2K1BA

Solution nmr structure of the chromo domain of the chromobox protein homolog 7
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
b'EQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 7
publication title Solution NMR structure of the chromobox protein homolog 7.
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k1bA00
1NCVA 2EOTA 2K01A 2JYOA 2BDNA 2Q8RE 4IUPA 1C8CA 4ZAIA 1QE6A 4XT3B 3G7LA 2B2TC 1SSOA 1JICA 4MHEA 5JJZA 2L12A 1X32A 4IURA 4R8IA 4X3KA 2MP1A 4QUCA 4RWSC 1WD0A 1RHPA 4X3TA 3DEOA 2HCCA 2K1BA 1RODA 3IL8A 1WTWA 5E4WC 2RSOA 5T1GA 1DONA 1HA6A 1HFGA 3R93A 1LV9A 5CMDA 2HCIA 4OIKA 4LMQD 1J8IA 3DM1A 3KUPA 1GUWA 5EQ0A 4MN3A 3GV6A 3TZDA 1HRJA 4ZK9B 3GV3A 1KNEA 1PFMA 1AZPA 2B2VA 1B50A 1CM9A 2FJ2A 1VMPA 1RTNA 1U4PA 1F2LA 2K28A 1QNKA 2KEEA 4IUQA 2HUGA 2Q8TA 1EIGA 2B2WA 4QUFA 4CJ0B 1WTOA 2K05A 4HCSA 1EIHA 5DNFA 1HFNA 1MGSA 1DOKA 5CORA 4HSVA 1WVLA 2DY8A 4DN4M 1A15A 1BBXC 1B3AA 2B2UC 2B2TA 2X69A 2XIWA 4X3SA 1G91A 2R3ZA 1WTQA 2NWGA 2FFKB 1HUNA 2RVLA 3I90A 1AZQA 3ONAB 2K04A 1B53A 2RSNA 1RTOA 4OIJA 4UAIA 5D65A 1ILPA 2L4NA 3SVMA 1DOLA 2FINB 1CA6A 4ZKCB 1PFNA 1U4LA 2MGSA 4HEDA 4X3UA 5CBAE 1S4ZA 1MSHA 1G2TA 1WTRA 1MSGA 4NW2A 2L1BA 1B2TA 3I91A 4HAEA 4RAUC 3QO2A 1MI2A 1DOMA 5T1IA 1BNZA 1EOTA 1PDQA 2DY7A 2EE1A 3F2UA 1BF4A 1F9SA 1SAPA 2VXWA 3D6WA 2K03A 2D9UA 5EPLA 1JE4A 2X6GA 1O7ZA 2KEDA 1ICWA 1VMCA 4IUVA 5EJWA 2B2UA 3FPUB 5AFWA 5EPKA 5EPJA 2KUMA 2HDLA 1QG7A 2CVRA 2KOLA 2B2YC 4CJ1B 4CJ2C 2RA4A 3IFDA 3I8ZA 3P7JA 2B2YA 4RA8A 1ILQA 1SDFA 1X3PA 3I3CA 1WD1A 4R9WA 3LWEA 1J9OA 1ESRA 1KNAA 1XX8A 2FHTA 4XDXA 4ZLTF 1XYIA 1EL0A 1HHVA 4IUUA 1IKMA 1WTPA 2N88A 3Q6SA 2KVMA 1F9RA 1ML0D 1NAPA 2L9HA 1F9QA 3N52A 5EKIA 1NR4A 1O80A 2IL8A 1PLFA 1E0BA 2M2LA 1ZXTA 1G2SA 1PFBA 1RJTA 3KBXA 1IL8A 1Q3LA 5COYA 3MWYW 1CA5A 1TVXA 1X3QA 1U4MA 2EPBA 4O42A 2NZ1D 1WTXA 3DEPA 3HP3A 2H1EA 3TN2A 4U68A 2KECA 5D14A 5CBEE 1EQTA 1BO0A 3FDTA 2HDMA 2MPMA 4ZKBB 2J7ZA 2N55A 1NR2A 2SDFA 1DZ1A 3H91A 2L11A 3MTSA 1HUMA 2JP1A 2FMMA 2X6LA 1F9PA 5E4XA 2NYZD 1M8AA 4XT1B 2B2VC 1G6ZA 2MJ8A 1WTVA 1IKLA 1U4RA 1AP0A 4IUTA 3UI2A 2B2WC 1B4OA 1O7YA
chains in the Genus database with same CATH superfamily
1V1QA 1XNRQ 3CC4A 5FO7B 2F1MA 4MHEA 5BN3A 1UE7A 1PYWD 4ZCKA 2M9VA 2CW0C 1RHPA 4A3EG 3DEOA 3GTKH 1CSPA 1BCPB 3ULLA 3PSIA 3S16B 2OF1A 1K83B 3MXUA 4G7OC 4DNRB 1BR9A 1EY6A 3P75A 1Y1WB 1RCVD 2OTLA 1M1KC 1Q46A 2NN6H 5AJ3L 1RTNA 1VMPA 3EFXD 3I4OA 2PQAA 3TSSA 4YHHQ 1HZBA 1WTHA 1OTCA 5GQOA 4A3FB 4EGVA 4K0KQ 2KHIA 4QMGA 1LTGD 4A93G 2HHHL 4GKKL 1E1OA 1PRTF 3I4NH 4C1NK 2K75A 2WIIB 1JCKB 1VQAA 5I6YA 1PRTD 2K5VA 2Z6KA 1RL2A 5KNBA 3PF5A 3J7AV 1MSHA 4FNFA 1WTRA 1NE3A 1VQ6A 4PMWA 1YIJA 4K5VA 1JWUD 3GTQH 4ULLA 4YCVA 2AHOB 3EROA 5IODA 2F3WA 1II3A 1X55A 1X9NA 1PH1A 1BOSA 1EY5A 1T5EA 2B2UA 3MXGA 1JOKA 5DM73 2PZUA 2QKIC 1YBYA 2RA4A 3D3RA 5E3FA 4RFBA 4DV4L 1B1ZA 3GTOB 1Y8NB 5AJ3Q 2ICEC 4XQJA 3ULJA 3A8JE 3I55A 4NXNL 3N52A 1RKNA 4ME5A 3NPPA 3CC2A 1NR4A 4I7ZC 5JJKA 4BWGB 1VQFA 2XRQD 1TY0A 1EYAA 1CUKA 2HHHQ 1TWGB 5EGTA 3S15B 1DYQA 1IBMQ 3AEVA 3EQLC 1UEAB 4DV2L 1LO5D 4B3MQ 3OYYA 1ONLA 2J7ZA 4KKUA 5K36G 2JEAI 4G57A 3G71A 2RQXA 2PQAB 3BVMA 2QCPX 3KF8B 5E4XA 3MAQA 5CC4A 2B2VC 5LL6X 1SE8A 3DMUA 4K6DA 2JA7G 1STGA 3VR6A 2AMCB 3BZCA 3HOXH 1ET6A 4C3JB 3Q24A 1SSOA 1TS4A 1WD0A 4QUCA 2F0LA 5A2QE 3S1QH 1GHJA 3IL8A 5JVH3 2RSOA 1ENAA 1I4QA 4BBSH 1BDOA 3HOVG 1EZ8A 4POFA 3M3YB 1FGUA 2DJFC 3EJIA 3GV6A 5D3DA 4LF6L 3M7NA 1JOQA 1CKNA 5A35A 3CMAA 5DEHA 4QUFA 2ZT9C 3AU7A 1X56A 3DWQA 1GUNA 3V05A 4G4KA 3T51B 1BBXC 4LNQA 2JXMB 1VQDA 2Q2HA 3G6EA 4CDEC 1IBKL 3RN5A 1RTOA 1YNND 2EJGC 1S5CD 1V1OA 2ZJPA 3SK6A 1DOLA 3SVMA 5IOCA 2XWJB 4DXGA 1EU3A 4GLVB 4KJNA 5FLXE 4NW2A 3LWUA 4TSSA 4C56C 4JI0Q 2NVYB 3I4MH 1QZGA 5L37A 3MHBA 1SAPA 3D6WA 1A0IA 1JE4A 1QUQA 1TIID 5KIXA 1I6HH 4GLXA 3I4NB 3JC66 1D2BA 3P20A 1CZGA 4J15A 3S1NB 4DV6L 4LWCA 4RKLA 2C35B 4LF6Q 3Q6SA 1STAA 2NYZD 3NQTA 3GTQB 2GVBA 4JI7L 3IRBA 1TWCB 3L3OC 2EPBA 3DUZA 4KN4C 3IFTA 4DR3L 4FVMA 1IBKQ 2ZM6L 1KC8C 1UE6A 1JJGA 1XMOL 2VB2X 1BUVT 1HXYD 2RDHA 4CHTB 3J81c 2PMZE 3OIPA 4M1UB 4XXEA 1L0YB 5ELOA 3IAYA 2A6HD 3FKIG 1VQ4A 1QNUA 2CH4A 3E0JA 1GO3E 4A3GG 4IFDH 3AYHB 1JORA 3LNNA 4CKCA 4QIWE 1X32A 4IURA 4JI2Q 1KL9A 1SMYD 1SN8A 4HSPA 5C3EH 1AN8A 5E1FA 3PGZA 5T1GA 1E2WA 1LV9A 3AFPA 2EVBA 2BOSA 1Q1BA 3CQZH 4H44C 4PZ6A 2MHVA 4H13C 1C48A 1LTSD 2WAQB 2VL6A 3HG9A 1QUQB 1F2LA 4GOPC 5CYUA 3GTJB 2DUDA 5IYBH 4RHRA 2E76C 4JI7Q 2DY8A 3NUCA 4RCNA 4X3SA 1G91A 1PA6A 2K5QA 2HIVA 3S1QB 2WP8J 2NUCA 1V43A 2VB3X 1Y1VG 2NVXB 1TS2A 1F2MA 4B08A 1S4ZA 3FPPA 2CQOA 1STBA 1UE1A 5JJIA 1TR5A 2L1BA 5KNDA 4HAEA 3H6MA 1VQMA 5TSSA 4HIMA 2JQOA 1X54A 3KDFA 1BQQT 1Q86C 1GVPA 1EOTA 4KN7C 2NTTA 2XRSD 4JI5L 1R4QB 1WCMG 1CHPD 1SE2A 4BY7G 2KHSA 5IT9L 3J7AF 1SNOA 1H9RA 1SYCA 1HNZL 3J80E 1EY8A 3PQIA 4YCUA 5C4HA 2IX3A 4RGOS 3BZKA 1X3PA 1JMCA 5FO8B 4E6IA 2R93H 2OTJA 2ZTEA 1PH5A 3NE5B 1C7YA 3NTKA 4HJ9A 2RHSB 2Z8LA 5C4XH 2V1CC 1G2SA 3PO2H 1U4MA 4FF3A 1VQPA 1WTXA 2LSSA 2H1EA 4L5TA 4WJWA 3VYUA 3M4OH 2N8NA 3HOWH 4IZ8A 4B3SL 3K7AB 3GTGH 3TS0A 4JC0A 4BXXG 4DUYQ 1Q81C 1F9PA 1W3SA 3RLNA 3HEJA 4C3IH 4R4TA 2CW0D 3PIP3 1H9JA 2EOTA 2WB1G 5GAHC 2UXBL 1J5EQ 3KLSA 4A3KH 3OWFA 2B63B 1I3QH 5M3MB 5IIFA 4RWSC 1RDPD 3RZOH 2BCOA 4IFDJ 1EWCA 1FYCA 2F0KA 1TWHH 5E4WC 5M5XB 1HFGA 4BY1G 2Z6KC 2F3IA 2GA4B 1N32Q 3I73A 3KDFB 2Q8IB 1CKOA 2EJFC 4O0AA 3VR5A 1L0XB 4RH6A 2YYZA 4KHPL 3KYHC 4X66L 3K6OA 4HIDA 2N78A 1H9SB 5JEAH 3S17H 3G48A 1PZJD 2Y0SG 1L0WA 3C1EA 1V1PB 2B2UC 4PMCA 3F2DA 4WFN3 4A3DB 1Q82C 4A3MB 3H0GG 4GN3B 1EYDA 1EOVA 5ELDA 3ONAB 4B3SQ 2A6EC 4U673 1CA6A 1JC7A 5C44H 1SE3A 2PZTA 2YTVA 1MSGA 4O2DA 2Q2IA 1PH6A 4TVAB 4AYBG 4H02A 1PTOH 2NTSA 1QVFA 1O7ZA 2KEDA 4ME3A 3UDIA 1HQRD 2F0WA 4KY5A 4L6TB 1MKHA 4G7ZC 1Z47A 2A69C 3I3CA 4XDXA 1KDCA 1SXTA 1AE2A 2HQLA 2E2JH 4KHPQ 4IPGA 4X66Q 5T1IA 4RCOA 5COYA 2V4DA 3MWYW 3RN2A 2QW7A 4XTCS 3ND9A 1B70B 1GUTA 4KJOA 2LS01 1QWYA 1BO0A 1LLRD 3FDTA 1NR2A 4IN3A 4NXML 1CK1A 1VQ9A 4C3HG 2J0TD 2RKSA 3SGIA 3HOZB 3NP8A 2R93B 4UP9A 5HURA 3UI2A 4X62L 4OWWB 4OGQC 1GXDC 2K01A 4MTKA 4LFBL 2F3VA 4AQYL 2BDNA 2HD3A 2Q8RE 2IWHA 3PO3G 5LMNL 4CBVA 4QB4A 1MJEA 1QJOA 4R8IA 4X3KA 3RLOA 5CGKA 3PO2B 2K52A 4KY6A 5DAUA 2AWOA 4PG3A 4Q5VA 4L5RC 3M4OB 2AQ2B 2F0OA 3PIOA 1TWFH 3I56A 1D5ZC 2EYPA 1EFWA 2RF4A 3HOUH 3ICEA 4OHJA 3KJPA 2VUMG 3GV3A 1LTAD 1M4VA 1A6XA 2K28A 3CCLA 2I5MX 1EIGA 2B2WA 3D31A 2EYOA 1PMRA 2SOBA 2YU9H 5JEAJ 1WOCA 1CKMA 4F87A 1VQGA 3RZOB 2BH2A 1VQHA 1VQOA 1HNWQ 4A76A 3MEHA 5LMNW 4I65A 4UAIA 2K6AA 4NXMQ 4HJAA 2FINB 1ICFB 1XPOA 3RMHA 5JPNC 1L1OA 2YTXA 1SMYC 1EQVA 4QL5A 3QG1A 1EY7A 1EZ6A 5I2YA 2VQEL 4RAUC 3L0OA 4JPBW 4AQYQ 4FF1A 3S17B 1F9SA 5LMNQ 3CAMA 5EPLA 2JA6B 2F0GA 1XNQL 4CDCC 1Y14B 3S2DH 5LMUL 2I0QA 1ET9A 4A3EH 1SLJA 5JAVA 1EQQA 5E7NA 3F1ZA 3RZDB 4G7HC 1PVOA 2K5DA 1KRTA 4UHVA 1XPUA 2NVTH 1YNJC 3JAME 1T5XD 5EKIA 4AYBE 4FXDA 1GOZA 4NMZA 1YEZA 5M3FB 2BE5C 4A3JG 2E2HH 3QIAA 1CFMA 3SDZA 2KECA 1E22A 1SEBD 2K50A 3D8GA 3SR1A 1Y8OB 4QJFA 2N55A 4YIJA 5G3LF 4A93H 1LTID 4CDFC 3NSWA 2UUBL 4UP8A 1KDAA 1JT8A 3K58A 3AQQA 5G3LD 1CSQA 1A8VA 2E2JB 2JA5B 2PCFB 4IUPA 4ZAIA 1GUSA 2EY6A 2R7ZB 3E9IA 5JPMC 2A8VA 2PW7A 1SYEA 1JQYD 2A74C 2DNCA 3GTLH 1RD9D 2E8GA 1XNQQ 2F0UA 3NTIA 1RODA 1RIPA 4IPHA 4BS9A 4OXPA 2A5HA 1Q1EA 3A55A 3G4SA 4M8AA 1C4QA 3DM1A 1VQNA 1CHQD 3SHLA 3HKZB 3R3OA 1YITA 1PYBA 4MIUA 4JI3Q 4OX9L 1U4PA 1HH2P 1EUJA 4IUQA 5CV8A 1HA5A 3ZJYC 4HCSA 4LFCQ 1MGSA 3J80L 4LF4Q 2R6GA 2D0OA 1R9TH 3E6ZX 2K33A 1WTQA 3RUZA 1YJ9A 1EWIA 1DXMA 3QJYA 2TSSA 1MHWC 2UUBQ 1TWFB 5K36H 4YY3Q 1PH4A 2D5DA 2UUCL 2JK8A 2VW9A 1BNZA 3KF8A 4DAVA 5IYDG 1BF4A 2JA7H 2UXCL 1SRUA 1D8LA 1CTMA 1A3VA 1IBML 2Z6BA 4B3ML 2LXKA 4K2LA 5DLQE 1ILQA 1KQSA 5EBCA 4TKOB 4R9WA 4ZLTF 1STYA 2I46A 5C5LA 4L8JA 4OX9Q 4KD3A 3I4LA 3CCMA 3HOVH 1EFID 2VQFQ 4DK6C 3HOYG 1G6PA 4S3SA 1JB3A 2NZ1D 4K8IA 2IX1A 3HP3A 2O5IC 1LM0A 3NBIA 1B8AA 4LFAL 1NTGA 1A63A 4GLAC 3M4QA 4QF4A 2GVAA 3OW2A 3NENA 2JP1A 2DN8A 4A3IH 1VQBA 1VQCA 4C3JG 1E7ZA 1N36Q 1FGBD 1U4RA 2OT2A 1H95A 1VQ8A 3P1HA 2Z0SA 2NVTB 1NCVA 2UUCQ 1LABA 1C8CA 5KNCA 5IT9c 3JAMi 2UXCQ 4DUZL 3HKZE 1Z9FA 2M00A 4P71A 1BKBA 2GN5A 1T9HA 2EY1A 1WTWA 2PYKA 1Z6HA 4HN7A 3TQYA 4A93B 1K8OA 5C4JH 2B8FA 4RKBA 4MN3A 1E2ZA 3M4YA 5ELFA 1HRJA 1PRTB 5IP7G 2SEBD 1AZPA 1ASZA 1SYBA 5KEEA 1LTBD 4JI0L 3T16A 1TS3A 1EIHA 2ZJQA 3D0FA 2E74C 1WVLA 2NVQH 2A6ED 1Q7YC 3UDFA 4X65L 3I72A 1PV4A 2F0IA 3BJUA 4LFAQ 3TBIB 1AZQA 3LGJA 2PI2A 4LF9Q 1S72A 3A56A 