4AYBG

Rnap at 3.2ang
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
113
structure length
113
Chain Sequence
KAQEIILSCEINSIERGSLKNLSIIHMSCNDFNISFDIIDSINIFSQKEKVKAFISKNRLSYTNDDFCGHGYIVTELKDSSSNNGNRYITIISLFGLLVKIISNKESFLKIHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
pubmed doi rcsb
molecule tags Transferase
total genus 12
structure length 113
sequence length 113
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF16992 RNA_pol_RpbG DNA-directed RNA polymerase, subunit G
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4aybG00
1X3EA 4IFDJ 2MQHA 2ZM6Q 2B29A 3IRBA 4J15A 3CMAA 3M3YH 2UXCL 2VQEQ 4LUOA 2IX0A 5M3FH 1KRTA 2JEAI 3ZJYC 4A76A 4LUVA 5LMUL 3HOVG 2VY3A 2JQOA 4LF4L 2NZHA 4TVAB 1XMOL 3OTOL 4DR2L 1I5FA 1A8VA 4R4OA 3S14H 5C4XG 3CCUA 1OXVA 3M85A 4JYAQ 5IP7H 4X6AH 1WCMH 3UDXA 2D0OA 2HHHL 3UDFA 2R7ZG 2JA5G 4JI0Q 4A93G 2GVAA 3S2HH 3A74A 1KHIA 3E9HA 3H3VH 4DAMA 3GTLH 2D62A 1MKHA 1MIUA 1YBYA 4DUZQ 3AFPA 4HIKA 4KI0A 4A3LG 1IYJB 1SE8A 1IBML 1HH2P 4JBJA 4A75A 1HZCA 3ULLA 3AYHB 1N8RC 4OX9Q 3RLOA 4QJFA 4B3TQ 3OW2A 1AE3A 1I50H 1TWGH 5C3EH 1IBKL 5C0XG 4UPAA 1T9HA 4JI5Q 5BR8L 2VZAA 1EUJA 3L2PA 3KF6B 3HOUG 3I56A 4K0KL 3NENA 4BBSH 3RN2A 3M7NA 2V1CC 2VQFL 1GO3E 4HJ7A 1D8LA 1L0WA 1V43A 2H5XA 1CUKA 3CCRA 3RN5A 1ASYA 1HJPA 1EFWA 2PI2E 5IT9c 3HOYG 4JBKA 4NXML 3Q8DA 3H3VI 2ATWA 2LXJA 1N33Q 5GADC 4JI6L 1S40A 2E8GA 2KCMA 5IYDH 4YCWA 4DV4Q 5C0XJ 1Q12A 1QVFA 4DR4L 2CKZB 1YITA 1SFOH 1BKBA 1PV4A 2VUMH 1Q1EA 4HJ9A 2HIVA 2ID0A 1L2FA 1SR3A 3E0EA 3PV0A 1VQEA 4RG1A 2K75A 2R92H 1XPOA 2B63G 3CF5A 1PH4A 3PO2H 5EAYA 4P72A 5E7NA 4AYBG 4A3GG 1O7IA 4DR7Q 1PH2A 1CKNB 4IOCA 1P16A 1VQIA 4A3KH 1HR0W 4OO1G 2K5NA 1VQ7A 1EIFA 4AH6A 1E1TA 1WYDA 3PUWA 2F3IA 3JAMc 3PIPA 1OTCA 2K5VA 4JI4Q 2BH2A 3BJUA 3F8TA 2UXDL 5GROA 2K50A 4X65L 3F2BA 2WAQE 3CC4A 4A4IA 1KC8C 3GDEA 1YJWA 4XIGS 4X66L 1NTGA 1VQOA 2UXBL 4DUYQ 2KENA 2JA9A 3GD7A 5LMNQ 2ZTCA 4A3JH 3PF5A 3CPWA 1J5EQ 1VQ6A 3NELA 2VQEL 1EYGA 1UWVA 4POGA 2N49A 2LXKA 1IBLQ 5IYDG 4BA2I 4PZ8A 4DV2Q 2Q2TA 4GKKQ 3ULJA 5M5XH 2VW9A 4JI8Q 1IL2A 3AEVA 4H02A 4JI2Q 1DGSA 3CW2C 1PH6A 2UU9Q 2PQAA 4LFCL 2A8VA 3KOJA 1FL0A 4DV3L 1G51A 4BY1G 2HT1A 2ZTDA 4DR1L 3AQQA 4A3EH 4AYBE 1L1OA 2NVTH 1GKHA 3PO2G 1FGUA 1Q86C 4A3BH 5IP9H 4JOIC 1HNXQ 1X54A 1X55A 1QVCA 3I4NH 4QQBX 1TWFH 3CP0A 3B6YA 3E9IA 1QVGA 4OX9L 2JEBI 3G48A 4DV6L 1VQ4A 1K9MC 4POFA 4B3TL 1OXTA 4JBMA 3PO3G 4IFDG 4B3RQ 4A3FG 4GNXA 3FP9A 2QEXA 3KDFB 4JI5L 4DV0Q 3KLWA 1CSQA 3RR5A 3CCMA 2N78A 1Q81C 3HOWH 2E2IH 3FKIG 3A0JA 1N32L 1Q7YC 2R7FA 1Y1WG 1XNQQ 3UE1A 4LF8L 4A3JG 2IX1A 3TS2A 4A3CG 2YV5A 1TWHH 4DV7L 4A3IH 3RZDH 4EX5A 5IY0A 1FJGQ 1VQFA 1YVCA 3A5UA 4HIDA 1X3GA 2K4KA 3CQZH 4X64L 2BA1A 3CCJA 1N33L 1A63A 2EQSA 2UUCQ 1AH9A 2UUAL 3CCVA 5JJKA 4KHPQ 2GN5A 3PUXA 3K7AH 2YU9H 4YWKA 1V1QA 1OXXK 4DR5Q 4L5QA 3NBHB 3I4MG 2OTJA 2BH8A 3EBEA 5JEAG 1HNWQ 2CWPA 4P75A 4LF6Q 1G6PA 1YZ6A 4BY7G 4UP8A 1S72A 1TWCH 2F52A 3ICEA 5DLQE 4LF9Q 1UEBA 1X6OA 2AHOB 4DR7L 1PH7A 2JA8G 2ASBA 2NVYH 2OCEA 2AWNA 5IYBH 1VCIA 1I94L 2VL6A 4DNIA 2JJQA 1W2BA 5FLMH 3J81j 2F4VQ 3KFUA 4HJ8A 3HOZH 1BBWA 4LFBQ 1WFQA 1J6QA 4GKJQ 1PYSB 5IWAQ 3U4VA 3J81c 3SGIA 1KL9A 3FHWA 5GAGC 4R4QA 4LF5L 5JEAJ 4AQYQ 1E24A 3CCQA 4JCVE 1K8GA 4GOPB 2B3GA 2ZTEA 3G71A 2JA6G 1JJCB 4IPCA 4QL5A 3G4SA 3LGJA 4XTCS 4DK6C 1YI2A 3L7ZC 3U58A 1VQ8A 4GKKL 1VQBA 1XTDA 5M3FG 2CCZA 3GTGH 1Q8KA 4JI2L 4DR6L 2WAQG 4JI7Q 2UU9L 2R93H 1P8LA 1LM0A 4IJHA 4IPDA 4KLKA 2I5HA 1E1OA 2AKWB 3I4OA 1HZBA 4BBRH 5M5YH 5M3MH 3H0GH 4LFAQ 3J80i 3J7ZC 2DUDA 1XMQQ 4UP9A 4PG3A 4EQ5A 5IP7G 1PH1A 1M90C 4YHHQ 1CKMA 1EIYB 1KD1C 1V9PA 4MNOA 1WCMG 1VQPA 3PF4A 4DR3L 2I0QA 4WJ3M 2XGTA 5FJ8H 3CC7A 4DV5Q 4NPSA 4P74A 1C9OA 5FLMG 1LUZA 3RLFA 1K8AC 4B3SQ 4DK3C 1D7QA 1X3FA 5C44H 1XNRQ 2I5MX 2KHJA 2MFIA 1VQGA 4B3RL 2JK8A 1QZHA 1RL2A 4R4IA 4DV0L 1YJ9A 1G291 2NVXH 2EIFA 5C3EG 3W5OA 1Q1BA 3NEMA 2Z6KC 3HOXH 3GTQH 4KHZA 3TEHB 1XNQL 3S17H 2VS1A 1NJIC 4BBSG 1CKOA 1Y1VH 5AJ3Q 2N8NA 1KXLA 1YJNA 1BVSA 2E5LQ 1S3OA 4OWWB 2NVQH 4JI1Q 4WJ4A 2MO1A 1B7YB 4LWCA 5LMUQ 2IY5B 4LF4Q 1JJGA 1UE5A 4OXPA 4OWTB 3OTOQ 4DR2Q 1N36L 3I7FA 4OWXB 1A62A 3S24A 2PQAB 4BBRG 2E2JH 3T1YQ 4C3JH 4ME3A 3KJOA 3TS0A 2JA7H 3HKZE 4JOIA 1JB7A 2ZM6L 4KHPL 1SLJA 2RCNA 2Q2HA 4GOPC 2HHHQ 1L1OB 3GTMH 1UE6A 1VQNA 3K8AA 3ULPA 4PMWA 1HNWL 1WI5A 2VUMG 3CCEA 1K0RA 4IPHA 4JYAL 1I6HH 3PUVA 3CXCA 1KRSA 4JG2A 4YY3Q 4LF9L 2HQLA 3F2CA 1K73C 1BBUA 4JI0L 2R92G 2L15A 4C2MH 1KAWA 1N9WA 4ALPA 2CFMA 1IBKQ 4A3KG 1B8AA 3HOXG 1EQQA 5BR8Q 4DUZL 1ASZA 4UP7A 4GKJL 3I2ZA 5IWAL 1PVOA 2RHQB 3OYYA 1HNZQ 3GTOH 4NB3A 3A5ZB 4IOAA 1YHBA 3F2DA 2YYZA 1QZGA 2KCTA 3S16H 3S1MH 4AQYL 1TWAH 3GO5A 3CAMA 3S2DH 1K83H 4R4CA 2CQOA 3UDGA 3CC2A 3VDYA 2R93G 2JA7G 1C0AA 3JC66 4IPGA 4PZ6A 5GAHC 4O0AA 3T1HQ 2BA0A 3K81C 1YHAA 1B70B 5C4XH 2WP8J 2MNAA 1VQLA 4LF7Q 3I55A 4MZ9A 3CCSA 1XMQL 5FLXc 4L5SA 3PUZA 4YHHL 2DGYA 1Z9FA 2R7ZH 1PA6A 4JV5Q 4A3EG 1H95A 1TXYA 4APVA 2JA5H 4A93H 4NXNQ 1IZ6A 3KF8B 4DV4L 1YNXA 4HJ5A 1YIJA 2Z0SA 4A3BG 5H1SE 5IP9G 4QGUA 2VNUD 4B3SL 4GN4B 3MEFA 4X62Q 2XTIA 5GQOA 1XNRL 3I4NG 1FVIA 4A3LH 1C7YA 5JJLA 2K5HA 3CPFA 1SRUA 3KDFA 3JAMi 4LUZA 2IT1A 3H15A 4A3MH 1XJVA 2PMZE 4OO1I 3HOUH 2ZJQA 4JI4L 4B3MQ 3S1NH 1GVPA 5C4JH 3HOWG 4DKAC 2YTVA 2YTYA 2HIXA 3UE0A 1QUQA 2WFWA 1LTLA 5ELOA 3TREA 3W1GA 5AJ3L 3DLLA 2EXDA 4DAYB 1PH5A 1MJEA 2E5LL 4JI3Q 2C35B 1LYLA 1Q46A 1MJCA 1SROA 4JI1L 1X9NA 1HR0Q 3ERSX 4A3IG 4L5RC 3U50C 1NMGA 1X56A 2UUBQ 3HOYH 4DUYL 1GM5A 2QA4A 3T1YL 5LMNL 1YEZA 4BA1I 4LFCQ 1J5EL 4DV3Q 2WB1G 1Y14B 4R4TA 3J7A5 1XPRA 4DR1Q 4Y52H 3BZKA 1IBLL 4BXXH 2LSSA 5IYCH 4DV2L 2R7DA 4JI8L 3TRZA 1PHJA 3PUYA 4YWLA 3GTPH 2ZJRA 1XPUA 1OXUA 4O2DA 4P73A 2Y0SE 4YY3L 3PCOB 2B63H 2Z6KA 1EWIA 4DV6Q 3HKZG 4A3GH 1PFSA 4DPGA 1VQ5A 1YHQA 4A3MG 1OXSC 3S15H 3M4QA 1HNXL 2RHSB 4TQUS 5IYBG 4YCUA 2I5LX 4DV1Q 1N32Q 3ER0A 3HOZG 4LW1A 1HNZL 2FXQA 5ELNA 4LF8Q 2RF4A 4IFDI 1U0LA 5IE8A 4HJAA 1VQHA 4GLAC 3HKSA 4DV7Q 3HFZB 2ZJPA 1VQ9A 4GOPA 3KF6A 1R9TH 4AIMA 1K3RA 4X64Q 3M4OH 2WB1E 1E3PA 3U4ZA 1VS0A 3M9BA 2UUAQ 1N34Q 4GN3B 3CCLA 1JJ2A 4BXXG 5IYCG 3T1HL 4YWMA 4A3DH 3PSIA 3PIOA 1FJGL 1CSPA 2UXCQ 2A19A 4LF7L 1NE3A 1A0IA 3K7UC 3WWVA 4JC0A 4YCVA 2NN6I 3BU2A 1XMOQ 2OQ0A 2PNHA 1VQMA 4BY1H 1M1KC 4PZ7A 2AWOA 5M3MG 3H0GG 3TQYA 3G6EA 4JV5L 2MO0A 4NXNL 2CWAA 2A1AA 3L0OA 2E2HH 1UE1A 4FDBA 4DR5L 4LNQA 1X65A 1IXRA 4X62L 1I94Q 5FJ8G 5J3BA 4R1JA 4LF6L 4RMFA 4Y7NH 3UDIA 3D31A 4OONA 1RIPA 3STBC 5C44G 2K52A 1GD7A 1PH9A 1IBMQ 3PO3H 4L5TA 4A3FH 3CMEA 4C3HH 1CKNA 4HIMA 2OTLA 4LF5Q 4IJLA 4GNXB 4B3ML 2R6GA 4QY7A 3FKIH 1EOVA 1VQDA 5HGQA 3J81i 2AMCB 3K0XA 2Q2IA 1I3QH 1Y1WH 2F4VL 3KJPA 5HY6A 4LFBL 4K0KQ 2KBNA 1AE2A 4JI3L 3RZOH 4A3CH 1Y1VG 2NZOA 3AFQA 3EN2A 2JE6I 3PGZA 4QIWE 4C3IH 2VQFQ 1PYBA 1VQJA 1HR0L 4A3DG 1PH8A 2UUBL 5C0XI 4DR6Q 2D0PA 1WJJA 4JBWA 4NXMQ 1JT8A 1JMCA 3BZCA 3STBD 4P71A 4JI6Q 1Q82C 1NY4A 2KHIA 3J80c 1UE7A 3GTJH 4DR3Q 3MXNB 1KIXA 3EIVA 1VQCA 2UUCL 4JI7L 2GVBA 3HOVH 5GAEC 2N3SA 3I4MH 4DR4Q 3D0FA 1E7ZA 5K36G 4MTNA 5M5WH 4LFAL 4BY7H 3RNUA 2OQKA 1SMXA 4GLXA 3GTKH 4GN5A 1NBWA 4IO9A 3S1RH 1E22A 2JA8H 2K14A 2QGQA 1VQAA 2IHFA 3W1BA 4DV5L 4DV1L 2ALYB 3F1ZA 1WOCA 1L1OC 3M4PA 1JE5A 1NMFA 1PH3A 3S1QH 5JJIA 3RLNA 3K80C 2YTXA 1SN8A 2OWOA 1QUQB 1W3SA 2IHEA 2PI2A 2Y0SG 5LMNW 1HZAA 2ES2A 2UXDQ 1KQSA 3KYHC 4X65Q 3DM3A 3CD6A 4UY8C 4GLVB 1Z47A 1U5KA 4X66Q 1HZ9A 4GS3A 1VQKA 2NN6G 2JA6H 4HIOA 1N36Q 2UXBQ 2Q2UA 1N34L 1EQRA 4GNXC
chains in the Genus database with same CATH superfamily
3HOUB 4IFDJ 3S1NB 5D3DA 4LF4Q 3D6WA 2K6AA 2IX0A 1KRTA 2JEAI 1F9SA 4LUVA 2NB0A 1A8VA 3R2IA 1OXVA 3OHXC 3M85A 3TP5A 5IP7H 1PTOD 3KF8A 3UDXA 4N8X1 2HHHL 2R7ZG 4A93G 2GVAA 3S2HH 3A74A 3C3LA 2B2VC 5E4WC 4HTHA 3NBHA 1JCKB 2EXZA 3GTLH 1MIUA 1YBYA 3AFPA 1N8RC 1HZCA 4IURA 3SHLA 2FFKB 5C3EH 3L2PA 1U4MA 3NENA 4M1UB 3RN2A 3HGBA 1OO9B 2VQFL 4RWSC 1V43A 2EDGA 3H91A 3I72A 5C44B 1JORA 4NXML 1PMRA 2ATWA 2AUJD 1B50A 2J0TD 3J7AF 5GADC 4JI6L 1Y8OB 2DY8A 4KV6A 4WRDA 1S40A 2F0IA 2KCMA 4YCWA 4XQJA 1PV4A 1JE4A 4HJ9A 4PV1C 1VQEA 2R92H 2PMZB 4P72A 1O7IA 3NTHA 1PH2A 1P16A 4A3KH 3CHBD 2O4XA 4OO1G 2K5NA 3PIPA 2K5VA 2P5ZX 1TS4A 3BJUA 2WAQE 1KC8C 3R93A 3GDEA 2PYKA 1YJWA 3PO3B 3OIPA 1RKNA 4DUYQ 1S4ZA 2X69A 5I9OA 1PRTF 4A3JH 1CFMA 2VQEL 1EYGA 2N49A 2LXKA 1IBLQ 3A56A 4R8NA 4DV2Q 3ULJA 2VW9A 4GKKQ 2IJ0A 4JI8Q 3AEVA 3P75A 3CW2C 3KOJA 5CV4A 2HT1A 2ZTDA 2BE5C 1SE4A 1K83B 1PZID 4GZYC 1V1PA 5FOBB 1LTAD 5ELCA 5JVH3 1X55A 3I4NH 3GTJB 1E0BA 3B6YA 2JEBI 3KK7A 1X3QA 2QILA 2QEXA 2XIWA 2PW5A 3KLWA 3CCMA 2N78A 1FNWA 2JA8B 1N32L 1Y1WG 4A3JG 4K5VA 1TY0A 5JVG3 4A3CG 2YV5A 1D6EC 5LL6X 4DV7L 3SXHA 4I7AA 3VA5A 2K4KA 3CQZH 3CCJA 1PRTD 3LWUA 5KNDA 1JWSD 3CU7A 3T51B 4LMQD 5C4JB 2YU9H 4YWKA 5CMDA 1DD2A 3UI2A 2DNCA 1H9SA 3SEBA 1PZJD 5DAUA 1EWCA 1EOTA 1EQVA 1Y8PB 1ICWA 2KEDA 5T1IA 4WORA 4RKBA 1G6PA 4BY7G 1S72A 2LMCB 4IQZA 3I70A 4HN7A 1PH7A 2ASBA 2OCEA 1I94L 1IW7C 1O7LA 1EZ8A 2WACA 2A6HC 3S2HB 3VYTA 1BBWA 4F7XA 3GTLB 4GKJQ 4QMGA 2WINB 3FHWA 2XN9C 5GAGC 4O42A 4R4QA 1PXUA 1E24A 3CCQA 1GHKA 2QKIC 4KK7A 2ZTEA 3G71A 2JA6G 1JJCB 1M8AA 3C1EA 5C3EB 1ILQA 1O7YA 1CZGA 1XTDA 2CQAA 5M3FG 2WAQG 2UU9L 1HZBA 2VB3X 1WD1A 4LFAQ 3J80i 4UP9A 1RD9D 1F2LA 4YHHQ 1CKMA 1KD1C 5F2DA 1WCMG 1VQPA 1EYAA 2HQEA 4JK1C 4UDUC 2I0QA 4WJ3M 2I07B 2PO4A 1C9OA 4KD4A 1R4QB 1X3FA 1KAAA 2I5MX 3GV6A 4KJNA 1VQGA 1RL2A 4DV0L 5FO7B 4K8JA 