4AYBG

Rnap at 3.2ang
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
113
structure length
113
Chain Sequence
KAQEIILSCEINSIERGSLKNLSIIHMSCNDFNISFDIIDSINIFSQKEKVKAFISKNRLSYTNDDFCGHGYIVTELKDSSSNNGNRYITIISLFGLLVKIISNKESFLKIHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 12
structure length 113
sequence length 113
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF16992 RNA_pol_RpbG DNA-directed RNA polymerase, subunit G
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4aybG00
2ZTDA 1N32L 1CKNA 1L2FA 2WP8J 4B3RL 3SGIA 1VQFA 2K5NA 3I56A 3F2DA 1K3RA 4JCVE 4YWKA 3PO3H 1UEBA 3ICEA 4LF9Q 4A4IA 2CFMA 2CWAA 4OX9Q 4P75A 2I5LX 4A3DG 5C0XG 3K0XA 4XTCS 1IBKL 4HIMA 1FVIA 3F2CA 4DV7L 5C4XH 4AIMA 2UUCL 4O2DA 1VQDA 1W3SA 1RL2A 4GN5A 2VUMH 1PH9A 4MZ9A 2Q2UA 3OW2A 4JI2L 3HOXG 2E5LL 2R93G 3CC2A 4KHPQ 1WI5A 3M85A 1PH4A 4BBRH 3JAMi 4GKJL 4WJ4A 3HOUH 2UUBL 1HZBA 3U58A 4A3IG 3E9HA 1SMXA 3STBC 4JI6Q 2RF4A 3JC66 1Q1BA 4OONA 3LGJA 4DUYQ 2OWOA 3M7NA 3CC7A 5GAGC 4RG1A 3K80C 2MFIA 4NPSA 5LMNL 3S16H 1Q7YC 2WB1G 1P8LA 2K75A 4LFAL 3TS2A 2XTIA 3GTGH 1IZ6A 3G4SA 1TWCH 4PZ6A 4OWWB 1HR0L 4BY7G 3RLOA 4QGUA 3AQQA 3RLNA 5M3FG 4HJ8A 1YHBA 4X64L 4JOIA 5GQOA 4X65L 1MKHA 3I4NG 2VQFL 2ZM6Q 4HJ7A 1X54A 2MQHA 3PUYA 2E5LQ 1HZAA 4JI5L 3S1QH 1TWGH 5M5WH 4X64Q 4A3BH 3KLWA 5FJ8G 1IXRA 1U5KA 1KC8C 4DR2Q 4GN4B 3PUVA 4AQYL 1SLJA 1L1OA 2PQAB 2MNAA 1I6HH 4A3EG 1Q46A 4R4QA 4IPDA 4C3JH 2ZJPA 2JA7H 4A3FH 2EXDA 4EQ5A 4DAMA 3T1HL 4JV5L 2IHEA 2QEXA 1QVFA 2JJQA 3EN2A 4OWTB 2UU9Q 1N36L 2FXQA 2V1CC 3E0EA 3CCVA 1G6PA 4DV4L 3CPFA 1IL2A 4APVA 1VQMA 1PV4A 4DV6L 4X62Q 1VQBA 4JI7L 3I7FA 4JI2Q 1EQRA 2RHQB 4DV5L 4IFDJ 3GTOH 2JEAI 1M1KC 1C7YA 4B3TL 4DAYB 3JAMc 2B29A 4JI8Q 1E24A 3CD6A 1E7ZA 1P16A 3A74A 3KYHC 2RHSB 1QZGA 3A0JA 3CAMA 1YEZA 2JA6G 1X56A 2CCZA 2N49A 1YIJA 5AJ3L 2OTLA 4YCVA 1HZ9A 3I2ZA 1YI2A 4KHZA 1N8RC 2UXCQ 4BA1I 1Y1VG 1MIUA 3W5OA 1PH6A 1Z9FA 4DR7L 4LFAQ 1LTLA 3HOZG 2GN5A 2BA0A 3KJOA 4LF4Q 1S72A 3PUWA 1N32Q 2NN6I 1X3EA 1YNXA 4DK6C 2A19A 1VQ8A 4A76A 4JBMA 5FLXc 1M90C 4R4IA 4K0KL 2JA5G 2B3GA 1Y1WG 2H5XA 2K5VA 4OWXB 4BY1H 4YHHL 4OO1G 4FDBA 1PFSA 1WFQA 1JB7A 3DLLA 4B3MQ 4X62L 1RIPA 2VQEL 1FGUA 2JK8A 4DV0Q 1V9PA 4C2MH 1YJWA 1JJGA 3RR5A 4DR3L 2NVXH 4HIDA 4JI0L 2UUAL 4QIWE 3H0GG 4GKJQ 1HH2P 5IYCG 4A3LH 5JJLA 3WWVA 4KI0A 2K4KA 4L5SA 4IO9A 2ZTCA 3RN2A 4YY3L 4LF8Q 4UP9A 4LF6L 1UE7A 1K8GA 1GO3E 3J7ZC 4HJ5A 3F2BA 2B63H 1T9HA 3U4ZA 3M4PA 1FL0A 1TWHH 4GOPB 3T1YL 1SRUA 2F3IA 3DM3A 4A3EH 2K50A 2Z6KC 4JI5Q 2F4VL 4QJFA 1KHIA 2K14A 4JI1Q 1YJ9A 1PH2A 1HNXQ 4IJLA 1AH9A 1JE5A 4A3FG 1EIFA 4DR4Q 5JEAJ 1YBYA 4YCWA 4R4CA 2KENA 2PNHA 2HHHL 1L1OB 2PQAA 3TEHB 4LFCQ 2NVQH 3E9IA 1GVPA 4IJHA 2Q2TA 5E7NA 1DGSA 1KQSA 3PCOB 4X66Q 2NZHA 1HR0Q 2PI2E 2YTVA 4JI4Q 1QVCA 4IFDG 3UDXA 1J5EL 1FJGQ 3FP9A 4GN3B 1NTGA 2JE6I 4POFA 5HGQA 3D31A 3CXCA 3S15H 4A75A 3ER0A 2EIFA 4YY3Q 5M3MH 2BH8A 4LF8L 1WCMH 1IYJB 1I94L 5C3EG 2DUDA 1O7IA 2Q2IA 4PZ8A 5IP7H 3J80i 4DK3C 1QZHA 4B3SQ 2RCNA 2KCTA 4LF5Q 4LW1A 2R92H 1VQAA 3D0FA 4DR5L 4LF5L 1VQHA 3ULPA 4OXPA 4UY8C 2QGQA 4JI1L 1GKHA 1K9MC 2LSSA 1EIYB 2A8VA 4O0AA 3AFQA 3RLFA 3TRZA 1UE5A 1VQEA 3AFPA 3AYHB 4DUZL 1KD1C 1LUZA 5IP9H 4JI7Q 3AEVA 3PIPA 2UUCQ 3UDGA 3G6EA 1R9TH 1YHAA 2HIXA 4BY1G 4DV4Q 1X55A 2JA5H 2OCEA 4DV2Q 4P71A 4JBKA 3PGZA 1XPUA 2YTXA 1SROA 3BZKA 1HR0W 4KLKA 1D8LA 3S17H 3KF6A 1EWIA 4AH6A 4R4TA 3H0GH 3H3VI 5ELNA 5IYCH 3CMAA 2E2JH 2DGYA 3H3VH 1Q1EA 4B3RQ 3UDFA 1W2BA 4PZ7A 3A5UA 1PVOA 4GLXA 2YTYA 3A5ZB 4BXXH 3MXNB 1XNRQ 1VQCA 2BA1A 1IBLL 1AE3A 1CKNB 2F4VQ 4LF7Q 4GKKQ 1BKBA 1E1OA 1K83H 4LF4L 1VQLA 3EBEA 3HOYG 1JJCB 3TREA 4Y52H 1HZCA 2AWOA 1IBKQ 2UXCL 2WFWA 3NELA 4A3KG 2KBNA 4A3CG 3Q8DA 1N9WA 3PIOA 5IT9c 3CQZH 3I4MH 5FLMH 4AYBG 3PO2H 4GLVB 3L2PA 4JI6L 1NE3A 3PUZA 1VQPA 4DR3Q 4LF9L 3S1NH 1QUQB 5IY0A 3PO3G 3L0OA 3ERSX 3GTPH 3GTMH 1A0IA 2Z6KA 4LUZA 4IFDI 4TQUS 2VQEQ 4YWMA 1K8AC 1X6OA 3CCEA 2ES2A 3UE0A 2R7FA 5C0XJ 3G71A 1E1TA 2N8NA 2EQSA 2Y0SG 3S14H 5C4XG 4PMWA 2VUMG 2XGTA 2CKZB 3OYYA 2WAQG 1OXXK 1Z47A 1WCMG 2KHIA 3K81C 3L7ZC 1PHJA 2UUBQ 2R93H 1GD7A 2D0OA 2PI2A 3OTOQ 3GTKH 3J80c 2L15A 1Y14B 2A1AA 3J81i 1SFOH 2AMCB 4JI0Q 5C44H 1TWFH 2I5MX 1HNWQ 3CMEA 3GO5A 4IOAA 3B6YA 4GNXB 3GTLH 4LF6Q 4K0KQ 4JOIC 3PV0A 4A3MG 4DR2L 4GOPC 4UP8A 4JI3Q 1N34Q 4XIGS 3HOVG 5DLQE 1I50H 1EQQA 5LMUQ 3FHWA 3GTJH 1IBMQ 4JI3L 5JJKA 2ALYB 3HOWG 2YU9H 4LNQA 3S2HH 3GD7A 1S40A 1L1OC 1VQJA 3U4VA 3CPWA 3T1HQ 4JV5Q 1I3QH 3I4NH 3PF4A 4DV7Q 3CCRA 4DR1Q 2NZOA 4UPAA 3S24A 4R1JA 5J3BA 4JYAL 5IYBH 1CKMA 3HOXH 3PF5A 5FJ8H 1D7QA 1QUQA 1MJEA 1E3PA 2YV5A 5LMNQ 1Q81C 1PYSB 4IOCA 1B7YB 1CSPA 1BVSA 2AHOB 4A3IH 1IBLQ 1V43A 2E8GA 4HIOA 2IX0A 4A3CH 3KFUA 1VQ4A 5H1SE 2GVBA 4DV0L 1VQGA 4A3GH 3IRBA 4JC0A 5FLMG 2JA8G 1UE6A 4LFCL 2HHHQ 1MJCA 4R4OA 2VW9A 2VL6A 4X6AH 1HNXL 1XPOA 1CSQA 2JQOA 2PMZE 3CW2C 2VY3A 3K8AA 5GROA 4UP7A 1YITA 2IT1A 3NBHB 1VCIA 2VZAA 4BBSG 2IX1A 2Q2HA 1HNZQ 3CCMA 2WB1E 3UE1A 1XNQL 2MO0A 1YJNA 1VQ5A 3TQYA 3J81c 4DR1L 3RZOH 5GAEC 3EIVA 3RZDH 1TWAH 1U0LA 1BBWA 3MEFA 2ZM6L 1OXUA 4A3JH 4DR5Q 4B3ML 3S2DH 3M4QA 1JJ2A 4J15A 1XMOQ 2HQLA 4NXNQ 4GS3A 3K7UC 2K52A 5C44G 1YHQA 1Y1VH 2IY5B 5JEAG 4AQYQ 1CKOA 3CCQA 3HOZH 3KF6B 1VQIA 3RN5A 3BU2A 2LXKA 4DV5Q 5HY6A 1I5FA 3CC4A 4A3MH 3HOVH 1Y1WH 1G51A 2OQKA 1XMQQ 2HIVA 1GM5A 5IWAQ 1WOCA 1NMFA 4GLAC 2LXJA 1I94Q 3S1MH 4NXML 2VS1A 5GADC 3CCJA 3HOWH 4DV1Q 3TS0A 3M3YH 5BR8Q 4LFBQ 1PH5A 4DR6Q 3HFZB 2N3SA 2ASBA 1NMGA 2R7DA 2E2IH 3U50C 1C0AA 1KAWA 1PH1A 1BBUA 5IYBG 5JJIA 3T1YQ 1H95A 4JBJA 4AYBE 1EFWA 4BA2I 1V1QA 4DR6L 3UDIA 3S1RH 4DV3Q 2JA6H 3CCSA 1KRTA 4IPCA 4MTNA 2NN6G 4IPHA 2OTJA 4P73A 4OX9L 3I4OA 4DR4L 4TVAB 1OXVA 5AJ3Q 2NVTH 4A3GG 3BZCA 4DV2L 1TXYA 1N36Q 2BH2A 2JA8H 1PH7A 5C4JH 3STBD 3OTOL 1LYLA 1X3GA 3J7A5 1XMQL 4JI4L 2OQ0A 4ME3A 3F1ZA 4X66L 1NJIC 1EYGA 1Q86C 2I5HA 1VQNA 2GVAA 1HJPA 4LF7L 3ULLA 1PYBA 1YZ6A 5IYDG 4B3TQ 4QY7A 1Q8KA 1B70B 4BBSH 4NB3A 4C3IH 4A3LG 1VQ7A 2UUAQ 4H02A 2D62A 4DR7Q 3KJPA 4B3SL 1A8VA 1N34L 3HKSA 4X65Q 4A93G 1OTCA 5IP7G 2R7ZG 2K5HA 4QQBX 1A63A 4A3JG 2KHJA 2Z0SA 1PH8A 2IHFA 4L5TA 2B63G 1Q82C 4IPGA 2QA4A 1N33Q 1J6QA 1K73C 1NY4A 3PO2G 2ZJRA 5ELOA 3FKIH 4P74A 1OXSC 3J81j 1A62A 3M4OH 4DUZQ 1KRSA 1J5EQ 1FJGL 2ATWA 1EOVA 3BJUA 5IP9G 1N33L 2C35B 4NXMQ 2VNUD 2CWPA 1VQ6A 1ASZA 1UWVA 4JG2A 2ZTEA 4GNXA 5M5YH 4ALPA 2UXDQ 3M9BA 3CCLA 3G48A 3CCUA 3GDEA 3K7AH 4C3HH 4DPGA 3RNUA 1SN8A 1KIXA 4JI8L 4A3DH 4GKKL 1XPRA 4P72A 1PA6A 1L0WA 2JEBI 1SR3A 3GTQH 5K36G 3W1GA 2AKWB 3KDFB 1PH3A 4KHPL 4LWCA 2UXBL 3PSIA 4YWLA 1HNWL 1XTDA 3NENA 5M3MG 3H15A 4DV1L 3CP0A 4BXXG 4DNIA 5LMNW 5C3EH 1X9NA 1JMCA 4LFBL 4L5QA 3W1BA 4BBRG 3ULJA 3HOYH 4L5RC 2NVYH 3ZJYC 2JA9A 1LM0A 2R92G 3HKZE 3KDFA 2ID0A 3HOUG 4A3KH 1JT8A 2E2HH 2ZJQA 2CQOA 1VQ9A 5GAHC 1S3OA 1X3FA 5LMUL 4HIKA 2R6GA 4HJAA 4MNOA 3I4MG 4DV3L 4OO1I 1X65A 1IBML 1C9OA 4DKAC 1OXTA 1B8AA 3F8TA 4YHHQ 4GNXC 1EUJA 4QL5A 2Y0SE 2YYZA 2UXBQ 4JBWA 2I0QA 4NXNL 3HKZG 1XNRL 3I55A 4Y7NH 1UE1A 4YCUA 5C0XI 1G291 2MO1A 4DV6Q 2VQFQ 1XJVA 1VQKA 4BY7H 4HJ9A 5IYDH 1Q12A 3PUXA 2UU9L 4POGA 1KL9A 5M3FH 5BR8L 4PG3A 1VS0A 4LUOA 5EAYA 2AWNA 4RMFA 4EX5A 4GOPA 1QVGA 4LUVA 2N78A 1E22A 1YVCA 3KOJA 4A93H 2WAQE 1HNZL 1WYDA 2R7ZH 5IWAL 1XNQQ 1WJJA 4A3BG 5IE8A 1NBWA 1ASYA 2KCMA 2D0PA 4JYAQ 3VDYA 1CUKA 1AE2A 1KXLA 3FKIG 5M5XH 2HT1A 2JA7G 2F52A 3CF5A 4DUYL 4WJ3M 1XMOL 1VQOA 2UXDL 1SE8A 3KF8B 1K0RA 3NEMA
chains in the Genus database with same CATH superfamily
3TP7A 4B3RL 2MGSA 2PZUA 3SGIA 1SE3A 3F2DA 1EYDA 3ICEA 4LF9Q 3BVGA 4A4IA 2J7ZA 4A3DG 2QDBA 2F0LA 1GUGA 1FVIA 3F2CA 4GN5A 2C5CA 2VUMH 1PH9A 2FJ2A 4A3MB 2E5LL 3CC2A 1WI5A 2WKCA 5G3LF 4GKJL 1Y8NB 4A3IG 4FP5D 5EKKA 4JI6Q 1Q1BA 5IGEA 4DUYQ 1ZYRD 4XQJA 4RG1A 1ZXTA 2E2IB 4CJ2C 5IIFA 3EVQA 2O4XA 3EQLC 2F3VA 1I4RA 3WDNA 1AN8A 4RHRA 1HUMA 3VR3A 1SYDA 1MKHA 3I4NG 1BNZA 3NQIA 2ZM6Q 3K6OA 3IFDA 2E5LQ 3S1QH 3S16B 5M5WH 2RVLA 1KC8C 4DR2Q 1GUWA 1SLJA 2PQAB 5KNCA 1I6HH 5LL6X 4R4QA 4IPDA 5NUCA 2K04A 1STBA 2B2UA 2VB2X 1N36L 1A6XA 3CCVA 1EY0A 2CQAA 4DV4L 4PV1C 3X3MA 1U4RA 1EQTA 1VQBA 2NB0A 5C44B 3GTOH 4DN4M 2RDHA 3JAMc 1D1KA 2MPMA 1E24A 5D65A 2E74C 3A74A 3KYHC 4XXEA 2K5QA 1E2WA 2KUMA 2OTLA 4YCVA 1NCVA 2NVXB 1PRTD 1PFBA 1Z9FA 3NTIA 1H9SB 3KJOA 1S72A 4KN7C 2F0VA 2D9UA 2B3GA 2H5XA 3NXWA 4YHHL 4V0BA 4FDBA 4OO1G 3I4LA 3VA5A 1IW7D 2UUAL 4QIWE 5JJLA 1KDAA 4GKJQ 2E2DC 4G57A 4L5SA 3RN2A 4ILWA 4YY3L 3J80E 4UP9A 3NUCA 1BUVT 2KCCA 5J22A 1TWHH 4A3EH 5BN5A 4U68A 3PO2H 5IODA 2K14A 4JI1Q 4DR4Q 3SK4A 2KENA 2PQAA 3NK9A 5E3FA 4A3JB 1GVPA 4DAYA 1LT4D 1QNUA 5F2DA 3KF8A 1KQSA 5C4ZA 3A8IE 4X66Q 2NZHA 1QVCA 3UDXA 1U4PA 1NTGA 5HGQA 1TR5A 3D31A 1STGA 3CXCA 3S15H 5CV8A 1CQVA 4WJWA 5M3MH 1JOOA 1O7IA 5IP7H 4PZ8A 1QZHA 1E2VA 1GHJA 2R92H 4LW1A 1DD2A 3HP3A 4DR5L 4H13C 3ULPA 2F3WA 3VYTA 1ZYRC 1K9MC 2TMPA 3K58A 1LTRD 4HMJA 4DUZL 1KD1C 5M3MB 2PW5A 2UUCQ 1TVXA 1YHAA 4WORA 1ILQA 2I46A 2R92B 1EY9A 3PGZA 1XPUA 3BZKA 4KKSA 1HR0W 4KLKA 3KF6A 1F2ZA 4AH6A 3H0GH 3H3VI 3I4MB 5K36H 3LWEA 2SOBA 4RGMA 1PVOA 2WV6D 2KHSA 2YTYA 3A5ZB 3HZXA 3T56B 1XNRQ 1CKNB 1BKBA 3GTPB 3EBEA 4Y52H 1W6JA 1TWCB 3N52A 4A3CG 4DNRB 1N9WA 3I4MH 4F87A 1ET6A 4AYBG 1ZEQX 4HTHA 3S1NH 3NE5B 1PDQA 1QUQB 1TWGB 5CR3A 4QIWB 1SFOB 1A0IA 4LUZA 5KIXA 4TQUS 2SEBD 1SNMA 3CCEA 4IFDH 3UE0A 2Z8LA 4CGYB 5I2XA 5C0XJ 3FKIB 4C3JB 1E1TA 2Y0SG 2B2VC 2EJFC 2B8FA 3DEPA 4X3TA 3L7ZC 2D0OA 3OTOQ 3J80c 