4AYBG

Rnap at 3.2ang
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
113
structure length
113
Chain Sequence
b'KAQEIILSCEINSIERGSLKNLSIIHMSCNDFNISFDIIDSINIFSQKEKVKAFISKNRLSYTNDDFCGHGYIVTELKDSSSNNGNRYITIISLFGLLVKIISNKESFLKIHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
pubmed doi rcsb
molecule tags Transferase
total genus 12
structure length 113
sequence length 113
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF16992 RNA_pol_RpbG DNA-directed RNA polymerase, subunit G
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4aybG00
4TQUS 2Q2IA 4BY1H 1EIFA 1EUJA 4PZ8A 4HJ8A 1Q7YC 4GKJL 2AMCB 2VY3A 2R92H 2ZTEA 1A62A 3NEMA 4LF6Q 3J80c 5IP7H 2JA6H 2ES2A 1XMQL 4LF5L 4BBRG 2I5LX 1TXYA 3G71A 1N33Q 1KAWA 4YY3L 4JI2Q 4DV0Q 3H0GG 1PHJA 5M3FG 4DV6Q 4BY7G 4A3CG 1L1OB 5GROA 4JI1L 1YVCA 4BBRH 1Q81C 4LFBQ 1XTDA 1SLJA 4APVA 3CC4A 4DR3L 4P72A 3PGZA 1EQQA 3KDFB 4LW1A 4IJHA 4HJAA 4BY7H 4DR7Q 1N32L 1K0RA 1J6QA 1BKBA 4HIMA 1XNRL 4DR2L 1CKMA 1FVIA 4X64L 4HIDA 1PH1A 3W5OA 5HGQA 4JYAL 4OO1I 4PZ6A 1UE6A 4GN5A 4UP7A 3G4SA 2WAQE 4LF8Q 1K8AC 3TS0A 1SE8A 4GOPB 1VQ7A 1V43A 4DPGA 1RL2A 3K7AH 3H15A 4JI6Q 1J5EQ 5M3MH 2UXDL 4DV7L 2JEBI 5C44G 4A3DH 1CSPA 1GM5A 1TWHH 3KYHC 3LGJA 2YYZA 3CCUA 3KFUA 3KF6A 4ALPA 4DV3Q 1FGUA 2YTVA 4OO1G 5C44H 4O0AA 4A76A 2QA4A 4JI3L 3HOUH 1Q1BA 3I4NG 2MFIA 1HNZQ 4QGUA 1QZGA 1CUKA 1Q46A 2I5MX 2N49A 2VQFQ 4YCWA 2Z0SA 1UE1A 1X3FA 2JA9A 4NXNL 4X62Q 3PIOA 3CC7A 3RR5A 3CCMA 4B3SL 1NMFA 5AJ3Q 1P8LA 4A3FG 3HFZB 1VCIA 1VQBA 2NN6G 3CQZH 3I4NH 5C0XI 2Y0SE 1K73C 4X65Q 4KHZA 3BZCA 4QIWE 2R93H 4A3FH 3FKIG 2ZJPA 4JI4L 3PO2G 1X65A 4QY7A 4YWLA 1PH6A 1CKNB 4UP9A 5IE8A 1PA6A 4LF9L 2EQSA 3L7ZC 3TS2A 4MZ9A 1GD7A 1X6OA 2NVTH 3FKIH 3M9BA 4YWKA 4JI8L 5BR8Q 4HJ9A 4A3EG 2R6GA 2OWOA 3A5UA 4DV4Q 4DUZQ 2UXBL 4JI5Q 1NY4A 4JI7L 3G6EA 1QUQB 3KJPA 5IT9c 1XMOL 1G6PA 3PUYA 1NTGA 2ZTCA 3W1BA 2VQEQ 3CCSA 2JEAI 1E7ZA 1YNXA 1EOVA 1HZ9A 2GN5A 2KHIA 4AYBG 2K75A 5M5XH 4A3EH 4JI0Q 1HNWQ 3WWVA 2UUAQ 2C35B 5H1SE 4RG1A 2OQ0A 2OCEA 3NELA 2ZM6L 1OXSC 2HIVA 4AQYL 1PH2A 1G51A 1PYBA 3UDGA 1N36L 3PUWA 1L2FA 3A5ZB 4A3KG 4LF7L 4DK6C 1JB7A 4A4IA 4OONA 1K3RA 3M7NA 1OTCA 2UXCQ 2MO0A 3K0XA 2L15A 2GVAA 2RF4A 1S72A 1L0WA 4OXPA 4A3KH 4BBSH 1TWGH 5HY6A 1FJGQ 1YHAA 5JEAJ 4JOIA 1AE2A 4IFDG 3ULLA 1IZ6A 5IWAL 5E7NA 1KHIA 1OXUA 5IYDH 2AKWB 2F4VQ 3J7A5 1JE5A 4LF4L 5IYBG 3CPWA 2NVYH 2CKZB 2N3SA 4IPGA 3S2DH 4C2MH 5LMNL 3T1HQ 2PI2E 3RLFA 1VQIA 3U58A 4OX9Q 3OYYA 2JK8A 3K8AA 4UPAA 3S14H 4A93G 2B3GA 1EFWA 1SR3A 1VQ8A 4H02A 4X66L 4XTCS 4BY1G 2D0PA 4PMWA 1YI2A 1PV4A 4DR4L 4WJ3M 4GN4B 4GNXC 5M5WH 1XNQQ 2QEXA 3CCEA 1IBLQ 4A93H 4DAYB 1IBKQ 4KHPL 3I4OA 3EBEA 3OW2A 1UEBA 1WYDA 1PH8A 4NXML 1IL2A 3HOWH 4B3TL 4IOAA 3GTPH 2PNHA 2QGQA 3ZJYC 1E3PA 2JA8H 1P16A 4GNXB 1IYJB 4JCVE 1L1OC 3E9HA 1KIXA 4JBJA 1A8VA 1X55A 2KENA 1EQRA 1M1KC 1O7IA 4A3GH 1OXVA 2V1CC 3MEFA 3JAMi 4X6AH 2Z6KC 2KCMA 4GKJQ 2K52A 3E0EA 3KF8B 2EIFA 3GTMH 2ZJRA 4Y52H 2VW9A 2BH8A 1I94L 1NMGA 4DUYL 3NENA 1XMQQ 4POFA 2PQAB 1Q8KA 3G48A 4L5QA 4ME3A 4R4CA 1QZHA 5LMUQ 4LF5Q 1SN8A 3GTJH 1TWAH 4YY3Q 2I0QA 4GOPC 3RNUA 3D0FA 3CCLA 2AWOA 3FHWA 5LMNW 4YWMA 4LUVA 3ULPA 4JI1Q 2NVQH 3H3VI 2K5VA 3M4OH 4A3BH 5M3MG 3S2HH 3PSIA 1YHBA 4DV6L 4OWXB 4BA2I 2K14A 4A3DG 1VQCA 1VQEA 4DR3Q 1E1TA 4HJ7A 1HNXQ 1YZ6A 3J81i 3CMAA 1I3QH 3I55A 1VQHA 2IHEA 3K7UC 4FDBA 1N34Q 1XNRQ 4YHHL 3GD7A 4DR2Q 4X64Q 4J15A 4JYAQ 1QVCA 4DAMA 3CCJA 2A1AA 3HKZE 3PUZA 1VQMA 2E5LL 4B3ML 3HOUG 1K83H 2NN6I 2H5XA 1PFSA 3PV0A 3GDEA 4R1JA 4KI0A 1K8GA 3AFQA 2UUCL 1R9TH 4R4OA 2UXDQ 3PCOB 1KC8C 1GKHA 1X3GA 3PF5A 4DV7Q 2R7FA 3STBC 1ASYA 1I5FA 3EN2A 5IY0A 3HOVG 5FLXc 2JA7G 2AHOB 3IRBA 4QL5A 4LFAL 3M3YH 1YBYA 4DV5L 4BA1I 2R93G 1I50H 1VQNA 2K4KA 4UY8C 3HOVH 4JI3Q 1W3SA 3HKSA 1EIYB 2JA7H 1GO3E 4MNOA 1E24A 2VL6A 2UUBL 4BXXH 1HNZL 4B3RL 4P71A 5GAHC 1W2BA 4NXNQ 1U0LA 1CKOA 2VQFL 4K0KL 4QQBX 4X62L 2CWPA 2VS1A 5AJ3L 3ICEA 1WCMH 2VZAA 5IP9G 3JC66 1PH4A 4GLVB 4LFCL 2KHJA 4P75A 1C9OA 3CP0A 3RLNA 4HIKA 4JI4Q 4DV2L 4LF9Q 3CF5A 3DLLA 3KLWA 3Q8DA 2DGYA 1EYGA 5IP9H 2Q2UA 1C0AA 1G291 3AEVA 4DR5Q 3KF6B 2LSSA 5DLQE 5J3BA 3S15H 4JI8Q 5IYCH 3OTOQ 4DR6L 3M4QA 1IXRA 3NBHB 4A3CH 3S1QH 3J80i 4QJFA 2UXBQ 5BR8L 3F1ZA 4IPCA 4JI7Q 3GO5A 1JMCA 2R7ZG 4A3LG 4DUZL 1XMOQ 4JI5L 2XGTA 1SROA 2BA0A 4IO9A 4IFDI 1A63A 2AWNA 4DR1L 2A19A 2ZJQA 4O2DA 2ATWA 3ER0A 4BBSG 1HNWL 1EWIA 2R7ZH 4A3LH 2UUAL 1HH2P 2WB1G 5C4XH 5FLMH 1HR0L 2ZM6Q 4AQYQ 1VQ9A 1UE7A 1YJNA 5IYDG 3PUXA 3CPFA 1N36Q 4LF7Q 3U4VA 2NVXH 2EXDA 4R4IA 4C3JH 1QVFA 2VUMG 3RZDH 1H95A 2OQKA 3A0JA 3HOZG 5K36G 3U50C 5ELNA 4C3HH 2XTIA 3CCRA 5JJIA 5EAYA 4GKKL 2UXCL 2UU9L 1LYLA 1PYSB 2LXKA 1VQKA 1VQAA 3I4MH 2VUMH 5IWAQ 1X56A 3GTKH 2BA1A 3HOZH 2HT1A 4JC0A 1IBML 1QVGA 3M4PA 4LF4Q 3I7FA 3HOWG 2YTXA 1E1OA 1YJWA 1Q1EA 4JV5L 3CCVA 5LMNQ 3KJOA 4A3JH 1DGSA 1UWVA 2JA8G 2HHHQ 4YCUA 3T1YL 4GLAC 3T1HL 1SFOH 2OTLA 1HZBA 1OXTA 4OX9L 2ALYB 2RHQB 4A3MH 2JJQA 3PO3G 3U4ZA 5GQOA 1Y1VG 3GTGH 1B70B 2PMZE 4C3IH 4A3GG 4JOIC 3UDFA 1L1OA 3D31A 4IJLA 4DR4Q 4HIOA 3BJUA 1BBWA 2Y0SG 3S17H 4KHPQ 1Q86C 3PO3H 4DV1Q 2Z6KA 4JBWA 2IY5B 1LM0A 2I5HA 2F52A 1Y1VH 3KDFA 1SRUA 4GS3A 3RLOA 1HR0W 3E9IA 4NPSA 1X3EA 3AYHB 1NE3A 2Q2HA 1K9MC 4L5TA 2D62A 1I6HH 4LF6L 4A3BG 1MJCA 1XPUA 1E22A 4PZ7A 1XPRA 1C7YA 2BH2A 1Y1WH 1NJIC 1N33L 1PVOA 1JT8A 2ID0A 4JBKA 1AE3A 1I94Q 1XJVA 4JI2L 5JJLA 4DUYQ 4DV0L 1VQ6A 4AYBE 1MKHA 1YEZA 3CC2A 4LFBL 1RIPA 5ELOA 4AH6A 5C0XJ 5LMUL 2IHFA 2R7DA 5GADC 1GVPA 4A75A 1N32Q 4JG2A 1KXLA 4DR7L 3BU2A 1U5KA 2B63G 5JEAG 4JI6L 4JBMA 2RCNA 4TVAB 1VQGA 3PIPA 3AQQA 1VQ5A 4IPHA 3S1MH 3FP9A 1X9NA 4Y7NH 1TWCH 2WB1E 2LXJA 4LUZA 1KD1C 1HNXL 3H0GH 4YHHQ 4LF8L 3EIVA 5M3FH 3F2CA 2B63H 1N34L 3TRZA 1KL9A 3I56A 1HZCA 2PI2A 1SMXA 2NZOA 2D0OA 3BZKA 1BBUA 4LUOA 5GAGC 3UE1A 1YITA 1J5EL 2YU9H 4B3MQ 2E5LQ 3CAMA 4HJ5A 1CKNA 1JJCB 2WP8J 1KRTA 4NB3A 4R4TA 2UUCQ 4BXXG 1Z9FA 3S1NH 4YCVA 2N78A 5JJKA 1N9WA 3UDXA 1Q82C 2CWAA 2N8NA 4DV3L 2YTYA 5C4JH 1HJPA 1VQ4A 1M90C 2WFWA 1WOCA 3B6YA 4XIGS 3PUVA 1WCMG 4LFAQ 3TQYA 2NZHA 3TREA 3S1RH 4DV5Q 4B3SQ 4NXMQ 1QUQA 1UE5A 3AFPA 2ASBA 4IFDJ 4LWCA 1HZAA 4WJ4A 3F2DA 2HIXA 1Q12A 1WI5A 3GTQH 2Q2TA 3K80C 2UUBQ 2F3IA 2E8GA 3CXCA 1KRSA 4X65L 3M85A 3RN5A 3H3VH 4B3RQ 4P73A 3MXNB 1TWFH 4K0KQ 1MIUA 5IYCG 3F2BA 1PH7A 1VS0A 4L5SA 2E2HH 4GN3B 3ERSX 3HOXG 2IX0A 2RHSB 4LFCQ 1Y14B 1VQJA 2YV5A 5C3EG 2OTJA 2VNUD 3JAMc 4DV2Q 4AIMA 3A74A 3CCQA 1AH9A 1CSQA 1S3OA 1Z47A 2DUDA 4KLKA 3W1GA 3HOXH 1JJ2A 4DV4L 2E2IH 1VQPA 2CQOA 3S24A 5C3EH 1LTLA 5C4XG 5FLMG 1YHQA 4DR5L 4DR6Q 3STBD 2MQHA 1MJEA 2VQEL 3PO2H 3RN2A 5C0XG 3OTOL 1VQOA 3UDIA 1N8RC 4JI0L 2A8VA 3RZOH 4OWTB 1YIJA 2KBNA 4RMFA 1X54A 4DNIA 1PH3A 3VDYA 3TEHB 4MTNA 2ZTDA 4UP8A 4DR1Q 1D8LA 3ULJA 3UE0A 1NBWA 3J81c 3I4MG 4IPDA 1FL0A 1OXXK 4PG3A 5M5YH 3CMEA 1V1QA 1HR0Q 2WAQG 1BVSA 1LUZA 2FXQA 4POGA 4R4QA 2B29A 2K50A 1KQSA 1VQLA 5FJ8G 2KCTA 4OWWB 3SGIA 4A3JG 4DKAC 3HKZG 1FJGL 3L0OA 4EX5A 2IT1A 2JA6G 3F8TA 4GNXA 4A3MG 1V9PA 3PF4A 1T9HA 3I2ZA 4GKKQ 2MO1A 2UU9Q 5FJ8H 2CCZA 2F4VL 2HQLA 2E2JH 3CD6A 4A3IG 3GTOH 2JQOA 1VQFA 3S16H 1S40A 1PH5A 5GAEC 4GLXA 4P74A 2JA5G 1XPOA 2K5NA 1IBMQ 3K81C 1PH9A 4X66Q 3J81j 4A3IH 4DK3C 1VQDA 2PQAA 4L5RC 1WJJA 1D7QA 1ASZA 2CFMA 3T1YQ 2MNAA 3HOYG 2JA5H 1IBLL 4LNQA 1XNQL 3GTLH 2K5HA 2HHHL 1IBKL 4JV5Q 3CW2C 4EQ5A 4B3TQ 2GVBA 2JE6I 3J7ZC 1WFQA 5IYBH 1Y1WG 1B8AA 3KOJA 3HOYH 2IX1A 3DM3A 2R92G 1A0IA 1YJ9A 3L2PA 4GOPA 1JJGA 5IP7G 4DV1L 1B7YB 4IOCA
chains in the Genus database with same CATH superfamily
2P5ZX 3NBIA 1MGSA 1EIFA 4X3SA 4GKJL 2VY3A 2R92H 3AB9A 2QCPX 3MVVA 3NEMA 3OMGA 5CYUA 3J80c 3MAQA 1Y69U 3L9AX 1I6HB 5EPLA 1SNPA 2ES2A 1XMQL 1N33Q 1TXYA 1KLGD 4ZCKA 1Y1WB 4NP5A 4DV0Q 1PHJA 1L0XB 4H7BA 2G9HD 3URYA 5FLXL 1TS4A 1AZPA 3G7LA 5AFWA 5FO8B 3Q24A 4DR3L 3CC4A 4P72A 1EQQA 3KDFB 4LW1A 4HJAA 5DEHA 4HIMA 3V05A 1XNRL 4DR2L 4R9WA 3EJIA 2KVMA 1VMCA 4GN5A 3KBGA 4GOPB 1V43A 4HSVA 1TU2B 3K7AH 3H15A 1K28A 3D4RA 2DNCA 4A3DH 3KK7A 2YU9B 2YYZA 3KF6A 4L6TB 1TKWB 4ALPA 4DV3Q 2C5CA 4K14A 2QA4A 2XRSD 1HNZQ 2PZUA 1QZGA 2Z0SA 3CC7A 2ZXOA 3NWSA 3C1EA 1PMRA 2A74C 4DXGA 3BVGA 1BCPF 3BZCA 4IZ8A 2IJ0A 3FKIG 4YWLA 1CKNB 1S5DD 4UP9A 5IE8A 2E2HB 2CW0D 3TBIB 2Z1CA 1GD7A 5ELEA 3CQZB 4B08A 4YWKA 1IKMA 2A6HC 4DV4Q 1B9MA 4RH6A 1A15A 2AQ2B 1QUQB 1R4QB 1HTPA 3PUYA 2ZTCA 3W1BA 1G6PA 3CCSA 1E7ZA 3VA5A 1EOVA 1HZ9A 2KHIA 5M5XH 4XQJA 2K75A 3FKIB 3RUZA 3WWVA 3H6MA 3RZOB 5EPKA 2OCEA 1I4RA 1GOZA 1HTLD 1L2FA 1MBYA 4DK6C 2O4XA 1RDPD 1HA5A 2KOLA 1K3RA 3M7NA 2F0TA 1OTCA 4TSSA 4U68A 2GVAA 1L0WA 2EJMA 1Q3LA 1F9SA 5JEAJ 4IFDG 1AE2A 4EGVA 1KHIA 1OXUA 5IYDH 4K6DA 2F4VQ 1JE5A 3S2DH 5CORA 1D5MC 2A6EC 1SE2A 3K8AA 3QJYA 4ZKCB 4UHVA 3R93A 4IUQA 1VQ8A 4H02A 2K6AA 4WJ3M 4DR4L 4A3IB 5J1ZA 2A69D 1XNQQ 3CCEA 2RDFA 2K1BA 4RWSC 3EBEA 3MFYA 4CDDC 1PH8A 3GTLB 1IL2A 3HOWH 2L0CA 1E3PA 1STEA 1G2TA 4IUTA 4PNYA 2QKIC 3M4YA 3DM1A 3C3LA 2H4OA 5EKKA 3GTPB 1H9SB 5LL6S 5C3XA 3IAYA 2R92B 4DUYL 5I4DA 4POFA 2PQAB 3G48A 3NXWA 1QZHA 4R4CA 3D0FA 3CCLA 1GHJA 3R2IA 4DV6L 4OWXB 4A3DG 4PV1C 5J22A 3L3OC 1HNXQ 5KYIA 1I3QH 1VQHA 2IHEA 4FDBA 1TWAB 4R8NA 2ZT9C 1O80A 4ME5A 1PFBA 4J15A 4JYAQ 3S2HB 3HKZE 3AFQA 2UUCL 4R4OA 1KC8C 4DV7Q 5JEAH 3K7AB 2R7FA 1ASYA 3EN2A 2HUGA 2AHOB 4A3DB 2KCNA 3IRBA 5FLXE 1YBYA 2XIWA 3H94A 3NHHA 1I50H 2OF1A 4M8AA 2F0UA 2VL6A 3QWNA 2A73B 4HMIA 1W2BA 2F0KA 4X62L 2CWPA 1PRTF 3ICEA 3FPPA 1WCMH 2VZAA 