1YJ9A 1SNCA 3W2DA 3TZDA 1PZKD 4K5XA 1XNQL 3S17H 1ILPA 3TP6A 4A3KB 4KY6A 1Y1VH 1S3OA 4OWWB 2NVQH 5IGDA 4WJ4A 2MO1A 1LTSD 5LMUQ 2IY5B 1JJGA 3QOJA 4DR2Q 2UUCL 3MAQA 3S24A 2H4OA 4L63B 4C3JH 2JA7H 4KHPL 1A15A 1F77A 4JOIA 1VMPA 2RCNA 1Y1WB 1L1OB 2BOSA 3K6OA 3C1FA 4A3JB 2IW3A 4QUCA 1D5XC 4PMWA 4CKBA 4IPHA 2MUYA 3SK8A 1I6HH 2E75C 3V2TA 3CXCA 1JICA 4LF9L 3F2CA 1XYIA 2L15A 1NR4A 4C2MH 1KAWA 1CZWA 2CFMA 1JOKA 1IBKQ 5BR8Q 1QE6A 5CBAE 1EU3A 4RAUC 1GUTA 2RHQB 3OYYA 4HAEA 4KN4C 3I4NB 1YHBA 4BY7B 5CGKA 1W6KA 1TWAH 3FPUB 3GTKB 4R4CA 2CQOA 3VDYA 2O5IC 2JA7G 2K32A 1C0AA 1F9QA 3G6JB 2BA0A 1EEID 1ESFA 1B70B 5C4XH 1VQLA 1S5CD 3I55A 4MZ9A 1XMQL 4IUVA 3PUZA 4JV5Q 3CQZB 4A3EG 2JA5H 1EIGA 3KF8B 4HJ5A 5IP9G 4QGUA 5CC4A 2YU9B 5GQOA 5M3FB 2IPKD 4A3LH 1PTOC 1C7YA 2ICIA 5JJLA 5FK9C 2WKCA 3T53B 2F0NA 4G7HC 2A5HA 1WCMB 5EKLA 4B3MQ 1GVPA 1UEAB 2HIXA 4FF1A 5ELOA 1LTLA 5AJ3L 3BVMA 3DLLA 1PH5A 2C35B 1LYLA 4K14A 4JI1L 4A3IG 2ZT9C 3FVQA 1Y8NB 3HOYH 5L37A 5LMNL 4BA1I 4V0BA 1J5EL 4KTAA 1TKWB 4BXXH 2LSSA 5CYUA 3TRZA 2B39A 2L12A 2M9VA 1Y69U 4O2DA 1EEFD 4YY3L 2B8FA 2B63H 1HXYD 5A2QL 3K5NA 4A3GH 2EPBA 4DPGA 1YHQA 3S15H 4MHEA 2K1BA 3M4QA 1HNXL 2I5LX 1TY2A 1HNZL 4IFDI 4DN4M 5IE8A 4GLAC 1PFBA 3HKSA 5DEHA 4GOPA 3E3XA 1R9TH 1JWMD 4U673 3WOEA 5FKAC 1AP0A 1VS0A 3M9BA 4BXXG 1EY5A 4QB4A 4LK1C 4A3DH 4XQNA 3PIOA 1FJGL 2A19A 2Q8TA 2FMCA 2NN6I 3BU2A 1XMOQ 2OQ0A 2PNHA 4FVMA 1VQMA 2NVQB 1M1KC 3NQTA 3TQYA 4C3JB 2JA7B 1IXRA 4X62L 5FJ8G 3D6CA 5J3BA 5K36H 3MHBA 1KDBA 2B2YA 2EOTA 1FGBD 3D31A 2K52A 2ZXPA 4J8QA 1BUVT 5IT9L 1CA5A 2Z8LA 3CMEA 1I6HB 1SXTA 5KYLA 4OIKA 2KJXA 2D2CC 2Q2IA 4K0KQ 2F0EA 3KJPA 5HY6A 3D4DA 1H9KA 2L11A 1B9MA 4A3DG 1MSGA 2F3WA 2SOBA 2JSOA 1NNXA 1HTLD 3K5OA 1CQFA 4TKOB 1TWAB 3STBD 4P71A 2FJ2A 1Q82C 1NY4A 2KHIA 1VQCA 4KKUA 3JAML 4JI7L 3VR4A 4K5WA 3I4MH 1H9SB 3QO2A 5K36G 2K28A 4IUUA 4MTNA 5M5WH 4A3IB 5C4XB 1Z6HA 1NBWA 1E22A 1RTOA 2QGQA 4LAAA 1VQAA 5NUCA 2BDOA 2JA5B 1M4VA 2EYLA 1JWUD 3M4PA 1PH3A 3A7AB 3RLNA 1C48A 1BR9A 1GHJA 1W3SA 2PI2A 3SK5A 1HZAA 1KQSA 3KYHC 3DM3A 5KIXA 2MPMA 3W3AA 1STYA 1EY7A 4CJ2C 2EY6A 5J22A 1WTQA 5DNFA 1HZ9A 1VQKA 1N36Q 1N34L 4GNXC 1X3EA 4DF7A 3CMAA 2B29A 4IUNA 4J15A 3M3YH 1ET9A 3RUZA 2UXCL 3KLSX 1AZQA 1JOOA 5EQ0A 5LL6S 3GP7A 2VY3A 2JQOA 3S14H 1I4XA 1DOKA 3ONAB 3ND8A 1A6XA 3HOYB 2D0OA 2PQEA 3MFYA 1MGSA 3EVQA 4KI0A 2G9DA 1IYJB 3A7LA 1IBML 1UUPA 3ULLA 3AYHB 3DEPA 4B3TQ 5M5YB 3QG1A 3OW2A 1I50H 2B63B 1TS5A 4UPAA 1T9HA 4NDXA 4JI5Q 3HOUG 3KF6B 4BBSH 3S15B 1L0YB 1GO3E 4HJ7A 2FMMA 2OT2A 1Q3LA 1EFWA 4RCNA 1HJPA 2D9UA 2SNSA 4ID6A 2PI2E 5IT9c 5FLXE 3A54A 1N33Q 2NVXB 3AU7A 3TP8A 2E8GA 1ESRA 4DV4Q 2VUMH 1Q1EA 1HUNA 2RA4A 4A3DB 1TU2B 3PV0A 2L55A 4RG1A 5FO8B 1EL0A 4P2CB 1PH4A 2E2JB 3PO2H 4AYBG 4DR7Q 1VQIA 2EVBA 2WV6D 3CKIB 1VQ7A 4JI4Q 2JYOA 3PUWA 2DJFC 5CV5A 3JAMc 4NW2A 2UXDL 5EKIA 5GROA 4X65L 5C4HA 3F2BA 4H44C 1NTGA 1MD2D 2UXBL 1TS3A 2KENA 1LT6D 1C8CA 3PF5A 4U68A 3EROA 3CPWA 1VQ6A 1DYQA 1UWVA 1L0XB 2X6GA 5M5XH 2MGSA 1IL2A 5I2XA 4JI2Q 4LFCL 4DV3L 1G51A 3AQQA 1LT5D 1L1OA 4KMUC 2NVTH 3TSSA 3PO2G 2F0LA 2C5CA 1X54A 5JEAH 4C56C 5IGCA 1TWFH 4IN3A 2CVRA 4G7ZC 3G48A 4DV6L 1OXTA 3PO3G 3BVGA 1K8MA 5M5WB 4IFDG 1HQMC 4KN7C 3A0JA 1G2SA 1YNJC 2R7FA 1MSHA 4HSPA 4CGYB 3UE1A 2F0UA 3NUCA 4LF8L 3TS2A 3KBGA 1TWHH 2O5JC 4EX5A 1F2YA 5IY0A 1YVCA 3A5UA 1X3GA 4X64L 2BA1A 3WOFA 1B53A 2B2VA 2OXPA 1SMYD 1WTRA 3VYRA 1SE2A 5JJKA 3I91A 2GN5A 3BG3A 3K7AH 2N88A 3SVMA 4L5QA 4DU9A 3M3YB 5JEAG 1HNWQ 1ZYRC 3OSOA 3S14B 3Q6SA 3ICEA 1B3QA 3DM1A 1UEBA 2AHOB 3V05A 1BCPF 2JA8G 3NP8A 5IYBH 1I4GA 1VCIA 2VL6A 1CM9A 1LTID 4DNIA 2JJQA 1W2BA 5FLMH 3HOZH 3KFUA 4HJ8A 4G4KA 5IWAQ 3U4VA 3J81c 2H1EA 4XYOA 4FNFA 2B8GA 5JEAJ 3K57A 4AQYQ 3VR5A 1BQQT 3MVVA 4GOPB 4AYBB 4IPCA 4QL5A 1I50B 3G4SA 1ZKOA 3LGJA 3L7ZC 1VQ8A 3J80E 4KKTA 2MJ8A 4GKKL 2CCZA 3GTGH 1A3TA 1KNEA 1LM0A 3I4OA 1EY9A 2K5QA 4HMJA 1PH1A 3OMGA 4EQ5A 5IP7G 1EIYB 1HFGA 3EQLC 1SJHD 4MNOA 5ELBA 5ELDA 1SNDA 2F0MA 2QEJC 2C9OA 2B2UC 4NPSA 4P74A 5FLMG 2KUMA 4B3SQ 2DN8A 1XNRQ 3OMCA 5IOCA 1BCPD 2VUMB 2KHJA 2MFIA 4MN3A 3DWAA 1SE3A 1A2TA 3NHHA 1J9OA 2J7ZA 5C3EG 2Z6KC 3GTQH 4KHZA 3TEHB 3PO2B 2VS1A 1RDPD 4Z9CB 2N8NA 1BVSA 2E5LQ 1Z7TA 3R3OA 4LWCA 4OXPA 3IFTA 3VYSA 3U9SA 1DM0B 3T1YQ 4ME3A 3KJOA 3H6MA 2ZM6L 4ABNA 2Q2HA 4RGMA 1O80A 2CH4A 4CBVA 2HHHQ 2CHBD 5I6YA 1DZ1A 4PMBA 1UE6A 3K8AA 3ULPA 1WI5A 1J8IA 1K0RA 1CI3M 4JYAL 5M5XB 3C2PA 4I65A 3ITPA 1RJTA 4RCOA 2R92G 1BBUA 4JI0L 1KNAA 3BS1A 1N9WA 1RODA 3X3NA 3FDTA 1ZEQX 4A3KG 1B8AA 2M00A 2NVTB 4DUZL 1MBYA 1K0SA 4UP7A 4GKJL 2JN4A 3LNNA 3GTOH 4EQOA 1GXDC 1HUMA 1R4PB 3F2DA 1TWFB 1RHPA 2F0GA 2IL8A 3S1MH 4KY7A 3S2DH 4QCLA 3UDGA 4X3SA 1E2VA 4IPGA 3LX0A 1I4PA 5GAHC 3T1HQ 3K81C 3VA7A 1HPCA 2WP8J 4LF7Q 1BF4A 1TWHB 3CCSA 4L5SA 4YHHL 2LKVA 1Z9FA 1TXYA 1LACA 4APVA 3A8IE 2L4NA 2Z0SA 3TZUA 2L9HA 2K05A 3I4NG 1B3AA 4IUQA 2F1MA 1D5MC 1EYCA 3KDFA 3JAMi 2IT1A 1XJVA 2QW7A 2ZJQA 2TSSA 2YTVA 3AB9A 3UE0A 1Q90A 2HUGA 2WFWA 5EJWA 3TREA 1S5FD 1Q8IA 4JI3Q 4ZLTF 3HOZB 4NKLA 1HR0Q 2B2TC 1X9NA 3ERSX 4L5RC 3E5SA 4NP5A 2UUBQ 1EFID 1F2MA 2EY1A 3NPPA 1JOQA 2DNEA 2WB1G 5T1GA 4EGVA 4ZYSA 5EKKA 1XPRA 4OGQC 3J7A5 3BZKA 4Y52H 3I90A 2CW0D 2R7DA 4N8FA 2X6LA 3QIAA 2KEEA 2ZJRA 1OXUA 3QR8A 2Y0SE 1SYBA 2V4DA 1G8ZD 3P20A 4N9TA 5CORA 1NSNS 1PFNA 3MXGA 3J7YW 3LWEA 4K6DA 1G91A 2XSCA 1N32Q 4LW1A 2PZUA 3TMEA 3I3CA 4L6TB 2RF4A 1FR3A 3FEWX 4WFN3 5I4DA 4HJAA 1VQHA 3DWPA 4DV7Q 5COYA 5ELFA 2R92B 3KF6A 5D65A 5JPMC 4OL7A 4AIMA 3M4OH 2SEBD 3DHQA 4GN3B 3CCLA 3GTQB 3PSIA 3BDCA 1NAPA 2L0CA 1NE3A 3IFDA 4JC0A 4YCVA 1EY8A 1EY4A 4BY1H 2VXWA 1SYFA 1K28A 4JV5L 3G6EA 3NWSA 2MO0A 2A69D 2CWAA 2PCFB 2A1AA 3L0OA 3CRKC 4FDBA 4DR5L 4LNQA 3VR2A 1I94Q 1AZPA 2NYZD 1QILA 4LF6L 4Y7NH 4KHVA 1UNSA 4V190 1GD7A 1QOHA 2NZ1D 4OELB 4L5TA 4A3FH 4C3HH 4IJLA 4B3ML 1SNMA 1I4QA 3FKIH 4TSSA 3J81i 2F4VL 3K0XA 2AMCB 1I3QH 2CH4W 4LFBL 5J1ZA 2AQ2B 1AE2A 3RZOH 1EYDA 1Y1VG 2QCPX 1PLFA 3AFQA 1HFNA 3PGZA 1F9PA 2L5TA 4C3IH 3KLSA 1PH8A 4B08A 1WTWA 4JBWA 4OHJA 1RCVD 1IHZA 3S1MB 1JT8A 4C3JG 3S2DB 3BZCA 4I7ZC 2KECA 5CV6A 5CV8A 4ZQ3A 1O7ZA 3HOVH 1KIXA 4DR4Q 1SMYC 2WKDA 1U4LA 3DWQA 4IALA 1SMXA 2XWJB 2K5DA 4JW0A 3QWNA 3S1RH 1ET6A 3K59A 1DJRD 2WB1B 2IHFA 4ZUIA 4DV5L 1WOCA 3H3VC 1JE5A 3K80C 1QUQB 2A6ED 2Y0SG 1A3VA 2JXMB 5C0XH 1Z47A 4X66Q 1T5XD 1AEXA 3DXJC 4XYQA 4HIOA 1EQRA 3IRBA 2F0DA 4LUOA 3HOVG 3ZJYC 4LF4L 2NZHA 1XMOL 3OTOL 1WTVA 1I5FA 4R4OA 5C4XG 1A3UA 5A35A 3UDFA 2JA5G 1KHIA 3E9HA 4DAMA 5HURA 4QIWB 4QF4A 1U9RA 4A3LG 1SE8A 2Z4HA 4OX9Q 4A75A 3RLOA 4QJFA 1AE3A 1ENFA 3R2TA 3DMUA 5FLXL 5C0XG 2RSOA 4K0KL 2VZAA 4X3UA 5M9OA 2SNMA 1JR0D 3P1HA 3NE5B 1LO5D 4HMIA 2KCNA 2E76C 2Q8IB 1D8LA 2G5DA 1CUKA 1DOMA 1ICFB 3HOYG 4H0LC 1BO0A 3M4OB 1RTNA 2BDNA 3S17B 4IZ8A 1QVFA 2RQXA 1Q12A 5C0XJ 1YITA 1SFOH 1BKBA 1Y1VB 4XDXA 2HIVA 1ZXTA 4KD3A 4DK0A 1HRJA 3KLRA 2B63G 1ONLA 4A3GG 2RDHA 4RGNA 3AMUA 1CKNB 4IOCA 1HR0W 3KUPA 1EIFA 4AH6A 1E1TA 1WYDA 2RKSA 1OTCA 5KGUA 1CTMA 1KDCA 5C4ZA 3F8TA 2K50A 2Z6BA 3BDLA 3A8JE 1PDQA 4Y7NB 3L3OC 5EPJA 1B2TA 1HTPA 4FYDA 2K01A 1XTCD 3BYTB 2JA9A 4C2MB 4C3HB 5LMNQ 1BOSA 2ZTCA 3N52A 1J5EQ 3NELA 3FKIB 1PTOH 1SBBB 4POGA 1GUWA 1I3QB 4BA2I 4PZ8A 1STBA 3Q24A 2HDMA 1K3BC 2Y0SB 3RZOB 3OWEB 2IWHA 1PH6A 4C3IB 2O2LD 1WD0A 4DAVA 4RHSA 4DR1L 4AYBE 1GKHA 1X3PA 4A3BH 1KDAA 1HNXQ 1IYUA 1PRTC 1AW7A 5IGEA 1QVCA 2Z9HA 1NUCA 3HOVB 1QVGA 3E9IA 1BDOA 5BN3A 1K9MC 4B3TL 4B3RQ 4GNXA 3FP9A 2B2YC 3KDFB 4JI5L 2ICEC 1Q81C 3RR5A 3HOWH 3S1RB 2E2IH 4ILWA 2R3ZA 4F87A 1WTHA 5C3WA 3RZDH 1FJGQ 1VQFA 2HD3A 3FRPB 1SAPA 3IL8A 3OOCA 1N33L 1AH9A 2UUAL 2QF7A 3CCVA 4KJOA 2ZXOA 3MXNA 1ENCA 2J4XA 3I4MG 2OTJA 4P75A 4MTKA 1D1IA 4UP8A 3QOLA 2F52A 3H09A 1X6OA 4DR7L 4IUTA 2EZVA 2AWNA 1FD7D 3J81j 3MA2B 3J80L 1PYSB 3NBIA 2OEOA 2L1BA 4LF5L 5IGFA 2RSNA 5DM73 3PIP3 1K8GA 4A3GB 2B3GA 1CK1A 4FF3A 1I6VC 3U58A 1VQBA 4CDDC 4DR6L 1Q8KA 4JI2L 2F3VA 3O13A 4JI7Q 5IGGA 3L9AX 1P8LA 3NK9A 4KLKA 2I5HA 1E1OA 2AKWB 3RD4A 1IW7D 4WJWA 2F0TA 5M3MH 3H0GH 2F0QA 4JBKA 4XQQA 4CJ0B 1V9PA 1R9TB 3PF4A 4DR3L 1KLUD 2EYJA 1SNPA 5CV7A 1STHA 2K7VA 3RLFA 4EQPA 4DK3C 2A69C 3URYA 1K8AC 1D7QA 4TRDA 5C44H 2D5DA 3OWFA 2JK8A 3MXUA 1QZHA 4R4IA 5A2QE 1G291 3W5OA 1Q1BA 3NEMA 3HOXH 4RGOS 4DFAA 1O78A 4BBSG 5E3FA 1YNND 1CKOA 5KYIA 2OF1A 5CR3A 1DONA 4Q0FA 1KXLA 1YJNA 3M7GA 1TQOA 5IIFA 4QUFA 3I7FA 1B4OA 1A62A 2PZTA 2PQAB 4OWXB 1CT1D 1SJED 5TSSA 3BYYB 3GTMH 5HGTA 1SNQA 1VQNA 1PTOB 1HNWL 2VUMG 2B2WA 2PW7A 2HCCA 3DUZA 3FPPA 3NQIA 3WDNA 1K73C 1SNOA 3D4RA 1U4RA 4CDEC 3HOXG 1EQQA 1ASZA 3I8ZA 1WTPA 2KVMA 5IWAL 1PVOA 2M2LA 4CJ1B 1V8QA 4RH6A 3I4MB 4NB3A 4IOAA 2PNRC 1SYDA 2YYZA 1QZGA 5IT9E 4AQYL 3CAMA 2K33A 1K83H 4G57A 5FO9B 5K5PA 3CC2A 2MP1A 2A6EC 3IAYA 4CKCA 3HOWB 3JC66 1PTOF 4H13C 4O0AA 5IGBA 3HS0C 2MNAA 4BS9A 3T13A 3RZDB 1H9MA 2DGYA 2R7ZH 1PA6A 1XXGA 2DJGC 4A93H 4NXNQ 1YIJA 3JAME 4B3SL 4GN4B 3MEFA 2XTIA 2A68D 1XNRL 1FVIA 3P7JA 4RFBA 1BXTA 3NTKA 4RKLA 1SRUA 4LUZA 1STNA 4A3MH 3K5MA 3HKZB 5C4JH 2E2DC 2YTYA 4X3KA 4C1NK 1QUQA 3W1GA 1MJEA 1JC7A 4DAYB 4OIJA 2E5LL 1MJCA 1SROA 3DEOA 2F0KA 3E0JA 3SR1A 4DUYL 2QA4A 3HG9A 3T1YL 4LFCQ 1G2TA 4DV3Q 2KQ3A 2B2UA 1IBLL 5IYCH 3C46A 1HA5A 4DV2L 5LHY1 1F9RA 4BBSB 4JI8L 1DOLA 1PHJA 2EYFA 4YWLA 3GTPH 2FINB 3PCOB 2Z6KA 1BBXC 4DV6Q 5M3MB 3H0GB 1U4PA 4A3MG 1OXSC 4OO1H 3ERQA 5IYBG 2E74C 4DV1Q 3ER0A 3HOZG 4LF8Q 4RA8A 1LTTD 1U0LA 3NSWA 2K03A 3HFZB 4KY5A 2ZJPA 1VQ9A 4X64Q 