4AYBG

Rnap at 3.2ang
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
113
structure length
113
Chain Sequence
KAQEIILSCEINSIERGSLKNLSIIHMSCNDFNISFDIIDSINIFSQKEKVKAFISKNRLSYTNDDFCGHGYIVTELKDSSSNNGNRYITIISLFGLLVKIISNKESFLKIHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
pubmed doi rcsb
total genus 12
structure length 113
sequence length 113
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF16992 RNA_pol_RpbG DNA-directed RNA polymerase, subunit G
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4aybG00
1GKHA 2OCEA 4BY1G 4GKJQ 3CCVA 1Q12A 4IPHA 4C3JH 5IT9c 1I94Q 1U0LA 4PZ6A 3CCRA 4NXML 4HIMA 2I5MX 3B6YA 1VQ9A 5FJ8G 3TRZA 1I6HH 5IYDG 1W3SA 2E2IH 3TREA 1ASYA 2JK8A 4A3EH 2Y0SG 1OTCA 2JA6G 3HOZG 4DR7L 4P74A 5AJ3Q 5JEAJ 1YITA 1P8LA 3GD7A 4JI0Q 3S24A 1FJGL 3AQQA 1BBWA 3A0JA 3NELA 3H15A 4DV5Q 4B3MQ 2B3GA 4R4OA 1BKBA 2R7DA 3PO3H 3CPFA 3PIPA 1N36Q 4MZ9A 4R4CA 1TWCH 4DNIA 4QGUA 4A3IG 1RL2A 2UXCL 3OTOQ 1YJ9A 1AE2A 4GOPA 1H95A 3OYYA 1N33L 4A3DG 2UUCQ 2DUDA 1BBUA 1EUJA 2CKZB 1NJIC 1FVIA 5GADC 2B63G 2HHHL 1KRTA 1NTGA 3GTOH 4P73A 2WB1G 1IBMQ 1KHIA 4R4TA 4YCVA 1GD7A 4JI7Q 1FL0A 1Z9FA 4B3TL 2HIXA 1VQ5A 1VQLA 3PF5A 3K7UC 3RZDH 3JC66 4DR1L 3KOJA 1UWVA 2HIVA 4X64L 3A5UA 3HKSA 1N34Q 3I55A 1GO3E 1WCMH 4A3LG 5BR8L 4OWWB 2OQ0A 1N32Q 2BA0A 3RLOA 3S1RH 2JA5H 2VZAA 4C3HH 5J3BA 5JJKA 2AWNA 4O0AA 5M3MH 1NBWA 2ZTDA 4DV6Q 4DR7Q 5K36G 2YYZA 4ME3A 1WYDA 1K0RA 4LF9L 4RG1A 4K0KQ 3CCUA 1YNXA 3CCMA 4HIDA 4JBJA 2AWOA 4YY3L 3HOXG 4DUYL 4A3CG 2YV5A 1AE3A 2KHJA 4DV1L 2GVAA 1HR0Q 5IP7H 4A3BG 2EQSA 1YHAA 3KF6B 3M3YH 3S14H 1YHBA 4A3FG 4FDBA 2NZHA 2N8NA 3GTPH 3FKIG 1KAWA 3W5OA 4DR6L 1MIUA 2WAQE 3T1YL 3KF8B 3PGZA 3J7A5 1P16A 3GTGH 2LXKA 3GDEA 3Q8DA 4PZ8A 5C3EG 1XPUA 1Q81C 1SROA 4QJFA 1Y1WH 4DR5Q 2IX0A 1X3FA 4X66L 5IYBH 5LMUL 4AH6A 5M3FG 1VQBA 3K8AA 3MEFA 3CMAA 4JG2A 1M1KC 2RHQB 4DV7Q 1SFOH 5C4JH 5JEAG 1IYJB 4H02A 3ULJA 4A3MG 2UUBL 4OX9Q 4OWTB 2F3IA 2D62A 2ES2A 2JA8G 3ER0A 3J81i 2JEAI 1I50H 3HKZG 2VUMH 3GTJH 3EIVA 4AIMA 1OXVA 1XTDA 1YEZA 2R7FA 4C3IH 1RIPA 2ZM6Q 4YWLA 1JE5A 3ERSX 3G71A 5LMNL 1XMQQ 3GTLH 4DUYQ 2XTIA 3S1NH 2ALYB 4JYAL 2OTJA 3H3VH 1VQHA 4DAMA 5IYCH 2E5LQ 5FLMG 4A4IA 4LFCL 4P72A 4JI3L 4JBMA 4BBSH 2YTVA 1CKNB 2NVYH 4JOIA 4LF8L 2VQFL 2E2HH 3M85A 1W2BA 3NEMA 4B3SL 1LTLA 2I5LX 4DUZQ 2HT1A 3MXNB 1HH2P 1VQ6A 3STBD 5GAHC 3CCLA 4LF5L 4DR2L 3M7NA 2Q2UA 2RCNA 1WFQA 1VQIA 1L1OA 4AQYQ 3PUVA 4GN5A 2N78A 1EYGA 4A3JH 4BBRG 4JI6L 2JQOA 2IT1A 2PI2E 2NZOA 4A3EG 1QVFA 4A3KG 1PV4A 2R93H 2KHIA 3E9IA 3K7AH 2Z6KC 1K8AC 3GTMH 4DV4L 4YHHQ 2L15A 3UDFA 3F2BA 2R7ZG 2ZJQA 1MJCA 1X3EA 2PMZE 5LMNQ 4A3GH 4LWCA 3KJOA 4OO1I 3PO2G 1LUZA 1SLJA 4LF4L 4JV5L 4LFCQ 1X65A 1XNQL 2K5NA 3CCSA 1PH4A 2UUAL 3H0GH 1QZHA 2VQFQ 1B70B 3E0EA 4IJLA 4LFBQ 1HNZL 1UEBA 3HOVH 3I7FA 1K8GA 4X62L 2R92H 3KFUA 1IXRA 1TWGH 1E24A 1YJWA 2AMCB 5HY6A 3U50C 1PFSA 1Z47A 4BXXH 1IBKQ 3E9HA 1Q7YC 1PHJA 4OO1G 4YCWA 4GKKQ 2DGYA 3PUZA 4P71A 2OWOA 5C4XG 2D0OA 1HNWQ 4QL5A 1WCMG 3JAMc 1KIXA 4GLVB 4APVA 3J81c 4LUZA 1YI2A 4B3RL 2JA5G 2Q2IA 4DR4L 4PMWA 3SGIA 3IRBA 3KDFA 4TVAB 4XIGS 1X56A 1EIFA 4R1JA 1PH9A 4ALPA 2I5HA 4IJHA 2OTLA 3U4ZA 1K3RA 2UU9L 1G291 5GQOA 2JA7H 1XNRQ 1Y1VH 2F4VL 3I2ZA 1TXYA 3WWVA 4LF6L 2I0QA 1X9NA 2C35B 1VQEA 2UXBQ 2IHEA 2KCTA 4OWXB 3S2HH 2AKWB 3BZCA 5C0XJ 1WJJA 2ZJRA 3CC2A 2N49A 1X6OA 2A19A 3L7ZC 3F2CA 1HNZQ 3RNUA 2K52A 4WJ3M 4X6AH 1PYSB 4NB3A 1HJPA 4HIKA 4LF7L 3CCEA 3J80c 2EIFA 1NE3A 2GN5A 1OXXK 3T1HL 4QQBX 1YHQA 5IP9G 4BY7G 3CCJA 4NXMQ 1VQOA 1VQDA 2CQOA 1XJVA 4KHZA 2BH2A 4GNXB 4GNXC 1V9PA 5IWAL 1J5EL 2K50A 3GTQH 4UPAA 3H3VI 1G51A 1FJGQ 3UE0A 2EXDA 3UE1A 5M5XH 1VQMA 4YCUA 1GVPA 1HR0W 1HNXL 1C9OA 3M9BA 3HOWH 2N3SA 4JI1L 3S17H 4AYBG 3W1GA 1V1QA 1IBLL 4DV2L 2UXCQ 3G6EA 1YVCA 5FJ8H 1OXSC 3FHWA 1EIYB 1N33Q 3TS2A 3F2DA 2K5VA 2NVXH 1CKOA 1OXTA 2E8GA 3HOZH 3RLNA 2HHHQ 1C7YA 2JEBI 5IYCG 1JMCA 1VQ8A 4NPSA 4BBSG 1KD1C 1UE7A 2QA4A 4B3TQ 1DGSA 4LNQA 1HZCA 2PI2A 2LSSA 4DR1Q 1XMOL 5M5WH 1EOVA 4POGA 4X64Q 2IHFA 2LXJA 4NXNL 5GAEC 1I3QH 2PNHA 5BR8Q 3F1ZA 2BA1A 2CCZA 4JI8L 2ZJPA 4IOAA 1K73C 1JJGA 4A93H 4KLKA 1Q86C 1K83H 1E1TA 3NBHB 4JBWA 2Z0SA 3JAMi 1SN8A 5C0XI 1FGUA 3W1BA 1EFWA 4JBKA 3HOYH 4LF9Q 3J7ZC 4GN3B 2JA9A 2V1CC 2F52A 3ICEA 2B29A 4X65L 3HOUH 4JI1Q 3AFQA 2PQAB 4YY3Q 2R93G 4A3LH 3M4PA 2QGQA 2YTYA 1S3OA 4DV2Q 1NMFA 4DV1Q 1IBLQ 3S1QH 1KXLA 1BVSA 1L2FA 4MTNA 5C0XG 4JI2L 4A3GG 1PVOA 3A5ZB 3STBC 4DR6Q 3EN2A 4GN4B 3T1YQ 4UP8A 3RN5A 3H0GG 2Y0SE 3ZJYC 3KF6A 2CWPA 3K81C 4EQ5A 1NY4A 1O7IA 3I4NG 5IE8A 3HOXH 1HZ9A 4JI5L 4GLXA 4J15A 1UE1A 4DV3L 4LFAL 4KHPL 5DLQE 3J80i 4X66Q 5LMUQ 1VQJA 4DKAC 1HZBA 2KBNA 3TEHB 4A3FH 3J81j 2UXDQ 4RMFA 1Q1EA 3F8TA 1Q46A 2BH8A 1MJEA 1JT8A 2UUBQ 1Q1BA 2JJQA 1SR3A 5JJIA 3CC4A 2VQEL 4DR3L 4JI4L 1OXUA 1I5FA 1LYLA 2WB1E 2H5XA 4UP7A 4X65Q 2R6GA 3PO3G 1B7YB 4JYAQ 5M3FH 1EWIA 1A62A 1E1OA 4JC0A 4GKJL 1Q8KA 1I94L 1KL9A 1GM5A 2JA7G 3RZOH 2A1AA 3LGJA 4IFDJ 4JI3Q 1PH8A 2WAQG 1C0AA 3KDFB 4C2MH 4A3MH 4LF8Q 4IPDA 4DAYB 3KYHC 5AJ3L 3CCQA 3K0XA 2NN6I 4JI0L 4B3SQ 2MO1A 2XGTA 3CF5A 1KRSA 4DV5L 1WI5A 4GOPB 4GOPC 4B3ML 3I4MH 2NVTH 3S1MH 1QUQA 1CKNA 4HJ8A 4LF5Q 2RHSB 3TQYA 3L0OA 4L5QA 4DR2Q 1N36L 3NENA 1X54A 1EQQA 5FLMH 1A63A 2RF4A 3VDYA 3OTOL 1E22A 4R4IA 2UUCL 1X3GA 3RLFA 4JI6Q 4HJ7A 5M3MG 2VY3A 4JI7L 2YU9H 4DV4Q 5ELOA 1PH6A 2MO0A 2Q2TA 5ELNA 2K75A 1SE8A 3HOWG 2MNAA 4YWKA 1N34L 4Y52H 1A0IA 2AHOB 2WFWA 2Z6KA 4GLAC 4JCVE 4LF4Q 4BBRH 4JV5Q 2QEXA 1N32L 1XNQQ 5IP7G 4EX5A 3M4QA 3PUWA 4GS3A 1PH1A 1SMXA 1PH5A 1LM0A 2UUAQ 4A3KH 1VQFA 4DV6L 5GROA 3S16H 1ASZA 2KCMA 3PUYA 4IPGA 4X62Q 1U5KA 2VW9A 2HQLA 1K9MC 2R7ZH 1YZ6A 1MKHA 2MFIA 3U4VA 4K0KL 4MNOA 5HGQA 3KJPA 1V43A 4POFA 3PO2H 3HKZE 3RR5A 2MQHA 2ZTEA 1Y1WG 1UE6A 1HR0L 2CWAA 5IYBG 4IFDI 4P75A 3BJUA 4LUVA 3I56A 4B3RQ 5C44H 3U58A 2OQKA 4DR4Q 4A93G 4BY1H 1D7QA 1S40A 5JJLA 2VUMG 1QVCA 2UU9Q 1R9TH 1QZGA 2FXQA 1CUKA 2A8VA 2F4VQ 3HOYG 3PCOB 4LF6Q 1NMGA 5C4XH 4HJ5A 4DR5L 2JA6H 3AEVA 3HOUG 4IFDG 4O2DA 4XTCS 1VQAA 2NVQH 4LW1A 4OXPA 4DV7L 1EQRA 5EAYA 4DV0L 3ULLA 3CD6A 3KLWA 5GAGC 4OX9L 1TWAH 3S2DH 1YJNA 4QIWE 1CSQA 4LF7Q 4A3IH 3T1HQ 1QVGA 1PH2A 4QY7A 2ZM6L 3BU2A 4A3DH 4JOIC 3CPWA 1XPRA 2B63H 1XMQL 2VNUD 1JJ2A 1L0WA 1CKMA 5IWAQ 1J5EQ 2E5LL 2YTXA 1PYBA 3BZKA 4DK6C 4UY8C 1VQNA 4BA2I 4A3JG 5H1SE 1D8LA 4HJAA 1J6QA 1VS0A 3FP9A 4GNXA 1HNXQ 4DUZL 4IO9A 1L1OB 1L1OC 3DM3A 3G48A 4DK3C 1VCIA 5E7NA 5IP9H 4BY7H 3CP0A 1KC8C 1T9HA 1X55A 3HFZB 4PG3A 4AQYL 4A76A 3G4SA 2CFMA 3I4OA 4HJ9A 4DV0Q 3TS0A 2ZTCA 2ID0A 4OONA 3PF4A 3UDIA 2IX1A 5M5YH 4PZ7A 2JE6I 1VQ4A 1WOCA 4A3CH 3K80C 1AH9A 1XMOQ 2ASBA 3HOVG 3CW2C 3EBEA 3M4OH 4YHHL 2E2JH 1VQPA 1JJCB 3OW2A 2K4KA 4NXNQ 2R92G 1E7ZA 3I4MG 4A3BH 4WJ4A 1Q82C 4BXXG 2Q2HA 4JI8Q 3GTKH 1UE5A 1G6PA 3FKIH 3ULPA 1Y14B 5LMNW 1A8VA 1QUQB 1B8AA 4BA1I 3DLLA 4TQUS 2K14A 5C3EH 1E3PA 3D0FA 4L5TA 4LFBL 4LUOA 3D31A 3UDXA 1TWHH 5FLXc 4Y7NH 4A75A 3A74A 4YWMA 1PA6A 1IBKL 1Y1VG 4GKKL 2GVBA 1IL2A 3AYHB 1HNWL 3GO5A 4JI2Q 1PH3A 2PQAA 1HZAA 2JA8H 3CMEA 1XPOA 1KQSA 2VL6A 3PV0A 3PSIA 2D0PA 2KENA 3UDGA 3S15H 3AFPA 2UXDL 2WP8J 4JI5Q 4L5RC 4LFAQ 1CSPA 2VS1A 3CQZH 4DV3Q 1VQ7A 4KHPQ 1VQKA 1N9WA 1XNRL 3CC7A 1PH7A 1JB7A 5IY0A 3RN2A 1M90C 4AYBE 1YIJA 1IZ6A 3CXCA 3CAMA 3PUXA 1SRUA 2NN6G 2UXBL 1IBML 2IY5B 4UP9A 4L5SA 4DPGA 1VQCA 1YBYA 3I4NH 4KI0A 2VQEQ 4DR3Q 2K5HA 3L2PA 4IOCA 4JI4Q 1S72A 1N8RC 1VQGA 5C44G 2ATWA 5IYDH 1TWFH 4HIOA 3PIOA 4IPCA 4R4QA
chains in the Genus database with same CATH superfamily
2QILA 5FK9C 5M9OA 3CCVA 1Q12A 5IT9c 1H9RA 1C4QA 4PZ6A 3TRZA 1EEID 5IYDG 1W3SA 2E2IH 1ASYA 4A3EH 2Y0SG 2KECA 4OELB 5BN4A 5IGBA 3S24A 3AQQA 2R7DA 1ZYRD 2A68D 4J1MA 4MZ9A 4R4CA 1TS2A 4DNIA 4QGUA 1AW7A 1RL2A 1ESRA 1SJHD 1G6ZA 1AE2A 2BE5C 3OYYA 2DUDA 2CKZB 3J7YW 1NJIC 3GTOH 1FL0A 3P7JA 2HIXA 1VQ5A 1BDOA 3PF5A 1VQLA 4CKBA 3JC66 1K83B 2HIVA 3HKSA 2VUMB 4A3LG 1I50B 1PYWD 5BR8L 4XDXA 2OQ0A 2BA0A 1SYCA 3S1NB 5J3BA 2F4IA 5JJKA 4O0AA 3MHBA 2NUCA 3H3VC 1B3AA 1WYDA 5K5PA 1K0RA 4LF9L 4RG1A 4K0KQ 3D4WA 3NPPA 4KMUC 3HOXG 4A3CG 5NUCA 1HR0Q 5IP7H 2F3VA 1O80A 2E74C 3S14H 1YHBA 1D5MC 4FDBA 1MGSA 3IAYA 2M2LA 2FINB 1VF5C 1LT6D 1W6KA 2WAQE 2BDNA 4KY5A 2SOBA 1JC7A 3M4YA 3J7AF 5F2DA 1X3FA 3SXHA 4JG2A 1M1KC 1SFOH 2EYLA 4KKUA 4A3MG 1ML0D 2A6EC 4ZQ3A 4OWTB 2K33A 3Q6SA 1MI2A 1V1PB 2ES2A 3ER0A 3J81i 4AIMA 1OXVA 2R7FA 4C3IH 3T13A 1H9MA 2RSNA 3G71A 3GTLH 2XTIA 3VA7A 5I6WA 4K2LA 1BF4A 4P72A 4JI3L 4BBSH 2FHTA 3VYRA 2YTVA 1CKNB 2VQFL 1LTLA 1ILPA 2XRQD 1F9RA 1L0YB 4LF5L 3Q0AA 4DR2L 1PRTB 1WFQA 1Y1VB 2N78A 1EYGA 3CKIB 2F0KA 2QKIC 1LTAD 2EYOA 2F0QA 2NZOA 1KDBA 1HPCA 5CV4A 2KHIA 3GTMH 1TQOA 3R93A 4YHHQ 4CDDC 1E2VA 3F2BA 4H44C 3S16B 1U9RA 4A3GH 4OO1I 3PO2G 1SLJA 4LF4L 4JV5L 4LFCQ 1X65A 4OIJA 1EOTA 1UEBA 1VF7A 1O7YA 2R92H 5C44B 1RCVD 1Z47A 1BO0A 2OWOA 3MA2B 4F88A 2D0OA 4K14A 4WFN3 3JAMc 3I91A 3J81c 5E3FA 4LUZA 4RGNA 4B3RL 1D6EC 3HOZB 2NVXB 2JA6B 2Q2IA 3QOLA 4DR4L 3IRBA 4XIGS 5FO8B 1IL8A 2I5HA 1SNOA 2K28A 3K5NA 1K3RA 3R2TA 1G291 3TP8A 1YNND 1X9NA 1IKLA 2K32A 2AKWB 4TSSA 1IYUA 3G7LA 4NMZA 2N49A 4RKBA 3L7ZC 3F2CA 1J9OA 1JB3A 1LACA 4X6AH 4DXGA 2EIFA 2GN5A 1WD1A 5IT9E 5IP9G 4NXMQ 1QOHA 2BH2A 1V9PA 4UPAA 3UE0A 5M5XH 4YCUA 1UUPA 3K5LA 1HNXL 2IW3A 1WTRA 3W1GA 2Z4IA 4ID6A 2DN8A 1YVCA 3FHWA 5IYDH 4FF3A 1K28A 2E8GA 1CHQD 5ELBA 2HHHQ 1K8OA 3VR3A 3GV6A 4B3TQ 1EY0A 1XWEA 2VB3X 3CU7A 3FKIB 1GHKA 4LNQA 5C6AA 4DR1Q 