q;  2K75 A;  1JB3 A;  5T1G A;  3ZJY C;  2UUA Q;  1VQE A;  2M2L A;  4OX9 L;  2F0N A;  2UXB L;  2E2I H;  1EZ8 A;  3V2T A;  2KCC A;  4OXP A;  2RA4 A;  2F0W A;  3VDY A;  3CP0 A;  1HNX L;  2HDL A;  3L7Z C;  4NDX A;  1C48 A;  2KJX A;  1AZQ A;  5M5Y B;  3HEJ A;  1Y1W B;  3I8Z A;  3I70 A;  1VQ6 A;  1D5M C;  2VY3 A;  1KC8 C;  1XMQ L;  2EYJ A;  4IUN A;  4CDC C;  1PTO C;  3G48 A;  2UUA L;  1L1O A;  5IE8 A;  3CD6 A;  1E2V A;  2LMC B;  2CQA A;  2F0T A;  3TS0 A;  1OO9 B;  2AUK A;  2RSO A;  2PW7 A;  5HGT A;  1GVP A;  4WJ4 A;  1SYG A;  5AJ3 Q;  4KKU A;  5DM7 3;  4DAV A;  2BA0 A;  4UPA A;  1MI2 A;  1K73 C;  3ND9 A;  1EYG A;  3N52 A;  3RLN A;  2D62 A;  2R61 A;  2ZXP A;  1YNN C;  3FKI H;  2NVX H;  4H0L C;  4MIU A;  3I56 A;  1DXM A;  2NVY B;  1TWA B;  1EL0 A;  5JJK A;  4QF4 A;  4B9W A;  4JG2 A;  2KHJ A;  4TQU S;  4LF4 Q;  1AH9 A;  5C3E H;  3CMA A;  4RGO S;  5JAV A;  3TBI B;  3X3N A;  2RCN A;  1C9O A;  3J81 L;  4DUZ L;  4HCE A;  1EFW A;  1H9K A;  1S5E D;  4YWL A;  3DHQ A;  1SNP A;  2WP8 J;  1EIH A;  2Q2T A;  1L0Y B;  3SEB A;  2RDH A;  3GP7 A;  1KAB A;  1SND A;  2PO4 A;  4A4I A;  4DN4 M;  3I55 A;  1EY6 A;  2NBF A;  4ZK9 B;  5FOB B;  4ZYS A;  4LNQ A;  1DCZ A;  3K57 A;  4WJW A;  4A3L H;  1RTN A;  1H9J A;  3CCQ A;  1VMC A;  1ZKO A;  2WV6 D;  3E9H A;  1PV4 A;  4BXX H;  4XQQ A;  1XTD A;  1A8V A;  1WCM H;  2NWG A;  5IGB A;  1SMX A;  3OMC A;  2HHH L;  4BY1 G;  1TS2 A;  1HPC A;  1GOZ A;  1WD1 A;  1NNX A;  2QA4 A;  2RHQ B;  1RHP A;  1FGU A;  4IFD G;  3MFY A;  2L1B A;  4ODG A;  3RLO A;  1Z6H A;  4IJH A;  1OTC A;  4ZLT F;  1KIX A;  3H15 A;  3SHL A;  2KOL A;  3ICE A;  3CRL C;  3BYY B;  4LW1 A;  2BDO A;  3GTO B;  4B3M Q;  1SYB A;  1KDC A;  4C3H B;  4BY7 H;  2X6G A;  4JI1 Q;  1CHQ D;  3PSI A;  3RZD B;  4MNO A;  4FF2 A;  3VYU A;  4NP5 A;  1YNX A;  2R7Z H;  2YTX A;  1R4P B;  3S15 B;  5J39 A;  1C8C A;  4MHE A;  3N6R A;  1HQM C;  1XMO Q;  2DJG C;  4TKO B;  5GRO A;  4F88 A;  3S14 H;  4JI2 Q;  2WB1 G;  3PMF A;  4GLX A;  1SR3 A;  3ERQ A;  1ICW A;  2ZTE A;  1G8Z D;  5JJI A;  1IYU A;  1LT5 D;  2CVR A;  3TME A;  4DV1 Q;  3S1R B;  1IL2 A;  2JK8 A;  1NJI C;  2C5C A;  2B39 A;  4JI1 L;  4L5S A;  1IKM A;  3DWP A;  2LS0 1;  4BBR G;  4RKL A;  5EKK A;  2Y0S E;  1DOM A;  4K5W A;  1TS5 A;  3J81 i;  4POF A;  3BVZ A;  2EY5 A;  3FEW X;  3BYT B;  3S9W A;  1ESR A;  1VQ5 A;  1XMO L;  4A3E G;  1F2L A;  2MO0 A;  4G7Z C;  1EU3 A;  4GNX B;  2NUC A;  1B9N A;  4GLA C;  5EPK A;  5ELO A;  1YJW A;  1OXV A;  4EQN A;  1Y1V H;  4J8Q A;  2G5D A;  4DV1 L;  5DEH A;  1LLR D;  3S17 B;  4A3B G;  4JI8 Q;  5CV5 A;  4LFC Q;  5IOC A;  3E9I A;  1GUO A;  4OWT B;  5E4X A;  2A5H A;  1TVX A;  2EZV A;  4NW2 A;  2SNS A;  3I3C A;  2B2W A;  1WTV A;  1SE2 A;  2CQO A;  4ZCK A;  4UDU C;  1II3 A;  3HFZ B;  3RN2 A;  5FLX c;  4JPB W;  5LMN Q;  1N9W A;  4KJN A;  4DNI A;  2QIL A;  4RH6 A;  2A74 C;  4XDX A;  2A69 C;  3HOZ B;  1GO3 E;  1KHI A;  1LAB A;  4XTC S;  5C44 H;  1ESF A;  1CA5 A;  2HD3 A;  3URY A;  1S5D D;  4OEL B;  1LT6 D;  5JJZ A;  3L0O A;  1VQC A;  3PIP A;  5HUR A;  3E5S A;  2EXD A;  2Q2I A;  3LX0 A;  4JI8 L;  5FLM G;  2Z8L A;  3D4D A;  4QCL A;  4GLV B;  1JJG A;  2F0M A;  