2WB1E 2NWGA 1XWEA 4RGTA 3HOXB 1PRTB 1JJ2A 5IYCG 2Z1CA 3T1HL 4YWMA 1CSPA 4LF7L 4K8IA 1QNKA 5AFWA 4PZ7A 2F0VA 2AWOA 4DXGA 5I6WA 2XVSA 1UE1A 3K0YA 5DM63 3GTMB 4OONA 3J81E 3STBC 3PMFA 1AN8A 1SYGA 4J1MA 1CKNA 2OTLA 1S5BD 4FXGC 4GNXB 2R6GA 4QY7A 1EOVA 4K2LA 3VYUA 1Y1WH 2KBNA 3J7AV 4JI3L 5EPKA 4A3CH 3EN2A 3HP3A 4QIWE 2JE6I 2VQFQ 1HR0L 1PYBA 1PFMA 2UUBL 3MWYW 5C0XI 1STAA 1WJJA 1II3A 1GJXA 4NXMQ 2EYHA 1LTGD 4JI6Q 1UAPA 1CA6A 1UE7A 2KHSA 4B9WA 3MXNB 1H9RA 1HA6A 4LFAL 4K2KA 4BY7H 2OQKA 2LS01 3GTKH 4GN5A 1NR2A 4ZAIA 5C5LA 2JP1A 5J39A 1HQRD 4FO2A 2R7ZB 1V1OA 3W1BA 4S3SA 5C3XA 2ALYB 3F1ZA 4A93B 3K7AB 2B2TA 3S1QH 1ENAA 2RBMA 2YTXA 4X3TA 2OWOA 1CHPD 2FHTA 3VR3A 3CD6A 1EWHA 2F0PA 1U5KA 3K58A 4FXKC 2F4IA 3OW7A 5BN5A 2JA6H 4A3MB 2Q2UA 2E2HH 3MXPA 2MQHA 2ZM6Q 1MHWC 2BCOA 2EJFC 2VQEQ 3H94A 3V96A 4EVOA 5M3FH 3I4LA 4A76A 5LMUL 2EYMA 2KOLA 4TVAB 4DR2L 3CCUA 4JYAQ 3PIO3 1WCMH 4X6AH 4JI0Q 1NCVA 4MIUA 1EZ6A 2LY7A 3BZDB 4K6LA 1B44D 3X3MA 2D62A 1MKHA 1A2UA 4B9XA 1GOZA 4DUZQ 4J6HA 4HIKA 3GTGB 3D4WA 3GTPB 1HH2P 4JBJA 3SK6A 1HHVA 1TWGH 1IBKL 4E6IA 5BR8L 1EUJA 2F03A 3I56A 1SDFA 2A74C 3M7NA 2Z4IA 2V1CC 3MC0B 4JPBW 1L0WA 3RN5A 2H5XA 4CDCC 3CCRA 1ASYA 1EIHA 3Q8DA 3H3VI 1YNNC 2LXJA 1IKLA 5KEEA 2MHVA 1S5ED 1X32A 5IYDH 4DA2A 4DR4L 2CKZB 5BN4A 5EGTA 4IUPA 4CDFC 2ID0A 1L2FA 1SR3A 2KCCA 4RHRA 2VB2X 3E0EA 2K75A 2K5WA 1XPOA 3TN2A 3CF5A 1BNZA 5ELEA 5EAYA 5E7NA 3T4AC 5G3LF 1W6JA 2NUCA 5JPNC 3EFXD 4DK1A 1KABA 2F3IA 4DNRB 4FF2A 2BH2A 4XXEA 1RF2D 2RDFA 3CC4A 2HCIA 4A4IA 1IL8A 3HEJA 2QDLA 4XIGS 4X66L 1VQOA 1C4QA 3GD7A 3F2UA 1SEBD 5KNCA 4ZCKA 5IYDG 2Q2TA 3GTOB 4H02A 1DGSA 2UU9Q 2PQAA 2A8VA 1FL0A 4BY1G 3VR6A 5JJZA 4A3EH 1FGUA 4N9PA 1Q86C 3S9WA 5IP9H 4JOIC 3T16A 4UHVA 2G9HD 3GV3A 1FNUA 4QQBX 2XWBB 1WTXA 1LTRD 1SYCA 3CP0A 4OX9L 1VQ4A 1EY6A 4JBMA 4POFA 5G3LD 3HZXA 4A3FG 3T56B 4C3HG 4DV0Q 1CSQA 2A68C 5E1FA 3FKIG 1D1KA 1Q7YC 1XNQQ 4Q5VA 2IX1A 3CRLC 3S1QB 1AFPA 4C3IG 4A3IH 1VDZA 3EJIA 1K8OA 4HIDA 1A63A 2EQSA 1JB3A 2UUCQ 4PMCA 4KKSA 3HRZC 4KHPQ 2NTSA 3PUXA 2JA6B 2E2HB 1V1QA 1OXXK 4DR5Q 1WVLA 3NBHB 5EBDA 2BH8A 3EBEA 2CWPA 1GUGA 2WAQB 4LF6Q 4G7OC 1YNJD 1YZ6A 2SDFA 3MEHA 1TWCH 2F0FA 5KNBA 3D3RA 5DLQE 5I9PA 3Q23A 3G7LA 4LF9Q 2NVYH 3TBIB 1DXMA 2F4VQ 4LFBQ 1WFQA 1J6QA 3D8GA 3SGIA 2F0SA 3MFGA 1KL9A 3EA6A 4YIJA 1TS2A 4F8MA 1CQVA 4JCVE 3A8KE 1TWGB 1BCPC 1FYCA 1MI2A 4XTCS 4DAYA 4DK6C 1ZYRD 1YI2A 2LFNA 3TP7A 1D2BA 3IKJA 2WIIB 5KRUA 1F2ZA 1LT3D 2KA7A 1E2WA 2AQ3B 3QJYA 2PZWA 4IJHA 4H7BA 1TVXA 4IPDA 4BBRH 5M5YH 3J7ZC 2DUDA 1XMQQ 4PG3A 1M90C 2AUKA 1HCZA 4OEMB 2TMPA 1B1ZA 4JVZA 5EPLA 1GUNA 2XGTA 1QWYA 2F0WA 5FJ8H 4ULLA 3CC7A 4DV5Q 1LUZA 3GQBA 3OPOA 2I46A 4B3RL 2RCFA 4BY1B 2F0HA 4BWGB 2NVXH 2EIFA 4UAIA 4PQXA 1NJIC 2GA4B 5AJ3Q 4DGZA 1I4RA 4JI1Q 1B7YB 3ND9A 4ZRZA 1CHQD 1E2ZA 1UE5A 5JOBA 4OWTB 4DNTB 4R8IA 3OTOQ 1N36L 4A3FB 2E2JH 4BBRG 4EQNA 3TS0A 3H3VH 2R93H 3HKZE 1JB7A 1SLJA 2EJMA 4GOPC 1STGA 1V1PB 2RDGA 3CCEA 3Q0AA 3PUVA 1KRSA 4JG2A 4YY3Q 2HQLA 4ALPA 5CBEE 4A3EB 1I4HA 4HCEA 4FF4A 3I2ZA 2EJGC 1QJOA 1HNZQ 2PPBC 1PYWD 5D3IB 3A5ZB 2AQ1B 3A55A 3TDQA 2EE1A 3I73A 3S16H 2KCTA 4ODGA 3RMHA 3GO5A 1WTOA 2QDBA 1SYEA 2R93G 1QG7A 1TT2A 4HEDA 1GUSA 4PZ6A 2HDLA 2BE5D 1YHAA 1D5ZC 1TIID 3FMCA 4ZKBB 5FLXc 1KLGD 1KTKA 1H95A 1IZ6A 4DV4L 4PNYA 1YNXA 4A3BG 2XNAC 4HCSA 4ZUJA 5H1SE 2VNUD 4X62Q 4ME5A 3K5LA 2CW0C 2K5HA 1EQTA 3CPFA 3H15A 4OO1I 1TWCB 2PMZE 3HOUH 1LV9A 4HSVA 4JI4L 3S1NH 3HOWG 4DKAC 2NVYB 3SE0A 5CV9A 2EXDA 4F88A 5D14A 1Q46A 3KBXA 3U50C 1NMGA 1X56A 3PQIA 1GM5A 1YEZA 1IYVA 4M8AA 4LJZC 5IODA 1Y14B 4R4TA 5ISRA 1DCZA 4DR1Q 1TR5A 3BVZA 1H9JA 3PUYA 4CKEA 4DAPA 4HR7B 3R8BA 1LABA 1XPUA 4P73A 1LLRD 2A6HD 1EWIA 4O1NA 1JQYD 3HKZG 4BBRB 1PFSA 1IKMA 1G6ZA 1VQ5A 2RHSB 4TQUS 4YCUA 2EY5A 2FXQA 1STEA 5ELNA 1SFOB 2XRSD 3M4YA 4R9WA 5E4XA 1SSOA 1K3RA 3QB3A 1E3PA 3U4ZA 3NWTA 5C6AA 2UUAQ 1N34Q 2F0OA 1S5DD 3SK4A 4XT3B 5JAVA 2UXCQ 1A0IA 3K7UC 4L8JA 3WWVA 3J81L 1ML0D 1XX8A 5M3MG 3H0GG 2DY7A 4NXNL 3MZ5A 1EY0A 1VF5C 2R93B 2NBFA 3OIQA 2K04A 3ZYYX 1X65A 3Q22A 4R1JA 4RMFA 3UDIA 1RIPA 2N55A 4XT1B 5C44G 1PH9A 1IBMQ 3PO3H 4IFDH 2EY2A 4NMZA 4HIMA 2IX3A 4LF5Q 5HGQA 2A73B 3NTIA 1VQDA 1B9NA 2ZXRA 1FNVA 2F0JA 1EU4A 4A3BB 3SDZA 2NZOA 1T5EA 2EYPA 1QB5D 1VQJA 2EYOA 1GUOA 5C5MA 2RVLA 4DR6Q 1VF7A 2D0PA 1LT4D 4C1NI 2NN6H 3S16B 3U9OA 3E6ZX 3MTSA 2R61A 1JMCA 2E2IB 3J80c 3GTJH 4DR3Q 4ZK9B 3EIVA 2GVBA 3BDOA 2N3SA 5GAEC 3D0FA 4FP5D 1E7ZA 2Q8RE 3RNUA 4GLXA 1LTBD 2ENBA 4IO9A 2B2WC 2JA8H 2K14A 4DXFA 1BCPB 4FXDA 4DV1L 1L1OC 1NMFA 1QCBD 5JJIA 3N6RA 1SN8A 3NXWA 2IHEA 5LMNW 2XRQD 1QNUA 2UXDQ 2ES2A 4X65Q 2NTTA 4ZKCB 4UY8C 4GLVB 4CHTB 4GS3A 2NN6G 5I2YA 2UXBQ 5EBCA 1VMCA
chains in the Genus database with same CATH topology
1X3EA 4IFDJ 2MQHA 2ZM6Q 2B29A 3IRBA 4J15A 3CMAA 3M3YH 2UXCL 2VQEQ 4LUOA 2IX0A 5M3FH 1KRTA 2JEAI 3ZJYC 4A76A 4LUVA 5LMUL 3HOVG 2VY3A 2JQOA 4LF4L 2NZHA 4TVAB 1XMOL 3OTOL 4DR2L 1I5FA 1A8VA 4R4OA 3S14H 5C4XG 3CCUA 1OXVA 3M85A 4JYAQ 5IP7H 4X6AH 1WCMH 3UDXA 2D0OA 2HHHL 3UDFA 2R7ZG 2JA5G 4JI0Q 4A93G 2GVAA 3S2HH 3A74A 1KHIA 3E9HA 3H3VH 4DAMA 3GTLH 2D62A 1MKHA 1MIUA 1YBYA 4DUZQ 3AFPA 4HIKA 4KI0A 4A3LG 1IYJB 1SE8A 1IBML 1HH2P 4JBJA 4A75A 1HZCA 3ULLA 3AYHB 1N8RC 4OX9Q 3RLOA 4QJFA 4B3TQ 3OW2A 1AE3A 1I50H 1TWGH 5C3EH 1IBKL 5C0XG 4UPAA 1T9HA 4JI5Q 5BR8L 2VZAA 1EUJA 3L2PA 3KF6B 3HOUG 3I56A 4K0KL 3NENA 4BBSH 3RN2A 3M7NA 2V1CC 2VQFL 1GO3E 4HJ7A 1D8LA 1L0WA 1V43A 2H5XA 1CUKA 3CCRA 3RN5A 1ASYA 1HJPA 1EFWA 2PI2E 5IT9c 3HOYG 4JBKA 4NXML 3Q8DA 3H3VI 2ATWA 2LXJA 1N33Q 5GADC 4JI6L 1S40A 2E8GA 2KCMA 5IYDH 4YCWA 4DV4Q 5C0XJ 1Q12A 1QVFA 4DR4L 2CKZB 1YITA 1SFOH 1BKBA 1PV4A 2VUMH 1Q1EA 4HJ9A 2HIVA 2ID0A 1L2FA 1SR3A 3E0EA 3PV0A 1VQEA 4RG1A 2K75A 2R92H 1XPOA 2B63G 3CF5A 1PH4A 3PO2H 5EAYA 4P72A 5E7NA 4AYBG 4A3GG 1O7IA 4DR7Q 1PH2A 1CKNB 4IOCA 1P16A 1VQIA 4A3KH 1HR0W 4OO1G 2K5NA 1VQ7A 1EIFA 4AH6A 1E1TA 1WYDA 3PUWA 2F3IA 3JAMc 3PIPA 1OTCA 2K5VA 4JI4Q 2BH2A 3BJUA 3F8TA 2UXDL 5GROA 2K50A 4X65L 3F2BA 2WAQE 3CC4A 4A4IA 1KC8C 3GDEA 1YJWA 4XIGS 4X66L 1NTGA 1VQOA 2UXBL 4DUYQ 2KENA 2JA9A 3GD7A 5LMNQ 2ZTCA 4A3JH 3PF5A 3CPWA 1J5EQ 1VQ6A 3NELA 2VQEL 1EYGA 1UWVA 4POGA 2N49A 2LXKA 1IBLQ 5IYDG 4BA2I 4PZ8A 4DV2Q 2Q2TA 4GKKQ 3ULJA 5M5XH 2VW9A 4JI8Q 1IL2A 3AEVA 4H02A 4JI2Q 1DGSA 3CW2C 1PH6A 2UU9Q 2PQAA 4LFCL 2A8VA 3KOJA 1FL0A 4DV3L 1G51A 4BY1G 2HT1A 2ZTDA 4DR1L 3AQQA 4A3EH 4AYBE 1L1OA 2NVTH 1GKHA 3PO2G 1FGUA 1Q86C 4A3BH 5IP9H 4JOIC 1HNXQ 1X54A 1X55A 1QVCA 3I4NH 4QQBX 1TWFH 3CP0A 3B6YA 3E9IA 1QVGA 4OX9L 2JEBI 3G48A 4DV6L 1VQ4A 1K9MC 4POFA 4B3TL 1OXTA 4JBMA 3PO3G 4IFDG 4B3RQ 4A3FG 4GNXA 3FP9A 2QEXA 3KDFB 4JI5L 4DV0Q 3KLWA 1CSQA 3RR5A 3CCMA 2N78A 1Q81C 3HOWH 2E2IH 3FKIG 3A0JA 1N32L 1Q7YC 2R7FA 1Y1WG 1XNQQ 3UE1A 4LF8L 4A3JG 2IX1A 3TS2A 4A3CG 2YV5A 1TWHH 4DV7L 4A3IH 3RZDH 4EX5A 5IY0A 1FJGQ 1VQFA 1YVCA 3A5UA 4HIDA 1X3GA 2K4KA 3CQZH 4X64L 2BA1A 3CCJA 1N33L 1A63A 2EQSA 2UUCQ 1AH9A 2UUAL 3CCVA 5JJKA 4KHPQ 2GN5A 3PUXA 3K7AH 2YU9H 4YWKA 1V1QA 1OXXK 4DR5Q 4L5QA 3NBHB 3I4MG 2OTJA 2BH8A 3EBEA 5JEAG 1HNWQ 2CWPA 4P75A 4LF6Q 1G6PA 1YZ6A 4BY7G 4UP8A 1S72A 1TWCH 2F52A 3ICEA 5DLQE 4LF9Q 1UEBA 1X6OA 2AHOB 4DR7L 1PH7A 2JA8G 2ASBA 2NVYH 2OCEA 2AWNA 5IYBH 1VCIA 1I94L 2VL6A 4DNIA 2JJQA 1W2BA 5FLMH 3J81j 2F4VQ 3KFUA 4HJ8A 3HOZH 1BBWA 4LFBQ 1WFQA 1J6QA 4GKJQ 1PYSB 5IWAQ 3U4VA 3J81c 3SGIA 1KL9A 3FHWA 5GAGC 4R4QA 4LF5L 5JEAJ 4AQYQ 1E24A 3CCQA 4JCVE 1K8GA 4GOPB 2B3GA 2ZTEA 3G71A 2JA6G 1JJCB 4IPCA 4QL5A 3G4SA 3LGJA 4XTCS 4DK6C 1YI2A 3L7ZC 3U58A 1VQ8A 4GKKL 1VQBA 1XTDA 5M3FG 2CCZA 3GTGH 1Q8KA 4JI2L 4DR6L 2WAQG 4JI7Q 2UU9L 2R93H 1P8LA 1LM0A 4IJHA 4IPDA 4KLKA 2I5HA 1E1OA 2AKWB 3I4OA 1HZBA 4BBRH 5M5YH 5M3MH 3H0GH 4LFAQ 3J80i 3J7ZC 2DUDA 1XMQQ 4UP9A 4PG3A 4EQ5A 5IP7G 1PH1A 1M90C 4YHHQ 1CKMA 1EIYB 1KD1C 1V9PA 4MNOA 1WCMG 1VQPA 3PF4A 4DR3L 2I0QA 4WJ3M 2XGTA 5FJ8H 3CC7A 4DV5Q 4NPSA 4P74A 1C9OA 5FLMG 1LUZA 3RLFA 1K8AC 4B3SQ 4DK3C 1D7QA 1X3FA 5C44H 1XNRQ 2I5MX 2KHJA 2MFIA 1VQGA 4B3RL 2JK8A 1QZHA 1RL2A 4R4IA 4DV0L 1YJ9A 1G291 2NVXH 2EIFA 5C3EG 3W5OA 1Q1BA 3NEMA 2Z6KC 3HOXH 3GTQH 4KHZA 3TEHB 1XNQL 3S17H 2VS1A 1NJIC 4BBSG 1CKOA 1Y1VH 5AJ3Q 2N8NA 1KXLA 1YJNA 1BVSA 2E5LQ 1S3OA 4OWWB 2NVQH 4JI1Q 4WJ4A 2MO1A 1B7YB 4LWCA 5LMUQ 2IY5B 4LF4Q 1JJGA 1UE5A 4OXPA 4OWTB 3OTOQ 4DR2Q 1N36L 3I7FA 4OWXB 1A62A 3S24A 2PQAB 4BBRG 2E2JH 3T1YQ 4C3JH 4ME3A 3KJOA 3TS0A 2JA7H 3HKZE 4JOIA 1JB7A 2ZM6L 4KHPL 1SLJA 2RCNA 2Q2HA 4GOPC 2HHHQ 1L1OB 3GTMH 1UE6A 1VQNA 3K8AA 3ULPA 4PMWA 1HNWL 1WI5A 2VUMG 3CCEA 1K0RA 4IPHA 4JYAL 1I6HH 3PUVA 3CXCA 1KRSA 4JG2A 4YY3Q 4LF9L 2HQLA 3F2CA 1K73C 1BBUA 4JI0L 2R92G 2L15A 4C2MH 1KAWA 1N9WA 4ALPA 2CFMA 1IBKQ 4A3KG 1B8AA 3HOXG 1EQQA 5BR8Q 4DUZL 1ASZA 4UP7A 4GKJL 3I2ZA 5IWAL 1PVOA 2RHQB 3OYYA 1HNZQ 3GTOH 4NB3A 3A5ZB 4IOAA 1YHBA 3F2DA 2YYZA 1QZGA 2KCTA 3S16H 3S1MH 4AQYL 1TWAH 3GO5A 3CAMA 3S2DH 1K83H 4R4CA 2CQOA 3UDGA 3CC2A 3VDYA 2R93G 2JA7G 1C0AA 3JC66 4IPGA 4PZ6A 5GAHC 4O0AA 3T1HQ 2BA0A 3K81C 1YHAA 1B70B 5C4XH 2WP8J 2MNAA 1VQLA 4LF7Q 3I55A 4MZ9A 3CCSA 1XMQL 5FLXc 4L5SA 3PUZA 4YHHL 2DGYA 1Z9FA 2R7ZH 1PA6A 4JV5Q 4A3EG 1H95A 1TXYA 4APVA 2JA5H 4A93H 4NXNQ 1IZ6A 3KF8B 4DV4L 1YNXA 4HJ5A 1YIJA 2Z0SA 4A3BG 5H1SE 5IP9G 4QGUA 2VNUD 4B3SL 4GN4B 3MEFA 4X62Q 2XTIA 5GQOA 1XNRL 3I4NG 1FVIA 4A3LH 1C7YA 5JJLA 2K5HA 3CPFA 1SRUA 3KDFA 3JAMi 4LUZA 2IT1A 3H15A 4A3MH 1XJVA 2PMZE 4OO1I 3HOUH 2ZJQA 4JI4L 4B3MQ 3S1NH 1GVPA 