3TREA 4HEDA 4LF7L 4PZ7A 1SBBB 2HQEA 2XN9C 1TU2B 3I91A 4IJLA 3RNUA 1PYSB 5FK9C 3Q23A 5FLMG 5BN5A 2K03A 2A69D 3FKIH 4DUZQ 1SFOH 4HCEA 4IUVA 2PNHA 4A3GH 5BN4A 1SNQA 4ILWA 4A3IG 5EPJA 4IO9A 3GTKB 4JK1C 3CXCA 1PH3A 2MNAA 2B2YC 3IFDA 1EIYB 1F2ZA 2ASBA 2IHEA 5C6AA 3LWEA 2FMCA 2F0FA 1QVCA 3T53B 1IKMA 2B29A 2D0PA 1F9RA 1NAPA 2L9HA 2JJQA 3F2CA 2Q2TA 1RJTA 1IL8A 2JA7B 3L9AX 2F52A 4X65Q 4ABNA 4JI2L 2I5HA 4L63B 5GADC 1O7LA 2HDMA 3TP6A 4O1NA 4I7AA 3TP8A 4A3BH 3MTSA 1IZ6A 4ZQ3A 1I5FA 2A68C 2Z1CA 4IPDA 3VA7A 3OIQA 3QR8A 4LF7Q 4IPCA 1U5KA 2JA8G 3NEMA 1Y1VH 2B2WC 2PO4A 3PUVA 1XTCD 4JBWA 1OO9B 4NB3A 3QOLA 1B3QA 4K6LA 2MFIA 1MD2D 2RDGA 4RGNA 3VA5A 4P72A 5M5WH 1TXYA 4LAAA 4JI6L 1WCMH 2R92H 1YJNA 4BY7H 4IOAA 1L1OC 3U4ZA 1LACA 3OPOA 1NY4A 1HR0L 1VS0A 4BA2I 1S40A 3BDCA 3QWNA 2QDBA 1HZ9A 1DJRD 4ZK9B 1JWMD 2PPBC 1B50A 4ZYSA 1G8ZD 2ICIA 1VQKA 3QB3A 1SJHD 2AUJD 3H3VC 1STHA 4X6AH 4QCLA 4JCVE 3PCOB 1V8QA 4EQOA 1PZID 2B39A 3C1FA 3RLFA 2VS1A 3URYA 2RSNA 4K5WA 3JAML 4ZKCB 4X3UA 1BCPC 1I4GA 4YWLA 2K14A 4BXXH 1KDBA 4XYOA 3IKJA 1MI2A 5IGBA 3MFYA 3S1RH 1HR0W 1S5DD 1JR0D 4RGTA 3HOXB 5FOBB 4DV5Q 2NVQB 4A3BG 5FLXc 2A73B 1I4XA 2F0QA 3FPUB 4GKJQ 4JI6Q 2KUMA 2YTYA 2HDLA 2LFNA 2KOLA 4CJ1B 1YNJD 4CJ2C 2L5TA 4RA8A 4DUYL 1HR0Q 1DGSA 1ESRA 4BBSB 4BY1H 2BE5D 2EYHA 1K8AC 3MEFA 3NQIA 1WTPA 2D62A 2ID0A 2F0HA 2KVMA 4H0LC 1A3UA 3S2HH 1BXTA 3FRPB 1PLFA 3KBXA 1J5EL 3EBEA 1UNSA 2BDOA 1X3QA 2K7VA 3J7YW 1FNWA 3FKIB 1SFOB 2R92G 3J81i 1H9SA 4A3GB 5C0XG 4KLKA 4PV1C 4DKAC 4X64L 4DR2Q 4ZRZA 3E3XA 4FDBA 5D3IB 3AMUA 1V1PA 3H0GH 1V9PA 1N32L 1M8AA 4HIOA 2R7FA 2B63G 1TT2A 2PW5A 4Y7NH 3GTMH 2K32A 1S3OA 2OEOA 1CT1D 2JYOA 2JEBI 2L0CA 1YHBA 2DJGC 1ENFA 4JBKA 3I4MB 5JJZA 4GNXB 2L12A 4DAMA 4GS3A 3MA2B 2DNEA 2WFWA 2Z4HA 1EYGA 1IL2A 5KGUA 1I6HB 1X3GA 4GZYC 4OIKA 1I4PA 1EY4A 4FXKC 4YCWA 5DM63 2VY3A 3N6RA 1C0AA 3SEBA 2IY5B 3W5OA 4A3DG 4DF7A 4A3MG 2UU9Q 1WTOA 3D4RA 1B44D 3CP0A 2TMPA 1AFPA 3K81C 4K8JA 2X69A 2EY2A 3T1YL 1NSNS 2PNRC 2WAQE 5M5WB 2AKWB 2NBFA 3UE0A 3I70A 3MC0B 4X64Q 4KHVA 2EQSA 1F2YA 5HGQA 4KK7A 1K73C 4JBMA 5IE8A 4QGUA 1G2TA 2EJMA 3WDNA 2CHBD 1HZCA 5I2XA 4C3HH 5I4DA 5HY6A 4DAYB 3DWPA 3R8BA 4PZ8A 1PDQA 5IGFA 2EDGA 3CW2C 1AW7A 4KD4A 5IYCH 1HTPA 5CV9A 1HPCA 2X6GA 3CPWA 3OSOA 3PO3H 5AFWA 5EPKA 2WV6D 5C3EB 3BVGA 2CVRA 2ZXPA 4XYQA 3RR5A 4A3CG 4F88A 2QDLA 2NZHA 3CQZB 3CCVA 4APVA 3W2DA 1HHVA 1X3EA 5J22A 1KHIA 3J80c 4QY7A 2UXDL 2G9DA 2VUMH 2M2LA 4DNIA 1B9NA 2CQAA 2WB1B 4LF8Q 3TN2A 3T1YQ 3MXPA 2AWNA 2F0MA 2MPMA 5JJLA 2RCNA 3BYYB 1S5FD 1YNXA 2SDFA 2RBMA 3OWEB 4L5SA 2F0SA 2H4OA 3EIVA 3MXNA 2ZXOA 2JSOA 1GHKA 3NBHB 2IX0A 3D4WA 1N34L 4R1JA 1B4OA 4B3TL 3H94A 3SK5A 1E24A 3O13A 5A2QL 3CHBD 3G7LA 3I2ZA 3PUXA 1JICA 3PUZA 2MP1A 2EYMA 4CKEA 1I50H 2QGQA 3HZXA 4F7XA 4KTAA 4H7BA 1HNWL 1DONA 5BR8Q 4KV6A 3D4DA 4MTNA 4V0BA 5F2DA 5LL6S 4OEMB 2NB0A 4LMQD 2OWOA 1EY9A 1K3RA 3VR2A 1GUWA 3V2TA 2RHQB 3TZDA 4OL7A 5I9OA 4Z9CB 1IXRA 2ES2A 3TP7A 5IYCG 2UXDQ 2FXQA 5DNFA 1LUZA 5C4XB 3NWSA 4DN4M 3OHXC 1EWHA 1NUCA 3CPFA 5IP9G 1B53A 4OIJA 4NKLA 3UDXA 4A4IA 2SNMA 4A3JH 3HOWB 2G5DA 4ID6A 5FLXL 4DPGA 3GTGB 3L7ZC 1YHAA 5ELEA 3NWTA 4DK1A 5FKAC 1N34Q 1DM0B 4B3RQ 3ER0A 3F8TA 4FF4A 4DR1Q 4B3TQ 3NXWA 4C3IB 2CWAA 1ZEQX 3J7ZC 2DY7A 1VQ5A 4A3KB 2D9UA 3M7GA 3NELA 1I3QB 1SNDA 2KJXA 3MXNB 4BBRG 1K83H 3KLSX 4GN5A 2F0EA 1Q12A 3DM3A 1QG7A 4OO1G 4KMUC 1Y1WH 2EXDA 1TWHB 4BA1I 4B9XA 5C0XI 3FHWA 2PQEA 5M3FG 2UUAQ 1EL0A 4EQNA 4DXFA 3WOEA 4C3HB 4CDDC 4JI4Q 4IQZA 4N9PA 4OWXB 1IHZA 1FJGQ 1KRSA 2F0NA 1EEID 3OMGA 1TVXA 2O2LD 1ENCA 2A68D 4XQQA 1QVGA 1JB7A 2C9OA 4U68A 2YV5A 4J1MA 1EQTA 3PO3B 5CR3A 1XMQQ 4ZKBB 2ENBA 2KCMA 1K0RA 4KY7A 3U50C 1E2VA 1LTTD 2L11A 2JA5G 2FMMA 5C3WA 4HTHA 4WJ4A 4ODGA 2R7ZG 5C5MA 4JV5L 5EBDA 1HJPA 2A19A 4IUTA 5C44B 1KAAA 3OTOL 4JI3L 3FP9A 1CQVA 2ZTCA 3WWVA 2E2DC 4AH6A 1VF5C 2XWBB 3M85A 1HNXQ 4LFCL 2KHJA 4LF4L 5I6WA 2MO0A 4DV1Q 5IYDH 4N9TA 1PTOB 3SXHA 3KJOA 1JWSD 3HKZG 3ITPA 3VYSA 1Q90A 3A54A 3BU2A 4IOCA 1EQRA 4PQXA 5EAYA 1EU4A 2F4IA 1SNPA 4YY3L 4R4QA 1GUOA 1OXVA 2FJ2A 1BCPF 3M4PA 4DR7Q 3HKSA 3R2TA 1DOKA 5CORA 4HMIA 4N8FA 3MFGA 1KLUD 4LW1A 1KABA 4L5QA 1A2TA 1BCPD 1MBYA 4DR5L 1Y1WG 3HOYH 1EIFA 1I50B 2NWGA 1HUNA 2RVLA 3BVZA 2K04A 1WJJA 4NDXA 4K2KA 1PFNA 1U4LA 3BDOA 1OXUA 4JV5Q 4A3FG 4RGMA 4F8MA 3SK8A 3OTOQ 4C3JH 5IGGA 5IWAL 3F2UA 1E3PA 1R4PB 2VQFL 5LHY1 1SNCA 3Q0AA 1SYDA 4JYAL 2QA4A 1FVIA 5IGCA 3KFUA 4A3JB 3U9OA 3M3YH 2CFMA 1TS5A 3HS0C 1QILA 1SJED 1N36L 3HOUB 3K5OA 4KHZA 1PH7A 2O4XA 1E0BA 3F2BA 5IP7H 4KKTA 3G6JB 1SYGA 1PH9A 1CA5A 2F0VA 2VNUD 2YU9B 3JAMc 4DR5Q 3QOJA 3K8AA 3A5ZB 5EKKA 4DV3Q 3HGBA 1DZ1A 3ULPA 4AIMA 3BZDB 4B9WA 1CI3M 4GOPB 1E1TA 4UDUC 4TRDA 3H15A 1WTVA 3R2IA 5M5YH 1G291 2NVYH 4OONA 5IWAQ 1KLGD 3K5LA 1JJ2A 3U9SA 3I7FA 4JOIA 4CGYB 3VYRA 1HQMC 4JYAQ 5FLMH 3ERSX 4A3LG 1PH8A 3S2DB 1HA6A 3S1NH 5EKLA 4LF9L 1YZ6A 4A3EB 3EVQA 1I6VC 2OXPA 3CF5A 4FO2A 3HRZC 3X3NA 4DR4Q 2KQ3A 2KEEA 1OXTA 3A7AB 4K5XA 2HUGA 1UUPA 1VQIA 4LJZC 4YWKA 2R7DA 1TWCH 2E75C 2B3GA 2Z4IA 3CCQA 1I4RA 3C46A 4LK1C 4TQUS 2F03A 2E2HB 1VDZA 3CCSA 3I90A 2SNSA 4K14A 1YVCA 2Q2UA 3CCEA 4OO1I 4HMJA 1B2TA 1J6QA 3QO2A 3J81j 1K3BC 1WI5A 3PIO3 3S24A 2JA8H 3STBC 1FNVA 4GKKQ 4DK0A 2A1AA 4IJHA 3GTLB 5EJWA 2K4KA 3PIPA 3HOYB 4DK3C 2NN6G 4UP7A 2F0DA 1XTDA 1KNAA 1XX8A 2WINB 1LTRD 1VF7A 2J4XA 1W2BA 1KTKA 2H5XA 2CWPA 3KOJA 3GTJH 1KD1C 3DWAA 1PH2A 4R4OA 3I4NG 3J81E 2CH4W 3MZ5A 5ELBA 1HZAA 1D1IA 2PMZB 1R9TB 2OQ0A 2NVXH 1O78A 3H91A 2X6LA 2XVSA 3PUYA 4DV4Q 1IYUA 1IYJB 4LF5L 2MJ8A 4QIWB 3BS1A 3H3VI 3A8IE 5IY0A 5GROA 1A3TA 4NXNQ 4WORA 4PMBA 4MZ9A 1W6JA 1QE6A 1D1KA 4XT3B 1M90C 2HT1A 4DV7L 3K7UC 3OW7A 2JE6I 4R8NA 3T1HL 3X3MA 1A2UA 3LX0A 4DV2Q 3AB9A 3K57A 2R61A 3GDEA 1BBWA 3EA6A 1PTOC 4DNTB 3AFQA 2CCZA 5ELCA 1PFMA 5M5YB 4P75A 5CV4A 4CJ0B 1IW7C 2ZTDA 2NZOA 3GTPH 3HOVB 1WFQA 3BG3A 4DV5L 4Y52H 5GAEC 2B2TA 1I94L 2KA7A 1X3FA 3K7AH 5JOBA 4GKJL 3DXJC 2AUKA 3VR3A 4FXGC 1ILPA 2WAQG 2C5CA 3CKIB 4DA2A 1O7IA 5J39A 1WYDA 5C0XH 4A3IB 4LF5Q 3HOXG 2IW3A 1FR3A 3TMEA 5ELNA 5KYIA 1NBWA 2B63H 2E2IH 1I4HA 5M3MH 1VQ7A 1LTLA 2KCCA 2WACA 4DV7Q 4QQBX 4FYDA 1LT6D 4JBJA 3T1HQ 3M9BA 1ICWA 3A7LA 5M5XH 4BBSG 1CKNB 3CRKC 3S14H 4DR2L 1TKWB 2XGTA 4Q0FA 3I8ZA 4GNXA 3U58A 4WJ3M 1SDFA 5C4JB 2EZVA 4LUOA 2LMCB 4PNYA 5ISRA 3TEHB 4IUUA 2ZJRA 1GM5A 3VYTA 1O80A 1ZXTA 1LT4D 3WOFA 1LT3D 1Q3LA 4J6HA 4A3DH 3CCRA 1W6KA 2JA8B 4XIGS 4A3MH 4UPAA 1GJXA 1I94Q 3OMCA 1U0LA 1Y69U 4DV0L 3KLRA 4EVOA 5KYLA 3E5SA 1SYFA 1S5BD 3K59A 3PV0A 4DV6Q 3A8KE 1KAWA 4DFAA 4P74A 2G9HD 3I4MG 1ZYRC 1AP0A 4HJ8A 5IGDA 1O7YA 3C2PA 3E0EA 2EY5A 2UU9L 5IGEA 3CRLC 2EYJA 2AQ3B 5C4ZA 1JOOA 3CCJA 4DR3Q 4DAYA 1UEBA 1VQJA 2ZM6Q 3NTHA 2F4VL 1XMOQ 1QZHA 2IHFA 2D2CC 5CMDA 2PI2E 4CKBA 4HJ7A 3ZYYX 3CC7A 2KCTA 3W1GA 1D5MC 1KNEA 5M3MG 3TDQA 1CM9A 3E9HA 3R93A 4A3CH 1QNKA 2Q8TA 4LUZA 2JA9A 2K05A 1BBUA 3RD4A 1PHJA 4HSVA 3CU7A 5J1ZA 4ZUIA 1STNA 1QOHA 1NNXA 5FO9B 2EXZA 4DV0Q 1BVSA 1VCIA 2JN4A 2IJ0A 1Q8KA 3GD7A 2HIXA 1MJCA 4A3BB 2P5ZX 4MNOA 4RMFA 3HOZH 5CBAE 2MO1A 2MGSA 2NN6I 5CV6A 4DAPA 4IFDG 5C0XJ 1Y1VB 3NHHA 1PRTC 2IT1A 5C3EG 3NBHA 3GTPB 3FEWX 2CKZB 2KCNA 3GO5A 1EY0A 4LF8L 3OOCA 2LXJA 2BH8A 2MQHA 1UAPA 1ASYA 5HGTA 2F4VQ 1YI2A 3GP7A 4OELB 1WCMB 5H1SE 3A5UA 1IBLL 3FVQA 2R92B 4BY7B 1N8RC 1J9OA 1N33L 2Z9HA 5JVG3 5IYBG 4HIKA 4OWTB 1ML0D 4IUNA 1F9QA 1NMFA 5D14A 4JI5Q 2E2IB 1PFBA 4JOIC 4JVZA 1TWAH 1H9KA 3A0JA 3KF6A 2ALYB 1EEFD 5CV7A 3S1MH 1YJWA 2L15A 1HNZQ 1UE5A 1L2FA 4NPSA 2K5NA 1KIXA 5J3BA 5BR8L 1HUMA 3S14B 3DHQA 3S9WA 3KBGA 5IP9H 1DD2A 1G6ZA 1C9OA 2F0PA 2QEJC 3VR4A 1IKLA 5CBEE 4C2MH 2F0TA 4YWMA 4EQPA 3L2PA 3BYTB 2JA6H 3S1RB 2O5JC 1CQFA 2BA0A 1AH9A 1K9MC 1GD7A 1ESFA 2K1BA 3SK4A 3HOZG 2R93G 3UDGA 2KBNA 2DGYA 2EIFA 4BBRH 3RZDH 1J8IA 1IBLQ 2PZWA 5CV5A 1D7QA 3UE1A 3T56B 5C4XG 4OO1H 1N33Q 2I07B 3K0YA 4WRDA 1FD7D 4B3RL 2B2VA 4N8X1 4BY1B 3A74A 4DR1L 3PO2G 2UXBQ 3K5NA 5M3FH 1IYVA 5GAGC 1NMGA 3S2HB 2IPKD 3HOWG 3BDLA 3GQBA 1B3AA 1Y8PB 4R4IA 2KENA 2AQ1B 2L55A 2R3ZA 3PMFA 4EQ5A 4HR7B 2FFKB 1FNUA 2K5WA 2Y0SB 2L4NA 4C3IG 1KXLA 2VZAA 4JW0A 2QEXA 3B6YA 1EYCA 3H0GB 3C3LA 3TS2A 1FL0A 3STBD 4A3KG 2UUAL 2JA5H 2MUYA 1OXXK 1YNNC 3KF6B 3J81L 4Y7NB 3U4VA 2R7ZH 3GTMB 4JG2A 2XSCA 1VQLA 1XJVA 4JI4L 1K8MA 2EE1A 1FJGL 2VXWA 1LYLA 1VQEA 4NP5A 2WKCA 3CD6A 1K0SA 1VMCA 3SE0A 4GN4B 1XMQL 4JI1L 2RDFA 1XPRA 4AYBB 1AE3A 3P7JA 2B2YA 1G51A 3J80i 5FJ8H 3EN2A 5JEAG 3H3VH 1JE5A 1SNMA 3KK7A 2JA6G 3Q22A 1JJCB 2XNAC 4KKSA 1HNXL 1D6EC 2ZXRA 1AEXA 2ATWA 4O42A 4UY8C 1YHQA 3CMEA 3DLLA 4DV1L 1QCBD 1SROA 3TRZA 2QF7A 3S16H 5C44G 5I9PA 5K5PA 1GKHA 2BA1A 2XTIA 2LKVA 3T13A 2WB1E 1P16A 4FP5D 2RCFA 1PTOF 2EYFA 1PZKD 1HCZA 5C3XA 2EYLA 4A3FH 4DR7L 4KI0A 2B2TC 1PTOD 1TWAB 3D6CA 4X3TA 5KRUA 1A62A 1STEA 2A6HC 2HCCA 3HFZB 3K80C 1SMXA 3J7A5 3S1MB 1PXUA 1DCZA 3K5MA 4JI1Q 1UWVA 2K5HA 2HCIA 1GUGA 4JI8L 1IW7D 3KUPA 4RG1A 5EQ0A 1X6OA 5M9OA 4X62Q 1XWEA 1OXSC 2Y0SE 1K8GA 4V190 1CZWA 4C2MB 4LFBQ 4LUVA 1SR3A 1P8LA 1HFNA 2E5LL 4IFDI 1HTLD 2VUMB 1A15A 2XIWA 2OCEA 1K28A 3FMCA 1MIUA 4GNXC 2N3SA 1ZKOA 1B7YB 5FJ8G 3KLWA 4DGZA 5D65A 1D5XC 1Q8IA 4BBRB 3GTOH 4P73A 4FF2A 4ZUJA 2N49A 4DR6L 1TQOA 4ALPA 1U9RA 1XNRL 1H9MA 1DOMA 1RF2D 4A75A 3TZUA 1N9WA 4GOPA 3MVVA 4EX5A 1TWGH 3VDYA 3S15H 3V96A 1NJIC 1TY2A 1Z7TA 4DU9A 1LT5D 1XXGA 2I5LX 4POGA 4RHSA 3HOUG 3CCUA 4DV3L 1WD1A 4JI8Q 4XQNA 4A3LH 2FHTA 4IALA 1XYIA 2VQEQ 2N88A 3K0XA 4YHHL 2WKDA 2IL8A 4HJ5A 3NK9A 4K0KL 2B8GA 3T4AC 2E5LQ 1S5ED 1F77A 3PF4A 3DEPA 3PUWA 1L1OB 2F0JA 5LMUQ 1PFSA 1SE4A 1ZYRD 1B9MA 3ERQA 1X65A 3W1BA 1QB5D 3TP5A 4C1NI 3ND8A 2OQKA 3Q8DA 4P2CB 5IT9E 4XT1B 4R4CA 4J8QA 3W3AA 2LY7A 4DR6Q 2QILA 3H09A 4DR4L 5NUCA
