3VYRA

Crystal structure of the hypc-hypd complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
72
structure length
72
Chain Sequence
AVPGKVIEVNGPVAVVDFGGVKREVRLDLMPDTKPGDWVIVHTGFAIEKLDEKKAMEILEAWAEVEKAMEGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Hydrogenase expression/formation protein HypC
publication title Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 17
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2012-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3vyrA00
3D3RA 3VYTA 3VYSA 2Z1CA 2OT2A 3VYUA 3VYRA
chains in the Genus database with same CATH superfamily
2RA4A 5G3LF 3PUZA 4ZLTF 3J81i 3KF8A 1YNJC 3G6EA 4B9XA 2FMCA 1SMYD 5HGTA 4HJ7A 4JYAQ 1K83H 2QDBA 5KYLA 2ZJRA 1F9PA 4ZRZA 1KQSA 3MA2B 4JCVE 4E6IA 1GM5A 2ASBA 1Y1VG 1L1OB 2A73B 4NXML 4L8JA 4QL5A 4DXFA 1K8AC 4B3TQ 3C3LA 1CKMA 2Q8RE 3IFDA 2EXZA 1W6KA 4BBSG 2WKCA 4GKKL 2N3SA 5C44B 2E2DC 2ZJQA 3VR6A 3RMHA 1D5MC 3BZKA 3F2UA 1BCPD 4CJ1B 4BY7G 3M4QA 2VUMB 2CFMA 2RHQB 2WAQB 1LTID 3M4OB 3DWPA 2BDNA 2D62A 3AFQA 4Z9CB 2E75C 1PXUA 1E2ZA 1F9QA 3A54A 2TMPA 1Q8KA 5K5PA 3TZDA 2HDLA 1F9RA 4ABNA 2EYMA 4K6DA 5LMNW 4RGTA 1LTRD 2R61A 5IT9L 3J7AV 3M7GA 1VQKA 4KK7A 5CV8A 1KLGD 2PMZB 3R2TA 2C9OA 4KLKA 2WAQE 1BCPB 2IW3A 3PIPA 3OTOQ 2E2HH 2EY2A 3KK7A 4A3IG 4K14A 4XDXA 1EQQA 3VYTA 3HOUG 5CV7A 1Y1WH 5M3MH 3NK9A 3K0YA 2X69A 1D7QA 2F0TA 4EQPA 3LNNA 2ZTCA 2NZOA 4DR4Q 1EWCA 3D3RA 2L0CA 3ULJA 2PMZE 5FLMG 1ONLA 3GTJB 1JJGA 1TT2A 4A3JG 2FXQA 5JJIA 3TRZA 5CMDA 4KHPQ 4WRDA 3MXPA 5GAHC 2NWGA 3RD4A 1NR4A 2HHHQ 2K03A 1L0YB 4KI0A 1CT1D 2Z6KC 4OEMB 2R93H 1E3PA 1YNND 2JA5B 1TWHH 1DCZA 1RHPA 1V9PA 3E6ZX 1Q7YC 3X3MA 2NTSA 1L2FA 1MD2D 1X55A 1SE8A 2RDHA 4IUVA 4P2CB 2NN6H 5M5WH 4OXPA 1EY9A 4RH6A 4BS9A 3HOWG 2CQAA 2NZ1D 4R8IA 4V0BA 1WCMH 4PQXA 1SN8A 3SK5A 2N49A 1PH8A 2F4IA 3I8ZA 2VZAA 1FR3A 3A5ZB 3VA5A 4AH6A 2CH4W 2K7VA 3F8TA 3C1FA 5L37A 5C4HA 1JWSD 4OGQC 1HCZA 1STGA 2H1EA 2UU9L 3CPFA 4K8JA 2JEBI 3C1EA 4X65Q 1EY5A 4NXMQ 5ELFA 3JAML 3KLSX 4DR3Q 4LJZC 2R7FA 3J7YW 5C44H 2PNHA 4GKKQ 1ZYRC 1K3BC 1AW7A 2CW0D 3G71A 1SYBA 3IFTA 1TVXA 2UUCL 4XTCS 3I2ZA 4K0KQ 3CP0A 2X6LA 2F0NA 2VUMH 2O4XA 4B3RL 4GN3B 1PZID 3T13A 4CJ0B 4A3DG 1HZAA 2A6HD 3UI2A 2CVRA 4ZUJA 2V4DA 1SSOA 3W5OA 4C1NI 1VMCA 1SLJA 3CRLC 3QIAA 1XPOA 1P16A 3UE1A 3K81C 4X64L 1I50H 3TBIB 1PTOB 2KECA 4LMQD 1EY0A 2OQKA 1EY7A 4BBRG 4XQJA 2B39A 4DR2Q 4IPCA 1HR0Q 4X62L 1QJOA 1X6OA 3OW2A 1S3OA 1YJ9A 4HEDA 3TP8A 2FMMA 5M9OA 4RCNA 1GUNA 1EY8A 1ET6A 1YHQA 1VQ9A 4LF4L 2R7ZG 3GTKB 1FVIA 4ULLA 4IJHA 3IL8A 1IL2A 1VMPA 1GO3E 1JR0D 3FDTA 3I4NH 3GTJH 1S5DD 1AZQA 2CH4A 4DAPA 1EU4A 3OHXC 3NXWA 2B29A 3KBXA 1KNAA 1CKNB 1NTGA 4O42A 4APVA 1VQAA 2A6EC 1WTXA 3S24A 2JA5H 3BYTB 1G291 3HOZB 3OPOA 1LTLA 4YWLA 2UXBL 1XMQL 3VDYA 4FXGC 4S3SA 4A3FB 2E2JB 1B9NA 4IUNA 1NUCA 4FDBA 4HSVA 2Z6KA 3UDGA 3GTGB 1PH6A 3PV0A 1STYA 5DAUA 2VQFL 1NBWA 4CDFC 1XJVA 1JQYD 3J7ZC 2UUBL 2RBMA 3S2DB 1B3AA 1X3FA 4PG3A 1FGUA 1QCBD 1NR2A 3MFYA 3NENA 1V8QA 2K75A 3AU7A 4HCSA 3BS1A 4OO1G 4HR7B 1UEBA 4OONA 2UU9Q 2NB0A 1MGSA 1IW7C 1TWGB 4A3LG 1VF7A 3HGBA 5J3BA 1CHQD 1N9WA 1NAPA 3NE5B 2L11A 4BBSB 4JI5L 3M85A 1XYIA 4OO1I 1F2ZA 1AE3A 1G6PA 3SR1A 1PZKD 1VQJA 5FO7B 3RLFA 4KY6A 3M3YB 1LT4D 3QR8A 3S1RB 1H9RA 2PNRC 3EJIA 4CJ2C 4ZKBB 3SK4A 1LM0A 5AJ3L 2UUCQ 2YTYA 1PRTD 1TKWB 5HY6A 4R4OA 4A4IA 1ENCA 3AB9A 1KAAA 1I94L 4B3RQ 2XIWA 1QOHA 2B2UC 1YZ6A 4R9WA 5IOCA 2JA8B 1TR5A 2HT1A 2K5HA 4DNIA 2A1AA 3D4RA 3DM1A 5JEAJ 2F0OA 1PFBA 1LTTD 4DR6Q 2E8GA 5F2DA 1KLUD 2OTJA 1PTOH 3HOYG 1C8CA 5E4XA 2CCZA 1Y8PB 2PZTA 1WTRA 5C4JB 4CGYB 4BA2I 3P75A 3HS0C 4JOIC 1B9MA 1E22A 3QO2A 5CV9A 3V96A 3CCUA 2EYPA 1IBKQ 3J7AF 3PCOB 4DR7L 1F77A 2EJMA 1R9TB 1X65A 3CW2C 3MWYW 2RDGA 3CCEA 1FYCA 1UWVA 3BZDB 2FJ2A 3J80L 4BXXG 3RR5A 3GTKH 2N78A 3RZDH 4JI6Q 1E2VA 2XGTA 4F88A 3EVQA 5LMNL 5JJKA 5M5YB 4DK1A 3I91A 3P20A 4A3JB 2UUAL 5JPMC 2IY5B 1HZ9A 1K28A 1PDQA 4UP7A 4A3GG 5C5LA 4QB4A 3OYYA 1YJNA 3PO3G 4K5XA 3G6JB 2EYLA 1YITA 4KKSA 5C3XA 1VQNA 1SMYC 2J4XA 4QJFA 4DF7A 3OIPA 1ASYA 1KRSA 3HOZH 2K01A 2QW7A 1ML0D 1FL0A 4A3FH 1XMQQ 3URYA 4KD3A 2UXDL 5JEAG 2WINB 1PH3A 1A62A 3ERQA 1D5ZC 1TY0A 1I4QA 4NB3A 4CDEC 2HD3A 3KJOA 2VQFQ 3S2DH 1M8AA 2PZWA 3GP7A 1VQMA 3L9AX 2MHVA 1SAPA 2UUBQ 1BCPC 2JQOA 2JA6G 1D5XC 1BNZA 4IFDJ 4HIKA 3ONAB 1IYVA 1CA6A 4GLXA 3NTIA 1O80A 1JWMD 1UNSA 3FPPA 1GKHA 4IJLA 5JVH3 3LWEA 2Z0SA 1GHJA 4CKEA 3CC7A 1TWGH 2HIVA 2EVBA 4H7BA 3ZYYX 3ITPA 3RLOA 4BBSH 4LFBL 1IKLA 3WOEA 4WJ4A 4NW2A 4JI5Q 1VQ5A 2F0FA 4WFN3 5I9OA 2EYFA 3M3YH 4N9PA 3S1RH 5I2YA 3DLLA 3MC0B 3HOVG 3NQIA 3I73A 3P1HA 2EY1A 2N88A 5LMUL 2L9HA 4HIDA 3CF5A 3ZJYC 2NVYB 2JA8H 1QVFA 1DONA 1E7ZA 3BVMA 1CZGA 3S17H 2KVMA 3QOLA 1YIJA 1U9RA 4C3HH 1SYGA 2E76C 4PNYA 2AHOB 4YCUA 1PH9A 4LFCQ 3U50C 1H9SA 2MNAA 1LTGD 3A0JA 4BBRB 1GXDC 4L5QA 4X3KA 5C4JH 4QIWB 2B2UA 1XMOQ 2CKZB 2RSOA 1NMFA 2HCCA 1Z7TA 2VS1A 1ICWA 3S2HB 1RKNA 5DLQE 4DV3L 1XXGA 1R9TH 1GUGA 3UDIA 3K58A 4K8IA 5J39A 2OT2A 1AH9A 4B9WA 5GAEC 1YNNC 1KAWA 3MXNB 4IFDG 3HFZB 1JOQA 1FNUA 4IOAA 3LWUA 4RAUC 1WOCA 3K5OA 4NKLA 4RMFA 4JOIA 5M5YH 5LMNQ 4RA8A 4QIWE 2F0QA 3K5NA 1EIHA 2DNCA 4OELB 3AEVA 4UPAA 2EZVA 1XX8A 5G3LD 2ZXOA 5IGFA 2HQLA 4A3KG 4IFDI 1SRUA 5ELBA 2IWHA 3S16B 2EE1A 4UAIA 4KD4A 5KEEA 4V190 4KKUA 5C0XJ 3HKZG 4ZUIA 2PYKA 2K5WA 4DR5L 4UP9A 5JJLA 1PZJD 4DR4L 3AYHB 1HUMA 1PH7A 4L5TA 2Z9HA 2RCNA 1E1TA 1YHAA 2GN5A 2Q2TA 1JWUD 2K28A 1H9KA 2Q2UA 4JI4Q 1CKOA 4J8QA 1HFGA 3A74A 1P8LA 2CW0C 2L1BA 1SJED 4JV5L 4DV0Q 2HHHL 2A69D 2BE5D 3NWTA 1H9SB 3E0JA 3IRBA 2TSSA 3GTOB 2JA7H 1WTOA 1W6JA 1BF4A 2PW5A 2NYZD 1WTQA 3ER0A 2A6HC 4HTHA 1SDFA 1H9MA 4FNFA 3J81E 5ELNA 2K50A 1SE3A 3CCLA 2B3GA 1JC7A 5JJZA 1V1PA 3MFGA 1B7YB 4OIKA 3OWEB 1ENAA 4LFBQ 3NBIA 5FLXE 3W3AA 5C4XH 1LT3D 1QILA 2K4KA 2IJ0A 1AN8A 2EYOA 1T5EA 2AQ1B 1RODA 2EOTA 4YWKA 4NP5A 2F0DA 4JPBW 4R4QA 2YYZA 1GUWA 5LMUQ 5M3FG 4PZ8A 1ZXTA 1RTOA 2XVSA 3K59A 2B63B 3PO2B 4MN3A 5I6YA 4X65L 5C0XG 4R8NA 2R3ZA 4NXNL 1CQFA 2QDLA 5IYCH 4DR3L 5FJ8G 2VW9A 1HA5A 5DNFA 2LS01 3NTHA 2HDMA 1G2SA 1JB7A 3W1GA 1TY2A 4KJOA 4BBRH 4WJ3M 3FRPB 3QB3A 5EKIA 4OL7A 4HIOA 4K0KL 5C0XI 3S2HH 1N8RC 1AZPA 1HHVA 3LGJA 4DV3Q 5AFWA 4HMIA 1HNZQ 2BA1A 3U58A 1S4ZA 3I4LA 2A19A 1X3PA 3ERSX 5LHY1 1HFNA 1TS3A 2KCMA 4DV7Q 1PMRA 2KA7A 2VL6A 3CHBD 4OX9Q 5COYA 3QWNA 1EL0A 1EZ8A 3J81c 4ODGA 4DR2L 2EXDA 1N32L 4CDCC 1HR0L 4A3GB 1V1PB 3S16H 4JI1Q 1QUQB 2R92G 4R1JA 3PUWA 5KNCA 5FLXc 1EEID 1KL9A 2KJXA 4BA1I 3I55A 3E9HA 3H3VI 4PMWA 1OO9B 4DR5Q 1QZGA 5KYIA 2F0LA 2B8FA 5T1IA 1MHWC 5EBCA 3UDFA 1ESFA 4F87A 3JAMi 1EYGA 1G51A 3WOFA 2P5ZX 3I4OA 2XNAC 3EN2A 4N8X1 2AWNA 3OMCA 1DM0B 1LTSD 1SYFA 2D2CC 3EIVA 4XQNA 2FFKB 2G9DA 4JV5Q 4KHZA 3GTOH 4JI2L 2JA6B 1PRTC 3GTQB 1ET9A 4XIGS 3M7NA 4C3IG 4KMUC 4OWXB 4BWGB 2F0WA 1VQBA 3ULLA 5T1GA 2FINB 2IX1A 1R4QB 2K5VA 3DM3A 1Z47A 3ND9A 3U4ZA 4GN5A 1TQOA 3DHQA 1SXTA 1BXTA 2WB1B 3SEBA 5IP9H 1S5FD 5IYDH 2X6GA 4GLVB 1EYAA 4LUOA 2F4VQ 4IALA 4TVAB 1GJXA 4G7OC 5C3EB 1PYSB 1IHZA 2AUKA 2VXWA 1O7IA 4K2KA 4C3JB 2EPBA 5H1SE 1CSPA 4IURA 4LK1C 5CV5A 1SMXA 2ZXPA 3PO2H 2B63H 3U4VA 4R4CA 2K33A 3TP5A 2J7ZA 2WB1E 1HPCA 1A3VA 1K3RA 4NXNQ 4QF4A 1DYQA 5EPKA 5GQOA 1CKNA 3R3OA 5JPNC 4JBWA 4LF6L 1I4RA 3EFXD 5GADC 2JN4A 3STBD 4RFBA 2O5IC 4ZYSA 3I56A 4A3CH 1V1OA 5BR8L 4HCEA 1FJGL 3CKIB 1SE2A 4JK1C 3M4OH 2FHTA 3I7FA 2B2WC 4BY1G 3I4MG 3KOJA 2O2LD 1QE6A 1B1ZA 3A56A 3CCJA 4A3EB 1CZWA 1VQLA 4DR6L 1FGBD 1X54A 2HIXA 1STAA 1YJWA 2NTTA 1JJ2A 4MTKA 1SR3A 4KHVA 4LF9L 4DU9A 2RF4A 1YI2A 1STNA 4A3GH 4QCLA 1N32Q 4A3KB 1IBKL 2GVAA 1A3UA 1OXVA 1QNUA 4GLAC 5CR3A 5IODA 5IYBG 3FPUB 1Q8IA 1RD9D 1ZEQX 2F0EA 1HA6A 4POFA 1I6HB 4JI6L 3PUVA 1CI3M 1VQDA 1UAPA 3K80C 3OMGA 2NBFA 2EJGC 1HNWQ 2KHJA 1U5KA 1A0IA 3CMEA 3F1ZA 2DGYA 5JEAH 1N36L 3CD6A 3NQTA 3H91A 5CBEE 3NEMA 5CORA 1EYCA 4IQZA 2L12A 1IBLQ 4H0LC 3NBHB 4LAAA 4ZAIA 3BDCA 1II3A 1LO5D 2XWJB 1RCVD 1HNXQ 4JI2Q 4YY3L 4XT3B 3RZOB 1G8ZD 4GOPB 2HCIA 4G7HC 2Y0SB 3L2PA 2SNMA 1PYBA 4A76A 5EQ0A 1JICA 4YIJA 