1IHZA

Structure of s. nuclease mutant quintuple mutant v23l/v66l/i72l/i92l/v99l
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYLYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Proteins with simplified hydrophobic cores compared to other packing mutants.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ihzA00
4QMGA 1JOQA 5IGBA 1SNMA 1TR5A 1KAAA 2F0SA 1A2TA 3D8GA 1F2ZA 3ITPA 3TP7A 2F0JA 5K5PA 4B9WA 3E5SA 5I6WA 4KY5A 2QDBA 3DHQA 4EQPA 1F2YA 2LKVA 2PQEA 3H6MA 1EZ6A 3U9OA 2EXZA 4ZUIA 4ME5A 3BDLA 4E6IA 2EY5A 5DEHA 4KD4A 1KDBA 3QOJA 3OMGA 3D4DA 5E1FA 1SYGA 2F0VA 2PW7A 4K8IA 2ENBA 2F0IA 2F0OA 4HMIA 5CV8A 2NUCA 2KQ3A 4PNYA 2F0EA 5I9OA 3EROA 4DFAA 1AEXA 1EY5A 3RUZA 3OSOA 1A3UA 1EY4A 1JOKA 1KABA 2EYLA 2SOBA 2SNSA 4N9PA 5IIFA 2F3WA 2F0MA 2F0HA 4F7XA 1EY8A 3C1EA 3MVVA 5J1ZA 1SNDA 5C3WA 1EY6A 4ODGA 3NXWA 1F2MA 1A3VA 1A2UA 4QF4A 5JOBA 4DGZA 1SYEA 3EVQA 4R8NA 4YIJA 3T16A 3MXPA 1EYCA 5IGFA 2EY6A 4G57A 3DMUA 5CV9A 4NP5A 3D6CA 5EKLA 1EY7A 4K2LA 1U9RA 4DU9A 5CGKA 3ERQA 4ZQ3A 4KD3A 5I6YA 5J22A 5CC4A 2F0FA 4KTAA 2F0UA 5IGDA 1STAA 3NK9A 1NUCA 4KJOA 3QOLA 2RBMA 3MHBA 4J1MA 5KEEA 5KYLA 4ZUJA 3NHHA 4I65A 5CV4A 4K8JA 5M9OA 1STHA 3NP8A 3TMEA 5JAVA 1JOOA 5EGTA 4PMBA 4WRDA 2EYMA 2OF1A 1EY9A 5DAUA 5E3FA 5C4HA 3SK5A 1TQOA 4MIUA 3SR1A 1KDCA 5I9PA 4RKBA 2RKSA 3MEHA 3OMCA 4J6HA 4KY6A 5NUCA 5J39A 4K5WA 4K5XA 3P75A 4ID6A 4NMZA 2OXPA 3SXHA 4DF7A 5ISRA 3SK4A 4HMJA 5IOCA 4S3SA 2EY2A 3NUCA 4RKLA 5EKKA 3SK6A 4EVOA 4KJNA 2PZWA 4PMCA 2F0LA 2PZUA 3C1FA 3EJIA 1SNQA 2F0WA 4K14A 5F2DA 1SYDA 5C6AA 1STGA 3BDCA 5CR3A 5HURA 2F3VA 1STNA 1JORA 1ENCA 3OWFA 2F0PA 1EQVA 1EYDA 4NDXA 5IGEA 1RKNA 5HGTA 5CV6A 3V2TA 1II3A 1A3TA 2F0KA 2HQEA 2F0GA 4K5VA 2EYFA 3HZXA 3P1HA 4HTHA 2F0QA 4IUNA 4LAAA 4EQNA 2EYHA 4EQOA 5IODA 1STBA 3R3OA 4OL7A 1SYBA 2WACA 4H7BA 4IZ8A 3SHLA 4KV6A 5KGUA 5C4ZA 1KDAA 5C5MA 1STYA 4WORA 3LX0A 1NSNS 5KRUA 3T13A 3HEJA 5CV5A 5KYIA 4KHVA 3NQTA 3TP5A 1SYFA 1SNCA 2KHSA 2PZTA 4TRDA 3QB3A 5C3XA 1TT2A 2PW5A 2EYPA 5CV7A 2F0DA 1EYAA 1EY0A 5C5LA 4K2KA 1IHZA 2OEOA 4KY7A 2O4XA 5IGCA 2F0TA 3S9WA 2PYKA 1ENAA 1SNPA 3MZ5A 4K6DA 3PMFA 2EYJA 2EY1A 2F0NA 4N9TA 3D4WA 1SNOA 4QB4A 3TP8A 2EYOA 2RDFA 4F8MA 5KIXA 1SYCA 3SK8A 5IGGA 1EZ8A 3VA5A 3TP6A 4B9XA 4NKLA 4IALA 2SNMA 2M00A
chains in the Genus database with same CATH superfamily
2WAQB 3CCQA 4A3EB 1F2ZA 3S16H 2K5DA 1DD2A 3RMHA 3IRBA 1F2YA 1EFID 1PZKD 1O7LA 2D0PA 1WTOA 1E1TA 1CTMA 1I4RA 5T1GA 2A6HC 3WWVA 2R7ZH 4MTKA 1QE6A 1R4QB 5IYBH 4JW0A 2A69D 2Q8IB 1SN8A 4A3GH 4AIMA 4DKAC 2MP1A 4UHVA 4U68A 4BBRG 3HOUH 1EIHA 1VQEA 1S5ED 4DFAA 1YNJD 2IT1A 5HY6A 4DV0L 2VNUD 1Q46A 3Q23A 2R93B 2NVQB 3H91A 1KLUD 2WB1E 3K0YA 3PO2H 4A3MG 2NTSA 5AJ3Q 1PRTD 3KLSX 3AYHB 2MQHA 4TQUS 1DZ1A 1N36Q 2NN6H 4KTAA 2G9DA 5M5YH 2KCTA 1G2TA 2XTIA 4RA8A 1VQ7A 1IYJB 4K8JA 1K8GA 2PNHA 1JOOA 4DXFA 2EYMA 1HQMC 1K3RA 3A56A 4RKBA 5C0XJ 4JYAQ 5EKKA 2D9UA 3I56A 2OWOA 1J9OA 4LF8Q 3KUPA 2A19A 1N33L 2EJGC 1PRTB 3ND9A 2Z8LA 1DYQA 2LY7A 5A2QE 1JJ2A 1EWCA 4IJHA 1VMCA 3H3VI 1QOHA 4FP5D 4DAYB 1SR3A 4O1NA 2WB1B 4IZ8A 2FMCA 4OXPA 4X62L 4IFDH 2E8GA 3PCOB 4JI4Q 3RD4A 4R8IA 4DV3L 3J81j 2E74C 4X64L 1MI2A 3VYRA 3T1HQ 3S16B 4DAYA 1TWFH 1EQTA 4HJAA 1HNZQ 4LF4L 3J7YW 3MXNB 1UE7A 4Y52H 2R7ZB 1SNPA 2K75A 1JJGA 2EYJA 4N9TA 2EPBA 2ZT9C 4A3GB 1X32A 1DCZA 4IN3A 4RGNA 1W2BA 4CBVA 3HOUB 2Z6KC 4GS3A 2QGQA 3TDQA 1T5EA 3PO3H 1C8CA 4XQQA 5K5PA 5BR8L 2KCNA 1CKNB 1VQPA 1C9OA 4DR6Q 4NB3A 1PH6A 2Z6KA 3CRKC 2VS1A 2KBNA 1EOTA 4C3JH 1S72A 1VQCA 3PO2B 1KDBA 3CCSA 3QOJA 1MKHA 2UUBQ 1VQJA 3D4DA 1MBYA 3S14H 1CQFA 4DK6C 4QL5A 2JEAI 4DR4L 3U4VA 2BDNA 1WVLA 1PFNA 2K5QA 1I4HA 4PNYA 4JI0L 2FJ2A 2VW9A 5M5YB 1CKNA 4N9PA 5C0XG 2EYLA 3PIP3 3MXUA 1EY8A 3MVVA 3ONAB 5ELEA 3IAYA 3ULLA 2LSSA 1A2UA 4BBRH 1CFMA 2EY6A 3OPOA 3D6CA 1V1QA 2E5LL 4QGUA 1JMCA 1WI5A 2O5IC 1DOMA 3L3OC 3I4LA 3MWYW 4R4CA 4UDUC 5IGDA 1KD1C 1NUCA 1YIJA 3RLOA 1D5XC 3CCVA 3HOVH 2WV6D 1P16A 2UXCQ 4MIUA 4KHPL 1E2VA 4YWLA 3BJUA 3I3CA 5FLXc 4DR3L 1VQ4A 2LXJA 2EQSA 5F2DA 3NBHA 1PVOA 3GD7A 2MO0A 3S2DH 4JI7Q 4B3SQ 5IGEA 3H94A 4B3RQ 1TWFB 1II3A 4FF3A 3P1HA 1UWVA 5C0XI 3CQZH 2VQEL 3TS0A 4KV6A 5KGUA 1CSQA 5CORA 4JBMA 1PMRA 3BU2A 4NXNL 3PO3B 3NENA 5T1IA 1G2SA 4IPGA 3VA7A 5LL6X 2F0DA 3KDFB 4JI6L 4YHHL 4C3JB 4K0KQ 2ZTEA 1G91A 2CKZB 2F0NA 3D4WA 1EWIA 4QB4A 3S14B 4HIDA 4OWTB 5CYUA 1UUPA 5I2XA 3VA5A 4NKLA 3K5LA 3R2TA 1KC8C 1EU3A 3ICEA 3KDFA 4B9WA 1QJOA 3NPPA 1HNXL 2Y0SG 3AFPA 3FMCA 1B9NA 4L5SA 1L1OB 4A3JG 4BBRB 1DOKA 3BDLA 4HJ7A 2AWNA 1Q90A 1AFPA 1XPRA 3W1BA 2B8FA 3I91A 1L1OC 2WIIB 5IP7H 4YY3L 4AYBG 5E1FA 4CJ0B 2ENBA 5CV8A 3T1YQ 4A3KH 1J6QA 2KVMA 4GN3B 4L6TB 1TU2B 1PZID 1TS5A 2JA5H 1L1OA 1X3GA 2F0HA 4L63B 3HOVB 1FGUA 4A3BH 1EY6A 4G7ZC 2VXWA 3MAQA 1VQMA 1I3QH 1YI2A 1B1ZA 2VQFQ 1S5CD 2MNAA 1J5EQ 2E76C 2CFMA 4TVAB 1X3EA 1E2ZA 5CC4A 2F0FA 1HR0Q 3CPWA 3LGJA 3S2DB 2B2VC 2DJGC 4BS9A 4L5RC 1D5MC 4MHEA 1S40A 2P5ZX 1VQFA 3E6ZX 2E2DC 5C4HA 2ZTDA 3PIPA 4A3FH 4EQ5A 3CD6A 1SMXA 3CQZB 4V0BA 2UU9L 4ID6A 2KCCA 1Z7TA 4HMJA 5IT9L 2OTLA 2F0LA 1K73C 5CR3A 1TWCH 3TSSA 1LTTD 3DEOA 5C44G 3DUZA 3J81i 1Q1EA 1ESFA 3Q8DA 1NAPA 2F1MA 1N8RC 2JA8G 4H02A 1KDAA 3QJYA 4DUZQ 1LYLA 1V1OA 3LX0A 2K1BA 1ZKOA 4PQXA 3T13A 2NVTH 2CVRA 3K5NA 1LTGD 4M8AA 2E2IH 3HKSA 1U0LA 5JJLA 1QUQB 2I5LX 4DR5L 1ASZA 1YNXA 2KUMA 3CCJA 1I94L 4JI3Q 3FEWX 1EYAA 2L12A 3OWEB 3GO5A 2L11A 5IP9G 1FD7D 2YTVA 4C3HG 1F9QA 2YTYA 3DM1A 4FVMA 4A3KB 4UY8C 4KJNA 1SNMA 4C56C 3CCLA 3J7AF 2JA5B 3ITPA 5LMUQ 4A3BB 1XJVA 3KBXA 2HIXA 1E7ZA 3A54A 2JA6G 1I3QB 1Q3LA 1RDPD 3URYA 1B3QA 1PYBA 1ILPA 2H1EA 2WFWA 2F0IA 3CC2A 4LJZC 3T56B 2L9HA 4PV1C 3I4NH 4JPBW 3NWSA 5I2YA 2SNSA 3DLLA 4F7XA 2MJ8A 1Q81C 2L5TA 4LUVA 4HCEA 4QF4A 1BCPF 4A3FB 3T16A 5IGFA 1SROA 3B6YA 4DU9A 4ZK9B 3U4ZA 1VQNA 3M7NA 1G6ZA 2I46A 1B44D 3F8TA 3L2PA 1H95A 4X3TA 1B3AA 3QG1A 2O2LD 4KJOA 1WTWA 5M5XB 1X9NA 1TWCB 5C3EH 3A0JA 4DV5L 3J80L 4DR1L 1PTOD 1RCVD 4ZYSA 5AFWA 1UNSA 4LW1A 3H09A 2V4DA 3L7ZC 4KY6A 3RLNA 2J4XA 5ISRA 3HG9A 1D7QA 2Q8TA 3KF8B 5EPJA 3CCEA 1HZAA 1IBMQ 3GTLH 5CBEE 1EYGA 4APVA 2CQAA 3NWTA 1VQKA 1STGA 4A3CH 2E2IB 1JC7A 3AU7A 4KKUA 1Z47A 1A63A 4EQNA 1L0WA 3KF8A 3KJPA 4OL7A 4NPSA 1VQOA 1PH9A 1G6PA 2ES2A 1K0RA 2JA9A 1F9SA 3TP5A 1SYFA 2JA8H 3NQIA 2OT2A 1LO5D 3I90A 5KNDA 4YWMA 4V190 2UUAL 1A8VA 3DWQA 2ATWA 1K8OA 5D3DA 3M4PA 2ICEC 5GADC 1D1KA 2L0CA 3I4NB 1O78A 4JYAL 1D2BA 4Z9CB 1H9RA 5EPKA 3TP7A 3O13A 5IP9H 1GHJA 3HOWG 5ELCA 3OYYA 3PV0A 3QIAA 5FO7B 1BBWA 2B63G 2EIFA 1SJED 2QEJC 4C3IH 1NMGA 3E3XA 3HOZG 2JJQA 4EGVA 2BE5D 1XWEA 3GV6A 4JBJA 1XPOA 1G291 5C3EB 2F3WA 1PDQA 4G7HC 2WKCA 4JI4L 1L0YB 3EVQA 4BXXH 2EZVA 1BCPB 3T1HL 4R4OA 1Y69U 4OIJA 1HNZL 1BCPC 3GTLB 5JPNC 4YCWA 2D0OA 2A1AA 2RBMA 1JB7A 1LTAD 5C4XG 1VQ5A 2IPKD 3NP8A 1K83H 5BN4A 2XIWA 4DUYQ 2UXDQ 1I5FA 1HH2P 3A8IE 3SGIA 5D14A 3NTHA 3FVQA 3TN2A 1I6VC 2AQ1B 2VUMG 1KL9A 4EVOA 5IY0A 2ID0A 1SYDA 2BH8A 4N8X1 2X6LA 1LM0A 4HIKA 4OO1H 1L2FA 5ELFA 3S1NH 3K59A 5GAGC 2OQ0A 3HOYG 2BCOA 1OXTA 3STBC 1PXUA 2VZAA 4JV5Q 4CGYB 1C0AA 4H7BA 2MUYA 2JP1A 1YHQA 5J3BA 2K05A 2EOTA 1FNVA 3S1RH 5FLXE 4XT1B 4FO2A 2E75C 2PNRC 4HCSA 1GUTA 1UAPA 2MO1A 1LTID 5IT9c 2CH4W 1VQBA 2JA7H 2Q8RE 1PH8A 3KOJA 1VQLA 1G51A 1V8QA 2PW5A 1SFOH 3MC0B 5C5LA 1J8IA 2OEOA 1Y1WH 4HIOA 3D31A 2BA1A 4A3DG 4C3IB 1SNOA 4KN4C 4F8MA 2EYOA 3EQLC 1IBKQ 2HIVA 1HNWQ 1AP0A 2NTTA 1SEBD 4BBSH 4IALA 4WJ3M 4GNXB 2RQXA 4MNOA 2PMZE 3GTPH 5K36H 4GNXC 3BZKA 2EE1A 1N34Q 1SDFA 2PO4A 3HFZB 3PIO3 4A3IG 3R2IA 4FF2A 1E1OA 3PSIA 4CDFC 2KOLA 2PW7A 4B3RL 2NUCA 5DLQE 4LF5Q 4BY7H 4XQJA 1IKLA 3M9BA 1JOKA 5IIFA 3C1EA 5FJ8G 4XQNA 5C3WA 2CW0C 4A3LG 1K83B 1LTBD 4DGZA 1WFQA 4G4KA 4FDBA 4IUTA 4CDDC 3FKIG 5CGKA 1HQRD 1IXRA 2ZM6L 3VR6A 2A5HA 5EJWA 3NEMA 3FDTA 3CCRA 2IL8A 2LMCB 3C46A 3G6JB 3S1NB 4JI5Q 1ZEQX 2PMZB 2ZJRA 5C4JH 4R4TA 1TQOA 4JI1Q 1TWAH 1VCIA 2QF7A 3MEHA 4FXGC 5I9PA 1VS0A 1HTPA 1TWGH 3NUCA 4PZ8A 3S1RB 3EA6A 3C1FA 2TSSA 1YHAA 1STNA 3PUVA 3OTOL 3PUZA 2HCCA 3VYTA 4A93G 1S5FD 3L9AX 5CV6A 5JEAJ 2JA7B 3T1YL 3PUXA 4GN5A 4HTHA 4I7AA 1SFOB 2A69C 3R3OA 1Y1WB 2WACA 4QUCA 1VF5C 2UUCQ 1U4MA 1NMFA 1YNJC 3CCMA 5EAYA 4GLVB 4WORA 2MPMA 4BBSB 1QWYA 1EOVA 1R4PB 3W3AA 2VQFL 2JXMB 4LFBQ 3GTJH 1X55A 3F2DA 2PZTA 3GTPB 1LT5D 3UE0A 4PMWA 3TZDA 3GV3A 1PRTC 1Y1VH 1ET9A 2F0TA 4HEDA 2F3IA 3RN2A 3MZ5A 3A8KE 2NWGA 5EKIA 1WCMG 2IW3A 3TP8A 1XTCD 2K32A 4XYQA 4BY7B 1KQSA 2F0SA 2HUGA 2FMMA 4OX9Q 4GKJQ 1V1PB 5M3FG 2DY7A 3IKJA 2K14A 1RHPA 5DEHA 4KD4A 3MFYA 1NR4A 2I0QA 3OMGA 1I50H 5FO8B 1VQIA 5L37A 2KQ3A 3RN5A 2F0EA 4X66Q 4LWCA 2L55A 4ULLA 