2K1BA

Solution nmr structure of the chromo domain of the chromobox protein homolog 7
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
EQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the chromobox protein homolog 7.
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
molecule keywords Chromobox protein homolog 7
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k1bA00
1X32A 1KNEA 5DNFA 1EOTA 1NR2A 2N55A 2HCCA 2FHTA 1PLFA 1E0BA 5EKIA 1JE4A 1EIGA 1JICA 2K28A 5EQ0A 3IFDA 2HUGA 4LMQD 1G2SA 1BNZA 4ZKBB 1DZ1A 1X3PA 5E4WC 2B2YC 2D9UA 1AZQA 2L1BA 1SAPA 4X3SA 4X3UA 1PFBA 4IUTA 3I91A 1CA6A 4CJ2C 1HRJA 2B2TA 3G7LA 3ONAB 4HCSA 3I3CA 1NCVA 3MWYW 1SSOA 1GUWA 4QUCA 1F9RA 2L4NA 2B2WA 1ILPA 4X3KA 1HUMA 3KUPA 2B2VC 1HFGA 2MGSA 2K1BA 3UI2A 1LV9A 5T1IA 5COYA 2HDLA 4RAUC 5CBAE 2K03A 1O7ZA 1WTOA 1WTQA 1WTXA 2JYOA 2M2LA 1QE6A 5AFWA 2K01A 3HP3A 5D65A 1X3QA 4CJ0B 4MN3A 5JJZA 3IL8A 2L12A 2J7ZA 1DONA 1ILQA 3GV3A 1Q3LA 2L11A 3I90A 2B2YA 2DY8A 2FFKB 2L9HA 3GV6A 5E4XA 1WTVA 1U4PA 2X6LA 2K05A 1B53A 1XX8A 4U68A 1IKMA 2DY7A 1F9QA 1NR4A 1TVXA 2KEEA 2X6GA 1MI2A 2IL8A 4UAIA 5EJWA 1CM9A 2BDNA 3D6WA 3H91A 3TN2A 4QUFA 1BF4A 2B2UA 1B2TA 1DOMA 2RSNA 1EL0A 4RWSC 2B2WC 1S4ZA 4OIKA 4OIJA 1AZPA 2MP1A 1ICWA 2EPBA 1EQTA 1VMPA 5D14A 3DM1A 1RODA 1WTWA 1HA6A 2K04A 2SDFA 5EPJA 1J8IA 3DEOA 4RA8A 1WD0A 5CBEE 2XIWA 2Q8TA 4IUPA 1U4RA 1G91A 1RHPA 5CMDA 1PDQA 3TZDA 3FPUB 1NAPA 1O7YA 3I8ZA 3N52A 1WTRA 4XT3B 1WD1A 2B2VA 1QG7A 1ZXTA 3P7JA 1EIHA 1IL8A 1VMCA 2MJ8A 4ZLTF 1KNAA 2B2UC 1CA5A 4X3TA 1U4LA 1PFNA 4IUVA 1XYIA 1B4OA 1SDFA 4IUUA 4XDXA 2JP1A 3DEPA 1C8CA 1MSGA 1MSHA 4IURA 3FDTA 1DOLA 4NW2A 5T1GA 3Q6SA 3F2UA 1F9PA 1M8AA 1HFNA 1B50A 2HCIA 2NYZD 2KECA 1MGSA 2KOLA 1ML0D 2X69A 1ESRA 1WVLA 2H1EA 1A15A 2EOTA 3LWEA 4ZAIA 1O80A 1G2TA 1RTOA 2KVMA 4O42A 4DN4M 2KUMA 5CORA 2EE1A 4CJ1B 2KEDA 2VXWA 1BBXC 1PFMA 2MPMA 4IUQA 5EPKA 3SVMA 4XT1B 1IKLA 5EPLA 4R9WA 2NZ1D 1BO0A 2Q8RE 4MHEA 1F9SA 2HDMA 3QO2A 1J9OA 1F2LA 1HHVA 4HSVA 3R93A 3KBXA 1HUNA 2FINB 1DOKA 4R8IA 3MTSA 4ZKCB 1U4MA 2CVRA 1B3AA 2FMMA 2RA4A 4ZK9B 1G6ZA 2RSOA 4HEDA 2FJ2A 2NWGA 4HAEA 2RVLA 1RTNA 2N88A 1WTPA 1QNKA 1AP0A 2R3ZA 2B2TC 1RJTA
chains in the Genus database with same CATH superfamily
3I70A 4L5RC 5EQ0A 4POGA 3EFXD 2EVBA 3VYUA 2RCNA 4IQZA 1ENAA 4RHRA 3BVZA 5LMNQ 5FLXL 2EQSA 3WWVA 4HN7A 1NMFA 4JOIC 5JVG3 3DUZA 2PMZE 3M7GA 3RLNA 1CSQA 2XN9C 3S9WA 5M5YH 1KLGD 2FXQA 5JEAJ 2PCFB 1PH8A 1Q46A 5HY6A 2HQEA 3PF5A 1VQJA 3W5OA 1H9KA 4JV5L 3RUZA 3PIPA 1YJNA 3NTIA 1WFQA 5A2QL 3SK5A 2ALYB 3CCSA 4NB3A 5DM73 1JCKB 2B39A 3SDZA 1VMPA 3EJIA 1PH7A 2F03A 3DM1A 4H44C 3CCMA 2QDLA 4CDEC 5M9OA 4DV3Q 2HQLA 4IZ8A 2A1AA 3KOJA 2VB2X 2UXDL 1EY8A 2F0LA 1CA5A 4IUVA 3NE5B 1RCVD 1GM5A 1SXTA 4A3LG 1K3RA 3DEPA 2A69D 4C3HB 3FDTA 4J6HA 5T1GA 4DV0L 3Q6SA 4PZ7A 3S1RB 2QGQA 2ZXPA 4RCNA 2IX3A 2E2IH 1VQEA 3KJPA 1JB7A 1IYUA 4OO1H 1CKNA 2A6ED 4BA1I 4JI3L 4LJZC 1EQQA 2DNEA 4KI0A 1FJGQ 3CXCA 4GZYC 1X55A 1JJGA 3A0JA 3SVMA 3D4WA 3PCOB 2RHSB 5J22A 3DMUA 4G7HC 1F2LA 4FF1A 1VCIA 2CVRA 1AEXA 1Y1WB 1PH2A 2FJ2A 5IGFA 4O0AA 1VF7A 2HD3A 2E76C 2ES2A 4A93B 3AYHB 3GTJB 2H5XA 4H13C 2JA7B 1EOTA 3HKZE 3S16H 4FYDA 1L0XB 3MFYA 1SLJA 5M3MB 2MQHA 5C44G 1TS3A 4K6DA 1FGBD 4DR7Q 1HZBA 2R7ZB 4QB4A 3NEMA 4YHHQ 3RZDH 3NXWA 4DV0Q 2K1BA 2K32A 5HGTA 3KDFA 5CBAE 1O7ZA 1B7YB 5D65A 2OWOA 1E22A 1YEZA 1RIPA 4AYBB 4DNRB 3VR5A 5E4XA 4PZ8A 5ELDA 2EXZA 1CK1A 1GKHA 1OXTA 3D8GA 4EVOA 1PV4A 4MTKA 1HNXL 5LMUL 1QCBD 1CM9A 4K6LA 3M7NA 2E74C 5JPMC 2PI2E 1R4QB 4DXGA 4RMFA 3STBD 4C3JH 1JT8A 3A8KE 3G71A 5CBEE 1N36L 2UUCL 4JI6Q 3GTKH 1VQMA 1O7YA 3I8ZA 1CQFA 4C3IB 4L8JA 2PQAA 4DV7Q 4LUZA 3WOFA 1NY4A 4DK0A 4K14A 5K36G 1KABA 2FMCA 3TZUA 1HA5A 2WB1B 4OO1I 1PRTC 4QMGA 4XYQA 1ML0D 4CBVA 3KFUA 2NVXH 2OT2A 3C1FA 2VS1A 1GD7A 3DXJC 4K2KA 3MAQA 1YNND 2VQFL 1JJ2A 1ENFA 4OL7A 3K0XA 3S1MB 5EPLA 1SNPA 5IP7G 1DXMA 4OGQC 4H7BA 1PTOF 2BA1A 3V96A 5KNBA 3TMEA 4A93G 1XPOA 1X65A 1B9MA 3IAYA 1KHIA 4WJWA 4B3TQ 4DR1L 2QEJC 2AWOA 2VQEL 2F1MA 2RSOA 3EN2A 4OELB 3H0GH 1IXRA 1IYJB 3A7LA 1Q7YC 4OX9Q 3CMEA 2NTTA 2N3SA 2LXJA 4DUZQ 4GOPB 2UUCQ 1SRUA 1QUQB 2EY6A 5F2DA 1CKMA 2RHQB 1QJOA 1SE2A 2A73B 1BNZA 3S2DH 3M4PA 2UXCQ 3QWNA 2L1BA 2MHVA 3KK7A 1TWCB 5IP9H 2M00A 3CCQA 1EZ6A 1LT5D 2B2TA 1E1TA 3OIPA 3I3CA 4FXGC 4X64Q 3SEBA 3HOYB 3S2DB 1PVOA 1YIJA 3GTMH 5IT9E 5C6AA 2E5LQ 3P75A 2QKIC 3BDOA 4J8QA 1W6KA 4P74A 1W6JA 2Z6BA 3A54A 3I2ZA 4DK1A 5JPNC 3AU7A 2LS01 2DY8A 1EIFA 4YCUA 1VQ5A 5JOBA 4DR1Q 4B3TL 2R92G 3FHWA 4HSPA 3KLWA 4R4CA 1Q8KA 2BDNA 5M5WH 1S5FD 3A55A 2B2UA 2CWPA 4LF6L 2C35B 4C3IH 1TR5A 3U4VA 3PO3G 3UE0A 4RGMA 1HR0W 2A8VA 4H02A 5EPJA 3PIP3 1X54A 3D4RA 4A3CH 1YITA 5NUCA 3PQIA 4BBSB 3T53B 4K0KL 2PI2A 1KXLA 1OTCA 2YU9H 2E2JH 3OPOA 1HQMC 5JJLA 2JA5G 3GTGH 1GOZA 4ZLTF 4GLXA 2IT1A 1SDFA 4XDXA 2CKZB 1TWGH 3L0OA 5CV5A 3VYRA 3TEHB 3HOVB 2QF7A 3S1NH 1M8AA 3ERQA 1Z9FA 1B50A 1FJGL 5EBCA 4X66Q 2CQAA 1LM0A 2X69A 1ESRA 2ICEC 4KHPL 1VQCA 3S1NB 1J6QA 4RKLA 1KLUD 1SR3A 5BN4A 4A3JB 2NVTB 4IUQA 2EIFA 2RKSA 4O2DA 1L0YB 2WV6D 1VQ4A 1SFOB 3HOVG 2IW3A 2K5WA 2K5DA 3F1ZA 5FOBB 1IBML 2G5DA 3HOZG 2NN6H 4KD4A 1U4MA 3J7ZC 1Y1WG 2ZXRA 3A7AB 5I2XA 3NENA 1WTPA 1HNZL 3CCUA 2KA7A 2B3GA 3K59A 5DNFA 4H0LC 2J4XA 1PLFA 3S1RH 4A3EG 4ZKBB 1I4HA 3E9IA 3ND8A 3PO3B 1T5XD 3NWTA 4DR7L 4X3UA 1IBKL 4N8FA 3MXNB 4BY7B 3J81i 3TRZA 3HZXA 2NN6I 4M1UB 2L4NA 2B2WA 1S5DD 4C1NI 3L7ZC 4MZ9A 5T1IA 3BZKA 5GAEC 2K01A 1Z47A 3IL8A 2CCZA 5IODA 1R4PB 5LHY1 4AQYL 3GQBA 4DV5Q 4BXXG 4FDBA 5CC4A 2LKVA 2JA7H 3FEWX 1AE2A 4A3EB 3HOXG 4R8NA 4I65A 5IYBH 3AFPA 4P75A 1XNQL 1B9NA 3S1MH 2F0SA 1S5CD 3SK8A 2JXMB 1RODA 2YV5A 1BVSA 4A3EH 1TWFH 1U4RA 3PGZA 4FO2A 3HKSA 5C3XA 4DV1Q 3OWEB 1W2BA 3VR2A 2VQEQ 4K5WA 4X65L 1MIUA 1PFNA 2HHHQ 1CT1D 4A76A 1MSGA 3U50C 3NQTA 1GUNA 2DJFC 2R93B 3H09A 2NZOA 4WJ4A 3F2DA 4OWTB 4XYOA 2KOLA 3I4LA 3TDQA 4JI0L 2H1EA 3HOYH 2O4XA 4C3HG 3CCRA 1I50H 2VXWA 4DU9A 2H4OA 4NKLA 4LFBL 4APVA 1BO0A 1UE1A 1TWAH 1PH3A 2PW7A 1VQ7A 2VUMB 3A56A 5ELOA 3F2BA 3R93A 4UHVA 4BBSG 3H94A 4DV7L 3M4YA 3MTSA 4JV5Q 3K0YA 3M9BA 1JB3A 1NBWA 2A19A 3CMAA 2AQ2B 4DR4L 2D5DA 2R3ZA 1H9SB 2SEBD 2IPKD 4N9PA 2N55A 1JICA 1VQOA 2HUGA 2OTJA 2SNMA 1BCPC 1TS5A 1FNVA 5IGEA 2F0QA 4DR6Q 1BCPB 3QJYA 3G7LA 3ONAB 4HCSA 4HJ9A 1NCVA 1OO9B 1I4RA 2D2CC 3V05A 3RN5A 4G4KA 3I4NB 3EA6A 4GLVB 4EX5A 2K03A 1KRTA 4CJ0B 2ZM6L 4JBKA 4GNXA 3H6MA 3HOVH 4OHJA 1P16A 4P72A 3I4NG 2L9HA 3HOWG 2K05A 3TBIB 3S1QB 1D5MC 4IOAA 1OXVA 1PZJD 3TN2A 3ZJYC 4X66L 4RH6A 4A3JH 5C4JB 3BDLA 2VQFQ 2ZTEA 1Y1VH 2SOBA 1GVPA 2Q2IA 5BR8L 2EJMA 4PMBA 2AUKA 2JA7G 1AFPA 3MZ5A 1JWSD 3W3AA 3I7FA 5CMDA 3S15H 4YY3Q 3GTMB 3A74A 3LWUA 3N52A 3EROA 3ULJA 1IL8A 4PZ6A 3I4MH 1HXYD 5DLQE 3J80c 1I4PA 1EYDA 1B4OA 1LO5D 2JK8A 2JP1A 1VQIA 4DKAC 4C3JG 1VF5C 4A3KH 3CC4A 5IIFA 1EEFD 3F2UA 4B9XA 2UU9Q 3I4MB 4LF6Q 2L0CA 2NYZD 1MGSA 2DJGC 2K7VA 2NVQH 1VQBA 4PNYA 4JG2A 1D2BA 3ULLA 1N36Q 3LWEA 1F77A 1RKNA 1U5KA 4DN4M 2JN4A 2HIVA 1CTMA 2AWNA 1K83H 1DCZA 3CQZH 4YCWA 5EPKA 1XMQQ 3K57A 2NZ1D 1GUOA 4B3ML 1EY9A 2BE5C 4LF4L 2K33A 1PH1A 2F3IA 3RZOB 3OOCA 1HNZQ 1A0IA 4NPSA 3I56A 3CQZB 3TQYA 3R3OA 5KYIA 2OXPA 4YIJA 1TWGB 3J80E 1G8ZD 3TP5A 4B3MQ 2XSCA 1SYEA 1XMQL 2VZAA 3HOZB 1UWVA 4JI2Q 3TP8A 5BN5A 4P2CB 5E4WC 2R92B 3KF8B 3RNUA 4UP8A 4PMCA 4KHPQ 1G6PA 5EAYA 5FO9B 1W3SA 3CKIB 3K7AH 2PZTA 2EYMA 1GO3E 1E7ZA 1SE3A 3E5SA 4CDDC 5JAVA 1S40A 3CU7A 3A5UA 3H15A 1Q86C 3S17H 1WTXA 3D0FA 1QWYA 4JYAQ 5JJKA 1A3VA 4A3MB 4A75A 2ICIA 2J7ZA 1EQRA 3K5MA 3I90A 1QZGA 3S17B 1HNWL 3GO5A 1S5ED 1SBBB 1JQYD 1B53A 2LSSA 4GOPC 2UUBQ 1XX8A 1F9QA 3P20A 1TVXA 4A3MH 4BY7G 2V1CC 4JI0Q 1Y14B 1QVFA 2WACA 3DWQA 4A3BG 2WP8J 3NUCA 1TY0A 1TIID 4AIMA 1TWAB 2K04A 2SDFA 3QIAA 1SYCA 4LWCA 1IW7C 5C0XJ 2I0QA 2NTSA 1RHPA 3PO2G 1WTRA 2B2VA 4DGZA 3LGJA 4QJFA 1IW7D 4ID6A 4NP5A 2BOSA 1A3TA 4Y7NH 2Z6KA 3FRPB 2L15A 3DLLA 2IJ0A 1ESFA 1KD1C 2RDHA 1N34Q 2KECA 4DF7A 1F2ZA 4X64L 2BH2A 5EKLA 3FKIG 2WAQE 3T13A 3GTQB 2JEBI 1PYBA 3SE0A 5IYDH 3BJUA 1TWHH 2MNAA 2JEAI 3AEVA 4DFAA 4JI8L 3DHQA 1STBA 2ENBA 3LX0A 2XNAC 3BYYB 3K7UC 2CW0D 1FNWA 2PNHA 4ZUJA 4FF4A 1V1PB 2FINB 4R4IA 4R8IA 4KN7C 2R92H 3T1YL 3HOUB 4HEDA 2NWGA 2GVAA 3HOXH 4L6TB 2B2TC 1IBKQ 4IOCA 2RQXA 4LF9Q 1FNUA 3KBGA 3TS2A 1PZID 1SNOA 5IP7H 4A3GB 1E0BA 2R93H 3QR8A 4LMQD 2N78A 1PA6A 1G2SA 1AZQA 1KAWA 5E1FA 1BDOA 4A3GH 1PFBA 2Z0SA 1HRJA 3EVQA 3EIVA 3N6RA 4POFA 2BCOA 5ELBA 3VYTA 2OCEA 3KUPA 3MHBA 3J7AF 3MXNA 2HDLA 2WFWA 2WB1G 3DWPA 3HP3A 4LK1C 4JYAL 1A6XA 5G3LD 2F0JA 1MD2D 4ABNA 