3VYRA

Crystal structure of the hypc-hypd complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
72
structure length
72
Chain Sequence
AVPGKVIEVNGPVAVVDFGGVKREVRLDLMPDTKPGDWVIVHTGFAIEKLDEKKAMEILEAWAEVEKAMEGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Metal binding protein
molecule keywords Hydrogenase expression/formation protein HypC
total genus 17
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2012-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3vyrA00
2Z1CA 3D3RA 2OT2A 3VYTA 3VYUA 3VYRA 3VYSA
chains in the Genus database with same CATH superfamily
3N6RA 5M3MH 4DR7Q 2B63G 1I6HB 2KENA 1PMRA 2F4VQ 1A3UA 1CFMA 3I70A 4FF3A 1E7ZA 4R8IA 3CF5A 4JG2A 1N36L 4L6TB 3ZYYX 3W2DA 1TWAB 4KHPQ 2DGYA 2NVYH 1VQOA 2EJGC 1LTTD 1JWMD 4UAIA 2VW9A 5M5YB 4B3TQ 3Q0AA 1EY7A 3NE5B 1Q46A 1ZYRD 3DWQA 2RQXA 4MZ9A 1LT6D 3D6CA 2C35B 4FXKC 2VB3X 3M4QA 1G51A 1NNXA 3TREA 4MNOA 2UUAQ 5D14A 4L5QA 5K36G 1H9JA 4XXEA 5C4XH 3D31A 3D4RA 4XT1B 4DV2L 3R2IA 5C4HA 1YHBA 3NTKA 5C44G 1P16A 1IXRA 1ENFA 3KBXA 5IYBH 4F7XA 2VQEQ 3DUZA 2TMPA 4IUPA 3TQYA 4A3MG 1X3EA 3QR8A 5JJZA 1KQSA 3PMFA 1JR0D 1VF5C 1ILPA 1QB5D 4A3LH 3MA2B 1QCBD 1RODA 1F9SA 1W3SA 1RIPA 1I94L 1SLJA 3DMUA 4PMBA 3H3VH 1SMYC 1BVSA 2VQEL 2KVMA 3TP8A 3Q23A 4X65Q 3KOJA 2R7ZG 2JA8B 1BBWA 3UDGA 4H0LC 1VMCA 4DXGA 4DUZL 2L15A 3F2DA 4KN7C 3A8IE 2Y0SE 4B9WA 2QKIC 2R7ZB 5IT9E 2CQOA 3D3RA 4IN3A 3LWEA 3FKIB 2F0PA 4B3MQ 4DFAA 5M5XH 1EZ8A 1QUQA 2JA7G 5C4XB 1XMQL 2E2IB 2B39A 2F0FA 1XPOA 3H09A 1PH7A 1Y1WB 1UE7A 1K0RA 4DR5L 4HIMA 5FLXL 1U5KA 3HOZB 4DV3Q 2AUKA 3U50C 4IJLA 3RR5A 1S5DD 3W5OA 3MAQA 5C3EH 4ODGA 2NVTH 1TWGB 1SFOH 1Q7YC 1HNWQ 4O42A 3GTGH 1VQ4A 2R93H 5IGDA 5J39A 4UPAA 2VUMB 4ID6A 1EWCA 5FLXE 1CKNA 2UUBL 4K2LA 3ONAB 4DA2A 4GKJL 2F0HA 5BN5A 5CBAE 2I07B 1J5EL 3PIOA 4J1MA 3E6ZX 4PZ8A 2JN4A 2EXDA 1NE3A 2G9DA 2UXDQ 3PO2G 2Y0SB 3S1NB 1CZGA 2A74C 3SK5A 4JI3Q 4PMCA 2Z8LA 2ZXPA 3HOXH 2WFWA 5C3EB 1O78A 2EDGA 3PO2B 1A6XA 4WJWA 1Q82C 2RDGA 2D0OA 2K5QA 4AQYL 1F9QA 3W3AA 4Y7NH 3VYSA 3V05A 5EBCA 2E2DC 1IBLL 1D6EC 1S5BD 4WORA 1EYGA 3S1MH 2HCCA 5BR8L 3PIP3 2OCEA 4RGOS 1JMCA 4DV7Q 4B08A 3JC66 2F0IA 3HOUG 2F4IA 2K32A 1SMYD 2EYHA 4LF6Q 3ICEA 1BNZA 1A63A 1EY9A 1BCPF 2JA8H 5GAGC 1CSPA 1DYQA 4BXXG 5IGBA 5M5XB 2CW0C 3S24A 4A3KG 2NZOA 5I9PA 4CGYB 2J0TD 2FHTA 4BY1B 4WFN3 4GNXA 1NMFA 4PQXA 1X3FA 3H94A 2F0MA 2F03A 1A3VA 4CDFC 3V96A 4HIKA 3P1HA 5I6YA 3RMHA 5JJIA 4A3DB 1X3GA 1LTSD 3R3OA 5F2DA 4IO9A 1I50H 3TEHB 4NXML 1RTOA 5A2QE 1WD0A 2K7VA 3SGIA 1QNKA 4HJ8A 1HFNA 3HOYH 3X3MA 4GKKQ 3S1NH 2LFNA 2N8NA 3F2BA 2XRSD 2VQFQ 3BDLA 4G7OC 4RGNA 4HSVA 2B63H 3GTQB 4A3KH 1STGA 3KF6A 2I0QA 3PIPA 5I9OA 4NP5A 4H02A 1QWYA 2PI2E 4LF6L 3NWSA 2FFKB 1UE1A 4ZYSA 1X32A 3J7AV 1HR0L 2PNRC 3VR6A 3L2PA 1JQYD 2EYMA 4YCVA 2UU9Q 4DKAC 3DEPA 3S16H 1AN8A 1I6HH 3H91A 3FRPB 4DR6L 2E2IH 4KJOA 1BDOA 4APVA 1SEBD 5FLXc 1GUGA 1PTOH 3S17H 5M3FB 2JA9A 2EYJA 5CR3A 1SROA 3OWEB 2XWBB 3CMEA 5DAUA 1DCZA 2HD3A 2B8FA 2B8GA 3UDIA 1DXMA 1JWUD 1KC8C 1UUPA 2K01A 4A93B 4RKBA 2NVQH 2PQAA 4DV4L 1B50A 1SYCA 2A68D 3NENA 4LF9L 4JBWA 4OO1H 3SK6A 2F0TA 4X64L 1PFNA 2WAQE 1YITA 2R3ZA 2A6HD 2Z0SA 1NJIC 2R7FA 1WCMH 4DR3L 5EKLA 5EPJA 1D5XC 1KXLA 1KLUD 4QIWE 2F0SA 5J1ZA 1PYWD 2UXCL 1N32Q 5IWAQ 1XNQQ 3M4YA 4R4TA 4UDUC 1PRTD 4IOAA 2UXDL 1I3QH 2K5NA 5IT9L 5JEAG 3TRZA 4R4OA 2HDLA 4ZKCB 1QG7A 5E1FA 4DPGA 1G91A 4QB4A 1EZ6A 4YCWA 3HOYG 4RFBA 2R6GA 1HZBA 1XYIA 1ZKOA 5JPMC 4KK7A 4P72A 3RNUA 1PRTC 1VQ8A 5C3WA 2M9VA 1WYDA 1ET6A 3K58A 3G71A 3KJOA 1CT1D 1LUZA 1R9TH 1XNRL 4OELB 1Y1VB 3DM3A 2E5LQ 3HEJA 2YTXA 3T16A 4DAYB 1NBWA 3G4SA 3CD6A 2XWJB 1B1ZA 3ULPA 5ELNA 2VXWA 3LNNA 3S2HB 1BF4A 1FGBD 3PQIA 3VA5A 5ISRA 1E1OA 2HQEA 1ILQA 3NTIA 1XWEA 1E0BA 1FNUA 1KDCA 5HY6A 4BBRB 4MIUA 4ZRZA 1HZAA 5J3BA 5T1GA 1DD2A 1GKHA 4DNIA 1I5FA 1V9PA 1K8OA 4BA1I 4IOCA 1EU3A 1SBBB 1EIHA 1ESFA 4P71A 1X56A 3T1YQ 2BCOA 5BR8Q 1AZPA 5CV9A 3S2DH 1VQ9A 4IPCA 1HFGA 3FMCA 1EQQA 4A3CG 4OIJA 1EIYB 4IPDA 2WV6D 4KLKA 3CCLA 4I65A 3C1EA 4DU9A 1K9MC 4BY7G 2FMCA 4L5SA 3IRBA 1U9RA 3VR3A 1STNA 3EIVA 4JVZA 4N8X1 2IW3A 3S14H 2QGQA 3OIQA 1HTPA 2B29A 1VQHA 2VS1A 4I7ZC 4NXMQ 3HOZH 1TS4A 3D4WA 1Y1WH 4NB3A 1TXYA 4IUUA 4K5XA 3GV6A 2PQEA 5IODA 2XSCA 2ZTCA 4POFA 2DNCA 5LMNQ 1O7YA 2E5LL 2EIFA 4HTHA 4JOIC 4ZUIA 4DV5Q 1LTRD 2VQFL 1HR0W 1B9MA 3S1RB 4IFDG 4A3BG 5JEAH 3QB3A 3CRLC 4O2DA 1HRJA 2F0DA 3RLOA 4FXDA 2F0GA 2JA5B 3SEBA 3E5SA 1VQPA 2I5LX 1A2UA 3MXUA 4JW0A 1MJEA 1VCIA 4UY8C 1AH9A 1BO0A 1H95A 4UP9A 1L1OB 2LY7A 1LM0A 3CC7A 3BZKA 1VQNA 3C2PA 2MPMA 2NN6G 1TWHB 1W2BA 2KEEA 2A69D 2MO0A 1T9HA 1VQEA 1WCMB 3EA6A 1G291 4XYOA 4HJ7A 1YNNC 4RA8A 3HZXA 1CA6A 3BDOA 1CQVA 2JEAI 4XTCS 5CYUA 3CHBD 4AH6A 4ULLA 1SNCA 4JI8Q 4CHTB 1RTNA 1SJHD 2CW0D 1Q1EA 2K03A 3I55A 3VR2A 1OO9B 1LTLA 4WRDA 2Q2TA 4FF2A 2K6AA 1SYBA 1Q81C 5JPNC 1X65A 3VR4A 3TP5A 3W1BA 4U673 1TWHH 5LMNL 2ES2A 1SYDA 4GN4B 4IALA 1AP0A 4TRDA 1G2TA 4JI2Q 3KJPA 5C44H 2YV5A 3S1QH 3WOEA 4H7BA 2SDFA 1XPUA 1KNAA 1R4QB 2HIXA 3GDEA 4DR1Q 4R4QA 1WI5A 3HRZC 2WAQB 1GUOA 2G9HD 5E4XA 1GUSA 3NBHB 1B4OA 2OTLA 1LTID 4A3CH 1PRTF 4F8MA 4GOPC 1UWVA 4C56C 4A3FG 3LWUA 1MSHA 1KRTA 1IBKQ 2CQAA 4GKJQ 1M4VA 4JV5L 4CJ1B 1RD9D 2F0QA 4LF8Q 1JORA 1S3OA 1QNUA 4MTKA 1XX8A 3OW2A 3TSSA 4C3IG 2SOBA 1C8CA 4KMUC 5KYIA 2Z1CA 3J7AF 3U9OA 3JAMc 3RN2A 2K33A 1FR3A 2XIWA 4G4KA 4M1UB 4X62L 5I2XA 4C3IB 4L5RC 1LYLA 1HUMA 3NHHA 2PW5A 1BBXC 5C5MA 3A7AB 5NUCA 3FDTA 1IYVA 2JEBI 3MFGA 4NDXA 2OXPA 5CV8A 2L55A 3H3VC 3OIPA 2NWGA 1EFWA 3H6MA 1IKMA 4HJ9A 2YYZA 1B3QA 2YTVA 4WJ4A 3F2CA 4JI6L 1HJPA 2DN8A 2I46A 2JA7H 2NN6H 4A4IA 3M9BA 3P20A 1PTOB 2K4KA 1DM0B 2D9UA 1XNQL 1NCVA 4FDBA 5HGQA 2M2LA 2NVQB 2KCTA 2PMZE 1ONLA 3KF6B 4LF8L 1F2LA 1HXYD 2ZXRA 3FKIH 2B2TC 1M8AA 1YVCA 3PUWA 3CCEA 1TQOA 1I4GA 1KDAA 3T51B 3VYUA 4PV1C 3CXCA 1JE4A 2Q2IA 2WKCA 4YHHL 3M4PA 1S5ED 4CDDC 2E2JB 4DUYL 4EX5A 4A3EH 4CDCC 2KUMA 3IL8A 3H3VI 1CKOA 5FJ8H 1BKBA 1PA6A 1NSNS 3M7NA 4LW1A 4HIDA 2IPKD 5JVG3 2PNHA 2XTIA 3P75A 1TS5A 5GAHC 3U4VA 4DV1Q 1PH6A 3RZOH 4K2KA 3NQTA 2RA4A 4LF5Q 3KF8B 4LFBQ 2KA7A 3PO3B 4BY1H 2A6HC 4RCOA 2KCNA 1LLRD 4CDEC 1PH9A 1F77A 2K14A 3U4ZA 4A3JB 3DM1A 3Q24A 5M3FH 1PRTB 2EYOA 1HR0Q 1QE6A 3STBD 4A93H 4ILWA 1V8QA 1QILA 2DY7A 4GLXA 2YU9H 1PH4A 1WTRA 1AEXA 3PCOB 3D0FA 1XMOL 1LTBD 1N34L 2OWOA 1Q90A 3TN2A 1SNQA 4O1NA 5FOBB 3KUPA 1JT8A 3I4NB 1ZEQX 4PG3A 4IJHA 1FNVA 2CH4A 1TY2A 2AQ2B 4M8AA 2L1BA 1TS3A 2X6GA 3MZ5A 3RZOB 4C3HH 5E4WC 1F2MA 1G8ZD 3G48A 2L0CA 3S2HH 5LMNW 1HPCA 1X6OA 4KY6A 4GLVB 1WOCA 2R61A 1FNWA 1BCPC 4HSPA 1VQLA 2PMZB 3HOXG 4KHZA 2IX1A 1MSGA 3H0GG 1TWFH 3CQZH 1QZGA 4RG1A 5M3FG 3GTGB 3ERQA 2MQHA 3GV3A 5I2YA 3HOXB 3H0GB 1KDBA 4KD3A 1PFMA 2O5IC 1P8LA 2NZ1D 3S16B 1D1IA 1PYSB 1QOHA 1GHKA 1YNXA 3K57A 4A3GH 2KBNA 3L9AX 1LT5D 1MI2A 4BY1G 4DAPA 3L3OC 3I7FA 3TBIB 3PO3H 1F2YA 3M3YB 4YCUA 4QMGA 1SNPA 1IBML 2RCNA 3MC0B 1WTOA 1CI3M 1FJGQ 1JC7A 2JQOA 2RSNA 3S1MB 1SE8A 2LSSA 3I3CA 1BUVT 5HGTA 1WTPA 3MEHA 1R9TB 3TZUA 3OYYA 5KRUA 1VQ5A 4OO1I 3UDFA 5C0XG 4IQZA 2EJMA 4BBSB 2D5DA 1HZCA 3MTSA 1KHIA 1YNJD 3S1RH 1ENCA 4BBSG 3W1GA 4DGZA 1J8IA 2K52A 1STAA 2L9HA 3I4OA 3JAME 3I56A 1SFOB 2BOSA 2F0UA 2JA5H 4R4CA 5CMDA 4K6DA 3UE0A 4P73A 2JE6I 3BVMA 1AFPA 4JOIA 3S17B 1EQRA 1VQBA 4JPBW 1EIFA 1H9SB 4R1JA 5T1IA 4XQQA 1EU4A 5JVH3 1BCPD 1S72A 1IBLQ 4KY5A 4CKCA 4IUQA 1OXSC 3A5UA 4ALPA 1GUNA 1K8MA 5AJ3L 5DM73 1EY6A 3BYYB 4IUNA 1OXUA 4P74A 1IL8A 3K5MA 1Q1BA 1Y1VG 3D8GA 1EYDA 2E74C 5K5PA 3OTOL 4GNXC 3CQZB 1VQDA 4C3IH 1KD1C 1TWAH 4HN7A 1CM9A 1H9KA 3M3YH 3RN5A 1EY4A 3N52A 2DUDA 5M9OA 2F1MA 4BBRG 5LHY1 1ASYA 1RJTA 1QJOA 1STYA 5KYLA 1I6VC 4DK0A 1Z9FA 1K3RA 3HOWG 2IX3A 1D1KA 2NTTA 4JI4Q 1HTLD 2KHIA 1MHWC 1VQJA 1HZ9A 2K04A 4A3JH 5FKAC 5G3LD 1Q86C 4PNYA 1SAPA 2VZAA 1MGSA 2PO4A 4DAYA 4B3SQ 3IFDA 1EFID 1FD7D 1T5EA 4RKLA 5TSSA 2KCCA 3PIO3 2KECA 3DWPA 1SYEA 2F3VA 4ME3A 1WTQA 4QCLA 3NEMA 2PZWA 3J81j 1WJJA 2K5DA 3KDFB 1UNSA 3Q8DA 3EFXD 3KF8A 2MNAA 4LFCQ 1STHA 1IW7C 1LACA 3G6JB 2KQ3A 3CCUA 