2K1BA

Solution nmr structure of the chromo domain of the chromobox protein homolog 7
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
EQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the chromobox protein homolog 7.
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
molecule keywords Chromobox protein homolog 7
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k1bA00
2MPMA 1S4ZA 1DZ1A 1MSHA 1WTXA 1HUNA 1G91A 2B2WA 3UI2A 1PLFA 2X6GA 1NR4A 2KEDA 4IUPA 2FJ2A 1B3AA 2SDFA 3I91A 1EIHA 5CBAE 2EE1A 4R8IA 2CVRA 1MGSA 1NR2A 2FFKB 4RAUC 1HA6A 1IL8A 3I90A 1U4LA 4IUUA 4U68A 2EOTA 5EPKA 2K03A 1GUWA 1MSGA 4O42A 1U4PA 4ZKCB 2X69A 2X6LA 2EPBA 1G2SA 2XIWA 4MHEA 1JICA 4OIJA 1BF4A 2NZ1D 3DM1A 1PFNA 4X3UA 1ICWA 2BDNA 3FPUB 4HEDA 2J7ZA 1BNZA 3GV3A 1RJTA 4ZKBB 2RA4A 1Q3LA 2RVLA 2HUGA 1PFMA 4OIKA 4R9WA 2MJ8A 3ONAB 1SSOA 3F2UA 4X3KA 5EJWA 4CJ2C 2HDMA 1SDFA 1HRJA 2KEEA 3FDTA 1G6ZA 1DOKA 3GV6A 1SAPA 1B50A 5D14A 1O7YA 3HP3A 1F2LA 2VXWA 4XT3B 1DONA 2B2YC 2JP1A 4HCSA 1LV9A 4RA8A 1VMPA 4UAIA 5COYA 1WD0A 1HFNA 5E4WC 4X3SA 4XT1B 1WTQA 1X3QA 2NYZD 1WVLA 1PDQA 4XDXA 1HHVA 2HCCA 2KUMA 3H91A 5AFWA 2L12A 4IUTA 5CORA 5JJZA 4X3TA 1AZQA 1G2TA 3TN2A 1AP0A 1F9QA 2R3ZA 2RSNA 1ILQA 1QE6A 1B53A 1O80A 2N55A 1EOTA 1IKLA 1DOLA 1WTWA 1AZPA 2M2LA 2L4NA 1CA6A 1PFBA 5CBEE 5T1IA 2B2TA 2B2YA 3I8ZA 1HUMA 1U4RA 4MN3A 5D65A 1BO0A 2MP1A 2H1EA 3KUPA 4HAEA 4LMQD 3TZDA 2D9UA 1F9SA 2K01A 5EKIA 2KECA 1QNKA 1MI2A 2B2VC 2JYOA 1VMCA 2MGSA 4ZAIA 2K1BA 1EQTA 2DY8A 1IKMA 5EPLA 1J8IA 2IL8A 2N88A 1XX8A 3Q6SA 1ZXTA 4ZK9B 1O7ZA 1RODA 3KBXA 5DNFA 1X3PA 1E0BA 4DN4M 2NWGA 1J9OA 1ML0D 1X32A 3R93A 1HFGA 3QO2A 5E4XA 1M8AA 2RSOA 2B2TC 1A15A 2B2UA 1CM9A 3MTSA 2K05A 4IURA 5EPJA 1EIGA 2FINB 2L9HA 3IFDA 4ZLTF 1WTPA 1WTRA 3G7LA 1QG7A 1C8CA 1DOMA 3DEPA 1F9RA 3MWYW 4QUFA 2K28A 1BBXC 4IUVA 2KOLA 1F9PA 2B2VA 4HSVA 4CJ1B 2B2WC 2L1BA 1ILPA 2K04A 2KVMA 2Q8RE 1RTOA 1NAPA 2DY7A 1WTOA 1WD1A 1U4MA 1JE4A 1CA5A 3DEOA 1B4OA 2FHTA 5CMDA 4CJ0B 1RHPA 1KNEA 2HCIA 5EQ0A 1B2TA 3N52A 5T1GA 1TVXA 3LWEA 4NW2A 3I3CA 1RTNA 3P7JA 3IL8A 4IUQA 1KNAA 1EL0A 2B2UC 1ESRA 4QUCA 2HDLA 3D6WA 2L11A 4RWSC 1WTVA 2FMMA 1XYIA 3SVMA 2Q8TA 1NCVA
chains in the Genus database with same CATH superfamily
4RKLA 2K5QA 5FLXc 4DNIA 3J80L 2QA4A 1KC8C 2Z6KC 2H5XA 3FMCA 5IGCA 4N8FA 2SDFA 5CV7A 2DGYA 4N9TA 4LF9L 2WKDA 4CDCC 1NNXA 4LAAA 2R93H 4FF3A 2P5ZX 2OCEA 5FJ8G 4KJNA 5I6YA 4HN7A 1BKBA 4R4QA 1IBLQ 4FF4A 3BU2A 3CPFA 3LX0A 2SNSA 2VB3X 3TQYA 1L0XB 1FNWA 2B3GA 4DAYB 2A69D 4JK1C 3F1ZA 3FKIG 3WWVA 1I4XA 5CV4A 3S1MH 3PSIA 1SMXA 3TRZA 4C3HG 4NXML 1XMQQ 2UUAL 3OW7A 2JP1A 4KMUC 2JA7G 1LV9A 2D0PA 1VMPA 4O2DA 3K0XA 2AQ2B 3OMCA 3NENA 3RLFA 3M3YB 3S15B 1SNMA 1PDQA 2RDGA 3MC0B 1IBKQ 3S16H 2Z9HA 5E7NA 4X64Q 4U673 1Y1VG 2N55A 2JA5H 1DOLA 2ZXRA 4K6DA 2WB1B 1K8MA 3TMEA 1NMFA 4BY1B 2B2YA 1VQMA 1TKWB 1YZ6A 3CC4A 4B08A 4RGTA 4IJLA 2JYOA 1VMCA 1EIYB 3GTGH 5GAHC 2KHJA 4YWMA 1EY8A 1SXTA 5M3MH 1XJVA 1HNWL 3S2HH 5I2YA 3GTGB 1K83B 3S1NH 4LFCL 3R93A 2ICIA 1M8AA 1D5XC 1WFQA 2JE6I 4DA2A 1A0IA 3A7LA 3PV0A 1KQSA 3MWYW 5IP7G 4DK3C 2O5IC 3DWPA 1HJPA 4ZQ3A 5A2QL 2E2DC 2ZXPA 1W2BA 2R7ZH 1PYBA 3S1RB 3I55A 1HZAA 1FGUA 1KNEA 3BZCA 3N52A 5HY6A 4JC0A 1Y1WH 1Q7YC 3CCJA 3VR3A 2E8GA 2R7FA 5ELDA 1EL0A 3SK5A 3N6RA 2HDLA 2L11A 2PI2E 3RNUA 1MHWC 3CAMA 3K59A 4PG3A 1QNUA 4FVMA 4HCEA 1UAPA 1N33L 5J3BA 4KJOA 4KY6A 1HR0W 2IHEA 1FGBD 3NSWA 3TP8A 1QUQB 3C3LA 2Z4IA 1AEXA 4R4CA 3HFZB 4L5SA 3I90A 2F3WA 4GN4B 2K03A 4K0KQ 3CCEA 1GJXA 1YBYA 3J81E 2D0OA 4LF7Q 3KF8A 3W2DA 1EYCA 3G6JB 3RZDH 4A3LH 3FRPB 1A6XA 1VQBA 1Q82C 1AE2A 1Q3LA 2RA4A 4OEMB 1XPOA 3J7A5 5KEEA 4JVZA 1JJGA 2Y0SE 2HHHL 3T1HQ 2A1AA 4R4IA 3J80c 3T4AC 1SN8A 1DCZA 5JVG3 5I9OA 3S16B 2QDLA 5EAYA 4AQYL 1G2TA 4K2LA 2EY1A 4A3MB 2NN6I 2Z0SA 1B53A 5IYCG 2ZTDA 2UXBQ 1S72A 3K6OA 3D8GA 1ASZA 3RMHA 3HKSA 3CU7A 4AYBE 1YNND 4UP8A 5C3EB 1A62A 1PYWD 1PVOA 2H1EA 5M3FB 5DM63 1LTLA 5FO9B 1CTMA 5C5LA 3W1BA 2DY8A 3QB3A 5IGEA 1BBUA 1WCMH 1XPUA 1J8IA 2IL8A 4LF9Q 1EU4A 4WJ3M 5M5XB 1VQEA 2F0DA 1I5FA 4LWCA 1HFGA 1TY0A 4A3EB 1CUKA 3CP0A 2RSOA 4OHJA 2PPBC 3H3VC 3UDGA 3GTMH 2I5MX 4DV4L 4FXKC 1VCIA 2M9VA 3DEPA 1F9RA 4QQBX 1OXUA 3K8AA 5JEAJ 5AJ3L 2EYFA 3RD4A 1G51A 3GTKH 5EKKA 4KHZA 2F0KA 4JCVE 5C3XA 1PTOD 1S5ED 1JORA 5IY0A 1QB5D 5BN5A 3HOYG 2Z8LA 5G3LF 3PO3G 1LTTD 3OPOA 3I4MG 4S3SA 4XQJA 2EVBA 1YNJC 4K6LA 1IW7C 5ELNA 2XWBB 2F03A 4KTAA 4MZ9A 1YHAA 4HR7B 5M5XH 3T1YL 2BA1A 2VNUD 1SE8A 1TWAB 1B44D 3A5UA 4GNXA 4BY7H 1Q12A 1BCPD 1HZ9A 4M8AA 2R92B 2CVRA 2DJFC 2JA6H 4DF7A 4U68A 5IYBH 2EOTA 4K8JA 4HJ7A 3GTLB 2C9OA 4DV5L 2KCCA 1CSPA 1TS3A 1OXXK 1NUCA 2QGQA 2XIWA 4NDXA 4FDBA 4B3ML 5I9PA 4IFDH 4B3SL 3PO2B 2J7ZA 4JI2L 2F0WA 4UP7A 4GNXC 4O0AA 1I94L 1MD2D 2JA8B 4R8NA 1EEFD 3K5NA 1SSOA 2AUJD 1WCMB 3H09A 2MO1A 1B9NA 4I7AA 1IBKL 1PTOC 1F2LA 3MEHA 3HZXA 4LF5Q 4HCSA 5E4WC 4FO2A 3I4NG 4A3MH 2XTIA 1JOQA 3CMEA 3H0GH 1UE7A 1FNUA 2F0LA 4YWLA 2K5DA 2R3ZA 4NXNL 2XN9C 4NP5A 3Q0AA 4A4IA 3KDFA 3P75A 4P74A 3NBHA 1PFBA 4QIWE 1WTHA 3RN5A 3C2PA 4JV5Q 2K5WA 2IX1A 3I4NB 4DR6L 4H13C 2K01A 2KECA 3I4NH 1SFOH 4QF4A 1UE6A 2OF1A 2OEOA 2PW5A 5BR8Q 4CDDC 5GADC 1ZXTA 1RODA 2HT1A 3SXHA 1H9SB 1PFSA 3M4PA 5ELFA 4OELB 2VB2X 5M9OA 1D8LA 4DAYA 3CF5A 3HOWG 3GTLH 1Y1VB 1BBXC 5DEHA 5JEAG 3OTOQ 2SEBD 1UNSA 4JI8Q 1NAPA 3NQIA 4X62L 1GUOA 3FEWX 3PO2H 1CKNA 5A2QE 2NVTH 3RZOH 3H94A 3H3VI 1TVXA 4BA1I 2JA8H 2K75A 5DM73 2ZJQA 1SYBA 3D6WA 1IYUA 5J39A 1HUMA 1ONLA 4I7ZC 1VDZA 1PH6A 4POGA 3E6ZX 2XRSD 4OX9Q 4A3MG 3HOZB 4A3GG 4PQXA 1GHJA 1MGSA 4DNRB 1CZGA 4GOPB 4J15A 4MTKA 1EY5A 1K8AC 1Q81C 4A3KB 1XWEA 1PH3A 4G7ZC 3QIAA 4CBVA 1ICWA 3G71A 2UUAQ 1ZKOA 4KD4A 1T5XD 1HNZL 1PMRA 1RF2D 2ENBA 4IFDG 1VQ5A 4JI0L 3K7AB 5CGKA 2CWAA 3SK8A 2HDMA 1E24A 1KTKA 1CKMA 1SDFA 1X56A 2RHSB 3Q8DA 5CV9A 1JWUD 4CDEC 3CCVA 2PNHA 2DJGC 2O4XA 1ASYA 1VQ8A 1X65A 1X3GA 4G7OC 1BCPF 2DUDA 5EKLA 3NELA 5FLMG 3CC7A 2G9DA 4EQNA 4GLVB 2F3IA 5AJ3Q 1V1PA 2NVYH 1SNDA 3WOEA 1TS5A 4BBRB 4OX9L 1D1IA 1QVFA 2F0OA 1CI3M 3RN2A 3KF8B 5D65A 1BO0A 4PV1C 3IAYA 4GKKL 3HOUH 4DK0A 1OXSC 5C4XG 4DUYQ 4LF5L 2ZTCA 1CKOA 2WAQE 4HJ9A 4A3BB 3F2BA 4Y52H 1HZBA 4XQNA 2Q8IB 4DN4M 1LACA 2E2JH 1EQVA 2E2HB 2NZOA 1QZHA 2B2UA 3M7NA 4Z9CB 5FKAC 5LMUQ 3T16A 2GVAA 3NWSA 1DOMA 3NBIA 1V1QA 2BDOA 4NKLA 4HSVA 5FOBB 3OWEB 4AQYQ 2XVSA 5JEAH 2F0QA 5C0XH 4FP5D 5C3EG 1AFPA 5CMDA 3BVGA 1FNVA 1GUSA 2B8GA 2CH4W 4IUQA 3HOVH 5KYLA 2B2UC 3RLOA 2A69C 4KY5A 3PUWA 4R1JA 2VUMB 1KRTA 4R8IA 1TWFB 5C4JH 4Q0FA 3M4QA 3NXWA 1DD2A 5BN4A 4J1MA 4K0KL 1E2ZA 2UXCQ 4HMJA 3GTPB 3DLLA 3HOWH 2RQXA 1STYA 1PFNA 2YYZA 5HURA 1I6VC 1OXVA 4X64L 3BDLA 3A8IE 2ATWA 1XPRA 4X3KA 5F2DA 2OQ0A 1S40A 5G3LD 1O7LA 1DOKA 3GV6A 4HIKA 4DV3L 4A3EG 4GKKQ 3S1QB 2Q2HA 1HCZA 1DONA 2LKVA 3CHBD 2B2YC 4OWWB 4IFDJ 2JSOA 1X3QA 2NYZD 1EZ8A 4DV6L 3BZDB 4GNXB 3VR2A 4A3IH 3C1FA 4IUTA 4JI1Q 3FKIH 1N33Q 2GN5A 3E3XA 3E0JA 1O80A 4HIDA 4HJAA 3K81C 1GUGA 1PH1A 3S1RH 3GTJH 3NE5B 1IBLL 2F0GA 1ZYRC 1U4RA 1XMQL 1JJ2A 5HGQA 2R7ZG 1BQQT 1LYLA 1LTID 2RCFA 3OHXC 3TP5A 1F77A 2EYJA 2F0UA 2DNCA 2MGSA 2L0CA 1Q90A 1EQRA 3GP7A 4DV1L 2BH2A 1BDOA 5K5PA 3UE0A 1X3PA 1JMCA 2IT1A 1F2MA 1QVCA 4BBSB 4GKJL 4RGNA 1VQKA 4YCUA 3HKZG 5K36G 3VA5A 3D3RA 4K2KA 1SNCA 1YITA 1EOVA 3HEJA 2A19A 3HOYH 3CW2C 4DXFA 1EU3A 1U4MA 2RF4A 3DEOA 1YNXA 3EVQA 4N8X1 3DWQA 3U9OA 2PZWA 2UXDL 1KNAA 3SDZA 2VUMG 1NMGA 3S2HB 4JI4Q 2Q8TA 1NCVA 1S4ZA 2N8NA 1S5DD 1MSHA 1G91A 3UI2A 1KRSA 4NB3A 3DXJC 3M4YA 3VDYA 4A3JG 4C3HB 1JQYD 2AQ1B 4V0BA 3PIP3 3A54A 1CKNB 1U4LA 1C7YA 2F4VQ 4YHHQ 2F0FA 1KL9A 3TSSA 1EUJA 1EY0A 2EPBA 3C1EA 1PH4A 4DR4Q 1L2FA 2JN4A 2J0TD 1K3BC 4Y7NH 2WACA 3GV3A 1AE3A 4LFBQ 2AHOB 1PFMA 2HUGA 2PW7A 2JA9A 3ULJA 1JE5A 1J5EQ 1JWMD 4BBSG 1EWIA 1SYDA 3P20A 5D14A 3HKZB 4YIJA 1R9TB 4DNTB 4UY8C 3HOXB 4X66Q 2JA5B 1AZQA 1AP0A 2MNAA 1Y1WB 3EQLC 1ILQA 3RZDB 5EGTA 2WFWA 5M3FH 1MKHA 3TP6A 2QW7A 1KAWA 1LUZA 1JOOA 1UEBA 4XTCS 4IPDA 4UP9A 5EBCA 3AFQA 1YVCA 3CMAA 1HR0L 2NVXH 3CCSA 1HZCA 4JI3L 4ZK9B 1QOHA 1K9MC 3U4ZA 1PH9A 2KCMA 4LF6Q 4GZYC 3NQTA 4C3IH 3MTSA 2EYLA 5FO7B 3IFDA 3HOXH 2V4DA 3J81c 1VQHA 4LUZA 3GTKB 4IUVA 4JI7L 3RUZA 3BJUA 1SYFA 1ENCA 1F9PA 4CJ1B 4DR1Q 4RHRA 4IZ8A 1N36L 5J22A 4GOPC 4KV6A 5IP7H 3S1MB 1JE4A 1L0YB 3MFYA 1LTAD 4ILWA 2HCIA 2M00A 1N9WA 4HIMA 4KN4C 2ZM6Q 1MJEA 3KFUA 1I6HB 4QUCA 5ELBA 2A8VA 1QJOA 5M5WH 2NVQB 2JJQA 2PMZB 4IO9A 1OO9B 5LMNQ 1IYJB 2WAQG 2E5LQ 2A6ED 1SNOA 1VQ7A 1B3AA 2B29A 5LL6X 3L9AX 5IT9L 3SK4A 1X3EA 1V43A 3W5OA 3J81j 4DV4Q 2B8FA 2X69A 3TS0A 1SMYD 1V1OA 