2K1BA

Solution nmr structure of the chromo domain of the chromobox protein homolog 7
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
EQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the chromobox protein homolog 7.
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
molecule keywords Chromobox protein homolog 7
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k1bA00
5T1IA 1ICWA 2IL8A 1S4ZA 1AZPA 4ZK9B 2N88A 2XIWA 1X3PA 5D14A 2SDFA 5E4XA 1U4LA 1J8IA 4X3UA 1X32A 1AZQA 4OIKA 4IUTA 2FINB 2RVLA 5T1GA 2FFKB 1TVXA 4CJ0B 2X6GA 1WTOA 1DZ1A 1SDFA 1DOMA 1WVLA 4MHEA 1RHPA 1RJTA 2NZ1D 1AP0A 2KVMA 3TZDA 3G7LA 4R8IA 4RAUC 3F2UA 4XT3B 2K28A 3LWEA 1IKLA 4HCSA 3N52A 1PFBA 4IURA 3H91A 4QUCA 4UAIA 3FPUB 1VMCA 2B2VC 5EJWA 1ILQA 4ZKBB 2CVRA 3UI2A 1QE6A 5CMDA 1HA6A 4CJ1B 1WTQA 1EOTA 2NWGA 1DONA 1QNKA 5CORA 1LV9A 1BO0A 1MSGA 3FDTA 4IUPA 4IUVA 2BDNA 2K05A 4X3KA 1BF4A 1GUWA 3P7JA 1SAPA 2K01A 1RTOA 1EIGA 1SSOA 1J9OA 3I90A 1EIHA 2JP1A 1IL8A 4RWSC 4QUFA 1NCVA 2HUGA 1B3AA 3DEOA 3GV6A 3IFDA 2B2WC 4XDXA 1HHVA 2RSOA 5DNFA 1F2LA 1XX8A 5EPKA 1RTNA 2L9HA 1MI2A 3I8ZA 1HRJA 4LMQD 1F9RA 5EPJA 4ZKCB 1B50A 4RA8A 1EL0A 1CM9A 5CBAE 3I3CA 1ML0D 2B2WA 1BBXC 2L4NA 3MWYW 3IL8A 1PFNA 2K1BA 2HDLA 4IUQA 2B2TC 1G91A 1QG7A 1RODA 1HFGA 2B2VA 2EPBA 1Q3LA 1ILPA 1U4MA 1NAPA 2HCIA 2KEDA 2MGSA 2L11A 2R3ZA 4MN3A 4NW2A 1M8AA 2MJ8A 3DEPA 2K04A 4R9WA 1CA6A 1KNEA 1E0BA 1DOKA 1ESRA 1PLFA 2HDMA 2VXWA 4ZAIA 1G2TA 1WD0A 2X69A 1KNAA 2MPMA 2N55A 1XYIA 2RA4A 1WTPA 1VMPA 1B2TA 1G2SA 3I91A 2FHTA 2MP1A 1O7ZA 2FJ2A 5EQ0A 5AFWA 1ZXTA 2L1BA 1NR4A 2L12A 4X3SA 1U4PA 2DY8A 1WTWA 4HEDA 2EOTA 2DY7A 1B53A 2KEEA 1BNZA 1F9PA 1EQTA 2B2YA 1WTVA 2D9UA 1B4OA 2EE1A 2M2LA 1U4RA 3GV3A 1O7YA 5EKIA 3MTSA 5JJZA 5CBEE 4DN4M 2H1EA 4ZLTF 1O80A 4HAEA 1F9SA 3SVMA 1JE4A 2B2TA 1F9QA 2Q8TA 4IUUA 3D6WA 3TN2A 2X6LA 1NR2A 4U68A 2HCCA 4O42A 4HSVA 2K03A 2KECA 5D65A 1C8CA 4OIJA 2JYOA 1DOLA 1WTXA 1MGSA 1WD1A 1X3QA 4XT1B 5E4WC 3ONAB 2RSNA 1WTRA 3Q6SA 1A15A 2FMMA 3KUPA 1IKMA 2J7ZA 3QO2A 4X3TA 1G6ZA 1PFMA 5EPLA 2B2UC 1PDQA 2KUMA 2NYZD 1MSHA 1JICA 1CA5A 3R93A 1HFNA 3DM1A 1HUMA 2B2YC 1HUNA 3HP3A 2KOLA 2Q8RE 3KBXA 4CJ2C 5COYA 2B2UA
chains in the Genus database with same CATH superfamily
4GLVB 1T5XD 4L5QA 4LF5Q 1FD7D 1X3PA 2CHBD 1W2BA 5E4XA 1PTOF 4KMUC 4IUNA 2LY7A 2EY1A 4ULLA 2A19A 1AEXA 3T56B 4HCSA 3D0FA 2JA5G 2C35B 2MO1A 3K5LA 1IBKL 3KLWA 4DUZQ 3I4NB 3BVGA 3NBIA 4I65A 3CCLA 2K75A 3A54A 1Y8NB 4J15A 3GTQB 2R93B 4Q5VA 1S5FD 5IP7H 2VZAA 4GNXA 5K36H 1RKNA 1E3PA 1RTOA 2ZTDA 3D8GA 1IL8A 5EKLA 4C3JB 1LTBD 4FXGC 1QUQB 1KL9A 1SE2A 5EGTA 1NNXA 3F8TA 2F0DA 4G7ZC 3U9SA 3CC2A 1HRJA 5D3DA 4A75A 2M00A 1SJED 3T1YQ 3S9WA 1E2ZA 5JAVA 4LFCL 3MWYW 5A35A 3J80L 4RKBA 1M4VA 1XMQL 2VUMB 2B2TC 3I4MG 4CKCA 4EQPA 4N8X1 1LTGD 2B3GA 1W3SA 4YWKA 3VYRA 1L0XB 3AMUA 3JAML 3PIP3 4XYQA 4A3DG 1EY7A 1I4QA 3FKIG 3NELA 1C0AA 2IT1A 2BOSA 1ZXTA 4A3KB 5IGGA 4HEDA 4AIMA 2JA9A 3J80E 1YNNC 2DY7A 5IOCA 5I6YA 1U5KA 5M3MG 3GP7A 1BKBA 4DV5Q 3GTGB 4JI1L 3ND8A 4ZUIA 4A3MH 1DD2A 1HR0Q 4DFAA 4JI7Q 4BXXG 3G71A 1X3QA 1SNDA 3S1NB 2FMCA 2VY3A 5BN5A 2AUJD 1E2WA 2E2JH 1RIPA 4QIWE 1EFWA 2C5CA 3TREA 3Q22A 1H95A 1CA5A 3F2CA 3FEWX 2IPKD 2A74C 2LS01 1V9PA 1L1OB 4GLXA 2QEJC 1Q46A 1EEFD 4UPAA 5C44G 3A0JA 1N33L 1VQNA 2M9VA 4QL5A 2R92H 5CV6A 3OSOA 1YNXA 1G51A 4NXNQ 1GXDC 1ONLA 4R4QA 2ES2A 2RVLA 2D2CC 3MVVA 4A3BB 3K7AB 4CDFC 3CCVA 2AUKA 4KTAA 3URYA 2YU9H 3DXJC 4AYBE 2ICEC 4FF1A 3T16A 1VQ8A 3E9HA 5IYCH 4HMJA 2R7ZG 2K5DA 1VQPA 5C3EG 3PGZA 4RHSA 2BCOA 5JVH3 4FF4A 3SE0A 3S1QB 2JA7G 1L0WA 1LT5D 1HJPA 1AFPA 2BDNA 2OXPA 5KRUA 1HH2P 2D5DA 3NK9A 3ULJA 2HUGA 3QR8A 1PH4A 1YZ6A 4ZQ3A 5IT9L 2F0KA 2DGYA 3P1HA 3D4RA 4A3KH 4LF4L 3LGJA 3NTKA 1HNWQ 4AQYL 5JVG3 3KBGA 3MHBA 2MNAA 5I9OA 3J81c 4C3JG 3QWNA 2HDLA 3KDFB 3F2BA 1RODA 1PMRA 1KNEA 2F0SA 1SXTA 2HDMA 3W1GA 3HOZB 5AJ3Q 3TDQA 1K8MA 2F0LA 2NTSA 2N3SA 2MP1A 5AFWA 2F03A 1QOHA 1Z9FA 2IX0A 1CUKA 3WOFA 3UDXA 3T13A 3QIAA 2VB3X 1A63A 3E0JA 1Y1WH 3S2DB 3TMEA 3MTSA 3SK4A 3FKIB 4DN4M 4IO9A 4DV1L 4C3HH 1HNXL 3S16H 3J7AV 3I72A 4HR7B 2Z6BA 1VQKA 1GUTA 4DAMA 2NVYB 3I4NH 1DOLA 1V8QA 4FYDA 1D7QA 3EIVA 3X3NA 1QNUA 5JEAG 2AQ1B 1QB5D 4KN4C 1XWEA 4KY5A 1TXYA 4X64L 2RQXA 4IPHA 4OXPA 3NE5B 4WORA 2NZOA 3C3LA 1P16A 4RCOA 2N88A 2XNAC 4JW0A 3KOJA 4L5SA 1IXRA 1YJWA 4C56C 1IBLQ 3AFQA 3OIPA 1AP0A 3R3OA 1O7IA 1X55A 3J81i 1EWCA 4L8JA 5C0XH 1LM0A 1ASYA 2ZJQA 3U9OA 4IJHA 3CC7A 2EY2A 1EQQA 1V1PA 1EOVA 3CQZH 4DR1Q 2MUYA 3UDFA 3E5SA 3A8KE 3K7UC 3NEMA 5CGKA 1BF4A 3GTKH 2NVTB 2PO4A 2IHEA 3HKZE 2AKWB 4LJZC 2HT1A 3MXUA 2B2WC 5DNFA 3S24A 1WFQA 3AFPA 2NVQH 3DM3A 3HOXG 1KDAA 1G8ZD 2E74C 5FLMG 3J81L 3RZDB 1PH6A 5I6WA 1K8OA 5C3EH 4L6TB 1KTKA 5C5MA 4A93H 3VA7A 1BVSA 2R6GA 2PZWA 1HZBA 2MJ8A 2K04A 1I4RA 3S1RB 5HGQA 1ESRA 1STGA 2UUAL 3L7ZC 2TSSA 3RUZA 4JI3L 1PRTB 4JI4L 3KDFA 4KKSA 1FR3A 3OHXC 2WKDA 4A3IG 1VDZA 2JA8G 1NUCA 2L1BA 3EQLC 1QWYA 2VS1A 4YIJA 3TQYA 5FOBB 3PSIA 2NVXB 3GTGH 4P75A 1VF7A 3A74A 3BDLA 1HXYD 5JJKA 2M2LA 3H3VH 2ASBA 1U4RA 2XN9C 5IT9E 2QCPX 2B63H 2F4VL 3S17B 3OOCA 1PH1A 1L1OC 1FNUA 1TWCB 1K3RA 2RBMA 3GQBA 5M5XB 4OHJA 1VQLA 4JBMA 1IW7D 3SK6A 4EX5A 4K5VA 2JYOA 1N32Q 4DXGA 2UU9L 4BA1I 1QUQA 1N34Q 4X6AH 2JA6G 1B9MA 1SNOA 5KYLA 2UXCQ 3BU2A 1CT1D 1ZKOA 2D0OA 2HIXA 3KJOA 3QJYA 1HFNA 1UE6A 2GA4B 1WJJA 1FNWA 1JMCA 4ME3A 5DLQE 2JK8A 2B63G 1GJXA 1KC8C 5C4JB 2XSCA 5JEAH 3FHWA 1U4LA 2AMCB 4RGNA 3PUVA 5ELOA 4DV2L 3NUCA 1AZQA 3B6YA 4A4IA 1EZ8A 5M3FB 2A68C 1FJGQ 4LF9Q 4R8IA 2ALYB 4DAYB 1TWAB 1S5ED 2HQEA 3N52A 4QUCA 2EYJA 1IYVA 4MTKA 2WB1G 4K8IA 2F0QA 1SRUA 1X65A 3BYYB 5D3IB 3FDTA 1TS3A 3H0GH 2NTTA 3DMUA 3BVMA 1NCVA 3AQQA 4V0BA 2XWBB 1KABA 3HKZB 4RGMA 2Q8IB 3PIPA 1VQ7A 3CD6A 3DWPA 1YHAA 3FPPA 2VQEL 3CCEA 1LTRD 2PQEA 4DR4L 5CBAE 3S16B 1EIYB 3K7AH 1VQHA 1J5EL 4FDBA 3GTMH 5C3WA 4JI5Q 1CA6A 3Q0AA 4BS9A 1SYEA 2RDHA 5M5WB 4CDCC 2CCZA 1VQFA 4KY7A 3CXCA 1N32L 1G2SA 3K59A 1O7ZA 1Q81C 2RCNA 2UXBL 4OWWB 4DGZA 4DU9A 3AYHB 4X62L 2ZM6L 4FXDA 2H5XA 1LT6D 4DKAC 3L2PA 1F9PA 4J8QA 1IBML 5CBEE 3K5NA 3S14B 3VA5A 4LF6Q 1X3EA 5C44B 2JA8B 4WFN3 5JPMC 4OWTB 4CDDC 5HGTA 1L0YB 1LUZA 3U4ZA 5IYBG 2K7VA 2PZTA 1D5XC 3EROA 3D4WA 3OWEB 3M9BA 3L0OA 1EY5A 2J7ZA 3H6MA 5KNDA 3S1QH 5J1ZA 2NYZD 4A93B 4RH6A 1OXUA 3JAME 1XJVA 1LO5D 3D6CA 1LYLA 4O0AA 1VQMA 3PO3H 1E22A 1S4ZA 1Y1VG 3JAMi 1JWMD 1TU2B 2YTVA 3ITPA 1ENCA 4KKTA 4XYOA 4ALPA 4JI6L 1K0SA 1TY2A 4S3SA 4BBSG 1SYGA 4JOIA 2LKVA 2XRSD 3SDZA 3NBHA 3BDCA 1EIFA 4N9TA 1HTPA 5CMDA 1YIJA 3NTIA 3RNUA 3M7GA 2UUCL 3T4AC 1ET6A 3WDNA 3GTLH 3MXGA 1SE4A 2UXBQ 1EY0A 1H9JA 2F0PA 2DJGC 1G6PA 1Y8PB 2PQAA 4QUFA 3CRKC 2Z6KC 3M85A 1XTDA 3OW2A 3S1NH 2PW7A 4IFDJ 2XRQD 4WJWA 1PRTC 4JC0A 3OTOQ 4DV3L 3F2DA 3PO3G 1A2UA 4JV5Q 4QF4A 2F1MA 2IY5B 2CWAA 3KFUA 3V96A 1HFGA 1ILPA 5IYCG 4DR6Q 3ERQA 4X66L 2A69C 4YWLA 4H7BA 4XQQA 1KDCA 3U4VA 4YHHL 4K0KL 1AE2A 2X69A 1KNAA 3J7YW 1IYUA 4F87A 1B2TA 2NVYH 2G9DA 3EJIA 3CMAA 2FHTA 2CKZB 2QW7A 2K5HA 2Y0SB 4UDUC 5EBDA 2F0IA 2K5QA 2A6HC 1D6EC 3SVMA 1PH8A 1KIXA 4LF9L 4RGTA 4JI6Q 1XPUA 1D1IA 5ELNA 4LFAL 1KLGD 4DV2Q 4KN7C 1YJ9A 1STYA 4X65Q 3OMGA 3A56A 1A0IA 5E1FA 4I7ZC 5H1SE 3GTQH 4DR6L 5K5PA 1OO9B 4FNFA 3R93A 1Y1VH 1PV4A 1KDBA 3VR4A 1SFOH 3ICEA 1HUMA 3T1HQ 5GADC 5LHY1 4K0KQ 4ID6A 5FLXc 4JPBW 1KHIA 3NSWA 2EOTA 2A6HD 2IL8A 1GOZA 1BCPB 3I56A 2JA8H 1CKNA 3MFYA 3TP8A 4A3LH 1GM5A 1HNZQ 4IUTA 3NXWA 4Y52H 3PQIA 2OTJA 3K58A 4B08A 4GKKL 4DV6Q 5IP9G 4GZYC 1FNVA 3G7LA 3BG3A 1YHBA 1TWGB 2F0WA 1CK1A 2KHIA 2ZM6Q 1IYJB 2B8FA 3I73A 1XNRL 5C0XI 4JBWA 2NUCA 1E2VA 3V05A 4QQBX 4A3FB 2VB2X 1QVGA 2K01A 4BY7B 2NN6G 3OWFA 1X56A 4NXML 2WINB 4A3JB 2CFMA 3I8ZA 4GN4B 1EY9A 4LMQD 1FGBD 3I3CA 2B2WA 2E2IB 2BE5D 1W6JA 4JYAQ 3S15B 1SNPA 2B2VA 3EBEA 1E1OA 1Q3LA 1FYCA 2WP8J 2B63B 1C9OA 4POFA 3I2ZA 5IGCA 1G2TA 2VXWA 1D2BA 2KCMA 2RHSB 2NVXH 3IAYA 2RA4A 2I46A 3K81C 3OPOA 1VMPA 4OGQC 3HOUG 1P8LA 2HIVA 3SHLA 3HOYH 2EYHA 4DR1L 5NUCA 3CPWA 5IGDA 5M3FH 1R4QB 3S1RH 1O7LA 2K33A 3J7A5 1O7YA 1VCIA 1ZYRC 3HOYB 3PO2G 3LWUA 1A2TA 4MTNA 1T5EA 1TQOA 1I6HH 4C3IG 1UUPA 4LF6L 5C4XB 4PZ7A 1L1OA 2YU9B 3Q6SA 1H9SB 1EEID 1IKMA 2JEAI 3A7LA 4GKKQ 4JI5L 4CHTB 4PNYA 1XXGA 1EY6A 2R92B 5EAYA 3HOWH 5FLXL 5CV8A 4A93G 1PTOD 1K73C 2IX1A 2NB0A 4DR7L 1EY8A 3RN5A 3PO3B 2J4XA 4BY7H 1KRSA 1PZKD 4X3UA 4IOAA 1B9NA 1BCPD 2WIIB 1DZ1A 1D1KA 2UUCQ 3NPPA 3BZKA 2EXDA 2K28A 1HNXQ 1S5CD 5LL6X 3J81E 2K32A 4A3DB 3S1MH 1YVCA 3BDOA 4PZ6A 1HA6A 4CJ1B 3M4PA 4R4TA 2ZJRA 1N36Q 2A5HA 1QVCA 2JA7H 3T53B 1XMOL 1YHQA 1BO0A 