2K1BA

Solution nmr structure of the chromo domain of the chromobox protein homolog 7
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
EQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 7
publication title Solution NMR structure of the chromobox protein homolog 7.
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k1bA00
5T1GA 1DZ1A 1M8AA 3MTSA 5D65A 4QUFA 2L12A 1VMPA 4IUQA 1EL0A 3SVMA 3H91A 1MI2A 2L4NA 1PFMA 5EKIA 2K01A 1F9QA 3Q6SA 2M2LA 1SSOA 1TVXA 3P7JA 1WVLA 2K28A 3DEPA 1A15A 1MSHA 1QE6A 4XDXA 1SDFA 2FINB 2RA4A 1ILPA 4X3UA 1DONA 2H1EA 3QO2A 3I90A 1SAPA 1IL8A 2EOTA 5T1IA 1U4LA 1IKMA 2DY7A 1B2TA 1MGSA 2JP1A 4QUCA 1Q3LA 2DY8A 2KVMA 4U68A 2B2YA 2FFKB 4RA8A 1XX8A 3F2UA 1DOKA 2KEEA 2L11A 4IUUA 1J8IA 2XIWA 2MGSA 3DM1A 3D6WA 2X6LA 2IL8A 1JE4A 1G2TA 1WTVA 4HEDA 1CA6A 1E0BA 2J7ZA 5CMDA 2NWGA 2NZ1D 4ZKCB 1HUNA 1RHPA 4IUTA 1IKLA 1RJTA 4IUVA 4NW2A 1B53A 2B2WA 1KNEA 2K04A 2MPMA 2KOLA 4UAIA 1EIGA 4ZAIA 1DOLA 2B2UA 3LWEA 4DN4M 1JICA 1AZQA 5DNFA 2SDFA 2B2TC 1EIHA 1NAPA 3ONAB 4CJ1B 2B2VC 4RAUC 1ILQA 2RSOA 1B50A 3I8ZA 2Q8RE 5CBEE 5EJWA 2K05A 2RSNA 4CJ2C 1WTXA 2CVRA 1BNZA 2X69A 1RODA 3HP3A 4IUPA 1WTQA 2X6GA 1X32A 4MN3A 1B3AA 1NR2A 2MJ8A 1ESRA 2KUMA 1PDQA 2L1BA 4LMQD 1NR4A 5EQ0A 1EQTA 1HHVA 1LV9A 1MSGA 2FHTA 3IFDA 1CA5A 2HDMA 3IL8A 2D9UA 1PLFA 4X3SA 4ZLTF 2KECA 2FMMA 3MWYW 1HA6A 2KEDA 2N88A 1HFNA 2B2WC 1BF4A 1O7ZA 2NYZD 1WTPA 2HCCA 1WTRA 2B2UC 3TZDA 3I91A 1WTOA 1ZXTA 2R3ZA 1J9OA 5JJZA 4R8IA 2Q8TA 1RTOA 1VMCA 4OIJA 1NCVA 2RVLA 1GUWA 1HRJA 3UI2A 4HSVA 5CBAE 1PFBA 1G6ZA 3GV6A 1DOMA 1WD1A 1O80A 5D14A 1U4RA 2B2YC 1G91A 3TN2A 1F2LA 1F9RA 3KBXA 1AP0A 5AFWA 2BDNA 2K03A 3FDTA 3G7LA 1WTWA 1U4MA 4X3KA 4XT1B 4HAEA 2EE1A 2K1BA 4RWSC 5E4WC 1HUMA 1EOTA 4XT3B 1O7YA 1F9PA 5COYA 4R9WA 1U4PA 2HUGA 1QG7A 1S4ZA 5CORA 1BBXC 1WD0A 3FPUB 1B4OA 3I3CA 2L9HA 2N55A 4OIKA 3N52A 4X3TA 5E4XA 1BO0A 3KUPA 2B2TA 2JYOA 2B2VA 1HFGA 1ICWA 1QNKA 4O42A 1X3PA 1XYIA 3DEOA 2HCIA 4ZKBB 3GV3A 1RTNA 2FJ2A 2EPBA 2HDLA 2VXWA 5EPKA 1F9SA 3R93A 1KNAA 1C8CA 5EPJA 1G2SA 1AZPA 1CM9A 4ZK9B 1X3QA 2MP1A 4CJ0B 1PFNA 4HCSA 5EPLA 1ML0D 4IURA 4MHEA
chains in the Genus database with same CATH superfamily
4DXGA 1N32Q 1F2ZA 3H3VH 4UP7A 3MEFA 4ZUJA 4CDFC 1L1OA 3H0GG 3S14B 1B9NA 1F9QA 3CQZB 3I4MG 1ILPA 4XDXA 5IP9G 5C4XH 2B8FA 2LKVA 1MGSA 1QWYA 3ER0A 3KLWA 4R4CA 2IT1A 3CCQA 3MFGA 4KD3A 4RA8A 2NVTB 2KEEA 4IUUA 1EIYB 1I94Q 1KL9A 2A6HC 2B8GA 4KHPL 1I50B 5M5XH 1RHPA 1K9MC 1RJTA 4YCUA 4GS3A 1NY4A 1PH1A 2LXJA 4DR6Q 1QNUA 1Y1WB 1STEA 4P71A 1D1KA 4DNTB 2KOLA 3J80L 4GN5A 4EQPA 1TS2A 4RAUC 3OMGA 1HZAA 4FDBA 2LSSA 2QDBA 2UXDQ 1WCMB 4BY1B 2X69A 5AJ3L 3GTQB 3S1MB 4G57A 2I5HA 4PNYA 4YY3Q 1D2BA 5LMUQ 1NR4A 4DR3L 4C3IH 4GOPC 1VQAA 2R92H 1ENFA 3HOVG 1V8QA 5L37A 4UY8C 2NYZD 3ITPA 2XVSA 2ENBA 4LJZC 4X6AH 2A6ED 5I2XA 4XIGS 5I2YA 2O4XA 3CU7A 1EQVA 2CH4A 4IFDH 2UUBL 3V96A 4ZUIA 5CV5A 1N34L 2IPKD 4LF9Q 3T1HQ 3DWAA 3HKZB 3KOJA 3S14H 1SE4A 3CQZH 1GUSA 2KCMA 4KY6A 1STNA 3J80i 3VYRA 1FNVA 5IT9L 2NTTA 4MTNA 2XWBB 2ZJRA 2JJQA 4XQQA 4L8JA 2F0VA 3LWUA 2NVTH 4DV0L 3GTLB 1KXLA 2C9OA 3NBIA 3HKSA 1GKHA 4HMJA 2HCIA 5IYCH 1IBLQ 1I50H 1H9SB 4PZ6A 3SDZA 1KNAA 4B3RL 2PW5A 3K8AA 3PUXA 2RKSA 4HCSA 3BZDB 3S16H 1AN8A 4H44C 3GTGB 1WCMH 1SYDA 4LUVA 3GTQH 3S1MH 3RLNA 3BYYB 1YJ9A 3Q6SA 1LTGD 2M2LA 1UE5A 3I73A 3RMHA 2V4DA 3KLRA 4LF6Q 3R2TA 4POGA 1SAPA 1KIXA 1VCIA 3EQLC 3PSIA 4QUCA 2KVMA 4HTHA 1BBWA 2IX0A 5H1SE 2EVBA 4OELB 4A3EB 4OXPA 4KKTA 4HEDA 1S5ED 1CA6A 4JI5Q 3P1HA 5M3MB 3F2CA 2F0SA 1Q8IA 2K04A 4UAIA 5ELBA 4ZAIA 4CDDC 3DLLA 1D8LA 1N32L 4FO2A 4DV7Q 3W2DA 1S5DD 3NBHB 4UPAA 3CCRA 5K36G 1RODA 3A7AB 3G6JB 1PVOA 1I4HA 2Q2UA 1EIFA 1NR2A 1I4XA 4DUYQ 1W6KA 1YITA 1LV9A 4A3CH 1VQEA 3AQQA 1KDAA 1L2FA 4ZLTF 4J15A 1KLUD 3GDEA 3K81C 3JAML 3I4OA 1XNQL 4GN3B 3MC0B 5IGEA 3M9BA 1NBWA 4DR6L 1HCZA 1HZ9A 1NE3A 4M1UB 2CWAA 4Q5VA 2A6HD 2PNHA 4QY7A 1HR0L 5IWAQ 4F87A 2UXDL 2K5DA 4L6TB 3CCMA 3AB9A 2NZHA 4XT3B 1CKNB 1HH2P 1SROA 4YY3L 4A3FB 3M4QA 5CORA 5LMUL 2E2IB 5HURA 5JJKA 4L63B 1B4OA 1E2WA 2L9HA 3GD7A 3GTKH 5E4XA 1A3TA 3T4AC 1G291 2K4KA 2A5HA 2B2TA 2JYOA 4A3EH 1PH5A 2ICEC 2Z0SA 4A3MG 2Q2HA 1GO3E 3HG9A 4OX9Q 3LGJA 5M3MH 3A54A 3QWNA 5EPKA 2KCTA 3TP8A 3C1FA 1BUVT 1QOHA 3F2BA 3ULJA 5I6WA 1MJEA 4MIUA 3BYTB 3OIQA 3T1HL 1VQHA 5FJ8G 3X3MA 4OO1G 3M3YB 2DN8A 4RHRA 1EL0A 1YJWA 4R8NA 1RF2D 1T5EA 1H9SA 3H91A 4LUZA 4JYAL 1VQKA 1SSOA 1E1TA 4X65Q 1WVLA 3Q0AA 3BDCA 4JI4Q 1II3A 5HY6A 1DONA 3VA5A 2G9DA 3CCLA 1OXSC 3KYHC 1H9JA 1UNSA 3A5ZB 4LW1A 3EFXD 5NUCA 3CCVA 5C6AA 1BCPC 2IX3A 3F2UA 4XYOA 3D6WA 1IBLL 2AUJD 1TS3A 5DM73 5IP7H 5C5LA 3A7LA 3D3RA 1SYFA 2KHJA 3RR5A 2MO0A 1N33Q 5IE8A 3LNNA 3CF5A 5EGTA 1PXUA 1LTAD 1X3FA 1ILQA 1B50A 2C35B 1QB5D 1FR3A 5CBEE 5M3FB 4A3FH 4C3JH 3FEWX 3IFTA 4R4OA 1L0YB 2E2IH 2Q8IB 4TQUS 3UDFA 4IUNA 1VF5C 5IGGA 2KUMA 4O0AA 3RZOB 4FVMA 2Z6KC 1PLFA 3HOUG 3NBHA 2K6AA 4H7BA 5KRUA 1SFOH 2PW7A 4BA1I 2GVAA 1YIJA 4LF8Q 2JA8G 2JA7B 1B1ZA 4OWTB 1H95A 3MAQA 1KLGD 3PO2B 4A3DB 4DV7L 3M3YH 4FNFA 1F2LA 2WFWA 3J7AF 4KJOA 1VQFA 2AUKA 3E9HA 2F03A 1GVPA 4X3KA 4XT1B 2ALYB 1Z6HA 4GLVB 5FK9C 4HJAA 1JOQA 3HOYB 3URYA 4FP5D 2R93G 4DGZA 2EY6A 3F1ZA 2VY3A 1CKNA 1HZCA 1PHJA 5IYDH 2FJ2A 2EPBA 2HDLA 2IWHA 2OEOA 4CGYB 1V1PB 3M7GA 5FO9B 2G5DA 4ZK9B 1S5CD 2F0UA 2IJ0A 4CJ0B 2N8NA 2I5LX 1YHQA 4LK1C 1AH9A 3MTSA 5M3FH 2L12A 5IWAL 4DV6L 1K8MA 2L4NA 4E6IA 4BS9A 5C0XG 3M7NA 2NN6I 3RZOH 4X64L 4LF7L 2QEJC 1PTOC 3QO2A 2BA0A 3I90A 1IKMA 2JP1A 3FKIG 1NUCA 1JWUD 1QCBD 2ZTEA 1TY2A 2JA7H 5GQOA 2DUDA 4FXKC 4QCLA 1UUPA 3H6MA 2M9VA 1L1OC 1DXMA 2E74C 4A3DH 5JAVA 1OO9B 1EIGA 4KHZA 2SDFA 4L5TA 1D5ZC 3HS0C 3SK4A 4C1NK 2RSOA 5M5WB 3C2PA 3A55A 1LT3D 1TS5A 4CJ2C 2L0CA 4X65L 4DU9A 2YTXA 3RZDB 1O7IA 3HOYH 2VUMH 3QB3A 1MJCA 1NJIC 2G9HD 4HIKA 3NXWA 3IFDA 1TWAB 3D4RA 2EYPA 3EJIA 5EKKA 2FMMA 3HOZG 4IPDA 1BF4A 4YWKA 1OXVA 2ZT9C 3Q22A 2PQEA 1D5XC 3E0EA 3PIOA 3E3XA 1KQSA 4L5SA 4OL7A 4KLKA 1VQPA 1BCPD 2RVLA 5J3BA 2Y0SE 3L3OC 3AFQA 1N33L 1YVCA 4EX5A 1VQGA 1G6ZA 1WD1A 2KHSA 2RDFA 1SN8A 4GNXC 1YNJC 5IODA 3NHHA 2WAQE 3C46A 1PZID 3PO3B 3K7AB 2N55A 2IHEA 4DUZQ 3I56A 3TP5A 1BO0A 4RCOA 4K5VA 2I46A 1QNKA 3MXGA 1X3PA 3HOWH 2UUAQ 4LF8L 4UP8A 3JC66 1DD2A 2EYMA 3RLOA 1CM9A 1JOKA 2RHSB 3OWEB 5DLQE 3K5NA 1EUJA 2IX1A 2F0LA 2EJMA 5M5WH 4Z9CB 3J81c 3K80C 1TWGB 2V1CC 4RCNA 2BCOA 5EKIA 3FRPB 5C4ZA 3RZDH 1TWHH 4BWGB 2F0NA 1FJGQ 4RMFA 4DV1Q 4PQXA 1TWAH 4IN3A 1Y69U 3KF6B 2F0DA 2JA5G 2K75A 4P72A 1X6OA 1EQRA 1LTID 4BBSB 1A3UA 2XRSD 1IW7C 3MXNB 5JVG3 1E0BA 5LL6X 2NTSA 2Q2IA 4KI0A 1G91A 2WV6D 4G4KA 3CRLC 4NXMQ 4F88A 2E8GA 3EROA 4A3IB 3I4NG 1A6XA 1MIUA 2MFIA 2EIFA 5GAGC 1V1OA 3PO3H 1ESRA 1TY0A 5C4XG 2CHBD 4APVA 2Q2TA 4JOIA 3J7AV 1EWCA 3K6OA 3VA7A 4GKJQ 1PTOD 1DM0B 1WTOA 1BR9A 2R3ZA 3HZXA 3ND9A 1NCVA 2QCPX 4YCVA 5I6YA 4GKKQ 4DAYB 1W2BA 3A5UA 2I07B 2SEBD 2QW7A 4AYBB 1M1KC 2XSCA 2Y0SB 3M4PA 2KQ3A 4JW0A 1SMXA 3A0JA 1WD0A 2WB1G 1HA5A 4C3IG 3N52A 5JVH3 5G3LD 1X3GA 2ID0A 1V9PA 1LTSD 3DMUA 3EN2A 4FF3A 4BBSH 1VS0A 3NTHA 3C3LA 3UDIA 3AMUA 1I3QB 1F9SA 3WOEA 1G2SA 1EFID 1H9KA 4A3GB 1HNWQ 2CH4W 2NUCA 3S1NB 3BJUA 1IYVA 1PFNA 4R1JA 4BY7G 4DK3C 1N36Q 1HZBA 3R3OA 3SK6A 2PZTA 4LFBL 1PYBA 1YJNA 3V2TA 3O13A 2CQAA 2K28A 1JR0D 3AU7A 5KYIA 1KAAA 1YNJD 1CHPD 1KRSA 3EBEA 1JWSD 5KYLA 4WJWA 4DUZL 3ERQA 4I7AA 4LFCQ 1E2ZA 1KTKA 3UDGA 1G8ZD 2XIWA 4QIWE 4PG3A 5IYCG 5EBDA 1A2UA 1RKNA 2K5QA 1JJ2A 1B53A 3KF6A 5KNCA 2F3IA 1KNEA 5GROA 3T56B 1QVCA 3CW2C 2HD3A 4KHVA 1GUNA 2OT2A 4JI6Q 1SNDA 2VB2X 2B2VC 3MXNA 1WCMG 1M4VA 3E5SA 3RNUA 1WTXA 2WINB 1J5EQ 2JXMB 1C4QA 3A8IE 4DV1L 3P20A 5D3DA 2EY5A 3VDYA 1Z9FA 4DAVA 1S40A 3WDNA 1NMFA 2K50A 4BBRH 4B9WA 1SEBD 1I3QH 4XQJA 1PZJD 2F0MA 3FP9A 2OCEA 3CRKC 3KLSX 3CXCA 4DV2Q 3K5LA 1D1IA 4A3GH 4OIJA 5JPMC 2F4VQ 4HIDA 3MEHA 1VDZA 4DR7L 2MO1A 2AQ3B 5CV7A 1QVGA 1IW7D 2SNMA 5D14A 3HKZG 3GTPB 4NXML 3BVGA 2YTYA 3I72A 1ESFA 1K3RA 1H9RA 5COYA 1JQYD 1QG7A 4DAYA 2F0PA 4I65A 1HNXQ 4OIKA 4A3CG 2JK8A 5F2DA 3KUPA 4F8MA 1B70B 1X56A 4GKJL 1ICWA 1HR0W 3PUWA 1E24A 1RTNA 4N8X1 5I4DA 3S1QB 4OWWB 1VQOA 1K8AC 2MP1A 4DK0A 3S1RB 1FYCA 2AKWB 4BXXG 5DM63 4LFAQ 4UHVA 1RD9D 3PIP3 1VMPA 5LHY1 2ZJQA 1PFMA 4NPSA 3P7JA 1AE3A 2JQOA 2EJFC 1SDFA 4ILWA 4Q0FA 2DJGC 1B2TA 2B2YA 2RDGA 5GADC 3BVZA 3TREA 2FFKB 4A3EG 2UUCQ 1Y1WH 2JSOA 3SK8A 3OWFA 1EY9A 4DF7A 1RCVD 5M3MG 2NZ1D 1HNWL 3HOVB 2R7ZB 1IKLA 4LUOA 3W1GA 4NW2A 4BY1H 3T53B 3GTPH 2NN6H 2B2UA 5KNDA 1F2YA 4QIWB 1BKBA 2Q8RE 4DAMA 1RL2A 3HRZC 2K05A 3DWPA 3K7UC 3H15A 1WTQA 2MJ8A 2N78A 