4LF4L 4NXMQ 1PH5A 4KHPQ 4DV2L 3QOLA 2E5LL 3L2PA 2KA7A 4C2MH 2KHIA 2ICEC 4BA2I 2K14A 4C2MB 2UU9L 5JJIA 5KGUA 1SAPA 4BY7B 3VYUA 1NE3A 2UUCQ 2VS1A 3BZKA 2RHQB 5COYA 1VQJA 4C3IB 4DUZQ 3D31A 3KF6B 4XT1B 1VQGA 3KJOA 3T53B 3AEVA 3CCQA 4OWTB 4A3JH 2AKWB 1EQQA 2PQEA 2M2LA 3LWUA 3KLSX 1H9JA 2OWOA 5CBEE 1EFWA 3RZOB 1TS2A 4DPGA 3MXGA 3ER0A 3FVQA 4HAEA 1B7YB 1N32Q 2DNEA 3CPWA 4XXEA 2OQKA 4DXGA 1BCPC 2B39A 1HPCA 1NY4A 1I4HA 3V96A 1L1OC 4ABNA 3E9HA 4A3CH 3CQZB 1QWYA 1QCBD 3KBXA 4DR3L 2VQFL 1N8RC 5IP9G 2JA8G 4OO1I 3HOVB 1IW7D 2D62A 3T56B 2CW0D 3AQQA 1H9KA 2L9HA 4RHSA 3DUZA 4YCWA 5KNDA 4DV1Q 2K04A 5CC4A 5IYDH 1UE5A 2CFMA 1KD1C 4L5TA 1W3SA 4KD3A 4H7BA 4A93H 5IGBA 2VZAA 2JEAI 4A3LG 4B3TL 1UWVA 1J5EL 3K5MA 1WOCA 1PRTD 3CRLC 3GTQB 2FMMA 3SVMA 4GLAC 1DZ1A 2G9HD 1WJJA 4MTNA 1F2YA 4A3BG 1R4QB 4IALA 4O1NA 1SEBD 2MQHA 1PV4A 5CBAE 3A8JE 4KHVA 3MXUA 4TSSA 2EJGC 4RAUC 3HKZE 5KIXA 4POFA 1GUWA 2JA7B 4YHHL 4DK1A 4IUNA 1DYQA 4DV7Q 1RIPA 3DM1A 1PRTB 4JOIA 4HTHA 4A93B 5KNCA 1I3QH 1D6EC 2RVLA 5D3DA 1SFOB 1LM0A 4FF1A 1HNXQ 2IJ0A 3PUVA 5IGGA 1C48A 1YJNA 2RDFA 2E2IB 2MHVA 1YJ9A 1PTOH 2I0QA 2HIVA 2O5JC 1KLUD 4JOIC 3K7UC 3CKIB 4XDXA 2VL6A 2YU9H 3G48A 5IOCA 4ODGA 4A3KH 1F9QA 4RFBA 4IPGA 4A3FB 5IYDG 4HIOA 3FP9A 1K83H 3S1NB 2EY6A 3OW2A 1LTGD 1NJIC 1TXYA 4ME5A 2EZVA 2EJFC 4HJ8A 4MN3A 1QUQA 3TZDA 2K6AA 1F9SA 4L5QA 4EQOA 1QNKA 1GVPA 3S2DH 1EWCA 2EIFA 3A8KE 5C0XJ 4FXGC 3CCUA 1EQTA 1EYDA 3HOVG 4JI0Q 3X3NA 3D6CA 3GDEA 1B70B 4A3CG 4AIMA 1TT2A 1IYVA 1X32A 3VA7A 4PZ7A 1EYAA 2K50A 1A15A 1I50H 3JAME 5HGTA 1C8CA 2JA7H 1TWGB 3K5LA 4AYBB 2K5HA 4TKOB 4IJHA 1K8GA 1XNRL 4TRDA 2KCTA 1RTOA 1WTOA 1VQ4A 3K0YA 5GQOA 1ET6A 1CQVA 5IT9E 2F0VA 4BY7G 3C46A 2EYPA 3K80C 1UUPA 3P7JA 2HQEA 2ZJPA 3K7AH 1FD7D 4V190 5IYBG 1ENAA 1GUNA 1QVGA 3P1HA 5FO8B 3ND8A 1WTXA 2CCZA 4F8MA 4IUPA 1HXYD 2D2CC 1W6KA 3TEHB 2RKSA 1VF5C 3FKIB 1Z9FA 4UHVA 3S24A 2KBNA 1IHZA 1VQ6A 4JBWA 2JEBI 3U50C 2NN6H 4L6TB 1XMOQ 4R4TA 1O78A 2VW9A 1P8LA 2OTLA 2XSCA 2BDNA 4LFAQ 1HNZQ 5JJKA 3HOUB 4CKCA 1NSNS 1UEAB 5IIFA 3S2DB 2WB1E 1TU2B 1JOKA 2R7ZB 1WCMG 4I65A 5JOBA 2F0NA 2N49A 5IGFA 1A8VA 2R93B 4JW0A 3T13A 1K3RA 3EIVA 3H6MA 4RA8A 2UUCL 1FJGQ 1AW7A 3AFPA 3VR5A 4ZYSA 1DM0B 2MUYA 2PZUA 2HCCA 1Q1EA 3HOWB 3IRBA 1QE6A 1X54A 3R8BA 5IWAQ 4DV2Q 1EOTA 1SMYC 1GKHA 5EBDA 4F7XA 5KRUA 5C5MA 1Q86C 2B2TA 2NUCA 3LNNA 4DR2L 4TQUS 4WORA 3MZ5A 4DR3Q 2F0SA 4P73A 4RMFA 3STBD 1KLGD 3M9BA 4HMIA 4K5XA 1MI2A 5KYIA 1N34Q 2I07B 2XGTA 4JBKA 2F0MA 1XX8A 2IY5B 4AYBG 3M3YH 2NWGA 4IOCA 1XNQL 4XYOA 3H3VH 2B2TC 2R61A 3W3AA 2K05A 4DV5Q 1WTRA 1E2WA 3VYTA 5H1SE 3S14B 3HOXG 4YY3Q 3HOYB 2KOLA 3KK7A 2UUBL 3FPPA 1ET9A 1PZKD 4FF2A 3NPPA 2WIIB 1JCKB 1CA5A 2EQSA 3MVVA 1TQOA 5E3FA 2ZJRA 4KKSA 2N3SA 3KF6A 1H9SA 4CKBA 4DV6Q 5FK9C 2UU9Q 5JPMC 1B1ZA 5IE8A 3BVZA 4DAPA 1SE2A 2NTTA 3F2DA 1HQRD 4JI5Q 3NBHB 3Q24A 2I5LX 4LJZC 4PMBA 1CHQD 1SR3A 5EPKA 2E74C 3UDFA 2JA6G 2E76C 2A74C 2JA5G 4JYAQ 2LS01 4C1NI 1E1TA 2X6LA 4DV7L 1JICA 3GTMB 1I4QA 2A68D 2AMCB 4OGQC 4A3BH 1N32L 3HG9A 1YI2A 1M4VA 4ZKBB 1JR0D 3H0GB 2F3VA 5D3IB 1SYCA 5C3EH 3K57A 3S1QH 3F2CA 1HRJA 2KEEA 3I4MH 2ES2A 4G7HC 4EVOA 3KBGA 2XRQD 2A68C 1XTCD 1J6QA 4JI5L 4IFDI 1N36Q 1D2BA 4DAMA 4L8JA 5I2XA 2TMPA 4JPBW 1QILA 3EFXD 4H0LC 3F8TA 1XMOL 5T1IA 4DR4L 4XQQA 1MIUA 2Y0SB 2NN6G 2HHHQ 1JT8A 3W1GA 3SK6A 1SYEA 2VUMH 3MXNB 1PRTC 3JC66 2B2VC 2D5DA 4ZAIA 1IKMA 1I4GA 4GOPA 3SGIA 2VY3A 3PUZA 1BOSA 1B3QA 2CKZB 4LUOA 1VQAA 4MIUA 1DXMA 2PYKA 5EPJA 4ZLTF 1BBWA 2FINB 3K58A 4YWKA 4B3RQ 1VS0A 2ID0A 3JAML 2B2VA 2UXDQ 4EQPA 5JVH3 4CHTB 4C56C 2ZM6L 1WD1A 4IQZA 1C9OA 4K14A 1LLRD 2R93G 1Y8NB 5EQ0A 1SJHD 4KKTA 1Q8IA 3DMUA 4RG1A 3VR4A 3NHHA 3K5OA 4RCOA 1UE1A 1XYIA 1WTVA 4QY7A 3ITPA 3STBC 2QKIC 2MPMA 3M4OH 3J7AF 4JI6L 1I94Q 2SNMA 2B63H 2EE1A 2EY2A 2EDGA 1YJWA 5NUCA 1HTLD 2O2LD 2B63B 4A3GH 3T1HL 1SROA 2BOSA 4P71A 4O42A 4Y7NB 5BR8L 4ZKCB 2WP8J 4NPSA 2TSSA 4OIJA 2IX0A 4N9PA 3RLNA 1D7QA 5C6AA 3SE0A 1E3PA 4M1UB 4LFAL 1V9PA 1II3A 2YU9B 1U0LA 1PH7A 1OXTA 2L15A 2MJ8A 3F2UA 5EJWA 3OWFA 2NVTB 5GROA 1PZID 3GTOH 4IPCA 2F0TA 1BUVT 1RCVD 1N34L 1IZ6A 2AWOA 1FYCA 4C3IG 4X3SA 2I5HA 1S3OA 1BVSA 1G6PA 1KHIA 1KAAA 2KUMA 2RDHA 2LY7A 2IX3A 1L1OA 3TN2A 2ASBA 4E6IA 4C1NK 5C0XG 1IKLA 3A56A 1SRUA 4L63B 1EY6A 3A74A 1GXDC 1E1OA 1STGA 3PIPA 4DR1L 5GAEC 3GO5A 3KUPA 4RGMA 2HQLA 4JI2Q 3OIQA 3H0GG 1E22A 3GTQH 1FJGL 3G6EA 2F52A 1O7IA 3M4OB 1SBBB 1PTOF 2FXQA 1WYDA 4JI3Q 1O7ZA 2E75C 2B63G 4A76A 1J9OA 4C3JB 1FVIA 4QJFA 3B6YA 1EYGA 4IURA 4LFBL 1T5EA 1EIGA 1YHBA 3BDOA 3G7LA 3FHWA 2JQOA 4QIWB 2K28A 1HTPA 1CT1D 4WFN3 4JI1L 1Y8OB 1HA5A 1K28A 2GA4B 2R7DA 4LF6L 1GM5A 4OL7A 2IWHA 4JI4L 1TIID 3OOCA 1PRTF 1B4OA 3KLSA 4LK1C 1EEID 5M3MG 5C44B 4A3IB 1EWHA 2OXPA 1A3VA 1U5KA 3I3CA 1RTNA 2Y0SG 4B3RL 5A35A 3PO3H 1H9MA 1L0WA 4JG2A 2HIXA 2QF7A 1C4QA 2X6GA 1PH8A 1SYGA 1STEA 3JAMc 3PF4A 2IHFA 3SR1A 1VQCA 1GHKA 4YCVA 3DHQA 3MFGA 1HA6A 4DUYL 2LFNA 1I4RA 4A3FH 2F0HA 1PYSB 2E2HH 4KY7A 4CKEA 5L37A 1MBYA 3PCOB 4RKBA 3TS2A 3NK9A 1RJTA 4RCNA 1H95A 4OIKA 4H44C 4JI6Q 1LTSD 4CJ2C 3E0EA 1BXTA 1XXGA 4EGVA 5IP9H 3FDTA 2NZHA 4DR6Q 3UDIA 3GTJB 3AU7A 4QB4A 1HFNA 1CFMA 3KDFB 5CYUA 2OT2A 4CGYB 2WAQB 3ZJYC 5IGDA 2C5CA 2E2JB 5AFWA 5FJ8H 1CQFA 4UDUC 3PO2G 1LTRD 3PIOA 2CWPA 2RSNA 1VQ9A 1G291 1H9RA 1HH2P 1K8OA 4LUVA 1HNXL 4WJ4A 4R4OA 2K33A 1TWCB 1Z6HA 1G8ZD 3CXCA 1SNPA 4BY1H 1JWSD 1GO3E 2K1BA 3TREA 2RCNA 2N88A 1BCPB 1Q46A 3M85A 2ALYB 1ML0D 1X9NA 4BXXH 4DR7L 1WTPA 3EN2A 4QUFA 4PNYA 4A3IG 3PGZA 3I2ZA 2MO0A 2L1BA 1PH2A 1ILPA 2CH4A 3MXNA 1RL2A 1SJED 5CV5A 2DY7A 4BWGB 4X62Q 2UXBL 2EYMA 3BS1A 2AUKA 5ELEA 1B2TA 1I3QB 1RDPD 4PZ8A 2A6HC 3PIO3 4TVAB 2QEJC 4ZCKA 1Y1WG 3EA6A 3BDCA 1RD9D 4QMGA 4C3JG 1GOZA 4AH6A 1SE3A 1P16A 1HUNA 1PLFA 1PHJA 4H02A 1PTOB 1AH9A 4LNQA 4K5WA 1STHA 2DN8A 4B3TQ 4LF4Q 4FYDA 1NR2A 2XNAC 4BBRH 1CZWA 4IUUA 1TR5A 4KI0A 5CV8A 3EJIA 4OO1H 3S15H 4KK7A 1BF4A 1VQDA 5M5YH 2Z6KA 5M3FG 1AN8A 4IPHA 1GUTA 4HEDA 5C4XH 4GLXA 1VF7A 2WKCA 3VR6A 4APVA 1BNZA 4KHPL 4ME3A 3GQBA 3TBIB 3ONAB 4QL5A 3L0OA 4XIGS 3D4DA 2CHBD 2K4KA 4EQ5A 1O7YA 1LABA 1TWGH 4G57A 1VQOA 2HD3A 4XT3B 4LF8Q 4UAIA 1VQPA 1I50B 1RKNA 4ID6A 3EBEA 1SLJA 4DUZL 3J7ZC 1WVLA 1F2ZA 1A3UA 2JXMB 1PA6A 2V1CC 1STBA 3PF5A 3H15A 4OXPA 4C3HH 2R92H 3Q22A 4A3DH 1LO5D 2L4NA 2PNRC 1CA6A 3HOUG 4BY1G 3CCLA 1BR9A 4F87A 4J6HA 4RGOS 2WINB 2CQOA 1OTCA 2VQEQ 2YTXA 2KJXA 4L5RC 3AB9A 3SEBA 4X6AH 4A93G 1Z47A 1XTDA 3J80E 4LW1A 1CHPD 3Q6SA 5DNFA 1VQLA 3GD7A 3MA2B 5M3MB 5JAVA 2FMCA 5E4XA 1IBML 1STNA 1YNJD 3KLRA 2C35B 4JBMA 1ENFA 4DK6C 2A6HD 2CQAA 2B2WC 4ZUIA 3E5SA 3D0FA 2OTJA 5FLMH 1T9HA 5IYCH 2IPKD 1EIFA 3Q23A 2NBFA 4A3DB 2NTSA 3OYYA 1RHPA 3WDNA 5C4HA 1SNQA 3A5ZB 4X65Q 2K7VA 4NW2A 1Y14B 1A3TA 4HSPA 5J1ZA 4A3JB 1JC7A 3IFTA 1YIJA 3D4RA 2K5VA 3BVMA 3S9WA 2EY5A 1V1PB 5LHY1 1L1OB 2Q2IA 2B2WA 1VQFA 2KEDA 4PMWA 3X3MA 3I91A 5LL6S 4B3SQ 2PO4A 1FL0A 3G4SA 1TWAH 5BN3A 2FFKB 4DV0L 1JB3A 2I46A 4QGUA 3NWTA 3VYRA 3QWNA 2KCNA 2NB0A 2WB1G 5C4XB 5IODA 2EXZA 1IXRA 2F1MA 3AMUA 3KYHC 3TZUA 4LFCQ 3AYHB 1VQIA 3TP7A 5FLXE 3T51B 3V2TA 2A5HA 3I4MB 2RBMA 3PUYA 3UE1A 1NBWA 3LGJA 3EROA 1G6ZA 4DKAC 2IW3A 4RH6A 2F0JA 4BS9A 3OMGA 4EX5A 3RR5A 2F4VL 3HP3A 3A0JA 2EXDA 3URYA 3S14H 1C0AA 2KENA 1WD0A 1EY7A 3NEMA 1R4PB 2PI2A 1B8AA 1TS4A 3HGBA 4DGZA 1IL2A 1HHVA 4DR5L 1DGSA 1X55A 3CQZH 1K0SA 4DU9A 1V8QA 4OO1G 1WTWA 1AZPA 4FNFA 2Q2TA 1YNNC 4IN3A 1HQMC 3CC2A 2ZXOA 3OTOL 4LF7L 1S5BD 3CRKC 1K73C 1LT6D 1D5MC 2D9UA 4GN3B 2LMCB 2PCFB 3U9SA 2EJMA 1TWFH 5C4JB 3O13A 3R2TA 1LTBD 5CV6A 2PQAB 1ZEQX 4CDFC 1KDAA 1E0BA 4KLKA 5IT9c 3QO2A 3I72A 2F0EA 3DWAA 2L5TA 3CCMA 2F0IA 3U4VA 1U9RA 3ERSX 2H4OA 1KIXA 5GAGC 2QDBA 2R6GA 3QG1A 5ELCA 1MJCA 3QJYA 4B3MQ 5JPNC 1Y1VH 1XNQQ 2FHTA 1YHQA 4CJ0B 4KKUA 1HR0Q 1NTGA 4BBSH 5C3WA 3CCRA 1Z7TA 5TSSA 1B9MA 1ESRA 3PMFA 3UDXA 2LXJA 2F0PA 5LMNW 4DV3Q 1KDCA 4DFAA 4RWSC 3J7AV 2L55A 2AWNA 4LF8L 1PZJD 1Q8KA 1ICFB 3J81L 4ULLA 3I56A 1NR4A 3MAQA 3NTIA 2Z1CA 2G5DA 3DM3A 2FJ2A 1HNWQ 4QCLA 4P2CB 2LSSA 3NP8A 4DR7Q 3HOZH 4GKJQ 4PZ6A 2K5NA 1ZYRD 3MEFA 1EY4A 5ELOA 5JJLA 4MHEA 2A6EC 3E9IA 1XNRQ 1X6OA 2NZ1D 4ZRZA 4X3UA 3OSOA 5DAUA 3FPUB 3NUCA 5KNBA 2NVXB 1FR3A 4R9WA 2PZTA 4ZUJA 2BA0A 3ULLA 4G4KA 4GS3A 1KABA 3A55A 2GVBA 4BXXG 2VQEL 3I7FA 1K0RA 5I4DA 1TWCH 3V05A 4DV0Q 2MFIA 3BYYB 3J7YW 1E2VA 2F4IA 1E7ZA 2YTVA 5C4ZA 3PQIA 2Z4HA 3R2IA 3ZYYX 1VQNA 2L12A 1A63A 2K32A 4OWXB 4IOAA 5K36H 4KN7C 1LT3D 5LMUL 1I6HH 2KHSA 3T1YQ 3D4WA 5E1FA 1D5ZC 2UUBQ 2WV6D 5C0XI 2VQFQ 2KQ3A 2XWJB 4A3FG 2K52A 2YTYA 1JJCB 1PXUA 3BYTB 5I6WA 1I4PA 1WI5A 4P75A 1CSQA 2SOBA 2QEXA 4A3DG 3L7ZC 2R92G 1IBMQ 4HJ5A 2QILA 3HOZG 4A3GB 1CM9A 4JYAL 3M7GA 2J4XA 4K5VA 5CR3A 3L3OC 4DR2Q 4DR5Q 1D1KA 2Q8RE 4NMZA 2NVYB 3MXPA 3ERQA 1EY9A 5IWAL 3HS0C 1KDBA 5T1GA 1TWHB 4A3EH 4JI7Q 3NTHA 3BG3A 3PUXA 3R3OA 1R9TH 3IKJA 2QCPX 3OIPA 2EYOA 5FLXL 3GTOB 3J80i 5M5YB 1STAA 3I4LA 1EIHA 2E2IH 2Z6BA 3A7AB 5ISRA 1M1KC 1QZGA 3KJPA 1IL8A 2YV5A 1JB7A 3WOFA 3S17B 3NTKA 1MSGA 5M5WB 2NVQH 1GD7A 1S5FD 1U4PA 4WJWA 3KLWA 1G2SA 5DLQE 5C44G 4P72A 4A3KG 3CD6A 4Q5VA 3GTPH 4MNOA 1TWHH 4NXNQ 2AQ3B 4PMCA 1Q1BA 2JA6B 3TDQA 2BE5D 2ZT9C 4A75A 2PQAA 1YEZA 4B9WA 1B50A 1SE4A 2A73B 2VXWA 4C3JH 4K8IA 3QOJA 4X65L 2JK8A 2BH8A 2UXCL 1WTQA 2EYHA 4F88A 3H91A 5JJZA 5CORA 5C44H 4X3TA 3S17H 4WRDA 3SHLA 4UPAA 5LMNL 3ICEA 4JBJA 3MHBA 3J81i 3QR8A 4DAVA 4BBRG 1LT5D 3I8ZA 2MP1A 4LMQD 5EKIA 2ZTEA 2BCOA 1LT4D 1EZ6A 1M90C 1Y69U 3I73A 5EPLA 1W6JA 4YY3L 2LXKA 4FXDA 1A2UA 3U58A 1S5CD 2PMZE 2N78A 3ULPA 3I70A 1KXLA 4ALPA 4OONA 1EFID 4J8QA 1QG7A 4GN5A 2BE5C 3VYSA 3KOJA 3ND9A 1DJRD 2CW0C 3HRZC 1A2TA 2KVMA 4X66L 3JAMi 3I4OA 1Y8PB 3PO3B 1CK1A 3LWEA 1X3FA 4B9XA 1TY2A 4JV5L 3IL8A 4XYQA 2Q2UA 1ESFA 4JI8L