chains in the Genus database with same CATH topology
5FO7B 2F1MA 4MHEA 5BN3A 1PYWD 2M9VA 2CW0C 1RHPA 3DEOA 1BCPB 3S16B 2OF1A 1K83B 3MXUA 4G7OC 4DNRB 1BR9A 1EY6A 3P75A 1Y1WB 1RCVD 2NN6H 1RTNA 1VMPA 3EFXD 3TSSA 4A3FB 4EGVA 4QMGA 1LTGD 1PRTF 4C1NK 2WIIB 1JCKB 5I6YA 1PRTD 5KNBA 3J7AV 1MSHA 4FNFA 1WTRA 4PMWA 4K5VA 1JWUD 4ULLA 3EROA 5IODA 2F3WA 1II3A 1T5EA 1BOSA 1EY5A 2B2UA 3MXGA 1JOKA 5DM73 2PZUA 2QKIC 2RA4A 3D3RA 5E3FA 4RFBA 1B1ZA 3GTOB 1Y8NB 2ICEC 4XQJA 3A8JE 3N52A 1RKNA 4ME5A 3NPPA 1NR4A 4I7ZC 4BWGB 2XRQD 1TY0A 1EYAA 1TWGB 5EGTA 3S15B 1DYQA 3EQLC 1UEAB 1LO5D 1ONLA 2J7ZA 4KKUA 5K36G 2JEAI 4G57A 2RQXA 3BVMA 2QCPX 5NUCA 5E4XA 3MAQA 5CC4A 2B2VC 5LL6X 3DMUA 4K6DA 1STGA 3VR6A 1ET6A 4C3JB 3Q24A 1SSOA 1TS4A 1WD0A 4QUCA 2F0LA 5A2QE 1GHJA 3IL8A 5JVH3 2RSOA 1ENAA 1I4QA 1BDOA 1EZ8A 3M3YB 3GV6A 3EJIA 1JOQA 5D3DA 3M7NA 5A35A 5DEHA 4QUFA 2ZT9C 3AU7A 3DWQA 1GUNA 3V05A 4G4KA 3T51B 1BBXC 2JXMB 1RTOA 1YNND 2EJGC 1S5CD 1V1OA 3SK6A 1DOLA 3SVMA 5IOCA 2XWJB 4DXGA 1EU3A 4KJNA 5FLXE 4NW2A 3LWUA 4TSSA 4C56C 2NVYB 3MHBA 1SAPA 3D6WA 1JE4A 1TIID 5KIXA 3I4NB 1D2BA 3P20A 1CZGA 3S1NB 4RKLA 3Q6SA 1STAA 2NYZD 3NQTA 3GTQB 1TWCB 3DUZA 3L3OC 2EPBA 4KN4C 3IFTA 4FVMA 2VB2X 1BUVT 1HXYD 2RDHA 4CHTB 3OIPA 4M1UB 4XXEA 1L0YB 3IAYA 2A6HD 1QNUA 3E0JA 4IFDH 1JORA 3LNNA 4CKCA 1X32A 4IURA 1SMYD 4HSPA 1AN8A 5E1FA 5T1GA 1E2WA 1LV9A 2EVBA 2BOSA 1Q1BA 4H44C 2MHVA 4H13C 1C48A 1LTSD 2WAQB 3HG9A 1F2LA 5CYUA 3GTJB 4RHRA 2E76C 2DY8A 3NUCA 4RCNA 4X3SA 1G91A 2K5QA 3S1QB 2WP8J 2NUCA 1V43A 2VB3X 2NVXB 1TS2A 1F2MA 4B08A 1S4ZA 3FPPA 1STBA 1TR5A 2L1BA 5KNDA 4HAEA 3H6MA 5TSSA 1BQQT 1EOTA 4KN7C 2NTTA 2XRSD 1R4QB 1CHPD 1SE2A 2KHSA 5IT9L 3J7AF 1SNOA 1SYCA 1H9RA 3J80E 1EY8A 5C4HA 2IX3A 4RGOS 1X3PA 5FO8B 4E6IA 3NE5B 3NTKA 2Z8LA 1G2SA 1U4MA 4FF3A 1WTXA 2H1EA 4WJWA 3VYUA 4IZ8A 3K7AB 1F9PA 3HEJA 2CW0D 3PIP3 1H9JA 2EOTA 3KLSA 3OWFA 2B63B 5M3MB 5IIFA 4RWSC 1RDPD 2BCOA 4IFDJ 1EWCA 1FYCA 2F0KA 5E4WC 5M5XB 1HFGA 2GA4B 3I73A 2Q8IB 2EJFC 3VR5A 1L0XB 4RH6A 2YYZA 3K6OA 1H9SB 5JEAH 1PZJD 3C1EA 1V1PB 2B2UC 4PMCA 4A3DB 4WFN3 4A3MB 1EYDA 5ELDA 3ONAB 2A6EC 4U673 1CA6A 1JC7A 1SE3A 2PZTA 1MSGA 1PTOH 2NTSA 1O7ZA 2KEDA 1HQRD 2F0WA 4KY5A 4L6TB 4G7ZC 1Z47A 2A69C 3I3CA 4XDXA 1KDCA 1SXTA 5T1IA 4RCOA 5COYA 2V4DA 3MWYW 4XTCS 3ND9A 1GUTA 4KJOA 2LS01 1QWYA 1BO0A 1LLRD 3FDTA 1NR2A 4IN3A 1CK1A 4C3HG 2J0TD 2RKSA 3HOZB 3NP8A 2R93B 5HURA 3UI2A 4OGQC 1GXDC 2K01A 2F3VA 2BDNA 2Q8RE 2IWHA 4CBVA 4QB4A 1QJOA 4R8IA 4X3KA 3PO2B 5CGKA 4KY6A 5DAUA 2AWOA 4Q5VA 3M4OB 2AQ2B 2F0OA 1D5ZC 2EYPA 4OHJA 3GV3A 1LTAD 1M4VA 1A6XA 2K28A 1EIGA 2B2WA 3D31A 2EYOA 1PMRA 2SOBA 5JEAJ 4F87A 3RZOB 3MEHA 4I65A 4UAIA 2K6AA 2FINB 5JPNC 1SMYC 1EQVA 3QG1A 1EY7A 1EZ6A 5I2YA 4RAUC 4FF1A 3S17B 1F9SA 5EPLA 2JA6B 2F0GA 1ET9A 5JAVA 3RZDB 4G7HC 2K5DA 1YNJC 3JAME 1T5XD 5EKIA 4FXDA 1GOZA 4NMZA 5M3FB 2BE5C 3QIAA 1CFMA 3SDZA 2KECA 1SEBD 3SR1A 3D8GA 1Y8OB 4YIJA 2N55A 5G3LF 1LTID 3NSWA 1KDAA 3K58A 5G3LD 2E2JB 2JA5B 2PCFB 4IUPA 4ZAIA 1GUSA 2EY6A 2R7ZB 5JPMC 2PW7A 1SYEA 1JQYD 2A74C 2DNCA 1RD9D 2F0UA 3NTIA 1RODA 4BS9A 2A5HA 1Q1EA 3A55A 4M8AA 1C4QA 3DM1A 1CHQD 3SHLA 3HKZB 3R3OA 4MIUA 1U4PA 4IUQA 5CV8A 1HA5A 4HCSA 1MGSA 3J80L 2R6GA 3E6ZX 2K33A 1WTQA 3RUZA 1DXMA 3QJYA 2TSSA 1TWFB 5K36H 2D5DA 1BNZA 3KF8A 4DAVA 1BF4A 1CTMA 1A3VA 4K2LA 1ILQA 5EBCA 4TKOB 4R9WA 4ZLTF 1STYA 2I46A 5C5LA 4L8JA 4KD3A 3I4LA 1EFID 4S3SA 1JB3A 2NZ1D 4K8IA 2IX1A 3HP3A 2O5IC 3NBIA 4QF4A 2JP1A 2DN8A 4C3JG 1FGBD 1U4RA 2OT2A 3P1HA 2NVTB 1NCVA 1LABA 1C8CA 5KNCA 2M00A 2EY1A 1WTWA 2PYKA 1Z6HA 4HN7A 4A93B 1K8OA 2B8FA 4RKBA 4MN3A 1E2ZA 3M4YA 5ELFA 1HRJA 1PRTB 2SEBD 1AZPA 1SYBA 5KEEA 1LTBD 3T16A 1TS3A 1EIHA 2E74C 1WVLA 2A6ED 3I72A 2F0IA 3TBIB 1AZQA 3A56A 4HEDA 1SBBB 2HQEA 2XN9C 1TU2B 3I91A 5FK9C 3Q23A 5BN5A 2K03A 2A69D 4HCEA 4IUVA 5BN4A 1SNQA 4ILWA 5EPJA 3GTKB 4JK1C 2B2YC 3IFDA 1F2ZA 5C6AA 3LWEA 2FMCA 2F0FA 3T53B 1IKMA 1F9RA 1NAPA 2L9HA 1RJTA 1IL8A 2JA7B 3L9AX 4ABNA 4L63B 1O7LA 2HDMA 3TP6A 4O1NA 3TP8A 3MTSA 4ZQ3A 2A68C 3VA7A 2Z1CA 3OIQA 2B2WC 2PO4A 3PUVA 1XTCD 4JBWA 1OO9B 3QOLA 4K6LA 1MD2D 2RDGA 4RGNA 3VA5A 4LAAA 1LACA 3OPOA 4BA2I 3BDCA 3QWNA 2QDBA 4ZK9B 1DJRD 1JWMD 2PPBC 1B50A 4ZYSA 1G8ZD 2ICIA 3QB3A 1SJHD 2AUJD 3H3VC 1STHA 4QCLA 1V8QA 4EQOA 1PZID 2B39A 3C1FA 3RLFA 3URYA 2RSNA 4K5WA 3JAML 4ZKCB 4X3UA 1BCPC 1I4GA 1KDBA 4XYOA 3IKJA 1MI2A 5IGBA 3MFYA 1S5DD 1JR0D 4RGTA 3HOXB 5FOBB 2NVQB 2A73B 1I4XA 2F0QA 3FPUB 2KUMA 2HDLA 2LFNA 2KOLA 4CJ1B 1YNJD 4CJ2C 2L5TA 4RA8A 1ESRA 4BBSB 2BE5D 2EYHA 1WTPA 3NQIA 2D62A 2ID0A 2F0HA 2KVMA 4H0LC 1A3UA 1BXTA 3FRPB 1PLFA 3KBXA 1UNSA 2BDOA 1X3QA 2K7VA 3J7YW 1FNWA 3FKIB 1SFOB 1H9SA 4A3GB 5C0XG 4PV1C 4ZRZA 5D3IB 3AMUA 1V1PA 1M8AA 1TT2A 2PW5A 2K32A 2OEOA 1CT1D 2JYOA 2JEBI 2L0CA 1ENFA 3I4MB 5JJZA 2L12A 3MA2B 2DNEA 2Z4HA 5KGUA 1I6HB 4GZYC 4OIKA 1I4PA 1EY4A 4FXKC 5DM63 3N6RA 3SEBA 4DF7A 1WTOA 3D4RA 1B44D 2TMPA 1AFPA 4K8JA 2X69A 2EY2A 1NSNS 2PNRC 5M5WB 2NBFA 3I70A 3MC0B 4KHVA 1F2YA 4KK7A 1G2TA 2EJMA 3WDNA 2CHBD 5I2XA 5I4DA 3DWPA 3R8BA 1PDQA 5IGFA 2EDGA 1AW7A 4KD4A 1HTPA 5CV9A 1HPCA 2X6GA 3OSOA 5AFWA 5EPKA 2WV6D 5C3EB 3BVGA 2CVRA 2ZXPA 4XYQA 4F88A 3CQZB 3W2DA 1HHVA 5J22A 2G9DA 2M2LA 1B9NA 2CQAA 2WB1B 3TN2A 3MXPA 2AWNA 2F0MA 2MPMA 3BYYB 1S5FD 2SDFA 3OWEB 2RBMA 2F0SA 2H4OA 3MXNA 2ZXOA 2JSOA 1GHKA 2IX0A 3D4WA 1B4OA 3H94A 3SK5A 3O13A 5A2QL 3CHBD 3G7LA 3PUXA 1JICA 3PUZA 2MP1A 2EYMA 4CKEA 3HZXA 4F7XA 4KTAA 4H7BA 1DONA 4KV6A 3D4DA 4V0BA 5F2DA 5LL6S 2NB0A 4LMQD 1EY9A 3VR2A 1GUWA 3V2TA 3TZDA 4OL7A 5I9OA 4Z9CB 3TP7A 5DNFA 5C4XB 3NWSA 4DN4M 3OHXC 1EWHA 1NUCA 1B53A 4OIJA 4NKLA 2SNMA 3HOWB 4ID6A 5FLXL 3GTGB 3L7ZC 5ELEA 3NWTA 4DK1A 5FKAC 1DM0B 4FF4A 3NXWA 4C3IB 1ZEQX 2DY7A 4A3KB 2D9UA 3M7GA 1I3QB 1SNDA 2KJXA 3KLSX 2F0EA 1Q12A 1QG7A 4OO1G 4KMUC 4BA1I 1TWHB 4B9XA 5C0XI 2PQEA 1EL0A 4EQNA 4DXFA 3WOEA 4C3HB 4IQZA 4N9PA 1IHZA 2F0NA 1EEID 3OMGA 1TVXA 2O2LD 1ENCA 2A68D 4XQQA 2C9OA 4U68A 4J1MA 1EQTA 3PO3B 5CR3A 4ZKBB 2ENBA 4KY7A 1E2VA 1LTTD 2L11A 2FMMA 5C3WA 4HTHA 4ODGA 5C5MA 5EBDA 4IUTA 5C44B 1KAAA 1CQVA 2E2DC 1VF5C 2XWBB 3M85A 5I6WA 4N9TA 1PTOB 3SXHA 1JWSD 3ITPA 3VYSA 1Q90A 3A54A 4PQXA 1EU4A 2F4IA 1SNPA 1GUOA 1OXVA 2FJ2A 1BCPF 3R2TA 1DOKA 5CORA 4HMIA 3MFGA 1KLUD 1KABA 1A2TA 1BCPD 1MBYA 1I50B 2NWGA 1HUNA 2RVLA 3BVZA 2K04A 4NDXA 4K2KA 1PFNA 1U4LA 3BDOA 1OXUA 4RGMA 4F8MA 3SK8A 5IGGA 3F2UA 1R4PB 5LHY1 1SNCA 3Q0AA 1SYDA 5IGCA 4A3JB 3U9OA 1TS5A 3HS0C 1QILA 1SJED 3HOUB 3K5OA 4KHZA 2O4XA 1E0BA 4KKTA 3G6JB 1SYGA 1CA5A 2F0VA 2VNUD 2YU9B 3QOJA 5EKKA 3HGBA 1DZ1A 4B9WA 3BZDB 1CI3M 4UDUC 4TRDA 1WTVA 3R2IA 1G291 1KLGD 3K5LA 3U9SA 4CGYB 3VYRA 1HQMC 3S2DB 1HA6A 5EKLA 4A3EB 3EVQA 1I6VC 2OXPA 4FO2A 3HRZC 3X3NA 2KQ3A 2KEEA 1OXTA 3A7AB 4K5XA 2HUGA 1UUPA 4LJZC 2E75C 2Z4IA 1I4RA 3C46A 4LK1C 4TQUS 2F03A 2E2HB 1VDZA 3I90A 2SNSA 4K14A 4OO1I 4HMJA 1B2TA 3QO2A 3PIO3 1FNVA 4DK0A 3GTLB 5EJWA 3HOYB 2NN6G 2F0DA 1KNAA 1XX8A 2WINB 1LTRD 1VF7A 2J4XA 1KTKA 3DWAA 3J81E 3MZ5A 5ELBA 2PMZB 1D1IA 1R9TB 1O78A 3H91A 2X6LA 2XVSA 3PUYA 1IYUA 2MJ8A 4QIWB 3BS1A 3A8IE 1A3TA 4WORA 4PMBA 1W6JA 1QE6A 1D1KA 4XT3B 3OW7A 2JE6I 4R8NA 3X3MA 1A2UA 3LX0A 3AB9A 3K57A 2R61A 3EA6A 1PTOC 4DNTB 5ELCA 1PFMA 5M5YB 5CV4A 4CJ0B 1IW7C 3HOVB 3BG3A 2B2TA 2KA7A 5JOBA 3DXJC 2AUKA 3VR3A 4FXGC 1ILPA 2C5CA 3CKIB 4DA2A 5J39A 5C0XH 4A3IB 2IW3A 1FR3A 3TMEA 5KYIA 1I4HA 2KCCA 4FYDA 2WACA 