3T1HQ 2F0HA 1B4OA 3A55A 1PTOF 1VQHA 3MZ5A 3L3OC 4DA2A 2OXPA 3CC2A 1ICFB 5HGQA 4AYBB 1EIYB 1WTWA 1FNVA 2ENBA 5CBAE 1STHA 1VQPA 1Y1WG 2NVTB 1NSNS 2BH2A 1HZCA 4OIJA 2H5XA 2JEAI 3TEHB 5C3EH 4Y7NB 4L5SA 1PVOA 2Y0SE 2I07B 4C3JH 2L5TA 2LXKA 4WORA 1EIGA 3MVVA 2PPBC 1K8MA 3J80i 5I2XA 3A8KE 4GZYC 1Y1VB 1B70B 1LTAD 3EROA 4K5WA 4LFAQ 1I4XA 2SEBD 1O7LA 1Q46A 4AYBE 1A63A 4N9TA 4LUZA 1DZ1A 1Q1BA 4Y52H 4LF6Q 2R93G 4C1NK 3BDLA 3AFPA 4O0AA 4JI8L 4EVOA 1C7YA 1X3QA 4C56C 2K14A 2IX0A 4HSPA 4YCVA 4BY7B 4K6LA 1M4VA 2KHIA 5BR8Q 1FJGQ 1EQVA 3VR2A 1QVGA 3MEHA 4DAYB 2NN6G 3RN2A 1SYDA 2ATWA 1E0BA 4IFDH 2EYHA 3I90A 4UDUC 1WCMG 2BA0A 1EFWA 1LLRD 4MHEA 2Q8IB 4J1MA 4A3EH 4X6AH 2HUGA 2Z4HA 1J5EL 1SNMA 1M1KC 3MAQA 4LFCL 3OSOA 1B2TA 5IGCA 5I4DA 1VQ7A 4A93G 1XMOL 2BH8A 2ZTDA 3VR4A 1K9MC 2NN6I 2F0MA 4LF9Q 1S72A 4A3KH 2B2WA 2A69C 2RSNA 2BE5C 4EX5A 1PRTB 4DV6Q 2K04A 3X3NA 3GV3A 1AP0A 3SXHA 4KY5A 4JBMA 1EFID 4A3IB 1PLFA 3KBGA 3HOUB 5IY0A 1I6HH 5BN3A 1SYEA 4R4IA 5D3IB 5EKLA 4WJWA 3S1NB 5C44G 3H0GG 4NDXA 2F0JA 1NMGA 4JVZA 4POGA 4FO2A 5FOBB 1N36Q 1UUPA 4C2MB 2M00A 3S14B 1KIXA 1LT5D 1TIID 4GN4B 3AQQA 1I4HA 1NE3A 4FF1A 2E5LL 4DV4L 2D0PA 3RZOH 4YY3Q 3PMFA 3F2DA 3MHBA 4FF3A 4RKBA 3TREA 3NUCA 2RDFA 3DEOA 1HZBA 2K5DA 4ILWA 3EBEA 3BVZA 4ME3A 1NJIC 4JI4L 4L6TB 2E2JH 2LKVA 3F2CA 3HOWB 3GTGH 1KHIA 3PUYA 4DV0L 1C9OA 3K0XA 2LY7A 2NVTH 5LL6X 2KCTA 5LL6S 2I46A 3MXNA 4Y7NH 2D5DA 1F2LA 5DEHA 3FKIG 2KHSA 5ELDA 4KTAA 3I4NG 2SNSA 1FD7D 2QEXA 4JC0A 1JMCA 4HAEA 4GNXB 3W1BA 2DY7A 4Q5VA 2F3WA 1G91A 4HIMA 1JOOA 1Y1VH 1K8GA 4A75A 2H4OA 2E2IB 1LUZA 4QY7A 1SNDA 2Z8LA 1EY4A 4JW0A 4A3MG 2I0QA 1F2YA 2BOSA 4TQUS 4UHVA 1D1KA 2MUYA 1PA6A 5EAYA 4RCOA 1A3TA 2CWAA 2JA5G 4PV1C 4RGNA 2F3IA 3D6WA 1TWFB 4JG2A 1B44D 2SDFA 4JI8Q 1T5XD 1H95A 3DWAA 2L55A 4DV5Q 4DUYL 3K7UC 4BY7H 4YCWA 1O7ZA 2AQ2B 2IL8A 1EWHA 4A3DB 4DKAC 4EQNA 3S9WA 5IE8A 2F52A 1S40A 4DV1L 2ZT9C 2DY8A 2F0SA 3FHWA 3D31A 1HXYD 1MKHA 2MQHA 2RQXA 3L0OA 1SNQA 4DUZL 2DNEA 2JSOA 4IUUA 3K57A 1J5EQ 2Z1CA 3CC4A 1EQRA 4P72A 4JI7Q 3EQLC 2J0TD 2MGSA 1C0AA 2K52A 4P71A 3S1MB 1TXYA 2NZHA 3KFUA 5NUCA 1VQEA 1WJJA 3N6RA 5DM63 1HNZL 2ES2A 2ID0A 1BVSA 3R93A 4A3IH 4FF4A 1BKBA 3HOUH 5IGDA 3FEWX 4DFAA 5A2QE 1TWCB 3S1NH 3MTSA 5ELEA 1KNEA 2R7ZB 4KJNA 3HOXG 4DV7L 4PZ6A 4OX9L 2K32A 5FLMH 1W2BA 2B2TC 4I7ZC 2I5HA 4A3JH 1IKMA 5KGUA 2G9HD 3TS0A 2YV5A 2CWPA 4C2MH 3S14H 3NTKA 1SYCA 4JI1L 4MTNA 1WTHA 1H9JA 3H09A 4KN7C 3KF6A 2PQEA 1VQ8A 5EPJA 2HQEA 1J9OA 1O78A 1T9HA 2E5LQ 3T53B 4DV4Q 2LSSA 2PI2A 5J22A 5BN5A 3A8JE 4JI3Q 1RTNA 3GTMB 4L63B 2KOLA 1BO0A 2DN8A 3A8IE 1L0WA 1SFOB 1GUSA 5KRUA 3Q22A 2NVQB 1U4PA 4QUCA 4HJ5A 1JT8A 2E2HB 3S15B 1J6QA 3C2PA 3HOWH 1QB5D 1UE7A 3STBC 3P7JA 2LXJA 1S5BD 2EJFC 3Q8DA 1Y1WB 1MJCA 3K8AA 4J15A 2LFNA 5IT9E 2JP1A 2IHEA 1WTVA 4CBVA 3DXJC 3SVMA 1U4RA 3D0FA 1A8VA 2CHBD 2DJGC 1K0RA 1GUTA 2MJ8A 1LV9A 2E2IH 1G2TA 1J8IA 3GV6A 3ICEA 3TP7A 1LTBD 5EPLA 3DMUA 3KJPA 1NNXA 1QUQA 1X56A 2WP8J 3D4DA 3BZCA 1M90C 4FXDA 4X3UA 2F4VL 2IT1A 1TWFH 3HEJA 3TMEA 4HJ9A 1XNQL 2F0IA 5KNDA 4JI0Q 3HOZG 1VQIA 4DGZA 3H15A 5E1FA 4DV2L 1BQQT 3WWVA 3ULPA 3KDFA 2OWOA 4DUYQ 3KF6B 2NVYH 4A3FG 1IXRA 2E74C 1YVCA 2AWOA 4A3DH 2EY6A 4H02A 4GOPC 4IUQA 1RL2A 5FKAC 4AQYL 4DV1Q 2QKIC 2WKDA 1SE4A 1BBWA 1CA5A 3RNUA 1NY4A 5K36G 1VQOA 4DUZQ 1Z6HA 1ESRA 2SOBA 3CRKC 1LABA 1AEXA 2XTIA 4GKJL 3HOYB 1V1QA 4A93B 2A68D 3LX0A 4LF8Q 2N55A 3S1MH 3CCMA 1KDBA 1RJTA 1SNCA 2OEOA 1HTPA 1IL8A 4DNTB 1U4MA 1IBML 5I9PA 5ELCA 1VQFA 5ELOA 4IOCA 3SDZA 4CKBA 3FVQA 4OHJA 5IYBH 2Z6BA 2F0GA 1A2UA 1TWCH 3BVGA 4R4TA 5D14A 2PI2E 4EGVA 3K6OA 4AIMA 2R7ZH 3H0GB 3U9SA 3K7AB 5IT9c 3GDEA 2JYOA 1X32A 5ISRA 2QF7A 1EU3A 1EZ6A 1LYLA 1OXXK 1QVCA 4X3TA 1WFQA 1WYDA 2R7DA 1X9NA 1VQ6A 2KEEA 2JA8G 2ZM6Q 3D8GA 3PQIA 3JAME 2K05A 4HMJA 3D6CA 3KLSA 3PO3B 2C35B 4C3HG 1GD7A 1HUNA 1KDAA 2JJQA 3M9BA 2B2TA 3PF4A 1CSQA 1HTLD 4M8AA 1I50B 3GTMH 1HJPA 3KDFB 1HNWL 2AQ3B 1SFOH 4HN7A 5C3WA 2NVQH 2UXCL 2F1MA 3J81L 5FK9C 1D6EC 2EQSA 2MP1A 3V05A 3S15H 1BOSA 3I72A 4ZQ3A 2EDGA 1TS5A 5EJWA 2PQAA 1IBLL 3H3VC 3KF8B 4IPHA 4NPSA 2VB2X 4PMBA 1EY6A 1Y69U 1HNXL 5FLXL 3VR5A 4O2DA 1GOZA 2XRQD 2N8NA 2M2LA 3FKIB 1Q81C 3BYYB 3I4NB 4OO1H 3Q0AA 3T1HL 3PSIA 3BU2A 4IPDA 3BDOA 1PFSA 4B3SL 1ILPA 1GVPA 2WIIB 3H94A 3SGIA 3BJUA 1EQTA 1CUKA 1WVLA 3B6YA 4A3LH 4JBJA 1ZKOA 1I5FA 4A3MB 2MO0A 2RVLA 3A7AB 1A6XA 1U4LA 4P75A 1BCPF 5E4WC 3TQYA 3NPPA 1S5CD 3FMCA 1XWEA 5IP7G 1XNQQ 3HOVB 2KENA 3EA6A 3PUXA 4M1UB 4DV2Q 1HQMC 4LF7Q 1I4GA 1O7YA 5E3FA 2XRSD 4YHHL 4A3BG 3JAMc 4CDDC 4DK0A 3FP9A 4LWCA 4LFAL 1PHJA 4EQ5A 4AQYQ 1K73C 3BG3A 4G4KA 2ZJPA 2WFWA 4ZKCB 3PGZA 2JA7G 4ALPA 3NWSA 2PCFB 3NBHA 3HOYH 1EIFA 1EUJA 1I4PA 1VQGA 4A93H 3CCQA 3C46A 4GKJQ 5GROA 1DOMA 1U0LA 3QG1A 2A8VA 1Z9FA 4GOPA 2R6GA 4DK6C 4DR1L 1PYWD 1DOKA 1IBMQ 4LNQA 2PQAB 5KNBA 4IUPA 2YTXA 3PIP3 3J81j 1EWIA 4DXGA 2KQ3A 4BXXH 4GNXC 3NP8A 2EYJA 3H0GH 3HP3A 2Z4IA 3K7AH 1PTOD 5C4XG 1PV4A 3HOXB 1JE4A 1UE1A 3R2IA 4KV6A 3U9OA 1BBUA 4B08A 1I6VC 2JE6I 2KCCA 1RIPA 1KABA 2F0PA 2KEDA 1K8OA 2KCNA 3W2DA 5IIFA 1ILQA 5KIXA 1N33L 3E9IA 2MPMA 4DV6L 2B2YC 4FXKC 3L7ZC 3PO3H 3I70A 3IAYA 3N52A 1CK1A 4ZCKA 3GO5A 5IYCG 4RHSA 2VNUD 3HKZB 3I3CA 2A5HA 4KN4C 3VYSA 4PMCA 5C6AA 1TS2A 4I7AA 3PF5A 2ALYB 2MFIA 4RGOS 1TWAB 2VQEL 4G57A 2CQOA 1Y8OB 1KC8C 2UXCQ 1IYUA 3O13A 1YNJD 1KXLA 2EY5A 2K1BA 3T16A 2F03A 1Q90A 3DEPA 4LW1A 4RKLA 1IYJB 4P74A 4QQBX 4IUTA 2QA4A 1DGSA 4B3ML 2YU9B 5M5XB 5E7NA 3NHHA 1QWYA 3GQBA 3HKZE 4K2LA 3T4AC 4DAYA 3RZDB 3TDQA 2JA6H 3RN5A 3GTQH 1EYDA 3FKIH 2D9UA 3KUPA 5JOBA 4N8FA 3TS2A 3V2TA 1C48A 3D4WA 3CQZB 2DUDA 1Y14B 3WDNA 4B3SQ 1GHKA 2EIFA 1AE2A 4A3MH 1BDOA 3J80E 3T1YL 4DN4M 1YHBA 1UE5A 5M3MG 4P73A 3G4SA 1XNRL 1EEFD 5D3DA 4DAVA 1JE5A 1JJCB 3HOVH 3E3XA 4OWWB 5FO8B 3KLWA 5M3FB 5CV4A 1OXTA 1BBXC 5I6WA 4OWTB 2AUJD 5JVG3 4YHHQ 2VB3X 1W3SA 1X3EA 5J1ZA 2PW7A 4XYOA 2XWBB 5CYUA 3S1QB 3GTPB 2F3VA 1A2TA 3AMUA 3KLRA 1STBA 4DV5L 1MI2A 1OTCA 4IPGA 3HZXA 4DR1Q 2C5CA 1B8AA 2OQ0A 1MIUA 1CQVA 1NCVA 1Y8NB 5IP9G 2JXMB 1QZHA 1MJEA 5IYDG 3F2BA 3Q24A 1Q86C 4HJ8A 2K5NA 1X3GA 2Q2HA 1XPUA 3HOXH 1PH4A 5D65A 1F2MA 4LF5L 4RG1A 4JI7L 1VDZA 1N34L 1CFMA 1KRTA 5EBDA 4RWSC 4TRDA 3NELA 4GS3A 3K5MA 1E24A 1PH5A 1N33Q 4TKOB 2B63G 3PO2G 5GAGC 3PIOA 2R92B 4Q0FA 4GNXA 3SHLA 1UE6A 3RUZA 3S17B 3J80c 1D8LA 5IGGA 4C3HB 1Q82C 4QUFA 1OXSC 4DK3C 4X64Q 1XPRA 2B2VC 1TWAH 1ASZA 3GTLB 5JAVA 2VQEQ 2B2YA 1V43A 3CPWA 5IGEA 4IN3A 1HR0W 4DNRB 4A3CG 1Q1EA 4X62Q 5IGBA 2VUMG 2WAQG 1HQRD 5BN4A 2YU9H 1E1OA 5M5XH 5CC4A 4XT1B 4B3MQ 4LF4Q 3JC66 1WTPA 5EKKA 3G7LA 2V1CC 2JA9A 3TSSA 4C3IB 1L1OC 4JI3L 4H13C 1PFMA 1Q3LA 4X66L 3CQZH 1ZYRD 5EGTA 1B3QA 1DOLA 5IWAL 1SNOA 4K5VA 4MIUA 4FF2A 1CHPD 1AFPA 1KDCA 4KY7A 3E0EA 2L15A 3NSWA 2MO1A 5A35A 2A68C 3M4YA 1E2WA 4MNOA 3T1YQ 1PRTF 3QJYA 1S5ED 3Q6SA 4RHRA 1XNRQ 1JORA 2IPKD 2KBNA 2F0VA 3T51B 1VQ4A 5DM73 1VS0A 5M3FH 3OIQA 1YEZA 1KD1C 2UXBQ 4QMGA 1KTKA 4A3BB 2O5JC 5CGKA 4KKTA 1PFNA 2I5LX 5C0XH 2ICEC 1C4QA 5FO9B 3PIO3 2F0KA 4U673 4DPGA 3IKJA 4UY8C 3MXGA 5FJ8H 5K36H 1SJHD 2D0OA 4FP5D 2AKWB 1PH2A 4L5RC 1BUVT 2JA7B 1A15A 3VA7A 4F7XA 2WV6D 1MBYA 2RCFA 3QOJA 3S1QH 3GTPH 3CCSA 4JBKA 4XQQA 4JI0L 4QGUA 1SBBB 1I3QB 3DUZA 1QG7A 1VF5C 4PZ7A 3OW7A 1XTCD 4O1NA 2NVXB 1XTDA 2WB1G 2B8GA 3HKSA 5CV6A 4BY1B 1B53A 2XSCA 3I4MB 1ENFA 2GVBA 5C4XB 4H44C 1TS4A 4G7ZC 1R4PB 5C3EG 2IHFA 4LF5Q 3RLNA 4LF8L 2RHSB 1JCKB 2A6ED 5AJ3Q 3H3VH 4C3JG 3CU7A 1N34Q 4JYAL 3CMAA 5C5MA 3SE0A 1K83B 3Q23A 1I94Q 3A5UA 3OWFA 2IX3A 2WACA 4ZK9B 2R92H 3MEFA 2OCEA 4FVMA 4B3TL 1WD0A 2LMCB 4DAMA 1D1IA 3TP6A 3VR3A 3VYUA 3E5SA 1EOTA 4F8MA 2QGQA 4I65A 3GTLH 1CTMA 1B50A 4HJAA 2Q2IA 1RF2D 1RDPD 2XN9C 1K0SA 2RKSA 1IZ6A 3CXCA 3H6MA 1HRJA 1GUOA 3M4PA 4DR7Q 4IZ8A 2ZM6L 2YTVA 5TSSA 3TN2A 1WI5A 4EQOA 1DJRD 4XYQA 3OOCA 1JOKA 3UDXA 4NMZA 1STEA 2B2VA 1IW7D 4CHTB 2ICIA 4A3EG 3HG9A 2OTLA 4RGMA 4C3IH 1G6ZA 4ME5A 3UE0A 2F0UA 2Q8TA 1MSHA 2UUAQ 4X66Q 2BDOA 3SK6A 1TU2B 2OF1A 1SNPA 1PH1A 3OTOL 1LACA 1Q12A 1SROA 5IWAQ 3R8BA 1JB3A 3KYHC 1L1OA 2QCPX 1DXMA 2PO4A 3K5LA 3CCRA 5M3MB 3A7LA 2A74C 2G5DA 1DD2A 1D2BA 1F9SA 2PZUA 5IP7H 4MZ9A 4X3SA 4LUVA 3MXUA 3GD7A 4J6HA 3CCVA 4TSSA 3HRZC 1LT6D 1WD1A 4XXEA 3G48A 2QILA 1EOVA 1HH2P 4FYDA 4A3BH 3ND8A 4U68A 3J7A5 2UXDQ 5C4ZA 4KHPL 1PTOC 2M9VA 3T56B 4CKCA 2ZTEA 2VY3A 3SK8A 2L4NA 1VCIA 2JK8A 2NUCA 1L0XB 2ZXRA 1YNXA 1OXUA 4ID6A 2GA4B 5HURA 2R93B 2K6AA 1CM9A 3DWQA 1TWHB 4UP8A 3VYRA 2Y0SG 1FNWA 1VQCA 1QNKA 1I3QH 3CAMA 4LF7L 2KUMA 2AMCB 1UEAB 3TZUA 2NVXH 2DJFC 1YBYA 1SEBD 1BR9A 5M5WB 2QEJC 2I5MX 4BY1H 3I4MH 4YWMA 1MSGA 2K5QA 4AYBG 1WCMB 4IO9A 5A2QL 2BCOA
