5D65A

X-ray structure of macrophage inflammatory protein-1 alpha (ccl3) with heparin complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 3
publication title Structural basis for oligomerization and glycosaminoglycan binding of CCL5 and CCL3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 13
structure length 68
sequence length 68
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5d65A00
1EIGA 1CA5A 3KBXA 2FFKB 5CMDA 1X32A 3TZDA 5AFWA 2K04A 2N88A 1U4PA 4LMQD 1E0BA 1B53A 4U68A 1WD1A 4CJ1B 1PFNA 5CBEE 2RA4A 1DOLA 1KNEA 1F9QA 1HUMA 2K1BA 1G2SA 3LWEA 2MP1A 2RSOA 3ONAB 4OIKA 5T1IA 4IUVA 2NZ1D 4ZKCB 5EPKA 1WTRA 1SAPA 1MSHA 5E4WC 5DNFA 5COYA 2JP1A 1SDFA 1MSGA 2R3ZA 1EOTA 1QNKA 1F9PA 4XDXA 1AP0A 2B2YC 2NWGA 1DONA 1ILQA 1X3PA 4IUPA 4X3KA 1DOKA 1ICWA 4HAEA 1ESRA 5EKIA 1F2LA 2FINB 3FDTA 4HEDA 4ZK9B 1WTXA 2N55A 2D9UA 2KOLA 2VXWA 5EPJA 2MGSA 3KUPA 3G7LA 4NW2A 1O7ZA 2KECA 1RJTA 2RSNA 3FPUB 4OIJA 2RVLA 1C8CA 1RHPA 2FHTA 3DEPA 2EPBA 4HCSA 3I8ZA 1VMPA 2EOTA 2Q8RE 1HA6A 1ZXTA 2B2VC 2L12A 1ML0D 2B2TC 2BDNA 1B50A 3I91A 1EQTA 1CA6A 2B2WC 3Q6SA 4IURA 1KNAA 5JJZA 4HSVA 1WTWA 4X3UA 3SVMA 5D14A 2X6LA 2K03A 2HUGA 1MGSA 3GV6A 4MN3A 1U4LA 4ZAIA 3P7JA 5T1GA 3MTSA 4ZKBB 2KEEA 5D65A 1F9SA 1BO0A 2K01A 2K05A 4R8IA 1DOMA 3TN2A 1WTVA 1AZQA 4RA8A 1NCVA 1GUWA 4CJ0B 1G91A 2FJ2A 2MPMA 1EL0A 2MJ8A 1Q3LA 3IFDA 1XYIA 2L9HA 5CORA 1B4OA 2J7ZA 1PFBA 1IL8A 2B2WA 1BNZA 3R93A 1HHVA 1X3QA 1F9RA 1TVXA 4DN4M 1J9OA 1XX8A 1JICA 1NAPA 3D6WA 4IUUA 2HDMA 2B2UC 2H1EA 2B2YA 5E4XA 1AZPA 1PFMA 1M8AA 1RTNA 3DM1A 3UI2A 1O80A 5EJWA 3HP3A 1QE6A 1IKLA 1VMCA 2M2LA 4RAUC 2HCCA 4XT3B 1WTPA 2SDFA 4UAIA 4X3TA 2X6GA 3IL8A 1B3AA 1EIHA 2K28A 1S4ZA 1HFGA 2DY7A 4RWSC 1U4MA 2JYOA 2KVMA 2L1BA 5CBAE 1HUNA 1U4RA 2NYZD 2IL8A 2X69A 4CJ2C 1DZ1A 4ZLTF 3QO2A 1WVLA 1WD0A 2B2VA 2B2TA 2XIWA 3GV3A 1MI2A 1BBXC 1B2TA 1J8IA 5EQ0A 1G2TA 1HRJA 3I90A 1A15A 2B2UA 2HDLA 2L4NA 1CM9A 3I3CA 4XT1B 2EE1A 1NR2A 4O42A 4MHEA 4IUTA 1QG7A 4QUCA 1O7YA 4QUFA 2DY8A 2FMMA 4X3SA 2KUMA 1WTOA 2L11A 2HCIA 1LV9A 1PLFA 4R9WA 1HFNA 1JE4A 1ILPA 1BF4A 1RTOA 3DEOA 3N52A 1IKMA 1NR4A 2CVRA 2Q8TA 2KEDA 1G6ZA 1WTQA 1PDQA 4IUQA 3H91A 1SSOA 5EPLA 3F2UA 3MWYW 1RODA
chains in the Genus database with same CATH superfamily
2WB1B 3HOVB 3I55A 1MKHA 3K5MA 1EY7A 1W6KA 3AU7A 4BY1H 4IUVA 1PXUA 2EY1A 1SAPA 2E74C 5LHY1 1HCZA 1QNKA 3UE0A 3R2TA 4GZYC 2NWGA 4A3BH 2F0NA 4X3KA 5TSSA 2RHSB 1K3BC 4AQYL 2JQOA 3VR3A 2PQEA 2PMZB 4HN7A 1S40A 2HD3A 3M7GA 1PTOF 5CC4A 4IPCA 4O2DA 1TXYA 3S2DH 1SEBD 1I50B 1EQVA 1N36L 4KN4C 3ERSX 4OWXB 1VQ4A 4HIKA 2IX1A 1YHBA 3Q22A 3CCVA 1UEBA 1V43A 4RGOS 1H9RA 1NE3A 1LTBD 1SNQA 3IFDA 5CORA 2CWPA 1KC8C 4YHHL 2KBNA 4A3DG 4QGUA 2CKZB 2RDFA 4DNRB 1XX8A 5JPMC 2XN9C 1TS5A 3PO3G 3ULLA 4ZRZA 1SYFA 4JI5Q 4JYAQ 4KY7A 1HR0L 5KGUA 1WFQA 4Y52H 1GKHA 1O80A 4TQUS 3EN2A 3TP7A 4OO1I 5GAEC 2NVXH 1XTCD 1F2MA 5ELCA 3J7A5 4DR2L 1GHKA 1JB3A 2E2DC 2LS01 2QW7A 4PZ8A 4QJFA 2E76C 3OIPA 2TSSA 3U9OA 4GKJQ 5ISRA 2RDGA 1WD0A 2UUCL 4DNTB 2WIIB 1B2TA 3C1FA 1PHJA 4JI4L 2JA6G 1IYUA 1LT5D 2ZXRA 4IOAA 4NKLA 3BVMA 2ZTEA 3SGIA 2JA7B 4A3IG 3GTQB 5M9OA 1HFNA 1UE7A 1HNZQ 3N52A 1SE2A 2BDOA 1GM5A 1XPRA 4KD4A 2H5XA 3NQIA 1N34Q 1BDOA 2Q2UA 1CA5A 1S5CD 2FFKB 4JI3L 4IJLA 4DAVA 1U4PA 2EJFC 2Q2IA 1QB5D 2B8FA 3MZ5A 1ENCA 3LWEA 3HOXH 1HHVA 4OIKA 2IHFA 1PH4A 1LT6D 5FJ8G 2J4XA 4YWLA 3A55A 1SDFA 1I4QA 4LF4L 2K5NA 1ILQA 1IHZA 1X3PA 3PUWA 1WTHA 4DK0A 2VQEQ 2VUMG 3PIOA 1LTRD 3J81i 4RGTA 2KOLA 4NW2A 1O7ZA 4DXFA 1RJTA 4BS9A 1BQQT 1D7QA 4APVA 4QIWB 3KF8B 4KTAA 4C3JB 2B2TC 1PTOD 3U58A 4AYBB 4DV0L 3DWPA 2OQKA 3J7AF 4X6AH 3U50C 1U9RA 3DMUA 2BE5C 3KK7A 2YU9H 1HA5A 4JBWA 4J6HA 4BBSG 1A2UA 1CHPD 3KF6B 3MTSA 4DR7Q 3KDFB 4B3SL 2K01A 4A3KG 4M1UB 5C4JH 2VY3A 3ZJYC 3AMUA 5J3BA 2MPMA 2V4DA 1OXXK 2KCCA 2XNAC 1XYIA 3H09A 1I94Q 4LWCA 2JA9A 1JWSD 2N49A 4GOPA 3D4WA 1BNZA 3R93A 1CSQA 3J80c 1I5FA 1CQFA 2CW0D 4X62L 4DAYA 5CYUA 4MTKA 1CZGA 4BXXH 1M8AA 1EY5A 3A0JA 3E9IA 4EQNA 2F0IA 4RAUC 3MXNB 4P2CB 1NTGA 2X6GA 1TKWB 1OXVA 5A2QE 1OTCA 2QCPX 5CV8A 3K7AB 3I4NG 2X69A 2JA5G 3QO2A 3BVGA 1Y8OB 1C0AA 1OXTA 3HRZC 4H0LC 4G57A 3E3XA 4OO1G 1E1TA 2B2UA 3HOYG 1IW7C 4I7ZC 4WJWA 5CGKA 2A1AA 4NPSA 1M90C 1LV9A 3PMFA 1BCPF 1PTOB 3CRLC 1BF4A 2CVRA 5A35A 3VR5A 2MFIA 4GLXA 3NWTA 1E0BA 4L8JA 4R4OA 5IGDA 4A3MH 1GXDC 3UDFA 2WINB 4RCOA 2MP1A 3E0EA 2MUYA 3FHWA 4F88A 1AP0A 4XDXA 2B2YC 4JI2L 5G3LF 4K6LA 2EXZA 2FINB 3CMEA 3SK4A 1Q46A 1SNCA 2D9UA 1J6QA 2HT1A 3MXGA 1V8QA 4RHRA 1R9TB 2MHVA 4LFCL 5KNCA 4X65Q 4BA1I 2LMCB 3I8ZA 3BYYB 4PV1C 4DV5Q 2BDNA 3S1MB 4DR7L 2F03A 4A3EH 1QUQB 2JEBI 4A3DB 5I9OA 4LF6L 1TR5A 4X3UA 3RN5A 1TWAB 2DNEA 1FL0A 3J81L 5D65A 5EBCA 1VQKA 1CKOA 1Q1EA 1CFMA 2KHIA 3PIO3 1WTVA 1B1ZA 2K5DA 4DV1Q 3NXWA 3W2DA 1B3QA 2F0WA 3CCUA 4DV6L 3HOUG 2K6AA 1ZYRD 1A3VA 4OEMB 1TQOA 1EU4A 2F4VL 3A5ZB 4OWTB 4J15A 3FRPB 5IGFA 2JA6B 4LW1A 3OOCA 2DNCA 1YHAA 2KA7A 3V2TA 4XYOA 4A3IB 1EIHA 2JYOA 2LKVA 1UE6A 2L1BA 4CJ2C 1AW7A 5IP9G 1XNQL 3DWQA 1J8IA 2KHJA 4POFA 3I56A 2HHHL 1SYGA 2K52A 1A15A 1E3PA 2L4NA 2Z6BA 4L63B 4EX5A 1FJGQ 4HMJA 4P73A 5ELDA 4RMFA 4LAAA 3HS0C 4DU9A 4Q0FA 2PZWA 4RKBA 1GUGA 1D5MC 2JA8G 1TWGB 3OIQA 4A3BG 2RHQB 2B29A 4G7ZC 4DAMA 2NVQB 1PH9A 1LM0A 1BCPD 1PH7A 4HIOA 1FD7D 4RKLA 1EIGA 3KBXA 2ZJPA 1I6HH 2VUMB 2EJMA 1FNUA 3CCRA 5EBDA 3NE5B 1G6PA 2UUAQ 1DOLA 1W6JA 2FMCA 3RUZA 1N33Q 1LT4D 1NMFA 1JWUD 1MJCA 1YNJC 2F1MA 2XWBB 4LF9L 2ASBA 3EROA 3PO3H 1EIYB 1T9HA 1CKNB 1SNDA 3T1YQ 1N8RC 1JOOA 1LYLA 1E2WA 3M4QA 1ESRA 4X65L 4LFAQ 5G3LD 4BBSB 1DXMA 1RIPA 1N32L 1STNA 3G7LA 4A3KB 5JVG3 2RVLA 4HCSA 2UU9L 2NVYB 2R7DA 4DV3Q 3W3AA 4DV2Q 4HIDA 3AYHB 5K5PA 5I2XA 2JA6H 4EGVA 5IGEA 3I4OA 2K32A 2DN8A 1IYJB 3STBD 1PH6A 3JC66 3K6OA 5DEHA 1H9SB 3SK5A 2RBMA 1NCVA 2D0PA 3MA2B 1L0WA 2XWJB 3KF8A 1Q3LA 4NXNL 1IXRA 3SHLA 4BWGB 4N9PA 2WV6D 3GTMB 3JAME 1CHQD 5C4ZA 2EXDA 3S16B 2BH8A 3KF6A 3KDFA 5D3DA 4K14A 1PH2A 1DCZA 2KCNA 3R8BA 2EYHA 5FJ8H 3GTKH 4JV5L 3PSIA 4H13C 2M2LA 5I9PA 4XTCS 3CCQA 1JOQA 3RZDH 5C3XA 1VQMA 2DY7A 3M7NA 1U4MA 4DV4Q 3ND9A 1FJGL 1II3A 4L5TA 3GV3A 1QNUA 4DK1A 4HJ7A 1HRJA 1JQYD 1B44D 5C6AA 4JVZA 4L6TB 2G9HD 4MHEA 1NBWA 4ODGA 4XXEA 3H15A 1TIID 2DY8A 2VL6A 1WTOA 2F0OA 4MTNA 4LJZC 2QILA 4C1NK 2VNUD 4DUZQ 2F0JA 4BBSH 4KV6A 3WOFA 4A3GG 4NDXA 1CT1D 1QZGA 3CKIB 4LUZA 1KRSA 3OMCA 1S5FD 4HSPA 2R92G 2A73B 2NVYH 4GNXC 2UUAL 1H9MA 2RCFA 1JT8A 2Q2HA 2E2HH 3KLWA 3D31A 3SEBA 3CW2C 4KN7C 2A6HC 2IX0A 2WKDA 4GS3A 3T1YL 1Y14B 3RLNA 2K5QA 1VQOA 2YTVA 3GD7A 1A3TA 5DNFA 5C4XG 2JP1A 1TT2A 2PO4A 3K0XA 2A68C 4IUPA 1STBA 4ZK9B 3FDTA 4B3RQ 2N55A 3PV0A 3GTGH 1TWFB 1ET6A 2K14A 2VXWA 5M5WH 2Y0SE 4RH6A 4KKSA 4V190 1X3GA 3JAMi 3I4NH 2JA5H 1JJ2A 1PYWD 4K0KQ 2L12A 2B39A 2OEOA 1Q82C 3SXHA 2CWAA 4OO1H 1VCIA 3PUYA 3HOYH 1BVSA 2I5LX 1BUVT 2A69D 1JR0D 4DR3L 4NB3A 3HOUB 3OTOL 3PUZA 2WFWA 4H44C 2CCZA 4BXXG 1FNVA 1SN8A 1LABA 4WJ4A 3H94A 3F2CA 3L7ZC 3CAMA 3TN2A 4K6DA 3KLRA 4RA8A 4LUOA 1PRTD 3NSWA 3L3OC 5ELEA 2EQSA 3P75A 3DLLA 1L0XB 3RN2A 3LNNA 1QUQA 4DUYL 1OO9B 5M3FG 4UPAA 3MFYA 1MHWC 4DR6L 4IFDJ 2F0LA 3DM1A 4YCVA 2GA4B 3NUCA 3HP3A 4CGYB 4CHTB 1A62A 4OHJA 2K33A 4BY1B 2HCCA 2MO1A 3BZCA 3WOEA 2R61A 1N36Q 4LFBL 4DV7L 3M4PA 4V0BA 4NXML 4A3BB 1KL9A 2B2VA 3CCSA 4A3MG 1ASYA 3I90A 4ALPA 3PCOB 4YCWA 2PQAA 2PW7A 1PYSB 4QUCA 2JK8A 2E2IH 2FMMA 4YHHQ 1PH1A 4A3LH 5JJIA 4X64L 1HH2P 2CH4W 3S2DB 1DJRD 4E6IA 2F0SA 3S1RH 1IBLL 1JMCA 2IY5B 1HTPA 4J8QA 5CR3A 1LO5D 2IJ0A 1Y1WH 1HR0Q 1T5EA 1YNND 4FVMA 1VQ5A 5IP7H 2GVBA 1DYQA 2XRQD 4GNXB 3HEJA 4LMQD 4LF7L 2TMPA 1VQ7A 1C4QA 3HOUH 4DKAC 4WRDA 2K1BA 1MIUA 2UUCQ 4PMCA 2NZ1D 4AH6A 2ZJRA 1L0YB 1V1PB 1IBML 4JI4Q 3CCJA 1HNWQ 3F1ZA 1E7ZA 5F2DA 2F3IA 1X55A 1JC7A 1LTAD 2LXJA 3BU2A 3H0GG 1LLRD 2NVXB 4FDBA 2I07B 1SBBB 4L5QA 4NMZA 2XRSD 2EPBA 5IP9H 1SLJA 3S2HH 3RLFA 1B50A 3T4AC 2QDLA 4C3IG 1QILA 1CKNA 4A4IA 2PZTA 1SMXA 1XPOA 4JI3Q 4CKBA 1Q12A 2Z4HA 1TWHH 2VB2X 3ITPA 1QJOA 1VQDA 2JA8H 1IYVA 3SK8A 2BA1A 1NMGA 4A93G 2A6EC 2D0OA 4K8JA 3H3VH 4P74A 3FKIG 2EYLA 1SFOH 4LF4Q 3EIVA 1AE3A 4KY5A 2KENA 3A5UA 2AUJD 2EYMA 1H9SA 1SE8A 5IYDG 3HOXB 1CK1A 4PZ6A 3ULJA 4DV0Q 1TS4A 3TS2A 3PUVA 4B9XA 4JI6L 5FLXL 2F0KA 1BR9A 1DZ1A 4B3SQ 1I4GA 2AMCB 3CHBD 3MXUA 1ESFA 1MI2A 3CRKC 1TS3A 2R92B 2P5ZX 1CM9A 4JI7L 5KYLA 2NN6I 1STHA 3GQBA 4X3SA 3CPFA 5C44H 1L1OC 3MEFA 4DR4L 3DWAA 4X62Q 1GOZA 1Q8KA 4JOIC 1IKMA 1NY4A 1VQFA 1AFPA 2KEDA 3G6JB 2YU9B 2UUBL 1D1KA 3AFPA 1WI5A 3CC7A 2ZJQA 4OXPA 1JCKB 5C4JB 3SDZA 3I4MH 2N88A 1AE2A 1GD7A 1HNWL 1KNEA 4PZ7A 1EY9A 