2K1BA

Solution nmr structure of the chromo domain of the chromobox protein homolog 7
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
EQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Chromobox protein homolog 7
publication title Solution NMR structure of the chromobox protein homolog 7.
rcsb
source organism Homo sapiens
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k1bA00
4HSVA 4HAEA 2DY7A 5T1IA 3P7JA 2HCIA 2RVLA 2FHTA 2NZ1D 4ZKCB 2NWGA 1J9OA 1IKMA 5CORA 1B53A 1QE6A 2X6LA 1C8CA 4NW2A 4OIKA 1F9SA 1WVLA 3H91A 4R8IA 2K04A 1HHVA 2B2UA 1WTVA 4X3UA 3I90A 1DONA 1BNZA 1MSGA 2H1EA 5E4XA 2K1BA 3DEPA 3HP3A 3LWEA 1IL8A 2K05A 2MGSA 3GV3A 3TZDA 1XYIA 1B50A 1AZPA 3QO2A 1DZ1A 1EL0A 4ZKBB 1WTQA 2HUGA 3DM1A 3N52A 4OIJA 2J7ZA 1PDQA 5CBAE 2B2TA 2Q8TA 2Q8RE 1WTRA 1BBXC 2KVMA 1HUMA 5EKIA 3I3CA 4IUUA 2CVRA 2IL8A 2KEEA 4O42A 4IUTA 1U4LA 1PLFA 1ZXTA 2KOLA 2NYZD 3UI2A 3IFDA 4X3KA 1EIGA 1G2TA 1SAPA 1KNEA 4R9WA 4XT1B 2FMMA 3I8ZA 4X3TA 2EE1A 1G6ZA 4CJ1B 1KNAA 2B2VC 4IUPA 2B2VA 5COYA 1RJTA 2DY8A 1DOLA 1O80A 4XDXA 5EJWA 1F9QA 4UAIA 1CA6A 2EOTA 5EQ0A 4ZLTF 1ILQA 2FFKB 3Q6SA 1S4ZA 2L9HA 5D14A 1WD0A 1RTOA 2KUMA 3KUPA 2N55A 3FPUB 1PFBA 3I91A 2VXWA 2B2YC 4ZAIA 2B2YA 3TN2A 1HA6A 1HFNA 1CM9A 1ESRA 3F2UA 1U4MA 2X6GA 4IUVA 4RWSC 5EPJA 1ICWA 1SDFA 1X3QA 2FINB 2L11A 1EQTA 2B2WC 2MPMA 1U4RA 4XT3B 1B4OA 4MN3A 1G2SA 1CA5A 2HDMA 1WD1A 1DOKA 1X3PA 1X32A 1QNKA 5CMDA 2L4NA 2JP1A 2N88A 1VMCA 4RA8A 4CJ0B 1MI2A 3DEOA 2MP1A 4QUCA 1JICA 4LMQD 1NCVA 1O7ZA 2EPBA 2L12A 5T1GA 1AZQA 1ILPA 4X3SA 1O7YA 2RSNA 2RSOA 1G91A 4ZK9B 4CJ2C 1F2LA 3IL8A 5EPLA 1LV9A 5E4WC 4QUFA 2BDNA 2SDFA 3G7LA 4MHEA 3GV6A 4HCSA 1HFGA 3D6WA 3KBXA 4HEDA 5D65A 3MWYW 1DOMA 2KEDA 1NR4A 2D9UA 1ML0D 5DNFA 1RTNA 2JYOA 1WTWA 1EOTA 5AFWA 1E0BA 1TVXA 4DN4M 2B2WA 2L1BA 5JJZA 3SVMA 1WTPA 2MJ8A 1F9RA 1MGSA 1NR2A 1PFMA 3FDTA 4U68A 2B2UC 1B2TA 1MSHA 1HRJA 3R93A 5CBEE 4RAUC 2M2LA 1SSOA 1J8IA 1JE4A 1NAPA 1QG7A 4IURA 1GUWA 2XIWA 1BO0A 1F9PA 1EIHA 1U4PA 2HDLA 2K03A 3MTSA 2RA4A 3ONAB 1AP0A 1XX8A 2HCCA 1PFNA 2R3ZA 1A15A 1Q3LA 1RHPA 1WTXA 1HUNA 1BF4A 2B2TC 1RODA 2FJ2A 1B3AA 2K01A 2K28A 2X69A 1WTOA 4IUQA 5EPKA 1M8AA 1VMPA 2KECA 1IKLA
chains in the Genus database with same CATH superfamily
3NTIA 3M3YB 1N36Q 4PZ7A 4CDDC 2KHIA 3JAME 1CUKA 1A62A 4HJ8A 1A2TA 5EBCA 1NBWA 2JEBI 2Q2IA 4LFCL 3D0FA 4KN4C 2DGYA 3CC4A 1K8AC 5GROA 3G71A 2KCTA 4K8IA 3TREA 3KFUA 4EQPA 3SHLA 2H4OA 1PZID 3R8BA 1SJHD 2AQ2B 1PHJA 4RGMA 1IXRA 1SJED 3HS0C 3I3CA 3G6EA 1Y8NB 2EYMA 1QCBD 5CC4A 1J5EL 3V05A 4EVOA 2F52A 4X62Q 4NDXA 4CKEA 5FO8B 2BE5D 4DV0Q 1K8MA 4JYAL 4EQNA 3TS2A 1C0AA 1FGUA 3CCLA 1FL0A 2PW7A 2HQLA 2A74C 1VF5C 2DNEA 3CF5A 1YITA 2JA8B 1ESFA 3S1RB 5C4ZA 1QZHA 1PH2A 2NVQH 2HIVA 2QA4A 2NVXB 3BVZA 2VL6A 3TS0A 5CV8A 1N9WA 4JI7Q 1P8LA 2EYFA 1A0IA 4HTHA 3PIP3 3TQYA 1X32A 3GTJB 3CCJA 4GNXA 3K81C 3BU2A 4DAMA 1B3QA 2N49A 1VDZA 1XWEA 3A54A 3TZUA 4QQBX 3J80i 3Q22A 4LFCQ 3S14B 3CCUA 1SE4A 1GXDC 4PMCA 3MFGA 4OONA 2Q2TA 2WFWA 3SDZA 4DK1A 3A7AB 5K5PA 1PH5A 3FKIH 3OHXC 3R2TA 1SMYD 2R92H 2R92G 1F9RA 1K0RA 3UDFA 4G7OC 3S1NB 5C3EB 2DNCA 4G7HC 1VQDA 4M1UB 1J5EQ 1NUCA 1N32L 5EKKA 3BZCA 4AYBE 1GUNA 1KABA 5GQOA 4CHTB 1JMCA 4JYAQ 4IUQA 4K8JA 3ZYYX 1M8AA 5C4JB 3BZDB 4N9TA 2HT1A 5CV4A 2PYKA 3H0GH 5T1IA 3I55A 3CCEA 3I4OA 1WCMH 1PYSB 2EXZA 4JI0Q 1DGSA 1XPRA 2X6LA 3URYA 2ZTCA 1JOOA 4H02A 1GOZA 4AYBG 5CYUA 4B3TL 4O0AA 1C7YA 1WTHA 3SK4A 1TWAB 5LMNQ 4LK1C 2F0TA 1LT5D 2J7ZA 4TQUS 5CBAE 3UE0A 3IAYA 4EQ5A 1AE2A 3QR8A 1SMXA 1OXXK 3DLLA 5FLMH 5EKIA 5EGTA 4C3JB 5KGUA 4A3CH 4A3CG 5ELOA 2EYJA 1EWHA 3M7GA 3ULJA 4YY3L 4XIGS 2FXQA 3D4DA 4XT1B 1RDPD 2Q2UA 4TRDA 4DUYL 2QGQA 1K83H 1ET9A 4DXGA 2JA6B 3D3RA 3RZDB 4A3KH 2XWJB 4A3KG 1EWCA 1PZKD 1XNRL 3KDFB 1N32Q 3JAMi 1KDCA 3CRLC 5IWAL 2D62A 2IX1A 3F2UA 1KC8C 2LXJA 1X3QA 2IHEA 1STYA 1IHZA 3NQIA 3D4WA 1LT6D 3RD4A 4WJWA 2EJFC 2JP1A 5IY0A 4RA8A 5M3MG 3QB3A 1X3FA 4LAAA 5T1GA 1LO5D 5CGKA 1MHWC 2YU9B 1O7LA 3HOVG 1UUPA 2QKIC 4RGNA 3KF8A 1D7QA 3MXUA 3WWVA 1A6XA 1YNJC 3BYYB 2RKSA 3HOXB 1I5FA 4CDEC 4NXML 1ML0D 3P1HA 2B2WA 4ZQ3A 5J1ZA 4IALA 3ERQA 1SSOA 4DK6C 1JE4A 1QG7A 4KLKA 2LXKA 4YY3Q 1AP0A 1Q3LA 1WOCA 1F2MA 1X6OA 4DUYQ 3H3VC 1A63A 1B3AA 2A69C 2O4XA 3M4OH 4L6TB 4BWGB 3DHQA 4BY7H 1XMQL 4DV7L 1XNRQ 4JI5L 2B63G 2SNSA 1VQHA 1XNQL 1Y14B 5IWAQ 3U9SA 1VQIA 2SOBA 1AN8A 4DXFA 4X64L 2I5HA 2LSSA 3DEPA 5JJLA 1AZPA 4UPAA 2AUKA 2HUGA 3OWFA 1JT8A 4DV2Q 2VB2X 4GS3A 1ASZA 4L5QA 2JJQA 4IN3A 2VB3X 1SYDA 3KLRA 3S2HB 1B1ZA 1TWGB 4K5WA 4K6LA 2WV6D 2CFMA 3T56B 1SAPA 1V43A 5LL6X 4NXMQ 4DV1L 4A3LH 5H1SE 4A3LG 3GDEA 2DY8A 2C9OA 3E9HA 4KY6A 1CA6A 5I6YA 3U9OA 3Q24A 2Z0SA 2ICIA 1CSPA 2VW9A 3S9WA 3CPWA 2QDBA 5DAUA 1SRUA 4OELB 1SYFA 3GTKB 5FLXL 1G8ZD 1TWHH 3BVMA 4A3MH 4A3MG 1NY4A 1G2SA 1DOKA 1MIUA 1PYBA 3M9BA 3S2DH 3RZOB 4UP8A 3OOCA 1XMQQ 2F0HA 1O7YA 4IJLA 1NE3A 4DV7Q 3PQIA 4JI5Q 1X65A 1XNQQ 2MHVA 2QW7A 3NEMA 5IYBG 4PQXA 4X64Q 3NENA 4FF1A 3TP6A 1E2WA 4FNFA 4C1NK 1OXVA 4FXGC 3MVVA 2E2IH 1TVXA 3W5OA 4DN4M 1I4XA 3GTGH 1MKHA 2Z6KC 3E5SA 4YWLA 4J8QA 1T5EA 4N8FA 3SK6A 1CQFA 1SNDA 2G9DA 2V1CC 3ND8A 2UXDL 2HHHL 3SK8A 3KJPA 1YNXA 3HKSA 4DV1Q 1JB7A 5IP7H 1EEID 5IP7G 4F8MA 2K33A 2K5WA 1VF7A 5M5XH 4NKLA 1BR9A 2OCEA 4MIUA 3STBD 1I4RA 3KBGA 1F9SA 5CV5A 1BCPC 3CQZH 2F03A 1M1KC 5CV9A 2CHBD 2NVQB 1Q82C 5E4XA 4KV6A 3U58A 3CU7A 1PH9A 2NN6H 3QO2A 4C3IH 2RHQB 3VYUA 4L5TA 2RDFA 3WDNA 4OIJA 4YIJA 5A2QL 1YVCA 3GTJH 1PH8A 1HPCA 1U5KA 3A8JE 3HOWH 2KVMA 1EEFD 3KJOA 4FDBA 4LW1A 5IGFA 3UDGA 5C0XI 1AW7A 3FHWA 4MNOA 1H9SB 2RBMA 3MXNB 5FO7B 1NJIC 1W2BA 3G6JB 3J81E 2EJGC 2R92B 1EIFA 1K3RA 3CPFA 4POFA 1FNWA 3PF4A 1NSNS 1VQPA 2UXDQ 2HHHQ 5IYDG 2A68C 2LKVA 5ELDA 5M5WB 2ZJQA 2HDMA 1YHAA 3F8TA 2F0JA 1N8RC 4EX5A 2CW0D 3RNUA 2R7ZH 4NP5A 2R7ZG 1WCMB 1QZGA 2SDFA 4CKCA 3TBIB 5C5MA 4AYBB 3ERSX 1QNUA 2JA5H 2D9UA 2JA5G 5DNFA 1VQ4A 1VQMA 4RFBA 2EY2A 3HFZB 1NR2A 1PFMA 1B9NA 5ELBA 2ASBA 2EYLA 3WOFA 1J8IA 1GUWA 1F9PA 1JWUD 2RA4A 4KMUC 1YNND 2E75C 3H3VI 1Q8IA 2GVBA 2B2TC 5C4HA 2K01A 5K36H 3NE5B 4HN7A 1EZ8A 2F0WA 2Q2HA 4LUZA 3SK5A 3J80L 1K83B 3UE1A 3K8AA 4C56C 1C8CA 4A3KB 1OXTA 4LJZC 3RN2A 4RGOS 3OSOA 2K4KA 3ZJYC 4O1NA 3ITPA 3GV3A 1EQVA 4HMIA 2E2DC 2IPKD 2VS1A 4DAYA 3PO3H 3PO3G 1VS0A 4B3SQ 3FMCA 1SNOA 2Q8TA 5LMNW 1BBXC 5BN5A 2YV5A 1UAPA 4K6DA 4R1JA 4R9WA 3TMEA 4Q5VA 4BY1G 3HEJA 4DK3C 1QUQB 1F9QA 3K57A 1TS2A 2LS01 5ELEA 1B8AA 3OYYA 3C1EA 3FPUB 1HA6A 3GTMH 3PUVA 5JEAH 4RGTA 2UXCL 1ICWA 1IBML 2FINB 2L11A 2Z8LA 5KRUA 4A3BH 2A6ED 4A3BG 1I4QA 2E8GA 1WD1A 2PQEA 2XTIA 4A3IH 4QUCA 4YWKA 3M4OB 1B9MA 1XTCD 4ZK9B 3A55A 2F0IA 1SNQA 4BY7B 4LFBQ 3LNNA 4PMWA 1EY0A 2F0MA 1BBUA 4N9PA 2KEDA 4JI8L 3DM3A 4JC0A 2JYOA 1VQGA 1QVCA 2QDLA 1VQAA 4CGYB 2AMCB 3J81i 5ELFA 5IODA 1STEA 3MTSA 2BA0A 4J15A 1K8OA 1JWSD 4LUVA 1CQVA 1TXYA 4K0KQ 1MJCA 5I6WA 1WTXA 3IKJA 4A3EH 1KXLA 1P16A 4A3EG 4ZYSA 2PNHA 2QF7A 4NPSA 1WTOA 3OIQA 2I46A 4R4IA 1IKLA 3I72A 2MO0A 4KY5A 3EA6A 4DR6L 4G4KA 4ODGA 3I4MG 1R9TH 1IW7D 4PG3A 4G57A 2UXCQ 3A56A 3NELA 4J1MA 1IBMQ 2M9VA 5IT9L 1RL2A 2K32A 1FYCA 5JEAJ 3MEFA 1TWHB 4A3MB 1L1OB 1LM0A 3TSSA 3NQTA 3PF5A 1EY6A 2F1MA 3NK9A 3S2DB 1S5DD 1TS3A 2K5QA 5JVG3 1T5XD 3KF6A 5IGCA 5KIXA 1I4GA 2RDHA 4OXPA 4LF5L 3MXPA 1ZXTA 3K5LA 1EIGA 4JI8Q 2XN9C 1V1QA 1G6ZA 2PI2E 4IUPA 3A74A 1STGA 2OF1A 2XNAC 1S40A 5EJWA 4UAIA 2E2IB 4QMGA 3GTGB 2EYHA 1EQQA 1VQ8A 1EY7A 1Q1BA 5FO9B 1RF2D 1I6VC 4IUVA 1PH3A 5EPJA 3AYHB 1LT4D 4MZ9A 2R61A 4B08A 4IJHA 4IZ8A 2D0PA 4O2DA 3W3AA 2BCOA 2AWNA 1C4QA 2L4NA 2QEXA 4LMQD 2R93H 2R93G 2L12A 4DR6Q 3VYTA 2VUMG 5M5XB 1NNXA 4B9XA 1X54A 2WB1E 2AQ1B 3HOUG 1HCZA 3K0XA 3G7LA 3D6CA 4MHEA 3CQZB 3GV6A 4JI0L 4FF2A 3WOEA 3ICEA 3W1BA 4GN3B 2CH4A 2R7FA 3NBIA 4APVA 4F7XA 4C3IB 1HNXQ 1II3A 1F2YA 4HCEA 1HRJA 3G48A 1QB5D 5LMNL 1CTMA 2WB1G 3FPPA 1EFID 3CXCA 4LF5Q 3HOWB 4K5XA 1BVSA 4FO2A 2GN5A 2K03A 1G51A 2EXDA 1PFNA 4FXDA 2A1AA 1YEZA 1QJOA 2TMPA 3W2DA 2WAQG 1JJCB 1ASYA 1WI5A 2NZ1D 1HJPA 2ATWA 3DMUA 4GLVB 4JVZA 2Z9HA 1BNZA 2H1EA 3K80C 4K5VA 4V190 2MGSA 2JA9A 1DZ1A 1EUJA 1STHA 5M5WH 2WACA 1PH1A 3J7AV 3CCQA 4I7ZC 4DV5L 1MBYA 2CCZA 4DFAA 1A2UA 3HOYG 3D4RA 4AH6A 5HY6A 2R7ZB 1LTRD 2CQOA 1YJ9A 1TKWB 1ZEQX 5DEHA 2Z6BA 5HURA 4F87A 2KOLA 2B29A 1E22A 2EIFA 4L63B 4DNTB 4ME3A 2OXPA 1U0LA 1VQOA 4BS9A 4CJ1B 2RCFA 3KYHC 1RJTA 2JA5B 3IFTA 4H7BA 1ILQA 1PRTB 1E2VA 1WD0A 4A93H 4A93G 3CC7A 5J39A 1PYWD 4KY7A 2PO4A 3NWSA 1CFMA 1EQTA 3E9IA 2VQEL 4MN3A 4BXXG 2HQEA 3FP9A 3D31A 4JI6L 1UE6A 1C9OA 3OMCA 1SE2A 3CCRA 2F0EA 3H09A 3K58A 