3VYRA

Crystal structure of the hypc-hypd complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
72
structure length
72
Chain Sequence
b'AVPGKVIEVNGPVAVVDFGGVKREVRLDLMPDTKPGDWVIVHTGFAIEKLDEKKAMEILEAWAEVEKAMEGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase expression/formation protein HypC
publication title Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Metal binding protein
total genus 17
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2012-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3vyrA00
2OT2A 3VYUA 2Z1CA 3VYTA 3D3RA 3VYSA 3VYRA
chains in the Genus database with same CATH superfamily
1NMFA 2E76C 2AWOA 5H1SE 1G2TA 3ZJYC 3PUVA 1UEBA 1HNXL 4LW1A 2KEEA 4IOAA 4X3KA 4A3FB 1EYAA 1VQKA 2ZJQA 3S1NH 5KNCA 3HKZE 1D1IA 2XSCA 1MGSA 3E0JA 2XGTA 1CA5A 1K9MC 1BXTA 1D5ZC 2I5HA 2IX0A 2YYZA 1KDCA 3H0GB 1EEFD 3NENA 4NDXA 1YNND 2N3SA 3VA7A 1F2ZA 1CZGA 1VQJA 1CFMA 4JI4Q 4LNQA 3S1MB 1VMPA 4KN4C 1EFID 3F8TA 1I3QH 1XMOQ 1L0YB 4X6AH 3CP0A 1I4GA 5EBDA 3PMFA 4DXFA 4DUZL 1JQYD 2G9HD 2A68D 1GJXA 1D5XC 5CYUA 2GVAA 2M9VA 2OTLA 2JA9A 1YNNC 1XX8A 4JI7Q 2K04A 4PMCA 2RSNA 2RF4A 3HGBA 3P1HA 3TZDA 3MHBA 4L5SA 2FXQA 3T51B 4M1UB 4R9WA 1E1TA 2C35B 1II3A 3HP3A 2I5MX 5FO8B 3TN2A 4QIWE 3DMUA 1PMRA 3QOJA 2PNHA 3RZOH 2RBMA 1K83H 3BZCA 1B50A 5GAEC 1UE7A 2ZM6L 2WV6D 1Y8PB 1CKMA 4AIMA 1NR4A 2ES2A 4IUPA 4BY1B 3PF4A 1SE3A 4X66L 1CQFA 3K8AA 5IYCG 3BVGA 2L1BA 2ZXPA 3S14B 2YV5A 3DEOA 3N52A 4RKBA 2WB1E 5M5XH 2KOLA 1NE3A 3UI2A 1E24A 4C3IH 4K14A 3TP7A 1C9OA 3RNUA 4B3MQ 4MZ9A 2F0EA 3IL8A 1K0SA 3TP8A 1JMCA 1U9RA 3UE1A 3RN5A 1SROA 4RAUC 2R92G 5C44H 5J39A 2A5HA 1KRSA 1FJGQ 4A93G 1P16A 3OOCA 3SVMA 3PO2H 2NZ1D 1HHVA 5D3DA 1ILQA 4V190 4DUYQ 5C4ZA 4DV6L 4B3RQ 4YCWA 3NTHA 1EYCA 4K0KL 1XMQQ 3W1GA 1PYSB 1SRUA 3VDYA 3P20A 4QJFA 2PQAB 2HDLA 3KK7A 2B8GA 2EE1A 2EYPA 2E74C 1HTPA 4LF4Q 1HR0Q 1XNRL 5A2QL 1JJ2A 4BBSH 1XNQL 3GTMB 4BA1I 4CGYB 3NQIA 5IT9E 4FO2A 1MSGA 2VW9A 1N36L 4MTKA 3H15A 1TWCH 4OO1I 1C8CA 2R61A 2ZT9C 3I70A 4CKBA 3HOVB 2A19A 2CH4W 1OXUA 4IO9A 5EPLA 1YHAA 3I73A 2R7ZG 4HJ8A 3HOWH 4LFBQ 2EVBA 1ML0D 1WCMG 4C3JH 1EU3A 4MNOA 3HEJA 2K5WA 1B8AA 3S2DB 1AE2A 1F2MA 1RHPA 5CORA 2L55A 4C3HG 1B44D 1W6KA 3I4MB 1L1OC 5JVH3 3NHHA 1NY4A 1OXSC 1S72A 1SAPA 1UE5A 2IHEA 3MZ5A 4PNYA 2F0FA 4NXML 5E7NA 5C4JH 4OWXB 4XQNA 4IUUA 5TSSA 3U4VA 1N32Q 3GTKH 2LMCB 3L0OA 1C0AA 2B29A 3TSSA 4GOPA 1GM5A 5FLMH 1X9NA 5CV6A 1TS5A 1JWUD 2R7DA 1DD2A 1L0XB 5T1GA 3H6MA 5C0XH 1B2TA 2E2DC 5JEAG 4G7HC 3TS2A 1ZXTA 1SFOH 4DNTB 1Y1WB 4OX9Q 4C56C 3PF5A 4TRDA 3HOZH 4HIKA 5LMNQ 2B63G 4A3LG 4JI8L 3FKIB 3MXPA 3ERQA 1K3BC 3KBXA 2Q8TA 5M9OA 3G6EA 4RCOA 1EQRA 4L6TB 2OF1A 4DR6L 3MFYA 5FLXE 1EFWA 1PH5A 4J6HA 2AQ2B 4XQQA 4GNXA 1HCZA 1BR9A 1EY7A 3KOJA 2Q8RE 4XDXA 1U0LA 4I7AA 1HZCA 1KNAA 1JWMD 3HOUG 4KD3A 3OWEB 4KMUC 4KI0A 2A1AA 3GD7A 5ELCA 1WJJA 4TSSA 4A3MG 5T1IA 4LFAL 3ICEA 4DV0L 2EY5A 1X3PA 3E5SA 5LL6S 1B3AA 2I5LX 5AFWA 1QZHA 3U50C 4BY7B 1EIFA 2K50A 1LT5D 4JV5Q 2VQEQ 3SR1A 1A2UA 4P73A 2F0IA 2X6GA 2EJMA 1D8LA 1STNA 1EQQA 3RUZA 4BWGB 1EU4A 4N9TA 2JA7G 5BN4A 4G7OC 5IE8A 3N6RA 2ZTEA 1O80A 1PYWD 2PO4A 2ZTCA 1QNUA 4ABNA 4A3BB 2PI2A 1WTQA 5I9OA 3CMAA 2K33A 5JJKA 2EDGA 1ENFA 1MSHA 1MJEA 1TQOA 1I50H 4DV7Q 2E8GA 5IY0A 3ITPA 3DWAA 3NPPA 3NQTA 1AZPA 4IOCA 1HRJA 1BDOA 1DYQA 3IRBA 1GOZA 4DV1Q 3CXCA 1AFPA 5DM63 3GV6A 4RFBA 5M3MB 1Y8OB 1NNXA 4JC0A 2K5QA 1NUCA 4B3SQ 1M8AA 1PA6A 3KF8B 1NSNS 4POFA 2E5LQ 1Y8NB 3T53B 2RVLA 2L15A 2JEAI 4R4QA 2PNRC 1YEZA 4KTAA 4ZAIA 5I9PA 4K8JA 3PO3G 4R8IA 3QO2A 2ALYB 3K7AH 4AYBB 4JI2L 3A7LA 4UAIA 5EPKA 4P72A 4DV2L 1Q81C 4UY8C 3D4RA 1L2FA 1KNEA 3TMEA 1XYIA 3URYA 2E2IH 2JA5H 1VCIA 1VQ6A 2RDHA 1SYEA 1X3QA 4HJ5A 1CA6A 4OELB 4BBRB 1B3QA 1W2BA 2I0QA 1PH3A 1VQMA 3BYYB 3LWUA 2CHBD 2JE6I 3EVQA 3HOYB 1A0IA 3D3RA 1FD7D 4OO1G 5M3FG 2EJFC 4JCVE 4LAAA 4QB4A 5C4XB 5D3IB 1UWVA 2N8NA 1HZ9A 2K5DA 2F0KA 1DONA 2D62A 4GS3A 1TWAH 1VQ5A 2UUBQ 5AJ3Q 2SDFA 2XNAC 4PZ7A 2K05A 3FHWA 1HA6A 4CJ1B 2VQFL 2K5HA 1J9OA 1TXYA 2FINB 1OXVA 2Y0SB 4YWLA 1BBWA 1S5FD 1EL0A 2AQ1B 1PH1A 1RIPA 1LTRD 2B2UA 4MN3A 1WD0A 4R4TA 3GTOB 1SXTA 2R93H 2EY6A 1B4OA 1HFGA 5HY6A 3E6ZX 3HS0C 1NJIC 3S15B 3GTJH 1PTOB 4AQYL 2NVYH 1STEA 4P74A 4DV3L 2NZOA 4BA2I 5GQOA 2CH4A 5IWAQ 4DFAA 1T5XD 4A75A 1VQBA 4LFCQ 1E0BA 2CVRA 3I72A 4A3FH 2L12A 2K4KA 4IPDA 4KHZA 1A6XA 2JA6G 4L5TA 3MTSA 1CUKA 1A3VA 1I6VC 1H9JA 4R1JA 4B3TQ 4N8X1 2WINB 5I6WA 1SNPA 1UE6A 1GXDC 1PZKD 1BCPF 3U9SA 3GTGB 2UUCQ 2MJ8A 4X3TA 3U58A 5IYBG 3HKZB 1QCBD 5C0XJ 3F2BA 4NKLA 4A3IB 1H9SB 1K8GA 4LF8Q 3C1FA 1BOSA 2HT1A 3STBD 2KQ3A 2OQKA 4DR2Q 3LGJA 1HZBA 3AB9A 4N8FA 5JOBA 4RKLA 2P5ZX 4A3DB 1Q1EA 4R8NA 1K28A 3DWQA 4QF4A 2PMZB 1CSPA 2NTSA 4WJWA 1D2BA 2WP8J 2O5JC 1EWIA 2K1BA 1V1PB 1IBKL 1M90C 4HJAA 3M9BA 2VZAA 1BQQT 4DR4L 1KLGD 1N34Q 4LF7L 3BDCA 2HCCA 2RDGA 1EIGA 2VUMG 5C3EB 1PRTB 4K2KA 4QUFA 4RCNA 2RHQB 1H9MA 2QDBA 3I56A 1QILA 5K36G 2L4NA 3VYTA 3S1RB 3Q6SA 2F0VA 1EOTA 4EVOA 1VQIA 4OWWB 3CU7A 3J7AV 4DR3L 5NUCA 1PH4A 4BY1H 3CCMA 2QCPX 3L3OC 3ZYYX 3Q23A 1B9MA 3S14H 2WAQB 3MEHA 1SYDA 4L63B 1VQ4A 1NMGA 2FJ2A 1FNUA 4JI6Q 2JA7B 4H44C 1K8MA 3J80L 4JI0L 4B9XA 2ZTDA 4BS9A 4IPGA 4RGMA 5KGUA 4HMJA 3TZUA 1YBYA 1MD2D 2SNMA 3EA6A 2NVXB 1O7YA 2XRSD 4DGZA 4ILWA 4AYBE 3I4NB 1QZGA 3CCQA 4DV5Q 2GVBA 3VR5A 4A3CH 1KTKA 1WD1A 5C6AA 2IHFA 2IX3A 1B70B 2F0DA 4JI2Q 2AUJD 5FJ8H 3JAMc 3HKSA 2L5TA 2FMMA 1BCPD 1IL2A 4KJNA 3KLRA 3HOXB 4IFDH 4YCUA 5JVG3 4C2MB 4FP5D 2E75C 5M5YB 1J5EL 3OSOA 1MBYA 2ID0A 2F0OA 1PH7A 2GA4B 1GKHA 1E2ZA 3D8GA 3G6JB 2F0PA 3M7NA 1DOLA 1STAA 2NN6H 5D65A 5DAUA 1IBLL 3GTMH 1FVIA 3D6WA 4HEDA 3HG9A 2K6AA 1BCPC 3DWPA 1T9HA 1H95A 3FPUB 1SNMA 5J1ZA 1AZQA 4YHHL 3HOVH 3I2ZA 2EYFA 1YIJA 3G48A 2Y0SE 5FO7B 4HJ9A 1HFNA 1IKMA 1TWGB 2F0WA 1YITA 4DAMA 4JBKA 2KJXA 4F7XA 1WVLA 3UDGA 5CC4A 3EBEA 2A69C 2NVQB 5DNFA 1U4PA 4KK7A 4DAVA 3S2DH 1ZEQX 4QY7A 3I4MH 1HPCA 3BJUA 3D31A 1EY4A 1IYUA 2HIVA 1B1ZA 1LV9A 4X62Q 2L11A 1EWHA 2D0PA 5C0XI 2UXBQ 2RQXA 1N33L 1PZJD 4P75A 5EKIA 1YHBA 4AH6A 2F3VA 2ZXRA 4JOIC 4KJOA 5CV8A 4MTNA 5EQ0A 2BH2A 2Q8IB 4JI5L 1CZWA 3AFQA 3SK4A 1Y1WH 3TP6A 2OEOA 3M4QA 2KHJA 1QJOA 4XT3B 1I6HB 2JQOA 3JC66 3FKIH 1Q82C 2OTJA 2A6HD 2ATWA 4IJHA 2MUYA 3HZXA 1VQ7A 2K01A 1S4ZA 2QILA 4JI1L 1XTDA 4LF9Q 2PMZE 2RDFA 4ZKBB 1I94Q 4RH6A 2AWNA 1PVOA 4FXDA 4K5WA 2VL6A 3TBIB 3AMUA 2VB2X 4F8MA 2F03A 1Y1VB 2EPBA 2EQSA 2D5DA 2HHHQ 4F87A 1EY9A 1SNDA 1NTGA 2A6HC 1H9RA 1F2YA 2K75A 1TIID 4JYAQ 2NZHA 4OXPA 4JW0A 3I3CA 4HIMA 4KD4A 4JI3L 5K5PA 4UHVA 4IUTA 4EQOA 4ID6A 2QA4A 1L1OA 2MNAA 4BY7H 3KDFB 4LUZA 3CD6A 2XN9C 4OGQC 2F4VL 1HUNA 1E1OA 4GKKQ 2QGQA 1L0WA 2WAQE 2O2LD 1Q12A 2ICIA 2VXWA 3F1ZA 4Y7NB 2JXMB 2KVMA 4J8QA 5KYLA 5JAVA 2NYZD 4JG2A 3BDOA 4A3BH 2RKSA 1YJWA 4U68A 3PIO3 4C3IG 2SNSA 2N88A 4CDDC 4IJLA 1F9RA 4JI0Q 2KA7A 4I7ZC 3UDIA 1YNJC 5KNDA 2N78A 4HAEA 2HIXA 2QF7A 4U673 5F2DA 5C44G 3PSIA 1CKNA 5EPJA 1J8IA 3PO2G 2K28A 5M3MH 3I91A 5JPMC 3T1HQ 3PUYA 2EYLA 4DR1L 2LY7A 4CJ0B 2QEJC 1I4HA 3J7ZC 1EWCA 4KN7C 2BOSA 3GO5A 1STYA 1RDPD 3MXNA 3UDXA 1A62A 1PFBA 1YNXA 1LUZA 2JEBI 2R7FA 4JBJA 2XTIA 4A3EB 1A2TA 3MVVA 4FF4A 2VS1A 1HUMA 1YHQA 1G2SA 1ONLA 1PRTC 2F0LA 1Y69U 1VMCA 1HQRD 2NB0A 2JK8A 4DV4L 3CC4A 2UXDL 1LM0A 4NW2A 4S3SA 4KLKA 3BYTB 1Z47A 3EN2A 4BBSG 1JJGA 3VR3A 3R3OA 2J4XA 1ZYRD 3RZDB 3BVZA 1JR0D 1PZID 2KECA 2SEBD 3DEPA 1PH8A 3OHXC 3S16B 5IYDH 5GROA 4BBRH 1RL2A 4LF5Q 5IOCA 1QWYA 2H1EA 1E2WA 4V0BA 2F1MA 4A3JB 4A3GB 4IFDJ 1Q1BA 2JJQA 3HRZC 2FMCA 3HOYH 3M4OH 3HOWG 1KIXA 2C5CA 1E3PA 3GTPH 3NTIA 2I46A 5C4XH 3WWVA 2AUKA 3V96A 3CF5A 4LF6L 1GHJA 4C3JG 1CHQD 1ZYRC 3BS1A 3AFPA 3CCVA 5CR3A 1QNKA 1TS4A 4ZLTF 1PFSA 2F3WA 1FGBD 3CMEA 1B53A 4CKCA 4GKJL 4DK0A 4OL7A 2VY3A 4XYQA 2NUCA 4KHPL 4YY3L 4M8AA 1CM9A 2OCEA 3DUZA 4HCSA 1UUPA 2KCTA 1GUOA 2F52A 2NTTA 3T13A 3GTOH 1JB3A 3T1YL 4A3KB 3CQZB 3J80c 3GQBA 4R4OA 5FLMG 1HNXQ 3S15H 4UDUC 5LMUL 3EIVA 2JA8B 3NXWA 3M3YH 5C0XG 1WTXA 1EOVA 4G7ZC 1KQSA 1VQGA 1HH2P 1STGA 3M4YA 2BE5D 3RLNA 1YI2A 