1IHZA

Structure of s. nuclease mutant quintuple mutant v23l/v66l/i72l/i92l/v99l
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYLYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proteins with simplified hydrophobic cores compared to other packing mutants.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ihzA00
2HQEA 1ENCA 3BDLA 3T16A 4S3SA 5CV5A 1NUCA 3D8GA 3TMEA 1STGA 5J39A 3OSOA 1ENAA 3HZXA 5HGTA 1EZ8A 4NP5A 5CV4A 1SNMA 4KJOA 3P75A 5I9PA 3EJIA 2KQ3A 4NKLA 2RDFA 4B9XA 1STNA 3SXHA 3SK8A 3QOLA 4DU9A 4EVOA 2SNMA 2PYKA 3MXPA 1SNPA 4DFAA 2F3VA 3NUCA 5IODA 1STYA 1A3TA 4K14A 3T13A 2O4XA 4HMIA 2F0OA 2PW5A 1SYDA 1A2TA 2EYJA 5CV7A 3TP6A 5CC4A 1EZ6A 2F0HA 5C5LA 4E6IA 1A3VA 4ME5A 4TRDA 4WORA 1EY8A 2F0KA 4R8NA 5I9OA 4IALA 5I6YA 3TP5A 4PNYA 4PMCA 5KRUA 3QOJA 4F8MA 2PZWA 1SYEA 3EROA 4J6HA 1JORA 2F0PA 1EY7A 2F0QA 5E3FA 2F0EA 2SOBA 3QB3A 4ZUJA 3SR1A 5C4HA 4ZUIA 2EYHA 4ODGA 3D6CA 2EY5A 4NMZA 5KYLA 3SK4A 1EYAA 1RKNA 1SNDA 3MEHA 2F0TA 5IGDA 5EGTA 5KIXA 5EKLA 2EYLA 1EYDA 5ISRA 2EXZA 2EYPA 5KGUA 3LX0A 2F0UA 2OEOA 1JOKA 3ERQA 4KV6A 1F2YA 3SHLA 3TP7A 1KDCA 1EY6A 1U9RA 3D4WA 3NP8A 5CGKA 3DHQA 1KAAA 4KJNA 4K5VA 4N9TA 2F0DA 4H7BA 3C1EA 2QDBA 4PMBA 5CV9A 4YIJA 5DEHA 5EKKA 1NSNS 2LKVA 4HMJA 1JOQA 3U9OA 4RKLA 4ZQ3A 4RKBA 4F7XA 3BDCA 2F0WA 3OWFA 4ID6A 4QF4A 5C3XA 5HURA 2M00A 2F0MA 2F0GA 1A3UA 2OXPA 5IGGA 5JAVA 1F2ZA 2EYFA 2KHSA 1EQVA 2SNSA 3HEJA 4DF7A 1EY0A 4LAAA 5CV8A 1IHZA 2EY6A 3DMUA 2F3WA 3D4DA 3NK9A 4I65A 4K5XA 5DAUA 3SK6A 3C1FA 5JOBA 3ITPA 4J1MA 5KYIA 3H6MA 4KHVA 4IUNA 1SNQA 5C5MA 3E5SA 2F0JA 5IGFA 1SYGA 3OMGA 2PQEA 3NHHA 4K8IA 2EY2A 2F0LA 1A2UA 4IZ8A 4KTAA 1TQOA 1STHA 3OMCA 2F0NA 2RKSA 5IGBA 5IOCA 4N9PA 1SYCA 2F0VA 1STBA 2F0FA 2F0IA 3NQTA 4KD3A 2PZTA 4KY5A 1EY9A 5I6WA 5J1ZA 1KABA 4KY6A 4KD4A 5IIFA 2PZUA 4NDXA 4QB4A 5IGEA 4K5WA 3SK5A 5CR3A 3S9WA 1EYCA 1SNOA 3P1HA 4HTHA 4KY7A 5IGCA 1EY4A 4B9WA 1EY5A 1STAA 2ENBA 1SNCA 2OF1A 1SYFA 2EY1A 4K2LA 4OL7A 5NUCA 4EQNA 5C4ZA 3R3OA 3MHBA 4K2KA 5CV6A 2NUCA 1JOOA 4WRDA 3RUZA 4EQPA 1AEXA 2WACA 5C6AA 4DGZA 5J22A 1TT2A 3V2TA 3VA5A 4EQOA 1II3A 1KDAA 4K6DA 3NXWA 4QMGA 3EVQA 5M9OA 4G57A 5E1FA 2EYMA 1KDBA 1SYBA 4MIUA 2RBMA 5K5PA 2PW7A 5C3WA 3PMFA 1F2MA 3MVVA 3TP8A 3MZ5A 5F2DA 2EYOA 5KEEA 4K8JA 1TR5A 2F0SA
chains in the Genus database with same CATH superfamily
2A74C 2OT2A 3RD4A 2HQEA 4DAYA 3GTMB 4B3RL 5J39A 1Q1EA 3OSOA 1V9PA 3HZXA 2VUMG 1EZ8A 4HEDA 5IYBG 1SNMA 1SJHD 3KDFB 2A19A 4GLAC 3NEMA 2JEBI 2GVAA 2JP1A 3MXPA 3GV6A 4HCSA 1PDQA 2K75A 2F4IA 3HOXG 4HJ9A 2MGSA 2M2LA 1F77A 3CCLA 3KF8B 1HNWQ 1JC7A 2GN5A 2R61A 1Y1WB 2C5CA 2XTIA 4R8IA 1XPRA 2CQOA 1U4PA 4JCVE 2AHOB 3A8IE 5M5YH 1AH9A 4KHZA 3OYYA 4DV5L 2K5VA 1TWCH 5KNBA 1U4RA 3HOUB 5KIXA 5EKLA 1XPUA 2UXCQ 1BCPF 3ULLA 1K8MA 4POGA 2CW0D 2E76C 2IX1A 1B2TA 1HJPA 3SEBA 1GUGA 5JVH3 4HCEA 1DOKA 1ESFA 1SR3A 2ZXPA 4X66L 1D5ZC 4RKBA 4XTCS 1DD2A 2NBFA 2M00A 2YV5A 1WD0A 1K3BC 1EQVA 4FVMA 1EY0A 2UXBL 2PCFB 2EY6A 4OWTB 3D4DA 2RSOA 4J1MA 4NPSA 3UDFA 4UAIA 1X54A 1S4ZA 1XJVA 4LF6Q 2BE5C 4O2DA 1CHQD 3E5SA 2E74C 2QILA 3OMGA 3NHHA 3HKZG 1Q12A 1KRSA 1X3FA 1Z47A 5J1ZA 4ZLTF 2A68D 3NBHB 2K5NA 4JI8Q 1WTOA 1N36L 1B50A 2ICIA 2QEJC 1I4RA 2EDGA 4B3SL 1XXGA 1X56A 2NVQB 3IKJA 4P74A 3RUZA 3F1ZA 4H13C 1FYCA 2RVLA 1TT2A 1RL2A 4LWCA 2VY3A 1HR0Q 1V1QA 4A3FG 2Z8LA 1CSQA 4EQ5A 5IP9H 1ESRA 1Q86C 1VQ7A 1MJCA 4DR3Q 1FL0A 3I4NG 1AW7A 4HIOA 1R4PB 1CI3M 3BZKA 1TWHH 3Q0AA 4KMUC 3BDLA 3CC7A 2FMCA 3IAYA 5LMNW 5LMNL 3GTLH 4NP5A 3IFDA 3ONAB 2RDFA 3WOEA 4R4QA 4JOIC 3K5MA 1GUWA 3A74A 1G2SA 4JI2Q 1ILQA 1CM9A 4A93G 1ILPA 1A3TA 2J0TD 3T13A 3RNUA 3D6WA 1J5EQ 2IJ0A 4H02A 3K57A 1T5EA 3S1QB 2B63H 1KIXA 3K80C 1EOTA 3JAMi 5BN4A 1L0YB 2F0QA 5CORA 1GO3E 5C4HA 4J15A 5ELNA 4NMZA 1Z7TA 4GOPC 1S3OA 3S2DB 1B3QA 2F0TA 1I4QA 3BVGA 4BA2I 2PPBC 1H95A 3S1RB 1SAPA 2R7DA 2EXZA 1L1OA 2OEOA 2LXKA 3ND9A 2K03A 1EIHA 1OO9B 3NP8A 5CGKA 1AE2A 2Q2IA 5FO7B 3PF4A 4X3UA 4X65Q 5E4XA 1GUSA 4KKUA 2E2IB 1GD7A 1IW7C 1B70B 1VQNA 1TS5A 4X62Q 2F0GA 4JI0Q 5M3MH 5FKAC 2JA8H 4A93H 4WFN3 2SNSA 3KBXA 1QNUA 5EKIA 3PSIA 3W1GA 2IX0A 3RMHA 1TWGH 1S40A 1DOLA 1Y14B 1VS0A 4JI4Q 1WCMB 2EY2A 3WOFA 3S1NB 2F0NA 5FJ8G 2KUMA 2PNRC 2Q8IB 1PFBA 4KD4A 1QVGA 3BZCA 3SK5A 4CKEA 1VQDA 5EJWA 4LMQD 1SJED 1AFPA 2A6HD 2R3ZA 4X3TA 4CJ1B 3S16B 3KFUA 3K5LA 1D1IA 1FJGL 4IJLA 4R4IA 2R7ZG 4WRDA 1HFNA 1LYLA 5I2XA 2NZOA 1BBWA 5FLMG 4JC0A 3MFGA 5ELFA 2CWPA 1EU4A 4BBRB 4LK1C 1QILA 1QVFA 5LL6X 4IQZA 3I4MG 3MZ5A 1CZWA 5C4XG 4DK3C 4JI6Q 1F9PA 3UE0A 2L15A 4YHHQ 3WDNA 1NUCA 4OIJA 4EX5A 4A3DB 4UPAA 1VMCA 4FF3A 1D6EC 2KHIA 3CCEA 4X6AH 3MC0B 1V43A 3QOLA 1O7ZA 3CW2C 5IP7G 1TWAH 3D3RA 4DR1L 5IODA 2NVYH 1ZXTA 1WTQA 4DV5Q 5JJZA 5CMDA 5K36G 1NR4A 1EIGA 1YBYA 3FDTA 2RCFA 3FPUB 3MWYW 4DNTB 4C3IB 4PMCA 2IL8A 3Q8DA 1NCVA 2HDLA 4DR5Q 4LFAQ 2B2VA 4AIMA 2CFMA 3H0GG 5M5YB 5EGTA 2VQEQ 3TBIB 5I2YA 3H91A 2R92B 5KGUA 2LXJA 1FD7D 2F0UA 1JOKA 2L11A 1LTGD 2VNUD 5IY0A 3EA6A 1XMOL 1IXRA 4DA2A 4HMJA 2N55A 2Z4IA 4PQXA 1VQEA 4A3JB 1VQCA 2N88A 1HPCA 3HOWG 4DR4L 1PRTB 3NK9A 3TEHB 1E2ZA 1Q46A 3PUYA 2KEEA 1YI2A 3A54A 4IUNA 3PQIA 5C4JH 4A4IA 5G3LF 3S1NH 2KA7A 2F0JA 4A3IG 2EJMA 1MD2D 3M4PA 3VA7A 3OMCA 2N49A 2Z1CA 4GZYC 4N9PA 2F0IA 4C3HG 3KOJA 2PI2A 3K7AH 1ET9A 3DWAA 1HTPA 1K83B 3T1YL 4ZRZA 2K14A 4NW2A 3S2HH 3RZDH 5IP9G 1PH5A 4GKJL 3U4ZA 2MHVA 1HNZL 4AYBE 5ELBA 1SBBB 2L12A 2A69D 3M85A 4EQPA 3X3MA 1GKHA 2BA1A 2K33A 4A3KB 1DM0B 3JAME 1KTKA 5BN5A 4IPHA 1XWEA 4L5QA 3OTOQ 2QGQA 4BY7B 5E1FA 4UP8A 5IYCG 4MIUA 5JJKA 2UU9Q 1TKWB 2BDOA 3BVMA 4HSVA 1WOCA 4L5TA 3SVMA 2LMCB 4FXDA 3TZUA 1JB7A 2G5DA 2AQ1B 2ID0A 5CV4A 2VQFL 4EVOA 2JA6G 1JJGA 1N8RC 1LV9A 4GN5A 1WTXA 3ZYYX 4HJ5A 3K0XA 2EYJA 1Z9FA 4WORA 3IFTA 1PV4A 4DV1Q 1EY8A 4LNQA 3NWSA 4IALA 4KHPL 1YITA 4U673 1CQVA 3DLLA 2JJQA 3NELA 2BH2A 4IOAA 3A8KE 5D65A 4DUZL 3D6CA 1AZPA 3PGZA 1RKNA 1H9KA 1X3QA 1S5ED 1I3QB 3QIAA 3PO3G 2XWJB 4NXML 5T1GA 2WAQB 4HR7B 2NN6H 4IOCA 4K5VA 3EN2A 2KCTA 4RMFA 1TS3A 2BOSA 3HOVB 2D62A 3U9OA 2PMZE 3C46A 4QF4A 1Q8KA 2LSSA 3I4LA 1QZHA 2F0MA 2BCOA 1EWHA 5JJIA 3I2ZA 4DF7A 3L3OC 1C9OA 1WTWA 2MO1A 1U5KA 4UDUC 1H9JA 5JJLA 2G9HD 4A75A 4A3GB 4FF1A 3KJOA 1ICWA 3HOXB 1K3RA 5AFWA 4LF8L 1BF4A 1KAWA 4JK1C 5KNDA 3CMAA 1Y1WG 1IW7D 2B2WC 1UUPA 5A2QE 3AYHB 1PFNA 1SYCA 1LTRD 4K6LA 4M8AA 5IGEA 1Q82C 1CKNA 1JE5A 2DNEA 4KY7A 1EY4A 3BYTB 5JEAJ 1K0SA 4FF4A 3CF5A 2A8VA 1G6ZA 3MXNA 4LUVA 3H3VH 3DUZA 4OEMB 1PVOA 4OX9L 4LUZA 1PA6A 3JC66 2NTTA 2JQOA 1JR0D 1N34Q 1HH2P 3RR5A 3SE0A 2KECA 4FXKC 4A76A 1WTVA 1I50B 2K32A 2QW7A 2E2IH 1JT8A 4NKLA 1SROA 2VXWA 2K4KA 4OIKA 3PIPA 4B9XA 2DNCA 4DV6Q 5D3DA 3VDYA 1GHJA 4DR7L 2F3VA 2A68C 4B3RQ 2HUGA 1ZYRD 3CCJA 1OXVA 1TY0A 3M4QA 1F9QA 4TKOB 3HOZB 3L7ZC 3KUPA 1QNKA 3R8BA 4GNXB 4FXGC 1JJCB 4J6HA 1DONA 3URYA 2SEBD 4DNRB 2B63B 1K8OA 5KYLA 3CP0A 3GQBA 5JPMC 5FK9C 3MEHA 3DM3A 1IYUA 1RJTA 1TVXA 4BXXH 1PRTD 4N8X1 4RCNA 3HOVH 1U9RA 1FNUA 4KJNA 3VR2A 1TS4A 5CV9A 5D3IB 2JA8G 1VQLA 4JYAL 4HN7A 1PRTC 4AQYL 4H0LC 2K6AA 4ID6A 1A6XA 5EPLA 5IGGA 3GTJH 1Y8NB 2OTLA 5M3FB 1RIPA 3NWTA 1JWMD 2N78A 4IFDI 2H1EA 3PO2B 2ZT9C 4DV2L 4KTAA 4IZ8A 3K6OA 1STHA 4R4CA 1WD1A 2RKSA 4YY3Q 1STBA 4B3SQ 1EY9A 2DGYA 4V0BA 4X3KA 4DKAC 3H15A 2PZUA 1E2WA 1PTOC 1NY4A 2B2YC 5FLXL 4BBSH 2NZHA 3OTOL 4DK0A 1EYGA 3H3VC 5IYCH 2AUJD 1QCBD 3A7AB 3ND8A 4YCWA 4OL7A 2ICEC 2XRSD 3R3OA 3MHBA 2ZJQA 1CA5A 4DGZA 4YWKA 2UUBQ 1M4VA 2YTXA 5DLQE 4G7HC 2WAQE 1IKLA 3S2DH 2I5MX 4CBVA 1DGSA 2EYOA 4PZ6A 4C3JB 1QWYA 2N8NA 5KEEA 2SDFA 4K8JA 3CXCA 3CQZB 4HJ8A 1O7LA 3GTPH 1XNQQ 5M5WH 1H9SA 2ZM6Q 4QGUA 1JE4A 1B1ZA 3CMEA 2WFWA 2RDHA 5HGQA 3S15H 2EJGC 1U0LA 5E4WC 1VQJA 1VQ4A 4DR6Q 2B29A 5CV7A 1JJ2A 2B3GA 2E2DC 3DWQA 5IT9E 4ME3A 4OELB 1HA6A 2E2JB 1O80A 3H0GH 3NENA 3PO2H 4LF4L 2JE6I 1EY7A 4ZUJA 1V1PB 1YVCA 5C4JB 2KCCA 2X6LA 1HZCA 2O2LD 3FPPA 3PIO3 4DV3L 5GROA 1QG7A 1HTLD 1YNNC 3SK4A 4B3TL 3CAMA 1WFQA 1TIID 5FO9B 3S14H 3LWEA 4IUTA 4UY8C 4C2MB 1BO0A 3JAMc 1G8ZD 2ASBA 1I3QH 1GVPA 5D14A 3M3YH 1VQGA 2RSNA 4LF8Q 2I5LX 2HIXA 1LTID 2VB2X 2OQ0A 4L6TB 1HR0L 2Y0SG 5DAUA 1RF2D 4ULLA 4GLXA 3ITPA 5KYIA 4Q0FA 2E8GA 2G9DA 4C56C 3HS0C 3NPPA 4QUCA 1LT3D 4UP7A 1UE1A 1VF7A 2X6GA 2J7ZA 4YCUA 3F2BA 3RLFA 1EIYB 1D1KA 2VQFQ 1BBUA 5DM63 1T5XD 2L4NA 2YU9B 2B2VC 2IWHA 5CR3A 4B3ML 1YJ9A 1SNOA 3LGJA 4G4KA 4L8JA 5IGCA 4XYOA 4DAMA 2RDGA 3DWPA 1GXDC 1YEZA 3Q22A 1JOOA 1TS2A 4A3BG 1IKMA 4EQOA 1N9WA 5C0XJ 3S1QH 1Z6HA 4QMGA 1ICFB 1K0RA 1NAPA 3TRZA 1PZID 1LACA 3FP9A 2D0OA 2F3IA 3QR8A 2F03A 3HOUH 3I4NB 2A6ED 3IL8A 1F2MA 3BDOA 3HOWB 1VQ6A 4BS9A 1F9SA 1E0BA 1PRTF 