5EPJA

Crystal structure of chromodomain of cbx7 in complex with inhibitor unc3866
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
52
structure length
52
Chain Sequence
QVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transcription inhibitor
molecule keywords Chromobox protein homolog 7
publication title Crystal Structure of chromodomain of CBX7 in complex with inhibitor UNC3866
rcsb
source organism Homo sapiens
total genus 10
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5epjA00
2K05A 1JE4A 1HUMA 2B2UA 4CJ1B 1VMPA 1B2TA 2HDMA 3N52A 1E0BA 4XDXA 2K03A 2K1BA 4IUUA 1CA5A 2B2VA 3D6WA 3H91A 3LWEA 2DY8A 1IKLA 1B53A 2KOLA 3TN2A 4ZKBB 1WD0A 2VXWA 4QUFA 3TZDA 1EQTA 2K01A 2MGSA 3GV6A 1LV9A 2JP1A 2N55A 1ILQA 2B2WC 1X32A 1WTWA 2FINB 2IL8A 4HEDA 2FHTA 3KUPA 1CM9A 2MP1A 5E4WC 5AFWA 1B3AA 1BF4A 1O7ZA 2NZ1D 2KEEA 4IUPA 2X6GA 1WTPA 1A15A 2B2WA 1RODA 2K04A 4NW2A 5D14A 2Q8RE 1F9QA 4U68A 3GV3A 1MSHA 1HFGA 1IKMA 2L11A 1WTQA 2HUGA 3FPUB 1DOKA 1NAPA 4LMQD 1B50A 2XIWA 4IUTA 5E4XA 3SVMA 1PLFA 3P7JA 4ZKCB 1SDFA 5EPKA 1BBXC 2RVLA 3G7LA 5COYA 5CMDA 1DOMA 4HAEA 3MWYW 4R8IA 1U4LA 4R9WA 1MI2A 2L4NA 2EPBA 4RAUC 4X3SA 1PFMA 3UI2A 1RTOA 1ZXTA 2RSNA 3MTSA 1G91A 3FDTA 1XYIA 1AZPA 1F9RA 1U4MA 2J7ZA 1F2LA 2R3ZA 4X3UA 3Q6SA 4ZAIA 4DN4M 1XX8A 2X69A 1GUWA 2MPMA 3HP3A 1ILPA 1HHVA 3KBXA 5D65A 1HRJA 2MJ8A 1RTNA 2B2YC 1U4PA 2K28A 1ESRA 1PFNA 2NYZD 1QNKA 3I8ZA 5CBAE 1WVLA 1QG7A 3IL8A 4RWSC 2D9UA 1SSOA 2KEDA 1EIGA 1EOTA 2KUMA 1HUNA 1U4RA 2EOTA 2CVRA 5T1IA 1BO0A 1EL0A 2DY7A 3DEPA 2B2YA 4MHEA 3DM1A 2HCCA 1ML0D 2L9HA 5T1GA 3R93A 1HA6A 1KNAA 1WTXA 3I91A 4O42A 1MGSA 1IL8A 5EPJA 2HDLA 1J8IA 1ICWA 1O7YA 2SDFA 4MN3A 1HFNA 1RHPA 1SAPA 1AZQA 1X3PA 1QE6A 1BNZA 2RSOA 2RA4A 3I3CA 1MSGA 5EJWA 2JYOA 2FJ2A 4IUQA 1J9OA 5CBEE 1C8CA 2BDNA 2FFKB 4HSVA 5DNFA 1F9PA 2B2VC 2N88A 4IUVA 1B4OA 1WTVA 1G6ZA 1M8AA 5JJZA 4HCSA 1PDQA 3F2UA 1AP0A 1Q3LA 1KNEA 1NR4A 3ONAB 4XT3B 2NWGA 2L1BA 4IURA 2M2LA 1NCVA 2EE1A 4OIKA 2HCIA 4X3TA 5EKIA 2B2TC 2KECA 4X3KA 1JICA 1RJTA 1F9SA 5CORA 1X3QA 3DEOA 1CA6A 1TVXA 2Q8TA 3I90A 1WTOA 4CJ0B 4ZLTF 2B2TA 1WTRA 1G2TA 3QO2A 1DONA 2X6LA 1NR2A 4RA8A 5EQ0A 4UAIA 1DOLA 1S4ZA 2L12A 3IFDA 1O80A 4CJ2C 1WD1A 1EIHA 4OIJA 2B2UC 1PFBA 2KVMA 4XT1B 4QUCA 2H1EA 4ZK9B 1VMCA 1DZ1A 5EPLA 1G2SA 2FMMA
chains in the Genus database with same CATH superfamily
1CA5A 4OO1G 1STNA 1LTRD 1XNQQ 2KOLA 1WOCA 4KD4A 3M7GA 2QEXA 3URYA 3GV6A 1E2VA 2JP1A 3GDEA 3GTJB 4DUZQ 4RHRA 1NJIC 1X6OA 1SYFA 3HOWH 4DK6C 3SDZA 3AMUA 1JB3A 2BE5C 4X65Q 1JR0D 1Y1VH 3HFZB 2R93G 1I94Q 3K58A 3HOWB 4G57A 1GKHA 4H0LC 1E2ZA 1Y1VB 2F3WA 2CKZB 1AFPA 5IWAQ 2NTTA 1HNXL 2EY1A 4X64L 5COYA 3PF4A 4HJ8A 2EPBA 4EX5A 4L6TB 4X66Q 2K5VA 1G91A 1KDCA 1OXXK 4JV5Q 2R3ZA 1JB7A 2EYFA 5NUCA 4BWGB 5FO9B 2EZVA 4LF5Q 4JW0A 1K28A 2YTVA 1HUNA 5E3FA 2EXZA 4G4KA 2LKVA 3R93A 1G291 1SROA 3FHWA 1PRTB 2PW7A 2IJ0A 2R93B 1PH5A 5C44G 3K59A 2IY5B 1D5MC 2BA0A 4DF7A 1CT1D 1YITA 1KL9A 4RFBA 2N88A 1B4OA 2AQ3B 3DWAA 4HCSA 4JI2L 1Q3LA 3G4SA 1TWGB 4CDCC 2JA8G 2IT1A 1PH1A 4UY8C 3CMAA 1A63A 1N36L 1HQMC 1XXGA 5JPNC 3P75A 1LTSD 3FVQA 1UE1A 2F0GA 2IHFA 3C1FA 1CSPA 4CDFC 2UXBL 2QF7A 1VQNA 5BN4A 1A0IA 5C44H 4GNXC 1N33L 2UUCL 3RUZA 3PUWA 2E2HH 1KDAA 1LLRD 3NSWA 1PZKD 1FGUA 1B44D 4R4TA 2G9HD 5C44B 1VMPA 1JMCA 2MO1A 2CQOA 2XTIA 1CSQA 2E2HB 5KEEA 1B53A 5IY0A 2G5DA 4KY7A 2MGSA 2F0VA 5IGGA 3K5LA 2GVBA 1HZBA 3T1HQ 2Y0SG 3IFTA 2JA8H 1ILQA 3CMEA 3KF6B 3OMCA 2UU9L 4LFAL 1QUQB 1BF4A 1PH2A 1LABA 3MXNB 2B2WA 4FDBA 2JA8B 1NTGA 1XMOL 1T9HA 3OHXC 1D1KA 4JI4L 3NBHA 5M9OA 4GKKQ 4TVAB 4DAPA 3SVMA 2MUYA 3I72A 2QW7A 1YBYA 4IUNA 4LUOA 4ZQ3A 4X6AH 4R8IA 4R9WA 2L4NA 4X3SA 1YHBA 1HNZQ 4IALA 3MXPA 1IL2A 5D3DA 1XX8A 4JI7Q 1HRJA 1RTNA 4E6IA 2ASBA 3PIPA 1QG7A 3AEVA 1EIGA 1HR0Q 4DKAC 3DEPA 1BBWA 1CI3M 1A3VA 3VA7A 3LX0A 4TKOB 5G3LF 2BE5D 1QWYA 2VNUD 3CQZB 4Z9CB 1J8IA 1ICWA 1O7YA 4O2DA 2N78A 4HN7A 1SAPA 3IRBA 4J8QA 1X3PA 1EUJA 3NHHA 3CPWA 2V1CC 3A8IE 1XTDA 5C6AA 1F9PA 4IUVA 3QG1A 5C0XG 4HCEA 4BS9A 4DV3Q 1LT5D 3GTKH 3A8JE 1FVIA 5M3MG 5HGTA 2RKSA 4AIMA 1HZAA 3EN2A 3AQQA 5CORA 4K5VA 2D0OA 2Q8TA 3CD6A 1JWSD 1SE4A 3TZUA 4C2MH 3NXWA 3J81L 1S4ZA 2NZOA 2I5HA 1BDOA 2GA4B 4JI8L 1EYGA 2ATWA 4C3HG 1SMYC 2H1EA 4C2MB 5GADC 1XJVA 1EWCA 2KA7A 3STBD 4HMIA 1O78A 4IUUA 3E9HA 5C0XH 2JEBI 3VYTA 2VXWA 1VQHA 2L55A 5C3EG 5DAUA 4LF7L 1LV9A 5ELBA 1CKNB 2N55A 1X32A 1WTWA 2QCPX 3BZKA 1H95A 3QR8A 2NN6G 3BDOA 4WJ4A 1SYEA 4PV1C 1UWVA 4A4IA 4A3BH 2F4VL 1EY5A 4C3HH 2BOSA 5D3IB 4DR2Q 4A3BB 3TP8A 1PFSA 1PYWD 4HAEA 4A3LG 4C3HB 2F3VA 4H44C 5J3BA 3UI2A 4YHHL 1H9KA 2YTXA 4TSSA 4X3UA 3M9BA 4DN4M 3I4MH 2MQHA 1PTOC 1T5XD 3V96A 4K14A 4B3RQ 1JJGA 2NN6H 3CCVA 1AN8A 1TR5A 2UUBL 4KK7A 3CRKC 1SMXA 2B2YA 3TP5A 3R2IA 1YJWA 4R4OA 2CFMA 2RCFA 4DAYA 1JT8A 1OXUA 2AWOA 4FXGC 4KY6A 4XYQA 2NTSA 1MJCA 2J0TD 3FKIG 4JI6L 1AZQA 3CXCA 1VCIA 1N34Q 3KK7A 1BNZA 3GTPB 2M9VA 4IFDG 4ZUIA 4JI5Q 3I70A 2PMZE 3ER0A 3F1ZA 4C1NI 4M8AA 4K6LA 3W1BA 5LHY1 2HT1A 1QZHA 4KKTA 1VF5C 4JC0A 3ZJYC 4IZ8A 1KHIA 2Z6BA 2CW0D 3SK8A 4C3JH 2KQ3A 4LJZC 1VQIA 4JI0Q 2HHHQ 1ASZA 4CJ0B 1SYDA 4RA8A 1NR2A 5IODA 1X56A 2F0TA 4CJ2C 4RGMA 2XWJB 4XQJA 1UE7A 3FKIH 5KYIA 2YV5A 1SYCA 5I9PA 4A93H 1CZGA 1LTID 1O7LA 1TS2A 2PMZB 4O0AA 4R4IA 3HZXA 4A75A 3FKIB 1B9NA 2GVAA 5G3LD 5M5XH 4DR4Q 2K1BA 3RLNA 4QCLA 3SK5A 4ILWA 1K83H 4DV4Q 3OIPA 4YCWA 5M5XB 4DNTB 2YU9B 5FLMG 5BR8L 1K83B 5ELOA 2FHTA 1CM9A 4R1JA 3ITPA 1A15A 1RODA 2K04A 2LSSA 3HGBA 4GKJQ 2IX3A 4LWCA 1JOOA 2A6HD 2F0FA 1LTAD 1LTGD 1SJHD 2H4OA 1IBMQ 1U5KA 4LMQD 4DXGA 4YCUA 4IUTA 5E4XA 2PI2E 4L5QA 2OCEA 3NTIA 3T56B 1VQJA 3KJOA 1GUTA 5IIFA 2G9DA 1GUSA 1V1OA 2XGTA 2LXJA 1NUCA 1SMYD 3OW7A 3TP7A 2RDFA 3QIAA 3A7LA 2NUCA 2UXDQ 2HQEA 3BZCA 1ILPA 3I8ZA 2I5MX 1PA6A 1SJED 1V43A 3KFUA 2B3GA 4ODGA 1FYCA 3E0EA 2ZXRA 1BO0A 1TWCH 1XTCD 2KCCA 1Q86C 1L1OA 4B3SL 1IL8A 1V1PB 3S15B 1TWCB 3RN5A 2ZM6L 1HZ9A 1OXTA 4P2CB 1Q1EA 5AJ3L 4JYAQ 1E24A 4B3TQ 2ZXOA 5L37A 1D7QA 3TEHB 1X3FA 1C8CA 4UP8A 2LS01 1SE3A 1WTVA 5JJZA 1NMGA 1PDQA 3PO2G 1SNCA 3J7AF 4JBWA 2L1BA 2A74C 4KJNA 4A3CG 4JI1L 4DK1A 3HG9A 2L5TA 1SE2A 3NQTA 4Q0FA 3DUZA 1SNOA 2F3IA 2B39A 3UDXA 1CQVA 2Z6KC 2UXCQ 2DN8A 1DONA 1I3QH 2UUAQ 4BY7G 1KXLA 3NELA 2M00A 1Y8OB 5CGKA 3CC4A 3DWPA 5IOCA 4XT1B 2OEOA 1IZ6A 4CDDC 1I3QB 3TQYA 1D5XC 3J80L 2EY6A 3K8AA 1G2SA 4HIKA 1JE4A 3HEJA 5C4XG 5FLXL 1I5FA 3S1MH 2KCMA 1PVOA 3R2TA 2E8GA 1GUGA 4ID6A 2FXQA 4XYOA 2PNHA 1IHZA 3J7AV 3PO2B 4HEDA 3S1MB 3L3OC 3NQIA 5KRUA 3QB3A 4LUZA 1IBKL 4LF6L 1EY4A 1OXSC 3AFQA 4DGZA 2X6GA 5J39A 2R7DA 1JQYD 1Q90A 1BKBA 1QVGA 4BY7H 2VS1A 4KD3A 1PZID 1JJ2A 3FPUB 4GN5A 1GOZA 1QJOA 2NB0A 1Q46A 2EQSA 4BY7B 3FP9A 4K0KL 4FXDA 5C4XH 1VQFA 5IYDH 1SNQA 2DGYA 3TDQA 1GHKA 1WYDA 3FDTA 2JEAI 1AZPA 1ZYRC 5C4XB 1EYAA 1NY4A 2BH8A 2D0PA 3EQLC 3HP3A 3KBXA 5M3FH 3WOFA 3PGZA 2NYZD 3G6EA 3I4NG 1IBLQ 2OT2A 2PQEA 3K5OA 1S5ED 4MHEA 1VF7A 3PUXA 1R9TB 1HA6A 3HS0C 3OTOQ 3A55A 5EPJA 3KLRA 2HDLA 3MXUA 2H5XA 3OIQA 4QF4A 3RNUA 1A62A 1D2BA 3E0JA 3H15A 4YWLA 2AUJD 2JQOA 3H3VI 4QY7A 4NXML 5J22A 3BS1A 2BDNA 2JA7G 4LUVA 1FGBD 2F0EA 1V8QA 3I2ZA 3G48A 3HOXG 1NR4A 3ONAB 1I4GA 2HCIA 1QVFA 3OWFA 3V2TA 3M7NA 1IXRA 1C7YA 2K5HA 2AMCB 1JWUD 1Y8PB 1WTOA 3G6JB 3NENA 2ZJQA 5LMUQ 4LF4Q 3LWUA 1EIHA 1D1IA 5CC4A 4P75A 4OX9Q 3S16H 5IGFA 2A68C 2FMMA 4FF2A 2ENBA 1BQQT 1BXTA 2JA7H 4M1UB 3TMEA 1STBA 3K0XA 3S16B 3HOYH 5JEAH 3HOXH 2XRSD 2JA7B 2HD3A 2IX0A 5KNCA 4FO2A 1MHWC 1KD1C 2Z4IA 5FKAC 3G71A 1J5EL 2Q2UA 3RZOH 3HOXB 1KTKA 2MP1A 1HXYD 1S72A 2PCFB 1YI2A 4K8IA 1Z7TA 3RZOB 4I7AA 1Y14B 5ELCA 3HKZB 1HPCA 5ELDA 3W3AA 5FK9C 2E2JH 3H09A 1E2WA 2F03A 2F0WA 3GTJH 3KLWA 3BVGA 1OTCA 3UDFA 4DV0L 2E2JB 3BJUA 3X3MA 1F9RA 3JAME 4I7ZC 5KYLA 1SYBA 2F0PA 2CWAA 3NBHB 4K2KA 2K28A 5K36H 1G51A 1PZJD 2D9UA 1FL0A 1EQRA 2ID0A 2AUKA 4HSPA 4A3JG 4RGNA 3DM1A 2TSSA 1RL2A 2I5LX 4UHVA 2ZTEA 3K7AH 5A2QL 1FJGQ 2JE6I 4CGYB 3L2PA 4MN3A 1X55A 4OO1H 3TBIB 1EY9A 2E2IH 2BH2A 3K7AB 2F0QA 5ELFA 3CU7A 2AHOB 4KHPQ 1BOSA 4GLVB 5HGQA 2E2IB 4HIDA 1PMRA 2PZTA 4RH6A 1HR0W 3K5MA 1QNUA 2F1MA 3HOUB 2F0NA 4XT3B 5KGUA 2R93H 1BR9A 2DJFC 4PQXA 3PMFA 1SYGA 1ZYRD 2D62A 3MA2B 5TSSA 2B2TC 1PH4A 2L15A 4A3JH 1STAA 2A5HA 3VYUA 4RCOA 3JAMc 3GQBA 4K5WA 3STBC 3A5ZB 4HJ5A 4A3JB 1XMQQ 3L0OA 4DR3Q 4DV1Q 3MEHA 1ZKOA 1TWGH 4JG2A 5C5MA 2VQFL 4LF8L 1DZ1A 4PZ6A 3GTOB 1FNWA 4H7BA 4NXNL 4PMBA 3EVQA 1HNWL 4JI3Q 2B2VA 3D6WA 4CKCA 4B9WA 2RHSB 3TZDA 1MBYA 4DR6L 3SXHA 1I50H 3GTMH 3EROA 3H0GG 2F0IA 4DR5Q 3A74A 1H9SA 1B3AA 1V1QA 2WV6D 1I50B 4KY5A 4RG1A 1Q1BA 