5IP9G 4FP5D 1RODA 1C9OA 3CP0A 4LF9Q 3CF5A 1ESRA 3CRLC 3KLWA 2PMZB 3EROA 3KF6B 5DLQE 5J3BA 3S15H 2SNMA 5KEEA 2OT2A 3JAME 4IPCA 1DONA 3RD4A 2EYFA 2Z8LA 2BA0A 1A63A 2A19A 2ZJQA 4FF4A 5M5XB 1EWIA 4KTAA 4A3LH 1JICA 2WB1G 5C4XH 3TMEA 1VQ9A 1YJNA 5IYDG 4K5WA 3NK9A 3CPFA 4LF7Q 4C3JH 4RAUC 2VUMG 1H95A 3A0JA 1LTBD 5ELNA 1QOHA 3CCRA 4KY5A 5EAYA 4RKLA 3VYUA 2LXKA 3I4MH 4QB4A 4EQNA 2BA1A 2KQ3A 3I91A 5EKIA 2WB1B 1B44D 1RHPA 3M4PA 1QVGA 3HOWG 2HDMA 3DEOA 1Q1EA 5LMNQ 4A3JH 1DGSA 1UWVA 2K03A 3T1YL 2OTLA 1EU3A 4OX9L 5T1GA 2VUMB 2RHQB 1FR3A 1Y1VG 2PMZE 3OHXC 1F77A 1C8CA 2WIIB 4KHPQ 4JBWA 3VR3A 2IY5B 2F52A 2F0FA 1YNNC 1ZYRC 3RLOA 4NPSA 3HOWB 1HA6A 3FMCA 2Q2HA 3D8GA 3M7GA 1XPUA 3VR5A 4PZ7A 1XPRA 5K5PA 2WACA 3MA2B 1JT8A 4JI2L 1XJVA 4DA2A 3J80E 1X32A 3CC2A 4LFBL 5ELOA 1CQFA 4RA8A 4AH6A 2IHFA 2RSOA 5C0XJ 3A54A 1GJXA 4JG2A 5E1FA 5EJWA 2XWBB 4DR7L 1EL0A 1W6JA 5JEAG 3BDCA 1CZGA 1BUVT 2F0LA 3PIPA 1GUOA 4QUCA 1EYCA 4BWGB 3N52A 4ZYSA 2QW7A 2M00A 1X9NA 3MWYW 2WB1E 3H0GH 4YHHQ 3TRZA 5M3FH 1SMXA 1KABA 5FK9C 5GAGC 1J5EL 1D5ZC 2K5QA 3BYTB 3CAMA 3KUPA 1O78A 1E0BA 2WP8J 1KRTA 4NB3A 1Z9FA 1T5XD 4ODGA 4KJNA 2CWAA 2N8NA 5EKLA 4XIGS 1CTMA 1WCMG 4LJZC 3S1RH 4B3SQ 3FRPB 4HCEA 1OO9B 3S1NB 4WJ4A 1I50B 3DXJC 1Q12A 1YNJC 3Q22A 2Q8RE 3RN5A 2E8GA 4X65L 2EYLA 3H3VH 1GHKA 2ZXRA 3A56A 4PMCA 3F2BA 3RMHA 1VS0A 4LMQD 3SE0A 4CKCA 1STYA 3K5MA 3FVQA 4LFCQ 5C3EG 2YV5A 1WCMB 2I07B 3A74A 2KECA 5ELBA 4CJ1B 4H44C 1S3OA 1JJ2A 1IKLA 1BO0A 3S9WA 1VQPA 5C4XG 2K28A 2KEEA 3K5LA 2HQEA 2MQHA 2VQEL 3S15B 3OTOL 4JI0L 3UDIA 4CDFC 4DNIA 1PH3A 4G7OC 5C3EB 1D8LA 5C0XH 1NBWA 3P20A 2CQAA 4NMZA 2GA4B 3I4MG 1O7YA 1OXXK 5DM73 5IGCA 2WAQG 2FXQA 4F88A 4POGA 4R4QA 3FPUB 2BDOA 2B29A 2K50A 5C4XB 1KQSA 1EIHA 1VQLA 5FJ8G 4N9PA 3SGIA 1PYWD 4A3JG 1CA5A 1SYDA 2WINB 4GNXA 1TS2A 4WRDA 3I2ZA 4GKKQ 2UU9Q 3CD6A 3S16H 3GTOH 1A2TA 4ZUJA 3ITPA 3I4MB 5GAEC 5CBEE 1B2TA 5TSSA 3KF8A 1IBMQ 2WAQB 3CU7A 2F0WA 3OIPA 4KKTA 1VQDA 2E75C 1D7QA 2CFMA 2VB3X 4A3JB 4YIJA 4LNQA 4UAIA 1D1IA 5T1IA 1IHZA 2JE6I 5G3LD 1EY0A 2IX1A 1A0IA 1A3TA 1YJ9A 4GOPA 1RJTA 5IP7G 2CH4A 4PQXA 3IKJA 4TQUS 4BY1H 1STGA 2AMCB 2ZTEA 5I6WA 2IL8A 2Y0SB 1CA6A 1EWCA 1MI2A 2BCOA 3TDQA 3TN2A 4LF5L 5M9OA 1KAWA 2B2UA 5KNDA 4YY3L 5E4WC 3H0GG 4IURA 5M3FG 4BY7G 5GROA 4JI1L 1KNAA 2WV6D 1YVCA 1XTDA 2E74C 2X6GA 3PGZA 2LY7A 4IJHA 3C2PA 1K0RA 5IGDA 1Y8NB 4Z9CB 4X64L 3W5OA 1F2MA 3G4SA 4B9XA 4LK1C 1YNND 1UAPA 2WAQE 4JVZA 1SE8A 4DPGA 4JI6Q 3H0GB 2UXDL 5M3FB 2MGSA 5IIFA 5C44G 4XT3B 3KFUA 2NWGA 1FGUA 2YTVA 1PZJD 1NNXA 3KLRA 4A76A 2V4DA 3NBHA 4JI3L 3HOUH 2EDGA 3I4NG 2R61A 1CUKA 2E2DC 4IUNA 2VQFQ 4NXML 2JN4A 3RR5A 1JWMD 5AJ3Q 4A3FG 3HFZB 1LTGD 1VQBA 3CQZH 4N9TA 5JPMC 5C0XI 2Y0SE 2A5HA 2R93H 1ET9A 2WKCA 4JI4L 1X65A 5C5MA 3L7ZC 2Z6BA 1TIID 3TS2A 4MZ9A 3H09A 3FKIH 1S5FD 1V1PB 5BR8Q 1RTNA 4A3EG 1SJED 3A7AB 3BDLA 4A3FB 4DUZQ 2UXBL 4JI5Q 1FNVA 4JI7L 3OIQA 3G6EA 1A6XA 5IT9c 1PLFA 1NTGA 3CHBD 1SNQA 1HNWQ 1STAA 4AYBG 2NVTB 2UUAQ 1XWEA 5H1SE 3O13A 4RG1A 2OQ0A 1S5CD 1EZ8A 5EQ0A 2Z9HA 1EY4A 3NELA 2HIVA 2Q8TA 4ZUIA 1PH2A 1G51A 2ICIA 1PYBA 2X6LA 1N36L 3A5ZB 4KY7A 4A3KG 3EA6A 4A3EB 4I7ZC 1JOQA 1IYUA 1Q8IA 4U673 2L15A 5DM63 5BN3A 4BBSH 4AYBB 2PZTA 4NKLA 2KHSA 3ULLA 1IZ6A 5E7NA 1DOMA 1LTSD 3J7A5 4LF4L 3K5OA 2NVYH 3S16B 3GTOB 4IFDH 3T1HQ 4H0LC 3RLFA 1D2BA 4A3KB 3U58A 4UPAA 1EFWA 1MSGA 1EYDA 4X66L 1YI2A 4BY1G 4PMWA 1PV4A 1VF5C 4FXGC 1IBLQ 4K2KA 5CV7A 3DMUA 1VF7A 2EY6A 3GQBA 4KKSA 4OEMB 1WTXA 3GTPH 1S5BD 2FJ2A 1DXMA 1LT3D 1GUWA 3MXGA 1P16A 4GNXB 1IYJB 4JBJA 3MZ5A 1X55A 1BQQT 2KENA 5LL6X 1M1KC 1OXVA 2V1CC 3MEFA 4X6AH 2KCMA 2PW5A 4GKJQ 2K52A 5CGKA 2KUMA 4BY1B 4DN4M 3KF8B 2JSOA 4Y52H 1HFNA 1NMGA 3BS1A 1LTID 3NENA 1XMQQ 4XYQA 1O7ZA 1SN8A 2AUJD 3GTJH 1TWAH 2F03A 3OMCA 2AWOA 3FHWA 4YWMA 4A3BH 3S2HH 1YHBA 1ENCA 4DR3Q 2EYOA 1E1TA 5CV5A 5C5LA 1YZ6A 3CMAA 2ZXPA 1N34Q 3VR2A 1XNRQ 4CDEC 2EYMA 4E6IA 4DR2Q 1B53A 1GUTA 1QVCA 3MEHA 4DAMA 2RA4A 3M4OB 3HOUG 3PUZA 4B3ML 3J7AV 1TT2A 1K83H 3PV0A 2H5XA 1PFSA 4KI0A 1PZKD 5DNFA 1FYCA 1QG7A 5CBAE 1GKHA 3VYRA 1IW7C 5CMDA 4KN4C 4RCNA 5NUCA 5KNCA 3JAML 2JA7G 1FNWA 1LO5D 2LKVA 2K05A 2R93G 2B2YA 1VQNA 1Z6HA 1EIYB 1DJRD 1GO3E 4I7AA 3HOUB 2EVBA 5JVH3 1HNZL 3C46A 4BXXH 4B3RL 4PMBA 5KYLA 1SE4A 1NSNS 2VS1A 2XNAC 5D65A 1SNCA 3PIP3 4K5XA 1PH4A 2JA7B 3J81L 4L8JA 3RLNA 2F0QA 4HIKA 1D1KA 1EOTA 3OSOA 2R93B 2DGYA 5IP9H 1C0AA 1G291 3AEVA 4DR5Q 1EEID 4DR6L 3NBHB 3S1QH 1RD9D 4KKUA 4F87A 1JMCA 2R7ZG 1TQOA 4IFDI 1B3QA 4G57A 4O1NA 3K5NA 4DNTB 4ZLTF 2BDNA 4BBSG 4GZYC 4XDXA 5D3IB 3VR4A 1HR0L 1UE7A 4CKEA 4J6HA 4F8MA 3J7YW 4RGTA 2Q8IB 4B9WA 2EXDA 4R4IA 1II3A 3RZDH 3HOZG 2DJFC 2RKSA 3OW7A 3WOEA 1RF2D 1SXTA 4BS9A 4DK1A 1VQKA 1VQAA 4RKBA 4BBSB 2VUMH 2SEBD 2B2WC 1X56A 3GTKH 3I7FA 1EY6A 5F2DA 2YTXA 2L1BA 3J80L 3CCVA 2F0NA 2NVYB 1LTRD 2HHHQ 4YCUA 2EYJA 1OXTA 2ENBA 3OOCA 5GQOA 3GTGH 3HOZB 4JOIC 3SXHA 4DR4Q 4DAVA 2EJFC 3NUCA 1Q86C 4DV1Q 2BE5C 2I5HA 1Y1VH 4X3TA 1LABA 1HR0W 3E9IA 3E0JA 3V96A 1X3EA 5CV8A 3D6CA 3AYHB 5C4HA 3I3CA 5CV9A 4LF6L 4A3BG 1E22A 1C7YA 4N8X1 1NJIC 1AE3A 3SK5A 4DUYQ 4S3SA 1DZ1A 4QIWB 2K5WA 1MKHA 5HGTA 1RIPA 2R7DA 5GADC 1GVPA 1N32Q 1AP0A 3GTJB 2KCCA 3BU2A 1NR4A 2B63G 1EWHA 3A55A 1EQVA 4A3BB 3AQQA 1VQ5A 1ILPA 3S1MH 2AQ3B 4Q5VA 1HNXL 1UEAB 4LF8L 3EIVA 3F2CA 4A3CH 1K8MA 3I56A 5FO7B 2NZOA 3BZKA 4LUOA 4HEDA 1XTCD 1O7LA 2UUCQ 4BXXG 3S1NH 1K83B 4YCVA 2F0DA 2DJGC 2N78A 1N9WA 4Y7NB 3UDXA 1H9KA 1LT5D 4XQNA 1VQ4A 5C4JH 1M90C 2B63B 2HCIA 4RHRA 5G3LF 4Q0FA 3TQYA 3TREA 3LWEA 2ASBA 4LWCA 1H9RA 1HZAA 2E76C 3F2DA 2HIXA 1EY8A 5LHY1 2Q2TA 1B50A 3D4WA 3R2TA 3QOLA 1TWFH 4L5SA 4ULLA 2QF7A 3FDTA 1SE3A 3GP7A 1STNA 1ML0D 4AIMA 2H1EA 1DOLA 1S4ZA 1AH9A 1CSQA 1CZWA 4KLKA 3BVMA 2E2IH 4JW0A 1SNDA 2RCFA 3S24A 5C3EH 1LTLA 2IPKD 1MJEA 1EY5A 3PO2H 1SMYC 3A8JE 1ZKOA 3S1QB 2NB0A 1EEFD 4MTNA 4UP8A 2XSCA 2PPBC 3UE0A 5IT9E 3E3XA 1LLRD 2A68C 1LTAD 3J81E 5CC4A 1I4XA 4PG3A 3EQLC 3Q6SA 1BVSA 4RCOA 1SAPA 4FF2A 2KCTA 4G4KA 2MHVA 3SK8A 1FJGL 1M4VA 4EX5A 4IUPA 5M5YB 4JPBW 2FHTA 2A6HD 3RZDB 1V9PA 3PF4A 1PDQA 3T13A 5FJ8H 2E2JH 1CT1D 1PRTC 3ND9A 4P74A 2JA5G 3GTKB 3K81C 4MIUA 3J81j 1WJJA 4RHSA 3T1YQ 3I4LA 3NQIA 2MNAA 1XYIA 3NP8A 2HCCA 4NW2A 2NTSA 1IBKL 3CW2C 4EQ5A 4B3TQ 1H9MA 3U9SA 2GVBA 3Q23A 4HR7B 3WDNA 1CK1A 5IYBH 3GTGB 4DU9A 1J8IA 2KJXA 1WD0A 5KGUA 1B7YB 1SNOA 2JA6G 1Y1VB 2WKDA 1U4MA 3I90A 3R3OA 5IP7H 2EE1A 2FMCA 4RFBA 1RCVD 2A6ED 2I5LX 4BBRG 3G71A 4ABNA 4JI2Q 3MTSA 4A3CG 1SYFA 2Z4HA 1X3QA 1Q81C 4LFBQ 2VXWA 1WTOA 1PZID 4BY7H 4DR7Q 1J6QA 1BKBA 1SDFA 2AQ1B 1HXYD 1BXTA 5HGQA 1UE6A 4UP7A 4BBRB 4WJWA 2NUCA 3S1MB 1VQ7A 1RL2A 4EVOA 1J5EQ 5M3MH 1V1PA 2JEBI 1CSPA 1K3BC 1PTOC 4FO2A 2EZVA 3LGJA 5C44H 1KDCA 4O0AA 2F0HA 5C4JB 2MFIA 2B39A 4QGUA 1Q46A 2N49A 2I5MX 2EY5A 4YCWA 2JA9A 4NXNL 4B3SL 3I8ZA 1P8LA 2JXMB 1FD7D 2NN6G 3GV3A 3I4NH 3VA7A 1K73C 4X65Q 4KHZA 4CGYB 4A3FH 3EFXD 1TWFB 3PO2G 4QY7A 4DGZA 2EQSA 2RBMA 4CDCC 2KA7A 2NVTH 3E6ZX 3M9BA 4JI8L 1HQMC 2R6GA 3A5UA 4X3KA 2E2IB 3KJPA 1XMOL 2VQEQ 3V2TA 1YNXA 5KNBA 4A3EH 4JI0Q 4ZAIA 3PO2B 1PFNA 2K04A 2L55A 3EVQA 1JCKB 2ZM6L 4AQYL 3AMUA 2RSNA 2XRQD 3CKIB 4ZRZA 4ILWA 4A4IA 1SYCA 5A35A 4KHVA 4F7XA 2EY2A 1HCZA 1GUSA 2UXCQ 2MO0A 3I70A 3K0XA 2F3VA 4OXPA 4A3KH 3R8BA 1YHAA 4OELB 5EPJA 5IWAL 4C56C 1CFMA 5IYBG 3CPWA 2E2JB 4C2MH 3NTIA 1VQIA 5ELFA 5K36H 1SMYD 3DEPA 4A93G 3HEJA 2O5JC 3TP6A 1SR3A 1JOKA 1XX8A 2QEXA 2D2CC 3I4OA 1WYDA 3MC0B 3K58A 3S14B 4IOAA 3BG3A 2PNHA 1K8OA 3ZJYC 1F9RA 2JA8H 1RTOA 4MTKA 1AW7A 1L1OC 3T56B 3E9HA 1KIXA 2BOSA 1A8VA 1I6VC 2HDLA 1EQRA 2PNRC 1WVLA 3D6WA 4A93B 3JAMi 2Z6KC 1B1ZA 1JE4A 1I4QA 1EQTA 2EIFA 4DAPA 1F9PA 1E2WA 2ZJRA 3GTMH 1I94L 4ME3A 1Q8KA 1DOKA 4L5QA 4LF5Q 1C4QA 1NR2A 5HURA 5LMUQ 4QCLA 4YY3Q 4V0BA 4C1NI 3TZDA 1WTQA 2B2TC 2F0GA 4LUVA 4JI1Q 3H3VI 3M4OH 2K5VA 5M3MG 3PSIA 3DWQA 1VQCA 1VQEA 5I2XA 4HJ7A 3J81i 1ZYRD 3I55A 1WTRA 1ZEQX 3K7UC 1JR0D 3GD7A 4FF3A 3NPPA 2L5TA 3MXNA 5KRUA 4X64Q 4BY7B 2IWHA 3UI2A 3CCJA 2A1AA 2E5LL 1K8GA 2CW0C 2RDGA 1R9TH 2UXDQ 3STBC 1I5FA 1FNUA 5M3MB 3HOVG 5FLXc 1WTVA 4LFAL 4DV5L 1IYVA 2K4KA 4JI3Q 1JB3A 1JOOA 3HKSA 5C44B 2JA7H 4MNOA 2UUBL 1V1OA 5GAHC 2FFKB 1CKOA 2VQFL 4K0KL 2SOBA 4IN3A 1DM0B 3TP7A 5AJ3L 1U4PA 2QILA 2K01A 2HD3A 3I4NB 3JC66 2SNSA 4GLVB 2KHJA 4P75A 2EJGC 4JI4Q 4DV2L 1JC7A 1PXUA 4C1NK 4KD3A 3DLLA 3Q8DA 1EYGA 2Q2UA 2J0TD 2LSSA 3BVZA 5IYCH 3M4QA 4DFAA 1IXRA 3J80i 1LV9A 4FVMA 1PTOD 4KK7A 1I4PA 3MFGA 2UXBQ 5BR8L 3F1ZA 4JI7Q 5IODA 1CQVA 1RKNA 4DF7A 4DUZL 2MUYA 4JI5L 1SROA 4IO9A 2AWNA 4DR1L 1YNJD 2ATWA 3ER0A 1ILQA 1HNWL 2R7ZH 1SBBB 1SJHD 2UUAL 1Q90A 1HH2P 5FLMH 3PUXA 1N36Q 3PIO3 2QDLA 4OGQC 3U4VA 1QVFA 2B8GA 4QMGA 5K36G 3U50C 2XTIA 5JJIA 1LYLA 1PYSB 3A8IE 1EIGA 4KJOA 3BYYB 4KY6A 3HOZH 4JC0A 4M1UB 3VR6A 2MPMA 4LF4Q 2XN9C 1BDOA 1E1OA 2M2LA 3IL8A 1YJWA 2JA8G 4OL7A 1SFOH 4C2MB 3T1HL 1WTPA 1HZBA 2EY1A 3PO3G 2ALYB 5IGFA 1QE6A 2JJQA 4JV5L 3U4ZA 1B70B 1L1OA 1EY9A 4IJLA 4HIOA 2EPBA 3BJUA 2PCFB 2Z6KA 4GS3A 1S5ED 2XWJB 1F2ZA 1NE3A 4J1MA 2D62A 4L5TA 2JA8B 3PMFA 3S17B 1MJCA 3VYTA 3PO3B 4K2LA 1WTHA 2BH2A 4OIJA 1N33L 4XXEA 3T53B 4DV0L 1JWSD 3GTMB 1KDAA 1TY0A 2PW7A 4AYBE 4OIKA 4A75A 5EGTA 3K57A 3PQIA 1STBA 2L4NA 4XT1B 1U5KA 1FGBD 4JBMA 4FXDA 2RCNA 4TVAB 4IPHA 1SSOA 2F3WA 4Y7NH 2LXJA 2TMPA 1KD1C 2B63H 1EYAA 5IGGA 1N34L 1KL9A 2PI2A 1YITA 3TSSA 4B3MQ 4TKOB 1JJCB 4RGMA 4R4TA 3LWUA 5JJKA 3SVMA 1TWCB 1R9TB 1Q82C 4DV3L 4FYDA 1KNEA 2YTYA 