1IHZA

Structure of s. nuclease mutant quintuple mutant v23l/v66l/i72l/i92l/v99l
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYLYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Proteins with simplified hydrophobic cores compared to other packing mutants.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ihzA00
1SNQA 2EYPA 2EXZA 2F0GA 2F0HA 1SYFA 1II3A 3D4DA 3DHQA 3SK4A 3VA5A 1TR5A 3OSOA 3HZXA 3DMUA 3OWFA 5CV9A 4N9PA 3QOLA 5KEEA 1TT2A 4KJOA 4EVOA 4PMCA 1EY0A 5C4ZA 5CC4A 4KJNA 3PMFA 4K5WA 1F2YA 2QDBA 1NSNS 3NK9A 4WORA 4YIJA 3SXHA 5I6YA 2F0QA 1JORA 1SNDA 2F0WA 4IALA 4PMBA 3H6MA 4KTAA 4NMZA 5CR3A 5DAUA 2SOBA 4K8IA 4F8MA 1STYA 4K2LA 5C3WA 5K5PA 5JOBA 3P75A 4G57A 2F0MA 3SR1A 3TP5A 5CV7A 2F0VA 4QB4A 1U9RA 2EYFA 2EYLA 4DF7A 5EGTA 3NQTA 1KABA 2EY1A 2HQEA 3LX0A 2F0OA 2PZTA 5NUCA 2PZUA 4DU9A 2EYJA 5I6WA 4QMGA 1STGA 1STNA 5IGFA 5ISRA 2OF1A 2F0SA 4QF4A 3ERQA 4KY7A 1ENCA 2F0DA 2F0KA 4H7BA 3SK6A 3ITPA 4LAAA 3TP6A 2SNMA 3T13A 1STHA 2EY6A 4RKBA 5I9PA 1SNPA 1A3VA 4HTHA 4KY5A 5IOCA 2KQ3A 4HMJA 3NUCA 5M9OA 3E5SA 1SYDA 5IGDA 3BDCA 4I65A 4RKLA 3TMEA 1RKNA 1NUCA 1SNCA 1EYAA 5HURA 1SNOA 3P1HA 1SYBA 1TQOA 2F0UA 1JOKA 2F0NA 2KHSA 3MHBA 3R3OA 5C5LA 4DGZA 1SNMA 4R8NA 1EY6A 2PQEA 5I9OA 4NKLA 5JAVA 2EY5A 1F2MA 1KDAA 3EROA 1EY8A 1STAA 3MEHA 4J1MA 5IODA 1EQVA 1EY4A 4K2KA 1ENAA 4KY6A 2F0JA 2EYHA 4EQPA 4HMIA 3S9WA 2EYOA 3BDLA 4J6HA 4MIUA 4NP5A 2F0LA 4PNYA 1EZ6A 3EVQA 4K5VA 2PW5A 5C4HA 3TP7A 5C6AA 3NXWA 4K5XA 2M00A 2PW7A 3EJIA 3OMCA 5E1FA 5IIFA 5CV6A 3D8GA 2F0FA 1A2TA 5EKLA 3OMGA 4IZ8A 1KAAA 2F3WA 3D4WA 5DEHA 1A3TA 3HEJA 1EYDA 5KYLA 2PZWA 5IGEA 2RBMA 1EY9A 2SNSA 5CV5A 4B9WA 5KRUA 4K8JA 1EZ8A 5J39A 4ZUIA 5KIXA 4N9TA 5IGBA 5E3FA 1A3UA 2F3VA 3SK8A 1EYCA 2O4XA 3NP8A 2NUCA 2OEOA 2EYMA 5J22A 4K6DA 3U9OA 1SYEA 2RDFA 4ODGA 4ME5A 4IUNA 5HGTA 4ZUJA 5F2DA 4KD4A 5KGUA 3TP8A 1EY5A 2PYKA 4S3SA 3MXPA 5CV8A 5J1ZA 5CGKA 3MZ5A 2EY2A 2F0PA 1KDCA 2LKVA 3QOJA 4KHVA 1A2UA 1SYCA 3MVVA 4F7XA 3RUZA 3V2TA 2WACA 5CV4A 4ZQ3A 1KDBA 4TRDA 4KV6A 1JOQA 5C5MA 1JOOA 3SHLA 4KD3A 1F2ZA 3QB3A 2F0TA 2OXPA 4WRDA 3T16A 1IHZA 2F0IA 5KYIA 3SK5A 3C1EA 4E6IA 5EKKA 5C3XA 2F0EA 1AEXA 4OL7A 4NDXA 4B9XA 1STBA 4EQOA 4EQNA 4ID6A 2RKSA 3NHHA 4K14A 3C1FA 2ENBA 1EY7A 5IGGA 5IGCA 3D6CA 4DFAA 1SYGA
chains in the Genus database with same CATH superfamily
1EIGA 1XPUA 1SNQA 1DGSA 5IYDH 1OTCA 2OQKA 5M5XB 3P20A 3DHQA 3GV3A 3S24A 5CV9A 1MSHA 3AMUA 2CVRA 2BA0A 4DV5Q 1WFQA 5IYCH 3NK9A 3M4YA 4OWWB 1KL9A 2BA1A 4F8MA 3PO3B 1TY2A 2B29A 3A56A 2FJ2A 4GNXC 2KOLA 5IYBG 3GTGH 3HOUH 2JA8B 2ATWA 1WTRA 3KLSA 5FO7B 4H13C 1V1PA 2EJFC 4DR1Q 3PF5A 4DR4L 4RCNA 3CMEA 2RSNA 1I94L 3HKZB 2KHIA 1SDFA 1AH9A 1PH7A 4H7BA 2Q8RE 4A3MB 3SK6A 2ZXRA 5ELOA 3S2HB 2EY6A 1SNPA 4UP9A 3A0JA 1VQPA 4Q5VA 4DV3Q 1H9SA 2NVQB 4RKLA 1KC8C 3CP0A 2C9OA 3E6ZX 5LMNW 2F0UA 4GS3A 1BVSA 3STBC 1EY6A 4XYQA 1F77A 4DV6L 4C3HG 3URYA 1QCBD 3FKIH 2B63B 1Q8IA 4BY1B 4EQPA 5M5XH 2EYOA 1Q12A 2HD3A 3NELA 3T1YQ 1A6XA 2G5DA 3NXWA 4U68A 3ONAB 2VXWA 4GLVB 3PO3H 3MWYW 3KLSX 3MFGA 3EBEA 1AN8A 5IGBA 3RN5A 1I6VC 1GHKA 1E2WA 3S1RB 4A3KG 1YZ6A 5HGTA 2QA4A 2D62A 4DKAC 4DNIA 2IHEA 2VQEL 1RJTA 4NXNL 2VS1A 3J81L 1CZWA 2NN6H 4A3MH 1KDBA 3G4SA 3S2HH 4RA8A 3Q24A 1EIFA 2WAQE 1MBYA 3FRPB 5M3FG 4HIKA 4KLKA 1QZGA 2NVQH 1BKBA 1Q86C 2A74C 2B2YA 2RKSA 5JVG3 4DUZL 1O78A 4LFAQ 3PUXA 1SYGA 1VQFA 4C56C 2NVTB 2EYPA 2X69A 1HJPA 4A3GB 2B63H 4BY1H 3KF6A 1D1IA 1W6JA 1X3QA 1SBBB 3E3XA 2A6HC 4ZKBB 3KJOA 4B3TQ 1D2BA 1F2YA 2K5NA 1BO0A 4YIJA 5I6YA 1PFSA 2IPKD 5C3EG 1XX8A 3A54A 4KTAA 4NMZA 2SOBA 3DM1A 5E4WC 1STYA 4P2CB 4LF6Q 3R2TA 1SSOA 3K0YA 4HR7B 4IJHA 1TVXA 1AFPA 3AB9A 3I72A 1S4ZA 3CPWA 5ISRA 2MO0A 3S1RH 5TSSA 2HCCA 3FEWX 4TSSA 1EEFD 3J7ZC 2A8VA 1A63A 2JA6B 2ASBA 2YYZA 2NWGA 1KRSA 1UEAB 4DAPA 1IBLQ 1ML0D 3TMEA 2EQSA 5HURA 1OXXK 1VQIA 3E9HA 1UAPA 4LF5Q 4DR7L 1G291 4DV1L 1C0AA 2JA5B 4DK3C 2E2DC 3MEHA 1UWVA 3JC66 3KF8B 2EJGC 2NVTH 3I4NG 4A3GH 1N9WA 1HR0Q 2MQHA 3ULPA 2Q2IA 3D6WA 2ZM6Q 4LW1A 4PQXA 4MTKA 3TP7A 4DR2L 1WTQA 2O5IC 2QEXA 1I6HB 1VMCA 3ICEA 4LK1C 2O2LD 3I4MH 3HOZG 1B2TA 4B3ML 2OCEA 4MHEA 4HIOA 1X9NA 1N34Q 4R4OA 2D9UA 2F4VQ 4FF4A 3HOYB 4AQYQ 3J80E 4FXDA 5G3LF 2HT1A 3CQZB 2DN8A 4X64L 2PYKA 3DXJC 2LKVA 1I50B 3AEVA 1SYCA 4HCSA 3NTKA 1VQJA 1L0WA 3PUWA 1AP0A 2GVBA 2JA6H 4LF7L 1GUTA 3T1HQ 3RMHA 3Q22A 1B4OA 4QIWE 5GADC 1N33L 1KD1C 3NTHA 2ZJRA 2A68D 1STBA 1HUMA 4HIMA 5ELCA 4DAVA 1EY7A 3TSSA 1V1QA 1TWCB 3TZDA 2JA5H 1K8OA 3I8ZA 1CM9A 4HJ5A 3NEMA 2K50A 1VQ7A 1PFBA 4PMCA 3GTMB 3TRZA 3PMFA 3P7JA 3A55A 5CR3A 4X3SA 3L2PA 3HRZC 4K8IA 2E2HB 4CKCA 5KNDA 4CKEA 5K5PA 1LTAD 2CWAA 2ID0A 4P74A 2EE1A 1GXDC 4IUVA 3TP5A 5IT9E 3JAME 2LS01 3LX0A 5NUCA 3HOYH 1QUQB 5I6WA 1TKWB 4X65Q 1JWUD 1AE3A 1KLGD 1L2FA 3SVMA 1VF7A 1M8AA 4X66L 1T5XD 4L5RC 2E8GA 3FPUB 1PXUA 4P71A 2B2TC 1I50H 1L1OA 4RKBA 4GKJQ 4B3SL 1T9HA 1XTDA 4KY5A 2TSSA 3KYHC 3S14B 2HIXA 2E76C 2K5WA 1SNCA 4JVZA 3V05A 1RD9D 3AYHB 3J80i 1S3OA 1Y1VG 3IL8A 3GTLB 1PFNA 1TWCH 2KA7A 1XPRA 3OWEB 4N8X1 1D1KA 2JE6I 4MIUA 4R4IA 4A3EB 1WTWA 1HUNA 1BCPD 2MUYA 3GTMH 4G7OC 1FR3A 4KN4C 4LWCA 4JI3L 2VQFL 1XNRQ 4RHRA 3ULJA 2E2HH 4A3DB 2Z1CA 1TWFB 3K5NA 3HOVB 4Y52H 3CCLA 2E2IB 1SEBD 3TBIB 2NTSA 1TIID 3KOJA 4HJAA 1QZHA 2O4XA 1MHWC 5GROA 3G6JB 1CHPD 3VR5A 3RNUA 3BZCA 5C4JB 1ET9A 3LNNA 1EY5A 1SJED 1LTGD 2A5HA 2F0PA 1PH4A 1G2SA 3PUYA 3J81c 4JYAQ 4JI0Q 3U9SA 3F2BA 1RCVD 3S14H 2A69C 5C3XA 3U4ZA 3UDIA 2WB1B 3T4AC 3JAMi 1MD2D 3C1FA 1L1OC 1FL0A 4ZKCB 5IGGA 5IGCA 4OO1H 4A93G 1ZYRD 1RIPA 4L63B 4MN3A 1YIJA 1Z9FA 3TZUA 4JI8Q 1QOHA 4EVOA 4BBRB 4A3EH 5GAEC 1Z47A 2QDBA 4I7AA 4ABNA 5C4XH 4EGVA 2RVLA 5EKIA 5C3WA 2VL6A 3NBIA 4OX9Q 3HOVH 1TWFH 2YTXA 1CSPA 1SE3A 2EDGA 4DNTB 4YCWA 3G6EA 2E2IH 1HNXL 1S5FD 4XIGS 1D6EC 5AJ3L 4A3BG 3CCSA 5IGFA 2QKIC 4C3IG 2CWPA 2V1CC 5C4JH 4RH6A 1H95A 3ITPA 1VQ8A 4DN4M 4ZLTF 1D5XC 3Q6SA 3A5UA 1LV9A 4X3KA 3IFTA 1A0IA 4DA2A 2M9VA 3R3OA 3VDYA 1SMXA 1M1KC 4B3RL 3A5ZB 4UDUC 3OPOA 1UE7A 2OTJA 3I56A 2NN6I 1YHAA 2CKZB 1O7YA 3CRLC 1K83B 4PNYA 4K5VA 1ASYA 4BBRH 4A76A 1BDOA 1DZ1A 1EFWA 1PYBA 5LL6X 1G6ZA 2ZT9C 1F9RA 2OQ0A 1V1OA 5DEHA 1Y8OB 4OIKA 3I91A 5A2QL 2XVSA 1IL8A 2K5DA 3A7AB 5CMDA 1HFGA 3NENA 4U673 3FHWA 2Q8TA 1JWMD 3GV6A 4IUNA 4C3JG 1QNUA 4DXGA 2IY5B 4BY7G 5LMNQ 1PZKD 4HN7A 4BXXG 5CORA 4UHVA 1YNXA 2GA4B 2K7VA 1WI5A 1HZBA 1X65A 1F2ZA 2Z4HA 5IYBH 1AEXA 4JI4Q 4A3KB 1IYJB 4FXKC 3AQQA 1SE4A 2K28A 1I4PA 2F0HA 2EXZA 1II3A 3DMUA 1S5DD 3G48A 4CJ0B 1MKHA 5C4ZA 4RCOA 4ULLA 1EY0A 5DLQE 5CC4A 1KQSA 4CHTB 1K83H 4K5WA 1TWHB 5M3FB 4A3CH 1S5ED 3WDNA 2H1EA 2Z0SA 3CW2C 1Q3LA 2QGQA 2Z6BA 2R92H 1WJJA 3DWAA 3UDGA 1TS2A 4AYBG 3MXNB 4DF7A 4QB4A 1I5FA 2WB1E 5C0XG 4YHHL 1Y1WH 2PMZB 1VF5C 1IKLA 2AUKA 4UAIA 2F0SA 2EOTA 4LF8Q 2ZTEA 3SDZA 1A62A 3S15B 5IWAL 1KLUD 3J7A5 3QR8A 4DAMA 2JP1A 1X3EA 3ER0A 2SDFA 3WOEA 5IP9H 5EBCA 2K05A 1TQOA 2KHSA 5C5LA 1PH6A 3NQIA 5BR8L 4A3KH 4NKLA 4K0KL 3HP3A 3E0JA 1O7LA 1FJGQ 3PIO3 4C1NI 5BN5A 4DR4Q 1PYSB 1T5EA 3SE0A 3LWUA 1EQQA 1J5EQ 4R4TA 5JVH3 3FVQA 2VUMG 4H44C 1XTCD 1HNWL 5M3FH 1A2TA 3D3RA 4QUCA 2H4OA 1HZ9A 1TWAB 2F3IA 4HIDA 2RDGA 3M7GA 1PH5A 1LTID 3PIPA 4JI2Q 3I4NB 1GM5A 2AMCB 2QILA 1XMQQ 1U4LA 3I3CA 4LUOA 5D65A 4TVAB 4X62L 4GNXA 4KD4A 3TQYA 1KRTA 1BXTA 4C1NK 2K33A 4DV6Q 4DAYA 4DR5L 3S15H 3HOZB 1Z6HA 2K32A 1VQ6A 1HA5A 5BN3A 4OWTB 2PPBC 3G7LA 1SFOB 1K0RA 2R7ZG 4G7HC 4FYDA 2HHHL 1C7YA 4QY7A 1MIUA 1NNXA 4OONA 2V4DA 5M5YB 1LT3D 4WJ3M 1SYFA 2FINB 1Q90A 1TT2A 1TXYA 3I73A 3W1GA 3E9IA 2MGSA 1SNDA 1CKNB 1B9NA 3H6MA 2RDHA 2UUCL 4QCLA 5ELNA 5IY0A 3P75A 2VQEQ 1EU3A 1TWAH 1JR0D 3SR1A 3QG1A 2F0VA 2NVXH 1U9RA 2K6AA 2HQEA 5G3LD 4DU9A 1MGSA 2PZUA 4QMGA 1AE2A 3STBD 1WYDA 2I5MX 2FFKB 2K5QA 2X6LA 3NBHA 3GTPB 1B53A 1ESFA 4QL5A 3K0XA 2ES2A 3GTQB 1F9QA 1YHBA 1V43A 3RR5A 3TP6A 1BBUA 3HOZH 4HTHA 1CQVA 4B08A 2E5LL 3M85A 5IGDA 1SFOH 3CRKC 3GD7A 4Y7NB 3NE5B 2K1BA 1HFNA 5GAGC 4DR3Q 3PGZA 5C44G 1CT1D 2AQ3B 3E0EA 2PQEA 2QEJC 2Q2TA 3EROA 2JA7G 2Y0SE 4IOAA 2F0JA 5M5YH 1XNQL 2KCNA 3PO2H 1VQLA 3Q23A 1IBMQ 5FJ8H 3WOFA 2M00A 3KF8A 2L1BA 1ZEQX 1AW7A 1X3FA 5EKLA 3FPPA 2OTLA 2CCZA 1A3TA 1IL2A 4NB3A 4GKKQ 4OO1I 3DWPA 1TS4A 3HOWG 4ZUIA 4KHPL 1R4QB 4IQZA 4DUYQ 2NUCA 4HAEA 4ME5A 5FLXL 4QGUA 1EQTA 1ZKOA 5F2DA 4DR7Q 4DV1Q 4APVA 1JB7A 3GTPH 3QOJA 4JV5Q 1VQGA 4DV2Q 3GTQH 2A6HD 4GN5A 1JOQA 2OXPA 1D5ZC 1LACA 2F0IA 5EJWA 4IN3A 4E6IA 4Q0FA 4DR2Q 4JOIA 1K8GA 5JJLA 2CH4A 4OL7A 3CCMA 1FVIA 4EQOA 4DV0L 3C2PA 1PDQA 2IX0A 5DM73 4NXML 2JA8H 2K75A 4DFAA 2AQ2B 2JK8A 2A6EC 1KAWA 4M8AA 1SXTA 2YTYA 3U4VA 4OELB 1ESRA 5E4XA 3BDOA 