1GVPA

Gene v protein (single-stranded dna binding protein)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
b'MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Analyses of the stability and function of three surface mutants (R82C, K69H, and L32R) of the gene V protein from Ff phage by X-ray crystallography.
pubmed rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 11
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1997-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1gvpA00
3G4SA 1L1OB 3GTJH 5FLXc 1WYDA 4JI2L 1CUKA 4IO9A 5M5YH 1K8AC 4R4CA 3TS0A 1VQHA 1HZBA 2MNAA 1W2BA 4A3BH 2K14A 1EWIA 3CCQA 3PIOA 4JI3Q 4B3TQ 1OXXK 1K83H 3ULPA 2QA4A 4QIWE 5M5XH 4B3ML 3J81j 3TS2A 1FVIA 4JBJA 5IYBH 3OTOL 1PHJA 2R92H 2WP8J 1PVOA 2ZM6Q 4DV4Q 2B3GA 1ASYA 1G51A 1TWFH 2R7ZG 1VQ4A 4JBKA 4KHPL 4OO1I 1GKHA 2H5XA 1FJGL 1E24A 3CD6A 3GTOH 3CCJA 3F2BA 4LF5L 1I6HH 4A3GG 3JAMc 1TWHH 1Y14B 3KDFB 2FXQA 3SGIA 3HKSA 4DUYQ 4LF4Q 2E5LQ 1OXVA 5IYDG 1IBLQ 2B63H 1VQKA 5IP9H 4BY7H 3CMAA 2KCTA 2Q2IA 2MO0A 1TXYA 2KENA 1VQFA 2ES2A 1TWGH 2Q2HA 4OX9L 5GADC 4APVA 4DV3L 3GTPH 3J80i 4UY8C 2N49A 3FP9A 2JEAI 4LFBQ 2PQAB 3M4OH 3CPFA 4YCVA 4LW1A 3GO5A 1MJEA 4DPGA 1RL2A 2Y0SG 3A74A 1WFQA 3AYHB 4A3FG 3L2PA 1MIUA 1CKOA 1VQ8A 3U4VA 4OWXB 1X56A 2K52A 1RIPA 3W1GA 2OQ0A 3NENA 2CWPA 3PCOB 4TVAB 3FKIH 4P73A 3JAMi 3GTQH 1GO3E 2NN6I 1YITA 3HOZH 3RLNA 3PUYA 4P75A 4JI8L 3H15A 4JCVE 4X66L 3HOVG 3CPWA 3CF5A 4BA2I 2VQEL 2NVXH 4C2MH 4NPSA 5GAEC 1DGSA 3CW2C 2JJQA 2VZAA 4PG3A 3I4NG 3BJUA 3S1RH 1UE7A 4JOIA 4NB3A 1A8VA 1K3RA 2LXKA 3ZJYC 3CCEA 1I94L 3PO3H 4DR4L 4HJ5A 5ELNA 2JA6H 4PMWA 1UE6A 1Y1WH 2AWNA 1UWVA 1PFSA 2HIXA 1HR0Q 2HT1A 4K0KQ 1HNWL 1SE8A 4NXNQ 1IXRA 4DR7L 3G6EA 3PO2H 3RNUA 2K50A 5LMNQ 1B7YB 3KLWA 4UP7A 4AH6A 4IOCA 2I0QA 1XPUA 1N32Q 1KRTA 5FJ8G 3HOWH 3KFUA 4JBMA 1VQJA 4PZ8A 3KF6B 4A93H 3NELA 2OTLA 1SLJA 1GD7A 1PH7A 1VQNA 2MQHA 2PI2A 1EFWA 2R6GA 1HNZQ 3U50C 3KJPA 1LUZA 3H3VH 4MNOA 1YNXA 3RZOH 4JI3L 4OWTB 4B3TL 5IP7G 3PUVA 3I2ZA 4JBWA 1FGUA 3S2HH 4AQYQ 2EQSA 3I4MG 5M3MG 1E3PA 1VQMA 4Y7NH 2ZM6L 2UXBL 4R4QA 1OTCA 1WCMG 2EXDA 2F52A 3CAMA 5GQOA 4JI1Q 3RLOA 4YY3Q 3TREA 4IPCA 3S14H 1H95A 3W1BA 2KCMA 2LXJA 2NVYH 2K75A 3HFZB 4LF8Q 3M3YH 3E9HA 1X3FA 1BBWA 5C44G 2D0PA 4HIOA 4GNXB 3ICEA 1YZ6A 2Q2TA 2D0OA 5C0XG 2E5LL 1HH2P 5C0XJ 1EIFA 1S72A 2R7ZH 4YHHL 1Q86C 4BBSG 4XIGS 1J5EQ 3FHWA 4YWMA 4GKJL 2JE6I 4LFCL 3UDXA 5C4JH 1CSQA 1O7IA 3IRBA 1X3EA 4A3EG 2WB1G 4A3GH 2N3SA 1X6OA 4LUZA 1N8RC 1T9HA 1VQPA 2KHIA 3E9IA 5M5WH 4DV5Q 1PH4A 