5D65A

X-ray structure of macrophage inflammatory protein-1 alpha (ccl3) with heparin complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords C-C motif chemokine 3
publication title Structural basis for oligomerization and glycosaminoglycan binding of CCL5 and CCL3.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 68
sequence length 68
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5d65A00
2B2VA 2EE1A 2B2VC 2XIWA 4X3TA 1G2SA 5EPJA 1WTRA 1HRJA 2MPMA 2RA4A 2VXWA 1PDQA 5D65A 4X3SA 4MHEA 1SDFA 2DY8A 4RA8A 4O42A 3FPUB 3DEOA 5D14A 2RSOA 5CBAE 5CBEE 5E4XA 2KEEA 1MGSA 1MSHA 1IL8A 1BNZA 1G6ZA 1EL0A 1EIGA 1JE4A 2DY7A 2B2TC 1NCVA 1PLFA 2K04A 1PFBA 2X6LA 3GV6A 1O7YA 1CA6A 2IL8A 1WD0A 1B2TA 1LV9A 1KNAA 2RVLA 2B2WA 2B2WC 4CJ2C 1A15A 3D6WA 1CA5A 1DOLA 1JICA 2J7ZA 4IURA 1KNEA 1WVLA 2MJ8A 1EQTA 1DZ1A 2B2YA 2B2YC 5COYA 1U4RA 2KUMA 2X69A 1X3PA 2CVRA 2NZ1D 4OIKA 5EJWA 4CJ0B 3DEPA 4MN3A 2N88A 4RAUC 1F2LA 3QO2A 2KVMA 4NW2A 5T1IA 4R8IA 1NR2A 3F2UA 1HA6A 1HHVA 1QE6A 4IUQA 5DNFA 1BF4A 4XT3B 4CJ1B 1XX8A 4ZK9B 1AP0A 2MP1A 3HP3A 4RWSC 2FMMA 2NYZD 3I3CA 2Q8TA 2K03A 2KEDA 2FHTA 2JYOA 1C8CA 1J8IA 1DONA 1RTOA 1ESRA 2H1EA 1VMPA 1CM9A 2HUGA 1B50A 1O7ZA 1U4PA 2FJ2A 1MI2A 3DM1A 1RTNA 2K01A 3SVMA 1QNKA 5E4WC 1U4MA 2L9HA 1WTWA 4OIJA 1ILQA 1F9SA 3TN2A 1M8AA 3IL8A 1GUWA 2HCCA 5EKIA 1G91A 3GV3A 3N52A 3P7JA 4HCSA 4X3KA 2L12A 1EIHA 4IUUA 1IKLA 2MGSA 4X3UA 2KOLA 2KECA 1BBXC 1F9PA 1ILPA 4QUCA 5AFWA 1WTXA 2EOTA 2N55A 3LWEA 1QG7A 4DN4M 1WD1A 3KBXA 4XT1B 5EQ0A 3IFDA 3UI2A 4QUFA 1WTVA 1WTOA 1VMCA 1B3AA 1AZPA 4ZKCB 1NAPA 1U4LA 1TVXA 1F9QA 2FINB 1S4ZA 3MWYW 1RJTA 4LMQD 1O80A 1WTQA 1HUNA 2HDMA 3I8ZA 1HFGA 2Q8RE 3H91A 1AZQA 1ZXTA 2SDFA 3R93A 2L1BA 2JP1A 3G7LA 3MTSA 1ICWA 4ZAIA 5JJZA 1HFNA 4UAIA 4ZLTF 2X6GA 1DOMA 4U68A 1ML0D 1SAPA 2K1BA 2K05A 2L11A 2L4NA 2HDLA 5EPLA 1NR4A 5T1GA 1F9RA 1PFMA 1G2TA 3ONAB 2R3ZA 1WTPA 1B4OA 1MSGA 4HSVA 5CORA 1DOKA 2NWGA 2B2TA 2BDNA 5CMDA 1X3QA 2D9UA 1PFNA 4IUPA 3I91A 1B53A 1EOTA 4R9WA 2M2LA 5EPKA 2HCIA 1BO0A 3I90A 1X32A 4ZKBB 4XDXA 2K28A 1RHPA 3FDTA 2RSNA 1Q3LA 3Q6SA 4HAEA 1IKMA 2FFKB 1HUMA 4HEDA 3KUPA 2B2UA 4IUVA 2B2UC 2EPBA 1J9OA 1SSOA 4IUTA 1XYIA 1RODA 3TZDA 1E0BA
chains in the Genus database with same CATH superfamily
1IW7C 2DNEA 3TP5A 4DR1L 3KJOA 1SDFA 4PZ7A 3URYA 4XQNA 4B3TQ 1HZAA 4N9PA 1AEXA 3CU7A 1KDCA 1UE7A 4DV5L 3V2TA 1VQ8A 1PH2A 1M4VA 4DR6L 4DV7L 5CV6A 1OXXK 1W6KA 5BN5A 1DZ1A 3NBIA 2R7ZH 2JA5B 1D1IA 1T5EA 4DXFA 2NN6G 2BDOA 3D8GA 5IIFA 3C46A 3E5SA 2Z0SA 2YTYA 3U50C 4OIKA 1QVCA 2A69C 1HHVA 2LFNA 2UUCL 5KYLA 1D1KA 1TY2A 5M5XB 4B3SL 2L15A 1L1OA 2FMMA 1B8AA 3DHQA 1ONLA 3A5ZB 4NXMQ 2NTTA 2JA8G 2QEJC 2KJXA 4DUYL 4ME5A 1EIFA 2B8GA 3RLFA 2VUMG 3EQLC 3H09A 3KLSA 1VQ7A 5CV4A 4DV3Q 2AKWB 1V1PA 1HJPA 4P75A 1EY4A 3GV3A 1DCZA 5ELNA 5E3FA 3ERQA 3E9IA 3NXWA 3LWEA 3K7AH 1QG7A 2KHIA 2M9VA 4MTNA 3UI2A 1HR0W 5KGUA 1NAPA 4A3BB 4KN4C 4HJ5A 1SE8A 4JPBW 1O78A 4U673 1LTBD 1O80A 3VR4A 1EQRA 5I2XA 2EIFA 1IBLL 2O5IC 1U5KA 4JV5L 3GTPH 4UAIA 4JYAQ 2Z6BA 3K57A 2K05A 4DF7A 5EPLA 1XTCD 1PTOB 2Y0SE 2R7FA 2Q2IA 2CQAA 3BU2A 3CCRA 1EWIA 5EBCA 4RHRA 2EJFC 3I91A 1SJHD 4A3EH 1SFOH 4OO1H 5EPKA 3FEWX 1PTOF 1SYCA 2AQ2B 5C4XG 3KUPA 1SSOA 4FF2A 4IUTA 3WDNA 4GNXB 2MPMA 2B2VC 5CV7A 3KOJA 4TKOB 1KRSA 3GO5A 1VQLA 1PTOC 3K58A 1SYBA 3K0XA 1I4GA 2WAQE 5D65A 1STEA 3SGIA 1HTPA 4O42A 4BBRG 3GDEA 5IP9G 3G6EA 1EIGA 4P71A 1PLFA 2JA5H 4JCVE 3I4MB 1LV9A 4M8AA 2DN8A 1J5EQ 1PH6A 3CMAA 3D6WA 4GNXC 3DWAA 4DV5Q 2C5CA 4J1MA 4QMGA 4K0KL 3Q24A 1XMOL 4DV7Q 1EFID 1V43A 1TS2A 4CJ0B 2N88A 5M5XH 4GKJL 4R8IA 4G7ZC 2KBNA 2LXJA 1ASZA 1JJGA 2VL6A 4HMIA 2WP8J 1BF4A 1JORA 1Q1BA 1XX8A 1EY8A 1I4QA 5CGKA 1WJJA 2F3VA 2KCTA 1SEBD 3I55A 3KBGA 1S5FD 2JK8A 3NP8A 4DGZA 1RL2A 4G57A 1Q90A 2RQXA 1E7ZA 1RTNA 2B63G 3K5LA 1S72A 2SNMA 3AEVA 4DUYQ 4LWCA 4I7ZC 3VR3A 1XMQQ 4A3BH 1WTXA 1HNZL 5IGDA 1WD1A 4QUFA 1OXSC 1UWVA 3FRPB 3P75A 1AZPA 3TRZA 4M1UB 4FNFA 3I8ZA 3BVMA 3J7YW 4RKLA 1E2WA 4YWKA 1PTOH 4ZLTF 2ZJPA 2JEAI 4X6AH 1D8LA 1SAPA 2EYFA 1PFMA 4QJFA 1H9MA 2AQ3B 4JV5Q 1VQNA 1I5FA 3RLNA 3UE0A 4A3GG 2EY2A 4B3RQ 5M5WB 1BBWA 1K8AC 3S17B 4NXNQ 1LM0A 1CSPA 2F52A 3HOWB 1Q3LA 3NTHA 3NTKA 3Q8DA 2NVYB 1JC7A 4F8MA 1I6HB 1JCKB 5C44B 4DNIA 3ND8A 1WTRA 1SE2A 4DXGA 1TQOA 2RKSA 1HZBA 3PUXA 3NBHB 2PW5A 1SNCA 3I4MH 5FLXE 2UUAL 1SMYD 2ZM6Q 4YWMA 1BNZA 4A3DG 1W2BA 1EL0A 2K04A 1NCVA 1IW7D 3A74A 4EVOA 1YJ9A 1CA6A 4ZCKA 1A15A 1K8MA 3SR1A 1YVCA 1DOLA 2R7DA 4XIGS 2HHHL 2CH4A 1JE5A 3S1RB 5I4DA 4A93G 5JVG3 3M7GA 1Y8OB 4KY5A 2F4VQ 1XPOA 4WRDA 2NZOA 4K0KQ 1XMOQ 2I5MX 2PZUA 3FPPA 2IX0A 2F0NA 4XTCS 4JI0Q 2WB1B 3BYTB 3CXCA 2KHJA 3A0JA 3E6ZX 4R4IA 1EZ6A 3DM1A 1A2UA 1V8QA 3OMGA 3SVMA 4UY8C 4JI5Q 5IP7G 1DXMA 1KABA 1SXTA 1CKNA 3CRKC 1EIHA 4IUUA 4LUOA 4EX5A 1LTSD 4GOPA 1NJIC 3HKZG 2JA6B 2R92G 4FXDA 4EGVA 4DV4L 3I2ZA 4RHSA 4JI1L 2LSSA 4JI8Q 2WB1E 2A68D 5L37A 1Y69U 1HNZQ 2L55A 1E22A 2WACA 2Q8IB 4A3MG 1FL0A 3L7ZC 1FJGQ 2DJFC 5HY6A 2O2LD 5KNCA 1EYGA 1Q1EA 3EVQA 3OIPA 4U68A 4DR5L 1WCMG 1DGSA 5M5WH 2VQFQ 3S17H 1PH4A 3OIQA 4X64Q 3HOWH 1PFNA 4ZQ3A 2P5ZX 2E5LL 3C1EA 4A4IA 4FXKC 1STYA 4PMWA 2NVYH 1I6HH 5C44H 4ZKBB 5IE8A 4KV6A 5IYCH 2K4KA 2RSNA 3DMUA 2N3SA 4GS3A 3EBEA 5FLMH 2OXPA 1LLRD 2AWNA 4LJZC 4LFCL 4DV2Q 2EE1A 1G2SA 2PI2E 1UAPA 4C3IB 5C4ZA 4LAAA 4LW1A 2IX1A 1D5MC 4RA8A 3RNUA 4L5SA 1GHJA 1TS3A 2Z4IA 3BG3A 1YZ6A 2F0QA 4KTAA 2DY7A 1MJCA 3FHWA 3S1RH 5DM73 3NQIA 2K50A 5FLXL 2UUAQ 4HJ9A 4MZ9A 1BKBA 4QF4A 3SDZA 1N8RC 1YI2A 4CHTB 2AHOB 2B2YC 3FMCA 3BYYB 2G5DA 5BR8Q 4JOIC 5GADC 2UXCL 3TS2A 1NMGA 1PYBA 1A3VA 1TWHB 2Z6KA 3ZYYX 5H1SE 4YHHQ 5LMNW 1BXTA 4LF9Q 2XWJB 1YNNC 1KLUD 3S24A 4AQYQ 5IGCA 1TWAB 2ID0A 2FHTA 2PQAB 1XPRA 4ALPA 1AE3A 1YHAA 1MI2A 1VQ5A 1CQFA 4POFA 3U58A 1KC8C 1SLJA 3D0FA 2FXQA 3NENA 1M8AA 1I94Q 5C3EG 2BH2A 4HTHA 3P7JA 4HCSA 3HOXH 3ULPA 1IYJB 2H5XA 4X3KA 2JA6H 1Q81C 4C2MB 1EQVA 2KOLA 5JEAJ 5IGGA 4MTKA 3J7AV 3BZKA 1AW7A 2TSSA 3QJYA 1S5ED 4GOPB 1U4LA 2F0JA 1GKHA 4A3KG 4EQOA 2FINB 1EU4A 5K5PA 4EQNA 2PZTA 1VQ6A 3HRZC 4LNQA 4QL5A 4DV4Q 2SDFA 1MHWC 4JI1Q 4BBSB 1Y1WB 1O7IA 2K33A 3X3NA 1KQSA 2R93B 3O13A 2BA1A 2G9DA 2R3ZA 4CKEA 1UE6A 2R6GA 4GOPC 3BDLA 4K2KA 1B9MA 3IAYA 2HCIA 4UHVA 3RMHA 2XRQD 3OW2A 4HJ8A 4AIMA 2E5LQ 4C3IH 1EY6A 1I3QB 1PV4A 3KDFA 5CBEE 5LHY1 1PRTB 4C3JB 2BA0A 3Q23A 4C3HB 2V4DA 4KN7C 3MHBA 2K5VA 4EQPA 5C4JB 1BUVT 1PRTF 3F2CA 1MGSA 1IL8A 1Y8PB 4OELB 4A3FG 3GV6A 1PFBA 4YCWA 2NB0A 3HOYG 3CC2A 1K9MC 3A56A 4KKSA 2B2WC 3DUZA 2EJGC 1LACA 1J6QA 1PRTC 1TS5A 1TWHH 4IPHA 2EY6A 1X3PA 3K7UC 4B3TL 2EDGA 1TWAH 5FO9B 5DNFA 4XT3B 3GTQB 2A6HC 2JA8H 4R8NA 2E2JB 1IHZA 3T56B 3D4WA 2H1EA 3U9SA 3PF5A 3C2PA 1CK1A 3A7AB 4OHJA 4Y7NB 5ELCA 1R4QB 1H9KA 3CAMA 4H7BA 4C2MH 4K8IA 3G48A 4OIJA 2K52A 2LMCB 3I73A 1V1QA 4HIOA 5FLXc 1LTAD 1BCPD 4KHVA 5EGTA 1PH3A 2JA7B 1RDPD 3PUWA 3K80C 1B3QA 4WORA 3J81j 1A3UA 3R3OA 5FJ8G 1B3AA 5C5LA 1CT1D 3T1HL 4BBSH 1Y1WH 1YNXA 1HUNA 2R93H 5GAEC 3MVVA 4WJ4A 3P20A 2L1BA 2QA4A 1VQFA 2EY5A 2F0DA 3ONAB 3KF6B 1B4OA 3W1BA 1NBWA 5CV5A 1H9SB 1GHKA 5CMDA 4O0AA 4A3GB 2QDBA 1I3QH 2YYZA 1QVFA 1G51A 1KDAA 1TWGB 2NVQH 1BR9A 1YEZA 4GKKQ 1U9RA 3ZJYC 4C3JH 3VYTA 1UEBA 1Q7YC 4JYAL 4C3HH 1A63A 3QIAA 4DN4M 2MUYA 4LF6Q 2B2VA 4R4CA 4X65Q 2F0TA 4K5XA 3BVZA 2OTJA 4MHEA 1FGUA 1C0AA 3RR5A 1RF2D 1C4QA 3FPUB 4L63B 2C9OA 5E4XA 1P8LA 3PUVA 2F0WA 1YNJC 1WTHA 3J80i 3OYYA 1T5XD 4ZYSA 1QZGA 3MXNB 5JPMC 4LF8Q 5M3FG 1D6EC 4GNXA 5JJKA 2KA7A 1KNEA 2A19A 1GJXA 5M3MG 3CCSA 2BOSA 4FF3A 4A93B 3R2TA 3FKIG 1HQMC 3NPPA 4DFAA 3CF5A 1MKHA 1SNMA 3GTQH 5T1IA 4OO1I 4NW2A 1LT6D 2E2JH 1HA6A 1UE5A 2N8NA 1HCZA 4RCOA 1J5EL 1K28A 5I2YA 1I50B 2RCNA 1AP0A 4Y7NH 3M4OB 2I46A 3T16A 1ZKOA 1BOSA 2Z1CA 1FVIA 2OWOA 1VMPA 2B63H 1HR0Q 4P73A 1Z47A 1CHQD 2A5HA 3PO2B 4A3CH 5E4WC 5D3IB 1U4MA 4RG1A 2L9HA 1A2TA 1X3GA 2KCMA 5GROA 2UUBQ 5ELFA 1F2YA 5D3DA 4LFBQ 2JA7H 2ZTEA 3CPWA 2FMCA 1N36Q 2AQ1B 1ESFA 3RN5A 3EJIA 4B08A 3EFXD 2V1CC 4A3JG 4XT1B 4A3IB 1K8GA 1WTOA 1VQAA 1SE3A 5K36H 2A6EC 4PZ6A 2CWAA 4KLKA 4HSPA 3GQBA 1STGA 2VS1A 3K5OA 3I4LA 3T1HQ 1XMQL 5JJZA 5JJIA 4A3GH 1PA6A 4FP5D 1TWGH 2F0LA 3CD6A 2YTXA 3N6RA 1JOQA 2Y0SB 2XVSA 2SEBD 5E7NA 5C5MA 2EYMA 2M2LA 4ZRZA 5JEAG 2CFMA 2K7VA 3PSIA 1XXGA 1HNWQ 1I4XA 1JQYD 4HEDA 4IUVA 2B2UC 5IYDH 2LKVA 3HOZG 1XYIA 2VB3X 1TU2B 4BXXH 5G3LD 2XSCA 1E2ZA 5CYUA 2QGQA 2WAQB 1HH2P 1RD9D 5DEHA 1FD7D 3I4NB 4B3RL 3M9BA 4IUNA 4NXNL 5LL6S 2ZJRA 2OT2A 1X54A 1KNAA 1HXYD 1L0YB 2XNAC 3E0JA 4J15A 5ELEA 4A93H 1CA5A 3JAME 3ICEA 3PO3B 5IGBA 4GLXA 4X66Q 1LYLA 