5D14A 3GTMB 1V9PA 1QOHA 1XPRA 3GV3A 4GOPA 2E74C 3Q24A 4LFCL 2K7VA 1YNND 4NMZA 2NZHA 1EYDA 1BBXC 3K7UC 2VQEQ 5EGTA 1MI2A 1LT6D 1EYCA 2RCNA 1PFMA 1NBWA 3KDFA 1S40A 1KIXA 1YHAA 2A68D 2P5ZX 1X3EA 4N9PA 4GLXA 1TWAB 3NWSA 3OYYA 1TWFH 1SNDA 4FP5D 1BVSA 2MJ8A 4J15A 3PV0A 2Y0SE 4ME5A 3D3RA 1TWFB 3H0GB 1EL0A 2QGQA 2I07B 4XQQA 4N8FA 3T1YL 2OTJA 1E1OA 1H9RA 3UE0A 1HNXQ 5IGCA 3RZDH 2I0QA 3CPFA 1G8ZD 4X64Q 1TS4A 3CKIB 2CW0C 2EYLA 4IJHA 3MZ5A 3M4YA 3RZDB 5IT9L 3HOVG 3K0YA 2JA5G 4DR2L 2EJFC 1F77A 3KF8A 3I4OA 3CAMA 2AQ2B 2K4KA 1M8AA 3EBEA 1CK1A 4GZYC 2Y0SB 1S5CD 4DAYB 3QWNA 3S1NH 5FO8B 3VR6A 2PNRC 3CQZH 4X3TA 5EKIA 2PYKA 3D31A 4DV7L 1A2UA 2K5WA 3VYRA 4V190 2EYMA 3S1NB 2QKIC 4KHZA 1UE5A 4R4CA 4RCNA 3QO2A 4GN4B 2X6LA 4LFBL 1DOLA 2F0JA 4NB3A 3AB9A 1FNUA 1RD9D 2C5CA 4P74A 1D6EC 1VQOA 2C9OA 5EPLA 4UP7A 4U68A 2K05A 3HOVH 2JA5H 2DJGC 4N8X1 1E0BA 4DPGA 1CQFA 5C4HA 3H91A 3TN2A 4JI2Q 4RHSA 3HOVB 2JA5B 2A6HC 5CV5A 1K0RA 2EYOA 3A0JA 4I65A 1N32L 4JPBW 3KUPA 4DV2L 1N36Q 3DXJC 2KEEA 1TY2A 4NW2A 4J6HA 3CCMA 3I55A 1HFGA 1KAAA 2O5IC 2ICIA 4B9XA 2UXBQ 2R7ZG 4RGTA 4YWKA 4DR1L 1DOKA 2I46A 2ZJPA 1N33Q 2UUCQ 4KJOA 1KAWA 2E75C 1GXDC 3D6CA 4XTCS 1ZXTA 5M3MH 1B70B 1VDZA 5GAEC 3MTSA 4QIWE 4OL7A 1YNXA 2Z8LA 2OXPA 3Q6SA 2X69A 1UEBA 5M3MB 1E22A 1SXTA 2CQAA 1WVLA 1QNKA 4LFAQ 2UU9Q 3S14B 1XPUA 1EZ8A 1XMOQ 3S1QH 4U673 2VZAA 1YJ9A 3J81i 4APVA 1WTXA 2RDHA 4JI4Q 2B8GA 3KBGA 3UE1A 4RKLA 3OWEB 3NK9A 3S1QB 1YNJC 4BBSG 1AE3A 3SK4A 2R7ZB 1K9MC 2NVQB 3Q0AA 1DXMA 4QIWB 1L0XB 1L0YB 3I3CA 5C3EH 1VQ7A 2CHBD 3D8GA 3M4OB 2VB2X 4J1MA 1Q8IA 1L1OB 5C3EB 4R4QA 1KNEA 1CTMA 1FD7D 3M3YH 3RD4A 3Q23A 4IOCA 2KECA 4P71A 3PO3G 3W1GA 4JBKA 2K5NA 2WAQG 1K73C 3M3YB 3GTPH 2WP8J 4JOIA 4NP5A 4FXKC 2VL6A 2XVSA 4A3LH 3ERSX 2Q8IB 2WAQE 3IAYA 4UP9A 2EVBA 3JC66 2F0UA 4ABNA 1WCMG 3PQIA 2QEJC 1A8VA 1XPOA 4CJ1B 4BBSB 2B2UA 4XDXA 1X65A 1EWIA 2K03A 5BN5A 2PW5A 1GUNA 2F0SA 3OMGA 1Z47A 4QMGA 4OELB 1P8LA 1TU2B 3OW2A 1KLGD 1YIJA 2EDGA 1ONLA 1X9NA 3VA5A 2JJQA 5I4DA 3T51B 2A73B 3EJIA 1EQVA 4WJ3M 1GJXA 3CC2A 2WAQB 3S17H 3MHBA 4ULLA 4JI8Q 2XIWA 4IFDH 2F52A 1ENAA 3J81j 4DAMA 3S17B 1HA5A 5CMDA 2YU9H 3HOUG 5IE8A 1MKHA 3KOJA 1QB5D 4V0BA 3U50C 2ES2A 2GN5A 2WKCA 3P20A 5I2XA 1AEXA 5LMNW 4ZAIA 3VR3A 4NDXA 1PXUA 4LF7Q 3K81C 3SHLA 5IYCG 3LGJA 5ISRA 1G6PA 2PQAB 3TS0A 3U9SA 1PFNA 4AQYL 5C4ZA 4A3FG 4KKSA 5LL6X 2BCOA 2A8VA 4DR7L 1LUZA 3J7YW 2F4VQ 3OOCA 4FF3A 3CCQA 5LMNL 5JJLA 4QGUA 4FF1A 5JVH3 3U4ZA 2J4XA 3HOUH 4GLAC 4HTHA 2JA6G 4JVZA 1EFID 4YHHQ 2ALYB 4IUQA 5C3XA 4ZYSA 2TMPA 1JCKB 5J1ZA 3D4WA 3EIVA 2B2VC 1KRTA 5FLMH 1C0AA 3F2UA 2ZTCA 3MFGA 3FPPA 4OGQC 3S15H 4A3FH 2UUBQ 4B3ML 3U9OA 4X3KA 4ZUJA 4KMUC 1X3QA 1CA6A 1JORA 3NWTA 4K6DA 1SNMA 1A3TA 2XN9C 4A3FB 2K52A 4DUYL 2IX1A 1C9OA 3MC0B 5IGBA 3A7AB 1T5EA 1U9RA 4JI6Q 5CYUA 4X62L 2VY3A 2E5LL 1L0WA 2JA6H 1VQLA 3WWVA 4EQPA 4GNXA 1BCPF 1YNJD 2VUMG 2AKWB 2RF4A 2WFWA 5ELNA 4DV5L 1MD2D 4UDUC 2JA6B 3QJYA 5JVG3 1WD0A 1BCPC 1LTTD 4OXPA 4TRDA 1STEA 1YHQA 1TY0A 2EJMA 2YTYA 2B2WC 4R8NA 5EKLA 4BA1I 4PNYA 3PIP3 3PUZA 1EY0A 1RDPD 2PZWA 3QOJA 3WOEA 4YY3L 1O7ZA 1TS5A 4DV6L 3F2CA 2Z1CA 1IYVA 4Y52H 2Q2TA 5H1SE 4OWWB 2F4IA 1MSHA 4B08A 3MVVA 1F2YA 3HOZG 1I6HB 3VDYA 2VW9A 1DD2A 2YYZA 1S5FD 3NTKA 4FNFA 4LF4L 4KLKA 3EA6A 3CCEA 3I73A 3C46A 1TXYA 1JWMD 2EXDA 2VUMH 3PO2H 1SR3A 2B8FA 5C0XJ 1UE6A 4F88A 1RKNA 1RTOA 3E9IA 4HJAA 1XNRL 3BG3A 1AH9A 4A3CH 3TRZA 2B63G 2VUMB 5KIXA 5I6WA 1GUWA 5BR8Q 2Q2IA 4DXFA 3NUCA 5CBAE 3S1RH 2KJXA 3A54A 1VQ4A 4FF4A 1TIID 1UUPA 5C0XI 5GAGC 3S1RB 5CV4A 4LF9L 4DFAA 3J80i 1K0SA 5E1FA 4OWXB 1XMQL 3PIO3 4QL5A 4EQNA 1D5ZC 3PF5A 1R9TH 2B63H 3CCUA 1XNQL 1EFWA 3T16A 3C1EA 1EEFD 5C4JH 3E5SA 1NCVA 2L0CA 2B63B 4DUZL 1EIYB 4AH6A 2EYJA 4N9TA 2EJGC 2O2LD 4ALPA 5C4JB 4WFN3 4X65L 2C35B 2R92G 1CZWA 1I94L 2KHJA 2Z4HA 4B3SQ 1AE2A 2HQLA 3J81E 3CCRA 1XWEA 1O80A 2ZM6Q 1EWHA 3M85A 2NN6I 1LTBD 5IWAL 5AJ3Q 4G7HC 2F0KA 5E7NA 2ZT9C 1HUMA 1ICFB 4X66L 1HCZA 3I4NH 2IPKD 4DA2A 4QUFA 4JV5L 2D5DA 1GUOA 4P72A 5IGDA 4KI0A 4JI1Q 3SR1A 1YNNC 3I4NB 1V1PA 3W2DA 4LF5L 5AFWA 2NZ1D 4K5XA 1M90C 2Q8RE 1CUKA 1LM0A 1VQGA 3J7ZC 2JXMB 5CV7A 1I4HA 1VQAA 2OTLA 1WFQA 3FMCA 3ULPA 1PLFA 4F7XA 4ZKCB 3BU2A 2RVLA 1TWHB 1B3QA 3F2DA 1C48A 1VQBA 4RAUC 4DV1L 3J81c 3J7A5 2A69D 4C3IG 1HZCA 3KLSA 4GOPB 1F2LA 1S5BD 3HKSA 5F2DA 1I4PA 2CCZA 4QJFA 4JBMA 2B2YC 1U4PA 1IBKQ 2RBMA 2FMCA 1BCPD 1RF2D 4LF6Q 4IQZA 3NTHA 1U4RA 4LW1A 5T1IA 2K75A 3A5UA 4LNQA 3HOWG 4IO9A 3I91A 4O42A 2ZJRA 4MNOA 1BCPB 4JCVE 4DNRB 3CW2C 1OXVA 1RCVD 1Y1VG 2EY5A 5IGEA 1HH2P 4H02A 5C3WA 5DM73 4K0KQ 2R61A 3S2HH 1MSGA 4JBJA 2IHEA 3E3XA 4IN3A 2ZXPA 1J9OA 5CBEE 4C3IH 1I4QA 2DNEA 4IPGA 3A8KE 3S2HB 1N9WA 3CP0A 4O1NA 4K2LA 4OWTB 5GQOA 4C3IB 3T1HL 2MFIA 2N8NA 5JJIA 2R6GA 3DWQA 1DJRD 2JN4A 3BVMA 1TVXA 1VS0A 3FRPB 1W2BA 3N6RA 3KF8B 5DM63 1Z6HA 4GKKL 4OIJA 4MTNA 1PFBA 4POGA 3D0FA 4YIJA 1EY7A 1K8MA 3K80C 3MEFA 4KN4C 4HJ7A 4NXMQ 2XSCA 1PYBA 1R4PB 2CH4W 3NE5B 4PG3A 1HNZL 5I6YA 1EQTA 3IKJA 3TS2A 3CCSA 3U58A 1GVPA 1ET9A 5CV9A 4JI7L 1H9JA 2FINB 4F87A 2KHIA 2PPBC 2MHVA 5CR3A 1Q81C 3GTOH 5I9OA 1HR0L 1PRTD 3ERQA 4KTAA 4TQUS 1WTQA 3GTLH 2MO0A 4CDEC 5EBDA 1SBBB 2PO4A 3U4VA 3P7JA 1SDFA 5EPKA 4EVOA 3GTLB 1LYLA 4A3MG 3I4LA 3SK6A 1W3SA 3GP7A 2JA9A 2MPMA 4DV3L 4RMFA 1J5EQ 3ICEA 1L1OC 1N8RC 4IPHA 1EQQA 1A2TA 3KYHC 4XXEA 1GD7A 1ML0D 3T53B 5IP9G 2QILA 1AW7A 3VYSA 1ENCA 1TWAH 1YEZA 1Z9FA 2D2CC 1STGA 4A3MH 2NVTH 3PUVA 1QE6A 4DV0Q 3A56A 3R8BA 4G7OC 2FJ2A 3H0GH 1SEBD 4A3MB 2NVTB 4FVMA 1VQ8A 4IPDA 1GM5A 3H3VC 2O5JC 1QVCA 4ME3A 2NWGA 4IURA 1HTLD 2EE1A 1YVCA 1EY8A 3CHBD 1F9SA 5A35A 5IP9H 1WTRA 4EQOA 2A6ED 1G2TA 2LMCB 3MFYA 1DM0B 1IYJB 4PMCA 4YCVA 1HJPA 4HIOA 3F2BA 2Z6KA 3GTQH 4QUCA 4ZK9B 1OO9B 1VQDA 1TS3A 1EEID 3J80E 3CRLC 1Y1WG 2KCNA 4QQBX 5JJKA 2CWPA 1B2TA 3GTQB 4A76A 3N52A 4G7ZC 1EY6A 5EAYA 5FLXE 5JPMC 1CKOA 3AFPA 5HURA 2K01A 1VQEA 3VR5A 4JK1C 1B8AA 4B3RL 4GN3B 1STYA 1SRUA 4A3KG 1J6QA 1F9QA 5DLQE 3K5NA 3K57A 1IKMA 4XIGS 1GO3E 1I6VC 1DYQA 2HUGA 2JK8A 1NMFA 3RMHA 2OQKA 3QOLA 2N3SA 5C5LA 4WRDA 2VQFQ 4LF8Q 1Y1WH 3I7FA 5HY6A 4CKEA 3T13A 3MWYW 4NXNQ 1N34L 1F2ZA 2LXKA 3FEWX 1VQMA 1SFOH 1MIUA 1HNWQ 1GHJA 1ZEQX 3BYYB 5JEAJ 1Y1WB 4NKLA 4JI5L 4RKBA 4L5TA 1U4MA 4DR6Q 4BXXG 1SFOB 1IW7C 4A3KH 3J80c 1PHJA 2F0OA 1EU4A 3IL8A 2KUMA 2CVRA 5FLXc 2DY7A 3BDLA 4A3KB 4JI0L 2HCCA 2HHHL 5T1GA 1H9MA 1CHPD 1KNAA 4CKBA 1LT4D 2WB1G 4LFCQ 1PH7A 3LNNA 3GTKB 1LTLA 2F0MA 1M4VA 1NE3A 5CV8A 1KABA 4A3BG 3AU7A 3NP8A 1EOVA 3S14H 2WB1E 1KRSA 1SNPA 2JSOA 4BY1G 2K6AA 4OEMB 4DR4L 4BXXH 1P16A 4DV4L 2HIXA 2M2LA 4OIKA 3PIOA 1S5DD 2MNAA 1KDBA 2R7ZH 3I4MG 2NVQH 4DK0A 5M5YH 1TQOA 2K50A 5CV6A 3S2DH 4GKJL 5KNBA 2VB3X 2F0LA 3M4OH 1UEAB 3T1YQ 4C56C 2OWOA 1UNSA 1YZ6A 1FR3A 5M5YB 1IBML 2V4DA 3KF6A 3S2DB 2KVMA 2WB1B 1DCZA 3RR5A 1QUQA 2EY2A 3MXNA 5JOBA 1Q82C 4BY1H 3DLLA 4A3GG 5FOBB 1IYUA 1TKWB 2B29A 2NBFA 3EFXD 1WI5A 1LT3D 4BY1B 1VQ9A 4OO1I 3SEBA 3S9WA 2UXDL 1PTOF 2XNAC 4HMJA 4DV7Q 1SLJA 1Q12A 5K5PA 2IW3A 2SNMA 2Z0SA 3BDCA 3E6ZX 2DNCA 3NPPA 1VQKA 2NVXH 1A6XA 4L5SA 4GNXB 4BBSH 3H3VH 1PV4A 2WIIB 4C3JG 4LFBQ 3I4MB 2NVXB 1NSNS 2A1AA 1CFMA 3BZDB 4A3IG 1Q7YC 4LAAA 3DM3A 3L7ZC 3OPOA 1QILA 4S3SA 4JYAL 2E76C 4A3GH 1PYSB 3D4RA 4B3TL 1NNXA 4HR7B 1JOQA 1KLUD 2RSNA 1K8GA 1XYIA 3W5OA 3JAML 3PO3H 4A93G 4Q5VA 4A3GB 5ELEA 1HHVA 4L8JA 3PCOB 1N32Q 1ESRA 5IP7G 4DV2Q 2A19A 4BBRG 3PO3B 2KEDA 1SSOA 2KCTA 1O7IA 1W6JA 1WCMH 1PH9A 2UXCL 3VR2A 3KLSX 4DR1Q 4IJLA 1Q8KA 1E3PA 2F0HA 2EIFA 4MIUA 3ND9A 4ZCKA 3V05A 5A2QE 4A3IH 2UUAL 1BUVT 1LO5D 2NVYH 4C3JB 2SDFA 1I4RA 1JC7A 1QCBD 1WCMB 1RHPA 1STHA 4F8MA 1DGSA 4A3IB 2NVYB 1SE8A 3GD7A 4C1NK 2FFKB 5DNFA 2SOBA 1E7ZA 4LK1C 3TREA 3GO5A 1M1KC 1AP0A 2Q2HA 3JAMi 2LFNA 5I2YA 5IP7H 4BBRH 4DNIA 4A93B 4IPCA 2RQXA 1IW7D 4MZ9A 1B9MA 4BBRB 4ZLTF 1B1ZA 2B2TA 1PH6A 5EQ0A 3AYHB 1B7YB 3B6YA 1CKNA 2L12A 3IFDA 1S3OA 1WD1A 5BN3A 2R7FA 1K3RA 1VMCA 1WTHA 5FJ8G 2DUDA 4IOAA 5IYCH 2HDMA 4QB4A 3UDGA 3LWEA 4POFA 5IYBG 1SN8A 1WJJA 4KV6A 1I4XA 1LACA 3CCLA 1EZ6A 4CHTB 4GOPC 2O4XA 4DAVA 1IBLL 1TT2A 1WTPA 2IWHA 3ZYYX 4CBVA 4DU9A 3CF5A 2OF1A 1CKMA 2L11A 3OTOL 2A69C 3SGIA 3Q8DA 4L5RC 3PUYA 1B50A 3NBIA 3G7LA 5FJ8H 4A3DG 4GS3A 1DOMA 1EIFA 1U4LA 2KENA 5JAVA 4RGOS 5IYBH 4EGVA 1K8OA 2K5QA 4OHJA 1JE5A 2J7ZA 1X54A 1D8LA 4WORA 2EYPA 1VQ6A 1I6HH 1R4QB 4L63B 1FNVA 2WINB 1K8AC 3ULLA 2EOTA 2LY7A 2WACA 4Y7NH 5DEHA 3HRZC 2L9HA 3H6MA 3PSIA 3BYTB 2QA4A 2EYHA 5GROA 1K3BC 1PTOD 3CCJA 5LMUL 1MGSA 5FO7B 4Y7NB 3R3OA 1PTOH 3M4QA 4A3DH 3KJPA 5LL6S 4WJWA 1Y8NB 4OX9L 2RSOA 2RA4A 1VQ5A 1PH3A 1PTOB 2XRQD 5EJWA 5IT9E 2JYOA 4YWMA 4A3DB 3DMUA 4HSVA 1VQCA 2E2DC 1RIPA 1MJEA 3X3NA 2SEBD 3ULJA 5IYDG 2Z9HA 3RN2A 4AQYQ 4A3EG 1KQSA 4AYBG 3HOZH 1ENFA 1JICA 4UPAA 1HTPA 4DR7Q 5M3FG 3I90A 5GAHC 4MTKA 1UAPA 4XQNA 5LMNQ 3HOZB 4UAIA 1ASYA 4AYBE 2BA1A 1F2MA 1X3GA 1HQRD 2BDOA 2PQAA 2F0DA 1PRTF 3BVZA 3I56A 3WDNA 4HIMA 1KC8C 1PRTC 2DY8A 1IKLA 3ND8A 4ZKBB 4P73A 3C2PA 4A3EH 4B3MQ 2IL8A 4BA2I 5IT9c 4HJ9A 3DHQA 5E4WC 1L2FA 4IUPA 2HIVA 4A3EB 3Q22A 2AQ1B 4EQ5A 3CC7A 4PMWA 4AYBB 5EKKA 4DUYQ 1A3UA 3SE0A 3C3LA 5M3FB 1NAPA 2K33A 4PZ8A 4OONA 4X62Q 1FJGL 2E5LQ 2WKDA 4ZRZA 2CH4A 3UDIA 4KN7C 3TSSA 3F8TA 4DV5Q 4KHPL 2PI2A 1ET6A 2RHQB 3RLOA 2AWNA 1BBUA 2K32A 5D65A 2R92H 2ICEC 4RWSC 2VQEL 4YY3Q 3HOYG 1EOTA 5JEAG 4DV6Q 3T4AC 1TWHH 5KNDA 2R92B 1ESFA 2QDBA 3O13A 1QZGA 2N49A 4IFDJ 3HKZG 2K14A 1H9SB 1W6KA 4DR3L 2KBNA 3GTGH 1EU3A 1II3A 4PZ7A 1HFNA 3S24A 3VR4A 1JJCB 2OQ0A 1XNRQ 3HKZE 3M4PA 4KHVA 1E1TA 2ZTDA 2RDGA 3GTGB 1G6ZA 4JI3L 5M5WH 2QDLA 1CHQD 3D4DA 2SNSA 4FYDA 2A6EC 4IFDI 3MAQA 3H94A 4H13C 3TP6A 1VQPA 3L9AX 3RLFA 5M5WB 3MXGA 4KKUA 3NEMA 5EBCA 4JOIC 4DR5L 3KDFB 4NPSA 1Y69U 1RJTA 1C4QA 3DEOA 2PZUA 3HOYB 1U0LA 1JOKA 4LF9Q 3OSOA 3K6OA 5K36G 1PH8A 2XWBB 2B2UC 2K5DA 2KHSA 4K8JA 1YJNA 3P1HA 4DK3C