chains in the Genus database with same CATH topology
2RA4A 5G3LF 3PUZA 4ZLTF 3KF8A 1YNJC 4B9XA 2FMCA 1SMYD 5HGTA 2QDBA 5KYLA 1F9PA 4ZRZA 3MA2B 4E6IA 2A73B 4L8JA 4DXFA 3C3LA 2Q8RE 3IFDA 2EXZA 1W6KA 2WKCA 5C44B 2E2DC 3VR6A 3RMHA 1D5MC 3F2UA 1BCPD 4CJ1B 2VUMB 2WAQB 1LTID 3M4OB 3DWPA 2BDNA 2D62A 4Z9CB 2E75C 1PXUA 1E2ZA 1F9QA 3A54A 2TMPA 5K5PA 3TZDA 2HDLA 1F9RA 4ABNA 2EYMA 4K6DA 4RGTA 1LTRD 2R61A 5IT9L 3J7AV 3M7GA 4KK7A 5CV8A 1KLGD 2PMZB 3R2TA 2C9OA 1BCPB 2IW3A 2EY2A 3KK7A 4K14A 4XDXA 3VYTA 5CV7A 3NK9A 3K0YA 2X69A 2F0TA 4EQPA 3LNNA 1EWCA 3D3RA 2L0CA 1ONLA 3GTJB 1TT2A 5CMDA 4WRDA 3MXPA 2NWGA 3RD4A 1NR4A 2K03A 1L0YB 4KI0A 1CT1D 1YNND 2JA5B 1DCZA 1RHPA 3E6ZX 3X3MA 2NTSA 1MD2D 2RDHA 4IUVA 4P2CB 2NN6H 4RH6A 1EY9A 4BS9A 2CQAA 2NZ1D 4R8IA 4V0BA 4PQXA 3SK5A 2F4IA 3I8ZA 1FR3A 3VA5A 2K7VA 3C1FA 5C4HA 1JWSD 4OGQC 1HCZA 1STGA 2H1EA 4K8JA 2JEBI 3C1EA 1EY5A 5ELFA 3JAML 3KLSX 4LJZC 3J7YW 1ZYRC 1AW7A 2CW0D 1SYBA 3IFTA 1TVXA 4XTCS 2X6LA 2F0NA 2O4XA 1PZID 3T13A 4CJ0B 2A6HD 3UI2A 2CVRA 4ZUJA 2V4DA 1SSOA 4C1NI 1VMCA 3CRLC 3QIAA 3TBIB 1PTOB 2KECA 4LMQD 1EY0A 1EY7A 4XQJA 2B39A 1QJOA 4HEDA 3TP8A 2FMMA 5M9OA 4RCNA 1GUNA 1EY8A 1ET6A 3GTKB 4ULLA 3IL8A 1VMPA 1JR0D 3FDTA 1S5DD 1AZQA 4DAPA 1EU4A 3OHXC 3NXWA 3KBXA 1KNAA 4O42A 2A6EC 1WTXA 3BYTB 1G291 3HOZB 3OPOA 4FXGC 4S3SA 4A3FB 2E2JB 1B9NA 4IUNA 1NUCA 4HSVA 3GTGB 3PV0A 1STYA 5DAUA 1JQYD 2RBMA 3S2DB 1B3AA 1QCBD 1NR2A 3MFYA 1V8QA 3AU7A 4HCSA 3BS1A 4OO1G 4HR7B 2NB0A 1MGSA 1IW7C 1TWGB 1VF7A 3HGBA 1CHQD 1NAPA 3NE5B 2L11A 4BBSB 3M85A 1XYIA 4OO1I 1F2ZA 3SR1A 1PZKD 3RLFA 5FO7B 3M3YB 4KY6A 1LT4D 3S1RB 1H9RA 2PNRC 3EJIA 4CJ2C 4ZKBB 3SK4A 1PRTD 1TKWB 1ENCA 3AB9A 1KAAA 2XIWA 1QOHA 2B2UC 4R9WA 5IOCA 2JA8B 1TR5A 3D4RA 3DM1A 5JEAJ 2F0OA 1PFBA 1LTTD 5F2DA 1KLUD 1PTOH 1C8CA 5E4XA 1Y8PB 2PZTA 1WTRA 5C4JB 4CGYB 4BA2I 3P75A 3HS0C 1B9MA 3QO2A 5CV9A 3V96A 3J7AF 2EYPA 1F77A 2EJMA 1R9TB 3MWYW 2RDGA 1FYCA 3BZDB 2FJ2A 3J80L 1E2VA 4F88A 3EVQA 5M5YB 4DK1A 3I91A 3P20A 4A3JB 5JPMC 1PDQA 5C5LA 4QB4A 4K5XA 3G6JB 2EYLA 4KKSA 5C3XA 1SMYC 2J4XA 4DF7A 3OIPA 2K01A 1ML0D 3URYA 4KD3A 5JEAG 2WINB 3ERQA 1D5ZC 1TY0A 1I4QA 1M8AA 2PZWA 3GP7A 3L9AX 2MHVA 1SAPA 1BCPC 1D5XC 1BNZA 4IFDJ 3ONAB 1IYVA 1CA6A 3NTIA 1O80A 1JWMD 1UNSA 3FPPA 5JVH3 3LWEA 1GHJA 4CKEA 2EVBA 4H7BA 3ZYYX 3ITPA 1IKLA 3WOEA 4NW2A 2F0FA 4WFN3 5I9OA 2EYFA 4N9PA 5I2YA 3MC0B 3NQIA 3I73A 3P1HA 2EY1A 2N88A 2L9HA 2NVYB 1DONA 3BVMA 1CZGA 2KVMA 3QOLA 1U9RA 1SYGA 2E76C 4PNYA 1H9SA 1LTGD 4BBRB 1GXDC 4X3KA 4QIWB 2B2UA 2RSOA 2HCCA 1Z7TA 3S2HB 1ICWA 1RKNA 1XXGA 1GUGA 3K58A 4K8IA 5J39A 2OT2A 4B9WA 1YNNC 4IFDG 1JOQA 1FNUA 3LWUA 4RAUC 3K5OA 4NKLA 4RA8A 2F0QA 3K5NA 1EIHA 2DNCA 2EZVA 1XX8A 5G3LD 2ZXOA 5IGFA 4IFDI 2IWHA 5ELBA 3S16B 2EE1A 4UAIA 4KD4A 5KEEA 4V190 4KKUA 5C0XJ 4ZUIA 2PYKA 2K5WA 1PZJD 1HUMA 1JWUD 2K28A 1H9KA 4J8QA 1HFGA 2CW0C 2L1BA 1SJED 2A69D 2BE5D 3NWTA 1H9SB 3E0JA 2TSSA 3GTOB 1WTOA 1W6JA 1BF4A 2PW5A 2NYZD 1WTQA 2A6HC 4HTHA 1SDFA 1H9MA 4FNFA 3J81E 1SE3A 1JC7A 5JJZA 1V1PA 3MFGA 4OIKA 3OWEB 1ENAA 3NBIA 5FLXE 3W3AA 1LT3D 1QILA 2IJ0A 1AN8A 2EYOA 1T5EA 2AQ1B 1RODA 2EOTA 4NP5A 2F0DA 2YYZA 1GUWA 1ZXTA 1RTOA 2XVSA 3K59A 2B63B 3PO2B 4MN3A 5I6YA 5C0XG 4R8NA 2R3ZA 1CQFA 1HA5A 5DNFA 2LS01 3NTHA 2HDMA 1G2SA 1TY2A 4KJOA 3FRPB 3QB3A 5EKIA 4OL7A 5C0XI 1AZPA 1HHVA 5AFWA 4HMIA 2BA1A 1S4ZA 3I4LA 1X3PA 5LHY1 1HFNA 1TS3A 1PMRA 2KA7A 3CHBD 5COYA 3QWNA 1EL0A 1EZ8A 4ODGA 4A3GB 1V1PB 3PUWA 5KNCA 1EEID 2KJXA 4BA1I 4PMWA 1OO9B 5KYIA 2F0LA 2B8FA 5T1IA 5EBCA 1ESFA 4F87A 3WOFA 2XNAC 2AWNA 3OMCA 1DM0B 1LTSD 1SYFA 2D2CC 4XQNA 2FFKB 2G9DA 4KHZA 2JA6B 1PRTC 3GTQB 1ET9A 4XIGS 3M7NA 4C3IG 4KMUC 4BWGB 2F0WA 5T1GA 2FINB 2IX1A 1R4QB 1Z47A 3ND9A 1TQOA 3DHQA 1SXTA 1BXTA 2WB1B 3SEBA 1S5FD 2X6GA 1EYAA 4IALA 1GJXA 4G7OC 5C3EB 1IHZA 2AUKA 2VXWA 4K2KA 4C3JB 2EPBA 4IURA 4LK1C 5CV5A 2ZXPA 3TP5A 2K33A 2J7ZA 1HPCA 1A3VA 4QF4A 1DYQA 5EPKA 3R3OA 5JPNC 4JBWA 1I4RA 3EFXD 4RFBA 2O5IC 4ZYSA 1V1OA 4HCEA 3CKIB 1SE2A 4JK1C 2FHTA 2B2WC 2O2LD 1QE6A 1B1ZA 3A56A 4A3EB 1CZWA 1FGBD 1STAA 2NTTA 4KHVA 4DU9A 1STNA 4QCLA 4A3KB 1A3UA 1OXVA 1QNUA 5CR3A 5IODA 3FPUB 1Q8IA 1RD9D 1ZEQX 2F0EA 1HA6A 1I6HB 3PUVA 1CI3M 1UAPA 3OMGA 2NBFA 2EJGC 5JEAH 3NQTA 3H91A 5CBEE 5CORA 1EYCA 4IQZA 2L12A 4H0LC 4LAAA 4ZAIA 3BDCA 1II3A 1LO5D 2XWJB 1RCVD 4XT3B 3RZOB 1G8ZD 2HCIA 4G7HC 2Y0SB 2SNMA 5EQ0A 1JICA 4YIJA 2F0HA 1B4OA 3A55A 1PTOF 3MZ5A 3L3OC 4DA2A 2OXPA 4AYBB 1WTWA 1FNVA 2ENBA 5CBAE 1STHA 2NVTB 1NSNS 4OIJA 2JEAI 4Y7NB 2I07B 2L5TA 4WORA 1EIGA 3MVVA 2PPBC 1K8MA 5I2XA 3A8KE 4GZYC 1Y1VB 1LTAD 3EROA 4K5WA 1I4XA 2SEBD 1O7LA 4N9TA 1DZ1A 1Q1BA 4C1NK 3BDLA 4EVOA 1X3QA 4C56C 2IX0A 4HSPA 4BY7B 4K6LA 1M4VA 1EQVA 3VR2A 3MEHA 2NN6G 1SYDA 1E0BA 4IFDH 2EYHA 3I90A 4UDUC 2BA0A 1LLRD 4MHEA 2Q8IB 4J1MA 2HUGA 2Z4HA 1SNMA 3MAQA 3OSOA 1B2TA 5IGCA 5I4DA 3VR4A 2NN6I 2F0MA 2B2WA 2A69C 2RSNA 2BE5C 1PRTB 2K04A 3X3NA 3GV3A 1AP0A 3SXHA 4KY5A 1EFID 4A3IB 1PLFA 3KBGA 3HOUB 5BN3A 1SYEA 5D3IB 5EKLA 4WJWA 3S1NB 4NDXA 2F0JA 4FO2A 5FOBB 1UUPA 4C2MB 2M00A 3S14B 1LT5D 1TIID 1I4HA 4FF1A 3PMFA 3MHBA 4FF3A 4RKBA 3NUCA 2RDFA 3DEOA 2K5DA 4ILWA 3BVZA 4L6TB 2LKVA 3HOWB 3PUYA 2LY7A 5LL6X 5LL6S 2I46A 3MXNA 2D5DA 1F2LA 5DEHA 2KHSA 5ELDA 4KTAA 2SNSA 1FD7D 4HAEA 2DY7A 4Q5VA 2F3WA 1G91A 1JOOA 2H4OA 2E2IB 1SNDA 2Z8LA 1EY4A 1F2YA 2BOSA 4TQUS 1D1KA 2MUYA 4RCOA 1A3TA 4PV1C 4RGNA 3D6WA 1TWFB 1B44D 2SDFA 1T5XD 3DWAA 2L55A 1O7ZA 2AQ2B 2IL8A 1EWHA 4A3DB 4EQNA 3S9WA 2ZT9C 2DY8A 2F0SA 3D31A 1HXYD 2RQXA 1SNQA 2DNEA 2JSOA 4IUUA 3K57A 2Z1CA 3EQLC 2J0TD 2MGSA 3S1MB 5NUCA 3N6RA 5DM63 2ID0A 3R93A 4FF4A 5IGDA 3FEWX 4DFAA 5A2QE 1TWCB 3MTSA 5ELEA 1KNEA 2R7ZB 4KJNA 2K32A 2B2TC 4I7ZC 1IKMA 5KGUA 2G9HD 3NTKA 1SYCA 1H9JA 3H09A 4KN7C 2PQEA 5EPJA 2HQEA 1J9OA 1O78A 3T53B 5J22A 5BN5A 3A8JE 3GTMB 1RTNA 4L63B 2KOLA 1BO0A 2DN8A 3A8IE 1SFOB 1GUSA 5KRUA 3Q22A 2NVQB 1U4PA 4QUCA 2E2HB 3S15B 3C2PA 1QB5D 3P7JA 1Y1WB 1S5BD 2EJFC 2LFNA 5IT9E 2JP1A 1WTVA 4CBVA 3DXJC 3SVMA 1U4RA 2CHBD 1GUTA 2MJ8A 1LV9A 1G2TA 1J8IA 3GV6A 3TP7A 1LTBD 5EPLA 3DMUA 2WP8J 3D4DA 4FXDA 4X3UA 2IT1A 3HEJA 3TMEA 2F0IA 5KNDA 4DGZA 5E1FA 1BQQT 2E74C 2AWOA 2EY6A 4IUQA 5FKAC 2QKIC 2WKDA 1SE4A 1CA5A 5K36G 1Z6HA 1ESRA 2SOBA 3CRKC 1LABA 1AEXA 3HOYB 4A93B 2A68D 3LX0A 2N55A 1KDBA 1RJTA 1SNCA 2OEOA 1HTPA 1IL8A 4DNTB 1U4MA 5I9PA 5ELCA 3SDZA 4CKBA 3FVQA 4OHJA 2F0GA 1A2UA 3BVGA 5D14A 4EGVA 3K6OA 3H0GB 3U9SA 3K7AB 5ISRA 2JYOA 1X32A 2QF7A 1EU3A 1EZ6A 1OXXK 4X3TA 2KEEA 3D8GA 3JAME 2K05A 4HMJA 3D6CA 3KLSA 3PO3B 4C3HG 1HUNA 1KDAA 2B2TA 1HTLD 4M8AA 1I50B 2AQ3B 4HN7A 5C3WA 2F1MA 3J81L 5FK9C 1D6EC 2MP1A 3V05A 1BOSA 3I72A 4ZQ3A 2EDGA 1TS5A 5EJWA 3H3VC 2VB2X 4PMBA 1EY6A 1Y69U 5FLXL 3VR5A 1GOZA 2XRQD 2M2LA 3FKIB 3BYYB 3I4NB 4OO1H 3Q0AA 3BDOA 1ILPA 2WIIB 3H94A 1EQTA 1WVLA 1ZKOA 4A3MB 2RVLA 3A7AB 1A6XA 1U4LA 1BCPF 5E4WC 1S5CD 3FMCA 3NPPA 1XWEA 3HOVB 3EA6A 3PUXA 4M1UB 1HQMC 1I4GA 1O7YA 5E3FA 2XRSD 4DK0A 3BG3A 4G4KA 4ZKCB 3NWSA 2PCFB 3NBHA 1I4PA 3C46A 1DOMA 3QG1A 2R6GA 1PYWD 1DOKA 5KNBA 4IUPA 3PIP3 4DXGA 2KQ3A 3NP8A 2EYJA 3HP3A 2Z4IA 1PTOD 3HOXB 1JE4A 3R2IA 4KV6A 3U9OA 4B08A 1I6VC 2JE6I 2KCCA 1KABA 2F0PA 2KEDA 1K8OA 2KCNA 3W2DA 5IIFA 1ILQA 5KIXA 2MPMA 2B2YC 4FXKC 3L7ZC 3I70A 3IAYA 3N52A 1CK1A 3GO5A 4RHSA 2VNUD 3HKZB 3I3CA 2A5HA 4KN4C 3VYSA 4PMCA 5C6AA 1TS2A 4RGOS 1TWAB 4G57A 1Y8OB 1IYUA 3O13A 1YNJD 2EY5A 2K1BA 