3NBHA 5IWAL 2ZM6L 1SNQA 3AU7A 4HN7A 1I50H 1STNA 3M4OH 2JJQA 2WFWA 2K5DA 3ER0A 4A76A 1M90C 1D5ZC 1NY4A 5ELOA 4QCLA 1VQEA 3F1ZA 2Q8TA 3PO2H 2B3GA 3QOLA 4JI6Q 3RUZA 4K14A 1ESRA 2CW0D 1Y1VB 1YHBA 1B50A 2F4VL 2JN4A 2K5NA 1PXUA 1QNKA 3CCLA 3H0GG 1WTWA 2YU9H 1F9SA 2OTLA 3TN2A 3IL8A 2I0QA 1GUWA 4CDEC 4RMFA 3OTOQ 1G91A 2PO4A 1S5BD 2QDLA 4A3IH 1L0WA 3U4ZA 2F0FA 4H44C 4JI0L 4A3LG 4JI5L 1DYQA 3F8TA 1NE3A 1RJTA 1EOVA 3EIVA 2ASBA 1Q46A 3BS1A 3QR8A 2D62A 1Q12A 4LF7L 3HOVB 2YV5A 1SBBB 2BCOA 2DGYA 3HS0C 1R9TB 3RD4A 1K3RA 2Q2HA 2MFIA 4IJLA 3C3LA 1YHQA 3EROA 4DV1L 1CZWA 4P2CB 3MA2B 4JI8L 1B53A 5BN4A 1SN8A 3RLOA 3E9HA 1UNSA 2QF7A 4O2DA 5DLQE 4DR3Q 4BY1B 3PIP3 1FJGL 1V1OA 5FO7B 1PH9A 1J9OA 2MO0A 2PI2A 2K6AA 4DKAC 3I4NH 1CI3M 1PMRA 1ZYRD 2R7ZG 4JI2Q 5EPJA 2VQFL 4AH6A 3W1GA 4O1NA 4X64L 2QKIC 4XXEA 3AFQA 3TS0A 1MSHA 3PV0A 4DPGA 1E3PA 1ET6A 2XWBB 1NMFA 2EYOA 4WJ3M 3PO3H 2WINB 2RVLA 4G7OC 3FP9A 3S9WA 1JICA 2J7ZA 4DV2L 1VS0A 3T1YQ 1EIYB 1CTMA 2F0IA 3LGJA 1W6JA 4WJWA 3H3VC 1GUSA 2B2YA 4DAPA 4IALA 4IPDA 4JOIA 4DUZQ 3JAML 4AYBB 5I6WA 3KF8B 5IWAQ 2ZXPA 4BY7B 1Y1VH 5C0XH 4DAVA 1Q8IA 3TMEA 4CGYB 4CKBA 2J0TD 2JYOA 4GZYC 3EA6A 4K8JA 1TR5A 1LTLA 4HIDA 1NSNS 1Y8NB 3KFUA 1YJNA 5BR8L 1ET9A 1CHPD 3PF4A 2OEOA 4YHHL 2GA4B 4S3SA 3CMEA 4LF9L 4AYBE 1W3SA 3IKJA 1V9PA 4AQYL 1CFMA 1JWMD 1JOOA 2E2HH 2PQAA 1BBXC 1LT3D 4A75A 3U9OA 1YITA 3TP6A 2A69D 3HOVH 2ALYB 2XTIA 4R4TA 4A3EG 1R9TH 3AFPA 1WOCA 5FO8B 1X65A 3CC4A 1I94L 2HDMA 2RHSB 4IPGA 4HJAA 1AZQA 4DR2Q 1ZXTA 4R4OA 3MEFA 3DLLA 3BVGA 2CKZB 4OWTB 4H02A 5J1ZA 2E75C 2A6ED 2MNAA 4LF7Q 1UE1A 4DV6Q 4HR7B 4HSVA 5CORA 2F0GA 2I5HA 2B2TA 4BY1H 1X3QA 3UDFA 3S1NB 3NWTA 1LUZA 4CBVA 4DV1Q 3HOXB 1D7QA 4RFBA 3VA7A 1TWFB 4APVA 2O5JC 4XDXA 1MD2D 1EQQA 2JA5G 2EXDA 3KK7A 3A54A 1RHPA 3H3VH 2A74C 2EYLA 3MC0B 1SE4A 1X56A 5IYBH 3TZDA 2RA4A 3NEMA 4B9WA 2F0PA 3A5UA 2IHFA 1PZJD 4X3SA 4C1NI 4DNRB 1EZ8A 2KEEA 4IJHA 1VQ9A 1KL9A 4IOAA 1G6ZA 3J7A5 2X6LA 1B2TA 5LMNQ 5C6AA 3BDOA 4ODGA 1EY7A 1IBMQ 4OX9Q 2EZVA 3GTGB 2B2WA 4UP9A 4CDFC 4CKCA 5C3XA 3PGZA 5IGEA 4FDBA 3AMUA 3CRLC 3HOUB 3STBC 5COYA 4JBKA 4R1JA 5AJ3Q 3A8JE 5JOBA 4JBWA 3H15A 4OWWB 4BY7H 1F2LA 3M4PA 4JI4Q 1Z9FA 4KHPQ 3KYHC 1WFQA 1FNUA 1VQGA 1EY0A 2JQOA 2MP1A 3CC7A 3OSOA 2NYZD 3I3CA 3W3AA 4A3BG 4P74A 1JOKA 1PTOD 1PH5A 1CM9A 4L5TA 1KTKA 1QUQB 1EY9A 1Q82C 5EKLA 2KHSA 2H4OA 3ULJA 1G6PA 1EWCA 2EQSA 4R4QA 4Y52H 2L0CA 2L12A 1MIUA 3CW2C 3S16B 1FNVA 1ILPA 5AFWA 3D4RA 2EVBA 2IHEA 3PUYA 5EQ0A 1QILA 2SOBA 3TP8A 1F9QA 3JAMc 3W5OA 4IFDH 1S4ZA 2JA8B 1XNRQ 3NUCA 1NTGA 4FF4A 3HZXA 1G8ZD 3CHBD 4NKLA 2RHQB 2IY5B 1AN8A 2VUMB 4ZAIA 3PUZA 2XGTA 2LS01 2QILA 3QG1A 3S1NH 5T1GA 4JI3L 3PQIA 5CC4A 1NR4A 1F9RA 1XPUA 1TWFH 1JB3A 1XTDA 4KK7A 3EN2A 2D9UA 4RH6A 4L8JA 1LT5D 5IGFA 3S1QB 1HA5A 4IPCA 1AFPA 4UDUC 1VDZA 2ZXOA 1HUMA 5C4HA 1HFNA 1A62A 4KD4A 3KF6A 1XJVA 1GO3E 4RGNA 4UPAA 2VXWA 1H9SA 1PDQA 2WIIB 2K75A 5HURA 2ZXRA 3GTGH 4Q5VA 3DEOA 3BZDB 1C7YA 4NPSA 4FO2A 1TS4A 2B2TC 4LUZA 1X3FA 2M00A 1O7YA 4GKKL 2WV6D 3CCMA 3HOUH 4YY3Q 3ULLA 5J39A 4LF6L 4X65L 4N8X1 3TEHB 4IOCA 5C4XB 4EQ5A 4GN5A 1OTCA 2NVQB 5EJWA 1A3TA 2IW3A 1SR3A 3MXGA 3MXNA 4CJ1B 4LF8L 4BBRB 1Z6HA 2K03A 3K59A 1E2VA 3JAMi 4NDXA 2NN6H 2Q2TA 3UDGA 2F03A 3I72A 5IODA 1SYFA 4Z9CB 1L2FA 2UXDQ 3S2DB 5JVH3 3S16H 5EKIA 2RDGA 2E2DC 5ELDA 5BN3A 3S14B 4IO9A 1GUNA 2N55A 5FKAC 2HQEA 5IOCA 1HR0L 1F2ZA 3KBXA 3IFDA 5DM63 3TBIB 3HOWG 4PG3A 1F77A 2VUMH 1B7YB 2UUBL 1CQVA 4KJNA 1VF7A 3SK8A 5C44G 1HNXQ 4LFBL 2ICEC 5IYCG 1B44D 1PFSA 5FLMG 4HIKA 1N36L 2B63B 4K6DA 2L11A 1LTRD 3DM3A 3S1QH 1DOKA 1IYVA 2PNHA 4PMBA 5EAYA 4I65A 5I9PA 5LMUQ 4JI3Q 3GTMB 4R9WA 4FXGC 1X32A 1QOHA 3AB9A 4QIWE 3I4OA 5JPNC 1IKMA 1L0XB 1QNUA 2B2UA 5IY0A 3G71A 5KEEA 3T51B 1TIID 2JSOA 1RODA 4NMZA 1E0BA 1OXVA 3T4AC 4GN3B 2UU9L 1T9HA 2OCEA 1PYSB 1GUGA 4OXPA 3NTIA 4CDDC 3P1HA 2DUDA 2RSOA 5C3WA 3R2IA 2F3IA 1HNWL 3MXUA 2D5DA 5DAUA 3KLRA 1WD0A 5C4XH 5KNDA 2WB1G 2NVTB 4JI7Q 1ENFA 1GVPA 1TKWB 3HKSA 4L5RC 2MJ8A 5A2QE 1VCIA 2F0HA 3SHLA 5I6YA 3UDIA 4MN3A 4BBRH 3DWPA 2Z4HA 1EY5A 5IP9H 5FK9C 3L2PA 3STBD 2D0PA 2JA6G 2GVAA 4IN3A 2G9HD 1EU3A 3HP3A 1Z7TA 4A3DB 2D2CC 1OO9B 1N33Q 3GTLB 3S2DH 2CHBD 1HPCA 4X66L 1U4PA 2FJ2A 4DA2A 2JE6I 4FVMA 4KY6A 5CV8A 4DR4Q 3AYHB 3S14H 3NWSA 1K3BC 3HEJA 4L5QA 2CQOA 4DAMA 1XWEA 4DU9A 4OONA 4X3UA 1VQ4A 4JI6L 4QUCA 5M9OA 3F2DA 3MXPA 1WTVA 2A73B 4ABNA 3RZOB 1IYUA 3VYSA 2CCZA 2BE5C 4XYOA 2SNSA 3MWYW 2ATWA 1SMYC 4XYQA 4KD3A 3OTOL 1YNND 4RGOS 3S2HB 4C3IG 3TREA 1VQBA 2EYJA 2L4NA 3SE0A 4DNTB 3GTMH 5GQOA 5GAHC 1GUOA 2YU9B 4LF4Q 3HKZB 1EOTA 1ENCA 4X62L 1BO0A 2R92B 2N78A 1FNWA 1NUCA 3K6OA 1Y14B 3Q6SA 4JVZA 3CKIB 1STHA 1YBYA 1FYCA 3SK5A 2GVBA 3IFTA 3VYUA 4A3MB 4LF5Q 1UUPA 1S5CD 3DWQA 3WWVA 3KLWA 4BA1I 3SXHA 1N34Q 4HIMA 4KMUC 5D14A 1WCMB 5CBAE 3J7ZC 2NVTH 1HTLD 2UU9Q 2EY1A 4DR3L 1DONA 3HKZE 4YWLA 1EEID 2MO1A 2PMZB 2I07B 3MEHA 1TY0A 3IRBA 1QZHA 4IURA 2J4XA 4JI2L 4IQZA 1WVLA 1EYDA 1EYAA 5HGQA 4K5WA 4DV0Q 2XRSD 1HQRD 1MJEA 4PMCA 3MFYA 2VQEQ 2TMPA 3L0OA 5I9OA 1QE6A 2A68C 4A3DH 5A2QL 3GTLH 3WOEA 1NNXA 2A8VA 1VQDA 3QWNA 5NUCA 3NE5B 1HZ9A 3V05A 3TDQA 3T1YL 2PMZE 3U4VA 1KAWA 3M3YB 2RDHA 1GD7A 3K5MA 1KD1C 4DUZL 2Z9HA 4BBSG 1Y1WG 4GLAC 3FVQA 3KF8A 2R93G 2RCFA 1B1ZA 1KIXA 1PRTD 3RZOH 1A6XA 3G6JB 2EOTA 2CH4W 2PZWA 2NVXH 1ASYA 2PQEA 3S2HH 2O4XA 2KCCA 3GTJB 3QOJA 2L5TA 1IL2A 1GOZA 5IP7H 1QCBD 2K5WA 2YTVA 2A6HD 5GAGC 4JC0A 3GTOB 1DM0B 4C3JG 4XQQA 1ICWA 5C0XI 2ZTDA 4C3HG 4FYDA 2K1BA 5ELBA 5C3EB 1G2TA 3L3OC 1MSGA 4DR1Q 2R92H 2NWGA 1UEAB 1VQPA 5C0XJ 3D4DA 4J6HA 2QW7A 2B29A 2Q2UA 1KXLA 3A8KE 1SYGA 4DAYA 1YJWA 4DR2L 2AWOA 2DJGC 4N9TA 2E2HB 4A3MH 2K32A 4HAEA 4PNYA 4Q0FA 4A3KB 5FOBB 4DR6Q 4TSSA 3DXJC 1TT2A 4X62Q 3ERSX 4DV6L 1OXTA 1N32L 2NZHA 1KLGD 2LY7A 1WCMH 2UXBL 2HD3A 1JMCA 1CUKA 2JEBI 1I6VC 2IJ0A 4ILWA 1EWHA 4I7AA 3PMFA 4TRDA 3M4YA 4N8FA 2QEXA 1KHIA 4TVAB 2BH8A 3ITPA 1MBYA 1H9JA 2VW9A 4ID6A 2PW7A 2UUCQ 3D3RA 1CSQA 3G4SA 1L1OB 4B3SQ 3K81C 3NQTA 3ND9A 2R61A 2KUMA 4A3CG 1F2MA 2CVRA 4QGUA 4RAUC 4KKTA 1O7LA 4F7XA 4CDCC 3J81E 4B3ML 1VQJA 2F0VA 2RDFA 2JA7G 1B9NA 1SNDA 5LMNL 1IBML 4OX9L 1V1PB 3H3VI 3M3YH 4RWSC 1L1OC 3CPFA 2E76C 2F0MA 2KEDA 4A3FB 1ENAA 1RTOA 3HOYB 5AJ3L 3LWUA 4DK1A 4F88A 5K36G 1SNPA 4JI4L 1YNJD 4KHPL 4RKBA 1IBLQ 3D6CA 1II3A 2MGSA 3GTJH 4LUVA 2F0OA 3MZ5A 1QUQA 3J80E 1K73C 3UDXA 4ZKCB 1EEFD 1I4PA 3GTOH 1K0SA 2RF4A 1K8OA 4BWGB 3K5NA 3K8AA 3GD7A 3K0YA 3C1FA 1KAAA 5JJLA 3OWFA 4G4KA 3S15B 4YIJA 2WKDA 3JC66 3OWEB 4ZUJA 3R93A 5C3EH 1K0RA 4KI0A 4C56C 5IYDG 2X6GA 1PZKD 2NTSA 2BE5D 4MNOA 1QB5D 1LO5D 4BXXG 3TP7A 1WTPA 2MQHA 4V190 2Z8LA 3NELA 4A3KH 1XNRL 2ICIA 1EUJA 4C1NK 1H95A 3I90A 2B39A 3F2BA 2XN9C 1PZID 4HCEA 3FDTA 2EYPA 4LFAL 1PYWD 4OO1G 2F3WA 4DAYB 2EYHA 2AUKA 4V0BA 1WI5A 1VQCA 1BCPB 1CKOA 1N9WA 1U0LA 2ZT9C 2DY8A 1BCPF 2DNCA 1N32Q 4IFDI 3KLSX 2UXBQ 4GKJQ 4BS9A 4PZ8A 1D2BA 3HG9A 1KDBA 1JR0D 5IT9E 3OPOA 2PNRC 4CJ2C 1BQQT 3PO2G 4IFDJ 5HGTA 3OMCA 1BCPC 3PIO3 3Q0AA 3LX0A 1EQTA 1E1TA 1PVOA 3L9AX 2X69A 2B8FA 4JW0A 3QO2A 4GN4B 4QY7A 4DK3C 4IUQA 4A3FH 3VR2A 4YY3L 2EXZA 3HOYH 1R4PB 4A3IG 4ZK9B 1S40A 1PH1A 3T13A 3J81L 4B3MQ 3PIPA 3D31A 1WYDA 4JBJA 1BVSA 4XQJA 2HUGA 1O7ZA 3E0EA 5A35A 5M3FB 4QB4A 3GP7A 1M1KC 2NBFA 2AMCB 2F0KA 1FR3A 5M3MB 3MFGA 1JWSD 1GXDC 3FKIB 2CWPA 1B70B 3CP0A 3N52A 4UP7A 3AQQA 2Y0SG 4QQBX 1D5XC 4RCNA 3T53B 1LT4D 4MIUA 1X9NA 3S15H 2UXDL 1X6OA 2HIVA 1WTQA 3SEBA 1S3OA 1KRTA 3J80L 3RZDB 3OW7A 3PCOB 3MTSA 1LTTD 3I4NG 2WAQG 2D0OA 2ES2A 2HDLA 4NB3A 2NN6I 5FJ8H 2BDNA 3I7FA 5CR3A 4DK6C 2A1AA 3V96A 1H9RA 1HNXL 4KHZA 4F87A 4A3JB 3VR5A 4HMJA 3PO3G 2E2IB 1IZ6A 4YCVA 2FFKB 4P72A 2F0EA 2EPBA 2NUCA 1XNQL 2KCNA 3LNNA 2HHHQ 4PQXA 2ENBA 4X3TA 2I5LX 1HRJA 4LFAQ 4E6IA 3TSSA 5LMUL 1K83B 1TXYA 2K5QA 4GLVB 4OWXB 2KENA 2WKCA 3I4MG 4KKUA 4LK1C 3NSWA 1SNOA 1SRUA 1GUTA 1PH7A 1Y1VG 2IX3A 2HT1A 3TQYA 4WFN3 5C0XG 4DR7L 1X55A 1SROA 1PH8A 5IT9L 1U4RA 2IT1A 2VY3A 1VQOA 3CCUA 4K2LA 3HOZB 1SJED 5E1FA 2OQKA 3E3XA 3M7NA 5M5YB 1NR2A 3F2UA 4G7HC 1CKNB 1QWYA 3Q22A 3M85A 4KJOA 4JI7L 2IWHA 1IBKL 5KIXA 5M3FH 3PIOA 2OQ0A 1C8CA 5ISRA 1J8IA 1X3EA 5M3MH 3HOVG 1STBA 2K14A 3FKIH 1QJOA 1RIPA 3NHHA 3X3MA 3QB3A 2E74C 1ILQA 3BZCA 1P16A 2HCCA 5G3LF 3CQZB 1ZEQX 1IKLA 1N33L 4POGA 2KECA 1F9PA 1VF5C 5TSSA 4ME3A 4DR5Q 4K6LA 2EJMA 4BY1G 1VMCA 3GTKB 3VA5A 3RZDH 1TVXA 2F4IA 3NK9A 4DR4L 3A8IE 4BA2I 3KJPA 1HFGA 2Q8RE 1RKNA 2JP1A 3G7LA 3HFZB 5IYBG 3H0GB 3UE1A 1DOMA 3J81c 1OXUA 3I70A 1TWCB 4HJ7A 1IXRA 1JJ2A 2AUJD 3H94A 1LABA 3HGBA 4LFCQ 3TZUA 4A3JH 1QVGA 2E2IH 3M4QA 1ICFB 4IUPA 2PCFB 1E1OA 1E24A 3B6YA 1VQMA 3RN2A 4QIWB 2JA9A 4JG2A 4B9XA 1C9OA 2MHVA 1YIJA 1S5DD 2ZTCA 4RGMA 1SYDA 3BJUA 3SK4A 2K28A 1C48A 4AYBG 1K83H 5KNBA 1Q8KA 2XIWA 1DD2A 4YCUA 1A0IA 3S1MB 1VQIA 2CW0C 4H0LC 4UP8A 4LF4L 4BY7G 2IPKD 1XNQQ 2LXKA 2RBMA 1I4RA 5JEAH 2UXCQ 1JE4A 1FGBD 4TQUS 3J80c 3BDCA 2IL8A 3CCJA 1JJCB 4IZ8A 4FF1A 1CZGA 1EYCA 2F0UA 3HOZH 1VQHA 4LF5L 1BDOA 1A8VA 5M5YH 3OHXC 1PHJA 4L6TB 1AH9A 3J7AF 4DR7Q 1N34L 3H6MA 4J8QA 2F1MA 2NZ1D 4ZUIA 3DEPA 2R7ZB 2K5HA 2KVMA 1JB7A 2Z6KC 1BBUA 4NXML 5CV9A 2HIXA 5J3BA 4OGQC 5EKKA 3A7LA 1DJRD 1STAA 5J22A 4NP5A 4DV0L 2GN5A 2VB2X 4DV3L 1AE2A 3CCQA 2VQEL 1IBKQ 3CQZH 2F0SA 2K01A 4ULLA 4IFDG 2VZAA 4DK0A 1LTID 3CCEA 1G291 4RGTA 2PPBC 3J81i 3SK6A 3VR6A 3VYRA 4PV1C 1GM5A 3GTKH 4JBMA 1JT8A 3W2DA 2JXMB 1SYEA 4OEMB 1EFWA 3R8BA 3HOXG 4K5VA 5KYIA 1ZYRC 2KQ3A 3OOCA 5IT9c 1SMXA 3I56A 1LTGD 1VQKA 2HQLA 3K7AB 2VNUD 3H0GH 4LMQD 4JK1C 4KY7A 3MAQA 1TWCH 3H91A 2OF1A 5C4JH 5KRUA 4OL7A 3KDFB 1ML0D 1HZCA 1Q86C 1CKMA 5F2DA 1JWUD 3GTPB 5JAVA 4A3LH 2QCPX 2C35B 2ZJQA 3WOFA 4H13C 1RCVD 2N49A 3HOUG 2PYKA 2E8GA 5LL6X 5EBDA 4A3EB 1SFOB 3S1MH 3CCVA 3VDYA 3A55A 2NVXB 1I4HA
