5D65A

X-ray structure of macrophage inflammatory protein-1 alpha (ccl3) with heparin complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
b'SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 3
publication title Structural basis for oligomerization and glycosaminoglycan binding of CCL5 and CCL3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 13
structure length 68
sequence length 68
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5d65A00
1X3PA 5E4WC 1MI2A 1WD0A 2L1BA 1DOLA 1EL0A 2KOLA 1X3QA 2EPBA 1ICWA 2N88A 2X6LA 4IUUA 1SAPA 1RJTA 2FJ2A 1MGSA 2B2VC 1RODA 2K04A 3DEPA 1XYIA 1E0BA 3D6WA 3H91A 2RA4A 1MSGA 1ML0D 2B2VA 1BBXC 1HUNA 2K01A 1VMCA 2B2TA 1GUWA 1X32A 1U4PA 3MTSA 4XT1B 1IKLA 3GV6A 1RTOA 5DNFA 1PFNA 5EQ0A 2RSNA 1WVLA 5JJZA 1ESRA 3G7LA 1IKMA 4XDXA 5CMDA 1PFMA 1B50A 1QG7A 1SSOA 3P7JA 1J8IA 3R93A 1O80A 4NW2A 1IL8A 1WTRA 1RHPA 2H1EA 1NAPA 2HDLA 2JP1A 2B2UC 3F2UA 1Q3LA 1WTOA 4IUTA 3ONAB 4MN3A 1ZXTA 4LMQD 1HA6A 2B2UA 5EJWA 2HCIA 2MP1A 2NYZD 3HP3A 4ZKBB 3FDTA 4R9WA 4RWSC 1KNAA 4CJ2C 1PLFA 2N55A 2BDNA 1F9RA 5COYA 2L4NA 5D14A 1B53A 5AFWA 1M8AA 3LWEA 1BO0A 2L9HA 2X6GA 4HAEA 4HCSA 5CBAE 2Q8RE 1WTVA 1EQTA 4RAUC 1B4OA 2KEDA 5EKIA 1ILPA 3I3CA 1AZQA 1AP0A 4OIKA 2KVMA 1SDFA 1TVXA 2VXWA 5CORA 1B3AA 3Q6SA 5D65A 4ZLTF 1BNZA 2NWGA 2K28A 2EE1A 1CA5A 2FHTA 5T1GA 2SDFA 3IFDA 2K1BA 4CJ0B 2K05A 2K03A 2EOTA 4IUQA 1WD1A 3KUPA 1HFNA 1HUMA 5T1IA 1WTQA 1O7YA 1F9QA 3IL8A 4CJ1B 2MPMA 1U4RA 1F9SA 1O7ZA 3QO2A 1DZ1A 1KNEA 1PDQA 1EOTA 2B2WC 3I91A 1XX8A 2D9UA 2HDMA 2R3ZA 4HEDA 1WTXA 1G2SA 2Q8TA 1G2TA 4ZAIA 1BF4A 1S4ZA 3UI2A 2RSOA 2X69A 4OIJA 2FFKB 4IURA 4O42A 1JE4A 2JYOA 2M2LA 1NR2A 4ZKCB 1CA6A 1F2LA 2MJ8A 4X3KA 4DN4M 3I8ZA 1NR4A 2CVRA 4X3SA 2L12A 1WTPA 2J7ZA 4X3UA 4HSVA 1A15A 1PFBA 1RTNA 4QUFA 5CBEE 1WTWA 1HRJA 4IUVA 1EIHA 1J9OA 3DM1A 1U4LA 1HFGA 2RVLA 2DY8A 2KEEA 3I90A 2HCCA 2B2TC 2DY7A 1LV9A 3TN2A 1MSHA 1QNKA 1HHVA 1F9PA 3SVMA 3FPUB 1DOMA 2L11A 1VMPA 2KECA 4R8IA 2HUGA 4XT3B 4MHEA 5EPLA 3TZDA 4U68A 2FMMA 2B2WA 4UAIA 1AZPA 1EIGA 1NCVA 2NZ1D 1DONA 1QE6A 4X3TA 1B2TA 4QUCA 1JICA 3GV3A 1G91A 5EPKA 2FINB 3DEOA 2XIWA 2IL8A 2MGSA 4IUPA 5E4XA 5EPJA 4ZK9B 3N52A 1ILQA 4RA8A 1C8CA 1DOKA 2B2YC 1CM9A 3KBXA 3MWYW 2KUMA 1G6ZA 1U4MA 2B2YA
chains in the Genus database with same CATH superfamily
4JI3Q 3TS0A 4WORA 3S15H 3S14H 3S17B 2WP8J 4A3EG 3RD4A 5IY0A 3MEHA 2Z0SA 3V96A 2F0EA 1K3RA 1NNXA 2QEJC 2WAQB 3CF5A 4DUYQ 1PMRA 1PTOC 3MTSA 5C44H 2F0MA 1A3TA 3OHXC 3H15A 3VYRA 3P7JA 2F0TA 2ZXOA 5IGDA 1P16A 1WTRA 2D0PA 4AYBE 2EZVA 1GHKA 4BY7H 1KD1C 5BR8L 4XQJA 4LK1C 4LUOA 3KK7A 5IIFA 3VR6A 1KNAA 1WYDA 3VR2A 3S2DB 1NMFA 2PNRC 1EY8A 2AWOA 2OTLA 2JA7G 2WAQE 4GOPA 4NDXA 2A73B 1K0SA 3CC4A 3FHWA 2QILA 2RDGA 1EQTA 4UP9A 5CV7A 1HR0W 2I0QA 2KEDA 2LY7A 1XMQL 2F4IA 1Y1VH 3U50C 3Q24A 2VXWA 1Q86C 4DV7Q 2K28A 2SNMA 3OWEB 4HIDA 1IL2A 4CDDC 1WD1A 5IGFA 4L5TA 4A3GH 1HFNA 3KUPA 2E2HB 3TEHB 4XYQA 3TP5A 4K5WA 3K7AH 3UDGA 1HJPA 1WOCA 1PTOB 2WV6D 3U4ZA 3GTQH 2BOSA 4DF7A 1V1QA 2NTSA 2Z6KC 1YITA 2KCCA 1PTOF 1T5XD 1KDCA 2EQSA 2QCPX 4DUZL 4FO2A 1PYBA 1LM0A 3STBC 5C4XH 4KD4A 1B8AA 4OWWB 3FKIH 4A3FH 2N3SA 1UEBA 1ZEQX 3SE0A 3K5OA 5EPLA 2K50A 2FMMA 4LFAQ 5IYBH 1X9NA 2IL8A 2EYHA 2YV5A 5FO9B 5IT9L 1YJ9A 4FYDA 1TS2A 2ZM6Q 2ATWA 4L5RC 1MI2A 1TQOA 2IT1A 4JI4Q 1DOLA 2DNEA 4DR6L 4L5SA 2JN4A 2JA7B 4GKJQ 1FJGL 4CHTB 1VQLA 1MD2D 3MXUA 4PZ7A 4WJ4A 2Z1CA 3T56B 3HOVH 2B2VA 5IYCH 1AE3A 1VMCA 3F2BA 4KHPQ 3JC66 1RTOA 2RSNA 1EUJA 2EJFC 4EQPA 5KYLA 3NENA 1S5BD 3CPFA 4C56C 2ENBA 1STEA 3KF6B 4LF9Q 4JI6L 4A3CG 3KLWA 3L7ZC 3OTOL 3J7AF 5IWAQ 1GOZA 4LMQD 2F0JA 1X6OA 4YCUA 4A3DG 5F2DA 2E2JH 4QMGA 3I4OA 2AQ2B 1W6KA 3OIPA 1VQIA 4IOCA 4TKOB 5HURA 3S17H 4JYAL 3RLNA 5IP9G 1VQNA 2NB0A 2UUBL 1HR0L 1AP0A 1I3QH 4XYOA 1TVXA 2F0HA 1PZKD 2F0LA 1H9RA 5C4JH 3MFYA 2RHQB 3CW2C 1N9WA 4GN3B 2FHTA 1XPUA 1QWYA 3KDFA 1IYJB 1TWFH 3HKZB 1WTQA 4K0KQ 5M9OA 2RKSA 3CAMA 1JWSD 1TWGH 5FLMH 1PZID 5C0XG 3RNUA 4U673 1Q7YC 3E5SA 1WTXA 1G2TA 1HZBA 4XXEA 3UI2A 2IPKD 3FP9A 2A19A 3S2DH 1Y1WG 2A8VA 1NR2A 1HTLD 1F2MA 3CRKC 2VQFQ 3LNNA 1XXGA 4PV1C 3VR4A 3T1YL 1FGUA 2HHHL 3PO3G 2E2IB 1KLUD 5DM73 2KCMA 4B3RL 3UDFA 4IFDG 1GXDC 3W5OA 4P72A 1C7YA 2JEBI 3J81i 1SYDA 1LV9A 3K8AA 1ZYRC 3K5LA 4IJHA 2F03A 3ERQA 5CYUA 2NVTB 1KQSA 1MHWC 4IOAA 3VA7A 3HOZG 4DPGA 2VW9A 5EPJA 2NBFA 1SE8A 3A7LA 4A3DB 4MNOA 2PZTA 1R9TH 2ZXPA 2B2YA 3RUZA 4LF4L 5KNDA 1II3A 1YHQA 1KRSA 1RJTA 1NTGA 2YTXA 4K2KA 2F0KA 3HS0C 1VQFA 1SXTA 2K5HA 3BYTB 4YY3Q 5AJ3Q 4DV3L 5EAYA 2E5LL 2UU9Q 3AEVA 3J7YW 4DV2L 5G3LD 1Z47A 2Z4HA 2A74C 3GQBA 2OQKA 5JJIA 4HN7A 5FOBB 4EVOA 1YI2A 3BDLA 4QB4A 2O4XA 2VS1A 2ASBA 3I2ZA 1JB3A 5EJWA 4XQNA 1RDPD 4RHSA 2JEAI 1Q46A 5M3FH 2JXMB 1JJ2A 2KHSA 3IFTA 2PQAB 4CDCC 3RZDB 1TY2A 2L4NA 1B53A 1Y1WB 2R93G 2EY5A 5EKLA 2JA7H 3L3OC 1A62A 3RZOH 3PO3B 1D1KA 1P8LA 1SMYC 1TS5A 4YHHL 2MQHA 1QCBD 3VA5A 4DR5Q 4DR4Q 5JPNC 2F0WA 4C3IG 1U4RA 4Y7NH 1BVSA 3DWAA 4JI8Q 3JAML 3HOZB 5HGQA 1F77A 4B3SL 3VDYA 2X69A 5GAGC 2CHBD 4IFDI 4OO1I 2F0UA 5BN3A 5GAHC 3IKJA 4A93G 1F2LA 2OQ0A 4RFBA 4KKSA 1EWIA 4J8QA 5G3LF 4IO9A 3I4MG 1G291 1WTPA 1VQMA 1M90C 4QUFA 1N34Q 1V9PA 1L1OA 1HRJA 1SYBA 5E7NA 4A3MG 3C2PA 3H6MA 1Y14B 4IN3A 4C1NK 1EYAA 2KECA 2A5HA 4RGOS 2UUAQ 2NZHA 4DAMA 4LF8Q 1K8MA 4A4IA 2UXBQ 4JK1C 4RCOA 1ESFA 2PNHA 1WCMH 1VQ7A 3PV0A 4OWXB 1VF7A 2MGSA 2F0OA 1DOKA 2KUMA 2JJQA 1CQVA 2EYLA 1HNZL 3FPPA 2UXCL 1NE3A 2K32A 1A3VA 2KOLA 4TSSA 4JI3L 2R93B 1LT3D 5KGUA 2HD3A 2Z9HA 1QB5D 1HZAA 1TIID 2E2IH 4F88A 4N9PA 1E2VA 1Q8KA 1C4QA 3CPWA 3HOXG 4DUYL 3I72A 1FD7D 3G7LA 1XNRQ 1G8ZD 2B8GA 5CV5A 4C3IB 1STGA 5ELEA 3OMGA 2JA8B 1MBYA 2F0GA 3PIPA 3J80i 2BA0A 3G6EA 3BDCA 1KAWA 5KRUA 1TU2B 2B63G 3FDTA 1TR5A 4N8X1 3J7AV 5IP7G 1PLFA 1EZ8A 5D14A 5AFWA 4HJAA 1I6VC 1M8AA 4KV6A 4A93B 1BXTA 1QOHA 1CHPD 1KLGD 5FJ8G 3H3VH 3I4MB 4AH6A 4TQUS 3S1NH 1HNXQ 1H9SB 4A3MB 3AYHB 4X65Q 3CMAA 3U9OA 1Q81C 5K36G 2JE6I 4DV7L 2PI2E 3K0XA 5T1IA 2DUDA 2IHFA 4UPAA 1WJJA 4FXGC 1EFID 5LMNL 1FL0A 5K5PA 1CKNA 3M9BA 3L0OA 2CQAA 2D0OA 1G2SA 1Y8OB 1I94Q 4DR3Q 3MXPA 3CHBD 3RZDH 2XSCA 2RHSB 4PNYA 2KCTA 3D4WA 3NBHA 2DNCA 4DN4M 1C48A 1XPOA 1C0AA 3HFZB 4R8NA 3FVQA 3UE1A 1TWHB 1H9SA 1S5DD 1HFGA 3F2CA 3I90A 3HOXB 2FMCA 3K57A 2KJXA 2RF4A 1A8VA 1IZ6A 5KNCA 2PQEA 1FNVA 2Y0SG 2R7FA 4LFAL 1QUQB 1EYDA 2WB1G 2B63B 3T4AC 1CKOA 5C3EB 5DEHA 1EWCA 2EYJA 1FNUA 2ZM6L 4K8IA 2F0SA 2AMCB 4RG1A 3PO2H 3BVMA 1EY4A 4JI4L 2IX1A 2X6LA 5ELNA 4H7BA 2K5VA 1I4GA 1VQ8A 3D6WA 2RA4A 5I9PA 2LMCB 5JJZA 4KHPL 1YNNC 1QZHA 2D62A 2IWHA 1PFMA 1CK1A 4G4KA 3CCSA 3OOCA 1IL8A 1RHPA 3AFQA 4LF9L 1QUQA 2VNUD 3GTKB 4IFDJ 2ES2A 2DGYA 2OXPA 5IWAL 2ALYB 4KI0A 1EYCA 1Z7TA 2ZJQA 1K8OA 2WFWA 1BBUA 4EQ5A 4A75A 1GJXA 1JOOA 4OL7A 2K5DA 1JOKA 4BBSH 4QCLA 1X3EA 5I6YA 1PYSB 3Q6SA 4ZCKA 1OXTA 4JBKA 1I4HA 3M3YH 2ZXRA 1PH9A 2K1BA 3GTPH 5LHY1 1CUKA 5JEAH 2K33A 5IGGA 2LSSA 4K0KL 2JA8H 2JA6G 2C5CA 1BBWA 4BS9A 2WB1B 4LJZC 3TRZA 1G6PA 5DLQE 1QILA 3EN2A 2PCFB 5FKAC 4KMUC 1L0WA 3I4NG 4H13C 3VR5A 2VQFL 4DV0Q 3SGIA 4BY1B 4JI1Q 4X3SA 1Q8IA 3SDZA 1XTCD 3J81L 3I4MH 1TKWB 3NTIA 1AFPA 4A3IG 3M7NA 3OW2A 1SR3A 1N32Q 3IAYA 1D7QA 3FEWX 5CV4A 4L63B 2XRSD 5DAUA 3NHHA 1XJVA 2RBMA 1QVGA 1E7ZA 2WB1E 4XIGS 4YWLA 4A3JG 4QUCA 2EY2A 2EJGC 1ZKOA 3N52A 2UXDL 1KDAA 1CM9A 4JI0Q 4R4IA 1W2BA 4XTCS 1U4MA 3SK5A 1X3PA 1SFOH 4F8MA 4F87A 3A56A 5J22A 1EWHA 1X3QA 1SEBD 3RLOA 4G7ZC 1B9MA 4KLKA 1XPRA 1M1KC 1Q12A 4KY6A 3HOWG 4GKKQ 1QNUA 3H0GH 1TWHH 3I73A 4YY3L 4NXMQ 4X66Q 3MXNB 4BBRG 2UU9L 3A8KE 2CH4A 3HOXH 4XDXA 1STAA 3OYYA 4RGTA 1QG7A 1JCKB 4DV4Q 4R4CA 3A8IE 3R8BA 2CH4W 1HQRD 2JA6B 1NAPA 4MTNA 4QJFA 4CDEC 1LT4D 4B9XA 1PVOA 5CV9A 4OWTB 1BQQT 1F9RA 5C3EH 3TP8A 1CTMA 1HA5A 4KK7A 4AQYQ 1PTOD 3PF5A 3I4NB 1HZCA 1RIPA 3SK6A 4A3IB 1D5XC 1CFMA 2EYOA 3D4RA 4CBVA 4APVA 2EE1A 5LMUQ 1CA5A 3IFDA 1A2UA 2K5WA 3GTMB 2HQLA 4J15A 4DR5L 4DR4L 1FYCA 2MHVA 1OTCA 1F9QA 3HEJA 2XNAC 4YWKA 2EYPA 2F0FA 1V1OA 3QO2A 4A3JB 4DV1Q 3GTKH 4OGQC 5E3FA 4JI8L 3SXHA 4IURA 5ELDA 3RR5A 1TY0A 2DN8A 2VZAA 1N33Q 2L12A 2H4OA 5A2QL 1XNQL 4P2CB 4RKBA 5CBEE 4A76A 4IUNA 1J5EQ 3S1QH 4IUVA 3M4PA 1J9OA 3HOWB 1N34L 1BOSA 2YTVA 4K14A 3F2DA 4BBRB 3OWFA 2F0QA 1YEZA 4UP7A 4DAPA 1JWUD 1VS0A 3T53B 5EGTA 1PRTC 2B39A 1BCPC 2JA5G 5KEEA 2UUAL 3S16B 4LF8L 2F0PA 4MTKA 2UXBL 4KHVA 2OTJA 3EA6A 4A3EB 3STBD 3A74A 2PW5A 5M5WB 2HQEA 2EPBA 4YIJA 1SAPA 2NN6H 5I2YA 1HCZA 4BY1H 3O13A 1MJEA 1EIYB 1TS4A 3WOEA 4PZ8A 3S2HH 4C3JG 4HSPA 3J80L 1XNRL 2YU9B 1M4VA 1JB7A 4N9TA 3F2UA 3GTOB 1EQVA 2NTTA 3NP8A 