1M90C 2DGYA 4GOPB 2E2IH 5IYDH 4IPDA 2ZJRA 3TRZA 3PV0A 1AE3A 1SROA 3CC7A 2F4VQ 4DKAC 4Y52H 3J81i 1KIXA 1HNXQ 4DV1Q 3CP0A 1JMCA 5JJLA 3M85A 4IFDI 3D0FA 4A3FH 4ALPA 3NEMA 4UP9A 1N9WA 1IBMQ 4YCWA 4A3CG 2N78A 2R93G 2OCEA 3K7UC 4GLAC 4XTCS 3EN2A 4C3IH 1I50H 1C0AA 4A3MG 1WOCA 5IWAQ 3HOVH 5GAHC 4JOIC 4MZ9A 1S40A 1SMXA 1PYBA 3PUWA 1HR0L 4K0KL 4OO1G 2ZJPA 1IBKQ 1CSPA 3M9BA 5LMNL 4O0AA 1NBWA 2CQOA 2KHJA 3K80C 1B70B 4R1JA 3I4NH 4C3HH 5H1SE 1A0IA 1EUJA 1HZAA 4RG1A 3PSIA 4J15A 4EX5A 4UP8A 3WWVA 1X3GA 2HHHQ 3B6YA 1YVCA 2Z0SA 4B3SQ 3ER0A 2JA7G 3J7A5 1HNZL 4HIMA 5FJ8H 4UPAA 4JI0L 4B3RQ 1WJJA 2IHEA 1K9MC 4QL5A 2OWOA 4JI5Q 4DR6Q 1D7QA 4JI4L 1PH9A 4LF6L 4AQYL 4JI6Q 4OXPA 1G291 1KL9A 1X9NA 4IPHA 3GTKH 1LYLA 1UEBA 1JT8A 1C7YA 1S3OA 2AHOB 2CFMA 5IP7H 4YY3L 1YJWA 5J3BA 4BXXG 3S15H 2VL6A 2C35B 4BBRG 4JYAL 1N34Q 1E7ZA 1VQGA 1L0WA 3F2DA 5M3MH 1QVFA 4LWCA 3I4MH 3D31A 3PF4A 5K36G 4DR1Q 2WAQE 1HJPA 1WCMH 3MXNB 2V1CC 4DR5Q 1V1QA 2ZTCA 3U58A 4PZ7A 1VQOA 2UU9Q 1OXSC 3TQYA 4A3DG 3KJOA 4DK3C 1YI2A 4GN4B 1J5EL 2AKWB 2WFWA 1UE5A 2IHFA 1Q8KA 2JA8G 2WAQG 5C44H 5BR8L 1VQ6A 4A3KG 1PV4A 2HQLA 5JJIA 1D8LA 3T1YQ 2JA9A 4DV5L 2ID0A 2OQKA 1K73C 2RF4A 4BBSH 1XPRA 1YIJA 1BBUA 4A76A 1TWAH 1WI5A 3T1HQ 4LF7Q 3CCMA 4GLVB 1NMGA 2VUMG 4GKKQ 2F4VL 4L5SA 4P71A 5AJ3L 4DR3Q 1AE2A 4A3EH 1YHQA 4A75A 2LSSA 4DV6Q 4DV1L 1KRSA 1E22A 2PNHA 3K7AH 2VY3A 5ELOA 1R9TH 2BH8A 1LTLA 1MJCA 3W5OA 3CMEA 5JEAG 2VQFQ 1EYGA 5JEAJ 3I7FA 3CCUA 1IBML 4EQ5A 4DUZQ 1HR0W 1JE5A 4MTNA 3TEHB 3DLLA 2K5NA 5C4XG 5EAYA 1SRUA 1XJVA 5LMNW 4IJLA 3GD7A 4HJ8A 1NY4A 4DAYB 1XMOQ 3EIVA 1XMQQ 2NVTH 4KHZA 3RN2A 1PYSB 4C3JH 3S2DH 4A3CH 1YEZA 2R93H 1QUQB 3VDYA 1P16A 4A3MH 1BKBA 2L15A 5C3EG 4BY1G 1LM0A 3K81C 3HOUG 2VW9A 2AWOA 3AFQA 3RR5A 4FDBA 4HIDA 5LMUQ 2YTVA 1JB7A 1V9PA 2EIFA 3I4OA 4YWKA 5FLMG 4GLXA 4B3SL 3GDEA 1IL2A 4A3LG 3S1MH 4AIMA 1UE1A 3L0OA 4DV4L 1PH6A 1VQ7A 4B3RL 4B3MQ 4JI5L 4DV2Q 2Q2UA 3HOXG 1EOVA 1VQCA 4GN3B 2UXDQ 3ULJA 5DLQE 3S17H 1M1KC 4JI6L 4LF4L 2JA7H 3UE0A 4DUYL 4IOAA 1Q81C 2BA1A 3KOJA 1IBLL 2QGQA 2N8NA 4H02A 2K4KA 4KHPQ 3OW2A 1PH5A 4LUOA 3DM3A 2MFIA 4LFAQ 1MKHA 2YTXA 4JI7Q 4LF5Q 2GVAA 4P72A 1N34L 1L1OC 4LFBL 2Z6KC 2ASBA 1NJIC 4PZ6A 3GTGH 3S1NH 1J6QA 1VQAA 3UDFA 1K0RA 4DR5L 4HJ7A 1PH2A 2UU9L 4BXXH 2PI2E 4OX9Q 3Q8DA 1I5FA 4BBRH 2VNUD 4WJ4A 2CKZB 4O2DA 1XNRQ 3S1QH 2VS1A 2YU9H 3G71A 4DK6C 1Q82C 1QVCA 3A0JA 4X64Q 1N33Q 2RCNA 1E1TA 2XTIA 5GAGC 1K8GA 4A3DH 4IJHA 1EQQA 1C9OA 1VS0A 2JA8H 4HJAA 3BZKA 1B8AA 1YHAA 4DR3L 4A3KH 2A8VA 3UDGA 2UXCQ 1OXUA 3UE1A 5IYCG 1YHBA 