chains in the Genus database with same CATH topology
1IW7C 2DNEA 3TP5A 1SDFA 3URYA 4XQNA 4N9PA 1AEXA 3CU7A 1KDCA 3V2TA 1M4VA 5CV6A 1OXXK 1W6KA 5BN5A 1DZ1A 3NBIA 2JA5B 1D1IA 1T5EA 4DXFA 2NN6G 2BDOA 3D8GA 5IIFA 3C46A 3E5SA 4OIKA 2A69C 1HHVA 2LFNA 5KYLA 1D1KA 1TY2A 5M5XB 2FMMA 3DHQA 1ONLA 2NTTA 2QEJC 2KJXA 4ME5A 2B8GA 3RLFA 3EQLC 3H09A 3KLSA 5CV4A 1V1PA 1EY4A 3GV3A 1DCZA 5E3FA 3ERQA 3NXWA 3LWEA 1QG7A 2M9VA 3UI2A 5KGUA 1NAPA 4A3BB 4KN4C 1O78A 4U673 1LTBD 1O80A 3VR4A 5I2XA 2O5IC 4UAIA 3K57A 2K05A 4DF7A 5EPLA 1XTCD 1PTOB 2CQAA 5EBCA 4RHRA 2EJFC 3I91A 1SJHD 4OO1H 5EPKA 3FEWX 1PTOF 1SYCA 2AQ2B 3KUPA 1SSOA 4FF2A 4IUTA 3WDNA 2MPMA 2B2VC 5CV7A 4TKOB 3GO5A 1PTOC 3K58A 1SYBA 5D65A 1I4GA 1STEA 1HTPA 4O42A 1EIGA 1PLFA 3I4MB 1LV9A 4M8AA 2DN8A 3D6WA 3DWAA 2C5CA 4J1MA 4QMGA 3Q24A 1EFID 1V43A 1TS2A 4CJ0B 2N88A 4R8IA 4G7ZC 4HMIA 2WP8J 1BF4A 1JORA 1Q1BA 1XX8A 1EY8A 1I4QA 5CGKA 2F3VA 1SEBD 3KBGA 1S5FD 3NP8A 4DGZA 4G57A 1Q90A 2RQXA 1RTNA 3K5LA 2SNMA 4I7ZC 3VR3A 1WTXA 5IGDA 1WD1A 4QUFA 1OXSC 3P75A 3FRPB 1AZPA 4M1UB 4FNFA 3I8ZA 3BVMA 3J7YW 4RKLA 1E2WA 2JEAI 1PTOH 4ZLTF 1SAPA 2EYFA 1PFMA 1H9MA 2AQ3B 2EY2A 5M5WB 3S17B 3HOWB 1Q3LA 3NTHA 3NTKA 2NVYB 1JC7A 4F8MA 1I6HB 1JCKB 5C44B 3ND8A 1WTRA 1SE2A 4DXGA 1TQOA 2RKSA 3PUXA 2PW5A 1SNCA 5FLXE 1SMYD 1BNZA 1EL0A 2K04A 1NCVA 1IW7D 4EVOA 1CA6A 1A15A 1K8MA 3SR1A 1DOLA 4XIGS 3S1RB 5I4DA 5JVG3 3M7GA 1Y8OB 4KY5A 4WRDA 2PZUA 3FPPA 2IX0A 2F0NA 4XTCS 2WB1B 3BYTB 3E6ZX 1EZ6A 3DM1A 1A2UA 1V8QA 3OMGA 3SVMA 1DXMA 1KABA 1SXTA 3CRKC 1EIHA 4IUUA 1LTSD 2JA6B 4FXDA 4EGVA 4RHSA 2A68D 1Y69U 2L55A 2WACA 2Q8IB 3L7ZC 2O2LD 5KNCA 1Q1EA 3EVQA 3OIPA 4U68A 3OIQA 1PFNA 4ZQ3A 3C1EA 4FXKC 1STYA 4PMWA 4ZKBB 4KV6A 2RSNA 3DMUA 2OXPA 1LLRD 2AWNA 4LJZC 2EE1A 1G2SA 1UAPA 4C3IB 5C4ZA 4LAAA 2IX1A 1D5MC 4RA8A 1GHJA 1TS3A 2Z4IA 3BG3A 2F0QA 4KTAA 2DY7A 5DM73 3NQIA 5FLXL 4QF4A 3SDZA 4CHTB 3FMCA 2B2YC 3BYYB 3ZYYX 1TWHB 1A3VA 1BXTA 2XWJB 1YNNC 1KLUD 5IGCA 1TWAB 2ID0A 2FHTA 1MI2A 1CQFA 1M8AA 4HTHA 3P7JA 4HCSA 4X3KA 4C2MB 1EQVA 2KOLA 5JEAJ 5IGGA 3J7AV 1AW7A 2TSSA 3QJYA 1S5ED 1U4LA 2F0JA 4EQOA 2FINB 1EU4A 5K5PA 4EQNA 2PZTA 3HRZC 2SDFA 4BBSB 1Y1WB 2K33A 3X3NA 2R93B 3O13A 2BA1A 2G9DA 2R3ZA 4CKEA 2R6GA 3BDLA 4K2KA 1B9MA 3IAYA 2HCIA 3RMHA 2XRQD 1EY6A 1I3QB 5CBEE 5LHY1 1PRTB 4C3JB 2BA0A 3Q23A 4C3HB 2V4DA 4KN7C 3MHBA 4EQPA 5C4JB 1BUVT 1PRTF 1MGSA 1IL8A 1Y8PB 3GV6A 1PFBA 2NB0A 3A56A 4KKSA 2B2WC 3DUZA 2EJGC 1LACA 1PRTC 1TS5A 2EY6A 1X3PA 2EDGA 5FO9B 5DNFA 4XT3B 3GTQB 2A6HC 4R8NA 2E2JB 1IHZA 3T56B 3D4WA 2H1EA 3U9SA 3C2PA 1CK1A 3A7AB 4OHJA 4Y7NB 5ELCA 1R4QB 1H9KA 4H7BA 4K8IA 4OIJA 2LMCB 3I73A 1LTAD 1BCPD 4KHVA 5EGTA 2JA7B 1RDPD 3PUWA 4WORA 1A3UA 3R3OA 1B3AA 5C5LA 1CT1D 1HUNA 3MVVA 3P20A 2L1BA 2EY5A 2F0DA 3ONAB 1B4OA 5CV5A 1H9SB 1GHKA 5CMDA 4A3GB 2QDBA 2YYZA 1KDAA 1TWGB 1BR9A 1U9RA 3VYTA 3QIAA 4DN4M 2MUYA 2B2VA 2F0TA 4K5XA 3BVZA 4MHEA 1RF2D 1C4QA 3FPUB 4L63B 2C9OA 5E4XA 3PUVA 2F0WA 1YNJC 1T5XD 4ZYSA 5JPMC 1D6EC 2KA7A 1KNEA 1GJXA 2BOSA 4FF3A 4A93B 3R2TA 3NPPA 1HQMC 4DFAA 1SNMA 5T1IA 4OO1I 4NW2A 1LT6D 1HA6A 1HCZA 4RCOA 5I2YA 1I50B 1AP0A 3M4OB 2I46A 3T16A 1ZKOA 1BOSA 2Z1CA 1VMPA 1Z47A 1CHQD 2A5HA 3PO2B 5E4WC 5D3IB 1U4MA 2L9HA 1A2TA 5ELFA 1F2YA 5D3DA 2FMCA 2AQ1B 1ESFA 3EJIA 4B08A 3EFXD 4XT1B 4A3IB 1WTOA 1SE3A 5K36H 2A6EC 4HSPA 3GQBA 1STGA 3K5OA 3I4LA 5JJZA 4FP5D 2F0LA 3N6RA 1JOQA 2Y0SB 2XVSA 2SEBD 5C5MA 2EYMA 2M2LA 4ZRZA 5JEAG 2K7VA 1XXGA 1I4XA 1JQYD 4HEDA 4IUVA 2B2UC 2LKVA 1XYIA 2VB3X 1TU2B 5G3LD 2XSCA 1E2ZA 5CYUA 3I4NB 2WAQB 1RD9D 5DEHA 1FD7D 4IUNA 5LL6S 2OT2A 1KNAA 1HXYD 1L0YB 2XNAC 3E0JA 5ELEA 1CA5A 3JAME 3PO3B 5IGBA 3NBHA 1SNQA 3AU7A 4HN7A 1STNA 2K5DA 1D5ZC 4QCLA 2Q8TA 3QOLA 3RUZA 4K14A 1ESRA 2CW0D 1Y1VB 1B50A 1PXUA 1QNKA 1WTWA 1F9SA 3TN2A 3IL8A 1GUWA 1G91A 2PO4A 1S5BD 2F0FA 4H44C 1DYQA 1RJTA 3BS1A 2D62A 1Q12A 3HOVB 1SBBB 2BCOA 3HS0C 1R9TB 3RD4A 3C3LA 3EROA 1CZWA 4P2CB 3MA2B 1B53A 5BN4A 1UNSA 2QF7A 4BY1B 3PIP3 1V1OA 5FO7B 1J9OA 2K6AA 1CI3M 1PMRA 1ZYRD 5EPJA 4O1NA 2QKIC 4XXEA 1MSHA 3PV0A 1ET6A 2XWBB 2EYOA 2WINB 2RVLA 4G7OC 3S9WA 1JICA 2J7ZA 1CTMA 2F0IA 1W6JA 4WJWA 3H3VC 1GUSA 2B2YA 4DAPA 4IALA 3JAML 4AYBB 5I6WA 2ZXPA 4BY7B 5C0XH 4DAVA 1Q8IA 3TMEA 4CGYB 4CKBA 2J0TD 2JYOA 4GZYC 3EA6A 4K8JA 1TR5A 1NSNS 1Y8NB 1ET9A 1CHPD 2OEOA 2GA4B 4S3SA 3IKJA 1CFMA 1JWMD 1JOOA 1BBXC 1LT3D 3U9OA 3TP6A 2A69D 5FO8B 2HDMA 1AZQA 1ZXTA 3BVGA 5J1ZA 2E75C 2A6ED 4HR7B 4HSVA 5CORA 2F0GA 2B2TA 1X3QA 3S1NB 3NWTA 4CBVA 3HOXB 4RFBA 3VA7A 1TWFB 2O5JC 4XDXA 1MD2D 3KK7A 3A54A 1RHPA 2A74C 2EYLA 3MC0B 1SE4A 3TZDA 2RA4A 4B9WA 2F0PA 1PZJD 4X3SA 4C1NI 4DNRB 1EZ8A 2KEEA 1G6ZA 2X6LA 1B2TA 5C6AA 3BDOA 4ODGA 1EY7A 3GTGB 2EZVA 2B2WA 4CKCA 5C3XA 5IGEA 3AMUA 3CRLC 3HOUB 5COYA 3A8JE 5JOBA 4JBWA 1F2LA 1FNUA 1EY0A 2MP1A 3OSOA 2NYZD 3I3CA 3W3AA 1JOKA 1PTOD 1CM9A 1KTKA 1EY9A 5EKLA 2KHSA 2H4OA 1EWCA 2L0CA 2L12A 3S16B 1FNVA 1ILPA 5AFWA 3D4RA 2EVBA 3PUYA 5EQ0A 1QILA 2SOBA 3TP8A 1F9QA 4IFDH 1S4ZA 2JA8B 3NUCA 4FF4A 3HZXA 1G8ZD 3CHBD 4NKLA 1AN8A 2VUMB 4ZAIA 3PUZA 3QG1A 2LS01 2QILA 5T1GA 5CC4A 1NR4A 1F9RA 1JB3A 4KK7A 2D9UA 4RH6A 4L8JA 1LT5D 5IGFA 3S1QB 1HA5A 1AFPA 4UDUC 1VDZA 2ZXOA 1HUMA 5C4HA 1HFNA 4KD4A 4RGNA 2VXWA 1H9SA 1PDQA 2WIIB 5HURA 2ZXRA 4Q5VA 3DEOA 3BZDB 4FO2A 1TS4A 2B2TC 2M00A 1O7YA 2WV6D 5J39A 5C4XB 2NVQB 5EJWA 1A3TA 2IW3A 3MXGA 3MXNA 4CJ1B 4BBRB 1Z6HA 2K03A 3K59A 1E2VA 4NDXA 2NN6H 2F03A 3I72A 5IODA 1SYFA 4Z9CB 3S2DB 5JVH3 5EKIA 2RDGA 2E2DC 5ELDA 5BN3A 3S14B 1GUNA 2N55A 5FKAC 2HQEA 5IOCA 1F2ZA 3KBXA 3IFDA 5DM63 3TBIB 1F77A 1CQVA 4KJNA 1VF7A 3SK8A 2ICEC 1B44D 2B63B 4K6DA 2L11A 1LTRD 1IYVA 1DOKA 4PMBA 4I65A 5I9PA 3GTMB 4R9WA 4FXGC 1X32A 1QOHA 3AB9A 5JPNC 1IKMA 1L0XB 1QNUA 2B2UA 5KEEA 3T51B 1TIID 2JSOA 1RODA 4NMZA 1E0BA 1OXVA 3T4AC 1GUGA 3NTIA 3P1HA 2RSOA 5C3WA 3R2IA 3MXUA 2D5DA 5DAUA 3KLRA 1WD0A 5KNDA 2NVTB 1ENFA 1TKWB 2MJ8A 5A2QE 1VCIA 2F0HA 3SHLA 5I6YA 4MN3A 3DWPA 2Z4HA 1EY5A 5FK9C 4IN3A 2G9HD 1EU3A 3HP3A 1Z7TA 4A3DB 2D2CC 1OO9B 3GTLB 2CHBD 1HPCA 1U4PA 2FJ2A 4DA2A 2JE6I 4FVMA 4KY6A 5CV8A 3NWSA 3HEJA 1XWEA 4DU9A 4X3UA 4QUCA 5M9OA 3MXPA 1WTVA 2A73B 4ABNA 3RZOB 1IYUA 3VYSA 2BE5C 4XYOA 2SNSA 3MWYW 1SMYC 4XYQA 4KD3A 3S2HB 1YNND 4RGOS 4C3IG 2EYJA 2L4NA 3SE0A 4DNTB 1GUOA 2YU9B 3HKZB 1EOTA 1ENCA 1BO0A 2R92B 1FNWA 1NUCA 3K6OA 3Q6SA 3CKIB 1STHA 1FYCA 3SK5A 3IFTA 3VYUA 4A3MB 1UUPA 1S5CD 3DWQA 4BA1I 3SXHA 4KMUC 5D14A 1WCMB 5CBAE 1HTLD 2EY1A 1DONA 1EEID 2PMZB 2I07B 3MEHA 1TY0A 4IURA 2J4XA 4IQZA 1WVLA 1EYDA 1EYAA 4K5WA 2XRSD 1HQRD 4PMCA 3MFYA 2TMPA 5I9OA 1QE6A 2A68C 5A2QL 3WOEA 3QWNA 5NUCA 3NE5B 3V05A 3TDQA 3M3YB 2RDHA 3K5MA 3FVQA 3KF8A 1B1ZA 1PRTD 1A6XA 3G6JB 2EOTA 2PZWA 2PQEA 2O4XA 2KCCA 3GTJB 3QOJA 2L5TA 1GOZA 1QCBD 2K5WA 2A6HD 3GTOB 1DM0B 4C3JG 4XQQA 1ICWA 5C0XI 4C3HG 4FYDA 2K1BA 5ELBA 5C3EB 1G2TA 3L3OC 1MSGA 2NWGA 1UEAB 5C0XJ 3D4DA 4J6HA 3A8KE 1SYGA 4DAYA 2AWOA 4N9TA 2E2HB 2K32A 4HAEA 4PNYA 4Q0FA 4A3KB 5FOBB 4TSSA 3DXJC 1TT2A 1OXTA 1KLGD 2LY7A 2JEBI 1I6VC 2IJ0A 4ILWA 1EWHA 3PMFA 4TRDA 3M4YA 3ITPA 1MBYA 1H9JA 4ID6A 2PW7A 3D3RA 3NQTA 3ND9A 2R61A 2KUMA 1F2MA 2CVRA 4RAUC 4KKTA 1O7LA 4F7XA 3J81E 2F0VA 2RDFA 1B9NA 1SNDA 1V1PB 4RWSC 2E76C 2F0MA 2KEDA 4A3FB 1ENAA 1RTOA 3HOYB 3LWUA 4DK1A 4F88A 5K36G 1SNPA 1YNJD 4RKBA 3D6CA 1II3A 2MGSA 2F0OA 3MZ5A 3J80E 4ZKCB 1EEFD 1I4PA 1K8OA 