4MN3A 2O5JC 2VY3A 1HA6A 4QQBX 5M3MG 2VUMH 2F52A 1WFQA 1OXXK 4ZQ3A 2SNSA 1QVCA 2A1AA 3P1HA 4X64Q 3JAMc 2ZTCA 3RMHA 4KY5A 1Q1BA 3ERSX 5EKIA 1B3QA 1TWAB 3CQZB 1TWCB 2Z8LA 4EGVA 1SNOA 1HNXL 2NWGA 3S1RB 1PA6A 4N8FA 4R4TA 1VQBA 4X65L 1HTPA 2O5IC 2CWAA 2K14A 1O7YA 4C2MB 4POFA 4CKCA 2JA5B 3A5UA 1LTRD 1KHIA 1KNEA 3HOYH 4HEDA 3UDIA 4YCWA 1X55A 4DR3L 3MZ5A 1JE4A 1GKHA 1SNCA 2Z6KA 3G4SA 3TSSA 1U0LA 1PH1A 4B3MQ 2L0CA 3I4NH 2EY6A 1HQMC 2EY1A 1FVIA 4HSVA 4OELB 3KF6A 5JJLA 3CXCA 4C3HG 1GUTA 1IBKQ 4NP5A 1MSHA 2TSSA 3MHBA 3GTMH 1EFWA 4DNTB 3TP6A 2HUGA 2V4DA 2B2WA 1NCVA 2EXDA 3PCOB 1CT1D 5JAVA 3JAME 2UUCQ 1VQAA 2Q2IA 2Z4IA 3GO5A 3KJOA 5M3MB 1UAPA 2I5MX 4KD3A 2O2LD 1JR0D 1SJED 1YNJC 4ZKCB 5ISRA 1AW7A 1G51A 4DR7Q 4A3KG 4QGUA 3BZKA 3PQIA 4OO1G 2FJ2A 1W6JA 5IGEA 2K04A 3M7GA 1ZYRD 1LUZA 3MEFA 1SRUA 1R4PB 1PH6A 3AB9A 3HOWH 1T9HA 1X32A 3I70A 2E2HH 1AN8A 4J1MA 5BN5A 3BVZA 4OONA 1PTOH 4JI5L 1GUNA 3R93A 5C6AA 1N8RC 1VQCA 4E6IA 2LS01 2K4KA 1JE5A 4UP8A 3TDQA 2JK8A 4RWSC 1BDOA 4L8JA 4A3EH 3UDXA 3A54A 1LTBD 4G7OC 1D2BA 5M5WH 4DAYB 3NELA 4DFAA 4BXXG 1CSQA 4IQZA 4I7AA 4WJWA 3URYA 4DK1A 3ZJYC 5JVG3 1D5MC 2J4XA 4ZYSA 4JOIC 4R1JA 3KLSA 1DXMA 1L1OC 5M5YB 4C3HB 2K52A 5C5MA 2I5LX 3G6JB 3RN5A 2EXZA 3OW7A 1N36Q 1LTSD 1O7ZA 1I50B 3I91A 2D9UA 1SNQA 3RLFA 3E0JA 4ZAIA 1LT5D 3A55A 3D3RA 2FFKB 4O42A 4A3KB 3DHQA 4K5XA 3T1HQ 1SMYD 4DAYA 2RDFA 3NE5B 1SE2A 4I7ZC 2CVRA 2IX3A 4DV0L 4JI1L 3U9SA 5C5LA 4DKAC 4YCVA 3CQZH 4DK6C 1TWCH 1N32L 3R2IA 4Q5VA 3S1RH 2Q2TA 1JC7A 3QIAA 4EX5A 5J3BA 4R8IA 4P74A 5BN4A 4C2MH 2OF1A 2PQAA 4GLXA 4B08A 4RA8A 3UE0A 3S9WA 1I6HB 4V190 1LTLA 5I4DA 3KF8B 3H09A 3WDNA 4JI0L 4RGMA 2IY5B 1AE2A 4KKTA 4IPGA 1YZ6A 1PFSA 1E0BA 4I65A 1CKMA 2AQ3B 4OX9Q 3OIQA 3QB3A 1IW7C 5DNFA 4POGA 2CKZB 3W2DA 4X66L 3DWQA 2AUKA 1ESRA 1VQ4A 1SROA 1V1PB 1EOVA 3MFGA 1SSOA 1K9MC 3GTGB 1R4QB 1NBWA 2BH8A 4DV4L 1VQOA 4MIUA 4JVZA 1JOQA 1IYVA 4O2DA 2B2UC 5A35A 2LKVA 4R4OA 2HCIA 4A3LG 1GVPA 2E8GA 2XWBB 4O1NA 1HPCA 1OXVA 3MC0B 2LFNA 3DUZA 2IHEA 4AQYL 4RMFA 5LL6X 2A6HC 1RCVD 4Z9CB 4KN4C 3SK4A 5I6WA 4B9WA 3NBIA 1V43A 5M5XB 2NVTH 5LMUL 1EY7A 4FNFA 2QA4A 1SMXA 4A3CH 1LTGD 5D3DA 1TT2A 5KNBA 4A3DH 1SNMA 3TREA 1EOTA 1K3BC 4DV1L 4AIMA 3L9AX 2L5TA 5IP9H 2WKCA 4O0AA 3NEMA 2K6AA 1LACA 1S40A 4ZUJA 3I8ZA 1N33L 1BKBA 4LWCA 4KHZA 3KJPA 4R4QA 1FJGQ 3ICEA 2YTYA 1J5EL 5JJKA 2RVLA 3I56A 1YVCA 5M5YH 1O7LA 3MA2B 1PH3A 2PI2A 2XWJB 5C44G 5C0XH 4KJOA 1SE3A 5CV6A 2R92G 3CCJA 2R61A 4GNXC 1QVFA 2GVAA 3K58A 1SN8A 4ZK9B 3C46A 3CMEA 1Y1WH 2L15A 2SEBD 4JBWA 1VDZA 2Q8IB 5FLXL 3PO3H 4PMCA 3X3NA 3BZCA 4PMWA 4IFDH 2B29A 1MSGA 2XRQD 1BBXC 3W1GA 4DR2Q 1KC8C 1Y1VG 3EVQA 1IKMA 4X62Q 3KLSX 3HOZH 3CCUA 2RCFA 3CCMA 2NVXB 4OHJA 2C35B 1UUPA 3M4QA 4K8JA 5IYDG 2ICEC 4WJ3M 3BVGA 3A7AB 1CZGA 3PUZA 4GKJL 1S5CD 3NXWA 2K75A 1KAAA 3M4OB 2Q8RE 4K2LA 4HMJA 1YNND 3S15B 4LUVA 1OXUA 5CORA 3PSIA 1RL2A 1PH7A 5CR3A 5C4XG 1B70B 2BDOA 1A3UA 4IUQA 4HIMA 4PMBA 2IW3A 1HUMA 4JBJA 4ME5A 3FKIG 1SNDA 2R92B 4A3FG 1LO5D 1SJHD 3PIP3 3EBEA 4IALA 1RKNA 2WINB 4DR1Q 3K5MA 1BF4A 4H0LC 2F0VA 2KBNA 1ICFB 1S4ZA 5IYBG 2MUYA 3WWVA 2R93H 1UE6A 2VB2X 1EQQA 2M2LA 1D8LA 4RCNA 5E1FA 2J0TD 2EVBA 4X3KA 1NR4A 4B3ML 1RTNA 1VQHA 4C3IH 5IGBA 3HOVG 4DV3Q 5IYCG 2HCCA 1Y1VB 2Y0SB 3OSOA 4LF7Q 4NPSA 1IBKL 4NB3A 3S24A 1NY4A 3FRPB 4XT3B 3J80c 5KIXA 1E1OA 1W3SA 1VQJA 4LFBQ 5EPKA 5C3WA 3HOYB 2RCNA 2UUCL 3ZYYX 3D0FA 1ILQA 5IT9c 2OWOA 3NPPA 4A93H 1LTTD 1PHJA 2AWNA 2M9VA 4LF5Q 1WD0A 2L1BA 1JWMD 4DR7L 3EIVA 3HRZC 4OEMB 4BWGB 2Z6BA 3CCEA 4A3MH 2A6EC 2Y0SE 5ELBA 3L2PA 2B2TA 4FVMA 4KN7C 3KYHC 1K73C 1LYLA 1TS3A 5EQ0A 1WVLA 4DK3C 5C4XB 2WAQG 4HJ9A 1B50A 2L55A 1K0RA 1J8IA 2PMZE 4UHVA 2F3IA 3FKIB 2BE5C 3I7FA 2KA7A 1UE5A 4A3FB 1B9NA 5FLMG 1STHA 4CDFC 3HP3A 1D1IA 1L2FA 2R7DA 3QOLA 2XTIA 1ONLA 1DCZA 1S3OA 3D8GA 4GOPC 3ER0A 3E6ZX 1KRTA 1BO0A 1XWEA 5CBAE 5EBCA 5AJ3L 1S5FD 2NN6I 2KVMA 3DWPA 5JEAJ 1HH2P 2CW0C 2XGTA 4ZLTF 1BNZA 1SBBB 4HR7B 4FXKC 4F7XA 3HOVB 3VYUA 1OO9B 4DV5Q 2F0DA 3I55A 1IBLQ 2BCOA 1GM5A 2N8NA 5IT9E 3CRLC 3MVVA 2B63H 1VQ9A 1PDQA 1N36L 1XX8A 1IBMQ 5IP7H 5IE8A 3PUYA 1V8QA 2AQ1B 1VQDA 2E74C 1JT8A 3K81C 5FJ8H 4DGZA 1D6EC 4HTHA 4DNRB 5I9OA 3T1HL 3M4YA 2E2JB 1EYGA 3G71A 4Q0FA 3MXNA 5IGCA 2NUCA 3KLRA 1PFBA 4FF2A 3BDOA 5K36H 4GOPB 5ELCA 3KOJA 2B8FA 2KEEA 4ME3A 1I3QB 3GTJB 3Q8DA 3FPUB 5C4JB 3T13A 1E2ZA 3CCVA 4MHEA 3K6OA 1ET6A 2R92H 2NZ1D 1TWFB 2EDGA 1ASZA 1G91A 1ENAA 3DEOA 4FF1A 1TWGB 4B3TQ 3NUCA 1BR9A 3AMUA 5E4WC 2VQEQ 4OXPA 3VR3A 5M3FG 1A2TA 1ICWA 3K0YA 3P75A 3BS1A 4HIOA 2PW7A 3N6RA 1VF5C 1E2WA 2B2VC 1U5KA 4DXFA 1SYFA 5I2XA 1L0XB 4JCVE 1PRTD 5FO7B 3AU7A 1BCPD 3PUXA 2E75C 1A6XA 1GUWA 5JVH3 4LF6Q 3RN2A 4OX9L 3HOUG 3EQLC 3J7A5 4CKEA 2VB3X 1BUVT 3U58A 2MFIA 3G48A 3PUVA 4K6LA 2PZUA 1I4RA 1DM0B 1KL9A 3GD7A 5LMNQ 2MP1A 3K80C 2E2DC 4PG3A 1VQPA 1EIFA 4ZRZA 5IYDH 2N55A 1Z9FA 5COYA 4HAEA 2L9HA 3SEBA 1VQ6A 1R9TB 4GN5A 2QF7A 4DXGA 4H02A 2I46A 3TS2A 4DNIA 1PV4A 1Q82C 2F0NA 4KTAA 1LTAD 2ZJRA 3PIOA 2F3WA 4IJLA 2K05A 2EOTA 3C1EA 3CU7A 3IL8A 3NWTA 2MPMA 1PRTB 5GROA 3D31A 1BCPB 1JJGA 3HKZG 2B2WC 3K5NA 2HDMA 5NUCA 1VCIA 1ENFA 2WACA 3PMFA 5FO8B 1WCMG 4Y52H 4JI7Q 2NZOA 1NSNS 1PRTF 4LNQA 1B1ZA 1BCPF 1PH8A 1CA6A 4G7HC 1JQYD 5M3FB 2PZWA 3C3LA 3W3AA 2AKWB 2QGQA 1FNWA 2F4VQ 1NJIC 3E9IA 3CP0A 3RZOB 1X65A 1E3PA 3HOUB 1YBYA 4GLVB 2DY7A 3TN2A 1JJCB 2JA6H 1SYEA 1F9PA 1KDBA 4NXNQ 2EYFA 3MXGA 3QJYA 2IX0A 3TZUA 4UAIA 2GN5A 1EIGA 1AZPA 1DONA 3H94A 1I94L 4X3TA 3KDFB 1PH5A 2TMPA 4IPHA 2QDBA 2B2YC 4Y7NB 2P5ZX 4QY7A 3QR8A 3BZDB 5EKKA 2SOBA 4RGNA 2JA9A 4ALPA 2RDHA 1UE1A 3DXJC 2N88A 4A3IH 1K8AC 2A69D 1AEXA 4C3JB 2A69C 4QIWB 3DEPA 4K6DA 4GS3A 1ML0D 2K01A 4M8AA 4LFCQ 2Q2UA 1U4PA 1DD2A 1STNA 1PFNA 3GTJH 4DR2L 1MKHA 4JV5Q 4X62L 1O80A 4A3JH 1VQEA 4JI2Q 3GTLB 1YNJD 2JP1A 1IYUA 3GDEA 3ND8A 4IUTA 3ONAB 5IOCA 3Q0AA 4IZ8A 4CJ2C 2GA4B 3EROA 1WCMB 5FK9C 2BDNA 4QIWE 3H3VC 4WFN3 3A5ZB 2WIIB 4NKLA 2CFMA 4DV6Q 3DM3A 2G5DA 4OIKA 4BBRH 2G9HD 1HNWQ 1EY9A 2LXJA 3SR1A 1JORA 1Y8NB 5CC4A 1LABA 1VQ5A 3TP7A 4CJ0B 1Y8PB 1EQRA 4DAVA 3S16H 3HKZE 1H95A 4GZYC 2OEOA 4LAAA 4CJ1B 2FXQA 1SNPA 3PIO3 3E0EA 1SYGA 2NVQB 4DR1L 2EYMA 2RQXA 1OXSC 2UXDQ 1U9RA 4FF3A 1O78A 1VQKA 2WKDA 1E1TA 3SHLA 3K7UC 2JQOA 3TBIB 5FLXc 3PO2G 1WTWA 5GADC 4RH6A 1X56A 1EY0A 1PXUA 2ZTEA 3S1NB 1EU4A 1PYWD 2V1CC 2YU9H 2CQOA 3QOJA 1NMGA 1Q90A 4DK0A 4KKUA 1HHVA 3SVMA 1DOMA 4LF7L 3GTOH 3NQIA 3IRBA 1KIXA 1GUOA 1QE6A 1CZWA 3GV3A 4M1UB 3BU2A 2FINB 4LFBL 1GHJA 1RF2D 1C8CA 1XMOQ 2DJFC 3MWYW 4FXDA 1G6ZA 3H3VI 1SE4A 3DLLA 1STYA 1TWAH 4LF5L 4IUUA 3R3OA 1EU3A 3NTHA 3E9HA 4WRDA 1QZGA 3ULPA 2CCZA 4A3BG 1HUNA 3X3MA 4L5QA 4BBSG 1YNXA 4XT1B 3GV6A 4XQQA 3S1MB 3HOUH 2JA5H 1L1OB 5C0XI 5JPMC 2ID0A 3CCRA 5JEAG 5BR8Q 5J1ZA 1WI5A 5LMNW 2ZJPA 2JA8G 3T51B 3WOFA 2Q2HA 5FLXE 2PPBC 3HZXA 1KTKA 1QJOA 3CC7A 1IW7D 2X6GA 3B6YA 4HCSA 4H44C 1PZJD 4K5VA 3M85A 1WTVA 1XMQQ 3NTKA 1MIUA 4RAUC 4JBMA 4GKKL 1ILPA 3I3CA 4C3JH 4NXML 1DYQA 4TVAB 4ABNA 3PO2B 1KABA 4FDBA 5EBDA 1B3AA 1Y69U 4JG2A 3A0JA 1XNQQ 4V0BA 4QF4A 2XVSA 4JOIA 2DJGC 3QG1A 1K83B 3ULJA 4DV5L 1NUCA 1J6QA 3HGBA 1IBLL 1ET9A 1I4PA 2CWPA 5M3MH 3GTLH 3KF8A 1DZ1A 5IODA 5L37A 2IJ0A 2QW7A 3AQQA 4P75A 1IBML 2F0IA 2JYOA 2A6HD 3LWUA 1EEFD 4NMZA 1KXLA 4DUZQ 2N78A 2M00A 3J81c 2J7ZA 2KENA 3I4LA 4X3UA 1V1PA 4A3BB 2PO4A 5KYIA 1YIJA 4BBSB 2DY8A 5DM63 3H0GG 3ULLA 2MO0A 1TXYA 5J39A 3SK8A 2NVYB 1VMPA 3M3YB 3Q23A 2BA1A 4RHRA 4KY7A 1GO3E 4U68A 3GTPB 2YYZA 3VYTA 4IPCA 4CKBA 2HT1A 2R7ZG 3EJIA 4B3TL 3LWEA 1EY5A 2NVQH 1SLJA 3QWNA 4DR6Q 1CKNB 4PZ6A 1EL0A 2VQEL 3CC2A 5HGTA 3Q22A 3F1ZA 1PH2A 5C3EG 4FP5D 4L6TB 1YHAA 2ZTDA 1RODA 3K59A 2B3GA 4EQNA 4C3HH 4P71A 4LUZA 3NBHB 3AFPA 1IKLA 1S72A 3NWSA 4UDUC 1S5ED 4LF6L 5CMDA 5ELFA 3TQYA 2BH2A 1I50H 4HCEA 4JI6Q 3E3XA 4CGYB 1CI3M 4BY7G 3OTOQ 2H1EA 2HDLA 4JPBW 1GUSA 1WTOA 1ZXTA 1T5EA 2B2UA 3KBGA 4A3KH 4R9WA 5C4ZA 3J81E 2KHJA 2D2CC 4OO1H 1E22A 1H9MA 4JYAQ 1SFOB 2UUBQ 1HR0Q 1B4OA 3D4DA 3U4VA 4P73A 1AZQA 1I4QA 3J7ZC 1K28A 1SDFA 4QL5A 4ILWA 3A8JE 4IPDA 2HIXA 4FF4A 2K5NA 3VYSA 4A3GG 3J81j 3CCLA 5TSSA 3S1MH 3H0GB 3NK9A 2JSOA 2K03A 5ELOA 1CSPA 3ITPA 1UEAB 4GN4B 1X54A 4ID6A 2A68D 1F2ZA 2A68C 4JC0A 1I6HH 1ENCA 1YJWA 3MAQA 4PQXA 4GNXB 4DU9A 2R3ZA 2R7ZB 2LXKA 2Q8TA 4X64L 1D5ZC 4BA1I 2RSOA 1EZ6A 1SYCA 1EEID 2ICIA 4JI7L 4BXXH 3S14B 4KJNA 3T1YQ 1MJCA 2HHHQ 1E24A 1CQFA 4B3RQ 5HY6A 4HJ5A 2F4VL 2NN6G 3OPOA 1EIHA 3DM1A 2K5QA 1U4LA 5C0XJ 4BY1G 5C44B 1O7IA 4HJ7A 3GTGH 1RD9D 2B2TC 3BYYB 1FGBD 3LX0A 3EFXD 1QNKA 4HIKA 4EQOA 1K83H 2I5HA 4NXNL 1I4XA 1F2YA 4TRDA 4S3SA 4BY7B 4JI5Q 1Q1EA 5D3IB 5LL6S 1JICA 3V05A 4GNXA 2EIFA 2G9DA 2PYKA 3DMUA 3TZDA 2KQ3A 1UE7A 4LF4Q 4HMIA 3BJUA 2VUMG 1EY6A 5CV8A 1A63A 3HG9A 1CHQD 2QKIC 2C9OA 1GD7A 1MGSA 4J6HA 2I07B 1YHBA 2QDLA 1XYIA 4MZ9A 5H1SE 2E5LQ 2QEXA 3H91A 5JOBA 5M5XH 3CD6A 3V2TA 4DV2Q 1A0IA 4A3BH 1AH9A 5C3XA 4LFCL 3OMCA 4A3GB 3S1QB 3LGJA 3CCQA 4JV5L 3K7AB 2PMZB 2MNAA 1C9OA 2NVYH 4NW2A 1H9KA 1B7YB 3ND9A 2ZT9C 4JI2L 1GUGA 4RKLA 5GAEC 1Q3LA 3GTQB 2OT2A 2E76C 2NYZD 4AYBG 4ZKBB 1IXRA 1LLRD 4X6AH 2N49A 1YJNA 3HOYG 2K7VA 5A2QE 2A6ED 4YWMA 1X3GA 3CKIB 5CGKA 1L0YB 2OCEA 4ZUIA 4ULLA 3NSWA 2AHOB 2AUJD 3W1BA 4DV6L 1DJRD 2HIVA 4YHHQ 2D5DA 4JW0A 1UWVA 1HNWL 2VL6A 5C4HA 5D65A 3PGZA 4BA2I 1HXYD 2BE5D 1LTID 5T1GA 2SDFA 3NQTA 3S2HB 1ASYA 1STBA 4UY8C 3TMEA 3R2TA 2KCNA 3PF4A 3C1FA 2H5XA 4A3LH 1F9SA 1IHZA 1PH4A 1WTHA 4B3SQ 1UNSA 2R6GA 1H9JA 2KHIA 4OIJA 1JMCA 1B44D 1VQGA 2VUMB 3P20A 1I5FA 3JAMi 2MJ8A 2CW0D 2EJMA 1LT6D 2F3VA 3J80E 1FR3A 1Z6HA 3BG3A 3FMCA 1A15A 3F8TA 4G57A 1K8GA 3PUWA 3D6CA 4GLAC 2MO1A 2XN9C 3HKSA 5GQOA 1XTDA 4HJ8A 3T16A 4DA2A 2NVXH 2L11A 1HZ9A 2F1MA 1DGSA 1X3FA 1B2TA 3GP7A 5E4XA 2XIWA 4IUPA 3KFUA 2R7ZH 4LW1A 4ODGA 4AYBB 2GVBA 3M4OH 3KBXA 1HNZQ 4C1NI 2UXCQ 1XMOL