5C4JH 3HOWG 4DKAC 2YTVA 2YTYA 2HIXA 3UE0A 1QUQA 2WFWA 1LTLA 5ELOA 3TREA 3W1GA 5AJ3L 3DLLA 2EXDA 4DAYB 1PH5A 1MJEA 2E5LL 4JI3Q 2C35B 1LYLA 1Q46A 1MJCA 1SROA 4JI1L 1X9NA 1HR0Q 3ERSX 4A3IG 4L5RC 3U50C 1NMGA 1X56A 2UUBQ 3HOYH 4DUYL 1GM5A 2QA4A 3T1YL 5LMNL 1YEZA 4BA1I 4LFCQ 1J5EL 4DV3Q 2WB1G 1Y14B 4R4TA 3J7A5 1XPRA 4DR1Q 4Y52H 3BZKA 1IBLL 4BXXH 2LSSA 5IYCH 4DV2L 2R7DA 4JI8L 3TRZA 1PHJA 3PUYA 4YWLA 3GTPH 2ZJRA 1XPUA 1OXUA 4O2DA 4P73A 2Y0SE 4YY3L 3PCOB 2B63H 2Z6KA 1EWIA 4DV6Q 3HKZG 4A3GH 1PFSA 4DPGA 1VQ5A 1YHQA 4A3MG 1OXSC 3S15H 3M4QA 1HNXL 2RHSB 4TQUS 5IYBG 4YCUA 2I5LX 4DV1Q 1N32Q 3ER0A 3HOZG 4LW1A 1HNZL 2FXQA 5ELNA 4LF8Q 2RF4A 4IFDI 1U0LA 5IE8A 4HJAA 1VQHA 4GLAC 3HKSA 4DV7Q 3HFZB 2ZJPA 1VQ9A 4GOPA 3KF6A 1R9TH 4AIMA 1K3RA 4X64Q 3M4OH 2WB1E 1E3PA 3U4ZA 1VS0A 3M9BA 2UUAQ 1N34Q 4GN3B 3CCLA 1JJ2A 4BXXG 5IYCG 3T1HL 4YWMA 4A3DH 3PSIA 3PIOA 1FJGL 1CSPA 2UXCQ 2A19A 4LF7L 1NE3A 1A0IA 3K7UC 3WWVA 4JC0A 4YCVA 2NN6I 3BU2A 1XMOQ 2OQ0A 2PNHA 1VQMA 4BY1H 1M1KC 4PZ7A 2AWOA 5M3MG 3H0GG 3TQYA 3G6EA 4JV5L 2MO0A 4NXNL 2CWAA 2A1AA 3L0OA 2E2HH 1UE1A 4FDBA 4DR5L 4LNQA 1X65A 1IXRA 4X62L 1I94Q 5FJ8G 5J3BA 4R1JA 4LF6L 4RMFA 4Y7NH 3UDIA 3D31A 4OONA 1RIPA 3STBC 5C44G 2K52A 1GD7A 1PH9A 1IBMQ 3PO3H 4L5TA 4A3FH 3CMEA 4C3HH 1CKNA 4HIMA 2OTLA 4LF5Q 4IJLA 4GNXB 4B3ML 2R6GA 4QY7A 3FKIH 1EOVA 1VQDA 5HGQA 3J81i 2AMCB 3K0XA 2Q2IA 1I3QH 1Y1WH 2F4VL 3KJPA 5HY6A 4LFBL 4K0KQ 2KBNA 1AE2A 4JI3L 3RZOH 4A3CH 1Y1VG 2NZOA 3AFQA 3EN2A 2JE6I 3PGZA 4QIWE 4C3IH 2VQFQ 1PYBA 1VQJA 1HR0L 4A3DG 1PH8A 2UUBL 5C0XI 4DR6Q 2D0PA 1WJJA 4JBWA 4NXMQ 1JT8A 1JMCA 3BZCA 3STBD 4P71A 4JI6Q 1Q82C 1NY4A 2KHIA 3J80c 1UE7A 3GTJH 4DR3Q 3MXNB 1KIXA 3EIVA 1VQCA 2UUCL 4JI7L 2GVBA 3HOVH 5GAEC 2N3SA 3I4MH 4DR4Q 3D0FA 1E7ZA 5K36G 4MTNA 5M5WH 4LFAL 4BY7H 3RNUA 2OQKA 1SMXA 4GLXA 3GTKH 4GN5A 1NBWA 4IO9A 3S1RH 1E22A 2JA8H 2K14A 2QGQA 1VQAA 2IHFA 3W1BA 4DV5L 4DV1L 2ALYB 3F1ZA 1WOCA 1L1OC 3M4PA 1JE5A 1NMFA 1PH3A 3S1QH 5JJIA 3RLNA 3K80C 2YTXA 1SN8A 2OWOA 1QUQB 1W3SA 2IHEA 2PI2A 2Y0SG 5LMNW 1HZAA 2ES2A 2UXDQ 1KQSA 3KYHC 4X65Q 3DM3A 3CD6A 4UY8C 4GLVB 1Z47A 1U5KA 4X66Q 1HZ9A 4GS3A 1VQKA 2NN6G 2JA6H 4HIOA 1N36Q 2UXBQ 2Q2UA 1N34L 1EQRA 4GNXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3E A;  4IFD J;  2MQH A;  2ZM6 Q;  2B29 A;  3IRB A;  4J15 A;  3CMA A;  3M3Y H;  2UXC L;  2VQE Q;  4LUO A;  2IX0 A;  5M3F H;  1KRT A;  2JEA I;  3ZJY C;  4A76 A;  4LUV A;  5LMU L;  3HOV G;  2VY3 A;  2JQO A;  4LF4 L;  2NZH A;  4TVA B;  1XMO L;  3OTO L;  4DR2 L;  1I5F A;  1A8V A;  4R4O A;  3S14 H;  5C4X G;  3CCU A;  1OXV A;  3M85 A;  4JYA Q;  5IP7 H;  4X6A H;  1WCM H;  3UDX A;  2D0O A;  2HHH L;  3UDF A;  2R7Z G;  2JA5 G;  4JI0 Q;  4A93 G;  2GVA A;  3S2H H;  3A74 A;  1KHI A;  3E9H A;  3H3V H;  4DAM A;  3GTL H;  2D62 A;  1MKH A;  1MIU A;  1YBY A;  4DUZ Q;  3AFP A;  4HIK A;  4KI0 A;  4A3L G;  1IYJ B;  1SE8 A;  1IBM L;  1HH2 P;  4JBJ A;  4A75 A;  1HZC A;  3ULL A;  3AYH B;  1N8R C;  4OX9 Q;  3RLO A;  4QJF A;  4B3T Q;  3OW2 A;  1AE3 A;  1I50 H;  1TWG H;  5C3E H;  1IBK L;  5C0X G;  4UPA A;  1T9H A;  4JI5 Q;  5BR8 L;  2VZA A;  1EUJ A;  3L2P A;  3KF6 B;  3HOU G;  3I56 A;  4K0K L;  3NEN A;  4BBS H;  3RN2 A;  3M7N A;  2V1C C;  2VQF L;  1GO3 E;  4HJ7 A;  1D8L A;  1L0W A;  1V43 A;  2H5X A;  1CUK A;  3CCR A;  3RN5 A;  1ASY A;  1HJP A;  1EFW A;  2PI2 E;  5IT9 c;  3HOY G;  4JBK A;  4NXM L;  3Q8D A;  3H3V I;  2ATW A;  2LXJ A;  1N33 Q;  5GAD C;  4JI6 L;  1S40 A;  2E8G A;  2KCM A;  5IYD H;  4YCW A;  4DV4 Q;  5C0X J;  1Q12 A;  1QVF A;  4DR4 L;  2CKZ B;  1YIT A;  1SFO H;  1BKB A;  1PV4 A;  2VUM H;  1Q1E A;  4HJ9 A;  2HIV A;  2ID0 A;  1L2F A;  1SR3 A;  3E0E A;  3PV0 A;  1VQE A;  4RG1 A;  2K75 A;  2R92 H;  1XPO A;  2B63 G;  3CF5 A;  1PH4 A;  3PO2 H;  5EAY A;  4P72 A;  5E7N A;  4AYB G;  4A3G G;  1O7I A;  4DR7 Q;  1PH2 A;  1CKN B;  4IOC A;  1P16 A;  1VQI A;  4A3K H;  1HR0 W;  4OO1 G;  2K5N A;  1VQ7 A;  1EIF A;  4AH6 A;  1E1T A;  1WYD A;  3PUW A;  2F3I A;  3JAM c;  3PIP A;  1OTC A;  2K5V A;  4JI4 Q;  2BH2 A;  3BJU A;  3F8T A;  2UXD L;  5GRO A;  2K50 A;  4X65 L;  3F2B A;  2WAQ E;  3CC4 A;  4A4I A;  1KC8 C;  3GDE A;  1YJW A;  4XIG S;  4X66 L;  1NTG A;  1VQO A;  2UXB L;  4DUY Q;  2KEN A;  2JA9 A;  3GD7 A;  5LMN Q;  2ZTC A;  4A3J H;  3PF5 A;  3CPW A;  1J5E Q;  1VQ6 A;  3NEL A;  2VQE L;  1EYG A;  1UWV A;  4POG A;  2N49 A;  2LXK A;  1IBL Q;  5IYD G;  4BA2 I;  4PZ8 A;  4DV2 Q;  2Q2T A;  4GKK Q;  3ULJ A;  5M5X H;  2VW9 A;  4JI8 Q;  1IL2 A;  3AEV A;  4H02 A;  4JI2 Q;  1DGS A;  3CW2 C;  1PH6 A;  2UU9 Q;  2PQA A;  4LFC L;  2A8V A;  3KOJ A;  1FL0 A;  4DV3 L;  1G51 A;  4BY1 G;  2HT1 A;  2ZTD A;  4DR1 L;  3AQQ A;  4A3E H;  4AYB E;  1L1O A;  2NVT H;  1GKH A;  3PO2 G;  1FGU A;  1Q86 C;  4A3B H;  5IP9 H;  4JOI C;  1HNX Q;  1X54 A;  1X55 A;  1QVC A;  3I4N H;  4QQB X;  1TWF H;  3CP0 A;  3B6Y A;  3E9I A;  1QVG A;  4OX9 L;  2JEB I;  3G48 A;  4DV6 L;  1VQ4 A;  1K9M C;  4POF A;  4B3T L;  1OXT A;  4JBM A;  3PO3 G;  4IFD G;  4B3R Q;  4A3F G;  4GNX A;  3FP9 A;  2QEX A;  3KDF B;  4JI5 L;  4DV0 Q;  3KLW A;  1CSQ A;  3RR5 A;  3CCM A;  2N78 A;  1Q81 C;  3HOW H;  2E2I H;  3FKI G;  3A0J A;  1N32 L;  1Q7Y C;  2R7F A;  1Y1W G;  1XNQ Q;  3UE1 A;  4LF8 L;  4A3J G;  2IX1 A;  3TS2 A;  4A3C G;  2YV5 A;  1TWH H;  4DV7 L;  4A3I H;  3RZD H;  4EX5 A;  5IY0 A;  1FJG Q;  1VQF A;  1YVC A;  3A5U A;  4HID A;  1X3G A;  2K4K A;  3CQZ H;  4X64 L;  2BA1 A;  3CCJ A;  1N33 L;  1A63 A;  2EQS A;  2UUC Q;  1AH9 A;  2UUA L;  3CCV A;  5JJK A;  4KHP Q;  2GN5 A;  3PUX A;  3K7A H;  2YU9 H;  4YWK A;  1V1Q A;  1OXX K;  4DR5 Q;  4L5Q A;  3NBH B;  3I4M G;  2OTJ A;  2BH8 A;  3EBE A;  5JEA G;  1HNW Q;  2CWP A;  4P75 A;  4LF6 Q;  1G6P A;  1YZ6 A;  4BY7 G;  4UP8 A;  1S72 A;  1TWC H;  2F52 A;  3ICE A;  5DLQ E;  4LF9 Q;  1UEB A;  1X6O A;  2AHO B;  4DR7 L;  1PH7 A;  2JA8 G;  2ASB A;  2NVY H;  2OCE A;  2AWN A;  5IYB H;  1VCI A;  1I94 L;  2VL6 A;  4DNI A;  2JJQ A;  1W2B A;  5FLM H;  3J81 j;  2F4V Q;  3KFU A;  4HJ8 A;  3HOZ H;  1BBW A;  4LFB Q;  1WFQ A;  1J6Q A;  4GKJ Q;  1PYS B;  5IWA Q;  3U4V A;  3J81 c;  3SGI A;  1KL9 A;  3FHW A;  5GAG C;  4R4Q A;  4LF5 L;  5JEA J;  4AQY Q;  1E24 A;  3CCQ A;  4JCV E;  1K8G A;  4GOP B;  2B3G A;  2ZTE A;  3G71 A;  2JA6 G;  1JJC B;  4IPC A;  4QL5 A;  3G4S A;  3LGJ A;  4XTC S;  4DK6 C;  1YI2 A;  3L7Z C;  3U58 A;  1VQ8 A;  4GKK L;  1VQB A;  1XTD A;  5M3F G;  2CCZ A;  3GTG H;  1Q8K A;  4JI2 L;  4DR6 L;  2WAQ G;  4JI7 Q;  2UU9 L;  2R93 H;  1P8L A;  1LM0 A;  4IJH A;  4IPD A;  4KLK A;  2I5H A;  1E1O A;  2AKW B;  3I4O A;  1HZB A;  4BBR H;  5M5Y H;  5M3M H;  3H0G H;  4LFA Q;  3J80 i;  3J7Z C;  2DUD A;  1XMQ Q;  4UP9 A;  4PG3 A;  4EQ5 A;  5IP7 G;  1PH1 A;  1M90 C;  4YHH Q;  1CKM A;  1EIY B;  1KD1 C;  1V9P A;  4MNO A;  1WCM G;  1VQP A;  3PF4 A;  4DR3 L;  2I0Q A;  4WJ3 M;  2XGT A;  5FJ8 H;  3CC7 A;  4DV5 Q;  4NPS A;  4P74 A;  1C9O A;  5FLM G;  1LUZ A;  3RLF A;  1K8A C;  4B3S Q;  4DK3 C;  1D7Q A;  1X3F A;  5C44 H;  1XNR Q;  2I5M X;  2KHJ A;  2MFI A;  1VQG A;  4B3R L;  2JK8 A;  1QZH A;  1RL2 A;  4R4I A;  4DV0 L;  1YJ9 A;  1G29 1;  2NVX H;  2EIF A;  5C3E G;  3W5O A;  1Q1B A;  3NEM A;  2Z6K C;  3HOX H;  3GTQ H;  4KHZ A;  3TEH B;  1XNQ L;  3S17 H;  2VS1 A;  1NJI C;  4BBS G;  1CKO A;  1Y1V H;  5AJ3 Q;  2N8N A;  1KXL A;  1YJN A;  1BVS A;  2E5L Q;  1S3O A;  4OWW B;  2NVQ H;  4JI1 Q;  4WJ4 A;  2MO1 A;  1B7Y B;  4LWC A;  5LMU Q;  2IY5 B;  4LF4 Q;  1JJG A;  1UE5 A;  4OXP A;  4OWT B;  3OTO Q;  4DR2 Q;  1N36 L;  3I7F A;  4OWX B;  1A62 A;  3S24 A;  2PQA B;  4BBR G;  2E2J H;  3T1Y Q;  4C3J H;  4ME3 A;  3KJO A;  3TS0 A;  2JA7 H;  3HKZ E;  4JOI A;  1JB7 A;  2ZM6 L;  4KHP L;  1SLJ A;  2RCN A;  2Q2H A;  4GOP C;  2HHH Q;  1L1O B;  3GTM H;  1UE6 A;  1VQN A;  3K8A A;  3ULP A;  4PMW A;  1HNW L;  1WI5 A;  2VUM G;  3CCE A;  1K0R A;  4IPH A;  4JYA L;  1I6H H;  3PUV A;  3CXC A;  1KRS A;  4JG2 A;  4YY3 Q;  4LF9 L;  2HQL A;  3F2C A;  1K73 C;  1BBU A;  4JI0 L;  2R92 G;  2L15 A;  4C2M H;  1KAW A;  1N9W A;  4ALP A;  2CFM A;  1IBK Q;  4A3K G;  1B8A A;  3HOX G;  1EQQ A;  5BR8 Q;  4DUZ L;  1ASZ A;  4UP7 A;  4GKJ L;  3I2Z A;  5IWA L;  1PVO A;  2RHQ B;  3OYY A;  1HNZ Q;  3GTO H;  4NB3 A;  3A5Z B;  4IOA A;  1YHB A;  3F2D A;  2YYZ A;  1QZG A;  2KCT A;  3S16 H;  3S1M H;  4AQY L;  1TWA H;  3GO5 A;  3CAM A;  3S2D H;  1K83 H;  4R4C A;  2CQO A;  3UDG A;  3CC2 A;  3VDY A;  2R93 G;  2JA7 G;  1C0A A;  3JC6 6;  4IPG A;  4PZ6 A;  5GAH C;  4O0A A;  3T1H Q;  2BA0 A;  3K81 C;  1YHA A;  1B70 B;  5C4X H;  2WP8 J;  2MNA A;  1VQL A;  4LF7 Q;  3I55 A;  4MZ9 A;  3CCS A;  1XMQ L;  5FLX c;  4L5S A;  3PUZ A;  4YHH L;  2DGY A;  1Z9F A;  2R7Z H;  1PA6 A;  4JV5 Q;  4A3E G;  1H95 A;  1TXY A;  4APV A;  2JA5 H;  4A93 H;  4NXN Q;  1IZ6 A;  3KF8 B;  4DV4 L;  1YNX A;  4HJ5 A;  1YIJ A;  2Z0S A;  4A3B G;  5H1S E;  5IP9 G;  4QGU A;  2VNU D;  4B3S L;  4GN4 B;  3MEF A;  4X62 Q;  2XTI A;  5GQO A;  1XNR L;  3I4N G;  1FVI A;  4A3L H;  1C7Y A;  5JJL A;  2K5H A;  3CPF A;  1SRU A;  3KDF A;  3JAM i;  4LUZ A;  2IT1 A;  3H15 A;  4A3M H;  1XJV A;  2PMZ E;  4OO1 I;  3HOU H;  2ZJQ A;  4JI4 L;  4B3M Q;  3S1N H;  1GVP A;  5C4J H;  3HOW G;  4DKA C;  2YTV A;  2YTY A;  2HIX A;  3UE0 A;  1QUQ A;  2WFW A;  1LTL A;  5ELO A;  3TRE A;  3W1G A;  5AJ3 L;  3DLL