4BWGB 3K5NA 3GD7A 3K0YA 3C1FA 1KAAA 3OWFA 4G4KA 3S15B 4YIJA 2WKDA 3OWEB 4ZUJA 3R93A 4KI0A 4C56C 2X6GA 1PZKD 2NTSA 2BE5D 1QB5D 1LO5D 3TP7A 1WTPA 4V190 2Z8LA 2ICIA 4C1NK 3I90A 2B39A 2XN9C 1PZID 4HCEA 3FDTA 2EYPA 1PYWD 4OO1G 2F3WA 2EYHA 2AUKA 4V0BA 1BCPB 2ZT9C 2DY8A 1BCPF 2DNCA 4IFDI 3KLSX 4BS9A 1D2BA 3HG9A 1KDBA 1JR0D 5IT9E 3OPOA 2PNRC 4CJ2C 1BQQT 4IFDJ 5HGTA 3OMCA 1BCPC 3PIO3 3Q0AA 3LX0A 1EQTA 3L9AX 2X69A 2B8FA 3QO2A 4IUQA 3VR2A 2EXZA 1R4PB 4ZK9B 3T13A 3J81L 3D31A 4XQJA 2HUGA 1O7ZA 5A35A 5M3FB 4QB4A 3GP7A 2NBFA 2F0KA 1FR3A 5M3MB 3MFGA 1JWSD 1GXDC 3FKIB 3N52A 1D5XC 4RCNA 3T53B 1LT4D 4MIUA 1WTQA 3SEBA 3J80L 3RZDB 3OW7A 3MTSA 1LTTD 2HDLA 2NN6I 2BDNA 5CR3A 3V96A 1H9RA 4KHZA 4F87A 4A3JB 3VR5A 4HMJA 2E2IB 2FFKB 2F0EA 2EPBA 2NUCA 2KCNA 3LNNA 4PQXA 2ENBA 4X3TA 1HRJA 4E6IA 3TSSA 1K83B 2K5QA 2WKCA 4KKUA 4LK1C 3NSWA 1SNOA 1GUTA 2IX3A 4WFN3 5C0XG 5IT9L 1U4RA 2IT1A 4K2LA 3HOZB 1SJED 5E1FA 5M5YB 3M7NA 1NR2A 3F2UA 4G7HC 1QWYA 3Q22A 3M85A 4KJOA 2IWHA 5KIXA 1C8CA 5ISRA 1J8IA 1STBA 1QJOA 3NHHA 3X3MA 3QB3A 2E74C 1ILQA 2HCCA 5G3LF 3CQZB 1ZEQX 1IKLA 2KECA 1F9PA 1VF5C 5TSSA 4K6LA 2EJMA 1VMCA 3GTKB 3VA5A 1TVXA 2F4IA 3NK9A 3A8IE 4BA2I 1HFGA 2Q8RE 1RKNA 2JP1A 3G7LA 3H0GB 1DOMA 1OXUA 3I70A 1TWCB 2AUJD 3H94A 1LABA 3HGBA 3TZUA 4IUPA 2PCFB 4QIWB 4B9XA 2MHVA 1S5DD 4RGMA 1SYDA 3SK4A 2K28A 1C48A 5KNBA 2XIWA 1DD2A 3S1MB 2CW0C 4H0LC 2IPKD 2RBMA 1I4RA 5JEAH 1JE4A 1FGBD 4TQUS 3BDCA 2IL8A 4IZ8A 4FF1A 1CZGA 1EYCA 2F0UA 1BDOA 3OHXC 4L6TB 3J7AF 3H6MA 4J8QA 2F1MA 2NZ1D 4ZUIA 3DEPA 2R7ZB 2KVMA 5CV9A 4OGQC 5EKKA 3A7LA 1DJRD 1STAA 5J22A 4NP5A 2VB2X 2F0SA 2K01A 4ULLA 4IFDG 4DK0A 1LTID 1G291 4RGTA 2PPBC 3SK6A 3VR6A 3VYRA 4PV1C 3W2DA 2JXMB 1SYEA 3R8BA 4K5VA 5KYIA 1ZYRC 2KQ3A 3OOCA 1LTGD 3K7AB 2VNUD 4LMQD 4JK1C 4KY7A 3MAQA 3H91A 2OF1A 5KRUA 4OL7A 1ML0D 5F2DA 1JWUD 3GTPB 5JAVA 2QCPX 3WOFA 4H13C 1RCVD 2PYKA 5LL6X 5EBDA 4A3EB 1SFOB 3A55A 2NVXB 1I4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2V A;  2EE1 A;  2B2V C;  2XIW A;  4X3T A;  1G2S A;  5EPJ A;  1WTR A;  1HRJ A;  2MPM A;  2RA4 A;  2VXW A;  1PDQ A;  5D65 A;  4X3S A;  4MHE A;  1SDF A;  2DY8 A;  4RA8 A;  4O42 A;  3FPU B;  3DEO A;  5D14 A;  2RSO A;  5CBA E;  5CBE E;  5E4X A;  2KEE A;  1MGS A;  1MSH A;  1IL8 A;  1BNZ A;  1G6Z A;  1EL0 A;  1EIG A;  1JE4 A;  2DY7 A;  2B2T C;  1NCV A;  1PLF A;  2K04 A;  1PFB A;  2X6L A;  3GV6 A;  1O7Y A;  1CA6 A;  2IL8 A;  1WD0 A;  1B2T A;  1LV9 A;  1KNA A;  2RVL A;  2B2W A;  2B2W C;  4CJ2 C;  1A15 A;  3D6W A;  1CA5 A;  1DOL A;  1JIC A;  2J7Z A;  4IUR A;  1KNE A;  1WVL A;  2MJ8 A;  1EQT A;  1DZ1 A;  2B2Y A;  2B2Y C;  5COY A;  1U4R A;  2KUM A;  2X69 A;  1X3P A;  2CVR A;  2NZ1 D;  4OIK A;  5EJW A;  4CJ0 B;  3DEP A;  4MN3 A;  2N88 A;  4RAU C;  1F2L A;  3QO2 A;  2KVM A;  4NW2 A;  5T1I A;  4R8I A;  1NR2 A;  3F2U A;  1HA6 A;  1HHV A;  1QE6 A;  4IUQ A;  5DNF A;  1BF4 A;  4XT3 B;  4CJ1 B;  1XX8 A;  4ZK9 B;  1AP0 A;  2MP1 A;  3HP3 A;  4RWS C;  2FMM A;  2NYZ D;  3I3C A;  2Q8T A;  2K03 A;  2KED A;  2FHT A;  2JYO A;  1C8C A;  1J8I A;  1DON A;  1RTO A;  1ESR A;  2H1E A;  1VMP A;  1CM9 A;  2HUG A;  1B50 A;  1O7Z A;  1U4P A;  2FJ2 A;  1MI2 A;  3DM1 A;  1RTN A;  2K01 A;  3SVM A;  1QNK A;  5E4W C;  1U4M A;  2L9H A;  1WTW A;  4OIJ A;  1ILQ A;  1F9S A;  3TN2 A;  1M8A A;  3IL8 A;  1GUW A;  2HCC A;  5EKI A;  1G91 A;  3GV3 A;  3N52 A;  3P7J A;  4HCS A;  4X3K A;  2L12 A;  1EIH A;  4IUU A;  1IKL A;  2MGS A;  4X3U A;  2KOL A;  2KEC A;  1BBX C;  1F9P A;  1ILP A;  4QUC A;  5AFW A;  1WTX A;  2EOT A;  2N55 A;  3LWE A;  1QG7 A;  4DN4 M;  1WD1 A;  3KBX A;  4XT1 B;  5EQ0 A;  3IFD A;  3UI2 A;  4QUF A;  1WTV A;  1WTO A;  1VMC A;  1B3A A;  1AZP A;  4ZKC B;  1NAP A;  1U4L A;  1TVX A;  1F9Q A;  2FIN B;  1S4Z A;  3MWY W;  1RJT A;  4LMQ D;  1O80 A;  1WTQ A;  1HUN A;  2HDM A;  3I8Z A;  1HFG A;  2Q8R E;  3H91 A;  1AZQ A;  1ZXT A;  2SDF A;  3R93 A;  2L1B A;  2JP1 A;  3G7L A;  3MTS A;  1ICW A;  4ZAI A;  5JJZ A;  1HFN A;  4UAI A;  4ZLT F;  2X6G A;  1DOM A;  4U68 A;  1ML0 D;  1SAP A;  2K1B A;  2K05 A;  2L11 A;  2L4N A;  2HDL A;  5EPL A;  1NR4 A;  5T1G A;  1F9R A;  1PFM A;  1G2T A;  3ONA B;  2R3Z A;  1WTP A;  1B4O A;  1MSG A;  4HSV A;  5COR A;  1DOK A;  2NWG A;  2B2T A;  2BDN A;  5CMD A;  1X3Q A;  2D9U A;  1PFN A;  4IUP A;  3I91 A;  1B53 A;  1EOT A;  4R9W A;  2M2L A;  5EPK A;  2HCI A;  1BO0 A;  3I90 A;  1X32 A;  4ZKB B;  4XDX A;  2K28 A;  1RHP A;  3FDT A;  2RSN A;  1Q3L A;  3Q6S A;  4HAE A;  1IKM A;  2FFK B;  1HUM A;  4HED A;  3KUP A;  2B2U A;  4IUV A;  2B2U C;  2EPB A;  1J9O A;  1SSO A;  4IUT A;  1XYI A;  1ROD A;  3TZD A;  1E0B A; 
#chains in the Genus database with same CATH topology
 1IW7 C;  2DNE A;  3TP5 A;  4DR1 L;  3KJO A;  1SDF A;  4PZ7 A;  3URY A;  4XQN A;  4B3T Q;  1HZA A;  4N9P A;  1AEX A;  3CU7 A;  1KDC A;  1UE7 A;  4DV5 L;  3V2T A;  1VQ8 A;  1PH2 A;  1M4V A;  4DR6 L;  4DV7 L;  5CV6 A;  1OXX K;  1W6K A;  5BN5 A;  1DZ1 A;  3NBI A;  2R7Z H;  2JA5 B;  1D1I A;  1T5E A;  4DXF A;  2NN6 G;  2BDO A;  3D8G A;  5IIF A;  3C46 A;  3E5S A;  2Z0S A;  2YTY A;  3U50 C;  4OIK A;  1QVC A;  2A69 C;  1HHV A;  2LFN A;  2UUC L;  5KYL A;  1D1K A;  1TY2 A;  5M5X B;  4B3S L;  2L15 A;  1L1O A;  2FMM A;  1B8A A;  3DHQ A;  1ONL A;  3A5Z B;  4NXM Q;  2NTT A;  2JA8 G;  2QEJ C;  2KJX A;  4DUY L;  4ME5 A;  1EIF A;  2B8G A;  3RLF A;  2VUM G;  3EQL C;  3H09 A;  3KLS A;  1VQ7 A;  5CV4 A;  4DV3 Q;  2AKW B;  1V1P A;  1HJP A;  4P75 A;  1EY4 A;  3GV3 A;  1DCZ A;  5ELN A;  5E3F A;  3ERQ A;  3E9I A;  3NXW A;  3LWE A;  3K7A H;  1QG7 A;  2KHI A;  2M9V A;  4MTN A;  3UI2 A;  1HR0 W;  5KGU A;  1NAP A;  4A3B B;  4KN4 C;  4HJ5 A;  1SE8 A;  4JPB W;  1O78 A;  4U67 3;  1LTB D;  1O80 A;  3VR4 A;  1EQR A;  5I2X A;  2EIF A;  1IBL L;  2O5I C;  1U5K A;  4JV5 L;  3GTP H;  4UAI A;  4JYA Q;  2Z6B A;  3K57 A;  2K05 A;  4DF7 A;  5EPL A;  1XTC D;  1PTO B;  2Y0S E;  2R7F A;  2Q2I A;  2CQA A;  3BU2 A;  3CCR A;  1EWI A;  5EBC A;  4RHR A;  2EJF C;  3I91 A;  1SJH D;  4A3E H;  1SFO H;  4OO1 H;  5EPK A;  3FEW X;  1PTO F;  1SYC A;  2AQ2 B;  5C4X G;  3KUP A;  1SSO A;  4FF2 A;  4IUT A;  3WDN A;  4GNX B;  2MPM A;  2B2V C;  5CV7 A;  3KOJ A;  4TKO B;  1KRS A;  3GO5 A;  1VQL A;  1PTO C;  3K58 A;  1SYB A;  3K0X A;  1I4G A;  2WAQ E;  5D65 A;  1STE A;  3SGI A;  1HTP A;  4O42 A;  4BBR G;  3GDE A;  5IP9 G;  3G6E A;  1EIG A;  4P71 A;  1PLF A;  2JA5 H;  4JCV E;  3I4M B;  1LV9 A;  4M8A A;  2DN8 A;  1J5E Q;  1PH6 A;  3CMA A;  3D6W A;  4GNX C;  3DWA A;  4DV5 Q;  2C5C A;  4J1M A;  4QMG A;  4K0K L;  3Q24 A;  1XMO L;  4DV7 Q;  1EFI D;  1V43 A;  1TS2 A;  4CJ0 B;  2N88 A;  5M5X H;  4GKJ L;  4R8I A;  4G7Z C;  2KBN A;  2LXJ A;  1ASZ A;  1JJG A;  2VL6 A;  4HMI A;  2WP8 J;  1BF4 A;  1JOR A;  1Q1B A;  1XX8 A;  1EY8 A;  1I4Q A;  5CGK A;  1WJJ A;  2F3V A;  2KCT A;  1SEB D;  3I55 A;  3KBG A;  1S5F D;  2JK8 A;  3NP8 A;  4DGZ A;  1RL2 A;  4G57 A;  1Q90 A;  2RQX A;  1E7Z A;  1RTN A;  2B63 G;  3K5L A;  1S72 A;  2SNM A;  3AEV A;  4DUY Q;  4LWC A;  4I7Z C;  3VR3 A;  1XMQ Q;  4A3B H;  1WTX A;  1HNZ L;  5IGD A;  1WD1 A;  4QUF A;  1OXS C;  1UWV A;  3FRP B;  3P75 A;  1AZP A;  3TRZ A;  4M1U B;  4FNF A;  3I8Z A;  3BVM A;  3J7Y W;  4RKL A;  1E2W A;  4YWK A;  1PTO H;  4ZLT F;  2ZJP A;  2JEA I;  4X6A H;  1D8L A;  1SAP A;  2EYF A;  1PFM A;  4QJF A;  1H9M A;  2AQ3 B;  4JV5 Q;  1VQN A;  1I5F A;  3RLN A;  3UE0 A;  4A3G G;  2EY2 A;  4B3R Q;  5M5W B;  1BBW A;  1K8A C;  3S17 B;  4NXN Q;  1LM0 A;  1CSP A;  2F52 A;  3HOW B;  1Q3L A;  3NTH A;  3NTK A;  3Q8D A;  2NVY B;  1JC7 A;  4F8M A;  1I6H B;  1JCK B;  5C44 B;  4DNI A;  3ND8 A;  1WTR A;  1SE2 A;  4DXG A;  1TQO A;  2RKS A;  1HZB A;  3PUX A;  3NBH B;  2PW5 A;  1SNC A;  3I4M H;  5FLX E;  2UUA L;  1SMY D;  2ZM6 Q;  4YWM A;  1BNZ A;  4A3D G;  1W2B A;  1EL0 A;  2K04 A;  1NCV A;  1IW7 D;  3A74 A;  4EVO A;  1YJ9 A;  1CA6 A;  4ZCK A;  1A15 A;  1K8M A;  3SR1 A;  1YVC A;  1DOL A;  2R7D A;  4XIG S;  2HHH L;  2CH4 A;  1JE5 A;  3S1R B;  5I4D A;  4A93 G;  5JVG 3;  3M7G A;  1Y8O B;  4KY5 A;  2F4V Q;  1XPO A;  4WRD A;  2NZO A;  4K0K Q;  1XMO Q;  2I5M X;  2PZU A;  3FPP A;  2IX0 A;  2F0N A;  4XTC S;  4JI0 Q;  2WB1 B;  3BYT B;  3CXC A;  2KHJ A;  3A0J A;  3E6Z X;  4R4I A;  1EZ6 A;  3DM1 A;  1A2U A;  1V8Q A;  3OMG A;  3SVM A;  4UY8 C;  4JI5 Q;  5IP7 G;  1DXM A;  1KAB A;  1SXT A;  1CKN A;  3CRK C;  1EIH A;  4IUU A;  4LUO A;  4EX5 A;  1LTS D;  4GOP A;  