2L15A 4RGNA 3QIAA 1Y14B 3HG9A 1DXMA 1TWFH 1II3A 4N8FA 4F8MA 4IOAA 3R2IA 4GNXB 4LF6Q 5I9PA 1U4LA 4HR7B 4JI3Q 4GOPC 4UP8A 5DLQE 3L3OC 2ALYB 3S2HH 4JV5Q 1IYUA 3MXUA 4DR1Q 1HA6A 3SXHA 4UPAA 4X3UA 3PIO3 3S24A 4R1JA 5J3BA 4JYAL 5IYBH 1B50A 1ZKOA 3GV6A 2WB1B 2YV5A 1Q81C 1KDBA 1PYSB 3ONAB 1B7YB 4BY7B 2EPBA 4A3IH 4RKLA 5M3FB 1KABA 3S2HB 5FLMG 1UE6A 4R4OA 3S2DB 1KLUD 3UI2A 5GROA 1YITA 4A3EB 1VCIA 2VZAA 1UNSA 1PTOC 1HNZQ 2WB1E 4C3IG 1RCVD 1YJNA 1BCPB 1EWCA 3J81c 5GAEC 3EIVA 1PFMA 4XT3B 1GUSA 2F0EA 5JOBA 2PPBC 3S2DH 1BCPC 3OWEB 3S1MB 1Q8IA 2KECA 4GS3A 5C44G 3R3OA 5I6YA 2AUJD 4ABNA 3HOZH 1VQIA 3RN5A 1IKMA 1G2TA 3VA7A 2K5DA 2OEOA 3V2TA 3OW7A 4A3MH 1Y1WH 1G51A 1JOQA 2HIVA 2KJXA 2A6ED 1CA5A 4GLAC 4NXML 4JK1C 2K01A 2EDGA 4NKLA 4DR6Q 3HFZB 2ASBA 1D1IA 4ZYSA 2JA5B 4BA2I 3MVVA 3UDIA 5JAVA 3MC0B 2FHTA 4IPCA 4R9WA 3H91A 4P73A 1IKLA 3I4OA 4DR4L 3H0GB 5AJ3Q 1KDCA 4DV2L 2JA8H 2BH2A 3T53B 1LYLA 3BDOA 3J7A5 1X32A 1TT2A 1AZQA 2IW3A 4ME3A 4IN3A 2B2WC 4X66L 1EYGA 1Q86C 1VQNA 1HJPA 3ULLA 4BBSH 3D4WA 1Q8KA 1B70B 3M4OB 3P1HA 1HRJA 5ELFA 2ZT9C 1LTBD 2B2UC 1A8VA 1B3AA 2FINB 4KMUC 1I4PA 4V190 1QG7A 5M5YB 1TS2A 1CFMA 2QA4A 4EQNA 4O42A 1Z6HA 3PO2G 1STHA 3FKIH 2ATWA 5IP9G 3VR5A 1PLFA 2VNUD 2CWPA 1ASZA 1UWVA 5C3EB 3K59A 2RSNA 4ZKCB 3GTKB 3QB3A 4GNXA 2NVYB 1SNOA 3CCLA 3GDEA 3ND8A 3K7AH 4C3HH 4LMQD 4GKKL 3H94A 2E2HB 1XPRA 1BCPD 4K8JA 4S3SA 1BQQT 2BE5C 2AKWB 3OWFA 5CMDA 3GTLB 1HNWL 3NENA 5M3MG 4BXXG 4DV1L 4DNIA 5LMNW 1JMCA 1XWEA 3HOYH 2R92G 4HAEA 1LM0A 3HOUG 3HKZE 2ID0A 1TIID 4A3KH 3NBIA 2E2HH 2ZJQA 2CQOA 3MXGA 4EGVA 1X3FA 2R6GA 4MNOA 1RD9D 1C9OA 1B8AA 1ILPA 1EUJA 5KGUA 3J81L 3I55A 4Y7NH 2QDLA 2CW0C 2MO1A 4UAIA 5IYDH 4HJ9A 1KL9A 4J8QA 1S5CD 1VS0A 3J7AF 1JCKB 4RMFA 2N78A 3KOJA 1WYDA 4QB4A 4A3BG 2NYZD 2D0PA 5CBEE 1AE2A 2KEEA 4C3JG 5C5MA 5CGKA 4QF4A 1ICWA 1K0RA 2WKDA 2Q8TA 2WAQB 4NMZA 1CKNA 1WCMB 1L2FA 2WP8J 3I56A 2K5NA 5AFWA 2PQEA 3KBGA 1K3RA 4JCVE 4FYDA 2I07B 1PTOF 4FXKC 2QKIC 4P75A 5C0XG 1LT3D 4XTCS 2CVRA 4HIMA 1SYEA 4DV7L 2ENBA 4NW2A 1VQDA 1RL2A 1BCPF 1JC7A 3OW2A 1EIGA 3HOVB 2HQEA 3M85A 4CHTB 4Q0FA 1QILA 4WJ4A 2UUBL 5CV5A 3T4AC 3HOWB 2RF4A 1X3PA 3M7NA 3IKJA 4KY6A 4FF1A 1G91A 5T1GA 4NPSA 5LMNL 4CDDC 1SNCA 4CKCA 2JYOA 5FO9B 1F9SA 2K75A 2L0CA 2J4XA 4OEMB 4LFAL 2XTIA 3K5NA 5K5PA 1TWCH 4BY7G 3DHQA 5EPLA 1CM9A 4DK0A 4HJ8A 1YHBA 2NVTB 2F0UA 2X6GA 5GQOA 1JWMD 1R4PB 4EVOA 1GJXA 4RCOA 1C8CA 1K8MA 2MJ8A 4JI5L 1TWGH 4X64Q 2KA7A 3TBIB 3GTMB 4KD4A 4AQYL 5EJWA 5D3DA 5EBCA 2K6AA 5T1IA 5FKAC 5IOCA 1Q46A 3OHXC 2JA7H 4BBSB 3TMEA 3S14B 5ELDA 2F0GA 4A3FH 4JV5L 2HUGA 2IHEA 2JJQA 3EN2A 3KLRA 1X3QA 2V1CC 2RBMA 3E0EA 5LHY1 1G6PA 5FOBB 1PV4A 3FDTA 1SBBB 1B3QA 3I7FA 1EQRA 1S5FD 4FNFA 1LACA 1I4QA 5IGDA 2EY1A 1M1KC 1SEBD 5CV4A 4B3TL 1I6VC 2A6HD 2B29A 1P16A 3DWAA 2RHSB 1QZGA 3CAMA 4FO2A 1YEZA 2JA6G 4H44C 4KD3A 4MTKA 3K0YA 5AJ3L 3LWUA 1N8RC 1YI2A 2PYKA 1V1PA 4BA1I 3W5OA 3GTOB 3HOZG 4LF4Q 1N32Q 2NN6I 1X3EA 1YNXA 5JPMC 2XIWA 1BDOA 1TS5A 1BF4A 1Y1WG 2JA5G 2K5VA 3A54A 1A3TA 1PFSA 1JB7A 3DLLA 3I70A 4X62L 4HIDA 3LX0A 4M1UB 1WD1A 1HH2P 5IYCG 5I6WA 1JICA 4QUFA 4KI0A 4IO9A 2ZTCA 4TRDA 1UE7A 4HJ5A 1IW7C 1T9HA 1Y69U 1BXTA 3DUZA 3MXPA 1FL0A 4Y7NB 3L9AX 4RWSC 4GOPB 3T1YL 2Z6KC 2NUCA 1HNXQ 3A56A 3BDLA 3X3NA 3VYSA 1JE5A 4NDXA 3S15B 1SSOA 5JEAJ 1YBYA 4YCWA 3DWPA 2CW0D 1SYGA 2Q8IB 3TEHB 2NVQH 1O7YA 5E7NA 1DJRD 2L1BA 3PCOB 1HR0Q 1RF2D 1J5EL 5M5XB 2JE6I 1A3UA 1GUTA 3ER0A 2F0PA 1EWHA 3KLSA 5CYUA 1TS4A 2BH8A 2EJMA 1IYJB 1I4HA 3TP6A 3J80i 3GV3A 2RCNA 4LF5Q 2B2YA 4OXPA 1CZGA 1F2MA 1GKHA 2B2WA 2LSSA 4O0AA 4ZAIA 1UE5A 5IP9H 4TKOB 3UDGA 1R9TH 2HIXA 2BOSA 1KNAA 4OO1H 2YTXA 4C3HG 3FEWX 4R4TA 5ELNA 2KEDA 2RSOA 1XYIA 2DGYA 4CKEA 5A2QE 1Q1EA 3E6ZX 4GLXA 4CDEC 4BXXH 3MXNB 2UXBQ 1PYWD 1AE3A 2Z6BA 1E1OA 4DK1A 1K83H 4LF4L 3HKZB 3HOYG 2F0NA 1HZCA 1IBKQ 2NWGA 2UXCL 3NELA 4A3KG 2DJFC 4PNYA 2EXZA 3Q8DA 3CQZH 3HRZC 3K57A 4CKBA 2PW7A 4GLVB 2F0HA 4TSSA 1AEXA 5G3LD 1SAPA 3KK7A 5IY0A 3L0OA 4OL7A 1SNQA 2ES2A 4YWMA 1K8AC 3HGBA 3BG3A 2JA7B 2H4OA 2EQSA 1RJTA 5C4XG 1NR2A 4PMWA 2F0QA 3CHBD 5KEEA 2WAQG 3AMUA 2KHIA 4DGZA 1PHJA 2R93H 3GTKH 1LTAD 1Z7TA 4K2LA 4JI0Q 1HUNA 5CBAE 2RA4A 3GO5A 3CMEA 3GTLH 4IUTA 1GHKA 3PV0A 2R93B 4DR2L 3HOVG 4FXGC 1N34Q 1C4QA 3I90A 1I50H 1EQQA 2G9DA 2HCIA 3URYA 1PMRA 3K5MA 2XSCA 4JI3L 5C0XH 3HOWG 3A8KE 2YU9H 3C1FA 2K05A 1S40A 1VQJA 3CPWA 3PF4A 4KY7A 2EOTA 1D7QA 1CKMA 5FJ8H 5ISRA 5LMNQ 1FNUA 2G5DA 4K5VA 4IURA 1RTNA 1STNA 1IBLQ 2IX0A 4A3CH 3KUPA 2N55A 2GVBA 1VQGA 3WOFA 4JC0A 2VW9A 4ZKBB 1XPOA 1CZWA 2VY3A 3JAML 3K8AA 1CT1D 2IX1A 1RKNA 3UE1A 1XNQL 1E2ZA 1K8OA 3RZDH 2ZM6L 1OXUA 3VR2A 4A3JH 3D8GA 3FVQA 5IT9L 4J15A 2HQLA 3K7UC 1GXDC 2K52A 4P2CB 1YHQA 1SMYD 1DM0B 3V05A 5JVH3 2LXKA 1DYQA 1I5FA 3Q0AA 1MBYA 1YNJC 3CC4A 1U4MA 1VF5C 2F0SA 1XMQQ 5IWAQ 2JA6B 1NMFA 4UDUC 2CHBD 1CK1A 1ICFB 4JW0A 2VS1A 1STAA 2EYJA 4DV1Q 3MHBA 2O5JC 2V4DA 2N3SA 1NMGA 2R7DA 2EVBA 4Q5VA 5IGFA 2E2IH 1KAWA 1PH1A 1EEFD 5IYBG 1R9TB 1H95A 4JBJA 1EFWA 4QCLA 1V1QA 1GUNA 4DR6L 2JA6H 4ZK9B 1KRTA 2OTJA 1OXVA 2NVTH 3SHLA 2K28A 1TXYA 1N36Q 1PH7A 5C4JH 4RHSA 3STBD 5L37A 2LS01 1X3GA 1XMQL 2A68D 2LKVA 2E75C 4LF7L 1V1PB 3C46A 2F0TA 1YZ6A 4HEDA 4C3IH 2F0DA 1SE4A 4A3FB 2Q8RE 2UUAQ 1CTMA 3KLSX 3NSWA 1DONA 2D62A 1QJOA 4DR7Q 4A93G 2JP1A 3HKSA 2R7ZG 3S1NB 2IHFA 1Q82C 4IPGA 2ZXRA 1G2SA 5ELOA 4ME5A 4HSPA 2M2LA 3QO2A 1EOVA 4G4KA 1VQ6A 3IAYA 4ALPA 2A6HC 3E0JA 3M9BA 2AUKA 4KK7A 4EQPA 1BBXC 3RNUA 1SN8A 3W3AA 2OXPA 1HFGA 3E5SA 3W1GA 4KHPL 2RDFA 3PSIA 2QF7A 2PNRC 1Y8OB 1PZKD 1TY2A 2L4NA 4BBRG 1SDFA 3KDFA 3NQTA 3I3CA 5GAHC 4HJAA 2M00A 4HIKA 5IGGA 4OO1I 4CBVA 2B2YC 2YYZA 3BDCA 2B2TC 1XX8A 4RGOS 4G7ZC 3HOYB 1UE1A 4YCUA 1G291 2VQFQ 5E1FA 1Q12A 1SJHD 5M3FH 4LUOA 4FVMA 2L11A 1QVGA 2EY5A 1YVCA 1WTVA 2WAQE 3DMUA 3MEHA 1XNQQ 1WJJA 1ASYA 2F0JA 1B9NA 4PQXA 1TY0A 1F2YA 1M8AA 3DXJC 3MFGA 2CH4W 3FKIG 2B39A 3DEOA 2F52A 4XYOA 3CF5A 4DUYL 3GQBA 4WJ3M 2VUMB 2ZTDA 1N32L 4B08A 4X3SA 1W6KA 4WFN3 2LFNA 3EROA 4RA8A 1RHPA 2CFMA 3ND9A 1MSGA 2I5LX 2Z1CA 3K0XA 1IBKL 3NTHA 1CA6A 5C4XH 4O2DA 1B1ZA 1W3SA 4MZ9A 1NNXA 5EPKA 1T5EA 4DAPA 2F0KA 2Q2UA 4JI2L 3HOXG 2R93G 1NSNS 5LL6S 4J6HA 3HOUH 3T13A 3U58A 3S17B 2A69C 2F03A 5DNFA 3HS0C 3STBC 1UAPA 3JC66 3MTSA 4OONA 3LGJA 1WTOA 3R93A 1WVLA 4C1NK 5KYIA 2OWOA 1VMPA 2AQ3B 3OIPA 3GP7A 3S16H 3S1QB 3SDZA 3TS2A 5J1ZA 3J7YW 3G4SA 1HR0L 3K5OA 3RLOA 3AQQA 4QGUA 3RLNA 5EKIA 4X64L 4JOIA 4WRDA 5JPNC 2JA8B 4DA2A 5M9OA 2LY7A 4X65L 3AU7A 5C4JB 4HJ7A 1A2TA 1X54A 3PUYA 1JE4A 1HQMC 2O2LD 4RKBA 2BDNA 2EYFA 5HURA 1NAPA 5FJ8G 4A3BH 1B53A 1U5KA 3VR4A 4GN4B 4ODGA 1EZ6A 1QOHA 4C3JH 2ZJPA 4C3IB 4EQ5A 4DAMA 3T1HL 2UU9Q 2FXQA 1SXTA 1VQMA 4DV6L 1I6HB 4DNTB 4JI7L 3MFYA 4JI2Q 2D2CC 2RHQB 4IQZA 4IFDJ 5DAUA 1G6ZA 4DAYB 2ZXOA 1E7ZA 4DFAA 1MHWC 4E6IA 4JVZA 1PTOB 1K3BC 2CCZA 1YIJA 4J1MA 1EL0A 1HZ9A 2UXCQ 3I72A 1MIUA 1PH6A 3GTQB 1LTLA 4N9PA 1PZID 3PUWA 4X3KA 2A19A 1ESFA 4DK6C 1VQ8A 4JBMA 5FLXc 1M90C 4ZQ3A 4K0KL 4BY1H 4F88A 4B3MQ 1RIPA 3OPOA 1ENCA 2JK8A 2VQEL 4DV0Q 1YJWA 1JJGA 3RR5A 3QJYA 2NVXH 4A3LH 4A3GB 2HDMA 5KYLA 4ZUJA 1EY8A 4LF6L 1K8GA 3J7ZC 3M4PA 3T16A 1ML0D 1SRUA 3A55A 3DM3A 2K50A 4JI5Q 4RCNA 4IJLA 4NP5A 4A3FG 2IL8A 2PNHA 4A93B 4ZRZA 3OMGA 1EIHA 4HCEA 4IJHA 1DGSA 4Z9CB 1D5MC 4YIJA 2PI2E 4JI4Q 2BDOA 5ELEA 2JN4A 3PO2B 1HQRD 1FJGQ 1O7LA 1CQFA 1GOZA 1AFPA 4KKUA 4LAAA 1WTQA 4A75A 2EIFA 2MP1A 4YY3Q 1ENFA 1WCMH 1VDZA 5C3EG 2DUDA 1I94L 2Q2IA 4B3SQ 2KCTA 4IUNA 1VQAA 1LABA 2NZ1D 3D0FA 1VQHA 2JXMB 4UY8C 2QGQA 2FFKB 4JI1L 1EIYB 2C9OA 2A8VA 3M3YB 1VMCA 1VQEA 3AYHB 3AFPA 4JI7Q 1R4QB 1WTWA 5I9OA 3PIPA 3H6MA 1A2UA 2JA5H 1O80A 4BBRB 3MXNA 1WTXA 4JBKA 3S17H 1D8LA 2PMZB 3D3RA 2VB3X 5IYCH 3LNNA 3CMAA 1HCZA 3NBHA 1W2BA 4PZ7A 2XRQD 1G8ZD 1VQCA 1IBLL 4LF7Q 4IUVA 1HHVA 1VQLA 1JJCB 3QOLA 2WFWA 5EKLA 2KBNA 1FNWA 3L2PA 4JI6L 1NE3A 3IFTA 3PUZA 3C3LA 4G7OC 4LF9L 4A3BB 1EFID 3PO3G 5FLXE 4ULLA 1TQOA 2R7FA 5D3IB 3G71A 4MHEA 1KLGD 1ET9A 2XGTA 3OYYA 2QCPX 1Q90A 1I50B 2FMMA 3I73A 4GZYC 4BS9A 2AMCB 4N8X1 2H1EA 3TDQA 5IGBA 2IWHA 4JOIC 5JVG3 3HOXB 5KNBA 3C1EA 4K14A 4XIGS 1PXUA 3TP8A 2IX3A 5CV9A 5D14A 5LMUQ 5TSSA 3FHWA 4A3IB 3HEJA 1IBMQ 1TWFB 5JJKA 1D6EC 4LNQA 3GD7A 1L1OC 4DV7Q 3ERQA 1AP0A 3PF5A 1PRTC 3HOXH 1QUQA 1E3PA 3DM1A 4IOCA 1CSPA 2L12A 3SVMA 1V43A 2NN6H 1JB3A 2E8GA 4L63B 5FO8B 2EJGC 2RCFA 3KFUA 5H1SE 2K1BA 1LO5D 4A3GH 3IRBA 4DF7A 3Q24A 4LFCL 2HHHQ 1K0SA 1MJCA 2JQOA 2PMZE 3CW2C 4UP7A 4OGQC 3Q22A 2EY6A 2IT1A 2R3ZA 4RH6A 3NBHB 2Q2HA 2F0WA 3BYTB 5HGTA 4DR1L 3RZOH 1WTHA 4RAUC 5FLXL 1TWAH 2CH4A 1BBWA 4ZLTF 2XWBB 3G7LA 5FK9C 2B2VA 1Y1VH 2IY5B 1H9MA 2RKSA 1CKOA 2X6LA 4HMIA 5CV6A 5A35A 1A15A 3KF6B 4AQYQ 3BU2A 3V96A 5COYA 3BZDB 2XNAC 4KV6A 4MN3A 4ZUIA 2HD3A 3HOVH 1WOCA 3Q23A 3S1MH 5E4XA 2KVMA 2KCNA 1L0YB 3CCJA 3HOWH 3TS0A 5BR8Q 3HOZB 1FD7D 1PH5A 3SEBA 2AQ1B 3U50C 3ITPA 5JJIA 1F9QA 4R8NA 4FXDA 4IUUA 1KAAA 3P20A 2WACA 2QILA 2N88A 1SYBA 4IPHA 4OX9L 4TVAB 1EZ8A 3BZCA 1DOLA 2RDGA 1BO0A 3OTOL 2KOLA 5C4HA 4JI4L 4I7AA 3F1ZA 1NJIC 3CU7A 2GVAA 3R2TA 1PYBA 4B3TQ 1S5ED 4NB3A 3D6WA 4A3LG 1VQ7A 4H02A 2EYHA 4B3SL 3QG1A 4X65Q 2EY2A 1OTCA 1EYAA 5EGTA 2K5HA 4A3JG 2KHJA 2ZXPA 4OHJA 1PH8A 4L5TA 1RTOA 1J6QA 1K73C 2PO4A 3WOEA 1OXSC 2M9VA 1A62A 3J81j 4DUZQ 2DY7A 3RD4A 1FJGL 1AW7A 3BJUA 1N33L 4NXMQ 1L0XB 4FF4A 2EYLA 2ZTEA 3D4RA 1PTOH 4OIKA 1UEAB 2UXDQ 4CJ0B 1KIXA 5EQ0A 4JI8L 4A3DH 4C56C 4DAVA 4P72A 1RDPD 1L0WA 