5C3WA 2PPBC 1DOKA 3CCUA 3SEBA 3HOZG 5IGFA 2EXDA 3C46A 1DJRD 4A76A 1FNWA 2OXPA 2B63B 2F0UA 5BR8L 2UU9L 5ELBA 1TU2B 3GTGH 1AH9A 4RGTA 2HQEA 2A6ED 1S5DD 2K5VA 2BE5C 1X3GA 4ZYSA 2E2HB 4A3IH 3JAML 4DUZQ 1E22A 1QE6A 1HNWL 1IL8A 2IPKD 2XVSA 4RGOS 2DY8A 2WFWA 5E4WC 4K5VA 4K5XA 4O2DA 5I6YA 1QVFA 4H0LC 1S5ED 1GUSA 5EBCA 2MPMA 3A7AB 2O5IC 4A3DH 1EY6A 1GUNA 2IW3A 2YTXA 4HSPA 4POGA 1CQVA 3NBHA 4QCLA 2A6EC 2IJ0A 2KHIA 3BZDB 3OTOL 1Y14B 1DM0B 1JICA 4MHEA 5A2QE 4XTCS 2WKCA 3FMCA 3NWTA 1HXYD 1JC7A 1ICWA 5C4HA 3I4OA 1JOQA 2B3GA 3QOLA 2EY2A 5D14A 2ZM6Q 4NMZA 2KEDA 1GUGA 2K52A 5C3EH 3NE5B 2PQAA 4H13C 4ME3A 1S40A 3F2DA 5IGCA 1KLUD 5J3BA 1VQCA 3IAYA 4CDEC 4X66Q 1PH2A 3S1RH 1GUTA 1ENCA 1HNZL 2FFKB 1LTLA 5JPNC 4DR5L 1G6PA 3E3XA 2B2TC 3VYUA 1QUQB 3RLFA 1F77A 5IP9H 2OQ0A 4CDFC 1OO9B 1V9PA 2EZVA 1GUWA 4O42A 3G71A 2F0NA 2JP1A 2PCFB 1VQEA 1YJNA 1STBA 3CPFA 1EEID 3AYHB 4DK6C 5CV4A 3EFXD 2XRQD 2WB1G 2IY5B 3KLWA 4DV6Q 2NVXH 1CHPD 4CBVA 4L5RC 3M4PA 4FVMA 3I4NH 4K0KQ 3H94A 4JVZA 3QJYA 3WOEA 5FO9B 4KKSA 3NBIA 4IFDI 1UEAB 2UUAL 1QOHA 1RTOA 2R92B 4XXEA 3OPOA 2KUMA 4A93B 1LABA 1LTAD 4X65L 3SK6A 1R4QB 1SE8A 4QUCA 3HOXH 1U4RA 2O4XA 4C2MH 1XNRQ 3J81L 1KAWA 4PG3A 1K3RA 1EY0A 2JA5G 1XNQQ 2PZUA 2NN6I 2HQLA 1N36Q 3FDTA 4K6DA 4L8JA 2UXCL 4LWCA 3PCOB 1KABA 2PI2E 2ENBA 5KYIA 1R9TB 2YU9H 3S2HB 3FP9A 1K73C 1B9NA 3GTLB 3TQYA 5HGTA 2CW0D 4NP5A 1NBWA 5IP7H 1LO5D 3D6CA 1GO3E 3CKIB 2Z1CA 5C5MA 4NXNL 2VNUD 1LT3D 4HIOA 4ZQ3A 3FRPB 5KNBA 1I4RA 4Z9CB 1TWGH 1STHA 2BCOA 4RHRA 5CMDA 1U4LA 2ICEC 1B7YB 3DHQA 1HR0W 1WYDA 4X64L 3JAMi 2NVQH 1EZ6A 2DN8A 4KKTA 2CW0C 1I4PA 3CHBD 3R8BA 4NXMQ 2R7ZB 4DAPA 2R93G 3K5MA 3T1YQ 3K81C 3QIAA 1WCMB 2DNCA 4DR7L 1YVCA 2E2JB 4C1NK 4K8IA 4C3HB 4A3FG 2PZWA 2N55A 3RD4A 3E0EA 2KCNA 1BKBA 2NWGA 2HCIA 1ET9A 4JI8Q 5C4JB 3SK8A 4PQXA 3MXGA 3DLLA 4TKOB 1V1QA 1XPRA 1IBML 1ESRA 1I6HH 5KEEA 1LTGD 4DR6Q 3H0GH 4LK1C 1FL0A 4DAYB 4UP7A 1VQLA 4HMIA 1ENAA 2PZTA 4L5QA 3QR8A 3MEFA 3HOZB 3S1MH 2M2LA 1JT8A 1WTHA 3RMHA 2ZJRA 5BN3A 4DNIA 3S9WA 1SLJA 2EY1A 2K5NA 3ER0A 1Y1VH 4G4KA 3J7YW 4CDCC 4LFAQ 1EY8A 5LMNW 2PW7A 4DV0Q 3S24A 3VR2A 3J7AF 1VQAA 1AEXA 4A4IA 1JOOA 1ZKOA 4R4CA 5JEAJ 4JI4L 1K8OA 1X56A 3HOUB 4QMGA 4MIUA 3HFZB 1XMOL 3SDZA 4RWSC 5EGTA 2QW7A 1LT6D 3DM1A 4WRDA 2LS01 5FOBB 1S5CD 3AU7A 4XQJA 1X3FA 4A3MB 2J0TD 5ELDA 3KF6B 3QG1A 3CC2A 4Y7NH 4JI7L 1RCVD 4BY1G 1SNQA 1WOCA 1VQHA 4JOIA 4ZUIA 3A8IE 3KJPA 2V4DA 3VR4A 1IXRA 1U4MA 1C7YA 3NP8A 2Q2IA 3KUPA 1X54A 4DU9A 5EKKA 1BBXC 2LXJA 2AMCB 4QQBX 2B2YC 5JJLA 3C3LA 3NELA 2Z6BA 3D0FA 3TDQA 3PUWA 4A3CG 4FF1A 2KBNA 5JJIA 3TS0A 1Z9FA 4JK1C 2F0JA 3TEHB 1PTOF 3S1QB 3X3NA 3PQIA 5FJ8G 4DNRB 2UUAQ 4UP8A 4K2LA 4A3EH 4DV2Q 3H09A 4BXXH 5M5WB 4B3ML 3H3VH 4J1MA 1DOMA 4IFDG 1VQDA 2AKWB 3S17B 1WTWA 2R3ZA 3SGIA 1SMYD 5FK9C 2FHTA 4LMQD 3KFUA 4XYOA 3NWSA 4IUQA 3LNNA 1EIYB 3OMGA 1QVGA 4LUVA 4DUYL 4GN3B 4B3RL 2NN6G 1BBUA 3PO3B 3RZDH 3SK5A 4HSVA 2A69D 1SNCA 1MHWC 3S16H 1V1OA 1AW7A 1AP0A 1XMQL 3A5ZB 2NVTB 3Q24A 3CRLC 3HOVG 2Z9HA 4ME5A 1SE4A 1SEBD 2EIFA 3IKJA 4A3JH 4A3GH 1KXLA 1SMYC 4IURA 1WTPA 5DM73 3L9AX 1XJVA 1JE5A 1TT2A 2DGYA 4X3SA 2VQFQ 1H9SA 4LF4L 3I4LA 3KBGA 3VR6A 4ALPA 5GAGC 3WDNA 1HR0L 1WTVA 3AQQA 4Q5VA 3QWNA 1EYDA 3X3MA 5G3LF 2H4OA 4KY5A 5CV7A 5M3FB 3I4MG 1XPOA 3R2IA 1Q7YC 1O7IA 4Q0FA 1SSOA 1VQFA 4AQYQ 1MJCA 1PRTF 1X6OA 1V1PA 4IALA 4DV3Q 2JN4A 4A3KH 3CQZH 3H91A 2L9HA 3GP7A 4B9WA 2IL8A 3MXNB 4RHSA 4XT1B 2JA8H 1PLFA 3K5LA 3EROA 3U9OA 1VF7A 1OTCA 4GLAC 2A73B 2Z4IA 2CCZA 1Y1WG 4LUOA 3E9IA 3IFDA 3VYRA 3W5OA 1BVSA 1KRTA 4ZK9B 2D2CC 3W2DA 3I90A 4B08A 3FKIG 3J80E 1KL9A 5ELEA 2B63H 1SYCA 4PV1C 4EGVA 1N32L 4EQ5A 3PUZA 1W3SA 1YZ6A 1LT4D 1SN8A 2F3IA 1UAPA 3K59A 1P8LA 1PTOD 3A54A 5KRUA 1IKLA 3J81c 1FYCA 1SJHD 5I2XA 2JA6B 2E2HH 2CKZB 2MQHA 3MXUA 2CQOA 4ZRZA 4OX9L 3L7ZC 4E6IA 3PGZA 5LMNL 1LTID 1NAPA 5COYA 3J80i 1A3UA 1IYJB 4DXGA 1IBKQ 3CAMA 1CKOA 2OT2A 1Q46A 4IUVA 3BG3A 3MAQA 4DR4Q 4WJ4A 3F2UA 1PH9A 2DJFC 1PTOC 2WACA 5IT9L 4LF7Q 3Q22A 2WKDA 3MFGA 5GADC 2ASBA 4EQPA 1SDFA 2XWBB 1A63A 1LLRD 3LWEA 4BY7G 1RJTA 5KIXA 1EY5A 1HJPA 5JJZA 2N49A 3I55A 3SE0A 5IODA 5CBAE 2A8VA 1YNJD 2Q2HA 4P2CB 4DK1A 4DR3Q 1ILPA 2HD3A 1FNVA 4GOPB 4A3BG 1J6QA 1QG7A 3A55A 1D5MC 4K6LA 3K57A 5G3LD 3RR5A 1ET6A 3PIPA 3R93A 3CCLA 2A68C 4JV5L 2VUMB 2VQEL 2F0GA 1CT1D 1VQNA 1T5EA 1VQ8A 4FXKC 2EYJA 3GV3A 4IN3A 2CQAA 1VS0A 1PRTD 1F2LA 1JOKA 4KY7A 5M3MG 1G6ZA 3LX0A 4IPHA 4PZ6A 3MA2B 4R4IA 4RMFA 1JJCB 1K0RA 3GTQB 1AE3A 5IYCH 4C1NI 5IGBA 2B2WC 4GNXB 3CCEA 1F9SA 4KV6A 1C48A 5LHY1 1QB5D 4DKAC 1LTBD 3NTKA 4O0AA 4PMBA 3CCJA 4DV7L 2EYOA 4OWTB 2F0QA 4DV1L 1H9KA 1TWHB 2K32A 1TWFB 4AYBG 4YIJA 1TY2A 1VQ9A 1J5EQ 2F0SA 2R92H 1PFMA 1ICFB 2MGSA 3NBHB 5GAHC 4A93H 4B3SL 1A3TA 5FLXL 2X6LA 2C9OA 5HGQA 4O1NA 2E5LL 1IBLQ 5IYDG 3OW7A 4HJ7A 4BBRG 2LSSA 2MHVA 4GN4B 1WFQA 1R9TH 3P75A 4KKUA 3S2HH 4YHHQ 1CTMA 3NSWA 1N8RC 3FVQA 3P7JA 3HOYG 3GTLH 3BDLA 2F0MA 2IX1A 1V8QA 5C4XG 1RTNA 4H02A 1X3EA 4APVA 1KDAA 3UDFA 4CHTB 3RN2A 3R2TA 1EYGA 3W3AA 3ULJA 2B2TA 3OW2A 4JBMA 1LTTD 1AN8A 1PFNA 3Q0AA 1N9WA 5EKLA 3OIQA 4RG1A 2GN5A 2Y0SG 1BNZA 1O7LA 1RODA 1Q3LA 4JBWA 3PUXA 1I4XA 1G291 2B8FA 2R7ZH 2CWPA 1TVXA 3KJOA 1GVPA 1N33Q 1WCMH 4ULLA 3TREA 2E2JH 1F9PA 1ASZA 1PTOH 3CCRA 3I8ZA 2UUBL 5AJ3L 3J81j 3UE0A 2MO0A 4C3HH 1O7ZA 3KDFA 1E2VA 4JI5Q 1LYLA 4ZCKA 4IQZA 2BA0A 5C3XA 3SXHA 2KHSA 3A8KE 1GHKA 2IT1A 2QEXA 4OIKA 1G51A 3OMCA 4JI1Q 2BH8A 1OXTA 3HKZG 3S1NB 2QKIC 4A3IG 5ISRA 5IWAL 1ASYA 3BVMA 5JEAH 4LFCL 2SOBA 1SYBA 1VF5C 4A3LH 3EQLC 1NR2A 3B6YA 4PMWA 4B3TL 1D6EC 4A3DG 3EJIA 1KAAA 1ESFA 4UPAA 4LJZC 2UUCL 4JI3Q 2BA1A 1I3QB 2X69A 3K80C 4FDBA 4DA2A 4DN4M 1TS2A 4PZ8A 2DUDA 4LF8L 4RGNA 1JB7A 1TY0A 3HOUH 2F4VQ 1SYGA 4DR2L 3DM3A 4CKEA 5C3EG 1WTRA 1C4QA 1X32A 3Q8DA 2G5DA 1VQPA 4RA8A 4A3MH 2DJGC 3AEVA 2WIIB 3V05A 1PYBA 1S5BD 3RZOB 4DPGA 4CJ2C 1K83B 4GZYC 5IP9G 5FKAC 1N34L 1Q8IA 2JYOA 2WAQG 4G57A 4OONA 5DLQE 3K7UC 1Z7TA 3NK9A 4X3UA 4GN5A 4GLXA 2JA7H 1DXMA 2F4IA 2DNEA 2XWJB 4DR1Q 1EUJA 4J15A 2Q2TA 4UP9A 5CGKA 3I4NG 3C1EA 1M4VA 1D1KA 1KDBA 3PV0A 5M5XB 1U5KA 4C3IB 2IWHA 4ZKCB 1PH6A 1RF2D 3T56B 1BCPB 2LXKA 3CCSA 3H3VI 2K03A 3S1QH 3MC0B 3A0JA 4JI6L 5C44B 4DV4Q 2UXDQ 3KLSA 4XIGS 3PO2B 1F9QA 5M5WH 3VA5A 3HOXG 3L2PA 3D4WA 5CBEE 3S17H 1PV4A 1V43A 1K8AC 4GOPC 1EZ8A 5M5YH 5HURA 2KCMA 4DV5L 2RHSB 1NCVA 1XWEA 5IT9c 1S3OA 3JAME 3PO3H 1KC8C 3O13A 1X65A 4WORA 5IP7G 2ZJPA 4H7BA 1EQVA 4ZUJA 4P71A 2KENA 2NVTH 2RCNA 4LF6Q 1EIHA 1VQOA 4BBSB 1SNOA 3K6OA 4ODGA 1HZAA 2EYHA 3PIP3 3FEWX 1TWCB 4GKJQ 3M85A 4GNXC 1SR3A 1G8ZD 4KHPQ 4YY3Q 1Q8KA 1DGSA 2TSSA 3M4OB 1XTCD 3GTPB 4OO1H 1LACA 2DY7A 5LL6X 5M3FH 1IZ6A 3HOWB 3H3VC 1BO0A 2B2YA 2EJGC 1KHIA 2PQEA 4C3JB 1Q90A 5LMUQ 2PW5A 1JWSD 3E9HA 1HA5A 1FGUA 3CW2C 5ELFA 5C5LA 4OHJA 3NUCA 2RSOA 4JPBW 3K5OA 2G9DA 4FNFA 3TRZA 3GTKB 5BR8Q 1R4PB 3U4ZA 2UU9Q 3G4SA 3ND9A 3BU2A 2EXZA 3F2CA 3I7FA 3M3YB 4DF7A 3H0GG 2HDMA 4X62L 3KLSX 2MFIA 2UXBL 1HTLD 1DCZA 1MI2A 1IW7D 1QUQA 5FLXc 1SFOB 3ND8A 3PIOA 1TKWB 2Z4HA 1HNWQ 3T16A 3GDEA 4QL5A 2JA6H 1Q86C 2OWOA 5E3FA 2F0HA 1LTSD 1Y1VG 3IFTA 1Z6HA 3OYYA 3WOFA 4EX5A 5E4XA 3NEMA 4FF2A 1SE2A 3KF8A 1PHJA 5IYBH 3OTOQ 5BN5A 2R6GA 3J81E 1IHZA 4IPCA 1IW7C 3OIPA 4LF9L 4HN7A 2A74C 3A56A 1I94L 3QB3A 1M1KC 1FR3A 1SYFA 4NPSA 5EAYA 2I07B 2MP1A 2Z6KA 1MIUA 1A15A 2Z8LA 5DEHA 3V2TA 5I2YA 1MKHA 1QVCA 1RKNA 2HHHL 1HNZQ 5A35A 2AHOB 2B2VA 4DR5Q 1HQMC 1D7QA 3C2PA 4FXGC 2D0OA 4WFN3 4JYAL 1SJED 4IUNA 4KHVA 3J81i 2V1CC 3STBC 1EQTA 3K0XA 3T4AC 3K5NA 2VUMH 1SBBB 2HUGA 2ZXOA 3A5UA 1PXUA 4OIJA 1XXGA 4GKKL 2CFMA 5IIFA 5K36H 2Q2UA 2BDOA 3OWFA 4QIWB 4WJ3M 4Y52H 4FYDA 3J7A5 2B39A 5IGEA 2EOTA 3FPPA 1I50B 3ERSX 3MWYW 1O78A 2RCFA 5L37A 3GTQH 4I65A 1JE4A 2RA4A 3SHLA 5IGGA 1W6JA 2LKVA 4A3EG 4QGUA 3A8JE 4DK3C 3TP5A 4BXXG 5J22A 1TR5A 1G91A 4IZ8A 1PDQA 4X65Q 5ELNA 2B2UC 5EJWA 4F88A 1TWHH 1WI5A 2MO1A 1TWFH 4OEMB 4NB3A 1X55A 2WB1B 3CPWA 1DZ1A 3CC7A 3T1HL 1FJGL 3G7LA 5E1FA 3M7GA 4TQUS 2LFNA 3K0YA 5ELOA 2UXCQ 3ULLA 1JCKB 2TMPA 3ULPA 1WTOA 1RD9D 1UE1A 1L1OB 4YWMA 2H5XA 3K7AB 1A8VA 2K7VA 2K14A 2NBFA 1OXXK 2AQ3B 4NXNQ 4A3JG 1VDZA 4YWKA 4A3GG 1CK1A 2JSOA 4GLVB 3CRKC 4YCVA 1E7ZA 1I4QA 4KY6A 5IGDA 2E2IB 2JA5B 4HTHA 4DAYA 3KYHC 4HR7B 2KCCA 4FF3A 2YU9B 2EYMA 4HIDA 2Z0SA 1TS3A 4X64Q 2J7ZA 2YTYA 1BUVT 4LF5L 5I4DA 3ONAB 3W1BA 2PYKA 1SMXA 1YJ9A 1KD1C 3K58A 1CKNB 2XIWA 2Z6KC 1TWAB 4DR7Q 1IYVA 1UNSA 4A3KG 2B2WA 5CV5A 3A74A 4LFBL 1CSQA 2F0TA 2L0CA 3D4DA 2YTVA 3DXJC 4TVAB 1GD7A 3BZKA 1XPUA 2JA8G 2B2VC 4N9PA 1JORA 2D9UA 1CI3M 2QDLA 2BDNA 2R93B 1I5FA 4HCEA 3RLOA 3VYSA 2VB3X 2M00A 4EQNA 1IBMQ 5CV9A 3GTJB 2CWAA 1BF4A 2NVYB 3KF6A