chains in the Genus database with same CATH topology
4RKLA 2K5QA 3J80L 3FMCA 5IGCA 2SDFA 5CV7A 4N9TA 2WKDA 4LAAA 4FF3A 4KJNA 5I6YA 4HN7A 4FF4A 3LX0A 2SNSA 2VB3X 1L0XB 1FNWA 2A69D 4JK1C 1I4XA 5CV4A 4C3HG 3OW7A 2JP1A 4KMUC 1LV9A 1VMPA 2AQ2B 3OMCA 3RLFA 3M3YB 3S15B 1SNMA 1PDQA 2RDGA 3MC0B 4U673 2N55A 1DOLA 2ZXRA 4K6DA 2WB1B 1K8MA 3TMEA 4BY1B 2B2YA 1TKWB 4B08A 4RGTA 2JYOA 1VMCA 1EY8A 1SXTA 5I2YA 3GTGB 1K83B 3R93A 2ICIA 1M8AA 1D5XC 2JE6I 4DA2A 3A7LA 3PV0A 3MWYW 2O5IC 3DWPA 4ZQ3A 5A2QL 2E2DC 2ZXPA 3S1RB 1KNEA 3N52A 3VR3A 5ELDA 1EL0A 3SK5A 3N6RA 2HDLA 2L11A 3K59A 1QNUA 4FVMA 4HCEA 1UAPA 4KJOA 4KY6A 1FGBD 3NSWA 3TP8A 3C3LA 2Z4IA 1AEXA 3I90A 2F3WA 2K03A 1GJXA 3J81E 3KF8A 3W2DA 1EYCA 3G6JB 3FRPB 1A6XA 2RA4A 1Q3LA 5KEEA 3T4AC 1DCZA 5JVG3 5I9OA 3S16B 1G2TA 4K2LA 2EY1A 4A3MB 2NN6I 1B53A 3K6OA 3D8GA 3RMHA 3CU7A 1YNND 5C3EB 1PYWD 2H1EA 5M3FB 5DM63 5FO9B 1CTMA 5C5LA 5IGEA 2DY8A 3QB3A 1J8IA 2IL8A 1EU4A 5M5XB 2F0DA 1HFGA 1TY0A 4A3EB 2RSOA 4OHJA 2PPBC 3H3VC 4FXKC 1VCIA 2M9VA 3DEPA 1F9RA 1OXUA 5JEAJ 2EYFA 3RD4A 5EKKA 4KHZA 2F0KA 5C3XA 1PTOD 1S5ED 1JORA 1QB5D 5BN5A 2Z8LA 5G3LF 1LTTD 3OPOA 4S3SA 4XQJA 2EVBA 1YNJC 4K6LA 1IW7C 2XWBB 2F03A 4KTAA 4HR7B 2BA1A 2VNUD 1TWAB 1B44D 1Q12A 1BCPD 4M8AA 2R92B 2CVRA 4DF7A 4U68A 2EOTA 4K8JA 3GTLB 2C9OA 2KCCA 1TS3A 1OXXK 1NUCA 2XIWA 4NDXA 4IFDH 5I9PA 3PO2B 2J7ZA 2F0WA 1MD2D 2JA8B 4R8NA 1EEFD 3K5NA 1SSOA 2AUJD 1WCMB 3H09A 1B9NA 1PTOC 1F2LA 3MEHA 3HZXA 4HCSA 5E4WC 4FO2A 1JOQA 1FNUA 2F0LA 2K5DA 2R3ZA 2XN9C 4NP5A 3Q0AA 3P75A 3NBHA 1PFBA 3C2PA 2K5WA 2IX1A 3I4NB 4H13C 2K01A 2KECA 4QF4A 2OF1A 2OEOA 2PW5A 1ZXTA 1RODA 3SXHA 1H9SB 5ELFA 2VB2X 5M9OA 4DAYA 1Y1VB 1BBXC 5DEHA 5JEAG 2SEBD 1UNSA 1NAPA 3NQIA 1GUOA 3FEWX 5A2QE 3H94A 1TVXA 4BA1I 5DM73 1SYBA 3D6WA 1IYUA 5J39A 1HUMA 1ONLA 4I7ZC 1VDZA 3E6ZX 2XRSD 3HOZB 4PQXA 1GHJA 1MGSA 4DNRB 1CZGA 1EY5A 4A3KB 1XWEA 4G7ZC 3QIAA 4CBVA 1ICWA 1ZKOA 4KD4A 1T5XD 1PMRA 1RF2D 2ENBA 4IFDG 3K7AB 5CGKA 3SK8A 2HDMA 1KTKA 1SDFA 5CV9A 1JWUD 2O4XA 4G7OC 1BCPF 5EKLA 2G9DA 4EQNA 1V1PA 1SNDA 3WOEA 1TS5A 4BBRB 1D1IA 2F0OA 1CI3M 5D65A 1BO0A 4PV1C 3IAYA 4DK0A 1OXSC 4A3BB 4XQNA 2Q8IB 4DN4M 1LACA 1EQVA 2E2HB 3M7NA 2B2UA 4Z9CB 5FKAC 3T16A 3NWSA 1DOMA 3NBIA 2BDOA 4NKLA 4HSVA 5FOBB 3OWEB 2XVSA 5JEAH 2F0QA 5C0XH 4FP5D 1AFPA 5CMDA 3BVGA 1FNVA 1GUSA 2B8GA 4IUQA 5KYLA 2B2UC 2A69C 4KY5A 3PUWA 2VUMB 4R8IA 1TWFB 4Q0FA 3NXWA 1DD2A 5BN4A 4J1MA 1E2ZA 4HMJA 3GTPB 2RQXA 1STYA 1PFNA 2YYZA 5HURA 1I6VC 1OXVA 3BDLA 3A8IE 4X3KA 5F2DA 5G3LD 1O7LA 1DOKA 3GV6A 3S1QB 1HCZA 1DONA 2LKVA 3CHBD 2B2YC 4IFDJ 2JSOA 1X3QA 2NYZD 1EZ8A 3BZDB 3VR2A 3C1FA 4IUTA 3E0JA 1O80A 1GUGA 3NE5B 2F0GA 1ZYRC 1U4RA 1BQQT 1LTID 3OHXC 3TP5A 1F77A 2EYJA 2F0UA 2DNCA 2MGSA 2L0CA 1Q90A 3GP7A 1BDOA 5K5PA 1X3PA 2IT1A 1F2MA 4BBSB 4RGNA 5K36G 3VA5A 3D3RA 4K2KA 1SNCA 3HEJA 4DXFA 1U4MA 1EU3A 3DEOA 3EVQA 3DWQA 3U9OA 2PZWA 1KNAA 3SDZA 3S2HB 2Q8TA 1NCVA 1S4ZA 1S5DD 1MSHA 1G91A 3UI2A 3DXJC 3M4YA 4C3HB 1JQYD 2AQ1B 4V0BA 3PIP3 3A54A 1U4LA 2F0FA 3TSSA 3C1EA 1EY0A 2EPBA 2J0TD 2WACA 3GV3A 2HUGA 1PFMA 2PW7A 1JWMD 1SYDA 3P20A 5D14A 3HKZB 4YIJA 1R9TB 4DNTB 3HOXB 2JA5B 1AZQA 1AP0A 1Y1WB 3EQLC 1ILQA 3RZDB 5EGTA 3TP6A 1JOOA 4XTCS 5EBCA 4ZK9B 1QOHA 4GZYC 3NQTA 3MTSA 2EYLA 5FO7B 3IFDA 2V4DA 3GTKB 4IUVA 3RUZA 1SYFA 1ENCA 1F9PA 4CJ1B 4RHRA 4IZ8A 5J22A 4KV6A 3S1MB 1JE4A 1L0YB 3MFYA 1LTAD 4ILWA 2HCIA 2M00A 4KN4C 1I6HB 4QUCA 5ELBA 1QJOA 2NVQB 2PMZB 1OO9B 2A6ED 1SNOA 1B3AA 5LL6X 3L9AX 5IT9L 3SK4A 1V43A 2B8FA 2X69A 1SMYD 1V1OA 3QOLA 2KA7A 2ICEC 4BA2I 4C2MB 5KGUA 1SAPA 4BY7B 3VYUA 5COYA 4C3IB 3D31A 4XT1B 3T53B 2PQEA 2M2LA 3LWUA 3KLSX 1H9JA 5CBEE 3RZOB 1TS2A 3MXGA 3FVQA 4HAEA 2DNEA 4XXEA 4DXGA 1BCPC 2B39A 1HPCA 1I4HA 3V96A 4ABNA 3CQZB 1QWYA 1QCBD 3KBXA 4OO1I 3HOVB 1IW7D 2D62A 3T56B 2CW0D 1H9KA 2L9HA 4RHSA 3DUZA 5KNDA 2K04A 5CC4A 4KD3A 4H7BA 5IGBA 2JEAI 3K5MA 1PRTD 3CRLC 3GTQB 2FMMA 3SVMA 1DZ1A 2G9HD 1F2YA 1R4QB 4IALA 4O1NA 1SEBD 5CBAE 3A8JE 4KHVA 3MXUA 4TSSA 2EJGC 4RAUC 5KIXA 1GUWA 2JA7B 4DK1A 4IUNA 1DYQA 3DM1A 1PRTB 4HTHA 4A93B 5KNCA 1D6EC 2RVLA 5D3DA 1SFOB 4FF1A 2IJ0A 3PUVA 5IGGA 1C48A 2RDFA 2E2IB 2MHVA 1PTOH 2O5JC 1KLUD 3CKIB 4XDXA 5IOCA 4ODGA 1F9QA 4RFBA 4A3FB 3S1NB 2EY6A 1LTGD 4ME5A 2EZVA 2EJFC 4MN3A 3TZDA 2K6AA 1F9SA 4EQOA 1QNKA 1EWCA 3A8KE 5C0XJ 4FXGC 1EQTA 1EYDA 3X3NA 3D6CA 1TT2A 1IYVA 1X32A 3VA7A 1EYAA 1A15A 3JAME 5HGTA 1C8CA 1TWGB 3K5LA 4AYBB 4TKOB 4TRDA 1RTOA 1WTOA 3K0YA 1ET6A 1CQVA 5IT9E 2F0VA 3C46A 2EYPA 1UUPA 3P7JA 2HQEA 1FD7D 4V190 1ENAA 1GUNA 3P1HA 5FO8B 3ND8A 1WTXA 4F8MA 4IUPA 1HXYD 2D2CC 1W6KA 2RKSA 1VF5C 3FKIB 1IHZA 4JBWA 2JEBI 2NN6H 4L6TB 1O78A 2XSCA 2BDNA 3HOUB 4CKCA 1NSNS 1UEAB 5IIFA 3S2DB 1TU2B 1JOKA 2R7ZB 4I65A 5JOBA 2F0NA 5IGFA 2R93B 3T13A 3H6MA 4RA8A 1AW7A 3VR5A 4ZYSA 1DM0B 2MUYA 2PZUA 2HCCA 1Q1EA 3HOWB 1QE6A 3R8BA 1EOTA 1SMYC 5EBDA 4F7XA 5KRUA 5C5MA 2B2TA 2NUCA 3LNNA 4TQUS 4WORA 3MZ5A 2F0SA 1KLGD 4HMIA 4K5XA 1MI2A 5KYIA 2I07B 2F0MA 1XX8A 2NWGA 4XYOA 2B2TC 2R61A 3W3AA 2K05A 1WTRA 1E2WA 3VYTA 3S14B 3HOYB 2KOLA 3KK7A 3FPPA 1ET9A 1PZKD 4FF2A 3NPPA 2WIIB 1JCKB 1CA5A 3MVVA 1TQOA 5E3FA 4KKSA 1H9SA 4CKBA 5FK9C 5JPMC 1B1ZA 3BVZA 4DAPA 1SE2A 2NTTA 1HQRD 3Q24A 4LJZC 4PMBA 1CHQD 5EPKA 2E74C 2E76C 2A74C 2LS01 4C1NI 2X6LA 1JICA 3GTMB 1I4QA 2A68D 4OGQC 3HG9A 1M4VA 4ZKBB 1JR0D 3H0GB 2F3VA 5D3IB 1SYCA 3K57A 1HRJA 2KEEA 4G7HC 4EVOA 3KBGA 2XRQD 2A68C 1XTCD 4IFDI 1D2BA 4L8JA 5I2XA 2TMPA 1QILA 3EFXD 4H0LC 5T1IA 4XQQA 2Y0SB 2NN6G 3SK6A 1SYEA 1PRTC 2B2VC 2D5DA 4ZAIA 1IKMA 1I4GA 3PUZA 1BOSA 4MIUA 1DXMA 2PYKA 5EPJA 4ZLTF 2FINB 3K58A 2ID0A 3JAML 2B2VA 4EQPA 5JVH3 4CHTB 4C56C 1WD1A 4IQZA 4K14A 1LLRD 1Y8NB 5EQ0A 1SJHD 4KKTA 1Q8IA 3DMUA 3VR4A 3NHHA 3K5OA 4RCOA 1XYIA 1WTVA 3ITPA 2QKIC 2MPMA 3J7AF 2SNMA 2EE1A 2EY2A 2EDGA 5NUCA 1HTLD 2O2LD 2B63B 2BOSA 4O42A 4Y7NB 4ZKCB 2WP8J 2TSSA 4OIJA 2IX0A 4N9PA 5C6AA 3SE0A 4M1UB 1II3A 2YU9B 1OXTA 2MJ8A 3F2UA 5EJWA 3OWFA 2NVTB 1PZID 2F0TA 1BUVT 1RCVD 2AWOA 1FYCA 4C3IG 4X3SA 1KAAA 2KUMA 2RDHA 2LY7A 2IX3A 3TN2A 4E6IA 4C1NK 5C0XG 1IKLA 3A56A 4L63B 1EY6A 1GXDC 1STGA 3GO5A 3KUPA 4RGMA 3OIQA 3M4OB 1SBBB 1PTOF 1O7ZA 2E75C 1J9OA 4C3JB 4IURA 1T5EA 1EIGA 3BDOA 3G7LA 4QIWB 2K28A 1HTPA 1CT1D 4WFN3 1Y8OB 1HA5A 2GA4B 4OL7A 2IWHA 1TIID 3OOCA 1PRTF 1B4OA 3KLSA 1EEID 4LK1C 5C44B 4A3IB 1EWHA 2OXPA 1A3VA 3I3CA 1RTNA 5A35A 1H9MA 2QF7A 1C4QA 2X6GA 1SYGA 1STEA 3SR1A 1GHKA 3DHQA 3MFGA 1HA6A 2LFNA 1I4RA 2F0HA 4KY7A 4CKEA 1MBYA 4RKBA 3NK9A 1RJTA 4RCNA 4OIKA 4H44C 1LTSD 4CJ2C 1BXTA 1XXGA 4EGVA 3FDTA 3GTJB 3AU7A 4QB4A 1HFNA 1CFMA 5CYUA 2OT2A 4CGYB 2WAQB 5IGDA 2C5CA 2E2JB 5AFWA 1CQFA 4UDUC 1LTRD 2RSNA 1G291 1H9RA 1K8OA 2K33A 1TWCB 1Z6HA 1G8ZD 1SNPA 1JWSD 2K1BA 2N88A 1BCPB 3M85A 1ML0D 1WTPA 4QUFA 4PNYA 2L1BA 1ILPA 3MXNA 5CV5A 1SJED 2DY7A 4BWGB 2EYMA 3BS1A 2AUKA 5ELEA 1B2TA 1I3QB 1RDPD 2A6HC 3PIO3 2QEJC 3EA6A 3BDCA 1RD9D 4QMGA 4C3JG 1GOZA 1SE3A 1HUNA 1PLFA 1PTOB 4K5WA 1STHA 2DN8A 4FYDA 1NR2A 2XNAC 1CZWA 4IUUA 1TR5A 4KI0A 5CV8A 3EJIA 4OO1H 4KK7A 1BF4A 1AN8A 1GUTA 4HEDA 1VF7A 2WKCA 3VR6A 1BNZA 3GQBA 3TBIB 3ONAB 4XIGS 3D4DA 2CHBD 1O7YA 1LABA 4G57A 4XT3B 4UAIA 1I50B 1RKNA 4ID6A 1WVLA 1F2ZA 1A3UA 2JXMB 1STBA 3Q22A 1LO5D 2L4NA 2PNRC 1CA6A 1BR9A 4F87A 4J6HA 4RGOS 2WINB 2KJXA 3AB9A 3SEBA 1Z47A 3J80E 1CHPD 3Q6SA 5DNFA 3GD7A 3MA2B 5M3MB 5JAVA 2FMCA 5E4XA 