1KHIA 2VNUD 4V0BA 2PMZE 5IE8A 2VQFL 4A3DH 2IW3A 4A3DG 4ALPA 3S16H 1CKMA 3VR4A 3D6WA 4HEDA 4AQYL 1WTWA 1TIID 4DV5Q 1ENAA 3PO3B 3TP7A 1BOSA 3T1HL 4RAUC 2R6GA 3L0OA 4JBJA 4I65A 4DKAC 5M3MH 1VQKA 2BDOA 2IX0A 1EIHA 4DV2L 2HDLA 3HOVH 2K75A 2AUJD 4A3FH 2G5DA 4A3FG 2FJ2A 1DYQA 1H9MA 1CKNB 1VQNA 1VMPA 2RQXA 2KECA 4KTAA 4OGQC 1HZCA 3S24A 2FHTA 4ZKCB 4IPDA 1J9OA 4LF4L 1B53A 3ER0A 1WVLA 4CBVA 2Z6KA 3TP8A 5C0XG 4PNYA 4JI4L 4JCVE 1QVFA 1JR0D 3A5ZB 3SXHA 1GUGA 1LTAD 1MSGA 4L5RC 2VQEQ 4GOPB 3GTMB 2K1BA 3HP3A 1B50A 1JE5A 3K0YA 4A3BB 2BE5C 3RMHA 5FOBB 1Q86C 4JI6Q 3L3OC 1Y8PB 3S15H 4A3IB 1I4PA 1GHKA 3NXWA 2Q8RE 2VQFQ 1PRTD 2BH8A 4ZUJA 1SROA 2NTTA 4IUUA 2Y0SE 1IYJB 1PXUA 2B8FA 1HNZL 2B63H 4UDUC 4AQYQ 4PZ8A 4HJ9A 4DPGA 1QILA 4RHRA 2IWHA 1DOLA 2OWOA 4Y7NB 5KYIA 5M5YH 4GLXA 3T1HQ 4RG1A 3M85A 3HRZC 4DF7A 2L9HA 3CD6A 1PA6A 2SNMA 2PZWA 4UY8C 2Y0SG 1CM9A 1ICFB 1CSQA 1DD2A 1LLRD 2F0KA 1KLGD 1Z9FA 3MFYA 2E2HH 4DR7L 4RMFA 4RHSA 2K14A 1HNWL 4A3EB 1SMYC 1O7ZA 1ILPA 2A6HD 5I2XA 4LF4Q 4J6HA 3PUXA 1L0XB 1LV9A 4Z9CB 3M7NA 2K50A 3H3VH 4CKBA 3L2PA 4JI4Q 1R9TB 1S72A 4WJ3M 3OPOA 1JWMD 1HFGA 4NB3A 1W3SA 1H9RA 3PIOA 1LABA 2RHSB 4OHJA 5C3WA 5KNDA 5FLXc 1STNA 2D5DA 2L1BA 4IQZA 4XYOA 4DNIA 2B2UC 4TVAB 2JQOA 5CBEE 4HJ5A 5IGEA 3HOZG 4N8X1 1UEAB 4PZ6A 1Y69U 4KHPL 4OEMB 1JOQA 4LF9L 1HNZQ 1CZGA 4R4CA 3AFQA 3MA2B 1G6PA 4HIOA 5IYBH 4OWTB 3A8IE 2R3ZA 3CC2A 2ES2A 3M4QA 2JE6I 3T4AC 5EPKA 5C6AA 2H5XA 1S3OA 1IBKL 3H15A 1PTOD 1Y1VG 1LACA 3QWNA 3GTQH 3K59A 2R7DA 1SYCA 1H95A 3AMUA 1PFSA 4R8NA 4R8IA 2K04A 1KLUD 4QGUA 4DK0A 1WTVA 2PQAB 1QWYA 3QIAA 3KDFA 1DONA 2WIIB 1BUVT 2J0TD 4DR7Q 3TZDA 2RDGA 4Y52H 4HIMA 1HZ9A 1UE5A 1HNWQ 3J81L 4C3HG 5LMUL 3GTOH 1EOVA 1Q90A 2B2TA 4K14A 1SNPA 2R93B 2K7VA 1SNCA 1KD1C 4GLAC 2F3IA 3LX0A 1YHBA 3PUZA 1GUSA 3PIO3 2F0SA 2ZXOA 1L2FA 2IHFA 1CT1D 1B70B 5C5LA 4UP7A 4TKOB 2IY5B 1KNAA 2K5HA 2B2VA 4Q0FA 2ALYB 5IOCA 2NB0A 1HQRD 1XMOL 2F0OA 1S5ED 2EOTA 2CQAA 4GKJL 1SNMA 4KHPQ 1S4ZA 3HZXA 4R4OA 5FLXE 4LF9Q 1D5MC 1ESRA 2WB1B 1U4MA 3KLSA 1V1PB 2B8GA 4ZRZA 2MPMA 4QCLA 2DJGC 1U4RA 1YI2A 4YCVA 1SE3A 4DU9A 4HJAA 1IBKQ 3IRBA 4CJ0B 2WAQB 2F0LA 2RSNA 4IUNA 2NBFA 3AU7A 1J6QA 2F3WA 3K5OA 4JBWA 2WINB 5AJ3L 2KCNA 2GVAA 2PCFB 1EQRA 5C44H 3J7AF 5C44G 2XRSD 4P74A 5EBDA 4NXNL 3CW2C 1RTNA 2AWOA 4DR2L 5IYDH 4DAVA 5IGGA 1E1TA 3TDQA 5JJZA 5LMUQ 4H0LC 1MGSA 1H9JA 1B2TA 1GHJA 1JB3A 3SR1A 4I7AA 4IURA 2NZHA 2XIWA 3KOJA 1BO0A 3N6RA 5M9OA 2K6AA 4B3SL 3AFPA 1UE7A 1RIPA 3EIVA 2NUCA 2TSSA 5E1FA 5DLQE 1EY4A 5HGQA 3C46A 1SEBD 3RLFA 1XMOQ 3J7ZC 4GKJQ 2DY7A 4G7ZC 2PNRC 2LMCB 1ZYRD 2NWGA 2WP8J 2JSOA 3GTPH 1BKBA 1X3EA 2I0QA 4A93B 2KA7A 5JVH3 3RUZA 1MD2D 4KKSA 5GADC 5A2QE 1XYIA 3NBHB 1SXTA 5C3XA 3D8GA 2I07B 2AKWB 1KRSA 1WYDA 1KDAA 2D2CC 5F2DA 1HZAA 1D5XC 3EROA 3S1MH 1IZ6A 5LL6S 5GAEC 3DWPA 5AJ3Q 2ZXRA 1PMRA 3PCOB 4QF4A 4ABNA 1VQFA 3J80c 2RCNA 1UEBA 2OTLA 1S5CD 3CAMA 1KNEA 3M4YA 4XQJA 4NXNQ 4A3DB 4LFBL 3S16B 3T51B 3CCMA 4DR2Q 2B2VC 3LGJA 3E3XA 1JJGA 1HR0L 2BH2A 4H44C 1F77A 5J3BA 4LF6Q 5BR8L 1BQQT 1STBA 3HKZE 4S3SA 2PMZB 4JI2L 3I91A 3NPPA 3TN2A 2ICEC 5M3MB 3PO2H 3PO2G 4GOPC 1PZJD 3HOVB 1Y1WH 1EYGA 2PI2A 1Y1WG 4IFDI 5CMDA 3GD7A 2F0PA 4A3FB 1KL9A 1D5ZC 3DEOA 4K0KL 4IPGA 3HKZG 5I9OA 2EPBA 2JEAI 4F88A 2UUCQ 1I3QB 4BY1H 1G91A 4JK1C 2DJFC 1F2ZA 2EY1A 2GA4B 4AIMA 2JN4A 1SLJA 3I2ZA 1K9MC 3NTKA 4OWWB 4JOIC 1E0BA 5D3DA 3CMAA 2MJ8A 1PTOH 3FDTA 3RN5A 1ONLA 3C2PA 1HH2P 4C2MH 2MFIA 3S15B 1NAPA 4HR7B 2KHJA 3STBC 3J7A5 3T53B 1X9NA 2B63B 1TS5A 2F4IA 2NZOA 4GNXB 1BF4A 1TR5A 4ULLA 2KCMA 1B7YB 2I5LX 2K28A 2N8NA 2X69A 2PZTA 1HR0Q 4LFAL 2E76C 1H9SA 5BR8Q 2CH4W 1A3VA 2DN8A 3MXNA 3X3NA 4Y7NH 4DGZA 1TWFH 1IKMA 5M5YB 4JI2Q 1HZBA 1QE6A 4RCNA 4NW2A 1Q81C 1TT2A 1HHVA 5EKLA 1SFOH 2ZT9C 2Y0SB 3JAML 3JAMc 4JBMA 2NN6I 1FVIA 3QJYA 1WTQA 4IPCA 2E2HB 4K2LA 5E7NA 1GO3E 2B3GA 1HTLD 2F3VA 1LYLA 1I4HA 4LF8L 1KRTA 5M3FH 2CKZB 5M3FG 1M4VA 2A8VA 1LTID 2EVBA 1K8GA 1I50H 3I56A 1TS4A 1W6KA 2NYZD 3I4MH 1VQBA 5EAYA 4JV5L 2P5ZX 3I8ZA 3H94A 2K5DA 1JCKB 1E2ZA 5COYA 5IT9c 2UUBL 1S5BD 1A3UA 4A3JH 1K3BC 4HIDA 2CW0C 4A3JG 3HOZB 1HNXL 2B2YA 2VZAA 3V96A 2A19A 2L55A 4CDCC 1SDFA 1TY0A 1TWCH 1B4OA 1PH6A 1OXSC 3ULPA 5J22A 1CKOA 4RH6A 4LFAQ 1O7IA 2N88A 3BDCA 3CCVA 4BBRH 4BBRG 4CJ2C 3ND9A 5FJ8H 3GTQB 2F0UA 5FJ8G 2ZXPA 2KJXA 3T1YL 3AEVA 2O2LD 1YHQA 1YNNC 3JC66 3KBXA 3KK7A 3W1GA 4YCWA 3MHBA 1WJJA 4LF8Q 4DV4L 4HMJA 1SYGA 2Q8IB 4C3HB 4DAPA 2M2LA 3GTOB 4JI1Q 4WORA 2EYOA 1X56A 2Z1CA 4H13C 2XVSA 1PRTF 1YNJD 3Q0AA 2VUMH 5IIFA 5IGDA 1Q46A 1PH4A 4JV5Q 1C48A 1YZ6A 3HOUH 3SGIA 1DXMA 1RODA 4WJ4A 2UUBQ 1ET6A 1CHPD 2Z4HA 1XPUA 2JK8A 1HQMC 3SE0A 3KF8B 4P71A 2OEOA 1QUQA 3F2DA 2WAQE 5IT9E 1NMGA 1LTGD 4NMZA 3F2CA 1EZ6A 1XTDA 3VYSA 2NVYH 4QIWB 1YJNA 2KENA 3I90A 3CKIB 2K05A 1L0YB 2EY5A 2A69D 5ISRA 2ENBA 1Q7YC 3DM1A 1LTTD 4A4IA 1VQ9A 1AH9A 3G4SA 4ZUIA 1GD7A 5KNBA 2KBNA 1FJGL 2HIXA 1HUMA 5CV7A 3T1YQ 2C35B 4O42A 1EYDA 5I9PA 4A76A 2ZTEA 3H6MA 5E3FA 2A6EC 3BDLA 5C44B 1FR3A 3VDYA 3GP7A 4U673 3O13A 3C1FA 4KKTA 4DV4Q 4LUOA 1YIJA 1BXTA 1BCPB 4ZLTF 1DCZA 4A3GH 4A3GG 5KYLA 4L5SA 4YWMA 2N55A 3K7AB 2KCCA 4HSPA 4FF3A 2B2YC 2X6GA 1NMFA 3HOYH 3FKIG 1VQEA 5JOBA 3K7UC 3U4ZA 1RD9D 3OW7A 3TP5A 1QNKA 3AB9A 2UUAL 4XXEA 1AE3A 1DM0B 3GTLH 4XTCS 2PW5A 1AZQA 3OIPA 2LY7A 1PTOF 1SE8A 3BZKA 4QUFA 1PV4A 3GTPB 1KAWA 1W6JA 1DOMA 3H0GG 1GUOA 2F0FA 1WCMG 3F2BA 4UP9A 1MJEA 4IOAA 4BXXH 4B3RL 1L1OA 5GAHC 4DUZL 4A75A 1FJGQ 1I6HH 4TSSA 2XWBB 3UDXA 3PMFA 1CK1A 2JA7H 3S1MB 2JA7G 4OO1I 1IW7C 1DJRD 3EFXD 2L15A 2WKCA 2HCCA 4C1NI 1A15A 3K5MA 4BA1I 5I4DA 1EY9A 3EJIA 1D8LA 4GZYC 1OTCA 3Q23A 5FLMG 2HCIA 3F1ZA 4KJNA 3MAQA 1GKHA 3S17H 2EY6A 2B2UA 3FVQA 4X66L 3TRZA 1KIXA 1JC7A 3PO2B 4KK7A 5CV6A 1Z47A 1IL8A 4P75A 4ZKBB 4JPBW 2UUAQ 3MEHA 1Y1WB 1UNSA 3E6ZX 1VCIA 5CR3A 4YCUA 3HKZB 1GM5A 1WTRA 1I3QH 3EQLC 1BCPD 2E2JH 1KQSA 4BY1B 2SEBD 2UU9L 4IUTA 1U4LA 3KLSX 3UI2A 3Q8DA 3RLOA 1SBBB 3GQBA 4GNXC 1AFPA 3NP8A 2OQKA 5JJKA 2FMCA 2IT1A 5C0XH 3VA5A 4XQQA 4B3RQ 3FRPB 4DUZQ 5EQ0A 3VR3A 2NVTH 4B3TQ 1PTOB 2KUMA 4C2MB 5JJIA 1V9PA 3X3MA 4PMBA 4XT3B 1LTSD 4DNRB 1CA5A 3J81j 2A5HA 2XSCA 3NTHA 1JICA 4DV6L 1G291 2YTXA 1QOHA 4K2KA 2RSOA 3I4LA 1XXGA 1F2LA 2Z4IA 1JOKA 5KNCA 4KHVA 1TWFB 4X66Q 1HTPA 4LF7L 3CHBD 2A68D 1SFOB 2YYZA 4POGA 1OO9B 3HGBA 2PZUA 1RKNA 4XYQA 4BY7G 4RCOA 3SVMA 1L1OC 3FEWX 1Y8OB 1A8VA 4IO9A 1JJ2A 1GVPA 1IL2A 3SEBA 5TSSA 5M3FB 3NHHA 3DWAA 5KEEA 2UU9Q 1U4PA 1LTLA 3I4NH 3I4NG 3BYTB 1Q12A 1I50B 1E7ZA 3I4MB 2OQ0A 4KJOA 5C0XJ 1OXUA 3P7JA 3OW2A 2MO1A 1Q1EA 3TEHB 1K73C 3S1QH 1X55A 4BA2I 2M00A 1HR0W 4OX9L 4OIKA 4A3JB 1TQOA 1ENCA 3H91A 3HOZH 4X3UA 4QJFA 3LWEA 1EY5A 2IJ0A 5HGTA 5C4XH 3GO5A 5C4XG 1TWCB 4KD3A 4DR3L 4DV6Q 2E74C 5JPNC 4BBSH 4BBSG 4X65L 3J7YW 1HA5A 4BBRB 1Y1VH 4LF7Q 1V1OA 5I2YA 2N78A 4FYDA 1EFWA 3OWEB 1EYAA 4IFDH 4X6AH 3R2IA 3P75A 4IFDG 2EE1A 3A0JA 4ZCKA 3M3YH 4ID6A 2PPBC 4XDXA 3NUCA 1TU2B 5BN4A 3NSWA 4JW0A 1K28A 2OT2A 3PUYA 4QB4A 3VYRA 3KUPA 4P73A 1E24A 2NTSA 4C3HH 3J81c 3C3LA 1JORA 4ZAIA 1HFNA 4RWSC 3RLNA 1IYUA 4R4QA 4DAYB 2B2WC 3EN2A 2VUMB 1FNUA 1H9KA 3AQQA 4QIWE 4MTNA 1X3PA 4QY7A 1VQ7A 4FP5D 1D6EC 3HOUB 3T13A 3NWTA 2XGTA 3V2TA 2ID0A 1CKNA 2YTYA 1Z7TA 4EGVA 1AEXA 1FGBD 4OX9Q 4YHHL 2BDNA 5IYCH 5IYCG 1I94L 1GJXA 2NVYB 5D3IB 1KDBA 1STAA 4DR3Q 2O5IC 4GOPA 2QILA 3I7FA 1IBLL 1VQ5A 4OWXB 1WTPA 5G3LF 1S5FD 3UDIA 2JA8H 1D1IA 2JA8G 2EJMA 4JG2A 4X65Q 3S1RH 2NVXH 4M8AA 4HIKA 4IOCA 1LTBD 1SN8A 2NN6G 4C3IG 2AQ3B 3L7ZC 2BA1A 3E0EA 2KQ3A 4IFDJ 3HOWG 2VY3A 2QCPX 4HSVA 1M90C 4HAEA 4KHZA 5JPMC 2ZTDA 2F0DA 4JOIA 2DUDA 2K5VA 3VR5A 3S14H 2ZM6L 4A3GB 1PRTC 3VA7A 3K7AH 4LF6L 1A3TA 5FKAC 3A7LA 3K5NA 4E6IA 2D0OA 4IPHA 3FKIB 3BS1A 3HOYB 3BG3A 1EL0A 2KHSA 4GKKL 3N52A 1N34L 1V8QA 3S1NH 5C3EH 1UE1A 4KKUA 5C3EG 3RR5A 3GTLB 4B3ML 1E3PA 4YHHQ 1K0SA 2IL8A 3KLWA 3CMEA 1I94Q 2UUCL 1PLFA 3EVQA 1LT3D 1G2TA 2EZVA 5ELNA 3OMGA 1N33L 1ZKOA 2OTJA 1WFQA 5C4JH 3CP0A 3VR6A 3OTOL 1IBLQ 3H0GB 1LUZA 2L0CA 3QG1A 2EDGA 2MNAA 4P72A 2F0QA 2FFKB 3Q6SA 2A6HC 4PV1C 5D14A 1ENFA 1PFBA 5L37A 1I6HB 2N3SA 1EU3A 2E5LL 3R3OA 1X3GA 2K5NA 2JA7B 3I73A 4ME5A 5LHY1 1VQ6A 3A5UA 1EYCA 1TWAH 4RKBA 1YBYA 5DM63 3QOLA 2WKDA 3U50C 1FD7D 4B9WA 2MP1A 3KF6B 1VQLA 4X3SA 4FF4A 3M4PA 4C3JH 2ZM6Q 5A35A 4C3JG 3IL8A 3T16A 2O5JC 3BVGA 5E4WC 5DM73 4KN7C 1Q8KA 3MZ5A 3S17B 2L5TA 4LNQA 2LFNA 5K36G 1B44D 1EWIA 2AHOB 1CHQD 1UWVA 5D65A 3MWYW 2PQAA 1NR4A 4GKKQ 3BDOA 1EOTA 1RCVD 1SR3A 1N34Q 2JA6H 2JA6G 4ILWA 3RZDH 1HXYD 3P20A 2K52A 4U68A 1PTOC 4B3MQ 1MSHA 4P2CB 1GUTA 3QOJA 3R93A 1FNVA 1U9RA 3HG9A 5IP9H 5IP9G 4DR5L 1EIYB 4GN5A 1BDOA 2G9HD 2E2JB 4DR1L 3ONAB 1XX8A 2EQSA 3U4VA 1N33Q 1RHPA 4EQOA 3A8KE 3OTOQ 2MUYA 2ZJPA 2V4DA 2IX3A 2YU9H 2UXBL 2RVLA 4R4TA 1CZWA 4WFN3 3BJUA 5CORA 1VQCA 2EYPA 2NVTB 1R4PB 2E5LQ 2QEJC 1T9HA 2I5MX 4DV3L 3HOXH 3HOXG 1O78A 2F0NA 1VQJA 1V1PA 4KD4A 4DR4L 1PDQA 4WRDA 4JI3L 5JEAG 3J80E 4FXKC 4KI0A 2CVRA 4OL7A 4DA2A 2KEEA 3DUZA 5ELCA 2XRQD 3CCSA 3IFDA 4X3KA 2HD3A 3DWQA 3EBEA 4A3IG 5BN3A 2F4VL 3L9AX 2FMMA 1PH7A 4X3TA 4HJ7A 1EY8A 4QL5A 1O80A 5JAVA 1Z6HA 1SYEA 2JXMB 4LWCA 4UHVA 2RF4A 2F0VA 1N36L 5GAGC 5G3LD 1RTOA 1XJVA 2ZJRA 4DR5Q 2VXWA 4DR1Q 3CRKC 4RKLA 2YTVA 4JI1L 1EU4A 1JQYD 4L8JA 3I4NB 1E1OA 2B39A 2CWAA 2F0GA 3PUWA 4JBKA 1VMCA 1CI3M 1MI2A 2J4XA 1NCVA 2UXBQ 2A73B 1PVOA 1D1KA 3ULLA 4XQNA 3K6OA 4OO1H 4OO1G 3MXGA 3PSIA 3S2HH 1TWGH 5EPLA 3S1QB 4DV3Q 2BOSA 2C5CA 1SYBA 4HCSA 1QVGA 2CWPA 3PGZA 4X62L 3I70A 1KTKA 4CDFC 1D2BA 5FK9C 1YJWA 4DV0L 4DR4Q 5AFWA 3MC0B 5C4XB 3B6YA 3DXJC 3NBHA 4JI3Q 3PV0A 1L0WA 3E0JA 3VR2A 1ZYRC 4FVMA 4BBSB 3GTKH 1NTGA 1BCPF 5IGBA 1XPOA 1Y1VB 4MTKA 5NUCA 2F4VQ 3LWUA 1HUNA 4JI7L 3RZOH 1TY2A 2MQHA 1KAAA 1BBWA 1R4QB 3PIPA 1IYVA 4GN4B