chains in the Genus database with same CATH topology
1CA5A 4OO1G 1STNA 1LTRD 2KOLA 4KD4A 3M7GA 3URYA 3GV6A 1E2VA 2JP1A 3GTJB 4RHRA 1SYFA 3SDZA 3AMUA 1JB3A 2BE5C 1JR0D 3K58A 3HOWB 4G57A 4H0LC 1E2ZA 1Y1VB 2F3WA 1AFPA 2NTTA 2EY1A 5COYA 2EPBA 4L6TB 1G91A 1KDCA 1OXXK 2R3ZA 2EYFA 5NUCA 4BWGB 5FO9B 2EZVA 1HUNA 5E3FA 2EXZA 4G4KA 2LKVA 3R93A 1G291 1PRTB 2PW7A 2IJ0A 2R93B 3K59A 1D5MC 2BA0A 4DF7A 1CT1D 4RFBA 2N88A 1B4OA 2AQ3B 3DWAA 4HCSA 1Q3LA 1TWGB 2IT1A 1HQMC 1XXGA 5JPNC 3P75A 1LTSD 3FVQA 2F0GA 3C1FA 2QF7A 5BN4A 3RUZA 3PUWA 1KDAA 1LLRD 3NSWA 1PZKD 1B44D 2G9HD 5C44B 1VMPA 2E2HB 5KEEA 1B53A 4KY7A 2MGSA 2F0VA 5IGGA 3K5LA 3IFTA 1ILQA 3OMCA 1BF4A 1LABA 2B2WA 2JA8B 3OHXC 1D1KA 3NBHA 5M9OA 4DAPA 3SVMA 2MUYA 3I72A 4IUNA 4ZQ3A 4R8IA 4R9WA 2L4NA 4X3SA 4IALA 3MXPA 5D3DA 1XX8A 1HRJA 1RTNA 4E6IA 1QG7A 1EIGA 3DEPA 1CI3M 1A3VA 3VA7A 3LX0A 4TKOB 5G3LF 2BE5D 1QWYA 2VNUD 3CQZB 4Z9CB 1J8IA 1ICWA 1O7YA 4HN7A 1SAPA 4J8QA 1X3PA 3NHHA 3A8IE 5C6AA 1F9PA 4IUVA 3QG1A 5C0XG 4HCEA 4BS9A 1LT5D 3A8JE 5HGTA 2RKSA 5CORA 4K5VA 2Q8TA 1JWSD 1SE4A 3TZUA 3NXWA 3J81L 1S4ZA 1BDOA 2GA4B 4C3HG 1SMYC 2H1EA 4C2MB 1EWCA 2KA7A 4HMIA 1O78A 4IUUA 5C0XH 2JEBI 3VYTA 2VXWA 2L55A 5DAUA 1LV9A 5ELBA 2N55A 1X32A 1WTWA 2QCPX 2NN6G 3BDOA 1SYEA 4PV1C 1EY5A 2BOSA 5D3IB 4A3BB 3TP8A 1PYWD 4HAEA 4C3HB 2F3VA 4H44C 3UI2A 1H9KA 4TSSA 4X3UA 4DN4M 1PTOC 1T5XD 3V96A 4K14A 2NN6H 1AN8A 1TR5A 4KK7A 3CRKC 2B2YA 3TP5A 3R2IA 4DAYA 1OXUA 2AWOA 4FXGC 4KY6A 4XYQA 2NTSA 2J0TD 1AZQA 1VCIA 1BNZA 3KK7A 3GTPB 2M9VA 4IFDG 4ZUIA 3I70A 4C1NI 4M8AA 4K6LA 5LHY1 4KKTA 1VF5C 4IZ8A 2CW0D 3SK8A 2KQ3A 4LJZC 4CJ0B 1SYDA 4RA8A 1NR2A 5IODA 2F0TA 4CJ2C 4RGMA 2XWJB 4XQJA 5KYIA 1SYCA 5I9PA 1CZGA 1LTID 1O7LA 1TS2A 2PMZB 3HZXA 3FKIB 1B9NA 5G3LD 2K1BA 4QCLA 3SK5A 4ILWA 3OIPA 5M5XB 4DNTB 2YU9B 1K83B 2FHTA 1CM9A 3ITPA 1A15A 1RODA 2K04A 3HGBA 2IX3A 1JOOA 2A6HD 2F0FA 1LTAD 1LTGD 1SJHD 2H4OA 4LMQD 4DXGA 4IUTA 5E4XA 3T56B 3NTIA 1GUTA 5IIFA 2G9DA 1GUSA 1V1OA 1NUCA 1SMYD 3OW7A 3TP7A 2RDFA 3QIAA 3A7LA 2NUCA 2HQEA 1ILPA 3I8ZA 1SJED 1V43A 4ODGA 1FYCA 2ZXRA 1BO0A 1XTCD 2KCCA 1IL8A 1V1PB 3S15B 1TWCB 1OXTA 4P2CB 1Q1EA 2ZXOA 1C8CA 2LS01 1SE3A 1WTVA 5JJZA 1PDQA 1SNCA 3J7AF 4JBWA 2L1BA 2A74C 4KJNA 4DK1A 3HG9A 2L5TA 1SE2A 3NQTA 4Q0FA 3DUZA 1SNOA 2B39A 1CQVA 2DN8A 1DONA 2M00A 1Y8OB 5CGKA 3DWPA 5IOCA 4XT1B 2OEOA 1I3QB 1D5XC 3J80L 2EY6A 1G2SA 1JE4A 3HEJA 5FLXL 3R2TA 1GUGA 4ID6A 4XYOA 1IHZA 3J7AV 3PO2B 4HEDA 3S1MB 3L3OC 3NQIA 5KRUA 3QB3A 1EY4A 1OXSC 4DGZA 2X6GA 5J39A 1JQYD 1Q90A 4KD3A 1PZID 3FPUB 1GOZA 1QJOA 2NB0A 4BY7B 4FXDA 1SNQA 3TDQA 1GHKA 3FDTA 2JEAI 1AZPA 1ZYRC 5C4XB 1EYAA 3HP3A 3EQLC 3KBXA 3WOFA 2NYZD 2OT2A 2PQEA 3K5OA 1S5ED 4MHEA 1VF7A 3PUXA 1R9TB 1HA6A 3HS0C 3A55A 5EPJA 3KLRA 2HDLA 3MXUA 3OIQA 4QF4A 1D2BA 3E0JA 2AUJD 5J22A 3BS1A 2BDNA 1FGBD 2F0EA 1V8QA 1NR4A 3ONAB 1I4GA 2HCIA 3OWFA 3V2TA 3M7NA 1JWUD 1Y8PB 1WTOA 3G6JB 3LWUA 1EIHA 1D1IA 5CC4A 5IGFA 2A68C 2FMMA 4FF2A 2ENBA 1BQQT 1BXTA 4M1UB 3TMEA 1STBA 3S16B 5JEAH 2XRSD 2JA7B 2IX0A 5KNCA 4FO2A 2Z4IA 5FKAC 3HOXB 1KTKA 2MP1A 1HXYD 2PCFB 4K8IA 1Z7TA 3RZOB 5ELCA 3HKZB 1HPCA 5ELDA 3W3AA 5FK9C 3H09A 1E2WA 2F03A 2F0WA 3BVGA 2E2JB 3X3MA 1F9RA 3JAME 4I7ZC 5KYLA 1SYBA 2F0PA 4K2KA 2K28A 5K36H 1PZJD 2D9UA 2ID0A 2AUKA 4HSPA 4RGNA 3DM1A 2TSSA 5A2QL 2JE6I 4CGYB 4MN3A 4OO1H 3TBIB 1EY9A 3K7AB 2F0QA 5ELFA 3CU7A 1BOSA 2E2IB 1PMRA 2PZTA 4RH6A 3K5MA 1QNUA 2F1MA 2F0NA 4XT3B 5KGUA 1BR9A 4PQXA 3PMFA 1SYGA 1ZYRD 2D62A 3MA2B 5TSSA 2B2TC 1STAA 2A5HA 3VYUA 4RCOA 3GQBA 4K5WA 4A3JB 3MEHA 1ZKOA 5C5MA 1DZ1A 3GTOB 1FNWA 4H7BA 4PMBA 3EVQA 2B2VA 3D6WA 4CKCA 4B9WA 3TZDA 1MBYA 3SXHA 3EROA 2F0IA 1H9SA 1B3AA 2WV6D 1I50B 4KY5A 1Q1BA 5D14A 3GTMB 1QOHA 3GV3A 2E74C 3Q24A 2K7VA 1YNND 4NMZA 1EYDA 1BBXC 5EGTA 1MI2A 1LT6D 1EYCA 1PFMA 2A68D 4N9PA 1TWAB 3NWSA 1SNDA 4FP5D 2MJ8A 3PV0A 4ME5A 3D3RA 1TWFB 3H0GB 1EL0A 2I07B 4XQQA 1H9RA 5IGCA 1G8ZD 1TS4A 3CKIB 2CW0C 2EYLA 3MZ5A 3M4YA 3RZDB 5IT9L 3K0YA 2EJFC 1F77A 3KF8A 2AQ2B 1M8AA 1CK1A 4GZYC 2Y0SB 1S5CD 3QWNA 5FO8B 3VR6A 2PNRC 4X3TA 5EKIA 2PYKA 3D31A 1A2UA 2K5WA 3VYRA 4V190 2EYMA 3S1NB 2QKIC 4KHZA 4RCNA 3QO2A 2X6LA 1DOLA 2F0JA 3AB9A 1FNUA 1RD9D 2C5CA 1D6EC 2C9OA 5EPLA 4U68A 2K05A 1E0BA 1CQFA 5C4HA 3H91A 3TN2A 4RHSA 3HOVB 2JA5B 2A6HC 5CV5A 2EYOA 4I65A 3KUPA 3DXJC 2KEEA 1TY2A 4NW2A 4J6HA 1HFGA 1KAAA 2O5IC 2ICIA 4B9XA 4RGTA 1DOKA 2I46A 4KJOA 2E75C 1GXDC 3D6CA 4XTCS 1ZXTA 1VDZA 3MTSA 4OL7A 2Z8LA 2OXPA 3Q6SA 2X69A 5M3MB 1SXTA 2CQAA 1WVLA 1QNKA 3S14B 1EZ8A 4U673 1WTXA 2RDHA 2B8GA 3KBGA 4RKLA 3OWEB 3NK9A 3S1QB 1YNJC 3SK4A 2R7ZB 2NVQB 3Q0AA 1DXMA 4QIWB 1L0XB 1L0YB 3I3CA 2CHBD 3D8GA 3M4OB 2VB2X 4J1MA 1Q8IA 5C3EB 1KNEA 1CTMA 1FD7D 3RD4A 3Q23A 2KECA 3M3YB 2WP8J 4NP5A 4FXKC 2XVSA 2Q8IB 3IAYA 2EVBA 2F0UA 4ABNA 2QEJC 4CJ1B 4BBSB 2B2UA 4XDXA 5BN5A 2K03A 2PW5A 1GUNA 2F0SA 3OMGA 1Z47A 4QMGA 1TU2B 1KLGD 2EDGA 1ONLA 3VA5A 5I4DA 3T51B 2A73B 3EJIA 1EQVA 1GJXA 2WAQB 3MHBA 4ULLA 2XIWA 4IFDH 1ENAA 3S17B 1HA5A 5CMDA 1QB5D 4V0BA 2WKCA 3P20A 5I2XA 1AEXA 4ZAIA 3VR3A 4NDXA 1PXUA 3SHLA 5ISRA 3U9SA 1PFNA 5C4ZA 4KKSA 5LL6X 2BCOA 3J7YW 3OOCA 4FF3A 4FF1A 5JVH3 2J4XA 4HTHA 1EFID 4IUQA 3HOUB 5C3XA 4ZYSA 2TMPA 1JCKB 5J1ZA 3D4WA 2B2VC 3F2UA 3MFGA 3FPPA 4OGQC 3U9OA 4X3KA 4ZUJA 4KMUC 1X3QA 1CA6A 1JORA 3NWTA 4K6DA 1SNMA 1A3TA 2XN9C 4A3FB 2IX1A 3MC0B 5IGBA 3A7AB 1T5EA 1U9RA 5CYUA 4EQPA 1BCPF 1YNJD 1MD2D 4UDUC 2JA6B 3QJYA 5JVG3 1WD0A 1BCPC 1LTTD 4TRDA 1STEA 1TY0A 2EJMA 2B2WC 4R8NA 5EKLA 4BA1I 4PNYA 3PIP3 3PUZA 1EY0A 1RDPD 2PZWA 3QOJA 3WOEA 1O7ZA 1TS5A 2Z1CA 1IYVA 2F4IA 1MSHA 4B08A 3MVVA 1F2YA 1I6HB 1DD2A 2YYZA 1S5FD 3NTKA 4FNFA 3EA6A 3I73A 3C46A 1JWMD 2B8FA 5C0XJ 4F88A 1RKNA 1RTOA 3BG3A 2VUMB 5KIXA 5I6WA 1GUWA 4DXFA 3NUCA 5CBAE 2KJXA 3A54A 4FF4A 1TIID 1UUPA 5C0XI 3S1RB 5CV4A 4DFAA 5E1FA 3PIO3 4EQNA 1D5ZC 3T16A 3C1EA 1EEFD 3E5SA 1NCVA 2L0CA 2B63B 2EYJA 4N9TA 2EJGC 2O2LD 5C4JB 4WFN3 1CZWA 2Z4HA 3J81E 1XWEA 1O80A 1EWHA 3M85A 2NN6I 1LTBD 4G7HC 2F0KA 2ZT9C 1HUMA 1HCZA 2IPKD 4DA2A 4QUFA 2D5DA 1GUOA 5IGDA 4KI0A 3SR1A 1YNNC 3I4NB 1V1PA 3W2DA 5AFWA 2NZ1D 4K5XA 2Q8RE 2JXMB 5CV7A 1I4HA 3FMCA 1PLFA 4F7XA 4ZKCB 2RVLA 1TWHB 1C48A 4RAUC 2A69D 4C3IG 3KLSA 1F2LA 1S5BD 5F2DA 1I4PA 2B2YC 1U4PA 2RBMA 2FMCA 1BCPD 1RF2D 4IQZA 3NTHA 1U4RA 5T1IA 3I91A 4O42A 1BCPB 4DNRB 1OXVA 1RCVD 5IGEA 2EY5A 5C3WA 5DM73 2R61A 1MSGA 4IN3A 2ZXPA 1J9OA 5CBEE 1I4QA 2DNEA 3A8KE 3S2HB 4O1NA 4K2LA 4C3IB 2R6GA 3DWQA 1DJRD 3BVMA 1TVXA 3FRPB 3N6RA 5DM63 1Z6HA 4OIJA 1PFBA 4YIJA 1EY7A 1K8MA 4KN4C 2XSCA 1R4PB 3NE5B 5I6YA 1EQTA 3IKJA 1ET9A 5CV9A 1H9JA 2FINB 4F87A 2PPBC 2MHVA 5CR3A 5I9OA 1PRTD 3ERQA 4KTAA 4TQUS 1WTQA 5EBDA 1SBBB 2PO4A 3P7JA 1SDFA 5EPKA 4EVOA 3GTLB 3I4LA 3SK6A 3GP7A 2MPMA 1A2TA 4XXEA 1ML0D 3T53B 2QILA 1AW7A 3VYSA 1ENCA 2D2CC 1STGA 3PUVA 1QE6A 3A56A 3R8BA 4G7OC 2FJ2A 1SEBD 4A3MB 2NVTB 4FVMA 3H3VC 2O5JC 2NWGA 4IURA 1HTLD 2EE1A 1EY8A 3CHBD 1F9SA 5A35A 1WTRA 4EQOA 2A6ED 1G2TA 2LMCB 3MFYA 1DM0B 4PMCA 4QUCA 4ZK9B 1OO9B 1TS3A 1EEID 3J80E 3CRLC 2KCNA 1B2TA 3GTQB 3N52A 4G7ZC 1EY6A 5FLXE 5JPMC 5HURA 2K01A 3VR5A 4JK1C 1STYA 1F9QA 3K5NA 3K57A 1IKMA 4XIGS 2HUGA 1I6VC 1DYQA 3RMHA 3QOLA 5C5LA 4WRDA 4CKEA 3T13A 3MWYW 1F2ZA 3FEWX 1GHJA 1ZEQX 3BYYB 5JEAJ 1Y1WB 4NKLA 4RKBA 1U4MA 1SFOB 