1STNA 1YNJD 3KLRA 1ENFA 2A6HD 2CQAA 2B2WC 4ZUIA 3E5SA 2IPKD 3Q23A 2NBFA 4A3DB 2NTSA 1RHPA 3WDNA 5C4HA 1SNQA 2K7VA 4NW2A 1A3TA 4HSPA 5J1ZA 4A3JB 1JC7A 3IFTA 3D4RA 3BVMA 3S9WA 2EY5A 1V1PB 5LHY1 2B2WA 2KEDA 4PMWA 3X3MA 3I91A 5LL6S 2PO4A 5BN3A 2FFKB 1JB3A 2I46A 3NWTA 3VYRA 3QWNA 2KCNA 2NB0A 5C4XB 5IODA 2EXZA 2F1MA 3AMUA 3TZUA 3TP7A 5FLXE 3T51B 3V2TA 2A5HA 3I4MB 2RBMA 3PUYA 3EROA 1G6ZA 2IW3A 4RH6A 2F0JA 4BS9A 3OMGA 3HP3A 3URYA 1WD0A 1EY7A 1R4PB 4DGZA 1TS4A 1HHVA 3HGBA 4DU9A 1V8QA 4OO1G 1WTWA 1AZPA 4FNFA 1YNNC 4IN3A 1HQMC 2ZXOA 1S5BD 3CRKC 1LT6D 1D5MC 2D9UA 2LMCB 2PCFB 3U9SA 2EJMA 5C4JB 3O13A 3R2TA 1LTBD 5CV6A 1ZEQX 1KDAA 1E0BA 3QO2A 3I72A 2F0EA 3DWAA 2L5TA 2F0IA 1U9RA 2H4OA 2QDBA 2R6GA 3QG1A 5ELCA 3QJYA 5JPNC 2FHTA 4CJ0B 4KKUA 5C3WA 1Z7TA 5TSSA 1B9MA 1ESRA 3PMFA 2F0PA 1KDCA 4DFAA 4RWSC 3J7AV 2L55A 2AWNA 1PZJD 3J81L 4ULLA 1NR4A 3MAQA 3NTIA 2Z1CA 2FJ2A 4QCLA 4P2CB 3NP8A 1ZYRD 1EY4A 4MHEA 2A6EC 2NZ1D 4ZRZA 4X3UA 3OSOA 5DAUA 3FPUB 3NUCA 5KNBA 2NVXB 1FR3A 4R9WA 2PZTA 4ZUJA 2BA0A 4G4KA 1KABA 3A55A 5I4DA 3V05A 3BYYB 3J7YW 1E2VA 2F4IA 5C4ZA 2Z4HA 3R2IA 3ZYYX 2L12A 2K32A 5K36H 4KN7C 1LT3D 2KHSA 3D4WA 5E1FA 1D5ZC 2WV6D 5C0XI 2KQ3A 2XWJB 1PXUA 3BYTB 5I6WA 1I4PA 2SOBA 3L7ZC 2QILA 4A3GB 1CM9A 3M7GA 2J4XA 4K5VA 5CR3A 3L3OC 1D1KA 2Q8RE 4NMZA 2NVYB 3MXPA 3ERQA 1EY9A 3HS0C 1KDBA 5T1GA 1TWHB 3NTHA 3BG3A 3PUXA 3R3OA 3IKJA 2QCPX 3OIPA 2EYOA 5FLXL 3GTOB 5M5YB 1STAA 3I4LA 1EIHA 3A7AB 5ISRA 1IL8A 3WOFA 3S17B 3NTKA 1MSGA 5M5WB 1S5FD 1U4PA 4WJWA 1G2SA 4Q5VA 2AQ3B 4PMCA 1Q1BA 2JA6B 3TDQA 2BE5D 2ZT9C 4B9WA 1B50A 1SE4A 2A73B 2VXWA 4K8IA 3QOJA 1WTQA 2EYHA 4F88A 3H91A 5JJZA 5CORA 4X3TA 4WRDA 3SHLA 3MHBA 4DAVA 1LT5D 3I8ZA 2MP1A 4LMQD 5EKIA 2BCOA 1LT4D 1EZ6A 1Y69U 3I73A 5EPLA 1W6JA 4FXDA 1A2UA 1S5CD 3I70A 1EFID 1QG7A 4J8QA 2BE5C 3VYSA 3ND9A 1DJRD 2CW0C 3HRZC 1A2TA 2KVMA 1Y8PB 3PO3B 1CK1A 4B9XA 3LWEA 1TY2A 3IL8A 4XYQA 1ESFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MPM A;  1S4Z A;  1DZ1 A;  1MSH A;  1WTX A;  1HUN A;  1G91 A;  2B2W A;  3UI2 A;  1PLF A;  2X6G A;  1NR4 A;  2KED A;  4IUP A;  2FJ2 A;  1B3A A;  2SDF A;  3I91 A;  1EIH A;  5CBA E;  2EE1 A;  4R8I A;  2CVR A;  1MGS A;  1NR2 A;  2FFK B;  4RAU C;  1HA6 A;  1IL8 A;  3I90 A;  1U4L A;  4IUU A;  4U68 A;  2EOT A;  5EPK A;  2K03 A;  1GUW A;  1MSG A;  4O42 A;  1U4P A;  4ZKC B;  2X69 A;  2X6L A;  2EPB A;  1G2S A;  2XIW A;  4MHE A;  1JIC A;  4OIJ A;  1BF4 A;  2NZ1 D;  3DM1 A;  1PFN A;  4X3U A;  1ICW A;  2BDN A;  3FPU B;  4HED A;  2J7Z A;  1BNZ A;  3GV3 A;  1RJT A;  4ZKB B;  2RA4 A;  1Q3L A;  2RVL A;  2HUG A;  1PFM A;  4OIK A;  4R9W A;  2MJ8 A;  3ONA B;  1SSO A;  3F2U A;  4X3K A;  5EJW A;  4CJ2 C;  2HDM A;  1SDF A;  1HRJ A;  2KEE A;  3FDT A;  1G6Z A;  1DOK A;  3GV6 A;  1SAP A;  1B50 A;  5D14 A;  1O7Y A;  3HP3 A;  1F2L A;  2VXW A;  4XT3 B;  1DON A;  2B2Y C;  2JP1 A;  4HCS A;  1LV9 A;  4RA8 A;  1VMP A;  4UAI A;  5COY A;  1WD0 A;  1HFN A;  5E4W C;  4X3S A;  4XT1 B;  1WTQ A;  1X3Q A;  2NYZ D;  1WVL A;  1PDQ A;  4XDX A;  1HHV A;  2HCC A;  2KUM A;  3H91 A;  5AFW A;  2L12 A;  4IUT A;  5COR A;  5JJZ A;  4X3T A;  1AZQ A;  1G2T A;  3TN2 A;  1AP0 A;  1F9Q A;  2R3Z A;  2RSN A;  1ILQ A;  1QE6 A;  1B53 A;  1O80 A;  2N55 A;  1EOT A;  1IKL A;  1DOL A;  1WTW A;  1AZP A;  2M2L A;  2L4N A;  1CA6 A;  1PFB A;  5CBE E;  5T1I A;  2B2T A;  2B2Y A;  3I8Z A;  1HUM A;  1U4R A;  4MN3 A;  5D65 A;  1BO0 A;  2MP1 A;  2H1E A;  3KUP A;  4HAE A;  4LMQ D;  3TZD A;  2D9U A;  1F9S A;  2K01 A;  5EKI A;  2KEC A;  1QNK A;  1MI2 A;  2B2V C;  2JYO A;  1VMC A;  2MGS A;  4ZAI A;  2K1B A;  1EQT A;  2DY8 A;  1IKM A;  5EPL A;  1J8I A;  2IL8 A;  2N88 A;  1XX8 A;  3Q6S A;  1ZXT A;  4ZK9 B;  1O7Z A;  1ROD A;  3KBX A;  5DNF A;  1X3P A;  1E0B A;  4DN4 M;  2NWG A;  1J9O A;  1ML0 D;  1X32 A;  3R93 A;  1HFG A;  3QO2 A;  5E4X A;  1M8A A;  2RSO A;  2B2T C;  1A15 A;  2B2U A;  1CM9 A;  3MTS A;  2K05 A;  4IUR A;  5EPJ A;  1EIG A;  2FIN B;  2L9H A;  3IFD A;  4ZLT F;  1WTP A;  1WTR A;  3G7L A;  1QG7 A;  1C8C A;  1DOM A;  3DEP A;  1F9R A;  3MWY W;  4QUF A;  2K28 A;  1BBX C;  4IUV A;  2KOL A;  1F9P A;  2B2V A;  4HSV A;  4CJ1 B;  2B2W C;  2L1B A;  1ILP A;  2K04 A;  2KVM A;  2Q8R E;  1RTO A;  1NAP A;  2DY7 A;  1WTO A;  1WD1 A;  1U4M A;  1JE4 A;  1CA5 A;  3DEO A;  1B4O A;  2FHT A;  5CMD A;  4CJ0 B;  1RHP A;  1KNE A;  2HCI A;  5EQ0 A;  1B2T A;  3N52 A;  5T1G A;  1TVX A;  3LWE A;  4NW2 A;  3I3C A;  1RTN A;  3P7J A;  3IL8 A;  4IUQ A;  1KNA A;  1EL0 A;  2B2U C;  1ESR A;  4QUC A;  2HDL A;  3D6W A;  2L11 A;  4RWS C;  1WTV A;  2FMM A;  1XYI A;  3SVM A;  2Q8T A;  1NCV A; 
#chains in the Genus database with same CATH topology
 4RKL A;  2K5Q A;  5FLX c;  4DNI A;  3J80 L;  2QA4 A;  1KC8 C;  2Z6K C;  2H5X A;  3FMC A;  5IGC A;  4N8F A;  2SDF A;  5CV7 A;  2DGY A;  4N9T A;  4LF9 L;  2WKD A;  4CDC C;  1NNX A;  4LAA A;  2R93 H;  4FF3 A;  2P5Z X;  2OCE A;  5FJ8 G;  4KJN A;  5I6Y A;  4HN7 A;  1BKB A;  4R4Q A;  1IBL Q;  4FF4 A;  3BU2 A;  3CPF A;  3LX0 A;  2SNS A;  2VB3 X;  3TQY A;  1L0X B;  1FNW A;  2B3G A;  4DAY B;  2A69 D;  4JK1 C;  3F1Z A;  3FKI G;  3WWV A;  1I4X A;  5CV4 A;  3S1M H;  3PSI A;  1SMX A;  3TRZ A;  4C3H G;  4NXM L;  1XMQ Q;  2UUA L;  3OW7 A;  2JP1 A;  4KMU C;  2JA7 G;  1LV9 A;  2D0P A;  1VMP A;  4O2D A;  3K0X A;  2AQ2 B;  3OMC A;  3NEN A;  3RLF A;  3M3Y B;  3S15 B;  1SNM A;  1PDQ A;  2RDG A;  3MC0 B;  1IBK Q;  3S16 H;  2Z9H A;  5E7N A;  4X64 Q;  4U67 3;  1Y1V G;  2N55 A;  2JA5 H;  1DOL A;  2ZXR A;  4K6D A;  2WB1 B;  1K8M A;  3TME A;  1NMF A;  4BY1 B;  2B2Y A;  1VQM A;  1TKW B;  1YZ6 A;  3CC4 A;  4B08 A;  4RGT A;  4IJL A;  2JYO A;  1VMC A;  1EIY B;  3GTG H;  5GAH C;  2KHJ A;  4YWM A;  1EY8 A;  1SXT A;  5M3M H;  1XJV A;  1HNW L;  3S2H H;  5I2Y A;  3GTG B;  1K83 B;  3S1N H;  4LFC L;  3R93 A;  2ICI A;  1M8A A;  1D5X C;  1WFQ A;  2JE6 I;  4DA2 A;  1A0I A;  3A7L A;  3PV0 A;  1KQS A;  3MWY W;  5IP7 G;  4DK3 C;  2O5I C;  3DWP A;  1HJP A;  4ZQ3 A;  5A2Q L;  2E2D C;  2ZXP A;  1W2B A;  2R7Z H;  1PYB A;  3S1R B;  3I55 A;  1HZA A;  1FGU A;  1KNE A;  3BZC A;  3N52 A;  5HY6 A;  4JC0 A;  1Y1W H;  1Q7Y C;  3CCJ A;  3VR3 A;  2E8G A;  2R7F A;  5ELD A;  1EL0 A;  3SK5 A;  3N6R A;  2HDL A;  2L11 A;  2PI2 E;  3RNU A;  1MHW C;  3CAM A;  3K59 A;  4PG3 A;  1QNU A;  4FVM A;  4HCE A;  1UAP A;  1N33 L;  5J3B A;  4KJO A;  4KY6 A;  1HR0 W;  2IHE A;  1FGB D;  3NSW A;  3TP8 A;  1QUQ B;  3C3L A;  2Z4I A;  1AEX A;  4R4C A;  3HFZ B;  4L5S A;  3I90 A;  2F3W A;  4GN4 B;  2K03 A;  4K0K Q;  3CCE A;  1GJX A;  1YBY A;  3J81 E;  2D0O A;  4LF7 Q;  3KF8 A;  3W2D A;  1EYC A;  3G6J B;  3RZD H;  4A3L H;  3FRP B;  1A6X A;  1VQB A;  1Q82 C;  1AE2 A;  1Q3L A;  2RA4 A;  4OEM B;  1XPO A;  3J7A 5;  5KEE A;  4JVZ A;  1JJG A;  2Y0S E;  2HHH L;  3T1H Q;  2A1A A;  4R4I A;  3J80 c;  3T4A C;  1SN8 A;  1DCZ A;  5JVG 3;  5I9O A;  3S16 B;  2QDL A;  5EAY A;  4AQY L;  1G2T A;  4K2L A;  2EY1 A;  4A3M B;  2NN6 I;  2Z0S A;  1B53 A;  5IYC G;  2ZTD A;  2UXB Q;  1S72 A;  3K6O A;  3D8G A;  1ASZ A;  3RMH A;  3HKS A;  3CU7 A;  4AYB E;  1YNN D;  4UP8 A;  5C3E B;  1A62 A;  1PYW D;  1PVO A;  2H1E A;  5M3F B;  5DM6 3;  1LTL A;  5FO9 B;  1CTM A;  5C5L A;  3W1B A;  2DY8 A;  3QB3 A;  5IGE A;  1BBU A;  1WCM H;  1XPU A;  1J8I A;  2IL8 A;  4LF9 Q;  1EU4 A;  4WJ3 M;  5M5X B;  1VQE A;  2F0D A;  1I5F A;  4LWC A;  1HFG A;  1TY0 A;  4A3E B;  1CUK A;  3CP0 A;  2RSO A;  4OHJ A;  2PPB C;  3H3V C;  3UDG A;  3GTM H;  2I5M X;  4DV4 L;  4FXK C;  1VCI A;  2M9V A;  3DEP A;  1F9R A;  4QQB X;  1OXU A;  3K8A A;  5JEA J;  5AJ3 L;  2EYF A;  3RD4 A;  1G51 A;  3GTK H;  5EKK A;  4KHZ A;  2F0K A;  4JCV E;  5C3X A;  1PTO D;  1S5E D;  1JOR A;  5IY0 A;  1QB5 D;  5BN5 A;  3HOY G;  2Z8L A;  5G3L F;  3PO3 G;  1LTT D;  3OPO A;  3I4M G;  4S3S A;  4XQJ A;  2EVB A;  1YNJ C;  4K6L A;  1IW7 C;  5ELN A;  2XWB B;  2F03 A;  4KTA A;  4MZ9 A;  1YHA A;  4HR7 B;  5M5X H;  3T1Y L;  2BA1 A;  2VNU D;  1SE8 A;  1TWA B;  1B44 D;  3A5U A;  4GNX A;  4BY7 H;  1Q12 A;  1BCP D;  1HZ9 A;  4M8A A;  2R92 B;  2CVR A;  2DJF C;  2JA6 H;  4DF7 A;  4U68 A;  5IYB H;  2EOT A;  4K8J A;  4HJ7 A;  3GTL B;  2C9O A;  4DV5 L;  2KCC A;  1CSP A;  1TS3 A;  1OXX K;  1NUC A;  2QGQ A;  2XIW A;  4NDX A;  4FDB A;  4B3M L;  5I9P A;  4IFD H;  4B3S L;  3PO2 B;  2J7Z A;  4JI2 L;  2F0W A;  4UP7 A;  4GNX C;  4O0A A;  1I94 L;  1MD2 D;  2JA8 B;  4R8N A;  1EEF D;  3K5N A;  1SSO A;  