1QVGA 1HZCA 1JORA 4A3FG 1LTTD 2UXDL 4IPDA 4X64Q 1PTOB 4K2LA 1AZQA 3OTOL 2B2WA 3L7ZC 2UUBQ 3MAQA 4A93B 2EYFA 4LF7Q 3V96A 1TS3A 5HY6A 3VYSA 3KBXA 1STNA 2VZAA 1LYLA 2OF1A 1B3QA 1SROA 1HTLD 1PRTD 2VB2X 3J81i 1FGBD 4J15A 3HKSA 1S5BD 4FF3A 4JBMA 2AQ1B 4P73A 4DV4L 4A4IA 1P16A 2XSCA 5M9OA 2J4XA 2EVBA 3GTJB 3OIPA 4DV5L 1HH2P 1A8VA 3OIQA 4C3IB 4HSPA 5JAVA 2R7DA 1LABA 2KENA 1SR3A 2Y0SG 1IBKL 3H94A 3K8AA 5M3MG 1VQ4A 4JOIC 1RL2A 4JBWA 2I0QA 1E2ZA 5E1FA 2PW7A 4DK0A 1K3BC 3U58A 4DR1L 2NYZD 2PCFB 3D4WA 3C3LA 1PTOH 1XWEA 4JI5L 3PQIA 4CDEC 4IFDH 1YNJC 3GTOB 1HPCA 1W2BA 2BE5C 5KRUA 4B3SQ 2NBFA 1E22A 1A3UA 1X54A 2RCNA 3W3AA 2JSOA 2KUMA 4QUFA 2MJ8A 1I3QB 2BOSA 2N78A 2IT1A 2B2WC 4POFA 4S3SA 3HKZE 3HGBA 5CV4A 4ZQ3A 1XJVA 1O7ZA 4IFDJ 3OYYA 3PF4A 3QB3A 1IHZA 4JI7Q 1G6PA 3SK5A 2PQAA 4BS9A 2EIFA 2QCPX 1IW7C 4IOCA 3T1YL 2B2TA 4C3JB 4EQ5A 4BY7B 2IW3A 1ET6A 3UE1A 5L37A 3X3MA 1NSNS 3H3VH 2F0QA 1QJOA 1M90C 5DAUA 1PZJD 2DNEA 2WAQG 2UXCQ 4HJ8A 1K73C 1S5CD 3NSWA 4IPGA 3GTOH 3HOUG 2F03A 5EGTA 4DK1A 1KABA 2CW0C 1E2VA 4X3UA 4AIMA 1UE1A 4IUTA 2E74C 1ENCA 3GTKB 1V9PA 5JEAH 1STHA 1VQBA 3VR4A 1SJHD 5EAYA 2JN4A 2A1AA 1TU2B 2XRQD 2ZTDA 4LFAL 2MNAA 1I6HH 4AYBB 4I65A 1HTPA 3VYTA 2XN9C 1EYAA 1SYBA 2N88A 1U5KA 1GVPA 5I9OA 4DR6Q 4LUZA 1F2MA 4C3JH 4LF4Q 3X3NA 1PRTB 4BY7H 3H0GG 3FKIG 4FF2A 4V190 2R93B 4XDXA 5K36G 1B70B 4LF6L 3CQZH 5JEAJ 1HNXQ 1JCKB 1PZID 1ONLA 1U0LA 3I70A 1OXTA 4A3IB 4CJ2C 3GQBA 1WTPA 1HCZA 3PO3G 3HOXB 2PZWA 2RBMA 2SNSA 3KF6B 1VQEA 1EZ8A 4F87A 1QILA 5M5WB 2A69D 3SK8A 5T1IA 3PV0A 4QJFA 3J80L 5FLXc 1PH8A 1DCZA 2XWJB 1N32Q 3KDFB 5KGUA 3BS1A 4FF1A 3GTKH 4LF5L 4A3MG 1JOOA 2NN6G 2A68C 1EU4A 2F0TA 4ALPA 1PHJA 1FYCA 3C1EA 3K7AB 2JXMB 1HR0L 3KK7A 3I55A 3PSIA 3OHXC 4PV1C 2ENBA 2N3SA 3D6CA 2MO1A 1KNAA 4JK1C 1N36Q 1IZ6A 3L3OC 3CXCA 1HA6A 2ZXOA 4JBKA 2B63G 3QOLA 1N34L 2JYOA 2R93H 4GN3B 2FMMA 2GVAA 3W1BA 4NPSA 4DNRB 4GOPB 1VS0A 4I7ZC 1R9TB 2R7ZB 1KNEA 2NZHA 4AQYL 2CQAA 2WKCA 4A3IH 3CCQA 2XRSD 4PZ7A 3BVGA 1YI2A 3HOXH 1SMYC 5CV7A 1XPOA 1PYWD 1Q1BA 2CHBD 5IT9L 5M5WH 2L55A 2F0OA 1VQMA 3JAML 2IJ0A 3GTLH 1JB3A 1GUGA 2QF7A 1RODA 1SE2A 4CBVA 4BBSB 4R4QA 3S17B 2LY7A 4M1UB 5I9PA 2R3ZA 4EX5A 1U4RA 4HMJA 5EBDA 3CAMA 3BDCA 3BVZA 3PUZA 2UU9Q 4BA2I 4IURA 3K7AH 2F0NA 3D0FA 3MHBA 4A3DH 1VQCA 1CA5A 1SNMA 1RF2D 2CQOA 3CD6A 1Q7YC 1E1OA 2LSSA 4J1MA 1YJNA 3S1MB 2EYHA 1VDZA 1UE5A 4CDDC 4NP5A 4A3GG 2BH2A 2WINB 4LF9L 1R9TH 1R4PB 2R7ZH 1LTLA 2AHOB 5BN4A 5FK9C 1K28A 2F3WA 1EL0A 1WTXA 4X65L 3I4MG 1ASZA 2DY7A 2NZOA 1VMPA 2KHJA 1EY9A 5EPLA 1H9JA 4A3JG 5LL6S 2JA7B 4N9TA 1B44D 1B8AA 5KNBA 1O80A 4RAUC 4ODGA 4GKJL 1X56A 4CDCC 4DV7Q 2J0TD 1E1TA 1UUPA 2Q8IB 2K03A 5BR8Q 1Q1EA 2ZXPA 4K0KQ 2K5VA 3CKIB 3CCJA 4JI6L 4BBSH 3S17H 1MJCA 4ME3A 3T16A 2JA6G 1LM0A 2XTIA 1BOSA 3C46A 4XYOA 3K58A 5JPNC 4H02A 1HNWQ 4JCVE 4C3HB 1SE8A 1HZAA 2RF4A 1WTHA 3MA2B 4YY3Q 3S2DB 1B9MA 4LFBL 2JA5G 1CUKA 4N9PA 3S1MH 1BCPB 1YNNC 2FXQA 3SEBA 2DJGC 4MZ9A 2L11A 2EZVA 3ULLA 1LTSD 1GO3E 3CCEA 4V0BA 3MXGA 4G57A 2JA7H 3NQTA 4JI1Q 3HOYG 5EPKA 4KI0A 4A3FB 4L8JA 2PI2E 4IFDI 4A3LG 3J7AF 3Q0AA 4RGNA 2KQ3A 2L15A 2Q2UA 2IWHA 3DEPA 2K04A 3K80C 3P1HA 4JI8L 3K5MA 1PVOA 3K6OA 4R8NA 4C3HH 2UUCQ 5EQ0A 2EY5A 1XMOL 5JJIA 1EY8A 1STAA 3S2DH 1EY4A 4HJ9A 1NJIC 1LT5D 5C3EB 3BU2A 1VQAA 2L0CA 1G8ZD 1LT6D 3J7YW 3UDFA 2UXBL 3GO5A 3MEFA 3VYUA 2RHSB 4P75A 3W2DA 1GJXA 2Q2HA 2I07B 4XQJA 1UE6A 1Y69U 2MPMA 1VQDA 3NTIA 5KYLA 4X3TA 1X6OA 2E5LQ 4KKUA 4IUQA 5M3MB 4R9WA 1DXMA 2EYMA 3J80c 1WTVA 2JQOA 1NY4A 1L0XB 1HHVA 3QIAA 3TP8A 4A3FH 1VQHA 3MXPA 1TWGB 4KMUC 5CV8A 1S72A 5FO9B 1I94Q 4TRDA 1D5MC 1CZGA 1TWHH 5I4DA 2H5XA 1TS5A 2HQLA 3DM3A 4IPCA 1TY0A 2D0PA 2F0EA 2TMPA 3F2UA 1VQOA 3QWNA 3I7FA 2AKWB 4ZAIA 4ZK9B 1FGUA 4BA1I 2PO4A 4OO1G 2B39A 3D4DA 1YHQA 3EN2A 3SK4A 1HNZL 4YWKA 1GUNA 1B1ZA 1CSQA 2AUJD 1CI3M 1EUJA 1EWHA 2D5DA 4MNOA 5C3EH 1A15A 4A3EG 5JJZA 3EA6A 1CKMA 5C4XG 4L5SA 1V8QA 3IKJA 4GLAC 2HIVA 3HOVG 2EPBA 5IT9c 2NB0A 1U4PA 2PZTA 3JAMc 1CTMA 2B8FA 5M3MH 1HXYD 1NE3A 2RQXA 3VR3A 4JBJA 3L0OA 4DV0Q 1C4QA 1JJCB 2MFIA 2DY8A 2L5TA 3KLWA 1TWGH 4HJ7A 2WAQB 1MSGA 5I2XA 1A3VA 5LMUL 2EXDA 3NUCA 2ZJPA 1AZPA 1K8AC 1VQ5A 4P72A 2MHVA 4A75A 4NXNQ 2Z4IA 3I4OA 2IL8A 3AFPA 3BG3A 3PIP3 3S16B 2WB1G 4XT3B 3OTOQ 3ZYYX 4XTCS 4ILWA 3I4NH 1RHPA 3CPFA 3N6RA 3U50C 1D7QA 1XYIA 1KHIA 2KJXA 1EFID 5CBAE 2PW5A 4DUZQ 1IKMA 1GHJA 2KVMA 1VQKA 4BBRG 1QWYA 1CK1A 3BVMA 3CCUA 2YTVA 4OEMB 4IUUA 4PZ6A 1GOZA 3EFXD 4LF8L 3RLOA 1ZXTA 4DV4Q 1OXVA 3LGJA 3H0GB 3ZJYC 1QE6A 2K5HA 1S40A 1BR9A 1SN8A 2Z6KC 2PMZE 4ZUJA 2DUDA 3CCRA 2VNUD 2B2VC 1UNSA 2A6ED 3MZ5A 3J81E 3CC2A 1ENFA 1A2UA 4CJ1B 1CFMA 1PTOC 1STEA 2WACA 3V2TA 1MJEA 4RGOS 2KCMA 1IBKQ 1EOTA 3A8KE 4L5QA 2BDNA 2XNAC 4LMQD 3H09A 1FJGL 1BQQT 4CKBA 5IP7G 1C48A 1WCMG 1Y1VB 4WJWA 1DOLA 5CYUA 1J5EL 3S16H 3T51B 4JI5Q 3I4LA 1J9OA 1Q46A 3I90A 1TR5A 1KIXA 3PUVA 1OXSC 4HCEA 3T53B 1K3RA 1JWSD 4PMBA 3WWVA 1EWCA 3A8JE 4UY8C 4A3CG 4JI2L 4RG1A 3IFDA 1BUVT 1XMQL 1LTBD 1QNKA 3O13A 3CC7A 1YJWA 4LFCL 2F0MA 2R92G 5FLMG 2VY3A 4Y7NH 1U4MA 1QVCA 3H0GH 4B3MQ 1BBWA 1STGA 5K36H 1Y1WG 2EJMA 1GKHA 5E7NA 3IRBA 3H3VC 2N8NA 3BZKA 2KCCA 2F0KA 1RTNA 2C5CA 1NR4A 3R2IA 4N8FA 1JE4A 4LAAA 1NMFA 4G4KA 1HRJA 1DOMA 1YITA 1F2LA 4QIWB 2KECA 5IP9G 3TS2A 1RKNA 1GUSA 1SNOA 4GNXB 4YWMA 1I4XA 3F8TA 1YNJD 1Y1VH 4DAYB 2BE5D 1SRUA 1C8CA 4GZYC 4ZCKA 1EQVA 5IODA 3I2ZA 4CGYB 4O1NA 4XQQA 1N33Q 2P5ZX 2IHFA 4O2DA 1CA6A 3FDTA 2XWBB 1SAPA 1OXUA 1QUQA 3TREA 5IIFA 3EJIA 2UUAL 1PLFA 4FDBA 1D8LA 1SLJA 3RLFA 2D0OA 3CCVA 2OWOA 1FNVA 4TQUS 1JICA 3CF5A 1Y8NB 5J39A 4K8JA 5KIXA 1N8RC 4UP8A 4A3BB 3K5OA 2M2LA 4KKTA 5J22A 1IW7D 1PH1A 1I4GA 1JT8A 2ALYB 5J1ZA 5T1GA 4LJZC 4KN7C 2BH8A 1L0YB 2G9HD 4FNFA 4DR3L 3I4MB 2G9DA 1DM0B 2OT2A 3RN2A 4WRDA 1G91A 3KDFA 3RLNA 4A3JB 4KK7A 4X66Q 4JPBW 3CC4A 5EKKA 3D31A 3NBHB 3NHHA 4YCUA 4PG3A 5FOBB 1IBML 4A93H 2GN5A 2HUGA 3K81C 2XIWA 4PMWA 2JJQA 3VA5A 3J7AV 2E2JB 1YVCA 3M7NA 2CW0D 4GKKL 5CBEE 4KJOA 4DV3L 3KUPA 1PH3A 2WV6D 3SXHA 2F0WA 2L9HA 2PI2A 2F4IA 3UI2A 2HCIA 1V1PB 4DUYL 3AFQA 4GOPA 1PA6A 1PTOF 3R8BA 1GUOA 3GTJH 4JI3Q 4R1JA 2FMCA 2VQFQ 1PRTC 2Z9HA 1ILQA 4JV5L 4A3BH 4DV2L 4RGTA 5FKAC 4C3IH 1IYVA 1C9OA 2R61A 2N55A 3ERQA 4KY7A 5IYDG 3MXUA 3TDQA 2F0DA 2R6GA 1H9SB 2B2YC 3N52A 4IJLA 2SNMA 3QO2A 5IYCG 4IUPA 2Z8LA 1F9SA 3CU7A 4UPAA 1SYDA 3NPPA 4H0LC 5EPJA 4DPGA 1WTOA 3Q8DA 4A3JH 3HFZB 3EIVA 4JW0A 2K52A 1KDAA 2A73B 1BBXC 1EWIA 1PMRA 2I46A 1CQFA 4K6LA 4KY6A 2LFNA 1WD0A 2E2JH 1HQRD 3F2CA 1I3QH 4RHSA 4LUVA 5C4HA 2UUBL 3PO2G 4POGA 4K5XA 5COYA 2F1MA 5FJ8G 1EYGA 1YEZA 1NTGA 3D4RA 4IZ8A 1KAAA 1I4QA 3HS0C 3DWQA 3HEJA 5ELBA 3M4OB 5E3FA 2PNRC 3TS0A 4O42A 2ICEC 2F3VA 4O0AA 4B3TL 3NP8A 3K7UC 4FXGC 3VA7A 1J8IA 3U9OA 3CMAA 2AWNA 4GOPC 4BXXH 3KLRA 5CGKA 3BYYB 3M4PA 3S1QB 2RCFA 3TEHB 3NWTA 3NWSA 5AJ3Q 4KV6A 1YJ9A 1BF4A 5KYIA 4X6AH 4LF9Q 3M9BA 3T56B 1JE5A 4NDXA 4F88A 2KCTA 5DNFA 1G51A 2I5HA 4Z9CB 2JA8G 2WP8J 1SMYD 1DD2A 3K59A 3K5LA 4YWLA 3OSOA 1QB5D 3OWFA 5DM63 5KEEA 4RMFA 2VUMB 1X3GA 4A3LH 1IBLL 4B3RQ 3HKZG 4LNQA 4IALA 1PH9A 1EEID 3FP9A 2HDLA 4FP5D 2JA9A 2R7FA 4UP7A 2RA4A 3RZDB 4JI6Q 1H9KA 2HDMA 5C0XH 3BZDB 2ZM6L 4NW2A 2EY1A 3M4OH 5D14A 3LWEA 4R8IA 4WJ4A 4G7ZC 2DNCA 4QF4A 4JI7L 1DONA 4BY1G 5C4XB 2WIIB 4L5TA 3S1QH 4LFBQ 3ND8A 4ZRZA 2F4VL 4L6TB 5IOCA 1FD7D 5ELDA 1LLRD 3H15A 5C0XJ 2DGYA 3KFUA 3BYTB 3EQLC 2BDOA 4HEDA 1PRTF 2UXCL 3MXNA 2LMCB 3T1HL 3EVQA 2PQAB 2VUMH 4RFBA 3OMCA 5CV6A 1WVLA 2F0FA 1QG7A 3QJYA 3OMGA 1B50A 1ICFB 5A2QE 2JEBI 2NZ1D 4IFDG 2NVYB 5CV5A 3RZDH 2JEAI 1NBWA 1PFMA 2B3GA 2B2UA 1EYCA 1JJGA 5GQOA 3MC0B 2OEOA 4K6DA 2RDFA 2WFWA 1BCPC 3MFYA 1EIHA 1KDCA 1XMOQ 4QQBX 2MP1A 3MVVA 4YHHQ 1YNND 1E24A 5C5MA 3SHLA 4DR6L 1EOVA 3FMCA 4LF4L 2YV5A 4KKSA 1X32A 5IWAQ 5C44B 4RGMA 3J81j 2UXBQ 4AYBE 1E7ZA 1O7IA 4ZYSA 4EQNA 3M3YB 2NTTA 2L4NA 4K14A 3DEOA 1Q81C 3BJUA 3OOCA 2F0GA 1JQYD 1LT4D 4C2MB 5IE8A 4XT1B 4XXEA 3DUZA 4JC0A 1K8MA 3VR6A 1KTKA 1VCIA 1Y14B 1Q82C 2BCOA 5JPMC 1WD1A 4PZ8A 3HOWB 1WCMB 4OHJA 3DLLA 3IAYA 1HR0W 3TN2A 5J3BA 1N32L 1ZYRC 2NVYH 4J8QA 3SGIA 4WFN3 2EYLA 3F2DA 2EYJA 2O5JC 2QDLA 1L1OB 4HSVA 1E3PA 2L12A 4AH6A 1XNRL 4TKOB 2ZTCA 5H1SE 1LUZA 4OWXB 1CKOA 3K57A 1WOCA 1BNZA 2B2UC 5JEAG 1HNZQ 1ILPA 1EQRA 3RD4A 1J6QA 4X62Q 2R92B 3E5SA 1NCVA 2IX3A 1N36L 4XQNA 4JG2A 2YU9B 5AFWA 4DR5Q 1NAPA 5C44H 1CKNA 1Y1WB 4GLXA 3M3YH 2ZJQA 3OW7A 1XXGA 5D3IB 1FNWA 2VW9A 4JYAL 3ERSX 3RZOB 4JI0L 1VQ9A 2XGTA 4HMIA 4C2MH 3S9WA 3BDLA 2F0LA 1EZ6A 1H9RA 1EIYB 2HHHQ 3S1NB 5C6AA 2A19A 3KBGA 3F1ZA 1G2TA 5IP7H 1IXRA 5LHY1 3HOWH 1WCMH 1FNUA 5IGEA 1I4RA 2I5LX 5D3DA 5LMUQ 1DOKA 1DJRD 1F9PA 2KEDA 1SYEA 1PH2A 5JJKA 1IYUA 3PIOA 2RSOA 1W3SA 2J7ZA 1YBYA 1JC7A 2EY2A 4YCVA 2UU9L 1MI2A 4F7XA 4OX9L 1E0BA 1RDPD 2KEEA 2K4KA 1GUWA 1I4HA 5FLMH 2N49A 3VYRA 2YU9H 2KBNA 4KHZA 2Y0SB 2PNHA 1CHQD 3H3VI 3RZOH 3HZXA 2CFMA 1H9MA 2R93G 4KJNA 3GDEA 1ICWA 1Z7TA 4OIJA 4WORA 1PV4A 1BCPF 3S1NH 1B3AA 1K9MC 5I2YA 1B7YB 1QVFA 3UDXA 1XNQQ 1UEBA 5JOBA 4A3IG 1GD7A 5ELFA 5FO8B 4RWSC 3HG9A 4DV7L 2K14A 3HOXG 1JJ2A 4FO2A 2C35B 2FHTA 1Q8KA 1X55A 1LTRD 1LO5D 4KHPQ 4BWGB 4FVMA 3OW2A 1M4VA 4CDFC 4R4CA 2IX1A 4IO9A 3ND9A 3T13A 5KNCA 4DK6C 1W6KA 3A7LA 3GP7A 2CH4W 4YY3L 1P8LA 1RTOA 2Z6KA 2VB3X 2LXJA 2D2CC 3A8IE 1NUCA 2NVXB 2B2VA 1JOKA 4IPHA 4DGZA 2WKDA 2ICIA 2X6GA 5LMNL 4A3DG 5ELEA 3UE0A 3KJPA 4K2KA 1ENAA 4LFCQ 1KXLA 2F52A 4J6HA 2DJFC 3L9AX 3W5OA 4DXFA 5GAHC 4NXMQ 1K0SA 3G71A 1Y8PB 4JI4L 5HGQA 3D8GA 2B8GA 4JI1L 1PTOD 3GTGB 3HOUB 1EYDA 4B9WA 4MTNA 2UXDQ 5A35A 3A74A 1NR2A 2QW7A 3H91A 5FLXE 2E75C 1JMCA 3MTSA 1X3PA 4OXPA 1OO9B 3PO2B 3CHBD 1DYQA 4KHVA 3RUZA 2AWOA 3PCOB 4BBSG 3AU7A 4KD3A 5C0XI 3VR2A 3B6YA 1VQNA 1HQMC 1NMGA 2SEBD 4OGQC 2K01A 3R93A 2LXKA 4B9XA 2UUAQ 3M4QA 4ID6A 4GN4B 2RHQB 3FKIB