1FVIA 5C6AA 1UE6A 2ZM6Q 2E8GA 2EY5A 4A3DH 1SE2A 1L1OA 2HUGA 1GOZA 4LK1C 2CWAA 4TKOB 1PV4A 5M5YH 1I4PA 4GN3B 2PCFB 2JA8G 2NZHA 3HOYB 1PH3A 2Q8RE 4LFBL 4GOPB 4DR3Q 3AFQA 2JP1A 1QZHA 5CGKA 3EQLC 4YWKA 2HIVA 2N55A 1I4HA 4LUOA 4QL5A 4BXXH 3I2ZA 4Q0FA 4FXGC 3DXJC 2UUBQ 2BE5D 2ZJPA 3FKIG 5CV4A 1F2ZA 1IW7D 2AWNA 3I4LA 3OWFA 4RWSC 1PLFA 2RHQB 4OEMB 4AIMA 3D6WA 4J6HA 3BU2A 3MEFA 3KDFA 2Z6KA 1LV9A 4A3IG 1E24A 4X3KA 2RCFA 3HOUH 1OXTA 3VR5A 4HJ5A 3AU7A 3BJUA 5H1SE 5IGFA 1KTKA 2RBMA 3S15H 3HKZB 2QW7A 4PZ7A 4V0BA 3HGBA 4LFAQ 4C3JB 2ATWA 1PTOC 1X3PA 3UE1A 3I4NH 3EVQA 3OTOQ 2GN5A 4U68A 1XNRQ 1SNMA 5LMUQ 5KEEA 3BYTB 2OQ0A 3KYHC 4LFCL 2E2JH 1GO3E 5C4JB 1B2TA 1AE2A 3T56B 4I7AA 1EY0A 1DZ1A 2PZTA 2PI2A 4A75A 1C7YA 1U4RA 4B3TL 4JCVE 1K3BC 4K14A 1I94Q 2K28A 3CCRA 2KHSA 5C3EG 4JC0A 2A19A 4DR2L 3J7ZC 2B2UC 3GTPB 2GVBA 4OGQC 3X3NA 2IWHA 1W6KA 2AKWB 1L0XB 3GTMB 2R93G 3CW2C 5I6WA 5EPLA 1BOSA 3EN2A 1PXUA 1UAPA 2AMCB 4AYBG 4FF1A 1BBUA 3CCQA 3KBGA 4X62Q 4QQBX 4OHJA 1D5ZC 2EXZA 3K5OA 5JAVA 1XPRA 4DUYQ 1VQAA 4AYBB 2V1CC 2ASBA 1VQCA 2MUYA 2ZTDA 3GTKB 1O80A 1Y14B 2B2UA 2R92B 3K5NA 4RGTA 3P7JA 3GTOH 1XMQQ 4A3IH 1MJCA 3CP0A 1NR4A 2QEXA 4CBVA 4RCNA 3I4MB 2YU9B 3J81L 4FF4A 1NUCA 3ND9A 1RHPA 1JWSD 2CFMA 1PH8A 3SHLA 1MIUA 1YNJC 5IY0A 3KLSA 1EY5A 1ZXTA 1HA5A 1GUTA 1SR3A 1KLGD 1PFSA 5AJ3Q 1VS0A 1B70B 5E3FA 2ZJRA 4A3LG 3J80i 1Z7TA 2NYZD 4A3MH 4MHEA 2CVRA 1KL9A 1VQMA 2ALYB 4KJNA 4LUZA 2N88A 2JJQA 1TS2A 4RHRA 3PUZA 2TSSA 4JI4L 3K7AB 3L7ZC 4IPHA 3TDQA 4KI0A 2B3GA 5IP9G 2JA6H 2AQ1B 1K8GA 5C44B 3S1QB 2HT1A 3O13A 3TZDA 3BG3A 3BVGA 1PDQA 3GTLH 4A3MB 4BBRH 4HR7B 1EY8A 4A3BH 5D3DA 1PYBA 4H13C 1I3QB 3K0XA 5CV6A 5KNBA 3IFTA 5C0XI 1C48A 4RMFA 1LTGD 1I4RA 1NR2A 2XRQD 1V1OA 1SNDA 4BA2I 4C3HG 4F88A 1HNZQ 1YBYA 4IPGA 1O7IA 3SR1A 3K80C 3CRKC 2WAQG 3MWYW 5FO8B 3J81c 3CC4A 2OF1A 3A54A 3B6YA 2EVBA 4OX9L 4Q5VA 4DAVA 4A3FB 2Z4IA 3HOVH 2QILA 1OXXK 4OO1G 4BY7H 1X9NA 2B2YC 5FLMG 4DV7L 3KK7A 4C2MH 4JI1Q 3E0JA 3VDYA 3CAMA 3CKIB 2F0JA 1SYFA 4FVMA 1LTAD 2F0LA 4DV6L 1F9RA 1SXTA 1KRSA 4DXFA 1V1PA 4DV0Q 4A93G 1Y1VH 2A5HA 3NBIA 4X64Q 1Y1WG 5I4DA 2WINB 2EPBA 3HOZG 1C9OA 4B3RL 2WP8J 4LUVA 2Q2HA 1QUQB 2EQSA 3WOFA 1JB7A 5BN3A 3AMUA 2L12A 4FO2A 1ASZA 3A74A 4DK6C 4RAUC 1K83B 3J7YW 1WD1A 2LXJA 1PTOD 3LX0A 1DONA 2EYLA 1ET9A 1JJCB 1PZID 3CPFA 1C0AA 3C1FA 2D2CC 5DM63 3GTPH 1TT2A 1WFQA 3I4NG 3IAYA 3GTJB 1MKHA 3NWTA 2G5DA 3QIAA 2L5TA 1B7YB 3OOCA 4DNTB 2Y0SG 5L37A 2QDBA 4GKKL 1DGSA 3MFYA 1JOKA 3M85A 1ESRA 5J22A 4GZYC 2BA0A 3AFPA 2K5WA 1XTCD 2B2WC 2H4OA 2NUCA 2J4XA 5IOCA 4K0KQ 2XNAC 1Y8NB 2ZTEA 1A2TA 4DN4M 3G6EA 3ULJA 2JA6G 1H9MA 1I50B 4A76A 3I91A 4XIGS 1X54A 4YY3L 4OWXB 5EJWA 3HOUB 4GS3A 1EEID 1W6JA 1TWCH 5ELEA 2A73B 4DV0L 3A0JA 4TSSA 5DNFA 2UU9L 4LF5L 3T1YL 3RLFA 4G7HC 2CKZB 2QDLA 2BA1A 2CH4W 4GLAC 4XDXA 2OTJA 5KIXA 4DNRB 4XT3B 2DNEA 1C4QA 3I72A 3DHQA 1PH2A 1JJ2A 2EJFC 3UDXA 4C1NK 1IZ6A 4LAAA 4DAMA 1QVFA 1K28A 2R7DA 4H44C 2X6LA 3OHXC 1K8AC 4XYQA 4A3DG 1CQFA 1STBA 4A3JG 3S2DB 1H9RA 5D3IB 5EAYA 4RH6A 5C5LA 5IGEA 4R9WA 1E2WA 1A8VA 1HCZA 4UP8A 1KABA 1V43A 2E2HH 2FINB 5C4ZA 5E7NA 3F8TA 1PHJA 5JJLA 2RDHA 4LWCA 2H1EA 4ME5A 5EQ0A 1IKLA 3PO2H 1Y8OB 1GD7A 3BVZA 3JAMi 3GTOB 2K75A 4KTAA 1UEBA 4Y7NB 2N49A 4R8NA 4JI2L 4O0AA 3ER0A 3E9HA 1KAWA 1L0WA 2F0VA 3QOLA 2EY2A 5IIFA 1XJVA 3NTHA 3BZCA 1EWIA 3F1ZA 3NPPA 1DJRD 1CKNB 5IP7H 1CUKA 2F3IA 2SNSA 4BWGB 4X6AH 2YTYA 1B8AA 3NQIA 2L4NA 3CCSA 2I5MX 5EGTA 2JK8A 4KHVA 1D5MC 2HDMA 5FO9B 2UXCQ 4CJ0B 3GO5A 3FHWA 2A6ED 4FP5D 3FPUB 1Z47A 2N78A 4B3ML 3OMCA 3GD7A 4UHVA 1S5CD 2ID0A 4JI5L 5EKKA 3AEVA 3FEWX 1EQTA 3A56A 1AZQA 3D4DA 1JB3A 2FXQA 5GADC 2F0WA 1WCMG 4POGA 2SEBD 1E1TA 1HUNA 4RHSA 3TP7A 3UI2A 2P5ZX 3SE0A 4QGUA 3WDNA 1WTHA 3FVQA 1PFBA 2Z4HA 4V190 3AYHB 4GOPA 3MHBA 5JOBA 2VY3A 1II3A 4JBKA 2DY8A 4K6LA 3CCVA 3GTQH 5IE8A 1EIGA 2R7ZH 3J81E 3ND8A 3KLRA 2JSOA 3RZDH 1CK1A 3SVMA 3HG9A 1IBMQ 1PH5A 3K5LA 1N33L 4G57A 1JCKB 3A7LA 4P75A 4OX9Q 2N3SA 4HJAA 1VQGA 2F0EA 4GNXB 4L8JA 5IYBG 1N32L 1DOKA 4JYAL 4FYDA 1DOMA 2BH2A 1SE4A 1MBYA 4EVOA 4DV5L 1JOOA 1GUWA 2KEDA 4JI6Q 5JJKA 1S4ZA 1IBKL 4L5TA 4XQJA 1TVXA 1RF2D 3TMEA 1S40A 2RKSA 5KGUA 4X66L 1YEZA 1LO5D 3QWNA 4LF4L 3GQBA 4DV4Q 3HOWH 2UUCQ 2UXBL 5M5WB 1B44D 2EY6A 4QF4A 4X3SA 1GXDC 1AE3A 3BS1A 3S14B 1FGUA 4DR5Q 4IFDJ 4X66Q 3NP8A 4Z9CB 3MVVA 3PF5A 3HKZG 4JI0L 4LF4Q 1CSQA 2DJGC 4JBJA 4ZQ3A 2BDNA 2B63B 5BN4A 3GTKH 1KNEA 2A1AA 4UP7A 3R2TA 1SE3A 2KOLA 2OT2A 3J80L 4AQYQ 3KLWA 1EEFD 4HIOA 2F52A 4YY3Q 5CV7A 1D8LA 2UUAL 3HOWB 4IUTA 4HCSA 5EKIA 2MO1A 1NTGA 1GHJA 2C5CA 1PZKD 2F0NA 1JICA 1U0LA 1I4XA 3WWVA 2VUMH 3RD4A 1R4PB 2PZUA 2ZM6L 4KKTA 2Q8TA 4DK1A 2IHEA 1EYCA 1TIID 2IT1A 2WB1G 1TU2B 2NVTB 4FNFA 5LL6S 1VQ6A 2WB1B 2OQKA 1U4LA 2MJ8A 2R93B 1VQ7A 3T1HL 4BBSH 3R8BA 2ICIA 3HP3A 4BY7B 1L2FA 1X55A 1Z6HA 2AHOB 3RZDB 4DR2Q 1UEAB 4EQ5A 4MTNA 2BDOA 2NB0A 2EE1A 1XMOQ 4IUVA 5IGGA 2LKVA 5ELCA 1G6PA 2UXBQ 1NY4A 2NN6I 3L0OA 4JYAQ 2Q2UA 2RHSB 3K8AA 4DK3C 3CCMA 4JI8L 4TVAB 2J7ZA 2OEOA 3OMGA 4N8FA 4IFDH 4LNQA 3HFZB 3Q6SA 3I4MG 2O5JC 1SJED 5GROA 4DR6Q 3RLNA 5C0XH 4A3BB 1HQMC 4OXPA 2RDFA 3HKSA 4QIWB 4A3KB 1N8RC 4OIKA 5DEHA 2WKDA 4NXNQ 1B9NA 1I4QA 3K7UC 2JA5G 2E2HB 2CHBD 5IGCA 2VL6A 5ELBA 1M1KC 3ITPA 2AUJD 5EPKA 3PO3G 1N9WA 4MN3A 2K05A 2JA7B 5C4XG 4KD4A 5D65A 5M5WH 1FJGL 2CCZA 1CZWA 1ZYRC 3M4OB 1TR5A 2F0OA 1GM5A 4PZ6A 2LS01 5LMUL 4A3GB 1UE5A 4P2CB 4NMZA 4K8JA 4X65L 2AWOA 1B53A 4A3GG 4ZK9B 1YIJA 5IP7G 2A68C 3E3XA 3C46A 1PZJD 1J9OA 3ERSX 4DF7A 2EZVA 1YJNA 1HNZL 4NW2A 1CHPD 1F9PA 2VUMG 2HHHQ 2PW7A 2PQAB 2RVLA 1SYGA 2QF7A 2VNUD 2MFIA 2E76C 5G3LF 4B9XA 2NVXH 2IJ0A 4EQPA 4DR4Q 4AYBE 1TWCB 4KN4C 3NXWA 3SDZA 2EYFA 2C9OA 2O2LD 1A15A 1SMXA 5GQOA 1STEA 3LGJA 3EJIA 4HEDA 1QVCA 5COYA 1MD2D 4C1NI 4C3HB 4JI5Q 1A3TA 1CTMA 2F3WA 1TKWB 3MXPA 1WTVA 1ICWA 2K1BA 4KKUA 4WJ3M 1HNXL 3H0GH 1JJGA 2A8VA 5IYDH 1YHAA 4OL7A 4ZAIA 4Y52H 4NKLA 1E2VA 1SRUA 3E0EA 2LMCB 3VA7A 4QY7A 1CA5A 4ZUJA 1TWFB 1EOTA 1U4MA 2QCPX 3BDCA 3K81C 1S5FD 3CU7A 5A35A 2R92G 1D2BA 3PF4A 1SNOA 2E75C 2Z6KC 3KLSX 2B2TA 5FK9C 4JI7L 1CHQD 3NBHA 5AFWA 2EOTA 3PSIA 3STBC 1YHQA 2UUCL 3A5ZB 4IFDI 1SSOA 4LJZC 5KNCA 3CPWA 1Y69U 4C2MB 1VMPA 1GVPA 2ZXOA 4NXNL 1Y8PB 5FJ8G 3SK8A 3K59A 4ABNA 5K36H 3PUYA 4J15A 2O4XA 4LF9Q 3A8KE 3E9IA 4YWLA 4DV1L 4A3EB 4XQNA 2K50A 4LF7L 3G7LA 4F87A 3T13A 1YNND 3I8ZA 1Q8IA 3QOJA 5CV5A 1E22A 5FO7B 1EYAA 2B2YA 4A3EG 3FP9A 2KJXA 4HAEA 2Q8IB 1B3AA 5M3MB 1TY0A 2LXKA 1FYCA 4RGMA 1YZ6A 2MHVA 4HMJA 3M7GA 1HQRD 5M3MG 3TP6A 1LT4D 2BE5C 3SXHA 3PUXA 4YHHQ 3EBEA 4JI0Q 3GTJH 4N9PA 1N34Q 2GVAA 3PUVA 1RDPD 3V2TA 1T5XD 4KV6A 3S9WA 3AB9A 4K5WA 3DLLA 1X3QA 1A0IA 2HQLA 2F0KA 1BQQT 5IWAL 2K5HA 4G7ZC 3I73A 3F2UA 1U4PA 4YWMA 1GJXA 5ELDA 4E6IA 4L63B 5IYCG 4JBMA 3T4AC 1Q12A 1N33Q 4HMIA 1E3PA 3HOVB 3Q22A 1G2SA 3IKJA 1EOVA 2D0PA 2M00A 1HH2P 3URYA 4KY7A 2ZJQA 3C3LA 3HOVG 2IHFA 2HCIA 1RKNA 3JAML 3AQQA 3CMAA 2ENBA 4N9TA 5EBDA 3QO2A 1HHVA 3CC2A 3I90A 4IURA 2ICEC 3R93A 2F4VL 2JXMB 1IL2A 3K7AH 2B2WA 2WB1E 1PH1A 4J8QA 2PPBC 2NVYB 1IYJB 1EUJA 2SNMA 3K6OA 1V1PB 4R4IA 5KNDA 3TS2A 3QJYA 1OTCA 1PVOA 1O7LA 4EQOA 1D7QA 1KIXA 1A62A 5C0XJ 1FL0A 2WACA 5C3XA 1K0SA 2VB2X 3T1HQ 2KCMA 2PYKA 4B3RQ 1DOLA 4B3SL 4OWWB 1LT3D 2GA4B 3OW7A 2QA4A 4JV5Q 3DEOA 4X3UA 3MXGA 3HS0C 3OPOA 4HCEA 4C3JH 4OONA 1NMGA 1Q3LA 4QJFA 5HURA 2XN9C 4OWTB 1K73C 2JYOA 2V4DA 1YJ9A 3J81i 4CJ2C 1V1QA 1TWGH 4JI3L 2RSOA 1BR9A 4LFAL 3A8JE 5IP9H 2NVXB 1IYUA 2FMMA 2QEJC 3FPPA 3PV0A 1H9SA 2DJFC 3J7A5 3TS0A 3NK9A 2Z9HA 3J80E 2K5VA 2IX0A 3T53B 5JEAJ 1YJWA 4DUZQ 1K83H 4EGVA 1VQIA 4DR1L 4CKBA 5IYCH 1WVLA 1HNWL 2EY1A 1KAAA 1XTDA 2FJ2A 5LL6X 2WIIB 2JA6B 4IZ8A 4ZCKA 1VQKA 3GTLB 4DR4L 3A55A 1AW7A 4BS9A 3M4OH 4PMWA 5ELOA 4K5VA 2L11A 3S15B 4A3IB 1L0YB 1EL0A 1M90C 1SDFA 5A2QL 4LMQD 1JOQA 4NPSA 2A69C 2B2VA 4KKSA 3U9SA 1VDZA 4GN5A 3NSWA 4DV2Q 5CBEE 3I4MH 4K0KL 3PGZA 3U58A 1JE5A 4TQUS 3J80c 2IL8A 5CORA 1RL2A 1Q8KA 2X69A 4C3JG 1E2ZA 3ZJYC 3KFUA 2NBFA 1WTWA 1XXGA 5IT9c 1ENAA 3SK4A 4QUCA 1G6ZA 1ICFB 5ELFA 2HHHL 1LABA 4KHPL 4EQNA 1BCPB 3MXNA 3NELA 4ZLTF 2B2VC 1IHZA 2I5HA 1PTOF 1HNXQ 1EQVA 2D62A 1VF7A 3VYRA 4YIJA 1ML0D 2NTSA 1EWHA 1J6QA 2CWPA 2MGSA 3CCJA 1CKMA 1WTXA 3K0YA 1RCVD 4K8IA 1SN8A 3VYTA 2BH8A 2A6EC 5DLQE 2IY5B 3HKZE 3OSOA 3GTMH 4LF7Q 3NUCA 2KHJA 5GAEC 4CKEA 3GP7A 2XVSA 3ULLA 4X3TA 1J5EQ 5IYDG 4DV6Q 4JK1C 5FLMH 2Z6BA 1NAPA 5C4JH 2MP1A 3EROA 3RUZA 3DWAA 4DR7L 1HA6A 1OXVA 1QVGA 1O7ZA 1N36Q 3MXNB 2ZT9C 2R92H 2H5XA 2AQ3B 4JI1L 2XGTA 1YI2A 1L1OC 3BZDB 1BXTA 2EYPA 4JI7Q 3QG1A 1VQFA 4S3SA 2RF4A 4QUFA 4A3FH 4DV3L 5CC4A 4ZKBB 3H15A