chains in the Genus database with same CATH topology
2E76C 2AWOA 1G2TA 3PUVA 2KEEA 4X3KA 4A3FB 1EYAA 5KNCA 1D1IA 2XSCA 1MGSA 3E0JA 1CA5A 1BXTA 1D5ZC 2IX0A 2YYZA 1KDCA 3H0GB 1EEFD 4NDXA 1YNND 3VA7A 1F2ZA 1CZGA 1CFMA 3S1MB 1VMPA 4KN4C 1EFID 1L0YB 1I4GA 5EBDA 3PMFA 4DXFA 1JQYD 2G9HD 2A68D 1GJXA 1D5XC 5CYUA 2M9VA 1YNNC 1XX8A 2K04A 4PMCA 2RSNA 3HGBA 3P1HA 3TZDA 3MHBA 3T51B 4M1UB 4R9WA 1II3A 3HP3A 5FO8B 3TN2A 3DMUA 1PMRA 3QOJA 2RBMA 1B50A 2WV6D 1Y8PB 1NR4A 4IUPA 4BY1B 1SE3A 1CQFA 3BVGA 2L1BA 2ZXPA 3S14B 3DEOA 3N52A 4RKBA 2KOLA 3UI2A 4K14A 3TP7A 2F0EA 3IL8A 3TP8A 1U9RA 4RAUC 5J39A 2A5HA 3SVMA 3OOCA 2NZ1D 1HHVA 5D3DA 1ILQA 4V190 5C4ZA 3NTHA 1EYCA 3P20A 2HDLA 3KK7A 2B8GA 2EE1A 2EYPA 2E74C 1HTPA 5A2QL 3GTMB 4BA1I 4CGYB 3NQIA 5IT9E 4FO2A 1MSGA 4OO1I 1C8CA 2R61A 2ZT9C 3I70A 4CKBA 3HOVB 1OXUA 5EPLA 3I73A 2EVBA 1ML0D 1EU3A 3HEJA 2K5WA 3S2DB 1F2MA 1RHPA 5CORA 2L55A 4C3HG 1B44D 1W6KA 3I4MB 5JVH3 3NHHA 1OXSC 1SAPA 3MZ5A 4PNYA 2F0FA 4XQNA 4IUUA 5TSSA 2LMCB 3TSSA 5CV6A 1TS5A 1JWUD 1DD2A 1L0XB 5T1GA 3H6MA 5C0XH 1B2TA 2E2DC 5JEAG 4G7HC 1ZXTA 4DNTB 1Y1WB 4C56C 4TRDA 3FKIB 3MXPA 3ERQA 3KBXA 2Q8TA 5M9OA 4RCOA 4L6TB 2OF1A 3MFYA 5FLXE 4J6HA 2AQ2B 4XQQA 1HCZA 1BR9A 1EY7A 2Q8RE 4XDXA 1KNAA 1JWMD 4KD3A 3OWEB 4KMUC 4KI0A 3GD7A 5ELCA 4TSSA 5T1IA 2EY5A 1X3PA 3E5SA 5LL6S 1B3AA 5AFWA 4BY7B 1LT5D 3SR1A 1A2UA 2F0IA 2X6GA 2EJMA 1STNA 3RUZA 4BWGB 1EU4A 4N9TA 5BN4A 4G7OC 3N6RA 1O80A 1PYWD 2PO4A 1QNUA 4ABNA 4A3BB 1WTQA 5I9OA 2K33A 2EDGA 1ENFA 1MSHA 1TQOA 3ITPA 3DWAA 3NPPA 3NQTA 1AZPA 1HRJA 1BDOA 1DYQA 1GOZA 1AFPA 5DM63 3GV6A 4RFBA 5M3MB 1Y8OB 2K5QA 1NUCA 1M8AA 1NSNS 1Y8NB 3T53B 2RVLA 2JEAI 2PNRC 4KTAA 4ZAIA 5I9PA 4K8JA 4R8IA 3QO2A 4AYBB 3A7LA 4UAIA 5EPKA 3D4RA 1KNEA 3TMEA 1XYIA 3URYA 1VCIA 2RDHA 1SYEA 1X3QA 1CA6A 4BBRB 3BYYB 3LWUA 2CHBD 2JE6I 3EVQA 3HOYB 3D3RA 1FD7D 4OO1G 2EJFC 4LAAA 4QB4A 5C4XB 5D3IB 2K5DA 2F0KA 1DONA 2D62A 2SDFA 2XNAC 1HA6A 2K05A 4CJ1B 1J9OA 2FINB 1OXVA 2Y0SB 1S5FD 1EL0A 2AQ1B 1LTRD 2B2UA 4MN3A 1WD0A 3GTOB 1SXTA 2EY6A 1B4OA 1HFGA 3E6ZX 3HS0C 3S15B 1PTOB 1STEA 4BA2I 4DFAA 1T5XD 1E0BA 2CVRA 3I72A 2L12A 4KHZA 1A6XA 3MTSA 1A3VA 1I6VC 1H9JA 2WINB 5I6WA 1SNPA 1GXDC 1PZKD 1BCPF 3U9SA 3GTGB 2MJ8A 4X3TA 3HKZB 1QCBD 5C0XJ 4NKLA 4A3IB 1H9SB 3C1FA 1BOSA 2KQ3A 3AB9A 5JOBA 4RKLA 4A3DB 4R8NA 1Q1EA 3DWQA 4QF4A 2PMZB 2NTSA 4WJWA 1D2BA 2WP8J 2O5JC 2K1BA 1V1PB 1BQQT 1KLGD 3BDCA 2HCCA 2RDGA 1EIGA 5C3EB 1PRTB 4K2KA 4QUFA 4RCNA 1H9MA 2QDBA 1QILA 5K36G 2L4NA 3VYTA 3S1RB 3Q6SA 2F0VA 1EOTA 4EVOA 3CU7A 3J7AV 5NUCA 2QCPX 3L3OC 3ZYYX 3Q23A 1B9MA 2WAQB 3MEHA 1SYDA 4L63B 2FJ2A 1FNUA 2JA7B 4H44C 1K8MA 3J80L 4B9XA 4BS9A 4RGMA 5KGUA 4HMJA 3TZUA 2SNMA 1MD2D 3EA6A 2NVXB 1O7YA 2XRSD 4DGZA 4ILWA 3I4NB 3VR5A 1KTKA 1WD1A 5C6AA 2IX3A 2F0DA 2AUJD 2L5TA 2FMMA 1BCPD 4KJNA 3KLRA 3HOXB 4IFDH 5JVG3 4C2MB 4FP5D 2E75C 5M5YB 3OSOA 1MBYA 2ID0A 2F0OA 2GA4B 1E2ZA 3D8GA 3G6JB 2F0PA 3M7NA 1DOLA 1STAA 2NN6H 5D65A 5DAUA 3D6WA 4HEDA 3HG9A 2K6AA 1BCPC 3DWPA 3FPUB 1SNMA 5J1ZA 1AZQA 2EYFA 5FO7B 1HFNA 1IKMA 1TWGB 2F0WA 2KJXA 4F7XA 1WVLA 5CC4A 2A69C 2NVQB 5DNFA 1U4PA 4KK7A 4DAVA 1ZEQX 1HPCA 3D31A 1EY4A 1IYUA 1B1ZA 1LV9A 2L11A 1EWHA 5C0XI 2RQXA 1PZJD 5EKIA 2F3VA 2ZXRA 4KJOA 5CV8A 5EQ0A 2Q8IB 1CZWA 3SK4A 3TP6A 2OEOA 1QJOA 4XT3B 1I6HB 2A6HD 2MUYA 3HZXA 2K01A 1S4ZA 2QILA 2RDFA 4ZKBB 4RH6A 2AWNA 4FXDA 4K5WA 3TBIB 3AMUA 2VB2X 4F8MA 2F03A 1Y1VB 2EPBA 2D5DA 4F87A 1EY9A 1SNDA 2A6HC 1H9RA 1F2YA 1TIID 3I3CA 4KD4A 5K5PA 4EQOA 4IUTA 4ID6A 2XN9C 4OGQC 1HUNA 2O2LD 1Q12A 2ICIA 2VXWA 4Y7NB 2JXMB 2KVMA 4J8QA 5KYLA 5JAVA 2NYZD 3BDOA 2RKSA 4U68A 3PIO3 4C3IG 2SNSA 2N88A 1F9RA 2KA7A 4I7ZC 1YNJC 5KNDA 4HAEA 2QF7A 4U673 5F2DA 5EPJA 1J8IA 2K28A 3I91A 5JPMC 3PUYA 2EYLA 2LY7A 4CJ0B 2QEJC 1I4HA 1EWCA 4KN7C 2BOSA 3GO5A 1STYA 1RDPD 3MXNA 1PFBA 2JEBI 4A3EB 1A2TA 3MVVA 4FF4A 1HUMA 1G2SA 1ONLA 1PRTC 2F0LA 1Y69U 1VMCA 1HQRD 2NB0A 4NW2A 4S3SA 3BYTB 1Z47A 3VR3A 3R3OA 2J4XA 1ZYRD 3RZDB 3BVZA 1JR0D 1PZID 2KECA 2SEBD 3DEPA 3OHXC 3S16B 5IOCA 1QWYA 2H1EA 1E2WA 4V0BA 2F1MA 4A3JB 4A3GB 4IFDJ 1Q1BA 3HRZC 2FMCA 2C5CA 3NTIA 2I46A 2AUKA 3V96A 1GHJA 4C3JG 1CHQD 1ZYRC 3BS1A 5CR3A 1QNKA 1TS4A 4ZLTF 2F3WA 1FGBD 1B53A 4CKCA 4DK0A 4OL7A 4XYQA 2NUCA 4M8AA 1CM9A 3DUZA 4HCSA 1UUPA 1GUOA 2NTTA 3T13A 1JB3A 4A3KB 3CQZB 3GQBA 4UDUC 2JA8B 3NXWA 5C0XG 1WTXA 4G7ZC 1STGA 3M4YA 2BE5D 5C3WA 2PPBC 1DOKA 3SEBA 5IGFA 3C46A 1DJRD 1FNWA 2OXPA 2B63B 2F0UA 5ELBA 1TU2B 4RGTA 2HQEA 2A6ED 1S5DD 2BE5C 4ZYSA 2E2HB 3JAML 1QE6A 1IL8A 2IPKD 2XVSA 4RGOS 2DY8A 5E4WC 4K5VA 4K5XA 5I6YA 4H0LC 1S5ED 1GUSA 5EBCA 2MPMA 3A7AB 2O5IC 1EY6A 1GUNA 2IW3A 4HSPA 1CQVA 3NBHA 4QCLA 2A6EC 2IJ0A 3BZDB 1DM0B 1JICA 4MHEA 5A2QE 4XTCS 2WKCA 3FMCA 3NWTA 1HXYD 1JC7A 1ICWA 5C4HA 1JOQA 3QOLA 2EY2A 5D14A 4NMZA 2KEDA 1GUGA 3NE5B 4H13C 5IGCA 1KLUD 3IAYA 1GUTA 1ENCA 2FFKB 5JPNC 2B2TC 3VYUA 3RLFA 1F77A 1OO9B 2EZVA 1GUWA 4O42A 2F0NA 2JP1A 2PCFB 1STBA 1EEID 5CV4A 3EFXD 2XRQD 1CHPD 4CBVA 4FVMA 3H94A 3QJYA 3WOEA 5FO9B 4KKSA 3NBIA 4IFDI 1UEAB 1QOHA 1RTOA 2R92B 4XXEA 3OPOA 2KUMA 4A93B 1LABA 1LTAD 3SK6A 1R4QB 4QUCA 1U4RA 2O4XA 3J81L 1EY0A 2PZUA 2NN6I 3FDTA 4K6DA 4L8JA 1KABA 5KYIA 2ENBA 1R9TB 3S2HB 1B9NA 3GTLB 5HGTA 2CW0D 4NP5A 1LO5D 3D6CA 3CKIB 2Z1CA 5C5MA 2VNUD 1LT3D 4ZQ3A 3FRPB 5KNBA 1I4RA 4Z9CB 1STHA 2BCOA 4RHRA 5CMDA 1U4LA 2ICEC 3DHQA 1EZ6A 2DN8A 4KKTA 2CW0C 1I4PA 3CHBD 3R8BA 2R7ZB 4DAPA 3K5MA 3QIAA 1WCMB 2DNCA 2E2JB 4C1NK 4K8IA 4C3HB 2PZWA 2N55A 3RD4A 2KCNA 2NWGA 2HCIA 1ET9A 5C4JB 3SK8A 4PQXA 3MXGA 4TKOB 1ESRA 5KEEA 1LTGD 4LK1C 4HMIA 1ENAA 2PZTA 3HOZB 2M2LA 3RMHA 5BN3A 3S9WA 2EY1A 4G4KA 3J7YW 1EY8A 2PW7A 3VR2A 3J7AF 1AEXA 1JOOA 1ZKOA 5JEAJ 1K8OA 3HOUB 4QMGA 4MIUA 3SDZA 4RWSC 5EGTA 1LT6D 3DM1A 4WRDA 2LS01 5FOBB 1S5CD 3AU7A 4XQJA 4A3MB 2J0TD 5ELDA 3QG1A 1RCVD 1SNQA 4ZUIA 3A8IE 2V4DA 3VR4A 1U4MA 3NP8A 3KUPA 4DU9A 5EKKA 1BBXC 2B2YC 3C3LA 3TDQA 3PUWA 4FF1A 4JK1C 2F0JA 1PTOF 3S1QB 3X3NA 4DNRB 4K2LA 3H09A 5M5WB 4J1MA 1DOMA 4IFDG 3S17B 1WTWA 2R3ZA 1SMYD 5FK9C 2FHTA 4LMQD 4XYOA 3NWSA 4IUQA 3LNNA 3OMGA 2NN6G 3PO3B 3SK5A 4HSVA 2A69D 1SNCA 1V1OA 1AW7A 1AP0A 2NVTB 3Q24A 3CRLC 4ME5A 1SE4A 1SEBD 3IKJA 1SMYC 4IURA 1WTPA 5DM73 3L9AX 1TT2A 4X3SA 1H9SA 3I4LA 3VR6A 3KBGA 3WDNA 1WTVA 4Q5VA 3QWNA 1EYDA 3X3MA 5G3LF 2H4OA 4KY5A 5CV7A 5M3FB 3R2IA 4Q0FA 1SSOA 1PRTF 1V1PA 4IALA 3H91A 2L9HA 3GP7A 4B9WA 4XT1B 2IL8A 4RHSA 1PLFA 3K5LA 3EROA 3U9OA 1VF7A 2A73B 2Z4IA 3VYRA 3IFDA 4ZK9B 2D2CC 3W2DA 3I90A 4B08A 3J80E 5ELEA 1SYCA 4PV1C 4EGVA 3PUZA 1LT4D 1UAPA 3K59A 1PTOD 3A54A 5KRUA 1IKLA 1FYCA 1SJHD 5I2XA 2JA6B 3MXUA 4ZRZA 3L7ZC 4E6IA 1LTID 1NAPA 5COYA 1A3UA 4DXGA 2OT2A 4IUVA 3BG3A 3MAQA 3F2UA 1PTOC 2WACA 5IT9L 3Q22A 2WKDA 3MFGA 4EQPA 1SDFA 2XWBB 1LLRD 3LWEA 1RJTA 5KIXA 1EY5A 5JJZA 3SE0A 5IODA 5CBAE 1YNJD 4P2CB 4DK1A 1ILPA 1FNVA 1QG7A 3A55A 1D5MC 4K6LA 3K57A 5G3LD 1ET6A 3R93A 2A68C 2VUMB 2F0GA 1CT1D 1T5EA 4FXKC 2EYJA 3GV3A 4IN3A 2CQAA 1PRTD 1F2LA 1JOKA 4KY7A 1G6ZA 3LX0A 3MA2B 3GTQB 4C1NI 5IGBA 2B2WC 1F9SA 4KV6A 1C48A 5LHY1 1QB5D 1LTBD 3NTKA 4PMBA 2EYOA 2F0QA 1H9KA 1TWHB 2K32A 1TWFB 4YIJA 1TY2A 2F0SA 1PFMA 2MGSA 1A3TA 5FLXL 2X6LA 2C9OA 4O1NA 3OW7A 2MHVA 3P75A 4KKUA 1CTMA 3NSWA 3FVQA 3P7JA 3BDLA 2F0MA 2IX1A 1V8QA 1RTNA 1KDAA 4CHTB 3R2TA 3W3AA 2B2TA 1LTTD 1AN8A 1PFNA 3Q0AA 5EKLA 3OIQA 1BNZA 1O7LA 1RODA 1Q3LA 4JBWA 3PUXA 1I4XA 1G291 