1UEAB 3MC0B 1D1IA 2JJQA 4KK7A 1SJED 3J80E 2Z6KC 2NTSA 1VQPA 1B9MA 1EFID 2D2CC 3I72A 2RSNA 4TVAB 4FYDA 4UY8C 1VQAA 1X56A 4AIMA 1RL2A 5GAHC 2Q8IB 1G291 3AFQA 1PH3A 4ILWA 1ASZA 2EY6A 2PNHA 5D14A 2X6LA 1LTID 2O4XA 2AQ3B 3ERQA 1VQHA 1G8ZD 4ME3A 4PG3A 5LMUQ 1K8AC 1S72A 1KQSA 2KCMA 2Z8LA 2L55A 3NTIA 4CJ0B 3L9AX 4A3GH 2F3WA 1FGUA 3URYA 2F0FA 5ELNA 3TP5A 1K9MC 4JI2Q 2R92H 3MEHA 3ICEA 1Z7TA 2DJGC 3QG1A 1Y69U 4HJAA 4LNQA 1J9OA 4LFCQ 4G7OC 5FKAC 1NAPA 1EIFA 2PI2A 1E1OA 5E4XA 1HQRD 4A3MB 5CV4A 3WDNA 3A7LA 2CW0C 3K8AA 1SNOA 1XMQL 2K5VA 1LTSD 5C4XH 3F2BA 3RLOA 3J81c 4UAIA 2NUCA 3IL8A 1B3AA 4LF6Q 5EKKA 1VQIA 1QWYA 2HQEA 1R4QB 3J81j 5C4HA 4YWMA 4GN4B 2IWHA 3L2PA 3TRZA 3T16A 1PH5A 5JJLA 2XVSA 2IT1A 3CMAA 2RCNA 2K4KA 3J80i 3V05A 4I65A 1MJEA 4KY6A 4DV6Q 5I4DA 3CQZH 2F4VQ 4A3EB 4JBMA 2MO0A 4BY7G 4S3SA 3H91A 4Y7NH 4KHPQ 1BBWA 1STGA 2NN6G 3LX0A 2HQLA 4DK3C 3TZDA 1V1QA 2SOBA 2K04A 2Z0SA 2OTLA 1TY0A 1Q90A 3H3VI 4TSSA 1EQRA 5CBEE 1WTPA 2SNSA 1V1OA 1WOCA 5M3FH 1Q8IA 1XNQQ 4MNOA 4JI1Q 1V9PA 1EWIA 2HHHQ 1MSGA 1M1KC 1K8OA 1DONA 3S17H 3D3RA 3DUZA 1KAAA 3BS1A 2B63G 4HAEA 2RQXA 5EKIA 1BXTA 4GNXA 3BG3A 3A54A 2BCOA 3T51B 3ULPA 2AKWB 2L15A 2AQ1B 4J1MA 4A76A 4R1JA 1UE1A 1EEID 2FHTA 4UHVA 2R93G 1PVOA 2K75A 1V1PA 1EQTA 1WJJA 3HKZE 5LMUL 1VQGA 3G4SA 1PZID 4IJHA 4IFDI 5FLMG 2XSCA 3E5SA 1HQMC 4LF9Q 4ZYSA 3VA7A 2MJ8A 1IW7D 1EYAA 2L9HA 3ND8A 2J7ZA 3PF4A 5HY6A 2SEBD 3A8JE 1K83H 5BN4A 1JB7A 1IL2A 4RGMA 1N32Q 1I6HB 1A0IA 1P8LA 5ELOA 2EIFA 2HDMA 4A3LG 3SR1A 2UU9Q 2E2JH 1YJNA 3KBGA 3CCMA 1IKLA 3UE1A 1JJGA 2N8NA 2CHBD 4A3CG 3PO3B 4HR7B 2K28A 1Y1WG 1U0LA 1QVCA 1S3OA 1YEZA 5IP7G 1XTDA 3H0GH 5DLQE 4P71A 3VYTA 3P1HA 1GUNA 1JORA 5AJ3L 3HFZB 1IBKL 1WCMG 1X3EA 3F8TA 4NXNQ 1YVCA 2E8GA 4C3IH 2KUMA 4IQZA 1KDBA 2O2LD 3C1EA 4KHPL 1RTOA 3S14H 4GLVB 4ABNA 4R4TA 3OSOA 4QQBX 1QVGA 1PDQA 4A93H 1VF7A 3LGJA 2KHSA 1RODA 4JV5Q 2QEXA 1U5KA 3FKIH 5CMDA 1HPCA 4JI1L 1JE5A 1PFNA 2V1CC 1GVPA 1G2SA 3F2DA 2IPKD 2ZXOA 4GKKL 2F0TA 5COYA 5IWAL 5DM73 3B6YA 5IYDH 2EYFA 4KI0A 3QJYA 5BR8L 3GTKB 3HOWH 1E2VA 3RZDB 1C8CA 1FYCA 4HJ8A 2YTXA 4MIUA 1J5EQ 2I5HA 3FEWX 3SE0A 2B2WC 2AWOA 2JEAI 4FXDA 2ICIA 5DM63 2K03A 2HUGA 1TY2A 1FVIA 2ZTCA 1DM0B 5JEAJ 2F3VA 5IIFA 2ZM6Q 1OXUA 3K80C 2WKCA 1W3SA 1HNXL 4Q5VA 2A5HA 3EBEA 3K5NA 4EVOA 3CF5A 1G91A 3Q8DA 3HOZG 3S9WA 3AQQA 3G71A 3E6ZX 1RKNA 1BBUA 4HJ5A 4X66Q 4IFDG 3U4VA 2E2HB 3D6WA 2IHEA 3FVQA 1FGBD 3M85A 3K7UC 4BBRG 2ALYB 5C44G 3OHXC 5HGTA 3BVZA 3M4YA 4R4QA 5C5LA 1DD2A 2SDFA 1SNPA 4DR3Q 2NZHA 1ICFB 4O1NA 3OTOQ 2R7ZH 5C3EG 3I2ZA 1HUNA 4CDFC 3HKSA 1B9NA 2NYZD 1ENAA 3G6EA 1ONLA 3DHQA 3I4MG 2WAQE 5HURA 4FXKC 1GJXA 3GTGB 1YNJD 1K0SA 5EQ0A 3HG9A 4A3FG 3Q24A 5M5WB 1HZBA 2F0VA 4RGNA 4POGA 2EE1A 3I4NB 1QG7A 2JA5B 3D6CA 5A2QL 1K0RA 4QCLA 2L11A 5DAUA 4DUYQ 2EY2A 3HOYB 3DEOA 3HOVG 1I4RA 2C5CA 1KABA 4DPGA 1G6ZA 1WTQA 4DR6Q 2Y0SG 3MXPA 1RDPD 1Z47A 4JBKA 1X32A 4H7BA 2E75C 3H3VC 3PUXA 4LFBQ 4DV7Q 4NXMQ 4IZ8A 5GAGC 1F9QA 1HUMA 5EAYA 4GOPC 5KNDA 5CV9A 2F0QA 2DGYA 3NTKA 4IUNA 3I7FA 3MXNA 4JOIA 2R3ZA 5M5YH 4DR5L 1F2LA 4B08A 2OXPA 2ID0A 3RR5A 4X64Q 1Y8PB 3J7AV 2Z1CA 1J5EL 2MGSA 1ZEQX 4B3ML 4OIJA 2ES2A 2UXDL 1IBLQ 1PH8A 4HMIA 2VZAA 3E9HA 2F0DA 5JOBA 3TP8A 3KJOA 1E24A 2Z6KA 2ZM6L 2B3GA 4LF7Q 5LMNW 4HTHA 4ZKBB 3CD6A 2E2IB 1YNXA 4CDDC 4FNFA 2CFMA 2WB1E 3GDEA 1SMYC 1IBMQ 4BY7H 4X66L 2NN6H 3S1RB 4L5RC 1SR3A 4JI8L 4B9WA 1IL8A 1O78A 1Y1WB 1PRTC 4DR1L 1F2ZA 1B7YB 3AEVA 2SNMA 5EKLA 5IT9c 1PFMA 4CDCC 3EFXD 2ZTDA 1O7IA 4CBVA 2D5DA 5BN5A 1EY8A 2PMZE 1VQ6A 4JW0A 2B63H 3T1HQ 2D62A 2BA0A 2A6HD 4XQJA 3AB9A 2JA7G 2B2TA 4FP5D 2R7FA 3UDXA 1BOSA 2R93H 1Q7YC 3PO2G 3BZDB 3W1GA 3CC2A 1R4PB 2MNAA 3S2HB 3BDOA 4KLKA 2HCIA 5JAVA 3U4ZA 3UDGA 3TEHB 3DXJC 3IRBA 2Q8TA 1QOHA 1TWHB 4IUQA 5FLMH 5EPLA 3F2UA 2JA8B 4RFBA 5LL6X 3PIPA 5FLXc 2DJFC 3VR4A 5J22A 4U68A 4JI6Q 1SFOB 2RA4A 2H4OA 1LTLA 4LF8Q 1KDAA 4C2MH 1I3QH 4R4IA 2C35B 2IX3A 4JCVE 2AUKA 2JSOA 1F9PA 2PPBC 4JI7Q 2CH4A 4XQQA 2CQOA 3NELA 4F87A 4C3JG 1A6XA 4A3CH 5EPJA 3S1QH 4DR4Q 5M5XH 3GP7A 3TBIB 2NVTB 2HIVA 2UUBQ 3QOJA 3S1NB 1XMOL 1ML0D 5CV5A 1AN8A 1PYBA 1I4HA 1WCMH 4KJNA 1EZ8A 1ENFA 1U4LA 3P7JA 4YWKA 3TSSA 4K8IA 4N8X1 1QVFA 1XXGA 3K58A 3OWFA 3RZOH 5C44B 5CV7A 3CP0A 3BZKA 1GUOA 5I6WA 1PA6A 3L0OA 3C3LA 3R2IA 1Y1VH 3G48A 3K0YA 2IW3A 1XNRL 1JOKA 5C3EB 1F9RA 5IT9L 1E2ZA 5M3MG 4R8NA 3I4MB 1JICA 4IUUA 2XTIA 3GTJH 2B2YA 4I7AA 3UI2A 2Z4IA 1TU2B 3T1HL 2F0UA 1QE6A 2OCEA 3A7AB 2GVAA 2UXBL 2J0TD 4FO2A 2K5WA 3DM3A 1PZJD 4X3TA 4UP9A 4P75A 3JAML 1HFGA 4RWSC 2EJGC 3BDLA 4QIWE 3OW7A 1SYDA 4LK1C 2C9OA 3QR8A 3NWSA 5E3FA 4AYBE 1F77A 1X9NA 1BBXC 2Y0SB 3VYRA 1I4PA 4H02A 1NR2A 1EY0A 1YZ6A 3X3NA 2E5LL 1GHJA 2QEJC 2NTTA 1ILPA 4HIMA 1VQLA 1AEXA 1EYCA 2G9DA 4OX9L 5IGCA 3MFGA 3HOWG 1XMQQ 2NVTH 2EYOA 3S1NH 3HOZH 2YYZA 4LF8L 5AFWA 2UXCL 3Q23A 1H95A 5FO8B 4A3GB 1WD1A 1EOVA 1D5XC 3NTHA 2VQFL 3QOLA 2XGTA 1CUKA 1EZ6A 4IALA 5L37A 3M9BA 1KLGD 4IFDH 5EPKA 1RCVD 1XPUA 4XIGS 2A6ED 1KDCA 3GTLH 4QL5A 4BBRH 2QA4A 1YIJA 5KNBA 4HCEA 4KHVA 4YCUA 4EQPA 2FXQA 5JPNC 5C4XB 3A56A 3T56B 5C3EH 3PIP3 3J81E 4G4KA 1AH9A 3H6MA 1PMRA 3O13A 3OWEB 4WJ3M 1EYDA 2EOTA 1KIXA 3EQLC 4A3FH 3D0FA 1CA6A 3Q6SA 1SE4A 3NBHB 3K59A 4YY3L 2F0GA 1MGSA 4B3TL 4LF5L 1MD2D 3TS0A 4KMUC 3HOVH 2NZOA 5IE8A 3KFUA 2R7ZG 1HZAA 4JC0A 3VA5A 3CQZB 3KLSX 3TDQA 2EYJA 1VS0A 2B2WA 2JE6I 4Y7NB 5I6YA 5GADC 1X3QA 2OT2A 3KLSA 1C48A 4DN4M 2KCTA 4K2LA 1QCBD 4PMWA 1K73C 4TKOB 2H1EA 3EA6A 2ZXPA 1PTOC 3BDCA 2Q2TA 3PO2B 3VR6A 5C0XI 5M3FB 4UP7A 4A3JG 1GO3E 3W1BA 3HGBA 5GQOA 2AWNA 1ZKOA 1UNSA 1RF2D 3S17B 1U4RA 2F52A 5C5MA 2ATWA 2VB3X 1I50H 3NEMA 3RMHA 2I46A 3K81C 5FK9C 1G2TA 4IPDA 1SNMA 1WYDA 2WACA 3I3CA 3TZUA 4FF1A 2I5MX 1UWVA 1H9JA 4QY7A 3IFTA 3TQYA 2GN5A 3VYUA 4ZUIA 3OPOA 4FXGC 3NQTA 1D8LA 4FF3A 3GTPB 3R3OA 3OW2A 1GUTA 1TWCB 4GLAC 2G5DA 3A8IE 4PNYA 1SYEA 1UAPA 3HKZG 2OQ0A 4ME5A 1E22A 5I2YA 3ONAB 5IOCA 1LUZA 5T1IA 2B8GA 1K83B 1MSHA 3T13A 5AJ3Q 5JJKA 5LMNQ 1IBKQ 5J1ZA 2M9VA 4CKCA 1L1OB 5J39A 3CPWA 1KXLA 4PQXA 1F2YA 1KLUD 3I73A 1WTXA 2E2JB 1EEFD 5FOBB 4JI0Q 3RD4A 2QKIC 2L0CA 1RHPA 3DEPA 2VW9A 5LL6S 4JI5L 1Q86C 1VMPA 4JYAL 2YV5A 2JA7H 5K36G 2B2VC 3GTQH 3A74A 3H0GB 3EJIA 2BE5D 5IYBH 3PO2H 5JEAG 4XQNA 1UUPA 3CU7A 4IOCA 5IYCH 4N8FA 4ZAIA 3GV6A 5M3MB 1T5XD 3MVVA 4OELB 4UP8A 4GKJL 4C3IB 2EDGA 1X6OA 1GUWA 1AZQA 4GKKQ 3S14B 1EY4A 5IWAQ 3C46A 3NBIA 4HJ9A 2LY7A 1PFBA 1S5DD 4A93B 5BR8Q 3I70A 3QWNA 1X3FA 1EUJA 3GO5A 4C56C 1TVXA 3TP6A 1HNZL 3FKIB 2EZVA 4ZQ3A 4JBJA 1KD1C 3PQIA 1JWMD 1EWCA 1N34L 1RTNA 3MHBA 2A19A 2ZT9C 1QZHA 1NJIC 3GTPH 1B8AA 4XT3B 3NP8A 4C3HG 4DA2A 3U9SA 1TWCH 1S4ZA 2KVMA 4C3JH 1HNXQ 1I6VC 3HOWB 5C0XG 2HIXA 4M8AA 4QUFA 2VQEL 2NB0A 1ZYRC 3Q0AA 1YI2A 5EGTA 5IGGA 1HZCA 2JN4A 1HR0W 1HZ9A 3MWYW 2N3SA 2F4IA 3K5OA 1SJHD 1D6EC 4IPHA 5LMNL 3SK6A 1SRUA 5M3MH 1WTRA 4GN5A 2F0HA 2OF1A 1STEA 4JI0L 1EOTA 1VQCA 2VS1A 4ULLA 3K7AH 1I94L 1K8GA 1ICWA 4HEDA 2O5JC 3TMEA 1YBYA 3UDIA 3M3YB 5IGBA 3KUPA 4FF2A 4F8MA 1BCPC 1Y1VG 1VQ9A 3NHHA 2RDHA 2R7ZB 3J80L 2K5HA 2Q8RE 5E7NA 3NPPA 1EY6A 3NK9A 1HA6A 3FPPA 2K50A 3BJUA 4JK1C 1PTOH 1LT3D 4IURA 4RHSA 1PZKD 4DK6C 5JJZA 2PQAB 2PNRC 5ELFA 5T1GA 4K2KA 2AHOB 4QF4A 1N9WA 2K05A 3NENA 5KRUA 1B70B 2ICEC 1K8MA 2PZUA 1P16A 1EL0A 2WAQG 4A3JB 4K5WA 2CQAA 3V96A 4DR5Q 2R6GA 3NBHA 2QF7A 4PMBA 4BY1G 4B3MQ 1CZWA 3OYYA 5C3WA 2UXDQ 3X3MA 1YHQA 1ET9A 1XJVA 1AZPA 1HXYD 1GUSA 1S5ED 1SXTA 1R9TH 2Z9HA 1W2BA 3STBC 1EYGA 5ELBA 1PV4A 5M5YB 2OTJA 2IL8A 3KYHC 1VF5C 3RNUA 2A74C 3KJPA 3S1MH 3WWVA 3J7ZC 1STAA 1C7YA 3CCLA 4A3DH 1A3UA 4XT1B 5FO7B 1O7LA 1TWAH 4ZUJA 4RG1A 1S5BD 3K5LA 1A63A 4JI8Q 2PI2E 2EYPA 4LUVA 4KKUA 3HKZB 2A8VA 1JE4A 3OMGA 4DR1Q 4OGQC 5IY0A 3I4LA 3M3YH 1NR4A 1LACA 1VQEA 1Z9FA 1SROA 1STYA 4DV5L 3M4OB 2RKSA 1SE3A 2ENBA 2M00A 1FR3A 5CV6A 2NBFA 2L5TA 1I4XA 4BY7B 1JJCB 3VR2A 1K28A 5C0XJ 5E4WC 1KAWA 3QB3A 4DV1L 4A3IH 4WORA 1MBYA 1HTLD 2F0MA 5IT9E 2N78A 1A2TA 2WB1G 5D3IB 1Q81C 3EVQA 1DOKA 1PRTF 4A3JH 1OXSC 3FPUB 1YJ9A 4L5SA 1BCPB 3FMCA 4DF7A 2B63B 5BN3A 1NSNS 1ZXTA 1TWGH 1PFSA 1L1OA 2NVQH 4HSVA 3ER0A 2R93B 1LTGD 4MN3A 4EQ5A 5H1SE 5FO9B 2RF4A 5IODA 2KEEA 1F9SA 1BO0A 4JPBW 4DGZA 4KJOA 3CC4A 1D2BA 2YTYA 3D4RA 5KYIA 2VUMH 4IN3A 4DXGA 4O0AA 1B4OA 1Z6HA 3GTOB 4C3HB 2KJXA 1YJWA 3VDYA 4OONA 4YIJA 3HOXG 3W5OA 5NUCA 5FLXE 1NUCA 4QMGA 2B2UC 1KHIA 1XWEA 3D4DA 5EJWA 1XMOQ 1VMCA 1SYCA 2QGQA 4C2MB 1YITA 2A69C 3M4OH 2BOSA 1I3QB 4A3KH 2EY5A 2EVBA 3S15B 2PW5A 3C2PA 1WVLA 4KD3A 1N33L 2BH2A 1EFWA 3S1QB 1CSPA 4KHZA 5M5XB 5K36H 3N6RA 4IUTA 1K3RA 4K5XA 1L2FA 2O5IC 4LFAL 1XNRQ 2F0EA 5JEAH 3MAQA 3CXCA 4R9WA 4C1NI 3P20A 1EU3A 1WCMB 1SYBA 2K7VA 3S24A 3A8KE 4DV3L 4DV2L 1KRTA 3K57A 3JAMc 1TS2A 3GTMH 2UXBQ 3RZOB 2AQ2B 3S16H 4G7HC 1B53A 4ID6A 1A8VA 1X54A 3T53B 4CDEC 4CJ1B 5IYBG 4R8IA 1Y1VB 4ZKCB 2RSOA 3BYTB 4NP5A 2A68D 5IYCG 2LSSA 1CKMA 3PF5A 1SMYD 4A75A 1DGSA 4Z9CB 3FP9A 2OWOA 3IAYA 3GTJB 4FF4A 4OL7A 1VQJA 2LXKA 2E5LQ 3GTOH 4C3HH 4XYQA 1LTTD 1EWHA 1IZ6A 1X65A 2DUDA 4TRDA 4U673 2KECA 3J7YW 4OX9Q 4AQYQ 2F0PA 1H9KA 1YNNC 2WAQB 4ZCKA 5KIXA 5C0XH 3I91A 3ZYYX 1NNXA 3D8GA 1UE5A 1KNAA 4RCNA 4GOPB 1HJPA 2UXCQ 4WFN3 4K5VA 1WTWA 1CI3M 3SVMA 3VYSA 4DV4L 4DAYB 4N9TA 2VQFQ 3S15H 1CQVA 4GN3B 4F7XA 1DOMA 1D5ZC 1EQQA 5KEEA 2FJ2A 1BKBA 3LWUA 1VQBA 2PYKA 3QIAA 2QDBA 4AYBG 3HZXA 2PCFB 1KTKA 2KQ3A 3HOZB 1CTMA 4DUZL 4JG2A 3PGZA 4UDUC 4MZ9A 4DAPA 4QB4A 1FNWA 4IO9A 3KOJA 1Y8NB 4BA2I 1TWFH 1VQNA 4P72A 4DNIA 1M4VA 2JXMB 4YY3Q 3GTLB 4BBRB 5CBAE 4OWWB 1G51A 4B3TQ 1VQ8A 5JVH3 4ZLTF 4LF5Q 5HGQA 1C9OA 3CCEA 4DR2Q 2XIWA 3TREA 3IKJA 1PRTB 1VDZA 2HDLA 2WP8J 4O42A 4A3EG 1Q1BA 1O7YA 4B3RL 2I0QA 4R4CA 2MQHA 4EQOA 1PLFA 4CKEA 4A3FB 1RD9D 4KKTA 5GROA 4DFAA 2LFNA 5E1FA 4IPGA 4K0KL 1SSOA 3E0JA
chains in the Genus database with same CATH topology
2WB1B 3HOVB 3K5MA 1EY7A 1W6KA 3AU7A 4IUVA 1PXUA 2EY1A 1SAPA 2E74C 5LHY1 1HCZA 1QNKA 4GZYC 3R2TA 2NWGA 2F0NA 4X3KA 5TSSA 3VR3A 2PQEA 2PMZB 4HN7A 3M7GA 1PTOF 5CC4A 1SEBD 1I50B 1EQVA 4KN4C 2IX1A 3Q22A 1V43A 4RGOS 1H9RA 1LTBD 1SNQA 3IFDA 5CORA 2RDFA 4DNRB 1XX8A 5JPMC 2XN9C 1TS5A 4ZRZA 1SYFA 4KY7A 5KGUA 1O80A 4TQUS 3TP7A 4OO1I 1XTCD 1F2MA 5ELCA 1GHKA 1JB3A 2E2DC 2LS01 2E76C 3OIPA 2TSSA 3U9OA 5ISRA 2RDGA 1WD0A 4DNTB 2WIIB 1B2TA 3C1FA 1IYUA 1LT5D 2ZXRA 4NKLA 3BVMA 2JA7B 3GTQB 5M9OA 1HFNA 3N52A 1SE2A 2BDOA 4KD4A 3NQIA 1BDOA 1CA5A 1S5CD 2FFKB 4DAVA 1U4PA 2EJFC 1QB5D 2B8FA 3MZ5A 1ENCA 3LWEA 1HHVA 4OIKA 1LT6D 2J4XA 3A55A 1SDFA 1I4QA 1ILQA 1IHZA 1X3PA 3PUWA 4DK0A 1LTRD 4RGTA 2KOLA 4NW2A 1O7ZA 4DXFA 1RJTA 4BS9A 1BQQT 4QIWB 4KTAA 4C3JB 2B2TC 1PTOD 4AYBB 3DWPA 3J7AF 1U9RA 3DMUA 2BE5C 3KK7A 1HA5A 4JBWA 4J6HA 1A2UA 1CHPD 3MTSA 2K01A 4M1UB 3AMUA 2MPMA 2V4DA 1OXXK 2KCCA 2XNAC 1XYIA 3H09A 1JWSD 3D4WA 1BNZA 3R93A 2CW0D 1CQFA 4DAYA 5CYUA 1CZGA 1M8AA 1EY5A 4EQNA 2F0IA 4RAUC 4P2CB 2X6GA 1TKWB 1OXVA 5A2QE 2QCPX 5CV8A 3K7AB 2X69A 3QO2A 3BVGA 1Y8OB 1OXTA 3HRZC 4H0LC 4G57A 4OO1G 2B2UA 1IW7C 4I7ZC 4WJWA 5CGKA 1LV9A 3PMFA 1BCPF 1PTOB 3CRLC 1BF4A 2CVRA 5A35A 3VR5A 3NWTA 1E0BA 4L8JA 5IGDA 1GXDC 2WINB 4RCOA 2MP1A 2MUYA 4F88A 1AP0A 4XDXA 2B2YC 5G3LF 4K6LA 2EXZA 2FINB 3SK4A 2D9UA 1SNCA 3MXGA 1V8QA 4RHRA 1R9TB 2MHVA 5KNCA 4BA1I 2LMCB 3I8ZA 3BYYB 4PV1C 2BDNA 3S1MB 2F03A 2JEBI 4A3DB 5I9OA 1TR5A 4X3UA 1TWAB 2DNEA 3J81L 5D65A 5EBCA 1Q1EA 1CFMA 3PIO3 1WTVA 1B1ZA 2K5DA 3NXWA 3W2DA 2F0WA 2K6AA 1ZYRD 1A3VA 1TQOA 1EU4A 3FRPB 5IGFA 2JA6B 3OOCA 2DNCA 2KA7A 3V2TA 4XYOA 4A3IB 1EIHA 2JYOA 2LKVA 2L1BA 4CJ2C 1AW7A 3DWQA 1J8IA 1SYGA 1A15A 2L4NA 4L63B 4HMJA 5ELDA 4LAAA 3HS0C 4DU9A 4Q0FA 2PZWA 4RKBA 1GUGA 1D5MC 1TWGB 3OIQA 4G7ZC 2NVQB 1BCPD 1FD7D 4RKLA 1EIGA 3KBXA 2VUMB 2EJMA 1FNUA 5EBDA 3NE5B 1DOLA 1W6JA 2FMCA 3RUZA 1LT4D 1JWUD 1YNJC 2XWBB 2F1MA 3EROA 1SNDA 1JOOA 1E2WA 1ESRA 5G3LD 4BBSB 1DXMA 1STNA 3G7LA 4A3KB 5JVG3 2RVLA 4HCSA 2NVYB 3W3AA 5K5PA 5I2XA 4EGVA 5IGEA 2K32A 2DN8A 3K6OA 5DEHA 1H9SB 3SK5A 2RBMA 1NCVA 3MA2B 2XWJB 3KF8A 1Q3LA 3SHLA 4BWGB 4N9PA 2WV6D 3GTMB 3JAME 1CHQD 5C4ZA 3S16B 5D3DA 4K14A 1DCZA 2KCNA 3R8BA 2EYHA 4H13C 2M2LA 5I9PA 4XTCS 1JOQA 5C3XA 2DY7A 3M7NA 1U4MA 3ND9A 1II3A 3GV3A 1QNUA 4DK1A 1HRJA 1JQYD 1B44D 5C6AA 4L6TB 2G9HD 4MHEA 4ODGA 4XXEA 1TIID 2DY8A 1WTOA 2F0OA 4LJZC 2QILA 4C1NK 2VNUD 2F0JA 4KV6A 3WOFA 4NDXA 1CT1D 3CKIB 3OMCA 1S5FD 4HSPA 2A73B 1H9MA 3SEBA 3D31A 4KN7C 2A6HC 2IX0A 2WKDA 2K5QA 3GD7A 1A3TA 5DNFA 2JP1A 1TT2A 2PO4A 2A68C 4IUPA 1STBA 4ZK9B 3FDTA 2N55A 3PV0A 1TWFB 1ET6A 2VXWA 4RH6A 4KKSA 4V190 1PYWD 2L12A 2B39A 2OEOA 3SXHA 4OO1H 1VCIA 3PUYA 1BUVT 2A69D 1JR0D 3HOUB 3PUZA 4H44C 1FNVA 1LABA 3H94A 3L7ZC 3TN2A 4K6DA 3KLRA 4RA8A 1PRTD 3NSWA 3L3OC 5ELEA 3P75A 1L0XB 3LNNA 1OO9B 3MFYA 4IFDJ 2F0LA 3DM1A 2GA4B 3NUCA 3HP3A 4CGYB 4CHTB 4OHJA 2K33A 4BY1B 2HCCA 3WOEA 2R61A 4V0BA 4A3BB 2B2VA 3I90A 2PW7A 4QUCA 2FMMA 3S2DB 1DJRD 4E6IA 2F0SA 1HTPA 4J8QA 5CR3A 1LO5D 2IJ0A 1T5EA 1YNND 4FVMA 1DYQA 2XRQD 3HEJA 4LMQD 2TMPA 1C4QA 4WRDA 2K1BA 4PMCA 2NZ1D 1L0YB 1V1PB 5F2DA 1JC7A 1LTAD 1LLRD 2NVXB 2I07B 1SBBB 4NMZA 2XRSD 2EPBA 3RLFA 1B50A 3T4AC 4C3IG 1QILA 2PZTA 4CKBA 1Q12A 2Z4HA 2VB2X 3ITPA 1QJOA 1IYVA 3SK8A 2BA1A 2A6EC 4K8JA 2EYLA 4KY5A 2AUJD 2EYMA 1H9SA 3HOXB 1CK1A 1TS4A 3PUVA 4B9XA 5FLXL 2F0KA 1BR9A 1DZ1A 1I4GA 3CHBD 3MXUA 1ESFA 1MI2A 3CRKC 1TS3A 2R92B 1CM9A 5KYLA 2NN6I 1STHA 3GQBA 4X3SA 3DWAA 1GOZA 1IKMA 1AFPA 2KEDA 3G6JB 2YU9B 1D1KA 1JCKB 5C4JB 3SDZA 2N88A 1KNEA 1EY9A 1UEAB 3MC0B 1D1IA 4KK7A 1SJED 3J80E 2NTSA 1B9MA 1EFID 2D2CC 3I72A 2RSNA 4FYDA 2Q8IB 1G291 4ILWA 2EY6A 5D14A 1LTID 2O4XA 2X6LA 2AQ3B 3ERQA 1G8ZD 2Z8LA 2L55A 3NTIA 4CJ0B 3L9AX 2F3WA 3URYA 2F0FA 3TP5A 3MEHA 1Z7TA 3QG1A 1Y69U 1J9OA 4G7OC 5FKAC 1NAPA 5E4XA 1HQRD 4A3MB 5CV4A 3WDNA 3A7LA 2CW0C 1SNOA 1LTSD 4UAIA 2NUCA 3IL8A 1B3AA 5EKKA 1QWYA 2HQEA 1R4QB 5C4HA 2IWHA 3T16A 2XVSA 2IT1A 3V05A 4I65A 4KY6A 5I4DA 4A3EB 4S3SA 3H91A 1STGA 2NN6G 3LX0A 3TZDA 2SOBA 2K04A 1TY0A 1Q90A 4TSSA 5CBEE 1WTPA 2SNSA 1V1OA 1Q8IA 1MSGA 1K8OA 1DONA 3D3RA 3DUZA 1KAAA 3BS1A 4HAEA 2RQXA 5EKIA 1BXTA 3BG3A 3A54A 2BCOA 3T51B 2AQ1B 4J1MA 1EEID 2FHTA 1V1PA 1EQTA 1PZID 4IFDI 2XSCA 3E5SA 1HQMC 4ZYSA 3VA7A 2MJ8A 1IW7D 1EYAA 2L9HA 3ND8A 2J7ZA 2SEBD 3A8JE 5BN4A 4RGMA 1I6HB 2HDMA 3SR1A 3KBGA 1IKLA 2CHBD 3PO3B 4HR7B 2K28A 3VYTA 3P1HA 1GUNA 1JORA 2KUMA 4IQZA 1KDBA 2O2LD 3C1EA 1RTOA 4ABNA 3OSOA 1PDQA 1VF7A 2KHSA 1RODA 5CMDA 1HPCA 1PFNA 1G2SA 2IPKD 2ZXOA 2F0TA 5COYA 5DM73 2EYFA 4KI0A 3QJYA 3GTKB 1E2VA 3RZDB 1C8CA 1FYCA 4MIUA 3FEWX 3SE0A 2B2WC 2AWOA 2JEAI 4FXDA 2ICIA 5DM63 2K03A 2HUGA 1TY2A 1DM0B 5JEAJ 2F3VA 5IIFA 1OXUA 2WKCA 4Q5VA 2A5HA 3K5NA 4EVOA 1G91A 3S9WA 3E6ZX 1RKNA 4IFDG 2E2HB 3D6WA 3FVQA 1FGBD 3M85A 3OHXC 5HGTA 3BVZA 3M4YA 5C5LA 1DD2A 2SDFA 1SNPA 4O1NA 1HUNA 1B9NA 2NYZD 1ENAA 1ONLA 3DHQA 5HURA 4FXKC 1GJXA 3GTGB 1YNJD 5EQ0A 3HG9A 3Q24A 5M5WB 4RGNA 2F0VA 2EE1A 3I4NB 1QG7A 2JA5B 3D6CA 5A2QL 4QCLA 2L11A 5DAUA 2EY2A 3HOYB 3DEOA 1I4RA 2C5CA 1KABA 1G6ZA 1WTQA 3MXPA 1RDPD 1Z47A 1X32A 4H7BA 2E75C 3H3VC 3PUXA 4IZ8A 1F9QA 1HUMA 5KNDA 5CV9A 2F0QA 3NTKA 4IUNA 3MXNA 2R3ZA 1F2LA 4B08A 2OXPA 2ID0A 1Y8PB 3J7AV 2Z1CA 2MGSA 1ZEQX 4OIJA 4HMIA 5JOBA 2F0DA 3TP8A 4HTHA 4ZKBB 2E2IB 4FNFA 1SMYC 2NN6H 3S1RB 4B9WA 1IL8A 1O78A 1Y1WB 1PRTC 1F2ZA 2SNMA 5EKLA 1PFMA 3EFXD 4CBVA 5BN5A 2D5DA 1EY8A 2D62A 2BA0A 2A6HD 4XQJA 3AB9A 2B2TA 4FP5D 1BOSA 3BZDB 1R4PB 3S2HB 3BDOA 2HCIA 5JAVA 3DXJC 2Q8TA 1QOHA 1TWHB 4IUQA 5EPLA 3F2UA 2JA8B 4RFBA 5LL6X 3VR4A 5J22A 4U68A 1SFOB 2RA4A 2H4OA 1KDAA 2IX3A 2AUKA 2JSOA 1F9PA 2PPBC 4XQQA 4F87A 4C3JG 1A6XA 5EPJA 3GP7A 3TBIB 2NVTB 3QOJA 3S1NB 1ML0D 5CV5A 1AN8A 1I4HA 4KJNA 1EZ8A 1ENFA 1U4LA 3P7JA 3TSSA 4K8IA 1XXGA 3K58A 3OWFA 5C44B 5CV7A 1GUOA 5I6WA 3C3LA 3R2IA 3K0YA 2IW3A 1JOKA 5C3EB 1F9RA 5IT9L 1E2ZA 4R8NA 3I4MB 1JICA 4IUUA 2B2YA 3UI2A 2Z4IA 1TU2B 2F0UA 1QE6A 3A7AB 2J0TD 4FO2A 2K5WA 1PZJD 4X3TA 3JAML 1HFGA 4RWSC 2EJGC 3BDLA 3OW7A 1SYDA 4LK1C 2C9OA 3NWSA 5E3FA 1F77A 1BBXC 2Y0SB 3VYRA 1I4PA 1NR2A 1EY0A 3X3NA 1GHJA 2QEJC 2NTTA 1ILPA 1AEXA 1EYCA 2G9DA 5IGCA 3MFGA 2EYOA 2YYZA 5AFWA 3Q23A 5FO8B 4A3GB 1WD1A 1D5XC 3NTHA 3QOLA 4IALA 1EZ6A 4IFDH 1KLGD 5EPKA 1RCVD 4XIGS 2A6ED 1KDCA 5KNBA 4HCEA 4KHVA 4EQPA 5JPNC 5C4XB 3A56A 3T56B 3PIP3 3J81E 4G4KA 3H6MA 1PMRA 3O13A 3OWEB 1EYDA 2EOTA 3EQLC 1CA6A 3Q6SA 1SE4A 3K59A 2F0GA 1MGSA 1MD2D 4KMUC 3VA5A 3CQZB 3KLSX 3TDQA 2EYJA 2B2WA 2JE6I 4Y7NB 5I6YA 1X3QA 2OT2A 3KLSA 1C48A 4DN4M 4K2LA 1QCBD 4PMWA 4TKOB 2H1EA 3EA6A 2ZXPA 1PTOC 3BDCA 3PO2B 3VR6A 5C0XI 5M3FB 3HGBA 2AWNA 1ZKOA 1UNSA 1RF2D 3S17B 1U4RA 5C5MA 2VB3X 3RMHA 2I46A 5FK9C 1G2TA 1SNMA 2WACA 3I3CA 3TZUA 4FF1A 1H9JA 3IFTA 3VYUA 4ZUIA 3OPOA 4FXGC 3NQTA 4FF3A 3GTPB 3R3OA 1GUTA 1TWCB 3A8IE 4PNYA 1SYEA 1UAPA 4ME5A 5I2YA 3ONAB 5IOCA 5T1IA 2B8GA 3T13A 1K83B 1MSHA 5J1ZA 2M9VA 4CKCA 5J39A 4PQXA 1F2YA 1KLUD 3I73A 1WTXA 2E2JB 1EEFD 5FOBB 3RD4A 2QKIC 2L0CA 1RHPA 3DEPA 5LL6S 1VMPA 5K36G 2B2VC 3H0GB 3EJIA 2BE5D 5JEAG 4XQNA 1UUPA 3CU7A 4ZAIA 3GV6A 5M3MB 1T5XD 3MVVA 4C3IB 2EDGA 1GUWA 1AZQA 3S14B 1EY4A 3C46A 3NBIA 2LY7A 1PFBA 1S5DD 4A93B 3I70A 3QWNA 4C56C 3GO5A 1TVXA 3TP6A 3FKIB 2EZVA 