5C4X B;  2R93 H;  3A54 A;  1X55 A;  3T1Y L;  3OYY A;  3HOV G;  3HRZ C;  3A8I E;  2WFW A;  4JI3 Q;  1EY9 A;  1Y8O B;  3NBH A;  4A3K B;  2A6H C;  1SJH D;  4C3J G;  2MGS A;  4DKA C;  3ULJ A;  1PFM A;  1JOR A;  4DXG A;  2Z6K C;  2OWO A;  1GUW A;  5M5Y H;  2EY6 A;  1G91 A;  2AMC B;  3KFU A;  4IUT A;  1WTP A;  4DA2 A;  4HJA A;  3CKI B;  2KCN A;  3C46 A;  1LAC A;  3TDQ A;  4R9W A;  1Z9F A;  2XWB B;  2B8G A;  3CCR A;  2PI2 A;  3PIP 3;  2UXD L;  1LT4 D;  4WOR A;  4JI3 L;  4CJ1 B;  2O4X A;  2L55 A;  4UP9 A;  5C0X I;  2BCO A;  1M8A A;  5M9O A;  2Z4H A;  3F2C A;  3V05 A;  5M5X B;  2HQE A;  1STY A;  2DNE A;  2ZTD A;  3HGB A;  3GTM B;  4XT1 B;  3WOE A;  1EQQ A;  3K5M A;  4M1U B;  2E76 C;  1U4R A;  3U58 A;  1TWA H;  1XPR A;  3DM1 A;  3HOU G;  3OIQ A;  2UUB L;  3HOY H;  1STA A;  2RKS A;  4LF7 Q;  4BS9 A;  1UWV A;  2XNA C;  1XYI A;  1DGS A;  1UEA B;  1UUP A;  3VYR A;  3KUP A;  4HIO A;  4IPH A;  4OL7 A;  1ASY A;  5IP9 G;  1PZI D;  3K6O A;  2JA7 G;  3CCS A;  2F52 A;  3NHH A;  1VQM A;  3D8G A;  5C0X G;  5J22 A;  3D4W A;  1WJJ A;  4PMB A;  4LF8 L;  3KLW A;  2QKI C;  3GTQ B;  1ENC A;  1EQR A;  4UAI A;  3CCE A;  5LMU Q;  1SMY C;  1PH5 A;  1I4R A;  5M3M H;  2B63 B;  1VQ9 A;  2D9U A;  4H13 C;  4CKE A;  2WAQ B;  2SDF A;  1KD1 C;  2L0C A;  2F0P A;  1X3Q A;  1F9S A;  1EYD A;  2CHB D;  3TP8 A;  1KQS A;  3A74 A;  2ZXR A;  1EY7 A;  1J9O A;  1L1O C;  3NEL A;  1XPO A;  2VB2 X;  2OXP A;  5CV8 A;  4A3G G;  3OW2 A;  3H09 A;  1IL8 A;  4RG1 A;  4MZ9 A;  2KEN A;  3U4Z A;  2E75 C;  4A3J G;  2MPM A;  4KTA A;  4N8F A;  3PUW A;  1QZH A;  4EX5 A;  4ZKC B;  4RGN A;  4A93 B;  1EY4 A;  1N34 Q;  1SFO B;  3GTO H;  4QQB X;  1GUT A;  5J1Z A;  3CF5 A;  5JPM C;  4C3H H;  3M7N A;  2A1A A;  3HKS A;  3PIO A;  2L4N A;  1E7Z A;  5EPJ A;  3RZD H;  3KF6 A;  1X3P A;  4K5X A;  1PMR A;  5C4Z A;  1S72 A;  2G9D A;  3S15 H;  4QL5 A;  5IYC G;  3BU2 A;  3H6M A;  3ERO A;  3KBX A;  2AUJ D;  4FF4 A;  4NXN Q;  3M85 A;  3WWV A;  2XTI A;  2OCE A;  1X6O A;  5KND A;  2NVT B;  4J1M A;  2B2T A;  1KAA A;  2R6G A;  3S1R H;  1BF4 A;  1KLG D;  1PH6 A;  3NSW A;  1NUC A;  3PO3 B;  3VR5 A;  4AYB E;  2K5D A;  1ILQ A;  1FGB D;  4OO1 G;  1GM5 A;  4FXG C;  3OTO Q;  3S16 B;  1DOL A;  4KV6 A;  4B3S L;  3HKZ G;  3PIO 3;  1EWC A;  1JJC B;  3A5U A;  5CV9 A;  4A76 A;  3E0E A;  4NXN L;  1IKL A;  1NCV A;  5JEA G;  2XVS A;  3AQQ A;  5COY A;  3GO5 A;  5DAU A;  5NUC A;  4DV0 Q;  1B50 A;  4UP7 A;  2KHS A;  1PH4 A;  5ISR A;  1W6J A;  3FPP A;  3NPP A;  2EOT A;  5E1F A;  3S17 H;  1P16 A;  1V1O A;  5M3F B;  1I6H B;  5C5M A;  4X66 L;  2F03 A;  3FPU B;  3AU7 A;  5K5P A;  5K36 H;  3ZYY X;  3FVQ A;  2K01 A;  3BZC A;  4L63 B;  1V1P A;  4DF7 A;  3HG9 A;  2KA7 A;  2IW3 A;  3HOZ H;  3KOJ A;  4DV0 L;  1U9R A;  2KUM A;  4X3U A;  1V8Q A;  2P5Z X;  5BN3 A;  1BBX C;  1EQV A;  2JA6 G;  2EY2 A;  1VQF A;  4DR7 L;  3GTK B;  3BS1 A;  3E0J A;  1PRT C;  1B3A A;  2IJ0 A;  4L8J A;  2NB0 A;  2ALY B;  1IYV A;  4PZ8 A;  5GAE C;  5C4X H;  1TQO A;  2QGQ A;  3I4M B;  2A68 D;  4IOC A;  4K6D A;  4A3K H;  1UAP A;  4UY8 C;  4A3C H;  4HN7 A;  2ICI A;  5LL6 S;  4C3I G;  4HIK A;  1G6P A;  1ASZ A;  1STN A;  5M5W B;  4QY7 