2AUJ D;  1WCM B;  3H09 A;  2MO1 A;  1B9N A;  4I7A A;  1IBK L;  1PTO C;  1F2L A;  3MEH A;  3HZX A;  4LF5 Q;  4HCS A;  5E4W C;  4FO2 A;  3I4N G;  4A3M H;  2XTI A;  1JOQ A;  3CME A;  3H0G H;  1UE7 A;  1FNU A;  2F0L A;  4YWL A;  2K5D A;  2R3Z A;  4NXN L;  2XN9 C;  4NP5 A;  3Q0A A;  4A4I A;  3KDF A;  3P75 A;  4P74 A;  3NBH A;  1PFB A;  4QIW E;  1WTH A;  3RN5 A;  3C2P A;  4JV5 Q;  2K5W A;  2IX1 A;  3I4N B;  4DR6 L;  4H13 C;  2K01 A;  2KEC A;  3I4N H;  1SFO H;  4QF4 A;  1UE6 A;  2OF1 A;  2OEO A;  2PW5 A;  5BR8 Q;  4CDD C;  5GAD C;  1ZXT A;  1ROD A;  2HT1 A;  3SXH A;  1H9S B;  1PFS A;  3M4P A;  5ELF A;  4OEL B;  2VB2 X;  5M9O A;  1D8L A;  4DAY A;  3CF5 A;  3HOW G;  3GTL H;  1Y1V B;  1BBX C;  5DEH A;  5JEA G;  3OTO Q;  2SEB D;  1UNS A;  4JI8 Q;  1NAP A;  3NQI A;  4X62 L;  1GUO A;  3FEW X;  3PO2 H;  1CKN A;  5A2Q E;  2NVT H;  3RZO H;  3H94 A;  3H3V I;  1TVX A;  4BA1 I;  2JA8 H;  2K75 A;  5DM7 3;  2ZJQ A;  1SYB A;  3D6W A;  1IYU A;  5J39 A;  1HUM A;  1ONL A;  4I7Z C;  1VDZ A;  1PH6 A;  4POG A;  3E6Z X;  2XRS D;  4OX9 Q;  4A3M G;  3HOZ B;  4A3G G;  4PQX A;  1GHJ A;  1MGS A;  4DNR B;  1CZG A;  4GOP B;  4J15 A;  4MTK A;  1EY5 A;  1K8A C;  1Q81 C;  4A3K B;  1XWE A;  1PH3 A;  4G7Z C;  3QIA A;  4CBV A;  1ICW A;  3G71 A;  2UUA Q;  1ZKO A;  4KD4 A;  1T5X D;  1HNZ L;  1PMR A;  1RF2 D;  2ENB A;  4IFD G;  1VQ5 A;  4JI0 L;  3K7A B;  5CGK A;  2CWA A;  3SK8 A;  2HDM A;  1E24 A;  1KTK A;  1CKM A;  1SDF A;  1X56 A;  2RHS B;  3Q8D A;  5CV9 A;  1JWU D;  4CDE C;  3CCV A;  2PNH A;  2DJG C;  2O4X A;  1ASY A;  1VQ8 A;  1X65 A;  1X3G A;  4G7O C;  1BCP F;  2DUD A;  5EKL A;  3NEL A;  5FLM G;  3CC7 A;  2G9D A;  4EQN A;  4GLV B;  2F3I A;  5AJ3 Q;  1V1P A;  2NVY H;  1SND A;  3WOE A;  1TS5 A;  4BBR B;  4OX9 L;  1D1I A;  1QVF A;  2F0O A;  1CI3 M;  3RN2 A;  3KF8 B;  5D65 A;  1BO0 A;  4PV1 C;  3IAY A;  4GKK L;  3HOU H;  4DK0 A;  1OXS C;  5C4X G;  4DUY Q;  4LF5 L;  2ZTC A;  1CKO A;  2WAQ E;  4HJ9 A;  4A3B B;  3F2B A;  4Y52 H;  1HZB A;  4XQN A;  2Q8I B;  4DN4 M;  1LAC A;  2E2J H;  1EQV A;  2E2H B;  2NZO A;  1QZH A;  2B2U A;  3M7N A;  4Z9C B;  5FKA C;  5LMU Q;  3T16 A;  2GVA A;  3NWS A;  1DOM A;  3NBI A;  1V1Q A;  2BDO A;  4NKL A;  4HSV A;  5FOB B;  3OWE B;  4AQY Q;  2XVS A;  5JEA H;  2F0Q A;  5C0X H;  4FP5 D;  5C3E G;  1AFP A;  5CMD A;  3BVG A;  1FNV A;  1GUS A;  2B8G A;  2CH4 W;  4IUQ A;  3HOV H;  5KYL A;  2B2U C;  3RLO A;  2A69 C;  4KY5 A;  3PUW A;  4R1J A;  2VUM B;  1KRT A;  4R8I A;  1TWF B;  5C4J H;  4Q0F A;  3M4Q A;  3NXW A;  1DD2 A;  5BN4 A;  4J1M A;  4K0K L;  1E2Z A;  2UXC Q;  4HMJ A;  3GTP B;  3DLL A;  3HOW H;  2RQX A;  1STY A;  1PFN A;  2YYZ A;  5HUR A;  1I6V C;  1OXV A;  4X64 L;  3BDL A;  3A8I E;  2ATW A;  1XPR A;  4X3K A;  5F2D A;  2OQ0 A;  1S40 A;  5G3L D;  1O7L A;  1DOK A;  3GV6 A;  4HIK A;  4DV3 L;  4A3E G;  4GKK Q;  3S1Q B;  2Q2H A;  1HCZ A;  1DON A;  2LKV A;  3CHB D;  2B2Y C;  4OWW B;  4IFD J;  2JSO A;  1X3Q A;  2NYZ D;  1EZ8 A;  4DV6 L;  3BZD B;  4GNX B;  3VR2 A;  4A3I H;  3C1F A;  4IUT A;  4JI1 Q;  3FKI H;  1N33 Q;  2GN5 A;  3E3X A;  3E0J A;  1O80 A;  4HID A;  4HJA A;  3K81 C;  1GUG A;  1PH1 A;  3S1R H;  3GTJ H;  3NE5 B;  1IBL L;  2F0G A;  1ZYR C;  1U4R A;  1XMQ L;  1JJ2 A;  5HGQ A;  2R7Z G;  1BQQ T;  1LYL A;  1LTI D;  2RCF A;  3OHX C;  3TP5 A;  1F77 A;  2EYJ A;  2F0U A;  2DNC A;  2MGS A;  2L0C A;  1Q90 A;  1EQR A;  3GP7 A;  4DV1 L;  2BH2 A;  1BDO A;  5K5P A;  3UE0 A;  1X3P A;  1JMC A;  2IT1 A;  1F2M A;  1QVC A;  4BBS B;  4GKJ L;  4RGN A;  1VQK A;  4YCU A;  3HKZ G;  5K36 G;  3VA5 A;  3D3R A;  4K2K A;  1SNC A;  1YIT A;  1EOV A;  3HEJ A;  2A19 A;  3HOY H;  3CW2 C;  4DXF A;  1EU3 A;  1U4M A;  2RF4 A;  3DEO A;  1YNX A;  3EVQ A;  4N8X 1;  3DWQ A;  3U9O A;  2PZW A;  2UXD L;  1KNA A;  3SDZ A;  2VUM G;  1NMG A;  3S2H B;  4JI4 Q;  2Q8T A;  1NCV A;  1S4Z A;  2N8N A;  1S5D D;  1MSH A;  1G91 A;  3UI2 A;  1KRS A;  4NB3 A;  3DXJ C;  3M4Y A;  3VDY A;  4A3J G;  4C3H B;  1JQY D;  2AQ1 B;  4V0B A;  3PIP 3;  3A54 A;  1CKN B;  1U4L A;  1C7Y A;  2F4V Q;  4YHH Q;  2F0F A;  1KL9 A;  3TSS A;  1EUJ A;  1EY0 A;  2EPB A;  3C1E A;  1PH4 A;  4DR4 Q;  1L2F A;  2JN4 A;  2J0T D;  1K3B C;  4Y7N H;  2WAC A;  3GV3 A;  1AE3 A;  4LFB Q;  2AHO B;  1PFM A;  2HUG A;  2PW7 A;  2JA9 A;  3ULJ A;  1JE5 A;  1J5E Q;  1JWM D;  4BBS G;  1EWI A;  1SYD A;  3P20 A;  5D14 A;  3HKZ B;  4YIJ A;  1R9T B;  4DNT B;  4UY8 C;  3HOX B;  4X66 Q;  2JA5 B;  1AZQ A;  1AP0 A;  2MNA A;  1Y1W B;  3EQL C;  1ILQ A;  3RZD B;  5EGT A;  2WFW A;  5M3F H;  1MKH A;  3TP6 A;  2QW7 A;  1KAW A;  1LUZ A;  1JOO A;  1UEB A;  4XTC S;  4IPD A;  4UP9 A;  5EBC A;  3AFQ A;  1YVC A;  3CMA A;  1HR0 L;  2NVX H;  3CCS A;  1HZC A;  4JI3 L;  4ZK9 B;  1QOH A;  1K9M C;  3U4Z A;  1PH9 A;  2KCM A;  4LF6 Q;  4GZY C;  3NQT A;  4C3I H;  3MTS A;  2EYL A;  5FO7 B;  3IFD A;  3HOX H;  2V4D A;  3J81 c;  1VQH A;  4LUZ A;  3GTK B;  4IUV A;  4JI7 L;  3RUZ A;  3BJU A;  1SYF A;  1ENC A;  1F9P A;  4CJ1 B;  4DR1 Q;  4RHR A;  4IZ8 A;  1N36 L;  5J22 A;  4GOP C;  4KV6 A;  5IP7 H;  3S1M B;  1JE4 A;  1L0Y B;  3MFY A;  1LTA D;  4ILW A;  2HCI A;  2M00 A;  1N9W A;  4HIM A;  4KN4 C;  2ZM6 Q;  1MJE A;  3KFU A;  1I6H B;  4QUC A;  5ELB A;  2A8V A;  1QJO A;  5M5W H;  2NVQ B;  2JJQ A;  2PMZ B;  4IO9 A;  1OO9 B;  5LMN Q;  1IYJ B;  2WAQ G;  2E5L Q;  2A6E D;  1SNO A;  1VQ7 A;  1B3A A;  2B29 A;  5LL6 X;  3L9A X;  5IT9 L;  3SK4 A;  1X3E A;  1V43 A;  3W5O A;  3J81 j;  4DV4 Q;  2B8F A;  2X69 A;  3TS0 A;  1SMY D;  1V1O A;  4LF4 L;  4NXM Q;  1PH5 A;  4KHP Q;  4DV2 L;  3QOL A;  2E5L L;  3L2P A;  2KA7 A;  4C2M H;  2KHI A;  2ICE C;  4BA2 I;  2K14 A;  4C2M B;  2UU9 L;  5JJI A;  5KGU A;  1SAP A;  4BY7 B;  3VYU A;  1NE3 A;  2UUC Q;  2VS1 A;  3BZK A;  2RHQ B;  5COY A;  1VQJ A;  4C3I B;  4DUZ Q;  3D31 A;  3KF6 B;  4XT1 B;  1VQG A;  3KJO A;  3T53 B;  3AEV A;  3CCQ A;  4OWT B;  4A3J H;  2AKW B;  1EQQ A;  2PQE A;  2M2L A;  3LWU A;  3KLS X;  1H9J A;  2OWO A;  5CBE E;  1EFW A;  3RZO B;  1TS2 A;  4DPG A;  3MXG A;  3ER0 A;  3FVQ A;  4HAE A;  1B7Y B;  1N32 Q;  2DNE A;  3CPW A;  4XXE A;  2OQK A;  4DXG A;  1BCP C;  2B39 A;  1HPC A;  1NY4 A;  1I4H A;  3V96 A;  1L1O C;  4ABN A;  3E9H A;  4A3C H;  3CQZ B;  1QWY A;  1QCB D;  3KBX A;  4DR3 L;  2VQF L;  1N8R C;  5IP9 G;  2JA8 G;  4OO1 I;  3HOV B;  1IW7 D;  2D62 A;  3T56 B;  2CW0 D;  3AQQ A;  1H9K A;  2L9H A;  4RHS A;  3DUZ A;  4YCW A;  5KND A;  4DV1 Q;  2K04 A;  5CC4 A;  5IYD H;  1UE5 A;  2CFM A;  1KD1 C;  4L5T A;  1W3S A;  4KD3 A;  4H7B A;  4A93 H;  5IGB A;  2VZA A;  2JEA I;  4A3L G;  4B3T L;  1UWV A;  1J5E L;  3K5M A;  1WOC A;  1PRT D;  3CRL C;  3GTQ B;  2FMM A;  3SVM A;  4GLA C;  1DZ1 A;  2G9H D;  1WJJ A;  4MTN A;  1F2Y A;  4A3B G;  1R4Q B;  4IAL A;  4O1N A;  1SEB D;  2MQH A;  1PV4 A;  5CBA E;  3A8J E;  4KHV A;  3MXU A;  4TSS A;  2EJG C;  4RAU C;  3HKZ E;  5KIX A;  4POF A;  1GUW A;  2JA7 B;  4YHH L;  4DK1 A;  4IUN A;  1DYQ A;  4DV7 Q;  1RIP A;  3DM1 A;  1PRT B;  4JOI A;  4HTH A;  4A93 B;  5KNC A;  1I3Q H;  1D6E C;  2RVL A;  5D3D A;  1SFO B;  1LM0 A;  4FF1 A;  1HNX Q;  2IJ0 A;  3PUV A;  5IGG A;  1C48 A;  1YJN A;  2RDF A;  2E2I B;  2MHV A;  1YJ9 A;  1PTO H;  2I0Q A;  2HIV A;  2O5J C;  1KLU D;  4JOI C;  3K7U C;  3CKI B;  4XDX A;  2VL6 A;  2YU9 H;  3G48 A;  5IOC A;  4ODG A;  4A3K H;  1F9Q A;  4RFB A;  4IPG A;  4A3F B;  5IYD G;  4HIO A;  3FP9 A;  1K83 H;  3S1N B;  2EY6 A;  3OW2 A;  1LTG D;  1NJI C;  1TXY A;  4ME5 A;  2EZV A;  2EJF C;  4HJ8 A;  4MN3 A;  1QUQ A;  3TZD A;  2K6A A;  1F9S A;  4L5Q A;  4EQO A;  1QNK A;  1GVP A;  3S2D H;  1EWC A;  2EIF A;  3A8K E;  5C0X J;  4FXG C;  3CCU A;  1EQT A;  1EYD A;  3HOV G;  4JI0 Q;  3X3N A;  3D6C A;  3GDE A;  1B70 B;  4A3C G;  4AIM A;  1TT2 A;  1IYV A;  1X32 A;  3VA7 A;  4PZ7 A;  1EYA A;  2K50 A;  1A15 A;  1I50 H;  3JAM E;  5HGT A;  1C8C A;  2JA7 H;  1TWG B;  3K5L A;  4AYB B;  2K5H A;  4TKO B;  4IJH A;  1K8G A;  1XNR L;  4TRD A;  2KCT A;  1RTO A;  1WTO A;  1VQ4 A;  3K0Y A;  5GQO A;  1ET6 A;  1CQV A;  5IT9 E;  2F0V A;  4BY7 G;  3C46 A;  2EYP A;  3K80 C;  1UUP A;  3P7J A;  2HQE A;  2ZJP A;  3K7A H;  1FD7 D;  4V19 0;  5IYB G;  1ENA A;  1GUN A;  1QVG A;  3P1H A;  5FO8 B;  3ND8 A;  1WTX A;  2CCZ A;  4F8M A;  4IUP A;  1HXY D;  2D2C C;  1W6K A;  3TEH B;  2RKS A;  1VF5 C;  3FKI B;  1Z9F A;  4UHV A;  3S24 A;  2KBN A;  1IHZ A;  1VQ6 A;  4JBW A;  2JEB I;  3U50 C;  2NN6 