5IGGA 4POGA 1BCPC 5GAEC 1I3QH 4LJZC 4KKTA 3F1ZA 5COYA 1S4ZA 2IPKD 4OGQC 1ICWA 4F87A 5M3FB 1HRJA 1SMYD 1JJGA 1RKNA 4J8QA 1K83H 3RZOB 4JBWA 2Z9HA 1D2BA 2V1CC 3EVQA 1B53A 3FDTA 1WTQA 2R93G 3T56B 1X3PA 1F9SA 4A3LH 3HKZB 1JQYD 4DV2Q 1NMFA 1SNDA 3S1QH 3VR4A 4K2KA 1HTPA 3S15B 1BVSA 1EQTA 5C0XG 3A5ZB 3EN2A 5KEEA 1AFPA 1CK1A 1KAAA 3T1YQ 4UP8A 3RN5A 3H0GG 2Y0SE 2M00A 3K81C 1NY4A 5IE8A 3HOXH 5A2QL 5IGDA 4KHPL 4X66Q 1PFMA 3T16A 4FNFA 3L9AX 3J81j 1TWFB 1U4RA 5FKAC 1JT8A 1R4QB 2UUBQ 4KJOA 1Q1BA 2DJGC 1OXUA 1I5FA 5E1FA 4UP7A 2R6GA 3PO3G 4JYAQ 1A62A 3CRKC 1V1PA 2QW7A 1KL9A 1GM5A 2LY7A 4IFDJ 1LTBD 3H09A 4C2MH 4KD4A 4A3MH 5HURA 4IPDA 5AJ3L 2NN6I 1KRSA 4GOPC 1WI5A 4B3ML 5CV5A 3HEJA 2Z8LA 1CKNA 1EY7A 1N36L 4L5QA 3NENA 3A56A 2RF4A 3T4AC 1T5EA 1EYDA 5CV7A 1E22A 4R4IA 4RA8A 1O78A 5JPNC 4JI6Q 3C3LA 4HJ7A 2D9UA 4DNRB 1WCMB 3KK7A 5M3MG 1VMCA 4JI7L 3HG9A 1TS4A 4DV4Q 3T51B 2JA5B 4C3HB 2K75A 1EYAA 1QNUA 4N9PA 1N34L 4Y52H 1A0IA 2NZ1D 2WFWA 2G9HD 2Z6KA 4GLAC 4JCVE 3R8BA 1N32L 1XNQQ 3M4QA 1ZKOA 1HQRD 1LM0A 2PZUA 3S16H 1BR9A 3LWEA 3TDQA 3KJPA 3OWEB 1V43A 3GTPB 4G4KA 3PO2H 1STAA 1Y1WG 1GUWA 1SSOA 1UE6A 1AEXA 4BY7B 4CDCC 3ONAB 5C44H 2J7ZA 4F8MA 1KLUD 1S40A 1QVCA 1QZGA 4LF6Q 4DR5L 3HOUG 4HJ5A 2JA6H 4MHEA 4O2DA 1VQAA 3DM1A 3GTJB 2A69C 4OXPA 2DY7A 3TP6A 3K59A 2JYOA 3KBGA 1TWAH 4ZKBB 1K3BC 2CW0C 2G9DA 4QY7A 3SHLA 5J39A 4JOIC 2E2HB 1XMQL 1JJ2A 3BZDB 3EROA 3K57A 5EKIA 2IL8A 4HSVA 3BZKA 4DN4M 4A3JG 2L1BA 3C1FA 4RGTA 3MVVA 1D8LA 4HJAA 2JSOA 2AQ2B 4IO9A 1L1OC 4DK3C 5E7NA 5IP9H 3CP0A 3FRPB 1LLRD 3OSOA 1T9HA 4A76A 2A6HD 3G4SA 1JOKA 3BVGA 1JOQA 2BCOA 2MPMA 2EY2A 1DXMA 2ZTCA 3MAQA 3PF4A 5M5YH 1CFMA 3I4NB 3OW2A 4NXNQ 4WJ4A 1E7ZA 1EZ6A 1D5XC 4G57A 2Q2HA 1RF2D 3MXGA 3FKIH 1STYA 3TP5A 3ULPA 3MC0B 4KTAA 1QUQB 3NE5B 2K14A 3D31A 3UDXA 2RVLA 1TWHH 5FLXc 2E2DC 4K5VA 4YWMA 1I4XA 1IBKL 5J1ZA 1DOLA 3AYHB 1HNWL 5C5MA 4JI2Q 1PH3A 1HZAA 2X69A 4DGZA 2WAQB 3SEBA 3KUPA 1HFGA 3S15H 3AFPA 4JI5Q 4L5RC 4E6IA 1CSPA 1VQKA 1N9WA 1M90C 1SRUA 5CR3A 3QR8A 2UXBL 1IBML 2IY5B 4HAEA 1S5CD 4KI0A 1Z6HA 4JI4Q 4IOCA 1XXGA 1S72A 1D1IA 1TWFH 1GKHA 2OCEA 4BY1G 3MZ5A 4IPHA 1I94Q 5EJWA 1BXTA 1U0LA 2Q8RE 3CCRA 4HIMA 1I6HH 1OTCA 1B9MA 4DR7L 4P74A 1YITA 1ZYRC 1SYGA 3GD7A 4JI0Q 2RDFA 1BBWA 3A0JA 2A68C 4DV5Q 2B3GA 3S14B 1BKBA 3PO3H 2PCFB 3CPFA 1JWUD 1FGBD 2F0PA 2Q8IB 3OTOQ 1H95A 2L5TA 4DAVA 2CHBD 2Z4HA 1N33L 2UUCQ 4A3DG 1BBUA 5GADC 1NTGA 4P73A 1SNMA 1NUCA 4RH6A 4YCVA 1Z9FA 4JW0A 1CT1D 1SFOB 1BQQT 3K7UC 4A93B 3KOJA 2OT2A 3A5UA 3HZXA 3I55A 1GO3E 1WCMH 4DF7A 3HOYB 4EQNA 3RLOA 3S1RH 2JA5H 2VZAA 2PQEA 4C3HH 4DXFA 5M3MH 3D3RA 4MIUA 1T5XD 3CCMA 2NB0A 4DUYL 4CDEC 4DV1L 3BYYB 4M8AA 2EQSA 3M3YH 2FMMA 1TIID 4A3FG 3P1HA 2O5IC 3GTPH 1KAWA 4DR6L 2XIWA 1MIUA 2F0DA 3KF8B 1CM9A 3PGZA 4L6TB 3J7A5 1P16A 5C3EG 1XPUA 1KLGD 5KYLA 2HCIA 1WTWA 1SROA 2KEEA 4QJFA 1Y1WH 2IX0A 4EQPA 2K01A 4HMIA 1MBYA 4HCSA 5ISRA 3CMAA 5JEAG 3TZDA 4A3GB 1KNEA 2F3IA 2L11A 4CJ1B 4QMGA 2JA8G 3GTJH 2ZM6Q 2HUGA 1RIPA 3WDNA 4YWLA 5LMNL 5BN5A 1YNJD 2ALYB 3H3VH 1VQHA 1Y8NB 4DAMA 5IYCH 2R92B 5FLMG 2NVTB 1I4QA 4JBMA 1EU4A 1B3QA 3LNNA 5C5LA 1WTHA 3OWFA 1G2SA 3FMCA 2E2HH 3M85A 1BCPF 3NEMA 1EWCA 4B3SL 2HT1A 2F0MA 2PNRC 2NTTA 1CI3M 1PFBA 3U9SA 3Q23A 3CCLA 3M7NA 4IALA 1EZ8A 3PUVA 4IUQA 4A3JH 4BBRG 3I72A 2JQOA 1PRTD 2IT1A 3E0JA 2PI2E 2LMCB 2KHSA 3K7AH 1K8AC 1ONLA 1PMRA 2CQAA 3A8KE 1STEA 5I2XA 2PMZE 2ZJQA 3NUCA 2HCCA 5EPJA 5DNFA 3OMCA 2NWGA 5JAVA 1ENFA 2MUYA 4CGYB 2K5NA 3IFTA 1B70B 3URYA 2VQFQ 1LT5D 2K03A 3BDLA 1LTTD 2MP1A 1K8GA 2Z1CA 3KFUA 1E24A 1YJWA 2DNEA 2EJFC 5M5XB 4DA2A 3U50C 2CH4W 2Q8TA 4OO1G 3E9HA 2XN9C 1Q7YC 4OL7A 2DGYA 3VYTA 5C4XG 1SBBB 1R9TB 4GLVB 1A6XA 2QDBA 1U4MA 2Y0SB 2NVQB 3PMFA 1PH9A 4R1JA 1EIFA 2UU9L 5GQOA 1XNRQ 2F4VL 2ICEC 4XXEA 4KJNA 3KLRA 2B2TA 1H9SB 1VQEA 2KCTA 1I3QB 3BZCA 5C0XJ 1WJJA 3DUZA 1X6OA 2A19A 2B2WA 2VB2X 3MXUA 4ZLTF 2K52A 2OXPA 1PYSB 2RKSA 5IIFA 1RHPA 3J80c 2B8FA 2F0WA 4NW2A 1WTVA 1XJVA 4GNXC 4KK7A 5IWAL 1J5EL 2K50A 3GTQH 3S1QB 1FJGQ 2EXDA 3NXWA 4ME5A 3QIAA 5CMDA 3M9BA 3IKJA 4TKOB 4UAIA 4JI1L 2PZTA 1H9KA 1V1QA 1STBA 2C9OA 1IBLL 2UXCQ 3N52A 1JWMD 4LMQD 3TS2A 1EIYB 3F2DA 1CKOA 3HOXB 2O2LD 2F3WA 2LS01 1Y69U 3M4OB 4YIJA 1KNAA 4NPSA 1UE7A 1EEFD 1NR2A 4RFBA 1CZWA 3G6JB 5KRUA 1XMOL 4DAPA 1EOVA 5EBCA 3K58A 4X64Q 2B2YC 3TSSA 3HGBA 2IHFA 2LXJA 2F1MA 3D6WA 2BA1A 2CCZA 1B44D 3FPUB 1K73C 4A93H 4KLKA 1EIHA 2K5DA 1Q86C 3NBHB 1E1TA 3JAMi 1SN8A 3W1BA 3TBIB 3HOYH 1GXDC 4C2MB 4A3MB 4X65L 4YY3Q 4IFDH 3M4PA 4RWSC 2QGQA 1HXYD 1S3OA 2HD3A 1KXLA 5IT9L 4OHJA 1XYIA 3STBC 4GN4B 4EQ5A 1O7IA 5D3DA 4L63B 4GLXA 3NQIA 5KGUA 4DV3L 4RGMA 4ABNA 5LMUQ 3KF8A 1VQJA 4DKAC 4C3JG 3TEHB 4A3FH 1BNZA 2RSOA 4B9WA 2JJQA 1SR3A 2E76C 5JJIA 4DR3L 2WIIB 1SEBD 4CHTB 1S5BD 1B7YB 1EWIA 2I07B 4JC0A 4O42A 4U68A 1Q8KA 1AZPA 2JA7G 2A73B 2A1AA 3LGJA 2OEOA 5JEAH 1I4RA 1PH8A 1C0AA 3BYTB 3KDFB 2L0CA 4LF8Q 4FF2A 1TR5A 3PO2B 4DAYB 1ICFB 4RCOA 3KYHC 3CCQA 3K0XA 3C46A 3AU7A 1SYDA 3VR2A 2N88A 4I65A 2NVTH 2B2VC 3BS1A 3QG1A 2RHSB 4IUUA 3TQYA 3L0OA 1QWYA 1X54A 5FLMH 5ELEA 1IW7D 2ZXPA 2FJ2A 2F0SA 3RLFA 1E2WA 2CVRA 5JPMC 1EL0A 4QUCA 5ELOA 2E75C 1PH6A 1KABA 2MO0A 2Q2TA 1TWAB 3HOWG 2MNAA 4YWKA 3H94A 4BBRH 1HQMC 2UUAQ 1FYCA 2F0FA 5C4ZA 3PUYA 4X62Q 2AQ3B 4CBVA 4P2CB 1YZ6A 4K0KL 1DM0B 1S5FD 3E3XA 2EZVA 2ZTEA 1A3VA 1HR0L 5IYBG 4P75A 3BJUA 1DD2A 4NDXA 4LUVA 1EYCA 1EWHA 3U58A 4BWGB 3Q22A 4RAUC 1D7QA 5JJLA 5KIXA 1R9TH 2FXQA 3PCOB 5M5YB 1PZKD 5C4XH 5EKKA 1PFNA 2NVQH 4DV0L 3ULLA 4CJ0B 3S2DH 4QIWE 4LF7Q 4IURA 3A7AB 3J80E 3T1HQ 5DAUA 2VNUD 1I6VC 1L0WA 1TWHB 2YTXA 1PYBA 2F0NA 4UY8C 4BA2I 3K6OA 4KN4C 3U9OA 3H91A 5H1SE 1J6QA 3FP9A 3RMHA 3TMEA 2F0EA 1BBXC 4HMJA 4CDFC 4DK0A 2K04A 4G7HC 2A6HC 2R93B 1S5ED 4PG3A 4N8X1 3L3OC 1DZ1A 4HJ9A 3I4OA 3JAML 3J81L 2DNCA 5LL6X 4IN3A 5EGTA 2KEDA 4TRDA 1VQ4A 3K80C 4A3CH 3GP7A 4I7ZC 3HOVG 3M4OH 1SNPA 3H0GB 4YHHL 2E2JH 3I4MG 4X3SA 2AQ1B 4FXDA 1II3A 4BXXG 4JI8Q 3GTKH 1PDQA 1TWGB 5IGCA 1A8VA 1B8AA 2DJFC 2KOLA 1I6HB 2XVSA 4JK1C 4KY7A 3NBHA 5G3LF 3PO3B 2GVBA 1IL2A 1QCBD 3MXPA 4KV6A 3I8ZA 5IODA 3OIQA 3PSIA 1L0XB 3FPPA 3I90A 3R2IA 4LFAQ 3CQZH 1SNQA 1IZ6A 1JICA 3HS0C 1JWSD 1LV9A 2VQEQ 2K5HA 2V4DA 3S1RB 2KJXA 5M3MB 2VXWA 5FO7B 5DM73 1NNXA 4GKJQ 4C3JH 4G7OC 4NXML 1VQ9A 3S17B 2JK8A 5JEAJ 4KHVA 3H15A 1F77A 3M3YB 5DEHA 1ZEQX 4R4OA 2NYZD 3X3MA 3PIPA 4DAYA 4IZ8A 1WTOA 2WKDA 4X3KA 4A3IG 2B63G 1PTOC 3DMUA 5M5WB 4K5WA 4CJ2C 1Y1WB 1KRTA 2HHHL 4N9TA 1IBMQ 2WB1G 4R4TA 1GD7A 4B3TL 3K5OA 1Q90A 4DR1L 4C1NI 2L55A 1UNSA 3HOUB 4MN3A 4DR7Q 2ZTDA 4DV6Q 2EYFA 4ME3A 5A2QE 1KDCA 3D4DA 2EOTA 4HIDA 1D5ZC 3OOCA 2KHJA 1SDFA 4A3BG 1YHAA 4X3UA 2IX3A 2N8NA 3K5MA 4FXKC 1EFID 3T1YL 4A3JB 3GTGH 1GUOA 3Q8DA 2B8GA 4PZ8A 1QE6A 3K7AB 5IGEA 4X66L 5IYBH 1VQBA 4ILWA 3BDOA 2RHQB 4DV7Q 1PZID 4IUVA 1IYJB 5CYUA 3ULJA 2K1BA 2UUBL 4OX9Q 3SK5A 1YNJC 2A5HA 2KA7A 1YEZA 5IOCA 3ERSX 4JYAL 4DUYQ 1EY9A 2OTJA 1F2MA 1LO5D 2E5LQ 5C3WA 3DEPA 2NVYH 3HP3A 1M8AA 5L37A 5IGFA 1W2BA 2I5LX 4DUZQ 1F9QA 3DEOA 2JP1A 2Q2UA 2RCNA 5EPLA 4G7ZC 2WINB 2KCCA 1DCZA 1PRTC 1VQIA 3C2PA 4AQYQ 4JI6L 3LWUA 1WTXA 1D1KA 1MSGA 4LK1C 4A3EG 4A3KG 2R93H 4RGOS 3ND8A 3QO2A 2Z6KC 4CKCA 4DV4L 2L15A 3Q24A 1PZJD 2R7ZG 1MJCA 5CBEE 1OO9B 5LMNQ 4LWCA 5C0XH 1Q8IA 3X3NA 1XNQL 1PH4A 1I4HA 3H0GH 4HN7A 2PO4A 1DOKA 1NAPA 4IJLA 4LFBQ 5KNDA 1HNZL 4K6LA 3HOVH 3I7FA 3GTQB 1C8CA 1TWGH 1HUMA 2AMCB 1PFSA 4BXXH 4GKKQ 4H13C 2X6LA 3PUZA 4P71A 3M7GA 4BY1B 4QL5A 4X3TA 1KIXA 4APVA 1RDPD 3V05A 2K5QA 3KLSA 3EJIA 4LAAA 4PMWA 3SGIA 1JR0D 2UXDQ 4ALPA 2OTLA 1HCZA 4IJHA 3I2ZA 4LF6L 3S9WA 1VMPA 3QOJA 4EQOA 1RJTA 4A3DB 4DNTB 3TP7A 3SK6A 3CC2A 2F0UA 3NSWA 4WJ3M 3NK9A 4NB3A 1HJPA 3CCEA 1NE3A 1OXXK 4QQBX 1YHQA 1TY0A 3WOEA 1VQOA 1VQDA 2CQOA 5I2YA 3NTIA 4S3SA 1EY5A 2Z6BA 3H3VI 1NR4A 4JPBW 1G51A 2KQ3A 3UE1A 1TVXA 1GVPA 4B08A 1DJRD 2N3SA 3S17H 2XSCA 4AYBG 3WOFA 5FLXL 1CTMA 2F0HA 4C3IG 3G6EA 5C4HA 4B9XA 5C3XA 4BBSG 3NWTA 1KD1C 3ZYYX 2QA4A 4A3FB 1DGSA 2A69D 3MFGA 2PI2A 2BDOA 5CBAE 2EVBA 5M5WH 2L9HA 1BCPB 2DY8A 3TN2A 4NXNL 2PNHA 5BR8Q 1X32A 2ZT9C 2RDGA 1LABA 2ZJPA 2Z0SA 4ZCKA 4JBKA 1SYFA 3SK8A 4LF9Q 4GN3B 1R4PB 1TS5A 2JA9A 2F52A 1ENCA 2B29A 3HOUH 4JI1Q 3AFQA 2JA8B 3VR6A 2YTYA 1IBLQ 2FFKB 1SE4A 1L2FA 2WKCA 4A3GG 4JI2L 1PVOA 1K8MA 1AP0A 4QUFA 4UHVA 2HQEA 4JI5L 1UE1A 5DLQE 1LTGD 2SNSA 3J80i 2KBNA 4WORA 1G91A 4RMFA 1Q1EA 3NTHA 1MJEA 2BH8A 4NKLA 1ET9A 1KTKA 2F0GA 4QIWB 1EQVA 4BBRB 3CC4A 4QCLA 1TY2A 4JI4L 2B39A 3QJYA 1LYLA 2WB1E 2EY1A 4X65Q 4ZYSA 1I94L 1A15A 1X3QA 4JI3Q 4R9WA 1STHA 4JI0L 3CF5A 4GOPB 4DV5L 5BN3A 2R3ZA 1QUQA 1IW7C 4HJ8A 4LF5Q 3A7LA 4DR2Q 3VDYA 3OTOL 3MFYA 4FF4A 2QF7A 2UUCL 1X3GA 2K5WA 3NBIA 5C4XB 1HTLD 4DK1A 1CZGA 1MSHA 2VY3A 1WVLA 3BVZA 2YU9H 1YNNC 1FNUA 1FNWA 5ELNA 3S2DB 2EXZA 2RDHA 1HHVA 4LF4Q 4JV5Q 2QEXA 4EX5A 3PUWA 4CKEA 4A3KH 3V96A 5GROA 2KCMA 1U5KA 5HGTA 1I4PA 1K9MC 2R7ZH 1JCKB 4MNOA 4K8IA 4H0LC 3P20A 1HA5A 1GUTA 1LTRD 4IFDI 3V2TA 1PTOB 2B2VA 4K5XA 4B3RQ 2B2UC 2OQKA 4DR4Q 2H1EA 3RD4A 4PNYA 4BY1H 5C4JB 2SDFA 2VUMG 3MTSA 1CUKA 3UI2A 2D5DA 2LKVA 3W3AA 3A8IE 1G8ZD 4XTCS 4LW1A 2F0JA 2E2JB 1RTOA 4HEDA 5EAYA 1LTID 3CD6A 3KLWA 3GTKB 2ZXRA 1YJNA 1B1ZA 1F9PA 2ZM6L 1PTOF 1SMYC 3CPWA 4A3DH 3ND9A 1CKMA 4ZUIA 3FVQA 3H6MA 1V8QA 4XT1B 1AN8A 3DWQA 1U4PA 1HNXQ 3NQTA 2XNAC 1L1OB 1VCIA 2KVMA 1TU2B 4RKLA 4EGVA 1KC8C 5EPKA 4FYDA 3O13A 3CQZB 5KYIA 1WD0A 2CFMA 4DV0Q 3F2UA 1CHPD 3PIP3 2ID0A 4PZ7A 