1LT6D 1ICWA 3A7LA 3CRKC 1TKWB 4Q0FA 3I8ZA 1SDFA 5C4JB 2EZVA 2LMCB 4PNYA 5ISRA 4IUUA 3VYTA 1O80A 1ZXTA 1LT4D 3WOFA 1LT3D 1Q3LA 4J6HA 2JA8B 1W6KA 4XIGS 1GJXA 3OMCA 1Y69U 3KLRA 4EVOA 5KYLA 3E5SA 1SYFA 1S5BD 3K59A 3PV0A 3A8KE 4DFAA 2G9HD 1ZYRC 1AP0A 5IGDA 1O7YA 3C2PA 2EY5A 5IGEA 3CRLC 2EYJA 2AQ3B 5C4ZA 1JOOA 4DAYA 3NTHA 2D2CC 5CMDA 4CKBA 3ZYYX 1D5MC 1KNEA 3TDQA 1CM9A 3R93A 1QNKA 2Q8TA 2K05A 3RD4A 4HSVA 3CU7A 5J1ZA 4ZUIA 1STNA 1QOHA 5FO9B 2EXZA 1VCIA 2IJ0A 3GD7A 4A3BB 5CBAE 2MGSA 2NN6I 5CV6A 4DAPA 4IFDG 5C0XJ 1Y1VB 3NHHA 1PRTC 2IT1A 3NBHA 3GTPB 3FEWX 2KCNA 3GO5A 1EY0A 3OOCA 1UAPA 5HGTA 3GP7A 1WCMB 3FVQA 2R92B 4BY7B 1J9OA 5JVG3 1ML0D 4IUNA 1F9QA 5D14A 2E2IB 1PFBA 1H9KA 1EEFD 5CV7A 1HUMA 3S14B 3DHQA 3S9WA 3KBGA 1DD2A 1G6ZA 2F0PA 2QEJC 3VR4A 1IKLA 5CBEE 2F0TA 4EQPA 3BYTB 3S1RB 2O5JC 1CQFA 2BA0A 1ESFA 2K1BA 3SK4A 1J8IA 2PZWA 5CV5A 3T56B 4OO1H 2I07B 3K0YA 4WRDA 1FD7D 2B2VA 4BY1B 3K5NA 1IYVA 3S2HB 2IPKD 3BDLA 3GQBA 1B3AA 1Y8PB 2R3ZA 2AQ1B 2L55A 3PMFA 4HR7B 2FFKB 1FNUA 2K5WA 2Y0SB 2L4NA 4C3IG 1EYCA 3H0GB 3C3LA 2MUYA 1OXXK 1YNNC 3J81L 4Y7NB 3GTMB 2XSCA 1K8MA 2EE1A 2VXWA 4NP5A 2WKCA 1VMCA 3SE0A 2RDFA 4AYBB 3P7JA 2B2YA 5JEAG 1SNMA 3KK7A 3Q22A 2XNAC 4KKSA 1D6EC 2ZXRA 1AEXA 4O42A 1QCBD 2QF7A 5I9PA 5K5PA 2BA1A 2LKVA 3T13A 4FP5D 1PTOF 2EYFA 1PZKD 1HCZA 5C3XA 2EYLA 4KI0A 2B2TC 1PTOD 1TWAB 3D6CA 4X3TA 5KRUA 1STEA 2A6HC 2HCCA 3S1MB 1PXUA 1DCZA 3K5MA 2HCIA 1GUGA 1IW7D 3KUPA 5EQ0A 5M9OA 1XWEA 1OXSC 4V190 4C2MB 1CZWA 1HFNA 4IFDI 1HTLD 2VUMB 1A15A 2XIWA 3FMCA 1ZKOA 4DGZA 5D65A 1D5XC 1Q8IA 4BBRB 4FF2A 4ZUJA 1TQOA 1U9RA 1H9MA 1DOMA 1RF2D 3TZUA 3MVVA 3V96A 1TY2A 1Z7TA 4DU9A 1LT5D 1XXGA 4RHSA 1WD1A 4XQNA 2FHTA 4IALA 1XYIA 2N88A 2WKDA 2IL8A 3NK9A 2B8GA 3T4AC 1S5ED 1F77A 3DEPA 3PUWA 2F0JA 1SE4A 1ZYRD 1B9MA 3ERQA 1QB5D 3TP5A 4C1NI 3ND8A 4P2CB 5IT9E 4XT1B 4J8QA 3W3AA 2LY7A 2QILA 3H09A 3RMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NCV A;  2EOT A;  2K01 A;  2JYO A;  2BDN A;  2Q8R E;  4IUP A;  1C8C A;  4ZAI A;  1QE6 A;  4XT3 B;  3G7L A;  2B2T C;  1SSO A;  1JIC A;  4MHE A;  5JJZ A;  2L12 A;  1X32 A;  4IUR A;  4R8I A;  4X3K A;  2MP1 A;  4QUC A;  4RWS C;  1WD0 A;  1RHP A;  4X3T A;  3DEO A;  2HCC A;  2K1B A;  1ROD A;  3IL8 A;  1WTW A;  5E4W C;  2RSO A;  5T1G A;  1DON A;  1HA6 A;  1HFG A;  3R93 A;  1LV9 A;  5CMD A;  2HCI A;  4OIK A;  4LMQ D;  1J8I A;  3DM1 A;  3KUP A;  1GUW A;  5EQ0 A;  4MN3 A;  3GV6 A;  3TZD A;  1HRJ A;  4ZK9 B;  3GV3 A;  1KNE A;  1PFM A;  1AZP A;  2B2V A;  1B50 A;  1CM9 A;  2FJ2 A;  1VMP A;  1RTN A;  1U4P A;  1F2L A;  2K28 A;  1QNK A;  2KEE A;  4IUQ A;  2HUG A;  2Q8T A;  1EIG A;  2B2W A;  4QUF A;  4CJ0 B;  1WTO A;  2K05 A;  4HCS A;  1EIH A;  5DNF A;  1HFN A;  1MGS A;  1DOK A;  5COR A;  4HSV A;  1WVL A;  2DY8 A;  4DN4 M;  1A15 A;  1BBX C;  1B3A A;  2B2U C;  2B2T A;  2X69 A;  2XIW A;  4X3S A;  1G91 A;  2R3Z A;  1WTQ A;  2NWG A;  2FFK B;  1HUN A;  2RVL A;  3I90 A;  1AZQ A;  3ONA B;  2K04 A;  1B53 A;  2RSN A;  1RTO A;  4OIJ A;  4UAI A;  5D65 A;  1ILP A;  2L4N A;  3SVM A;  1DOL A;  2FIN B;  1CA6 A;  4ZKC B;  1PFN A;  1U4L A;  2MGS A;  4HED A;  4X3U A;  5CBA E;  1S4Z A;  1MSH A;  1G2T A;  1WTR A;  1MSG A;  4NW2 A;  2L1B A;  1B2T A;  3I91 A;  4HAE A;  4RAU C;  3QO2 A;  1MI2 A;  1DOM A;  5T1I A;  1BNZ A;  1EOT A;  1PDQ A;  2DY7 A;  2EE1 A;  3F2U A;  1BF4 A;  1F9S A;  1SAP A;  2VXW A;  3D6W A;  2K03 A;  2D9U A;  5EPL A;  1JE4 A;  2X6G A;  1O7Z A;  2KED A;  1ICW A;  1VMC A;  4IUV A;  5EJW A;  2B2U A;  3FPU B;  5AFW A;  5EPK A;  5EPJ A;  2KUM A;  2HDL A;  1QG7 A;  2CVR A;  2KOL A;  2B2Y C;  4CJ1 B;  4CJ2 C;  2RA4 A;  3IFD A;  3I8Z A;  3P7J A;  2B2Y A;  4RA8 A;  1ILQ A;  1SDF A;  1X3P A;  3I3C A;  1WD1 A;  4R9W A;  3LWE A;  1J9O A;  1ESR A;  1KNA A;  1XX8 A;  2FHT A;  4XDX A;  4ZLT F;  1XYI A;  1EL0 A;  1HHV A;  4IUU A;  1IKM A;  1WTP A;  2N88 A;  3Q6S A;  2KVM A;  1F9R A;  1ML0 D;  1NAP A;  2L9H A;  1F9Q A;  3N52 A;  5EKI A;  1NR4 A;  1O80 A;  2IL8 A;  1PLF A;  1E0B A;  2M2L A;  1ZXT A;  1G2S A;  1PFB A;  1RJT A;  3KBX A;  1IL8 A;  1Q3L A;  5COY A;  3MWY W;  1CA5 A;  1TVX A;  1X3Q A;  1U4M A;  2EPB A;  4O42 A;  2NZ1 D;  1WTX A;  3DEP A;  3HP3 A;  2H1E A;  3TN2 A;  4U68 A;  2KEC A;  5D14 A;  5CBE E;  1EQT A;  1BO0 A;  3FDT A;  2HDM A;  2MPM A;  4ZKB B;  2J7Z A;  2N55 A;  1NR2 A;  2SDF A;  1DZ1 A;  3H91 A;  2L11 A;  3MTS A;  1HUM A;  2JP1 A;  2FMM A;  2X6L A;  1F9P A;  5E4X A;  2NYZ D;  1M8A A;  4XT1 B;  2B2V C;  1G6Z A;  2MJ8 A;  1WTV A;  1IKL A;  1U4R A;  1AP0 A;  4IUT A;  3UI2 A;  2B2W C;  1B4O A;  1O7Y A; 
#chains in the Genus database with same CATH topology
 1V1Q A;  1XNR Q;  3CC4 A;  5FO7 B;  2F1M A;  4MHE A;  5BN3 A;  1UE7 A;  1PYW D;  4ZCK A;  2M9V A;  2CW0 C;  1RHP A;  4A3E G;  3DEO A;  3GTK H;  1CSP A;  1BCP B;  3ULL A;  3PSI A;  3S16 B;  2OF1 A;  1K83 B;  3MXU A;  4G7O C;  4DNR B;  1BR9 A;  1EY6 A;  3P75 A;  1Y1W B;  1RCV D;  2OTL A;  1M1K C;  1Q46 A;  2NN6 H;  5AJ3 L;  1RTN A;  1VMP A;  3EFX D;  3I4O A;  2PQA A;  3TSS A;  4YHH Q;  1HZB A;  1WTH A;  1OTC A;  5GQO A;  4A3F B;  4EGV A;  4K0K Q;  2KHI A;  4QMG A;  1LTG D;  4A93 G;  2HHH L;  4GKK L;  1E1O A;  1PRT F;  3I4N H;  4C1N K;  2K75 A;  2WII B;  1JCK B;  1VQA A;  5I6Y A;  1PRT D;  2K5V A;  2Z6K A;  1RL2 A;  5KNB A;  3PF5 A;  3J7A V;  1MSH A;  4FNF A;  1WTR A;  1NE3 A;  1VQ6 A;  4PMW A;  1YIJ A;  4K5V A;  1JWU D;  3GTQ H;  4ULL A;  4YCV A;  2AHO B;  3ERO A;  5IOD A;  2F3W A;  1II3 A;  1X55 A;  1X9N A;  1PH1 A;  1BOS A;  1EY5 A;  1T5E A;  2B2U A;  3MXG A;  1JOK A;  5DM7 3;  2PZU A;  2QKI C;  1YBY A;  2RA4 A;  3D3R A;  5E3F A;  4RFB A;  4DV4 L;  1B1Z A;  3GTO B;  1Y8N B;  5AJ3 Q;  2ICE C;  4XQJ A;  3ULJ A;  3A8J E;  3I55 A;  4NXN L;  3N52 A;  1RKN A;  4ME5 A;  3NPP A;  3CC2 A;  1NR4 A;  4I7Z C;  5JJK A;  4BWG B;  1VQF A;  2XRQ D;  1TY0 A;  1EYA A;  1CUK A;  2HHH Q;  1TWG B;  5EGT A;  3S15 B;  1DYQ A;  1IBM Q;  3AEV A;  3EQL C;  1UEA B;  4DV2 L;  1LO5 D;  4B3M Q;  3OYY A;  1ONL A;  2J7Z A;  4KKU A;  5K36 G;  2JEA I;  4G57 A;  3G71 A;  2RQX A;  2PQA B;  3BVM A;  2QCP X;  3KF8 B;  5E4X A;  3MAQ A;  5CC4 A;  2B2V C;  5LL6 X;  1SE8 A;  3DMU A;  4K6D A;  2JA7 G;  1STG A;  3VR6 A;  2AMC B;  3BZC A;  3HOX H;  1ET6 A;  4C3J B;  3Q24 A;  1SSO A;  1TS4 A;  1WD0 A;  4QUC A;  2F0L A;  5A2Q E;  3S1Q H;  1GHJ A;  3IL8 A;  5JVH 3;  2RSO A;  1ENA A;  1I4Q A;  4BBS H;  1BDO A;  3HOV G;  1EZ8 A;  4POF A;  3M3Y B;  1FGU A;  2DJF C;  3EJI A;  3GV6 A;  5D3D A;  4LF6 L;  3M7N A;  1JOQ A;  1CKN A;  5A35 A;  3CMA A;  5DEH A;  4QUF A;  2ZT9 C;  3AU7 A;  1X56 A;  3DWQ A;  1GUN A;  3V05 A;  4G4K A;  3T51 B;  1BBX C;  4LNQ A;  2JXM B;  1VQD A;  2Q2H A;  3G6E A;  4CDE C;  1IBK L;  3RN5 A;  1RTO A;  1YNN D;  2EJG C;  1S5C D;  1V1O A;  2ZJP A;  3SK6 A;  1DOL A;  3SVM A;  5IOC A;  2XWJ B;  4DXG A;  1EU3 A;  4GLV B;  4KJN A;  5FLX E;  4NW2 A;  3LWU A;  4TSS A;  4C56 C;  4JI0 Q;  2NVY B;  3I4M H;  1QZG A;  5L37 A;  3MHB A;  1SAP A;  3D6W A;  1A0I A;  1JE4 A;  1QUQ A;  1TII D;  5KIX A;  1I6H H;  4GLX A;  3I4N B;  3JC6 6;  1D2B A;  3P20 A;  1CZG A;  4J15 A;  3S1N B;  4DV6 L;  4LWC A;  4RKL A;  2C35 B;  4LF6 Q;  3Q6S A;  1STA A;  2NYZ D;  3NQT A;  3GTQ B;  2GVB A;  4JI7 L;  3IRB A;  1TWC B;  3L3O C;  2EPB A;  3DUZ A;  4KN4 C;  3IFT A;  4DR3 L;  4FVM A;  1IBK Q;  2ZM6 L;  1KC8 C;  1UE6 A;  1JJG A;  1XMO L;  2VB2 X;  1BUV T;  1HXY D;  2RDH A;  4CHT B;  3J81 c;  2PMZ E;  3OIP A;  4M1U B;  4XXE A;  1L0Y B;  5ELO A;  3IAY A;  2A6H D;  3FKI G;  1VQ4 A;  1QNU A;  2CH4 A;  3E0J A;  1GO3 E;  4A3G G;  4IFD H;  3AYH B;  1JOR A;  3LNN A;  4CKC A;  4QIW E;  1X32 A;  4IUR A;  4JI2 Q;  1KL9 A;  1SMY D;  1SN8 A;  4HSP A;  5C3E H;  1AN8 A;  5E1F A;  3PGZ A;  5T1G A;  1E2W A;  1LV9 A;  3AFP A;  2EVB A;  2BOS A;  1Q1B A;  3CQZ H;  4H44 C;  4PZ6 A;  2MHV A;  4H13 C;  1C48 A;  1LTS D;  2WAQ B;  2VL6 A;  3HG9 A;  1QUQ B;  1F2L A;  4GOP C;  5CYU A;  3GTJ B;  2DUD A;  5IYB H;  4RHR A;  2E76 C;  4JI7 Q;  2DY8 A;  3NUC A;  4RCN A;  4X3S A;  1G91 A;  1PA6 A;  2K5Q A;  2HIV A;  3S1Q B;  2WP8 J;  2NUC A;  1V43 A;  2VB3 X;  1Y1V G;  2NVX B;  1TS2 A;  1F2M A;  4B08 A;  1S4Z A;  3FPP A;  2CQO A;  1STB A;  1UE1 A;  5JJI A;  1TR5 A;  2L1B A;  5KND A;  4HAE A;  3H6M A;  1VQM A;  5TSS A;  4HIM A;  2JQO A;  1X54 A;  3KDF A;  1BQQ T;  1Q86 C;  1GVP A;  1EOT A;  4KN7 C;  2NTT A;  2XRS D;  4JI5 L;  