4ZQ3A 1JWMD 1EWCA 1RTNA 3MHBA 2ZT9C 4XT3B 3NP8A 4C3HG 4DA2A 3U9SA 1S4ZA 2KVMA 1I6VC 3HOWB 5C0XG 4M8AA 4QUFA 2NB0A 1ZYRC 3Q0AA 5EGTA 5IGGA 3MWYW 2F4IA 3K5OA 1SJHD 1D6EC 3SK6A 1WTRA 2F0HA 2OF1A 1STEA 1EOTA 4ULLA 1ICWA 4HEDA 2O5JC 3TMEA 3M3YB 5IGBA 3KUPA 4FF2A 4F8MA 1BCPC 3NHHA 2RDHA 2R7ZB 3J80L 2Q8RE 1HA6A 3NPPA 1EY6A 3NK9A 3FPPA 4JK1C 1PTOH 1LT3D 4IURA 4RHSA 1PZKD 5JJZA 2PNRC 5ELFA 5T1GA 4K2KA 4QF4A 2K05A 5KRUA 2ICEC 1K8MA 2PZUA 1EL0A 4A3JB 4K5WA 2CQAA 3V96A 2R6GA 3NBHA 2QF7A 4PMBA 1CZWA 5C3WA 3X3MA 1ET9A 1AZPA 1HXYD 1GUSA 1S5ED 1SXTA 5ELBA 5M5YB 2IL8A 1VF5C 2A74C 1STAA 1A3UA 4XT1B 5FO7B 1O7LA 4ZUJA 1S5BD 3K5LA 2EYPA 4KKUA 3HKZB 1JE4A 3OMGA 4OGQC 3I4LA 1NR4A 1LACA 1STYA 3M4OB 2RKSA 1SE3A 2ENBA 2M00A 1FR3A 5CV6A 2NBFA 2L5TA 1I4XA 4BY7B 3VR2A 5C0XJ 5E4WC 3QB3A 4WORA 1MBYA 1HTLD 2F0MA 5IT9E 1A2TA 5D3IB 3EVQA 1DOKA 1PRTF 1OXSC 3FPUB 1BCPB 3FMCA 4DF7A 2B63B 5BN3A 1NSNS 1ZXTA 4HSVA 2R93B 4MN3A 1LTGD 5FO9B 5IODA 2KEEA 1F9SA 1BO0A 4DGZA 4KJOA 1D2BA 3D4RA 5KYIA 4IN3A 4DXGA 1B4OA 1Z6HA 3GTOB 4C3HB 2KJXA 4YIJA 5NUCA 5FLXE 1NUCA 4QMGA 2B2UC 1XWEA 3D4DA 5EJWA 1VMCA 1SYCA 4C2MB 2A69C 2BOSA 1I3QB 2EY5A 2EVBA 3S15B 2PW5A 3C2PA 1WVLA 4KD3A 3S1QB 4KHZA 5M5XB 5K36H 3N6RA 4IUTA 4K5XA 2O5IC 2F0EA 5JEAH 3MAQA 4R9WA 4C1NI 1EU3A 3P20A 1WCMB 1SYBA 2K7VA 3A8KE 3K57A 1TS2A 3RZOB 2AQ2B 4G7HC 1B53A 4ID6A 3T53B 4CJ1B 4R8IA 1Y1VB 4ZKCB 2RSOA 3BYTB 4NP5A 2A68D 1SMYD 4Z9CB 3IAYA 3GTJB 4FF4A 4OL7A 4XYQA 1LTTD 1EWHA 4TRDA 4U673 2KECA 3J7YW 2F0PA 1H9KA 1YNNC 2WAQB 5KIXA 5C0XH 3I91A 3ZYYX 3D8GA 1KNAA 4RCNA 4WFN3 4K5VA 1WTWA 1CI3M 3SVMA 3VYSA 4N9TA 1CQVA 4F7XA 1DOMA 1D5ZC 5KEEA 2FJ2A 3LWUA 2PYKA 3QIAA 2QDBA 3HZXA 2PCFB 1KTKA 2KQ3A 3HOZB 1CTMA 4UDUC 4DAPA 4QB4A 1FNWA 1Y8NB 4BA2I 1M4VA 2JXMB 3GTLB 4BBRB 5CBAE 5JVH3 4ZLTF 2XIWA 3IKJA 1PRTB 1VDZA 2HDLA 2WP8J 4O42A 1Q1BA 1O7YA 4EQOA 1PLFA 4CKEA 4A3FB 1RD9D 4KKTA 4DFAA 2LFNA 5E1FA 1SSOA 3E0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EIG A;  1CA5 A;  3KBX A;  2FFK B;  5CMD A;  1X32 A;  3TZD A;  5AFW A;  2K04 A;  2N88 A;  1U4P A;  4LMQ D;  1E0B A;  1B53 A;  4U68 A;  1WD1 A;  4CJ1 B;  1PFN A;  5CBE E;  2RA4 A;  1DOL A;  1KNE A;  1F9Q A;  1HUM A;  2K1B A;  1G2S A;  3LWE A;  2MP1 A;  2RSO A;  3ONA B;  4OIK A;  5T1I A;  4IUV A;  2NZ1 D;  4ZKC B;  5EPK A;  1WTR A;  1SAP A;  1MSH A;  5E4W C;  5DNF A;  5COY A;  2JP1 A;  1SDF A;  1MSG A;  2R3Z A;  1EOT A;  1QNK A;  1F9P A;  4XDX A;  1AP0 A;  2B2Y C;  2NWG A;  1DON A;  1ILQ A;  1X3P A;  4IUP A;  4X3K A;  1DOK A;  1ICW A;  4HAE A;  1ESR A;  5EKI A;  1F2L A;  2FIN B;  3FDT A;  4HED A;  4ZK9 B;  1WTX A;  2N55 A;  2D9U A;  2KOL A;  2VXW A;  5EPJ A;  2MGS A;  3KUP A;  3G7L A;  4NW2 A;  1O7Z A;  2KEC A;  1RJT A;  2RSN A;  3FPU B;  4OIJ A;  2RVL A;  1C8C A;  1RHP A;  2FHT A;  3DEP A;  2EPB A;  4HCS A;  3I8Z A;  1VMP A;  2EOT A;  2Q8R E;  1HA6 A;  1ZXT A;  2B2V C;  2L12 A;  1ML0 D;  2B2T C;  2BDN A;  1B50 A;  3I91 A;  1EQT A;  1CA6 A;  2B2W C;  3Q6S A;  4IUR A;  1KNA A;  5JJZ A;  4HSV A;  1WTW A;  4X3U A;  3SVM A;  5D14 A;  2X6L A;  2K03 A;  2HUG A;  1MGS A;  3GV6 A;  4MN3 A;  1U4L A;  4ZAI A;  3P7J A;  5T1G A;  3MTS A;  4ZKB B;  2KEE A;  5D65 A;  1F9S A;  1BO0 A;  2K01 A;  2K05 A;  4R8I A;  1DOM A;  3TN2 A;  1WTV A;  1AZQ A;  4RA8 A;  1NCV A;  1GUW A;  4CJ0 B;  1G91 A;  2FJ2 A;  2MPM A;  1EL0 A;  2MJ8 A;  1Q3L A;  3IFD A;  1XYI A;  2L9H A;  5COR A;  1B4O A;  2J7Z A;  1PFB A;  1IL8 A;  2B2W A;  1BNZ A;  3R93 A;  1HHV A;  1X3Q A;  1F9R A;  1TVX A;  4DN4 M;  1J9O A;  1XX8 A;  1JIC A;  1NAP A;  3D6W A;  4IUU A;  2HDM A;  2B2U C;  2H1E A;  2B2Y A;  5E4X A;  1AZP A;  1PFM A;  1M8A A;  1RTN A;  3DM1 A;  3UI2 A;  1O80 A;  5EJW A;  3HP3 A;  1QE6 A;  1IKL A;  1VMC A;  2M2L A;  4RAU C;  2HCC A;  4XT3 B;  1WTP A;  2SDF A;  4UAI A;  4X3T A;  2X6G A;  3IL8 A;  1B3A A;  1EIH A;  2K28 A;  1S4Z A;  1HFG A;  2DY7 A;  4RWS C;  1U4M A;  2JYO A;  2KVM A;  2L1B A;  5CBA E;  1HUN A;  1U4R A;  2NYZ D;  2IL8 A;  2X69 A;  4CJ2 C;  1DZ1 A;  4ZLT F;  3QO2 A;  1WVL A;  1WD0 A;  2B2V A;  2B2T A;  2XIW A;  3GV3 A;  1MI2 A;  1BBX C;  1B2T A;  1J8I A;  5EQ0 A;  1G2T A;  1HRJ A;  3I90 A;  1A15 A;  2B2U A;  2HDL A;  2L4N A;  1CM9 A;  3I3C A;  4XT1 B;  2EE1 A;  1NR2 A;  4O42 A;  4MHE A;  4IUT A;  1QG7 A;  4QUC A;  1O7Y A;  4QUF A;  2DY8 A;  2FMM A;  4X3S A;  2KUM A;  1WTO A;  2L11 A;  2HCI A;  1LV9 A;  1PLF A;  4R9W A;  1HFN A;  1JE4 A;  1ILP A;  1BF4 A;  1RTO A;  3DEO A;  3N52 A;  1IKM A;  1NR4 A;  2CVR A;  2Q8T A;  2KED A;  1G6Z A;  1WTQ A;  1PDQ A;  4IUQ A;  3H91 A;  1SSO A;  5EPL A;  3F2U A;  3MWY W;  1ROD A; 
#chains in the Genus database with same CATH topology
 2WB1 B;  3HOV B;  3I55 A;  1MKH A;  3K5M A;  1EY7 A;  1W6K A;  3AU7 A;  4BY1 H;  4IUV A;  1PXU A;  2EY1 A;  1SAP A;  2E74 C;  5LHY 1;  1HCZ A;  1QNK A;  3UE0 A;  3R2T A;  4GZY C;  2NWG A;  4A3B H;  2F0N A;  4X3K A;  5TSS A;  2RHS B;  1K3B C;  4AQY L;  2JQO A;  3VR3 A;  2PQE A;  2PMZ B;  4HN7 A;  1S40 A;  2HD3 A;  3M7G A;  1PTO F;  5CC4 A;  4IPC A;  4O2D A;  1TXY A;  3S2D H;  1SEB D;  1I50 B;  1EQV A;  1N36 L;  4KN4 C;  3ERS X;  4OWX B;  1VQ4 A;  4HIK A;  2IX1 A;  1YHB A;  3Q22 A;  3CCV A;  1UEB A;  1V43 A;  4RGO S;  1H9R A;  1NE3 A;  1LTB D;  1SNQ A;  3IFD A;  5COR A;  2CWP A;  1KC8 C;  4YHH L;  2KBN A;  4A3D G;  4QGU A;  2CKZ B;  2RDF A;  4DNR B;  1XX8 A;  5JPM C;  2XN9 C;  1TS5 A;  3PO3 G;  3ULL A;  4ZRZ A;  1SYF A;  4JI5 Q;  4JYA Q;  4KY7 A;  1HR0 L;  5KGU A;  1WFQ A;  4Y52 H;  1GKH A;  1O80 A;  4TQU S;  3EN2 A;  3TP7 A;  4OO1 I;  5GAE C;  2NVX H;  1XTC D;  1F2M A;  5ELC A;  3J7A 5;  4DR2 L;  1GHK A;  1JB3 A;  2E2D C;  2LS0 1;  2QW7 A;  4PZ8 A;  4QJF A;  2E76 C;  3OIP A;  2TSS A;  3U9O A;  4GKJ Q;  5ISR A;  2RDG A;  1WD0 A;  2UUC L;  4DNT B;  2WII B;  1B2T A;  3C1F A;  1PHJ A;  4JI4 L;  2JA6 G;  1IYU A;  1LT5 D;  2ZXR A;  4IOA A;  4NKL A;  3BVM A;  2ZTE A;  3SGI A;  2JA7 B;  4A3I G;  3GTQ B;  5M9O A;  1HFN A;  1UE7 A;  1HNZ Q;  3N52 A;  1SE2 A;  2BDO A;  1GM5 A;  1XPR A;  4KD4 A;  2H5X A;  3NQI A;  1N34 Q;  1BDO A;  2Q2U A;  1CA5 A;  1S5C D;  2FFK B;  4JI3 L;  4IJL A;  4DAV A;  1U4P A;  2EJF C;  2Q2I A;  1QB5 D;  2B8F A;  3MZ5 A;  1ENC A;  3LWE A;  3HOX H;  1HHV A;  4OIK A;  2IHF A;  1PH4 A;  1LT6 D;  5FJ8 G;  2J4X A;  4YWL A;  3A55 A;  1SDF A;  1I4Q A;  4LF4 L;  2K5N A;  1ILQ A;  1IHZ A;  1X3P A;  3PUW A;  1WTH A;  4DK0 A;  2VQE Q;  2VUM G;  3PIO A;  1LTR D;  3J81 i;  4RGT A;  2KOL A;  4NW2 A;  1O7Z A;  4DXF A;  1RJT A;  4BS9 A;  1BQQ T;  1D7Q A;  4APV A;  4QIW B;  3KF8 B;  4KTA A;  4C3J B;  2B2T C;  1PTO D;  3U58 A;  4AYB B;  4DV0 L;  3DWP A;  2OQK A;  3J7A F;  4X6A H;  3U50 C;  1U9R A;  3DMU A;  2BE5 C;  3KK7 A;  2YU9 H;  1HA5 A;  4JBW A;  4J6H A;  4BBS G;  1A2U A;  1CHP D;  3KF6 B;  3MTS A;  4DR7 Q;  3KDF B;  4B3S L;  2K01 A;  4A3K G;  4M1U B;  5C4J H;  2VY3 A;  3ZJY C;  3AMU A;  5J3B A;  2MPM A;  2V4D A;  1OXX K;  2KCC A;  2XNA C;  1XYI A;  3H09 A;  1I94 Q;  4LWC A;  2JA9 A;  1JWS D;  2N49 A;  4GOP A;  3D4W A;  1BNZ A;  3R93 A;  1CSQ A;  3J80 c;  1I5F A;  1CQF A;  2CW0 D;  4X62 L;  4DAY A;  5CYU A;  4MTK A;  1CZG A;  4BXX H;  1M8A A;  1EY5 A;  3A0J A;  3E9I A;  4EQN A;  2F0I A;  4RAU C;  3MXN B;  4P2C B;  1NTG A;  2X6G A;  1TKW B;  1OXV A;  5A2Q E;  1OTC A;  2QCP X;  5CV8 A;  3K7A B;  3I4N G;  2X69 A;  2JA5 G;  3QO2 A;  3BVG A;  1Y8O B;  1C0A A;  1OXT A;  3HRZ C;  4H0L C;  4G57 A;  3E3X A;  4OO1 G;  1E1T A;  2B2U A;  3HOY G;  1IW7 C;  4I7Z C;  4WJW A;  5CGK A;  2A1A A;  4NPS A;  1M90 C;  1LV9 A;  3PMF A;  1BCP F;  1PTO B;  3CRL C;  1BF4 A;  2CVR A;  5A35 A;  3VR5 A;  2MFI A;  4GLX A;  3NWT A;  1E0B A;  4L8J A;  4R4O A;  5IGD A;  4A3M H;  1GXD C;  3UDF A;  2WIN B;  4RCO A;  2MP1 A;  3E0E A;  2MUY A;  3FHW A;  4F88 A;  1AP0 A;  4XDX A;  2B2Y C;  4JI2 L;  5G3L F;  4K6L A;  2EXZ A;  2FIN B;  3CME A;  3SK4 A;  1Q46 A;  1SNC A;  2D9U A;  1J6Q A;  2HT1 A;  3MXG A;  1V8Q A;  4RHR A;  1R9T B;  2MHV A;  4LFC L;  5KNC A;  4X65 Q;  4BA1 I;  2LMC B;  3I8Z A;  3BYY B;  4PV1 C;  4DV5 Q;  2BDN A;  3S1M B;  4DR7 L;  2F03 A;  4A3E H;  1QUQ B;  2JEB I;  4A3D B;  5I9O A;  4LF6 L;  1TR5 A;  4X3U A;  3RN5 A;  1TWA B;  2DNE A;  1FL0 A;  3J81 L;  5D65 A;  5EBC A;  1VQK A;  1CKO A;  1Q1E A;  1CFM A;  2KHI A;  3PIO 3;  1WTV A;  1B1Z A;  2K5D A;  4DV1 Q;  3NXW A;  3W2D A;  1B3Q A;  2F0W A;  3CCU A;  4DV6 L;  