2B8FA 1TVXA 4ULLA 1F9PA 1PTOH 3I8ZA 1O7ZA 1E2VA 4IQZA 2BA0A 5C3XA 3SXHA 2KHSA 3A8KE 1GHKA 2IT1A 4OIKA 3OMCA 1OXTA 3S1NB 2QKIC 5ISRA 3BVMA 5JEAH 2SOBA 1SYBA 1VF5C 3EQLC 1NR2A 4PMWA 1D6EC 3EJIA 1KAAA 1ESFA 4LJZC 2BA1A 1I3QB 2X69A 4DN4M 4DA2A 1TS2A 4RGNA 1TY0A 1SYGA 4CKEA 1WTRA 1C4QA 1X32A 4RA8A 2WIIB 3V05A 1S5BD 3RZOB 4CJ2C 1K83B 4GZYC 5FKAC 1Q8IA 2JYOA 4G57A 1Z7TA 3NK9A 4X3UA 1DXMA 2F4IA 2DNEA 2XWJB 5CGKA 3C1EA 1M4VA 1D1KA 1KDBA 3PV0A 5M5XB 4C3IB 2IWHA 4ZKCB 1RF2D 3T56B 1BCPB 2K03A 3MC0B 5C44B 3KLSA 4XIGS 3PO2B 1F9QA 3VA5A 3D4WA 5CBEE 1V43A 1EZ8A 5HURA 1NCVA 1XWEA 3JAME 3O13A 4WORA 4H7BA 1EQVA 4ZUJA 1EIHA 4BBSB 1SNOA 3K6OA 4ODGA 2EYHA 3PIP3 3FEWX 1TWCB 3M85A 1G8ZD 2TSSA 3M4OB 1XTCD 3GTPB 4OO1H 1LACA 2DY7A 5LL6X 3HOWB 3H3VC 1BO0A 2B2YA 2EJGC 2PQEA 4C3JB 1Q90A 2PW5A 1JWSD 1HA5A 5ELFA 5C5LA 4OHJA 3NUCA 2RSOA 3K5OA 2G9DA 4FNFA 3GTKB 1R4PB 3ND9A 2EXZA 3M3YB 4DF7A 2HDMA 3KLSX 1HTLD 1DCZA 1MI2A 1IW7D 1SFOB 3ND8A 1TKWB 2Z4HA 3T16A 5E3FA 2F0HA 1LTSD 3IFTA 1Z6HA 3WOFA 5E4XA 4FF2A 1SE2A 3KF8A 5BN5A 2R6GA 3J81E 1IHZA 1IW7C 3OIPA 4HN7A 2A74C 3A56A 3QB3A 1FR3A 1SYFA 2I07B 2MP1A 1A15A 2Z8LA 5DEHA 3V2TA 5I2YA 1RKNA 5A35A 2B2VA 1HQMC 3C2PA 4FXGC 4WFN3 1SJED 4IUNA 4KHVA 1EQTA 3T4AC 3K5NA 1SBBB 2HUGA 2ZXOA 1PXUA 4OIJA 1XXGA 5IIFA 5K36H 2BDOA 3OWFA 4QIWB 4FYDA 2B39A 5IGEA 2EOTA 3FPPA 1I50B 3MWYW 1O78A 4I65A 1JE4A 2RA4A 3SHLA 5IGGA 1W6JA 2LKVA 3A8JE 3TP5A 5J22A 1TR5A 1G91A 4IZ8A 1PDQA 2B2UC 5EJWA 4F88A 2WB1B 1DZ1A 3G7LA 5E1FA 3M7GA 4TQUS 2LFNA 3K0YA 1JCKB 2TMPA 1WTOA 1RD9D 3K7AB 2K7VA 2NBFA 1OXXK 2AQ3B 1VDZA 1CK1A 2JSOA 3CRKC 4KY6A 1I4QA 5IGDA 2E2IB 2JA5B 4HTHA 4DAYA 4HR7B 2KCCA 4FF3A 2YU9B 2EYMA 1TS3A 2J7ZA 1BUVT 5I4DA 3ONAB 2PYKA 3K58A 2XIWA 1TWAB 1IYVA 1UNSA 2B2WA 5CV5A 3D4DA 2F0TA 2L0CA 3DXJC 2B2VC 4N9PA 1JORA 2D9UA 1CI3M 2BDNA 2R93B 4HCEA 3VYSA 2VB3X 2M00A 4EQNA 5CV9A 3GTJB 1BF4A 2NVYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OT2 A;  3VYU A;  2Z1C A;  3VYT A;  3D3R A;  3VYS A;  3VYR A; 
#chains in the Genus database with same CATH topology
 1NMF A;  2E76 C;  2AWO A;  5H1S E;  1G2T A;  3ZJY C;  3PUV A;  1UEB A;  1HNX L;  4LW1 A;  2KEE A;  4IOA A;  4X3K A;  4A3F B;  1EYA A;  1VQK A;  2ZJQ A;  3S1N H;  5KNC A;  3HKZ E;  1D1I A;  2XSC A;  1MGS A;  3E0J A;  2XGT A;  1CA5 A;  1K9M C;  1BXT A;  1D5Z C;  2I5H A;  2IX0 A;  2YYZ A;  1KDC A;  3H0G B;  1EEF D;  3NEN A;  4NDX A;  1YNN D;  2N3S A;  3VA7 A;  1F2Z A;  1CZG A;  1VQJ A;  1CFM A;  4JI4 Q;  4LNQ A;  3S1M B;  1VMP A;  4KN4 C;  1EFI D;  3F8T A;  1I3Q H;  1XMO Q;  1L0Y B;  4X6A H;  3CP0 A;  1I4G A;  5EBD A;  3PMF A;  4DXF A;  4DUZ L;  1JQY D;  2G9H D;  2A68 D;  1GJX A;  1D5X C;  5CYU A;  2GVA A;  2M9V A;  2OTL A;  2JA9 A;  1YNN C;  1XX8 A;  4JI7 Q;  2K04 A;  4PMC A;  2RSN A;  2RF4 A;  3HGB A;  3P1H A;  3TZD A;  3MHB A;  4L5S A;  2FXQ A;  3T51 B;  4M1U B;  4R9W A;  1E1T A;  2C35 B;  1II3 A;  3HP3 A;  2I5M X;  5FO8 B;  3TN2 A;  4QIW E;  3DMU A;  1PMR A;  3QOJ A;  2PNH A;  3RZO H;  2RBM A;  1K83 H;  3BZC A;  1B50 A;  5GAE C;  1UE7 A;  2ZM6 L;  2WV6 D;  1Y8P B;  1CKM A;  4AIM A;  1NR4 A;  2ES2 A;  4IUP A;  4BY1 B;  3PF4 A;  1SE3 A;  4X66 L;  1CQF A;  3K8A A;  5IYC G;  3BVG A;  2L1B A;  2ZXP A;  3S14 B;  2YV5 A;  3DEO A;  3N52 A;  4RKB A;  2WB1 E;  5M5X H;  2KOL A;  1NE3 A;  3UI2 A;  1E24 A;  4C3I H;  4K14 A;  3TP7 A;  1C9O A;  3RNU A;  4B3M Q;  4MZ9 A;  2F0E A;  3IL8 A;  1K0S A;  3TP8 A;  1JMC A;  1U9R A;  3UE1 A;  3RN5 A;  1SRO A;  4RAU C;  2R92 G;  5C44 H;  5J39 A;  2A5H A;  1KRS A;  1FJG Q;  4A93 G;  1P16 A;  3OOC A;  3SVM A;  3PO2 H;  2NZ1 D;  1HHV A;  5D3D A;  1ILQ A;  4V19 0;  4DUY Q;  5C4Z A;  4DV6 L;  4B3R Q;  4YCW A;  3NTH A;  1EYC A;  4K0K L;  1XMQ Q;  3W1G A;  1PYS B;  1SRU A;  3VDY A;  3P20 A;  4QJF A;  2PQA B;  2HDL A;  3KK7 A;  2B8G A;  2EE1 A;  2EYP A;  2E74 C;  1HTP A;  4LF4 Q;  1HR0 Q;  1XNR L;  5A2Q L;  1JJ2 A;  4BBS H;  1XNQ L;  3GTM B;  4BA1 I;  4CGY B;  3NQI A;  5IT9 E;  4FO2 A;  1MSG A;  2VW9 A;  1N36 L;  4MTK A;  3H15 A;  1TWC H;  4OO1 I;  1C8C A;  2R61 A;  2ZT9 C;  3I70 A;  4CKB A;  3HOV B;  2A19 A;  2CH4 W;  1OXU A;  4IO9 A;  5EPL A;  1YHA A;  3I73 A;  2R7Z G;  4HJ8 A;  3HOW H;  4LFB Q;  2EVB A;  1ML0 D;  1WCM G;  4C3J H;  1EU3 A;  4MNO A;  3HEJ A;  2K5W A;  1B8A A;  3S2D B;  1AE2 A;  1F2M A;  1RHP A;  5COR A;  2L55 A;  4C3H G;  1B44 D;  1W6K A;  3I4M B;  1L1O C;  5JVH 3;  3NHH A;  1NY4 A;  1OXS C;  1S72 A;  1SAP A;  1UE5 A;  2IHE A;  3MZ5 A;  4PNY A;  2F0F A;  4NXM L;  5E7N A;  5C4J H;  4OWX B;  4XQN A;  4IUU A;  5TSS A;  3U4V A;  1N32 Q;  3GTK H;  2LMC B;  3L0O A;  1C0A A;  2B29 A;  3TSS A;  4GOP A;  1GM5 A;  5FLM H;  1X9N A;  5CV6 A;  1TS5 A;  1JWU D;  2R7D A;  1DD2 A;  1L0X B;  5T1G A;  3H6M A;  5C0X H;  1B2T A;  2E2D C;  5JEA G;  4G7H C;  3TS2 A;  1ZXT A;  1SFO H;  4DNT B;  1Y1W B;  4OX9 Q;  4C56 C;  3PF5 A;  4TRD A;  3HOZ H;  4HIK A;  5LMN Q;  2B63 G;  4A3L G;  4JI8 L;  3FKI B;  3MXP A;  3ERQ A;  1K3B C;  3KBX A;  2Q8T A;  5M9O A;  3G6E A;  4RCO A;  1EQR A;  4L6T B;  2OF1 A;  4DR6 L;  3MFY A;  5FLX E;  1EFW A;  1PH5 A;  4J6H A;  2AQ2 B;  4XQQ A;  4GNX A;  1HCZ A;  1BR9 A;  1EY7 A;  3KOJ A;  2Q8R E;  4XDX A;  1U0L A;  4I7A A;  1HZC A;  1KNA A;  1JWM D;  3HOU G;  4KD3 A;  3OWE B;  4KMU C;  4KI0 A;  2A1A A;  3GD7 A;  5ELC A;  1WJJ A;  4TSS A;  4A3M G;  5T1I A;  4LFA L;  3ICE A;  4DV0 L;  2EY5 A;  1X3P A;  3E5S A;  5LL6 S;  1B3A A;  2I5L X;  5AFW A;  1QZH A;  3U50 C;  4BY7 B;  1EIF A;  2K50 A;  1LT5 D;  4JV5 Q;  2VQE Q;  3SR1 A;  1A2U A;  4P73 A;  2F0I A;  2X6G A;  2EJM A;  1D8L A;  1STN A;  1EQQ A;  3RUZ A;  4BWG B;  1EU4 A;  4N9T A;  2JA7 G;  5BN4 A;  4G7O C;  5IE8 A;  3N6R A;  2ZTE A;  1O80 A;  1PYW D;  2PO4 A;  2ZTC A;  1QNU A;  4ABN A;  4A3B B;  2PI2 A;  1WTQ A;  5I9O A;  3CMA A;  2K33 A;  5JJK A;  2EDG A;  1ENF A;  1MSH A;  1MJE A;  1TQO A;  1I50 H;  4DV7 Q;  2E8G A;  5IY0 A;  3ITP A;  3DWA A;  3NPP A;  3NQT A;  1AZP A;  4IOC A;  1HRJ A;  1BDO A;  1DYQ A;  3IRB A;  1GOZ A;  4DV1 Q;  3CXC A;  1AFP A;  5DM6 3;  3GV6 A;  4RFB A;  5M3M B;  1Y8O B;  1NNX A;  4JC0 A;  2K5Q A;  1NUC A;  4B3S Q;  1M8A A;  1PA6 A;  3KF8 B;  1NSN S;  4POF A;  2E5L Q;  1Y8N B;  3T53 B;  2RVL A;  2L15 A;  2JEA I;  4R4Q A;  2PNR C;  1YEZ A;  4KTA A;  4ZAI A;  5I9P A;  4K8J A;  3PO3 G;  4R8I A;  3QO2 A;  2ALY B;  3K7A H;  4AYB B;  4JI2 L;  3A7L A;  4UAI A;  5EPK A;  4P72 A;  4DV2 L;  1Q81 C;  4UY8 C;  3D4R A;  1L2F A;  1KNE A;  3TME A;  1XYI A;  3URY A;  2E2I H;  2JA5 H;  1VCI A;  1VQ6 A;  2RDH A;  1SYE A;  1X3Q A;  4HJ5 A;  1CA6 A;  4OEL B;  4BBR B;  1B3Q A;  1W2B A;  2I0Q A;  1PH3 A;  1VQM A;  3BYY B;  3LWU A;  2CHB D;  2JE6 I;  3EVQ A;  3HOY B;  1A0I A;  3D3R A;  1FD7 D;  4OO1 G;  5M3F G;  2EJF C;  4JCV E;  4LAA A;  4QB4 A;  5C4X B;  5D3I B;  1UWV A;  2N8N A;  1HZ9 A;  2K5D A;  2F0K A;  1DON A;  2D62 A;  4GS3 A;  1TWA H;  1VQ5 A;  2UUB Q;  5AJ3 Q;  2SDF A;  2XNA C;  4PZ7 A;  2K05 A;  3FHW A;  1HA6 A;  4CJ1 B;  2VQF L;  2K5H A;  1J9O A;  1TXY A;  2FIN B;  1OXV A;  2Y0S B;  4YWL A;  1BBW A;  1S5F D;  1EL0 A;  2AQ1 B;  1PH1 A;  1RIP A;  1LTR D;  2B2U A;  4MN3 A;  1WD0 A;  4R4T A;  3GTO B;  1SXT A;  2R93 H;  2EY6 A;  1B4O A;  1HFG A;  5HY6 A;  3E6Z X;  3HS0 C;  1NJI C;  3S15 B;  3GTJ H;  1PTO B;  4AQY L;  2NVY H;  1STE A;  4P74 A;  4DV3 L;  2NZO A;  4BA2 I;  5GQO A;  2CH4 A;  5IWA Q;  4DFA A;  1T5X D;  4A75 A;  1VQB A;  4LFC Q;  1E0B A;  2CVR A;  3I72 A;  4A3F H;  2L12 A;  2K4K A;  4IPD A;  4KHZ A;  1A6X A;  2JA6 G;  4L5T A;  3MTS A;  1CUK A;  1A3V A;  1I6V C;  1H9J A;  4R1J A;  4B3T Q;  4N8X 1;  2WIN B;  5I6W A;  1SNP A;  1UE6 A;  1GXD C;  1PZK D;  1BCP F;  3U9S A;  3GTG B;  2UUC Q;  2MJ8 A;  4X3T A;  3U58 A;  5IYB G;  3HKZ B;  1QCB D;  5C0X J;  3F2B A;  4NKL A;  4A3I B;  1H9S B;  1K8G A;  4LF8 Q;  3C1F A;  1BOS A;  2HT1 A;  3STB D;  2KQ3 