2JEBI 4MIUA 1QE6A 4HCSA 3KDFB 4YWLA 1XTDA 3H15A 2DN8A 3OIQA 5C3EH 4LFBL 4L5QA 3MWYW 3SK5A 2BCOA 3W1BA 3A7AB 4BY1B 4L5RC 2NBFA 3ZJYC 4C3HB 1FGBD 1VQ9A 2XRSD 2YU9B 1LV9A 2EYOA 3SE0A 3NPPA 4QMGA 1WTPA 4DV3L 1X65A 2JSOA 3R8BA 1PRTB 3EJIA 3F8TA 2WINB 4XT1B 4GNXC 4XDXA 4HSVA 2WIIB 4BWGB 2Y0SE 1QCBD 1MD2D 2I0QA 4RGTA 3HKZG 1XNRL 1MI2A 1S5BD 4I7ZC 1KTKA 4DV6Q 1DOKA 4GKKQ 4A3KB 5EAYA 5ELCA 2AWNA 2A74C 1PRTF 3FPUB 4LUVA 1E22A 4A93H 1HNZL 4KHVA 2R7ZH 2XWJB 3SK8A 1NBWA 2KCMA 1I4GA 1FNVA 4JYAQ 4K6DA 4CDCC 2OF1A 2HT1A 1TKWB 3OSOA 2Y0SB 3U9SA 3CRLC 5C4XB 1VQOA 2UXDL 1SE8A 4EX5A 2HDLA 3NEMA 2E76C 1ESRA 2A6EC 1VQFA 2D5DA 1TWAB 1SYCA 4YWKA 3PO3H 1UEBA 4PMCA 1JQYD 3KBXA 2CWAA 2A5HA 4OX9Q 3PIP3 3J7AV 1B4OA 4XYQA 3VR6A 4AIMA 5IT9E 4G7HC 2UUCL 2SNSA 2A69D 1M4VA 1WD0A 2Z9HA 1EYCA 1EY4A 4FF2A 4KHPQ 1PH4A 1PTOD 4BBRH 3JAMi 4FF3A 3GTGB 1FR3A 1HZBA 1O7ZA 4K2KA 3SR1A 1H9KA 3E9HA 1SMXA 1PFNA 1BR9A 3CC7A 1HTPA 5GAGC 3MAQA 1F2LA 3K80C 2BE5D 2MFIA 1Q7YC 2WB1G 1P8LA 3GTGH 1IZ6A 2EZVA 4PZ6A 4OWWB 1EU3A 1T5XD 5M3FG 1LT6D 1ONLA 3FPPA 2F0FA 1HPCA 1O78A 1DCZA 4L8JA 2VQFL 3MA2B 2MQHA 1HZAA 3O13A 3KLWA 1IXRA 3PUVA 2K7VA 1L1OA 3DWQA 1STEA 2MNAA 4A3EG 3M7GA 5JEAH 3C2PA 4K8IA 3RUZA 2DY8A 2EXDA 3U9OA 2QEXA 1QVFA 4OWTB 1NR4A 2J0TD 1IL2A 3CPFA 5C3WA 4IUPA 4APVA 2EE1A 4N9TA 4X62Q 3A8JE 2IJ0A 2MUYA 4DV5L 3W2DA 1EY6A 5DEHA 2MHVA 4XQQA 1C7YA 4JI8Q 3CD6A 1V8QA 1SNPA 3BYYB 1JR0D 1EOTA 1KNEA 3J81E 4L6TB 3A0JA 1U9RA 4ZCKA 1X56A 2N49A 2GA4B 3RMHA 3I2ZA 4KJOA 3OOCA 4KHZA 1Y1VG 3F2UA 1EY7A 2AQ2B 4K5XA 4LFAQ 4DR7L 2F0OA 2GN5A 2BA0A 4A76A 4R4IA 3TZUA 1V1OA 4OWXB 5BN4A 1TWHB 3D4DA 1EQVA 1WFQA 2B2TA 2K33A 3FMCA 3OMCA 1FGUA 4H0LC 1V9PA 4C2MH 1RODA 1STYA 4DR3L 4JI0L 1TS3A 3H0GG 3S9WA 1JWSD 3WWVA 2K4KA 1UUPA 4LF8Q 4QUCA 2NVQB 1JORA 1DOMA 1GO3E 1LTGD 3F2BA 2B63H 3U4ZA 4UHVA 1J9OA 3CKIB 2F3IA 2QW7A 2SDFA 4O1NA 2JEAI 2F4VL 4QJFA 1KHIA 3BVMA 1YJ9A 1AH9A 1PH2A 5CORA 3ZYYX 1I4XA 5DM63 1EIFA 1D5XC 1WTRA 4K5WA 4R4CA 3RZOB 2HHHL 1L1OB 1PZJD 3RZDB 4LFCQ 2R7ZB 3E9IA 4RFBA 2Q2TA 2B63B 3NP8A 2B8GA 5C6AA 4C1NI 2YTVA 4IFDG 3VYUA 3FP9A 4GN3B 4POFA 1JOKA 4HN7A 2F0IA 4LF8L 5JJZA 3CRKC 5FO7B 4DK3C 1MGSA 3TP5A 1A3VA 2K5WA 4IZ8A 2G9HD 3AFQA 1IL8A 3RLFA 3TRZA 1LUZA 4R8IA 3AEVA 3G6EA 4BY1G 4DV4Q 1X55A 2OCEA 4B9XA 2X69A 4DV2Q 4P71A 3HOUB 1OO9B 1SROA 1EWIA 3CQZB 2XVSA 2E2JH 3H3VH 4B3RQ 3UDFA 3A5UA 1QNKA 2DNEA 2BA1A 2F4VQ 3EFXD 1HA5A 1QWYA 3TREA 1CI3M 2AWOA 5EBDA 3PIOA 5IT9c 5FLMH 1H9JA 2E2JB 2DJGC 1BOSA 4M8AA 1VQPA 4DR3Q 3I8ZA 2ICEC 3ERSX 3GTPH 3GTMH 2Z6KA 3I91A 4IFDI 1J8IA 2VQEQ 1X6OA 4IUQA 1K28A 4DU9A 3E3XA 2N8NA 3S14H 1Y8PB 2P5ZX 2VUMG 1GUOA 2CKZB 1OXXK 1Z47A 1WCMG 2NTTA 3K81C 2UUBQ 1XTCD 1GD7A 1H9RA 2PI2A 5ELBA 4KKTA 3D6CA 1D5ZC 1C48A 3FRPB 2A1AA 1B9MA 4OIJA 3J81i 1SFOH 3G6JB 3K7AB 4A3DB 5C44H 2I5MX 2TSSA 1HNWQ 1LTSD 1I3QB 3B6YA 4K0KQ 3SK6A 4A3MG 2DNCA 4KTAA 1XXGA 1HXYD 1MSHA 3GTJH 4DXGA 3U4VA 3T1HQ 1EY5A 2Z4HA 1I3QH 4PMBA 3I4NH 3CCRA 2NZOA 2L5TA 5I2YA 1F9PA 1YNNC 1MJEA 1BVSA 2AHOB 1HTLD 3GTJB 4HIOA 2F4IA 5CC4A 1VQ4A 4DV0L 2JA8G 3I4NB 2VL6A 4X6AH 2OT2A 2QEJC 5IGCA 1CSQA 1HNXL 3EA6A 2KQ3A 4BBSG 5CV7A 1AZPA 3CCMA 4EQOA 4KJNA 2MO0A 1VQ5A 3TQYA 2A73B 1LLRD 1U0LA 4CJ1B 1Q3LA 3MEFA 4IALA 4DR5Q 4B3ML 1QB5D 3M4QA 1JJ2A 1SMYC 5EPJA 1EEID 1XMOQ 4LJZC 4NXNQ 1F9RA 3TSSA 5DM73 5JEAG 3CCQA 5KNDA 1D2BA 1YNJD 2PCFB 4DV5Q 2PZTA 5HY6A 3IL8A 2OQKA 3T51B 1GM5A 3P75A 1LTID 3S1RB 2FMCA 1I94Q 2LXJA 4F7XA 3QWNA 2O5IC 1SYFA 1IYVA 5A2QL 5GADC 4DXFA 1Y1VB 1FYCA 3M3YH 1TU2B 4LFBQ 2NTSA 1C0AA 1BBUA 3T1YQ 1Y1WB 1IHZA 4AYBE 3S1RH 4DV3Q 3TZDA 3A7LA 3CCSA 2EYPA 4MTNA 2NN6G 2L9HA 4A3GG 1VF7A 4KN4C 5BN3A 1LT5D 5E4WC 1NUCA 5C5LA 5M5WB 2L55A 3NWTA 2OQ0A 4OELB 3K5LA 1K83B 2I5HA 2PZWA 5IYDG 4B9WA 4QY7A 4K6LA 3H3VC 2RQXA 3BS1A 3NWSA 5C3XA 2VXWA 2XN9C 4U673 3KJPA 1N34L 2SNMA 2F1MA 5IP7G 4QQBX 1A63A 2F0MA 2Z0SA 2B63G 1EU4A 1SE2A 1N33Q 1NY4A 2ZJRA 4P74A 4LK1C 3M4OH 4ID6A 1KRSA 1J5EQ 3PMFA 1B44D 2C35B 4I65A 4JG2A 3PQIA 5M5YH 3Q6SA 3G48A 3CCUA 4DPGA 2IPKD 1SJED 1PA6A 1SR3A 3GTQH 5K36G 1PH3A 3BVZA 4LWCA 1SNDA 4H7BA 2UXBL 1HFNA 3JAME 2R61A 3CP0A 1X9NA 3P7JA 5J39A 3ULJA 2NVYH 2JA9A 1F77A 1H9SA 4C2MB 3N6RA 1JT8A 3TN2A 1ENAA 1S3OA 5LMUL 1B2TA 3I4MG 2K03A 3MZ5A 2K32A 1IBML 4DKAC 4YHHQ 1OXTA 3VYRA 5I4DA 3QOJA 3AB9A 3NHHA 2HCCA 4QL5A 3J80L 4JBWA 4NXNL 4KY5A 4CDFC 1S5DD 1CHPD 1E0BA 1VQKA 5C0XI 4BY7H 1XJVA 3PUXA 1YNND 2UU9L 4POGA 5BR8L 4PG3A 3M4YA 2A68C 4AYBB 4GOPA 3QR8A 4XQNA 3NTKA 5IWAL 4JPBW 3PO3B 5IE8A 1LTTD 3VDYA 1CUKA 3H09A 2LMCB 1KXLA 5M5XH 2JA7G 2EYMA 2Z4IA 2ICIA 1DZ1A 1CHQD 1XMOL 5KRUA 1JWUD 3KF8B 4LF5L 1S4ZA
chains in the Genus database with same CATH topology
2ZTDA 1N32L 1CKNA 1L2FA 2WP8J 4B3RL 3SGIA 1VQFA 2K5NA 3I56A 3F2DA 1K3RA 4JCVE 4YWKA 3PO3H 1UEBA 3ICEA 4LF9Q 4A4IA 2CFMA 2CWAA 4OX9Q 4P75A 2I5LX 4A3DG 5C0XG 3K0XA 4XTCS 1IBKL 4HIMA 1FVIA 3F2CA 4DV7L 5C4XH 4AIMA 2UUCL 4O2DA 1VQDA 1W3SA 1RL2A 4GN5A 2VUMH 1PH9A 4MZ9A 2Q2UA 3OW2A 4JI2L 3HOXG 2E5LL 2R93G 3CC2A 4KHPQ 1WI5A 3M85A 1PH4A 4BBRH 3JAMi 4GKJL 4WJ4A 3HOUH 2UUBL 1HZBA 3U58A 4A3IG 3E9HA 1SMXA 3STBC 4JI6Q 2RF4A 3JC66 1Q1BA 4OONA 3LGJA 4DUYQ 2OWOA 3M7NA 3CC7A 5GAGC 4RG1A 3K80C 2MFIA 4NPSA 5LMNL 3S16H 1Q7YC 2WB1G 1P8LA 2K75A 4LFAL 3TS2A 2XTIA 3GTGH 1IZ6A 3G4SA 1TWCH 4PZ6A 4OWWB 1HR0L 4BY7G 3RLOA 4QGUA 3AQQA 3RLNA 5M3FG 4HJ8A 1YHBA 4X64L 4JOIA 5GQOA 4X65L 1MKHA 3I4NG 2VQFL 2ZM6Q 4HJ7A 1X54A 2MQHA 3PUYA 2E5LQ 1HZAA 4JI5L 3S1QH 1TWGH 5M5WH 4X64Q 4A3BH 3KLWA 5FJ8G 1IXRA 1U5KA 1KC8C 4DR2Q 4GN4B 3PUVA 4AQYL 1SLJA 1L1OA 2PQAB 2MNAA 1I6HH 4A3EG 1Q46A 4R4QA 4IPDA 4C3JH 2ZJPA 2JA7H 4A3FH 2EXDA 4EQ5A 4DAMA 3T1HL 4JV5L 2IHEA 2QEXA 1QVFA 2JJQA 3EN2A 4OWTB 2UU9Q 1N36L 2FXQA 2V1CC 3E0EA 3CCVA 1G6PA 4DV4L 3CPFA 1IL2A 4APVA 1VQMA 1PV4A 4DV6L 4X62Q 1VQBA 4JI7L 3I7FA 4JI2Q 1EQRA 2RHQB 4DV5L 4IFDJ 3GTOH 2JEAI 1M1KC 1C7YA 4B3TL 4DAYB 3JAMc 2B29A 4JI8Q 1E24A 3CD6A 1E7ZA 1P16A 3A74A 3KYHC 2RHSB 1QZGA 3A0JA 3CAMA 1YEZA 2JA6G 1X56A 2CCZA 2N49A 1YIJA 5AJ3L 2OTLA 4YCVA 1HZ9A 3I2ZA 1YI2A 4KHZA 1N8RC 2UXCQ 4BA1I 1Y1VG 1MIUA 3W5OA 1PH6A 1Z9FA 4DR7L 4LFAQ 1LTLA 3HOZG 2GN5A 2BA0A 3KJOA 4LF4Q 1S72A 3PUWA 1N32Q 2NN6I 1X3EA 1YNXA 4DK6C 2A19A 1VQ8A 4A76A 4JBMA 5FLXc 1M90C 4R4IA 4K0KL 2JA5G 2B3GA 1Y1WG 2H5XA 2K5VA 4OWXB 4BY1H 4YHHL 4OO1G 4FDBA 1PFSA 1WFQA 1JB7A 3DLLA 4B3MQ 4X62L 1RIPA 2VQEL 1FGUA 2JK8A 4DV0Q 1V9PA 4C2MH 1YJWA 1JJGA 3RR5A 4DR3L 2NVXH 4HIDA 4JI0L 2UUAL 4QIWE 3H0GG 4GKJQ 1HH2P 5IYCG 4A3LH 5JJLA 3WWVA 4KI0A 2K4KA 4L5SA 4IO9A 2ZTCA 3RN2A 4YY3L 4LF8Q 4UP9A 4LF6L 1UE7A 1K8GA 1GO3E 3J7ZC 4HJ5A 3F2BA 2B63H 1T9HA 3U4ZA 3M4PA 1FL0A 1TWHH 4GOPB 3T1YL 1SRUA 2F3IA 3DM3A 4A3EH 2K50A 2Z6KC 4JI5Q 2F4VL 4QJFA 1KHIA 2K14A 4JI1Q 1YJ9A 1PH2A 1HNXQ 4IJLA 1AH9A 1JE5A 4A3FG 1EIFA 4DR4Q 5JEAJ 1YBYA 4YCWA 4R4CA 2KENA 2PNHA 2HHHL 1L1OB 2PQAA 3TEHB 4LFCQ 2NVQH 3E9IA 1GVPA 4IJHA 2Q2TA 5E7NA 1DGSA 1KQSA 3PCOB 4X66Q 2NZHA 1HR0Q 2PI2E 2YTVA 4JI4Q 1QVCA 4IFDG 3UDXA 1J5EL 1FJGQ 3FP9A 4GN3B 1NTGA 2JE6I 4POFA 5HGQA 3D31A 3CXCA 3S15H 4A75A 3ER0A 2EIFA 4YY3Q 5M3MH 2BH8A 4LF8L 1WCMH 1IYJB 1I94L 5C3EG 2DUDA 1O7IA 2Q2IA 4PZ8A 5IP7H 3J80i 4DK3C 1QZHA 4B3SQ 2RCNA 2KCTA 4LF5Q 4LW1A 2R92H 1VQAA 3D0FA 4DR5L 4LF5L 1VQHA 3ULPA 4OXPA 4UY8C 2QGQA 4JI1L 1GKHA 1K9MC 2LSSA 1EIYB 2A8VA 4O0AA 3AFQA 3RLFA 3TRZA 1UE5A 1VQEA 3AFPA 3AYHB 4DUZL 1KD1C 1LUZA 5IP9H 4JI7Q 3AEVA 3PIPA 2UUCQ 3UDGA 3G6EA 1R9TH 1YHAA 2HIXA 4BY1G 4DV4Q 1X55A 2JA5H 2OCEA 4DV2Q 4P71A 4JBKA 3PGZA 1XPUA 2YTXA 1SROA 3BZKA 1HR0W 4KLKA 1D8LA 3S17H 3KF6A 1EWIA 4AH6A 4R4TA 3H0GH 3H3VI 5ELNA 5IYCH 3CMAA 2E2JH 2DGYA 3H3VH 1Q1EA 4B3RQ 3UDFA 1W2BA 4PZ7A 3A5UA 1PVOA 4GLXA 2YTYA 3A5ZB 4BXXH 3MXNB 1XNRQ 1VQCA 2BA1A 1IBLL 1AE3A 1CKNB 2F4VQ 4LF7Q 4GKKQ 1BKBA 1E1OA 1K83H 4LF4L 1VQLA 3EBEA 3HOYG 1JJCB 3TREA 4Y52H 1HZCA 2AWOA 1IBKQ 2UXCL 2WFWA 3NELA 4A3KG 2KBNA 4A3CG 3Q8DA 1N9WA 3PIOA 5IT9c 3CQZH 3I4MH 5FLMH 4AYBG 3PO2H 4GLVB 3L2PA 4JI6L 1NE3A 3PUZA 1VQPA 4DR3Q 4LF9L 3S1NH 1QUQB 5IY0A 3PO3G 3L0OA 3ERSX 3GTPH 3GTMH 1A0IA 2Z6KA 4LUZA 4IFDI 4TQUS 2VQEQ 4YWMA 1K8AC 1X6OA 3CCEA 2ES2A 3UE0A 2R7FA 5C0XJ 3G71A 1E1TA 2N8NA 2EQSA 2Y0SG 3S14H 5C4XG 4PMWA 2VUMG 2XGTA 2CKZB 3OYYA 2WAQG 1OXXK 1Z47A 1WCMG 2KHIA 3K81C 3L7ZC 1PHJA 2UUBQ 2R93H 1GD7A 2D0OA 2PI2A 3OTOQ 3GTKH 3J80c 2L15A 1Y14B 2A1AA 3J81i 1SFOH 2AMCB 4JI0Q 5C44H 1TWFH 2I5MX 1HNWQ 3CMEA 3GO5A 4IOAA 3B6YA 4GNXB 3GTLH 4LF6Q 4K0KQ 4JOIC 3PV0A 4A3MG 4DR2L 4GOPC 4UP8A 4JI3Q 1N34Q 4XIGS 3HOVG 5DLQE 1I50H 1EQQA 5LMUQ 3FHWA 3GTJH 1IBMQ 4JI3L 5JJKA 2ALYB 3HOWG 2YU9H 4LNQA 3S2HH 3GD7A 1S40A 1L1OC 1VQJA 3U4VA 3CPWA 3T1HQ 4JV5Q 1I3QH 3I4NH 3PF4A 4DV7Q 3CCRA 4DR1Q 2NZOA 4UPAA 3S24A 4R1JA 5J3BA 4JYAL 5IYBH 1CKMA 3HOXH 3PF5A 5FJ8H 1D7QA 1QUQA 1MJEA 1E3PA 2YV5A 5LMNQ 1Q81C 1PYSB 4IOCA 1B7YB 1CSPA 1BVSA 2AHOB 4A3IH 1IBLQ 1V43A 2E8GA 4HIOA 2IX0A 4A3CH 3KFUA 1VQ4A 5H1SE 2GVBA 4DV0L 1VQGA 4A3GH 3IRBA 4JC0A 5FLMG 2JA8G 1UE6A 4LFCL 2HHHQ 1MJCA 4R4OA 2VW9A 2VL6A 4X6AH 1HNXL 1XPOA 1CSQA 2JQOA 2PMZE 3CW2C 2VY3A 3K8AA 5GROA 4UP7A 1YITA 2IT1A 3NBHB 1VCIA 2VZAA 4BBSG 2IX1A 2Q2HA 1HNZQ 3CCMA 2WB1E 3UE1A 1XNQL 2MO0A 1YJNA 1VQ5A 3TQYA 3J81c 4DR1L 3RZOH 5GAEC 3EIVA 3RZDH 1TWAH 1U0LA 1BBWA 3MEFA 2ZM6L 1OXUA 4A3JH 4DR5Q 4B3ML 3S2DH 3M4QA 1JJ2A 4J15A 1XMOQ 2HQLA 4NXNQ 4GS3A 3K7UC 2K52A 5C44G 1YHQA 1Y1VH 2IY5B 5JEAG 4AQYQ 1CKOA 3CCQA 3HOZH 3KF6B 1VQIA 3RN5A 