4X66Q 3CXCA 5M3FG 4NXNL 2F3IA 4DV0Q 4HIKA 2IT1A 3M4PA 1X55A 2VQFL 2ATWA 3AEVA 2K5HA 1QZHA 2VUMH 2IY5B 1N32L 2I5MX 4ME3A 2YV5A 4HJ9A 1Q46A 3L7ZC 1OXTA 1HNWQ 2ZTEA 2ALYB 4JV5Q 4A3JG 3NBHB 4OWWB 4DR7Q 2CCZA 2KBNA 1W3SA 3K0XA 4LF9Q 2NZHA 4KI0A 2UUCQ 4WJ3M 3CCSA 5C4XH 4X65Q 1PH3A 3F2CA 3F1ZA 3F8TA 2E8GA 1CKNA 4X62Q 2D62A 1XPOA 1L2FA 5LMUL 2XGTA 3STBC 4JI1L 1Y1VG 2NN6G 4LNQA 1PH8A 3BU2A 3JC66 2R7DA 4IPGA 1L1OA 4A4IA 2Z6KA 5C3EH 4DV2L 3A5UA 1QZGA 2JA5G 4BY1H 4LF8L 3H3VI 3HOUH 2B29A 1A62A 3H0GG 3J80c 3G48A 2UXDL 2UXBQ 3AFPA 5JJKA 5FLMH 4A3LH 3HOYG 2JQOA 4R4IA 2OTJA 1XNQQ 4L5RC 2IX1A 1FL0A 1NTGA 2MO1A 1Q12A 5HGQA 5IT9c 2GN5A 2ZJQA 1Z47A 4JG2A 3HOXH 3K8AA 4A3IG 2UUBQ 4JI7L 1VCIA 4DAMA 4LFAL 1VQLA 4QQBX 3STBD 4DV7Q 3GTLH 3LGJA 2JK8A 5GROA 2K5VA 3EBEA 1TWCH 3E0EA 4YHHQ 3PIPA 2Y0SE 3MEFA 4DNIA 3CCRA 4LFCQ 3GTMH 4GKJQ 4RMFA 2AMCB 1BVSA 2QEXA 1XNRL 1HNXL 3I56A 2A1AA 1N33L 4X64L 4X6AH 1JJCB 5HY6A 4DR2Q 2RHSB 3KDFA 3RZDH 1KXLA 4L5QA 3ULLA 1Q1BA 2UUAQ 1KAWA 3CC2A 1AH9A 2UXCL 1E1OA 3S16H 1SFOH 5IWAL 1GM5A 4NXMQ 3KF8B 1N36Q 1IYJB 5IE8A 2CWAA 2PQAA 2GVBA 1X65A 4L5TA 3BZCA 1PA6A 4A3BG 4DV0L 1IBKL 1YBYA 1SR3A 4R4OA 3S24A 4GNXC 1I3QH 2IX0A 1VQBA 4BA1I 4R4TA 4YCUA 4QY7A 1U0LA 4JI2Q 5IYCH 3J7ZC 3CQZH 5IYBG 3CC4A 5M3FH 2R92G 4JV5L 2HHHL 1EQRA 1Q7YC 1IZ6A 4GN5A 4LF9L 1HZCA 3U4ZA 2UUCL 2HIVA 2I5HA 4JC0A 2E2HH 1EIYB 2ZTDA 4GOPC 3A5ZB 3UDIA 4X65L 1YJNA 3OTOQ 4AYBE 3PUXA 4A3JH 1PH1A 1SN8A 2NVQH 3CCLA 2YTYA 4KLKA 4X62L 2JEBI 2B63G 4JI0Q 1Q1EA 1VQEA 5IP9G 1XTDA 4P74A 4BY7G 3RLFA 4AYBG 1VQ5A 4JI4Q 4LF6Q 1FJGQ 5IY0A 3CCVA 4IFDG 1YJ9A 1VQ9A 4IFDJ 4POGA 4DR6L 3KF6A 2A19A 1G6PA 4YWLA 4DR1L 2YYZA 2PMZE 2RHQB 1NE3A 1A63A 1Y1VH 4TQUS 1XNQL 1VQDA 1VQIA 1KHIA 1NMFA 4JYAQ 4DV3Q 2JA5H 1ASZA 2UUBL 1QUQA 3J81c 3FKIG 1Z9FA 3H0GH 2I5LX 3KYHC 5E7NA 3HOZG 1GVPA 3HOYH 2WB1E 4DV7L 1V43A 3T1YL 2NZOA 2BA0A 4QJFA 3PUZA 4A3IH 3T1HL 4LF7L 3AQQA 3HKZE 1P8LA 3RN5A 4GKKL 5BR8Q 4OONA 3PO3G 1JJGA 3PGZA 4POFA 4JI8Q 4DV6L 1X54A 2JA6G 1U5KA 1Y1WG 3ERSX 2VQEQ 1KD1C 4DR2L 4GNXA 3HKZG 3PO2G 3I55A 4GS3A 3OYYA 4LUVA 3M4QA 5AJ3Q 1QVGA 5C0XI 1I94Q 4DUZL 2UUAL 3HOWG 1CKMA 4QGUA 4DR4Q 3PF5A 2BH2A 2E2JH 4A93G 1CKNB 1HZ9A 2DUDA 2R7FA 3M7NA 4NXML 1XMOL 1N36L 1KQSA 1XMQL 1KC8C 1JJ2A 4GOPA
chains in the Genus database with same CATH superfamily