2HCCA 1FVIA 1CZGA 3AFPA 4CGYB 1EQRA 1XTCD 2RA4A 5HGTA 4GOPB 2OCEA 2MFIA 3P75A 4X65L 4MTNA 2ZJRA 1EEFD 3E9IA 2NYZD 2XGTA 3KK7A 1I4HA 1M1KC 3RLNA 4BXXG 3I91A 4IO9A 4TSSA 4P72A 1EZ6A 1EWIA 3PUZA 1G6PA 1CA6A 1YZ6A 3TP5A 4FO2A 4UP9A 4A3MB 1JORA 1IBML 1BOSA 1R9TH 4NXNQ 4RHRA 2DY8A 1JB3A 1A0IA 4A3KG 4ZKBB 2H5XA 1EYAA 3WWVA 5L37A 3OPOA 2Z6KC 3FRPB 3EIVA 2KHJA 2EYPA 3R2IA 1CK1A 5AJ3Q 1EUJA 4YIJA 3NTIA 3VYSA 4BY1G 1NSNS 2YTYA 2MQHA 3RN2A 2Q8RE 1L0XB 1SSOA 5FLXc 4MTKA 1XMQL 4R9WA 4JI2L 3S1RH 4DR2Q 2RHQB 2UUAQ 3HEJA 1S5CD 4JI5Q 4OWWB 3K59A 4CKCA 4DV4Q 1WTPA 1SDFA 4JI1L 2VL6A 1YJWA 4JBMA 3CPWA 1Y8OB 3VYRA 4OO1G 1LLRD 2BH8A 2E2HB 1JWSD 3CC2A 2DY7A 4KY5A 1BVSA 3GTOB 2ZXOA 1CT1D 1C8CA 2K5QA 1CKMA 1HA5A 3J7ZC 2R93G 1UEAB 2D5DA 1D8LA 3NSWA 5IYDH 1EL0A 2JXMB 1SNCA 3PO3B 2AQ2B 1HUNA 4K2LA 5CV6A 2CCZA 4N8FA 1SE3A 4IJHA 5BN3A 3BS1A 5J22A 3STBD 1XNQL 4KLKA 4BBRG 2B8GA 3ULJA 3FMCA 2PW7A 2F4VQ 1N32Q 4A3DG 5C0XG 2JEAI 4OO1H 4TVAB 2MO0A 4LF5L 1NMGA 4IFDJ 3G6JB 4KJOA 1BBXC 3HKZE 2CKZB 2IW3A 3I72A 4C3HH 4KKSA 3I90A 4YWMA 3GV3A 1I94L 1MBYA 5IYDG 4K14A 4DR4Q 1CKNB 1PZJD 3KJPA 4DK6C 5LMNQ 1RDPD 2F0HA 3AEVA 4DK1A 4E6IA 2R6GA 3DEOA 3I70A 4PNYA 3QOJA 3DM1A 2E75C 3QB3A 4QJFA 1I4GA 5IWAQ 3E0JA 1Y1VH 3GTQH 5ELEA 2HHHQ 2A6HC 1VDZA 1EU3A 2ZTDA 5ISRA 3ULPA 1EWCA 4XQNA 4DV7Q 2WP8J 1RTNA 1I5FA 1HNZQ 3I4MH 3GO5A 3UI2A 5JAVA 2EYFA 1WTHA 3K58A 4P75A 3LNNA 1YNXA 4RGNA 1J6QA 1VQHA 2NN6I 3BVZA 3MTSA 2KEDA 4A93B 5IP7H 3S1MB 1FGUA 1HNXL 2JYOA 4I7AA 2JA7G 2ATWA 3GP7A 1KNAA 3A7LA 5IGBA 4V190 2F0VA 2F0FA 1M8AA 4ILWA 3FKIH 1YNJD 2VQEL 1NMFA 4IN3A 3IRBA 1UE7A 4HTHA 1LTSD 3G71A 3PCOB 3K0YA 1G291 1KL9A 1KRTA 2NUCA 1N34L 1WVLA 3I7FA 2J4XA 4LF4Q 2E2JH 4A3FH 1D5MC 3JAML 2UXDQ 5EPKA 1VQ5A 2I5HA 3MVVA 5FO8B 1Y69U 2L55A 1W3SA 2VUMB 1BXTA 4HAEA 4DR7Q 4A3IH 1PH1A 1ENCA 3HOWH 3T16A 4QUFA 4JV5L 1VQKA 2JA6B 5M3MG 1SFOB 3J80E 1Y1WH 1WCMG 2K01A 5IT9c 2KBNA 5M5WB 1MHWC 2QCPX 1Y1VG 1SNPA 1HFGA 2C9OA 3RZOB 2KOLA 1IBLQ 4IUVA 1BCPB 1TY2A 4HMIA 3TP6A 2B2YA 2K28A 4P73A 2MP1A 4TRDA 3PUWA 4BY1H 1J9OA 3E9HA 2XVSA 3D0FA 4RH6A 3VYTA 2B8FA 3CKIB 5E3FA 2F0EA 4KN4C 5AJ3L 1ASYA 2EYHA 4ODGA 1QVCA 1LO5D 4DXGA 3DEPA 4YCVA 2WAQG 1B9MA 5IGDA 1EQTA 4AQYQ 1MGSA 3KDFA 4DR2L 1FR3A 2A73B 1I6VC 2ZM6L 3I4MB 4C1NK 4FDBA 1KAAA 4LFCL 5EKKA 4RGTA 4DV4L 2NVYB 2RF4A 1FNWA 2HIVA 4HJ7A 3MXNB 4RHSA 2CW0C 4RGOS 4C2MH 2ZXRA 1A3UA 1E7ZA 4QQBX 3KLWA 1LM0A 1D2BA 2ALYB 4G7OC 1ZKOA 1L1OB 2JK8A 4X64L 1XMOQ 3GTGB 1O7YA 3MXGA 4PV1C 3OIQA 1HXYD 2YTVA 1AZQA 4PG3A 4IPCA 4JBWA 4DUZQ 4MHEA 4B3TQ 3M4OB 1KABA 1VQPA 4GNXA 5ELCA 1YJNA 1G51A 3T56B 1TXYA 2WINB 3H0GB 4ZYSA 5BR8L 4DV2Q 1C4QA 3K7AB 3NTHA 4A3BH 1EY5A 4JI3L 3VR5A 3VR3A 3FEWX 2B2TA 3M4OH 1SYFA 1KD1C 2AWNA 4PZ7A 4EQNA 4NB3A 2WACA 2R7FA 3I55A 4K6DA 3CPFA 2NN6G 4CDEC 3TDQA 4ZCKA 1V8QA 2Y0SE 1SE2A 1E24A 1W6KA 2OQKA 3J81i 1FNVA 2Y0SB 2EIFA 1NR2A 3L2PA 1GUNA 2F0SA 2Z9HA 1S5FD 4A3CG 1BCPD 3U4VA 3J80i 3Q23A 1PH9A 5I9PA 1BQQT 4A3IB 3EJIA 2KQ3A 3RZDB 4PMWA 4HIMA 1V1OA 1RODA 4GN3B 3QJYA 4LUOA 1HZ9A 4OONA 5IWAL 4RAUC 4DV3Q 3U50C 1HHVA 3S15B 2F0KA 2E2HH 4AYBG 4BBSB 3S17H 1GJXA 5JEAG 4LFBL 4QCLA 4DR6L 4QL5A 4G7ZC 3HOZH 1BKBA 1PMRA 3E0EA 4JBJA 1N33Q 1PLFA 1VQIA 4TQUS 1TWAB 3FHWA 4GOPA 1Q7YC 1F2YA 2ZJPA 2JA7H 1SEBD 4N9TA 5DM73 3C1EA 1L1OC 3OHXC 5LHY1 4DV6L 2B39A 2NVTB 4ZQ3A 1S72A 1E2VA 4RWSC 5EBCA 2VUMH 1JICA 3W2DA 4IUUA 3W3AA 1DOMA 2WIIB 3PO2G 2HT1A 1IYJB 5ELDA 1Q3LA 1TWFH 3AQQA 2MJ8A 2R92H 1ET6A 1SYGA 2PQEA 1IBMQ 2F0LA 2K7VA 3J81j 2EOTA 1PTOD 1TQOA 5IOCA 3QG1A 1J8IA 3S16H 2QA4A 1UWVA 3PIP3 4A3CH 1LTTD 2F1MA 5H1SE 4A3EG 1KQSA 3KLRA 3Q6SA 1I94Q 3FKIB 1V1PA 1RHPA 2VW9A 1CTMA 1STAA 4HSPA 4A3DH 3G7LA 2EY1A 4QIWE 2E5LQ 4JI7Q 4F88A 3GD7A 1IYVA 5C6AA 1L2FA 3BJUA 3CCMA 5M9OA 1GUTA 2R7ZB 2UUCQ 5C4XB 5C3WA 2V4DA 3C3LA 4R4TA 2EE1A 5C3EB 4EGVA 4O42A 5C44H 3TMEA 4RGMA 4QY7A 1ENAA 2MNAA 3K5NA 4OX9Q 2JA9A 4YY3L 1BUVT 4XT1B 1VMPA 2SNMA 1MSHA 1F2LA 3ZJYC 1SMYD 2WKDA 4NXNL 2PW5A 4C3IG 1SYDA 1A2TA 1K73C 1OXUA 2I0QA 4CKBA 3EBEA 3ERSX 1D7QA 4CJ0B 3HOYG 3F2DA 3T51B 2JA5B 1VQ9A 1SE8A 5DNFA 1VQBA 5M5XB 2MUYA 2R92G 2DN8A 1SNDA 3I73A 4APVA 4RG1A 1SMYC 2BA0A 3BZDB 2ZTEA 4DV0Q 3F2UA 1XMQQ 4Z9CB 1QJOA 5C44G 2MPMA 3AB9A 3DXJC 4LF5Q 1A62A 5DEHA 2QDBA 3VR6A 3X3NA 4X64Q 1XTDA 3A56A 1B44D 1C0AA 4LF6L 1G91A 1B7YB 2NVQH 4C3IH 3CD6A 4JYAQ 1Q90A 4BY7H 2QEXA 5C3EH 4A3JH 3QWNA 3J81L 5LL6S 5A35A 4A3KH 1KLUD 2FJ2A 1LTBD 2UUAL 2EXDA 1EFWA 4JI5L 1TWFB 2L1BA 4ZK9B 2JN4A 3HG9A 4QB4A 4A3LH 3J80L 4WJ3M 2O5JC 4LF9Q 2AUKA 1MJEA 3ICEA 2WB1B 4DV7L 4DNIA 5ELOA 1B9NA 5CBEE 2WB1E 5GAGC 1HNWL 4GN4B 2F4VL 1I6HB 1X3GA 2FMMA 2YU9H 2R7ZH 1AE3A 1B53A 1VF5C 3PIOA 4XIGS 5FLMH 1H9SB 1YNJC 1E1TA 2DUDA 4OGQC 4BY7G 4MNOA 4FNFA 1DCZA 2UXCL 3V96A 1HUMA 5GAEC 4S3SA 1VQAA 2BDNA 3E3XA 4HIKA 4K0KL 2DJFC 2VB3X 4C1NI 1B8AA 3HOYH 1EEID 2NZ1D 4CJ2C 4GKKL 3SK8A 4DU9A 3H94A 5LMUL 4B3MQ 3FVQA 1OXXK 1STYA 1UEBA 5CC4A 3B6YA 2CWAA 2LY7A 3UDIA 1BCPC 4R8NA 1XX8A 2PZWA 4F8MA 4CHTB 2KJXA 1YHQA 2SOBA 5GQOA 2Z6KA 2B2UA 3EFXD 4HJAA 1F9RA 4DUYQ 4KKTA 1IBKL 3OOCA 1MKHA 1EYDA 2IY5B 4O1NA 3LX0A 4KV6A 3G4SA 3HOVG 4DAYB 3HOUG 4C3JG 5C0XH 4GLVB 4JI3Q 5C4XH 1HCZA 2K5DA 1STEA 4U68A 4F7XA 3A0JA 3BDCA 1PH7A 4FYDA 1NJIC 3TSSA 3A8JE 1NE3A 2Z6BA 2VS1A 2HDMA 4I65A 4P2CB 2A69C 3C1FA 3NE5B 1UAPA 2RHSB 3UDGA 4DR3L 3HRZC 3K8AA 1UE5A 1SNQA 1X65A 4DN4M 4A3EH 5C5MA 1R9TB 3I4NH 2QF7A 4XQQA 2NVXB 5K36H 4ZKCB 1P16A 1CQFA 2CQAA 1K8AC 2PI2E 4JI7L 2PZTA 1O7IA 2LFNA 2O5IC 1FJGQ 2R93B 5IYBH 5COYA 1A15A 2Q2TA 3S1MH 1TWHB 2D0PA 2D9UA 3MA2B 4M1UB 3T1HQ 4LJZC 3LWUA 3I56A 3P7JA 2AKWB 1U4MA 3CU7A 1H9MA 3HKSA 3EQLC 3OW7A 4G57A 1SYBA 2I46A 1X55A 3TS0A 5K5PA 3PMFA 1X9NA 4MN3A 1SLJA 3F8TA 1LT5D 2JSOA 2CHBD 4IFDG 1STGA 3L0OA 3AMUA 3KYHC 2K5WA 4POFA 4Y7NB 1JWUD 4L5SA 2HD3A 3SXHA 2XWBB 4DFAA 3NBIA 4FF2A 4DR5L 1VQ8A 1PZKD 4GNXC 5EBDA 5C5LA 4Y52H 1YHBA 1NTGA 4XDXA 1PH4A 3NBHA 1PXUA 3A55A 3P20A 3HOZG 2NVXH 4C3HB 3EROA 2B2TC 4XQJA 4A3BB 1MIUA 3KLSX 1IL8A 5FLXE 4A3MH 1HRJA 1N32L 1T9HA 4IFDH 3SHLA 4IURA 1EY6A 3D4WA 4PMBA 4H7BA 3STBC 4A3GH 1ASZA 2AMCB 2KHSA 3OIPA 1OTCA 4X3SA 1I6HH 1PYSB 1I4XA 2K04A 5JEAH 2NVTH 2IHEA 2UXDL 2JA6H 1DXMA 1J5EL 2K05A 3M3YB 3H6MA 3I3CA 5CYUA 3W1BA 4LF7L 4DAPA 2XRQD 1UNSA 1B4OA 3RZOH 1U4LA 1D5XC 3MXUA 4K8IA 1N36Q 3VYUA 2X69A 2NTSA 3U58A 4A3MG 1I4PA 1ZYRC 2KCMA 1LUZA 1MSGA 4JI1Q 4NDXA 1PHJA 1XNRL 2A6EC 3BG3A 3S9WA 1EYCA 1QUQA 1TWCB 3AFQA 4JVZA 3GTOH 4UHVA 1PH2A 3GTLB 2OF1A 4ABNA 5C4ZA 3GTJB 2KVMA 2NB0A 4WJWA 3OW2A 1R4QB 3CQZH 1IZ6A 3V2TA 1KDAA 2TSSA 1VQOA 4BY1B 3TN2A 4K0KQ 3I8ZA 1JQYD 3MEFA 3Q24A 2K52A 2RBMA 1BDOA 2L0CA 1PYBA 1KXLA 1TR5A 4Y7NH 3D8GA 1HZBA 1ML0D 5KNCA 4LFCQ 5JVG3 4IUPA 4DV1L 4X66Q 4KHPQ 1LTLA 1ZEQX 4J8QA 5IE8A 2WV6D 5J3BA 1PFSA 4A3GG 3J81c 2XSCA 2KCNA 3CCVA 1MI2A 2V1CC 2O4XA 3D4RA 1W2BA 3PUXA 1Q8IA 2B2WA 5I9OA 4DUYL 1HQMC 3FKIG 3S2HB 2WKCA 3S14B 4HIDA 3HKZB 1KC8C 2F0PA 4F87A 2ZTCA 4C3JH 2UUCL 4CDCC 2PMZB 3I4OA 2CH4W 3GTMH 4MZ9A 4JI8L 2EYLA 4BWGB 3UE1A 4FP5D 2GA4B 2M9VA 1CHPD 5EQ0A 2FXQA 1BNZA 2Q8TA 1ONLA 5A2QL 3DHQA 4JV5Q 5C3EG 5M3FH 1GUOA 2F0DA 3C2PA 1JOQA 2HHHL 4RKLA 4A3FB 4KK7A 2L9HA 3OWFA 5C3XA 2AQ3B 3M7GA 2OXPA 4DXFA 1F2ZA 2NWGA 3S17B 1IBLL 2FFKB 3PV0A 4LAAA 2F3WA 2IHFA 3H09A 5JOBA 3CCSA 4RA8A 5IT9L 1CKOA 1X32A 1KLGD 3UDXA 1QE6A 1RCVD 4JOIA 2R93H 1A2UA 5I4DA 2EQSA 3SGIA 4BA1I 3T1HL 4KY6A 3H3VI 4GKKQ 5TSSA 1KNEA 3KLSA 1HNXQ 4Q5VA 1LT4D 1GHKA 3P1HA 4B9WA 1VQMA 4AH6A 1EOVA 1SXTA 3CHBD 4JBKA 1K28A 2K5HA 5NUCA 3ER0A 2CH4A 4K2KA 2QDLA 1KHIA 2IT1A 3N52A 5JPNC 2UXBQ 1NNXA 1QB5D 3J7AF 1OXSC 1BR9A 3K5OA 1LTAD 3V05A 3MAQA 1WJJA 2JA8B 1VCIA 1Y8PB 3NQIA 3NXWA 2PO4A 3RLOA 4DR1Q 1SN8A 4XYQA 4I7ZC 1XPOA 1NBWA 3K7UC 4CDFC 1PH6A 2IX3A 1STNA 4LF9L 4O0AA 4X62L 3G48A 4XT3B 2P5ZX 3CRLC 3TS2A 4JI0L 5M3FG 4JI6L 2CVRA 3NUCA 3T1YQ 5BR8Q 3J7A5 4LFAL 1P8LA 4IPGA 2F0OA 4AYBB 3GDEA 2KENA 4L63B 3G6EA 1QZGA 1M90C 1W6JA 3A5UA 4BBSG 2WB1G 4PZ8A 2GVBA 3HFZB 3K81C 3VR4A 2AWOA 5KRUA 1EFID 1G2TA 1SYEA 4JI4L 5GAHC 1YNND 3HOXH 1A63A 1X6OA 1PTOF 3PUVA 2EY5A 1FGBD 3CC4A 5T1IA 2EVBA 4OWXB 1IL2A 3T53B 1YIJA 4P71A 4ALPA 1B3AA 3ERQA 3J7AV 3GTKH 1CSPA 3A5ZB 1HQRD 2VZAA 1X3PA 1K8GA 2LKVA 2XNAC 5EAYA 3J81E 4QIWB 2F0WA 4OXPA 4LF7Q 4DV0L 3HGBA 1WYDA 5FOBB 2QKIC 5CV8A 3TQYA 2YYZA 3SK6A 3F2CA 4K5XA 2FINB 1Y1VB 3GTQB 4OHJA 1WI5A 4DAVA 2OTJA 3W5OA 1JCKB 1LABA 1K83H 3R2TA 1XNRQ 5IGFA 4LFBQ 3RN5A 1PYWD 1TU2B 1A8VA 3KBGA 4A3EB 3CCRA 3NQTA 3BU2A 2BE5D 1O78A 1RD9D 3HP3A 1Q1BA 2F52A 2PQAB 3S24A 4XXEA 1IBKQ 1CUKA 1HZAA 2B2UC 1PTOH 4K5WA 2L5TA 5FJ8H 3KF6B 1AN8A 2UUBL 1YHAA 1S5BD 5CBAE 4ZAIA 1SRUA 4BBRH 5EPJA 1QOHA 3VA5A 1II3A 2Z4HA 1E3PA 1XYIA 2TMPA 3EVQA 2LS01 4KI0A 2RCNA 2RQXA 1KDBA 4GKJQ 2EJFC 1UE6A 1WCMH 3T4AC 5F2DA 3NTKA 1C48A 1SMXA 1CFMA 1TWGB 4A3LG 5CV5A 4A3JG 4H44C 3QO2A 2H4OA 3PO3H 2UU9L 1X3EA 1OXTA 2XIWA 2Q2HA 1EIFA 1C7YA 2PYKA 2HQLA 1L0WA 2N3SA 1WTRA 3MFYA 1A3VA 4ME5A 3J80c 3HOYB 1DZ1A 3O13A 2HCIA 4OO1I 2JA5G 5I6YA 3M4YA 1EQQA 4R4OA 3KF8A 4NXMQ 1PTOB 5LMUQ 2A1AA 3OWEB 3SR1A 4ZUIA 4WJ4A 3TZDA 4YWLA 1I50H 5C44B 1VQFA 1Q81C 2B63G 2XN9C 1GOZA 3BYYB 4RFBA 3TP7A 1KDCA 4YHHL 5G3LD 1ENFA 3L9AX 3U9SA 4IUQA 4IPDA 3GTKB 1N33L 5HURA 2FHTA 2C35B 4R1JA 3PF5A 4B08A 3M9BA 4LW1A 1QUQB 4JPBW 1IHZA 3DMUA 5M5XH 5HY6A 3E6ZX 1H9RA 4KHVA 4KN7C 5C0XI 3CCQA 1AP0A 2EZVA 2JA5H 3J7YW 3N6RA 2EPBA 4RCOA 2ES2A 2A5HA 3CCUA 1DJRD 1PH3A 4CDDC 1RTOA 1JMCA 3M7NA 3AU7A 3D31A 4KD3A 5I6WA 2JA7B 3GTGH 4DPGA 5IIFA 2PNHA 4JG2A 2PQAA 2OWOA 5E7NA 2Q2UA 4L5RC 5GADC 3GTPB 2DJGC 3CRKC 2K50A 2K1BA 3KF6A 2ENBA 1PFMA 1DYQA 1S5DD 4JW0A 1SE4A 3R93A 1LT6D 1GM5A 1AEXA 1E22A 1K9MC 1E1OA 3TREA 2EYMA 2I07B 2D2CC 1SFOH 2E5LL 3TP8A 2Z0SA 4GS3A 1PH8A 1HR0W 3SDZA 5M3MB 2IPKD