2JE6I 5G3LD 1AH9A 1WOCA 2F0LA 3EBEA 4IUNA 2ICIA 1VQPA 1G2TA 1PLFA 2K4KA 4HR7B 5CORA 2JN4A 1UE5A 3LX0A 1Y14B 3DWAA 4C3JB 2EYPA 5LMNW 3A54A 3DLLA 3VYSA 5C3EH 2MJ8A 1E3PA 2QEJC 3J80L 1Y1VG 2ENBA 3AMUA 1A2TA 2RA4A 2JA7B 2JA8H 1GUSA 1TT2A 2VL6A 1DOMA 2B2TC 3UDGA 2WP8J 3S2HB 1VQ7A 4KHPQ 1FD7D 3I4LA 1XNRL 3CC7A 1PH7A 1JB7A 3RN2A 5T1IA 2J4XA 4AYBE 2B2WC 3CAMA 2NN6G 4UP9A 3R3OA 4R8NA 3L2PA 1Q3LA 1KDAA 4IQZA 5C44G 2H4OA 1PRTF 3PIOA 1PHJA 4GZYC 5JVH3 2G5DA 1K0SA 2ATWA 2IX1A 2I5MX 3B6YA 5FJ8G 3HOWB 2RQXA 3TREA 3HOZG 2JA6G 4J6HA 2D2CC 4EVOA 5AJ3Q 1P8LA 1FJGL 3NELA 4B3MQ 3IFDA 3DHQA 3SDZA 1N36Q 1TWCH 2UXCL 4ZRZA 2I46A 1YJ9A 4GOPA 3GTGB 1EUJA 1FVIA 2BE5D 4Z9CB 1KHIA 2C5CA 3SR1A 4JI7Q 1CA6A 4OO1H 3RZDH 2EYHA 1UWVA 3C1EA 4X64L 1N34Q 1QB5D 3T53B 1GHJA 4OWWB 2EY6A 5JOBA 1N32Q 2XRSD 4ZK9B 4L8JA 2AWNA 2F0IA 1NBWA 5K36G 2BOSA 2YYZA 1H9SA 3FEWX 1F2LA 1B4OA 2NVYB 3CCUA 1YNXA 4KY6A 4JBJA 2AWOA 4YY3L 2YV5A 1AE3A 2MGSA 5KNBA 2GVAA 4K6DA 3KF6B 1BOSA 1LT4D 2NZHA 3FKIG 3W5OA 4PV1C 5LL6S 4UDUC 1ET6A 4Q0FA 1IKMA 3N6RA 2LXKA 3GDEA 1PTOH 1Q81C 4DR5Q 5M3FG 3MEHA 1GUGA 4FP5D 4AH6A 5LMUL 3K8AA 3MEFA 3DXJC 5CV6A 2HDLA 2NTSA 5I9OA 5C4JH 4H02A 2D62A 2VUMH 2JEAI 1I50H 3HKZG 2A6ED 3EIVA 1ZXTA 4HTHA 1XTDA 2XWJB 1JE5A 3S1NH 1XMQQ 3HOVB 1SNCA 3I4MB 3S1MB 3GQBA 4A4IA 4LFCL 2M9VA 2F0TA 1E0BA 4JOIA 1LT3D 4LF8L 2F0OA 3A8JE 4ULLA 1TS3A 3MXNB 1HH2P 1VQ6A 1F2YA 3VA5A 3STBD 5GAHC 1QJOA 5ELDA 3K0YA 1L1OA 2L12A 4GN5A 1PXUA 4WJWA 1QVFA 1PV4A 1FR3A 3E9IA 1LTSD 3UDFA 1RD9D 1X3EA 2PPBC 3D4RA 3W2DA 3KJOA 3NWSA 4V0BA 1LUZA 1JE4A 1SXTA 4IUTA 5EBDA 3RUZA 2WV6D 3CCSA 2UUAL 1TKWB 1QZHA 2EDGA 3E0EA 5AFWA 4F7XA 2PYKA 4IUPA 4X62L 3PQIA 2PZWA 1IXRA 5HY6A 2EJMA 1IBKQ 3NP8A 4YCWA 5TSSA 1HNWQ 4HCEA 5D3IB 1WCMG 3IL8A 5KNCA 2NBFA 1YI2A 2JA5G 4C3HG 5FOBB 1QNKA 2J0TD 3KDFA 4TVAB 1X56A 3I70A 3U4ZA 3GV3A 2JA7H 1Y1VH 3D8GA 1TXYA 3WWVA 3I3CA 2I0QA 1BUVT 2C35B 4A3IB 2UXBQ 2IHEA 4ZAIA 4OWXB 3S2HH 2QCPX 3NTKA 2B63B 1EIGA 2ZJRA 5J22A 2SNMA 1ILQA 2WB1B 3CRLC 1HNZQ 3RNUA 3EA6A 2PMZB 4KD3A 1AZQA 3ERQA 4LF7L 2F0VA 4HIKA 3T1HL 4XT3B 4H7BA 5CGKA 4BY7G 3CCJA 5LHY1 4KHZA 1GJXA 2A74C 2NN6H 4GNXB 1Z7TA 3JAME 3J81E 1VQMA 1B9NA 2R61A 1HR0W 1C9OA 3QWNA 3HOWH 3EFXD 3KLSX 3A55A 4DV2L 2WACA 2IWHA 5FJ8H 1OXSC 3OW7A 1N33Q 2K5VA 2NVXH 3HOZH 1OXTA 3RLNA 4OIKA 1C7YA 4Q5VA 4A3BB 2JEBI 5IYCG 1JMCA 3E5SA 1VQ8A 1HUNA 4V190 4KKSA 1NSNS 1MHWC 1HZCA 1J8IA 5JJZA 2LSSA 4C56C 3BVMA 4RCNA 4KN7C 3TZUA 4ZKCB 1HFNA 1NCVA 3HRZC 5JVG3 1BCPD 4JI8L 4IOAA 2N55A 3VR5A 3QB3A 4Y7NB 5C0XI 1CQFA 1O7LA 1U4LA 3BDCA 1FGUA 4FO2A 1EFWA 3J7ZC 2X6GA 4RHSA 3ICEA 5CV8A 2PQAB 1JORA 2QDLA 4DV1Q 4HSPA 2HDMA 1S5DD 5FO9B 5K36H 4MTNA 4K8JA 4FXGC 4DR6Q 4I7AA 4DFAA 3ZJYC 3I4NG 3KF6A 2CWPA 1HZ9A 4FVMA 4J15A 4LFAL 1XX8A 5EKLA 1CA5A 2O5JC 2YU9B 2SEBD 1HZBA 5CV9A 2ZXOA 3OIPA 3F8TA 1Q46A 3OPOA 3CHBD 5EQ0A 3SK4A 2VQEL 2E2IB 4A3EB 2H5XA 4A3KB 5M3FH 1E1OA 4DU9A 4GKJL 2R7ZB 4JVZA 3RZOH 2WAQG 2PW5A 2EE1A 4B3SQ 4RHRA 2MO1A 2XGTA 5DM63 3I4MH 3S1MH 1DONA 3VYUA 1RODA 2EPBA 3GTOB 1QILA 1HA6A 1STGA 4ODGA 1EQQA 1A63A 1JOOA 3MXNA 3MWYW 1CQVA 1MD2D 4ZUJA 5D14A 1EU3A 4PMBA 1SE2A 5A35A 1A3UA 2RCFA 3KBXA 1SE8A 4O1NA 1IYVA 2MHVA 2AHOB 1Y8OB 5IP7G 2XWBB 4GS3A 1PH1A 1SMXA 1PH5A 5ELFA 1VQFA 2RBMA 4DV6L 1ASZA 2KUMA 4IPGA 2KCNA 2VW9A 2CH4A 1SYBA 2HQLA 2MFIA 1MKHA 3U4VA 3J7AV 5HGQA 4POFA 3HKZE 4N8FA 2MQHA 2TMPA 1O7ZA 3RR5A 1WTPA 2CWAA 3OMGA 4MTKA 1I4GA 4XYOA 5E4XA 3I56A 5ELCA 2JXMB 3D6CA 5CC4A 2AUKA 4A93G 4XQJA 1PTOD 1GUNA 4XQNA 2UU9Q 3HOYG 2A8VA 2F4VQ 3AB9A 4M1UB 1NMGA 4AYBB 2IJ0A 3AEVA 4IFDG 1UAPA 1SYEA 2EJGC 2PW7A 4C3IB 4DV7L 1EQRA 3GTLB 1STNA 4PMCA 5GAGC 2EY5A 4OX9L 1CSQA 2TSSA 4OEMB 4U673 1RTNA 4A3IH 1QVGA 1PH2A 4BBSB 3BU2A 5C3EB 1XPRA 2B63H 2CW0D 1B50A 1C48A 5IWAQ 1J5EQ 4PQXA 2E5LL 1GOZA 3NHHA 4DK6C 3ITPA 1VQNA 1A3TA 3PIO3 3SE0A 4FF1A 1FNVA 1ENAA 5T1GA 4BS9A 4GNXA 1VS0A 4DUZL 2P5ZX 3DM3A 3G48A 4BY7H 1SE3A 2OF1A 4QB4A 2B2UA 5I6YA 1X55A 3I73A 3HFZB 3GTMB 1XTCD 4AQYL 1W6JA 1M4VA 3BG3A 1F2ZA 3TS0A 3DWPA 4OONA 3UDIA 1EY4A 1XMOQ 1QG7A 2ASBA 3CW2C 1JJCB 4A3BH 2R92G 1UEAB 1Q82C 1E2ZA 4NP5A 2EYMA 1G6PA 2B2YA 5I4DA 5E4WC 1V1OA 2EYJA 4BA1I 3OHXC 4TQUS 1IHZA 3D0FA 4LFBL 4L5TA 4XYQA 3E6ZX 4LUOA 2O4XA 4WRDA 4Y7NH 4A75A 2K7VA 3A74A 2AUJD 1SAPA 3SVMA 1Y8PB 3P75A 1PA6A 2K05A 2F03A 4GKKL 4QF4A 3GO5A 2PQAA 1TWCB 2LFNA 3CMEA 1XPOA 1KQSA 3PV0A 1VDZA 2FMCA 2D0PA 2KENA 1B2TA 2K6AA 2UXDL 5D65A 4DV3Q 2VS1A 1DYQA 5IY0A 5I9PA 4R8IA 3RZDB 1YIJA 3CXCA 3PUXA 2L4NA 2GA4B 4L5SA 1H9JA 4DPGA 1VQCA 1YBYA 3I4NH 4XQQA 4C1NK 4DR3Q 1N8RC 1VQGA 1EY6A 1ESFA 1EY8A 1SJED 4HIOA 3EQLC 5FLXE 1A2UA 4IPCA 4R4QA
chains in the Genus database with same CATH topology
1GKHA 2OCEA 4BY1G 4GKJQ 3CCVA 1Q12A 4IPHA 4C3JH 5IT9c 1I94Q 1U0LA 4PZ6A 3CCRA 4NXML 4HIMA 2I5MX 3B6YA 1VQ9A 5FJ8G 3TRZA 1I6HH 5IYDG 1W3SA 2E2IH 3TREA 1ASYA 2JK8A 4A3EH 2Y0SG 1OTCA 2JA6G 3HOZG 4DR7L 4P74A 5AJ3Q 5JEAJ 1YITA 1P8LA 3GD7A 4JI0Q 3S24A 1FJGL 3AQQA 1BBWA 3A0JA 3NELA 3H15A 4DV5Q 4B3MQ 2B3GA 4R4OA 1BKBA 2R7DA 3PO3H 3CPFA 3PIPA 1N36Q 4MZ9A 4R4CA 1TWCH 4DNIA 4QGUA 4A3IG 1RL2A 2UXCL 3OTOQ 1YJ9A 1AE2A 4GOPA 1H95A 3OYYA 1N33L 4A3DG 2UUCQ 2DUDA 1BBUA 1EUJA 2CKZB 1NJIC 1FVIA 5GADC 2B63G 2HHHL 1KRTA 1NTGA 3GTOH 4P73A 2WB1G 1IBMQ 1KHIA 4R4TA 4YCVA 1GD7A 4JI7Q 1FL0A 1Z9FA 4B3TL 2HIXA 1VQ5A 1VQLA 3PF5A 3K7UC 3RZDH 3JC66 4DR1L 3KOJA 1UWVA 2HIVA 4X64L 3A5UA 3HKSA 1N34Q 3I55A 1GO3E 1WCMH 4A3LG 5BR8L 4OWWB 2OQ0A 1N32Q 2BA0A 3RLOA 3S1RH 2JA5H 2VZAA 4C3HH 5J3BA 5JJKA 2AWNA 4O0AA 5M3MH 1NBWA 2ZTDA 4DV6Q 4DR7Q 5K36G 2YYZA 4ME3A 1WYDA 1K0RA 4LF9L 4RG1A 4K0KQ 3CCUA 1YNXA 3CCMA 4HIDA 4JBJA 2AWOA 4YY3L 3HOXG 4DUYL 4A3CG 2YV5A 1AE3A 2KHJA 4DV1L 2GVAA 1HR0Q 5IP7H 4A3BG 2EQSA 1YHAA 3KF6B 3M3YH 3S14H 1YHBA 4A3FG 4FDBA 2NZHA 2N8NA 3GTPH 3FKIG 1KAWA 3W5OA 4DR6L 1MIUA 2WAQE 3T1YL 3KF8B 3PGZA 3J7A5 1P16A 3GTGH 2LXKA 3GDEA 3Q8DA 4PZ8A 5C3EG 1XPUA 1Q81C 1SROA 4QJFA 1Y1WH 4DR5Q 2IX0A 1X3FA 4X66L 5IYBH 5LMUL 4AH6A 5M3FG 1VQBA 3K8AA 3MEFA 3CMAA 4JG2A 1M1KC 2RHQB 4DV7Q 1SFOH 5C4JH 5JEAG 1IYJB 4H02A 3ULJA 4A3MG 2UUBL 4OX9Q 4OWTB 2F3IA 2D62A 2ES2A 2JA8G 3ER0A 3J81i 2JEAI 1I50H 3HKZG 2VUMH 3GTJH 3EIVA 4AIMA 1OXVA 1XTDA 1YEZA 2R7FA 4C3IH 1RIPA 2ZM6Q 4YWLA 1JE5A 3ERSX 3G71A 5LMNL 1XMQQ 3GTLH 4DUYQ 2XTIA 3S1NH 2ALYB 4JYAL 2OTJA 3H3VH 1VQHA 4DAMA 5IYCH 2E5LQ 5FLMG 4A4IA 4LFCL 4P72A 4JI3L 4JBMA 4BBSH 2YTVA 1CKNB 2NVYH 4JOIA 4LF8L 2VQFL 2E2HH 3M85A 1W2BA 3NEMA 4B3SL 1LTLA 2I5LX 4DUZQ 2HT1A 3MXNB 1HH2P 1VQ6A 3STBD 5GAHC 3CCLA 4LF5L 4DR2L 3M7NA 2Q2UA 2RCNA 1WFQA 1VQIA 1L1OA 4AQYQ 3PUVA 4GN5A 2N78A 1EYGA 4A3JH 4BBRG 4JI6L 2JQOA 2IT1A 2PI2E 2NZOA 4A3EG 1QVFA 4A3KG 1PV4A 2R93H 2KHIA 3E9IA 3K7AH 2Z6KC 1K8AC 3GTMH 4DV4L 4YHHQ 2L15A 3UDFA 3F2BA 2R7ZG 2ZJQA 1MJCA 1X3EA 2PMZE 5LMNQ 4A3GH 4LWCA 3KJOA 4OO1I 3PO2G 1LUZA 1SLJA 4LF4L 4JV5L 4LFCQ 1X65A 1XNQL 2K5NA 3CCSA 1PH4A 2UUAL 3H0GH 1QZHA 2VQFQ 1B70B 3E0EA 4IJLA 4LFBQ 1HNZL 1UEBA 3HOVH 3I7FA 1K8GA 4X62L 2R92H 3KFUA 1IXRA 1TWGH 1E24A 1YJWA 2AMCB 5HY6A 3U50C 1PFSA 1Z47A 4BXXH 1IBKQ 3E9HA 1Q7YC 1PHJA 4OO1G 4YCWA 4GKKQ 2DGYA 3PUZA 4P71A 2OWOA 5C4XG 2D0OA 1HNWQ 4QL5A 1WCMG 3JAMc 1KIXA 4GLVB 4APVA 3J81c 4LUZA 1YI2A 4B3RL 2JA5G 2Q2IA 4DR4L 4PMWA 3SGIA 3IRBA 3KDFA 4TVAB 4XIGS 1X56A 1EIFA 4R1JA 1PH9A 4ALPA 2I5HA 4IJHA 2OTLA 3U4ZA 1K3RA 2UU9L 1G291 5GQOA 2JA7H 1XNRQ 1Y1VH 2F4VL 3I2ZA 1TXYA 3WWVA 4LF6L 2I0QA 1X9NA 2C35B 1VQEA 2UXBQ 2IHEA 2KCTA 4OWXB 3S2HH 2AKWB 3BZCA 5C0XJ 1WJJA 2ZJRA 3CC2A 2N49A 1X6OA 2A19A 3L7ZC 3F2CA 1HNZQ 3RNUA 2K52A 4WJ3M 4X6AH 1PYSB 4NB3A 1HJPA 4HIKA 4LF7L 3CCEA 3J80c 2EIFA 1NE3A 2GN5A 1OXXK 3T1HL 4QQBX 1YHQA 5IP9G 4BY7G 3CCJA 4NXMQ 1VQOA 1VQDA 2CQOA 1XJVA 4KHZA 2BH2A 4GNXB 4GNXC 1V9PA 5IWAL 1J5EL 2K50A 3GTQH 4UPAA 3H3VI 1G51A 1FJGQ 3UE0A 2EXDA 3UE1A 5M5XH 1VQMA 4YCUA 1GVPA 1HR0W 1HNXL 1C9OA 3M9BA 3HOWH 2N3SA 4JI1L 3S17H 4AYBG 3W1GA 1V1QA 1IBLL 4DV2L 2UXCQ 3G6EA 1YVCA 5FJ8H 1OXSC 3FHWA 1EIYB 1N33Q 3TS2A 3F2DA 2K5VA 2NVXH 1CKOA 1OXTA 2E8GA 3HOZH 3RLNA 2HHHQ 1C7YA 2JEBI 5IYCG 1JMCA 1VQ8A 4NPSA 4BBSG 1KD1C 1UE7A 2QA4A 4B3TQ 1DGSA 4LNQA 1HZCA 2PI2A 2LSSA 4DR1Q 1XMOL 5M5WH 1EOVA 4POGA 4X64Q 2IHFA 2LXJA 4NXNL 5GAEC 1I3QH 2PNHA 5BR8Q 3F1ZA 2BA1A 2CCZA 4JI8L 2ZJPA 4IOAA 1K73C 1JJGA 4A93H 4KLKA 1Q86C 1K83H 1E1TA 3NBHB 4JBWA 2Z0SA 3JAMi 1SN8A 5C0XI 1FGUA 3W1BA 1EFWA 4JBKA 3HOYH 4LF9Q 3J7ZC 4GN3B 2JA9A 2V1CC 2F52A 3ICEA 2B29A 4X65L 3HOUH 4JI1Q 3AFQA 2PQAB 4YY3Q 2R93G 4A3LH 3M4PA 2QGQA 2YTYA 1S3OA 4DV2Q 1NMFA 4DV1Q 1IBLQ 3S1QH 1KXLA 1BVSA 1L2FA 4MTNA 5C0XG 4JI2L 4A3GG 1PVOA 3A5ZB 3STBC 4DR6Q 3EN2A 4GN4B 3T1YQ 4UP8A 3RN5A 3H0GG 2Y0SE 3ZJYC 3KF6A 2CWPA 3K81C 4EQ5A 1NY4A 1O7IA 3I4NG 5IE8A 3HOXH 1HZ9A 4JI5L 4GLXA 4J15A 1UE1A 4DV3L 4LFAL 4KHPL 5DLQE 3J80i 4X66Q 5LMUQ 1VQJA 4DKAC 1HZBA 2KBNA 3TEHB 4A3FH 3J81j 2UXDQ 4RMFA 1Q1EA 3F8TA 1Q46A 2BH8A 1MJEA 1JT8A 2UUBQ 1Q1BA 2JJQA 1SR3A 5JJIA 3CC4A 2VQEL 4DR3L 4JI4L 1OXUA 1I5FA 1LYLA 2WB1E 2H5XA 4UP7A 4X65Q 2R6GA 3PO3G 1B7YB 4JYAQ 5M3FH 1EWIA 1A62A 1E1OA 4JC0A 4GKJL 1Q8KA 1I94L 1KL9A 1GM5A 2JA7G 3RZOH 2A1AA 3LGJA 4IFDJ 4JI3Q 1PH8A 2WAQG 1C0AA 3KDFB 4C2MH 4A3MH 4LF8Q 4IPDA 4DAYB 3KYHC 5AJ3L 3CCQA 3K0XA 2NN6I 4JI0L 4B3SQ 2MO1A 2XGTA 3CF5A 1KRSA 4DV5L 1WI5A 4GOPB 4GOPC 4B3ML 3I4MH 2NVTH 3S1MH 1QUQA 1CKNA 4HJ8A 4LF5Q 2RHSB 3TQYA 3L0OA 4L5QA 4DR2Q 1N36L 3NENA 1X54A 1EQQA 5FLMH 1A63A 2RF4A 