3BU2A 2LXKA 4DV5Q 5HY6A 1I5FA 3CC4A 4A3MH 3HOVH 1Y1WH 1G51A 2OQKA 1XMQQ 2HIVA 1GM5A 5IWAQ 1WOCA 1NMFA 4GLAC 2LXJA 1I94Q 3S1MH 4NXML 2VS1A 5GADC 3CCJA 3HOWH 4DV1Q 3TS0A 3M3YH 5BR8Q 4LFBQ 1PH5A 4DR6Q 3HFZB 2N3SA 2ASBA 1NMGA 2R7DA 2E2IH 3U50C 1C0AA 1KAWA 1PH1A 1BBUA 5IYBG 5JJIA 3T1YQ 1H95A 4JBJA 4AYBE 1EFWA 4BA2I 1V1QA 4DR6L 3UDIA 3S1RH 4DV3Q 2JA6H 3CCSA 1KRTA 4IPCA 4MTNA 2NN6G 4IPHA 2OTJA 4P73A 4OX9L 3I4OA 4DR4L 4TVAB 1OXVA 5AJ3Q 2NVTH 4A3GG 3BZCA 4DV2L 1TXYA 1N36Q 2BH2A 2JA8H 1PH7A 5C4JH 3STBD 3OTOL 1LYLA 1X3GA 3J7A5 1XMQL 4JI4L 2OQ0A 4ME3A 3F1ZA 4X66L 1NJIC 1EYGA 1Q86C 2I5HA 1VQNA 2GVAA 1HJPA 4LF7L 3ULLA 1PYBA 1YZ6A 5IYDG 4B3TQ 4QY7A 1Q8KA 1B70B 4BBSH 4NB3A 4C3IH 4A3LG 1VQ7A 2UUAQ 4H02A 2D62A 4DR7Q 3KJPA 4B3SL 1A8VA 1N34L 3HKSA 4X65Q 4A93G 1OTCA 5IP7G 2R7ZG 2K5HA 4QQBX 1A63A 4A3JG 2KHJA 2Z0SA 1PH8A 2IHFA 4L5TA 2B63G 1Q82C 4IPGA 2QA4A 1N33Q 1J6QA 1K73C 1NY4A 3PO2G 2ZJRA 5ELOA 3FKIH 4P74A 1OXSC 3J81j 1A62A 3M4OH 4DUZQ 1KRSA 1J5EQ 1FJGL 2ATWA 1EOVA 3BJUA 5IP9G 1N33L 2C35B 4NXMQ 2VNUD 2CWPA 1VQ6A 1ASZA 1UWVA 4JG2A 2ZTEA 4GNXA 5M5YH 4ALPA 2UXDQ 3M9BA 3CCLA 3G48A 3CCUA 3GDEA 3K7AH 4C3HH 4DPGA 3RNUA 1SN8A 1KIXA 4JI8L 4A3DH 4GKKL 1XPRA 4P72A 1PA6A 1L0WA 2JEBI 1SR3A 3GTQH 5K36G 3W1GA 2AKWB 3KDFB 1PH3A 4KHPL 4LWCA 2UXBL 3PSIA 4YWLA 1HNWL 1XTDA 3NENA 5M3MG 3H15A 4DV1L 3CP0A 4BXXG 4DNIA 5LMNW 5C3EH 1X9NA 1JMCA 4LFBL 4L5QA 3W1BA 4BBRG 3ULJA 3HOYH 4L5RC 2NVYH 3ZJYC 2JA9A 1LM0A 2R92G 3HKZE 3KDFA 2ID0A 3HOUG 4A3KH 1JT8A 2E2HH 2ZJQA 2CQOA 1VQ9A 5GAHC 1S3OA 1X3FA 5LMUL 4HIKA 2R6GA 4HJAA 4MNOA 3I4MG 4DV3L 4OO1I 1X65A 1IBML 1C9OA 4DKAC 1OXTA 1B8AA 3F8TA 4YHHQ 4GNXC 1EUJA 4QL5A 2Y0SE 2YYZA 2UXBQ 4JBWA 2I0QA 4NXNL 3HKZG 1XNRL 3I55A 4Y7NH 1UE1A 4YCUA 5C0XI 1G291 2MO1A 4DV6Q 2VQFQ 1XJVA 1VQKA 4BY7H 4HJ9A 5IYDH 1Q12A 3PUXA 2UU9L 4POGA 1KL9A 5M3FH 5BR8L 4PG3A 1VS0A 4LUOA 5EAYA 2AWNA 4RMFA 4EX5A 4GOPA 1QVGA 4LUVA 2N78A 1E22A 1YVCA 3KOJA 4A93H 2WAQE 1HNZL 1WYDA 2R7ZH 5IWAL 1XNQQ 1WJJA 4A3BG 5IE8A 1NBWA 1ASYA 2KCMA 2D0PA 4JYAQ 3VDYA 1CUKA 1AE2A 1KXLA 3FKIG 5M5XH 2HT1A 2JA7G 2F52A 3CF5A 4DUYL 4WJ3M 1XMOL 1VQOA 2UXDL 1SE8A 3KF8B 1K0RA 3NEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZTD A;  1N32 L;  1CKN A;  1L2F A;  2WP8 J;  4B3R L;  3SGI A;  1VQF A;  2K5N A;  3I56 A;  3F2D A;  1K3R A;  4JCV E;  4YWK A;  3PO3 H;  1UEB A;  3ICE A;  4LF9 Q;  4A4I A;  2CFM A;  2CWA A;  4OX9 Q;  4P75 A;  2I5L X;  4A3D G;  5C0X G;  3K0X A;  4XTC S;  1IBK L;  4HIM A;  1FVI A;  3F2C A;  4DV7 L;  5C4X H;  4AIM A;  2UUC L;  4O2D A;  1VQD A;  1W3S A;  1RL2 A;  4GN5 A;  2VUM H;  1PH9 A;  4MZ9 A;  2Q2U A;  3OW2 A;  4JI2 L;  3HOX G;  2E5L L;  2R93 G;  3CC2 A;  4KHP Q;  1WI5 A;  3M85 A;  1PH4 A;  4BBR H;  3JAM i;  4GKJ L;  4WJ4 A;  3HOU H;  2UUB L;  1HZB A;  3U58 A;  4A3I G;  3E9H A;  1SMX A;  3STB C;  4JI6 Q;  2RF4 A;  3JC6 6;  1Q1B A;  4OON A;  3LGJ A;  4DUY Q;  2OWO A;  3M7N A;  3CC7 A;  5GAG C;  4RG1 A;  3K80 C;  2MFI A;  4NPS A;  5LMN L;  3S16 H;  1Q7Y C;  2WB1 G;  1P8L A;  2K75 A;  4LFA L;  3TS2 A;  2XTI A;  3GTG H;  1IZ6 A;  3G4S A;  1TWC H;  4PZ6 A;  4OWW B;  1HR0 L;  4BY7 G;  3RLO A;  4QGU A;  3AQQ A;  3RLN A;  5M3F G;  4HJ8 A;  1YHB A;  4X64 L;  4JOI A;  5GQO A;  4X65 L;  1MKH A;  3I4N G;  2VQF L;  2ZM6 Q;  4HJ7 A;  1X54 A;  2MQH A;  3PUY A;  2E5L Q;  1HZA A;  4JI5 L;  3S1Q H;  1TWG H;  5M5W H;  4X64 Q;  4A3B H;  3KLW A;  5FJ8 G;  1IXR A;  1U5K A;  1KC8 C;  4DR2 Q;  4GN4 B;  3PUV A;  4AQY L;  1SLJ A;  1L1O A;  2PQA B;  2MNA A;  1I6H H;  4A3E G;  1Q46 A;  4R4Q A;  4IPD A;  4C3J H;  2ZJP A;  2JA7 H;  4A3F H;  2EXD A;  4EQ5 A;  4DAM A;  3T1H L;  4JV5 L;  2IHE A;  2QEX A;  1QVF A;  2JJQ A;  3EN2 A;  4OWT B;  2UU9 Q;  1N36 L;  2FXQ A;  2V1C C;  3E0E A;  3CCV A;  1G6P A;  4DV4 L;  3CPF A;  1IL2 A;  4APV A;  1VQM A;  1PV4 A;  4DV6 L;  4X62 Q;  1VQB A;  4JI7 L;  3I7F A;  4JI2 Q;  1EQR A;  2RHQ B;  4DV5 L;  4IFD J;  3GTO H;  2JEA I;  1M1K C;  1C7Y A;  4B3T L;  4DAY B;  3JAM c;  2B29 A;  4JI8 Q;  1E24 A;  3CD6 A;  1E7Z A;  1P16 A;  3A74 A;  3KYH C;  2RHS B;  1QZG A;  3A0J A;  3CAM A;  1YEZ A;  2JA6 G;  1X56 A;  2CCZ A;  2N49 A;  1YIJ A;  5AJ3 L;  2OTL A;  4YCV A;  1HZ9 A;  3I2Z A;  1YI2 A;  4KHZ A;  1N8R C;  2UXC Q;  4BA1 I;  1Y1V G;  1MIU A;  3W5O A;  1PH6 A;  1Z9F A;  4DR7 L;  4LFA Q;  1LTL A;  3HOZ G;  2GN5 A;  2BA0 A;  3KJO A;  4LF4 Q;  1S72 A;  3PUW A;  1N32 Q;  2NN6 I;  1X3E A;  1YNX A;  4DK6 C;  2A19 A;  1VQ8 A;  4A76 A;  4JBM A;  5FLX c;  1M90 C;  4R4I A;  4K0K L;  2JA5 G;  2B3G A;  1Y1W G;  2H5X A;  2K5V A;  4OWX B;  4BY1 H;  4YHH L;  4OO1 G;  4FDB A;  1PFS A;  1WFQ A;  1JB7 A;  3DLL A;  4B3M Q;  4X62 L;  1RIP A;  2VQE L;  1FGU A;  2JK8 A;  4DV0 Q;  1V9P A;  4C2M H;  1YJW A;  1JJG A;  3RR5 A;  4DR3 L;  2NVX H;  4HID A;  4JI0 L;  2UUA L;  4QIW E;  3H0G G;  4GKJ Q;  1HH2 P;  5IYC G;  4A3L H;  5JJL A;  3WWV A;  4KI0 A;  2K4K A;  4L5S A;  4IO9 A;  2ZTC A;  3RN2 A;  4YY3 L;  4LF8 Q;  4UP9 A;  4LF6 L;  1UE7 A;  1K8G A;  1GO3 E;  3J7Z C;  4HJ5 A;  3F2B A;  2B63 H;  1T9H A;  3U4Z A;  3M4P A;  1FL0 A;  1TWH H;  4GOP B;  3T1Y L;  1SRU A;  2F3I A;  3DM3 A;  4A3E H;  2K50 A;  2Z6K C;  4JI5 Q;  2F4V L;  4QJF A;  1KHI A;  2K14 A;  4JI1 Q;  1YJ9 A;  1PH2 A;  1HNX Q;  4IJL A;  1AH9 A;  1JE5 A;  4A3F G;  1EIF A;  4DR4 Q;  5JEA J;  1YBY A;  4YCW A;  4R4C A;  2KEN A;  2PNH A;  2HHH L;  1L1O B;  2PQA A;  3TEH B;  4LFC Q;  2NVQ H;  3E9I A;  1GVP A;  4IJH A;  2Q2T A;  5E7N A;  1DGS A;  1KQS A;  3PCO B;  4X66 Q;  2NZH A;  1HR0 Q;  2PI2 E;  2YTV A;  4JI4 Q;  1QVC A;  4IFD G;  3UDX A;  1J5E L;  1FJG Q;  3FP9 A;  4GN3 B;  1NTG A;  2JE6 I;  4POF A;  5HGQ A;  3D31 A;  3CXC A;  3S15 H;  4A75 A;  3ER0 A;  2EIF A;  4YY3 Q;  5M3M H;  2BH8 A;  4LF8 L;  1WCM H;  1IYJ B;  1I94 L;  5C3E G;  2DUD A;  1O7I A;  2Q2I A;  4PZ8 A;  5IP7 H;  3J80 i;  4DK3 C;  1QZH A;  4B3S Q;  2RCN A;  2KCT A;  4LF5 Q;  4LW1 A;  2R92 H;  1VQA A;  3D0F A;  4DR5 L;  4LF5 L;  1VQH A;  3ULP A;  4OXP A;  4UY8 C;  2QGQ A;  4JI1 L;  1GKH A;  1K9M C;  2LSS A;  1EIY B;  2A8V A;  4O0A A;  3AFQ A;  3RLF A;  3TRZ A;  1UE5 A;  1VQE A;  3AFP A;  3AYH B;  4DUZ L;  1KD1 C;  1LUZ A;  5IP9 H;  4JI7 Q;  3AEV A;  3PIP A;  2UUC Q;  3UDG A;  3G6E A;  1R9T H;  1YHA A;  2HIX A;  4BY1 G;  4DV4 Q;  1X55 A;  2JA5 H;  2OCE A;  4DV2 Q;  4P71 A;  4JBK A;  3PGZ A;  1XPU A;  2YTX A;  1SRO A;  3BZK A;  1HR0 W;  4KLK A;  1D8L A;  3S17 H;  3KF6 A;  1EWI A;  4AH6 A;  4R4T A;  3H0G H;  3H3V I;  5ELN A;  5IYC H;  3CMA A;  2E2J H;  2DGY A;  3H3V H;  1Q1E A;  4B3R Q;  3UDF A;  1W2B A;  4PZ7 A;  3A5U A;  1PVO A;  4GLX A;  2YTY A;  3A5Z B;  4BXX H;  3MXN B;  1XNR Q;  1VQC A;  2BA1 A;  1IBL L;  1AE3 A;  1CKN B;  2F4V Q;  4LF7 Q;  4GKK Q;  1BKB A;  1E1O A;  1K83 H;  4LF4 L;  1VQL A;  3EBE A;  3HOY G;  1JJC B;  3TRE A;  4Y52 H;  1HZC A;  2AWO A;  1IBK Q;  2UXC L;  2WFW A;  3NEL A;  4A3K G;  2KBN A;  4A3C G;  3Q8D A;  1N9W A;  3PIO A;  5IT9 c;  3CQZ H;  3I4M H;  5FLM H;  4AYB G;  3PO2 H;  4GLV B;  3L2P A;  4JI6 L;  1NE3 A;  3PUZ A;  1VQP A;  4DR3 Q;  4LF9 L;  3S1N H;  1QUQ B;  5IY0 A;  3PO3 G;  3L0O A;  3ERS X;  3GTP H;  3GTM H;  1A0I A;  2Z6K A;  4LUZ A;  4IFD I;  4TQU S;  2VQE Q;  4YWM A;  1K8A C;  1X6O A;  3CCE A;  2ES2 A;  3UE0 A;  2R7F A;  5C0X J;  3G71 A;  1E1T A;  2N8N A;  2EQS A;  2Y0S G;  3S14 H;  5C4X G;  4PMW A;  2VUM G;  2XGT A;  2CKZ B;  3OYY A;  2WAQ G;  1OXX K;  1Z47 A;  1WCM G;  2KHI A;  3K81 C;  3L7Z C;  1PHJ A;  2UUB Q;  2R93 H;  1GD7 A;  2D0O A;  2PI2 A;  3OTO Q;  3GTK H;  3J80 c;  2L15 A;  1Y14 B;  2A1A A;  3J81 i;  1SFO H;  2AMC B;  4JI0 Q;  5C44 H;  1TWF H;  2I5M X;  1HNW Q;  3CME A;  3GO5 A;  4IOA A;  3B6Y A;  4GNX B;  3GTL H;  4LF6 Q;  4K0K Q;  4JOI C;  3PV0 A;  4A3M G;  4DR2 L;  4GOP C;  4UP8 A;  4JI3 Q;  1N34 Q;  4XIG S;  3HOV G;  5DLQ E;  1I50 H;  1EQQ A;  5LMU Q;  3FHW A;  3GTJ H;  1IBM Q;  4JI3 L;  5JJK A;  2ALY B;  3HOW G;  2YU9 H;  4LNQ A;  3S2H H;  3GD7 A;  1S40 A;  1L1O C;  1VQJ A;  3U4V A;  3CPW A;  3T1H Q;  4JV5 Q;  1I3Q H;  3I4N H;  3PF4 A;  4DV7 Q;  3CCR A;  4DR1 Q;  2NZO A;  4UPA A;  3S24 A;  4R1J A;  5J3B A;  4JYA L;  5IYB H;  1CKM A;  3HOX H;  3PF5 A;  5FJ8 H;  1D7Q A;  1QUQ A;  1MJE A;  1E3P A;  2YV5 A;  5LMN Q;  1Q81 C;  1PYS B;  4IOC A;  1B7Y B;  1CSP A;  1BVS A;  2AHO B;  4A3I H;  1IBL Q;  1V43 A;  2E8G A;  4HIO A;  2IX0 A;  4A3C H;  3KFU A;  1VQ4 A;  5H1S E;  2GVB A;  4DV0 L;  1VQG A;  4A3G H;  3IRB A;  4JC0 A;  5FLM G;  2JA8 G;  1UE6 A;  4LFC L;  2HHH Q;  1MJC A;  4R4O A;  2VW9 A;  2VL6 A;  4X6A H;  1HNX L;  1XPO A;  1CSQ A;  2JQO A;  2PMZ E;  3CW2 C;  2VY3 A;  3K8A A;  5GRO A;  4UP7 A;  1YIT A;  2IT1 A;  3NBH B;  1VCI A;  2VZA A;  4BBS G;  2IX1 A;  2Q2H A;  1HNZ Q;  3CCM A;  2WB1 E;  3UE1 A;  1XNQ L;  2MO0 A;  1YJN A;  1VQ5 A;  3TQY A;  3J81 c;  4DR1 L;  3RZO H;  5GAE C;  3EIV A;  3RZD H;  1TWA H;  1U0L A;  1BBW A;  3MEF A;  2ZM6 L;  1OXU A;  4A3J H;  4DR5 Q;  4B3M L;  3S2D H;  3M4Q A;  1JJ2 A;  4J15 A;  1XMO Q;  2HQL A;  4NXN Q;  4GS3 A;  3K7U C;  2K52 A;  5C44 G;  1YHQ A;  1Y1V H;  2IY5 B;  5JEA G;  4AQY Q;  1CKO A;  3CCQ A;  3HOZ H;  3KF6 B;  1VQI A;  3RN5 A;  3BU2 A;  2LXK A;  4DV5 Q;  5HY6 A;  1I5F A;  3CC4 A;  4A3M H;  3HOV H;  1Y1W H;  1G51 A;  2OQK A;  1XMQ Q;  2HIV A;  1GM5 A;  5IWA Q;  1WOC A;  1NMF A;  4GLA C;  2LXJ A;  1I94 Q;  3S1M H;  4NXM L;  2VS1 A;  5GAD C;  3CCJ A;  3HOW H;  4DV1 Q;  3TS0 A;  3M3Y H;  5BR8 Q;  4LFB Q;  1PH5 A;  4DR6 Q;  3HFZ B;  2N3S A;  2ASB A;  1NMG A;  2R7D A;  2E2I H;  3U50 C;  1C0A A;  1KAW A;  1PH1 A;  1BBU A;  5IYB G;  5JJI A;  3T1Y Q;  1H95 A;  4JBJ A;  4AYB E;  1EFW A;  4BA2 I;  1V1Q A;  4DR6 L;  3UDI A;  3S1R H;  4DV3 Q;  2JA6 H;  3CCS A;  1KRT A;  4IPC A;  4MTN A;  2NN6 G;  4IPH A;  2OTJ A;  4P73 A;  4OX9 L;  3I4O A;  4DR4 L;  4TVA B;  1OXV A;  5AJ3 Q;  2NVT H;  4A3G G;  3BZC A;  4DV2 L;  1TXY A;  1N36 Q;  2BH2 A;  2JA8 H;  1PH7 A;  5C4J H;  3STB D;  3OTO L;  1LYL A;  1X3G A;  3J7A 5;  1XMQ L;  4JI4 L;  2OQ0 A;  4ME3 A;  3F1Z A;  4X66 L;  1NJI C;  1EYG A;  1Q86 C;  2I5H A;  1VQN A;  2GVA A;  1HJP A;  4LF7 L;  3ULL A;  1PYB A;  1YZ6 A;  5IYD G;  4B3T Q;  4QY7 A;  1Q8K A;  1B70 B;  4BBS H;  4NB3 A;  4C3I H;  4A3L G;  1VQ7 A;  2UUA Q;  4H02 A;  2D62 A;  4DR7 Q;  3KJP A;  4B3S L;  1A8V A;  1N34 L;  3HKS A;  4X65 Q;  4A93 G;  1OTC A;  5IP7 G;  2R7Z G;  2K5H A;  4QQB X;  1A63 A;  4A3J G;  2KHJ A;  2Z0S A;  1PH8 A;  2IHF A;  4L5T A;  2B63 G;  1Q82 C;  4IPG A;  2QA4 A;  1N33 Q;  1J6Q A;  1K73 C;  1NY4 A;  3PO2 G;  2ZJR A;  5ELO A;  3FKI H;  4P74 A;  1OXS C;  3J81 j;  1A62 A;  3M4O H;  4DUZ Q;  1KRS A;  1J5E Q;  1FJG L;  2ATW A;  1EOV A;  3BJU A;  5IP9 G;  1N33 L;  2C35 B;  4NXM Q;  2VNU D;  2CWP A;  1VQ6 A;  1ASZ A;  1UWV A;  4JG2 A;  2ZTE A;  4GNX A;  5M5Y H;  4ALP A;  2UXD Q;  3M9B A;  3CCL A;  3G48 A;  3CCU A;  3GDE A;  3K7A H;  4C3H H;  4DPG A;  3RNU A;  1SN8 A;  1KIX A;  4JI8 L;  4A3D H;  4GKK L;  1XPR A;  4P72 A;  1PA6 A;  1L0W A;  2JEB I;  1SR3 A;  3GTQ H;  5K36 G;  3W1G A;  2AKW B;  3KDF B;  1PH3 A;  4KHP L;  4LWC A;  2UXB L;  3PSI A;  4YWL A;  1HNW L;  1XTD A;  3NEN A;  5M3M G;  3H15 A;  4DV1 L;  3CP0 A;  4BXX G;  4DNI A;  5LMN W;  5C3E H;  1X9N A;  1JMC A;  4LFB L;  4L5Q A;  3W1B A;  4BBR G;  3ULJ A;  3HOY H;  4L5R C;  2NVY H;  3ZJY C;  2JA9 A;  1LM0 A;  2R92 G;  3HKZ E;  3KDF A;  2ID0 A;  3HOU G;  4A3K H;  1JT8 A;  2E2H H;  2ZJQ A;  2CQO A;  1VQ9 A;  5GAH C;  1S3O A;  1X3F A;  5LMU L;  4HIK A;  2R6G A;  4HJA A;  4MNO A;  3I4M G;  4DV3 L;  4OO1 I;  1X65 A;  1IBM L;  1C9O A;  4DKA C;  1OXT A;  1B8A A;  3F8T A;  4YHH Q;  4GNX C;  1EUJ A;  4QL5 A;  2Y0S E;  2YYZ A;  2UXB Q;  4JBW A;  2I0Q A;  4NXN L;  3HKZ G;  1XNR L;  3I55 A;  4Y7N H;  1UE1 A;  4YCU A;  5C0X I;  1G29 1;  2MO1 A;  4DV6 Q;  2VQF Q;  1XJV A;  1VQK A;  4BY7 H;  4HJ9 A;  5IYD H;  1Q12 A;  3PUX A;  2UU9 L;  4POG A;  1KL9 A;  5M3F H;  5BR8 L;  4PG3 A;  1VS0 A;  4LUO A;  5EAY A;  2AWN A;  4RMF A;  4EX5 A;  4GOP A;  1QVG A;  4LUV A;  2N78 A;  1E22 A;  1YVC A;  3KOJ A;  4A93 H;  2WAQ E;  1HNZ L;  1WYD A;  2R7Z H;  5IWA L;  1XNQ Q;  1WJJ A;  4A3B G;  5IE8 A;  1NBW A;  1ASY A;  2KCM A;  2D0P A;  4JYA Q;  3VDY A;  1CUK A;  1AE2 A;  1KXL A;  3FKI G;  5M5X H;  2HT1 A;  2JA7 G;  2F52 A;  3CF5 A;  4DUY L;  4WJ3 M;  1XMO L;  1VQO A;  2UXD L;  1SE8 A;  3KF8 B;  1K0R A;  3NEM A; 
#chains in the Genus database with same CATH topology
 3TP7 A;  4B3R L;  2MGS A;  2PZU A;  3SGI A;  1SE3 A;  3F2D A;  1EYD A;  3ICE A;  4LF9 Q;  3BVG A;  4A4I A;  2J7Z A;  4A3D G;  2QDB A;  2F0L A;  1GUG A;  1FVI A;  3F2C A;  4GN5 A;  2C5C A;  2VUM H;  1PH9 A;  2FJ2 A;  4A3M B;  2E5L L;  3CC2 A;  1WI5 A;  2WKC A;  5G3L F;  4GKJ L;  1Y8N B;  4A3I G;  4FP5 D;  5EKK A;  4JI6 Q;  1Q1B A;  5IGE A;  4DUY Q;  1ZYR D;  4XQJ A;  4RG1 A;  1ZXT A;  2E2I B;  4CJ2 C;  5IIF A;  3EVQ A;  2O4X A;  3EQL C;  2F3V A;  1I4R A;  3WDN A;  1AN8 A;  4RHR A;  1HUM A;  3VR3 A;  1SYD A;  1MKH A;  3I4N G;  1BNZ A;  3NQI A;  2ZM6 Q;  3K6O A;  3IFD A;  2E5L Q;  3S1Q H;  3S16 B;  5M5W H;  2RVL A;  1KC8 C;  4DR2 Q;  1GUW A;  1SLJ A;  2PQA B;  5KNC A;  1I6H H;  5LL6 X;  4R4Q A;  4IPD A;  5NUC A;  2K04 A;  1STB A;  2B2U A;  2VB2 X;  1N36 L;  1A6X A;  3CCV A;  1EY0 A;  2CQA A;  4DV4 L;  4PV1 C;  3X3M A;  1U4R A;  1EQT A;  1VQB A;  2NB0 A;  5C44 B;  3GTO H;  4DN4 M;  2RDH A;  3JAM c;  1D1K A;  2MPM A;  1E24 A;  5D65 A;  2E74 C;  3A74 A;  3KYH C;  4XXE A;  2K5Q A;  1E2W A;  2KUM A;  2OTL A;  4YCV A;  1NCV A;  2NVX B;  1PRT D;  1PFB A;  1Z9F A;  3NTI A;  1H9S B;  3KJO A;  1S72 A;  4KN7 C;  2F0V A;  2D9U A;  2B3G A;  2H5X A;  3NXW A;  4YHH L;  4V0B A;  4FDB A;  4OO1 G;  3I4L A;  3VA5 A;  1IW7 D;  2UUA L;  4QIW E;  5JJL A;  1KDA A;  4GKJ Q;  2E2D C;  4G57 A;  4L5S A;  3RN2 A;  4ILW A;  4YY3 L;  3J80 E;  4UP9 A;  3NUC A;  1BUV T;  2KCC A;  5J22 A;  1TWH H;  4A3E H;  5BN5 A;  4U68 A;  3PO2 H;  5IOD A;  2K14 A;  4JI1 Q;  4DR4 Q;  3SK4 A;  2KEN A;  2PQA A;  3NK9 A;  5E3F A;  4A3J B;  1GVP A;  4DAY A;  1LT4 D;  1QNU A;  5F2D A;  3KF8 A;  1KQS A;  5C4Z A;  3A8I E;  4X66 Q;  2NZH A;  1QVC A;  3UDX A;  1U4P A;  1NTG A;  5HGQ A;  1TR5 A;  3D31 A;  1STG A;  3CXC A;  3S15 H;  5CV8 A;  1CQV A;  4WJW A;  5M3M H;  1JOO A;  1O7I A;  5IP7 H;  4PZ8 A;  1QZH A;  1E2V A;  1GHJ A;  2R92 H;  4LW1 A;  1DD2 A;  3HP3 A;  4DR5 L;  4H13 C;  3ULP A;  2F3W A;  3VYT A;  1ZYR C;  1K9M C;  2TMP A;  3K58 A;  1LTR D;  4HMJ A;  4DUZ L;  1KD1 C;  5M3M B;  2PW5 A;  2UUC Q;  1TVX A;  1YHA A;  4WOR A;  1ILQ A;  2I46 A;  2R92 B;  1EY9 A;  3PGZ A;  1XPU A;  3BZK A;  4KKS A;  1HR0 W;  4KLK A;  3KF6 A;  1F2Z A;  4AH6 A;  3H0G H;  3H3V I;  3I4M B;  5K36 H;  3LWE A;  2SOB A;  4RGM A;  1PVO A;  2WV6 D;  2KHS A;  2YTY A;  3A5Z B;  3HZX A;  3T56 B;  1XNR Q;  1CKN B;  1BKB A;  3GTP B;  3EBE A;  4Y52 H;  1W6J A;  1TWC B;  3N52 A;  4A3C G;  4DNR B;  1N9W A;  3I4M H;  4F87 A;  1ET6 A;  4AYB G;  1ZEQ X;  4HTH A;  3S1N H;  3NE5 B;  1PDQ A;  1QUQ B;  1TWG B;  5CR3 A;  4QIW B;  1SFO B;  1A0I A;  4LUZ A;  5KIX A;  4TQU S;  2SEB D;  1SNM A;  3CCE A;  4IFD H;  3UE0 A;  2Z8L A;  4CGY B;  5I2X A;  5C0X J;  3FKI B;  4C3J B;  1E1T A;  2Y0S G;  2B2V C;  2EJF C;  2B8F A;  3DEP A;  4X3T A;  3L7Z C;  2D0O A;  3OTO Q;  3J80 c;  2L15 A;  4RGN A;  3QIA A;  1Y14 B;  3HG9 A;  1DXM A;  1TWF H;  1II3 A;  4N8F A;  4F8M A;  4IOA A;  3R2I A;  4GNX B;  4LF6 Q;  5I9P A;  1U4L A;  4HR7 B;  4JI3 Q;  4GOP C;  4UP8 A;  5DLQ E;  3L3O C;  2ALY B;  3S2H H;  4JV5 Q;  1IYU A;  3MXU A;  4DR1 Q;  1HA6 A;  3SXH A;  4UPA A;  4X3U A;  3PIO 3;  3S24 A;  4R1J A;  5J3B A;  4JYA L;  5IYB H;  1B50 A;  1ZKO A;  3GV6 A;  2WB1 B;  2YV5 A;  1Q81 C;  1KDB A;  1PYS B;  3ONA B;  1B7Y B;  4BY7 B;  2EPB A;  4A3I H;  4RKL A;  5M3F B;  1KAB A;  3S2H B;  5FLM G;  1UE6 A;  4R4O A;  3S2D B;  1KLU D;  3UI2 A;  5GRO A;  1YIT A;  4A3E B;  1VCI A;  2VZA A;  1UNS A;  1PTO C;  1HNZ Q;  2WB1 E;  4C3I G;  1RCV D;  1YJN A;  1BCP B;  1EWC A;  3J81 c;  5GAE C;  3EIV A;  1PFM A;  4XT3 B;  1GUS A;  2F0E A;  5JOB A;  2PPB C;  3S2D H;  1BCP C;  3OWE B;  3S1M B;  1Q8I A;  2KEC A;  4GS3 A;  5C44 G;  3R3O A;  5I6Y A;  2AUJ D;  4ABN A;  3HOZ H;  1VQI A;  3RN5 A;  1IKM A;  1G2T A;  3VA7 A;  2K5D A;  2OEO A;  3V2T A;  3OW7 A;  4A3M H;  1Y1W H;  1G51 A;  1JOQ A;  2HIV A;  2KJX A;  2A6E D;  1CA5 A;  4GLA C;  4NXM L;  4JK1 C;  2K01 A;  2EDG A;  4NKL A;  4DR6 Q;  3HFZ B;  2ASB A;  1D1I A;  4ZYS A;  2JA5 B;  4BA2 I;  3MVV A;  3UDI A;  5JAV A;  3MC0 B;  2FHT A;  4IPC A;  4R9W A;  3H91 A;  4P73 A;  1IKL A;  3I4O A;  4DR4 L;  3H0G B;  5AJ3 Q;  1KDC A;  4DV2 L;  2JA8 H;  2BH2 A;  3T53 B;  1LYL A;  3BDO A;  3J7A 5;  1X32 A;  1TT2 A;  1AZQ A;  2IW3 A;  4ME3 A;  4IN3 A;  2B2W C;  4X66 L;  1EYG A;  1Q86 C;  1VQN A;  1HJP A;  3ULL A;  4BBS H;  3D4W A;  1Q8K A;  1B70 B;  3M4O B;  3P1H A;  1HRJ A;  5ELF A;  2ZT9 C;  1LTB D;  2B2U C;  1A8V A;  1B3A A;  2FIN B;  4KMU C;  1I4P A;  4V19 0;  1QG7 A;  5M5Y B;  1TS2 A;  1CFM A;  2QA4 A;  4EQN A;  4O42 A;  1Z6H A;  3PO2 G;  1STH A;  3FKI H;  2ATW A;  5IP9 G;  3VR5 A;  1PLF A;  2VNU D;  2CWP A;  1ASZ A;  1UWV A;  5C3E B;  3K59 A;  2RSN A;  4ZKC B;  3GTK B;  3QB3 A;  4GNX A;  2NVY B;  1SNO A;  3CCL A;  3GDE A;  3ND8 A;  3K7A H;  4C3H H;  4LMQ D;  4GKK L;  3H94 A;  2E2H B;  1XPR A;  1BCP D;  4K8J A;  4S3S A;  1BQQ T;  2BE5 C;  2AKW B;  3OWF A;  5CMD A;  3GTL B;  1HNW L;  3NEN A;  5M3M G;  4BXX G;  4DV1 L;  4DNI A;  5LMN W;  1JMC A;  1XWE A;  3HOY H;  2R92 G;  4HAE A;  1LM0 A;  3HOU G;  3HKZ E;  2ID0 A;  1TII D;  4A3K H;  3NBI A;  2E2H H;  2ZJQ A;  2CQO A;  3MXG A;  4EGV A;  1X3F A;  2R6G A;  4MNO A;  1RD9 D;  1C9O A;  1B8A A;  1ILP A;  1EUJ A;  5KGU A;  3J81 L;  3I55 A;  4Y7N H;  2QDL A;  2CW0 C;  2MO1 A;  4UAI A;  5IYD H;  4HJ9 A;  1KL9 A;  4J8Q A;  1S5C D;  1VS0 A;  3J7A F;  1JCK B;  4RMF A;  2N78 A;  3KOJ A;  1WYD A;  4QB4 A;  4A3B G;  2NYZ D;  2D0P A;  5CBE E;  1AE2 A;  2KEE A;  4C3J G;  5C5M A;  5CGK A;  4QF4 A;  1ICW A;  1K0R A;  2WKD A;  2Q8T A;  2WAQ B;  4NMZ A;  1CKN A;  1WCM B;  1L2F A;  2WP8 J;  3I56 A;  2K5N A;  5AFW A;  2PQE A;  3KBG A;  1K3R A;  4JCV E;  4FYD A;  2I07 B;  1PTO F;  4FXK C;  2QKI C;  4P75 A;  5C0X G;  1LT3 D;  4XTC S;  2CVR A;  4HIM A;  1SYE A;  4DV7 L;  2ENB A;  4NW2 A;  1VQD A;  1RL2 A;  1BCP F;  1JC7 A;  3OW2 A;  1EIG A;  3HOV B;  2HQE A;  3M85 A;  4CHT B;  4Q0F A;  1QIL A;  4WJ4 A;  2UUB L;  5CV5 A;  3T4A C;  3HOW B;  2RF4 A;  1X3P A;  3M7N A;  3IKJ A;  4KY6 A;  4FF1 A;  