chains in the Genus database with same CATH topology
4WORA 3S17B 2WP8J 3RD4A 3MEHA 3V96A 2F0EA 2QEJC 2WAQB 1PMRA 1PTOC 3MTSA 2F0MA 1A3TA 3OHXC 3VYRA 3P7JA 2F0TA 2ZXOA 5IGDA 1WTRA 2EZVA 1GHKA 4XQJA 4LK1C 5IIFA 3KK7A 3VR6A 1KNAA 3VR2A 3S2DB 2PNRC 1EY8A 2AWOA 4NDXA 2A73B 2QILA 2RDGA 1EQTA 5CV7A 2KEDA 2LY7A 2F4IA 3Q24A 2VXWA 2K28A 2SNMA 3OWEB 1WD1A 5IGFA 1HFNA 3KUPA 2E2HB 3TP5A 4XYQA 4K5WA 1PTOB 2WV6D 2BOSA 4DF7A 2NTSA 2KCCA 1PTOF 1T5XD 1KDCA 2QCPX 4FO2A 4KD4A 1ZEQX 3SE0A 3K5OA 5EPLA 2FMMA 2IL8A 2EYHA 5FO9B 5IT9L 4FYDA 1TS2A 1MI2A 1TQOA 2IT1A 1DOLA 2DNEA 2JA7B 4CHTB 1MD2D 3MXUA 2Z1CA 3T56B 2B2VA 1VMCA 1RTOA 2RSNA 2EJFC 4EQPA 5KYLA 1S5BD 4C56C 2ENBA 1STEA 3L7ZC 3J7AF 1GOZA 4LMQD 2F0JA 5F2DA 4QMGA 2AQ2B 1W6KA 3OIPA 4TKOB 5HURA 2NB0A 1AP0A 4XYOA 1TVXA 2F0HA 1PZKD 2F0LA 1H9RA 3MFYA 2FHTA 1QWYA 3HKZB 1WTQA 5M9OA 2RKSA 1JWSD 1PZID 5C0XG 4U673 3E5SA 1WTXA 1G2TA 4XXEA 3UI2A 2IPKD 1NR2A 1HTLD 1F2MA 3CRKC 3LNNA 1XXGA 4PV1C 3VR4A 2E2IB 1KLUD 5DM73 4IFDG 1GXDC 2JEBI 1SYDA 1LV9A 1ZYRC 3K5LA 2F03A 3ERQA 5CYUA 2NVTB 3VA7A 5EPJA 2NBFA 3A7LA 4A3DB 2PZTA 2ZXPA 2B2YA 3RUZA 5KNDA 1II3A 1RJTA 4K2KA 2F0KA 3HS0C 1SXTA 3BYTB 3J7YW 5G3LD 1Z47A 2Z4HA 2A74C 3GQBA 4HN7A 5FOBB 4EVOA 3BDLA 4QB4A 2O4XA 1JB3A 5EJWA 4XQNA 1RDPD 4RHSA 2JEAI 2JXMB 2KHSA 3IFTA 3RZDB 1TY2A 2L4NA 1B53A 1Y1WB 2EY5A 5EKLA 3L3OC 3PO3B 1D1KA 1SMYC 1TS5A 1QCBD 3VA5A 5JPNC 2F0WA 4C3IG 1U4RA 3DWAA 3JAML 3HOZB 1F77A 2X69A 2CHBD 4IFDI 4OO1I 2F0UA 5BN3A 3IKJA 1F2LA 4RFBA 4KKSA 4J8QA 5G3LF 1G291 1WTPA 4QUFA 1HRJA 1SYBA 3C2PA 3H6MA 4IN3A 4C1NK 1EYAA 2KECA 2A5HA 4RGOS 1K8MA 4JK1C 4RCOA 1ESFA 3PV0A 1VF7A 2MGSA 2F0OA 1DOKA 2KUMA 1CQVA 2EYLA 3FPPA 2K32A 1A3VA 2KOLA 4TSSA 2R93B 1LT3D 5KGUA 1QB5D 1TIID 4F88A 4N9PA 1E2VA 1C4QA 3I72A 1FD7D 3G7LA 1G8ZD 2B8GA 5CV5A 4C3IB 1STGA 5ELEA 3OMGA 2JA8B 1MBYA 2F0GA 2BA0A 3BDCA 5KRUA 1TU2B 3FDTA 1TR5A 3J7AV 1PLFA 1EZ8A 5D14A 5AFWA 1I6VC 1M8AA 4KV6A 4A93B 1BXTA 1QOHA 1CHPD 1KLGD 3I4MB 4TQUS 1H9SB 4A3MB 3U9OA 5K36G 2JE6I 5T1IA 4FXGC 1EFID 5K5PA 2CQAA 1G2SA 1Y8OB 3MXPA 3CHBD 2XSCA 4PNYA 3D4WA 3NBHA 2DNCA 4DN4M 1C48A 4R8NA 3FVQA 1TWHB 1H9SA 1S5DD 1HFGA 3I90A 3HOXB 2FMCA 3K57A 2KJXA 5KNCA 2PQEA 1FNVA 1EYDA 2B63B 3T4AC 5C3EB 5DEHA 1EWCA 2EYJA 1FNUA 4K8IA 2F0SA 3BVMA 1EY4A 2IX1A 2X6LA 4H7BA 1I4GA 3D6WA 2RA4A 5I9PA 2LMCB 5JJZA 1YNNC 2D62A 2IWHA 1PFMA 1CK1A 4G4KA 3OOCA 1IL8A 1RHPA 2VNUD 3GTKB 4IFDJ 2OXPA 4KI0A 1EYCA 1Z7TA 1K8OA 1GJXA 1JOOA 4OL7A 2K5DA 1JOKA 4QCLA 5I6YA 3Q6SA 1OXTA 1I4HA 2ZXRA 2K1BA 5LHY1 5JEAH 2K33A 5IGGA 2C5CA 4BS9A 2WB1B 4LJZC 1QILA 2PCFB 5FKAC 4KMUC 4H13C 3VR5A 4BY1B 3SDZA 4X3SA 1Q8IA 3J81L 1XTCD 1TKWB 3NTIA 1AFPA 3M7NA 3IAYA 3FEWX 5CV4A 4L63B 2XRSD 5DAUA 3NHHA 2RBMA 4XIGS 4QUCA 2EY2A 2EJGC 1ZKOA 3N52A 1KDAA 1CM9A 4XTCS 1U4MA 3SK5A 1X3PA 4F8MA 4F87A 3A56A 5J22A 1EWHA 1X3QA 1SEBD 4G7ZC 1B9MA 1Q12A 4KY6A 1QNUA 3I73A 3A8KE 4XDXA 1STAA 4RGTA 1QG7A 1JCKB 3A8IE 3R8BA 1HQRD 2JA6B 1NAPA 1LT4D 4B9XA 5CV9A 1BQQT 1F9RA 3TP8A 1CTMA 1HA5A 4KK7A 3I4NB 1PTOD 3SK6A 4A3IB 1D5XC 1CFMA 2EYOA 3D4RA 4CBVA 2EE1A 1CA5A 3IFDA 1A2UA 2K5WA 3GTMB 1FYCA 2MHVA 1F9QA 3HEJA 2XNAC 2EYPA 2F0FA 1V1OA 3QO2A 4A3JB 4OGQC 5E3FA 3SXHA 4IURA 5ELDA 1TY0A 2DN8A 2L12A 2H4OA 5A2QL 4P2CB 4RKBA 5CBEE 4IUNA 4IUVA 3HOWB 1J9OA 1BOSA 4K14A 4BBRB 3OWFA 2F0QA 4DAPA 1JWUD 3T53B 5EGTA 1PRTC 2B39A 1BCPC 5KEEA 3S16B 2F0PA 4KHVA 3EA6A 4A3EB 2PW5A 5M5WB 2HQEA 2EPBA 4YIJA 1SAPA 2NN6H 5I2YA 1HCZA 3O13A 1TS4A 3WOEA 4C3JG 4HSPA 3J80L 2YU9B 1M4VA 4N9TA 3F2UA 3GTOB 1EQVA 2NTTA 3NP8A 4MN3A 2O5JC 1HA6A 1OXXK 4ZQ3A 2SNSA 3P1HA 3RMHA 4KY5A 1Q1BA 5EKIA 1TWAB 3CQZB 1TWCB 2Z8LA 4EGVA 1SNOA 2NWGA 3S1RB 1HTPA 2O5IC 1O7YA 4C2MB 4CKCA 2JA5B 1LTRD 1KNEA 4HEDA 3MZ5A 1JE4A 1SNCA 3TSSA 2L0CA 2EY6A 1HQMC 2EY1A 4HSVA 4C3HG 1GUTA 4NP5A 1MSHA 2TSSA 3MHBA 4DNTB 3TP6A 2HUGA 2V4DA 2B2WA 1NCVA 3JAME 1CT1D 5JAVA 2Z4IA 3GO5A 5M3MB 1UAPA 4KD3A 2O2LD 1JR0D 1SJED 1YNJC 4ZKCB 5ISRA 1AW7A 4OO1G 2FJ2A 1W6JA 5IGEA 2K04A 3M7GA 1ZYRD 1R4PB 3AB9A 1X32A 3I70A 1AN8A 4J1MA 5BN5A 3BVZA 1PTOH 1GUNA 3R93A 5C6AA 4E6IA 2LS01 3TDQA 4RWSC 1BDOA 4L8JA 3A54A 1LTBD 4G7OC 1D2BA 4DFAA 4IQZA 4WJWA 3URYA 4DK1A 5JVG3 1D5MC 2J4XA 4ZYSA 3KLSA 1DXMA 5M5YB 4C3HB 5C5MA 3G6JB 2EXZA 3OW7A 1LTSD 1O7ZA 1I50B 3I91A 2D9UA 3RLFA 1SNQA 3E0JA 4ZAIA 1LT5D 3A55A 3D3RA 2FFKB 4O42A 4A3KB 3DHQA 4K5XA 1SMYD 4DAYA 2RDFA 3NE5B 1SE2A 4I7ZC 2CVRA 2IX3A 3U9SA 5C5LA 3R2IA 4Q5VA 1JC7A 3QIAA 4R8IA 5BN4A 2OF1A 4B08A 4RA8A 3S9WA 1I6HB 4V190 5I4DA 3H09A 3WDNA 4RGMA 4KKTA 1E0BA 4I65A 2AQ3B 3OIQA 3QB3A 1IW7C 5DNFA 3W2DA 3DWQA 2AUKA 1ESRA 1V1PB 3MFGA 1SSOA 3GTGB 1R4QB 4MIUA 1JOQA 1IYVA 2B2UC 5A35A 2LKVA 2HCIA 2XWBB 4O1NA 1HPCA 1OXVA 3MC0B 2LFNA 3DUZA 5LL6X 2A6HC 1RCVD 4Z9CB 4KN4C 3SK4A 5I6WA 4B9WA 3NBIA 1V43A 5M5XB 1EY7A 4FNFA 1LTGD 5D3DA 1TT2A 5KNBA 1SNMA 1EOTA 3L9AX 2L5TA 2WKCA 2K6AA 1LACA 4ZUJA 3I8ZA 4KHZA 2RVLA 1O7LA 3MA2B 2XWJB 5C0XH 4KJOA 1SE3A 5CV6A 2R61A 3K58A 4ZK9B 3C46A 2SEBD 4JBWA 1VDZA 2Q8IB 5FLXL 4PMCA 3X3NA 4PMWA 4IFDH 1MSGA 2XRQD 1BBXC 1IKMA 3EVQA 3KLSX 2NVXB 4OHJA 1UUPA 4K8JA 2ICEC 3BVGA 3A7AB 1CZGA 3PUZA 1S5CD 3NXWA 1KAAA 3M4OB 2Q8RE 4K2LA 4HMJA 1YNND 3S15B 1OXUA 5CORA 5CR3A 2BDOA 1A3UA 4IUQA 4PMBA 2IW3A 1HUMA 4ME5A 1SNDA 2R92B 1LO5D 1SJHD 3PIP3 4IALA 1RKNA 2WINB 3K5MA 1BF4A 4H0LC 2F0VA 1S4ZA 2MUYA 2VB2X 2M2LA 4RCNA 5E1FA 2J0TD 2EVBA 4X3KA 1NR4A 1RTNA 5IGBA 2HCCA 1Y1VB 2Y0SB 3OSOA 3FRPB 4XT3B 5KIXA 5EPKA 5C3WA 3HOYB 3ZYYX 1ILQA 3NPPA 1LTTD 2AWNA 2M9VA 1WD0A 2L1BA 1JWMD 3HRZC 4BWGB 2A6EC 5ELBA 2B2TA 4FVMA 4KN7C 1TS3A 5EQ0A 1WVLA 5C4XB 1B50A 2L55A 1J8IA 3FKIB 2BE5C 4A3FB 2KA7A 1B9NA 1STHA 3HP3A 1D1IA 3QOLA 1ONLA 1DCZA 3D8GA 3E6ZX 1BO0A 1XWEA 5CBAE 5EBCA 1S5FD 2NN6I 2KVMA 3DWPA 5JEAJ 2CW0C 4ZLTF 1BNZA 1SBBB 4HR7B 4FXKC 4F7XA 3HOVB 3VYUA 1OO9B 2F0DA 2BCOA 5IT9E 3CRLC 3MVVA 1PDQA 1XX8A 3PUYA 1V8QA 2AQ1B 2E74C 4DGZA 1D6EC 4HTHA 4DNRB 5I9OA 3M4YA 2E2JB 4Q0FA 3MXNA 5IGCA 2NUCA 3KLRA 1PFBA 4FF2A 3BDOA 5K36H 5ELCA 2B8FA 2KEEA 1I3QB 3GTJB 3FPUB 5C4JB 3T13A 1E2ZA 4MHEA 3K6OA 1ET6A 2NZ1D 1TWFB 2EDGA 1G91A 1ENAA 3DEOA 4FF1A 1TWGB 3NUCA 1BR9A 3AMUA 5E4WC 3VR3A 1A2TA 1ICWA 3K0YA 3P75A 3BS1A 2PW7A 3N6RA 1VF5C 1E2WA 2B2VC 4DXFA 1SYFA 5I2XA 1L0XB 1PRTD 5FO7B 1BCPD 3AU7A 3PUXA 2E75C 1A6XA 1GUWA 5JVH3 3EQLC 4CKEA 2VB3X 1BUVT 3PUVA 4K6LA 2PZUA 1I4RA 1DM0B 3GD7A 2MP1A 2E2DC 4ZRZA 2N55A 5COYA 4HAEA 2L9HA 3SEBA 1R9TB 2QF7A 4DXGA 2I46A 2F0NA 4KTAA 1LTAD 2F3WA 2K05A 2EOTA 3C1EA 3CU7A 3IL8A 3NWTA 2MPMA 1PRTB 3D31A 1BCPB 2B2WC 3K5NA 2HDMA 5NUCA 1VCIA 1ENFA 2WACA 3PMFA 5FO8B 1NSNS 1PRTF 1B1ZA 1BCPF 1CA6A 4G7HC 1JQYD 5M3FB 2PZWA 3C3LA 3W3AA 1FNWA 3RZOB 3HOUB 2DY7A 3TN2A 1SYEA 1F9PA 1KDBA 2EYFA 3MXGA 3QJYA 2IX0A 3TZUA 4UAIA 1AZPA 1EIGA 1DONA 3H94A 4X3TA 2TMPA 2QDBA 2B2YC 4Y7NB 5EKKA 3BZDB 2SOBA 4RGNA 2RDHA 3DXJC 2N88A 2A69D 1AEXA 4C3JB 2A69C 4QIWB 3DEPA 4K6DA 1ML0D 2K01A 4M8AA 1U4PA 1DD2A 1STNA 1PFNA 1O80A 3GTLB 1YNJD 2JP1A 1IYUA 3ND8A 4IUTA 3ONAB 5IOCA 3Q0AA 4IZ8A 4CJ2C 2GA4B 3EROA 1WCMB 5FK9C 2BDNA 3H3VC 4WFN3 2WIIB 4NKLA 4OIKA 2G9HD 1EY9A 3SR1A 1JORA 1Y8NB 5CC4A 1LABA 3TP7A 4CJ0B 1Y8PB 4DAVA 4GZYC 2OEOA 4LAAA 4CJ1B 1SNPA 3PIO3 1SYGA 2NVQB 2EYMA 2RQXA 1OXSC 1U9RA 4FF3A 1O78A 2WKDA 3SHLA 3TBIB 1WTWA 4RH6A 1EY0A 1PXUA 3S1NB 1EU4A 