1R4Q B;  1WCM G;  1CHP D;  1SE2 A;  4BY7 G;  2KHS A;  5IT9 L;  3J7A F;  1SNO A;  1H9R A;  1SYC A;  1HNZ L;  3J80 E;  1EY8 A;  3PQI A;  4YCU A;  5C4H A;  2IX3 A;  4RGO S;  3BZK A;  1X3P A;  1JMC A;  5FO8 B;  4E6I A;  2R93 H;  2OTJ A;  2ZTE A;  1PH5 A;  3NE5 B;  1C7Y A;  3NTK A;  4HJ9 A;  2RHS B;  2Z8L A;  5C4X H;  2V1C C;  1G2S A;  3PO2 H;  1U4M A;  4FF3 A;  1VQP A;  1WTX A;  2LSS A;  2H1E A;  4L5T A;  4WJW A;  3VYU A;  3M4O H;  2N8N A;  3HOW H;  4IZ8 A;  4B3S L;  3K7A B;  3GTG H;  3TS0 A;  4JC0 A;  4BXX G;  4DUY Q;  1Q81 C;  1F9P A;  1W3S A;  3RLN A;  3HEJ A;  4C3I H;  4R4T A;  2CW0 D;  3PIP 3;  1H9J A;  2EOT A;  2WB1 G;  5GAH C;  2UXB L;  1J5E Q;  3KLS A;  4A3K H;  3OWF A;  2B63 B;  1I3Q H;  5M3M B;  5IIF A;  4RWS C;  1RDP D;  3RZO H;  2BCO A;  4IFD J;  1EWC A;  1FYC A;  2F0K A;  1TWH H;  5E4W C;  5M5X B;  1HFG A;  4BY1 G;  2Z6K C;  2F3I A;  2GA4 B;  1N32 Q;  3I73 A;  3KDF B;  2Q8I B;  1CKO A;  2EJF C;  4O0A A;  3VR5 A;  1L0X B;  4RH6 A;  2YYZ A;  4KHP L;  3KYH C;  4X66 L;  3K6O A;  4HID A;  2N78 A;  1H9S B;  5JEA H;  3S17 H;  3G48 A;  1PZJ D;  2Y0S G;  1L0W A;  3C1E A;  1V1P B;  2B2U C;  4PMC A;  3F2D A;  4WFN 3;  4A3D B;  1Q82 C;  4A3M B;  3H0G G;  4GN3 B;  1EYD A;  1EOV A;  5ELD A;  3ONA B;  4B3S Q;  2A6E C;  4U67 3;  1CA6 A;  1JC7 A;  5C44 H;  1SE3 A;  2PZT A;  2YTV A;  1MSG A;  4O2D A;  2Q2I A;  1PH6 A;  4TVA B;  4AYB G;  4H02 A;  1PTO H;  2NTS A;  1QVF A;  1O7Z A;  2KED A;  4ME3 A;  3UDI A;  1HQR D;  2F0W A;  4KY5 A;  4L6T B;  1MKH A;  4G7Z C;  1Z47 A;  2A69 C;  3I3C A;  4XDX A;  1KDC A;  1SXT A;  1AE2 A;  2HQL A;  2E2J H;  4KHP Q;  4IPG A;  4X66 Q;  5T1I A;  4RCO A;  5COY A;  2V4D A;  3MWY W;  3RN2 A;  2QW7 A;  4XTC S;  3ND9 A;  1B70 B;  1GUT A;  4KJO A;  2LS0 1;  1QWY A;  1BO0 A;  1LLR D;  3FDT A;  1NR2 A;  4IN3 A;  4NXM L;  1CK1 A;  1VQ9 A;  4C3H G;  2J0T D;  2RKS A;  3SGI A;  3HOZ B;  3NP8 A;  2R93 B;  4UP9 A;  5HUR A;  3UI2 A;  4X62 L;  4OWW B;  4OGQ C;  1GXD C;  2K01 A;  4MTK A;  4LFB L;  2F3V A;  4AQY L;  2BDN A;  2HD3 A;  2Q8R E;  2IWH A;  3PO3 G;  5LMN L;  4CBV A;  4QB4 A;  1MJE A;  1QJO A;  4R8I A;  4X3K A;  3RLO A;  5CGK A;  3PO2 B;  2K52 A;  4KY6 A;  5DAU A;  2AWO A;  4PG3 A;  4Q5V A;  4L5R C;  3M4O B;  2AQ2 B;  2F0O A;  3PIO A;  1TWF H;  3I56 A;  1D5Z C;  2EYP A;  1EFW A;  2RF4 A;  3HOU H;  3ICE A;  4OHJ A;  3KJP A;  2VUM G;  3GV3 A;  1LTA D;  1M4V A;  1A6X A;  2K28 A;  3CCL A;  2I5M X;  1EIG A;  2B2W A;  3D31 A;  2EYO A;  1PMR A;  2SOB A;  2YU9 H;  5JEA J;  1WOC A;  1CKM A;  4F87 A;  1VQG A;  3RZO B;  2BH2 A;  1VQH A;  1VQO A;  1HNW Q;  4A76 A;  3MEH A;  5LMN W;  4I65 A;  4UAI A;  2K6A A;  4NXM Q;  4HJA A;  2FIN B;  1ICF B;  1XPO A;  3RMH A;  5JPN C;  1L1O A;  2YTX A;  1SMY C;  1EQV A;  4QL5 A;  3QG1 A;  1EY7 A;  1EZ6 A;  5I2Y A;  2VQE L;  4RAU C;  3L0O A;  4JPB W;  4AQY Q;  4FF1 A;  3S17 B;  1F9S A;  5LMN Q;  3CAM A;  5EPL A;  2JA6 B;  2F0G A;  1XNQ L;  4CDC C;  1Y14 B;  3S2D H;  5LMU L;  2I0Q A;  1ET9 A;  4A3E H;  1SLJ A;  5JAV A;  1EQQ A;  5E7N A;  3F1Z A;  3RZD B;  4G7H C;  1PVO A;  2K5D A;  1KRT A;  4UHV A;  1XPU A;  2NVT H;  1YNJ C;  3JAM E;  1T5X D;  5EKI A;  4AYB E;  4FXD A;  1GOZ A;  4NMZ A;  1YEZ A;  5M3F B;  2BE5 C;  4A3J G;  2E2H H;  3QIA A;  1CFM A;  3SDZ A;  2KEC A;  1E22 A;  1SEB D;  2K50 A;  3D8G A;  3SR1 A;  1Y8O B;  4QJF A;  2N55 A;  4YIJ A;  5G3L F;  4A93 H;  1LTI D;  4CDF C;  3NSW A;  2UUB L;  4UP8 A;  1KDA A;  1JT8 A;  3K58 A;  3AQQ A;  5G3L D;  1CSQ A;  1A8V A;  2E2J B;  2JA5 B;  2PCF B;  4IUP A;  4ZAI A;  1GUS A;  2EY6 A;  2R7Z B;  3E9I A;  5JPM C;  2A8V A;  2PW7 A;  1SYE A;  1JQY D;  2A74 C;  2DNC A;  3GTL H;  1RD9 D;  2E8G A;  1XNQ Q;  2F0U A;  3NTI A;  1ROD A;  1RIP A;  4IPH A;  4BS9 A;  4OXP A;  2A5H A;  1Q1E A;  3A55 A;  3G4S A;  4M8A A;  1C4Q A;  3DM1 A;  1VQN A;  1CHQ D;  3SHL A;  3HKZ B;  3R3O A;  1YIT A;  1PYB A;  4MIU A;  4JI3 Q;  4OX9 L;  1U4P A;  1HH2 P;  1EUJ A;  4IUQ A;  5CV8 A;  1HA5 A;  3ZJY C;  4HCS A;  4LFC Q;  1MGS A;  3J80 L;  4LF4 Q;  2R6G A;  2D0O A;  1R9T H;  3E6Z X;  2K33 A;  1WTQ A;  3RUZ A;  1YJ9 A;  1EWI A;  1DXM A;  3QJY A;  2TSS A;  1MHW C;  2UUB Q;  1TWF B;  5K36 H;  4YY3 Q;  1PH4 A;  2D5D A;  2UUC L;  2JK8 A;  2VW9 A;  1BNZ A;  3KF8 A;  4DAV A;  5IYD G;  1BF4 A;  2JA7 H;  2UXC L;  1SRU A;  1D8L A;  1CTM A;  1A3V A;  1IBM L;  2Z6B A;  4B3M L;  2LXK A;  4K2L A;  5DLQ E;  1ILQ A;  1KQS A;  5EBC A;  4TKO B;  4R9W A;  4ZLT F;  1STY A;  2I46 A;  5C5L A;  4L8J A;  4OX9 Q;  4KD3 A;  3I4L A;  3CCM A;  3HOV H;  1EFI D;  2VQF Q;  4DK6 C;  3HOY G;  1G6P A;  4S3S A;  1JB3 A;  2NZ1 D;  4K8I A;  2IX1 A;  3HP3 A;  2O5I C;  1LM0 A;  3NBI A;  1B8A A;  4LFA L;  1NTG A;  1A63 A;  4GLA C;  3M4Q A;  4QF4 A;  2GVA A;  3OW2 A;  3NEN A;  2JP1 A;  2DN8 A;  4A3I H;  1VQB A;  1VQC A;  4C3J G;  1E7Z A;  1N36 Q;  1FGB D;  1U4R A;  2OT2 A;  1H95 A;  1VQ8 A;  3P1H A;  2Z0S A;  2NVT B;  1NCV A;  2UUC Q;  1LAB A;  1C8C A;  5KNC A;  5IT9 c;  3JAM i;  2UXC Q;  4DUZ L;  3HKZ E;  1Z9F A;  2M00 A;  4P71 A;  1BKB A;  2GN5 A;  1T9H A;  2EY1 A;  1WTW A;  2PYK A;  1Z6H A;  4HN7 A;  3TQY A;  4A93 B;  1K8O A;  5C4J H;  2B8F A;  4RKB A;  4MN3 A;  1E2Z A;  3M4Y A;  5ELF A;  1HRJ A;  1PRT B;  5IP7 G;  2SEB D;  1AZP A;  1ASZ A;  1SYB A;  5KEE A;  1LTB D;  4JI0 L;  3T16 A;  1TS3 A;  1EIH A;  2ZJQ A;  3D0F A;  2E74 C;  1WVL A;  2NVQ H;  2A6E D;  1Q7Y C;  3UDF A;  4X65 L;  3I72 A;  1PV4 A;  2F0I A;  3BJU A;  4LFA Q;  3TBI B;  1AZQ A;  3LGJ A;  2PI2 A;  4LF9 Q;  1S72 A;  3A56 A;  3TRE A;  4HED A;  4LF7 L;  4PZ7 A;  1SBB B;  2HQE A;  2XN9 C;  1TU2 B;  3I91 A;  4IJL A;  3RNU A;  1PYS B;  5FK9 C;  3Q23 A;  5FLM G;  5BN5 A;  2K03 A;  2A69 D;  3FKI H;  4DUZ Q;  1SFO H;  4HCE A;  4IUV A;  2PNH A;  4A3G H;  5BN4 A;  1SNQ A;  4ILW A;  4A3I G;  5EPJ A;  4IO9 A;  3GTK B;  4JK1 C;  3CXC A;  1PH3 A;  2MNA A;  2B2Y C;  3IFD A;  1EIY B;  1F2Z A;  2ASB A;  2IHE A;  5C6A A;  3LWE A;  2FMC A;  2F0F A;  1QVC A;  3T53 B;  1IKM A;  2B29 A;  2D0P A;  1F9R A;  1NAP A;  2L9H A;  2JJQ A;  3F2C A;  2Q2T A;  1RJT A;  1IL8 A;  2JA7 B;  3L9A X;  2F52 A;  4X65 Q;  4ABN A;  4JI2 L;  2I5H A;  4L63 B;  5GAD C;  1O7L A;  2HDM A;  3TP6 A;  4O1N A;  4I7A A;  3TP8 A;  4A3B H;  3MTS A;  1IZ6 A;  4ZQ3 A;  1I5F A;  2A68 C;  2Z1C A;  4IPD A;  3VA7 A;  3OIQ A;  3QR8 A;  4LF7 Q;  4IPC A;  1U5K A;  2JA8 G;  3NEM A;  1Y1V H;  2B2W C;  2PO4 A;  3PUV A;  1XTC D;  4JBW A;  1OO9 B;  4NB3 A;  3QOL A;  1B3Q A;  4K6L A;  2MFI A;  1MD2 D;  2RDG A;  4RGN A;  3VA5 A;  4P72 A;  5M5W H;  1TXY A;  4LAA A;  4JI6 L;  1WCM H;  2R92 H;  1YJN A;  4BY7 H;  4IOA A;  1L1O C;  3U4Z A;  1LAC A;  3OPO A;  1NY4 A;  1HR0 L;  1VS0 A;  4BA2 I;  1S40 A;  3BDC A;  3QWN A;  2QDB A;  1HZ9 A;  1DJR D;  4ZK9 B;  1JWM D;  2PPB C;  1B50 A;  4ZYS A;  1G8Z D;  2ICI A;  1VQK A;  3QB3 A;  1SJH D;  2AUJ D;  3H3V C;  1STH A;  4X6A H;  4QCL A;  4JCV E;  3PCO B;  1V8Q A;  4EQO A;  1PZI D;  2B39 A;  3C1F A;  3RLF A;  2VS1 A;  3URY A;  2RSN A;  4K5W A;  3JAM L;  4ZKC B;  4X3U A;  1BCP C;  1I4G A;  4YWL A;  2K14 A;  4BXX H;  1KDB A;  4XYO A;  3IKJ A;  1MI2 A;  5IGB A;  3MFY A;  3S1R H;  1HR0 W;  1S5D D;  1JR0 D;  4RGT A;  3HOX B;  5FOB B;  4DV5 Q;  2NVQ B;  4A3B G;  5FLX c;  2A73 B;  1I4X A;  2F0Q A;  3FPU B;  4GKJ Q;  4JI6 Q;  2KUM A;  2YTY A;  2HDL A;  2LFN A;  2KOL A;  4CJ1 B;  1YNJ D;  4CJ2 C;  2L5T A;  4RA8 A;  4DUY L;  1HR0 Q;  1DGS A;  1ESR A;  4BBS B;  4BY1 H;  2BE5 D;  2EYH A;  1K8A C;  3MEF A;  3NQI A;  1WTP A;  2D62 A;  2ID0 A;  2F0H A;  2KVM A;  4H0L C;  1A3U A;  3S2H H;  1BXT A;  3FRP B;  1PLF A;  3KBX A;  1J5E L;  3EBE A;  1UNS A;  2BDO A;  1X3Q A;  2K7V A;  3J7Y W;  1FNW A;  3FKI B;  1SFO B;  2R92 G;  3J81 i;  1H9S A;  4A3G B;  5C0X G;  4KLK A;  4PV1 C;  4DKA C;  4X64 L;  4DR2 Q;  4ZRZ A;  3E3X A;  4FDB A;  5D3I B;  3AMU A;  1V1P A;  3H0G H;  1V9P A;  1N32 L;  1M8A A;  4HIO A;  2R7F A;  2B63 G;  1TT2 A;  2PW5 A;  4Y7N H;  3GTM H;  2K32 A;  1S3O A;  2OEO A;  1CT1 D;  2JYO A;  2JEB I;  2L0C A;  1YHB A;  2DJG C;  1ENF A;  4JBK A;  3I4M B;  5JJZ A;  4GNX B;  2L12 A;  4DAM A;  4GS3 A;  3MA2 B;  2DNE A;  2WFW A;  2Z4H A;  1EYG A;  1IL2 A;  5KGU A;  1I6H B;  1X3G A;  4GZY C;  4OIK A;  1I4P A;  1EY4 A;  4FXK C;  4YCW A;  5DM6 3;  2VY3 A;  3N6R A;  1C0A A;  3SEB A;  2IY5 B;  3W5O A;  4A3D G;  4DF7 A;  4A3M G;  2UU9 Q;  