1NJI C;  3HKZ G;  2JA6 B;  2R92 G;  4FXD A;  4EGV A;  4DV4 L;  3I2Z A;  4RHS A;  4JI1 L;  2LSS A;  4JI8 Q;  2WB1 E;  2A68 D;  5L37 A;  1Y69 U;  1HNZ Q;  2L55 A;  1E22 A;  2WAC A;  2Q8I B;  4A3M G;  1FL0 A;  3L7Z C;  1FJG Q;  2DJF C;  5HY6 A;  2O2L D;  5KNC A;  1EYG A;  1Q1E A;  3EVQ A;  3OIP A;  4U68 A;  4DR5 L;  1WCM G;  1DGS A;  5M5W H;  2VQF Q;  3S17 H;  1PH4 A;  3OIQ A;  4X64 Q;  3HOW H;  1PFN A;  4ZQ3 A;  2P5Z X;  2E5L L;  3C1E A;  4A4I A;  4FXK C;  1STY A;  4PMW A;  2NVY H;  1I6H H;  5C44 H;  4ZKB B;  5IE8 A;  4KV6 A;  5IYC H;  2K4K A;  2RSN A;  3DMU A;  2N3S A;  4GS3 A;  3EBE A;  5FLM H;  2OXP A;  1LLR D;  2AWN A;  4LJZ C;  4LFC L;  4DV2 Q;  2EE1 A;  1G2S A;  2PI2 E;  1UAP A;  4C3I B;  5C4Z A;  4LAA A;  4LW1 A;  2IX1 A;  1D5M C;  4RA8 A;  3RNU A;  4L5S A;  1GHJ A;  1TS3 A;  2Z4I A;  3BG3 A;  1YZ6 A;  2F0Q A;  4KTA A;  2DY7 A;  1MJC A;  3FHW A;  3S1R H;  5DM7 3;  3NQI A;  2K50 A;  5FLX L;  2UUA Q;  4HJ9 A;  4MZ9 A;  1BKB A;  4QF4 A;  3SDZ A;  1N8R C;  1YI2 A;  4CHT B;  2AHO B;  2B2Y C;  3FMC A;  3BYY B;  2G5D A;  5BR8 Q;  4JOI C;  5GAD C;  2UXC L;  3TS2 A;  1NMG A;  1PYB A;  1A3V A;  1TWH B;  2Z6K A;  3ZYY X;  5H1S E;  4YHH Q;  5LMN W;  1BXT A;  4LF9 Q;  2XWJ B;  1YNN C;  1KLU D;  3S24 A;  4AQY Q;  5IGC A;  1TWA B;  2ID0 A;  2FHT A;  2PQA B;  1XPR A;  4ALP A;  1AE3 A;  1YHA A;  1MI2 A;  1VQ5 A;  1CQF A;  4POF A;  3U58 A;  1KC8 C;  1SLJ A;  3D0F A;  2FXQ A;  3NEN A;  1M8A A;  1I94 Q;  5C3E G;  2BH2 A;  4HTH A;  3P7J A;  4HCS A;  3HOX H;  3ULP A;  1IYJ B;  2H5X A;  4X3K A;  2JA6 H;  1Q81 C;  4C2M B;  1EQV A;  2KOL A;  5JEA J;  5IGG A;  4MTK A;  3J7A V;  3BZK A;  1AW7 A;  2TSS A;  3QJY A;  1S5E D;  4GOP B;  1U4L A;  2F0J A;  1GKH A;  4A3K G;  4EQO A;  2FIN B;  1EU4 A;  5K5P A;  4EQN A;  2PZT A;  1VQ6 A;  3HRZ C;  4LNQ A;  4QL5 A;  4DV4 Q;  2SDF A;  1MHW C;  4JI1 Q;  4BBS B;  1Y1W B;  1O7I A;  2K33 A;  3X3N A;  1KQS A;  2R93 B;  3O13 A;  2BA1 A;  2G9D A;  2R3Z A;  4CKE A;  1UE6 A;  2R6G A;  4GOP C;  3BDL A;  4K2K A;  1B9M A;  3IAY A;  2HCI A;  4UHV A;  3RMH A;  2XRQ D;  3OW2 A;  4HJ8 A;  4AIM A;  2E5L Q;  4C3I H;  1EY6 A;  1I3Q B;  1PV4 A;  3KDF A;  5CBE E;  5LHY 1;  1PRT B;  4C3J B;  2BA0 A;  3Q23 A;  4C3H B;  2V4D A;  4KN7 C;  3MHB A;  2K5V A;  4EQP A;  5C4J B;  1BUV T;  1PRT F;  3F2C A;  1MGS A;  1IL8 A;  1Y8P B;  4OEL B;  4A3F G;  3GV6 A;  1PFB A;  4YCW A;  2NB0 A;  3HOY G;  3CC2 A;  1K9M C;  3A56 A;  4KKS A;  2B2W C;  3DUZ A;  2EJG C;  1LAC A;  1J6Q A;  1PRT C;  1TS5 A;  1TWH H;  4IPH A;  2EY6 A;  1X3P A;  3K7U C;  4B3T L;  2EDG A;  1TWA H;  5FO9 B;  5DNF A;  4XT3 B;  3GTQ B;  2A6H C;  2JA8 H;  4R8N A;  2E2J B;  1IHZ A;  3T56 B;  3D4W A;  2H1E A;  3U9S A;  3PF5 A;  3C2P A;  1CK1 A;  3A7A B;  4OHJ A;  4Y7N B;  5ELC A;  1R4Q B;  1H9K A;  3CAM A;  4H7B A;  4C2M H;  4K8I A;  3G48 A;  4OIJ A;  2K52 A;  2LMC B;  3I73 A;  1V1Q A;  4HIO A;  5FLX c;  1LTA D;  1BCP D;  4KHV A;  5EGT A;  1PH3 A;  2JA7 B;  1RDP D;  3PUW A;  3K80 C;  1B3Q A;  4WOR A;  3J81 j;  1A3U A;  3R3O A;  5FJ8 G;  1B3A A;  5C5L A;  1CT1 D;  3T1H L;  4BBS H;  1Y1W H;  1YNX A;  1HUN A;  2R93 H;  5GAE C;  3MVV A;  4WJ4 A;  3P20 A;  2L1B A;  2QA4 A;  1VQF A;  2EY5 A;  2F0D A;  3ONA B;  3KF6 B;  1B4O A;  3W1B A;  1NBW A;  5CV5 A;  1H9S B;  1GHK A;  5CMD A;  4O0A A;  4A3G B;  2QDB A;  1I3Q H;  2YYZ A;  1QVF A;  1G51 A;  1KDA A;  1TWG B;  2NVQ H;  1BR9 A;  1YEZ A;  4GKK Q;  1U9R A;  3ZJY C;  4C3J H;  3VYT A;  1UEB A;  1Q7Y C;  4JYA L;  4C3H H;  1A63 A;  3QIA A;  4DN4 M;  2MUY A;  4LF6 Q;  2B2V A;  4R4C A;  4X65 Q;  2F0T A;  4K5X A;  3BVZ A;  2OTJ A;  4MHE A;  1FGU A;  1C0A A;  3RR5 A;  1RF2 D;  1C4Q A;  3FPU B;  4L63 B;  2C9O A;  5E4X A;  1P8L A;  3PUV A;  2F0W A;  1YNJ C;  1WTH A;  3J80 i;  3OYY A;  1T5X D;  4ZYS A;  1QZG A;  3MXN B;  5JPM C;  4LF8 Q;  5M3F G;  1D6E C;  4GNX A;  5JJK A;  2KA7 A;  1KNE A;  2A19 A;  1GJX A;  5M3M G;  3CCS A;  2BOS A;  4FF3 A;  4A93 B;  3R2T A;  3FKI G;  1HQM C;  3NPP A;  4DFA A;  3CF5 A;  1MKH A;  1SNM A;  3GTQ H;  5T1I A;  4OO1 I;  4NW2 A;  1LT6 D;  2E2J H;  1HA6 A;  1UE5 A;  2N8N A;  1HCZ A;  4RCO A;  1J5E L;  1K28 A;  5I2Y A;  1I50 B;  2RCN A;  1AP0 A;  4Y7N H;  3M4O B;  2I46 A;  3T16 A;  1ZKO A;  1BOS A;  2Z1C A;  1FVI A;  2OWO A;  1VMP A;  2B63 H;  1HR0 Q;  4P73 A;  1Z47 A;  1CHQ D;  2A5H A;  3PO2 B;  4A3C H;  5E4W C;  5D3I B;  1U4M A;  4RG1 A;  2L9H A;  1A2T A;  1X3G A;  2KCM A;  5GRO A;  2UUB Q;  5ELF A;  1F2Y A;  5D3D A;  4LFB Q;  2JA7 H;  2ZTE A;  3CPW A;  2FMC A;  1N36 Q;  2AQ1 B;  1ESF A;  3RN5 A;  3EJI A;  4B08 A;  3EFX D;  2V1C C;  4A3J G;  4XT1 B;  4A3I B;  1K8G A;  1WTO A;  1VQA A;  1SE3 A;  5K36 H;  2A6E C;  4PZ6 A;  2CWA A;  4KLK A;  4HSP A;  3GQB A;  1STG A;  2VS1 A;  3K5O A;  3I4L A;  3T1H Q;  1XMQ L;  5JJZ A;  5JJI A;  4A3G H;  1PA6 A;  4FP5 D;  1TWG H;  2F0L A;  3CD6 A;  2YTX A;  3N6R A;  1JOQ A;  2Y0S B;  2XVS A;  2SEB D;  5E7N A;  5C5M A;  2EYM A;  2M2L A;  4ZRZ A;  5JEA G;  2CFM A;  2K7V A;  3PSI A;  1XXG A;  1HNW Q;  1I4X A;  1JQY D;  4HED A;  4IUV A;  2B2U C;  5IYD H;  2LKV A;  3HOZ G;  1XYI A;  2VB3 X;  1TU2 B;  4BXX H;  5G3L D;  2XSC A;  1E2Z A;  5CYU A;  2QGQ A;  2WAQ B;  1HH2 P;  1RD9 D;  5DEH A;  1FD7 D;  3I4N B;  4B3R L;  3M9B A;  4IUN A;  4NXN L;  5LL6 S;  2ZJR A;  2OT2 A;  1X54 A;  1KNA A;  1HXY D;  1L0Y B;  2XNA C;  3E0J A;  4J15 A;  5ELE A;  4A93 H;  1CA5 A;  3JAM E;  3ICE A;  3PO3 B;  5IGB A;  4GLX A;  4X66 Q;  1LYL A;  3NBH A;  5IWA L;  2ZM6 L;  1SNQ A;  3AU7 A;  4HN7 A;  1I50 H;  1STN A;  3M4O H;  2JJQ A;  2WFW A;  2K5D A;  3ER0 A;  4A76 A;  1M90 C;  1D5Z C;  1NY4 A;  5ELO A;  4QCL A;  1VQE A;  3F1Z A;  2Q8T A;  3PO2 H;  2B3G A;  3QOL A;  4JI6 Q;  3RUZ A;  4K14 A;  1ESR A;  2CW0 D;  1Y1V B;  1YHB A;  1B50 A;  2F4V L;  2JN4 A;  2K5N A;  1PXU A;  1QNK A;  3CCL A;  3H0G G;  1WTW A;  2YU9 H;  1F9S A;  2OTL A;  3TN2 A;  3IL8 A;  2I0Q A;  1GUW A;  4CDE C;  4RMF A;  3OTO Q;  1G91 A;  2PO4 A;  1S5B D;  2QDL A;  4A3I H;  1L0W A;  3U4Z A;  2F0F A;  4H44 C;  4JI0 L;  4A3L G;  4JI5 L;  1DYQ A;  3F8T A;  1NE3 A;  1RJT A;  1EOV A;  3EIV A;  2ASB A;  1Q46 A;  3BS1 A;  3QR8 A;  2D62 A;  1Q12 A;  4LF7 L;  3HOV B;  2YV5 A;  1SBB B;  2BCO A;  2DGY A;  3HS0 C;  1R9T B;  3RD4 A;  1K3R A;  2Q2H A;  2MFI A;  4IJL A;  3C3L A;  1YHQ A;  3ERO A;  4DV1 L;  1CZW A;  4P2C B;  3MA2 B;  4JI8 L;  1B53 A;  5BN4 A;  1SN8 A;  3RLO A;  3E9H A;  1UNS A;  2QF7 A;  4O2D A;  5DLQ E;  4DR3 Q;  4BY1 B;  3PIP 3;  1FJG L;  1V1O A;  5FO7 B;  1PH9 A;  1J9O A;  2MO0 A;  2PI2 A;  2K6A A;  4DKA C;  3I4N H;  1CI3 M;  1PMR A;  1ZYR D;  2R7Z G;  4JI2 Q;  5EPJ A;  2VQF L;  4AH6 A;  3W1G A;  4O1N A;  4X64 L;  2QKI C;  4XXE A;  3AFQ A;  3TS0 A;  1MSH A;  3PV0 A;  4DPG A;  1E3P A;  1ET6 A;  2XWB B;  1NMF A;  2EYO A;  4WJ3 M;  3PO3 H;  2WIN B;  2RVL A;  4G7O C;  3FP9 A;  3S9W A;  1JIC A;  2J7Z A;  4DV2 L;  1VS0 A;  3T1Y Q;  1EIY B;  1CTM A;  2F0I A;  3LGJ A;  1W6J A;  4WJW A;  3H3V C;  1GUS A;  2B2Y A;  4DAP A;  4IAL A;  4IPD A;  4JOI A;  4DUZ Q;  3JAM L;  4AYB B;  5I6W A;  3KF8 B;  5IWA Q;  2ZXP A;  4BY7 B;  1Y1V H;  5C0X H;  4DAV A;  1Q8I A;  3TME A;  4CGY B;  4CKB A;  2J0T D;  2JYO A;  4GZY C;  3EA6 A;  4K8J A;  1TR5 A;  1LTL A;  4HID A;  1NSN S;  1Y8N B;  3KFU A;  1YJN A;  5BR8 L;  1ET9 A;  1CHP D;  3PF4 A;  2OEO A;  4YHH L;  2GA4 B;  4S3S A;  3CME A;  4LF9 L;  4AYB E;  1W3S A;  3IKJ A;  1V9P A;  4AQY L;  1CFM A;  1JWM D;  1JOO A;  2E2H H;  2PQA A;  1BBX C;  1LT3 D;  4A75 A;  3U9O A;  1YIT A;  3TP6 A;  2A69 D;  3HOV H;  2ALY B;  2XTI A;  4R4T A;  4A3E G;  1R9T H;  3AFP A;  1WOC A;  5FO8 B;  1X65 A;  3CC4 A;  1I94 L;  2HDM A;  2RHS B;  4IPG A;  4HJA A;  1AZQ A;  4DR2 Q;  1ZXT A;  4R4O A;  3MEF A;  3DLL A;  3BVG A;  2CKZ B;  4OWT B;  4H02 A;  5J1Z A;  2E75 C;  2A6E D;  2MNA A;  4LF7 Q;  1UE1 A;  4DV6 Q;  4HR7 B;  4HSV A;  5COR A;  2F0G A;  2I5H A;  2B2T A;  4BY1 H;  1X3Q A;  3UDF A;  3S1N B;  3NWT A;  1LUZ A;  4CBV A;  4DV1 Q;  3HOX B;  1D7Q A;  4RFB A;  3VA7 A;  1TWF B;  4APV A;  2O5J C;  4XDX A;  1MD2 D;  1EQQ A;  2JA5 G;  2EXD A;  3KK7 A;  3A54 A;  1RHP A;  3H3V H;  2A74 C;  2EYL A;  3MC0 B;  1SE4 A;  1X56 A;  5IYB H;  3TZD A;  2RA4 A;  3NEM A;  4B9W A;  2F0P A;  3A5U A;  2IHF A;  1PZJ D;  4X3S A;  4C1N I;  4DNR B;  1EZ8 A;  2KEE A;  4IJH A;  1VQ9 A;  1KL9 A;  4IOA A;  1G6Z A;  3J7A 5;  