chains in the Genus database with same CATH topology
3N6RA 1I6HB 1PMRA 1A3UA 1CFMA 3I70A 4FF3A 4R8IA 4L6TB 3ZYYX 3W2DA 1TWAB 2EJGC 1LTTD 1JWMD 4UAIA 5M5YB 3Q0AA 1EY7A 3NE5B 1ZYRD 3DWQA 2RQXA 1LT6D 3D6CA 4FXKC 2VB3X 5D14A 5K36G 1H9JA 4XXEA 3D31A 3D4RA 4XT1B 3R2IA 5C4HA 3NTKA 1ENFA 3KBXA 4F7XA 3DUZA 2TMPA 4IUPA 5JJZA 1ILPA 3PMFA 1JR0D 1VF5C 1QB5D 3MA2B 1QCBD 1RODA 1F9SA 3DMUA 4PMBA 1SMYC 2KVMA 3TP8A 3Q23A 2JA8B 4H0LC 1VMCA 4DXGA 4KN7C 3A8IE 4B9WA 2QKIC 2R7ZB 5IT9E 3D3RA 4IN3A 3LWEA 3FKIB 2F0PA 4DFAA 1EZ8A 5C4XB 2E2IB 2B39A 2F0FA 3H09A 1Y1WB 5FLXL 3HOZB 2AUKA 1S5DD 3MAQA 4ODGA 1TWGB 4O42A 5IGDA 5J39A 2VUMB 4ID6A 1EWCA 5FLXE 4K2LA 3ONAB 4DA2A 2F0HA 5BN5A 5CBAE 2I07B 4J1MA 3E6ZX 2G9DA 3S1NB 2Y0SB 1CZGA 2A74C 3SK5A 4PMCA 2Z8LA 2ZXPA 5C3EB 1O78A 2EDGA 3PO2B 1A6XA 4WJWA 2RDGA 2K5QA 1F9QA 3W3AA 3VYSA 3V05A 5EBCA 2E2DC 1D6EC 1S5BD 4WORA 2HCCA 3PIP3 4RGOS 4B08A 2F0IA 2F4IA 2K32A 1SMYD 2EYHA 1BNZA 1EY9A 1BCPF 1DYQA 5IGBA 5M5XB 2CW0C 5I9PA 4CGYB 2J0TD 2FHTA 4BY1B 4WFN3 4PQXA 3H94A 2F0MA 2F03A 1A3VA 3V96A 3P1HA 5I6YA 3RMHA 4A3DB 1LTSD 3R3OA 5F2DA 1RTOA 5A2QE 1WD0A 2K7VA 1QNKA 1HFNA 3X3MA 2LFNA 2XRSD 3BDLA 4G7OC 4RGNA 4HSVA 3GTQB 1STGA 5I9OA 4NP5A 1QWYA 3NWSA 2FFKB 4ZYSA 1X32A 3J7AV 2PNRC 3VR6A 1JQYD 2EYMA 3DEPA 1AN8A 3H91A 3FRPB 4KJOA 1BDOA 1SEBD 1GUGA 1PTOH 5M3FB 2EYJA 5CR3A 3OWEB 2XWBB 5DAUA 1DCZA 2B8FA 2B8GA 1DXMA 1JWUD 1UUPA 2K01A 4A93B 4RKBA 1B50A 1SYCA 2A68D 4JBWA 4OO1H 3SK6A 2F0TA 1PFNA 2R3ZA 2A6HD 5EKLA 5EPJA 1D5XC 1KLUD 2F0SA 5J1ZA 1PYWD 3M4YA 4UDUC 1PRTD 5IT9L 5JEAG 2HDLA 4ZKCB 1QG7A 5E1FA 1G91A 4QB4A 1EZ6A 4RFBA 2R6GA 1XYIA 1ZKOA 5JPMC 4KK7A 1PRTC 5C3WA 2M9VA 1ET6A 3K58A 1CT1D 1Y1VB 3HEJA 3T16A 2XWJB 1B1ZA 2VXWA 3LNNA 3S2HB 1BF4A 1FGBD 3VA5A 5ISRA 2HQEA 1ILQA 3NTIA 1XWEA 1E0BA 1FNUA 1KDCA 4BBRB 4MIUA 4ZRZA 1DD2A 5T1GA 1K8OA 4BA1I 1EU3A 1SBBB 1EIHA 1ESFA 2BCOA 1AZPA 5CV9A 1HFGA 3FMCA 4OIJA 2WV6D 4I65A 3C1EA 4DU9A 2FMCA 1U9RA 3VR3A 1STNA 2IW3A 3OIQA 1HTPA 4I7ZC 1TS4A 3D4WA 4IUUA 4K5XA 3GV6A 2PQEA 5IODA 2XSCA 2DNCA 1O7YA 4HTHA 4ZUIA 1LTRD 1B9MA 3S1RB 4IFDG 5JEAH 3QB3A 3CRLC 1HRJA 2F0DA 4FXDA 2F0GA 2JA5B 3SEBA 3E5SA 1A2UA 3MXUA 1VCIA 1BO0A 2LY7A 3C2PA 2MPMA 2NN6G 1TWHB 2KEEA 2A69D 1WCMB 3EA6A 1G291 4XYOA 1YNNC 4RA8A 3HZXA 1CA6A 3BDOA 1CQVA 2JEAI 4XTCS 5CYUA 3CHBD 4ULLA 1SNCA 4CHTB 1RTNA 1SJHD 2CW0D 1Q1EA 2K03A 3VR2A 1OO9B 4WRDA 4FF2A 2K6AA 1SYBA 5JPNC 3VR4A 3TP5A 4U673 1SYDA 4IALA 1AP0A 4TRDA 1G2TA 3WOEA 4H7BA 2SDFA 1KNAA 1R4QB 3HRZC 2WAQB 1GUOA 2G9HD 5E4XA 1GUSA 1B4OA 1LTID 1PRTF 4F8MA 4C56C 3LWUA 1MSHA 2CQAA 1M4VA 4CJ1B 1RD9D 2F0QA 1JORA 1QNUA 1XX8A 3TSSA 4C3IG 2SOBA 1C8CA 4KMUC 5KYIA 2Z1CA 3J7AF 3U9OA 2K33A 1FR3A 2XIWA 4G4KA 4M1UB 5I2XA 4C3IB 1HUMA 3NHHA 2PW5A 1BBXC 5C5MA 3A7AB 5NUCA 3FDTA 1IYVA 2JEBI 3MFGA 4NDXA 2OXPA 5CV8A 2L55A 3H3VC 3OIPA 2NWGA 3H6MA 1IKMA 2YYZA 2DN8A 2I46A 2NN6H 3P20A 1PTOB 1DM0B 2D9UA 1NCVA 2M2LA 2NVQB 1ONLA 1F2LA 1HXYD 2ZXRA 2B2TC 1M8AA 3PUWA 1TQOA 1I4GA 1KDAA 3T51B 3VYUA 4PV1C 1JE4A 2WKCA 1S5ED 2E2JB 2KUMA 3IL8A 1NSNS 3M7NA 2IPKD 5JVG3 3P75A 1TS5A 4K2KA 3NQTA 2RA4A 2KA7A 3PO3B 2A6HC 4RCOA 2KCNA 1LLRD 1F77A 4A3JB 3DM1A 3Q24A 1PRTB 2EYOA 1QE6A 4ILWA 1V8QA 1QILA 2DY7A 1WTRA 1AEXA 1LTBD 1Q90A 3TN2A 1SNQA 4O1NA 5FOBB 3KUPA 3I4NB 1ZEQX 1FNVA 1TY2A 2AQ2B 4M8AA 2L1BA 1TS3A 2X6GA 3MZ5A 3RZOB 5E4WC 1F2MA 1G8ZD 2L0CA 1HPCA 4KY6A 2R61A 1FNWA 1BCPC 4HSPA 2PMZB 2IX1A 4KHZA 1MSGA 3GTGB 3ERQA 3GV3A 5I2YA 3HOXB 3H0GB 1KDBA 4KD3A 1PFMA 2O5IC 2NZ1D 3S16B 1D1IA 1QOHA 1GHKA 3K57A 3L9AX 1LT5D 1MI2A 4DAPA 3L3OC 3TBIB 1F2YA 3M3YB 4QMGA 1SNPA 3MC0B 1WTOA 1CI3M 1JC7A 2RSNA 3S1MB 3I3CA 1BUVT 5HGTA 1WTPA 3MEHA 1R9TB 3TZUA 5KRUA 4OO1I 5C0XG 4IQZA 2EJMA 4BBSB 2D5DA 3MTSA 1YNJD 1ENCA 4DGZA 1J8IA 1STAA 2L9HA 3JAME 1SFOB 2BOSA 2F0UA 5CMDA 4K6DA 2JE6I 3BVMA 1AFPA 3S17B 5JVH3 1H9SB 5T1IA 4XQQA 1EU4A 1BCPD 4KY5A 4CKCA 4IUQA 1OXSC 1GUNA 1K8MA 5DM73 1EY6A 3BYYB 4IUNA 1OXUA 1IL8A 3K5MA 1Q1BA 3D8GA 1EYDA 2E74C 5K5PA 3CQZB 4HN7A 1CM9A 1H9KA 1EY4A 3N52A 5M9OA 2F1MA 5LHY1 1RJTA 1STYA 1QJOA 5KYLA 1I6VC 4DK0A 2IX3A 1D1KA 2NTTA 1HTLD 2K04A 5FKAC 5G3LD 4PNYA 1SAPA 1MGSA 2PO4A 4DAYA 3IFDA 1EFID 1FD7D 1T5EA 4RKLA 5TSSA 2KCCA 3PIO3 2KECA 3DWPA 1SYEA 2F3VA 1WTQA 4QCLA 2PZWA 2K5DA 1UNSA 3EFXD 3KF8A 1STHA 1IW7C 1LACA 2KQ3A 3G6JB 5C6AA 2EY5A 1SE2A 2HUGA 1GOZA 4LK1C 4TKOB 1I4PA 2PCFB 3HOYB 2Q8RE 2JP1A 5CGKA 3EQLC 2N55A 1I4HA 4Q0FA 4FXGC 3DXJC 2BE5D 5CV4A 1F2ZA 1IW7D 2AWNA 3I4LA 3OWFA 4RWSC 1PLFA 3D6WA 4J6HA 1LV9A 4X3KA 1OXTA 3VR5A 3AU7A 5IGFA 1KTKA 2RBMA 3HKZB 4V0BA 3HGBA 4C3JB 1PTOC 1X3PA 3EVQA 4U68A 1SNMA 5KEEA 3BYTB 5C4JB 1B2TA 3T56B 1EY0A 1DZ1A 2PZTA 1U4RA 4K14A 2K28A 2KHSA 2B2UC 3GTPB 4OGQC 3X3NA 2IWHA 1W6KA 1L0XB 3GTMB 5I6WA 5EPLA 1BOSA 1PXUA 1UAPA 4FF1A 3KBGA 4OHJA 1D5ZC 2EXZA 3K5OA 5JAVA 4AYBB 2MUYA 3GTKB 1O80A 2B2UA 2R92B 3K5NA 4RGTA 3P7JA 1NR4A 4CBVA 4RCNA 3I4MB 2YU9B 3J81L 4FF4A 1NUCA 3ND9A 1RHPA 1JWSD 3SHLA 1YNJC 3KLSA 1EY5A 1ZXTA 1HA5A 1GUTA 1KLGD 5E3FA 1Z7TA 2NYZD 4MHEA 2CVRA 4KJNA 2N88A 1TS2A 4RHRA 3PUZA 2TSSA 3K7AB 3L7ZC 3TDQA 4KI0A 2AQ1B 5C44B 3S1QB 3O13A 3TZDA 3BG3A 3BVGA 1PDQA 4A3MB 4HR7B 1EY8A 5D3DA 4H13C 1I3QB 5KNBA 5CV6A 5C0XI 3IFTA 1C48A 1LTGD 1I4RA 1NR2A 2XRQD 1V1OA 1SNDA 4BA2I 4C3HG 4F88A 3SR1A 3CRKC 3MWYW 5FO8B 2OF1A 3A54A 2EVBA 4Q5VA 4DAVA 4A3FB 2Z4IA 2QILA 1OXXK 4OO1G 2B2YC 3KK7A 3E0JA 3CKIB 2F0JA 1SYFA 4FVMA 1LTAD 2F0LA 1F9RA 1SXTA 4DXFA 1V1PA 2A5HA 3NBIA 5I4DA 2WINB 2EPBA 2WP8J 3WOFA 5BN3A 3AMUA 2L12A 4FO2A 3J7YW 4RAUC 1K83B 1WD1A 1PTOD 3LX0A 1DONA 2EYLA 1ET9A 1PZID 3C1FA 2D2CC 5DM63 1TT2A 3IAYA 3GTJB 3NWTA 3QIAA 2L5TA 3OOCA 4DNTB 2QDBA 3MFYA 1JOKA 3M85A 1ESRA 5J22A 4GZYC 2BA0A 2K5WA 1XTCD 2B2WC 2H4OA 2NUCA 2J4XA 5IOCA 2XNAC 1Y8NB 1A2TA 4DN4M 1H9MA 1I50B 3I91A 4XIGS 5EJWA 3HOUB 1EEID 1W6JA 5ELEA 2A73B 4TSSA 5DNFA 3RLFA 4G7HC 2BA1A 4XDXA 5KIXA 4DNRB 4XT3B 2DNEA 1C4QA 3I72A 3DHQA 2EJFC 4C1NK 4LAAA 4H44C 2X6LA 3OHXC 4XYQA 1CQFA 1STBA 3S2DB 1H9RA 5D3IB 4RH6A 5C5LA 5IGEA 4R9WA 1E2WA 1HCZA 1KABA 1V43A 2FINB 5C4ZA 2RDHA 2H1EA 4ME5A 5EQ0A 1IKLA 1Y8OB 3BVZA 3GTOB 4KTAA 4Y7NB 4R8NA 2F0VA 3QOLA 2EY2A 5IIFA 3NTHA 3NPPA 1DJRD 2SNSA 4BWGB 3NQIA 2L4NA 5EGTA 4KHVA 1D5MC 2HDMA 5FO9B 4CJ0B 3GO5A 2A6ED 4FP5D 3FPUB 1Z47A 3OMCA 3GD7A 1S5CD 2ID0A 5EKKA 3FEWX 1EQTA 3A56A 1AZQA 3D4DA 1JB3A 2F0WA 2SEBD 1HUNA 4RHSA 3TP7A 3UI2A 3SE0A 3WDNA 3FVQA 1PFBA 2Z4HA 4V190 3MHBA 5JOBA 1II3A 2DY8A 4K6LA 1EIGA 3J81E 3ND8A 3KLRA 2JSOA 1CK1A 3SVMA 3HG9A 3K5LA 4G57A 1JCKB 3A7LA 2F0EA 4L8JA 1DOKA 4FYDA 1DOMA 1SE4A 1MBYA 4EVOA 1JOOA 1GUWA 2KEDA 1S4ZA 4XQJA 1TVXA 1RF2D 3TMEA 2RKSA 5KGUA 1LO5D 3QWNA 3GQBA 5M5WB 1B44D 2EY6A 4QF4A 4X3SA 1GXDC 3BS1A 3S14B 4IFDJ 3NP8A 4Z9CB 3MVVA 4ZQ3A 2BDNA 2B63B 5BN4A 1KNEA 3R2TA 1SE3A 2KOLA 2OT2A 3J80L 1EEFD 5CV7A 3HOWB 4IUTA 4HCSA 5EKIA 1GHJA 2C5CA 1PZKD 2F0NA 1JICA 1I4XA 3RD4A 1R4PB 2PZUA 4KKTA 2Q8TA 4DK1A 1EYCA 1TIID 2IT1A 1TU2B 2NVTB 4FNFA 5LL6S 2WB1B 1U4LA 2MJ8A 2R93B 3R8BA 2ICIA 3HP3A 4BY7B 1Z6HA 3RZDB 1UEAB 2BDOA 2NB0A 2EE1A 4IUVA 5IGGA 2LKVA 5ELCA 2NN6I 2J7ZA 2OEOA 3OMGA 4IFDH 3Q6SA 2O5JC 1SJED 5C0XH 4A3BB 1HQMC 2RDFA 4A3KB 4QIWB 4OIKA 5DEHA 2WKDA 1B9NA 1I4QA 2E2HB 2CHBD 5IGCA 5ELBA 3ITPA 2AUJD 5EPKA 4MN3A 2K05A 2JA7B 4KD4A 5D65A 1CZWA 1ZYRC 3M4OB 1TR5A 2F0OA 2LS01 4A3GB 4P2CB 4NMZA 4K8JA 2AWOA 1B53A 4ZK9B 2A68C 3C46A 1PZJD 1J9OA 