1Y69U 3TSSA 2JA8H 1Y8OB 4A3FB 5M3FH 3DWAA 3QOJA 3HOYG 5IT9c 2EYOA 4UP7A 5I6WA 2RDFA 3JAMi 1PRTB 4JI3Q 2UXBL 3OIQA 3HKZB 1BF4A 1BXTA 5LL6S 4KKSA 2B63B 3FPPA 4A3FH 2ZTDA 2B2WC 5C3WA 1VQHA 4CDFC 1ZEQX 4JI2L 5FK9C 1SROA 1B44D 5LL6X 2WAQB 2F0GA 2UUAQ 1I6HB 1N34L 4HCEA 3CCLA 1L1OA 2B29A 2AKWB 1UE7A 1YNJD 1QVGA 4EQ5A 3OW7A 3T51B 1XPUA 4X62Q 1PTOB 1U4LA 2A5HA 1XYIA 2KHIA 4DAPA 2QEXA 1ZKOA 4A93H 1I4QA 1TWHB 1YVCA 4IALA 1LT3D 3R2IA 5H1SE 4LFCL 3AQQA 2RBMA 2K14A 1SE8A 4CGYB 3OMCA 1TY2A 5IYDG 1RDPD 4BBRH 1E2VA 1ET6A 2AHOB 2AQ3B 2KCTA 3E3XA 4WORA 5C0XI 1UUPA 3PO2H 1O7LA 1SYGA 1J5EQ 1L2FA 3AMUA 4LF7Q 4XXEA 2UUAL 3CPFA 4JI7Q 5ELEA 4A3KB 3CD6A 2XVSA 1MHWC 5EKIA 4KKTA 4KJNA 3K81C 3IFDA 4DK3C 1Y1VG 2A68D 4KD3A 2I5LX 5IT9L 5A35A 1SJHD 3TP7A 5E3FA 3FKIB 5L37A 4DUZL 2ASBA 4IJHA 1BUVT 2K52A 4C1NK 1YNXA 4NXMQ 1HFGA 1G51A 3UDIA 2EXDA 2JJQA 5COYA 1N9WA 3OWFA 3RZOH 1STAA 3NBHB 1GUSA 2EJGC 3BG3A 2Z9HA 2DY7A 2Z8LA 4A3DG 3V2TA 1ZYRC 3VDYA 2HIXA 2Y0SG 4IJLA 3Q8DA 1FR3A 4YCVA 2F0MA 3BZDB 4LAAA 4ME3A 2K75A 1KL9A 1UEAB 4PQXA 3A8JE 4B08A 4IUPA 4C56C 2KHJA 4L5SA 1I94L 3K8AA 1ZXTA 5FLMH 3HOXB 2EJFC 2BH8A 3C1EA 2E2DC 1EUJA 2D0OA 2GVBA 3A5ZB 4X3TA 3X3NA 4A3JG 2R61A 2VUMG 3M4OB 2IY5B 1LACA 4GOPA 2F0OA 2PPBC 2F3VA 2E75C 2K5HA 1HFNA 4QQBX 4LFAL 4FVMA 1TS2A 3PSIA 1H9JA 2JA8G 1EY5A 1YHBA 1K28A 2E2HH 5C44H 5IP9G 3MXUA 1A15A 1QOHA 1VDZA 3RN2A 1HQRD 2QCPX 1SMYD 5DAUA 3I73A 2OQ0A 1EFID 3NWSA 1B3QA 1IKLA 2CH4W 2DN8A 3CAMA 4EGVA 4C3JB 4HIKA 1EY6A 4OEMB 4JBWA 3NPPA 5IY0A 1HHVA 4DR2L 5M3FB 4YWMA 5CV9A 2F4VL 4DV1L 4HJ8A 2ZXOA 3BVMA 2Y0SE 3IRBA 2F0VA 2FHTA 1KIXA 3VR3A 4QGUA 3HGBA 4R4OA 1RF2D 2B2YC 3U4ZA 4F87A 3SXHA 1SAPA 4GNXC 2YTVA 2I07B 4JI7L 1ICFB 4LF7L 1P8LA 5I2YA 3W1BA 4R4QA 1UNSA 4NDXA 4OWXB 3U9OA 2KHSA 2YU9B 3I4MG 1ILPA 3S16B 1HUMA 4AH6A 4DUYL 4RAUC 2EYHA 1WTQA 4IN3A 1AN8A 1EU4A 1SYFA 1YHQA 1GHJA 2TMPA 3NELA 4DV4L 2YTXA 1Q3LA 4HIMA 1UE5A 1S72A 1XXGA 1SYDA 2KEEA 4HMIA 4LFCQ 1BCPD 1VQPA 3MFGA 4UP9A 2N8NA 3SHLA 5KRUA 2JQOA 4JI8Q 1VQNA 1UEBA 4OIKA 1JOQA 1AZPA 1S5BD 5D14A 5IYBG 2QA4A 1CHQD 4IO9A 1X9NA 1D5XC 2I5HA 4RA8A 3TREA 1WD0A 1SFOH 3CF5A 1CQVA 1G91A 4OO1G 2BDOA 2B63G 3M3YB 4X6AH 5AJ3Q 4IFDG 2B8GA 4IPDA 1WCMH 5GADC 1PFSA 1IBMQ 2LMCB 4LF4Q 3MA2B 1SNCA 1MSHA 2A6HD 2AUJD 1PRTF 1C0AA 1Q8IA 2WKCA 2HT1A 3HG9A 4DAYB 4G7ZC 1KAAA 1YNNC 3MC0B 2PQAB 1KC8C 4EQPA 1C48A 4J15A 5C0XG 5KGUA 1QZHA 1HZAA 2KEDA 2UU9L 1NUCA 4K2LA 3STBC 1K3BC 1X3GA 2D62A 4I7ZC 3RR5A 2MO0A 1N33Q 3GTOB 1D1KA 4DA2A 4OONA 2ZJPA 3RLOA 4L5QA 5GQOA 3PF4A 3E0EA 2E2JB 2JA5B 4AQYQ 4UPAA 1EWIA 4YY3L 3GTOH 1TKWB 1BBWA 1QNKA 4ZRZA 4CKEA 2A68C 1WCMG 5C3EB 5GAGC 5D3IB 4V190 5M5XH 3K5NA 1V1PA 2VL6A 3GP7A 3NBHA 3BZCA 3D31A 1I5FA 3G6EA 2R6GA 4A3CG 4B9WA 4IUTA 3RD4A 4C2MH 4DV2L 1SSOA 3NSWA 1CSPA 3CW2C 2QDBA 1F9RA 1C7YA 4LF5Q 3GTLH 4DR5L 4WRDA 1BKBA 4HJAA 4RG1A 2A6HC 4MN3A 2A69C 1I3QB 1DONA 1V1QA 3GV3A 5AJ3L 1FD7D 2V4DA 4DV6Q 1XJVA 5IYCG 3ITPA 3G48A 1CHPD 3OMGA 4A3DH 1EOVA 1C9OA 2IX0A 3W1GA 2RSNA 1IBLL 1LUZA 4BBRG 2MP1A 1JWUD 1I50B 1ICWA 2AQ1B 2EPBA 5EGTA 1EQTA 2ATWA 1QB5D 3HFZB 2BA0A 3UDXA 3AFQA 2VY3A 4DR3Q 1U0LA 1PH4A 2EYLA 1PDQA 1NSNS 3FPUB 4RGOS 1A62A 1NAPA 1HCZA 5C5LA 1EIHA 1I94Q 1RL2A 3LNNA 1LABA 4DV4Q 4KV6A 5IGDA 1H95A 1LTBD 2NVXB 3K6OA 4DUYQ 2E8GA 4LF8Q 2RCFA 4EQOA 1EYAA 1F9PA 2EY2A 3CRKC 5CV7A 4IFDH 1X6OA 1EY7A 2D0PA 3E0JA 3L9AX 1PRTD 1I4GA 1CZGA 5LMNL 3ICEA 3PUWA 1RTOA 3J80i 2UUBL 2JA5H 3G6JB 1XPRA 3NTKA 4PG3A 4XQNA 1HNWQ 2EZVA 2QW7A 4G57A 5M5YB 4XT1B 4CKBA 4LUVA 4JC0A 4KMUC 4LF9L 1CFMA 4Q0FA 1YHAA 5C3EH 2RF4A 2XRQD 4UDUC 4HSVA 1V1OA 4X65Q 1NTGA 1A3UA 1KTKA 1EIYB 2J0TD 2ZJQA 2F0NA 2WAQG 2EYPA 3UE1A 1G6ZA 5D3DA 1VQ6A 1EY0A 4GS3A 3VYSA 2F0KA 1SEBD 1SNDA 4A3LH 1T5EA 4FF3A 3PUYA 3CC2A 1XWEA 4S3SA 4L5TA 2K5VA 4RGTA 1Q90A 1BCPF 1JE4A 4GN4B 3OTOQ 3BVGA 3CCJA 3J81E 1X3PA 3F8TA 1D5ZC 4QCLA 5C4JH 3Q23A 2E2HB 4P73A 2A6EC 3FMCA 2K6AA 5LMNW 1EWCA 1I3QH 4FXKC 1J5EL 1HTPA 3MWYW 5JJIA 2P5ZX 2ZJRA 1GUWA 2UXCL 4DV6L 2DUDA 3HOWB 4HR7B 3VR6A 1TWCH 1E3PA 3NQIA 1E2ZA 2VB3X 4KY5A 2JYOA 4JBJA 5AFWA 4DK6C 4IFDI 1ILQA 5I9OA 1LTAD 2O2LD 1U4PA 2R7ZG 3J80L 4U68A 1NR4A 4AYBE 1V43A 3GTKB 3H91A 3RMHA 2F0HA 1DOMA 1LTGD 3JC66 2WB1E 3I55A 1EWHA 4KLKA 3K5LA 3HOUG 2XIWA 1E1OA 5FO7B 1G291 3TZDA 1WD1A 3D6CA 4JW0A 1MJCA 3P7JA 1EFWA 1VQDA 2MJ8A 4GLAC 2I46A 1PH5A 2EY5A 5ELNA 1STNA 3DM3A 3GD7A 4GN5A 4K8IA 4J1MA 5M5XB 3KYHC 4NW2A 4IPGA 5J1ZA 4JI1Q 2O5JC 4GNXB 1HJPA 3HOZH 2OEOA 5I9PA 2MFIA 4ULLA 1WVLA 2CWAA 1XNRL 3PMFA 4I7AA 3WOEA 2R7ZH 4O1NA 3ZYYX 1JOKA 2KCNA 3GDEA 4JI5Q 1F2MA 3GTLB 1FL0A 3S14B 3RLFA 4R9WA 1ENCA 3KJOA 1FGUA 4MHEA 2ZM6Q 2HDMA 3T16A 3QO2A 1J9OA 1HUNA 3HS0C 1B2TA 2XGTA 1WCMB 1MBYA 3SK6A 3T1HL 1RTNA 2QILA 1HZ9A 3J7AV 4C3HH 3FP9A 4DAVA 1KNEA 3KLSA 3WDNA 1Q81C 4JI4L 4RGNA 2IHFA 3AB9A 4BS9A 3E6ZX 1KRSA 3H3VH 5E7NA 1ZYRD 4OXPA 3I91A 2Q2TA 1N8RC 5JVH3 4ZUIA 1JJCB 5GAHC 4XQQA 1VQGA 4JI4Q 1LV9A 1K83B 1YI2A 5M5WB 4PMWA 2PZWA 4ZCKA 2EY1A 5JJZA 1JWMD 3S24A 5I4DA 2E5LL 1D7QA 1SMYC 3TS0A 1VQKA 4GKJQ 2C9OA 4TVAB 4Z9CB 2CH4A 4UAIA 4MNOA 4U673 5C5MA 5KEEA 3CC7A 4RWSC 3GTGB 3OTOL 1PHJA 1Q1EA 1U9RA 4ALPA 1SE4A 3IFTA 5EKKA 1I4XA 2F0UA 1JORA 1K0SA 1HZCA 3RZDB 5HURA 2F0TA 4ZQ3A 4NMZA 1SNQA 1WJJA 1PZKD 4RFBA 1K8GA 4JBMA 1DOLA 4QL5A 2NVYB 1LYLA 2NN6G 1YBYA 4CHTB 1VQFA 3VR4A 1II3A 5KYLA 2PO4A 5ISRA 3MXPA 5CV6A 1ET9A 1LTTD 4O42A 2KUMA 1TQOA 4K5VA 5C4XH 3JAME 4DV5L 1K8OA 4LFAQ 1A8VA 2N49A 1FYCA 3R2TA 3OSOA 1JR0D 1A2UA 4DR4Q 1XTCD 4ZKCB 4Q5VA 3ERSX 4ZK9B 1KDCA 4JVZA 5M3FG 1RD9D 1DGSA 1EQVA 1VQAA 2XWJB 1TU2B 5C0XH 2KBNA 1Y8PB 4BY7H 1AP0A 1X32A 4QIWB 1K0RA 2JA9A 4B3SL 4LFBQ 2YYZA 1DZ1A 2I5MX 2D9UA 1IBLQ 5KNDA 4BBSH 3NHHA 5GROA 4HTHA 3MEFA 1BQQT 1EYCA 1HTLD 1B1ZA 5C4HA 3NK9A 1DYQA 3K5OA 1PYWD 3GTPH 1QUQA 2CFMA 1PTOC 5JEAH 3QOLA 1JMCA 5FLXE 5FO8B 4G7OC 1ASZA 1O7IA 3S2HH 2M9VA 1ASYA 2Q2UA 1PTOH 2KENA 3GTPB 5BN3A 2L12A 4OX9L 3W2DA 1V9PA 1B8AA 1V8QA 2FFKB 4KJOA 4A3IG 3KF8A 4YHHL 1R9TH 3TP6A 3K58A 4DV2Q 1Y1VB 5IWAL 1MI2A 1XNRQ 3Q22A 1SNMA 2NVTH 4IUNA 2Y0SB 2K50A 3BYTB 1BOSA 1HR0Q 3H3VI 2KCCA 1WTWA 3HKZG 5C3EG 2IX1A 2EYJA 2Q8TA 1H9RA 2VNUD 3HOWH 4KTAA 2JA6H 4BY1H 1OXUA 2MO1A 3Q24A 1QG7A 4DXFA 4DNTB 1KQSA 4LF8L 1KNAA 5J39A 4K0KQ 1D8LA 5K36H 4K5XA 3J81j 2NVQB 4IUUA 1IL2A 1GJXA 5CGKA 2O5IC 5BR8Q 3URYA 5A2QE 2SNSA 4IFDJ 4F88A 4HIOA 3L2PA 3PO3H 1GUTA 2HCIA 1VQLA 3ULPA 1DJRD 4JI6L 5FJ8H 2IHEA 4DR3L 4B3RL 4ZAIA 5CORA 2EE1A 2AMCB 5C4XG 2PZUA 3R8BA 3D4DA 2XWBB 3NP8A 1WOCA 2Q8RE 4A3KG 3IKJA 5M3MG 4RKBA 4IPCA 1NE3A 3KLSX 1CI3M 3H0GG 4X62L 1I6HH 3T1HQ 2FMMA 2RA4A 1ONLA 1XTDA 1EY4A 4HJ7A 1IHZA 3C2PA 5I6YA 4Y7NB 1CZWA 2A74C 1WTHA 5CR3A 1RJTA 2EDGA 4DV3L 1EU3A 4WFN3 4N8X1 2K28A 3F2CA 4LF5L 4JI5L 1TWFB 2EYFA 2JE6I 4B3SQ 1UE6A 2C5CA 4RHSA 3J7YW 2LY7A 4QUCA 3S14H 1I6VC 1LTID 4X3KA 5IGBA 1JC7A 3D3RA 4A3BH 3S1QH 2CW0C 2K5QA 4KHZA 3J7A5 5CYUA 4TQUS 4MIUA 4LNQA 4WJ3M 3KLRA 1WI5A 1XMOL 5JEAG 4DPGA 4UY8C 2G9DA 4KY6A 1M1KC 4QF4A 5EJWA 4CKCA 4RCOA 2IL8A 5C44B 2JA6B 4FP5D 3MEHA 1GUGA 1H9SA 1Q1BA 4YWLA 4GN3B 3OW2A 1YJ9A 1GXDC 4A3IH 1AH9A 2F0EA 3X3MA 5CV4A 4CDCC 4OWWB 1J8IA 1VQ8A 3VA5A 1BBUA 3SK4A 1OXXK 3MVVA 4ODGA 5IYCH 4YWKA 3KF6B 1HH2P 3FKIH 1BR9A 2NB0A 4XT3B 3G4SA 4A3IB 1K9MC 2JA6G 1VMCA 3NTHA 4LUOA 2B2UC 4DR2Q 3PIO3 3SGIA 3HEJA 1F2YA 3ND9A 1NJIC 3E9HA 4PV1C 2L55A 4LW1A 1B70B 2F0PA 3UDFA 1VQ9A 4JK1C 1FVIA 4BXXH 1L0WA 3VA7A 4DAYA 2R7DA 5KNCA 1QVCA 1XNQQ 5DEHA 3M4QA 3KDFB 3B6YA 2Q2HA 2EOTA 4EQNA 1O80A 4DR6L 2KVMA 3U9SA 2PNRC 4ZYSA 1K73C 1TT2A 1T9HA 1L1OC 1PFMA 3S2HB 2R93G 1YJWA 2YTYA 1MKHA 4XTCS 3HRZC 3PUZA 5FJ8G 2F3WA 3QB3A 1KDBA 1KDAA 2KJXA 1N32L 1IYVA 1B3AA 1H9MA 4XIGS 2Z4HA 1PYSB 4HAEA 4K8JA 4BY1G 2WIIB 4BBRB 3JAMc 5K5PA 5IE8A 3M4OH 2NVYH 5FKAC 1EIGA 2Z4IA 4XQJA 2F0WA 4L63B 3PUVA 4P71A 3T4AC 1EZ8A 3S15B 4CJ2C 1EEID 2NBFA 5C4XB 4A3MG 3OHXC 1VS0A 4FF2A 3H3VC 1GHKA 4FXDA 2MGSA 3M3YH 3UI2A 1SMXA 2BE5D 3FVQA 4JCVE 3A8IE 5IGGA 1WYDA 2M2LA 2VUMH 2RDGA 1QE6A 4HMJA 2HHHL 1N33L 2PYKA 3MXGA 2F4VQ 2B63H 2L11A 2OQKA 2K5NA 4A4IA 3GV6A 2VW9A 1WTVA 3OYYA 1N32Q 5ELCA 5IOCA 2X6GA 3PV0A 5KIXA 1AE3A 3D6WA 1STEA 3Q0AA 4QUFA 1DD2A 2OF1A 1S4ZA 1YZ6A 4JI1L 3PIOA 2F0IA 3NBIA 1PXUA 3C3LA 3O13A 3CP0A 5LMUQ 5ELFA 1Q82C 4GKJL 1JE5A 1LT4D 3JAML 3I4NH 3QG1A 3EBEA 4AYBG 2UXDQ 5G3LF 1D6EC 4IPHA 3GTQH 1SN8A 1C8CA 2OTLA 4IURA 4QY7A 1PTOD 3GTJH 4KN4C 2B8FA 4DR5Q 2PQEA 1R9TB 2MUYA 5HGQA 2LFNA 2LXKA 1M90C 4R1JA 4DNIA 1SJED 1YNJC 1TXYA 4MTNA 4V0BA 4B3RQ 1CUKA 2GA4B 4GKKL 1LTLA 3BS1A 5TSSA 2DNCA 5FLXc 1HPCA 4CJ1B 5IGCA 3I72A 3M85A 1BBXC 3P1HA 1LLRD 4C3IG 1O78A 3CHBD 3CCVA 3PO2B 1SYBA 2WKDA 1STYA 4BY1B 2K4KA 3KBXA 1CKNB 1D1IA 1DOKA 1X56A 5DM63 1IZ6A 4QIWE 1XMOQ 1JOOA 2TSSA 3J81L 1MJEA 4KHVA 3ER0A 2N88A 4BWGB 4FNFA 1TS4A 1NR2A 2HCCA 1Y8NB 2F4IA 4A3DB 1QNUA 3K80C 1HR0L 2JSOA 4NXML 1PMRA 1C4QA 2PW5A 2R7FA 2F52A 3BU2A 4X3SA 1K8MA 2DGYA 2PMZB 4F7XA 2UXBQ 4Y52H 1STHA 4HIDA 1CA6A 1A63A 2JA8B 1X3EA 4ILWA 4KK7A 2L5TA 3EQLC 4A3FG 1Z6HA 2B2VC 2Q8IB 1CKOA 1E2WA 3CPWA 1WTOA 2NUCA 2KCMA 4M8AA 3J81c 1X3QA 3KF6A 1OXSC 1LT6D 2XTIA 2B2YA 2XRSD 2Z6KC 2X6LA 1Y1WH 3PUXA 1IKMA 2F0FA 1PH9A 3U58A 1EL0A 1PH6A 4OIJA 4E6IA 4TRDA 1HA6A 2NZHA 1L1OB 3DEOA 5M3MH 5CV8A 4A3GG 4GKKQ 4NXNQ 3K7AB 1A2TA 4DAMA 4C2MB 3L3OC 5J3BA 3HOUH 2IWHA 1M4VA 2F0DA 4A3BB 3T1YQ 1QILA 4TSSA 5C4ZA 2ID0A 3H0GB 4NXNL 1DM0B 1Q12A 1EYGA 3BDCA 3I4OA 4TKOB 4BA2I 3CRLC 1NNXA 4ME5A 1AW7A 3CCEA 2ZTCA 1X3FA 3T56B 1Z7TA 4JPBW 2Z1CA 2CQOA 1HNXQ 5EBDA 1G2TA 5FLMG 2G9HD 1LTRD 4R4TA 4KKUA 2KQ3A 2MPMA 4HJ5A 1K8AC 2GN5A 3SR1A 1E24A 2E2IB 1F9SA 2ZT9C 2WINB 5IWAQ 3C46A 1S3OA 4N9TA 1NMGA 1STGA 3UDGA 2RVLA 2CHBD 4JOIA 4KY7A 4F8MA 1UAPA 1LTSD