1GUNA 1L1OB 3GTJH 4IZ8A 2F0FA 4A3BH 4H13C 5FO7B 1EWIA 3KLSX 1OXXK 1K83H 1H9RA 2Z6BA 5CR3A 2B2UC 2R92H 5K5PA 1PVOA 1IKMA 1ASYA 2OT2A 3S15B 1FNUA 1I6VC 3CCJA 3F2BA 2FMMA 1TWHH 3H6MA 3KDFB 1TS3A 4DUYQ 2F03A 3A54A 5IYDG 1ONLA 2L4NA 1NCVA 4ABNA 5IP9H 3J7YW 3BZDB 1MD2D 2Q2IA 2MO0A 1TWGH 5IIFA 5GADC 4DV3L 1D5XC 2JEAI 3FP9A 4N9PA 2BOSA 1RF2D 2PQAB 4JPBW 2HCIA 3ND8A 3GO5A 1TR5A 1TWAB 3A74A 1WFQA 1QCBD 3AYHB 4DK0A 1WD0A 3SHLA 1BXTA 3NENA 4TVAB 4DU9A 1II3A 3MWYW 3HOVG 4DN4M 3CF5A 4BA2I 2F0KA 3H09A 4NPSA 2R3ZA 3R8BA 3R2IA 5I9PA 2QF7A 3I4NG 3BJUA 1UE7A 3PO3H 1A8VA 2P5ZX 2PCFB 3ZJYC 3SVMA 4DR4L 4V190 2JA6H 4PMWA 3J80E 1HNWL 1SE8A 2PQEA 4MIUA 1NAPA 5LMNQ 2RSNA 2I0QA 5IT9E 5FJ8G 2B2VC 4A3MB 4DAPA 1HFNA 4M1UB 4A93H 3A8JE 3KBXA 3JAME 1PH7A 2MQHA 3D6CA 3SEBA 2KECA 3RZOH 1LUZA 4MNOA 4JI3L 4B3TL 1PTOH 3PUVA 3T51B 4JBWA 5EJWA 4C1NK 3HP3A 5M3MG 4Y7NH 2ZM6L 5CGKA 4OL7A 1OTCA 5GQOA 3RLOA 4DAYA 2F0IA 1SE4A 4N9TA 2EPBA 2CHBD 2DNEA 4IPCA 4F87A 2F0TA 2K75A 3HFZB 1X3FA 4CGYB 1BOSA 2D0OA 1D2BA 1O7ZA 2E5LL 2R7ZH 2B8FA 4BBRB 2F0UA 4YHHL 4QUFA 1ET6A 4YWMA 1JWMD 3S1QB 3IRBA 5IGEA 1X3EA 4A3EG 2WB1G 4M8AA 1JB3A 1JOQA 4RA8A 1HRJA 2KHIA 2DGYA 2K32A 1DOMA 3MC0B 3PV0A 2RQXA 1SROA 1DD2A 5D3DA 4A3KB 4DKAC 3J81i 4O1NA 3NUCA 5ISRA 4DV1Q 1CQVA 1EEID 3M85A 1W6JA 3NEMA 2VUMB 4UP9A 1QJOA 1IBMQ 2JP1A 4YCWA 3FDTA 2R93G 1Q90A 5IWAQ 4EQOA 1S40A 4K0KL 2ZJPA 5C4XB 1SBBB 5H1SE 4WJWA 1A0IA 3BVGA 2Z4IA 3I72A 4HN7A 4RG1A 3KLRA 4CJ1B 4EX5A 3WWVA 1X3GA 5KNDA 1DOKA 5EBCA 4B3RQ 1RCVD 3TBIB 4LF6L 1CI3M 2FHTA 2A68D 1KL9A 4OIKA 1X9NA 3A55A 3GTKH 1UEBA 2X6GA 5IGBA 1JT8A 2AHOB 1BCPF 5IP7H 1B4OA 3MXUA 1LTSD 2FJ2A 3D6WA 1N34Q 3I4MH 3PF4A 4EQNA 4L8JA 4DR1Q 1TWCB 2WAQE 1HJPA 2V1CC 4DR5Q 3MTSA 1VQOA 4KY7A 4B9XA 3TQYA 1Y8PB 2M2LA 4EGVA 1J5EL 5G3LD 2AKWB 2OXPA 2IHFA 2WAQG 5KEEA 1VQ6A 2EZVA 1PTOC 4MN3A 2XRSD 3T1YQ 3RZDB 2ID0A 2F0WA 4EQPA 1K73C 1BBUA 4A76A 4I7ZC 5AJ3L 1AE2A 4A75A 2LSSA 1SYBA 1X3QA 2Q8TA 2VY3A 5JPMC 5DAUA 1MJCA 3OMGA 4CJ2C 2VQFQ 1EYGA 1RTOA 3DMUA 3I7FA 4G4KA 1JE5A 3TEHB 1LABA 3EROA 1SRUA 4DK1A 4IJLA 1G8ZD 1S5ED 4KHZA 2K05A 4C3JH 2PW5A 3S2DH 4A3CH 3LWUA 2E2HB 2RKSA 3VDYA 1NSNS 5DEHA 3T56B 4BY1G 5LHY1 2OF1A 4OO1H 3AFQA 1IL2A 3KF8A 3GDEA 5C3WA 1UE1A 1TY2A 3RMHA 4DV4L 1VQ7A 1TS5A 4MTKA 4JI5L 1EOVA 1VQCA 4CDCC 1B9NA 3S17H 1M1KC 1HQMC 2JA7H 3UE0A 4Q5VA 1QOHA 1Q81C 3P20A 2QGQA 2K4KA 4LUOA 3DM3A 2MFIA 5BN3A 1RKNA 2YTXA 3NWSA 4JI7Q 1GUSA 1QE6A 1A2UA 5CV9A 3S1NH 1JC7A 1RDPD 1ILQA 1I5FA 1ZYRC 2VNUD 5K36H 4JK1C 2YU9H 1QVCA 4X64Q 4ULLA 1N33Q 1KLUD 2RCNA 1F9SA 2O5IC 1K8GA 4A3DH 2K7VA 1VS0A 3MEHA 4HJAA 5BN5A 2E2JB 1YHAA 4DR3L 1OXUA 2L55A 1YHBA 2EYHA 3MAQA 3ITPA 3BS1A 1AEXA 4ZK9B 1WTXA 1E2ZA 4OHJA 3GTJB 2F3VA 2K5HA 2I5MX 2K6AA 4HJ9A 4ZKBB 2RBMA 3DHQA 