chains in the Genus database with same CATH topology
2A74C 2OT2A 3RD4A 2HQEA 4DAYA 3GTMB 5J39A 1Q1EA 3OSOA 3HZXA 1EZ8A 4HEDA 1SNMA 1SJHD 2JEBI 2JP1A 3MXPA 3GV6A 4HCSA 1PDQA 2F4IA 2MGSA 2M2LA 1F77A 1JC7A 2R61A 1Y1WB 2C5CA 4R8IA 1U4PA 3A8IE 4KHZA 5KNBA 1U4RA 3HOUB 5KIXA 5EKLA 1BCPF 1K8MA 2CW0D 2E76C 2IX1A 1B2TA 3SEBA 1GUGA 5JVH3 1DOKA 1ESFA 2ZXPA 4HCEA 1D5ZC 4RKBA 4XTCS 1DD2A 2NBFA 2M00A 1WD0A 1EQVA 4FVMA 1EY0A 2PCFB 2EY6A 3D4DA 2RSOA 4J1MA 4UAIA 1S4ZA 2BE5C 1CHQD 3E5SA 2E74C 2QILA 3OMGA 3NHHA 1Q12A 1Z47A 5J1ZA 4ZLTF 2A68D 1WTOA 1B50A 2ICIA 2QEJC 1I4RA 2EDGA 1XXGA 2NVQB 3IKJA 3RUZA 4H13C 1FYCA 2RVLA 1TT2A 2Z8LA 1ESRA 1AW7A 1R4PB 1CI3M 3Q0AA 4KMUC 3BDLA 2FMCA 3IAYA 4NP5A 3IFDA 3ONAB 2RDFA 3WOEA 3K5MA 1GUWA 1G2SA 1ILQA 1CM9A 1ILPA 1A3TA 2J0TD 3T13A 3D6WA 2IJ0A 3K57A 1T5EA 3S1QB 1EOTA 5BN4A 1L0YB 2F0QA 5CORA 5C4HA 4NMZA 1Z7TA 3S2DB 2F0TA 1I4QA 3BVGA 4BA2I 2PPBC 3S1RB 1SAPA 2EXZA 2OEOA 3ND9A 2K03A 1EIHA 1OO9B 3NP8A 5CGKA 5FO7B 4X3UA 5E4XA 1GUSA 4KKUA 2E2IB 1IW7C 1TS5A 2F0GA 5FKAC 4WFN3 2SNSA 3KBXA 1QNUA 5EKIA 2IX0A 3RMHA 1DOLA 1WCMB 2EY2A 3WOFA 3S1NB 2F0NA 2KUMA 2PNRC 2Q8IB 1PFBA 4KD4A 3SK5A 4CKEA 5EJWA 4LMQD 1SJED 1AFPA 2A6HD 2R3ZA 4X3TA 4CJ1B 3S16B 3K5LA 1D1IA 4WRDA 1HFNA 5I2XA 3MFGA 5ELFA 1EU4A 4BBRB 4LK1C 1QILA 5LL6X 4IQZA 3MZ5A 1CZWA 1F9PA 3WDNA 1NUCA 4OIJA 4A3DB 4FF3A 1VMCA 1D6EC 3MC0B 1V43A 3QOLA 1O7ZA 3D3RA 5IODA 1ZXTA 1WTQA 5JJZA 5CMDA 5K36G 1NR4A 1EIGA 3FDTA 3FPUB 3MWYW 4DNTB 4C3IB 4PMCA 2IL8A 1NCVA 2HDLA 2B2VA 5M5YB 5EGTA 3TBIB 5I2YA 3H91A 2R92B 5KGUA 1FD7D 2F0UA 1JOKA 2L11A 1LTGD 2VNUD 3EA6A 4DA2A 2N55A 2Z4IA 4HMJA 4PQXA 4A3JB 2N88A 1HPCA 1PRTB 3NK9A 1E2ZA 3PUYA 2KEEA 3A54A 4IUNA 5G3LF 2KA7A 2F0JA 2EJMA 1MD2D 3VA7A 3OMCA 2Z1CA 4GZYC 4N9PA 2F0IA 4C3HG 1ET9A 3DWAA 1HTPA 1K83B 4ZRZA 4NW2A 2MHVA 5ELBA 1SBBB 2L12A 2A69D 3M85A 4EQPA 3X3MA 2BA1A 2K33A 4A3KB 1DM0B 3JAME 1KTKA 5BN5A 1XWEA 4BY7B 5E1FA 4MIUA 1TKWB 2BDOA 3BVMA 4HSVA 3SVMA 2LMCB 4FXDA 3TZUA 2AQ1B 2ID0A 5CV4A 4EVOA 1LV9A 1WTXA 3ZYYX 2EYJA 4WORA 3IFTA 1EY8A 3NWSA 4IALA 4U673 1CQVA 3A8KE 5D65A 3D6CA 1AZPA 1RKNA 1H9KA 1X3QA 1S5ED 1I3QB 3QIAA 2XWJB 5T1GA 2WAQB 4HR7B 2NN6H 4K5VA 1TS3A 2BOSA 3HOVB 2D62A 3U9OA 3C46A 4QF4A 3I4LA 2F0MA 2BCOA 1EWHA 4DF7A 3L3OC 1WTWA 4UDUC 1H9JA 2G9HD 4A3GB 4FF1A 1ICWA 3HOXB 5AFWA 1BF4A 4JK1C 5KNDA 1IW7D 2B2WC 1UUPA 5A2QE 1PFNA 1SYCA 1LTRD 4K6LA 4M8AA 5IGEA 2DNEA 4KY7A 1EY4A 3BYTB 5JEAJ 4FF4A 1G6ZA 3MXNA 3DUZA 2NTTA 1JR0D 3SE0A 2KECA 4FXKC 1WTVA 1I50B 2K32A 4NKLA 2VXWA 4OIKA 4B9XA 2DNCA 5D3DA 1GHJA 2F3VA 2A68C 2HUGA 1ZYRD 1OXVA 1TY0A 1F9QA 4TKOB 3HOZB 3L7ZC 3KUPA 1QNKA 3R8BA 4FXGC 4J6HA 1DONA 3URYA 2SEBD 4DNRB 2B63B 1K8OA 5KYLA 3GQBA 5JPMC 5FK9C 3MEHA 1IYUA 1RJTA 1TVXA 1PRTD 4RCNA 1U9RA 1FNUA 4KJNA 3VR2A 1TS4A 5CV9A 5D3IB 4HN7A 1PRTC 4H0LC 2K6AA 4ID6A 1A6XA 5EPLA 5IGGA 1Y8NB 5M3FB 3NWTA 1JWMD 4IFDI 2H1EA 3PO2B 2ZT9C 4KTAA 4IZ8A 3K6OA 1STHA 1WD1A 2RKSA 1STBA 1EY9A 4V0BA 4X3KA 2PZUA 1E2WA 1PTOC 5FLXL 2B2YC 4DK0A 3H3VC 2AUJD 1QCBD 3A7AB 3ND8A 4OL7A 2ICEC 2XRSD 3R3OA 3MHBA 1CA5A 4DGZA 1M4VA 4G7HC 1IKLA 4CBVA 2EYOA 4C3JB 1QWYA 5KEEA 2SDFA 4K8JA 3CQZB 1O7LA 1H9SA 1JE4A 1B1ZA 2RDHA 2EJGC 5E4WC 5CV7A 2E2DC 3DWQA 5IT9E 1HA6A 2E2JB 1O80A 2JE6I 1EY7A 4ZUJA 1V1PB 5C4JB 2KCCA 2X6LA 2O2LD 3FPPA 3PIO3 1QG7A 1HTLD 1YNNC 3SK4A 1TIID 5FO9B 3LWEA 4IUTA 4C2MB 1BO0A 1G8ZD 5D14A 2RSNA 2VB2X 1LTID 4L6TB 5DAUA 1RF2D 4ULLA 3ITPA 5KYIA 4Q0FA 2G9DA 4C56C 3HS0C 3NPPA 4QUCA 1LT3D 1VF7A 2X6GA 2J7ZA 3RLFA 1D1KA 5DM63 1T5XD 2L4NA 2YU9B 2B2VC 2IWHA 5CR3A 1SNOA 4G4KA 4L8JA 5IGCA 4XYOA 2RDGA 3DWPA 1GXDC 3Q22A 1JOOA 1TS2A 1IKMA 4EQOA 5C0XJ 1Z6HA 4QMGA 1NAPA 1PZID 1LACA 3I4NB 2F03A 2A6ED 3IL8A 1F2MA 3BDOA 3HOWB 4BS9A 1F9SA 1E0BA 1PRTF 2HCCA 1CZGA 4CGYB 1XTCD 2RA4A 5HGTA 3P75A 1EEFD 2NYZD 3KK7A 1I4HA 3I91A 4TSSA 1EZ6A 3PUZA 1CA6A 3TP5A 4FO2A 1JORA 4A3MB 1BOSA 4RHRA 2DY8A 1JB3A 4ZKBB 1EYAA 3OPOA 3FRPB 2EYPA 3R2IA 1CK1A 4YIJA 3NTIA 3VYSA 1NSNS 2Q8RE 1L0XB 1SSOA 4R9WA 3HEJA 1S5CD 3K59A 4CKCA 1WTPA 1SDFA 1Y8OB 3VYRA 4OO1G 1LLRD 2E2HB 1JWSD 2DY7A 4KY5A 3GTOB 2ZXOA 1CT1D 1C8CA 2K5QA 1HA5A 1UEAB 2D5DA 3NSWA 1EL0A 2JXMB 1SNCA 3PO3B 2AQ2B 1HUNA 4K2LA 5CV6A 1SE3A 3BS1A 5BN3A 5J22A 2B8GA 3FMCA 2PW7A 5C0XG 2JEAI 4OO1H 4IFDJ 3G6JB 4KJOA 1BBXC 2IW3A 3I72A 4KKSA 3I90A 3GV3A 1MBYA 4K14A 1PZJD 1RDPD 2F0HA 4DK1A 4E6IA 2R6GA 3DEOA 3I70A 4PNYA 3QOJA 3DM1A 2E75C 3QB3A 1I4GA 3E0JA 5ELEA 2A6HC 1VDZA 1EU3A 5ISRA 1EWCA 4XQNA 2WP8J 1RTNA 3GO5A 3UI2A 5JAVA 2EYFA 3K58A 3LNNA 4RGNA 2NN6I 3BVZA 3MTSA 2KEDA 4A93B 3S1MB 2JYOA 3GP7A 1KNAA 3A7LA 5IGBA 4V190 2F0VA 2F0FA 1M8AA 4ILWA 1YNJD 4IN3A 4HTHA 1LTSD 3K0YA 1G291 2NUCA 1WVLA 2J4XA 1D5MC 3JAML 5EPKA 3MVVA 5FO8B 1Y69U 2L55A 2VUMB 1BXTA 4HAEA 1ENCA 3T16A 4QUFA 2JA6B 1SFOB 3J80E 2K01A 5M5WB 2QCPX 1SNPA 1HFGA 2C9OA 3RZOB 2KOLA 4IUVA 1BCPB 1TY2A 4HMIA 3TP6A 2B2YA 2K28A 2MP1A 4TRDA 3PUWA 1J9OA 2XVSA 4RH6A 3VYTA 2B8FA 3CKIB 5E3FA 2F0EA 4KN4C 2EYHA 4ODGA 1LO5D 4DXGA 3DEPA 1B9MA 5IGDA 1EQTA 1MGSA 1FR3A 2A73B 1I6VC 3I4MB 4C1NK 1KAAA 5EKKA 4RGTA 2NVYB 1FNWA 4RHSA 2CW0C 4RGOS 2ZXRA 1A3UA 1D2BA 4G7OC 1ZKOA 3GTGB 1O7YA 3MXGA 4PV1C 3OIQA 1HXYD 1AZQA 4JBWA 4MHEA 3M4OB 1KABA 5ELCA 3T56B 2WINB 3H0GB 4ZYSA 1C4QA 3K7AB 3NTHA 1EY5A 3VR5A 3VR3A 3FEWX 2B2TA 1SYFA 2AWNA 4EQNA 2WACA 4K6DA 2NN6G 3TDQA 1V8QA 1SE2A 1W6KA 1FNVA 2Y0SB 1NR2A 1GUNA 2F0SA 1S5FD 1BCPD 3Q23A 5I9PA 1BQQT 4A3IB 3EJIA 2KQ3A 3RZDB 4PMWA 1V1OA 1RODA 3QJYA 4RAUC 1HHVA 3S15B 2F0KA 4BBSB 1GJXA 5JEAG 4QCLA 4G7ZC 1PMRA 1PLFA 4TQUS 1TWAB 1F2YA 1SEBD 4N9TA 5DM73 3C1EA 3OHXC 5LHY1 2B39A 2NVTB 4ZQ3A 1E2VA 4RWSC 5EBCA 1JICA 3W2DA 4IUUA 3W3AA 1DOMA 2WIIB 5ELDA 1Q3LA 2MJ8A 1ET6A 1SYGA 2PQEA 2F0LA 2K7VA 2EOTA 1PTOD 1TQOA 5IOCA 3QG1A 1J8IA 3PIP3 1LTTD 2F1MA 3KLRA 3Q6SA 3FKIB 1V1PA 1RHPA 1CTMA 1STAA 4HSPA 3G7LA 2EY1A 4F88A 3GD7A 1IYVA 5C6AA 5M9OA 1GUTA 2R7ZB 5C4XB 5C3WA 2V4DA 3C3LA 2EE1A 5C3EB 4EGVA 4O42A 3TMEA 4RGMA 1ENAA 3K5NA 1BUVT 4XT1B 1VMPA 2SNMA 1MSHA 1F2LA 1SMYD 2WKDA 2PW5A 4C3IG 1SYDA 1A2TA 1OXUA 4CKBA 4CJ0B 3T51B 2JA5B 5DNFA 5M5XB 2MUYA 2DN8A 1SNDA 3I73A 1SMYC 2BA0A 3BZDB 3F2UA 4Z9CB 1QJOA 2MPMA 3AB9A 3DXJC 5DEHA 2QDBA 3VR6A 3X3NA 3A56A 1B44D 1G91A 1Q90A 3QWNA 3J81L 5LL6S 5A35A 1KLUD 2FJ2A 1LTBD 1TWFB 2L1BA 4ZK9B 4QB4A 3HG9A 3J80L 2O5JC 2AUKA 2WB1B 1B9NA 5CBEE 1I6HB 2FMMA 1B53A 1VF5C 4XIGS 1H9SB 1YNJC 4OGQC 4FNFA 1DCZA 3V96A 1HUMA 4S3SA 2BDNA 2VB3X 4C1NI 1EEID 2NZ1D 4CJ2C 3SK8A 4DU9A 3H94A 3FVQA 1OXXK 1STYA 5CC4A 2LY7A 1BCPC 4R8NA 1XX8A 2PZWA 4F8MA 4CHTB 2KJXA 2SOBA 2B2UA 3EFXD 1F9RA 4KKTA 3OOCA 1EYDA 4O1NA 3LX0A 4KV6A 4C3JG 5C0XH 1HCZA 2K5DA 1STEA 4U68A 4F7XA 3BDCA 4FYDA 3TSSA 3A8JE 2HDMA 4I65A 4P2CB 2A69C 3C1FA 3NE5B 1UAPA 3HRZC 1R9TB 1SNQA 4DN4M 5C5MA 2QF7A 4XQQA 2NVXB 5K36H 4ZKCB 1CQFA 2CQAA 2PZTA 2O5IC 2LFNA 2R93B 5COYA 1A15A 1TWHB 2D9UA 3MA2B 4M1UB 4LJZC 3LWUA 3P7JA 1U4MA 3CU7A 1H9MA 3EQLC 3OW7A 4G57A 1SYBA 2I46A 5K5PA 3PMFA 4MN3A 1LT5D 2JSOA 2CHBD 4IFDG 1STGA 3AMUA 2K5WA 4Y7NB 1JWUD 3SXHA 2XWBB 4DFAA 4FF2A 3NBIA 1PZKD 5EBDA 5C5LA 4XDXA 3NBHA 1PXUA 3A55A 3P20A 4C3HB 3EROA 2B2TC 4XQJA 4A3BB 3KLSX 1IL8A 5FLXE 1HRJA 4IFDH 3SHLA 4IURA 1EY6A 3D4WA 4PMBA 4H7BA 2KHSA 3OIPA 4X3SA 1I4XA 2K04A 5JEAH 1DXMA 2K05A 3M3YB 3H6MA 3I3CA 5CYUA 4DAPA 2XRQD 1UNSA 1B4OA 1U4LA 1D5XC 3MXUA 4K8IA 3VYUA 2X69A 2NTSA 1I4PA 1ZYRC 