4ODGA 3PF4A 4NXNL 1AW7A 2F3IA 2JP1A 1HTLD 5CV7A 4GKJL 1TT2A 2YTYA 1YNJC 1KAWA 1D8LA 3S1MB 4IQZA 1S40A 5IP9H 1VF5C 4Z9CB 1B3QA 4KHVA 5A2QE 4IZ8A 4DR2L 2SOBA 1CSPA 5EBCA 4YWMA 5FJ8H 1TR5A 4LFBL 3H94A 2ZTEA 3PUXA 1DOKA 2RCFA 3J80i 3A7AB 1X6OA 2LMCB 1CTMA 3PF5A 2RDGA 1XNRQ 5EQ0A 2GN5A 3OTOL 2L12A 4LF7L 2EXZA 1HQRD 3A8IE 3CKIB 4JI1Q 1PRTD 1Q86C 2D62A 3KK7A 3H3VC 5CV5A 1ICFB 2Z0SA 3GTJB 4XTCS 3FP9A 1EWHA 5CC4A 5M5YH 1HNZL 2EQSA 4HSVA 3RMHA 3AEVA 1CSQA 3RN2A 1BCPC 1II3A 2CH4A 1XTCD 2Q2TA 3ONAB 2IJ0A 1HR0W 4QY7A 4YY3L 3VR5A 1XMQQ 2KUMA 4HIDA 1JJCB 1SYBA 3UE0A 2VQEQ 4A3DH 2L15A 3STBD 4CJ2C 1AE3A 1MKHA 3M3YB 4B3TL 1CQVA 2PI2A 3FKIH 4KD4A 2OEOA 1JOKA 5T1GA 1WTOA 4J6HA 3TSSA 1PZID 2QEXA 3PUYA 3AB9A 1H9MA 2BA0A 4YY3Q 2QILA 2Y0SG 4H13C 1SYDA 2K14A 5M3MB 1Q1EA 1HZCA 3FPUB 3TZUA 3KLSX 2DN8A 1QNKA 1WCMG 1WI5A 2O5IC 1MSGA 4A3FH 1IBMQ 2KCCA 1SSOA 2L0CA 2PMZE 2QA4A 4NB3A 1RDPD 3GV6A 2IX3A 4YHHQ 4X66Q 3BVZA 4JVZA 5I9PA 4OX9L 4A3EG 1VS0A 4BBSH 2WACA 4ZKCB 2K5VA 4F7XA 3R2TA 2PNRC 3CMEA 4DR7Q 1U4MA 2HCIA 4MN3A 5JJIA 4MIUA 4LFBQ 4NPSA 4YCWA 4F88A 1EYGA 1EUJA 2VW9A 1K8GA 3JAMc 5C3EB 4E6IA 1JQYD 4OO1G 2JE6I 4XQNA 1K83H 1NY4A 1J6QA 3DLLA 2DY8A 4A3GH 2EYOA 1B53A 4HCEA 4G4KA 2D9UA 4BWGB 5C0XG 5EKIA 3S15H 5JPNC 5HURA 2E2IH 4HAEA 4IFDG 3HS0C 3MA2B 4BBRG 3D6WA 1XMOQ 2X6LA 3I4LA 1I6VC 1LLRD 2RKSA 4FVMA 1A62A 3J7AF 4BY7G 4P74A 3SK5A 1KD1C 3I55A 1V43A 1GD7A 1D5MC 2N49A 3VR3A 1A3VA 3FVQA 2B2YC 5AJ3L 3HG9A 3HP3A 2KOLA 3KBXA 4IJLA 3HKSA 3CCQA 1UNSA 1R4PB 3H0GB 1TS2A 1B8AA 1JR0D 4KHZA 1WOCA 3HKZG 4H44C 1WVLA 4MHEA 2Z9HA 4APVA 3HRZC 3EN2A 2F0TA 4RAUC 4LUOA 4OL7A 2EYLA 5I4DA 2YYZA 3H91A 5L37A 4DR5L 1PH7A 3UI2A 4RFBA 1NTGA 5E3FA 3HOYG 2F4IA 3VYUA 2L55A 1SNMA 1EU3A 1N8RC 1TWFB 4K2KA 4FXKC 2A69D 4A3EH 2G5DA 4ILWA 4LF7Q 3IFDA 4DV6L 3W5OA 2JEBI 1RTNA 3A55A 1A8VA 2F0FA 1VQBA 5FLMH 4JG2A 2F0GA 4CBVA 4UY8C 3TRZA 3HOWB 4IUQA 1AH9A 3HOUB 3DWQA 2UUAQ 1JE5A 4IPCA 1VQEA 3I4MH 4A3EB 4H0LC 1J5EQ 4DR2Q 3JC66 1E0BA 2A6EC 2OTLA 2WB1E 4HJ5A 1XYIA 2N55A 2WAQG 2A6ED 1WTPA 1SE3A 4IALA 5IYBH 1BBWA 4HN7A 4L5TA 1TS4A 5ELDA 2IWHA 1KLUD 3QOJA 2FJ2A 1HCZA 1IBKQ 1X3GA 4HSPA 5BN4A 1EZ6A 4DK3C 4NXMQ 3GV3A 4QIWB 5JJZA 3HOVB 1FJGL 3MXPA 1G291 1N36L 1NMGA 4EVOA 2V1CC 3TBIB 4U68A 4FP5D 3A8JE 3D31A 1KRTA 5ELCA 2R61A 4OIJA 3MXNB 1UE1A 1UE7A 4DV5L 1SMYC 4DNIA 1JB7A 1I50H 2J0TD 3S14H 4BBRB 4X62Q 4RKLA 4HJ8A 1G6ZA 4BXXH 1JICA 4G7HC 4IFDI 1W6KA 2EJGC 5DM73 4LK1C 3VYTA 5ELEA 3QG1A 1R9TH 1SR3A 4KD3A 1TIID 1VQIA 2WV6D 1SLJA 1CKMA 2X6GA 5BR8L 1WYDA 3HOXB 1N34L 1RHPA 2NZ1D 3TZDA 1B44D 4TVAB 1TS5A 2Q2IA 4Y7NH 2V4DA 1QCBD 1Y8OB 3M3YH 1PFBA 2E8GA 2GVBA 4ZRZA 3NQIA 1QZGA 4LFAQ 2CVRA 1FVIA 1O78A 4P72A 1EWIA 1F2YA 2WAQE 1PH5A 3NBHB 5DEHA 2DUDA 2EDGA 1JOQA 3VDYA 4C2MH 1SMYD 4KJNA 4X3KA 1SAPA 1EIHA 2QDBA 3DEOA 3ERSX 3KLRA 1HHVA 2RSOA 2A68D 1QJOA 1PH3A 1GHJA 4AYBG 1YNND 4JI3Q 1A6XA 4LF5L 2Z8LA 3MFGA 5TSSA 4DV4L 3ER0A 3UE1A 2E2HB 3K0XA 1QG7A 3VR6A 2HQLA 5G3LF 1GUSA 1VQ5A 4JYAL 4A3LG 3W2DA 4A3CH 1PH2A 4GNXC 2K52A 2KCNA 4JV5L 2LFNA 4OELB 1YITA 2XTIA 1Q90A 3MAQA 2BDOA 2F3WA 2JA5H 1ET9A 3W1BA 3GTMB 5J3BA 1PH9A 2P5ZX 3EVQA 3I4NG 1U9RA 3SGIA 4DR3L 4I7AA 3M4OB 2B2TA 1SROA 1WCMB 4EQOA 3KF8B 2A8VA 4NMZA 1Y69U 3PIO3 4WRDA 3GO5A 1SNQA 4A3MG 1F2MA 2EZVA 4V190 4OWXB 3E3XA 1GUNA 3S17H 5F2DA 3OW7A 5EPLA 2JXMB 2B2UC 3PCOB 1PTOH 1DM0B 2BH2A 1ASZA 4AH6A 5IYDH 1GVPA 4ZCKA 1STAA 3T1HL 1IW7C 4HJ7A 5M5YB 2AQ3B 1AZPA 4ZK9B 3A5ZB 3NWTA 1OTCA 3CC4A 1BUVT 1Y1VB 2SDFA 4KY6A 1PVOA 3GTJH 3CCRA 4X65L 4A3JG 2FINB 2VUMG 1CKNB 1BQQT 2B39A 1JWSD 2KVMA 4DV1Q 3GTOB 2L5TA 1GUGA 2F0UA 5I2YA 4C3IB 4J1MA 1BBUA 1PYWD 4C1NI 1MHWC 3HZXA 4DF7A 4UP7A 2NWGA 3TEHB 4IOCA 1MJEA 1DONA 3OIQA 4BY1B 4A3BH 3M4YA 4A3IB 1S3OA 2K05A 2OCEA 1J9OA 2F0EA 1STEA 4BY1H 2EJFC 1EYAA 4DK0A 3C1EA 3MC0B 2LXJA 4DUYL 1I94L 5ELFA 3VYSA 1SN8A 4UP9A 1IBLL 1OXXK 1BBXC 2K4KA 2E76C 4IPDA 4JBKA 1PFNA 2K1BA 4K5XA 3RLNA 2E2JB 4TKOB 1I50B 1IZ6A 1STNA 2AHOB 4R9WA 2UUBL 3BYTB 4K14A 3NTHA 1LTSD 2KQ3A 4ZUJA 2JA7B 1DCZA 3IKJA 1HNWL 2O4XA 2ZXRA 4DR4Q 3G6JB 2ATWA 3K57A 1PRTF 2AWNA 4KKUA 4BBSB 1A3UA 5EKKA 5C44H 3DUZA 1PTOB 1RL2A 4KHPQ 4C3HG 4N9PA 4G57A 1JWUD 4ME5A 4HIKA 1F9SA 1VQCA 2O2LD 4WJ4A 2CQAA 4EGVA 1EU4A 4R4OA 3J7ZC 4B9XA 5IGEA 3RZDH 4JK1C 2NVQB 1WTXA 3BZCA 1H9SA 4XT1B 5M3MH 3CCMA 1WTRA 2JA6H 1A15A 1B1ZA 1ENAA 3ND9A 1SMXA 3QO2A 3TS2A 3CQZB 4CKEA 3AU7A 3NQTA 3M4QA 1UE5A 1RCVD 2DNCA 2Q8RE 3EA6A 4K6LA 5GAEC 1OXVA 3TS0A 1GO3E 2F0OA 3GTOH 2EIFA 3VR2A 4GN3B 2FFKB 5CR3A 4HJ9A 1JCKB 1MD2D 1TWHH 1HPCA 4LF4Q 1LACA 1DJRD 1I5FA 2Q2HA 5IIFA 3Q8DA 1IKLA 4IURA 4DNTB 5EJWA 1Z47A 4ZKBB 2RF4A 2AQ2B 2DNEA 3F1ZA 2K6AA 2N78A 1LV9A 3CRLC 3CU7A 3TP5A 1CI3M 4C2MB 1YI2A 4LF8Q 2F4VQ 1DYQA 2IHFA 1B70B 4M1UB 2KHJA 2L9HA 4BY1G 3I70A 3LX0A 3RLOA 3K5MA 4LFCQ 4RA8A 4JI4Q 4DA2A 1EL0A 1PA6A 4CDEC 1DGSA 2WAQB 4LWCA 2L4NA 4GLAC 4ZYSA 4L5RC 4A3BG 3HOXH 3S2HH 1N33Q 1NAPA 1E7ZA 2WFWA 1Q82C 3M7NA 1BDOA 4EQNA 4X64Q 4JI2Q 1VQ4A 4JBJA 1VQ9A 3NHHA 2R7ZB 3I91A 3KLSA 4GOPC 3HOZH 1NR4A 4DV0Q 3ULLA 1CZGA 4DXFA 3SR1A 1SBBB 4DAYA 1DXMA 3UDGA 3SEBA 2EE1A 4A3GB 1VQOA 3A5UA 3G48A 1LT4D 2OQ0A 4RMFA 4O2DA 1C4QA 2HHHL 1U0LA 2HCCA 4O42A 5DAUA 4DAVA 1NE3A 1IHZA 3I4OA 4PZ8A 3DWAA 1MGSA 1K0RA 1WD1A 1AN8A 4DV7L 2SEBD 2WKCA 1SFOB 4F8MA 5ISRA 1E24A 1Q7YC 2F0HA 1CQFA 3KUPA 3SXHA 3RLFA 4R4CA 2PMZB 2UUBQ 5IGBA 3HOZG 3GTPB 3E6ZX 1PDQA 1MSHA 1XNQL 4IFDH 3HEJA 2MFIA 1PFSA 1GUOA 1EYDA 3CCSA 2SNSA 4B3MQ 3C1FA 4B3SL 2KA7A 4LNQA 1L2FA 3L3OC 2NBFA 4AQYQ 1YNJD 2R7DA 4K8JA 3ZJYC 5C0XJ 4DV3Q 2F0VA 2UXCL 2TMPA 2NVTH 3I4MB 3HOUH 5FJ8G 1RJTA 2OWOA 3PO2H 2JA6B 3D3RA 4A3IH 4HJAA 5BN3A 2XGTA 1Y1WG 2ZXOA 2HD3A 3KF6B 2B2VC 1NMFA 3W3AA 1ILQA 3BZDB 1VQDA 2ZT9C 4C1NK 1ZEQX 1I6HB 5CORA 1Q8IA 3STBC 3BS1A 3PMFA 1RD9D 2CWPA 1NSNS 3PUWA 3HGBA 5C4XG 1EIGA 3QB3A 5IODA 2KBNA 1M1KC 4RWSC 1B3AA 2UXDQ 1JT8A 1XX8A 1LTTD 1VQGA 4QB4A 2KHSA 1STHA 1ENFA 1B50A 1EFID 1HQMC 4PV1C 1PYSB 1PTOC 2PW5A 1S5DD 1G91A 1PHJA 1KXLA 2QGQA 3ZYYX 1X54A 3N6RA 1M90C 3CCUA 2L11A 2Q2UA 1Z7TA 3OYYA 1UEBA 5G3LD 4ZAIA 2GVAA 1WD0A 3E9IA 1V1QA 3SK8A 2OQKA 5LMNL 4KK7A 3WOEA 1Z6HA 5ELBA 5CV9A 2PCFB 1WTWA 1SNCA 1U4PA 2ID0A 5IYDG 3IFTA 5JJLA 1BOSA 4A3JH 3GTKB 1ZYRD 1LTLA 3S2DH 1I4PA 1HR0L 4R8NA 2K5NA 4RCNA 2H1EA 2WB1B 1I4XA 4ZLTF 3CCJA 5IWAQ 4JI0Q 5I2XA 2E75C 2PNHA 1NR2A 2ZTCA 1T9HA 2K03A 3T51B 1VQJA 1D5ZC 4C3IH 1JC7A 5LMUQ 2B29A 2FMMA 1PZJD 2Z1CA 4R4IA 3O13A 1TWFH 3CPFA 3EFXD 4QCLA 3GTPH 1PFMA 2MHVA 1JB3A 2Y0SE 4KJOA 2H4OA 1C7YA 1JORA 2PI2E 1K83B 2DJFC 3L9AX 4DK1A 3MZ5A 2B2UA 4CGYB 1A3TA 1ICWA 4DV7Q 3J80c 2O5JC 4Q0FA 5D14A 5GROA 4NP5A 2BA1A 2E5LL 4HIMA 1UAPA 2C9OA 1BCPF 5E7NA 3V2TA 1X32A 1TWHB 4NKLA 3C2PA 5J39A 5DM63 1TVXA 1GHKA 2VQFL 2F52A 2XWJB 1DOMA 1YJNA 3F2UA 4QMGA 1JJ2A 1V1PB 3U50C 1LTID 3NWSA 4UAIA 4JI8Q 2EYFA 2E2DC 4QJFA 5LMNW 3M4OH 2EVBA 4QGUA 5KEEA 2NN6I 4IUVA 1Y1WB 2NN6H 4A3GG 2JA5B 2CW0D 3S2HB 3KF6A 3K6OA 1LABA 1Q8KA 4G7OC 5EPKA 4GS3A 5J22A 4CKBA 1FGUA 3K80C 1MI2A 5FKAC 3I7FA 4JCVE 1MIUA 5M9OA 4POGA 2A73B 1F9RA 5EPJA 5HY6A 2F0MA 1CM9A 2CH4W 3TP7A 1ML0D 5K36G 3RD4A 4JOIC 4HTHA 4NDXA 3IL8A 5FO9B 4RGOS 1B7YB 2YV5A 4RHRA 2R3ZA 1M8AA 2PZUA 3DEPA 1SYCA 3CHBD 5IE8A 1CKOA 4B3ML 2YTXA 1PLFA 2R93G 5C4XH 5C4ZA 2R92G 4LF8L 4GN5A 4WJ3M 2Z6KA 4DNRB 3FRPB 3KYHC 1LTAD 3P75A 2I5MX 2UU9Q 4A3FG 2JQOA 3TP6A 1BNZA 2Z4HA 1WTVA 3HOVH 2ICIA 4PG3A 4FF3A 4AYBB 3K5OA 2I5HA 1F9QA 3MXNA 2Q8TA 5FLXE 5C3XA 3TN2A 3GTLB 2VL6A 5LMNQ 4GNXB 5D65A 1C8CA 3WWVA 4DUZL 2LXKA 1QZHA 4Y7NB 5IGFA 4P73A 1GKHA 5E4WC 2K5WA 2RSNA 3GD7A 5FO7B 4U673 1OXTA 5JEAJ 1STBA 3FMCA 1H9RA 1E1TA 5IT9c 2KCTA 1EQRA 5C6AA 3C46A 1R9TB 3LNNA 2JJQA 4JI2L 2NZHA 1KAAA 3HFZB 4H02A 1Q12A 1F77A 5M5XH 2UXDL 5A2QL 2CW0C 1XPRA 1RF2D 2JN4A 4C3JH 3PUZA 3H3VI 2MQHA 4OIKA 3MEFA 2N8NA 4CJ0B 2F0NA 4OO1H 1CZWA 4BBRH 5KYIA 2R93H 4A3KG 1YEZA 2ENBA 3CW2C 3CAMA 4TSSA 1MBYA 5FK9C 4DR3Q 4JI7L 1NBWA 1K8AC 1VMCA 4K5WA 4A3MB 2F3VA 1EOTA 4M8AA 1XPOA 1UEAB 3Q24A 4DPGA 4MNOA 2RDFA 1GUWA 3OMCA 4B3SQ 4RG1A 1F2LA 2B8GA 5C4HA 1BXTA 3J81j 3H0GG 5KNBA 1I3QH 1XNQQ 4O1NA 3PIOA 5M5WH 1WCMH 2R7ZH 2QDLA 1I4HA 1V1OA 3HOWG 2EPBA 2KEDA 4NW2A 2MGSA 4KI0A 3R8BA 1VQAA 4OEMB 3RZOH 5LL6S 4LAAA 3T1YL 1MJCA 2MPMA 2Z4IA 1K28A 3QOLA 4GKJQ 2XVSA 2D0PA 4LUVA 4UHVA 5FO8B 3H09A 4PMCA 4R1JA 2KEEA 2QF7A 1EQTA 4B3RQ 2B2YA 2AWOA 4XXEA 2KJXA 1SYFA 2G9HD 3KF8A 4GOPA 3HOVG 1O80A 1JE4A 4TQUS 3ULPA 4IUUA 4PMBA 1I3QB 5CYUA 5M3FG 2E2HH 1PYBA 4B3RL 1PXUA 2E5LQ 3NP8A 3RR5A 1TWAH 1SE8A 4XIGS 4HMIA 4N8FA 2VNUD 4ABNA 3GDEA 1EY4A 5KIXA 4A76A 1I4GA 1HZ9A 4HIOA 5C5LA 4XQJA 3DM1A 4KLKA 5C4JH 1SJHD 1C48A 5COYA 2R7FA 5T1IA 4DUYQ 1I94Q 2OT2A 2XIWA 3BJUA 5CV4A 5JOBA 2ZJPA 2PPBC 1QILA 1J8IA 4B9WA 4C3HB 4FO2A 1NJIC 2I5LX 2ZXPA 4PMWA 1SDFA 3P20A 2I0QA 4IN3A 1JOOA 1CHPD 4FF2A 1S72A 4DR5Q 4XT3B 3LWEA 2EY6A 1BR9A 4P71A 2RHQB 5IY0A 2A1AA 1K9MC 1HA5A 1JJGA 5GAHC 1Y14B 1QE6A 3R2IA 5IWAL 4JI0L 2EY5A 5KGUA 1WTQA 1IL2A 5GAGC 3PO2B 2OF1A 5IP7G 3MEHA 1TWCH 4TRDA 2HHHQ 4IUPA 2K50A 3G4SA 3P7JA 3I90A 2MO0A 4JI8L 1TKWB 2FXQA 4B3TQ 4XDXA 3H15A 4PQXA 3K8AA 2PQAB 1SEBD 4DV0L 2KENA 4LW1A 1TWGH 1S5BD 1K3BC 4A3CG 2VQFQ 4DAPA 2EYPA 4OONA 4DV4Q 5GQOA 3E0EA 4MZ9A 1ESFA 2CQOA 2LSSA 3DHQA 1H9KA 3U58A 4IPGA 2F0JA 4P2CB 1OXSC 2BH8A 4BA2I 1X3FA 1TY0A 3CP0A 4OO1I 1FL0A 1CHQD 4K2LA 4EQ5A 3Q23A 1X9NA 1KQSA 3PV0A 4X3SA 2IW3A 1QVFA 3D4DA 4DK6C 1HZAA 4K6DA 4KHPL 5LMUL 1B4OA 1WTHA 1Q1BA 1UWVA 2EYMA 1LT3D 1EQVA 2VUMH 5BR8Q 2I07B 3X3MA 3IRBA 3NENA 4YCVA 2QKIC 3CF5A 2KECA 2PYKA 2SNMA 5KNCA 2EJMA 4GOPB 3RZOB 3KJPA 3UDIA 3G6EA 4YCUA 2JSOA 3K0YA 4X3TA 1EYCA 4UP8A 1F2ZA 1N9WA 4KV6A 1VQ6A 1YBYA 4LUZA 1CFMA 2BE5C 1HUNA 4OX9Q 4L63B