H;  4L6T B;  1XMO Q;  4R4T A;  1O78 A;  2VW9 A;  1P8L A;  2OTL A;  2XSC A;  2BDN A;  4LFA Q;  1HNZ Q;  5JJK A;  3HOU B;  4CKC A;  1NSN S;  1UEA B;  5IIF A;  3S2D B;  2WB1 E;  1TU2 B;  1JOK A;  2R7Z B;  1WCM G;  4I65 A;  5JOB A;  2F0N A;  2N49 A;  5IGF A;  1A8V A;  2R93 B;  4JW0 A;  3T13 A;  1K3R A;  3EIV A;  3H6M A;  4RA8 A;  2UUC L;  1FJG Q;  1AW7 A;  3AFP A;  3VR5 A;  4ZYS A;  1DM0 B;  2MUY A;  2PZU A;  2HCC A;  1Q1E A;  3HOW B;  3IRB A;  1QE6 A;  1X54 A;  3R8B A;  5IWA Q;  4DV2 Q;  1EOT A;  1SMY C;  1GKH A;  5EBD A;  4F7X A;  5KRU A;  5C5M A;  1Q86 C;  2B2T A;  2NUC A;  3LNN A;  4DR2 L;  4TQU S;  4WOR A;  3MZ5 A;  4DR3 Q;  2F0S A;  4P73 A;  4RMF A;  3STB D;  1KLG D;  3M9B A;  4HMI A;  4K5X A;  1MI2 A;  5KYI A;  1N34 Q;  2I07 B;  2XGT A;  4JBK A;  2F0M A;  1XX8 A;  2IY5 B;  4AYB G;  3M3Y H;  2NWG A;  4IOC A;  1XNQ L;  4XYO A;  3H3V H;  2B2T C;  2R61 A;  3W3A A;  2K05 A;  4DV5 Q;  1WTR A;  1E2W A;  3VYT A;  5H1S E;  3S14 B;  3HOX G;  4YY3 Q;  3HOY B;  2KOL A;  3KK7 A;  2UUB L;  3FPP A;  1ET9 A;  1PZK D;  4FF2 A;  3NPP A;  2WII B;  1JCK B;  1CA5 A;  2EQS A;  3MVV A;  1TQO A;  5E3F A;  2ZJR A;  4KKS A;  2N3S A;  3KF6 A;  1H9S A;  4CKB A;  4DV6 Q;  5FK9 C;  2UU9 Q;  5JPM C;  1B1Z A;  5IE8 A;  3BVZ A;  4DAP A;  1SE2 A;  2NTT A;  3F2D A;  1HQR D;  4JI5 Q;  3NBH B;  3Q24 A;  2I5L X;  4LJZ C;  4PMB A;  1CHQ D;  1SR3 A;  5EPK A;  2E74 C;  3UDF A;  2JA6 G;  2E76 C;  2A74 C;  2JA5 G;  4JYA Q;  2LS0 1;  4C1N I;  1E1T A;  2X6L A;  4DV7 L;  1JIC A;  3GTM B;  1I4Q A;  2A68 D;  2AMC B;  4OGQ C;  4A3B H;  1N32 L;  3HG9 A;  1YI2 A;  1M4V A;  4ZKB B;  1JR0 D;  3H0G B;  2F3V A;  5D3I B;  1SYC A;  5C3E H;  3K57 A;  3S1Q H;  3F2C A;  1HRJ A;  2KEE A;  3I4M H;  2ES2 A;  4G7H C;  4EVO A;  3KBG A;  2XRQ D;  2A68 C;  1XTC D;  1J6Q A;  4JI5 L;  4IFD I;  1N36 Q;  1D2B A;  4DAM A;  4L8J A;  5I2X A;  2TMP A;  4JPB W;  1QIL A;  3EFX D;  4H0L C;  3F8T A;  1XMO L;  5T1I A;  4DR4 L;  4XQQ A;  1MIU A;  2Y0S B;  2NN6 G;  2HHH Q;  1JT8 A;  3W1G A;  3SK6 A;  1SYE A;  2VUM H;  3MXN B;  1PRT C;  3JC6 6;  2B2V C;  2D5D A;  4ZAI A;  1IKM A;  1I4G A;  4GOP A;  3SGI A;  2VY3 A;  3PUZ A;  1BOS A;  1B3Q A;  2CKZ B;  4LUO A;  1VQA A;  4MIU A;  1DXM A;  2PYK A;  5EPJ A;  4ZLT F;  1BBW A;  2FIN B;  3K58 A;  4YWK A;  4B3R Q;  1VS0 A;  2ID0 A;  3JAM L;  2B2V A;  2UXD Q;  4EQP A;  5JVH 3;  4CHT B;  4C56 C;  2ZM6 L;  1WD1 A;  4IQZ A;  1C9O A;  4K14 A;  1LLR D;  2R93 G;  1Y8N B;  5EQ0 A;  1SJH D;  4KKT A;  1Q8I A;  3DMU A;  4RG1 A;  3VR4 A;  3NHH A;  3K5O A;  4RCO A;  1UE1 A;  1XYI A;  1WTV A;  4QY7 A;  3ITP A;  3STB C;  2QKI C;  2MPM A;  3M4O H;  3J7A F;  4JI6 L;  1I94 Q;  2SNM A;  2B63 H;  2EE1 A;  2EY2 A;  2EDG A;  1YJW A;  5NUC A;  1HTL D;  2O2L D;  2B63 B;  4A3G H;  3T1H L;  1SRO A;  2BOS A;  4P71 A;  4O42 A;  4Y7N B;  5BR8 L;  4ZKC B;  2WP8 J;  4NPS A;  2TSS A;  4OIJ A;  2IX0 A;  4N9P A;  3RLN A;  1D7Q A;  5C6A A;  3SE0 A;  1E3P A;  4M1U B;  4LFA L;  1V9P A;  1II3 A;  2YU9 B;  1U0L A;  1PH7 A;  1OXT A;  2L15 A;  2MJ8 A;  3F2U A;  5EJW A;  3OWF A;  2NVT B;  5GRO A;  1PZI D;  3GTO H;  4IPC A;  2F0T A;  1BUV T;  1RCV D;  1N34 L;  1IZ6 A;  2AWO A;  1FYC A;  4C3I G;  4X3S A;  2I5H A;  1S3O A;  1BVS A;  1G6P A;  1KHI A;  1KAA A;  2KUM A;  2RDH A;  2LY7 A;  2IX3 A;  1L1O A;  3TN2 A;  2ASB A;  4E6I A;  4C1N K;  5C0X G;  1IKL A;  3A56 A;  1SRU A;  4L63 B;  1EY6 A;  3A74 A;  1GXD C;  1E1O A;  1STG A;  3PIP A;  4DR1 L;  5GAE C;  3GO5 A;  3KUP A;  4RGM A;  2HQL A;  4JI2 Q;  3OIQ A;  3H0G G;  1E22 A;  3GTQ H;  1FJG L;  3G6E A;  2F52 A;  1O7I A;  3M4O B;  1SBB B;  1PTO F;  2FXQ A;  1WYD A;  4JI3 Q;  1O7Z A;  2E75 C;  2B63 G;  4A76 A;  1J9O A;  4C3J B;  1FVI A;  4QJF A;  3B6Y A;  1EYG A;  4IUR A;  4LFB L;  1T5E A;  1EIG A;  1YHB A;  3BDO A;  3G7L A;  3FHW A;  2JQO A;  4QIW B;  2K28 A;  1HTP A;  1CT1 D;  4WFN 3;  4JI1 L;  1Y8O B;  1HA5 A;  1K28 A;  2GA4 B;  2R7D A;  4LF6 L;  1GM5 A;  4OL7 A;  2IWH A;  4JI4 L;  1TII D;  3OOC A;  1PRT F;  1B4O A;  3KLS A;  4LK1 C;  1EEI D;  5M3M G;  5C44 B;  4A3I B;  1EWH A;  2OXP A;  1A3V A;  1U5K A;  3I3C A;  1RTN A;  2Y0S G;  4B3R L;  5A35 A;  3PO3 H;  1H9M A;  1L0W A;  4JG2 A;  2HIX A;  2QF7 A;  1C4Q A;  2X6G A;  1PH8 A;  1SYG A;  1STE A;  3JAM c;  3PF4 A;  2IHF A;  3SR1 A;  1VQC A;  1GHK A;  4YCV A;  3DHQ A;  3MFG A;  1HA6 A;  4DUY L;  2LFN A;  1I4R A;  4A3F H;  2F0H A;  1PYS B;  2E2H H;  4KY7 A;  4CKE A;  5L37 A;  1MBY A;  3PCO B;  4RKB A;  3TS2 A;  3NK9 A;  1RJT A;  4RCN A;  1H95 A;  4OIK A;  4H44 C;  4JI6 Q;  1LTS D;  4CJ2 C;  3E0E A;  1BXT A;  1XXG A;  4EGV A;  5IP9 H;  3FDT A;  2NZH A;  4DR6 Q;  3UDI A;  3GTJ B;  3AU7 A;  4QB4 A;  1HFN A;  1CFM A;  3KDF B;  5CYU A;  2OT2 A;  4CGY B;  2WAQ B;  3ZJY C;  5IGD A;  2C5C A;  2E2J B;  5AFW A;  5FJ8 H;  1CQF A;  4UDU C;  3PO2 G;  1LTR D;  3PIO A;  2CWP A;  2RSN A;  1VQ9 A;  1G29 1;  1H9R A;  1HH2 P;  1K8O A;  4LUV A;  1HNX L;  4WJ4 A;  4R4O A;  2K33 A;  1TWC B;  1Z6H A;  1G8Z D;  3CXC A;  1SNP A;  4BY1 H;  1JWS D;  1GO3 E;  2K1B A;  3TRE A;  2RCN A;  2N88 A;  1BCP B;  1Q46 A;  3M85 A;  2ALY B;  1ML0 D;  1X9N A;  4BXX H;  4DR7 L;  1WTP A;  3EN2 A;  4QUF A;  4PNY A;  4A3I G;  3PGZ A;  3I2Z A;  2MO0 A;  2L1B A;  1PH2 A;  1ILP A;  2CH4 A;  3MXN A;  1RL2 A;  1SJE D;  5CV5 A;  2DY7 A;  4BWG B;  4X62 Q;  2UXB L;  2EYM A;  3BS1 A;  2AUK A;  5ELE A;  1B2T A;  1I3Q B;  1RDP D;  4PZ8 A;  2A6H C;  3PIO 3;  4TVA B;  2QEJ C;  4ZCK A;  1Y1W G;  3EA6 A;  3BDC A;  1RD9 D;  4QMG A;  4C3J G;  1GOZ A;  4AH6 A;  1SE3 A;  1P16 A;  1HUN A;  1PLF A;  1PHJ A;  4H02 A;  1PTO B;  1AH9 A;  4LNQ A;  4K5W A;  1STH A;  2DN8 A;  4B3T Q;  4LF4 Q;  4FYD A;  1NR2 A;  2XNA C;  4BBR H;  1CZW A;  4IUU A;  1TR5 A;  4KI0 A;  5CV8 A;  3EJI A;  4OO1 H;  3S15 H;  4KK7 A;  1BF4 A;  1VQD A;  5M5Y H;  2Z6K A;  5M3F G;  1AN8 A;  4IPH A;  1GUT A;  4HED A;  5C4X H;  4GLX A;  1VF7 A;  2WKC A;  3VR6 A;  4APV A;  1BNZ A;  4KHP L;  4ME3 A;  3GQB A;  3TBI B;  3ONA B;  4QL5 A;  3L0O A;  4XIG S;  3D4D A;  2CHB D;  2K4K A;  4EQ5 A;  1O7Y A;  1LAB A;  1TWG H;  4G57 A;  1VQO A;  2HD3 A;  4XT3 B;  4LF8 Q;  4UAI A;  1VQP A;  1I50 B;  1RKN A;  4ID6 A;  3EBE A;  1SLJ A;  4DUZ L;  3J7Z C;  1WVL A;  1F2Z A;  1A3U A;  2JXM B;  1PA6 A;  2V1C C;  1STB A;  3PF5 A;  3H15 A;  4OXP A;  4C3H H;  2R92 H;  3Q22 A;  4A3D H;  1LO5 D;  2L4N A;  2PNR C;  1CA6 A;  3HOU G;  4BY1 G;  3CCL A;  1BR9 A;  4F87 A;  4J6H A;  4RGO S;  2WIN B;  2CQO A;  1OTC A;  2VQE Q;  2YTX A;  2KJX A;  4L5R C;  3AB9 A;  3SEB A;  4X6A H;  4A93 G;  1Z47 A;  1XTD A;  3J80 E;  4LW1 A;  1CHP D;  3Q6S A;  5DNF A;  1VQL A;  3GD7 A;  3MA2 B;  5M3M B;  5JAV A;  2FMC A;  5E4X A;  1IBM L;  1STN A;  1YNJ D;  3KLR A;  2C35 B;  4JBM A;  1ENF A;  4DK6 C;  2A6H D;  2CQA A;  2B2W C;  4ZUI A;  3E5S A;  3D0F A;  2OTJ A;  5FLM H;  1T9H A;  5IYC H;  2IPK D;  1EIF A;  3Q23 A;  2NBF A;  4A3D B;  2NTS A;  3OYY A;  1RHP A;  3WDN A;  5C4H A;  1SNQ A;  3A5Z B;  4X65 Q;  2K7V A;  4NW2 A;  1Y14 B;  1A3T A;  4HSP A;  5J1Z A;  4A3J B;  1JC7 A;  3IFT A;  1YIJ A;  3D4R A;  2K5V A;  3BVM A;  3S9W A;  2EY5 A;  1V1P B;  5LHY 1;  1L1O B;  2Q2I A;  2B2W A;  1VQF A;  2KED A;  4PMW A;  3X3M A;  3I91 A;  5LL6 S;  4B3S Q;  2PO4 A;  1FL0 A;  3G4S A;  1TWA H;  5BN3 A;  2FFK B;  4DV0 L;  1JB3 A;  2I46 A;  4QGU A;  3NWT A;  3VYR A;  3QWN A;  2KCN A;  2NB0 A;  2WB1 G;  5C4X B;  5IOD A;  2EXZ A;  1IXR A;  2F1M A;  3AMU A;  3KYH C;  3TZU A;  4LFC Q;  3AYH B;  1VQI A;  3TP7 A;  5FLX E;  3T51 B;  3V2T A;  2A5H A;  3I4M B;  2RBM A;  3PUY A;  3UE1 A;  1NBW A;  3LGJ A;  3ERO A;  1G6Z A;  4DKA C;  2IW3 A;  4RH6 A;  2F0J A;  4BS9 A;  3OMG A;  4EX5 A;  3RR5 A;  2F4V L;  3HP3 A;  3A0J A;  2EXD A;  3URY A;  3S14 H;  1C0A A;  2KEN A;  1WD0 A;  1EY7 A;  3NEM A;  1R4P B;  2PI2 A;  1B8A A;  1TS4 A;  3HGB A;  4DGZ A;  1IL2 A;  1HHV A;  4DR5 L;  1DGS A;  1X55 A;  3CQZ H;  1K0S A;  4DU9 A;  1V8Q A;  4OO1 G;  1WTW A;  1AZP A;  4FNF A;  2Q2T A;  1YNN C;  4IN3 A;  1HQM C;  3CC2 A;  2ZXO A;  3OTO L;  4LF7 L;  1S5B D;  3CRK C;  1K73 C;  1LT6 D;  1D5M C;  2D9U A;  4GN3 B;  2LMC B;  2PCF B;  3U9S A;  2EJM A;  1TWF H;  5C4J B;  3O13 A;  3R2T A;  1LTB D;  5CV6 A;  2PQA B;  1ZEQ X;  4CDF C;  1KDA A;  1E0B A;  4KLK A;  5IT9 c;  3QO2 A;  3I72 A;  2F0E A;  3DWA A;  2L5T A;  3CCM A;  2F0I A;  3U4V A;  1U9R A;  3ERS X;  2H4O