chains in the Genus database with same CATH topology
1EIGA 1SNQA 5M5XB 3P20A 3DHQA 3GV3A 5CV9A 1MSHA 3AMUA 2CVRA 2BA0A 3NK9A 3M4YA 2BA1A 4F8MA 3PO3B 1TY2A 3A56A 2FJ2A 2KOLA 2JA8B 1WTRA 3KLSA 5FO7B 4H13C 1V1PA 2EJFC 4RCNA 2RSNA 3HKZB 1SDFA 4H7BA 2Q8RE 4A3MB 3SK6A 2ZXRA 3S2HB 2EY6A 1SNPA 4Q5VA 1H9SA 2NVQB 4RKLA 2C9OA 3E6ZX 2F0UA 1EY6A 4XYQA 1F77A 4C3HG 3URYA 1QCBD 2B63B 1Q8IA 4BY1B 4EQPA 2EYOA 1Q12A 1A6XA 3NXWA 4U68A 3ONAB 2VXWA 3MWYW 3KLSX 3MFGA 1AN8A 5IGBA 1I6VC 1GHKA 1E2WA 3S1RB 5HGTA 2D62A 1RJTA 3J81L 1CZWA 2NN6H 1KDBA 4RA8A 3Q24A 3FRPB 1MBYA 2A74C 2B2YA 2RKSA 5JVG3 1O78A 3PUXA 1SYGA 4C56C 2NVTB 2EYPA 2X69A 4A3GB 1D1IA 1W6JA 1X3QA 1SBBB 4ZKBB 2A6HC 1D2BA 1F2YA 1BO0A 4YIJA 5I6YA 2IPKD 1XX8A 3A54A 4KTAA 4NMZA 2SOBA 3DM1A 5E4WC 1STYA 4P2CB 3R2TA 1SSOA 3K0YA 4HR7B 1TVXA 1AFPA 3AB9A 3I72A 1S4ZA 5ISRA 5TSSA 2HCCA 3FEWX 4TSSA 1EEFD 2JA6B 2YYZA 2NWGA 1UEAB 4DAPA 1ML0D 3TMEA 5HURA 1OXXK 1UAPA 1G291 2JA5B 2E2DC 3MEHA 2EJGC 3D6WA 4PQXA 3TP7A 1WTQA 2O5IC 1I6HB 1VMCA 4LK1C 2O2LD 1B2TA 4MHEA 2D9UA 4FF4A 3HOYB 3J80E 4FXDA 5G3LF 3CQZB 2DN8A 2PYKA 3DXJC 2LKVA 1I50B 1SYCA 4HCSA 3NTKA 3PUWA 1AP0A 1GUTA 3RMHA 3Q22A 1B4OA 3NTHA 2A68D 1STBA 1HUMA 5ELCA 4DAVA 1EY7A 3TSSA 1TWCB 3TZDA 1K8OA 3I8ZA 1CM9A 1PFBA 4PMCA 3GTMB 3PMFA 3P7JA 3A55A 5CR3A 4X3SA 3HRZC 4K8IA 2E2HB 4CKCA 5KNDA 4CKEA 5K5PA 1LTAD 2ID0A 2EE1A 1GXDC 4IUVA 3TP5A 5IT9E 3JAME 2LS01 3LX0A 5NUCA 5I6WA 1TKWB 1JWUD 1KLGD 3SVMA 1VF7A 1M8AA 1T5XD 3FPUB 1PXUA 2B2TC 4RKBA 4KY5A 2TSSA 3S14B 2E76C 2K5WA 1SNCA 3V05A 1RD9D 3IL8A 3GTLB 1PFNA 2KA7A 3OWEB 1D1KA 2JE6I 4MIUA 4A3EB 1WTWA 1HUNA 1BCPD 2MUYA 4G7OC 1FR3A 4KN4C 4RHRA 4A3DB 2Z1CA 1TWFB 3K5NA 3HOVB 2E2IB 1SEBD 3TBIB 2NTSA 1TIID 2O4XA 3G6JB 1CHPD 3VR5A 5C4JB 1ET9A 1EY5A 1SJED 1LTGD 3LNNA 2A5HA 2F0PA 1G2SA 3PUYA 3U9SA 1RCVD 2A69C 5C3XA 2WB1B 3T4AC 1MD2D 3C1FA 5IGGA 4ZKCB 5IGCA 4OO1H 1ZYRD 4L63B 4MN3A 3TZUA 1QOHA 4EVOA 4BBRB 1Z47A 2QDBA 4ABNA 4EGVA 2RVLA 5EKIA 5C3WA 3NBIA 1SE3A 2EDGA 4DNTB 1S5FD 4XIGS 1D6EC 5IGFA 2QKIC 4C3IG 4RH6A 3ITPA 4DN4M 4ZLTF 1D5XC 3Q6SA 1LV9A 4X3KA 3IFTA 4DA2A 2M9VA 3R3OA 4UDUC 3OPOA 2NN6I 1O7YA 3CRLC 1K83B 4PNYA 4K5VA 1BDOA 1DZ1A 5LL6X 1G6ZA 2ZT9C 1F9RA 1V1OA 5DEHA 1Y8OB 4OIKA 3I91A 5A2QL 2XVSA 1IL8A 2K5DA 3A7AB 5CMDA 1HFGA 4U673 2Q8TA 1JWMD 3GV6A 4IUNA 4C3JG 1QNUA 4DXGA 1PZKD 4HN7A 5CORA 2GA4B 2K7VA 1F2ZA 2Z4HA 1AEXA 4A3KB 4FXKC 1SE4A 2K28A 1I4PA 2F0HA 2EXZA 1II3A 3DMUA 1S5DD 4CJ0B 5C4ZA 4RCOA 4ULLA 1EY0A 5CC4A 4CHTB 4K5WA 1TWHB 5M3FB 1S5ED 3WDNA 2H1EA 1Q3LA 3DWAA 1TS2A 4DF7A 4QB4A 5C0XG 2PMZB 1VF5C 1IKLA 2AUKA 4UAIA 2F0SA 2EOTA 3SDZA 3S15B 1KLUD 2JP1A 2SDFA 3WOEA 5EBCA 2K05A 1TQOA 2KHSA 5C5LA 3NQIA 4NKLA 3HP3A 3E0JA 1O7LA 3PIO3 4C1NI 5BN5A 1T5EA 3SE0A 3LWUA 5JVH3 3FVQA 4H44C 1XTCD 1A2TA 3D3RA 4QUCA 2H4OA 1TWAB 2RDGA 3M7GA 1LTID 3I4NB 2QILA 1U4LA 3I3CA 5D65A 4KD4A 1BXTA 4C1NK 2K33A 4DAYA 3HOZB 1Z6HA 2K32A 1HA5A 5BN3A 2PPBC 3G7LA 1SFOB 4G7HC 4FYDA 2V4DA 5M5YB 1LT3D 1SYFA 2FINB 1Q90A 1TT2A 3I73A 2MGSA 1SNDA 1B9NA 3H6MA 2RDHA 4QCLA 3P75A 1EU3A 1JR0D 3SR1A 3QG1A 2F0VA 1U9RA 2K6AA 2HQEA 5G3LD 4DU9A 1MGSA 2PZUA 4QMGA 2FFKB 2K5QA 2X6LA 3NBHA 3GTPB 1B53A 1ESFA 3GTQB 1F9QA 3TP6A 1V43A 4HTHA 1CQVA 4B08A 3M85A 5IGDA 3CRKC 3GD7A 4Y7NB 3NE5B 2K1BA 1HFNA 1CT1D 2AQ3B 2PQEA 2QEJC 3EROA 2F0JA 2KCNA 3Q23A 3WOFA 2M00A 3KF8A 2L1BA 1ZEQX 1AW7A 5EKLA 3FPPA 1A3TA 4OO1I 3DWPA 1TS4A 4ZUIA 1R4QB 4IQZA 2NUCA 4HAEA 4ME5A 5FLXL 1EQTA 1ZKOA 5F2DA 3QOJA 2A6HD 1JOQA 2OXPA 1D5ZC 1LACA 2F0IA 5EJWA 4IN3A 4E6IA 4Q0FA 4OL7A 4EQOA 3C2PA 1PDQA 2IX0A 5DM73 4DFAA 2AQ2B 2A6EC 4M8AA 1SXTA 5E4XA 1ESRA 3BDOA 1JORA 1LTTD 1PTOB 4K2LA 1AZQA 2B2WA 3L7ZC 3MAQA 4A93B 2EYFA 3V96A 1TS3A 3VYSA 3KBXA 1STNA 2OF1A 1HTLD 1PRTD 2VB2X 1FGBD 1S5BD 4FF3A 2AQ1B 2XSCA 5M9OA 2J4XA 2EVBA 3GTJB 3OIPA 3OIQA 4C3IB 4HSPA 5JAVA 1LABA 3H94A 4JBWA 1E2ZA 5E1FA 2PW7A 4DK0A 2NYZD 2PCFB 3D4WA 3C3LA 1PTOH 1XWEA 4IFDH 1YNJC 3GTOB 1HPCA 2BE5C 5KRUA 2NBFA 1A3UA 3W3AA 2JSOA 2KUMA 4QUFA 2MJ8A 1I3QB 2BOSA 2IT1A 2B2WC 4S3SA 3HGBA 5CV4A 4ZQ3A 1O7ZA 4IFDJ 3QB3A 1IHZA 3SK5A 4BS9A 2QCPX 1IW7C 2B2TA 4C3JB 4BY7B 2IW3A 1ET6A 3X3MA 1NSNS 2F0QA 1QJOA 5DAUA 1PZJD 2DNEA 1S5CD 3NSWA 2F03A 5EGTA 4DK1A 1KABA 2CW0C 1E2VA 4X3UA 4IUTA 2E74C 1ENCA 3GTKB 5JEAH 1STHA 3VR4A 1SJHD 1TU2B 2XRQD 4AYBB 4I65A 3VYTA 1HTPA 2XN9C 1EYAA 1SYBA 2N88A 5I9OA 1F2MA 3X3NA 1PRTB 4FF2A 4V190 2R93B 4XDXA 5K36G 5JEAJ 1JCKB 1PZID 1ONLA 3I70A 1OXTA 4A3IB 4CJ2C 3GQBA 1WTPA 1HCZA 3HOXB 2PZWA 2RBMA 2SNSA 1EZ8A 4F87A 1QILA 5M5WB 2A69D 3SK8A 5T1IA 3PV0A 3J80L 1DCZA 2XWJB 5KGUA 3BS1A 4FF1A 1JOOA 2NN6G 2A68C 1EU4A 2F0TA 1FYCA 3C1EA 3K7AB 2JXMB 3KK7A 3OHXC 4PV1C 2ENBA 3D6CA 4JK1C 1KNAA 3L3OC 1HA6A 2ZXOA 3QOLA 2JYOA 2FMMA 4DNRB 4I7ZC 1R9TB 2R7ZB 1KNEA 2CQAA 2WKCA 2XRSD 3BVGA 1SMYC 5CV7A 1PYWD 1Q1BA 2CHBD 5IT9L 2L55A 2F0OA 3JAML 2IJ0A 1JB3A 1GUGA 2QF7A 1RODA 1SE2A 4CBVA 4BBSB 3S17B 2LY7A 4M1UB 5I9PA 2R3ZA 1U4RA 4HMJA 5EBDA 3BDCA 3BVZA 3PUZA 4BA2I 4IURA 2F0NA 3MHBA 1CA5A 1SNMA 1RF2D 4J1MA 3S1MB 2EYHA 1VDZA 4NP5A 2WINB 1R4PB 5BN4A 5FK9C 2F3WA 1EL0A 1WTXA 2DY7A 1VMPA 1EY9A 5EPLA 1H9JA 5LL6S 2JA7B 4N9TA 1B44D 5KNBA 1O80A 4RAUC 4ODGA 2J0TD 1UUPA 2Q8IB 2K03A 1Q1EA 2ZXPA 3CKIB 3T16A 1BOSA 3C46A 4XYOA 3K58A 5JPNC 4C3HB 3MA2B 3S2DB 1B9MA 4N9PA 1BCPB 1YNNC 3SEBA 2L11A 2EZVA 1LTSD 4V0BA 3MXGA 4G57A 3NQTA 5EPKA 4KI0A 4A3FB 4L8JA 4IFDI 3J7AF 3Q0AA 4RGNA 2KQ3A 2IWHA 3DEPA 2K04A 3P1HA 3K5MA 3K6OA 4R8NA 5EQ0A 2EY5A 1EY8A 1STAA 1EY4A 1LT5D 5C3EB 2L0CA 1G8ZD 1LT6D 3J7YW 3GO5A 3VYUA 3W2DA 1GJXA 2I07B 4XQJA 1Y69U 2MPMA 3NTIA 5KYLA 4X3TA 4KKUA 4IUQA 5M3MB 4R9WA 1DXMA 2EYMA 1WTVA 1L0XB 1HHVA 3QIAA 3TP8A 3MXPA 1TWGB 4KMUC 5CV8A 5FO9B 4TRDA 1D5MC 1CZGA 5I4DA 1TS5A 1TY0A 2TMPA 2F0EA 3F2UA 3QWNA 4ZAIA 4ZK9B 4BA1I 2PO4A 4OO1G 2B39A 3D4DA 3SK4A 1GUNA 1B1ZA 2AUJD 1CI3M 1EWHA 2D5DA 1A15A 5JJZA 3EA6A 1V8QA 3IKJA 2EPBA 2NB0A 1U4PA 2PZTA 1CTMA 2B8FA 1HXYD 2RQXA 3VR3A 1C4QA 2DY8A 2L5TA 2WAQB 1MSGA 5I2XA 1A3VA 3NUCA 1AZPA 2MHVA 2Z4IA 2IL8A 3BG3A 3PIP3 3S16B 4XT3B 3ZYYX 4XTCS 4ILWA 1RHPA 3N6RA 1XYIA 2KJXA 1EFID 5CBAE 2PW5A 1IKMA 1GHJA 2KVMA 1QWYA 1CK1A 3BVMA 4IUUA 1GOZA 3EFXD 1ZXTA 1OXVA 3H0GB 1QE6A 1BR9A 4ZUJA 2VNUD 2B2VC 1UNSA 2A6ED 3MZ5A 3J81E 1ENFA 1A2UA 4CJ1B 1CFMA 1PTOC 1STEA 2WACA 3V2TA 4RGOS 1EOTA 3A8KE 2BDNA 2XNAC 4LMQD 3H09A 1BQQT 4CKBA 1C48A 1Y1VB 4WJWA 1DOLA 5CYUA 3T51B 3I4LA 1J9OA 3I90A 1TR5A 3PUVA 1OXSC 4HCEA 3T53B 1JWSD 4PMBA 1EWCA 3A8JE 3IFDA 1BUVT 1LTBD 1QNKA 3O13A 2F0MA 1U4MA 1STGA 5K36H 2EJMA 3H3VC 2KCCA 2F0KA 1RTNA 2C5CA 1NR4A 3R2IA 1JE4A 4LAAA 4G4KA 1HRJA 1DOMA 1F2LA 4QIWB 2KECA 1RKNA 1GUSA 1SNOA 1I4XA 1YNJD 2BE5D 1C8CA 4GZYC 5IODA 1EQVA 4CGYB 4O1NA 4XQQA 1CA6A 3FDTA 2XWBB 1SAPA 1OXUA 5IIFA 3EJIA 1PLFA 3RLFA 1FNVA 4TQUS 1JICA 1Y8NB 5J39A 4K8JA 5KIXA 4A3BB 3K5OA 2M2LA 4KKTA 5J22A 1IW7D 1I4GA 5J1ZA 5T1GA 4LJZC 4KN7C 1L0YB 2G9HD 4FNFA 3I4MB 2G9DA 1DM0B 2OT2A 4WRDA 1G91A 4A3JB 4KK7A 5EKKA 3D31A 3NHHA 5FOBB 2HUGA 2XIWA 4PMWA 3VA5A 3J7AV 2E2JB 3M7NA 2CW0D 5CBEE 4KJOA 3KUPA 2WV6D 3SXHA 2F0WA 2L9HA 2F4IA 3UI2A 2HCIA 1V1PB 1PTOF 3R8BA 1GUOA 2FMCA 1PRTC 1ILQA 4RGTA 5FKAC 1IYVA 2R61A 2N55A 3ERQA 4KY7A 3MXUA 3TDQA 2F0DA 2R6GA 1H9SB 2B2YC 3N52A 2SNMA 3QO2A 4IUPA 2Z8LA 1F9SA 3CU7A 1SYDA 3NPPA 4H0LC 5EPJA 1WTOA 1KDAA 2A73B 1BBXC 1PMRA 2I46A 1CQFA 4K6LA 4KY6A 2LFNA 1WD0A 