1MGSA 4QJFA 4A76A 1K8AC 2JN4A 4RMFA 2KEEA 2Z4HA 4CHTB 4DUZL 5C4JB 1RTNA 3MXNA 1ESRA 1TWAB 4IPDA 1TY0A 4QY7A 3TZUA 3PF4A 3PIOA 1F77A 1TWGB 1DXMA 5JEAG 3KBGA 1UE1A 3GTOH 1IW7D 1IKMA 4JI3L 5IYDH 3Q24A 1B2TA 2YYZA 3K58A 1BKBA 1GOZA 1E24A 2BDOA 2K04A 1EIYB 4XYOA 3CRLC 1STHA 4IPCA 1MJEA 2Q2IA 1N32Q 1WTPA 2DN8A 1ENFA 2A6ED 2RF4A 1YITA 1PA6A 2K5WA 2KCMA 1HA5A 3J81c 3QWNA 5LMUL 1S5BD 4RAUC 3H3VH 1GUSA 2AQ3B 2QDLA 5FK9C 1JWSD 3GTJB 4OELB 2F0KA 1IW7C 1SLJA 1CKOA 3HOXG 4A3MH 4OGQC 5FLMG 2DJFC 1Y1VB 2F4VQ 5C5MA 1JQYD 1STYA 1V9PA 1ML0D 2IX3A 1UE6A 5I4DA 3K5OA 4UPAA 4X3SA 5KYIA 3W2DA 4KHVA 4XTCS 2NBFA 3NQTA 3MFGA 3NBIA 3X3MA 1GM5A 5D3IB 4DV1Q 1TT2A 2K52A 4POFA 1C7YA 2E2HH 3PMFA 3F2CA 1WTQA 1HXYD 4HJ8A 4LF7L 2RDFA 3G6EA 1I50B 2B8GA 3FP9A 2OCEA 4CDCC 5ELDA 5KIXA 2R61A 4DA2A 4LNQA 2UXBQ 3E5SA 2GVAA 3JAML 2XGTA 4DNTB 3J80i 1H9KA 4ZUIA 4ME5A 3K80C 2FHTA 4RWSC 1A15A 2RHQB 1IZ6A 1XYIA 3V05A 1XMOQ 1RJTA 3GTOB 5IWAL 4YWKA 1ZXTA 3A55A 2A73B 1Q1BA 2ALYB 2F03A 3I4MG 1VF7A 1M90C 1W3SA 4P73A 3Q22A 3L0OA 1N9WA 2HHHQ 4DR2Q 4JC0A 1BDOA 4K2LA 4DV4L 4ZQ3A 3I70A 5J22A 2RDHA 1GUWA 1DGSA 2LFNA 1XNRQ 1WOCA 1O7ZA 1OXUA 1HZ9A 3RR5A 1E2WA 1MSHA 2HCIA 1CM9A 1Y8PB 4DV0Q 4XXEA 1NY4A 2G5DA 2Q2TA 4LF6Q 1CHQD 3BG3A 2RKSA 3HKZG 4HIMA 1R9TH 4A3MB 2K03A 4K5WA 1LABA 1KRSA 3SK4A 3CCUA 2EY2A 4Q5VA 2CWAA 1YNND 2PZWA 1VQAA 2OQKA 4CDEC 1PH3A 1LTRD 5C0XH 2XSCA 2ICIA 4IUPA 3G4SA 1RKNA 4ZAIA 4IPHA 2VY3A 4DNIA 4K5VA 4IUNA 2O5JC 3TS2A 4AQYQ 1TS3A 1U5KA 2E2HB 3BVZA 3SHLA 4LK1C 5LMNQ 1LV9A 5EBDA 4IUUA 2B2VA 2V1CC 4EX5A 1ZYRD 1N33Q 3LNNA 1CK1A 4BY1G 3KFUA 3VR4A 3D4RA 3UE1A 3CMEA 4IOCA 2BA0A 1IHZA 4RGMA 2O4XA 2PYKA 1FNUA 1PTOF 4BWGB 4RHRA 2IX0A 1QILA 4CKCA 2LS01 2UXDL 4M1UB 4X62Q 3KYHC 4QMGA 2NZOA 4B3ML 1TR5A 2CHBD 4POGA 3E9IA 1HA6A 5HGQA 2F0JA 4X64Q 2Z0SA 1OXXK 5I6WA 1VQ9A 5IT9E 4LUOA 2NVXH 1BF4A 3H0GG 2EY5A 4DAVA 4LF4Q 1FJGL 2ZJQA 4IURA 3FPPA 1SYGA 1I4XA 1ICFB 1PTOH 1SE3A 3I4OA 2N78A 4IOAA 1AEXA 2JYOA 1MD2D 2JEBI 4IUQA 2PI2E 1QUQA 1YBYA 3UI2A 2XWJB 2FXQA 1A3VA 1D6EC 1EYCA 3IFDA 1R9TB 2DUDA 1TIID 1EY7A 1XMQQ 4HR7B 3BZCA 2AMCB 2IHEA 2XRQD 4OONA 5M3MG 3I4MH 1O7YA 1S4ZA 3G71A 1I4GA 1STAA 3DEPA 2DGYA 5KEEA 1VQGA 3DWAA 1HFNA 5JAVA 4A3JH 3K0XA 2CQOA 3D6WA 3FRPB 4J6HA 3CKIB 4NMZA 1O7IA 4QQBX 1SJHD 2MFIA 2PZUA 4XDXA 1N34L 1FGBD 1RIPA 3RLFA 1JICA 5E4XA 4GLXA 2QW7A 3V2TA 4NXML 3CC4A 1A3TA 1A0IA 2KEDA 4LAAA 1LT3D 2PCFB 4JI8Q 3K81C 4JI2L 1A62A 3ZYYX 3K6OA 5JJIA 1TS2A 1KAWA 3KF6B 2PI2A 2NZHA 4FNFA 1EUJA 2WAQG 2Y0SE 3FHWA 3GP7A 3SE0A 4A3EG 2JK8A 4TRDA 4DV7Q 2HD3A 2VB3X 2NYZD 2NVTB 2NVXB 1B4OA 1EY0A 3WOFA 1OTCA 4K2KA 4KY7A 4AYBE 4FXDA 3UDFA 3PUYA 1JE4A 4JI5L 1G8ZD 1PTOB 1SYCA 3T53B 4FXKC 1FNWA 4JI1L 3CXCA 2K7VA 2CCZA 2K4KA 1PTOC 4RCNA 5C44H 1KAAA 2QILA 1XX8A 4NXNQ 3HGBA 3GTGH 1FR3A 2R93G 1JWUD 3U9OA 5AJ3L 2NB0A 1O80A 2B2WC 1N36L 4JI6Q 1GUOA 4YHHQ 1F2LA 3W5OA 3Q0AA 1PFMA 3I4MB 4HAEA 2B2WA 3K8AA 1OXSC 2F0MA 5J1ZA 3IL8A 2Y0SB 4A3JB 4GKKQ 2IHFA 4R8NA 1X3QA 1HNXQ 4JBWA 3OW7A 4LFBL 4ZRZA 4LF8L 1YJ9A 2KECA 4AYBB 4C3HH 4KD3A 1M8AA 4PZ6A 4YY3Q 3NTKA 4RG1A 5FO9B 1LTLA 3NK9A 2D2CC 1WTHA 2N8NA 1NE3A 4CKBA 2F52A 4K6LA 2JA6H 3ULJA 3DWPA 5M3MH 1VMPA 3NTIA 1M4VA 4JOIC 2DNCA 2WB1G 2L4NA 3HS0C 3I72A 5IOCA 4OX9L 4R1JA 4PMCA 2KHIA 1HRJA 1ENCA 1EYDA 1ICWA 4A4IA 5COYA 4KKTA 1WTVA 4ZKBB 4MN3A 2M9VA 1PLFA 5CMDA 4IFDJ 3PUWA 4X66L 5IODA 4UP9A 3I2ZA 3P20A 2A68D 2R7ZG 2B2TC 4JCVE 1QVGA 1ILQA 2BE5C 5IYBG 3LWUA 1Q86C 4A3GG 1MHWC 3J81E 1EL0A 5EBCA 3HOUG 2WKDA 1KTKA 5GQOA 3J7A5 5CV5A 2AKWB 5C44B 2B2TA 2NZ1D 4DR6L 4WJ4A 1KIXA 3GTGB 1EWHA 1RTOA 4KHZA 4O0AA 1ONLA 5CV7A 3EFXD 2UUBL 4PZ7A 4J8QA 2JA8B 2HDLA 1ENAA 1GD7A 3PO2G 4X65Q 3AEVA 4FF4A 1D8LA 1H9JA 1Q82C 3SK8A 5IGGA 3IFTA 2NN6G 3TP6A 2SNMA 2IX1A 1A2TA 1HPCA 4RHSA 1YJNA 3RZDH 4KY5A 3TQYA 1EZ6A 5M5WH 2EXZA 1LLRD 4E6IA 1I94Q 5EPLA 2AWOA 3CP0A 4C3HB 1EQRA 1HFGA 1UEBA 2F0OA 4HMIA 3H15A 1BBXC 1DONA 1EY5A 3GQBA 1BO0A 3RUZA 2F4VL 4NW2A 2UXCL 2JA6B 5M3MB 5CV9A 4NP5A 2RHSB 4ZCKA 3UDIA 4A75A 5I6YA 4DV1L 3VYUA 4JI7L 3KK7A 3A5UA 4B3SL 4IFDG 1AW7A 5A35A 1SMYD 4GNXA 4J1MA 4F87A 3E9HA 1TWHH 3HOWH 4PMBA 2NN6I 2OF1A 4XIGS 2B63H 5CBAE 1X3FA 5NUCA 1U4LA 1X6OA 2H5XA 4LFCQ 2UXBL 2A6HD 3HOZH 1KRTA 3BYTB 1IL2A 1BQQT 1EEID 1K28A 1XNQQ 2AUKA 2VB2X 4Q0FA 5HURA 4C2MH 3PO3G 4DR7Q 4UP8A 4DV5Q 1T9HA 2F0GA 3HZXA 4K0KL 4DR1Q 3HRZC 1SE2A 3JAMi 4C3JG 3U58A 1CA6A 1AZPA 5FOBB 4UP7A 3E0EA 1LT6D 5C4XH 2HHHL 4DR2L 1E0BA 1D1IA 3A8JE 5ELNA 2GN5A 3RZDB 3HP3A 4FF1A 5C3XA 4IFDI 1IYUA 3CMAA 1RD9D 1FL0A 2EJFC 4DV2Q 5M5WB 1TXYA 1XNRL 1F9PA 2VUMH 1X54A 1RL2A 1E3PA 2RSOA 2IY5B 5IE8A 1KLGD 2DY8A 3J80c 2C5CA 2R7FA 4LF6L 4L8JA 2B3GA 3BYYB 3HOYH 1X3PA 1IBLQ 3HOVG 2QDBA 2PQEA 3TRZA 2Q2HA 4TSSA 1Z6HA 2N88A 3GTQH 3A5ZB 4U673 1J5EL 1NTGA 1NBWA 2UUAQ 3TEHB 5A2QL 2C35B 4KKSA 4HJ5A 1HR0L 3AMUA 2GA4B 4X6AH 1Y8OB 1H9MA 3M4QA 1CUKA 1K9MC 2Z1CA 1CHPD 4AQYL 3EIVA 1A3UA 3X3NA 1PFBA 1GJXA 1TWHB 2YV5A 4ODGA 5LMNL 3HOWB 3KLRA 3NELA 2N3SA 5JOBA 3J7AV 1SYEA 4YIJA 3U50C 2B63B 4G57A 3DMUA 5H1SE 5EKLA 4A3DH 1WYDA 3CF5A 2JSOA 2A8VA 3ERQA 3HOZB 5JJKA 4LUZA 2LXKA 1GUNA 2F0UA 1JT8A 1CA5A 5KYLA 4C2MB 3N6RA 3I73A 4OHJA 5CV4A 3BZDB 3EBEA 4LFAQ 5DAUA 1EY9A 1V1PA 1CZGA 5E3FA 4A3IH 1BNZA 3SEBA 4DF7A 1C4QA 4ZKCB 3M4YA 1PH5A 3SK6A 4RKLA 5KNBA 4QIWE 4K14A 1SNQA 4J15A 3P7JA 2PPBC 2F3VA 5C4XB 1JORA 4B08A 2F0PA 1QZHA 5FJ8H 4B3TQ 4A3LH 1LUZA 3S17H 1JR0D 4DK1A 4DV6Q 3JC66 2K5HA 1VQHA 3I7FA 2X6GA 2FFKB 3FKIH 2VUMB 1WJJA 1W6KA 5C4ZA 1BUVT 4O42A 5IP7G 1Q8IA 3UDXA 1ET6A 3K7AH 4IJLA 1I4QA 1WTRA 2DNEA 4A3KG 3R8BA 4ME3A 4UAIA 1Q8KA 2XN9C 1XMQL 2JA5G 2CH4A 3HOYB 2I5HA 1X56A 4A3BG 2JQOA 2ZTCA 4KMUC 1AE2A 1I4PA 2NVYH 3GTQB 3VR5A 3MEFA 3NE5B 3U9SA 2B29A 4Y7NH 2M2LA 3SDZA 1BOSA 2FINB 4XT3B 1JE5A 1QVCA 5KNCA 4QIWB 4LF9Q 4A93H 1AE3A 5JPMC 4JVZA 2N55A 3I55A 2GVBA 3AB9A 4KN7C 3DHQA 2A6EC 4DAPA 3CHBD 2G9HD 2VL6A 4A3FG 1PYWD 1SE8A 4WJWA 2BH2A 4A3DB 3GTMH 3NBHB 5I9OA 3EROA 1QB5D 1EFWA 4JI8L 2RVLA 1EY4A 1KABA 2RCFA 1CT1D 1NNXA 1WTXA 1VDZA 3NXWA 4A3IB 3MXPA 1EQQA 1UE5A 1IBML 1WCMH 3A74A 3CAMA 5LHY1 2A74C 3T4AC 4DV7L 2YU9H 2ZJPA 2OTJA 1CZWA 1QNUA 3C3LA 4HJ9A 5GAEC 4ZUJA 5M9OA 5M3FH 2WP8J 2KENA 2AHOB 4DAMA 2K33A 3S17B 3SR1A 3OMCA 1JCKB 2TMPA 3D3RA 5J39A 3K57A 2OXPA 4RGTA 2RSNA 3FKIB 1HTLD 4S3SA 4L5QA 1PV4A 1AN8A 3JAME 1PZJD 2SEBD 1V43A 3EJIA 1PH4A 3K7AB 2ZM6Q 2HT1A 3S1QH 2EJMA 2KHJA 4ABNA 3R93A 1SSOA 2HQLA 3N52A 5EQ0A 3M7GA 5GAHC 1ASYA 2EYHA 2NVYB 1MIUA 1VQDA 4R4IA 1SE4A 3H3VC 3F2UA 5JEAH 1TY2A 4Y7NB 2CWPA 4GKKL 2IWHA 1NSNS 1X65A 1PYSB 3I4NG 4A93B 3TBIB 1SNCA 4QUFA 3Q6SA 3OTOQ 5TSSA 1B9MA 3NSWA 3T51B 1NCVA 3S24A 3AFQA 1QZGA 5IGCA 1YVCA 3M3YH 5DM73 3FPUB 1WD1A 1Y14B 3GTMB 2QEXA 1HUNA 2I07B 1IL8A 4B9XA 2M00A 4DXGA 4HSPA 3D8GA 1PFSA 1EIFA 2K5VA 5C3EG 4IQZA 5LL6S 3HOXH 1CQVA 4IUVA 5FLMH 4RCOA 3GTKH 3W1GA 1NJIC 5BN3A 1IYVA 1YNNC 1JJCB 1WCMB 1Y8NB 4I7ZC 1YEZA 2K5NA 3ERSX 3S15H 3RZOH 2YU9B 3ZJYC 3SVMA 1U4RA 4YCUA 1LTSD 2K50A 5ELBA 2ZXRA 4A3CG 3QO2A 4DUYL 1SNDA 3DXJC 5M3FB 1MJCA 4DV3Q 1EU4A 4FYDA 4MZ9A 4G7OC 5M5XH 1U9RA 2Z6BA 1ZYRC 1TVXA 4IO9A 1A6XA 1FYCA 3BS1A 1HUMA 3AQQA 3QOLA 3S1QB 3I8ZA 3MHBA 1HCZA 4P75A 4X65L 2N49A 5EGTA 1QVFA 5IYDG 1Q7YC 4JV5L 3BVGA 1KDCA 4ALPA 4K5XA 1E22A 3BDOA 5BR8Q 1JB3A 4PG3A 4X3UA 3QR8A 1DOLA 5C6AA 3LWEA 1STEA 1EQVA 1GUGA 4DR4Q 4JI0Q 2EYFA 4EQOA 2F0QA 1L0XB 1S3OA 3UDGA 3A7LA 2RA4A 5G3LF 1IBKL 1GO3E 1HNWL 3M3YB 4R9WA 1SBBB 4C3IG 3VR3A 4HN7A 2WINB 4DK0A 2RCNA 3OHXC 4AH6A 1KNEA 4R4QA 2E5LQ 5DM63 3V96A 3QB3A 3TREA 1SAPA 3A7AB 1HZCA 3VYSA 2J7ZA 2Z9HA 2EYPA 2R7DA 3HOXB 3C2PA 1K3BC 1I6HH 4BXXG 1SRUA 3GTKB 3MXGA 2R92G 1LACA 2BOSA 2EY1A 4LF5L 3S15B 1NR2A 4P71A 4BA1I 3OOCA 3RZOB 3S1MH 4KHPQ 4GN4B 2MGSA 1EEFD 4LFCL 4DR3Q 3VDYA 1UEAB 4BA2I 1U4PA 1PH7A 2ZXOA 2C9OA 2LKVA 1XNQL 3CC7A 4WFN3 2I5MX 3MTSA 3OIPA 1KNAA 2ZXPA 1HJPA 4P72A 3KLSA 2D5DA 2F0VA 3PQIA 4KLKA 2QA4A 4DR7L 1OXVA 4LF7Q 1HZBA 1MSGA 3KJOA 2VQEQ 4BY1H 3KF6A 3J80E 2SOBA 3WDNA 1QG7A 4OO1G 1PHJA 3D0FA 3HKZE 1C48A 4CJ1B 2EDGA 4CJ2C 3M4OH 4P2CB 3PGZA 4DV2L 1T5XD 2MHVA 5IWAQ 3NHHA 4I65A 2XRSD 2EVBA 2L15A 1P8LA 3TMEA 5ELOA 3VR2A 5JVH3 4H0LC 2XWBB 5IYCG 2JA7G 3H0GH 5G3LD 2HDMA 2XVSA 2B39A 4ZLTF 2UUCL 3S2HH 1AH9A 3SXHA 1YHBA 1Y1WG 4JK1C 1BBUA 2E2JH 1IBLL 4H13C 1DM0B 4DV4Q 2B2UC 4RFBA 3JAMc 1B70B 4HSVA 3BDCA 4BBSG 3OWFA 3F1ZA 4NDXA 1PH1A 1S5DD 4OEMB 5HGTA 4GLAC 5GROA 5K36G 3G48A 1XPUA 3HKZB 2K28A 2B2UA 2EXDA 2H4OA 1I6HB 4OO1I 1BXTA 4DNRB 4OIKA 2RDGA 1YJWA 4P74A 4ILWA 5JJZA 2ASBA 3S1MB 1BCPD 3OIQA 4F88A 4GKJL 2X69A 4BY7G 3CU7A 1SXTA 4GOPB 4JOIA 1CKMA 3F2BA 4L5TA 4GOPC 2K01A 4K6DA 4LMQD 4KI0A 1GKHA 3J7ZC 1RODA 2J0TD 4LFAL 2D62A 2PQAB 4OWWB 1EZ8A 3OW2A 1GVPA 1TS4A 4GOPA 1HHVA 1F9RA 1RF2D 3J81L 2UU9Q 4BY1B 2IJ0A 5IGBA 1AZQA 2R92H 1XXGA 4EQPA 3H6MA 3WOEA 4QCLA 3STBD 3CW2C 2PQAA 4B3TL 1VQ6A 1H9SB 1VQ8A 3M4OB 4X3KA 5D65A 4K8IA 1D5ZC 5JVG3 1PH2A 3ULPA 1KXLA 5E4WC 1QCBD 3ND8A 4DV6L 4JG2A 3OSOA 4A3EH 1JOQA 3CPFA 3E0JA 4TKOB 4B3MQ 1N32L 5FLXL 3EN2A 1EIGA 1F2MA 2F4IA 3M85A 3RNUA 2Q2UA 1H9SA 3H0GB 2A68C 1B53A 5BN5A 3PF5A 3K7UC 3S2HB 1YZ6A 4DR5Q 4CKEA 1FJGQ 2E2JB 1DJRD 1LT4D 1FVIA 3MA2B 4YCVA 2JE6I 4DN4M 2R93H 4KK7A 2NVQH 4WRDA 1B8AA 3BVMA 3GDEA 1HR0W 3SK5A 4OWXB 4LF9L 1BR9A 2B2YC 3P75A 1Y1VG 4MTNA 2L1BA 1PRTF 1CI3M 2QCPX 2YTXA 3G7LA 4DPGA 5LMNW 5IYCH 2F0WA 4GZYC 2WAQE 1XTDA 1B50A 1GHKA 4DK3C 2B2YA 1TKWB 1M1KC 4H44C 4JBKA 1W6JA 2K6AA 5E7NA 5FKAC 4RGOS 2XNAC 1KHIA 2Z4IA 2AUJD 3ER0A 2R6GA 2HQEA 4RH6A 3DM3A 1OO9B 2CW0D 1JWMD 1STBA 1SYBA 1BVSA 2QKIC 1GXDC 1WD0A 4O2DA 5KRUA 1CSPA 3HEJA 1K8MA 1K0SA 1B7YB 2KHSA 2R92B 1QNKA 3K5MA 4N8FA 2AQ2B 1Q12A 4NXMQ 3S9WA 1XMOL 4C1NI 1Z9FA 2KA7A 4C1NK 4JI2Q 5DNFA 1SMYC 3KLWA 2KJXA 2R3ZA 2SDFA