A;  4ZUI A;  2LXK A;  2VQE L;  2VUM G;  3JAM E;  3A55 A;  1Q86 C;  4NXM Q;  1C0A A;  1HNW L;  1IW7 C;  1ENA A;  3MFG A;  3HOX B;  4A3F G;  1SDF A;  5D3D A;  1WTW A;  3SXH A;  1KXL A;  4HJ5 A;  1BUV T;  4LFA Q;  3CC7 A;  4X6A H;  2RQX A;  5KIX A;  5M5X H;  2A73 B;  1JWM D;  1WTQ A;  4BWG B;  2B2U A;  5T1I A;  1XPU A;  3OHX C;  4B08 A;  4NB3 A;  1UE7 A;  1CM9 A;  4DXF A;  4NXM L;  3GTM H;  1EOT A;  1EEI D;  2XRQ D;  1BCP F;  3E3X A;  3K0Y A;  2N88 A;  4OGQ C;  1AP0 A;  4QMG A;  3OWE B;  2Q8T A;  4G4K A;  4MTN A;  4JI5 Q;  3EIV A;  2K5V A;  3I7F A;  4L5Q A;  1STH A;  4LFA L;  2HQL A;  1PYW D;  5CR3 A;  2NVQ B;  2KQ3 A;  5KRU A;  3CPW A;  4GKK Q;  1VQK A;  4JOI A;  3K81 C;  4KMU C;  5EBD A;  2F0O A;  3M4P A;  2XGT A;  3WOF A;  3G71 A;  4E6I A;  2E8G A;  4NMZ A;  2NYZ D;  1CK1 A;  3HOW B;  4YHH Q;  4ABN A;  1VF7 A;  2I5L X;  2RVL A;  3GTQ H;  4FO2 A;  2B2Y A;  3NTK A;  1A15 A;  1PTO F;  4ME5 A;  1D6E C;  4IUP A;  3FKI G;  2B63 H;  3PQI A;  2EXZ A;  1X9N A;  1XXG A;  2R92 B;  3NE5 B;  1EU4 A;  3K0X A;  4GKK L;  4X64 Q;  1IBK Q;  2HIV A;  2MP1 A;  5KYL A;  1VQA A;  3KDF B;  5I9O A;  1UNS A;  5C3E G;  1QWY A;  3AMU A;  3KJP A;  1PFB A;  2DGY A;  1P8L A;  2IPK D;  4YHH L;  1K83 B;  2X69 A;  4DR1 L;  1MSH A;  1EYC A;  1XTC D;  4I65 A;  1HHV A;  4IFD J;  4YCU A;  1O80 A;  2PNH A;  1O7I A;  2Z1C A;  2GN5 A;  2B2V A;  4HCS A;  2VQF Q;  2WKD A;  2DN8 A;  3CQZ B;  1K8A C;  3KLS A;  1BCP D;  1SXT A;  1Q3L A;  2UUC Q;  4HSP A;  4IUV A;  4A93 H;  1Q81 C;  3VA5 A;  4R8N A;  4A3D H;  1HJP A;  4R4C A;  3EJI A;  1MJE A;  1FL0 A;  3TRE A;  1XNQ Q;  3H3V H;  2FFK B;  1IBK L;  1A0I A;  3PO2 G;  3BDC A;  2L5T A;  1WTR A;  2K5W A;  2CKZ B;  4A3L G;  1UEB A;  1CT1 D;  3I90 A;  3JC6 6;  1F77 A;  4BXX G;  4K2L A;  5I6W A;  1WCM G;  1S5C D;  1HA6 A;  4KKT A;  5FK9 C;  1K8M A;  4R4I A;  4G7O C;  2K5N A;  2EYM A;  3P1H A;  1K8O A;  2NVT H;  4HAE A;  4K2K A;  4JBK A;  1R9T B;  3RR5 A;  1E2W A;  3GV6 A;  2UUC L;  1YEZ A;  2F0L A;  2JSO A;  3GTJ B;  4K6L A;  1B7Y B;  1PTO D;  1QJO A;  3PO3 H;  1UE5 A;  4F87 A;  2YV5 A;  2VS1 A;  4AIM A;  4A3B B;  2E2H B;  2NZH A;  1NMG A;  4IO9 A;  1H9S B;  1BDO A;  2J4X A;  4GKJ Q;  3TP6 A;  4I7Z C;  1LT3 D;  2DUD A;  3NP8 A;  2AWO A;  2E2D C;  2K1B A;  4BY7 G;  1CA6 A;  3DWA A;  1T9H A;  3A56 A;  3TZU A;  2PQA B;  1JB7 A;  3S1N H;  4LMQ D;  4U68 A;  5AJ3 L;  1PZJ D;  3H91 A;  2R7Z G;  1M1K C;  4ME3 A;  1YNN D;  4A3M B;  4FF1 A;  5M3F H;  4A3I G;  1I6H H;  3I4N B;  1OXU A;  1HUN A;  4DK0 A;  4GKJ L;  1BVS A;  2EJF C;  1FNW A;  1O7Y A;  1PDQ A;  2Q8R E;  5J3B A;  4GNX A;  2EYH A;  5BN4 A;  1ONL A;  1Q1E A;  2QEX A;  4LF4 L;  5E7N A;  5G3L F;  4X62 Q;  2TSS A;  4PV1 C;  4WRD A;  4GOP B;  1A2T A;  1I50 B;  2R7F A;  4X3T A;  1GD7 A;  1VQ8 A;  4G57 A;  5KYI A;  4RMF A;  3U4V A;  3D0F A;  1IBL Q;  3GTK H;  1QCB D;  1D5X C;  1ZEQ X;  2F0K A;  2Z0S A;  3OIP A;  3L3O C;  5L37 A;  1CZW A;  3M4Q A;  1Q12 A;  1MSG A;  1Y1V G;  2SNM A;  4ULL A;  5HY6 A;  4HID A;  2OEO A;  3I4M H;  4Q0F A;  1MD2 D;  3K7U C;  1B53 A;  4KY7 A;  3GTP B;  4JV5 Q;  2GA4 B;  4X62 L;  3A7L A;  3SK6 A;  3CCM A;  2B2T C;  