A;  2EXD A;  4DAY B;  1PH5 A;  1MJE A;  2E5L L;  4JI3 Q;  2C35 B;  1LYL A;  1Q46 A;  1MJC A;  1SRO A;  4JI1 L;  1X9N A;  1HR0 Q;  3ERS X;  4A3I G;  4L5R C;  3U50 C;  1NMG A;  1X56 A;  2UUB Q;  3HOY H;  4DUY L;  1GM5 A;  2QA4 A;  3T1Y L;  5LMN L;  1YEZ A;  4BA1 I;  4LFC Q;  1J5E L;  4DV3 Q;  2WB1 G;  1Y14 B;  4R4T A;  3J7A 5;  1XPR A;  4DR1 Q;  4Y52 H;  3BZK A;  1IBL L;  4BXX H;  2LSS A;  5IYC H;  4DV2 L;  2R7D A;  4JI8 L;  3TRZ A;  1PHJ A;  3PUY A;  4YWL A;  3GTP H;  2ZJR A;  1XPU A;  1OXU A;  4O2D A;  4P73 A;  2Y0S E;  4YY3 L;  3PCO B;  2B63 H;  2Z6K A;  1EWI A;  4DV6 Q;  3HKZ G;  4A3G H;  1PFS A;  4DPG A;  1VQ5 A;  1YHQ A;  4A3M G;  1OXS C;  3S15 H;  3M4Q A;  1HNX L;  2RHS B;  4TQU S;  5IYB G;  4YCU A;  2I5L X;  4DV1 Q;  1N32 Q;  3ER0 A;  3HOZ G;  4LW1 A;  1HNZ L;  2FXQ A;  5ELN A;  4LF8 Q;  2RF4 A;  4IFD I;  1U0L A;  5IE8 A;  4HJA A;  1VQH A;  4GLA C;  3HKS A;  4DV7 Q;  3HFZ B;  2ZJP A;  1VQ9 A;  4GOP A;  3KF6 A;  1R9T H;  4AIM A;  1K3R A;  4X64 Q;  3M4O H;  2WB1 E;  1E3P A;  3U4Z A;  1VS0 A;  3M9B A;  2UUA Q;  1N34 Q;  4GN3 B;  3CCL A;  1JJ2 A;  4BXX G;  5IYC G;  3T1H L;  4YWM A;  4A3D H;  3PSI A;  3PIO A;  1FJG L;  1CSP A;  2UXC Q;  2A19 A;  4LF7 L;  1NE3 A;  1A0I A;  3K7U C;  3WWV A;  4JC0 A;  4YCV A;  2NN6 I;  3BU2 A;  1XMO Q;  2OQ0 A;  2PNH A;  1VQM A;  4BY1 H;  1M1K C;  4PZ7 A;  2AWO A;  5M3M G;  3H0G G;  3TQY A;  3G6E A;  4JV5 L;  2MO0 A;  4NXN L;  2CWA A;  2A1A A;  3L0O A;  2E2H H;  1UE1 A;  4FDB A;  4DR5 L;  4LNQ A;  1X65 A;  1IXR A;  4X62 L;  1I94 Q;  5FJ8 G;  5J3B A;  4R1J A;  4LF6 L;  4RMF A;  4Y7N H;  3UDI A;  3D31 A;  4OON A;  1RIP A;  3STB C;  5C44 G;  2K52 A;  1GD7 A;  1PH9 A;  1IBM Q;  3PO3 H;  4L5T A;  4A3F H;  3CME A;  4C3H H;  1CKN A;  4HIM A;  2OTL A;  4LF5 Q;  4IJL A;  4GNX B;  4B3M L;  2R6G A;  4QY7 A;  3FKI H;  1EOV A;  1VQD A;  5HGQ A;  3J81 i;  2AMC B;  3K0X A;  2Q2I A;  1I3Q H;  1Y1W H;  2F4V L;  3KJP A;  5HY6 A;  4LFB L;  4K0K Q;  2KBN A;  1AE2 A;  4JI3 L;  3RZO H;  4A3C H;  1Y1V G;  2NZO A;  3AFQ A;  3EN2 A;  2JE6 I;  3PGZ A;  4QIW E;  4C3I H;  2VQF Q;  1PYB A;  1VQJ A;  1HR0 L;  4A3D G;  1PH8 A;  2UUB L;  5C0X I;  4DR6 Q;  2D0P A;  1WJJ A;  4JBW A;  4NXM Q;  1JT8 A;  1JMC A;  3BZC A;  3STB D;  4P71 A;  4JI6 Q;  1Q82 C;  1NY4 A;  2KHI A;  3J80 c;  1UE7 A;  3GTJ H;  4DR3 Q;  3MXN B;  1KIX A;  3EIV A;  1VQC A;  2UUC L;  4JI7 L;  2GVB A;  3HOV H;  5GAE C;  2N3S A;  3I4M H;  4DR4 Q;  3D0F A;  1E7Z A;  5K36 G;  4MTN A;  5M5W H;  4LFA L;  4BY7 H;  3RNU A;  2OQK A;  1SMX A;  4GLX A;  3GTK H;  4GN5 A;  1NBW A;  4IO9 A;  3S1R H;  1E22 A;  2JA8 H;  2K14 A;  2QGQ A;  1VQA A;  2IHF A;  3W1B A;  4DV5 L;  4DV1 L;  2ALY B;  3F1Z A;  1WOC A;  1L1O C;  3M4P A;  1JE5 A;  1NMF A;  1PH3 A;  3S1Q H;  5JJI A;  3RLN A;  3K80 C;  2YTX A;  1SN8 A;  2OWO A;  1QUQ B;  1W3S A;  2IHE A;  2PI2 A;  2Y0S G;  5LMN W;  1HZA A;  2ES2 A;  2UXD Q;  1KQS A;  3KYH C;  4X65 Q;  3DM3 A;  3CD6 A;  4UY8 C;  4GLV B;  1Z47 A;  1U5K A;  4X66 Q;  1HZ9 A;  4GS3 A;  1VQK A;  2NN6 G;  2JA6 H;  4HIO A;  1N36 Q;  2UXB Q;  2Q2U A;  1N34 L;  1EQR A;  4GNX C; 
#chains in the Genus database with same CATH topology
 3HOU B;  4IFD J;  3S1N B;  5D3D A;  4LF4 Q;  3D6W A;  2K6A A;  2IX0 A;  1KRT A;  2JEA I;  1F9S A;  4LUV A;  2NB0 A;  1A8V A;  3R2I A;  1OXV A;  3OHX C;  3M85 A;  3TP5 A;  5IP7 H;  1PTO D;  3KF8 A;  3UDX A;  4N8X 1;  2HHH L;  2R7Z G;  4A93 G;  2GVA A;  3S2H H;  3A74 A;  3C3L A;  2B2V C;  5E4W C;  4HTH A;  3NBH A;  1JCK B;  2EXZ A;  3GTL H;  1MIU A;  1YBY A;  3AFP A;  1N8R C;  1HZC A;  4IUR A;  3SHL A;  2FFK B;  5C3E H;  3L2P A;  1U4M A;  3NEN A;  4M1U B;  3RN2 A;  3HGB A;  1OO9 B;  2VQF L;  4RWS C;  1V43 A;  2EDG A;  3H91 A;  3I72 A;  5C44 B;  1JOR A;  4NXM L;  1PMR A;  2ATW A;  2AUJ D;  1B50 A;  2J0T D;  3J7A F;  5GAD C;  4JI6 L;  1Y8O B;  2DY8 A;  4KV6 A;  4WRD A;  1S40 A;  2F0I A;  2KCM A;  4YCW A;  4XQJ A;  1PV4 A;  1JE4 A;  4HJ9 A;  4PV1 C;  1VQE A;  2R92 H;  2PMZ B;  4P72 A;  1O7I A;  3NTH A;  1PH2 A;  1P16 A;  4A3K H;  3CHB D;  2O4X A;  4OO1 G;  2K5N A;  3PIP A;  2K5V A;  2P5Z X;  1TS4 A;  3BJU A;  2WAQ E;  1KC8 C;  3R93 A;  3GDE A;  2PYK A;  1YJW A;  3PO3 B;  3OIP A;  1RKN A;  4DUY Q;  1S4Z A;  2X69 A;  5I9O A;  1PRT F;  4A3J H;  1CFM A;  2VQE L;  1EYG A;  2N49 A;  2LXK A;  1IBL Q;  3A56 A;  4R8N A;  4DV2 Q;  3ULJ A;  2VW9 A;  4GKK Q;  2IJ0 A;  4JI8 Q;  3AEV A;  3P75 A;  3CW2 C;  3KOJ A;  5CV4 A;  2HT1 A;  2ZTD A;  2BE5 C;  1SE4 A;  1K83 B;  1PZI D;  4GZY C;  1V1P A;  5FOB B;  1LTA D;  5ELC A;  5JVH 3;  1X55 A;  3I4N H;  3GTJ B;  1E0B A;  3B6Y A;  2JEB I;  3KK7 A;  1X3Q A;  2QIL A;  2QEX A;  2XIW A;  2PW5 A;  3KLW A;  3CCM A;  2N78 A;  1FNW A;  2JA8 B;  1N32 L;  1Y1W G;  4A3J G;  4K5V A;  1TY0 A;  5JVG 3;  4A3C G;  2YV5 A;  1D6E C;  5LL6 X;  4DV7 L;  3SXH A;  4I7A A;  3VA5 A;  2K4K A;  3CQZ H;  3CCJ A;  1PRT D;  3LWU A;  5KND A;  1JWS D;  3CU7 A;  3T51 B;  4LMQ D;  5C4J B;  2YU9 H;  4YWK A;  5CMD A;  1DD2 A;  3UI2 A;  2DNC A;  1H9S A;  3SEB A;  1PZJ D;  5DAU A;  1EWC A;  1EOT A;  1EQV A;  1Y8P B;  1ICW A;  2KED A;  5T1I A;  4WOR A;  4RKB A;  1G6P A;  4BY7 G;  1S72 A;  2LMC B;  4IQZ A;  3I70 A;  4HN7 A;  1PH7 A;  2ASB A;  2OCE A;  1I94 L;  1IW7 C;  1O7L A;  1EZ8 A;  2WAC A;  2A6H C;  3S2H B;  3VYT A;  1BBW A;  4F7X A;  3GTL B;  4GKJ Q;  4QMG A;  2WIN B;  3FHW A;  2XN9 C;  5GAG C;  4O42 A;  4R4Q A;  1PXU A;  1E24 A;  3CCQ A;  1GHK A;  2QKI C;  4KK7 A;  2ZTE A;  3G71 A;  2JA6 G;  1JJC B;  1M8A A;  3C1E A;  5C3E B;  1ILQ A;  1O7Y A;  1CZG A;  1XTD A;  2CQA A;  5M3F G;  2WAQ G;  2UU9 L;  1HZB A;  2VB3 X;  1WD1 A;  4LFA Q;  3J80 i;  4UP9 A;  1RD9 D;  1F2L A;  4YHH Q;  1CKM A;  1KD1 C;  5F2D A;  1WCM G;  1VQP A;  1EYA A;  2HQE A;  4JK1 C;  4UDU C;  2I0Q A;  4WJ3 M;  2I07 B;  2PO4 A;  1C9O A;  4KD4 A;  1R4Q B;  1X3F A;  1KAA A;  2I5M X;  3GV6 A;  4KJN A;  1VQG A;  1RL2 A;  4DV0 L;  5FO7 B;  4K8J A;  1YJ9 A;  1SNC A;  3W2D A;  3TZD A;  1PZK D;  4K5X A;  1XNQ L;  3S17 H;  1ILP A;  3TP6 A;  4A3K B;  4KY6 A;  1Y1V H;  1S3O A;  4OWW B;  2NVQ H;  5IGD A;  4WJ4 A;  2MO1 A;  1LTS D;  5LMU Q;  2IY5 B;  1JJG A;  3QOJ A;  4DR2 Q;  2UUC L;  3MAQ A;  3S24 A;  2H4O A;  4L63 B;  4C3J H;  2JA7 H;  4KHP L;  1A15 A;  1F77 A;  4JOI A;  1VMP A;  2RCN A;  1Y1W B;  1L1O B;  2BOS A;  3K6O A;  3C1F A;  4A3J B;  2IW3 A;  4QUC A;  1D5X C;  4PMW A;  4CKB A;  4IPH A;  2MUY A;  3SK8 A;  1I6H H;  2E75 C;  3V2T A;  3CXC A;  1JIC A;  4LF9 L;  3F2C A;  1XYI A;  2L15 A;  1NR4 A;  4C2M H;  1KAW A;  1CZW A;  2CFM A;  1JOK A;  1IBK Q;  5BR8 Q;  1QE6 A;  5CBA E;  1EU3 A;  4RAU C;  1GUT A;  2RHQ B;  3OYY A;  4HAE A;  4KN4 C;  3I4N B;  1YHB A;  4BY7 B;  5CGK A;  1W6K A;  1TWA H;  3FPU B;  3GTK B;  4R4C A;  2CQO A;  3VDY A;  2O5I C;  2JA7 G;  2K32 A;  1C0A A;  1F9Q A;  3G6J B;  2BA0 A;  1EEI D;  1ESF A;  1B70 B;  5C4X H;  1VQL A;  1S5C D;  3I55 A;  4MZ9 A;  1XMQ L;  4IUV A;  3PUZ A;  4JV5 Q;  3CQZ B;  4A3E G;  2JA5 H;  1EIG A;  3KF8 B;  4HJ5 A;  5IP9 G;  4QGU A;  5CC4 A;  2YU9 B;  5GQO A;  5M3F B;  2IPK D;  4A3L H;  1PTO C;  1C7Y A;  2ICI A;  5JJL A;  5FK9 C;  2WKC A;  3T53 B;  2F0N A;  4G7H C;  2A5H A;  1WCM B;  5EKL A;  4B3M Q;  1GVP A;  1UEA B;  2HIX A;  4FF1 A;  5ELO A;  1LTL A;  5AJ3 L;  3BVM A;  3DLL A;  1PH5 A;  2C35 B;  1LYL A;  4K14 A;  4JI1 L;  4A3I G;  2ZT9 C;  3FVQ A;  1Y8N B;  3HOY H;  5L37 A;  5LMN L;  4BA1 I;  4V0B A;  1J5E L;  4KTA A;  1TKW B;  4BXX H;  2LSS A;  5CYU A;  3TRZ A;  2B39 A;  2L12 A;  2M9V A;  1Y69 U;  4O2D A;  1EEF D;  4YY3 L;  2B8F A;  2B63 H;  1HXY D;  5A2Q L;  3K5N A;  4A3G H;  2EPB A;  4DPG A;  1YHQ A;  3S15 H;  4MHE A;  2K1B A;  3M4Q A;  1HNX L;  2I5L X;  1TY2 A;  1HNZ L;  4IFD I;  4DN4 M;  5IE8 A;  4GLA C;  1PFB A;  3HKS A;  5DEH A;  4GOP A;  3E3X A;  1R9T H;  1JWM D;  4U67 3;  3WOE A;  5FKA C;  1AP0 A;  1VS0 A;  3M9B A;  4BXX G;  1EY5 A;  4QB4 A;  4LK1 C;  4A3D H;  4XQN A;  3PIO A;  1FJG L;  2A19 A;  2Q8T A;  2FMC A;  2NN6 I;  3BU2 A;  1XMO Q;  2OQ0 A;  2PNH A;  4FVM A;  1VQM A;  2NVQ B;  1M1K C;  3NQT A;  3TQY A;  4C3J B;  2JA7 B;  1IXR A;  4X62 L;  5FJ8 G;  3D6C A;  5J3B A;  5K36 H;  3MHB A;  1KDB A;  2B2Y A;  2EOT A;  1FGB D;  3D31 A;  2K52 A;  2ZXP A;  4J8Q A;  1BUV T;  5IT9 L;  1CA5 A;  2Z8L A;  3CME A;  1I6H B;  1SXT A;  5KYL A;  4OIK A;  2KJX A;  2D2C C;  2Q2I A;  4K0K Q;  2F0E A;  3KJP A;  5HY6 A;  3D4D A;  1H9K A;  2L11 A;  1B9M A;  4A3D G;  1MSG A;  2F3W A;  2SOB A;  2JSO A;  1NNX A;  1HTL D;  3K5O A;  1CQF A;  4TKO B;  1TWA B;  3STB D;  4P71 A;  2FJ2 A;  1Q82 C;  1NY4 A;  2KHI A;  1VQC A;  4KKU A;  3JAM L;  4JI7 L;  3VR4 A;  4K5W A;  3I4M H;  1H9S B;  3QO2 A;  5K36 G;  2K28 A;  4IUU A;  4MTN A;  5M5W H;  4A3I B;  5C4X B;  1Z6H A;  1NBW A;  1E22 A;  1RTO A;  2QGQ A;  4LAA A;  1VQA A;  5NUC A;  2BDO A;  2JA5 B;  1M4V A;  2EYL A;  1JWU D;  3M4P A;  1PH3 A;  3A7A B;  3RLN A;  1C48 A;  1BR9 A;  1GHJ A;  1W3S A;  2PI2 A;  3SK5 A;  1HZA A;  1KQS A;  3KYH C;  3DM3 A;  5KIX A;  2MPM A;  3W3A A;  1STY A;  1EY7 A;  4CJ2 C;  2EY6 A;  5J22 A;  1WTQ A;  5DNF A;  1HZ9 A;  1VQK A;  1N36 Q;  1N34 L;  4GNX C;  1X3E A;  4DF7 A;  3CMA A;  2B29 A;  4IUN A;  4J15 A;  3M3Y H;  1ET9 A;  3RUZ A;  2UXC L;  