1HJPA 2PO4A 2F0IA 2WFWA 3B6YA 3PUVA 1F2YA 1UE5A 1SYBA 3AFPA 1HRJA 3F2UA 3TP8A 5D3DA 1NUCA 1AEXA 5IT9L 3GTQH 4K8JA 4ZKBB 2F3IA 4B3RQ 1PTOB 4P73A 3MXNB 1MIUA 5IYCG 4OO1H 1QJOA 4I65A 4GN3B 4RGNA 3HOXG 2IX0A 1BR9A 1NAPA 1SYEA 1Y14B 1HUNA 3CCQA 1EY7A 2DUDA 1Z47A 5FKAC 1E2ZA 3X3MA 2IW3A 4K8IA 4DV4L 4XQQA 4IALA 5FLMG 1B9NA 4DR5L 4DR6Q 3STBD 3W2DA 1N8RC 3HG9A 4OWTB 1YIJA 2KBNA 1WTWA 3CRKC 3HOXB 4P2CB 5CR3A 2NZ1D 4H13C 3ULJA 1T5EA 4DK0A 2F1MA 5JOBA 1SYGA 4IPDA 1FL0A 5M5YH 3CMEA 1V1QA 1HR0Q 2R7ZB 1BOSA 4XYOA 1U9RA 2O2LD 4DAYA 5J39A 3ONAB 4OWWB 1SEBD 3HKZG 1BCPC 2ICEC 1I4HA 4QUFA 5FOBB 1Y8PB 1B3AA 4WORA 1KTKA 2TSSA 4ZK9B 2CCZA 2F4VL 4A3IG 2JQOA 1S40A 1ZXTA 2L9HA 3DUZA 2EOTA 1PH5A 4GLXA 4X3UA 2R3ZA 2L11A 1L0YB 1Y8OB 1K0SA 3HOYG 2JA5H 3HKZB 1XNQL 2K5HA 3ND8A 4NDXA 1SFOB 2HHHL 1C48A 3J7ZC 1QWYA 3KOJA 3DM3A 2R92G 4LAAA 3L2PA 1JJGA 4DV1L 2N55A 3Q0AA 3K6OA 2Q2IA 1WD1A 1EUJA 4PZ8A 1Q7YC 3SK6A 4HJ8A 1D5XC 1A62A 4LF6Q 3HOYB 2JA6H 3IFTA 3FEWX 2B8FA 2IX3A 1U4RA 5C6AA 5KIXA 5A2QL 4DV6Q 1L1OB 4BBRH 3AU7A 1SLJA 4APVA 3W3AA 2VB2X 1HUMA 1G8ZD 3A8KE 3OWFA 1N32L 1QNKA 4IQZA 1A2UA 1CKMA 1FVIA 1HFGA 4QF4A 4HIDA 1PH1A 2C9OA 4JYAL 4OO1I 4PZ6A 4LF8Q 1K8AC 3TS0A 1NCVA 3N6RA 3NWTA 2EYPA 4DV7L 1GM5A 1TWHH 3KYHC 3CCUA 5DAUA 1B4OA 1ICWA 4OO1G 3A7LA 2G9DA 3OWEB 2F0VA 1AN8A 1Q1BA 2B2VC 3LX0A 1CHQD 1U4LA 3NE5B 3H3VC 1UE1A 1X3FA 3D3RA 3I72A 4X62Q 3PIOA 3CCMA 4DNRB 1NMFA 2PYKA 1VCIA 1JWUD 3GTQB 3U9OA 4HSPA 4QIWE 5CV6A 2K5DA 3ZYYX 2ZJPA 2O5IC 4LF9L 1PH6A 2NN6H 1PA6A 2QDBA 2NBFA 2G5DA 1IW7D 1X6OA 2DY8A 3E5SA 3NQTA 5E3FA 5CV4A 1JQYD 4HJ9A 2OWOA 1V8QA 5COYA 1NY4A 1DD2A 3J7AF 2QEJC 4CKBA 2CVRA 2JEAI 2GN5A 1J9OA 2C35B 4FF1A 2PQEA 1OXSC 2B2WA 5IGBA 2MJ8A 3UDGA 2X69A 3NSWA 1MHWC 3PUWA 4LF7L 3NTKA 5JAVA 1JB7A 2XVSA 4OONA 1MSHA 2F0PA 2F0OA 3DWPA 3SR1A 3TZUA 2RF4A 1S72A 1TWGH 2OXPA 5HY6A 1FJGQ 4JOIA 2D5DA 2AKWB 5E4XA 5IOCA 4IPGA 2CKZB 2KEDA 2N3SA 3TP5A 5JJZA 5LMNL 2PI2E 4OX9Q 3HZXA 3OYYA 2JK8A 3S14H 2B3GA 3WOFA 5JVG3 2MP1A 4XTCS 2D0PA 4GN4B 4GNXC 1HHVA 5M5WH 4OHJA 3S2DB 4A93H 4DAYB 1IBKQ 4KHPL 5JPNC 3OW2A 1UEBA 2JA5B 1G2SA 4B3TL 1STHA 2QGQA 1PTOF 5I9OA 4JCVE 5D14A 3MXUA 4MN3A 1O7IA 3QO2A 4A3GH 4G7HC 1HPCA 1ENAA 1TY2A 2NTTA 1BCPD 3E0EA 1M8AA 4CJ0B 2VW9A 2BH8A 1UNSA 1VDZA 2JA6B 3OPOA 1W6KA 2I0QA 4GOPC 3RNUA 5LMNW 3QG1A 3ULPA 2PZWA 2NVQH 2L12A 4N8FA 1KLUD 2K33A 4BA2I 1LACA 2K14A 2NYZD 4HAEA 2BE5D 2M9VA 2RQXA 1R4PB 2DNEA 4YHHL 2K32A 2B2UC 1EU4A 3I73A 3T16A 1VQMA 2N88A 4J8QA 1LT4D 2NN6I 4R1JA 3GDEA 2D9UA 1I3QB 3PCOB 3PF5A 1X3GA 2B2VA 3BDOA 5IY0A 5A2QE 3LNNA 4QL5A 4L63B 3M3YH 1TWHB 4BA1I 1AZQA 2FMMA 4UY8C 3HOVH 1W3SA 2EYHA 5ELCA 1E24A 3BZDB 1BF4A 1KAAA 2LS01 1XXGA 4P71A 4G7ZC 4NXNQ 1U0LA 5C3WA 1CHPD 4QQBX 3SK4A 3HRZC 1A3UA 4LFCL 1QILA 1D6EC 4IUVA 2F0MA 1IL8A 2DY7A 1ET6A 4ZQ3A 1TS3A 3K59A 4JI8Q 3OTOQ 1QNUA 4QJFA 2J4XA 2OEOA 3GO5A 4CBVA 4A3LG 1SNMA 1XMOQ 2XGTA 2RVLA 1G6ZA 1DYQA 1TS5A 2K7VA 4O2DA 3DWAA 2J7ZA 5EBCA 4JK1C 2Z4IA 4C3JG 4O42A 2ZM6Q 4AQYQ 3P1HA 2NVXH 3P7JA 3ERQA 4EQPA 2OQKA 4KMUC 4C3HH 1MD2D 4TRDA 4GKKL 2UXCL 2UU9L 1ONLA 1EFID 1BNZA 3MXPA 5I6YA 1TWGB 5IWAQ 2HT1A 4C3JB 2F0SA 1IBML 5L37A 1DCZA 2EXZA 3KJOA 4FXKC 4GLAC 2A68D 2DN8A 3IFDA 1BCPB 4A3MH 3SDZA 4C3IH 4A3GG 3UDFA 3D31A 4FNFA 4KV6A 3T51B 1BBWA 2Y0SG 4K6LA 4EQOA 3KBXA 3S17H 3PO3H 5I2YA 5M5WB 1LM0A 3KDFA 1SRUA 2F0EA 1GUGA 1CM9A 3K0YA 4HMJA 1K9MC 1I6HH 1TVXA 3QB3A 4CHTB 5I9PA 1PRTD 1Y1WH 4A3GB 1PVOA 2ID0A 4JBKA 1I94Q 5JJLA 4K5VA 1VQ6A 4WFN3 1YEZA 5LMUL 1KXLA 3HS0C 1EZ6A 3P75A 2NVQB 1VQGA 4HN7A 4V190 3FP9A 1TWCH 4LUZA 2OTJA 1LTTD 1HZCA 4JI6L 2D0OA 5ISRA 1BBUA 1QCBD 5BN5A 3UE1A 2YU9H 2E5LQ 1H9JA 4HJ5A 1A3VA 1CKNA 1BBXC 3NTHA 1JORA 1PFMA 1TR5A 2AUKA 1E2VA 1PTOH 1WOCA 3C1FA 4LFAQ 2NZHA 4NXMQ 4DV5Q 1GXDC 1QUQA 3QR8A 3M3YB 4IFDJ 1KDBA 1ESFA 3SEBA 1WI5A 3HOVB 3K80C 2UUBQ 3CXCA 1KRSA 4R8IA 3M85A 4K0KQ 1PH7A 3S1RB 3X3NA 2LFNA 2E2HH 3ERSX 2B2YC 2RHSB 1VQJA 2VNUD 3H91A 5BN4A 2RDHA 3JAMc 4DV2Q 2FINB 3KLSA 3G6JB 3W1GA 3HOXH 3D4DA 1HQRD 2CQOA 1YHQA 2CHBD 1G91A 2CH4W 3RN2A 5C0XG 1VQOA 2A8VA 3RZOH 4RMFA 4UDUC 1X54A 2F0JA 3TEHB 3VDYA 2ZTDA 4DR1Q 2A69C 4C3HG 5IGEA 1Z7TA 3J81c 1AFPA 1X3PA 4IUUA 3MHBA 2I46A 1LUZA 2JP1A 3QIAA 4HCSA 3QOJA 4CJ2C 2F4IA 3SHLA 1ICFB 1F9QA 1UUPA 4DKAC 1F2LA 3VYSA 3L0OA 5ELDA 4HTHA 2IT1A 5EBDA 2NVXB 3F8TA 5FO9B 4A3MG 1CI3M 1T9HA 3DHQA 2MO1A 4MHEA 4C3IG 4C3HB 2HQLA 1VQFA 3HP3A 4DXFA 3KLSX 3GV6A 4KD4A 1H9SA 2K5NA 1XPOA 1PH9A 4X66Q 4A3IH 1I4GA 4DK3C 2PQAA 4L5RC 1GUNA 1ASZA 1QB5D 1PRTB 3HGBA 1IBLL 3T4AC 3GTLH 1VMPA 1ENFA 4JV5Q 2SDFA 2JYOA 4A3MB 4KN7C 1WFQA 2LMCB 1Y1WG 4C3IB 1B8AA 1LT6D 3HOYH 4ID6A 5C4ZA 4IOCA 2B2TA 4RGOS
chains in the Genus database with same CATH topology
4TQUS 2Q2IA 4BY1H 1EIFA 1EUJA 4PZ8A 4HJ8A 1Q7YC 4GKJL 2AMCB 2VY3A 2R92H 2ZTEA 1A62A 3NEMA 4LF6Q 3J80c 5IP7H 2JA6H 2ES2A 1XMQL 4LF5L 4BBRG 2I5LX 1TXYA 3G71A 1N33Q 1KAWA 4YY3L 4JI2Q 4DV0Q 3H0GG 1PHJA 5M3FG 4DV6Q 4BY7G 4A3CG 1L1OB 5GROA 4JI1L 1YVCA 4BBRH 1Q81C 4LFBQ 1XTDA 1SLJA 4APVA 3CC4A 4DR3L 4P72A 3PGZA 1EQQA 3KDFB 4LW1A 4IJHA 4HJAA 4BY7H 4DR7Q 1N32L 1K0RA 1J6QA 1BKBA 4HIMA 1XNRL 4DR2L 1CKMA 1FVIA 4X64L 4HIDA 1PH1A 3W5OA 5HGQA 4JYAL 4OO1I 4PZ6A 1UE6A 4GN5A 4UP7A 3G4SA 2WAQE 4LF8Q 1K8AC 3TS0A 1SE8A 4GOPB 1VQ7A 1V43A 4DPGA 1RL2A 3K7AH 3H15A 4JI6Q 1J5EQ 5M3MH 2UXDL 4DV7L 2JEBI 5C44G 4A3DH 1CSPA 1GM5A 1TWHH 3KYHC 3LGJA 2YYZA 3CCUA 3KFUA 3KF6A 4ALPA 4DV3Q 1FGUA 2YTVA 4OO1G 5C44H 4O0AA 4A76A 2QA4A 4JI3L 3HOUH 1Q1BA 3I4NG 2MFIA 1HNZQ 4QGUA 1QZGA 1CUKA 1Q46A 2I5MX 2N49A 2VQFQ 4YCWA 2Z0SA 1UE1A 1X3FA 2JA9A 4NXNL 4X62Q 3PIOA 3CC7A 3RR5A 3CCMA 4B3SL 1NMFA 5AJ3Q 1P8LA 4A3FG 3HFZB 1VCIA 1VQBA 2NN6G 3CQZH 3I4NH 5C0XI 2Y0SE 1K73C 4X65Q 4KHZA 3BZCA 4QIWE 2R93H 4A3FH 3FKIG 2ZJPA 4JI4L 3PO2G 1X65A 4QY7A 4YWLA 1PH6A 1CKNB 4UP9A 5IE8A 1PA6A 4LF9L 2EQSA 3L7ZC 3TS2A 4MZ9A 1GD7A 1X6OA 2NVTH 3FKIH 3M9BA 4YWKA 4JI8L 5BR8Q 4HJ9A 4A3EG 2R6GA 2OWOA 3A5UA 4DV4Q 4DUZQ 2UXBL 4JI5Q 1NY4A 4JI7L 3G6EA 1QUQB 3KJPA 5IT9c 1XMOL 1G6PA 3PUYA 1NTGA 2ZTCA 3W1BA 2VQEQ 3CCSA 2JEAI 1E7ZA 1YNXA 1EOVA 1HZ9A 2GN5A 2KHIA 4AYBG 2K75A 5M5XH 4A3EH 4JI0Q 1HNWQ 3WWVA 2UUAQ 2C35B 5H1SE 4RG1A 2OQ0A 2OCEA 3NELA 2ZM6L 1OXSC 2HIVA 4AQYL 1PH2A 1G51A 1PYBA 3UDGA 1N36L 3PUWA 1L2FA 3A5ZB 4A3KG 4LF7L 4DK6C 1JB7A 4A4IA 4OONA 1K3RA 3M7NA 1OTCA 2UXCQ 2MO0A 3K0XA 2L15A 2GVAA 2RF4A 1S72A 1L0WA 4OXPA 4A3KH 4BBSH 1TWGH 5HY6A 1FJGQ 1YHAA 5JEAJ 4JOIA 1AE2A 4IFDG 3ULLA 1IZ6A 5IWAL 5E7NA 1KHIA 1OXUA 5IYDH 2AKWB 2F4VQ 3J7A5 1JE5A 4LF4L 5IYBG 3CPWA 2NVYH 2CKZB 2N3SA 4IPGA 3S2DH 4C2MH 5LMNL 3T1HQ 2PI2E 3RLFA 1VQIA 3U58A 4OX9Q 3OYYA 2JK8A 3K8AA 4UPAA 3S14H 4A93G 2B3GA 1EFWA 1SR3A 1VQ8A 4H02A 4X66L 4XTCS 4BY1G 2D0PA 4PMWA 1YI2A 1PV4A 4DR4L 4WJ3M 4GN4B 4GNXC 5M5WH 1XNQQ 2QEXA 3CCEA 1IBLQ 4A93H 4DAYB 1IBKQ 4KHPL 3I4OA 3EBEA 3OW2A 1UEBA 1WYDA 1PH8A 4NXML 1IL2A 3HOWH 4B3TL 4IOAA 3GTPH 2PNHA 2QGQA 3ZJYC 1E3PA 2JA8H 1P16A 4GNXB 1IYJB 4JCVE 1L1OC 3E9HA 1KIXA 4JBJA 1A8VA 1X55A 2KENA 1EQRA 1M1KC 1O7IA 4A3GH 1OXVA 2V1CC 3MEFA 3JAMi 4X6AH 2Z6KC 2KCMA 4GKJQ 2K52A 3E0EA 3KF8B 2EIFA 3GTMH 2ZJRA 4Y52H 2VW9A 2BH8A 1I94L 1NMGA 4DUYL 3NENA 1XMQQ 4POFA 2PQAB 1Q8KA 3G48A 4L5QA 4ME3A 4R4CA 1QZHA 5LMUQ 4LF5Q 1SN8A 3GTJH 1TWAH 4YY3Q 2I0QA 4GOPC 3RNUA 3D0FA 3CCLA 2AWOA 3FHWA 5LMNW 4YWMA 4LUVA 3ULPA 4JI1Q 2NVQH 3H3VI 2K5VA 3M4OH 4A3BH 5M3MG 3S2HH 3PSIA 1YHBA 4DV6L 4OWXB 4BA2I 2K14A 4A3DG 1VQCA 1VQEA 4DR3Q 1E1TA 4HJ7A 1HNXQ 1YZ6A 3J81i 3CMAA 1I3QH 3I55A 1VQHA 2IHEA 3K7UC 4FDBA 1N34Q 1XNRQ 4YHHL 3GD7A 4DR2Q 4X64Q 4J15A 4JYAQ 1QVCA 4DAMA 3CCJA 2A1AA 3HKZE 3PUZA 1VQMA 2E5LL 4B3ML 3HOUG 1K83H 2NN6I 2H5XA 1PFSA 3PV0A 3GDEA 4R1JA 4KI0A 1K8GA 3AFQA 2UUCL 1R9TH 4R4OA 2UXDQ 3PCOB 1KC8C 1GKHA 1X3GA 3PF5A 4DV7Q 2R7FA 3STBC 1ASYA 1I5FA 3EN2A 5IY0A 3HOVG 5FLXc 2JA7G 2AHOB 3IRBA 4QL5A 4LFAL 3M3YH 1YBYA 4DV5L 4BA1I 2R93G 1I50H 1VQNA 2K4KA 4UY8C 3HOVH 4JI3Q 1W3SA 3HKSA 1EIYB 2JA7H 1GO3E 4MNOA 1E24A 2VL6A 2UUBL 4BXXH 1HNZL 4B3RL 4P71A 5GAHC 1W2BA 4NXNQ 1U0LA 1CKOA 2VQFL 4K0KL 4QQBX 4X62L 2CWPA 2VS1A 5AJ3L 3ICEA 1WCMH 2VZAA 5IP9G 3JC66 1PH4A 4GLVB 4LFCL 2KHJA 4P75A 1C9OA 3CP0A 3RLNA 4HIKA 4JI4Q 4DV2L 4LF9Q 3CF5A 3DLLA 3KLWA 3Q8DA 2DGYA 1EYGA 5IP9H 2Q2UA 1C0AA 1G291 3AEVA 4DR5Q 3KF6B 2LSSA 5DLQE 5J3BA 3S15H 4JI8Q 5IYCH 3OTOQ 4DR6L 3M4QA 1IXRA 3NBHB 4A3CH 3S1QH 3J80i 4QJFA 2UXBQ 5BR8L 3F1ZA 4IPCA 4JI7Q 3GO5A 1JMCA 2R7ZG 4A3LG 4DUZL 1XMOQ 4JI5L 2XGTA 1SROA 2BA0A 4IO9A 4IFDI 1A63A 2AWNA 4DR1L 2A19A 2ZJQA 4O2DA 2ATWA 3ER0A 4BBSG 1HNWL 1EWIA 2R7ZH 4A3LH 2UUAL 1HH2P 2WB1G 5C4XH 5FLMH 1HR0L 2ZM6Q 4AQYQ 1VQ9A 1UE7A 1YJNA 5IYDG 3PUXA 3CPFA 1N36Q 4LF7Q 3U4VA 2NVXH 2EXDA 4R4IA 4C3JH 1QVFA 2VUMG 3RZDH 1H95A 2OQKA 3A0JA 3HOZG 5K36G 3U50C 5ELNA 4C3HH 2XTIA 3CCRA 5JJIA 5EAYA 4GKKL 2UXCL 2UU9L 1LYLA 1PYSB 2LXKA 1VQKA 1VQAA 3I4MH 2VUMH 5IWAQ 1X56A 3GTKH 2BA1A 3HOZH 2HT1A 4JC0A 1IBML 1QVGA 3M4PA 4LF4Q 3I7FA 3HOWG 2YTXA 1E1OA 1YJWA 1Q1EA 4JV5L 3CCVA 5LMNQ 3KJOA 4A3JH 1DGSA 1UWVA 2JA8G 2HHHQ 4YCUA 3T1YL 4GLAC 3T1HL 1SFOH 2OTLA 1HZBA 1OXTA 4OX9L 2ALYB 2RHQB 4A3MH 2JJQA 3PO3G 3U4ZA 5GQOA 1Y1VG 3GTGH 1B70B 2PMZE 4C3IH 4A3GG 4JOIC 3UDFA 1L1OA 3D31A 4IJLA 4DR4Q 4HIOA 3BJUA 1BBWA 2Y0SG 3S17H 4KHPQ 1Q86C 3PO3H 4DV1Q 2Z6KA 4JBWA 2IY5B 1LM0A 2I5HA 2F52A 1Y1VH 3KDFA 1SRUA 4GS3A 3RLOA 1HR0W 3E9IA 4NPSA 1X3EA 3AYHB 1NE3A 2Q2HA 1K9MC 4L5TA 2D62A 1I6HH 4LF6L 