1HNWQ 4A3BB 3HZXA 4JV5Q 2D5DA 3NBHB 5JEAH 4K8JA 1K83B 2NZHA 2UUCQ 3TSSA 3CCSA 2R92B 3F1ZA 1B44D 2E8GA 1CKNA 2D62A 1XPOA 5C5LA 3J80L 1CHPD 3STBC 1KTKA 1Y1VG 5C3EH 4A4IA 4DV2L 1U4RA 4J1MA 2JA5G 1TWHB 3A5UA 3H3VI 3HOUH 5IT9L 1DCZA 2UXDL 3H0GG 3G48A 3EA6A 3AFPA 1BDOA 3G6JB 4A3LH 3J7AV 2JQOA 3K6OA 3JAML 1XNQQ 4L5RC 1TWGB 2NZ1D 2GN5A 4A3IG 3K8AA 1D1KA 3SK4A 4CDEC 4QQBX 3LGJA 2JK8A 3E0EA 4YHHQ 3R93A 1SDFA 3AMUA 3MEFA 2QW7A 3GTMH 2PMZB 2AMCB 4IQZA 1BVSA 4F88A 4KKSA 5JOBA 3V05A 3SK5A 1EYDA 2SNMA 2DJGC 1JJCB 5HY6A 4DR2Q 1KXLA 3PO3B 3SK6A 3K58A 1AH9A 5ELBA 2JA6B 2UXCL 3S16H 2VXWA 4DNRB 3HKZB 1GM5A 1PRTC 1IYJB 2LMCB 4O42A 4L5TA 5KNBA 4DV0L 1IBKL 1WD1A 3C3LA 4A93B 1PMRA 4GNXC 1PFMA 1QNUA 4YCUA 1U0LA 1PLFA 3I8ZA 5IYCH 4L6TB 2NTSA 3CQZH 5IYBG 3RZOB 2QDLA 4GN5A 3U4ZA 1PTOB 3RD4A 4I65A 2V4DA 3K57A 4Y7NB 3PUXA 1SN8A 2SEBD 4B08A 2B63G 4HSPA 5I6WA 1Q1EA 4BY7G 2KQ3A 4IALA 4LF6Q 1YJ9A 4IFDJ 4K14A 5IGGA 3W2DA 4CJ0B 4RKBA 3CKIB 2R7ZB 3DUZA 2NN6H 3T4AC 3VA5A 2MJ8A 1NMFA 1ASZA 1A3VA 1QNKA 4HSVA 3J81c 2I5LX 2L9HA 3KYHC 5E7NA 5C3XA 3BVMA 4DV7L 1V43A 4IUQA 2BE5C 4J6HA 3PUZA 5C6AA 4K6LA 2HDLA 2QILA 1JJGA 5IOCA 3V96A 1U5KA 2I46A 1UUPA 3VYSA 3PO2G 4GS3A 4LUVA 3M4QA 5AJ3Q 1D1IA 1EU4A 5C0XI 1I94Q 2F0GA 3GQBA 2UUAL 1CKMA 3HEJA 3HOWG 3PF5A 3SDZA 2R7FA 1DZ1A 3MFYA 1EU3A 1JJ2A 5EGTA 4GOPA 3G4SA 4Z9CB 4RGOS 4RGMA 4RWSC 1K8AC 3TS0A 1VQHA 2MPMA 1H9KA 2F0OA 2JYOA 4PMCA 3TP7A 2QA4A 4K8IA 5M5XH 3TS2A 3GTKB 2WP8J 1EIHA 2XWBB 1UNSA 1S5FD 4DV4Q 3K0YA 1G51A 1TWFH 3M4YA 4JBKA 1V1PA 2KVMA 3I4MB 3CD6A 3GTOH 4A3GG 3JAMc 3SGIA 5E4WC 1NR4A 4OX9L 4HAEA 4HEDA 4KN4C 1SYCA 4XQJA 3M4OH 1RL2A 2Y0SG 1MIUA 1CKOA 3FMCA 1JQYD 2EY5A 2IPKD 4K5XA 3W1GA 2CWPA 3FKIH 1WTHA 2A6EC 1GO3E 2NN6I 4C3IG 1YITA 3HOZH 4DNTB 4DXGA 1EIGA 1LT3D 2VQEL 2EJFC 3NPPA 3R2TA 4C2MH 1DGSA 2JJQA 2VZAA 3DXJC 2F0EA 2EYLA 4IN3A 1K3RA 4C3HG 5ELEA 1SMYC 3BG3A 4HJ5A 1BR9A 5ELNA 1UE6A 1BCPD 2AWNA 1HR0Q 2HT1A 4XQQA 4DR7L 4C3JB 4B9WA 3RNUA 3S2DB 4IOCA 4AH6A 1I4GA 1X32A 3KFUA 4JBMA 4HTHA 4PZ8A 3KF6B 3TP8A 2EE1A 1VQNA 4FVMA 4BS9A 3VYUA 1HNZQ 2BDOA 3KJPA 4OWTB 3S17B 2A69D 4AQYQ 2EQSA 2JA7B 1E3PA 1VQMA 2SDFA 3U9SA 2UXBL 1WCMG 2F52A 1CK1A 3TREA 5KIXA 1BO0A 5HGTA 3S14H 1H95A 1PRTB 3W1BA 1G6ZA 2A6HD 4ZKCB 4ID6A 2KJXA 3E9HA 3DWPA 5C44G 3S1NB 4GNXB 3ICEA 5C0XJ 1EIFA 4BBSG 3FHWA 4LFCL 3UDXA 4PQXA 2YU9B 3LWEA 3MXPA 2SOBA 2G5DA 1VQPA 3E9IA 5M5WH 5IYDH 3KUPA 4A3DB 2ZJRA 1C48A 3TRZA 4HR7B 2F4VQ 3PIO3 3N6RA 2DN8A 3HS0C 2WV6D 3CP0A 1RD9D 3D0FA 1GUWA 1K3BC 1N9WA 5EBDA 4HMJA 3HRZC 1KNAA 