A;  1KIX A;  5GAG C;  2QDB A;  2R6G A;  3QG1 A;  5ELC A;  1MJC A;  3QJY A;  4B3M Q;  5JPN C;  1Y1V H;  1XNQ Q;  2FHT A;  1YHQ A;  4CJ0 B;  4KKU A;  1HR0 Q;  1NTG A;  4BBS H;  5C3W A;  3CCR A;  1Z7T A;  5TSS A;  1B9M A;  1ESR A;  3PMF A;  3UDX A;  2LXJ A;  2F0P A;  5LMN W;  4DV3 Q;  1KDC A;  4DFA A;  4RWS C;  3J7A V;  2L55 A;  2AWN A;  4LF8 L;  1PZJ D;  1Q8K A;  1ICF B;  3J81 L;  4ULL A;  3I56 A;  1NR4 A;  3MAQ A;  3NTI A;  2Z1C A;  2G5D A;  3DM3 A;  2FJ2 A;  1HNW Q;  4QCL A;  4P2C B;  2LSS A;  3NP8 A;  4DR7 Q;  3HOZ H;  4GKJ Q;  4PZ6 A;  2K5N A;  1ZYR D;  3MEF A;  1EY4 A;  5ELO A;  5JJL A;  4MHE A;  2A6E C;  3E9I A;  1XNR Q;  1X6O A;  2NZ1 D;  4ZRZ A;  4X3U A;  3OSO A;  5DAU A;  3FPU B;  3NUC A;  5KNB A;  2NVX B;  1FR3 A;  4R9W A;  2PZT A;  4ZUJ A;  2BA0 A;  3ULL A;  4G4K A;  4GS3 A;  1KAB A;  3A55 A;  2GVB A;  4BXX G;  2VQE L;  3I7F A;  1K0R A;  5I4D A;  1TWC H;  3V05 A;  4DV0 Q;  2MFI A;  3BYY B;  3J7Y W;  1E2V A;  2F4I A;  1E7Z A;  2YTV A;  5C4Z A;  3PQI A;  2Z4H A;  3R2I A;  3ZYY X;  1VQN A;  2L12 A;  1A63 A;  2K32 A;  4OWX B;  4IOA A;  5K36 H;  4KN7 C;  1LT3 D;  5LMU L;  1I6H H;  2KHS A;  3T1Y Q;  3D4W A;  5E1F A;  1D5Z C;  2UUB Q;  2WV6 D;  5C0X I;  2VQF Q;  2KQ3 A;  2XWJ B;  4A3F G;  2K52 A;  2YTY A;  1JJC B;  1PXU A;  3BYT B;  5I6W A;  1I4P A;  1WI5 A;  4P75 A;  1CSQ A;  2SOB A;  2QEX A;  4A3D G;  3L7Z C;  2R92 G;  1IBM Q;  4HJ5 A;  2QIL A;  3HOZ G;  4A3G B;  1CM9 A;  4JYA L;  3M7G A;  2J4X A;  4K5V A;  5CR3 A;  3L3O C;  4DR2 Q;  4DR5 Q;  1D1K A;  2Q8R E;  4NMZ A;  2NVY B;  3MXP A;  3ERQ A;  1EY9 A;  5IWA L;  3HS0 C;  1KDB A;  5T1G A;  1TWH B;  4A3E H;  4JI7 Q;  3NTH A;  3BG3 A;  3PUX A;  3R3O A;  1R9T H;  3IKJ A;  2QCP X;  3OIP A;  2EYO A;  5FLX L;  3GTO B;  3J80 i;  5M5Y B;  1STA A;  3I4L A;  1EIH A;  2E2I H;  2Z6B A;  3A7A B;  5ISR A;  1M1K C;  1QZG A;  3KJP A;  1IL8 A;  2YV5 A;  1JB7 A;  3WOF A;  3S17 B;  3NTK A;  1MSG A;  5M5W B;  2NVQ H;  1GD7 A;  1S5F D;  1U4P A;  4WJW A;  3KLW A;  1G2S A;  5DLQ E;  5C44 G;  4P72 A;  4A3K G;  3CD6 A;  4Q5V A;  3GTP H;  4MNO A;  1TWH H;  4NXN Q;  2AQ3 B;  4PMC A;  1Q1B A;  2JA6 B;  3TDQ A;  2BE5 D;  2ZT9 C;  4A75 A;  2PQA A;  1YEZ A;  4B9W A;  1B50 A;  1SE4 A;  2A73 B;  2VXW A;  4C3J H;  4K8I A;  3QOJ A;  4X65 L;  2JK8 A;  2BH8 A;  2UXC L;  1WTQ A;  2EYH A;  4F88 A;  3H91 A;  5JJZ A;  5COR A;  5C44 H;  4X3T A;  3S17 H;  4WRD A;  3SHL A;  4UPA A;  5LMN L;  3ICE A;  4JBJ A;  3MHB A;  3J81 i;  3QR8 A;  4DAV A;  4BBR G;  1LT5 D;  3I8Z A;  2MP1 A;  4LMQ D;  5EKI A;  2ZTE A;  2BCO A;  1LT4 D;  1EZ6 A;  1M90 C;  1Y69 U;  3I73 A;  5EPL A;  1W6J A;  4YY3 L;  2LXK A;  4FXD A;  1A2U A;  3U58 A;  1S5C D;  2PMZ E;  2N78 A;  3ULP A;  3I70 A;  1KXL A;  4ALP A;  4OON A;  1EFI D;  4J8Q A;  1QG7 A;  4GN5 A;  2BE5 C;  3VYS A;  3KOJ A;  3ND9 A;  1DJR D;  2CW0 C;  3HRZ C;  1A2T A;  2KVM A;  4X66 L;  3JAM i;  3I4O A;  1Y8P B;  3PO3 B;  1CK1 A;  3LWE A;  1X3F A;  4B9X A;  1TY2 A;  4JV5 L;  3IL8 A;  4XYQ A;  2Q2U A;  1ESF A;  4JI8 L; 
#chains in the Genus database with same CATH homology
 4RKL A;  2K5Q A;  3J80 L;  3FMC A;  5IGC A;  2SDF A;  5CV7 A;  4N9T A;  2WKD A;  4LAA A;  4FF3 A;  4KJN A;  5I6Y A;  4HN7 A;  4FF4 A;  3LX0 A;  2SNS A;  2VB3 X;  1L0X B;  1FNW A;  2A69 D;  4JK1 C;  1I4X A;  5CV4 A;  4C3H G;  3OW7 A;  2JP1 A;  4KMU C;  1LV9 A;  1VMP A;  2AQ2 B;  3OMC A;  3RLF A;  3M3Y B;  3S15 B;  1SNM A;  1PDQ A;  2RDG A;  3MC0 B;  4U67 3;  2N55 A;  1DOL A;  2ZXR A;  4K6D A;  2WB1 B;  1K8M A;  3TME A;  4BY1 B;  2B2Y A;  1TKW B;  4B08 A;  4RGT A;  2JYO A;  1VMC A;  1EY8 A;  1SXT A;  5I2Y A;  3GTG B;  1K83 B;  3R93 A;  2ICI A;  1M8A A;  1D5X C;  2JE6 I;  4DA2 A;  3A7L A;  3PV0 A;  3MWY W;  2O5I C;  3DWP A;  4ZQ3 A;  5A2Q L;  2E2D C;  2ZXP A;  3S1R B;  1KNE A;  3N52 A;  3VR3 A;  5ELD A;  1EL0 A;  3SK5 A;  3N6R A;  2HDL A;  2L11 A;  3K59 A;  1QNU A;  4FVM A;  4HCE A;  1UAP A;  4KJO A;  4KY6 A;  1FGB D;  3NSW A;  3TP8 A;  3C3L A;  2Z4I A;  1AEX A;  3I90 A;  2F3W A;  2K03 A;  1GJX A;  3J81 E;  3KF8 A;  3W2D A;  1EYC A;  3G6J B;  3FRP B;  1A6X A;  2RA4 A;  1Q3L A;  5KEE A;  3T4A C;  1DCZ A;  5JVG 3;  5I9O A;  3S16 B;  1G2T A;  4K2L A;  2EY1 A;  4A3M B;  2NN6 I;  1B53 A;  3K6O A;  3D8G A;  3RMH A;  3CU7 A;  1YNN D;  5C3E B;  1PYW D;  2H1E A;  5M3F B;  5DM6 3;  5FO9 B;  1CTM A;  5C5L A;  5IGE A;  2DY8 A;  3QB3 A;  1J8I A;  2IL8 A;  1EU4 A;  5M5X B;  2F0D A;  1HFG A;  1TY0 A;  4A3E B;  2RSO A;  4OHJ A;  2PPB C;  3H3V C;  4FXK C;  1VCI A;  2M9V A;  3DEP A;  1F9R A;  1OXU A;  5JEA J;  2EYF A;  3RD4 A;  5EKK A;  4KHZ A;  2F0K A;  5C3X A;  1PTO D;  1S5E D;  1JOR A;  1QB5 D;  5BN5 A;  2Z8L A;  5G3L F;  1LTT D;  3OPO A;  4S3S A;  4XQJ A;  2EVB A;  1YNJ C;  4K6L A;  1IW7 C;  2XWB B;  2F03 A;  4KTA A;  4HR7 B;  2BA1 A;  2VNU D;  1TWA B;  1B44 D;  1Q12 A;  1BCP D;  4M8A A;  2R92 B;  2CVR A;  4DF7 A;  4U68 A;  2EOT A;  4K8J A;  3GTL B;  2C9O A;  2KCC A;  1TS3 A;  1OXX K;  1NUC A;  2XIW A;  4NDX A;  4IFD H;  5I9P A;  3PO2 B;  2J7Z A;  2F0W A;  1MD2 D;  2JA8 B;  4R8N A;  1EEF D;  3K5N A;  1SSO A;  2AUJ D;  1WCM B;  3H09 A;  1B9N A;  1PTO C;  1F2L A;  3MEH A;  3HZX A;  4HCS A;  5E4W C;  4FO2 A;  1JOQ A;  1FNU A;  2F0L A;  2K5D A;  2R3Z A;  2XN9 C;  4NP5 A;  3Q0A A;  3P75 A;  3NBH A;  1PFB A;  3C2P A;  2K5W A;  2IX1 A;  3I4N B;  4H13 C;  2K01 A;  2KEC A;  4QF4 A;  2OF1 A;  2OEO A;  2PW5 A;  1ZXT A;  1ROD A;  3SXH A;  1H9S B;  5ELF A;  2VB2 X;  5M9O A;  4DAY A;  1Y1V B;  1BBX C;  5DEH A;  5JEA G;  2SEB D;  1UNS A;  1NAP A;  3NQI A;  1GUO A;  3FEW X;  5A2Q E;  3H94 A;  1TVX A;  4BA1 I;  5DM7 3;  1SYB A;  3D6W A;  1IYU A;  5J39 A;  1HUM A;  1ONL A;  4I7Z C;  1VDZ A;  3E6Z X;  2XRS D;  3HOZ B;  4PQX A;  1GHJ A;  1MGS A;  4DNR B;  1CZG A;  1EY5 A;  4A3K B;  1XWE A;  4G7Z C;  3QIA A;  4CBV A;  1ICW A;  1ZKO A;  4KD4 A;  1T5X D;  1PMR A;  1RF2 D;  2ENB A;  4IFD G;  3K7A B;  5CGK A;  3SK8 A;  2HDM A;  1KTK A;  1SDF A;  5CV9 A;  1JWU D;  2O4X A;  4G7O C;  1BCP F;  5EKL A;  2G9D A;  4EQN A;  1V1P A;  1SND A;  3WOE A;  1TS5 A;  4BBR B;  1D1I A;  2F0O A;  1CI3 M;  5D65 A;  1BO0 A;  4PV1 C;  3IAY A;  4DK0 A;  1OXS C;  4A3B B;  4XQN A;  2Q8I B;  4DN4 M;  1LAC A;  1EQV A;  2E2H B;  3M7N A;  2B2U A;  4Z9C B;  5FKA C;  3T16 A;  3NWS A;  1DOM A;  3NBI A;  2BDO A;  4NKL A;  4HSV A;  5FOB B;  3OWE B;  2XVS A;  5JEA H;  2F0Q A;  5C0X H;  4FP5 D;  1AFP A;  5CMD A;  3BVG A;  1FNV A;  1GUS A;  2B8G A;  4IUQ A;  5KYL A;  2B2U C;  2A69 C;  4KY5 A;  3PUW A;  2VUM B;  4R8I A;  1TWF B;  4Q0F A;  3NXW A;  1DD2 A;  5BN4 A;  4J1M A;  1E2Z A;  4HMJ A;  3GTP B;  2RQX A;  1STY A;  1PFN A;  2YYZ A;  5HUR A;  1I6V C;  1OXV A;  3BDL A;  3A8I E;  4X3K A;  5F2D A;  5G3L D;  1O7L A;  1DOK A;  3GV6 A;  3S1Q B;  1HCZ A;  1DON A;  2LKV A;  3CHB D;  2B2Y C;  4IFD J;  2JSO A;  1X3Q A;  2NYZ D;  1EZ8 A;  3BZD B;  3VR2 A;  3C1F A;  4IUT A;  3E0J A;  1O80 A;  1GUG A;  3NE5 B;  2F0G A;  1ZYR C;  1U4R A;  1BQQ T;  1LTI D;  3OHX C;  3TP5 A;  1F77 A;  2EYJ A;  2F0U A;  2DNC A;  2MGS A;  2L0C A;  1Q90 A;  3GP7 A;  1BDO A;  5K5P A;  1X3P A;  2IT1 A;  1F2M A;  4BBS B;  4RGN A;  5K36 G;  3VA5 A;  3D3R A;  4K2K A;  1SNC A;  3HEJ A;  4DXF A;  1U4M A;  1EU3 A;  3DEO A;  3EVQ A;  3DWQ A;  3U9O A;  2PZW A;  1KNA A;  3SDZ A;  3S2H B;  2Q8T A;  1NCV A;  1S4Z A;  1S5D D;  1MSH A;  1G91 A;  3UI2 A;  3DXJ C;  3M4Y A;  4C3H B;  1JQY D;  2AQ1 B;  4V0B A;  3PIP 3;  3A54 A;  1U4L A;  2F0F A;  3TSS A;  3C1E A;  1EY0 A;  2EPB A;  2J0T D;  2WAC A;  3GV3 A;  2HUG A;  1PFM A;  2PW7 A;  1JWM D;  1SYD A;  3P20 A;  5D14 A;  3HKZ B;  4YIJ A;  1R9T B;  4DNT B;  3HOX B;  2JA5 B;  1AZQ A;  1AP0 A;  1Y1W B;  3EQL C;  1ILQ A;  3RZD B;  5EGT A;  3TP6 A;  1JOO A;  4XTC S;  5EBC A;  4ZK9 B;  1QOH A;  4GZY C;  3NQT A;  3MTS A;  2EYL A;  5FO7 B;  3IFD A;  2V4D A;  3GTK B;  4IUV A;  3RUZ A;  1SYF A;  1ENC A;  1F9P A;  4CJ1 B;  4RHR A;  4IZ8 A;  5J22 A;  4KV6 A;  3S1M B;  1JE4 A;  1L0Y B;  3MFY A;  1LTA D;  4ILW A;  2HCI A;  2M00 A;  4KN4 C;  1I6H B;  4QUC A;  5ELB A;  1QJO A;  2NVQ B;  2PMZ B;  1OO9 B;  2A6E D;  1SNO A;  1B3A A;  5LL6 X;  3L9A X;  5IT9 L;  3SK4 A;  1V43 A;  2B8F A;  2X69 A;  1SMY D;  1V1O A;  3QOL A;  2KA7 A;  2ICE C;  4BA2 I;  4C2M B;  5KGU A;  1SAP A;  4BY7 B;  3VYU A;  5COY A;  4C3I B;  3D31 A;  4XT1 B;  3T53 B;  2PQE A;  2M2L A;  