1HQRD 4RHSA 5C4HA 4K5XA 5COYA 2F1MA 3D4RA 4IZ8A 1KAAA 1I4QA 3HS0C 3DWQA 3HEJA 5ELBA 3M4OB 5E3FA 2PNRC 4O42A 2ICEC 2F3VA 3NP8A 4FXGC 3VA7A 1J8IA 3U9OA 2AWNA 3KLRA 5CGKA 3BYYB 3S1QB 3NWTA 3NWSA 4KV6A 1BF4A 5KYIA 3T56B 4F88A 4NDXA 5DNFA 4Z9CB 2WP8J 1SMYD 1DD2A 3K59A 3K5LA 3OSOA 1QB5D 3OWFA 5DM63 5KEEA 2VUMB 4IALA 1EEID 2HDLA 4FP5D 2RA4A 3RZDB 1H9KA 2HDMA 5C0XH 3BZDB 4NW2A 2EY1A 5D14A 3LWEA 4R8IA 4G7ZC 2DNCA 4QF4A 1DONA 5C4XB 2WIIB 3ND8A 4ZRZA 4L6TB 5IOCA 1FD7D 5ELDA 1LLRD 5C0XJ 3BYTB 3EQLC 2BDOA 4HEDA 1PRTF 3MXNA 2LMCB 3EVQA 4RFBA 3OMCA 5CV6A 1WVLA 2F0FA 1QG7A 3QJYA 3OMGA 1B50A 5A2QE 2JEBI 2NZ1D 4IFDG 2NVYB 5CV5A 2JEAI 1PFMA 2B2UA 1EYCA 3MC0B 2OEOA 4K6DA 2RDFA 1BCPC 3MFYA 1EIHA 1KDCA 2MP1A 3MVVA 1YNND 5C5MA 3SHLA 3FMCA 4KKSA 1X32A 5C44B 4RGMA 4ZYSA 4EQNA 3M3YB 2NTTA 2L4NA 4K14A 3DEOA 3OOCA 2F0GA 1JQYD 1LT4D 4C2MB 4XT1B 4XXEA 3DUZA 1K8MA 3VR6A 1KTKA 1VCIA 2BCOA 5JPMC 1WD1A 3HOWB 1WCMB 4OHJA 3IAYA 3TN2A 1ZYRC 4J8QA 4WFN3 2EYLA 2EYJA 2O5JC 4HSVA 2L12A 4TKOB 3K57A 1BNZA 2B2UC 5JEAG 1ILPA 3RD4A 2R92B 3E5SA 1NCVA 2IX3A 4XQNA 2YU9B 5AFWA 1NAPA 1Y1WB 3OW7A 1XXGA 5D3IB 1FNWA 3RZOB 4HMIA 3S9WA 3BDLA 2F0LA 1EZ6A 1H9RA 3S1NB 5C6AA 3KBGA 1G2TA 5LHY1 1FNUA 5IGEA 1I4RA 5D3DA 1DOKA 1DJRD 1F9PA 2KEDA 1SYEA 1IYUA 2RSOA 2J7ZA 1JC7A 2EY2A 1MI2A 4F7XA 1E0BA 1RDPD 2KEEA 1GUWA 1I4HA 3VYRA 4KHZA 2Y0SB 1CHQD 3HZXA 1H9MA 4KJNA 1ICWA 1Z7TA 4OIJA 4WORA 1BCPF 1B3AA 5I2YA 5JOBA 5ELFA 5FO8B 4RWSC 3HG9A 4FO2A 2FHTA 1LTRD 1LO5D 4BWGB 4FVMA 1M4VA 2IX1A 3ND9A 3T13A 5KNCA 1W6KA 3A7LA 3GP7A 1RTOA 2VB3X 2D2CC 3A8IE 1NUCA 2NVXB 2B2VA 1JOKA 4DGZA 2WKDA 2ICIA 2X6GA 5ELEA 4K2KA 1ENAA 4J6HA 3L9AX 4DXFA 1Y8PB 3D8GA 2B8GA 1PTOD 3GTGB 3HOUB 1EYDA 4B9WA 5A35A 1NR2A 3H91A 5FLXE 2E75C 3MTSA 1X3PA 1OO9B 3PO2B 3CHBD 1DYQA 4KHVA 3RUZA 2AWOA 3AU7A 4KD3A 5C0XI 3VR2A 1HQMC 2SEBD 4OGQC 2K01A 3R93A 4B9XA 4ID6A 3FKIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNQ A;  2EYP A;  2EXZ A;  2F0G A;  2F0H A;  1SYF A;  1II3 A;  3D4D A;  3DHQ A;  3SK4 A;  3VA5 A;  1TR5 A;  3OSO A;  3HZX A;  3DMU A;  3OWF A;  5CV9 A;  4N9P A;  3QOL A;  5KEE A;  1TT2 A;  4KJO A;  4EVO A;  4PMC A;  1EY0 A;  5C4Z A;  5CC4 A;  4KJN A;  3PMF A;  4K5W A;  1F2Y A;  2QDB A;  1NSN S;  3NK9 A;  4WOR A;  4YIJ A;  3SXH A;  5I6Y A;  2F0Q A;  1JOR A;  1SND A;  2F0W A;  4IAL A;  4PMB A;  3H6M A;  4KTA A;  4NMZ A;  5CR3 A;  5DAU A;  2SOB A;  4K8I A;  4F8M A;  1STY A;  4K2L A;  5C3W A;  5K5P A;  5JOB A;  3P75 A;  4G57 A;  2F0M A;  3SR1 A;  3TP5 A;  5CV7 A;  2F0V A;  4QB4 A;  1U9R A;  2EYF A;  2EYL A;  4DF7 A;  5EGT A;  3NQT A;  1KAB A;  2EY1 A;  2HQE A;  3LX0 A;  2F0O A;  2PZT A;  5NUC A;  2PZU A;  4DU9 A;  2EYJ A;  5I6W A;  4QMG A;  1STG A;  1STN A;  5IGF A;  5ISR A;  2OF1 A;  2F0S A;  4QF4 A;  3ERQ A;  4KY7 A;  1ENC A;  2F0D A;  2F0K A;  4H7B A;  3SK6 A;  3ITP A;  4LAA A;  3TP6 A;  2SNM A;  3T13 A;  1STH A;  2EY6 A;  4RKB A;  5I9P A;  1SNP A;  1A3V A;  4HTH A;  4KY5 A;  5IOC A;  2KQ3 A;  4HMJ A;  3NUC A;  5M9O A;  3E5S A;  1SYD A;  5IGD A;  3BDC A;  4I65 A;  4RKL A;  3TME A;  1RKN A;  1NUC A;  1SNC A;  1EYA A;  5HUR A;  1SNO A;  3P1H A;  1SYB A;  1TQO A;  2F0U A;  1JOK A;  2F0N A;  2KHS A;  3MHB A;  3R3O A;  5C5L A;  4DGZ A;  1SNM A;  4R8N A;  1EY6 A;  2PQE A;  5I9O A;  4NKL A;  5JAV A;  2EY5 A;  1F2M A;  1KDA A;  3ERO A;  1EY8 A;  1STA A;  3MEH A;  4J1M A;  5IOD A;  1EQV A;  1EY4 A;  4K2K A;  1ENA A;  4KY6 A;  2F0J A;  2EYH A;  4EQP A;  4HMI A;  3S9W A;  2EYO A;  3BDL A;  4J6H A;  4MIU A;  4NP5 A;  2F0L A;  4PNY A;  1EZ6 A;  3EVQ A;  4K5V A;  2PW5 A;  5C4H A;  3TP7 A;  5C6A A;  3NXW A;  4K5X A;  2M00 A;  2PW7 A;  3EJI A;  3OMC A;  5E1F A;  5IIF A;  5CV6 A;  3D8G A;  2F0F A;  1A2T A;  5EKL A;  3OMG A;  4IZ8 A;  1KAA A;  2F3W A;  3D4W A;  5DEH A;  1A3T A;  3HEJ A;  1EYD A;  5KYL A;  2PZW A;  5IGE A;  2RBM A;  1EY9 A;  2SNS A;  5CV5 A;  4B9W A;  5KRU A;  4K8J A;  1EZ8 A;  5J39 A;  4ZUI A;  5KIX A;  4N9T A;  5IGB A;  5E3F A;  1A3U A;  2F3V A;  3SK8 A;  1EYC A;  2O4X A;  3NP8 A;  2NUC A;  2OEO A;  2EYM A;  5J22 A;  4K6D A;  3U9O A;  1SYE A;  2RDF A;  4ODG A;  4ME5 A;  4IUN A;  5HGT A;  4ZUJ A;  5F2D A;  4KD4 A;  5KGU A;  3TP8 A;  1EY5 A;  2PYK A;  4S3S A;  3MXP A;  5CV8 A;  5J1Z A;  5CGK A;  3MZ5 A;  2EY2 A;  2F0P A;  1KDC A;  2LKV A;  3QOJ A;  4KHV A;  1A2U A;  1SYC A;  3MVV A;  4F7X A;  3RUZ A;  3V2T A;  2WAC A;  5CV4 A;  4ZQ3 A;  1KDB A;  4TRD A;  4KV6 A;  1JOQ A;  5C5M A;  1JOO A;  3SHL A;  4KD3 A;  1F2Z A;  3QB3 A;  2F0T A;  2OXP A;  4WRD A;  3T16 A;  1IHZ A;  2F0I A;  5KYI A;  3SK5 A;  3C1E A;  4E6I A;  5EKK A;  5C3X A;  2F0E A;  1AEX A;  4OL7 A;  4NDX A;  4B9X A;  1STB A;  4EQO A;  4EQN A;  4ID6 A;  2RKS A;  3NHH A;  4K14 A;  3C1F A;  2ENB A;  1EY7 A;  5IGG A;  5IGC A;  3D6C A;  4DFA A;  1SYG A; 
#chains in the Genus database with same CATH topology
 1EIG A;  1XPU A;  1SNQ A;  1DGS A;  5IYD H;  1OTC A;  2OQK A;  5M5X B;  3P20 A;  3DHQ A;  3GV3 A;  3S24 A;  5CV9 A;  1MSH A;  3AMU A;  2CVR A;  2BA0 A;  4DV5 Q;  1WFQ A;  5IYC H;  3NK9 A;  3M4Y A;  4OWW B;  1KL9 A;  2BA1 A;  4F8M A;  3PO3 B;  1TY2 A;  2B29 A;  3A56 A;  2FJ2 A;  4GNX C;  2KOL A;  5IYB G;  3GTG H;  3HOU H;  2JA8 B;  2ATW A;  1WTR A;  3KLS A;  5FO7 B;  4H13 C;  1V1P A;  2EJF C;  4DR1 Q;  3PF5 A;  4DR4 L;  4RCN A;  3CME A;  2RSN A;  1I94 L;  3HKZ B;  2KHI A;  1SDF A;  1AH9 A;  1PH7 A;  4H7B A;  2Q8R E;  4A3M B;  3SK6 A;  2ZXR A;  5ELO A;  3S2H B;  2EY6 A;  1SNP A;  4UP9 A;  3A0J A;  1VQP A;  4Q5V A;  4DV3 Q;  1H9S A;  2NVQ B;  4RKL A;  1KC8 C;  3CP0 A;  2C9O A;  3E6Z X;  5LMN W;  2F0U A;  4GS3 A;  1BVS A;  3STB C;  1EY6 A;  4XYQ A;  1F77 A;  4DV6 L;  4C3H G;  3URY A;  1QCB D;  3FKI H;  2B63 B;  1Q8I A;  4BY1 B;  4EQP A;  5M5X H;  2EYO A;  1Q12 A;  2HD3 A;  3NEL A;  3T1Y Q;  1A6X A;  2G5D A;  3NXW A;  4U68 A;  3ONA B;  2VXW A;  4GLV B;  3PO3 H;  3MWY W;  3KLS X;  3MFG A;  3EBE A;  1AN8 A;  5IGB A;  3RN5 A;  1I6V C;  1GHK A;  1E2W A;  3S1R B;  4A3K G;  1YZ6 A;  5HGT A;  2QA4 A;  2D62 A;  4DKA C;  4DNI A;  2IHE A;  2VQE L;  1RJT A;  4NXN L;  2VS1 A;  3J81 L;  1CZW A;  2NN6 H;  4A3M H;  1KDB A;  3G4S A;  3S2H H;  4RA8 A;  3Q24 A;  1EIF A;  2WAQ E;  1MBY A;  3FRP B;  5M3F G;  4HIK A;  4KLK A;  1QZG A;  2NVQ H;  1BKB A;  1Q86 C;  2A74 C;  2B2Y A;  2RKS A;  5JVG 3;  4DUZ L;  1O78 A;  4LFA Q;  3PUX A;  1SYG A;  1VQF A;  4C56 C;  2NVT B;  2EYP A;  2X69 A;  1HJP A;  4A3G B;  2B63 H;  4BY1 H;  3KF6 A;  1D1I A;  1W6J A;  1X3Q A;  1SBB B;  3E3X A;  2A6H C;  4ZKB B;  3KJO A;  4B3T Q;  1D2B A;  1F2Y A;  2K5N A;  1BO0 A;  4YIJ A;  5I6Y A;  1PFS A;  2IPK D;  5C3E G;  1XX8 A;  3A54 A;  4KTA A;  4NMZ A;  2SOB A;  3DM1 A;  5E4W C;  1STY A;  4P2C B;  4LF6 Q;  3R2T A;  1SSO A;  3K0Y A;  4HR7 B;  4IJH A;  1TVX A;  1AFP A;  3AB9 A;  3I72 A;  1S4Z A;  3CPW A;  5ISR A;  2MO0 A;  3S1R H;  5TSS A;  2HCC A;  3FEW X;  4TSS A;  1EEF D;  3J7Z C;  2A8V A;  1A63 A;  2JA6 B;  2ASB A;  2YYZ A;  2NWG A;  1KRS A;  1UEA B;  4DAP A;  1IBL Q;  1ML0 D;  3TME A;  2EQS A;  5HUR A;  1OXX K;  1VQI A;  3E9H A;  1UAP A;  4LF5 Q;  4DR7 L;  1G29 1;  4DV1 L;  1C0A A;  2JA5 B;  4DK3 C;  2E2D C;  3MEH A;  1UWV A;  3JC6 6;  3KF8 B;  2EJG C;  2NVT H;  3I4N G;  4A3G H;  1N9W A;  1HR0 Q;  2MQH A;  3ULP A;  2Q2I A;  3D6W A;  2ZM6 Q;  4LW1 A;  4PQX A;  4MTK A;  3TP7 A;  4DR2 L;  1WTQ A;  2O5I C;  2QEX A;  1I6H B;  1VMC A;  3ICE A;  4LK1 C;  2O2L D;  3I4M H;  3HOZ G;  1B2T A;  4B3M L;  2OCE A;  4MHE A;  4HIO A;  1X9N A;  1N34 Q;  4R4O A;  2D9U A;  2F4V Q;  4FF4 A;  3HOY B;  4AQY Q;  3J80 E;  4FXD A;  5G3L F;  2HT1 A;  3CQZ B;  2DN8 A;  4X64 L;  2PYK A;  3DXJ C;  2LKV A;  1I50 B;  3AEV A;  1SYC A;  4HCS A;  3NTK A;  1VQJ A;  1L0W A;  3PUW A;  1AP0 A;  2GVB A;  2JA6 H;  4LF7 L;  1GUT A;  3T1H Q;  3RMH A;  3Q22 A;  1B4O A;  4QIW E;  5GAD C;  1N33 L;  1KD1 C;  3NTH A;  2ZJR A;  2A68 D;  1STB A;  1HUM A;  4HIM A;  5ELC A;  4DAV A;  1EY7 A;  3TSS A;  1V1Q A;  1TWC B;  3TZD A;  2JA5 H;  1K8O A;  3I8Z A;  1CM9 A;  4HJ5 A;  3NEM A;  2K50 A;  1VQ7 A;  1PFB A;  4PMC A;  3GTM B;  3TRZ A;  3PMF A;  3P7J A;  3A55 A;  5CR3 A;  4X3S A;  3L2P A;  3HRZ C;  4K8I A;  2E2H B;  4CKC A;  5KND A;  4CKE A;  5K5P A;  1LTA D;  2CWA A;  2ID0 A;  4P74 A;  2EE1 A;  1GXD C;  4IUV A;  3TP5 A;  5IT9 E;  3JAM E;  2LS0 1;  3LX0 A;  5NUC A;  3HOY H;  1QUQ B;  5I6W A;  1TKW B;  4X65 Q;  1JWU D;  1AE3 A;  1KLG D;  1L2F A;  3SVM