3VDYA 3OTOL 1E22A 4R4IA 2UUCL 1X3GA 3RLFA 4JI6Q 4HJ7A 5M3MG 2VY3A 4JI7L 2YU9H 4DV4Q 5ELOA 1PH6A 2MO0A 2Q2TA 5ELNA 2K75A 1SE8A 3HOWG 2MNAA 4YWKA 1N34L 4Y52H 1A0IA 2AHOB 2WFWA 2Z6KA 4GLAC 4JCVE 4LF4Q 4BBRH 4JV5Q 2QEXA 1N32L 1XNQQ 5IP7G 4EX5A 3M4QA 3PUWA 4GS3A 1PH1A 1SMXA 1PH5A 1LM0A 2UUAQ 4A3KH 1VQFA 4DV6L 5GROA 3S16H 1ASZA 2KCMA 3PUYA 4IPGA 4X62Q 1U5KA 2VW9A 2HQLA 1K9MC 2R7ZH 1YZ6A 1MKHA 2MFIA 3U4VA 4K0KL 4MNOA 5HGQA 3KJPA 1V43A 4POFA 3PO2H 3HKZE 3RR5A 2MQHA 2ZTEA 1Y1WG 1UE6A 1HR0L 2CWAA 5IYBG 4IFDI 4P75A 3BJUA 4LUVA 3I56A 4B3RQ 5C44H 3U58A 2OQKA 4DR4Q 4A93G 4BY1H 1D7QA 1S40A 5JJLA 2VUMG 1QVCA 2UU9Q 1R9TH 1QZGA 2FXQA 1CUKA 2A8VA 2F4VQ 3HOYG 3PCOB 4LF6Q 1NMGA 5C4XH 4HJ5A 4DR5L 2JA6H 3AEVA 3HOUG 4IFDG 4O2DA 4XTCS 1VQAA 2NVQH 4LW1A 4OXPA 4DV7L 1EQRA 5EAYA 4DV0L 3ULLA 3CD6A 3KLWA 5GAGC 4OX9L 1TWAH 3S2DH 1YJNA 4QIWE 1CSQA 4LF7Q 4A3IH 3T1HQ 1QVGA 1PH2A 4QY7A 2ZM6L 3BU2A 4A3DH 4JOIC 3CPWA 1XPRA 2B63H 1XMQL 2VNUD 1JJ2A 1L0WA 1CKMA 5IWAQ 1J5EQ 2E5LL 2YTXA 1PYBA 3BZKA 4DK6C 4UY8C 1VQNA 4BA2I 4A3JG 5H1SE 1D8LA 4HJAA 1J6QA 1VS0A 3FP9A 4GNXA 1HNXQ 4DUZL 4IO9A 1L1OB 1L1OC 3DM3A 3G48A 4DK3C 1VCIA 5E7NA 5IP9H 4BY7H 3CP0A 1KC8C 1T9HA 1X55A 3HFZB 4PG3A 4AQYL 4A76A 3G4SA 2CFMA 3I4OA 4HJ9A 4DV0Q 3TS0A 2ZTCA 2ID0A 4OONA 3PF4A 3UDIA 2IX1A 5M5YH 4PZ7A 2JE6I 1VQ4A 1WOCA 4A3CH 3K80C 1AH9A 1XMOQ 2ASBA 3HOVG 3CW2C 3EBEA 3M4OH 4YHHL 2E2JH 1VQPA 1JJCB 3OW2A 2K4KA 4NXNQ 2R92G 1E7ZA 3I4MG 4A3BH 4WJ4A 1Q82C 4BXXG 2Q2HA 4JI8Q 3GTKH 1UE5A 1G6PA 3FKIH 3ULPA 1Y14B 5LMNW 1A8VA 1QUQB 1B8AA 4BA1I 3DLLA 4TQUS 2K14A 5C3EH 1E3PA 3D0FA 4L5TA 4LFBL 4LUOA 3D31A 3UDXA 1TWHH 5FLXc 4Y7NH 4A75A 3A74A 4YWMA 1PA6A 1IBKL 1Y1VG 4GKKL 2GVBA 1IL2A 3AYHB 1HNWL 3GO5A 4JI2Q 1PH3A 2PQAA 1HZAA 2JA8H 3CMEA 1XPOA 1KQSA 2VL6A 3PV0A 3PSIA 2D0PA 2KENA 3UDGA 3S15H 3AFPA 2UXDL 2WP8J 4JI5Q 4L5RC 4LFAQ 1CSPA 2VS1A 3CQZH 4DV3Q 1VQ7A 4KHPQ 1VQKA 1N9WA 1XNRL 3CC7A 1PH7A 1JB7A 5IY0A 3RN2A 1M90C 4AYBE 1YIJA 1IZ6A 3CXCA 3CAMA 3PUXA 1SRUA 2NN6G 2UXBL 1IBML 2IY5B 4UP9A 4L5SA 4DPGA 1VQCA 1YBYA 3I4NH 4KI0A 2VQEQ 4DR3Q 2K5HA 3L2PA 4IOCA 4JI4Q 1S72A 1N8RC 1VQGA 5C44G 2ATWA 5IYDH 1TWFH 4HIOA 3PIOA 4IPCA 4R4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GKH A;  2OCE A;  4BY1 G;  4GKJ Q;  3CCV A;  1Q12 A;  4IPH A;  4C3J H;  5IT9 c;  1I94 Q;  1U0L A;  4PZ6 A;  3CCR A;  4NXM L;  4HIM A;  2I5M X;  3B6Y A;  1VQ9 A;  5FJ8 G;  3TRZ A;  1I6H H;  5IYD G;  1W3S A;  2E2I H;  3TRE A;  1ASY A;  2JK8 A;  4A3E H;  2Y0S G;  1OTC A;  2JA6 G;  3HOZ G;  4DR7 L;  4P74 A;  5AJ3 Q;  5JEA J;  1YIT A;  1P8L A;  3GD7 A;  4JI0 Q;  3S24 A;  1FJG L;  3AQQ A;  1BBW A;  3A0J A;  3NEL A;  3H15 A;  4DV5 Q;  4B3M Q;  2B3G A;  4R4O A;  1BKB A;  2R7D A;  3PO3 H;  3CPF A;  3PIP A;  1N36 Q;  4MZ9 A;  4R4C A;  1TWC H;  4DNI A;  4QGU A;  4A3I G;  1RL2 A;  2UXC L;  3OTO Q;  1YJ9 A;  1AE2 A;  4GOP A;  1H95 A;  3OYY A;  1N33 L;  4A3D G;  2UUC Q;  2DUD A;  1BBU A;  1EUJ A;  2CKZ B;  1NJI C;  1FVI A;  5GAD C;  2B63 G;  2HHH L;  1KRT A;  1NTG A;  3GTO H;  4P73 A;  2WB1 G;  1IBM Q;  1KHI A;  4R4T A;  4YCV A;  1GD7 A;  4JI7 Q;  1FL0 A;  1Z9F A;  4B3T L;  2HIX A;  1VQ5 A;  1VQL A;  3PF5 A;  3K7U C;  3RZD H;  3JC6 6;  4DR1 L;  3KOJ A;  1UWV A;  2HIV A;  4X64 L;  3A5U A;  3HKS A;  1N34 Q;  3I55 A;  1GO3 E;  1WCM H;  4A3L G;  5BR8 L;  4OWW B;  2OQ0 A;  1N32 Q;  2BA0 A;  3RLO A;  3S1R H;  2JA5 H;  2VZA A;  4C3H H;  5J3B A;  5JJK A;  2AWN A;  4O0A A;  5M3M H;  1NBW A;  2ZTD A;  4DV6 Q;  4DR7 Q;  5K36 G;  2YYZ A;  4ME3 A;  1WYD A;  1K0R A;  4LF9 L;  4RG1 A;  4K0K Q;  3CCU A;  1YNX A;  3CCM A;  4HID A;  4JBJ A;  2AWO A;  4YY3 L;  3HOX G;  4DUY L;  4A3C G;  2YV5 A;  1AE3 A;  2KHJ A;  4DV1 L;  2GVA A;  1HR0 Q;  5IP7 H;  4A3B G;  2EQS A;  1YHA A;  3KF6 B;  3M3Y H;  3S14 H;  1YHB A;  4A3F G;  4FDB A;  2NZH A;  2N8N A;  3GTP H;  3FKI G;  1KAW A;  3W5O A;  4DR6 L;  1MIU A;  2WAQ E;  3T1Y L;  3KF8 B;  3PGZ A;  3J7A 5;  1P16 A;  3GTG H;  2LXK A;  3GDE A;  3Q8D A;  4PZ8 A;  5C3E G;  1XPU A;  1Q81 C;  1SRO A;  4QJF A;  1Y1W H;  4DR5 Q;  2IX0 A;  1X3F A;  4X66 L;  5IYB H;  5LMU L;  4AH6 A;  5M3F G;  1VQB A;  3K8A A;  3MEF A;  3CMA A;  4JG2 A;  1M1K C;  2RHQ B;  4DV7 Q;  1SFO H;  5C4J H;  5JEA G;  1IYJ B;  4H02 A;  3ULJ A;  4A3M G;  2UUB L;  4OX9 Q;  4OWT B;  2F3I A;  2D62 A;  2ES2 A;  2JA8 G;  3ER0 A;  3J81 i;  2JEA I;  1I50 H;  3HKZ G;  2VUM H;  3GTJ H;  3EIV A;  4AIM A;  1OXV A;  1XTD A;  1YEZ A;  2R7F A;  4C3I H;  1RIP A;  2ZM6 Q;  4YWL A;  1JE5 A;  3ERS X;  3G71 A;  5LMN L;  1XMQ Q;  3GTL H;  4DUY Q;  2XTI A;  3S1N H;  2ALY B;  4JYA L;  2OTJ A;  3H3V H;  1VQH A;  4DAM A;  5IYC H;  2E5L Q;  5FLM G;  4A4I A;  4LFC L;  4P72 A;  4JI3 L;  4JBM A;  4BBS H;  2YTV A;  1CKN B;  2NVY H;  4JOI A;  4LF8 L;  2VQF L;  2E2H H;  3M85 A;  1W2B A;  3NEM A;  4B3S L;  1LTL A;  2I5L X;  4DUZ Q;  2HT1 A;  3MXN B;  1HH2 P;  1VQ6 A;  3STB D;  5GAH C;  3CCL A;  4LF5 L;  4DR2 L;  3M7N A;  2Q2U A;  2RCN A;  1WFQ A;  1VQI A;  1L1O A;  4AQY Q;  3PUV A;  4GN5 A;  2N78 A;  1EYG A;  4A3J H;  4BBR G;  4JI6 L;  2JQO A;  2IT1 A;  2PI2 E;  2NZO A;  4A3E G;  1QVF A;  4A3K G;  1PV4 A;  2R93 H;  2KHI A;  3E9I A;  3K7A H;  2Z6K C;  1K8A C;  3GTM H;  4DV4 L;  4YHH Q;  2L15 A;  3UDF A;  3F2B A;  2R7Z G;  2ZJQ A;  1MJC A;  1X3E A;  2PMZ E;  5LMN Q;  4A3G H;  4LWC A;  3KJO A;  4OO1 I;  3PO2 G;  1LUZ A;  1SLJ A;  4LF4 L;  4JV5 L;  4LFC Q;  1X65 A;  1XNQ L;  2K5N A;  3CCS A;  1PH4 A;  2UUA L;  3H0G H;  1QZH A;  2VQF Q;  1B70 B;  3E0E A;  4IJL A;  4LFB Q;  1HNZ L;  1UEB A;  3HOV H;  3I7F A;  1K8G A;  4X62 L;  2R92 H;  3KFU A;  1IXR A;  1TWG H;  1E24 A;  1YJW A;  2AMC B;  5HY6 A;  3U50 C;  1PFS A;  1Z47 A;  4BXX H;  1IBK Q;  3E9H A;  1Q7Y C;  1PHJ A;  4OO1 G;  4YCW A;  4GKK Q;  2DGY A;  3PUZ A;  4P71 A;  2OWO A;  5C4X G;  2D0O A;  1HNW Q;  4QL5 A;  1WCM G;  3JAM c;  1KIX A;  4GLV B;  4APV A;  3J81 c;  4LUZ A;  1YI2 A;  4B3R L;  2JA5 G;  2Q2I A;  4DR4 L;  4PMW A;  3SGI A;  3IRB A;  3KDF A;  4TVA B;  4XIG S;  1X56 A;  1EIF A;  4R1J A;  1PH9 A;  4ALP A;  2I5H A;  4IJH A;  2OTL A;  3U4Z A;  1K3R A;  2UU9 L;  1G29 1;  5GQO A;  2JA7 H;  1XNR Q;  1Y1V H;  2F4V L;  3I2Z A;  1TXY A;  3WWV A;  4LF6 L;  2I0Q A;  1X9N A;  2C35 B;  1VQE A;  2UXB Q;  2IHE A;  2KCT A;  4OWX B;  3S2H H;  2AKW B;  3BZC A;  5C0X J;  1WJJ A;  2ZJR A;  3CC2 A;  2N49 A;  1X6O A;  2A19 A;  3L7Z C;  3F2C A;  1HNZ Q;  3RNU A;  2K52 A;  4WJ3 M;  4X6A H;  1PYS B;  4NB3 A;  1HJP A;  4HIK A;  4LF7 L;  3CCE A;  3J80 c;  2EIF A;  1NE3 A;  2GN5 A;  1OXX K;  3T1H L;  4QQB X;  1YHQ A;  5IP9 G;  4BY7 G;  3CCJ A;  4NXM Q;  1VQO A;  1VQD A;  2CQO A;  1XJV A;  4KHZ A;  2BH2 A;  4GNX B;  4GNX C;  1V9P A;  5IWA L;  1J5E L;  2K50 A;  3GTQ H;  4UPA A;  3H3V I;  1G51 A;  1FJG Q;  3UE0 A;  2EXD A;  3UE1 A;  5M5X H;  1VQM A;  4YCU A;  1GVP A;  1HR0 W;  1HNX L;  1C9O A;  3M9B A;  3HOW H;  2N3S A;  4JI1 L;  3S17 H;  4AYB G;  3W1G A;  1V1Q A;  1IBL L;  4DV2 L;  2UXC Q;  3G6E A;  1YVC A;  5FJ8 H;  1OXS C;  3FHW A;  1EIY B;  1N33 Q;  3TS2 A;  3F2D A;  2K5V A;  2NVX H;  1CKO A;  1OXT A;  2E8G A;  3HOZ H;  3RLN A;  2HHH Q;  1C7Y A;  2JEB I;  5IYC G;  1JMC A;  1VQ8 A;  4NPS A;  4BBS G;  1KD1 C;  1UE7 A;  2QA4 A;  4B3T Q;  1DGS A;  4LNQ A;  1HZC A;  2PI2 A;  2LSS A;  4DR1 Q;  1XMO L;  5M5W H;  1EOV A;  4POG A;  4X64 Q;  2IHF A;  2LXJ A;  4NXN L;  5GAE C;  1I3Q H;  2PNH A;  5BR8 Q;  3F1Z A;  2BA1 A;  2CCZ A;  4JI8 L;  2ZJP A;  4IOA A;  1K73 C;  1JJG A;  4A93 H;  4KLK A;  1Q86 C;  1K83 H;  1E1T A;  3NBH B;  4JBW A;  2Z0S A;  3JAM i;  1SN8 A;  5C0X I;  1FGU A;  3W1B A;  1EFW A;  4JBK A;  3HOY H;  4LF9 Q;  3J7Z C;  4GN3 B;  2JA9 A;  2V1C C;  2F52 A;  3ICE A;  2B29 A;  4X65 L;  3HOU H;  4JI1 Q;  3AFQ A;  2PQA B;  4YY3 Q;  2R93 G;  4A3L H;  3M4P A;  2QGQ A;  2YTY A;  1S3O A;  4DV2 Q;  1NMF A;  4DV1 Q;  1IBL Q;  3S1Q H;  1KXL A;  1BVS A;  1L2F A;  4MTN A;  5C0X G;  4JI2 L;  4A3G G;  1PVO A;  3A5Z B;  3STB C;  4DR6 Q;  3EN2 A;  4GN4 B;  3T1Y Q;  4UP8 A;  3RN5 A;  3H0G G;  2Y0S E;  3ZJY C;  3KF6 A;  2CWP A;  3K81 C;  4EQ5 A;  1NY4 A;  1O7I A;  3I4N G;  5IE8 A;  3HOX H;  1HZ9 A;  4JI5 L;  4GLX A;  4J15 A;  1UE1 A;  4DV3 L;  4LFA L;  4KHP L;  5DLQ E;  3J80 i;  4X66 Q;  5LMU Q;  1VQJ A;  4DKA C;  1HZB A;  2KBN A;  3TEH B;  4A3F H;  3J81 j;  2UXD Q;  4RMF A;  1Q1E A;  3F8T A;  1Q46 A;  2BH8 A;  1MJE A;  1JT8 A;  2UUB Q;  1Q1B A;  2JJQ A;  1SR3 A;  5JJI A;  3CC4 A;  2VQE L;  4DR3 L;  4JI4 L;  1OXU A;  1I5F A;  1LYL A;  2WB1 E;  2H5X A;  4UP7 A;  4X65 Q;  2R6G A;  3PO3 G;  1B7Y B;  4JYA Q;  5M3F H;  1EWI A;  1A62 A;  1E1O A;  4JC0 A;  4GKJ L;  1Q8K A;  1I94 L;  1KL9 A;  1GM5 A;  2JA7 G;  3RZO H;  2A1A A;  3LGJ A;  4IFD J;  4JI3 Q;  1PH8 A;  2WAQ G;  1C0A A;  3KDF B;  4C2M H;  4A3M H;  4LF8 Q;  4IPD A;  4DAY B;  3KYH C;  5AJ3 L;  3CCQ A;  3K0X A;  2NN6 I;  4JI0 L;  4B3S Q;  2MO1 A;  2XGT A;  3CF5 A;  1KRS A;  4DV5 L;  1WI5 A;  4GOP B;  4GOP C;  4B3M L;  3I4M H;  2NVT H;  3S1M H;  1QUQ A;  1CKN A;  4HJ8 A;  4LF5 Q;  2RHS B;  3TQY A;  3L0O A;  4L5Q A;  4DR2 Q;  1N36 L;  3NEN A;  1X54 A;  1EQQ A;  5FLM H;  1A63 A;  2RF4 A;  3VDY A;  3OTO L;  1E22 A;  4R4I A;  2UUC L;  1X3G A;  3RLF A;  4JI6 Q;  4HJ7 A;  5M3M G;  2VY3 A;  4JI7 L;  2YU9 H;  