1IHZA

Structure of s. nuclease mutant quintuple mutant v23l/v66l/i72l/i92l/v99l
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYLYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Proteins with simplified hydrophobic cores compared to other packing mutants.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ihzA00
4EQNA 1KDAA 1SYEA 4KJNA 4NMZA 3MVVA 3MZ5A 2EY2A 2F0IA 4DU9A 4HTHA 1STBA 3C1EA 5C4ZA 3P1HA 1AEXA 2F0KA 4KHVA 5KIXA 1RKNA 3D4WA 1EYDA 3DMUA 1A2UA 4K2LA 3QOLA 2PYKA 5J39A 1EZ8A 1NUCA 2PZWA 4KD4A 2F0VA 5HGTA 3C1FA 3ITPA 1U9RA 2F0QA 2RKSA 3D4DA 2SNSA 5EKLA 4KV6A 1STAA 1TQOA 5EKKA 2RDFA 4MIUA 3SXHA 4KY6A 3OMGA 4K8JA 4B9XA 2F0UA 1TR5A 5CV7A 3HEJA 2EYOA 3P75A 5C4HA 5CV9A 4F7XA 2NUCA 1F2MA 3TP6A 3NUCA 1SNQA 2F0DA 4WORA 1A3UA 2EY1A 4K5WA 4QMGA 1SYBA 4K2KA 1JOOA 5C3WA 4KY5A 1NSNS 3NXWA 5C3XA 1JORA 2EYLA 5E3FA 3ERQA 1STHA 3SK6A 3OSOA 1STNA 2O4XA 5CC4A 2F0PA 4KD3A 3NHHA 5E1FA 3E5SA 1EYAA 2EYHA 2F3WA 3BDCA 4N9PA 5IOCA 5IODA 2F3VA 2EY5A 2F0NA 3NQTA 4J6HA 3NK9A 4I65A 1SYFA 4NP5A 5ISRA 2EXZA 1SYCA 4E6IA 5IIFA 5IGFA 1EY0A 2F0FA 5CV4A 1EY8A 2F0JA 3D6CA 4K8IA 4KJOA 4ZQ3A 4EVOA 5I6YA 5J22A 2PW7A 1EQVA 5C5LA 3TP8A 2F0EA 4RKLA 1JOQA 5NUCA 3QOJA 1A2TA 1EY6A 2LKVA 2QDBA 3S9WA 1ENAA 1IHZA 2F0LA 4H7BA 1EY4A 3TMEA 3TP7A 5DEHA 1EZ6A 3V2TA 5CGKA 1EY5A 2SNMA 2OXPA 2KQ3A 4KY7A 4ME5A 5DAUA 2EYMA 2HQEA 1KAAA 2RBMA 2F0WA 1F2ZA 2PQEA 3SK5A 4DFAA 3HZXA 1SYDA 4G57A 3SHLA 1STYA 4IZ8A 4B9WA 5CV5A 4ZUIA 4ZUJA 3EROA 1SNMA 2F0TA 5M9OA 5KRUA 5I9OA 3SK4A 3R3OA 2OEOA 3U9OA 2M00A 1TT2A 4QF4A 4HMIA 3D8GA 2F0GA 2PW5A 5C6AA 1SNDA 5JAVA 4N9TA 4QB4A 5KEEA 2F0HA 4ODGA 3EVQA 1KABA 4F8MA 2OF1A 5F2DA 3T13A 3PMFA 4KTAA 3SR1A 5IGGA 4DGZA 1A3VA 1STGA 1SYGA 4OL7A 5HURA 4K5VA 4RKBA 2WACA 5IGBA 2F0SA 5CV8A 5I9PA 1EY7A 3OWFA 1SNCA 4PMBA 5C5MA 4IALA 5JOBA 5CR3A 5EGTA 4TRDA 4PNYA 4WRDA 1A3TA 2ENBA 4R8NA 1JOKA 1KDBA 2EYJA 2PZTA 4ID6A 5K5PA 4S3SA 3DHQA 3TP5A 5KGUA 4LAAA 4K6DA 2F0MA 4YIJA 1SNPA 3H6MA 1SNOA 5KYLA 2EYFA 3QB3A 5J1ZA 4EQPA 3OMCA 2SOBA 1EY9A 3MXPA 3NP8A 1II3A 2KHSA 4DF7A 2PZUA 5IGEA 3MEHA 4NDXA 5IGDA 1EYCA 3EJIA 4K5XA 3MHBA 1KDCA 4K14A 4J1MA 3SK8A 4PMCA 5IGCA 3BDLA 4HMJA 3T16A 3RUZA 4NKLA 2EY6A 3VA5A 2F0OA 5CV6A 4EQOA 4IUNA 1ENCA 5KYIA 3LX0A 2EYPA 5I6WA 1F2YA
chains in the Genus database with same CATH superfamily
4NMZA 3M7GA 1O7YA 1R4PB 2CH4W 2L12A 2WAQB 1NR4A 1K8MA 1WCMB 3ITPA 1U9RA 4JI5Q 2PPBC 5JVG3 3U50C 4H44C 1WTVA 2RDFA 1CA5A 4X62Q 3S24A 4O1NA 1HCZA 4UAIA 1F2MA 3S15H 1PH2A 4K2KA 4LJZC 1R9TB 5CBAE 1XPUA 3S1NH 4TQUS 5CBEE 1I94L 1RTOA 4C3IG 2WB1G 1VF5C 4X3UA 4A93G 2EXZA 4Q5VA 4XQJA 3H3VH 1B7YB 1K0RA 3RR5A 1PYSB 4L8JA 1VQGA 2ZXRA 1KAWA 4PG3A 1OXXK 4FF1A 1RHPA 1ET9A 1Q86C 1ILQA 3S9WA 3Q0AA 2JA8G 2K1BA 2CH4A 3R93A 4GOPB 1QZGA 2R93G 1IYJB 3FDTA 2RBMA 4CJ1B 3F2BA 3A8KE 3HZXA 3K7AH 1QJOA 4WJ4A 1EQRA 1KRTA 5IT9L 4ZUJA 5EPLA 5M9OA 2VY3A 5I9OA 2HUGA 2AUKA 2I07B 4GLAC 5KRUA 3OW7A 1HFGA 2KVMA 5DM63 4LFBQ 4HMIA 5EKIA 5JEAJ 3IFDA 3T13A 2EQSA 4PQXA 2A6HC 2ES2A 1Y1WB 4OL7A 1P8LA 4LF7L 1SNCA 4O0AA 4PMBA 1AE3A 4KHZA 2ALYB 3A8JE 4JC0A 2Z6BA 4FXDA 3CHBD 4DAYB 4JI1L 4LF4Q 2XNAC 3KF8B 4ZYSA 3AMUA 5JJKA 3F8TA 1BQQT 5JPNC 3PIO3 1LTGD 5JEAH 2JE6I 3SK8A 5BR8L 4XQNA 1KIXA 2Z1CA 4HR7B 2E2JH 1F9RA 1SBBB 1I50H 1A0IA 3J80L 4NKLA 2QEJC 5CV6A 2UUCQ 4C3HB 3HOZG 4ME3A 5I6WA 1PTOH 4HTHA 2GVBA 4CJ0B 3MVVA 2F0IA 4JOIA 4R4OA 1I94Q 3VR4A 2A6HD 3ZJYC 3VYTA 2KENA 2NVXH 3QJYA 4GKJL 4LUOA 1MI2A 3H3VC 3SXHA 1M1KC 4LWCA 1ENFA 3KOJA 1X56A 5C4HA 5LMNL 2PMZE 2EY1A 3PO3H 4IUTA 2ZJRA 3W2DA 1D5ZC 1S3OA 3UDIA 3S2HB 3NHHA 2F3WA 2PQAA 4J6HA 4CDDC 3OIPA 2L15A 4HN7A 4A76A 5KNBA 3K0XA 4LFAQ 5J22A 3F1ZA 1UAPA 2PW7A 5A2QL 1JWUD 3CCJA 4R4CA 1IZ6A 3S1RH 4A3IH 3QOJA 4V0BA 4H7BA 4IPDA 3MFGA 5AJ3L 3T1HQ 1TVXA 4LF7Q 2SNMA 2OXPA 3A54A 2ZM6L 2HDLA 3CU7A 4DR5L 2B2WC 4G57A 2IL8A 3MC0B 1BCPC 4U68A 4QUCA 2EJFC 2L11A 2OEOA 5C3EG 1VQAA 5IWAL 3M3YH 4DR2L 2N78A 2F0GA 4OWWB 3AB9A 2LY7A 3FRPB 4BBRH 3DWPA 1KABA 4JI7Q 1HZCA 1SYGA 1OXTA 2XGTA 3FEWX 4OIKA 2AKWB 4BY1B 3CC4A 5CV8A 2R92H 1LM0A 2Q8RE 2ZT9C 4JYAQ 2J0TD 3CPFA 5C4XH 1PTOC 1X55A 2F0MA 2G5DA 4YIJA 1RL2A 2J7ZA 4YCVA 1HTLD 1CFMA 1SFOH 1HFNA 1P16A 1V1PB 3NP8A 3GTPH 3MEHA 2JA5G 4J1MA 5C0XH 2DNCA 3N6RA 1QCBD 1BCPD 2YU9B 1C9OA 2K05A 5C44B 1FNUA 4A3CG 1LTRD 3HOVG 5EPJA 3FP9A 4CDFC 4DU9A 1G8ZD 1LLRD 1G2SA 2CWAA 3DMUA 1NTGA 2A5HA 2PYKA 1X3EA 3PUVA 3S17B 3PCOB 3DEPA 2RCNA 2NZOA 2RCFA 2A73B 5IYDH 1LV9A 1VQ9A 1TR5A 5CV7A 1YITA 4G4KA 1HZBA 2MJ8A 1PTOD 4WORA 4APVA 2Z8LA 1H9KA 4A75A 3G71A 2L0CA 3J81E 4X3KA 1SN8A 2ZM6Q 1JB7A 2JXMB 1YZ6A 3H94A 5IOCA 1PFSA 1D6EC 2R7FA 2KEEA 2ZTCA 3SVMA 4E6IA 2NWGA 2NTSA 3RNUA 4Y7NH 4C3JG 1ONLA 3PF5A 2IW3A 5FLMG 4GZYC 4KJOA 1KNEA 4A3BB 4DV2L 2OQKA 3S2DB 1VQJA 1DOMA 2XWBB 1E2ZA 2KCTA 5I2YA 1VQIA 4AYBE 3GTMB 1SAPA 2DN8A 2RQXA 3CRLC 2G9DA 1ENAA 1CKOA 4GKKL 1V43A 1PXUA 2K5WA 4KY7A 2K6AA 3HFZB 4RWSC 4JI4L 4NXMQ 2VUMB 4LNQA 2XWJB 1SYDA 3KBXA 3C46A 2J4XA 2A68C 1B1ZA 3EN2A 2E8GA 1U0LA 4CDCC 1I4RA 3HOXB 5FK9C 3NPPA 1E7ZA 1F77A 1F9QA 4YY3Q 1FNWA 1CA6A 4RHRA 1PRTC 2N88A 2AQ3B 3PMFA 4K0KQ 2IY5B 4DGZA 1XNQL 4OIJA 2F0SA 1EIGA 4ABNA 2JYOA 4IALA 4PNYA 3U4VA 3KFUA 1I6HH 2WV6D 2IHFA 4OONA 4DR7Q 1LUZA 1BR9A 4ZRZA 2RA4A 3GTKB 2A6EC 5M5YB 1D2BA 1Z7TA 4X6AH 1KXLA 1RTNA 4QQBX 1KNAA 1W3SA 3RN5A 1YHQA 3GQBA 2L1BA 2E5LL 2IX1A 3TS2A 4A3LH 2A68D 1FD7D 3VA5A 3G6EA 3VA7A 4YCWA 2E2DC 4LUZA 2KOLA 3OIQA 5M3FB 1PRTD 2OWOA 2RVLA 3M4OH 3D3RA 3I70A 4IPHA 5EKKA 4DV2Q 5G3LD 3HOZH 3KJPA 2EYOA 2NVYB 1BBUA 1FGUA 4DUYQ 2A1AA 4GNXB 4V190 2A6ED 3SGIA 2LSSA 3K58A 2PQAB 1FGBD 3QR8A 1N8RC 3NBIA 1K83H 1Y1VG 5M5WH 4JCVE 1N9WA 2R61A 3MWYW 4G7ZC 2FXQA 1SDFA 3EQLC 4K8IA 4AQYL 2KHIA 2VB3X 1YIJA 2QEXA 3M9BA 4NXNQ 2Y0SG 2JA7B 2LKVA 2L5TA 3TMEA 1HA5A 5IY0A 1LT6D 2B63B 4DAPA 4CKEA 3L7ZC 2CVRA 1N33L 1GXDC 2VB2X 1LT4D 3P20A 4MN3A 3R3OA 3D0FA 1JJGA 3CMEA 4C56C 2R7ZG 2F4VQ 4DV1L 1AN8A 3E3XA 1DOLA 1XPOA 3BDOA 4HCSA 1WFQA 4F8MA 2YTXA 4JI6Q 4K6LA 4HSPA 3VDYA 1SE8A 4RKBA 2B2WA 4YHHQ 3R2TA 1EY7A 2QGQA 1WCMG 4TRDA 1M90C 2PMZB 5C3EH 4O42A 4BY7B 2VQEL 1FJGQ 3GTGH 3GTQB 4ZK9B 1LTSD 2PCFB 2ZTDA 1DCZA 3BG3A 4GLVB 3MAQA 2LXKA 1QILA 4JW0A 3T1YQ 5IYCG 3FKIB 5IGEA 2VQFQ 4K14A 3GTJH 5IP7G 4DUZL 1NMGA 1QZHA 2KCCA 3U58A 2VS1A 3ER0A 4B08A 3K59A 3M4YA 2BE5C 3SDZA 1GUNA 4C2MH 3NQIA 2A69C 1QB5D 1STBA 4HSVA 4DA2A 1Z47A 1JT8A 1RKNA 1PV4A 3CD6A 1TWHH 2JA5H 5CORA 5JVH3 1X65A 1KL9A 3KLWA 1IW7C 3G6JB 4L5TA 1U4MA 3PUYA 4A3JB 3Q24A 4PZ8A 3P75A 2K5HA 2RHQB 1Y8PB 2F0DA 1X9NA 3CCMA 3KDFA 3CC2A 1X6OA 3K8AA 1VQCA 3ERQA 4KKTA 1STNA 2WKCA 5GQOA 3VR2A 3NQTA 4R4IA 2E2HB 3DWQA 2IX3A 4I65A 1Q90A 1IL8A 2UUAQ 1HNZL 2UXBL 4CJ2C 3TP8A 2BE5D 2EVBA 2A69D 3HGBA 1A2TA 5FO7B 4X64Q 5ISRA 4IFDG 2F0LA 1GUWA 1EQTA 2UUBL 4A3JH 4LF9Q 1LTLA 3GD7A 2K5VA 3AEVA 4C3JH 3RZOH 1T5EA 1IW7D 2VQEQ 4ZAIA 1G6ZA 5M5XB 4L6TB 1JMCA 4IJLA 5A35A 4L5QA 4JI5L 1O7IA 4OGQC 1DGSA 4A3EB 1EEFD 4QB4A 3HOUH 4X62L 1TWGB 4KTAA 1E24A 4GS3A 5EQ0A 3I3CA 2UXCQ 1UEAB 3I4NB 2I5HA 1MIUA 3F2CA 1A3TA 2EYJA 4LUVA 1H9SA 1EFID 1YNNC 4PMWA 1NMFA 2N8NA 3PF4A 2HDMA 3I4LA 3BS1A 1HJPA 4GN5A 4DR1Q 1H95A 5HY6A 3QB3A 1MGSA 3OMCA 1B44D 1AFPA 2KHSA 3OW2A 2PZUA 1PH4A 1EIHA 3BVMA 3CMAA 1HZ9A 1KDCA 4BS9A 1G2TA 1PYBA 3KJOA 4OELB 1FYCA 1Q1BA 1NNXA 3I4MH 4AYBB 4IUNA 1B2TA 3LX0A 1CZWA 1UNSA 4FF3A 2RDHA 1PZID 1TWFH 3GDEA 1UE1A 2PZWA 1NUCA 1TWCH 1C4QA 2FHTA 2RKSA 1WTRA 3S15B 4LFBL 1STAA 2KA7A 4KY6A 3CQZH 4OO1G 2MO1A 4M1UB 1YNND 3S1NB 4KKUA 1PH6A 1SNQA 3UE1A 2AQ1B 1I4HA 1SMXA 4BXXG 3NXWA 4QY7A 3VR6A 4B3TQ 4LF8Q 2B2UC 3U4ZA 1EWIA 1MBYA 1VQEA 1EL0A 2O4XA 2EYHA 3BZDB 2EDGA 4PZ7A 4LF4L 4DKAC 1CZGA 1QNUA 1PH5A 3CCEA 5IYBH 2V1CC 3I8ZA 4BY1G 2JA9A 1CM9A 3TZDA 4IJHA 3PGZA 1PA6A 2GVAA 1F9PA 1GUGA 1CHQD 5TSSA 2ZXPA 1G51A 2CKZB 2ZTEA 2FINB 4P74A 1EIYB 4RGOS 5DLQE 2Q2UA 1JQYD 5DEHA 2C35B 3K7AB 2UUCL 3T56B 2QDLA 1ZKOA 4R4TA 4TVAB 1TS4A 4ILWA 1B9MA 5LMUQ 2RSOA 4AH6A 1LTBD 2N49A 1CK1A 1ZXTA 1IXRA 1SNMA 1ICWA 1UE6A 4HEDA 3HG9A 2LMCB 2NN6I 3GTOH 2ICEC 1HQRD 1XTDA 1E1TA 2HCCA 1Y69U 2PW5A 3PQIA 4QIWE 3J7A5 5C44G 4BBSH 1BCPB 2P5ZX 1MHWC 4J15A 5EGTA 3NBHA 1Q1EA 4XT1B 1AZPA 4ALPA 1JOKA 1XNRQ 1VQOA 2R7ZH 2O2LD 3UDGA 2NBFA 1LTAD 5FO8B 2E2JB 2WINB 5J1ZA 4EQPA 3VYRA 1I50B 2SOBA 4EX5A 2OCEA 2K32A 1MD2D 3NE5B 4LFAL 5FLXE 2YV5A 3VR5A 1U5KA 2AUJD 4I7ZC 3CAMA 3HKZG 2KECA 1PTOB 4DXFA 3Q6SA 3IAYA 3T1HL 3TBIB 3HOYB 1U4RA 2NN6H 3IKJA 2O5JC 4A3FG 1HR0Q 1GUTA 5C4ZA 4JV5Q 4A3BG 4IUUA 2NVXB 1SE4A 3D4WA 4XYOA 1A2UA 5IT9c 5J39A 1RD9D 5IP7H 3R2IA 4UY8C 4DV3L 