3KF8 B;  2BDN A;  4YY3 Q;  4IUU A;  1ET9 A;  2PMZ B;  2I0Q A;  3K5L A;  3S2H B;  3NEM A;  4FP5 D;  4CDF C;  1VDZ A;  3GQB A;  1CTM A;  4Z9C B;  1IBL L;  1A6X A;  5CC4 A;  5FO7 B;  3NTH A;  3Q23 A;  4YCW A;  3U9S A;  4DR4 Q;  4HED A;  3HOX H;  3SK5 A;  2B29 A;  1AZP A;  1I4X A;  3HOU B;  1QG7 A;  2GVA A;  4JV5 L;  1W6K A;  1VMP A;  4LFB Q;  4C2M B;  1Q7Y C;  1N36 Q;  4B3M L;  1SYF A;  2K03 A;  1AN8 A;  1YNJ C;  2R93 G;  3BVM A;  4AH6 A;  5G3L D;  4YY3 L;  3UE0 A;  3J81 c;  2C35 B;  3NK9 A;  3K7A B;  1IXR A;  1GHJ A;  1C7Y A;  3JAM L;  4B3T Q;  3SGI A;  1LM0 A;  1L0X B;  3W2D A;  1Z47 A;  4IQZ A;  4JI2 L;  2VB3 X;  1T5X D;  1SNM A;  4DK1 A;  1Y8N B;  1EWH A;  3GTG B;  1A3T A;  3BZK A;  1CKN B;  4UP8 A;  4LFB L;  1PA6 A;  3KBG A;  1SJE D;  4R1J A;  1SN8 A;  2JA8 G;  1JOQ A;  2NVQ H;  5IYB H;  4QUF A;  1B8A A;  2RF4 A;  1JE4 A;  1D1K A;  1FNV A;  2DY8 A;  2I46 A;  2F0H A;  3UDI A;  1HZ9 A;  1DM0 B;  1PH3 A;  3BDL A;  3R93 A;  3UDG A;  3HOW H;  3OOC A;  2K28 A;  2QCP X;  4EVO A;  4H02 A;  4B3T L;  4A3G B;  1PH9 A;  1HH2 P;  4UHV A;  1D1I A;  2PZW A;  4OIJ A;  4A3J B;  3S1M H;  1VQJ A;  5IT9 E;  1U4L A;  2XSC A;  4CBV A;  2WII B;  2R92 H;  1SYD A;  2BE5 C;  3BG3 A;  4B3R Q;  1JWS D;  2AKW B;  4EQO A;  4KY5 A;  1QB5 D;  4LFC L;  4ID6 A;  1VQI A;  1LTG D;  2HDM A;  3HOY G;  2CWA A;  5IP7 G;  2KHI A;  3H94 A;  1EUJ A;  1I4P A;  3PUX A;  2VL6 A;  4IUQ A;  2N78 A;  1IBM Q;  2NN6 H;  1K83 H;  4R4O A;  4OWW B;  5LMN W;  2A69 D;  1WYD A;  3FHW A;  5LMN L;  1MKH A;  1U4M A;  1V9P A;  3M3Y B;  4LK1 C;  3CQZ H;  2Q8I B;  2F0I A;  4LF9 Q;  4QGU A;  1B3Q A;  1KDA A;  3RMH A;  4DV7 Q;  3EVQ A;  1Y1W H;  2B2U C;  3CU7 A;  2PCF B;  4B3R L;  1X3G A;  1X56 A;  2E74 C;  1PLF A;  5M3M G;  3A5Z B;  1EEF D;  1ZYR C;  3M7G A;  2A6H D;  1K3B C;  4OWX B;  2EYO A;  1TY0 A;  2WIN B;  1I94 Q;  1BBW A;  5IYD G;  1PYS B;  4EQP A;  2Q2U A;  1HXY D;  4LF9 L;  3JAM i;  2Y0S G;  3BDO A;  4DV3 Q;  1R4Q B;  3OW7 A;  4AQY Q;  2LY7 A;  3D3R A;  2KCM A;  3H0G G;  2NVY H;  4KN4 C;  4JI4 Q;  2AWN A;  3CCJ A;  2IX3 A;  2JYO A;  2XRS D;  3T13 A;  5F2D A;  1AW7 A;  4C3H G;  1KAW A; 
#chains in the Genus database with same CATH homology
 2F4I A;  2B2Y C;  4FNF A;  3G6J B;  1EY0 A;  2NTT A;  3K5N A;  4EGV A;  4ZUJ A;  2JE6 I;  5LHY 1;  4JBW A;  2PZU A;  5A35 A;  2FIN B;  2B2V C;  5DM6 3;  3MHB A;  2HCC A;  4XYQ A;  3DUZ A;  5KNB A;  4C3I B;  2AQ1 B;  1S4Z A;  2M00 A;  3K58 A;  1SAP A;  1ROD A;  4C1N I;  1HTP A;  2EVB A;  4RWS C;  4CJ0 B;  2HUG A;  1F2Z A;  1SMY D;  2F3V A;  1NAP A;  4KI0 A;  1BCP B;  3G7L A;  1WD0 A;  4Q5V A;  3V96 A;  2BOS A;  4RHR A;  1EY5 A;  1TWH B;  5C5L A;  2H1E A;  2E2I B;  4CJ2 C;  2FJ2 A;  4XIG S;  2D5D A;  3VR4 A;  3RD4 A;  1FD7 D;  3WDN A;  2F0S A;  3U9O A;  3MXP A;  3P7J A;  1TWG B;  4DFA A;  1TII D;  1LO5 D;  1TT2 A;  4BBS B;  2IL8 A;  4NKL A;  3EA6 A;  2RBM A;  3R8B A;  3QIA A;  4N9T A;  3M4Y A;  1GJX A;  1PTO B;  1SE3 A;  4KD4 A;  2F0U A;  3C1E A;  3C3L A;  3MTS A;  1Q8I A;  2JA5 B;  2MJ8 A;  1WTX A;  3S1Q B;  3I91 A;  1TKW B;  4HTH A;  5I2Y A;  3K59 A;  1PRT F;  5DNF A;  4ZAI A;  1EY8 A;  1AFP A;  1F9Q