A;  2OQK A;  4DR2 Q;  3LGJ A;  1HZB A;  3AB9 A;  4N8F A;  5JOB A;  4RKL A;  2P5Z X;  4A3D B;  1Q1E A;  4R8N A;  1K28 A;  3DWQ A;  4QF4 A;  2PMZ B;  1CSP A;  2NTS A;  4WJW A;  1D2B A;  2WP8 J;  2O5J C;  1EWI A;  2K1B A;  1V1P B;  1IBK L;  1M90 C;  4HJA A;  3M9B A;  2VZA A;  1BQQ T;  4DR4 L;  1KLG D;  1N34 Q;  4LF7 L;  3BDC A;  2HCC A;  2RDG A;  1EIG A;  2VUM G;  5C3E B;  1PRT B;  4K2K A;  4QUF A;  4RCN A;  2RHQ B;  1H9M A;  2QDB A;  3I56 A;  1QIL A;  5K36 G;  2L4N A;  3VYT A;  3S1R B;  3Q6S A;  2F0V A;  1EOT A;  4EVO A;  1VQI A;  4OWW B;  3CU7 A;  3J7A V;  4DR3 L;  5NUC A;  1PH4 A;  4BY1 H;  3CCM A;  2QCP X;  3L3O C;  3ZYY X;  3Q23 A;  1B9M A;  3S14 H;  2WAQ B;  3MEH A;  1SYD A;  4L63 B;  1VQ4 A;  1NMG A;  2FJ2 A;  1FNU A;  4JI6 Q;  2JA7 B;  4H44 C;  1K8M A;  3J80 L;  4JI0 L;  4B9X A;  2ZTD A;  4BS9 A;  4IPG A;  4RGM A;  5KGU A;  4HMJ A;  3TZU A;  1YBY A;  1MD2 D;  2SNM A;  3EA6 A;  2NVX B;  1O7Y A;  2XRS D;  4DGZ A;  4ILW A;  4AYB E;  3I4N B;  1QZG A;  3CCQ A;  4DV5 Q;  2GVB A;  3VR5 A;  4A3C H;  1KTK A;  1WD1 A;  5C6A A;  2IHF A;  2IX3 A;  1B70 B;  2F0D A;  4JI2 Q;  2AUJ D;  5FJ8 H;  3JAM c;  3HKS A;  2L5T A;  2FMM A;  1BCP D;  1IL2 A;  4KJN A;  3KLR A;  3HOX B;  4IFD H;  4YCU A;  5JVG 3;  4C2M B;  4FP5 D;  2E75 C;  5M5Y B;  1J5E L;  3OSO A;  1MBY A;  2ID0 A;  2F0O A;  1PH7 A;  2GA4 B;  1GKH A;  1E2Z A;  3D8G A;  3G6J B;  2F0P A;  3M7N A;  1DOL A;  1STA A;  2NN6 H;  5D65 A;  5DAU A;  1IBL L;  3GTM H;  1FVI A;  3D6W A;  4HED A;  3HG9 A;  2K6A A;  1BCP C;  3DWP A;  1T9H A;  1H95 A;  3FPU B;  1SNM A;  5J1Z A;  1AZQ A;  4YHH L;  3HOV H;  3I2Z A;  2EYF A;  1YIJ A;  3G48 A;  2Y0S E;  5FO7 B;  4HJ9 A;  1HFN A;  1IKM A;  1TWG B;  2F0W A;  1YIT A;  4DAM A;  4JBK A;  2KJX A;  4F7X A;  1WVL A;  3UDG A;  5CC4 A;  3EBE A;  2A69 C;  2NVQ B;  5DNF A;  1U4P A;  4KK7 A;  4DAV A;  3S2D H;  1ZEQ X;  4QY7 A;  3I4M H;  1HPC A;  3BJU A;  3D31 A;  1EY4 A;  1IYU A;  2HIV A;  1B1Z A;  1LV9 A;  4X62 Q;  2L11 A;  1EWH A;  2D0P A;  5C0X I;  2UXB Q;  2RQX A;  1N33 L;  1PZJ D;  4P75 A;  5EKI A;  1YHB A;  4AH6 A;  2F3V A;  2ZXR A;  4JOI C;  4KJO A;  5CV8 A;  4MTN A;  5EQ0 A;  2BH2 A;  2Q8I B;  4JI5 L;  1CZW A;  3AFQ A;  3SK4 A;  1Y1W H;  3TP6 A;  2OEO A;  3M4Q A;  2KHJ A;  1QJO A;  4XT3 B;  1I6H B;  2JQO A;  3JC6 6;  3FKI H;  1Q82 C;  2OTJ A;  2A6H D;  2ATW A;  4IJH A;  2MUY A;  3HZX A;  1VQ7 A;  2K01 A;  1S4Z A;  2QIL A;  4JI1 L;  1XTD A;  4LF9 Q;  2PMZ E;  2RDF A;  4ZKB B;  1I94 Q;  4RH6 A;  2AWN A;  1PVO A;  4FXD A;  4K5W A;  2VL6 A;  3TBI B;  3AMU A;  2VB2 X;  4F8M A;  2F03 A;  1Y1V B;  2EPB A;  2EQS A;  2D5D A;  2HHH Q;  4F87 A;  1EY9 A;  1SND A;  1NTG A;  2A6H C;  1H9R A;  1F2Y A;  2K75 A;  1TII D;  4JYA Q;  2NZH A;  4OXP A;  4JW0 A;  3I3C A;  4HIM A;  4KD4 A;  4JI3 L;  5K5P A;  4UHV A;  4IUT A;  4EQO A;  4ID6 A;  2QA4 A;  1L1O A;  2MNA A;  4BY7 H;  3KDF B;  4LUZ A;  3CD6 A;  2XN9 C;  4OGQ C;  2F4V L;  1HUN A;  1E1O A;  4GKK Q;  2QGQ A;  1L0W A;  2WAQ E;  2O2L D;  1Q12 A;  2ICI A;  2VXW A;  3F1Z A;  4Y7N B;  2JXM B;  2KVM A;  4J8Q A;  5KYL A;  5JAV A;  2NYZ D;  4JG2 A;  3BDO A;  4A3B H;  2RKS A;  1YJW A;  4U68 A;  3PIO 3;  4C3I G;  2SNS A;  2N88 A;  4CDD C;  4IJL A;  1F9R A;  4JI0 Q;  2KA7 A;  4I7Z C;  3UDI A;  1YNJ C;  5KND A;  2N78 A;  4HAE A;  2HIX A;  2QF7 A;  4U67 3;  5F2D A;  5C44 G;  3PSI A;  1CKN A;  5EPJ A;  1J8I A;  3PO2 G;  2K28 A;  5M3M H;  3I91 A;  5JPM C;  3T1H Q;  3PUY A;  2EYL A;  4DR1 L;  2LY7 A;  4CJ0 B;  2QEJ C;  1I4H A;  3J7Z C;  1EWC A;  4KN7 C;  2BOS A;  3GO5 A;  1STY A;  1RDP D;  3MXN A;  3UDX A;  1A62 A;  1PFB A;  1YNX A;  1LUZ A;  2JEB I;  2R7F A;  4JBJ A;  2XTI A;  4A3E B;  1A2T A;  3MVV A;  4FF4 A;  2VS1 A;  1HUM A;  1YHQ A;  1G2S A;  1ONL A;  1PRT C;  2F0L A;  1Y69 U;  1VMC A;  1HQR D;  2NB0 A;  2JK8 A;  4DV4 L;  3CC4 A;  2UXD L;  1LM0 A;  4NW2 A;  4S3S A;  4KLK A;  3BYT B;  1Z47 A;  3EN2 A;  4BBS G;  1JJG A;  3VR3 A;  3R3O A;  2J4X A;  1ZYR D;  3RZD B;  3BVZ A;  1JR0 D;  1PZI D;  2KEC A;  2SEB D;  3DEP A;  1PH8 A;  3OHX C;  3S16 B;  5IYD H;  5GRO A;  4BBR H;  1RL2 A;  4LF5 Q;  5IOC A;  1QWY A;  2H1E A;  1E2W A;  4V0B A;  2F1M A;  4A3J B;  4A3G B;  4IFD J;  1Q1B A;  2JJQ A;  3HRZ C;  2FMC A;  3HOY H;  3M4O H;  3HOW G;  1KIX A;  2C5C A;  1E3P A;  3GTP H;  3NTI A;  2I46 A;  5C4X H;  3WWV A;  2AUK A;  3V96 A;  3CF5 A;  4LF6 L;  1GHJ A;  4C3J G;  1CHQ D;  1ZYR C;  3BS1 A;  3AFP A;  3CCV A;  5CR3 A;  1QNK A;  1TS4 A;  4ZLT F;  1PFS A;  2F3W A;  1FGB D;  3CME A;  1B53 A;  4CKC A;  4GKJ L;  4DK0 A;  4OL7 A;  2VY3 A;  4XYQ A;  2NUC A;  4KHP L;  4YY3 L;  4M8A A;  1CM9 A;  2OCE A;  3DUZ A;  4HCS A;  1UUP A;  2KCT A;  1GUO A;  2F52 A;  2NTT A;  3T13 A;  3GTO H;  1JB3 A;  3T1Y L;  4A3K B;  3CQZ B;  3J80 c;  3GQB A;  4R4O A;  5FLM G;  1HNX Q;  3S15 H;  4UDU C;  5LMU L;  3EIV A;  2JA8 B;  3NXW A;  3M3Y H;  5C0X G;  1WTX A;  1EOV A;  4G7Z C;  1KQS A;  1VQG A;  1HH2 P;  1STG A;  3M4Y A;  2BE5 D;  3RLN A;  1YI2 A;  5C3W A;  2PPB C;  1DOK A;  3CCU A;  3SEB A;  3HOZ G;  5IGF A;  2EXD A;  3C46 A;  1DJR D;  4A76 A;  1FNW A;  2OXP A;  2B63 B;  2F0U A;  5BR8 L;  2UU9 L;  5ELB A;  1TU2 B;  3GTG H;  1AH9 A;  4RGT A;  2HQE A;  2A6E D;  1S5D D;  2K5V A;  2BE5 C;  1X3G A;  4ZYS A;  2E2H B;  4A3I H;  3JAM L;  4DUZ Q;  1E22 A;  1QE6 A;  1HNW L;  1IL8 A;  2IPK D;  2XVS A;  4RGO S;  2DY8 A;  2WFW A;  5E4W C;  4K5V A;  4K5X A;  4O2D A;  5I6Y A;  1QVF A;  4H0L C;  1S5E D;  1GUS A;  5EBC A;  2MPM A;  3A7A B;  2O5I C;  4A3D H;  1EY6 A;  1GUN A;  2IW3 A;  2YTX A;  4HSP A;  4POG A;  1CQV A;  3NBH A;  4QCL A;  2A6E C;  2IJ0 A;  2KHI A;  3BZD B;  3OTO L;  1Y14 B;  1DM0 B;  1JIC A;  4MHE A;  5A2Q E;  4XTC S;  2WKC A;  3FMC A;  3NWT A;  1HXY D;  1JC7 A;  1ICW A;  5C4H A;  3I4O A;  1JOQ A;  2B3G A;  3QOL A;  2EY2 A;  5D14 A;  2ZM6 Q;  4NMZ A;  2KED A;  1GUG A;  2K52 A;  5C3E H;  3NE5 B;  2PQA A;  4H13 C;  4ME3 A;  1S40 A;  3F2D A;  5IGC A;  1KLU D;  5J3B A;  1VQC A;  3IAY A;  4CDE C;  4X66 Q;  1PH2 A;  3S1R H;  1GUT A;  1ENC A;  1HNZ L;  2FFK B;  1LTL A;  5JPN C;  4DR5 L;  1G6P A;  3E3X A;  2B2T C;  3VYU A;  1QUQ B;  3RLF A;  1F77 A;  5IP9 H;  2OQ0 A;  4CDF C;  1OO9 B;  1V9P A;  2EZV A;  1GUW A;  4O42 A;  3G71 A;  2F0N A;  2JP1 A;  2PCF B;  1VQE A;  1YJN A;  1STB A;  3CPF A;  1EEI D;  3AYH B;  4DK6 C;  5CV4 A;  3EFX D;  2XRQ D;  2WB1 G;  2IY5 B;  3KLW A;  4DV6 Q;  2NVX H;  1CHP D;  4CBV A;  4L5R C;  3M4P A;  4FVM A;  3I4N H;  4K0K Q;  3H94 A;  4JVZ A;  3QJY A;  3WOE A;  5FO9 B;  4KKS A;  3NBI A;  4IFD I;  1UEA B;  2UUA L;  1QOH A;  1RTO A;  2R92 B;  4XXE A;  3OPO A;  2KUM A;  4A93 B;  1LAB A;  1LTA D;  4X65 L;  3SK6 A;  1R4Q B;  1SE8 A;  4QUC A;  3HOX H;  1U4R A;  2O4X A;  4C2M H;  1XNR Q;  3J81 L;  1KAW A;  4PG3 A;  1K3R A;  1EY0 A;  2JA5 G;  1XNQ Q;  2PZU A;  2NN6 I;  2HQL A;  1N36 Q;  3FDT A;  4K6D A;  4L8J A;  2UXC L;  4LWC A;  3PCO B;  1KAB A;  2PI2 E;  2ENB A;  5KYI A;  1R9T B;  2YU9 H;  3S2H B;  3FP9 A;  1K73 C;  1B9N A;  3GTL B;  3TQY A;  5HGT A;  2CW0 D;  4NP5 A;  1NBW A;  5IP7 H;  1LO5 D;  3D6C A;  1GO3 E;  3CKI B;  2Z1C A;  5C5M A;  4NXN L;  2VNU D;  1LT3 D;  4HIO A;  4ZQ3 A;  3FRP B;  5KNB A;  1I4R A;  4Z9C B;  1TWG H;  1STH A;  2BCO A;  4RHR A;  5CMD A;  1U4L A;  2ICE C;  1B7Y B;  3DHQ A;  1HR0 W;  1WYD A;  4X64 L;  3JAM i;  2NVQ H;  1EZ6 A;  2DN8 A;  4KKT A;  2CW0 C;  1I4P A;  3CHB D;  3R8B A;  4NXM Q;  2R7Z B;  4DAP A;  2R93 G;  3K5M A;  3T1Y Q;  3K81 C;  3QIA A;  1WCM B;  2DNC A;  4DR7 L;  1YVC A;  2E2J B;  4C1N K;  4K8I A;  4C3H B;  4A3F G;  2PZW A;  2N55 A;  3RD4 A;  3E0E A;  2KCN A;  1BKB A;  2NWG A;  2HCI A;  1ET9 A;  4JI8 Q;  5C4J B;  3SK8 A;  4PQX A;  3MXG A;  3DLL A;  4TKO B;  1V1Q A;  1XPR A;  1IBM L;  1ESR A;  1I6H H;  5KEE A;  1LTG D;  4DR6 Q;  3H0G H;  4LK1 C;  1FL0 A;  4DAY B;  4UP7 A;  