2GN5A 4LFCL 4HIMA 1MSGA 2NB0A 5C3EB 2HDMA 3LX0A 5IP9H 1KABA 1QILA 1EY8A 2ZTDA 3BVMA 1CKMA 1PFSA 2RCNA 3S1QH 4WJ4A 1L0WA 4JBJA 3QOLA 2RDHA 5KIXA 5IP7G 1N9WA 1UE6A 4CKCA 3S1RH 1SYBA 1PFBA 1STGA 3K58A 1PV4A 4WFN3 3VR6A 2ZJPA 4JI6L 2L5TA 2F4IA 3FDTA 1XPRA 1CFMA 3DWQA 1J5EL 4A3FG 4C3JG 1VQCA 1NSNS 3GTLH 4DXFA 1D5MC 2HUGA 1WOCA 1E2VA 4DNIA 5C4HA 4IPCA 1ICFB 1I94L 2QGQA 2Z9HA 1YI2A 4GOPB 4H0LC 1HFGA 4O42A 1J6QA 5ELNA 1Q1EA 3IRBA 4ZKBB 2F0QA 4DV2L 2R7ZH 3GTGH 1JE5A 4S3SA 2F4VL 2EZVA 2IY5B 1HXYD 2YTVA 3TDQA 3CP0A 1SNOA 5EPLA 2R7DA 5GAHC 1SNPA 1C0AA 3A8KE 4WJ3M 5T1GA 4QUFA 5C3WA 1EU4A 4XQNA 5KGUA 4J6HA 1BQQT 2O5JC 1CZWA 4A4IA 3QOJA 3CCUA 1A15A 4ODGA 3ZJYC 1HNXL 1JB3A 5C3EH 3I55A 1YNXA 1ZEQX 1QZGA 2ASBA 1XX8A 3DM1A 2MGSA 3KFUA 2N3SA 1JE4A 5IYDG 2OQ0A 5LL6S 1EWIA 2ZM6Q 5CMDA 4LF9L 2WKDA 5ELOA 1TIID 1DOLA 1EIHA 3PGZA 4V190 3V05A 2A69C 1CQVA 3I8ZA 5JPNC 3RD4A 2MHVA 5IGFA 3UE0A 5CV4A 1UAPA 4H13C 4HIOA 4A3BG 2ATWA 1I6VC 1A0IA 5IT9c 3TMEA 3ULLA 4KN7C 1KDCA 1Q90A 2L1BA 5EBCA 5HGQA 1GHJA 1ET6A 2FHTA 1HA6A 1IXRA 4RGTA 3J7YW 4AQYQ 2XGTA 1ZXTA 2JA7G 1C48A 4DK1A 5JJZA 4A75A 2E5LQ 1GD7A 1VQDA 3T16A 2QA4A 4A3DG 3NP8A 4OHJA 1P16A 1U4RA 2NVQB 2IHFA 2K03A 3U50C 4LF6L 2I0QA 3OW2A 4P75A 3CKIB 4JPBW 2HQEA 2K1BA 1YEZA 1CSQA 3F8TA 1SNMA 3HOYG 4AIMA 4OGQC 3S9WA 2VUMG 4K5WA 1K3BC 1BBXC 4ZQ3A 2LXKA 3CPWA 4DV3Q 4JI5L 4A3KG 1JT8A 4FYDA 1XPUA 2ZXPA 1AFPA 3OHXC 1I4QA 1JJCB 1EWHA 4R4TA 1XYIA 1Z7TA 2B63G 4K6LA 1PH3A 3MXUA 2K14A 1XMOQ 2DGYA 3SHLA 5JEAH 2L55A 3CC4A 1PH9A 2AQ2B 4K2LA 1UEBA 1FGBD 3A56A 5M5YB 3AFPA 1ML0D 1CZGA 2F0EA 4GOPA 5C44G 1OTCA 3S2DB 4DUYL 3D31A 4DR2Q 1S3OA 1CUKA 4NXNQ 1K83B 2A68C 1SLJA 1LACA 2OQKA 4CHTB 2PCFB 1B44D 5BR8Q 3CCEA 2F0TA 1P8LA 1U4LA 4DA2A 4A3JG 1JCKB 5J22A 3JAMc 3OTOQ 2ES2A 3S24A 1JJGA 3L9AX 1DOKA 1TXYA 4RGOS 1GUOA 1LO5D 1CT1D 2PPBC 2O5IC 1G2TA 3J7A5 3HOWG 1WTVA 1D7QA 2NVXB 3HOUB 3SE0A 2ICIA 2B2WA 3L7ZC 5CYUA 3M4OB 4EVOA 2NVQH 5DNFA 1YNNC 1NAPA 1LT4D 3ONAB 4IPGA 1PH4A 3AYHB 2QEXA 2HIVA 3NENA 2K5NA 5CV8A 1BDOA 5IYBH 1XMQQ 1BNZA 1MKHA 3J7ZC 2RCFA 2C5CA 2D0PA 2EDGA 1I4PA 2EYHA 3NTKA 1EQTA 1X65A 1GHKA 4OX9L 1IYJB 2D9UA 4X3SA 1M90C 2N49A 1SXTA 3VYTA 3BS1A 2EJGC 3MWYW 3CD6A 5CC4A 1BCPB 4G7ZC 1KHIA 1WTRA 3PO2H 3NK9A 1Y1VG 2R93B 2ZM6L 1FD7D 3J81i 3HOXB 1HNZQ 4OWXB 3BZKA 2KENA 4B3MQ 4KKUA 4RFBA 3D4DA 3S2DH 2A1AA 1LUZA 3KBXA 1AE2A 4JI4L 1HJPA 3NPPA 1U4MA 3R8BA 2VS1A 5GAEC 3F2DA 2A74C 1SMYC 2A69D 1WTHA 3MHBA 4G7HC 1A8VA 1KDBA 1HPCA 4JI3Q 4C3HB 4KN4C 2PZWA 1U0LA 2NVXH 2OXPA 1STYA 1BOSA 2E5LL 4JI0Q 2F1MA 3HOUH 1XWEA 3PUZA 5EPJA 3T1YQ 4JI8Q 4LF5Q 2QDLA 3M4OH 1ET9A 2BH2A 1Q1BA 3H3VC 4EGVA 3GTOB 1DZ1A 5D65A 3U4VA 5C0XJ 3SVMA 1K73C 4FF2A 1PRTB 1SYGA 2E2HB 2EYFA 1I6HB 4EQNA 4JG2A 3PUVA 1GM5A 4DR1Q 4DV3L 2AMCB 2DY7A 2KJXA 4IJLA 3STBC 2YYZA 1TS4A 2F0JA 4BBSG 1K0SA 1J8IA 2X6LA 3U58A 3HOXH 1XMOL 2M00A 4A3LG 1LTBD 3GTMB 1X3EA 1MBYA 2DJFC 2TMPA 1O7LA 4IUVA 1X55A 3CCJA 3D0FA 5LMNQ 1NMGA 3OIPA 4CJ1B 4YWMA 4DR2L 4NB3A 5IOCA 4O1NA 1EZ6A 1BXTA 2F0GA 2WB1E 4ULLA 2VW9A 3GQBA 3TRZA 1X54A 2EXZA 1PDQA 4Y52H 3TP6A 2P5ZX 3OPOA 5I9OA 4DV4Q 4C3HH 3OTOL 4RG1A 1PTOB 2A68D 2VQFQ 3PF5A 3L0OA 2KEDA 3X3NA 4M8AA 1O7ZA 3T13A 2HCCA 4I7ZC 4ID6A 2WP8J 2B2UC 5A2QE 4PV1C 3K0XA 2Q8TA 5DEHA 4P73A 4DPGA 1DOMA 3GTOH 4C1NI 2OTLA 4QF4A 2XTIA 4KHPQ 1PRTF 2JA6B 1ENAA 5AFWA 2BDNA 1PA6A 3K7AH 4AYBG 3SEBA 1STHA 3ICEA 1TWCB 1HUMA 1I6HH 1F9PA 1BVSA 5A35A 2K32A 1YNND 1Q12A 3WWVA 1S4ZA 1E3PA 1MD2D 3IKJA 4GZYC 1STBA 4PMBA 3PF4A 1ASYA 4EQ5A 4BBRG 1B7YB 1SNQA 3GTMH 3GV3A 4KMUC 1TWFB 1VQJA 4RHSA 5J1ZA 1TWGH 4QL5A 2JA5B 3NELA 4A76A 1VQ4A 1TU2B 2Z6KA 4L5RC 1VQ8A 1R4PB 1JORA 4R4IA 4BA2I 1CHQD 2J0TD 4FF4A 2WACA 3WOFA 4GNXB 3S15B 4IJHA 5C4JB 2UUBQ 4TVAB 1LT6D 3QG1A 2FMCA 4F7XA 5ELEA 3UDXA 2R92G 1MSHA 2WAQB 1PTOH 3CHBD 2EOTA 4JI3L 3I4NB 3PUYA 2PZUA 3DHQA 4GLAC 1SMYD 3Q23A 2B39A 4A93B 5IGBA 4IFDG 3T1YL 1FNUA 3FMCA 3K5OA 4JI8L 1B3QA 3HKZE 3MVVA 4LF5L 2D2CC 2D62A 5E7NA 2CW0C 4A3IH 4OEMB 4DN4M 1IYUA 2JA6H 3CMAA 1Q7YC 1HQMC 2EQSA 5DAUA 2B2TC 2O2LD 5EKLA 4IOCA 5I9PA 3VYUA 4H02A 4WORA 4IUPA 2LY7A 1IBMQ 1QZHA 1B3AA 4DR1L 4OO1I 1U9RA 4HCEA 4K8IA 4TKOB 1IHZA 1SYEA 3VR2A 2UUAL 2F3WA 3VYSA 1KRTA 4IQZA 1Y1WG 2QKIC 2WB1B 4C3IB 1TWFH 1AW7A 1LABA 1SJHD 1SYCA 2PQAB 4UDUC 2JA5H 1DYQA 2VNUD 4BY1G 1QVFA 1F77A 5LMNL 4NP5A 2NVYB 1FJGL 2DNCA 4RGNA 3S15H 1AP0A 2OF1A 4WRDA 1DGSA 3MZ5A 4LF4Q 4P2CB 3GTJB 4BY7B 1U5KA 3ERSX 3HFZB 2NZOA 4DV4L 3CCSA 3I3CA 3I4NH 2QF7A 4JBWA 2VQFL 3I4LA 3MXPA 4KY5A 4DKAC 4A93H 4MNOA 1W6JA 3G48A 2K5HA 3I2ZA 3S1NH 4N8FA 3ULPA 1CK1A 3W5OA 3K0YA 2JN4A 3D6CA 1AZPA 4IFDJ 2B3GA 1XNQQ 2L15A 3J81E 1EU3A 1C7YA 1XTDA 2I5MX 3AEVA 1EEFD 3U9SA 1JWMD 3TBIB 4DR4Q 3C1EA 3ZYYX 3Q8DA 4IUQA 1SJED 1GOZA 3KJPA 2K01A 1EQQA 3H0GB 3S16B 3UE1A 1HR0Q 3I4MB 4X3UA 1PYWD 2H1EA 4JVZA 4R4QA 5T1IA 1KAWA 1CQFA 1FL0A 4ME3A 1Z47A 2PO4A 3BZCA 4GNXA 1R9TB 4C2MB 4GKKL 1VQ7A 2XN9C 2R7ZG 1CKOA 2SNSA 2KCNA 3QR8A 4L5QA 2NVYH 3OSOA 5K5PA 1SR3A 5FLMH 3ND8A 1SBBB 3NQIA 5JJLA 2F0IA 4K2KA 5BN5A 3GTJH 4BY7H 4J1MA 4QMGA 4ABNA 3PIO3 4HJ5A 4LWCA 4HR7B 4POFA 3W3AA 5C3EG 5EQ0A 4K14A 1LT5D 1CA5A 4JYAQ 1OXTA 3IL8A 5C0XI 1K8GA 1DJRD 3BG3A 1Q81C 3KDFB 2N88A 2B2WC 3D4WA 4PMWA 1XNRQ 5FLXc 2BH8A 2BE5C 5CGKA 1UE1A 1QUQA 1J9OA 2Z1CA 1N36L 3S2HB 1HRJA 1PZKD 3KF8B 5CBAE 2WKCA 3Q24A 3RN2A 3P75A 5CV9A 3GV6A 3QIAA 3K59A 1EY4A 4QJFA 2LS01 2BOSA 2UU9Q 2BDOA 3H0GH 2CWPA 2CW0D 2PQAA 4PZ7A 2BA1A 1JC7A 2XWJB 5E4WC 1IBML 2A8VA 1O7YA 2IW3A 3I4MH 1U4PA 3SGIA 3FPUB 2JEAI 4X3TA 1TKWB 3OMCA 2EXDA 1R9TH 4C2MH 2F0WA 4RKBA 1ZKOA 2E75C 3GTKB 4RGMA 4DFAA 1Q46A 1VQ9A 1JB7A 2UXBQ 1O78A 1FGUA 1SRUA 1PH7A 5A2QL 2K33A 1W3SA 1EY0A 4JI2Q 3K5MA 4LF4L 1PH2A 4JBKA 1TVXA 1VQIA 1IL8A 1OXXK 1WFQA 1SNCA 4JBMA 2CKZB 3HOVH 1XJVA 2VQEQ 4N9TA 3TP7A 3J80c 4ZCKA 3KJOA 1STAA 2F52A 5FO7B 5JEAG 3S2HH 2J7ZA 2NWGA 4IUTA 1B9MA 4CDEC 4NDXA 2EY1A 1CTMA 4DR4L 5JOBA 1VQ5A 2E76C 1PMRA 1VQNA 2KBNA 2H5XA 1K28A 4BXXH 1K8OA 2CVRA 1VF7A 1T5XD 2AQ1B 1X32A 3H09A 4QGUA 1GJXA 4K5XA 4DV6Q 1EY5A 3NEMA 3KBGA 4KJNA 2HT1A 4C3JB 3PCOB 5ISRA 4X64Q 4LF7Q 1EY7A 1HFNA 1L0XB 4LFAL 1RTOA 1Q86C 3UI2A 4HSVA 3SXHA 5M3FG 4Y7NB 4YWLA 3G4SA 1SFOB 2A19A 5M9OA 5ELCA 4HN7A 1E7ZA 3KDFA 3HEJA 1UE7A 1WJJA 3NSWA 1LLRD 3CPFA 2KHIA 2QILA 1WTWA 3NWTA 3JAMi 5IYBG 4HAEA 5ELFA 4HJ9A 5KEEA 1EOTA 4QB4A 5EAYA 2ZXOA 3KF8A 1E1OA 1WYDA 3H3VI 4K0KQ 2UUCL 1TT2A 1EYGA 5JJIA 4ZYSA 2F3VA 4DR5Q 3S17B 1XNRL 2PI2E 2B2VA 2OTJA 3PO2G 2XRQD 4CDCC 1AEXA 4A3MB 3BDLA 4YCWA 5JEAJ 4IO9A 1PH6A 4NMZA 2BE5D 2KCCA 4JOIC 4IURA 4TRDA 4EQOA 2A73B 2UU9L 1EZ8A 2EY2A 1MI2A 4JCVE 5BN3A 1A3VA 2Z6BA 5K36H 1IZ6A 4CKEA 1QE6A 2RA4A 1TR5A 1Q82C 4UP9A 4A3BB 1CSPA 3EIVA 2E2JB 3DM3A 4X66Q 2L11A 3NTIA 2R7FA 1S5BD 2VL6A 5FLXE 3D8GA 3SR1A 2RBMA 2EYOA 1EYDA 4Y7NH 1A62A 2UXBL 1HUNA 2JE6I 4RH6A 4JK1C 1VQ6A 4KV6A 2AWOA 2PMZE 3NQTA 2K5WA 1S5FD 4CBVA 4XTCS 4ME5A 4JI2L 1K0RA 3VR4A 3J81L 4IFDI 1F2MA 4MN3A 1YZ6A 1PRTC 4HSPA 4NKLA 5FOBB 3S17H 3A74A 1A2TA 1TQOA 1UWVA 4B9XA 3TQYA 2VQEL 1ZYRC 2UXCQ 1EOVA 5IY0A 2VUMB 4JV5Q 4JC0A 3HOXG 5HGTA 4A3MH 1C9OA 4DV5Q 2F0FA 4R8IA 4A3KB 1VMCA 1DCZA 2D0OA 3OYYA 5CV6A 2JA8B 5BN4A 3U4ZA 2B63B 5C3XA 1MHWC 3PQIA 3W1BA 1O80A 4HMIA 4KY7A 4B3SQ 2J4XA 5FJ8H 3GO5A 1KC8C 4OO1H 1G51A 1WI5A 1NNXA 1Y8OB 4B08A 4X62Q 2F0OA 4JI7Q 5C44B 3KLSA 4DNRB 1S72A 1QJOA 4B3TQ 2H4OA 1PYSB 3CAMA 4C3HG 2WIIB 4A3BH 2E2JH 1KD1C 2JEBI 4GN4B 5E1FA 2VZAA 1ASZA 1H9MA 2ZTCA 4MTKA 5M5YH 3J80E 5ELDA 4A3JB 2VXWA 1EEID 4IALA 3EVQA 5FKAC 1X3QA 1K83H 1Y8NB 4IPHA 3HOWB 1LTLA 4RKLA 2Z4IA 4FF1A 4LAAA 1YHBA 1M8AA 3PO3G 3DXJC 2E2DC 3M85A 1LYLA 3U9OA 3DEPA 4K0KL 2LFNA 4DR5L 2Z8LA 2ZXRA 4AQYL 3HGBA 2DY8A 1TWHB 3CC7A 3PIPA 3GP7A 2LMCB 3FKIB 3T51B 2EYLA 2FXQA 1BBUA 4J8QA 4A3KH 3N6RA 5D3IB 1OXUA 1D6EC 1R4QB 2XNAC 2JA8H 3TS2A 4ZKCB 4PMCA 2B63H 2KA7A 2RF4A 2MPMA 3RLFA 1HQRD 2YV5A 1Y1VB 4AYBE 3LWEA 1AZQA 1CI3M 1IBKQ 2B29A 1G6PA 2CQOA 4MZ9A 4JI1Q 5IT9E 2F0HA 2RSNA 3TZUA 3CC2A 1BCPF 5C44H 3B6YA 2X6GA 2F0KA 3E6ZX 4LFBQ 4YHHQ 2D5DA 2PMZB 2R93H 1HHVA 4AH6A 4ALPA 1B8AA 2TSSA 3TSSA 4IZ8A 2KECA 4X66L 1Y8PB 4K6DA 4G7OC 3FVQA 3HOZB 2R61A 4A3JH 1SE8A 1YBYA 2RHQB 5IGDA 2JA9A 1V43A 1GUTA 3DUZA 1JOOA 4A3IG 2NBFA 4NXNL 4HJ8A 1VQBA 2JA6G 2GA4B 2B2YC 3TN2A 1F9RA 5C5MA 1PH8A 1VQLA 2HHHQ 1I4RA 2K5VA 4IOAA 3G7LA 1FNWA 5BR8L 3TEHB 1LTTD 5C0XH 1A63A 3BU2A 3A8JE 3OW7A 4R9WA 2PNRC 3NE5B 2K7VA 3CMEA 1V1PA 2SOBA 3FKIH 5CR3A 4ZRZA 2UXCL 5LMNW 5TSSA 1PRTD 4JV5L 4KTAA 1XTCD 2MQHA 3IAYA 3FHWA 3FPPA 4DV5L 3RN5A 4DAPA 5J39A 4GLXA 4C56C 1L1OB 3R93A 1GXDC 1ONLA 1ZYRD 4KD4A 1Y1VH 2RQXA 4XXEA 1XMQL 3RUZA 4B3SL 2E2HH 4KK7A 2Y0SG 1LTRD 5IGCA 2EYJA 4CKBA 4DR7Q 2HIXA 4LNQA 2MUYA 4X62L 1I4GA 1V1QA 3H94A 4JI7L 5AJ3Q 4TSSA 2WAQG 3JAME 2FINB 1EYCA 3G6EA 4B3TL 4DR3Q 1XPOA 2A6EC 2PI2A 1Q3LA 4U68A 1HNZL 4A93G 4A3GG 3HOZH 4B3ML 1RDPD 2GVBA 4XYQA 2IL8A 1NTGA 3I70A 1UEAB 4V0BA 4HJ7A 1Y14B 2R6GA 3VR3A 2YU9B 5KNBA 1JICA 3NWSA 1N34Q 3E9IA 1PTOF 1SE3A 3BDOA 5EJWA 2MNAA 3HP3A 4K8JA 3NUCA 4KKSA 1ENCA 4LMQD 3J81j 3PV0A 2CCZA 1JMCA 3KK7A 2K52A 1X9NA 4JI0L 5C4XB 1T9HA 2OWOA 2AWNA 4DV0Q 1WTPA 3OOCA 3PMFA 2Z4HA 3TZDA 3VR5A 3K57A 3I91A 1E22A 3M4YA 1HTPA 3E0JA 3EA6A 1GUWA 4B3RQ 3R2IA 4BBRB 5M5XB 4A3LH 5G3LF 5IIFA 1TWCH 3TS0A 2DNEA 3SK5A 5FLMG 5FLXL 3QJYA 1IBKL 4P74A 1VQMA 3G71A 4JI1L 4OONA 1QUQB 4DK6C 2CFMA 2HQLA 1Q8KA 4PZ8A 3L2PA 1RIPA 2EE1A 4RWSC 2VB3X 2AHOB 1EFWA 1I5FA 1FVIA 4YHHL 4FXDA 2PYKA 4QQBX 4YIJA 5E3FA 3MFYA 1EY6A 3STBD 2R92B 3MA2B 4U673 1EYAA 3DEOA 1YHAA 5FO8B 1N8RC 2NN6G 1XXGA 4FXGC 1C8CA 2YU9H 4O2DA 1HTLD 5C4JH 1GUGA 1LM0A 3I7FA 1IL2A 4MHEA 1SE2A 2HHHL 4N9PA