chains in the Genus database with same CATH topology
1T5XD 1FD7D 1X3PA 2CHBD 5E4XA 1PTOF 4KMUC 4IUNA 2LY7A 2EY1A 4ULLA 1AEXA 3T56B 4HCSA 3K5LA 3I4NB 3BVGA 3NBIA 4I65A 3A54A 1Y8NB 3GTQB 2R93B 4Q5VA 1S5FD 5K36H 1RKNA 1RTOA 3D8GA 1IL8A 5EKLA 4C3JB 1LTBD 4FXGC 1SE2A 5EGTA 2F0DA 4G7ZC 3U9SA 1HRJA 5D3DA 2M00A 1SJED 3S9WA 1E2ZA 5JAVA 3MWYW 5A35A 3J80L 4RKBA 1M4VA 2VUMB 2B2TC 4CKCA 4EQPA 1LTGD 3VYRA 1L0XB 3AMUA 3JAML 3PIP3 4XYQA 1EY7A 1I4QA 2IT1A 2BOSA 1ZXTA 4A3KB 5IGGA 4HEDA 3J80E 1YNNC 2DY7A 5IOCA 5I6YA 3GP7A 3GTGB 3ND8A 4ZUIA 1DD2A 4DFAA 1X3QA 1SNDA 3S1NB 2FMCA 5BN5A 2AUJD 1E2WA 2C5CA 3Q22A 1CA5A 3FEWX 2IPKD 2A74C 2LS01 2QEJC 1EEFD 2M9VA 5CV6A 3OSOA 1GXDC 1ONLA 2RVLA 2D2CC 3MVVA 4A3BB 3K7AB 2AUKA 4KTAA 3URYA 3DXJC 2ICEC 4FF1A 3T16A 4HMJA 2K5DA 4RHSA 2BCOA 5JVH3 4FF4A 3SE0A 3S1QB 1LT5D 1AFPA 2BDNA 2OXPA 5KRUA 2D5DA 3NK9A 2HUGA 4ZQ3A 5IT9L 2F0KA 3P1HA 3D4RA 3NTKA 5JVG3 3KBGA 3MHBA 5I9OA 4C3JG 3QWNA 2HDLA 1RODA 1PMRA 1KNEA 2F0SA 1SXTA 2HDMA 3HOZB 3TDQA 1K8MA 2F0LA 2NTSA 2MP1A 5AFWA 2F03A 1QOHA 2IX0A 3WOFA 3T13A 3QIAA 2VB3X 3E0JA 3S2DB 3TMEA 3MTSA 3SK4A 3FKIB 4DN4M 3J7AV 3I72A 4HR7B 1GUTA 2NVYB 1DOLA 1V8QA 4FYDA 3X3NA 1QNUA 5JEAG 2AQ1B 1QB5D 4KN4C 1XWEA 4KY5A 2RQXA 3NE5B 4WORA 3C3LA 4RCOA 2N88A 2XNAC 4C56C 3OIPA 1AP0A 3R3OA 1EWCA 4L8JA 5C0XH 3U9OA 2EY2A 1V1PA 2MUYA 3E5SA 3A8KE 5CGKA 1BF4A 2NVTB 2PO4A 4LJZC 3MXUA 2B2WC 5DNFA 1KDAA 1G8ZD 2E74C 3J81L 3RZDB 5I6WA 1K8OA 4L6TB 1KTKA 5C5MA 3VA7A 2R6GA 2PZWA 2MJ8A 2K04A 1I4RA 3S1RB 1ESRA 1STGA 3L7ZC 2TSSA 3RUZA 1PRTB 4KKSA 1FR3A 3OHXC 2WKDA 1VDZA 1NUCA 2L1BA 3EQLC 4YIJA 1QWYA 5FOBB 2NVXB 1VF7A 3BDLA 1HXYD 2M2LA 1U4RA 2XN9C 5IT9E 2QCPX 3S17B 3OOCA 1FNUA 1TWCB 2RBMA 3GQBA 5M5XB 4OHJA 1IW7D 3SK6A 4K5VA 2JYOA 4DXGA 4BA1I 1B9MA 1SNOA 5KYLA 1CT1D 1ZKOA 3QJYA 1HFNA 2GA4B 1FNWA 1GJXA 5C4JB 2XSCA 5JEAH 1U4LA 4RGNA 3PUVA 1AZQA 3NUCA 1EZ8A 5M3FB 2A68C 4R8IA 1TWAB 1S5ED 2HQEA 3N52A 4QUCA 2EYJA 1IYVA 4K8IA 2F0QA 3BYYB 5D3IB 3FDTA 1TS3A 2NTTA 3DMUA 3BVMA 1NCVA 4V0BA 2XWBB 1KABA 3HKZB 4RGMA 2Q8IB 3DWPA 3FPPA 1LTRD 2PQEA 5CBAE 3S16B 5C3WA 1CA6A 3Q0AA 4BS9A 1SYEA 2RDHA 5M5WB 4KY7A 1G2SA 3K59A 1O7ZA 4DGZA 4DU9A 4FXDA 1LT6D 1F9PA 4J8QA 5CBEE 3K5NA 3S14B 3VA5A 5C44B 2JA8B 4WFN3 5JPMC 5HGTA 1L0YB 2K7VA 2PZTA 1D5XC 3EROA 3D4WA 3OWEB 1EY5A 2J7ZA 3H6MA 5KNDA 5J1ZA 2NYZD 4A93B 4RH6A 1OXUA 3JAME 1LO5D 3D6CA 1S4ZA 1JWMD 1TU2B 3ITPA 1ENCA 4KKTA 4XYOA 1TY2A 4S3SA 1SYGA 2LKVA 2XRSD 3SDZA 3NBHA 3BDCA 4N9TA 1HTPA 5CMDA 3NTIA 3M7GA 3T4AC 1ET6A 3WDNA 3MXGA 1SE4A 1EY0A 1H9JA 2F0PA 1Y8PB 4QUFA 3CRKC 3M85A 2PW7A 4IFDJ 2XRQD 4WJWA 1PRTC 1A2UA 4QF4A 2F1MA 3V96A 1HFGA 1ILPA 3ERQA 2A69C 4XQQA 4H7BA 1KDCA 2X69A 1KNAA 3J7YW 1IYUA 4F87A 1B2TA 2G9DA 3EJIA 2FHTA 2Y0SB 4UDUC 5EBDA 2F0IA 2K5QA 2A6HC 1D6EC 3SVMA 4RGTA 1D1IA 1KLGD 4KN7C 1STYA 3OMGA 3A56A 5E1FA 4I7ZC 5K5PA 1OO9B 4FNFA 3R93A 1KDBA 3VR4A 1HUMA 5LHY1 4ID6A 3NSWA 2EOTA 2A6HD 2IL8A 1GOZA 1BCPB 3MFYA 3TP8A 4IUTA 3NXWA 3K58A 4B08A 4GZYC 1FNVA 3G7LA 3BG3A 1TWGB 2F0WA 1CK1A 2B8FA 3I73A 5C0XI 4JBWA 2NUCA 1E2VA 3V05A 4A3FB 2VB2X 2K01A 4BY7B 2NN6G 3OWFA 2WINB 4A3JB 3I8ZA 1EY9A 4LMQD 1FGBD 3I3CA 2B2WA 2E2IB 2BE5D 1W6JA 3S15B 1SNPA 2B2VA 1Q3LA 1FYCA 2WP8J 2B63B 5IGCA 1G2TA 2VXWA 1D2BA 3IAYA 2RA4A 2I46A 3OPOA 1VMPA 4OGQC 3SHLA 2EYHA 5NUCA 5IGDA 1R4QB 1O7LA 2K33A 1O7YA 1VCIA 1ZYRC 3HOYB 3LWUA 1A2TA 1T5EA 1TQOA 4C3IG 1UUPA 5C4XB 2YU9B 3Q6SA 1H9SB 1EEID 1IKMA 2JEAI 3A7LA 4CHTB 4PNYA 1XXGA 1EY6A 2R92B 5FLXL 5CV8A 1PTOD 2IX1A 2NB0A 1EY8A 3PO3B 2J4XA 1PZKD 4X3UA 1B9NA 1BCPD 2WIIB 1DZ1A 1D1KA 3NPPA 2K28A 1S5CD 5LL6X 3J81E 2K32A 4A3DB 3BDOA 1HA6A 4CJ1B 2A5HA 3T53B 1BO0A 4ODGA 1AW7A 2JP1A 1HTLD 5CV7A 1TT2A 1YNJC 3S1MB 4IQZA 1VF5C 4Z9CB 4KHVA 5A2QE 4IZ8A 2SOBA 5EBCA 1TR5A 3H94A 3PUXA 1DOKA 3A7AB 2LMCB 1CTMA 2RDGA 5EQ0A 2L12A 2EXZA 1HQRD 3A8IE 3CKIB 1PRTD 2D62A 3KK7A 3H3VC 5CV5A 3GTJB 4XTCS 1EWHA 5CC4A 3RMHA 4HSVA 1BCPC 1II3A 1XTCD 3ONAB 2IJ0A 3VR5A 2KUMA 1SYBA 4CJ2C 3M3YB 1CQVA 4KD4A 2OEOA 1JOKA 5T1GA 1WTOA 4J6HA 3TSSA 1PZID 3PUYA 3AB9A 1H9MA 2BA0A 2QILA 4H13C 1SYDA 5M3MB 1Q1EA 3FPUB 3TZUA 3KLSX 2DN8A 1QNKA 2O5IC 1MSGA 2KCCA 1SSOA 2L0CA 1RDPD 3GV6A 2IX3A 3BVZA 5I9PA 2WACA 4ZKCB 4F7XA 3R2TA 2PNRC 1U4MA 2HCIA 4MN3A 4MIUA 4F88A 5C3EB 4E6IA 1JQYD 4OO1G 2JE6I 4XQNA 2DY8A 2EYOA 1B53A 4HCEA 4G4KA 2D9UA 4BWGB 5C0XG 5EKIA 5JPNC 5HURA 4IFDG 4HAEA 3HS0C 3MA2B 3D6WA 2X6LA 3I4LA 1I6VC 1LLRD 2RKSA 4FVMA 3J7AF 3SK5A 1V43A 1D5MC 3VR3A 1A3VA 3FVQA 2B2YC 3HG9A 3HP3A 2KOLA 3KBXA 1UNSA 1R4PB 3H0GB 1TS2A 1JR0D 4KHZA 4H44C 1WVLA 4MHEA 3HRZC 4RAUC 2F0TA 4OL7A 2EYLA 5I4DA 2YYZA 3H91A 3UI2A 4RFBA 5E3FA 2F4IA 3VYUA 2L55A 1SNMA 1EU3A 1TWFB 4K2KA 4FXKC 2A69D 4ILWA 3IFDA 2JEBI 1RTNA 3A55A 2F0FA 2F0GA 4CBVA 3HOWB 4IUQA 3HOUB 3DWQA 4A3EB 4H0LC 1E0BA 2A6EC 1XYIA 2N55A 2A6ED 1WTPA 1SE3A 4IALA 4HN7A 5ELDA 2IWHA 1TS4A 1KLUD 3QOJA 2FJ2A 1HCZA 4HSPA 5BN4A 1EZ6A 3GV3A 4QIWB 5JJZA 3HOVB 3MXPA 1G291 4EVOA 3TBIB 4U68A 4FP5D 3A8JE 3D31A 5ELCA 2R61A 4OIJA 1SMYC 2J0TD 4BBRB 4RKLA 1G6ZA 1JICA 4G7HC 4IFDI 1W6KA 2EJGC 5DM73 4LK1C 3VYTA 5ELEA 3QG1A 4KD3A 1TIID 2WV6D 2X6GA 3HOXB 1RHPA 2NZ1D 3TZDA 1B44D 1TS5A 2V4DA 1QCBD 1Y8OB 1PFBA 4ZRZA 3NQIA 2CVRA 1O78A 1F2YA 5DEHA 2EDGA 1JOQA 1SMYD 4KJNA 4X3KA 1SAPA 1EIHA 2QDBA 3DEOA 3KLRA 1HHVA 2RSOA 2A68D 1QJOA 1GHJA 1YNND 1A6XA 2Z8LA 3MFGA 5TSSA 2E2HB 1QG7A 3VR6A 5G3LF 1GUSA 3W2DA 2KCNA 2LFNA 1Q90A 3MAQA 2BDOA 2F3WA 1ET9A 3GTMB 3EVQA 1U9RA 3M4OB 2B2TA 1WCMB 4EQOA 4NMZA 1Y69U 3PIO3 4WRDA 3GO5A 1SNQA 1F2MA 2EZVA 4V190 1GUNA 5F2DA 3OW7A 5EPLA 2JXMB 2B2UC 1PTOH 1DM0B 1STAA 1IW7C 5M5YB 2AQ3B 1AZPA 4ZK9B 3NWTA 1BUVT 1Y1VB 2SDFA 4KY6A 2FINB 1BQQT 2B39A 1JWSD 2KVMA 3GTOB 2L5TA 1GUGA 2F0UA 5I2YA 4C3IB 4J1MA 1PYWD 4C1NI 3HZXA 4DF7A 2NWGA 1DONA 3OIQA 4BY1B 3M4YA 4A3IB 2K05A 1J9OA 2F0EA 1STEA 2EJFC 1EYAA 4DK0A 3C1EA 3MC0B 5ELFA 3VYSA 1OXXK 1BBXC 2E76C 1PFNA 2K1BA 4K5XA 2E2JB 4TKOB 1I50B 1STNA 4R9WA 3BYTB 4K14A 3NTHA 1LTSD 2KQ3A 4ZUJA 2JA7B 1DCZA 3IKJA 2O4XA 2ZXRA 3G6JB 3K57A 1PRTF 2AWNA 4KKUA 4BBSB 1A3UA 5EKKA 1PTOB 3DUZA 4C3HG 4N9PA 4G57A 1JWUD 4ME5A 1F9SA 2O2LD 2CQAA 4EGVA 1EU4A 4B9XA 5IGEA 4JK1C 2NVQB 1WTXA 1H9SA 4XT1B 1WTRA 1A15A 1B1ZA 1ENAA 3ND9A 3QO2A 3CQZB 4CKEA 3AU7A 3NQTA 1RCVD 2DNCA 2Q8RE 3EA6A 4K6LA 1OXVA 2F0OA 3VR2A 2FFKB 5CR3A 1JCKB 1MD2D 1HPCA 1LACA 1DJRD 5IIFA 1IKLA 4DNTB 4IURA 5EJWA 1Z47A 4ZKBB 2AQ2B 2DNEA 2K6AA 1LV9A 3CRLC 3CU7A 3TP5A 1CI3M 4C2MB 1DYQA 4M1UB 2L9HA 3I70A 3LX0A 3K5MA 4RA8A 1EL0A 4DA2A 2WAQB 2L4NA 4ZYSA 1NAPA 3M7NA 1BDOA 4EQNA 3NHHA 2R7ZB 3I91A 3KLSA 1NR4A 1CZGA 4DXFA 3SR1A 1SBBB 4DAYA 1DXMA 3SEBA 2EE1A 4A3GB 1LT4D 1C4QA 4DAVA 2HCCA 4O42A 5DAUA 1IHZA 3DWAA 1MGSA 1WD1A 1AN8A 2SEBD 2WKCA 1SFOB 4F8MA 5ISRA 2F0HA 1CQFA 3KUPA 3SXHA 3RLFA 2PMZB 5IGBA 3GTPB 3E6ZX 1PDQA 1MSHA 4IFDH 3HEJA 1GUOA 1EYDA 2SNSA 3C1FA 2KA7A 3L3OC 2NBFA 1YNJD 4K8JA 5C0XJ 2F0VA 2TMPA 3I4MB 1RJTA 2JA6B 3D3RA 5BN3A 2ZXOA 2B2VC 3W3AA 1ILQA 3BZDB 2ZT9C 4C1NK 1ZEQX 1I6HB 5CORA 1Q8IA 3BS1A 3PMFA 1RD9D 1NSNS 3PUWA 3HGBA 1EIGA 3QB3A 5IODA 4RWSC 1B3AA 1XX8A 1LTTD 4QB4A 2KHSA 1STHA 1ENFA 1B50A 1EFID 1HQMC 4PV1C 2PW5A 1PTOC 1S5DD 1G91A 3ZYYX 3N6RA 2L11A 1Z7TA 5G3LD 4ZAIA 1WD0A 3SK8A 4KK7A 3WOEA 1Z6HA 5ELBA 5CV9A 2PCFB 1WTWA 1SNCA 1U4PA 2ID0A 3IFTA 1BOSA 3GTKB 1ZYRD 1I4PA 4R8NA 4RCNA 2H1EA 