4A3BG 1MJCA 1XPUA 1E22A 4PZ7A 1XPRA 1C7YA 2BH2A 1Y1WH 1NJIC 1N33L 1PVOA 1JT8A 2ID0A 4JBKA 1AE3A 1I94Q 1XJVA 4JI2L 5JJLA 4DUYQ 4DV0L 1VQ6A 4AYBE 1MKHA 1YEZA 3CC2A 4LFBL 1RIPA 5ELOA 4AH6A 5C0XJ 5LMUL 2IHFA 2R7DA 5GADC 1GVPA 4A75A 1N32Q 4JG2A 1KXLA 4DR7L 3BU2A 1U5KA 2B63G 5JEAG 4JI6L 4JBMA 2RCNA 4TVAB 1VQGA 3PIPA 3AQQA 1VQ5A 4IPHA 3S1MH 3FP9A 1X9NA 4Y7NH 1TWCH 2WB1E 2LXJA 4LUZA 1KD1C 1HNXL 3H0GH 4YHHQ 4LF8L 3EIVA 5M3FH 3F2CA 2B63H 1N34L 3TRZA 1KL9A 3I56A 1HZCA 2PI2A 1SMXA 2NZOA 2D0OA 3BZKA 1BBUA 4LUOA 5GAGC 3UE1A 1YITA 1J5EL 2YU9H 4B3MQ 2E5LQ 3CAMA 4HJ5A 1CKNA 1JJCB 2WP8J 1KRTA 4NB3A 4R4TA 2UUCQ 4BXXG 1Z9FA 3S1NH 4YCVA 2N78A 5JJKA 1N9WA 3UDXA 1Q82C 2CWAA 2N8NA 4DV3L 2YTYA 5C4JH 1HJPA 1VQ4A 1M90C 2WFWA 1WOCA 3B6YA 4XIGS 3PUVA 1WCMG 4LFAQ 3TQYA 2NZHA 3TREA 3S1RH 4DV5Q 4B3SQ 4NXMQ 1QUQA 1UE5A 3AFPA 2ASBA 4IFDJ 4LWCA 1HZAA 4WJ4A 3F2DA 2HIXA 1Q12A 1WI5A 3GTQH 2Q2TA 3K80C 2UUBQ 2F3IA 2E8GA 3CXCA 1KRSA 4X65L 3M85A 3RN5A 3H3VH 4B3RQ 4P73A 3MXNB 1TWFH 4K0KQ 1MIUA 5IYCG 3F2BA 1PH7A 1VS0A 4L5SA 2E2HH 4GN3B 3ERSX 3HOXG 2IX0A 2RHSB 4LFCQ 1Y14B 1VQJA 2YV5A 5C3EG 2OTJA 2VNUD 3JAMc 4DV2Q 4AIMA 3A74A 3CCQA 1AH9A 1CSQA 1S3OA 1Z47A 2DUDA 4KLKA 3W1GA 3HOXH 1JJ2A 4DV4L 2E2IH 1VQPA 2CQOA 3S24A 5C3EH 1LTLA 5C4XG 5FLMG 1YHQA 4DR5L 4DR6Q 3STBD 2MQHA 1MJEA 2VQEL 3PO2H 3RN2A 5C0XG 3OTOL 1VQOA 3UDIA 1N8RC 4JI0L 2A8VA 3RZOH 4OWTB 1YIJA 2KBNA 4RMFA 1X54A 4DNIA 1PH3A 3VDYA 3TEHB 4MTNA 2ZTDA 4UP8A 4DR1Q 1D8LA 3ULJA 3UE0A 1NBWA 3J81c 3I4MG 4IPDA 1FL0A 1OXXK 4PG3A 5M5YH 3CMEA 1V1QA 1HR0Q 2WAQG 1BVSA 1LUZA 2FXQA 4POGA 4R4QA 2B29A 2K50A 1KQSA 1VQLA 5FJ8G 2KCTA 4OWWB 3SGIA 4A3JG 4DKAC 3HKZG 1FJGL 3L0OA 4EX5A 2IT1A 2JA6G 3F8TA 4GNXA 4A3MG 1V9PA 3PF4A 1T9HA 3I2ZA 4GKKQ 2MO1A 2UU9Q 5FJ8H 2CCZA 2F4VL 2HQLA 2E2JH 3CD6A 4A3IG 3GTOH 2JQOA 1VQFA 3S16H 1S40A 1PH5A 5GAEC 4GLXA 4P74A 2JA5G 1XPOA 2K5NA 1IBMQ 3K81C 1PH9A 4X66Q 3J81j 4A3IH 4DK3C 1VQDA 2PQAA 4L5RC 1WJJA 1D7QA 1ASZA 2CFMA 3T1YQ 2MNAA 3HOYG 2JA5H 1IBLL 4LNQA 1XNQL 3GTLH 2K5HA 2HHHL 1IBKL 4JV5Q 3CW2C 4EQ5A 4B3TQ 2GVBA 2JE6I 3J7ZC 1WFQA 5IYBH 1Y1WG 1B8AA 3KOJA 3HOYH 2IX1A 3DM3A 2R92G 1A0IA 1YJ9A 3L2PA 4GOPA 1JJGA 5IP7G 4DV1L 1B7YB 4IOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TQU S;  2Q2I A;  4BY1 H;  1EIF A;  1EUJ A;  4PZ8 A;  4HJ8 A;  1Q7Y C;  4GKJ L;  2AMC B;  2VY3 A;  2R92 H;  2ZTE A;  1A62 A;  3NEM A;  4LF6 Q;  3J80 c;  5IP7 H;  2JA6 H;  2ES2 A;  1XMQ L;  4LF5 L;  4BBR G;  2I5L X;  1TXY A;  3G71 A;  1N33 Q;  1KAW A;  4YY3 L;  4JI2 Q;  4DV0 Q;  3H0G G;  1PHJ A;  5M3F G;  4DV6 Q;  4BY7 G;  4A3C G;  1L1O B;  5GRO A;  4JI1 L;  1YVC A;  4BBR H;  1Q81 C;  4LFB Q;  1XTD A;  1SLJ A;  4APV A;  3CC4 A;  4DR3 L;  4P72 A;  3PGZ A;  1EQQ A;  3KDF B;  4LW1 A;  4IJH A;  4HJA A;  4BY7 H;  4DR7 Q;  1N32 L;  1K0R A;  1J6Q A;  1BKB A;  4HIM A;  1XNR L;  4DR2 L;  1CKM A;  1FVI A;  4X64 L;  4HID A;  1PH1 A;  3W5O A;  5HGQ A;  4JYA L;  4OO1 I;  4PZ6 A;  1UE6 A;  4GN5 A;  4UP7 A;  3G4S A;  2WAQ E;  4LF8 Q;  1K8A C;  3TS0 A;  1SE8 A;  4GOP B;  1VQ7 A;  1V43 A;  4DPG A;  1RL2 A;  3K7A H;  3H15 A;  4JI6 Q;  1J5E Q;  5M3M H;  2UXD L;  4DV7 L;  2JEB I;  5C44 G;  4A3D H;  1CSP A;  1GM5 A;  1TWH H;  3KYH C;  3LGJ A;  2YYZ A;  3CCU A;  3KFU A;  3KF6 A;  4ALP A;  4DV3 Q;  1FGU A;  2YTV A;  4OO1 G;  5C44 H;  4O0A A;  4A76 A;  2QA4 A;  4JI3 L;  3HOU H;  1Q1B A;  3I4N G;  2MFI A;  1HNZ Q;  4QGU A;  1QZG A;  1CUK A;  1Q46 A;  2I5M X;  2N49 A;  2VQF Q;  4YCW A;  2Z0S A;  1UE1 A;  1X3F A;  2JA9 A;  4NXN L;  4X62 Q;  3PIO A;  3CC7 A;  3RR5 A;  3CCM A;  4B3S L;  1NMF A;  5AJ3 Q;  1P8L A;  4A3F G;  3HFZ B;  1VCI A;  1VQB A;  2NN6 G;  3CQZ H;  3I4N H;  5C0X I;  2Y0S E;  1K73 C;  4X65 Q;  4KHZ A;  3BZC A;  4QIW E;  2R93 H;  4A3F H;  3FKI G;  2ZJP A;  4JI4 L;  3PO2 G;  1X65 A;  4QY7 A;  4YWL A;  1PH6 A;  1CKN B;  4UP9 A;  5IE8 A;  1PA6 A;  4LF9 L;  2EQS A;  3L7Z C;  3TS2 A;  4MZ9 A;  1GD7 A;  1X6O A;  2NVT H;  3FKI H;  3M9B A;  4YWK A;  4JI8 L;  5BR8 Q;  4HJ9 A;  4A3E G;  2R6G A;  2OWO A;  3A5U A;  4DV4 Q;  4DUZ Q;  2UXB L;  4JI5 Q;  1NY4 A;  4JI7 L;  3G6E A;  1QUQ B;  3KJP A;  5IT9 c;  1XMO L;  1G6P A;  3PUY A;  1NTG A;  2ZTC A;  3W1B A;  2VQE Q;  3CCS A;  2JEA I;  1E7Z A;  1YNX A;  1EOV A;  1HZ9 A;  2GN5 A;  2KHI A;  4AYB G;  2K75 A;  5M5X H;  4A3E H;  4JI0 Q;  1HNW Q;  3WWV A;  2UUA Q;  2C35 B;  5H1S E;  4RG1 A;  2OQ0 A;  2OCE A;  3NEL A;  2ZM6 L;  1OXS C;  2HIV A;  4AQY L;  1PH2 A;  1G51 A;  1PYB A;  3UDG A;  1N36 L;  3PUW A;  1L2F A;  3A5Z B;  4A3K G;  4LF7 L;  4DK6 C;  1JB7 A;  4A4I A;  4OON A;  1K3R A;  3M7N A;  1OTC A;  2UXC Q;  2MO0 A;  3K0X A;  2L15 A;  2GVA A;  2RF4 A;  1S72 A;  1L0W A;  4OXP A;  4A3K H;  4BBS H;  1TWG H;  5HY6 A;  1FJG Q;  1YHA A;  5JEA J;  4JOI A;  1AE2 A;  4IFD G;  3ULL A;  1IZ6 A;  5IWA L;  5E7N A;  1KHI A;  1OXU A;  5IYD H;  2AKW B;  2F4V Q;  3J7A 5;  1JE5 A;  4LF4 L;  5IYB G;  3CPW A;  2NVY H;  2CKZ B;  2N3S A;  4IPG A;  3S2D H;  4C2M H;  5LMN L;  3T1H Q;  2PI2 E;  3RLF A;  1VQI A;  3U58 A;  4OX9 Q;  3OYY A;  2JK8 A;  3K8A A;  4UPA A;  3S14 H;  4A93 G;  2B3G A;  1EFW A;  1SR3 A;  1VQ8 A;  4H02 A;  4X66 L;  4XTC S;  4BY1 G;  2D0P A;  4PMW A;  1YI2 A;  1PV4 A;  4DR4 L;  4WJ3 M;  4GN4 B;  4GNX C;  5M5W H;  1XNQ Q;  2QEX A;  3CCE A;  1IBL Q;  4A93 H;  4DAY B;  1IBK Q;  4KHP L;  3I4O A;  3EBE A;  3OW2 A;  1UEB A;  1WYD A;  1PH8 A;  4NXM L;  1IL2 A;  3HOW H;  4B3T L;  4IOA A;  3GTP H;  2PNH A;  2QGQ A;  3ZJY C;  1E3P A;  2JA8 H;  1P16 A;  4GNX B;  1IYJ B;  4JCV E;  1L1O C;  3E9H A;  1KIX A;  4JBJ A;  1A8V A;  1X55 A;  2KEN A;  1EQR A;  1M1K C;  1O7I A;  4A3G H;  1OXV A;  2V1C C;  3MEF A;  3JAM i;  4X6A H;  2Z6K C;  2KCM A;  4GKJ Q;  2K52 A;  3E0E A;  3KF8 B;  2EIF A;  3GTM H;  2ZJR A;  4Y52 H;  2VW9 A;  2BH8 A;  1I94 L;  1NMG A;  4DUY L;  3NEN A;  1XMQ Q;  4POF A;  2PQA B;  1Q8K A;  3G48 A;  4L5Q A;  4ME3 A;  4R4C A;  1QZH A;  5LMU Q;  4LF5 Q;  1SN8 A;  3GTJ H;  1TWA H;  4YY3 Q;  2I0Q A;  4GOP C;  3RNU A;  3D0F A;  3CCL A;  2AWO A;  3FHW A;  5LMN W;  4YWM A;  4LUV A;  3ULP A;  4JI1 Q;  2NVQ H;  3H3V I;  2K5V A;  3M4O H;  4A3B H;  5M3M G;  3S2H H;  3PSI A;  1YHB A;  4DV6 L;  4OWX B;  4BA2 I;  2K14 A;  4A3D G;  1VQC A;  1VQE A;  4DR3 Q;  1E1T A;  4HJ7 A;  1HNX Q;  1YZ6 A;  3J81 i;  3CMA A;  1I3Q H;  3I55 A;  1VQH A;  2IHE A;  3K7U C;  4FDB A;  1N34 Q;  1XNR Q;  4YHH L;  3GD7 A;  4DR2 Q;  4X64 Q;  4J15 A;  4JYA Q;  1QVC A;  4DAM A;  3CCJ A;  2A1A A;  3HKZ E;  3PUZ A;  1VQM A;  2E5L L;  4B3M L;  3HOU G;  1K83 H;  2NN6 I;  2H5X A;  1PFS A;  3PV0 A;  3GDE A;  4R1J A;  4KI0 A;  1K8G A;  3AFQ A;  2UUC L;  1R9T H;  4R4O A;  2UXD Q;  3PCO B;  1KC8 C;  1GKH A;  1X3G A;  3PF5 A;  4DV7 Q;  2R7F A;  3STB C;  1ASY A;  1I5F A;  3EN2 A;  5IY0 A;  3HOV G;  5FLX c;  2JA7 G;  2AHO B;  3IRB A;  4QL5 A;  4LFA L;  3M3Y H;  1YBY A;  4DV5 L;  4BA1 I;  2R93 G;  1I50 H;  1VQN A;  2K4K A;  4UY8 C;  3HOV H;  4JI3 Q;  1W3S A;  3HKS A;  1EIY B;  2JA7 H;  1GO3 E;  4MNO A;  1E24 A;  2VL6 A;  2UUB L;  4BXX H;  1HNZ L;  4B3R L;  4P71 A;  5GAH C;  1W2B A;  4NXN Q;  1U0L A;  1CKO A;  2VQF L;  4K0K L;  4QQB X;  4X62 L;  2CWP A;  2VS1 A;  5AJ3 L;  3ICE A;  1WCM H;  2VZA A;  5IP9 G;  3JC6 6;  1PH4 A;  4GLV B;  4LFC L;  2KHJ A;  4P75 A;  1C9O A;  3CP0 A;  3RLN A;  4HIK A;  4JI4 Q;  4DV2 L;  4LF9 Q;  3CF5 A;  3DLL A;  3KLW A;  3Q8D A;  2DGY A;  1EYG A;  5IP9 H;  2Q2U A;  1C0A A;  1G29 1;  3AEV A;  4DR5 Q;  3KF6 B;  2LSS A;  5DLQ E;  5J3B A;  3S15 H;  4JI8 Q;  5IYC H;  3OTO Q;  4DR6 L;  3M4Q A;  1IXR A;  3NBH B;  4A3C H;  3S1Q H;  3J80 i;  4QJF A;  2UXB Q;  5BR8 L;  3F1Z A;  4IPC A;  4JI7 Q;  3GO5 A;  1JMC A;  2R7Z G;  4A3L G;  4DUZ L;  1XMO Q;  4JI5 L;  2XGT A;  1SRO A;  2BA0 A;  4IO9 A;  4IFD I;  1A63 A;  2AWN A;  4DR1 L;  2A19 A;  2ZJQ A;  4O2D A;  2ATW A;  3ER0 A;  4BBS G;  1HNW L;  1EWI A;  2R7Z H;  4A3L H;  2UUA L;  1HH2 P;  2WB1 G;  5C4X H;  5FLM H;  1HR0 L;  2ZM6 Q;  4AQY Q;  1VQ9 A;  1UE7 A;  1YJN A;  5IYD G;  3PUX A;  3CPF A;  1N36 Q;  4LF7 Q;  3U4V A;  2NVX H;  2EXD A;  4R4I A;  4C3J H;  1QVF A;  2VUM G;  3RZD H;  1H95 A;  2OQK A;  3A0J A;  3HOZ G;  5K36 G;  3U50 C;  5ELN A;  4C3H H;  2XTI A;  3CCR A;  5JJI A;  5EAY A;  4GKK L;  2UXC L;  2UU9 L;  1LYL A;  1PYS B;  2LXK A;  1VQK A;  1VQA A;  3I4M H;  2VUM H;  5IWA Q;  1X56 A;  3GTK H;  2BA1 A;  3HOZ H;  2HT1 A;  4JC0 A;  1IBM L;  1QVG A;  3M4P A;  4LF4 Q;  3I7F A;  3HOW G;  2YTX A;  1E1O A;  1YJW A;  1Q1E A;  4JV5 L;  3CCV A;  5LMN Q;  3KJO A;  4A3J H;  1DGS A;  1UWV A;  2JA8 G;  2HHH Q;  4YCU A;  3T1Y L;  4GLA C;  3T1H L;  1SFO H;  2OTL A;  1HZB A;  1OXT A;  4OX9 L;  2ALY B;  2RHQ B;  4A3M H;  2JJQ A;  3PO3 G;  3U4Z A;  5GQO A;  1Y1V G;  3GTG H;  1B70 B;  2PMZ E;  4C3I H;  4A3G G;  4JOI C;  3UDF A;  1L1O A;  3D31 A;  4IJL A;  4DR4 Q;  4HIO A;  3BJU A;  1BBW A;  2Y0S G;  3S17 H;  4KHP Q;  1Q86 C;  3PO3 H;  4DV1 Q;  2Z6K A;  4JBW A;  2IY5 B;  1LM0 A;  2I5H A;  2F52 A;  1Y1V H;  3KDF A;  1SRU A;  4GS3 A;  3RLO A;  1HR0 W;  3E9I A;  4NPS A;  1X3E A;  3AYH B;  1NE3 A;  2Q2H A;  1K9M C;  4L5T A;  2D62 A;  1I6H H;  4LF6 L;  4A3B G;  1MJC A;  1XPU A;  1E22 A;  4PZ7 A;  1XPR A;  1C7Y A;  2BH2 A;  1Y1W H;  1NJI C;  1N33 L;  1PVO A;  1JT8 A;  2ID0 A;  4JBK