1IW7C 2F0OA 1EU4A 3IL8A 2KUMA 2CVRA 2DY7A 3BDLA 4A3KB 2HCCA 5T1GA 1H9MA 1CHPD 1KNAA 4CKBA 1LT4D 3LNNA 3GTKB 2F0MA 1M4VA 5CV8A 1KABA 3AU7A 3NP8A 1SNPA 2JSOA 2K6AA 2M2LA 4OIKA 1S5DD 1KDBA 4DK0A 1TQOA 5CV6A 5KNBA 2VB3X 2F0LA 1UEAB 4C56C 1UNSA 1FR3A 5M5YB 2V4DA 3S2DB 2KVMA 2WB1B 1DCZA 2EY2A 3MXNA 5JOBA 5FOBB 1IYUA 1TKWB 2NBFA 3EFXD 1LT3D 4BY1B 4OO1I 3SEBA 3S9WA 1PTOF 2XNAC 4HMJA 1Q12A 5K5PA 2IW3A 2SNMA 3BDCA 3E6ZX 3NPPA 2DNCA 1A6XA 2WIIB 4C3JG 3I4MB 2NVXB 1NSNS 1CFMA 3BZDB 4LAAA 3L7ZC 3OPOA 1QILA 4S3SA 2E76C 3D4RA 4HR7B 1JOQA 1KLUD 2RSNA 1XYIA 3JAML 4Q5VA 4A3GB 5ELEA 1HHVA 4L8JA 1ESRA 3PO3B 2KEDA 1SSOA 1W6JA 3VR2A 3KLSX 2F0HA 4MIUA 3V05A 3ND9A 5A2QE 1BUVT 1LO5D 4C3JB 2SDFA 1I4RA 1JC7A 1QCBD 1WCMB 1RHPA 1STHA 4F8MA 4A3IB 2NVYB 3GD7A 4C1NK 2FFKB 5DNFA 2SOBA 4LK1C 3GO5A 1AP0A 2LFNA 5I2YA 4A93B 2RQXA 1IW7D 1B9MA 4BBRB 4ZLTF 1B1ZA 2B2TA 5EQ0A 2L12A 3IFDA 1WD1A 5BN3A 1VMCA 2HDMA 4QB4A 3LWEA 4KV6A 1I4XA 1LACA 1EZ6A 4CHTB 2O4XA 4DAVA 1TT2A 1WTPA 2IWHA 3ZYYX 4CBVA 4DU9A 2OF1A 2L11A 2A69C 3PUYA 1B50A 3NBIA 3G7LA 1DOMA 1U4LA 5JAVA 4RGOS 4EGVA 1K8OA 2K5QA 4OHJA 2J7ZA 4WORA 2EYPA 1R4QB 4L63B 1FNVA 2WINB 2EOTA 2LY7A 2WACA 5DEHA 3HRZC 2L9HA 3H6MA 3BYTB 2EYHA 1PTOD 1MGSA 5FO7B 4Y7NB 3R3OA 1PTOH 5LL6S 4WJWA 1Y8NB 2RSOA 2RA4A 1PTOB 2XRQD 5EJWA 5IT9E 2JYOA 4A3DB 3DMUA 4HSVA 2E2DC 3X3NA 2SEBD 1ENFA 1JICA 1HTPA 3I90A 1UAPA 4XQNA 3HOZB 4UAIA 2BA1A 1F2MA 1HQRD 2BDOA 2F0DA 1PRTF 3BVZA 3WDNA 1PRTC 2DY8A 1IKLA 3ND8A 4ZKBB 3C2PA 2IL8A 4BA2I 3DHQA 5E4WC 4IUPA 4A3EB 3Q22A 2AQ1B 4PMWA 4AYBB 5EKKA 1A3UA 3SE0A 3C3LA 5M3FB 1NAPA 2K33A 2WKDA 4ZRZA 4KN7C 3TSSA 1ET6A 2AWNA 2K32A 5D65A 2ICEC 4RWSC 1EOTA 5JEAG 3T4AC 5KNDA 2R92B 1ESFA 2QDBA 3O13A 4IFDJ 1H9SB 1W6KA 1EU3A 1II3A 1HFNA 3VR4A 4KHVA 3GTGB 2RDGA 1G6ZA 1CHQD 3D4DA 2SNSA 4FYDA 2A6EC 4IFDI 3MAQA 3H94A 4H13C 3TP6A 3L9AX 3RLFA 5M5WB 3MXGA 4KKUA 5EBCA 1Y69U 1RJTA 1C4QA 3DEOA 2PZUA 3HOYB 1JOKA 3OSOA 3K6OA 5K36G 2XWBB 2B2UC 2K5DA 2KHSA 4K8JA 3P1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K05 A;  1JE4 A;  1HUM A;  2B2U A;  4CJ1 B;  1VMP A;  1B2T A;  2HDM A;  3N52 A;  1E0B A;  4XDX A;  2K03 A;  2K1B A;  4IUU A;  1CA5 A;  2B2V A;  3D6W A;  3H91 A;  3LWE A;  2DY8 A;  1IKL A;  1B53 A;  2KOL A;  3TN2 A;  4ZKB B;  1WD0 A;  2VXW A;  4QUF A;  3TZD A;  1EQT A;  2K01 A;  2MGS A;  3GV6 A;  1LV9 A;  2JP1 A;  2N55 A;  1ILQ A;  2B2W C;  1X32 A;  1WTW A;  2FIN B;  2IL8 A;  4HED A;  2FHT A;  3KUP A;  1CM9 A;  2MP1 A;  5E4W C;  5AFW A;  1B3A A;  1BF4 A;  1O7Z A;  2NZ1 D;  2KEE A;  4IUP A;  2X6G A;  1WTP A;  1A15 A;  2B2W A;  1ROD A;  2K04 A;  4NW2 A;  5D14 A;  2Q8R E;  1F9Q A;  4U68 A;  3GV3 A;  1MSH A;  1HFG A;  1IKM A;  2L11 A;  1WTQ A;  2HUG A;  3FPU B;  1DOK A;  1NAP A;  4LMQ D;  1B50 A;  2XIW A;  4IUT A;  5E4X A;  3SVM A;  1PLF A;  3P7J A;  4ZKC B;  1SDF A;  5EPK A;  1BBX C;  2RVL A;  3G7L A;  5COY A;  5CMD A;  1DOM A;  4HAE A;  3MWY W;  4R8I A;  1U4L A;  4R9W A;  1MI2 A;  2L4N A;  2EPB A;  4RAU C;  4X3S A;  1PFM A;  3UI2 A;  1RTO A;  1ZXT A;  2RSN A;  3MTS A;  1G91 A;  3FDT A;  1XYI A;  1AZP A;  1F9R A;  1U4M A;  2J7Z A;  1F2L A;  2R3Z A;  4X3U A;  3Q6S A;  4ZAI A;  4DN4 M;  1XX8 A;  2X69 A;  1GUW A;  2MPM A;  3HP3 A;  1ILP A;  1HHV A;  3KBX A;  5D65 A;  1HRJ A;  2MJ8 A;  1RTN A;  2B2Y C;  1U4P A;  2K28 A;  1ESR A;  1PFN A;  2NYZ D;  1QNK A;  3I8Z A;  5CBA E;  1WVL A;  1QG7 A;  3IL8 A;  4RWS C;  2D9U A;  1SSO A;  2KED A;  1EIG A;  1EOT A;  2KUM A;  1HUN A;  1U4R A;  2EOT A;  2CVR A;  5T1I A;  1BO0 A;  1EL0 A;  2DY7 A;  3DEP A;  2B2Y A;  4MHE A;  3DM1 A;  2HCC A;  1ML0 D;  2L9H A;  5T1G A;  3R93 A;  1HA6 A;  1KNA A;  1WTX A;  3I91 A;  4O42 A;  1MGS A;  1IL8 A;  5EPJ A;  2HDL A;  1J8I A;  1ICW A;  1O7Y A;  2SDF A;  4MN3 A;  1HFN A;  1RHP A;  1SAP A;  1AZQ A;  1X3P A;  1QE6 A;  1BNZ A;  2RSO A;  2RA4 A;  3I3C A;  1MSG A;  5EJW A;  2JYO A;  2FJ2 A;  4IUQ A;  1J9O A;  5CBE E;  1C8C A;  2BDN A;  2FFK B;  4HSV A;  5DNF A;  1F9P A;  2B2V C;  2N88 A;  4IUV A;  1B4O A;  1WTV A;  1G6Z A;  1M8A A;  5JJZ A;  4HCS A;  1PDQ A;  3F2U A;  1AP0 A;  1Q3L A;  1KNE A;  1NR4 A;  3ONA B;  4XT3 B;  2NWG A;  2L1B A;  4IUR A;  2M2L A;  1NCV A;  2EE1 A;  4OIK A;  2HCI A;  4X3T A;  5EKI A;  2B2T C;  2KEC A;  4X3K A;  1JIC A;  1RJT A;  1F9S A;  5COR A;  1X3Q A;  3DEO A;  1CA6 A;  1TVX A;  2Q8T A;  3I90 A;  1WTO A;  4CJ0 B;  4ZLT F;  2B2T A;  1WTR A;  1G2T A;  3QO2 A;  1DON A;  2X6L A;  1NR2 A;  4RA8 A;  5EQ0 A;  4UAI A;  1DOL A;  1S4Z A;  2L12 A;  3IFD A;  1O80 A;  4CJ2 C;  1WD1 A;  1EIH A;  4OIJ A;  2B2U C;  1PFB A;  2KVM A;  4XT1 B;  4QUC A;  2H1E A;  4ZK9 B;  1VMC A;  1DZ1 A;  5EPL A;  1G2S A;  2FMM A; 
#chains in the Genus database with same CATH topology
 1CA5 A;  4OO1 G;  1STN A;  1LTR D;  1XNQ Q;  2KOL A;  1WOC A;  4KD4 A;  3M7G A;  2QEX A;  3URY A;  3GV6 A;  1E2V A;  2JP1 A;  3GDE A;  3GTJ B;  4DUZ Q;  4RHR A;  1NJI C;  1X6O A;  1SYF A;  3HOW H;  4DK6 C;  3SDZ A;  3AMU A;  1JB3 A;  2BE5 C;  4X65 Q;  1JR0 D;  1Y1V H;  3HFZ B;  2R93 G;  1I94 Q;  3K58 A;  3HOW B;  4G57 A;  1GKH A;  4H0L C;  1E2Z A;  1Y1V B;  2F3W A;  2CKZ B;  1AFP A;  5IWA Q;  2NTT A;  1HNX L;  2EY1 A;  4X64 L;  5COY A;  3PF4 A;  4HJ8 A;  2EPB A;  4EX5 A;  4L6T B;  4X66 Q;  2K5V A;  1G91 A;  1KDC A;  1OXX K;  4JV5 Q;  2R3Z A;  1JB7 A;  2EYF A;  5NUC A;  4BWG B;  5FO9 B;  2EZV A;  4LF5 Q;  4JW0 A;  1K28 A;  2YTV A;  1HUN A;  5E3F A;  2EXZ A;  4G4K A;  2LKV A;  3R93 A;  1G29 1;  1SRO A;  3FHW A;  1PRT B;  2PW7 A;  2IJ0 A;  2R93 B;  1PH5 A;  5C44 G;  3K59 A;  2IY5 B;  1D5M C;  2BA0 A;  4DF7 A;  1CT1 D;  1YIT A;  1KL9 A;  4RFB A;  2N88 A;  1B4O A;  2AQ3 B;  3DWA A;  4HCS A;  4JI2 L;  1Q3L A;  3G4S A;  1TWG B;  4CDC C;  2JA8 G;  2IT1 A;  1PH1 A;  4UY8 C;  3CMA A;  1A63 A;  1N36 L;  1HQM C;  1XXG A;  5JPN C;  3P75 A;  1LTS D;  3FVQ A;  1UE1 A;  2F0G A;  2IHF A;  3C1F A;  1CSP A;  4CDF C;  2UXB L;  2QF7 A;  1VQN A;  5BN4 A;  1A0I A;  5C44 H;  4GNX C;  1N33 L;  2UUC L;  3RUZ A;  3PUW A;  2E2H H;  1KDA A;  1LLR D;  3NSW A;  1PZK D;  1FGU A;  1B44 D;  4R4T A;  2G9H D;  5C44 B;  1VMP A;  1JMC A;  2MO1 A;  2CQO A;  2XTI A;  1CSQ A;  2E2H B;  5KEE A;  1B53 A;  5IY0 A;  2G5D A;  4KY7 A;  2MGS A;  2F0V A;  5IGG A;  3K5L A;  2GVB A;  1HZB A;  3T1H Q;  2Y0S G;  3IFT A;  2JA8 H;  1ILQ A;  3CME A;  3KF6 B;  3OMC A;  2UU9 L;  4LFA L;  1QUQ B;  1BF4 A;  1PH2 A;  1LAB A;  3MXN B;  2B2W A;  4FDB A;  2JA8 B;  1NTG A;  1XMO L;  1T9H A;  3OHX C;  1D1K A;  4JI4 L;  3NBH A;  5M9O A;  4GKK Q;  4TVA B;  4DAP A;  3SVM A;  2MUY A;  3I72 A;  2QW7 A;  1YBY A;  4IUN A;  4LUO A;  4ZQ3 A;  4X6A H;  4R8I A;  4R9W A;  2L4N A;  4X3S A;  1YHB A;  1HNZ Q;  4IAL A;  3MXP A;  1IL2 A;  5D3D A;  1XX8 A;  4JI7 Q;  1HRJ A;  1RTN A;  4E6I A;  2ASB A;  3PIP A;  1QG7 A;  3AEV A;  1EIG A;  1HR0 Q;  4DKA C;  3DEP A;  1BBW A;  1CI3 M;  1A3V A;  3VA7 A;  3LX0 A;  4TKO B;  5G3L F;  2BE5 D;  1QWY A;  2VNU D;  3CQZ B;  4Z9C B;  1J8I A;  1ICW A;  1O7Y A;  4O2D A;  2N78 A;  4HN7 A;  1SAP A;  3IRB A;  4J8Q A;  1X3P A;  1EUJ A;  3NHH A;  3CPW A;  2V1C C;  3A8I E;  1XTD A;  5C6A A;  1F9P A;  4IUV A;  3QG1 A;  5C0X G;  4HCE A;  4BS9 A;  4DV3 Q;  1LT5 D;  3GTK H;  3A8J E;  1FVI A;  5M3M G;  5HGT A;  2RKS A;  4AIM A;  1HZA A;  3EN2 A;  3AQQ A;  5COR A;  4K5V A;  2D0O A;  2Q8T A;  3CD6 A;  1JWS D;  1SE4 A;  3TZU A;  4C2M H;  3NXW A;  3J81 L;  1S4Z A;  2NZO A;  2I5H A;  1BDO A;  2GA4 B;  4JI8 L;  1EYG A;  2ATW A;  4C3H G;  1SMY C;  2H1E A;  4C2M B;  5GAD C;  1XJV A;  1EWC A;  2KA7 A;  3STB D;  4HMI A;  1O78 A;  4IUU A;  3E9H A;  5C0X H;  2JEB I;  3VYT A;  2VXW A;  1VQH A;  2L55 A;  5C3E G;  5DAU A;  4LF7 L;  1LV9 A;  5ELB A;  1CKN B;  2N55 A;  1X32 A;  1WTW A;  2QCP X;  3BZK A;  1H95 A;  3QR8 A;  2NN6 G;  3BDO A;  4WJ4 A;  1SYE A;  4PV1 C;  1UWV A;  4A4I A;  4A3B H;  2F4V L;  1EY5 A;  4C3H H;  2BOS A;  5D3I B;  4DR2 Q;  4A3B B;  3TP8 A;  1PFS A;  1PYW D;  4HAE A;  4A3L G;  4C3H B;  2F3V A;  4H44 C;  5J3B A;  3UI2 A;  4YHH L;  1H9K A;  2YTX A;  4TSS A;  4X3U A;  3M9B A;  4DN4 M;  3I4M H;  2MQH A;  1PTO C;  1T5X D;  3V96 A;  4K14 A;  4B3R Q;  1JJG A;  2NN6 H;  3CCV A;  1AN8 A;  1TR5 A;  2UUB L;  4KK7 A;  3CRK C;  1SMX A;  2B2Y A;  3TP5 A;  3R2I A;  1YJW A;  4R4O A;  2CFM A;  2RCF A;  4DAY A;  1JT8 A;  1OXU A;  2AWO A;  4FXG C;  4KY6 A;  4XYQ A;  2NTS A;  1MJC A;  2J0T D;  3FKI G;  4JI6 L;  1AZQ A;  3CXC A;  1VCI A;  1N34 Q;  3KK7 A;  1BNZ A;  3GTP B;  2M9V A;  4IFD G;  4ZUI A;  4JI5 Q;  3I70 A;  2PMZ E;  3ER0 A;  3F1Z A;  4C1N I;  4M8A A;  4K6L A;  3W1B A;  5LHY 1;  2HT1 A;  1QZH A;  4KKT A;  1VF5 C;  4JC0 A;  3ZJY C;  4IZ8 A;  1KHI A;  2Z6B A;  2CW0 D;  3SK8 A;  4C3J H;  2KQ3 A;  4LJZ C;  1VQI A;  4JI0 Q;  2HHH Q;  1ASZ A;  4CJ0 B;  1SYD A;  4RA8 A;  1NR2 A;  5IOD A;  1X56 A;  2F0T A;  4CJ2 C;  4RGM A;  2XWJ B;  4XQJ A;  1UE7 A;  3FKI H;  5KYI A;  2YV5 A;  1SYC A;  5I9P A;  4A93 H;  1CZG A;  1LTI D;  1O7L A;  1TS2 A;  2PMZ B;  4O0A A;  4R4I A;  3HZX A;  4A75 A;  3FKI B;  1B9N A;  2GVA A;  5G3L D;  5M5X H;  4DR4 Q;  2K1B A;  3RLN A;  4QCL A;  3SK5 A;  4ILW A;  1K83 H;  4DV4 Q;  3OIP A;  4YCW A;  5M5X B;  4DNT B;  2YU9 B;  5FLM G;  5BR8 L;  1K83 B;  5ELO A;  2FHT A;  1CM9 A;  4R1J A;  3ITP A;  1A15 A;  1ROD A;  2K04 A;  2LSS A;  3HGB A;  4GKJ Q;  2IX3 A;  4LWC A;  1JOO A;  2A6H D;  2F0F A;  1LTA D;  1LTG D;  1SJH D;  2H4O A;  1IBM Q;  1U5K A;  4LMQ D;  4DXG A;  4YCU A;  4IUT A;  5E4X A;  2PI2 E;  4L5Q A;  2OCE A;  3NTI A;  3T56 B;  1VQJ A;  3KJO A;  1GUT A;  5IIF A;  2G9D A;  1GUS A;  1V1O A;  2XGT A;  2LXJ A;  1NUC A;  1SMY D;  3OW7 A;  3TP7 A;  2RDF A;  3QIA A;  3A7L A;  2NUC A;  2UXD Q;  2HQE A;  3BZC A;  1ILP A;  3I8Z A;  2I5M X;  1PA6 A;  1SJE D;  1V43 A;  3KFU A;  2B3G A;  4ODG A;  1FYC A;  3E0E A;  2ZXR A;  1BO0 A;  1TWC H;  1XTC D;  2KCC A;  1Q86 C;  1L1O A;  4B3S L;  1IL8 A;  1V1P B;  3S15 B;  1TWC B;  3RN5 A;  2ZM6 L;  1HZ9 A;  1OXT A;  4P2C B;  1Q1E A;  5AJ3 L;  4JYA Q;  1E24 A;  4B3T Q;  2ZXO A;  5L37 A;  1D7Q A;  3TEH B;  1X3F A;  1C8C A;  4UP8 A;  2LS0 1;  1SE3 A;  1WTV A;  5JJZ A;  1NMG A;  1PDQ A;  3PO2 G;  1SNC A;  3J7A F;  4JBW A;  2L1B A;  2A74 C;  4KJN A;  4A3C G;  4JI1 L;  4DK1 A;  3HG9 A;  2L5T A;  1SE2 A;  3NQT A;  4Q0F A;  3DUZ A;  1SNO A;  2F3I A;  2B39 A;  3UDX A;  1CQV A;  2Z6K C;  2UXC Q;  2DN8 A;  1DON A;  1I3Q H;  2UUA Q;  4BY7 G;  1KXL A;  3NEL A;  2M00 A;  1Y8O B;  5CGK A;  3CC4 A;  3DWP A;  5IOC A;  4XT1 B;  2OEO A;  1IZ6 A;  4CDD C;  1I3Q B;  3TQY A;  1D5X C;  3J80 L;  2EY6 A;  3K8A A;  1G2S A;  4HIK A;  1JE4 A;  3HEJ A;  5C4X G;  5FLX L;  1I5F A;  3S1M H;  2KCM A;  1PVO A;  3R2T A;  2E8G A;  1GUG A;  4ID6 A;  2FXQ A;  4XYO A;  2PNH A;  1IHZ A;  3J7A V;  3PO2 B;  4HED A;  3S1M B;  3L3O C;  3NQI A;  5KRU A;  3QB3 A;  4LUZ A;  1IBK L;  4LF6 L;  1EY4 A;  1OXS C;  3AFQ A;  4DGZ A;  2X6G A;  5J39 A;  2R7D A;  1JQY D;  1Q90 A;  1BKB A;  1QVG A;  4BY7 H;  2VS1 A;  4KD3 A;  1PZI D;  1JJ2 A;  3FPU B;  4GN5 A;  1GOZ A;  1QJO A;  2NB0 A;  1Q46 A;  2EQS A;  4BY7 B;  3FP9 A;  4K0K L;  4FXD A;  5C4X H;  1VQF A;  5IYD H;  1SNQ A;  2DGY A;  3TDQ A;  1GHK A;  1WYD A;  3FDT A;  2JEA I;  1AZP A;  1ZYR C;  5C4X B;  1EYA A;  1NY4 A;  2BH8 A;  2D0P A;  3EQL C;  3HP3 A;  3KBX A;  5M3F H;  3WOF A;  3PGZ A;  2NYZ D;  3G6E A;  3I4N G;  1IBL Q;  2OT2 A;  2PQE A;  3K5O A;  1S5E D;  4MHE A;  1VF7 A;  3PUX A;  1R9T B;  1HA6 A;  3HS0 C;  3OTO Q;  3A55 A;  5EPJ A;  3KLR A;  2HDL A;  3MXU A;  2H5X A;  3OIQ A;  4QF4 A;  3RNU A;  1A62 A;  1D2B A;  3E0J A;  3H15 A;  4YWL A;  2AUJ D;  2JQO A;  3H3V I;  4QY7 A;  4NXM L;  5J22 A;  3BS1 A;  2BDN A;  2JA7 G;  4LUV A;  1FGB D;  2F0E A;  1V8Q A;  3I2Z A;  3G48 A;  3HOX G;  1NR4 A;  3ONA B;  1I4G A;  2HCI A;  1QVF A;  3OWF A;  3V2T A;  3M7N A;  1IXR A;  1C7Y A;  2K5H A;  2AMC B;  1JWU D;  1Y8P B;  1WTO A;  3G6J B;  3NEN A;  2ZJQ A;  5LMU Q;  4LF4 Q;  3LWU A;  1EIH A;  1D1I A;  5CC4 A;  4P75 A;  4OX9 Q;  3S16 H;  5IGF A;  2A68 C;  2FMM A;  4FF2 A;  2ENB A;  1BQQ T;  1BXT A;  2JA7 H;  4M1U B;  3TME A;  1STB A;  3K0X A;  3S16 B;  3HOY H;  5JEA H;  3HOX H;  2XRS D;  2JA7 B;  2HD3 A;  2IX0 A;  5KNC A;  4FO2 A;  1MHW C;  1KD1 C;  2Z4I A;  5FKA C;  3G71 A;  1J5E L;  2Q2U A;  3RZO H;  3HOX B;  1KTK A;  2MP1 A;  1HXY D;  1S72 A;  2PCF B;  1YI2 A;  4K8I A;  1Z7T A;  3RZO B;  4I7A A;  1Y14 B;  5ELC A;  3HKZ B;  1HPC A;  5ELD A;  3W3A A;  5FK9 C;  2E2J H;  3H09 A;  1E2W A;  2F03 A;  2F0W A;  3GTJ H;  3KLW A;  3BVG A;  1OTC A;  3UDF A;  4DV0 L;  2E2J B;  3BJU A;  3X3M A;  1F9R A;  3JAM E;  4I7Z C;  5KYL A;  1SYB A;  2F0P A;  2CWA A;  3NBH B;  4K2K A;  2K28 A;  5K36 H;  1G51 A;  1PZJ D;  2D9U A;  1FL0 A;  1EQR A;  2ID0 A;  2AUK A;  4HSP A;  4A3J G;  4RGN A;  3DM1 A;  2TSS A;  1RL2 A;  2I5L X;  4UHV A;  2ZTE A;  3K7A H;  5A2Q L;  1FJG Q;  2JE6 I;  4CGY B;  3L2P A;  4MN3 A;  1X55 A;  4OO1 H;  3TBI B;  1EY9 A;  2E2I H;  2BH2 A;  3K7A B;  2F0Q A;  5ELF A;  3CU7 A;  2AHO B;  4KHP Q;  1BOS A;  4GLV B;  5HGQ A;  2E2I B;  4HID A;  1PMR A;  2PZT A;  4RH6 A;  1HR0 W;  3K5M A;  1QNU A;  2F1M A;  3HOU B;  2F0N A;  4XT3 B;  5KGU A;  2R93 H;  1BR9 A;  2DJF C;  4PQX A;  3PMF A;  1SYG A;  1ZYR D;  2D62 A;  3MA2 B;  5TSS A;  2B2T C;  1PH4 A;  2L15 A;  4A3J H;  1STA A;  2A5H A;  3VYU A;  4RCO A;  3JAM c;  3GQB A;  4K5W A;  3STB C;  3A5Z B;  4HJ5 A;  4A3J B;  1XMQ Q;  3L0O A;  4DR3 Q;  4DV1 Q;  3MEH A;  1ZKO A;  1TWG H;  4JG2 A;  5C5M A;  2VQF L;  4LF8 L;  1DZ1 A;  4PZ6 A;  3GTO B;  1FNW A;  4H7B A;  4NXN L;  4PMB A;  3EVQ A;  1HNW L;  4JI3 Q;  2B2V A;  3D6W A;  4CKC A;  4B9W A;  2RHS B;  3TZD A;  1MBY A;  4DR6 L;  3SXH A;  1I50 H;  3GTM H;  3ERO A;  3H0G G;  2F0I A;  4DR5 Q;  3A74 A;  1H9S A;  1B3A A;  1V1Q A;  2WV6 D;  1I50 B;  4KY5 A;  4RG1 A;  1Q1B A;  5D14 A;  3GTM B;  1V9P A;  1QOH A;  1XPR A;  3GV3 A;  4GOP A;  2E74 C;  3Q24 A;  4LFC L;  2K7V A;  1YNN D;  4NMZ A;  2NZH A;  1EYD A;  1BBX C;  3K7U C;  2VQE Q;  5EGT A;  1MI2 A;  1LT6 D;  1EYC A;  2RCN A;  1PFM A;  1NBW A;  3KDF A;  1S40 A;  1KIX A;  1YHA A;  2A68 D;  2P5Z X;  1X3E A;  4N9P A;  4GLX A;  1TWA B;  3NWS A;  3OYY A;  1TWF H;  1SND A;  4FP5 D;  1BVS A;  2MJ8 A;  4J15 A;  3PV0 A;  2Y0S E;  4ME5 A;  3D3R A;  1TWF B;  3H0G B;  1EL0 A;  2QGQ A;  2I07 B;  4XQQ A;  4N8F A;  3T1Y L;  2OTJ A;  1E1O A;  1H9R A;  3UE0 A;  1HNX Q;  5IGC A;  3RZD H;  2I0Q A;  3CPF A;  1G8Z D;  4X64 Q;  1TS4 A;  3CKI B;  2CW0 C;  2EYL A;  4IJH A;  3MZ5 A;  3M4Y A;  3RZD B;  5IT9 L;  3HOV G;  3K0Y A;  2JA5 G;  4DR2 L;  2EJF C;  1F77 A;  3KF8 A;  3I4O A;  3CAM A;  2AQ2 B;  2K4K A;  1M8A A;  3EBE A;  1CK1 A;  4GZY C;  2Y0S B;  1S5C D;  4DAY B;  3QWN A;  3S1N H;  5FO8 B;  3VR6 A;  2PNR C;  3CQZ H;  4X3T A;  5EKI A;  2PYK A;  3D31 A;  4DV7 L;  1A2U A;  2K5W A;  3VYR A;  4V19 0;  2EYM A;  3S1N B;  2QKI C;  4KHZ A;  1UE5 A;  4R4C A;  4RCN A;  3QO2 A;  4GN4 B;  2X6L A;  4LFB L;  1DOL A;  2F0J A;  4NB3 A;  3AB9 A;  1FNU A;  1RD9 D;  2C5C A;  4P74 A;  1D6E C;  1VQO A;  2C9O A;  5EPL A;  4UP7 A;  4U68 A;  2K05 A;  3HOV H;  2JA5 H;  2DJG C;  4N8X 1;  1E0B A;  4DPG A;  1CQF A;  5C4H A;  3H91 A;  3TN2 A;  4JI2 Q;  4RHS A;  3HOV B;  2JA5 B;  2A6H C;  5CV5 A;  1K0R A;  2EYO A;  3A0J A;  4I65 A;  1N32 L;  4JPB W;  3KUP A;  4DV2 L;  1N36 Q;  3DXJ C;  2KEE A;  1TY2 A;  4NW2 A;  4J6H A;  3CCM A;  3I55 A;  1HFG A;  1KAA A;  2O5I C;  2ICI A;  4B9X A;  2UXB Q;  2R7Z G;  4RGT A;  4YWK A;  4DR1 L;  1DOK A;  2I46 A;  2ZJP A;  1N33 Q;  2UUC Q;  4KJO A;  1KAW A;  2E75 C;  1GXD C;  3D6C A;  4XTC S;  1ZXT A;  5M3M H;  1B70 B;  1VDZ A;  5GAE C;  3MTS A;  4QIW E;  4OL7 A;  1YNX A;  2Z8L A;  2OXP A;  3Q6S A;  2X69 A;  1UEB A;  5M3M B;  1E22 A;  1SXT A;  2CQA A;  1WVL A;  1QNK A;  4LFA Q;  2UU9 Q;  3S14 B;  1XPU A;  1EZ8 A;  1XMO Q;  3S1Q H;  4U67 3;  2VZA A;  1YJ9 A;  3J81 i;  4APV A;  1WTX A;  2RDH A;  4JI4 Q;  2B8G A;  3KBG A;  3UE1 A;  4RKL A;  3OWE B;  3NK9 A;  3S1Q B;  1YNJ C;  4BBS G;  1AE3 A;  3SK4 A;  2R7Z B;  1K9M C;  2NVQ B;  3Q0A A;  1DXM A;  4QIW B;  1L0X B;  1L0Y B;  3I3C A;  5C3E H;  1VQ7 A;  2CHB D;  3D8G A;  3M4O B;  2VB2 X;  4J1M A;  1Q8I A;  1L1O B;  5C3E B;  4R4Q A;  1KNE A;  1CTM A;  1FD7 D;  3M3Y H;  3RD4 A;  3Q23 A;  4IOC A;  2KEC A;  4P71 A;  3PO3 G;  3W1G A;  4JBK A;  2K5N A;  2WAQ G;  1K73 C;  3M3Y B;  3GTP H;  2WP8 J;  4JOI A;  4NP5 A;  4FXK C;  2VL6 A;  2XVS A;  4A3L H;  3ERS X;  2Q8I B;  2WAQ E;  3IAY A;  4UP9 A;  2EVB A;  3JC6 6;  2F0U A;  4ABN A;  1WCM G;  3PQI A;  2QEJ C;  1A8V A;  1XPO A;  4CJ1 B;  4BBS B;  2B2U A;  4XDX A;  1X65 A;  1EWI A;  2K03 A;  5BN5 A;  2PW5 A;  1GUN A;  2F0S A;  3OMG A;  1Z47 A;  4QMG A;  4OEL B;  1P8L A;  1TU2 B;  3OW2 A;  1KLG D;  1YIJ A;  2EDG A;  1ONL A;  1X9N A;  3VA5 A;  2JJQ A;  5I4D A;  3T51 B;  