2Z4HA 2MQHA 4A4IA 3CXCA 5FKAC 1K73C 3PO3B 3K6OA 3HEJA 1O78A 1S5BD 3KDFB 4HIOA 2TMPA 4JI7L 1HR0W 2VUMG 4KHPQ 2R6GA 4HJAA 1ASYA 2JEBI 1HNXQ 2EYLA 1KHIA 1V8QA 1XJVA 1JWSD 4IFDI 1JJ2A 2H1EA 1PZKD 4JYAL 2EY5A 2F0NA 4IOAA 3HOYH 2VNUD 1N32Q 3S1RB 4A3IB 1E0BA 5CV4A 4IFDJ 2H4OA 1VDZA 1S5DD 5NUCA 3I7FA 4FYDA 2ICIA 4RCNA 3PIPA 3NWSA 1Q8KA 3CKIB 3J80c 2E75C 5JJZA 1E3PA 1EY5A 1Q12A 3NWTA 3D31A 4GNXA 5JJIA 3M3YB 2FMCA 3BZCA 4JBKA 1XTCD 4BBRB 2X69A 4HJ7A 1PH3A 1L0YB 2C5CA 1BDOA 3KLRA 4IFDH 3RLOA 3H15A 4A3KG 2LXJA 2WP8J 3DWAA 2QA4A 3AFQA 2R92B 4XQQA 3G4SA 3EVQA 3I73A 5F2DA 4KMUC 1TKWB 4DAMA 3GO5A 4A3MG 1A3VA 1PMRA 2QW7A 1TU2B 1I4PA 1CKNA 5C4XB 1TXYA 1H9SB 1DD2A 5JOBA 2Z6KC 2B29A 3J81L 1KDBA 1EIFA 1S40A 1SFOB 1G91A 1PRTB 1U4PA 3DHQA 4NPSA 3GTPB 4A3DG 4LAAA 3A7LA 2V4DA 3ERSX 3K5NA 4AIMA 1YBYA 4DV3Q 1SSOA 1SRUA 1B3QA 2JA6H 3JAMi 1C48A 2F03A 1Q3LA 3Q23A 3OTOL 1IKMA 1QWYA 4OO1I 2B8GA 3F2UA 4J8QA 2EYPA 1HRJA 1B53A 2NZHA 3RN2A 3ULLA 3MZ5A 4NXML 4G7HC 4P75A 3L2PA 4FF4A 3QOLA 1QUQA 1QOHA 2F0VA 5HGTA 3MXNA 1CKMA 2D9UA 1K28A 4YY3L 3U9SA 3T4AC 1DM0B 2EPBA 1SJHD 2M2LA 1UE5A 3M4PA 1V1OA 4FP5D 4K0KL 2UU9Q 4QMGA 1D1KA 3H09A 3HOWH 5C3WA 5KNCA 5C3XA 1MKHA 2E76C 4B3MQ 4FVMA 4Y7NB 2B3GA 4DR7L 1HNWQ 4RGTA 1WTOA 1J5EQ 3DUZA 1SYFA 4C1NI 4OO1H 5IIFA 4L63B 2MPMA 5IGFA 1IBLQ 3CCSA 1EY0A 5T1GA 5M3MH 4BXXH 2WB1B 4JG2A 5C4JH 4C1NK 3KUPA 2B2UA 1EWHA 5ELBA 2BA1A 4G7OC 3TP7A 1IHZA 1K3BC 3V2TA 1VF7A 3GV6A 1S4ZA 1QG7A 2RHSB 1L1OC 1KRSA 4IO9A 1U4LA 1BUVT 2QILA 1PH9A 3EROA 5LMNW 2K52A 4ULLA 3FPUB 4HIKA 5KEEA 3NTIA 3OTOQ 4A3GG 1I6HB 2IT1A 1VQBA 4DUYL 1HA6A 1PZJD 3NBHB 4C3IH 1YEZA 2CCZA 1NR2A 4DV4L 4MTNA 3MTSA 1JC7A 4A93H 5GAEC 3TRZA 2MUYA 4DR3Q 1VQ8A 1I6VC 1AH9A 3OPOA 1SE2A 3H0GG 4HIMA 1LO5D 2M9VA 1ESFA 2BDOA 1WYDA 2XRSD 3A74A 1XMOL 1EY9A 1PYWD 2JA8H 1TY2A 3RLFA 1G6PA 2AMCB 3EBEA 1LACA 4NXNL 3PUWA 1FNVA 2R93H 1KLGD 4R4QA 1DJRD 2Y0SE 4XT3B 2EY6A 2WACA 3PIP3 3M4OB 4BA1I 5IP9G 1OXSC 1Q8IA 3HOZB 3TREA 1LABA 1BBXC 2F52A 3OYYA 2F4VL 4K8JA 5LL6X 3CP0A 4B9XA 4JI6L 4RFBA 2CQAA 4LF5Q 1ESRA 1K83B 4QIWB 3FVQA 4YHHL 5M5WB 4L5SA 2C9OA 1STHA 3SE0A 1E1OA 1VQKA 2DNEA 1FJGL 4N9PA 4QL5A 4A3EG 4FXGC 1JCKB 3T1YL 3S1MH 2NZ1D 2OT2A 5C5LA 2VQFL 3S14H 4WFN3 1JOQA 4B3SQ 1SR3A 1AE2A 4R8IA 3K5MA 2YYZA 4DV0Q 4DV4Q 2B2YC 4DAVA 5EPKA 1LT3D 4IN3A 1BF4A 1HH2P 4DFAA 4M8AA 4KKSA 2XRQD 3PO2G 2NVQH 3K5OA 1VQNA 1YI2A 4YWLA 2HT1A 1XMOQ 4AYBG 2EJGC 2WKDA 1CKNB 3PSIA 3J81j 4L5RC 2OF1A 5C3EB 4K5VA 4RA8A 1NBWA 2ZJQA 3GTGB 3BYYB 1KTKA 2MHVA 4IUVA 5IGBA 1I3QH 4HJ9A 4OX9Q 1SXTA 1IBMQ 5C5MA 1MJCA 1N36Q 3RD4A 1QVCA 3PUXA 4RCOA 1EOVA 4A3KH 4ID6A 1VQFA 3T53B 4F88A 2BH8A 3DXJC 1T5XD 1OO9B 5BN5A 3GTJB 1Y8NB 2RDGA 4A3MH 2UUAL 4WJ3M 1PHJA 2A8VA 2XN9C 4NDXA 1IBKQ 2NTTA 5ELEA 5IGCA 4C2MB 4X64L 1K3RA 1FR3A 3D6WA 1DZ1A 2Q8IB 1J8IA 4LF9L 1TWHB 5KYIA 2JA5B 1CSQA 2WAQG 2E2IH 2KCMA 1KDAA 1QUQB 5E7NA 4DR6L 2ASBA 3C1EA 3WDNA 1GM5A 4IPGA 1Q46A 3MXNB 2JP1A 1RDPD 2B8FA 4B3RQ 2E74C 1RIPA 2IX0A 2XTIA 2FMMA 3E0EA 3VYSA 4CGYB 2EXDA 3OMGA 3A5ZB 2K7VA 2NUCA 1YHBA 1JR0D 1ZYRC 2B2VC 4I7AA 4K5WA 2JEAI 2UXCL 5DNFA 3KF6A 1S5CD 3NSWA 4P72A 1JE4A 1GVPA 3SK6A 1XYIA 2HQLA 4LW1A 3J81i 3E5SA 1EYAA 4JVZA 1E22A 4XDXA 3TEHB 4FO2A 4DNRB 1I4GA 3J7YW 4UHVA 4DR1L 2MGSA 4CKCA 1TWAH 3J7ZC 1X3PA 1WI5A 4HJ8A 1JE5A 5I6YA 2R3ZA 5ELNA 1XPRA 4RKLA 5G3LF 2EZVA 4C3JB 3RZDH 4A3CH 3RZOB 3HOVH 5J3BA 2AWOA 4DV6Q 1WTWA 2KQ3A 2KHJA 2L55A 1C0AA 4X3SA 2B39A 3KLSX 1SJED 1SLJA 4LK1C 3HOUB 1ZYRD 3HRZC 4NW2A 1LYLA 1JJCB 4LFCQ 1Y1WG 3WWVA 4BA2I 4DV7Q 4DXGA 3I91A 4QF4A 4X3TA 3M4QA 1LTID 3JAML 2XSCA 4ZKBB 1L1OA 2EJMA 2KBNA 1STGA 2Q8TA 5HGQA 2K04A 3QG1A 4B3TL 4LF8L 4JI8L 2I46A 4BWGB 1B8AA 4GN3B 4DR6Q 5FLMH 3P7JA 5D14A 2AQ2B 4K6DA 1F9SA 4A3GH 4RHSA 4DR4Q 4P73A 3JAMc 1II3A 4DF7A 3I4MB 4N8X1 4C3HG 1G291 3S1QH 1TWFB 1A62A 2O5IC 2F0OA 3H0GH 4HAEA 2HIVA 1H9JA 5LMUL 1TWCB 1BNZA 2D2CC 2EY2A 3AFPA 2HHHQ 1GJXA 3R8BA 3PIOA 4K2LA 1LTTD 4QCLA 4KD4A 2WB1E 3CQZB 3TDQA 3I56A 2SNSA 1N34Q 1TQOA 3A7AB 3JC66 1KC8C 1L2FA 1GO3E 1TIID 1WTQA 1GD7A 4POFA 4EGVA 1A3UA 4PZ6A 3UDFA 3URYA 3HP3A 1A15A 1OXUA 5CMDA 3FPPA 1XNRL 3M7NA 5GAGC 2R92G 1VQPA 4H02A 2L4NA 1VQ5A 5E4WC 1CSPA 3TSSA 1X3GA 5FLXL 1DONA 4ZKCB 3HKZE 4OXPA 2A19A 1IL2A 4OWTB 2EIFA 1DOKA 1LT5D 3K0YA 4H13C 4H0LC 1JWMD 5C0XG 2Y0SB 4JI8Q 1HXYD 1HR0L 1CUKA 1KAAA 1CI3M 1F2ZA 1GHJA 2D0OA 2D62A 2F0WA 1EOTA 5DM73 3GTOB 4JV5L 4XYQA 3SHLA 1JICA 2F1MA 3TS0A 2D5DA 5CV5A 4BBSB 1VQ7A 3TN2A 3U9OA 3A8IE 1ILPA 1UEBA 2JQOA 1RCVD 3GTLH 3B6YA 4ODGA 1ASZA 1V1QA 2LS01 4IUQA 2B2YA 3VYUA 5HURA 4HJ5A 2ID0A 5IYDG 3I55A 4KHPL 2R7ZB 1Y1VH 2RF4A 2NYZD 2AHOB 3OWFA 3PO2H 1HNXL 3BU2A 1VQ6A 5KNDA 2K33A 2QF7A 2NVTH 1XXGA 2PZTA 2PO4A 1XMQQ 1CHPD 5KGUA 5I2XA 1GUSA 1N32L 4X65Q 4KLKA 5KYLA 1TS2A 4XIGS 4JI0Q 3J7AV 1SE3A 3UDXA 1MJEA 2YTYA 5CYUA 3KLSA 1S5FD 3SEBA 4UP9A 1B70B 2FFKB 2WIIB 1RODA 1TS3A 2ZJPA 5L37A 1I4XA 4EQNA 4KJNA 2CWPA 3P1HA 1IYUA 3IRBA 1WTXA 1EYDA 1EZ8A 5COYA 2CW0C 4KV6A 3RLNA 1IKLA 4MIUA 3I90A 1DXMA 2F0UA 3KF6B 1WCMH 1J9OA 3QWNA 5CV9A 4F7XA 4F87A 1Y8OB 5GAHC 4ZLTF 4DV5L 1A6XA 5JJLA 4KD3A 1VQLA 2AWNA 2K75A 1RF2D 4MZ9A 5IYCH 2F3VA 3NTHA 1R9TH 4MNOA 1VS0A 2Q2IA 2A74C 4LF6Q 2BH2A 4KN7C 2F0FA 1EY8A 2B2VA 4CKBA 1EU4A 4ZQ3A 1EYGA 2PNHA 1PFMA 1QVGA 1T9HA 1BOSA 3A5UA 1R4QB 2L9HA 4GN4B 1BO0A 1UUPA 4GLXA 4IUPA 4UPAA 4YWMA 5IE8A 2CW0D 4FNFA 4A3LG 3HOXG 4DK3C 3ULPA 3L3OC 3LWEA 3KK7A 1BVSA 2Z4IA 1TT2A 1L1OB 3GV3A 3D8GA 1Q81C 2SEBD 4N9TA 2PI2E 2MO0A 4UP8A 4EQ5A 5IGGA 4XXEA 4X66L 2OTLA 2UU9L 1D1IA 4JK1C 1AZQA 3BJUA 3MXGA 4XTCS 3ICEA 5K36G 3BVGA 4B3ML 1NAPA 1Y1WH 2KJXA 2JA6B 5K5PA 1HNWL 1J5EL 1D5MC 3WOFA 1IBLL 3CPWA 3M85A 3UE0A 3BZKA 1EYCA 2I0QA 4PMCA 1DYQA 3DLLA 4Y52H 4FF2A 3C2PA 2N3SA 5M3FG 4QGUA 1PFNA 1WVLA 1ENCA 3K7UC 2K4KA 2QCPX 4DV5Q 1XX8A 5IT9E 3W1BA 2XVSA 5KIXA 1O7ZA 4C3HH 3ND9A 1ZEQX 3CCQA 4LMQD 1EQQA 3D4DA 1L0WA 3HOWB 2KEDA 5FJ8G 4JBWA 1HPCA 1YVCA 3MFYA 1V9PA 1I4QA 1X54A 1SYBA 1JOOA 1IYVA 1FL0A 1K0SA 4IOCA 5E3FA 2X6GA 2PI2A 2MP1A 1ET6A 5EBCA 3J81c 4DR3L 2VZAA 3V05A 5IODA 5M3MB 4JI1Q 4U673 5C0XI 1C8CA 5C4JB 1HUNA 5ELFA 2F3IA 1SYCA 4YCUA 3CCVA 2JA7G 3S2HH 4JPBW 4GOPC 2F0JA 2ZXOA 4JI3L 4NB3A 1PLFA 2B63G 2DY7A 5C0XJ 5BR8Q 3J80E 3CRKC 2QDBA 4X66Q 4QUFA 3E9HA 4WJWA 4ME5A 5H1SE 1GOZA 4HCEA 2PQEA 2VL6A 3MA2B 1STYA 1WD1A 2IPKD 2F0TA 4DK1A 3VR3A 3G7LA 1Y14B 1O80A 4GKJQ 3HS0C 3IFTA 4C3IB 5C6AA 1W2BA 3L9AX 4A93B 3SR1A 5LMNQ 1Z9FA 4LF5L 5ELCA 3UI2A 1K8AC 4BY7G 4ZCKA 5LHY1 3LNNA 2DJGC 5BN3A 1D5XC 3FKIG 4BY1H 2JA8B 2GN5A 4DNTB 1B50A 2UXDL 2FJ2A 1SNPA 5A2QE 3I72A 1BXTA 2R93B 3F2DA 3FMCA 3N52A 4RMFA 2OQ0A 3CC7A 1ICFB 3CF5A 4R1JA 2H5XA 3C3LA 1B9NA 3V96A 4B3SL 3GP7A 2I5MX 2B2TC 4R9WA 3RUZA 1WTHA 5AJ3Q 5JPMC 4KN4C 1VCIA 4DV0L 3HKZB 4DR5Q 1SYEA 5BN4A 2YU9H 1A63A 1B4OA 3A55A 4A3JG 2D0PA 3OHXC 5C44H 3BYTB 4A3FB 3C1FA 1XWEA 5IWAQ 1D8LA 2K01A 4DR2Q 5EKLA 4JI3Q 3MEFA 3NELA 3S17H 3E9IA 3NUCA 3TP6A 4CBVA 2JK8A 4RAUC 4OX9L 1YNXA 4KY5A 3WOEA 3HOUG 1IBML 1JORA 1YJWA 1N36L 4FXKC 3OSOA 1WTPA 2F0PA 4Q0FA 3S1MB 1AP0A 4OHJA 4UDUC 1EUJA 2NB0A 3S14B 4JI2L 2K50A 1RJTA 1ML0D 2MFIA 2F0EA 3K57A 1IBKL 2IHEA 3D4RA 4A3FH 3QO2A 1EY6A 2EOTA 3T51B 4A3BH 3S2DH 2Z9HA 2NVQB 1BCPF 3GTMH 3H91A 2WAQE 1MSGA 4PV1C 4OWXB 3I4MG 2TSSA 5T1IA 5D3IB 4B9WA 2JJQA 3A0JA 2UXDQ 1Q7YC 3CCUA 4B3RL 2M00A 2VUMH 1BKBA 1K8OA 1I3QB 1KD1C 4RGMA 4DK6C 2F0HA 4IQZA 3I4NG 3Q8DA 3DEOA 2OTJA 3HOXH 4A3KB 3KYHC 1PTOF 5I9PA 1OXVA 3BVZA 4A3MB 3E6ZX 4WRDA 2ENBA 1YHAA 3E0JA 2CQOA 3RMHA 1KLUD 1HTPA 2BOSA 1PFBA 4JBMA 3EIVA 2HIXA 3TP5A 3H6MA 1SNOA 2GA4B 1E2WA 2EYFA 3LGJA 3MXPA 1S72A 1GHKA 4A3DB 2YTVA 3GTKH 3EJIA 1W6JA 5K36H 5M5YH 1SEBD 2E2IB 4RG1A 5IYBG 3BDLA 4HMJA 4DNIA 1STEA 4DV6L 4GKKQ 5D3DA 1SROA 2DY8A 4JI4Q 3A56A 3PUZA 4OEMB 2F0KA 5EJWA 1J6QA 3J7AF 2DUDA 3PV0A 5GROA 4LFCL 4JI2Q 1H9RA 1QVFA 3X3NA 4DV7L 1M4VA 5M3FH 2ATWA 2RSNA 3AQQA 3AYHB 5AFWA 3NTKA 4QJFA 1XNQQ 3J80i 3STBC 2Z6KA 1NSNS 3W3AA 2JN4A 4A3DH 4BBSG 2NVYH 5CC4A 2PNRC 5E1FA 1TWAB 4UP7A 5FJ8H 3NK9A 2Z0SA 4NP5A 1CQFA 1YJNA 4DR4L 3RZDB 3HOVB 1PH7A 3FHWA 4CHTB 2KCNA 2F4IA 5EAYA 1CQVA 3NEMA 2E5LQ 2VXWA 4DN4M 3S16B 2LFNA 3CCLA 5CGKA 5FO9B 2I5LX 1X3FA 4DPGA 4DK0A 1YNJC 5DAUA 2HD3A 2JA7H 2IJ0A 2HQEA 1L0XB 1PDQA 1WJJA 3W1GA 2HHHL 4GOPA 4CDEC 1K8GA 2NN6G 3L0OA 2B63H 4IURA 1PRTF 3STBD 1PVOA 1N34L 3OWEB 5JAVA 1AW7A 1Z6HA 2N55A 5D65A 4TSSA 3TQYA 3TZUA 4P2CB 3ONAB 4KK7A 5JEAG 5E4XA 1QE6A 3OOCA 1K9MC 5CR3A 3I4OA 4A3GB 1NE3A 3CCRA 1EWCA 4R8NA 1S5ED 1OTCA 1UE7A 1VQ4A 3CW2C 2K28A 3KBGA 3S16H 4IPCA 3S1QB 4DAYA 4BY7H 4JOIC 4YWKA 3K80C 3MXUA 4HIDA 4AQYQ 3GTQH 3KF8A 3HOYG 1YNJD 4TKOB 3H0GB 3AU7A 3I2ZA 1D7QA 3T16A 3FKIH 1VMCA 3Q22A 4EQOA 2R7DA 3NENA 4RH6A 3W5OA 2DJFC 1AEXA 4KHVA 1N33Q 1QNKA 3PO3G 2K5NA 2X6LA 4GNXC 1TY0A 1B3AA 2MNAA 2K14A 2CFMA 2F0QA 3QIAA 2JSOA 2EE1A 2B2TA 4DV1Q 1Q82C 3HKSA 1GUOA 1I5FA 1VQDA 1UWVA 4Z9CB 1NY4A 1WD0A 1PH8A 1WOCA 1C7YA 4A3IG 3BDCA 4MHEA 1XMQL 1H9MA 4JBJA 3ZYYX 1W6KA 4X65L 2BA0A 3D6CA 4JI0L 2E2HH 4EVOA 1EQVA 1F2LA 1A8VA 2XIWA 1HHVA 1SMYC 1CT1D 1EEID 3O13A 3EA6A 4DUZQ 3K81C 5EBDA 2JA6G 1O7LA 1EY4A 5IP9H 1EZ6A 2G9HD 2Q2HA 2SDFA 1HZAA 4BBRG 1PH1A 2Q2TA 2DGYA 2IWHA 1JB3A 2EYMA 5FOBB 3SK5A 1X3QA 5ELOA 4RGNA 4IZ8A 3GTLB 3DM3A 4FDBA 4ZUIA 3EFXD 3SK4A 3IL8A 2QKIC 4O2DA 1HQMC 1X32A 1Y1VB 2WFWA 5C4XG 1BBWA 4KI0A 1VQMA 1SNDA 2HCIA 5M5XH 1VMPA 3PO2B 3LWUA 1YJ9A 1M8AA 2CHBD 2VW9A 2NVTB 1VQHA 4A3EH 1E2VA 3X3MA 1MSHA 1EFWA 1GKHA 1TWGH 5ELDA 1HUMA 3ULJA 5I4DA 4POGA 3HOWG 2BDNA 4S3SA 3ND8A 3I4NH 1SMYD 1KQSA 4MTKA 4LF6L 3JAME 1HNZQ 2K5DA 2UXBQ 4P71A 1EU3A 2BCOA 5IGDA 1TS5A 4K5XA 3MHBA 4N8FA 1CTMA 1NCVA 5FLXc 1NJIC 1V1PA 3G48A 3DM1A 5GADC 5M3MG 2K5QA 3K5LA 2UUBQ 2K03A 3H3VI 5LL6S 1FVIA 2KUMA 1F2YA