A;  1VF7 A;  1M8A A;  4X66 L;  1T5X D;  4L5R C;  2E8G A;  3FPU B;  1PXU A;  4P71 A;  2B2T C;  1I50 H;  1L1O A;  4RKB A;  4GKJ Q;  4B3S L;  1T9H A;  1XTD A;  4KY5 A;  2TSS A;  3KYH C;  3S14 B;  2HIX A;  2E76 C;  2K5W A;  1SNC A;  4JVZ A;  3V05 A;  1RD9 D;  3AYH B;  3J80 i;  1S3O A;  1Y1V G;  3IL8 A;  3GTL B;  1PFN A;  1TWC H;  2KA7 A;  1XPR A;  3OWE B;  4N8X 1;  1D1K A;  2JE6 I;  4MIU A;  4R4I A;  4A3E B;  1WTW A;  1HUN A;  1BCP D;  2MUY A;  3GTM H;  4G7O C;  1FR3 A;  4KN4 C;  4LWC A;  4JI3 L;  2VQF L;  1XNR Q;  4RHR A;  3ULJ A;  2E2H H;  4A3D B;  2Z1C A;  1TWF B;  3K5N A;  3HOV B;  4Y52 H;  3CCL A;  2E2I B;  1SEB D;  3TBI B;  2NTS A;  1TII D;  3KOJ A;  4HJA A;  1QZH A;  2O4X A;  1MHW C;  5GRO A;  3G6J B;  1CHP D;  3VR5 A;  3RNU A;  3BZC A;  5C4J B;  1ET9 A;  3LNN A;  1EY5 A;  1SJE D;  1LTG D;  2A5H A;  2F0P A;  1PH4 A;  1G2S A;  3PUY A;  3J81 c;  4JYA Q;  4JI0 Q;  3U9S A;  3F2B A;  1RCV D;  3S14 H;  2A69 C;  5C3X A;  3U4Z A;  3UDI A;  2WB1 B;  3T4A C;  3JAM i;  1MD2 D;  3C1F A;  1L1O C;  1FL0 A;  4ZKC B;  5IGG A;  5IGC A;  4OO1 H;  4A93 G;  1ZYR D;  1RIP A;  4L63 B;  4MN3 A;  1YIJ A;  1Z9F A;  3TZU A;  4JI8 Q;  1QOH A;  4EVO A;  4BBR B;  4A3E H;  5GAE C;  1Z47 A;  2QDB A;  4I7A A;  4ABN A;  5C4X H;  4EGV A;  2RVL A;  5EKI A;  5C3W A;  2VL6 A;  3NBI A;  4OX9 Q;  3HOV H;  1TWF H;  2YTX A;  1CSP A;  1SE3 A;  2EDG A;  4DNT B;  4YCW A;  3G6E A;  2E2I H;  1HNX L;  1S5F D;  4XIG S;  1D6E C;  5AJ3 L;  4A3B G;  3CCS A;  5IGF A;  2QKI C;  4C3I G;  2CWP A;  2V1C C;  5C4J H;  4RH6 A;  1H95 A;  3ITP A;  1VQ8 A;  4DN4 M;  4ZLT F;  1D5X C;  3Q6S A;  3A5U A;  1LV9 A;  4X3K A;  3IFT A;  1A0I A;  4DA2 A;  2M9V A;  3R3O A;  3VDY A;  1SMX A;  1M1K C;  4B3R L;  3A5Z B;  4UDU C;  3OPO A;  1UE7 A;  2OTJ A;  3I56 A;  2NN6 I;  1YHA A;  2CKZ B;  1O7Y A;  3CRL C;  1K83 B;  4PNY A;  4K5V A;  1ASY A;  4BBR H;  4A76 A;  1BDO A;  1DZ1 A;  1EFW A;  1PYB A;  5LL6 X;  1G6Z A;  2ZT9 C;  1F9R A;  2OQ0 A;  1V1O A;  5DEH A;  1Y8O B;  4OIK A;  3I91 A;  5A2Q L;  2XVS A;  1IL8 A;  2K5D A;  3A7A B;  5CMD A;  1HFG A;  3NEN A;  4U67 3;  3FHW A;  2Q8T A;  1JWM D;  3GV6 A;  4IUN A;  4C3J G;  1QNU A;  4DXG A;  2IY5 B;  4BY7 G;  5LMN Q;  1PZK D;  4HN7 A;  4BXX G;  5COR A;  4UHV A;  1YNX A;  2GA4 B;  2K7V A;  1WI5 A;  1HZB A;  1X65 A;  1F2Z A;  2Z4H A;  5IYB H;  1AEX A;  4JI4 Q;  4A3K B;  1IYJ B;  4FXK C;  3AQQ A;  1SE4 A;  2K28 A;  1I4P A;  2F0H A;  2EXZ A;  1II3 A;  3DMU A;  1S5D D;  3G48 A;  4CJ0 B;  1MKH A;  5C4Z A;  4RCO A;  4ULL A;  1EY0 A;  5DLQ E;  5CC4 A;  1KQS A;  4CHT B;  1K83 H;  4K5W A;  1TWH B;  5M3F B;  4A3C H;  1S5E D;  3WDN A;  2H1E A;  2Z0S A;  3CW2 C;  1Q3L A;  2QGQ A;  2Z6B A;  2R92 H;  1WJJ A;  3DWA A;  3UDG A;  1TS2 A;  4AYB G;  3MXN B;  4DF7 A;  4QB4 A;  1I5F A;  2WB1 E;  5C0X G;  4YHH L;  1Y1W H;  2PMZ B;  1VF5 C;  1IKL A;  2AUK A;  4UAI A;  2F0S A;  2EOT A;  4LF8 Q;  2ZTE A;  3SDZ A;  1A62 A;  3S15 B;  5IWA L;  1KLU D;  3J7A 5;  3QR8 A;  4DAM A;  2JP1 A;  1X3E A;  3ER0 A;  2SDF A;  3WOE A;  5IP9 H;  5EBC A;  2K05 A;  1TQO A;  2KHS A;  5C5L A;  1PH6 A;  3NQI A;  5BR8 L;  4A3K H;  4NKL A;  4K0K L;  3HP3 A;  3E0J A;  1O7L A;  1FJG Q;  3PIO 3;  4C1N I;  5BN5 A;  4DR4 Q;  1PYS B;  1T5E A;  3SE0 A;  3LWU A;  1EQQ A;  1J5E Q;  4R4T A;  5JVH 3;  3FVQ A;  2VUM G;  4H44 C;  1XTC D;  1HNW L;  5M3F H;  1A2T A;  3D3R A;  4QUC A;  2H4O A;  1HZ9 A;  1TWA B;  2F3I A;  4HID A;  2RDG A;  3M7G A;  1PH5 A;  1LTI D;  3PIP A;  4JI2 Q;  3I4N B;  1GM5 A;  2AMC B;  2QIL A;  1XMQ Q;  1U4L A;  3I3C A;  4LUO A;  5D65 A;  4TVA B;  4X62 L;  4GNX A;  4KD4 A;  3TQY A;  1KRT A;  1BXT A;  4C1N K;  2K33 A;  4DV6 Q;  4DAY A;  4DR5 L;  3S15 H;  3HOZ B;  1Z6H A;  2K32 A;  1VQ6 A;  1HA5 A;  5BN3 A;  4OWT B;  2PPB C;  3G7L A;  1SFO B;  1K0R A;  2R7Z G;  4G7H C;  4FYD A;  2HHH L;  1C7Y A;  4QY7 A;  1MIU A;  1NNX A;  4OON A;  2V4D A;  5M5Y B;  1LT3 D;  4WJ3 M;  1SYF A;  2FIN B;  1Q90 A;  1TT2 A;  1TXY A;  3I73 A;  3W1G A;  3E9I A;  2MGS A;  1SND A;  1CKN B;  1B9N A;  3H6M A;  2RDH A;  2UUC L;  4QCL A;  5ELN A;  5IY0 A;  3P75 A;  2VQE Q;  1EU3 A;  1TWA H;  1JR0 D;  3SR1 A;  3QG1 A;  2F0V A;  2NVX H;  1U9R A;  2K6A A;  2HQE A;  5G3L D;  4DU9 A;  1MGS A;  2PZU A;  4QMG A;  1AE2 A;  3STB D;  1WYD A;  2I5M X;  2FFK B;  2K5Q A;  2X6L A;  3NBH A;  3GTP B;  1B53 A;  1ESF A;  4QL5 A;  3K0X A;  2ES2 A;  3GTQ B;  1F9Q A;  1YHB A;  1V43 A;  3RR5 A;  3TP6 A;  1BBU A;  3HOZ H;  4HTH A;  1CQV A;  4B08 A;  2E5L L;  3M85 A;  5IGD A;  1SFO H;  3CRK C;  3GD7 A;  4Y7N B;  3NE5 B;  2K1B A;  1HFN A;  5GAG C;  4DR3 Q;  3PGZ A;  5C44 G;  1CT1 D;  2AQ3 B;  3E0E A;  2PQE A;  2QEJ C;  2Q2T A;  3ERO A;  2JA7 G;  2Y0S E;  4IOA A;  2F0J A;  5M5Y H;  1XNQ L;  2KCN A;  3PO2 H;  1VQL A;  3Q23 A;  1IBM Q;  5FJ8 H;  3WOF A;  2M00 A;  3KF8 A;  2L1B A;  1ZEQ X;  1AW7 A;  1X3F A;  5EKL A;  3FPP A;  2OTL A;  2CCZ A;  1A3T A;  1IL2 A;  4NB3 A;  4GKK Q;  4OO1 I;  3DWP A;  1TS4 A;  3HOW G;  4ZUI A;  4KHP L;  1R4Q B;  4IQZ A;  4DUY Q;  2NUC A;  4HAE A;  4ME5 A;  5FLX L;  4QGU A;  1EQT A;  1ZKO A;  5F2D A;  4DR7 Q;  4DV1 Q;  4APV A;  1JB7 A;  3GTP H;  3QOJ A;  4JV5 Q;  1VQG A;  4DV2 Q;  3GTQ H;  2A6H D;  4GN5 A;  1JOQ A;  2OXP A;  1D5Z C;  1LAC A;  2F0I A;  5EJW A;  4IN3 A;  4E6I A;  4Q0F A;  4DR2 Q;  4JOI A;  1K8G A;  5JJL A;  2CH4 A;  4OL7 A;  3CCM A;  1FVI A;  4EQO A;  4DV0 L;  3C2P A;  1PDQ A;  2IX0 A;  5DM7 3;  4NXM L;  2JA8 H;  2K75 A;  4DFA A;  2AQ2 B;  2JK8 A;  2A6E C;  1KAW A;  4M8A A;  1SXT A;  2YTY A;  3U4V A;  4OEL B;  1ESR A;  5E4X A;  3BDO A;  1QVG A;  1HZC A;  1JOR A;  4A3F G;  1LTT D;  2UXD L;  4IPD A;  4X64 Q;  1PTO B;  4K2L A;  1AZQ A;  3OTO L;  2B2W A;  3L7Z C;  2UUB Q;  3MAQ A;  4A93 B;  2EYF A;  4LF7 Q;  3V96 A;  1TS3 A;  5HY6 A;  3VYS A;  3KBX A;  1STN A;  2VZA A;  1LYL A;  2OF1 A;  1B3Q A;  1SRO A;  1HTL D;  1PRT D;  2VB2 X;  3J81 i;  1FGB D;  4J15 A;  3HKS A;  1S5B D;  4FF3 A;  4JBM A;  2AQ1 B;  4P73 A;  4DV4 L;  4A4I A;  1P16 A;  2XSC A;  5M9O A;  2J4X A;  2EVB A;  3GTJ B;  3OIP A;  4DV5 L;  1HH2 P;  1A8V A;  3OIQ A;  4C3I B;  4HSP A;  5JAV A;  2R7D A;  1LAB A;  2KEN A;  1SR3 A;  2Y0S G;  1IBK L;  3H94 A;  3K8A A;  5M3M G;  1VQ4 A;  4JOI C;  1RL2 A;  4JBW A;  2I0Q A;  1E2Z A;  5E1F A;  2PW7 A;  4DK0 A;  1K3B C;  3U58 A;  4DR1 L;  2NYZ D;  2PCF B;  3D4W A;  3C3L A;  1PTO H;  1XWE A;  4JI5 L;  3PQI A;  4CDE C;  4IFD H;  1YNJ C;  3GTO B;  1HPC A;  1W2B A;  2BE5 C;  5KRU A;  4B3S Q;  2NBF A;  1E22 A;  1A3U A;  1X54 A;  2RCN A;  3W3A A;  2JSO A;  2KUM A;  4QUF A;  2MJ8 A;  1I3Q B;  2BOS A;  2N78 A;  2IT1 A;  2B2W C;  4POF A;  4S3S A;  3HKZ E;  3HGB A;  5CV4 A;  4ZQ3 A;  1XJV A;  1O7Z A;  4IFD J;  3OYY A;  3PF4 A;  3QB3 A;  1IHZ A;  4JI7 Q;  1G6P A;  3SK5 A;  2PQA A;  4BS9 A;  2EIF A;  2QCP X;  1IW7 C;  4IOC A;  3T1Y L;  2B2T A;  4C3J B;  4EQ5 A;  4BY7 B;  2IW3 A;  1ET6 A;  3UE1 A;  5L37 A;  3X3M A;  1NSN S;  3H3V H;  2F0Q A;  1QJO A;  1M90 C;  5DAU A;  1PZJ D;  2DNE A;  2WAQ G;  2UXC Q;  4HJ8 A;  1K73 C;  1S5C D;  3NSW A;  4IPG A;  3GTO H;  3HOU G;  2F03 A;  5EGT A;  4DK1 A;  1KAB A;  2CW0 C;  1E2V A;  4X3U A;  4AIM A;  1UE1 A;  4IUT A;  2E74 C;  1ENC A;  3GTK B;  1V9P A;  5JEA H;  1STH A;  1VQB A;  3VR4 A;  1SJH D;  5EAY A;  2JN4 A;  2A1A A;  1TU2 B;  2XRQ D;  2ZTD A;  4LFA L;  2MNA A;  1I6H H;  4AYB B;  4I65 A;  1HTP A;  3VYT A;  2XN9 C;  1EYA A;  1SYB A;  2N88 A;  1U5K A;  1GVP A;  5I9O A;  4DR6 Q;  4LUZ A;  1F2M A;  4C3J H;  4LF4 Q;  3X3N A;  1PRT B;  4BY7 H;  3H0G G;  3FKI G;  4FF2 A;  4V19 0;  2R93 B;  4XDX A;  5K36 G;  1B70 B;  4LF6 L;  3CQZ H;  5JEA J;  1HNX Q;  1JCK B;  1PZI D;  1ONL A;  1U0L A;  3I70 A;  1OXT A;  4A3I B;  4CJ2 C;  3GQB A;  1WTP A;  1HCZ A;  3PO3 G;  3HOX B;  2PZW A;  2RBM A;  2SNS A;  3KF6 B;  1VQE A;  1EZ8 A;  4F87 A;  1QIL A;  5M5W B;  2A69 D;  3SK8 A;  5T1I A;  3PV0 A;  4QJF A;  3J80 L;  5FLX c;  1PH8 A;  1DCZ A;  2XWJ B;  1N32 Q;  3KDF B;  5KGU A;  3BS1 A;  4FF1 A;  3GTK H;  4LF5 L;  4A3M G;  1JOO A;  2NN6 G;  2A68 C;  1EU4 A;  2F0T A;  4ALP A;  1PHJ A;  1FYC A;  3C1E A;  3K7A B;  2JXM B;  1HR0 L;  3KK7 A;  3I55 A;  3PSI A;  3OHX C;  4PV1 C;  2ENB A;  2N3S A;  3D6C A;  2MO1 A;  1KNA A;  4JK1 C;  1N36 Q;  1IZ6 A;  3L3O C;  3CXC A;  1HA6 A;  2ZXO A;  4JBK A;  2B63 G;  3QOL A;  1N34 L;  2JYO A;  2R93 H;  4GN3 B;  2FMM A;  2GVA A;  3W1B A;  4NPS A;  4DNR B;  4GOP