2A73 B;  3EJI A;  1EQV A;  4WJ3 M;  1GJX A;  3CC2 A;  2WAQ B;  3S17 H;  3MHB A;  4ULL A;  4JI8 Q;  2XIW A;  4IFD H;  2F52 A;  1ENA A;  3J81 j;  4DAM A;  3S17 B;  1HA5 A;  5CMD A;  2YU9 H;  3HOU G;  5IE8 A;  1MKH A;  3KOJ A;  1QB5 D;  4V0B A;  3U50 C;  2ES2 A;  2GN5 A;  2WKC A;  3P20 A;  5I2X A;  1AEX A;  5LMN W;  4ZAI A;  3VR3 A;  4NDX A;  1PXU A;  4LF7 Q;  3K81 C;  3SHL A;  5IYC G;  3LGJ A;  5ISR A;  1G6P A;  2PQA B;  3TS0 A;  3U9S A;  1PFN A;  4AQY L;  5C4Z A;  4A3F G;  4KKS A;  5LL6 X;  2BCO A;  2A8V A;  4DR7 L;  1LUZ A;  3J7Y W;  2F4V Q;  3OOC A;  4FF3 A;  3CCQ A;  5LMN L;  5JJL A;  4QGU A;  4FF1 A;  5JVH 3;  3U4Z A;  2J4X A;  3HOU H;  4GLA C;  4HTH A;  2JA6 G;  4JVZ A;  1EFI D;  4YHH Q;  2ALY B;  4IUQ A;  5C3X A;  4ZYS A;  2TMP A;  1JCK B;  5J1Z A;  3D4W A;  3EIV A;  2B2V C;  1KRT A;  5FLM H;  1C0A A;  3F2U A;  2ZTC A;  3MFG A;  3FPP A;  4OGQ C;  3S15 H;  4A3F H;  2UUB Q;  4B3M L;  3U9O A;  4X3K A;  4ZUJ A;  4KMU C;  1X3Q A;  1CA6 A;  1JOR A;  3NWT A;  4K6D A;  1SNM A;  1A3T A;  2XN9 C;  4A3F B;  2K52 A;  4DUY L;  2IX1 A;  1C9O A;  3MC0 B;  5IGB A;  3A7A B;  1T5E A;  1U9R A;  4JI6 Q;  5CYU A;  4X62 L;  2VY3 A;  2E5L L;  1L0W A;  2JA6 H;  1VQL A;  3WWV A;  4EQP A;  4GNX A;  1BCP F;  1YNJ D;  2VUM G;  2AKW B;  2RF4 A;  2WFW A;  5ELN A;  4DV5 L;  1MD2 D;  4UDU C;  2JA6 B;  3QJY A;  5JVG 3;  1WD0 A;  1BCP C;  1LTT D;  4OXP A;  4TRD A;  1STE A;  1YHQ A;  1TY0 A;  2EJM A;  2YTY A;  2B2W C;  4R8N A;  5EKL A;  4BA1 I;  4PNY A;  3PIP 3;  3PUZ A;  1EY0 A;  1RDP D;  2PZW A;  3QOJ A;  3WOE A;  4YY3 L;  1O7Z A;  1TS5 A;  4DV6 L;  3F2C A;  2Z1C A;  1IYV A;  4Y52 H;  2Q2T A;  5H1S E;  4OWW B;  2F4I A;  1MSH A;  4B08 A;  3MVV A;  1F2Y A;  3HOZ G;  1I6H B;  3VDY A;  2VW9 A;  1DD2 A;  2YYZ A;  1S5F D;  3NTK A;  4FNF A;  4LF4 L;  4KLK A;  3EA6 A;  3CCE A;  3I73 A;  3C46 A;  1TXY A;  1JWM D;  2EXD A;  2VUM H;  3PO2 H;  1SR3 A;  2B8F A;  5C0X J;  1UE6 A;  4F88 A;  1RKN A;  1RTO A;  3E9I A;  4HJA A;  1XNR L;  3BG3 A;  1AH9 A;  4A3C H;  3TRZ A;  2B63 G;  2VUM B;  5KIX A;  5I6W A;  1GUW A;  5BR8 Q;  2Q2I A;  4DXF A;  3NUC A;  5CBA E;  3S1R H;  2KJX A;  3A54 A;  1VQ4 A;  4FF4 A;  1TII D;  1UUP A;  5C0X I;  5GAG C;  3S1R B;  5CV4 A;  4LF9 L;  4DFA A;  3J80 i;  1K0S A;  5E1F A;  4OWX B;  1XMQ L;  3PIO 3;  4QL5 A;  4EQN A;  1D5Z C;  3PF5 A;  1R9T H;  2B63 H;  3CCU A;  1XNQ L;  1EFW A;  3T16 A;  3C1E A;  1EEF D;  5C4J H;  3E5S A;  1NCV A;  2L0C A;  2B63 B;  4DUZ L;  1EIY B;  4AH6 A;  2EYJ A;  4N9T A;  2EJG C;  2O2L D;  4ALP A;  5C4J B;  4WFN 3;  4X65 L;  2C35 B;  2R92 G;  1CZW A;  1I94 L;  2KHJ A;  2Z4H A;  4B3S Q;  1AE2 A;  2HQL A;  3J81 E;  3CCR A;  1XWE A;  1O80 A;  2ZM6 Q;  1EWH A;  3M85 A;  2NN6 I;  1LTB D;  5IWA L;  5AJ3 Q;  4G7H C;  2F0K A;  5E7N A;  2ZT9 C;  1HUM A;  1ICF B;  4X66 L;  1HCZ A;  3I4N H;  2IPK D;  4DA2 A;  4QUF A;  4JV5 L;  2D5D A;  1GUO A;  4P72 A;  5IGD A;  4KI0 A;  4JI1 Q;  3SR1 A;  1YNN C;  3I4N B;  1V1P A;  3W2D A;  4LF5 L;  5AFW A;  2NZ1 D;  4K5X A;  1M90 C;  2Q8R E;  1CUK A;  1LM0 A;  1VQG A;  3J7Z C;  2JXM B;  5CV7 A;  1I4H A;  1VQA A;  2OTL A;  1WFQ A;  3FMC A;  3ULP A;  1PLF A;  4F7X A;  4ZKC B;  3BU2 A;  2RVL A;  1TWH B;  1B3Q A;  3F2D A;  1C48 A;  1VQB A;  4RAU C;  4DV1 L;  3J81 c;  3J7A 5;  2A69 D;  4C3I G;  1HZC A;  3KLS A;  4GOP B;  1F2L A;  1S5B D;  3HKS A;  5F2D A;  1I4P A;  2CCZ A;  4QJF A;  4JBM A;  2B2Y C;  1U4P A;  1IBK Q;  2RBM A;  2FMC A;  1BCP D;  1RF2 D;  4LF6 Q;  4IQZ A;  3NTH A;  1U4R A;  4LW1 A;  5T1I A;  2K75 A;  3A5U A;  4LNQ A;  3HOW G;  4IO9 A;  3I91 A;  4O42 A;  2ZJR A;  4MNO A;  1BCP B;  4JCV E;  4DNR B;  3CW2 C;  1OXV A;  1RCV D;  1Y1V G;  2EY5 A;  5IGE A;  1HH2 P;  4H02 A;  5C3W A;  5DM7 3;  4K0K Q;  2R61 A;  3S2H H;  1MSG A;  4JBJ A;  2IHE A;  3E3X A;  4IN3 A;  2ZXP A;  1J9O A;  5CBE E;  4C3I H;  1I4Q A;  2DNE A;  4IPG A;  3A8K E;  3S2H B;  1N9W A;  3CP0 A;  4O1N A;  4K2L A;  4OWT B;  5GQO A;  4C3I B;  3T1H L;  2MFI A;  2N8N A;  5JJI A;  2R6G A;  3DWQ A;  1DJR D;  2JN4 A;  3BVM A;  1TVX A;  1VS0 A;  3FRP B;  1W2B A;  3N6R A;  3KF8 B;  5DM6 3;  1Z6H A;  4GKK L;  4OIJ A;  4MTN A;  1PFB A;  4POG A;  3D0F A;  4YIJ A;  1EY7 A;  1K8M A;  3K80 C;  3MEF A;  4KN4 C;  4HJ7 A;  4NXM Q;  2XSC A;  1PYB A;  1R4P B;  2CH4 W;  3NE5 B;  4PG3 A;  1HNZ L;  5I6Y A;  1EQT A;  3IKJ A;  3TS2 A;  3CCS A;  3U58 A;  1GVP A;  1ET9 A;  5CV9 A;  4JI7 L;  1H9J A;  2FIN B;  4F87 A;  2KHI A;  2PPB C;  2MHV A;  5CR3 A;  1Q81 C;  3GTO H;  5I9O A;  1HR0 L;  1PRT D;  3ERQ A;  4KTA A;  4TQU S;  1WTQ A;  3GTL H;  2MO0 A;  4CDE C;  5EBD A;  1SBB B;  2PO4 A;  3U4V A;  3P7J A;  1SDF A;  5EPK A;  4EVO A;  3GTL B;  1LYL A;  4A3M G;  3I4L A;  3SK6 A;  1W3S A;  3GP7 A;  2JA9 A;  2MPM A;  4DV3 L;  4RMF A;  1J5E Q;  3ICE A;  1L1O C;  1N8R C;  4IPH A;  1EQQ A;  1A2T A;  3KYH C;  4XXE A;  1GD7 A;  1ML0 D;  3T53 B;  5IP9 G;  2QIL A;  1AW7 A;  3VYS A;  1ENC A;  1TWA H;  1YEZ A;  1Z9F A;  2D2C C;  1STG A;  4A3M H;  2NVT H;  3PUV A;  1QE6 A;  4DV0 Q;  3A56 A;  3R8B A;  4G7O C;  2FJ2 A;  3H0G H;  1SEB D;  4A3M B;  2NVT B;  4FVM A;  1VQ8 A;  4IPD A;  1GM5 A;  3H3V C;  2O5J C;  1QVC A;  4ME3 A;  2NWG A;  4IUR A;  1HTL D;  2EE1 A;  1YVC A;  1EY8 A;  3CHB D;  1F9S A;  5A35 A;  5IP9 H;  1WTR A;  4EQO A;  2A6E D;  1G2T A;  2LMC B;  3MFY A;  1DM0 B;  1IYJ B;  4PMC A;  4YCV A;  1HJP A;  4HIO A;  3F2B A;  2Z6K A;  3GTQ H;  4QUC A;  4ZK9 B;  1OO9 B;  1VQD A;  1TS3 A;  1EEI D;  3J80 E;  3CRL C;  1Y1W G;  2KCN A;  4QQB X;  5JJK A;  2CWP A;  1B2T A;  3GTQ B;  4A76 A;  3N52 A;  4G7Z C;  1EY6 A;  5EAY A;  5FLX E;  5JPM C;  1CKO A;  3AFP A;  5HUR A;  2K01 A;  1VQE A;  3VR5 A;  4JK1 C;  1B8A A;  4B3R L;  4GN3 B;  1STY A;  1SRU A;  4A3K G;  1J6Q A;  1F9Q A;  5DLQ E;  3K5N A;  3K57 A;  1IKM A;  4XIG S;  1GO3 E;  1I6V C;  1DYQ A;  2HUG A;  2JK8 A;  1NMF A;  3RMH A;  2OQK A;  3QOL A;  2N3S A;  5C5L A;  4WRD A;  2VQF Q;  4LF8 Q;  1Y1W H;  3I7F A;  5HY6 A;  4CKE A;  3T13 A;  3MWY W;  4NXN Q;  1N34 L;  1F2Z A;  2LXK A;  3FEW X;  1VQM A;  1SFO H;  1MIU A;  1HNW Q;  1GHJ A;  1ZEQ X;  3BYY B;  5JEA J;  1Y1W B;  4NKL A;  4JI5 L;  4RKB A;  4L5T A;  1U4M A;  4DR6 Q;  4BXX G;  1SFO B;  1IW7 C;  4A3K H;  3J80 c;  1PHJ A;  2F0O A;  1EU4 A;  3IL8 A;  2KUM A;  2CVR A;  5FLX c;  2DY7 A;  3BDL A;  4A3K B;  4JI0 L;  2HCC A;  2HHH L;  5T1G A;  1H9M A;  1CHP D;  1KNA A;  4CKB A;  1LT4 D;  2WB1 G;  4LFC Q;  1PH7 A;  3LNN A;  3GTK B;  1LTL A;  2F0M A;  1M4V A;  1NE3 A;  5CV8 A;  1KAB A;  4A3B G;  3AU7 A;  3NP8 A;  1EOV A;  3S14 H;  2WB1 E;  1KRS A;  1SNP A;  2JSO A;  4BY1 G;  2K6A A;  4OEM B;  4DR4 L;  4BXX H;  1P16 A;  4DV4 L;  2HIX A;  2M2L A;  4OIK A;  3PIO A;  1S5D D;  2MNA A;  1KDB A;  2R7Z H;  3I4M G;  2NVQ H;  4DK0 A;  5M5Y H;  1TQO A;  2K50 A;  5CV6 A;  3S2D H;  4GKJ L;  5KNB A;  2VB3 X;  2F0L A;  3M4O H;  1UEA B;  3T1Y Q;  4C56 C;  2OWO A;  1UNS A;  1YZ6 A;  1FR3 A;  5M5Y B;  1IBM L;  2V4D A;  3KF6 A;  3S2D B;  2KVM A;  2WB1 B;  1DCZ A;  3RR5 A;  1QUQ A;  2EY2 A;  3MXN A;  5JOB A;  1Q82 C;  4BY1 H;  3DLL A;  4A3G G;  5FOB B;  1IYU A;  1TKW B;  2B29 A;  2NBF A;  3EFX D;  1WI5 A;  1LT3 D;  4BY1 B;  1VQ9 A;  4OO1 I;  3SEB A;  3S9W A;  2UXD L;  1PTO F;  2XNA C;  4HMJ A;  4DV7 Q;  1SLJ A;  1Q12 A;  5K5P A;  2IW3 A;  2SNM A;  2Z0S A;  3BDC A;  3E6Z X;  2DNC A;  3NPP A;  1VQK A;  2NVX H;  1A6X A;  4L5S A;  4GNX B;  4BBS H;  3H3V H;  1PV4 A;  2WII B;  4C3J G;  4LFB Q;  3I4M B;  2NVX B;  1NSN S;  2A1A A;  1CFM A;  3BZD B;  4A3I G;  1Q7Y C;  4LAA A;  3DM3 A;  3L7Z C;  3OPO A;  1QIL A;  4S3S A;  4JYA L;  2E76 C;  4A3G H;  1PYS B;  3D4R A;  4B3T L;  1NNX A;  4HR7 B;  1JOQ A;  1KLU D;  2RSN A;  1K8G A;  1XYI A;  3W5O A;  3JAM L;  3PO3 H;  4A93 G;  4Q5V A;  4A3G B;  5ELE A;  1HHV A;  4L8J A;  3PCO B;  1N32 Q;  1ESR A;  5IP7 G;  4DV2 Q;  2A19 A;  4BBR G;  3PO3 B;  2KED A;  1SSO A;  2KCT A;  1O7I A;  1W6J A;  1WCM H;  1PH9 A;  2UXC L;  3VR2 A;  3KLS X;  4DR1 Q;  4IJL A;  1Q8K A;  1E3P A;  2F0H A;  2EIF A;  4MIU A;  3ND9 A;  4ZCK A;  3V05 A;  5A2Q E;  4A3I H;  2UUA L;  1BUV T;  1LO5 D;  2NVY H;  4C3J B;  2SDF A;  1I4R A;  1JC7 A;  1QCB D;  1WCM B;  1RHP A;  1STH A;  4F8M A;  1DGS A;  4A3I B;  2NVY B;  1SE8 A;  3GD7 A;  4C1N K;  2FFK B;  5DNF A;  2SOB A;  1E7Z A;  4LK1 C;  3TRE A;  3GO5 A;  1M1K C;  1AP0 A;  2Q2H A;  3JAM i;  2LFN A;  5I2Y A;  