chains in the Genus database with same CATH topology
4NMZA 3M7GA 1O7YA 1R4PB 2L12A 2WAQB 1NR4A 1K8MA 1WCMB 3ITPA 1U9RA 2PPBC 5JVG3 4H44C 1WTVA 2RDFA 1CA5A 4O1NA 1HCZA 4UAIA 1F2MA 4K2KA 4LJZC 1R9TB 5CBAE 4TQUS 5CBEE 1RTOA 4C3IG 1VF5C 4X3UA 2EXZA 4Q5VA 4XQJA 4L8JA 2ZXRA 4FF1A 1OXXK 1RHPA 1ET9A 1ILQA 3S9WA 3Q0AA 2K1BA 3R93A 3FDTA 2RBMA 4CJ1B 3A8KE 3HZXA 1QJOA 5IT9L 4ZUJA 5EPLA 5M9OA 5KRUA 5I9OA 2HUGA 2AUKA 2I07B 3OW7A 1HFGA 2KVMA 5DM63 4HMIA 5EKIA 5JEAJ 3IFDA 3T13A 4PQXA 2A6HC 1Y1WB 4OL7A 1SNCA 4PMBA 4KHZA 3A8JE 4FXDA 3CHBD 2XNAC 4ZYSA 3AMUA 1BQQT 5JPNC 3PIO3 1LTGD 5JEAH 2JE6I 3SK8A 4XQNA 2Z1CA 4HR7B 1F9RA 1SBBB 3J80L 4NKLA 2QEJC 5CV6A 4C3HB 5I6WA 1PTOH 4HTHA 4CJ0B 3MVVA 2F0IA 3VR4A 2A6HD 3VYTA 3QJYA 1MI2A 3H3VC 3SXHA 1ENFA 5C4HA 2EY1A 4IUTA 3W2DA 1D5ZC 3S2HB 3NHHA 2F3WA 4J6HA 3OIPA 4HN7A 5KNBA 5J22A 5A2QL 1UAPA 2PW7A 1JWUD 3QOJA 4V0BA 4H7BA 3MFGA 1TVXA 2SNMA 2OXPA 3A54A 2HDLA 3CU7A 2B2WC 4G57A 2IL8A 3MC0B 1BCPC 4U68A 4QUCA 2EJFC 2L11A 2OEOA 2F0GA 3AB9A 2LY7A 3FRPB 3DWPA 1KABA 1SYGA 1OXTA 3FEWX 4OIKA 4BY1B 5CV8A 2Q8RE 2ZT9C 2J0TD 1PTOC 2F0MA 4YIJA 2J7ZA 1HTLD 1CFMA 1HFNA 1V1PB 3NP8A 3MEHA 4J1MA 5C0XH 2DNCA 3N6RA 1QCBD 1BCPD 2YU9B 2K05A 5C44B 1FNUA 1LTRD 5EPJA 4DU9A 1G8ZD 1LLRD 1G2SA 3DMUA 2A5HA 2PYKA 3PUVA 3S17B 3DEPA 2A73B 1LV9A 1TR5A 5CV7A 4G4KA 2MJ8A 1PTOD 4WORA 2Z8LA 1H9KA 2L0CA 3J81E 4X3KA 2JXMB 3H94A 5IOCA 1D6EC 2KEEA 3SVMA 4E6IA 2NWGA 2NTSA 4C3JG 1ONLA 4GZYC 2IW3A 4KJOA 1KNEA 4A3BB 3S2DB 1DOMA 2XWBB 1E2ZA 3GTMB 5I2YA 1SAPA 2DN8A 2RQXA 3CRLC 2G9DA 1ENAA 1V43A 1PXUA 2K5WA 4KY7A 2K6AA 4RWSC 2VUMB 2XWJB 1SYDA 3KBXA 3C46A 2J4XA 2A68C 1B1ZA 1I4RA 3HOXB 5FK9C 3NPPA 1F77A 1F9QA 1FNWA 1CA6A 4RHRA 1PRTC 2N88A 2AQ3B 3PMFA 4DGZA 4OIJA 2F0SA 1EIGA 4ABNA 2JYOA 4IALA 4PNYA 2WV6D 1BR9A 4ZRZA 2RA4A 3GTKB 2A6EC 5M5YB 1D2BA 1Z7TA 1RTNA 1KNAA 3GQBA 2L1BA 2IX1A 2A68D 1FD7D 3VA5A 3VA7A 2E2DC 2KOLA 3OIQA 5M3FB 1PRTD 2RVLA 3D3RA 3I70A 5EKKA 5G3LD 2EYOA 2NVYB 4V190 2A6ED 3K58A 1FGBD 3NBIA 4G7ZC 2R61A 3MWYW 1SDFA 3EQLC 4K8IA 2VB3X 2JA7B 2LKVA 2L5TA 3TMEA 1HA5A 1LT6D 2B63B 4DAPA 4CKEA 3L7ZC 2CVRA 1GXDC 2VB2X 1LT4D 3P20A 4MN3A 3R3OA 4C56C 1AN8A 1DOLA 3BDOA 4HCSA 4F8MA 4K6LA 4HSPA 4RKBA 2B2WA 3R2TA 1EY7A 4TRDA 2PMZB 4O42A 4BY7B 3GTQB 4ZK9B 1LTSD 2PCFB 1DCZA 3BG3A 3MAQA 1QILA 3FKIB 5IGEA 4K14A 2KCCA 4B08A 3K59A 3M4YA 2BE5C 3SDZA 1GUNA 3NQIA 2A69C 1QB5D 1STBA 4HSVA 4DA2A 1Z47A 1RKNA 5CORA 5JVH3 1IW7C 3G6JB 1U4MA 3PUYA 4A3JB 3Q24A 3P75A 1Y8PB 2F0DA 3ERQA 4KKTA 1STNA 2WKCA 3VR2A 3NQTA 2E2HB 3DWQA 2IX3A 4I65A 1Q90A 1IL8A 4CJ2C 3TP8A 2BE5D 2EVBA 2A69D 3HGBA 1A2TA 5FO7B 5ISRA 4IFDG 2F0LA 1GUWA 1EQTA 3GD7A 1T5EA 1IW7D 4ZAIA 1G6ZA 5M5XB 4L6TB 5A35A 4OGQC 4A3EB 1EEFD 4QB4A 1TWGB 4KTAA 5EQ0A 3I3CA 1UEAB 3I4NB 1A3TA 2EYJA 1H9SA 1EFID 1YNNC 4PMWA 2HDMA 3I4LA 3BS1A 3QB3A 1MGSA 3OMCA 1B44D 1AFPA 2KHSA 2PZUA 1EIHA 3BVMA 1KDCA 4BS9A 1G2TA 1FYCA 1Q1BA 4AYBB 4IUNA 1B2TA 3LX0A 1CZWA 1UNSA 4FF3A 2RDHA 1PZID 2PZWA 1NUCA 1C4QA 2FHTA 2RKSA 1WTRA 3S15B 1STAA 2KA7A 4KY6A 4OO1G 4M1UB 1YNND 3S1NB 4KKUA 1SNQA 2AQ1B 1I4HA 3NXWA 3VR6A 2B2UC 1MBYA 1EL0A 2O4XA 2EYHA 3BZDB 2EDGA 1CZGA 1QNUA 3I8ZA 3TZDA 1CM9A 1F9PA 1GUGA 1CHQD 5TSSA 2ZXPA 2FINB 4RGOS 1JQYD 5DEHA 3K7AB 3T56B 1ZKOA 1TS4A 4ILWA 1B9MA 2RSOA 1LTBD 1CK1A 1ZXTA 1SNMA 1ICWA 4HEDA 3HG9A 2LMCB 2NN6I 2ICEC 1HQRD 1Y69U 2HCCA 2PW5A 1BCPB 5EGTA 3NBHA 1Q1EA 4XT1B 1AZPA 1JOKA 2O2LD 2NBFA 1LTAD 5FO8B 2E2JB 2WINB 5J1ZA 4EQPA 3VYRA 1I50B 2SOBA 2K32A 1MD2D 3NE5B 5FLXE 3VR5A 2AUJD 4I7ZC 2KECA 1PTOB 4DXFA 3Q6SA 3IAYA 3HOYB 3TBIB 1U4RA 2NN6H 3IKJA 2O5JC 1GUTA 5C4ZA 2NVXB 4IUUA 1SE4A 3D4WA 4XYOA 1A2UA 5J39A 1RD9D 3R2IA 2Z4HA 5FKAC 3PO3B 3K6OA 3HEJA 1O78A 1S5BD 2TMPA 2R6GA 2JEBI 2EYLA 1V8QA 4IFDI 1JWSD 2H1EA 1PZKD 2EY5A 2F0NA 2VNUD 3S1RB 4A3IB 1E0BA 5CV4A 4IFDJ 2H4OA 1VDZA 1S5DD 5NUCA 4FYDA 2ICIA 4RCNA 3NWSA 3CKIB 2E75C 5JJZA 1EY5A 1Q12A 3NWTA 3D31A 3M3YB 2FMCA 1XTCD 4BBRB 2X69A 1L0YB 2C5CA 1BDOA 3KLRA 4IFDH 3DWAA 2WP8J 2R92B 4XQQA 3EVQA 3I73A 5F2DA 4KMUC 1TKWB 3GO5A 1A3VA 1PMRA 1TU2B 1I4PA 5C4XB 1H9SB 1DD2A 5JOBA 3J81L 1KDBA 1SFOB 1G91A 1PRTB 1U4PA 3DHQA 3GTPB 4LAAA 3A7LA 2V4DA 3K5NA 1SSOA 1C48A 2F03A 1Q3LA 3Q23A 1IKMA 1QWYA 4OO1I 2B8GA 3F2UA 4J8QA 2EYPA 1HRJA 1B53A 3MZ5A 4G7HC 4FF4A 3QOLA 1QOHA 2F0VA 5HGTA 3MXNA 2D9UA 3U9SA 3T4AC 1DM0B 2EPBA 1SJHD 2M2LA 1V1OA 4FP5D 4QMGA 1D1KA 3H09A 5C3WA 5KNCA 5C3XA 2E76C 4FVMA 4Y7NB 4RGTA 1WTOA 3DUZA 1SYFA 4C1NI 4OO1H 5IIFA 4L63B 2MPMA 5IGFA 1EY0A 5T1GA 2WB1B 4C1NK 2B2UA 3KUPA 1EWHA 5ELBA 2BA1A 4G7OC 3TP7A 1IHZA 3V2TA 1VF7A 3GV6A 1S4ZA 1QG7A 1U4LA 1BUVT 2QILA 3EROA 4ULLA 3FPUB 5KEEA 3NTIA 1I6HB 2IT1A 1HA6A 1PZJD 1NR2A 3MTSA 1JC7A 2MUYA 1I6VC 3OPOA 1SE2A 1LO5D 2M9VA 1ESFA 2BDOA 2XRSD 1EY9A 1PYWD 1TY2A 3RLFA 1LACA 3PUWA 1FNVA 1KLGD 1DJRD 4XT3B 2EY6A 2WACA 3PIP3 3M4OB 4BA1I 1OXSC 1Q8IA 3HOZB 1LABA 1BBXC 4K8JA 5LL6X 4B9XA 4RFBA 2CQAA 1ESRA 1K83B 4QIWB 3FVQA 5M5WB 2C9OA 1STHA 3SE0A 2DNEA 4N9PA 4FXGC 1JCKB 2NZ1D 2OT2A 5C5LA 4WFN3 1JOQA 4R8IA 3K5MA 2YYZA 2B2YC 4DAVA 5EPKA 1LT3D 4IN3A 1BF4A 4DFAA 4M8AA 4KKSA 2XRQD 3K5OA 2EJGC 2WKDA 2OF1A 5C3EB 4K5VA 4RA8A 3GTGB 3BYYB 1KTKA 2MHVA 4IUVA 5IGBA 1SXTA 5C5MA 3RD4A 3PUXA 4RCOA 4ID6A 3T53B 4F88A 3DXJC 1T5XD 1OO9B 5BN5A 3GTJB 1Y8NB 2RDGA 2XN9C 4NDXA 2NTTA 5ELEA 5IGCA 4C2MB 1FR3A 3D6WA 1DZ1A 2Q8IB 1J8IA 1TWHB 5KYIA 2JA5B 1KDAA 3C1EA 3WDNA 2JP1A 1RDPD 2B8FA 2E74C 2IX0A 2FMMA 3VYSA 4CGYB 3OMGA 2K7VA 2NUCA 1JR0D 1ZYRC 2B2VC 4K5WA 2JEAI 5DNFA 1S5CD 3NSWA 1JE4A 3SK6A 1XYIA 3E5SA 1EYAA 4XDXA 4FO2A 4DNRB 1I4GA 3J7YW 2MGSA 4CKCA 1X3PA 5I6YA 2R3ZA 4RKLA 5G3LF 2EZVA 4C3JB 3RZOB 2AWOA 1WTWA 2KQ3A 2L55A 4X3SA 2B39A 3KLSX 1SJED 4LK1C 3HOUB 1ZYRD 3HRZC 4NW2A 4BA2I 4DXGA 3I91A 4QF4A 4X3TA 1LTID 3JAML 2XSCA 4ZKBB 2EJMA 1STGA 2Q8TA 2K04A 3QG1A 2I46A 4BWGB 3P7JA 5D14A 2AQ2B 4K6DA 1F9SA 4RHSA 1II3A 4DF7A 3I4MB 4C3HG 1G291 1TWFB 2O5IC 2F0OA 4HAEA 1H9JA 1TWCB 1BNZA 2D2CC 2EY2A 1GJXA 3R8BA 4K2LA 1LTTD 4QCLA 4KD4A 3CQZB 3TDQA 2SNSA 1TQOA 3A7AB 1TIID 1WTQA 4EGVA 1A3UA 3URYA 3HP3A 1A15A 1OXUA 5CMDA 3FPPA 3M7NA 2L4NA 5E4WC 3TSSA 5FLXL 1DONA 4ZKCB 1DOKA 1LT5D 3K0YA 4H13C 4H0LC 1JWMD 5C0XG 2Y0SB 1HXYD 1KAAA 5DM73 1CI3M 1F2ZA 1GHJA 2D62A 2F0WA 1EOTA 3GTOB 4XYQA 3SHLA 1JICA 2F1MA 2D5DA 5CV5A 4BBSB 3TN2A 3U9OA 3A8IE 1ILPA 1RCVD 4ODGA 2LS01 4IUQA 2B2YA 3VYUA 5HURA 2ID0A 2R7ZB 2NYZD 3OWFA 5KNDA 2K33A 2QF7A 1XXGA 2PZTA 2PO4A 1CHPD 5KGUA 5I2XA 1GUSA 5KYLA 1TS2A 4XIGS 3J7AV 1SE3A 5CYUA 3KLSA 1S5FD 3SEBA 2FFKB 2WIIB 1RODA 1TS3A 1I4XA 4EQNA 4KJNA 3P1HA 1IYUA 1WTXA 1EYDA 1EZ8A 5COYA 2CW0C 4KV6A 1IKLA 4MIUA 1DXMA 2F0UA 3I90A 1J9OA 3QWNA 5CV9A 4F7XA 4F87A 1Y8OB 4ZLTF 1A6XA 4KD3A 2AWNA 1RF2D 2F3VA 3NTHA 2A74C 4KN7C 2F0FA 1EY8A 2B2VA 4CKBA 1EU4A 4ZQ3A 1PFMA 1BOSA 1R4QB 2L9HA 1BO0A 1UUPA 4IUPA 2CW0D 4FNFA 3L3OC 3LWEA 3KK7A 2Z4IA 1TT2A 3D8GA 3GV3A 2SEBD 4N9TA 5IGGA 4XXEA 1D1IA 4JK1C 1AZQA 3MXGA 4XTCS 5K36G 3BVGA 1NAPA 2KJXA 2JA6B 5K5PA 1D5MC 3WOFA 3M85A 1EYCA 4PMCA 1DYQA 4FF2A 3C2PA 1PFNA 1WVLA 1ENCA 2QCPX 1XX8A 5IT9E 2XVSA 5KIXA 1O7ZA 3ND9A 1ZEQX 4LMQD 3D4DA 3HOWB 2KEDA 4JBWA 1HPCA 3MFYA 1I4QA 1SYBA 1JOOA 1IYVA 5E3FA 2X6GA 2MP1A 1ET6A 5EBCA 3V05A 5IODA 5M3MB 5C0XI 4U673 1C8CA 5C4JB 1HUNA 5ELFA 1SYCA 2F0JA 2ZXOA 1PLFA 2DY7A 5C0XJ 3J80E 3CRKC 2QDBA 4QUFA 4WJWA 4ME5A 1GOZA 4HCEA 2PQEA 3MA2B 1STYA 1WD1A 