chains in the Genus database with same CATH topology
2WAQB 4A3EB 1F2ZA 2K5DA 1DD2A 3RMHA 1F2YA 1EFID 1PZKD 1O7LA 1WTOA 1CTMA 1I4RA 5T1GA 2A6HC 1QE6A 1R4QB 2A69D 2Q8IB 2MP1A 4U68A 1EIHA 1S5ED 4DFAA 1YNJD 2IT1A 2VNUD 3Q23A 2R93B 2NVQB 3H91A 1KLUD 3K0YA 2NTSA 1PRTD 3KLSX 4TQUS 1DZ1A 2NN6H 4KTAA 2G9DA 1G2TA 4RA8A 4K8JA 1JOOA 4DXFA 2EYMA 1HQMC 3A56A 4RKBA 5C0XJ 5EKKA 2D9UA 1J9OA 3KUPA 2EJGC 1PRTB 3ND9A 2Z8LA 1DYQA 2LY7A 5A2QE 1EWCA 1VMCA 1QOHA 4FP5D 4O1NA 2WB1B 4IZ8A 2FMCA 4IFDH 3RD4A 4R8IA 2E74C 1MI2A 3VYRA 3S16B 4DAYA 1EQTA 3J7YW 2R7ZB 1SNPA 2EYJA 4N9TA 2EPBA 2ZT9C 4A3GB 1X32A 1DCZA 4IN3A 4RGNA 3HOUB 4CBVA 3TDQA 1T5EA 1C8CA 4XQQA 5K5PA 2KCNA 3CRKC 1EOTA 3PO2B 1KDBA 3QOJA 3D4DA 1MBYA 1CQFA 2JEAI 2BDNA 1WVLA 1PFNA 2K5QA 1I4HA 4PNYA 2FJ2A 5M5YB 4N9PA 5C0XG 2EYLA 3PIP3 3MXUA 1EY8A 3MVVA 3ONAB 5ELEA 3IAYA 1A2UA 1CFMA 2EY6A 3OPOA 3D6CA 2O5IC 1DOMA 3L3OC 3I4LA 3MWYW 4UDUC 5IGDA 1NUCA 1D5XC 2WV6D 4MIUA 1E2VA 3I3CA 5F2DA 3NBHA 3GD7A 5IGEA 3H94A 1TWFB 1II3A 4FF3A 3P1HA 5C0XI 4KV6A 5KGUA 5CORA 1PMRA 3PO3B 5T1IA 1G2SA 3VA7A 5LL6X 2F0DA 4C3JB 1G91A 2F0NA 3D4WA 4QB4A 3S14B 5CYUA 1UUPA 5I2XA 3VA5A 4NKLA 3K5LA 3R2TA 1EU3A 4B9WA 1QJOA 3NPPA 3FMCA 1B9NA 4BBRB 1DOKA 3BDLA 2AWNA 1Q90A 1AFPA 2B8FA 3I91A 2WIIB 5E1FA 4CJ0B 2ENBA 5CV8A 2KVMA 4L6TB 1TU2B 1PZID 1TS5A 2F0HA 4L63B 3HOVB 1EY6A 4G7ZC 2VXWA 3MAQA 1B1ZA 1S5CD 2E76C 1E2ZA 5CC4A 2F0FA 3S2DB 2B2VC 4BS9A 1D5MC 4MHEA 3E6ZX 2E2DC 5C4HA 3CQZB 4V0BA 4ID6A 2KCCA 1Z7TA 4HMJA 5IT9L 2F0LA 5CR3A 3TSSA 1LTTD 3DEOA 3DUZA 1Q1EA 1ESFA 1NAPA 2F1MA 1KDAA 3QJYA 1V1OA 3LX0A 2K1BA 1ZKOA 4PQXA 3T13A 2CVRA 3K5NA 1LTGD 4M8AA 2KUMA 3FEWX 1EYAA 2L12A 3OWEB 3GO5A 2L11A 1FD7D 4C3HG 1F9QA 3DM1A 4FVMA 4A3KB 4KJNA 1SNMA 4C56C 3J7AF 2JA5B 3ITPA 4A3BB 3KBXA 3A54A 1I3QB 1Q3LA 1RDPD 3URYA 1ILPA 2H1EA 2F0IA 4LJZC 3T56B 2L9HA 4PV1C 5I2YA 3NWSA 2SNSA 4F7XA 2MJ8A 2L5TA 4HCEA 4QF4A 1BCPF 4A3FB 3T16A 5IGFA 4DU9A 4ZK9B 3M7NA 1G6ZA 2I46A 1B44D 4X3TA 1B3AA 3QG1A 2O2LD 4KJOA 1WTWA 5M5XB 1TWCB 3J80L 1PTOD 1RCVD 4ZYSA 5AFWA 1UNSA 3H09A 2V4DA 3L7ZC 4KY6A 2J4XA 5ISRA 3HG9A 2Q8TA 5EPJA 5CBEE 2CQAA 3NWTA 1STGA 2E2IB 1JC7A 3AU7A 4KKUA 1Z47A 4EQNA 3KF8A 4OL7A 1F9SA 3TP5A 1SYFA 3NQIA 2OT2A 1LO5D 3I90A 5KNDA 4V190 3DWQA 1K8OA 5D3DA 2ICEC 1D1KA 2L0CA 3I4NB 1O78A 1D2BA 4Z9CB 1H9RA 5EPKA 3TP7A 3O13A 1GHJA 5ELCA 3PV0A 3QIAA 5FO7B 1SJED 2QEJC 4EGVA 2BE5D 1XWEA 3GV6A 1G291 5C3EB 2F3WA 1PDQA 4G7HC 2WKCA 1L0YB 3EVQA 2EZVA 1BCPB 1Y69U 4OIJA 1BCPC 3GTLB 5JPNC 2RBMA 1LTAD 2IPKD 3NP8A 5BN4A 2XIWA 3A8IE 5D14A 3NTHA 3FVQA 3TN2A 1I6VC 2AQ1B 4EVOA 2ID0A 1SYDA 2X6LA 4OO1H 5ELFA 3K59A 2BCOA 1OXTA 1PXUA 4CGYB 4H7BA 2MUYA 2JP1A 2K05A 2EOTA 1FNVA 5FLXE 4XT1B 4FO2A 2E75C 2PNRC 4HCSA 1GUTA 1UAPA 1LTID 2Q8RE 1V8QA 2PW5A 3MC0B 5C5LA 1J8IA 2OEOA 3D31A 2BA1A 4C3IB 1SNOA 4KN4C 4F8MA 2EYOA 3EQLC 1AP0A 2NTTA 1SEBD 4IALA 2RQXA 5K36H 2EE1A 1SDFA 2PO4A 3PIO3 4FF2A 3R2IA 2KOLA 2PW7A 2NUCA 4XQJA 1IKLA 1JOKA 5IIFA 3C1EA 4XQNA 5C3WA 2CW0C 1K83B 1LTBD 4DGZA 4G4KA 4IUTA 5CGKA 1HQRD 3VR6A 2A5HA 5EJWA 3FDTA 2IL8A 2LMCB 3C46A 3G6JB 3S1NB 1ZEQX 2PMZB 1TQOA 5I9PA 1VCIA 2QF7A 3MEHA 4FXGC 1HTPA 3NUCA 3S1RB 3EA6A 3C1FA 2TSSA 1STNA 3PUVA 3PUZA 2HCCA 3VYTA 1S5FD 3L9AX 5CV6A 5JEAJ 2JA7B 3PUXA 4HTHA 1SFOB 2A69C 3R3OA 1Y1WB 2WACA 4QUCA 1VF5C 1U4MA 1YNJC 4WORA 2MPMA 4BBSB 1QWYA 1R4PB 3W3AA 2JXMB 2PZTA 3GTPB 1LT5D 4PMWA 3TZDA 3GV3A 1PRTC 1ET9A 2F0TA 4HEDA 3MZ5A 3A8KE 2NWGA 5EKIA 2IW3A 3TP8A 1XTCD 2K32A 4XYQA 4BY7B 2F0SA 2HUGA 2FMMA 1V1PB 2DY7A 3IKJA 1RHPA 5DEHA 4KD4A 3MFYA 1NR4A 3OMGA 5FO8B 2KQ3A 2F0EA 2L55A 4ULLA 1MGSA 2KEEA 2Z4HA 4CHTB 5C4JB 1RTNA 3MXNA 1ESRA 1TWAB 1TY0A 3TZUA 1F77A 1TWGB 1DXMA 5JEAG 3KBGA 1IW7D 1IKMA 3Q24A 1B2TA 2YYZA 3K58A 1GOZA 2BDOA 2K04A 4XYOA 3CRLC 1STHA 1WTPA 2DN8A 1ENFA 2A6ED 2K5WA 1HA5A 3QWNA 1S5BD 4RAUC 1GUSA 2AQ3B 5FK9C 1JWSD 3GTJB 2F0KA 1IW7C 4OGQC 1Y1VB 5C5MA 1JQYD 1STYA 2IX3A 1ML0D 5I4DA 3K5OA 4X3SA 5KYIA 3W2DA 4KHVA 4XTCS 2NBFA 3NQTA 3MFGA 3NBIA 3X3MA 5D3IB 1TT2A 3PMFA 1WTQA 1HXYD 2RDFA 1I50B 2B8GA 5ELDA 5KIXA 2R61A 4DA2A 3E5SA 3JAML 4DNTB 1H9KA 4ZUIA 4ME5A 2FHTA 4RWSC 1A15A 1XYIA 3V05A 1RJTA 3GTOB 1ZXTA 3A55A 2A73B 1Q1BA 2F03A 1VF7A 3Q22A 1BDOA 4K2LA 4ZQ3A 3I70A 5J22A 2RDHA 1GUWA 2LFNA 1O7ZA 1OXUA 1E2WA 1MSHA 2HCIA 1CM9A 1Y8PB 4XXEA 1CHQD 3BG3A 2RKSA 4A3MB 2K03A 4K5WA 1LABA 3SK4A 2EY2A 4Q5VA 1YNND 2PZWA 1LTRD 5C0XH 2XSCA 2ICIA 4IUPA 1RKNA 4ZAIA 4K5VA 4IUNA 2O5JC 1TS3A 2E2HB 3BVZA 3SHLA 4LK1C 1LV9A 5EBDA 4IUUA 2B2VA 1ZYRD 3LNNA 1CK1A 3VR4A 3D4RA 2BA0A 1IHZA 4RGMA 2O4XA 2PYKA 1FNUA 1PTOF 4BWGB 4RHRA 2IX0A 1QILA 4CKCA 2LS01 4M1UB 4QMGA 1TR5A 2CHBD 1HA6A 2F0JA 1OXXK 5I6WA 5IT9E 1BF4A 2EY5A 4DAVA 4IURA 3FPPA 1SYGA 1I4XA 1PTOH 1SE3A 1AEXA 2JYOA 1MD2D 2JEBI 4IUQA 3UI2A 2XWJB 1A3VA 1D6EC 1EYCA 3IFDA 1R9TB 1TIID 1EY7A 4HR7B 2XRQD 1O7YA 1S4ZA 1I4GA 1STAA 3DEPA 5KEEA 3DWAA 1HFNA 5JAVA 3D6WA 3FRPB 4J6HA 3CKIB 4NMZA 1SJHD 2PZUA 4XDXA 1FGBD 3RLFA 1JICA 5E4XA 3V2TA 1A3TA 2KEDA 4LAAA 1LT3D 2PCFB 3ZYYX 3K6OA 1TS2A 4FNFA 3GP7A 3SE0A 4TRDA 2VB3X 2NYZD 2NVTB 2NVXB 1B4OA 1EY0A 3WOFA 4K2KA 4KY7A 4FXDA 3PUYA 1JE4A 1G8ZD 1PTOB 1SYCA 3T53B 4FXKC 1FNWA 2K7VA 4RCNA 1PTOC 1KAAA 2QILA 1XX8A 3HGBA 1FR3A 1JWUD 3U9OA 2NB0A 1O80A 2B2WC 1GUOA 1F2LA 3Q0AA 1PFMA 3I4MB 4HAEA 2B2WA 1OXSC 2F0MA 5J1ZA 3IL8A 2Y0SB 4A3JB 4R8NA 1X3QA 4JBWA 3OW7A 4ZRZA 2KECA 4AYBB 4KD3A 1M8AA 3NTKA 5FO9B 3NK9A 2D2CC 4CKBA 4K6LA 3DWPA 1VMPA 3NTIA 1M4VA 2DNCA 2L4NA 3HS0C 3I72A 5IOCA 4PMCA 1HRJA 1ENCA 1EYDA 1ICWA 5COYA 4KKTA 1WTVA 4ZKBB 4MN3A 2M9VA 1PLFA 5CMDA 4IFDJ 3PUWA 5IODA 3P20A 2A68D 2B2TC 1ILQA 2BE5C 3LWUA 3J81E 1EL0A 5EBCA 2WKDA 1KTKA 5CV5A 5C44B 2B2TA 2NZ1D 3GTGB 1EWHA 1RTOA 4KHZA 1ONLA 5CV7A 3EFXD 4J8QA 2JA8B 2HDLA 1ENAA 4FF4A 1H9JA 3SK8A 5IGGA 3IFTA 2NN6G 3TP6A 2SNMA 2IX1A 1A2TA 1HPCA 4RHSA 4KY5A 1EZ6A 2EXZA 1LLRD 4E6IA 5EPLA 2AWOA 4C3HB 1HFGA 2F0OA 4HMIA 1BBXC 1DONA 1EY5A 3GQBA 1BO0A 3RUZA 4NW2A 2JA6B 5M3MB 5CV9A 4NP5A 5I6YA 3VYUA 3KK7A 4IFDG 1AW7A 5A35A 1SMYD 4J1MA 4F87A 4PMBA 2NN6I 2OF1A 4XIGS 5CBAE 5NUCA 1U4LA 2A6HD 3BYTB 1BQQT 1EEID 2AUKA 2VB2X 4Q0FA 5HURA 2F0GA 3HZXA 3HRZC 1SE2A 4C3JG 1CA6A 1AZPA 5FOBB 1LT6D 1E0BA 1D1IA 3A8JE 3RZDB 3HP3A 4FF1A 5C3XA 4IFDI 1IYUA 1RD9D 2EJFC 5M5WB 1F9PA 2RSOA 1KLGD 2DY8A 2C5CA 4L8JA 3BYYB 1X3PA 2QDBA 2PQEA 4TSSA 1Z6HA 2N88A 4U673 5A2QL 4KKSA 3AMUA 2GA4B 1Y8OB 1H9MA 2Z1CA 1CHPD 1A3UA 3X3NA 1PFBA 1GJXA 1TWHB 4ODGA 3HOWB 3KLRA 5JOBA 3J7AV 1SYEA 4YIJA 2B63B 4G57A 3DMUA 5EKLA 2JSOA 3ERQA 3HOZB 1GUNA 2F0UA 1CA5A 5KYLA 4C2MB 3N6RA 3I73A 4OHJA 5CV4A 3BZDB 1BNZA 5DAUA 1EY9A 1V1PA 1CZGA 5E3FA 3SEBA 4DF7A 1C4QA 4ZKCB 3M4YA 3SK6A 4RKLA 5KNBA 4K14A 1SNQA 3P7JA 2PPBC 2F3VA 5C4XB 1JORA 4B08A 2F0PA 1JR0D 4DK1A 2X6GA 2FFKB 2VUMB 1W6KA 5C4ZA 1BUVT 4O42A 1Q8IA 1ET6A 1I4QA 1WTRA 2DNEA 3R8BA 4UAIA 2XN9C 3HOYB 4KMUC 1I4PA 3GTQB 3VR5A 3NE5B 3U9SA 2M2LA 3SDZA 1BOSA 2FINB 4XT3B 5KNCA 4QIWB 5JPMC 2N55A 4KN7C 3AB9A 3DHQA 2A6EC 4DAPA 3CHBD 2G9HD 1PYWD 4WJWA 4A3DB 5I9OA 3EROA 1QB5D 2RVLA 1EY4A 1KABA 1CT1D 1WTXA 1VDZA 3NXWA 4A3IB 3MXPA 5LHY1 2A74C 3T4AC 1CZWA 1QNUA 3C3LA 4ZUJA 5M9OA 2WP8J 2K33A 3S17B 3SR1A 3OMCA 1JCKB 2TMPA 3D3RA 5J39A 3K57A 2OXPA 4RGTA 2RSNA 3FKIB 1HTLD 4S3SA 1AN8A 3JAME 1PZJD 2SEBD 1V43A 3EJIA 3K7AB 2EJMA 4ABNA 3R93A 1SSOA 3N52A 5EQ0A 3M7GA 2EYHA 2NVYB 3H3VC 1SE4A 3F2UA 5JEAH 