2WB1B 1I4XA 4ZLTF 5I2XA 2E75C 1NR2A 2K03A 3T51B 1D5ZC 1JC7A 2FMMA 1PZJD 2Z1CA 3O13A 3EFXD 4QCLA 1PFMA 2MHVA 1JB3A 4KJOA 2H4OA 1JORA 1K83B 3L9AX 4DK1A 3MZ5A 2B2UA 4CGYB 1A3TA 1ICWA 2O5JC 4Q0FA 5D14A 4NP5A 2BA1A 1UAPA 2C9OA 1BCPF 3V2TA 1X32A 1TWHB 4NKLA 3C2PA 5J39A 5DM63 1TVXA 1GHKA 2XWJB 1DOMA 3F2UA 4QMGA 1V1PB 1LTID 3NWSA 4UAIA 2EYFA 2E2DC 2EVBA 5KEEA 2NN6I 4IUVA 1Y1WB 2NN6H 2JA5B 2CW0D 3S2HB 3K6OA 1LABA 4G7OC 5EPKA 5J22A 4CKBA 1MI2A 5FKAC 5M9OA 2A73B 1F9RA 5EPJA 2F0MA 1CM9A 3TP7A 5K36G 1ML0D 3RD4A 4HTHA 4NDXA 3IL8A 5FO9B 4RGOS 4RHRA 2R3ZA 1M8AA 2PZUA 3DEPA 1SYCA 3CHBD 1PLFA 5C4ZA 4DNRB 3FRPB 1LTAD 3P75A 1BNZA 3TP6A 2Z4HA 1WTVA 2ICIA 4FF3A 4AYBB 5FLXE 3K5OA 1F9QA 3MXNA 2Q8TA 5C3XA 3TN2A 3GTLB 5D65A 1C8CA 4Y7NB 5IGFA 5E4WC 2K5WA 2RSNA 3GD7A 5FO7B 4U673 1OXTA 5JEAJ 1STBA 3FMCA 1H9RA 5C6AA 3C46A 1R9TB 3LNNA 1KAAA 1Q12A 1F77A 5A2QL 2CW0C 1RF2D 3PUZA 4OIKA 4CJ0B 2F0NA 4OO1H 1CZWA 5KYIA 2ENBA 4TSSA 1MBYA 5FK9C 1VMCA 4K5WA 4A3MB 2F3VA 1EOTA 4M8AA 1UEAB 3Q24A 2RDFA 1GUWA 3OMCA 1F2LA 2B8GA 5C4HA 1BXTA 5KNBA 4O1NA 1I4HA 1V1OA 2EPBA 2KEDA 2MGSA 4KI0A 4NW2A 3R8BA 5LL6S 4LAAA 2MPMA 2Z4IA 3QOLA 2XVSA 5FO8B 3H09A 4PMCA 2KEEA 2QF7A 1EQTA 2B2YA 2AWOA 4XXEA 2KJXA 1SYFA 2G9HD 3KF8A 1O80A 1JE4A 4TQUS 4IUUA 4PMBA 1I3QB 5CYUA 1PXUA 3NP8A 4XIGS 4HMIA 2VNUD 4ABNA 1EY4A 5KIXA 1I4GA 5C5LA 4XQJA 3DM1A 1SJHD 1C48A 5COYA 5T1IA 2OT2A 2XIWA 5CV4A 5JOBA 2PPBC 1QILA 1J8IA 4B9WA 4C3HB 4FO2A 2ZXPA 4PMWA 1SDFA 3P20A 4IN3A 1JOOA 1CHPD 4FF2A 4XT3B 2EY6A 3LWEA 1BR9A 1HA5A 3R2IA 1QE6A 3PO2B 2EY5A 5KGUA 1WTQA 2OF1A 3MEHA 4TRDA 4IUPA 3P7JA 3I90A 1TKWB 4XDXA 4PQXA 1SEBD 1S5BD 4DAPA 2EYPA 1ESFA 3DHQA 1H9KA 2F0JA 4P2CB 1OXSC 4BA2I 1TY0A 4OO1I 3Q23A 1CHQD 4K2LA 3PV0A 4X3SA 2IW3A 3D4DA 4K6DA 1B4OA 1Q1BA 2EYMA 1LT3D 1EQVA 2I07B 3X3MA 2QKIC 2KECA 2PYKA 2SNMA 5KNCA 2EJMA 3RZOB 2JSOA 3K0YA 4X3TA 1EYCA 1F2ZA 4KV6A 1CFMA 2BE5C 1HUNA 4L63B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T1I A;  1ICW A;  2IL8 A;  1S4Z A;  1AZP A;  4ZK9 B;  2N88 A;  2XIW A;  1X3P A;  5D14 A;  2SDF A;  5E4X A;  1U4L A;  1J8I A;  4X3U A;  1X32 A;  1AZQ A;  4OIK A;  4IUT A;  2FIN B;  2RVL A;  5T1G A;  2FFK B;  1TVX A;  4CJ0 B;  2X6G A;  1WTO A;  1DZ1 A;  1SDF A;  1DOM A;  1WVL A;  4MHE A;  1RHP A;  1RJT A;  2NZ1 D;  1AP0 A;  2KVM A;  3TZD A;  3G7L A;  4R8I A;  4RAU C;  3F2U A;  4XT3 B;  2K28 A;  3LWE A;  1IKL A;  4HCS A;  3N52 A;  1PFB A;  4IUR A;  3H91 A;  4QUC A;  4UAI A;  3FPU B;  1VMC A;  2B2V C;  5EJW A;  1ILQ A;  4ZKB B;  2CVR A;  3UI2 A;  1QE6 A;  5CMD A;  1HA6 A;  4CJ1 B;  1WTQ A;  1EOT A;  2NWG A;  1DON A;  1QNK A;  5COR A;  1LV9 A;  1BO0 A;  1MSG A;  3FDT A;  4IUP A;  4IUV A;  2BDN A;  2K05 A;  4X3K A;  1BF4 A;  1GUW A;  3P7J A;  1SAP A;  2K01 A;  1RTO A;  1EIG A;  1SSO A;  1J9O A;  3I90 A;  1EIH A;  2JP1 A;  1IL8 A;  4RWS C;  4QUF A;  1NCV A;  2HUG A;  1B3A A;  3DEO A;  3GV6 A;  3IFD A;  2B2W C;  4XDX A;  1HHV A;  2RSO A;  5DNF A;  1F2L A;  1XX8 A;  5EPK A;  1RTN A;  2L9H A;  1MI2 A;  3I8Z A;  1HRJ A;  4LMQ D;  1F9R A;  5EPJ A;  4ZKC B;  1B50 A;  4RA8 A;  1EL0 A;  1CM9 A;  5CBA E;  3I3C A;  1ML0 D;  2B2W A;  1BBX C;  2L4N A;  3MWY W;  3IL8 A;  1PFN A;  2K1B A;  2HDL A;  4IUQ A;  2B2T C;  1G91 A;  1QG7 A;  1ROD A;  1HFG A;  2B2V A;  2EPB A;  1Q3L A;  1ILP A;  1U4M A;  1NAP A;  2HCI A;  2KED A;  2MGS A;  2L11 A;  2R3Z A;  4MN3 A;  4NW2 A;  1M8A A;  2MJ8 A;  3DEP A;  2K04 A;  4R9W A;  1CA6 A;  1KNE A;  1E0B A;  1DOK A;  1ESR A;  1PLF A;  2HDM A;  2VXW A;  4ZAI A;  1G2T A;  1WD0 A;  2X69 A;  1KNA A;  2MPM A;  2N55 A;  1XYI A;  2RA4 A;  1WTP A;  1VMP A;  1B2T A;  1G2S A;  3I91 A;  2FHT A;  2MP1 A;  1O7Z A;  2FJ2 A;  5EQ0 A;  5AFW A;  1ZXT A;  2L1B A;  1NR4 A;  2L12 A;  4X3S A;  1U4P A;  2DY8 A;  1WTW A;  4HED A;  2EOT A;  2DY7 A;  1B53 A;  2KEE A;  1BNZ A;  1F9P A;  1EQT A;  2B2Y A;  1WTV A;  2D9U A;  1B4O A;  2EE1 A;  2M2L A;  1U4R A;  3GV3 A;  1O7Y A;  5EKI A;  3MTS A;  5JJZ A;  5CBE E;  4DN4 M;  2H1E A;  4ZLT F;  1O80 A;  4HAE A;  1F9S A;  3SVM A;  1JE4 A;  2B2T A;  1F9Q A;  2Q8T A;  4IUU A;  3D6W A;  3TN2 A;  2X6L A;  1NR2 A;  4U68 A;  2HCC A;  4O42 A;  4HSV A;  2K03 A;  2KEC A;  5D65 A;  1C8C A;  4OIJ A;  2JYO A;  1DOL A;  1WTX A;  1MGS A;  1WD1 A;  1X3Q A;  4XT1 B;  5E4W C;  3ONA B;  2RSN A;  1WTR A;  3Q6S A;  1A15 A;  2FMM A;  3KUP A;  1IKM A;  2J7Z A;  3QO2 A;  4X3T A;  1G6Z A;  1PFM A;  5EPL A;  2B2U C;  1PDQ A;  2KUM A;  2NYZ D;  1MSH A;  1JIC A;  1CA5 A;  3R93 A;  1HFN A;  3DM1 A;  1HUM A;  2B2Y C;  1HUN A;  3HP3 A;  2KOL A;  2Q8R E;  3KBX A;  4CJ2 C;  5COY A;  2B2U A; 
#chains in the Genus database with same CATH topology
 4GLV B;  1T5X D;  4L5Q A;  4LF5 Q;  1FD7 D;  1X3P A;  2CHB D;  1W2B A;  5E4X A;  1PTO F;  4KMU C;  4IUN A;  2LY7 A;  2EY1 A;  4ULL A;  2A19 A;  1AEX A;  3T56 B;  4HCS A;  3D0F A;  2JA5 G;  2C35 B;  2MO1 A;  3K5L A;  1IBK L;  3KLW A;  4DUZ Q;  3I4N B;  3BVG A;  3NBI A;  4I65 A;  3CCL A;  2K75 A;  3A54 A;  1Y8N B;  4J15 A;  3GTQ B;  2R93 B;  4Q5V A;  1S5F D;  5IP7 H;  2VZA A;  4GNX A;  5K36 H;  1RKN A;  1E3P A;  1RTO A;  2ZTD A;  3D8G A;  1IL8 A;  5EKL A;  4C3J B;  1LTB D;  4FXG C;  1QUQ B;  1KL9 A;  1SE2 A;  5EGT A;  1NNX A;  3F8T A;  2F0D A;  4G7Z C;  3U9S A;  3CC2 A;  1HRJ A;  5D3D A;  4A75 A;  2M00 A;  1SJE D;  3T1Y Q;  3S9W A;  1E2Z A;  5JAV A;  4LFC L;  3MWY W;  5A35 A;  3J80 L;  4RKB A;  1M4V A;  1XMQ L;  2VUM B;  2B2T C;  3I4M G;  4CKC A;  4EQP A;  4N8X 1;  1LTG D;  2B3G A;  1W3S A;  4YWK A;  3VYR A;  1L0X B;  3AMU A;  3JAM L;  3PIP 3;  4XYQ A;  4A3D G;  1EY7 A;  1I4Q A;  3FKI G;  3NEL A;  1C0A A;  2IT1 A;  2BOS A;  1ZXT A;  4A3K B;  5IGG A;  4HED A;  4AIM A;  2JA9 A;  3J80 E;  1YNN C;  2DY7 A;  5IOC A;  5I6Y A;  1U5K A;  5M3M G;  3GP7 A;  1BKB A;  4DV5 Q;  3GTG B;  4JI1 L;  3ND8 A;  4ZUI A;  4A3M H;  1DD2 A;  1HR0 Q;  4DFA A;  4JI7 Q;  4BXX G;  3G71 A;  1X3Q A;  1SND A;  3S1N B;  2FMC A;  2VY3 A;  5BN5 A;  2AUJ D;  1E2W A;  2E2J H;  1RIP A;  4QIW E;  1EFW A;  2C5C A;  3TRE A;  3Q22 A;  1H95 A;  1CA5 A;  3F2C A;  3FEW X;  2IPK D;  2A74 C;  2LS0 1;  1V9P A;  1L1O B;  4GLX A;  2QEJ C;  1Q46 A;  1EEF D;  4UPA A;  5C44 G;  3A0J A;  1N33 L;  1VQN A;  2M9V A;  4QL5 A;  2R92 H;  5CV6 A;  3OSO A;  1YNX A;  1G51 A;  4NXN Q;  1GXD C;  1ONL A;  4R4Q A;  2ES2 A;  2RVL A;  2D2C C;  3MVV A;  4A3B B;  3K7A B;  4CDF C;  3CCV A;  2AUK A;  4KTA A;  3URY A;  2YU9 H;  3DXJ C;  4AYB E;  2ICE C;  4FF1 A;  3T16 A;  1VQ8 A;  3E9H A;  5IYC H;  4HMJ A;  2R7Z G;  2K5D A;  1VQP A;  5C3E G;  3PGZ A;  4RHS A;  2BCO A;  5JVH 3;  4FF4 A;  3SE0 A;  3S1Q B;  2JA7 G;  1L0W A;  1LT5 D;  1HJP A;  1AFP A;  2BDN A;  2OXP A;  5KRU A;  1HH2 P;  2D5D A;  3NK9 A;  3ULJ A;  2HUG A;  3QR8 A;  1PH4 A;  1YZ6 A;  4ZQ3 A;  5IT9 L;  2F0K A;  2DGY A;  3P1H A;  3D4R A;  4A3K H;  4LF4 L;  3LGJ A;  3NTK A;  1HNW Q;  4AQY L;  5JVG 3;  3KBG A;  3MHB A;  2MNA A;  5I9O A;  3J81 c;  4C3J G;  3QWN A;  2HDL A;  3KDF B;  3F2B A;  1ROD A;  1PMR A;  1KNE A;  2F0S A;  1SXT A;  2HDM A;  3W1G A;  3HOZ B;  5AJ3 Q;  3TDQ A;  1K8M A;  2F0L A;  2NTS A;  2N3S A;  2MP1 A;  5AFW A;  2F03 A;  1QOH A;  1Z9F A;  2IX0 A;  1CUK A;  3WOF A;  3UDX A;  3T13 A;  3QIA A;  2VB3 X;  1A63 A;  3E0J A;  1Y1W H;  3S2D B;  3TME A;  3MTS A;  3SK4 A;  3FKI B;  4DN4 M;  4IO9 A;  4DV1 L;  4C3H H;  1HNX L;  3S16 H;  3J7A V;  3I72 A;  4HR7 B;  2Z6B A;  1VQK A;  1GUT A;  4DAM A;  2NVY B;  3I4N H;  1DOL A;  1V8Q A;  4FYD A;  1D7Q A;  3EIV A;  3X3N A;  1QNU A;  5JEA G;  2AQ1 B;  1QB5 D;  4KN4 C;  1XWE A;  4KY5 A;  1TXY A;  4X64 L;  2RQX A;  4IPH A;  4OXP A;  3NE5 B;  4WOR A;  2NZO A;  3C3L A;  1P16 A;  4RCO A;  2N88 A;  2XNA C;  4JW0 A;  3KOJ A;  4L5S A;  1IXR A;  1YJW A;  4C56 C;  1IBL Q;  3AFQ A;  3OIP A;  1AP0 A;  3R3O A;  1O7I A;  1X55 A;  3J81 i;  1EWC A;  4L8J A;  5C0X H;  1LM0 A;  1ASY A;  2ZJQ A;  3U9O A;  4IJH A;  3CC7 A;  2EY2 A;  1EQQ A;  1V1P A;  1EOV A;  3CQZ H;  4DR1 Q;  2MUY A;  3UDF A;  3E5S A;  3A8K E;  3K7U C;  3NEM A;  5CGK A;  1BF4 A;  3GTK H;  2NVT B;  2PO4 A;  2IHE A;  3HKZ E;  2AKW B;  4LJZ C;  2HT1 A;  3MXU A;  2B2W C;  5DNF A;  3S24 A;  1WFQ A;  3AFP A;  2NVQ H;  3DM3 A;  3HOX G;  1KDA A;  1G8Z D;  2E74 C;  5FLM G;  3J81 L;  3RZD B;  1PH6 A;  5I6W A;  1K8O A;  5C3E H;  4L6T B;  1KTK A;  5C5M A;  4A93 H;  3VA7 A;  1BVS A;  2R6G A;  2PZW A;  1HZB A;  2MJ8 A;  2K04 A;  