3K7UC 3EVQA 3HOVH 3G7LA 4JOIC 4DA2A 3PUWA 4K5VA 1STHA 2KOLA 2C9OA 1IBKQ 1CSPA 3M9BA 4R8NA 1K0SA 1NBWA 2CQOA 2KHJA 3I4NH 1B70B 1DYQA 1EUJA 1HZAA 3J81E 4J15A 3K5MA 1VDZA 2KEEA 2M00A 1EYAA 2JSOA 3B6YA 4B3SQ 1KNEA 1Z7TA 5DNFA 3J7A5 5D14A 4HIMA 5FJ8H 3FPUB 4OEMB 5C3EB 1K9MC 3HOUB 3LNNA 1H9JA 4JI4L 2EYJA 5KYLA 4IUPA 1CTMA 1R4QB 4JI6Q 4IPHA 1SNQA 4YY3L 3IFTA 5CORA 2VL6A 4FXKC 2C35B 1QILA 4JYAL 3OIPA 1E7ZA 1L0WA 5M3MH 1HQRD 5KYIA 1A6XA 1B2TA 4UHVA 5TSSA 3I73A 3EQLC 3OIQA 2ZTCA 2UU9Q 3GTMB 2J0TD 3TMEA 3HG9A 3KJOA 4DK3C 2LKVA 1UE5A 2JA8G 1Q8KA 5IGDA 1STAA 4HMIA 4DV5L 1VMPA 3V2TA 4GLVB 3S16B 2LFNA 4A3EH 1YHQA 2MUYA 1Q3LA 1F77A 4J8QA 3K7AH 2BH8A 1WTWA 3CMEA 3ERQA 3CCUA 4EQ5A 1AP0A 4MTNA 1LACA 1QG7A 2K5NA 3CQZB 3K5NA 1SYEA 5LMNW 3GD7A 4RKLA 2MHVA 1NY4A 4N8FA 2FMCA 4DAYB 3BDLA 3EIVA 3RN2A 5F2DA 1BUVT 2R93H 4KKUA 1MI2A 1LM0A 1LO5D 3K81C 2RVLA 4HIDA 2YTVA 2Q8IB 1V9PA 2DNCA 4GLXA 3OPOA 1Y8NB 3S1MH 3L0OA 1PH6A 3HOXG 1SJED 2IX3A 5DLQE 1AFPA 5EKKA 4LF4L 3KOJA 1IHZA 2N8NA 3ZYYX 1O78A 1SXTA 1FR3A 2RDGA 1MKHA 4C56C 1JR0D 2GVAA 3A56A 4P72A 1WTQA 3GTGH 2XIWA 3GV6A 1K0RA 1S5BD 2F0MA 4OX9Q 3Q8DA 3BDCA 4WJ4A 2F4IA 2XSCA 2VS1A 3G71A 4DK6C 1YNJD 2Z1CA 5GAGC 1EQQA 3BZKA 1B8AA 3FPPA 4RCOA 1EY8A 2A8VA 3UE1A 4X3SA 2PO4A 5M3FG 1EL0A 4HIKA 3M4PA 2ATWA 3AEVA 1QZHA 4ME3A 4ZUJA 2BE5D 1B50A 2ZTEA 4A3JG 1MSGA 4DR7Q 1JICA 2H1EA 3K0XA 4LF9Q 1ENFA 3E5SA 4WJ3M 5M5XB 1IW7D 4R8IA 4X65Q 1VMCA 3F2CA 1XYIA 3F8TA 1S5DD 2KCNA 4X62Q 1CHQD 1TWFB 2PZTA 5LMUL 1RTNA 4OGQC 2XGTA 4JI1L 3GTOB 1PH8A 2R7DA 1QZGA 4BY1H 1R4PB 2NTTA 2B29A 2CW0D 2KCCA 1PTOF 1V8QA 1CA6A 2UXBQ 1T5EA 3HOYG 2OTJA 4ZLTF 3Q23A 3A8IE 3NXWA 2UUBQ 3H91A 4LFAL 5J22A 3M4OB 1CZGA 3GTLH 4ZUIA 5GROA 2K5VA 1GUTA 5CV6A 4DNIA 3FKIB 3CCRA 4LFCQ 2Q8RE 4RMFA 1I4QA 3HOZB 1XNRL 1JE4A 1HNXL 3I56A 4C2MB 4X6AH 3FVQA 4IUNA 4L5QA 3ULLA 4QCLA 2J7ZA 2PW7A 1DJRD 5C4HA 1F9QA 3KK7A 1SFOH 3KF8B 2CWAA 3D4RA 4FF1A 1PA6A 3S24A 1I3QH 4BA1I 1J8IA 4R4TA 2NWGA 4QY7A 2QEJC 2XNAC 1Q7YC 1IZ6A 4DF7A 1Q8IA 1TY0A 4GOPC 3VYTA 3A5ZB 3D4WA 2A5HA 3UDIA 1SNMA 2B2TA 1GHKA 4AYBE 3MFGA 3Q0AA 2NVQH 3C2PA 2E74C 3DEPA 5DM73 3S14B 1VQEA 4P74A 4AYBG 5ELCA 1LT6D 4JI4Q 3TZDA 4IFDG 1VQ9A 1KLGD 5E3FA 5T1GA 4DR6L 1G6PA 2E76C 3J81L 1A63A 3I70A 1Y1VH 1WTOA 3QJYA 5C4ZA 4JYAQ 4DV3Q 2JA5H 2B39A 5LL6S 3H0GH 5M5WB 1LTTD 2TMPA 2BA0A 1EY0A 4CDFC 4CBVA 4A3IH 4LF7L 1JOOA 2DY7A 4GKKL 1SYFA 4DV6L 1U4LA 1X54A 3PQIA 5NUCA 1Y1WG 3ERSX 1QVGA 2F0VA 4QGUA 3HOVB 4DR4Q 2BH2A 1CKNB 1HZ9A 3M7NA 3I90A 4ODGA 4NXML 4KJNA 1N36L 2B2VA 3SE0A 