B;  1VS0 A;  4I7Z C;  1R9T B;  2R7Z B;  1KNE A;  2NZH A;  4AQY L;  2CQA A;  2WKC A;  4A3I H;  3CCQ A;  2XRS D;  4PZ7 A;  3BVG A;  1YI2 A;  3HOX H;  1SMY C;  5CV7 A;  1XPO A;  1PYW D;  1Q1B A;  2CHB D;  5IT9 L;  5M5W H;  2L55 A;  2F0O A;  1VQM A;  3JAM L;  2IJ0 A;  3GTL H;  1JB3 A;  1GUG A;  2QF7 A;  1ROD A;  1SE2 A;  4CBV A;  4BBS B;  4R4Q A;  3S17 B;  2LY7 A;  4M1U B;  5I9P A;  2R3Z A;  4EX5 A;  1U4R A;  4HMJ A;  5EBD A;  3CAM A;  3BDC A;  3BVZ A;  3PUZ A;  2UU9 Q;  4BA2 I;  4IUR A;  3K7A H;  2F0N A;  3D0F A;  3MHB A;  4A3D H;  1VQC A;  1CA5 A;  1SNM A;  1RF2 D;  2CQO A;  3CD6 A;  1Q7Y C;  1E1O A;  2LSS A;  4J1M A;  1YJN A;  3S1M B;  2EYH A;  1VDZ A;  1UE5 A;  4CDD C;  4NP5 A;  4A3G G;  2BH2 A;  2WIN B;  4LF9 L;  1R9T H;  1R4P B;  2R7Z H;  1LTL A;  2AHO B;  5BN4 A;  5FK9 C;  1K28 A;  2F3W A;  1EL0 A;  1WTX A;  4X65 L;  3I4M G;  1ASZ A;  2DY7 A;  2NZO A;  1VMP A;  2KHJ A;  1EY9 A;  5EPL A;  1H9J A;  4A3J G;  5LL6 S;  2JA7 B;  4N9T A;  1B44 D;  1B8A A;  5KNB A;  1O80 A;  4RAU C;  4ODG A;  4GKJ L;  1X56 A;  4CDC C;  4DV7 Q;  2J0T D;  1E1T A;  1UUP A;  2Q8I B;  2K03 A;  5BR8 Q;  1Q1E A;  2ZXP A;  4K0K Q;  2K5V A;  3CKI B;  3CCJ A;  4JI6 L;  4BBS H;  3S17 H;  1MJC A;  4ME3 A;  3T16 A;  2JA6 G;  1LM0 A;  2XTI A;  1BOS A;  3C46 A;  4XYO A;  3K58 A;  5JPN C;  4H02 A;  1HNW Q;  4JCV E;  4C3H B;  1SE8 A;  1HZA A;  2RF4 A;  1WTH A;  3MA2 B;  4YY3 Q;  3S2D B;  1B9M A;  4LFB L;  2JA5 G;  1CUK A;  4N9P A;  3S1M H;  1BCP B;  1YNN C;  2FXQ A;  3SEB A;  2DJG C;  4MZ9 A;  2L11 A;  2EZV A;  3ULL A;  1LTS D;  1GO3 E;  3CCE A;  4V0B A;  3MXG A;  4G57 A;  2JA7 H;  3NQT A;  4JI1 Q;  3HOY G;  5EPK A;  4KI0 A;  4A3F B;  4L8J A;  2PI2 E;  4IFD I;  4A3L G;  3J7A F;  3Q0A A;  4RGN A;  2KQ3 A;  2L15 A;  2Q2U A;  2IWH A;  3DEP A;  2K04 A;  3K80 C;  3P1H A;  4JI8 L;  3K5M A;  1PVO A;  3K6O A;  4R8N A;  4C3H H;  2UUC Q;  5EQ0 A;  2EY5 A;  1XMO L;  5JJI A;  1EY8 A;  1STA A;  3S2D H;  1EY4 A;  4HJ9 A;  1NJI C;  1LT5 D;  5C3E B;  3BU2 A;  1VQA A;  2L0C A;  1G8Z D;  1LT6 D;  3J7Y W;  3UDF A;  2UXB L;  3GO5 A;  3MEF A;  3VYU A;  2RHS B;  4P75 A;  3W2D A;  1GJX A;  2Q2H A;  2I07 B;  4XQJ A;  1UE6 A;  1Y69 U;  2MPM A;  1VQD A;  3NTI A;  5KYL A;  4X3T A;  1X6O A;  2E5L Q;  4KKU A;  4IUQ A;  5M3M B;  4R9W A;  1DXM A;  2EYM A;  3J80 c;  1WTV A;  2JQO A;  1NY4 A;  1L0X B;  1HHV A;  3QIA A;  3TP8 A;  4A3F H;  1VQH A;  3MXP A;  1TWG B;  4KMU C;  5CV8 A;  1S72 A;  5FO9 B;  1I94 Q;  4TRD A;  1D5M C;  1CZG A;  1TWH H;  5I4D A;  2H5X A;  1TS5 A;  2HQL A;  3DM3 A;  4IPC A;  1TY0 A;  2D0P A;  2F0E A;  2TMP A;  3F2U A;  1VQO A;  3QWN A;  3I7F A;  2AKW B;  4ZAI A;  4ZK9 B;  1FGU A;  4BA1 I;  2PO4 A;  4OO1 G;  2B39 A;  3D4D A;  1YHQ A;  3EN2 A;  3SK4 A;  1HNZ L;  4YWK A;  1GUN A;  1B1Z A;  1CSQ A;  2AUJ D;  1CI3 M;  1EUJ A;  1EWH A;  2D5D A;  4MNO A;  5C3E H;  1A15 A;  4A3E G;  5JJZ A;  3EA6 A;  1CKM A;  5C4X G;  4L5S A;  1V8Q A;  3IKJ A;  4GLA C;  2HIV A;  3HOV G;  2EPB A;  5IT9 c;  2NB0 A;  1U4P A;  2PZT A;  3JAM c;  1CTM A;  2B8F A;  5M3M H;  1HXY D;  1NE3 A;  2RQX A;  3VR3 A;  4JBJ A;  3L0O A;  4DV0 Q;  1C4Q A;  1JJC B;  2MFI A;  2DY8 A;  2L5T A;  3KLW A;  1TWG H;  4HJ7 A;  2WAQ B;  1MSG A;  5I2X A;  1A3V A;  5LMU L;  2EXD A;  3NUC A;  2ZJP A;  1AZP A;  1K8A C;  1VQ5 A;  4P72 A;  2MHV A;  4A75 A;  4NXN Q;  2Z4I A;  3I4O A;  2IL8 A;  3AFP A;  3BG3 A;  3PIP 3;  3S16 B;  2WB1 G;  4XT3 B;  3OTO Q;  3ZYY X;  4XTC S;  4ILW A;  3I4N H;  1RHP A;  3CPF A;  3N6R A;  3U50 C;  1D7Q A;  1XYI A;  1KHI A;  2KJX A;  1EFI D;  5CBA E;  2PW5 A;  4DUZ Q;  1IKM A;  1GHJ A;  2KVM A;  1VQK A;  4BBR G;  1QWY A;  1CK1 A;  3BVM A;  3CCU A;  2YTV A;  4OEM B;  4IUU A;  4PZ6 A;  1GOZ A;  3EFX D;  4LF8 L;  3RLO A;  1ZXT A;  4DV4 Q;  1OXV A;  3LGJ A;  3H0G B;  3ZJY C;  1QE6 A;  2K5H A;  1S40 A;  1BR9 A;  1SN8 A;  2Z6K C;  2PMZ E;  4ZUJ A;  2DUD A;  3CCR A;  2VNU D;  2B2V C;  1UNS A;  2A6E D;  3MZ5 A;  3J81 E;  3CC2 A;  1ENF A;  1A2U A;  4CJ1 B;  1CFM A;  1PTO C;  1STE A;  2WAC A;  3V2T A;  1MJE A;  4RGO S;  2KCM A;  1IBK Q;  1EOT A;  3A8K E;  4L5Q A;  2BDN A;  2XNA C;  4LMQ D;  3H09 A;  1FJG L;  1BQQ T;  4CKB A;  5IP7 G;  1C48 A;  1WCM G;  1Y1V B;  4WJW A;  1DOL A;  5CYU A;  1J5E L;  3S16 H;  3T51 B;  4JI5 Q;  3I4L A;  1J9O A;  1Q46 A;  3I90 A;  1TR5 A;  1KIX A;  3PUV A;  1OXS C;  4HCE A;  3T53 B;  1K3R A;  1JWS D;  4PMB A;  3WWV A;  1EWC A;  3A8J E;  4UY8 C;  4A3C G;  4JI2 L;  4RG1 A;  3IFD A;  1BUV T;  1XMQ L;  1LTB D;  1QNK A;  3O13 A;  3CC7 A;  1YJW A;  4LFC L;  2F0M A;  2R92 G;  5FLM G;  2VY3 A;  4Y7N H;  1U4M A;  1QVC A;  3H0G H;  4B3M Q;  1BBW A;  1STG A;  5K36 H;  1Y1W G;  2EJM A;  1GKH A;  5E7N A;  3IRB A;  3H3V C;  2N8N A;  3BZK A;  2KCC A;  2F0K A;  1RTN A;  2C5C A;  1NR4 A;  3R2I A;  4N8F A;  1JE4 A;  4LAA A;  1NMF A;  4G4K A;  1HRJ A;  1DOM A;  1YIT A;  1F2L A;  4QIW B;  2KEC A;  5IP9 G;  3TS2 A;  1RKN A;  1GUS A;  1SNO A;  4GNX B;  4YWM A;  1I4X A;  3F8T A;  1YNJ D;  1Y1V H;  4DAY B;  2BE5 D;  1SRU A;  1C8C A;  4GZY C;  4ZCK A;  1EQV A;  5IOD A;  3I2Z A;  4CGY B;  4O1N A;  4XQQ A;  1N33 Q;  2P5Z X;  2IHF A;  4O2D A;  1CA6 A;  3FDT A;  2XWB B;  1SAP A;  1OXU A;  1QUQ A;  3TRE A;  5IIF A;  3EJI A;  2UUA L;  1PLF A;  4FDB A;  1D8L A;  1SLJ A;  3RLF A;  2D0O A;  3CCV A;  2OWO A;  1FNV A;  4TQU S;  1JIC A;  3CF5 A;  1Y8N B;  5J39 A;  4K8J A;  5KIX A;  1N8R C;  4UP8 A;  4A3B B;  3K5O A;  2M2L A;  4KKT A;  5J22 A;  1IW7 D;  1PH1 A;  1I4G A;  1JT8 A;  2ALY B;  5J1Z A;  5T1G A;  4LJZ C;  4KN7 C;  2BH8 A;  1L0Y B;  2G9H D;  4FNF A;  4DR3 L;  3I4M B;  2G9D A;  1DM0 B;  2OT2 A;  3RN2 A;  4WRD A;  1G91 A;  3KDF A;  3RLN A;  4A3J B;  4KK7 A;  4X66 Q;  4JPB W;  3CC4 A;  5EKK A;  3D31 A;  3NBH B;  3NHH A;  4YCU A;  4PG3 A;  5FOB B;  1IBM L;  4A93 H;  2GN5 A;  2HUG A;  3K81 C;  2XIW A;  4PMW A;  2JJQ A;  3VA5 A;  3J7A V;  2E2J B;  1YVC A;  3M7N A;  2CW0 D;  4GKK L;  5CBE E;  4KJO A;  4DV3 L;  3KUP A;  1PH3 A;  2WV6 D;  3SXH A;  2F0W A;  2L9H A;  2PI2 A;  2F4I A;  3UI2 A;  2HCI A;  1V1P B;  4DUY L;  3AFQ A;  4GOP A;  1PA6 A;  1PTO F;  3R8B A;  1GUO A;  3GTJ H;  4JI3 Q;  4R1J A;  2FMC A;  2VQF Q;  1PRT C;  2Z9H A;  1ILQ A;  4JV5 L;  4A3B H;  4DV2 L;  4RGT A;  5FKA C;  4C3I H;  1IYV A;  1C9O A;  2R61 A;  2N55 A;  3ERQ A;  4KY7 A;  5IYD G;  3MXU A;  3TDQ A;  2F0D A;  2R6G A;  1H9S B;  2B2Y C;  3N52 A;  4IJL A;  2SNM A;  3QO2 A;  5IYC G;  4IUP A;  2Z8L A;  1F9S A;  3CU7 A;  4UPA A;  1SYD A;  3NPP A;  4H0L C;  5EPJ A;  4DPG A;  1WTO A;  3Q8D A;  4A3J H;  3HFZ B;  3EIV A;  4JW0 A;  2K52 A;  1KDA A;  2A73 B;  1BBX C;  1EWI A;  1PMR A;  2I46 A;  1CQF A;  4K6L A;  4KY6 A;  2LFN A;  1WD0 A;  2E2J H;  1HQR D;  3F2C A;  1I3Q H;  4RHS A;  4LUV A;  5C4H A;  2UUB L;  3PO2 G;  4POG A;  4K5X A;  5COY A;  2F1M A;  5FJ8 G;  1EYG A;  1YEZ A;  1NTG A;  3D4R A;  4IZ8 A;  1KAA A;  1I4Q A;  3HS0 C;  3DWQ A;  3HEJ A;  5ELB A;  3M4O B;  5E3F A;  2PNR C;  3TS0 A;  4O42 A;  2ICE C;  2F3V A;  4O0A A;  4B3T L;  3NP8 A;  3K7U C;  4FXG C;  3VA7 A;  1J8I A;  3U9O A;  3CMA A;  2AWN A;  4GOP C;  4BXX H;  3KLR A;  5CGK A;  3BYY B;  3M4P A;  3S1Q B;  2RCF A;  3TEH B;  3NWT A;  3NWS A;  5AJ3 Q;  4KV6 A;  1YJ9 A;  1BF4 A;  5KYI A;  4X6A H;  4LF9 Q;  3M9B A;  3T56 B;  1JE5 A;  4NDX A;  4F88 A;  2KCT A;  5DNF A;  1G51 A;  2I5H A;  4Z9C B;  2JA8 G;  2WP8 J;  1SMY D;  1DD2 A;  3K59 A;  3K5L A;  4YWL A;  3OSO A;  1QB5 D;  3OWF A;  5DM6 3;  5KEE A;  4RMF A;  2VUM B;  1X3G A;  4A3L H;  1IBL L;  4B3R Q;  3HKZ G;  4LNQ A;  4IAL A;  1PH9 A;  1EEI D;  3FP9 A;  2HDL A;  4FP5 D;  2JA9 A;  2R7F A;  4UP7 A;  2RA4 A;  3RZD B;  4JI6 Q;  1H9K A;  2HDM A;  5C0X H;  3BZD B;  2ZM6 L;  4NW2 A;  2EY1 A;  3M4O H;  5D14 A;  3LWE A;  4R8I A;  4WJ4 A;  4G7Z C;  2DNC A;  4QF4 A;  4JI7 L;  1DON A;  4BY1 G;  5C4X B;  2WII B;  4L5T A;  3S1Q H;  4LFB Q;  3ND8 A;  4ZRZ A;  2F4V L;  4L6T B;  5IOC A;  1FD7 D;  5ELD A;  1LLR D;  3H15 A;  5C0X J;  2DGY A;  3KFU A;  3BYT B;  3EQL C;  2BDO A;  4HED A;  1PRT F;  2UXC L;  3MXN A;  2LMC B;  3T1H L;  3EVQ A;  2PQA B;  2VUM H;  4RFB A;  3OMC A;  5CV6 A;  1WVL A;  2F0F A;  1QG7 A;  3QJY A;  3OMG A;  1B50 A;  1ICF B;  5A2Q E;  2JEB I;  2NZ1 D;  4IFD G;  2NVY B;  5CV5 A;  3RZD H;  2JEA I;  1NBW A;  1PFM A;  2B3G A;  2B2U A;  1EYC A;  1JJG A;  5GQO A;  3MC0 B;  2OEO A;  4K6D A;  2RDF A;  2WFW A;  1BCP C;  3MFY A;  1EIH