4DF7A 2EZVA 4NW2A 1CHPD 1F9PA 2PW7A 2RVLA 1SYGA 2QF7A 2VNUD 2E76C 5G3LF 4B9XA 2IJ0A 4EQPA 1TWCB 4KN4C 3NXWA 3SDZA 2EYFA 2C9OA 2O2LD 1A15A 1STEA 3EJIA 4HEDA 5COYA 1MD2D 4C1NI 4C3HB 1A3TA 1CTMA 2F3WA 1TKWB 3MXPA 1WTVA 1ICWA 2K1BA 4KKUA 4OL7A 4ZAIA 4NKLA 1E2VA 2LMCB 3VA7A 1CA5A 4ZUJA 1TWFB 1EOTA 1U4MA 2QCPX 3BDCA 1S5FD 3CU7A 5A35A 1D2BA 1SNOA 2E75C 3KLSX 5FK9C 2B2TA 1CHQD 3NBHA 5AFWA 2EOTA 4IFDI 1SSOA 4LJZC 5KNCA 1Y69U 4C2MB 1VMPA 2ZXOA 1Y8PB 3SK8A 3K59A 4ABNA 5K36H 3PUYA 2O4XA 3A8KE 4A3EB 4XQNA 3G7LA 4F87A 3T13A 1YNND 3I8ZA 1Q8IA 3QOJA 5CV5A 5FO7B 1EYAA 2B2YA 2KJXA 4HAEA 2Q8IB 1B3AA 5M3MB 1TY0A 1FYCA 4RGMA 2MHVA 4HMJA 3M7GA 1HQRD 3TP6A 1LT4D 2BE5C 3SXHA 3PUXA 4N9PA 3PUVA 1RDPD 3V2TA 1T5XD 4KV6A 3S9WA 3AB9A 4K5WA 1X3QA 2F0KA 1BQQT 4G7ZC 3I73A 3F2UA 1U4PA 1GJXA 5ELDA 4E6IA 4L63B 3T4AC 1Q12A 3HOVB 4HMIA 3Q22A 1G2SA 3IKJA 2M00A 3URYA 4KY7A 3C3LA 2HCIA 1RKNA 3JAML 5EBDA 2ENBA 4N9TA 3QO2A 1HHVA 3I90A 4IURA 2ICEC 3R93A 2JXMB 2B2WA 4J8QA 2PPBC 2NVYB 2SNMA 5KNDA 3K6OA 1V1PB 3QJYA 1O7LA 4EQOA 5C0XJ 2WACA 5C3XA 2VB2X 2PYKA 1DOLA 1LT3D 2GA4B 3OW7A 3DEOA 4X3UA 3MXGA 3HS0C 3OPOA 4HCEA 1Q3LA 5HURA 2XN9C 2JYOA 2V4DA 4CJ2C 2RSOA 1BR9A 3A8JE 2NVXB 1IYUA 2FMMA 2QEJC 3FPPA 3PV0A 1H9SA 3NK9A 3J80E 2IX0A 3T53B 5JEAJ 4EGVA 4CKBA 1WVLA 2EY1A 1KAAA 2FJ2A 5LL6X 2JA6B 2WIIB 4IZ8A 3GTLB 3A55A 1AW7A 4BS9A 4PMWA 4K5VA 2L11A 3S15B 4A3IB 1L0YB 1EL0A 1SDFA 5A2QL 4LMQD 1JOQA 2A69C 2B2VA 4KKSA 3U9SA 1VDZA 3NSWA 5CBEE 4TQUS 2IL8A 5CORA 2X69A 4C3JG 1E2ZA 2NBFA 1WTWA 1XXGA 1ENAA 3SK4A 4QUCA 1G6ZA 5ELFA 1LABA 4EQNA 1BCPB 3MXNA 4ZLTF 2B2VC 1IHZA 1PTOF 1EQVA 2D62A 1VF7A 3VYRA 4YIJA 1ML0D 2NTSA 1EWHA 2MGSA 1WTXA 3K0YA 1RCVD 4K8IA 3VYTA 2A6EC 3OSOA 3NUCA 4CKEA 3GP7A 2XVSA 4X3TA 4JK1C 1NAPA 2MP1A 3EROA 3RUZA 3DWAA 1HA6A 1OXVA 1O7ZA 2ZT9C 2AQ3B 3BZDB 1BXTA 2EYPA 3QG1A 4S3SA 4QUFA 5CC4A 4ZKBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z1C A;  3D3R A;  2OT2 A;  3VYT A;  3VYU A;  3VYR A;  3VYS A; 
#chains in the Genus database with same CATH topology
 3N6R A;  5M3M H;  4DR7 Q;  2B63 G;  1I6H B;  2KEN A;  1PMR A;  2F4V Q;  1A3U A;  1CFM A;  3I70 A;  4FF3 A;  1E7Z A;  4R8I A;  3CF5 A;  4JG2 A;  1N36 L;  4L6T B;  3ZYY X;  3W2D A;  1TWA B;  4KHP Q;  2DGY A;  2NVY H;  1VQO A;  2EJG C;  1LTT D;  1JWM D;  4UAI A;  2VW9 A;  5M5Y B;  4B3T Q;  3Q0A A;  1EY7 A;  3NE5 B;  1Q46 A;  1ZYR D;  3DWQ A;  2RQX A;  4MZ9 A;  1LT6 D;  3D6C A;  2C35 B;  4FXK C;  2VB3 X;  3M4Q A;  1G51 A;  1NNX A;  3TRE A;  4MNO A;  2UUA Q;  5D14 A;  4L5Q A;  5K36 G;  1H9J A;  4XXE A;  5C4X H;  3D31 A;  3D4R A;  4XT1 B;  4DV2 L;  3R2I A;  5C4H A;  1YHB A;  3NTK A;  5C44 G;  1P16 A;  1IXR A;  1ENF A;  3KBX A;  5IYB H;  4F7X A;  2VQE Q;  3DUZ A;  2TMP A;  4IUP A;  3TQY A;  4A3M G;  1X3E A;  3QR8 A;  5JJZ A;  1KQS A;  3PMF A;  1JR0 D;  1VF5 C;  1ILP A;  1QB5 D;  4A3L H;  3MA2 B;  1QCB D;  1ROD A;  1F9S A;  1W3S A;  1RIP A;  1I94 L;  1SLJ A;  3DMU A;  4PMB A;  3H3V H;  1SMY C;  1BVS A;  2VQE L;  2KVM A;  3TP8 A;  3Q23 A;  4X65 Q;  3KOJ A;  2R7Z G;  2JA8 B;  1BBW A;  3UDG A;  4H0L C;  1VMC A;  4DXG A;  4DUZ L;  2L15 A;  3F2D A;  4KN7 C;  3A8I E;  2Y0S E;  4B9W A;  2QKI C;  2R7Z B;  5IT9 E;  2CQO A;  3D3R A;  4IN3 A;  3LWE A;  3FKI B;  2F0P A;  4B3M Q;  4DFA A;  5M5X H;  1EZ8 A;  1QUQ A;  2JA7 G;  5C4X B;  1XMQ L;  2E2I B;  2B39 A;  2F0F A;  1XPO A;  3H09 A;  1PH7 A;  1Y1W B;  1UE7 A;  1K0R A;  4DR5 L;  4HIM A;  5FLX L;  1U5K A;  3HOZ B;  4DV3 Q;  2AUK A;  3U50 C;  4IJL A;  3RR5 A;  1S5D D;  3W5O A;  3MAQ A;  5C3E H;  4ODG A;  2NVT H;  1TWG B;  1SFO H;  1Q7Y C;  1HNW Q;  4O42 A;  3GTG H;  1VQ4 A;  2R93 H;  5IGD A;  5J39 A;  4UPA A;  2VUM B;  4ID6 A;  1EWC A;  5FLX E;  1CKN A;  2UUB L;  4K2L A;  3ONA B;  4DA2 A;  4GKJ L;  2F0H A;  5BN5 A;  5CBA E;  2I07 B;  1J5E L;  3PIO A;  4J1M A;  3E6Z X;  4PZ8 A;  2JN4 A;  2EXD A;  1NE3 A;  2G9D A;  2UXD Q;  3PO2 G;  2Y0S B;  3S1N B;  1CZG A;  2A74 C;  3SK5 A;  4JI3 Q;  4PMC A;  2Z8L A;  2ZXP A;  3HOX H;  2WFW A;  5C3E B;  1O78 A;  2EDG A;  3PO2 B;  1A6X A;  4WJW A;  1Q82 C;  2RDG A;  2D0O A;  2K5Q A;  4AQY L;  1F9Q A;  3W3A A;  4Y7N H;  3VYS A;  3V05 A;  5EBC A;  2E2D C;  1IBL L;  1D6E C;  1S5B D;  4WOR A;  1EYG A;  3S1M H;  2HCC A;  5BR8 L;  3PIP 3;  2OCE A;  4RGO S;  1JMC A;  4DV7 Q;  4B08 A;  3JC6 6;  2F0I A;  3HOU G;  2F4I A;  2K32 A;  1SMY D;  2EYH A;  4LF6 Q;  3ICE A;  1BNZ A;  1A63 A;  1EY9 A;  1BCP F;  2JA8 H;  5GAG C;  1CSP A;  1DYQ A;  4BXX G;  5IGB A;  5M5X B;  2CW0 C;  3S24 A;  4A3K G;  2NZO A;  5I9P A;  4CGY B;  2J0T D;  2FHT A;  4BY1 B;  4WFN 3;  4GNX A;  1NMF A;  4PQX A;  1X3F A;  3H94 A;  2F0M A;  2F03 A;  1A3V A;  4CDF C;  3V96 A;  4HIK A;  3P1H A;  5I6Y A;  3RMH A;  5JJI A;  4A3D B;  1X3G A;  1LTS D;  3R3O A;  5F2D A;  4IO9 A;  1I50 H;  3TEH B;  4NXM L;  1RTO A;  5A2Q E;  1WD0 A;  2K7V A;  3SGI A;  1QNK A;  4HJ8 A;  1HFN A;  3HOY H;  3X3M A;  4GKK Q;  3S1N H;  2LFN A;  2N8N A;  3F2B A;  2XRS D;  2VQF Q;  3BDL A;  4G7O C;  4RGN A;  4HSV A;  2B63 H;  3GTQ B;  4A3K H;  1STG A;  3KF6 A;  2I0Q A;  3PIP A;  5I9O A;  4NP5 A;  4H02 A;  1QWY A;  2PI2 E;  4LF6 L;  3NWS A;  2FFK B;  1UE1 A;  4ZYS A;  1X32 A;  3J7A V;  1HR0 L;  2PNR C;  3VR6 A;  3L2P A;  1JQY D;  2EYM A;  4YCV A;  2UU9 Q;  4DKA C;  3DEP A;  3S16 H;  1AN8 A;  1I6H H;  3H91 A;  3FRP B;  4DR6 L;  2E2I H;  4KJO A;  1BDO A;  4APV A;  1SEB D;  5FLX c;  1GUG A;  1PTO H;  3S17 H;  5M3F B;  2JA9 A;  2EYJ A;  5CR3 A;  1SRO A;  3OWE B;  2XWB B;  3CME A;  5DAU A;  1DCZ A;  2HD3 A;  2B8F A;  2B8G A;  3UDI A;  1DXM A;  1JWU D;  1KC8 C;  1UUP A;  2K01 A;  4A93 B;  4RKB A;  2NVQ H;  2PQA A;  4DV4 L;  1B50 A;  1SYC A;  2A68 D;  3NEN A;  4LF9 L;  4JBW A;  4OO1 H;  3SK6 A;  2F0T A;  4X64 L;  1PFN A;  2WAQ E;  1YIT A;  2R3Z A;  2A6H D;  2Z0S A;  1NJI C;  2R7F A;  1WCM H;  4DR3 L;  5EKL A;  5EPJ A;  1D5X C;  1KXL A;  1KLU D;  4QIW E;  2F0S A;  5J1Z A;  1PYW D;  2UXC L;  1N32 Q;  5IWA Q;  1XNQ Q;  3M4Y A;  4R4T A;  4UDU C;  1PRT D;  4IOA A;  2UXD L;  1I3Q H;  2K5N A;  5IT9 L;  5JEA G;  3TRZ A;  4R4O A;  2HDL A;  4ZKC B;  1QG7 A;  5E1F A;  4DPG A;  1G91 A;  4QB4 A;  1EZ6 A;  4YCW A;  3HOY G;  4RFB A;  2R6G A;  1HZB A;  1XYI A;  1ZKO A;  5JPM C;  4KK7 A;  4P72 A;  3RNU A;  1PRT C;  1VQ8 A;  5C3W A;  2M9V A;  1WYD A;  1ET6 A;  3K58 A;  3G71 A;  3KJO A;  1CT1 D;  1LUZ A;  1R9T H;  1XNR L;  4OEL B;  1Y1V B;  3DM3 A;  2E5L Q;  3HEJ A;  2YTX A;  3T16 A;  4DAY B;  1NBW A;  3G4S A;  3CD6 A;  2XWJ B;  1B1Z A;  3ULP A;  5ELN A;  2VXW A;  3LNN A;  3S2H B;  1BF4 A;  1FGB D;  3PQI A;  3VA5 A;  5ISR A;  1E1O A;  2HQE A;  1ILQ A;  3NTI A;  1XWE A;  1E0B A;  1FNU A;  1KDC A;  5HY6 A;  4BBR B;  4MIU A;  4ZRZ A;  1HZA A;  5J3B A;  5T1G A;  1DD2 A;  1GKH A;  4DNI A;  1I5F A;  1V9P A;  1K8O A;  4BA1 I;  4IOC A;  1EU3 A;  1SBB B;  1EIH A;  1ESF A;  4P71 A;  1X56 A;  3T1Y Q;  2BCO A;  5BR8 Q;  1AZP A;  5CV9 A;  3S2D H;  1VQ9 A;  4IPC A;  1HFG A;  3FMC A;  1EQQ A;  4A3C G;  4OIJ A;  1EIY B;  4IPD A;  2WV6 D;  4KLK A;  3CCL A;  4I65 A;  3C1E A;  4DU9 A;  1K9M C;  4BY7 G;  2FMC A;  4L5S A;  3IRB A;  1U9R A;  3VR3 A;  1STN A;  3EIV A;  4JVZ A;  4N8X 1;  2IW3 A;  3S14 H;  2QGQ A;  3OIQ A;  1HTP A;  2B29 A;  1VQH A;  2VS1 A;  4I7Z C;  4NXM Q;  3HOZ H;  1TS4 A;  3D4W A;  1Y1W H;  4NB3 A;  1TXY A;  4IUU A;  4K5X A;  3GV6 A;  2PQE A;  5IOD A;  2XSC A;  2ZTC A;  4POF A;  2DNC A;  5LMN Q;  1O7Y A;  2E5L L;  2EIF A;  4HTH A;  4JOI C;  4ZUI A;  4DV5 Q;  1LTR D;  2VQF L;  1HR0 W;  1B9M A;  3S1R B;  4IFD G;  4A3B G;  5JEA H;  3QB3 A;  3CRL C;  4O2D A;  1HRJ A;  2F0D A;  3RLO A;  4FXD A;  2F0G A;  2JA5 B;  3SEB A;  3E5S A;  1VQP A;  2I5L X;  1A2U A;  3MXU A;  4JW0 A;  1MJE A;  1VCI A;  4UY8 C;  1AH9 A;  1BO0 A;  1H95 A;  4UP9 A;  1L1O B;  2LY7 A;  1LM0 A;  3CC7 A;  3BZK A;  1VQN A;  3C2P A;  2MPM A;  2NN6 G;  