chains in the Genus database with same CATH topology
3NTIA 3M3YB 3JAME 1A2TA 5EBCA 2JEBI 4KN4C 4K8IA 4EQPA 3SHLA 2H4OA 1PZID 3R8BA 1SJHD 2AQ2B 4RGMA 1SJED 3HS0C 3I3CA 1Y8NB 2EYMA 1QCBD 5CC4A 3V05A 4EVOA 4NDXA 4CKEA 5FO8B 2BE5D 1K8MA 4EQNA 2PW7A 2A74C 1VF5C 2DNEA 2JA8B 1ESFA 3S1RB 5C4ZA 2NVXB 3BVZA 5CV8A 2EYFA 3PIP3 4HTHA 1X32A 3GTJB 1VDZA 1XWEA 3A54A 3TZUA 3Q22A 3S14B 1SE4A 1GXDC 4PMCA 3MFGA 3SDZA 4DK1A 3A7AB 5K5PA 3OHXC 3R2TA 1SMYD 1F9RA 4G7OC 3S1NB 5C3EB 2DNCA 4G7HC 4M1UB 1NUCA 5EKKA 1GUNA 1KABA 4CHTB 4IUQA 4K8JA 3ZYYX 1M8AA 5C4JB 3BZDB 4N9TA 5CV4A 2PYKA 5T1IA 2EXZA 2X6LA 3URYA 1JOOA 1GOZA 5CYUA 3SK4A 1TWAB 4LK1C 2F0TA 1LT5D 2J7ZA 4TQUS 5CBAE 3IAYA 1OXXK 5EKIA 5EGTA 4C3JB 5KGUA 2EYJA 1EWHA 3M7GA 4XIGS 3D4DA 4XT1B 1RDPD 4TRDA 1ET9A 4DXGA 2JA6B 3D3RA 3RZDB 2XWJB 1EWCA 1PZKD 1KDCA 3CRLC 2IX1A 2D62A 3F2UA 1X3QA 1STYA 1IHZA 3NQIA 3D4WA 1LT6D 3RD4A 4WJWA 2EJFC 2JP1A 4RA8A 3QB3A 4LAAA 5T1GA 1LO5D 5CGKA 2YU9B 1O7LA 1UUPA 2QKIC 4RGNA 3KF8A 3MXUA 1A6XA 1YNJC 3BYYB 2RKSA 3HOXB 1ML0D 3P1HA 2B2WA 4ZQ3A 5J1ZA 4IALA 3ERQA 1SSOA 1JE4A 1QG7A 1AP0A 1Q3LA 1F2MA 3H3VC 1B3AA 2A69C 2O4XA 4L6TB 4BWGB 3DHQA 2SNSA 3U9SA 2SOBA 1AN8A 4DXFA 3DEPA 1AZPA 2AUKA 2HUGA 3OWFA 2VB2X 4IN3A 2VB3X 1SYDA 3KLRA 3S2HB 1B1ZA 1TWGB 4K5WA 4K6LA 2WV6D 3T56B 1SAPA 1V43A 5LL6X 2DY8A 2C9OA 4KY6A 1CA6A 5I6YA 3U9OA 3Q24A 2ICIA 3S9WA 2QDBA 5DAUA 1SYFA 3GTKB 5FLXL 1G8ZD 3BVMA 1G2SA 1DOKA 3RZOB 3OOCA 2F0HA 1O7YA 2MHVA 4PQXA 4FF1A 3TP6A 1E2WA 4FNFA 4C1NK 1OXVA 4FXGC 3MVVA 1TVXA 4DN4M 1I4XA 3E5SA 4J8QA 1T5EA 3SK6A 1CQFA 1SNDA 2G9DA 3ND8A 3SK8A 1EEID 4F8MA 2K33A 2K5WA 1VF7A 4NKLA 1BR9A 4MIUA 1I4RA 3KBGA 1F9SA 5CV5A 1BCPC 2F03A 5CV9A 2CHBD 2NVQB 5E4XA 4KV6A 3CU7A 2NN6H 3QO2A 3VYUA 2RDFA 3WDNA 4OIJA 4YIJA 5A2QL 1HPCA 3A8JE 2KVMA 1EEFD 5IGFA 5C0XI 1AW7A 1H9SB 2RBMA 5FO7B 3G6JB 3J81E 2EJGC 2R92B 1FNWA 1NSNS 2A68C 2LKVA 5ELDA 5M5WB 2HDMA 2F0JA 2CW0D 4NP5A 1WCMB 2SDFA 4CKCA 3TBIB 5C5MA 4AYBB 1QNUA 2D9UA 5DNFA 4RFBA 2EY2A 1NR2A 1PFMA 1B9NA 5ELBA 2EYLA 3WOFA 1J8IA 1GUWA 1F9PA 1JWUD 2RA4A 4KMUC 1YNND 2E75C 1Q8IA 2B2TC 5C4HA 2K01A 5K36H 3NE5B 4HN7A 1EZ8A 2F0WA 3SK5A 3J80L 1K83B 4C56C 1C8CA 4A3KB 1OXTA 4LJZC 4RGOS 3OSOA 4O1NA 3ITPA 3GV3A 1EQVA 4HMIA 2E2DC 2IPKD 4DAYA 3FMCA 1SNOA 2Q8TA 1BBXC 5BN5A 1UAPA 4K6DA 4R9WA 3TMEA 4Q5VA 3HEJA 1F9QA 3K57A 1TS2A 2LS01 5ELEA 3C1EA 3FPUB 1HA6A 3PUVA 5JEAH 4RGTA 1ICWA 2FINB 2L11A 2Z8LA 5KRUA 2A6ED 1I4QA 1WD1A 2PQEA 4QUCA 3M4OB 1B9MA 1XTCD 4ZK9B 3A55A 2F0IA 1SNQA 4BY7B 3LNNA 4PMWA 1EY0A 2F0MA 4N9PA 2KEDA 2JYOA 4CGYB 5ELFA 5IODA 1STEA 3MTSA 2BA0A 1K8OA 1JWSD 1CQVA 5I6WA 1WTXA 3IKJA 4ZYSA 2QF7A 1WTOA 3OIQA 2I46A 1IKLA 3I72A 4KY5A 3EA6A 4G4KA 4ODGA 1IW7D 4G57A 3A56A 4J1MA 2M9VA 5IT9L 2K32A 1FYCA 5JEAJ 1TWHB 4A3MB 3TSSA 3NQTA 1EY6A 2F1MA 3NK9A 3S2DB 1S5DD 1TS3A 2K5QA 5JVG3 1T5XD 5IGCA 5KIXA 1I4GA 2RDHA 3MXPA 1ZXTA 3K5LA 1EIGA 2XN9C 1G6ZA 4IUPA 1STGA 2OF1A 2XNAC 5EJWA 4UAIA 2E2IB 4QMGA 3GTGB 2EYHA 1EY7A 1Q1BA 5FO9B 1RF2D 1I6VC 4IUVA 5EPJA 1LT4D 2R61A 4B08A 4IZ8A 3W3AA 2BCOA 2AWNA 1C4QA 2L4NA 4LMQD 2L12A 3VYTA 5M5XB 4B9XA 2AQ1B 1HCZA 3G7LA 3D6CA 4MHEA 3CQZB 3GV6A 4FF2A 3WOEA 3NBIA 4F7XA 4C3IB 1II3A 1F2YA 4HCEA 1HRJA 1QB5D 1CTMA 3FPPA 1EFID 3HOWB 4K5XA 4FO2A 2K03A 1PFNA 4FXDA 1QJOA 2TMPA 3W2DA 2NZ1D 3DMUA 1BNZA 2H1EA 4K5VA 4V190 2MGSA 1DZ1A 1STHA 2WACA 3J7AV 4I7ZC 1MBYA 4DFAA 1A2UA 3D4RA 2R7ZB 1LTRD 1TKWB 1ZEQX 5DEHA 5HURA 4F87A 2KOLA 4L63B 4DNTB 2OXPA 4BS9A 4CJ1B 1RJTA 2JA5B 3IFTA 4H7BA 1ILQA 1PRTB 1E2VA 1WD0A 5J39A 1PYWD 4KY7A 2PO4A 3NWSA 1CFMA 1EQTA 4MN3A 2HQEA 3D31A 3OMCA 1SE2A 2F0EA 3H09A 3K58A 2VNUD 4V0BA 2IW3A 3VR4A 3D6WA 4HEDA 1WTWA 1TIID 1ENAA 3PO3B 3TP7A 1BOSA 4RAUC 2R6GA 4I65A 2BDOA 2IX0A 1EIHA 2HDLA 2AUJD 2FJ2A 1DYQA 1H9MA 1VMPA 2RQXA 2KECA 4KTAA 4OGQC 2FHTA 4ZKCB 1J9OA 1B53A 1WVLA 4CBVA 3TP8A 5C0XG 4PNYA 1JR0D 3SXHA 3GTMB 1GUGA 1LTAD 1MSGA 2K1BA 3HP3A 1B50A 3K0YA 4A3BB 2BE5C 3RMHA 5FOBB 3L3OC 1Y8PB 4A3IB 1I4PA 1GHKA 3NXWA 2Q8RE 1PRTD 4ZUJA 2NTTA 4IUUA 1PXUA 2B8FA 4UDUC 1QILA 4RHRA 2IWHA 1DOLA 4Y7NB 5KYIA 3M85A 3HRZC 4DF7A 2L9HA 2SNMA 2PZWA 1CM9A 1DD2A 1LLRD 2F0KA 1KLGD 3MFYA 4RHSA 4A3EB 1SMYC 1O7ZA 1ILPA 2A6HD 5I2XA 4J6HA 3PUXA 1L0XB 1LV9A 4Z9CB 3M7NA 4CKBA 1R9TB 3OPOA 1JWMD 1HFGA 1H9RA 1LABA 4OHJA 5C3WA 5KNDA 1STNA 2D5DA 2L1BA 4IQZA 4XYOA 2B2UC 5CBEE 5IGEA 1UEAB 1Y69U 1JOQA 1CZGA 3MA2B 3A8IE 2R3ZA 2JE6I 3T4AC 5EPKA 5C6AA 1PTOD 1LACA 3QWNA 3K59A 1SYCA 3AMUA 4R8NA 4R8IA 2K04A 1KLUD 4DK0A 1WTVA 1QWYA 3QIAA 1DONA 2WIIB 1BUVT 2J0TD 3TZDA 2RDGA 3J81L 4C3HG 1Q90A 2B2TA 4K14A 1SNPA 2R93B 2K7VA 1SNCA 3LX0A 3PUZA 1GUSA 3PIO3 2F0SA 2ZXOA 1CT1D 5C5LA 4TKOB 1KNAA 2B2VA 4Q0FA 5IOCA 2NB0A 1HQRD 2F0OA 1S5ED 2EOTA 2CQAA 1SNMA 1S4ZA 3HZXA 5FLXE 1D5MC 1ESRA 2WB1B 1U4MA 3KLSA 1V1PB 2B8GA 4ZRZA 2MPMA 4QCLA 1U4RA 1SE3A 4DU9A 4CJ0B 2WAQB 2F0LA 2RSNA 4IUNA 2NBFA 3AU7A 2F3WA 3K5OA 4JBWA 2WINB 2KCNA 2PCFB 3J7AF 2XRSD 5EBDA 1RTNA 2AWOA 4DAVA 5IGGA 3TDQA 5JJZA 4H0LC 1MGSA 1H9JA 1B2TA 1GHJA 1JB3A 3SR1A 4IURA 2XIWA 1BO0A 3N6RA 5M9OA 2K6AA 2NUCA 2TSSA 5E1FA 3C46A 1EY4A 1SEBD 3RLFA 2DY7A 4G7ZC 2PNRC 2LMCB 1ZYRD 2NWGA 2WP8J 2JSOA 4A93B 2KA7A 5JVH3 3RUZA 1MD2D 4KKSA 5A2QE 1XYIA 1SXTA 5C3XA 3D8GA 2I07B 1KDAA 2D2CC 5F2DA 1D5XC 3EROA 5LL6S 3DWPA 2ZXRA 1PMRA 4QF4A 4ABNA 1S5CD 1KNEA 3M4YA 4XQJA 4A3DB 3S16B 3T51B 2B2VC 4H44C 1F77A 1BQQT 1STBA 4S3SA 2PMZB 3I91A 3NPPA 3TN2A 2ICEC 5M3MB 1PZJD 3HOVB 4IFDI 5CMDA 3GD7A 2F0PA 4A3FB 1D5ZC 3DEOA 5I9OA 2EPBA 2JEAI 4F88A 1I3QB 1G91A 4JK1C 1F2ZA 2EY1A 2GA4B 3NTKA 1E0BA 5D3DA 2MJ8A 1PTOH 3FDTA 1ONLA 3C2PA 3S15B 1NAPA 4HR7B 3T53B 2B63B 1TS5A 2F4IA 1BF4A 1TR5A 4ULLA 2K28A 2X69A 2PZTA 2E76C 1H9SA 3X3NA 1A3VA 2DN8A 3MXNA 4DGZA 1IKMA 5M5YB 1QE6A 4RCNA 4NW2A 1TT2A 1HHVA 5EKLA 2ZT9C 2Y0SB 3JAML 2NN6I 3QJYA 1WTQA 2E2HB 4K2LA 1HTLD 2F3VA 1I4HA 1M4VA 1LTID 2EVBA 1TS4A 1W6KA 2NYZD 3I8ZA 3H94A 2K5DA 1JCKB 1E2ZA 5COYA 1S5BD 1A3UA 2CW0C 3HOZB 2B2YA 3V96A 2L55A 1SDFA 1TY0A 1B4OA 1OXSC 5J22A 4RH6A 2N88A 3BDCA 4CJ2C 3ND9A 3GTQB 2F0UA 2ZXPA 2KJXA 2O2LD 1YNNC 3KBXA 3KK7A 3MHBA 2Q8IB 1SYGA 4C3HB 4HMJA 4DAPA 2M2LA 3GTOB 4WORA 2EYOA 2Z1CA 4H13C 2XVSA 1PRTF 1YNJD 3Q0AA 5IIFA 5IGDA 1C48A 1DXMA 1RODA 1ET6A 1CHPD 2Z4HA 1HQMC 3SE0A 2OEOA 5IT9E 1LTGD 4NMZA 1EZ6A 3VYSA 4QIWB 3I90A 3CKIB 2K05A 1L0YB 2EY5A 2A69D 5ISRA 2ENBA 3DM1A 1LTTD 4ZUIA 5KNBA 1HUMA 5CV7A 4O42A 1EYDA 5I9PA 3H6MA 5E3FA 2A6EC 3BDLA 5C44B 1FR3A 3GP7A 4U673 3O13A 3C1FA 4KKTA 1BXTA 1BCPB 4ZLTF 1DCZA 5KYLA 4FF3A 2N55A 3K7AB 2KCCA 4HSPA 2B2YC 2X6GA 5JOBA 1RD9D 3OW7A 3TP5A 1QNKA 3AB9A 4XXEA 1DM0B 4XTCS 2PW5A 1AZQA 3OIPA 2LY7A 1PTOF 4QUFA 3GTPB 1W6JA 1DOMA 1GUOA 2F0FA 4TSSA 2XWBB 3PMFA 1CK1A 3S1MB 4OO1I 1IW7C 1DJRD 3EFXD 2WKCA 2HCCA 4C1NI 1A15A 3K5MA 4BA1I 5I4DA 1EY9A 3EJIA 4GZYC 3Q23A 2HCIA 4KJNA 3MAQA 2EY6A 2B2UA 3FVQA 1JC7A 3PO2B 4KK7A 5CV6A 1Z47A 1IL8A 4ZKBB 3MEHA 1Y1WB 1UNSA 3E6ZX 1VCIA 5CR3A 3HKZB 1WTRA 3EQLC 1BCPD 4BY1B 2SEBD 4IUTA 1U4LA 3KLSX 3UI2A 1SBBB 3GQBA 1AFPA 3NP8A 2FMCA 2IT1A 5C0XH 3VA5A 4XQQA 3FRPB 5EQ0A 3VR3A 1PTOB 2KUMA 4C2MB 3X3MA 4PMBA 4XT3B 1LTSD 4DNRB 1CA5A 2A5HA 2XSCA 3NTHA 1JICA 1G291 1QOHA 4K2KA 2RSOA 3I4LA 1XXGA 1F2LA 2Z4IA 1JOKA 5KNCA 4KHVA 1TWFB 1HTPA 3CHBD 2A68D 1SFOB 2YYZA 1OO9B 3HGBA 2PZUA 1RKNA 4XYQA 4RCOA 3SVMA 3FEWX 1Y8OB 3SEBA 5TSSA 