A;  1KDC A;  1XMO Q;  4QQB X;  2MP1 A;  3MVV A;  4YHH Q;  1YNN D;  1E24 A;  5C5M A;  3SHL A;  4DR6 L;  1EOV A;  3FMC A;  4LF4 L;  2YV5 A;  4KKS A;  1X32 A;  5IWA Q;  5C44 B;  4RGM A;  3J81 j;  2UXB Q;  4AYB E;  1E7Z A;  1O7I A;  4ZYS A;  4EQN A;  3M3Y B;  2NTT A;  2L4N A;  4K14 A;  3DEO A;  1Q81 C;  3BJU A;  3OOC A;  2F0G A;  1JQY D;  1LT4 D;  4C2M B;  5IE8 A;  4XT1 B;  4XXE A;  3DUZ A;  4JC0 A;  1K8M A;  3VR6 A;  1KTK A;  1VCI A;  1Y14 B;  1Q82 C;  2BCO A;  5JPM C;  1WD1 A;  4PZ8 A;  3HOW B;  1WCM B;  4OHJ A;  3DLL A;  3IAY A;  1HR0 W;  3TN2 A;  5J3B A;  1N32 L;  1ZYR C;  2NVY H;  4J8Q A;  3SGI A;  4WFN 3;  2EYL A;  3F2D A;  2EYJ A;  2O5J C;  2QDL A;  1L1O B;  4HSV A;  1E3P A;  2L12 A;  4AH6 A;  1XNR L;  4TKO B;  2ZTC A;  5H1S E;  1LUZ A;  4OWX B;  1CKO A;  3K57 A;  1WOC A;  1BNZ A;  2B2U C;  5JEA G;  1HNZ Q;  1ILP A;  1EQR A;  3RD4 A;  1J6Q A;  4X62 Q;  2R92 B;  3E5S A;  1NCV A;  2IX3 A;  1N36 L;  4XQN A;  4JG2 A;  2YU9 B;  5AFW A;  4DR5 Q;  1NAP A;  5C44 H;  1CKN A;  1Y1W B;  4GLX A;  3M3Y H;  2ZJQ A;  3OW7 A;  1XXG A;  5D3I B;  1FNW A;  2VW9 A;  4JYA L;  3ERS X;  3RZO B;  4JI0 L;  1VQ9 A;  2XGT A;  4HMI A;  4C2M H;  3S9W A;  3BDL A;  2F0L A;  1EZ6 A;  1H9R A;  1EIY B;  2HHH Q;  3S1N B;  5C6A A;  2A19 A;  3KBG A;  3F1Z A;  1G2T A;  5IP7 H;  1IXR A;  5LHY 1;  3HOW H;  1WCM H;  1FNU A;  5IGE A;  1I4R A;  2I5L X;  5D3D A;  5LMU Q;  1DOK A;  1DJR D;  1F9P A;  2KED A;  1SYE A;  1PH2 A;  5JJK A;  1IYU A;  3PIO A;  2RSO A;  1W3S A;  2J7Z A;  1YBY A;  1JC7 A;  2EY2 A;  4YCV A;  2UU9 L;  1MI2 A;  4F7X A;  4OX9 L;  1E0B A;  1RDP D;  2KEE A;  2K4K A;  1GUW A;  1I4H A;  5FLM H;  2N49 A;  3VYR A;  2YU9 H;  2KBN A;  4KHZ A;  2Y0S B;  2PNH A;  1CHQ D;  3H3V I;  3RZO H;  3HZX A;  2CFM A;  1H9M A;  2R93 G;  4KJN A;  3GDE A;  1ICW A;  1Z7T A;  4OIJ A;  4WOR A;  1PV4 A;  1BCP F;  3S1N H;  1B3A A;  1K9M C;  5I2Y A;  1B7Y B;  1QVF A;  3UDX A;  1XNQ Q;  1UEB A;  5JOB A;  4A3I G;  1GD7 A;  5ELF A;  5FO8 B;  4RWS C;  3HG9 A;  4DV7 L;  2K14 A;  3HOX G;  1JJ2 A;  4FO2 A;  2C35 B;  2FHT A;  1Q8K A;  1X55 A;  1LTR D;  1LO5 D;  4KHP Q;  4BWG B;  4FVM A;  3OW2 A;  1M4V A;  4CDF C;  4R4C A;  2IX1 A;  4IO9 A;  3ND9 A;  3T13 A;  5KNC A;  4DK6 C;  1W6K A;  3A7L A;  3GP7 A;  2CH4 W;  4YY3 L;  1P8L A;  1RTO A;  2Z6K A;  2VB3 X;  2LXJ A;  2D2C C;  3A8I E;  1NUC A;  2NVX B;  2B2V A;  1JOK A;  4IPH A;  4DGZ A;  2WKD A;  2ICI A;  2X6G A;  5LMN L;  4A3D G;  5ELE A;  3UE0 A;  3KJP A;  4K2K A;  1ENA A;  4LFC Q;  1KXL A;  2F52 A;  4J6H A;  2DJF C;  3L9A X;  3W5O A;  4DXF A;  5GAH C;  4NXM Q;  1K0S A;  3G71 A;  1Y8P B;  4JI4 L;  5HGQ A;  3D8G A;  2B8G A;  4JI1 L;  1PTO D;  3GTG B;  3HOU B;  1EYD A;  4B9W A;  4MTN A;  2UXD Q;  5A35 A;  3A74 A;  1NR2 A;  2QW7 A;  3H91 A;  5FLX E;  2E75 C;  1JMC A;  3MTS A;  1X3P A;  4OXP A;  1OO9 B;  3PO2 B;  3CHB D;  1DYQ A;  4KHV A;  3RUZ A;  2AWO A;  3PCO B;  4BBS G;  3AU7 A;  4KD3 A;  5C0X I;  3VR2 A;  3B6Y A;  1VQN A;  1HQM C;  1NMG A;  2SEB D;  4OGQ C;  2K01 A;  3R93 A;  2LXK A;  4B9X A;  2UUA Q;  3M4Q A;  4ID6 A;  4GN4 B;  2RHQ B;  3FKI B; 
#chains in the Genus database with same CATH homology
 1EIG A;  1SNQ A;  5M5X B;  3P20 A;  3DHQ A;  3GV3 A;  5CV9 A;  1MSH A;  3AMU A;  2CVR A;  2BA0 A;  3NK9 A;  3M4Y A;  2BA1 A;  4F8M A;  3PO3 B;  1TY2 A;  3A56 A;  2FJ2 A;  2KOL A;  2JA8 B;  1WTR A;  3KLS A;  5FO7 B;  4H13 C;  1V1P A;  2EJF C;  4RCN A;  2RSN A;  3HKZ B;  1SDF A;  4H7B A;  2Q8R E;  4A3M B;  3SK6 A;  2ZXR A;  3S2H B;  2EY6 A;  1SNP A;  4Q5V A;  1H9S A;  2NVQ B;  4RKL A;  2C9O A;  3E6Z X;  2F0U A;  1EY6 A;  4XYQ A;  1F77 A;  4C3H G;  3URY A;  1QCB D;  2B63 B;  1Q8I A;  4BY1 B;  4EQP A;  2EYO A;  1Q12 A;  1A6X A;  3NXW A;  4U68 A;  3ONA B;  2VXW A;  3MWY W;  3KLS X;  3MFG A;  1AN8 A;  5IGB A;  1I6V C;  1GHK A;  1E2W A;  3S1R B;  5HGT A;  2D62 A;  1RJT A;  3J81 L;  1CZW A;  2NN6 H;  1KDB A;  4RA8 A;  3Q24 A;  3FRP B;  1MBY A;  2A74 C;  2B2Y A;  2RKS A;  5JVG 3;  1O78 A;  3PUX A;  1SYG A;  4C56 C;  2NVT B;  2EYP A;  2X69 A;  4A3G B;  1D1I A;  1W6J A;  1X3Q A;  1SBB B;  4ZKB B;  2A6H C;  1D2B A;  1F2Y A;  1BO0 A;  4YIJ A;  5I6Y A;  2IPK D;  1XX8 A;  3A54 A;  4KTA A;  4NMZ A;  2SOB A;  3DM1 A;  5E4W C;  1STY A;  4P2C B;  3R2T A;  1SSO A;  3K0Y A;  4HR7 B;  1TVX A;  1AFP A;  3AB9 A;  3I72 A;  1S4Z A;  5ISR A;  5TSS A;  2HCC A;  3FEW X;  4TSS A;  1EEF D;  2JA6 B;  2YYZ A;  2NWG A;  1UEA B;  4DAP A;  1ML0 D;  3TME A;  5HUR A;  1OXX K;  1UAP A;  1G29 1;  2JA5 B;  2E2D C;  3MEH A;  2EJG C;  3D6W A;  4PQX A;  3TP7 A;  1WTQ A;  2O5I C;  1I6H B;  1VMC A;  4LK1 C;  2O2L D;  1B2T A;  4MHE A;  2D9U A;  4FF4 A;  3HOY B;  3J80 E;  4FXD A;  5G3L F;  3CQZ B;  2DN8 A;  2PYK A;  3DXJ C;  2LKV A;  1I50 B;  1SYC A;  4HCS A;  3NTK A;  3PUW A;  1AP0 A;  1GUT A;  3RMH A;  3Q22 A;  1B4O A;  3NTH A;  2A68 D;  1STB A;  1HUM A;  5ELC A;  4DAV A;  1EY7 A;  3TSS A;  1TWC B;  3TZD A;  1K8O A;  3I8Z A;  1CM9 A;  1PFB A;  4PMC A;  3GTM B;  3PMF A;  3P7J A;  3A55 A;  5CR3 A;  4X3S A;  3HRZ C;  4K8I A;  2E2H B;  4CKC A;  5KND A;  4CKE A;  5K5P A;  1LTA D;  2ID0 A;  2EE1 A;  1GXD C;  4IUV A;  3TP5 A;  5IT9 E;  3JAM E;  2LS0 1;  3LX0 A;  5NUC A;  5I6W A;  1TKW B;  1JWU D;  1KLG D;  3SVM A;  1VF7 A;  1M8A A;  1T5X D;  3FPU B;  1PXU A;  2B2T C;  4RKB A;  4KY5 A;  2TSS A;  3S14 B;  2E76 C;  2K5W A;  1SNC A;  3V05 A;  1RD9 D;  3IL8 A;  3GTL B;  1PFN A;  2KA7 A;  3OWE B;  1D1K A;  2JE6 I;  4MIU A;  4A3E B;  1WTW A;  1HUN A;  1BCP D;  2MUY A;  4G7O C;  1FR3 A;  4KN4 C;  4RHR A;  4A3D B;  2Z1C A;  1TWF B;  3K5N A;  3HOV B;  2E2I B;  1SEB D;  3TBI B;  2NTS A;  1TII D;  2O4X A;  3G6J B;  1CHP D;  3VR5 A;  5C4J B;  1ET9 A;  1EY5 A;  1SJE D;  1LTG D;  3LNN A;  2A5H A;  2F0P A;  1G2S A;  3PUY A;  3U9S A;  1RCV D;  2A69 C;  5C3X A;  2WB1 B;  3T4A C;  1MD2 D;  3C1F A;  5IGG A;  4ZKC B;  5IGC A;  4OO1 H;  1ZYR D;  4L63 B;  4MN3 A;  3TZU A;  1QOH A;  4EVO A;  4BBR B;  1Z47 A;  2QDB A;  4ABN A;  4EGV A;  2RVL A;  5EKI A;  5C3W A;  3NBI A;  1SE3 A;  2EDG A;  4DNT B;  1S5F D;  4XIG S;  1D6E C;  5IGF A;  2QKI C;  4C3I G;  4RH6 A;  3ITP A;  4DN4 M;  4ZLT F;  1D5X C;  3Q6S A;  1LV9 A;  4X3K A;  3IFT A;  4DA2 A;  2M9V A;  3R3O A;  4UDU C;  3OPO A;  2NN6 I;  1O7Y A;  3CRL C;  1K83 B;  4PNY A;  4K5V A;  1BDO A;  1DZ1 A;  5LL6 X;  1G6Z A;  2ZT9 C;  1F9R A;  1V1O A;  5DEH A;  1Y8O B;  4OIK A;  3I91 A;  5A2Q L;  2XVS A;  1IL8 A;  2K5D A;  3A7A B;  5CMD A;  1HFG A;  4U67 3;  2Q8T A;  1JWM D;  3GV6 A;  4IUN A;  4C3J G;  1QNU A;  4DXG A;  1PZK D;  4HN7 A;  5COR A;  2GA4 B;  2K7V A;  1F2Z A;  2Z4H A;  1AEX A;  4A3K B;  4FXK C;  1SE4 A;  2K28 A;  1I4P A;  2F0H A;  2EXZ A;  1II3 A;  3DMU A;  1S5D D;  4CJ0 B;  5C4Z A;  4RCO A;  4ULL A;  1EY0 A;  5CC4 A;  4CHT B;  4K5W A;  1TWH B;  5M3F B;  1S5E D;  3WDN A;  2H1E A;  1Q3L A;  3DWA A;  1TS2 A;  4DF7 A;  4QB4 A;  5C0X G;  2PMZ B;  1VF5 C;  1IKL A;  2AUK A;  4UAI A;  2F0S A;  2EOT A;  3SDZ A;  3S15 B;  1KLU D;  2JP1 A;  2SDF A;  3WOE A;  5EBC A;  2K05 A;  1TQO A;  2KHS A;  5C5L A;  3NQI A;  4NKL A;  3HP3 A;  3E0J A;  1O7L A;  3PIO 3;  4C1N I;  5BN5 A;  1T5E A;  3SE0 A;  3LWU A;  5JVH 3;  3FVQ A;  4H44 C;  1XTC D;  1A2T A;  3D3R A;  4QUC A;  2H4O A;  1TWA B;  2RDG A;  3M7G A;  1LTI D;  3I4N B;  2QIL A;  1U4L A;  3I3C A;  5D65 A;  4KD4 A;  1BXT A;  4C1N K;  2K33 A;  4DAY A;  3HOZ B;  1Z6H A;  2K32 A;  1HA5 A;  5BN3 A;  2PPB C;  3G7L A;  1SFO B;  4G7H C;  4FYD A;  2V4D A;  5M5Y B;  1LT3 D;  1SYF A;  2FIN B;  1Q90 A;  1TT2 A;  3I73 A;  2MGS A;  1SND A;  1B9N A;  3H6M A;  2RDH A;  4QCL A;  3P75 A;  1EU3 A;  1JR0 D;  3SR1 A;  3QG1 A;  2F0V A;  1U9R A;  2K6A A;  2HQE A;  5G3L D;  4DU9 A;  1MGS A;  2PZU A;  4QMG A;  2FFK B;  2K5Q A;  2X6L A;  3NBH A;  3GTP B;  1B53 A;  1ESF A;  3GTQ B;  1F9Q A;  3TP6 A;  1V43 A;  4HTH A;  1CQV A;  4B08 A;  3M85 A;  5IGD A;  3CRK C;  3GD7 A;  4Y7N B;  3NE5 B;  2K1B A;  1HFN A;  1CT1 D;  2AQ3 B;  2PQE A;  2QEJ C;  3ERO A;  2F0J A;  2KCN A;  3Q23 A;  3WOF A;  2M00 A;  3KF8 A;  2L1B A;  1ZEQ X;  1AW7 A;  5EKL A;  3FPP A;  1A3T A;  4OO1 I;  3DWP A;  1TS4 A;  4ZUI A;  1R4Q B;  4IQZ A;  2NUC A;  4HAE A;  4ME5 A;  5FLX L;  1EQT A;  1ZKO A;  5F2D A;  3QOJ A;  2A6H D;  1JOQ A;  2OXP A;  1D5Z C;  1LAC A;  2F0I A;  5EJW A;  4IN3 A;  4E6I A;  4Q0F A;  4OL7 A;  4EQO A;  3C2P A;  1PDQ A;  2IX0 A;  5DM7 3;  4DFA A;  2AQ2 