3T16A 2F03A 1Q90A 3DEPA 4RKLA 4IUTA 2YU9B 5M5XB 3NHHA 1QWYA 3GQBA 4K2LA 3T4AC 4DAYA 3RZDB 3TDQA 1EYDA 2D9UA 3KUPA 5JOBA 3V2TA 1C48A 3D4WA 3CQZB 3WDNA 1GHKA 1BDOA 3J80E 4DN4M 1EEFD 5D3DA 4DAVA 5FO8B 5M3FB 5CV4A 1OXTA 1BBXC 5I6WA 2AUJD 5JVG3 2VB3X 5J1ZA 2PW7A 4XYOA 2XWBB 5CYUA 3S1QB 3GTPB 2F3VA 1A2TA 3AMUA 3KLRA 1STBA 1MI2A 3HZXA 2C5CA 1CQVA 1NCVA 1Y8NB 2JXMB 3Q24A 5D65A 1F2MA 1VDZA 1CFMA 5EBDA 4RWSC 4TRDA 3K5MA 4TKOB 2R92B 4Q0FA 3SHLA 3RUZA 3S17B 5IGGA 4C3HB 4QUFA 1OXSC 2B2VC 3GTLB 5JAVA 2B2YA 1V43A 5IGEA 4IN3A 4DNRB 1Q1EA 5IGBA 1HQRD 5BN4A 5CC4A 4XT1B 1WTPA 5EKKA 3G7LA 3TSSA 4C3IB 4H13C 1PFMA 1Q3LA 1ZYRD 5EGTA 1DOLA 1SNOA 4K5VA 4MIUA 4FF2A 1CHPD 1AFPA 1KDCA 4KY7A 3NSWA 5A35A 2A68C 3M4YA 1E2WA 1PRTF 3QJYA 1S5ED 3Q6SA 4RHRA 1JORA 2IPKD 2F0VA 3T51B 5DM73 3OIQA 4QMGA 1KTKA 4A3BB 2O5JC 5CGKA 4KKTA 1PFNA 5C0XH 2ICEC 1C4QA 5FO9B 3PIO3 2F0KA 4U673 3IKJA 3MXGA 5K36H 1SJHD 4FP5D 1BUVT 2JA7B 1A15A 3VA7A 4F7XA 2WV6D 1MBYA 3QOJA 4XQQA 1SBBB 1I3QB 3DUZA 1QG7A 1VF5C 3OW7A 1XTCD 4O1NA 2NVXB 2B8GA 4BY1B 5CV6A 1B53A 2XSCA 3I4MB 1ENFA 5C4XB 4H44C 1TS4A 4G7ZC 1R4PB 1JCKB 2A6ED 4C3JG 3CU7A 5C5MA 3SE0A 1K83B 3Q23A 3OWFA 2IX3A 2WACA 4ZK9B 4FVMA 1WD0A 2LMCB 1D1IA 3TP6A 3VR3A 3VYUA 3E5SA 1EOTA 4F8MA 4I65A 1B50A 1CTMA 1RF2D 1RDPD 2XN9C 2RKSA 3H6MA 1HRJA 1GUOA 4IZ8A 5TSSA 3TN2A 4EQOA 1DJRD 4XYQA 3OOCA 1JOKA 4NMZA 1STEA 2B2VA 1IW7D 4CHTB 2ICIA 3HG9A 4RGMA 1G6ZA 4ME5A 2F0UA 2Q8TA 1MSHA 2BDOA 3SK6A 1TU2B 2OF1A 1SNPA 1LACA 1Q12A 3R8BA 1JB3A 2QCPX 1DXMA 2PO4A 3K5LA 5M3MB 3A7LA 2A74C 1DD2A 1D2BA 1F9SA 2PZUA 4X3SA 3MXUA 3GD7A 4J6HA 4TSSA 3HRZC 1LT6D 1WD1A 4XXEA 2QILA 4FYDA 3ND8A 4U68A 5C4ZA 1PTOC 2M9VA 3T56B 4CKCA 3SK8A 2L4NA 1VCIA 2NUCA 1L0XB 2ZXRA 4ID6A 1OXUA 2GA4B 5HURA 2R93B 2K6AA 1CM9A 3DWQA 1TWHB 3VYRA 1FNWA 1QNKA 2KUMA 1UEAB 3TZUA 1SEBD 1BR9A 5M5WB 2QEJC 1MSGA 2K5QA 1WCMB 5A2QL 2BCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D3R A;  3VYT A;  3VYS A;  2Z1C A;  2OT2 A;  3VYU A;  3VYR A; 
#chains in the Genus database with same CATH topology
 2RA4 A;  5G3L F;  3PUZ A;  4ZLT F;  3J81 i;  3KF8 A;  1YNJ C;  3G6E A;  4B9X A;  2FMC A;  1SMY D;  5HGT A;  4HJ7 A;  4JYA Q;  1K83 H;  2QDB A;  5KYL A;  2ZJR A;  1F9P A;  4ZRZ A;  1KQS A;  3MA2 B;  4JCV E;  4E6I A;  1GM5 A;  2ASB A;  1Y1V G;  1L1O B;  2A73 B;  4NXM L;  4L8J A;  4QL5 A;  4DXF A;  1K8A C;  4B3T Q;  3C3L A;  1CKM A;  2Q8R E;  3IFD A;  2EXZ A;  1W6K A;  4BBS G;  2WKC A;  4GKK L;  2N3S A;  5C44 B;  2E2D C;  2ZJQ A;  3VR6 A;  3RMH A;  1D5M C;  3BZK A;  3F2U A;  1BCP D;  4CJ1 B;  4BY7 G;  3M4Q A;  2VUM B;  2CFM A;  2RHQ B;  2WAQ B;  1LTI D;  3M4O B;  3DWP A;  2BDN A;  2D62 A;  3AFQ A;  4Z9C B;  2E75 C;  1PXU A;  1E2Z A;  1F9Q A;  3A54 A;  2TMP A;  1Q8K A;  5K5P A;  3TZD A;  2HDL A;  1F9R A;  4ABN A;  2EYM A;  4K6D A;  5LMN W;  4RGT A;  1LTR D;  2R61 A;  5IT9 L;  3J7A V;  3M7G A;  1VQK A;  4KK7 A;  5CV8 A;  1KLG D;  2PMZ B;  3R2T A;  2C9O A;  4KLK A;  2WAQ E;  1BCP B;  2IW3 A;  3PIP A;  3OTO Q;  2E2H H;  2EY2 A;  3KK7 A;  4A3I G;  4K14 A;  4XDX A;  1EQQ A;  3VYT A;  3HOU G;  5CV7 A;  1Y1W H;  5M3M H;  3NK9 A;  3K0Y A;  2X69 A;  1D7Q A;  2F0T A;  4EQP A;  3LNN A;  2ZTC A;  2NZO A;  4DR4 Q;  1EWC A;  3D3R A;  2L0C A;  3ULJ A;  2PMZ E;  5FLM G;  1ONL A;  3GTJ B;  1JJG A;  1TT2 A;  4A3J G;  2FXQ A;  5JJI A;  3TRZ A;  5CMD A;  4KHP Q;  4WRD A;  3MXP A;  5GAH C;  2NWG A;  3RD4 A;  1NR4 A;  2HHH Q;  2K03 A;  1L0Y B;  4KI0 A;  1CT1 D;  2Z6K C;  4OEM B;  2R93 H;  1E3P A;  1YNN D;  2JA5 B;  1TWH H;  1DCZ A;  1RHP A;  1V9P A;  3E6Z X;  1Q7Y C;  3X3M A;  2NTS A;  1L2F A;  1MD2 D;  1X55 A;  1SE8 A;  2RDH A;  4IUV A;  4P2C B;  2NN6 H;  5M5W H;  4OXP A;  1EY9 A;  4RH6 A;  4BS9 A;  3HOW G;  2CQA A;  2NZ1 D;  4R8I A;  4V0B A;  1WCM H;  4PQX A;  1SN8 A;  3SK5 A;  2N49 A;  1PH8 A;  2F4I A;  3I8Z A;  2VZA A;  1FR3 A;  3A5Z B;  3VA5 A;  4AH6 A;  2CH4 W;  2K7V A;  3F8T A;  3C1F A;  5L37 A;  5C4H A;  1JWS D;  4OGQ C;  1HCZ A;  1STG A;  2H1E A;  2UU9 L;  3CPF A;  4K8J A;  2JEB I;  3C1E A;  4X65 Q;  1EY5 A;  4NXM Q;  5ELF A;  3JAM L;  3KLS X;  4DR3 Q;  4LJZ C;  2R7F A;  3J7Y W;  5C44 H;  2PNH A;  4GKK Q;  1ZYR C;  1K3B C;  1AW7 A;  2CW0 D;  3G71 A;  1SYB A;  3IFT A;  1TVX A;  2UUC L;  4XTC S;  3I2Z A;  4K0K Q;  3CP0 A;  2X6L A;  2F0N A;  2VUM H;  2O4X A;  4B3R L;  4GN3 B;  1PZI D;  3T13 A;  4CJ0 B;  4A3D G;  1HZA A;  2A6H D;  3UI2 A;  2CVR A;  4ZUJ A;  2V4D A;  1SSO A;  3W5O A;  4C1N I;  1VMC A;  1SLJ A;  3CRL C;  3QIA A;  1XPO A;  1P16 A;  3UE1 A;  3K81 C;  4X64 L;  1I50 H;  3TBI B;  1PTO B;  2KEC A;  4LMQ D;  1EY0 A;  2OQK A;  1EY7 A;  4BBR G;  4XQJ A;  2B39 A;  4DR2 Q;  4IPC A;  1HR0 Q;  4X62 L;  1QJO A;  1X6O A;  3OW2 A;  1S3O A;  1YJ9 A;  4HED A;  3TP8 A;  2FMM A;  5M9O A;  4RCN A;  1GUN A;  1EY8 A;  1ET6 A;  1YHQ A;  1VQ9 A;  4LF4 L;  2R7Z G;  3GTK B;  1FVI A;  4ULL A;  4IJH A;  3IL8 A;  1IL2 A;  1VMP A;  1GO3 E;  1JR0 D;  3FDT A;  3I4N H;  3GTJ H;  1S5D D;  1AZQ A;  2CH4 A;  4DAP A;  1EU4 A;  3OHX C;  3NXW A;  2B29 A;  3KBX A;  1KNA A;  1CKN B;  1NTG A;  4O42 A;  4APV A;  1VQA A;  2A6E C;  1WTX A;  3S24 A;  2JA5 H;  3BYT B;  1G29 1;  3HOZ B;  3OPO A;  1LTL A;  4YWL A;  2UXB L;  1XMQ L;  3VDY A;  4FXG C;  4S3S A;  4A3F B;  2E2J B;  1B9N A;  4IUN A;  1NUC A;  4FDB A;  4HSV A;  2Z6K A;  3UDG A;  3GTG B;  1PH6 A;  3PV0 A;  1STY A;  5DAU A;  2VQF L;  1NBW A;  4CDF C;  1XJV A;  1JQY D;  3J7Z C;  2UUB L;  2RBM A;  3S2D B;  1B3A A;  1X3F A;  4PG3 A;  1FGU A;  1QCB D;  1NR2 A;  3MFY A;  3NEN A;  1V8Q A;  2K75 A;  3AU7 A;  4HCS A;  3BS1 A;  4OO1 G;  4HR7 B;  1UEB A;  4OON A;  2UU9 Q;  2NB0 A;  1MGS A;  1IW7 C;  1TWG B;  4A3L G;  1VF7 A;  3HGB A;  5J3B A;  1CHQ D;  1N9W A;  1NAP A;  3NE5 B;  2L11 A;  4BBS B;  4JI5 L;  3M85 A;  1XYI A;  4OO1 I;  1F2Z A;  1AE3 A;  1G6P A;  3SR1 A;  1PZK D;  1VQJ A;  5FO7 B;  3RLF A;  4KY6 A;  3M3Y B;  1LT4 D;  3QR8 A;  3S1R B;  1H9R A;  2PNR C;  3EJI A;  4CJ2 C;  4ZKB B;  3SK4 A;  1LM0 A;  5AJ3 L;  2UUC Q;  2YTY A;  1PRT D;  1TKW B;  5HY6 A;  4R4O A;  4A4I A;  1ENC A;  3AB9 A;  1KAA A;  1I94 L;  4B3R Q;  2XIW A;  1QOH A;  2B2U C;  1YZ6 A;  4R9W A;  5IOC A;  2JA8 B;  1TR5 A;  2HT1 A;  2K5H A;  4DNI A;  2A1A A;  3D4R A;  3DM1 A;  5JEA J;  2F0O A;  1PFB A;  1LTT D;  4DR6 Q;  2E8G A;  5F2D A;  1KLU D;  2OTJ A;  1PTO H;  3HOY G;  1C8C A;  5E4X A;  2CCZ A;  1Y8P B;  2PZT A;  1WTR A;  5C4J B;  4CGY B;  4BA2 I;  3P75 A;  3HS0 C;  4JOI C;  1B9M A;  1E22 A;  3QO2 A;  5CV9 A;  3V96 A;  3CCU A;  2EYP A;  1IBK Q;  3J7A F;  3PCO B;  4DR7 L;  1F77 A;  2EJM A;  1R9T B;  1X65 A;  3CW2 C;  3MWY W;  2RDG A;  3CCE A;  1FYC A;  1UWV A;  3BZD B;  2FJ2 A;  3J80 L;  4BXX G;  3RR5 A;  3GTK H;  2N78 A;  3RZD H;  4JI6 Q;  1E2V A;  2XGT A;  4F88 A;  3EVQ A;  5LMN L;  5JJK A;  5M5Y B;  4DK1 A;  3I91 A;  3P20 A;  4A3J B;  2UUA L;  5JPM C;  2IY5 B;  1HZ9 A;  1K28 A;  1PDQ A;  4UP7 A;  4A3G G;  5C5L A;  4QB4 A;  3OYY A;  1YJN A;  3PO3 G;  4K5X A;  3G6J B;  2EYL A;  1YIT A;  4KKS A;  5C3X A;  1VQN A;  1SMY C;  2J4X A;  4QJF A;  4DF7 A;  3OIP A;  1ASY A;  1KRS A;  3HOZ H;  2K01 A;  2QW7 A;  1ML0 D;  1FL0 A;  4A3F H;  1XMQ Q;  3URY A;  4KD3 A;  2UXD L;  5JEA G;  2WIN B;  1PH3 A;  1A62 A;  3ERQ A;  1D5Z C;  1TY0 A;  1I4Q A;  4NB3 A;  4CDE C;  2HD3 A;  3KJO A;  2VQF Q;  3S2D H;  1M8A A;  2PZW A;  3GP7 A;  1VQM A;  3L9A X;  2MHV A;  1SAP A;  2UUB Q;  1BCP C;  2JQO A;  2JA6 G;  1D5X C;  1BNZ A;  4IFD J;  4HIK A;  3ONA B;  1IYV A;  1CA6 A;  4GLX A;  3NTI A;  1O80 A;  1JWM D;  1UNS A;  3FPP A;  1GKH A;  4IJL A;  5JVH 3;  3LWE A;  2Z0S A;  1GHJ A;  4CKE A;  3CC7 A;  1TWG H;  2HIV A;  2EVB A;  4H7B A;  3ZYY X;  3ITP A;  3RLO A;  4BBS H;  4LFB L;  1IKL A;  3WOE A;  4WJ4 A;  4NW2 A;  4JI5 Q;  1VQ5 A;  2F0F A;  4WFN 3;  5I9O A;  2EYF A;  3M3Y H;  4N9P A;  3S1R H;  5I2Y A;  3DLL A;  3MC0 B;  