5M3FB 3NHHA 3DWAA 5KEEA 1U4PA 3BYTB 1Q12A 1I50B 3I4MB 4KJOA 5C0XJ 1OXUA 3P7JA 1Q1EA 4BA2I 2M00A 4OIKA 4A3JB 1TQOA 1ENCA 3H91A 4X3UA 3LWEA 1EY5A 2IJ0A 5HGTA 3GO5A 1TWCB 4KD3A 2E74C 5JPNC 3J7YW 1HA5A 4BBRB 1V1OA 5I2YA 4FYDA 3OWEB 1EYAA 4IFDH 3R2IA 3P75A 4IFDG 2EE1A 4ID6A 2PPBC 4XDXA 3NUCA 1TU2B 5BN4A 3NSWA 2OT2A 3PUYA 4QB4A 3VYRA 3KUPA 3C3LA 1JORA 2NTSA 4ZAIA 1HFNA 4RWSC 1IYUA 2B2WC 2VUMB 1FNUA 1H9KA 1X3PA 4FP5D 1D6EC 3HOUB 3T13A 3NWTA 3V2TA 2ID0A 4EGVA 1Z7TA 1AEXA 1FGBD 2BDNA 1GJXA 2NVYB 5D3IB 1KDBA 1STAA 2O5IC 2QILA 1WTPA 5G3LF 1S5FD 1D1IA 2EJMA 4M8AA 1LTBD 2NN6G 4C3IG 2AQ3B 3L7ZC 2BA1A 2KQ3A 4IFDJ 2QCPX 4HSVA 4HAEA 4KHZA 5JPMC 2F0DA 3VR5A 4A3GB 1PRTC 3VA7A 1A3TA 5FKAC 3A7LA 3K5NA 4E6IA 3FKIB 3BS1A 3HOYB 3BG3A 1EL0A 2KHSA 3N52A 1V8QA 4KKUA 3GTLB 2IL8A 1PLFA 3EVQA 1LT3D 1G2TA 2EZVA 3OMGA 1ZKOA 3VR6A 3H0GB 2L0CA 3QG1A 2EDGA 2F0QA 2FFKB 3Q6SA 2A6HC 4PV1C 5D14A 1ENFA 1PFBA 1I6HB 1EU3A 3R3OA 2JA7B 3I73A 4ME5A 5LHY1 1EYCA 4RKBA 5DM63 3QOLA 2WKDA 1FD7D 4B9WA 2MP1A 4X3SA 4FF4A 5A35A 4C3JG 3IL8A 3T16A 2O5JC 3BVGA 5E4WC 5DM73 4KN7C 3MZ5A 3S17B 2L5TA 5K36G 2LFNA 1B44D 1CHQD 5D65A 3MWYW 1NR4A 3BDOA 1EOTA 1RCVD 4ILWA 1HXYD 3P20A 4U68A 1PTOC 1MSHA 4P2CB 1GUTA 3QOJA 3R93A 1FNVA 1U9RA 3HG9A 1BDOA 2G9HD 2E2JB 3ONAB 1XX8A 1RHPA 4EQOA 3A8KE 2MUYA 2V4DA 2IX3A 2RVLA 1CZWA 4WFN3 5CORA 2EYPA 2NVTB 1R4PB 2QEJC 1O78A 2F0NA 1V1PA 4KD4A 1PDQA 4WRDA 5JEAG 3J80E 4FXKC 4KI0A 2CVRA 4OL7A 4DA2A 2KEEA 3DUZA 5ELCA 2XRQD 3IFDA 4X3KA 3DWQA 5BN3A 3L9AX 2FMMA 4X3TA 1EY8A 1O80A 5JAVA 1Z6HA 1SYEA 2JXMB 2F0VA 5G3LD 1RTOA 2VXWA 3CRKC 4RKLA 1EU4A 1JQYD 4L8JA 3I4NB 2B39A 2F0GA 3PUWA 1VMCA 1CI3M 1MI2A 2J4XA 1NCVA 2A73B 1D1KA 4XQNA 3K6OA 4OO1H 4OO1G 3MXGA 5EPLA 3S1QB 2BOSA 2C5CA 1SYBA 4HCSA 1D2BA 3I70A 1KTKA 5FK9C 5AFWA 3MC0B 5C4XB 3DXJC 3NBHA 3PV0A 3E0JA 3VR2A 1ZYRC 4FVMA 4BBSB 1BCPF 5IGBA 1Y1VB 5NUCA 3LWUA 1HUNA 1TY2A 1KAAA 1R4QB 1IYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HSV A;  4HAE A;  2DY7 A;  5T1I A;  3P7J A;  2HCI A;  2RVL A;  2FHT A;  2NZ1 D;  4ZKC B;  2NWG A;  1J9O A;  1IKM A;  5COR A;  1B53 A;  1QE6 A;  2X6L A;  1C8C A;  4NW2 A;  4OIK A;  1F9S A;  1WVL A;  3H91 A;  4R8I A;  2K04 A;  1HHV A;  2B2U A;  1WTV A;  4X3U A;  3I90 A;  1DON A;  1BNZ A;  1MSG A;  2H1E A;  5E4X A;  2K1B A;  3DEP A;  3HP3 A;  3LWE A;  1IL8 A;  2K05 A;  2MGS A;  3GV3 A;  3TZD A;  1XYI A;  1B50 A;  1AZP A;  3QO2 A;  1DZ1 A;  1EL0 A;  4ZKB B;  1WTQ A;  2HUG A;  3DM1 A;  3N52 A;  4OIJ A;  2J7Z A;  1PDQ A;  5CBA E;  2B2T A;  2Q8T A;  2Q8R E;  1WTR A;  1BBX C;  2KVM A;  1HUM A;  5EKI A;  3I3C A;  4IUU A;  2CVR A;  2IL8 A;  2KEE A;  4O42 A;  4IUT A;  1U4L A;  1PLF A;  1ZXT A;  2KOL A;  2NYZ D;  3UI2 A;  3IFD A;  4X3K A;  1EIG A;  1G2T A;  1SAP A;  1KNE A;  4R9W A;  4XT1 B;  2FMM A;  3I8Z A;  4X3T A;  2EE1 A;  1G6Z A;  4CJ1 B;  1KNA A;  2B2V C;  4IUP A;  2B2V A;  5COY A;  1RJT A;  2DY8 A;  1DOL A;  1O80 A;  4XDX A;  5EJW A;  1F9Q A;  4UAI A;  1CA6 A;  2EOT A;  5EQ0 A;  4ZLT F;  1ILQ A;  2FFK B;  3Q6S A;  1S4Z A;  2L9H A;  5D14 A;  1WD0 A;  1RTO A;  2KUM A;  3KUP A;  2N55 A;  3FPU B;  1PFB A;  3I91 A;  2VXW A;  2B2Y C;  4ZAI A;  2B2Y A;  3TN2 A;  1HA6 A;  1HFN A;  1CM9 A;  1ESR A;  3F2U A;  1U4M A;  2X6G A;  4IUV A;  4RWS C;  5EPJ A;  1ICW A;  1SDF A;  1X3Q A;  2FIN B;  2L11 A;  1EQT A;  2B2W C;  2MPM A;  1U4R A;  4XT3 B;  1B4O A;  4MN3 A;  1G2S A;  1CA5 A;  2HDM A;  1WD1 A;  1DOK A;  1X3P A;  1X32 A;  1QNK A;  5CMD A;  2L4N A;  2JP1 A;  2N88 A;  1VMC A;  4RA8 A;  4CJ0 B;  1MI2 A;  3DEO A;  2MP1 A;  4QUC A;  1JIC A;  4LMQ D;  1NCV A;  1O7Z A;  2EPB A;  2L12 A;  5T1G A;  1AZQ A;  1ILP A;  4X3S A;  1O7Y A;  2RSN A;  2RSO A;  1G91 A;  4ZK9 B;  4CJ2 C;  1F2L A;  3IL8 A;  5EPL A;  1LV9 A;  5E4W C;  4QUF A;  2BDN A;  2SDF A;  3G7L A;  4MHE A;  3GV6 A;  4HCS A;  1HFG A;  3D6W A;  3KBX A;  4HED A;  5D65 A;  3MWY W;  1DOM A;  2KED A;  1NR4 A;  2D9U A;  1ML0 D;  5DNF A;  1RTN A;  2JYO A;  1WTW A;  1EOT A;  5AFW A;  1E0B A;  1TVX A;  4DN4 M;  2B2W A;  2L1B A;  5JJZ A;  3SVM A;  1WTP A;  2MJ8 A;  1F9R A;  1MGS A;  1NR2 A;  1PFM A;  3FDT A;  4U68 A;  2B2U C;  1B2T A;  1MSH A;  1HRJ A;  3R93 A;  5CBE E;  4RAU C;  2M2L A;  1SSO A;  1J8I A;  1JE4 A;  1NAP A;  1QG7 A;  4IUR A;  1GUW A;  2XIW A;  1BO0 A;  1F9P A;  1EIH A;  1U4P A;  2HDL A;  2K03 A;  3MTS A;  2RA4 A;  3ONA B;  1AP0 A;  1XX8 A;  2HCC A;  1PFN A;  2R3Z A;  1A15 A;  1Q3L A;  1RHP A;  1WTX A;  1HUN A;  1BF4 A;  2B2T C;  1ROD A;  2FJ2 A;  1B3A A;  2K01 A;  2K28 A;  2X69 A;  1WTO A;  4IUQ A;  5EPK A;  1M8A A;  1VMP A;  2KEC A;  1IKL A; 
#chains in the Genus database with same CATH topology
 3NTI A;  3M3Y B;  1N36 Q;  4PZ7 A;  4CDD C;  2KHI A;  3JAM E;  1CUK A;  1A62 A;  4HJ8 A;  1A2T A;  5EBC A;  1NBW A;  2JEB I;  2Q2I A;  4LFC L;  3D0F A;  4KN4 C;  2DGY A;  3CC4 A;  1K8A C;  5GRO A;  3G71 A;  2KCT A;  4K8I A;  3TRE A;  3KFU A;  4EQP A;  3SHL A;  2H4O A;  1PZI D;  3R8B A;  1SJH D;  2AQ2 B;  1PHJ A;  4RGM A;  1IXR A;  1SJE D;  3HS0 C;  3I3C A;  3G6E A;  1Y8N B;  2EYM A;  1QCB D;  5CC4 A;  1J5E L;  3V05 A;  4EVO A;  2F52 A;  4X62 Q;  4NDX A;  4CKE A;  5FO8 B;  2BE5 D;  4DV0 Q;  1K8M A;  4JYA L;  4EQN A;  3TS2 A;  1C0A A;  1FGU A;  3CCL A;  1FL0 A;  2PW7 A;  2HQL A;  2A74 C;  1VF5 C;  2DNE A;  3CF5 A;  1YIT A;  2JA8 B;  1ESF A;  3S1R B;  5C4Z A;  1QZH A;  1PH2 A;  2NVQ H;  2HIV A;  2QA4 A;  2NVX B;  3BVZ A;  2VL6 A;  3TS0 A;  5CV8 A;  1N9W A;  4JI7 Q;  1P8L A;  2EYF A;  1A0I A;  4HTH A;  3PIP 3;  3TQY A;  1X32 A;  3GTJ B;  3CCJ A;  4GNX A;  3K81 C;  3BU2 A;  4DAM A;  1B3Q A;  2N49 A;  1VDZ A;  1XWE A;  3A54 A;  3TZU A;  4QQB X;  3J80 i;  3Q22 A;  4LFC Q;  3S14 B;  3CCU A;  1SE4 A;  1GXD C;  4PMC A;  3MFG A;  4OON A;  2Q2T A;  2WFW A;  3SDZ A;  4DK1 A;  3A7A B;  5K5P A;  1PH5 A;  3FKI H;  3OHX C;  3R2T A;  1SMY D;  2R92 H;  2R92 G;  1F9R A;  1K0R A;  3UDF A;  4G7O C;  3S1N B;  5C3E B;  2DNC A;  4G7H C;  1VQD A;  4M1U B;  1J5E Q;  1NUC A;  1N32 L;  5EKK A;  3BZC A;  4AYB E;  1GUN A;  1KAB A;  5GQO A;  4CHT B;  1JMC A;  4JYA Q;  4IUQ A;  4K8J A;  3ZYY X;  1M8A A;  5C4J B;  3BZD B;  4N9T A;  2HT1 A;  5CV4 A;  2PYK A;  3H0G H;  5T1I A;  3I55 A;  3CCE A;  3I4O A;  1WCM H;  1PYS B;  2EXZ A;  4JI0 Q;  1DGS A;  1XPR A;  2X6L A;  3URY A;  2ZTC A;  1JOO A;  4H02 A;  1GOZ A;  4AYB G;  5CYU A;  4B3T L;  4O0A A;  1C7Y A;  1WTH A;  3SK4 A;  1TWA B;  5LMN Q;  4LK1 C;  2F0T A;  1LT5 D;  2J7Z A;  4TQU S;  5CBA E;  3UE0 A;  3IAY A;  4EQ5 A;  1AE2 A;  3QR8 A;  1SMX A;  1OXX K;  3DLL A;  5FLM H;  5EKI A;  5EGT A;  4C3J B;  5KGU A;  4A3C H;  4A3C G;  5ELO A;  2EYJ A;  1EWH A;  3M7G A;  3ULJ A;  4YY3 L;  4XIG S;  2FXQ A;  3D4D A;  4XT1 B;  1RDP D;  2Q2U A;  4TRD A;  4DUY L;  2QGQ A;  1K83 H;  1ET9 A;  4DXG A;  2JA6 B;  3D3R A;  3RZD B;  4A3K H;  2XWJ B;  4A3K G;  1EWC A;  1PZK D;  1XNR L;  3KDF B;  1N32 Q;  3JAM i;  1KDC A;  3CRL C;  5IWA L;  2D62 A;  2IX1 A;  3F2U A;  1KC8 C;  2LXJ A;  1X3Q A;  2IHE A;  1STY A;  1IHZ A;  3NQI A;  3D4W A;  1LT6 D;  3RD4 A;  4WJW A;  2EJF C;  2JP1 A;  5IY0 A;  4RA8 A;  5M3M G;  3QB3 A;  1X3F A;  4LAA A;  5T1G A;  1LO5 D;  5CGK A;  1MHW C;  2YU9 B;  1O7L A;  3HOV G;  1UUP A;  2QKI C;  4RGN A;  3KF8 A;  1D7Q A;  3MXU A;  3WWV A;  1A6X A;  1YNJ C;  3BYY B;  2RKS A;  3HOX B;  1I5F A;  4CDE C;  4NXM L;  1ML0 D;  3P1H A;  2B2W A;  4ZQ3 A;  5J1Z A;  4IAL A;  3ERQ A;  1SSO A;  4DK6 C;  1JE4 A;  1QG7 A;  4KLK A;  2LXK A;  4YY3 Q;  1AP0 A;  1Q3L A;  1WOC A;  1F2M A;  1X6O A;  4DUY Q;  3H3V C;  1A63 A;  1B3A A;  2A69 C;  2O4X A;  3M4O H;  4L6T B;  4BWG B;  3DHQ A;  4BY7 H;  1XMQ L;  4DV7 L;  1XNR Q;  4JI5 L;  2B63 G;  2SNS A;  1VQH A;  1XNQ L;  1Y14 B;  5IWA Q;  3U9S A;  1VQI A;  2SOB A;  1AN8 A;  4DXF A;  4X64 L;  2I5H A;  2LSS A;  3DEP A;  5JJL A;  1AZP A;  4UPA A;  2AUK A;  2HUG A;  3OWF A;  1JT8 A;  4DV2 Q;  2VB2 X;  4GS3 A;  1ASZ A;  4L5Q A;  2JJQ A;  4IN3 A;  2VB3 X;  1SYD A;  3KLR A;  3S2H B;  1B1Z A;  1TWG B;  4K5W A;  4K6L A;  2WV6 D;  2CFM A;  3T56 B;  1SAP A;  1V43 A;  5LL6 X;  4NXM Q;  4DV1 L;  4A3L H;  5H1S E;  4A3L G;  3GDE A;  2DY8 A;  2C9O A;  3E9H A;  4KY6 A;  1CA6 A;  5I6Y A;  3U9O A;  3Q24 A;  2Z0S A;  2ICI A;  1CSP A;  2VW9 A;  3S9W A;  3CPW A;  2QDB A;  5DAU A;  1SRU A;  4OEL B;  1SYF A;  3GTK B;  5FLX L;  1G8Z D;  1TWH H;  3BVM A;  4A3M H;  4A3M G;  1NY4 A;  1G2S