3LWU A;  3KLS X;  1H9J A;  5CBE E;  3RZO B;  1TS2 A;  3MXG A;  3FVQ A;  4HAE A;  2DNE A;  4XXE A;  4DXG A;  1BCP C;  2B39 A;  1HPC A;  1I4H A;  3V96 A;  4ABN A;  3CQZ B;  1QWY A;  1QCB D;  3KBX A;  4OO1 I;  3HOV B;  1IW7 D;  2D62 A;  3T56 B;  2CW0 D;  1H9K A;  2L9H A;  4RHS A;  3DUZ A;  5KND A;  2K04 A;  5CC4 A;  4KD3 A;  4H7B A;  5IGB A;  2JEA I;  3K5M A;  1PRT D;  3CRL C;  3GTQ B;  2FMM A;  3SVM A;  1DZ1 A;  2G9H D;  1F2Y A;  1R4Q B;  4IAL A;  4O1N A;  1SEB D;  5CBA E;  3A8J E;  4KHV A;  3MXU A;  4TSS A;  2EJG C;  4RAU C;  5KIX A;  1GUW A;  2JA7 B;  4DK1 A;  4IUN A;  1DYQ A;  3DM1 A;  1PRT B;  4HTH A;  4A93 B;  5KNC A;  1D6E C;  2RVL A;  5D3D A;  1SFO B;  4FF1 A;  2IJ0 A;  3PUV A;  5IGG A;  1C48 A;  2RDF A;  2E2I B;  2MHV A;  1PTO H;  2O5J C;  1KLU D;  3CKI B;  4XDX A;  5IOC A;  4ODG A;  1F9Q A;  4RFB A;  4A3F B;  3S1N B;  2EY6 A;  1LTG D;  4ME5 A;  2EZV A;  2EJF C;  4MN3 A;  3TZD A;  2K6A A;  1F9S A;  4EQO A;  1QNK A;  1EWC A;  3A8K E;  5C0X J;  4FXG C;  1EQT A;  1EYD A;  3X3N A;  3D6C A;  1TT2 A;  1IYV A;  1X32 A;  3VA7 A;  1EYA A;  1A15 A;  3JAM E;  5HGT A;  1C8C A;  1TWG B;  3K5L A;  4AYB B;  4TKO B;  4TRD A;  1RTO A;  1WTO A;  3K0Y A;  1ET6 A;  1CQV A;  5IT9 E;  2F0V A;  3C46 A;  2EYP A;  1UUP A;  3P7J A;  2HQE A;  1FD7 D;  4V19 0;  1ENA A;  1GUN A;  3P1H A;  5FO8 B;  3ND8 A;  1WTX A;  4F8M A;  4IUP A;  1HXY D;  2D2C C;  1W6K A;  2RKS A;  1VF5 C;  3FKI B;  1IHZ A;  4JBW A;  2JEB I;  2NN6 H;  4L6T B;  1O78 A;  2XSC A;  2BDN A;  3HOU B;  4CKC A;  1NSN S;  1UEA B;  5IIF A;  3S2D B;  1TU2 B;  1JOK A;  2R7Z B;  4I65 A;  5JOB A;  2F0N A;  5IGF A;  2R93 B;  3T13 A;  3H6M A;  4RA8 A;  1AW7 A;  3VR5 A;  4ZYS A;  1DM0 B;  2MUY A;  2PZU A;  2HCC A;  1Q1E A;  3HOW B;  1QE6 A;  3R8B A;  1EOT A;  1SMY C;  5EBD A;  4F7X A;  5KRU A;  5C5M A;  2B2T A;  2NUC A;  3LNN A;  4TQU S;  4WOR A;  3MZ5 A;  2F0S A;  1KLG D;  4HMI A;  4K5X A;  1MI2 A;  5KYI A;  2I07 B;  2F0M A;  1XX8 A;  2NWG A;  4XYO A;  2B2T C;  2R61 A;  3W3A A;  2K05 A;  1WTR A;  1E2W A;  3VYT A;  3S14 B;  3HOY B;  2KOL A;  3KK7 A;  3FPP A;  1ET9 A;  1PZK D;  4FF2 A;  3NPP A;  2WII B;  1JCK B;  1CA5 A;  3MVV A;  1TQO A;  5E3F A;  4KKS A;  1H9S A;  4CKB A;  5FK9 C;  5JPM C;  1B1Z A;  3BVZ A;  4DAP A;  1SE2 A;  2NTT A;  1HQR D;  3Q24 A;  4LJZ C;  4PMB A;  1CHQ D;  5EPK A;  2E74 C;  2E76 C;  2A74 C;  2LS0 1;  4C1N I;  2X6L A;  1JIC A;  3GTM B;  1I4Q A;  2A68 D;  4OGQ C;  3HG9 A;  1M4V A;  4ZKB B;  1JR0 D;  3H0G B;  2F3V A;  5D3I B;  1SYC A;  3K57 A;  1HRJ A;  2KEE A;  4G7H C;  4EVO A;  3KBG A;  2XRQ D;  2A68 C;  1XTC D;  4IFD I;  1D2B A;  4L8J A;  5I2X A;  2TMP A;  1QIL A;  3EFX D;  4H0L C;  5T1I A;  4XQQ A;  2Y0S B;  2NN6 G;  3SK6 A;  1SYE A;  1PRT C;  2B2V C;  2D5D A;  4ZAI A;  1IKM A;  1I4G A;  3PUZ A;  1BOS A;  4MIU A;  1DXM A;  2PYK A;  5EPJ A;  4ZLT F;  2FIN B;  3K58 A;  2ID0 A;  3JAM L;  2B2V A;  4EQP A;  5JVH 3;  4CHT B;  4C56 C;  1WD1 A;  4IQZ A;  4K14 A;  1LLR D;  1Y8N B;  5EQ0 A;  1SJH D;  4KKT A;  1Q8I A;  3DMU A;  3VR4 A;  3NHH A;  3K5O A;  4RCO A;  1XYI A;  1WTV A;  3ITP A;  2QKI C;  2MPM A;  3J7A F;  2SNM A;  2EE1 A;  2EY2 A;  2EDG A;  5NUC A;  1HTL D;  2O2L D;  2B63 B;  2BOS A;  4O42 A;  4Y7N B;  4ZKC B;  2WP8 J;  2TSS A;  4OIJ A;  2IX0 A;  4N9P A;  5C6A A;  3SE0 A;  4M1U B;  1II3 A;  2YU9 B;  1OXT A;  2MJ8 A;  3F2U A;  5EJW A;  3OWF A;  2NVT B;  1PZI D;  2F0T A;  1BUV T;  1RCV D;  2AWO A;  1FYC A;  4C3I G;  4X3S A;  1KAA A;  2KUM A;  2RDH A;  2LY7 A;  2IX3 A;  3TN2 A;  4E6I A;  4C1N K;  5C0X G;  1IKL A;  3A56 A;  4L63 B;  1EY6 A;  1GXD C;  1STG A;  3GO5 A;  3KUP A;  4RGM A;  3OIQ A;  3M4O B;  1SBB B;  1PTO F;  1O7Z A;  2E75 C;  1J9O A;  4C3J B;  4IUR A;  1T5E A;  1EIG A;  3BDO A;  3G7L A;  4QIW B;  2K28 A;  1HTP A;  1CT1 D;  4WFN 3;  1Y8O B;  1HA5 A;  2GA4 B;  4OL7 A;  2IWH A;  1TII D;  3OOC A;  1PRT F;  1B4O A;  3KLS A;  1EEI D;  4LK1 C;  5C44 B;  4A3I B;  1EWH A;  2OXP A;  1A3V A;  3I3C A;  1RTN A;  5A35 A;  1H9M A;  2QF7 A;  1C4Q A;  2X6G A;  1SYG A;  1STE A;  3SR1 A;  1GHK A;  3DHQ A;  3MFG A;  1HA6 A;  2LFN A;  1I4R A;  2F0H A;  4KY7 A;  4CKE A;  1MBY A;  4RKB A;  3NK9 A;  1RJT A;  4RCN A;  4OIK A;  4H44 C;  1LTS D;  4CJ2 C;  1BXT A;  1XXG A;  4EGV A;  3FDT A;  3GTJ B;  3AU7 A;  4QB4 A;  1HFN A;  1CFM A;  5CYU A;  2OT2 A;  4CGY B;  2WAQ B;  5IGD A;  2C5C A;  2E2J B;  5AFW A;  1CQF A;  4UDU C;  1LTR D;  2RSN A;  1G29 1;  1H9R A;  1K8O A;  2K33 A;  1TWC B;  1Z6H A;  1G8Z D;  1SNP A;  1JWS D;  2K1B A;  2N88 A;  1BCP B;  3M85 A;  1ML0 D;  1WTP A;  4QUF A;  4PNY A;  2L1B A;  1ILP A;  3MXN A;  5CV5 A;  1SJE D;  2DY7 A;  4BWG B;  2EYM A;  3BS1 A;  2AUK A;  5ELE A;  1B2T A;  1I3Q B;  1RDP D;  2A6H C;  3PIO 3;  2QEJ C;  3EA6 A;  3BDC A;  1RD9 D;  4QMG A;  4C3J G;  1GOZ A;  1SE3 A;  1HUN A;  1PLF A;  1PTO B;  4K5W A;  1STH A;  2DN8 A;  4FYD A;  1NR2 A;  2XNA C;  1CZW A;  4IUU A;  1TR5 A;  4KI0 A;  5CV8 A;  3EJI A;  4OO1 H;  4KK7 A;  1BF4 A;  1AN8 A;  1GUT A;  4HED A;  1VF7 A;  2WKC A;  3VR6 A;  1BNZ A;  3GQB A;  3TBI B;  3ONA B;  4XIG S;  3D4D A;  2CHB D;  1O7Y A;  1LAB A;  4G57 A;  4XT3 B;  4UAI A;  1I50 B;  1RKN A;  4ID6 A;  1WVL A;  1F2Z A;  1A3U A;  2JXM B;  1STB A;  3Q22 A;  1LO5 D;  2L4N A;  2PNR C;  1CA6 A;  1BR9 A;  4F87 A;  4J6H A;  4RGO S;  2WIN B;  2KJX A;  3AB9 A;  3SEB A;  1Z47 A;  3J80 E;  1CHP D;  3Q6S A;  5DNF A;  3GD7 A;  3MA2 B;  5M3M B;  5JAV A;  2FMC A;  5E4X A;  1STN A;  1YNJ D;  3KLR A;  1ENF A;  2A6H D;  2CQA A;  2B2W C;  4ZUI A;  3E5S A;  2IPK D;  3Q23 A;  2NBF A;  4A3D B;  2NTS A;  1RHP A;  3WDN A;  5C4H A;  1SNQ A;  2K7V A;  4NW2 A;  1A3T A;  4HSP A;  5J1Z A;  4A3J B;  1JC7 A;  3IFT A;  3D4R A;  3BVM A;  3S9W A;  2EY5 A;  1V1P B;  5LHY 1;  2B2W A;  2KED A;  4PMW A;  3X3M A;  3I91 A;  5LL6 S;  2PO4 A;  5BN3 A;  2FFK B;  1JB3 A;  2I46 A;  3NWT A;  3VYR A;  3QWN A;  2KCN A;  2NB0 A;  5C4X B;  5IOD A;  2EXZ A;  2F1M A;  3AMU A;  3TZU A;  3TP7 A;  5FLX E;  3T51 B;  3V2T A;  2A5H A;  3I4M B;  2RBM A;  3PUY A;  3ERO A;  1G6Z A;  2IW3 A;  4RH6 A;  2F0J A;  4BS9 A;  3OMG A;  3HP3 A;  3URY A;  1WD0 A;  1EY7 A;  1R4P B;  4DGZ A;  1TS4 A;  1HHV A;  3HGB A;  4DU9 A;  1V8Q A;  4OO1 G;  1WTW A;  1AZP A;  4FNF A;  1YNN C;  4IN3 A;  1HQM C;  2ZXO A;  1S5B D;  3CRK C;  1LT6 D;  1D5M C;  2D9U A;  2LMC B;  2PCF B;  3U9S A;  2EJM A;  5C4J B;  3O13 A;  3R2T A;  1LTB D;  5CV6 A;  1ZEQ X;  1KDA A;  1E0B A;  3QO2 A;  3I72 A;  2F0E A;  3DWA A;  2L5T A;  2F0I A;  1U9R A;  2H4O A;  2QDB A;  2R6G A;  3QG1 A;  5ELC A;  3QJY A;  5JPN C;  2FHT A;  4CJ0 B;  4KKU A;  5C3W A;  1Z7T A;  5TSS A;  1B9M A;  1ESR A;  3PMF A;  2F0P A;  1KDC A;  4DFA A;  4RWS C;  3J7A V;  2L55 A;  2AWN A;  1PZJ D;  3J81 L;  4ULL A;  1NR4 A;  3MAQ A;  3NTI A;  2Z1C A;  2FJ2 A;  4QCL A;  4P2C B;  3NP8 A;  1ZYR D;  1EY4 A;  4MHE A;  2A6E C;  2NZ1 D;  4ZRZ A;  4X3U A;  3OSO A;  5DAU A;  3FPU B;  3NUC A;  5KNB A;  2NVX B;  1FR3 A;  4R9W A;  2PZT A;  4ZUJ A;  2BA0 A;  4G4K A;  1KAB A;  3A55 A;  5I4D A;  3V05 A;  3BYY B;  3J7Y W;  1E2V A;  2F4I A;  5C4Z A;  2Z4H A;  3R2I A;  3ZYY X;  2L12 A;  2K32 A;  5K36 H;  4KN7 C;  1LT3 D;  2KHS A;  3D4W A;  5E1F A;  1D5Z C;  2WV6 D;  5C0X I;  2KQ3 A;  2XWJ B;  1PXU A;  3BYT B;  5I6W A;  1I4P A;  2SOB A;  3L7Z C;  2QIL A;  4A3G B;  1CM9 A;  3M7G A;  2J4X A;  4K5V A;  5CR3 A;  3L3O C;  1D1K A;  2Q8R E;  4NMZ A;  2NVY B;  3MXP A;  3ERQ A;  1EY9 A;  3HS0 C;  1KDB A;  5T1G A;  1TWH B;  3NTH A;  3BG3 A;  3PUX A;  3R3O A;  3IKJ A;  2QCP X;  3OIP A;  2EYO A;  5FLX L;  3GTO B;  5M5Y B;  1STA A;  3I4L A;  1EIH A;  3A7A B;  5ISR A;  1IL8 A;  3WOF A;  3S17 B;  3NTK A;  1MSG A;  5M5W B;  1S5F D;  1U4P A;  4WJW A;  1G2S A;  4Q5V A;  2AQ3 B;  4PMC A;  1Q1B A;  2JA6 B;  3TDQ A;  2BE5 D;  2ZT9 C;  4B9W A;  1B50 A;  1SE4 A;  2A73 B;  2VXW A;  4K8I A;  3QOJ A;  1WTQ A;  2EYH A;  4F88 A;  3H91 A;  5JJZ A;  5COR A;  4X3T A;  4WRD A;  3SHL A;  3MHB A;  4DAV A;  1LT5 D;  3I8Z A;  2MP1 A;  4LMQ D;  5EKI A;  2BCO A;  1LT4 D;  1EZ6 A;  1Y69 U;  3I73 A;  5EPL A;  1W6J A;  4FXD A;  1A2U A;  1S5C D;  3I70 A;  1EFI D;  1QG7 A;  4J8Q A;  2BE5 C;  3VYS A;  3ND9 A;  1DJR D;  2CW0 C;  3HRZ C;  1A2T A;  2KVM A;  1Y8P B;  3PO3 B;  1CK1 A;  4B9X A;  3LWE A;  1TY2 A;  3IL8 A;  4XYQ A;  1ESF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...