1PYWD 3QOJA 1Q90A 4DK0A 4KKUA 1HHVA 3SVMA 1DOMA 3NQIA 1GUOA 1QE6A 1CZWA 3GV3A 4M1UB 2FINB 1GHJA 1RF2D 1C8CA 3MWYW 4FXDA 1G6ZA 1SE4A 1STYA 4IUUA 3R3OA 1EU3A 3NTHA 4WRDA 1HUNA 3X3MA 4XT1B 3GV6A 4XQQA 3S1MB 5C0XI 5JPMC 2ID0A 5JEAG 5J1ZA 3T51B 3WOFA 5FLXE 2PPBC 3HZXA 1KTKA 1QJOA 1IW7D 2X6GA 4K5VA 4HCSA 4H44C 1PZJD 3M85A 1WTVA 3NTKA 4RAUC 1ILPA 3I3CA 1DYQA 4ABNA 3PO2B 1KABA 5EBDA 1B3AA 1Y69U 4V0BA 4QF4A 2XVSA 3QG1A 1K83B 1NUCA 3HGBA 1ET9A 1I4PA 3KF8A 1DZ1A 5IODA 2IJ0A 2F0IA 2JYOA 2A6HD 3LWUA 1EEFD 4NMZA 2M00A 2J7ZA 4X3UA 3I4LA 1V1PA 4A3BB 2PO4A 5KYIA 4BBSB 2DY8A 5DM63 5J39A 3SK8A 2NVYB 1VMPA 3M3YB 3Q23A 2BA1A 4RHRA 4KY7A 4U68A 3GTPB 2YYZA 3VYTA 4CKBA 3EJIA 3LWEA 1EY5A 3QWNA 1EL0A 5HGTA 3Q22A 4FP5D 4L6TB 1RODA 3K59A 4EQNA 1IKLA 3NWSA 4UDUC 1S5ED 5CMDA 5ELFA 4HCEA 4CGYB 1CI3M 2H1EA 2HDLA 1GUSA 1WTOA 1ZXTA 1T5EA 2B2UA 3KBGA 4R9WA 5C4ZA 3J81E 2D2CC 4OO1H 1H9MA 1SFOB 1B4OA 3D4DA 1AZQA 1I4QA 1SDFA 4ILWA 3A8JE 4FF4A 3VYSA 5TSSA 3H0GB 3NK9A 2JSOA 2K03A 3ITPA 1UEAB 4ID6A 2A68D 1F2ZA 2A68C 1ENCA 3MAQA 4PQXA 4DU9A 2R3ZA 2R7ZB 2Q8TA 1D5ZC 4BA1I 2RSOA 1EZ6A 1SYCA 1EEID 2ICIA 3S14B 4KJNA 1CQFA 2NN6G 3OPOA 1EIHA 3DM1A 2K5QA 1U4LA 5C0XJ 5C44B 1RD9D 2B2TC 3BYYB 1FGBD 3LX0A 3EFXD 1QNKA 4EQOA 1I4XA 1F2YA 4TRDA 4S3SA 4BY7B 1Q1EA 5D3IB 5LL6S 1JICA 3V05A 2G9DA 2PYKA 3DMUA 3TZDA 2KQ3A 4HMIA 1EY6A 5CV8A 3HG9A 1CHQD 2QKIC 2C9OA 1MGSA 4J6HA 2I07B 1XYIA 3H91A 5JOBA 3V2TA 5C3XA 3OMCA 4A3GB 3S1QB 3K7AB 2PMZB 4NW2A 1H9KA 3ND9A 2ZT9C 1GUGA 4RKLA 1Q3LA 3GTQB 2OT2A 2E76C 2NYZD 4ZKBB 1LLRD 2K7VA 5A2QE 2A6ED 3CKIB 5CGKA 1L0YB 4ZUIA 4ULLA 3NSWA 2AUJD 1DJRD 2D5DA 5C4HA 5D65A 4BA2I 1HXYD 2BE5D 1LTID 5T1GA 2SDFA 3NQTA 3S2HB 1STBA 3TMEA 3R2TA 2KCNA 3C1FA 1F9SA 1IHZA 1UNSA 2R6GA 1H9JA 4OIJA 1B44D 2VUMB 3P20A 2MJ8A 2CW0D 2EJMA 1LT6D 2F3VA 3J80E 1FR3A 1Z6HA 3BG3A 3FMCA 1A15A 4G57A 3PUWA 3D6CA 2XN9C 3T16A 4DA2A 2L11A 2F1MA 1B2TA 3GP7A 5E4XA 2XIWA 4IUPA 4ODGA 4AYBB 3KBXA 4C1NI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3P A;  5E4W C;  1MI2 A;  1WD0 A;  2L1B A;  1DOL A;  1EL0 A;  2KOL A;  1X3Q A;  2EPB A;  1ICW A;  2N88 A;  2X6L A;  4IUU A;  1SAP A;  1RJT A;  2FJ2 A;  1MGS A;  2B2V C;  1ROD A;  2K04 A;  3DEP A;  1XYI A;  1E0B A;  3D6W A;  3H91 A;  2RA4 A;  1MSG A;  1ML0 D;  2B2V A;  1BBX C;  1HUN A;  2K01 A;  1VMC A;  2B2T A;  1GUW A;  1X32 A;  1U4P A;  3MTS A;  4XT1 B;  1IKL A;  3GV6 A;  1RTO A;  5DNF A;  1PFN A;  5EQ0 A;  2RSN A;  1WVL A;  5JJZ A;  1ESR A;  3G7L A;  1IKM A;  4XDX A;  5CMD A;  1PFM A;  1B50 A;  1QG7 A;  1SSO A;  3P7J A;  1J8I A;  3R93 A;  1O80 A;  4NW2 A;  1IL8 A;  1WTR A;  1RHP A;  2H1E A;  1NAP A;  2HDL A;  2JP1 A;  2B2U C;  3F2U A;  1Q3L A;  1WTO A;  4IUT A;  3ONA B;  4MN3 A;  1ZXT A;  4LMQ D;  1HA6 A;  2B2U A;  5EJW A;  2HCI A;  2MP1 A;  2NYZ D;  3HP3 A;  4ZKB B;  3FDT A;  4R9W A;  4RWS C;  1KNA A;  4CJ2 C;  1PLF A;  2N55 A;  2BDN A;  1F9R A;  5COY A;  2L4N A;  5D14 A;  1B53 A;  5AFW A;  1M8A A;  3LWE A;  1BO0 A;  2L9H A;  2X6G A;  4HAE A;  4HCS A;  5CBA E;  2Q8R E;  1WTV A;  1EQT A;  4RAU C;  1B4O A;  2KED A;  5EKI A;  1ILP A;  3I3C A;  1AZQ A;  1AP0 A;  4OIK A;  2KVM A;  1SDF A;  1TVX A;  2VXW A;  5COR A;  1B3A A;  3Q6S A;  5D65 A;  4ZLT F;  1BNZ A;  2NWG A;  2K28 A;  2EE1 A;  1CA5 A;  2FHT A;  5T1G A;  2SDF A;  3IFD A;  2K1B A;  4CJ0 B;  2K05 A;  2K03 A;  2EOT A;  4IUQ A;  1WD1 A;  3KUP A;  1HFN A;  1HUM A;  5T1I A;  1WTQ A;  1O7Y A;  1F9Q A;  3IL8 A;  4CJ1 B;  2MPM A;  1U4R A;  1F9S A;  1O7Z A;  3QO2 A;  1DZ1 A;  1KNE A;  1PDQ A;  1EOT A;  2B2W C;  3I91 A;  1XX8 A;  2D9U A;  2HDM A;  2R3Z A;  4HED A;  1WTX A;  1G2S A;  2Q8T A;  1G2T A;  4ZAI A;  1BF4 A;  1S4Z A;  3UI2 A;  2RSO A;  2X69 A;  4OIJ A;  2FFK B;  4IUR A;  4O42 A;  1JE4 A;  2JYO A;  2M2L A;  1NR2 A;  4ZKC B;  1CA6 A;  1F2L A;  2MJ8 A;  4X3K A;  4DN4 M;  3I8Z A;  1NR4 A;  2CVR A;  4X3S A;  2L12 A;  1WTP A;  2J7Z A;  4X3U A;  4HSV A;  1A15 A;  1PFB A;  1RTN A;  4QUF A;  5CBE E;  1WTW A;  1HRJ A;  4IUV A;  1EIH A;  1J9O A;  3DM1 A;  1U4L A;  1HFG A;  2RVL A;  2DY8 A;  2KEE A;  3I90 A;  2HCC A;  2B2T C;  2DY7 A;  1LV9 A;  3TN2 A;  1MSH A;  1QNK A;  1HHV A;  1F9P A;  3SVM A;  3FPU B;  1DOM A;  2L11 A;  1VMP A;  2KEC A;  4R8I A;  2HUG A;  4XT3 B;  4MHE A;  5EPL A;  3TZD A;  4U68 A;  2FMM A;  2B2W A;  4UAI A;  1AZP A;  1EIG A;  1NCV A;  2NZ1 D;  1DON A;  1QE6 A;  4X3T A;  1B2T A;  4QUC A;  1JIC A;  3GV3 A;  1G91 A;  5EPK A;  2FIN B;  3DEO A;  2XIW A;  2IL8 A;  2MGS A;  4IUP A;  5E4X A;  5EPJ A;  4ZK9 B;  3N52 A;  1ILQ A;  4RA8 A;  1C8C A;  1DOK A;  2B2Y C;  1CM9 A;  3KBX A;  3MWY W;  2KUM A;  1G6Z A;  1U4M A;  2B2Y A; 
#chains in the Genus database with same CATH topology
 4JI3 Q;  3TS0 A;  4WOR A;  3S15 H;  3S14 H;  3S17 B;  2WP8 J;  4A3E G;  3RD4 A;  5IY0 A;  3MEH A;  2Z0S A;  3V96 A;  2F0E A;  1K3R A;  1NNX A;  2QEJ C;  2WAQ B;  3CF5 A;  4DUY Q;  1PMR A;  1PTO C;  3MTS A;  5C44 H;  2F0M A;  1A3T A;  3OHX C;  3H15 A;  3VYR A;  3P7J A;  2F0T A;  2ZXO A;  5IGD A;  1P16 A;  1WTR A;  2D0P A;  4AYB E;  2EZV A;  1GHK A;  4BY7 H;  1KD1 C;  5BR8 L;  4XQJ A;  4LK1 C;  4LUO A;  3KK7 A;  5IIF A;  3VR6 A;  1KNA A;  1WYD A;  3VR2 A;  3S2D B;  1NMF A;  2PNR C;  1EY8 A;  2AWO A;  2OTL A;  2JA7 G;  2WAQ E;  4GOP A;  4NDX A;  2A73 B;  1K0S A;  3CC4 A;  3FHW A;  2QIL A;  2RDG A;  1EQT A;  4UP9 A;  5CV7 A;  1HR0 W;  2I0Q A;  2KED A;  2LY7 A;  1XMQ L;  2F4I A;  1Y1V H;  3U50 C;  3Q24 A;  2VXW A;  1Q86 C;  4DV7 Q;  2K28 A;  2SNM A;  3OWE B;  4HID A;  1IL2 A;  4CDD C;  1WD1 A;  5IGF A;  4L5T A;  4A3G H;  1HFN A;  3KUP A;  2E2H B;  3TEH B;  4XYQ A;  3TP5 A;  4K5W A;  3K7A H;  3UDG A;  1HJP A;  1WOC A;  1PTO B;  2WV6 D;  3U4Z A;  3GTQ H;  2BOS A;  4DF7 A;  1V1Q A;  2NTS A;  2Z6K C;  1YIT A;  2KCC A;  1PTO F;  1T5X D;  1KDC A;  2EQS A;  2QCP X;  4DUZ L;  4FO2 A;  1PYB A;  1LM0 A;  3STB C;  5C4X H;  4KD4 A;  1B8A A;  4OWW B;  3FKI H;  4A3F H;  2N3S A;  1UEB A;  1ZEQ X;  3SE0 A;  3K5O A;  5EPL A;  2K50 A;  2FMM A;  4LFA Q;  5IYB H;  1X9N A;  2IL8 A;  2EYH A;  2YV5 A;  5FO9 B;  5IT9 L;  1YJ9 A;  4FYD A;  1TS2 A;  2ZM6 Q;  2ATW A;  4L5R C;  1MI2 A;  1TQO A;  2IT1 A;  4JI4 Q;  1DOL A;  2DNE A;  4DR6 L;  4L5S A;  2JN4 A;  2JA7 B;  4GKJ Q;  1FJG L;  4CHT B;  1VQL A;  1MD2 D;  3MXU A;  4PZ7 A;  4WJ4 A;  2Z1C A;  3T56 B;  3HOV H;  2B2V A;  5IYC H;  1AE3 A;  1VMC A;  3F2B A;  4KHP Q;  3JC6 6;  1RTO A;  2RSN A;  1EUJ A;  2EJF C;  4EQP A;  5KYL A;  3NEN A;  1S5B D;  3CPF A;  4C56 C;  2ENB A;  1STE A;  3KF6 B;  4LF9 Q;  4JI6 L;  4A3C G;  3KLW A;  3L7Z C;  3OTO L;  3J7A F;  5IWA Q;  1GOZ A;  4LMQ D;  2F0J A;  1X6O A;  4YCU A;  4A3D G;  5F2D A;  2E2J H;  4QMG A;  3I4O A;  2AQ2 B;  1W6K A;  3OIP A;  1VQI A;  4IOC A;  4TKO B;  5HUR A;  3S17 H;  4JYA L;  3RLN A;  5IP9 G;  1VQN A;  2NB0 A;  2UUB L;  1HR0 L;  1AP0 A;  1I3Q H;  4XYO A;  1TVX A;  2F0H A;  1PZK D;  2F0L A;  1H9R A;  5C4J H;  3MFY A;  2RHQ B;  3CW2 C;  1N9W A;  4GN3 B;  2FHT A;  1XPU A;  1QWY A;  3KDF A;  1IYJ B;  1TWF H;  3HKZ B;  1WTQ A;  4K0K Q;  5M9O A;  2RKS A;  3CAM A;  1JWS D;  1TWG H;  5FLM H;  1PZI D;  5C0X G;  3RNU A;  4U67 3;  1Q7Y C;  3E5S A;  1WTX A;  1G2T A;  1HZB A;  4XXE A;  3UI2 A;  2IPK D;  3FP9 A;  2A19 A;  3S2D H;  1Y1W G;  2A8V A;  1NR2 A;  1HTL D;  1F2M A;  3CRK C;  2VQF Q;  3LNN A;  1XXG A;  4PV1 C;  3VR4 A;  3T1Y L;  1FGU A;  2HHH L;  3PO3 G;  2E2I B;  1KLU D;  5DM7 3;  2KCM A;  4B3R L;  3UDF A;  4IFD G;  1GXD C;  3W5O A;  4P72 A;  1C7Y A;  2JEB I;  3J81 i;  1SYD A;  1LV9 A;  3K8A A;  1ZYR C;  3K5L A;  4IJH A;  2F03 A;  3ERQ A;  5CYU A;  2NVT B;  1KQS A;  1MHW C;  4IOA A;  3VA7 A;  3HOZ G;  4DPG A;  2VW9 A;  5EPJ A;  2NBF A;  1SE8 A;  3A7L A;  4A3D B;  4MNO A;  2PZT A;  1R9T H;  2ZXP A;  2B2Y A;  3RUZ A;  4LF4 L;  5KND A;  1II3 A;  1YHQ A;  1KRS A;  1RJT A;  1NTG A;  2YTX A;  4K2K A;  2F0K A;  3HS0 C;  1VQF A;  1SXT A;  2K5H A;  3BYT B;  4YY3 Q;  5AJ3 Q;  4DV3 L;  5EAY A;  2E5L L;  2UU9 Q;  3AEV A;  3J7Y W;  4DV2 L;  5G3L D;  1Z47 A;  2Z4H A;  2A74 C;  3GQB A;  2OQK A;  5JJI A;  4HN7 A;  5FOB B;  4EVO A;  1YI2 A;  3BDL A;  4QB4 A;  2O4X A;  2VS1 A;  2ASB A;  3I2Z A;  1JB3 A;  5EJW A;  4XQN A;  1RDP D;  4RHS A;  2JEA I;  1Q46 A;  5M3F H;  2JXM B;  1JJ2 A;  2KHS A;  3IFT A;  2PQA B;  4CDC C;  3RZD B;  1TY2 A;  2L4N A;  1B53 A;  1Y1W B;  2R93 G;  2EY5 A;  5EKL A;  2JA7 H;  3L3O C;  1A62 A;  