A;  1DOK A;  1MIU A;  1PYB A;  3M9B A;  3S2D H;  3RZO B;  4UP8 A;  3OOC A;  1XMQ Q;  2F0H A;  1O7Y A;  4IJL A;  1NE3 A;  4DV7 Q;  3PQI A;  4JI5 Q;  1X65 A;  1XNQ Q;  2MHV A;  2QW7 A;  3NEM A;  5IYB G;  4PQX A;  4X64 Q;  3NEN A;  4FF1 A;  3TP6 A;  1E2W A;  4FNF A;  4C1N K;  1OXV A;  4FXG C;  3MVV A;  2E2I H;  1TVX A;  3W5O A;  4DN4 M;  1I4X A;  3GTG H;  1MKH A;  2Z6K C;  3E5S A;  4YWL A;  4J8Q A;  1T5E A;  4N8F A;  3SK6 A;  1CQF A;  1SND A;  2G9D A;  2V1C C;  3ND8 A;  2UXD L;  2HHH L;  3SK8 A;  3KJP A;  1YNX A;  3HKS A;  4DV1 Q;  1JB7 A;  5IP7 H;  1EEI D;  5IP7 G;  4F8M A;  2K33 A;  2K5W A;  1VF7 A;  5M5X H;  4NKL A;  1BR9 A;  2OCE A;  4MIU A;  3STB D;  1I4R A;  3KBG A;  1F9S A;  5CV5 A;  1BCP C;  3CQZ H;  2F03 A;  1M1K C;  5CV9 A;  2CHB D;  2NVQ B;  1Q82 C;  5E4X A;  4KV6 A;  3U58 A;  3CU7 A;  1PH9 A;  2NN6 H;  3QO2 A;  4C3I H;  2RHQ B;  3VYU A;  4L5T A;  2RDF A;  3WDN A;  4OIJ A;  4YIJ A;  5A2Q L;  1YVC A;  3GTJ H;  1PH8 A;  1HPC A;  1U5K A;  3A8J E;  3HOW H;  2KVM A;  1EEF D;  3KJO A;  4FDB A;  4LW1 A;  5IGF A;  3UDG A;  5C0X I;  1AW7 A;  3FHW A;  4MNO A;  1H9S B;  2RBM A;  3MXN B;  5FO7 B;  1NJI C;  1W2B A;  3G6J B;  3J81 E;  2EJG C;  2R92 B;  1EIF A;  1K3R A;  3CPF A;  4POF A;  1FNW A;  3PF4 A;  1NSN S;  1VQP A;  2UXD Q;  2HHH Q;  5IYD G;  2A68 C;  2LKV A;  5ELD A;  5M5W B;  2ZJQ A;  2HDM A;  1YHA A;  3F8T A;  2F0J A;  1N8R C;  4EX5 A;  2CW0 D;  3RNU A;  2R7Z H;  4NP5 A;  2R7Z G;  1WCM B;  1QZG A;  2SDF A;  4CKC A;  3TBI B;  5C5M A;  4AYB B;  3ERS X;  1QNU A;  2JA5 H;  2D9U A;  2JA5 G;  5DNF A;  1VQ4 A;  1VQM A;  4RFB A;  2EY2 A;  3HFZ B;  1NR2 A;  1PFM A;  1B9N A;  5ELB A;  2ASB A;  2EYL A;  3WOF A;  1J8I A;  1GUW A;  1F9P A;  1JWU D;  2RA4 A;  4KMU C;  1YNN D;  2E75 C;  3H3V I;  1Q8I A;  2GVB A;  2B2T C;  5C4H A;  2K01 A;  5K36 H;  3NE5 B;  4HN7 A;  1EZ8 A;  2F0W A;  2Q2H A;  4LUZ A;  3SK5 A;  3J80 L;  1K83 B;  3UE1 A;  3K8A A;  4C56 C;  1C8C A;  4A3K B;  1OXT A;  4LJZ C;  3RN2 A;  4RGO S;  3OSO A;  2K4K A;  3ZJY C;  4O1N A;  3ITP A;  3GV3 A;  1EQV A;  4HMI A;  2E2D C;  2IPK D;  2VS1 A;  4DAY A;  3PO3 H;  3PO3 G;  1VS0 A;  4B3S Q;  3FMC A;  1SNO A;  2Q8T A;  5LMN W;  1BBX C;  5BN5 A;  2YV5 A;  1UAP A;  4K6D A;  4R1J A;  4R9W A;  3TME A;  4Q5V A;  4BY1 G;  3HEJ A;  4DK3 C;  1QUQ B;  1F9Q A;  3K57 A;  1TS2 A;  2LS0 1;  5ELE A;  1B8A A;  3OYY A;  3C1E A;  3FPU B;  1HA6 A;  3GTM H;  3PUV A;  5JEA H;  4RGT A;  2UXC L;  1ICW A;  1IBM L;  2FIN B;  2L11 A;  2Z8L A;  5KRU A;  4A3B H;  2A6E D;  4A3B G;  1I4Q A;  2E8G A;  1WD1 A;  2PQE A;  2XTI A;  4A3I H;  4QUC A;  4YWK A;  3M4O B;  1B9M A;  1XTC D;  4ZK9 B;  3A55 A;  2F0I A;  1SNQ A;  4BY7 B;  4LFB Q;  3LNN A;  4PMW A;  1EY0 A;  2F0M A;  1BBU A;  4N9P A;  2KED A;  4JI8 L;  3DM3 A;  4JC0 A;  2JYO A;  1VQG A;  1QVC A;  2QDL A;  1VQA A;  4CGY B;  2AMC B;  3J81 i;  5ELF A;  5IOD A;  1STE A;  3MTS A;  2BA0 A;  4J15 A;  1K8O A;  1JWS D;  4LUV A;  1CQV A;  1TXY A;  4K0K Q;  1MJC A;  5I6W A;  1WTX A;  3IKJ A;  4A3E H;  1KXL A;  1P16 A;  4A3E G;  4ZYS A;  2PNH A;  2QF7 A;  4NPS A;  1WTO A;  3OIQ A;  2I46 A;  4R4I A;  1IKL A;  3I72 A;  2MO0 A;  4KY5 A;  3EA6 A;  4DR6 L;  4G4K A;  4ODG A;  3I4M G;  1R9T H;  1IW7 D;  4PG3 A;  4G57 A;  2UXC Q;  3A56 A;  3NEL A;  4J1M A;  1IBM Q;  2M9V A;  5IT9 L;  1RL2 A;  2K32 A;  1FYC A;  5JEA J;  3MEF A;  1TWH B;  4A3M B;  1L1O B;  1LM0 A;  3TSS A;  3NQT A;  3PF5 A;  1EY6 A;  2F1M A;  3NK9 A;  3S2D B;  1S5D D;  1TS3 A;  2K5Q A;  5JVG 3;  1T5X D;  3KF6 A;  5IGC A;  5KIX A;  1I4G A;  2RDH A;  4OXP A;  4LF5 L;  3MXP A;  1ZXT A;  3K5L A;  1EIG A;  4JI8 Q;  2XN9 C;  1V1Q A;  1G6Z A;  2PI2 E;  4IUP A;  3A74 A;  1STG A;  2OF1 A;  2XNA C;  1S40 A;  5EJW A;  4UAI A;  2E2I B;  4QMG A;  3GTG B;  2EYH A;  1EQQ A;  1VQ8 A;  1EY7 A;  1Q1B A;  5FO9 B;  1RF2 D;  1I6V C;  4IUV A;  1PH3 A;  5EPJ A;  3AYH B;  1LT4 D;  4MZ9 A;  2R61 A;  4B08 A;  4IJH A;  4IZ8 A;  2D0P A;  4O2D A;  3W3A A;  2BCO A;  2AWN A;  1C4Q A;  2L4N A;  2QEX A;  4LMQ D;  2R93 H;  2R93 G;  2L12 A;  4DR6 Q;  3VYT A;  2VUM G;  5M5X B;  1NNX A;  4B9X A;  1X54 A;  2WB1 E;  2AQ1 B;  3HOU G;  1HCZ A;  3K0X A;  3G7L A;  3D6C A;  4MHE A;  3CQZ B;  3GV6 A;  4JI0 L;  4FF2 A;  3WOE A;  3ICE A;  3W1B A;  4GN3 B;  2CH4 A;  2R7F A;  3NBI A;  4APV A;  4F7X A;  4C3I B;  1HNX Q;  1II3 A;  1F2Y A;  4HCE A;  1HRJ A;  3G48 A;  1QB5 D;  5LMN L;  1CTM A;  2WB1 G;  3FPP A;  1EFI D;  3CXC A;  4LF5 Q;  3HOW B;  4K5X A;  1BVS A;  4FO2 A;  2GN5 A;  2K03 A;  1G51 A;  2EXD A;  1PFN A;  4FXD A;  2A1A A;  1YEZ A;  1QJO A;  2TMP A;  3W2D A;  2WAQ G;  1JJC B;  1ASY A;  1WI5 A;  2NZ1 D;  1HJP A;  2ATW A;  3DMU A;  4GLV B;  4JVZ A;  2Z9H A;  1BNZ A;  2H1E A;  3K80 C;  4K5V A;  4V19 0;  2MGS A;  2JA9 A;  1DZ1 A;  1EUJ A;  1STH A;  5M5W H;  2WAC A;  1PH1 A;  3J7A V;  3CCQ A;  4I7Z C;  4DV5 L;  1MBY A;  2CCZ A;  4DFA A;  1A2U A;  3HOY G;  3D4R A;  4AH6 A;  5HY6 A;  2R7Z B;  1LTR D;  2CQO A;  1YJ9 A;  1TKW B;  1ZEQ X;  5DEH A;  2Z6B A;  5HUR A;  4F87 A;  2KOL A;  2B29 A;  1E22 A;  2EIF A;  4L63 B;  4DNT B;  4ME3 A;  2OXP A;  1U0L A;  1VQO A;  4BS9 A;  4CJ1 B;  2RCF A;  3KYH C;  1RJT A;  2JA5 B;  3IFT A;  4H7B A;  1ILQ A;  1PRT B;  1E2V A;  1WD0 A;  4A93 H;  4A93 G;  3CC7 A;  5J39 A;  1PYW D;  4KY7 A;  2PO4 A;  3NWS A;  1CFM A;  1EQT A;  3E9I A;  2VQE L;  4MN3 A;  4BXX G;  2HQE A;  3FP9 A;  3D31 A;  4JI6 L;  1UE6 A;  1C9O A;  3OMC A;  1SE2 A;  3CCR A;  2F0E A;  3H09 A;  3K58 A;  1KHI A;  2VNU D;  4V0B A;  2PMZ E;  5IE8 A;  2VQF L;  4A3D H;  2IW3 A;  4A3D G;  4ALP A;  3S16 H;  1CKM A;  3VR4 A;  3D6W A;  4HED A;  4AQY L;  1WTW A;  1TII D;  4DV5 Q;  1ENA A;  3PO3 B;  3TP7 A;  1BOS A;  3T1H L;  4RAU C;  2R6G A;  3L0O A;  4JBJ A;  4I65 A;  4DKA C;  5M3M H;  1VQK A;  2BDO A;  2IX0 A;  1EIH A;  4DV2 L;  2HDL A;  3HOV H;  2K75 A;  2AUJ D;  4A3F H;  2G5D A;  4A3F G;  2FJ2 A;  1DYQ A;  1H9M A;  1CKN B;  1VQN A;  1VMP A;  2RQX A;  2KEC A;  4KTA A;  4OGQ C;  1HZC A;  3S24 A;  2FHT A;  4ZKC B;  4IPD A;  1J9O A;  4LF4 L;  1B53 A;  3ER0 A;  1WVL A;  4CBV A;  2Z6K A;  3TP8 A;  5C0X G;  4PNY A;  4JI4 L;  4JCV E;  1QVF A;  1JR0 D;  3A5Z B;  3SXH A;  1GUG A;  1LTA D;  1MSG A;  4L5R C;  2VQE Q;  4GOP B;  3GTM B;  2K1B A;  3HP3 A;  1B50 A;  1JE5 A;  3K0Y A;  4A3B B;  2BE5 C;  3RMH A;  5FOB B;  1Q86 C;  4JI6 Q;  3L3O C;  1Y8P B;  3S15 H;  4A3I B;  1I4P A;  1GHK A;  3NXW A;  2Q8R E;  2VQF Q;  1PRT D;  2BH8 A;  4ZUJ A;  1SRO A;  2NTT A;  4IUU A;  2Y0S E;  1IYJ B;  1PXU A;  2B8F A;  1HNZ L;  2B63 H;  4UDU C;  4AQY Q;  4PZ8 A;  4HJ9 A;  4DPG A;  1QIL A;  4RHR A;  2IWH A;  1DOL A;  2OWO A;  4Y7N B;  5KYI A;  5M5Y H;  4GLX A;  3T1H Q;  4RG1 A;  3M85 A;  3HRZ C;  4DF7 A;  2L9H A;  3CD6 A;  1PA6 A;  2SNM A;  2PZW A;  4UY8 C;  2Y0S G;  1CM9 A;  1ICF B;  1CSQ A;  1DD2 A;  1LLR D;  2F0K A;  1KLG D;  1Z9F A;  3MFY A;  2E2H H;  4DR7 L;  4RMF A;  4RHS A;  2K14 A;  1HNW L;  4A3E B;  1SMY C;  1O7Z A;  1ILP A;  2A6H D;  5I2X A;  4LF4 Q;  4J6H A;  3PUX A;  1L0X B;  1LV9 A;  4Z9C B;  3M7N A;  2K50 A;  3H3V H;  4CKB A;  3L2P A;  4JI4 Q;  1R9T B;  1S72 A;  4WJ3 M;  3OPO A;  1JWM D;  1HFG A;  4NB3 A;  1W3S A;  1H9R A;  3PIO A;  1LAB A;  2RHS B;  4OHJ A;  5C3W A;  5KND A;  5FLX c;  1STN A;  2D5D A;  2L1B A;  4IQZ A;  4XYO A;  4DNI A;  2B2U C;  4TVA B;  2JQO A;  5CBE E;  4HJ5 A;  5IGE A;  3HOZ G;  4N8X 1;  1UEA B;  4PZ6 A;  1Y69 U;  4KHP L;  4OEM B;  1JOQ A;  4LF9 L;  1HNZ Q;  1CZG A;  4R4C A;  3AFQ A;  3MA2 B;  1G6P A;  4HIO A;  5IYB H;  4OWT B;  3A8I E;  2R3Z A;  3CC2 A;  2ES2 A;  3M4Q A;  2JE6 I;  3T4A C;  5EPK A;  5C6A A;  2H5X A;  1S3O A;  1IBK L;  3H15 A;  1PTO D;  1Y1V G;  1LAC A;  3QWN A;  3GTQ H;  3K59 A;  2R7D A;  1SYC A;  1H95 A;  3AMU A;  1PFS A;  4R8N A;  4R8I A;  2K04 A;  1KLU D;  4QGU A;  4DK0 A;  1WTV A;  2PQA B;  1QWY A;  3QIA A;  3KDF A;  1DON A;  2WII B;  1BUV T;  2J0T D;  4DR7 Q;  3TZD A;  2RDG A;  4Y52 H;  4HIM A;  1HZ9 A;  1UE5 A;  1HNW Q;  3J81 L;  4C3H G;  5LMU L;  3GTO H;  1EOV A;  1Q90 A;  2B2T A;  4K14 A;  1SNP A;  2R93 B;  2K7V A;  1SNC A;  1KD1 C;  4GLA C;  2F3I A;  3LX0 A;  1YHB A;  3PUZ A;  1GUS A;  3PIO 3;  2F0S A;  2ZXO A;  1L2F A;  2IHF A;  1CT1 D;  1B70 B;  5C5L A;  4UP7 A;  4TKO B;  2IY5 B;  1KNA A;  2K5H A;  2B2V A;  4Q0F A;  2ALY B;  5IOC A;  2NB0 A;  1HQR D;  1XMO L;  2F0O A;  1S5E D;  2EOT