chains in the Genus database with same CATH topology
4DXGA 1F2ZA 4ZUJA 3S14B 1B9NA 1F9QA 3CQZB 1ILPA 4XDXA 2B8FA 2LKVA 1MGSA 1QWYA 2IT1A 3MFGA 4KD3A 4RA8A 2NVTB 2KEEA 4IUUA 2A6HC 2B8GA 1I50B 1RHPA 1RJTA 1QNUA 1Y1WB 1STEA 4DNTB 1D1KA 3J80L 2KOLA 4EQPA 1TS2A 4RAUC 3OMGA 2QDBA 1WCMB 4BY1B 2X69A 3GTQB 3S1MB 4G57A 4PNYA 1D2BA 1NR4A 1ENFA 1V8QA 2NYZD 3ITPA 2XVSA 2ENBA 4LJZC 2A6ED 5I2XA 4XIGS 5I2YA 2O4XA 3CU7A 1EQVA 4IFDH 3V96A 4ZUIA 5CV5A 2IPKD 3DWAA 3HKZB 1SE4A 1GUSA 4KY6A 1STNA 3VYRA 1FNVA 5IT9L 2NTTA 2XWBB 4XQQA 4L8JA 2F0VA 3LWUA 3GTLB 2C9OA 3NBIA 4HMJA 2HCIA 1H9SB 3SDZA 1KNAA 2PW5A 3PUXA 2RKSA 4HCSA 3BZDB 1AN8A 4H44C 3GTGB 1SYDA 3BYYB 3Q6SA 1LTGD 2M2LA 3I73A 3RMHA 2V4DA 3KLRA 3R2TA 1SAPA 1VCIA 3EQLC 4QUCA 2KVMA 4HTHA 2IX0A 2EVBA 4A3EB 4KKTA 4HEDA 1S5ED 1CA6A 3P1HA 5M3MB 2F0SA 1Q8IA 2K04A 4UAIA 5ELBA 4ZAIA 4FO2A 3W2DA 1S5DD 5K36G 1RODA 3A7AB 3G6JB 1I4HA 1NR2A 1I4XA 1W6KA 1LV9A 1KDAA 4ZLTF 1KLUD 3JAML 3MC0B 5IGEA 1HCZA 4M1UB 4Q5VA 2A6HD 4F87A 2K5DA 4L6TB 3AB9A 4XT3B 4A3FB 5CORA 2E2IB 5HURA 4L63B 1B4OA 1E2WA 2L9HA 3GD7A 5E4XA 1A3TA 3T4AC 1G291 2A5HA 2B2TA 2JYOA 2ICEC 3HG9A 3A54A 3QWNA 5EPKA 3TP8A 3C1FA 1BUVT 1QOHA 5I6WA 4MIUA 3BYTB 3OIQA 3X3MA 4OO1G 3M3YB 2DN8A 4RHRA 1EL0A 4R8NA 1RF2D 1T5EA 1H9SA 3H91A 1SSOA 1WVLA 3Q0AA 3BDCA 1II3A 1DONA 3VA5A 2G9DA 1OXSC 1H9JA 1UNSA 3EFXD 5NUCA 5C6AA 1BCPC 2IX3A 3F2UA 4XYOA 3D6WA 2AUJD 1TS3A 5DM73 5C5LA 3A7LA 3D3RA 1SYFA 3LNNA 5EGTA 1PXUA 1LTAD 1ILQA 1B50A 1QB5D 1FR3A 5CBEE 5M3FB 3FEWX 3IFTA 1L0YB 2Q8IB 4TQUS 3RZOB 4IUNA 1VF5C 5IGGA 2KUMA 4FVMA 1PLFA 3NBHA 2K6AA 4H7BA 5KRUA 2PW7A 4BA1I 2JA7B 1B1ZA 3MAQA 1KLGD 3PO2B 4A3DB 4FNFA 1F2LA 3J7AF 4KJOA 2AUKA 2F03A 4X3KA 4XT1B 1Z6HA 5FK9C 1JOQA 3HOYB 3URYA 4FP5D 4DGZA 2EY6A 2FJ2A 2EPBA 2HDLA 2IWHA 2OEOA 4CGYB 1V1PB 3M7GA 5FO9B 4ZK9B 1S5CD 2F0UA 2IJ0A 4CJ0B 4LK1C 3MTSA 2L12A 1K8MA 2L4NA 4E6IA 4BS9A 5C0XG 3M7NA 2NN6I 2QEJC 1PTOC 3QO2A 2BA0A 3I90A 1IKMA 2JP1A 1NUCA 1JWUD 1QCBD 1TY2A 4FXKC 4QCLA 1UUPA 3H6MA 2M9VA 2E74C 1DXMA 5JAVA 1OO9B 1EIGA 4KHZA 2SDFA 1D5ZC 3HS0C 3SK4A 4C1NK 2RSOA 5M5WB 3C2PA 3A55A 1LT3D 1TS5A 4CJ2C 2L0CA 4DU9A 3RZDB 3QB3A 2G9HD 3NXWA 3IFDA 1TWAB 3D4RA 2EYPA 3EJIA 5EKKA 2FMMA 1BF4A 1OXVA 2ZT9C 3Q22A 2PQEA 1D5XC 4OL7A 1BCPD 2RVLA 3L3OC 1G6ZA 1WD1A 2KHSA 2RDFA 1YNJC 5IODA 3NHHA 3C46A 1PZID 3PO3B 3K7AB 2N55A 3TP5A 1BO0A 4RCOA 4K5VA 2I46A 1QNKA 3MXGA 1X3PA 1DD2A 2EYMA 1CM9A 1JOKA 3OWEB 3K5NA 2IX1A 2F0LA 2EJMA 4Z9CB 1TWGB 4RCNA 2BCOA 5EKIA 3FRPB 5C4ZA 4BWGB 2F0NA 4PQXA 4IN3A 1Y69U 2F0DA 1LTID 4BBSB 1A3UA 2XRSD 1IW7C 5JVG3 1E0BA 5LL6X 2NTSA 4KI0A 1G91A 2WV6D 4G4KA 3CRLC 4F88A 3EROA 4A3IB 1A6XA 1V1OA 1ESRA 1TY0A 2CHBD 3J7AV 1EWCA 3K6OA 3VA7A 1PTOD 1DM0B 1WTOA 1BR9A 2R3ZA 3HZXA 3ND9A 1NCVA 2QCPX 5I6YA 2I07B 2SEBD 4AYBB 2XSCA 2Y0SB 2KQ3A 1WD0A 1HA5A 4C3IG 3N52A 5JVH3 5G3LD 2ID0A 1LTSD 3DMUA 4FF3A 3C3LA 3NTHA 3AMUA 1I3QB 1F9SA 3WOEA 1G2SA 1EFID 1H9KA 4A3GB 2NUCA 3S1NB 1IYVA 1PFNA 3SK6A 3R3OA 2PZTA 3V2TA 3O13A 2CQAA 2K28A 1JR0D 3AU7A 5KYIA 1KAAA 1YNJD 1CHPD 1JWSD 5KYLA 4WJWA 3ERQA 1E2ZA 1KTKA 1G8ZD 2XIWA 5EBDA 1A2UA 1RKNA 2K5QA 1B53A 5KNCA 1KNEA 3T56B 4KHVA 1GUNA 2OT2A 1SNDA 2VB2X 2B2VC 3MXNA 1M4VA 3E5SA 1WTXA 2WINB 2JXMB 1C4QA 3A8IE 3P20A 5D3DA 2EY5A 4DAVA 3WDNA 4B9WA 1SEBD 4XQJA 1PZJD 2F0MA 3CRKC 3KLSX 3K5LA 1D1IA 4OIJA 5JPMC 3MEHA 1VDZA 2AQ3B 5CV7A 1IW7D 2SNMA 5D14A 3GTPB 3BVGA 3I72A 1ESFA 1H9RA 5COYA 1JQYD 1QG7A 4DAYA 2F0PA 4I65A 4OIKA 5F2DA 3KUPA 4F8MA 1ICWA 3PUWA 1RTNA 5I4DA 3S1QB 2MP1A 4DK0A 3S1RB 1FYCA 5DM63 1RD9D 3PIP3 1VMPA 5LHY1 1PFMA 3P7JA 2EJFC 1SDFA 4ILWA 4Q0FA 1B2TA 2B2YA 2RDGA 3BVZA 2FFKB 2JSOA 3SK8A 3OWFA 1EY9A 4DF7A 1RCVD 2NZ1D 3HOVB 2R7ZB 1IKLA 4NW2A 3T53B 2NN6H 2B2UA 5KNDA 1F2YA 4QIWB 2Q8RE 3HRZC 2K05A 3DWPA 1WTQA 2MJ8A 1MSGA 2NB0A 5C3EB 2HDMA 3LX0A 1KABA 1QILA 1EY8A 3BVMA 3QOLA 2RDHA 5KIXA 4CKCA 1SYBA 1PFBA 1STGA 3K58A 4WFN3 3VR6A 2L5TA 2F4IA 3FDTA 1CFMA 3DWQA 4C3JG 1NSNS 4DXFA 1D5MC 2HUGA 1E2VA 5C4HA 4H0LC 1HFGA 4O42A 1Q1EA 4ZKBB 2F0QA 4S3SA 2EZVA 1HXYD 3TDQA 1SNOA 5EPLA 1SNPA 3A8KE 5T1GA 4QUFA 5C3WA 1EU4A 4XQNA 5KGUA 4J6HA 1BQQT 2O5JC 1CZWA 3QOJA 1A15A 4ODGA 1JB3A 1ZEQX 1XX8A 3DM1A 2MGSA 1JE4A 5LL6S 5CMDA 2WKDA 1TIID 1DOLA 1EIHA 4V190 3V05A 2A69C 1CQVA 3I8ZA 5JPNC 3RD4A 2MHVA 5IGFA 5CV4A 1UAPA 4H13C 1I6VC 3TMEA 4KN7C 1KDCA 1Q90A 2L1BA 5EBCA 1GHJA 1ET6A 2FHTA 1HA6A 4RGTA 3J7YW 1ZXTA 1C48A 4DK1A 5JJZA 3T16A 3NP8A 4OHJA 1U4RA 2NVQB 2K03A 3CKIB 2HQEA 2K1BA 1SNMA 4OGQC 3S9WA 4K5WA 1BBXC 4ZQ3A 4FYDA 2ZXPA 1AFPA 1I4QA 3OHXC 1EWHA 1XYIA 1Z7TA 4K6LA 3MXUA 3SHLA 5JEAH 2L55A 2AQ2B 4K2LA 1FGBD 3A56A 5M5YB 1ML0D 1CZGA 2F0EA 3S2DB 3D31A 1K83B 2A68C 1LACA 4CHTB 2PCFB 1B44D 2F0TA 1U4LA 4DA2A 1JCKB 5J22A 3L9AX 1DOKA 4RGOS 1GUOA 1LO5D 1CT1D 2PPBC 2O5IC 1G2TA 1WTVA 2NVXB 3HOUB 3SE0A 2ICIA 2B2WA 3L7ZC 5CYUA 3M4OB 4EVOA 5DNFA 1YNNC 1NAPA 1LT4D 3ONAB 5CV8A 1BDOA 1BNZA 2C5CA 2EDGA 1I4PA 2EYHA 3NTKA 1EQTA 1GHKA 2D9UA 4X3SA 1SXTA 3VYTA 3BS1A 2EJGC 3MWYW 5CC4A 1BCPB 4G7ZC 1WTRA 3NK9A 2R93B 1FD7D 3HOXB 4KKUA 4RFBA 3D4DA 3KBXA 3NPPA 1U4MA 3R8BA 2A74C 1SMYC 2A69D 3MHBA 4G7HC 1KDBA 1HPCA 4C3HB 4KN4C 2PZWA 2OXPA 1STYA 1BOSA 2F1MA 1XWEA 3PUZA 5EPJA 1ET9A 1Q1BA 3H3VC 4EGVA 3GTOB 1DZ1A 5D65A 5C0XJ 3SVMA 4FF2A 1PRTB 1SYGA 2E2HB 2EYFA 1I6HB 4EQNA 3PUVA 2DY7A 2KJXA 2YYZA 1TS4A 2F0JA 1J8IA 2X6LA 2M00A 1LTBD 3GTMB 1MBYA 2TMPA 1O7LA 4IUVA 3OIPA 4CJ1B 5IOCA 4O1NA 1EZ6A 1BXTA 2F0GA 4ULLA 3GQBA 2EXZA 1PDQA 3TP6A 5I9OA 3OPOA 1PTOB 2A68D 2KEDA 3X3NA 4M8AA 1O7ZA 3T13A 2HCCA 4I7ZC 4ID6A 2WP8J 2B2UC 5A2QE 4PV1C 2Q8TA 5DEHA 1DOMA 4C1NI 4QF4A 1PRTF 2JA6B 1ENAA 5AFWA 2BDNA 3SEBA 1STHA 1TWCB 1HUMA 1F9PA 5A35A 2K32A 1YNND 1Q12A 1S4ZA 1MD2D 3IKJA 4GZYC 1STBA 4PMBA 1SNQA 3GV3A 4KMUC 1TWFB 4RHSA 5J1ZA 2JA5B 1TU2B 1R4PB 1JORA 4BA2I 1CHQD 2J0TD 4FF4A 2WACA 3WOFA 3S15B 5C4JB 1LT6D 3QG1A 2FMCA 4F7XA 5ELEA 1MSHA 2WAQB 1PTOH 3CHBD 2EOTA 3I4NB 3PUYA 2PZUA 3DHQA 1SMYD 3Q23A 2B39A 4A93B 5IGBA 4IFDG 1FNUA 3FMCA 3K5OA 3MVVA 2D2CC 2D62A 2CW0C 4DN4M 1IYUA 1HQMC 5DAUA 2B2TC 2O2LD 5EKLA 5I9PA 3VYUA 4WORA 4IUPA 2LY7A 1B3AA 4OO1I 1U9RA 4HCEA 4K8IA 4TKOB 1IHZA 1SYEA 3VR2A 2F3WA 3VYSA 4IQZA 2QKIC 2WB1B 4C3IB 1AW7A 1LABA 1SJHD 1SYCA 4UDUC 1DYQA 2VNUD 1F77A 4NP5A 2NVYB 2DNCA 4RGNA 1AP0A 2OF1A 4WRDA 3MZ5A 4P2CB 3GTJB 4BY7B 3I3CA 2QF7A 4JBWA 3I4LA 3MXPA 4KY5A 1W6JA 1CK1A 3K0YA 3D6CA 1AZPA 4IFDJ 3J81E 1EU3A 1EEFD 3U9SA 1JWMD 3TBIB 3C1EA 3ZYYX 4IUQA 1SJED 1GOZA 2K01A 3H0GB 3S16B 3I4MB 4X3UA 1PYWD 2H1EA 5T1IA 1CQFA 1Z47A 2PO4A 1R9TB 4C2MB 2XN9C 2SNSA 2KCNA 3OSOA 5K5PA 3ND8A 1SBBB 3NQIA 2F0IA 4K2KA 5BN5A 4J1MA 4QMGA 4ABNA 3PIO3 4HR7B 3W3AA 5EQ0A 4K14A 1LT5D 1CA5A 1OXTA 3IL8A 5C0XI 1DJRD 3BG3A 2N88A 2B2WC 3D4WA 4PMWA 2BE5C 5CGKA 1J9OA 2Z1CA 3S2HB 1HRJA 1PZKD 5CBAE 2WKCA 3Q24A 3P75A 5CV9A 3GV6A 3QIAA 3K59A 1EY4A 2LS01 2BOSA 2BDOA 2CW0D 2BA1A 1JC7A 2XWJB 5E4WC 1O7YA 2IW3A 1U4PA 3FPUB 2JEAI 4X3TA 1TKWB 3OMCA 2F0WA 4RKBA 1ZKOA 2E75C 3GTKB 4RGMA 4DFAA 1O78A 5A2QL 2K33A 1EY0A 3K5MA 1TVXA 1IL8A 1OXXK 1SNCA 4N9TA 3TP7A 1STAA 5FO7B 5JEAG 2J7ZA 2NWGA 4IUTA 1B9MA 4NDXA 2EY1A 1CTMA 5JOBA 2E76C 1PMRA 1K8OA 2CVRA 1VF7A 1T5XD 2AQ1B 1X32A 3H09A 1GJXA 4K5XA 1EY5A 3KBGA 4KJNA 4C3JB 5ISRA 1EY7A 1HFNA 1L0XB 1RTOA 3UI2A 4HSVA 3SXHA 4Y7NB 1SFOB 5M9OA 5ELCA 4HN7A 3HEJA 3NSWA 1LLRD 2QILA 1WTWA 3NWTA 4HAEA 5ELFA 5KEEA 1EOTA 