2X6L A;  1B2T A;  5LMN Q;  5C6A A;  3BDO A;  4ODG A;  1EY7 A;  1IBM Q;  4OX9 Q;  2EZV A;  3GTG B;  2B2W A;  4UP9 A;  4CDF C;  4CKC A;  5C3X A;  3PGZ A;  5IGE A;  4FDB A;  3AMU A;  3CRL C;  3HOU B;  3STB C;  5COY A;  4JBK A;  4R1J A;  5AJ3 Q;  3A8J E;  5JOB A;  4JBW A;  3H15 A;  4OWW B;  4BY7 H;  1F2L A;  3M4P A;  4JI4 Q;  1Z9F A;  4KHP Q;  3KYH C;  1WFQ A;  1FNU A;  1VQG A;  1EY0 A;  2JQO A;  2MP1 A;  3CC7 A;  3OSO A;  2NYZ D;  3I3C A;  3W3A A;  4A3B G;  4P74 A;  1JOK A;  1PTO D;  1PH5 A;  1CM9 A;  4L5T A;  1KTK A;  1QUQ B;  1EY9 A;  1Q82 C;  5EKL A;  2KHS A;  2H4O A;  3ULJ A;  1G6P A;  1EWC A;  2EQS A;  4R4Q A;  4Y52 H;  2L0C A;  2L12 A;  1MIU A;  3CW2 C;  3S16 B;  1FNV A;  1ILP A;  5AFW A;  3D4R A;  2EVB A;  2IHE A;  3PUY A;  5EQ0 A;  1QIL A;  2SOB A;  3TP8 A;  1F9Q A;  3JAM c;  3W5O A;  4IFD H;  1S4Z A;  2JA8 B;  1XNR Q;  3NUC A;  1NTG A;  4FF4 A;  3HZX A;  1G8Z D;  3CHB D;  4NKL A;  2RHQ B;  2IY5 B;  1AN8 A;  2VUM B;  4ZAI A;  3PUZ A;  2XGT A;  2LS0 1;  2QIL A;  3QG1 A;  3S1N H;  5T1G A;  4JI3 L;  3PQI A;  5CC4 A;  1NR4 A;  1F9R A;  1XPU A;  1TWF H;  1JB3 A;  1XTD A;  4KK7 A;  3EN2 A;  2D9U A;  4RH6 A;  4L8J A;  1LT5 D;  5IGF A;  3S1Q B;  1HA5 A;  4IPC A;  1AFP A;  4UDU C;  1VDZ A;  2ZXO A;  1HUM A;  5C4H A;  1HFN A;  1A62 A;  4KD4 A;  3KF6 A;  1XJV A;  1GO3 E;  4RGN A;  4UPA A;  2VXW A;  1H9S A;  1PDQ A;  2WII B;  2K75 A;  5HUR A;  2ZXR A;  3GTG H;  4Q5V A;  3DEO A;  3BZD B;  1C7Y A;  4NPS A;  4FO2 A;  1TS4 A;  2B2T C;  4LUZ A;  1X3F A;  2M00 A;  1O7Y A;  4GKK L;  2WV6 D;  3CCM A;  3HOU H;  4YY3 Q;  3ULL A;  5J39 A;  4LF6 L;  4X65 L;  4N8X 1;  3TEH B;  4IOC A;  5C4X B;  4EQ5 A;  4GN5 A;  1OTC A;  2NVQ B;  5EJW A;  1A3T A;  2IW3 A;  1SR3 A;  3MXG A;  3MXN A;  4CJ1 B;  4LF8 L;  4BBR B;  1Z6H A;  2K03 A;  3K59 A;  1E2V A;  3JAM i;  4NDX A;  2NN6 H;  2Q2T A;  3UDG A;  2F03 A;  3I72 A;  5IOD A;  1SYF A;  4Z9C B;  1L2F A;  2UXD Q;  3S2D B;  5JVH 3;  3S16 H;  5EKI A;  2RDG A;  2E2D C;  5ELD A;  5BN3 A;  3S14 B;  4IO9 A;  1GUN A;  2N55 A;  5FKA C;  2HQE A;  5IOC A;  1HR0 L;  1F2Z A;  3KBX A;  3IFD A;  5DM6 3;  3TBI B;  3HOW G;  4PG3 A;  1F77 A;  2VUM H;  1B7Y B;  2UUB L;  1CQV A;  4KJN A;  1VF7 A;  3SK8 A;  5C44 G;  1HNX Q;  4LFB L;  2ICE C;  5IYC G;  1B44 D;  1PFS A;  5FLM G;  4HIK A;  1N36 L;  2B63 B;  4K6D A;  2L11 A;  1LTR D;  3DM3 A;  3S1Q H;  1DOK A;  1IYV A;  2PNH A;  4PMB A;  5EAY A;  4I65 A;  5I9P A;  5LMU Q;  4JI3 Q;  3GTM B;  4R9W A;  4FXG C;  1X32 A;  1QOH A;  3AB9 A;  4QIW E;  3I4O A;  5JPN C;  1IKM A;  1L0X B;  1QNU A;  2B2U A;  5IY0 A;  3G71 A;  5KEE A;  3T51 B;  1TII D;  2JSO A;  1ROD A;  4NMZ A;  1E0B A;  1OXV A;  3T4A C;  4GN3 B;  2UU9 L;  1T9H A;  2OCE A;  1PYS B;  1GUG A;  4OXP A;  3NTI A;  4CDD C;  3P1H A;  2DUD A;  2RSO A;  5C3W A;  3R2I A;  2F3I A;  1HNW L;  3MXU A;  2D5D A;  5DAU A;  3KLR A;  1WD0 A;  5C4X H;  5KND A;  2WB1 G;  2NVT B;  4JI7 Q;  1ENF A;  1GVP A;  1TKW B;  3HKS A;  4L5R C;  2MJ8 A;  5A2Q E;  1VCI A;  2F0H A;  3SHL A;  5I6Y A;  3UDI A;  4MN3 A;  4BBR H;  3DWP A;  2Z4H A;  1EY5 A;  5IP9 H;  5FK9 C;  3L2P A;  3STB D;  2D0P A;  2JA6 G;  2GVA A;  4IN3 A;  2G9H D;  1EU3 A;  3HP3 A;  1Z7T A;  4A3D B;  2D2C C;  1OO9 B;  1N33 Q;  3GTL B;  3S2D H;  2CHB D;  1HPC A;  4X66 L;  1U4P A;  2FJ2 A;  4DA2 A;  2JE6 I;  4FVM A;  4KY6 A;  5CV8 A;  4DR4 Q;  3AYH B;  3S14 H;  3NWS A;  1K3B C;  3HEJ A;  4L5Q A;  2CQO A;  4DAM A;  1XWE A;  4DU9 A;  4OON A;  4X3U A;  1VQ4 A;  4JI6 L;  4QUC A;  5M9O A;  3F2D A;  3MXP A;  1WTV A;  2A73 B;  4ABN A;  3RZO B;  1IYU A;  3VYS A;  2CCZ A;  2BE5 C;  4XYO A;  2SNS A;  3MWY W;  2ATW A;  1SMY C;  4XYQ A;  4KD3 A;  3OTO L;  1YNN D;  4RGO S;  3S2H B;  4C3I G;  3TRE A;  1VQB A;  2EYJ A;  2L4N A;  3SE0 A;  4DNT B;  3GTM H;  5GQO A;  5GAH C;  1GUO A;  2YU9 B;  4LF4 Q;  3HKZ B;  1EOT A;  1ENC A;  4X62 L;  1BO0 A;  2R92 B;  2N78 A;  1FNW A;  1NUC A;  3K6O A;  1Y14 B;  3Q6S A;  4JVZ A;  3CKI B;  1STH A;  1YBY A;  1FYC A;  3SK5 A;  2GVB A;  3IFT A;  3VYU A;  4A3M B;  4LF5 Q;  1UUP A;  1S5C D;  3DWQ A;  3WWV A;  3KLW A;  4BA1 I;  3SXH A;  1N34 Q;  4HIM A;  4KMU C;  5D14 A;  1WCM B;  5CBA E;  3J7Z C;  2NVT H;  1HTL D;  2UU9 Q;  2EY1 A;  4DR3 L;  1DON A;  3HKZ E;  4YWL A;  1EEI D;  2MO1 A;  2PMZ B;  2I07 B;  3MEH A;  1TY0 A;  3IRB A;  1QZH A;  4IUR A;  2J4X A;  4JI2 L;  4IQZ A;  1WVL A;  1EYD A;  1EYA A;  5HGQ A;  4K5W A;  4DV0 Q;  2XRS D;  1HQR D;  1MJE A;  4PMC A;  3MFY A;  2VQE Q;  2TMP A;  3L0O A;  5I9O A;  1QE6 A;  2A68 C;  4A3D H;  5A2Q L;  3GTL H;  3WOE A;  1NNX A;  2A8V A;  1VQD A;  3QWN A;  5NUC A;  3NE5 B;  1HZ9 A;  3V05 A;  3TDQ A;  3T1Y L;  2PMZ E;  3U4V A;  1KAW A;  3M3Y B;  2RDH A;  1GD7 A;  3K5M A;  1KD1 C;  4DUZ L;  2Z9H A;  4BBS G;  1Y1W G;  4GLA C;  3FVQ A;  3KF8 A;  2R93 G;  2RCF A;  1B1Z A;  1KIX A;  1PRT D;  3RZO H;  1A6X A;  3G6J B;  2EOT A;  2CH4 W;  2PZW A;  2NVX H;  1ASY A;  2PQE A;  3S2H H;  2O4X A;  2KCC A;  3GTJ B;  3QOJ A;  2L5T A;  1IL2 A;  1GOZ A;  5IP7 H;  1QCB D;  2K5W A;  2YTV A;  2A6H D;  5GAG C;  4JC0 A;  3GTO B;  1DM0 B;  4C3J G;  4XQQ A;  1ICW A;  5C0X I;  2ZTD A;  4C3H G;  4FYD A;  2K1B A;  5ELB A;  5C3E B;  1G2T A;  3L3O C;  1MSG A;  4DR1 Q;  2R92 H;  2NWG A;  1UEA B;  1VQP A;  5C0X J;  3D4D A;  4J6H A;  2QW7 A;  2B29 A;  2Q2U A;  1KXL A;  3A8K E;  1SYG A;  4DAY A;  1YJW A;  4DR2 L;  2AWO A;  2DJG C;  4N9T A;  2E2H B;  4A3M H;  2K32 A;  4HAE A;  4PNY A;  4Q0F A;  4A3K B;  5FOB B;  4DR6 Q;  4TSS A;  3DXJ C;  1TT2 A;  4X62 Q;  3ERS X;  4DV6 L;  1OXT A;  1N32 L;  2NZH A;  1KLG D;  2LY7 A;  1WCM H;  2UXB L;  2HD3 A;  1JMC A;  1CUK A;  2JEB I;  1I6V C;  2IJ0 A;  4ILW A;  1EWH A;  4I7A A;  3PMF A;  4TRD A;  3M4Y A;  4N8F A;  2QEX A;  1KHI A;  4TVA B;  2BH8 A;  3ITP A;  1MBY A;  1H9J A;  2VW9 A;  4ID6 A;  2PW7 A;  2UUC Q;  3D3R A;  1CSQ A;  3G4S A;  1L1O B;  4B3S Q;  3K81 C;  3NQT A;  3ND9 A;  2R61 A;  2KUM A;  4A3C G;  1F2M A;  2CVR A;  4QGU A;  4RAU C;  4KKT A;  1O7L A;  4F7X A;  4CDC C;  3J81 E;  4B3M L;  1VQJ A;  2F0V A;  2RDF A;  2JA7 G;  1B9N A;  1SND A;  5LMN L;  1IBM L;  4OX9 L;  1V1P B;  3H3V I;  3M3Y H;  4RWS C;  1L1O C;  3CPF A;  2E76 C;  2F0M A;  2KED A;  4A3F B;  1ENA A;  1RTO A;  3HOY B;  5AJ3 L;  3LWU A;  4DK1 A;  4F88 A;  5K36 G;  1SNP A;  4JI4 L;  1YNJ D;  4KHP L;  4RKB A;  1IBL Q;  3D6C A;  1II3 A;  2MGS A;  3GTJ H;  4LUV A;  2F0O A;  3MZ5 A;  1QUQ A;  3J80 E;  1K73 C;  3UDX A;  4ZKC B;  1EEF D;  1I4P A;  3GTO H;  1K0S A;  2RF4 A;  1K8O A;  4BWG B;  3K5N A;  3K8A A;  3GD7 A;  3K0Y A;  3C1F A;  1KAA A;  5JJL A;  3OWF A;  4G4K A;  3S15 B;  4YIJ A;  2WKD A;  3JC6 6;  3OWE B;  4ZUJ A;  3R93 A;  5C3E H;  1K0R A;  4KI0 A;  4C56 C;  5IYD G;  2X6G A;  1PZK D;  2NTS A;  2BE5 D;  4MNO A;  1QB5 D;  1LO5 D;  4BXX G;  3TP7 A;  1WTP A;  2MQH A;  4V19 0;  2Z8L A;  3NEL A;  4A3K H;  1XNR L;  2ICI A;  1EUJ A;  4C1N K;  1H95 A;  3I90 A;  2B39 A;  3F2B A;  2XN9 C;  1PZI D;  4HCE A;  3FDT A;  2EYP A;  4LFA L;  1PYW D;  4OO1 G;  2F3W A;  4DAY B;  2EYH A;  2AUK A;  4V0B A;  1WI5 A;  1VQC A;  1BCP B;  1CKO A;  1N9W A;  1U0L A;  2ZT9 C;  2DY8 A;  1BCP F;  2DNC A;  1N32 Q;  4IFD I;  3KLS X;  2UXB Q;  4GKJ Q;  4BS9 A;  4PZ8 A;  1D2B A;  3HG9 A;  1KDB A;  1JR0 D;  5IT9 E;  3OPO A;  2PNR C;  4CJ2 C;  1BQQ T;  3PO2 G;  4IFD J;  5HGT A;  3OMC A;  1BCP C;  3PIO 3;  3Q0A A;  3LX0 A;  1EQT A;  1E1T A;  1PVO A;  3L9A X;  2X69 A;  2B8F A;  4JW0 A;  3QO2 A;  4GN4 B;  4QY7 A;  4DK3 C;  4IUQ A;  4A3F H;  3VR2 A;  4YY3 L;  2EXZ A;  3HOY H;  1R4P B;  4A3I G;  4ZK9 B;  1S40 A;  1PH1 A;  3T13 A;  3J81 L;  4B3M Q;  3PIP A;  3D31 A;  1WYD A;  4JBJ A;  1BVS A;  4XQJ A;  2HUG A;  1O7Z A;  3E0E A;  5A35 A;  5M3F B;  4QB4 A;  3GP7 A;  1M1K C;  2NBF A;  2AMC B;  2F0K A;  1FR3 A;  5M3M B;  3MFG A;  1JWS D;  1GXD C;  3FKI B;  2CWP A;  1B70 B;  3CP0 A;  3N52 A;  4UP7 A;  3AQQ A;  2Y0S G;  4QQB X;  1D5X C;  4RCN A;  3T53 B;  1LT4 D;  4MIU A;  1X9N A;  3S15 H;  2UXD L;  1X6O A;  2HIV A;  1WTQ A;  3SEB A;  1S3O A;  1KRT A;  3J80 L;  3RZD B;  3OW7 A;  3PCO B;  3MTS A;  1LTT D;  3I4N G;  2WAQ G;  2D0O A;  2ES2 A;  2HDL A;  4NB3 A;  2NN6 I;  5FJ8 H;  2BDN A;  3I7F A;  5CR3 A;  4DK6 C;  2A1A A;  3V96 A;  1H9R A;  1HNX L;  4KHZ A;  4F87 A;  4A3J B;  3VR5 A;  4HMJ A;  3PO3 G;  2E2I B;  1IZ6 A;  4YCV A;  2FFK B;  4P72 A;  2F0E A;  2EPB A;  