1G91 A;  5T1G A;  4NPS A;  5LMN L;  4CDD C;  1SNC A;  4CKC A;  2JYO A;  5FO9 B;  1F9S A;  2K75 A;  2L0C A;  2J4X A;  4OEM B;  4LFA L;  2XTI A;  3K5N A;  5K5P A;  1TWC H;  4BY7 G;  3DHQ A;  5EPL A;  1CM9 A;  4DK0 A;  4HJ8 A;  1YHB A;  2NVT B;  2F0U A;  2X6G A;  5GQO A;  1JWM D;  1R4P B;  4EVO A;  1GJX A;  4RCO A;  1C8C A;  1K8M A;  2MJ8 A;  4JI5 L;  1TWG H;  4X64 Q;  2KA7 A;  3TBI B;  3GTM B;  4KD4 A;  4AQY L;  5EJW A;  5D3D A;  5EBC A;  2K6A A;  5T1I A;  5FKA C;  5IOC A;  1Q46 A;  3OHX C;  2JA7 H;  4BBS B;  3TME A;  3S14 B;  5ELD A;  2F0G A;  4A3F H;  4JV5 L;  2HUG A;  2IHE A;  2JJQ A;  3EN2 A;  3KLR A;  1X3Q A;  2V1C C;  2RBM A;  3E0E A;  5LHY 1;  1G6P A;  5FOB B;  1PV4 A;  3FDT A;  1SBB B;  1B3Q A;  3I7F A;  1EQR A;  1S5F D;  4FNF A;  1LAC A;  1I4Q A;  5IGD A;  2EY1 A;  1M1K C;  1SEB D;  5CV4 A;  4B3T L;  1I6V C;  2A6H D;  2B29 A;  1P16 A;  3DWA A;  2RHS B;  1QZG A;  3CAM A;  4FO2 A;  1YEZ A;  2JA6 G;  4H44 C;  4KD3 A;  4MTK A;  3K0Y A;  5AJ3 L;  3LWU A;  1N8R C;  1YI2 A;  2PYK A;  1V1P A;  4BA1 I;  3W5O A;  3GTO B;  3HOZ G;  4LF4 Q;  1N32 Q;  2NN6 I;  1X3E A;  1YNX A;  5JPM C;  2XIW A;  1BDO A;  1TS5 A;  1BF4 A;  1Y1W G;  2JA5 G;  2K5V A;  3A54 A;  1A3T A;  1PFS A;  1JB7 A;  3DLL A;  3I70 A;  4X62 L;  4HID A;  3LX0 A;  4M1U B;  1WD1 A;  1HH2 P;  5IYC G;  5I6W A;  1JIC A;  4QUF A;  4KI0 A;  4IO9 A;  2ZTC A;  4TRD A;  1UE7 A;  4HJ5 A;  1IW7 C;  1T9H A;  1Y69 U;  1BXT A;  3DUZ A;  3MXP A;  1FL0 A;  4Y7N B;  3L9A X;  4RWS C;  4GOP B;  3T1Y L;  2Z6K C;  2NUC A;  1HNX Q;  3A56 A;  3BDL A;  3X3N A;  3VYS A;  1JE5 A;  4NDX A;  3S15 B;  1SSO A;  5JEA J;  1YBY A;  4YCW A;  3DWP A;  2CW0 D;  1SYG A;  2Q8I B;  3TEH B;  2NVQ H;  1O7Y A;  5E7N A;  1DJR D;  2L1B A;  3PCO B;  1HR0 Q;  1RF2 D;  1J5E L;  5M5X B;  2JE6 I;  1A3U A;  1GUT A;  3ER0 A;  2F0P A;  1EWH A;  3KLS A;  5CYU A;  1TS4 A;  2BH8 A;  2EJM A;  1IYJ B;  1I4H A;  3TP6 A;  3J80 i;  3GV3 A;  2RCN A;  4LF5 Q;  2B2Y A;  4OXP A;  1CZG A;  1F2M A;  1GKH A;  2B2W A;  2LSS A;  4O0A A;  4ZAI A;  1UE5 A;  5IP9 H;  4TKO B;  3UDG A;  1R9T H;  2HIX A;  2BOS A;  1KNA A;  4OO1 H;  2YTX A;  4C3H G;  3FEW X;  4R4T A;  5ELN A;  2KED A;  2RSO A;  1XYI A;  2DGY A;  4CKE A;  5A2Q E;  1Q1E A;  3E6Z X;  4GLX A;  4CDE C;  4BXX H;  3MXN B;  2UXB Q;  1PYW D;  1AE3 A;  2Z6B A;  1E1O A;  4DK1 A;  1K83 H;  4LF4 L;  3HKZ B;  3HOY G;  2F0N A;  1HZC A;  1IBK Q;  2NWG A;  2UXC L;  3NEL A;  4A3K G;  2DJF C;  4PNY A;  2EXZ A;  3Q8D A;  3CQZ H;  3HRZ C;  3K57 A;  4CKB A;  2PW7 A;  4GLV B;  2F0H A;  4TSS A;  1AEX A;  5G3L D;  1SAP A;  3KK7 A;  5IY0 A;  3L0O A;  4OL7 A;  1SNQ A;  2ES2 A;  4YWM A;  1K8A C;  3HGB A;  3BG3 A;  2JA7 B;  2H4O A;  2EQS A;  1RJT A;  5C4X G;  1NR2 A;  4PMW A;  2F0Q A;  3CHB D;  5KEE A;  2WAQ G;  3AMU A;  2KHI A;  4DGZ A;  1PHJ A;  2R93 H;  3GTK H;  1LTA D;  1Z7T A;  4K2L A;  4JI0 Q;  1HUN A;  5CBA E;  2RA4 A;  3GO5 A;  3CME A;  3GTL H;  4IUT A;  1GHK A;  3PV0 A;  2R93 B;  4DR2 L;  3HOV G;  4FXG C;  1N34 Q;  1C4Q A;  3I90 A;  1I50 H;  1EQQ A;  2G9D A;  2HCI A;  3URY A;  1PMR A;  3K5M A;  2XSC A;  4JI3 L;  5C0X H;  3HOW G;  3A8K E;  2YU9 H;  3C1F A;  2K05 A;  1S40 A;  1VQJ A;  3CPW A;  3PF4 A;  4KY7 A;  2EOT A;  1D7Q A;  1CKM A;  5FJ8 H;  5ISR A;  5LMN Q;  1FNU A;  2G5D A;  4K5V A;  4IUR A;  1RTN A;  1STN A;  1IBL Q;  2IX0 A;  4A3C H;  3KUP A;  2N55 A;  2GVB A;  1VQG A;  3WOF A;  4JC0 A;  2VW9 A;  4ZKB B;  1XPO A;  1CZW A;  2VY3 A;  3JAM L;  3K8A A;  1CT1 D;  2IX1 A;  1RKN A;  3UE1 A;  1XNQ L;  1E2Z A;  1K8O A;  3RZD H;  2ZM6 L;  1OXU A;  3VR2 A;  4A3J H;  3D8G A;  3FVQ A;  5IT9 L;  4J15 A;  2HQL A;  3K7U C;  1GXD C;  2K52 A;  4P2C B;  1YHQ A;  1SMY D;  1DM0 B;  3V05 A;  5JVH 3;  2LXK A;  1DYQ A;  1I5F A;  3Q0A A;  1MBY A;  1YNJ C;  3CC4 A;  1U4M A;  1VF5 C;  2F0S A;  1XMQ Q;  5IWA Q;  2JA6 B;  1NMF A;  4UDU C;  2CHB D;  1CK1 A;  1ICF B;  4JW0 A;  2VS1 A;  1STA A;  2EYJ A;  4DV1 Q;  3MHB A;  2O5J C;  2V4D A;  2N3S A;  1NMG A;  2R7D A;  2EVB A;  4Q5V A;  5IGF A;  2E2I H;  1KAW A;  1PH1 A;  1EEF D;  5IYB G;  1R9T B;  1H95 A;  4JBJ A;  1EFW A;  4QCL A;  1V1Q A;  1GUN A;  4DR6 L;  2JA6 H;  4ZK9 B;  1KRT A;  2OTJ A;  1OXV A;  2NVT H;  3SHL A;  2K28 A;  1TXY A;  1N36 Q;  1PH7 A;  5C4J H;  4RHS A;  3STB D;  5L37 A;  2LS0 1;  1X3G A;  1XMQ L;  2A68 D;  2LKV A;  2E75 C;  4LF7 L;  1V1P B;  3C46 A;  2F0T A;  1YZ6 A;  4HED A;  4C3I H;  2F0D A;  1SE4 A;  4A3F B;  2Q8R E;  2UUA Q;  1CTM A;  3KLS X;  3NSW A;  1DON A;  2D62 A;  1QJO A;  4DR7 Q;  4A93 G;  2JP1 A;  3HKS A;  2R7Z G;  3S1N B;  2IHF A;  1Q82 C;  4IPG A;  2ZXR A;  1G2S A;  5ELO A;  4ME5 A;  4HSP A;  2M2L A;  3QO2 A;  1EOV A;  4G4K A;  1VQ6 A;  3IAY A;  4ALP A;  2A6H C;  3E0J A;  3M9B A;  2AUK A;  4KK7 A;  4EQP A;  1BBX C;  3RNU A;  1SN8 A;  3W3A A;  2OXP A;  1HFG A;  3E5S A;  3W1G A;  4KHP L;  2RDF A;  3PSI A;  2QF7 A;  2PNR C;  1Y8O B;  1PZK D;  1TY2 A;  2L4N A;  4BBR G;  1SDF A;  3KDF A;  3NQT A;  3I3C A;  5GAH C;  4HJA A;  2M00 A;  4HIK A;  5IGG A;  4OO1 I;  4CBV A;  2B2Y C;  2YYZ A;  3BDC A;  2B2T C;  1XX8 A;  4RGO S;  4G7Z C;  3HOY B;  1UE1 A;  4YCU A;  1G29 1;  2VQF Q;  5E1F A;  1Q12 A;  1SJH D;  5M3F H;  4LUO A;  4FVM A;  2L11 A;  1QVG A;  2EY5 A;  1YVC A;  1WTV A;  2WAQ E;  3DMU A;  3MEH A;  1XNQ Q;  1WJJ A;  1ASY A;  2F0J A;  1B9N A;  4PQX A;  1TY0 A;  1F2Y A;  1M8A A;  3DXJ C;  3MFG A;  2CH4 W;  3FKI G;  2B39 A;  3DEO A;  2F52 A;  4XYO A;  3CF5 A;  4DUY L;  3GQB A;  4WJ3 M;  2VUM B;  2ZTD A;  1N32 L;  4B08 A;  4X3S A;  1W6K A;  4WFN 3;  2LFN A;  3ERO A;  4RA8 A;  1RHP A;  2CFM A;  3ND9 A;  1MSG A;  2I5L X;  2Z1C A;  3K0X A;  1IBK L;  3NTH A;  1CA6 A;  5C4X H;  4O2D A;  1B1Z A;  1W3S A;  4MZ9 A;  1NNX A;  5EPK A;  1T5E A;  4DAP A;  2F0K A;  2Q2U A;  4JI2 L;  3HOX G;  2R93 G;  1NSN S;  5LL6 S;  4J6H A;  3HOU H;  3T13 A;  3U58 A;  3S17 B;  2A69 C;  2F03 A;  5DNF A;  3HS0 C;  3STB C;  1UAP A;  3JC6 6;  3MTS A;  4OON A;  3LGJ A;  1WTO A;  3R93 A;  1WVL A;  4C1N K;  5KYI A;  2OWO A;  1VMP A;  2AQ3 B;  3OIP A;  3GP7 A;  3S16 H;  3S1Q B;  3SDZ A;  3TS2 A;  5J1Z A;  3J7Y W;  3G4S A;  1HR0 L;  3K5O A;  3RLO A;  3AQQ A;  4QGU A;  3RLN A;  5EKI A;  4X64 L;  4JOI A;  4WRD A;  5JPN C;  2JA8 B;  4DA2 A;  5M9O A;  2LY7 A;  4X65 L;  3AU7 A;  5C4J B;  4HJ7 A;  1A2T A;  1X54 A;  3PUY A;  1JE4 A;  1HQM C;  2O2L D;  4RKB A;  2BDN A;  2EYF A;  5HUR A;  1NAP A;  5FJ8 G;  4A3B H;  1B53 A;  1U5K A;  3VR4 A;  4GN4 B;  4ODG A;  1EZ6 A;  1QOH A;  4C3J H;  2ZJP A;  4C3I B;  4EQ5 A;  4DAM A;  3T1H L;  2UU9 Q;  2FXQ A;  1SXT A;  1VQM A;  4DV6 L;  1I6H B;  4DNT B;  4JI7 L;  3MFY A;  4JI2 Q;  2D2C C;  2RHQ B;  4IQZ A;  4IFD J;  5DAU A;  1G6Z A;  4DAY B;  2ZXO A;  1E7Z A;  4DFA A;  1MHW C;  4E6I A;  4JVZ A;  1PTO B;  1K3B C;  2CCZ A;  1YIJ A;  4J1M A;  1EL0 A;  1HZ9 A;  2UXC Q;  3I72 A;  1MIU A;  1PH6 A;  3GTQ B;  1LTL A;  4N9P A;  1PZI D;  3PUW A;  4X3K A;  2A19 A;  1ESF A;  4DK6 C;  1VQ8 A;  4JBM A;  5FLX c;  1M90 C;  4ZQ3 A;  4K0K L;  4BY1 H;  4F88 A;  4B3M Q;  1RIP A;  3OPO A;  1ENC A;  2JK8 A;  2VQE L;  4DV0 Q;  1YJW A;  1JJG A;  3RR5 A;  3QJY A;  2NVX H;  4A3L H;  4A3G B;  2HDM A;  5KYL A;  4ZUJ A;  1EY8 A;  4LF6 L;  1K8G A;  3J7Z C;  3M4P A;  3T16 A;  1ML0 D;  1SRU A;  3A55 A;  3DM3 A;  2K50 A;  4JI5 Q;  4RCN A;  4IJL A;  4NP5 A;  4A3F G;  2IL8 A;  2PNH A;  4A93 B;  4ZRZ A;  3OMG A;  1EIH A;  4HCE A;  4IJH A;  1DGS A;  4Z9C B;  1D5M C;  4YIJ A;  2PI2 E;  4JI4 Q;  2BDO A;  5ELE A;  2JN4 A;  3PO2 B;  1HQR D;  1FJG Q;  1O7L A;  1CQF A;  1GOZ A;  1AFP A;  4KKU A;  4LAA A;  1WTQ A;  4A75 A;  2EIF A;  2MP1 A;  4YY3 Q;  1ENF A;  1WCM H;  1VDZ A;  5C3E G;  2DUD A;  1I94 L;  2Q2I A;  4B3S Q;  2KCT A;  4IUN A;  1VQA A;  1LAB A;  2NZ1 D;  3D0F A;  1VQH A;  2JXM B;  4UY8 C;  2QGQ A;  2FFK B;  4JI1 L;  1EIY B;  2C9O A;  2A8V A;  3M3Y B;  1VMC A;  1VQE A;  3AYH B;  3AFP A;  4JI7 Q;  1R4Q B;  1WTW A;  5I9O A;  3PIP A;  3H6M A;  1A2U A;  2JA5 H;  1O80 A;  4BBR B;  3MXN A;  1WTX A;  4JBK A;  3S17 H;  1D8L A;  2PMZ B;  3D3R A;  2VB3 X;  5IYC H;  3LNN A;  3CMA A;  1HCZ A;  3NBH A;  1W2B A;  4PZ7 A;  2XRQ D;  1G8Z D;  1VQC A;  1IBL L;  4LF7 Q;  4IUV A;  1HHV A;  1VQL A;  1JJC B;  3QOL A;  2WFW A;  5EKL A;  2KBN A;  1FNW A;  3L2P A;  4JI6 L;  1NE3 A;  3IFT A;  3PUZ A;  3C3L A;  4G7O C;  4LF9 L;  4A3B B;  1EFI D;  3PO3 G;  5FLX E;  4ULL A;  1TQO A;  2R7F A;  5D3I B;  3G71 A;  4MHE A;  1KLG D;  1ET9 A;  2XGT A;  3OYY A;  2QCP X;  1Q90 A;  1I50 B;  2FMM A;  3I73 A;  4GZY C;  4BS9 A;  2AMC B;  4N8X 1;  2H1E A;  3TDQ A;  5IGB A;  2IWH A;  4JOI C;  5JVG 3;  3HOX B;  5KNB A;  3C1E A;  4K14 A;  4XIG S;  1PXU A;  3TP8 A;  2IX3 A;  5CV9 A;  5D14 A;  5LMU Q;  5TSS A;  3FHW A;  4A3I B;  3HEJ A;  1IBM Q;  1TWF B;  5JJK A;  1D6E C;  4LNQ A;  3GD7 A;  1L1O C;  4DV7 Q;  3ERQ A;  1AP0 A;  3PF5 A;  1PRT C;  3HOX H;  1QUQ A;  1E3P A;  3DM1 A;  4IOC A;  1CSP A;  2L12 A;  3SVM A;  1V43 A;  2NN6 H;  1JB3 A;  2E8G A;  4L63 B;  5FO8 B;  2EJG C;  2RCF A;  3KFU A;  5H1S E;  2K1B A;  1LO5 D;  4A3G H;  3IRB A;  4DF7 A;  3Q24 A;  4LFC L;  2HHH Q;  1K0S A;  1MJC A;  2JQO A;  2PMZ E;  3CW2 C;  4UP7 A;  4OGQ C;  3Q22 A;  2EY6 A;  2IT1 A;  2R3Z A;  4RH6 