1MSGA 4NDXA 2A6EC 3BG3A 3S9WA 1EYCA 1TWCB 3GTLB 2OF1A 4ABNA 5C4ZA 3GTJB 2KVMA 2NB0A 4WJWA 1R4QB 3V2TA 1KDAA 2TSSA 4BY1B 3TN2A 3I8ZA 1JQYD 3Q24A 2RBMA 1BDOA 2L0CA 1TR5A 3D8GA 1ML0D 5KNCA 5JVG3 4IUPA 1ZEQX 4J8QA 2WV6D 2XSCA 2KCNA 1MI2A 2O4XA 3D4RA 3PUXA 1Q8IA 2B2WA 5I9OA 1HQMC 3S2HB 2WKCA 3S14B 3HKZB 2F0PA 4F87A 2PMZB 2EYLA 4BWGB 2GA4B 2M9VA 4FP5D 1CHPD 5EQ0A 1BNZA 2Q8TA 1ONLA 5A2QL 3DHQA 1GUOA 2F0DA 3C2PA 1JOQA 4RKLA 4A3FB 4KK7A 2L9HA 3OWFA 5C3XA 2AQ3B 3M7GA 2OXPA 4DXFA 1F2ZA 2NWGA 3S17B 2FFKB 3PV0A 4LAAA 2F3WA 3H09A 5JOBA 4RA8A 5IT9L 1X32A 1KLGD 1QE6A 1RCVD 1A2UA 5I4DA 4BA1I 4KY6A 5TSSA 1KNEA 3KLSA 4Q5VA 1LT4D 1GHKA 3P1HA 4B9WA 1SXTA 3CHBD 5NUCA 4K2KA 2IT1A 3N52A 5JPNC 1QB5D 3J7AF 1OXSC 1BR9A 3K5OA 1LTAD 3V05A 3MAQA 2JA8B 1VCIA 1Y8PB 3NQIA 3NXWA 2PO4A 4XYQA 4I7ZC 2IX3A 1STNA 4XT3B 3CRLC 2CVRA 3NUCA 2F0OA 4AYBB 4L63B 1W6JA 3VR4A 2AWOA 5KRUA 1EFID 1G2TA 1SYEA 1YNND 1PTOF 3PUVA 2EY5A 1FGBD 5T1IA 2EVBA 3T53B 1B3AA 3ERQA 3J7AV 1HQRD 1X3PA 2LKVA 2XNAC 3J81E 4QIWB 2F0WA 3HGBA 5FOBB 2QKIC 5CV8A 2YYZA 3SK6A 4K5XA 2FINB 1Y1VB 3GTQB 4OHJA 4DAVA 1JCKB 1LABA 3R2TA 5IGFA 1PYWD 1TU2B 3KBGA 4A3EB 3NQTA 2BE5D 1O78A 1RD9D 3HP3A 1Q1BA 4XXEA 2B2UC 1PTOH 4K5WA 2L5TA 1AN8A 1S5BD 5CBAE 4ZAIA 5EPJA 1QOHA 3VA5A 1II3A 2Z4HA 1XYIA 2TMPA 3EVQA 2LS01 4KI0A 2RQXA 1KDBA 2EJFC 3T4AC 5F2DA 3NTKA 1C48A 1CFMA 1TWGB 5CV5A 4H44C 3QO2A 2H4OA 1OXTA 2XIWA 2PYKA 1WTRA 3MFYA 1A3VA 4ME5A 1DZ1A 3HOYB 3O13A 2HCIA 4OO1I 5I6YA 3M4YA 3KF8A 1PTOB 3SR1A 3OWEB 4ZUIA 3TZDA 5C44B 2XN9C 1GOZA 3BYYB 4RFBA 3TP7A 1KDCA 5G3LD 1ENFA 3L9AX 3U9SA 4IUQA 3GTKB 5HURA 2FHTA 4B08A 1IHZA 3DMUA 3E6ZX 1H9RA 4KHVA 4KN7C 5C0XI 1AP0A 2EZVA 3J7YW 3N6RA 2EPBA 4RCOA 2A5HA 1DJRD 1RTOA 3M7NA 3AU7A 3D31A 4KD3A 5I6WA 2JA7B 5IIFA 3GTPB 3CRKC 2K1BA 2ENBA 1PFMA 1DYQA 1S5DD 1SE4A 3R93A 1LT6D 1AEXA 2EYMA 2I07B 2D2CC 3TP8A 3SDZA 5M3MB 2IPKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQE A;  1ENC A;  3BDL A;  3T16 A;  4S3S A;  5CV5 A;  1NUC A;  3D8G A;  3TME A;  1STG A;  5J39 A;  3OSO A;  1ENA A;  3HZX A;  5HGT A;  1EZ8 A;  4NP5 A;  5CV4 A;  1SNM A;  4KJO A;  3P75 A;  5I9P A;  3EJI A;  2KQ3 A;  4NKL A;  2RDF A;  4B9X A;  1STN A;  3SXH A;  3SK8 A;  3QOL A;  4DU9 A;  4EVO A;  2SNM A;  2PYK A;  3MXP A;  1SNP A;  4DFA A;  2F3V A;  3NUC A;  5IOD A;  1STY A;  1A3T A;  4K14 A;  3T13 A;  2O4X A;  4HMI A;  2F0O A;  2PW5 A;  1SYD A;  1A2T A;  2EYJ A;  5CV7 A;  3TP6 A;  5CC4 A;  1EZ6 A;  2F0H A;  5C5L A;  4E6I A;  1A3V A;  4ME5 A;  4TRD A;  4WOR A;  1EY8 A;  2F0K A;  4R8N A;  5I9O A;  4IAL A;  5I6Y A;  3TP5 A;  4PNY A;  4PMC A;  5KRU A;  3QOJ A;  4F8M A;  2PZW A;  1SYE A;  3ERO A;  4J6H A;  1JOR A;  2F0P A;  1EY7 A;  2F0Q A;  5E3F A;  2F0E A;  2SOB A;  3QB3 A;  4ZUJ A;  3SR1 A;  5C4H A;  4ZUI A;  2EYH A;  4ODG A;  3D6C A;  2EY5 A;  4NMZ A;  5KYL A;  3SK4 A;  1EYA A;  1RKN A;  1SND A;  3MEH A;  2F0T A;  5IGD A;  5EGT A;  5KIX A;  5EKL A;  2EYL A;  1EYD A;  5ISR A;  2EXZ A;  2EYP A;  5KGU A;  3LX0 A;  2F0U A;  2OEO A;  1JOK A;  3ERQ A;  4KV6 A;  1F2Y A;  3SHL A;  3TP7 A;  1KDC A;  1EY6 A;  1U9R A;  3D4W A;  3NP8 A;  5CGK A;  3DHQ A;  1KAA A;  4KJN A;  4K5V A;  4N9T A;  2F0D A;  4H7B A;  3C1E A;  2QDB A;  4PMB A;  5CV9 A;  4YIJ A;  5DEH A;  5EKK A;  1NSN S;  2LKV A;  4HMJ A;  1JOQ A;  3U9O A;  4RKL A;  4ZQ3 A;  4RKB A;  4F7X A;  3BDC A;  2F0W A;  3OWF A;  4ID6 A;  4QF4 A;  5C3X A;  5HUR A;  2M00 A;  2F0M A;  2F0G A;  1A3U A;  2OXP A;  5IGG A;  5JAV A;  1F2Z A;  2EYF A;  2KHS A;  1EQV A;  2SNS A;  3HEJ A;  4DF7 A;  1EY0 A;  4LAA A;  5CV8 A;  1IHZ A;  2EY6 A;  3DMU A;  2F3W A;  3D4D A;  3NK9 A;  4I65 A;  4K5X A;  5DAU A;  3SK6 A;  3C1F A;  5JOB A;  3ITP A;  4J1M A;  5KYI A;  3H6M A;  4KHV A;  4IUN A;  1SNQ A;  5C5M A;  3E5S A;  2F0J A;  5IGF A;  1SYG A;  3OMG A;  2PQE A;  3NHH A;  4K8I A;  2EY2 A;  2F0L A;  1A2U A;  4IZ8 A;  4KTA A;  1TQO A;  1STH A;  3OMC A;  2F0N A;  2RKS A;  5IGB A;  5IOC A;  4N9P A;  1SYC A;  2F0V A;  1STB A;  2F0F A;  2F0I A;  3NQT A;  4KD3 A;  2PZT A;  4KY5 A;  1EY9 A;  5I6W A;  5J1Z A;  1KAB A;  4KY6 A;  4KD4 A;  5IIF A;  2PZU A;  4NDX A;  4QB4 A;  5IGE A;  4K5W A;  3SK5 A;  5CR3 A;  3S9W A;  1EYC A;  1SNO A;  3P1H A;  4HTH A;  4KY7 A;  5IGC A;  1EY4 A;  4B9W A;  1EY5 A;  1STA A;  2ENB A;  1SNC A;  2OF1 A;  1SYF A;  2EY1 A;  4K2L A;  4OL7 A;  5NUC A;  4EQN A;  5C4Z A;  3R3O A;  3MHB A;  4K2K A;  5CV6 A;  2NUC A;  1JOO A;  4WRD A;  3RUZ A;  4EQP A;  1AEX A;  2WAC A;  5C6A A;  4DGZ A;  5J22 A;  1TT2 A;  3V2T A;  3VA5 A;  4EQO A;  1II3 A;  1KDA A;  4K6D A;  3NXW A;  4QMG A;  3EVQ A;  5M9O A;  4G57 A;  5E1F A;  2EYM A;  1KDB A;  1SYB A;  4MIU A;  2RBM A;  5K5P A;  2PW7 A;  5C3W A;  3PMF A;  1F2M A;  3MVV A;  3TP8 A;  3MZ5 A;  5F2D A;  2EYO A;  5KEE A;  4K8J A;  1TR5 A;  2F0S A; 
#chains in the Genus database with same CATH topology
 2A74 C;  2OT2 A;  3RD4 A;  2HQE A;  4DAY A;  3GTM B;  4B3R L;  5J39 A;  1Q1E A;  3OSO A;  1V9P A;  3HZX A;  2VUM G;  1EZ8 A;  4HED A;  5IYB G;  1SNM A;  1SJH D;  3KDF B;  2A19 A;  4GLA C;  3NEM A;  2JEB I;  2GVA A;  2JP1 A;  3MXP A;  3GV6 A;  4HCS A;  1PDQ A;  2K75 A;  2F4I A;  3HOX G;  4HJ9 A;  2MGS A;  2M2L A;  1F77 A;  3CCL A;  3KF8 B;  1HNW Q;  1JC7 A;  2GN5 A;  2R61 A;  1Y1W B;  2C5C A;  2XTI A;  4R8I A;  1XPR A;  2CQO A;  1U4P A;  4JCV E;  2AHO B;  3A8I E;  5M5Y H;  1AH9 A;  4KHZ A;  3OYY A;  4DV5 L;  2K5V A;  1TWC H;  5KNB A;  1U4R A;  3HOU B;  5KIX A;  5EKL A;  1XPU A;  2UXC Q;  1BCP F;  3ULL A;  1K8M A;  4POG A;  2CW0 D;  2E76 C;  2IX1 A;  1B2T A;  1HJP A;  3SEB A;  1GUG A;  5JVH 3;  4HCE A;  1DOK A;  1ESF A;  1SR3 A;  2ZXP A;  4X66 L;  1D5Z C;  4RKB A;  4XTC S;  1DD2 A;  2NBF A;  2M00 A;  2YV5 A;  1WD0 A;  1K3B C;  1EQV A;  4FVM A;  1EY0 A;  2UXB L;  2PCF B;  2EY6 A;  4OWT B;  3D4D A;  2RSO A;  4J1M A;  4NPS A;  3UDF A;  4UAI A;  1X54 A;  1S4Z A;  1XJV A;  4LF6 Q;  2BE5 C;  4O2D A;  1CHQ D;  3E5S A;  2E74 C;  2QIL A;  3OMG A;  3NHH A;  3HKZ G;  1Q12 A;  1KRS A;  1X3F A;  1Z47 A;  5J1Z A;  4ZLT F;  2A68 D;  3NBH B;  2K5N A;  4JI8 Q;  1WTO A;  1N36 L;  1B50 A;  2ICI A;  2QEJ C;  1I4R A;  2EDG A;  4B3S L;  1XXG A;  1X56 A;  2NVQ B;  3IKJ A;  4P74 A;  3RUZ A;  3F1Z A;  4H13 C;  1FYC A;  2RVL A;  1TT2 A;  1RL2 A;  4LWC A;  2VY3 A;  1HR0 Q;  1V1Q A;  4A3F G;  2Z8L A;  1CSQ A;  4EQ5 A;  5IP9 H;  1ESR A;  1Q86 C;  1VQ7 A;  1MJC A;  4DR3 Q;  1FL0 A;  3I4N G;  1AW7 A;  4HIO A;  1R4P B;  1CI3 M;  3BZK A;  1TWH H;  3Q0A A;  4KMU C;  3BDL A;  3CC7 A;  2FMC A;  3IAY A;  5LMN W;  5LMN L;  3GTL H;  4NP5 A;  3IFD A;  3ONA B;  2RDF A;  3WOE A;  4R4Q A;  4JOI C;  3K5M A;  1GUW A;  3A74 A;  1G2S A;  4JI2 Q;  1ILQ A;  1CM9 A;  4A93 G;  1ILP A;  1A3T A;  2J0T D;  3T13 A;  3RNU A;  3D6W A;  1J5E Q;  2IJ0 A;  4H02 A;  3K57 A;  1T5E A;  3S1Q B;  2B63 H;  1KIX A;  3K80 C;  1EOT A;  3JAM i;  5BN4 A;  1L0Y B;  2F0Q A;  5COR A;  1GO3 E;  5C4H A;  4J15 A;  5ELN A;  4NMZ A;  1Z7T A;  4GOP C;  1S3O A;  3S2D B;  1B3Q A;  2F0T A;  1I4Q A;  3BVG A;  4BA2 I;  2PPB C;  1H95 A;  3S1R B;  1SAP A;  2R7D A;  2EXZ A;  1L1O A;  2OEO A;  2LXK A;  3ND9 A;  2K03 A;  1EIH A;  1OO9 B;  3NP8 A;  5CGK A;  1AE2 A;  2Q2I A;  5FO7 B;  3PF4 A;  4X3U A;  4X65 Q;  5E4X A;  1GUS A;  4KKU A;  2E2I B;  1GD7 A;  1IW7 C;  1B70 B;  1VQN A;  1TS5 A;  4X62 Q;  2F0G A;  4JI0 Q;  5M3M H;  5FKA C;  2JA8 H;  4A93 H;  4WFN 3;  2SNS A;  3KBX A;  1QNU A;  5EKI A;  3PSI A;  3W1G A;  2IX0 A;  3RMH A;  1TWG H;  1S40 A;  1DOL A;  1Y14 B;  1VS0 A;  4JI4 Q;  1WCM B;  2EY2 A;  3WOF A;  3S1N B;  2F0N A;  5FJ8 G;  2KUM A;  2PNR C;  2Q8I B;  1PFB A;  4KD4 A;  1QVG A;  3BZC A;  3SK5 A;  4CKE A;  1VQD A;  5EJW A;  4LMQ D;  1SJE D;  1AFP A;  2A6H D;  2R3Z A;  4X3T A;  4CJ1 B;  3S16 B;  3KFU A;  3K5L A;  1D1I A;  1FJG L;  4IJL A;  4R4I A;  2R7Z G;  4WRD A;  1HFN A;  1LYL A;  5I2X A;  2NZO A;  1BBW A;  5FLM G;  4JC0 A;  3MFG A;  5ELF A;  2CWP A;  1EU4 A;  4BBR B;  4LK1 C;  1QIL A;  1QVF A;  5LL6 X;  4IQZ A;  3I4M G;  3MZ5 A;  1CZW A;  5C4X G;  4DK3 C;  4JI6 Q;  1F9P A;  3UE0 A;  2L15 A;  4YHH Q;  3WDN A;  1NUC A;  4OIJ A;  4EX5 A;  4A3D B;  4UPA A;  1VMC A;  4FF3 A;  1D6E C;  2KHI A;  3CCE A;  4X6A H;  3MC0 B;  1V43 A;  3QOL A;  1O7Z A;  3CW2 C;  5IP7 G;  1TWA H;  3D3R A;  4DR1 L;  5IOD A;  2NVY H;  1ZXT A;  1WTQ A;  4DV5 Q;  5JJZ A;  5CMD A;  5K36 G;  1NR4 A;  1EIG A;  1YBY A;  3FDT A;  2RCF A;  3FPU B;  3MWY W;  4DNT