2IPKD 2F0TA 4DK1A 3VR3A 3G7LA 1O80A 3HS0C 3IFTA 4C3IB 5C6AA 3L9AX 4A93B 3SR1A 5ELCA 3UI2A 5LHY1 3LNNA 5BN3A 1D5XC 2JA8B 4DNTB 1B50A 2FJ2A 1SNPA 5A2QE 3I72A 1BXTA 2R93B 3FMCA 3N52A 3C3LA 1B9NA 3V96A 3GP7A 2B2TC 4R9WA 3RUZA 5JPMC 4KN4C 1VCIA 3HKZB 1SYEA 5BN4A 1B4OA 3A55A 3OHXC 3BYTB 4A3FB 3C1FA 1XWEA 2K01A 5EKLA 3TP6A 3NUCA 4CBVA 4RAUC 4KY5A 3WOEA 1JORA 4FXKC 3OSOA 1WTPA 2F0PA 4Q0FA 3S1MB 1AP0A 4OHJA 4UDUC 2NB0A 3S14B 1RJTA 1ML0D 2F0EA 3K57A 3D4RA 3QO2A 1EY6A 2EOTA 3T51B 2NVQB 1BCPF 3H91A 1MSGA 4PV1C 2TSSA 5T1IA 5D3IB 4B9WA 2M00A 1K8OA 1I3QB 4RGMA 2F0HA 4IQZA 3DEOA 4A3KB 1PTOF 5I9PA 1OXVA 3BVZA 4A3MB 3E6ZX 4WRDA 2ENBA 3E0JA 3RMHA 1KLUD 1HTPA 2BOSA 1PFBA 3TP5A 3H6MA 1SNOA 2GA4B 1E2WA 2EYFA 3MXPA 1GHKA 4A3DB 3EJIA 1W6JA 5K36H 1SEBD 2E2IB 3BDLA 4HMJA 1STEA 5D3DA 2DY8A 3A56A 3PUZA 2F0KA 5EJWA 3J7AF 3PV0A 1H9RA 3X3NA 1M4VA 2RSNA 5AFWA 3NTKA 1NSNS 3W3AA 5CC4A 2PNRC 5E1FA 1TWAB 3NK9A 4NP5A 1CQFA 3RZDB 3HOVB 4CHTB 2KCNA 2F4IA 1CQVA 2VXWA 4DN4M 3S16B 2LFNA 5CGKA 5FO9B 4DK0A 1YNJC 5DAUA 2IJ0A 2HQEA 1L0XB 1PDQA 2NN6G 4IURA 1PRTF 3OWEB 5JAVA 1AW7A 1Z6HA 2N55A 5D65A 4TSSA 3TZUA 4P2CB 3ONAB 4KK7A 5JEAG 5E4XA 1QE6A 3OOCA 5CR3A 4A3GB 1EWCA 4R8NA 1S5ED 2K28A 3KBGA 3S1QB 4DAYA 3MXUA 3KF8A 1YNJD 4TKOB 3H0GB 3AU7A 3T16A 1VMCA 3Q22A 4EQOA 4RH6A 1AEXA 4KHVA 1QNKA 2X6LA 1TY0A 1B3AA 2F0QA 3QIAA 2JSOA 2EE1A 2B2TA 1GUOA 4Z9CB 1WD0A 3BDCA 4MHEA 1H9MA 3ZYYX 1W6KA 2BA0A 3D6CA 4EVOA 1EQVA 1F2LA 2XIWA 1HHVA 1SMYC 1CT1D 1EEID 3O13A 3EA6A 5EBDA 1O7LA 1EY4A 1EZ6A 2G9HD 2SDFA 2IWHA 1JB3A 2EYMA 5FOBB 3SK5A 1X3QA 4RGNA 4IZ8A 3GTLB 4ZUIA 3EFXD 3SK4A 3IL8A 2QKIC 1HQMC 1X32A 1Y1VB 4KI0A 1SNDA 2HCIA 3PO2B 1VMPA 3LWUA 1M8AA 2CHBD 2NVTB 1E2VA 3X3MA 1MSHA 5ELDA 1HUMA 5I4DA 2BDNA 4S3SA 3ND8A 1SMYD 3JAME 2K5DA 1EU3A 2BCOA 5IGDA 1TS5A 4K5XA 3MHBA 1CTMA 1NCVA 1V1PA 3DM1A 2K5QA 3K5LA 2K03A 5LL6S 2KUMA 1F2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQN A;  1KDA A;  1SYE A;  4KJN A;  4NMZ A;  3MVV A;  3MZ5 A;  2EY2 A;  2F0I A;  4DU9 A;  4HTH A;  1STB A;  3C1E A;  5C4Z A;  3P1H A;  1AEX A;  2F0K A;  4KHV A;  5KIX A;  1RKN A;  3D4W A;  1EYD A;  3DMU A;  1A2U A;  4K2L A;  3QOL A;  2PYK A;  5J39 A;  1EZ8 A;  1NUC A;  2PZW A;  4KD4 A;  2F0V A;  5HGT A;  3C1F A;  3ITP A;  1U9R A;  2F0Q A;  2RKS A;  3D4D A;  2SNS A;  5EKL A;  4KV6 A;  1STA A;  1TQO A;  5EKK A;  2RDF A;  4MIU A;  3SXH A;  4KY6 A;  3OMG A;  4K8J A;  4B9X A;  2F0U A;  1TR5 A;  5CV7 A;  3HEJ A;  2EYO A;  3P75 A;  5C4H A;  5CV9 A;  4F7X A;  2NUC A;  1F2M A;  3TP6 A;  3NUC A;  1SNQ A;  2F0D A;  4WOR A;  1A3U A;  2EY1 A;  4K5W A;  4QMG A;  1SYB A;  4K2K A;  1JOO A;  5C3W A;  4KY5 A;  1NSN S;  3NXW A;  5C3X A;  1JOR A;  2EYL A;  5E3F A;  3ERQ A;  1STH A;  3SK6 A;  3OSO A;  1STN A;  2O4X A;  5CC4 A;  2F0P A;  4KD3 A;  3NHH A;  5E1F A;  3E5S A;  1EYA A;  2EYH A;  2F3W A;  3BDC A;  4N9P A;  5IOC A;  5IOD A;  2F3V A;  2EY5 A;  2F0N A;  3NQT A;  4J6H A;  3NK9 A;  4I65 A;  1SYF A;  4NP5 A;  5ISR A;  2EXZ A;  1SYC A;  4E6I A;  5IIF A;  5IGF A;  1EY0 A;  2F0F A;  5CV4 A;  1EY8 A;  2F0J A;  3D6C A;  4K8I A;  4KJO A;  4ZQ3 A;  4EVO A;  5I6Y A;  5J22 A;  2PW7 A;  1EQV A;  5C5L A;  3TP8 A;  2F0E A;  4RKL A;  1JOQ A;  5NUC A;  3QOJ A;  1A2T A;  1EY6 A;  2LKV A;  2QDB A;  3S9W A;  1ENA A;  1IHZ A;  2F0L A;  4H7B A;  1EY4 A;  3TME A;  3TP7 A;  5DEH A;  1EZ6 A;  3V2T A;  5CGK A;  1EY5 A;  2SNM A;  2OXP A;  2KQ3 A;  4KY7 A;  4ME5 A;  5DAU A;  2EYM A;  2HQE A;  1KAA A;  2RBM A;  2F0W A;  1F2Z A;  2PQE A;  3SK5 A;  4DFA A;  3HZX A;  1SYD A;  4G57 A;  3SHL A;  1STY A;  4IZ8 A;  4B9W A;  5CV5 A;  4ZUI A;  4ZUJ A;  3ERO A;  1SNM A;  2F0T A;  5M9O A;  5KRU A;  5I9O A;  3SK4 A;  3R3O A;  2OEO A;  3U9O A;  2M00 A;  1TT2 A;  4QF4 A;  4HMI A;  3D8G A;  2F0G A;  2PW5 A;  5C6A A;  1SND A;  5JAV A;  4N9T A;  4QB4 A;  5KEE A;  2F0H A;  4ODG A;  3EVQ A;  1KAB A;  4F8M A;  2OF1 A;  5F2D A;  3T13 A;  3PMF A;  4KTA A;  3SR1 A;  5IGG A;  4DGZ A;  1A3V A;  1STG A;  1SYG A;  4OL7 A;  5HUR A;  4K5V A;  4RKB A;  2WAC A;  5IGB A;  2F0S A;  5CV8 A;  5I9P A;  1EY7 A;  3OWF A;  1SNC A;  4PMB A;  5C5M A;  4IAL A;  5JOB A;  5CR3 A;  5EGT A;  4TRD A;  4PNY A;  4WRD A;  1A3T A;  2ENB A;  4R8N A;  1JOK A;  1KDB A;  2EYJ A;  2PZT A;  4ID6 A;  5K5P A;  4S3S A;  3DHQ A;  3TP5 A;  5KGU A;  4LAA A;  4K6D A;  2F0M A;  4YIJ A;  1SNP A;  3H6M A;  1SNO A;  5KYL A;  2EYF A;  3QB3 A;  5J1Z A;  4EQP A;  3OMC A;  2SOB A;  1EY9 A;  3MXP A;  3NP8 A;  1II3 A;  2KHS A;  4DF7 A;  2PZU A;  5IGE A;  3MEH A;  4NDX A;  5IGD A;  1EYC A;  3EJI A;  4K5X A;  3MHB A;  1KDC A;  4K14 A;  4J1M A;  3SK8 A;  4PMC A;  5IGC A;  3BDL A;  4HMJ A;  3T16 A;  3RUZ A;  4NKL A;  2EY6 A;  3VA5 A;  2F0O A;  5CV6 A;  4EQO A;  4IUN A;  1ENC A;  5KYI A;  3LX0 A;  2EYP A;  5I6W A;  1F2Y A; 
#chains in the Genus database with same CATH topology
 4NMZ A;  3M7G A;  1O7Y A;  1R4P B;  2CH4 W;  2L12 A;  2WAQ B;  1NR4 A;  1K8M A;  1WCM B;  3ITP A;  1U9R A;  4JI5 Q;  2PPB C;  5JVG 3;  3U50 C;  4H44 C;  1WTV A;  2RDF A;  1CA5 A;  4X62 Q;  3S24 A;  4O1N A;  1HCZ A;  4UAI A;  1F2M A;  3S15 H;  1PH2 A;  4K2K A;  4LJZ C;  1R9T B;  5CBA E;  1XPU A;  3S1N H;  4TQU S;  5CBE E;  1I94 L;  1RTO A;  4C3I G;  2WB1 G;  1VF5 C;  4X3U A;  4A93 G;  2EXZ A;  4Q5V A;  4XQJ A;  3H3V H;  1B7Y B;  1K0R A;  3RR5 A;  1PYS B;  4L8J A;  1VQG A;  2ZXR A;  1KAW A;  4PG3 A;  1OXX K;  4FF1 A;  1RHP A;  1ET9 A;  1Q86 C;  1ILQ A;  3S9W A;  3Q0A A;  2JA8 G;  2K1B A;  2CH4 A;  3R93 A;  4GOP B;  1QZG A;  2R93 G;  1IYJ B;  3FDT A;  2RBM A;  4CJ1 B;  3F2B A;  3A8K E;  3HZX A;  3K7A H;  1QJO A;  4WJ4 A;  1EQR A;  1KRT A;  5IT9 L;  4ZUJ A;  5EPL A;  5M9O A;  2VY3 A;  5I9O A;  2HUG A;  2AUK A;  2I07 B;  4GLA C;  5KRU A;  3OW7 A;  1HFG A;  2KVM A;  5DM6 3;  4LFB Q;  4HMI A;  5EKI A;  5JEA J;  3IFD A;  3T13 A;  2EQS A;  4PQX A;  2A6H C;  2ES2 A;  1Y1W B;  4OL7 A;  1P8L A;  4LF7 L;  1SNC A;  4O0A A;  4PMB A;  1AE3 A;  4KHZ A;  2ALY B;  3A8J E;  4JC0 A;  2Z6B A;  4FXD A;  3CHB D;  4DAY B;  4JI1 L;  4LF4 Q;  2XNA C;  3KF8 B;  4ZYS A;  3AMU A;  5JJK A;  3F8T A;  1BQQ T;  5JPN C;  3PIO 3;  1LTG D;  5JEA H;  2JE6 I;  3SK8 A;  5BR8 L;  4XQN A;  1KIX A;  2Z1C A;  4HR7 B;  2E2J H;  1F9R A;  1SBB B;  1I50 H;  1A0I A;  3J80 L;  4NKL A;  2QEJ C;  5CV6 A;  2UUC Q;  4C3H B;  3HOZ G;  4ME3 A;  5I6W A;  1PTO H;  4HTH A;  2GVB A;  4CJ0 B;  3MVV A;  2F0I A;  4JOI A;  4R4O A;  1I94 Q;  3VR4 A;  2A6H D;  3ZJY C;  3VYT A;  2KEN A;  2NVX H;  3QJY A;  4GKJ L;  4LUO A;  1MI2 A;  3H3V C;  3SXH A;  1M1K C;  4LWC A;  1ENF A;  3KOJ A;  1X56 A;  5C4H A;  5LMN L;  2PMZ E;  2EY1 A;  3PO3 H;  4IUT A;  2ZJR A;  3W2D A;  1D5Z C;  1S3O A;  3UDI A;  3S2H B;  3NHH A;  2F3W A;  2PQA A;  4J6H A;  4CDD C;  3OIP A;  2L15 A;  4HN7 A;  4A76 A;  5KNB A;  3K0X A;  4LFA Q;  5J22 A;  3F1Z A;  1UAP A;  2PW7 A;  5A2Q L;  1JWU D;  3CCJ A;  4R4C A;  1IZ6 A;  3S1R H;  4A3I H;  3QOJ A;  4V0B A;  4H7B A;  4IPD A;  3MFG A;  5AJ3 L;  3T1H Q;  1TVX A;  4LF7 Q;  2SNM A;  2OXP A;  3A54 A;  2ZM6 L;  2HDL A;  3CU7 A;  4DR5 L;  2B2W C;  4G57 A;  2IL8 A;  3MC0 B;  1BCP C;  4U68 A;  4QUC A;  2EJF C;  2L11 A;  2OEO A;  5C3E G;  1VQA A;  5IWA L;  3M3Y H;  4DR2 L;  2N78 A;  2F0G A;  4OWW B;  3AB9 A;  2LY7 A;  3FRP B;  4BBR H;  3DWP A;  1KAB A;  4JI7 Q;  1HZC A;  1SYG A;  1OXT A;  2XGT A;  3FEW X;  4OIK A;  2AKW B;  4BY1 B;  3CC4 A;  5CV8 A;  2R92 H;  1LM0 A;  2Q8R E;  2ZT9 C;  4JYA Q;  2J0T D;  3CPF A;  5C4X H;  1PTO C;  1X55 A;  2F0M A;  2G5D A;  4YIJ A;  1RL2 A;  2J7Z A;  4YCV A;  1HTL D;  1CFM A;  1SFO H;  1HFN A;  1P16 A;  1V1P B;  3NP8 A;  3GTP H;  3MEH A;  2JA5 G;  4J1M A;  5C0X H;  2DNC A;  3N6R A;  1QCB D;  1BCP D;  2YU9 B;  1C9O A;  2K05 A;  5C44 B;  1FNU A;  4A3C G;  1LTR D;  3HOV G;  5EPJ A;  3FP9 A;  4CDF C;  4DU9 A;  1G8Z D;  1LLR D;  1G2S A;  2CWA A;  3DMU A;  1NTG A;  2A5H A;  2PYK A;  1X3E A;  3PUV A;  3S17 B;  3PCO B;  3DEP A;  2RCN A;  2NZO A;  2RCF A;  2A73 B;  5IYD H;  1LV9 A;  1VQ9 A;  1TR5 A;  5CV7 A;  1YIT A;  4G4K A;  1HZB A;  2MJ8 A;  1PTO D;  4WOR A;  4APV A;  2Z8L A;  1H9K A;  4A75 A;  3G71 A;  2L0C A;  3J81 E;  4X3K A;  1SN8 A;  2ZM6 Q;  1JB7 A;  2JXM B;  1YZ6 A;  3H94 A;  5IOC A;  1PFS A;  1D6E C;  2R7F A;  2KEE A;  2ZTC A;  3SVM A;  4E6I A;  2NWG A;  2NTS A;  3RNU A;  4Y7N H;  4C3J G;  1ONL A;  3PF5 A;  2IW3 A;  5FLM G;  4GZY C;  4KJO A;  1KNE A;  4A3B B;  4DV2 L;  2OQK A;  3S2D B;  1VQJ A;  1DOM A;  2XWB B;  1E2Z A;  2KCT A;  5I2Y A;  1VQI A;  4AYB E;  3GTM B;  1SAP A;  2DN8 A;  2RQX A;  3CRL C;  2G9D A;  1ENA A;  1CKO A;  4GKK L;  1V43 A;  1PXU A;  2K5W A;  4KY7 A;  2K6A A;  3HFZ B;  4RWS C;  4JI4 L;  4NXM Q;  2VUM B;  4LNQ A;  2XWJ B;  1SYD A;  3KBX A;  3C46 A;  2J4X A;  2A68 C;  1B1Z A;  3EN2 A;  2E8G A;  1U0L A;  4CDC C;  1I4R A;  3HOX B;  5FK9 C;  3NPP A;  1E7Z A;  1F77 A;  1F9Q A;  4YY3 Q;  1FNW A;  1CA6 A;  4RHR A;  1PRT C;  2N88 A;  2AQ3 B;  3PMF A;  4K0K Q;  2IY5 B;  4DGZ A;  1XNQ L;  4OIJ A;  2F0S A;  1EIG A;  4ABN A;  2JYO A;  4IAL A;  4PNY A;  3U4V A;  3KFU A;  1I6H H;  2WV6 D;  2IHF A;  4OON A;  4DR7 Q;  1LUZ A;  1BR9 A;  4ZRZ A;  2RA4 A;  3GTK B;  2A6E C;  5M5Y B;  1D2B A;  1Z7T A;  4X6A H;  1KXL A;  1RTN A;  4QQB X;  1KNA A;  1W3S A;  3RN5 A;  1YHQ A;  3GQB A;  2L1B A;  2E5L L;  2IX1 A;  3TS2 A;  4A3L H;  2A68 D;  1FD7 D;  3VA5 A;  3G6E A;  3VA7 A;  4YCW A;  2E2D C;  4LUZ A;  2KOL A;  3OIQ A;  5M3F B;  1PRT D;  2OWO A;  2RVL A;  3M4O H;  3D3R A;  3I70 A;  4IPH A;  5EKK A;  4DV2 Q;  5G3L D;  3HOZ H;  3KJP A;  2EYO A;  2NVY B;  1BBU A;  1FGU A;  4DUY Q;  2A1A A;  4GNX B;  4V19 0;  2A6E D;  3SGI A;  2LSS A;  3K58 A;  2PQA B;  1FGB D;  3QR8 A;  1N8R C;  3NBI A;  1K83 H;  1Y1V G;  5M5W H;  4JCV E;  1N9W A;  2R61 A;  3MWY W;  4G7Z C;  2FXQ A;  1SDF A;  3EQL C;  4K8I A;  4AQY L;  2KHI A;  2VB3 X;  1YIJ A;  2QEX A;  3M9B A;  4NXN Q;  2Y0S G;  2JA7 B;  2LKV A;  2L5T A;  3TME A;  1HA5 A;  5IY0 A;  1LT6 D;  2B63 B;  4DAP A;  4CKE A;  3L7Z C;  2CVR A;  1N33 L;  1GXD C;  2VB2 X;  1LT4 D;  3P20 A;  4MN3 A;  3R3O A;  3D0F A;  1JJG A;  3CME A;  4C56 C;  2R7Z G;  2F4V Q;  4DV1 L;  1AN8 A;  3E3X A;  1DOL A;  1XPO A;  3BDO A;  4HCS A;  1WFQ A;  4F8M A;  2YTX A;  4JI6 Q;  4K6L A;  4HSP A;  3VDY A;  1SE8 A;  4RKB A;  2B2W A;  4YHH Q;  3R2T A;  1EY7 A;  2QGQ A;  1WCM G;  4TRD A;  1M90 C;  2PMZ B;  5C3E H;  4O42 A;  4BY7 B;  2VQE L;  1FJG Q;  3GTG H;  3GTQ B;  4ZK9 B;  1LTS D;  2PCF B;  2ZTD A;  1DCZ A;  3BG3 A;  4GLV B;  3MAQ A;  2LXK A;  1QIL A;  4JW0 A;  3T1Y Q;  5IYC G;  3FKI B;  5IGE A;  2VQF Q;  4K14 A;  3GTJ H;  5IP7 G;  4DUZ L;  1NMG A;  1QZH A;  2KCC A;  3U58 A;  2VS1 A;  3ER0 A;  4B08 A;  3K59 A;  3M4Y A;  2BE5 C;  3SDZ A;  1GUN A;  4C2M H;  3NQI A;  2A69 C;  1QB5 D;  1STB A;  4HSV A;  4DA2 A;  1Z47 A;  1JT8 A;  1RKN A;  1PV4 A;  3CD6 A;  1TWH H;  2JA5 H;  5COR A;  5JVH 3;  1X65 A;  1KL9 A;  3KLW A;  1IW7 C;  3G6J B;  4L5T A;  1U4M A;  3PUY A;  4A3J B;  3Q24 A;  4PZ8 A;  3P75 A;  2K5H A;  2RHQ B;  1Y8P B;  2F0D A;  1X9N A;  3CCM A;  3KDF A;  3CC2 A;  1X6O A;  3K8A A;  1VQC A;  3ERQ A;  4KKT A;  1STN A;  2WKC A;  5GQO A;  3VR2 A;  3NQT A;  4R4I A;  2E2H B;  3DWQ A;  2IX3 A;  4I65 A;  1Q90 A;  1IL8 A;  2UUA Q;  1HNZ L;  2UXB L;  4CJ2 C;  3TP8 A;  2BE5 D;  2EVB A;  2A69 D;  3HGB A;  1A2T A;  5FO7 B;  4X64 Q;  5ISR A;  4IFD G;  2F0L A;  1GUW A;  1EQT A;  2UUB L;  4A3J H;  4LF9 Q;  1LTL A;  3GD7 A;  2K5V A;  3AEV A;  4C3J H;  3RZO H;  1T5E A;  1IW7 D;  2VQE Q;  4ZAI A;  1G6Z A;  5M5X B;  4L6T B;  1JMC A;  4IJL A;  5A35 A;  4L5Q A;  4JI5 L;  1O7I A;  4OGQ C;  1DGS A;  4A3E B;  1EEF D;  4QB4 A;  3HOU H;  4X62 L;  1TWG B;  4KTA A;  1E24 A;  4GS3 A;  5EQ0 A;  3I3C A;  2UXC Q;  1UEA B;  3I4N B;  2I5H A;  1MIU A;  3F2C A;  1A3T A;  2EYJ A;  4LUV A;  1H9S A;  1EFI D;  1YNN C;  4PMW A;  1NMF A;  2N8N A;  3PF4 A;  2HDM A;  3I4L A;  3BS1 A;  1HJP A;  4GN5 A;  4DR1 Q;  1H95 A;  5HY6 A;  3QB3 A;  1MGS A;  3OMC A;  1B44 D;  1AFP A;  2KHS A;  3OW2 A;  2PZU A;  1PH4 A;  1EIH A;  3BVM A;  3CMA A;  1HZ9 A;  1KDC A;  4BS9 A;  1G2T A;  1PYB A;  3KJO A;  4OEL B;  1FYC A;  1Q1B A;  1NNX A;  3I4M H;  4AYB B;  4IUN A;  1B2T A;  3LX0 A;  1CZW A;  1UNS A;  4FF3 A;  2RDH A;  1PZI D;  1TWF H;  3GDE A;  1UE1 A;  2PZW A;  1NUC A;  1TWC H;  1C4Q A;  2FHT A;  2RKS A;  1WTR A;  3S15 B;  4LFB L;  1STA A;  2KA7 A;  4KY6 A;  3CQZ H;  4OO1 G;  2MO1 A;  4M1U B;  1YNN D;  3S1N B;  4KKU A;  1PH6 A;  1SNQ A;  3UE1 A;  2AQ1 B;  1I4H A;  1SMX A;  4BXX G;  3NXW A;  4QY7 A;  3VR6 A;  4B3T Q;  4LF8 Q;  2B2U C;  3U4Z A;  1EWI A;  1MBY A;  1VQE A;  1EL0 A;  2O4X A;  2EYH A;  3BZD B;  2EDG A;  4PZ7 A;  4LF4 L;  4DKA C;  1CZG A;  1QNU A;  1PH5 A;  3CCE A;  5IYB H;  2V1C C;  3I8Z A;  4BY1 G;  2JA9 A;  1CM9 A;  3TZD A;  4IJH A;  3PGZ A;  1PA6 A;  2GVA A;  1F9P A;  1GUG A;  1CHQ D;  5TSS A;  2ZXP A;  1G51 A;  2CKZ B;  2ZTE A;  2FIN B;  4P74 A;  1EIY B;  4RGO S;  5DLQ E;  2Q2U A;  1JQY D;  5DEH A;  2C35 B;  3K7A B;  2UUC L;  3T56 B;  2QDL A;  1ZKO A;  4R4T A;  4TVA B;  1TS4 A;  4ILW A;  1B9M A;  5LMU Q;  2RSO A;  4AH6 A;  1LTB D;  2N49 A;  1CK1 A;  1ZXT A;  1IXR A;  1SNM A;  1ICW A;  1UE6 A;  4HED A;  3HG9 A;  2LMC B;  2NN6 I;  3GTO H;  2ICE C;  1HQR D;  1XTD A;  1E1T A;  2HCC A;  1Y69 U;  2PW5 A;  3PQI A;  4QIW E;  3J7A 5;  5C44 G;  4BBS H;  1BCP B;  2P5Z X;  1MHW C;  4J15 A;  5EGT A;  3NBH A;  1Q1E A;  4XT1 B;  1AZP A;  4ALP A;  1JOK A;  1XNR Q;  1VQO A;  2R7Z H;  2O2L D;  3UDG A;  2NBF A;  1LTA D;  5FO8 B;  2E2J B;  2WIN B;  5J1Z A;  4EQP A;  3VYR A;  1I50 B;  2SOB A;  4EX5 A;  2OCE A;  2K32 A;  1MD2 D;  3NE5 B;  4LFA L;  5FLX E;  2YV5 A;  3VR5 A;  1U5K A;  2AUJ D;  4I7Z C;  3CAM A;  3HKZ G;  2KEC A;  1PTO B;  4DXF A;  3Q6S A;  3IAY A;  3T1H L;  3TBI B;  3HOY B;  1U4R A;  2NN6 H;  3IKJ A;  2O5J C;  4A3F G;  1HR0 Q;  1GUT A;  5C4Z A;  4JV5 Q;  4A3B G;  4IUU A;  2NVX B;  1SE4 A;  3D4W A;  4XYO A;  1A2U A;  5IT9 c;  5J39 A;  1RD9 D;  5IP7 H;  3R2I A;  4UY8 C;  4DV3 L;  2Z4H A;  2MQH A;  4A4I A;  3CXC A;  5FKA C;  1K73 C;  3PO3 B;  3K6O A;  3HEJ A;  1O78 A;  1S5B D;  3KDF B;  4HIO A;  2TMP A;  4JI7 L;  1HR0 W;  2VUM G;  4KHP Q;  2R6G A;  4HJA A;  1ASY A;  2JEB I;  1HNX Q;  2EYL A;  1KHI A;  1V8Q A;  1XJV A;  1JWS D;  4IFD I;  1JJ2 A;  2H1E A;  1PZK D;  4JYA L;  2EY5 A;  2F0N A;  4IOA A;  3HOY H;  2VNU D;  1N32 Q;  3S1R B;  4A3I B;  1E0B A;  5CV4 A;  4IFD J;  2H4O A;  1VDZ A;  1S5D D;  5NUC A;  3I7F A;  4FYD A;  2ICI A;  4RCN A;  3PIP A;  3NWS A;  1Q8K A;  3CKI B;  3J80 c;  2E75 C;  5JJZ A;  1E3P A;  1EY5 A;  1Q12 A;  3NWT A;  3D31 A;  4GNX A;  5JJI A;  3M3Y B;  2FMC A;  3BZC A;  4JBK A;  1XTC D;  4BBR B;  2X69 A;  4HJ7 A;  1PH3 A;  1L0Y B;  2C5C A;  1BDO A;  3KLR A;  4IFD H;  3RLO A;  3H15 A;  4A3K G;  2LXJ A;  2WP8 J;  3DWA A;  2QA4 A;  3AFQ A;  2R92 B;  4XQQ A;  3G4S A;  3EVQ A;  3I73 A;  5F2D A;  4KMU C;  1TKW B;  4DAM A;  3GO5 A;  4A3M G;  1A3V A;  1PMR A;  2QW7 A;  1TU2 B;  1I4P A;  1CKN A;  5C4X B;  1TXY A;  1H9S B;  1DD2 A;  5JOB A;  2Z6K C;  2B29 A;  3J81 L;  1KDB A;  1EIF A;  1S40 A;  1SFO B;  1G91 A;  1PRT B;  1U4P A;  3DHQ A;  4NPS A;  3GTP B;  4A3D G;  4LAA A;  3A7L A;  2V4D A;  3ERS X;  3K5N A;  4AIM A;  1YBY A;  4DV3 Q;  1SSO A;  1SRU A;  1B3Q A;  2JA6 H;  3JAM i;  1C48 A;  2F03 A;  1Q3L A;  3Q23 A;  3OTO L;  1IKM A;  1QWY A;  4OO1 I;  2B8G A;  3F2U A;  4J8Q A;  2EYP A;  1HRJ A;  1B53 A;  2NZH A;  3RN2 A;  3ULL A;  3MZ5 A;  4NXM L;  4G7H C;  4P75 A;  3L2P A;  4FF4 A;  3QOL A;  1QUQ A;  1QOH A;  2F0V A;  5HGT A;  3MXN A;  1CKM A;  2D9U A;  1K28 A;  4YY3 L;  3U9S A;  3T4A C;  1DM0 B;  2EPB A;  1SJH D;  2M2L A;  1UE5 A;  3M4P A;  1V1O A;  4FP5 D;  4K0K L;  2UU9 Q;  4QMG A;  1D1K A;  3H09 A;  3HOW H;  5C3W A;  5KNC A;  5C3X A;  1MKH A;  2E76 C;  4B3M Q;  4FVM A;  4Y7N B;  2B3G A;  4DR7 L;  1HNW Q;  4RGT A;  1WTO A;  1J5E Q;  3DUZ A;  1SYF A;  4C1N I;  4OO1 H;  5IIF A;  4L63 B;  2MPM A;  5IGF A;  1IBL Q;  3CCS A;  1EY0 A;  5T1G A;  5M3M H;  4BXX H;  2WB1 B;  4JG2 A;  5C4J H;  4C1N K;  3KUP A;  2B2U A;  1EWH A;  5ELB A;  2BA1 A;  4G7O C;  3TP7 A;  1IHZ A;  1K3B C;  3V2T A;  1VF7 A;  3GV6 A;  1S4Z A;  1QG7 A;  2RHS B;  1L1O C;  1KRS A;  4IO9 A;  1U4L A;  1BUV T;  2QIL A;  1PH9 A;  3ERO A;  5LMN W;  2K52 A;  4ULL A;  3FPU B;  4HIK A;  5KEE A;  3NTI A;  3OTO Q;  4A3G G;  1I6H B;  2IT1 A;  1VQB A;  4DUY L;  1HA6 A;  1PZJ D;  3NBH B;  4C3I H;  1YEZ A;  2CCZ A;  1NR2 A;  4DV4 L;  4MTN A;  3MTS A;  1JC7 A;  4A93 H;  5GAE C;  3TRZ A;  2MUY A;  4DR3 Q;  1VQ8 A;  1I6V C;  1AH9 A;  3OPO A;  1SE2 A;  3H0G G;  4HIM A;  1LO5 D;  2M9V A;  1ESF A;  2BDO A;  1WYD A;  2XRS D;  3A74 A;  1XMO L;  1EY9 A;  1PYW D;  2JA8 H;  1TY2 A;  3RLF A;  1G6P A;  2AMC B;  3EBE A;  1LAC A;  4NXN L;  3PUW A;  1FNV A;  2R93 H;  1KLG D;  4R4Q A;  1DJR