A;  2CQA A;  4GKJ L;  1SNM A;  4KHP Q;  1S4Z A;  3HZX A;  4R4O A;  5FLX E;  4LF9 Q;  1D5M C;  1ESR A;  2WB1 B;  1U4M A;  3KLS A;  1V1P B;  2B8G A;  4ZRZ A;  2MPM A;  4QCL A;  2DJG C;  1U4R A;  1YI2 A;  4YCV A;  1SE3 A;  4DU9 A;  4HJA A;  1IBK Q;  3IRB A;  4CJ0 B;  2WAQ B;  2F0L A;  2RSN A;  4IUN A;  2NBF A;  3AU7 A;  1J6Q A;  2F3W A;  3K5O A;  4JBW A;  2WIN B;  5AJ3 L;  2KCN A;  2GVA A;  2PCF B;  1EQR A;  5C44 H;  3J7A F;  5C44 G;  2XRS D;  4P74 A;  5EBD A;  4NXN L;  3CW2 C;  1RTN A;  2AWO A;  4DR2 L;  5IYD H;  4DAV A;  5IGG A;  1E1T A;  3TDQ A;  5JJZ A;  5LMU Q;  4H0L C;  1MGS A;  1H9J A;  1B2T A;  1GHJ A;  1JB3 A;  3SR1 A;  4I7A A;  4IUR A;  2NZH A;  2XIW A;  3KOJ A;  1BO0 A;  3N6R A;  5M9O A;  2K6A A;  4B3S L;  3AFP A;  1UE7 A;  1RIP A;  3EIV A;  2NUC A;  2TSS A;  5E1F A;  5DLQ E;  1EY4 A;  5HGQ A;  3C46 A;  1SEB D;  3RLF A;  1XMO Q;  3J7Z C;  4GKJ Q;  2DY7 A;  4G7Z C;  2PNR C;  2LMC B;  1ZYR D;  2NWG A;  2WP8 J;  2JSO A;  3GTP H;  1BKB A;  1X3E A;  2I0Q A;  4A93 B;  2KA7 A;  5JVH 3;  3RUZ A;  1MD2 D;  4KKS A;  5GAD C;  5A2Q E;  1XYI A;  3NBH B;  1SXT A;  5C3X A;  3D8G A;  2I07 B;  2AKW B;  1KRS A;  1WYD A;  1KDA A;  2D2C C;  5F2D A;  1HZA A;  1D5X C;  3ERO A;  3S1M H;  1IZ6 A;  5LL6 S;  5GAE C;  3DWP A;  5AJ3 Q;  2ZXR A;  1PMR A;  3PCO B;  4QF4 A;  4ABN A;  1VQF A;  3J80 c;  2RCN A;  1UEB A;  2OTL A;  1S5C D;  3CAM A;  1KNE A;  3M4Y A;  4XQJ A;  4NXN Q;  4A3D B;  4LFB L;  3S16 B;  3T51 B;  3CCM A;  4DR2 Q;  2B2V C;  3LGJ A;  3E3X A;  1JJG A;  1HR0 L;  2BH2 A;  4H44 C;  1F77 A;  5J3B A;  4LF6 Q;  5BR8 L;  1BQQ T;  1STB A;  3HKZ E;  4S3S A;  2PMZ B;  4JI2 L;  3I91 A;  3NPP A;  3TN2 A;  2ICE C;  5M3M B;  3PO2 H;  3PO2 G;  4GOP C;  1PZJ D;  3HOV B;  1Y1W H;  1EYG A;  2PI2 A;  1Y1W G;  4IFD I;  5CMD A;  3GD7 A;  2F0P A;  4A3F B;  1KL9 A;  1D5Z C;  3DEO A;  4K0K L;  4IPG A;  3HKZ G;  5I9O A;  2EPB A;  2JEA I;  4F88 A;  2UUC Q;  1I3Q B;  4BY1 H;  1G91 A;  4JK1 C;  2DJF C;  1F2Z A;  2EY1 A;  2GA4 B;  4AIM A;  2JN4 A;  1SLJ A;  3I2Z A;  1K9M C;  3NTK A;  4OWW B;  4JOI C;  1E0B A;  5D3D A;  3CMA A;  2MJ8 A;  1PTO H;  3FDT A;  3RN5 A;  1ONL A;  3C2P A;  1HH2 P;  4C2M H;  2MFI A;  3S15 B;  1NAP A;  4HR7 B;  2KHJ A;  3STB C;  3J7A 5;  3T53 B;  1X9N A;  2B63 B;  1TS5 A;  2F4I A;  2NZO A;  4GNX B;  1BF4 A;  1TR5 A;  4ULL A;  2KCM A;  1B7Y B;  2I5L X;  2K28 A;  2N8N A;  2X69 A;  2PZT A;  1HR0 Q;  4LFA L;  2E76 C;  1H9S A;  5BR8 Q;  2CH4 W;  1A3V A;  2DN8 A;  3MXN A;  3X3N A;  4Y7N H;  4DGZ A;  1TWF H;  1IKM A;  5M5Y B;  4JI2 Q;  1HZB A;  1QE6 A;  4RCN A;  4NW2 A;  1Q81 C;  1TT2 A;  1HHV A;  5EKL A;  1SFO H;  2ZT9 C;  2Y0S B;  3JAM L;  3JAM c;  4JBM A;  2NN6 I;  1FVI A;  3QJY A;  1WTQ A;  4IPC A;  2E2H B;  4K2L A;  5E7N A;  1GO3 E;  2B3G A;  1HTL D;  2F3V A;  1LYL A;  1I4H A;  4LF8 L;  1KRT A;  5M3F H;  2CKZ B;  5M3F G;  1M4V A;  2A8V A;  1LTI D;  2EVB A;  1K8G A;  1I50 H;  3I56 A;  1TS4 A;  1W6K A;  2NYZ D;  3I4M H;  1VQB A;  5EAY A;  4JV5 L;  2P5Z X;  3I8Z A;  3H94 A;  2K5D A;  1JCK B;  1E2Z A;  5COY A;  5IT9 c;  2UUB L;  1S5B D;  1A3U A;  4A3J H;  1K3B C;  4HID A;  2CW0 C;  4A3J G;  3HOZ B;  1HNX L;  2B2Y A;  2VZA A;  3V96 A;  2A19 A;  2L55 A;  4CDC C;  1SDF A;  1TY0 A;  1TWC H;  1B4O A;  1PH6 A;  1OXS C;  3ULP A;  5J22 A;  1CKO A;  4RH6 A;  4LFA Q;  1O7I A;  2N88 A;  3BDC A;  3CCV A;  4BBR H;  4BBR G;  4CJ2 C;  3ND9 A;  5FJ8 H;  3GTQ B;  2F0U A;  5FJ8 G;  2ZXP A;  2KJX A;  3T1Y L;  3AEV A;  2O2L D;  1YHQ A;  1YNN C;  3JC6 6;  3KBX A;  3KK7 A;  3W1G A;  4YCW A;  3MHB A;  1WJJ A;  4LF8 Q;  4DV4 L;  4HMJ A;  1SYG A;  2Q8I B;  4C3H B;  4DAP A;  2M2L A;  3GTO B;  4JI1 Q;  4WOR A;  2EYO A;  1X56 A;  2Z1C A;  4H13 C;  2XVS A;  1PRT F;  1YNJ D;  3Q0A A;  2VUM H;  5IIF A;  5IGD A;  1Q46 A;  1PH4 A;  4JV5 Q;  1C48 A;  1YZ6 A;  3HOU H;  3SGI A;  1DXM A;  1ROD A;  4WJ4 A;  2UUB Q;  1ET6 A;  1CHP D;  2Z4H A;  1XPU A;  2JK8 A;  1HQM C;  3SE0 A;  3KF8 B;  4P71 A;  2OEO A;  1QUQ A;  3F2D A;  2WAQ E;  5IT9 E;  1NMG A;  1LTG D;  4NMZ A;  3F2C A;  1EZ6 A;  1XTD A;  3VYS A;  2NVY H;  4QIW B;  1YJN A;  2KEN A;  3I90 A;  3CKI B;  2K05 A;  1L0Y B;  2EY5 A;  2A69 D;  5ISR A;  2ENB A;  1Q7Y C;  3DM1 A;  1LTT D;  4A4I A;  1VQ9 A;  1AH9 A;  3G4S A;  4ZUI A;  1GD7 A;  5KNB A;  2KBN A;  1FJG L;  2HIX A;  1HUM A;  5CV7 A;  3T1Y Q;  2C35 B;  4O42 A;  1EYD A;  5I9P A;  4A76 A;  2ZTE A;  3H6M A;  5E3F A;  2A6E C;  3BDL A;  5C44 B;  1FR3 A;  3VDY A;  3GP7 A;  4U67 3;  3O13 A;  3C1F A;  4KKT A;  4DV4 Q;  4LUO A;  1YIJ A;  1BXT A;  1BCP B;  4ZLT F;  1DCZ A;  4A3G H;  4A3G G;  5KYL A;  4L5S A;  4YWM A;  2N55 A;  3K7A B;  2KCC A;  4HSP A;  4FF3 A;  2B2Y C;  2X6G A;  1NMF A;  3HOY H;  3FKI G;  1VQE A;  5JOB A;  3K7U C;  3U4Z A;  1RD9 D;  3OW7 A;  3TP5 A;  1QNK A;  3AB9 A;  2UUA L;  4XXE A;  1AE3 A;  1DM0 B;  3GTL H;  4XTC S;  2PW5 A;  1AZQ A;  3OIP A;  2LY7 A;  1PTO F;  1SE8 A;  3BZK A;  4QUF A;  1PV4 A;  3GTP B;  1KAW A;  1W6J A;  1DOM A;  3H0G G;  1GUO A;  2F0F A;  1WCM G;  3F2B A;  4UP9 A;  1MJE A;  4IOA A;  4BXX H;  4B3R L;  1L1O A;  5GAH C;  4DUZ L;  4A75 A;  1FJG Q;  1I6H H;  4TSS A;  2XWB B;  3UDX A;  3PMF A;  1CK1 A;  2JA7 H;  3S1M B;  2JA7 G;  4OO1 I;  1IW7 C;  1DJR D;  3EFX D;  2L15 A;  2WKC A;  2HCC A;  4C1N I;  1A15 A;  3K5M A;  4BA1 I;  5I4D A;  1EY9 A;  3EJI A;  1D8L A;  4GZY C;  1OTC A;  3Q23 A;  5FLM G;  2HCI A;  3F1Z A;  4KJN A;  3MAQ A;  1GKH A;  3S17 H;  2EY6 A;  2B2U A;  3FVQ A;  4X66 L;  3TRZ A;  1KIX A;  1JC7 A;  3PO2 B;  4KK7 A;  5CV6 A;  1Z47 A;  1IL8 A;  4P75 A;  4ZKB B;  4JPB W;  2UUA Q;  3MEH A;  1Y1W B;  1UNS A;  3E6Z X;  1VCI A;  5CR3 A;  4YCU A;  3HKZ B;  1GM5 A;  1WTR A;  1I3Q H;  3EQL C;  1BCP D;  2E2J H;  1KQS A;  4BY1 B;  2SEB D;  2UU9 L;  4IUT A;  1U4L A;  3KLS X;  3UI2 A;  3Q8D A;  3RLO A;  1SBB B;  3GQB A;  4GNX C;  1AFP A;  3NP8 A;  2OQK A;  5JJK A;  2FMC A;  2IT1 A;  5C0X H;  3VA5 A;  4XQQ A;  4B3R Q;  3FRP B;  4DUZ Q;  5EQ0 A;  3VR3 A;  2NVT H;  4B3T Q;  1PTO B;  2KUM A;  4C2M B;  5JJI A;  1V9P A;  3X3M A;  4PMB A;  4XT3 B;  1LTS D;  4DNR B;  1CA5 A;  3J81 j;  2A5H A;  2XSC A;  3NTH A;  1JIC A;  4DV6 L;  1G29 1;  2YTX A;  1QOH A;  4K2K A;  2RSO A;  3I4L A;  1XXG A;  1F2L A;  2Z4I A;  1JOK A;  5KNC A;  4KHV A;  1TWF B;  4X66 Q;  1HTP A;  4LF7 L;  3CHB D;  2A68 D;  1SFO B;  2YYZ A;  4POG A;  1OO9 B;  3HGB A;  2PZU A;  1RKN A;  4XYQ A;  4BY7 G;  4RCO A;  3SVM A;  1L1O C;  3FEW X;  1Y8O B;  1A8V A;  4IO9 A;  1JJ2 A;  1GVP A;  1IL2 A;  3SEB A;  5TSS A;  5M3F B;  3NHH A;  3DWA A;  5KEE A;  2UU9 Q;  1U4P A;  1LTL A;  3I4N H;  3I4N G;  3BYT B;  1Q12 A;  1I50 B;  1E7Z A;  3I4M B;  2OQ0 A;  4KJO A;  5C0X J;  1OXU A;  3P7J A;  3OW2 A;  2MO1 A;  1Q1E A;  3TEH B;  1K73 C;  3S1Q H;  1X55 A;  4BA2 I;  2M00 A;  1HR0 W;  4OX9 L;  4OIK A;  4A3J B;  1TQO A;  1ENC A;  3H91 A;  3HOZ H;  4X3U A;  4QJF A;  3LWE A;  1EY5 A;  2IJ0 A;  5HGT A;  5C4X H;  3GO5 A;  5C4X G;  1TWC B;  4KD3 A;  4DR3 L;  4DV6 Q;  2E74 C;  5JPN C;  4BBS H;  4BBS G;  4X65 L;  3J7Y W;  1HA5 A;  4BBR B;  1Y1V H;  4LF7 Q;  1V1O A;  5I2Y A;  2N78 A;  4FYD A;  1EFW A;  3OWE B;  1EYA A;  4IFD H;  4X6A H;  3R2I A;  3P75 A;  4IFD G;  2EE1 A;  3A0J A;  4ZCK A;  3M3Y H;  4ID6 A;  2PPB C;  4XDX A;  3NUC A;  1TU2 B;  5BN4 A;  3NSW A;  4JW0 A;  1K28 A;  2OT2 A;  3PUY A;  4QB4 A;  3VYR A;  3KUP A;  4P73 A;  1E24 A;  2NTS A;  4C3H H;  3J81 c;  3C3L A;  1JOR A;  4ZAI A;  1HFN A;  4RWS C;  3RLN A;  1IYU A;  4R4Q A;  4DAY B;  2B2W C;  3EN2 A;  2VUM B;  1FNU A;  1H9K A;  3AQQ A;  4QIW E;  4MTN A;  1X3P A;  4QY7 A;  1VQ7 A;  4FP5 D;  1D6E C;  3HOU B;  3T13 A;  3NWT A;  2XGT A;  3V2T A;  2ID0 A;  1CKN A;  2YTY A;  1Z7T A;  4EGV A;  1AEX A;  1FGB D;  4OX9 Q;  4YHH L;  2BDN A;  5IYC H;  5IYC G;  1I94 L;  1GJX A;  2NVY B;  5D3I B;  1KDB A;  1STA A;  4DR3 Q;  2O5I C;  4GOP A;  2QIL A;  3I7F A;  1IBL L;  1VQ5 A;  4OWX B;  1WTP A;  5G3L F;  1S5F D;  3UDI A;  2JA8 H;  1D1I A;  2JA8 G;  2EJM A;  4JG2 A;  4X65 Q;  3S1R H;  2NVX H;  4M8A A;  4HIK A;  4IOC A;  1LTB D;  1SN8 A;  2NN6 G;  4C3I G;  2AQ3 B;  3L7Z C;  2BA1 A;  3E0E A;  2KQ3 A;  4IFD J;  3HOW G;  2VY3 A;  2QCP X;  4HSV A;  1M90 C;  4HAE A;  4KHZ A;  5JPM C;  2ZTD A;  2F0D A;  4JOI A;  2DUD A;  2K5V A;  3VR5 A;  3S14 H;  2ZM6 L;  4A3G B;  1PRT C;  3VA7 A;  3K7A H;  4LF6 L;  1A3T A;  5FKA C;  