chains in the Genus database with same CATH topology
3I70A 5EQ0A 3EFXD 2EVBA 3VYUA 4IQZA 1ENAA 4RHRA 3BVZA 5FLXL 4HN7A 5JVG3 3DUZA 3M7GA 2XN9C 3S9WA 1KLGD 5JEAJ 2PCFB 2HQEA 1H9KA 3RUZA 3NTIA 5A2QL 3SK5A 5DM73 1JCKB 2B39A 3SDZA 1VMPA 3EJIA 2F03A 3DM1A 4H44C 5M9OA 4IZ8A 2VB2X 1EY8A 2F0LA 1CA5A 4IUVA 3NE5B 1RCVD 1SXTA 3DEPA 2A69D 4C3HB 3FDTA 4J6HA 5T1GA 3Q6SA 3S1RB 2ZXPA 4RCNA 2IX3A 1IYUA 4OO1H 2A6ED 4BA1I 4LJZC 2DNEA 4KI0A 4GZYC 3SVMA 3D4WA 5J22A 3DMUA 4G7HC 1F2LA 4FF1A 1VCIA 2CVRA 1AEXA 1Y1WB 2FJ2A 5IGFA 1VF7A 2E76C 4A93B 3GTJB 4H13C 2JA7B 1EOTA 4FYDA 1L0XB 3MFYA 5M3MB 1TS3A 4K6DA 1FGBD 2R7ZB 4QB4A 3NXWA 2K1BA 2K32A 5HGTA 5CBAE 1O7ZA 5D65A 4AYBB 4DNRB 3VR5A 5E4XA 5ELDA 2EXZA 1CK1A 1OXTA 3D8GA 4EVOA 1QCBD 1CM9A 4K6LA 3M7NA 2E74C 5JPMC 1R4QB 4DXGA 3A8KE 5CBEE 1O7YA 3I8ZA 1CQFA 4C3IB 4L8JA 3WOFA 4DK0A 4K14A 5K36G 1KABA 2FMCA 3TZUA 1HA5A 2WB1B 4OO1I 1PRTC 4QMGA 4XYQA 1ML0D 4CBVA 2OT2A 3C1FA 3DXJC 4K2KA 3MAQA 1YNND 1ENFA 4OL7A 3S1MB 5EPLA 1SNPA 1DXMA 4H7BA 4OGQC 1PTOF 2BA1A 3V96A 5KNBA 3TMEA 1B9MA 3IAYA 4WJWA 2QEJC 2AWOA 2F1MA 2RSOA 3A7LA 2NTTA 2EY6A 5F2DA 1QJOA 1SE2A 2A73B 1BNZA 3QWNA 2L1BA 2MHVA 3KK7A 1TWCB 2M00A 1EZ6A 1LT5D 2B2TA 3OIPA 3I3CA 4FXGC 3HOYB 3SEBA 3S2DB 5IT9E 5C6AA 3P75A 2QKIC 3BDOA 4J8QA 1W6KA 1W6JA 3A54A 4DK1A 5JPNC 3AU7A 2LS01 2DY8A 5JOBA 4HSPA 2BDNA 1S5FD 3A55A 2B2UA 1TR5A 4RGMA 5EPJA 3PIP3 3D4RA 5NUCA 4BBSB 3T53B 3OPOA 1HQMC 1GOZA 4ZLTF 2IT1A 1SDFA 4XDXA 5CV5A 3VYRA 3HOVB 2QF7A 1M8AA 3ERQA 1B50A 5EBCA 2CQAA 2X69A 1ESRA 2ICEC 3S1NB 4RKLA 1KLUD 5BN4A 4A3JB 2NVTB 4IUQA 2RKSA 1L0YB 2WV6D 1SFOB 2IW3A 2K5WA 2K5DA 5FOBB 2NN6H 4KD4A 1U4MA 2ZXRA 3A7AB 5I2XA 1WTPA 2KA7A 3K59A 5DNFA 4H0LC 2J4XA 1PLFA 4ZKBB 1I4HA 3ND8A 3PO3B 1T5XD 3NWTA 4X3UA 4BY7B 3HZXA 2NN6I 4M1UB 2L4NA 2B2WA 1S5DD 4C1NI 3L7ZC 5T1IA 2K01A 1Z47A 3IL8A 5IODA 1R4PB 5LHY1 3GQBA 5CC4A 2LKVA 3FEWX 4A3EB 4R8NA 4I65A 1B9NA 2F0SA 1S5CD 3SK8A 2JXMB 1RODA 1U4RA 4FO2A 5C3XA 3OWEB 3VR2A 4K5WA 1PFNA 1CT1D 1MSGA 3NQTA 1GUNA 2R93B 3H09A 4XYOA 2KOLA 3I4LA 3TDQA 2H1EA 2O4XA 4C3HG 2VXWA 4DU9A 2H4OA 4NKLA 1BO0A 2PW7A 2VUMB 3A56A 3R93A 3H94A 3M4YA 3MTSA 3K0YA 1JB3A 2AQ2B 2D5DA 2R3ZA 1H9SB 2SEBD 2IPKD 4N9PA 2N55A 1JICA 2HUGA 2SNMA 1BCPC 1TS5A 1FNVA 5IGEA 2F0QA 1BCPB 3QJYA 3G7LA 3ONAB 4HCSA 1NCVA 1OO9B 1I4RA 2D2CC 3V05A 4G4KA 3I4NB 3EA6A 2K03A 4CJ0B 3H6MA 4OHJA 2L9HA 2K05A 3TBIB 3S1QB 1D5MC 1OXVA 1PZJD 3TN2A 4RH6A 5C4JB 3BDLA 2SOBA 2EJMA 4PMBA 2AUKA 1AFPA 3MZ5A 1JWSD 3W3AA 5CMDA 3GTMB 3LWUA 3N52A 3EROA 1IL8A 1HXYD 1I4PA 1EYDA 1B4OA 1LO5D 2JP1A 4C3JG 1VF5C 5IIFA 1EEFD 3F2UA 4B9XA 3I4MB 2L0CA 2NYZD 1MGSA 2K7VA 4PNYA 1D2BA 3LWEA 1F77A 1RKNA 4DN4M 1CTMA 2AWNA 1DCZA 5EPKA 3K57A 2NZ1D 1GUOA 1EY9A 2BE5C 2K33A 3RZOB 3OOCA 3CQZB 3R3OA 5KYIA 2OXPA 4YIJA 1TWGB 3J80E 1G8ZD 3TP5A 2XSCA 1SYEA 3HOZB 5BN5A 3TP8A 4P2CB 5E4WC 2R92B 4PMCA 5FO9B 3CKIB 2PZTA 2EYMA 1SE3A 3E5SA 5JAVA 3CU7A 1WTXA 1QWYA 1A3VA 4A3MB 2ICIA 2J7ZA 3K5MA 3I90A 3S17B 3GO5A 1S5ED 1SBBB 1JQYD 1B53A 1XX8A 1F9QA 3P20A 1TVXA 2WACA 3DWQA 2WP8J 3NUCA 1TY0A 1TIID 1TWAB 2K04A 2SDFA 3QIAA 1SYCA 1IW7C 5C0XJ 2NTSA 1RHPA 1WTRA 2B2VA 4DGZA 1IW7D 4ID6A 4NP5A 2BOSA 1A3TA 3FRPB 2IJ0A 1ESFA 2RDHA 2KECA 4DF7A 1F2ZA 5EKLA 3T13A 3GTQB 2JEBI 3SE0A 2JEAI 4DFAA 3DHQA 1STBA 2ENBA 3LX0A 2XNAC 3BYYB 2CW0D 1FNWA 4ZUJA 4FF4A 1V1PB 2FINB 4R8IA 4KN7C 3HOUB 4HEDA 2NWGA 4L6TB 2B2TC 2RQXA 1FNUA 3KBGA 1PZID 1SNOA 4A3GB 1E0BA 4LMQD 1G2SA 1AZQA 5E1FA 1BDOA 1PFBA 1HRJA 3EVQA 3N6RA 2BCOA 5ELBA 3VYTA 3KUPA 3MHBA 3J7AF 3MXNA 2HDLA 3DWPA 3HP3A 4LK1C 1A6XA 5G3LD 2F0JA 1MD2D 4ABNA 1Y69U 3TSSA 1Y8OB 4A3FB 3DWAA 3QOJA 2EYOA 5I6WA 2RDFA 1PRTB 3OIQA 3HKZB 1BF4A 1BXTA 5LL6S 4KKSA 2B63B 3FPPA 2B2WC 5C3WA 1ZEQX 5FK9C 1B44D 5LL6X 2WAQB 2F0GA 1I6HB 4HCEA 1YNJD 3OW7A 3T51B 1PTOB 1U4LA 2A5HA 1XYIA 4DAPA 1ZKOA 1I4QA 1TWHB 4IALA 1LT3D 3R2IA 2RBMA 4CGYB 3OMCA 1TY2A 1RDPD 1E2VA 1ET6A 2AQ3B 4WORA 5C0XI 1UUPA 1O7LA 1SYGA 3AMUA 4XXEA 5ELEA 4A3KB 2XVSA 5EKIA 4KKTA 4KJNA 3IFDA 2A68D 4KD3A 5IT9L 5A35A 1SJHD 3TP7A 5E3FA 3FKIB 1BUVT 4C1NK 1HFGA 5COYA 3OWFA 1STAA 1GUSA 2EJGC 3BG3A 2DY7A 2Z8LA 3V2TA 1ZYRC 1FR3A 2F0MA 3BZDB 4LAAA 1UEAB 4PQXA 3A8JE 4B08A 4IUPA 4C56C 1ZXTA 3HOXB 2EJFC 3C1EA 2E2DC 4X3TA 3X3NA 2R61A 3M4OB 1LACA 2F0OA 2PPBC 2F3VA 2E75C 1HFNA 1TS2A 4FVMA 1H9JA 1EY5A 3MXUA 1A15A 1QOHA 1VDZA 1HQRD 2QCPX 1SMYD 5DAUA 3I73A 1EFID 3NWSA 1IKLA 2DN8A 4EGVA 4C3JB 1EY6A 4JBWA 3NPPA 1HHVA 5M3FB 5CV9A 2ZXOA 3BVMA 2F0VA 2FHTA 3VR3A 3HGBA 1RF2D 2B2YC 4F87A 3SXHA 1SAPA 2I07B 5I2YA 1UNSA 4NDXA 3U9OA 2YU9B 2KHSA 1ILPA 3S16B 1HUMA 4RAUC 2EYHA 1WTQA 4IN3A 1AN8A 1EU4A 1SYFA 1GHJA 2TMPA 1Q3LA 1XXGA 1SYDA 2KEEA 4HMIA 1BCPD 3MFGA 3SHLA 5KRUA 4OIKA 1JOQA 1AZPA 1S5BD 5D14A 1CHQD 1D5XC 4RA8A 1WD0A 1CQVA 1G91A 4OO1G 2BDOA 3M3YB 4IFDG 2B8GA 2LMCB 3MA2B 1SNCA 1MSHA 2A6HD 2AUJD 1PRTF 1Q8IA 2WKCA 3HG9A 4G7ZC 1KAAA 1YNNC 3MC0B 4EQPA 1C48A 5C0XG 5KGUA 2KEDA 1NUCA 4K2LA 2D62A 4I7ZC 3GTOB 1D1KA 4DA2A 2E2JB 2JA5B 1TKWB 1QNKA 4ZRZA 4CKEA 2A68C 5C3EB 5D3IB 4V190 3K5NA 1V1PA 3GP7A 3NBHA 3D31A 2R6GA 4B9WA 4IUTA 3RD4A 1SSOA 3NSWA 2QDBA 1F9RA 4WRDA 2A6HC 4MN3A 2A69C 1I3QB 1DONA 3GV3A 1FD7D 2V4DA 3ITPA 1CHPD 3OMGA 2IX0A 2RSNA 2MP1A 1JWUD 1I50B 1ICWA 2AQ1B 2EPBA 5EGTA 1EQTA 1QB5D 2BA0A 2EYLA 1PDQA 1NSNS 3FPUB 4RGOS 1NAPA 1HCZA 5C5LA 1EIHA 3LNNA 1LABA 4KV6A 5IGDA 1LTBD 2NVXB 3K6OA 4EQOA 1EYAA 1F9PA 2EY2A 3CRKC 5CV7A 4IFDH 1EY7A 3E0JA 3L9AX 1PRTD 1I4GA 1CZGA 3PUWA 1RTOA 3G6JB 3NTKA 4XQNA 2EZVA 4G57A 5M5YB 4XT1B 4CKBA 4KMUC 1CFMA 4Q0FA 2XRQD 4UDUC 4HSVA 1V1OA 1A3UA 1KTKA 2J0TD 2F0NA 2EYPA 1G6ZA 5D3DA 1EY0A 3VYSA 2F0KA 1SEBD 1SNDA 1UAPA 1T5EA 4FF3A 3PUYA 1XWEA 4S3SA 4RGTA 1Q90A 1BCPF 1JE4A 3BVGA 3J81E 1X3PA 1D5ZC 4QCLA 3Q23A 2E2HB 2A6EC 3FMCA 2K6AA 1EWCA 4FXKC 1HTPA 3MWYW 1GUWA 3HOWB 4HR7B 3VR6A 3NQIA 1E2ZA 2VB3X 4KY5A 2JYOA 5AFWA 4IFDI 1ILQA 5I9OA 1LTAD 2O2LD 1U4PA 3J80L 4U68A 1NR4A 1V43A 3GTKB 3RMHA 3H91A 2F0HA 1DOMA 1LTGD 1EWHA 3K5LA 2XIWA 5FO7B 1G291 3TZDA 1WD1A 3D6CA 3P7JA 2MJ8A 2I46A 2EY5A 1STNA 3GD7A 4K8IA 4J1MA 5M5XB 4NW2A 5J1ZA 2O5JC 2OEOA 5I9PA 4ULLA 1WVLA 3PMFA 3WOEA 4O1NA 3ZYYX 1JOKA 2KCNA 1F2MA 3GTLB 3S14B 3RLFA 4R9WA 1ENCA 4MHEA 2HDMA 3T16A 3QO2A 1J9OA 1HUNA 3HS0C 1B2TA 1WCMB 1MBYA 3SK6A 1RTNA 2QILA 3J7AV 4DAVA 1KNEA 3KLSA 3WDNA 4RGNA 3AB9A 4BS9A 3E6ZX 1ZYRD 3I91A 5JVH3 4ZUIA 4XQQA 1LV9A 1K83B 5M5WB 4PMWA 2PZWA 2EY1A 5JJZA 1JWMD 5I4DA 1SMYC 2C9OA 4Z9CB 4UAIA 4U673 5C5MA 5KEEA 4RWSC 3GTGB 1Q1EA 1U9RA 1SE4A 3IFTA 5EKKA 1I4XA 2F0UA 1JORA 3RZDB 5HURA 2F0TA 4ZQ3A 4NMZA 1SNQA 1PZKD 4RFBA 1DOLA 2NVYB 2NN6G 4CHTB 3VR4A 1II3A 5KYLA 2PO4A 5ISRA 3MXPA 5CV6A 1ET9A 1LTTD 4O42A 2KUMA 1TQOA 4K5VA 3JAME 1K8OA 1FYCA 3R2TA 3OSOA 1JR0D 1A2UA 1XTCD 4ZKCB 4Q5VA 4ZK9B 1KDCA 1RD9D 1EQVA 2XWJB 5C0XH 1TU2B 1Y8PB 1AP0A 1X32A 4QIWB 2YYZA 1DZ1A 2D9UA 5KNDA 3NHHA 4HTHA 1BQQT 1EYCA 1HTLD 1B1ZA 5C4HA 3NK9A 1DYQA 3K5OA 1PYWD 1PTOC 5JEAH 3QOLA 5FLXE 5FO8B 4G7OC 2M9VA 1PTOH 3GTPB 5BN3A 2L12A 3W2DA 1V8QA 2FFKB 4KJOA 3KF8A 3TP6A 3K58A 1Y1VB 1MI2A 3Q22A 1SNMA 4IUNA 2Y0SB 3BYTB 1BOSA 2KCCA 1WTWA 2IX1A 2EYJA 2Q8TA 1H9RA 2VNUD 4KTAA 1OXUA 3Q24A 1QG7A 4DXFA 4DNTB 1KNAA 5J39A 5K36H 4K5XA 2NVQB 4IUUA 1GJXA 5CGKA 2O5IC 5A2QE 3URYA 2SNSA 4IFDJ 4F88A 1GUTA 2HCIA 1DJRD 4ZAIA 5CORA 2EE1A 2PZUA 3R8BA 3D4DA 2XWBB 3NP8A 