1TWH B;  1W2B A;  2KEE A;  2A69 D;  2MO0 A;  1T9H A;  1VQE A;  1WCM B;  3EA6 A;  1G29 1;  4XYO A;  4HJ7 A;  1YNN C;  4RA8 A;  3HZX A;  1CA6 A;  3BDO A;  1CQV A;  2JEA I;  4XTC S;  5CYU A;  3CHB D;  4AH6 A;  4ULL A;  1SNC A;  4JI8 Q;  4CHT B;  1RTN A;  1SJH D;  2CW0 D;  1Q1E A;  2K03 A;  3I55 A;  3VR2 A;  1OO9 B;  1LTL A;  4WRD A;  2Q2T A;  4FF2 A;  2K6A A;  1SYB A;  1Q81 C;  5JPN C;  1X65 A;  3VR4 A;  3TP5 A;  3W1B A;  4U67 3;  1TWH H;  5LMN L;  2ES2 A;  1SYD A;  4GN4 B;  4IAL A;  1AP0 A;  4TRD A;  1G2T A;  4JI2 Q;  3KJP A;  5C44 H;  2YV5 A;  3S1Q H;  3WOE A;  4H7B A;  2SDF A;  1XPU A;  1KNA A;  1R4Q B;  2HIX A;  3GDE A;  4DR1 Q;  4R4Q A;  1WI5 A;  3HRZ C;  2WAQ B;  1GUO A;  2G9H D;  5E4X A;  1GUS A;  3NBH B;  1B4O A;  2OTL A;  1LTI D;  4A3C H;  1PRT F;  4F8M A;  4GOP C;  1UWV A;  4C56 C;  4A3F G;  3LWU A;  1MSH A;  1KRT A;  1IBK Q;  2CQA A;  4GKJ Q;  1M4V A;  4JV5 L;  4CJ1 B;  1RD9 D;  2F0Q A;  4LF8 Q;  1JOR A;  1S3O A;  1QNU A;  4MTK A;  1XX8 A;  3OW2 A;  3TSS A;  4C3I G;  2SOB A;  1C8C A;  4KMU C;  5KYI A;  2Z1C A;  3J7A F;  3U9O A;  3JAM c;  3RN2 A;  2K33 A;  1FR3 A;  2XIW A;  4G4K A;  4M1U B;  4X62 L;  5I2X A;  4C3I B;  4L5R C;  1LYL A;  1HUM A;  3NHH A;  2PW5 A;  1BBX C;  5C5M A;  3A7A B;  5NUC A;  3FDT A;  1IYV A;  2JEB I;  3MFG A;  4NDX A;  2OXP A;  5CV8 A;  2L55 A;  3H3V C;  3OIP A;  2NWG A;  1EFW A;  3H6M A;  1IKM A;  4HJ9 A;  2YYZ A;  1B3Q A;  2YTV A;  4WJ4 A;  3F2C A;  4JI6 L;  1HJP A;  2DN8 A;  2I46 A;  2JA7 H;  2NN6 H;  4A4I A;  3M9B A;  3P20 A;  1PTO B;  2K4K A;  1DM0 B;  2D9U A;  1XNQ L;  1NCV A;  4FDB A;  5HGQ A;  2M2L A;  2NVQ B;  2KCT A;  2PMZ E;  1ONL A;  3KF6 B;  4LF8 L;  1F2L A;  1HXY D;  2ZXR A;  3FKI H;  2B2T C;  1M8A A;  1YVC A;  3PUW A;  3CCE A;  1TQO A;  1I4G A;  1KDA A;  3T51 B;  3VYU A;  4PV1 C;  3CXC A;  1JE4 A;  2Q2I A;  2WKC A;  4YHH L;  3M4P A;  1S5E D;  4CDD C;  2E2J B;  4DUY L;  4EX5 A;  4A3E H;  4CDC C;  2KUM A;  3IL8 A;  3H3V I;  1CKO A;  5FJ8 H;  1BKB A;  1PA6 A;  1NSN S;  3M7N A;  4LW1 A;  4HID A;  2IPK D;  5JVG 3;  2PNH A;  2XTI A;  3P75 A;  1TS5 A;  5GAH C;  3U4V A;  4DV1 Q;  1PH6 A;  3RZO H;  4K2K A;  3NQT A;  2RA4 A;  4LF5 Q;  3KF8 B;  4LFB Q;  2KA7 A;  3PO3 B;  4BY1 H;  2A6H C;  4RCO A;  2KCN A;  1LLR D;  4CDE C;  1PH9 A;  1F77 A;  2K14 A;  3U4Z A;  4A3J B;  3DM1 A;  3Q24 A;  5M3F H;  1PRT B;  2EYO A;  1HR0 Q;  1QE6 A;  3STB D;  4A93 H;  4ILW A;  1V8Q A;  1QIL A;  2DY7 A;  4GLX A;  2YU9 H;  1PH4 A;  1WTR A;  1AEX A;  3PCO B;  3D0F A;  1XMO L;  1LTB D;  1N34 L;  2OWO A;  1Q90 A;  3TN2 A;  1SNQ A;  4O1N A;  5FOB B;  3KUP A;  1JT8 A;  3I4N B;  1ZEQ X;  4PG3 A;  4IJH A;  1FNV A;  2CH4 A;  1TY2 A;  2AQ2 B;  4M8A A;  2L1B A;  1TS3 A;  2X6G A;  3MZ5 A;  3RZO B;  4C3H H;  5E4W C;  1F2M A;  1G8Z D;  3G48 A;  2L0C A;  3S2H H;  5LMN W;  1HPC A;  1X6O A;  4KY6 A;  4GLV B;  1WOC A;  2R61 A;  1FNW A;  1BCP C;  4HSP A;  1VQL A;  2PMZ B;  3HOX G;  4KHZ A;  2IX1 A;  1MSG A;  3H0G G;  1TWF H;  3CQZ H;  1QZG A;  4RG1 A;  5M3F G;  3GTG B;  3ERQ A;  2MQH A;  3GV3 A;  5I2Y A;  3HOX B;  3H0G B;  1KDB A;  4KD3 A;  1PFM A;  2O5I C;  1P8L A;  2NZ1 D;  3S16 B;  1D1I A;  1PYS B;  1QOH A;  1GHK A;  1YNX A;  3K57 A;  4A3G H;  2KBN A;  3L9A X;  1LT5 D;  1MI2 A;  4BY1 G;  4DAP A;  3L3O C;  3I7F A;  3TBI B;  3PO3 H;  1F2Y A;  3M3Y B;  4YCU A;  4QMG A;  1SNP A;  1IBM L;  2RCN A;  3MC0 B;  1WTO A;  1CI3 M;  1FJG Q;  1JC7 A;  2JQO A;  2RSN A;  3S1M B;  1SE8 A;  2LSS A;  3I3C A;  1BUV T;  5HGT A;  1WTP A;  3MEH A;  1R9T B;  3TZU A;  3OYY A;  5KRU A;  1VQ5 A;  4OO1 I;  3UDF A;  5C0X G;  4IQZ A;  2EJM A;  4BBS B;  2D5D A;  1HZC A;  3MTS A;  1KHI A;  1YNJ D;  3S1R H;  1ENC A;  4BBS G;  3W1G A;  4DGZ A;  1J8I A;  2K52 A;  1STA A;  2L9H A;  3I4O A;  3JAM E;  3I56 A;  1SFO B;  2BOS A;  2F0U A;  2JA5 H;  4R4C A;  5CMD A;  4K6D A;  3UE0 A;  4P73 A;  2JE6 I;  3BVM A;  1AFP A;  4JOI A;  3S17 B;  1EQR A;  1VQB A;  4JPB W;  1EIF A;  1H9S B;  4R1J A;  5T1I A;  4XQQ A;  1EU4 A;  5JVH 3;  1BCP D;  1S72 A;  1IBL Q;  4KY5 A;  4CKC A;  4IUQ A;  1OXS C;  3A5U A;  4ALP A;  1GUN A;  1K8M A;  5AJ3 L;  5DM7 3;  1EY6 A;  3BYY B;  4IUN A;  1OXU A;  4P74 A;  1IL8 A;  3K5M A;  1Q1B A;  1Y1V G;  3D8G A;  1EYD A;  2E74 C;  5K5P A;  3OTO L;  4GNX C;  3CQZ B;  1VQD A;  4C3I H;  1KD1 C;  1TWA H;  4HN7 A;  1CM9 A;  1H9K A;  3M3Y H;  3RN5 A;  1EY4 A;  3N52 A;  2DUD A;  5M9O A;  2F1M A;  4BBR G;  5LHY 1;  1ASY A;  1RJT A;  1QJO A;  1STY A;  5KYL A;  1I6V C;  4DK0 A;  1Z9F A;  1K3R A;  3HOW G;  2IX3 A;  1D1K A;  2NTT A;  4JI4 Q;  1HTL D;  2KHI A;  1MHW C;  1VQJ A;  1HZ9 A;  2K04 A;  4A3J H;  5FKA C;  5G3L D;  1Q86 C;  4PNY A;  1SAP A;  2VZA A;  1MGS A;  2PO4 A;  4DAY A;  4B3S Q;  3IFD A;  1EFI D;  1FD7 D;  1T5E A;  4RKL A;  5TSS A;  2KCC A;  3PIO 3;  2KEC A;  3DWP A;  1SYE A;  2F3V A;  4ME3 A;  1WTQ A;  4QCL A;  3NEM A;  2PZW A;  3J81 j;  1WJJ A;  2K5D A;  3KDF B;  1UNS A;  3Q8D A;  3EFX D;  3KF8 A;  2MNA A;  4LFC Q;  1STH A;  1IW7 C;  1LAC A;  3G6J B;  2KQ3 A;  3CCU A;  1FVI A;  5C6A A;  1UE6 A;  2ZM6 Q;  2E8G A;  2EY5 A;  4A3D H;  1SE2 A;  1L1O A;  2HUG A;  1GOZ A;  4LK1 C;  2CWA A;  4TKO B;  1PV4 A;  5M5Y H;  1I4P A;  4GN3 B;  2PCF B;  2JA8 G;  2NZH A;  3HOY B;  1PH3 A;  2Q8R E;  4LFB L;  4GOP B;  4DR3 Q;  3AFQ A;  2JP1 A;  1QZH A;  5CGK A;  3EQL C;  4YWK A;  2HIV A;  2N55 A;  1I4H A;  4LUO A;  4QL5 A;  4BXX H;  3I2Z A;  4Q0F A;  4FXG C;  3DXJ C;  2UUB Q;  2BE5 D;  2ZJP A;  3FKI G;  5CV4 A;  1F2Z A;  1IW7 D;  2AWN A;  3I4L A;  3OWF A;  4RWS C;  1PLF A;  2RHQ B;  4OEM B;  4AIM A;  3D6W A;  4J6H A;  3BU2 A;  3MEF A;  3KDF A;  2Z6K A;  1LV9 A;  4A3I G;  1E24 A;  4X3K A;  2RCF A;  3HOU H;  1OXT A;  3VR5 A;  4HJ5 A;  3AU7 A;  3BJU A;  5H1S E;  5IGF A;  1KTK A;  2RBM A;  3S15 H;  3HKZ B;  2QW7 A;  4PZ7 A;  4V0B A;  3HGB A;  4LFA Q;  4C3J B;  2ATW A;  1PTO C;  1X3P A;  3UE1 A;  3I4N H;  3EVQ A;  3OTO Q;  2GN5 A;  4U68 A;  1XNR Q;  1SNM A;  5LMU Q;  5KEE A;  3BYT B;  2OQ0 A;  3KYH C;  4LFC L;  2E2J H;  1GO3 E;  5C4J B;  1B2T A;  1AE2 A;  3T56 B;  4I7A A;  1EY0 A;  1DZ1 A;  2PZT A;  2PI2 A;  4A75 A;  1C7Y A;  1U4R A;  4B3T L;  4JCV E;  1K3B C;  4K14 A;  1I94 Q;  2K28 A;  3CCR A;  2KHS A;  5C3E G;  4JC0 A;  2A19 A;  4DR2 L;  3J7Z C;  2B2U C;  3GTP B;  2GVB A;  4OGQ C;  3X3N A;  2IWH A;  1W6K A;  2AKW B;  1L0X B;  3GTM B;  2R93 G;  3CW2 C;  5I6W A;  5EPL A;  1BOS A;  3EN2 A;  1PXU A;  1UAP A;  2AMC B;  4AYB G;  4FF1 A;  1BBU A;  3CCQ A;  3KBG A;  4X62 Q;  4QQB X;  4OHJ A;  1D5Z C;  2EXZ A;  3K5O A;  5JAV A;  1XPR A;  4DUY Q;  1VQA A;  4AYB B;  2V1C C;  2ASB A;  1VQC A;  2MUY A;  2ZTD A;  3GTK B;  1O80 A;  1Y14 B;  2B2U A;  2R92 B;  3K5N A;  4RGT A;  3P7J A;  3GTO H;  1XMQ Q;  4A3I H;  1MJC A;  3CP0 A;  1NR4 A;  2QEX A;  4CBV A;  4RCN A;  3I4M B;  2YU9 B;  3J81 L;  4FF4 A;  1NUC A;  3ND9 A;  1RHP A;  1JWS D;  2CFM A;  1PH8 A;  3SHL A;  1MIU A;  1YNJ C;  5IY0 A;  3KLS A;  1EY5 A;  1ZXT A;  1HA5 A;  1GUT A;  1SR3 A;  1KLG D;  1PFS A;  5AJ3 Q;  1VS0 A;  1B70 B;  5E3F A;  2ZJR A;  4A3L G;  3J80 i;  1Z7T A;  2NYZ D;  4A3M H;  4MHE A;  2CVR A;  1KL9 A;  1VQM A;  2ALY B;  4KJN A;  4LUZ A;  2N88 A;  2JJQ A;  1TS2 A;  4RHR A;  3PUZ A;  2TSS A;  4JI4 L;  3K7A B;  3L7Z C;  4IPH A;  3TDQ A;  4KI0 A;  2B3G A;  5IP9 G;  2JA6 H;  2AQ1 B;  1K8G A;  5C44 B;  3S1Q B;  2HT1 A;  3O13 A;  3TZD A;  3BG3 A;  3BVG A;  1PDQ A;  3GTL H;  4A3M B;  4BBR H;  4HR7 B;  1EY8 A;  4A3B H;  5D3D A;  1PYB A;  4H13 C;  1I3Q B;  3K0X A;  5CV6 A;  5KNB A;  3IFT A;  5C0X I;  1C48 A;  4RMF A;  1LTG D;  1I4R A;  1NR2 A;  2XRQ D;  1V1O A;  1SND A;  4BA2 I;  4C3H G;  4F88 A;  1HNZ Q;  1YBY A;  4IPG A;  1O7I A;  3SR1 A;  3K80 C;  3CRK C;  2WAQ G;  3MWY W;  5FO8 B;  3J81 c;  3CC4 A;  2OF1 A;  3A54 A;  3B6Y A;  2EVB A;  4OX9 L;  4Q5V A;  4DAV A;  4A3F B;  