1TY2A 4Y7NB 2IWHA 1NSNS 4A93B 3TBIB 1SNCA 4QUFA 3Q6SA 5TSSA 1B9MA 3NSWA 3T51B 1NCVA 5IGCA 5DM73 3FPUB 1WD1A 3GTMB 1HUNA 2I07B 1IL8A 4B9XA 2M00A 4DXGA 4HSPA 3D8GA 4IQZA 5LL6S 1CQVA 4IUVA 4RCOA 5BN3A 1IYVA 1YNNC 1WCMB 1Y8NB 4I7ZC 2YU9B 3SVMA 1U4RA 1LTSD 5ELBA 2ZXRA 3QO2A 1SNDA 3DXJC 5M3FB 1EU4A 4FYDA 4G7OC 1U9RA 1ZYRC 1TVXA 1A6XA 1FYCA 3BS1A 1HUMA 3QOLA 3S1QB 3I8ZA 3MHBA 1HCZA 5EGTA 3BVGA 1KDCA 4K5XA 3BDOA 1JB3A 4X3UA 1DOLA 5C6AA 3LWEA 1STEA 1EQVA 1GUGA 2EYFA 4EQOA 2F0QA 1L0XB 3A7LA 2RA4A 5G3LF 3M3YB 4R9WA 1SBBB 4C3IG 3VR3A 4HN7A 2WINB 4DK0A 3OHXC 1KNEA 5DM63 3V96A 3QB3A 1SAPA 3A7AB 3VYSA 2J7ZA 3HOXB 2EYPA 3C2PA 3GTKB 3MXGA 1LACA 2BOSA 2EY1A 3S15B 1NR2A 4BA1I 3OOCA 3RZOB 2MGSA 1EEFD 1UEAB 4BA2I 1U4PA 2ZXOA 2C9OA 2LKVA 4WFN3 3MTSA 3OIPA 1KNAA 2ZXPA 3KLSA 2D5DA 2F0VA 1OXVA 1MSGA 3J80E 2SOBA 3WDNA 1QG7A 4OO1G 1C48A 4CJ1B 2EDGA 4CJ2C 4P2CB 1T5XD 2MHVA 3NHHA 4I65A 2XRSD 2EVBA 3TMEA 3VR2A 5JVH3 4H0LC 2XWBB 5G3LD 2HDMA 2XVSA 2B39A 4ZLTF 3SXHA 4JK1C 4H13C 1DM0B 2B2UC 4RFBA 4HSVA 3BDCA 3OWFA 4NDXA 1S5DD 5HGTA 5K36G 3HKZB 2K28A 2B2UA 2H4OA 1I6HB 4OO1I 1BXTA 4DNRB 4OIKA 2RDGA 4ILWA 5JJZA 3S1MB 1BCPD 3OIQA 4F88A 2X69A 3CU7A 1SXTA 2K01A 4K6DA 4LMQD 4KI0A 1RODA 2J0TD 2D62A 1EZ8A 1TS4A 1HHVA 1F9RA 1RF2D 3J81L 4BY1B 2IJ0A 5IGBA 1AZQA 1XXGA 4EQPA 3H6MA 3WOEA 4QCLA 1H9SB 3M4OB 4X3KA 5D65A 4K8IA 1D5ZC 5JVG3 5E4WC 1QCBD 3ND8A 3OSOA 1JOQA 3E0JA 4TKOB 5FLXL 1EIGA 1F2MA 2F4IA 3M85A 1H9SA 3H0GB 2A68C 1B53A 5BN5A 3S2HB 4CKEA 2E2JB 1DJRD 1LT4D 3MA2B 2JE6I 4DN4M 4KK7A 4WRDA 3BVMA 3SK5A 1BR9A 2B2YC 3P75A 2L1BA 1PRTF 1CI3M 2QCPX 3G7LA 2F0WA 4GZYC 1B50A 1GHKA 2B2YA 1TKWB 4H44C 1W6JA 2K6AA 5FKAC 4RGOS 2XNAC 2Z4IA 2AUJD 2R6GA 2HQEA 4RH6A 1OO9B 2CW0D 1JWMD 1STBA 1SYBA 2QKIC 1GXDC 1WD0A 5KRUA 3HEJA 1K8MA 2KHSA 2R92B 1QNKA 3K5MA 2AQ2B 1Q12A 3S9WA 4C1NI 2KA7A 4C1NK 5DNFA 1SMYC 2KJXA 2R3ZA 2SDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QMG A;  1JOQ A;  5IGB A;  1SNM A;  1TR5 A;  1KAA A;  2F0S A;  1A2T A;  3D8G A;  1F2Z A;  3ITP A;  3TP7 A;  2F0J A;  5K5P A;  4B9W A;  3E5S A;  5I6W A;  4KY5 A;  2QDB A;  3DHQ A;  4EQP A;  1F2Y A;  2LKV A;  2PQE A;  3H6M A;  1EZ6 A;  3U9O A;  2EXZ A;  4ZUI A;  4ME5 A;  3BDL A;  4E6I A;  2EY5 A;  5DEH A;  4KD4 A;  1KDB A;  3QOJ A;  3OMG A;  3D4D A;  5E1F A;  1SYG A;  2F0V A;  2PW7 A;  4K8I A;  2ENB A;  2F0I A;  2F0O A;  4HMI A;  5CV8 A;  2NUC A;  2KQ3 A;  4PNY A;  2F0E A;  5I9O A;  3ERO A;  4DFA A;  1AEX A;  1EY5 A;  3RUZ A;  3OSO A;  1A3U A;  1EY4 A;  1JOK A;  1KAB A;  2EYL A;  2SOB A;  2SNS A;  4N9P A;  5IIF A;  2F3W A;  2F0M A;  2F0H A;  4F7X A;  1EY8 A;  3C1E A;  3MVV A;  5J1Z A;  1SND A;  5C3W A;  1EY6 A;  4ODG A;  3NXW A;  1F2M A;  1A3V A;  1A2U A;  4QF4 A;  5JOB A;  4DGZ A;  1SYE A;  3EVQ A;  4R8N A;  4YIJ A;  3T16 A;  3MXP A;  1EYC A;  5IGF A;  2EY6 A;  4G57 A;  3DMU A;  5CV9 A;  4NP5 A;  3D6C A;  5EKL A;  1EY7 A;  4K2L A;  1U9R A;  4DU9 A;  5CGK A;  3ERQ A;  4ZQ3 A;  4KD3 A;  5I6Y A;  5J22 A;  5CC4 A;  2F0F A;  4KTA A;  2F0U A;  5IGD A;  1STA A;  3NK9 A;  1NUC A;  4KJO A;  3QOL A;  2RBM A;  3MHB A;  4J1M A;  5KEE A;  5KYL A;  4ZUJ A;  3NHH A;  4I65 A;  5CV4 A;  4K8J A;  5M9O A;  1STH A;  3NP8 A;  3TME A;  5JAV A;  1JOO A;  5EGT A;  4PMB A;  4WRD A;  2EYM A;  2OF1 A;  1EY9 A;  5DAU A;  5E3F A;  5C4H A;  3SK5 A;  1TQO A;  4MIU A;  3SR1 A;  1KDC A;  5I9P A;  4RKB A;  2RKS A;  3MEH A;  3OMC A;  4J6H A;  4KY6 A;  5NUC A;  5J39 A;  4K5W A;  4K5X A;  3P75 A;  4ID6 A;  4NMZ A;  2OXP A;  3SXH A;  4DF7 A;  5ISR A;  3SK4 A;  4HMJ A;  5IOC A;  4S3S A;  2EY2 A;  3NUC A;  4RKL A;  5EKK A;  3SK6 A;  4EVO A;  4KJN A;  2PZW A;  4PMC A;  2F0L A;  2PZU A;  3C1F A;  3EJI A;  1SNQ A;  2F0W A;  4K14 A;  5F2D A;  1SYD A;  5C6A A;  1STG A;  3BDC A;  5CR3 A;  5HUR A;  2F3V A;  1STN A;  1JOR A;  1ENC A;  3OWF A;  2F0P A;  1EQV A;  1EYD A;  4NDX A;  5IGE A;  1RKN A;  5HGT A;  5CV6 A;  3V2T A;  1II3 A;  1A3T A;  2F0K A;  2HQE A;  2F0G A;  4K5V A;  2EYF A;  3HZX A;  3P1H A;  4HTH A;  2F0Q A;  4IUN A;  4LAA A;  4EQN A;  2EYH A;  4EQO A;  5IOD A;  1STB A;  3R3O A;  4OL7 A;  1SYB A;  2WAC A;  4H7B A;  4IZ8 A;  3SHL A;  4KV6 A;  5KGU A;  5C4Z A;  1KDA A;  5C5M A;  1STY A;  4WOR A;  3LX0 A;  1NSN S;  5KRU A;  3T13 A;  3HEJ A;  5CV5 A;  5KYI A;  4KHV A;  3NQT A;  3TP5 A;  1SYF A;  1SNC A;  2KHS A;  2PZT A;  4TRD A;  3QB3 A;  5C3X A;  1TT2 A;  2PW5 A;  2EYP A;  5CV7 A;  2F0D A;  1EYA A;  1EY0 A;  5C5L A;  4K2K A;  1IHZ A;  2OEO A;  4KY7 A;  2O4X A;  5IGC A;  2F0T A;  3S9W A;  2PYK A;  1ENA A;  1SNP A;  3MZ5 A;  4K6D A;  3PMF A;  2EYJ A;  2EY1 A;  2F0N A;  4N9T A;  3D4W A;  1SNO A;  4QB4 A;  3TP8 A;  2EYO A;  2RDF A;  4F8M A;  5KIX A;  1SYC A;  3SK8 A;  5IGG A;  1EZ8 A;  3VA5 A;  3TP6 A;  4B9X A;  4NKL A;  4IAL A;  2SNM A;  2M00 A; 
#chains in the Genus database with same CATH topology
 2WAQ B;  3CCQ A;  4A3E B;  1F2Z A;  3S16 H;  2K5D A;  1DD2 A;  3RMH A;  3IRB A;  1F2Y A;  1EFI D;  1PZK D;  1O7L A;  2D0P A;  1WTO A;  1E1T A;  1CTM A;  1I4R A;  5T1G A;  2A6H C;  3WWV A;  2R7Z H;  4MTK A;  1QE6 A;  1R4Q B;  5IYB H;  4JW0 A;  2A69 D;  2Q8I B;  1SN8 A;  4A3G H;  4AIM A;  4DKA C;  2MP1 A;  4UHV A;  4U68 A;  4BBR G;  3HOU H;  1EIH A;  1VQE A;  1S5E D;  4DFA A;  1YNJ D;  2IT1 A;  5HY6 A;  4DV0 L;  2VNU D;  1Q46 A;  3Q23 A;  2R93 B;  2NVQ B;  3H91 A;  1KLU D;  2WB1 E;  3K0Y A;  3PO2 H;  4A3M G;  2NTS A;  5AJ3 Q;  1PRT D;  3KLS X;  3AYH B;  2MQH A;  4TQU S;  1DZ1 A;  1N36 Q;  2NN6 H;  4KTA A;  2G9D A;  5M5Y H;  2KCT A;  1G2T A;  2XTI A;  4RA8 A;  1VQ7 A;  1IYJ B;  4K8J A;  1K8G A;  2PNH A;  1JOO A;  4DXF A;  2EYM A;  1HQM C;  1K3R A;  3A56 A;  4RKB A;  5C0X J;  4JYA Q;  5EKK A;  2D9U A;  3I56 A;  2OWO A;  1J9O A;  4LF8 Q;  3KUP A;  2A19 A;  1N33 L;  2EJG C;  1PRT B;  3ND9 A;  2Z8L A;  1DYQ A;  2LY7 A;  5A2Q E;  1JJ2 A;  1EWC A;  4IJH A;  1VMC A;  3H3V I;  1QOH A;  4FP5 D;  4DAY B;  1SR3 A;  4O1N A;  2WB1 B;  4IZ8 A;  2FMC A;  4OXP A;  4X62 L;  4IFD H;  2E8G A;  3PCO B;  4JI4 Q;  3RD4 A;  4R8I A;  4DV3 L;  3J81 j;  2E74 C;  4X64 L;  1MI2 A;  3VYR A;  3T1H Q;  3S16 B;  4DAY A;  1TWF H;  1EQT A;  4HJA A;  1HNZ Q;  4LF4 L;  3J7Y W;  3MXN B;  1UE7 A;  4Y52 H;  2R7Z B;  1SNP A;  2K75 A;  1JJG A;  2EYJ A;  4N9T A;  2EPB A;  2ZT9 C;  4A3G B;  1X32 A;  1DCZ A;  4IN3 A;  4RGN A;  1W2B A;  4CBV A;  3HOU B;  2Z6K C;  4GS3 A;  2QGQ A;  3TDQ A;  1T5E A;  3PO3 H;  1C8C A;  4XQQ A;  5K5P A;  5BR8 L;  2KCN A;  1CKN B;  1VQP A;  1C9O A;  4DR6 Q;  4NB3 A;  1PH6 A;  2Z6K A;  3CRK C;  2VS1 A;  2KBN A;  1EOT A;  4C3J H;  1S72 A;  1VQC A;  3PO2 B;  1KDB A;  3CCS A;  3QOJ A;  1MKH A;  2UUB Q;  1VQJ A;  3D4D A;  1MBY A;  3S14 H;  1CQF A;  4DK6 C;  4QL5 A;  2JEA I;  4DR4 L;  3U4V A;  2BDN A;  1WVL A;  1PFN A;  2K5Q A;  1I4H A;  4PNY A;  4JI0 L;  2FJ2 A;  2VW9 A;  5M5Y B;  1CKN A;  4N9P A;  5C0X G;  2EYL A;  3PIP 3;  3MXU A;  1EY8 A;  3MVV A;  3ONA B;  5ELE A;  3IAY A;  3ULL A;  2LSS A;  1A2U A;  4BBR H;  1CFM A;  2EY6 A;  3OPO A;  3D6C A;  1V1Q A;  2E5L L;  4QGU A;  1JMC A;  1WI5 A;  2O5I C;  1DOM A;  3L3O C;  3I4L A;  3MWY W;  4R4C A;  4UDU C;  5IGD A;  1KD1 C;  1NUC A;  1YIJ A;  3RLO A;  1D5X C;  3CCV A;  3HOV H;  2WV6 D;  1P16 A;  2UXC Q;  4MIU A;  4KHP L;  1E2V A;  4YWL A;  3BJU A;  3I3C A;  5FLX c;  4DR3 L;  1VQ4 A;  2LXJ A;  2EQS A;  5F2D A;  3NBH A;  1PVO A;  3GD7 A;  2MO0 A;  3S2D H;  4JI7 Q;  4B3S Q;  5IGE A;  3H94 A;  4B3R Q;  1TWF B;  1II3 A;  4FF3 A;  3P1H A;  1UWV A;  5C0X I;  3CQZ H;  2VQE L;  3TS0 A;  4KV6 A;  5KGU A;  1CSQ A;  5COR A;  4JBM A;  1PMR A;  3BU2 A;  4NXN L;  3PO3 B;  3NEN A;  5T1I A;  1G2S A;  4IPG A;  3VA7 A;  5LL6 X;  2F0D A;  3KDF B;  4JI6 L;  4YHH L;  4C3J B;  4K0K Q;  2ZTE A;  1G91 A;  2CKZ B;  2F0N A;  3D4W A;  1EWI A;  4QB4 A;  3S14 B;  4HID A;  4OWT B;  5CYU A;  1UUP A;  5I2X A;  3VA5 A;  4NKL A;  3K5L A;  3R2T A;  1KC8 C;  1EU3 A;  3ICE A;  3KDF A;  4B9W A;  1QJO A;  3NPP A;  1HNX L;  2Y0S G;  3AFP A;  3FMC A;  1B9N A;  4L5S A;  1L1O B;  4A3J G;  4BBR B;  1DOK A;  3BDL A;  4HJ7 A;  2AWN A;  1Q90 A;  1AFP A;  1XPR A;  3W1B A;  2B8F A;  3I91 A;  1L1O C;  2WII B;  5IP7 H;  4YY3 L;  4AYB G;  5E1F A;  4CJ0 B;  2ENB A;  5CV8 A;  3T1Y Q;  4A3K H;  1J6Q A;  2KVM A;  4GN3 B;  4L6T B;  1TU2 B;  1PZI D;  1TS5 A;  2JA5 H;  1L1O A;  1X3G A;  2F0H A;  4L63 B;  3HOV B;  1FGU A;  4A3B H;  1EY6 A;  4G7Z C;  2VXW A;  3MAQ A;  1VQM A;  1I3Q H;  1YI2 A;  1B1Z A;  2VQF Q;  1S5C D;  2MNA A;  1J5E Q;  2E76 C;  2CFM A;  4TVA B;  1X3E A;  1E2Z A;  5CC4 A;  2F0F A;  1HR0 Q;  3CPW A;  3LGJ A;  3S2D B;  2B2V C;  2DJG C;  4BS9 A;  4L5R C;  1D5M C;  4MHE A;  1S40 A;  2P5Z X;  1VQF A;  3E6Z X;  2E2D C;  5C4H A;  2ZTD A;  3PIP A;  4A3F H;  4EQ5 A;  3CD6 A;  1SMX A;  3CQZ B;  4V0B A;  2UU9 L;  4ID6 A;  2KCC A;  1Z7T A;  4HMJ A;  5IT9 L;  2OTL A;  2F0L A;  1K73 C;  5CR3 A;  1TWC H;  3TSS A;  1LTT D;  3DEO A;  5C44 G;  3DUZ A;  3J81 i;  1Q1E A;  1ESF A;  3Q8D A;  1NAP A;  2F1M A;  1N8R C;  2JA8 G;  4H02 A;  1KDA A;  3QJY A;  4DUZ Q;  1LYL A;  1V1O A;  3LX0 A;  2K1B A;  1ZKO A;  4PQX A;  3T13 A;  2NVT H;  2CVR A;  3K5N A;  1LTG D;  4M8A A;  2E2I H;  3HKS A;  1U0L A;  5JJL A;  1QUQ B;  2I5L X;  4DR5 L;  1ASZ A;  1YNX A;  2KUM A;  3CCJ A;  1I94 L;  4JI3 Q;  3FEW X;  1EYA A;  2L12 A;  3OWE B;  3GO5 A;  2L11 A;  5IP9 G;  1FD7 D;  2YTV A;  4C3H G;  1F9Q A;  2YTY A;  3DM1 A;  4FVM A;  4A3K B;  4UY8 C;  4KJN A;  1SNM A;  4C56 C;  3CCL A;  3J7A F;  2JA5 B;  3ITP A;  5LMU Q;  4A3B B;  1XJV A;  3KBX A;  2HIX A;  1E7Z A;  3A54 A;  2JA6 G;  1I3Q B;  1Q3L A;  1RDP D;  3URY A;  1B3Q A;  1PYB A;  1ILP A;  2H1E A;  2WFW A;  2F0I A;  3CC2 A;  4LJZ C;  3T56 B;  2L9H A;  4PV1 C;  3I4N H;  4JPB W;  3NWS A;  5I2Y A;  2SNS A;  3DLL A;  4F7X A;  2MJ8 A;  1Q81 C;  2L5T A;  4LUV A;  4HCE A;  4QF4 A;  1BCP F;  4A3F B;  3T16 A;  5IGF A;  1SRO A;  3B6Y A;  4DU9 A;  4ZK9 B;  3U4Z A;  1VQN A;  3M7N A;  1G6Z A;  2I46 A;  1B44 D;  3F8T A;  3L2P A;  1H95 A;  4X3T A;  1B3A A;  3QG1 A;  2O2L D;  4KJO A;  1WTW A;  5M5X B;  1X9N A;  1TWC B;  5C3E H;  3A0J A;  4DV5 L;  3J80 L;  4DR1 L;  1PTO D;  1RCV D;  4ZYS A;  5AFW A;  1UNS A;  4LW1 A;  3H09 A;  2V4D A;  3L7Z C;  4KY6 A;  3RLN A;  2J4X A;  5ISR A;  3HG9 A;  1D7Q A;  2Q8T A;  3KF8 B;  5EPJ A;  3CCE A;  1HZA A;  1IBM Q;  3GTL H;  5CBE E;  1EYG A;  4APV A;  2CQA A;  3NWT A;  1VQK A;  1STG A;  4A3C H;  2E2I B;  1JC7 A;  3AU7 A;  4KKU A;  1Z47 A;  1A63 A;  4EQN A;  1L0W A;  3KF8 A;  3KJP A;  4OL7 A;  4NPS A;  1VQO A;  1PH9 A;  1G6P A;  2ES2 A;  1K0R A;  2JA9 A;  1F9S A;  3TP5 A;  1SYF A;  2JA8 H;  3NQI A;  2OT2 A;  1LO5 D;  3I90 A;  5KND A;  4YWM A;  4V19 0;  2UUA L;  1A8V A;  3DWQ A;  2ATW A;  1K8O A;  5D3D A;  3M4P A;  2ICE C;  5GAD C;  1D1K A;  2L0C A;  3I4N B;  1O78 A;  4JYA L;  1D2B A;  4Z9C B;  1H9R A;  5EPK A;  3TP7 A;  3O13 A;  5IP9 H;  1GHJ A;  3HOW G;  5ELC A;  3OYY A;  3PV0 A;  3QIA A;  5FO7 B;  1BBW A;  2B63 G;  2EIF A;  1SJE D;  2QEJ C;  4C3I H;  1NMG A;  3E3X A;  3HOZ G;  2JJQ A;  4EGV A;  2BE5 D;  1XWE A;  3GV6 A;  4JBJ A;  1XPO A;  1G29 1;  5C3E B;  2F3W A;  1PDQ A;  4G7H C;  2WKC A;  4JI4 L;  1L0Y B;  3EVQ A;  4BXX H;  2EZV A;  1BCP B;  3T1H L;  4R4O A;  1Y69 U;  4OIJ A;  1HNZ L;  1BCP C;  3GTL B;  5JPN C;  4YCW A;  2D0O A;  2A1A A;  2RBM A;  1JB7 A;  1LTA D;  5C4X G;  1VQ5 A;  2IPK D;  3NP8 A;  1K83 H;  5BN4 A;  2XIW A;  4DUY Q;  2UXD Q;  1I5F A;  1HH2 P;  3A8I E;  3SGI A;  5D14 A;  3NTH A;  3FVQ A;  3TN2 A;  1I6V C;  2AQ1 B;  2VUM G;  1KL9 A;  4EVO A;  5IY0 A;  2ID0 A;  1SYD A;  2BH8 A;  4N8X 1;  2X6L A;  1LM0 A;  4HIK A;  4OO1 H;  1L2F A;  5ELF A;  3S1N H;  3K59 A;  5GAG C;  2OQ0 A;  3HOY G;  2BCO A;  1OXT A;  3STB C;  1PXU A;  2VZA A;  4JV5 Q;  4CGY B;  1C0A A;  4H7B A;  2MUY A;  2JP1 A;  1YHQ A;  5J3B A;  2K05 A;  2EOT A;  1FNV A;  3S1R H;  5FLX E;  4XT1 B;  4FO2 A;  2E75 C;  2PNR C;  4HCS A;  1GUT A;  1UAP A;  2MO1 A;  1LTI D;  5IT9 c;  2CH4 W;  1VQB A;  2JA7 H;  2Q8R E;  1PH8 A;  3KOJ A;  1VQL A;  1G51 A;  1V8Q A;  2PW5 A;  1SFO H;  3MC0 B;  5C5L A;  1J8I A;  2OEO A;  1Y1W H;  4HIO A;  3D31 A;  2BA1 A;  4A3D G;  4C3I B;  1SNO A;  4KN4 C;  4F8M A;  2EYO A;  3EQL C;  1IBK Q;  2HIV A;  1HNW Q;  1AP0 A;  2NTT A;  1SEB D;  4BBS H;  4IAL A;  4WJ3 M;  4GNX B;  2RQX A;  4MNO A;  2PMZ E;  3GTP H;  5K36 H;  4GNX C;  3BZK A;  2EE1 A;  1N34 Q;  1SDF A;  2PO4 A;  3HFZ B;  3PIO 3;  4A3I G;  3R2I A;  4FF2 A;  1E1O A;  3PSI A;  4CDF C;  2KOL A;  2PW7 A;  4B3R L;  2NUC A;  5DLQ E;  4LF5 Q;  4BY7 H;  4XQJ A;  1IKL A;  3M9B A;  1JOK A;  5IIF A;  3C1E A;  5FJ8 G;  4XQN A;  5C3W A;  2CW0 C;  4A3L G;  1K83 B;  1LTB D;  4DGZ A;  1WFQ A;  4G4K A;  4FDB A;  4IUT A;  4CDD C;  3FKI G;  5CGK A;  1HQR D;  1IXR A;  2ZM6 L;  3VR6 A;  2A5H A;  5EJW A;  3NEM A;  3FDT A;  3CCR A;  2IL8 A;  2LMC B;  3C46 A;  3G6J B;  3S1N B;  4JI5 Q;  1ZEQ X;  2PMZ B;  2ZJR A;  5C4J H;  4R4T A;  1TQO A;  4JI1 Q;  1TWA H;  1VCI A;  2QF7 A;  3MEH A;  4FXG C;  5I9P A;  1VS0 A;  1HTP A;  1TWG H;  3NUC A;  4PZ8 A;  3S1R B;  3EA6 A;  3C1F A;  2TSS A;  1YHA A;  1STN A;  3PUV A;  3OTO L;  3PUZ A;  2HCC A;  3VYT A;  4A93 G;  1S5F D;  3L9A X;  5CV6 A;  5JEA J;  2JA7 B;  3T1Y L;  3PUX A;  4GN5 A;  4HTH A;  4I7A A;  1SFO B;  2A69 C;  3R3O A;  1Y1W B;  2WAC A;  4QUC A;  1VF5 C;  2UUC Q;  1U4M A;  1NMF A;  1YNJ C;  3CCM A;  5EAY A;  4GLV B;  4WOR A;  2MPM A;  4BBS B;  1QWY A;  1EOV A;  1R4P B;  3W3A A;  2VQF L;  2JXM B;  4LFB Q;  3GTJ H;  1X55 A;  3F2D A;  2PZT A;  3GTP B;  1LT5 D;  3UE0 A;  4PMW A;  3TZD A;  3GV3 A;  1PRT C;  1Y1V H;  1ET9 A;  2F0T A;  4HED A;  2F3I A;  3RN2 A;  3MZ5 A;  3A8K E;  2NWG A;  5EKI A;  1WCM G;  2IW3 A;  3TP8 A;  1XTC D;  2K32 A;  4XYQ A;  4BY7 B;  1KQS A;  2F0S A;  2HUG A;  2FMM A;  4OX9 Q;  4GKJ Q;  1V1P B;  5M3F G;  2DY7 A;  3IKJ A;  2K14 A;  1RHP A;  5DEH A;  4KD4 A;  3MFY A;  1NR4 A;  2I0Q A;  3OMG A;  1I50 H;  5FO8 B;  1VQI A;  5L37 A;  2KQ3 A;  3RN5 A;  2F0E A;  4X66 Q;  4LWC A;  2L55 A;  4ULL A;  1MGS A;  4QJF A;  4A76 A;  1K8A C;  2JN4 A;  4RMF A;  2KEE A;  2Z4H A;  4CHT B;  4DUZ L;  5C4J B;  1RTN A;  3MXN A;  1ESR A;  1TWA B;  4IPD A;  1TY0 A;  4QY7 A;  3TZU A;  3PF4 A;  3PIO A;  1F77 A;  1TWG B;  1DXM A;  5JEA G;  3KBG A;  1UE1 A;  3GTO H;  1IW7 D;  1IKM A;  4JI3 L;  5IYD H;  3Q24 A;  1B2T A;  2YYZ A;  3K58 A;  1BKB A;  1GOZ A;  1E24 A;  2BDO A;  2K04 A;  1EIY B;  4XYO A;  3CRL C;  1STH A;  4IPC A;  1MJE A;  2Q2I A;  1N32 Q;  1WTP A;  2DN8 A;  1ENF A;  2A6E D;  2RF4 A;  1YIT A;  1PA6 A;  2K5W A;  2KCM A;  1HA5 A;  3J81 c;  3QWN A;  5LMU L;  1S5B D;  4RAU C;  3H3V H;  1GUS A;  2AQ3 B;  2QDL A;  5FK9 C;  1JWS D;  3GTJ B;  4OEL B;  2F0K A;  1IW7 C;  1SLJ A;  1CKO A;  3HOX G;  4A3M H;  4OGQ C;  5FLM G;  2DJF C;  1Y1V B;  2F4V Q;  5C5M A;  1JQY D;  1STY A;  1V9P A;  1ML0 D;  2IX3 A;  1UE6 A;  5I4D A;  3K5O A;  4UPA A;  4X3S A;  5KYI A;  3W2D A;  4KHV A;  4XTC S;  2NBF A;  3NQT A;  3MFG A;  3NBI A;  3X3M A;  1GM5 A;  5D3I B;  4DV1 Q;  1TT2 A;  2K52 A;  4POF A;  1C7Y A;  2E2H H;  3PMF A;  3F2C A;  1WTQ A;  1HXY D;  4HJ8 A;  4LF7 L;  2RDF A;  3G6E A;  1I50 B;  2B8G A;  3FP9 A;  2OCE A;  4CDC C;  5ELD A;  5KIX A;  2R61 A;  4DA2 A;  4LNQ A;  2UXB Q;  3E5S A;  2GVA A;  3JAM L;  2XGT A;  4DNT B;  3J80 i;  1H9K A;  4ZUI A;  4ME5 A;  3K80 C;  2FHT A;  4RWS C;  1A15 A;  2RHQ B;  1IZ6 A;  1XYI A;  3V05 A;  1XMO Q;  1RJT A;  3GTO B;  5IWA L;  4YWK A;  1ZXT A;  3A55 A;  2A73 B;  1Q1B A;  2ALY B;  2F03 A;  3I4M G;  1VF7 A;  1M90 C;  1W3S A;  4P73 A;  3Q22 A;  3L0O A;  1N9W A;  2HHH Q;  4DR2 Q;  4JC0 A;  1BDO A;  4K2L A;  4DV4 L;  4ZQ3 A;  3I70 A;  5J22 A;  2RDH A;  1GUW A;  1DGS A;  2LFN A;  1XNR Q;  1WOC A;  1O7Z A;  1OXU A;  1HZ9 A;  3RR5 A;  1E2W A;  1MSH A;  2HCI A;  1CM9 A;  1Y8P B;  4DV0 Q;  4XXE A;  1NY4 A;  2G5D A;  2Q2T A;  4LF6 Q;  1CHQ D;  3BG3 A;  2RKS A;  3HKZ G;  4HIM A;  1R9T H;  4A3M B;  2K03 A;  4K5W A;  1LAB A;  1KRS A;  3SK4 A;  3CCU A;  2EY2 A;  4Q5V A;  2CWA A;  1YNN D;  2PZW A;  1VQA A;  2OQK A;  4CDE C;  1PH3 A;  1LTR D;  5C0X H;  2XSC A;  2ICI A;  4IUP A;  3G4S A;  1RKN A;  4ZAI A;  4IPH A;  2VY3 A;  4DNI A;  4K5V A;  4IUN A;  2O5J C;  3TS2 A;  4AQY Q;  1TS3 A;  1U5K A;  2E2H B;  3BVZ A;  3SHL A;  4LK1 C;  5LMN Q;  1LV9 A;  5EBD A;  4IUU A;  2B2V A;  2V1C C;  4EX5 A;  1ZYR D;  1N33 Q;  3LNN A;  1CK1 A;  4BY1 G;  3KFU A;  3VR4 A;  3D4R A;  3UE1 A;  3CME A;  4IOC A;  2BA0 A;  1IHZ A;  4RGM A;  2O4X A;  2PYK A;  1FNU A;  1PTO F;  4BWG B;  4RHR A;  2IX0 A;  1QIL A;  4CKC A;  2LS0 1;  2UXD L;  4M1U B;  4X62 Q;  3KYH C;  4QMG A;  2NZO A;  4B3M L;  1TR5 A;  2CHB D;  4POG A;  3E9I A;  1HA6 A;  5HGQ A;  2F0J A;  4X64 Q;  2Z0S A;  1OXX K;  5I6W A;  1VQ9 A;  5IT9 E;  4LUO A;  2NVX H;  1BF4 A;  3H0G G;  2EY5 A;  4DAV A;  4LF4 Q;  1FJG L;  2ZJQ A;  4IUR