2Q8RE 3IKJA 4RKBA 3KLSX 1CI3M 2FMMA 2RA4A 1ONLA 1EY4A 1IHZA 3C2PA 5I6YA 1CZWA 2A74C 5CR3A 1RJTA 2EDGA 1EU3A 4WFN3 2K28A 1TWFB 2EYFA 2JE6I 2C5CA 4RHSA 3J7YW 2LY7A 4QUCA 1I6VC 1LTID 4X3KA 5IGBA 1JC7A 3D3RA 2CW0C 2K5QA 4KHZA 5CYUA 4TQUS 4MIUA 3KLRA 5JEAG 2G9DA 4KY6A 4QF4A 5EJWA 4CKCA 4RCOA 2IL8A 5C44B 2JA6B 3MEHA 4FP5D 1GUGA 1H9SA 1Q1BA 1GXDC 2F0EA 3X3MA 5CV4A 1J8IA 3VA5A 3SK4A 1OXXK 3MVVA 4ODGA 1BR9A 2NB0A 4XT3B 4A3IB 1VMCA 3NTHA 2B2UC 3PIO3 3HEJA 1F2YA 3ND9A 4PV1C 2L55A 2F0PA 4JK1C 3VA7A 4DAYA 5KNCA 5DEHA 2EOTA 4EQNA 1O80A 2KVMA 3U9SA 2PNRC 4ZYSA 1TT2A 1PFMA 3S2HB 4XTCS 3HRZC 3PUZA 2F3WA 3QB3A 1KDBA 1KDAA 2KJXA 1IYVA 1B3AA 1H9MA 4XIGS 2Z4HA 4HAEA 4K8JA 2WIIB 4BBRB 5K5PA 5FKAC 1EIGA 2Z4IA 4XQJA 2F0WA 4L63B 3PUVA 3T4AC 1EZ8A 3S15B 4CJ2C 1EEID 2NBFA 5C4XB 3OHXC 4FF2A 3H3VC 1GHKA 4FXDA 2MGSA 3UI2A 2BE5D 3FVQA 3A8IE 5IGGA 2M2LA 2RDGA 1QE6A 4HMJA 2PYKA 3MXGA 2L11A 3GV6A 1WTVA 5ELCA 5IOCA 2X6GA 3PV0A 5KIXA 3D6WA 1STEA 3Q0AA 4QUFA 1DD2A 2OF1A 1S4ZA 2F0IA 3NBIA 1PXUA 3C3LA 3O13A 5ELFA 1LT4D 3JAML 3QG1A 5G3LF 1D6EC 1C8CA 4IURA 1PTOD 4KN4C 2B8FA 2PQEA 1R9TB 2MUYA 2LFNA 1SJED 1YNJC 4V0BA 2GA4B 3BS1A 5TSSA 2DNCA 1HPCA 4CJ1B 3M85A 3I72A 5IGCA 1BBXC 3P1HA 1LLRD 4C3IG 1O78A 3CHBD 3PO2B 1SYBA 2WKDA 1STYA 4BY1B 3KBXA 1D1IA 1DOKA 5DM63 1JOOA 2TSSA 3J81L 4KHVA 2N88A 4BWGB 4FNFA 1TS4A 1NR2A 2HCCA 1Y8NB 2F4IA 4A3DB 1QNUA 2JSOA 1PMRA 1C4QA 2PW5A 4F7XA 4X3SA 1K8MA 2PMZB 1STHA 1CA6A 2JA8B 4ILWA 4KK7A 2L5TA 3EQLC 1Z6HA 2B2VC 2Q8IB 1E2WA 1WTOA 2NUCA 4M8AA 1X3QA 1OXSC 1LT6D 2B2YA 2XRSD 2X6LA 3PUXA 1IKMA 2F0FA 1EL0A 4OIJA 4E6IA 4TRDA 1HA6A 3DEOA 5CV8A 3K7AB 1A2TA 4C2MB 3L3OC 2IWHA 1M4VA 2F0DA 4A3BB 1QILA 4TSSA 5C4ZA 2ID0A 3H0GB 1DM0B 1Q12A 3BDCA 4TKOB 4BA2I 3CRLC 4ME5A 1AW7A 3T56B 1Z7TA 2Z1CA 5EBDA 1G2TA 2G9HD 1LTRD 4KKUA 2KQ3A 2MPMA 3SR1A 2E2IB 1F9SA 2ZT9C 2WINB 3C46A 4N9TA 1STGA 2RVLA 2CHBD 4KY7A 4F8MA 4Y7NB 1LTSD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X32 A;  1KNE A;  5DNF A;  1EOT A;  1NR2 A;  2N55 A;  2HCC A;  2FHT A;  1PLF A;  1E0B A;  5EKI A;  1JE4 A;  1EIG A;  1JIC A;  2K28 A;  5EQ0 A;  3IFD A;  2HUG A;  4LMQ D;  1G2S A;  1BNZ A;  4ZKB B;  1DZ1 A;  1X3P A;  5E4W C;  2B2Y C;  2D9U A;  1AZQ A;  2L1B A;  1SAP A;  4X3S A;  4X3U A;  1PFB A;  4IUT A;  3I91 A;  1CA6 A;  4CJ2 C;  1HRJ A;  2B2T A;  3G7L A;  3ONA B;  4HCS A;  3I3C A;  1NCV A;  3MWY W;  1SSO A;  1GUW A;  4QUC A;  1F9R A;  2L4N A;  2B2W A;  1ILP A;  4X3K A;  1HUM A;  3KUP A;  2B2V C;  1HFG A;  2MGS A;  2K1B A;  3UI2 A;  1LV9 A;  5T1I A;  5COY A;  2HDL A;  4RAU C;  5CBA E;  2K03 A;  1O7Z A;  1WTO A;  1WTQ A;  1WTX A;  2JYO A;  2M2L A;  1QE6 A;  5AFW A;  2K01 A;  3HP3 A;  5D65 A;  1X3Q A;  4CJ0 B;  4MN3 A;  5JJZ A;  3IL8 A;  2L12 A;  2J7Z A;  1DON A;  1ILQ A;  3GV3 A;  1Q3L A;  2L11 A;  3I90 A;  2B2Y A;  2DY8 A;  2FFK B;  2L9H A;  3GV6 A;  5E4X A;  1WTV A;  1U4P A;  2X6L A;  2K05 A;  1B53 A;  1XX8 A;  4U68 A;  1IKM A;  2DY7 A;  1F9Q A;  1NR4 A;  1TVX A;  2KEE A;  2X6G A;  1MI2 A;  2IL8 A;  4UAI A;  5EJW A;  1CM9 A;  2BDN A;  3D6W A;  3H91 A;  3TN2 A;  4QUF A;  1BF4 A;  2B2U A;  1B2T A;  1DOM A;  2RSN A;  1EL0 A;  4RWS C;  2B2W C;  1S4Z A;  4OIK A;  4OIJ A;  1AZP A;  2MP1 A;  1ICW A;  2EPB A;  1EQT A;  1VMP A;  5D14 A;  3DM1 A;  1ROD A;  1WTW A;  1HA6 A;  2K04 A;  2SDF A;  5EPJ A;  1J8I A;  3DEO A;  4RA8 A;  1WD0 A;  5CBE E;  2XIW A;  2Q8T A;  4IUP A;  1U4R A;  1G91 A;  1RHP A;  5CMD A;  1PDQ A;  3TZD A;  3FPU B;  1NAP A;  1O7Y A;  3I8Z A;  3N52 A;  1WTR A;  4XT3 B;  1WD1 A;  2B2V A;  1QG7 A;  1ZXT A;  3P7J A;  1EIH A;  1IL8 A;  1VMC A;  2MJ8 A;  4ZLT F;  1KNA A;  2B2U C;  1CA5 A;  4X3T A;  1U4L A;  1PFN A;  4IUV A;  1XYI A;  1B4O A;  1SDF A;  4IUU A;  4XDX A;  2JP1 A;  3DEP A;  1C8C A;  1MSG A;  1MSH A;  4IUR A;  3FDT A;  1DOL A;  4NW2 A;  5T1G A;  3Q6S A;  3F2U A;  1F9P A;  1M8A A;  1HFN A;  1B50 A;  2HCI A;  2NYZ D;  2KEC A;  1MGS A;  2KOL A;  1ML0 D;  2X69 A;  1ESR A;  1WVL A;  2H1E A;  1A15 A;  2EOT A;  3LWE A;  4ZAI A;  1O80 A;  1G2T A;  1RTO A;  2KVM A;  4O42 A;  4DN4 M;  2KUM A;  5COR A;  2EE1 A;  4CJ1 B;  2KED A;  2VXW A;  1BBX C;  1PFM A;  2MPM A;  4IUQ A;  5EPK A;  3SVM A;  4XT1 B;  1IKL A;  5EPL A;  4R9W A;  2NZ1 D;  1BO0 A;  2Q8R E;  4MHE A;  1F9S A;  2HDM A;  3QO2 A;  1J9O A;  1F2L A;  1HHV A;  4HSV A;  3R93 A;  3KBX A;  1HUN A;  2FIN B;  1DOK A;  4R8I A;  3MTS A;  4ZKC B;  1U4M A;  2CVR A;  1B3A A;  2FMM A;  2RA4 A;  4ZK9 B;  1G6Z A;  2RSO A;  4HED A;  2FJ2 A;  2NWG A;  4HAE A;  2RVL A;  1RTN A;  2N88 A;  1WTP A;  1QNK A;  1AP0 A;  2R3Z A;  2B2T C;  1RJT A; 
#chains in the Genus database with same CATH topology
 3I70 A;  4L5R C;  5EQ0 A;  4POG A;  3EFX D;  2EVB A;  3VYU A;  2RCN A;  4IQZ A;  1ENA A;  4RHR A;  3BVZ A;  5LMN Q;  5FLX L;  2EQS A;  3WWV A;  4HN7 A;  1NMF A;  4JOI C;  5JVG 3;  3DUZ A;  2PMZ E;  3M7G A;  3RLN A;  1CSQ A;  2XN9 C;  3S9W A;  5M5Y H;  1KLG D;  2FXQ A;  5JEA J;  2PCF B;  1PH8 A;  1Q46 A;  5HY6 A;  2HQE A;  3PF5 A;  1VQJ A;  3W5O A;  1H9K A;  4JV5 L;  3RUZ A;  3PIP A;  1YJN A;  3NTI A;  1WFQ A;  5A2Q L;  3SK5 A;  2ALY B;  3CCS A;  4NB3 A;  5DM7 3;  1JCK B;  2B39 A;  3SDZ A;  1VMP A;  3EJI A;  1PH7 A;  2F03 A;  3DM1 A;  4H44 C;  3CCM A;  2QDL A;  4CDE C;  5M9O A;  4DV3 Q;  2HQL A;  4IZ8 A;  2A1A A;  3KOJ A;  2VB2 X;  2UXD L;  1EY8 A;  2F0L A;  1CA5 A;  4IUV A;  3NE5 B;  1RCV D;  1GM5 A;  1SXT A;  4A3L G;  1K3R A;  3DEP A;  2A69 D;  4C3H B;  3FDT A;  4J6H A;  5T1G A;  4DV0 L;  3Q6S A;  4PZ7 A;  3S1R B;  2QGQ A;  2ZXP A;  4RCN A;  2IX3 A;  2E2I H;  1VQE A;  3KJP A;  1JB7 A;  1IYU A;  4OO1 H;  1CKN A;  2A6E D;  4BA1 I;  4JI3 L;  4LJZ C;  1EQQ A;  2DNE A;  4KI0 A;  1FJG Q;  3CXC A;  4GZY C;  1X55 A;  1JJG A;  3A0J A;  3SVM A;  3D4W A;  3PCO B;  2RHS B;  5J22 A;  3DMU A;  4G7H C;  1F2L A;  4FF1 A;  1VCI A;  2CVR A;  1AEX A;  1Y1W B;  1PH2 A;  2FJ2 A;  5IGF A;  4O0A A;  1VF7 A;  2HD3 A;  2E76 C;  2ES2 A;  4A93 B;  3AYH B;  3GTJ B;  2H5X A;  4H13 C;  2JA7 B;  1EOT A;  3HKZ E;  3S16 H;  4FYD A;  1L0X B;  3MFY A;  1SLJ A;  5M3M B;  2MQH A;  5C44 G;  1TS3 A;  4K6D A;  1FGB D;  4DR7 Q;  1HZB A;  2R7Z B;  4QB4 A;  3NEM A;  4YHH Q;  3RZD H;  3NXW A;  4DV0 Q;  2K1B A;  2K32 A;  5HGT A;  3KDF A;  5CBA E;  1O7Z A;  1B7Y B;  5D65 A;  2OWO A;  1E22 A;  1YEZ A;  1RIP A;  4AYB B;  4DNR B;  3VR5 A;  5E4X A;  4PZ8 A;  5ELD A;  2EXZ A;  1CK1 A;  1GKH A;  1OXT A;  3D8G A;  4EVO A;  1PV4 A;  4MTK A;  1HNX L;  5LMU L;  1QCB D;  1CM9 A;  4K6L A;  3M7N A;  2E74 C;  5JPM C;  2PI2 E;  1R4Q B;  4DXG A;  4RMF A;  3STB D;  4C3J H;  1JT8 A;  3A8K E;  3G71 A;  5CBE E;  1N36 L;  2UUC L;  4JI6 Q;  3GTK H;  1VQM A;  1O7Y A;  3I8Z A;  1CQF A;  4C3I B;  4L8J A;  2PQA A;  4DV7 Q;  4LUZ A;  3WOF A;  1NY4 A;  4DK0 A;  4K14 A;  5K36 G;  1KAB A;  2FMC A;  3TZU A;  1HA5 A;  2WB1 B;  4OO1 I;  1PRT C;  4QMG A;  4XYQ A;  1ML0 D;  4CBV A;  3KFU A;  2NVX H;  2OT2 A;  3C1F A;  2VS1 A;  1GD7 A;  3DXJ C;  4K2K A;  3MAQ A;  1YNN D;  2VQF L;  1JJ2 A;  1ENF A;  4OL7 A;  3K0X A;  3S1M B;  5EPL A;  1SNP A;  5IP7 G;  1DXM A;  4OGQ C;  4H7B A;  1PTO F;  2BA1 A;  3V96 A;  5KNB A;  3TME A;  4A93 G;  1XPO A;  1X65 A;  1B9M A;  3IAY A;  1KHI A;  4WJW A;  4B3T Q;  4DR1 L;  2QEJ C;  2AWO A;  2VQE L;  2F1M A;  2RSO A;  3EN2 A;  4OEL B;  3H0G H;  1IXR A;  1IYJ B;  3A7L A;  1Q7Y C;  4OX9 Q;  3CME A;  2NTT A;  2N3S A;  2LXJ A;  4DUZ Q;  4GOP B;  2UUC Q;  1SRU A;  1QUQ B;  2EY6 A;  5F2D A;  1CKM A;  2RHQ B;  1QJO A;  1SE2 A;  2A73 B;  1BNZ A;  3S2D H;  3M4P A;  2UXC Q;  3QWN A;  2L1B A;  2MHV A;  3KK7 A;  1TWC B;  5IP9 H;  2M00 A;  3CCQ A;  1EZ6 A;  1LT5 D;  2B2T A;  1E1T A;  3OIP A;  3I3C A;  4FXG C;  4X64 Q;  3SEB A;  3HOY B;  3S2D B;  1PVO A;  1YIJ A;  3GTM H;  5IT9 E;  5C6A A;  2E5L Q;  3P75 A;  2QKI C;  3BDO A;  4J8Q A;  1W6K A;  4P74 A;  1W6J A;  2Z6B A;  3A54 A;  3I2Z A;  4DK1 A;  5JPN C;  3AU7 A;  2LS0 1;  2DY8 A;  1EIF A;  4YCU A;  1VQ5 A;  5JOB A;  4DR1 Q;  4B3T L;  2R92 G;  3FHW A;  4HSP A;  3KLW A;  4R4C A;  1Q8K A;  2BDN A;  5M5W H;  1S5F D;  3A55 A;  2B2U A;  2CWP A;  4LF6 L;  2C35 B;  4C3I H;  1TR5 A;  3U4V A;  3PO3 G;  3UE0 A;  4RGM A;  1HR0 W;  2A8V A;  4H02 A;  5EPJ A;  3PIP 3;  1X54 A;  3D4R A;  4A3C H;  1YIT A;  5NUC A;  3PQI A;  4BBS B;  3T53 B;  4K0K L;  2PI2 A;  1KXL A;  1OTC A;  2YU9 H;  2E2J H;  3OPO A;  1HQM C;  5JJL A;  2JA5 G;  