A;  1AE3 A;  1I94 Q;  1XJV A;  4JI2 L;  5JJL A;  4DUY Q;  4DV0 L;  1VQ6 A;  4AYB E;  1MKH A;  1YEZ A;  3CC2 A;  4LFB L;  1RIP A;  5ELO A;  4AH6 A;  5C0X J;  5LMU L;  2IHF A;  2R7D A;  5GAD C;  1GVP A;  4A75 A;  1N32 Q;  4JG2 A;  1KXL A;  4DR7 L;  3BU2 A;  1U5K A;  2B63 G;  5JEA G;  4JI6 L;  4JBM A;  2RCN A;  4TVA B;  1VQG A;  3PIP A;  3AQQ A;  1VQ5 A;  4IPH A;  3S1M H;  3FP9 A;  1X9N A;  4Y7N H;  1TWC H;  2WB1 E;  2LXJ A;  4LUZ A;  1KD1 C;  1HNX L;  3H0G H;  4YHH Q;  4LF8 L;  3EIV A;  5M3F H;  3F2C A;  2B63 H;  1N34 L;  3TRZ A;  1KL9 A;  3I56 A;  1HZC A;  2PI2 A;  1SMX A;  2NZO A;  2D0O A;  3BZK A;  1BBU A;  4LUO A;  5GAG C;  3UE1 A;  1YIT A;  1J5E L;  2YU9 H;  4B3M Q;  2E5L Q;  3CAM A;  4HJ5 A;  1CKN A;  1JJC B;  2WP8 J;  1KRT A;  4NB3 A;  4R4T A;  2UUC Q;  4BXX G;  1Z9F A;  3S1N H;  4YCV A;  2N78 A;  5JJK A;  1N9W A;  3UDX A;  1Q82 C;  2CWA A;  2N8N A;  4DV3 L;  2YTY A;  5C4J H;  1HJP A;  1VQ4 A;  1M90 C;  2WFW A;  1WOC A;  3B6Y A;  4XIG S;  3PUV A;  1WCM G;  4LFA Q;  3TQY A;  2NZH A;  3TRE A;  3S1R H;  4DV5 Q;  4B3S Q;  4NXM Q;  1QUQ A;  1UE5 A;  3AFP A;  2ASB A;  4IFD J;  4LWC A;  1HZA A;  4WJ4 A;  3F2D A;  2HIX A;  1Q12 A;  1WI5 A;  3GTQ H;  2Q2T A;  3K80 C;  2UUB Q;  2F3I A;  2E8G A;  3CXC A;  1KRS A;  4X65 L;  3M85 A;  3RN5 A;  3H3V H;  4B3R Q;  4P73 A;  3MXN B;  1TWF H;  4K0K Q;  1MIU A;  5IYC G;  3F2B A;  1PH7 A;  1VS0 A;  4L5S A;  2E2H H;  4GN3 B;  3ERS X;  3HOX G;  2IX0 A;  2RHS B;  4LFC Q;  1Y14 B;  1VQJ A;  2YV5 A;  5C3E G;  2OTJ A;  2VNU D;  3JAM c;  4DV2 Q;  4AIM A;  3A74 A;  3CCQ A;  1AH9 A;  1CSQ A;  1S3O A;  1Z47 A;  2DUD A;  4KLK A;  3W1G A;  3HOX H;  1JJ2 A;  4DV4 L;  2E2I H;  1VQP A;  2CQO A;  3S24 A;  5C3E H;  1LTL A;  5C4X G;  5FLM G;  1YHQ A;  4DR5 L;  4DR6 Q;  3STB D;  2MQH A;  1MJE A;  2VQE L;  3PO2 H;  3RN2 A;  5C0X G;  3OTO L;  1VQO A;  3UDI A;  1N8R C;  4JI0 L;  2A8V A;  3RZO H;  4OWT B;  1YIJ A;  2KBN A;  4RMF A;  1X54 A;  4DNI A;  1PH3 A;  3VDY A;  3TEH B;  4MTN A;  2ZTD A;  4UP8 A;  4DR1 Q;  1D8L A;  3ULJ A;  3UE0 A;  1NBW A;  3J81 c;  3I4M G;  4IPD A;  1FL0 A;  1OXX K;  4PG3 A;  5M5Y H;  3CME A;  1V1Q A;  1HR0 Q;  2WAQ G;  1BVS A;  1LUZ A;  2FXQ A;  4POG A;  4R4Q A;  2B29 A;  2K50 A;  1KQS A;  1VQL A;  5FJ8 G;  2KCT A;  4OWW B;  3SGI A;  4A3J G;  4DKA C;  3HKZ G;  1FJG L;  3L0O A;  4EX5 A;  2IT1 A;  2JA6 G;  3F8T A;  4GNX A;  4A3M G;  1V9P A;  3PF4 A;  1T9H A;  3I2Z A;  4GKK Q;  2MO1 A;  2UU9 Q;  5FJ8 H;  2CCZ A;  2F4V L;  2HQL A;  2E2J H;  3CD6 A;  4A3I G;  3GTO H;  2JQO A;  1VQF A;  3S16 H;  1S40 A;  1PH5 A;  5GAE C;  4GLX A;  4P74 A;  2JA5 G;  1XPO A;  2K5N A;  1IBM Q;  3K81 C;  1PH9 A;  4X66 Q;  3J81 j;  4A3I H;  4DK3 C;  1VQD A;  2PQA A;  4L5R C;  1WJJ A;  1D7Q A;  1ASZ A;  2CFM A;  3T1Y Q;  2MNA A;  3HOY G;  2JA5 H;  1IBL L;  4LNQ A;  1XNQ L;  3GTL H;  2K5H A;  2HHH L;  1IBK L;  4JV5 Q;  3CW2 C;  4EQ5 A;  4B3T Q;  2GVB A;  2JE6 I;  3J7Z C;  1WFQ A;  5IYB H;  1Y1W G;  1B8A A;  3KOJ A;  3HOY H;  2IX1 A;  3DM3 A;  2R92 G;  1A0I A;  1YJ9 A;  3L2P A;  4GOP A;  1JJG A;  5IP7 G;  4DV1 L;  1B7Y B;  4IOC A; 
#chains in the Genus database with same CATH topology
 2P5Z X;  3NBI A;  1MGS A;  1EIF A;  4X3S A;  4GKJ L;  2VY3 A;  2R92 H;  3AB9 A;  2QCP X;  3MVV A;  3NEM A;  3OMG A;  5CYU A;  3J80 c;  3MAQ A;  1Y69 U;  3L9A X;  1I6H B;  5EPL A;  1SNP A;  2ES2 A;  1XMQ L;  1N33 Q;  1TXY A;  1KLG D;  4ZCK A;  1Y1W B;  4NP5 A;  4DV0 Q;  1PHJ A;  1L0X B;  4H7B A;  2G9H D;  3URY A;  5FLX L;  1TS4 A;  1AZP A;  3G7L A;  5AFW A;  5FO8 B;  3Q24 A;  4DR3 L;  3CC4 A;  4P72 A;  1EQQ A;  3KDF B;  4LW1 A;  4HJA A;  5DEH A;  4HIM A;  3V05 A;  1XNR L;  4DR2 L;  4R9W A;  3EJI A;  2KVM A;  1VMC A;  4GN5 A;  3KBG A;  4GOP B;  1V43 A;  4HSV A;  1TU2 B;  3K7A H;  3H15 A;  1K28 A;  3D4R A;  2DNC A;  4A3D H;  3KK7 A;  2YU9 B;  2YYZ A;  3KF6 A;  4L6T B;  1TKW B;  4ALP A;  4DV3 Q;  2C5C A;  4K14 A;  2QA4 A;  2XRS D;  1HNZ Q;  2PZU A;  1QZG A;  2Z0S A;  3CC7 A;  2ZXO A;  3NWS A;  3C1E A;  1PMR A;  2A74 C;  4DXG A;  3BVG A;  1BCP F;  3BZC A;  4IZ8 A;  2IJ0 A;  3FKI G;  4YWL A;  1CKN B;  1S5D D;  4UP9 A;  5IE8 A;  2E2H B;  2CW0 D;  3TBI B;  2Z1C A;  1GD7 A;  5ELE A;  3CQZ B;  4B08 A;  4YWK A;  1IKM A;  2A6H C;  4DV4 Q;  1B9M A;  4RH6 A;  1A15 A;  2AQ2 B;  1QUQ B;  1R4Q B;  1HTP A;  3PUY A;  2ZTC A;  3W1B A;  1G6P A;  3CCS A;  1E7Z A;  3VA5 A;  1EOV A;  1HZ9 A;  2KHI A;  5M5X H;  4XQJ A;  2K75 A;  3FKI B;  3RUZ A;  3WWV A;  3H6M A;  3RZO B;  5EPK A;  2OCE A;  1I4R A;  1GOZ A;  1HTL D;  1L2F A;  1MBY A;  4DK6 C;  2O4X A;  1RDP D;  1HA5 A;  2KOL A;  1K3R A;  3M7N A;  2F0T A;  1OTC A;  4TSS A;  4U68 A;  2GVA A;  1L0W A;  2EJM A;  1Q3L A;  1F9S A;  5JEA J;  4IFD G;  1AE2 A;  4EGV A;  1KHI A;  1OXU A;  5IYD H;  4K6D A;  2F4V Q;  1JE5 A;  3S2D H;  5COR A;  1D5M C;  2A6E C;  1SE2 A;  3K8A A;  3QJY A;  4ZKC B;  4UHV A;  3R93 A;  4IUQ A;  1VQ8 A;  4H02 A;  2K6A A;  4WJ3 M;  4DR4 L;  4A3I B;  5J1Z A;  2A69 D;  1XNQ Q;  3CCE A;  2RDF A;  2K1B A;  4RWS C;  3EBE A;  3MFY A;  4CDD C;  1PH8 A;  3GTL B;  1IL2 A;  3HOW H;  2L0C A;  1E3P A;  1STE A;  1G2T A;  4IUT A;  4PNY A;  2QKI C;  3M4Y A;  3DM1 A;  3C3L A;  2H4O A;  5EKK A;  3GTP B;  1H9S B;  5LL6 S;  5C3X A;  3IAY A;  2R92 B;  4DUY L;  5I4D A;  4POF A;  2PQA B;  3G48 A;  3NXW A;  1QZH A;  4R4C A;  3D0F A;  3CCL A;  1GHJ A;  3R2I A;  4DV6 L;  4OWX B;  4A3D G;  4PV1 C;  5J22 A;  3L3O C;  1HNX Q;  5KYI A;  1I3Q H;  1VQH A;  2IHE A;  4FDB A;  1TWA B;  4R8N A;  2ZT9 C;  1O80 A;  4ME5 A;  1PFB A;  4J15 A;  4JYA Q;  3S2H B;  3HKZ E;  3AFQ A;  2UUC L;  4R4O A;  1KC8 C;  4DV7 Q;  5JEA H;  3K7A B;  2R7F A;  1ASY A;  3EN2 A;  2HUG A;  2AHO B;  4A3D B;  2KCN A;  3IRB A;  5FLX E;  1YBY A;  2XIW A;  3H94 A;  3NHH A;  1I50 H;  2OF1 A;  4M8A A;  2F0U A;  2VL6 A;  3QWN A;  2A73 B;  4HMI A;  1W2B A;  2F0K A;  4X62 L;  2CWP A;  1PRT F;  3ICE A;  3FPP A;  1WCM H;  2VZA A;  5IP9 G;  4FP5 D;  1ROD A;  1C9O A;  3CP0 A;  4LF9 Q;  3CF5 A;  1ESR A;  3CRL C;  3KLW A;  2PMZ B;  3ERO A;  3KF6 B;  5DLQ E;  5J3B A;  3S15 H;  2SNM A;  5KEE A;  2OT2 A;  3JAM E;  4IPC A;  1DON A;  3RD4 A;  2EYF A;  2Z8L A;  2BA0 A;  1A63 A;  2A19 A;  2ZJQ A;  4FF4 A;  5M5X B;  1EWI A;  4KTA A;  4A3L H;  1JIC A;  2WB1 G;  5C4X H;  3TME A;  1VQ9 A;  1YJN A;  5IYD G;  4K5W A;  3NK9 A;  3CPF A;  4LF7 Q;  4C3J H;  4RAU C;  2VUM G;  1H95 A;  3A0J A;  1LTB D;  5ELN A;  1QOH A;  3CCR A;  4KY5 A;  5EAY A;  4RKL A;  3VYU A;  2LXK A;  3I4M H;  4QB4 A;  4EQN A;  2BA1 A;  2KQ3 A;  3I91 A;  5EKI A;  2WB1 B;  1B44 D;  1RHP A;  3M4P A;  1QVG A;  3HOW G;  2HDM A;  3DEO A;  1Q1E A;  5LMN Q;  4A3J H;  1DGS A;  1UWV A;  2K03 A;  3T1Y L;  2OTL A;  1EU3 A;  4OX9 L;  5T1G A;  2VUM B;  2RHQ B;  1FR3 A;  1Y1V G;  2PMZ E;  3OHX C;  1F77 A;  1C8C A;  2WII B;  4KHP Q;  4JBW A;  3VR3 A;  2IY5 B;  2F52 A;  2F0F A;  1YNN C;  1ZYR C;  3RLO A;  4NPS A;  3HOW B;  1HA6 A;  3FMC A;  2Q2H A;  3D8G A;  3M7G A;  1XPU A;  3VR5 A;  4PZ7 A;  1XPR A;  5K5P A;  2WAC A;  3MA2 B;  1JT8 A;  4JI2 L;  1XJV A;  4DA2 A;  3J80 E;  1X32 A;  3CC2 A;  4LFB L;  5ELO A;  1CQF A;  4RA8 A;  4AH6 A;  2IHF A;  2RSO A;  5C0X J;  3A54 A;  1GJX A;  4JG2 A;  5E1F A;  5EJW A;  2XWB B;  4DR7 L;  1EL0 A;  1W6J A;  5JEA G;  3BDC A;  1CZG A;  1BUV T;  2F0L A;  3PIP A;  1GUO A;  4QUC A;  1EYC A;  4BWG B;  3N52 A;  4ZYS A;  2QW7 A;  2M00 A;  1X9N A;  3MWY W;  2WB1 E;  3H0G H;  4YHH Q;  3TRZ A;  5M3F H;  1SMX A;  1KAB A;  5FK9 C;  5GAG C;  1J5E L;  1D5Z C;  2K5Q A;  3BYT B;  3CAM A;  3KUP A;  1O78 A;  1E0B A;  2WP8 J;  1KRT A;  4NB3 A;  1Z9F A;  1T5X D;  4ODG A;  4KJN A;  2CWA A;  2N8N A;  5EKL A;  4XIG S;  1CTM A;  1WCM G;  4LJZ C;  3S1R H;  4B3S Q;  3FRP B;  4HCE A;  1OO9 B;  3S1N B;  4WJ4 A;  1I50 B;  3DXJ C;  1Q12 A;  1YNJ C;  3Q22 A;  2Q8R E;  3RN5 A;  2E8G A;  4X65 L;  2EYL A;  3H3V H;  1GHK A;  2ZXR A;  3A56 A;  4PMC A;  3F2B A;  3RMH A;  1VS0 A;  4LMQ D;  3SE0 A;  4CKC A;  1STY A;  3K5M A;  3FVQ A;  4LFC Q;  5C3E G;  2YV5 A;  1WCM B;  2I07 B;  3A74 A;  2KEC A;  5ELB A;  4CJ1 B;  4H44 C;  1S3O A;  1JJ2 A;  1IKL A;  1BO0 A;  3S9W A;  1VQP A;  5C4X G;  2K28 A;  2KEE A;  3K5L A;  2HQE A;  2MQH A;  2VQE L;  3S15 B;  3OTO L;  4JI0 L;  3UDI A;  4CDF C;  4DNI A;  1PH3 A;  4G7O C;  5C3E B;  1D8L A;  5C0X H;  1NBW A;  3P20 A;  2CQA A;  4NMZ A;  2GA4 B;  3I4M G;  1O7Y A;  1OXX K;  5DM7 3;  5IGC A;  2WAQ G;  2FXQ A;  4F88 A;  4POG A;  4R4Q A;  3FPU B;  2BDO A;  2B29 A;  2K50 A;  5C4X B;  1KQS A;  1EIH A;  1VQL A;  5FJ8 G;  4N9P A;  3SGI A;  1PYW D;  4A3J G;  1CA5 A;  1SYD A;  2WIN B;  4GNX A;  1TS2 A;  4WRD A;  3I2Z A;  4GKK Q;  2UU9 Q;  3CD6 A;  3S16 H;  3GTO H;  1A2T A;  4ZUJ A;  3ITP A;  3I4M B;  5GAE C;  5CBE E;  1B2T A;  5TSS A;  3KF8 A;  1IBM Q;  2WAQ B;  3CU7 A;  2F0W A;  3OIP A;  4KKT A;  1VQD A;  2E75 C;  1D7Q A;  2CFM A;  2VB3 X;  4A3J B;  4YIJ A;  4LNQ A;  4UAI A;  1D1I A;  5T1I A;  1IHZ A;  2JE6 I;  5G3L D;  1EY0 A;  2IX1 A;  1A0I A;  1A3T A;  1YJ9 A;  4GOP A;  1RJT A;  5IP7 G;  2CH4 A;  4PQX A;  3IKJ A;  4TQU S;  4BY1 H;  1STG A;  2AMC B;  2ZTE A;  5I6W A;  2IL8 A;  2Y0S B;  1CA6 A;  1EWC A;  1MI2 A;  2BCO A;  3TDQ A;  3TN2 A;  4LF5 L;  5M9O A;  1KAW