A;  3FPP A;  1SYG A;  1I4X A;  1ICF B;  1PTO H;  1SE3 A;  3I4O A;  2N78 A;  4IOA A;  1AEX A;  2JYO A;  1MD2 D;  2JEB I;  4IUQ A;  2PI2 E;  1QUQ A;  1YBY A;  3UI2 A;  2XWJ B;  2FXQ A;  1A3V A;  1D6E C;  1EYC A;  3IFD A;  1R9T B;  2DUD A;  1TII D;  1EY7 A;  1XMQ Q;  4HR7 B;  3BZC A;  2AMC B;  2IHE A;  2XRQ D;  4OON A;  5M3M G;  3I4M H;  1O7Y A;  1S4Z A;  3G71 A;  1I4G A;  1STA A;  3DEP A;  2DGY A;  5KEE A;  1VQG A;  3DWA A;  1HFN A;  5JAV A;  4A3J H;  3K0X A;  2CQO A;  3D6W A;  3FRP B;  4J6H A;  3CKI B;  4NMZ A;  1O7I A;  4QQB X;  1SJH D;  2MFI A;  2PZU A;  4XDX A;  1N34 L;  1FGB D;  1RIP A;  3RLF A;  1JIC A;  5E4X A;  4GLX A;  2QW7 A;  3V2T A;  4NXM L;  3CC4 A;  1A3T A;  1A0I A;  2KED A;  4LAA A;  1LT3 D;  2PCF B;  4JI8 Q;  3K81 C;  4JI2 L;  1A62 A;  3ZYY X;  3K6O A;  5JJI A;  1TS2 A;  1KAW A;  3KF6 B;  2PI2 A;  2NZH A;  4FNF A;  1EUJ A;  2WAQ G;  2Y0S E;  3FHW A;  3GP7 A;  3SE0 A;  4A3E G;  2JK8 A;  4TRD A;  4DV7 Q;  2HD3 A;  2VB3 X;  2NYZ D;  2NVT B;  2NVX B;  1B4O A;  1EY0 A;  3WOF A;  1OTC A;  4K2K A;  4KY7 A;  4AYB E;  4FXD A;  3UDF A;  3PUY A;  1JE4 A;  4JI5 L;  1G8Z D;  1PTO B;  1SYC A;  3T53 B;  4FXK C;  1FNW A;  4JI1 L;  3CXC A;  2K7V A;  2CCZ A;  2K4K A;  1PTO C;  4RCN A;  5C44 H;  1KAA A;  2QIL A;  1XX8 A;  4NXN Q;  3HGB A;  3GTG H;  1FR3 A;  2R93 G;  1JWU D;  3U9O A;  5AJ3 L;  2NB0 A;  1O80 A;  2B2W C;  1N36 L;  4JI6 Q;  1GUO A;  4YHH Q;  1F2L A;  3W5O A;  3Q0A A;  1PFM A;  3I4M B;  4HAE A;  2B2W A;  3K8A A;  1OXS C;  2F0M A;  5J1Z A;  3IL8 A;  2Y0S B;  4A3J B;  4GKK Q;  2IHF A;  4R8N A;  1X3Q A;  1HNX Q;  4JBW A;  3OW7 A;  4LFB L;  4ZRZ A;  4LF8 L;  1YJ9 A;  2KEC A;  4AYB B;  4C3H H;  4KD3 A;  1M8A A;  4PZ6 A;  4YY3 Q;  3NTK A;  4RG1 A;  5FO9 B;  1LTL A;  3NK9 A;  2D2C C;  1WTH A;  2N8N A;  1NE3 A;  4CKB A;  2F52 A;  4K6L A;  2JA6 H;  3ULJ A;  3DWP A;  5M3M H;  1VMP A;  3NTI A;  1M4V A;  4JOI C;  2DNC A;  2WB1 G;  2L4N A;  3HS0 C;  3I72 A;  5IOC A;  4OX9 L;  4R1J A;  4PMC A;  2KHI A;  1HRJ A;  1ENC A;  1EYD A;  1ICW A;  4A4I A;  5COY A;  4KKT A;  1WTV A;  4ZKB B;  4MN3 A;  2M9V A;  1PLF A;  5CMD A;  4IFD J;  3PUW A;  4X66 L;  5IOD A;  4UP9 A;  3I2Z A;  3P20 A;  2A68 D;  2R7Z G;  2B2T C;  4JCV E;  1QVG A;  1ILQ A;  2BE5 C;  5IYB G;  3LWU A;  1Q86 C;  4A3G G;  1MHW C;  3J81 E;  1EL0 A;  5EBC A;  3HOU G;  2WKD A;  1KTK A;  5GQO A;  3J7A 5;  5CV5 A;  2AKW B;  5C44 B;  2B2T A;  2NZ1 D;  4DR6 L;  4WJ4 A;  1KIX A;  3GTG B;  1EWH A;  1RTO A;  4KHZ A;  4O0A A;  1ONL A;  5CV7 A;  3EFX D;  2UUB L;  4PZ7 A;  4J8Q A;  2JA8 B;  2HDL A;  1ENA A;  1GD7 A;  3PO2 G;  4X65 Q;  3AEV A;  4FF4 A;  1D8L A;  1H9J A;  1Q82 C;  3SK8 A;  5IGG A;  3IFT A;  2NN6 G;  3TP6 A;  2SNM A;  2IX1 A;  1A2T A;  1HPC A;  4RHS A;  1YJN A;  3RZD H;  4KY5 A;  3TQY A;  1EZ6 A;  5M5W H;  2EXZ A;  1LLR D;  4E6I A;  1I94 Q;  5EPL A;  2AWO A;  3CP0 A;  4C3H B;  1EQR A;  1HFG A;  1UEB A;  2F0O A;  4HMI A;  3H15 A;  1BBX C;  1DON A;  1EY5 A;  3GQB A;  1BO0 A;  3RUZ A;  2F4V L;  4NW2 A;  2UXC L;  2JA6 B;  5M3M B;  5CV9 A;  4NP5 A;  2RHS B;  4ZCK A;  3UDI A;  4A75 A;  5I6Y A;  4DV1 L;  3VYU A;  4JI7 L;  3KK7 A;  3A5U A;  4B3S L;  4IFD G;  1AW7 A;  5A35 A;  1SMY D;  4GNX A;  4J1M A;  4F87 A;  3E9H A;  1TWH H;  3HOW H;  4PMB A;  2NN6 I;  2OF1 A;  4XIG S;  2B63 H;  5CBA E;  1X3F A;  5NUC A;  1U4L A;  1X6O A;  2H5X A;  4LFC Q;  2UXB L;  2A6H D;  3HOZ H;  1KRT A;  3BYT B;  1IL2 A;  1BQQ T;  1EEI D;  1K28 A;  1XNQ Q;  2AUK A;  2VB2 X;  4Q0F A;  5HUR A;  4C2M H;  3PO3 G;  4DR7 Q;  4UP8 A;  4DV5 Q;  1T9H A;  2F0G A;  3HZX A;  4K0K L;  4DR1 Q;  3HRZ C;  1SE2 A;  3JAM i;  4C3J G;  3U58 A;  1CA6 A;  1AZP A;  5FOB B;  4UP7 A;  3E0E A;  1LT6 D;  5C4X H;  2HHH L;  4DR2 L;  1E0B A;  1D1I A;  3A8J E;  5ELN A;  2GN5 A;  3RZD B;  3HP3 A;  4FF1 A;  5C3X A;  4IFD I;  1IYU A;  3CMA A;  1RD9 D;  1FL0 A;  2EJF C;  4DV2 Q;  5M5W B;  1TXY A;  1XNR L;  1F9P A;  2VUM H;  1X54 A;  1RL2 A;  1E3P A;  2RSO A;  2IY5 B;  5IE8 A;  1KLG D;  2DY8 A;  3J80 c;  2C5C A;  2R7F A;  4LF6 L;  4L8J A;  2B3G A;  3BYY B;  3HOY H;  1X3P A;  1IBL Q;  3HOV G;  2QDB A;  2PQE A;  3TRZ A;  2Q2H A;  4TSS A;  1Z6H A;  2N88 A;  3GTQ H;  3A5Z B;  4U67 3;  1J5E L;  1NTG A;  1NBW A;  2UUA Q;  3TEH B;  5A2Q L;  2C35 B;  4KKS A;  4HJ5 A;  1HR0 L;  3AMU A;  2GA4 B;  4X6A H;  1Y8O B;  1H9M A;  3M4Q A;  1CUK A;  1K9M C;  2Z1C A;  1CHP D;  4AQY L;  3EIV A;  1A3U A;  3X3N A;  1PFB A;  1GJX A;  1TWH B;  2YV5 A;  4ODG A;  5LMN L;  3HOW B;  3KLR A;  3NEL A;  2N3S A;  5JOB A;  3J7A V;  1SYE A;  4YIJ A;  3U50 C;  2B63 B;  4G57 A;  3DMU A;  5H1S E;  5EKL A;  4A3D H;  1WYD A;  3CF5 A;  2JSO A;  2A8V A;  3ERQ A;  3HOZ B;  5JJK A;  4LUZ A;  2LXK A;  1GUN A;  2F0U A;  1JT8 A;  1CA5 A;  5KYL A;  4C2M B;  3N6R A;  3I73 A;  4OHJ A;  5CV4 A;  3BZD B;  3EBE A;  4LFA Q;  5DAU A;  1EY9 A;  1V1P A;  1CZG A;  5E3F A;  4A3I H;  1BNZ A;  3SEB A;  4DF7 A;  1C4Q A;  4ZKC B;  3M4Y A;  1PH5 A;  3SK6 A;  4RKL A;  5KNB A;  4QIW E;  4K14 A;  1SNQ A;  4J15 A;  3P7J A;  2PPB C;  2F3V A;  5C4X B;  1JOR A;  4B08 A;  2F0P A;  1QZH A;  5FJ8 H;  4B3T Q;  4A3L H;  1LUZ A;  3S17 H;  1JR0 D;  4DK1 A;  4DV6 Q;  3JC6 6;  2K5H A;  1VQH A;  3I7F A;  2X6G A;  2FFK B;  3FKI H;  2VUM B;  1WJJ A;  1W6K A;  5C4Z A;  1BUV T;  4O42 A;  5IP7 G;  1Q8I A;  3UDX A;  1ET6 A;  3K7A H;  4IJL A;  1I4Q A;  1WTR A;  2DNE A;  4A3K G;  3R8B A;  4ME3 A;  4UAI A;  1Q8K A;  2XN9 C;  1XMQ L;  2JA5 G;  2CH4 A;  3HOY B;  2I5H A;  1X56 A;  4A3B G;  2JQO A;  2ZTC A;  4KMU C;  1AE2 A;  1I4P A;  2NVY H;  3GTQ B;  3VR5 A;  3MEF A;  3NE5 B;  3U9S A;  2B29 A;  4Y7N H;  2M2L A;  3SDZ A;  1BOS A;  2FIN B;  4XT3 B;  1JE5 A;  1QVC A;  5KNC A;  4QIW B;  4LF9 Q;  4A93 H;  1AE3 A;  5JPM C;  4JVZ A;  2N55 A;  3I55 A;  2GVB A;  3AB9 A;  4KN7 C;  3DHQ A;  2A6E C;  4DAP A;  3CHB D;  2G9H D;  2VL6 A;  4A3F G;  1PYW D;  1SE8 A;  4WJW A;  2BH2 A;  4A3D B;  3GTM H;  3NBH B;  5I9O A;  3ERO A;  1QB5 D;  1EFW A;  4JI8 L;  2RVL A;  1EY4 A;  1KAB A;  2RCF A;  1CT1 D;  1NNX A;  1WTX A;  1VDZ A;  3NXW A;  4A3I B;  3MXP A;  1EQQ A;  1UE5 A;  1IBM L;  1WCM H;  3A74 A;  3CAM A;  5LHY 1;  2A74 C;  3T4A C;  4DV7 L;  2YU9 H;  2ZJP A;  2OTJ A;  1CZW A;  1QNU A;  3C3L A;  4HJ9 A;  5GAE C;  4ZUJ A;  5M9O A;  5M3F H;  2WP8 J;  2KEN A;  2AHO B;  4DAM A;  2K33 A;  3S17 B;  3SR1 A;  3OMC A;  1JCK B;  2TMP A;  3D3R A;  5J39 A;  3K57 A;  2OXP A;  4RGT A;  2RSN A;  3FKI B;  1HTL D;  4S3S A;  4L5Q A;  1PV4 A;  1AN8 A;  3JAM E;  1PZJ D;  2SEB D;  1V43 A;  3EJI A;  1PH4 A;  3K7A B;  2ZM6 Q;  2HT1 A;  3S1Q H;  2EJM A;  2KHJ A;  4ABN A;  3R93 A;  1SSO A;  2HQL A;  3N52 A;  5EQ0 A;  3M7G A;  5GAH C;  1ASY A;  2EYH A;  2NVY B;  1MIU A;  1VQD A;  4R4I A;  1SE4 A;  3H3V C;  3F2U A;  5JEA H;  1TY2 A;  4Y7N B;  2CWP A;  4GKK L;  2IWH A;  1NSN S;  1X65 A;  1PYS B;  3I4N G;  4A93 B;  3TBI B;  1SNC A;  4QUF A;  3Q6S A;  3OTO Q;  5TSS A;  1B9M A;  3NSW A;  3T51 B;  1NCV A;  3S24 A;  3AFQ A;  1QZG A;  5IGC A;  1YVC A;  3M3Y H;  5DM7 3;  3FPU B;  1WD1 A;  1Y14 B;  3GTM B;  2QEX A;  1HUN A;  2I07 B;  1IL8 A;  4B9X A;  2M00 A;  4DXG A;  4HSP A;  3D8G A;  1PFS A;  1EIF A;  2K5V A;  5C3E G;  4IQZ A;  5LL6 S;  3HOX H;  1CQV A;  4IUV A;  5FLM H;  4RCO A;  3GTK H;  3W1G A;  1NJI C;  5BN3 A;  1IYV A;  1YNN C;  1JJC B;  1WCM B;  1Y8N B;  4I7Z C;  1YEZ A;  2K5N A;  3ERS X;  3S15 H;  3RZO H;  2YU9 B;  3ZJY C;  3SVM A;  1U4R A;  4YCU A;  1LTS D;  2K50 A;  5ELB A;  2ZXR A;  4A3C G;  3QO2 A;  4DUY L;  1SND A;  3DXJ C;  5M3F B;  1MJC A;  4DV3 Q;  1EU4 A;  4FYD A;  4MZ9 A;  4G7O C;  5M5X H;  1U9R A;  2Z6B A;  1ZYR C;  1TVX A;  4IO9 A;  1A6X A;  1FYC A;  3BS1 A;  1HUM A;  3AQQ A;  3QOL A;  3S1Q B;  3I8Z A;  3MHB A;  1HCZ A;  4P75 A;  4X65 L;  2N49 A;  5EGT A;  1QVF A;  5IYD G;  1Q7Y C;  4JV5 L;  3BVG A;  1KDC A;  4ALP A;  4K5X A;  1E22 A;  3BDO A;  5BR8 Q;  1JB3 A;  4PG3 A;  4X3U A;  3QR8 A;  1DOL A;  5C6A A;  3LWE A;  1STE A;  1EQV A;  1GUG A;  4DR4 Q;  4JI0 Q;  2EYF A;  4EQO A;  2F0Q A;  1L0X B;  1S3O A;  3UDG A;  3A7L A;  2RA4 A;  5G3L F;  1IBK L;  1GO3 E;  1HNW L;  3M3Y B;  4R9W A;  1SBB B;  4C3I G;  3VR3 A;  4HN7 A;  2WIN B;  4DK0 A;  2RCN A;  3OHX C;  4AH6 A;  1KNE A;  4R4Q A;  2E5L Q;  5DM6 3;  3V96 A;  3QB3 A;  3TRE A;  1SAP A;  3A7A B;  1HZC A;  3VYS A;  2J7Z A;  2Z9H A;  2EYP A;  2R7D A;  3HOX B;  3C2P A;  1K3B C;  1I6H H;  4BXX G;  1SRU