3KLS X;  1AZQ A;  1JOO A;  5EQ0 A;  5LL6 S;  3GP7 A;  2VY3 A;  2JQO A;  3S14 H;  1I4X A;  1DOK A;  3ONA B;  3ND8 A;  1A6X A;  3HOY B;  2D0O A;  2PQE A;  3MFY A;  1MGS A;  3EVQ A;  4KI0 A;  2G9D A;  1IYJ B;  3A7L A;  1IBM L;  1UUP A;  3ULL A;  3AYH B;  3DEP A;  4B3T Q;  5M5Y B;  3QG1 A;  3OW2 A;  1I50 H;  2B63 B;  1TS5 A;  4UPA A;  1T9H A;  4NDX A;  4JI5 Q;  3HOU G;  3KF6 B;  4BBS H;  3S15 B;  1L0Y B;  1GO3 E;  4HJ7 A;  2FMM A;  2OT2 A;  1Q3L A;  1EFW A;  4RCN A;  1HJP A;  2D9U A;  2SNS A;  4ID6 A;  2PI2 E;  5IT9 c;  5FLX E;  3A54 A;  1N33 Q;  2NVX B;  3AU7 A;  3TP8 A;  2E8G A;  1ESR A;  4DV4 Q;  2VUM H;  1Q1E A;  1HUN A;  2RA4 A;  4A3D B;  1TU2 B;  3PV0 A;  2L55 A;  4RG1 A;  5FO8 B;  1EL0 A;  4P2C B;  1PH4 A;  2E2J B;  3PO2 H;  4AYB G;  4DR7 Q;  1VQI A;  2EVB A;  2WV6 D;  3CKI B;  1VQ7 A;  4JI4 Q;  2JYO A;  3PUW A;  2DJF C;  5CV5 A;  3JAM c;  4NW2 A;  2UXD L;  5EKI A;  5GRO A;  4X65 L;  5C4H A;  3F2B A;  4H44 C;  1NTG A;  1MD2 D;  2UXB L;  1TS3 A;  2KEN A;  1LT6 D;  1C8C A;  3PF5 A;  4U68 A;  3ERO A;  3CPW A;  1VQ6 A;  1DYQ A;  1UWV A;  1L0X B;  2X6G A;  5M5X H;  2MGS A;  1IL2 A;  5I2X A;  4JI2 Q;  4LFC L;  4DV3 L;  1G51 A;  3AQQ A;  1LT5 D;  1L1O A;  4KMU C;  2NVT H;  3TSS A;  3PO2 G;  2F0L A;  2C5C A;  1X54 A;  5JEA H;  4C56 C;  5IGC A;  1TWF H;  4IN3 A;  2CVR A;  4G7Z C;  3G48 A;  4DV6 L;  1OXT A;  3PO3 G;  3BVG A;  1K8M A;  5M5W B;  4IFD G;  1HQM C;  4KN7 C;  3A0J A;  1G2S A;  1YNJ C;  2R7F A;  1MSH A;  4HSP A;  4CGY B;  3UE1 A;  2F0U A;  3NUC A;  4LF8 L;  3TS2 A;  3KBG A;  1TWH H;  2O5J C;  4EX5 A;  1F2Y A;  5IY0 A;  1YVC A;  3A5U A;  1X3G A;  4X64 L;  2BA1 A;  3WOF A;  1B53 A;  2B2V A;  2OXP A;  1SMY D;  1WTR A;  3VYR A;  1SE2 A;  5JJK A;  3I91 A;  2GN5 A;  3BG3 A;  3K7A H;  2N88 A;  3SVM A;  4L5Q A;  4DU9 A;  3M3Y B;  5JEA G;  1HNW Q;  1ZYR C;  3OSO A;  3S14 B;  3Q6S A;  3ICE A;  1B3Q A;  3DM1 A;  1UEB A;  2AHO B;  3V05 A;  1BCP F;  2JA8 G;  3NP8 A;  5IYB H;  1I4G A;  1VCI A;  2VL6 A;  1CM9 A;  1LTI D;  4DNI A;  2JJQ A;  1W2B A;  5FLM H;  3HOZ H;  3KFU A;  4HJ8 A;  4G4K A;  5IWA Q;  3U4V A;  3J81 c;  2H1E A;  4XYO A;  4FNF A;  2B8G A;  5JEA J;  3K57 A;  4AQY Q;  3VR5 A;  1BQQ T;  3MVV A;  4GOP B;  4AYB B;  4IPC A;  4QL5 A;  1I50 B;  3G4S A;  1ZKO A;  3LGJ A;  3L7Z C;  1VQ8 A;  3J80 E;  4KKT A;  2MJ8 A;  4GKK L;  2CCZ A;  3GTG H;  1A3T A;  1KNE A;  1LM0 A;  3I4O A;  1EY9 A;  2K5Q A;  4HMJ A;  1PH1 A;  3OMG A;  4EQ5 A;  5IP7 G;  1EIY B;  1HFG A;  3EQL C;  1SJH D;  4MNO A;  5ELB A;  5ELD A;  1SND A;  2F0M A;  2QEJ C;  2C9O A;  2B2U C;  4NPS A;  4P74 A;  5FLM G;  2KUM A;  4B3S Q;  2DN8 A;  1XNR Q;  3OMC A;  5IOC A;  1BCP D;  2VUM B;  2KHJ A;  2MFI A;  4MN3 A;  3DWA A;  1SE3 A;  1A2T A;  3NHH A;  1J9O A;  2J7Z A;  5C3E G;  2Z6K C;  3GTQ H;  4KHZ A;  3TEH B;  3PO2 B;  2VS1 A;  1RDP D;  4Z9C B;  2N8N A;  1BVS A;  2E5L Q;  1Z7T A;  3R3O A;  4LWC A;  4OXP A;  3IFT A;  3VYS A;  3U9S A;  1DM0 B;  3T1Y Q;  4ME3 A;  3KJO A;  3H6M A;  2ZM6 L;  4ABN A;  2Q2H A;  4RGM A;  1O80 A;  2CH4 A;  4CBV A;  2HHH Q;  2CHB D;  5I6Y A;  1DZ1 A;  4PMB A;  1UE6 A;  3K8A A;  3ULP A;  1WI5 A;  1J8I A;  1K0R A;  1CI3 M;  4JYA L;  5M5X B;  3C2P A;  4I65 A;  3ITP A;  1RJT A;  4RCO A;  2R92 G;  1BBU A;  4JI0 L;  1KNA A;  3BS1 A;  1N9W A;  1ROD A;  3X3N A;  3FDT A;  1ZEQ X;  4A3K G;  1B8A A;  2M00 A;  2NVT B;  4DUZ L;  1MBY A;  1K0S A;  4UP7 A;  4GKJ L;  2JN4 A;  3LNN A;  3GTO H;  4EQO A;  1GXD C;  1HUM A;  1R4P B;  3F2D A;  1TWF B;  1RHP A;  2F0G A;  2IL8 A;  3S1M H;  4KY7 A;  3S2D H;  4QCL A;  3UDG A;  4X3S A;  1E2V A;  4IPG A;  3LX0 A;  1I4P A;  5GAH C;  3T1H Q;  3K81 C;  3VA7 A;  1HPC A;  2WP8 J;  4LF7 Q;  1BF4 A;  1TWH B;  3CCS A;  4L5S A;  4YHH L;  2LKV A;  1Z9F A;  1TXY A;  1LAC A;  4APV A;  3A8I E;  2L4N A;  2Z0S A;  3TZU A;  2L9H A;  2K05 A;  3I4N G;  1B3A A;  4IUQ A;  2F1M A;  1D5M C;  1EYC A;  3KDF A;  3JAM i;  2IT1 A;  1XJV A;  2QW7 A;  2ZJQ A;  2TSS A;  2YTV A;  3AB9 A;  3UE0 A;  1Q90 A;  2HUG A;  2WFW A;  5EJW A;  3TRE A;  1S5F D;  1Q8I A;  4JI3 Q;  4ZLT F;  3HOZ B;  4NKL A;  1HR0 Q;  2B2T C;  1X9N A;  3ERS X;  4L5R C;  3E5S A;  4NP5 A;  2UUB Q;  1EFI D;  1F2M A;  2EY1 A;  3NPP A;  1JOQ A;  2DNE A;  2WB1 G;  5T1G A;  4EGV A;  4ZYS A;  5EKK A;  1XPR A;  4OGQ C;  3J7A 5;  3BZK A;  4Y52 H;  3I90 A;  2CW0 D;  2R7D A;  4N8F A;  2X6L A;  3QIA A;  2KEE A;  2ZJR A;  1OXU A;  3QR8 A;  2Y0S E;  1SYB A;  2V4D A;  1G8Z D;  3P20 A;  4N9T A;  5COR A;  1NSN S;  1PFN A;  3MXG A;  3J7Y W;  3LWE A;  4K6D A;  1G91 A;  2XSC A;  1N32 Q;  4LW1 A;  2PZU A;  3TME A;  3I3C A;  4L6T B;  2RF4 A;  1FR3 A;  3FEW X;  4WFN 3;  5I4D A;  4HJA A;  1VQH A;  3DWP A;  4DV7 Q;  5COY A;  5ELF A;  2R92 B;  3KF6 A;  5D65 A;  5JPM C;  4OL7 A;  4AIM A;  3M4O H;  2SEB D;  3DHQ A;  4GN3 B;  3CCL A;  3GTQ B;  3PSI A;  3BDC A;  1NAP A;  2L0C A;  1NE3 A;  3IFD A;  4JC0 A;  4YCV A;  1EY8 A;  1EY4 A;  4BY1 H;  2VXW A;  1SYF A;  1K28 A;  4JV5 L;  3G6E A;  3NWS A;  2MO0 A;  2A69 D;  2CWA A;  2PCF B;  2A1A A;  3L0O A;  3CRK C;  4FDB A;  4DR5 L;  4LNQ A;  3VR2 A;  1I94 Q;  1AZP A;  2NYZ D;  1QIL A;  4LF6 L;  4Y7N H;  4KHV A;  1UNS A;  4V19 0;  1GD7 A;  1QOH A;  2NZ1 D;  4OEL B;  4L5T A;  4A3F H;  4C3H H;  4IJL A;  4B3M L;  1SNM A;  1I4Q A;  3FKI H;  4TSS A;  3J81 i;  2F4V L;  3K0X A;  2AMC B;  1I3Q H;  2CH4 W;  4LFB L;  5J1Z A;  2AQ2 B;  1AE2 A;  3RZO H;  1EYD A;  1Y1V G;  2QCP X;  1PLF A;  3AFQ A;  1HFN A;  3PGZ A;  1F9P A;  2L5T A;  4C3I H;  3KLS A;  1PH8 A;  4B08 A;  1WTW A;  4JBW A;  4OHJ A;  1RCV D;  1IHZ A;  3S1M B;  1JT8 A;  4C3J G;  3S2D B;  3BZC A;  4I7Z C;  2KEC A;  5CV6 A;  5CV8 A;  4ZQ3 A;  1O7Z A;  3HOV H;  1KIX A;  4DR4 Q;  1SMY C;  2WKD A;  1U4L A;  3DWQ A;  4IAL A;  1SMX A;  2XWJ B;  2K5D A;  4JW0 A;  3QWN A;  3S1R H;  1ET6 A;  3K59 A;  1DJR D;  2WB1 B;  2IHF A;  4ZUI A;  4DV5 L;  1WOC A;  3H3V C;  1JE5 A;  3K80 C;  1QUQ B;  2A6E D;  2Y0S G;  1A3V A;  2JXM B;  5C0X H;  1Z47 A;  4X66 Q;  1T5X D;  1AEX A;  3DXJ C;  4XYQ A;  4HIO A;  1EQR A;  3IRB A;  2F0D A;  4LUO A;  3HOV G;  3ZJY C;  4LF4 L;  2NZH A;  1XMO L;  3OTO L;  1WTV A;  1I5F A;  4R4O A;  5C4X G;  1A3U A;  5A35 A;  3UDF A;  2JA5 G;  1KHI A;  3E9H A;  4DAM A;  5HUR A;  4QIW B;  4QF4 A;  1U9R A;  4A3L G;  1SE8 A;  2Z4H A;  4OX9 Q;  4A75 A;  3RLO A;  4QJF A;  1AE3 A;  1ENF A;  3R2T A;  3DMU A;  5FLX L;  5C0X G;  2RSO A;  4K0K L;  2VZA A;  4X3U A;  5M9O A;  2SNM A;  1JR0 D;  3P1H A;  3NE5 B;  1LO5 D;  4HMI A;  2KCN A;  2E76 C;  2Q8I B;  1D8L A;  2G5D A;  1CUK A;  1DOM A;  1ICF B;  3HOY G;  4H0L C;  1BO0 A;  3M4O B;  1RTN A;  2BDN A;  3S17 B;  4IZ8 A;  1QVF A;  2RQX A;  1Q12 A;  5C0X J;  1YIT A;  1SFO H;  1BKB A;  1Y1V B;  4XDX A;  2HIV A;  1ZXT A;  4KD3 A;  4DK0 A;  1HRJ A;  3KLR A;  2B63 G;  1ONL A;  4A3G G;  2RDH A;  4RGN A;  3AMU A;  1CKN B;  4IOC A;  1HR0 W;  3KUP A;  1EIF A;  4AH6 A;  1E1T A;  1WYD A;  2RKS A;  1OTC A;  5KGU A;  1CTM A;  1KDC A;  5C4Z A;  3F8T A;  2K50 A;  2Z6B A;  3BDL A;  3A8J E;  1PDQ A;  4Y7N B;  3L3O C;  5EPJ A;  1B2T A;  1HTP A;  4FYD A;  2K01 A;  1XTC D;  3BYT B;  2JA9 A;  4C2M B;  4C3H B;  5LMN Q;  1BOS A;  2ZTC A;  3N52 A;  1J5E Q;  3NEL A;  3FKI B;  1PTO H;  1SBB B;  4POG A;  1GUW A;  1I3Q B;  4BA2 I;  4PZ8 A;  1STB A;  3Q24 A;  2HDM A;  1K3B C;  2Y0S B;  3RZO B;  3OWE B;  2IWH A;  1PH6 A;  4C3I B;  2O2L D;  1WD0 A;  4DAV A;  4RHS A;  4DR1 L;  4AYB E;  1GKH A;  1X3P A;  4A3B H;  1KDA A;  1HNX Q;  1IYU A;  1PRT C;  1AW7 A;  5IGE A;  1QVC A;  2Z9H A;  1NUC A;  3HOV B;  1QVG A;  3E9I A;  1BDO A;  5BN3 A;  1K9M C;  4B3T L;  4B3R Q;  4GNX A;  3FP9 A;  2B2Y C;  3KDF B;  4JI5 L;  2ICE C;  1Q81 C;  3RR5 A;  3HOW H;  3S1R B;  2E2I H;  4ILW A;  2R3Z A;  4F87 A;  1WTH A;  5C3W A;  3RZD H;  1FJG Q;  1VQF A;  2HD3 A;  3FRP B;  1SAP A;  3IL8 A;  3OOC A;  1N33 L;  1AH9 A;  2UUA L;  2QF7 A;  3CCV A;  4KJO A;  2ZXO A;  3MXN A;  1ENC A;  2J4X A;  3I4M G;  2OTJ A;  4P75 A;  4MTK A;  1D1I A;  4UP8 A;  3QOL A;  2F52 A;  3H09 A;  1X6O A;  4DR7 L;  4IUT A;  2EZV A;  2AWN A;  1FD7 D;  3J81 j;  3MA2 B;  3J80 L;  1PYS B;  3NBI A;  2OEO A;  2L1B A;  4LF5 L;  5IGF A;  2RSN A;  5DM7 3;  3PIP 3;  1K8G A;  4A3G B;  2B3G A;  1CK1 A;  4FF3 A;  1I6V C;  3U58 A;  1VQB A;  4CDD C;  4DR6 L;  1Q8K A;  4JI2 L;  2F3V A;  3O13 A;  4JI7 Q;  5IGG A;  3L9A X;  1P8L A;  3NK9 A;  4KLK A;  2I5H A;  1E1O A;  2AKW B;  3RD4 A;  1IW7 D;  4WJW A;  2F0T A;  5M3M H;  3H0G H;  2F0Q A;  4JBK A;  4XQQ A;  4CJ0 B;  1V9P A;  1R9T B;  3PF4 A;  4DR3 L;  1KLU D;  2EYJ A;  1SNP A;  5CV7 A;  1STH A;  2K7V A;  3RLF A;  4EQP A;  4DK3 C;  2A69 C;  3URY A;  1K8A C;  1D7Q A;  4TRD A;  5C44 H;  2D5D A;  3OWF A;  2JK8 A;  3MXU A;  1QZH A;  4R4I A;  5A2Q E;  1G29 1;  3W5O A;  1Q1B A;  3NEM A;  3HOX H;  4RGO S;  4DFA A;  1O78 A;  4BBS G;  5E3F A;  1YNN D;  1CKO A;  5KYI A;  2OF1 A;  5CR3 A;  1DON A;  4Q0F A;  1KXL A;  1YJN A;  3M7G A;  1TQO A;  5IIF A;  4QUF A;  3I7F A;  1B4O A;  1A62 A;  2PZT A;  2PQA B;  4OWX B;  1CT1 D;  1SJE D;  5TSS A;  3BYY B;  3GTM H;  5HGT A;  1SNQ A;  1VQN A;  1PTO B;  1HNW L;  2VUM G;  2B2W A;  2PW7 A;  2HCC A;  3DUZ A;  3FPP A;  3NQI A;  3WDN A;  1K73 C;  1SNO A;  3D4R A;  1U4R A;  