4QB4A 2ZXOA 3KF8A 1TT2A 4ZYSA 2F3VA 3S17B 2B2VA 2XRQD 1AEXA 4A3MB 3BDLA 5JEAJ 4NMZA 2BE5D 2KCCA 4IURA 4TRDA 4EQOA 2A73B 1EZ8A 2EY2A 1MI2A 5BN3A 1A3VA 5K36H 4CKEA 1QE6A 2RA4A 1TR5A 4A3BB 2E2JB 2L11A 3NTIA 1S5BD 5FLXE 3D8GA 3SR1A 2RBMA 2EYOA 1EYDA 1HUNA 2JE6I 4RH6A 4JK1C 4KV6A 2AWOA 3NQTA 2K5WA 1S5FD 4CBVA 4XTCS 4ME5A 3VR4A 3J81L 4IFDI 1F2MA 4MN3A 1PRTC 4HSPA 4NKLA 5FOBB 1A2TA 1TQOA 4B9XA 1ZYRC 2VUMB 5HGTA 2F0FA 4R8IA 4A3KB 1VMCA 1DCZA 5CV6A 2JA8B 5BN4A 2B63B 5C3XA 1O80A 4HMIA 4KY7A 2J4XA 3GO5A 4OO1H 1Y8OB 4B08A 2F0OA 5C44B 3KLSA 4DNRB 1QJOA 2H4OA 4C3HG 2WIIB 2JEBI 5E1FA 1H9MA 3J80E 5ELDA 4A3JB 2VXWA 1EEID 4IALA 3EVQA 5FKAC 1X3QA 1Y8NB 3HOWB 4RKLA 2Z4IA 4FF1A 4LAAA 1M8AA 3DXJC 2E2DC 3M85A 3U9OA 3DEPA 2LFNA 2Z8LA 2ZXRA 3HGBA 2DY8A 1TWHB 3GP7A 2LMCB 3FKIB 3T51B 2EYLA 4J8QA 3N6RA 5D3IB 1OXUA 1D6EC 1R4QB 2XNAC 4ZKCB 4PMCA 2KA7A 2MPMA 3RLFA 1HQRD 1Y1VB 1AZQA 3LWEA 1CI3M 5IT9E 2F0HA 2RSNA 3TZUA 1BCPF 2X6GA 2F0KA 3E6ZX 2D5DA 2PMZB 1HHVA 2TSSA 3TSSA 4IZ8A 2KECA 1Y8PB 4K6DA 4G7OC 3FVQA 3HOZB 2R61A 5IGDA 1V43A 1GUTA 3DUZA 1JOOA 2NBFA 2GA4B 2B2YC 3TN2A 1F9RA 5C5MA 1I4RA 3G7LA 1FNWA 1LTTD 5C0XH 3A8JE 3OW7A 4R9WA 2PNRC 3NE5B 2K7VA 1V1PA 2SOBA 5CR3A 4ZRZA 5TSSA 1PRTD 4KTAA 1XTCD 3IAYA 3FPPA 4DAPA 5J39A 4C56C 3R93A 1GXDC 1ONLA 1ZYRD 4KD4A 2RQXA 4XXEA 3RUZA 4KK7A 1LTRD 5IGCA 2EYJA 4CKBA 2MUYA 1I4GA 3H94A 4TSSA 3JAME 2FINB 1EYCA 2A6EC 1Q3LA 4U68A 1RDPD 4XYQA 2IL8A 3I70A 1UEAB 4V0BA 2R6GA 3VR3A 2YU9B 5KNBA 1JICA 3NWSA 1PTOF 1SE3A 3BDOA 5EJWA 3HP3A 4K8JA 3NUCA 4KKSA 1ENCA 4LMQD 3PV0A 3KK7A 5C4XB 2AWNA 1WTPA 3OOCA 3PMFA 2Z4HA 3TZDA 3VR5A 3K57A 3I91A 3M4YA 1HTPA 3E0JA 3EA6A 1GUWA 3R2IA 4BBRB 5M5XB 5G3LF 5IIFA 2DNEA 3SK5A 5FLXL 3QJYA 2EE1A 4RWSC 2VB3X 4FXDA 2PYKA 4YIJA 5E3FA 3MFYA 1EY6A 2R92B 3MA2B 4U673 1EYAA 3DEOA 5FO8B 2NN6G 1XXGA 4FXGC 1C8CA 1HTLD 1GUGA 4MHEA 1SE2A 4N9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T1G A;  1DZ1 A;  1M8A A;  3MTS A;  5D65 A;  4QUF A;  2L12 A;  1VMP A;  4IUQ A;  1EL0 A;  3SVM A;  3H91 A;  1MI2 A;  2L4N A;  1PFM A;  5EKI A;  2K01 A;  1F9Q A;  3Q6S A;  2M2L A;  1SSO A;  1TVX A;  3P7J A;  1WVL A;  2K28 A;  3DEP A;  1A15 A;  1MSH A;  1QE6 A;  4XDX A;  1SDF A;  2FIN B;  2RA4 A;  1ILP A;  4X3U A;  1DON A;  2H1E A;  3QO2 A;  3I90 A;  1SAP A;  1IL8 A;  2EOT A;  5T1I A;  1U4L A;  1IKM A;  2DY7 A;  1B2T A;  1MGS A;  2JP1 A;  4QUC A;  1Q3L A;  2DY8 A;  2KVM A;  4U68 A;  2B2Y A;  2FFK B;  4RA8 A;  1XX8 A;  3F2U A;  1DOK A;  2KEE A;  2L11 A;  4IUU A;  1J8I A;  2XIW A;  2MGS A;  3DM1 A;  3D6W A;  2X6L A;  2IL8 A;  1JE4 A;  1G2T A;  1WTV A;  4HED A;  1CA6 A;  1E0B A;  2J7Z A;  5CMD A;  2NWG A;  2NZ1 D;  4ZKC B;  1HUN A;  1RHP A;  4IUT A;  1IKL A;  1RJT A;  4IUV A;  4NW2 A;  1B53 A;  2B2W A;  1KNE A;  2K04 A;  2MPM A;  2KOL A;  4UAI A;  1EIG A;  4ZAI A;  1DOL A;  2B2U A;  3LWE A;  4DN4 M;  1JIC A;  1AZQ A;  5DNF A;  2SDF A;  2B2T C;  1EIH A;  1NAP A;  3ONA B;  4CJ1 B;  2B2V C;  4RAU C;  1ILQ A;  2RSO A;  1B50 A;  3I8Z A;  2Q8R E;  5CBE E;  5EJW A;  2K05 A;  2RSN A;  4CJ2 C;  1WTX A;  2CVR A;  1BNZ A;  2X69 A;  1ROD A;  3HP3 A;  4IUP A;  1WTQ A;  2X6G A;  1X32 A;  4MN3 A;  1B3A A;  1NR2 A;  2MJ8 A;  1ESR A;  2KUM A;  1PDQ A;  2L1B A;  4LMQ D;  1NR4 A;  5EQ0 A;  1EQT A;  1HHV A;  1LV9 A;  1MSG A;  2FHT A;  3IFD A;  1CA5 A;  2HDM A;  3IL8 A;  2D9U A;  1PLF A;  4X3S A;  4ZLT F;  2KEC A;  2FMM A;  3MWY W;  1HA6 A;  2KED A;  2N88 A;  1HFN A;  2B2W C;  1BF4 A;  1O7Z A;  2NYZ D;  1WTP A;  2HCC A;  1WTR A;  2B2U C;  3TZD A;  3I91 A;  1WTO A;  1ZXT A;  2R3Z A;  1J9O A;  5JJZ A;  4R8I A;  2Q8T A;  1RTO A;  1VMC A;  4OIJ A;  1NCV A;  2RVL A;  1GUW A;  1HRJ A;  3UI2 A;  4HSV A;  5CBA E;  1PFB A;  1G6Z A;  3GV6 A;  1DOM A;  1WD1 A;  1O80 A;  5D14 A;  1U4R A;  2B2Y C;  1G91 A;  3TN2 A;  1F2L A;  1F9R A;  3KBX A;  1AP0 A;  5AFW A;  2BDN A;  2K03 A;  3FDT A;  3G7L A;  1WTW A;  1U4M A;  4X3K A;  4XT1 B;  4HAE A;  2EE1 A;  2K1B A;  4RWS C;  5E4W C;  1HUM A;  1EOT A;  4XT3 B;  1O7Y A;  1F9P A;  5COY A;  4R9W A;  1U4P A;  2HUG A;  1QG7 A;  1S4Z A;  5COR A;  1BBX C;  1WD0 A;  3FPU B;  1B4O A;  3I3C A;  2L9H A;  2N55 A;  4OIK A;  3N52 A;  4X3T A;  5E4X A;  1BO0 A;  3KUP A;  2B2T A;  2JYO A;  2B2V A;  1HFG A;  1ICW A;  1QNK A;  4O42 A;  1X3P A;  1XYI A;  3DEO A;  2HCI A;  4ZKB B;  3GV3 A;  1RTN A;  2FJ2 A;  2EPB A;  2HDL A;  2VXW A;  5EPK A;  1F9S A;  3R93 A;  1KNA A;  1C8C A;  5EPJ A;  1G2S A;  1AZP A;  1CM9 A;  4ZK9 B;  1X3Q A;  2MP1 A;  4CJ0 B;  1PFN A;  4HCS A;  5EPL A;  1ML0 D;  4IUR A;  4MHE A; 
#chains in the Genus database with same CATH topology
 4DXG A;  1N32 Q;  1F2Z A;  3H3V H;  4UP7 A;  3MEF A;  4ZUJ A;  4CDF C;  1L1O A;  3H0G G;  3S14 B;  1B9N A;  1F9Q A;  3CQZ B;  3I4M G;  1ILP A;  4XDX A;  5IP9 G;  5C4X H;  2B8F A;  2LKV A;  1MGS A;  1QWY A;  3ER0 A;  3KLW A;  4R4C A;  2IT1 A;  3CCQ A;  3MFG A;  4KD3 A;  4RA8 A;  2NVT B;  2KEE A;  4IUU A;  1EIY B;  1I94 Q;  1KL9 A;  2A6H C;  2B8G A;  4KHP L;  1I50 B;  5M5X H;  1RHP A;  1K9M C;  1RJT A;  4YCU A;  4GS3 A;  1NY4 A;  1PH1 A;  2LXJ A;  4DR6 Q;  1QNU A;  1Y1W B;  1STE A;  4P71 A;  1D1K A;  4DNT B;  2KOL A;  3J80 L;  4GN5 A;  4EQP A;  1TS2 A;  4RAU C;  3OMG A;  1HZA A;  4FDB A;  2LSS A;  2QDB A;  2UXD Q;  1WCM B;  4BY1 B;  2X69 A;  5AJ3 L;  3GTQ B;  3S1M B;  4G57 A;  2I5H A;  4PNY A;  4YY3 Q;  1D2B A;  5LMU Q;  1NR4 A;  4DR3 L;  4C3I H;  4GOP C;  1VQA A;  2R92 H;  1ENF A;  3HOV G;  1V8Q A;  5L37 A;  4UY8 C;  2NYZ D;  3ITP A;  2XVS A;  2ENB A;  4LJZ C;  4X6A H;  2A6E D;  5I2X A;  4XIG S;  5I2Y A;  2O4X A;  3CU7 A;  1EQV A;  2CH4 A;  4IFD H;  2UUB L;  3V96 A;  4ZUI A;  5CV5 A;  1N34 L;  2IPK D;  4LF9 Q;  3T1H Q;  3DWA A;  3HKZ B;  3KOJ A;  3S14 H;  1SE4 A;  3CQZ H;  1GUS A;  2KCM A;  4KY6 A;  1STN A;  3J80 i;  3VYR A;  1FNV A;  5IT9 L;  2NTT A;  4MTN A;  2XWB B;  2ZJR A;  2JJQ A;  4XQQ A;  4L8J A;  2F0V A;  3LWU A;  2NVT H;  4DV0 L;  3GTL B;  1KXL A;  2C9O A;  3NBI A;  3HKS A;  1GKH A;  4HMJ A;  2HCI A;  5IYC H;  1IBL Q;  1I50 H;  1H9S B;  4PZ6 A;  3SDZ A;  1KNA A;  4B3R L;  2PW5 A;  3K8A A;  3PUX A;  2RKS A;  4HCS A;  3BZD B;  3S16 H;  1AN8 A;  4H44 C;  3GTG B;  1WCM H;  1SYD A;  4LUV A;  3GTQ H;  3S1M H;  3RLN A;  3BYY B;  1YJ9 A;  3Q6S A;  1LTG D;  2M2L A;  1UE5 A;  3I73 A;  3RMH A;  2V4D A;  3KLR A;  4LF6 Q;  3R2T A;  4POG A;  1SAP A;  1KIX A;  1VCI A;  3EQL C;  3PSI A;  4QUC A;  2KVM A;  4HTH A;  1BBW A;  2IX0 A;  5H1S E;  2EVB A;  4OEL B;  4A3E B;  4OXP A;  4KKT A;  4HED A;  1S5E D;  1CA6 A;  4JI5 Q;  3P1H A;  5M3M B;  3F2C A;  2F0S A;  1Q8I A;  2K04 A;  4UAI A;  5ELB A;  4ZAI A;  4CDD C;  3DLL A;  1D8L A;  1N32 L;  4FO2 A;  4DV7 Q;  3W2D A;  1S5D D;  3NBH B;  4UPA A;  3CCR A;  5K36 G;  1ROD A;  3A7A B;  3G6J B;  1PVO A;  1I4H A;  2Q2U A;  1EIF A;  1NR2 A;  1I4X A;  4DUY Q;  1W6K A;  1YIT A;  1LV9 A;  4A3C H;  1VQE A;  3AQQ A;  1KDA A;  1L2F A;  4ZLT F;  4J15 A;  1KLU D;  3GDE A;  3K81 C;  3JAM L;  3I4O A;  1XNQ L;  4GN3 B;  3MC0 B;  5IGE A;  3M9B A;  1NBW A;  4DR6 L;  1HCZ A;  1HZ9 A;  1NE3 A;  4M1U B;  2CWA A;  4Q5V A;  2A6H D;  2PNH A;  4QY7 A;  1HR0 L;  5IWA Q;  4F87 A;  2UXD L;  2K5D A;  4L6T B;  3CCM A;  3AB9 A;  2NZH A;  4XT3 B;  1CKN B;  1HH2 P;  1SRO A;  4YY3 L;  4A3F B;  3M4Q A;  5COR A;  5LMU L;  2E2I B;  5HUR A;  5JJK A;  4L63 B;  1B4O A;  1E2W A;  2L9H A;  3GD7 A;  3GTK H;  5E4X A;  1A3T A;  3T4A C;  1G29 1;  2K4K A;  2A5H A;  2B2T A;  2JYO A;  4A3E H;  1PH5 A;  2ICE C;  2Z0S A;  4A3M G;  2Q2H A;  1GO3 E;  3HG9 A;  4OX9 Q;  3LGJ A;  5M3M H;  3A54 A;  3QWN A;  5EPK A;  2KCT A;  3TP8 A;  3C1F A;  1BUV T;  1QOH A;  3F2B A;  3ULJ A;  5I6W A;  1MJE A;  4MIU A;  3BYT B;  3OIQ A;  3T1H L;  1VQH A;  5FJ8 G;  3X3M A;  4OO1 G;  3M3Y B;  2DN8 A;  4RHR A;  1EL0 A;  1YJW A;  4R8N A;  1RF2 D;  1T5E A;  1H9S A;  3H91 A;  4LUZ A;  4JYA L;  1VQK A;  1SSO A;  1E1T A;  4X65 Q;  1WVL A;  3Q0A A;  3BDC A;  4JI4 Q;  1II3 A;  5HY6 A;  1DON A;  3VA5 A;  2G9D A;  3CCL A;  1OXS C;  3KYH C;  1H9J A;  1UNS A;  3A5Z B;  4LW1 A;  3EFX D;  5NUC A;  3CCV A;  5C6A A;  1BCP C;  2IX3 A;  3F2U A;  4XYO A;  3D6W A;  1IBL L;  2AUJ D;  1TS3 A;  5DM7 3;  5IP7 H;  5C5L A;  3A7L A;  3D3R A;  1SYF A;  2KHJ A;  3RR5 A;  2MO0 A;  1N33 Q;  5IE8 A;  3LNN A;  3CF5 A;  5EGT A;  1PXU A;  1LTA D;  1X3F A;  1ILQ A;  1B50 A;  2C35 B;  1QB5 D;  1FR3 A;  