A;  3GTK B;  3MXG A;  2R92 G;  1LAC A;  2BOS A;  2EY1 A;  4LF5 L;  3S15 B;  1NR2 A;  4P71 A;  4BA1 I;  3OOC A;  3RZO B;  3S1M H;  4KHP Q;  4GN4 B;  2MGS A;  1EEF D;  4LFC L;  4DR3 Q;  3VDY A;  1UEA B;  4BA2 I;  1U4P A;  1PH7 A;  2ZXO A;  2C9O A;  2LKV A;  1XNQ L;  3CC7 A;  4WFN 3;  2I5M X;  3MTS A;  3OIP A;  1KNA A;  2ZXP A;  1HJP A;  4P72 A;  3KLS A;  2D5D A;  2F0V A;  3PQI A;  4KLK A;  2QA4 A;  4DR7 L;  1OXV A;  4LF7 Q;  1HZB A;  1MSG A;  3KJO A;  2VQE Q;  4BY1 H;  3KF6 A;  3J80 E;  2SOB A;  3WDN A;  1QG7 A;  4OO1 G;  1PHJ A;  3D0F A;  3HKZ E;  1C48 A;  4CJ1 B;  2EDG A;  4CJ2 C;  3M4O H;  4P2C B;  3PGZ A;  4DV2 L;  1T5X D;  2MHV A;  5IWA Q;  3NHH A;  4I65 A;  2XRS D;  2EVB A;  2L15 A;  1P8L A;  3TME A;  5ELO A;  3VR2 A;  5JVH 3;  4H0L C;  2XWB B;  5IYC G;  2JA7 G;  3H0G H;  5G3L D;  2HDM A;  2XVS A;  2B39 A;  4ZLT F;  2UUC L;  3S2H H;  1AH9 A;  3SXH A;  1YHB A;  1Y1W G;  4JK1 C;  1BBU A;  2E2J H;  1IBL L;  4H13 C;  1DM0 B;  4DV4 Q;  2B2U C;  4RFB A;  3JAM c;  1B70 B;  4HSV A;  3BDC A;  4BBS G;  3OWF A;  3F1Z A;  4NDX A;  1PH1 A;  1S5D D;  4OEM B;  5HGT A;  4GLA C;  5GRO A;  5K36 G;  3G48 A;  1XPU A;  3HKZ B;  2K28 A;  2B2U A;  2EXD A;  2H4O A;  1I6H B;  4OO1 I;  1BXT A;  4DNR B;  4OIK A;  2RDG A;  1YJW A;  4P74 A;  4ILW A;  5JJZ A;  2ASB A;  3S1M B;  1BCP D;  3OIQ A;  4F88 A;  4GKJ L;  2X69 A;  4BY7 G;  3CU7 A;  1SXT A;  4GOP B;  4JOI A;  1CKM A;  3F2B A;  4L5T A;  4GOP C;  2K01 A;  4K6D A;  4LMQ D;  4KI0 A;  1GKH A;  3J7Z C;  1ROD A;  2J0T D;  4LFA L;  2D62 A;  2PQA B;  4OWW B;  1EZ8 A;  3OW2 A;  1GVP A;  1TS4 A;  4GOP A;  1HHV A;  1F9R A;  1RF2 D;  3J81 L;  2UU9 Q;  4BY1 B;  2IJ0 A;  5IGB A;  1AZQ A;  2R92 H;  1XXG A;  4EQP A;  3H6M A;  3WOE A;  4QCL A;  3STB D;  3CW2 C;  2PQA A;  4B3T L;  1VQ6 A;  1H9S B;  1VQ8 A;  3M4O B;  4X3K A;  5D65 A;  4K8I A;  1D5Z C;  5JVG 3;  1PH2 A;  3ULP A;  1KXL A;  5E4W C;  1QCB D;  3ND8 A;  4DV6 L;  4JG2 A;  3OSO A;  4A3E H;  1JOQ A;  3CPF A;  3E0J A;  4TKO B;  4B3M Q;  1N32 L;  5FLX L;  3EN2 A;  1EIG A;  1F2M A;  2F4I A;  3M85 A;  3RNU A;  2Q2U A;  1H9S A;  3H0G B;  2A68 C;  1B53 A;  5BN5 A;  3PF5 A;  3K7U C;  3S2H B;  1YZ6 A;  4DR5 Q;  4CKE A;  1FJG Q;  2E2J B;  1DJR D;  1LT4 D;  1FVI A;  3MA2 B;  4YCV A;  2JE6 I;  4DN4 M;  2R93 H;  4KK7 A;  2NVQ H;  4WRD A;  1B8A A;  3BVM A;  3GDE A;  1HR0 W;  3SK5 A;  4OWX B;  4LF9 L;  1BR9 A;  2B2Y C;  3P75 A;  1Y1V G;  4MTN A;  2L1B A;  1PRT F;  1CI3 M;  2QCP X;  2YTX A;  3G7L A;  4DPG A;  5LMN W;  5IYC H;  2F0W A;  4GZY C;  2WAQ E;  1XTD A;  1B50 A;  1GHK A;  4DK3 C;  2B2Y A;  1TKW B;  1M1K C;  4H44 C;  4JBK A;  1W6J A;  2K6A A;  5E7N A;  5FKA C;  4RGO S;  2XNA C;  1KHI A;  2Z4I A;  2AUJ D;  3ER0 A;  2R6G A;  2HQE A;  4RH6 A;  3DM3 A;  1OO9 B;  2CW0 D;  1JWM D;  1STB A;  1SYB A;  1BVS A;  2QKI C;  1GXD C;  1WD0 A;  4O2D A;  5KRU A;  1CSP A;  3HEJ A;  1K8M A;  1K0S A;  1B7Y B;  2KHS A;  2R92 B;  1QNK A;  3K5M A;  4N8F A;  2AQ2 B;  1Q12 A;  4NXM Q;  3S9W A;  1XMO L;  4C1N I;  1Z9F A;  2KA7 A;  4C1N K;  4JI2 Q;  5DNF A;  1SMY C;  3KLW A;  2KJX A;  2R3Z A;  2SDF A; 
#chains in the Genus database with same CATH homology
 2WAQ B;  4A3E B;  1F2Z A;  2K5D A;  1DD2 A;  3RMH A;  1F2Y A;  1EFI D;  1PZK D;  1O7L A;  1WTO A;  1CTM A;  1I4R A;  5T1G A;  2A6H C;  1QE6 A;  1R4Q B;  2A69 D;  2Q8I B;  2MP1 A;  4U68 A;  1EIH A;  1S5E D;  4DFA A;  1YNJ D;  2IT1 A;  2VNU D;  3Q23 A;  2R93 B;  2NVQ B;  3H91 A;  1KLU D;  3K0Y A;  2NTS A;  1PRT D;  3KLS X;  4TQU S;  1DZ1 A;  2NN6 H;  4KTA A;  2G9D A;  1G2T A;  4RA8 A;  4K8J A;  1JOO A;  4DXF A;  2EYM A;  1HQM C;  3A56 A;  4RKB A;  5C0X J;  5EKK A;  2D9U A;  1J9O A;  3KUP A;  2EJG C;  1PRT B;  3ND9 A;  2Z8L A;  1DYQ A;  2LY7 A;  5A2Q E;  1EWC A;  1VMC A;  1QOH A;  4FP5 D;  4O1N A;  2WB1 B;  4IZ8 A;  2FMC A;  4IFD H;  3RD4 A;  4R8I A;  2E74 C;  1MI2 A;  3VYR A;  3S16 B;  4DAY A;  1EQT A;  3J7Y W;  2R7Z B;  1SNP A;  2EYJ A;  4N9T A;  2EPB A;  2ZT9 C;  4A3G B;  1X32 A;  1DCZ A;  4IN3 A;  4RGN A;  3HOU B;  4CBV A;  3TDQ A;  1T5E A;  1C8C A;  4XQQ A;  5K5P A;  2KCN A;  3CRK C;  1EOT A;  3PO2 B;  1KDB A;  3QOJ A;  3D4D A;  1MBY A;  1CQF A;  2JEA I;  2BDN A;  1WVL A;  1PFN A;  2K5Q A;  1I4H A;  4PNY A;  2FJ2 A;  5M5Y B;  4N9P A;  5C0X G;  2EYL A;  3PIP 3;  3MXU A;  1EY8 A;  3MVV A;  3ONA B;  5ELE A;  3IAY A;  1A2U A;  1CFM A;  2EY6 A;  3OPO A;  3D6C A;  2O5I C;  1DOM A;  3L3O C;  3I4L A;  3MWY W;  4UDU C;  5IGD A;  1NUC A;  1D5X C;  2WV6 D;  4MIU A;  1E2V A;  3I3C A;  5F2D A;  3NBH A;  3GD7 A;  5IGE A;  3H94 A;  1TWF B;  1II3 A;  4FF3 A;  3P1H A;  5C0X I;  4KV6 A;  5KGU A;  5COR A;  1PMR A;  3PO3 B;  5T1I A;  1G2S A;  3VA7 A;  5LL6 X;  2F0D A;  4C3J B;  1G91 A;  2F0N A;  3D4W A;  4QB4 A;  3S14 B;  5CYU A;  1UUP A;  5I2X A;  3VA5 A;  4NKL A;  3K5L A;  3R2T A;  1EU3 A;  4B9W A;  1QJO A;  3NPP A;  3FMC A;  1B9N A;  4BBR B;  1DOK A;  3BDL A;  2AWN A;  1Q90 A;  1AFP A;  2B8F A;  3I91 A;  2WII B;  5E1F A;  4CJ0 B;  2ENB A;  5CV8 A;  2KVM A;  4L6T B;  1TU2 B;  1PZI D;  1TS5 A;  2F0H A;  4L63 B;  3HOV B;  1EY6 A;  4G7Z C;  2VXW A;  3MAQ A;  1B1Z A;  1S5C D;  2E76 C;  1E2Z A;  5CC4 A;  2F0F A;  3S2D B;  2B2V C;  4BS9 A;  1D5M C;  4MHE A;  3E6Z X;  2E2D C;  5C4H A;  3CQZ B;  4V0B A;  4ID6 A;  2KCC A;  1Z7T A;  4HMJ A;  5IT9 L;  2F0L A;  5CR3 A;  3TSS A;  1LTT D;  3DEO A;  3DUZ A;  1Q1E A;  1ESF A;  1NAP A;  2F1M A;  1KDA A;  3QJY A;  1V1O A;  3LX0 A;  2K1B A;  1ZKO A;  4PQX A;  3T13 A;  2CVR A;  3K5N A;  1LTG D;  4M8A A;  2KUM A;  3FEW X;  1EYA A;  2L12 A;  3OWE B;  3GO5 A;  2L11 A;  1FD7 D;  4C3H G;  1F9Q A;  3DM1 A;  4FVM A;  4A3K B;  4KJN A;  1SNM A;  4C56 C;  3J7A F;  2JA5 B;  3ITP A;  4A3B B;  3KBX A;  3A54 A;  1I3Q B;  1Q3L A;  1RDP D;  3URY A;  1ILP A;  2H1E A;  2F0I A;  4LJZ C;  3T56 B;  2L9H A;  4PV1 C;  5I2Y A;  3NWS A;  2SNS A;  4F7X A;  2MJ8 A;  2L5T A;  4HCE A;  4QF4 A;  1BCP F;  4A3F B;  3T16 A;  5IGF A;  4DU9 A;  4ZK9 B;  3M7N A;  1G6Z A;  2I46 A;  1B44 D;  4X3T A;  1B3A A;  3QG1 A;  2O2L D;  4KJO A;  1WTW A;  5M5X B;  1TWC B;  3J80 L;  1PTO D;  1RCV D;  4ZYS A;  5AFW A;  1UNS A;  3H09 A;  2V4D A;  3L7Z C;  4KY6 A;  2J4X A;  5ISR A;  3HG9 A;  2Q8T A;  5EPJ A;  5CBE E;  2CQA A;  3NWT A;  1STG A;  2E2I B;  1JC7 A;  3AU7 A;  4KKU A;  1Z47 A;  4EQN A;  3KF8 A;  4OL7 A;  1F9S A;  3TP5 A;  1SYF A;  3NQI A;  2OT2 A;  1LO5 D;  3I90 A;  5KND A;  4V19 0;  3DWQ A;  1K8O A;  5D3D A;  2ICE C;  1D1K A;  2L0C A;  3I4N B;  1O78 A;  1D2B A;  4Z9C B;  1H9R A;  5EPK A;  3TP7 A;  3O13 A;  1GHJ A;  5ELC A;  3PV0 A;  3QIA A;  5FO7 B;  1SJE D;  2QEJ C;  4EGV A;  2BE5 D;  1XWE A;  3GV6 A;  1G29 1;  5C3E B;  2F3W A;  1PDQ A;  4G7H C;  2WKC A;  1L0Y B;  3EVQ A;  2EZV A;  1BCP B;  1Y69 U;  4OIJ A;  1BCP C;  3GTL B;  5JPN C;  2RBM A;  1LTA D;  2IPK D;  3NP8 A;  5BN4 A;  2XIW A;  3A8I E;  5D14 A;  3NTH A;  3FVQ A;  3TN2 A;  1I6V C;  2AQ1 B;  4EVO A;  2ID0 A;  1SYD A;  2X6L A;  4OO1 H;  5ELF A;  3K59 A;  2BCO A;  1OXT A;  1PXU A;  4CGY B;  4H7B A;  2MUY A;  2JP1 A;  2K05 A;  2EOT A;  1FNV A;  5FLX E;  4XT1 B;  4FO2 A;  2E75 C;  2PNR C;  4HCS A;  1GUT A;  1UAP A;  1LTI D;  2Q8R E;  1V8Q A;  2PW5 A;  3MC0 B;  5C5L A;  1J8I A;  2OEO A;  3D31 A;  2BA1 A;  4C3I B;  1SNO A;  4KN4 C;  4F8M A;  2EYO A;  3EQL C;  1AP0 A;  2NTT A;  1SEB D;  4IAL A;  2RQX A;  5K36 H;  2EE1 A;  1SDF A;  2PO4 A;  3PIO 3;  4FF2 A;  3R2I A;  2KOL A;  2PW7 A;  2NUC A;  4XQJ A;  1IKL A;  1JOK A;  5IIF A;  3C1E A;  4XQN A;  5C3W A;  2CW0 C;  1K83 B;  1LTB D;  4DGZ A;  4G4K A;  4IUT A;  5CGK A;  1HQR D;  3VR6 A;  2A5H A;  5EJW A;  3FDT A;  2IL8 A;  2LMC B;  3C46 A;  3G6J B;  3S1N B;  1ZEQ X;  2PMZ B;  1TQO A;  5I9P A;  1VCI A;  2QF7 A;  3MEH A;  4FXG C;  1HTP A;  3NUC A;  3S1R B;  3EA6 A;  3C1F A;  2TSS A;  1STN A;  3PUV A;  3PUZ A;  2HCC A;  3VYT A;  1S5F D;  3L9A X;  5CV6 A;  5JEA J;  2JA7 B;  3PUX A;  4HTH A;  1SFO B;  2A69 C;  3R3O A;  1Y1W B;  2WAC A;  4QUC A;  1VF5 C;  1U4M A;  1YNJ C;  4WOR A;  2MPM A;  4BBS B;  1QWY A;  1R4P B;  3W3A A;  2JXM B;  2PZT A;  3GTP B;  1LT5 D;  4PMW A;  3TZD A;  3GV3 A;  1PRT C;  1ET9 A;  2F0T A;  4HED A;  3MZ5 A;  3A8K E;  2NWG A;  5EKI A;  2IW3 A;  3TP8 A;  1XTC D;  2K32 A;  4XYQ A;  4BY7 B;  2F0S A;  2HUG A;  2FMM A;  1V1P B;  2DY7 A;  3IKJ A;  1RHP A;  5DEH A;  4KD4 A;  3MFY A;  1NR4 A;  3OMG A;  5FO8 B;  2KQ3 A;  2F0E A;  2L55 