2NUC A;  1XNQ L;  2KCN A;  3LNN A;  2HHH Q;  4PQX A;  2ENB A;  4X3T A;  2I5L X;  1HRJ A;  4LFA Q;  4E6I A;  3TSS A;  5LMU L;  1K83 B;  1TXY A;  2K5Q A;  4GLV B;  4OWX B;  2KEN A;  2WKC A;  3I4M G;  4KKU A;  4LK1 C;  3NSW A;  1SNO A;  1SRU A;  1GUT A;  1PH7 A;  1Y1V G;  2IX3 A;  2HT1 A;  3TQY A;  4WFN 3;  5C0X G;  4DR7 L;  1X55 A;  1SRO A;  1PH8 A;  5IT9 L;  1U4R A;  2IT1 A;  2VY3 A;  1VQO A;  3CCU A;  4K2L A;  3HOZ B;  1SJE D;  5E1F A;  2OQK A;  3E3X A;  3M7N A;  5M5Y B;  1NR2 A;  3F2U A;  4G7H C;  1CKN B;  1QWY A;  3Q22 A;  3M85 A;  4KJO A;  4JI7 L;  2IWH A;  1IBK L;  5KIX A;  5M3F H;  3PIO A;  2OQ0 A;  1C8C A;  5ISR A;  1J8I A;  1X3E A;  5M3M H;  3HOV G;  1STB A;  2K14 A;  3FKI H;  1QJO A;  1RIP A;  3NHH A;  3X3M A;  3QB3 A;  2E74 C;  1ILQ A;  3BZC A;  1P16 A;  2HCC A;  5G3L F;  3CQZ B;  1ZEQ X;  1IKL A;  1N33 L;  4POG A;  2KEC A;  1F9P A;  1VF5 C;  5TSS A;  4ME3 A;  4DR5 Q;  4K6L A;  2EJM A;  4BY1 G;  1VMC A;  3GTK B;  3VA5 A;  3RZD H;  1TVX A;  2F4I A;  3NK9 A;  4DR4 L;  3A8I E;  4BA2 I;  3KJP A;  1HFG A;  2Q8R E;  1RKN A;  2JP1 A;  3G7L A;  3HFZ B;  5IYB G;  3H0G B;  3UE1 A;  1DOM A;  3J81 c;  1OXU A;  3I70 A;  1TWC B;  4HJ7 A;  1IXR A;  1JJ2 A;  2AUJ D;  3H94 A;  1LAB A;  3HGB A;  4LFC Q;  3TZU A;  4A3J H;  1QVG A;  2E2I H;  3M4Q A;  1ICF B;  4IUP A;  2PCF B;  1E1O A;  1E24 A;  3B6Y A;  1VQM A;  3RN2 A;  4QIW B;  2JA9 A;  4JG2 A;  4B9X A;  1C9O A;  2MHV A;  1YIJ A;  1S5D D;  2ZTC A;  4RGM A;  1SYD A;  3BJU A;  3SK4 A;  2K28 A;  1C48 A;  4AYB G;  1K83 H;  5KNB A;  1Q8K A;  2XIW A;  1DD2 A;  4YCU A;  1A0I A;  3S1M B;  1VQI A;  2CW0 C;  4H0L C;  4UP8 A;  4LF4 L;  4BY7 G;  2IPK D;  1XNQ Q;  2LXK A;  2RBM A;  1I4R A;  5JEA H;  2UXC Q;  1JE4 A;  1FGB D;  4TQU S;  3J80 c;  3BDC A;  2IL8 A;  3CCJ A;  1JJC B;  4IZ8 A;  4FF1 A;  1CZG A;  1EYC A;  2F0U A;  3HOZ H;  1VQH A;  4LF5 L;  1BDO A;  1A8V A;  5M5Y H;  3OHX C;  1PHJ A;  4L6T B;  1AH9 A;  3J7A F;  4DR7 Q;  1N34 L;  3H6M A;  4J8Q A;  2F1M A;  2NZ1 D;  4ZUI A;  3DEP A;  2R7Z B;  2K5H A;  2KVM A;  1JB7 A;  2Z6K C;  1BBU A;  4NXM L;  5CV9 A;  2HIX A;  5J3B A;  4OGQ C;  5EKK A;  3A7L A;  1DJR D;  1STA A;  5J22 A;  4NP5 A;  4DV0 L;  2GN5 A;  2VB2 X;  4DV3 L;  1AE2 A;  3CCQ A;  2VQE L;  1IBK Q;  3CQZ H;  2F0S A;  2K01 A;  4ULL A;  4IFD G;  2VZA A;  4DK0 A;  1LTI D;  3CCE A;  1G29 1;  4RGT A;  2PPB C;  3J81 i;  3SK6 A;  3VR6 A;  3VYR A;  4PV1 C;  1GM5 A;  3GTK H;  4JBM A;  1JT8 A;  3W2D A;  2JXM B;  1SYE A;  4OEM B;  1EFW A;  3R8B A;  3HOX G;  4K5V A;  5KYI A;  1ZYR C;  2KQ3 A;  3OOC A;  5IT9 c;  1SMX A;  3I56 A;  1LTG D;  1VQK A;  2HQL A;  3K7A B;  2VNU D;  3H0G H;  4LMQ D;  4JK1 C;  4KY7 A;  3MAQ A;  1TWC H;  3H91 A;  2OF1 A;  5C4J H;  5KRU A;  4OL7 A;  3KDF B;  1ML0 D;  1HZC A;  1Q86 C;  1CKM A;  5F2D A;  1JWU D;  3GTP B;  5JAV A;  4A3L H;  2QCP X;  2C35 B;  2ZJQ A;  3WOF A;  4H13 C;  1RCV D;  2N49 A;  3HOU G;  2PYK A;  2E8G A;  5LL6 X;  5EBD A;  4A3E B;  1SFO B;  3S1M H;  3CCV A;  3VDY A;  3A55 A;  2NVX B;  1I4H A; 
#chains in the Genus database with same CATH homology
 1IW7 C;  2DNE A;  3TP5 A;  1SDF A;  3URY A;  4XQN A;  4N9P A;  1AEX A;  3CU7 A;  1KDC A;  3V2T A;  1M4V A;  5CV6 A;  1OXX K;  1W6K A;  5BN5 A;  1DZ1 A;  3NBI A;  2JA5 B;  1D1I A;  1T5E A;  4DXF A;  2NN6 G;  2BDO A;  3D8G A;  5IIF A;  3C46 A;  3E5S A;  4OIK A;  2A69 C;  1HHV A;  2LFN A;  5KYL A;  1D1K A;  1TY2 A;  5M5X B;  2FMM A;  3DHQ A;  1ONL A;  2NTT A;  2QEJ C;  2KJX A;  4ME5 A;  2B8G A;  3RLF A;  3EQL C;  3H09 A;  3KLS A;  5CV4 A;  1V1P A;  1EY4 A;  3GV3 A;  1DCZ A;  5E3F A;  3ERQ A;  3NXW A;  3LWE A;  1QG7 A;  2M9V A;  3UI2 A;  5KGU A;  1NAP A;  4A3B B;  4KN4 C;  1O78 A;  4U67 3;  1LTB D;  1O80 A;  3VR4 A;  5I2X A;  2O5I C;  4UAI A;  3K57 A;  2K05 A;  4DF7 A;  5EPL A;  1XTC D;  1PTO B;  2CQA A;  5EBC A;  4RHR A;  2EJF C;  3I91 A;  1SJH D;  4OO1 H;  5EPK A;  3FEW X;  1PTO F;  1SYC A;  2AQ2 B;  3KUP A;  1SSO A;  4FF2 A;  4IUT A;  3WDN A;  2MPM A;  2B2V C;  5CV7 A;  4TKO B;  3GO5 A;  1PTO C;  3K58 A;  1SYB A;  5D65 A;  1I4G A;  1STE A;  1HTP A;  4O42 A;  1EIG A;  1PLF A;  3I4M B;  1LV9 A;  4M8A A;  2DN8 A;  3D6W A;  3DWA A;  2C5C A;  4J1M A;  4QMG A;  3Q24 A;  1EFI D;  1V43 A;  1TS2 A;  4CJ0 B;  2N88 A;  4R8I A;  4G7Z C;  4HMI A;  2WP8 J;  1BF4 A;  1JOR A;  1Q1B A;  1XX8 A;  1EY8 A;  1I4Q A;  5CGK A;  2F3V A;  1SEB D;  3KBG A;  1S5F D;  3NP8 A;  4DGZ A;  4G57 A;  1Q90 A;  2RQX A;  1RTN A;  3K5L A;  2SNM A;  4I7Z C;  3VR3 A;  1WTX A;  5IGD A;  1WD1 A;  4QUF A;  1OXS C;  3P75 A;  3FRP B;  1AZP A;  4M1U B;  4FNF A;  3I8Z A;  3BVM A;  3J7Y W;  4RKL A;  1E2W A;  2JEA I;  1PTO H;  4ZLT F;  1SAP A;  2EYF A;  1PFM A;  1H9M A;  2AQ3 B;  2EY2 A;  5M5W B;  3S17 B;  3HOW B;  1Q3L A;  3NTH A;  3NTK A;  2NVY B;  1JC7 A;  4F8M A;  1I6H B;  1JCK B;  5C44 B;  3ND8 A;  1WTR A;  1SE2 A;  4DXG A;  1TQO A;  2RKS A;  3PUX A;  2PW5 A;  1SNC A;  5FLX E;  1SMY D;  1BNZ A;  1EL0 A;  2K04 A;  1NCV A;  1IW7 D;  4EVO A;  1CA6 A;  1A15 A;  1K8M A;  3SR1 A;  1DOL A;  4XIG S;  3S1R B;  5I4D A;  5JVG 3;  3M7G A;  1Y8O B;  4KY5 A;  4WRD A;  2PZU A;  3FPP A;  2IX0 A;  2F0N A;  4XTC S;  2WB1 B;  3BYT B;  3E6Z X;  1EZ6 A;  3DM1 A;  1A2U A;  1V8Q A;  3OMG A;  3SVM A;  1DXM A;  1KAB A;  1SXT A;  3CRK C;  1EIH A;  4IUU A;  1LTS D;  2JA6 B;  4FXD A;  4EGV A;  4RHS A;  2A68 D;  1Y69 U;  2L55 A;  2WAC A;  2Q8I B;  3L7Z C;  2O2L D;  5KNC A;  1Q1E A;  3EVQ A;  3OIP A;  4U68 A;  3OIQ A;  1PFN A;  4ZQ3 A;  3C1E A;  4FXK C;  1STY A;  4PMW A;  4ZKB B;  4KV6 A;  2RSN A;  3DMU A;  2OXP A;  1LLR D;  2AWN A;  4LJZ C;  2EE1 A;  1G2S A;  1UAP A;  4C3I B;  5C4Z A;  4LAA A;  2IX1 A;  1D5M C;  4RA8 A;  1GHJ A;  1TS3 A;  2Z4I A;  3BG3 A;  2F0Q A;  4KTA A;  2DY7 A;  5DM7 3;  3NQI A;  5FLX L;  4QF4 A;  3SDZ A;  4CHT B;  3FMC A;  2B2Y C;  3BYY B;  3ZYY X;  1TWH B;  1A3V A;  1BXT A;  2XWJ B;  1YNN C;  1KLU D;  5IGC A;  1TWA B;  2ID0 A;  2FHT A;  1MI2 A;  1CQF A;  1M8A A;  4HTH A;  3P7J A;  4HCS A;  4X3K A;  4C2M B;  1EQV A;  2KOL A;  5JEA J;  5IGG A;  3J7A V;  1AW7 A;  2TSS A;  3QJY A;  1S5E D;  1U4L A;  2F0J A;  4EQO A;  2FIN B;  1EU4 A;  5K5P A;  4EQN A;  2PZT A;  3HRZ C;  2SDF A;  4BBS B;  1Y1W B;  2K33 A;  3X3N A;  2R93 B;  3O13 A;  2BA1 A;  2G9D A;  2R3Z A;  4CKE A;  2R6G A;  3BDL A;  4K2K A;  1B9M A;  3IAY A;  2HCI A;  3RMH A;  2XRQ D;  1EY6 A;  1I3Q B;  5CBE E;  5LHY 1;  1PRT B;  4C3J B;  2BA0 A;  3Q23 A;  4C3H B;  2V4D A;  4KN7 C;  3MHB A;  4EQP A;  5C4J B;  1BUV T;  1PRT F;  1MGS A;  1IL8 A;  1Y8P B;  3GV6 A;  1PFB A;  2NB0 A;  3A56 A;  4KKS A;  2B2W C;  3DUZ A;  2EJG C;  1LAC A;  1PRT C;  1TS5 A;  2EY6 A;  1X3P A;  2EDG A;  5FO9 B;  5DNF A;  4XT3 B;  3GTQ B;  2A6H C;  4R8N A;  2E2J B;  1IHZ A;  3T56 B;  3D4W A;  2H1E A;  3U9S A;  3C2P A;  1CK1 A;  3A7A B;  4OHJ A;  4Y7N B;  5ELC A;  1R4Q B;  1H9K A;  4H7B A;  4K8I A;  4OIJ A;  2LMC B;  3I73 A;  1LTA D;  1BCP D;  4KHV A;  5EGT A;  2JA7 B;  1RDP D;  3PUW A;  4WOR A;  1A3U A;  3R3O A;  1B3A A;  5C5L A;  1CT1 D;  1HUN A;  3MVV A;  3P20 A;  2L1B A;  2EY5 A;  2F0D A;  3ONA B;  1B4O A;  5CV5 A;  1H9S B;  1GHK A;  5CMD A;  4A3G B;  2QDB A;  2YYZ A;  1KDA A;  1TWG B;  1BR9 A;  1U9R A;  3VYT A;  3QIA A;  4DN4 M;  2MUY A;  2B2V A;  2F0T A;  4K5X A;  3BVZ A;  4MHE A;  1RF2 D;  1C4Q A;  3FPU B;  4L63 B;  2C9O A;  5E4X A;  3PUV A;  2F0W A;  1YNJ C;  1T5X D;  4ZYS A;  5JPM C;  1D6E C;  2KA7 A;  1KNE A;  1GJX A;  2BOS A;  4FF3 A;  4A93 B;  3R2T A;  3NPP A;  1HQM C;  4DFA A;  1SNM A;  5T1I A;  4OO1 I;  4NW2 A;  1LT6 D;  1HA6 A;  1HCZ A;  4RCO A;  5I2Y A;  1I50 B;  1AP0 A;  3M4O B;  2I46 A;  3T16 A;  1ZKO A;  1BOS A;  2Z1C A;  1VMP A;  1Z47 A;  1CHQ D;  2A5H A;  3PO2 B;  5E4W C;  5D3I B;  1U4M A;  2L9H A;  1A2T A;  5ELF A;  1F2Y A;  5D3D A;  2FMC A;  2AQ1 B;  1ESF A;  3EJI A;  4B08 A;  3EFX D;  4XT1 B;  4A3I B;  1WTO A;  1SE3 A;  5K36 H;  2A6E C;  4HSP A;  3GQB A;  1STG A;  3K5O A;  3I4L A;  5JJZ A;  4FP5 D;  2F0L A;  3N6R A;  1JOQ A;  2Y0S B;  2XVS A;  2SEB D;  5C5M A;  2EYM A;  2M2L A;  4ZRZ A;  5JEA G;  2K7V A;  1XXG A;  1I4X A;  1JQY D;  4HED A;  4IUV A;  2B2U C;  2LKV A;  1XYI A;  2VB3 X;  1TU2 B;  5G3L D;  2XSC A;  1E2Z A;  5CYU A;  3I4N B;  2WAQ B;  1RD9 D;  5DEH A;  1FD7 D;  4IUN A;  5LL6 S;  2OT2 A;  1KNA A;  1HXY D;  1L0Y B;  2XNA C;  3E0J A;  5ELE A;  1CA5 