1I4R A;  3S1R B;  5HGQ A;  1ESR A;  1STG A;  2UUA L;  3L7Z C;  2TSS A;  3RUZ A;  4JI3 L;  1PRT B;  4JI4 L;  3KDF A;  4KKS A;  1FR3 A;  3OHX C;  2WKD A;  4A3I G;  1VDZ A;  2JA8 G;  1NUC A;  2L1B A;  3EQL C;  1QWY A;  2VS1 A;  4YIJ A;  3TQY A;  5FOB B;  3PSI A;  2NVX B;  3GTG H;  4P75 A;  1VF7 A;  3A74 A;  3BDL A;  1HXY D;  5JJK A;  2M2L A;  3H3V H;  2ASB A;  1U4R A;  2XN9 C;  5IT9 E;  2QCP X;  2B63 H;  2F4V L;  3S17 B;  3OOC A;  1PH1 A;  1L1O C;  1FNU A;  1TWC B;  1K3R A;  2RBM A;  3GQB A;  5M5X B;  4OHJ A;  1VQL A;  4JBM A;  1IW7 D;  3SK6 A;  4EX5 A;  4K5V A;  2JYO A;  1N32 Q;  4DXG A;  2UU9 L;  4BA1 I;  1QUQ A;  1N34 Q;  4X6A H;  2JA6 G;  1B9M A;  1SNO A;  5KYL A;  2UXC Q;  3BU2 A;  1CT1 D;  1ZKO A;  2D0O A;  2HIX A;  3KJO A;  3QJY A;  1HFN A;  1UE6 A;  2GA4 B;  1WJJ A;  1FNW A;  1JMC A;  4ME3 A;  5DLQ E;  2JK8 A;  2B63 G;  1GJX A;  1KC8 C;  5C4J B;  2XSC A;  5JEA H;  3FHW A;  1U4L A;  2AMC B;  4RGN A;  3PUV A;  5ELO A;  4DV2 L;  3NUC A;  1AZQ A;  3B6Y A;  4A4I A;  1EZ8 A;  5M3F B;  2A68 C;  1FJG Q;  4LF9 Q;  4R8I A;  2ALY B;  4DAY B;  1TWA B;  1S5E D;  2HQE A;  3N52 A;  4QUC A;  2EYJ A;  1IYV A;  4MTK A;  2WB1 G;  4K8I A;  2F0Q A;  1SRU A;  1X65 A;  3BYY B;  5D3I B;  3FDT A;  1TS3 A;  3H0G H;  2NTT A;  3DMU A;  3BVM A;  1NCV A;  3AQQ A;  4V0B A;  2XWB B;  1KAB A;  3HKZ B;  4RGM A;  2Q8I B;  3PIP A;  1VQ7 A;  3CD6 A;  3DWP A;  1YHA A;  3FPP A;  2VQE L;  3CCE A;  1LTR D;  2PQE A;  4DR4 L;  5CBA E;  3S16 B;  1EIY B;  3K7A H;  1VQH A;  1J5E L;  4FDB A;  3GTM H;  5C3W A;  4JI5 Q;  1CA6 A;  3Q0A A;  4BS9 A;  1SYE A;  2RDH A;  5M5W B;  4CDC C;  2CCZ A;  1VQF A;  4KY7 A;  3CXC A;  1N32 L;  1G2S A;  3K59 A;  1O7Z A;  1Q81 C;  2RCN A;  2UXB L;  4OWW B;  4DGZ A;  4DU9 A;  3AYH B;  4X62 L;  2ZM6 L;  4FXD A;  2H5X A;  1LT6 D;  4DKA C;  3L2P A;  1F9P A;  4J8Q A;  1IBM L;  5CBE E;  3K5N A;  3S14 B;  3VA5 A;  4LF6 Q;  1X3E A;  5C44 B;  2JA8 B;  4WFN 3;  5JPM C;  4OWT B;  4CDD C;  5HGT A;  1L0Y B;  1LUZ A;  3U4Z A;  5IYB G;  2K7V A;  2PZT A;  1D5X C;  3ERO A;  3D4W A;  3OWE B;  3M9B A;  3L0O A;  1EY5 A;  2J7Z A;  3H6M A;  5KND A;  3S1Q H;  5J1Z A;  2NYZ D;  4A93 B;  4RH6 A;  1OXU A;  3JAM E;  1XJV A;  1LO5 D;  3D6C A;  1LYL A;  4O0A A;  1VQM A;  3PO3 H;  1E22 A;  1S4Z A;  1Y1V G;  3JAM i;  1JWM D;  1TU2 B;  2YTV A;  3ITP A;  1ENC A;  4KKT A;  4XYO A;  4ALP A;  4JI6 L;  1K0S A;  1TY2 A;  4S3S A;  4BBS G;  1SYG A;  4JOI A;  2LKV A;  2XRS D;  3SDZ A;  3NBH A;  3BDC A;  1EIF A;  4N9T A;  1HTP A;  5CMD A;  1YIJ A;  3NTI A;  3RNU A;  3M7G A;  2UUC L;  3T4A C;  1ET6 A;  3WDN A;  3GTL H;  3MXG A;  1SE4 A;  2UXB Q;  1EY0 A;  1H9J A;  2F0P A;  2DJG C;  1G6P A;  1Y8P B;  2PQA A;  4QUF A;  3CRK C;  2Z6K C;  3M85 A;  1XTD A;  3OW2 A;  3S1N H;  2PW7 A;  4IFD J;  2XRQ D;  4WJW A;  1PRT C;  4JC0 A;  3OTO Q;  4DV3 L;  3F2D A;  3PO3 G;  1A2U A;  4JV5 Q;  4QF4 A;  2F1M A;  2IY5 B;  2CWA A;  3KFU A;  3V96 A;  1HFG A;  1ILP A;  5IYC G;  4DR6 Q;  3ERQ A;  4X66 L;  2A69 C;  4YWL A;  4H7B A;  4XQQ A;  1KDC A;  3U4V A;  4YHH L;  4K0K L;  1AE2 A;  2X69 A;  1KNA A;  3J7Y W;  1IYU A;  4F87 A;  1B2T A;  2NVY H;  2G9D A;  3EJI A;  3CMA A;  2FHT A;  2CKZ B;  2QW7 A;  2K5H A;  2Y0S B;  4UDU C;  5EBD A;  2F0I A;  2K5Q A;  2A6H C;  1D6E C;  3SVM A;  1PH8 A;  1KIX A;  4LF9 L;  4RGT A;  4JI6 Q;  1XPU A;  1D1I A;  5ELN A;  4LFA L;  1KLG D;  4DV2 Q;  4KN7 C;  1YJ9 A;  1STY A;  4X65 Q;  3OMG A;  3A56 A;  1A0I A;  5E1F A;  4I7Z C;  5H1S E;  3GTQ H;  4DR6 L;  5K5P A;  1OO9 B;  4FNF A;  3R93 A;  1Y1V H;  1PV4 A;  1KDB A;  3VR4 A;  1SFO H;  3ICE A;  1HUM A;  3T1H Q;  5GAD C;  5LHY 1;  4K0K Q;  4ID6 A;  5FLX c;  4JPB W;  1KHI A;  3NSW A;  2EOT A;  2A6H D;  2IL8 A;  1GOZ A;  1BCP B;  3I56 A;  2JA8 H;  1CKN A;  3MFY A;  3TP8 A;  4A3L H;  1GM5 A;  1HNZ Q;  4IUT A;  3NXW A;  4Y52 H;  3PQI A;  2OTJ A;  3K58 A;  4B08 A;  4GKK L;  4DV6 Q;  5IP9 G;  4GZY C;  1FNV A;  3G7L A;  3BG3 A;  1YHB A;  1TWG B;  2F0W A;  1CK1 A;  2KHI A;  2ZM6 Q;  1IYJ B;  2B8F A;  3I73 A;  1XNR L;  5C0X I;  4JBW A;  2NUC A;  1E2V A;  3V05 A;  4QQB X;  4A3F B;  2VB2 X;  1QVG A;  2K01 A;  4BY7 B;  2NN6 G;  3OWF A;  1X56 A;  4NXM L;  2WIN B;  4A3J B;  2CFM A;  3I8Z A;  4GN4 B;  1EY9 A;  4LMQ D;  1FGB D;  3I3C A;  2B2W A;  2E2I B;  2BE5 D;  1W6J A;  4JYA Q;  3S15 B;  1SNP A;  2B2V A;  3EBE A;  1E1O A;  1Q3L A;  1FYC A;  2WP8 J;  2B63 B;  1C9O A;  4POF A;  3I2Z A;  5IGC A;  1G2T A;  2VXW A;  1D2B A;  2KCM A;  2RHS B;  2NVX H;  3IAY A;  2RA4 A;  2I46 A;  3K81 C;  3OPO A;  1VMP A;  4OGQ C;  3HOU G;  1P8L A;  2HIV A;  3SHL A;  3HOY H;  2EYH A;  4DR1 L;  5NUC A;  3CPW A;  5IGD A;  5M3F H;  1R4Q B;  3S1R H;  1O7L A;  2K33 A;  3J7A 5;  1O7Y A;  1VCI A;  1ZYR C;  3HOY B;  3PO2 G;  3LWU A;  1A2T A;  4MTN A;  1T5E A;  1TQO A;  1I6H H;  4C3I G;  1UUP A;  4LF6 L;  5C4X B;  4PZ7 A;  1L1O A;  2YU9 B;  3Q6S A;  1H9S B;  1EEI D;  1IKM A;  2JEA I;  3A7L A;  4GKK Q;  4JI5 L;  4CHT B;  4PNY A;  1XXG A;  1EY6 A;  2R92 B;  5EAY A;  3HOW H;  5FLX L;  5CV8 A;  4A93 G;  1PTO D;  1K73 C;  2IX1 A;  2NB0 A;  4DR7 L;  1EY8 A;  3RN5 A;  3PO3 B;  2J4X A;  4BY7 H;  1KRS A;  1PZK D;  4X3U A;  4IOA A;  1B9N A;  1BCP D;  2WII B;  1DZ1 A;  1D1K A;  2UUC Q;  3NPP A;  3BZK A;  2EXD A;  2K28 A;  1HNX Q;  1S5C D;  5LL6 X;  3J81 E;  2K32 A;  4A3D B;  3S1M H;  1YVC A;  3BDO A;  4PZ6 A;  1HA6 A;  4CJ1 B;  3M4P A;  4R4T A;  2ZJR A;  1N36 Q;  2A5H A;  1QVC A;  2JA7 H;  3T53 B;  1XMO L;  1YHQ A;  1BO0 A;  4ODG A;  3PF4 A;  4NXN L;  1AW7 A;  2F3I A;  2JP1 A;  1HTL D;  5CV7 A;  4GKJ L;  1TT2 A;  2YTY A;  1YNJ C;  1KAW A;  1D8L A;  3S1M B;  4IQZ A;  1S40 A;  5IP9 H;  1VF5 C;  4Z9C B;  1B3Q A;  4KHV A;  5A2Q E;  4IZ8 A;  4DR2 L;  2SOB A;  1CSP A;  5EBC A;  4YWM A;  5FJ8 H;  1TR5 A;  4LFB L;  3H94 A;  2ZTE A;  3PUX A;  1DOK A;  2RCF A;  3J80 i;  3A7A B;  1X6O A;  2LMC B;  1CTM A;  3PF5 A;  2RDG A;  1XNR Q;  5EQ0 A;  2GN5 A;  3OTO L;  2L12 A;  4LF7 L;  2EXZ A;  1HQR D;  3A8I E;  3CKI B;  4JI1 Q;  1PRT D;  1Q86 C;  2D62 A;  3KK7 A;  3H3V C;  5CV5 A;  1ICF B;  2Z0S A;  3GTJ B;  4XTC S;  3FP9 A;  1EWH A;  5CC4 A;  5M5Y H;  1HNZ L;  2EQS A;  4HSV A;  3RMH A;  3AEV A;  1CSQ A;  3RN2 A;  1BCP C;  1II3 A;  2CH4 A;  1XTC D;  2Q2T A;  3ONA B;  2IJ0 A;  1HR0 W;  4QY7 A;  4YY3 L;  3VR5 A;  1XMQ Q;  2KUM A;  4HID A;  1JJC B;  1SYB A;  3UE0 A;  2VQE Q;  4A3D H;  2L15 A;  3STB D;  4CJ2 C;  1AE3 A;  1MKH A;  3M3Y B;  4B3T L;  1CQV A;  2PI2 A;  3FKI H;  4KD4 A;  2OEO A;  1JOK A;  5T1G A;  1WTO A;  4J6H A;  3TSS A;  1PZI D;  2QEX A;  3PUY A;  3AB9 A;  1H9M A;  2BA0 A;  4YY3 Q;  2QIL A;  2Y0S G;  4H13 C;  1SYD A;  2K14 A;  5M3M B;  1Q1E A;  1HZC A;  3FPU B;  3TZU A;  3KLS X;  2DN8 A;  1QNK A;  1WCM G;  1WI5 A;  2O5I C;  1MSG A;  4A3F H;  1IBM Q;  2KCC A;  1SSO A;  2L0C A;  2PMZ E;  2QA4 A;  4NB3 A;  1RDP D;  3GV6 A;  2IX3 A;  4YHH Q;  4X66 Q;  3BVZ A;  4JVZ A;  5I9P A;  4OX9 L;  4A3E G;  1VS0 A;  4BBS H;  2WAC A;  4ZKC B;  2K5V A;  4F7X A;  3R2T A;  2PNR C;  3CME A;  4DR7 Q;  1U4M A;  2HCI A;  4MN3 A;  5JJI A;  4MIU A;  4LFB Q;  4NPS A;  4YCW A;  4F88 A;  1EYG A;  1EUJ A;  2VW9 A;  1K8G A;  3JAM c;  5C3E B;  4E6I A;  1JQY D;  4OO1 G;  2JE6 I;  4XQN A;  1K83 H;  1NY4 A;  1J6Q A;  3DLL A;  2DY8 A;  4A3G H;  2EYO A;  1B53 A;  4HCE A;  4G4K A;  2D9U A;  4BWG B;  5C0X G;  5EKI A;  3S15 H;  5JPN C;  5HUR A;  2E2I H;  4HAE A;  4IFD G;  3HS0 C;  3MA2 B;  4BBR G;  3D6W A;  1XMO Q;  2X6L A;  3I4L A;  1I6V C;  1LLR D;  2RKS A;  4FVM A;  1A62 A;  3J7A F;  4BY7 G;  4P74 A;  3SK5 A;  1KD1 C;  3I55 A;  1V43 A;  1GD7 A;  1D5M C;  2N49 A;  3VR3 A;  1A3V A;  3FVQ A;  2B2Y C;  5AJ3 L;  3HG9 A;  3HP3 A;  2KOL A;  3KBX A;  4IJL A;  3HKS A;  3CCQ A;  1UNS A;  1R4P B;  3H0G B;  1TS2 A;  1B8A A;  1JR0 D;  4KHZ A;  1WOC A;  3HKZ G;  4H44 C;  1WVL A;  4MHE A;  2Z9H A;  4APV A;  3HRZ C;  3EN2 A;  2F0T A;  4RAU C;  4LUO A;  4OL7 A;  2EYL A;  5I4D A;  2YYZ A;  3H91 A;  5L37 A;  4DR5 L;  1PH7 A;  3UI2 A;  4RFB A;  1NTG A;  5E3F A;  3HOY G;  2F4I A;  3VYU A;  2L55 A;  1SNM A;  1EU3 A;  1N8R C;  1TWF B;  4K2K A;  4FXK C;  2A69 D;  4A3E H;  2G5D A;  4ILW A;  4LF7 Q;  3IFD A;  4DV6 L;  3W5O A;  2JEB I;  1RTN A;  3A55 A;  1A8V A;  2F0F A;  1VQB A;  5FLM H;  4JG2 A;  2F0G A;  4CBV A;  4UY8 C;  3TRZ A;  3HOW B;  4IUQ A;  1AH9 A;  3HOU B;  3DWQ A;  2UUA Q;  1JE5 A;  