A;  2B2U A;  5KND A;  4YY3 L;  5E4W C;  3H0G G;  4IUR A;  5M3F G;  4BY7 G;  5GRO A;  4JI1 L;  1KNA A;  2WV6 D;  1YVC A;  1XTD A;  2E74 C;  2X6G A;  3PGZ A;  2LY7 A;  4IJH A;  3C2P A;  1K0R A;  5IGD A;  1Y8N B;  4Z9C B;  4X64 L;  3W5O A;  1F2M A;  3G4S A;  4B9X A;  4LK1 C;  1YNN D;  1UAP A;  2WAQ E;  4JVZ A;  1SE8 A;  4DPG A;  4JI6 Q;  3H0G B;  2UXD L;  5M3F B;  2MGS A;  5IIF A;  5C44 G;  4XT3 B;  3KFU A;  2NWG A;  1FGU A;  2YTV A;  1PZJ D;  1NNX A;  3KLR A;  4A76 A;  2V4D A;  3NBH A;  4JI3 L;  3HOU H;  2EDG A;  3I4N G;  2R61 A;  1CUK A;  2E2D C;  4IUN A;  2VQF Q;  4NXM L;  2JN4 A;  3RR5 A;  1JWM D;  5AJ3 Q;  4A3F G;  3HFZ B;  1LTG D;  1VQB A;  3CQZ H;  4N9T A;  5JPM C;  5C0X I;  2Y0S E;  2A5H A;  2R93 H;  1ET9 A;  2WKC A;  4JI4 L;  1X65 A;  5C5M A;  3L7Z C;  2Z6B A;  1TII D;  3TS2 A;  4MZ9 A;  3H09 A;  3FKI H;  1S5F D;  1V1P B;  5BR8 Q;  1RTN A;  4A3E G;  1SJE D;  3A7A B;  3BDL A;  4A3F B;  4DUZ Q;  2UXB L;  4JI5 Q;  1FNV A;  4JI7 L;  3OIQ A;  3G6E A;  1A6X A;  5IT9 c;  1PLF A;  1NTG A;  3CHB D;  1SNQ A;  1HNW Q;  1STA A;  4AYB G;  2NVT B;  2UUA Q;  1XWE A;  5H1S E;  3O13 A;  4RG1 A;  2OQ0 A;  1S5C D;  1EZ8 A;  5EQ0 A;  2Z9H A;  1EY4 A;  3NEL A;  2HIV A;  2Q8T A;  4ZUI A;  1PH2 A;  1G51 A;  2ICI A;  1PYB A;  2X6L A;  1N36 L;  3A5Z B;  4KY7 A;  4A3K G;  3EA6 A;  4A3E B;  4I7Z C;  1JOQ A;  1IYU A;  1Q8I A;  4U67 3;  2L15 A;  5DM6 3;  5BN3 A;  4BBS H;  4AYB B;  2PZT A;  4NKL A;  2KHS A;  3ULL A;  1IZ6 A;  5E7N A;  1DOM A;  1LTS D;  3J7A 5;  4LF4 L;  3K5O A;  2NVY H;  3S16 B;  3GTO B;  4IFD H;  3T1H Q;  4H0L C;  3RLF A;  1D2B A;  4A3K B;  3U58 A;  4UPA A;  1EFW A;  1MSG A;  1EYD A;  4X66 L;  1YI2 A;  4BY1 G;  4PMW A;  1PV4 A;  1VF5 C;  4FXG C;  1IBL Q;  4K2K A;  5CV7 A;  3DMU A;  1VF7 A;  2EY6 A;  3GQB A;  4KKS A;  4OEM B;  1WTX A;  3GTP H;  1S5B D;  2FJ2 A;  1DXM A;  1LT3 D;  1GUW A;  3MXG A;  1P16 A;  4GNX B;  1IYJ B;  4JBJ A;  3MZ5 A;  1X55 A;  1BQQ T;  2KEN A;  5LL6 X;  1M1K C;  1OXV A;  2V1C C;  3MEF A;  4X6A H;  2KCM A;  2PW5 A;  4GKJ Q;  2K52 A;  5CGK A;  2KUM A;  4BY1 B;  4DN4 M;  3KF8 B;  2JSO A;  4Y52 H;  1HFN A;  1NMG A;  3BS1 A;  1LTI D;  3NEN A;  1XMQ Q;  4XYQ A;  1O7Z A;  1SN8 A;  2AUJ D;  3GTJ H;  1TWA H;  2F03 A;  3OMC A;  2AWO A;  3FHW A;  4YWM A;  4A3B H;  3S2H H;  1YHB A;  1ENC A;  4DR3 Q;  2EYO A;  1E1T A;  5CV5 A;  5C5L A;  1YZ6 A;  3CMA A;  2ZXP A;  1N34 Q;  3VR2 A;  1XNR Q;  4CDE C;  2EYM A;  4E6I A;  4DR2 Q;  1B53 A;  1GUT A;  1QVC A;  3MEH A;  4DAM A;  2RA4 A;  3M4O B;  3HOU G;  3PUZ A;  4B3M L;  3J7A V;  1TT2 A;  1K83 H;  3PV0 A;  2H5X A;  1PFS A;  4KI0 A;  1PZK D;  5DNF A;  1FYC A;  1QG7 A;  5CBA E;  1GKH A;  3VYR A;  1IW7 C;  5CMD A;  4KN4 C;  4RCN A;  5NUC A;  5KNC A;  3JAM L;  2JA7 G;  1FNW A;  1LO5 D;  2LKV A;  2K05 A;  2R93 G;  2B2Y A;  1VQN A;  1Z6H A;  1EIY B;  1DJR D;  1GO3 E;  4I7A A;  3HOU B;  2EVB A;  5JVH 3;  1HNZ L;  3C46 A;  4BXX H;  4B3R L;  4PMB A;  5KYL A;  1SE4 A;  1NSN S;  2VS1 A;  2XNA C;  5D65 A;  1SNC A;  3PIP 3;  4K5X A;  1PH4 A;  2JA7 B;  3J81 L;  4L8J A;  3RLN A;  2F0Q A;  4HIK A;  1D1K A;  1EOT A;  3OSO A;  2R93 B;  2DGY A;  5IP9 H;  1C0A A;  1G29 1;  3AEV A;  4DR5 Q;  1EEI D;  4DR6 L;  3NBH B;  3S1Q H;  1RD9 D;  4KKU A;  4F87 A;  1JMC A;  2R7Z G;  1TQO A;  4IFD I;  1B3Q A;  4G57 A;  4O1N A;  3K5N A;  4DNT B;  4ZLT F;  2BDN A;  4BBS G;  4GZY C;  4XDX A;  5D3I B;  3VR4 A;  1HR0 L;  1UE7 A;  4CKE A;  4J6H A;  4F8M A;  3J7Y W;  4RGT A;  2Q8I B;  4B9W A;  2EXD A;  4R4I A;  1II3 A;  3RZD H;  3HOZ G;  2DJF C;  2RKS A;  3OW7 A;  3WOE A;  1RF2 D;  1SXT A;  4BS9 A;  4DK1 A;  1VQK A;  1VQA A;  4RKB A;  4BBS B;  2VUM H;  2SEB D;  2B2W C;  1X56 A;  3GTK H;  3I7F A;  1EY6 A;  5F2D A;  2YTX A;  2L1B A;  3J80 L;  3CCV A;  2F0N A;  2NVY B;  1LTR D;  2HHH Q;  4YCU A;  2EYJ A;  1OXT A;  2ENB A;  3OOC A;  5GQO A;  3GTG H;  3HOZ B;  4JOI C;  3SXH A;  4DR4 Q;  4DAV A;  2EJF C;  3NUC A;  1Q86 C;  4DV1 Q;  2BE5 C;  2I5H A;  1Y1V H;  4X3T A;  1LAB A;  1HR0 W;  3E9I A;  3E0J A;  3V96 A;  1X3E A;  5CV8 A;  3D6C A;  3AYH B;  5C4H A;  3I3C A;  5CV9 A;  4LF6 L;  4A3B G;  1E22 A;  1C7Y A;  4N8X 1;  1NJI C;  1AE3 A;  3SK5 A;  4DUY Q;  4S3S A;  1DZ1 A;  4QIW B;  2K5W A;  1MKH A;  5HGT A;  1RIP A;  2R7D A;  5GAD C;  1GVP A;  1N32 Q;  1AP0 A;  3GTJ B;  2KCC A;  3BU2 A;  1NR4 A;  2B63 G;  1EWH A;  3A55 A;  1EQV A;  4A3B B;  3AQQ A;  1VQ5 A;  1ILP A;  3S1M H;  2AQ3 B;  4Q5V A;  1HNX L;  1UEA B;  4LF8 L;  3EIV A;  3F2C A;  4A3C H;  1K8M A;  3I56 A;  5FO7 B;  2NZO A;  3BZK A;  4LUO A;  4HED A;  1XTC D;  1O7L A;  2UUC Q;  4BXX G;  3S1N H;  1K83 B;  4YCV A;  2F0D A;  2DJG C;  2N78 A;  1N9W A;  4Y7N B;  3UDX A;  1H9K A;  1LT5 D;  4XQN A;  1VQ4 A;  5C4J H;  1M90 C;  2B63 B;  2HCI A;  4RHR A;  5G3L F;  4Q0F A;  3TQY A;  3TRE A;  3LWE A;  2ASB A;  4LWC A;  1H9R A;  1HZA A;  2E76 C;  3F2D A;  2HIX A;  1EY8 A;  5LHY 1;  2Q2T A;  1B50 A;  3D4W A;  3R2T A;  3QOL A;  1TWF H;  4L5S A;  4ULL A;  2QF7 A;  3FDT A;  1SE3 A;  3GP7 A;  1STN A;  1ML0 D;  4AIM A;  2H1E A;  1DOL A;  1S4Z A;  1AH9 A;  1CSQ A;  1CZW A;  4KLK A;  3BVM A;  2E2I H;  4JW0 A;  1SND A;  2RCF A;  3S24 A;  5C3E H;  1LTL A;  2IPK D;  1MJE A;  1EY5 A;  3PO2 H;  1SMY C;  3A8J E;  1ZKO A;  3S1Q B;  2NB0 A;  1EEF D;  4MTN A;  4UP8 A;  2XSC A;  2PPB C;  3UE0 A;  5IT9 E;  3E3X A;  1LLR D;  2A68 C;  1LTA D;  3J81 E;  5CC4 A;  1I4X A;  4PG3 A;  3EQL C;  3Q6S A;  1BVS A;  4RCO A;  1SAP A;  4FF2 A;  2KCT A;  4G4K A;  2MHV A;  3SK8 A;  1FJG L;  1M4V A;  4EX5 A;  4IUP A;  5M5Y B;  4JPB W;  2FHT A;  2A6H D;  3RZD B;  1V9P A;  3PF4 A;  1PDQ A;  3T13 A;  5FJ8 H;  2E2J H;  1CT1 D;  1PRT C;  3ND9 A;  4P74 A;  2JA5 G;  3GTK B;  3K81 C;  4MIU A;  3J81 j;  1WJJ A;  4RHS A;  3T1Y Q;  3I4L A;  3NQI A;  2MNA A;  1XYI A;  3NP8 A;  2HCC A;  4NW2 A;  2NTS A;  1IBK L;  3CW2 C;  4EQ5 A;  4B3T Q;  1H9M A;  3U9S A;  2GVB A;  3Q23 A;  4HR7 B;  3WDN A;  1CK1 A;  5IYB H;  3GTG B;  4DU9 A;  1J8I A;  2KJX A;  1WD0 A;  5KGU A;  1B7Y B;  1SNO A;  2JA6 G;  1Y1V B;  2WKD A;  1U4M A;  3I90 A;  3R3O A;  5IP7 H;  2EE1 A;  2FMC A;  4RFB A;  1RCV D;  2A6E D;  2I5L X;  4BBR G;  3G71 A;  4ABN A;  4JI2 Q;  3MTS A;  4A3C G;  1SYF A;  2Z4H A;  1X3Q A;  1Q81 C;  4LFB Q;  2VXW A;  1WTO A;  1PZI D;  4BY7 H;  4DR7 Q;  1J6Q A;  1BKB A;  1SDF A;  2AQ1 B;  1HXY D;  1BXT A;  5HGQ A;  1UE6 A;  4UP7 A;  4BBR B;  4WJW A;  2NUC A;  3S1M B;  1VQ7 A;  1RL2 A;  4EVO A;  1J5E Q;  5M3M H;  1V1P A;  2JEB I;  1CSP A;  1K3B C;  1PTO C;  4FO2 A;  2EZV A;  3LGJ A;  5C44 H;  1KDC A;  4O0A A;  2F0H A;  5C4J B;  2MFI A;  2B39 A;  4QGU A;  1Q46 A;  2N49 A;  2I5M X;  2EY5 A;  4YCW A;  2JA9 A;  4NXN L;  4B3S L;  3I8Z A;  1P8L A;  2JXM B;  1FD7 D;  2NN6 G;  3GV3 A;  3I4N H;  3VA7 A;  1K73 C;  4X65 Q;  4KHZ A;  4CGY B;  4A3F H;  3EFX D;  1TWF B;  3PO2 G;  4QY7 A;  4DGZ A;  2EQS A;  2RBM A;  4CDC C;  2KA7 A;  2NVT H;  3E6Z X;  3M9B A;  4JI8 L;  1HQM C;  2R6G A;  3A5U A;  4X3K A;  2E2I B;  3KJP A;  1XMO L;  2VQE Q;  3V2T A;  1YNX A;  5KNB A;  4A3E H;  4JI0 Q;  4ZAI A;  3PO2 B;  1PFN A;  2K04 A;  2L55 A;  3EVQ A;  1JCK B;  2ZM6 L;  4AQY L;  3AMU A;  2RSN A;  2XRQ D;  3CKI B;  4ZRZ A;  4ILW A;  4A4I A;  1SYC A;  5A35 A;  4KHV A;  4F7X A;  2EY2 A;  1HCZ A;  1GUS A;  2UXC Q;  2MO0 A;  3I70 A;  3K0X A;  2F3V A;  4OXP A;  4A3K H;  3R8B A;  1YHA A;  4OEL B;  5EPJ A;  5IWA L;  4C56 C;  1CFM A;  5IYB G;  3CPW A;  2E2J B;  4C2M H;  3NTI A;  1VQI A;  5ELF A;  5K36 H;  1SMY D;  3DEP A;  4A93 G;  3HEJ A;  2O5J C;  3TP6 A;  1SR3 A;  1JOK A;  1XX8 A;  2QEX A;  2D2C C;  3I4O A;  1WYD A;  3MC0 B;  3K58 A;  3S14 B;  4IOA A;  3BG3 A;  2PNH A;  1K8O A;  3ZJY C;  1F9R A;  2JA8 H;  1RTO A;  4MTK A;  1AW7 A;  1L1O C;  3T56 B;  3E9H A;  1KIX A;  2BOS A;  1A8V A;  1I6V C;  2HDL A;  1EQR A;  2PNR C;  1WVL A;  3D6W A;  4A93 B;  3JAM i;  2Z6K C;  1B1Z A;  1JE4 A;  1I4Q A;  1EQT A;  2EIF A;  4DAP A;  1F9P A;  1E2W A;  2ZJR A;  3GTM H;  1I94 L;  4ME3 A;  1Q8K A;  1DOK A;  4L5Q A;  4LF5 Q;  1C4Q A;  1NR2 A;  5HUR A;  5LMU Q;  4QCL A;  4YY3 Q;  4V0B A;  4C1N I;  3TZD A;  1WTQ A;  2B2T C;  2F0G A;  4LUV A;  4JI1 Q;  3H3V I;  3M4O H;  2K5V A;  5M3M G;  3PSI A;  3DWQ A;  1VQC A;  1VQE A;  5I2X A;  4HJ7 A;  3J81 i;  1ZYR D;  3I55 A;  1WTR A;  1ZEQ X;  3K7U C;  1JR0 D;  3GD7 A;  4FF3 A;  3NPP A;  2L5T A;  3MXN A;  5KRU A;  4X64 Q;  4BY7 B;  2IWH A;  3UI2 A;  3CCJ A;  2A1A A;  2E5L L;  1K8G A;  2CW0 C;  2RDG A;  1R9T H;  2UXD Q;  3STB C;  1I5F A;  1FNU A;  5M3M B;  3HOV G;  5FLX c;  1WTV A;  4LFA L;  4DV5 L;  1IYV A;  2K4K A;  4JI3 Q;  1JB3 A;  1JOO A;  3HKS A;  5C44 B;  2JA7 H;  4MNO A;  2UUB L;  1V1O A;  5GAH C;  2FFK B;  1CKO A;  2VQF L;  4K0K L;  2SOB A;  4IN3 A;  1DM0 B;  3TP7 A;  5AJ3 L;  1U4P A;  2QIL A;  2K01 A;  2HD3 A;  3I4N B;  3JC6 6;  2SNS A;  4GLV B;  2KHJ A;  4P75 A;  2EJG C;  4JI4 Q;  4DV2 L;  1JC7 A;  1PXU A;  4C1N K;  4KD3 A;  3DLL A;  3Q8D A;  1EYG A;  2Q2U A;  2J0T D;  2LSS A;  3BVZ A;  5IYC H;  3M4Q A;  4DFA A;  1IXR A;  3J80 i;  1LV9 A;  4FVM A;  1PTO D;  4KK7 A;  1I4P A;  3MFG A;  2UXB Q;  5BR8 L;  3F1Z A;  4JI7 Q;  5IOD A;  1CQV A;  1RKN A;  4DF7 A;  4DUZ L;  2MUY A;  4JI5 L;  1SRO A;  4IO9 A;  2AWN A;  