A;  3JAM E;  3PO3 B;  5IGB A;  3NBH A;  1SNQ A;  3AU7 A;  4HN7 A;  1STN A;  2K5D A;  1D5Z C;  4QCL A;  2Q8T A;  3QOL A;  3RUZ A;  4K14 A;  1ESR A;  2CW0 D;  1Y1V B;  1B50 A;  1PXU A;  1QNK A;  1WTW A;  1F9S A;  3TN2 A;  3IL8 A;  1GUW A;  1G91 A;  2PO4 A;  1S5B D;  2F0F A;  4H44 C;  1DYQ A;  1RJT A;  3BS1 A;  2D62 A;  1Q12 A;  3HOV B;  1SBB B;  2BCO A;  3HS0 C;  1R9T B;  3RD4 A;  3C3L A;  3ERO A;  1CZW A;  4P2C B;  3MA2 B;  1B53 A;  5BN4 A;  1UNS A;  2QF7 A;  4BY1 B;  3PIP 3;  1V1O A;  5FO7 B;  1J9O A;  2K6A A;  1CI3 M;  1PMR A;  1ZYR D;  5EPJ A;  4O1N A;  2QKI C;  4XXE A;  1MSH A;  3PV0 A;  1ET6 A;  2XWB B;  2EYO A;  2WIN B;  2RVL A;  4G7O C;  3S9W A;  1JIC A;  2J7Z A;  1CTM A;  2F0I A;  1W6J A;  4WJW A;  3H3V C;  1GUS A;  2B2Y A;  4DAP A;  4IAL A;  3JAM L;  4AYB B;  5I6W A;  2ZXP A;  4BY7 B;  5C0X H;  4DAV A;  1Q8I A;  3TME A;  4CGY B;  4CKB A;  2J0T D;  2JYO A;  4GZY C;  3EA6 A;  4K8J A;  1TR5 A;  1NSN S;  1Y8N B;  1ET9 A;  1CHP D;  2OEO A;  2GA4 B;  4S3S A;  3IKJ A;  1CFM A;  1JWM D;  1JOO A;  1BBX C;  1LT3 D;  3U9O A;  3TP6 A;  2A69 D;  5FO8 B;  2HDM A;  1AZQ A;  1ZXT A;  3BVG A;  5J1Z A;  2E75 C;  2A6E D;  4HR7 B;  4HSV A;  5COR A;  2F0G A;  2B2T A;  1X3Q A;  3S1N B;  3NWT A;  4CBV A;  3HOX B;  4RFB A;  3VA7 A;  1TWF B;  2O5J C;  4XDX A;  1MD2 D;  3KK7 A;  3A54 A;  1RHP A;  2A74 C;  2EYL A;  3MC0 B;  1SE4 A;  3TZD A;  2RA4 A;  4B9W A;  2F0P A;  1PZJ D;  4X3S A;  4C1N I;  4DNR B;  1EZ8 A;  2KEE A;  1G6Z A;  2X6L A;  1B2T A;  5C6A A;  3BDO A;  4ODG A;  1EY7 A;  3GTG B;  2EZV A;  2B2W A;  4CKC A;  5C3X A;  5IGE A;  3AMU A;  3CRL C;  3HOU B;  5COY A;  3A8J E;  5JOB A;  4JBW A;  1F2L A;  1FNU A;  1EY0 A;  2MP1 A;  3OSO A;  2NYZ D;  3I3C A;  3W3A A;  1JOK A;  1PTO D;  1CM9 A;  1KTK A;  1EY9 A;  5EKL A;  2KHS A;  2H4O A;  1EWC A;  2L0C A;  2L12 A;  3S16 B;  1FNV A;  1ILP A;  5AFW A;  3D4R A;  2EVB A;  3PUY A;  5EQ0 A;  1QIL A;  2SOB A;  3TP8 A;  1F9Q A;  4IFD H;  1S4Z A;  2JA8 B;  3NUC A;  4FF4 A;  3HZX A;  1G8Z D;  3CHB D;  4NKL A;  1AN8 A;  2VUM B;  4ZAI A;  3PUZ A;  3QG1 A;  2LS0 1;  2QIL A;  5T1G A;  5CC4 A;  1NR4 A;  1F9R A;  1JB3 A;  4KK7 A;  2D9U A;  4RH6 A;  4L8J A;  1LT5 D;  5IGF A;  3S1Q B;  1HA5 A;  1AFP A;  4UDU C;  1VDZ A;  2ZXO A;  1HUM A;  5C4H A;  1HFN A;  4KD4 A;  4RGN A;  2VXW A;  1H9S A;  1PDQ A;  2WII B;  5HUR A;  2ZXR A;  4Q5V A;  3DEO A;  3BZD B;  4FO2 A;  1TS4 A;  2B2T C;  2M00 A;  1O7Y A;  2WV6 D;  5J39 A;  5C4X B;  2NVQ B;  5EJW A;  1A3T A;  2IW3 A;  3MXG A;  3MXN A;  4CJ1 B;  4BBR B;  1Z6H A;  2K03 A;  3K59 A;  1E2V A;  4NDX A;  2NN6 H;  2F03 A;  3I72 A;  5IOD A;  1SYF A;  4Z9C B;  3S2D B;  5JVH 3;  5EKI A;  2RDG A;  2E2D C;  5ELD A;  5BN3 A;  3S14 B;  1GUN A;  2N55 A;  5FKA C;  2HQE A;  5IOC A;  1F2Z A;  3KBX A;  3IFD A;  5DM6 3;  3TBI B;  1F77 A;  1CQV A;  4KJN A;  1VF7 A;  3SK8 A;  2ICE C;  1B44 D;  2B63 B;  4K6D A;  2L11 A;  1LTR D;  1IYV A;  1DOK A;  4PMB A;  4I65 A;  5I9P A;  3GTM B;  4R9W A;  4FXG C;  1X32 A;  1QOH A;  3AB9 A;  5JPN C;  1IKM A;  1L0X B;  1QNU A;  2B2U A;  5KEE A;  3T51 B;  1TII D;  2JSO A;  1ROD A;  4NMZ A;  1E0B A;  1OXV A;  3T4A C;  1GUG A;  3NTI A;  3P1H A;  2RSO A;  5C3W A;  3R2I A;  3MXU A;  2D5D A;  5DAU A;  3KLR A;  1WD0 A;  5KND A;  2NVT B;  1ENF A;  1TKW B;  2MJ8 A;  5A2Q E;  1VCI A;  2F0H A;  3SHL A;  5I6Y A;  4MN3 A;  3DWP A;  2Z4H A;  1EY5 A;  5FK9 C;  4IN3 A;  2G9H D;  1EU3 A;  3HP3 A;  1Z7T A;  4A3D B;  2D2C C;  1OO9 B;  3GTL B;  2CHB D;  1HPC A;  1U4P A;  2FJ2 A;  4DA2 A;  2JE6 I;  4FVM A;  4KY6 A;  5CV8 A;  3NWS A;  3HEJ A;  1XWE A;  4DU9 A;  4X3U A;  4QUC A;  5M9O A;  3MXP A;  1WTV A;  2A73 B;  4ABN A;  3RZO B;  1IYU A;  3VYS A;  2BE5 C;  4XYO A;  2SNS A;  3MWY W;  1SMY C;  4XYQ A;  4KD3 A;  3S2H B;  1YNN D;  4RGO S;  4C3I G;  2EYJ A;  2L4N A;  3SE0 A;  4DNT B;  1GUO A;  2YU9 B;  3HKZ B;  1EOT A;  1ENC A;  1BO0 A;  2R92 B;  1FNW A;  1NUC A;  3K6O A;  3Q6S A;  3CKI B;  1STH A;  1FYC A;  3SK5 A;  3IFT A;  3VYU A;  4A3M B;  1UUP A;  1S5C D;  3DWQ A;  4BA1 I;  3SXH A;  4KMU C;  5D14 A;  1WCM B;  5CBA E;  1HTL D;  2EY1 A;  1DON A;  1EEI D;  2PMZ B;  2I07 B;  3MEH A;  1TY0 A;  4IUR A;  2J4X A;  4IQZ A;  1WVL A;  1EYD A;  1EYA A;  4K5W A;  2XRS D;  1HQR D;  4PMC A;  3MFY A;  2TMP A;  5I9O A;  1QE6 A;  2A68 C;  5A2Q L;  3WOE A;  3QWN A;  5NUC A;  3NE5 B;  3V05 A;  3TDQ A;  3M3Y B;  2RDH A;  3K5M A;  3FVQ A;  3KF8 A;  1B1Z A;  1PRT D;  1A6X A;  3G6J B;  2EOT A;  2PZW A;  2PQE A;  2O4X A;  2KCC A;  3GTJ B;  3QOJ A;  2L5T A;  1GOZ A;  1QCB D;  2K5W A;  2A6H D;  3GTO B;  1DM0 B;  4C3J G;  4XQQ A;  1ICW A;  5C0X I;  4C3H G;  4FYD A;  2K1B A;  5ELB A;  5C3E B;  1G2T A;  3L3O C;  1MSG A;  2NWG A;  1UEA B;  5C0X J;  3D4D A;  4J6H A;  3A8K E;  1SYG A;  4DAY A;  2AWO A;  4N9T A;  2E2H B;  2K32 A;  4HAE A;  4PNY A;  4Q0F A;  4A3K B;  5FOB B;  4TSS A;  3DXJ C;  1TT2 A;  1OXT A;  1KLG D;  2LY7 A;  2JEB I;  1I6V C;  2IJ0 A;  4ILW A;  1EWH A;  3PMF A;  4TRD A;  3M4Y A;  3ITP A;  1MBY A;  1H9J A;  4ID6 A;  2PW7 A;  3D3R A;  3NQT A;  3ND9 A;  2R61 A;  2KUM A;  1F2M A;  2CVR A;  4RAU C;  4KKT A;  1O7L A;  4F7X A;  3J81 E;  2F0V A;  2RDF A;  1B9N A;  1SND A;  1V1P B;  4RWS C;  2E76 C;  2F0M A;  2KED A;  4A3F B;  1ENA A;  1RTO A;  3HOY B;  3LWU A;  4DK1 A;  4F88 A;  5K36 G;  1SNP A;  1YNJ D;  4RKB A;  3D6C A;  1II3 A;  2MGS A;  2F0O A;  3MZ5 A;  3J80 E;  4ZKC B;  1EEF D;  1I4P A;  1K8O A;  4BWG B;  3K5N A;  3GD7 A;  3K0Y A;  3C1F A;  1KAA A;  3OWF A;  4G4K A;  3S15 B;  4YIJ A;  2WKD A;  3OWE B;  4ZUJ A;  3R93 A;  4KI0 A;  4C56 C;  2X6G A;  1PZK D;  2NTS A;  2BE5 D;  1QB5 D;  1LO5 D;  3TP7 A;  1WTP A;  4V19 0;  2Z8L A;  2ICI A;  4C1N K;  3I90 A;  2B39 A;  2XN9 C;  1PZI D;  4HCE A;  3FDT A;  2EYP A;  1PYW D;  4OO1 G;  2F3W A;  2EYH A;  2AUK A;  4V0B A;  1BCP B;  2ZT9 C;  2DY8 A;  1BCP F;  2DNC A;  4IFD I;  3KLS X;  4BS9 A;  1D2B A;  3HG9 A;  1KDB A;  1JR0 D;  5IT9 E;  3OPO A;  2PNR C;  4CJ2 C;  1BQQ T;  4IFD J;  5HGT A;  3OMC A;  1BCP C;  3PIO 3;  3Q0A A;  3LX0 A;  1EQT A;  3L9A X;  2X69 A;  2B8F A;  3QO2 A;  4IUQ A;  3VR2 A;  2EXZ A;  1R4P B;  4ZK9 B;  3T13 A;  3J81 L;  3D31 A;  4XQJ A;  2HUG A;  1O7Z A;  5A35 A;  5M3F B;  4QB4 A;  3GP7 A;  2NBF A;  2F0K A;  1FR3 A;  5M3M B;  3MFG A;  1JWS D;  1GXD C;  3FKI B;  3N52 A;  1D5X C;  4RCN A;  3T53 B;  1LT4 D;  4MIU A;  1WTQ A;  3SEB A;  3J80 L;  3RZD B;  3OW7 A;  3MTS A;  1LTT D;  2HDL A;  2NN6 I;  2BDN A;  5CR3 A;  3V96 A;  1H9R A;  4KHZ A;  4F87 A;  4A3J B;  3VR5 A;  4HMJ A;  2E2I B;  2FFK B;  2F0E A;  2EPB A;  2NUC A;  2KCN A;  3LNN A;  4PQX A;  2ENB A;  4X3T A;  1HRJ A;  4E6I A;  3TSS A;  1K83 B;  2K5Q A;  2WKC A;  4KKU A;  4LK1 C;  3NSW A;  1SNO A;  1GUT A;  2IX3 A;  4WFN 3;  5C0X G;  5IT9 L;  1U4R A;  2IT1 A;  4K2L A;  3HOZ B;  1SJE D;  5E1F A;  5M5Y B;  3M7N A;  1NR2 A;  3F2U A;  4G7H C;  1QWY A;  3Q22 A;  3M85 A;  4KJO A;  2IWH A;  5KIX A;  1C8C A;  5ISR A;  1J8I A;  1STB A;  1QJO A;  3NHH A;  3X3M A;  3QB3 A;  2E74 C;  1ILQ A;  2HCC A;  5G3L F;  3CQZ B;  1ZEQ X;  1IKL A;  2KEC A;  1F9P A;  1VF5 C;  5TSS A;  4K6L A;  2EJM A;  1VMC A;  3GTK B;  3VA5 A;  1TVX A;  2F4I A;  3NK9 A;  3A8I E;  4BA2 I;  1HFG A;  2Q8R E;  1RKN A;  2JP1 A;  3G7L A;  3H0G B;  1DOM A;  1OXU A;  3I70 A;  1TWC B;  2AUJ D;  3H94 A;  1LAB A;  3HGB A;  3TZU A;  4IUP A;  2PCF B;  4QIW B;  4B9X A;  2MHV A;  1S5D D;  4RGM A;  1SYD A;  3SK4 A;  2K28 A;  1C48 A;  5KNB A;  2XIW A;  1DD2 A;  3S1M B;  2CW0 C;  4H0L C;  2IPK D;  2RBM A;  1I4R A;  5JEA H;  1JE4 A;  1FGB D;  4TQU S;  3BDC A;  2IL8 A;  4IZ8 A;  4FF1 A;  1CZG A;  1EYC A;  2F0U A;  1BDO A;  3OHX C;  4L6T B;  3J7A F;  3H6M A;  4J8Q A;  2F1M A;  2NZ1 D;  4ZUI A;  3DEP A;  2R7Z B;  2KVM A;  5CV9 A;  4OGQ C;  5EKK A;  3A7L A;  1DJR D;  1STA A;  5J22 A;  4NP5 A;  2VB2 X;  2F0S A;  2K01 A;  4ULL A;  4IFD G;  4DK0 A;  1LTI D;  1G29 1;  4RGT A;  2PPB C;  3SK6 A;  3VR6 A;  3VYR A;  4PV1 C;  3W2D A;  2JXM B;  1SYE A;  3R8B A;  4K5V A;  5KYI A;  1ZYR C;  2KQ3 A;  3OOC A;  1LTG D;  3K7A B;  2VNU D;  4LMQ D;  4JK1 C;  4KY7 A;  3MAQ A;  3H91 A;  2OF1 A;  5KRU A;  4OL7 A;  1ML0 D;  5F2D A;  1JWU D;  3GTP B;  5JAV A;  2QCP X;  3WOF A;  4H13 C;  1RCV D;  2PYK A;  5LL6 X;  5EBD A;  4A3E B;  1SFO B;  3A55 A;  2NVX B;  1I4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...