4IPC A;  1VQE A;  3I4M H;  4A3E B;  4H0L C;  1J5E Q;  4DR2 Q;  3JC6 6;  1E0B A;  2A6E C;  2OTL A;  2WB1 E;  4HJ5 A;  1XYI A;  2N55 A;  2WAQ G;  2A6E D;  1WTP A;  1SE3 A;  4IAL A;  5IYB H;  1BBW A;  4HN7 A;  4L5T A;  1TS4 A;  5ELD A;  2IWH A;  1KLU D;  3QOJ A;  2FJ2 A;  1HCZ A;  1IBK Q;  1X3G A;  4HSP A;  5BN4 A;  1EZ6 A;  4DK3 C;  4NXM Q;  3GV3 A;  4QIW B;  5JJZ A;  3HOV B;  1FJG L;  3MXP A;  1G29 1;  1N36 L;  1NMG A;  4EVO A;  2V1C C;  3TBI B;  4U68 A;  4FP5 D;  3A8J E;  3D31 A;  1KRT A;  5ELC A;  2R61 A;  4OIJ A;  3MXN B;  1UE1 A;  1UE7 A;  4DV5 L;  1SMY C;  4DNI A;  1JB7 A;  1I50 H;  2J0T D;  3S14 H;  4BBR B;  4X62 Q;  4RKL A;  4HJ8 A;  1G6Z A;  4BXX H;  1JIC A;  4G7H C;  4IFD I;  1W6K A;  2EJG C;  5DM7 3;  4LK1 C;  3VYT A;  5ELE A;  3QG1 A;  1R9T H;  1SR3 A;  4KD3 A;  1TII D;  1VQI A;  2WV6 D;  1SLJ A;  1CKM A;  2X6G A;  5BR8 L;  1WYD A;  3HOX B;  1N34 L;  1RHP A;  2NZ1 D;  3TZD A;  1B44 D;  4TVA B;  1TS5 A;  2Q2I A;  4Y7N H;  2V4D A;  1QCB D;  1Y8O B;  3M3Y H;  1PFB A;  2E8G A;  2GVB A;  4ZRZ A;  3NQI A;  1QZG A;  4LFA Q;  2CVR A;  1FVI A;  1O78 A;  4P72 A;  1EWI A;  1F2Y A;  2WAQ E;  1PH5 A;  3NBH B;  5DEH A;  2DUD A;  2EDG A;  1JOQ A;  3VDY A;  4C2M H;  1SMY D;  4KJN A;  4X3K A;  1SAP A;  1EIH A;  2QDB A;  3DEO A;  3ERS X;  3KLR A;  1HHV A;  2RSO A;  2A68 D;  1QJO A;  1PH3 A;  1GHJ A;  4AYB G;  1YNN D;  4JI3 Q;  1A6X A;  4LF5 L;  2Z8L A;  3MFG A;  5TSS A;  4DV4 L;  3ER0 A;  3UE1 A;  2E2H B;  3K0X A;  1QG7 A;  3VR6 A;  2HQL A;  5G3L F;  1GUS A;  1VQ5 A;  4JYA L;  4A3L G;  3W2D A;  4A3C H;  1PH2 A;  4GNX C;  2K52 A;  2KCN A;  4JV5 L;  2LFN A;  4OEL B;  1YIT A;  2XTI A;  1Q90 A;  3MAQ A;  2BDO A;  2F3W A;  2JA5 H;  1ET9 A;  3W1B A;  3GTM B;  5J3B A;  1PH9 A;  2P5Z X;  3EVQ A;  3I4N G;  1U9R A;  3SGI A;  4DR3 L;  4I7A A;  3M4O B;  2B2T A;  1SRO A;  1WCM B;  4EQO A;  3KF8 B;  2A8V A;  4NMZ A;  1Y69 U;  3PIO 3;  4WRD A;  3GO5 A;  1SNQ A;  4A3M G;  1F2M A;  2EZV A;  4V19 0;  4OWX B;  3E3X A;  1GUN A;  3S17 H;  5F2D A;  3OW7 A;  5EPL A;  2JXM B;  2B2U C;  3PCO B;  1PTO H;  1DM0 B;  2BH2 A;  1ASZ A;  4AH6 A;  5IYD H;  1GVP A;  4ZCK A;  1STA A;  3T1H L;  1IW7 C;  4HJ7 A;  5M5Y B;  2AQ3 B;  1AZP A;  4ZK9 B;  3A5Z B;  3NWT A;  1OTC A;  3CC4 A;  1BUV T;  1Y1V B;  2SDF A;  4KY6 A;  1PVO A;  3GTJ H;  3CCR A;  4X65 L;  4A3J G;  2FIN B;  2VUM G;  1CKN B;  1BQQ T;  2B39 A;  1JWS D;  2KVM A;  4DV1 Q;  3GTO B;  2L5T A;  1GUG A;  2F0U A;  5I2Y A;  4C3I B;  4J1M A;  1BBU A;  1PYW D;  4C1N I;  1MHW C;  3HZX A;  4DF7 A;  4UP7 A;  2NWG A;  3TEH B;  4IOC A;  1MJE A;  1DON A;  3OIQ A;  4BY1 B;  4A3B H;  3M4Y A;  4A3I B;  1S3O A;  2K05 A;  2OCE A;  1J9O A;  2F0E A;  1STE A;  4BY1 H;  2EJF C;  1EYA A;  4DK0 A;  3C1E A;  3MC0 B;  2LXJ A;  4DUY L;  1I94 L;  5ELF A;  3VYS A;  1SN8 A;  4UP9 A;  1IBL L;  1OXX K;  1BBX C;  2K4K A;  2E76 C;  4IPD A;  4JBK A;  1PFN A;  2K1B A;  4K5X A;  3RLN A;  2E2J B;  4TKO B;  1I50 B;  1IZ6 A;  1STN A;  2AHO B;  4R9W A;  2UUB L;  3BYT B;  4K14 A;  3NTH A;  1LTS D;  2KQ3 A;  4ZUJ A;  2JA7 B;  1DCZ A;  3IKJ A;  1HNW L;  2O4X A;  2ZXR A;  4DR4 Q;  3G6J B;  2ATW A;  3K57 A;  1PRT F;  2AWN A;  4KKU A;  4BBS B;  1A3U A;  5EKK A;  5C44 H;  3DUZ A;  1PTO B;  1RL2 A;  4KHP Q;  4C3H G;  4N9P A;  4G57 A;  1JWU D;  4ME5 A;  4HIK A;  1F9S A;  1VQC A;  2O2L D;  4WJ4 A;  2CQA A;  4EGV A;  1EU4 A;  4R4O A;  3J7Z C;  4B9X A;  5IGE A;  3RZD H;  4JK1 C;  2NVQ B;  1WTX A;  3BZC A;  1H9S A;  4XT1 B;  5M3M H;  3CCM A;  1WTR A;  2JA6 H;  1A15 A;  1B1Z A;  1ENA A;  3ND9 A;  1SMX A;  3QO2 A;  3TS2 A;  3CQZ B;  4CKE A;  3AU7 A;  3NQT A;  3M4Q A;  1UE5 A;  1RCV D;  2DNC A;  2Q8R E;  3EA6 A;  4K6L A;  5GAE C;  1OXV A;  3TS0 A;  1GO3 E;  2F0O A;  3GTO H;  2EIF A;  3VR2 A;  4GN3 B;  2FFK B;  5CR3 A;  4HJ9 A;  1JCK B;  1MD2 D;  1TWH H;  1HPC A;  4LF4 Q;  1LAC A;  1DJR D;  1I5F A;  2Q2H A;  5IIF A;  3Q8D A;  1IKL A;  4IUR A;  4DNT B;  5EJW A;  1Z47 A;  4ZKB B;  2RF4 A;  2AQ2 B;  2DNE A;  3F1Z A;  2K6A A;  2N78 A;  1LV9 A;  3CRL C;  3CU7 A;  3TP5 A;  1CI3 M;  4C2M B;  1YI2 A;  4LF8 Q;  2F4V Q;  1DYQ A;  2IHF A;  1B70 B;  4M1U B;  2KHJ A;  2L9H A;  4BY1 G;  3I70 A;  3LX0 A;  3RLO A;  3K5M A;  4LFC Q;  4RA8 A;  4JI4 Q;  4DA2 A;  1EL0 A;  1PA6 A;  4CDE C;  1DGS A;  2WAQ B;  4LWC A;  2L4N A;  4GLA C;  4ZYS A;  4L5R C;  4A3B G;  3HOX H;  3S2H H;  1N33 Q;  1NAP A;  1E7Z A;  2WFW A;  1Q82 C;  3M7N A;  1BDO A;  4EQN A;  4X64 Q;  4JI2 Q;  1VQ4 A;  4JBJ A;  1VQ9 A;  3NHH A;  2R7Z B;  3I91 A;  3KLS A;  4GOP C;  3HOZ H;  1NR4 A;  4DV0 Q;  3ULL A;  1CZG A;  4DXF A;  3SR1 A;  1SBB B;  4DAY A;  1DXM A;  3UDG A;  3SEB A;  2EE1 A;  4A3G B;  1VQO A;  3A5U A;  3G48 A;  1LT4 D;  2OQ0 A;  4RMF A;  4O2D A;  1C4Q A;  2HHH L;  1U0L A;  2HCC A;  4O42 A;  5DAU A;  4DAV A;  1NE3 A;  1IHZ A;  3I4O A;  4PZ8 A;  3DWA A;  1MGS A;  1K0R A;  1WD1 A;  1AN8 A;  4DV7 L;  2SEB D;  2WKC A;  1SFO B;  4F8M A;  5ISR A;  1E24 A;  1Q7Y C;  2F0H A;  1CQF A;  3KUP A;  3SXH A;  3RLF A;  4R4C A;  2PMZ B;  2UUB Q;  5IGB A;  3HOZ G;  3GTP B;  3E6Z X;  1PDQ A;  1MSH A;  1XNQ L;  4IFD H;  3HEJ A;  2MFI A;  1PFS A;  1GUO A;  1EYD A;  3CCS A;  2SNS A;  4B3M Q;  3C1F A;  4B3S L;  2KA7 A;  4LNQ A;  1L2F A;  3L3O C;  2NBF A;  4AQY Q;  1YNJ D;  2R7D A;  4K8J A;  3ZJY C;  5C0X J;  4DV3 Q;  2F0V A;  2UXC L;  2TMP A;  2NVT H;  3I4M B;  3HOU H;  5FJ8 G;  1RJT A;  2OWO A;  3PO2 H;  2JA6 B;  3D3R A;  4A3I H;  4HJA A;  5BN3 A;  2XGT A;  1Y1W G;  2ZXO A;  2HD3 A;  3KF6 B;  2B2V C;  1NMF A;  3W3A A;  1ILQ A;  3BZD B;  1VQD A;  2ZT9 C;  4C1N K;  1ZEQ X;  1I6H B;  5COR A;  1Q8I A;  3STB C;  3BS1 A;  3PMF A;  1RD9 D;  2CWP A;  1NSN S;  3PUW A;  3HGB A;  5C4X G;  1EIG A;  3QB3 A;  5IOD A;  2KBN A;  1M1K C;  4RWS C;  1B3A A;  2UXD Q;  1JT8 A;  1XX8 A;  1LTT D;  1VQG A;  4QB4 A;  2KHS A;  1STH A;  1ENF A;  1B50 A;  1EFI D;  1HQM C;  4PV1 C;  1PYS B;  1PTO C;  2PW5 A;  1S5D D;  1G91 A;  1PHJ A;  1KXL A;  2QGQ A;  3ZYY X;  1X54 A;  3N6R A;  1M90 C;  3CCU A;  2L11 A;  2Q2U A;  1Z7T A;  3OYY A;  1UEB A;  5G3L D;  4ZAI A;  2GVA A;  1WD0 A;  3E9I A;  1V1Q A;  3SK8 A;  2OQK A;  5LMN L;  4KK7 A;  3WOE A;  1Z6H A;  5ELB A;  5CV9 A;  2PCF B;  1WTW A;  1SNC A;  1U4P A;  2ID0 A;  5IYD G;  3IFT A;  5JJL A;  1BOS A;  4A3J H;  3GTK B;  1ZYR D;  1LTL A;  3S2D H;  1I4P A;  1HR0 L;  4R8N A;  2K5N A;  4RCN A;  2H1E A;  2WB1 B;  1I4X A;  4ZLT F;  3CCJ A;  5IWA Q;  4JI0 Q;  5I2X A;  2E75 C;  2PNH A;  1NR2 A;  2ZTC A;  1T9H A;  2K03 A;  3T51 B;  1VQJ A;  1D5Z C;  4C3I H;  1JC7 A;  5LMU Q;  2B29 A;  2FMM A;  1PZJ D;  2Z1C A;  4R4I A;  3O13 A;  1TWF H;  3CPF A;  3EFX D;  4QCL A;  3GTP H;  1PFM A;  2MHV A;  1JB3 A;  2Y0S E;  4KJO A;  2H4O A;  1C7Y A;  1JOR A;  2PI2 E;  1K83 B;  2DJF C;  3L9A X;  4DK1 A;  3MZ5 A;  2B2U A;  4CGY B;  1A3T A;  1ICW A;  4DV7 Q;  3J80 c;  2O5J C;  4Q0F A;  5D14 A;  5GRO A;  4NP5 A;  2BA1 A;  2E5L L;  4HIM A;  1UAP A;  2C9O A;  1BCP F;  5E7N A;  3V2T A;  1X32 A;  1TWH B;  4NKL A;  3C2P A;  5J39 A;  5DM6 3;  1TVX A;  1GHK A;  2VQF L;  2F52 A;  2XWJ B;  1DOM A;  1YJN A;  3F2U A;  4QMG A;  1JJ2 A;  1V1P B;  3U50 C;  1LTI D;  3NWS A;  4UAI A;  4JI8 Q;  2EYF A;  2E2D C;  4QJF A;  5LMN W;  3M4O H;  2EVB A;  4QGU A;  5KEE A;  2NN6 I;  4IUV A;  1Y1W B;  2NN6 H;  4A3G G;  2JA5 B;  2CW0 D;  3S2H B;  3KF6 A;  3K6O A;  1LAB A;  1Q8K A;  4G7O C;  5EPK A;  4GS3 A;  5J22 A;  4CKB A;  1FGU A;  3K80 C;  1MI2 A;  5FKA C;  3I7F A;  4JCV E;  1MIU A;  5M9O A;  4POG A;  2A73 B;  1F9R A;  5EPJ A;  5HY6 A;  2F0M A;  1CM9 A;  2CH4 W;  3TP7 A;  1ML0 D;  5K36 G;  3RD4 A;  4JOI C;  4HTH A;  4NDX A;  3IL8 A;  5FO9 B;  4RGO S;  1B7Y B;  2YV5 A;  4RHR A;  2R3Z A;  1M8A A;  2PZU A;  3DEP A;  1SYC A;  3CHB D;  5IE8 A;  1CKO A;  4B3M L;  2YTX A;  1PLF A;  2R93 G;  5C4X H;  5C4Z A;  2R92 G;  4LF8 L;  4GN5 A;  4WJ3 M;  2Z6K A;  4DNR B;  3FRP B;  3KYH C;  1LTA D;  3P75 A;  2I5M X;  2UU9 Q;  4A3F G;  2JQO A;  3TP6 A;  1BNZ A;  2Z4H A;  1WTV A;  3HOV H;  2ICI A;  4PG3 A;  4FF3 A;  4AYB B;  3K5O A;  2I5H A;  1F9Q A;  3MXN A;  2Q8T A;  5FLX E;  5C3X A;  3TN2 A;  3GTL B;  2VL6 A;  5LMN Q;  4GNX B;  5D65 A;  1C8C A;  3WWV A;  4DUZ L;  2LXK A;  1QZH A;  4Y7N B;  5IGF A;  4P73 A;  1GKH A;  5E4W C;  2K5W A;  2RSN A;  3GD7 A;  5FO7 B;  4U67 3;  1OXT A;  5JEA J;  1STB A;  3FMC A;  1H9R A;  1E1T A;  5IT9 