3RZO H;  3PO3 B;  1D1K A;  1P8L A;  1SMY C;  1TS5 A;  4YHH L;  2MQH A;  1QCB D;  3VA5 A;  4DR5 Q;  4DR4 Q;  5JPN C;  2F0W A;  4C3I G;  1U4R A;  4Y7N H;  1BVS A;  3DWA A;  4JI8 Q;  3JAM L;  3HOZ B;  5HGQ A;  1F77 A;  4B3S L;  3VDY A;  2X69 A;  5GAG C;  2CHB D;  4IFD I;  4OO1 I;  2F0U A;  5BN3 A;  5GAH C;  3IKJ A;  4A93 G;  1F2L A;  2OQ0 A;  4RFB A;  4KKS A;  1EWI A;  4J8Q A;  5G3L F;  4IO9 A;  3I4M G;  1G29 1;  1WTP A;  1VQM A;  1M90 C;  4QUF A;  1N34 Q;  1V9P A;  1L1O A;  1HRJ A;  1SYB A;  5E7N A;  4A3M G;  3C2P A;  3H6M A;  1Y14 B;  4IN3 A;  4C1N K;  1EYA A;  2KEC A;  2A5H A;  4RGO S;  2UUA Q;  2NZH A;  4DAM A;  4LF8 Q;  1K8M A;  4A4I A;  2UXB Q;  4JK1 C;  4RCO A;  1ESF A;  2PNH A;  1WCM H;  1VQ7 A;  3PV0 A;  4OWX B;  1VF7 A;  2MGS A;  2F0O A;  1DOK A;  2KUM A;  2JJQ A;  1CQV A;  2EYL A;  1HNZ L;  3FPP A;  2UXC L;  1NE3 A;  2K32 A;  1A3V A;  2KOL A;  4TSS A;  4JI3 L;  2R93 B;  1LT3 D;  5KGU A;  2HD3 A;  2Z9H A;  1QB5 D;  1HZA A;  1TII D;  2E2I H;  4F88 A;  4N9P A;  1E2V A;  1Q8K A;  1C4Q A;  3CPW A;  3HOX G;  4DUY L;  3I72 A;  1FD7 D;  3G7L A;  1XNR Q;  1G8Z D;  2B8G A;  5CV5 A;  4C3I B;  1STG A;  5ELE A;  3OMG A;  2JA8 B;  1MBY A;  2F0G A;  3PIP A;  3J80 i;  2BA0 A;  3G6E A;  3BDC A;  1KAW A;  5KRU A;  1TU2 B;  2B63 G;  3FDT A;  1TR5 A;  4N8X 1;  3J7A V;  5IP7 G;  1PLF A;  1EZ8 A;  5D14 A;  5AFW A;  4HJA A;  1I6V C;  1M8A A;  4KV6 A;  4A93 B;  1BXT A;  1QOH A;  1CHP D;  1KLG D;  5FJ8 G;  3H3V H;  3I4M B;  4AH6 A;  4TQU S;  3S1N H;  1HNX Q;  1H9S B;  4A3M B;  3AYH B;  4X65 Q;  3CMA A;  3U9O A;  1Q81 C;  5K36 G;  2JE6 I;  4DV7 L;  2PI2 E;  3K0X A;  5T1I A;  2DUD A;  2IHF A;  4UPA A;  1WJJ A;  4FXG C;  1EFI D;  5LMN L;  1FL0 A;  5K5P A;  1CKN A;  3M9B A;  3L0O A;  2CQA A;  2D0O A;  1G2S A;  1Y8O B;  1I94 Q;  4DR3 Q;  3MXP A;  3CHB D;  3RZD H;  2XSC A;  2RHS B;  4PNY A;  2KCT A;  3D4W A;  3NBH A;  2DNC A;  4DN4 M;  1C48 A;  1XPO A;  1C0A A;  3HFZ B;  4R8N A;  3FVQ A;  3UE1 A;  1TWH B;  1H9S A;  1S5D D;  1HFG A;  3F2C A;  3I90 A;  3HOX B;  2FMC A;  3K57 A;  2KJX A;  2RF4 A;  1A8V A;  1IZ6 A;  5KNC A;  2PQE A;  1FNV A;  2Y0S G;  2R7F A;  4LFA L;  1QUQ B;  1EYD A;  2WB1 G;  2B63 B;  3T4A C;  1CKO A;  5C3E B;  5DEH A;  1EWC A;  2EYJ A;  1FNU A;  2ZM6 L;  4K8I A;  2F0S A;  2AMC B;  4RG1 A;  3PO2 H;  3BVM A;  1EY4 A;  4JI4 L;  2IX1 A;  2X6L A;  5ELN A;  4H7B A;  2K5V A;  1I4G A;  1VQ8 A;  3D6W A;  2RA4 A;  5I9P A;  2LMC B;  5JJZ A;  4KHP L;  1YNN C;  1QZH A;  2D62 A;  2IWH A;  1PFM A;  1CK1 A;  4G4K A;  3CCS A;  3OOC A;  1IL8 A;  1RHP A;  3AFQ A;  4LF9 L;  1QUQ A;  2VNU D;  3GTK B;  4IFD J;  2ES2 A;  2DGY A;  2OXP A;  5IWA L;  2ALY B;  4KI0 A;  1EYC A;  1Z7T A;  2ZJQ A;  1K8O A;  2WFW A;  1BBU A;  4EQ5 A;  4A75 A;  1GJX A;  1JOO A;  4OL7 A;  2K5D A;  1JOK A;  4BBS H;  4QCL A;  1X3E A;  5I6Y A;  1PYS B;  3Q6S A;  4ZCK A;  1OXT A;  4JBK A;  1I4H A;  3M3Y H;  2ZXR A;  1PH9 A;  2K1B A;  3GTP H;  5LHY 1;  1CUK A;  5JEA H;  2K33 A;  5IGG A;  2LSS A;  4K0K L;  2JA8 H;  2JA6 G;  2C5C A;  1BBW A;  4BS9 A;  2WB1 B;  4LJZ C;  3TRZ A;  1G6P A;  5DLQ E;  1QIL A;  3EN2 A;  2PCF B;  5FKA C;  4KMU C;  1L0W A;  3I4N G;  4H13 C;  3VR5 A;  2VQF L;  4DV0 Q;  3SGI A;  4BY1 B;  4JI1 Q;  4X3S A;  1Q8I A;  3SDZ A;  1XTC D;  3J81 L;  3I4M H;  1TKW B;  3NTI A;  1AFP A;  4A3I G;  3M7N A;  3OW2 A;  1SR3 A;  1N32 Q;  3IAY A;  1D7Q A;  3FEW X;  5CV4 A;  4L63 B;  2XRS D;  5DAU A;  3NHH A;  1XJV A;  2RBM A;  1QVG A;  1E7Z A;  2WB1 E;  4XIG S;  4YWL A;  4A3J G;  4QUC A;  2EY2 A;  2EJG C;  1ZKO A;  3N52 A;  2UXD L;  1KDA A;  1CM9 A;  4JI0 Q;  4R4I A;  1W2B A;  4XTC S;  1U4M A;  3SK5 A;  1X3P A;  1SFO H;  4F8M A;  4F87 A;  3A56 A;  5J22 A;  1EWH A;  1X3Q A;  1SEB D;  3RLO A;  4G7Z C;  1B9M A;  4KLK A;  1XPR A;  1M1K C;  1Q12 A;  4KY6 A;  3HOW G;  4GKK Q;  1QNU A;  3H0G H;  1TWH H;  3I73 A;  4YY3 L;  4NXM Q;  4X66 Q;  3MXN B;  4BBR G;  2UU9 L;  3A8K E;  2CH4 A;  3HOX H;  4XDX A;  1STA A;  3OYY A;  4RGT A;  1QG7 A;  1JCK B;  4DV4 Q;  4R4C A;  3A8I E;  3R8B A;  2CH4 W;  1HQR D;  2JA6 B;  1NAP A;  4MTN A;  4QJF A;  4CDE C;  1LT4 D;  4B9X A;  1PVO A;  5CV9 A;  4OWT B;  1BQQ T;  1F9R A;  5C3E H;  3TP8 A;  1CTM A;  1HA5 A;  4KK7 A;  4AQY Q;  1PTO D;  3PF5 A;  3I4N B;  1HZC A;  1RIP A;  3SK6 A;  4A3I B;  1D5X C;  1CFM A;  2EYO A;  3D4R A;  4CBV A;  4APV A;  2EE1 A;  5LMU Q;  1CA5 A;  3IFD A;  1A2U A;  2K5W A;  3GTM B;  2HQL A;  4J15 A;  4DR5 L;  4DR4 L;  1FYC A;  2MHV A;  1OTC A;  1F9Q A;  3HEJ A;  2XNA C;  4YWK A;  2EYP A;  2F0F A;  1V1O A;  3QO2 A;  4A3J B;  4DV1 Q;  3GTK H;  4OGQ C;  5E3F A;  4JI8 L;  3SXH A;  4IUR A;  5ELD A;  3RR5 A;  1TY0 A;  2DN8 A;  2VZA A;  1N33 Q;  2L12 A;  2H4O A;  5A2Q L;  1XNQ L;  4P2C B;  4RKB A;  5CBE E;  4A76 A;  4IUN A;  1J5E Q;  3S1Q H;  4IUV A;  3M4P A;  1J9O A;  3HOW B;  1N34 L;  1BOS A;  2YTV A;  4K14 A;  3F2D A;  4BBR B;  3OWF A;  2F0Q A;  1YEZ A;  4UP7 A;  4DAP A;  1JWU D;  1VS0 A;  3T53 B;  5EGT A;  1PRT C;  2B39 A;  1BCP C;  2JA5 G;  5KEE A;  2UUA L;  3S16 B;  4LF8 L;  2F0P A;  4MTK A;  2UXB L;  4KHV A;  2OTJ A;  3EA6 A;  4A3E B;  3STB D;  3A74 A;  2PW5 A;  5M5W B;  2HQE A;  2EPB A;  4YIJ A;  1SAP A;  2NN6 H;  5I2Y A;  1HCZ A;  4BY1 H;  3O13 A;  1MJE A;  1EIY B;  1TS4 A;  3WOE A;  4PZ8 A;  3S2H H;  4C3J G;  4HSP A;  3J80 L;  1XNR L;  2YU9 B;  1M4V A;  1JB7 A;  4N9T A;  3F2U A;  3GTO B;  1EQV A;  2NTT A;  3NP8 A;  4MN3 A;  2O5J C;  2VY3 A;  1HA6 A;  4QQB X;  5M3M G;  2VUM H;  2F52 A;  1WFQ A;  1OXX K;  4ZQ3 A;  2SNS A;  1QVC A;  2A1A A;  3P1H A;  4X64 Q;  3JAM c;  2ZTC A;  3RMH A;  4KY5 A;  1Q1B A;  3ERS X;  5EKI A;  1B3Q A;  1TWA B;  3CQZ B;  1TWC B;  2Z8L A;  4EGV A;  1SNO A;  1HNX L;  2NWG A;  3S1R B;  1PA6 A;  4N8F A;  4R4T A;  1VQB A;  4X65 L;  1HTP A;  2O5I C;  2CWA A;  2K14 A;  1O7Y A;  4C2M B;  4POF A;  4CKC A;  2JA5 B;  3A5U A;  1LTR D;  1KHI A;  1KNE A;  3HOY H;  4HED A;  3UDI A;  4YCW A;  1X55 A;  4DR3 L;  3MZ5 A;  1JE4 A;  1GKH A;  1SNC A;  2Z6K A;  3G4S A;  3TSS A;  1U0L A;  1PH1 A;  4B3M Q;  2L0C A;  3I4N H;  2EY6 A;  1HQM C;  2EY1 A;  1FVI A;  4HSV A;  4OEL B;  3KF6 A;  5JJL A;  3CXC A;  4C3H G;  1GUT A;  1IBK Q;  4NP5 A;  1MSH A;  2TSS A;  3MHB A;  3GTM H;  1EFW A;  4DNT B;  3TP6 A;  2HUG A;  2V4D A;  2B2W A;  1NCV A;  2EXD A;  3PCO B;  1CT1 D;  5JAV A;  3JAM E;  2UUC Q;  1VQA A;  2Q2I A;  2Z4I A;  3GO5 A;  3KJO A;  5M3M B;  1UAP A;  2I5M X;  4KD3 A;  2O2L D;  1JR0 D;  1SJE D;  1YNJ C;  4ZKC B;  5ISR A;  1AW7 A;  1G51 A;  4DR7 Q;  4A3K G;  4QGU A;  3BZK A;  3PQI A;  4OO1 G;  2FJ2 A;  1W6J A;  5IGE A;  2K04 A;  3M7G A;  1ZYR D;  1LUZ A;  3MEF A;  1SRU A;  1R4P B;  1PH6 A;  3AB9 A;  3HOW H;  1T9H A;  1X32 A;  3I70 A;  2E2H H;  1AN8 A;  4J1M A;  5BN5 A;  3BVZ A;  4OON A;  1PTO H;  4JI5 L;  1GUN A;  3R93 A;  5C6A A;  1N8R C;  1VQC A;  4E6I A;  2LS0 1;  2K4K A;  1JE5 A;  4UP8 A;  3TDQ A;  2JK8 A;  4RWS C;  1BDO A;  4L8J A;  4A3E H;  3UDX A;  3A54 A;  1LTB D;  4G7O C;  1D2B A;  5M5W H;  4DAY B;  3NEL A;  4DFA A;  4BXX G;  1CSQ A;  4IQZ A;  4I7A A;  4WJW A;  3URY A;  4DK1 A;  3ZJY C;  5JVG 3;  1D5M C;  2J4X A;  4ZYS A;  4JOI C;  4R1J A;  3KLS A;  1DXM A;  1L1O C;  5M5Y B;  4C3H B;  2K52 A;  5C5M A;  2I5L X;  3G6J B;  3RN5 A;  2EXZ A;  3OW7 A;  1N36 Q;  1LTS D;  1O7Z A;  1I50 B;  3I91 A;  2D9U A;  1SNQ A;  3RLF A;  3E0J A;  4ZAI A;  1LT5 D;  3A55 A;  3D3R A;  2FFK B;  4O42 A;  4A3K B;  3DHQ A;  4K5X A;  3T1H Q;  1SMY D;  4DAY A;  2RDF A;  3NE5 B;  1SE2 A;  4I7Z C;  2CVR A;  2IX3 A;  4DV0 L;  4JI1 L;  3U9S A;  5C5L A;  4DKA C;  4YCV A;  3CQZ H;  4DK6 C;  1TWC H;  1N32 L;  3R2I A;  4Q5V A;  3S1R H;  2Q2T A;  1JC7 A;  3QIA A;  4EX5 A;  5J3B A;  4R8I A;  4P74 A;  5BN4 A;  4C2M H;  2OF1 A;  2PQA A;  4GLX A;  4B08 A;  4RA8 A;  3UE0 A;  3S9W A;  1I6H B;  4V19 0;  1LTL A;  5I4D A;  3KF8 B;  3H09 A;  3WDN A;  4JI0 L;  4RGM A;  2IY5 B;  1AE2 A;  4KKT A;  4IPG A;  1YZ6 A;  1PFS A;  1E0B A;  4I65 A;  1CKM A;  2AQ3 B;  4OX9 Q;  3OIQ A;  3QB3 A;  1IW7 C;  5DNF A;  4POG A;  2CKZ B;  3W2D A;  4X66 L;  3DWQ A;  2AUK A;  1ESR A;  1VQ4 A;  1SRO A;  1V1P B;  1EOV A;  3MFG A;  1SSO A;  1K9M C;  3GTG B;  1R4Q B;  1NBW A;  2BH8 A;  4DV4 L;  1VQO A;  4MIU A;  4JVZ A;  1JOQ A;  1IYV A;  4O2D A;  2B2U C;  5A35 A;  2LKV A;  4R4O A;  2HCI A;  4A3L G;  1GVP A;  2E8G A;  2XWB B;  4O1N A;  1HPC A;  1OXV A;  