B;  4C3I B;  4PMC A;  2IL8 A;  3Q8D A;  1NCV A;  2HDL A;  4DR5 Q;  4LFA Q;  2B2V A;  4AIM A;  2CFM A;  3H0G G;  5M5Y B;  5EGT A;  2VQE Q;  3TBI B;  5I2Y A;  3H91 A;  2R92 B;  5KGU A;  2LXJ A;  1FD7 D;  2F0U A;  1JOK A;  2L11 A;  1LTG D;  2VNU D;  5IY0 A;  3EA6 A;  1XMO L;  1IXR A;  4DA2 A;  4HMJ A;  2N55 A;  2Z4I A;  4PQX A;  1VQE A;  4A3J B;  1VQC A;  2N88 A;  1HPC A;  3HOW G;  4DR4 L;  1PRT B;  3NK9 A;  3TEH B;  1E2Z A;  1Q46 A;  3PUY A;  2KEE A;  1YI2 A;  3A54 A;  4IUN A;  3PQI A;  5C4J H;  4A4I A;  5G3L F;  3S1N H;  2KA7 A;  2F0J A;  4A3I G;  2EJM A;  1MD2 D;  3M4P A;  3VA7 A;  3OMC A;  2N49 A;  2Z1C A;  4GZY C;  4N9P A;  2F0I A;  4C3H G;  3KOJ A;  2PI2 A;  3K7A H;  1ET9 A;  3DWA A;  1HTP A;  1K83 B;  3T1Y L;  4ZRZ A;  2K14 A;  4NW2 A;  3S2H H;  3RZD H;  5IP9 G;  1PH5 A;  4GKJ L;  3U4Z A;  2MHV A;  1HNZ L;  4AYB E;  5ELB A;  1SBB B;  2L12 A;  2A69 D;  3M85 A;  4EQP A;  3X3M A;  1GKH A;  2BA1 A;  2K33 A;  4A3K B;  1DM0 B;  3JAM E;  1KTK A;  5BN5 A;  4IPH A;  1XWE A;  4L5Q A;  3OTO Q;  2QGQ A;  4BY7 B;  5E1F A;  4UP8 A;  5IYC G;  4MIU A;  5JJK A;  2UU9 Q;  1TKW B;  2BDO A;  3BVM A;  4HSV A;  1WOC A;  4L5T A;  3SVM A;  2LMC B;  4FXD A;  3TZU A;  1JB7 A;  2G5D A;  2AQ1 B;  2ID0 A;  5CV4 A;  2VQF L;  4EVO A;  2JA6 G;  1JJG A;  1N8R C;  1LV9 A;  4GN5 A;  1WTX A;  3ZYY X;  4HJ5 A;  3K0X A;  2EYJ A;  1Z9F A;  4WOR A;  3IFT A;  1PV4 A;  4DV1 Q;  1EY8 A;  4LNQ A;  3NWS A;  4IAL A;  4KHP L;  1YIT A;  4U67 3;  1CQV A;  3DLL A;  2JJQ A;  3NEL A;  2BH2 A;  4IOA A;  3A8K E;  5D65 A;  4DUZ L;  3D6C A;  1AZP A;  3PGZ A;  1RKN A;  1H9K A;  1X3Q A;  1S5E D;  1I3Q B;  3QIA A;  3PO3 G;  2XWJ B;  4NXM L;  5T1G A;  2WAQ B;  4HR7 B;  2NN6 H;  4IOC A;  4K5V A;  3EN2 A;  2KCT A;  4RMF A;  1TS3 A;  2BOS A;  3HOV B;  2D62 A;  3U9O A;  2PMZ E;  3C46 A;  4QF4 A;  1Q8K A;  2LSS A;  3I4L A;  1QZH A;  2F0M A;  2BCO A;  1EWH A;  5JJI A;  3I2Z A;  4DF7 A;  3L3O C;  1C9O A;  1WTW A;  2MO1 A;  1U5K A;  4UDU C;  1H9J A;  5JJL A;  2G9H D;  4A75 A;  4A3G B;  4FF1 A;  3KJO A;  1ICW A;  3HOX B;  1K3R A;  5AFW A;  4LF8 L;  1BF4 A;  1KAW A;  4JK1 C;  5KND A;  3CMA A;  1Y1W G;  1IW7 D;  2B2W C;  1UUP A;  5A2Q E;  3AYH B;  1PFN A;  1SYC A;  1LTR D;  4K6L A;  4M8A A;  5IGE A;  1Q82 C;  1CKN A;  1JE5 A;  2DNE A;  4KY7 A;  1EY4 A;  3BYT B;  5JEA J;  1K0S A;  4FF4 A;  3CF5 A;  2A8V A;  1G6Z A;  3MXN A;  4LUV A;  3H3V H;  3DUZ A;  4OEM B;  1PVO A;  4OX9 L;  4LUZ A;  1PA6 A;  3JC6 6;  2NTT A;  2JQO A;  1JR0 D;  1N34 Q;  1HH2 P;  3RR5 A;  3SE0 A;  2KEC A;  4FXK C;  4A76 A;  1WTV A;  1I50 B;  2K32 A;  2QW7 A;  2E2I H;  1JT8 A;  4NKL A;  1SRO A;  2VXW A;  2K4K A;  4OIK A;  3PIP A;  4B9X A;  2DNC A;  4DV6 Q;  5D3D A;  3VDY A;  1GHJ A;  4DR7 L;  2F3V A;  2A68 C;  4B3R Q;  2HUG A;  1ZYR D;  3CCJ A;  1OXV A;  1TY0 A;  3M4Q A;  1F9Q A;  4TKO B;  3HOZ B;  3L7Z C;  3KUP A;  1QNK A;  3R8B A;  4GNX B;  4FXG C;  1JJC B;  4J6H A;  1DON A;  3URY A;  2SEB D;  4DNR B;  2B63 B;  1K8O A;  5KYL A;  3CP0 A;  3GQB A;  5JPM C;  5FK9 C;  3MEH A;  3DM3 A;  1IYU A;  1RJT A;  1TVX A;  4BXX H;  1PRT D;  4N8X 1;  4RCN A;  3HOV H;  1U9R A;  1FNU A;  4KJN A;  3VR2 A;  1TS4 A;  5CV9 A;  5D3I B;  2JA8 G;  1VQL A;  4JYA L;  4HN7 A;  1PRT C;  4AQY L;  4H0L C;  2K6A A;  4ID6 A;  1A6X A;  5EPL A;  5IGG A;  3GTJ H;  1Y8N B;  2OTL A;  5M3F B;  1RIP A;  3NWT A;  1JWM D;  2N78 A;  4IFD I;  2H1E A;  3PO2 B;  2ZT9 C;  4DV2 L;  4KTA A;  4IZ8 A;  3K6O A;  1STH A;  4R4C A;  1WD1 A;  2RKS A;  4YY3 Q;  1STB A;  4B3S Q;  1EY9 A;  2DGY A;  4V0B A;  4X3K A;  4DKA C;  3H15 A;  2PZU A;  1E2W A;  1PTO C;  1NY4 A;  2B2Y C;  5FLX L;  4BBS H;  2NZH A;  3OTO L;  4DK0 A;  1EYG A;  3H3V C;  5IYC H;  2AUJ D;  1QCB D;  3A7A B;  3ND8 A;  4YCW A;  4OL7 A;  2ICE C;  2XRS D;  3R3O A;  3MHB A;  2ZJQ A;  1CA5 A;  4DGZ A;  4YWK A;  2UUB Q;  1M4V A;  2YTX A;  5DLQ E;  4G7H C;  2WAQ E;  1IKL A;  3S2D H;  2I5M X;  4CBV A;  1DGS A;  2EYO A;  4PZ6 A;  4C3J B;  1QWY A;  2N8N A;  5KEE A;  2SDF A;  4K8J A;  3CXC A;  3CQZ B;  4HJ8 A;  1O7L A;  3GTP H;  1XNQ Q;  5M5W H;  1H9S A;  2ZM6 Q;  4QGU A;  1JE4 A;  1B1Z A;  3CME A;  2WFW A;  2RDH A;  5HGQ A;  3S15 H;  2EJG C;  1U0L A;  5E4W C;  1VQJ A;  1VQ4 A;  4DR6 Q;  2B29 A;  5CV7 A;  1JJ2 A;  2B3G A;  2E2D C;  3DWQ A;  5IT9 E;  4ME3 A;  4OEL B;  1HA6 A;  2E2J B;  1O80 A;  3H0G H;  3NEN A;  3PO2 H;  4LF4 L;  2JE6 I;  1EY7 A;  4ZUJ A;  1V1P B;  1YVC A;  5C4J B;  2KCC A;  2X6L A;  1HZC A;  2O2L D;  3FPP A;  3PIO 3;  4DV3 L;  5GRO A;  1QG7 A;  1HTL D;  1YNN C;  3SK4 A;  4B3T L;  3CAM A;  1WFQ A;  1TII D;  5FO9 B;  3S14 H;  3LWE A;  4IUT A;  4UY8 C;  4C2M B;  1BO0 A;  3JAM c;  1G8Z D;  2ASB A;  1I3Q H;  1GVP A;  5D14 A;  3M3Y H;  1VQG A;  2RSN A;  4LF8 Q;  2I5L X;  2HIX A;  1LTI D;  2VB2 X;  2OQ0 A;  4L6T B;  1HR0 L;  2Y0S G;  5DAU A;  1RF2 D;  4ULL A;  4GLX A;  3ITP A;  5KYI A;  4Q0F A;  2E8G A;  2G9D A;  4C56 C;  3HS0 C;  3NPP A;  4QUC A;  1LT3 D;  4UP7 A;  1UE1 A;  1VF7 A;  2X6G A;  2J7Z A;  4YCU A;  3F2B A;  3RLF A;  1EIY B;  1D1K A;  2VQF Q;  1BBU A;  5DM6 3;  1T5X D;  2L4N A;  2YU9 B;  2B2V C;  2IWH A;  5CR3 A;  4B3M L;  1YJ9 A;  1SNO A;  3LGJ A;  4G4K A;  4L8J A;  5IGC A;  4XYO A;  4DAM A;  2RDG A;  3DWP A;  1GXD C;  1YEZ A;  3Q22 A;  1JOO A;  1TS2 A;  4A3B G;  1IKM A;  4EQO A;  1N9W A;  5C0X J;  3S1Q H;  1Z6H A;  4QMG A;  1ICF B;  1K0R A;  1NAP A;  3TRZ A;  1PZI D;  1LAC A;  3FP9 A;  2D0O A;  2F3I A;  3QR8 A;  2F03 A;  3HOU H;  3I4N B;  2A6E D;  3IL8 A;  1F2M A;  3BDO A;  3HOW B;  1VQ6 A;  4BS9 A;  1F9S A;  1E0B A;  1PRT F;  2HCC A;  1FVI A;  1CZG A;  3AFP A;  4CGY B;  1EQR A;  1XTC D;  2RA4 A;  5HGT A;  4GOP B;  2OCE A;  2MFI A;  3P75 A;  4X65 L;  4MTN A;  2ZJR A;  1EEF D;  3E9I A;  2NYZ D;  2XGT A;  3KK7 A;  1I4H A;  1M1K C;  3RLN A;  4BXX G;  3I91 A;  4IO9 A;  4TSS A;  4P72 A;  1EZ6 A;  1EWI A;  3PUZ A;  1G6P A;  1CA6 A;  1YZ6 A;  3TP5 A;  4FO2 A;  4UP9 A;  4A3M B;  1JOR A;  1IBM L;  1BOS A;  1R9T H;  4NXN Q;  4RHR A;  2DY8 A;  1JB3 A;  1A0I A;  4A3K G;  4ZKB B;  2H5X A;  1EYA A;  3WWV A;  5L37 A;  3OPO A;  2Z6K C;  3FRP B;  3EIV A;  2KHJ A;  2EYP A;  3R2I A;  1CK1 A;  5AJ3 Q;  1EUJ A;  4YIJ A;  3NTI A;  3VYS A;  4BY1 G;  1NSN S;  2YTY A;  2MQH A;  3RN2 A;  2Q8R E;  1L0X B;  1SSO A;  5FLX c;  4MTK A;  1XMQ L;  4R9W A;  4JI2 L;  3S1R H;  4DR2 Q;  2RHQ B;  2UUA Q;  3HEJ A;  1S5C D;  4JI5 Q;  4OWW B;  3K59 A;  4CKC A;  4DV4 Q;  1WTP A;  1SDF A;  4JI1 L;  2VL6 A;  1YJW A;  4JBM A;  3CPW A;  1Y8O B;  3VYR A;  4OO1 G;  1LLR D;  2BH8 A;  2E2H B;  1JWS D;  3CC2 A;  2DY7 A;  4KY5 A;  1BVS A;  3GTO B;  2ZXO A;  1CT1 D;  1C8C A;  2K5Q A;  1CKM A;  1HA5 A;  3J7Z C;  2R93 G;  1UEA B;  2D5D A;  1D8L A;  3NSW A;  5IYD H;  1EL0 A;  2JXM B;  1SNC A;  3PO3 B;  2AQ2 B;  1HUN A;  4K2L A;  5CV6 A;  2CCZ A;  4N8F A;  1SE3 A;  4IJH A;  5BN3 A;  3BS1 A;  5J22 A;  3STB D;  1XNQ L;  4KLK A;  4BBR G;  2B8G A;  3ULJ A;  3FMC A;  2PW7 A;  2F4V Q;  1N32 Q;  4A3D G;  5C0X G;  2JEA I;  4OO1 H;  4TVA B;  2MO0 A;  4LF5 L;  1NMG A;  4IFD J;  3G6J B;  4KJO A;  1BBX C;  3HKZ E;  2CKZ B;  2IW3 A;  3I72 A;  4C3H H;  4KKS A;  3I90 A;  4YWM A;  3GV3 A;  1I94 L;  1MBY A;  5IYD G;  4K14 A;  4DR4 Q;  1CKN B;  1PZJ D;  3KJP A;  4DK6 C;  5LMN Q;  1RDP D;  2F0H A;  3AEV A;  4DK1 A;  4E6I A;  2R6G A;  3DEO A;  3I70 A;  4PNY A;  3QOJ A;  3DM1 A;  2E75 C;  3QB3 A;  4QJF A;  1I4G A;  5IWA Q;  3E0J A;  1Y1V H;  3GTQ H;  5ELE A;  2HHH Q;  2A6H C;  1VDZ A;  1EU3 A;  2ZTD A;  5ISR A;  3ULP A;  1EWC A;  4XQN A;  4DV7 Q;  2WP8 J;  1RTN A;  1I5F A;  1HNZ Q;  3I4M H;  3GO5 A;  3UI2 A;  5JAV A;  2EYF A;  1WTH A;  3K58 A;  4P75 A;  3LNN A;  1YNX A;  4RGN A;  1J6Q A;  1VQH A;  2NN6 I;  3BVZ A;  3MTS A;  2KED A;  4A93 B;  5IP7 H;  3S1M B;  1FGU A;  1HNX L;  2JYO A;  4I7A A;  2JA7 G;  2ATW A;  3GP7 A;  1KNA A;  3A7L A;  5IGB A;  4V19 0;  2F0V A;  2F0F A;  1M8A A;  4ILW A;  3FKI H;  1YNJ D;  2VQE L;  1NMF A;  4IN3 A;  3IRB A;  1UE7 A;  4HTH A;  1LTS D;  3G71 A;  3PCO B;  3K0Y A;  1G29 1;  1KL9 A;  1KRT A;  2NUC A;  1N34 L;  1WVL A;  3I7F A;  2J4X A;  4LF4 Q;  2E2J H;  4A3F H;  1D5M C;  3JAM L;  2UXD Q;  5EPK A;  1VQ5 A;  2I5H A;  3MVV A;  5FO8 B;  1Y69 U;  2L55 A;  1W3S A;  2VUM B;  1BXT A;  4HAE A;  4DR7 Q;  4A3I H;  1PH1 A;  1ENC A;  3HOW H;  3T16 A;  4QUF A;  4JV5 L;  1VQK A;  2JA6 B;  5M3M G;  1SFO B;  3J80 E;  1Y1W H;  1WCM G;  2K01 