2Z4I A;  3HOV H;  2QIL A;  1OXX K;  4OO1 G;  4BY7 H;  1X9N A;  2B2Y C;  5FLM G;  4DV7 L;  3KK7 A;  4C2M H;  4JI1 Q;  3E0J A;  3VDY A;  3CAM A;  3CKI B;  2F0J A;  1SYF A;  4FVM A;  1LTA D;  2F0L A;  4DV6 L;  1F9R A;  1SXT A;  1KRS A;  4DXF A;  1V1P A;  4DV0 Q;  4A93 G;  1Y1V H;  2A5H A;  3NBI A;  4X64 Q;  1Y1W G;  5I4D A;  2WIN B;  2EPB A;  3HOZ G;  1C9O A;  4B3R L;  2WP8 J;  4LUV A;  2Q2H A;  1QUQ B;  2EQS A;  3WOF A;  1JB7 A;  5BN3 A;  3AMU A;  2L12 A;  4FO2 A;  1ASZ A;  3A74 A;  4DK6 C;  4RAU C;  1K83 B;  3J7Y W;  1WD1 A;  2LXJ A;  1PTO D;  3LX0 A;  1DON A;  2EYL A;  1ET9 A;  1JJC B;  1PZI D;  3CPF A;  1C0A A;  3C1F A;  2D2C C;  5DM6 3;  3GTP H;  1TT2 A;  1WFQ A;  3I4N G;  3IAY A;  3GTJ B;  1MKH A;  3NWT A;  2G5D A;  3QIA A;  2L5T A;  1B7Y B;  3OOC A;  4DNT B;  2Y0S G;  5L37 A;  2QDB A;  4GKK L;  1DGS A;  3MFY A;  1JOK A;  3M85 A;  1ESR A;  5J22 A;  4GZY C;  2BA0 A;  3AFP A;  2K5W A;  1XTC D;  2B2W C;  2H4O A;  2NUC A;  2J4X A;  5IOC A;  4K0K Q;  2XNA C;  1Y8N B;  2ZTE A;  1A2T A;  4DN4 M;  3G6E A;  3ULJ A;  2JA6 G;  1H9M A;  1I50 B;  4A76 A;  3I91 A;  4XIG S;  1X54 A;  4YY3 L;  4OWX B;  5EJW A;  3HOU B;  4GS3 A;  1EEI D;  1W6J A;  1TWC H;  5ELE A;  2A73 B;  4DV0 L;  3A0J A;  4TSS A;  5DNF A;  2UU9 L;  4LF5 L;  3T1Y L;  3RLF A;  4G7H C;  2CKZ B;  2QDL A;  2BA1 A;  2CH4 W;  4GLA C;  4XDX A;  2OTJ A;  5KIX A;  4DNR B;  4XT3 B;  2DNE A;  1C4Q A;  3I72 A;  3DHQ A;  1PH2 A;  1JJ2 A;  2EJF C;  3UDX A;  4C1N K;  1IZ6 A;  4LAA A;  4DAM A;  1QVF A;  1K28 A;  2R7D A;  4H44 C;  2X6L A;  3OHX C;  1K8A C;  4XYQ A;  4A3D G;  1CQF A;  1STB A;  4A3J G;  3S2D B;  1H9R A;  5D3I B;  5EAY A;  4RH6 A;  5C5L A;  5IGE A;  4R9W A;  1E2W A;  1A8V A;  1HCZ A;  4UP8 A;  1KAB A;  1V43 A;  2E2H H;  2FIN B;  5C4Z A;  5E7N A;  3F8T A;  1PHJ A;  5JJL A;  2RDH A;  4LWC A;  2H1E A;  4ME5 A;  5EQ0 A;  1IKL A;  3PO2 H;  1Y8O B;  1GD7 A;  3BVZ A;  3JAM i;  3GTO B;  2K75 A;  4KTA A;  1UEB A;  4Y7N B;  2N49 A;  4R8N A;  4JI2 L;  4O0A A;  3ER0 A;  3E9H A;  1KAW A;  1L0W A;  2F0V A;  3QOL A;  2EY2 A;  5IIF A;  1XJV A;  3NTH A;  3BZC A;  1EWI A;  3F1Z A;  3NPP A;  1DJR D;  1CKN B;  5IP7 H;  1CUK A;  2F3I A;  2SNS A;  4BWG B;  4X6A H;  2YTY A;  1B8A A;  3NQI A;  2L4N A;  3CCS A;  2I5M X;  5EGT A;  2JK8 A;  4KHV A;  1D5M C;  2HDM A;  5FO9 B;  2UXC Q;  4CJ0 B;  3GO5 A;  3FHW A;  2A6E D;  4FP5 D;  3FPU B;  1Z47 A;  2N78 A;  4B3M L;  3OMC A;  3GD7 A;  4UHV A;  1S5C D;  2ID0 A;  4JI5 L;  5EKK A;  3AEV A;  3FEW X;  1EQT A;  3A56 A;  1AZQ A;  3D4D A;  1JB3 A;  2FXQ A;  5GAD C;  2F0W A;  1WCM G;  4POG A;  2SEB D;  1E1T A;  1HUN A;  4RHS A;  3TP7 A;  3UI2 A;  2P5Z X;  3SE0 A;  4QGU A;  3WDN A;  1WTH A;  3FVQ A;  1PFB A;  2Z4H A;  4V19 0;  3AYH B;  4GOP A;  3MHB A;  5JOB A;  2VY3 A;  1II3 A;  4JBK A;  2DY8 A;  4K6L A;  3CCV A;  3GTQ H;  5IE8 A;  1EIG A;  2R7Z H;  3J81 E;  3ND8 A;  3KLR A;  2JSO A;  3RZD H;  1CK1 A;  3SVM A;  3HG9 A;  1IBM Q;  1PH5 A;  3K5L A;  1N33 L;  4G57 A;  1JCK B;  3A7L A;  4P75 A;  4OX9 Q;  2N3S A;  4HJA A;  1VQG A;  2F0E A;  4GNX B;  4L8J A;  5IYB G;  1N32 L;  1DOK A;  4JYA L;  4FYD A;  1DOM A;  2BH2 A;  1SE4 A;  1MBY A;  4EVO A;  4DV5 L;  1JOO A;  1GUW A;  2KED A;  4JI6 Q;  5JJK A;  1S4Z A;  1IBK L;  4L5T A;  4XQJ A;  1TVX A;  1RF2 D;  3TME A;  1S40 A;  2RKS A;  5KGU A;  4X66 L;  1YEZ A;  1LO5 D;  3QWN A;  4LF4 L;  3GQB A;  4DV4 Q;  3HOW H;  2UUC Q;  2UXB L;  5M5W B;  1B44 D;  2EY6 A;  4QF4 A;  4X3S A;  1GXD C;  1AE3 A;  3BS1 A;  3S14 B;  1FGU A;  4DR5 Q;  4IFD J;  4X66 Q;  3NP8 A;  4Z9C B;  3MVV A;  3PF5 A;  3HKZ G;  4JI0 L;  4LF4 Q;  1CSQ A;  2DJG C;  4JBJ A;  4ZQ3 A;  2BDN A;  2B63 B;  5BN4 A;  3GTK H;  1KNE A;  2A1A A;  4UP7 A;  3R2T A;  1SE3 A;  2KOL A;  2OT2 A;  3J80 L;  4AQY Q;  3KLW A;  1EEF D;  4HIO A;  2F52 A;  4YY3 Q;  5CV7 A;  1D8L A;  2UUA L;  3HOW B;  4IUT A;  4HCS A;  5EKI A;  2MO1 A;  1NTG A;  1GHJ A;  2C5C A;  1PZK D;  2F0N A;  1JIC A;  1U0L A;  1I4X A;  3WWV A;  2VUM H;  3RD4 A;  1R4P B;  2PZU A;  2ZM6 L;  4KKT A;  2Q8T A;  4DK1 A;  2IHE A;  1EYC A;  1TII D;  2IT1 A;  2WB1 G;  1TU2 B;  2NVT B;  4FNF A;  5LL6 S;  1VQ6 A;  2WB1 B;  2OQK A;  1U4L A;  2MJ8 A;  2R93 B;  1VQ7 A;  3T1H L;  4BBS H;  3R8B A;  2ICI A;  3HP3 A;  4BY7 B;  1L2F A;  1X55 A;  1Z6H A;  2AHO B;  3RZD B;  4DR2 Q;  1UEA B;  4EQ5 A;  4MTN A;  2BDO A;  2NB0 A;  2EE1 A;  1XMO Q;  4IUV A;  5IGG A;  2LKV A;  5ELC A;  1G6P A;  2UXB Q;  1NY4 A;  2NN6 I;  3L0O A;  4JYA Q;  2Q2U A;  2RHS B;  3K8A A;  4DK3 C;  3CCM A;  4JI8 L;  4TVA B;  2J7Z A;  2OEO A;  3OMG A;  4N8F A;  4IFD H;  4LNQ A;  3HFZ B;  3Q6S A;  3I4M G;  2O5J C;  1SJE D;  5GRO A;  4DR6 Q;  3RLN A;  5C0X H;  4A3B B;  1HQM C;  4OXP A;  2RDF A;  3HKS A;  4QIW B;  4A3K B;  1N8R C;  4OIK A;  5DEH A;  2WKD A;  4NXN Q;  1B9N A;  1I4Q A;  3K7U C;  2JA5 G;  2E2H B;  2CHB D;  5IGC A;  2VL6 A;  5ELB A;  1M1K C;  3ITP A;  2AUJ D;  5EPK A;  3PO3 G;  1N9W A;  4MN3 A;  2K05 A;  2JA7 B;  5C4X G;  4KD4 A;  5D65 A;  5M5W H;  1FJG L;  2CCZ A;  1CZW A;  1ZYR C;  3M4O B;  1TR5 A;  2F0O A;  1GM5 A;  4PZ6 A;  2LS0 1;  5LMU L;  4A3G B;  1UE5 A;  4P2C B;  4NMZ A;  4K8J A;  4X65 L;  2AWO A;  1B53 A;  4A3G G;  4ZK9 B;  1YIJ A;  5IP7 G;  2A68 C;  3E3X A;  3C46 A;  1PZJ D;  1J9O A;  3ERS X;  4DF7 A;  2EZV A;  1YJN A;  1HNZ L;  4NW2 A;  1CHP D;  1F9P A;  2VUM G;  2HHH Q;  2PW7 A;  2PQA B;  2RVL A;  1SYG A;  2QF7 A;  2VNU D;  2MFI A;  2E76 C;  5G3L F;  4B9X A;  2NVX H;  2IJ0 A;  4EQP A;  4DR4 Q;  4AYB E;  1TWC B;  4KN4 C;  3NXW A;  3SDZ A;  2EYF A;  2C9O A;  2O2L D;  1A15 A;  1SMX A;  5GQO A;  1STE A;  3LGJ A;  3EJI A;  4HED A;  1QVC A;  5COY A;  1MD2 D;  4C1N I;  4C3H B;  4JI5 Q;  1A3T A;  1CTM A;  2F3W A;  1TKW B;  3MXP A;  1WTV A;  1ICW A;  2K1B A;  4KKU A;  4WJ3 M;  1HNX L;  3H0G H;  1JJG A;  2A8V A;  5IYD H;  1YHA A;  4OL7 A;  4ZAI A;  4Y52 H;  4NKL A;  1E2V A;  1SRU A;  3E0E A;  2LMC B;  3VA7 A;  4QY7 A;  1CA5 A;  4ZUJ A;  1TWF B;  1EOT A;  1U4M A;  2QCP X;  3BDC A;  3K81 C;  1S5F D;  3CU7 A;  5A35 A;  2R92 G;  1D2B A;  3PF4 A;  1SNO A;  2E75 C;  2Z6K C;  3KLS X;  2B2T A;  5FK9 C;  4JI7 L;  1CHQ D;  3NBH A;  5AFW A;  2EOT A;  3PSI A;  3STB C;  1YHQ A;  2UUC L;  3A5Z B;  4IFD I;  1SSO A;  4LJZ C;  5KNC A;  3CPW A;  1Y69 U;  4C2M B;  1VMP A;  1GVP A;  2ZXO A;  4NXN L;  1Y8P B;  5FJ8 G;  3SK8 A;  3K59 A;  4ABN A;  5K36 H;  3PUY A;  4J15 A;  2O4X A;  4LF9 Q;  3A8K E;  3E9I A;  4YWL A;  4DV1 L;  4A3E B;  4XQN A;  2K50 A;  4LF7 L;  3G7L A;  4F87 A;  3T13 A;  1YNN D;  3I8Z A;  1Q8I A;  3QOJ A;  5CV5 A;  1E22 A;  5FO7 B;  1EYA A;  2B2Y A;  4A3E G;  3FP9 A;  2KJX A;  4HAE A;  2Q8I B;  1B3A A;  5M3M B;  1TY0 A;  2LXK A;  1FYC A;  4RGM A;  1YZ6 A;  2MHV A;  4HMJ A;  3M7G A;  1HQR D;  5M3M G;  3TP6 A;  1LT4 D;  2BE5 C;  3SXH A;  3PUX A;  4YHH Q;  3EBE A;  4JI0 Q;  3GTJ H;  4N9P A;  1N34 Q;  2GVA A;  3PUV A;  1RDP D;  3V2T A;  1T5X D;  4KV6 A;  3S9W A;  3AB9 A;  4K5W A;  3DLL A;  1X3Q A;  1A0I A;  2HQL A;  2F0K A;  1BQQ T;  5IWA L;  2K5H A;  4G7Z C;  3I73 A;  3F2U A;  1U4P A;  4YWM A;  1GJX A;  5ELD A;  4E6I A;  4L63 B;  5IYC G;  4JBM A;  3T4A C;  1Q12 A;  1N33 Q;  4HMI A;  1E3P A;  3HOV B;  3Q22 A;  1G2S A;  3IKJ A;  1EOV A;  2D0P A;  2M00 A;  1HH2 P;  3URY A;  4KY7 A;  2ZJQ A;  3C3L A;  3HOV G;  2IHF A;  2HCI A;  1RKN A;  3JAM L;  3AQQ A;  3CMA A;  2ENB A;  4N9T A;  5EBD A;  3QO2 A;  1HHV A;  3CC2 A;  3I90 A;  4IUR A;  2ICE C;  3R93 A;  2F4V L;  2JXM B;  1IL2 A;  3K7A H;  2B2W A;  2WB1 E;  1PH1 A;  4J8Q A;  2PPB C;  2NVY B;  1IYJ B;  1EUJ A;  2SNM A;  3K6O A;  1V1P B;  4R4I A;  5KND A;  3TS2 A;  3QJY A;  1OTC A;  1PVO A;  1O7L A;  4EQO A;  1D7Q A;  1KIX A;  1A62 A;  5C0X J;  1FL0 A;  2WAC A;  5C3X A;  1K0S A;  2VB2 X;  3T1H Q;  2KCM A;  2PYK A;  4B3R Q;  1DOL A;  4B3S L;  4OWW B;  1LT3 D;  2GA4 B;  