3GTG H;  1GOZ A;  4ZLT F;  4GLX A;  2IT1 A;  1SDF A;  4XDX A;  2CKZ B;  1TWG H;  3L0O A;  5CV5 A;  3VYR A;  3TEH B;  3HOV B;  2QF7 A;  3S1N H;  1M8A A;  3ERQ A;  1Z9F A;  1B50 A;  1FJG L;  5EBC A;  4X66 Q;  2CQA A;  1LM0 A;  2X69 A;  1ESR A;  2ICE C;  4KHP L;  1VQC A;  3S1N B;  1J6Q A;  4RKL A;  1KLU D;  1SR3 A;  5BN4 A;  4A3J B;  2NVT B;  4IUQ A;  2EIF A;  2RKS A;  4O2D A;  1L0Y B;  2WV6 D;  1VQ4 A;  1SFO B;  3HOV G;  2IW3 A;  2K5W A;  2K5D A;  3F1Z A;  5FOB B;  1IBM L;  2G5D A;  3HOZ G;  2NN6 H;  4KD4 A;  1U4M A;  3J7Z C;  1Y1W G;  2ZXR A;  3A7A B;  5I2X A;  3NEN A;  1WTP A;  1HNZ L;  3CCU A;  2KA7 A;  2B3G A;  3K59 A;  5DNF A;  4H0L C;  2J4X A;  1PLF A;  3S1R H;  4A3E G;  4ZKB B;  1I4H A;  3E9I A;  3ND8 A;  3PO3 B;  1T5X D;  3NWT A;  4DR7 L;  4X3U A;  1IBK L;  4N8F A;  3MXN B;  4BY7 B;  3J81 i;  3TRZ A;  3HZX A;  2NN6 I;  4M1U B;  2L4N A;  2B2W A;  1S5D D;  4C1N I;  3L7Z C;  4MZ9 A;  5T1I A;  3BZK A;  5GAE C;  2K01 A;  1Z47 A;  3IL8 A;  2CCZ A;  5IOD A;  1R4P B;  5LHY 1;  4AQY L;  3GQB A;  4DV5 Q;  4BXX G;  4FDB A;  5CC4 A;  2LKV A;  2JA7 H;  3FEW X;  1AE2 A;  4A3E B;  3HOX G;  4R8N A;  4I65 A;  5IYB H;  3AFP A;  4P75 A;  1XNQ L;  1B9N A;  3S1M H;  2F0S A;  1S5C D;  3SK8 A;  2JXM B;  1ROD A;  2YV5 A;  1BVS A;  4A3E H;  1TWF H;  1U4R A;  3PGZ A;  4FO2 A;  3HKS A;  5C3X A;  4DV1 Q;  3OWE B;  1W2B A;  3VR2 A;  2VQE Q;  4K5W A;  4X65 L;  1MIU A;  1PFN A;  2HHH Q;  1CT1 D;  4A76 A;  1MSG A;  3U50 C;  3NQT A;  1GUN A;  2DJF C;  2R93 B;  3H09 A;  2NZO A;  4WJ4 A;  3F2D A;  4OWT B;  4XYO A;  2KOL A;  3I4L A;  3TDQ A;  4JI0 L;  2H1E A;  3HOY H;  2O4X A;  4C3H G;  3CCR A;  1I50 H;  2VXW A;  4DU9 A;  2H4O A;  4NKL A;  4LFB L;  4APV A;  1BO0 A;  1UE1 A;  1TWA H;  1PH3 A;  2PW7 A;  1VQ7 A;  2VUM B;  3A56 A;  5ELO A;  3F2B A;  3R93 A;  4UHV A;  4BBS G;  3H94 A;  4DV7 L;  3M4Y A;  3MTS A;  4JV5 Q;  3K0Y A;  3M9B A;  1JB3 A;  1NBW A;  2A19 A;  3CMA A;  2AQ2 B;  4DR4 L;  2D5D A;  2R3Z A;  1H9S B;  2SEB D;  2IPK D;  4N9P A;  2N55 A;  1JIC A;  1VQO A;  2HUG A;  2OTJ A;  2SNM A;  1BCP C;  1TS5 A;  1FNV A;  5IGE A;  2F0Q A;  4DR6 Q;  1BCP B;  3QJY A;  3G7L A;  3ONA B;  4HCS A;  4HJ9 A;  1NCV A;  1OO9 B;  1I4R A;  2D2C C;  3V05 A;  3RN5 A;  4G4K A;  3I4N B;  3EA6 A;  4GLV B;  4EX5 A;  2K03 A;  1KRT A;  4CJ0 B;  2ZM6 L;  4JBK A;  4GNX A;  3H6M A;  3HOV H;  4OHJ A;  1P16 A;  4P72 A;  3I4N G;  2L9H A;  3HOW G;  2K05 A;  3TBI B;  3S1Q B;  1D5M C;  4IOA A;  1OXV A;  1PZJ D;  3TN2 A;  3ZJY C;  4X66 L;  4RH6 A;  4A3J H;  5C4J B;  3BDL A;  2VQF Q;  2ZTE A;  1Y1V H;  2SOB A;  1GVP A;  2Q2I A;  5BR8 L;  2EJM A;  4PMB A;  2AUK A;  2JA7 G;  1AFP A;  3MZ5 A;  1JWS D;  3W3A A;  3I7F A;  5CMD A;  3S15 H;  4YY3 Q;  3GTM B;  3A74 A;  3LWU A;  3N52 A;  3ERO A;  3ULJ A;  1IL8 A;  4PZ6 A;  3I4M H;  1HXY D;  5DLQ E;  3J80 c;  1I4P A;  1EYD A;  1B4O A;  1LO5 D;  2JK8 A;  2JP1 A;  1VQI A;  4DKA C;  4C3J G;  1VF5 C;  4A3K H;  3CC4 A;  5IIF A;  1EEF D;  3F2U A;  4B9X A;  2UU9 Q;  3I4M B;  4LF6 Q;  2L0C A;  2NYZ D;  1MGS A;  2DJG C;  2K7V A;  2NVQ H;  1VQB A;  4PNY A;  4JG2 A;  1D2B A;  3ULL A;  1N36 Q;  3LWE A;  1F77 A;  1RKN A;  1U5K A;  4DN4 M;  2JN4 A;  2HIV A;  1CTM A;  2AWN A;  1K83 H;  1DCZ A;  3CQZ H;  4YCW A;  5EPK A;  1XMQ Q;  3K57 A;  2NZ1 D;  1GUO A;  4B3M L;  1EY9 A;  2BE5 C;  4LF4 L;  2K33 A;  1PH1 A;  2F3I A;  3RZO B;  3OOC A;  1HNZ Q;  1A0I A;  4NPS A;  3I56 A;  3CQZ B;  3TQY A;  3R3O A;  5KYI A;  2OXP A;  4YIJ A;  1TWG B;  3J80 E;  1G8Z D;  3TP5 A;  4B3M Q;  2XSC A;  1SYE A;  1XMQ L;  2VZA A;  3HOZ B;  1UWV A;  4JI2 Q;  3TP8 A;  5BN5 A;  4P2C B;  5E4W C;  2R92 B;  3KF8 B;  3RNU A;  4UP8 A;  4PMC A;  4KHP Q;  1G6P A;  5EAY A;  5FO9 B;  1W3S A;  3CKI B;  3K7A H;  2PZT A;  2EYM A;  1GO3 E;  1E7Z A;  1SE3 A;  3E5S A;  4CDD C;  5JAV A;  1S40 A;  3CU7 A;  3A5U A;  3H15 A;  1Q86 C;  3S17 H;  1WTX A;  3D0F A;  1QWY A;  4JYA Q;  5JJK A;  1A3V A;  4A3M B;  4A75 A;  2ICI A;  2J7Z A;  1EQR A;  3K5M A;  3I90 A;  1QZG A;  3S17 B;  1HNW L;  3GO5 A;  1S5E D;  1SBB B;  1JQY D;  1B53 A;  2LSS A;  4GOP C;  2UUB Q;  1XX8 A;  1F9Q A;  3P20 A;  1TVX A;  4A3M H;  4BY7 G;  2V1C C;  4JI0 Q;  1Y14 B;  1QVF A;  2WAC A;  3DWQ A;  4A3B G;  2WP8 J;  3NUC A;  1TY0 A;  1TII D;  4AIM A;  1TWA B;  2K04 A;  2SDF A;  3QIA A;  1SYC A;  4LWC A;  1IW7 C;  5C0X J;  2I0Q A;  2NTS A;  1RHP A;  3PO2 G;  1WTR A;  2B2V A;  4DGZ A;  3LGJ A;  4QJF A;  1IW7 D;  4ID6 A;  4NP5 A;  2BOS A;  1A3T A;  4Y7N H;  2Z6K A;  3FRP B;  2L15 A;  3DLL A;  2IJ0 A;  1ESF A;  1KD1 C;  2RDH A;  1N34 Q;  2KEC A;  4DF7 A;  1F2Z A;  4X64 L;  2BH2 A;  5EKL A;  3FKI G;  2WAQ E;  3T13 A;  3GTQ B;  2JEB I;  1PYB A;  3SE0 A;  5IYD H;  3BJU A;  1TWH H;  2MNA A;  2JEA I;  3AEV A;  4DFA A;  4JI8 L;  3DHQ A;  1STB A;  2ENB A;  3LX0 A;  2XNA C;  3BYY B;  3K7U C;  2CW0 D;  1FNW A;  2PNH A;  4ZUJ A;  4FF4 A;  1V1P B;  2FIN B;  4R4I A;  4R8I A;  4KN7 C;  2R92 H;  3T1Y L;  3HOU B;  4HED A;  2NWG A;  2GVA A;  3HOX H;  4L6T B;  2B2T C;  1IBK Q;  4IOC A;  2RQX A;  4LF9 Q;  1FNU A;  3KBG A;  3TS2 A;  1PZI D;  1SNO A;  5IP7 H;  4A3G B;  1E0B A;  2R93 H;  3QR8 A;  4LMQ D;  2N78 A;  1PA6 A;  1G2S A;  1AZQ A;  1KAW A;  5E1F A;  1BDO A;  4A3G H;  1PFB A;  2Z0S A;  1HRJ A;  3EVQ A;  3EIV A;  3N6R A;  4POF A;  2BCO A;  5ELB A;  3VYT A;  2OCE A;  3KUP A;  3MHB A;  3J7A F;  3MXN A;  2HDL A;  2WFW A;  2WB1 G;  3DWP A;  3HP3 A;  4LK1 C;  4JYA L;  1A6X A;  5G3L D;  2F0J A;  1MD2 D;  4ABN A;  1Y69 U;  3TSS A;  2JA8 H;  1Y8O B;  4A3F B;  5M3F H;  3DWA A;  3QOJ A;  3HOY G;  5IT9 c;  2EYO A;  4UP7 A;  5I6W A;  2RDF A;  3JAM i;  1PRT B;  4JI3 Q;  2UXB L;  3OIQ A;  3HKZ B;  1BF4 A;  1BXT A;  5LL6 S;  4KKS A;  2B63 B;  3FPP A;  4A3F H;  2ZTD A;  2B2W C;  5C3W A;  1VQH A;  4CDF C;  1ZEQ X;  4JI2 L;  5FK9 C;  1SRO A;  1B44 D;  5LL6 X;  2WAQ B;  2F0G A;  2UUA Q;  1I6H B;  1N34 L;  4HCE A;  3CCL A;  1L1O A;  2B29 A;  2AKW B;  1UE7 A;  1YNJ D;  1QVG A;  4EQ5 A;  3OW7 A;  3T51 B;  1XPU A;  4X62 Q;  1PTO B;  1U4L A;  2A5H A;  1XYI A;  2KHI A;  4DAP A;  2QEX A;  1ZKO A;  4A93 H;  1I4Q A;  1TWH B;  1YVC A;  4IAL A;  1LT3 D;  3R2I A;  5H1S E;  4LFC L;  3AQQ A;  2RBM A;  2K14 A;  1SE8 A;  4CGY B;  3OMC A;  1TY2 A;  5IYD G;  1RDP D;  4BBR H;  1E2V A;  1ET6 A;  2AHO B;  2AQ3 B;  2KCT A;  3E3X A;  4WOR A;  5C0X I;  1UUP A;  3PO2 H;  1O7L A;  1SYG A;  1J5E Q;  1L2F A;  3AMU A;  4LF7 Q;  4XXE A;  2UUA L;  3CPF A;  4JI7 Q;  5ELE A;  4A3K B;  3CD6 A;  2XVS A;  1MHW C;  5EKI A;  4KKT A;  4KJN A;  3K81 C;  3IFD A;  4DK3 C;  1Y1V G;  2A68 D;  4KD3 A;  2I5L X;  5IT9 L;  5A35 A;  1SJH D;  3TP7 A;  5E3F A;  3FKI B;  5L37 A;  4DUZ L;  2ASB A;  4IJH A;  1BUV T;  2K52 A;  4C1N K;  1YNX A;  4NXM Q;  1HFG A;  1G51 A;  3UDI A;  2EXD A;  2JJQ A;  5COY A;  1N9W A;  3OWF A;  3RZO H;  1STA A;  3NBH B;  1GUS A;  2EJG C;  3BG3 A;  2Z9H A;  2DY7 A;  2Z8L A;  4A3D G;  3V2T A;  1ZYR C;  3VDY A;  2HIX A;  2Y0S G;  4IJL A;  3Q8D A;  1FR3 A;  4YCV A;  2F0M A;  3BZD B;  4LAA A;  4ME3 A;  2K75 A;  1KL9 A;  1UEA B;  4PQX A;  3A8J E;  4B08 A;  4IUP A;  4C56 C;  2KHJ A;  4L5S A;  1I94 L;  3K8A A;  1ZXT A;  5FLM H;  3HOX B;  2EJF C;  2BH8 A;  3C1E A;  2E2D C;  1EUJ A;  2D0O A;  2GVB A;  3A5Z B;  4X3T A;  3X3N A;  4A3J G;  2R61 A;  2VUM G;  3M4O B;  2IY5 B;  1LAC A;  4GOP A;  2F0O A;  2PPB C;  2F3V A;  2E75 C;  2K5H A;  1HFN A;  4QQB X;  4LFA L;  4FVM A;  1TS2 A;  3PSI A;  1H9J A;  2JA8 G;  1EY5 A;  1YHB A;  1K28 A;  2E2H H;  5C44 H;  5IP9 G;  3MXU A;  1A15 A;  1QOH A;  1VDZ A;  3RN2 A;  1HQR D;  2QCP X;  1SMY D;  5DAU A;  3I73 A;  2OQ0 A;  1EFI D;  3NWS A;  1B3Q A;  1IKL A;  2CH4 W;  2DN8 A;  3CAM A;  4EGV A;  4C3J B;  4HIK A;  1EY6 A;  4OEM B;  4JBW A;  3NPP A;  5IY0 A;  1HHV A;  4DR2 L;  5M3F B;  4YWM A;  5CV9 A;  2F4V L;  4DV1 L;  4HJ8 A;  2ZXO A;  3BVM A;  2Y0S E;  3IRB A;  2F0V A;  2FHT A;  1KIX A;  3VR3 A;  4QGU A;  3HGB A;  4R4O A;  1RF2 D;  2B2Y C;  3U4Z A;  4F87 A;  3SXH A;  1SAP A;  4GNX C;  2YTV A;  2I07 B;  4JI7 L;  1ICF B;  4LF7 L;  1P8L A;  5I2Y A;  3W1B A;  4R4Q A;  1UNS A;  4NDX A;  4OWX B;  3U9O A;  2KHS A;  2YU9 B;  3I4M G;  1ILP A;  3S16 B;  1HUM A;  4AH6 A;  4DUY L;  4RAU C;  2EYH A;  1WTQ A;  4IN3 A;  1AN8 A;  1EU4 A;  1SYF A;  1YHQ A;  1GHJ A;  2TMP A;  3NEL A;  4DV4 L;  2YTX A;  1Q3L A;  4HIM A;  1UE5 A;  1S72 A;  1XXG A;  