1WTO A;  3D4R A;  1B44 D;  3CP0 A;  2TMP A;  1AFP A;  3K81 C;  4K8J A;  2X69 A;  2EY2 A;  3T1Y L;  1NSN S;  2PNR C;  2WAQ E;  5M5W B;  2AKW B;  2NBF A;  3UE0 A;  3I70 A;  3MC0 B;  4X64 Q;  4KHV A;  2EQS A;  1F2Y A;  5HGQ A;  4KK7 A;  1K73 C;  4JBM A;  5IE8 A;  4QGU A;  1G2T A;  2EJM A;  3WDN A;  2CHB D;  1HZC A;  5I2X A;  4C3H H;  5I4D A;  5HY6 A;  4DAY B;  3DWP A;  3R8B A;  4PZ8 A;  1PDQ A;  5IGF A;  2EDG A;  3CW2 C;  1AW7 A;  4KD4 A;  5IYC H;  1HTP A;  5CV9 A;  1HPC A;  2X6G A;  3CPW A;  3OSO A;  3PO3 H;  5AFW A;  5EPK A;  2WV6 D;  5C3E B;  3BVG A;  2CVR A;  2ZXP A;  4XYQ A;  3RR5 A;  4A3C G;  4F88 A;  2QDL A;  2NZH A;  3CQZ B;  3CCV A;  4APV A;  3W2D A;  1HHV A;  1X3E A;  5J22 A;  1KHI A;  3J80 c;  4QY7 A;  2UXD L;  2G9D A;  2VUM H;  2M2L A;  4DNI A;  1B9N A;  2CQA A;  2WB1 B;  4LF8 Q;  3TN2 A;  3T1Y Q;  3MXP A;  2AWN A;  2F0M A;  2MPM A;  5JJL A;  2RCN A;  3BYY B;  1S5F D;  1YNX A;  2SDF A;  2RBM A;  3OWE B;  4L5S A;  2F0S A;  2H4O A;  3EIV A;  3MXN A;  2ZXO A;  2JSO A;  1GHK A;  3NBH B;  2IX0 A;  3D4W A;  1N34 L;  4R1J A;  1B4O A;  4B3T L;  3H94 A;  3SK5 A;  1E24 A;  3O13 A;  5A2Q L;  3CHB D;  3G7L A;  3I2Z A;  3PUX A;  1JIC A;  3PUZ A;  2MP1 A;  2EYM A;  4CKE A;  1I50 H;  2QGQ A;  3HZX A;  4F7X A;  4KTA A;  4H7B A;  1HNW L;  1DON A;  5BR8 Q;  4KV6 A;  3D4D A;  4MTN A;  4V0B A;  5F2D A;  5LL6 S;  4OEM B;  2NB0 A;  4LMQ D;  2OWO A;  1EY9 A;  1K3R A;  3VR2 A;  1GUW A;  3V2T A;  2RHQ B;  3TZD A;  4OL7 A;  5I9O A;  4Z9C B;  1IXR A;  2ES2 A;  3TP7 A;  5IYC G;  2UXD Q;  2FXQ A;  5DNF A;  1LUZ A;  5C4X B;  3NWS A;  4DN4 M;  3OHX C;  1EWH A;  1NUC A;  3CPF A;  5IP9 G;  1B53 A;  4OIJ A;  4NKL A;  3UDX A;  4A4I A;  2SNM A;  4A3J H;  3HOW B;  2G5D A;  4ID6 A;  5FLX L;  4DPG A;  3GTG B;  3L7Z C;  1YHA A;  5ELE A;  3NWT A;  4DK1 A;  5FKA C;  1N34 Q;  1DM0 B;  4B3R Q;  3ER0 A;  3F8T A;  4FF4 A;  4DR1 Q;  4B3T Q;  3NXW A;  4C3I B;  2CWA A;  1ZEQ X;  3J7Z C;  2DY7 A;  1VQ5 A;  4A3K B;  2D9U A;  3M7G A;  3NEL A;  1I3Q B;  1SND A;  2KJX A;  3MXN B;  4BBR G;  1K83 H;  3KLS X;  4GN5 A;  2F0E A;  1Q12 A;  3DM3 A;  1QG7 A;  4OO1 G;  4KMU C;  1Y1W H;  2EXD A;  1TWH B;  4BA1 I;  4B9X A;  5C0X I;  3FHW A;  2PQE A;  5M3F G;  2UUA Q;  1EL0 A;  4EQN A;  4DXF A;  3WOE A;  4C3H B;  4CDD C;  4JI4 Q;  4IQZ A;  4N9P A;  4OWX B;  1IHZ A;  1FJG Q;  1KRS A;  2F0N A;  1EEI D;  3OMG A;  1TVX A;  2O2L D;  1ENC A;  2A68 D;  4XQQ A;  1QVG A;  1JB7 A;  2C9O A;  4U68 A;  2YV5 A;  4J1M A;  1EQT A;  3PO3 B;  5CR3 A;  1XMQ Q;  4ZKB B;  2ENB A;  2KCM A;  1K0R A;  4KY7 A;  3U50 C;  1E2V A;  1LTT D;  2L11 A;  2JA5 G;  2FMM A;  5C3W A;  4HTH A;  4WJ4 A;  4ODG A;  2R7Z G;  5C5M A;  4JV5 L;  5EBD A;  1HJP A;  2A19 A;  4IUT A;  5C44 B;  1KAA A;  3OTO L;  4JI3 L;  3FP9 A;  1CQV A;  2ZTC A;  3WWV A;  2E2D C;  4AH6 A;  1VF5 C;  2XWB B;  3M85 A;  1HNX Q;  4LFC L;  2KHJ A;  4LF4 L;  5I6W A;  2MO0 A;  4DV1 Q;  5IYD H;  4N9T A;  1PTO B;  3SXH A;  3KJO A;  1JWS D;  3HKZ G;  3ITP A;  3VYS A;  1Q90 A;  3A54 A;  3BU2 A;  4IOC A;  1EQR A;  4PQX A;  5EAY A;  1EU4 A;  2F4I A;  1SNP A;  4YY3 L;  4R4Q A;  1GUO A;  1OXV A;  2FJ2 A;  1BCP F;  3M4P A;  4DR7 Q;  3HKS A;  3R2T A;  1DOK A;  5COR A;  4HMI A;  4N8F A;  3MFG A;  1KLU D;  4LW1 A;  1KAB A;  4L5Q A;  1A2T A;  1BCP D;  1MBY A;  4DR5 L;  1Y1W G;  3HOY H;  1EIF A;  1I50 B;  2NWG A;  1HUN A;  2RVL A;  3BVZ A;  2K04 A;  1WJJ A;  4NDX A;  4K2K A;  1PFN A;  1U4L A;  3BDO A;  1OXU A;  4JV5 Q;  4A3F G;  4RGM A;  4F8M A;  3SK8 A;  3OTO Q;  4C3J H;  5IGG A;  5IWA L;  3F2U A;  1E3P A;  1R4P B;  2VQF L;  5LHY 1;  1SNC A;  3Q0A A;  1SYD A;  4JYA L;  2QA4 A;  1FVI A;  5IGC A;  3KFU A;  4A3J B;  3U9O A;  3M3Y H;  2CFM A;  1TS5 A;  3HS0 C;  1QIL A;  1SJE D;  1N36 L;  3HOU B;  3K5O A;  4KHZ A;  1PH7 A;  2O4X A;  1E0B A;  3F2B A;  5IP7 H;  4KKT A;  3G6J B;  1SYG A;  1PH9 A;  1CA5 A;  2F0V A;  2VNU D;  2YU9 B;  3JAM c;  4DR5 Q;  3QOJ A;  3K8A A;  3A5Z B;  5EKK A;  4DV3 Q;  3HGB A;  1DZ1 A;  3ULP A;  4AIM A;  3BZD B;  4B9W A;  1CI3 M;  4GOP B;  1E1T A;  4UDU C;  4TRD A;  3H15 A;  1WTV A;  3R2I A;  5M5Y H;  1G29 1;  2NVY H;  4OON A;  5IWA Q;  1KLG D;  3K5L A;  1JJ2 A;  3U9S A;  3I7F A;  4JOI A;  4CGY B;  3VYR A;  1HQM C;  4JYA Q;  5FLM H;  3ERS X;  4A3L G;  1PH8 A;  3S2D B;  1HA6 A;  3S1N H;  5EKL A;  4LF9 L;  1YZ6 A;  4A3E B;  3EVQ A;  1I6V C;  2OXP A;  3CF5 A;  4FO2 A;  3HRZ C;  3X3N A;  4DR4 Q;  2KQ3 A;  2KEE A;  1OXT A;  3A7A B;  4K5X A;  2HUG A;  1UUP A;  1VQI A;  4LJZ C;  4YWK A;  2R7D A;  1TWC H;  2E75 C;  2B3G A;  2Z4I A;  3CCQ A;  1I4R A;  3C46 A;  4LK1 C;  4TQU S;  2F03 A;  2E2H B;  1VDZ A;  3CCS A;  3I90 A;  2SNS A;  4K14 A;  1YVC A;  2Q2U A;  3CCE A;  4OO1 I;  4HMJ A;  1B2T A;  1J6Q A;  3QO2 A;  3J81 j;  1K3B C;  1WI5 A;  3PIO 3;  3S24 A;  2JA8 H;  3STB C;  1FNV A;  4GKK Q;  4DK0 A;  2A1A A;  4IJH A;  3GTL B;  5EJW A;  2K4K A;  3PIP A;  3HOY B;  4DK3 C;  2NN6 G;  4UP7 A;  2F0D A;  1XTD A;  1KNA A;  1XX8 A;  2WIN B;  1LTR D;  1VF7 A;  2J4X A;  1W2B A;  1KTK A;  2H5X A;  2CWP A;  3KOJ A;  3GTJ H;  1KD1 C;  3DWA A;  1PH2 A;  4R4O A;  3I4N G;  3J81 E;  2CH4 W;  3MZ5 A;  5ELB A;  1HZA A;  1D1I A;  2PMZ B;  1R9T B;  2OQ0 A;  2NVX H;  1O78 A;  3H91 A;  2X6L A;  2XVS A;  3PUY A;  4DV4 Q;  1IYU A;  1IYJ B;  4LF5 L;  2MJ8 A;  4QIW B;  3BS1 A;  3H3V I;  3A8I E;  5IY0 A;  5GRO A;  1A3T A;  4NXN Q;  4WOR A;  4PMB A;  4MZ9 A;  1W6J A;  1QE6 A;  1D1K A;  4XT3 B;  1M90 C;  2HT1 A;  4DV7 L;  3K7U C;  3OW7 A;  2JE6 I;  4R8N A;  3T1H L;  3X3M A;  1A2U A;  3LX0 A;  4DV2 Q;  3AB9 A;  3K57 A;  2R61 A;  3GDE A;  1BBW A;  3EA6 A;  1PTO C;  4DNT B;  3AFQ A;  2CCZ A;  5ELC A;  1PFM A;  5M5Y B;  4P75 A;  5CV4 A;  4CJ0 B;  1IW7 C;  2ZTD A;  2NZO A;  3GTP H;  3HOV B;  1WFQ A;  3BG3 A;  4DV5 L;  4Y52 H;  5GAE C;  2B2T A;  1I94 L;  2KA7 A;  1X3F A;  3K7A H;  5JOB A;  4GKJ L;  3DXJ C;  2AUK A;  3VR3 A;  4FXG C;  1ILP A;  2WAQ G;  2C5C A;  3CKI B;  4DA2 A;  1O7I A;  5J39 A;  1WYD A;  5C0X H;  4A3I B;  4LF5 Q;  3HOX G;  2IW3 A;  1FR3 A;  3TME A;  5ELN A;  5KYI A;  1NBW A;  2B63 H;  2E2I H;  1I4H A;  5M3M H;  1VQ7 A;  1LTL A;  2KCC A;  2WAC A;  4DV7 Q;  4QQB X;  4FYD A;  1LT6 D;  4JBJ A;  3T1H Q;  3M9B A;  1ICW A;  3A7L A;  5M5X H;  4BBS G;  1CKN B;  3CRK C;  3S14 H;  4DR2 L;  1TKW B;  2XGT A;  4Q0F A;  3I8Z A;  4GNX A;  3U58 A;  4WJ3 M;  1SDF A;  5C4J B;  2EZV A;  4LUO A;  2LMC B;  4PNY A;  5ISR A;  3TEH B;  4IUU A;  2ZJR A;  1GM5 A;  3VYT A;  1O80 A;  1ZXT A;  1LT4 D;  3WOF A;  1LT3 D;  1Q3L A;  4J6H A;  4A3D H;  3CCR A;  1W6K A;  2JA8 B;  4XIG S;  4A3M H;  4UPA A;  1GJX A;  1I94 Q;  3OMC A;  1U0L A;  1Y69 U;  4DV0 L;  3KLR A;  4EVO A;  5KYL A;  3E5S A;  1SYF A;  1S5B D;  3K59 A;  3PV0 A;  4DV6 Q;  3A8K E;  1KAW A;  4DFA A;  4P74 A;  2G9H D;  3I4M G;  1ZYR C;  1AP0 A;  4HJ8 A;  5IGD A;  1O7Y A;  3C2P A;  3E0E A;  2EY5 A;  2UU9 L;  5IGE A;  3CRL C;  2EYJ A;  2AQ3 B;  5C4Z A;  1JOO A;  3CCJ A;  4DR3 Q;  4DAY A;  1UEB A;  1VQJ A;  2ZM6 Q;  3NTH A;  2F4V L;  1XMO Q;  1QZH A;  2IHF A;  2D2C C;  5CMD A;  2PI2 E;  4CKB A;  4HJ7 A;  3ZYY X;  3CC7 A;  2KCT A;  3W1G A;  1D5M C;  1KNE A;  5M3M G;  3TDQ A;  1CM9 A;  3E9H A;  3R93 A;  4A3C H;  1QNK A;  2Q8T A;  4LUZ A;  2JA9 A;  2K05 A;  1BBU A;  3RD4 A;  1PHJ A;  4HSV A;  3CU7 A;  5J1Z A;  4ZUI A;  1STN A;  1QOH A;  1NNX A;  5FO9 B;  2EXZ A;  4DV0 Q;  1BVS A;  1VCI A;  2JN4 A;  2IJ0 A;  1Q8K A;  3GD7 A;  2HIX A;  1MJC A;  4A3B B;  2P5Z X;  4MNO A;  4RMF A;  3HOZ H;  5CBA E;  2MO1 A;  2MGS A;  2NN6 I;  5CV6 A;  4DAP A;  4IFD G;  5C0X J;  1Y1V B;  3NHH A;  1PRT C;  2IT1 A;  5C3E G;  3NBH A;  3GTP B;  3FEW X;  2CKZ B;  2KCN A;  3GO5 A;  1EY0 A;  4LF8 L;  3OOC A;  2LXJ A;  2BH8 A;  2MQH A;  1UAP A;  1ASY A;  5HGT A;  2F4V Q;  1YI2 A;  3GP7 A;  4OEL B;  1WCM B;  5H1S E;  3A5U A;  1IBL L;  3FVQ A;  2R92 B;  4BY7 B;  1N8R C;  1J9O A;  1N33 L;  2Z9H A;  5JVG 3;  5IYB G;  4HIK A;  4OWT B;  1ML0 D;  4IUN A;  1F9Q A;  1NMF A;  5D14 A;  4JI5 Q;  2E2I B;  1PFB A;  4JOI C;  4JVZ A;  1TWA H;  1H9K A;  3A0J A;  3KF6 A;  2ALY B;  1EEF D;  5CV7 A;  3S1M H;  1YJW A;  2L15 A;  1HNZ Q;  1UE5 A;  1L2F A;  4NPS A;  2K5N A;  1KIX A;  5J3B A;  5BR8 L;  1HUM A;  3S14 B;  3DHQ A;  3S9W A;  3KBG A;  5IP9 H;  1DD2 A;  1G6Z A;  1C9O A;  2F0P A;  2QEJ C;  3VR4 A;  1IKL A;  5CBE E;  4C2M H;  2F0T A;  