4CDE C;  3HOX G;  1EQQ A;  1ASZ A;  3I8Z A;  1WTP A;  2KVM A;  5IWA L;  1PVO A;  2M2L A;  4CJ1 B;  1V8Q A;  4RH6 A;  3I4M B;  4NB3 A;  4IOA A;  2PNR C;  1SYD A;  2YYZ A;  1QZG A;  5IT9 E;  4AQY L;  3CAM A;  2K33 A;  1K83 H;  4G57 A;  5FO9 B;  5K5P A;  3CC2 A;  2MP1 A;  2A6E C;  3IAY A;  4CKC A;  3HOW B;  3JC6 6;  1PTO F;  4H13 C;  4O0A A;  5IGB A;  3HS0 C;  2MNA A;  4BS9 A;  3T13 A;  3RZD B;  1H9M A;  2DGY A;  2R7Z H;  1PA6 A;  1XXG A;  2DJG C;  4A93 H;  4NXN Q;  1YIJ A;  3JAM E;  4B3S L;  4GN4 B;  3MEF A;  2XTI A;  2A68 D;  1XNR L;  1FVI A;  3P7J A;  4RFB A;  1BXT A;  3NTK A;  4RKL A;  1SRU A;  4LUZ A;  1STN A;  4A3M H;  3K5M A;  3HKZ B;  5C4J H;  2E2D C;  2YTY A;  4X3K A;  4C1N K;  1QUQ A;  3W1G A;  1MJE A;  1JC7 A;  4DAY B;  4OIJ A;  2E5L L;  1MJC A;  1SRO A;  3DEO A;  2F0K A;  3E0J A;  3SR1 A;  4DUY L;  2QA4 A;  3HG9 A;  3T1Y L;  4LFC Q;  1G2T A;  4DV3 Q;  2KQ3 A;  2B2U A;  1IBL L;  5IYC H;  3C46 A;  1HA5 A;  4DV2 L;  5LHY 1;  1F9R A;  4BBS B;  4JI8 L;  1DOL A;  1PHJ A;  2EYF A;  4YWL A;  3GTP H;  2FIN B;  3PCO B;  2Z6K A;  1BBX C;  4DV6 Q;  5M3M B;  3H0G B;  1U4P A;  4A3M G;  1OXS C;  4OO1 H;  3ERQ A;  5IYB G;  2E74 C;  4DV1 Q;  3ER0 A;  3HOZ G;  4LF8 Q;  4RA8 A;  1LTT D;  1U0L A;  3NSW A;  2K03 A;  3HFZ B;  4KY5 A;  2ZJP A;  1VQ9 A;  4X64 Q;  2WB1 E;  2NWG A;  1XWE A;  4RGT A;  3HOX B;  1PRT B;  1JJ2 A;  5IYC G;  2Z1C A;  3T1H L;  4YWM A;  1CSP A;  4LF7 L;  4K8I A;  1QNK A;  5AFW A;  4PZ7 A;  2F0V A;  2AWO A;  4DXG A;  5I6W A;  2XVS A;  1UE1 A;  3K0Y A;  5DM6 3;  3GTM B;  4OON A;  3J81 E;  3STB C;  3PMF A;  1AN8 A;  1SYG A;  4J1M A;  1CKN A;  2OTL A;  1S5B D;  4FXG C;  4GNX B;  2R6G A;  4QY7 A;  1EOV A;  4K2L A;  3VYU A;  1Y1W H;  2KBN A;  3J7A V;  4JI3 L;  5EPK A;  4A3C H;  3EN2 A;  3HP3 A;  4QIW E;  2JE6 I;  2VQF Q;  1HR0 L;  1PYB A;  1PFM A;  2UUB L;  3MWY W;  5C0X I;  1STA A;  1WJJ A;  1II3 A;  1GJX A;  4NXM Q;  2EYH A;  1LTG D;  4JI6 Q;  1UAP A;  1CA6 A;  1UE7 A;  2KHS A;  4B9W A;  3MXN B;  1H9R A;  1HA6 A;  4LFA L;  4K2K A;  4BY7 H;  2OQK A;  2LS0 1;  3GTK H;  4GN5 A;  1NR2 A;  4ZAI A;  5C5L A;  2JP1 A;  5J39 A;  1HQR D;  4FO2 A;  2R7Z B;  1V1O A;  3W1B A;  4S3S A;  5C3X A;  2ALY B;  3F1Z A;  4A93 B;  3K7A B;  2B2T A;  3S1Q H;  1ENA A;  2RBM A;  2YTX A;  4X3T A;  2OWO A;  1CHP D;  2FHT A;  3VR3 A;  3CD6 A;  1EWH A;  2F0P A;  1U5K A;  3K58 A;  4FXK C;  2F4I A;  3OW7 A;  5BN5 A;  2JA6 H;  4A3M B;  2Q2U A;  2E2H H;  3MXP A;  2MQH A;  2ZM6 Q;  1MHW C;  2BCO A;  2EJF C;  2VQE Q;  3H94 A;  3V96 A;  4EVO A;  5M3F H;  3I4L A;  4A76 A;  5LMU L;  2EYM A;  2KOL A;  4TVA B;  4DR2 L;  3CCU A;  4JYA Q;  3PIO 3;  1WCM H;  4X6A H;  4JI0 Q;  1NCV A;  4MIU A;  1EZ6 A;  2LY7 A;  3BZD B;  4K6L A;  1B44 D;  3X3M A;  2D62 A;  1MKH A;  1A2U A;  4B9X A;  1GOZ A;  4DUZ Q;  4J6H A;  4HIK A;  3GTG B;  3D4W A;  3GTP B;  1HH2 P;  4JBJ A;  3SK6 A;  1HHV A;  1TWG H;  1IBK L;  4E6I A;  5BR8 L;  1EUJ A;  2F03 A;  3I56 A;  1SDF A;  2A74 C;  3M7N A;  2Z4I A;  2V1C C;  3MC0 B;  4JPB W;  1L0W A;  3RN5 A;  2H5X A;  4CDC C;  3CCR A;  1ASY A;  1EIH A;  3Q8D A;  3H3V I;  1YNN C;  2LXJ A;  1IKL A;  5KEE A;  2MHV A;  1S5E D;  1X32 A;  5IYD H;  4DA2 A;  4DR4 L;  2CKZ B;  5BN4 A;  5EGT A;  4IUP A;  4CDF C;  2ID0 A;  1L2F A;  1SR3 A;  2KCC A;  4RHR A;  2VB2 X;  3E0E A;  2K75 A;  2K5W A;  1XPO A;  3TN2 A;  3CF5 A;  1BNZ A;  5ELE A;  5EAY A;  5E7N A;  3T4A C;  5G3L F;  1W6J A;  2NUC A;  5JPN C;  3EFX D;  4DK1 A;  1KAB A;  2F3I A;  4DNR B;  4FF2 A;  2BH2 A;  4XXE A;  1RF2 D;  2RDF A;  3CC4 A;  2HCI A;  4A4I A;  1IL8 A;  3HEJ A;  2QDL A;  4XIG S;  4X66 L;  1VQO A;  1C4Q A;  3GD7 A;  3F2U A;  1SEB D;  5KNC A;  4ZCK A;  5IYD G;  2Q2T A;  3GTO B;  4H02 A;  1DGS A;  2UU9 Q;  2PQA A;  2A8V A;  1FL0 A;  4BY1 G;  3VR6 A;  5JJZ A;  4A3E H;  1FGU A;  4N9P A;  1Q86 C;  3S9W A;  5IP9 H;  4JOI C;  3T16 A;  4UHV A;  2G9H D;  3GV3 A;  1FNU A;  4QQB X;  2XWB B;  1WTX A;  1LTR D;  1SYC A;  3CP0 A;  4OX9 L;  1VQ4 A;  1EY6 A;  4JBM A;  4POF A;  5G3L D;  3HZX A;  4A3F G;  3T56 B;  4C3H G;  4DV0 Q;  1CSQ A;  2A68 C;  5E1F A;  3FKI G;  1D1K A;  1Q7Y C;  1XNQ Q;  4Q5V A;  2IX1 A;  3CRL C;  3S1Q B;  1AFP A;  4C3I G;  4A3I H;  1VDZ A;  3EJI A;  1K8O A;  4HID A;  1A63 A;  2EQS A;  1JB3 A;  2UUC Q;  4PMC A;  4KKS A;  3HRZ C;  4KHP Q;  2NTS A;  3PUX A;  2JA6 B;  2E2H B;  1V1Q A;  1OXX K;  4DR5 Q;  1WVL A;  3NBH B;  5EBD A;  2BH8 A;  3EBE A;  2CWP A;  1GUG A;  2WAQ B;  4LF6 Q;  4G7O C;  1YNJ D;  1YZ6 A;  2SDF A;  3MEH A;  1TWC H;  2F0F A;  5KNB A;  3D3R A;  5DLQ E;  5I9P A;  3Q23 A;  3G7L A;  4LF9 Q;  2NVY H;  3TBI B;  1DXM A;  2F4V Q;  4LFB Q;  1WFQ A;  1J6Q A;  3D8G A;  3SGI A;  2F0S A;  3MFG A;  1KL9 A;  3EA6 A;  4YIJ A;  1TS2 A;  4F8M A;  1CQV A;  4JCV E;  3A8K E;  1TWG B;  1BCP C;  1FYC A;  1MI2 A;  4XTC S;  4DAY A;  4DK6 C;  1ZYR D;  1YI2 A;  2LFN A;  3TP7 A;  1D2B A;  3IKJ A;  2WII B;  5KRU A;  1F2Z A;  1LT3 D;  2KA7 A;  1E2W A;  2AQ3 B;  3QJY A;  2PZW A;  4IJH A;  4H7B A;  1TVX A;  4IPD A;  4BBR H;  5M5Y H;  3J7Z C;  2DUD A;  1XMQ Q;  4PG3 A;  1M90 C;  2AUK A;  1HCZ A;  4OEM B;  2TMP A;  1B1Z A;  4JVZ A;  5EPL A;  1GUN A;  2XGT A;  1QWY A;  2F0W A;  5FJ8 H;  4ULL A;  3CC7 A;  4DV5 Q;  1LUZ A;  3GQB A;  3OPO A;  2I46 A;  4B3R L;  2RCF A;  4BY1 B;  2F0H A;  4BWG B;  2NVX H;  2EIF A;  4UAI A;  4PQX A;  1NJI C;  2GA4 B;  5AJ3 Q;  4DGZ A;  1I4R A;  4JI1 Q;  1B7Y B;  3ND9 A;  4ZRZ A;  1CHQ D;  1E2Z A;  1UE5 A;  5JOB A;  4OWT B;  4DNT B;  4R8I A;  3OTO Q;  1N36 L;  4A3F B;  2E2J H;  4BBR G;  4EQN A;  3TS0 A;  3H3V H;  2R93 H;  3HKZ E;  1JB7 A;  1SLJ A;  2EJM A;  4GOP C;  1STG A;  1V1P B;  2RDG A;  3CCE A;  3Q0A A;  3PUV A;  1KRS A;  4JG2 A;  4YY3 Q;  2HQL A;  4ALP A;  5CBE E;  4A3E B;  1I4H A;  4HCE A;  4FF4 A;  3I2Z A;  2EJG C;  1QJO A;  1HNZ Q;  2PPB C;  1PYW D;  5D3I B;  3A5Z B;  2AQ1 B;  3A55 A;  3TDQ A;  2EE1 A;  3I73 A;  3S16 H;  2KCT A;  4ODG A;  3RMH A;  3GO5 A;  1WTO A;  2QDB A;  1SYE A;  2R93 G;  1QG7 A;  1TT2 A;  4HED A;  1GUS A;  4PZ6 A;  2HDL A;  2BE5 D;  1YHA A;  1D5Z C;  1TII D;  3FMC A;  4ZKB B;  5FLX c;  1KLG D;  1KTK A;  1H95 A;  1IZ6 A;  4DV4 L;  4PNY A;  1YNX A;  4A3B G;  2XNA C;  4HCS A;  4ZUJ A;  5H1S E;  2VNU D;  4X62 Q;  4ME5 A;  3K5L A;  2CW0 C;  2K5H A;  1EQT A;  3CPF A;  3H15 A;  4OO1 I;  1TWC B;  2PMZ E;  3HOU H;  1LV9 A;  4HSV A;  4JI4 L;  3S1N H;  3HOW G;  4DKA C;  2NVY B;  3SE0 A;  5CV9 A;  2EXD A;  4F88 A;  5D14 A;  1Q46 A;  3KBX A;  3U50 C;  1NMG A;  1X56 A;  3PQI A;  1GM5 A;  1YEZ A;  1IYV A;  4M8A A;  4LJZ C;  5IOD A;  1Y14 B;  4R4T A;  5ISR A;  1DCZ A;  4DR1 Q;  1TR5 A;  3BVZ A;  1H9J A;  3PUY A;  4CKE A;  4DAP A;  4HR7 B;  3R8B A;  1LAB A;  1XPU A;  4P73 A;  1LLR D;  2A6H D;  1EWI A;  4O1N A;  1JQY D;  3HKZ G;  4BBR B;  1PFS A;  1IKM A;  1G6Z A;  1VQ5 A;  2RHS B;  4TQU S;  4YCU A;  2EY5 A;  2FXQ A;  1STE A;  5ELN A;  1SFO B;  2XRS D;  3M4Y A;  4R9W A;  5E4X A;  1SSO A;  1K3R A;  3QB3 A;  1E3P A;  3U4Z A;  3NWT A;  5C6A A;  2UUA Q;  1N34 Q;  2F0O A;  1S5D D;  3SK4 A;  4XT3 B;  5JAV A;  2UXC Q;  1A0I A;  3K7U C;  4L8J A;  3WWV A;  3J81 L;  1ML0 D;  1XX8 A;  5M3M G;  3H0G G;  2DY7 A;  4NXN L;  3MZ5 A;  1EY0 A;  1VF5 C;  2R93 B;  2NBF A;  3OIQ A;  2K04 A;  3ZYY X;  1X65 A;  3Q22 A;  4R1J A;  4RMF A;  3UDI A;  1RIP A;  2N55 A;  4XT1 B;  5C44 G;  1PH9 A;  1IBM Q;  3PO3 H;  4IFD H;  2EY2 A;  4NMZ A;  4HIM A;  2IX3 A;  4LF5 Q;  5HGQ A;  2A73 B;  3NTI A;  1VQD A;  1B9N A;  2ZXR A;  1FNV A;  2F0J A;  1EU4 A;  4A3B B;  3SDZ A;  2NZO A;  1T5E A;  2EYP A;  1QB5 D;  1VQJ A;  2EYO A;  1GUO A;  5C5M A;  2RVL A;  4DR6 Q;  1VF7 A;  2D0P A;  1LT4 D;  4C1N I;  2NN6 H;  3S16 B;  3U9O A;  3E6Z X;  3MTS A;  2R61 A;  1JMC A;  2E2I B;  3J80 c;  3GTJ H;  4DR3 Q;  4ZK9 B;  3EIV A;  2GVB A;  3BDO A;  2N3S A;  5GAE C;  3D0F A;  4FP5 D;  1E7Z A;  2Q8R E;  3RNU A;  4GLX A;  1LTB D;  2ENB A;  4IO9 A;  2B2W C;  2JA8 H;  2K14 A;  4DXF A;  1BCP B;  4FXD A;  4DV1 L;  1L1O C;  1NMF A;  1QCB D;  5JJI A;  3N6R A;  1SN8 A;  3NXW A;  2IHE A;  5LMN W;  2XRQ D;  1QNU A;  2UXD Q;  2ES2 A;  4X65 Q;  2NTT A;  4ZKC B;  4UY8 C;  4GLV B;  4CHT B;  4GS3 A;  2NN6 G;  5I2Y A;  2UXB Q;  5EBC A;  1VMC A; 
#chains in the Genus database with same CATH homology