3HOU G;  2K6A A;  1ZYR D;  1A3V A;  4OEM B;  1TQO A;  1EU4 A;  2F4V L;  3A5Z B;  4OWT B;  4J15 A;  3FRP B;  5IGF A;  2JA6 B;  4LW1 A;  3OOC A;  2DNC A;  1YHA A;  2KA7 A;  3V2T A;  4XYO A;  4A3I B;  1EIH A;  2JYO A;  2LKV A;  1UE6 A;  2L1B A;  4CJ2 C;  1AW7 A;  5IP9 G;  1XNQ L;  3DWQ A;  1J8I A;  2KHJ A;  4POF A;  3I56 A;  2HHH L;  1SYG A;  2K52 A;  1A15 A;  1E3P A;  2L4N A;  2Z6B A;  4L63 B;  4EX5 A;  1FJG Q;  4HMJ A;  4P73 A;  5ELD A;  4RMF A;  4LAA A;  3HS0 C;  4DU9 A;  4Q0F A;  2PZW A;  4RKB A;  1GUG A;  1D5M C;  2JA8 G;  1TWG B;  3OIQ A;  4A3B G;  2RHQ B;  2B29 A;  4G7Z C;  4DAM A;  2NVQ B;  1PH9 A;  1LM0 A;  1BCP D;  1PH7 A;  4HIO A;  1FD7 D;  4RKL A;  1EIG A;  3KBX A;  2ZJP A;  1I6H H;  2VUM B;  2EJM A;  1FNU A;  3CCR A;  5EBD A;  3NE5 B;  1G6P A;  2UUA Q;  1DOL A;  1W6J A;  2FMC A;  3RUZ A;  1N33 Q;  1LT4 D;  1NMF A;  1JWU D;  1MJC A;  1YNJ C;  2F1M A;  2XWB B;  4LF9 L;  2ASB A;  3ERO A;  3PO3 H;  1EIY B;  1T9H A;  1CKN B;  1SND A;  3T1Y Q;  1N8R C;  1JOO A;  1LYL A;  1E2W A;  3M4Q A;  1ESR A;  4X65 L;  4LFA Q;  5G3L D;  4BBS B;  1DXM A;  1RIP A;  1N32 L;  1STN A;  3G7L A;  4A3K B;  5JVG 3;  2RVL A;  4HCS A;  2UU9 L;  2NVY B;  2R7D A;  4DV3 Q;  3W3A A;  4DV2 Q;  4HID A;  3AYH B;  5K5P A;  5I2X A;  2JA6 H;  4EGV A;  5IGE A;  3I4O A;  2K32 A;  2DN8 A;  1IYJ B;  3STB D;  1PH6 A;  3JC6 6;  3K6O A;  5DEH A;  1H9S B;  3SK5 A;  2RBM A;  1NCV A;  2D0P A;  3MA2 B;  1L0W A;  2XWJ B;  3KF8 A;  1Q3L A;  4NXN L;  1IXR A;  3SHL A;  4BWG B;  4N9P A;  2WV6 D;  3GTM B;  3JAM E;  1CHQ D;  5C4Z A;  2EXD A;  3S16 B;  2BH8 A;  3KF6 A;  3KDF A;  5D3D A;  4K14 A;  1PH2 A;  1DCZ A;  2KCN A;  3R8B A;  2EYH A;  5FJ8 H;  3GTK H;  4JV5 L;  3PSI A;  4H13 C;  2M2L A;  5I9P A;  4XTC S;  3CCQ A;  1JOQ A;  3RZD H;  5C3X A;  1VQM A;  2DY7 A;  3M7N A;  1U4M A;  4DV4 Q;  3ND9 A;  1FJG L;  1II3 A;  4L5T A;  3GV3 A;  1QNU A;  4DK1 A;  4HJ7 A;  1HRJ A;  1JQY D;  1B44 D;  5C6A A;  4JVZ A;  4L6T B;  2G9H D;  4MHE A;  1NBW A;  4ODG A;  4XXE A;  3H15 A;  1TII D;  2DY8 A;  2VL6 A;  1WTO A;  2F0O A;  4MTN A;  4LJZ C;  2QIL A;  4C1N K;  2VNU D;  4DUZ Q;  2F0J A;  4BBS H;  4KV6 A;  3WOF A;  4A3G G;  4NDX A;  1CT1 D;  1QZG A;  3CKI B;  4LUZ A;  1KRS A;  3OMC A;  1S5F D;  4HSP A;  2R92 G;  2A73 B;  2NVY H;  4GNX C;  2UUA L;  1H9M A;  2RCF A;  1JT8 A;  2Q2H A;  2E2H H;  3KLW A;  3D31 A;  3SEB A;  3CW2 C;  4KN7 C;  2A6H C;  2IX0 A;  2WKD A;  4GS3 A;  3T1Y L;  1Y14 B;  3RLN A;  2K5Q A;  1VQO A;  2YTV A;  3GD7 A;  1A3T A;  5DNF A;  5C4X G;  2JP1 A;  1TT2 A;  2PO4 A;  3K0X A;  2A68 C;  4IUP A;  1STB A;  4ZK9 B;  3FDT A;  4B3R Q;  2N55 A;  3PV0 A;  3GTG H;  1TWF B;  1ET6 A;  2K14 A;  2VXW A;  5M5W H;  2Y0S E;  4RH6 A;  4KKS A;  4V19 0;  1X3G A;  3JAM i;  3I4N H;  2JA5 H;  1JJ2 A;  1PYW D;  4K0K Q;  2L12 A;  2B39 A;  2OEO A;  1Q82 C;  3SXH A;  2CWA A;  4OO1 H;  1VCI A;  3PUY A;  3HOY H;  1BVS A;  2I5L X;  1BUV T;  2A69 D;  1JR0 D;  4DR3 L;  4NB3 A;  3HOU B;  3OTO L;  3PUZ A;  2WFW A;  4H44 C;  2CCZ A;  4BXX G;  1FNV A;  1SN8 A;  1LAB A;  4WJ4 A;  3H94 A;  3F2C A;  3L7Z C;  3CAM A;  3TN2 A;  4K6D A;  3KLR A;  4RA8 A;  4LUO A;  1PRT D;  3NSW A;  3L3O C;  5ELE A;  2EQS A;  3P75 A;  3DLL A;  1L0X B;  3RN2 A;  3LNN A;  1QUQ A;  4DUY L;  1OO9 B;  5M3F G;  4UPA A;  3MFY A;  1MHW C;  4DR6 L;  4IFD J;  2F0L A;  3DM1 A;  4YCV A;  2GA4 B;  3NUC A;  3HP3 A;  4CGY B;  4CHT B;  1A62 A;  4OHJ A;  2K33 A;  4BY1 B;  2HCC A;  2MO1 A;  3BZC A;  3WOE A;  2R61 A;  1N36 Q;  4LFB L;  4DV7 L;  3M4P A;  4V0B A;  4NXM L;  4A3B B;  1KL9 A;  2B2V A;  3CCS A;  4A3M G;  1ASY A;  3I90 A;  4ALP A;  3PCO B;  4YCW A;  2PQA A;  2PW7 A;  1PYS B;  4QUC A;  2JK8 A;  2E2I H;  2FMM A;  4YHH Q;  1PH1 A;  4A3L H;  5JJI A;  4X64 L;  1HH2 P;  2CH4 W;  3S2D B;  1DJR D;  4E6I A;  2F0S A;  3S1R H;  1IBL L;  1JMC A;  2IY5 B;  1HTP A;  4J8Q A;  5CR3 A;  1LO5 D;  2IJ0 A;  1Y1W H;  1HR0 Q;  1T5E A;  1YNN D;  4FVM A;  1VQ5 A;  5IP7 H;  2GVB A;  1DYQ A;  2XRQ D;  4GNX B;  3HEJ A;  4LMQ D;  4LF7 L;  2TMP A;  1VQ7 A;  1C4Q A;  3HOU H;  4DKA C;  4WRD A;  2K1B A;  1MIU A;  2UUC Q;  4PMC A;  2NZ1 D;  4AH6 A;  2ZJR A;  1L0Y B;  1V1P B;  1IBM L;  4JI4 Q;  3CCJ A;  1HNW Q;  3F1Z A;  1E7Z A;  5F2D A;  2F3I A;  1X55 A;  1JC7 A;  1LTA D;  2LXJ A;  3BU2 A;  3H0G G;  1LLR D;  2NVX B;  4FDB A;  2I07 B;  1SBB B;  4L5Q A;  4NMZ A;  2XRS D;  2EPB A;  5IP9 H;  1SLJ A;  3S2H H;  3RLF A;  1B50 A;  3T4A C;  2QDL A;  4C3I G;  1QIL A;  1CKN A;  4A4I A;  2PZT A;  1SMX A;  1XPO A;  4JI3 Q;  4CKB A;  1Q12 A;  2Z4H A;  1TWH H;  2VB2 X;  3ITP A;  1QJO A;  1VQD A;  2JA8 H;  1IYV A;  3SK8 A;  2BA1 A;  1NMG A;  4A93 G;  2A6E C;  2D0O A;  4K8J A;  3H3V H;  4P74 A;  3FKI G;  2EYL A;  1SFO H;  4LF4 Q;  3EIV A;  1AE3 A;  4KY5 A;  2KEN A;  3A5U A;  2AUJ D;  2EYM A;  1H9S A;  1SE8 A;  5IYD G;  3HOX B;  1CK1 A;  4PZ6 A;  3ULJ A;  4DV0 Q;  1TS4 A;  3TS2 A;  3PUV A;  4B9X A;  4JI6 L;  5FLX L;  2F0K A;  1BR9 A;  1DZ1 A;  4B3S Q;  1I4G A;  2AMC B;  3CHB D;  3MXU A;  1ESF A;  1MI2 A;  3CRK C;  1TS3 A;  2R92 B;  2P5Z X;  1CM9 A;  4JI7 L;  5KYL A;  2NN6 I;  1STH A;  3GQB A;  4X3S A;  3CPF A;  5C44 H;  1L1O C;  3MEF A;  4DR4 L;  3DWA A;  4X62 Q;  1GOZ A;  1Q8K A;  4JOI C;  1IKM A;  1NY4 A;  1VQF A;  1AFP A;  2KED A;  3G6J B;  2YU9 B;  2UUB L;  1D1K A;  3AFP A;  1WI5 A;  3CC7 A;  2ZJQ A;  4OXP A;  1JCK B;  5C4J B;  3SDZ A;  3I4M H;  2N88 A;  1AE2 A;  1GD7 A;  1HNW L;  1KNE A;  4PZ7 A;  1EY9 A;  1UEA B;  3MC0 B;  1D1I A;  2JJQ A;  4KK7 A;  1SJE D;  3J80 E;  2Z6K C;  2NTS A;  1VQP A;  1B9M A;  1EFI D;  2D2C C;  3I72 A;  2RSN A;  4TVA B;  4FYD A;  4UY8 C;  1VQA A;  1X56 A;  4AIM A;  1RL2 A;  5GAH C;  2Q8I B;  1G29 1;  3AFQ A;  1PH3 A;  4ILW A;  1ASZ A;  2EY6 A;  2PNH A;  5D14 A;  2X6L A;  1LTI D;  2O4X A;  2AQ3 B;  3ERQ A;  1VQH A;  1G8Z D;  4ME3 A;  4PG3 A;  5LMU Q;  1K8A C;  1S72 A;  1KQS A;  2KCM A;  2Z8L A;  2L55 A;  3NTI A;  4CJ0 B;  3L9A X;  4A3G H;  2F3W A;  1FGU A;  3URY A;  2F0F A;  5ELN A;  3TP5 A;  1K9M C;  4JI2 Q;  2R92 H;  3MEH A;  3ICE A;  1Z7T A;  2DJG C;  3QG1 A;  1Y69 U;  4HJA A;  4LNQ A;  1J9O A;  4LFC Q;  4G7O C;  5FKA C;  1NAP A;  1EIF A;  2PI2 A;  1E1O A;  5E4X A;  1HQR D;  4A3M B;  5CV4 A;  3WDN A;  3A7L A;  2CW0 C;  3K8A A;  1SNO A;  1XMQ L;  2K5V A;  1LTS D;  5C4X H;  3F2B A;  3RLO A;  3J81 c;  4UAI A;  2NUC A;  3IL8 A;  1B3A A;  4LF6 Q;  5EKK A;  1VQI A;  1QWY A;  2HQE A;  1R4Q B;  3J81 j;  5C4H A;  4YWM A;  4GN4 B;  2IWH A;  3L2P A;  3TRZ A;  3T16 A;  1PH5 A;  5JJL A;  2XVS A;  2IT1 A;  3CMA A;  2RCN A;  2K4K A;  3J80 i;  3V05 A;  4I65 A;  1MJE A;  4KY6 A;  4DV6 Q;  5I4D A;  3CQZ H;  2F4V Q;  4A3E B;  4JBM A;  2MO0 A;  4BY7 G;  4S3S A;  3H91 A;  4Y7N H;  4KHP Q;  1BBW A;  1STG A;  2NN6 G;  3LX0 A;  2HQL A;  4DK3 C;  3TZD A;  1V1Q A;  2SOB A;  2K04 A;  2Z0S A;  2OTL A;  1TY0 A;  1Q90 A;  3H3V I;  4TSS A;  1EQR A;  5CBE E;  1WTP A;  2SNS A;  1V1O A;  1WOC A;  5M3F H;  1Q8I A;  1XNQ Q;  4MNO A;  4JI1 Q;  1V9P A;  1EWI A;  2HHH Q;  1MSG A;  1M1K C;  1K8O A;  1DON A;  3S17 H;  3D3R A;  3DUZ A;  1KAA A;  3BS1 A;  2B63 G;  4HAE A;  2RQX A;  5EKI A;  1BXT A;  4GNX A;  3BG3 A;  3A54 A;  2BCO A;  3T51 B;  3ULP A;  2AKW B;  2L15 A;  2AQ1 B;  4J1M A;  4A76 A;  4R1J A;  1UE1 A;  1EEI D;  2FHT A;  4UHV A;  2R93 G;  1PVO A;  2K75 A;  1V1P A;  1EQT A;  1WJJ A;  3HKZ E;  5LMU L;  1VQG A;  3G4S A;  1PZI D;  4IJH A;  4IFD I;  5FLM G;  2XSC A;  3E5S A;  1HQM C;  4LF9 Q;  4ZYS A;  3VA7 A;  2MJ8 A;  1IW7 D;  1EYA A;  2L9H A;  3ND8 A;  2J7Z A;  3PF4 A;  5HY6 A;  2SEB D;  3A8J E;  1K83 H;  5BN4 A;  1JB7 A;  1IL2 A;  4RGM A;  1N32 Q;  1I6H B;  1A0I A;  1P8L A;  5ELO A;  2EIF A;  2HDM A;  4A3L G;  3SR1 A;  2UU9 Q;  2E2J H;  1YJN A;  3KBG A;  3CCM A;  1IKL A;  3UE1 A;  1JJG A;  2N8N A;  2CHB D;  4A3C G;  3PO3 B;  4HR7 B;  2K28 A;  1Y1W G;  1U0L A;  1QVC A;  1S3O A;  1YEZ A;  5IP7 G;  1XTD A;  3H0G H;  5DLQ E;  4P71 A;  3VYT A;  3P1H A;  1GUN A;  1JOR A;  5AJ3 L;  3HFZ B;  1IBK L;  1WCM G;  1X3E A;  3F8T A;  4NXN Q;  1YVC A;  2E8G A;  4C3I H;  2KUM A;  4IQZ A;  1KDB A;  2O2L D;  3C1E A;  4KHP L;  1RTO A;  3S14 H;  4GLV B;  4ABN A;  4R4T A;  3OSO A;  4QQB X;  1QVG A;  1PDQ A;  4A93 H;  1VF7 A;  3LGJ A;  2KHS A;  1ROD A;  4JV5 Q;  2QEX A;  1U5K A;  3FKI H;  5CMD A;  1HPC A;  4JI1 L;  1JE5 A;  1PFN A;  2V1C C;  1GVP A;  