4DV4 Q;  5ELO A;  1PH6 A;  2MO0 A;  2Q2T A;  5ELN A;  2K75 A;  1SE8 A;  3HOW G;  2MNA A;  4YWK A;  1N34 L;  4Y52 H;  1A0I A;  2AHO B;  2WFW A;  2Z6K A;  4GLA C;  4JCV E;  4LF4 Q;  4BBR H;  4JV5 Q;  2QEX A;  1N32 L;  1XNQ Q;  5IP7 G;  4EX5 A;  3M4Q A;  3PUW A;  4GS3 A;  1PH1 A;  1SMX A;  1PH5 A;  1LM0 A;  2UUA Q;  4A3K H;  1VQF A;  4DV6 L;  5GRO A;  3S16 H;  1ASZ A;  2KCM A;  3PUY A;  4IPG A;  4X62 Q;  1U5K A;  2VW9 A;  2HQL A;  1K9M C;  2R7Z H;  1YZ6 A;  1MKH A;  2MFI A;  3U4V A;  4K0K L;  4MNO A;  5HGQ A;  3KJP A;  1V43 A;  4POF A;  3PO2 H;  3HKZ E;  3RR5 A;  2MQH A;  2ZTE A;  1Y1W G;  1UE6 A;  1HR0 L;  2CWA A;  5IYB G;  4IFD I;  4P75 A;  3BJU A;  4LUV A;  3I56 A;  4B3R Q;  5C44 H;  3U58 A;  2OQK A;  4DR4 Q;  4A93 G;  4BY1 H;  1D7Q A;  1S40 A;  5JJL A;  2VUM G;  1QVC A;  2UU9 Q;  1R9T H;  1QZG A;  2FXQ A;  1CUK A;  2A8V A;  2F4V Q;  3HOY G;  3PCO B;  4LF6 Q;  1NMG A;  5C4X H;  4HJ5 A;  4DR5 L;  2JA6 H;  3AEV A;  3HOU G;  4IFD G;  4O2D A;  4XTC S;  1VQA A;  2NVQ H;  4LW1 A;  4OXP A;  4DV7 L;  1EQR A;  5EAY A;  4DV0 L;  3ULL A;  3CD6 A;  3KLW A;  5GAG C;  4OX9 L;  1TWA H;  3S2D H;  1YJN A;  4QIW E;  1CSQ A;  4LF7 Q;  4A3I H;  3T1H Q;  1QVG A;  1PH2 A;  4QY7 A;  2ZM6 L;  3BU2 A;  4A3D H;  4JOI C;  3CPW A;  1XPR A;  2B63 H;  1XMQ L;  2VNU D;  1JJ2 A;  1L0W A;  1CKM A;  5IWA Q;  1J5E Q;  2E5L L;  2YTX A;  1PYB A;  3BZK A;  4DK6 C;  4UY8 C;  1VQN A;  4BA2 I;  4A3J G;  5H1S E;  1D8L A;  4HJA A;  1J6Q A;  1VS0 A;  3FP9 A;  4GNX A;  1HNX Q;  4DUZ L;  4IO9 A;  1L1O B;  1L1O C;  3DM3 A;  3G48 A;  4DK3 C;  1VCI A;  5E7N A;  5IP9 H;  4BY7 H;  3CP0 A;  1KC8 C;  1T9H A;  1X55 A;  3HFZ B;  4PG3 A;  4AQY L;  4A76 A;  3G4S A;  2CFM A;  3I4O A;  4HJ9 A;  4DV0 Q;  3TS0 A;  2ZTC A;  2ID0 A;  4OON A;  3PF4 A;  3UDI A;  2IX1 A;  5M5Y H;  4PZ7 A;  2JE6 I;  1VQ4 A;  1WOC A;  4A3C H;  3K80 C;  1AH9 A;  1XMO Q;  2ASB A;  3HOV G;  3CW2 C;  3EBE A;  3M4O H;  4YHH L;  2E2J H;  1VQP A;  1JJC B;  3OW2 A;  2K4K A;  4NXN Q;  2R92 G;  1E7Z A;  3I4M G;  4A3B H;  4WJ4 A;  1Q82 C;  4BXX G;  2Q2H A;  4JI8 Q;  3GTK H;  1UE5 A;  1G6P A;  3FKI H;  3ULP A;  1Y14 B;  5LMN W;  1A8V A;  1QUQ B;  1B8A A;  4BA1 I;  3DLL A;  4TQU S;  2K14 A;  5C3E H;  1E3P A;  3D0F A;  4L5T A;  4LFB L;  4LUO A;  3D31 A;  3UDX A;  1TWH H;  5FLX c;  4Y7N H;  4A75 A;  3A74 A;  4YWM A;  1PA6 A;  1IBK L;  1Y1V G;  4GKK L;  2GVB A;  1IL2 A;  3AYH B;  1HNW L;  3GO5 A;  4JI2 Q;  1PH3 A;  2PQA A;  1HZA A;  2JA8 H;  3CME A;  1XPO A;  1KQS A;  2VL6 A;  3PV0 A;  3PSI A;  2D0P A;  2KEN A;  3UDG A;  3S15 H;  3AFP A;  2UXD L;  2WP8 J;  4JI5 Q;  4L5R C;  4LFA Q;  1CSP A;  2VS1 A;  3CQZ H;  4DV3 Q;  1VQ7 A;  4KHP Q;  1VQK A;  1N9W A;  1XNR L;  3CC7 A;  1PH7 A;  1JB7 A;  5IY0 A;  3RN2 A;  1M90 C;  4AYB E;  1YIJ A;  1IZ6 A;  3CXC A;  3CAM A;  3PUX A;  1SRU A;  2NN6 G;  2UXB L;  1IBM L;  2IY5 B;  4UP9 A;  4L5S A;  4DPG A;  1VQC A;  1YBY A;  3I4N H;  4KI0 A;  2VQE Q;  4DR3 Q;  2K5H A;  3L2P A;  4IOC A;  4JI4 Q;  1S72 A;  1N8R C;  1VQG A;  5C44 G;  2ATW A;  5IYD H;  1TWF H;  4HIO A;  3PIO A;  4IPC A;  4R4Q A; 
#chains in the Genus database with same CATH topology
 2QIL A;  5FK9 C;  5M9O A;  3CCV A;  1Q12 A;  5IT9 c;  1H9R A;  1C4Q A;  4PZ6 A;  3TRZ A;  1EEI D;  5IYD G;  1W3S A;  2E2I H;  1ASY A;  4A3E H;  2Y0S G;  2KEC A;  4OEL B;  5BN4 A;  5IGB A;  3S24 A;  3AQQ A;  2R7D A;  1ZYR D;  2A68 D;  4J1M A;  4MZ9 A;  4R4C A;  1TS2 A;  4DNI A;  4QGU A;  1AW7 A;  1RL2 A;  1ESR A;  1SJH D;  1G6Z A;  1AE2 A;  2BE5 C;  3OYY A;  2DUD A;  2CKZ B;  3J7Y W;  1NJI C;  3GTO H;  1FL0 A;  3P7J A;  2HIX A;  1VQ5 A;  1BDO A;  3PF5 A;  1VQL A;  4CKB A;  3JC6 6;  1K83 B;  2HIV A;  3HKS A;  2VUM B;  4A3L G;  1I50 B;  1PYW D;  5BR8 L;  4XDX A;  2OQ0 A;  2BA0 A;  1SYC A;  3S1N B;  5J3B A;  2F4I A;  5JJK A;  4O0A A;  3MHB A;  2NUC A;  3H3V C;  1B3A A;  1WYD A;  5K5P A;  1K0R A;  4LF9 L;  4RG1 A;  4K0K Q;  3D4W A;  3NPP A;  4KMU C;  3HOX G;  4A3C G;  5NUC A;  1HR0 Q;  5IP7 H;  2F3V A;  1O80 A;  2E74 C;  3S14 H;  1YHB A;  1D5M C;  4FDB A;  1MGS A;  3IAY A;  2M2L A;  2FIN B;  1VF5 C;  1LT6 D;  1W6K A;  2WAQ E;  2BDN A;  4KY5 A;  2SOB A;  1JC7 A;  3M4Y A;  3J7A F;  5F2D A;  1X3F A;  3SXH A;  4JG2 A;  1M1K C;  1SFO H;  2EYL A;  4KKU A;  4A3M G;  1ML0 D;  2A6E C;  4ZQ3 A;  4OWT B;  2K33 A;  3Q6S A;  1MI2 A;  1V1P B;  2ES2 A;  3ER0 A;  3J81 i;  4AIM A;  1OXV A;  2R7F A;  4C3I H;  3T13 A;  1H9M A;  2RSN A;  3G71 A;  3GTL H;  2XTI A;  3VA7 A;  5I6W A;  4K2L A;  1BF4 A;  4P72 A;  4JI3 L;  4BBS H;  2FHT A;  3VYR A;  2YTV A;  1CKN B;  2VQF L;  1LTL A;  1ILP A;  2XRQ D;  1F9R A;  1L0Y B;  4LF5 L;  3Q0A A;  4DR2 L;  1PRT B;  1WFQ A;  1Y1V B;  2N78 A;  1EYG A;  3CKI B;  2F0K A;  2QKI C;  1LTA D;  2EYO A;  2F0Q A;  2NZO A;  1KDB A;  1HPC A;  5CV4 A;  2KHI A;  3GTM H;  1TQO A;  3R93 A;  4YHH Q;  4CDD C;  1E2V A;  3F2B A;  4H44 C;  3S16 B;  1U9R A;  4A3G H;  4OO1 I;  3PO2 G;  1SLJ A;  4LF4 L;  4JV5 L;  4LFC Q;  1X65 A;  4OIJ A;  1EOT A;  1UEB A;  1VF7 A;  1O7Y A;  2R92 H;  5C44 B;  1RCV D;  1Z47 A;  1BO0 A;  2OWO A;  3MA2 B;  4F88 A;  2D0O A;  4K14 A;  4WFN 3;  3JAM c;  3I91 A;  3J81 c;  5E3F A;  4LUZ A;  4RGN A;  4B3R L;  1D6E C;  3HOZ B;  2NVX B;  2JA6 B;  2Q2I A;  3QOL A;  4DR4 L;  3IRB A;  4XIG S;  5FO8 B;  1IL8 A;  2I5H A;  1SNO A;  2K28 A;  3K5N A;  1K3R A;  3R2T A;  1G29 1;  3TP8 A;  1YNN D;  1X9N A;  1IKL A;  2K32 A;  2AKW B;  4TSS A;  1IYU A;  3G7L A;  4NMZ A;  2N49 A;  4RKB A;  3L7Z C;  3F2C A;  1J9O A;  1JB3 A;  1LAC A;  4X6A H;  4DXG A;  2EIF A;  2GN5 A;  1WD1 A;  5IT9 E;  5IP9 G;  4NXM Q;  1QOH A;  2BH2 A;  1V9P A;  4UPA A;  3UE0 A;  5M5X H;  4YCU A;  1UUP A;  3K5L A;  1HNX L;  2IW3 A;  1WTR A;  3W1G A;  2Z4I A;  4ID6 A;  2DN8 A;  1YVC A;  3FHW A;  5IYD H;  4FF3 A;  1K28 A;  2E8G A;  1CHQ D;  5ELB A;  2HHH Q;  1K8O A;  3VR3 A;  3GV6 A;  4B3T Q;  1EY0 A;  1XWE A;  2VB3 X;  3CU7 A;  3FKI B;  1GHK A;  4LNQ A;  5C6A A;  4DR1 Q;  5IGG A;  4POG A;  1BCP C;  5GAE C;  1I3Q H;  4LJZ C;  4KKT A;  3F1Z A;  5COY A;  1S4Z A;  2IPK D;  4OGQ C;  1ICW A;  4F87 A;  5M3F B;  1HRJ A;  1SMY D;  1JJG A;  1RKN A;  4J8Q A;  1K83 H;  3RZO B;  4JBW A;  2Z9H A;  1D2B A;  2V1C C;  3EVQ A;  1B53 A;  3FDT A;  1WTQ A;  2R93 G;  3T56 B;  1X3P A;  1F9S A;  4A3L H;  3HKZ B;  1JQY D;  4DV2 Q;  1NMF A;  1SND A;  3S1Q H;  3VR4 A;  4K2K A;  1HTP A;  3S15 B;  1BVS A;  1EQT A;  5C0X G;  3A5Z B;  3EN2 A;  5KEE A;  1AFP A;  1CK1 A;  1KAA A;  3T1Y Q;  4UP8 A;  3RN5 A;  3H0G G;  2Y0S E;  2M00 A;  3K81 C;  1NY4 A;  5IE8 A;  3HOX H;  5A2Q L;  5IGD A;  4KHP L;  4X66 Q;  1PFM A;  3T16 A;  4FNF A;  3L9A X;  3J81 j;  1TWF B;  1U4R A;  5FKA C;  1JT8 A;  1R4Q B;  2UUB Q;  4KJO A;  1Q1B A;  2DJG C;  1OXU A;  1I5F A;  5E1F A;  4UP7 A;  2R6G A;  3PO3 G;  4JYA Q;  1A62 A;  3CRK C;  1V1P A;  2QW7 A;  1KL9 A;  1GM5 A;  2LY7 A;  4IFD J;  1LTB D;  3H09 A;  4C2M H;  4KD4 A;  4A3M H;  5HUR A;  4IPD A;  5AJ3 L;  2NN6 I;  1KRS A;  4GOP C;  1WI5 A;  4B3M L;  5CV5 A;  3HEJ A;  2Z8L A;  1CKN A;  1EY7 A;  1N36 L;  4L5Q A;  3NEN A;  3A56 A;  2RF4 A;  3T4A C;  1T5E A;  1EYD A;  5CV7 A;  1E22 A;  4R4I A;  4RA8 A;  1O78 A;  5JPN C;  4JI6 Q;  3C3L A;  4HJ7 A;  2D9U A;  4DNR B;  1WCM B;  3KK7 A;  5M3M G;  1VMC A;  4JI7 L;  3HG9 A;  1TS4 A;  4DV4 Q;  3T51 B;  2JA5 B;  4C3H B;  2K75 A;  1EYA A;  1QNU A;  4N9P A;  1N34 L;  4Y52 H;  1A0I A;  2NZ1 D;  2WFW A;  2G9H D;  2Z6K A;  4GLA C;  4JCV E;  3R8B A;  1N32 L;  1XNQ Q;  3M4Q A;  1ZKO A;  1HQR D;  1LM0 A;  2PZU A;  3S16 H;  1BR9 A;  3LWE A;  3TDQ A;  3KJP A;  3OWE B;  1V43 A;  3GTP B;  4G4K A;  3PO2 H;  1STA A;  1Y1W G;  1GUW A;  1SSO A;  1UE6 A;  1AEX A;  4BY7 B;  4CDC C;  3ONA B;  5C44 H;  2J7Z A;  4F8M A;  1KLU D;  1S40 A;  1QVC A;  1QZG A;  4LF6 Q;  4DR5 L;  3HOU G;  4HJ5 A;  2JA6 H;  4MHE A;  4O2D A;  1VQA A;  3DM1 A;  3GTJ B;  2A69 C;  4OXP A;  2DY7 A;  3TP6 A;  3K59 A;  2JYO A;  3KBG A;  1TWA H;  4ZKB B;  1K3B C;  2CW0 C;  2G9D A;  4QY7 A;  3SHL A;  5J39 A;  4JOI C;  2E2H B;  1XMQ L;  1JJ2 A;  3BZD B;  3ERO A;  3K57 A;  5EKI A;  2IL8 A;  4HSV A;  3BZK A;  4DN4 M;  4A3J G;  2L1B A;  3C1F A;  4RGT A;  3MVV A;  1D8L A;  4HJA A;  2JSO A;  2AQ2 B;  4IO9 A;  1L1O C;  4DK3 C;  5E7N A;  5IP9 H;  3CP0 A;  3FRP B;  1LLR D;  3OSO A;  1T9H A;  4A76 A;  2A6H D;  3G4S A;  1JOK A;  3BVG A;  1JOQ A;  2BCO A;  2MPM A;  2EY2 A;  1DXM A;  2ZTC A;  3MAQ A;  3PF4 A;  5M5Y H;  1CFM A;  3I4N B;  3OW2 A;  4NXN Q;  4WJ4 A;  1E7Z A;  1EZ6 A;  1D5X C;  4G57 A;  2Q2H A;  1RF2 D;  3MXG A;  3FKI H;  1STY A;  3TP5 A;  3ULP A;  3MC0 B;  4KTA A;  1QUQ B;  3NE5 B;  2K14 A;  3D31 A;  3UDX A;  2RVL A;  1TWH H;  5FLX c;  2E2D C;  4K5V A;  4YWM A;  1I4X A;  1IBK L;  5J1Z A;  1DOL A;  3AYH B;  1HNW L;  5C5M A;  4JI2 Q;  1PH3 A;  1HZA A;  2X69 A;  4DGZ A;  2WAQ B;  3SEB A;  3KUP A;  1HFG A;  3S15 H;  3AFP A;  4JI5 Q;  4L5R C;  4E6I A;  1CSP A;  1VQK A;  1N9W A;  1M90 C;  1SRU A;  5CR3 A;  3QR8 A;  2UXB L;  1IBM L;  2IY5 B;  4HAE A;  1S5C D;  4KI0 A;  1Z6H A;  4JI4 Q;  4IOC A;  1XXG A;  1S72 A;  1D1I A;  1TWF H;  1GKH A;  2OCE A;  4BY1 G;  3MZ5 A;  4IPH A;  1I94 Q;  5EJW A;  1BXT A;  1U0L A;  2Q8R E;  3CCR A;  4HIM A;  1I6H H;  1OTC A;  1B9M A;  