4YWM A;  4EQP A;  3L2P A;  3BYT B;  2JA6 H;  3S1R B;  2O5J C;  1CQF A;  2BA0 A;  1AH9 A;  1K9M C;  1GD7 A;  1ESF A;  2K1B A;  3SK4 A;  3HOZ G;  2R93 G;  3UDG A;  2KBN A;  2DGY A;  2EIF A;  4BBR H;  3RZD H;  1J8I A;  1IBL Q;  2PZW A;  5CV5 A;  1D7Q A;  3UE1 A;  3T56 B;  5C4X G;  4OO1 H;  1N33 Q;  2I07 B;  3K0Y A;  4WRD A;  1FD7 D;  4B3R L;  2B2V A;  4N8X 1;  4BY1 B;  3A74 A;  4DR1 L;  3PO2 G;  2UXB Q;  3K5N A;  5M3F H;  1IYV A;  5GAG C;  1NMG A;  3S2H B;  2IPK D;  3HOW G;  3BDL A;  3GQB A;  1B3A A;  1Y8P B;  4R4I A;  2KEN A;  2AQ1 B;  2L55 A;  2R3Z A;  3PMF A;  4EQ5 A;  4HR7 B;  2FFK B;  1FNU A;  2K5W A;  2Y0S B;  2L4N A;  4C3I G;  1KXL A;  2VZA A;  4JW0 A;  2QEX A;  3B6Y A;  1EYC A;  3H0G B;  3C3L A;  3TS2 A;  1FL0 A;  3STB D;  4A3K G;  2UUA L;  2JA5 H;  2MUY A;  1OXX K;  1YNN C;  3KF6 B;  3J81 L;  4Y7N B;  3U4V A;  2R7Z H;  3GTM B;  4JG2 A;  2XSC A;  1VQL A;  1XJV A;  4JI4 L;  1K8M A;  2EE1 A;  1FJG L;  2VXW A;  1LYL A;  1VQE A;  4NP5 A;  2WKC A;  3CD6 A;  1K0S A;  1VMC A;  3SE0 A;  4GN4 B;  1XMQ L;  4JI1 L;  2RDF A;  1XPR A;  4AYB B;  1AE3 A;  3P7J A;  2B2Y A;  1G51 A;  3J80 i;  5FJ8 H;  3EN2 A;  5JEA G;  3H3V H;  1JE5 A;  1SNM A;  3KK7 A;  2JA6 G;  3Q22 A;  1JJC B;  2XNA C;  4KKS A;  1HNX L;  1D6E C;  2ZXR A;  1AEX A;  2ATW A;  4O42 A;  4UY8 C;  1YHQ A;  3CME A;  3DLL A;  4DV1 L;  1QCB D;  1SRO A;  3TRZ A;  2QF7 A;  3S16 H;  5C44 G;  5I9P A;  5K5P A;  1GKH A;  2BA1 A;  2XTI A;  2LKV A;  3T13 A;  2WB1 E;  1P16 A;  4FP5 D;  2RCF A;  1PTO F;  2EYF A;  1PZK D;  1HCZ A;  5C3X A;  2EYL A;  4A3F H;  4DR7 L;  4KI0 A;  2B2T C;  1PTO D;  1TWA B;  3D6C A;  4X3T A;  5KRU A;  1A62 A;  1STE A;  2A6H C;  2HCC A;  3HFZ B;  3K80 C;  1SMX A;  3J7A 5;  3S1M B;  1PXU A;  1DCZ A;  3K5M A;  4JI1 Q;  1UWV A;  2K5H A;  2HCI A;  1GUG A;  4JI8 L;  1IW7 D;  3KUP A;  4RG1 A;  5EQ0 A;  1X6O A;  5M9O A;  4X62 Q;  1XWE A;  1OXS C;  2Y0S E;  1K8G A;  4V19 0;  1CZW A;  4C2M B;  4LFB Q;  4LUV A;  1SR3 A;  1P8L A;  1HFN A;  2E5L L;  4IFD I;  1HTL D;  2VUM B;  1A15 A;  2XIW A;  2OCE A;  1K28 A;  3FMC A;  1MIU A;  4GNX C;  2N3S A;  1ZKO A;  1B7Y B;  5FJ8 G;  3KLW A;  4DGZ A;  5D65 A;  1D5X C;  1Q8I A;  4BBR B;  3GTO H;  4P73 A;  4FF2 A;  4ZUJ A;  2N49 A;  4DR6 L;  1TQO A;  4ALP A;  1U9R A;  1XNR L;  1H9M A;  1DOM A;  1RF2 D;  4A75 A;  3TZU A;  1N9W A;  4GOP A;  3MVV A;  4EX5 A;  1TWG H;  3VDY A;  3S15 H;  3V96 A;  1NJI C;  1TY2 A;  1Z7T A;  4DU9 A;  1LT5 D;  1XXG A;  2I5L X;  4POG A;  4RHS A;  3HOU G;  3CCU A;  4DV3 L;  1WD1 A;  4JI8 Q;  4XQN A;  4A3L H;  2FHT A;  4IAL A;  1XYI A;  2VQE Q;  2N88 A;  3K0X A;  4YHH L;  2WKD A;  2IL8 A;  4HJ5 A;  3NK9 A;  4K0K L;  2B8G A;  3T4A C;  2E5L Q;  1S5E D;  1F77 A;  3PF4 A;  3DEP A;  3PUW A;  1L1O B;  2F0J A;  5LMU Q;  1PFS A;  1SE4 A;  1ZYR D;  1B9M A;  3ERQ A;  1X65 A;  3W1B A;  1QB5 D;  3TP5 A;  4C1N I;  3ND8 A;  2OQK A;  3Q8D A;  4P2C B;  5IT9 E;  4XT1 B;  4R4C A;  4J8Q A;  3W3A A;  2LY7 A;  4DR6 Q;  2QIL A;  3H09 A;  4DR4 L;  5NUC A; 
#chains in the Genus database with same CATH homology
 5FO7 B;  2F1M A;  4MHE A;  5BN3 A;  1PYW D;  2M9V A;  2CW0 C;  1RHP A;  3DEO A;  1BCP B;  3S16 B;  2OF1 A;  1K83 B;  3MXU A;  4G7O C;  4DNR B;  1BR9 A;  1EY6 A;  3P75 A;  1Y1W B;  1RCV D;  2NN6 H;  1RTN A;  1VMP A;  3EFX D;  3TSS A;  4A3F B;  4EGV A;  4QMG A;  1LTG D;  1PRT F;  4C1N K;  2WII B;  1JCK B;  5I6Y A;  1PRT D;  5KNB A;  3J7A V;  1MSH A;  4FNF A;  1WTR A;  4PMW A;  4K5V A;  1JWU D;  4ULL A;  3ERO A;  5IOD A;  2F3W A;  1II3 A;  1T5E A;  1BOS A;  1EY5 A;  2B2U A;  3MXG A;  1JOK A;  5DM7 3;  2PZU A;  2QKI C;  2RA4 A;  3D3R A;  5E3F A;  4RFB A;  1B1Z A;  3GTO B;  1Y8N B;  2ICE C;  4XQJ A;  3A8J E;  3N52 A;  1RKN A;  4ME5 A;  3NPP A;  1NR4 A;  4I7Z C;  4BWG B;  2XRQ D;  1TY0 A;  1EYA A;  1TWG B;  5EGT A;  3S15 B;  1DYQ A;  3EQL C;  1UEA B;  1LO5 D;  1ONL A;  2J7Z A;  4KKU A;  5K36 G;  2JEA I;  4G57 A;  2RQX A;  3BVM A;  2QCP X;  5NUC A;  5E4X A;  3MAQ A;  5CC4 A;  2B2V C;  5LL6 X;  3DMU A;  4K6D A;  1STG A;  3VR6 A;  1ET6 A;  4C3J B;  3Q24 A;  1SSO A;  1TS4 A;  1WD0 A;  4QUC A;  2F0L A;  5A2Q E;  1GHJ A;  3IL8 A;  5JVH 3;  2RSO A;  1ENA A;  1I4Q A;  1BDO A;  1EZ8 A;  3M3Y B;  3GV6 A;  3EJI A;  1JOQ A;  5D3D A;  3M7N A;  5A35 A;  5DEH A;  4QUF A;  2ZT9 C;  3AU7 A;  3DWQ A;  1GUN A;  3V05 A;  4G4K A;  3T51 B;  1BBX C;  2JXM B;  1RTO A;  1YNN D;  2EJG C;  1S5C D;  1V1O A;  3SK6 A;  1DOL A;  3SVM A;  5IOC A;  2XWJ B;  4DXG A;  1EU3 A;  4KJN A;  5FLX E;  4NW2 A;  3LWU A;  4TSS A;  4C56 C;  2NVY B;  3MHB A;  1SAP A;  3D6W A;  1JE4 A;  1TII D;  5KIX A;  3I4N B;  1D2B A;  3P20 A;  1CZG A;  3S1N B;  4RKL A;  3Q6S A;  1STA A;  2NYZ D;  3NQT A;  3GTQ B;  1TWC B;  3DUZ A;  3L3O C;  2EPB A;  4KN4 C;  3IFT A;  4FVM A;  2VB2 X;  1BUV T;  1HXY D;  2RDH A;  4CHT B;  3OIP A;  4M1U B;  4XXE A;  1L0Y B;  3IAY A;  2A6H D;  1QNU A;  3E0J A;  4IFD H;  1JOR A;  3LNN A;  4CKC A;  1X32 A;  4IUR A;  1SMY D;  4HSP A;  1AN8 A;  5E1F A;  5T1G A;  1E2W A;  1LV9 A;  2EVB A;  2BOS A;  1Q1B A;  4H44 C;  2MHV A;  4H13 C;  1C48 A;  1LTS D;  2WAQ B;  3HG9 A;  1F2L A;  5CYU A;  3GTJ B;  4RHR A;  2E76 C;  2DY8 A;  3NUC A;  4RCN A;  4X3S A;  1G91 A;  2K5Q A;  3S1Q B;  2WP8 J;  2NUC A;  1V43 A;  2VB3 X;  2NVX B;  1TS2 A;  1F2M A;  4B08 A;  1S4Z A;  3FPP A;  1STB A;  1TR5 A;  2L1B A;  5KND A;  4HAE A;  3H6M A;  5TSS A;  1BQQ T;  1EOT A;  4KN7 C;  2NTT A;  2XRS D;  1R4Q B;  1CHP D;  1SE2 A;  2KHS A;  5IT9 L;  3J7A F;  1SNO A;  1SYC A;  1H9R A;  3J80 E;  1EY8 A;  5C4H A;  2IX3 A;  4RGO S;  1X3P A;  5FO8 B;  4E6I A;  3NE5 B;  3NTK A;  2Z8L A;  1G2S A;  1U4M A;  4FF3 A;  1WTX A;  2H1E A;  4WJW A;  3VYU A;  4IZ8 A;  3K7A B;  1F9P A;  3HEJ A;  2CW0 D;  3PIP 3;  1H9J A;  2EOT A;  3KLS A;  3OWF A;  2B63 B;  5M3M B;  5IIF A;  4RWS C;  1RDP D;  2BCO A;  4IFD J;  1EWC A;  1FYC A;  2F0K A;  5E4W C;  5M5X B;  1HFG A;  2GA4 B;  3I73 A;  2Q8I B;  2EJF C;  3VR5 A;  1L0X B;  4RH6 A;  2YYZ A;  3K6O A;  1H9S B;  5JEA H;  1PZJ D;  3C1E A;  1V1P B;  2B2U C;  4PMC A;  4A3D B;  4WFN 3;  4A3M B;  1EYD A;  5ELD A;  3ONA B;  2A6E C;  4U67 3;  1CA6 A;  1JC7 A;  1SE3 A;  2PZT A;  1MSG A;  1PTO H;  2NTS A;  1O7Z A;  2KED A;  1HQR D;  2F0W A;  4KY5 A;  4L6T B;  4G7Z C;  1Z47 A;  2A69 C;  3I3C A;  4XDX A;  1KDC A;  1SXT A;  5T1I A;  4RCO A;  5COY A;  2V4D A;  3MWY W;  4XTC S;  3ND9 A;  1GUT A;  4KJO A;  2LS0 1;  1QWY A;  1BO0 A;  1LLR D;  3FDT A;  1NR2 A;  4IN3 A;  1CK1 A;  4C3H G;  2J0T D;  2RKS A;  3HOZ B;  3NP8 A;  2R93 B;  5HUR A;  3UI2 A;  4OGQ C;  1GXD C;  2K01 A;  2F3V A;  2BDN A;  2Q8R E;  2IWH A;  4CBV A;  4QB4 A;  1QJO A;  4R8I A;  4X3K A;  3PO2 B;  5CGK A;  4KY6 A;  5DAU A;  2AWO A;  4Q5V A;  3M4O B;  2AQ2 B;  2F0O A;  1D5Z C;  2EYP A;  4OHJ A;  3GV3 A;  1LTA D;  1M4V A;  1A6X A;  2K28 A;  1EIG A;  2B2W A;  3D31 A;  2EYO A;  1PMR A;  2SOB A;  5JEA J;  4F87 A;  3RZO B;  3MEH A;  4I65 A;  4UAI A;  2K6A A;  2FIN B;  5JPN C;  1SMY C;  1EQV A;  3QG1 A;  1EY7 A;  1EZ6 A;  5I2Y A;  4RAU C;  4FF1 A;  3S17 B;  1F9S A;  5EPL A;  2JA6 B;  2F0G A;  1ET9 A;  5JAV A;  3RZD B;  4G7H C;  2K5D A;  1YNJ C;  3JAM E;  1T5X D;  5EKI A;  4FXD A;  1GOZ A;  4NMZ A;  5M3F B;  2BE5 C;  3QIA A;  1CFM A;  3SDZ A;  2KEC A;  1SEB D;  3SR1 A;  3D8G A;  1Y8O B;  4YIJ A;  2N55 A;  5G3L F;  1LTI D;  3NSW A;  1KDA A;  3K58 A;  5G3L D;  2E2J B;  2JA5 B;  2PCF B;  4IUP A;  4ZAI A;  1GUS A;  2EY6 A;  2R7Z B;  5JPM C;  2PW7 A;  1SYE A;  1JQY D;  2A74 C;  2DNC A;  1RD9 D;  2F0U A;  3NTI A;  1ROD A;  4BS9 A;  2A5H A;  1Q1E A;  3A55 A;  4M8A A;  1C4Q A;  3DM1 A;  1CHQ D;  3SHL A;  3HKZ B;  3R3O A;  4MIU A;  1U4P A;  4IUQ A;  5CV8 A;  1HA5 A;  4HCS A;  1MGS A;  3J80 L;  2R6G A;  3E6Z X;  2K33 A;  1WTQ A;  3RUZ A;  1DXM A;  3QJY A;  2TSS A;  1TWF B;  5K36 H;  2D5D A;  1BNZ A;  3KF8 A;  4DAV A;  1BF4 A;  1CTM A;  1A3V A;  4K2L A;  1ILQ A;  5EBC A;  4TKO B;  4R9W A;  4ZLT F;  1STY A;  2I46 A;  5C5L A;  4L8J A;  4KD3 A;  3I4L A;  1EFI D;  4S3S A;  1JB3 A;  2NZ1 D;  4K8I A;  2IX1 A;  3HP3 A;  2O5I C;  3NBI A;  4QF4 A;  2JP1 A;  2DN8 A;  4C3J G;  1FGB D;  1U4R A;  2OT2 A;  3P1H A;  2NVT B;  1NCV A;  1LAB A;  1C8C A;  5KNC A;  2M00 A;  2EY1 A;  1WTW A;  2PYK A;  1Z6H A;  4HN7 A;  4A93 B;  1K8O A;  2B8F A;  4RKB A;  4MN3 A;  1E2Z A;  3M4Y A;  5ELF A;  1HRJ A;  1PRT