A;  5IT9 c;  2KBN A;  5M5W B;  1MHW C;  2QCP X;  1Y1V G;  1SNP A;  1HFG A;  2C9O A;  3RZO B;  2KOL A;  1IBL Q;  4IUV A;  1BCP B;  1TY2 A;  4HMI A;  3TP6 A;  2B2Y A;  2K28 A;  4P73 A;  2MP1 A;  4TRD A;  3PUW A;  4BY1 H;  1J9O A;  3E9H A;  2XVS A;  3D0F A;  4RH6 A;  3VYT A;  2B8F A;  3CKI B;  5E3F A;  2F0E A;  4KN4 C;  5AJ3 L;  1ASY A;  2EYH A;  4ODG A;  1QVC A;  1LO5 D;  4DXG A;  3DEP A;  4YCV A;  2WAQ G;  1B9M A;  5IGD A;  1EQT A;  4AQY Q;  1MGS A;  3KDF A;  4DR2 L;  1FR3 A;  2A73 B;  1I6V C;  2ZM6 L;  3I4M B;  4C1N K;  4FDB A;  1KAA A;  4LFC L;  5EKK A;  4RGT A;  4DV4 L;  2NVY B;  2RF4 A;  1FNW A;  2HIV A;  4HJ7 A;  3MXN B;  4RHS A;  2CW0 C;  4RGO S;  4C2M H;  2ZXR A;  1A3U A;  1E7Z A;  4QQB X;  3KLW A;  1LM0 A;  1D2B A;  2ALY B;  4G7O C;  1ZKO A;  1L1O B;  2JK8 A;  4X64 L;  1XMO Q;  3GTG B;  1O7Y A;  3MXG A;  4PV1 C;  3OIQ A;  1HXY D;  2YTV A;  1AZQ A;  4PG3 A;  4IPC A;  4JBW A;  4DUZ Q;  4MHE A;  4B3T Q;  3M4O B;  1KAB A;  1VQP A;  4GNX A;  5ELC A;  1YJN A;  1G51 A;  3T56 B;  1TXY A;  2WIN B;  3H0G B;  4ZYS A;  5BR8 L;  4DV2 Q;  1C4Q A;  3K7A B;  3NTH A;  4A3B H;  1EY5 A;  4JI3 L;  3VR5 A;  3VR3 A;  3FEW X;  2B2T A;  3M4O H;  1SYF A;  1KD1 C;  2AWN A;  4PZ7 A;  4EQN A;  4NB3 A;  2WAC A;  2R7F A;  3I55 A;  4K6D A;  3CPF A;  2NN6 G;  4CDE C;  3TDQ A;  4ZCK A;  1V8Q A;  2Y0S E;  1SE2 A;  1E24 A;  1W6K A;  2OQK A;  3J81 i;  1FNV A;  2Y0S B;  2EIF A;  1NR2 A;  3L2P A;  1GUN A;  2F0S A;  2Z9H A;  1S5F D;  4A3C G;  1BCP D;  3U4V A;  3J80 i;  3Q23 A;  1PH9 A;  5I9P A;  1BQQ T;  4A3I B;  3EJI A;  2KQ3 A;  3RZD B;  4PMW A;  4HIM A;  1V1O A;  1ROD A;  4GN3 B;  3QJY A;  4LUO A;  1HZ9 A;  4OON A;  5IWA L;  4RAU C;  4DV3 Q;  3U50 C;  1HHV A;  3S15 B;  2F0K A;  2E2H H;  4AYB G;  4BBS B;  3S17 H;  1GJX A;  5JEA G;  4LFB L;  4QCL A;  4DR6 L;  4QL5 A;  4G7Z C;  3HOZ H;  1BKB A;  1PMR A;  3E0E A;  4JBJ A;  1N33 Q;  1PLF A;  1VQI A;  4TQU S;  1TWA B;  3FHW A;  4GOP A;  1Q7Y C;  1F2Y A;  2ZJP A;  2JA7 H;  1SEB D;  4N9T A;  5DM7 3;  3C1E A;  1L1O C;  3OHX C;  5LHY 1;  4DV6 L;  2B39 A;  2NVT B;  4ZQ3 A;  1S72 A;  1E2V A;  4RWS C;  5EBC A;  2VUM H;  1JIC A;  3W2D A;  4IUU A;  3W3A A;  1DOM A;  2WII B;  3PO2 G;  2HT1 A;  1IYJ B;  5ELD A;  1Q3L A;  1TWF H;  3AQQ A;  2MJ8 A;  2R92 H;  1ET6 A;  1SYG A;  2PQE A;  1IBM Q;  2F0L A;  2K7V A;  3J81 j;  2EOT A;  1PTO D;  1TQO A;  5IOC A;  3QG1 A;  1J8I A;  3S16 H;  2QA4 A;  1UWV A;  3PIP 3;  4A3C H;  1LTT D;  2F1M A;  5H1S E;  4A3E G;  1KQS A;  3KLR A;  3Q6S A;  1I94 Q;  3FKI B;  1V1P A;  1RHP A;  2VW9 A;  1CTM A;  1STA A;  4HSP A;  4A3D H;  3G7L A;  2EY1 A;  4QIW E;  2E5L Q;  4JI7 Q;  4F88 A;  3GD7 A;  1IYV A;  5C6A A;  1L2F A;  3BJU A;  3CCM A;  5M9O A;  1GUT A;  2R7Z B;  2UUC Q;  5C4X B;  5C3W A;  2V4D A;  3C3L A;  4R4T A;  2EE1 A;  5C3E B;  4EGV A;  4O42 A;  5C44 H;  3TME A;  4RGM A;  4QY7 A;  1ENA A;  2MNA A;  3K5N A;  4OX9 Q;  2JA9 A;  4YY3 L;  1BUV T;  4XT1 B;  1VMP A;  2SNM A;  1MSH A;  1F2L A;  3ZJY C;  1SMY D;  2WKD A;  4NXN L;  2PW5 A;  4C3I G;  1SYD A;  1A2T A;  1K73 C;  1OXU A;  2I0Q A;  4CKB A;  3EBE A;  3ERS X;  1D7Q A;  4CJ0 B;  3HOY G;  3F2D A;  3T51 B;  2JA5 B;  1VQ9 A;  1SE8 A;  5DNF A;  1VQB A;  5M5X B;  2MUY A;  2R92 G;  2DN8 A;  1SND A;  3I73 A;  4APV A;  4RG1 A;  1SMY C;  2BA0 A;  3BZD B;  2ZTE A;  4DV0 Q;  3F2U A;  1XMQ Q;  4Z9C B;  1QJO A;  5C44 G;  2MPM A;  3AB9 A;  3DXJ C;  4LF5 Q;  1A62 A;  5DEH A;  2QDB A;  3VR6 A;  3X3N A;  4X64 Q;  1XTD A;  3A56 A;  1B44 D;  1C0A A;  4LF6 L;  1G91 A;  1B7Y B;  2NVQ H;  4C3I H;  3CD6 A;  4JYA Q;  1Q90 A;  4BY7 H;  2QEX A;  5C3E H;  4A3J H;  3QWN A;  3J81 L;  5LL6 S;  5A35 A;  4A3K H;  1KLU D;  2FJ2 A;  1LTB D;  2UUA L;  2EXD A;  1EFW A;  4JI5 L;  1TWF B;  2L1B A;  4ZK9 B;  2JN4 A;  3HG9 A;  4QB4 A;  4A3L H;  3J80 L;  4WJ3 M;  2O5J C;  4LF9 Q;  2AUK A;  1MJE A;  3ICE A;  2WB1 B;  4DV7 L;  4DNI A;  5ELO A;  1B9N A;  5CBE E;  2WB1 E;  5GAG C;  1HNW L;  4GN4 B;  2F4V L;  1I6H B;  1X3G A;  2FMM A;  2YU9 H;  2R7Z H;  1AE3 A;  1B53 A;  1VF5 C;  3PIO A;  4XIG S;  5FLM H;  1H9S B;  1YNJ C;  1E1T A;  2DUD A;  4OGQ C;  4BY7 G;  4MNO A;  4FNF A;  1DCZ A;  2UXC L;  3V96 A;  1HUM A;  5GAE C;  4S3S A;  1VQA A;  2BDN A;  3E3X A;  4HIK A;  4K0K L;  2DJF C;  2VB3 X;  4C1N I;  1B8A A;  3HOY H;  1EEI D;  2NZ1 D;  4CJ2 C;  4GKK L;  3SK8 A;  4DU9 A;  3H94 A;  5LMU L;  4B3M Q;  3FVQ A;  1OXX K;  1STY A;  1UEB A;  5CC4 A;  3B6Y A;  2CWA A;  2LY7 A;  3UDI A;  1BCP C;  4R8N A;  1XX8 A;  2PZW A;  4F8M A;  4CHT B;  2KJX A;  1YHQ A;  2SOB A;  5GQO A;  2Z6K A;  2B2U A;  3EFX D;  4HJA A;  1F9R A;  4DUY Q;  4KKT A;  1IBK L;  3OOC A;  1MKH A;  1EYD A;  2IY5 B;  4O1N A;  3LX0 A;  4KV6 A;  3G4S A;  3HOV G;  4DAY B;  3HOU G;  4C3J G;  5C0X H;  4GLV B;  4JI3 Q;  5C4X H;  1HCZ A;  2K5D A;  1STE A;  4U68 A;  4F7X A;  3A0J A;  3BDC A;  1PH7 A;  4FYD A;  1NJI C;  3TSS A;  3A8J E;  1NE3 A;  2Z6B A;  2VS1 A;  2HDM A;  4I65 A;  4P2C B;  2A69 C;  3C1F A;  3NE5 B;  1UAP A;  2RHS B;  3UDG A;  4DR3 L;  3HRZ C;  3K8A A;  1UE5 A;  1SNQ A;  1X65 A;  4DN4 M;  4A3E H;  5C5M A;  1R9T B;  3I4N H;  2QF7 A;  4XQQ A;  2NVX B;  5K36 H;  4ZKC B;  1P16 A;  1CQF A;  2CQA A;  1K8A C;  2PI2 E;  4JI7 L;  2PZT A;  1O7I A;  2LFN A;  2O5I C;  1FJG Q;  2R93 B;  5IYB H;  5COY A;  1A15 A;  2Q2T A;  3S1M H;  1TWH B;  2D0P A;  2D9U A;  3MA2 B;  4M1U B;  3T1H Q;  4LJZ C;  3LWU A;  3I56 A;  3P7J A;  2AKW B;  1U4M A;  3CU7 A;  1H9M A;  3HKS A;  3EQL C;  3OW7 A;  4G57 A;  1SYB A;  2I46 A;  1X55 A;  3TS0 A;  5K5P A;  3PMF A;  1X9N A;  4MN3 A;  1SLJ A;  3F8T A;  1LT5 D;  2JSO A;  2CHB D;  4IFD G;  1STG A;  3L0O A;  3AMU A;  3KYH C;  2K5W A;  4POF A;  4Y7N B;  1JWU D;  4L5S A;  2HD3 A;  3SXH A;  2XWB B;  4DFA A;  3NBI A;  4FF2 A;  4DR5 L;  1VQ8 A;  1PZK D;  4GNX C;  5EBD A;  5C5L A;  4Y52 H;  1YHB A;  1NTG A;  4XDX A;  1PH4 A;  3NBH A;  1PXU A;  3A55 A;  3P20 A;  3HOZ G;  2NVX H;  4C3H B;  3ERO A;  2B2T C;  4XQJ A;  4A3B B;  1MIU A;  3KLS X;  1IL8 A;  5FLX E;  4A3M H;  1HRJ A;  1N32 L;  1T9H A;  4IFD H;  3SHL A;  4IUR A;  1EY6 A;  3D4W A;  4PMB A;  4H7B A;  3STB C;  4A3G H;  1ASZ A;  2AMC B;  2KHS A;  3OIP A;  1OTC A;  4X3S A;  1I6H H;  1PYS B;  1I4X A;  2K04 A;  5JEA H;  2NVT H;  2IHE A;  2UXD L;  2JA6 H;  1DXM A;  1J5E L;  2K05 A;  3M3Y B;  3H6M A;  3I3C A;  5CYU A;  3W1B A;  4LF7 L;  4DAP A;  2XRQ D;  1UNS A;  1B4O A;  3RZO H;  1U4L A;  1D5X C;  3MXU A;  4K8I A;  1N36 Q;  3VYU A;  2X69 A;  2NTS A;  3U58 A;  4A3M G;  1I4P A;  1ZYR C;  2KCM A;  1LUZ A;  1MSG A;  4JI1 Q;  4NDX A;  1PHJ A;  1XNR L;  2A6E C;  3BG3 A;  3S9W A;  1EYC A;  1QUQ A;  1TWC B;  3AFQ A;  4JVZ A;  3GTO H;  4UHV A;  1PH2 A;  3GTL B;  2OF1 A;  4ABN A;  5C4Z A;  3GTJ B;  2KVM A;  2NB0 A;  4WJW A;  3OW2 A;  1R4Q B;  3CQZ H;  1IZ6 A;  3V2T A;  1KDA A;  2TSS A;  1VQO A;  4BY1 B;  3TN2 A;  4K0K Q;  3I8Z A;  1JQY D;  3MEF A;  3Q24 A;  2K52 A;  2RBM A;  1BDO A;  2L0C A;  1PYB A;  1KXL A;  1TR5 A;  4Y7N H;  3D8G A;  1HZB A;  1ML0 D;  5KNC A;  4LFC Q;  5JVG 3;  4IUP A;  4DV1 L;  4X66 Q;  4KHP Q;  1LTL A;  1ZEQ X;  4J8Q A;  5IE8 A;  2WV6 D;  5J3B A;  1PFS A;  4A3G G;  3J81 c;  2XSC A;  2KCN A;  3CCV A;  1MI2 A;  2V1C C;  2O4X A;  3D4R A;  1W2B A;  3PUX A;  1Q8I A;  2B2W A;  5I9O A;  4DUY L;  1HQM C;  3FKI G;  3S2H B;  2WKC A;  3S14 B;  4HID A;  3HKZ B;  1KC8 C;  2F0P A;  4F87 A;  2ZTC A;  4C3J H;  2UUC L;  4CDC C;  2PMZ B;  3I4O A;  2CH4 W;  3GTM H;  4MZ9 A;  4JI8 L;  2EYL A;  4BWG B;  3UE1 A;  4FP5 D;  2GA4 B;  2M9V A;  1CHP D;  5EQ0 A;  2FXQ A;  1BNZ A;  2Q8T A;  1ONL A;  5A2Q L;  3DHQ A;  4JV5 Q;  5C3E G;  5M3F H;  1GUO A;  2F0D A;  3C2P A;  1JOQ A;  2HHH L;  4RKL A;  4A3F B;  4KK7 A;  2L9H A;  3OWF A;  5C3X A;  2AQ3 B;  3M7G A;  2OXP A;  4DXF A;  1F2Z A;  2NWG A;  3S17 B;  1IBL L;  2FFK B;  3PV0 A;  4LAA A;  2F3W A;  2IHF A;  3H09 A;  5JOB A;  3CCS A;  4RA8 A;  5IT9 L;  1CKO A;  1X32 A;  1KLG D;  3UDX A;  1QE6 A;  1RCV D;  4JOI A;  2R93 H;  1A2U A;  5I4D A;  2EQS A;  3SGI A;  4BA1 I;  3T1H L;  4KY6 A;  3H3V I;  4GKK Q;  5TSS A;  1KNE A;  3KLS A;  1HNX Q;  4Q5V A;  1LT4 D;  1GHK A;  3P1H A;  4B9W A;  1VQM A;  4AH6 A;  1EOV A;  1SXT A;  3CHB D;  4JBK A;  1K28 A;  2K5H A;  5NUC A;  3ER0 A;  2CH4 A;  4K2K A;  2QDL A;  1KHI A;  2IT1 A;  3N52 A;  5JPN C;  2UXB Q;  1NNX A;  1QB5 D;  3J7A F;  1OXS C;  1BR9 A;  3K5O A;  1LTA D;  3V05 A;  3MAQ A;  1WJJ A;  2JA8 B;  1VCI A;  1Y8P B;  3NQI A;  3NXW A;  2PO4 A;  3RLO A;  4DR1 Q;  1SN8 A;  4XYQ A;  4I7Z C;  1XPO A;  1NBW A;  3K7U C;  4CDF C;  1PH6 A;  2IX3 A;  1STN A;  4LF9 L;  4O0A A;  4X62 L;  3G48 A;  4XT3 B;  2P5Z X;  3CRL C;  3TS2 A;  4JI0 L;  5M3F G;  4JI6 L;  2CVR A;  3NUC A;  3T1Y Q;  5BR8 Q;  3J7A 5;  4LFA L;  1P8L A;  4IPG A;  2F0O A;  4AYB B;  3GDE A;  2KEN A;  4L63 B;  3G6E A;  1QZG A;  1M90 C;  1W6J A;  3A5U A;  4BBS G;  2WB1 G;  4PZ8 A;  2GVB A;  3HFZ B;  3K81 C;  3VR4 A;  2AWO A;  5KRU A;  1EFI D;  1G2T A;  1SYE A;  4JI4 L;  5GAH C;  1YNN D;  3HOX H;  1A63 A;  1X6O A;  1PTO F;  3PUV A;  2EY5 A;  1FGB D;  3CC4 A;  5T1I A;  2EVB A;  4OWX B;  1IL2 A;  3T53 B;  1YIJ A;  4P71 A;  4ALP A;  1B3A A;  3ERQ A;  3J7A V;  3GTK H;  1CSP A;  3A5Z B;  1HQR D;  2VZA A;  1X3P A;  1K8G A;  2LKV A;  2XNA C;  5EAY A;  3J81 E;  4QIW B;  2F0W A;  4OXP A;  4LF7 Q;  4DV0 L;  3HGB A;  1WYD A;  5FOB B;  2QKI C;  5CV8 A;  3TQY A;  2YYZ A;  3SK6 A;  3F2C A;  4K5X A;  2FIN B;  1Y1V B;  3GTQ B;  4OHJ A;  1WI5 A;  4DAV A;  2OTJ A;  3W5O A;  1JCK B;  1LAB A;  1K83 H;  3R2T A;  1XNR Q;  5IGF A;  4LFB Q;  3RN5 A;  1PYW D;  1TU2 B;  1A8V A;  3KBG A;  4A3E B;  3CCR A;  3NQT A;  3BU2 A;  2BE5 D;  1O78 A;  1RD9 D;  3HP3 A;  1Q1B A;  2F52 A;  2PQA B;  3S24 A;  4XXE A;  1IBK Q;  1CUK A;  1HZA A;  2B2U C;  1PTO H;  4K5W A;  2L5T A;  5FJ8 H;  3KF6 B;  1AN8 A;  2UUB L;  1YHA A;  1S5B D;  5CBA E;  4ZAI A;  1SRU A;  4BBR H;  5EPJ A;  1QOH A;  3VA5 A;  1II3 A;  2Z4H A;  1E3P A;  1XYI A;  2TMP A;  3EVQ A;  2LS0 1;  4KI0 A;  2RCN A;  2RQX A;  1KDB A;  4GKJ Q;  2EJF C;  1UE6 A;  1WCM H;  3T4A C;  5F2D A;  3NTK A;  1C48 A;  1SMX A;  1CFM A;  1TWG B;  4A3L G;  5CV5 A;  4A3J G;  4H44 C;  3QO2 A;  2H4O A;  3PO3 H;  2UU9 L;  1X3E A;  1OXT A;  2XIW A;  2Q2H A;  1EIF A;  1C7Y A;  2PYK A;  2HQL A;  1L0W A;  2N3S A;  1WTR A;  3MFY A;  1A3V A;  4ME5 A;  3J80 c;  3HOY B;  1DZ1 A;  3O13 A;  2HCI A;  4OO1 I;  2JA5 G;  5I6Y A;  3M4Y A;  1EQQ A;  4R4O A;  3KF8 A;  4NXM Q;  1PTO B;  5LMU Q;  2A1A A;  3OWE B;  3SR1 A;  4ZUI A;  4WJ4 A;  3TZD A;  4YWL A;  1I50 H;  5C44 B;  1VQF A;  1Q81 C;  2B63 G;  2XN9 C;  1GOZ A;  3BYY B;  4RFB A;  3TP7 A;  1KDC A;  4YHH L;  5G3L D;  1ENF A;  3L9A X;  3U9S A;  4IUQ A;  4IPD A;  3GTK B;  1N33 L;  5HUR A;  2FHT A;  2C35 B;  4R1J A;  3PF5 A;  4B08 A;  3M9B A;  4LW1 A;  1QUQ B;  4JPB W;  1IHZ A;  3DMU A;  5M5X H;  5HY6 A;  3E6Z X;  1H9R A;  4KHV A;  4KN7 C;  5C0X I;  3CCQ A;  1AP0 A;  2EZV A;  2JA5 H;  3J7Y W;  3N6R A;  2EPB A;  4RCO A;  2ES2 A;  2A5H A;  3CCU A;  1DJR D;  1PH3 A;  4CDD C;  1RTO A;  1JMC A;  3M7N A;  3AU7 A;  3D31 A;  4KD3 A;  5I6W A;  2JA7 B;  3GTG H;  4DPG A;  5IIF A;  2PNH A;  4JG2 A;  2PQA A;  2OWO A;  5E7N A;  2Q2U A;  4L5R C;  5GAD C;  3GTP B;  2DJG C;  3CRK C;  2K50 A;  2K1B A;  3KF6 A;  2ENB A;  1PFM A;  1DYQ A;  1S5D D;  4JW0 A;  1SE4 A;  3R93 A;  1LT6 D;  1GM5 A;  1AEX A;  1E22 A;  1K9M C;  1E1O A;  3TRE A;  2EYM A;  2I07 B;  2D2C C;  1SFO H;  2E5L L;  3TP8 A;  2Z0S A;  4GS3 A;  1PH8 A;  1HR0 W;  3SDZ A;  5M3M B;  2IPK D; 
#chains in the Genus database with same CATH homology
 2A74 C;  2OT2 A;  3RD4 A;  2HQE A;  4DAY A;  3GTM B;  5J39 A;  1Q1E A;  3OSO A;  3HZX A;  1EZ8 A;  4HED A;  1SNM A;  1SJH D;  2JEB I;  2JP1 A;  3MXP A;  3GV6 A;  4HCS A;  1PDQ A;  2F4I A;  2MGS A;  2M2L A;  1F77 A;  1JC7 A;  2R61 A;  1Y1W B;  2C5C A;  4R8I A;  1U4P A;  3A8I E;  4KHZ A;  5KNB A;  1U4R A;  3HOU B;  5KIX A;  5EKL A;  1BCP F;  1K8M A;  2CW0 D;  2E76 C;  2IX1 A;  1B2T A;  3SEB A;  1GUG A;  5JVH 3;  1DOK A;  1ESF A;  2ZXP A;  4HCE A;  1D5Z C;  4RKB A;  4XTC S;  1DD2 A;  2NBF A;  2M00 A;  1WD0 A;  1EQV A;  4FVM A;  1EY0 A;  2PCF B;  2EY6 A;  3D4D A;  2RSO A;  4J1M A;  4UAI A;  1S4Z A;  2BE5 C;  1CHQ D;  3E5S A;  2E74 C;  2QIL A;  3OMG A;  3NHH A;  1Q12 A;  1Z47 A;  5J1Z A;  4ZLT F;  2A68 D;  1WTO A;  1B50 A;  2ICI A;  2QEJ C;  1I4R A;  2EDG A;  1XXG A;  2NVQ B;  3IKJ A;  3RUZ A;  4H13 C;  1FYC A;  2RVL A;  1TT2 A;  2Z8L A;  1ESR A;  1AW7 A;  1R4P B;  1CI3 M;  3Q0A A;  4KMU C;  3BDL A;  2FMC A;  3IAY A;  4NP5 A;  3IFD A;  3ONA B;  2RDF A;  3WOE A;  3K5M A;  1GUW A;  1G2S A;  1ILQ A;  1CM9 A;  1ILP A;  1A3T A;  2J0T D;  3T13 A;  3D6W A;  2IJ0 A;  3K57 A;  1T5E A;  3S1Q B;  1EOT A;  5BN4 A;  1L0Y B;  2F0Q A;  5COR A;  5C4H A;  4NMZ A;  1Z7T A;  3S2D B;  2F0T A;  1I4Q A;  3BVG A;  4BA2 I;  2PPB C;  3S1R B;  1SAP A;  2EXZ A;  2OEO A;  3ND9 A;  2K03 A;  1EIH A;  1OO9 B;  3NP8 A;  5CGK A;  5FO7 B;  4X3U A;  5E4X A;  1GUS A;  4KKU A;  2E2I B;  1IW7 C;  1TS5 A;  2F0G A;  5FKA C;  4WFN 3;  2SNS A;  3KBX A;  1QNU A;  5EKI A;  2IX0 A;  3RMH A;  1DOL A;  1WCM B;  2EY2 A;  3WOF A;  3S1N B;  2F0N A;  2KUM A;  2PNR C;  2Q8I B;  1PFB A;  4KD4 A;  3SK5 A;  4CKE A;  5EJW A;  4LMQ D;  1SJE D;  1AFP A;  2A6H D;  2R3Z A;  4X3T A;  4CJ1 B;  3S16 B;  3K5L A;  1D1I A;  4WRD A;  1HFN A;  5I2X A;  3MFG A;  5ELF A;  1EU4 A;  4BBR B;  4LK1 C;  1QIL A;  5LL6 X;  4IQZ A;  3MZ5 A;  1CZW A;  1F9P A;  3WDN A;  1NUC A;  4OIJ A;  4A3D B;  4FF3 A;  1VMC A;  1D6E C;  3MC0 B;  1V43 A;  3QOL A;  1O7Z A;  3D3R A;  5IOD A;  1ZXT A;  1WTQ A;  5JJZ A;  5CMD A;  5K36 G;  1NR4 A;  1EIG A;  3FDT A;  3FPU B;  3MWY W;  4DNT B;  4C3I B;  4PMC A;  2IL8 A;  1NCV A;  2HDL A;  2B2V A;  5M5Y B;  5EGT A;  3TBI B;  5I2Y A;  3H91 A;  2R92 B;  5KGU A;  1FD7 D;  2F0U A;  1JOK A;  2L11 A;  1LTG D;  2VNU D;  3EA6 A;  4DA2 A;  2N55 A;  2Z4I A;  4HMJ A;  4PQX A;  4A3J B;  2N88 A;  1HPC A;  1PRT B;  3NK9 A;  1E2Z A;  3PUY A;  2KEE A;  3A54 A;  4IUN A;  5G3L F;  2KA7 A;  2F0J A;  2EJM A;  1MD2 D;  3VA7 A;  3OMC A;  2Z1C A;  4GZY C;  4N9P A;  2F0I A;  4C3H G;  1ET9 A;  3DWA A;  1HTP A;  1K83 B;  4ZRZ A;  4NW2 A;  2MHV A;  5ELB A;  1SBB B;  2L12 A;  2A69 D;  3M85 A;  4EQP A;  3X3M A;  2BA1 A;  2K33 A;  4A3K B;  1DM0 B;  3JAM E;  1KTK A;  5BN5 A;  1XWE A;  4BY7 B;  5E1F A;  4MIU A;  1TKW B;  2BDO A;  3BVM A;  4HSV A;  3SVM A;  2LMC B;  4FXD A;  3TZU A;  2AQ1 B;  2ID0 A;  5CV4 A;  4EVO A;  1LV9 A;  1WTX A;  3ZYY X;  2EYJ A;  4WOR A;  3IFT A;  1EY8 A;  3NWS A;  4IAL A;  4U67 3;  1CQV A;  3A8K E;  5D65 A;  3D6C A;  1AZP A;  1RKN A;  1H9K A;  1X3Q A;  1S5E D;  1I3Q B;  3QIA A;  2XWJ B;  5T1G A;  2WAQ B;  4HR7 B;  2NN6 H;  4K5V A;  1TS3 A;  2BOS A;  3HOV B;  2D62 A;  3U9O A;  3C46 A;  4QF4 A;  3I4L A;  2F0M A;  2BCO A;  1EWH A;  4DF7 A;  3L3O C;  1WTW A;  4UDU C;  1H9J A;  2G9H D;  4A3G B;  4FF1 A;  1ICW A;  3HOX B;  5AFW A;  1BF4 A;  4JK1 C;  5KND A;  1IW7 D;  2B2W C;  1UUP A;  5A2Q E;  1PFN A;  1SYC A;  1LTR D;  4K6L A;  4M8A A;  5IGE A;  2DNE A;  4KY7 A;  1EY4 A;  3BYT B;  5JEA J;  4FF4 A;  1G6Z A;  3MXN A;  3DUZ A;  2NTT A;  1JR0 D;  3SE0 A;  2KEC A;  4FXK C;  1WTV A;  1I50 B;  2K32 A;  4NKL A;  2VXW A;  4OIK A;  4B9X A;  2DNC A;  5D3D A;  1GHJ A;  2F3V A;  2A68 C;  2HUG A;  1ZYR D;  1OXV A;  1TY0 A;  1F9Q A;  4TKO B;  3HOZ B;  3L7Z C;  3KUP A;  1QNK A;  3R8B A;  4FXG C;  4J6H A;  1DON A;  3URY A;  2SEB D;  4DNR B;  2B63 B;  1K8O A;  5KYL A;  3GQB A;  5JPM C;  5FK9 C;  3MEH A;  1IYU A;  1RJT A;  1TVX A;  1PRT D;  4RCN A;  1U9R A;  1FNU A;  4KJN A;  3VR2 A;  1TS4 A;  5CV9 A;  5D3I B;  4HN7 A;  1PRT C;  4H0L C;  2K6A A;  4ID6 A;  1A6X A;  5EPL A;  5IGG A;  1Y8N B;  5M3F B;  3NWT A;  1JWM D;  4IFD I;  2H1E A;  3PO2 B;  2ZT9 C;  4KTA A;  4IZ8 A;  3K6O A;  1STH A;  1WD1 A;  2RKS A;  1STB A;  1EY9 A;  4V0B A;  4X3K A;  2PZU A;  1E2W A;  1PTO C;  5FLX L;  2B2Y C;  4DK0 A;  3H3V C;  2AUJ D;  1QCB D;  3A7A B;  3ND8 A;  4OL7 A;  2ICE C;  2XRS D;  3R3O A;  3MHB A;  1CA5 A;  4DGZ A;  1M4V A;  4G7H C;  1IKL A;  4CBV A;  2EYO A;  4C3J B;  1QWY A;  5KEE A;  2SDF A;  4K8J A;  3CQZ B;  1O7L A;  1H9S A;  1JE4 A;  1B1Z A;  2RDH A;  2EJG C;  5E4W C;  5CV7 A;  2E2D C;  3DWQ A;  5IT9 E;  1HA6 A;  2E2J B;  1O80 A;  2JE6 I;  1EY7 A;  4ZUJ A;  1V1P B;  5C4J B;  2KCC A;  2X6L A;  2O2L D;  3FPP A;  3PIO 3;  1QG7 A;  1HTL D;  1YNN C;  3SK4 A;  1TII D;  5FO9 B;  3LWE A;  4IUT A;  4C2M B;  1BO0 A;  1G8Z D;  5D14 A;  2RSN A;  2VB2 X;  1LTI D;  4L6T B;  5DAU A;  1RF2 D;  4ULL A;  3ITP A;  5KYI A;  4Q0F A;  2G9D A;  4C56 C;  3HS0 C;  3NPP A;  4QUC A;  1LT3 D;  1VF7 A;  2X6G A;  2J7Z A;  3RLF A;  1D1K A;  5DM6 3;  1T5X D;  2L4N A;  2YU9 B;  2B2V C;  2IWH A;  5CR3 A;  1SNO A;  4G4K A;  4L8J A;  5IGC A;  4XYO