3OW7 A;  2QA4 A;  4JV5 Q;  3DEO A;  4X3U A;  3MXG A;  3HS0 C;  3OPO A;  4HCE A;  4C3J H;  4OON A;  1NMG A;  1Q3L A;  4QJF A;  5HUR A;  2XN9 C;  4OWT B;  1K73 C;  2JYO A;  2V4D A;  1YJ9 A;  3J81 i;  4CJ2 C;  1V1Q A;  1TWG H;  4JI3 L;  2RSO A;  1BR9 A;  4LFA L;  3A8J E;  5IP9 H;  2NVX B;  1IYU A;  2FMM A;  2QEJ C;  3FPP A;  3PV0 A;  1H9S A;  2DJF C;  3J7A 5;  3TS0 A;  3NK9 A;  2Z9H A;  3J80 E;  2K5V A;  2IX0 A;  3T53 B;  5JEA J;  1YJW A;  4DUZ Q;  1K83 H;  4EGV A;  1VQI A;  4DR1 L;  4CKB A;  5IYC H;  1WVL A;  1HNW L;  2EY1 A;  1KAA A;  1XTD A;  2FJ2 A;  5LL6 X;  2WII B;  2JA6 B;  4IZ8 A;  4ZCK A;  1VQK A;  3GTL B;  4DR4 L;  3A55 A;  1AW7 A;  4BS9 A;  3M4O H;  4PMW A;  5ELO A;  4K5V A;  2L11 A;  3S15 B;  4A3I B;  1L0Y B;  1EL0 A;  1M90 C;  1SDF A;  5A2Q L;  4LMQ D;  1JOQ A;  4NPS A;  2A69 C;  2B2V A;  4KKS A;  3U9S A;  1VDZ A;  4GN5 A;  3NSW A;  4DV2 Q;  5CBE E;  3I4M H;  4K0K L;  3PGZ A;  3U58 A;  1JE5 A;  4TQU S;  3J80 c;  2IL8 A;  5COR A;  1RL2 A;  1Q8K A;  2X69 A;  4C3J G;  1E2Z A;  3ZJY C;  3KFU A;  2NBF A;  1WTW A;  1XXG A;  5IT9 c;  1ENA A;  3SK4 A;  4QUC A;  1G6Z A;  1ICF B;  5ELF A;  2HHH L;  1LAB A;  4KHP L;  4EQN A;  1BCP B;  3MXN A;  3NEL A;  4ZLT F;  2B2V C;  1IHZ A;  2I5H A;  1PTO F;  1HNX Q;  1EQV A;  2D62 A;  1VF7 A;  3VYR A;  4YIJ A;  1ML0 D;  2NTS A;  1EWH A;  1J6Q A;  2CWP A;  2MGS A;  3CCJ A;  1CKM A;  1WTX A;  3K0Y A;  1RCV D;  4K8I A;  1SN8 A;  3VYT A;  2BH8 A;  2A6E C;  5DLQ E;  2IY5 B;  3HKZ E;  3OSO A;  3GTM H;  4LF7 Q;  3NUC A;  2KHJ A;  5GAE C;  4CKE A;  3GP7 A;  2XVS A;  3ULL A;  4X3T A;  1J5E Q;  5IYD G;  4DV6 Q;  4JK1 C;  5FLM H;  2Z6B A;  1NAP A;  5C4J H;  2MP1 A;  3ERO A;  3RUZ A;  3DWA A;  4DR7 L;  1HA6 A;  1OXV A;  1QVG A;  1O7Z A;  1N36 Q;  3MXN B;  2ZT9 C;  2R92 H;  2H5X A;  2AQ3 B;  4JI1 L;  2XGT A;  1YI2 A;  1L1O C;  3BZD B;  1BXT A;  2EYP A;  4JI7 Q;  3QG1 A;  1VQF A;  4S3S A;  2RF4 A;  4QUF A;  4A3F H;  4DV3 L;  5CC4 A;  4ZKB B;  3H15 A; 
#chains in the Genus database with same CATH homology
 3N6R A;  1I6H B;  1PMR A;  1A3U A;  1CFM A;  3I70 A;  4FF3 A;  4R8I A;  4L6T B;  3ZYY X;  3W2D A;  1TWA B;  2EJG C;  1LTT D;  1JWM D;  4UAI A;  5M5Y B;  3Q0A A;  1EY7 A;  3NE5 B;  1ZYR D;  3DWQ A;  2RQX A;  1LT6 D;  3D6C A;  4FXK C;  2VB3 X;  5D14 A;  5K36 G;  1H9J A;  4XXE A;  3D31 A;  3D4R A;  4XT1 B;  3R2I A;  5C4H A;  3NTK A;  1ENF A;  3KBX A;  4F7X A;  3DUZ A;  2TMP A;  4IUP A;  5JJZ A;  1ILP A;  3PMF A;  1JR0 D;  1VF5 C;  1QB5 D;  3MA2 B;  1QCB D;  1ROD A;  1F9S A;  3DMU A;  4PMB A;  1SMY C;  2KVM A;  3TP8 A;  3Q23 A;  2JA8 B;  4H0L C;  1VMC A;  4DXG A;  4KN7 C;  3A8I E;  4B9W A;  2QKI C;  2R7Z B;  5IT9 E;  3D3R A;  4IN3 A;  3LWE A;  3FKI B;  2F0P A;  4DFA A;  1EZ8 A;  5C4X B;  2E2I B;  2B39 A;  2F0F A;  3H09 A;  1Y1W B;  5FLX L;  3HOZ B;  2AUK A;  1S5D D;  3MAQ A;  4ODG A;  1TWG B;  4O42 A;  5IGD A;  5J39 A;  2VUM B;  4ID6 A;  1EWC A;  5FLX E;  4K2L A;  3ONA B;  4DA2 A;  2F0H A;  5BN5 A;  5CBA E;  2I07 B;  4J1M A;  3E6Z X;  2G9D A;  3S1N B;  2Y0S B;  1CZG A;  2A74 C;  3SK5 A;  4PMC A;  2Z8L A;  2ZXP A;  5C3E B;  1O78 A;  2EDG A;  3PO2 B;  1A6X A;  4WJW A;  2RDG A;  2K5Q A;  1F9Q A;  3W3A A;  3VYS A;  3V05 A;  5EBC A;  2E2D C;  1D6E C;  1S5B D;  4WOR A;  2HCC A;  3PIP 3;  4RGO S;  4B08 A;  2F0I A;  2F4I A;  2K32 A;  1SMY D;  2EYH A;  1BNZ A;  1EY9 A;  1BCP F;  1DYQ A;  5IGB A;  5M5X B;  2CW0 C;  5I9P A;  4CGY B;  2J0T D;  2FHT A;  4BY1 B;  4WFN 3;  4PQX A;  3H94 A;  2F0M A;  2F03 A;  1A3V A;  3V96 A;  3P1H A;  5I6Y A;  3RMH A;  4A3D B;  1LTS D;  3R3O A;  5F2D A;  1RTO A;  5A2Q E;  1WD0 A;  2K7V A;  1QNK A;  1HFN A;  3X3M A;  2LFN A;  2XRS D;  3BDL A;  4G7O C;  4RGN A;  4HSV A;  3GTQ B;  1STG A;  5I9O A;  4NP5 A;  1QWY A;  3NWS A;  2FFK B;  4ZYS A;  1X32 A;  3J7A V;  2PNR C;  3VR6 A;  1JQY D;  2EYM A;  3DEP A;  1AN8 A;  3H91 A;  3FRP B;  4KJO A;  1BDO A;  1SEB D;  1GUG A;  1PTO H;  5M3F B;  2EYJ A;  5CR3 A;  3OWE B;  2XWB B;  5DAU A;  1DCZ A;  2B8F A;  2B8G A;  1DXM A;  1JWU D;  1UUP A;  2K01 A;  4A93 B;  4RKB A;  1B50 A;  1SYC A;  2A68 D;  4JBW A;  4OO1 H;  3SK6 A;  2F0T A;  1PFN A;  2R3Z A;  2A6H D;  5EKL A;  5EPJ A;  1D5X C;  1KLU D;  2F0S A;  5J1Z A;  1PYW D;  3M4Y A;  4UDU C;  1PRT D;  5IT9 L;  5JEA G;  2HDL A;  4ZKC B;  1QG7 A;  5E1F A;  1G91 A;  4QB4 A;  1EZ6 A;  4RFB A;  2R6G A;  1XYI A;  1ZKO A;  5JPM C;  4KK7 A;  1PRT C;  5C3W A;  2M9V A;  1ET6 A;  3K58 A;  1CT1 D;  1Y1V B;  3HEJ A;  3T16 A;  2XWJ B;  1B1Z A;  2VXW A;  3LNN A;  3S2H B;  1BF4 A;  1FGB D;  3VA5 A;  5ISR A;  2HQE A;  1ILQ A;  3NTI A;  1XWE A;  1E0B A;  1FNU A;  1KDC A;  4BBR B;  4MIU A;  4ZRZ A;  1DD2 A;  5T1G A;  1K8O A;  4BA1 I;  1EU3 A;  1SBB B;  1EIH A;  1ESF A;  2BCO A;  1AZP A;  5CV9 A;  1HFG A;  3FMC A;  4OIJ A;  2WV6 D;  4I65 A;  3C1E A;  4DU9 A;  2FMC A;  1U9R A;  3VR3 A;  1STN A;  2IW3 A;  3OIQ A;  1HTP A;  4I7Z C;  1TS4 A;  3D4W A;  4IUU A;  4K5X A;  3GV6 A;  2PQE A;  5IOD A;  2XSC A;  2DNC A;  1O7Y A;  4HTH A;  4ZUI A;  1LTR D;  1B9M A;  3S1R B;  4IFD G;  5JEA H;  3QB3 A;  3CRL C;  1HRJ A;  2F0D A;  4FXD A;  2F0G A;  2JA5 B;  3SEB A;  3E5S A;  1A2U A;  3MXU A;  1VCI A;  1BO0 A;  2LY7 A;  3C2P A;  2MPM A;  2NN6 G;  1TWH B;  2KEE A;  2A69 D;  1WCM B;  3EA6 A;  1G29 1;  4XYO A;  1YNN C;  4RA8 A;  3HZX A;  1CA6 A;  3BDO A;  1CQV A;  2JEA I;  4XTC S;  5CYU A;  3CHB D;  4ULL A;  1SNC A;  4CHT B;  1RTN A;  1SJH D;  2CW0 D;  1Q1E A;  2K03 A;  3VR2 A;  1OO9 B;  4WRD A;  4FF2 A;  2K6A A;  1SYB A;  5JPN C;  3VR4 A;  3TP5 A;  4U67 3;  1SYD A;  4IAL A;  1AP0 A;  4TRD A;  1G2T A;  3WOE A;  4H7B A;  2SDF A;  1KNA A;  1R4Q B;  3HRZ C;  2WAQ B;  1GUO A;  2G9H D;  5E4X A;  1GUS A;  1B4O A;  1LTI D;  1PRT F;  4F8M A;  4C56 C;  3LWU A;  1MSH A;  2CQA A;  1M4V A;  4CJ1 B;  1RD9 D;  2F0Q A;  1JOR A;  1QNU A;  1XX8 A;  3TSS A;  4C3I G;  2SOB A;  1C8C A;  4KMU C;  5KYI A;  2Z1C A;  3J7A F;  3U9O A;  2K33 A;  1FR3 A;  2XIW A;  4G4K A;  4M1U B;  5I2X A;  4C3I B;  1HUM A;  3NHH A;  2PW5 A;  1BBX C;  5C5M A;  3A7A B;  5NUC A;  3FDT A;  1IYV A;  2JEB I;  3MFG A;  4NDX A;  2OXP A;  5CV8 A;  2L55 A;  3H3V C;  3OIP A;  2NWG A;  3H6M A;  1IKM A;  2YYZ A;  2DN8 A;  2I46 A;  2NN6 H;  3P20 A;  1PTO B;  1DM0 B;  2D9U A;  1NCV A;  2M2L A;  2NVQ B;  1ONL A;  1F2L A;  1HXY D;  2ZXR A;  2B2T C;  1M8A A;  3PUW A;  1TQO A;  1I4G A;  1KDA A;  3T51 B;  3VYU A;  4PV1 C;  1JE4 A;  2WKC A;  1S5E D;  2E2J B;  2KUM A;  3IL8 A;  1NSN S;  3M7N A;  2IPK D;  5JVG 3;  3P75 A;  1TS5 A;  4K2K A;  3NQT A;  2RA4 A;  2KA7 A;  3PO3 B;  2A6H C;  4RCO A;  2KCN A;  1LLR D;  1F77 A;  4A3J B;  3DM1 A;  3Q24 A;  1PRT B;  2EYO A;  1QE6 A;  4ILW A;  1V8Q A;  1QIL A;  2DY7 A;  1WTR A;  1AEX A;  1LTB D;  1Q90 A;  3TN2 A;  1SNQ A;  4O1N A;  5FOB B;  3KUP A;  3I4N B;  1ZEQ X;  1FNV A;  1TY2 A;  2AQ2 B;  4M8A A;  2L1B A;  1TS3 A;  2X6G A;  3MZ5 A;  3RZO B;  5E4W C;  1F2M A;  1G8Z D;  2L0C A;  1HPC A;  4KY6 A;  2R61 A;  1FNW A;  1BCP C;  4HSP A;  2PMZ B;  2IX1 A;  4KHZ A;  1MSG A;  3GTG B;  3ERQ A;  3GV3 A;  5I2Y A;  3HOX B;  3H0G B;  1KDB A;  4KD3 A;  1PFM A;  2O5I C;  2NZ1 D;  3S16 B;  1D1I A;  1QOH A;  1GHK A;  3K57 A;  3L9A X;  1LT5 D;  1MI2 A;  4DAP A;  3L3O C;  3TBI B;  1F2Y A;  3M3Y B;  4QMG A;  1SNP A;  3MC0 B;  1WTO A;  1CI3 M;  1JC7 A;  2RSN A;  3S1M B;  3I3C A;  1BUV T;  5HGT A;  1WTP A;  3MEH A;  1R9T B;  3TZU A;  5KRU A;  4OO1 I;  5C0X G;  4IQZ A;  2EJM A;  4BBS B;  2D5D A;  3MTS A;  1YNJ D;  1ENC A;  4DGZ A;  1J8I A;  1STA A;  2L9H A;  3JAM E;  1SFO B;  2BOS A;  2F0U A;  5CMD A;  4K6D A;  2JE6 I;  3BVM A;  1AFP A;  3S17 B;  5JVH 3;  1H9S B;  5T1I A;  4XQQ A;  1EU4 A;  1BCP D;  4KY5 A;  4CKC A;  4IUQ A;  1OXS C;  1GUN A;  1K8M A;  5DM7 3;  1EY6 A;  3BYY B;  4IUN A;  1OXU A;  1IL8 A;  3K5M A;  1Q1B A;  3D8G A;  1EYD