 1X3E A;  4IFD J;  2MQH A;  2ZM6 Q;  2B29 A;  3IRB A;  4J15 A;  3CMA A;  3M3Y H;  2UXC L;  2VQE Q;  4LUO A;  2IX0 A;  5M3F H;  1KRT A;  2JEA I;  3ZJY C;  4A76 A;  4LUV A;  5LMU L;  3HOV G;  2VY3 A;  2JQO A;  4LF4 L;  2NZH A;  4TVA B;  1XMO L;  3OTO L;  4DR2 L;  1I5F A;  1A8V A;  4R4O A;  3S14 H;  5C4X G;  3CCU A;  1OXV A;  3M85 A;  4JYA Q;  5IP7 H;  4X6A H;  1WCM H;  3UDX A;  2D0O A;  2HHH L;  3UDF A;  2R7Z G;  2JA5 G;  4JI0 Q;  4A93 G;  2GVA A;  3S2H H;  3A74 A;  1KHI A;  3E9H A;  3H3V H;  4DAM A;  3GTL H;  2D62 A;  1MKH A;  1MIU A;  1YBY A;  4DUZ Q;  3AFP A;  4HIK A;  4KI0 A;  4A3L G;  1IYJ B;  1SE8 A;  1IBM L;  1HH2 P;  4JBJ A;  4A75 A;  1HZC A;  3ULL A;  3AYH B;  1N8R C;  4OX9 Q;  3RLO A;  4QJF A;  4B3T Q;  3OW2 A;  1AE3 A;  1I50 H;  1TWG H;  5C3E H;  1IBK L;  5C0X G;  4UPA A;  1T9H A;  4JI5 Q;  5BR8 L;  2VZA A;  1EUJ A;  3L2P A;  3KF6 B;  3HOU G;  3I56 A;  4K0K L;  3NEN A;  4BBS H;  3RN2 A;  3M7N A;  2V1C C;  2VQF L;  1GO3 E;  4HJ7 A;  1D8L A;  1L0W A;  1V43 A;  2H5X A;  1CUK A;  3CCR A;  3RN5 A;  1ASY A;  1HJP A;  1EFW A;  2PI2 E;  5IT9 c;  3HOY G;  4JBK A;  4NXM L;  3Q8D A;  3H3V I;  2ATW A;  2LXJ A;  1N33 Q;  5GAD C;  4JI6 L;  1S40 A;  2E8G A;  2KCM A;  5IYD H;  4YCW A;  4DV4 Q;  5C0X J;  1Q12 A;  1QVF A;  4DR4 L;  2CKZ B;  1YIT A;  1SFO H;  1BKB A;  1PV4 A;  2VUM H;  1Q1E A;  4HJ9 A;  2HIV A;  2ID0 A;  1L2F A;  1SR3 A;  3E0E A;  3PV0 A;  1VQE A;  4RG1 A;  2K75 A;  2R92 H;  1XPO A;  2B63 G;  3CF5 A;  1PH4 A;  3PO2 H;  5EAY A;  4P72 A;  5E7N A;  4AYB G;  4A3G G;  1O7I A;  4DR7 Q;  1PH2 A;  1CKN B;  4IOC A;  1P16 A;  1VQI A;  4A3K H;  1HR0 W;  4OO1 G;  2K5N A;  1VQ7 A;  1EIF A;  4AH6 A;  1E1T A;  1WYD A;  3PUW A;  2F3I A;  3JAM c;  3PIP A;  1OTC A;  2K5V A;  4JI4 Q;  2BH2 A;  3BJU A;  3F8T A;  2UXD L;  5GRO A;  2K50 A;  4X65 L;  3F2B A;  2WAQ E;  3CC4 A;  4A4I A;  1KC8 C;  3GDE A;  1YJW A;  4XIG S;  4X66 L;  1NTG A;  1VQO A;  2UXB L;  4DUY Q;  2KEN A;  2JA9 A;  3GD7 A;  5LMN Q;  2ZTC A;  4A3J H;  3PF5 A;  3CPW A;  1J5E Q;  1VQ6 A;  3NEL A;  2VQE L;  1EYG A;  1UWV A;  4POG A;  2N49 A;  2LXK A;  1IBL Q;  5IYD G;  4BA2 I;  4PZ8 A;  4DV2 Q;  2Q2T A;  4GKK Q;  3ULJ A;  5M5X H;  2VW9 A;  4JI8 Q;  1IL2 A;  3AEV A;  4H02 A;  4JI2 Q;  1DGS A;  3CW2 C;  1PH6 A;  2UU9 Q;  2PQA A;  4LFC L;  2A8V A;  3KOJ A;  1FL0 A;  4DV3 L;  1G51 A;  4BY1 G;  2HT1 A;  2ZTD A;  4DR1 L;  3AQQ A;  4A3E H;  4AYB E;  1L1O A;  2NVT H;  1GKH A;  3PO2 G;  1FGU A;  1Q86 C;  4A3B H;  5IP9 H;  4JOI C;  1HNX Q;  1X54 A;  1X55 A;  1QVC A;  3I4N H;  4QQB X;  1TWF H;  3CP0 A;  3B6Y A;  3E9I A;  1QVG A;  4OX9 L;  2JEB I;  3G48 A;  4DV6 L;  1VQ4 A;  1K9M C;  4POF A;  4B3T L;  1OXT A;  4JBM A;  3PO3 G;  4IFD G;  4B3R Q;  4A3F G;  4GNX A;  3FP9 A;  2QEX A;  3KDF B;  4JI5 L;  4DV0 Q;  3KLW A;  1CSQ A;  3RR5 A;  3CCM A;  2N78 A;  1Q81 C;  3HOW H;  2E2I H;  3FKI G;  3A0J A;  1N32 L;  1Q7Y C;  2R7F A;  1Y1W G;  1XNQ Q;  3UE1 A;  4LF8 L;  4A3J G;  2IX1 A;  3TS2 A;  4A3C G;  2YV5 A;  1TWH H;  4DV7 L;  4A3I H;  3RZD H;  4EX5 A;  5IY0 A;  1FJG Q;  1VQF A;  1YVC A;  3A5U A;  4HID A;  1X3G A;  2K4K A;  3CQZ H;  4X64 L;  2BA1 A;  3CCJ A;  1N33 L;  1A63 A;  2EQS A;  2UUC Q;  1AH9 A;  2UUA L;  3CCV A;  5JJK A;  4KHP Q;  2GN5 A;  3PUX A;  3K7A H;  2YU9 H;  4YWK A;  1V1Q A;  1OXX K;  4DR5 Q;  4L5Q A;  3NBH B;  3I4M G;  2OTJ A;  2BH8 A;  3EBE A;  5JEA G;  1HNW Q;  2CWP A;  4P75 A;  4LF6 Q;  1G6P A;  1YZ6 A;  4BY7 G;  4UP8 A;  1S72 A;  1TWC H;  2F52 A;  3ICE A;  5DLQ E;  4LF9 Q;  1UEB A;  1X6O A;  2AHO B;  4DR7 L;  1PH7 A;  2JA8 G;  2ASB A;  2NVY H;  2OCE A;  2AWN A;  5IYB H;  1VCI A;  1I94 L;  2VL6 A;  4DNI A;  2JJQ A;  1W2B A;  5FLM H;  3J81 j;  2F4V Q;  3KFU A;  4HJ8 A;  3HOZ H;  1BBW A;  4LFB Q;  1WFQ A;  1J6Q A;  4GKJ Q;  1PYS B;  5IWA Q;  3U4V A;  3J81 c;  3SGI A;  1KL9 A;  3FHW A;  5GAG C;  4R4Q A;  4LF5 L;  5JEA J;  4AQY Q;  1E24 A;  3CCQ A;  4JCV E;  1K8G A;  4GOP B;  2B3G A;  2ZTE A;  3G71 A;  2JA6 G;  1JJC B;  4IPC A;  4QL5 A;  3G4S A;  3LGJ A;  4XTC S;  4DK6 C;  1YI2 A;  3L7Z C;  3U58 A;  1VQ8 A;  4GKK L;  1VQB A;  1XTD A;  5M3F G;  2CCZ A;  3GTG H;  1Q8K A;  4JI2 L;  4DR6 L;  2WAQ G;  4JI7 Q;  2UU9 L;  2R93 H;  1P8L A;  1LM0 A;  4IJH A;  4IPD A;  4KLK A;  2I5H A;  1E1O A;  2AKW B;  3I4O A;  1HZB A;  4BBR H;  5M5Y H;  5M3M H;  3H0G H;  4LFA Q;  3J80 i;  3J7Z C;  2DUD A;  1XMQ Q;  4UP9 A;  4PG3 A;  4EQ5 A;  5IP7 G;  1PH1 A;  1M90 C;  4YHH Q;  1CKM A;  1EIY B;  1KD1 C;  1V9P A;  4MNO A;  1WCM G;  1VQP A;  3PF4 A;  4DR3 L;  2I0Q A;  4WJ3 M;  2XGT A;  5FJ8 H;  3CC7 A;  4DV5 Q;  4NPS A;  4P74 A;  1C9O A;  5FLM G;  1LUZ A;  3RLF A;  1K8A C;  4B3S Q;  4DK3 C;  1D7Q A;  1X3F A;  5C44 H;  1XNR Q;  2I5M X;  2KHJ A;  2MFI A;  1VQG A;  4B3R L;  2JK8 A;  1QZH A;  1RL2 A;  4R4I A;  4DV0 L;  1YJ9 A;  1G29 1;  2NVX H;  2EIF A;  5C3E G;  3W5O A;  1Q1B A;  3NEM A;  2Z6K C;  3HOX H;  3GTQ H;  4KHZ A;  3TEH B;  1XNQ L;  3S17 H;  2VS1 A;  1NJI C;  4BBS G;  1CKO A;  1Y1V H;  5AJ3 Q;  2N8N A;  1KXL A;  1YJN A;  1BVS A;  2E5L Q;  1S3O A;  4OWW B;  2NVQ H;  4JI1 Q;  4WJ4 A;  2MO1 A;  1B7Y B;  4LWC A;  5LMU Q;  2IY5 B;  4LF4 Q;  1JJG A;  1UE5 A;  4OXP A;  4OWT B;  3OTO Q;  4DR2 Q;  1N36 L;  3I7F A;  4OWX B;  1A62 A;  3S24 A;  2PQA B;  4BBR G;  2E2J H;  3T1Y Q;  4C3J H;  4ME3 A;  3KJO A;  3TS0 A;  2JA7 H;  3HKZ E;  4JOI A;  1JB7 A;  2ZM6 L;  4KHP L;  1SLJ A;  2RCN A;  2Q2H A;  4GOP C;  2HHH Q;  1L1O B;  3GTM H;  1UE6 A;  1VQN A;  3K8A A;  3ULP A;  4PMW A;  1HNW L;  1WI5 A;  2VUM G;  3CCE A;  1K0R A;  4IPH A;  4JYA L;  1I6H H;  3PUV A;  3CXC A;  1KRS A;  4JG2 A;  4YY3 Q;  4LF9 L;  2HQL A;  3F2C A;  1K73 C;  1BBU A;  4JI0 L;  2R92 G;  2L15 A;  4C2M H;  1KAW A;  1N9W A;  4ALP A;  2CFM A;  1IBK Q;  4A3K G;  1B8A A;  3HOX G;  1EQQ A;  5BR8 Q;  4DUZ L;  1ASZ A;  4UP7 A;  4GKJ L;  3I2Z A;  5IWA L;  1PVO A;  2RHQ B;  3OYY A;  1HNZ Q;  3GTO H;  4NB3 A;  3A5Z B;  4IOA A;  1YHB A;  3F2D A;  2YYZ A;  1QZG A;  2KCT A;  3S16 H;  3S1M H;  4AQY L;  1TWA H;  3GO5 A;  3CAM A;  3S2D H;  1K83 H;  4R4C A;  2CQO A;  3UDG A;  3CC2 A;  3VDY A;  2R93 G;  2JA7 G;  1C0A A;  3JC6 6;  4IPG A;  4PZ6 A;  5GAH C;  4O0A A;  3T1H Q;  2BA0 A;  3K81 C;  1YHA A;  1B70 B;  5C4X H;  2WP8 J;  2MNA A;  1VQL A;  4LF7 Q;  3I55 A;  4MZ9 A;  3CCS A;  1XMQ L;  5FLX c;  4L5S A;  3PUZ A;  4YHH L;  2DGY A;  1Z9F A;  2R7Z H;  1PA6 A;  4JV5 Q;  4A3E G;  1H95 A;  1TXY A;  4APV A;  2JA5 H;  4A93 H;  4NXN Q;  1IZ6 A;  3KF8 B;  4DV4 L;  1YNX A;  4HJ5 A;  1YIJ A;  2Z0S A;  4A3B G;  5H1S E;  5IP9 G;  4QGU A;  2VNU D;  4B3S L;  4GN4 B;  3MEF A;  4X62 Q;  2XTI A;  5GQO A;  1XNR L;  3I4N G;  1FVI A;  4A3L H;  1C7Y A;  5JJL A;  2K5H A;  3CPF A;  1SRU A;  3KDF A;  3JAM i;  4LUZ A;  2IT1 A;  3H15 A;  4A3M H;  1XJV A;  2PMZ E;  4OO1 I;  3HOU H;  2ZJQ A;  4JI4 L;  4B3M Q;  3S1N H;  1GVP A;  5C4J H;  3HOW G;  4DKA C;  2YTV A;  2YTY A;  2HIX A;  3UE0 A;  1QUQ A;  2WFW A;  1LTL A;  5ELO A;  3TRE A;  3W1G A;  5AJ3 L;  3DLL A;  2EXD A;  4DAY B;  1PH5 A;  1MJE A;  2E5L L;  4JI3 Q;  2C35 B;  1LYL A;  1Q46 A;  1MJC A;  1SRO A;  4JI1 L;  1X9N A;  1HR0 Q;  3ERS X;  4A3I G;  4L5R C;  3U50 C;  1NMG A;  1X56 A;  2UUB Q;  3HOY H;  4DUY L;  1GM5 A;  2QA4 A;  3T1Y L;  5LMN L;  1YEZ A;  4BA1 I;  4LFC Q;  1J5E L;  4DV3 Q;  2WB1 G;  1Y14 B;  4R4T A;  3J7A 5;  1XPR A;  4DR1 Q;  4Y52 H;  3BZK A;  1IBL L;  4BXX H;  2LSS A;  5IYC H;  4DV2 L;  2R7D A;  4JI8 L;  3TRZ A;  1PHJ A;  3PUY A;  4YWL A;  3GTP H;  2ZJR A;  1XPU A;  1OXU A;  4O2D A;  4P73 A;  2Y0S E;  4YY3 L;  3PCO B;  2B63 H;  2Z6K A;  1EWI A;  4DV6 Q;  3HKZ G;  4A3G H;  1PFS A;  4DPG A;  1VQ5 A;  1YHQ A;  4A3M G;  1OXS C;  3S15 H;  3M4Q A;  1HNX L;  2RHS B;  4TQU S;  5IYB G;  4YCU A;  2I5L X;  4DV1 Q;  1N32 Q;  3ER0 A;  3HOZ G;  4LW1 A;  1HNZ L;  2FXQ A;  5ELN A;  4LF8 Q;  2RF4 A;  4IFD I;  1U0L A;  5IE8 A;  4HJA A;  1VQH A;  4GLA C;  3HKS A;  4DV7 Q;  3HFZ B;  2ZJP A;  1VQ9 A;  4GOP A;  3KF6 A;  1R9T H;  4AIM A;  1K3R A;  4X64 Q;  3M4O H;  2WB1 E;  1E3P A;  3U4Z A;  1VS0 A;  3M9B A;  2UUA Q;  1N34 Q;  4GN3 B;  3CCL A;  1JJ2 A;  4BXX G;  5IYC G;  3T1H L;  4YWM A;  4A3D H;  3PSI A;  3PIO A;  1FJG L;  1CSP A;  2UXC Q;  2A19 A;  4LF7 L;  1NE3 A;  1A0I A;  3K7U C;  3WWV A;  4JC0 A;  4YCV A;  2NN6 I;  3BU2 A;  1XMO Q;  2OQ0 A;  2PNH A;  1VQM A;  4BY1 H;  1M1K C;  4PZ7 A;  2AWO A;  5M3M G;  3H0G G;  3TQY A;  3G6E A;  4JV5 L;  2MO0 A;  4NXN L;  2CWA A;  2A1A A;  3L0O A;  2E2H H;  1UE1 A;  4FDB A;  4DR5 L;  4LNQ A;  1X65 A;  1IXR A;  4X62 L;  1I94 Q;  5FJ8 G;  5J3B A;  4R1J A;  4LF6 L;  4RMF A;  4Y7N H;  3UDI A;  3D31 A;  4OON A;  1RIP A;  3STB C;  5C44 G;  2K52 A;  1GD7 A;  1PH9 A;  1IBM Q;  3PO3 H;  4L5T A;  4A3F H;  3CME A;  4C3H H;  1CKN A;  4HIM A;  2OTL A;  4LF5 Q;  4IJL A;  4GNX B;  4B3M L;  2R6G A;  4QY7 A;  3FKI H;  1EOV A;  1VQD A;  5HGQ A;  3J81 i;  2AMC B;  3K0X A;  2Q2I A;  1I3Q H;  1Y1W H;  2F4V L;  3KJP A;  5HY6 A;  4LFB L;  4K0K Q;  2KBN A;  1AE2 A;  4JI3 L;  3RZO H;  4A3C H;  1Y1V G;  2NZO A;  3AFQ A;  3EN2 A;  2JE6 I;  3PGZ A;  4QIW E;  4C3I H;  2VQF Q;  1PYB A;  1VQJ A;  1HR0 L;  4A3D G;  1PH8 A;  2UUB L;  5C0X I;  4DR6 Q;  2D0P A;  1WJJ A;  4JBW A;  4NXM Q;  1JT8 A;  1JMC A;  3BZC A;  3STB D;  4P71 A;  4JI6 Q;  1Q82 C;  1NY4 A;  2KHI A;  3J80 c;  1UE7 A;  3GTJ H;  4DR3 Q;  3MXN B;  1KIX A;  3EIV A;  1VQC A;  2UUC L;  4JI7 L;  2GVB A;  3HOV H;  5GAE C;  2N3S A;  3I4M H;  4DR4 Q;  3D0F A;  1E7Z A;  5K36 G;  4MTN A;  5M5W H;  4LFA L;  4BY7 H;  3RNU A;  2OQK A;  1SMX A;  4GLX A;  3GTK H;  4GN5 A;  1NBW A;  4IO9 A;  3S1R H;  1E22 A;  2JA8 H;  2K14 A;  2QGQ A;  1VQA A;  2IHF A;  3W1B A;  4DV5 L;  4DV1 L;  2ALY B;  3F1Z A;  1WOC A;  1L1O C;  3M4P A;  1JE5 A;  1NMF A;  1PH3 A;  3S1Q H;  5JJI A;  3RLN A;  3K80 C;  2YTX A;  1SN8 A;  2OWO A;  1QUQ B;  1W3S A;  2IHE A;  2PI2 A;  2Y0S G;  5LMN W;  1HZA A;  2ES2 A;  2UXD Q;  1KQS A;  3KYH C;  4X65 Q;  3DM3 A;  3CD6 A;  4UY8 C;  4GLV B;  1Z47 A;  1U5K A;  4X66 Q;  1HZ9 A;  4GS3 A;  1VQK A;  2NN6 G;  2JA6 H;  4HIO A;  1N36 Q;  2UXB Q;  2Q2U A;  1N34 L;  1EQR A;  4GNX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...