1SYD A;  2KEE A;  4HMI A;  4LFC Q;  1BCP D;  1VQP A;  3MFG A;  4UP9 A;  2N8N A;  3SHL A;  5KRU A;  2JQO A;  4JI8 Q;  1VQN A;  1UEB A;  4OIK A;  1JOQ A;  1AZP A;  1S5B D;  5D14 A;  5IYB G;  2QA4 A;  1CHQ D;  4IO9 A;  1X9N A;  1D5X C;  2I5H A;  4RA8 A;  3TRE A;  1WD0 A;  1SFO H;  3CF5 A;  1CQV A;  1G91 A;  4OO1 G;  2BDO A;  2B63 G;  3M3Y B;  4X6A H;  5AJ3 Q;  4IFD G;  2B8G A;  4IPD A;  1WCM H;  5GAD C;  1PFS A;  1IBM Q;  2LMC B;  4LF4 Q;  3MA2 B;  1SNC A;  1MSH A;  2A6H D;  2AUJ D;  1PRT F;  1C0A A;  1Q8I A;  2WKC A;  2HT1 A;  3HG9 A;  4DAY B;  4G7Z C;  1KAA A;  1YNN C;  3MC0 B;  2PQA B;  1KC8 C;  4EQP A;  1C48 A;  4J15 A;  5C0X G;  5KGU A;  1QZH A;  1HZA A;  2KED A;  2UU9 L;  1NUC A;  4K2L A;  3STB C;  1K3B C;  1X3G A;  2D62 A;  4I7Z C;  3RR5 A;  2MO0 A;  1N33 Q;  3GTO B;  1D1K A;  4DA2 A;  4OON A;  2ZJP A;  3RLO A;  4L5Q A;  5GQO A;  3PF4 A;  3E0E A;  2E2J B;  2JA5 B;  4AQY Q;  4UPA A;  1EWI A;  4YY3 L;  3GTO H;  1TKW B;  1BBW A;  1QNK A;  4ZRZ A;  4CKE A;  2A68 C;  1WCM G;  5C3E B;  5GAG C;  5D3I B;  4V19 0;  5M5X H;  3K5N A;  1V1P A;  2VL6 A;  3GP7 A;  3NBH A;  3BZC A;  3D31 A;  1I5F A;  3G6E A;  2R6G A;  4A3C G;  4B9W A;  4IUT A;  3RD4 A;  4C2M H;  4DV2 L;  1SSO A;  3NSW A;  1CSP A;  3CW2 C;  2QDB A;  1F9R A;  1C7Y A;  4LF5 Q;  3GTL H;  4DR5 L;  4WRD A;  1BKB A;  4HJA A;  4RG1 A;  2A6H C;  4MN3 A;  2A69 C;  1I3Q B;  1DON A;  1V1Q A;  3GV3 A;  5AJ3 L;  1FD7 D;  2V4D A;  4DV6 Q;  1XJV A;  5IYC G;  3ITP A;  3G48 A;  1CHP D;  3OMG A;  4A3D H;  1EOV A;  1C9O A;  2IX0 A;  3W1G A;  2RSN A;  1IBL L;  1LUZ A;  4BBR G;  2MP1 A;  1JWU D;  1I50 B;  1ICW A;  2AQ1 B;  2EPB A;  5EGT A;  1EQT A;  2ATW A;  1QB5 D;  3HFZ B;  2BA0 A;  3UDX A;  3AFQ A;  2VY3 A;  4DR3 Q;  1U0L A;  1PH4 A;  2EYL A;  1PDQ A;  1NSN S;  3FPU B;  4RGO S;  1A62 A;  1NAP A;  1HCZ A;  5C5L A;  1EIH A;  1I94 Q;  1RL2 A;  3LNN A;  1LAB A;  4DV4 Q;  4KV6 A;  5IGD A;  1H95 A;  1LTB D;  2NVX B;  3K6O A;  4DUY Q;  2E8G A;  4LF8 Q;  2RCF A;  4EQO A;  1EYA A;  1F9P A;  2EY2 A;  3CRK C;  5CV7 A;  4IFD H;  1X6O A;  1EY7 A;  2D0P A;  3E0J A;  3L9A X;  1PRT D;  1I4G A;  1CZG A;  5LMN L;  3ICE A;  3PUW A;  1RTO A;  3J80 i;  2UUB L;  2JA5 H;  3G6J B;  1XPR A;  3NTK A;  4PG3 A;  4XQN A;  1HNW Q;  2EZV A;  2QW7 A;  4G57 A;  5M5Y B;  4XT1 B;  4CKB A;  4LUV A;  4JC0 A;  4KMU C;  4LF9 L;  1CFM A;  4Q0F A;  1YHA A;  5C3E H;  2RF4 A;  2XRQ D;  4UDU C;  4HSV A;  1V1O A;  4X65 Q;  1NTG A;  1A3U A;  1KTK A;  1EIY B;  2J0T D;  2ZJQ A;  2F0N A;  2WAQ G;  2EYP A;  3UE1 A;  1G6Z A;  5D3D A;  1VQ6 A;  1EY0 A;  4GS3 A;  3VYS A;  2F0K A;  1SEB D;  1SND A;  4A3L H;  1T5E A;  4FF3 A;  3PUY A;  3CC2 A;  1XWE A;  4S3S A;  4L5T A;  2K5V A;  4RGT A;  1Q90 A;  1BCP F;  1JE4 A;  4GN4 B;  3OTO Q;  3BVG A;  3CCJ A;  3J81 E;  1X3P A;  3F8T A;  1D5Z C;  4QCL A;  5C4J H;  3Q23 A;  2E2H B;  4P73 A;  2A6E C;  3FMC A;  2K6A A;  5LMN W;  1EWC A;  1I3Q H;  4FXK C;  1J5E L;  1HTP A;  3MWY W;  5JJI A;  2P5Z X;  2ZJR A;  1GUW A;  2UXC L;  4DV6 L;  2DUD A;  3HOW B;  4HR7 B;  3VR6 A;  1TWC H;  1E3P A;  3NQI A;  1E2Z A;  2VB3 X;  4KY5 A;  2JYO A;  4JBJ A;  5AFW A;  4DK6 C;  4IFD I;  1ILQ A;  5I9O A;  1LTA D;  2O2L D;  1U4P A;  2R7Z G;  3J80 L;  4U68 A;  1NR4 A;  4AYB E;  1V43 A;  3GTK B;  3H91 A;  3RMH A;  2F0H A;  1DOM A;  1LTG D;  3JC6 6;  2WB1 E;  3I55 A;  1EWH A;  4KLK A;  3K5L A;  3HOU G;  2XIW A;  1E1O A;  5FO7 B;  1G29 1;  3TZD A;  1WD1 A;  3D6C A;  4JW0 A;  1MJC A;  3P7J A;  1EFW A;  1VQD A;  2MJ8 A;  4GLA C;  2I46 A;  1PH5 A;  2EY5 A;  5ELN A;  1STN A;  3DM3 A;  3GD7 A;  4GN5 A;  4K8I A;  4J1M A;  5M5X B;  3KYH C;  4NW2 A;  4IPG A;  5J1Z A;  4JI1 Q;  2O5J C;  4GNX B;  1HJP A;  3HOZ H;  2OEO A;  5I9P A;  2MFI A;  4ULL A;  1WVL A;  2CWA A;  1XNR L;  3PMF A;  4I7A A;  3WOE A;  2R7Z H;  4O1N A;  3ZYY X;  1JOK A;  2KCN A;  3GDE A;  4JI5 Q;  1F2M A;  3GTL B;  1FL0 A;  3S14 B;  3RLF A;  4R9W A;  1ENC A;  3KJO A;  1FGU A;  4MHE A;  2ZM6 Q;  2HDM A;  3T16 A;  3QO2 A;  1J9O A;  1HUN A;  3HS0 C;  1B2T A;  2XGT A;  1WCM B;  1MBY A;  3SK6 A;  3T1H L;  1RTN A;  2QIL A;  1HZ9 A;  3J7A V;  4C3H H;  3FP9 A;  4DAV A;  1KNE A;  3KLS A;  3WDN A;  1Q81 C;  4JI4 L;  4RGN A;  2IHF A;  3AB9 A;  4BS9 A;  3E6Z X;  1KRS A;  3H3V H;  5E7N A;  1ZYR D;  4OXP A;  3I91 A;  2Q2T A;  1N8R C;  5JVH 3;  4ZUI A;  1JJC B;  5GAH C;  4XQQ A;  1VQG A;  4JI4 Q;  1LV9 A;  1K83 B;  1YI2 A;  5M5W B;  4PMW A;  2PZW A;  4ZCK A;  2EY1 A;  5JJZ A;  1JWM D;  3S24 A;  5I4D A;  2E5L L;  1D7Q A;  1SMY C;  3TS0 A;  1VQK A;  4GKJ Q;  2C9O A;  4TVA B;  4Z9C B;  2CH4 A;  4UAI A;  4MNO A;  4U67 3;  5C5M A;  5KEE A;  3CC7 A;  4RWS C;  3GTG B;  3OTO L;  1PHJ A;  1Q1E A;  1U9R A;  4ALP A;  1SE4 A;  3IFT A;  5EKK A;  1I4X A;  2F0U A;  1JOR A;  1K0S A;  1HZC A;  3RZD B;  5HUR A;  2F0T A;  4ZQ3 A;  4NMZ A;  1SNQ A;  1WJJ A;  1PZK D;  4RFB A;  1K8G A;  4JBM A;  1DOL A;  4QL5 A;  2NVY B;  1LYL A;  2NN6 G;  1YBY A;  4CHT B;  1VQF A;  3VR4 A;  1II3 A;  5KYL A;  2PO4 A;  5ISR A;  3MXP A;  5CV6 A;  1ET9 A;  1LTT D;  4O42 A;  2KUM A;  1TQO A;  4K5V A;  5C4X H;  3JAM E;  4DV5 L;  1K8O A;  4LFA Q;  1A8V A;  2N49 A;  1FYC A;  3R2T A;  3OSO A;  1JR0 D;  1A2U A;  4DR4 Q;  1XTC D;  4ZKC B;  4Q5V A;  3ERS X;  4ZK9 B;  1KDC A;  4JVZ A;  5M3F G;  1RD9 D;  1DGS A;  1EQV A;  1VQA A;  2XWJ B;  1TU2 B;  5C0X H;  2KBN A;  1Y8P B;  4BY7 H;  1AP0 A;  1X32 A;  4QIW B;  1K0R A;  2JA9 A;  4B3S L;  4LFB Q;  2YYZ A;  1DZ1 A;  2I5M X;  2D9U A;  1IBL Q;  5KND A;  4BBS H;  3NHH A;  5GRO A;  4HTH A;  3MEF A;  1BQQ T;  1EYC A;  1HTL D;  1B1Z A;  5C4H A;  3NK9 A;  1DYQ A;  3K5O A;  1PYW D;  3GTP H;  1QUQ A;  2CFM A;  1PTO C;  5JEA H;  3QOL A;  1JMC A;  5FLX E;  5FO8 B;  4G7O C;  1ASZ A;  1O7I A;  3S2H H;  2M9V A;  1ASY A;  2Q2U A;  1PTO H;  2KEN A;  3GTP B;  5BN3 A;  2L12 A;  4OX9 L;  3W2D A;  1V9P A;  1B8A A;  1V8Q A;  2FFK B;  4KJO A;  4A3I G;  3KF8 A;  4YHH L;  1R9T H;  3TP6 A;  3K58 A;  4DV2 Q;  1Y1V B;  5IWA L;  1MI2 A;  1XNR Q;  3Q22 A;  1SNM A;  2NVT H;  4IUN A;  2Y0S B;  2K50 A;  3BYT B;  1BOS A;  1HR0 Q;  3H3V I;  2KCC A;  1WTW A;  3HKZ G;  5C3E G;  2IX1 A;  2EYJ A;  2Q8T A;  1H9R A;  2VNU D;  3HOW H;  4KTA A;  2JA6 H;  4BY1 H;  1OXU A;  2MO1 A;  3Q24 A;  1QG7 A;  4DXF A;  4DNT B;  1KQS A;  4LF8 L;  1KNA A;  5J39 A;  4K0K Q;  1D8L A;  5K36 H;  4K5X A;  3J81 j;  2NVQ B;  4IUU A;  1IL2 A;  1GJX A;  5CGK A;  2O5I C;  5BR8 Q;  3URY A;  5A2Q E;  2SNS A;  4IFD J;  4F88 A;  4HIO A;  3L2P A;  3PO3 H;  1GUT A;  2HCI A;  1VQL A;  3ULP A;  1DJR D;  4JI6 L;  5FJ8 H;  2IHE A;  4DR3 L;  4B3R L;  4ZAI A;  5COR A;  2EE1 A;  2AMC B;  5C4X G;  2PZU A;  3R8B A;  3D4D A;  2XWB B;  3NP8 A;  1WOC A;  2Q8R E;  4A3K G;  3IKJ A;  5M3M G;  4RKB A;  4IPC A;  1NE3 A;  3KLS X;  1CI3 M;  3H0G G;  4X62 L;  1I6H H;  3T1H Q;  2FMM A;  2RA4 A;  1ONL A;  1XTD A;  1EY4 A;  4HJ7 A;  1IHZ A;  3C2P A;  5I6Y A;  4Y7N B;  1CZW A;  2A74 C;  1WTH A;  5CR3 A;  1RJT A;  2EDG A;  4DV3 L;  1EU3 A;  4WFN 3;  4N8X 1;  2K28 A;  3F2C A;  4LF5 L;  4JI5 L;  1TWF B;  2EYF A;  2JE6 I;  4B3S Q;  1UE6 A;  2C5C A;  4RHS A;  3J7Y W;  2LY7 A;  4QUC A;  3S14 H;  1I6V C;  1LTI D;  4X3K A;  5IGB A;  1JC7 A;  3D3R A;  4A3B H;  3S1Q H;  2CW0 C;  2K5Q A;  4KHZ A;  3J7A 5;  5CYU A;  4TQU S;  4MIU A;  4LNQ A;  4WJ3 M;  3KLR A;  1WI5 A;  1XMO L;  5JEA G;  4DPG A;  4UY8 C;  2G9D A;  4KY6 A;  1M1K C;  4QF4 A;  5EJW A;  4CKC A;  4RCO A;  2IL8 A;  5C44 B;  2JA6 B;  4FP5 D;  3MEH A;  1GUG A;  1H9S A;  1Q1B A;  4YWL A;  4GN3 B;  3OW2 A;  1YJ9 A;  1GXD C;  4A3I H;  1AH9 A;  2F0E A;  3X3M A;  5CV4 A;  4CDC C;  4OWW B;  1J8I A;  1VQ8 A;  3VA5 A;  1BBU A;  3SK4 A;  1OXX K;  3MVV A;  4ODG A;  5IYC H;  4YWK A;  3KF6 B;  1HH2 P;  3FKI H;  1BR9 A;  2NB0 A;  4XT3 B;  3G4S A;  4A3I B;  1K9M C;  2JA6 G;  1VMC A;  3NTH A;  4LUO A;  2B2U C;  4DR2 Q;  3PIO 3;  3SGI A;  3HEJ A;  1F2Y A;  3ND9 A;  1NJI C;  3E9H A;  4PV1 C;  2L55 A;  4LW1 A;  1B70 B;  2F0P A;  3UDF A;  1VQ9 A;  4JK1 C;  1FVI A;  4BXX H;  1L0W A;  3VA7 A;  4DAY A;  2R7D A;  5KNC A;  1QVC A;  1XNQ Q;  5DEH A;  3M4Q A;  3KDF B;  3B6Y A;  2Q2H A;  2EOT A;  4EQN A;  1O80 A;  4DR6 L;  2KVM A;  3U9S A;  2PNR C;  4ZYS A;  1K73 C;  1TT2 A;  1T9H A;  1L1O C;  1PFM A;  3S2H B;  2R93 G;  1YJW A;  2YTY A;  1MKH A;  4XTC S;  3HRZ C;  3PUZ A;  5FJ8 G;  2F3W A;  3QB3 A;  1KDB