2NUCA 3I4NB 2KUMA 1XMQL 1KC8C 2AUKA 5KGUA 3TP5A 3AB9A 4OELB 4L63B 5JPNC 1WYDA 4KD4A 4JI2L 2F0LA 5M5YH 1B3QA 4R4CA 2JN4A 4JI3Q 3PIOA 4B3TQ 3WOEA 3ULPA 4B3ML 3AU7A 1WTRA 5IYBH 3OTOL 1PHJA 1EWCA 1FYCA 1YNND 2ZM6Q 5CC4A 3IAYA 2LS01 1B3AA 1PZKD 2B3GA 3S9WA 2L0CA 4KHPL 4OO1I 5M3MB 1XTCD 1FJGL 1E24A 5FKAC 1TU2B 1Y14B 4LF4Q 2FXQA 1HUNA 3HKSA 2E5LQ 1OXVA 2B63H 3NBHA 3SR1A 1VQKA 3Q22A 4BY7H 3CMAA 2PZUA 2KCTA 3C46A 2KENA 2Q2HA 2D2CC 4HCSA 4X3TA 4APVA 4UY8C 1A3UA 1EOTA 4YCVA 1K8MA 1F2ZA 4LW1A 1MJEA 1PRTF 5KRUA 2EYPA 4A3FG 3L2PA 2CVRA 2M9VA 4LJZC 1VQ8A 4OWXB 1X56A 2WB1B 4A3EB 2OQ0A 3PCOB 4P73A 5A35A 1HHVA 3K7AB 3RLNA 3PUYA 4P75A 4JI8L 2BCOA 4JCVE 4X66L 3URYA 1H9MA 2A74C 4X3KA 3MXNA 3E0JA 4PG3A 4UDUC 3S1RH 5JJLA 3TN2A 3OSOA 2HIXA 4K0KQ 4IURA 2I07B 3G6EA 3PO2H 3HGBA 1B7YB 3KLWA 2R93B 1KRTA 3HOWH 1HUMA 1VQJA 2WKDA 3NELA 2OTLA 1SLJA 2NYZD 1GD7A 3OOCA 1PZID 1SJHD 1TQOA 2R6GA 3S1MB 2F0SA 4H0LC 3I2ZA 3CRKC 1FGUA 3S2HH 1H9SA 3O13A 4QIWB 3C1FA 5JAVA 3CAMA 4JI1Q 2KCMA 2NVYH 1ML0D 2D0PA 3GTGB 4HIOA 2F0DA 4K2KA 1YZ6A 2KHSA 5C0XG 1HH2P 1Q86C 4XIGS 1J5EQ 4GKJL 5C4JH 1K8OA 1CSQA 2K28A 1HCZA 1WTVA 4A3GH 5LL6X 2N3SA 1X6OA 1N8RC 3NSWA 1T9HA 1M90C 4LAAA 2E2IH 4GOPB 1CA5A 1AE3A 4F7XA 2WAQB 3CC7A 3BDOA 1HNXQ 2F0QA 1JMCA 1F9RA 2DJFC 4ALPA 1U4MA 3J7AF 4DGZA 3QIAA 4NKLA 3T16A 4GLAC 3EN2A 4C3IH 1I50H 4A3MG 1WOCA 1ENCA 5GAHC 1CT1D 1DM0B 1HTPA 1V1PB 5LMNL 2FINB 4O0AA 2A68C 1A3TA 1IYUA 1EFID 4C3HH 4F8MA 3DWAA 4YIJA 3PSIA 4UP8A 2EY6A 2OEOA 1AZQA 4FXDA 4U68A 4UAIA 4BWGB 1RHPA 1NNXA 3NTKA 1EWHA 4QL5A 4BY1B 4JI5Q 3CU7A 1D7QA 1PH9A 3TP6A 1WVLA 3E6ZX 4OXPA 1ZEQX 1LYLA 3I3CA 1RJTA 2KEDA 1C7YA 1YJWA 4BXXG 2PYKA 4BBRG 4XT1B 3OHXC 5C5MA 4DR6Q 3GTLB 4LWCA 1QB5D 3D31A 1G2SA 1WCMH 1OXSC 4QB4A 4GN4B 2WFWA 5C44H 5BR8L 4A3KG 4QMGA 1PV4A 2HQLA 5JJIA 3VR2A 2JA9A 1HA6A 2OQKA 2RF4A 1JWUD 2NBFA 4BBSH 1YIJA 1LTAD 4LF7Q 3CCMA 5I6YA 1NMGA 1SYGA 2VUMG 4GKKQ 1SFOB 4L5SA 4DR3Q 4DV6Q 4DV1L 1KRSA 2C5CA 2G9DA 5ELOA 2J4XA 1R9TH 2F1MA 2CQAA 3W5OA 1EQTA 1I3QB 5JEAJ 1IBML 5FK9C 3R3OA 4RCNA 1HR0W 1PTOD 1LT5D 3DLLA 5C4XG 2KA7A 5EAYA 1XJVA 4G7OC 2WIIB 1F2LA 3OWFA 4R9WA 2EYOA 1XMQQ 2NVTH 1PYSB 5CV5A 4I7AA 1QUQB 4IUUA 1P16A 4N8X1 1PYWD 1G2TA 2NVQB 4P2CB 2VW9A 1FNWA 1LTID 3RR5A 3TZUA 1GJXA 4FO2A 3I4OA 4YWKA 5FLMG 1AZPA 2EYFA 3MHBA 4AIMA 3UI2A 4B3RL 2SNSA 3NE5B 4B3MQ 4DV2Q 4OIJA 2UXDQ 3ULJA 4CKEA 4IOAA 1Y1VB 4DAVA 1IBLL 2BA1A 3QR8A 4TKOB 4H02A 2RDFA 4KHPQ 2JA5B 3QOLA 3H0GB 4LK1C 4X3UA 1N34L 5ELDA 3I4LA 2HUGA 4LFBL 3UDFA 5CMDA 4DR5L 4A3IB 2PI2E 4FF2A 