A;  3NBH B;  2Q2H A;  2F0W A;  3BYT B;  5HGT A;  4DR1 L;  3RZO H;  1WTH A;  4RAU C;  5FLX L;  1TWA H;  2CH4 A;  1BBW A;  4ZLT F;  2XWB B;  3G7L A;  5FK9 C;  2B2V A;  1Y1V H;  2IY5 B;  1H9M A;  2RKS A;  1CKO A;  2X6L A;  4HMI A;  5CV6 A;  5A35 A;  1A15 A;  3KF6 B;  4AQY Q;  3BU2 A;  3V96 A;  5COY A;  3BZD B;  2XNA C;  4KV6 A;  4MN3 A;  4ZUI A;  2HD3 A;  3HOV H;  1WOC A;  3Q23 A;  3S1M H;  5E4X A;  2KVM A;  2KCN A;  1L0Y B;  3CCJ A;  3HOW H;  3TS0 A;  5BR8 Q;  3HOZ B;  1FD7 D;  1PH5 A;  3SEB A;  2AQ1 B;  3U50 C;  3ITP A;  5JJI A;  1F9Q A;  4R8N A;  4FXD A;  4IUU A;  1KAA A;  3P20 A;  2WAC A;  2QIL A;  2N88 A;  1SYB A;  4IPH A;  4OX9 L;  4TVA B;  1EZ8 A;  3BZC A;  1DOL A;  2RDG A;  1BO0 A;  3OTO L;  2KOL A;  5C4H A;  4JI4 L;  4I7A A;  3F1Z A;  1NJI C;  3CU7 A;  2GVA A;  3R2T A;  1PYB A;  4B3T Q;  1S5E D;  4NB3 A;  3D6W A;  4A3L G;  1VQ7 A;  4H02 A;  2EYH A;  4B3S L;  3QG1 A;  4X65 Q;  2EY2 A;  1OTC A;  1EYA A;  5EGT A;  2K5H A;  4A3J G;  2KHJ A;  2ZXP A;  4OHJ A;  1PH8 A;  4L5T A;  1RTO A;  1J6Q A;  1K73 C;  2PO4 A;  3WOE A;  1OXS C;  2M9V A;  1A62 A;  3J81 j;  4DUZ Q;  2DY7 A;  3RD4 A;  1FJG L;  1AW7 A;  3BJU A;  1N33 L;  4NXM Q;  1L0X B;  4FF4 A;  2EYL A;  2ZTE A;  3D4R A;  1PTO H;  4OIK A;  1UEA B;  2UXD Q;  4CJ0 B;  1KIX A;  5EQ0 A;  4JI8 L;  4A3D H;  4C56 C;  4DAV A;  4P72 A;  1RDP D;  1L0W A;  2JEB I;  4MIU A;  1QE6 A;  4HCS A;  3KDF B;  4YWL A;  1XTD A;  3H15 A;  2DN8 A;  3OIQ A;  5C3E H;  4LFB L;  4L5Q A;  3MWY W;  3SK5 A;  2BCO A;  3W1B A;  3A7A B;  4BY1 B;  4L5R C;  2NBF A;  3ZJY C;  4C3H B;  1FGB D;  1VQ9 A;  2XRS D;  2YU9 B;  1LV9 A;  2EYO A;  3SE0 A;  3NPP A;  4QMG A;  1WTP A;  4DV3 L;  1X65 A;  2JSO A;  3R8B A;  1PRT B;  3EJI A;  3F8T A;  2WIN B;  4XT1 B;  4GNX C;  4XDX A;  4HSV A;  2WII B;  4BWG B;  2Y0S E;  1QCB D;  1MD2 D;  2I0Q A;  4RGT A;  3HKZ G;  1XNR L;  1MI2 A;  1S5B D;  4I7Z C;  1KTK A;  4DV6 Q;  1DOK A;  4GKK Q;  4A3K B;  5EAY A;  5ELC A;  2AWN A;  2A74 C;  1PRT F;  3FPU B;  4LUV A;  1E22 A;  4A93 H;  1HNZ L;  4KHV A;  2R7Z H;  2XWJ B;  3SK8 A;  1NBW A;  2KCM A;  1I4G A;  1FNV A;  4JYA Q;  4K6D A;  4CDC C;  2OF1 A;  2HT1 A;  1TKW B;  3OSO A;  2Y0S B;  3U9S A;  3CRL C;  5C4X B;  1VQO A;  2UXD L;  1SE8 A;  4EX5 A;  2HDL A;  3NEM A;  2E76 C;  1ESR A;  2A6E C;  1VQF A;  2D5D A;  1TWA B;  1SYC A;  4YWK A;  3PO3 H;  1UEB A;  4PMC A;  1JQY D;  3KBX A;  2CWA A;  2A5H A;  4OX9 Q;  3PIP 3;  3J7A V;  1B4O A;  4XYQ A;  3VR6 A;  4AIM A;  5IT9 E;  4G7H C;  2UUC L;  2SNS A;  2A69 D;  1M4V A;  1WD0 A;  2Z9H A;  1EYC A;  1EY4 A;  4FF2 A;  4KHP Q;  1PH4 A;  1PTO D;  4BBR H;  3JAM i;  4FF3 A;  3GTG B;  1FR3 A;  1HZB A;  1O7Z A;  4K2K A;  3SR1 A;  1H9K A;  3E9H A;  1SMX A;  1PFN A;  1BR9 A;  3CC7 A;  1HTP A;  5GAG C;  3MAQ A;  1F2L A;  3K80 C;  2BE5 D;  2MFI A;  1Q7Y C;  2WB1 G;  1P8L A;  3GTG H;  1IZ6 A;  2EZV A;  4PZ6 A;  4OWW B;  1EU3 A;  1T5X D;  5M3F G;  1LT6 D;  1ONL A;  3FPP A;  2F0F A;  1HPC A;  1O78 A;  1DCZ A;  4L8J A;  2VQF L;  3MA2 B;  2MQH A;  1HZA A;  3O13 A;  3KLW A;  1IXR A;  3PUV A;  2K7V A;  1L1O A;  3DWQ A;  1STE A;  2MNA A;  4A3E G;  3M7G A;  5JEA H;  3C2P A;  4K8I A;  3RUZ A;  2DY8 A;  2EXD A;  3U9O A;  2QEX A;  1QVF A;  4OWT B;  1NR4 A;  2J0T D;  1IL2 A;  3CPF A;  5C3W A;  4IUP A;  4APV A;  2EE1 A;  4N9T A;  4X62 Q;  3A8J E;  2IJ0 A;  2MUY A;  4DV5 L;  3W2D A;  1EY6 A;  5DEH A;  2MHV A;  4XQQ A;  1C7Y A;  4JI8 Q;  3CD6 A;  1V8Q A;  1SNP A;  3BYY B;  1JR0 D;  1EOT A;  1KNE A;  3J81 E;  4L6T B;  3A0J A;  1U9R A;  4ZCK A;  1X56 A;  2N49 A;  2GA4 B;  3RMH A;  3I2Z A;  4KJO A;  3OOC A;  4KHZ A;  1Y1V G;  3F2U A;  1EY7 A;  2AQ2 B;  4K5X A;  4LFA Q;  4DR7 L;  2F0O A;  2GN5 A;  2BA0 A;  4A76 A;  4R4I A;  3TZU A;  1V1O A;  4OWX B;  5BN4 A;  1TWH B;  3D4D A;  1EQV A;  1WFQ A;  2B2T A;  2K33 A;  3FMC A;  3OMC A;  1FGU A;  4H0L C;  1V9P A;  4C2M H;  1ROD A;  1STY A;  4DR3 L;  4JI0 L;  1TS3 A;  3H0G G;  3S9W A;  1JWS D;  3WWV A;  2K4K A;  1UUP A;  4LF8 Q;  4QUC A;  2NVQ B;  1JOR A;  1DOM A;  1GO3 E;  1LTG D;  3F2B A;  2B63 H;  3U4Z A;  4UHV A;  1J9O A;  3CKI B;  2F3I A;  2QW7 A;  2SDF A;  4O1N A;  2JEA I;  2F4V L;  4QJF A;  1KHI A;  3BVM A;  1YJ9 A;  1AH9 A;  1PH2 A;  5COR A;  3ZYY X;  1I4X A;  5DM6 3;  1EIF A;  1D5X C;  1WTR A;  4K5W A;  4R4C A;  3RZO B;  2HHH L;  1L1O B;  1PZJ D;  3RZD B;  4LFC Q;  2R7Z B;  3E9I A;  4RFB A;  2Q2T A;  2B63 B;  3NP8 A;  2B8G A;  5C6A A;  4C1N I;  2YTV A;  4IFD G;  3VYU A;  3FP9 A;  4GN3 B;  4POF A;  1JOK A;  4HN7 A;  2F0I A;  4LF8 L;  5JJZ A;  3CRK C;  5FO7 B;  4DK3 C;  1MGS A;  3TP5 A;  1A3V A;  2K5W A;  4IZ8 A;  2G9H D;  3AFQ A;  1IL8 A;  3RLF A;  3TRZ A;  1LUZ A;  4R8I A;  3AEV A;  3G6E A;  4BY1 G;  4DV4 Q;  1X55 A;  2OCE A;  4B9X A;  2X69 A;  4DV2 Q;  4P71 A;  3HOU B;  1OO9 B;  1SRO A;  1EWI A;  3CQZ B;  2XVS A;  2E2J H;  3H3V H;  4B3R Q;  3UDF A;  3A5U A;  1QNK A;  2DNE A;  2BA1 A;  2F4V Q;  3EFX D;  1HA5 A;  1QWY A;  3TRE A;  1CI3 M;  2AWO A;  5EBD A;  3PIO A;  5IT9 c;  5FLM H;  1H9J A;  2E2J B;  2DJG C;  1BOS A;  4M8A A;  1VQP A;  4DR3 Q;  3I8Z A;  2ICE C;  3ERS X;  3GTP H;  3GTM H;  2Z6K A;  3I91 A;  4IFD I;  1J8I A;  2VQE Q;  1X6O A;  4IUQ A;  1K28 A;  4DU9 A;  3E3X A;  2N8N A;  3S14 H;  1Y8P B;  2P5Z X;  2VUM G;  1GUO A;  2CKZ B;  1OXX K;  1Z47 A;  1WCM G;  2NTT A;  3K81 C;  2UUB Q;  1XTC D;  1GD7 A;  1H9R A;  2PI2 A;  5ELB A;  4KKT A;  3D6C A;  1D5Z C;  1C48 A;  3FRP B;  2A1A A;  1B9M A;  4OIJ A;  3J81 i;  1SFO H;  3G6J B;  3K7A B;  4A3D B;  5C44 H;  2I5M X;  2TSS A;  1HNW Q;  1LTS D;  1I3Q B;  3B6Y A;  4K0K Q;  3SK6 A;  4A3M G;  2DNC A;  4KTA A;  1XXG A;  1HXY D;  1MSH A;  3GTJ H;  4DXG A;  3U4V A;  3T1H Q;  1EY5 A;  2Z4H A;  1I3Q H;  4PMB A;  3I4N H;  3CCR A;  2NZO A;  2L5T A;  5I2Y A;  1F9P A;  1YNN C;  1MJE A;  1BVS A;  2AHO B;  1HTL D;  3GTJ B;  4HIO A;  2F4I A;  5CC4 A;  1VQ4 A;  4DV0 L;  2JA8 G;  3I4N B;  2VL6 A;  4X6A H;  2OT2 A;  2QEJ C;  5IGC A;  1CSQ A;  1HNX L;  3EA6 A;  2KQ3 A;  4BBS G;  5CV7 A;  1AZP A;  3CCM A;  4EQO A;  4KJN A;  2MO0 A;  1VQ5 A;  3TQY A;  2A73 B;  1LLR D;  1U0L A;  4CJ1 B;  1Q3L A;  3MEF A;  4IAL A;  4DR5 Q;  4B3M L;  1QB5 D;  3M4Q A;  1JJ2 A;  1SMY C;  5EPJ A;  1EEI D;  1XMO Q;  4LJZ C;  4NXN Q;  1F9R A;  3TSS A;  5DM7 3;  5JEA G;  3CCQ A;  5KND A;  1D2B A;  1YNJ D;  2PCF B;  4DV5 Q;  2PZT A;  5HY6 A;  3IL8 A;  2OQK A;  3T51 B;  1GM5 A;  3P75 A;  1LTI D;  3S1R B;  2FMC A;  1I94 Q;  2LXJ A;  4F7X A;  3QWN A;  2O5I C;  1SYF A;  1IYV A;  5A2Q L;  5GAD C;  4DXF A;  1Y1V B;  1FYC A;  3M3Y H;  1TU2 B;  4LFB Q;  2NTS A;  1C0A A;  1BBU A;  3T1Y Q;  1Y1W B;  1IHZ A;  4AYB E;  3S1R H;  4DV3 Q;  3TZD A;  3A7L A;  3CCS A;  2EYP A;  4MTN A;  2NN6 G;  2L9H A;  4A3G G;  1VF7 A;  4KN4 C;  5BN3 A;  1LT5 D;  5E4W C;  1NUC A;  5C5L A;  5M5W B;  2L55 A;  3NWT A;  2OQ0 A;  4OEL B;  3K5L A;  1K83 B;  2I5H A;  2PZW A;  5IYD G;  4B9W A;  4QY7 A;  4K6L A;  3H3V C;  2RQX A;  3BS1 A;  3NWS A;  5C3X A;  2VXW A;  2XN9 C;  4U67 3;  3KJP A;  1N34 L;  2SNM A;  2F1M A;  5IP7 G;  4QQB X;  1A63 A;  2F0M A;  2Z0S A;  2B63 G;  1EU4 A;  1SE2 A;  1N33 Q;  1NY4 A;  2ZJR A;  4P74 A;  4LK1 C;  3M4O H;  4ID6 A;  1KRS A;  1J5E Q;  3PMF A;  1B44 D;  2C35 B;  4I65 A;  4JG2 A;  3PQI A;  5M5Y H;  3Q6S A;  3G48 A;  3CCU A;  4DPG A;  2IPK D;  1SJE D;  1PA6 A;  1SR3 A;  3GTQ H;  5K36 G;  1PH3 A;  3BVZ A;  4LWC A;  1SND A;  4H7B A;  2UXB L;  1HFN A;  3JAM E;  2R61 A;  3CP0 A;  1X9N A;  3P7J A;  5J39 A;  3ULJ A;  2NVY H;  2JA9 A;  1F77 A;  1H9S A;  4C2M B;  3N6R A;  1JT8 A;  3TN2 A;  1ENA A;  1S3O A;  5LMU L;  1B2T A;  3I4M G;  2K03 A;  3MZ5 A;  2K32 A;  1IBM L;  4DKA C;  4YHH Q;  1OXT A;  3VYR A;  5I4D A;  3QOJ A;  3AB9 A;  3NHH A;  2HCC A;  4QL5 A;  3J80 L;  4JBW A;  4NXN L;  4KY5 A;  4CDF C;  1S5D D;  1CHP D;  1E0B A;  1VQK A;  5C0X I;  4BY7 H;  1XJV A;  3PUX A;  1YNN D;  2UU9 L;  4POG A;  5BR8 L;  4PG3 A;  3M4Y A;  2A68 C;  4AYB B;  4GOP A;  3QR8 A;  4XQN A;  3NTK A;  5IWA L;  4JPB W;  3PO3 B;  5IE8 A;  1LTT D;  3VDY A;  1CUK A;  3H09 A;  2LMC B;  1KXL A;  5M5X H;  2JA7 G;  2EYM A;  2Z4I A;  2ICI A;  1DZ1 A;  1CHQ D;  1XMO L;  5KRU A;  1JWU D;  3KF8 B;  4LF5 L;  1S4Z A; 
#chains in the Genus database with same CATH homology