A;  1KDA A;  2KJX A;  1N32 L;  1IYV A;  1B3A A;  1H9M A;  4XIG S;  2Z4H A;  1PYS B;  4HAE A;  4K8J A;  4BY1 G;  2WII B;  4BBR B;  3JAM c;  5K5P A;  5IE8 A;  3M4O H;  2NVY H;  5FKA C;  1EIG A;  2Z4I A;  4XQJ A;  2F0W A;  4L63 B;  3PUV A;  4P71 A;  3T4A C;  1EZ8 A;  3S15 B;  4CJ2 C;  1EEI D;  2NBF A;  5C4X B;  4A3M G;  3OHX C;  1VS0 A;  4FF2 A;  3H3V C;  1GHK A;  4FXD A;  2MGS A;  3M3Y H;  3UI2 A;  1SMX A;  2BE5 D;  3FVQ A;  4JCV E;  3A8I E;  5IGG A;  1WYD A;  2M2L A;  2VUM H;  2RDG A;  1QE6 A;  4HMJ A;  2HHH L;  1N33 L;  2PYK A;  3MXG A;  2F4V Q;  2B63 H;  2L11 A;  2OQK A;  2K5N A;  4A4I A;  3GV6 A;  2VW9 A;  1WTV A;  3OYY A;  1N32 Q;  5ELC A;  5IOC A;  2X6G A;  3PV0 A;  5KIX A;  1AE3 A;  3D6W A;  1STE A;  3Q0A A;  4QUF A;  1DD2 A;  2OF1 A;  1S4Z A;  1YZ6 A;  4JI1 L;  3PIO A;  2F0I A;  3NBI A;  1PXU A;  3C3L A;  3O13 A;  3CP0 A;  5LMU Q;  5ELF A;  1Q82 C;  4GKJ L;  1JE5 A;  1LT4 D;  3JAM L;  3I4N H;  3QG1 A;  3EBE A;  4AYB G;  2UXD Q;  5G3L F;  1D6E C;  4IPH A;  3GTQ H;  1SN8 A;  1C8C A;  2OTL A;  4IUR A;  4QY7 A;  1PTO D;  3GTJ H;  4KN4 C;  2B8F A;  4DR5 Q;  2PQE A;  1R9T B;  2MUY A;  5HGQ A;  2LFN A;  2LXK A;  1M90 C;  4R1J A;  4DNI A;  1SJE D;  1YNJ C;  1TXY A;  4MTN A;  4V0B A;  4B3R Q;  1CUK A;  2GA4 B;  4GKK L;  1LTL A;  3BS1 A;  5TSS A;  2DNC A;  5FLX c;  1HPC A;  4CJ1 B;  5IGC A;  3I72 A;  3M85 A;  1BBX C;  3P1H A;  1LLR D;  4C3I G;  1O78 A;  3CHB D;  3CCV A;  3PO2 B;  1SYB A;  2WKD A;  1STY A;  4BY1 B;  2K4K A;  3KBX A;  1CKN B;  1D1I A;  1DOK A;  1X56 A;  5DM6 3;  1IZ6 A;  4QIW E;  1XMO Q;  1JOO A;  2TSS A;  3J81 L;  1MJE A;  4KHV A;  3ER0 A;  2N88 A;  4BWG B;  4FNF A;  1TS4 A;  1NR2 A;  2HCC A;  1Y8N B;  2F4I A;  4A3D B;  1QNU A;  3K80 C;  1HR0 L;  2JSO A;  4NXM L;  1PMR A;  1C4Q A;  2PW5 A;  2R7F A;  2F52 A;  3BU2 A;  4X3S A;  1K8M A;  2DGY A;  2PMZ B;  4F7X A;  2UXB Q;  4Y52 H;  1STH A;  4HID A;  1CA6 A;  1A63 A;  2JA8 B;  1X3E A;  4ILW A;  4KK7 A;  2L5T A;  3EQL C;  4A3F G;  1Z6H A;  2B2V C;  2Q8I B;  1CKO A;  1E2W A;  3CPW A;  1WTO A;  2NUC A;  2KCM A;  4M8A A;  3J81 c;  1X3Q A;  3KF6 A;  1OXS C;  1LT6 D;  2XTI A;  2B2Y A;  2XRS D;  2Z6K C;  2X6L A;  1Y1W H;  3PUX A;  1IKM A;  2F0F A;  1PH9 A;  3U58 A;  1EL0 A;  1PH6 A;  4OIJ A;  4E6I A;  4TRD A;  1HA6 A;  2NZH A;  1L1O B;  3DEO A;  5M3M H;  5CV8 A;  4A3G G;  4GKK Q;  4NXN Q;  3K7A B;  1A2T A;  4DAM A;  4C2M B;  3L3O C;  5J3B A;  3HOU H;  2IWH A;  1M4V A;  2F0D A;  4A3B B;  3T1Y Q;  1QIL A;  4TSS A;  5C4Z A;  2ID0 A;  3H0G B;  4NXN L;  1DM0 B;  1Q12 A;  1EYG A;  3BDC A;  3I4O A;  4TKO B;  4BA2 I;  3CRL C;  1NNX A;  4ME5 A;  1AW7 A;  3CCE A;  2ZTC A;  1X3F A;  3T56 B;  1Z7T A;  4JPB W;  2Z1C A;  2CQO A;  1HNX Q;  5EBD A;  1G2T A;  5FLM G;  2G9H D;  1LTR D;  4R4T A;  4KKU A;  2KQ3 A;  2MPM A;  4HJ5 A;  1K8A C;  2GN5 A;  3SR1 A;  1E24 A;  2E2I B;  1F9S A;  2ZT9 C;  2WIN B;  5IWA Q;  3C46 A;  1S3O A;  4N9T A;  1NMG A;  1STG A;  3UDG A;  2RVL A;  2CHB D;  4JOI A;  4KY7 A;  4F8M A;  1UAP A;  1LTS D; 
#chains in the Genus database with same CATH homology
 3I70 A;  5EQ0 A;  3EFX D;  2EVB A;  3VYU A;  4IQZ A;  1ENA A;  4RHR A;  3BVZ A;  5FLX L;  4HN7 A;  5JVG 3;  3DUZ A;  3M7G A;  2XN9 C;  3S9W A;  1KLG D;  5JEA J;  2PCF B;  2HQE A;  1H9K A;  3RUZ A;  3NTI A;  5A2Q L;  3SK5 A;  5DM7 3;  1JCK B;  2B39 A;  3SDZ A;  1VMP A;  3EJI A;  2F03 A;  3DM1 A;  4H44 C;  5M9O A;  4IZ8 A;  2VB2 X;  1EY8 A;  2F0L A;  1CA5 A;  4IUV A;  3NE5 B;  1RCV D;  1SXT A;  3DEP A;  2A69 D;  4C3H B;  3FDT A;  4J6H A;  5T1G A;  3Q6S A;  3S1R B;  2ZXP A;  4RCN A;  2IX3 A;  1IYU A;  4OO1 H;  2A6E D;  4BA1 I;  4LJZ C;  2DNE A;  4KI0 A;  4GZY C;  3SVM A;  3D4W A;  5J22 A;  3DMU A;  4G7H C;  1F2L A;  4FF1 A;  1VCI A;  2CVR A;  1AEX A;  1Y1W B;  2FJ2 A;  5IGF A;  1VF7 A;  2E76 C;  4A93 B;  3GTJ B;  4H13 C;  2JA7 B;  1EOT A;  4FYD A;  1L0X B;  3MFY A;  5M3M B;  1TS3 A;  4K6D A;  1FGB D;  2R7Z B;  4QB4 A;  3NXW A;  2K1B A;  2K32 A;  5HGT A;  5CBA E;  1O7Z A;  5D65 A;  4AYB B;  4DNR B;  3VR5 A;  5E4X A;  5ELD A;  2EXZ A;  1CK1 A;  1OXT A;  3D8G A;  4EVO A;  1QCB D;  1CM9 A;  4K6L A;  3M7N A;  2E74 C;  5JPM C;  1R4Q B;  4DXG A;  3A8K E;  5CBE E;  1O7Y A;  3I8Z A;  1CQF A;  4C3I B;  4L8J A;  3WOF A;  4DK0 A;  4K14 A;  5K36 G;  1KAB A;  2FMC A;  3TZU A;  1HA5 A;  2WB1 B;  4OO1 I;  1PRT C;  4QMG A;  4XYQ A;  1ML0 D;  4CBV A;  2OT2 A;  3C1F A;  3DXJ C;  4K2K A;  3MAQ A;  1YNN D;  1ENF A;  4OL7 A;  3S1M B;  5EPL A;  1SNP A;  1DXM A;  4H7B A;  4OGQ C;  1PTO F;  2BA1 A;  3V96 A;  5KNB A;  3TME A;  1B9M A;  3IAY A;  4WJW A;  2QEJ C;  2AWO A;  2F1M A;  2RSO A;  3A7L A;  2NTT A;  2EY6 A;  5F2D A;  1QJO A;  1SE2 A;  2A73 B;  1BNZ A;  3QWN A;  2L1B A;  2MHV A;  3KK7 A;  1TWC B;  2M00 A;  1EZ6 A;  1LT5 D;  2B2T A;  3OIP A;  3I3C A;  4FXG C;  3HOY B;  3SEB A;  3S2D B;  5IT9 E;  5C6A A;  3P75 A;  2QKI C;  3BDO A;  4J8Q A;  1W6K A;  1W6J A;  3A54 A;  4DK1 A;  5JPN C;  3AU7 A;  2LS0 1;  2DY8 A;  5JOB A;  4HSP A;  2BDN A;  1S5F D;  3A55 A;  2B2U A;  1TR5 A;  4RGM A;  5EPJ A;  3PIP 3;  3D4R A;  5NUC A;  4BBS B;  3T53 B;  3OPO A;  1HQM C;  1GOZ A;  4ZLT F;  2IT1 A;  1SDF A;  4XDX A;  5CV5 A;  3VYR A;  3HOV B;  2QF7 A;  1M8A A;  3ERQ A;  1B50 A;  5EBC A;  2CQA A;  2X69 A;  1ESR A;  2ICE C;  3S1N B;  4RKL A;  1KLU D;  5BN4 A;  4A3J B;  2NVT B;  4IUQ A;  2RKS A;  1L0Y B;  2WV6 D;  1SFO B;  2IW3 A;  2K5W A;  2K5D A;  5FOB B;  2NN6 H;  4KD4 A;  1U4M A;  2ZXR A;  3A7A B;  5I2X A;  1WTP A;  2KA7 A;  3K59 A;  5DNF A;  4H0L C;  2J4X A;  1PLF A;  4ZKB B;  1I4H A;  3ND8 A;  3PO3 B;  1T5X D;  3NWT A;  4X3U A;  4BY7 B;  3HZX A;  2NN6 I;  4M1U B;  2L4N A;  2B2W A;  1S5D D;  4C1N I;  3L7Z C;  5T1I A;  2K01 A;  1Z47 A;  3IL8 A;  5IOD A;  1R4P B;  5LHY 1;  3GQB A;  5CC4 A;  2LKV A;  3FEW X;  4A3E B;  4R8N A;  4I65 A;  1B9N A;  2F0S A;  1S5C D;  3SK8 A;  2JXM B;  1ROD A;  1U4R A;  4FO2 A;  5C3X A;  3OWE B;  3VR2 A;  4K5W A;  1PFN A;  1CT1 D;  1MSG A;  3NQT A;  1GUN A;  2R93 B;  3H09 A;  4XYO A;  2KOL A;  3I4L A;  3TDQ A;  2H1E A;  2O4X A;  4C3H G;  2VXW A;  4DU9 A;  2H4O A;  4NKL A;  1BO0 A;  2PW7 A;  2VUM B;  3A56 A;  3R93 A;  3H94 A;  3M4Y A;  3MTS A;  3K0Y A;  1JB3 A;  2AQ2 B;  2D5D A;  2R3Z A;  1H9S B;  2SEB D;  2IPK D;  4N9P A;  2N55 A;  1JIC A;  2HUG A;  2SNM A;  1BCP C;  1TS5 A;  1FNV A;  5IGE A;  2F0Q A;  1BCP B;  3QJY A;  3G7L A;  3ONA B;  4HCS A;  1NCV A;  1OO9 B;  1I4R A;  2D2C C;  3V05 A;  4G4K A;  3I4N B;  3EA6 A;  2K03 A;  4CJ0 B;  3H6M A;  4OHJ A;  2L9H A;  2K05 A;  3TBI B;  3S1Q B;  1D5M C;  1OXV A;  1PZJ D;  3TN2 A;  4RH6 A;  5C4J B;  3BDL A;  2SOB A;  2EJM A;  4PMB A;  2AUK A;  1AFP A;  3MZ5 A;  1JWS D;  3W3A A;  5CMD A;  3GTM B;  3LWU A;  3N52 A;  3ERO A;  1IL8 A;  1HXY D;  1I4P A;  1EYD A;  1B4O A;  1LO5 D;  2JP1 A;  4C3J G;  1VF5 C;  5IIF A;  1EEF D;  3F2U A;  4B9X A;  3I4M B;  2L0C A;  2NYZ D;  1MGS A;  2K7V A;  4PNY A;  1D2B A;  3LWE A;  1F77 A;  1RKN A;  4DN4 M;  1CTM A;  2AWN A;  1DCZ A;  5EPK A;  3K57 A;  2NZ1 D;  1GUO A;  1EY9 A;  2BE5 C;  2K33 A;  3RZO B;  3OOC A;  3CQZ B;  3R3O A;  5KYI A;  2OXP A;  4YIJ A;  1TWG B;  3J80 E;  1G8Z D;  3TP5 A;  2XSC A;  1SYE A;  3HOZ B;  5BN5 A;  3TP8 A;  4P2C B;  5E4W C;  2R92 B;  4PMC A;  5FO9 B;  3CKI B;  2PZT A;  2EYM A;  1SE3 A;  3E5S A;  5JAV A;  3CU7 A;  1WTX A;  1QWY A;  1A3V A;  4A3M B;  2ICI A;  2J7Z A;  3K5M A;  3I90 A;  3S17 B;  3GO5 A;  1S5E D;  1SBB B;  1JQY D;  1B53 A;  1XX8 A;  1F9Q A;  3P20 A;  1TVX A;  2WAC A;  3DWQ A;  2WP8 J;  3NUC A;  1TY0 A;  1TII D;  1TWA B;  2K04 A;  2SDF A;  3QIA A;  1SYC A;  1IW7 C;  5C0X J;  2NTS A;  1RHP A;  1WTR A;  2B2V A;  4DGZ A;  1IW7 D;  4ID6 A;  4NP5 A;  2BOS A;  1A3T A;  3FRP B;  2IJ0 A;  1ESF A;  2RDH A;  2KEC A;  4DF7 A;  1F2Z A;  5EKL A;  3T13 A;  3GTQ B;  2JEB I;  3SE0 A;  2JEA I;  4DFA A;  3DHQ A;  1STB A;  2ENB A;  3LX0 A;  2XNA C;  3BYY B;  2CW0 D;  1FNW A;  4ZUJ A;  4FF4 A;  1V1P B;  2FIN B;  4R8I A;  4KN7 C;  3HOU B;  4HED A;  2NWG A;  4L6T B;  2B2T C;  2RQX A;  1FNU A;  3KBG A;  1PZI D;  1SNO A;  4A3G B;  1E0B A;  4LMQ D;  1G2S A;  1AZQ A;  5E1F A;  1BDO A;  1PFB A;  1HRJ A;  3EVQ A;  3N6R A;  2BCO A;  5ELB A;  3VYT A;  3KUP A;  3MHB A;  3J7A F;  3MXN A;  2HDL A;  3DWP A;  3HP3 A;  4LK1 C;  1A6X A;  5G3L D;  2F0J A;  1MD2 D;  4ABN A;  1Y69 U;  3TSS A;  1Y8O B;  