1VQL A;  4HMI A;  1ENA A;  2PZT A;  4L5Q A;  3QR8 A;  3MEF A;  3HOZ B;  3S1M H;  2M2L A;  1JT8 A;  1WTH A;  3RMH A;  2ZJR A;  5BN3 A;  4DNI A;  3S9W A;  1SLJ A;  2EY1 A;  2K5N A;  3ER0 A;  1Y1V H;  4G4K A;  3J7Y W;  4CDC C;  4LFA Q;  1EY8 A;  5LMN W;  2PW7 A;  4DV0 Q;  3S24 A;  3VR2 A;  3J7A F;  1VQA A;  1AEX A;  4A4I A;  1JOO A;  1ZKO A;  4R4C A;  5JEA J;  4JI4 L;  1K8O A;  1X56 A;  3HOU B;  4QMG A;  4MIU A;  3HFZ B;  1XMO L;  3SDZ A;  4RWS C;  5EGT A;  2QW7 A;  1LT6 D;  3DM1 A;  4WRD A;  2LS0 1;  5FOB B;  1S5C D;  3AU7 A;  4XQJ A;  1X3F A;  4A3M B;  2J0T D;  5ELD A;  3KF6 B;  3QG1 A;  3CC2 A;  4Y7N H;  4JI7 L;  1RCV D;  4BY1 G;  1SNQ A;  1WOC A;  1VQH A;  4JOI A;  4ZUI A;  3A8I E;  3KJP A;  2V4D A;  3VR4 A;  1IXR A;  1U4M A;  1C7Y A;  3NP8 A;  2Q2I A;  3KUP A;  1X54 A;  4DU9 A;  5EKK A;  1BBX C;  2LXJ A;  2AMC B;  4QQB X;  2B2Y C;  5JJL A;  3C3L A;  3NEL A;  2Z6B A;  3D0F A;  3TDQ A;  3PUW A;  4A3C G;  4FF1 A;  2KBN A;  5JJI A;  3TS0 A;  1Z9F A;  4JK1 C;  2F0J A;  3TEH B;  1PTO F;  3S1Q B;  3X3N A;  3PQI A;  5FJ8 G;  4DNR B;  2UUA Q;  4UP8 A;  4K2L A;  4A3E H;  4DV2 Q;  3H09 A;  4BXX H;  5M5W B;  4B3M L;  3H3V H;  4J1M A;  1DOM A;  4IFD G;  1VQD A;  2AKW B;  3S17 B;  1WTW A;  2R3Z A;  3SGI A;  1SMY D;  5FK9 C;  2FHT A;  4LMQ D;  3KFU A;  4XYO A;  3NWS A;  4IUQ A;  3LNN A;  1EIY B;  3OMG A;  1QVG A;  4LUV A;  4DUY L;  4GN3 B;  4B3R L;  2NN6 G;  1BBU A;  3PO3 B;  3RZD H;  3SK5 A;  4HSV A;  2A69 D;  1SNC A;  1MHW C;  3S16 H;  1V1O A;  1AW7 A;  1AP0 A;  1XMQ L;  3A5Z B;  2NVT B;  3Q24 A;  3CRL C;  3HOV G;  2Z9H A;  4ME5 A;  1SE4 A;  1SEB D;  2EIF A;  3IKJ A;  4A3J H;  4A3G H;  1KXL A;  1SMY C;  4IUR A;  1WTP A;  5DM7 3;  3L9A X;  1XJV A;  1JE5 A;  1TT2 A;  2DGY A;  4X3S A;  2VQF Q;  1H9S A;  4LF4 L;  3I4L A;  3KBG A;  3VR6 A;  4ALP A;  5GAG C;  3WDN A;  1HR0 L;  1WTV A;  3AQQ A;  4Q5V A;  3QWN A;  1EYD A;  3X3M A;  5G3L F;  2H4O A;  4KY5 A;  5CV7 A;  5M3F B;  3I4M G;  1XPO A;  3R2I A;  1Q7Y C;  1O7I A;  4Q0F A;  1SSO A;  1VQF A;  4AQY Q;  1MJC A;  1PRT F;  1X6O A;  1V1P A;  4IAL A;  4DV3 Q;  2JN4 A;  4A3K H;  3CQZ H;  3H91 A;  2L9H A;  3GP7 A;  4B9W A;  2IL8 A;  3MXN B;  4RHS A;  4XT1 B;  2JA8 H;  1PLF A;  3K5L A;  3ERO A;  3U9O A;  1VF7 A;  1OTC A;  4GLA C;  2A73 B;  2Z4I A;  2CCZ A;  1Y1W G;  4LUO A;  3E9I A;  3IFD A;  3VYR A;  3W5O A;  1BVS A;  1KRT A;  4ZK9 B;  2D2C C;  3W2D A;  3I90 A;  4B08 A;  3FKI G;  3J80 E;  1KL9 A;  5ELE A;  2B63 H;  1SYC A;  4PV1 C;  4EGV A;  1N32 L;  4EQ5 A;  3PUZ A;  1W3S A;  1YZ6 A;  1LT4 D;  1SN8 A;  2F3I A;  1UAP A;  3K59 A;  1P8L A;  1PTO D;  3A54 A;  5KRU A;  1IKL A;  3J81 c;  1FYC A;  1SJH D;  5I2X A;  2JA6 B;  2E2H H;  2CKZ B;  2MQH A;  3MXU A;  2CQO A;  4ZRZ A;  4OX9 L;  3L7Z C;  4E6I A;  3PGZ A;  5LMN L;  1LTI D;  1NAP A;  5COY A;  3J80 i;  1A3U A;  1IYJ B;  4DXG A;  1IBK Q;  3CAM A;  1CKO A;  2OT2 A;  1Q46 A;  4IUV A;  3BG3 A;  3MAQ A;  4DR4 Q;  4WJ4 A;  3F2U A;  1PH9 A;  2DJF C;  1PTO C;  2WAC A;  5IT9 L;  4LF7 Q;  3Q22 A;  2WKD A;  3MFG A;  5GAD C;  2ASB A;  4EQP A;  1SDF A;  2XWB B;  1A63 A;  1LLR D;  3LWE A;  4BY7 G;  1RJT A;  5KIX A;  1EY5 A;  1HJP A;  5JJZ A;  2N49 A;  3I55 A;  3SE0 A;  5IOD A;  5CBA E;  2A8V A;  1YNJ D;  2Q2H A;  4P2C B;  4DK1 A;  4DR3 Q;  1ILP A;  2HD3 A;  1FNV A;  4GOP B;  4A3B G;  1J6Q A;  1QG7 A;  3A55 A;  1D5M C;  4K6L A;  3K57 A;  5G3L D;  3RR5 A;  1ET6 A;  3PIP A;  3R93 A;  3CCL A;  2A68 C;  4JV5 L;  2VUM B;  2VQE L;  2F0G A;  1CT1 D;  1VQN A;  1T5E A;  1VQ8 A;  4FXK C;  2EYJ A;  3GV3 A;  4IN3 A;  2CQA A;  1VS0 A;  1PRT D;  1F2L A;  1JOK A;  4KY7 A;  5M3M G;  1G6Z A;  3LX0 A;  4IPH A;  4PZ6 A;  3MA2 B;  4R4I A;  4RMF A;  1JJC B;  1K0R A;  3GTQ B;  1AE3 A;  5IYC H;  4C1N I;  5IGB A;  2B2W C;  4GNX B;  3CCE A;  1F9S A;  4KV6 A;  1C48 A;  5LHY 1;  1QB5 D;  4DKA C;  1LTB D;  3NTK A;  4O0A A;  4PMB A;  3CCJ A;  4DV7 L;  2EYO A;  4OWT B;  2F0Q A;  4DV1 L;  1H9K A;  1TWH B;  2K32 A;  1TWF B;  4AYB G;  4YIJ A;  1TY2 A;  1VQ9 A;  1J5E Q;  2F0S A;  2R92 H;  1PFM A;  1ICF B;  2MGS A;  3NBH B;  5GAH C;  4A93 H;  4B3S L;  1A3T A;  5FLX L;  2X6L A;  2C9O A;  5HGQ A;  4O1N A;  2E5L L;  1IBL Q;  5IYD G;  3OW7 A;  4HJ7 A;  4BBR G;  2LSS A;  2MHV A;  4GN4 B;  1WFQ A;  1R9T H;  3P75 A;  4KKU A;  3S2H H;  4YHH Q;  1CTM A;  3NSW A;  1N8R C;  3FVQ A;  3P7J A;  3HOY G;  3GTL H;  3BDL A;  2F0M A;  2IX1 A;  1V8Q A;  5C4X G;  1RTN A;  4H02 A;  1X3E A;  4APV A;  1KDA A;  3UDF A;  4CHT B;  3RN2 A;  3R2T A;  1EYG A;  3W3A A;  3ULJ A;  2B2T A;  3OW2 A;  4JBM A;  1LTT D;  1AN8 A;  1PFN A;  3Q0A A;  1N9W A;  5EKL A;  3OIQ A;  4RG1 A;  2GN5 A;  2Y0S G;  1BNZ A;  1O7L A;  1ROD A;  1Q3L A;  4JBW A;  3PUX A;  1I4X A;  1G29 1;  2B8F A;  2R7Z H;  2CWP A;  1TVX A;  3KJO A;  1GVP A;  1N33 Q;  1WCM H;  4ULL A;  3TRE A;  2E2J H;  1F9P A;  1ASZ A;  1PTO H;  3CCR A;  3I8Z A;  2UUB L;  5AJ3 L;  3J81 j;  3UE0 A;  2MO0 A;  4C3H H;  1O7Z A;  3KDF A;  1E2V A;  4JI5 Q;  1LYL A;  4ZCK A;  4IQZ A;  2BA0 A;  5C3X A;  3SXH A;  2KHS A;  3A8K E;  1GHK A;  2IT1 A;  2QEX A;  4OIK A;  1G51 A;  3OMC A;  4JI1 Q;  2BH8 A;  1OXT A;  3HKZ G;  3S1N B;  2QKI C;  4A3I G;  5ISR A;  5IWA L;  1ASY A;  3BVM A;  5JEA H;  4LFC L;  2SOB A;  1SYB A;  1VF5 C;  4A3L H;  3EQL C;  1NR2 A;  3B6Y A;  4PMW A;  4B3T L;  1D6E C;  4A3D G;  3EJI A;  1KAA A;  1ESF A;  4UPA A;  4LJZ C;  2UUC L;  4JI3 Q;  2BA1 A;  1I3Q B;  2X69 A;  3K80 C;  4FDB A;  4DA2 A;  4DN4 M;  1TS2 A;  4PZ8 A;  2DUD A;  4LF8 L;  4RGN A;  1JB7 A;  1TY0 A;  3HOU H;  2F4V Q;  1SYG A;  4DR2 L;  3DM3 A;  4CKE A;  5C3E G;  1WTR A;  1C4Q A;  1X32 A;  3Q8D A;  2G5D A;  1VQP A;  4RA8 A;  4A3M H;  2DJG C;  3AEV A;  2WII B;  3V05 A;  1PYB A;  1S5B D;  3RZO B;  4DPG A;  4CJ2 C;  1K83 B;  4GZY C;  5IP9 G;  5FKA C;  1N34 L;  1Q8I A;  2JYO A;  2WAQ G;  4G57 A;  4OON A;  5DLQ E;  3K7U C;  1Z7T A;  3NK9 A;  4X3U A;  4GN5 A;  4GLX A;  2JA7 H;  1DXM A;  2F4I A;  2DNE A;  2XWJ B;  4DR1 Q;  1EUJ A;  4J15 A;  2Q2T A;  4UP9 A;  5CGK A;  3I4N G;  3C1E A;  1M4V A;  1D1K A;  1KDB A;  3PV0 A;  5M5X B;  1U5K A;  4C3I B;  2IWH A;  4ZKC B;  1PH6 A;  1RF2 D;  3T56 B;  1BCP B;  2LXK A;  3CCS A;  3H3V I;  2K03 A;  3S1Q H;  3MC0 B;  3A0J A;  4JI6 L;  5C44 B;  4DV4 Q;  2UXD Q;  3KLS A;  4XIG S;  3PO2 B;  1F9Q A;  5M5W H;  3VA5 A;  3HOX G;  3L2P A;  3D4W A;  5CBE E;  3S17 H;  1PV4 A;  1V43 A;  1K8A C;  4GOP C;  1EZ8 A;  5M5Y H;  5HUR A;  2KCM A;  4DV5 L;  2RHS B;  1NCV A;  1XWE A;  5IT9 c;  1S3O A;  3JAM E;  3PO3 H;  1KC8 C;  3O13 A;  1X65 A;  4WOR A;  5IP7 G;  2ZJP A;  4H7B A;  1EQV A;  4ZUJ A;  4P71 A;  2KEN A;  2NVT H;  2RCN A;  4LF6 Q;  1EIH A;  1VQO A;  4BBS B;  1SNO A;  3K6O A;  4ODG A;  1HZA A;  2EYH A;  3PIP 3;  3FEW X;  1TWC B;  4GKJ Q;  3M85 A;  4GNX C;  1SR3 A;  1G8Z D;  4KHP Q;  4YY3 Q;  1Q8K A;  1DGS A;  2TSS A;  3M4O B;  1XTC D;  3GTP B;  4OO1 H;  1LAC A;  2DY7 A;  5LL6 X;  5M3F H;  1IZ6 A;  3HOW B;  3H3V C;  1BO0 A;  2B2Y A;  2EJG C;  1KHI A;  2PQE A;  4C3J B;  1Q90 A;  5LMU Q;  2PW5 A;  1JWS D;  3E9H A;  1HA5 A;  1FGU A;  3CW2 C;  5ELF A;  5C5L A;  4OHJ A;  3NUC A;  2RSO A;  4JPB W;  3K5O A;  2G9D A;  4FNF A;  3TRZ A;  3GTK B;  5BR8 Q;  1R4P B;  3U4Z A;  2UU9 Q;  3G4S A;  3ND9 A;  3BU2 A;  2EXZ A;  3F2C A;  3I7F A;  3M3Y B;  4DF7 A;  3H0G G;  2HDM A;  4X62 L;  3KLS X;  2MFI A;  2UXB L;  1HTL D;  1DCZ A;  1MI2 A;  1IW7 D;  1QUQ A;  5FLX c;  1SFO B;  3ND8 A;  3PIO A;  1TKW B;  2Z4H A;  1HNW Q;  3T16 A;  3GDE A;  4QL5 A;  2JA6 H;  1Q86 C;  2OWO A;  5E3F A;  2F0H A;  1LTS D;  1Y1V G;  3IFT A;  1Z6H A;  3OYY A;  3WOF A;  4EX5 A;  5E4X A;  3NEM A;  4FF2 A;  1SE2 A;  3KF8 A;  1PHJ A;  5IYB H;  3OTO Q;  5BN5 A;  2R6G A;  3J81 E;  1IHZ A;  4IPC A;  1IW7 C;  3OIP A;  4LF9 L;  4HN7 A;  2A74 C;  3A56 A;  1I94 L;  3QB3 A;  1M1K C;  1FR3 A;  1SYF A;  4NPS