4DR7 L;  4P74 A;  1YIT A;  1ZYR C;  1SYG A;  3GD7 A;  4JI0 Q;  2RDF A;  1BBW A;  3A0J A;  2A68 C;  4DV5 Q;  2B3G A;  3S14 B;  1BKB A;  3PO3 H;  2PCF B;  3CPF A;  1JWU D;  1FGB D;  2F0P A;  2Q8I B;  3OTO Q;  1H95 A;  2L5T A;  4DAV A;  2CHB D;  2Z4H A;  1N33 L;  2UUC Q;  4A3D G;  1BBU A;  5GAD C;  1NTG A;  4P73 A;  1SNM A;  1NUC A;  4RH6 A;  4YCV A;  1Z9F A;  4JW0 A;  1CT1 D;  1SFO B;  1BQQ T;  3K7U C;  4A93 B;  3KOJ A;  2OT2 A;  3A5U A;  3HZX A;  3I55 A;  1GO3 E;  1WCM H;  4DF7 A;  3HOY B;  4EQN A;  3RLO A;  3S1R H;  2JA5 H;  2VZA A;  2PQE A;  4C3H H;  4DXF A;  5M3M H;  3D3R A;  4MIU A;  1T5X D;  3CCM A;  2NB0 A;  4DUY L;  4CDE C;  4DV1 L;  3BYY B;  4M8A A;  2EQS A;  3M3Y H;  2FMM A;  1TII D;  4A3F G;  3P1H A;  2O5I C;  3GTP H;  1KAW A;  4DR6 L;  2XIW A;  1MIU A;  2F0D A;  3KF8 B;  1CM9 A;  3PGZ A;  4L6T B;  3J7A 5;  1P16 A;  5C3E G;  1XPU A;  1KLG D;  5KYL A;  2HCI A;  1WTW A;  1SRO A;  2KEE A;  4QJF A;  1Y1W H;  2IX0 A;  4EQP A;  2K01 A;  4HMI A;  1MBY A;  4HCS A;  5ISR A;  3CMA A;  5JEA G;  3TZD A;  4A3G B;  1KNE A;  2F3I A;  2L11 A;  4CJ1 B;  4QMG A;  2JA8 G;  3GTJ H;  2ZM6 Q;  2HUG A;  1RIP A;  3WDN A;  4YWL A;  5LMN L;  5BN5 A;  1YNJ D;  2ALY B;  3H3V H;  1VQH A;  1Y8N B;  4DAM A;  5IYC H;  2R92 B;  5FLM G;  2NVT B;  1I4Q A;  4JBM A;  1EU4 A;  1B3Q A;  3LNN A;  5C5L A;  1WTH A;  3OWF A;  1G2S A;  3FMC A;  2E2H H;  3M85 A;  1BCP F;  3NEM A;  1EWC A;  4B3S L;  2HT1 A;  2F0M A;  2PNR C;  2NTT A;  1CI3 M;  1PFB A;  3U9S A;  3Q23 A;  3CCL A;  3M7N A;  4IAL A;  1EZ8 A;  3PUV A;  4IUQ A;  4A3J H;  4BBR G;  3I72 A;  2JQO A;  1PRT D;  2IT1 A;  3E0J A;  2PI2 E;  2LMC B;  2KHS A;  3K7A H;  1K8A C;  1ONL A;  1PMR A;  2CQA A;  3A8K E;  1STE A;  5I2X A;  2PMZ E;  2ZJQ A;  3NUC A;  2HCC A;  5EPJ A;  5DNF A;  3OMC A;  2NWG A;  5JAV A;  1ENF A;  2MUY A;  4CGY B;  2K5N A;  3IFT A;  1B70 B;  3URY A;  2VQF Q;  1LT5 D;  2K03 A;  3BDL A;  1LTT D;  2MP1 A;  1K8G A;  2Z1C A;  3KFU A;  1E24 A;  1YJW A;  2DNE A;  2EJF C;  5M5X B;  4DA2 A;  3U50 C;  2CH4 W;  2Q8T A;  4OO1 G;  3E9H A;  2XN9 C;  1Q7Y C;  4OL7 A;  2DGY A;  3VYT A;  5C4X G;  1SBB B;  1R9T B;  4GLV B;  1A6X A;  2QDB A;  1U4M A;  2Y0S B;  2NVQ B;  3PMF A;  1PH9 A;  4R1J A;  1EIF A;  2UU9 L;  5GQO A;  1XNR Q;  2F4V L;  2ICE C;  4XXE A;  4KJN A;  3KLR A;  2B2T A;  1H9S B;  1VQE A;  2KCT A;  1I3Q B;  3BZC A;  5C0X J;  1WJJ A;  3DUZ A;  1X6O A;  2A19 A;  2B2W A;  2VB2 X;  3MXU A;  4ZLT F;  2K52 A;  2OXP A;  1PYS B;  2RKS A;  5IIF A;  1RHP A;  3J80 c;  2B8F A;  2F0W A;  4NW2 A;  1WTV A;  1XJV A;  4GNX C;  4KK7 A;  5IWA L;  1J5E L;  2K50 A;  3GTQ H;  3S1Q B;  1FJG Q;  2EXD A;  3NXW A;  4ME5 A;  3QIA A;  5CMD A;  3M9B A;  3IKJ A;  4TKO B;  4UAI A;  4JI1 L;  2PZT A;  1H9K A;  1V1Q A;  1STB A;  2C9O A;  1IBL L;  2UXC Q;  3N52 A;  1JWM D;  4LMQ D;  3TS2 A;  1EIY B;  3F2D A;  1CKO A;  3HOX B;  2O2L D;  2F3W A;  2LS0 1;  1Y69 U;  3M4O B;  4YIJ A;  1KNA A;  4NPS A;  1UE7 A;  1EEF D;  1NR2 A;  4RFB A;  1CZW A;  3G6J B;  5KRU A;  1XMO L;  4DAP A;  1EOV A;  5EBC A;  3K58 A;  4X64 Q;  2B2Y C;  3TSS A;  3HGB A;  2IHF A;  2LXJ A;  2F1M A;  3D6W A;  2BA1 A;  2CCZ A;  1B44 D;  3FPU B;  1K73 C;  4A93 H;  4KLK A;  1EIH A;  2K5D A;  1Q86 C;  3NBH B;  1E1T A;  3JAM i;  1SN8 A;  3W1B A;  3TBI B;  3HOY H;  1GXD C;  4C2M B;  4A3M B;  4X65 L;  4YY3 Q;  4IFD H;  3M4P A;  4RWS C;  2QGQ A;  1HXY D;  1S3O A;  2HD3 A;  1KXL A;  5IT9 L;  4OHJ A;  1XYI A;  3STB C;  4GN4 B;  4EQ5 A;  1O7I A;  5D3D A;  4L63 B;  4GLX A;  3NQI A;  5KGU A;  4DV3 L;  4RGM A;  4ABN A;  5LMU Q;  3KF8 A;  1VQJ A;  4DKA C;  4C3J G;  3TEH B;  4A3F H;  1BNZ A;  2RSO A;  4B9W A;  2JJQ A;  1SR3 A;  2E76 C;  5JJI A;  4DR3 L;  2WII B;  1SEB D;  4CHT B;  1S5B D;  1B7Y B;  1EWI A;  2I07 B;  4JC0 A;  4O42 A;  4U68 A;  1Q8K A;  1AZP A;  2JA7 G;  2A73 B;  2A1A A;  3LGJ A;  2OEO A;  5JEA H;  1I4R A;  1PH8 A;  1C0A A;  3BYT B;  3KDF B;  2L0C A;  4LF8 Q;  4FF2 A;  1TR5 A;  3PO2 B;  4DAY B;  1ICF B;  4RCO A;  3KYH C;  3CCQ A;  3K0X A;  3C46 A;  3AU7 A;  1SYD A;  3VR2 A;  2N88 A;  4I65 A;  2NVT H;  2B2V C;  3BS1 A;  3QG1 A;  2RHS B;  4IUU A;  3TQY A;  3L0O A;  1QWY A;  1X54 A;  5FLM H;  5ELE A;  1IW7 D;  2ZXP A;  2FJ2 A;  2F0S A;  3RLF A;  1E2W A;  2CVR A;  5JPM C;  1EL0 A;  4QUC A;  5ELO A;  2E75 C;  1PH6 A;  1KAB A;  2MO0 A;  2Q2T A;  1TWA B;  3HOW G;  2MNA A;  4YWK A;  3H94 A;  4BBR H;  1HQM C;  2UUA Q;  1FYC A;  2F0F A;  5C4Z A;  3PUY A;  4X62 Q;  2AQ3 B;  4CBV A;  4P2C B;  1YZ6 A;  4K0K L;  1DM0 B;  1S5F D;  3E3X A;  2EZV A;  2ZTE A;  1A3V A;  1HR0 L;  5IYB G;  4P75 A;  3BJU A;  1DD2 A;  4NDX A;  4LUV A;  1EYC A;  1EWH A;  3U58 A;  4BWG B;  3Q22 A;  4RAU C;  1D7Q A;  5JJL A;  5KIX A;  1R9T H;  2FXQ A;  3PCO B;  5M5Y B;  1PZK D;  5C4X H;  5EKK A;  1PFN A;  2NVQ H;  4DV0 L;  3ULL A;  4CJ0 B;  3S2D H;  4QIW E;  4LF7 Q;  4IUR A;  3A7A B;  3J80 E;  3T1H Q;  5DAU A;  2VNU D;  1I6V C;  1L0W A;  1TWH B;  2YTX A;  1PYB A;  2F0N A;  4UY8 C;  4BA2 I;  3K6O A;  4KN4 C;  3U9O A;  3H91 A;  5H1S E;  1J6Q A;  3FP9 A;  3RMH A;  3TME A;  2F0E A;  1BBX C;  4HMJ A;  4CDF C;  4DK0 A;  2K04 A;  4G7H C;  2A6H C;  2R93 B;  1S5E D;  4PG3 A;  4N8X 1;  3L3O C;  1DZ1 A;  4HJ9 A;  3I4O A;  3JAM L;  3J81 L;  2DNC A;  5LL6 X;  4IN3 A;  5EGT A;  2KED A;  4TRD A;  1VQ4 A;  3K80 C;  4A3C H;  3GP7 A;  4I7Z C;  3HOV G;  3M4O H;  1SNP A;  3H0G B;  4YHH L;  2E2J H;  3I4M G;  4X3S A;  2AQ1 B;  4FXD A;  1II3 A;  4BXX G;  4JI8 Q;  3GTK H;  1PDQ A;  1TWG B;  5IGC A;  1A8V A;  1B8A A;  2DJF C;  2KOL A;  1I6H B;  2XVS A;  4JK1 C;  4KY7 A;  3NBH A;  5G3L F;  3PO3 B;  2GVB A;  1IL2 A;  1QCB D;  3MXP A;  4KV6 A;  3I8Z A;  5IOD A;  3OIQ A;  3PSI A;  1L0X B;  3FPP A;  3I90 A;  3R2I A;  4LFA Q;  3CQZ H;  1SNQ A;  1IZ6 A;  1JIC A;  3HS0 C;  1JWS D;  1LV9 A;  2VQE Q;  2K5H A;  2V4D A;  3S1R B;  2KJX A;  5M3M B;  2VXW A;  5FO7 B;  5DM7 3;  1NNX A;  4GKJ Q;  4C3J H;  4G7O C;  4NXM L;  1VQ9 A;  3S17 B;  2JK8 A;  5JEA J;  4KHV A;  3H15 A;  1F77 A;  3M3Y B;  5DEH A;  1ZEQ X;  4R4O A;  2NYZ D;  3X3M A;  3PIP A;  4DAY A;  4IZ8 A;  1WTO A;  2WKD A;  4X3K A;  4A3I G;  2B63 G;  1PTO C;  3DMU A;  5M5W B;  4K5W A;  4CJ2 C;  1Y1W B;  1KRT A;  2HHH L;  4N9T A;  1IBM Q;  2WB1 G;  4R4T A;  1GD7 A;  4B3T L;  3K5O A;  1Q90 A;  4DR1 L;  4C1N I;  2L55 A;  1UNS A;  3HOU B;  4MN3 A;  4DR7 Q;  2ZTD A;  4DV6 Q;  2EYF A;  4ME3 A;  5A2Q E;  1KDC A;  3D4D A;  2EOT A;  4HID A;  1D5Z C;  3OOC A;  2KHJ A;  1SDF A;  4A3B G;  1YHA A;  4X3U A;  2IX3 A;  2N8N A;  3K5M A;  4FXK C;  1EFI D;  3T1Y L;  4A3J B;  3GTG H;  1GUO A;  3Q8D A;  2B8G A;  4PZ8 A;  1QE6 A;  3K7A B;  5IGE A;  4X66 L;  5IYB H;  1VQB A;  4ILW A;  3BDO A;  2RHQ B;  4DV7 Q;  1PZI D;  4IUV A;  1IYJ B;  5CYU A;  3ULJ A;  2K1B A;  2UUB L;  4OX9 Q;  3SK5 A;  1YNJ C;  2A5H A;  2KA7 A;  1YEZ A;  5IOC A;  3ERS X;  4JYA L;  4DUY Q;  1EY9 A;  2OTJ A;  1F2M A;  1LO5 D;  2E5L Q;  5C3W A;  3DEP A;  2NVY H;  3HP3 A;  1M8A A;  5L37 A;  5IGF A;  1W2B A;  2I5L X;  4DUZ Q;  1F9Q A;  3DEO A;  2JP1 A;  2Q2U A;  2RCN A;  5EPL A;  4G7Z C;  2WIN B;  2KCC A;  1DCZ A;  1PRT C;  1VQI A;  3C2P A;  4AQY Q;  4JI6 L;  3LWU A;  1WTX A;  1D1K A;  1MSG A;  4LK1 C;  4A3E G;  4A3K G;  2R93 H;  4RGO S;  3ND8 A;  3QO2 A;  2Z6K C;  4CKC A;  4DV4 L;  2L15 A;  3Q24 A;  1PZJ D;  2R7Z G;  1MJC A;  5CBE E;  1OO9 B;  5LMN Q;  4LWC A;  5C0X H;  1Q8I A;  3X3N A;  1XNQ L;  1PH4 A;  1I4H A;  3H0G H;  4HN7 A;  2PO4 A;  1DOK A;  1NAP A;  4IJL A;  4LFB Q;  5KND A;  1HNZ L;  4K6L A;  3HOV H;  3I7F A;  3GTQ B;  1C8C A;  1TWG H;  1HUM A;  2AMC B;  1PFS A;  4BXX H;  4GKK Q;  4H13 C;  2X6L A;  3PUZ A;  4P71 A;  3M7G A;  4BY1 B;  4QL5 A;  4X3T A;  1KIX A;  4APV A;  1RDP D;  3V05 A;  2K5Q A;  3KLS A;  3EJI A;  4LAA A;  4PMW A;  3SGI A;  1JR0 D;  2UXD Q;  4ALP A;  2OTL A;  1HCZ A;  4IJH A;  3I2Z A;  4LF6 L;  3S9W A;  1VMP A;  3QOJ A;  4EQO A;  1RJT A;  4A3D B;  4DNT B;  3TP7 A;  3SK6 A;  3CC2 A;  2F0U A;  3NSW A;  4WJ3 M;  3NK9 A;  4NB3 A;  1HJP A;  3CCE A;  1NE3 A;  1OXX K;  4QQB X;  1YHQ A;  1TY0 A;  3WOE A;  1VQO A;  1VQD A;  2CQO A;  5I2Y A;  3NTI A;  4S3S A;  1EY5 A;  2Z6B A;  3H3V I;  1NR4 A;  4JPB W;  1G51 A;  2KQ3 A;  3UE1 A;  1TVX A;  1GVP A;  4B08 A;  1DJR D;  2N3S A;  3S17 H;  2XSC A;  4AYB G;  3WOF A;  5FLX L;  1CTM A;  2F0H A;  4C3I G;  3G6E A;  5C4H A;  4B9X A;  5C3X A;  4BBS G;  3NWT A;  1KD1 C;  3ZYY X;  2QA4 A;  4A3F B;  1DGS A;  2A69 D;  3MFG A;  2PI2 A;  2BDO A;  5CBA E;  2EVB A;  5M5W H;  2L9H A;  1BCP B;  2DY8 A;  3TN2 A;  4NXN L;  2PNH A;  5BR8 Q;  1X32 A;  2ZT9 C;  2RDG A;  1LAB A;  2ZJP A;  2Z0S A;  4ZCK A;  4JBK A;  1SYF A;  3SK8 A;  4LF9 Q;  4GN3 B;  1R4P B;  1TS5 A;  2JA9 A;  2F52 A;  1ENC A;  2B29 A;  3HOU H;  4JI1 Q;  3AFQ A;  2JA8 B;  3VR6 A;  2YTY A;  1IBL Q;  2FFK B;  1SE4 A;  1L2F A;  2WKC A;  4A3G G;  4JI2 L;  1PVO A;  1K8M A;  1AP0 A;  4QUF A;  4UHV A;  2HQE A;  4JI5 L;  1UE1 A;  5DLQ E;  1LTG D;  2SNS A;  3J80 i;  2KBN A;  4WOR A;  1G91 A;  4RMF A;  1Q1E A;  3NTH A;  1MJE A;  2BH8 A;  4NKL A;  1ET9 A;  1KTK A;  2F0G A;  4QIW B;  1EQV A;  4BBR B;  3CC4 A;  4QCL A;  1TY2 A;  4JI4 L;  2B39 A;  3QJY A;  1LYL A;  2WB1 E;  2EY1 A;  4X65 Q;  4ZYS