A;  2E74 C;  5K5P A;  3CQZ B;  4HN7 A;  1CM9 A;  1H9K A;  1EY4 A;  3N52 A;  5M9O A;  2F1M A;  5LHY 1;  1RJT A;  1STY A;  1QJO A;  5KYL A;  1I6V C;  4DK0 A;  2IX3 A;  1D1K A;  2NTT A;  1HTL D;  2K04 A;  5FKA C;  5G3L D;  4PNY A;  1SAP A;  1MGS A;  2PO4 A;  4DAY A;  3IFD A;  1EFI D;  1FD7 D;  1T5E A;  4RKL A;  5TSS A;  2KCC A;  3PIO 3;  2KEC A;  3DWP A;  1SYE A;  2F3V A;  1WTQ A;  4QCL A;  2PZW A;  2K5D A;  1UNS A;  3EFX D;  3KF8 A;  1STH A;  1IW7 C;  1LAC A;  2KQ3 A;  3G6J B;  5C6A A;  2EY5 A;  1SE2 A;  2HUG A;  1GOZ A;  4LK1 C;  4TKO B;  1I4P A;  2PCF B;  3HOY B;  2Q8R E;  2JP1 A;  5CGK A;  3EQL C;  2N55 A;  1I4H A;  4Q0F A;  4FXG C;  3DXJ C;  2BE5 D;  5CV4 A;  1F2Z A;  1IW7 D;  2AWN A;  3I4L A;  3OWF A;  4RWS C;  1PLF A;  3D6W A;  4J6H A;  1LV9 A;  4X3K A;  1OXT A;  3VR5 A;  3AU7 A;  5IGF A;  1KTK A;  2RBM A;  3HKZ B;  4V0B A;  3HGB A;  4C3J B;  1PTO C;  1X3P A;  3EVQ A;  4U68 A;  1SNM A;  5KEE A;  3BYT B;  5C4J B;  1B2T A;  3T56 B;  1EY0 A;  1DZ1 A;  2PZT A;  1U4R A;  4K14 A;  2K28 A;  2KHS A;  2B2U C;  3GTP B;  4OGQ C;  3X3N A;  2IWH A;  1W6K A;  1L0X B;  3GTM B;  5I6W A;  5EPL A;  1BOS A;  1PXU A;  1UAP A;  4FF1 A;  3KBG A;  4OHJ A;  1D5Z C;  2EXZ A;  3K5O A;  5JAV A;  4AYB B;  2MUY A;  3GTK B;  1O80 A;  2B2U A;  2R92 B;  3K5N A;  4RGT A;  3P7J A;  1NR4 A;  4CBV A;  4RCN A;  3I4M B;  2YU9 B;  3J81 L;  4FF4 A;  1NUC A;  3ND9 A;  1RHP A;  1JWS D;  3SHL A;  1YNJ C;  3KLS A;  1EY5 A;  1ZXT A;  1HA5 A;  1GUT A;  1KLG D;  5E3F A;  1Z7T A;  2NYZ D;  4MHE A;  2CVR A;  4KJN A;  2N88 A;  1TS2 A;  4RHR A;  3PUZ A;  2TSS A;  3K7A B;  3L7Z C;  3TDQ A;  4KI0 A;  2AQ1 B;  5C44 B;  3S1Q B;  3O13 A;  3TZD A;  3BG3 A;  3BVG A;  1PDQ A;  4A3M B;  4HR7 B;  1EY8 A;  5D3D A;  4H13 C;  1I3Q B;  5KNB A;  5CV6 A;  5C0X I;  3IFT A;  1C48 A;  1LTG D;  1I4R A;  1NR2 A;  2XRQ D;  1V1O A;  1SND A;  4BA2 I;  4C3H G;  4F88 A;  3SR1 A;  3CRK C;  3MWY W;  5FO8 B;  2OF1 A;  3A54 A;  2EVB A;  4Q5V A;  4DAV A;  4A3F B;  2Z4I A;  2QIL A;  1OXX K;  4OO1 G;  2B2Y C;  3KK7 A;  3E0J A;  3CKI B;  2F0J A;  1SYF A;  4FVM A;  1LTA D;  2F0L A;  1F9R A;  1SXT A;  4DXF A;  1V1P A;  2A5H A;  3NBI A;  5I4D A;  2WIN B;  2EPB A;  2WP8 J;  3WOF A;  5BN3 A;  3AMU A;  2L12 A;  4FO2 A;  3J7Y W;  4RAU C;  1K83 B;  1WD1 A;  1PTO D;  3LX0 A;  1DON A;  2EYL A;  1ET9 A;  1PZI D;  3C1F A;  2D2C C;  5DM6 3;  1TT2 A;  3IAY A;  3GTJ B;  3NWT A;  3QIA A;  2L5T A;  3OOC A;  4DNT B;  2QDB A;  3MFY A;  1JOK A;  3M85 A;  1ESR A;  5J22 A;  4GZY C;  2BA0 A;  2K5W A;  1XTC D;  2B2W C;  2H4O A;  2NUC A;  2J4X A;  5IOC A;  2XNA C;  1Y8N B;  1A2T A;  4DN4 M;  1H9M A;  1I50 B;  3I91 A;  4XIG S;  5EJW A;  3HOU B;  1EEI D;  1W6J A;  5ELE A;  2A73 B;  4TSS A;  5DNF A;  3RLF A;  4G7H C;  2BA1 A;  4XDX A;  5KIX A;  4DNR B;  4XT3 B;  2DNE A;  1C4Q A;  3I72 A;  3DHQ A;  2EJF C;  4C1N K;  4LAA A;  4H44 C;  2X6L A;  3OHX C;  4XYQ A;  1CQF A;  1STB A;  3S2D B;  1H9R A;  5D3I B;  4RH6 A;  5C5L A;  5IGE A;  4R9W A;  1E2W A;  1HCZ A;  1KAB A;  1V43 A;  2FIN B;  5C4Z A;  2RDH A;  2H1E A;  4ME5 A;  5EQ0 A;  1IKL A;  1Y8O B;  3BVZ A;  3GTO B;  4KTA A;  4Y7N B;  4R8N A;  2F0V A;  3QOL A;  2EY2 A;  5IIF A;  3NTH A;  3NPP A;  1DJR D;  2SNS A;  4BWG B;  3NQI A;  2L4N A;  5EGT A;  4KHV A;  1D5M C;  2HDM A;  5FO9 B;  4CJ0 B;  3GO5 A;  2A6E D;  4FP5 D;  3FPU B;  1Z47 A;  3OMC A;  3GD7 A;  1S5C D;  2ID0 A;  5EKK A;  3FEW X;  1EQT A;  3A56 A;  1AZQ A;  3D4D A;  1JB3 A;  2F0W A;  2SEB D;  1HUN A;  4RHS A;  3TP7 A;  3UI2 A;  3SE0 A;  3WDN A;  3FVQ A;  1PFB A;  2Z4H A;  4V19 0;  3MHB A;  5JOB A;  1II3 A;  2DY8 A;  4K6L A;  1EIG A;  3J81 E;  3ND8 A;  3KLR A;  2JSO A;  1CK1 A;  3SVM A;  3HG9 A;  3K5L A;  4G57 A;  1JCK B;  3A7L A;  2F0E A;  4L8J A;  1DOK A;  4FYD A;  1DOM A;  1SE4 A;  1MBY A;  4EVO A;  1JOO A;  1GUW A;  2KED A;  1S4Z A;  4XQJ A;  1TVX A;  1RF2 D;  3TME A;  2RKS A;  5KGU A;  1LO5 D;  3QWN A;  3GQB A;  5M5W B;  1B44 D;  2EY6 A;  4QF4 A;  4X3S A;  1GXD C;  3BS1 A;  3S14 B;  4IFD J;  3NP8 A;  4Z9C B;  3MVV A;  4ZQ3 A;  2BDN A;  2B63 B;  5BN4 A;  1KNE A;  3R2T A;  1SE3 A;  2KOL A;  2OT2 A;  3J80 L;  1EEF D;  5CV7 A;  3HOW B;  4IUT A;  4HCS A;  5EKI A;  1GHJ A;  2C5C A;  1PZK D;  2F0N A;  1JIC A;  1I4X A;  3RD4 A;  1R4P B;  2PZU A;  4KKT A;  2Q8T A;  4DK1 A;  1EYC A;  1TII D;  2IT1 A;  1TU2 B;  2NVT B;  4FNF A;  5LL6 S;  2WB1 B;  1U4L A;  2MJ8 A;  2R93 B;  3R8B A;  2ICI A;  3HP3 A;  4BY7 B;  1Z6H A;  3RZD B;  1UEA B;  2BDO A;  2NB0 A;  2EE1 A;  4IUV A;  5IGG A;  2LKV A;  5ELC A;  2NN6 I;  2J7Z A;  2OEO A;  3OMG A;  4IFD H;  3Q6S A;  2O5J C;  1SJE D;  5C0X H;  4A3B B;  1HQM C;  2RDF A;  4A3K B;  4QIW B;  4OIK A;  5DEH A;  2WKD A;  1B9N A;  1I4Q A;  2E2H B;  2CHB D;  5IGC A;  5ELB A;  3ITP A;  2AUJ D;  5EPK A;  4MN3 A;  2K05 A;  2JA7 B;  4KD4 A;  5D65 A;  1CZW A;  1ZYR C;  3M4O B;  1TR5 A;  2F0O A;  2LS0 1;  4A3G B;  4P2C B;  4NMZ A;  4K8J A;  2AWO A;  1B53 A;  4ZK9 B;  2A68 C;  3C46 A;  1PZJ D;  1J9O A;  4DF7 A;  2EZV A;  4NW2 A;  1CHP D;  1F9P A;  2PW7 A;  2RVL A;  1SYG A;  2QF7 A;  2VNU D;  2E76 C;  5G3L F;  4B9X A;  2IJ0 A;  4EQP A;  1TWC B;  4KN4 C;  3NXW A;  3SDZ A;  2EYF A;  2C9O A;  2O2L D;  1A15 A;  1STE A;  3EJI A;  4HED A;  5COY A;  1MD2 D;  4C1N I;  4C3H B;  1A3T A;  1CTM A;  2F3W A;  1TKW B;  3MXP A;  1WTV A;  1ICW A;  2K1B A;  4KKU A;  4OL7 A;  4ZAI A;  4NKL A;  1E2V A;  2LMC B;  3VA7 A;  1CA5 A;  4ZUJ A;  1TWF B;  1EOT A;  1U4M A;  2QCP X;  3BDC A;  1S5F D;  3CU7 A;  5A35 A;  1D2B A;  1SNO A;  2E75 C;  3KLS X;  5FK9 C;  2B2T A;  1CHQ D;  3NBH A;  5AFW A;  2EOT A;  4IFD I;  1SSO A;  4LJZ C;  5KNC A;  1Y69 U;  4C2M B;  1VMP A;  2ZXO A;  1Y8P B;  3SK8 A;  3K59 A;  4ABN A;  5K36 H;  3PUY A;  2O4X A;  3A8K E;  4A3E B;  4XQN A;  3G7L A;  4F87 A;  3T13 A;  1YNN D;  3I8Z A;  1Q8I A;  3QOJ A;  5CV5 A;  5FO7 B;  1EYA A;  2B2Y A;  2KJX A;  4HAE A;  2Q8I B;  1B3A A;  5M3M B;  1TY0 A;  1FYC A;  4RGM A;  2MHV A;  4HMJ A;  3M7G A;  1HQR D;  3TP6 A;  1LT4 D;  2BE5 C;  3SXH A;  3PUX A;  4N9P A;  3PUV A;  1RDP D;  3V2T A;  1T5X D;  4KV6 A;  3S9W A;  3AB9 A;  4K5W A;  1X3Q A;  2F0K A;  1BQQ T;  4G7Z C;  3I73 A;  3F2U A;  1U4P A;  1GJX A;  5ELD A;  4E6I A;  4L63 B;  3T4A C;  1Q12 A;  3HOV B;  4HMI A;  3Q22 A;  1G2S A;  3IKJ A;  2M00 A;  3URY A;  4KY7 A;  3C3L A;  2HCI A;  1RKN A;  3JAM L;  5EBD A;  2ENB A;  4N9T A;  3QO2 A;  1HHV A;  3I90 A;  4IUR A;  2ICE C;  3R93 A;  2JXM B;  2B2W A;  4J8Q A;  2PPB C;  2NVY B;  2SNM A;  5KND A;  3K6O A;  1V1P B;  3QJY A;  1O7L A;  4EQO A;  5C0X J;  2WAC A;  5C3X A;  2VB2 X;  2PYK A;  1DOL A;  1LT3 D;  2GA4 B;  3OW7 A;  3DEO A;  4X3U A;  3MXG A;  3HS0 C;  3OPO A;  4HCE A;  1Q3L A;  5HUR A;  2XN9 C;  2JYO A;  2V4D A;  4CJ2 C;  2RSO A;  1BR9 A;  3A8J E;  2NVX B;  1IYU A;  2FMM A;  2QEJ C;  3FPP A;  3PV0 A;  1H9S A;  3NK9 A;  3J80 E;  2IX0 A;  3T53 B;  5JEA J;  4EGV A;  4CKB A;  1WVL A;  2EY1 A;  1KAA A;  2FJ2 A;  5LL6 X;  2JA6 B;  2WII B;  4IZ8 A;  3GTL B;  3A55 A;  1AW7 A;  4BS9 A;  4PMW A;  4K5V A;  2L11 A;  3S15 B;  4A3I B;  1L0Y B;  1EL0 A;  1SDF A;  5A2Q L;  4LMQ D;  1JOQ A;  2A69 C;  2B2V A;  4KKS A;  3U9S A;  1VDZ A;  3NSW A;  5CBE E;  4TQU S;  2IL8 A;  5COR A;  2X69 A;  4C3J G;  1E2Z A;  2NBF A;  1WTW A;  1XXG A;  1ENA A;  3SK4 A;  4QUC A;  1G6Z A;  5ELF A;  1LAB A;  4EQN A;  1BCP B;  3MXN A;  4ZLT F;  2B2V C;  1IHZ A;  1PTO F;  1EQV A;  2D62 A;  1VF7 A;  3VYR A;  4YIJ A;  1ML0 D;  2NTS A;  1EWH A;  2MGS A;  1WTX A;  3K0Y A;  1RCV D;  4K8I A;  3VYT A;  2A6E C;  3OSO A;  3NUC A;  4CKE A;  3GP7 A;  2XVS A;  4X3T A;  4JK1 C;  1NAP A;  2MP1 A;  3ERO A;  3RUZ A;  3DWA A;  1HA6 A;  1OXV A;  1O7Z A;  2ZT9 C;  2AQ3 B;  3BZD B;  1BXT A;  2EYP A;  3QG1 A;  4S3S A;  4QUF A;  5CC4 A;  4ZKB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...