3A7L A;  3K5N A;  4E6I A;  2D0O A;  4IPH A;  3FKI B;  3BS1 A;  3HOY B;  3BG3 A;  1EL0 A;  2KHS A;  4GKK L;  3N52 A;  1N34 L;  1V8Q A;  3S1N H;  5C3E H;  1UE1 A;  4KKU A;  5C3E G;  3RR5 A;  3GTL B;  4B3M L;  1E3P A;  4YHH Q;  1K0S A;  2IL8 A;  3KLW A;  3CME A;  1I94 Q;  2UUC L;  1PLF A;  3EVQ A;  1LT3 D;  1G2T A;  2EZV A;  5ELN A;  3OMG A;  1N33 L;  1ZKO A;  2OTJ A;  1WFQ A;  5C4J H;  3CP0 A;  3VR6 A;  3OTO L;  1IBL Q;  3H0G B;  1LUZ A;  2L0C A;  3QG1 A;  2EDG A;  2MNA A;  4P72 A;  2F0Q A;  2FFK B;  3Q6S A;  2A6H C;  4PV1 C;  5D14 A;  1ENF A;  1PFB A;  5L37 A;  1I6H B;  2N3S A;  1EU3 A;  2E5L L;  3R3O A;  1X3G A;  2K5N A;  2JA7 B;  3I73 A;  4ME5 A;  5LHY 1;  1VQ6 A;  3A5U A;  1EYC A;  1TWA H;  4RKB A;  1YBY A;  5DM6 3;  3QOL A;  2WKD A;  3U50 C;  1FD7 D;  4B9W A;  2MP1 A;  3KF6 B;  1VQL A;  4X3S A;  4FF4 A;  3M4P A;  4C3J H;  2ZM6 Q;  5A35 A;  4C3J G;  3IL8 A;  3T16 A;  2O5J C;  3BVG A;  5E4W C;  5DM7 3;  4KN7 C;  1Q8K A;  3MZ5 A;  3S17 B;  2L5T A;  4LNQ A;  2LFN A;  5K36 G;  1B44 D;  1EWI A;  2AHO B;  1CHQ D;  1UWV A;  5D65 A;  3MWY W;  2PQA A;  1NR4 A;  4GKK Q;  3BDO A;  1EOT A;  1RCV D;  1SR3 A;  1N34 Q;  2JA6 H;  2JA6 G;  4ILW A;  3RZD H;  1HXY D;  3P20 A;  2K52 A;  4U68 A;  1PTO C;  4B3M Q;  1MSH A;  4P2C B;  1GUT A;  3QOJ A;  3R93 A;  1FNV A;  1U9R A;  3HG9 A;  5IP9 H;  5IP9 G;  4DR5 L;  1EIY B;  4GN5 A;  1BDO A;  2G9H D;  2E2J B;  4DR1 L;  3ONA B;  1XX8 A;  2EQS A;  3U4V A;  1N33 Q;  1RHP A;  4EQO A;  3A8K E;  3OTO Q;  2MUY A;  2ZJP A;  2V4D A;  2IX3 A;  2YU9 H;  2UXB L;  2RVL A;  4R4T A;  1CZW A;  4WFN 3;  3BJU A;  5COR A;  1VQC A;  2EYP A;  2NVT B;  1R4P B;  2E5L Q;  2QEJ C;  1T9H A;  2I5M X;  4DV3 L;  3HOX H;  3HOX G;  1O78 A;  2F0N A;  1VQJ A;  1V1P A;  4KD4 A;  4DR4 L;  1PDQ A;  4WRD A;  4JI3 L;  5JEA G;  3J80 E;  4FXK C;  4KI0 A;  2CVR A;  4OL7 A;  4DA2 A;  2KEE A;  3DUZ A;  5ELC A;  2XRQ D;  3CCS A;  3IFD A;  4X3K A;  2HD3 A;  3DWQ A;  3EBE A;  4A3I G;  5BN3 A;  2F4V L;  3L9A X;  2FMM A;  1PH7 A;  4X3T A;  4HJ7 A;  1EY8 A;  4QL5 A;  1O80 A;  5JAV A;  1Z6H A;  1SYE A;  2JXM B;  4LWC A;  4UHV A;  2RF4 A;  2F0V A;  1N36 L;  5GAG C;  5G3L D;  1RTO A;  1XJV A;  2ZJR A;  4DR5 Q;  2VXW A;  4DR1 Q;  3CRK C;  4RKL A;  2YTV A;  4JI1 L;  1EU4 A;  1JQY D;  4L8J A;  3I4N B;  1E1O A;  2B39 A;  2CWA A;  2F0G A;  3PUW A;  4JBK A;  1VMC A;  1CI3 M;  1MI2 A;  2J4X A;  1NCV A;  2UXB Q;  2A73 B;  1PVO A;  1D1K A;  3ULL A;  4XQN A;  3K6O A;  4OO1 H;  4OO1 G;  3MXG A;  3PSI A;  3S2H H;  1TWG H;  5EPL A;  3S1Q B;  4DV3 Q;  2BOS A;  2C5C A;  1SYB A;  4HCS A;  1QVG A;  2CWP A;  3PGZ A;  4X62 L;  3I70 A;  1KTK A;  4CDF C;  1D2B A;  5FK9 C;  1YJW A;  4DV0 L;  4DR4 Q;  5AFW A;  3MC0 B;  5C4X B;  3B6Y A;  3DXJ C;  3NBH A;  4JI3 Q;  3PV0 A;  1L0W A;  3E0J A;  3VR2 A;  1ZYR C;  4FVM A;  4BBS B;  3GTK H;  1NTG A;  1BCP F;  5IGB A;  1XPO A;  1Y1V B;  4MTK A;  5NUC A;  2F4V Q;  3LWU A;  1HUN A;  4JI7 L;  3RZO H;  1TY2 A;  2MQH A;  1KAA A;  1BBW A;  1R4Q B;  3PIP A;  1IYV A;  4GN4 B; 
#chains in the Genus database with same CATH homology
 3NTI A;  3M3Y B;  3JAM E;  1A2T A;  5EBC A;  2JEB I;  4KN4 C;  4K8I A;  4EQP A;  3SHL A;  2H4O A;  1PZI D;  3R8B A;  1SJH D;  2AQ2 B;  4RGM A;  1SJE D;  3HS0 C;  3I3C A;  1Y8N B;  2EYM A;  1QCB D;  5CC4 A;  3V05 A;  4EVO A;  4NDX A;  4CKE A;  5FO8 B;  2BE5 D;  1K8M A;  4EQN A;  2PW7 A;  2A74 C;  1VF5 C;  2DNE A;  2JA8 B;  1ESF A;  3S1R B;  5C4Z A;  2NVX B;  3BVZ A;  5CV8 A;  2EYF A;  3PIP 3;  4HTH A;  1X32 A;  3GTJ B;  1VDZ A;  1XWE A;  3A54 A;  3TZU A;  3Q22 A;  3S14 B;  1SE4 A;  1GXD C;  4PMC A;  3MFG A;  3SDZ A;  4DK1 A;  3A7A B;  5K5P A;  3OHX C;  3R2T A;  1SMY D;  1F9R A;  4G7O C;  3S1N B;  5C3E B;  2DNC A;  4G7H C;  4M1U B;  1NUC A;  5EKK A;  1GUN A;  1KAB A;  4CHT B;  4IUQ A;  4K8J A;  3ZYY X;  1M8A A;  5C4J B;  3BZD B;  4N9T A;  5CV4 A;  2PYK A;  5T1I A;  2EXZ A;  2X6L A;  3URY A;  1JOO A;  1GOZ A;  5CYU A;  3SK4 A;  1TWA B;  4LK1 C;  2F0T A;  1LT5 D;  2J7Z A;  4TQU S;  5CBA E;  3IAY A;  1OXX K;  5EKI A;  5EGT A;  4C3J B;  5KGU A;  2EYJ A;  1EWH A;  3M7G A;  4XIG S;  3D4D A;  4XT1 B;  1RDP D;  4TRD A;  1ET9 A;  4DXG A;  2JA6 B;  3D3R A;  3RZD B;  2XWJ B;  1EWC A;  1PZK D;  1KDC A;  3CRL C;  2IX1 A;  2D62 A;  3F2U A;  1X3Q A;  1STY A;  1IHZ A;  3NQI A;  3D4W A;  1LT6 D;  3RD4 A;  4WJW A;  2EJF C;  2JP1 A;  4RA8 A;  3QB3 A;  4LAA A;  5T1G A;  1LO5 D;  5CGK A;  2YU9 B;  1O7L A;  1UUP A;  2QKI C;  4RGN A;  3KF8 A;  3MXU A;  1A6X A;  1YNJ C;  3BYY B;  2RKS A;  3HOX B;  1ML0 D;  3P1H A;  2B2W A;  4ZQ3 A;  5J1Z A;  4IAL A;  3ERQ A;  1SSO A;  1JE4 A;  1QG7 A;  1AP0 A;  1Q3L A;  1F2M A;  3H3V C;  1B3A A;  2A69 C;  2O4X A;  4L6T B;  4BWG B;  3DHQ A;  2SNS A;  3U9S A;  2SOB A;  1AN8 A;  4DXF A;  3DEP A;  1AZP A;  2AUK A;  2HUG A;  3OWF A;  2VB2 X;  4IN3 A;  2VB3 X;  1SYD A;  3KLR A;  3S2H B;  1B1Z A;  1TWG B;  4K5W A;  4K6L A;  2WV6 D;  3T56 B;  1SAP A;  1V43 A;  5LL6 X;  2DY8 A;  2C9O A;  4KY6 A;  1CA6 A;  5I6Y A;  3U9O A;  3Q24 A;  2ICI A;  3S9W A;  2QDB A;  5DAU A;  1SYF A;  3GTK B;  5FLX L;  1G8Z D;  3BVM A;  1G2S A;  1DOK A;  3RZO B;  3OOC A;  2F0H A;  1O7Y A;  2MHV A;  4PQX A;  4FF1 A;  3TP6 A;  1E2W A;  4FNF A;  4C1N K;  1OXV A;  4FXG C;  3MVV A;  1TVX A;  4DN4 M;  1I4X A;  3E5S A;  4J8Q A;  1T5E A;  3SK6 A;  1CQF A;  1SND A;  2G9D A;  3ND8 A;  3SK8 A;  1EEI D;  4F8M A;  2K33 A;  2K5W A;  1VF7 A;  4NKL A;  1BR9 A;  4MIU A;  1I4R A;  3KBG A;  1F9S A;  5CV5 A;  1BCP C;  2F03 A;  5CV9 A;  2CHB D;  2NVQ B;  5E4X A;  4KV6 A;  3CU7 A;  2NN6 H;  3QO2 A;  3VYU A;  2RDF A;  3WDN A;  4OIJ A;  4YIJ A;  5A2Q L;  1HPC A;  3A8J E;  2KVM A;  1EEF D;  5IGF A;  5C0X I;  1AW7 A;  1H9S B;  2RBM A;  5FO7 B;  3G6J B;  3J81 E;  2EJG C;  2R92 B;  1FNW A;  1NSN S;  2A68 C;  2LKV A;  5ELD A;  5M5W B;  2HDM A;  2F0J A;  2CW0 D;  4NP5 A;  1WCM B;  2SDF A;  4CKC A;  3TBI B;  5C5M A;  4AYB B;  1QNU A;  2D9U A;  5DNF A;  4RFB A;  2EY2 A;  1NR2 A;  1PFM A;  1B9N A;  5ELB A;  2EYL A;  3WOF A;  1J8I A;  1GUW A;  1F9P A;  1JWU D;  2RA4 A;  4KMU C;  1YNN D;  2E75 C;  1Q8I A;  2B2T C;  5C4H A;  2K01 A;  5K36 H;  3NE5 B;  4HN7 A;  1EZ8 A;  2F0W A;  3SK5 A;  3J80 L;  1K83 B;  4C56 C;  1C8C A;  4A3K B;  1OXT A;  4LJZ C;  4RGO S;  3OSO A;  4O1N A;  3ITP A;  3GV3 A;  1EQV A;  4HMI A;  2E2D C;  2IPK D;  4DAY A;  3FMC A;  1SNO A;  2Q8T A;  1BBX C;  5BN5 A;  1UAP A;  4K6D A;  4R9W A;  3TME A;  4Q5V A;  3HEJ A;  1F9Q A;  3K57 A;  1TS2 A;  2LS0 1;  5ELE A;  3C1E A;  3FPU B;  1HA6 A;  3PUV A;  5JEA H;  4RGT A;  1ICW A;  2FIN B;  2L11 A;  2Z8L A;  5KRU A;  2A6E D;  1I4Q A;  1WD1 A;  2PQE A;  4QUC A;  3M4O B;  1B9M A;  1XTC D;  4ZK9 B;  3A55 A;  2F0I A;  1SNQ A;  4BY7 B;  3LNN A;  4PMW A;  1EY0 A;  2F0M A;  4N9P A;  2KED A;  2JYO A;  4CGY B;  5ELF A;  5IOD A;  1STE A;  3MTS A;  2BA0 A;  1K8O A;  1JWS D;  1CQV A;  5I6W A;  1WTX A;  3IKJ A;  4ZYS A;  2QF7 A;  1WTO A;  3OIQ A;  2I46 A;  1IKL A;  3I72 A;  4KY5 A;  3EA6 A;  4G4K A;  4ODG A;  1IW7 D;  4G57 A;  3A56 A;  4J1M A;  2M9V A;  5IT9 L;  2K32 A;  1FYC A;  5JEA J;  1TWH B;  4A3M B;  3TSS A;  3NQT A;  1EY6 A;  2F1M A;  3NK9 A;  3S2D B;  1S5D D;  1TS3 A;  2K5Q A;  5JVG 3;  1T5X D;  5IGC A;  5KIX A;  1I4G A;  2RDH A;  3MXP A;  1ZXT A;  3K5L A;  1EIG A;  2XN9 C;  1G6Z A;  4IUP A;  1STG A;  2OF1 A;  2XNA C;  5EJW A;  4UAI A;  2E2I B;  4QMG A;  3GTG B;  2EYH A;  1EY7 A;  1Q1B A;  5FO9 B;  1RF2 D;  1I6V C;  4IUV A;  5EPJ A;  1LT4 D;  2R61 A;  4B08 A;  4IZ8 A;  3W3A A;  2BCO A;  2AWN A;  1C4Q A;  2L4N A;  4LMQ D;  2L12 A;  3VYT A;  5M5X B;  4B9X A;  2AQ1 B;  1HCZ A;  3G7L A;  3D6C A;  4MHE A;  3CQZ B;  3GV6 A;  4FF2 A;  3WOE A;  3NBI A;  4F7X A;  4C3I B;  1II3 A;  1F2Y A;  4HCE A;  1HRJ A;  1QB5 D;  1CTM A;  3FPP A;  1EFI D;  3HOW B;  4K5X A;  4FO2 A;  2K03 A;  1PFN A;  4FXD A;  1QJO A;  2TMP A;  3W2D A;  2NZ1 D;  3DMU A;  1BNZ A;  2H1E A;  4K5V A;  4V19 0;  2MGS A;  1DZ1 A;  1STH A;  2WAC A;  3J7A V;  4I7Z C;  1MBY A;  4DFA A;  1A2U A;  3D4R A;  2R7Z B;  1LTR D;  1TKW B;  1ZEQ X;  5DEH A;  5HUR A;  4F87 A;  2KOL A;  4L63 B;  4DNT B;  2OXP A;  4BS9 A;  4CJ1 B;  1RJT A;  2JA5 B;  3IFT A;  4H7B A;  1ILQ A;  1PRT B;  1E2V A;  1WD0 A;  5J39 A;  1PYW D;  4KY7 A;  2PO4 A;  3NWS A;  1CFM A;  1EQT A;  4MN3 A;  2HQE A;  3D31 A;  3OMC A;  1SE2 A;  2F0E A;  3H09 A;  