3HOV G;  3NQI A;  3I73 A;  3P1H A;  2EY1 A;  2N88 A;  5LMU L;  2L9H A;  4HID A;  3CF5 A;  3ZJY C;  2NVY B;  2JA8 H;  1QVF A;  1DON A;  1E7Z A;  3BVM A;  1CZG A;  3S17 H;  2KVM A;  3QOL A;  1YIJ A;  1U9R A;  4C3H H;  1SYG A;  2E76 C;  4PNY A;  2AHO B;  4YCU A;  1PH9 A;  4LFC Q;  3U50 C;  1H9S A;  2MNA A;  1LTG D;  3A0J A;  4BBR B;  1GXD C;  4L5Q A;  4X3K A;  5C4J H;  4QIW B;  2B2U A;  1XMO Q;  2CKZ B;  2RSO A;  1NMF A;  2HCC A;  1Z7T A;  2VS1 A;  1ICW A;  3S2H B;  1RKN A;  5DLQ E;  4DV3 L;  1XXG A;  1R9T H;  1GUG A;  3UDI A;  3K58 A;  4K8I A;  5J39 A;  2OT2 A;  1AH9 A;  4B9W A;  5GAE C;  1YNN C;  1KAW A;  3MXN B;  4IFD G;  3HFZ B;  1JOQ A;  1FNU A;  4IOA A;  3LWU A;  4RAU C;  1WOC A;  3K5O A;  4NKL A;  4RMF A;  4JOI A;  5M5Y H;  5LMN Q;  4RA8 A;  4QIW E;  2F0Q A;  3K5N A;  1EIH A;  2DNC A;  4OEL B;  3AEV A;  4UPA A;  2EZV A;  1XX8 A;  5G3L D;  2ZXO A;  5IGF A;  2HQL A;  4A3K G;  4IFD I;  1SRU A;  5ELB A;  2IWH A;  3S16 B;  2EE1 A;  4UAI A;  4KD4 A;  5KEE A;  4V19 0;  4KKU A;  5C0X J;  3HKZ G;  4ZUI A;  2PYK A;  2K5W A;  4DR5 L;  4UP9 A;  5JJL A;  1PZJ D;  4DR4 L;  3AYH B;  1HUM A;  1PH7 A;  4L5T A;  2Z9H A;  2RCN A;  1E1T A;  1YHA A;  2GN5 A;  2Q2T A;  1JWU D;  2K28 A;  1H9K A;  2Q2U A;  4JI4 Q;  1CKO A;  4J8Q A;  1HFG A;  3A74 A;  1P8L A;  2CW0 C;  2L1B A;  1SJE D;  4JV5 L;  4DV0 Q;  2HHH L;  2A69 D;  2BE5 D;  3NWT A;  1H9S B;  3E0J A;  3IRB A;  2TSS A;  3GTO B;  2JA7 H;  1WTO A;  1W6J A;  1BF4 A;  2PW5 A;  2NYZ D;  1WTQ A;  3ER0 A;  2A6H C;  4HTH A;  1SDF A;  1H9M A;  4FNF A;  3J81 E;  5ELN A;  2K50 A;  1SE3 A;  3CCL A;  2B3G A;  1JC7 A;  5JJZ A;  1V1P A;  3MFG A;  1B7Y B;  4OIK A;  3OWE B;  1ENA A;  4LFB Q;  3NBI A;  5FLX E;  3W3A A;  5C4X H;  1LT3 D;  1QIL A;  2K4K A;  2IJ0 A;  1AN8 A;  2EYO A;  1T5E A;  2AQ1 B;  1ROD A;  2EOT A;  4YWK A;  4NP5 A;  2F0D A;  4JPB W;  4R4Q A;  2YYZ A;  1GUW A;  5LMU Q;  5M3F G;  4PZ8 A;  1ZXT A;  1RTO A;  2XVS A;  3K59 A;  2B63 B;  3PO2 B;  4MN3 A;  5I6Y A;  4X65 L;  5C0X G;  4R8N A;  2R3Z A;  4NXN L;  1CQF A;  2QDL A;  5IYC H;  4DR3 L;  5FJ8 G;  2VW9 A;  1HA5 A;  5DNF A;  2LS0 1;  3NTH A;  2HDM A;  1G2S A;  1JB7 A;  3W1G A;  1TY2 A;  4KJO A;  4BBR H;  4WJ3 M;  3FRP B;  3QB3 A;  5EKI A;  4OL7 A;  4HIO A;  4K0K L;  5C0X I;  3S2H H;  1N8R C;  1AZP A;  1HHV A;  3LGJ A;  4DV3 Q;  5AFW A;  4HMI A;  1HNZ Q;  2BA1 A;  3U58 A;  1S4Z A;  3I4L A;  2A19 A;  1X3P A;  3ERS X;  5LHY 1;  1HFN A;  1TS3 A;  2KCM A;  4DV7 Q;  1PMR A;  2KA7 A;  2VL6 A;  3CHB D;  4OX9 Q;  5COY A;  3QWN A;  1EL0 A;  1EZ8 A;  3J81 c;  4ODG A;  4DR2 L;  2EXD A;  1N32 L;  4CDC C;  1HR0 L;  4A3G B;  1V1P B;  3S16 H;  4JI1 Q;  1QUQ B;  2R92 G;  4R1J A;  3PUW A;  5KNC A;  5FLX c;  1EEI D;  1KL9 A;  2KJX A;  4BA1 I;  3I55 A;  3E9H A;  3H3V I;  4PMW A;  1OO9 B;  4DR5 Q;  1QZG A;  5KYI A;  2F0L A;  2B8F A;  5T1I A;  1MHW C;  5EBC A;  3UDF A;  1ESF A;  4F87 A;  3JAM i;  1EYG A;  1G51 A;  3WOF A;  2P5Z X;  3I4O A;  2XNA C;  3EN2 A;  4N8X 1;  2AWN A;  3OMC A;  1DM0 B;  1LTS D;  1SYF A;  2D2C C;  3EIV A;  4XQN A;  2FFK B;  2G9D A;  4JV5 Q;  4KHZ A;  3GTO H;  4JI2 L;  2JA6 B;  1PRT C;  3GTQ B;  1ET9 A;  4XIG S;  3M7N A;  4C3I G;  4KMU C;  4OWX B;  4BWG B;  2F0W A;  1VQB A;  3ULL A;  5T1G A;  2FIN B;  2IX1 A;  1R4Q B;  2K5V A;  3DM3 A;  1Z47 A;  3ND9 A;  3U4Z A;  4GN5 A;  1TQO A;  3DHQ A;  1SXT A;  1BXT A;  2WB1 B;  3SEB A;  5IP9 H;  1S5F D;  5IYD H;  2X6G A;  4GLV B;  1EYA A;  4LUO A;  2F4V Q;  4IAL A;  4TVA B;  1GJX A;  4G7O C;  5C3E B;  1PYS B;  1IHZ A;  2AUK A;  2VXW A;  1O7I A;  4K2K A;  4C3J B;  2EPB A;  5H1S E;  1CSP A;  4IUR A;  4LK1 C;  5CV5 A;  1SMX A;  2ZXP A;  3PO2 H;  2B63 H;  3U4V A;  4R4C A;  2K33 A;  3TP5 A;  2J7Z A;  2WB1 E;  1HPC A;  1A3V A;  1K3R A;  4NXN Q;  4QF4 A;  1DYQ A;  5EPK A;  5GQO A;  1CKN A;  3R3O A;  5JPN C;  4JBW A;  4LF6 L;  1I4R A;  3EFX D;  5GAD C;  2JN4 A;  3STB D;  4RFB A;  2O5I C;  4ZYS A;  3I56 A;  4A3C H;  1V1O A;  5BR8 L;  4HCE A;  1FJG L;  3CKI B;  1SE2 A;  4JK1 C;  3M4O H;  2FHT A;  3I7F A;  2B2W C;  4BY1 G;  3I4M G;  3KOJ A;  2O2L D;  1QE6 A;  1B1Z A;  3A56 A;  3CCJ A;  4A3E B;  1CZW A;  1VQL A;  4DR6 L;  1FGB D;  1X54 A;  2HIX A;  1STA A;  1YJW A;  2NTT A;  1JJ2 A;  4MTK A;  1SR3 A;  4KHV A;  4LF9 L;  4DU9 A;  2RF4 A;  1YI2 A;  1STN A;  4A3G H;  4QCL A;  1N32 Q;  4A3K B;  1IBK L;  2GVA A;  1A3U A;  1OXV A;  1QNU A;  4GLA C;  5CR3 A;  5IOD A;  5IYB G;  3FPU B;  1Q8I A;  1RD9 D;  1ZEQ X;  2F0E A;  1HA6 A;  4POF A;  1I6H B;  4JI6 L;  3PUV A;  1CI3 M;  1VQD A;  1UAP A;  3K80 C;  3OMG A;  2NBF A;  2EJG C;  1HNW Q;  2KHJ A;  1U5K A;  1A0I A;  3CME A;  3F1Z A;  2DGY A;  5JEA H;  1N36 L;  3CD6 A;  3NQT A;  3H91 A;  5CBE E;  3NEM A;  5COR A;  1EYC A;  4IQZ A;  2L12 A;  1IBL Q;  4H0L C;  3NBH B;  4LAA A;  4ZAI A;  3BDC A;  1II3 A;  1LO5 D;  2XWJ B;  1RCV D;  1HNX Q;  4JI2 Q;  4YY3 L;  4XT3 B;  3RZO B;  1G8Z D;  4GOP B;  2HCI A;  4G7H C;  2Y0S B;  3L2P A;  2SNM A;  1PYB A;  4A76 A;  5EQ0 A;  1JIC A;  4YIJ A;  3T1H Q;  2F0H A;  1B4O A;  3A55 A;  1PTO F;  1VQH A;  3MZ5 A;  3L3O C;  4DA2 A;  2OXP A;  3CC2 A;  1ICF B;  5HGQ A;  4AYB B;  1EIY B;  1WTW A;  1FNV A;  2ENB A;  5CBA E;  1STH A;  1VQP A;  1Y1W G;  2NVT B;  1NSN S;  2BH2 A;  1HZC A;  4OIJ A;  2H5X A;  2JEA I;  3TEH B;  5C3E H;  4Y7N B;  4L5S A;  1PVO A;  2Y0S E;  2I07 B;  4C3J H;  2L5T A;  2LXK A;  4WOR A;  1EIG A;  3MVV A;  2PPB C;  1K8M A;  3J80 i;  5I2X A;  3A8K E;  4GZY C;  1Y1V B;  1B70 B;  1LTA D;  3ERO A;  4K5W A;  4LFA Q;  1I4X A;  2SEB D;  1O7L A;  1Q46 A;  4AYB E;  1A63 A;  4N9T A;  4LUZ A;  1DZ1 A;  1Q1B A;  4Y52 H;  4LF6 Q;  2R93 G;  4C1N K;  3BDL A;  3AFP A;  4O0A A;  4JI8 L;  4EVO A;  1C7Y A;  1X3Q A;  4C56 C;  2K14 A;  2IX0 A;  4HSP A;  4YCV A;  4BY7 B;  4K6L A;  1M4V A;  2KHI A;  5BR8 Q;  1FJG Q;  1EQV A;  3VR2 A;  1QVG A;  3MEH A;  4DAY B;  2NN6 G;  3RN2 A;  1SYD A;  2ATW A;  1E0B A;  4IFD H;  2EYH A;  3I90 A;  4UDU C;  1WCM G;  2BA0 A;  1EFW A;  1LLR D;  4MHE A;  2Q8I B;  4J1M A;  4A3E H;  4X6A H;  2HUG A;  2Z4H A;  1J5E L;  1SNM A;  1M1K C;  3MAQ A;  4LFC L;  3OSO A;  1B2T A;  5IGC A;  5I4D A;  1VQ7 A;  4A93 G;  1XMO L;  2BH8 A;  2ZTD A;  3VR4 A;  1K9M C;  2NN6 I;  2F0M A;  4LF9 Q;  1S72 A;  4A3K H;  2B2W A;  2A69 C;  2RSN A;  2BE5 C;  4EX5 A;  1PRT B;  4DV6 Q;  2K04 A;  3X3N A;  3GV3 A;  1AP0 A;  3SXH A;  4KY5 A;  4JBM A;  1EFI D;  4A3I B;  1PLF A;  3KBG A;  3HOU B;  5IY0 A;  1I6H H;  5BN3 A;  1SYE A;  4R4I A;  5D3I B;  5EKL A;  4WJW A;  3S1N B;  5C44 G;  3H0G G;  4NDX A;  2F0J A;  1NMG A;  4JVZ A;  4POG A;  4FO2 A;  5FOB B;  1N36 Q;  1UUP A;  4C2M B;  2M00 A;  3S14 B;  1KIX A;  1LT5 D;  1TII D;  4GN4 B;  3AQQ A;  1I4H A;  1NE3 A;  4FF1 A;  2E5L L;  4DV4 L;  2D0P A;  3RZO H;  4YY3 Q;  3PMF A;  3F2D A;  3MHB A;  4FF3 A;  4RKB A;  3TRE A;  3NUC A;  2RDF A;  3DEO A;  1HZB A;  2K5D A;  4ILW A;  3EBE A;  3BVZ A;  4ME3 A;  1NJI C;  4JI4 L;  4L6T B;  2E2J H;  2LKV A;  3F2C A;  3HOW B;  3GTG H;  1KHI A;  3PUY A;  4DV0 L;  1C9O A;  3K0X A;  2LY7 A;  2NVT H;  5LL6 X;  2KCT A;  5LL6 S;  2I46 A;  3MXN A;  4Y7N H;  2D5D A;  1F2L A;  5DEH A;  3FKI G;  2KHS A;  5ELD A;  4KTA A;  3I4N G;  2SNS A;  1FD7 D;  2QEX A;  4JC0 A;  1JMC A;  4HAE A;  4GNX B;  3W1B A;  2DY7 A;  4Q5V A;  2F3W A;  1G91 A;  4HIM A;  1JOO A;  1Y1V H;  1K8G A;  4A75 A;  2H4O A;  2E2I B;  1LUZ A;  4QY7 A;  1SND A;  2Z8L A;  1EY4 A;  4JW0 A;  4A3M G;  2I0Q A;  1F2Y A;  2BOS A;  4TQU S;  4UHV A;  1D1K A;  2MUY A;  1PA6 A;  5EAY A;  4RCO A;  1A3T A;  2CWA A;  2JA5 G;  4PV1 C;  4RGN A;  2F3I A;  3D6W A;  1TWF B;  4JG2 A;  1B44 D;  2SDF A;  4JI8 Q;  1T5X D;  1H95 A;  3DWA A;  2L55 A;  4DV5 Q;  4DUY L;  3K7U C;  4BY7 H;  4YCW A;  1O7Z A;  2AQ2 B;  2IL8 A;  1EWH A;  4A3D B;  4DKA C;  4EQN A;  3S9W A;  5IE8 A;  2F52 A;  1S40 A;  4DV1 L;  