5CBE E;  5M3F B;  4A3F H;  4C3J H;  3FEW X;  3IFT A;  4R4O A;  1L0Y B;  2E2I H;  2Q8I B;  4TQU S;  3UDF A;  4IUN A;  1VF5 C;  5IGG A;  2KUM A;  4O0A A;  3RZO B;  4FVM A;  2Z6K C;  1PLF A;  3HOU G;  3NBH A;  2K6A A;  4H7B A;  5KRU A;  1SFO H;  2PW7 A;  4BA1 I;  2GVA A;  1YIJ A;  4LF8 Q;  2JA8 G;  2JA7 B;  1B1Z A;  4OWT B;  1H95 A;  3MAQ A;  1KLG D;  3PO2 B;  4A3D B;  4DV7 L;  3M3Y H;  4FNF A;  1F2L A;  2WFW A;  3J7A F;  4KJO A;  1VQF A;  2AUK A;  3E9H A;  2F03 A;  1GVP A;  4X3K A;  4XT1 B;  2ALY B;  1Z6H A;  4GLV B;  5FK9 C;  4HJA A;  1JOQ A;  3HOY B;  3URY A;  4FP5 D;  2R93 G;  4DGZ A;  2EY6 A;  3F1Z A;  2VY3 A;  1CKN A;  1HZC A;  1PHJ A;  5IYD H;  2FJ2 A;  2EPB A;  2HDL A;  2IWH A;  2OEO A;  4CGY B;  1V1P B;  3M7G A;  5FO9 B;  2G5D A;  4ZK9 B;  1S5C D;  2F0U A;  2IJ0 A;  4CJ0 B;  2N8N A;  2I5L X;  1YHQ A;  4LK1 C;  1AH9 A;  3MTS A;  5M3F H;  2L12 A;  5IWA L;  4DV6 L;  1K8M A;  2L4N A;  4E6I A;  4BS9 A;  5C0X G;  3M7N A;  2NN6 I;  3RZO H;  4X64 L;  4LF7 L;  2QEJ C;  1PTO C;  3QO2 A;  2BA0 A;  3I90 A;  1IKM A;  2JP1 A;  3FKI G;  1NUC A;  1JWU D;  1QCB D;  2ZTE A;  1TY2 A;  2JA7 H;  5GQO A;  2DUD A;  4FXK C;  4QCL A;  1UUP A;  3H6M A;  2M9V A;  1L1O C;  1DXM A;  2E74 C;  4A3D H;  5JAV A;  1OO9 B;  1EIG A;  4KHZ A;  2SDF A;  4L5T A;  1D5Z C;  3HS0 C;  3SK4 A;  4C1N K;  2RSO A;  5M5W B;  3C2P A;  3A55 A;  1LT3 D;  1TS5 A;  4CJ2 C;  2L0C A;  4X65 L;  4DU9 A;  2YTX A;  3RZD B;  1O7I A;  3HOY H;  2VUM H;  3QB3 A;  1MJC A;  1NJI C;  2G9H D;  4HIK A;  3NXW A;  3IFD A;  1TWA B;  3D4R A;  2EYP A;  3EJI A;  5EKK A;  2FMM A;  3HOZ G;  4IPD A;  1BF4 A;  4YWK A;  1OXV A;  2ZT9 C;  3Q22 A;  2PQE A;  1D5X C;  3E0E A;  3PIO A;  3E3X A;  1KQS A;  4L5S A;  4OL7 A;  4KLK A;  1VQP A;  1BCP D;  2RVL A;  5J3B A;  2Y0S E;  3L3O C;  3AFQ A;  1N33 L;  1YVC A;  4EX5 A;  1VQG A;  1G6Z A;  1WD1 A;  2KHS A;  2RDF A;  1SN8 A;  4GNX C;  1YNJ C;  5IOD A;  3NHH A;  2WAQ E;  3C46 A;  1PZI D;  3PO3 B;  3K7A B;  2N55 A;  2IHE A;  4DUZ Q;  3I56 A;  3TP5 A;  1BO0 A;  4RCO A;  4K5V A;  2I46 A;  1QNK A;  3MXG A;  1X3P A;  3HOW H;  2UUA Q;  4LF8 L;  4UP8 A;  3JC6 6;  1DD2 A;  2EYM A;  3RLO A;  1CM9 A;  1JOK A;  2RHS B;  3OWE B;  5DLQ E;  3K5N A;  1EUJ A;  2IX1 A;  2F0L A;  2EJM A;  5M5W H;  4Z9C B;  3J81 c;  3K80 C;  1TWG B;  2V1C C;  4RCN A;  2BCO A;  5EKI A;  3FRP B;  5C4Z A;  3RZD H;  1TWH H;  4BWG B;  2F0N A;  1FJG Q;  4RMF A;  4DV1 Q;  4PQX A;  1TWA H;  4IN3 A;  1Y69 U;  3KF6 B;  2F0D A;  2JA5 G;  2K75 A;  4P72 A;  1X6O A;  1EQR A;  1LTI D;  4BBS B;  1A3U A;  2XRS D;  1IW7 C;  3MXN B;  5JVG 3;  1E0B A;  5LL6 X;  2NTS A;  2Q2I A;  4KI0 A;  1G91 A;  2WV6 D;  4G4K A;  3CRL C;  4NXM Q;  4F88 A;  2E8G A;  3ERO A;  4A3I B;  3I4N G;  1A6X A;  1MIU A;  2MFI A;  2EIF A;  5GAG C;  1V1O A;  3PO3 H;  1ESR A;  1TY0 A;  5C4X G;  2CHB D;  4APV A;  2Q2T A;  4JOI A;  3J7A V;  1EWC A;  3K6O A;  3VA7 A;  4GKJ Q;  1PTO D;  1DM0 B;  1WTO A;  1BR9 A;  2R3Z A;  3HZX A;  3ND9 A;  1NCV A;  2QCP X;  4YCV A;  5I6Y A;  4GKK Q;  4DAY B;  1W2B A;  3A5U A;  2I07 B;  2SEB D;  2QW7 A;  4AYB B;  1M1K C;  2XSC A;  2Y0S B;  3M4P A;  2KQ3 A;  4JW0 A;  1SMX A;  3A0J A;  1WD0 A;  2WB1 G;  1HA5 A;  4C3I G;  3N52 A;  5JVH 3;  5G3L D;  1X3G A;  2ID0 A;  1V9P A;  1LTS D;  3DMU A;  3EN2 A;  4FF3 A;  4BBS H;  1VS0 A;  3NTH A;  3C3L A;  3UDI A;  3AMU A;  1I3Q B;  1F9S A;  3WOE A;  1G2S A;  1EFI D;  1H9K A;  4A3G B;  1HNW Q;  2CH4 W;  2NUC A;  3S1N B;  3BJU A;  1IYV A;  1PFN A;  4R1J A;  4BY7 G;  4DK3 C;  1N36 Q;  1HZB A;  3R3O A;  3SK6 A;  2PZT A;  4LFB L;  1PYB A;  1YJN A;  3V2T A;  3O13 A;  2CQA A;  2K28 A;  1JR0 D;  3AU7 A;  5KYI A;  1KAA A;  1YNJ D;  1CHP D;  1KRS A;  3EBE A;  1JWS D;  5KYL A;  4WJW A;  4DUZ L;  3ERQ A;  4I7A A;  4LFC Q;  1E2Z A;  1KTK A;  3UDG A;  1G8Z D;  2XIW A;  4QIW E;  4PG3 A;  5IYC G;  5EBD A;  1A2U A;  1RKN A;  2K5Q A;  1JJ2 A;  1B53 A;  3KF6 A;  5KNC A;  2F3I A;  1KNE A;  5GRO A;  3T56 B;  1QVC A;  3CW2 C;  2HD3 A;  4KHV A;  1GUN A;  2OT2 A;  4JI6 Q;  1SND A;  2VB2 X;  2B2V C;  3MXN A;  1WCM G;  1M4V A;  3E5S A;  3RNU A;  1WTX A;  2WIN B;  1J5E Q;  2JXM B;  1C4Q A;  3A8I E;  4DV1 L;  3P20 A;  5D3D A;  2EY5 A;  3VDY A;  1Z9F A;  4DAV A;  1S40 A;  3WDN A;  1NMF A;  2K50 A;  4BBR H;  4B9W A;  1SEB D;  1I3Q H;  4XQJ A;  1PZJ D;  2F0M A;  3FP9 A;  2OCE A;  3CRK C;  3KLS X;  3CXC A;  4DV2 Q;  3K5L A;  1D1I A;  4A3G H;  4OIJ A;  5JPM C;  2F4V Q;  4HID A;  3MEH A;  1VDZ A;  4DR7 L;  2MO1 A;  2AQ3 B;  5CV7 A;  1QVG A;  1IW7 D;  2SNM A;  5D14 A;  3HKZ G;  3GTP B;  4NXM L;  3BVG A;  2YTY A;  3I72 A;  1ESF A;  1K3R A;  1H9R A;  5COY A;  1JQY D;  1QG7 A;  4DAY A;  2F0P A;  4I65 A;  1HNX Q;  4OIK A;  4A3C G;  2JK8 A;  5F2D A;  3KUP A;  4F8M A;  1B70 B;  1X56 A;  4GKJ L;  1ICW A;  1HR0 W;  3PUW A;  1E24 A;  1RTN A;  4N8X 1;  5I4D A;  3S1Q B;  4OWW B;  1VQO A;  1K8A C;  2MP1 A;  4DK0 A;  3S1R B;  1FYC A;  2AKW B;  4BXX G;  5DM6 3;  4LFA Q;  4UHV A;  1RD9 D;  3PIP 3;  1VMP A;  5LHY 1;  2ZJQ A;  1PFM A;  4NPS A;  3P7J A;  1AE3 A;  2JQO A;  2EJF C;  1SDF A;  4ILW A;  4Q0F A;  2DJG C;  1B2T A;  2B2Y A;  2RDG A;  5GAD C;  3BVZ A;  3TRE A;  2FFK B;  4A3E G;  2UUC Q;  1Y1W H;  2JSO A;  3SK8 A;  3OWF A;  1EY9 A;  4DF7 A;  1RCV D;  5M3M G;  2NZ1 D;  1HNW L;  3HOV B;  2R7Z B;  1IKL A;  4LUO A;  3W1G A;  4NW2 A;  4BY1 H;  3T53 B;  3GTP H;  2NN6 H;  2B2U A;  5KND A;  1F2Y A;  4QIW B;  1BKB A;  2Q8R E;  4DAM A;  1RL2 A;  3HRZ C;  2K05 A;  3DWP A;  3K7U C;  3H15 A;  1WTQ A;  2MJ8 A;  2N78 A;  2GN5 A;  4LFC L;  4HIM A;  1MSG A;  2NB0 A;  5C3E B;  2HDM A;  3LX0 A;  5IP9 H;  1KAB A;  1QIL A;  1EY8 A;  2ZTD A;  3BVM A;  1CKM A;  1PFS A;  2RCN A;  3S1Q H;  4WJ4 A;  1L0W A;  4JBJ A;  3QOL A;  2RDH A;  5KIX A;  5IP7 G;  1N9W A;  1UE6 A;  4CKC A;  3S1R H;  1SYB A;  1PFB A;  1STG A;  3K58 A;  1PV4 A;  4WFN 3;  3VR6 A;  2ZJP A;  4JI6 L;  2L5T A;  2F4I A;  3FDT A;  1XPR A;  1CFM A;  3DWQ A;  1J5E L;  4A3F G;  4C3J G;  1VQC A;  1NSN S;  3GTL H;  4DXF A;  1D5M C;  2HUG A;  1WOC A;  1E2V A;  4DNI A;  5C4H A;  4IPC A;  1ICF B;  1I94 L;  2QGQ A;  2Z9H A;  1YI2 A;  4GOP B;  4H0L C;  1HFG A;  4O42 A;  1J6Q A;  5ELN A;  1Q1E A;  3IRB A;  4ZKB B;  2F0Q A;  4DV2 L;  2R7Z H;  3GTG H;  1JE5 A;  4S3S A;  2F4V L;  2EZV A;  2IY5 B;  1HXY D;  2YTV A;  3TDQ A;  3CP0 A;  1SNO A;  5EPL A;  2R7D A;  5GAH C;  1SNP A;  1C0A A;  3A8K E;  4WJ3 M;  5T1G A;  4QUF A;  5C3W A;  1EU4 A;  4XQN A;  5KGU A;  4J6H A;  1BQQ T;  2O5J C;  1CZW A;  4A4I A;  3QOJ A;  3CCU A;  1A15 A;  4ODG A;  3ZJY C;  1HNX L;  1JB3 A;  5C3E H;  3I55 A;  1YNX A;  1ZEQ X;  1QZG A;  2ASB A;  1XX8 A;  3DM1 A;  2MGS A;  3KFU A;  2N3S A;  1JE4 A;  5IYD G;  2OQ0 A;  5LL6 S;  1EWI A;  2ZM6 Q;  5CMD A;  4LF9 L;  2WKD A;  5ELO A;  1TII D;  1DOL A;  1EIH A;  3PGZ A;  4V19 0;  3V05 A;  2A69 C;  1CQV A;  3I8Z A;  5JPN C;  3RD4 A;  2MHV A;  5IGF A;  3UE0 A;  5CV4 A;  1UAP A;  4H13 C;  4HIO A;  4A3B G;  2ATW A;  1I6V C;  1A0I A;  5IT9 c;  3TME A;  3ULL A;  4KN7 C;  1KDC A;  1Q90 A;  2L1B A;  5EBC A;  5HGQ A;  1GHJ A;  1ET6 A;  2FHT A;  1HA6 A;  1IXR A;  4RGT A;  3J7Y W;  4AQY Q;  2XGT A;  1ZXT A;  2JA7 G;  1C48 A;  4DK1 A;  5JJZ A;  4A75 A;  2E5L Q;  1GD7 A;  1VQD A;  3T16 A;  2QA4 A;  4A3D G;  3NP8 A;  4OHJ A;  1P16 A;  1U4R A;  2NVQ B;  2IHF A;  2K03 A;  3U50 C;  4LF6 L;  2I0Q A;  3OW2 A;  4P75 A;  3CKI B;  4JPB W;  2HQE A;  2K1B A;  1YEZ A;  1CSQ A;  3F8T A;  1SNM A;  3HOY G;  4AIM A;  4OGQ C;  3S9W A;  2VUM G;  4K5W A;  1K3B C;  1BBX C;  4ZQ3 A;  2LXK A;  3CPW A;  4DV3 Q;  4JI5 L;  4A3K G;  1JT8 A;  4FYD A;  1XPU A;  2ZXP A;  1AFP A;  3OHX C;  1I4Q A;  1JJC B;  1EWH A;  4R4T A;  1XYI A;  1Z7T A;  2B63 G;  4K6L A;  1PH3 A;  3MXU A;  2K14 A;  1XMO Q;  2DGY A;  3SHL A;  5JEA H;  2L55 A;  3CC4 A;  1PH9 A;  2AQ2 B;  4K2L A;  1UEB A;  1FGB D;  3A56 A;  5M5Y B;  3AFP A;  1ML0 D;  1CZG A;  2F0E A;  4GOP A;  5C44 G;  1OTC A;  3S2D B;  4DUY L;  3D31 A;  4DR2 Q;  1S3O A;  1CUK A;  4NXN Q;  1K83 B;  2A68 C;  1SLJ A;  1LAC A;  2OQK A;  4CHT B;  2PCF B;  1B44 D;  5BR8 Q;  3CCE A;  2F0T A;  1P8L A;  1U4L A;  4DA2 A;  4A3J G;  1JCK B;  5J22 A;  3JAM c;  3OTO Q;  2ES2 A;  3S24 A;  1JJG A;  3L9A X;  1DOK A;  1TXY A;  4RGO S;  1GUO A;  1LO5 D;  1CT1 D;  2PPB C;  2O5I C;  1G2T A;  3J7A 5;  3HOW G;  1WTV A;  1D7Q A;  2NVX B;  3HOU B;  