3MC0 B;  2LFN A;  3DUZ A;  2IHE A;  4AQY L;  4RMF A;  5LL6 X;  2A6H C;  1RCV D;  4Z9C B;  4KN4 C;  3SK4 A;  5I6W A;  4B9W A;  3NBI A;  1V43 A;  5M5X B;  2NVT H;  5LMU L;  1EY7 A;  4FNF A;  2QA4 A;  1SMX A;  4A3C H;  1LTG D;  5D3D A;  1TT2 A;  5KNB A;  4A3D H;  1SNM A;  3TRE A;  1EOT A;  1K3B C;  4DV1 L;  4AIM A;  3L9A X;  2L5T A;  5IP9 H;  2WKC A;  4O0A A;  3NEM A;  2K6A A;  1LAC A;  1S40 A;  4ZUJ A;  3I8Z A;  1N33 L;  1BKB A;  4LWC A;  4KHZ A;  3KJP A;  4R4Q A;  1FJG Q;  3ICE A;  2YTY A;  1J5E L;  5JJK A;  2RVL A;  3I56 A;  1YVC A;  5M5Y H;  1O7L A;  3MA2 B;  1PH3 A;  2PI2 A;  2XWJ B;  5C44 G;  5C0X H;  4KJO A;  1SE3 A;  5CV6 A;  2R92 G;  3CCJ A;  2R61 A;  4GNX C;  1QVF A;  2GVA A;  3K58 A;  1SN8 A;  4ZK9 B;  3C46 A;  3CME A;  1Y1W H;  2L15 A;  2SEB D;  4JBW A;  1VDZ A;  2Q8I B;  5FLX L;  3PO3 H;  4PMC A;  3X3N A;  3BZC A;  4PMW A;  4IFD H;  2B29 A;  1MSG A;  2XRQ D;  1BBX C;  3W1G A;  4DR2 Q;  1KC8 C;  1Y1V G;  3EVQ A;  1IKM A;  4X62 Q;  3KLS X;  3HOZ H;  3CCU A;  2RCF A;  3CCM A;  2NVX B;  4OHJ A;  2C35 B;  1UUP A;  3M4Q A;  4K8J A;  5IYD G;  2ICE C;  4WJ3 M;  3BVG A;  3A7A B;  1CZG A;  3PUZ A;  4GKJ L;  1S5C D;  3NXW A;  2K75 A;  1KAA A;  3M4O B;  2Q8R E;  4K2L A;  4HMJ A;  1YNN D;  3S15 B;  4LUV A;  1OXU A;  5COR A;  3PSI A;  1RL2 A;  1PH7 A;  5CR3 A;  5C4X G;  1B70 B;  2BDO A;  1A3U A;  4IUQ A;  4HIM A;  4PMB A;  2IW3 A;  1HUM A;  4JBJ A;  4ME5 A;  3FKI G;  1SND A;  2R92 B;  4A3F G;  1LO5 D;  1SJH D;  3PIP 3;  3EBE A;  4IAL A;  1RKN A;  2WIN B;  4DR1 Q;  3K5M A;  1BF4 A;  4H0L C;  2F0V A;  2KBN A;  1ICF B;  1S4Z A;  5IYB G;  2MUY A;  3WWV A;  2R93 H;  1UE6 A;  2VB2 X;  1EQQ A;  2M2L A;  1D8L A;  4RCN A;  5E1F A;  2J0T D;  2EVB A;  4X3K A;  1NR4 A;  4B3M L;  1RTN A;  1VQH A;  4C3I H;  5IGB A;  3HOV G;  4DV3 Q;  5IYC G;  2HCC A;  1Y1V B;  2Y0S B;  3OSO A;  4LF7 Q;  4NPS A;  1IBK L;  4NB3 A;  3S24 A;  1NY4 A;  3FRP B;  4XT3 B;  3J80 c;  5KIX A;  1E1O A;  1W3S A;  1VQJ A;  4LFB Q;  5EPK A;  5C3W A;  3HOY B;  2RCN A;  2UUC L;  3ZYY X;  3D0F A;  1ILQ A;  5IT9 c;  2OWO A;  3NPP A;  4A93 H;  1LTT D;  1PHJ A;  2AWN A;  2M9V A;  4LF5 Q;  1WD0 A;  2L1B A;  1JWM D;  4DR7 L;  3EIV A;  3HRZ C;  4OEM B;  4BWG B;  2Z6B A;  3CCE A;  4A3M H;  2A6E C;  2Y0S E;  5ELB A;  3L2P A;  2B2T A;  4FVM A;  4KN7 C;  3KYH C;  1K73 C;  1LYL A;  1TS3 A;  5EQ0 A;  1WVL A;  4DK3 C;  5C4X B;  2WAQ G;  4HJ9 A;  1B50 A;  2L55 A;  1K0R A;  1J8I A;  2PMZ E;  4UHV A;  2F3I A;  3FKI B;  2BE5 C;  3I7F A;  2KA7 A;  1UE5 A;  4A3F B;  1B9N A;  5FLM G;  1STH A;  4CDF C;  3HP3 A;  1D1I A;  1L2F A;  2R7D A;  3QOL A;  2XTI A;  1ONL A;  1DCZ A;  1S3O A;  3D8G A;  4GOP C;  3ER0 A;  3E6Z X;  1KRT A;  1BO0 A;  1XWE A;  5CBA E;  5EBC A;  5AJ3 L;  1S5F D;  2NN6 I;  2KVM A;  3DWP A;  5JEA J;  1HH2 P;  2CW0 C;  2XGT A;  4ZLT F;  1BNZ A;  1SBB B;  4HR7 B;  4FXK C;  4F7X A;  3HOV B;  3VYU A;  1OO9 B;  4DV5 Q;  2F0D A;  3I55 A;  1IBL Q;  2BCO A;  1GM5 A;  2N8N A;  5IT9 E;  3CRL C;  3MVV A;  2B63 H;  1VQ9 A;  1PDQ A;  1N36 L;  1XX8 A;  1IBM Q;  5IP7 H;  5IE8 A;  3PUY A;  1V8Q A;  2AQ1 B;  1VQD A;  2E74 C;  1JT8 A;  3K81 C;  5FJ8 H;  4DGZ A;  1D6E C;  4HTH A;  4DNR B;  5I9O A;  3T1H L;  3M4Y A;  2E2J B;  1EYG A;  3G71 A;  4Q0F A;  3MXN A;  5IGC A;  2NUC A;  3KLR A;  1PFB A;  4FF2 A;  3BDO A;  5K36 H;  4GOP B;  5ELC A;  3KOJ A;  2B8F A;  2KEE A;  4ME3 A;  1I3Q B;  3GTJ B;  3Q8D A;  3FPU B;  5C4J B;  3T13 A;  1E2Z A;  3CCV A;  4MHE A;  3K6O A;  1ET6 A;  2R92 H;  2NZ1 D;  1TWF B;  2EDG A;  1ASZ A;  1G91 A;  1ENA A;  3DEO A;  4FF1 A;  1TWG B;  4B3T Q;  3NUC A;  1BR9 A;  3AMU A;  5E4W C;  2VQE Q;  4OXP A;  3VR3 A;  5M3F G;  1A2T A;  1ICW A;  3K0Y A;  3P75 A;  3BS1 A;  4HIO A;  2PW7 A;  3N6R A;  1VF5 C;  1E2W A;  2B2V C;  1U5K A;  4DXF A;  1SYF A;  5I2X A;  1L0X B;  4JCV E;  1PRT D;  5FO7 B;  3AU7 A;  1BCP D;  3PUX A;  2E75 C;  1A6X A;  1GUW A;  5JVH 3;  4LF6 Q;  3RN2 A;  4OX9 L;  3HOU G;  3EQL C;  3J7A 5;  4CKE A;  2VB3 X;  1BUV T;  3U58 A;  2MFI A;  3G48 A;  3PUV A;  4K6L A;  2PZU A;  1I4R A;  1DM0 B;  1KL9 A;  3GD7 A;  5LMN Q;  2MP1 A;  3K80 C;  2E2D C;  4PG3 A;  1VQP A;  1EIF A;  4ZRZ A;  5IYD H;  2N55 A;  1Z9F A;  5COY A;  4HAE A;  2L9H A;  3SEB A;  1VQ6 A;  1R9T B;  4GN5 A;  2QF7 A;  4DXG A;  4H02 A;  2I46 A;  3TS2 A;  4DNI A;  1PV4 A;  1Q82 C;  2F0N A;  4KTA A;  1LTA D;  2ZJR A;  3PIO A;  2F3W A;  4IJL A;  2K05 A;  2EOT A;  3C1E A;  3CU7 A;  3IL8 A;  3NWT A;  2MPM A;  1PRT B;  5GRO A;  3D31 A;  1BCP B;  1JJG A;  3HKZ G;  2B2W C;  3K5N A;  2HDM A;  5NUC A;  1VCI A;  1ENF A;  2WAC A;  3PMF A;  5FO8 B;  1WCM G;  4Y52 H;  4JI7 Q;  2NZO A;  1NSN S;  1PRT F;  4LNQ A;  1B1Z A;  1BCP F;  1PH8 A;  1CA6 A;  4G7H C;  1JQY D;  5M3F B;  2PZW A;  3C3L A;  3W3A A;  2AKW B;  2QGQ A;  1FNW A;  2F4V Q;  1NJI C;  3E9I A;  3CP0 A;  3RZO B;  1X65 A;  1E3P A;  3HOU B;  1YBY A;  4GLV B;  2DY7 A;  3TN2 A;  1JJC B;  2JA6 H;  1SYE A;  1F9P A;  1KDB A;  4NXN Q;  2EYF A;  3MXG A;  3QJY A;  2IX0 A;  3TZU A;  4UAI A;  2GN5 A;  1EIG A;  1AZP A;  1DON A;  3H94 A;  1I94 L;  4X3T A;  3KDF B;  1PH5 A;  2TMP A;  4IPH A;  2QDB A;  2B2Y C;  4Y7N B;  2P5Z X;  4QY7 A;  3QR8 A;  3BZD B;  5EKK A;  2SOB A;  4RGN A;  2JA9 A;  4ALP A;  2RDH A;  1UE1 A;  3DXJ C;  2N88 A;  4A3I H;  1K8A C;  2A69 D;  1AEX A;  4C3J B;  2A69 C;  4QIW B;  3DEP A;  4K6D A;  4GS3 A;  1ML0 D;  2K01 A;  4M8A A;  4LFC Q;  2Q2U A;  1U4P A;  1DD2 A;  1STN A;  1PFN A;  3GTJ H;  4DR2 L;  1MKH A;  4JV5 Q;  4X62 L;  1O80 A;  4A3J H;  1VQE A;  4JI2 Q;  3GTL B;  1YNJ D;  2JP1 A;  1IYU A;  3GDE A;  3ND8 A;  4IUT A;  3ONA B;  5IOC A;  3Q0A A;  4IZ8 A;  4CJ2 C;  2GA4 B;  3ERO A;  1WCM B;  5FK9 C;  2BDN A;  4QIW E;  3H3V C;  4WFN 3;  3A5Z B;  2WII B;  4NKL A;  2CFM A;  4DV6 Q;  3DM3 A;  2G5D A;  4OIK A;  4BBR H;  2G9H D;  1HNW Q;  1EY9 A;  2LXJ A;  3SR1 A;  1JOR A;  1Y8N B;  5CC4 A;  1LAB A;  1VQ5 A;  3TP7 A;  4CJ0 B;  1Y8P B;  1EQR A;  4DAV A;  3S16 H;  3HKZ E;  1H95 A;  4GZY C;  2OEO A;  4LAA A;  4CJ1 B;  2FXQ A;  1SNP A;  3PIO 3;  3E0E A;  1SYG A;  2NVQ B;  4DR1 L;  2EYM A;  2RQX A;  1OXS C;  2UXD Q;  1U9R A;  4FF3 A;  1O78 A;  1VQK A;  2WKD A;  1E1T A;  3SHL A;  3K7U C;  2JQO A;  3TBI B;  5FLX c;  3PO2 G;  1WTW A;  5GAD C;  4RH6 A;  1X56 A;  1EY0 A;  1PXU A;  2ZTE A;  3S1N B;  1EU4 A;  1PYW D;  2V1C C;  2YU9 H;  2CQO A;  3QOJ A;  1NMG A;  1Q90 A;  4DK0 A;  4KKU A;  1HHV A;  3SVM A;  1DOM A;  4LF7 L;  3GTO H;  3NQI A;  3IRB A;  1KIX A;  1GUO A;  1QE6 A;  1CZW A;  3GV3 A;  4M1U B;  3BU2 A;  2FIN B;  4LFB L;  1GHJ A;  1RF2 D;  1C8C A;  1XMO Q;  2DJF C;  3MWY W;  4FXD A;  1G6Z A;  3H3V I;  1SE4 A;  3DLL A;  1STY A;  1TWA H;  4LF5 L;  4IUU A;  3R3O A;  1EU3 A;  3NTH A;  3E9H A;  4WRD A;  1QZG A;  3ULP A;  2CCZ A;  4A3B G;  1HUN A;  3X3M A;  4L5Q A;  4BBS G;  1YNX A;  4XT1 B;  3GV6 A;  4XQQ A;  3S1M B;  3HOU H;  2JA5 H;  1L1O B;  5C0X I;  5JPM C;  2ID0 A;  3CCR A;  5JEA G;  5BR8 Q;  5J1Z A;  1WI5 A;  5LMN W;  2ZJP A;  2JA8 G;  3T51 B;  3WOF A;  2Q2H A;  5FLX E;  2PPB C;  3HZX A;  1KTK A;  1QJO A;  3CC7 A;  1IW7 D;  2X6G A;  3B6Y A;  4HCS A;  4H44 C;  1PZJ D;  4K5V A;  3M85 A;  1WTV A;  1XMQ Q;  3NTK A;  1MIU A;  4RAU C;  4JBM A;  4GKK L;  1ILP A;  3I3C A;  4C3J H;  4NXM L;  1DYQ A;  4TVA B;  4ABN A;  3PO2 B;  1KAB A;  4FDB A;  5EBD A;  1B3A A;  1Y69 U;  4JG2 A;  3A0J A;  1XNQ Q;  4V0B A;  4QF4 A;  2XVS A;  4JOI A;  2DJG C;  3QG1 A;  1K83 B;  3ULJ A;  4DV5 L;  1NUC A;  1J6Q A;  3HGB A;  1IBL L;  1ET9 A;  1I4P A;  2CWP A;  5M3M H;  3GTL H;  3KF8 A;  1DZ1 A;  5IOD A;  5L37 A;  2IJ0 A;  2QW7 A;  3AQQ A;  4P75 A;  1IBM L;  2F0I A;  2JYO A;  2A6H D;  3LWU A;  1EEF D;  4NMZ A;  1KXL A;  4DUZ Q;  2N78 A;  2M00 A;  3J81 c;  2J7Z A;  2KEN A;  3I4L A;  4X3U A;  1V1P A;  4A3B B;  2PO4 A;  5KYI A;  1YIJ A;  4BBS B;  2DY8 A;  5DM6 3;  3H0G G;  3ULL A;  2MO0 A;  1TXY A;  5J39 A;  3SK8 A;  2NVY B;  1VMP A;  3M3Y B;  3Q23 A;  2BA1 A;  4RHR A;  4KY7 A;  1GO3 E;  4U68 A;  3GTP B;  2YYZ A;  3VYT A;  4IPC A;  4CKB A;  2HT1 A;  2R7Z G;  3EJI A;  4B3T L;  3LWE A;  1EY5 A;  2NVQ H;  1SLJ A;  3QWN A;  4DR6 Q;  1CKN B;  4PZ6 A;  1EL0 A;  2VQE L;  3CC2 A;  5HGT A;  3Q22 A;  3F1Z A;  1PH2 A;  5C3E G;  4FP5 D;  4L6T B;  1YHA A;  2ZTD A;  1ROD A;  3K59 A;  2B3G A;  4EQN A;  4C3H H;  4P71 A;  4LUZ A;  3NBH B;  3AFP A;  1IKL A;  1S72 A;  3NWS