 2ZTD A;  1N32 L;  1CKN A;  1L2F A;  2WP8 J;  4B3R L;  3SGI A;  1VQF A;  2K5N A;  3I56 A;  3F2D A;  1K3R A;  4JCV E;  4YWK A;  3PO3 H;  1UEB A;  3ICE A;  4LF9 Q;  4A4I A;  2CFM A;  2CWA A;  4OX9 Q;  4P75 A;  2I5L X;  4A3D G;  5C0X G;  3K0X A;  4XTC S;  1IBK L;  4HIM A;  1FVI A;  3F2C A;  4DV7 L;  5C4X H;  4AIM A;  2UUC L;  4O2D A;  1VQD A;  1W3S A;  1RL2 A;  4GN5 A;  2VUM H;  1PH9 A;  4MZ9 A;  2Q2U A;  3OW2 A;  4JI2 L;  3HOX G;  2E5L L;  2R93 G;  3CC2 A;  4KHP Q;  1WI5 A;  3M85 A;  1PH4 A;  4BBR H;  3JAM i;  4GKJ L;  4WJ4 A;  3HOU H;  2UUB L;  1HZB A;  3U58 A;  4A3I G;  3E9H A;  1SMX A;  3STB C;  4JI6 Q;  2RF4 A;  3JC6 6;  1Q1B A;  4OON A;  3LGJ A;  4DUY Q;  2OWO A;  3M7N A;  3CC7 A;  5GAG C;  4RG1 A;  3K80 C;  2MFI A;  4NPS A;  5LMN L;  3S16 H;  1Q7Y C;  2WB1 G;  1P8L A;  2K75 A;  4LFA L;  3TS2 A;  2XTI A;  3GTG H;  1IZ6 A;  3G4S A;  1TWC H;  4PZ6 A;  4OWW B;  1HR0 L;  4BY7 G;  3RLO A;  4QGU A;  3AQQ A;  3RLN A;  5M3F G;  4HJ8 A;  1YHB A;  4X64 L;  4JOI A;  5GQO A;  4X65 L;  1MKH A;  3I4N G;  2VQF L;  2ZM6 Q;  4HJ7 A;  1X54 A;  2MQH A;  3PUY A;  2E5L Q;  1HZA A;  4JI5 L;  3S1Q H;  1TWG H;  5M5W H;  4X64 Q;  4A3B H;  3KLW A;  5FJ8 G;  1IXR A;  1U5K A;  1KC8 C;  4DR2 Q;  4GN4 B;  3PUV A;  4AQY L;  1SLJ A;  1L1O A;  2PQA B;  2MNA A;  1I6H H;  4A3E G;  1Q46 A;  4R4Q A;  4IPD A;  4C3J H;  2ZJP A;  2JA7 H;  4A3F H;  2EXD A;  4EQ5 A;  4DAM A;  3T1H L;  4JV5 L;  2IHE A;  2QEX A;  1QVF A;  2JJQ A;  3EN2 A;  4OWT B;  2UU9 Q;  1N36 L;  2FXQ A;  2V1C C;  3E0E A;  3CCV A;  1G6P A;  4DV4 L;  3CPF A;  1IL2 A;  4APV A;  1VQM A;  1PV4 A;  4DV6 L;  4X62 Q;  1VQB A;  4JI7 L;  3I7F A;  4JI2 Q;  1EQR A;  2RHQ B;  4DV5 L;  4IFD J;  3GTO H;  2JEA I;  1M1K C;  1C7Y A;  4B3T L;  4DAY B;  3JAM c;  2B29 A;  4JI8 Q;  1E24 A;  3CD6 A;  1E7Z A;  1P16 A;  3A74 A;  3KYH C;  2RHS B;  1QZG A;  3A0J A;  3CAM A;  1YEZ A;  2JA6 G;  1X56 A;  2CCZ A;  2N49 A;  1YIJ A;  5AJ3 L;  2OTL A;  4YCV A;  1HZ9 A;  3I2Z A;  1YI2 A;  4KHZ A;  1N8R C;  2UXC Q;  4BA1 I;  1Y1V G;  1MIU A;  3W5O A;  1PH6 A;  1Z9F A;  4DR7 L;  4LFA Q;  1LTL A;  3HOZ G;  2GN5 A;  2BA0 A;  3KJO A;  4LF4 Q;  1S72 A;  3PUW A;  1N32 Q;  2NN6 I;  1X3E A;  1YNX A;  4DK6 C;  2A19 A;  1VQ8 A;  4A76 A;  4JBM A;  5FLX c;  1M90 C;  4R4I A;  4K0K L;  2JA5 G;  2B3G A;  1Y1W G;  2H5X A;  2K5V A;  4OWX B;  4BY1 H;  4YHH L;  4OO1 G;  4FDB A;  1PFS A;  1WFQ A;  1JB7 A;  3DLL A;  4B3M Q;  4X62 L;  1RIP A;  2VQE L;  1FGU A;  2JK8 A;  4DV0 Q;  1V9P A;  4C2M H;  1YJW A;  1JJG A;  3RR5 A;  4DR3 L;  2NVX H;  4HID A;  4JI0 L;  2UUA L;  4QIW E;  3H0G G;  4GKJ Q;  1HH2 P;  5IYC G;  4A3L H;  5JJL A;  3WWV A;  4KI0 A;  2K4K A;  4L5S A;  4IO9 A;  2ZTC A;  3RN2 A;  4YY3 L;  4LF8 Q;  4UP9 A;  4LF6 L;  1UE7 A;  1K8G A;  1GO3 E;  3J7Z C;  4HJ5 A;  3F2B A;  2B63 H;  1T9H A;  3U4Z A;  3M4P A;  1FL0 A;  1TWH H;  4GOP B;  3T1Y L;  1SRU A;  2F3I A;  3DM3 A;  4A3E H;  2K50 A;  2Z6K C;  4JI5 Q;  2F4V L;  4QJF A;  1KHI A;  2K14 A;  4JI1 Q;  1YJ9 A;  1PH2 A;  1HNX Q;  4IJL A;  1AH9 A;  1JE5 A;  4A3F G;  1EIF A;  4DR4 Q;  5JEA J;  1YBY A;  4YCW A;  4R4C A;  2KEN A;  2PNH A;  2HHH L;  1L1O B;  2PQA A;  3TEH B;  4LFC Q;  2NVQ H;  3E9I A;  1GVP A;  4IJH A;  2Q2T A;  5E7N A;  1DGS A;  1KQS A;  3PCO B;  4X66 Q;  2NZH A;  1HR0 Q;  2PI2 E;  2YTV A;  4JI4 Q;  1QVC A;  4IFD G;  3UDX A;  1J5E L;  1FJG Q;  3FP9 A;  4GN3 B;  1NTG A;  2JE6 I;  4POF A;  5HGQ A;  3D31 A;  3CXC A;  3S15 H;  4A75 A;  3ER0 A;  2EIF A;  4YY3 Q;  5M3M H;  2BH8 A;  4LF8 L;  1WCM H;  1IYJ B;  1I94 L;  5C3E G;  2DUD A;  1O7I A;  2Q2I A;  4PZ8 A;  5IP7 H;  3J80 i;  4DK3 C;  1QZH A;  4B3S Q;  2RCN A;  2KCT A;  4LF5 Q;  4LW1 A;  2R92 H;  1VQA A;  3D0F A;  4DR5 L;  4LF5 L;  1VQH A;  3ULP A;  4OXP A;  4UY8 C;  2QGQ A;  4JI1 L;  1GKH A;  1K9M C;  2LSS A;  1EIY B;  2A8V A;  4O0A A;  3AFQ A;  3RLF A;  3TRZ A;  1UE5 A;  1VQE A;  3AFP A;  3AYH B;  4DUZ L;  1KD1 C;  1LUZ A;  5IP9 H;  4JI7 Q;  3AEV A;  3PIP A;  2UUC Q;  3UDG A;  3G6E A;  1R9T H;  1YHA A;  2HIX A;  4BY1 G;  4DV4 Q;  1X55 A;  2JA5 H;  2OCE A;  4DV2 Q;  4P71 A;  4JBK A;  3PGZ A;  1XPU A;  2YTX A;  1SRO A;  3BZK A;  1HR0 W;  4KLK A;  1D8L A;  3S17 H;  3KF6 A;  1EWI A;  4AH6 A;  4R4T A;  3H0G H;  3H3V I;  5ELN A;  5IYC H;  3CMA A;  2E2J H;  2DGY A;  3H3V H;  1Q1E A;  4B3R Q;  3UDF A;  1W2B A;  4PZ7 A;  3A5U A;  1PVO A;  4GLX A;  2YTY A;  3A5Z B;  4BXX H;  3MXN B;  1XNR Q;  1VQC A;  2BA1 A;  1IBL L;  1AE3 A;  1CKN B;  2F4V Q;  4LF7 Q;  4GKK Q;  1BKB A;  1E1O A;  1K83 H;  4LF4 L;  1VQL A;  3EBE A;  3HOY G;  1JJC B;  3TRE A;  4Y52 H;  1HZC A;  2AWO A;  1IBK Q;  2UXC L;  2WFW A;  3NEL A;  4A3K G;  2KBN A;  4A3C G;  3Q8D A;  1N9W A;  3PIO A;  5IT9 c;  3CQZ H;  3I4M H;  5FLM H;  4AYB G;  3PO2 H;  4GLV B;  3L2P A;  4JI6 L;  1NE3 A;  3PUZ A;  1VQP A;  4DR3 Q;  4LF9 L;  3S1N H;  1QUQ B;  5IY0 A;  3PO3 G;  3L0O A;  3ERS X;  3GTP H;  3GTM H;  1A0I A;  2Z6K A;  4LUZ A;  4IFD I;  4TQU S;  2VQE Q;  4YWM A;  1K8A C;  1X6O A;  3CCE A;  2ES2 A;  3UE0 A;  2R7F A;  5C0X J;  3G71 A;  1E1T A;  2N8N A;  2EQS A;  2Y0S G;  3S14 H;  5C4X G;  4PMW A;  2VUM G;  2XGT A;  2CKZ B;  3OYY A;  2WAQ G;  1OXX K;  1Z47 A;  1WCM G;  2KHI A;  3K81 C;  3L7Z C;  1PHJ A;  2UUB Q;  2R93 H;  1GD7 A;  2D0O A;  2PI2 A;  3OTO Q;  3GTK H;  3J80 c;  2L15 A;  1Y14 B;  2A1A A;  3J81 i;  1SFO H;  2AMC B;  4JI0 Q;  5C44 H;  1TWF H;  2I5M X;  1HNW Q;  3CME A;  3GO5 A;  4IOA A;  3B6Y A;  4GNX B;  3GTL H;  4LF6 Q;  4K0K Q;  4JOI C;  3PV0 A;  4A3M G;  4DR2 L;  4GOP C;  4UP8 A;  4JI3 Q;  1N34 Q;  4XIG S;  3HOV G;  5DLQ E;  1I50 H;  1EQQ A;  5LMU Q;  3FHW A;  3GTJ H;  1IBM Q;  4JI3 L;  5JJK A;  2ALY B;  3HOW G;  2YU9 H;  4LNQ A;  3S2H H;  3GD7 A;  1S40 A;  1L1O C;  1VQJ A;  3U4V A;  3CPW A;  3T1H Q;  4JV5 Q;  1I3Q H;  3I4N H;  3PF4 A;  4DV7 Q;  3CCR A;  4DR1 Q;  2NZO A;  4UPA A;  3S24 A;  4R1J A;  5J3B A;  4JYA L;  5IYB H;  1CKM A;  3HOX H;  3PF5 A;  5FJ8 H;  1D7Q A;  1QUQ A;  1MJE A;  1E3P A;  2YV5 A;  5LMN Q;  1Q81 C;  1PYS B;  4IOC A;  1B7Y B;  1CSP A;  1BVS A;  2AHO B;  4A3I H;  1IBL Q;  1V43 A;  2E8G A;  4HIO A;  2IX0 A;  4A3C H;  3KFU A;  1VQ4 A;  5H1S E;  2GVB A;  4DV0 L;  1VQG A;  4A3G H;  3IRB A;  4JC0 A;  5FLM G;  2JA8 G;  1UE6 A;  4LFC L;  2HHH Q;  1MJC A;  4R4O A;  2VW9 A;  2VL6 A;  4X6A H;  1HNX L;  1XPO A;  1CSQ A;  2JQO A;  2PMZ E;  3CW2 C;  2VY3 A;  3K8A A;  5GRO A;  4UP7 A;  1YIT A;  2IT1 A;  3NBH B;  1VCI A;  2VZA A;  4BBS G;  2IX1 A;  2Q2H A;  1HNZ Q;  3CCM A;  2WB1 E;  3UE1 A;  1XNQ L;  2MO0 A;  1YJN A;  1VQ5 A;  3TQY A;  3J81 c;  4DR1 L;  3RZO H;  5GAE C;  3EIV A;  3RZD H;  1TWA H;  1U0L A;  1BBW A;  3MEF A;  2ZM6 L;  1OXU A;  4A3J H;  4DR5 Q;  4B3M L;  3S2D H;  3M4Q A;  1JJ2 A;  4J15 A;  1XMO Q;  2HQL A;  4NXN Q;  4GS3 A;  3K7U C;  2K52 A;  5C44 G;  1YHQ A;  1Y1V H;  2IY5 B;  5JEA G;  4AQY Q;  1CKO A;  3CCQ A;  3HOZ H;  3KF6 B;  1VQI A;  3RN5 A;  3BU2 A;  2LXK A;  4DV5 Q;  5HY6 A;  1I5F A;  3CC4 A;  4A3M H;  3HOV H;  1Y1W H;  1G51 A;  2OQK A;  1XMQ Q;  2HIV A;  1GM5 A;  5IWA Q;  1WOC A;  1NMF A;  4GLA C;  2LXJ A;  1I94 Q;  3S1M H;  4NXM L;  2VS1 A;  5GAD C;  3CCJ A;  3HOW H;  4DV1 Q;  3TS0 A;  3M3Y H;  5BR8 Q;  4LFB Q;  1PH5 A;  4DR6 Q;  3HFZ B;  2N3S A;  2ASB A;  1NMG A;  2R7D A;  2E2I H;  3U50 C;  1C0A A;  1KAW A;  1PH1 A;  1BBU A;  5IYB G;  5JJI A;  3T1Y Q;  1H95 A;  4JBJ A;  4AYB E;  1EFW A;  4BA2 I;  1V1Q A;  4DR6 L;  3UDI A;  3S1R H;  4DV3 Q;  2JA6 H;  3CCS A;  1KRT A;  4IPC A;  4MTN A;  2NN6 G;  4IPH A;  2OTJ A;  4P73 A;  4OX9 L;  3I4O A;  4DR4 L;  4TVA B;  1OXV A;  5AJ3 Q;  2NVT H;  4A3G G;  3BZC A;  4DV2 L;  1TXY A;  1N36 Q;  2BH2 A;  2JA8 H;  1PH7 A;  5C4J H;  3STB D;  3OTO L;  1LYL A;  1X3G A;  3J7A 5;  1XMQ L;  4JI4 L;  2OQ0 A;  4ME3 A;  3F1Z A;  4X66 L;  1NJI C;  1EYG A;  1Q86 C;  2I5H A;  1VQN A;  2GVA A;  1HJP A;  4LF7 L;  3ULL A;  1PYB A;  1YZ6 A;  5IYD G;  4B3T Q;  4QY7 A;  1Q8K A;  1B70 B;  4BBS H;  4NB3 A;  4C3I H;  4A3L G;  1VQ7 A;  2UUA Q;  4H02 A;  2D62 A;  4DR7 Q;  3KJP A;  4B3S L;  1A8V A;  1N34 L;  3HKS A;  4X65 Q;  4A93 G;  1OTC A;  5IP7 G;  2R7Z G;  2K5H A;  4QQB X;  1A63 A;  4A3J G;  2KHJ A;  2Z0S A;  1PH8 A;  2IHF A;  4L5T A;  2B63 G;  1Q82 C;  4IPG A;  2QA4 A;  1N33 Q;  1J6Q A;  1K73 C;  1NY4 A;  3PO2 G;  2ZJR A;  5ELO A;  3FKI H;  4P74 A;  1OXS C;  3J81 j;  1A62 A;  3M4O H;  4DUZ Q;  1KRS A;  1J5E Q;  1FJG L;  2ATW A;  1EOV A;  3BJU A;  5IP9 G;  1N33 L;  2C35 B;  4NXM Q;  2VNU D;  2CWP A;  1VQ6 A;  1ASZ A;  1UWV A;  4JG2 A;  2ZTE A;  4GNX A;  5M5Y H;  4ALP A;  2UXD Q;  3M9B A;  3CCL A;  3G48 A;  3CCU A;  3GDE A;  3K7A H;  4C3H H;  4DPG A;  3RNU A;  1SN8 A;  1KIX A;  4JI8 L;  4A3D H;  4GKK L;  1XPR A;  4P72 A;  1PA6 A;  1L0W A;  2JEB I;  1SR3 A;  3GTQ H;  5K36 G;  3W1G A;  2AKW B;  3KDF B;  1PH3 A;  4KHP L;  4LWC A;  2UXB L;  3PSI A;  4YWL A;  1HNW L;  1XTD A;  3NEN A;  5M3M G;  3H15 A;  4DV1 L;  3CP0 A;  4BXX G;  4DNI A;  5LMN W;  5C3E H;  1X9N A;  1JMC A;  4LFB L;  4L5Q A;  3W1B A;  4BBR G;  3ULJ A;  3HOY H;  4L5R C;  2NVY H;  3ZJY C;  2JA9 A;  1LM0 A;  2R92 G;  3HKZ E;  3KDF A;  2ID0 A;  3HOU G;  4A3K H;  1JT8 A;  2E2H H;  2ZJQ A;  2CQO A;  1VQ9 A;  5GAH C;  1S3O A;  1X3F A;  5LMU L;  4HIK A;  2R6G A;  4HJA A;  4MNO A;  3I4M G;  4DV3 L;  4OO1 I;  1X65 A;  1IBM L;  1C9O A;  4DKA C;  1OXT A;  1B8A A;  3F8T A;  4YHH Q;  4GNX C;  1EUJ A;  4QL5 A;  2Y0S E;  2YYZ A;  2UXB Q;  4JBW A;  2I0Q A;  4NXN L;  3HKZ G;  1XNR L;  3I55 A;  4Y7N H;  1UE1 A;  4YCU A;  5C0X I;  1G29 1;  2MO1 A;  4DV6 Q;  2VQF Q;  1XJV A;  1VQK A;  4BY7 H;  4HJ9 A;  5IYD H;  1Q12 A;  3PUX A;  2UU9 L;  4POG A;  1KL9 A;  5M3F H;  5BR8 L;  4PG3 A;  1VS0 A;  4LUO A;  5EAY A;  2AWN A;  4RMF A;  4EX5 A;  4GOP A;  1QVG A;  4LUV A;  2N78 A;  1E22 A;  1YVC A;  3KOJ A;  4A93 H;  2WAQ E;  1HNZ L;  1WYD A;  2R7Z H;  5IWA L;  1XNQ Q;  1WJJ A;  4A3B G;  5IE8 A;  1NBW A;  1ASY A;  2KCM A;  2D0P A;  4JYA Q;  3VDY A;  1CUK A;  1AE2 A;  1KXL A;  3FKI G;  5M5X H;  2HT1 A;  2JA7 G;  2F52 A;  3CF5 A;  4DUY L;  4WJ3 M;  1XMO L;  1VQO A;  2UXD L;  1SE8 A;  3KF8 B;  1K0R A;  3NEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...