3SE0 A;  2ICI A;  2B2W A;  3L7Z C;  5CYU A;  3M4O B;  4EVO A;  2NVQ H;  5DNF A;  1YNN C;  1NAP A;  1LT4 D;  3ONA B;  4IPG A;  1PH4 A;  3AYH B;  2QEX A;  2HIV A;  3NEN A;  2K5N A;  5CV8 A;  1BDO A;  5IYB H;  1XMQ Q;  1BNZ A;  1MKH A;  3J7Z C;  2RCF A;  2C5C A;  2D0P A;  2EDG A;  1I4P A;  2EYH A;  3NTK A;  1EQT A;  1X65 A;  1GHK A;  4OX9 L;  1IYJ B;  2D9U A;  4X3S A;  1M90 C;  2N49 A;  1SXT A;  3VYT A;  3BS1 A;  2EJG C;  3MWY W;  3CD6 A;  5CC4 A;  1BCP B;  4G7Z C;  1KHI A;  1WTR A;  3PO2 H;  3NK9 A;  1Y1V G;  2R93 B;  2ZM6 L;  1FD7 D;  3J81 i;  3HOX B;  1HNZ Q;  4OWX B;  3BZK A;  2KEN A;  4B3M Q;  4KKU A;  4RFB A;  3D4D A;  3S2D H;  2A1A A;  1LUZ A;  3KBX A;  1AE2 A;  4JI4 L;  1HJP A;  3NPP A;  1U4M A;  3R8B A;  2VS1 A;  5GAE C;  3F2D A;  2A74 C;  1SMY C;  2A69 D;  1WTH A;  3MHB A;  4G7H C;  1A8V A;  1KDB A;  1HPC A;  4JI3 Q;  4C3H B;  4KN4 C;  2PZW A;  1U0L A;  2NVX H;  2OXP A;  1STY A;  1BOS A;  2E5L L;  4JI0 Q;  2F1M A;  3HOU H;  1XWE A;  3PUZ A;  5EPJ A;  3T1Y Q;  4JI8 Q;  4LF5 Q;  2QDL A;  3M4O H;  1ET9 A;  2BH2 A;  1Q1B A;  3H3V C;  4EGV A;  3GTO B;  1DZ1 A;  5D65 A;  3U4V A;  5C0X J;  3SVM A;  1K73 C;  4FF2 A;  1PRT B;  1SYG A;  2E2H B;  2EYF A;  1I6H B;  4EQN A;  4JG2 A;  3PUV A;  1GM5 A;  4DR1 Q;  4DV3 L;  2AMC B;  2DY7 A;  2KJX A;  4IJL A;  3STB C;  2YYZ A;  1TS4 A;  2F0J A;  4BBS G;  1K0S A;  1J8I A;  2X6L A;  3U58 A;  3HOX H;  1XMO L;  2M00 A;  4A3L G;  1LTB D;  3GTM B;  1X3E A;  1MBY A;  2DJF C;  2TMP A;  1O7L A;  4IUV A;  1X55 A;  3CCJ A;  3D0F A;  5LMN Q;  1NMG A;  3OIP A;  4CJ1 B;  4YWM A;  4DR2 L;  4NB3 A;  5IOC A;  4O1N A;  1EZ6 A;  1BXT A;  2F0G A;  2WB1 E;  4ULL A;  2VW9 A;  3GQB A;  3TRZ A;  1X54 A;  2EXZ A;  1PDQ A;  4Y52 H;  3TP6 A;  2P5Z X;  3OPO A;  5I9O A;  4DV4 Q;  4C3H H;  3OTO L;  4RG1 A;  1PTO B;  2A68 D;  2VQF Q;  3PF5 A;  3L0O A;  2KED A;  3X3N A;  4M8A A;  1O7Z A;  3T13 A;  2HCC A;  4I7Z C;  4ID6 A;  2WP8 J;  2B2U C;  5A2Q E;  4PV1 C;  3K0X A;  2Q8T A;  5DEH A;  4P73 A;  4DPG A;  1DOM A;  3GTO H;  4C1N I;  2OTL A;  4QF4 A;  2XTI A;  4KHP Q;  1PRT F;  2JA6 B;  1ENA A;  5AFW A;  2BDN A;  1PA6 A;  3K7A H;  4AYB G;  3SEB A;  1STH A;  3ICE A;  1TWC B;  1HUM A;  1I6H H;  1F9P A;  1BVS A;  5A35 A;  2K32 A;  1YNN D;  1Q12 A;  3WWV A;  1S4Z A;  1E3P A;  1MD2 D;  3IKJ A;  4GZY C;  1STB A;  4PMB A;  3PF4 A;  1ASY A;  4EQ5 A;  4BBR G;  1B7Y B;  1SNQ A;  3GTM H;  3GV3 A;  4KMU C;  1TWF B;  1VQJ A;  4RHS A;  5J1Z A;  1TWG H;  4QL5 A;  2JA5 B;  3NEL A;  4A76 A;  1VQ4 A;  1TU2 B;  2Z6K A;  4L5R C;  1VQ8 A;  1R4P B;  1JOR A;  4R4I A;  4BA2 I;  1CHQ D;  2J0T D;  4FF4 A;  2WAC A;  3WOF A;  4GNX B;  3S15 B;  4IJH A;  5C4J B;  2UUB Q;  4TVA B;  1LT6 D;  3QG1 A;  2FMC A;  4F7X A;  5ELE A;  3UDX A;  2R92 G;  1MSH A;  2WAQ B;  1PTO H;  3CHB D;  2EOT A;  4JI3 L;  3I4N B;  3PUY A;  2PZU A;  3DHQ A;  4GLA C;  1SMY D;  3Q23 A;  2B39 A;  4A93 B;  5IGB A;  4IFD G;  3T1Y L;  1FNU A;  3FMC A;  3K5O A;  4JI8 L;  1B3Q A;  3HKZ E;  3MVV A;  4LF5 L;  2D2C C;  2D62 A;  5E7N A;  2CW0 C;  4A3I H;  4OEM B;  4DN4 M;  1IYU A;  2JA6 H;  3CMA A;  1Q7Y C;  1HQM C;  2EQS A;  5DAU A;  2B2T C;  2O2L D;  5EKL A;  4IOC A;  5I9P A;  3VYU A;  4H02 A;  4WOR A;  4IUP A;  2LY7 A;  1IBM Q;  1QZH A;  1B3A A;  4DR1 L;  4OO1 I;  1U9R A;  4HCE A;  4K8I A;  4TKO B;  1IHZ A;  1SYE A;  3VR2 A;  2UUA L;  2F3W A;  3VYS A;  1KRT A;  4IQZ A;  1Y1W G;  2QKI C;  2WB1 B;  4C3I B;  1TWF H;  1AW7 A;  1LAB A;  1SJH D;  1SYC A;  2PQA B;  4UDU C;  2JA5 H;  1DYQ A;  2VNU D;  4BY1 G;  1QVF A;  1F77 A;  5LMN L;  4NP5 A;  2NVY B;  1FJG L;  2DNC A;  4RGN A;  3S15 H;  1AP0 A;  2OF1 A;  4WRD A;  1DGS A;  3MZ5 A;  4LF4 Q;  4P2C B;  3GTJ B;  4BY7 B;  1U5K A;  3ERS X;  3HFZ B;  2NZO A;  4DV4 L;  3CCS A;  3I3C A;  3I4N H;  2QF7 A;  4JBW A;  2VQF L;  3I4L A;  3MXP A;  4KY5 A;  4DKA C;  4A93 H;  4MNO A;  1W6J A;  3G48 A;  2K5H A;  3I2Z A;  3S1N H;  4N8F A;  3ULP A;  1CK1 A;  3W5O A;  3K0Y A;  2JN4 A;  3D6C A;  1AZP A;  4IFD J;  2B3G A;  1XNQ Q;  2L15 A;  3J81 E;  1EU3 A;  1C7Y A;  1XTD A;  2I5M X;  3AEV A;  1EEF D;  3U9S A;  1JWM D;  3TBI B;  4DR4 Q;  3C1E A;  3ZYY X;  3Q8D A;  4IUQ A;  1SJE D;  1GOZ A;  3KJP A;  2K01 A;  1EQQ A;  3H0G B;  3S16 B;  3UE1 A;  1HR0 Q;  3I4M B;  4X3U A;  1PYW D;  2H1E A;  4JVZ A;  4R4Q A;  5T1I A;  1KAW A;  1CQF A;  1FL0 A;  4ME3 A;  1Z47 A;  2PO4 A;  3BZC A;  4GNX A;  1R9T B;  4C2M B;  4GKK L;  1VQ7 A;  2XN9 C;  2R7Z G;  1CKO A;  2SNS A;  2KCN A;  3QR8 A;  4L5Q A;  2NVY H;  3OSO A;  5K5P A;  1SR3 A;  5FLM H;  3ND8 A;  1SBB B;  3NQI A;  5JJL A;  2F0I A;  4K2K A;  5BN5 A;  3GTJ H;  4BY7 H;  4J1M A;  4QMG A;  4ABN A;  3PIO 3;  4HJ5 A;  4LWC A;  4HR7 B;  4POF A;  3W3A A;  5C3E G;  5EQ0 A;  4K14 A;  1LT5 D;  1CA5 A;  4JYA Q;  1OXT A;  3IL8 A;  5C0X I;  1K8G A;  1DJR D;  3BG3 A;  1Q81 C;  3KDF B;  2N88 A;  2B2W C;  3D4W A;  4PMW A;  1XNR Q;  5FLX c;  2BH8 A;  2BE5 C;  5CGK A;  1UE1 A;  1QUQ A;  1J9O A;  2Z1C A;  1N36 L;  3S2H B;  1HRJ A;  1PZK D;  3KF8 B;  5CBA E;  2WKC A;  3Q24 A;  3RN2 A;  3P75 A;  5CV9 A;  3GV6 A;  3QIA A;  3K59 A;  1EY4 A;  4QJF A;  2LS0 1;  2BOS A;  2UU9 Q;  2BDO A;  3H0G H;  2CWP A;  2CW0 D;  2PQA A;  4PZ7 A;  2BA1 A;  1JC7 A;  2XWJ B;  5E4W C;  1IBM L;  2A8V A;  1O7Y A;  2IW3 A;  3I4M H;  1U4P A;  3SGI A;  3FPU B;  2JEA I;  4X3T A;  1TKW B;  3OMC A;  2EXD A;  1R9T H;  4C2M H;  2F0W A;  4RKB A;  1ZKO A;  2E75 C;  3GTK B;  4RGM A;  4DFA A;  1Q46 A;  1VQ9 A;  1JB7 A;  2UXB Q;  1O78 A;  1FGU A;  1SRU A;  1PH7 A;  5A2Q L;  2K33 A;  1W3S A;  1EY0 A;  4JI2 Q;  3K5M A;  4LF4 L;  1PH2 A;  4JBK A;  1TVX A;  1VQI A;  1IL8 A;  1OXX K;  1WFQ A;  1SNC A;  4JBM A;  2CKZ B;  3HOV H;  1XJV A;  2VQE Q;  4N9T A;  3TP7 A;  3J80 c;  4ZCK A;  3KJO A;  1STA A;  2F52 A;  5FO7 B;  5JEA G;  3S2H H;  2J7Z A;  2NWG A;  4IUT A;  1B9M A;  4CDE C;  4NDX A;  2EY1 A;  1CTM A;  4DR4 L;  5JOB A;  1VQ5 A;  2E76 C;  1PMR A;  1VQN A;  2KBN A;  2H5X A;  1K28 A;  4BXX H;  1K8O A;  2CVR A;  1VF7 A;  1T5X D;  2AQ1 B;  1X32 A;  3H09 A;  4QGU A;  1GJX A;  4K5X A;  4DV6 Q;  1EY5 A;  3NEM A;  3KBG A;  4KJN A;  2HT1 A;  4C3J B;  3PCO B;  5ISR A;  4X64 Q;  4LF7 Q;  1EY7 A;  1HFN A;  1L0X B;  4LFA L;  1RTO A;  1Q86 C;  3UI2 A;  4HSV A;  3SXH A;  5M3F G;  4Y7N B;  4YWL A;  3G4S A;  1SFO B;  2A19 A;  5M9O A;  5ELC A;  4HN7 A;  1E7Z A;  3KDF A;  3HEJ A;  1UE7 A;  1WJJ A;  3NSW A;  1LLR D;  3CPF A;  2KHI A;  2QIL A;  1WTW A;  3NWT A;  3JAM i;  5IYB G;  4HAE A;  5ELF A;  4HJ9 A;  5KEE A;  1EOT A;  4QB4 A;  5EAY A;  2ZXO A;  3KF8 A;  1E1O A;  1WYD A;  3H3V I;  4K0K Q;  2UUC L;  1TT2 A;  1EYG A;  5JJI A;  4ZYS A;  2F3V A;  4DR5 Q;  3S17 B;  1XNR L;  2PI2 E;  2B2V A;  2OTJ A;  3PO2 G;  2XRQ D;  4CDC C;  1AEX A;  4A3M B;  3BDL A;  4YCW A;  5JEA J;  4IO9 A;  1PH6 A;  4NMZ A;  2BE5 D;  2KCC A;  4JOI C;  4IUR A;  4TRD A;  4EQO A;  2A73 B;  2UU9 L;  1EZ8 A;  2EY2 A;  1MI2 A;  4JCV E;  5BN3 A;  1A3V A;  2Z6B A;  5K36 H;  1IZ6 A;  4CKE A;  1QE6 A;  2RA4 A;  1TR5 A;  1Q82 C;  4UP9 A;  4A3B B;  1CSP A;  3EIV A;  2E2J B;  3DM3 A;  4X66 Q;  2L11 A;  3NTI A;  2R7F A;  1S5B D;  2VL6 A;  5FLX E;  3D8G A;  3SR1 A;  2RBM A;  2EYO A;  1EYD A;  4Y7N H;  1A62 A;  2UXB L;  1HUN A;  2JE6 I;  4RH6 A;  4JK1 C;  1VQ6 A;  4KV6 A;  2AWO A;  2PMZ E;  3NQT A;  2K5W A;  1S5F D;  4CBV A;  4XTC S;  4ME5 A;  4JI2 L;  1K0R A;  3VR4 A;  3J81 L;  4IFD I;  1F2M A;  4MN3 A;  1YZ6 A;  1PRT C;  4HSP A;  4NKL A;  5FOB B;  3S17 H;  3A74 A;  1A2T A;  1TQO A;  1UWV A;  4B9X A;  3TQY A;  2VQE L;  1ZYR C;  2UXC Q;  1EOV A;  5IY0 A;  2VUM B;  4JV5 Q;  4JC0 A;  3HOX G;  5HGT A;  4A3M H;  1C9O A;  4DV5 Q;  2F0F A;  4R8I A;  4A3K B;  1VMC A;  1DCZ A;  2D0O A;  3OYY A;  5CV6 A;  2JA8 B;  5BN4 A;  3U4Z A;  2B63 B;  5C3X A;  1MHW C;  3PQI A;  3W1B A;  1O80 A;  4HMI A;  4KY7 A;  4B3S Q;  2J4X A;  5FJ8 H;  3GO5 A;  1KC8 C;  4OO1 H;  1G51 A;  1WI5 A;  1NNX A;  1Y8O B;  4B08 A;  4X62 Q;  2F0O A;  4JI7 Q;  5C44 B;  3KLS A;  4DNR B;  1S72 A;  1QJO A;  4B3T Q;  2H4O A;  1PYS B;  3CAM A;  4C3H G;  2WII B;  4A3B H;  2E2J H;  1KD1 C;  2JEB I;  4GN4 B;  5E1F A;  2VZA A;  1ASZ A;  1H9M A;  2ZTC A;  4MTK A;  5M5Y H;  3J80 E;  5ELD A;  4A3J B;  2VXW A;  1EEI D;  4IAL A;  3EVQ A;  5FKA C;  1X3Q A;  1K83 H;  1Y8N B;  4IPH A;  3HOW B;  1LTL A;  4RKL A;  2Z4I A;  4FF1 A;  4LAA A;  1YHB A;  