1G2S A;  3F2D A;  2IPK D;  2ZXO A;  4GKK L;  2F0T A;  5COY A;  5IWA L;  5DM7 3;  3B6Y A;  5IYD H;  2EYF A;  4KI0 A;  3QJY A;  5BR8 L;  3GTK B;  3HOW H;  1E2V A;  3RZD B;  1C8C A;  1FYC A;  4HJ8 A;  2YTX A;  4MIU A;  1J5E Q;  2I5H A;  3FEW X;  3SE0 A;  2B2W C;  2AWO A;  2JEA I;  4FXD A;  2ICI A;  5DM6 3;  2K03 A;  2HUG A;  1TY2 A;  1FVI A;  2ZTC A;  1DM0 B;  5JEA J;  2F3V A;  5IIF A;  2ZM6 Q;  1OXU A;  3K80 C;  2WKC A;  1W3S A;  1HNX L;  4Q5V A;  2A5H A;  3EBE A;  3K5N A;  4EVO A;  3CF5 A;  1G91 A;  3Q8D A;  3HOZ G;  3S9W A;  3AQQ A;  3G71 A;  3E6Z X;  1RKN A;  1BBU A;  4HJ5 A;  4X66 Q;  4IFD G;  3U4V A;  2E2H B;  3D6W A;  2IHE A;  3FVQ A;  1FGB D;  3M85 A;  3K7U C;  4BBR G;  2ALY B;  5C44 G;  3OHX C;  5HGT A;  3BVZ A;  3M4Y A;  4R4Q A;  5C5L A;  1DD2 A;  2SDF A;  1SNP A;  4DR3 Q;  2NZH A;  1ICF B;  4O1N A;  3OTO Q;  2R7Z H;  5C3E G;  3I2Z A;  1HUN A;  4CDF C;  3HKS A;  1B9N A;  2NYZ D;  1ENA A;  3G6E A;  1ONL A;  3DHQ A;  3I4M G;  2WAQ E;  5HUR A;  4FXK C;  1GJX A;  3GTG B;  1YNJ D;  1K0S A;  5EQ0 A;  3HG9 A;  4A3F G;  3Q24 A;  5M5W B;  1HZB A;  2F0V A;  4RGN A;  4POG A;  2EE1 A;  3I4N B;  1QG7 A;  2JA5 B;  3D6C A;  5A2Q L;  1K0R A;  4QCL A;  2L11 A;  5DAU A;  4DUY Q;  2EY2 A;  3HOY B;  3DEO A;  3HOV G;  1I4R A;  2C5C A;  1KAB A;  4DPG A;  1G6Z A;  1WTQ A;  4DR6 Q;  2Y0S G;  3MXP A;  1RDP D;  1Z47 A;  4JBK A;  1X32 A;  4H7B A;  2E75 C;  3H3V C;  3PUX A;  4LFB Q;  4DV7 Q;  4NXM Q;  4IZ8 A;  5GAG C;  1F9Q A;  1HUM A;  5EAY A;  4GOP C;  5KND A;  5CV9 A;  2F0Q A;  2DGY A;  3NTK A;  4IUN A;  3I7F A;  3MXN A;  4JOI A;  2R3Z A;  5M5Y H;  4DR5 L;  1F2L A;  4B08 A;  2OXP A;  2ID0 A;  3RR5 A;  4X64 Q;  1Y8P B;  3J7A V;  2Z1C A;  1J5E L;  2MGS A;  1ZEQ X;  4B3M L;  4OIJ A;  2ES2 A;  2UXD L;  1IBL Q;  1PH8 A;  4HMI A;  2VZA A;  3E9H A;  2F0D A;  5JOB A;  3TP8 A;  3KJO A;  1E24 A;  2Z6K A;  2ZM6 L;  2B3G A;  4LF7 Q;  5LMN W;  4HTH A;  4ZKB B;  3CD6 A;  2E2I B;  1YNX A;  4CDD C;  4FNF A;  2CFM A;  2WB1 E;  3GDE A;  1SMY C;  1IBM Q;  4BY7 H;  4X66 L;  2NN6 H;  3S1R B;  4L5R C;  1SR3 A;  4JI8 L;  4B9W A;  1IL8 A;  1O78 A;  1Y1W B;  1PRT C;  4DR1 L;  1F2Z A;  1B7Y B;  3AEV A;  2SNM A;  5EKL A;  5IT9 c;  1PFM A;  4CDC C;  3EFX D;  2ZTD A;  1O7I A;  4CBV A;  2D5D A;  5BN5 A;  1EY8 A;  2PMZ E;  1VQ6 A;  4JW0 A;  2B63 H;  3T1H Q;  2D62 A;  2BA0 A;  2A6H D;  4XQJ A;  3AB9 A;  2JA7 G;  2B2T A;  4FP5 D;  2R7F A;  3UDX A;  1BOS A;  2R93 H;  1Q7Y C;  3PO2 G;  3BZD B;  3W1G A;  3CC2 A;  1R4P B;  2MNA A;  3S2H B;  3BDO A;  4KLK A;  2HCI A;  5JAV A;  3U4Z A;  3UDG A;  3TEH B;  3DXJ C;  3IRB A;  2Q8T A;  1QOH A;  1TWH B;  4IUQ A;  5FLM H;  5EPL A;  3F2U A;  2JA8 B;  4RFB A;  5LL6 X;  3PIP A;  5FLX c;  2DJF C;  3VR4 A;  5J22 A;  4U68 A;  4JI6 Q;  1SFO B;  2RA4 A;  2H4O A;  1LTL A;  4LF8 Q;  1KDA A;  4C2M H;  1I3Q H;  4R4I A;  2C35 B;  2IX3 A;  4JCV E;  2AUK A;  2JSO A;  1F9P A;  2PPB C;  4JI7 Q;  2CH4 A;  4XQQ A;  2CQO A;  3NEL A;  4F87 A;  4C3J G;  1A6X A;  4A3C H;  5EPJ A;  3S1Q H;  4DR4 Q;  5M5X H;  3GP7 A;  3TBI B;  2NVT B;  2HIV A;  2UUB Q;  3QOJ A;  3S1N B;  1XMO L;  1ML0 D;  5CV5 A;  1AN8 A;  1PYB A;  1I4H A;  1WCM H;  4KJN A;  1EZ8 A;  1ENF A;  1U4L A;  3P7J A;  4YWK A;  3TSS A;  4K8I A;  4N8X 1;  1QVF A;  1XXG A;  3K58 A;  3OWF A;  3RZO H;  5C44 B;  5CV7 A;  3CP0 A;  3BZK A;  1GUO A;  5I6W A;  1PA6 A;  3L0O A;  3C3L A;  3R2I A;  1Y1V H;  3G48 A;  3K0Y A;  2IW3 A;  1XNR L;  1JOK A;  5C3E B;  1F9R A;  5IT9 L;  1E2Z A;  5M3M G;  4R8N A;  3I4M B;  1JIC A;  4IUU A;  2XTI A;  3GTJ H;  2B2Y A;  4I7A A;  3UI2 A;  2Z4I A;  1TU2 B;  3T1H L;  2F0U A;  1QE6 A;  2OCE A;  3A7A B;  2GVA A;  2UXB L;  2J0T D;  4FO2 A;  2K5W A;  3DM3 A;  1PZJ D;  4X3T A;  4UP9 A;  4P75 A;  3JAM L;  1HFG A;  4RWS C;  2EJG C;  3BDL A;  4QIW E;  3OW7 A;  1SYD A;  4LK1 C;  2C9O A;  3QR8 A;  3NWS A;  5E3F A;  4AYB E;  1F77 A;  1X9N A;  1BBX C;  2Y0S B;  3VYR A;  1I4P A;  4H02 A;  1NR2 A;  1EY0 A;  1YZ6 A;  3X3N A;  2E5L L;  1GHJ A;  2QEJ C;  2NTT A;  1ILP A;  4HIM A;  1VQL A;  1AEX A;  1EYC A;  2G9D A;  4OX9 L;  5IGC A;  3MFG A;  3HOW G;  1XMQ Q;  2NVT H;  2EYO A;  3S1N H;  3HOZ H;  2YYZ A;  4LF8 L;  5AFW A;  2UXC L;  3Q23 A;  1H95 A;  5FO8 B;  4A3G B;  1WD1 A;  1EOV A;  1D5X C;  3NTH A;  2VQF L;  3QOL A;  2XGT A;  1CUK A;  1EZ6 A;  4IAL A;  5L37 A;  3M9B A;  1KLG D;  4IFD H;  5EPK A;  1RCV D;  1XPU A;  4XIG S;  2A6E D;  1KDC A;  3GTL H;  4QL5 A;  4BBR H;  2QA4 A;  1YIJ A;  5KNB A;  4HCE A;  4KHV A;  4YCU A;  4EQP A;  2FXQ A;  5JPN C;  5C4X B;  3A56 A;  3T56 B;  5C3E H;  3PIP 3;  3J81 E;  4G4K A;  1AH9 A;  3H6M A;  1PMR A;  3O13 A;  3OWE B;  4WJ3 M;  1EYD A;  2EOT A;  1KIX A;  3EQL C;  4A3F H;  3D0F A;  1CA6 A;  3Q6S A;  1SE4 A;  3NBH B;  3K59 A;  4YY3 L;  2F0G A;  1MGS A;  4B3T L;  4LF5 L;  1MD2 D;  3TS0 A;  4KMU C;  3HOV H;  2NZO A;  5IE8 A;  3KFU A;  2R7Z G;  1HZA A;  4JC0 A;  3VA5 A;  3CQZ B;  3KLS X;  3TDQ A;  2EYJ A;  1VS0 A;  2B2W A;  2JE6 I;  4Y7N B;  5I6Y A;  5GAD C;  1X3Q A;  2OT2 A;  3KLS A;  1C48 A;  4DN4 M;  2KCT A;  4K2L A;  1QCB D;  4PMW A;  1K73 C;  4TKO B;  2H1E A;  3EA6 A;  2ZXP A;  1PTO C;  3BDC A;  2Q2T A;  3PO2 B;  3VR6 A;  5C0X I;  5M3F B;  4UP7 A;  4A3J G;  1GO3 E;  3W1B A;  3HGB A;  5GQO A;  2AWN A;  1ZKO A;  1UNS A;  1RF2 D;  3S17 B;  1U4R A;  2F52 A;  5C5M A;  2ATW A;  2VB3 X;  1I50 H;  3NEM A;  3RMH A;  2I46 A;  3K81 C;  5FK9 C;  1G2T A;  4IPD A;  1SNM A;  1WYD A;  2WAC A;  3I3C A;  3TZU A;  4FF1 A;  2I5M X;  1UWV A;  1H9J A;  4QY7 A;  3IFT A;  3TQY A;  2GN5 A;  3VYU A;  4ZUI A;  3OPO A;  4FXG C;  3NQT A;  1D8L A;  4FF3 A;  3GTP B;  3R3O A;  3OW2 A;  1GUT A;  1TWC B;  4GLA C;  2G5D A;  3A8I E;  4PNY A;  1SYE A;  1UAP A;  3HKZ G;  2OQ0 A;  4ME5 A;  1E22 A;  5I2Y A;  3ONA B;  5IOC A;  1LUZ A;  5T1I A;  2B8G A;  1K83 B;  1MSH A;  3T13 A;  5AJ3 Q;  5JJK A;  5LMN Q;  1IBK Q;  5J1Z A;  2M9V A;  4CKC A;  1L1O B;  5J39 A;  3CPW A;  1KXL A;  4PQX A;  1F2Y A;  1KLU D;  3I73 A;  1WTX A;  2E2J B;  1EEF D;  5FOB B;  4JI0 Q;  3RD4 A;  2QKI C;  2L0C A;  1RHP A;  3DEP A;  2VW9 A;  5LL6 S;  4JI5 L;  1Q86 C;  1VMP A;  4JYA L;  2YV5 A;  2JA7 H;  5K36 G;  2B2V C;  3GTQ H;  3A74 A;  3H0G B;  3EJI A;  2BE5 D;  5IYB H;  3PO2 H;  5JEA G;  4XQN A;  1UUP A;  3CU7 A;  4IOC A;  5IYC H;  4N8F A;  4ZAI A;  3GV6 A;  5M3M B;  1T5X D;  3MVV A;  4OEL B;  4UP8 A;  4GKJ L;  4C3I B;  2EDG A;  1X6O A;  1GUW A;  1AZQ A;  4GKK Q;  3S14 B;  1EY4 A;  5IWA Q;  3C46 A;  3NBI A;  4HJ9 A;  2LY7 A;  1PFB A;  1S5D D;  4A93 B;  5BR8 Q;  3I70 A;  3QWN A;  1X3F A;  1EUJ A;  3GO5 A;  4C56 C;  1TVX A;  3TP6 A;  1HNZ L;  3FKI B;  2EZV A;  4ZQ3 A;  4JBJ A;  1KD1 C;  3PQI A;  1JWM D;  1EWC A;  1N34 L;  1RTN A;  3MHB A;  2A19 A;  2ZT9 C;  1QZH A;  1NJI C;  3GTP H;  1B8A A;  4XT3 B;  3NP8 A;  4C3H G;  4DA2 A;  3U9S A;  1TWC H;  1S4Z A;  2KVM A;  4C3J H;  1HNX Q;  1I6V C;  3HOW B;  5C0X G;  2HIX A;  4M8A A;  4QUF A;  2VQE L;  2NB0 A;  1ZYR C;  3Q0A A;  1YI2 A;  5EGT A;  5IGG A;  1HZC A;  2JN4 A;  1HR0 W;  1HZ9 A;  3MWY W;  2N3S A;  2F4I A;  3K5O A;  1SJH D;  1D6E C;  4IPH A;  5LMN L;  3SK6 A;  1SRU A;  5M3M H;  1WTR A;  4GN5 A;  2F0H A;  2OF1 A;  1STE A;  4JI0 L;  1EOT A;  1VQC A;  2VS1 A;  4ULL A;  3K7A H;  1I94 L;  1K8G A;  1ICW A;  4HED A;  2O5J C;  3TME A;  1YBY A;  3UDI A;  3M3Y B;  5IGB A;  3KUP A;  4FF2 A;  4F8M A;  1BCP C;  1Y1V G;  1VQ9 A;  3NHH A;  2RDH A;  2R7Z B;  3J80 L;  2K5H A;  2Q8R E;  5E7N A;  3NPP A;  1EY6 A;  3NK9 A;  1HA6 A;  3FPP A;  2K50 A;  3BJU A;  4JK1 C;  1PTO H;  1LT3 D;  4IUR A;  4RHS A;  1PZK D;  4DK6 C;  5JJZ A;  2PQA B;  2PNR C;  5ELF A;  5T1G A;  4K2K A;  2AHO B;  4QF4 A;  1N9W A;  2K05 A;  3NEN A;  5KRU A;  1B70 B;  2ICE C;  1K8M A;  2PZU A;  1P16 A;  1EL0 A;  2WAQ G;  4A3J B;  4K5W A;  2CQA A;  3V96 A;  4DR5 Q;  2R6G A;  3NBH A;  2QF7 A;  4PMB A;  4BY1 G;  4B3M Q;  1CZW A;  3OYY A;  5C3W A;  2UXD Q;  3X3M A;  1YHQ A;  1ET9 A;  1XJV A;  1AZP A;  1HXY D;  1GUS A;  1S5E D;  1SXT A;  1R9T H;  2Z9H A;  1W2B A;  3STB C;  1EYG A;  5ELB A;  1PV4 A;  5M5Y B;  2OTJ A;  2IL8 A;  3KYH C;  1VF5 C;  3RNU A;  2A74 C;  3KJP A;  3S1M H;  3WWV A;  3J7Z C;  1STA A;  1C7Y A;  3CCL A;  4A3D H;  1A3U A;  4XT1 B;  5FO7 B;  1O7L A;  1TWA H;  4ZUJ A;  4RG1 A;  1S5B D;  3K5L A;  1A63 A;  4JI8 Q;  2PI2 E;  2EYP A;  4LUV A;  4KKU A;  3HKZ B;  2A8V A;  