5IP7 H;  4BBR H;  4DNI A;  4A93 B;  4IPC A;  2RQX A;  1IW7 D;  4MZ9 A;  1B9M A;  4BBR B;  4ZLT F;  1B1Z A;  2B2T A;  1PH6 A;  5EQ0 A;  3AYH B;  1B7Y B;  3B6Y A;  1CKN A;  2L12 A;  3IFD A;  1S3O A;  1WD1 A;  5BN3 A;  2R7F A;  1K3R A;  1VMC A;  1WTH A;  5FJ8 G;  2DUD A;  4IOA A;  5IYC H;  2HDM A;  4QB4 A;  3UDG A;  3LWE A;  4POF A;  5IYB G;  1SN8 A;  1WJJ A;  4KV6 A;  1I4X A;  1LAC A;  3CCL A;  1EZ6 A;  4CHT B;  4GOP C;  2O4X A;  4DAV A;  1IBL L;  1TT2 A;  1WTP A;  2IWH A;  3ZYY X;  4CBV A;  4DU9 A;  3CF5 A;  2OF1 A;  1CKM A;  2L11 A;  3OTO L;  2A69 C;  3SGI A;  3Q8D A;  4L5R C;  3PUY A;  1B50 A;  3NBI A;  3G7L A;  5FJ8 H;  4A3D G;  4GS3 A;  1DOM A;  1EIF A;  1U4L A;  2KEN A;  5JAV A;  4RGO S;  5IYB H;  4EGV A;  1K8O A;  2K5Q A;  4OHJ A;  1JE5 A;  2J7Z A;  1X54 A;  1D8L A;  4WOR A;  2EYP A;  1VQ6 A;  1I6H H;  1R4Q B;  4L63 B;  1FNV A;  2WIN B;  1K8A C;  3ULL A;  2EOT A;  2LY7 A;  2WAC A;  4Y7N H;  5DEH A;  3HRZ C;  2L9H A;  3H6M A;  3PSI A;  3BYT B;  2QA4 A;  2EYH A;  5GRO A;  1K3B C;  1PTO D;  3CCJ A;  5LMU L;  1MGS A;  5FO7 B;  4Y7N B;  3R3O A;  1PTO H;  3M4Q A;  4A3D H;  3KJP A;  5LL6 S;  4WJW A;  1Y8N B;  4OX9 L;  2RSO A;  2RA4 A;  1VQ5 A;  1PH3 A;  1PTO B;  2XRQ D;  5EJW A;  5IT9 E;  2JYO A;  4YWM A;  4A3D B;  3DMU A;  4HSV A;  1VQC A;  2E2D C;  1RIP A;  1MJE A;  3X3N A;  2SEB D;  3ULJ A;  5IYD G;  2Z9H A;  3RN2 A;  4AQY Q;  4A3E G;  1KQS A;  4AYB G;  3HOZ H;  1ENF A;  1JIC A;  4UPA A;  1HTP A;  4DR7 Q;  5M3F G;  3I90 A;  5GAH C;  4MTK A;  1UAP A;  4XQN A;  5LMN Q;  3HOZ B;  4UAI A;  1ASY A;  4AYB E;  2BA1 A;  1F2M A;  1X3G A;  1HQR D;  2BDO A;  2PQA A;  2F0D A;  1PRT F;  3BVZ A;  3I56 A;  3WDN A;  4HIM A;  1KC8 C;  1PRT C;  2DY8 A;  1IKL A;  3ND8 A;  4ZKB B;  4P73 A;  3C2P A;  4A3E H;  4B3M Q;  2IL8 A;  4BA2 I;  5IT9 c;  4HJ9 A;  3DHQ A;  5E4W C;  1L2F A;  4IUP A;  2HIV A;  4A3E B;  3Q22 A;  2AQ1 B;  4EQ5 A;  3CC7 A;  4PMW A;  4AYB B;  5EKK A;  4DUY Q;  1A3U A;  3SE0 A;  3C3L A;  5M3F B;  1NAP A;  2K33 A;  4PZ8 A;  4OON A;  4X62 Q;  1FJG L;  2E5L Q;  2WKD A;  4ZRZ A;  2CH4 A;  3UDI A;  4KN7 C;  3TSS A;  3F8T A;  4DV5 Q;  4KHP L;  2PI2 A;  1ET6 A;  2RHQ B;  3RLO A;  2AWN A;  1BBU A;  2K32 A;  5D65 A;  2R92 H;  2ICE C;  4RWS C;  2VQE L;  4YY3 Q;  3HOY G;  1EOT A;  5JEA G;  4DV6 Q;  3T4A C;  1TWH H;  5KND A;  2R92 B;  1ESF A;  2QDB A;  3O13 A;  1QZG A;  2N49 A;  4IFD J;  3HKZ G;  2K14 A;  1H9S B;  1W6K A;  4DR3 L;  2KBN A;  3GTG H;  1EU3 A;  1II3 A;  4PZ7 A;  1HFN A;  3S24 A;  3VR4 A;  1JJC B;  2OQ0 A;  1XNR Q;  3HKZ E;  3M4P A;  4KHV A;  1E1T A;  2ZTD A;  2RDG A;  3GTG B;  1G6Z A;  4JI3 L;  5M5W H;  2QDL A;  1CHQ D;  3D4D A;  2SNS A;  4FYD A;  2A6E C;  4IFD I;  3MAQ A;  3H94 A;  4H13 C;  3TP6 A;  1VQP A;  3L9A X;  3RLF A;  5M5W B;  3MXG A;  4KKU A;  3NEM A;  5EBC A;  4JOI C;  4DR5 L;  3KDF B;  4NPS A;  1Y69 U;  1RJT A;  1C4Q A;  3DEO A;  2PZU A;  3HOY B;  1U0L A;  1JOK A;  4LF9 Q;  3OSO A;  3K6O A;  5K36 G;  1PH8 A;  2XWB B;  2B2U C;  2K5D A;  2KHS A;  4K8J A;  1YJN A;  3P1H A;  4DK3 C; 
#chains in the Genus database with same CATH homology
 1CA5 A;  4OO1 G;  1STN A;  1LTR D;  2KOL A;  4KD4 A;  3M7G A;  3URY A;  3GV6 A;  1E2V A;  2JP1 A;  3GTJ B;  4RHR A;  1SYF A;  3SDZ A;  3AMU A;  1JB3 A;  2BE5 C;  1JR0 D;  3K58 A;  3HOW B;  4G57 A;  4H0L C;  1E2Z A;  1Y1V B;  2F3W A;  1AFP A;  2NTT A;  2EY1 A;  5COY A;  2EPB A;  4L6T B;  1G91 A;  1KDC A;  1OXX K;  2R3Z A;  2EYF A;  5NUC A;  4BWG B;  5FO9 B;  2EZV A;  1HUN A;  5E3F A;  2EXZ A;  4G4K A;  2LKV A;  3R93 A;  1G29 1;  1PRT B;  2PW7 A;  2IJ0 A;  2R93 B;  3K59 A;  1D5M C;  2BA0 A;  4DF7 A;  1CT1 D;  4RFB A;  2N88 A;  1B4O A;  2AQ3 B;  3DWA A;  4HCS A;  1Q3L A;  1TWG B;  2IT1 A;  1HQM C;  1XXG A;  5JPN C;  3P75 A;  1LTS D;  3FVQ A;  2F0G A;  3C1F A;  2QF7 A;  5BN4 A;  3RUZ A;  3PUW A;  1KDA A;  1LLR D;  3NSW A;  1PZK D;  1B44 D;  2G9H D;  5C44 B;  1VMP A;  2E2H B;  5KEE A;  1B53 A;  4KY7 A;  2MGS A;  2F0V A;  5IGG A;  3K5L A;  3IFT A;  1ILQ A;  3OMC A;  1BF4 A;  1LAB A;  2B2W A;  2JA8 B;  3OHX C;  1D1K A;  3NBH A;  5M9O A;  4DAP A;  3SVM A;  2MUY A;  3I72 A;  4IUN A;  4ZQ3 A;  4R8I A;  4R9W A;  2L4N A;  4X3S A;  4IAL A;  3MXP A;  5D3D A;  1XX8 A;  1HRJ A;  1RTN A;  4E6I A;  1QG7 A;  1EIG A;  3DEP A;  1CI3 M;  1A3V A;  3VA7 A;  3LX0 A;  4TKO B;  5G3L F;  2BE5 D;  1QWY A;  2VNU D;  3CQZ B;  4Z9C B;  1J8I A;  1ICW A;  1O7Y A;  4HN7 A;  1SAP A;  4J8Q A;  1X3P A;  3NHH A;  3A8I E;  5C6A A;  1F9P A;  4IUV A;  3QG1 A;  5C0X G;  4HCE A;  4BS9 A;  1LT5 D;  3A8J E;  5HGT A;  2RKS A;  5COR A;  4K5V A;  2Q8T A;  1JWS D;  1SE4 A;  3TZU A;  3NXW A;  3J81 L;  1S4Z A;  1BDO A;  2GA4 B;  4C3H G;  1SMY C;  2H1E A;  4C2M B;  1EWC A;  2KA7 A;  4HMI A;  1O78 A;  4IUU A;  5C0X H;  2JEB I;  3VYT A;  2VXW A;  2L55 A;  5DAU A;  1LV9 A;  5ELB A;  2N55 A;  1X32 A;  1WTW A;  2QCP X;  2NN6 G;  3BDO A;  1SYE A;  4PV1 C;  1EY5 A;  2BOS A;  5D3I B;  4A3B B;  3TP8 A;  1PYW D;  4HAE A;  4C3H B;  2F3V A;  4H44 C;  3UI2 A;  1H9K A;  4TSS A;  4X3U A;  4DN4 M;  1PTO C;  1T5X D;  3V96 A;  4K14 A;  2NN6 H;  1AN8 A;  1TR5 A;  4KK7 A;  3CRK C;  2B2Y A;  3TP5 A;  3R2I A;  4DAY A;  1OXU A;  2AWO A;  4FXG C;  4KY6 A;  4XYQ A;  2NTS A;  2J0T D;  1AZQ A;  1VCI A;  1BNZ A;  3KK7 A;  3GTP B;  2M9V A;  4IFD G;  4ZUI A;  3I70 A;  4C1N I;  4M8A A;  4K6L A;  5LHY 1;  4KKT A;  1VF5 C;  4IZ8 A;  2CW0 D;  3SK8 A;  2KQ3 A;  4LJZ C;  4CJ0 B;  1SYD A;  4RA8 A;  1NR2 A;  5IOD A;  2F0T A;  4CJ2 C;  4RGM A;  2XWJ B;  4XQJ A;  5KYI A;  1SYC A;  5I9P A;  1CZG A;  1LTI D;  1O7L A;  1TS2 A;  2PMZ B;  3HZX A;  3FKI B;  1B9N A;  5G3L D;  2K1B A;  4QCL A;  3SK5 A;  4ILW A;  3OIP A;  5M5X B;  4DNT B;  2YU9 B;  1K83 B;  2FHT A;  1CM9 A;  3ITP A;  1A15 A;  1ROD A;  2K04 A;  3HGB A;  2IX3 A;  1JOO A;  2A6H D;  2F0F A;  1LTA D;  1LTG D;  1SJH D;  2H4O A;  4LMQ D;  4DXG A;  4IUT A;  5E4X A;  3T56 B;  3NTI A;  1GUT A;  5IIF A;  2G9D A;  1GUS A;  1V1O A;  1NUC A;  1SMY D;  3OW7 A;  3TP7 A;  2RDF A;  3QIA A;  3A7L A;  2NUC A;  2HQE A;  1ILP A;  3I8Z A;  1SJE D;  1V43 A;  4ODG A;  1FYC A;  2ZXR A;  1BO0 A;  1XTC D;  2KCC A;  1IL8 A;  1V1P B;  3S15 B;  1TWC B;  1OXT A;  4P2C B;  1Q1E A;  2ZXO A;  1C8C A;  2LS0 1;  1SE3 A;  1WTV A;  5JJZ A;  1PDQ A;  1SNC A;  3J7A F;  4JBW A;  2L1B A;  2A74 C;  4KJN A;  4DK1 A;  3HG9 A;  2L5T A;  1SE2 A;  3NQT A;  4Q0F A;  3DUZ A;  1SNO A;  2B39 A;  1CQV A;  2DN8 A;  1DON A;  2M00 A;  1Y8O B;  5CGK A;  3DWP A;  5IOC A;  4XT1 B;  2OEO A;  1I3Q B;  1D5X C;  3J80 L;  2EY6 A;  1G2S A;  1JE4 A;  3HEJ A;  5FLX L;  3R2T A;  1GUG A;  4ID6 A;  4XYO A;  1IHZ A;  3J7A V;  3PO2 B;  4HED A;  3S1M B;  3L3O C;  3NQI A;  5KRU A;  3QB3 A;  1EY4 A;  1OXS C;  4DGZ A;  2X6G A;  5J39 A;  1JQY D;  1Q90 A;  4KD3 A;  1PZI D;  3FPU B;  1GOZ A;  1QJO A;  2NB0 A;  4BY7 B;  4FXD A;  1SNQ A;  3TDQ A;  1GHK A;  3FDT A;  2JEA I;  1AZP A;  1ZYR C;  5C4X B;  1EYA A;  3HP3 A;  3EQL C;  3KBX A;  3WOF A;  2NYZ D;  2OT2 A;  2PQE A;  3K5O A;  1S5E D;  4MHE A;  1VF7 A;  3PUX A;  1R9T B;  1HA6 A;  3HS0 C;  3A55 A;  5EPJ A;  3KLR A;  2HDL A;  3MXU A;  3OIQ A;  4QF4 A;  1D2B A;  3E0J A;  2AUJ D;  5J22 A;  3BS1 A;  2BDN A;  1FGB D;  2F0E A;  1V8Q A;  1NR4 A;  3ONA B;  1I4G A;  2HCI A;  3OWF A;  3V2T A;  3M7N A;  1JWU D;  1Y8P B;  1WTO A;  3G6J B;  3LWU A;  1EIH A;  1D1I A;  5CC4 A;  5IGF A;  2A68 C;  2FMM A;  4FF2 A;  2ENB A;  1BQQ T;  1BXT A;  4M1U B;  3TME A;  1STB A;  3S16 B;  5JEA H;  2XRS D;  2JA7 B;  2IX0 A;  5KNC A;  4FO2 A;  2Z4I A;  5FKA C;  3HOX B;  1KTK A;  2MP1 A;  1HXY D;  2PCF B;  4K8I A;  1Z7T A;  3RZO B;  5ELC A;  3HKZ B;  1HPC A;  5ELD A;  3W3A A;  5FK9 C;  3H09 A;  1E2W A;  2F03 A;  2F0W A;  3BVG A;  2E2J B;  3X3M A;  1F9R A;  3JAM E;  4I7Z C;  5KYL A;  1SYB A;  2F0P A;  4K2K A;  2K28 A;  5K36 H;  1PZJ D;  2D9U A;  2ID0 A;  2AUK A;  4HSP A;  4RGN A;  3DM1 A;  2TSS A;  5A2Q L;  2JE6 I;  4CGY B;  4MN3 A;  4OO1 H;  3TBI B;  1EY9 A;  3K7A B;  2F0Q A;  5ELF A;  3CU7 A;  1BOS A;  2E2I B;  1PMR A;  2PZT A;  4RH6 A;  3K5M A;  1QNU A;  2F1M A;  2F0N A;  4XT3 B;  5KGU A;  1BR9 A;  4PQX A;  3PMF A;  1SYG A;  1ZYR D;  2D62 A;  3MA2 B;  5TSS A;  2B2T C;  1STA A;  2A5H A;  3VYU A;  4RCO A;  3GQB A;  4K5W A;  4A3J B;  3MEH A;  1ZKO A;  5C5M A;  1DZ1 A;  3GTO B;  1FNW A;  4H7B A;  4PMB A;  3EVQ A;  2B2V A;  3D6W A;  4CKC