4DR1 L;  1YNJ D;  2ATW A;  3ER0 A;  1ILQ A;  1HNW L;  2R7Z H;  1SBB B;  1SJH D;  2UUA L;  1Q90 A;  1HH2 P;  5FLM H;  3PUX A;  1N36 Q;  3PIO 3;  2QDL A;  4OGQ C;  3U4V A;  1QVF A;  2B8G A;  4QMG A;  5K36 G;  3U50 C;  2XTI A;  5JJI A;  1LYL A;  1PYS B;  3A8I E;  1EIG A;  4KJO A;  3BYY B;  4KY6 A;  3HOZ H;  4JC0 A;  4M1U B;  3VR6 A;  2MPM A;  4LF4 Q;  2XN9 C;  1BDO A;  1E1O A;  2M2L A;  3IL8 A;  1YJW A;  2JA8 G;  4OL7 A;  1SFO H;  4C2M B;  3T1H L;  1WTP A;  1HZB A;  2EY1 A;  3PO3 G;  2ALY B;  5IGF A;  1QE6 A;  2JJQ A;  4JV5 L;  3U4Z A;  1B70 B;  1L1O A;  1EY9 A;  4IJL A;  4HIO A;  2EPB A;  3BJU A;  2PCF B;  2Z6K A;  4GS3 A;  1S5E D;  2XWJ B;  1F2Z A;  1NE3 A;  4J1M A;  2D62 A;  4L5T A;  2JA8 B;  3PMF A;  3S17 B;  1MJC A;  3VYT A;  3PO3 B;  4K2L A;  1WTH A;  2BH2 A;  4OIJ A;  1N33 L;  4XXE A;  3T53 B;  4DV0 L;  1JWS D;  3GTM B;  1KDA A;  1TY0 A;  2PW7 A;  4AYB E;  4OIK A;  4A75 A;  5EGT A;  3K57 A;  3PQI A;  1STB A;  2L4N A;  4XT1 B;  1U5K A;  1FGB D;  4JBM A;  4FXD A;  2RCN A;  4TVA B;  4IPH A;  1SSO A;  2F3W A;  4Y7N H;  2LXJ A;  2TMP A;  1KD1 C;  2B63 H;  1EYA A;  5IGG A;  1N34 L;  1KL9 A;  2PI2 A;  1YIT A;  3TSS A;  4B3M Q;  4TKO B;  1JJC B;  4RGM A;  4R4T A;  3LWU A;  5JJK A;  3SVM A;  1TWC B;  1R9T B;  1Q82 C;  4DV3 L;  4FYD A;  1KNE A;  2YTY A;  1HJP A;  2PO4 A;  2F0I A;  2WFW A;  3B6Y A;  3PUV A;  1F2Y A;  1UE5 A;  1SYB A;  3AFP A;  1HRJ A;  3F2U A;  3TP8 A;  5D3D A;  1NUC A;  1AEX A;  5IT9 L;  3GTQ H;  4K8J A;  4ZKB B;  2F3I A;  4B3R Q;  1PTO B;  4P73 A;  3MXN B;  1MIU A;  5IYC G;  4OO1 H;  1QJO A;  4I65 A;  4GN3 B;  4RGN A;  3HOX G;  2IX0 A;  1BR9 A;  1NAP A;  1SYE A;  1Y14 B;  1HUN A;  3CCQ A;  1EY7 A;  2DUD A;  1Z47 A;  5FKA C;  1E2Z A;  3X3M A;  2IW3 A;  4K8I A;  4DV4 L;  4XQQ A;  4IAL A;  5FLM G;  1B9N A;  4DR5 L;  4DR6 Q;  3STB D;  3W2D A;  1N8R C;  3HG9 A;  4OWT B;  1YIJ A;  2KBN A;  1WTW A;  3CRK C;  3HOX B;  4P2C B;  5CR3 A;  2NZ1 D;  4H13 C;  3ULJ A;  1T5E A;  4DK0 A;  2F1M A;  5JOB A;  1SYG A;  4IPD A;  1FL0 A;  5M5Y H;  3CME A;  1V1Q A;  1HR0 Q;  2R7Z B;  1BOS A;  4XYO A;  1U9R A;  2O2L D;  4DAY A;  5J39 A;  3ONA B;  4OWW B;  1SEB D;  3HKZ G;  1BCP C;  2ICE C;  1I4H A;  4QUF A;  5FOB B;  1Y8P B;  1B3A A;  4WOR A;  1KTK A;  2TSS A;  4ZK9 B;  2CCZ A;  2F4V L;  4A3I G;  2JQO A;  1S40 A;  1ZXT A;  2L9H A;  3DUZ A;  2EOT A;  1PH5 A;  4GLX A;  4X3U A;  2R3Z A;  2L11 A;  1L0Y B;  1Y8O B;  1K0S A;  3HOY G;  2JA5 H;  3HKZ B;  1XNQ L;  2K5H A;  3ND8 A;  4NDX A;  1SFO B;  2HHH L;  1C48 A;  3J7Z C;  1QWY A;  3KOJ A;  3DM3 A;  2R92 G;  4LAA A;  3L2P A;  1JJG A;  4DV1 L;  2N55 A;  3Q0A A;  3K6O A;  2Q2I A;  1WD1 A;  1EUJ A;  4PZ8 A;  1Q7Y C;  3SK6 A;  4HJ8 A;  1D5X C;  1A62 A;  4LF6 Q;  3HOY B;  2JA6 H;  3IFT A;  3FEW X;  2B8F A;  2IX3 A;  1U4R A;  5C6A A;  5KIX A;  5A2Q L;  4DV6 Q;  1L1O B;  4BBR H;  3AU7 A;  1SLJ A;  4APV A;  3W3A A;  2VB2 X;  1HUM A;  1G8Z D;  3A8K E;  3OWF A;  1N32 L;  1QNK A;  4IQZ A;  1A2U A;  1CKM A;  1FVI A;  1HFG A;  4QF4 A;  4HID A;  1PH1 A;  2C9O A;  4JYA L;  4OO1 I;  4PZ6 A;  4LF8 Q;  1K8A C;  3TS0 A;  1NCV A;  3N6R A;  3NWT A;  2EYP A;  4DV7 L;  1GM5 A;  1TWH H;  3KYH C;  3CCU A;  5DAU A;  1B4O A;  1ICW A;  4OO1 G;  3A7L A;  2G9D A;  3OWE B;  2F0V A;  1AN8 A;  1Q1B A;  2B2V C;  3LX0 A;  1CHQ D;  1U4L A;  3NE5 B;  3H3V C;  1UE1 A;  1X3F A;  3D3R A;  3I72 A;  4X62 Q;  3PIO A;  3CCM A;  4DNR B;  1NMF A;  2PYK A;  1VCI A;  1JWU D;  3GTQ B;  3U9O A;  4HSP A;  4QIW E;  5CV6 A;  2K5D A;  3ZYY X;  2ZJP A;  2O5I C;  4LF9 L;  1PH6 A;  2NN6 H;  1PA6 A;  2QDB A;  2NBF A;  2G5D A;  1IW7 D;  1X6O A;  2DY8 A;  3E5S A;  3NQT A;  5E3F A;  5CV4 A;  1JQY D;  4HJ9 A;  2OWO A;  1V8Q A;  5COY A;  1NY4 A;  1DD2 A;  3J7A F;  2QEJ C;  4CKB A;  2CVR A;  2JEA I;  2GN5 A;  1J9O A;  2C35 B;  4FF1 A;  2PQE A;  1OXS C;  2B2W A;  5IGB A;  2MJ8 A;  3UDG A;  2X69 A;  3NSW A;  1MHW C;  3PUW A;  4LF7 L;  3NTK A;  5JAV A;  1JB7 A;  2XVS A;  4OON A;  1MSH A;  2F0P A;  2F0O A;  3DWP A;  3SR1 A;  3TZU A;  2RF4 A;  1S72 A;  1TWG H;  2OXP A;  5HY6 A;  1FJG Q;  4JOI A;  2D5D A;  2AKW B;  5E4X A;  5IOC A;  4IPG A;  2CKZ B;  2KED A;  2N3S A;  3TP5 A;  5JJZ A;  5LMN L;  2PI2 E;  4OX9 Q;  3HZX A;  3OYY A;  2JK8 A;  3S14 H;  2B3G A;  3WOF A;  5JVG 3;  2MP1 A;  4XTC S;  2D0P A;  4GN4 B;  4GNX C;  1HHV A;  5M5W H;  4OHJ A;  3S2D B;  4A93 H;  4DAY B;  1IBK Q;  4KHP L;  5JPN C;  3OW2 A;  1UEB A;  2JA5 B;  1G2S A;  4B3T L;  1STH A;  2QGQ A;  1PTO F;  5I9O A;  4JCV E;  5D14 A;  3MXU A;  4MN3 A;  1O7I A;  3QO2 A;  4A3G H;  4G7H C;  1HPC A;  1ENA A;  1TY2 A;  2NTT A;  1BCP D;  3E0E A;  1M8A A;  4CJ0 B;  2VW9 A;  2BH8 A;  1UNS A;  1VDZ A;  2JA6 B;  3OPO A;  1W6K A;  2I0Q A;  4GOP C;  3RNU A;  5LMN W;  3QG1 A;  3ULP A;  2PZW A;  2NVQ H;  2L12 A;  4N8F A;  1KLU D;  2K33 A;  4BA2 I;  1LAC A;  2K14 A;  2NYZ D;  4HAE A;  2BE5 D;  2M9V A;  2RQX A;  1R4P B;  2DNE A;  4YHH L;  2K32 A;  2B2U C;  1EU4 A;  3I73 A;  3T16 A;  1VQM A;  2N88 A;  4J8Q A;  1LT4 D;  2NN6 I;  4R1J A;  3GDE A;  2D9U A;  1I3Q B;  3PCO B;  3PF5 A;  1X3G A;  2B2V A;  3BDO A;  5IY0 A;  5A2Q E;  3LNN A;  4QL5 A;  4L63 B;  3M3Y H;  1TWH B;  4BA1 I;  1AZQ A;  2FMM A;  4UY8 C;  3HOV H;  1W3S A;  2EYH A;  5ELC A;  1E24 A;  3BZD B;  1BF4 A;  1KAA A;  2LS0 1;  1XXG A;  4P71 A;  4G7Z C;  4NXN Q;  1U0L A;  5C3W A;  1CHP D;  4QQB X;  3SK4 A;  3HRZ C;  1A3U A;  4LFC L;  1QIL A;  1D6E C;  4IUV A;  2F0M A;  1IL8 A;  2DY7 A;  1ET6 A;  4ZQ3 A;  1TS3 A;  3K59 A;  4JI8 Q;  3OTO Q;  1QNU A;  4QJF A;  2J4X A;  2OEO A;  3GO5 A;  4CBV A;  4A3L G;  1SNM A;  1XMO Q;  2XGT A;  2RVL A;  1G6Z A;  1DYQ A;  1TS5 A;  2K7V A;  4O2D A;  3DWA A;  2J7Z A;  5EBC A;  4JK1 C;  2Z4I A;  4C3J G;  4O42 A;  2ZM6 Q;  4AQY Q;  3P1H A;  2NVX H;  3P7J A;  3ERQ A;  4EQP A;  2OQK A;  4KMU C;  4C3H H;  1MD2 D;  4TRD A;  4GKK L;  2UXC L;  2UU9 L;  1ONL A;  1EFI D;  1BNZ A;  3MXP A;  5I6Y A;  1TWG B;  5IWA Q;  2HT1 A;  4C3J B;  2F0S A;  1IBM L;  5L37 A;  1DCZ A;  2EXZ A;  3KJO A;  4FXK C;  4GLA C;  2A68 D;  2DN8 A;  3IFD A;  1BCP B;  4A3M H;  3SDZ A;  4C3I H;  4A3G G;  3UDF A;  3D31 A;  4FNF A;  4KV6 A;  3T51 B;  1BBW A;  2Y0S G;  4K6L A;  4EQO A;  3KBX A;  3S17 H;  3PO3 H;  5I2Y A;  5M5W B;  1LM0 A;  3KDF A;  1SRU A;  2F0E A;  1GUG A;  1CM9 A;  3K0Y A;  4HMJ A;  1K9M C;  1I6H H;  1TVX A;  3QB3 A;  4CHT B;  5I9P A;  1PRT D;  1Y1W H;  4A3G B;  1PVO A;  2ID0 A;  4JBK A;  1I94 Q;  5JJL A;  4K5V A;  1VQ6 A;  4WFN 3;  1YEZ A;  5LMU L;  1KXL A;  3HS0 C;  1EZ6 A;  3P75 A;  2NVQ B;  1VQG A;  4HN7 A;  4V19 0;  3FP9 A;  1TWC H;  4LUZ A;  2OTJ A;  1LTT D;  1HZC A;  4JI6 L;  2D0O A;  5ISR A;  1BBU A;  1QCB D;  5BN5 A;  3UE1 A;  2YU9 H;  2E5L Q;  1H9J A;  4HJ5 A;  1A3V A;  1CKN A;  1BBX C;  3NTH A;  1JOR A;  1PFM A;  1TR5 A;  2AUK A;  1E2V A;  1PTO H;  1WOC A;  3C1F A;  4LFA Q;  2NZH A;  4NXM Q;  4DV5 Q;  1GXD C;  1QUQ A;  3QR8 A;  3M3Y B;  4IFD J;  1KDB A;  1ESF A;  3SEB A;  1WI5 A;  3HOV B;  3K80 C;  2UUB Q;  3CXC A;  1KRS A;  4R8I A;  3M85 A;  4K0K Q;  1PH7 A;  3S1R B;  3X3N A;  2LFN A;  2E2H H;  3ERS X;  2B2Y C;  2RHS B;  1VQJ A;  2VNU D;  3H91 A;  5BN4 A;  2RDH A;  3JAM c;  4DV2 Q;  2FIN B;  3KLS A;  3G6J B;  3W1G A;  3HOX H;  3D4D A;  1HQR D;  2CQO A;  1YHQ A;  2CHB D;  1G91 A;  2CH4 W;  3RN2 A;  5C0X G;  1VQO A;  2A8V A;  3RZO H;  4RMF A;  4UDU C;  1X54 A;  2F0J A;  3TEH B;  3VDY A;  2ZTD A;  4DR1 Q;  2A69 C;  4C3H G;  5IGE A;  1Z7T A;  3J81 c;  1AFP A;  1X3P A;  4IUU A;  3MHB A;  2I46 A;  1LUZ A;  2JP1 A;  3QIA A;  4HCS A;  3QOJ A;  4CJ2 C;  2F4I A;  3SHL A;  1ICF B;  1F9Q A;  1UUP A;  4DKA C;  1F2L A;  3VYS A;  3L0O A;  5ELD A;  4HTH A;  2IT1 A;  5EBD A;  2NVX B;  3F8T A;  5FO9 B;  4A3M G;  1CI3 M;  1T9H A;  3DHQ A;  2MO1 A;  4MHE A;  4C3I G;  4C3H B;  2HQL A;  1VQF A;  3HP3 A;  4DXF A;  3KLS X;  3GV6 A;  4KD4 A;  1H9S A;  2K5N A;  1XPO A;  1PH9 A;  4X66 Q;  4A3I H;  1I4G A;  4DK3 C;  2PQA A;  4L5R C;  1GUN A;  1ASZ A;  1QB5 D;  1PRT B;  3HGB A;  1IBL L;  3T4A C;  3GTL H;  1VMP A;  1ENF A;  4JV5 Q;  2SDF A;  2JYO A;  4A3M B;  4KN7 C;  1WFQ A;  2LMC B;  1Y1W G;  4C3I B;  1B8A A;  1LT6 D;  3HOY H;  4ID6 A;  5C4Z A;  4IOC A;  2B2T A;  4RGO S; 
#chains in the Genus database with same CATH homology