1JE4 A;  3OMG A;  4DR1 Q;  4OGQ C;  5IY0 A;  3I4L A;  3M3Y H;  1NR4 A;  1LAC A;  1VQE A;  1Z9F A;  1SRO A;  1STY A;  4DV5 L;  3M4O B;  2RKS A;  1SE3 A;  2ENB A;  2M00 A;  1FR3 A;  5CV6 A;  2NBF A;  2L5T A;  1I4X A;  4BY7 B;  1JJC B;  3VR2 A;  1K28 A;  5C0X J;  5E4W C;  1KAW A;  3QB3 A;  4DV1 L;  4A3I H;  4WOR A;  1MBY A;  1HTL D;  2F0M A;  5IT9 E;  2N78 A;  1A2T A;  2WB1 G;  5D3I B;  1Q81 C;  3EVQ A;  1DOK A;  1PRT F;  4A3J H;  1OXS C;  3FPU B;  1YJ9 A;  4L5S A;  1BCP B;  3FMC A;  4DF7 A;  2B63 B;  5BN3 A;  1NSN S;  1ZXT A;  1TWG H;  1PFS A;  1L1O A;  2NVQ H;  4HSV A;  3ER0 A;  2R93 B;  1LTG D;  4MN3 A;  4EQ5 A;  5H1S E;  5FO9 B;  2RF4 A;  5IOD A;  2KEE A;  1F9S A;  1BO0 A;  4JPB W;  4DGZ A;  4KJO A;  3CC4 A;  1D2B A;  2YTY A;  3D4R A;  5KYI A;  2VUM H;  4IN3 A;  4DXG A;  4O0A A;  1B4O A;  1Z6H A;  3GTO B;  4C3H B;  2KJX A;  1YJW A;  3VDY A;  4OON A;  4YIJ A;  3HOX G;  3W5O A;  5NUC A;  5FLX E;  1NUC A;  4QMG A;  2B2U C;  1KHI A;  1XWE A;  3D4D A;  5EJW A;  1XMO Q;  1VMC A;  1SYC A;  2QGQ A;  4C2M B;  1YIT A;  2A69 C;  3M4O H;  2BOS A;  1I3Q B;  4A3K H;  2EY5 A;  2EVB A;  3S15 B;  2PW5 A;  3C2P A;  1WVL A;  4KD3 A;  1N33 L;  2BH2 A;  1EFW A;  3S1Q B;  1CSP A;  4KHZ A;  5M5X B;  5K36 H;  3N6R A;  4IUT A;  1K3R A;  4K5X A;  1L2F A;  2O5I C;  4LFA L;  1XNR Q;  2F0E A;  5JEA H;  3MAQ A;  3CXC A;  4R9W A;  4C1N I;  3P20 A;  1EU3 A;  1WCM B;  1SYB A;  2K7V A;  3S24 A;  3A8K E;  4DV3 L;  4DV2 L;  1KRT A;  3K57 A;  3JAM c;  1TS2 A;  3GTM H;  2UXB Q;  3RZO B;  2AQ2 B;  3S16 H;  4G7H C;  1B53 A;  4ID6 A;  1A8V A;  1X54 A;  3T53 B;  4CDE C;  4CJ1 B;  5IYB G;  4R8I A;  1Y1V B;  4ZKC B;  2RSO A;  3BYT B;  4NP5 A;  2A68 D;  5IYC G;  2LSS A;  1CKM A;  3PF5 A;  1SMY D;  4A75 A;  1DGS A;  4Z9C B;  3FP9 A;  2OWO A;  3IAY A;  3GTJ B;  4FF4 A;  4OL7 A;  1VQJ A;  2LXK A;  2E5L Q;  3GTO H;  4C3H H;  4XYQ A;  1LTT D;  1EWH A;  1IZ6 A;  1X65 A;  2DUD A;  4TRD A;  4U67 3;  2KEC A;  3J7Y W;  4OX9 Q;  4AQY Q;  2F0P A;  1H9K A;  1YNN C;  2WAQ B;  4ZCK A;  5KIX A;  5C0X H;  3I91 A;  3ZYY X;  1NNX A;  3D8G A;  1UE5 A;  1KNA A;  4RCN A;  4GOP B;  1HJP A;  2UXC Q;  4WFN 3;  4K5V A;  1WTW A;  1CI3 M;  3SVM A;  3VYS A;  4DV4 L;  4DAY B;  4N9T A;  2VQF Q;  3S15 H;  1CQV A;  4GN3 B;  4F7X A;  1DOM A;  1D5Z C;  1EQQ A;  5KEE A;  2FJ2 A;  1BKB A;  3LWU A;  1VQB A;  2PYK A;  3QIA A;  2QDB A;  4AYB G;  3HZX A;  2PCF B;  1KTK A;  2KQ3 A;  3HOZ B;  1CTM A;  4DUZ L;  4JG2 A;  3PGZ A;  4UDU C;  4MZ9 A;  4DAP A;  4QB4 A;  1FNW A;  4IO9 A;  3KOJ A;  1Y8N B;  4BA2 I;  1TWF H;  1VQN A;  4P72 A;  4DNI A;  1M4V A;  2JXM B;  4YY3 Q;  3GTL B;  4BBR B;  5CBA E;  4OWW B;  1G51 A;  4B3T Q;  1VQ8 A;  5JVH 3;  4ZLT F;  4LF5 Q;  5HGQ A;  1C9O A;  3CCE A;  4DR2 Q;  2XIW A;  3TRE A;  3IKJ A;  1PRT B;  1VDZ A;  2HDL A;  2WP8 J;  4O42 A;  4A3E G;  1Q1B A;  1O7Y A;  4B3R L;  2I0Q A;  4R4C A;  2MQH A;  4EQO A;  1PLF A;  4CKE A;  4A3F B;  1RD9 D;  4KKT A;  5GRO A;  4DFA A;  2LFN A;  5E1F A;  4IPG A;  4K0K L;  1SSO A;  3E0J A; 
#chains in the Genus database with same CATH homology
 2WB1 B;  3HOV B;  3K5M A;  1EY7 A;  1W6K A;  3AU7 A;  4IUV A;  1PXU A;  2EY1 A;  1SAP A;  2E74 C;  5LHY 1;  1HCZ A;  1QNK A;  4GZY C;  3R2T A;  2NWG A;  2F0N A;  4X3K A;  5TSS A;  3VR3 A;  2PQE A;  2PMZ B;  4HN7 A;  3M7G A;  1PTO F;  5CC4 A;  1SEB D;  1I50 B;  1EQV A;  4KN4 C;  2IX1 A;  3Q22 A;  1V43 A;  4RGO S;  1H9R A;  1LTB D;  1SNQ A;  3IFD A;  5COR A;  2RDF A;  4DNR B;  1XX8 A;  5JPM C;  2XN9 C;  1TS5 A;  4ZRZ A;  1SYF A;  4KY7 A;  5KGU A;  1O80 A;  4TQU S;  3TP7 A;  4OO1 I;  1XTC D;  1F2M A;  5ELC A;  1GHK A;  1JB3 A;  2E2D C;  2LS0 1;  2E76 C;  3OIP A;  2TSS A;  3U9O A;  5ISR A;  2RDG A;  1WD0 A;  4DNT B;  2WII B;  1B2T A;  3C1F A;  1IYU A;  1LT5 D;  2ZXR A;  4NKL A;  3BVM A;  2JA7 B;  3GTQ B;  5M9O A;  1HFN A;  3N52 A;  1SE2 A;  2BDO A;  4KD4 A;  3NQI A;  1BDO A;  1CA5 A;  1S5C D;  2FFK B;  4DAV A;  1U4P A;  2EJF C;  1QB5 D;  2B8F A;  3MZ5 A;  1ENC A;  3LWE A;  1HHV A;  4OIK A;  1LT6 D;  2J4X A;  3A55 A;  1SDF A;  1I4Q A;  1ILQ A;  1IHZ A;  1X3P A;  3PUW A;  4DK0 A;  1LTR D;  4RGT A;  2KOL A;  4NW2 A;  1O7Z A;  4DXF A;  1RJT A;  4BS9 A;  1BQQ T;  4QIW B;  4KTA A;  4C3J B;  2B2T C;  1PTO D;  4AYB B;  3DWP A;  3J7A F;  1U9R A;  3DMU A;  2BE5 C;  3KK7 A;  1HA5 A;  4JBW A;  4J6H A;  1A2U A;  1CHP D;  3MTS A;  2K01 A;  4M1U B;  3AMU A;  2MPM A;  2V4D A;  1OXX K;  2KCC A;  2XNA C;  1XYI A;  3H09 A;  1JWS D;  3D4W A;  1BNZ A;  3R93 A;  2CW0 D;  1CQF A;  4DAY A;  5CYU A;  1CZG A;  1M8A A;  1EY5 A;  4EQN A;  2F0I A;  4RAU C;  4P2C B;  2X6G A;  1TKW B;  1OXV A;  5A2Q E;  2QCP X;  5CV8 A;  3K7A B;  2X69 A;  3QO2 A;  3BVG A;  1Y8O B;  1OXT A;  3HRZ C;  4H0L C;  4G57 A;  4OO1 G;  2B2U A;  1IW7 C;  4I7Z C;  4WJW A;  5CGK A;  1LV9 A;  3PMF A;  1BCP F;  1PTO B;  3CRL C;  1BF4 A;  2CVR A;  5A35 A;  3VR5 A;  3NWT A;  1E0B A;  4L8J A;  5IGD A;  1GXD C;  2WIN B;  4RCO A;  2MP1 A;  2MUY A;  4F88 A;  1AP0 A;  4XDX A;  2B2Y C;  5G3L F;  4K6L A;  2EXZ A;  2FIN B;  3SK4 A;  2D9U A;  1SNC A;  3MXG A;  1V8Q A;  4RHR A;  1R9T B;  2MHV A;  5KNC A;  4BA1 I;  2LMC B;  3I8Z A;  3BYY B;  4PV1 C;  2BDN A;  3S1M B;  2F03 A;  2JEB I;  4A3D B;  5I9O A;  1TR5 A;  4X3U A;  1TWA B;  2DNE A;  3J81 L;  5D65 A;  5EBC A;  1Q1E A;  1CFM A;  3PIO 3;  1WTV A;  1B1Z A;  2K5D A;  3NXW A;  3W2D A;  2F0W A;  2K6A A;  1ZYR D;  1A3V A;  1TQO A;  1EU4 A;  3FRP B;  5IGF A;  2JA6 B;  3OOC A;  2DNC A;  2KA7 A;  3V2T A;  4XYO A;  4A3I B;  1EIH A;  2JYO A;  2LKV A;  2L1B A;  4CJ2 C;  1AW7 A;  3DWQ A;  1J8I A;  1SYG A;  1A15 A;  2L4N A;  4L63 B;  4HMJ A;  5ELD A;  4LAA A;  3HS0 C;  4DU9 A;  4Q0F A;  2PZW A;  4RKB A;  1GUG A;  1D5M C;  1TWG B;  3OIQ A;  4G7Z C;  2NVQ B;  1BCP D;  1FD7 D;  4RKL A;  1EIG A;  3KBX A;  2VUM B;  2EJM A;  1FNU A;  5EBD A;  3NE5 B;  1DOL A;  1W6J A;  2FMC A;  3RUZ A;  1LT4 D;  1JWU D;  1YNJ C;  2XWB B;  2F1M A;  3ERO A;  1SND A;  1JOO A;  1E2W A;  1ESR A;  5G3L D;  4BBS B;  1DXM A;  1STN A;  3G7L A;  4A3K B;  5JVG 3;  2RVL A;  4HCS A;  2NVY B;  3W3A A;  5K5P A;  5I2X A;  4EGV A;  5IGE A;  2K32 A;  2DN8 A;  3K6O A;  5DEH A;  1H9S B;  3SK5 A;  2RBM A;  1NCV A;  3MA2 B;  2XWJ B;  3KF8 A;  1Q3L A;  3SHL A;  4BWG B;  4N9P A;  2WV6 D;  3GTM B;  3JAM E;  1CHQ D;  5C4Z A;  3S16 B;  5D3D A;  4K14 A;  1DCZ A;  2KCN A;  3R8B A;  2EYH A;  4H13 C;  2M2L A;  5I9P A;  4XTC S;  1JOQ A;  5C3X A;  2DY7 A;  3M7N A;  1U4M A;  3ND9 A;  1II3 A;  3GV3 A;  1QNU A;  4DK1 A;  1HRJ A;  1JQY D;  1B44 D;  5C6A A;  4L6T B;  2G9H D;  4MHE A;  4ODG A;  4XXE A;  1TII D;  2DY8 A;  1WTO A;  2F0O A;  4LJZ C;  2QIL A;  4C1N K;  2VNU D;  2F0J A;  4KV6 A;  3WOF A;  4NDX A;  1CT1 D;  3CKI B;  3OMC A;  1S5F D;  4HSP A;  2A73 B;  1H9M A;  3SEB A;  3D31 A;  4KN7 C;  2A6H C;  2IX0 A;  2WKD A;  2K5Q A;  3GD7 A;  1A3T A;  5DNF A;  2JP1 A;  1TT2 A;  2PO4 A;  2A68 C;  4IUP A;  1STB A;  4ZK9 B;  3FDT A;  2N55 A;  3PV0 A;  1TWF B;  1ET6 A;  2VXW A;  4RH6 A;  4KKS A;  4V19 0;  1PYW D;  2L12 A;  2B39 A;  2OEO A;  3SXH A;  4OO1 H;  1VCI A;  3PUY A;  1BUV T;  2A69 D;  1JR0 D;  3HOU B;  3PUZ A;  4H44 C;  1FNV A;  1LAB A;  3H94 A;  3L7Z C;  3TN2 A;  4K6D A;  3KLR A;  4RA8 A;  1PRT D;  3NSW A;  3L3O C;  5ELE A;  3P75 A;  1L0X B;  3LNN A;  1OO9 B;  3MFY A;  4IFD J;  2F0L A;  3DM1 A;  2GA4 B;  3NUC A;  3HP3 A;  4CGY B;  4CHT B;  4OHJ A;  2K33 A;  4BY1 B;  2HCC A;  3WOE A;  2R61 A;  4V0B A;  4A3B B;  2B2V A;  3I90 A;  2PW7 A;  4QUC A;  2FMM A;  3S2D B;  1DJR D;  4E6I A;  2F0S A;  1HTP A;  4J8Q A;  5CR3 A;  1LO5 D;  2IJ0 A;  1T5E A;  1YNN D;  4FVM A;  1DYQ A;  2XRQ D;  3HEJ A;  4LMQ D;  2TMP A;  1C4Q A;  4WRD A;  2K1B A;  4PMC A;  2NZ1 D;  1L0Y B;  1V1P B;  5F2D A;  1JC7 A;  1LTA D;  1LLR D;  2NVX B;  2I07 B;  1SBB B;  4NMZ A;  2XRS D;  2EPB A;  3RLF A;  1B50 A;  3T4A C;  4C3I G;  1QIL A;  2PZT A;  4CKB A;  1Q12 A;  2Z4H A;  2VB2 X;  3ITP A;  1QJO A;  1IYV A;  3SK8 A;  2BA1 A;  2A6E C;  4K8J A;  2EYL A;  4KY5 A;  2AUJ D;  2EYM A;  1H9S A;  3HOX B;  1CK1 A;  1TS4 A;  3PUV A;  4B9X A;  5FLX L;  2F0K A;  1BR9 A;  1DZ1 A;  1I4G A;  3CHB D;  3MXU A;  1ESF A;  1MI2 A;  3CRK C;  1TS3 A;  2R92 B;  1CM9 A;  5KYL A;  2NN6 I;  1STH A;  3GQB A;  4X3S A;  3DWA A;  1GOZ A;  1IKM A;  1AFP A;  2KED A;  3G6J B;  2YU9 B;  1D1K A;  1JCK B;  5C4J B;  3SDZ A;  2N88 A;  1KNE A;  1EY9 A;  1UEA B;  3MC0 B;  1D1I A;  4KK7 A;  1SJE D;  3J80 E;  2NTS A;  1B9M A;  1EFI D;  2D2C C;  3I72 A;  2RSN A;  4FYD A;  2Q8I B;  1G29 1;  4ILW A;  2EY6 A;  5D14 A;  1LTI D;  2O4X A;  2X6L A;  2AQ3 B;  3ERQ A;  1G8Z D;  2Z8L A;  2L55 A;  3NTI A;  4CJ0 B;  3L9A X;  2F3W A;  3URY A;  2F0F A;  3TP5 A;  3MEH A;  1Z7T A;  3QG1 A;  1Y69 U;  1J9O A;  4G7O C;  5FKA C;  1NAP A;  5E4X A;  1HQR D;  4A3M B;  5CV4 A;  3WDN A;  3A7L A;  2CW0 C;  1SNO A;  1LTS D;  4UAI A;  2NUC A;  3IL8 A;  1B3A A;  5EKK A;  1QWY A;  2HQE A;  1R4Q B;  5C4H A;  2IWH A;  3T16 A;  2XVS A;  2IT1 A;  3V05 A;  4I65 A;  4KY6 A;  5I4D A;  4A3E B;  4S3S A;  3H91 A;  1STG A;  2NN6 G;  3LX0 A;  3TZD A;  2SOB A;  2K04 A;  1TY0 A;  1Q90 A;  4TSS A;  5CBE E;  1WTP A;  2SNS A;  1V1O A;  1Q8I A;  1MSG A;  1K8O A;  1DON A;  3D3R A;  3DUZ A;  1KAA A;  3BS1 A;  4HAE A;  2RQX A;  5EKI A;  1BXT A;  3BG3 A;  3A54 A;  2BCO A;  3T51 B;  2AQ1 B;  4J1M A;  1EEI D;  2FHT A;  1V1P A;  1EQT A;  1PZI D;  4IFD I;  2XSC A;  3E5S A;  1HQM C;  4ZYS A;  3VA7 A;  2MJ8 A;  1IW7 D;  1EYA A;  2L9H A;  3ND8 A;  2J7Z A;  2SEB D;  3A8J E;  5BN4 A;  4RGM A;  1I6H B;  2HDM A;  3SR1 A;  3KBG A;  1IKL A;  2CHB D;  3PO3 B;  4HR7 B;  2K28 A;  3VYT A;  3P1H A;  1GUN A;  1JOR A;  2KUM A;  4IQZ A;  1KDB A;  2O2L D;  3C1E A;  1RTO A;  4ABN A;  3OSO A;  1PDQ A;  1VF7 A;  2KHS A;  1ROD A;  5CMD A;  1HPC A;  1PFN A;  1G2S A;  2IPK D;  2ZXO A;  2F0T A;  5COY A;  5DM7 3;  2EYF A;  4KI0 A;  3QJY A;  3GTK B;  1E2V A;  3RZD B;  1C8C A;  1FYC A;  4MIU A;  3FEW X;  3SE0 A;  2B2W C;  2AWO A;  2JEA I;  4FXD A;  2ICI A;  5DM6 3;  2K03 A;  2HUG A;  1TY2 A;  1DM0 B;  5JEA J;  2F3V A;  5IIF A;  1OXU A;  2WKC A;  4Q5V A;  2A5H A;  3K5N A;  4EVO A;  1G91 A;  3S9W A;  3E6Z X;  1RKN A;  4IFD G;  2E2H B;  3D6W A;  3FVQ A;  1FGB D;  3M85 A;  3OHX C;  5HGT A;  3BVZ A;  3M4Y A;  5C5L A;  1DD2 A;  2SDF A;  1SNP A;  4O1N A;  1HUN A;  1B9N A;  2NYZ D;  1ENA A;  1ONL A;  3DHQ A;  5HUR A;  4FXK C;  1GJX A;  3GTG B;  1YNJ D;  5EQ0 A;  3HG9 A;  3Q24 A;  5M5W B;  4RGN A;  2F0V A;  2EE1 A;  3I4N B;  1QG7 A;  2JA5 B;  3D6C A;  5A2Q L;  4QCL A;  2L11 A;  5DAU A;  2EY2 A;  3HOY B;  3DEO A;  1I4R A;  2C5C A;  1KAB A;  1G6Z A;  1WTQ A;  3MXP A;  1RDP D;  1Z47 A;  1X32 A;  4H7B A;  2E75 C;  3H3V C;  3PUX A;  4IZ8 A;  1F9Q A;  1HUM A;  5KND A;  5CV9 A;  2F0Q A;  3NTK A;  4IUN A;  3MXN A;  2R3Z A;  1F2L A;  4B08 A;  2OXP A;  2ID0 A;  1Y8P B;  3J7A V;  2Z1C A;  2MGS A;  1ZEQ X;  4OIJ A;  4HMI A;  5JOB A;  2F0D A;  3TP8 A;  4HTH A;  4ZKB B;  2E2I B;  4FNF A;  1SMY C;  2NN6 H;  3S1R B;  4B9W A;  1IL8 A;  1O78 A;  1Y1W B;  1PRT C;  1F2Z A;  2SNM A;  5EKL A;  1PFM A;  3EFX D;  4CBV A;  5BN5 A;  2D5D A;  1EY8 A;  2D62 A;  2BA0 A;  2A6H D;  4XQJ A;  3AB9 A;  2B2T A;  4FP5 D;  1BOS A;  3BZD B;  1R4P B;  3S2H B;  3BDO A;  2HCI A;  5JAV A;  3DXJ C;  2Q8T A;  1QOH A;  1TWH B;  4IUQ A;  5EPL A;  3F2U A;  2JA8 B;  4RFB A;  5LL6 X;  3VR4 A;  5J22 A;  4U68 A;  1SFO B;  2RA4 A;  2H4O A;  1KDA A;  2IX3 A;  2AUK A;  2JSO A;  1F9P A;  2PPB C;  4XQQ A;  4F87 A;  4C3J G;  1A6X A;  5EPJ A;  3GP7 A;  3TBI B;  2NVT B;  3QOJ A;  3S1N B;  1ML0 D;  5CV5 A;  1AN8 A;  1I4H A;  4KJN A;  1EZ8 A;  1ENF A;  1U4L A;  3P7J A;  3TSS A;  4K8I A;  1XXG A;  3K58 A;  3OWF A;  5C44 B;  5CV7 A;  1GUO A;  5I6W A;  3C3L A;  3R2I A;  3K0Y A;  2IW3 A;  1JOK A;  5C3E B;  1F9R A;  5IT9 L;  1E2Z A;  4R8N A;  3I4M B;  1JIC A;  4IUU A;  2B2Y A;  3UI2 A;  2Z4I A;  1TU2 B;  2F0U A;  1QE6 A;  3A7A B;  2J0T D;  4FO2 A;  2K5W A;  1PZJ D;  4X3T A;  3JAM L;  1HFG A;  4RWS C;  2EJG C;  3BDL A;  3OW7 A;  1SYD A;  4LK1 C;  2C9O A;  3NWS A;  5E3F A;  1F77 A;  1BBX C;  2Y0S B;  3VYR A;  1I4P A;  1NR2 A;  1EY0 A;  3X3N A;  1GHJ A;  2QEJ C;  2NTT A;  1ILP A;  1AEX A;  1EYC A;  2G9D A;  5IGC A;  3MFG A;  2EYO A;  2YYZ A;  5AFW A;  3Q23 A;  5FO8 B;  4A3G B;  1WD1 A;  1D5X C;  3NTH A;  3QOL A;  4IAL A;  1EZ6 A;  4IFD H;  1KLG D;  5EPK A;  1RCV D;  4XIG S;  2A6E D;  1KDC A;  5KNB A;  4HCE A;  4KHV A;  4EQP A;  5JPN C;  5C4X B;  3A56 A;  3T56 B;  3PIP 3;  3J81 E;  4G4K A;  3H6M A;  1PMR A;  3O13 A;  3OWE B;  1EYD A;  2EOT A;  3EQL C;  1CA6 A;  3Q6S A;  1SE4 A;  3K59 A;  2F0G A;  1MGS A;  1MD2 D;  4KMU C;  3VA5 A;  3CQZ B;  3KLS X;  3TDQ A;  2EYJ A;  2B2W A;  2JE6 I;  4Y7N B;  5I6Y A;  1X3Q A;  2OT2 A;  3KLS A;  1C48 A;  4DN4 M;  4K2L A;  1QCB D;  4PMW A;  4TKO B;  2H1E A;  3EA6 A;  2ZXP A;  1PTO C;  3BDC A;  3PO2 B;  3VR6 A;  5C0X I;  5M3F B;  3HGB A;  2AWN A;  1ZKO A;  1UNS A;  1RF2 D;  3S17 B;  1U4R A;  5C5M A;  2VB3 X;  3RMH A;  2I46 A;  5FK9 C;  1G2T A;  1SNM A;  2WAC A;  3I3C A;  3TZU A;  4FF1 A;  1H9J A;  3IFT A;  3VYU A;  4ZUI A;  3OPO A;  4FXG C;  3NQT A;  4FF3 A;  3GTP B;  3R3O A;  1GUT A;  1TWC B;  3A8I E;  4PNY A;  1SYE A;  1UAP A;  4ME5 A;  5I2Y A;  3ONA B;  5IOC A;  5T1I A;  2B8G A;  3T13 A;  1K83 B;  1MSH A;  5J1Z A;  2M9V A;  4CKC A;  5J39 A;  4PQX A;  1F2Y A;  1KLU D;  3I73 A;  1WTX A;  2E2J B;  1EEF D;  5FOB B;  3RD4 A;  2QKI C;  2L0C A;  1RHP A;  3DEP A;  5LL6 S;  1VMP A;  5K36 G;  2B2V C;  3H0G B;  3EJI A;  2BE5 D;  5JEA G;  4XQN A;  1UUP A;  3CU7 A;  4ZAI A;  3GV6 A;  5M3M B;  1T5X D;  3MVV A;  4C3I B;  2EDG A;  1GUW A;  1AZQ A;  3S14 B;  1EY4 A;  3C46 A;  3NBI A;  2LY7 A;  1PFB A;  1S5D D;  4A93 B;  3I70 A;  3QWN A;  4C56 C;  3GO5 A;  1TVX A;  3TP6 A;  3FKI B;  2EZV A;  4ZQ3 A;  1JWM D;  1EWC A;  1RTN A;  3MHB A;  2ZT9 C;  4XT3 B;  3NP8 A;  4C3H G;  4DA2 A;  3U9S A;  1S4Z A;  2KVM A;  1I6V C;  3HOW B;  5C0X G;  4M8A A;  4QUF A;  2NB0 A;  1ZYR C;  3Q0A A;  5EGT A;  5IGG A;  3MWY W;  2F4I A;  3K5O A;  1SJH D;  1D6E C;  3SK6 A;  1WTR A;  2F0H A;  2OF1 A;  1STE A;  1EOT A;  4ULL A;  1ICW A;  4HED A;  2O5J C;  3TME A;  3M3Y B;  5IGB A;  3KUP A;  4FF2 A;  4F8M A;  1BCP C;  3NHH A;  2RDH A;  2R7Z B;  3J80 L;  2Q8R E;  1HA6 A;  3NPP A;  1EY6 A;  3NK9 A;  3FPP A;  4JK1 C;  1PTO H;  1LT3 D;  4IUR A;  4RHS A;  1PZK D;  5JJZ A;  2PNR C;  5ELF A;  5T1G A;  4K2K A;  4QF4 A;  2K05 A;  5KRU A;  2ICE C;  1K8M A;  2PZU A;  1EL0 A;  4A3J B;  4K5W A;  2CQA A;  3V96 A;  2R6G A;  3NBH A;  2QF7 A;  4PMB A;  1CZW A;  5C3W A;  3X3M A;  1ET9 A;  1AZP A;  1HXY D;  1GUS A;  1S5E D;  1SXT A;  5ELB A;  5M5Y B;  2IL8 A;  1VF5 C;  2A74 C;  1STA A;  1A3U A;  4XT1 B;  5FO7 B;  1O7L A;  4ZUJ A;  1S5B D;  3K5L A;  2EYP A;  4KKU A;  3HKZ B;  1JE4 A;  3OMG A;  4OGQ C;  3I4L A;  1NR4 A;  1LAC A;  1STY A;  3M4O B;  2RKS A;  1SE3 A;  2ENB A;  2M00 A;  1FR3 A;  5CV6 A;  2NBF A;  2L5T A;  1I4X A;  4BY7 B;  3VR2 A;  5C0X J;  5E4W C;  3QB3 A;  4WOR A;  1MBY A;  1HTL D;  2F0M A;  5IT9 E;  1A2T A;  5D3I B;  3EVQ A;  1DOK A;  1PRT F;  1OXS C;  3FPU B;  1BCP B;  3FMC A;  4DF7 A;  2B63 B;  5BN3 A;  1NSN S;  1ZXT A;  4HSV A;  2R93 B;  4MN3 A;  1LTG D;  5FO9 B;  5IOD A;  2KEE A;  1F9S A;  1BO0 A;  4DGZ A;  4KJO A;  1D2B A;  3D4R A;  5KYI A;  4IN3 A;  4DXG A;  1B4O A;  1Z6H A;  3GTO B;  4C3H B;  2KJX A;  4YIJ A;  5NUC A;  5FLX E;  1NUC A;  4QMG A;  2B2U C;  1XWE A;  3D4D A;  5EJW A;  1VMC A;  1SYC A;  4C2M B;  2A69 C;  2BOS A;  1I3Q B;  2EY5 A;  2EVB A;  3S15 B;  2PW5 A;  3C2P A;  1WVL A;  4KD3 A;  3S1Q B;  4KHZ A;  5M5X B;  5K36 H;  3N6R A;  4IUT A;  4K5X A;  2O5I C;  2F0E A;  5JEA H;  3MAQ A;  4R9W A;  4C1N I;  1EU3 A;  3P20 A;  1WCM B;  1SYB A;  2K7V A;  3A8K E;  3K57 A;  1TS2 A;  3RZO B;  2AQ2 B;  4G7H C;  1B53 A;  4ID6 A;  3T53 B;  4CJ1 B;  4R8I A;  1Y1V B;  4ZKC B;  2RSO A;  3BYT B;  4NP5 A;  2A68 D;  1SMY D;  4Z9C B;  3IAY A;  3GTJ B;  4FF4 A;  4OL7 A;  4XYQ A;  1LTT D;  1EWH A;  4TRD A;  4U67 3;  2KEC A;  3J7Y W;  2F0P A;  1H9K A;  1YNN C;  2WAQ B;  5KIX A;  5C0X H;  3I91 A;  3ZYY X;  3D8G A;  1KNA A;  4RCN A;  4WFN 3;  4K5V A;  1WTW A;  1CI3 M;  3SVM A;  3VYS A;  4N9T A;  1CQV A;  4F7X A;  1DOM A;  1D5Z C;  5KEE A;  2FJ2 A;  3LWU A;  2PYK A;  3QIA A;  2QDB A;  3HZX A;  2PCF B;  1KTK A;  2KQ3 A;  3HOZ B;  1CTM A;  4UDU C;  4DAP A;  4QB4 A;  1FNW A;  1Y8N B;  4BA2 I;  1M4V A;  2JXM B;  3GTL B;  4BBR B;  5CBA E;  5JVH 3;  4ZLT F;  2XIW A;  3IKJ A;  1PRT B;  1VDZ A;  2HDL A;  2WP8 J;  4O42 A;  1Q1B A;  1O7Y A;  4EQO A;  1PLF A;  4CKE A;  4A3F B;  1RD9 D;  4KKT A;  4DFA A;  2LFN A;  5E1F A;  1SSO A;  3E0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...