c;  2KCT A;  1EQR A;  5C6A A;  3C46 A;  1R9T B;  3LNN A;  2JJQ A;  4JI2 L;  2NZH A;  1KAA A;  3HFZ B;  4H02 A;  1Q12 A;  1F77 A;  5M5X H;  2UXD L;  5A2Q L;  2CW0 C;  1XPR A;  1RF2 D;  2JN4 A;  4C3J H;  3PUZ A;  3H3V I;  2MQH A;  4OIK A;  3MEF A;  2N8N A;  4CJ0 B;  2F0N A;  4OO1 H;  1CZW A;  4BBR H;  5KYI A;  2R93 H;  4A3K G;  1YEZ A;  2ENB A;  3CW2 C;  3CAM A;  4TSS A;  1MBY A;  5FK9 C;  4DR3 Q;  4JI7 L;  1NBW A;  1K8A C;  1VMC A;  4K5W A;  4A3M B;  2F3V A;  1EOT A;  4M8A A;  1XPO A;  1UEA B;  3Q24 A;  4DPG A;  4MNO A;  2RDF A;  1GUW A;  3OMC A;  4B3S Q;  4RG1 A;  1F2L A;  2B8G A;  5C4H A;  1BXT A;  3J81 j;  3H0G G;  5KNB A;  1I3Q H;  1XNQ Q;  4O1N A;  3PIO A;  5M5W H;  1WCM H;  2R7Z H;  2QDL A;  1I4H A;  1V1O A;  3HOW G;  2EPB A;  2KED A;  4NW2 A;  2MGS A;  4KI0 A;  3R8B A;  1VQA A;  4OEM B;  3RZO H;  5LL6 S;  4LAA A;  3T1Y L;  1MJC A;  2MPM A;  2Z4I A;  1K28 A;  3QOL A;  4GKJ Q;  2XVS A;  2D0P A;  4LUV A;  4UHV A;  5FO8 B;  3H09 A;  4PMC A;  4R1J A;  2KEE A;  2QF7 A;  1EQT A;  4B3R Q;  2B2Y A;  2AWO A;  4XXE A;  2KJX A;  1SYF A;  2G9H D;  3KF8 A;  4GOP A;  3HOV G;  1O80 A;  1JE4 A;  4TQU S;  3ULP A;  4IUU A;  4PMB A;  1I3Q B;  5CYU A;  5M3F G;  2E2H H;  1PYB A;  4B3R L;  1PXU A;  2E5L Q;  3NP8 A;  3RR5 A;  1TWA H;  1SE8 A;  4XIG S;  4HMI A;  4N8F A;  2VNU D;  4ABN A;  3GDE A;  1EY4 A;  5KIX A;  4A76 A;  1I4G A;  1HZ9 A;  4HIO A;  5C5L A;  4XQJ A;  3DM1 A;  4KLK A;  5C4J H;  1SJH D;  1C48 A;  5COY A;  2R7F A;  5T1I A;  4DUY Q;  1I94 Q;  2OT2 A;  2XIW A;  3BJU A;  5CV4 A;  5JOB A;  2ZJP A;  2PPB C;  1QIL A;  1J8I A;  4B9W A;  4C3H B;  4FO2 A;  1NJI C;  2I5L X;  2ZXP A;  4PMW A;  1SDF A;  3P20 A;  2I0Q A;  4IN3 A;  1JOO A;  1CHP D;  4FF2 A;  1S72 A;  4DR5 Q;  4XT3 B;  3LWE A;  2EY6 A;  1BR9 A;  4P71 A;  2RHQ B;  5IY0 A;  2A1A A;  1K9M C;  1HA5 A;  1JJG A;  5GAH C;  1Y14 B;  1QE6 A;  3R2I A;  5IWA L;  4JI0 L;  2EY5 A;  5KGU A;  1WTQ A;  1IL2 A;  5GAG C;  3PO2 B;  2OF1 A;  5IP7 G;  3MEH A;  1TWC H;  4TRD A;  2HHH Q;  4IUP A;  2K50 A;  3G4S A;  3P7J A;  3I90 A;  2MO0 A;  4JI8 L;  1TKW B;  2FXQ A;  4B3T Q;  4XDX A;  3H15 A;  4PQX A;  3K8A A;  2PQA B;  1SEB D;  4DV0 L;  2KEN A;  4LW1 A;  1TWG H;  1S5B D;  1K3B C;  4A3C G;  2VQF Q;  4DAP A;  2EYP A;  4OON A;  4DV4 Q;  5GQO A;  3E0E A;  4MZ9 A;  1ESF A;  2CQO A;  2LSS A;  3DHQ A;  1H9K A;  3U58 A;  4IPG A;  2F0J A;  4P2C B;  1OXS C;  2BH8 A;  4BA2 I;  1X3F A;  1TY0 A;  3CP0 A;  4OO1 I;  1FL0 A;  1CHQ D;  4K2L A;  4EQ5 A;  3Q23 A;  1X9N A;  1KQS A;  3PV0 A;  4X3S A;  2IW3 A;  1QVF A;  3D4D A;  4DK6 C;  1HZA A;  4K6D A;  4KHP L;  5LMU L;  1B4O A;  1WTH A;  1Q1B A;  1UWV A;  2EYM A;  1LT3 D;  1EQV A;  2VUM H;  5BR8 Q;  2I07 B;  3X3M A;  3IRB A;  3NEN A;  4YCV A;  2QKI C;  3CF5 A;  2KEC A;  2PYK A;  2SNM A;  5KNC A;  2EJM A;  4GOP B;  3RZO B;  3KJP A;  3UDI A;  3G6E A;  4YCU A;  2JSO A;  3K0Y A;  4X3T A;  1EYC A;  4UP8 A;  1F2Z A;  1N9W A;  4KV6 A;  1VQ6 A;  1YBY A;  4LUZ A;  1CFM A;  2BE5 C;  1HUN A;  4OX9 Q;  4L63 B; 
#chains in the Genus database with same CATH homology
 1T5X D;  1FD7 D;  1X3P A;  2CHB D;  5E4X A;  1PTO F;  4KMU C;  4IUN A;  2LY7 A;  2EY1 A;  4ULL A;  1AEX A;  3T56 B;  4HCS A;  3K5L A;  3I4N B;  3BVG A;  3NBI A;  4I65 A;  3A54 A;  1Y8N B;  3GTQ B;  2R93 B;  4Q5V A;  1S5F D;  5K36 H;  1RKN A;  1RTO A;  3D8G A;  1IL8 A;  5EKL A;  4C3J B;  1LTB D;  4FXG C;  1SE2 A;  5EGT A;  2F0D A;  4G7Z C;  3U9S A;  1HRJ A;  5D3D A;  2M00 A;  1SJE D;  3S9W A;  1E2Z A;  5JAV A;  3MWY W;  5A35 A;  3J80 L;  4RKB A;  1M4V A;  2VUM B;  2B2T C;  4CKC A;  4EQP A;  1LTG D;  3VYR A;  1L0X B;  3AMU A;  3JAM L;  3PIP 3;  4XYQ A;  1EY7 A;  1I4Q A;  2IT1 A;  2BOS A;  1ZXT A;  4A3K B;  5IGG A;  4HED A;  3J80 E;  1YNN C;  2DY7 A;  5IOC A;  5I6Y A;  3GP7 A;  3GTG B;  3ND8 A;  4ZUI A;  1DD2 A;  4DFA A;  1X3Q A;  1SND A;  3S1N B;  2FMC A;  5BN5 A;  2AUJ D;  1E2W A;  2C5C A;  3Q22 A;  1CA5 A;  3FEW X;  2IPK D;  2A74 C;  2LS0 1;  2QEJ C;  1EEF D;  2M9V A;  5CV6 A;  3OSO A;  1GXD C;  1ONL A;  2RVL A;  2D2C C;  3MVV A;  4A3B B;  3K7A B;  2AUK A;  4KTA A;  3URY A;  3DXJ C;  2ICE C;  4FF1 A;  3T16 A;  4HMJ A;  2K5D A;  4RHS A;  2BCO A;  5JVH 3;  4FF4 A;  3SE0 A;  3S1Q B;  1LT5 D;  1AFP A;  2BDN A;  2OXP A;  5KRU A;  2D5D A;  3NK9 A;  2HUG A;  4ZQ3 A;  5IT9 L;  2F0K A;  3P1H A;  3D4R A;  3NTK A;  5JVG 3;  3KBG A;  3MHB A;  5I9O A;  4C3J G;  3QWN A;  2HDL A;  1ROD A;  1PMR A;  1KNE A;  2F0S A;  1SXT A;  2HDM A;  3HOZ B;  3TDQ A;  1K8M A;  2F0L A;  2NTS A;  2MP1 A;  5AFW A;  2F03 A;  1QOH A;  2IX0 A;  3WOF A;  3T13 A;  3QIA A;  2VB3 X;  3E0J A;  3S2D B;  3TME A;  3MTS A;  3SK4 A;  3FKI B;  4DN4 M;  3J7A V;  3I72 A;  4HR7 B;  1GUT A;  2NVY B;  1DOL A;  1V8Q A;  4FYD A;  3X3N A;  1QNU A;  5JEA G;  2AQ1 B;  1QB5 D;  4KN4 C;  1XWE A;  4KY5 A;  2RQX A;  3NE5 B;  4WOR A;  3C3L A;  4RCO A;  2N88 A;  2XNA C;  4C56 C;  3OIP A;  1AP0 A;  3R3O A;  1EWC A;  4L8J A;  5C0X H;  3U9O A;  2EY2 A;  1V1P A;  2MUY A;  3E5S A;  3A8K E;  5CGK A;  1BF4 A;  2NVT B;  2PO4 A;  4LJZ C;  3MXU A;  2B2W C;  5DNF A;  1KDA A;  1G8Z D;  2E74 C;  3J81 L;  3RZD B;  5I6W A;  1K8O A;  4L6T B;  1KTK A;  5C5M A;  3VA7 A;  2R6G A;  2PZW A;  2MJ8 A;  2K04 A;  1I4R A;  3S1R B;  1ESR A;  1STG A;  3L7Z C;  2TSS A;  3RUZ A;  1PRT B;  4KKS A;  1FR3 A;  3OHX C;  2WKD A;  1VDZ A;  1NUC A;  2L1B A;  3EQL C;  4YIJ A;  1QWY A;  5FOB B;  2NVX B;  1VF7 A;  3BDL A;  1HXY D;  2M2L A;  1U4R A;  2XN9 C;  5IT9 E;  2QCP X;  3S17 B;  3OOC A;  1FNU A;  1TWC B;  2RBM A;  3GQB A;  5M5X B;  4OHJ A;  1IW7 D;  3SK6 A;  4K5V A;  2JYO A;  4DXG A;  4BA1 I;  1B9M A;  1SNO A;  5KYL A;  1CT1 D;  1ZKO A;  3QJY A;  1HFN A;  2GA4 B;  1FNW A;  1GJX A;  5C4J B;  2XSC A;  5JEA H;  1U4L A;  4RGN A;  3PUV A;  1AZQ A;  3NUC A;  1EZ8 A;  5M3F B;  2A68 C;  4R8I A;  1TWA B;  1S5E D;  2HQE A;  3N52 A;  4QUC A;  2EYJ A;  1IYV A;  4K8I A;  2F0Q A;  3BYY B;  5D3I B;  3FDT A;  1TS3 A;  2NTT A;  3DMU A;  3BVM A;  1NCV A;  4V0B A;  2XWB B;  1KAB A;  3HKZ B;  4RGM A;  2Q8I B;  3DWP A;  3FPP A;  1LTR D;  2PQE A;  5CBA E;  3S16 B;  5C3W A;  1CA6 A;  3Q0A A;  4BS9 A;  1SYE A;  2RDH A;  5M5W B;  4KY7 A;  1G2S A;  3K59 A;  1O7Z A;  4DGZ A;  4DU9 A;  4FXD A;  1LT6 D;  1F9P A;  4J8Q A;  5CBE E;  3K5N A;  3S14 B;  3VA5 A;  5C44 B;  2JA8 B;  4WFN 3;  5JPM C;  5HGT A;  1L0Y B;  2K7V A;  2PZT A;  1D5X C;  3ERO A;  3D4W A;  3OWE B;  1EY5 A;  2J7Z A;  3H6M A;  5KND A;  5J1Z A;  2NYZ D;  4A93 B;  4RH6 A;  1OXU A;  3JAM E;  1LO5 D;  3D6C A;  1S4Z A;  1JWM D;  1TU2 B;  3ITP A;  1ENC A;  4KKT A;  4XYO A;  1TY2 A;  4S3S A;  1SYG A;  2LKV A;  2XRS D;  3SDZ A;  3NBH A;  3BDC A;  4N9T A;  1HTP A;  5CMD A;  3NTI A;  3M7G A;  3T4A C;  1ET6 A;  3WDN A;  3MXG A;  1SE4 A;  1EY0 A;  1H9J A;  2F0P A;  1Y8P B;  4QUF A;  3CRK C;  3M85 A;  2PW7 A;  4IFD J;  2XRQ D;  4WJW A;  1PRT C;  1A2U A;  4QF4 A;  2F1M A;  3V96 A;  1HFG A;  1ILP A;  3ERQ A;  2A69 C;  4XQQ A;  4H7B A;  1KDC A;  2X69 A;  1KNA A;  3J7Y W;  1IYU A;  4F87 A;  1B2T A;  2G9D A;  3EJI A;  2FHT A;  2Y0S B;  4UDU C;  5EBD A;  2F0I A;  2K5Q A;  2A6H C;  1D6E C;  3SVM A;  4RGT A;  1D1I A;  1KLG D;  4KN7 C;  1STY A;  3OMG A;  3A56 A;  5E1F A;  4I7Z C;  5K5P A;  1OO9 B;  4FNF A;  3R93 A;  1KDB A;  3VR4 A;  1HUM A;  5LHY 1;  4ID6 A;  3NSW A;  2EOT A;  2A6H D;  2IL8 A;  1GOZ A;  1BCP B;  3MFY A;  3TP8 A;  4IUT A;  3NXW A;  3K58 A;  4B08 A;  4GZY C;  1FNV A;  3G7L A;  3BG3 A;  1TWG B;  2F0W A;  1CK1 A;  2B8F A;  3I73 A;  5C0X I;  4JBW A;  2NUC A;  1E2V A;  3V05 A;  4A3F B;  2VB2 X;  2K01 A;  4BY7 B;  2NN6 G;  3OWF A;  2WIN B;  4A3J B;  3I8Z A;  1EY9 A;  4LMQ D;  1FGB D;  3I3C A;  2B2W A;  2E2I B;  2BE5 D;  1W6J A;  3S15 B;  1SNP A;  2B2V A;  1Q3L A;  1FYC A;  2WP8 J;  2B63 B;  5IGC A;  1G2T A;  2VXW A;  1D2B A;  3IAY A;  2RA4 A;  2I46 A;  3OPO A;  1VMP A;  4OGQ C;  3SHL A;  2EYH A;  5NUC A;  5IGD A;  1R4Q B;  1O7L A;  2K33 A;  1O7Y A;  1VCI A;  1ZYR C;  3HOY B;  3LWU A;  1A2T A;  1T5E A;  1TQO A;  4C3I G;  1UUP A;  5C4X B;  2YU9 B;  3Q6S A;  1H9S B;  1EEI D;  1IKM A;  2JEA I;  3A7L A;  4CHT B;  4PNY A;  1XXG A;  1EY6 A;  2R92 B;  5FLX L;  5CV8 A;  1PTO D;  2IX1 A;  2NB0 A;  1EY8 A;  3PO3 B;  2J4X A;  1PZK D;  4X3U A;  1B9N A;  1BCP D;  2WII B;  1DZ1 A;  1D1K A;  3NPP A;  2K28 A;  1S5C D;  5LL6 X;  3J81 E;  2K32 A;  4A3D B;  3BDO A;  1HA6 A;  4CJ1 B;  2A5H A;  3T53 B;  1BO0 A;  4ODG A;  1AW7 A;  2JP1 A;  1HTL D;  5CV7 A;  1TT2 A;  1YNJ C;  3S1M B;  4IQZ A;  1VF5 C;  4Z9C B;  4KHV A;  5A2Q E;  4IZ8 A;  2SOB A;  5EBC A;  1TR5 A;  3H94 A;  3PUX A;  1DOK A;  3A7A B;  2LMC B;  1CTM A;  2RDG A;  5EQ0 A;  2L12 A;  2EXZ A;  1HQR D;  3A8I E;  3CKI B;  1PRT D;  2D62 A;  3KK7 A;  3H3V C;  5CV5 A;  3GTJ B;  4XTC S;  1EWH A;  5CC4 A;  3RMH A;  4HSV A;  1BCP C;  1II3 A;  1XTC D;  3ONA B;  2IJ0 A;  3VR5 A;  2KUM A;  1SYB A;  4CJ2 C;  3M3Y B;  1CQV A;  4KD4 A;  2OEO A;  1JOK A;  5T1G A;  1WTO A;  4J6H A;  3TSS A;  1PZI D;  3PUY A;  3AB9 A;  1H9M A;  2BA0 A;  2QIL A;  4H13 C;  1SYD A;  5M3M B;  1Q1E A;  3FPU B;  3TZU A;  3KLS X;  2DN8 A;  1QNK A;  2O5I C;  1MSG A;  2KCC A;  1SSO A;  2L0C A;  1RDP D;  3GV6 A;  2IX3 A;  3BVZ A;  5I9P A;  2WAC A;  4ZKC B;  4F7X A;  3R2T A;  2PNR C;  1U4M A;  2HCI A;  4MN3 A;  4MIU A;  4F88 A;  5C3E B;  4E6I A;  1JQY D;  4OO1 G;  2JE6 I;  4XQN A;  2DY8 A;  2EYO A;  1B53 A;  4HCE A;  4G4K A;  2D9U A;  4BWG B;  5C0X G;  5EKI A;  5JPN C;  5HUR A;  4IFD G;  4HAE A;  3HS0 C;  3MA2 B;  3D6W A;  2X6L A;  3I4L A;  1I6V C;  1LLR D;  2RKS A;  4FVM A;  3J7A F;  3SK5 A;  1V43 A;  1D5M C;  3VR3 A;  1A3V A;  3FVQ A;  2B2Y C;  3HG9 A;  3HP3 A;  2KOL A;  3KBX A;  1UNS A;  1R4P B;  3H0G B;  1TS2 A;  1JR0 D;  4KHZ A;  4H44 C;  1WVL A;  4MHE A;  3HRZ C;  4RAU C;  2F0T A;  4OL7 A;  2EYL A;  5I4D A;  2YYZ A;  3H91 A;  3UI2 A;  4RFB A;  5E3F A;  2F4I A;  3VYU A;  2L55 A;  1SNM A;  1EU3 A;  1TWF B;  4K2K A;  4FXK C;  2A69 D;  4ILW A;  3IFD A;  2JEB I;  1RTN A;  3A55 A;  2F0F A;  2F0G A;  4CBV A;  3HOW B;  4IUQ A;  3HOU B;  3DWQ A;  4A3E B;  4H0L C;  1E0B A;  2A6E C;  1XYI A;  2N55 A;  2A6E D;  1WTP A;  1SE3 A;  4IAL A;  4HN7 A;  5ELD A;  2IWH A;  1TS4 A;  1KLU D;  3QOJ A;  2FJ2 A;  1HCZ A;  4HSP A;  5BN4 A;  1EZ6 A;  3GV3 A;  4QIW B;  5JJZ A;  3HOV B;  3MXP A;  1G29 1;  4EVO A;  3TBI B;  4U68 A;  4FP5 D;  3A8J E;  3D31 A;  5ELC A;  2R61 A;  4OIJ A;  1SMY C;  2J0T D;  4BBR B;  4RKL A;  1G6Z A;  1JIC A;  4G7H C;  4IFD I;  1W6K A;  2EJG C;  5DM7 3;  4LK1 C;  3VYT A;  5ELE A;  3QG1 A;  4KD3 A;  1TII D;  2WV6 D;  2X6G A;  3HOX B;  1RHP A;  2NZ1 D;  3TZD A;  1B44 D;  1TS5 A;  2V4D A;  1QCB D;  1Y8O B;  1PFB A;  4ZRZ A;  3NQI A;  2CVR A;  1O78 A;  1F2Y A;  5DEH A;  2EDG A;  1JOQ A;  1SMY D;  4KJN A;  4X3K A;  1SAP A;  1EIH A;  2QDB A;  3DEO A;  3KLR A;  1HHV A;  2RSO A;  2A68 D;  1QJO A;  1GHJ A;  1YNN D;  1A6X A;  2Z8L A;  3MFG A;  5TSS A;  2E2H B;  1QG7 A;  3VR6 A;  5G3L F;  1GUS A;  3W2D A;  2KCN A;  2LFN A;  1Q90 A;  3MAQ A;  2BDO A;  2F3W A;  1ET9 A;  3GTM B;  3EVQ A;  1U9R A;  3M4O B;  2B2T A;  1WCM B;  4EQO A;  4NMZ A;  1Y69 U;  3PIO 3;  4WRD A;  3GO5 A;  1SNQ A;  1F2M A;  2EZV A;  4V19 0;  1GUN A;  5F2D A;  3OW7 A;  5EPL A;  2JXM B;  2B2U C;  1PTO H;  1DM0 B;  1STA A;  1IW7 C;  5M5Y B;  2AQ3 B;  1AZP A;  4ZK9 B;  3NWT A;  1BUV T;  1Y1V B;  2SDF A;  4KY6 A;  2FIN B;  1BQQ T;  2B39 A;  1JWS D;  2KVM A;  3GTO B;  2L5T A;  1GUG A;  2F0U A;  5I2Y A;  4C3I B;  4J1M A;  1PYW D;  4C1N I;  3HZX A;  4DF7 A;  2NWG A;  1DON A;  3OIQ A;  4BY1 B;  3M4Y A;  4A3I B;  2K05 A;  1J9O A;  2F0E A;  1STE A;  2EJF C;  1EYA A;  4DK0 A;  3C1E A;  3MC0 B;  5ELF A;  3VYS A;  1OXX K;  1BBX C;  2E76 C;  1PFN A;  2K1B A;  4K5X A;  2E2J B;  4TKO B;  1I50 B;  1STN A;  4R9W A;  3BYT B;  4K14 A;  3NTH A;  1LTS D;  2KQ3 A;  4ZUJ A;  2JA7 B;  1DCZ A;  3IKJ A;  2O4X A;  2ZXR A;  3G6J B;  3K57 A;  1PRT F;  2AWN A;  4KKU A;  4BBS B;  1A3U A;  5EKK A;  1PTO B;  3DUZ A;  4C3H G;  4N9P A;  4G57 A;  1JWU D;  4ME5 A;  1F9S A;  2O2L D;  2CQA A;  4EGV A;  1EU4 A;  4B9X A;  5IGE A;  4JK1 C;  2NVQ B;  1WTX A;  1H9S A;  4XT1 B;  1WTR A;  1A15 A;  1B1Z A;  1ENA A;  3ND9 A;  3QO2 A;  3CQZ B;  4CKE A;  3AU7 A;  3NQT A;  1RCV D;  2DNC A;  2Q8R E;  3EA6 A;  4K6L A;  1OXV A;  2F0O A;  3VR2 A;  2FFK B;  5CR3 A;  1JCK B;  1MD2 D;  1HPC A;  1LAC A;  1DJR D;  5IIF A;  1IKL A;  4DNT B;  4IUR A;  5EJW A;  1Z47 A;  4ZKB B;  2AQ2 B;  2DNE A;  2K6A A;  1LV9 A;  3CRL C;  3CU7 A;  3TP5 A;  1CI3 M;  4C2M B;  1DYQ A;  4M1U B;  2L9H A;  3I70 A;  3LX0 A;  3K5M A;  4RA8 A;  1EL0 A;  4DA2 A;  2WAQ B;  2L4N A;  4ZYS A;  1NAP A;  3M7N A;  1BDO A;  4EQN A;  3NHH A;  2R7Z B;  3I91 A;  3KLS A;  1NR4 A;  1CZG A;  4DXF A;  3SR1 A;  1SBB B;  4DAY A;  1DXM A;  3SEB A;  2EE1 A;  4A3G B;  1LT4 D;  1C4Q A;  4DAV A;  2HCC A;  4O42 A;  5DAU A;  1IHZ A;  3DWA A;  1MGS A;  1WD1 A;  1AN8 A;  2SEB D;  2WKC A;  1SFO B;  4F8M A;  5ISR A;  2F0H A;  1CQF A;  3KUP A;  3SXH A;  3RLF A;  2PMZ B;  5IGB A;  3GTP B;  3E6Z X;  1PDQ A;  1MSH A;  4IFD H;  3HEJ A;  1GUO A;  1EYD A;  2SNS A;  3C1F A;  2KA7 A;  3L3O C;  2NBF A;  1YNJ D;  4K8J A;  5C0X J;  2F0V A;  2TMP A;  3I4M B;  1RJT A;  2JA6 B;  3D3R A;  5BN3 A;  2ZXO A;  2B2V C;  3W3A A;  1ILQ A;  3BZD B;  2ZT9 C;  4C1N K;  1ZEQ X;  1I6H B;  5COR A;  1Q8I A;  3BS1 A;  3PMF A;  1RD9 D;  1NSN S;  3PUW A;  3HGB A;  1EIG A;  3QB3 A;  5IOD A;  4RWS C;  1B3A A;  1XX8 A;  1LTT D;  4QB4 A;  2KHS A;  1STH A;  1ENF A;  1B50 A;  1EFI D;  1HQM C;  4PV1 C;  2PW5 A;  1PTO C;  1S5D D;  1G91 A;  3ZYY X;  3N6R A;  2L11 A;  1Z7T A;  5G3L D;  4ZAI A;  1WD0 A;  3SK8 A;  4KK7 A;  3WOE A;  1Z6H A;  5ELB A;  5CV9 A;  2PCF B;  1WTW A;  1SNC A;  1U4P A;  2ID0 A;  3IFT A;  1BOS A;  3GTK B;  1ZYR D;  1I4P A;  4R8N A;  4RCN A;  2H1E A;  2WB1 B;  1I4X A;  4ZLT F;  5I2X A;  2E75 C;  1NR2 A;  2K03 A;  3T51 B;  1D5Z C;  1JC7 A;  2FMM A;  1PZJ D;  2Z1C A;  3O13 A;  3EFX D;  4QCL A;  1PFM A;  2MHV A;  1JB3 A;  4KJO A;  2H4O A;  1JOR A;  1K83 B;  3L9A X;  4DK1 A;  3MZ5 A;  2B2U A;  4CGY B;  1A3T A;  1ICW A;  2O5J C;  4Q0F A;  5D14 A;  4NP5 A;  2BA1 A;  1UAP A;  2C9O A;  1BCP F;  3V2T A;  1X32 A;  1TWH B;  4NKL A;  3C2P A;  5J39 A;  5DM6 3;  1TVX A;  1GHK A;  2XWJ B;  1DOM A;  3F2U A;  4QMG A;  1V1P B;  1LTI D;  3NWS A;  4UAI A;  2EYF A;  2E2D C;  2EVB A;  5KEE A;  2NN6 I;  4IUV A;  1Y1W B;  2NN6 H;  2JA5 B;  2CW0 D;  3S2H B;  3K6O A;  1LAB A;  4G7O C;  5EPK A;  5J22 A;  4CKB A;  1MI2 A;  5FKA C;  5M9O A;  2A73 B;  1F9R A;  5EPJ A;  2F0M A;  1CM9 A;  3TP7 A;  5K36 G;  1ML0 D;  3RD4 A;  4HTH A;  4NDX A;  3IL8 A;  5FO9 B;  4RGO S;  4RHR A;  2R3Z A;  1M8A A;  2PZU A;  3DEP A;  1SYC A;  3CHB D;  1PLF A;  5C4Z A;  4DNR B;  3FRP B;  1LTA D;  3P75 A;  1BNZ A;  3TP6 A;  2Z4H A;  1WTV A;  2ICI A;  4FF3 A;  4AYB B;  5FLX E;  3K5O A;  1F9Q A;  3MXN A;  2Q8T A;  5C3X A;  3TN2 A;  3GTL B;  5D65 A;  1C8C A;  4Y7N B;  5IGF A;  5E4W C;  2K5W A;  2RSN A;  3GD7 A;  5FO7 B;  4U67 3;  1OXT A;  5JEA J;  1STB A;  3FMC A;  1H9R A;  5C6A A;  3C46 A;  1R9T B;  3LNN A;  1KAA A;  1Q12 A;  1F77 A;  5A2Q L;  2CW0 C;  1RF2 D;  3PUZ A;  4OIK A;  4CJ0 B;  2F0N A;  4OO1 H;  1CZW A;  5KYI A;  2ENB A;  4TSS A;  1MBY A;  5FK9 C;  1VMC A;  4K5W A;  4A3M B;  2F3V A;  1EOT A;  4M8A A;  1UEA B;  3Q24 A;  2RDF A;  1GUW A;  3OMC A;  1F2L A;  2B8G A;  5C4H A;  1BXT A;  5KNB A;  4O1N A;  1I4H A;  1V1O A;  2EPB A;  2KED A;  2MGS A;  4KI0 A;  4NW2 A;  3R8B A;  5LL6 S;  4LAA A;  2MPM A;  2Z4I A;  3QOL A;  2XVS A;  5FO8 B;  3H09 A;  4PMC A;  2KEE A;  2QF7 A;  1EQT A;  2B2Y A;  2AWO A;  4XXE A;  2KJX A;  1SYF A;  2G9H D;  3KF8 A;  1O80 A;  1JE4 A;  4TQU S;  4IUU A;  4PMB A;  1I3Q B;  5CYU A;  1PXU A;  3NP8 A;  4XIG S;  4HMI A;  2VNU D;  4ABN A;  1EY4 A;  5KIX A;  1I4G A;  5C5L A;  4XQJ A;  3DM1 A;  1SJH D;  1C48 A;  5COY A;  5T1I A;  2OT2 A;  2XIW A;  5CV4 A;  5JOB A;  2PPB C;  1QIL A;  1J8I A;  4B9W A;  4C3H B;  4FO2 A;  2ZXP A;  4PMW A;  1SDF A;  3P20 A;  4IN3 A;  1JOO A;  1CHP D;  4FF2 A;  4XT3 B;  2EY6 A;  3LWE A;  1BR9 A;  1HA5 A;  3R2I A;  1QE6 A;  3PO2 B;  2EY5 A;  5KGU A;  1WTQ A;  2OF1 A;  3MEH A;  4TRD A;  4IUP A;  3P7J A;  3I90 A;  1TKW B;  4XDX A;  4PQX A;  1SEB D;  1S5B D;  4DAP A;  2EYP A;  1ESF A;  3DHQ A;  1H9K A;  2F0J A;  4P2C B;  1OXS C;  4BA2 I;  1TY0 A;  4OO1 I;  3Q23 A;  1CHQ D;  4K2L A;  3PV0 A;  4X3S A;  2IW3 A;  3D4D A;  4K6D A;  1B4O A;  1Q1B A;  2EYM A;  1LT3 D;  1EQV A;  2I07 B;  3X3M A;  2QKI C;  2KEC A;  2PYK A;  2SNM A;  5KNC A;  2EJM A;  3RZO B;  2JSO A;  3K0Y A;  4X3T A;  1EYC A;  1F2Z A;  4KV6 A;  1CFM A;  2BE5 C;  1HUN A;  4L63 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...