A;  4B9W A;  3TZD A;  1MBY A;  3SXH A;  3ERO A;  2F0I A;  1H9S A;  1B3A A;  2WV6 D;  1I50 B;  4KY5 A;  1Q1B A;  5D14 A;  3GTM B;  1QOH A;  3GV3 A;  2E74 C;  3Q24 A;  2K7V A;  1YNN D;  4NMZ A;  1EYD A;  1BBX C;  5EGT A;  1MI2 A;  1LT6 D;  1EYC A;  1PFM A;  2A68 D;  4N9P A;  1TWA B;  3NWS A;  1SND A;  4FP5 D;  2MJ8 A;  3PV0 A;  4ME5 A;  3D3R A;  1TWF B;  3H0G B;  1EL0 A;  2I07 B;  4XQQ A;  1H9R A;  5IGC A;  1G8Z D;  1TS4 A;  3CKI B;  2CW0 C;  2EYL A;  3MZ5 A;  3M4Y A;  3RZD B;  5IT9 L;  3K0Y A;  2EJF C;  1F77 A;  3KF8 A;  2AQ2 B;  1M8A A;  1CK1 A;  4GZY C;  2Y0S B;  1S5C D;  3QWN A;  5FO8 B;  3VR6 A;  2PNR C;  4X3T A;  5EKI A;  2PYK A;  3D31 A;  1A2U A;  2K5W A;  3VYR A;  4V19 0;  2EYM A;  3S1N B;  2QKI C;  4KHZ A;  4RCN A;  3QO2 A;  2X6L A;  1DOL A;  2F0J A;  3AB9 A;  1FNU A;  1RD9 D;  2C5C A;  1D6E C;  2C9O A;  5EPL A;  4U68 A;  2K05 A;  1E0B A;  1CQF A;  5C4H A;  3H91 A;  3TN2 A;  4RHS A;  3HOV B;  2JA5 B;  2A6H C;  5CV5 A;  2EYO A;  4I65 A;  3KUP A;  3DXJ C;  2KEE A;  1TY2 A;  4NW2 A;  4J6H A;  1HFG A;  1KAA A;  2O5I C;  2ICI A;  4B9X A;  4RGT A;  1DOK A;  2I46 A;  4KJO A;  2E75 C;  1GXD C;  3D6C A;  4XTC S;  1ZXT A;  1VDZ A;  3MTS A;  4OL7 A;  2Z8L A;  2OXP A;  3Q6S A;  2X69 A;  5M3M B;  1SXT A;  2CQA A;  1WVL A;  1QNK A;  3S14 B;  1EZ8 A;  4U67 3;  1WTX A;  2RDH A;  2B8G A;  3KBG A;  4RKL A;  3OWE B;  3NK9 A;  3S1Q B;  1YNJ C;  3SK4 A;  2R7Z B;  2NVQ B;  3Q0A A;  1DXM A;  4QIW B;  1L0X B;  1L0Y B;  3I3C A;  2CHB D;  3D8G A;  3M4O B;  2VB2 X;  4J1M A;  1Q8I A;  5C3E B;  1KNE A;  1CTM A;  1FD7 D;  3RD4 A;  3Q23 A;  2KEC A;  3M3Y B;  2WP8 J;  4NP5 A;  4FXK C;  2XVS A;  2Q8I B;  3IAY A;  2EVB A;  2F0U A;  4ABN A;  2QEJ C;  4CJ1 B;  4BBS B;  2B2U A;  4XDX A;  5BN5 A;  2K03 A;  2PW5 A;  1GUN A;  2F0S A;  3OMG A;  1Z47 A;  4QMG A;  1TU2 B;  1KLG D;  2EDG A;  1ONL A;  3VA5 A;  5I4D A;  3T51 B;  2A73 B;  3EJI A;  1EQV A;  1GJX A;  2WAQ B;  3MHB A;  4ULL A;  2XIW A;  4IFD H;  1ENA A;  3S17 B;  1HA5 A;  5CMD A;  1QB5 D;  4V0B A;  2WKC A;  3P20 A;  5I2X A;  1AEX A;  4ZAI A;  3VR3 A;  4NDX A;  1PXU A;  3SHL A;  5ISR A;  3U9S A;  1PFN A;  5C4Z A;  4KKS A;  5LL6 X;  2BCO A;  3J7Y W;  3OOC A;  4FF3 A;  4FF1 A;  5JVH 3;  2J4X A;  4HTH A;  1EFI D;  4IUQ A;  3HOU B;  5C3X A;  4ZYS A;  2TMP A;  1JCK B;  5J1Z A;  3D4W A;  2B2V C;  3F2U A;  3MFG A;  3FPP A;  4OGQ C;  3U9O A;  4X3K A;  4ZUJ A;  4KMU C;  1X3Q A;  1CA6 A;  1JOR A;  3NWT A;  4K6D A;  1SNM A;  1A3T A;  2XN9 C;  4A3F B;  2IX1 A;  3MC0 B;  5IGB A;  3A7A B;  1T5E A;  1U9R A;  5CYU A;  4EQP A;  1BCP F;  1YNJ D;  1MD2 D;  4UDU C;  2JA6 B;  3QJY A;  5JVG 3;  1WD0 A;  1BCP C;  1LTT D;  4TRD A;  1STE A;  1TY0 A;  2EJM A;  2B2W C;  4R8N A;  5EKL A;  4BA1 I;  4PNY A;  3PIP 3;  3PUZ A;  1EY0 A;  1RDP D;  2PZW A;  3QOJ A;  3WOE A;  1O7Z A;  1TS5 A;  2Z1C A;  1IYV A;  2F4I A;  1MSH A;  4B08 A;  3MVV A;  1F2Y A;  1I6H B;  1DD2 A;  2YYZ A;  1S5F D;  3NTK A;  4FNF A;  3EA6 A;  3I73 A;  3C46 A;  1JWM D;  2B8F A;  5C0X J;  4F88 A;  1RKN A;  1RTO A;  3BG3 A;  2VUM B;  5KIX A;  5I6W A;  1GUW A;  4DXF A;  3NUC A;  5CBA E;  2KJX A;  3A54 A;  4FF4 A;  1TII D;  1UUP A;  5C0X I;  3S1R B;  5CV4 A;  4DFA A;  5E1F A;  3PIO 3;  4EQN A;  1D5Z C;  3T16 A;  3C1E A;  1EEF D;  3E5S A;  1NCV A;  2L0C A;  2B63 B;  2EYJ A;  4N9T A;  2EJG C;  2O2L D;  5C4J B;  4WFN 3;  1CZW A;  2Z4H A;  3J81 E;  1XWE A;  1O80 A;  1EWH A;  3M85 A;  2NN6 I;  1LTB D;  4G7H C;  2F0K A;  2ZT9 C;  1HUM A;  1HCZ A;  2IPK D;  4DA2 A;  4QUF A;  2D5D A;  1GUO A;  5IGD A;  4KI0 A;  3SR1 A;  1YNN C;  3I4N B;  1V1P A;  3W2D A;  5AFW A;  2NZ1 D;  4K5X A;  2Q8R E;  2JXM B;  5CV7 A;  1I4H A;  3FMC A;  1PLF A;  4F7X A;  4ZKC B;  2RVL A;  1TWH B;  1C48 A;  4RAU C;  2A69 D;  4C3I G;  3KLS A;  1F2L A;  1S5B D;  5F2D A;  1I4P A;  2B2Y C;  1U4P A;  2RBM A;  2FMC A;  1BCP D;  1RF2 D;  4IQZ A;  3NTH A;  1U4R A;  5T1I A;  3I91 A;  4O42 A;  1BCP B;  4DNR B;  1OXV A;  1RCV D;  5IGE A;  2EY5 A;  5C3W A;  5DM7 3;  2R61 A;  1MSG A;  4IN3 A;  2ZXP A;  1J9O A;  5CBE E;  1I4Q A;  2DNE A;  3A8K E;  3S2H B;  4O1N A;  4K2L A;  4C3I B;  2R6G A;  3DWQ A;  1DJR D;  3BVM A;  1TVX A;  3FRP B;  3N6R A;  5DM6 3;  1Z6H A;  4OIJ A;  1PFB A;  4YIJ A;  1EY7 A;  1K8M A;  4KN4 C;  2XSC A;  1R4P B;  3NE5 B;  5I6Y A;  1EQT A;  3IKJ A;  1ET9 A;  5CV9 A;  1H9J A;  2FIN B;  4F87 A;  2PPB C;  2MHV A;  5CR3 A;  5I9O A;  1PRT D;  3ERQ A;  4KTA A;  4TQU S;  1WTQ A;  5EBD A;  1SBB B;  2PO4 A;  3P7J A;  1SDF A;  5EPK A;  4EVO A;  3GTL B;  3I4L A;  3SK6 A;  3GP7 A;  2MPM A;  1A2T A;  4XXE A;  1ML0 D;  3T53 B;  2QIL A;  1AW7 A;  3VYS A;  1ENC A;  2D2C C;  1STG A;  3PUV A;  1QE6 A;  3A56 A;  3R8B A;  4G7O C;  2FJ2 A;  1SEB D;  4A3M B;  2NVT B;  4FVM A;  3H3V C;  2O5J C;  2NWG A;  4IUR A;  1HTL D;  2EE1 A;  1EY8 A;  3CHB D;  1F9S A;  5A35 A;  1WTR A;  4EQO A;  2A6E D;  1G2T A;  2LMC B;  3MFY A;  1DM0 B;  4PMC A;  4QUC A;  4ZK9 B;  1OO9 B;  1TS3 A;  1EEI D;  3J80 E;  3CRL C;  2KCN A;  1B2T A;  3GTQ B;  3N52 A;  4G7Z C;  1EY6 A;  5FLX E;  5JPM C;  5HUR A;  2K01 A;  3VR5 A;  4JK1 C;  1STY A;  1F9Q A;  3K5N A;  3K57 A;  1IKM A;  4XIG S;  2HUG A;  1I6V C;  1DYQ A;  3RMH A;  3QOL A;  5C5L A;  4WRD A;  4CKE A;  3T13 A;  3MWY W;  1F2Z A;  3FEW X;  1GHJ A;  1ZEQ X;  3BYY B;  5JEA J;  1Y1W B;  4NKL A;  4RKB A;  1U4M A;  1SFO B;  1IW7 C;  2F0O A;  1EU4 A;  3IL8 A;  2KUM A;  2CVR A;  2DY7 A;  3BDL A;  4A3K B;  2HCC A;  5T1G A;  1H9M A;  1CHP D;  1KNA A;  4CKB A;  1LT4 D;  3LNN A;  3GTK B;  2F0M A;  1M4V A;  5CV8 A;  1KAB A;  3AU7 A;  3NP8 A;  1SNP A;  2JSO A;  2K6A A;  2M2L A;  4OIK A;  1S5D D;  1KDB A;  4DK0 A;  1TQO A;  5CV6 A;  5KNB A;  2VB3 X;  2F0L A;  1UEA B;  4C56 C;  1UNS A;  1FR3 A;  5M5Y B;  2V4D A;  3S2D B;  2KVM A;  2WB1 B;  1DCZ A;  2EY2 A;  3MXN A;  5JOB A;  5FOB B;  1IYU A;  1TKW B;  2NBF A;  3EFX D;  1LT3 D;  4BY1 B;  4OO1 I;  3SEB A;  3S9W A;  1PTO F;  2XNA C;  4HMJ A;  1Q12 A;  5K5P A;  2IW3 A;  2SNM A;  3BDC A;  3E6Z X;  3NPP A;  2DNC A;  1A6X A;  2WII B;  4C3J G;  3I4M B;  2NVX B;  1NSN S;  1CFM A;  3BZD B;  4LAA A;  3L7Z C;  3OPO A;  1QIL A;  4S3S A;  2E76 C;  3D4R A;  4HR7 B;  1JOQ A;  1KLU D;  2RSN A;  1XYI A;  3JAM L;  4Q5V A;  4A3G B;  5ELE A;  1HHV A;  4L8J A;  1ESR A;  3PO3 B;  2KED A;  1SSO A;  1W6J A;  3VR2 A;  3KLS X;  2F0H A;  4MIU A;  3V05 A;  3ND9 A;  5A2Q E;  1BUV T;  1LO5 D;  4C3J B;  2SDF A;  1I4R A;  1JC7 A;  1QCB D;  1WCM B;  1RHP A;  1STH A;  4F8M A;  4A3I B;  2NVY B;  3GD7 A;  4C1N K;  2FFK B;  5DNF A;  2SOB A;  4LK1 C;  3GO5 A;  1AP0 A;  2LFN A;  5I2Y A;  4A93 B;  2RQX A;  1IW7 D;  1B9M A;  4BBR B;  4ZLT F;  1B1Z A;  2B2T A;  5EQ0 A;  2L12 A;  3IFD A;  1WD1 A;  5BN3 A;  1VMC A;  2HDM A;  4QB4 A;  3LWE A;  4KV6 A;  1I4X A;  1LAC A;  1EZ6 A;  4CHT B;  2O4X A;  4DAV A;  1TT2 A;  1WTP A;  2IWH A;  3ZYY X;  4CBV A;  4DU9 A;  2OF1 A;  2L11 A;  2A69 C;  3PUY A;  1B50 A;  3NBI A;  3G7L A;  1DOM A;  1U4L A;  5JAV A;  4RGO S;  4EGV A;  1K8O A;  2K5Q A;  4OHJ A;  2J7Z A;  4WOR A;  2EYP A;  1R4Q B;  4L63 B;  1FNV A;  2WIN B;  2EOT A;  2LY7 A;  2WAC A;  5DEH A;  3HRZ C;  2L9H A;  3H6M A;  3BYT B;  2EYH A;  1PTO D;  1MGS A;  5FO7 B;  4Y7N B;  3R3O A;  1PTO H;  5LL6 S;  4WJW A;  1Y8N B;  2RSO A;  2RA4 A;  1PTO B;  2XRQ D;  5EJW A;  5IT9 E;  2JYO A;  4A3D B;  3DMU A;  4HSV A;  2E2D C;  3X3N A;  2SEB D;  1ENF A;  1JIC A;  1HTP A;  3I90 A;  1UAP A;  4XQN A;  3HOZ B;  4UAI A;  2BA1 A;  1F2M A;  1HQR D;  2BDO A;  2F0D A;  1PRT F;  3BVZ A;  3WDN A;  1PRT C;  2DY8 A;  1IKL A;  3ND8 A;  4ZKB B;  3C2P A;  2IL8 A;  4BA2 I;  3DHQ A;  5E4W C;  4IUP A;  4A3E B;  3Q22 A;  2AQ1 B;  4PMW A;  4AYB B;  5EKK A;  1A3U A;  3SE0 A;  3C3L A;  5M3F B;  1NAP A;  2K33 A;  2WKD A;  4ZRZ A;  4KN7 C;  3TSS A;  1ET6 A;  2AWN A;  2K32 A;  5D65 A;  2ICE C;  4RWS C;  1EOT A;  5JEA G;  3T4A C;  5KND A;  2R92 B;  1ESF A;  2QDB A;  3O13 A;  4IFD J;  1H9S B;  1W6K A;  1EU3 A;  1II3 A;  1HFN A;  3VR4 A;  4KHV A;  3GTG B;  2RDG A;  1G6Z A;  1CHQ D;  3D4D A;  2SNS A;  4FYD A;  2A6E C;  4IFD I;  3MAQ A;  3H94 A;  4H13 C;  3TP6 A;  3L9A X;  3RLF A;  5M5W B;  3MXG A;  4KKU A;  5EBC A;  1Y69 U;  1RJT A;  1C4Q A;  3DEO A;  2PZU A;  3HOY B;  1JOK A;  3OSO A;  3K6O A;  5K36 G;  2XWB B;  2B2U C;  2K5D A;  2KHS A;  4K8J A;  3P1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...