D;  2Y0S E;  4XT3 B;  2EY6 A;  2WAC A;  3PIP 3;  3M4O B;  4BA1 I;  5IP9 G;  1OXS C;  1Q8I A;  3HOZ B;  3TRE A;  1LAB A;  1BBX C;  2F52 A;  3OYY A;  2F4V L;  4K8J A;  5LL6 X;  3CP0 A;  4B9X A;  4JI6 L;  4RFB A;  2CQA A;  4LF5 Q;  1ESR A;  1K83 B;  4QIW B;  3FVQ A;  4YHH L;  5M5W B;  4L5S A;  2C9O A;  1STH A;  3SE0 A;  1E1O A;  1VQK A;  2DNE A;  1FJG L;  4N9P A;  4QL5 A;  4A3E G;  4FXG C;  1JCK B;  3T1Y L;  3S1M H;  2NZ1 D;  2OT2 A;  5C5L A;  2VQF L;  3S14 H;  4WFN 3;  1JOQ A;  4B3S Q;  1SR3 A;  1AE2 A;  4R8I A;  3K5M A;  2YYZ A;  4DV0 Q;  4DV4 Q;  2B2Y C;  4DAV A;  5EPK A;  1LT3 D;  4IN3 A;  1BF4 A;  1HH2 P;  4DFA A;  4M8A A;  4KKS A;  2XRQ D;  3PO2 G;  2NVQ H;  3K5O A;  1VQN A;  1YI2 A;  4YWL A;  2HT1 A;  1XMO Q;  4AYB G;  2EJG C;  2WKD A;  1CKN B;  3PSI A;  3J81 j;  4L5R C;  2OF1 A;  5C3E B;  4K5V A;  4RA8 A;  1NBW A;  2ZJQ A;  3GTG B;  3BYY B;  1KTK A;  2MHV A;  4IUV A;  5IGB A;  1I3Q H;  4HJ9 A;  4OX9 Q;  1SXT A;  1IBM Q;  5C5M A;  1MJC A;  1N36 Q;  3RD4 A;  1QVC A;  3PUX A;  4RCO A;  1EOV A;  4A3K H;  4ID6 A;  1VQF A;  3T53 B;  4F88 A;  2BH8 A;  3DXJ C;  1T5X D;  1OO9 B;  5BN5 A;  3GTJ B;  1Y8N B;  2RDG A;  4A3M H;  2UUA L;  4WJ3 M;  1PHJ A;  2A8V A;  2XN9 C;  4NDX A;  1IBK Q;  2NTT A;  5ELE A;  5IGC A;  4C2M B;  4X64 L;  1K3R A;  1FR3 A;  3D6W A;  1DZ1 A;  2Q8I B;  1J8I A;  4LF9 L;  1TWH B;  5KYI A;  2JA5 B;  1CSQ A;  2WAQ G;  2E2I H;  2KCM A;  1KDA A;  1QUQ B;  5E7N A;  4DR6 L;  2ASB A;  3C1E A;  3WDN A;  1GM5 A;  4IPG A;  1Q46 A;  3MXN B;  2JP1 A;  1RDP D;  2B8F A;  4B3R Q;  2E74 C;  1RIP A;  2IX0 A;  2XTI A;  2FMM A;  3E0E A;  3VYS A;  4CGY B;  2EXD A;  3OMG A;  3A5Z B;  2K7V A;  2NUC A;  1YHB A;  1JR0 D;  1ZYR C;  2B2V C;  4I7A A;  4K5W A;  2JEA I;  2UXC L;  5DNF A;  3KF6 A;  1S5C D;  3NSW A;  4P72 A;  1JE4 A;  1GVP A;  3SK6 A;  1XYI A;  2HQL A;  4LW1 A;  3J81 i;  3E5S A;  1EYA A;  4JVZ A;  1E22 A;  4XDX A;  3TEH B;  4FO2 A;  4DNR B;  1I4G A;  3J7Y W;  4UHV A;  4DR1 L;  2MGS A;  4CKC A;  1TWA H;  3J7Z C;  1X3P A;  1WI5 A;  4HJ8 A;  1JE5 A;  5I6Y A;  2R3Z A;  5ELN A;  1XPR A;  4RKL A;  5G3L F;  2EZV A;  4C3J B;  3RZD H;  4A3C H;  3RZO B;  3HOV H;  5J3B A;  2AWO A;  4DV6 Q;  1WTW A;  2KQ3 A;  2KHJ A;  2L55 A;  1C0A A;  4X3S A;  2B39 A;  3KLS X;  1SJE D;  1SLJ A;  4LK1 C;  3HOU B;  1ZYR D;  3HRZ C;  4NW2 A;  1LYL A;  1JJC B;  4LFC Q;  1Y1W G;  3WWV A;  4BA2 I;  4DV7 Q;  4DXG A;  3I91 A;  4QF4 A;  4X3T A;  3M4Q A;  1LTI D;  3JAM L;  2XSC A;  4ZKB B;  1L1O A;  2EJM A;  2KBN A;  1STG A;  2Q8T A;  5HGQ A;  2K04 A;  3QG1 A;  4B3T L;  4LF8 L;  4JI8 L;  2I46 A;  4BWG B;  1B8A A;  4GN3 B;  4DR6 Q;  5FLM H;  3P7J A;  5D14 A;  2AQ2 B;  4K6D A;  1F9S A;  4A3G H;  4RHS A;  4DR4 Q;  4P73 A;  3JAM c;  1II3 A;  4DF7 A;  3I4M B;  4N8X 1;  4C3H G;  1G29 1;  3S1Q H;  1TWF B;  1A62 A;  2O5I C;  2F0O A;  3H0G H;  4HAE A;  2HIV A;  1H9J A;  5LMU L;  1TWC B;  1BNZ A;  2D2C C;  2EY2 A;  3AFP A;  2HHH Q;  1GJX A;  3R8B A;  3PIO A;  4K2L A;  1LTT D;  4QCL A;  4KD4 A;  2WB1 E;  3CQZ B;  3TDQ A;  3I56 A;  2SNS A;  1N34 Q;  1TQO A;  3A7A B;  3JC6 6;  1KC8 C;  1L2F A;  1GO3 E;  1TII D;  1WTQ A;  1GD7 A;  4POF A;  4EGV A;  1A3U A;  4PZ6 A;  3UDF A;  3URY A;  3HP3 A;  1A15 A;  1OXU A;  5CMD A;  3FPP A;  1XNR L;  3M7N A;  5GAG C;  2R92 G;  1VQP A;  4H02 A;  2L4N A;  1VQ5 A;  5E4W C;  1CSP A;  3TSS A;  1X3G A;  5FLX L;  1DON A;  4ZKC B;  3HKZ E;  4OXP A;  2A19 A;  1IL2 A;  4OWT B;  2EIF A;  1DOK A;  1LT5 D;  3K0Y A;  4H13 C;  4H0L C;  1JWM D;  5C0X G;  2Y0S B;  4JI8 Q;  1HXY D;  1HR0 L;  1CUK A;  1KAA A;  1CI3 M;  1F2Z A;  1GHJ A;  2D0O A;  2D62 A;  2F0W A;  1EOT A;  5DM7 3;  3GTO B;  4JV5 L;  4XYQ A;  3SHL A;  1JIC A;  2F1M A;  3TS0 A;  2D5D A;  5CV5 A;  4BBS B;  1VQ7 A;  3TN2 A;  3U9O A;  3A8I E;  1ILP A;  1UEB A;  2JQO A;  1RCV D;  3GTL H;  3B6Y A;  4ODG A;  1ASZ A;  1V1Q A;  2LS0 1;  4IUQ A;  2B2Y A;  3VYU A;  5HUR A;  4HJ5 A;  2ID0 A;  5IYD G;  3I55 A;  4KHP L;  2R7Z B;  1Y1V H;  2RF4 A;  2NYZ D;  2AHO B;  3OWF A;  3PO2 H;  1HNX L;  3BU2 A;  1VQ6 A;  5KND A;  2K33 A;  2QF7 A;  2NVT H;  1XXG A;  2PZT A;  2PO4 A;  1XMQ Q;  1CHP D;  5KGU A;  5I2X A;  1GUS A;  1N32 L;  4X65 Q;  4KLK A;  5KYL A;  1TS2 A;  4XIG S;  4JI0 Q;  3J7A V;  1SE3 A;  3UDX A;  1MJE A;  2YTY A;  5CYU A;  3KLS A;  1S5F D;  3SEB A;  4UP9 A;  1B70 B;  2FFK B;  2WII B;  1ROD A;  1TS3 A;  2ZJP A;  5L37 A;  1I4X A;  4EQN A;  4KJN A;  2CWP A;  3P1H A;  1IYU A;  3IRB A;  1WTX A;  1EYD A;  1EZ8 A;  5COY A;  2CW0 C;  4KV6 A;  3RLN A;  1IKL A;  4MIU A;  3I90 A;  1DXM A;  2F0U A;  3KF6 B;  1WCM H;  1J9O A;  3QWN A;  5CV9 A;  4F7X A;  4F87 A;  1Y8O B;  5GAH C;  4ZLT F;  4DV5 L;  1A6X A;  5JJL A;  4KD3 A;  1VQL A;  2AWN A;  2K75 A;  1RF2 D;  4MZ9 A;  5IYC H;  2F3V A;  3NTH A;  1R9T H;  4MNO A;  1VS0 A;  2Q2I A;  2A74 C;  4LF6 Q;  2BH2 A;  4KN7 C;  2F0F A;  1EY8 A;  2B2V A;  4CKB A;  1EU4 A;  4ZQ3 A;  1EYG A;  2PNH A;  1PFM A;  1QVG A;  1T9H A;  1BOS A;  3A5U A;  1R4Q B;  2L9H A;  4GN4 B;  1BO0 A;  1UUP A;  4GLX A;  4IUP A;  4UPA A;  4YWM A;  5IE8 A;  2CW0 D;  4FNF A;  4A3L G;  3HOX G;  4DK3 C;  3ULP A;  3L3O C;  3LWE A;  3KK7 A;  1BVS A;  2Z4I A;  1TT2 A;  1L1O B;  3GV3 A;  3D8G A;  1Q81 C;  2SEB D;  4N9T A;  2PI2 E;  2MO0 A;  4UP8 A;  4EQ5 A;  5IGG A;  4XXE A;  4X66 L;  2OTL A;  2UU9 L;  1D1I A;  4JK1 C;  1AZQ A;  3BJU A;  3MXG A;  4XTC S;  3ICE A;  5K36 G;  3BVG A;  4B3M L;  1NAP A;  1Y1W H;  2KJX A;  2JA6 B;  5K5P A;  1HNW L;  1J5E L;  1D5M C;  3WOF A;  1IBL L;  3CPW A;  3M85 A;  3UE0 A;  3BZK A;  1EYC A;  2I0Q A;  4PMC A;  1DYQ A;  3DLL A;  4Y52 H;  4FF2 A;  3C2P A;  2N3S A;  5M3F G;  4QGU A;  1PFN A;  1WVL A;  1ENC A;  3K7U C;  2K4K A;  2QCP X;  4DV5 Q;  1XX8 A;  5IT9 E;  3W1B A;  2XVS A;  5KIX A;  1O7Z A;  4C3H H;  3ND9 A;  1ZEQ X;  3CCQ A;  4LMQ D;  1EQQ A;  3D4D A;  1L0W A;  3HOW B;  2KED A;  5FJ8 G;  4JBW A;  1HPC A;  1YVC A;  3MFY A;  1V9P A;  1I4Q A;  1X54 A;  1SYB A;  1JOO A;  1IYV A;  1FL0 A;  1K0S A;  4IOC A;  5E3F A;  2X6G A;  2PI2 A;  2MP1 A;  1ET6 A;  5EBC A;  3J81 c;  4DR3 L;  2VZA A;  3V05 A;  5IOD A;  5M3M B;  4JI1 Q;  4U67 3;  5C0X I;  1C8C A;  5C4J B;  1HUN A;  5ELF A;  2F3I A;  1SYC A;  4YCU A;  3CCV A;  2JA7 G;  3S2H H;  4JPB W;  4GOP C;  2F0J A;  2ZXO A;  4JI3 L;  4NB3 A;  1PLF A;  2B63 G;  2DY7 A;  5C0X J;  5BR8 Q;  3J80 E;  3CRK C;  2QDB A;  4X66 Q;  4QUF A;  3E9H A;  4WJW A;  4ME5 A;  5H1S E;  1GOZ A;  4HCE A;  2PQE A;  2VL6 A;  3MA2 B;  1STY A;  1WD1 A;  2IPK D;  2F0T A;  4DK1 A;  3VR3 A;  3G7L A;  1Y14 B;  1O80 A;  4GKJ Q;  3HS0 C;  3IFT A;  4C3I B;  5C6A A;  1W2B A;  3L9A X;  4A93 B;  3SR1 A;  5LMN Q;  1Z9F A;  4LF5 L;  5ELC A;  3UI2 A;  1K8A C;  4BY7 G;  4ZCK A;  5LHY 1;  3LNN A;  2DJG C;  5BN3 A;  1D5X C;  3FKI G;  4BY1 H;  2JA8 B;  2GN5 A;  4DNT B;  1B50 A;  2UXD L;  2FJ2 A;  1SNP A;  5A2Q E;  3I72 A;  1BXT A;  2R93 B;  3F2D A;  3FMC A;  3N52 A;  4RMF A;  2OQ0 A;  3CC7 A;  1ICF B;  3CF5 A;  4R1J A;  2H5X A;  3C3L A;  1B9N A;  3V96 A;  4B3S L;  3GP7 A;  2I5M X;  2B2T C;  4R9W A;  3RUZ A;  1WTH A;  5AJ3 Q;  5JPM C;  4KN4 C;  1VCI A;  4DV0 L;  3HKZ B;  4DR5 Q;  1SYE A;  5BN4 A;  2YU9 H;  1A63 A;  1B4O A;  3A55 A;  4A3J G;  2D0P A;  3OHX C;  5C44 H;  3BYT B;  4A3F B;  3C1F A;  1XWE A;  5IWA Q;  1D8L A;  2K01 A;  4DR2 Q;  5EKL A;  4JI3 Q;  3MEF A;  3NEL A;  3S17 H;  3E9I A;  3NUC A;  3TP6 A;  4CBV A;  2JK8 A;  4RAU C;  4OX9 L;  1YNX A;  4KY5 A;  3WOE A;  3HOU G;  1IBM L;  1JOR A;  1YJW A;  1N36 L;  4FXK C;  3OSO A;  1WTP A;  2F0P A;  4Q0F A;  3S1M B;  1AP0 A;  4OHJ A;  4UDU C;  1EUJ A;  2NB0 A;  3S14 B;  4JI2 L;  2K50 A;  1RJT A;  1ML0 D;  2MFI A;  2F0E A;  3K57 A;  1IBK L;  2IHE A;  3D4R A;  4A3F H;  3QO2 A;  1EY6 A;  2EOT A;  3T51 B;  4A3B H;  3S2D H;  2Z9H A;  2NVQ B;  1BCP F;  3GTM H;  3H91 A;  2WAQ E;  1MSG A;  4PV1 C;  4OWX B;  3I4M G;  2TSS A;  5T1I A;  5D3I B;  4B9W A;  2JJQ A;  3A0J A;  2UXD Q;  1Q7Y C;  3CCU A;  4B3R L;  2M00 A;  2VUM H;  1BKB A;  1K8O A;  1I3Q B;  1KD1 C;  4RGM A;  4DK6 C;  2F0H A;  4IQZ A;  3I4N G;  3Q8D A;  3DEO A;  2OTJ A;  3HOX H;  4A3K B;  3KYH C;  1PTO F;  5I9P A;  1OXV A;  3BVZ A;  4A3M B;  3E6Z X;  4WRD A;  2ENB A;  1YHA A;  3E0J A;  2CQO A;  3RMH A;  1KLU D;  1HTP A;  2BOS A;  1PFB A;  4JBM A;  3EIV A;  2HIX A;  3TP5 A;  3H6M A;  1SNO A;  2GA4 B;  1E2W A;  2EYF A;  3LGJ A;  3MXP A;  1S72 A;  1GHK A;  4A3D