A;  3KLS X;  1DYQ A;  4IN3 A;  3DEO A;  4FYD A;  4X3S A;  4KJO A;  1B2T A;  1GUS A;  4RGT A;  3VYT A;  2JEA I;  3VYS A;  4TRD A;  1EZ6 A;  1FR3 A;  3QJY A;  5A2Q E;  1PFN A;  5C6A A;  1SE4 A;  1HFG A;  2PQE A;  5D3I B;  5ELB A;  5FLX E;  2LKV A;  4GZY C;  1D5Z C;  1PZK D;  5TSS A;  1FNU A;  1KLU D;  3PO2 B;  1SYC A;  1B9M A;  2L12 A;  2XN9 C;  1NSN S;  2DNC A;  3J7Y W;  1PRT D;  5IT9 L;  3GTL B;  3D31 A;  1E2Z A;  2XWJ B;  3I4L A;  1LV9 A;  3NUC A;  3UI2 A;  2CW0 C;  3P20 A;  4BY7 B;  4H44 C;  3RZO B;  4DNT B;  2YYZ A;  4TSS A;  2X6L A;  2R7Z B;  2JEB I;  4ZRZ A;  1IW7 D;  3SDZ A;  1B1Z A;  2A6E C;  4A3I B;  3S14 B;  5JVG 3;  5JOB A;  2B2W C;  1A2U A;  5FKA C;  4K14 A;  5C3X A;  5IGC A;  3I73 A;  1B4O A;  1F9P A;  3NBI A;  2F1M A;  1HUM A;  2KVM A;  5I2X A;  3R2I A;  4PMC A;  1H9S A;  1LTR D;  1DZ1 A;  4BY1 B;  2QDB A;  5EKI A;  2FMM A;  3I72 A;  3J80 E;  5I6Y A;  5JPN C;  1I4Q A;  2L9H A;  1O78 A;  2VNU D;  2EJM A;  1HCZ A;  1U4P A;  2YU9 B;  1EIG A;  1VCI A;  1ZXT A;  1EFI D;  5EKL A;  1F9R A;  2SOB A;  3DXJ C;  3MEH A;  1ENF A;  3NQT A;  5CBA E;  5ELF A;  4JK1 C;  4X3K A;  1RKN A;  2XIW A;  1MGS A;  2EPB A;  1F2M A;  2WB1 B;  1TU2 B;  3E6Z X;  5EQ0 A;  1DJR D;  2IX1 A;  3GD7 A;  3HS0 C;  2EDG A;  3H3V C;  2ID0 A;  4CKB A;  2R93 B;  2EY1 A;  3R3O A;  4BBR B;  3EQL C;  4PMW A;  2F0G A;  1LTS D;  1G2T A;  4RHS A;  2RDG A;  4A3E B;  3T16 A;  4XQN A;  1LTA D;  3KF8 A;  4FXD A;  1QIL A;  2JA8 B;  3Q24 A;  3IKJ A;  2PNR C;  1PTO H;  4DNR B;  1NR4 A;  4HMJ A;  5E4W C;  1G2S A;  1GUN A;  4K8I A;  1SSO A;  1O7Z A;  2J7Z A;  1CZG A;  2EE1 A;  5KEE A;  1BO0 A;  1MBY A;  1DOK A;  1SEB D;  2K32 A;  1BQQ T;  3TP5 A;  1E0B A;  2IWH A;  3ND8 A;  3DWQ A;  1VF5 C;  3HOY B;  4IFD I;  4J6H A;  2IT1 A;  3HOV B;  1I6V C;  3T4A C;  2K33 A;  1EYA A;  4C3J B;  3A8J E;  4KN7 C;  4L6T B;  1GHK A;  1BNZ A;  2K7V A;  3SVM A;  5IGF A;  5E3F A;  5EPL A;  2IX0 A;  4U67 3;  5EJW A;  3Q6S A;  1V43 A;  2ENB A;  2NN6 I;  1SNC A;  5M3M B;  1S5F D;  3FMC A;  5A2Q L;  2O2L D;  3LNN A;  4KK7 A;  1AEX A;  4DAP A;  2E2J B;  3AB9 A;  4XYO A;  1XX8 A;  5FLX L;  2Y0S B;  5KNC A;  3O13 A;  5JVH 3;  5LL6 X;  1Y8P B;  1SNO A;  4XT3 B;  3H0G B;  3R2T A;  3TZD A;  1KTK A;  3IL8 A;  1Z7T A;  2QEJ C;  4QIW B;  4IAL A;  3NQI A;  4O1N A;  4ZKB B;  2K04 A;  2NN6 G;  1NR2 A;  1EQT A;  2JA7 B;  3D4R A;  5CV7 A;  1RJT A;  1STB A;  2NTS A;  1G29 1;  2TMP A;  2V4D A;  1OXS C;  4DGZ A;  2AQ2 B;  2FHT A;  1X32 A;  1YNJ D;  2G9H D;  1C4Q A;  2NZ1 D;  5CYU A;  5IOD A;  3NWS A;  2FMC A;  2LFN A;  3MXU A;  4M8A A;  2MHV A;  1SYE A;  2F0V A;  3CRK C;  3C1F A;  4IFD H;  1WVL A;  5C0X J;  3PV0 A;  4DU9 A;  1RCV D;  2C9O A;  3EFX D;  4N9P A;  5D65 A;  1Q90 A;  4Y7N B;  1OXT A;  4O42 A;  4F8M A;  1M4V A;  1S5B D;  1TWF B;  3OWF A;  3SK8 A;  3MZ5 A;  1JCK B;  3D6W A;  2K6A A;  1TR5 A;  2HCI A;  2L11 A;  3PUY A;  3M4O B;  5IIF A;  3J80 L;  3LWU A;  1LTT D;  3VR3 A;  2PW5 A;  2SEB D;  3S2D B;  2BE5 D;  2I07 B;  1CQV A;  1PRT B;  5ELC A;  1LTB D;  3P75 A;  3HP3 A;  2PZT A;  1BR9 A;  4K5V A;  4ILW A;  3QOJ A;  1H9M A;  2KED A;  3FDT A;  2K5Q A;  3MXG A;  