B;  2SEB D;  1AZP A;  1SYB A;  5KEE A;  1LTB D;  3T16 A;  1TS3 A;  1EIH A;  2E74 C;  1WVL A;  2A6E D;  3I72 A;  2F0I A;  3TBI B;  1AZQ A;  3A56 A;  4HED A;  1SBB B;  2HQE A;  2XN9 C;  1TU2 B;  3I91 A;  5FK9 C;  3Q23 A;  5BN5 A;  2K03 A;  2A69 D;  4HCE A;  4IUV A;  5BN4 A;  1SNQ A;  4ILW A;  5EPJ A;  3GTK B;  4JK1 C;  2B2Y C;  3IFD A;  1F2Z A;  5C6A A;  3LWE A;  2FMC A;  2F0F A;  3T53 B;  1IKM A;  1F9R A;  1NAP A;  2L9H A;  1RJT A;  1IL8 A;  2JA7 B;  3L9A X;  4ABN A;  4L63 B;  1O7L A;  2HDM A;  3TP6 A;  4O1N A;  3TP8 A;  3MTS A;  4ZQ3 A;  2A68 C;  3VA7 A;  2Z1C A;  3OIQ A;  2B2W C;  2PO4 A;  3PUV A;  1XTC D;  4JBW A;  1OO9 B;  3QOL A;  4K6L A;  1MD2 D;  2RDG A;  4RGN A;  3VA5 A;  4LAA A;  1LAC A;  3OPO A;  4BA2 I;  3BDC A;  3QWN A;  2QDB A;  4ZK9 B;  1DJR D;  1JWM D;  2PPB C;  1B50 A;  4ZYS A;  1G8Z D;  2ICI A;  3QB3 A;  1SJH D;  2AUJ D;  3H3V C;  1STH A;  4QCL A;  1V8Q A;  4EQO A;  1PZI D;  2B39 A;  3C1F A;  3RLF A;  3URY A;  2RSN A;  4K5W A;  3JAM L;  4ZKC B;  4X3U A;  1BCP C;  1I4G A;  1KDB A;  4XYO A;  3IKJ A;  1MI2 A;  5IGB A;  3MFY A;  1S5D D;  1JR0 D;  4RGT A;  3HOX B;  5FOB B;  2NVQ B;  2A73 B;  1I4X A;  2F0Q A;  3FPU B;  2KUM A;  2HDL A;  2LFN A;  2KOL A;  4CJ1 B;  1YNJ D;  4CJ2 C;  2L5T A;  4RA8 A;  1ESR A;  4BBS B;  2BE5 D;  2EYH A;  1WTP A;  3NQI A;  2D62 A;  2ID0 A;  2F0H A;  2KVM A;  4H0L C;  1A3U A;  1BXT A;  3FRP B;  1PLF A;  3KBX A;  1UNS A;  2BDO A;  1X3Q A;  2K7V A;  3J7Y W;  1FNW A;  3FKI B;  1SFO B;  1H9S A;  4A3G B;  5C0X G;  4PV1 C;  4ZRZ A;  5D3I B;  3AMU A;  1V1P A;  1M8A A;  1TT2 A;  2PW5 A;  2K32 A;  2OEO A;  1CT1 D;  2JYO A;  2JEB I;  2L0C A;  1ENF A;  3I4M B;  5JJZ A;  2L12 A;  3MA2 B;  2DNE A;  2Z4H A;  5KGU A;  1I6H B;  4GZY C;  4OIK A;  1I4P A;  1EY4 A;  4FXK C;  5DM6 3;  3N6R A;  3SEB A;  4DF7 A;  1WTO A;  3D4R A;  1B44 D;  2TMP A;  1AFP A;  4K8J A;  2X69 A;  2EY2 A;  1NSN S;  2PNR C;  5M5W B;  2NBF A;  3I70 A;  3MC0 B;  4KHV A;  1F2Y A;  4KK7 A;  1G2T A;  2EJM A;  3WDN A;  2CHB D;  5I2X A;  5I4D A;  3DWP A;  3R8B A;  1PDQ A;  5IGF A;  2EDG A;  1AW7 A;  4KD4 A;  1HTP A;  5CV9 A;  1HPC A;  2X6G A;  3OSO A;  5AFW A;  5EPK A;  2WV6 D;  5C3E B;  3BVG A;  2CVR A;  2ZXP A;  4XYQ A;  4F88 A;  3CQZ B;  3W2D A;  1HHV A;  5J22 A;  2G9D A;  2M2L A;  1B9N A;  2CQA A;  2WB1 B;  3TN2 A;  3MXP A;  2AWN A;  2F0M A;  2MPM A;  3BYY B;  1S5F D;  2SDF A;  3OWE B;  2RBM A;  2F0S A;  2H4O A;  3MXN A;  2ZXO A;  2JSO A;  1GHK A;  2IX0 A;  3D4W A;  1B4O A;  3H94 A;  3SK5 A;  3O13 A;  5A2Q L;  3CHB D;  3G7L A;  3PUX A;  1JIC A;  3PUZ A;  2MP1 A;  2EYM A;  4CKE A;  3HZX A;  4F7X A;  4KTA A;  4H7B A;  1DON A;  4KV6 A;  3D4D A;  4V0B A;  5F2D A;  5LL6 S;  2NB0 A;  4LMQ D;  1EY9 A;  3VR2 A;  1GUW A;  3V2T A;  3TZD A;  4OL7 A;  5I9O A;  4Z9C B;  3TP7 A;  5DNF A;  5C4X B;  3NWS A;  4DN4 M;  3OHX C;  1EWH A;  1NUC A;  1B53 A;  4OIJ A;  4NKL A;  2SNM A;  3HOW B;  4ID6 A;  5FLX L;  3GTG B;  3L7Z C;  5ELE A;  3NWT A;  4DK1 A;  5FKA C;  1DM0 B;  4FF4 A;  3NXW A;  4C3I B;  1ZEQ X;  2DY7 A;  4A3K B;  2D9U A;  3M7G A;  1I3Q B;  1SND A;  2KJX A;  3KLS X;  2F0E A;  1Q12 A;  1QG7 A;  4OO1 G;  4KMU C;  4BA1 I;  1TWH B;  4B9X A;  5C0X I;  2PQE A;  1EL0 A;  4EQN A;  4DXF A;  3WOE A;  4C3H B;  4IQZ A;  4N9P A;  1IHZ A;  2F0N A;  1EEI D;  3OMG A;  1TVX A;  2O2L D;  1ENC A;  2A68 D;  4XQQ A;  2C9O A;  4U68 A;  4J1M A;  1EQT A;  3PO3 B;  5CR3 A;  4ZKB B;  2ENB A;  4KY7 A;  1E2V A;  1LTT D;  2L11 A;  2FMM A;  5C3W A;  4HTH A;  4ODG A;  5C5M A;  5EBD A;  4IUT A;  5C44 B;  1KAA A;  1CQV A;  2E2D C;  1VF5 C;  2XWB B;  3M85 A;  5I6W A;  4N9T A;  1PTO B;  3SXH A;  1JWS D;  3ITP A;  3VYS A;  1Q90 A;  3A54 A;  4PQX A;  1EU4 A;  2F4I A;  1SNP A;  1GUO A;  1OXV A;  2FJ2 A;  1BCP F;  3R2T A;  1DOK A;  5COR A;  4HMI A;  3MFG A;  1KLU D;  1KAB A;  1A2T A;  1BCP D;  1MBY A;  1I50 B;  2NWG A;  1HUN A;  2RVL A;  3BVZ A;  2K04 A;  4NDX A;  4K2K A;  1PFN A;  1U4L A;  3BDO A;  1OXU A;  4RGM A;  4F8M A;  3SK8 A;  5IGG A;  3F2U A;  1R4P B;  5LHY 1;  1SNC A;  3Q0A A;  1SYD A;  5IGC A;  4A3J B;  3U9O A;  1TS5 A;  3HS0 C;  1QIL A;  1SJE D;  3HOU B;  3K5O A;  4KHZ A;  2O4X A;  1E0B A;  4KKT A;  3G6J B;  1SYG A;  1CA5 A;  2F0V A;  2VNU D;  2YU9 B;  3QOJ A;  5EKK A;  3HGB A;  1DZ1 A;  4B9W A;  3BZD B;  1CI3 M;  4UDU C;  4TRD A;  1WTV A;  3R2I A;  1G29 1;  1KLG D;  3K5L A;  3U9S A;  4CGY B;  3VYR A;  1HQM C;  3S2D B;  1HA6 A;  5EKL A;  4A3E B;  3EVQ A;  1I6V C;  2OXP A;  4FO2 A;  3HRZ C;  3X3N A;  2KQ3 A;  2KEE A;  1OXT A;  3A7A B;  4K5X A;  2HUG A;  1UUP A;  4LJZ C;  2E75 C;  2Z4I A;  1I4R A;  3C46 A;  4LK1 C;  4TQU S;  2F03 A;  2E2H B;  1VDZ A;  3I90 A;  2SNS A;  4K14 A;  4OO1 I;  4HMJ A;  1B2T A;  3QO2 A;  3PIO 3;  1FNV A;  4DK0 A;  3GTL B;  5EJW A;  3HOY B;  2NN6 G;  2F0D A;  1KNA A;  1XX8 A;  2WIN B;  1LTR D;  1VF7 A;  2J4X A;  1KTK A;  3DWA A;  3J81 E;  3MZ5 A;  5ELB A;  2PMZ B;  1D1I A;  1R9T B;  1O78 A;  3H91 A;  2X6L A;  2XVS A;  3PUY A;  1IYU A;  2MJ8 A;  4QIW B;  3BS1 A;  3A8I E;  1A3T A;  4WOR A;  4PMB A;  1W6J A;  1QE6 A;  1D1K A;  4XT3 B;  3OW7 A;  2JE6 I;  4R8N A;  3X3M A;  1A2U A;  3LX0 A;  3AB9 A;  3K57 A;  2R61 A;  3EA6 A;  1PTO C;  4DNT B;  5ELC A;  1PFM A;  5M5Y B;  5CV4 A;  4CJ0 B;  1IW7 C;  3HOV B;  3BG3 A;  2B2T A;  2KA7 A;  5JOB A;  3DXJ C;  2AUK A;  3VR3 A;  4FXG C;  1ILP A;  2C5C A;  3CKI B;  4DA2 A;  5J39 A;  5C0X H;  4A3I B;  2IW3 A;  1FR3 A;  3TME A;  5KYI A;  1I4H A;  2KCC A;  4FYD A;  2WAC A;  1LT6 D;  1ICW A;  3A7L A;  3CRK C;  1TKW B;  4Q0F A;  3I8Z A;  1SDF A;  5C4J B;  2EZV A;  2LMC B;  4PNY A;  5ISR A;  4IUU A;  3VYT A;  1O80 A;  1ZXT A;  1LT4 D;  3WOF A;  1LT3 D;  1Q3L A;  4J6H A;  2JA8 B;  1W6K A;  4XIG S;  1GJX A;  3OMC A;  1Y69 U;  3KLR A;  4EVO A;  5KYL A;  3E5S A;  1SYF A;  1S5B D;  3K59 A;  3PV0 A;  3A8K E;  4DFA A;  2G9H D;  1ZYR C;  1AP0 A;  5IGD A;  1O7Y A;  3C2P A;  2EY5 A;  5IGE A;  3CRL C;  2EYJ A;  2AQ3 B;  5C4Z A;  1JOO A;  4DAY A;  3NTH A;  2D2C C;  5CMD A;  4CKB A;  3ZYY X;  1D5M C;  1KNE A;  3TDQ A;  1CM9 A;  3R93 A;  1QNK A;  2Q8T A;  2K05 A;  3RD4 A;  4HSV A;  3CU7 A;  5J1Z A;  4ZUI A;  1STN A;  1QOH A;  5FO9 B;  2EXZ A;  1VCI A;  2IJ0 A;  3GD7 A;  4A3B B;  5CBA E;  2MGS A;  2NN6 I;  5CV6 A;  4DAP A;  4IFD G;  5C0X J;  1Y1V B;  3NHH A;  1PRT C;  2IT1 A;  3NBH A;  3GTP B;  3FEW X;  2KCN A;  3GO5 A;  1EY0 A;  3OOC A;  1UAP A;  5HGT A;  3GP7 A;  1WCM B;  3FVQ A;  2R92 B;  4BY7 B;  1J9O A;  5JVG 3;  1ML0 D;  4IUN A;  1F9Q A;  5D14 A;  2E2I B;  1PFB A;  1H9K A;  1EEF D;  5CV7 A;  1HUM A;  3S14 B;  3DHQ A;  3S9W A;  3KBG A;  1DD2 A;  1G6Z A;  2F0P A;  2QEJ C;  3VR4 A;  1IKL A;  5CBE E;  2F0T A;  4EQP A;  3BYT B;  3S1R B;  2O5J C;  1CQF A;  2BA0 A;  1ESF A;  2K1B A;  3SK4 A;  1J8I A;  2PZW A;  5CV5 A;  3T56 B;  4OO1 H;  2I07 B;  3K0Y A;  4WRD A;  1FD7 D;  2B2V A;  4BY1 B;  3K5N A;  1IYV A;  3S2H B;  2IPK D;  3BDL A;  3GQB A;  1B3A A;  1Y8P B;  2R3Z A;  2AQ1 B;  2L55 A;  3PMF A;  4HR7 B;  2FFK B;  1FNU A;  2K5W A;  2Y0S B;  2L4N A;  4C3I G;  1EYC A;  3H0G B;  3C3L A;  2MUY A;  1OXX K;  1YNN C;  3J81 L;  4Y7N B;  3GTM B;  2XSC A;  1K8M A;  2EE1 A;  2VXW A;  4NP5 A;  2WKC A;  1VMC A;  3SE0 A;  2RDF A;  4AYB B;  3P7J A;  2B2Y A;  5JEA G;  1SNM A;  3KK7 A;  3Q22 A;  2XNA C;  4KKS A;  1D6E C;  2ZXR A;  1AEX A;  4O42 A;  1QCB D;  2QF7 A;  5I9P A;  5K5P A;  2BA1 A;  2LKV A;  3T13 A;  4FP5 D;  1PTO F;  2EYF A;  1PZK D;  1HCZ A;  5C3X A;  2EYL A;  4KI0 A;  2B2T C;  1PTO D;  1TWA B;  3D6C A;  4X3T A;  5KRU A;  1STE A;  2A6H C;  2HCC A;  3S1M B;  1PXU A;  1DCZ A;  3K5M A;  2HCI A;  1GUG A;  1IW7 D;  3KUP A;  5EQ0 A;  5M9O A;  1XWE A;  1OXS C;  4V19 0;  4C2M B;  1CZW A;  1HFN A;  4IFD I;  1HTL D;  2VUM B;  1A15 A;  2XIW A;  3FMC A;  1ZKO A;  4DGZ A;  5D65 A;  1D5X C;  1Q8I A;  4BBR B;  4FF2 A;  4ZUJ A;  1TQO A;  1U9R A;  1H9M A;  1DOM A;  1RF2 D;  3TZU A;  3MVV A;  3V96 A;  1TY2 A;  1Z7T A;  4DU9 A;  1LT5 D;  1XXG A;  4RHS A;  1WD1 A;  4XQN A;  2FHT A;  4IAL A;  1XYI A;  2N88 A;  2WKD A;  2IL8 A;  3NK9 A;  2B8G A;  3T4A C;  1S5E D;  1F77 A;  3DEP A;  3PUW A;  2F0J A;  1SE4 A;  1ZYR D;  1B9M A;  3ERQ A;  1QB5 D;  3TP5 A;  4C1N I;  3ND8 A;  4P2C B;  5IT9 E;  4XT1 B;  4J8Q A;  3W3A A;  2LY7 A;  2QIL A;  3H09 A;  3RMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...