2ZT9 C;  2DY8 A;  2F0S A;  3FHW A;  3D31 A;  1HXY D;  1MKH A;  2MQH A;  2RQX A;  3L0O A;  1SNQ A;  4DUZ L;  2DNE A;  2JSO A;  4IUU A;  3K57 A;  1J5E Q;  2Z1C A;  3CC4 A;  1EQR A;  4P72 A;  4JI7 Q;  3EQL C;  2J0T D;  2MGS A;  1C0A A;  2K52 A;  4P71 A;  3S1M B;  1TXY A;  2NZH A;  3KFU A;  5NUC A;  1VQE A;  1WJJ A;  3N6R A;  5DM6 3;  1HNZ L;  2ES2 A;  2ID0 A;  1BVS A;  3R93 A;  4A3I H;  4FF4 A;  1BKB A;  3HOU H;  5IGD A;  3FEW X;  4DFA A;  5A2Q E;  1TWC B;  3S1N H;  3MTS A;  5ELE A;  1KNE A;  2R7Z B;  4KJN A;  3HOX G;  4DV7 L;  4PZ6 A;  4OX9 L;  2K32 A;  5FLM H;  1W2B A;  2B2T C;  4I7Z C;  2I5H A;  4A3J H;  1IKM A;  5KGU A;  2G9H D;  3TS0 A;  2YV5 A;  2CWP A;  4C2M H;  3S14 H;  3NTK A;  1SYC A;  4JI1 L;  4MTN A;  1WTH A;  1H9J A;  3H09 A;  4KN7 C;  3KF6 A;  2PQE A;  1VQ8 A;  5EPJ A;  2HQE A;  1J9O A;  1O78 A;  1T9H A;  2E5L Q;  3T53 B;  4DV4 Q;  2LSS A;  2PI2 A;  5J22 A;  5BN5 A;  3A8J E;  4JI3 Q;  1RTN A;  3GTM B;  4L63 B;  2KOL A;  1BO0 A;  2DN8 A;  3A8I E;  1L0W A;  1SFO B;  1GUS A;  5KRU A;  3Q22 A;  2NVQ B;  1U4P A;  4QUC A;  4HJ5 A;  1JT8 A;  2E2H B;  3S15 B;  1J6Q A;  3C2P A;  3HOW H;  1QB5 D;  1UE7 A;  3STB C;  3P7J A;  2LXJ A;  1S5B D;  2EJF C;  3Q8D A;  1Y1W B;  1MJC A;  3K8A A;  4J15 A;  2LFN A;  5IT9 E;  2JP1 A;  2IHE A;  1WTV A;  4CBV A;  3DXJ C;  3SVM A;  1U4R A;  3D0F A;  1A8V A;  2CHB D;  2DJG C;  1K0R A;  1GUT A;  2MJ8 A;  1LV9 A;  2E2I H;  1G2T A;  1J8I A;  3GV6 A;  3ICE A;  3TP7 A;  1LTB D;  5EPL A;  3DMU A;  3KJP A;  1NNX A;  1QUQ A;  1X56 A;  2WP8 J;  3D4D A;  3BZC A;  1M90 C;  4FXD A;  4X3U A;  2F4V L;  2IT1 A;  1TWF H;  3HEJ A;  3TME A;  4HJ9 A;  1XNQ L;  2F0I A;  5KND A;  4JI0 Q;  3HOZ G;  1VQI A;  4DGZ A;  3H15 A;  5E1F A;  4DV2 L;  1BQQ T;  3WWV A;  3ULP A;  3KDF A;  2OWO A;  4DUY Q;  3KF6 B;  2NVY H;  4A3F G;  1IXR A;  2E74 C;  1YVC A;  2AWO A;  4A3D H;  2EY6 A;  4H02 A;  4GOP C;  4IUQ A;  1RL2 A;  5FKA C;  4AQY L;  4DV1 Q;  2QKI C;  2WKD A;  1SE4 A;  1BBW A;  1CA5 A;  3RNU A;  1NY4 A;  5K36 G;  1VQO A;  4DUZ Q;  1Z6H A;  1ESR A;  2SOB A;  3CRK C;  1LAB A;  1AEX A;  2XTI A;  4GKJ L;  3HOY B;  1V1Q A;  4A93 B;  2A68 D;  3LX0 A;  4LF8 Q;  2N55 A;  3S1M H;  3CCM A;  1KDB A;  1RJT A;  1SNC A;  2OEO A;  1HTP A;  1IL8 A;  4DNT B;  1U4M A;  1IBM L;  5I9P A;  5ELC A;  1VQF A;  5ELO A;  4IOC A;  3SDZ A;  4CKB A;  3FVQ A;  4OHJ A;  5IYB H;  2Z6B A;  2F0G A;  1A2U A;  1TWC H;  3BVG A;  4R4T A;  5D14 A;  2PI2 E;  4EGV A;  3K6O A;  4AIM A;  2R7Z H;  3H0G B;  3U9S A;  3K7A B;  5IT9 c;  3GDE A;  2JYO A;  1X32 A;  5ISR A;  2QF7 A;  1EU3 A;  1EZ6 A;  1LYL A;  1OXX K;  1QVC A;  4X3T A;  1WFQ A;  1WYD A;  2R7D A;  1X9N A;  1VQ6 A;  2KEE A;  2JA8 G;  2ZM6 Q;  3D8G A;  3PQI A;  3JAM E;  2K05 A;  4HMJ A;  3D6C A;  3KLS A;  3PO3 B;  2C35 B;  4C3H G;  1GD7 A;  1HUN A;  1KDA A;  2JJQ A;  3M9B A;  2B2T A;  3PF4 A;  1CSQ A;  1HTL D;  4M8A A;  1I50 B;  3GTM H;  1HJP A;  3KDF B;  1HNW L;  2AQ3 B;  1SFO H;  4HN7 A;  5C3W A;  2NVQ H;  2UXC L;  2F1M A;  3J81 L;  5FK9 C;  1D6E C;  2EQS A;  2MP1 A;  3V05 A;  3S15 H;  1BOS A;  3I72 A;  4ZQ3 A;  2EDG A;  1TS5 A;  5EJW A;  2PQA A;  1IBL L;  3H3V C;  3KF8 B;  4IPH A;  4NPS A;  2VB2 X;  4PMB A;  1EY6 A;  1Y69 U;  1HNX L;  5FLX L;  3VR5 A;  4O2D A;  1GOZ A;  2XRQ D;  2N8N A;  2M2L A;  3FKI B;  1Q81 C;  3BYY B;  3I4N B;  4OO1 H;  3Q0A A;  3T1H L;  3PSI A;  3BU2 A;  4IPD A;  3BDO A;  1PFS A;  4B3S L;  1ILP A;  1GVP A;  2WII B;  3H94 A;  3SGI A;  3BJU A;  1EQT A;  1CUK A;  1WVL A;  3B6Y A;  4A3L H;  4JBJ A;  1ZKO A;  1I5F A;  4A3M B;  2MO0 A;  2RVL A;  3A7A B;  1A6X A;  1U4L A;  4P75 A;  1BCP F;  5E4W C;  3TQY A;  3NPP A;  1S5C D;  3FMC A;  1XWE A;  5IP7 G;  1XNQ Q;  3HOV B;  2KEN A;  3EA6 A;  3PUX A;  4M1U B;  4DV2 Q;  1HQM C;  4LF7 Q;  1I4G A;  1O7Y A;  5E3F A;  2XRS D;  4YHH L;  4A3B G;  3JAM c;  4CDD C;  4DK0 A;  3FP9 A;  4LWC A;  4LFA L;  1PHJ A;  4EQ5 A;  4AQY Q;  1K73 C;  3BG3 A;  4G4K A;  2ZJP A;  2WFW A;  4ZKC B;  3PGZ A;  2JA7 G;  4ALP A;  3NWS A;  2PCF B;  3NBH A;  3HOY H;  1EIF A;  1EUJ A;  1I4P A;  1VQG A;  4A93 H;  3CCQ A;  3C46 A;  4GKJ Q;  5GRO A;  1DOM A;  1U0L A;  3QG1 A;  2A8V A;  1Z9F A;  4GOP A;  2R6G A;  4DK6 C;  4DR1 L;  1PYW D;  1DOK A;  1IBM Q;  4LNQ A;  2PQA B;  5KNB A;  4IUP A;  2YTX A;  3PIP 3;  3J81 j;  1EWI A;  4DXG A;  2KQ3 A;  4BXX H;  4GNX C;  3NP8 A;  2EYJ A;  3H0G H;  3HP3 A;  2Z4I A;  3K7A H;  1PTO D;  5C4X G;  1PV4 A;  3HOX B;  1JE4 A;  1UE1 A;  3R2I A;  4KV6 A;  3U9O A;  1BBU A;  4B08 A;  1I6V C;  2JE6 I;  2KCC A;  1RIP A;  1KAB A;  2F0P A;  2KED A;  1K8O A;  2KCN A;  3W2D A;  5IIF A;  1ILQ A;  5KIX A;  1N33 L;  3E9I A;  2MPM A;  4DV6 L;  2B2Y C;  4FXK C;  3L7Z C;  3PO3 H;  3I70 A;  3IAY A;  3N52 A;  1CK1 A;  4ZCK A;  3GO5 A;  5IYC G;  4RHS A;  2VNU D;  3HKZ B;  3I3C A;  2A5H A;  4KN4 C;  3VYS A;  4PMC A;  5C6A A;  1TS2 A;  4I7A A;  3PF5 A;  2ALY B;  2MFI A;  4RGO S;  1TWA B;  2VQE L;  4G57 A;  2CQO A;  1Y8O B;  1KC8 C;  2UXC Q;  1IYU A;  3O13 A;  1YNJ D;  1KXL A;  2EY5 A;  2K1B A;  3T16 A;  2F03 A;  1Q90 A;  3DEP A;  4LW1 A;  4RKL A;  1IYJ B;  4P74 A;  4QQB X;  4IUT A;  2QA4 A;  1DGS A;  4B3M L;  2YU9 B;  5M5X B;  5E7N A;  3NHH A;  1QWY A;  3GQB A;  3HKZ E;  4K2L A;  3T4A C;  4DAY A;  3RZD B;  3TDQ A;  2JA6 H;  3RN5 A;  3GTQ H;  1EYD A;  3FKI H;  2D9U A;  3KUP A;  5JOB A;  4N8F A;  3TS2 A;  3V2T A;  1C48 A;  3D4W A;  3CQZ B;  2DUD A;  1Y14 B;  3WDN A;  4B3S Q;  1GHK A;  2EIF A;  1AE2 A;  4A3M H;  1BDO A;  3J80 E;  3T1Y L;  4DN4 M;  1YHB A;  1UE5 A;  5M3M G;  4P73 A;  3G4S A;  1XNR L;  1EEF D;  5D3D A;  4DAV A;  1JE5 A;  1JJC B;  3HOV H;  3E3X A;  4OWW B;  5FO8 B;  3KLW A;  5M3F B;  5CV4 A;  1OXT A;  1BBX C;  5I6W A;  4OWT B;  2AUJ D;  5JVG 3;  4YHH Q;  2VB3 X;  1W3S A;  1X3E A;  5J1Z A;  2PW7 A;  4XYO A;  2XWB B;  5CYU A;  3S1Q B;  3GTP B;  2F3V A;  1A2T A;  3AMU A;  3KLR A;  1STB A;  4DV5 L;  1MI2 A;  1OTC A;  4IPG A;  3HZX A;  4DR1 Q;  2C5C A;  1B8A A;  2OQ0 A;  1MIU A;  1CQV A;  1NCV A;  1Y8N B;  5IP9 G;  2JXM B;  1QZH A;  1MJE A;  5IYD G;  3F2B A;  3Q24 A;  1Q86 C;  4HJ8 A;  2K5N A;  1X3G A;  2Q2H A;  1XPU A;  3HOX H;  1PH4 A;  5D65 A;  1F2M A;  4LF5 L;  4RG1 A;  4JI7 L;  1VDZ A;  1N34 L;  1CFM A;  1KRT A;  5EBD A;  4RWS C;  4TRD A;  3NEL A;  4GS3 A;  3K5M A;  1E24 A;  1PH5 A;  1N33 Q;  4TKO B;  2B63 G;  3PO2 G;  5GAG C;  3PIO A;  2R92 B;  4Q0F A;  4GNX A;  3SHL A;  1UE6 A;  3RUZ A;  3S17 B;  3J80 c;  1D8L A;  5IGG A;  4C3H B;  1Q82 C;  4QUF A;  1OXS C;  4DK3 C;  4X64 Q;  1XPR A;  2B2V C;  1TWA H;  1ASZ A;  3GTL B;  5JAV A;  2VQE Q;  2B2Y A;  1V43 A;  3CPW A;  5IGE A;  4IN3 A;  1HR0 W;  4DNR B;  4A3C G;  1Q1E A;  4X62 Q;  5IGB A;  2VUM G;  2WAQ G;  1HQR D;  5BN4 A;  2YU9 H;  1E1O A;  5M5X H;  5CC4 A;  4XT1 B;  4B3M Q;  4LF4 Q;  3JC6 6;  1WTP A;  5EKK A;  3G7L A;  2V1C C;  2JA9 A;  3TSS A;  4C3I B;  1L1O C;  4JI3 L;  4H13 C;  1PFM A;  1Q3L A;  4X66 L;  3CQZ H;  1ZYR D;  5EGT A;  1B3Q A;  1DOL A;  5IWA L;  1SNO A;  4K5V A;  4MIU A;  4FF2 A;  1CHP D;  1AFP A;  1KDC A;  4KY7 A;  3E0E A;  2L15 A;  3NSW A;  2MO1 A;  5A35 A;  2A68 C;  3M4Y A;  1E2W A;  4MNO A;  3T1Y Q;  1PRT F;  3QJY A;  1S5E D;  3Q6S A;  4RHR A;  1XNR Q;  1JOR A;  2IPK D;  2KBN A;  2F0V A;  3T51 B;  1VQ4 A;  5DM7 3;  1VS0 A;  5M3F H;  3OIQ A;  1YEZ A;  1KD1 C;  2UXB Q;  4QMG A;  1KTK A;  4A3B B;  2O5J C;  5CGK A;  4KKT A;  1PFN A;  2I5L X;  5C0X H;  2ICE C;  1C4Q A;  5FO9 B;  3PIO 3;  2F0K A;  4U67 3;  4DPG A;  3IKJ A;  4UY8 C;  3MXG A;  5FJ8 H;  5K36 H;  1SJH D;  2D0O A;  4FP5 D;  2AKW B;  1PH2 A;  4L5R C;  1BUV T;  2JA7 B;  1A15 A;  3VA7 A;  4F7X A;  2WV6 D;  1MBY A;  2RCF A;  3QOJ A;  3S1Q H;  3GTP H;  3CCS A;  4JBK A;  4XQQ A;  4JI0 L;  4QGU A;  1SBB B;  1I3Q B;  3DUZ A;  1QG7 A;  1VF5 C;  4PZ7 A;  3OW7 A;  1XTC D;  4O1N A;  2NVX B;  1XTD