A;  4UDU C;  1S5E D;  4LF6 L;  5CMD A;  5ELF A;  3TQY A;  2BH2 A;  1I50 H;  4HCE A;  4JI6 Q;  3E3X A;  4CGY B;  1CI3 M;  4BY7 G;  3OTO Q;  2H1E A;  2HDL A;  4JPB W;  1GUS A;  1WTO A;  1ZXT A;  1T5E A;  2B2U A;  3KBG A;  4A3K H;  4R9W A;  5C4Z A;  3J81 E;  2KHJ A;  2D2C C;  4OO1 H;  1E22 A;  1H9M A;  4JYA Q;  1SFO B;  2UUB Q;  1HR0 Q;  1B4O A;  3D4D A;  3U4V A;  4P73 A;  1AZQ A;  1I4Q A;  3J7Z C;  1K28 A;  1SDF A;  4QL5 A;  4ILW A;  3A8J E;  4IPD A;  2HIX A;  4FF4 A;  2K5N A;  3VYS A;  4A3G G;  3J81 j;  3CCL A;  5TSS A;  3S1M H;  3H0G B;  3NK9 A;  2JSO A;  2K03 A;  5ELO A;  1CSP A;  3ITP A;  1UEA B;  4GN4 B;  1X54 A;  4ID6 A;  2A68 D;  1F2Z A;  2A68 C;  4JC0 A;  1I6H H;  1ENC A;  1YJW A;  3MAQ A;  4PQX A;  4GNX B;  4DU9 A;  2R3Z A;  2R7Z B;  2LXK A;  2Q8T A;  4X64 L;  1D5Z C;  4BA1 I;  2RSO A;  1EZ6 A;  1SYC A;  1EEI D;  2ICI A;  4JI7 L;  4BXX H;  3S14 B;  4KJN A;  3T1Y Q;  1MJC A;  2HHH Q;  1E24 A;  1CQF A;  4B3R Q;  5HY6 A;  4HJ5 A;  2F4V L;  2NN6 G;  3OPO A;  1EIH A;  3DM1 A;  2K5Q A;  1U4L A;  5C0X J;  4BY1 G;  5C44 B;  1O7I A;  4HJ7 A;  3GTG H;  1RD9 D;  2B2T C;  3BYY B;  1FGB D;  3LX0 A;  3EFX D;  1QNK A;  4HIK A;  4EQO A;  1K83 H;  2I5H A;  4NXN L;  1I4X A;  1F2Y A;  4TRD A;  4S3S A;  4BY7 B;  4JI5 Q;  1Q1E A;  5D3I B;  5LL6 S;  1JIC A;  3V05 A;  4GNX A;  2EIF A;  2G9D A;  2PYK A;  3DMU A;  3TZD A;  2KQ3 A;  1UE7 A;  4LF4 Q;  4HMI A;  3BJU A;  2VUM G;  1EY6 A;  5CV8 A;  1A63 A;  3HG9 A;  1CHQ D;  2QKI C;  2C9O A;  1GD7 A;  1MGS A;  4J6H A;  2I07 B;  1YHB A;  2QDL A;  1XYI A;  4MZ9 A;  5H1S E;  2E5L Q;  2QEX A;  3H91 A;  5JOB A;  5M5X H;  3CD6 A;  3V2T A;  4DV2 Q;  1A0I A;  4A3B H;  1AH9 A;  5C3X A;  4LFC L;  3OMC A;  4A3G B;  3S1Q B;  3LGJ A;  3CCQ A;  4JV5 L;  3K7A B;  2PMZ B;  2MNA A;  1C9O A;  2NVY H;  4NW2 A;  1H9K A;  1B7Y B;  3ND9 A;  2ZT9 C;  4JI2 L;  1GUG A;  4RKL A;  5GAE C;  1Q3L A;  3GTQ B;  2OT2 A;  2E76 C;  2NYZ D;  4AYB G;  4ZKB B;  1IXR A;  1LLR D;  4X6A H;  2N49 A;  1YJN A;  3HOY G;  2K7V A;  5A2Q E;  2A6E D;  4YWM A;  1X3G A;  3CKI B;  5CGK A;  1L0Y B;  2OCE A;  4ZUI A;  4ULL A;  3NSW A;  2AHO B;  2AUJ D;  3W1B A;  4DV6 L;  1DJR D;  2HIV A;  4YHH Q;  2D5D A;  4JW0 A;  1UWV A;  1HNW L;  2VL6 A;  5C4H A;  5D65 A;  3PGZ A;  4BA2 I;  1HXY D;  2BE5 D;  1LTI D;  5T1G A;  2SDF A;  3NQT A;  3S2H B;  1ASY A;  1STB A;  4UY8 C;  3TME A;  3R2T A;  2KCN A;  3PF4 A;  3C1F A;  2H5X A;  4A3L H;  1F9S A;  1IHZ A;  1PH4 A;  1WTH A;  4B3S Q;  1UNS A;  2R6G A;  1H9J A;  2KHI A;  4OIJ A;  1JMC A;  1B44 D;  1VQG A;  2VUM B;  3P20 A;  1I5F A;  3JAM i;  2MJ8 A;  2CW0 D;  2EJM A;  1LT6 D;  2F3V A;  3J80 E;  1FR3 A;  1Z6H A;  3BG3 A;  3FMC A;  1A15 A;  3F8T A;  4G57 A;  1K8G A;  3PUW A;  3D6C A;  4GLA C;  2MO1 A;  2XN9 C;  3HKS A;  5GQO A;  1XTD A;  4HJ8 A;  3T16 A;  4DA2 A;  2NVX H;  2L11 A;  1HZ9 A;  2F1M A;  1DGS A;  1X3F A;  1B2T A;  3GP7 A;  5E4X A;  2XIW A;  4IUP A;  3KFU A;  2R7Z H;  4LW1 A;  4ODG A;  4AYB B;  2GVB A;  3M4O H;  3KBX A;  1HNZ Q;  4C1N I;  2UXC Q;  1XMO L; 
#chains in the Genus database with same CATH homology
 4WOR A;  3S17 B;  2WP8 J;  3RD4 A;  3MEH A;  3V96 A;  2F0E A;  2QEJ C;  2WAQ B;  1PMR A;  1PTO C;  3MTS A;  2F0M A;  1A3T A;  3OHX C;  3VYR A;  3P7J A;  2F0T A;  2ZXO A;  5IGD A;  1WTR A;  2EZV A;  1GHK A;  4XQJ A;  4LK1 C;  5IIF A;  3KK7 A;  3VR6 A;  1KNA A;  3VR2 A;  3S2D B;  2PNR C;  1EY8 A;  2AWO A;  4NDX A;  2A73 B;  2QIL A;  2RDG A;  1EQT A;  5CV7 A;  2KED A;  2LY7 A;  2F4I A;  3Q24 A;  2VXW A;  2K28 A;  2SNM A;  3OWE B;  1WD1 A;  5IGF A;  1HFN A;  3KUP A;  2E2H B;  3TP5 A;  4XYQ A;  4K5W A;  1PTO B;  2WV6 D;  2BOS A;  4DF7 A;  2NTS A;  2KCC A;  1PTO F;  1T5X D;  1KDC A;  2QCP X;  4FO2 A;  4KD4 A;  1ZEQ X;  3SE0 A;  3K5O A;  5EPL A;  2FMM A;  2IL8 A;  2EYH A;  5FO9 B;  5IT9 L;  4FYD A;  1TS2 A;  1MI2 A;  1TQO A;  2IT1 A;  1DOL A;  2DNE A;  2JA7 B;  4CHT B;  1MD2 D;  3MXU A;  2Z1C A;  3T56 B;  2B2V A;  1VMC A;  1RTO A;  2RSN A;  2EJF C;  4EQP A;  5KYL A;  1S5B D;  4C56 C;  2ENB A;  1STE A;  3L7Z C;  3J7A F;  1GOZ A;  4LMQ D;  2F0J A;  5F2D A;  4QMG A;  2AQ2 B;  1W6K A;  3OIP A;  4TKO B;  5HUR A;  2NB0 A;  1AP0 A;  4XYO A;  1TVX A;  2F0H A;  1PZK D;  2F0L A;  1H9R A;  3MFY A;  2FHT A;  1QWY A;  3HKZ B;  1WTQ A;  5M9O A;  2RKS A;  1JWS D;  1PZI D;  5C0X G;  4U67 3;  3E5S A;  1WTX A;  1G2T A;  4XXE A;  3UI2 A;  2IPK D;  1NR2 A;  1HTL D;  1F2M A;  3CRK C;  3LNN A;  1XXG A;  4PV1 C;  3VR4 A;  2E2I B;  1KLU D;  5DM7 3;  4IFD G;  1GXD C;  2JEB I;  1SYD A;  1LV9 A;  1ZYR C;  3K5L A;  2F03 A;  3ERQ A;  5CYU A;  2NVT B;  3VA7 A;  5EPJ A;  2NBF A;  3A7L A;  4A3D B;  2PZT A;  2ZXP A;  2B2Y A;  3RUZ A;  5KND A;  1II3 A;  1RJT A;  4K2K A;  2F0K A;  3HS0 C;  1SXT A;  3BYT B;  3J7Y W;  5G3L D;  1Z47 A;  2Z4H A;  2A74 C;  3GQB A;  4HN7 A;  5FOB B;  4EVO A;  3BDL A;  4QB4 A;  2O4X A;  1JB3 A;  5EJW A;  4XQN A;  1RDP D;  4RHS A;  2JEA I;  2JXM B;  2KHS A;  3IFT A;  3RZD B;  1TY2 A;  2L4N A;  1B53 A;  1Y1W B;  2EY5 A;  5EKL A;  3L3O C;  3PO3 B;  1D1K A;  1SMY C;  1TS5 A;  1QCB D;  3VA5 A;  5JPN C;  2F0W A;  4C3I G;  1U4R A;  3DWA A;  3JAM L;  3HOZ B;  1F77 A;  2X69 A;  2CHB D;  4IFD I;  4OO1 I;  2F0U A;  5BN3 A;  3IKJ A;  1F2L A;  4RFB A;  4KKS A;  4J8Q A;  5G3L F;  1G29 1;  1WTP A;  4QUF A;  1HRJ A;  1SYB A;  3C2P A;  3H6M A;  4IN3 A;  4C1N K;  1EYA A;  2KEC A;  2A5H A;  4RGO S;  1K8M A;  4JK1 C;  4RCO A;  1ESF A;  3PV0 A;  1VF7 A;  2MGS A;  2F0O A;  1DOK A;  2KUM A;  1CQV A;  2EYL A;  3FPP A;  2K32 A;  1A3V A;  2KOL A;  4TSS A;  2R93 B;  1LT3 D;  5KGU A;  1QB5 D;  1TII D;  4F88 A;  4N9P A;  1E2V A;  1C4Q A;  3I72 A;  1FD7 D;  3G7L A;  1G8Z D;  2B8G A;  5CV5 A;  4C3I B;  1STG A;  5ELE A;  3OMG A;  2JA8 B;  1MBY A;  2F0G A;  2BA0 A;  3BDC A;  5KRU A;  1TU2 B;  3FDT A;  1TR5 A;  3J7A V;  1PLF A;  1EZ8 A;  5D14 A;  5AFW A;  1I6V C;  1M8A A;  4KV6 A;  4A93 B;  1BXT A;  1QOH A;  1CHP D;  1KLG D;  3I4M B;  4TQU S;  1H9S B;  4A3M B;  3U9O A;  5K36 G;  2JE6 I;  5T1I A;  4FXG C;  1EFI D;  5K5P A;  2CQA A;  1G2S A;  1Y8O B;  3MXP A;  3CHB D;  2XSC A;  4PNY A;  3D4W A;  3NBH A;  2DNC A;  4DN4 M;  1C48 A;  4R8N A;  3FVQ A;  1TWH B;  1H9S A;  1S5D D;  1HFG A;  3I90 A;  3HOX B;  2FMC A;  3K57 A;  2KJX A;  5KNC A;  2PQE A;  1FNV A;  1EYD A;  2B63 B;  3T4A C;  5C3E B;  5DEH A;  1EWC A;  2EYJ A;  1FNU A;  4K8I A;  2F0S A;  3BVM A;  1EY4 A;  2IX1 A;  2X6L A;  4H7B A;  1I4G A;  3D6W A;  2RA4 A;  5I9P A;  2LMC B;  5JJZ A;  1YNN C;  2D62 A;  2IWH A;  1PFM A;  1CK1 A;  4G4K A;  3OOC A;  1IL8 A;  1RHP A;  2VNU D;  3GTK B;  4IFD J;  2OXP A;  4KI0 A;  1EYC A;  1Z7T A;  1K8O A;  1GJX A;  1JOO A;  4OL7 A;  2K5D A;  1JOK A;  4QCL A;  5I6Y A;  3Q6S A;  1OXT A;  1I4H A;  2ZXR A;  2K1B A;  5LHY 1;  5JEA H;  2K33 A;  5IGG A;  2C5C A;  4BS9 A;  2WB1 B;  4LJZ C;  1QIL A;  2PCF B;  5FKA C;  4KMU C;  4H13 C;  3VR5 A;  4BY1 B;  3SDZ A;  4X3S A;  1Q8I A;  3J81 L;  1XTC D;  1TKW B;  3NTI A;  1AFP A;  3M7N A;  3IAY A;  3FEW X;  5CV4 A;  4L63 B;  2XRS D;  5DAU A;  3NHH A;  2RBM A;  4XIG S;  4QUC A;  2EY2 A;  2EJG C;  1ZKO A;  3N52 A;  1KDA A;  1CM9 A;  4XTC S;  1U4M A;  3SK5 A;  1X3P A;  4F8M A;  4F87 A;  3A56 A;  5J22 A;  1EWH A;  1X3Q A;  1SEB D;  4G7Z C;  1B9M A;  1Q12 A;  4KY6 A;  1QNU A;  3I73 A;  3A8K E;  4XDX A;  1STA A;  4RGT A;  1QG7 A;  1JCK B;  3A8I E;  3R8B A;  1HQR D;  2JA6 B;  1NAP A;  1LT4 D;  4B9X A;  5CV9 A;  1BQQ T;  1F9R A;  3TP8 A;  1CTM A;  1HA5 A;  4KK7 A;  3I4N B;  1PTO D;  3SK6 A;  4A3I B;  1D5X C;  1CFM A;  2EYO A;  3D4R A;  4CBV A;  2EE1 A;  1CA5 A;  3IFD A;  1A2U A;  2K5W A;  3GTM B;  1FYC A;  2MHV A;  1F9Q A;  3HEJ A;  2XNA C;  2EYP A;  2F0F A;  1V1O A;  3QO2 A;  4A3J B;  4OGQ C;  5E3F A;  3SXH A;  4IUR A;  5ELD A;  1TY0 A;  2DN8 A;  2L12 A;  2H4O A;  5A2Q L;  4P2C B;  4RKB A;  5CBE E;  4IUN A;  4IUV A;  3HOW B;  1J9O A;  1BOS A;  4K14 A;  4BBR B;  3OWF A;  2F0Q A;  4DAP A;  1JWU D;  3T53 B;  5EGT A;  1PRT C;  2B39 A;  1BCP C;  5KEE A;  3S16 B;  2F0P A;  4KHV A;  3EA6 A;  4A3E B;  2PW5 A;  5M5W B;  2HQE A;  2EPB A;  4YIJ A;  1SAP A;  2NN6 H;  5I2Y A;  1HCZ A;  3O13 A;  1TS4 A;  3WOE A;  4C3J G;  4HSP A;  3J80 L;  2YU9 B;  1M4V A;  4N9T A;  3F2U A;  3GTO B;  1EQV A;  2NTT A;  3NP8 A;  4MN3 A;  2O5J C;  1HA6 A;  1OXX K;  4ZQ3 A;  2SNS A;  3P1H A;  3RMH A;  4KY5 A;  1Q1B A;  5EKI A;  1TWA B;  3CQZ B;  1TWC B;  2Z8L A;  4EGV A;  1SNO A;  2NWG A;  3S1R B;  1HTP A;  2O5I C;  1O7Y A;  4C2M B;  4CKC A;  2JA5 B;  1LTR D;  1KNE A;  4HED A;  3MZ5 A;  1JE4 A;  1SNC A;  3TSS A;  2L0C A;  2EY6 A;  1HQM C;  2EY1 A;  4HSV A;  4C3H G;  1GUT A;  4NP5 A;  1MSH A;  2TSS A;  3MHB A;  4DNT B;  3TP6 A;  2HUG A;  2V4D A;  2B2W A;  1NCV A;  3JAM E;  1CT1 D;  5JAV A;  2Z4I A;  3GO5 A;  5M3M B;  1UAP A;  4KD3 A;  2O2L D;  1JR0 D;  1SJE D;  1YNJ C;  4ZKC B;  5ISR A;  1AW7 A;  4OO1 G;  2FJ2 A;  1W6J A;  5IGE A;  2K04 A;  3M7G A;  1ZYR D;  1R4P B;  3AB9 A;  1X32 A;  3I70 A;  1AN8 A;  4J1M A;  5BN5 A;  3BVZ A;  1PTO H;  1GUN A;  3R93 A;  5C6A A;  4E6I A;  2LS0 1;  3TDQ A;  4RWS C;  1BDO A;  4L8J A;  3A54 A;  1LTB D;  4G7O C;  1D2B A;  4DFA A;  4IQZ A;  4WJW A;  3URY A;  4DK1 A;  5JVG 3;  1D5M C;  2J4X A;  4ZYS A;  3KLS A;  1DXM A;  5M5Y B;  4C3H B;  5C5M A;  3G6J B;  2EXZ A;  3OW7 A;  1LTS D;  1O7Z A;  1I50 B;  3I91 A;  2D9U A;  3RLF A;  1SNQ A;  3E0J A;  4ZAI A;  1LT5 D;  3A55 A;  3D3R A;  2FFK B;  4O42 A;  4A3K B;  3DHQ A;  4K5X A;  1SMY D;  4DAY A;  2RDF A;  3NE5 B;  1SE2 A;  4I7Z C;  2CVR A;  2IX3 A;  3U9S A;  5C5L A;  3R2I A;  4Q5V A;  1JC7 A;  3QIA A;  4R8I A;  5BN4 A;  2OF1 A;  4B08 A;  4RA8 A;  3S9W A;  1I6H B;  4V19 0;  5I4D A;  3H09 A;  3WDN A;  4RGM A;  4KKT A;  1E0B A;  4I65 A;  2AQ3 B;  3OIQ A;  3QB3 A;  1IW7 C;  5DNF A;  3W2D A;  3DWQ A;  2AUK A;  1ESR A;  1V1P B;  3MFG A;  1SSO A;  3GTG B;  1R4Q B;  4MIU A;  1JOQ A;  1IYV A;  2B2U C;  5A35 A;  2LKV A;  2HCI A;  2XWB B;  4O1N A;  1HPC A;  1OXV A;  3MC0 B;  2LFN A;  3DUZ A;  5LL6 X;  2A6H C;  1RCV D;  4Z9C B;  4KN4 C;  3SK4 A;  5I6W A;  4B9W A;  3NBI A;  1V43 A;  5M5X B;  1EY7 A;  4FNF A;  1LTG D;  5D3D A;  1TT2 A;  5KNB A;  1SNM A;  1EOT A;  3L9A X;  2L5T A;  2WKC A;  2K6A A;  1LAC A;  4ZUJ A;  3I8Z A;  4KHZ A;  2RVL A;  1O7L A;  3MA2 B;  2XWJ B;  5C0X H;  4KJO A;  1SE3 A;  5CV6 A;  2R61 A;  3K58 A;  4ZK9 B;  3C46 A;  2SEB D;  4JBW A;  1VDZ A;  2Q8I B;  5FLX L;  4PMC A;  3X3N A;  4PMW A;  4IFD H;  1MSG A;  2XRQ D;  1BBX C;  1IKM A;  3EVQ A;  3KLS X;  2NVX B;  4OHJ A;  1UUP A;  4K8J A;  2ICE C;  3BVG A;  3A7A B;  1CZG A;  3PUZ A;  1S5C D;  3NXW A;  1KAA A;  3M4O B;  2Q8R E;  4K2L A;  4HMJ A;  1YNN D;  3S15 B;  1OXU A;  5COR A;  5CR3 A;  2BDO A;  1A3U A;  4IUQ A;  4PMB A;  2IW3 A;  1HUM A;  4ME5 A;  1SND A;  2R92 B;  1LO5 D;  1SJH D;  3PIP 3;  4IAL A;  1RKN A;  2WIN B;  3K5M A;  1BF4 A;  4H0L C;  2F0V A;  1S4Z A;  2MUY A;  2VB2 X;  2M2L A;  4RCN A;  5E1F A;  2J0T D;  2EVB A;  4X3K A;  1NR4 A;  1RTN A;  5IGB A;  2HCC A;  1Y1V B;  2Y0S B;  3OSO A;  3FRP B;  4XT3 B;  5KIX A;  5EPK A;  5C3W A;  3HOY B;  3ZYY X;  1ILQ A;  3NPP A;  1LTT D;  2AWN A;  2M9V A;  1WD0 A;  2L1B A;  1JWM D;  3HRZ C;  4BWG B;  2A6E C;  5ELB A;  2B2T A;  4FVM A;  4KN7 C;  1TS3 A;  5EQ0 A;  1WVL A;  5C4X B;  1B50 A;  2L55 A;  1J8I A;  3FKI B;  2BE5 C;  4A3F B;  2KA7 A;  1B9N A;  1STH A;  3HP3 A;  1D1I A;  3QOL A;  1ONL A;  1DCZ A;  3D8G A;  3E6Z X;  1BO0 A;  1XWE A;  5CBA E;  5EBC A;  1S5F D;  2NN6 I;  2KVM A;  3DWP A;  5JEA J;  2CW0 C;  4ZLT F;  1BNZ A;  1SBB B;  4HR7 B;  4FXK C;  4F7X A;  3HOV B;  3VYU A;  1OO9 B;  2F0D A;  2BCO A;  5IT9 E;  3CRL C;  3MVV A;  1PDQ A;  1XX8 A;  3PUY A;  1V8Q A;  2AQ1 B;  2E74 C;  4DGZ A;  1D6E C;  4HTH A;  4DNR B;  5I9O A;  3M4Y A;  2E2J B;  4Q0F A;  3MXN A;  5IGC A;  2NUC A;  3KLR A;  1PFB A;  4FF2 A;  3BDO A;  5K36 H;  5ELC A;  2B8F A;  2KEE A;  1I3Q B;  3GTJ B;  3FPU B;  5C4J B;  3T13 A;  1E2Z A;  4MHE A;  3K6O A;  1ET6 A;  2NZ1 D;  1TWF B;  2EDG A;  1G91 A;  1ENA A;  3DEO A;  4FF1 A;  1TWG B;  3NUC A;  1BR9 A;  3AMU A;  5E4W C;  3VR3 A;  1A2T A;  1ICW A;  3K0Y A;  3P75 A;  3BS1 A;  2PW7 A;  3N6R A;  1VF5 C;  1E2W A;  2B2V C;  4DXF A;  1SYF A;  5I2X A;  1L0X B;  1PRT D;  5FO7 B;  1BCP D;  3AU7 A;  3PUX A;  2E75 C;  1A6X A;  1GUW A;  5JVH 3;  3EQL C;  4CKE A;  2VB3 X;  1BUV T;  3PUV A;  4K6L A;  2PZU A;  1I4R A;  1DM0 B;  3GD7 A;  2MP1 A;  2E2D C;  4ZRZ A;  2N55 A;  5COY A;  4HAE A;  2L9H A;  3SEB A;  1R9T B;  2QF7 A;  4DXG A;  2I46 A;  2F0N A;  4KTA A;  1LTA D;  2F3W A;  2K05 A;  2EOT A;  3C1E A;  3CU7 A;  3IL8 A;  3NWT A;  2MPM A;  1PRT B;  3D31 A;  1BCP B;  2B2W C;  3K5N A;  2HDM A;  5NUC A;  1VCI A;  1ENF A;  2WAC A;  3PMF A;  5FO8 B;  1NSN S;  1PRT F;  1B1Z A;  1BCP F;  1CA6 A;  4G7H C;  1JQY D;  5M3F B;  2PZW A;  3C3L A;  3W3A A;  1FNW A;  3RZO B;  3HOU B;  2DY7 A;  3TN2 A;  1SYE A;  1F9P A;  1KDB A;  2EYF A;  3MXG A;  3QJY A;  2IX0 A;  3TZU A;  4UAI A;  1AZP A;  1EIG A;  1DON A;  3H94 A;  4X3T A;  2TMP A;  2QDB A;  2B2Y C;  4Y7N B;  5EKK A;  3BZD B;  2SOB A;  4RGN A;  2RDH A;  3DXJ C;  2N88 A;  2A69 D;  1AEX A;  4C3J B;  2A69 C;  4QIW B;  3DEP A;  4K6D A;  1ML0 D;  2K01 A;  4M8A A;  1U4P A;  1DD2 A;  1STN A;  1PFN A;  1O80 A;  3GTL B;  1YNJ D;  2JP1 A;  1IYU A;  3ND8 A;  4IUT A;  3ONA B;  5IOC A;  3Q0A A;  4IZ8 A;  4CJ2 C;  2GA4 B;  3ERO A;  1WCM B;  5FK9 C;  2BDN A;  3H3V C;  4WFN 3;  2WII B;  4NKL A;  4OIK A;  2G9H D;  1EY9 A;  3SR1 A;  1JOR A;  1Y8N B;  5CC4 A;  1LAB A;  3TP7 A;  4CJ0 B;  1Y8P B;  4DAV A;  4GZY C;  2OEO A;  4LAA A;  4CJ1 B;  1SNP A;  3PIO 3;  1SYG A;  2NVQ B;  2EYM A;  2RQX A;  1OXS C;  1U9R A;  4FF3 A;  1O78 A;  2WKD A;  3SHL A;  3TBI B;  1WTW A;  4RH6 A;  1EY0 A;  1PXU A;  3S1N B;  1EU4 A;  1PYW D;  3QOJ A;  1Q90 A;  4DK0 A;  4KKU A;  1HHV A;  3SVM A;  1DOM A;  3NQI A;  1GUO A;  1QE6 A;  1CZW A;  3GV3 A;  4M1U B;  2FIN B;  1GHJ A;  1RF2 D;  1C8C A;  3MWY W;  4FXD A;  1G6Z A;  1SE4 A;  1STY A;  4IUU A;  3R3O A;  1EU3 A;  3NTH A;  4WRD A;  1HUN A;  3X3M A;  4XT1 B;  3GV6 A;  4XQQ A;  3S1M B;  5C0X I;  5JPM C;  2ID0 A;  5JEA G;  5J1Z A;  3T51 B;  3WOF A;  5FLX E;  2PPB C;  3HZX A;  1KTK A;  1QJO A;  1IW7 D;  2X6G A;  4K5V A;  4HCS A;  4H44 C;  1PZJ D;  3M85 A;  1WTV A;  3NTK A;  4RAU C;  1ILP A;  3I3C A;  1DYQ A;  4ABN A;  3PO2 B;  1KAB A;  5EBD A;  1B3A A;  1Y69 U;  4V0B A;  4QF4 A;  2XVS A;  3QG1 A;  1K83 B;  1NUC A;  3HGB A;  1ET9 A;  1I4P A;  3KF8 A;  1DZ1 A;  5IOD A;  2IJ0 A;  2F0I A;  2JYO A;  2A6H D;  3LWU A;  1EEF D;  4NMZ A;  2M00 A;  2J7Z A;  4X3U A;  3I4L A;  1V1P A;  4A3B B;  2PO4 A;  5KYI A;  4BBS B;  2DY8 A;  5DM6 3;  5J39 A;  3SK8 A;  2NVY B;  1VMP A;  3M3Y B;  3Q23 A;  2BA1 A;  4RHR A;  4KY7 A;  4U68 A;  3GTP B;  2YYZ A;  3VYT A;  4CKB A;  3EJI A;  3LWE A;  1EY5 A;  3QWN A;  1EL0 A;  5HGT A;  3Q22 A;  4FP5 D;  4L6T B;  1ROD A;  3K59 A;  4EQN A;  1IKL A;  3NWS A;  4UDU C;  1S5E D;  5CMD A;  5ELF A;  4HCE A;  4CGY B;  1CI3 M;  2H1E A;  2HDL A;  1GUS A;  1WTO A;  1ZXT A;  1T5E A;  2B2U A;  3KBG A;  4R9W A;  5C4Z A;  3J81 E;  2D2C C;  4OO1 H;  1H9M A;  1SFO B;  1B4O A;  3D4D A;  1AZQ A;  1I4Q A;  1SDF A;  4ILW A;  3A8J E;  4FF4 A;  3VYS A;  5TSS A;  3H0G B;  3NK9 A;  2JSO A;  2K03 A;  3ITP A;  1UEA B;  4ID6 A;  2A68 D;  1F2Z A;  2A68 C;  1ENC A;  3MAQ A;  4PQX A;  4DU9 A;  2R3Z A;  2R7Z B;  2Q8T A;  1D5Z C;  4BA1 I;  2RSO A;  1EZ6 A;  1SYC A;  1EEI D;  2ICI A;  3S14 B;  4KJN A;  1CQF A;  2NN6 G;  3OPO A;  1EIH A;  3DM1 A;  2K5Q A;  1U4L A;  5C0X J;  5C44 B;  1RD9 D;  2B2T C;  3BYY B;  1FGB D;  3LX0 A;  3EFX D;  1QNK A;  4EQO A;  1I4X A;  1F2Y A;  4TRD A;  4S3S A;  4BY7 B;  1Q1E A;  5D3I B;  5LL6 S;  1JIC A;  3V05 A;  2G9D A;  2PYK A;  3DMU A;  3TZD A;  2KQ3 A;  4HMI A;  1EY6 A;  5CV8 A;  3HG9 A;  1CHQ D;  2QKI C;  2C9O A;  1MGS A;  4J6H A;  2I07 B;  1XYI A;  3H91 A;  5JOB A;  3V2T A;  5C3X A;  3OMC A;  4A3G B;  3S1Q B;  3K7A B;  2PMZ B;  4NW2 A;  1H9K A;  3ND9 A;  2ZT9 C;  1GUG A;  4RKL A;  1Q3L A;  3GTQ B;  2OT2 A;  2E76 C;  2NYZ D;  4ZKB B;  1LLR D;  2K7V A;  5A2Q E;  2A6E D;  3CKI B;  5CGK A;  1L0Y B;  4ZUI A;  4ULL A;  3NSW A;  2AUJ D;  1DJR D;  2D5D A;  5C4H A;  5D65 A;  4BA2 I;  1HXY D;  2BE5 D;  1LTI D;  5T1G A;  2SDF A;  3NQT A;  3S2H B;  1STB A;  3TME A;  3R2T A;  2KCN A;  3C1F A;  1F9S A;  1IHZ A;  1UNS A;  2R6G A;  1H9J A;  4OIJ A;  1B44 D;  2VUM B;  3P20 A;  2MJ8 A;  2CW0 D;  2EJM A;  1LT6 D;  2F3V A;  3J80 E;  1FR3 A;  1Z6H A;  3BG3 A;  3FMC A;  1A15 A;  4G57 A;  3PUW A;  3D6C A;  2XN9 C;  3T16 A;  4DA2 A;  2L11 A;  2F1M A;  1B2T A;  3GP7 A;  5E4X A;  2XIW A;  4IUP A;  4ODG A;  4AYB B;  3KBX A;  4C1N I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...