A;  5EAY A;  2I07 B;  2MP1 A;  2Z6K A;  1MIU A;  1A15 A;  2Z8L A;  5DEH A;  3V2T A;  5I2Y A;  1MKH A;  1QVC A;  1RKN A;  2HHH L;  1HNZ Q;  5A35 A;  2AHO B;  2B2V A;  4DR5 Q;  1HQM C;  1D7Q A;  3C2P A;  4FXG C;  2D0O A;  4WFN 3;  4JYA L;  1SJE D;  4IUN A;  4KHV A;  3J81 i;  2V1C C;  3STB C;  1EQT A;  3K0X A;  3T4A C;  3K5N A;  2VUM H;  1SBB B;  2HUG A;  2ZXO A;  3A5U A;  1PXU A;  4OIJ A;  1XXG A;  4GKK L;  2CFM A;  5IIF A;  5K36 H;  2Q2U A;  2BDO A;  3OWF A;  4QIW B;  4WJ3 M;  4Y52 H;  4FYD A;  3J7A 5;  2B39 A;  5IGE A;  2EOT A;  3FPP A;  1I50 B;  3ERS X;  3MWY W;  1O78 A;  2RCF A;  5L37 A;  3GTQ H;  4I65 A;  1JE4 A;  2RA4 A;  3SHL A;  5IGG A;  1W6J A;  2LKV A;  4A3E G;  4QGU A;  3A8J E;  4DK3 C;  3TP5 A;  4BXX G;  5J22 A;  1TR5 A;  1G91 A;  4IZ8 A;  1PDQ A;  4X65 Q;  5ELN A;  2B2U C;  5EJW A;  4F88 A;  1TWH H;  1WI5 A;  2MO1 A;  1TWF H;  4OEM B;  4NB3 A;  1X55 A;  2WB1 B;  3CPW A;  1DZ1 A;  3CC7 A;  3T1H L;  1FJG L;  3G7L A;  5E1F A;  3M7G A;  4TQU S;  2LFN A;  3K0Y A;  5ELO A;  2UXC Q;  3ULL A;  1JCK B;  2TMP A;  3ULP A;  1WTO A;  1RD9 D;  1UE1 A;  1L1O B;  4YWM A;  2H5X A;  3K7A B;  1A8V A;  2K7V A;  2K14 A;  2NBF A;  1OXX K;  2AQ3 B;  4NXN Q;  4A3J G;  1VDZ A;  4YWK A;  4A3G G;  1CK1 A;  2JSO A;  4GLV B;  3CRK C;  4YCV A;  1E7Z A;  1I4Q A;  4KY6 A;  5IGD A;  2E2I B;  2JA5 B;  4HTH A;  4DAY A;  3KYH C;  4HR7 B;  2KCC A;  4FF3 A;  2YU9 B;  2EYM A;  4HID A;  2Z0S A;  1TS3 A;  4X64 Q;  2J7Z A;  2YTY A;  1BUV T;  4LF5 L;  5I4D A;  3ONA B;  3W1B A;  2PYK A;  1SMX A;  1YJ9 A;  1KD1 C;  3K58 A;  1CKN B;  2XIW A;  2Z6K C;  1TWA B;  4DR7 Q;  1IYV A;  1UNS A;  4A3K G;  2B2W A;  5CV5 A;  3A74 A;  4LFB L;  1CSQ A;  2F0T A;  2L0C A;  3D4D A;  2YTV A;  3DXJ C;  4TVA B;  1GD7 A;  3BZK A;  1XPU A;  2JA8 G;  2B2V C;  4N9P A;  1JOR A;  2D9U A;  1CI3 M;  2QDL A;  2BDN A;  2R93 B;  1I5F A;  4HCE A;  3RLO A;  3VYS A;  2VB3 X;  2M00 A;  4EQN A;  1IBM Q;  5CV9 A;  3GTJ B;  2CWA A;  1BF4 A;  2NVY B;  3KF6 A; 
#chains in the Genus database with same CATH homology
 2E76 C;  2AWO A;  1G2T A;  3PUV A;  2KEE A;  4X3K A;  4A3F B;  1EYA A;  5KNC A;  1D1I A;  2XSC A;  1MGS A;  3E0J A;  1CA5 A;  1BXT A;  1D5Z C;  2IX0 A;  2YYZ A;  1KDC A;  3H0G B;  1EEF D;  4NDX A;  1YNN D;  3VA7 A;  1F2Z A;  1CZG A;  1CFM A;  3S1M B;  1VMP A;  4KN4 C;  1EFI D;  1L0Y B;  1I4G A;  5EBD A;  3PMF A;  4DXF A;  1JQY D;  2G9H D;  2A68 D;  1GJX A;  1D5X C;  5CYU A;  2M9V A;  1YNN C;  1XX8 A;  2K04 A;  4PMC A;  2RSN A;  3HGB A;  3P1H A;  3TZD A;  3MHB A;  3T51 B;  4M1U B;  4R9W A;  1II3 A;  3HP3 A;  5FO8 B;  3TN2 A;  3DMU A;  1PMR A;  3QOJ A;  2RBM A;  1B50 A;  2WV6 D;  1Y8P B;  1NR4 A;  4IUP A;  4BY1 B;  1SE3 A;  1CQF A;  3BVG A;  2L1B A;  2ZXP A;  3S14 B;  3DEO A;  3N52 A;  4RKB A;  2KOL A;  3UI2 A;  4K14 A;  3TP7 A;  2F0E A;  3IL8 A;  3TP8 A;  1U9R A;  4RAU C;  5J39 A;  2A5H A;  3SVM A;  3OOC A;  2NZ1 D;  1HHV A;  5D3D A;  1ILQ A;  4V19 0;  5C4Z A;  3NTH A;  1EYC A;  3P20 A;  2HDL A;  3KK7 A;  2B8G A;  2EE1 A;  2EYP A;  2E74 C;  1HTP A;  5A2Q L;  3GTM B;  4BA1 I;  4CGY B;  3NQI A;  5IT9 E;  4FO2 A;  1MSG A;  4OO1 I;  1C8C A;  2R61 A;  2ZT9 C;  3I70 A;  4CKB A;  3HOV B;  1OXU A;  5EPL A;  3I73 A;  2EVB A;  1ML0 D;  1EU3 A;  3HEJ A;  2K5W A;  3S2D B;  1F2M A;  1RHP A;  5COR A;  2L55 A;  4C3H G;  1B44 D;  1W6K A;  3I4M B;  5JVH 3;  3NHH A;  1OXS C;  1SAP A;  3MZ5 A;  4PNY A;  2F0F A;  4XQN A;  4IUU A;  5TSS A;  2LMC B;  3TSS A;  5CV6 A;  1TS5 A;  1JWU D;  1DD2 A;  1L0X B;  5T1G A;  3H6M A;  5C0X H;  1B2T A;  2E2D C;  5JEA G;  4G7H C;  1ZXT A;  4DNT B;  1Y1W B;  4C56 C;  4TRD A;  3FKI B;  3MXP A;  3ERQ A;  3KBX A;  2Q8T A;  5M9O A;  4RCO A;  4L6T B;  2OF1 A;  3MFY A;  5FLX E;  4J6H A;  2AQ2 B;  4XQQ A;  1HCZ A;  1BR9 A;  1EY7 A;  2Q8R E;  4XDX A;  1KNA A;  1JWM D;  4KD3 A;  3OWE B;  4KMU C;  4KI0 A;  3GD7 A;  5ELC A;  4TSS A;  5T1I A;  2EY5 A;  1X3P A;  3E5S A;  5LL6 S;  1B3A A;  5AFW A;  4BY7 B;  1LT5 D;  3SR1 A;  1A2U A;  2F0I A;  2X6G A;  2EJM A;  1STN A;  3RUZ A;  4BWG B;  1EU4 A;  4N9T A;  5BN4 A;  4G7O C;  3N6R A;  1O80 A;  1PYW D;  2PO4 A;  1QNU A;  4ABN A;  4A3B B;  1WTQ A;  5I9O A;  2K33 A;  2EDG A;  1ENF A;  1MSH A;  1TQO A;  3ITP A;  3DWA A;  3NPP A;  3NQT A;  1AZP A;  1HRJ A;  1BDO A;  1DYQ A;  1GOZ A;  1AFP A;  5DM6 3;  3GV6 A;  4RFB A;  5M3M B;  1Y8O B;  2K5Q A;  1NUC A;  1M8A A;  1NSN S;  1Y8N B;  3T53 B;  2RVL A;  2JEA I;  2PNR C;  4KTA A;  4ZAI A;  5I9P A;  4K8J A;  4R8I A;  3QO2 A;  4AYB B;  3A7L A;  4UAI A;  5EPK A;  3D4R A;  1KNE A;  3TME A;  1XYI A;  3URY A;  1VCI A;  2RDH A;  1SYE A;  1X3Q A;  1CA6 A;  4BBR B;  3BYY B;  3LWU A;  2CHB D;  2JE6 I;  3EVQ A;  3HOY B;  3D3R A;  1FD7 D;  4OO1 G;  2EJF C;  4LAA A;  4QB4 A;  5C4X B;  5D3I B;  2K5D A;  2F0K A;  1DON A;  2D62 A;  2SDF A;  2XNA C;  1HA6 A;  2K05 A;  4CJ1 B;  1J9O A;  2FIN B;  1OXV A;  2Y0S B;  1S5F D;  1EL0 A;  2AQ1 B;  1LTR D;  2B2U A;  4MN3 A;  1WD0 A;  3GTO B;  1SXT A;  2EY6 A;  1B4O A;  1HFG A;  3E6Z X;  3HS0 C;  3S15 B;  1PTO B;  1STE A;  4BA2 I;  4DFA A;  1T5X D;  1E0B A;  2CVR A;  3I72 A;  2L12 A;  4KHZ A;  1A6X A;  3MTS A;  1A3V A;  1I6V C;  1H9J A;  2WIN B;  5I6W A;  1SNP A;  1GXD C;  1PZK D;  1BCP F;  3U9S A;  3GTG B;  2MJ8 A;  4X3T A;  3HKZ B;  1QCB D;  5C0X J;  4NKL A;  4A3I B;  1H9S B;  3C1F A;  1BOS A;  2KQ3 A;  3AB9 A;  5JOB A;  4RKL A;  4A3D B;  4R8N A;  1Q1E A;  3DWQ A;  4QF4 A;  2PMZ B;  2NTS A;  4WJW A;  1D2B A;  2WP8 J;  2O5J C;  2K1B A;  1V1P B;  1BQQ T;  1KLG D;  3BDC A;  2HCC A;  2RDG A;  1EIG A;  5C3E B;  1PRT B;  4K2K A;  4QUF A;  4RCN A;  1H9M A;  2QDB A;  1QIL A;  5K36 G;  2L4N A;  3VYT A;  3S1R B;  3Q6S A;  2F0V A;  1EOT A;  4EVO A;  3CU7 A;  3J7A V;  5NUC A;  2QCP X;  3L3O C;  3ZYY X;  3Q23 A;  1B9M A;  2WAQ B;  3MEH A;  1SYD A;  4L63 B;  2FJ2 A;  1FNU A;  2JA7 B;  4H44 C;  1K8M A;  3J80 L;  4B9X A;  4BS9 A;  4RGM A;  5KGU A;  4HMJ A;  3TZU A;  2SNM A;  1MD2 D;  3EA6 A;  2NVX B;  1O7Y A;  2XRS D;  4DGZ A;  4ILW A;  3I4N B;  3VR5 A;  1KTK A;  1WD1 A;  5C6A A;  2IX3 A;  2F0D A;  2AUJ D;  2L5T A;  2FMM A;  1BCP D;  4KJN A;  3KLR A;  3HOX B;  4IFD H;  5JVG 3;  4C2M B;  4FP5 D;  2E75 C;  5M5Y B;  3OSO A;  1MBY A;  2ID0 A;  2F0O A;  2GA4 B;  1E2Z A;  3D8G A;  3G6J B;  2F0P A;  3M7N A;  1DOL A;  1STA A;  2NN6 H;  5D65 A;  5DAU A;  3D6W A;  4HED A;  3HG9 A;  2K6A A;  1BCP C;  3DWP A;  3FPU B;  1SNM A;  5J1Z A;  1AZQ A;  2EYF A;  5FO7 B;  1HFN A;  1IKM A;  1TWG B;  2F0W A;  2KJX A;  4F7X A;  1WVL A;  5CC4 A;  2A69 C;  2NVQ B;  5DNF A;  1U4P A;  4KK7 A;  4DAV A;  1ZEQ X;  1HPC A;  3D31 A;  1EY4 A;  1IYU A;  1B1Z A;  1LV9 A;  2L11 A;  1EWH A;  5C0X I;  2RQX A;  1PZJ D;  5EKI A;  2F3V A;  2ZXR A;  4KJO A;  5CV8 A;  5EQ0 A;  2Q8I B;  1CZW A;  3SK4 A;  3TP6 A;  2OEO A;  1QJO A;  4XT3 B;  1I6H B;  2A6H D;  2MUY A;  3HZX A;  2K01 A;  1S4Z A;  2QIL A;  2RDF A;  4ZKB B;  4RH6 A;  2AWN A;  4FXD A;  4K5W A;  3TBI B;  3AMU A;  2VB2 X;  4F8M A;  2F03 A;  1Y1V B;  2EPB A;  2D5D A;  4F87 A;  1EY9 A;  1SND A;  2A6H C;  1H9R A;  1F2Y A;  1TII D;  3I3C A;  4KD4 A;  5K5P A;  4EQO A;  4IUT A;  4ID6 A;  2XN9 C;  4OGQ C;  1HUN A;  2O2L D;  1Q12 A;  2ICI A;  2VXW A;  4Y7N B;  2JXM B;  2KVM A;  4J8Q A;  5KYL A;  5JAV A;  2NYZ D;  3BDO A;  2RKS A;  4U68 A;  3PIO 3;  4C3I G;  2SNS A;  2N88 A;  1F9R A;  2KA7 A;  4I7Z C;  1YNJ C;  5KND A;  4HAE A;  2QF7 A;  4U67 3;  5F2D A;  5EPJ A;  1J8I A;  2K28 A;  3I91 A;  5JPM C;  3PUY A;  2EYL A;  2LY7 A;  4CJ0 B;  2QEJ C;  1I4H A;  1EWC A;  4KN7 C;  2BOS A;  3GO5 A;  1STY A;  1RDP D;  3MXN A;  1PFB A;  2JEB I;  4A3E B;  1A2T A;  3MVV A;  4FF4 A;  1HUM A;  1G2S A;  1ONL A;  1PRT C;  2F0L A;  1Y69 U;  1VMC A;  1HQR D;  2NB0 A;  4NW2 A;  4S3S A;  3BYT B;  1Z47 A;  3VR3 A;  3R3O A;  2J4X A;  1ZYR D;  3RZD B;  3BVZ A;  1JR0 D;  