A;  2RDG A;  3DWP A;  1GXD C;  3Q22 A;  1JOO A;  1TS2 A;  1IKM A;  4EQO A;  5C0X J;  1Z6H A;  4QMG A;  1NAP A;  1PZI D;  1LAC A;  3I4N B;  2F03 A;  2A6E D;  3IL8 A;  1F2M A;  3BDO A;  3HOW B;  4BS9 A;  1F9S A;  1E0B A;  1PRT F;  2HCC A;  1CZG A;  4CGY B;  1XTC D;  2RA4 A;  5HGT A;  3P75 A;  1EEF D;  2NYZ D;  3KK7 A;  1I4H A;  3I91 A;  4TSS A;  1EZ6 A;  3PUZ A;  1CA6 A;  3TP5 A;  4FO2 A;  1JOR A;  4A3M B;  1BOS A;  4RHR A;  2DY8 A;  1JB3 A;  4ZKB B;  1EYA A;  3OPO A;  3FRP B;  2EYP A;  3R2I A;  1CK1 A;  4YIJ A;  3NTI A;  3VYS A;  1NSN S;  2Q8R E;  1L0X B;  1SSO A;  4R9W A;  3HEJ A;  1S5C D;  3K59 A;  4CKC A;  1WTP A;  1SDF A;  1Y8O B;  3VYR A;  4OO1 G;  1LLR D;  2E2H B;  1JWS D;  2DY7 A;  4KY5 A;  3GTO B;  2ZXO A;  1CT1 D;  1C8C A;  2K5Q A;  1HA5 A;  1UEA B;  2D5D A;  3NSW A;  1EL0 A;  2JXM B;  1SNC A;  3PO3 B;  2AQ2 B;  1HUN A;  4K2L A;  5CV6 A;  1SE3 A;  3BS1 A;  5BN3 A;  5J22 A;  2B8G A;  3FMC A;  2PW7 A;  5C0X G;  2JEA I;  4OO1 H;  4IFD J;  3G6J B;  4KJO A;  1BBX C;  2IW3 A;  3I72 A;  4KKS A;  3I90 A;  3GV3 A;  1MBY A;  4K14 A;  1PZJ D;  1RDP D;  2F0H A;  4DK1 A;  4E6I A;  2R6G A;  3DEO A;  3I70 A;  4PNY A;  3QOJ A;  3DM1 A;  2E75 C;  3QB3 A;  1I4G A;  3E0J A;  5ELE A;  2A6H C;  1VDZ A;  1EU3 A;  5ISR A;  1EWC A;  4XQN A;  2WP8 J;  1RTN A;  3GO5 A;  3UI2 A;  5JAV A;  2EYF A;  3K58 A;  3LNN A;  4RGN A;  2NN6 I;  3BVZ A;  3MTS A;  2KED A;  4A93 B;  3S1M B;  2JYO A;  3GP7 A;  1KNA A;  3A7L A;  5IGB A;  4V19 0;  2F0V A;  2F0F A;  1M8A A;  4ILW A;  1YNJ D;  4IN3 A;  4HTH A;  1LTS D;  3K0Y A;  1G29 1;  2NUC A;  1WVL A;  2J4X A;  1D5M C;  3JAM L;  5EPK A;  3MVV A;  5FO8 B;  1Y69 U;  2L55 A;  2VUM B;  1BXT A;  4HAE A;  1ENC A;  3T16 A;  4QUF A;  2JA6 B;  1SFO B;  3J80 E;  2K01 A;  5M5W B;  2QCP X;  1SNP A;  1HFG A;  2C9O A;  3RZO B;  2KOL A;  4IUV A;  1BCP B;  1TY2 A;  4HMI A;  3TP6 A;  2B2Y A;  2K28 A;  2MP1 A;  4TRD A;  3PUW A;  1J9O A;  2XVS A;  4RH6 A;  3VYT A;  2B8F A;  3CKI B;  5E3F A;  2F0E A;  4KN4 C;  2EYH A;  4ODG A;  1LO5 D;  4DXG A;  3DEP A;  1B9M A;  5IGD A;  1EQT A;  1MGS A;  1FR3 A;  2A73 B;  1I6V C;  3I4M B;  4C1N K;  1KAA A;  5EKK A;  4RGT A;  2NVY B;  1FNW A;  4RHS A;  2CW0 C;  4RGO S;  2ZXR A;  1A3U A;  1D2B A;  4G7O C;  1ZKO A;  3GTG B;  1O7Y A;  3MXG A;  4PV1 C;  3OIQ A;  1HXY D;  1AZQ A;  4JBW A;  4MHE A;  3M4O B;  1KAB A;  5ELC A;  3T56 B;  2WIN B;  3H0G B;  4ZYS A;  1C4Q A;  3K7A B;  3NTH A;  1EY5 A;  3VR5 A;  3VR3 A;  3FEW X;  2B2T A;  1SYF A;  2AWN A;  4EQN A;  2WAC A;  4K6D A;  2NN6 G;  3TDQ A;  1V8Q A;  1SE2 A;  1W6K A;  1FNV A;  2Y0S B;  1NR2 A;  1GUN A;  2F0S A;  1S5F D;  1BCP D;  3Q23 A;  5I9P A;  1BQQ T;  4A3I B;  3EJI A;  2KQ3 A;  3RZD B;  4PMW A;  1V1O A;  1ROD A;  3QJY A;  4RAU C;  1HHV A;  3S15 B;  2F0K A;  4BBS B;  1GJX A;  5JEA G;  4QCL A;  4G7Z C;  1PMR A;  1PLF A;  4TQU S;  1TWA B;  1F2Y A;  1SEB D;  4N9T A;  5DM7 3;  3C1E A;  3OHX C;  5LHY 1;  2B39 A;  2NVT B;  4ZQ3 A;  1E2V A;  4RWS C;  5EBC A;  1JIC A;  3W2D A;  4IUU A;  3W3A A;  1DOM A;  2WII B;  5ELD A;  1Q3L A;  2MJ8 A;  1ET6 A;  1SYG A;  2PQE A;  2F0L A;  2K7V A;  2EOT A;  1PTO D;  1TQO A;  5IOC A;  3QG1 A;  1J8I A;  3PIP 3;  1LTT D;  2F1M A;  3KLR A;  3Q6S A;  3FKI B;  1V1P A;  1RHP A;  1CTM A;  1STA A;  4HSP A;  3G7L A;  2EY1 A;  4F88 A;  3GD7 A;  1IYV A;  5C6A A;  5M9O A;  1GUT A;  2R7Z B;  5C4X B;  5C3W A;  2V4D A;  3C3L A;  2EE1 A;  5C3E B;  4EGV A;  4O42 A;  3TME A;  4RGM A;  1ENA A;  3K5N A;  1BUV T;  4XT1 B;  1VMP A;  2SNM A;  1MSH A;  1F2L A;  1SMY D;  2WKD A;  2PW5 A;  4C3I G;  1SYD A;  1A2T A;  1OXU A;  4CKB A;  4CJ0 B;  3T51 B;  2JA5 B;  5DNF A;  5M5X B;  2MUY A;  2DN8 A;  1SND A;  3I73 A;  1SMY C;  2BA0 A;  3BZD B;  3F2U A;  4Z9C B;  1QJO A;  2MPM A;  3AB9 A;  3DXJ C;  5DEH A;  2QDB A;  3VR6 A;  3X3N A;  3A56 A;  1B44 D;  1G91 A;  1Q90 A;  3QWN A;  3J81 L;  5LL6 S;  5A35 A;  1KLU D;  2FJ2 A;  1LTB D;  1TWF B;  2L1B A;  4ZK9 B;  4QB4 A;  3HG9 A;  3J80 L;  2O5J C;  2AUK A;  2WB1 B;  1B9N A;  5CBE E;  1I6H B;  2FMM A;  1B53 A;  1VF5 C;  4XIG S;  1H9S B;  1YNJ C;  4OGQ C;  4FNF A;  1DCZ A;  3V96 A;  1HUM A;  4S3S A;  2BDN A;  2VB3 X;  4C1N I;  1EEI D;  2NZ1 D;  4CJ2 C;  3SK8 A;  4DU9 A;  3H94 A;  3FVQ A;  1OXX K;  1STY A;  5CC4 A;  2LY7 A;  1BCP C;  4R8N A;  1XX8 A;  2PZW A;  4F8M A;  4CHT B;  2KJX A;  2SOB A;  2B2U A;  3EFX D;  1F9R A;  4KKT A;  3OOC A;  1EYD A;  4O1N A;  3LX0 A;  4KV6 A;  4C3J G;  5C0X H;  1HCZ A;  2K5D A;  1STE A;  4U68 A;  4F7X A;  3BDC A;  4FYD A;  3TSS A;  3A8J E;  2HDM A;  4I65 A;  4P2C B;  2A69 C;  3C1F A;  3NE5 B;  1UAP A;  3HRZ C;  1R9T B;  1SNQ A;  4DN4 M;  5C5M A;  2QF7 A;  4XQQ A;  2NVX B;  5K36 H;  4ZKC B;  1CQF A;  2CQA A;  2PZT A;  2O5I C;  2LFN A;  2R93 B;  5COY A;  1A15 A;  1TWH B;  2D9U A;  3MA2 B;  4M1U B;  4LJZ C;  3LWU A;  3P7J A;  1U4M A;  3CU7 A;  1H9M A;  3EQL C;  3OW7 A;  4G57 A;  1SYB A;  2I46 A;  5K5P A;  3PMF A;  4MN3 A;  1LT5 D;  2JSO A;  2CHB D;  4IFD G;  1STG A;  3AMU A;  2K5W A;  4Y7N B;  1JWU D;  3SXH A;  2XWB B;  4DFA A;  4FF2 A;  3NBI A;  1PZK D;  5EBD A;  5C5L A;  4XDX A;  3NBH A;  1PXU A;  3A55 A;  3P20 A;  4C3H B;  3ERO A;  2B2T C;  4XQJ A;  4A3B B;  3KLS X;  1IL8 A;  5FLX E;  1HRJ A;  4IFD H;  3SHL A;  4IUR A;  1EY6 A;  3D4W A;  4PMB A;  4H7B A;  2KHS A;  3OIP A;  4X3S A;  1I4X A;  2K04 A;  5JEA H;  1DXM A;  2K05 A;  3M3Y B;  3H6M A;  3I3C A;  5CYU A;  4DAP A;  2XRQ D;  1UNS A;  1B4O A;  1U4L A;  1D5X C;  3MXU A;  4K8I A;  3VYU A;  2X69 A;  2NTS A;  1I4P A;  1ZYR C;  1MSG A;  4NDX A;  2A6E C;  3BG3 A;  3S9W A;  1EYC A;  1TWC B;  3GTL B;  2OF1 A;  4ABN A;  5C4Z A;  3GTJ B;  2KVM A;  2NB0 A;  4WJW A;  1R4Q B;  3V2T A;  1KDA A;  2TSS A;  4BY1 B;  3TN2 A;  3I8Z A;  1JQY D;  3Q24 A;  2RBM A;  1BDO A;  2L0C A;  1TR5 A;  3D8G A;  1ML0 D;  5KNC A;  5JVG 3;  4IUP A;  1ZEQ X;  4J8Q A;  2WV6 D;  2XSC A;  2KCN A;  1MI2 A;  2O4X A;  3D4R A;  3PUX A;  1Q8I A;  2B2W A;  5I9O A;  1HQM C;  3S2H B;  2WKC A;  3S14 B;  3HKZ B;  2F0P A;  4F87 A;  2PMZ B;  2EYL A;  4BWG B;  2GA4 B;  2M9V A;  4FP5 D;  1CHP D;  5EQ0 A;  1BNZ A;  2Q8T A;  1ONL A;  5A2Q L;  3DHQ A;  1GUO A;  2F0D A;  3C2P A;  1JOQ A;  4RKL A;  4A3F B;  4KK7 A;  2L9H A;  3OWF A;  5C3X A;  2AQ3 B;  3M7G A;  2OXP A;  4DXF A;  1F2Z A;  2NWG A;  3S17 B;  2FFK B;  3PV0 A;  4LAA A;  2F3W A;  3H09 A;  5JOB A;  4RA8 A;  5IT9 L;  1X32 A;  1KLG D;  1QE6 A;  1RCV D;  1A2U A;  5I4D A;  4BA1 I;  4KY6 A;  5TSS A;  1KNE A;  3KLS A;  4Q5V A;  1LT4 D;  1GHK A;  3P1H A;  4B9W A;  1SXT A;  3CHB D;  5NUC A;  4K2K A;  2IT1 A;  3N52 A;  5JPN C;  1QB5 D;  3J7A F;  1OXS C;  1BR9 A;  3K5O A;  1LTA D;  3V05 A;  3MAQ A;  2JA8 B;  1VCI A;  1Y8P B;  3NQI A;  3NXW A;  2PO4 A;  4XYQ A;  4I7Z C;  2IX3 A;  1STN A;  4XT3 B;  3CRL C;  2CVR A;  3NUC A;  2F0O A;  4AYB B;  4L63 B;  1W6J A;  3VR4 A;  2AWO A;  5KRU A;  1EFI D;  1G2T A;  1SYE A;  1YNN D;  1PTO F;  3PUV A;  2EY5 A;  1FGB D;  5T1I A;  2EVB A;  3T53 B;  1B3A A;  3ERQ A;  3J7A V;  1HQR D;  1X3P A;  2LKV A;  2XNA C;  3J81 E;  4QIW B;  2F0W A;  3HGB A;  5FOB B;  2QKI C;  5CV8 A;  2YYZ A;  3SK6 A;  4K5X A;  2FIN B;  1Y1V B;  3GTQ B;  4OHJ A;  4DAV A;  1JCK B;  1LAB A;  3R2T A;  5IGF A;  1PYW D;  1TU2 B;  3KBG A;  4A3E B;  3NQT A;  2BE5 D;  1O78 A;  1RD9 D;  3HP3 A;  1Q1B A;  4XXE A;  2B2U C;  1PTO H;  4K5W A;  2L5T A;  1AN8 A;  1S5B D;  5CBA E;  4ZAI A;  5EPJ A;  1QOH A;  3VA5 A;  1II3 A;  2Z4H A;  1XYI A;  2TMP A;  3EVQ A;  2LS0 1;  4KI0 A;  2RQX A;  1KDB A;  2EJF C;  3T4A C;  5F2D A;  3NTK A;  1C48 A;  1CFM A;  1TWG B;  5CV5 A;  4H44 C;  3QO2 A;  2H4O A;  1OXT A;  2XIW A;  2PYK A;  1WTR A;  3MFY A;  1A3V A;  4ME5 A;  1DZ1 A;  3HOY B;  3O13 A;  2HCI A;  4OO1 I;  5I6Y A;  3M4Y A;  3KF8 A;  1PTO B;  3SR1 A;  3OWE B;  4ZUI A;  3TZD A;  5C44 B;  2XN9 C;  1GOZ A;  3BYY B;  4RFB A;  3TP7 A;  1KDC A;  5G3L D;  1ENF A;  3L9A X;  3U9S A;  4IUQ A;  3GTK B;  5HUR A;  2FHT A;  4B08 A;  1IHZ A;  3DMU A;  3E6Z X;  1H9R A;  4KHV A;  4KN7 C;  5C0X I;  1AP0 A;  2EZV A;  3J7Y W;  3N6R A;  2EPB A;  4RCO A;  2A5H A;  1DJR D;  1RTO A;  3M7N A;  3AU7 A;  3D31 A;  4KD3 A;  5I6W A;  2JA7 B;  5IIF A;  3GTP B;  3CRK C;  2K1B A;  2ENB A;  1PFM A;  1DYQ A;  1S5D D;  1SE4 A;  3R93 A;  1LT6 D;  1AEX A;  2EYM A;  2I07 B;  2D2C C;  3TP8 A;  3SDZ A;  5M3M B;  2IPK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...