1A3V A;  2DY7 A;  3HKZ B;  1QNU A;  3SR1 A;  3Q22 A;  1QOH A;  4FF3 A;  2B8F A;  4RKB A;  2EYF A;  5EBC A;  5FO8 B;  1JQY D;  4MN3 A;  2AQ3 B;  1ZYR D;  2EYL A;  1TWC B;  4RCO A;  4DAY A;  5C4J B;  5KGU A;  1CI3 M;  3W3A A;  4V0B A;  4H7B A;  5I4D A;  3MA2 B;  4BA1 I;  1STG A;  5JEA J;  2K05 A;  2JP1 A;  3J7A F;  2JA6 B;  4RCN A;  2D2C C;  1FYC A;  2OT2 A;  1TS4 A;  4KHZ A;  1PXU A;  2RSN A;  1I3Q B;  4QUC A;  1OXX K;  3DEP A;  4K8J A;  1TY2 A;  2MUY A;  2VUM B;  2O5I C;  1F2Y A;  2WKC A;  3GV3 A;  4XQJ A;  1SBB B;  3RLF A;  3C2P A;  5D14 A;  4A3F B;  1JWU D;  3CHB D;  3MWY W;  2F0J A;  1HFN A;  1I4G A;  1I4H A;  3TP7 A;  2KEE A;  2VXW A;  5K36 G;  3PUZ A;  4ZQ3 A;  4AYB B;  5COR A;  4BA2 I;  1ILP A;  3RUZ A;  1H9R A;  4HSV A;  3LWE A;  4CKC A;  4KKS A;  3K5O A;  5C3W A;  4OO1 I;  1CFM A;  3FRP B;  1TS3 A;  3T56 B;  2WAC A;  3VR6 A;  4P2C B;  3X3M A;  1O7L A;  4A3D B;  4KHV A;  1JR0 D;  3PUV A;  2PPB C;  4R8I A;  3MC0 B;  2PYK A;  4CGY B;  1A3U A;  2ZT9 C;  2RDF A;  5FO9 B;  4PNY A;  1ET6 A;  3NXW A;  5IGD A;  1RDP D;  4C56 C;  4HR7 B;  3J81 E;  3IFD A;  1WTO A;  5C0X H;  4LAA A;  2R3Z A;  4G7H C;  2F3W A;  1HTL D;  1IHZ A;  1HRJ A;  3MVV A;  1QNK A;  3VA7 A;  1ML0 D;  2OF1 A;  1KNA A;  3FKI B;  2NVX B;  1BXT A;  3IFT A;  2KEC A;  5ELD A;  3MAQ A;  3MXN A;  5C3E B;  1RD9 D;  1Y69 U;  3S1N B;  3QB3 A;  5CGK A;  3KLR A;  4C1N K;  2EJG C;  1JIC A;  1JOO A;  2ZXO A;  3DMU A;  2F0F A;  3A8K E;  3QWN A;  2J0T D;  1HQR D;  4WFN 3;  2A68 C;  4LJZ C;  5EGT A;  4PQX A;  2F0Q A;  1KNE A;  1WCM B;  5CMD A;  4OIK A;  3VR2 A;  2H4O A;  4V19 0;  3BZD B;  5CV6 A;  2N55 A;  3HZX A;  2M9V A;  1Q1B A;  3OPO A;  4FVM A;  1BOS A;  3QG1 A;  1STE A;  4OO1 H;  3KK7 A;  1QE6 A;  5CV4 A;  3J7A V;  1J8I A;  4HMI A;  3OMG A;  4YIJ A;  5JEA H;  1DD2 A;  3TSS A;  1KDB A;  1GXD C;  3QOL A;  2O5J C;  4QB4 A;  1DON A;  3ITP A;  4F7X A;  2QF7 A;  1HA5 A;  1LTI D;  4OHJ A;  2CW0 D;  3NWT A;  3T51 B;  5BN5 A;  3OSO A;  4CHT B;  2BA1 A;  3F2U A;  3Q0A A;  4B9X A;  3L9A X;  3SE0 A;  1JOK A;  2A6E D;  3SK4 A;  4FXK C;  3IAY A;  3A7A B;  3D6C A;  4IUR A;  1B44 D;  1GUG A;  1T5E A;  1V1P B;  1Y1V B;  5ELE A;  2ICE C;  4XXE A;  2F0D A;  4KD3 A;  4S3S A;  5C4H A;  4RAU C;  3TN2 A;  5CBE E;  3T53 B;  3BVG A;  2Z4I A;  3ONA B;  5I9P A;  4KY6 A;  4RGM A;  2EYP A;  4RA8 A;  5AFW A;  2JXM B;  1RF2 D;  1JC7 A;  1XWE A;  4RFB A;  3NTI A;  1D2B A;  2F0E A;  3S1M B;  1SNQ A;  1G6Z A;  5C44 B;  5IGG A;  1RTO A;  4IZ8 A;  1CHP D;  1BCP C;  1CQF A;  5IGE A;  3QO2 A;  5T1G A;  1JB3 A;  2M2L A;  2F0N A;  1EZ8 A;  3V2T A;  2KCC A;  2RA4 A;  2F0W A;  2HDL A;  3L7Z C;  4NDX A;  1C48 A;  2KJX A;  1AZQ A;  5M5Y B;  3HEJ A;  1Y1W B;  3I8Z A;  3I70 A;  1D5M C;  2EYJ A;  4IUN A;  1PTO C;  1E2V A;  2LMC B;  2CQA A;  2F0T A;  1OO9 B;  2AUK A;  2RSO A;  2PW7 A;  5HGT A;  1SYG A;  4KKU A;  5DM7 3;  4DAV A;  2BA0 A;  1MI2 A;  3ND9 A;  3N52 A;  2D62 A;  2R61 A;  2ZXP A;  1YNN C;  4H0L C;  4MIU A;  1DXM A;  2NVY B;  1TWA B;  1EL0 A;  4QF4 A;  4B9W A;  4TQU S;  4RGO S;  5JAV A;  3TBI B;  3X3N A;  3J81 L;  4HCE A;  1H9K A;  1S5E D;  3DHQ A;  1SNP A;  2WP8 