1PZI D;  2KEC A;  2SEB D;  3DEP A;  3OHX C;  3S16 B;  5IOC A;  1QWY A;  2H1E A;  1E2W A;  4V0B A;  2F1M A;  4A3J B;  4A3G B;  4IFD J;  1Q1B A;  3HRZ C;  2FMC A;  2C5C A;  3NTI A;  2I46 A;  2AUK A;  3V96 A;  1GHJ A;  4C3J G;  1CHQ D;  1ZYR C;  3BS1 A;  5CR3 A;  1QNK A;  1TS4 A;  4ZLT F;  2F3W A;  1FGB D;  1B53 A;  4CKC A;  4DK0 A;  4OL7 A;  4XYQ A;  2NUC A;  4M8A A;  1CM9 A;  3DUZ A;  4HCS A;  1UUP A;  1GUO A;  2NTT A;  3T13 A;  1JB3 A;  4A3K B;  3CQZ B;  3GQB A;  4UDU C;  2JA8 B;  3NXW A;  5C0X G;  1WTX A;  4G7Z C;  1STG A;  3M4Y A;  2BE5 D;  5C3W A;  2PPB C;  1DOK A;  3SEB A;  5IGF A;  3C46 A;  1DJR D;  1FNW A;  2OXP A;  2B63 B;  2F0U A;  5ELB A;  1TU2 B;  4RGT A;  2HQE A;  2A6E D;  1S5D D;  2BE5 C;  4ZYS A;  2E2H B;  3JAM L;  1QE6 A;  1IL8 A;  2IPK D;  2XVS A;  4RGO S;  2DY8 A;  5E4W C;  4K5V A;  4K5X A;  5I6Y A;  4H0L C;  1S5E D;  1GUS A;  5EBC A;  2MPM A;  3A7A B;  2O5I C;  1EY6 A;  1GUN A;  2IW3 A;  4HSP A;  1CQV A;  3NBH A;  4QCL A;  2A6E C;  2IJ0 A;  3BZD B;  1DM0 B;  1JIC A;  4MHE A;  5A2Q E;  4XTC S;  2WKC A;  3FMC A;  3NWT A;  1HXY D;  1JC7 A;  1ICW A;  5C4H A;  1JOQ A;  3QOL A;  2EY2 A;  5D14 A;  4NMZ A;  2KED A;  1GUG A;  3NE5 B;  4H13 C;  5IGC A;  1KLU D;  3IAY A;  1GUT A;  1ENC A;  2FFK B;  5JPN C;  2B2T C;  3VYU A;  3RLF A;  1F77 A;  1OO9 B;  2EZV A;  1GUW A;  4O42 A;  2F0N A;  2JP1 A;  2PCF B;  1STB A;  1EEI D;  5CV4 A;  3EFX D;  2XRQ D;  1CHP D;  4CBV A;  4FVM A;  3H94 A;  3QJY A;  3WOE A;  5FO9 B;  4KKS A;  3NBI A;  4IFD I;  1UEA B;  1QOH A;  1RTO A;  2R92 B;  4XXE A;  3OPO A;  2KUM A;  4A93 B;  1LAB A;  1LTA D;  3SK6 A;  1R4Q B;  4QUC A;  1U4R A;  2O4X A;  3J81 L;  1EY0 A;  2PZU A;  2NN6 I;  3FDT A;  4K6D A;  4L8J A;  1KAB A;  5KYI A;  2ENB A;  1R9T B;  3S2H B;  1B9N A;  3GTL B;  5HGT A;  2CW0 D;  4NP5 A;  1LO5 D;  3D6C A;  3CKI B;  2Z1C A;  5C5M A;  2VNU D;  1LT3 D;  4ZQ3 A;  3FRP B;  5KNB A;  1I4R A;  4Z9C B;  1STH A;  2BCO A;  4RHR A;  5CMD A;  1U4L A;  2ICE C;  3DHQ A;  1EZ6 A;  2DN8 A;  4KKT A;  2CW0 C;  1I4P A;  3CHB D;  3R8B A;  2R7Z B;  4DAP A;  3K5M A;  3QIA A;  1WCM B;  2DNC A;  2E2J B;  4C1N K;  4K8I A;  4C3H B;  2PZW A;  2N55 A;  3RD4 A;  2KCN A;  2NWG A;  2HCI A;  1ET9 A;  5C4J B;  3SK8 A;  4PQX A;  3MXG A;  4TKO B;  1ESR A;  5KEE A;  1LTG D;  4LK1 C;  4HMI A;  1ENA A;  2PZT A;  3HOZ B;  2M2L A;  3RMH A;  5BN3 A;  3S9W A;  2EY1 A;  4G4K A;  3J7Y W;  1EY8 A;  2PW7 A;  3VR2 A;  3J7A F;  1AEX A;  1JOO A;  1ZKO A;  5JEA J;  1K8O A;  3HOU B;  4QMG A;  4MIU A;  3SDZ A;  4RWS C;  5EGT A;  1LT6 D;  3DM1 A;  4WRD A;  2LS0 1;  5FOB B;  1S5C D;  3AU7 A;  4XQJ A;  4A3M B;  2J0T D;  5ELD A;  3QG1 A;  1RCV D;  1SNQ A;  4ZUI A;  3A8I E;  2V4D A;  3VR4 A;  1U4M A;  3NP8 A;  3KUP A;  4DU9 A;  5EKK A;  1BBX C;  2B2Y C;  3C3L A;  3TDQ A;  3PUW A;  4FF1 A;  4JK1 C;  2F0J A;  1PTO F;  3S1Q B;  3X3N A;  4DNR B;  4K2L A;  3H09 A;  5M5W B;  4J1M A;  1DOM A;  4IFD G;  3S17 B;  1WTW A;  2R3Z A;  1SMY D;  5FK9 C;  2FHT A;  4LMQ D;  4XYO A;  3NWS A;  4IUQ A;  3LNN A;  3OMG A;  2NN6 G;  3PO3 B;  3SK5 A;  4HSV A;  2A69 D;  1SNC A;  1V1O A;  1AW7 A;  1AP0 A;  2NVT B;  3Q24 A;  3CRL C;  4ME5 A;  1SE4 A;  1SEB D;  3IKJ A;  1SMY C;  4IUR A;  1WTP A;  5DM7 3;  3L9A X;  1TT2 A;  4X3S A;  1H9S A;  3I4L A;  3VR6 A;  3KBG A;  3WDN A;  1WTV A;  4Q5V A;  3QWN A;  1EYD A;  3X3M A;  5G3L F;  2H4O A;  4KY5 A;  5CV7 A;  5M3F B;  3R2I A;  4Q0F A;  1SSO A;  1PRT F;  1V1P A;  4IAL A;  3H91 A;  2L9H A;  3GP7 A;  4B9W A;  4XT1 B;  2IL8 A;  4RHS A;  1PLF A;  3K5L A;  3ERO A;  3U9O A;  1VF7 A;  2A73 B;  2Z4I A;  3VYR A;  3IFD A;  4ZK9 B;  2D2C C;  3W2D A;  3I90 A;  4B08 A;  3J80 E;  5ELE A;  1SYC A;  4PV1 C;  4EGV A;  3PUZ A;  1LT4 D;  1UAP A;  3K59 A;  1PTO D;  3A54 A;  5KRU A;  1IKL A;  1FYC A;  1SJH D;  5I2X A;  2JA6 B;  3MXU A;  4ZRZ A;  3L7Z C;  4E6I A;  1LTI D;  1NAP A;  5COY A;  1A3U A;  4DXG A;  2OT2 A;  4IUV A;  3BG3 A;  3MAQ A;  3F2U A;  1PTO C;  2WAC A;  5IT9 L;  3Q22 A;  2WKD A;  3MFG A;  4EQP A;  1SDF A;  2XWB B;  1LLR D;  3LWE A;  1RJT A;  5KIX A;  1EY5 A;  5JJZ A;  3SE0 A;  5IOD A;  5CBA E;  1YNJ D;  4P2C B;  4DK1 A;  1ILP A;  1FNV A;  1QG7 A;  3A55 A;  1D5M C;  4K6L A;  3K57 A;  5G3L D;  1ET6 A;  3R93 A;  2A68 C;  2VUM B;  2F0G A;  1CT1 D;  1T5E A;  4FXK C;  2EYJ A;  3GV3 A;  4IN3 A;  2CQA A;  1PRT D;  1F2L A;  1JOK A;  4KY7 A;  1G6Z A;  3LX0 A;  3MA2 B;  3GTQ B;  4C1N I;  5IGB A;  2B2W C;  1F9S A;  4KV6 A;  1C48 A;  5LHY 1;  1QB5 D;  1LTB D;  3NTK A;  4PMB A;  2EYO A;  2F0Q A;  1H9K A;  1TWH B;  2K32 A;  1TWF B;  4YIJ A;  1TY2 A;  2F0S A;  1PFM A;  2MGS A;  1A3T A;  5FLX L;  2X6L A;  2C9O A;  4O1N A;  3OW7 A;  2MHV A;  3P75 A;  4KKU A;  1CTM A;  3NSW A;  3FVQ A;  3P7J A;  3BDL A;  2F0M A;  2IX1 A;  1V8Q A;  1RTN A;  1KDA A;  4CHT B;  3R2T A;  3W3A A;  2B2T A;  1LTT D;  1AN8 A;  1PFN A;  3Q0A A;  5EKL A;  3OIQ A;  1BNZ A;  1O7L A;  1ROD A;  1Q3L A;  4JBW A;  3PUX A;  1I4X A;  1G29 1;  2B8F A;  1TVX A;  4ULL A;  1F9P A;  1PTO H;  3I8Z A;  1O7Z A;  1E2V A;  4IQZ A;  2BA0 A;  5C3X A;  3SXH A;  2KHS A;  3A8K E;  1GHK A;  2IT1 A;  4OIK A;  3OMC A;  1OXT A;  3S1N B;  2QKI C;  5ISR A;  3BVM A;  5JEA H;  2SOB A;  1SYB A;  1VF5 C;  3EQL C;  1NR2 A;  4PMW A;  1D6E C;  3EJI A;  1KAA A;  1ESF A;  4LJZ C;  2BA1 A;  1I3Q B;  2X69 A;  4DN4 M;  4DA2 A;  1TS2 A;  4RGN A;  1TY0 A;  1SYG A;  4CKE A;  1WTR A;  1C4Q A;  1X32 A;  4RA8 A;  2WII B;  3V05 A;  1S5B D;  3RZO B;  4CJ2 C;  1K83 B;  4GZY C;  5FKA C;  1Q8I A;  2JYO A;  4G57 A;  1Z7T A;  3NK9 A;  4X3U A;  1DXM A;  2F4I A;  2DNE A;  2XWJ B;  5CGK A;  3C1E A;  1M4V A;  1D1K A;  1KDB A;  3PV0 A;  5M5X B;  4C3I B;  2IWH A;  4ZKC B;  1RF2 D;  3T56 B;  1BCP B;  2K03 A;  3MC0 B;  5C44 B;  3KLS A;  4XIG S;  3PO2 B;  1F9Q A;  3VA5 A;  3D4W A;  5CBE E;  1V43 A;  1EZ8 A;  5HUR A;  1NCV A;  1XWE A;  3JAM E;  3O13 A;  4WOR A;  4H7B A;  1EQV A;  4ZUJ A;  1EIH A;  4BBS B;  1SNO A;  3K6O A;  4ODG A;  2EYH A;  3PIP 3;  3FEW X;  1TWC B;  3M85 A;  1G8Z D;  2TSS A;  3M4O B;  1XTC D;  3GTP B;  4OO1 H;  1LAC A;  2DY7 A;  5LL6 X;  3HOW B;  3H3V C;  1BO0 A;  2B2Y A;  2EJG C;  2PQE A;  4C3J B;  1Q90 A;  2PW5 A;  1JWS D;  1HA5 A;  5ELF A;  5C5L A;  4OHJ A;  3NUC A;  2RSO A;  3K5O A;  2G9D A;  4FNF A;  3GTK B;  1R4P B;  3ND9 A;  2EXZ A;  3M3Y B;  4DF7 A;  2HDM A;  3KLS X;  1HTL D;  1DCZ A;  1MI2 A;  1IW7 D;  1SFO B;  3ND8 A;  1TKW B;  2Z4H A;  3T16 A;  5E3F A;  2F0H A;  1LTS D;  3IFT A;  1Z6H A;  3WOF A;  5E4X A;  4FF2 A;  1SE2 A;  3KF8 A;  5BN5 A;  2R6G A;  3J81 E;  1IHZ A;  1IW7 C;  3OIP A;  4HN7 A;  2A74 C;  3A56 A;  3QB3 A;  1FR3 A;  1SYF A;  2I07 B;  2MP1 A;  1A15 A;  2Z8L A;  5DEH A;  3V2T A;  5I2Y A;  1RKN A;  5A35 A;  2B2V A;  1HQM C;  3C2P A;  4FXG C;  4WFN 3;  1SJE D;  4IUN A;  4KHV A;  1EQT A;  3T4A C;  3K5N A;  1SBB B;  2HUG A;  2ZXO A;  1PXU A;  4OIJ A;  1XXG A;  5IIF A;  5K36 H;  2BDO A;  3OWF A;  4QIW B;  4FYD A;  2B39 A;  5IGE A;  2EOT A;  3FPP A;  1I50 B;  3MWY W;  1O78 A;  4I65 A;  1JE4 A;  2RA4 A;  3SHL A;  5IGG A;  1W6J A;  2LKV A;  3A8J E;  3TP5 A;  5J22 A;  1TR5 A;  1G91 A;  4IZ8 A;  1PDQ A;  2B2U C;  5EJW A;  4F88 A;  2WB1 B;  1DZ1 A;  3G7L A;  5E1F A;  3M7G A;  4TQU S;  2LFN A;  3K0Y A;  1JCK B;  2TMP A;  1WTO A;  1RD9 D;  3K7A B;  2K7V A;  2NBF A;  1OXX K;  2AQ3 B;  1VDZ A;  1CK1 A;  2JSO A;  3CRK C;  4KY6 A;  1I4Q A;  5IGD A;  2E2I B;  2JA5 B;  4HTH A;  4DAY A;  4HR7 B;  2KCC A;  4FF3 A;  2YU9 B;  2EYM A;  1TS3 A;  2J7Z A;  1BUV T;  5I4D A;  3ONA B;  2PYK A;  3K58 A;  2XIW A;  1TWA B;  1IYV A;  1UNS A;  2B2W A;  5CV5 A;  3D4D A;  2F0T A;  2L0C A;  3DXJ C;  2B2V C;  4N9P A;  1JOR A;  2D9U A;  1CI3 M;  2BDN A;  2R93 B;  4HCE A;  3VYS A;  2VB3 X;  2M00 A;  4EQN A;  5CV9 A;  3GTJ B;  1BF4 A;  2NVY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...