B;  2A6E C;  4M8A A;  1SXT A;  5E4X A;  1ESR A;  3BDO A;  1JOR A;  1LTT D;  1PTO B;  4K2L A;  1AZQ A;  2B2W A;  3L7Z C;  3MAQ A;  4A93 B;  2EYF A;  3V96 A;  1TS3 A;  3VYS A;  3KBX A;  1STN A;  2OF1 A;  1HTL D;  1PRT D;  2VB2 X;  1FGB D;  1S5B D;  4FF3 A;  2AQ1 B;  2XSC A;  5M9O A;  2J4X A;  2EVB A;  3GTJ B;  3OIP A;  3OIQ A;  4C3I B;  4HSP A;  5JAV A;  1LAB A;  3H94 A;  4JBW A;  1E2Z A;  5E1F A;  2PW7 A;  4DK0 A;  2NYZ D;  2PCF B;  3D4W A;  3C3L A;  1PTO H;  1XWE A;  4IFD H;  1YNJ C;  3GTO B;  1HPC A;  2BE5 C;  5KRU A;  2NBF A;  1A3U A;  3W3A A;  2JSO A;  2KUM A;  4QUF A;  2MJ8 A;  1I3Q B;  2BOS A;  2IT1 A;  2B2W C;  4S3S A;  3HGB A;  5CV4 A;  4ZQ3 A;  1O7Z A;  4IFD J;  3QB3 A;  1IHZ A;  3SK5 A;  4BS9 A;  2QCP X;  1IW7 C;  2B2T A;  4C3J B;  4BY7 B;  2IW3 A;  1ET6 A;  3X3M A;  1NSN S;  2F0Q A;  1QJO A;  5DAU A;  1PZJ D;  2DNE A;  1S5C D;  3NSW A;  2F03 A;  5EGT A;  4DK1 A;  1KAB A;  2CW0 C;  1E2V A;  4X3U A;  4IUT A;  2E74 C;  1ENC A;  3GTK B;  5JEA H;  1STH A;  3VR4 A;  1SJH D;  1TU2 B;  2XRQ D;  4AYB B;  4I65 A;  3VYT A;  1HTP A;  2XN9 C;  1EYA A;  1SYB A;  2N88 A;  5I9O A;  1F2M A;  3X3N A;  1PRT B;  4FF2 A;  4V19 0;  2R93 B;  4XDX A;  5K36 G;  5JEA J;  1JCK B;  1PZI D;  1ONL A;  3I70 A;  1OXT A;  4A3I B;  4CJ2 C;  3GQB A;  1WTP A;  1HCZ A;  3HOX B;  2PZW A;  2RBM A;  2SNS A;  1EZ8 A;  4F87 A;  1QIL A;  5M5W B;  2A69 D;  3SK8 A;  5T1I A;  3PV0 A;  3J80 L;  1DCZ A;  2XWJ B;  5KGU A;  3BS1 A;  4FF1 A;  1JOO A;  2NN6 G;  2A68 C;  1EU4 A;  2F0T A;  1FYC A;  3C1E A;  3K7A B;  2JXM B;  3KK7 A;  3OHX C;  4PV1 C;  2ENB A;  3D6C A;  4JK1 C;  1KNA A;  3L3O C;  1HA6 A;  2ZXO A;  3QOL A;  2JYO A;  2FMM A;  4DNR B;  4I7Z C;  1R9T B;  2R7Z B;  1KNE A;  2CQA A;  2WKC A;  2XRS D;  3BVG A;  1SMY C;  5CV7 A;  1PYW D;  1Q1B A;  2CHB D;  5IT9 L;  2L55 A;  2F0O A;  3JAM L;  2IJ0 A;  1JB3 A;  1GUG A;  2QF7 A;  1ROD A;  1SE2 A;  4CBV A;  4BBS B;  3S17 B;  2LY7 A;  4M1U B;  5I9P A;  2R3Z A;  1U4R A;  4HMJ A;  5EBD A;  3BDC A;  3BVZ A;  3PUZ A;  4BA2 I;  4IUR A;  2F0N A;  3MHB A;  1CA5 A;  1SNM A;  1RF2 D;  4J1M A;  3S1M B;  2EYH A;  1VDZ A;  4NP5 A;  2WIN B;  1R4P B;  5BN4 A;  5FK9 C;  2F3W A;  1EL0 A;  1WTX A;  2DY7 A;  1VMP A;  1EY9 A;  5EPL A;  1H9J A;  5LL6 S;  2JA7 B;  4N9T A;  1B44 D;  5KNB A;  1O80 A;  4RAU C;  4ODG A;  2J0T D;  1UUP A;  2Q8I B;  2K03 A;  1Q1E A;  2ZXP A;  3CKI B;  3T16 A;  1BOS A;  3C46 A;  4XYO A;  3K58 A;  5JPN C;  4C3H B;  3MA2 B;  3S2D B;  1B9M A;  4N9P A;  1BCP B;  1YNN C;  3SEB A;  2L11 A;  2EZV A;  1LTS D;  4V0B A;  3MXG A;  4G57 A;  3NQT A;  5EPK A;  4KI0 A;  4A3F B;  4L8J A;  4IFD I;  3J7A F;  3Q0A A;  4RGN A;  2KQ3 A;  2IWH A;  3DEP A;  2K04 A;  3P1H A;  3K5M A;  3K6O A;  4R8N A;  5EQ0 A;  2EY5 A;  1EY8 A;  1STA A;  1EY4 A;  1LT5 D;  5C3E B;  2L0C A;  1G8Z D;  1LT6 D;  3J7Y W;  3GO5 A;  3VYU A;  3W2D A;  1GJX A;  2I07 B;  4XQJ A;  1Y69 U;  2MPM A;  3NTI A;  5KYL A;  4X3T A;  4KKU A;  4IUQ A;  5M3M B;  4R9W A;  1DXM A;  2EYM A;  1WTV A;  1L0X B;  1HHV A;  3QIA A;  3TP8 A;  3MXP A;  1TWG B;  4KMU C;  5CV8 A;  5FO9 B;  4TRD A;  1D5M C;  1CZG A;  5I4D A;  1TS5 A;  1TY0 A;  2TMP A;  2F0E A;  3F2U A;  3QWN A;  4ZAI A;  4ZK9 B;  4BA1 I;  2PO4 A;  4OO1 G;  2B39 A;  3D4D A;  3SK4 A;  1GUN A;  1B1Z A;  2AUJ D;  1CI3 M;  1EWH A;  2D5D A;  1A15 A;  5JJZ A;  3EA6 A;  1V8Q A;  3IKJ A;  2EPB A;  2NB0 A;  1U4P A;  2PZT A;  1CTM A;  2B8F A;  1HXY D;  2RQX A;  3VR3 A;  1C4Q A;  2DY8 A;  2L5T A;  2WAQ B;  1MSG A;  5I2X A;  1A3V A;  3NUC A;  1AZP A;  2MHV A;  2Z4I A;  2IL8 A;  3BG3 A;  3PIP 3;  3S16 B;  4XT3 B;  3ZYY X;  4XTC S;  4ILW A;  1RHP A;  3N6R A;  1XYI A;  2KJX A;  1EFI D;  5CBA E;  2PW5 A;  1IKM A;  1GHJ A;  2KVM A;  1QWY A;  1CK1 A;  3BVM A;  4IUU A;  1GOZ A;  3EFX D;  1ZXT A;  1OXV A;  3H0G B;  1QE6 A;  1BR9 A;  4ZUJ A;  2VNU D;  2B2V C;  1UNS A;  2A6E D;  3MZ5 A;  3J81 E;  1ENF A;  1A2U A;  4CJ1 B;  1CFM A;  1PTO C;  1STE A;  2WAC A;  3V2T A;  4RGO S;  1EOT A;  3A8K E;  2BDN A;  2XNA C;  4LMQ D;  3H09 A;  1BQQ T;  4CKB A;  1C48 A;  1Y1V B;  4WJW A;  1DOL A;  5CYU A;  3T51 B;  3I4L A;  1J9O A;  3I90 A;  1TR5 A;  3PUV A;  1OXS C;  4HCE A;  3T53 B;  1JWS D;  4PMB A;  1EWC A;  3A8J E;  3IFD A;  1BUV T;  1LTB D;  1QNK A;  3O13 A;  2F0M A;  1U4M A;  1STG A;  5K36 H;  2EJM A;  3H3V C;  2KCC A;  2F0K A;  1RTN A;  2C5C A;  1NR4 A;  3R2I A;  1JE4 A;  4LAA A;  4G4K A;  1HRJ A;  1DOM A;  1F2L A;  4QIW B;  2KEC A;  1RKN A;  1GUS A;  1SNO A;  1I4X A;  1YNJ D;  2BE5 D;  1C8C A;  4GZY C;  5IOD A;  1EQV A;  4CGY B;  4O1N A;  4XQQ A;  1CA6 A;  3FDT A;  2XWB B;  1SAP A;  1OXU A;  5IIF A;  3EJI A;  1PLF A;  3RLF A;  1FNV A;  4TQU S;  1JIC A;  1Y8N B;  5J39 A;  4K8J A;  5KIX A;  4A3B B;  3K5O A;  2M2L A;  4KKT A;  5J22 A;  1IW7 D;  1I4G A;  5J1Z A;  5T1G A;  4LJZ C;  4KN7 C;  1L0Y B;  2G9H D;  4FNF A;  3I4M B;  2G9D A;  1DM0 B;  2OT2 A;  4WRD A;  1G91 A;  4A3J B;  4KK7 A;  5EKK A;  3D31 A;  3NHH A;  5FOB B;  2HUG A;  2XIW A;  4PMW A;  3VA5 A;  3J7A V;  2E2J B;  3M7N A;  2CW0 D;  5CBE E;  4KJO A;  3KUP A;  2WV6 D;  3SXH A;  2F0W A;  2L9H A;  2F4I A;  3UI2 A;  2HCI A;  1V1P B;  1PTO F;  3R8B A;  1GUO A;  2FMC A;  1PRT C;  1ILQ A;  4RGT A;  5FKA C;  1IYV A;  2R61 A;  2N55 A;  3ERQ A;  4KY7 A;  3MXU A;  3TDQ A;  2F0D A;  2R6G A;  1H9S B;  2B2Y C;  3N52 A;  2SNM A;  3QO2 A;  4IUP A;  2Z8L A;  1F9S A;  3CU7 A;  1SYD A;  3NPP A;  4H0L C;  5EPJ A;  1WTO A;  1KDA A;  2A73 B;  1BBX C;  1PMR A;  2I46 A;  1CQF A;  4K6L A;  4KY6 A;  2LFN A;  1WD0 A;  1HQR D;  4RHS A;  5C4H A;  4K5X A;  5COY A;  2F1M A;  3D4R A;  4IZ8 A;  1KAA A;  1I4Q A;  3HS0 C;  3DWQ A;  3HEJ A;  5ELB A;  3M4O B;  5E3F A;  2PNR C;  4O42 A;  2ICE C;  2F3V A;  3NP8 A;  4FXG C;  3VA7 A;  1J8I A;  3U9O A;  2AWN A;  3KLR A;  5CGK A;  3BYY B;  3S1Q B;  3NWT A;  3NWS A;  4KV6 A;  1BF4 A;  5KYI A;  3T56 B;  4F88 A;  4NDX A;  5DNF A;  4Z9C B;  2WP8 J;  1SMY D;  1DD2 A;  3K59 A;  3K5L A;  3OSO A;  1QB5 D;  3OWF A;  5DM6 3;  5KEE A;  2VUM B;  4IAL A;  1EEI D;  2HDL A;  4FP5 D;  2RA4 A;  3RZD B;  1H9K A;  2HDM A;  5C0X H;  3BZD B;  4NW2 A;  2EY1 A;  5D14 A;  3LWE A;  4R8I A;  4G7Z C;  2DNC A;  4QF4 A;  1DON A;  5C4X B;  2WII B;  3ND8 A;  4ZRZ A;  4L6T B;  5IOC A;  1FD7 D;  5ELD A;  1LLR D;  5C0X J;  3BYT B;  3EQL C;  2BDO A;  4HED A;  1PRT F;  3MXN A;  2LMC B;  3EVQ A;  4RFB A;  3OMC A;  5CV6 A;  1WVL A;  2F0F A;  1QG7 A;  3QJY A;  3OMG A;  1B50 A;  5A2Q E;  2JEB I;  2NZ1 D;  4IFD G;  2NVY B;  5CV5 A;  2JEA I;  1PFM A;  2B2U A;  1EYC A;  3MC0 B;  2OEO A;  4K6D A;  2RDF A;  1BCP C;  3MFY A;  1EIH A;  1KDC A;  2MP1 A;  3MVV A;  1YNN D;  5C5M A;  3SHL A;  3FMC A;  4KKS A;  1X32 A;  5C44 B;  4RGM A;  4ZYS A;  4EQN A;  3M3Y B;  2NTT A;  2L4N A;  4K14 A;  3DEO A;  3OOC A;  2F0G A;  1JQY D;  1LT4 D;  4C2M B;  4XT1 B;  4XXE A;  3DUZ A;  1K8M A;  3VR6 A;  1KTK A;  1VCI A;  2BCO A;  5JPM C;  1WD1 A;  3HOW B;  1WCM B;  4OHJ A;  3IAY A;  3TN2 A;  1ZYR C;  4J8Q A;  4WFN 3;  2EYL A;  2EYJ A;  2O5J C;  4HSV A;  2L12 A;  4TKO B;  3K57 A;  1BNZ A;  2B2U C;  5JEA G;  1ILP A;  3RD4 A;  2R92 B;  3E5S A;  1NCV A;  2IX3 A;  4XQN A;  2YU9 B;  5AFW A;  1NAP A;  1Y1W B;  3OW7 A;  1XXG A;  5D3I B;  1FNW A;  3RZO B;  4HMI A;  3S9W A;  3BDL A;  2F0L A;  1EZ6 A;  1H9R A;  3S1N B;  5C6A A;  3KBG A;  1G2T A;  5LHY 1;  1FNU A;  5IGE A;  1I4R A;  5D3D A;  1DOK A;  1DJR D;  1F9P A;  2KED A;  1SYE A;  1IYU A;  2RSO A;  2J7Z A;  1JC7 A;  2EY2 A;  1MI2 A;  4F7X A;  1E0B A;  1RDP D;  2KEE A;  1GUW A;  1I4H A;  3VYR A;  4KHZ A;  2Y0S B;  1CHQ D;  3HZX A;  1H9M A;  4KJN A;  1ICW A;  1Z7T A;  4OIJ A;  4WOR A;  1BCP F;  1B3A A;  5I2Y A;  5JOB A;  5ELF A;  5FO8 B;  4RWS C;  3HG9 A;  4FO2 A;  2FHT A;  1LTR D;  1LO5 D;  4BWG B;  4FVM A;  1M4V A;  2IX1 A;  3ND9 A;  3T13 A;  5KNC A;  1W6K A;  3A7L A;  3GP7 A;  1RTO A;  2VB3 X;  2D2C C;  3A8I E;  1NUC A;  2NVX B;  2B2V A;  1JOK A;  4DGZ A;  2WKD A;  2ICI A;  2X6G A;  5ELE A;  4K2K A;  1ENA A;  4J6H A;  3L9A X;  4DXF A;  1Y8P B;  3D8G A;  2B8G A;  1PTO D;  3GTG B;  3HOU B;  1EYD A;  4B9W A;  5A35 A;  1NR2 A;  3H91 A;  5FLX E;  2E75 C;  3MTS A;  1X3P A;  1OO9 B;  3PO2 B;  3CHB D;  1DYQ A;  4KHV A;  3RUZ A;  2AWO A;  3AU7 A;  4KD3 A;  5C0X I;  3VR2 A;  1HQM C;  2SEB D;  4OGQ C;  2K01 A;  3R93 A;  4B9X A;  4ID6 A;  3FKI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...