J;  1EIH A;  1L0Y B;  3SEB A;  2RDH A;  3GP7 A;  1KAB A;  1SND A;  2PO4 A;  4DN4 M;  5FOB B;  1EY6 A;  2NBF A;  4ZK9 B;  4ZYS A;  1DCZ A;  3K57 A;  4WJW A;  1RTN A;  1H9J A;  1VMC A;  1ZKO A;  2WV6 D;  4XQQ A;  2NWG A;  5IGB A;  3OMC A;  1TS2 A;  1HPC A;  1GOZ A;  1WD1 A;  1RHP A;  4IFD G;  3MFY A;  2L1B A;  4ODG A;  1Z6H A;  4ZLT F;  3SHL A;  2KOL A;  3CRL C;  3BYY B;  2BDO A;  3GTO B;  1SYB A;  1KDC A;  4C3H B;  2X6G A;  1CHQ D;  3RZD B;  4FF2 A;  3VYU A;  4NP5 A;  1R4P B;  3S15 B;  5J39 A;  1C8C A;  4MHE A;  3N6R A;  1HQM C;  4TKO B;  4F88 A;  3PMF A;  3ERQ A;  1ICW A;  1G8Z D;  1IYU A;  1LT5 D;  2CVR A;  3TME A;  3S1R B;  2C5C A;  2B39 A;  1IKM A;  3DWP A;  2LS0 1;  4RKL A;  5EKK A;  1DOM A;  4K5W A;  1TS5 A;  3BVZ A;  2EY5 A;  3FEW X;  3BYT B;  3S9W A;  1ESR A;  1F2L A;  4G7Z C;  1EU3 A;  2NUC A;  1B9N A;  5EPK A;  1OXV A;  4EQN A;  4J8Q A;  5DEH A;  1LLR D;  3S17 B;  5CV5 A;  5IOC A;  1GUO A;  5E4X A;  2A5H A;  1TVX A;  2EZV A;  4NW2 A;  2SNS A;  3I3C A;  2B2W A;  1WTV A;  1SE2 A;  4UDU C;  1II3 A;  4KJN A;  2QIL A;  4RH6 A;  2A74 C;  4XDX A;  2A69 C;  3HOZ B;  1LAB A;  4XTC S;  1ESF A;  1CA5 A;  3URY A;  1S5D D;  1LT6 D;  5JJZ A;  5HUR A;  3E5S A;  3LX0 A;  2Z8L A;  3D4D A;  4QCL A;  2F0M A;  5C4X B;  3A54 A;  3HRZ C;  3A8I E;  1EY9 A;  1Y8O B;  3NBH A;  4A3K B;  2A6H C;  1SJH D;  4C3J G;  2MGS A;  1PFM A;  1JOR A;  4DXG A;  1GUW A;  2EY6 A;  1G91 A;  4IUT A;  1WTP A;  4DA2 A;  3CKI B;  2KCN A;  3C46 A;  1LAC A;  3TDQ A;  4R9W A;  2XWB B;  2B8G A;  3PIP 3;  1LT4 D;  4WOR A;  4CJ1 B;  2O4X A;  2L55 A;  5C0X I;  2BCO A;  1M8A A;  5M9O A;  2Z4H A;  3V05 A;  5M5X B;  2HQE A;  1STY A;  2DNE A;  3HGB A;  3GTM B;  4XT1 B;  3WOE A;  3K5M A;  4M1U B;  2E76 C;  1U4R A;  3DM1 A;  3OIQ A;  1STA A;  2RKS A;  4BS9 A;  2XNA C;  1XYI A;  1UEA B;  1UUP A;  3VYR A;  3KUP A;  4OL7 A;  1PZI D;  3K6O A;  3NHH A;  3D8G A;  5C0X G;  5J22 A;  3D4W A;  4PMB A;  3GTQ B;  2QKI C;  1ENC A;  4UAI A;  1SMY C;  1I4R A;  2B63 B;  2D9U A;  4H13 C;  4CKE A;  2WAQ B;  2SDF A;  2L0C A;  2F0P A;  1X3Q A;  1F9S A;  1EYD A;  2CHB D;  3TP8 A;  2ZXR A;  1EY7 A;  1J9O A;  2VB2 X;  2OXP A;  5CV8 A;  3H09 A;  1IL8 A;  2E75 C;  2MPM A;  4KTA A;  3PUW A;  4ZKC B;  4RGN A;  4A93 B;  1EY4 A;  1SFO B;  1GUT A;  5J1Z A;  5JPM C;  3M7N A;  2L4N A;  5EPJ A;  1X3P A;  4K5X A;  1PMR A;  5C4Z A;  2G9D A;  3H6M A;  3ERO A;  3KBX A;  2AUJ D;  4FF4 A;  3M85 A;  5KND A;  2NVT B;  4J1M A;  2B2T A;  1KAA A;  2R6G A;  1BF4 A;  1KLG D;  3NSW A;  1NUC A;  3PO3 B;  3VR5 A;  2K5D A;  1ILQ A;  1FGB D;  4OO1 G;  4FXG C;  3S16 B;  1DOL A;  4KV6 A;  3PIO 3;  1EWC A;  5CV9 A;  1IKL A;  1NCV A;  5JEA G;  2XVS A;  5COY A;  3GO5 A;  5DAU A;  5NUC A;  1B50 A;  2KHS A;  5ISR A;  1W6J A;  3FPP A;  3NPP A;  2EOT A;  5E1F A;  1V1O A;  5M3F B;  1I6H B;  5C5M A;  2F03 A;  3FPU B;  3AU7 A;  5K5P A;  5K36 H;  3ZYY X;  3FVQ A;  2K01 A;  4L63 B;  1V1P A;  4DF7 A;  3HG9 A;  2KA7 A;  2IW3 A;  1U9R A;  2KUM A;  4X3U A;  1V8Q A;  5BN3 A;  1BBX C;  1EQV A;  2EY2 A;  3GTK B;  3BS1 A;  3E0J A;  1PRT C;  1B3A A;  2IJ0 A;  4L8J A;  2NB0 A;  1IYV A;  1TQO A;  3I4M B;  2A68 