A;  4ULL A;  1MGS A;  2KEE A;  2Z4H A;  4CHT B;  5C4J B;  1RTN A;  3MXN A;  1ESR A;  1TWA B;  1TY0 A;  3TZU A;  1F77 A;  1TWG B;  1DXM A;  5JEA G;  3KBG A;  1IW7 D;  1IKM A;  3Q24 A;  1B2T A;  2YYZ A;  3K58 A;  1GOZ A;  2BDO A;  2K04 A;  4XYO A;  3CRL C;  1STH A;  1WTP A;  2DN8 A;  1ENF A;  2A6E D;  2K5W A;  1HA5 A;  3QWN A;  1S5B D;  4RAU C;  1GUS A;  2AQ3 B;  5FK9 C;  1JWS D;  3GTJ B;  2F0K A;  1IW7 C;  4OGQ C;  1Y1V B;  5C5M A;  1JQY D;  1STY A;  2IX3 A;  1ML0 D;  5I4D A;  3K5O A;  4X3S A;  5KYI A;  3W2D A;  4KHV A;  4XTC S;  2NBF A;  3NQT A;  3MFG A;  3NBI A;  3X3M A;  5D3I B;  1TT2 A;  3PMF A;  1WTQ A;  1HXY D;  2RDF A;  1I50 B;  2B8G A;  5ELD A;  5KIX A;  2R61 A;  4DA2 A;  3E5S A;  3JAM L;  4DNT B;  1H9K A;  4ZUI A;  4ME5 A;  2FHT A;  4RWS C;  1A15 A;  1XYI A;  3V05 A;  1RJT A;  3GTO B;  1ZXT A;  3A55 A;  2A73 B;  1Q1B A;  2F03 A;  1VF7 A;  3Q22 A;  1BDO A;  4K2L A;  4ZQ3 A;  3I70 A;  5J22 A;  2RDH A;  1GUW A;  2LFN A;  1O7Z A;  1OXU A;  1E2W A;  1MSH A;  2HCI A;  1CM9 A;  1Y8P B;  4XXE A;  1CHQ D;  3BG3 A;  2RKS A;  4A3M B;  2K03 A;  4K5W A;  1LAB A;  3SK4 A;  2EY2 A;  4Q5V A;  1YNN D;  2PZW A;  1LTR D;  5C0X H;  2XSC A;  2ICI A;  4IUP A;  1RKN A;  4ZAI A;  4K5V A;  4IUN A;  2O5J C;  1TS3 A;  2E2H B;  3BVZ A;  3SHL A;  4LK1 C;  1LV9 A;  5EBD A;  4IUU A;  2B2V A;  1ZYR D;  3LNN A;  1CK1 A;  3VR4 A;  3D4R A;  2BA0 A;  1IHZ A;  4RGM A;  2O4X A;  2PYK A;  1FNU A;  1PTO F;  4BWG B;  4RHR A;  2IX0 A;  1QIL A;  4CKC A;  2LS0 1;  4M1U B;  4QMG A;  1TR5 A;  2CHB D;  1HA6 A;  2F0J A;  1OXX K;  5I6W A;  5IT9 E;  1BF4 A;  2EY5 A;  4DAV A;  4IUR A;  3FPP A;  1SYG A;  1I4X A;  1PTO H;  1SE3 A;  1AEX A;  2JYO A;  1MD2 D;  2JEB I;  4IUQ A;  3UI2 A;  2XWJ B;  1A3V A;  1D6E C;  1EYC A;  3IFD A;  1R9T B;  1TII D;  1EY7 A;  4HR7 B;  2XRQ D;  1O7Y A;  1S4Z A;  1I4G A;  1STA A;  3DEP A;  5KEE A;  3DWA A;  1HFN A;  5JAV A;  3D6W A;  3FRP B;  4J6H A;  3CKI B;  4NMZ A;  1SJH D;  2PZU A;  4XDX A;  1FGB D;  3RLF A;  1JIC A;  5E4X A;  3V2T A;  1A3T A;  2KED A;  4LAA A;  1LT3 D;  2PCF B;  3ZYY X;  3K6O A;  1TS2 A;  4FNF A;  3GP7 A;  3SE0 A;  4TRD A;  2VB3 X;  2NYZ D;  2NVT B;  2NVX B;  1B4O A;  1EY0 A;  3WOF A;  4K2K A;  4KY7 A;  4FXD A;  3PUY A;  1JE4 A;  1G8Z D;  1PTO B;  1SYC A;  3T53 B;  4FXK C;  1FNW A;  2K7V A;  4RCN A;  1PTO C;  1KAA A;  2QIL A;  1XX8 A;  3HGB A;  1FR3 A;  1JWU D;  3U9O A;  2NB0 A;  1O80 A;  2B2W C;  1GUO A;  1F2L A;  3Q0A A;  1PFM A;  3I4M B;  4HAE A;  2B2W A;  1OXS C;  2F0M A;  5J1Z A;  3IL8 A;  2Y0S B;  4A3J B;  4R8N A;  1X3Q A;  4JBW A;  3OW7 A;  4ZRZ A;  2KEC A;  4AYB B;  4KD3 A;  1M8A A;  3NTK A;  5FO9 B;  3NK9 A;  2D2C C;  4CKB A;  4K6L A;  3DWP A;  1VMP A;  3NTI A;  1M4V A;  2DNC A;  2L4N A;  3HS0 C;  3I72 A;  5IOC A;  4PMC A;  1HRJ A;  1ENC A;  1EYD A;  1ICW A;  5COY A;  4KKT A;  1WTV A;  4ZKB B;  4MN3 A;  2M9V A;  1PLF A;  5CMD A;  4IFD J;  3PUW A;  5IOD A;  3P20 A;  2A68 D;  2B2T C;  1ILQ A;  2BE5 C;  3LWU A;  3J81 E;  1EL0 A;  5EBC A;  2WKD A;  1KTK A;  5CV5 A;  5C44 B;  2B2T A;  2NZ1 D;  3GTG B;  1EWH A;  1RTO A;  4KHZ A;  1ONL A;  5CV7 A;  3EFX D;  4J8Q A;  2JA8 B;  2HDL A;  1ENA A;  4FF4 A;  1H9J A;  3SK8 A;  5IGG A;  3IFT A;  2NN6 G;  3TP6 A;  2SNM A;  2IX1 A;  1A2T A;  1HPC A;  4RHS A;  4KY5 A;  1EZ6 A;  2EXZ A;  1LLR D;  4E6I A;  5EPL A;  2AWO A;  4C3H B;  1HFG A;  2F0O A;  4HMI A;  1BBX C;  1DON A;  1EY5 A;  3GQB A;  1BO0 A;  3RUZ A;  4NW2 A;  2JA6 B;  5M3M B;  5CV9 A;  4NP5 A;  5I6Y A;  3VYU A;  3KK7 A;  4IFD G;  1AW7 A;  5A35 A;  1SMY D;  4J1M A;  4F87 A;  4PMB A;  2NN6 I;  2OF1 A;  4XIG S;  5CBA E;  5NUC A;  1U4L A;  2A6H D;  3BYT B;  1BQQ T;  1EEI D;  2AUK A;  2VB2 X;  4Q0F A;  5HUR A;  2F0G A;  3HZX A;  3HRZ C;  1SE2 A;  4C3J G;  1CA6 A;  1AZP A;  5FOB B;  1LT6 D;  1E0B A;  1D1I A;  3A8J E;  3RZD B;  3HP3 A;  4FF1 A;  5C3X A;  4IFD I;  1IYU A;  1RD9 D;  2EJF C;  5M5W B;  1F9P A;  2RSO A;  1KLG D;  2DY8 A;  2C5C A;  4L8J A;  3BYY B;  1X3P A;  2QDB A;  2PQE A;  4TSS A;  1Z6H A;  2N88 A;  4U67 3;  5A2Q L;  4KKS A;  3AMU A;  2GA4 B;  1Y8O B;  1H9M A;  2Z1C A;  1CHP D;  1A3U A;  3X3N A;  1PFB A;  1GJX A;  1TWH B;  4ODG A;  3HOW B;  3KLR A;  5JOB A;  3J7A V;  1SYE A;  4YIJ A;  2B63 B;  4G57 A;  3DMU A;  5EKL A;  2JSO A;  3ERQ A;  3HOZ B;  1GUN A;  2F0U A;  1CA5 A;  5KYL A;  4C2M B;  3N6R A;  3I73 A;  4OHJ A;  5CV4 A;  3BZD B;  1BNZ A;  5DAU A;  1EY9 A;  1V1P A;  1CZG A;  5E3F A;  3SEB A;  4DF7 A;  1C4Q A;  4ZKC B;  3M4Y A;  3SK6 A;  4RKL A;  5KNB A;  4K14 A;  1SNQ A;  3P7J A;  2PPB C;  2F3V A;  5C4X B;  1JOR A;  4B08 A;  2F0P A;  1JR0 D;  4DK1 A;  2X6G A;  2FFK B;  2VUM B;  1W6K A;  5C4Z A;  1BUV T;  4O42 A;  1Q8I A;  1ET6 A;  1I4Q A;  1WTR A;  2DNE A;  3R8B A;  4UAI A;  2XN9 C;  3HOY B;  4KMU C;  1I4P A;  3GTQ B;  3VR5 A;  3NE5 B;  3U9S A;  2M2L A;  3SDZ A;  1BOS A;  2FIN B;  4XT3 B;  5KNC A;  4QIW B;  5JPM C;  2N55 A;  4KN7 C;  3AB9 A;  3DHQ A;  2A6E C;  4DAP A;  3CHB D;  2G9H D;  1PYW D;  4WJW A;  4A3D B;  5I9O A;  3ERO A;  1QB5 D;  2RVL A;  1EY4 A;  1KAB A;  1CT1 D;  1WTX A;  1VDZ A;  3NXW A;  4A3I B;  3MXP A;  5LHY 1;  2A74 C;  3T4A C;  1CZW A;  1QNU A;  3C3L A;  4ZUJ A;  5M9O A;  2WP8 J;  2K33 A;  3S17 B;  3SR1 A;  3OMC A;  1JCK B;  2TMP A;  3D3R A;  5J39 A;  3K57 A;  2OXP A;  4RGT A;  2RSN A;  3FKI B;  1HTL D;  4S3S A;  1AN8 A;  3JAM E;  1PZJ D;  2SEB D;  1V43 A;  3EJI A;  3K7A B;  2EJM A;  4ABN A;  3R93 A;  1SSO A;  3N52 A;  5EQ0 A;  3M7G A;  2EYH A;  2NVY B;  3H3V C;  1SE4 A;  3F2U A;  5JEA H;  1TY2 A;  4Y7N B;  2IWH A;  1NSN S;  4A93 B;  3TBI B;  1SNC A;  4QUF A;  3Q6S A;  5TSS A;  1B9M A;  3NSW A;  3T51 B;  1NCV A;  5IGC A;  5DM7 3;  3FPU B;  1WD1 A;  3GTM B;  1HUN A;  2I07 B;  1IL8 A;  4B9X A;  2M00 A;  4DXG A;  4HSP A;  3D8G A;  4IQZ A;  5LL6 S;  1CQV A;  4IUV A;  4RCO A;  5BN3 A;  1IYV A;  1YNN C;  1WCM B;  1Y8N B;  4I7Z C;  2YU9 B;  3SVM A;  1U4R A;  1LTS D;  5ELB A;  2ZXR A;  3QO2 A;  1SND A;  3DXJ C;  5M3F B;  1EU4 A;  4FYD A;  4G7O C;  1U9R A;  1ZYR C;  1TVX A;  1A6X A;  1FYC A;  3BS1 A;  1HUM A;  3QOL A;  3S1Q B;  3I8Z A;  3MHB A;  1HCZ A;  5EGT A;  3BVG A;  1KDC A;  4K5X A;  3BDO A;  1JB3 A;  4X3U A;  1DOL A;  5C6A A;  3LWE A;  1STE A;  1EQV A;  1GUG A;  2EYF A;  4EQO A;  2F0Q A;  1L0X B;  3A7L A;  2RA4 A;  5G3L F;  3M3Y B;  4R9W A;  1SBB B;  4C3I G;  3VR3 A;  4HN7 A;  2WIN B;  4DK0 A;  3OHX C;  1KNE A;  5DM6 3;  3V96 A;  3QB3 A;  1SAP A;  3A7A B;  3VYS A;  2J7Z A;  3HOX B;  2EYP A;  3C2P A;  3GTK B;  3MXG A;  1LAC A;  2BOS A;  2EY1 A;  3S15 B;  1NR2 A;  4BA1 I;  3OOC A;  3RZO B;  2MGS A;  1EEF D;  1UEA B;  4BA2 I;  1U4P A;  2ZXO A;  2C9O A;  2LKV A;  4WFN 3;  3MTS A;  3OIP A;  1KNA A;  2ZXP A;  3KLS A;  2D5D A;  2F0V A;  1OXV A;  1MSG A;  3J80 E;  2SOB A;  3WDN A;  1QG7 A;  4OO1 G;  1C48 A;  4CJ1 B;  2EDG A;  4CJ2 C;  4P2C B;  1T5X D;  2MHV A;  3NHH A;  4I65 A;  2XRS D;  2EVB A;  3TME A;  3VR2 A;  5JVH 3;  4H0L C;  2XWB B;  5G3L D;  2HDM A;  2XVS A;  2B39 A;  4ZLT F;  3SXH A;  4JK1 C;  4H13 C;  1DM0 B;  2B2U C;  4RFB A;  4HSV A;  3BDC A;  3OWF A;  4NDX A;  1S5D D;  5HGT A;  5K36 G;  3HKZ B;  2K28 A;  2B2U A;  2H4O A;  1I6H B;  4OO1 I;  1BXT A;  4DNR B;  4OIK A;  2RDG A;  4ILW A;  5JJZ A;  3S1M B;  1BCP D;  3OIQ A;  4F88 A;  2X69 A;  3CU7 A;  1SXT A;  2K01 A;  4K6D A;  4LMQ D;  4KI0 A;  1ROD A;  2J0T D;  2D62 A;  1EZ8 A;  1TS4 A;  1HHV A;  1F9R A;  1RF2 D;  3J81 L;  4BY1 B;  2IJ0 A;  5IGB A;  1AZQ A;  1XXG A;  4EQP A;  3H6M A;  3WOE A;  4QCL A;  1H9S B;  3M4O B;  4X3K A;  5D65 A;  4K8I A;  1D5Z C;  5JVG 3;  5E4W C;  1QCB D;  3ND8 A;  3OSO A;  1JOQ A;  3E0J A;  4TKO B;  5FLX L;  1EIG A;  1F2M A;  2F4I A;  3M85 A;  1H9S A;  3H0G B;  2A68 C;  1B53 A;  5BN5 A;  3S2H B;  4CKE A;  2E2J B;  1DJR D;  1LT4 D;  3MA2 B;  2JE6 I;  4DN4 M;  4KK7 A;  4WRD A;  3BVM A;  3SK5 A;  1BR9 A;  2B2Y C;  3P75 A;  2L1B A;  1PRT F;  1CI3 M;  2QCP X;  3G7L A;  2F0W A;  4GZY C;  1B50 A;  1GHK A;  2B2Y A;  1TKW B;  4H44 C;  1W6J A;  2K6A A;  5FKA C;  4RGO S;  2XNA C;  2Z4I A;  2AUJ D;  2R6G A;  2HQE A;  4RH6 A;  1OO9 B;  2CW0 D;  1JWM D;  1STB A;  1SYB A;  2QKI C;  1GXD C;  1WD0 A;  5KRU A;  3HEJ A;  1K8M A;  2KHS A;  2R92 B;  1QNK A;  3K5M A;  2AQ2 B;  1Q12 A;  3S9W A;  4C1N I;  2KA7 A;  4C1N K;  5DNF A;  1SMY C;  2KJX A;  2R3Z A;  2SDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...