A;  1I94 L;  1A15 A;  1X3Q A;  4JI3 Q;  4R9W A;  1STH A;  4JI0 L;  3CF5 A;  4GOP B;  4DV5 L;  5BN3 A;  2R3Z A;  1QUQ A;  1IW7 C;  4HJ8 A;  4LF5 Q;  3A7L A;  4DR2 Q;  3VDY A;  3OTO L;  3MFY A;  4FF4 A;  2QF7 A;  2UUC L;  1X3G A;  2K5W A;  3NBI A;  5C4X B;  1HTL D;  4DK1 A;  1CZG A;  1MSH A;  2VY3 A;  1WVL A;  3BVZ A;  2YU9 H;  1YNN C;  1FNU A;  1FNW A;  5ELN A;  3S2D B;  2EXZ A;  2RDH A;  1HHV A;  4LF4 Q;  4JV5 Q;  2QEX A;  4EX5 A;  3PUW A;  4CKE A;  4A3K H;  3V96 A;  5GRO A;  2KCM A;  1U5K A;  5HGT A;  1I4P A;  1K9M C;  2R7Z H;  1JCK B;  4MNO A;  4K8I A;  4H0L C;  3P20 A;  1HA5 A;  1GUT A;  1LTR D;  4IFD I;  3V2T A;  1PTO B;  2B2V A;  4K5X A;  4B3R Q;  2B2U C;  2OQK A;  4DR4 Q;  2H1E A;  3RD4 A;  4PNY A;  4BY1 H;  5C4J B;  2SDF A;  2VUM G;  3MTS A;  1CUK A;  3UI2 A;  2D5D A;  2LKV A;  3W3A A;  3A8I E;  1G8Z D;  4XTC S;  4LW1 A;  2F0J A;  2E2J B;  1RTO A;  4HED A;  5EAY A;  1LTI D;  3CD6 A;  3KLW A;  3GTK B;  2ZXR A;  1YJN A;  1B1Z A;  1F9P A;  2ZM6 L;  1PTO F;  1SMY C;  3CPW A;  4A3D H;  3ND9 A;  1CKM A;  4ZUI A;  3FVQ A;  3H6M A;  1V8Q A;  4XT1 B;  1AN8 A;  3DWQ A;  1U4P A;  1HNX Q;  3NQT A;  2XNA C;  1L1O B;  1VCI A;  2KVM A;  1TU2 B;  4RKL A;  4EGV A;  1KC8 C;  5EPK A;  4FYD A;  3O13 A;  3CQZ B;  5KYI A;  1WD0 A;  2CFM A;  4DV0 Q;  3F2U A;  1CHP D;  3PIP 3;  2ID0 A;  4PZ7 A;  2JE6 I;  5G3L D;  1AH9 A;  1WOC A;  2F0L A;  3EBE A;  4IUN A;  2ICI A;  1VQP A;  1G2T A;  1PLF A;  2K4K A;  4HR7 B;  5COR A;  2JN4 A;  1UE5 A;  3LX0 A;  1Y14 B;  3DWA A;  4C3J B;  2EYP A;  5LMN W;  3A54 A;  3DLL A;  3VYS A;  5C3E H;  2MJ8 A;  1E3P A;  2QEJ C;  3J80 L;  1Y1V G;  2ENB A;  3AMU A;  1A2T A;  2RA4 A;  2JA7 B;  2JA8 H;  1GUS A;  1TT2 A;  2VL6 A;  1DOM A;  2B2T C;  3UDG A;  2WP8 J;  3S2H B;  1VQ7 A;  4KHP Q;  1FD7 D;  3I4L A;  1XNR L;  3CC7 A;  1PH7 A;  1JB7 A;  3RN2 A;  5T1I A;  2J4X A;  4AYB E;  2B2W C;  3CAM A;  2NN6 G;  4UP9 A;  3R3O A;  4R8N A;  3L2P A;  1Q3L A;  1KDA A;  4IQZ A;  5C44 G;  2H4O A;  1PRT F;  3PIO A;  1PHJ A;  4GZY C;  5JVH 3;  2G5D A;  1K0S A;  2ATW A;  2IX1 A;  2I5M X;  3B6Y A;  5FJ8 G;  3HOW B;  2RQX A;  3TRE A;  3HOZ G;  2JA6 G;  4J6H A;  2D2C C;  4EVO A;  5AJ3 Q;  1P8L A;  1FJG L;  3NEL A;  4B3M Q;  3IFD A;  3DHQ A;  3SDZ A;  1N36 Q;  1TWC H;  2UXC L;  4ZRZ A;  2I46 A;  1YJ9 A;  4GOP A;  3GTG B;  1EUJ A;  1FVI A;  2BE5 D;  4Z9C B;  1KHI A;  2C5C A;  3SR1 A;  4JI7 Q;  1CA6 A;  4OO1 H;  3RZD H;  2EYH A;  1UWV A;  3C1E A;  4X64 L;  1N34 Q;  1QB5 D;  3T53 B;  1GHJ A;  4OWW B;  2EY6 A;  5JOB A;  1N32 Q;  2XRS D;  4ZK9 B;  4L8J A;  2AWN A;  2F0I A;  1NBW A;  5K36 G;  2BOS A;  2YYZ A;  1H9S A;  3FEW X;  1F2L A;  1B4O A;  2NVY B;  3CCU A;  1YNX A;  4KY6 A;  4JBJ A;  2AWO A;  4YY3 L;  2YV5 A;  1AE3 A;  2MGS A;  5KNB A;  2GVA A;  4K6D A;  3KF6 B;  1BOS A;  1LT4 D;  2NZH A;  3FKI G;  3W5O A;  4PV1 C;  5LL6 S;  4UDU C;  1ET6 A;  4Q0F A;  1IKM A;  3N6R A;  2LXK A;  3GDE A;  1PTO H;  1Q81 C;  4DR5 Q;  5M3F G;  3MEH A;  1GUG A;  4FP5 D;  4AH6 A;  5LMU L;  3K8A A;  3MEF A;  3DXJ C;  5CV6 A;  2HDL A;  2NTS A;  5I9O A;  5C4J H;  4H02 A;  2D62 A;  2VUM H;  2JEA I;  1I50 H;  3HKZ G;  2A6E D;  3EIV A;  1ZXT A;  4HTH A;  1XTD A;  2XWJ B;  1JE5 A;  3S1N H;  1XMQ Q;  3HOV B;  1SNC A;  3I4M B;  3S1M B;  3GQB A;  4A4I A;  4LFC L;  2M9V A;  2F0T A;  1E0B A;  4JOI A;  1LT3 D;  4LF8 L;  2F0O A;  3A8J E;  4ULL A;  1TS3 A;  3MXN B;  1HH2 P;  1VQ6 A;  1F2Y A;  3VA5 A;  3STB D;  5GAH C;  1QJO A;  5ELD A;  3K0Y A;  1L1O A;  2L12 A;  4GN5 A;  1PXU A;  4WJW A;  1QVF A;  1PV4 A;  1FR3 A;  3E9I A;  1LTS D;  3UDF A;  1RD9 D;  1X3E A;  2PPB C;  3D4R A;  3W2D A;  3KJO A;  3NWS A;  4V0B A;  1LUZ A;  1JE4 A;  1SXT A;  4IUT A;  5EBD A;  3RUZ A;  2WV6 D;  3CCS A;  2UUA L;  1TKW B;  1QZH A;  2EDG A;  3E0E A;  5AFW A;  4F7X A;  2PYK A;  4IUP A;  4X62 L;  3PQI A;  2PZW A;  1IXR A;  5HY6 A;  2EJM A;  1IBK Q;  3NP8 A;  4YCW A;  5TSS A;  1HNW Q;  4HCE A;  5D3I B;  1WCM G;  3IL8 A;  5KNC A;  2NBF A;  1YI2 A;  2JA5 G;  4C3H G;  5FOB B;  1QNK A;  2J0T D;  3KDF A;  4TVA B;  1X56 A;  3I70 A;  3U4Z A;  3GV3 A;  2JA7 H;  1Y1V H;  3D8G A;  1TXY A;  3WWV A;  3I3C A;  2I0Q A;  1BUV T;  2C35 B;  4A3I B;  2UXB Q;  2IHE A;  4ZAI A;  4OWX B;  3S2H H;  2QCP X;  3NTK A;  2B63 B;  1EIG A;  2ZJR A;  5J22 A;  2SNM A;  1ILQ A;  2WB1 B;  3CRL C;  1HNZ Q;  3RNU A;  3EA6 A;  2PMZ B;  4KD3 A;  1AZQ A;  3ERQ A;  4LF7 L;  2F0V A;  4HIK A;  3T1H L;  4XT3 B;  4H7B A;  5CGK A;  4BY7 G;  3CCJ A;  5LHY 1;  4KHZ A;  1GJX A;  2A74 C;  2NN6 H;  4GNX B;  1Z7T A;  3JAM E;  3J81 E;  1VQM A;  1B9N A;  2R61 A;  1HR0 W;  1C9O A;  3QWN A;  3HOW H;  3EFX D;  3KLS X;  3A55 A;  4DV2 L;  2WAC A;  2IWH A;  5FJ8 H;  1OXS C;  3OW7 A;  1N33 Q;  2K5V A;  2NVX H;  3HOZ H;  1OXT A;  3RLN A;  4OIK A;  1C7Y A;  4Q5V A;  4A3B B;  2JEB I;  5IYC G;  1JMC A;  3E5S A;  1VQ8 A;  1HUN A;  4V19 0;  4KKS A;  1NSN S;  1MHW C;  1HZC A;  1J8I A;  5JJZ A;  2LSS A;  4C56 C;  3BVM A;  4RCN A;  4KN7 C;  3TZU A;  4ZKC B;  1HFN A;  1NCV A;  3HRZ C;  5JVG 3;  1BCP D;  4JI8 L;  4IOA A;  2N55 A;  3VR5 A;  3QB3 A;  4Y7N B;  5C0X I;  1CQF A;  1O7L A;  1U4L A;  3BDC A;  1FGU A;  4FO2 A;  1EFW A;  3J7Z C;  2X6G A;  4RHS A;  3ICE A;  5CV8 A;  2PQA B;  1JOR A;  2QDL A;  4DV1 Q;  4HSP A;  2HDM A;  1S5D D;  5FO9 B;  5K36 H;  4MTN A;  4K8J A;  4FXG C;  4DR6 Q;  4I7A A;  4DFA A;  3ZJY C;  3I4N G;  3KF6 A;  2CWP A;  1HZ9 A;  4FVM A;  4J15 A;  4LFA L;  1XX8 A;  5EKL A;  1CA5 A;  2O5J C;  2YU9 B;  2SEB D;  1HZB A;  5CV9 A;  2ZXO A;  3OIP A;  3F8T A;  1Q46 A;  3OPO A;  3CHB D;  5EQ0 A;  3SK4 A;  2VQE L;  2E2I B;  4A3E B;  2H5X A;  4A3K B;  5M3F H;  1E1O A;  4DU9 A;  4GKJ L;  2R7Z B;  4JVZ A;  3RZO H;  2WAQ G;  2PW5 A;  2EE1 A;  4B3S Q;  4RHR A;  2MO1 A;  2XGT A;  5DM6 3;  3I4M H;  3S1M H;  1DON A;  3VYU A;  1ROD A;  2EPB A;  3GTO B;  1QIL A;  1HA6 A;  1STG A;  4ODG A;  1EQQ A;  1A63 A;  1JOO A;  3MXN A;  3MWY W;  1CQV A;  1MD2 D;  4ZUJ A;  5D14 A;  1EU3 A;  4PMB A;  1SE2 A;  5A35 A;  1A3U A;  2RCF A;  3KBX A;  1SE8 A;  4O1N A;  1IYV A;  2MHV A;  2AHO B;  1Y8O B;  5IP7 G;  2XWB B;  4GS3 A;  1PH1 A;  1SMX A;  1PH5 A;  5ELF A;  1VQF A;  2RBM A;  4DV6 L;  1ASZ A;  2KUM A;  4IPG A;  2KCN A;  2VW9 A;  2CH4 A;  1SYB A;  2HQL A;  2MFI A;  1MKH A;  3U4V A;  3J7A V;  5HGQ A;  4POF A;  3HKZ E;  4N8F A;  2MQH A;  2TMP A;  1O7Z A;  3RR5 A;  1WTP A;  2CWA A;  3OMG A;  4MTK A;  1I4G A;  4XYO A;  5E4X A;  3I56 A;  5ELC A;  2JXM B;  3D6C A;  5CC4 A;  2AUK A;  4A93 G;  4XQJ A;  1PTO D;  1GUN A;  4XQN A;  2UU9 Q;  3HOY G;  2A8V A;  2F4V Q;  3AB9 A;  4M1U B;  1NMG A;  4AYB B;  2IJ0 A;  3AEV A;  4IFD G;  1UAP A;  1SYE A;  2EJG C;  2PW7 A;  4C3I B;  4DV7 L;  1EQR A;  3GTL B;  1STN A;  4PMC A;  5GAG C;  2EY5 A;  4OX9 L;  1CSQ A;  2TSS A;  4OEM B;  4U67 3;  1RTN A;  4A3I H;  1QVG A;  1PH2 A;  4BBS B;  3BU2 A;  5C3E B;  1XPR A;  2B63 H;  2CW0 D;  1B50 A;  1C48 A;  5IWA Q;  1J5E Q;  4PQX A;  2E5L L;  1GOZ A;  3NHH A;  4DK6 C;  3ITP A;  1VQN A;  1A3T A;  3PIO 3;  3SE0 A;  4FF1 A;  1FNV A;  1ENA A;  5T1G A;  4BS9 A;  4GNX A;  1VS0 A;  4DUZ L;  2P5Z X;  3DM3 A;  3G48 A;  4BY7 H;  1SE3 A;  2OF1 A;  4QB4 A;  2B2U A;  5I6Y A;  1X55 A;  3I73 A;  3HFZ B;  3GTM B;  1XTC D;  4AQY L;  1W6J A;  1M4V A;  3BG3 A;  1F2Z A;  3TS0 A;  3DWP A;  4OON A;  3UDI A;  1EY4 A;  1XMO Q;  1QG7 A;  2ASB A;  3CW2 C;  1JJC B;  4A3B H;  2R92 G;  1UEA B;  1Q82 C;  1E2Z A;  4NP5 A;  2EYM A;  1G6P A;  2B2Y A;  5I4D A;  5E4W C;  1V1O A;  2EYJ A;  4BA1 I;  3OHX C;  4TQU S;  1IHZ A;  3D0F A;  4LFB L;  4L5T A;  4XYQ A;  3E6Z X;  4LUO A;  2O4X A;  4WRD A;  4Y7N H;  4A75 A;  2K7V A;  3A74 A;  2AUJ D;  1SAP A;  3SVM A;  1Y8P B;  3P75 A;  1PA6 A;  2K05 A;  2F03 A;  4GKK L;  4QF4 A;  3GO5 A;  2PQA A;  1TWC B;  2LFN A;  3CME A;  1XPO A;  1KQS A;  3PV0 A;  1VDZ A;  2FMC A;  2D0P A;  2KEN A;  1B2T A;  2K6A A;  2UXD L;  5D65 A;  4DV3 Q;  2VS1 A;  1DYQ A;  5IY0 A;  5I9P A;  4R8I A;  3RZD B;  1YIJ A;  3CXC A;  3PUX A;  2L4N A;  2GA4 B;  4L5S A;  1H9J A;  4DPG A;  1VQC A;  1YBY A;  3I4N H;  4XQQ A;  4C1N K;  4DR3 Q;  1N8R C;  1VQG A;  1EY6 A;  1ESF A;  1EY8 A;  1SJE D;  4HIO A;  3EQL C;  5FLX E;  1A2U A;  4IPC A;  4R4Q A; 
#chains in the Genus database with same CATH homology