1M8A A;  3PO3 G;  3DXJ C;  2E2D C;  3M85 A;  1LYL A;  3U9O A;  3DEP A;  4K0K L;  2LFN A;  4DR5 L;  2Z8L A;  2ZXR A;  4AQY L;  3HGB A;  2DY8 A;  1TWH B;  3CC7 A;  3PIP A;  3GP7 A;  2LMC B;  3FKI B;  3T51 B;  2EYL A;  2FXQ A;  1BBU A;  4J8Q A;  4A3K H;  3N6R A;  5D3I B;  1OXU A;  1D6E C;  1R4Q B;  2XNA C;  2JA8 H;  3TS2 A;  4ZKC B;  4PMC A;  2B63 H;  2KA7 A;  2RF4 A;  2MPM A;  3RLF A;  1HQR D;  2YV5 A;  1Y1V B;  4AYB E;  3LWE A;  1AZQ A;  1CI3 M;  1IBK Q;  2B29 A;  1G6P A;  2CQO A;  4MZ9 A;  4JI1 Q;  5IT9 E;  2F0H A;  2RSN A;  3TZU A;  3CC2 A;  1BCP F;  5C44 H;  3B6Y A;  2X6G A;  2F0K A;  3E6Z X;  4LFB Q;  4YHH Q;  2D5D A;  2PMZ B;  2R93 H;  1HHV A;  4AH6 A;  4ALP A;  1B8A A;  2TSS A;  3TSS A;  4IZ8 A;  2KEC A;  4X66 L;  1Y8P B;  4K6D A;  4G7O C;  3FVQ A;  3HOZ B;  2R61 A;  4A3J H;  1SE8 A;  1YBY A;  2RHQ B;  5IGD A;  2JA9 A;  1V43 A;  1GUT A;  3DUZ A;  1JOO A;  4A3I G;  2NBF A;  4NXN L;  4HJ8 A;  1VQB A;  2JA6 G;  2GA4 B;  2B2Y C;  3TN2 A;  1F9R A;  5C5M A;  1PH8 A;  1VQL A;  2HHH Q;  1I4R A;  2K5V A;  4IOA A;  3G7L A;  1FNW A;  5BR8 L;  3TEH B;  1LTT D;  5C0X H;  1A63 A;  3BU2 A;  3A8J E;  3OW7 A;  4R9W A;  2PNR C;  3NE5 B;  2K7V A;  3CME A;  1V1P A;  2SOB A;  3FKI H;  5CR3 A;  4ZRZ A;  2UXC L;  5LMN W;  5TSS A;  1PRT D;  4JV5 L;  4KTA A;  1XTC D;  2MQH A;  3IAY A;  3FHW A;  3FPP A;  4DV5 L;  3RN5 A;  4DAP A;  5J39 A;  4GLX A;  4C56 C;  1L1O B;  3R93 A;  1GXD C;  1ONL A;  1ZYR D;  4KD4 A;  1Y1V H;  2RQX A;  4XXE A;  1XMQ L;  3RUZ A;  4B3S L;  2E2H H;  4KK7 A;  2Y0S G;  1LTR D;  5IGC A;  2EYJ A;  4CKB A;  4DR7 Q;  2HIX A;  4LNQ A;  2MUY A;  4X62 L;  1I4G A;  1V1Q A;  3H94 A;  4JI7 L;  5AJ3 Q;  4TSS A;  2WAQ G;  3JAM E;  2FIN B;  1EYC A;  3G6E A;  4B3T L;  4DR3 Q;  1XPO A;  2A6E C;  2PI2 A;  1Q3L A;  4U68 A;  1HNZ L;  4A93 G;  4A3G G;  3HOZ H;  4B3M L;  1RDP D;  2GVB A;  4XYQ A;  2IL8 A;  1NTG A;  3I70 A;  1UEA B;  4V0B A;  4HJ7 A;  1Y14 B;  2R6G A;  3VR3 A;  2YU9 B;  5KNB A;  1JIC A;  3NWS A;  1N34 Q;  3E9I A;  1PTO F;  1SE3 A;  3BDO A;  5EJW A;  2MNA A;  3HP3 A;  4K8J A;  3NUC A;  4KKS A;  1ENC A;  4LMQ D;  3J81 j;  3PV0 A;  2CCZ A;  1JMC A;  3KK7 A;  2K52 A;  1X9N A;  4JI0 L;  5C4X B;  1T9H A;  2OWO A;  2AWN A;  4DV0 Q;  1WTP A;  3OOC A;  3PMF A;  2Z4H A;  3TZD A;  3VR5 A;  3K57 A;  3I91 A;  1E22 A;  3M4Y A;  1HTP A;  3E0J A;  3EA6 A;  1GUW A;  4B3R Q;  3R2I A;  4BBR B;  5M5X B;  4A3L H;  5G3L F;  5IIF A;  1TWC H;  3TS0 A;  2DNE A;  3SK5 A;  5FLM G;  5FLX L;  3QJY A;  1IBK L;  4P74 A;  1VQM A;  3G71 A;  4JI1 L;  4OON A;  1QUQ B;  4DK6 C;  2CFM A;  2HQL A;  1Q8K A;  4PZ8 A;  3L2P A;  1RIP A;  2EE1 A;  4RWS C;  2VB3 X;  2AHO B;  1EFW A;  1I5F A;  1FVI A;  4YHH L;  4FXD A;  2PYK A;  4QQB X;  4YIJ A;  5E3F A;  3MFY A;  1EY6 A;  3STB D;  2R92 B;  3MA2 B;  4U67 3;  1EYA A;  3DEO A;  1YHA A;  5FO8 B;  1N8R C;  2NN6 G;  1XXG A;  4FXG C;  1C8C A;  2YU9 H;  4O2D A;  1HTL D;  5C4J H;  1GUG A;  1LM0 A;  3I7F A;  1IL2 A;  4MHE A;  1SE2 A;  2HHH L;  4N9P A; 
#chains in the Genus database with same CATH homology
 4DXG A;  1F2Z A;  4ZUJ A;  3S14 B;  1B9N A;  1F9Q A;  3CQZ B;  1ILP A;  4XDX A;  2B8F A;  2LKV A;  1MGS A;  1QWY A;  2IT1 A;  3MFG A;  4KD3 A;  4RA8 A;  2NVT B;  2KEE A;  4IUU A;  2A6H C;  2B8G A;  1I50 B;  1RHP A;  1RJT A;  1QNU A;  1Y1W B;  1STE A;  4DNT B;  1D1K A;  3J80 L;  2KOL A;  4EQP A;  1TS2 A;  4RAU C;  3OMG A;  2QDB A;  1WCM B;  4BY1 B;  2X69 A;  3GTQ B;  3S1M B;  4G57 A;  4PNY A;  1D2B A;  1NR4 A;  1ENF A;  1V8Q A;  2NYZ D;  3ITP A;  2XVS A;  2ENB A;  4LJZ C;  2A6E D;  5I2X A;  4XIG S;  5I2Y A;  2O4X A;  3CU7 A;  1EQV A;  4IFD H;  3V96 A;  4ZUI A;  5CV5 A;  2IPK D;  3DWA A;  3HKZ B;  1SE4 A;  1GUS A;  4KY6 A;  1STN A;  3VYR A;  1FNV A;  5IT9 L;  2NTT A;  2XWB B;  4XQQ A;  4L8J A;  2F0V A;  3LWU A;  3GTL B;  2C9O A;  3NBI A;  4HMJ A;  2HCI A;  1H9S B;  3SDZ A;  1KNA A;  2PW5 A;  3PUX A;  2RKS A;  4HCS A;  3BZD B;  1AN8 A;  4H44 C;  3GTG B;  1SYD A;  3BYY B;  3Q6S A;  1LTG D;  2M2L A;  3I73 A;  3RMH A;  2V4D A;  3KLR A;  3R2T A;  1SAP A;  1VCI A;  3EQL C;  4QUC A;  2KVM A;  4HTH A;  2IX0 A;  2EVB A;  4A3E B;  4KKT A;  4HED A;  1S5E D;  1CA6 A;  3P1H A;  5M3M B;  2F0S A;  1Q8I A;  2K04 A;  4UAI A;  5ELB A;  4ZAI A;  4FO2 A;  3W2D A;  1S5D D;  5K36 G;  1ROD A;  3A7A B;  3G6J B;  1I4H A;  1NR2 A;  1I4X A;  1W6K A;  1LV9 A;  1KDA A;  4ZLT F;  1KLU D;  3JAM L;  3MC0 B;  5IGE A;  1HCZ A;  4M1U B;  4Q5V A;  2A6H D;  4F87 A;  2K5D A;  4L6T B;  3AB9 A;  4XT3 B;  4A3F B;  5COR A;  2E2I B;  5HUR A;  4L63 B;  1B4O A;  1E2W A;  2L9H A;  3GD7 A;  5E4X A;  1A3T A;  3T4A C;  1G29 1;  2A5H A;  2B2T A;  2JYO A;  2ICE C;  3HG9 A;  3A54 A;  3QWN A;  5EPK A;  3TP8 A;  3C1F A;  1BUV T;  1QOH A;  5I6W A;  4MIU A;  3BYT B;  3OIQ A;  3X3M A;  4OO1 G;  3M3Y B;  2DN8 A;  4RHR A;  1EL0 A;  4R8N A;  1RF2 D;  1T5E A;  1H9S A;  3H91 A;  1SSO A;  1WVL A;  3Q0A A;  3BDC A;  1II3 A;  1DON A;  3VA5 A;  2G9D A;  1OXS C;  1H9J A;  1UNS A;  3EFX D;  5NUC A;  5C6A A;  1BCP C;  2IX3 A;  3F2U A;  4XYO A;  3D6W A;  2AUJ D;  1TS3 A;  5DM7 3;  5C5L A;  3A7L A;  3D3R A;  1SYF A;  3LNN A;  5EGT A;  1PXU A;  1LTA D;  1ILQ A;  1B50 A;  1QB5 D;  1FR3 A;  5CBE E;  5M3F B;  3FEW X;  3IFT A;  1L0Y B;  2Q8I B;  4TQU S;  3RZO B;  4IUN A;  1VF5 C;  5IGG A;  2KUM A;  4FVM A;  1PLF A;  3NBH A;  2K6A A;  4H7B A;  5KRU A;  2PW7 A;  4BA1 I;  2JA7 B;  1B1Z A;  3MAQ A;  1KLG D;  3PO2 B;  4A3D B;  4FNF A;  1F2L A;  3J7A F;  4KJO A;  2AUK A;  2F03 A;  4X3K A;  4XT1 B;  1Z6H A;  5FK9 C;  1JOQ A;  3HOY B;  3URY A;  4FP5 D;  4DGZ A;  2EY6 A;  2FJ2 A;  2EPB A;  2HDL A;  2IWH A;  2OEO A;  4CGY B;  1V1P B;  3M7G A;  5FO9 B;  4ZK9 B;  1S5C D;  2F0U A;  2IJ0 A;  4CJ0 B;  4LK1 C;  3MTS A;  2L12 A;  1K8M A;  2L4N A;  4E6I A;  4BS9 A;  5C0X G;  3M7N A;  2NN6 I;  2QEJ C;  1PTO C;  3QO2 A;  2BA0 A;  3I90 A;  1IKM A;  2JP1 A;  1NUC A;  1JWU D;  1QCB D;  1TY2 A;  4FXK C;  4QCL A;  1UUP A;  3H6M A;  2M9V A;  2E74 C;  1DXM A;  5JAV A;  1OO9 B;  1EIG A;  4KHZ A;  2SDF A;  1D5Z C;  3HS0 C;  3SK4 A;  4C1N K;  2RSO A;  5M5W B;  3C2P A;  3A55 A;  1LT3 D;  1TS5 A;  4CJ2 C;  2L0C A;  4DU9 A;  3RZD B;  3QB3 A;  2G9H D;  3NXW A;  3IFD A;  1TWA B;  3D4R A;  2EYP A;  3EJI A;  5EKK A;  2FMM A;  1BF4 A;  1OXV A;  2ZT9 C;  3Q22 A;  2PQE A;  1D5X C;  4OL7 A;  1BCP D;  2RVL A;  3L3O C;  1G6Z A;  1WD1 A;  2KHS A;  2RDF A;  1YNJ C;  5IOD A;  3NHH A;  3C46 A;  1PZI D;  3PO3 B;  3K7A B;  2N55 A;  3TP5 A;  1BO0 A;  4RCO A;  4K5V A;  2I46 A;  1QNK A;  3MXG A;  1X3P A;  1DD2 A;  2EYM A;  1CM9 A;  1JOK A;  3OWE B;  3K5N A;  2IX1 A;  2F0L A;  2EJM A;  4Z9C B;  1TWG B;  4RCN A;  2BCO A;  5EKI A;  3FRP B;  5C4Z A;  4BWG B;  2F0N A;  4PQX A;  4IN3 A;  1Y69 U;  2F0D A;  1LTI D;  4BBS B;  1A3U A;  2XRS D;  1IW7 C;  5JVG 3;  1E0B A;  5LL6 X;  2NTS A;  4KI0 A;  1G91 A;  2WV6 D;  4G4K A;  3CRL C;  4F88 A;  3ERO A;  4A3I B;  1A6X A;  1V1O A;  1ESR A;  1TY0 A;  2CHB D;  3J7A V;  1EWC A;  3K6O A;  3VA7 A;  1PTO D;  1DM0 B;  1WTO A;  1BR9 A;  2R3Z A;  3HZX A;  3ND9 A;  1NCV A;  2QCP X;  5I6Y A;  2I07 B;  2SEB D;  4AYB B;  2XSC A;  2Y0S B;  2KQ3 A;  1WD0 A;  1HA5 A;  4C3I G;  3N52 A;  5JVH 3;  5G3L D;  2ID0 A;  1LTS D;  3DMU A;  4FF3 A;  3C3L A;  3NTH A;  3AMU A;  1I3Q B;  1F9S A;  3WOE A;  1G2S A;  1EFI D;  1H9K A;  4A3G B;  2NUC A;  3S1N B;  1IYV A;  1PFN A;  3SK6 A;  3R3O A;  2PZT A;  3V2T A;  3O13 A;  2CQA A;  2K28 A;  1JR0 D;  3AU7 A;  5KYI A;  1KAA A;  1YNJ D;  1CHP D;  1JWS D;  5KYL A;  4WJW A;  3ERQ A;  1E2Z A;  1KTK A;  1G8Z D;  2XIW A;  5EBD A;  1A2U A;  1RKN A;  2K5Q A;  1B53 A;  5KNC A;  1KNE A;  3T56 B;  4KHV A;  1GUN A;  2OT2 A;  1SND A;  2VB2 X;  2B2V C;  3MXN A;  1M4V A;  3E5S A;  1WTX A;  2WIN B;  2JXM B;  1C4Q A;  3A8I E;  3P20 A;  5D3D A;  2EY5 A;  4DAV A;  3WDN A;  4B9W A;  1SEB D;  4XQJ A;  1PZJ D;  2F0M A;  3CRK C;  3KLS X;  3K5L A;  1D1I A;  4OIJ A;  5JPM C;  3MEH A;  1VDZ A;  2AQ3 B;  5CV7 A;  1IW7 D;  2SNM A;  5D14 A;  3GTP B;  3BVG A;  3I72 A;  1ESF A;  1H9R A;  5COY A;  1JQY D;  1QG7 A;  4DAY A;  2F0P A;  4I65 A;  4OIK A;  5F2D A;  3KUP A;  4F8M A;  1ICW A;  3PUW A;  1RTN A;  5I4D A;  3S1Q B;  2MP1 A;  4DK0 A;  3S1R B;  1FYC A;  5DM6 3;  1RD9 D;  3PIP 3;  1VMP A;  5LHY 1;  1PFM A;  3P7J A;  2EJF C;  1SDF A;  4ILW A;  4Q0F A;  1B2T A;  2B2Y