B;  2YTV A;  3GTK H;  3EJI A;  1W6J A;  5K36 H;  5M5Y H;  1SEB D;  2E2I B;  4RG1 A;  5IYB G;  3BDL A;  4HMJ A;  4DNI A;  1STE A;  4DV6 L;  4GKK Q;  5D3D A;  1SRO A;  2DY8 A;  4JI4 Q;  3A56 A;  3PUZ A;  4OEM B;  2F0K A;  5EJW A;  1J6Q A;  3J7A F;  2DUD A;  3PV0 A;  5GRO A;  4LFC L;  4JI2 Q;  1H9R A;  1QVF A;  3X3N A;  4DV7 L;  1M4V A;  5M3F H;  2ATW A;  2RSN A;  3AQQ A;  3AYH B;  5AFW A;  3NTK A;  4QJF A;  1XNQ Q;  3J80 i;  3STB C;  2Z6K A;  1NSN S;  3W3A A;  2JN4 A;  4A3D H;  4BBS G;  2NVY H;  5CC4 A;  2PNR C;  5E1F A;  1TWA B;  4UP7 A;  5FJ8 H;  3NK9 A;  2Z0S A;  4NP5 A;  1CQF A;  1YJN A;  4DR4 L;  3RZD B;  3HOV B;  1PH7 A;  3FHW A;  4CHT B;  2KCN A;  2F4I A;  5EAY A;  1CQV A;  3NEM A;  2E5L Q;  2VXW A;  4DN4 M;  3S16 B;  2LFN A;  3CCL A;  5CGK A;  5FO9 B;  2I5L X;  1X3F A;  4DPG A;  4DK0 A;  1YNJ C;  5DAU A;  2HD3 A;  2JA7 H;  2IJ0 A;  2HQE A;  1L0X B;  1PDQ A;  1WJJ A;  3W1G A;  2HHH L;  4GOP A;  4CDE C;  1K8G A;  2NN6 G;  3L0O A;  2B63 H;  4IUR A;  1PRT F;  3STB D;  1PVO A;  1N34 L;  3OWE B;  5JAV A;  1AW7 A;  1Z6H A;  2N55 A;  5D65 A;  4TSS A;  3TQY A;  3TZU A;  4P2C B;  3ONA B;  4KK7 A;  5JEA G;  5E4X A;  1QE6 A;  3OOC A;  1K9M C;  5CR3 A;  3I4O A;  4A3G B;  1NE3 A;  3CCR A;  1EWC A;  4R8N A;  1S5E D;  1OTC A;  1UE7 A;  1VQ4 A;  3CW2 C;  2K28 A;  3KBG A;  3S16 H;  4IPC A;  3S1Q B;  4DAY A;  4BY7 H;  4JOI C;  4YWK A;  3K80 C;  3MXU A;  4HID A;  4AQY Q;  3GTQ H;  3KF8 A;  3HOY G;  1YNJ D;  4TKO B;  3H0G B;  3AU7 A;  3I2Z A;  1D7Q A;  3T16 A;  3FKI H;  1VMC A;  3Q22 A;  4EQO A;  2R7D A;  3NEN A;  4RH6 A;  3W5O A;  2DJF C;  1AEX A;  4KHV A;  1N33 Q;  1QNK A;  3PO3 G;  2K5N A;  2X6L A;  4GNX C;  1TY0 A;  1B3A A;  2MNA A;  2K14 A;  2CFM A;  2F0Q A;  3QIA A;  2JSO A;  2EE1 A;  2B2T A;  4DV1 Q;  1Q82 C;  3HKS A;  1GUO A;  1I5F A;  1VQD A;  1UWV A;  4Z9C B;  1NY4 A;  1WD0 A;  1PH8 A;  1WOC A;  1C7Y A;  4A3I G;  3BDC A;  4MHE A;  1XMQ L;  1H9M A;  4JBJ A;  3ZYY X;  1W6K A;  4X65 L;  2BA0 A;  3D6C A;  4JI0 L;  2E2H H;  4EVO A;  1EQV A;  1F2L A;  1A8V A;  2XIW A;  1HHV A;  1SMY C;  1CT1 D;  1EEI D;  3O13 A;  3EA6 A;  4DUZ Q;  3K81 C;  5EBD A;  2JA6 G;  1O7L A;  1EY4 A;  5IP9 H;  1EZ6 A;  2G9H D;  2Q2H A;  2SDF A;  1HZA A;  4BBR G;  1PH1 A;  2Q2T A;  2DGY A;  2IWH A;  1JB3 A;  2EYM A;  5FOB B;  3SK5 A;  1X3Q A;  5ELO A;  4RGN A;  4IZ8 A;  3GTL B;  3DM3 A;  4FDB A;  4ZUI A;  3EFX D;  3SK4 A;  3IL8 A;  2QKI C;  4O2D A;  1HQM C;  1X32 A;  1Y1V B;  2WFW A;  5C4X G;  1BBW A;  4KI0 A;  1VQM A;  1SND A;  2HCI A;  5M5X H;  1VMP A;  3PO2 B;  3LWU A;  1YJ9 A;  1M8A A;  2CHB D;  2VW9 A;  2NVT B;  1VQH A;  4A3E H;  1E2V A;  3X3M A;  1MSH A;  1EFW A;  1GKH A;  1TWG H;  5ELD A;  1HUM A;  3ULJ A;  5I4D A;  4POG A;  3HOW G;  2BDN A;  4S3S A;  3ND8 A;  3I4N H;  1SMY D;  1KQS A;  4MTK A;  4LF6 L;  3JAM E;  1HNZ Q;  2K5D A;  2UXB Q;  4P71 A;  1EU3 A;  2BCO A;  5IGD A;  1TS5 A;  4K5X A;  3MHB A;  4N8F A;  1CTM A;  1NCV A;  5FLX c;  1NJI C;  1V1P A;  3G48 A;  3DM1 A;  5GAD C;  5M3M G;  2K5Q A;  3K5L A;  2UUB Q;  2K03 A;  3H3V I;  5LL6 S;  1FVI A;  2KUM A;  1F2Y A; 
#chains in the Genus database with same CATH homology
 4NMZ A;  3M7G A;  1O7Y A;  1R4P B;  2L12 A;  2WAQ B;  1NR4 A;  1K8M A;  1WCM B;  3ITP A;  1U9R A;  2PPB C;  5JVG 3;  4H44 C;  1WTV A;  2RDF A;  1CA5 A;  4O1N A;  1HCZ A;  4UAI A;  1F2M A;  4K2K A;  4LJZ C;  1R9T B;  5CBA E;  4TQU S;  5CBE E;  1RTO A;  4C3I G;  1VF5 C;  4X3U A;  2EXZ A;  4Q5V A;  4XQJ A;  4L8J A;  2ZXR A;  4FF1 A;  1OXX K;  1RHP A;  1ET9 A;  1ILQ A;  3S9W A;  3Q0A A;  2K1B A;  3R93 A;  3FDT A;  2RBM A;  4CJ1 B;  3A8K E;  3HZX A;  1QJO A;  5IT9 L;  4ZUJ A;  5EPL A;  5M9O A;  5KRU A;  5I9O A;  2HUG A;  2AUK A;  2I07 B;  3OW7 A;  1HFG A;  2KVM A;  5DM6 3;  4HMI A;  5EKI A;  5JEA J;  3IFD A;  3T13 A;  4PQX A;  2A6H C;  1Y1W B;  4OL7 A;  1SNC A;  4PMB A;  4KHZ A;  3A8J E;  4FXD A;  3CHB D;  2XNA C;  4ZYS A;  3AMU A;  1BQQ T;  5JPN C;  3PIO 3;  1LTG D;  5JEA H;  2JE6 I;  3SK8 A;  4XQN A;  2Z1C A;  4HR7 B;  1F9R A;  1SBB B;  3J80 L;  4NKL A;  2QEJ C;  5CV6 A;  4C3H B;  5I6W A;  1PTO H;  4HTH A;  4CJ0 B;  3MVV A;  2F0I A;  3VR4 A;  2A6H D;  3VYT A;  3QJY A;  1MI2 A;  3H3V C;  3SXH A;  1ENF A;  5C4H A;  2EY1 A;  4IUT A;  3W2D A;  1D5Z C;  3S2H B;  3NHH A;  2F3W A;  4J6H A;  3OIP A;  4HN7 A;  5KNB A;  5J22 A;  5A2Q L;  1UAP A;  2PW7 A;  1JWU D;  3QOJ A;  4V0B A;  4H7B A;  3MFG A;  1TVX A;  2SNM A;  2OXP A;  3A54 A;  2HDL A;  3CU7 A;  2B2W C;  4G57 A;  2IL8 A;  3MC0 B;  1BCP C;  4U68 A;  4QUC A;  2EJF C;  2L11 A;  2OEO A;  2F0G A;  3AB9 A;  2LY7 A;  3FRP B;  3DWP A;  1KAB A;  1SYG A;  1OXT A;  3FEW X;  4OIK A;  4BY1 B;  5CV8 A;  2Q8R E;  2ZT9 C;  2J0T D;  1PTO C;  2F0M A;  4YIJ A;  2J7Z A;  1HTL D;  1CFM A;  1HFN A;  1V1P B;  3NP8 A;  3MEH A;  4J1M A;  5C0X H;  2DNC A;  3N6R A;  1QCB D;  1BCP D;  2YU9 B;  2K05 A;  5C44 B;  1FNU A;  1LTR D;  5EPJ A;  4DU9 A;  1G8Z D;  1LLR D;  1G2S A;  3DMU A;  2A5H A;  2PYK A;  3PUV A;  3S17 B;  3DEP A;  2A73 B;  1LV9 A;  1TR5 A;  5CV7 A;  4G4K A;  2MJ8 A;  1PTO D;  4WOR A;  2Z8L A;  1H9K A;  2L0C A;  3J81 E;  4X3K A;  2JXM B;  3H94 A;  5IOC A;  1D6E C;  2KEE A;  3SVM A;  4E6I A;  2NWG A;  2NTS A;  4C3J G;  1ONL A;  4GZY C;  2IW3 A;  4KJO A;  1KNE A;  4A3B B;  3S2D B;  1DOM A;  2XWB B;  1E2Z A;  3GTM B;  5I2Y A;  1SAP A;  2DN8 A;  2RQX A;  3CRL C;  2G9D A;  1ENA A;  1V43 A;  1PXU A;  2K5W A;  4KY7 A;  2K6A A;  4RWS C;  2VUM B;  2XWJ B;  1SYD A;  3KBX A;  3C46 A;  2J4X A;  2A68 C;  1B1Z A;  1I4R A;  3HOX B;  5FK9 C;  3NPP A;  1F77 A;  1F9Q A;  1FNW A;  1CA6 A;  4RHR A;  1PRT C;  2N88 A;  2AQ3 B;  3PMF A;  4DGZ A;  4OIJ A;  2F0S A;  1EIG A;  4ABN A;  2JYO A;  4IAL A;  4PNY A;  2WV6 D;  1BR9 A;  4ZRZ A;  2RA4 A;  3GTK B;  2A6E C;  5M5Y B;  1D2B A;  1Z7T A;  1RTN A;  1KNA A;  3GQB A;  2L1B A;  2IX1 A;  2A68 D;  1FD7 D;  3VA5 A;  3VA7 A;  2E2D C;  2KOL A;  3OIQ A;  5M3F B;  1PRT D;  2RVL A;  3D3R A;  3I70 A;  5EKK A;  5G3L D;  2EYO A;  2NVY B;  4V19 0;  2A6E D;  3K58 A;  1FGB D;  3NBI A;  4G7Z C;  2R61 A;  3MWY W;  1SDF A;  3EQL C;  4K8I A;  2VB3 X;  2JA7 B;  2LKV A;  2L5T A;  3TME A;  1HA5 A;  1LT6 D;  2B63 B;  4DAP A;  4CKE A;  3L7Z C;  2CVR A;  1GXD C;  2VB2 X;  1LT4 D;  3P20 A;  4MN3 A;  3R3O A;  4C56 C;  1AN8 A;  1DOL A;  3BDO A;  4HCS A;  4F8M A;  4K6L A;  4HSP A;  4RKB A;  2B2W A;  3R2T A;  1EY7 A;  4TRD A;  2PMZ B;  4O42 A;  4BY7 B;  3GTQ B;  4ZK9 B;  1LTS D;  2PCF B;  1DCZ A;  3BG3 A;  3MAQ A;  1QIL A;  3FKI B;  5IGE A;  4K14 A;  2KCC A;  4B08 A;  3K59 A;  3M4Y A;  2BE5 C;  3SDZ A;  1GUN A;  3NQI A;  2A69 C;  1QB5 D;  1STB A;  4HSV A;  4DA2 A;  1Z47 A;  1RKN A;  5COR A;  5JVH 3;  1IW7 C;  3G6J B;  1U4M A;  3PUY A;  4A3J B;  3Q24 A;  3P75 A;  1Y8P B;  2F0D A;  3ERQ A;  4KKT A;  1STN A;  2WKC A;  3VR2 A;  3NQT A;  2E2H B;  3DWQ A;  2IX3 A;  4I65 A;  1Q90 A;  1IL8 A;  4CJ2 C;  3TP8 A;  2BE5 D;  2EVB A;  2A69 D;  3HGB A;  1A2T A;  5FO7 B;  5ISR A;  4IFD G;  2F0L A;  1GUW A;  1EQT A;  3GD7 A;  1T5E A;  1IW7 D;  4ZAI A;  1G6Z A;  5M5X B;  4L6T B;  5A35 A;  4OGQ C;  4A3E B;  1EEF D;  4QB4 A;  1TWG B;  4KTA A;  5EQ0 A;  3I3C A;  1UEA B;  3I4N B;  1A3T A;  2EYJ A;  1H9S A;  1EFI D;  1YNN C;  4PMW A;  2HDM A;  3I4L A;  3BS1 A;  3QB3 A;  1MGS A;  3OMC A;  1B44 D;  1AFP A;  2KHS A;  2PZU A;  1EIH A;  3BVM A;  1KDC A;  4BS9 A;  1G2T A;  1FYC A;  1Q1B A;  4AYB B;  4IUN A;  1B2T A;  3LX0 A;  1CZW A;  1UNS A;  4FF3 A;  2RDH A;  1PZI D;  2PZW A;  1NUC A;  1C4Q A;  2FHT A;  2RKS A;  1WTR A;  3S15 B;  1STA A;  2KA7 A;  4KY6 A;  4OO1 G;  4M1U B;  1YNN D;  3S1N B;  4KKU A;  1SNQ A;  2AQ1 B;  1I4H A;  3NXW A;  3VR6 A;  2B2U C;  1MBY A;  1EL0 A;  2O4X A;  2EYH A;  3BZD B;  2EDG A;  1CZG A;  1QNU A;  3I8Z A;  3TZD A;  1CM9 A;  1F9P A;  1GUG A;  1CHQ D;  5TSS A;  2ZXP A;  2FIN B;  4RGO S;  1JQY D;  5DEH A;  3K7A B;  3T56 B;  1ZKO A;  1TS4 A;  4ILW A;  1B9M A;  2RSO A;  1LTB D;  1CK1 A;  1ZXT A;  1SNM A;  1ICW A;  4HED A;  3HG9 A;  2LMC B;  2NN6 I;  2ICE C;  1HQR D;  1Y69 U;  2HCC A;  2PW5 A;  1BCP B;  5EGT A;  3NBH A;  1Q1E A;  4XT1 B;  1AZP A;  1JOK A;  2O2L D;  2NBF A;  1LTA D;  5FO8 B;  2E2J B;  2WIN B;  5J1Z A;  4EQP A;  3VYR A;  1I50 B;  2SOB A;  2K32 A;  1MD2 D;  3NE5 B;  5FLX E;  3VR5 A;  2AUJ D;  4I7Z C;  2KEC A;  1PTO B;  4DXF A;  3Q6S A;  3IAY A;  3HOY B;  3TBI B;  1U4R A;  2NN6 H;  3IKJ A;  2O5J C;  1GUT A;  5C4Z A;  2NVX B;  4IUU A;  1SE4 A;  3D4W A;  4XYO A;  1A2U A;  5J39 A;  1RD9 D;  3R2I A;  2Z4H A;  5FKA C;  3PO3 B;  3K6O A;  3HEJ A;  1O78 A;  1S5B D;  2TMP A;  2R6G A;  2JEB I;  2EYL A;  1V8Q A;  4IFD I;  1JWS D;  2H1E A;  1PZK D;  2EY5 A;  2F0N A;  2VNU D;  3S1R B;  4A3I B;  1E0B A;  5CV4 A;  4IFD J;  2H4O A;  1VDZ A;  1S5D D;  5NUC A;  4FYD A;  2ICI A;  4RCN A;  3NWS A;  3CKI B;  2E75 C;  5JJZ A;  1EY5 A;  1Q12 A;  3NWT A;  3D31 A;  3M3Y B;  2FMC A;  1XTC D;  4BBR B;  2X69 A;  1L0Y B;  2C5C A;  1BDO A;  3KLR A;  4IFD H;  3DWA A;  2WP8 J;  2R92 B;  4XQQ A;  3EVQ A;  3I73 A;  5F2D A;  4KMU C;  1TKW B;  3GO5 A;  1A3V A;  1PMR A;  1TU2 B;  1I4P A;  5C4X B;  1H9S B;  1DD2 A;  5JOB A;  3J81 L;  1KDB A;  1SFO B;  1G91 A;  1PRT B;  1U4P A;  3DHQ A;  3GTP B;  4LAA A;  3A7L A;  2V4D A;  3K5N A;  1SSO A;  1C48 A;  2F03 A;  1Q3L A;  3Q23 A;  1IKM A;  1QWY A;  4OO1 I;  2B8G A;  3F2U A;  4J8Q A;  2EYP A;  1HRJ A;  1B53 A;  3MZ5 A;  4G7H C;  4FF4 A;  3QOL A;  1QOH A;  2F0V A;  5HGT A;  3MXN A;  2D9U A;  3U9S A;  3T4A C;  1DM0 B;  2EPB A;  1SJH D;  2M2L A;  1V1O A;  4FP5 D;  4QMG A;  1D1K A;  3H09 A;  5C3W A;  5KNC A;  5C3X A;  2E76 C;  4FVM A;  4Y7N B;  4RGT A;  1WTO A;  3DUZ A;  1SYF A;  4C1N I;  4OO1 H;  5IIF A;  4L63 B;  2MPM A;  5IGF A;  1EY0 A;  5T1G A;  2WB1 B;  4C1N K;  2B2U A;  3KUP A;  1EWH A;  5ELB A;  2BA1 A;  4G7O C;  3TP7 A;  1IHZ A;  3V2T A;  1VF7 A;  3GV6 A;  1S4Z A;  1QG7 A;  1U4L A;  1BUV T;  2QIL A;  3ERO A;  4ULL A;  3FPU B;  5KEE A;  3NTI A;  1I6H B;  2IT1 A;  1HA6 A;  1PZJ D;  1NR2 A;  3MTS A;  1JC7 A;  2MUY A;  1I6V C;  3OPO A;  1SE2 A;  1LO5 D;  2M9V A;  1ESF A;  2BDO A;  2XRS D;  1EY9 A;  1PYW D;  1TY2 A;  3RLF A;  1LAC A;  3PUW A;  1FNV A;  1KLG D;  1DJR D;  4XT3 B;  2EY6 A;  2WAC A;  3PIP 3;  3M4O B;  4BA1 I;  1OXS C;  1Q8I A;  3HOZ B;  1LAB A;  1BBX C;  4K8J A;  5LL6 X;  4B9X A;  4RFB A;  2CQA A;  1ESR A;  1K83 B;  4QIW B;  3FVQ A;  5M5W B;  2C9O A;  1STH A;  3SE0 A;  2DNE A;  4N9P A;  4FXG C;  1JCK B;  2NZ1 D;  2OT2 A;  5C5L A;  4WFN 3;  1JOQ A;  4R8I A;  3K5M A;  2YYZ A;  2B2Y C;  4DAV A;  5EPK A;  1LT3 D;  4IN3 A;  1BF4 A;  4DFA A;  4M8A A;  4KKS A;  2XRQ D;  3K5O A;  2EJG C;  2WKD A;  2OF1 A;  5C3E B;  4K5V A;  4RA8 A;  3GTG B;  3BYY B;  1KTK A;  2MHV A;  4IUV A;  5IGB A;  1SXT A;  5C5M A;  3RD4 A;  3PUX A;  4RCO A;  4ID6 A;  3T53 B;  4F88 A;  3DXJ C;  1T5X D;  1OO9 B;  5BN5 A;  3GTJ B;  1Y8N B;  2RDG A;  2XN9 C;  4NDX A;  2NTT A;  5ELE A;  5IGC A;  4C2M B;  1FR3 A;  3D6W A;  1DZ1 A;  2Q8I B;  1J8I A;  1TWH B;  5KYI A;  2JA5 B;  1KDA A;  3C1E A;  3WDN A;  2JP1 A;  1RDP D;  2B8F A;  2E74 C;  2IX0 A;  2FMM A;  3VYS A;  4CGY B;  3OMG A;  2K7V A;  2NUC A;  1JR0 D;  1ZYR C;  2B2V C;  4K5W A;  2JEA I;  5DNF A;  1S5C D;  3NSW A;  1JE4 A;  3SK6 A;  1XYI A;  3E5S A;  1EYA A;  4XDX A;  4FO2 A;  4DNR B;  1I4G A;  3J7Y W;  2MGS A;  4CKC A;  1X3P A;  5I6Y A;  2R3Z A;  4RKL A;  5G3L F;  2EZV A;  4C3J B;  3RZO B;  2AWO A;  1WTW A;  2KQ3 A;  2L55 A;  4X3S A;  2B39 A;  3KLS X;  1SJE D;  4LK1 C;  3HOU B;  1ZYR D;  3HRZ C;  4NW2 A;  4BA2 I;  4DXG A;  3I91 A;  4QF4 A;  4X3T A;  1LTI D;  3JAM L;  2XSC A;  4ZKB B;  2EJM A;  1STG A;  2Q8T A;  2K04 A;  3QG1 A;  2I46 A;  4BWG B;  3P7J A;  5D14 A;  2AQ2 B;  4K6D A;  1F9S A;  4RHS A;  1II3 A;  4DF7 A;  3I4M B;  4C3H G;  1G29 1;  1TWF B;  2O5I C;  2F0O A;  4HAE A;  1H9J A;  1TWC B;  1BNZ A;  2D2C C;  2EY2 A;  1GJX A;  3R8B A;  4K2L A;  1LTT D;  4QCL A;  4KD4 A;  3CQZ B;  3TDQ A;  2SNS A;  1TQO A;  3A7A B;  1TII D;  1WTQ A;  4EGV A;  1A3U A;  3URY A;  3HP3 A;  1A15 A;  1OXU A;  5CMD A;  3FPP A;  3M7N A;  2L4N A;  5E4W C;  3TSS A;  5FLX L;  1DON A;  4ZKC B;  1DOK A;  1LT5 D;  3K0Y A;  4H13 C;  4H0L C;  1JWM D;  5C0X G;  2Y0S B;  1HXY D;  1KAA A;  5DM7 3;  1CI3 M;  1F2Z A;  1GHJ A;  2D62 A;  2F0W A;  1EOT A;  3GTO B;  4XYQ A;  3SHL A;  1JIC A;  2F1M A;  2D5D A;  5CV5 A;  4BBS B;  3TN2 A;  3U9O A;  3A8I E;  1ILP A;  1RCV D;  4ODG A;  2LS0 1;  4IUQ A;  2B2Y A;  3VYU A;  5HUR A;  2ID0 A;  2R7Z B;  2NYZ D;  3OWF A;  5KND A;  2K33 A;  2QF7 A;  1XXG A;  2PZT A;  2PO4 A;  1CHP D;  5KGU A;  5I2X A;  1GUS A;  5KYL A;  1TS2 A;  4XIG S;  3J7A V;  1SE3 A;  5CYU A;  3KLS A;  1S5F D;  3SEB A;  2FFK B;  2WII B;  1ROD A;  1TS3 A;  1I4X A;  4EQN A;  4KJN A;  3P1H A;  1IYU A;  1WTX A;  1EYD A;  1EZ8 A;  5COY A;  2CW0 C;  4KV6 A;  1IKL A;  4MIU A;  1DXM A;  2F0U A;  3I90 A;  1J9O A;  3QWN A;  5CV9 A;  4F7X A;  4F87 A;  1Y8O B;  4ZLT F;  1A6X A;  4KD3 A;  2AWN A;  1RF2 D;  2F3V A;  3NTH A;  2A74 C;  4KN7 C;  2F0F A;  1EY8 A;  2B2V A;  4CKB A;  1EU4 A;  4ZQ3 A;  1PFM A;  1BOS A;  1R4Q B;  2L9H A;  1BO0 A;  1UUP A;  4IUP A;  2CW0 D;  4FNF A;  3L3O C;  3LWE A;  3KK7 A;  2Z4I A;  1TT2 A;  3D8G A;  3GV3 A;  2SEB D;  4N9T A;  5IGG A;  4XXE A;  1D1I A;  4JK1 C;  1AZQ A;  3MXG A;  4XTC S;  5K36 G;  3BVG A;  1NAP A;  2KJX A;  2JA6 B;  5K5P A;  1D5M C;  3WOF A;  3M85 A;  1EYC A;  4PMC A;  1DYQ A;  4FF2 A;  3C2P A;  1PFN A;  1WVL A;  1ENC A;  2QCP X;  1XX8 A;  5IT9 E;  2XVS A;  5KIX A;  1O7Z A;  3ND9 A;  1ZEQ X;  4LMQ D;  3D4D A;  3HOW B;  2KED A;  4JBW A;  1HPC A;  3MFY A;  1I4Q A;  1SYB A;  1JOO A;  1IYV A;  5E3F A;  2X6G A;  2MP1 A;  1ET6 A;  5EBC A;  3V05 A;  5IOD A;  5M3M B;  5C0X I;  4U67 3;  1C8C A;  5C4J B;  1HUN A;  5ELF A;  1SYC A;  2F0J A;  2ZXO A;  1PLF A;  2DY7 A;  5C0X J;  3J80 E;  3CRK C;  2QDB A;  4QUF A;  4WJW A;  4ME5 A;  1GOZ A;  4HCE A;  2PQE A;  3MA2 B;  1STY A;  1WD1 A;  2IPK D;  2F0T A;  4DK1 A;  3VR3 A;  3G7L A;  1O80 A;  3HS0 C;  3IFT A;  4C3I B;  5C6A A;  3L9A X;  4A93 B;  3SR1 A;  5ELC A;  3UI2 A;  5LHY 1;  3LNN A;  5BN3 A;  1D5X C;  2JA8 B;  4DNT B;  1B50 A;  2FJ2 A;  1SNP A;  5A2Q E;  3I72 A;  1BXT A;  2R93 B;  3FMC A;  3N52 A;  3C3L A;  1B9N A;  3V96 A;  3GP7 A;  2B2T C;  4R9W A;  3RUZ A;  5JPM C;  4KN4 C;  1VCI A;  3HKZ B;  1SYE A;  5BN4 A;  1B4O A;  3A55 A;  3OHX C;  3BYT B;  4A3F B;  3C1F A;  1XWE A;  2K01 A;  5EKL A;  3TP6 A;  3NUC A;  4CBV A;  4RAU C;  4KY5 A;  3WOE A;  1JOR A;  4FXK C;  3OSO A;  1WTP A;  2F0P A;  4Q0F A;  3S1M B;  1AP0 A;  4OHJ A;  4UDU C;  2NB0 A;  3S14 B;  1RJT A;  1ML0 D;  2F0E A;  3K57 A;  3D4R A;  3QO2 A;  1EY6 A;  2EOT A;  3T51 B;  2NVQ B;  1BCP F;  3H91 A;  1MSG A;  4PV1 C;  2TSS A;  5T1I A;  5D3I B;  4B9W A;  2M00 A;  1K8O A;  1I3Q B;  4RGM A;  2F0H A;  4IQZ A;  3DEO A;  4A3K B;  1PTO F;  5I9P A;  1OXV A;  3BVZ A;  4A3M B;  3E6Z X;  4WRD A;  2ENB A;  3E0J A;  3RMH A;  1KLU D;  1HTP A;  2BOS A;  1PFB A;  3TP5 A;  3H6M A;  1SNO A;  2GA4 B;  1E2W A;  2EYF A;  3MXP A;  1GHK A;  4A3D B;  3EJI A;  1W6J A;  5K36 H;  1SEB D;  2E2I B;  3BDL A;  4HMJ A;  1STE A;  5D3D A;  2DY8 A;  3A56 A;  3PUZ A;  2F0K A;  5EJW A;  3J7A F;  3PV0 A;  1H9R A;  3X3N A;  1M4V A;  2RSN A;  5AFW A;  3NTK A;  1NSN S;  3W3A A;  5CC4 A;  2PNR C;  5E1F A;  1TWA B;  3NK9 A;  4NP5 A;  1CQF A;  3RZD B;  3HOV B;  4CHT B;  2KCN A;  2F4I A;  1CQV A;  2VXW A;  4DN4 M;  3S16 B;  2LFN A;  5CGK A;  5FO9 B;  4DK0 A;  1YNJ C;  5DAU A;  2IJ0 A;  2HQE A;  1L0X B;  1PDQ A;  2NN6 G;  4IUR A;  1PRT F;  3OWE B;  5JAV A;  1AW7 A;  1Z6H A;  2N55 A;  5D65 A;  4TSS A;  3TZU A;  4P2C B;  3ONA B;  4KK7 A;  5JEA G;  5E4X A;  1QE6 A;  3OOC A;  5CR3 A;  4A3G B;  1EWC A;  4R8N A;  1S5E D;  2K28 A;  3KBG A;  3S1Q B;  4DAY A;  3MXU A;  3KF8 A;  1YNJ D;  4TKO B;  3H0G B;  3AU7 A;  3T16 A;  1VMC A;  3Q22 A;  4EQO A;  4RH6 A;  1AEX A;  4KHV A;  1QNK A;  2X6L A;  1TY0 A;  1B3A A;  2F0Q A;  3QIA A;  2JSO A;  2EE1 A;  2B2T A;  1GUO A;  4Z9C B;  1WD0 A;  3BDC A;  4MHE A;  1H9M A;  3ZYY X;  1W6K A;  2BA0 A;  3D6C A;  4EVO A;  1EQV A;  1F2L A;  2XIW A;  1HHV A;  1SMY C;  1CT1 D;  1EEI D;  3O13 A;  3EA6 A;  5EBD A;  1O7L A;  1EY4 A;  1EZ6 A;  2G9H D;  2SDF A;  2IWH A;  1JB3 A;  2EYM A;  5FOB B;  3SK5 A;  1X3Q A;  4RGN A;  4IZ8 A;  3GTL B;  4ZUI A;  3EFX D;  3SK4 A;  3IL8 A;  2QKI C;  1HQM C;  1X32 A;  1Y1V B;  4KI0 A;  1SND A;  2HCI A;  3PO2 B;  1VMP A;  3LWU A;  1M8A A;  2CHB D;  2NVT B;  1E2V A;  3X3M A;  1MSH A;  5ELD A;  1HUM A;  5I4D A;  2BDN A;  4S3S A;  3ND8 A;  1SMY D;  3JAM E;  2K5D A;  1EU3 A;  2BCO A;  5IGD A;  1TS5 A;  4K5X A;  3MHB A;  1CTM A;  1NCV A;  1V1P A;  3DM1 A;  2K5Q A;  3K5L A;  2K03 A;  5LL6 S;  2KUM A;  1F2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...