D;  4K6D A;  1UAP A;  4HN7 A;  2ICI A;  5LL6 S;  4C3I G;  1STN A;  5M5W B;  4ZUI A;  3JAM E;  3A55 A;  1IW7 C;  1ENA A;  3MFG A;  3HOX B;  1SDF A;  5D3D A;  1WTW A;  3SXH A;  1BUV T;  2RQX A;  5KIX A;  2A73 B;  1JWM D;  1WTQ A;  4BWG B;  2B2U A;  5T1I A;  3OHX C;  4B08 A;  1CM9 A;  4DXF A;  1EOT A;  1EEI D;  2XRQ D;  1BCP F;  3K0Y A;  2N88 A;  4OGQ C;  1AP0 A;  4QMG A;  3OWE B;  2Q8T A;  4G4K A;  1STH A;  5CR3 A;  1PYW D;  2NVQ B;  2KQ3 A;  5KRU A;  4KMU C;  5EBD A;  2F0O A;  3WOF A;  4E6I A;  4NMZ A;  2NYZ D;  1CK1 A;  3HOW B;  4ABN A;  1VF7 A;  2RVL A;  4FO2 A;  2B2Y A;  3NTK A;  1A15 A;  1PTO F;  4ME5 A;  1D6E C;  4IUP A;  2EXZ A;  1XXG A;  2R92 B;  3NE5 B;  1EU4 A;  2MP1 A;  5KYL A;  5I9O A;  1UNS A;  1QWY A;  3AMU A;  1PFB A;  2IPK D;  1K83 B;  2X69 A;  1MSH A;  1EYC A;  1XTC D;  4I65 A;  1HHV A;  4IFD J;  1O80 A;  2Z1C A;  2B2V A;  4HCS A;  2WKD A;  2DN8 A;  3CQZ B;  3KLS A;  1BCP D;  1SXT A;  1Q3L A;  4HSP A;  4IUV A;  3VA5 A;  4R8N A;  3EJI A;  2FFK B;  3BDC A;  2L5T A;  1WTR A;  2K5W A;  1CT1 D;  3I90 A;  1F77 A;  4K2L A;  5I6W A;  1HA6 A;  1S5C D;  4KKT A;  5FK9 C;  1K8M A;  4G7O C;  1K8O A;  2EYM A;  3P1H A;  4HAE A;  4K2K A;  1R9T B;  1E2W A;  3GV6 A;  2JSO A;  2F0L A;  3GTJ B;  4K6L A;  1PTO D;  1QJO A;  4F87 A;  4A3B B;  2E2H B;  1H9S B;  1BDO A;  2J4X A;  3TP6 A;  4I7Z C;  1LT3 D;  3NP8 A;  2AWO A;  2E2D C;  2K1B A;  1CA6 A;  3DWA A;  3A56 A;  3TZU A;  4LMQ D;  4U68 A;  1PZJ D;  3H91 A;  1YNN D;  4A3M B;  4FF1 A;  3I4N B;  1OXU A;  1HUN A;  4DK0 A;  2EJF C;  1FNW A;  1O7Y A;  1PDQ A;  2Q8R E;  2EYH A;  5BN4 A;  1ONL A;  1Q1E A;  5G3L F;  2TSS A;  4PV1 C;  4WRD A;  1A2T A;  1I50 B;  4X3T A;  4G57 A;  5KYI A;  1QCB D;  1D5X C;  1ZEQ X;  2F0K A;  3OIP A;  3L3O C;  1CZW A;  1Q12 A;  1MSG A;  2SNM A;  4ULL A;  2OEO A;  4Q0F A;  1MD2 D;  1B53 A;  4KY7 A;  3GTP B;  2GA4 B;  3A7L A;  3SK6 A;  2B2T C;  2BDN A;  4IUU A;  1ET9 A;  2PMZ B;  3S2H B;  3K5L A;  4FP5 D;  1VDZ A;  3GQB A;  1CTM A;  4Z9C B;  1A6X A;  5CC4 A;  5FO7 B;  3NTH A;  3Q23 A;  3U9S A;  4HED A;  3SK5 A;  1AZP A;  1I4X A;  3HOU B;  1QG7 A;  1W6K A;  1VMP A;  4C2M B;  1SYF A;  2K03 A;  1AN8 A;  1YNJ C;  3BVM A;  5G3L D;  3NK9 A;  3K7A B;  1GHJ A;  3JAM L;  1L0X B;  3W2D A;  1Z47 A;  4IQZ A;  2VB3 X;  1T5X D;  1SNM A;  4DK1 A;  1Y8N B;  1EWH A;  3GTG B;  1A3T A;  3KBG A;  1SJE D;  1JOQ A;  4QUF A;  1JE4 A;  1D1K A;  1FNV A;  2DY8 A;  2I46 A;  2F0H A;  1DM0 B;  3BDL A;  3R93 A;  3OOC A;  2K28 A;  2QCP X;  4EVO A;  4A3G B;  1D1I A;  2PZW A;  4OIJ A;  4A3J B;  5IT9 E;  1U4L A;  2XSC A;  4CBV A;  2WII B;  1SYD A;  2BE5 C;  3BG3 A;  1JWS D;  4EQO A;  4KY5 A;  1QB5 D;  4ID6 A;  1LTG D;  2HDM A;  3H94 A;  3PUX A;  1I4P A;  4IUQ A;  2NN6 H;  2A69 D;  1U4M A;  3M3Y B;  4LK1 C;  2Q8I B;  2F0I A;  1KDA A;  3RMH A;  3EVQ A;  2B2U C;  3CU7 A;  2PCF B;  2E74 C;  1PLF A;  1EEF D;  1ZYR C;  3M7G A;  2A6H D;  2EYO A;  1TY0 A;  2WIN B;  4EQP A;  1HXY D;  3BDO A;  1R4Q B;  3OW7 A;  2LY7 A;  3D3R A;  4KN4 C;  2AWN A;  2IX3 A;  2JYO A;  2XRS D;  3T13 A;  5F2D A;  1AW7 A;  4C3H G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...