3K58 A;  2VNU D;  4V0B A;  2IW3 A;  3VR4 A;  3D6W A;  4HED A;  1WTW A;  1TII D;  1ENA A;  3PO3 B;  3TP7 A;  1BOS A;  4RAU C;  2R6G A;  4I65 A;  2BDO A;  2IX0 A;  1EIH A;  2HDL A;  2AUJ D;  2FJ2 A;  1DYQ A;  1H9M A;  1VMP A;  2RQX A;  2KEC A;  4KTA A;  4OGQ C;  2FHT A;  4ZKC B;  1J9O A;  1B53 A;  1WVL A;  4CBV A;  3TP8 A;  5C0X G;  4PNY A;  1JR0 D;  3SXH A;  3GTM B;  1GUG A;  1LTA D;  1MSG A;  2K1B A;  3HP3 A;  1B50 A;  3K0Y A;  4A3B B;  2BE5 C;  3RMH A;  5FOB B;  3L3O C;  1Y8P B;  4A3I B;  1I4P A;  1GHK A;  3NXW A;  2Q8R E;  1PRT D;  4ZUJ A;  2NTT A;  4IUU A;  1PXU A;  2B8F A;  4UDU C;  1QIL A;  4RHR A;  2IWH A;  1DOL A;  4Y7N B;  5KYI A;  3M85 A;  3HRZ C;  4DF7 A;  2L9H A;  2SNM A;  2PZW A;  1CM9 A;  1DD2 A;  1LLR D;  2F0K A;  1KLG D;  3MFY A;  4RHS A;  4A3E B;  1SMY C;  1O7Z A;  1ILP A;  2A6H D;  5I2X A;  4J6H A;  3PUX A;  1L0X B;  1LV9 A;  4Z9C B;  3M7N A;  4CKB A;  1R9T B;  3OPO A;  1JWM D;  1HFG A;  1H9R A;  1LAB A;  4OHJ A;  5C3W A;  5KND A;  1STN A;  2D5D A;  2L1B A;  4IQZ A;  4XYO A;  2B2U C;  5CBE E;  5IGE A;  1UEA B;  1Y69 U;  1JOQ A;  1CZG A;  3MA2 B;  3A8I E;  2R3Z A;  2JE6 I;  3T4A C;  5EPK A;  5C6A A;  1PTO D;  1LAC A;  3QWN A;  3K59 A;  1SYC A;  3AMU A;  4R8N A;  4R8I A;  2K04 A;  1KLU D;  4DK0 A;  1WTV A;  1QWY A;  3QIA A;  1DON A;  2WII B;  1BUV T;  2J0T D;  3TZD A;  2RDG A;  3J81 L;  4C3H G;  1Q90 A;  2B2T A;  4K14 A;  1SNP A;  2R93 B;  2K7V A;  1SNC A;  3LX0 A;  3PUZ A;  1GUS A;  3PIO 3;  2F0S A;  2ZXO A;  1CT1 D;  5C5L A;  4TKO B;  1KNA A;  2B2V A;  4Q0F A;  5IOC A;  2NB0 A;  1HQR D;  2F0O A;  1S5E D;  2EOT A;  2CQA A;  1SNM A;  1S4Z A;  3HZX A;  5FLX E;  1D5M C;  1ESR A;  2WB1 B;  1U4M A;  3KLS A;  1V1P B;  2B8G A;  4ZRZ A;  2MPM A;  4QCL A;  1U4R A;  1SE3 A;  4DU9 A;  4CJ0 B;  2WAQ B;  2F0L A;  2RSN A;  4IUN A;  2NBF A;  3AU7 A;  2F3W A;  3K5O A;  4JBW A;  2WIN B;  2KCN A;  2PCF B;  3J7A F;  2XRS D;  5EBD A;  1RTN A;  2AWO A;  4DAV A;  5IGG A;  3TDQ A;  5JJZ A;  4H0L C;  1MGS A;  1H9J A;  1B2T A;  1GHJ A;  1JB3 A;  3SR1 A;  4IUR A;  2XIW A;  1BO0 A;  3N6R A;  5M9O A;  2K6A A;  2NUC A;  2TSS A;  5E1F A;  3C46 A;  1EY4 A;  1SEB D;  3RLF A;  2DY7 A;  4G7Z C;  2PNR C;  2LMC B;  1ZYR D;  2NWG A;  2WP8 J;  2JSO A;  4A93 B;  2KA7 A;  5JVH 3;  3RUZ A;  1MD2 D;  4KKS A;  5A2Q E;  1XYI A;  1SXT A;  5C3X A;  3D8G A;  2I07 B;  1KDA A;  2D2C C;  5F2D A;  1D5X C;  3ERO A;  5LL6 S;  3DWP A;  2ZXR A;  1PMR A;  4QF4 A;  4ABN A;  1S5C D;  1KNE A;  3M4Y A;  4XQJ A;  4A3D B;  3S16 B;  3T51 B;  2B2V C;  4H44 C;  1F77 A;  1BQQ T;  1STB A;  4S3S A;  2PMZ B;  3I91 A;  3NPP A;  3TN2 A;  2ICE C;  5M3M B;  1PZJ D;  3HOV B;  4IFD I;  5CMD A;  3GD7 A;  2F0P A;  4A3F B;  1D5Z C;  3DEO A;  5I9O A;  2EPB A;  2JEA I;  4F88 A;  1I3Q B;  1G91 A;  4JK1 C;  1F2Z A;  2EY1 A;  2GA4 B;  3NTK A;  1E0B A;  5D3D A;  2MJ8 A;  1PTO H;  3FDT A;  1ONL A;  3C2P A;  3S15 B;  1NAP A;  4HR7 B;  3T53 B;  2B63 B;  1TS5 A;  2F4I A;  1BF4 A;  1TR5 A;  4ULL A;  2K28 A;  2X69 A;  2PZT A;  2E76 C;  1H9S A;  3X3N A;  1A3V A;  2DN8 A;  3MXN A;  4DGZ A;  1IKM A;  5M5Y B;  1QE6 A;  4RCN A;  4NW2 A;  1TT2 A;  1HHV A;  5EKL A;  2ZT9 C;  2Y0S B;  3JAM L;  2NN6 I;  3QJY A;  1WTQ A;  2E2H B;  4K2L A;  1HTL D;  2F3V A;  1I4H A;  1M4V A;  1LTI D;  2EVB A;  1TS4 A;  1W6K A;  2NYZ D;  3I8Z A;  3H94 A;  2K5D A;  1JCK B;  1E2Z A;  5COY A;  1S5B D;  1A3U A;  2CW0 C;  3HOZ B;  2B2Y A;  3V96 A;  2L55 A;  1SDF A;  1TY0 A;  1B4O A;  1OXS C;  5J22 A;  4RH6 A;  2N88 A;  3BDC A;  4CJ2 C;  3ND9 A;  3GTQ B;  2F0U A;  2ZXP A;  2KJX A;  2O2L D;  1YNN C;  3KBX A;  3KK7 A;  3MHB A;  2Q8I B;  1SYG A;  4C3H B;  4HMJ A;  4DAP A;  2M2L A;  3GTO B;  4WOR A;  2EYO A;  2Z1C A;  4H13 C;  2XVS A;  1PRT F;  1YNJ D;  3Q0A A;  5IIF A;  5IGD A;  1C48 A;  1DXM A;  1ROD A;  1ET6 A;  1CHP D;  2Z4H A;  1HQM C;  3SE0 A;  2OEO A;  5IT9 E;  1LTG D;  4NMZ A;  1EZ6 A;  3VYS A;  4QIW B;  3I90 A;  3CKI B;  2K05 A;  1L0Y B;  2EY5 A;  2A69 D;  5ISR A;  2ENB A;  3DM1 A;  1LTT D;  4ZUI A;  5KNB A;  1HUM A;  5CV7 A;  4O42 A;  1EYD A;  5I9P A;  3H6M A;  5E3F A;  2A6E C;  3BDL A;  5C44 B;  1FR3 A;  3GP7 A;  4U67 3;  3O13 A;  3C1F A;  4KKT A;  1BXT A;  1BCP B;  4ZLT F;  1DCZ A;  5KYL A;  4FF3 A;  2N55 A;  3K7A B;  2KCC A;  4HSP A;  2B2Y C;  2X6G A;  5JOB A;  1RD9 D;  3OW7 A;  3TP5 A;  1QNK A;  3AB9 A;  4XXE A;  1DM0 B;  4XTC S;  2PW5 A;  1AZQ A;  3OIP A;  2LY7 A;  1PTO F;  4QUF A;  3GTP B;  1W6J A;  1DOM A;  1GUO A;  2F0F A;  4TSS A;  2XWB B;  3PMF A;  1CK1 A;  3S1M B;  4OO1 I;  1IW7 C;  1DJR D;  3EFX D;  2WKC A;  2HCC A;  4C1N I;  1A15 A;  3K5M A;  4BA1 I;  5I4D A;  1EY9 A;  3EJI A;  4GZY C;  3Q23 A;  2HCI A;  4KJN A;  3MAQ A;  2EY6 A;  2B2U A;  3FVQ A;  1JC7 A;  3PO2 B;  4KK7 A;  5CV6 A;  1Z47 A;  1IL8 A;  4ZKB B;  3MEH A;  1Y1W B;  1UNS A;  3E6Z X;  1VCI A;  5CR3 A;  3HKZ B;  1WTR A;  3EQL C;  1BCP D;  4BY1 B;  2SEB D;  4IUT A;  1U4L A;  3KLS X;  3UI2 A;  1SBB B;  3GQB A;  1AFP A;  3NP8 A;  2FMC A;  2IT1 A;  5C0X H;  3VA5 A;  4XQQ A;  3FRP B;  5EQ0 A;  3VR3 A;  1PTO B;  2KUM A;  4C2M B;  3X3M A;  4PMB A;  4XT3 B;  1LTS D;  4DNR B;  1CA5 A;  2A5H A;  2XSC A;  3NTH A;  1JIC A;  1G29 1;  1QOH A;  4K2K A;  2RSO A;  3I4L A;  1XXG A;  1F2L A;  2Z4I A;  1JOK A;  5KNC A;  4KHV A;  1TWF B;  1HTP A;  3CHB D;  2A68 D;  1SFO B;  2YYZ A;  1OO9 B;  3HGB A;  2PZU A;  1RKN A;  4XYQ A;  4RCO A;  3SVM A;  3FEW X;  1Y8O B;  3SEB A;  5TSS A;  5M3F B;  3NHH A;  3DWA A;  5KEE A;  1U4P A;  3BYT B;  1Q12 A;  1I50 B;  3I4M B;  4KJO A;  5C0X J;  1OXU A;  3P7J A;  1Q1E A;  4BA2 I;  2M00 A;  4OIK A;  4A3J B;  1TQO A;  1ENC A;  3H91 A;  4X3U A;  3LWE A;  1EY5 A;  2IJ0 A;  5HGT A;  3GO5 A;  1TWC B;  4KD3 A;  2E74 C;  5JPN C;  3J7Y W;  1HA5 A;  4BBR B;  1V1O A;  5I2Y A;  4FYD A;  3OWE B;  1EYA A;  4IFD H;  3R2I A;  3P75 A;  4IFD G;  2EE1 A;  4ID6 A;  2PPB C;  4XDX A;  3NUC A;  1TU2 B;  5BN4 A;  3NSW A;  2OT2 A;  3PUY A;  4QB4 A;  3VYR A;  3KUP A;  3C3L A;  1JOR A;  2NTS A;  4ZAI A;  1HFN A;  4RWS C;  1IYU A;  2B2W C;  2VUM B;  1FNU A;  1H9K A;  1X3P A;  4FP5 D;  1D6E C;  3HOU B;  3T13 A;  3NWT A;  3V2T A;  2ID0 A;  4EGV A;  1Z7T A;  1AEX A;  1FGB D;  2BDN A;  1GJX A;  2NVY B;  5D3I B;  1KDB A;  1STA A;  2O5I C;  2QIL A;  1WTP A;  5G3L F;  1S5F D;  1D1I A;  2EJM A;  4M8A A;  1LTB D;  2NN6 G;  4C3I G;  2AQ3 B;  3L7Z C;  2BA1 A;  2KQ3 A;  4IFD J;  2QCP X;  4HSV A;  4HAE A;  4KHZ A;  5JPM C;  2F0D A;  3VR5 A;  4A3G B;  1PRT C;  3VA7 A;  1A3T A;  5FKA C;  3A7L A;  3K5N A;  4E6I A;  3FKI B;  3BS1 A;  3HOY B;  3BG3 A;  1EL0 A;  2KHS A;  3N52 A;  1V8Q A;  4KKU A;  3GTL B;  2IL8 A;  1PLF A;  3EVQ A;  1LT3 D;  1G2T A;  2EZV A;  3OMG A;  1ZKO A;  3VR6 A;  3H0G B;  2L0C A;  3QG1 A;  2EDG A;  2F0Q A;  2FFK B;  3Q6S A;  2A6H C;  4PV1 C;  5D14 A;  1ENF A;  1PFB A;  1I6H B;  1EU3 A;  3R3O A;  2JA7 B;  3I73 A;  4ME5 A;  5LHY 1;  1EYC A;  4RKB A;  5DM6 3;  3QOL A;  2WKD A;  1FD7 D;  4B9W A;  2MP1 A;  4X3S A;  4FF4 A;  5A35 A;  4C3J G;  3IL8 A;  3T16 A;  2O5J C;  3BVG A;  5E4W C;  5DM7 3;  4KN7 C;  3MZ5 A;  3S17 B;  2L5T A;  5K36 G;  2LFN A;  1B44 D;  1CHQ D;  5D65 A;  3MWY W;  1NR4 A;  3BDO A;  1EOT A;  1RCV D;  4ILW A;  1HXY D;  3P20 A;  4U68 A;  1PTO C;  1MSH A;  4P2C B;  1GUT A;  3QOJ A;  3R93 A;  1FNV A;  1U9R A;  3HG9 A;  1BDO A;  2G9H D;  2E2J B;  3ONA B;  1XX8 A;  1RHP A;  4EQO A;  3A8K E;  2MUY A;  2V4D A;  2IX3 A;  2RVL A;  1CZW A;  4WFN 3;  5COR A;  2EYP A;  2NVT B;  1R4P B;  2QEJ C;  1O78 A;  2F0N A;  1V1P A;  4KD4 A;  1PDQ A;  4WRD A;  5JEA G;  3J80 E;  4FXK C;  4KI0 A;  2CVR A;  4OL7 A;  4DA2 A;  2KEE A;  3DUZ A;  5ELC A;  2XRQ D;  3IFD A;  4X3K A;  3DWQ A;  5BN3 A;  3L9A X;  2FMM A;  4X3T A;  1EY8 A;  1O80 A;  5JAV A;  1Z6H A;  1SYE A;  2JXM B;  2F0V A;  5G3L D;  1RTO A;  2VXW A;  3CRK C;  4RKL A;  1EU4 A;  1JQY D;  4L8J A;  3I4N B;  2B39 A;  2F0G A;  3PUW A;  1VMC A;  1CI3 M;  1MI2 A;  2J4X A;  1NCV A;  2A73 B;  1D1K A;  4XQN A;  3K6O A;  4OO1 H;  4OO1 G;  3MXG A;  5EPL A;  3S1Q B;  2BOS A;  2C5C A;  1SYB A;  4HCS A;  1D2B A;  3I70 A;  1KTK A;  5FK9 C;  5AFW A;  3MC0 B;  5C4X B;  3DXJ C;  3NBH A;  3PV0 A;  3E0J A;  3VR2 A;  1ZYR C;  4FVM A;  4BBS B;  1BCP F;  5IGB A;  1Y1V B;  5NUC A;  3LWU A;  1HUN A;  1TY2 A;  1KAA A;  1R4Q B;  1IYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...