 4TQU S;  2Q2I A;  4BY1 H;  1EIF A;  1EUJ A;  4PZ8 A;  4HJ8 A;  1Q7Y C;  4GKJ L;  2AMC B;  2VY3 A;  2R92 H;  2ZTE A;  1A62 A;  3NEM A;  4LF6 Q;  3J80 c;  5IP7 H;  2JA6 H;  2ES2 A;  1XMQ L;  4LF5 L;  4BBR G;  2I5L X;  1TXY A;  3G71 A;  1N33 Q;  1KAW A;  4YY3 L;  4JI2 Q;  4DV0 Q;  3H0G G;  1PHJ A;  5M3F G;  4DV6 Q;  4BY7 G;  4A3C G;  1L1O B;  5GRO A;  4JI1 L;  1YVC A;  4BBR H;  1Q81 C;  4LFB Q;  1XTD A;  1SLJ A;  4APV A;  3CC4 A;  4DR3 L;  4P72 A;  3PGZ A;  1EQQ A;  3KDF B;  4LW1 A;  4IJH A;  4HJA A;  4BY7 H;  4DR7 Q;  1N32 L;  1K0R A;  1J6Q A;  1BKB A;  4HIM A;  1XNR L;  4DR2 L;  1CKM A;  1FVI A;  4X64 L;  4HID A;  1PH1 A;  3W5O A;  5HGQ A;  4JYA L;  4OO1 I;  4PZ6 A;  1UE6 A;  4GN5 A;  4UP7 A;  3G4S A;  2WAQ E;  4LF8 Q;  1K8A C;  3TS0 A;  1SE8 A;  4GOP B;  1VQ7 A;  1V43 A;  4DPG A;  1RL2 A;  3K7A H;  3H15 A;  4JI6 Q;  1J5E Q;  5M3M H;  2UXD L;  4DV7 L;  2JEB I;  5C44 G;  4A3D H;  1CSP A;  1GM5 A;  1TWH H;  3KYH C;  3LGJ A;  2YYZ A;  3CCU A;  3KFU A;  3KF6 A;  4ALP A;  4DV3 Q;  1FGU A;  2YTV A;  4OO1 G;  5C44 H;  4O0A A;  4A76 A;  2QA4 A;  4JI3 L;  3HOU H;  1Q1B A;  3I4N G;  2MFI A;  1HNZ Q;  4QGU A;  1QZG A;  1CUK A;  1Q46 A;  2I5M X;  2N49 A;  2VQF Q;  4YCW A;  2Z0S A;  1UE1 A;  1X3F A;  2JA9 A;  4NXN L;  4X62 Q;  3PIO A;  3CC7 A;  3RR5 A;  3CCM A;  4B3S L;  1NMF A;  5AJ3 Q;  1P8L A;  4A3F G;  3HFZ B;  1VCI A;  1VQB A;  2NN6 G;  3CQZ H;  3I4N H;  5C0X I;  2Y0S E;  1K73 C;  4X65 Q;  4KHZ A;  3BZC A;  4QIW E;  2R93 H;  4A3F H;  3FKI G;  2ZJP A;  4JI4 L;  3PO2 G;  1X65 A;  4QY7 A;  4YWL A;  1PH6 A;  1CKN B;  4UP9 A;  5IE8 A;  1PA6 A;  4LF9 L;  2EQS A;  3L7Z C;  3TS2 A;  4MZ9 A;  1GD7 A;  1X6O A;  2NVT H;  3FKI H;  3M9B A;  4YWK A;  4JI8 L;  5BR8 Q;  4HJ9 A;  4A3E G;  2R6G A;  2OWO A;  3A5U A;  4DV4 Q;  4DUZ Q;  2UXB L;  4JI5 Q;  1NY4 A;  4JI7 L;  3G6E A;  1QUQ B;  3KJP A;  5IT9 c;  1XMO L;  1G6P A;  3PUY A;  1NTG A;  2ZTC A;  3W1B A;  2VQE Q;  3CCS A;  2JEA I;  1E7Z A;  1YNX A;  1EOV A;  1HZ9 A;  2GN5 A;  2KHI A;  4AYB G;  2K75 A;  5M5X H;  4A3E H;  4JI0 Q;  1HNW Q;  3WWV A;  2UUA Q;  2C35 B;  5H1S E;  4RG1 A;  2OQ0 A;  2OCE A;  3NEL A;  2ZM6 L;  1OXS C;  2HIV A;  4AQY L;  1PH2 A;  1G51 A;  1PYB A;  3UDG A;  1N36 L;  3PUW A;  1L2F A;  3A5Z B;  4A3K G;  4LF7 L;  4DK6 C;  1JB7 A;  4A4I A;  4OON A;  1K3R A;  3M7N A;  1OTC A;  2UXC Q;  2MO0 A;  3K0X A;  2L15 A;  2GVA A;  2RF4 A;  1S72 A;  1L0W A;  4OXP A;  4A3K H;  4BBS H;  1TWG H;  5HY6 A;  1FJG Q;  1YHA A;  5JEA J;  4JOI A;  1AE2 A;  4IFD G;  3ULL A;  1IZ6 A;  5IWA L;  5E7N A;  1KHI A;  1OXU A;  5IYD H;  2AKW B;  2F4V Q;  3J7A 5;  1JE5 A;  4LF4 L;  5IYB G;  3CPW A;  2NVY H;  2CKZ B;  2N3S A;  4IPG A;  3S2D H;  4C2M H;  5LMN L;  3T1H Q;  2PI2 E;  3RLF A;  1VQI A;  3U58 A;  4OX9 Q;  3OYY A;  2JK8 A;  3K8A A;  4UPA A;  3S14 H;  4A93 G;  2B3G A;  1EFW A;  1SR3 A;  1VQ8 A;  4H02 A;  4X66 L;  4XTC S;  4BY1 G;  2D0P A;  4PMW A;  1YI2 A;  1PV4 A;  4DR4 L;  4WJ3 M;  4GN4 B;  4GNX C;  5M5W H;  1XNQ Q;  2QEX A;  3CCE A;  1IBL Q;  4A93 H;  4DAY B;  1IBK Q;  4KHP L;  3I4O A;  3EBE A;  3OW2 A;  1UEB A;  1WYD A;  1PH8 A;  4NXM L;  1IL2 A;  3HOW H;  4B3T L;  4IOA A;  3GTP H;  2PNH A;  2QGQ A;  3ZJY C;  1E3P A;  2JA8 H;  1P16 A;  4GNX B;  1IYJ B;  4JCV E;  1L1O C;  3E9H A;  1KIX A;  4JBJ A;  1A8V A;  1X55 A;  2KEN A;  1EQR A;  1M1K C;  1O7I A;  4A3G H;  1OXV A;  2V1C C;  3MEF A;  3JAM i;  4X6A H;  2Z6K C;  2KCM A;  4GKJ Q;  2K52 A;  3E0E A;  3KF8 B;  2EIF A;  3GTM H;  2ZJR A;  4Y52 H;  2VW9 A;  2BH8 A;  1I94 L;  1NMG A;  4DUY L;  3NEN A;  1XMQ Q;  4POF A;  2PQA B;  1Q8K A;  3G48 A;  4L5Q A;  4ME3 A;  4R4C A;  1QZH A;  5LMU Q;  4LF5 Q;  1SN8 A;  3GTJ H;  1TWA H;  4YY3 Q;  2I0Q A;  4GOP C;  3RNU A;  3D0F A;  3CCL A;  2AWO A;  3FHW A;  5LMN W;  4YWM A;  4LUV A;  3ULP A;  4JI1 Q;  2NVQ H;  3H3V I;  2K5V A;  3M4O H;  4A3B H;  5M3M G;  3S2H H;  3PSI A;  1YHB A;  4DV6 L;  4OWX B;  4BA2 I;  2K14 A;  4A3D G;  1VQC A;  1VQE A;  4DR3 Q;  1E1T A;  4HJ7 A;  1HNX Q;  1YZ6 A;  3J81 i;  3CMA A;  1I3Q H;  3I55 A;  1VQH A;  2IHE A;  3K7U C;  4FDB A;  1N34 Q;  1XNR Q;  4YHH L;  3GD7 A;  4DR2 Q;  4X64 Q;  4J15 A;  4JYA Q;  1QVC A;  4DAM A;  3CCJ A;  2A1A A;  3HKZ E;  3PUZ A;  1VQM A;  2E5L L;  4B3M L;  3HOU G;  1K83 H;  2NN6 I;  2H5X A;  1PFS A;  3PV0 A;  3GDE A;  4R1J A;  4KI0 A;  1K8G A;  3AFQ A;  2UUC L;  1R9T H;  4R4O A;  2UXD Q;  3PCO B;  1KC8 C;  1GKH A;  1X3G A;  3PF5 A;  4DV7 Q;  2R7F A;  3STB C;  1ASY A;  1I5F A;  3EN2 A;  5IY0 A;  3HOV G;  5FLX c;  2JA7 G;  2AHO B;  3IRB A;  4QL5 A;  4LFA L;  3M3Y H;  1YBY A;  4DV5 L;  4BA1 I;  2R93 G;  1I50 H;  1VQN A;  2K4K A;  4UY8 C;  3HOV H;  4JI3 Q;  1W3S A;  3HKS A;  1EIY B;  2JA7 H;  1GO3 E;  4MNO A;  1E24 A;  2VL6 A;  2UUB L;  4BXX H;  1HNZ L;  4B3R L;  4P71 A;  5GAH C;  1W2B A;  4NXN Q;  1U0L A;  1CKO A;  2VQF L;  4K0K L;  4QQB X;  4X62 L;  2CWP A;  2VS1 A;  5AJ3 L;  3ICE A;  1WCM H;  2VZA A;  5IP9 G;  3JC6 6;  1PH4 A;  4GLV B;  4LFC L;  2KHJ A;  4P75 A;  1C9O A;  3CP0 A;  3RLN A;  4HIK A;  4JI4 Q;  4DV2 L;  4LF9 Q;  3CF5 A;  3DLL A;  3KLW A;  3Q8D A;  2DGY A;  1EYG A;  5IP9 H;  2Q2U A;  1C0A A;  1G29 1;  3AEV A;  4DR5 Q;  3KF6 B;  2LSS A;  5DLQ E;  5J3B A;  3S15 H;  4JI8 Q;  5IYC H;  3OTO Q;  4DR6 L;  3M4Q A;  1IXR A;  3NBH B;  4A3C H;  3S1Q H;  3J80 i;  4QJF A;  2UXB Q;  5BR8 L;  3F1Z A;  4IPC A;  4JI7 Q;  3GO5 A;  1JMC A;  2R7Z G;  4A3L G;  4DUZ L;  1XMO Q;  4JI5 L;  2XGT A;  1SRO A;  2BA0 A;  4IO9 A;  4IFD I;  1A63 A;  2AWN A;  4DR1 L;  2A19 A;  2ZJQ A;  4O2D A;  2ATW A;  3ER0 A;  4BBS G;  1HNW L;  1EWI A;  2R7Z H;  4A3L H;  2UUA L;  1HH2 P;  2WB1 G;  5C4X H;  5FLM H;  1HR0 L;  2ZM6 Q;  4AQY Q;  1VQ9 A;  1UE7 A;  1YJN A;  5IYD G;  3PUX A;  3CPF A;  1N36 Q;  4LF7 Q;  3U4V A;  2NVX H;  2EXD A;  4R4I A;  4C3J H;  1QVF A;  2VUM G;  3RZD H;  1H95 A;  2OQK A;  3A0J A;  3HOZ G;  5K36 G;  3U50 C;  5ELN A;  4C3H H;  2XTI A;  3CCR A;  5JJI A;  5EAY A;  4GKK L;  2UXC L;  2UU9 L;  1LYL A;  1PYS B;  2LXK A;  1VQK A;  1VQA A;  3I4M H;  2VUM H;  5IWA Q;  1X56 A;  3GTK H;  2BA1 A;  3HOZ H;  2HT1 A;  4JC0 A;  1IBM L;  1QVG A;  3M4P A;  4LF4 Q;  3I7F A;  3HOW G;  2YTX A;  1E1O A;  1YJW A;  1Q1E A;  4JV5 L;  3CCV A;  5LMN Q;  3KJO A;  4A3J H;  1DGS A;  1UWV A;  2JA8 G;  2HHH Q;  4YCU A;  3T1Y L;  4GLA C;  3T1H L;  1SFO H;  2OTL A;  1HZB A;  1OXT A;  4OX9 L;  2ALY B;  2RHQ B;  4A3M H;  2JJQ A;  3PO3 G;  3U4Z A;  5GQO A;  1Y1V G;  3GTG H;  1B70 B;  2PMZ E;  4C3I H;  4A3G G;  4JOI C;  3UDF A;  1L1O A;  3D31 A;  4IJL A;  4DR4 Q;  4HIO A;  3BJU A;  1BBW A;  2Y0S G;  3S17 H;  4KHP Q;  1Q86 C;  3PO3 H;  4DV1 Q;  2Z6K A;  4JBW A;  2IY5 B;  1LM0 A;  2I5H A;  2F52 A;  1Y1V H;  3KDF A;  1SRU A;  4GS3 A;  3RLO A;  1HR0 W;  3E9I A;  4NPS A;  1X3E A;  3AYH B;  1NE3 A;  2Q2H A;  1K9M C;  4L5T A;  2D62 A;  1I6H H;  4LF6 L;  4A3B G;  1MJC A;  1XPU A;  1E22 A;  4PZ7 A;  1XPR A;  1C7Y A;  2BH2 A;  1Y1W H;  1NJI C;  1N33 L;  1PVO A;  1JT8 A;  2ID0 A;  4JBK A;  1AE3 A;  1I94 Q;  1XJV A;  4JI2 L;  5JJL A;  4DUY Q;  4DV0 L;  1VQ6 A;  4AYB E;  1MKH A;  1YEZ A;  3CC2 A;  4LFB L;  1RIP A;  5ELO A;  4AH6 A;  5C0X J;  5LMU L;  2IHF A;  2R7D A;  5GAD C;  1GVP A;  4A75 A;  1N32 Q;  4JG2 A;  1KXL A;  4DR7 L;  3BU2 A;  1U5K A;  2B63 G;  5JEA G;  4JI6 L;  4JBM A;  2RCN A;  4TVA B;  1VQG A;  3PIP A;  3AQQ A;  1VQ5 A;  4IPH A;  3S1M H;  3FP9 A;  1X9N A;  4Y7N H;  1TWC H;  2WB1 E;  2LXJ A;  4LUZ A;  1KD1 C;  1HNX L;  3H0G H;  4YHH Q;  4LF8 L;  3EIV A;  5M3F H;  3F2C A;  2B63 H;  1N34 L;  3TRZ A;  1KL9 A;  3I56 A;  1HZC A;  2PI2 A;  1SMX A;  2NZO A;  2D0O A;  3BZK A;  1BBU A;  4LUO A;  5GAG C;  3UE1 A;  1YIT A;  1J5E L;  2YU9 H;  4B3M Q;  2E5L Q;  3CAM A;  4HJ5 A;  1CKN A;  1JJC B;  2WP8 J;  1KRT A;  4NB3 A;  4R4T A;  2UUC Q;  4BXX G;  1Z9F A;  3S1N H;  4YCV A;  2N78 A;  5JJK A;  1N9W A;  3UDX A;  1Q82 C;  2CWA A;  2N8N A;  4DV3 L;  2YTY A;  5C4J H;  1HJP A;  1VQ4 A;  1M90 C;  2WFW A;  1WOC A;  3B6Y A;  4XIG S;  3PUV A;  1WCM G;  4LFA Q;  3TQY A;  2NZH A;  3TRE A;  3S1R H;  4DV5 Q;  4B3S Q;  4NXM Q;  1QUQ A;  1UE5 A;  3AFP A;  2ASB A;  4IFD J;  4LWC A;  1HZA A;  4WJ4 A;  3F2D A;  2HIX A;  1Q12 A;  1WI5 A;  3GTQ H;  2Q2T A;  3K80 C;  2UUB Q;  2F3I A;  2E8G A;  3CXC A;  1KRS A;  4X65 L;  3M85 A;  3RN5 A;  3H3V H;  4B3R Q;  4P73 A;  3MXN B;  1TWF H;  4K0K Q;  1MIU A;  5IYC G;  3F2B A;  1PH7 A;  1VS0 A;  4L5S A;  2E2H H;  4GN3 B;  3ERS X;  3HOX G;  2IX0 A;  2RHS B;  4LFC Q;  1Y14 B;  1VQJ A;  2YV5 A;  5C3E G;  2OTJ A;  2VNU D;  3JAM c;  4DV2 Q;  4AIM A;  3A74 A;  3CCQ A;  1AH9 A;  1CSQ A;  1S3O A;  1Z47 A;  2DUD A;  4KLK A;  3W1G A;  3HOX H;  1JJ2 A;  4DV4 L;  2E2I H;  1VQP A;  2CQO A;  3S24 A;  5C3E H;  1LTL A;  5C4X G;  5FLM G;  1YHQ A;  4DR5 L;  4DR6 Q;  3STB D;  2MQH A;  1MJE A;  2VQE L;  3PO2 H;  3RN2 A;  5C0X G;  3OTO L;  1VQO A;  3UDI A;  1N8R C;  4JI0 L;  2A8V A;  3RZO H;  4OWT B;  1YIJ A;  2KBN A;  4RMF A;  1X54 A;  4DNI A;  1PH3 A;  3VDY A;  3TEH B;  4MTN A;  2ZTD A;  4UP8 A;  4DR1 Q;  1D8L A;  3ULJ A;  3UE0 A;  1NBW A;  3J81 c;  3I4M G;  4IPD A;  1FL0 A;  1OXX K;  4PG3 A;  5M5Y H;  3CME A;  1V1Q A;  1HR0 Q;  2WAQ G;  1BVS A;  1LUZ A;  2FXQ A;  4POG A;  4R4Q A;  2B29 A;  2K50 A;  1KQS A;  1VQL A;  5FJ8 G;  2KCT A;  4OWW B;  3SGI A;  4A3J G;  4DKA C;  3HKZ G;  1FJG L;  3L0O A;  4EX5 A;  2IT1 A;  2JA6 G;  3F8T A;  4GNX A;  4A3M G;  1V9P A;  3PF4 A;  1T9H A;  3I2Z A;  4GKK Q;  2MO1 A;  2UU9 Q;  5FJ8 H;  2CCZ A;  2F4V L;  2HQL A;  2E2J H;  3CD6 A;  4A3I G;  3GTO H;  2JQO A;  1VQF A;  3S16 H;  1S40 A;  1PH5 A;  5GAE C;  4GLX A;  4P74 A;  2JA5 G;  1XPO A;  2K5N A;  1IBM Q;  3K81 C;  1PH9 A;  4X66 Q;  3J81 j;  4A3I H;  4DK3 C;  1VQD A;  2PQA A;  4L5R C;  1WJJ A;  1D7Q A;  1ASZ A;  2CFM A;  3T1Y Q;  2MNA A;  3HOY G;  2JA5 H;  1IBL L;  4LNQ A;  1XNQ L;  3GTL H;  2K5H A;  2HHH L;  1IBK L;  4JV5 Q;  3CW2 C;  4EQ5 A;  4B3T Q;  2GVB A;  2JE6 I;  3J7Z C;  1WFQ A;  5IYB H;  1Y1W G;  1B8A A;  3KOJ A;  3HOY H;  2IX1 A;  3DM3 A;  2R92 G;  1A0I A;  1YJ9 A;  3L2P A;  4GOP A;  1JJG A;  5IP7 G;  4DV1 L;  1B7Y B;  4IOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...