4A3F B;  3DWA A;  3QOJ A;  2EYO A;  5I6W A;  2RDF A;  1PRT B;  3OIQ A;  3HKZ B;  1BF4 A;  1BXT A;  5LL6 S;  4KKS A;  2B63 B;  3FPP A;  2B2W C;  5C3W A;  1ZEQ X;  5FK9 C;  1B44 D;  5LL6 X;  2WAQ B;  2F0G A;  1I6H B;  4HCE A;  1YNJ D;  3OW7 A;  3T51 B;  1PTO B;  1U4L A;  2A5H A;  1XYI A;  4DAP A;  1ZKO A;  1I4Q A;  1TWH B;  4IAL A;  1LT3 D;  3R2I A;  2RBM A;  4CGY B;  3OMC A;  1TY2 A;  1RDP D;  1E2V A;  1ET6 A;  2AQ3 B;  4WOR A;  5C0X I;  1UUP A;  1O7L A;  1SYG A;  3AMU A;  4XXE A;  5ELE A;  4A3K B;  2XVS A;  5EKI A;  4KKT A;  4KJN A;  3IFD A;  2A68 D;  4KD3 A;  5IT9 L;  5A35 A;  1SJH D;  3TP7 A;  5E3F A;  3FKI B;  1BUV T;  4C1N K;  1HFG A;  5COY A;  3OWF A;  1STA A;  1GUS A;  2EJG C;  3BG3 A;  2DY7 A;  2Z8L A;  3V2T A;  1ZYR C;  1FR3 A;  2F0M A;  3BZD B;  4LAA A;  1UEA B;  4PQX A;  3A8J E;  4B08 A;  4IUP A;  4C56 C;  1ZXT A;  3HOX B;  2EJF C;  3C1E A;  2E2D C;  4X3T A;  3X3N A;  2R61 A;  3M4O B;  1LAC A;  2F0O A;  2PPB C;  2F3V A;  2E75 C;  1HFN A;  1TS2 A;  4FVM A;  1H9J A;  1EY5 A;  3MXU A;  1A15 A;  1QOH A;  1VDZ A;  1HQR D;  2QCP X;  1SMY D;  5DAU A;  3I73 A;  1EFI D;  3NWS A;  1IKL A;  2DN8 A;  4EGV A;  4C3J B;  1EY6 A;  4JBW A;  3NPP A;  1HHV A;  5M3F B;  5CV9 A;  2ZXO A;  3BVM A;  2F0V A;  2FHT A;  3VR3 A;  3HGB A;  1RF2 D;  2B2Y C;  4F87 A;  3SXH A;  1SAP A;  2I07 B;  5I2Y A;  1UNS A;  4NDX A;  3U9O A;  2YU9 B;  2KHS A;  1ILP A;  3S16 B;  1HUM A;  4RAU C;  2EYH A;  1WTQ A;  4IN3 A;  1AN8 A;  1EU4 A;  1SYF A;  1GHJ A;  2TMP A;  1Q3L A;  1XXG A;  1SYD A;  2KEE A;  4HMI A;  1BCP D;  3MFG A;  3SHL A;  5KRU A;  4OIK A;  1JOQ A;  1AZP A;  1S5B D;  5D14 A;  1CHQ D;  1D5X C;  4RA8 A;  1WD0 A;  1CQV A;  1G91 A;  4OO1 G;  2BDO A;  3M3Y B;  4IFD G;  2B8G A;  2LMC B;  3MA2 B;  1SNC A;  1MSH A;  2A6H D;  2AUJ D;  1PRT F;  1Q8I A;  2WKC A;  3HG9 A;  4G7Z C;  1KAA A;  1YNN C;  3MC0 B;  4EQP A;  1C48 A;  5C0X G;  5KGU A;  2KED A;  1NUC A;  4K2L A;  2D62 A;  4I7Z C;  3GTO B;  1D1K A;  4DA2 A;  2E2J B;  2JA5 B;  1TKW B;  1QNK A;  4ZRZ A;  4CKE A;  2A68 C;  5C3E B;  5D3I B;  4V19 0;  3K5N A;  1V1P A;  3GP7 A;  3NBH A;  3D31 A;  2R6G A;  4B9W A;  4IUT A;  3RD4 A;  1SSO A;  3NSW A;  2QDB A;  1F9R A;  4WRD A;  2A6H C;  4MN3 A;  2A69 C;  1I3Q B;  1DON A;  3GV3 A;  1FD7 D;  2V4D A;  3ITP A;  1CHP D;  3OMG A;  2IX0 A;  2RSN A;  2MP1 A;  1JWU D;  1I50 B;  1ICW A;  2AQ1 B;  2EPB A;  5EGT A;  1EQT A;  1QB5 D;  2BA0 A;  2EYL A;  1PDQ A;  1NSN S;  3FPU B;  4RGO S;  1NAP A;  1HCZ A;  5C5L A;  1EIH A;  3LNN A;  1LAB A;  4KV6 A;  5IGD A;  1LTB D;  2NVX B;  3K6O A;  4EQO A;  1EYA A;  1F9P A;  2EY2 A;  3CRK C;  5CV7 A;  4IFD H;  1EY7 A;  3E0J A;  3L9A X;  1PRT D;  1I4G A;  1CZG A;  3PUW A;  1RTO A;  3G6J B;  3NTK A;  4XQN A;  2EZV A;  4G57 A;  5M5Y B;  4XT1 B;  4CKB A;  4KMU C;  1CFM A;  4Q0F A;  2XRQ D;  4UDU C;  4HSV A;  1V1O A;  1A3U A;  1KTK A;  2J0T D;  2F0N A;  2EYP A;  1G6Z A;  5D3D A;  1EY0 A;  3VYS A;  2F0K A;  1SEB D;  1SND A;  1UAP A;  1T5E A;  4FF3 A;  3PUY A;  1XWE A;  4S3S A;  4RGT A;  1Q90 A;  1BCP F;  1JE4 A;  3BVG A;  3J81 E;  1X3P A;  1D5Z C;  4QCL A;  3Q23 A;  2E2H B;  2A6E C;  3FMC A;  2K6A A;  1EWC A;  4FXK C;  1HTP A;  3MWY W;  1GUW A;  3HOW B;  4HR7 B;  3VR6 A;  3NQI A;  1E2Z A;  2VB3 X;  4KY5 A;  2JYO A;  5AFW A;  4IFD I;  1ILQ A;  5I9O A;  1LTA D;  2O2L D;  1U4P A;  3J80 L;  4U68 A;  1NR4 A;  1V43 A;  3GTK B;  3RMH A;  3H91 A;  2F0H A;  1DOM A;  1LTG D;  1EWH A;  3K5L A;  2XIW A;  5FO7 B;  1G29 1;  3TZD A;  1WD1 A;  3D6C A;  3P7J A;  2MJ8 A;  2I46 A;  2EY5 A;  1STN A;  3GD7 A;  4K8I A;  4J1M A;  5M5X B;  4NW2 A;  5J1Z A;  2O5J C;  2OEO A;  5I9P A;  4ULL A;  1WVL A;  3PMF A;  3WOE A;  4O1N A;  3ZYY X;  1JOK A;  2KCN A;  1F2M A;  3GTL B;  3S14 B;  3RLF A;  4R9W A;  1ENC A;  4MHE A;  2HDM A;  3T16 A;  3QO2 A;  1J9O A;  1HUN A;  3HS0 C;  1B2T A;  1WCM B;  1MBY A;  3SK6 A;  1RTN A;  2QIL A;  3J7A V;  4DAV A;  1KNE A;  3KLS A;  3WDN A;  4RGN A;  3AB9 A;  4BS9 A;  3E6Z X;  1ZYR D;  3I91 A;  5JVH 3;  4ZUI A;  4XQQ A;  1LV9 A;  1K83 B;  5M5W B;  4PMW A;  2PZW A;  2EY1 A;  5JJZ A;  1JWM D;  5I4D A;  1SMY C;  2C9O A;  4Z9C B;  4UAI A;  4U67 3;  5C5M A;  5KEE A;  4RWS C;  3GTG B;  1Q1E A;  1U9R A;  1SE4 A;  3IFT A;  5EKK A;  1I4X A;  2F0U A;  1JOR A;  3RZD B;  5HUR A;  2F0T A;  4ZQ3 A;  4NMZ A;  1SNQ A;  1PZK D;  4RFB A;  1DOL A;  2NVY B;  2NN6 G;  4CHT B;  3VR4 A;  1II3 A;  5KYL A;  2PO4 A;  5ISR A;  3MXP A;  5CV6 A;  1ET9 A;  1LTT D;  4O42 A;  2KUM A;  1TQO A;  4K5V A;  3JAM E;  1K8O A;  1FYC A;  3R2T A;  3OSO A;  1JR0 D;  1A2U A;  1XTC D;  4ZKC B;  4Q5V A;  4ZK9 B;  1KDC A;  1RD9 D;  1EQV A;  2XWJ B;  5C0X H;  1TU2 B;  1Y8P B;  1AP0 A;  1X32 A;  4QIW B;  2YYZ A;  1DZ1 A;  2D9U A;  5KND A;  3NHH A;  4HTH A;  1BQQ T;  1EYC A;  1HTL D;  1B1Z A;  5C4H A;  3NK9 A;  1DYQ A;  3K5O A;  1PYW D;  1PTO C;  5JEA H;  3QOL A;  5FLX E;  5FO8 B;  4G7O C;  2M9V A;  1PTO H;  3GTP B;  5BN3 A;  2L12 A;  3W2D A;  1V8Q A;  2FFK B;  4KJO A;  3KF8 A;  3TP6 A;  3K58 A;  1Y1V B;  1MI2 A;  3Q22 A;  1SNM A;  4IUN A;  2Y0S B;  3BYT B;  1BOS A;  2KCC A;  1WTW A;  2IX1 A;  2EYJ A;  2Q8T A;  1H9R A;  2VNU D;  4KTA A;  1OXU A;  3Q24 A;  1QG7 A;  4DXF A;  4DNT B;  1KNA A;  5J39 A;  5K36 H;  4K5X A;  2NVQ B;  4IUU A;  1GJX A;  5CGK A;  2O5I C;  5A2Q E;  3URY A;  2SNS A;  4IFD J;  4F88 A;  1GUT A;  2HCI A;  1DJR D;  4ZAI A;  5COR A;  2EE1 A;  2PZU A;  3R8B A;  3D4D A;  2XWB B;  3NP8 A;  2Q8R E;  3IKJ A;  4RKB A;  3KLS X;  1CI3 M;  2FMM A;  2RA4 A;  1ONL A;  1EY4 A;  1IHZ A;  3C2P A;  5I6Y A;  1CZW A;  2A74 C;  5CR3 A;  1RJT A;  2EDG A;  1EU3 A;  4WFN 3;  2K28 A;  1TWF B;  2EYF A;  2JE6 I;  2C5C A;  4RHS A;  3J7Y W;  2LY7 A;  4QUC A;  1I6V C;  1LTI D;  4X3K A;  5IGB A;  1JC7 A;  3D3R A;  2CW0 C;  2K5Q A;  4KHZ A;  5CYU A;  4TQU S;  4MIU A;  3KLR A;  5JEA G;  2G9D A;  4KY6 A;  4QF4 A;  5EJW A;  4CKC A;  4RCO A;  2IL8 A;  5C44 B;  2JA6 B;  3MEH A;  4FP5 D;  1GUG A;  1H9S A;  1Q1B A;  1GXD C;  2F0E A;  3X3M A;  5CV4 A;  1J8I A;  3VA5 A;  3SK4 A;  1OXX K;  3MVV A;  4ODG A;  1BR9 A;  2NB0 A;  4XT3 B;  4A3I B;  1VMC A;  3NTH A;  2B2U C;  3PIO 3;  3HEJ A;  1F2Y A;  3ND9 A;  4PV1 C;  2L55 A;  2F0P A;  4JK1 C;  3VA7 A;  4DAY A;  5KNC A;  5DEH A;  2EOT A;  4EQN A;  1O80 A;  2KVM A;  3U9S A;  2PNR C;  4ZYS A;  1TT2 A;  1PFM A;  3S2H B;  4XTC S;  3HRZ C;  3PUZ A;  2F3W A;  3QB3 A;  1KDB A;  1KDA A;  2KJX A;  1IYV A;  1B3A A;  1H9M A;  4XIG S;  2Z4H A;  4HAE A;  4K8J A;  2WII B;  4BBR B;  5K5P A;  5FKA C;  1EIG A;  2Z4I A;  4XQJ A;  2F0W A;  4L63 B;  3PUV A;  3T4A C;  1EZ8 A;  3S15 B;  4CJ2 C;  1EEI D;  2NBF A;  5C4X B;  3OHX C;  4FF2 A;  3H3V C;  1GHK A;  4FXD A;  2MGS A;  3UI2 A;  2BE5 D;  3FVQ A;  3A8I E;  5IGG A;  2M2L A;  2RDG A;  1QE6 A;  4HMJ A;  2PYK A;  3MXG A;  2L11 A;  3GV6 A;  1WTV A;  5ELC A;  5IOC A;  2X6G A;  3PV0 A;  5KIX A;  3D6W A;  1STE A;  3Q0A A;  4QUF A;  1DD2 A;  2OF1 A;  1S4Z A;  2F0I A;  3NBI A;  1PXU A;  3C3L A;  3O13 A;  5ELF A;  1LT4 D;  3JAM L;  3QG1 A;  5G3L F;  1D6E C;  1C8C A;  4IUR A;  1PTO D;  4KN4 C;  2B8F A;  2PQE A;  1R9T B;  2MUY A;  2LFN A;  1SJE D;  1YNJ C;  4V0B A;  2GA4 B;  3BS1 A;  5TSS A;  2DNC A;  1HPC A;  4CJ1 B;  3M85 A;  3I72 A;  5IGC A;  1BBX C;  3P1H A;  1LLR D;  4C3I G;  1O78 A;  3CHB D;  3PO2 B;  1SYB A;  2WKD A;  1STY A;  4BY1 B;  3KBX A;  1D1I A;  1DOK A;  5DM6 3;  1JOO A;  2TSS A;  3J81 L;  4KHV A;  2N88 A;  4BWG B;  4FNF A;  1TS4 A;  1NR2 A;  2HCC A;  1Y8N B;  2F4I A;  4A3D B;  1QNU A;  2JSO A;  1PMR A;  1C4Q A;  2PW5 A;  4F7X A;  4X3S A;  1K8M A;  2PMZ B;  1STH A;  1CA6 A;  2JA8 B;  4ILW A;  4KK7 A;  2L5T A;  3EQL C;  1Z6H A;  2B2V C;  2Q8I B;  1E2W A;  1WTO A;  2NUC A;  4M8A A;  1X3Q A;  1OXS C;  1LT6 D;  2B2Y A;  2XRS D;  2X6L A;  3PUX A;  1IKM A;  2F0F A;  1EL0 A;  4OIJ A;  4E6I A;  4TRD A;  1HA6 A;  3DEO A;  5CV8 A;  3K7A B;  1A2T A;  4C2M B;  3L3O C;  2IWH A;  1M4V A;  2F0D A;  4A3B B;  1QIL A;  4TSS A;  5C4Z A;  2ID0 A;  3H0G B;  1DM0 B;  1Q12 A;  3BDC A;  4TKO B;  4BA2 I;  3CRL C;  4ME5 A;  1AW7 A;  3T56 B;  1Z7T A;  2Z1C A;  5EBD A;  1G2T A;  2G9H D;  1LTR D;  4KKU A;  2KQ3 A;  2MPM A;  3SR1 A;  2E2I B;  1F9S A;  2ZT9 C;  2WIN B;  3C46 A;  4N9T A;  1STG A;  2RVL A;  2CHB D;  4KY7 A;  4F8M A;  4Y7N B;  1LTS D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...