A;  2WB1 G;  2B8G A;  3HKS A;  5CV6 A;  4BY1 B;  1B53 A;  2XSC A;  3I4M B;  1ENF A;  2GVB A;  5C4X B;  4H44 C;  1TS4 A;  4G7Z C;  1R4P B;  5C3E G;  2IHF A;  4LF5 Q;  3RLN A;  4LF8 L;  2RHS B;  1JCK B;  2A6E D;  5AJ3 Q;  3H3V H;  4C3J G;  3CU7 A;  1N34 Q;  4JYA L;  3CMA A;  5C5M A;  3SE0 A;  1K83 B;  3Q23 A;  1I94 Q;  3A5U A;  3OWF A;  2IX3 A;  2WAC A;  4ZK9 B;  2R92 H;  3MEF A;  2OCE A;  4FVM A;  4B3T L;  1WD0 A;  2LMC B;  4DAM A;  1D1I A;  3TP6 A;  3VR3 A;  3VYU A;  3E5S A;  1EOT A;  4F8M A;  2QGQ A;  4I65 A;  3GTL H;  1CTM A;  1B50 A;  4HJA A;  2Q2I A;  1RF2 D;  1RDP D;  2XN9 C;  1K0S A;  2RKS A;  1IZ6 A;  3CXC A;  3H6M A;  1HRJ A;  1GUO A;  3M4P A;  4DR7 Q;  4IZ8 A;  2ZM6 L;  2YTV A;  5TSS A;  3TN2 A;  1WI5 A;  4EQO A;  1DJR D;  4XYQ A;  3OOC A;  1JOK A;  3UDX A;  4NMZ A;  1STE A;  2B2V A;  1IW7 D;  4CHT B;  2ICI A;  4A3E G;  3HG9 A;  2OTL A;  4RGM A;  4C3I H;  1G6Z A;  4ME5 A;  3UE0 A;  2F0U A;  2Q8T A;  1MSH A;  2UUA Q;  4X66 Q;  2BDO A;  3SK6 A;  1TU2 B;  2OF1 A;  1SNP A;  1PH1 A;  3OTO L;  1LAC A;  1Q12 A;  1SRO A;  5IWA Q;  3R8B A;  1JB3 A;  3KYH C;  1L1O A;  2QCP X;  1DXM A;  2PO4 A;  3K5L A;  3CCR A;  5M3M B;  3A7L A;  2A74 C;  2G5D A;  1DD2 A;  1D2B A;  1F9S A;  2PZU A;  5IP7 H;  4MZ9 A;  4X3S A;  4LUV A;  3MXU A;  3GD7 A;  4J6H A;  3CCV A;  4TSS A;  3HRZ C;  1LT6 D;  1WD1 A;  4XXE A;  3G48 A;  2QIL A;  1EOV A;  1HH2 P;  4FYD A;  4A3B H;  3ND8 A;  4U68 A;  3J7A 5;  2UXD Q;  5C4Z A;  4KHP L;  1PTO C;  2M9V A;  3T56 B;  4CKC A;  2ZTE A;  2VY3 A;  3SK8 A;  2L4N A;  1VCI A;  2JK8 A;  2NUC A;  1L0X B;  2ZXR A;  1YNX A;  1OXU A;  4ID6 A;  2GA4 B;  5HUR A;  2R93 B;  2K6A A;  1CM9 A;  3DWQ A;  1TWH B;  4UP8 A;  3VYR A;  2Y0S G;  1FNW A;  1VQC A;  1QNK A;  1I3Q H;  3CAM A;  4LF7 L;  2KUM A;  2AMC B;  1UEA B;  3TZU A;  2NVX H;  2DJF C;  1YBY A;  1SEB D;  1BR9 A;  5M5W B;  2QEJ C;  2I5M X;  4BY1 H;  3I4M H;  4YWM A;  1MSG A;  2K5Q A;  4AYB G;  1WCM B;  4IO9 A;  5A2Q L;  2BCO A; 
#chains in the Genus database with same CATH homology
 2RA4 A;  5G3L F;  3PUZ A;  4ZLT F;  3KF8 A;  1YNJ C;  4B9X A;  2FMC A;  1SMY D;  5HGT A;  2QDB A;  5KYL A;  1F9P A;  4ZRZ A;  3MA2 B;  4E6I A;  2A73 B;  4L8J A;  4DXF A;  3C3L A;  2Q8R E;  3IFD A;  2EXZ A;  1W6K A;  2WKC A;  5C44 B;  2E2D C;  3VR6 A;  3RMH A;  1D5M C;  3F2U A;  1BCP D;  4CJ1 B;  2VUM B;  2WAQ B;  1LTI D;  3M4O B;  3DWP A;  2BDN A;  2D62 A;  4Z9C B;  2E75 C;  1PXU A;  1E2Z A;  1F9Q A;  3A54 A;  2TMP A;  5K5P A;  3TZD A;  2HDL A;  1F9R A;  4ABN A;  2EYM A;  4K6D A;  4RGT A;  1LTR D;  2R61 A;  5IT9 L;  3J7A V;  3M7G A;  4KK7 A;  5CV8 A;  1KLG D;  2PMZ B;  3R2T A;  2C9O A;  1BCP B;  2IW3 A;  2EY2 A;  3KK7 A;  4K14 A;  4XDX A;  3VYT A;  5CV7 A;  3NK9 A;  3K0Y A;  2X69 A;  2F0T A;  4EQP A;  3LNN A;  1EWC A;  3D3R A;  2L0C A;  1ONL A;  3GTJ B;  1TT2 A;  5CMD A;  4WRD A;  3MXP A;  2NWG A;  3RD4 A;  1NR4 A;  2K03 A;  1L0Y B;  4KI0 A;  1CT1 D;  1YNN D;  2JA5 B;  1DCZ A;  1RHP A;  3E6Z X;  3X3M A;  2NTS A;  1MD2 D;  2RDH A;  4IUV A;  4P2C B;  2NN6 H;  4RH6 A;  1EY9 A;  4BS9 A;  2CQA A;  2NZ1 D;  4R8I A;  4V0B A;  4PQX A;  3SK5 A;  2F4I A;  3I8Z A;  1FR3 A;  3VA5 A;  2K7V A;  3C1F A;  5C4H A;  1JWS D;  4OGQ C;  1HCZ A;  1STG A;  2H1E A;  4K8J A;  2JEB I;  3C1E A;  1EY5 A;  5ELF A;  3JAM L;  3KLS X;  4LJZ C;  3J7Y W;  1ZYR C;  1AW7 A;  2CW0 D;  1SYB A;  3IFT A;  1TVX A;  4XTC S;  2X6L A;  2F0N A;  2O4X A;  1PZI D;  3T13 A;  4CJ0 B;  2A6H D;  3UI2 A;  2CVR A;  4ZUJ A;  2V4D A;  1SSO A;  4C1N I;  1VMC A;  3CRL C;  3QIA A;  3TBI B;  1PTO B;  2KEC A;  4LMQ D;  1EY0 A;  1EY7 A;  4XQJ A;  2B39 A;  1QJO A;  4HED A;  3TP8 A;  2FMM A;  5M9O A;  4RCN A;  1GUN A;  1EY8 A;  1ET6 A;  3GTK B;  4ULL A;  3IL8 A;  1VMP A;  1JR0 D;  3FDT A;  1S5D D;  1AZQ A;  4DAP A;  1EU4 A;  3OHX C;  3NXW A;  3KBX A;  1KNA A;  4O42 A;  2A6E C;  1WTX A;  3BYT B;  1G29 1;  3HOZ B;  3OPO A;  4FXG C;  4S3S A;  4A3F B;  2E2J B;  1B9N A;  4IUN A;  1NUC A;  4HSV A;  3GTG B;  3PV0 A;  1STY A;  5DAU A;  1JQY D;  2RBM A;  3S2D B;  1B3A A;  1QCB D;  1NR2 A;  3MFY A;  1V8Q A;  3AU7 A;  4HCS A;  3BS1 A;  4OO1 G;  4HR7 B;  2NB0 A;  1MGS A;  1IW7 C;  1TWG B;  1VF7 A;  3HGB A;  1CHQ D;  1NAP A;  3NE5 B;  2L11 A;  4BBS B;  3M85 A;  1XYI A;  4OO1 I;  1F2Z A;  3SR1 A;  1PZK D;  3RLF A;  5FO7 B;  3M3Y B;  4KY6 A;  1LT4 D;  3S1R B;  1H9R A;  2PNR C;  3EJI A;  4CJ2 C;  4ZKB B;  3SK4 A;  1PRT D;  1TKW B;  1ENC A;  3AB9 A;  1KAA A;  2XIW A;  1QOH A;  2B2U C;  4R9W A;  5IOC A;  2JA8 B;  1TR5 A;  3D4R A;  3DM1 A;  5JEA J;  2F0O A;  1PFB A;  1LTT D;  5F2D A;  1KLU D;  1PTO H;  1C8C A;  5E4X A;  1Y8P B;  2PZT A;  1WTR A;  5C4J B;  4CGY B;  4BA2 I;  3P75 A;  3HS0 C;  1B9M A;  3QO2 A;  5CV9 A;  3V96 A;  3J7A F;  2EYP A;  1F77 A;  2EJM A;  1R9T B;  3MWY W;  2RDG A;  1FYC A;  3BZD B;  2FJ2 A;  3J80 L;  1E2V A;  4F88 A;  3EVQ A;  5M5Y B;  4DK1 A;  3I91 A;  3P20 A;  4A3J B;  5JPM C;  1PDQ A;  5C5L A;  4QB4 A;  4K5X A;  3G6J B;  2EYL A;  4KKS A;  5C3X A;  1SMY C;  2J4X A;  4DF7 A;  3OIP A;  2K01 A;  1ML0 D;  3URY A;  4KD3 A;  5JEA G;  2WIN B;  3ERQ A;  1D5Z C;  1TY0 A;  1I4Q A;  1M8A A;  2PZW A;  3GP7 A;  3L9A X;  2MHV A;  1SAP A;  1BCP C;  1D5X C;  1BNZ A;  4IFD J;  3ONA B;  1IYV A;  1CA6 A;  3NTI A;  1O80 A;  1JWM D;  1UNS A;  3FPP A;  5JVH 3;  3LWE A;  1GHJ A;  4CKE A;  2EVB A;  4H7B A;  3ZYY X;  3ITP A;  1IKL A;  3WOE A;  4NW2 A;  2F0F A;  4WFN 3;  5I9O A;  2EYF A;  4N9P A;  5I2Y A;  3MC0 B;  3NQI A;  3I73 A;  3P1H A;  2EY1 A;  2N88 A;  2L9H A;  2NVY B;  1DON A;  3BVM A;  1CZG A;  2KVM A;  3QOL A;  1U9R A;  1SYG A;  2E76 C;  4PNY A;  1H9S A;  1LTG D;  4BBR B;  1GXD C;  4X3K A;  4QIW B;  2B2U A;  2RSO A;  2HCC A;  1Z7T A;  3S2H B;  1ICW A;  1RKN A;  1XXG A;  1GUG A;  3K58 A;  4K8I A;  5J39 A;  2OT2 A;  4B9W A;  1YNN C;  4IFD G;  1JOQ A;  1FNU A;  3LWU A;  4RAU C;  3K5O A;  4NKL A;  4RA8 A;  2F0Q A;  3K5N A;  1EIH A;  2DNC A;  2EZV A;  1XX8 A;  5G3L D;  2ZXO A;  5IGF A;  4IFD I;  2IWH A;  5ELB A;  3S16 B;  2EE1 A;  4UAI A;  4KD4 A;  5KEE A;  4V19 0;  4KKU A;  5C0X J;  4ZUI A;  2PYK A;  2K5W A;  1PZJ D;  1HUM A;  1JWU D;  2K28 A;  1H9K A;  4J8Q A;  1HFG A;  2CW0 C;  2L1B A;  1SJE D;  2A69 D;  2BE5 D;  3NWT A;  1H9S B;  3E0J A;  2TSS A;  3GTO B;  1WTO A;  1W6J A;  1BF4 A;  2PW5 A;  2NYZ D;  1WTQ A;  2A6H C;  4HTH A;  1SDF A;  1H9M A;  4FNF A;  3J81 E;  1SE3 A;  1JC7 A;  5JJZ A;  1V1P A;  3MFG A;  4OIK A;  3OWE B;  1ENA A;  3NBI A;  5FLX E;  3W3A A;  1LT3 D;  1QIL A;  2IJ0 A;  1AN8 A;  2EYO A;  1T5E A;  2AQ1 B;  1ROD A;  2EOT A;  4NP5 A;  2F0D A;  2YYZ A;  1GUW A;  1ZXT A;  1RTO A;  2XVS A;  3K59 A;  2B63 B;  3PO2 B;  4MN3 A;  5I6Y A;  5C0X G;  4R8N A;  2R3Z A;  1CQF A;  1HA5 A;  5DNF A;  2LS0 1;  3NTH A;  2HDM A;  1G2S A;  1TY2 A;  4KJO A;  3FRP B;  3QB3 A;  5EKI A;  4OL7 A;  5C0X I;  1AZP A;  1HHV A;  5AFW A;  4HMI A;  2BA1 A;  1S4Z A;  3I4L A;  1X3P A;  5LHY 1;  1HFN A;  1TS3 A;  1PMR A;  2KA7 A;  3CHB D;  5COY A;  3QWN A;  1EL0 A;  1EZ8 A;  4ODG A;  4A3G B;  1V1P B;  3PUW A;  5KNC A;  1EEI D;  2KJX A;  4BA1 I;  4PMW A;  1OO9 B;  5KYI A;  2F0L A;  2B8F A;  5T1I A;  5EBC A;  1ESF A;  4F87 A;  3WOF A;  2XNA C;  2AWN A;  3OMC A;  1DM0 B;  1LTS D;  1SYF A;  2D2C C;  4XQN A;  2FFK B;  2G9D A;  4KHZ A;  2JA6 B;  1PRT C;  3GTQ B;  1ET9 A;  4XIG S;  3M7N A;  4C3I G;  4KMU C;  4BWG B;  2F0W A;  5T1G A;  2FIN B;  2IX1 A;  1R4Q B;  1Z47 A;  3ND9 A;  1TQO A;  3DHQ A;  1SXT A;  1BXT A;  2WB1 B;  3SEB A;  1S5F D;  2X6G A;  1EYA A;  4IAL A;  1GJX A;  4G7O C;  5C3E B;  1IHZ A;  2AUK A;  2VXW A;  4K2K A;  4C3J B;  2EPB A;  4IUR A;  4LK1 C;  5CV5 A;  2ZXP A;  3TP5 A;  2K33 A;  2J7Z A;  1HPC A;  1A3V A;  4QF4 A;  1DYQ A;  5EPK A;  3R3O A;  5JPN C;  4JBW A;  1I4R A;  3EFX D;  4RFB A;  2O5I C;  4ZYS A;  1V1O A;  4HCE A;  3CKI