A;  2RDG A;  3BVZ A;  2FFK B;  2JSO A;  3SK8 A;  3OWF A;  1EY9 A;  4DF7 A;  1RCV D;  2NZ1 D;  3HOV B;  2R7Z B;  1IKL A;  4NW2 A;  3T53 B;  2NN6 H;  2B2U A;  5KND A;  1F2Y A;  4QIW B;  2Q8R E;  3HRZ C;  2K05 A;  3DWP A;  1WTQ A;  2MJ8 A;  1MSG A;  2NB0 A;  5C3E B;  2HDM A;  3LX0 A;  1KAB A;  1QIL A;  1EY8 A;  3BVM A;  3QOL A;  2RDH A;  5KIX A;  4CKC A;  1SYB A;  1PFB A;  1STG A;  3K58 A;  4WFN 3;  3VR6 A;  2L5T A;  2F4I A;  3FDT A;  1CFM A;  3DWQ A;  4C3J G;  1NSN S;  4DXF A;  1D5M C;  2HUG A;  1E2V A;  5C4H A;  4H0L C;  1HFG A;  4O42 A;  1Q1E A;  4ZKB B;  2F0Q A;  4S3S A;  2EZV A;  1HXY D;  3TDQ A;  1SNO A;  5EPL A;  1SNP A;  3A8K E;  5T1G A;  4QUF A;  5C3W A;  1EU4 A;  4XQN A;  5KGU A;  4J6H A;  1BQQ T;  2O5J C;  1CZW A;  3QOJ A;  1A15 A;  4ODG A;  1JB3 A;  1ZEQ X;  1XX8 A;  3DM1 A;  2MGS A;  1JE4 A;  5LL6 S;  5CMD A;  2WKD A;  1TII D;  1DOL A;  1EIH A;  4V19 0;  3V05 A;  2A69 C;  1CQV A;  3I8Z A;  5JPN C;  3RD4 A;  2MHV A;  5IGF A;  5CV4 A;  1UAP A;  4H13 C;  1I6V C;  3TME A;  4KN7 C;  1KDC A;  1Q90 A;  2L1B A;  5EBC A;  1GHJ A;  1ET6 A;  2FHT A;  1HA6 A;  4RGT A;  3J7Y W;  1ZXT A;  1C48 A;  4DK1 A;  5JJZ A;  3T16 A;  3NP8 A;  4OHJ A;  1U4R A;  2NVQ B;  2K03 A;  3CKI B;  2HQE A;  2K1B A;  1SNM A;  4OGQ C;  3S9W A;  4K5W A;  1BBX C;  4ZQ3 A;  4FYD A;  2ZXP A;  1AFP A;  1I4Q A;  3OHX C;  1EWH A;  1XYI A;  1Z7T A;  4K6L A;  3MXU A;  3SHL A;  5JEA H;  2L55 A;  2AQ2 B;  4K2L A;  1FGB D;  3A56 A;  5M5Y B;  1ML0 D;  1CZG A;  2F0E A;  3S2D B;  3D31 A;  1K83 B;  2A68 C;  1LAC A;  4CHT B;  2PCF B;  1B44 D;  2F0T A;  1U4L A;  4DA2 A;  1JCK B;  5J22 A;  3L9A X;  1DOK A;  4RGO S;  1GUO A;  1LO5 D;  1CT1 D;  2PPB C;  2O5I C;  1G2T A;  1WTV A;  2NVX B;  3HOU B;  3SE0 A;  2ICI A;  2B2W A;  3L7Z C;  5CYU A;  3M4O B;  4EVO A;  5DNF A;  1YNN C;  1NAP A;  1LT4 D;  3ONA B;  5CV8 A;  1BDO A;  1BNZ A;  2C5C A;  2EDG A;  1I4P A;  2EYH A;  3NTK A;  1EQT A;  1GHK A;  2D9U A;  4X3S A;  1SXT A;  3VYT A;  3BS1 A;  2EJG C;  3MWY W;  5CC4 A;  1BCP B;  4G7Z C;  1WTR A;  3NK9 A;  2R93 B;  1FD7 D;  3HOX B;  4KKU A;  4RFB A;  3D4D A;  3KBX A;  3NPP A;  1U4M A;  3R8B A;  2A74 C;  1SMY C;  2A69 D;  3MHB A;  4G7H C;  1KDB A;  1HPC A;  4C3H B;  4KN4 C;  2PZW A;  2OXP A;  1STY A;  1BOS A;  2F1M A;  1XWE A;  3PUZ A;  5EPJ A;  1ET9 A;  1Q1B A;  3H3V C;  4EGV A;  3GTO B;  1DZ1 A;  5D65 A;  5C0X J;  3SVM A;  4FF2 A;  1PRT B;  1SYG A;  2E2H B;  2EYF A;  1I6H B;  4EQN A;  3PUV A;  2DY7 A;  2KJX A;  2YYZ A;  1TS4 A;  2F0J A;  1J8I A;  2X6L A;  2M00 A;  1LTB D;  3GTM B;  1MBY A;  2TMP A;  1O7L A;  4IUV A;  3OIP A;  4CJ1 B;  5IOC A;  4O1N A;  1EZ6 A;  1BXT A;  2F0G A;  4ULL A;  3GQB A;  2EXZ A;  1PDQ A;  3TP6 A;  5I9O A;  3OPO A;  1PTO B;  2A68 D;  2KED A;  3X3N A;  4M8A A;  1O7Z A;  3T13 A;  2HCC A;  4I7Z C;  4ID6 A;  2WP8 J;  2B2U C;  5A2Q E;  4PV1 C;  2Q8T A;  5DEH A;  1DOM A;  4C1N I;  4QF4 A;  1PRT F;  2JA6 B;  1ENA A;  5AFW A;  2BDN A;  3SEB A;  1STH A;  1TWC B;  1HUM A;  1F9P A;  5A35 A;  2K32 A;  1YNN D;  1Q12 A;  1S4Z A;  1MD2 D;  3IKJ A;  4GZY C;  1STB A;  4PMB A;  1SNQ A;  3GV3 A;  4KMU C;  1TWF B;  4RHS A;  5J1Z A;  2JA5 B;  1TU2 B;  1R4P B;  1JOR A;  4BA2 I;  1CHQ D;  2J0T D;  4FF4 A;  2WAC A;  3WOF A;  3S15 B;  5C4J B;  1LT6 D;  3QG1 A;  2FMC A;  4F7X A;  5ELE A;  1MSH A;  2WAQ B;  1PTO H;  3CHB D;  2EOT A;  3I4N B;  3PUY A;  2PZU A;  3DHQ A;  1SMY D;  3Q23 A;  2B39 A;  4A93 B;  5IGB A;  4IFD G;  1FNU A;  3FMC A;  3K5O A;  3MVV A;  2D2C C;  2D62 A;  2CW0 C;  4DN4 M;  1IYU A;  1HQM C;  5DAU A;  2B2T C;  2O2L D;  5EKL A;  5I9P A;  3VYU A;  4WOR A;  4IUP A;  2LY7 A;  1B3A A;  4OO1 I;  1U9R A;  4HCE A;  4K8I A;  4TKO B;  1IHZ A;  1SYE A;  3VR2 A;  2F3W A;  3VYS A;  4IQZ A;  2QKI C;  2WB1 B;  4C3I B;  1AW7 A;  1LAB A;  1SJH D;  1SYC A;  4UDU C;  1DYQ A;  2VNU D;  1F77 A;  4NP5 A;  2NVY B;  2DNC A;  4RGN A;  1AP0 A;  2OF1 A;  4WRD A;  3MZ5 A;  4P2C B;  3GTJ B;  4BY7 B;  3I3C A;  2QF7 A;  4JBW A;  3I4L A;  3MXP A;  4KY5 A;  1W6J A;  1CK1 A;  3K0Y A;  3D6C A;  1AZP A;  4IFD J;  3J81 E;  1EU3 A;  1EEF D;  3U9S A;  1JWM D;  3TBI B;  3C1E A;  3ZYY X;  4IUQ A;  1SJE D;  1GOZ A;  2K01 A;  3H0G B;  3S16 B;  3I4M B;  4X3U A;  1PYW D;  2H1E A;  5T1I A;  1CQF A;  1Z47 A;  2PO4 A;  1R9T B;  4C2M B;  2XN9 C;  2SNS A;  2KCN A;  3OSO A;  5K5P A;  3ND8 A;  1SBB B;  3NQI A;  2F0I A;  4K2K A;  5BN5 A;  4J1M A;  4QMG A;  4ABN A;  3PIO 3;  4HR7 B;  3W3A A;  5EQ0 A;  4K14 A;  1LT5 D;  1CA5 A;  1OXT A;  3IL8 A;  5C0X I;  1DJR D;  3BG3 A;  2N88 A;  2B2W C;  3D4W A;  4PMW A;  2BE5 C;  5CGK A;  1J9O A;  2Z1C A;  3S2H B;  1HRJ A;  1PZK D;  5CBA E;  2WKC A;  3Q24 A;  3P75 A;  5CV9 A;  3GV6 A;  3QIA A;  3K59 A;  1EY4 A;  2LS0 1;  2BOS A;  2BDO A;  2CW0 D;  2BA1 A;  1JC7 A;  2XWJ B;  5E4W C;  1O7Y A;  2IW3 A;  1U4P A;  3FPU B;  2JEA I;  4X3T A;  1TKW B;  3OMC A;  2F0W A;  4RKB A;  1ZKO A;  2E75 C;  3GTK B;  4RGM A;  4DFA A;  1O78 A;  5A2Q L;  2K33 A;  1EY0 A;  3K5M A;  1TVX A;  1IL8 A;  1OXX K;  1SNC A;  4N9T A;  3TP7 A;  1STA A;  5FO7 B;  5JEA G;  2J7Z A;  2NWG A;  4IUT A;  1B9M A;  4NDX A;  2EY1 A;  1CTM A;  5JOB A;  2E76 C;  1PMR A;  1K8O A;  2CVR A;  1VF7 A;  1T5X D;  2AQ1 B;  1X32 A;  3H09 A;  1GJX A;  4K5X A;  1EY5 A;  3KBG A;  4KJN A;  4C3J B;  5ISR A;  1EY7 A;  1HFN A;  1L0X B;  1RTO A;  3UI2 A;  4HSV A;  3SXH A;  4Y7N B;  1SFO B;  5M9O A;  5ELC A;  4HN7 A;  3HEJ A;  3NSW A;  1LLR D;  2QIL A;  1WTW A;  3NWT A;  4HAE A;  5ELF A;  5KEE A;  1EOT A;  4QB4 A;  2ZXO A;  3KF8 A;  1TT2 A;  4ZYS A;  2F3V A;  3S17 B;  2B2V A;  2XRQ D;  1AEX A;  4A3M B;  3BDL A;  5JEA J;  4NMZ A;  2BE5 D;  2KCC A;  4IUR A;  4TRD A;  4EQO A;  2A73 B;  1EZ8 A;  2EY2 A;  1MI2 A;  5BN3 A;  1A3V A;  5K36 H;  4CKE A;  1QE6 A;  2RA4 A;  1TR5 A;  4A3B B;  2E2J B;  2L11 A;  3NTI A;  1S5B D;  5FLX E;  3D8G A;  3SR1 A;  2RBM A;  2EYO A;  1EYD A;  1HUN A;  2JE6 I;  4RH6 A;  4JK1 C;  4KV6 A;  2AWO A;  3NQT A;  2K5W A;  1S5F D;  4CBV A;  4XTC S;  4ME5 A;  3VR4 A;  3J81 L;  4IFD I;  1F2M A;  4MN3 A;  1PRT C;  4HSP A;  4NKL A;  5FOB B;  1A2T A;  1TQO A;  4B9X A;  1ZYR C;  2VUM B;  5HGT A;  2F0F A;  4R8I A;  4A3K B;  1VMC A;  1DCZ A;  5CV6 A;  2JA8 B;  5BN4 A;  2B63 B;  5C3X A;  1O80 A;  4HMI A;  4KY7 A;  2J4X A;  3GO5 A;  4OO1 H;  1Y8O B;  4B08 A;  2F0O A;  5C44 B;  3KLS A;  4DNR B;  1QJO A;  2H4O A;  4C3H G;  2WII B;  2JEB I;  5E1F A;  1H9M A;  3J80 E;  5ELD A;  4A3J B;  2VXW A;  1EEI D;  4IAL A;  3EVQ A;  5FKA C;  1X3Q A;  1Y8N B;  3HOW B;  4RKL A;  2Z4I A;  4FF1 A;  4LAA A;  1M8A A;  3DXJ C;  2E2D C;  3M85 A;  3U9O A;  3DEP A;  2LFN A;  2Z8L A;  2ZXR A;  3HGB A;  2DY8 A;  1TWH B;  3GP7 A;  2LMC B;  3FKI B;  3T51 B;  2EYL A;  4J8Q A;  3N6R A;  5D3I B;  1OXU A;  1D6E C;  1R4Q B;  2XNA C;  4ZKC B;  4PMC A;  2KA7 A;  2MPM A;  3RLF A;  1HQR D;  1Y1V B;  1AZQ A;  3LWE A;  1CI3 M;  5IT9 E;  2F0H A;  2RSN A;  3TZU A;  1BCP F;  2X6G A;  2F0K A;  3E6Z X;  2D5D A;  2PMZ B;  1HHV A;  2TSS A;  3TSS A;  4IZ8 A;  2KEC A;  1Y8P B;  4K6D A;  4G7O C;  3FVQ A;  3HOZ B;  2R61 A;  5IGD A;  1V43 A;  1GUT A;  3DUZ A;  1JOO A;  2NBF A;  2GA4 B;  2B2Y C;  3TN2 A;  1F9R A;  5C5M A;  1I4R A;  3G7L A;  1FNW A;  1LTT D;  5C0X H;  3A8J E;  3OW7 A;  4R9W A;  2PNR C;  3NE5 B;  2K7V A;  1V1P A;  2SOB A;  5CR3 A;  4ZRZ A;  5TSS A;  1PRT D;  4KTA A;  1XTC D;  3IAY A;  3FPP A;  4DAP A;  5J39 A;  4C56 C;  3R93 A;  1GXD C;  1ONL A;  1ZYR D;  4KD4 A;  2RQX A;  4XXE A;  3RUZ A;  4KK7 A;  1LTR D;  5IGC A;  2EYJ A;  4CKB A;  2MUY A;  1I4G A;  3H94 A;  4TSS A;  3JAM E;  2FIN B;  1EYC A;  2A6E C;  1Q3L A;  4U68 A;  1RDP D;  4XYQ A;  2IL8 A;  3I70 A;  1UEA B;  4V0B A;  2R6G A;  3VR3 A;  2YU9 B;  5KNB A;  1JIC A;  3NWS A;  1PTO F;  1SE3 A;  3BDO A;  5EJW A;  3HP3 A;  4K8J A;  3NUC A;  4KKS A;  1ENC A;  4LMQ D;  3PV0 A;  3KK7 A;  5C4X B;  2AWN A;  1WTP A;  3OOC A;  3PMF A;  2Z4H A;  3TZD A;  3VR5 A;  3K57 A;  3I91 A;  3M4Y A;  1HTP A;  3E0J A;  3EA6 A;  1GUW A;  3R2I A;  4BBR B;  5M5X B;  5G3L F;  5IIF A;  2DNE A;  3SK5 A;  5FLX L;  3QJY A;  2EE1 A;  4RWS C;  2VB3 X;  4FXD A;  2PYK A;  4YIJ A;  5E3F A;  3MFY A;  1EY6 A;  2R92 B;  3MA2 B;  4U67 3;  1EYA A;  3DEO A;  5FO8 B;  2NN6 G;  1XXG A;  4FXG C;  1C8C A;  1HTL D;  1GUG A;  4MHE A;  1SE2 A;  4N9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...