 1GKH A;  2OCE A;  4BY1 G;  4GKJ Q;  3CCV A;  1Q12 A;  4IPH A;  4C3J H;  5IT9 c;  1I94 Q;  1U0L A;  4PZ6 A;  3CCR A;  4NXM L;  4HIM A;  2I5M X;  3B6Y A;  1VQ9 A;  5FJ8 G;  3TRZ A;  1I6H H;  5IYD G;  1W3S A;  2E2I H;  3TRE A;  1ASY A;  2JK8 A;  4A3E H;  2Y0S G;  1OTC A;  2JA6 G;  3HOZ G;  4DR7 L;  4P74 A;  5AJ3 Q;  5JEA J;  1YIT A;  1P8L A;  3GD7 A;  4JI0 Q;  3S24 A;  1FJG L;  3AQQ A;  1BBW A;  3A0J A;  3NEL A;  3H15 A;  4DV5 Q;  4B3M Q;  2B3G A;  4R4O A;  1BKB A;  2R7D A;  3PO3 H;  3CPF A;  3PIP A;  1N36 Q;  4MZ9 A;  4R4C A;  1TWC H;  4DNI A;  4QGU A;  4A3I G;  1RL2 A;  2UXC L;  3OTO Q;  1YJ9 A;  1AE2 A;  4GOP A;  1H95 A;  3OYY A;  1N33 L;  4A3D G;  2UUC Q;  2DUD A;  1BBU A;  1EUJ A;  2CKZ B;  1NJI C;  1FVI A;  5GAD C;  2B63 G;  2HHH L;  1KRT A;  1NTG A;  3GTO H;  4P73 A;  2WB1 G;  1IBM Q;  1KHI A;  4R4T A;  4YCV A;  1GD7 A;  4JI7 Q;  1FL0 A;  1Z9F A;  4B3T L;  2HIX A;  1VQ5 A;  1VQL A;  3PF5 A;  3K7U C;  3RZD H;  3JC6 6;  4DR1 L;  3KOJ A;  1UWV A;  2HIV A;  4X64 L;  3A5U A;  3HKS A;  1N34 Q;  3I55 A;  1GO3 E;  1WCM H;  4A3L G;  5BR8 L;  4OWW B;  2OQ0 A;  1N32 Q;  2BA0 A;  3RLO A;  3S1R H;  2JA5 H;  2VZA A;  4C3H H;  5J3B A;  5JJK A;  2AWN A;  4O0A A;  5M3M H;  1NBW A;  2ZTD A;  4DV6 Q;  4DR7 Q;  5K36 G;  2YYZ A;  4ME3 A;  1WYD A;  1K0R A;  4LF9 L;  4RG1 A;  4K0K Q;  3CCU A;  1YNX A;  3CCM A;  4HID A;  4JBJ A;  2AWO A;  4YY3 L;  3HOX G;  4DUY L;  4A3C G;  2YV5 A;  1AE3 A;  2KHJ A;  4DV1 L;  2GVA A;  1HR0 Q;  5IP7 H;  4A3B G;  2EQS A;  1YHA A;  3KF6 B;  3M3Y H;  3S14 H;  1YHB A;  4A3F G;  4FDB A;  2NZH A;  2N8N A;  3GTP H;  3FKI G;  1KAW A;  3W5O A;  4DR6 L;  1MIU A;  2WAQ E;  3T1Y L;  3KF8 B;  3PGZ A;  3J7A 5;  1P16 A;  3GTG H;  2LXK A;  3GDE A;  3Q8D A;  4PZ8 A;  5C3E G;  1XPU A;  1Q81 C;  1SRO A;  4QJF A;  1Y1W H;  4DR5 Q;  2IX0 A;  1X3F A;  4X66 L;  5IYB H;  5LMU L;  4AH6 A;  5M3F G;  1VQB A;  3K8A A;  3MEF A;  3CMA A;  4JG2 A;  1M1K C;  2RHQ B;  4DV7 Q;  1SFO H;  5C4J H;  5JEA G;  1IYJ B;  4H02 A;  3ULJ A;  4A3M G;  2UUB L;  4OX9 Q;  4OWT B;  2F3I A;  2D62 A;  2ES2 A;  2JA8 G;  3ER0 A;  3J81 i;  2JEA I;  1I50 H;  3HKZ G;  2VUM H;  3GTJ H;  3EIV A;  4AIM A;  1OXV A;  1XTD A;  1YEZ A;  2R7F A;  4C3I H;  1RIP A;  2ZM6 Q;  4YWL A;  1JE5 A;  3ERS X;  3G71 A;  5LMN L;  1XMQ Q;  3GTL H;  4DUY Q;  2XTI A;  3S1N H;  2ALY B;  4JYA L;  2OTJ A;  3H3V H;  1VQH A;  4DAM A;  5IYC H;  2E5L Q;  5FLM G;  4A4I A;  4LFC L;  4P72 A;  4JI3 L;  4JBM A;  4BBS H;  2YTV A;  1CKN B;  2NVY H;  4JOI A;  4LF8 L;  2VQF L;  2E2H H;  3M85 A;  1W2B A;  3NEM A;  4B3S L;  1LTL A;  2I5L X;  4DUZ Q;  2HT1 A;  3MXN B;  1HH2 P;  1VQ6 A;  3STB D;  5GAH C;  3CCL A;  4LF5 L;  4DR2 L;  3M7N A;  2Q2U A;  2RCN A;  1WFQ A;  1VQI A;  1L1O A;  4AQY Q;  3PUV A;  4GN5 A;  2N78 A;  1EYG A;  4A3J H;  4BBR G;  4JI6 L;  2JQO A;  2IT1 A;  2PI2 E;  2NZO A;  4A3E G;  1QVF A;  4A3K G;  1PV4 A;  2R93 H;  2KHI A;  3E9I A;  3K7A H;  2Z6K C;  1K8A C;  3GTM H;  4DV4 L;  4YHH Q;  2L15 A;  3UDF A;  3F2B A;  2R7Z G;  2ZJQ A;  1MJC A;  1X3E A;  2PMZ E;  5LMN Q;  4A3G H;  4LWC A;  3KJO A;  4OO1 I;  3PO2 G;  1LUZ A;  1SLJ A;  4LF4 L;  4JV5 L;  4LFC Q;  1X65 A;  1XNQ L;  2K5N A;  3CCS A;  1PH4 A;  2UUA L;  3H0G H;  1QZH A;  2VQF Q;  1B70 B;  3E0E A;  4IJL A;  4LFB Q;  1HNZ L;  1UEB A;  3HOV H;  3I7F A;  1K8G A;  4X62 L;  2R92 H;  3KFU A;  1IXR A;  1TWG H;  1E24 A;  1YJW A;  2AMC B;  5HY6 A;  3U50 C;  1PFS A;  1Z47 A;  4BXX H;  1IBK Q;  3E9H A;  1Q7Y C;  1PHJ A;  4OO1 G;  4YCW A;  4GKK Q;  2DGY A;  3PUZ A;  4P71 A;  2OWO A;  5C4X G;  2D0O A;  1HNW Q;  4QL5 A;  1WCM G;  3JAM c;  1KIX A;  4GLV B;  4APV A;  3J81 c;  4LUZ A;  1YI2 A;  4B3R L;  2JA5 G;  2Q2I A;  4DR4 L;  4PMW A;  3SGI A;  3IRB A;  3KDF A;  4TVA B;  4XIG S;  1X56 A;  1EIF A;  4R1J A;  1PH9 A;  4ALP A;  2I5H A;  4IJH A;  2OTL A;  3U4Z A;  1K3R A;  2UU9 L;  1G29 1;  5GQO A;  2JA7 H;  1XNR Q;  1Y1V H;  2F4V L;  3I2Z A;  1TXY A;  3WWV A;  4LF6 L;  2I0Q A;  1X9N A;  2C35 B;  1VQE A;  2UXB Q;  2IHE A;  2KCT A;  4OWX B;  3S2H H;  2AKW B;  3BZC A;  5C0X J;  1WJJ A;  2ZJR A;  3CC2 A;  2N49 A;  1X6O A;  2A19 A;  3L7Z C;  3F2C A;  1HNZ Q;  3RNU A;  2K52 A;  4WJ3 M;  4X6A H;  1PYS B;  4NB3 A;  1HJP A;  4HIK A;  4LF7 L;  3CCE A;  3J80 c;  2EIF A;  1NE3 A;  2GN5 A;  1OXX K;  3T1H L;  4QQB X;  1YHQ A;  5IP9 G;  4BY7 G;  3CCJ A;  4NXM Q;  1VQO A;  1VQD A;  2CQO A;  1XJV A;  4KHZ A;  2BH2 A;  4GNX B;  4GNX C;  1V9P A;  5IWA L;  1J5E L;  2K50 A;  3GTQ H;  4UPA A;  3H3V I;  1G51 A;  1FJG Q;  3UE0 A;  2EXD A;  3UE1 A;  5M5X H;  1VQM A;  4YCU A;  1GVP A;  1HR0 W;  1HNX L;  1C9O A;  3M9B A;  3HOW H;  2N3S A;  4JI1 L;  3S17 H;  4AYB G;  3W1G A;  1V1Q A;  1IBL L;  4DV2 L;  2UXC Q;  3G6E A;  1YVC A;  5FJ8 H;  1OXS C;  3FHW A;  1EIY B;  1N33 Q;  3TS2 A;  3F2D A;  2K5V A;  2NVX H;  1CKO A;  1OXT A;  2E8G A;  3HOZ H;  3RLN A;  2HHH Q;  1C7Y A;  2JEB I;  5IYC G;  1JMC A;  1VQ8 A;  4NPS A;  4BBS G;  1KD1 C;  1UE7 A;  2QA4 A;  4B3T Q;  1DGS A;  4LNQ A;  1HZC A;  2PI2 A;  2LSS A;  4DR1 Q;  1XMO L;  5M5W H;  1EOV A;  4POG A;  4X64 Q;  2IHF A;  2LXJ A;  4NXN L;  5GAE C;  1I3Q H;  2PNH A;  5BR8 Q;  3F1Z A;  2BA1 A;  2CCZ A;  4JI8 L;  2ZJP A;  4IOA A;  1K73 C;  1JJG A;  4A93 H;  4KLK A;  1Q86 C;  1K83 H;  1E1T A;  3NBH B;  4JBW A;  2Z0S A;  3JAM i;  1SN8 A;  5C0X I;  1FGU A;  3W1B A;  1EFW A;  4JBK A;  3HOY H;  4LF9 Q;  3J7Z C;  4GN3 B;  2JA9 A;  2V1C C;  2F52 A;  3ICE A;  2B29 A;  4X65 L;  3HOU H;  4JI1 Q;  3AFQ A;  2PQA B;  4YY3 Q;  2R93 G;  4A3L H;  3M4P A;  2QGQ A;  2YTY A;  1S3O A;  4DV2 Q;  1NMF A;  4DV1 Q;  1IBL Q;  3S1Q H;  1KXL A;  1BVS A;  1L2F A;  4MTN A;  5C0X G;  4JI2 L;  4A3G G;  1PVO A;  3A5Z B;  3STB C;  4DR6 Q;  3EN2 A;  4GN4 B;  3T1Y Q;  4UP8 A;  3RN5 A;  3H0G G;  2Y0S E;  3ZJY C;  3KF6 A;  2CWP A;  3K81 C;  4EQ5 A;  1NY4 A;  1O7I A;  3I4N G;  5IE8 A;  3HOX H;  1HZ9 A;  4JI5 L;  4GLX A;  4J15 A;  1UE1 A;  4DV3 L;  4LFA L;  4KHP L;  5DLQ E;  3J80 i;  4X66 Q;  5LMU Q;  1VQJ A;  4DKA C;  1HZB A;  2KBN A;  3TEH B;  4A3F H;  3J81 j;  2UXD Q;  4RMF A;  1Q1E A;  3F8T A;  1Q46 A;  2BH8 A;  1MJE A;  1JT8 A;  2UUB Q;  1Q1B A;  2JJQ A;  1SR3 A;  5JJI A;  3CC4 A;  2VQE L;  4DR3 L;  4JI4 L;  1OXU A;  1I5F A;  1LYL A;  2WB1 E;  2H5X A;  4UP7 A;  4X65 Q;  2R6G A;  3PO3 G;  1B7Y B;  4JYA Q;  5M3F H;  1EWI A;  1A62 A;  1E1O A;  4JC0 A;  4GKJ L;  1Q8K A;  1I94 L;  1KL9 A;  1GM5 A;  2JA7 G;  3RZO H;  2A1A A;  3LGJ A;  4IFD J;  4JI3 Q;  1PH8 A;  2WAQ G;  1C0A A;  3KDF B;  4C2M H;  4A3M H;  4LF8 Q;  4IPD A;  4DAY B;  3KYH C;  5AJ3 L;  3CCQ A;  3K0X A;  2NN6 I;  4JI0 L;  4B3S Q;  2MO1 A;  2XGT A;  3CF5 A;  1KRS A;  4DV5 L;  1WI5 A;  4GOP B;  4GOP C;  4B3M L;  3I4M H;  2NVT H;  3S1M H;  1QUQ A;  1CKN A;  4HJ8 A;  4LF5 Q;  2RHS B;  3TQY A;  3L0O A;  4L5Q A;  4DR2 Q;  1N36 L;  3NEN A;  1X54 A;  1EQQ A;  5FLM H;  1A63 A;  2RF4 A;  3VDY A;  3OTO L;  1E22 A;  4R4I A;  2UUC L;  1X3G A;  3RLF A;  4JI6 Q;  4HJ7 A;  5M3M G;  2VY3 A;  4JI7 L;  2YU9 H;  4DV4 Q;  5ELO A;  1PH6 A;  2MO0 A;  2Q2T A;  5ELN A;  2K75 A;  1SE8 A;  3HOW G;  2MNA A;  4YWK A;  1N34 L;  4Y52 H;  1A0I A;  2AHO B;  2WFW A;  2Z6K A;  4GLA C;  4JCV E;  4LF4 Q;  4BBR H;  4JV5 Q;  2QEX A;  1N32 L;  1XNQ Q;  5IP7 G;  4EX5 A;  3M4Q A;  3PUW A;  4GS3 A;  1PH1 A;  1SMX A;  1PH5 A;  1LM0 A;  2UUA Q;  4A3K H;  1VQF A;  4DV6 L;  5GRO A;  3S16 H;  1ASZ A;  2KCM A;  3PUY A;  4IPG A;  4X62 Q;  1U5K A;  2VW9 A;  2HQL A;  1K9M C;  2R7Z H;  1YZ6 A;  1MKH A;  2MFI A;  3U4V A;  4K0K L;  4MNO A;  5HGQ A;  3KJP A;  1V43 A;  4POF A;  3PO2 H;  3HKZ E;  3RR5 A;  2MQH A;  2ZTE A;  1Y1W G;  1UE6 A;  1HR0 L;  2CWA A;  5IYB G;  4IFD I;  4P75 A;  3BJU A;  4LUV A;  3I56 A;  4B3R Q;  5C44 H;  3U58 A;  2OQK A;  4DR4 Q;  4A93 G;  4BY1 H;  1D7Q A;  1S40 A;  5JJL A;  2VUM G;  1QVC A;  2UU9 Q;  1R9T H;  1QZG A;  2FXQ A;  1CUK A;  2A8V A;  2F4V Q;  3HOY G;  3PCO B;  4LF6 Q;  1NMG A;  5C4X H;  4HJ5 A;  4DR5 L;  2JA6 H;  3AEV A;  3HOU G;  4IFD G;  4O2D A;  4XTC S;  1VQA A;  2NVQ H;  4LW1 A;  4OXP A;  4DV7 L;  1EQR A;  5EAY A;  4DV0 L;  3ULL A;  3CD6 A;  3KLW A;  5GAG C;  4OX9 L;  1TWA H;  3S2D H;  1YJN A;  4QIW E;  1CSQ A;  4LF7 Q;  4A3I H;  3T1H Q;  1QVG A;  1PH2 A;  4QY7 A;  2ZM6 L;  3BU2 A;  4A3D H;  4JOI C;  3CPW A;  1XPR A;  2B63 H;  1XMQ L;  2VNU D;  1JJ2 A;  1L0W A;  1CKM A;  5IWA Q;  1J5E Q;  2E5L L;  2YTX A;  1PYB A;  3BZK A;  4DK6 C;  4UY8 C;  1VQN A;  4BA2 I;  4A3J G;  5H1S E;  1D8L A;  4HJA A;  1J6Q A;  1VS0 A;  3FP9 A;  4GNX A;  1HNX Q;  4DUZ L;  4IO9 A;  1L1O B;  1L1O C;  3DM3 A;  3G48 A;  4DK3 C;  1VCI A;  5E7N A;  5IP9 H;  4BY7 H;  3CP0 A;  1KC8 C;  1T9H A;  1X55 A;  3HFZ B;  4PG3 A;  4AQY L;  4A76 A;  3G4S A;  2CFM A;  3I4O A;  4HJ9 A;  4DV0 Q;  3TS0 A;  2ZTC A;  2ID0 A;  4OON A;  3PF4 A;  3UDI A;  2IX1 A;  5M5Y H;  4PZ7 A;  2JE6 I;  1VQ4 A;  1WOC A;  4A3C H;  3K80 C;  1AH9 A;  1XMO Q;  2ASB A;  3HOV G;  3CW2 C;  3EBE A;  3M4O H;  4YHH L;  2E2J H;  1VQP A;  1JJC B;  3OW2 A;  2K4K A;  4NXN Q;  2R92 G;  1E7Z A;  3I4M G;  4A3B H;  4WJ4 A;  1Q82 C;  4BXX G;  2Q2H A;  4JI8 Q;  3GTK H;  1UE5 A;  1G6P A;  3FKI H;  3ULP A;  1Y14 B;  5LMN W;  1A8V A;  1QUQ B;  1B8A A;  4BA1 I;  3DLL A;  4TQU S;  2K14 A;  5C3E H;  1E3P A;  3D0F A;  4L5T A;  4LFB L;  4LUO A;  3D31 A;  3UDX A;  1TWH H;  5FLX c;  4Y7N H;  4A75 A;  3A74 A;  4YWM A;  1PA6 A;  1IBK L;  1Y1V G;  4GKK L;  2GVB A;  1IL2 A;  3AYH B;  1HNW L;  3GO5 A;  4JI2 Q;  1PH3 A;  2PQA A;  1HZA A;  2JA8 H;  3CME A;  1XPO A;  1KQS A;  2VL6 A;  3PV0 A;  3PSI A;  2D0P A;  2KEN A;  3UDG A;  3S15 H;  3AFP A;  2UXD L;  2WP8 J;  4JI5 Q;  4L5R C;  4LFA Q;  1CSP A;  2VS1 A;  3CQZ H;  4DV3 Q;  1VQ7 A;  4KHP Q;  1VQK A;  1N9W A;  1XNR L;  3CC7 A;  1PH7 A;  1JB7 A;  5IY0 A;  3RN2 A;  1M90 C;  4AYB E;  1YIJ A;  1IZ6 A;  3CXC A;  3CAM A;  3PUX A;  1SRU A;  2NN6 G;  2UXB L;  1IBM L;  2IY5 B;  4UP9 A;  4L5S A;  4DPG A;  1VQC A;  1YBY A;  3I4N H;  4KI0 A;  2VQE Q;  4DR3 Q;  2K5H A;  3L2P A;  4IOC A;  4JI4 Q;  1S72 A;  1N8R C;  1VQG A;  5C44 G;  2ATW A;  5IYD H;  1TWF H;  4HIO A;  3PIO A;  4IPC A;  4R4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...