B;  1SE2 A;  4JK1 C;  2FHT A;  2B2W C;  2O2L D;  1QE6 A;  1B1Z A;  3A56 A;  4A3E B;  1CZW A;  1FGB D;  1STA A;  2NTT A;  4KHV A;  4DU9 A;  1STN A;  4QCL A;  4A3K B;  1A3U A;  1OXV A;  1QNU A;  5CR3 A;  5IOD A;  3FPU B;  1Q8I A;  1RD9 D;  1ZEQ X;  2F0E A;  1HA6 A;  1I6H B;  3PUV A;  1CI3 M;  1UAP A;  3OMG A;  2NBF A;  2EJG C;  5JEA H;  3NQT A;  3H91 A;  5CBE E;  5COR A;  1EYC A;  4IQZ A;  2L12 A;  4H0L C;  4LAA A;  4ZAI A;  3BDC A;  1II3 A;  1LO5 D;  2XWJ B;  1RCV D;  4XT3 B;  3RZO B;  1G8Z D;  2HCI A;  4G7H C;  2Y0S B;  2SNM A;  5EQ0 A;  1JIC A;  4YIJ A;  2F0H A;  1B4O A;  3A55 A;  1PTO F;  3MZ5 A;  3L3O C;  4DA2 A;  2OXP A;  4AYB B;  1WTW A;  1FNV A;  2ENB A;  5CBA E;  1STH A;  2NVT B;  1NSN S;  4OIJ A;  2JEA I;  4Y7N B;  2I07 B;  2L5T A;  4WOR A;  1EIG A;  3MVV A;  2PPB C;  1K8M A;  5I2X A;  3A8K E;  4GZY C;  1Y1V B;  1LTA D;  3ERO A;  4K5W A;  1I4X A;  2SEB D;  1O7L A;  4N9T A;  1DZ1 A;  1Q1B A;  4C1N K;  3BDL A;  4EVO A;  1X3Q A;  4C56 C;  2IX0 A;  4HSP A;  4BY7 B;  4K6L A;  1M4V A;  1EQV A;  3VR2 A;  3MEH A;  2NN6 G;  1SYD A;  1E0B A;  4IFD H;  2EYH A;  3I90 A;  4UDU C;  2BA0 A;  1LLR D;  4MHE A;  2Q8I B;  4J1M A;  2HUG A;  2Z4H A;  1SNM A;  3MAQ A;  3OSO A;  1B2T A;  5IGC A;  5I4D A;  3VR4 A;  2NN6 I;  2F0M A;  2B2W A;  2A69 C;  2RSN A;  2BE5 C;  1PRT B;  2K04 A;  3X3N A;  3GV3 A;  1AP0 A;  3SXH A;  4KY5 A;  1EFI D;  4A3I B;  1PLF A;  3KBG A;  3HOU B;  5BN3 A;  1SYE A;  5D3I B;  5EKL A;  4WJW A;  3S1N B;  4NDX A;  2F0J A;  4FO2 A;  5FOB B;  1UUP A;  4C2M B;  2M00 A;  3S14 B;  1LT5 D;  1TII D;  1I4H A;  4FF1 A;  3PMF A;  3MHB A;  4FF3 A;  4RKB A;  3NUC A;  2RDF A;  3DEO A;  2K5D A;  4ILW A;  3BVZ A;  4L6T B;  2LKV A;  3HOW B;  3PUY A;  2LY7 A;  5LL6 X;  5LL6 S;  2I46 A;  3MXN A;  2D5D A;  1F2L A;  5DEH A;  2KHS A;  5ELD A;  4KTA A;  2SNS A;  1FD7 D;  4HAE A;  2DY7 A;  4Q5V A;  2F3W A;  1G91 A;  1JOO A;  2H4O A;  2E2I B;  1SND A;  2Z8L A;  1EY4 A;  1F2Y A;  2BOS A;  4TQU S;  1D1K A;  2MUY A;  4RCO A;  1A3T A;  4PV1 C;  4RGN A;  3D6W A;  1TWF B;  1B44 D;  2SDF A;  1T5X D;  3DWA A;  2L55 A;  1O7Z A;  2AQ2 B;  2IL8 A;  1EWH A;  4A3D B;  4EQN A;  3S9W A;  2ZT9 C;  2DY8 A;  2F0S A;  3D31 A;  1HXY D;  2RQX A;  1SNQ A;  2DNE A;  2JSO A;  4IUU A;  3K57 A;  2Z1C A;  3EQL C;  2J0T D;  2MGS A;  3S1M B;  5NUC A;  3N6R A;  5DM6 3;  2ID0 A;  3R93 A;  4FF4 A;  5IGD A;  3FEW X;  4DFA A;  5A2Q E;  1TWC B;  3MTS A;  5ELE A;  1KNE A;  2R7Z B;  4KJN A;  2K32 A;  2B2T C;  4I7Z C;  1IKM A;  5KGU A;  2G9H D;  3NTK A;  1SYC A;  1H9J A;  3H09 A;  4KN7 C;  2PQE A;  5EPJ A;  2HQE A;  1J9O A;  1O78 A;  3T53 B;  5J22 A;  5BN5 A;  3A8J E;  3GTM B;  1RTN A;  4L63 B;  2KOL A;  1BO0 A;  2DN8 A;  3A8I E;  1SFO B;  1GUS A;  5KRU A;  3Q22 A;  2NVQ B;  1U4P A;  4QUC A;  2E2H B;  3S15 B;  3C2P A;  1QB5 D;  3P7J A;  1Y1W B;  1S5B D;  2EJF C;  2LFN A;  5IT9 E;  2JP1 A;  1WTV A;  4CBV A;  3DXJ C;  3SVM A;  1U4R A;  2CHB D;  1GUT A;  2MJ8 A;  1LV9 A;  1G2T A;  1J8I A;  3GV6 A;  3TP7 A;  1LTB D;  5EPL A;  3DMU A;  2WP8 J;  3D4D A;  4FXD A;  4X3U A;  2IT1 A;  3HEJ A;  3TME A;  2F0I A;  5KND A;  4DGZ A;  5E1F A;  1BQQ T;  2E74 C;  2AWO A;  2EY6 A;  4IUQ A;  5FKA C;  2QKI C;  2WKD A;  1SE4 A;  1CA5 A;  5K36 G;  1Z6H A;  1ESR A;  2SOB A;  3CRK C;  1LAB A;  1AEX A;  3HOY B;  4A93 B;  2A68 D;  3LX0 A;  2N55 A;  1KDB A;  1RJT A;  1SNC A;  2OEO A;  1HTP A;  1IL8 A;  4DNT B;  1U4M A;  5I9P A;  5ELC A;  3SDZ A;  4CKB A;  3FVQ A;  4OHJ A;  2F0G A;  1A2U A;  3BVG A;  5D14 A;  4EGV A;  3K6O A;  3H0G B;  3U9S A;  3K7A B;  5ISR A;  2JYO A;  1X32 A;  2QF7 A;  1EU3 A;  1EZ6 A;  1OXX K;  4X3T A;  2KEE A;  3D8G A;  3JAM E;  2K05 A;  4HMJ A;  3D6C A;  3KLS A;  3PO3 B;  4C3H G;  1HUN A;  1KDA A;  2B2T A;  1HTL D;  4M8A A;  1I50 B;  2AQ3 B;  4HN7 A;  5C3W A;  2F1M A;  3J81 L;  5FK9 C;  1D6E C;  2MP1 A;  3V05 A;  1BOS A;  3I72 A;  4ZQ3 A;  2EDG A;  1TS5 A;  5EJW A;  3H3V C;  2VB2 X;  4PMB A;  1EY6 A;  1Y69 U;  5FLX L;  3VR5 A;  1GOZ A;  2XRQ D;  2M2L A;  3FKI B;  3BYY B;  3I4N B;  4OO1 H;  3Q0A A;  3BDO A;  1ILP A;  2WII B;  3H94 A;  1EQT A;  1WVL A;  1ZKO A;  4A3M B;  2RVL A;  3A7A B;  1A6X A;  1U4L A;  1BCP F;  5E4W C;  1S5C D;  3FMC A;  3NPP A;  1XWE A;  3HOV B;  3EA6 A;  3PUX A;  4M1U B;  1HQM C;  1I4G A;  1O7Y A;  5E3F A;  2XRS D;  4DK0 A;  3BG3 A;  4G4K A;  4ZKC B;  3NWS A;  2PCF B;  3NBH A;  1I4P A;  3C46 A;  1DOM A;  3QG1 A;  2R6G A;  1PYW D;  1DOK A;  5KNB A;  4IUP A;  3PIP 3;  4DXG A;  2KQ3 A;  3NP8 A;  2EYJ A;  3HP3 A;  2Z4I A;  1PTO D;  3HOX B;  1JE4 A;  3R2I A;  4KV6 A;  3U9O A;  4B08 A;  1I6V C;  2JE6 I;  2KCC A;  1KAB A;  2F0P A;  2KED A;  1K8O A;  2KCN A;  3W2D A;  5IIF A;  1ILQ A;  5KIX A;  2MPM A;  2B2Y C;  4FXK C;  3L7Z C;  3I70 A;  3IAY A;  3N52 A;  1CK1 A;  3GO5 A;  4RHS A;  2VNU D;  3HKZ B;  3I3C A;  2A5H A;  4KN4 C;  3VYS A;  4PMC A;  5C6A A;  1TS2 A;  4RGO S;  1TWA B;  4G57 A;  1Y8O B;  1IYU A;  3O13 A;  1YNJ D;  2EY5 A;  2K1B A;  3T16 A;  2F03 A;  1Q90 A;  3DEP A;  4RKL A;  4IUT A;  2YU9 B;  5M5X B;  3NHH A;  1QWY A;  3GQB A;  4K2L A;  3T4A C;  4DAY A;  3RZD B;  3TDQ A;  1EYD A;  2D9U A;  3KUP A;  5JOB A;  3V2T A;  1C48 A;  3D4W A;  3CQZ B;  3WDN A;  1GHK A;  1BDO A;  3J80 E;  4DN4 M;  1EEF D;  5D3D A;  4DAV A;  5FO8 B;  5M3F B;  5CV4 A;  1OXT A;  1BBX C;  5I6W A;  2AUJ D;  5JVG 3;  2VB3 X;  5J1Z A;  2PW7 A;  4XYO A;  2XWB B;  5CYU A;  3S1Q B;  3GTP B;  2F3V A;  1A2T A;  3AMU A;  3KLR A;  1STB A;  1MI2 A;  3HZX A;  2C5C A;  1CQV A;  1NCV A;  1Y8N B;  2JXM B;  3Q24 A;  5D65 A;  1F2M A;  1VDZ A;  1CFM A;  5EBD A;  4RWS C;  4TRD A;  3K5M A;  4TKO B;  2R92 B;  4Q0F A;  3SHL A;  3RUZ A;  3S17 B;  5IGG A;  4C3H B;  4QUF A;  1OXS C;  2B2V C;  3GTL B;  5JAV A;  2B2Y A;  1V43 A;  5IGE A;  4IN3 A;  4DNR B;  1Q1E A;  5IGB A;  1HQR D;  5BN4 A;  5CC4 A;  4XT1 B;  1WTP A;  5EKK A;  3G7L A;  3TSS A;  4C3I B;  4H13 C;  1PFM A;  1Q3L A;  1ZYR D;  5EGT A;  1DOL A;  1SNO A;  4K5V A;  4MIU A;  4FF2 A;  1CHP D;  1AFP A;  1KDC A;  4KY7 A;  3NSW A;  5A35 A;  2A68 C;  3M4Y A;  1E2W A;  1PRT F;  3QJY A;  1S5E D;  3Q6S A;  4RHR A;  1JOR A;  2IPK D;  2F0V A;  3T51 B;  5DM7 3;  3OIQ A;  4QMG A;  1KTK A;  4A3B B;  2O5J C;  5CGK A;  4KKT A;  1PFN A;  5C0X H;  2ICE C;  1C4Q A;  5FO9 B;  3PIO 3;  2F0K A;  4U67 3;  3IKJ A;  3MXG A;  5K36 H;  1SJH D;  4FP5 D;  1BUV T;  2JA7 B;  1A15 A;  3VA7 A;  4F7X A;  2WV6 D;  1MBY A;  3QOJ A;  4XQQ A;  1SBB B;  1I3Q B;  3DUZ A;  1QG7 A;  1VF5 C;  3OW7 A;  1XTC D;  4O1N A;  2NVX B;  2B8G A;  4BY1 B;  5CV6 A;  1B53 A;  2XSC A;  3I4M B;  1ENF A;  5C4X B;  4H44 C;  1TS4 A;  4G7Z C;  1R4P B;  1JCK B;  2A6E D;  4C3J G;  3CU7 A;  5C5M A;  3SE0 A;  1K83 B;  3Q23 A;  3OWF A;  2IX3 A;  2WAC A;  4ZK9 B;  4FVM A;  1WD0 A;  2LMC B;  1D1I A;  3TP6 A;  3VR3 A;  3VYU A;  3E5S A;  1EOT A;  4F8M A;  4I65 A;  1B50 A;  1CTM A;  1RF2 D;  1RDP D;  2XN9 C;  2RKS A;  3H6M A;  1HRJ A;  1GUO A;  4IZ8 A;  5TSS A;  3TN2 A;  4EQO A;  1DJR D;  4XYQ A;  3OOC A;  1JOK A;  4NMZ A;  1STE A;  2B2V A;  1IW7 D;  4CHT B;  2ICI A;  3HG9 A;  4RGM A;  1G6Z A;  4ME5 A;  2F0U A;  2Q8T A;  1MSH A;  2BDO A;  3SK6 A;  1TU2 B;  2OF1 A;  1SNP A;  1LAC A;  1Q12 A;  3R8B A;  1JB3 A;  2QCP X;  1DXM A;  2PO4 A;  3K5L A;  5M3M B;  3A7L A;  2A74 C;  1DD2 A;  1D2B A;  1F9S A;  2PZU A;  4X3S A;  3MXU A;  3GD7 A;  4J6H A;  4TSS A;  3HRZ C;  1LT6 D;  1WD1 A;  4XXE A;  2QIL A;  4FYD A;  3ND8 A;  4U68 A;  5C4Z A;  1PTO C;  2M9V A;  3T56 B;  4CKC A;  3SK8 A;  2L4N A;  1VCI A;  2NUC A;  1L0X B;  2ZXR A;  4ID6 A;  1OXU A;  2GA4 B;  5HUR A;  2R93 B;  2K6A A;  1CM9 A;  3DWQ A;  1TWH B;  3VYR A;  1FNW A;  1QNK A;  2KUM A;  1UEA B;  3TZU A;  1SEB D;  1BR9 A;  5M5W B;  2QEJ C;  1MSG A;  2K5Q A;  1WCM B;  5A2Q L;  2BCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...