4KY6A 3D8GA 4RAUC 2CKZB 4O2DA 4ZYSA 4G57A 2FFKB 3A0JA 3EJIA 5CYUA 2WACA 4HCEA 3GV3A 1I4RA 2JA8H 3VR4A 2UXCQ 1LLRD 1IKLA 1ZXTA 2B2WA 3UDGA 3OMCA 1ZKOA 2AUJD 4X66Q 3CXCA 1D5MC 1ZYRD 2L11A 4NXNL 2IWHA 4DV0Q 2VQFL 4H7BA 2EY2A 1IL8A 2N88A 1N32L 1D5ZC 1ESFA 4TRDA 4IUTA 5M5YB 3L7ZC 1WTPA 3DM1A 4OWWB 3D3RA 2CH4W 2RCFA 2E2DC 1GXDC 1PH3A 3RUZA 2IW3A 2GA4B 1L2FA 2O4XA 5CV4A 1LTGD 4LNQA 3WOFA 1O7LA 4IPGA 5IODA 1L1OA 2Z6KA 4LF8L 3W3AA 4FP5D 2B2TC 2B63B 5JJKA 4BY7B 4FNFA 3MA2B 5CV7A 4R4IA 4WRDA 1HTLD 1NTGA 5HGQA 1Q12A 2EYMA 1Z47A 3HOXH 1XWEA 4JI7L 1VCIA 1E2WA 5FO8B 3STBD 4DV7Q 4G7HC 3Q6SA 2XN9C 1ILPA 2MGSA 4GKJQ 3P75A 1A2TA 2AQ2B 2N55A 1DXMA 2XRQD 3Q24A 1N33L 4X64L 1SAPA 2G9HD 1I4XA 3NHHA 2ZXRA 3KDFA 2Z4HA 3S1RB 2EVBA 3L3OC 1Q1BA 2UUAQ 1KAWA 3NTIA 1VF7A 3CC2A 1E1OA 3PO2B 4K6DA 5IE8A 1M8AA 2PQAA 1X65A 4A3BG 1LTBD 1UAPA 3HOWB 1SR3A 2EY1A 1SSOA 3P7JA 3J7ZC 1EYCA 3CC4A 5M3FH 2R92G 4JV5L 1C8CA 2HHHL 1EQRA 1VF5C 2UUCL 1I4HA 3S2HB 2ZTDA 1IYVA 1PRTD 1TIID 1YJNA 2L1BA 4KV6A 2F0HA 1PH1A 4A3JH 3CCLA 5EPLA 2JEBI 5IGCA 5IP9G 4KD3A 2NVYB 3RLFA 2IL8A 4DFAA 3CCVA 4POGA 1EY4A 1QWYA 4YWLA 1NE3A 2PMZE 3A8KE 1XNQL 2ZXOA 1CQFA 5C4JB 1KHIA 3A7AB 4A3GB 1U4PA 2Z8LA 1Z9FA 2E2IB 4PMBA 1GVPA 3HOYH 2WB1E 1J9OA 4PV1C 5IGFA 2NZOA 3NBIA 3TDQA 4QJFA 3NTHA 3FRPB 1EQVA 4ZQ3A 3T1HL 3D4DA 3HKZE 1P8LA 3RN5A 5BR8Q 3PO3G 3PGZA 2Y0SB 2JA6G 2VQEQ 4MHEA 5FOBB 3VR3A 4DR2L 1KD1C 4RH6A 3HKZG 3I55A 3EFXD 4C3IB 1I50B 4DUZL 4A93G 2DUDA 1BBXC 1XMOL 2ENBA 2NB0A 3SXHA 2TSSA 2JXMB 4C3HB 5FLXc 1B1ZA 1CUKA 2HDMA 2RDHA 4IO9A 3P1HA 1S4ZA 1HZBA 1CM9A 1STGA 3DWQA 2K14A 2MNAA 1W2BA 1EY5A 3CCQA 3K5OA 4QIWE 3PIP3 3J81j 1NR2A 1FVIA 4JBJA 2A73B 2XWJB 3N52A 2O5JC 1GOZA 1HPCA 3VA7A 1VQ4A 2R7ZG 1KAAA 3QG1A 3M7GA 4KK7A 1F2MA 4CHTB 1GKHA 2H5XA 4ILWA 1EY7A 1I6HH 4LF5L 1WCMB 3T53B 1IBLQ 1AW7A 4E6IA 1KDBA 5JJZA 2ES2A 1TXYA 1VQFA 5C44B 4IFDH 3GTPH 3J80i 1E0BA 2N49A 3MVVA 1SNPA 4QF4A 4LFBQ 2EDGA 2B2YA 1MGSA 3CPFA 3QWNA 4FXGC 4Q0FA 4EVOA 4BBSB 4DPGA 4PNYA 2F0NA 1BCPC 5CBAE 3U4VA 2K52A 1RIPA 1PDQA 1LV9A 3JAMi 3GTQH 1R9TB 5A2QE 3H15A 3CPWA 1JCKB 2NVXH 5GAEC 1Y8OB 3CW2C 3H94A 1T5XD 1STYA 4C1NI 4NB3A 4JOIA 2LXKA 4NW2A 3CCEA 1I94L 1Y1WH 1UWVA 1PFSA 2NVTB 3NWTA 2A69C 4NXNQ 1IXRA 3KBGA 2K50A 3ONAB 1XPUA 4UP7A 1ICWA 3NK9A 2A6ED 4RHRA 1EY9A 1N32Q 2B2UA 2R61A 1FD7D 3PMFA 1HXYD 2L5TA 2A6HC 2PI2A 4V0BA 5M9OA 1EFWA 1JOKA 5COYA 5HURA 3U50C 3H3VH 3L9AX 1YNXA 1SMYD 1ET9A 3DEOA 5IP7G 2K03A 2F0JA 3KLSA 2K5WA 3I4MG 4R4QA 2EXDA 4CKCA 2ZXPA 4YY3Q 1V1OA 1GHJA 5J39A 4JVZA 1Y69U 2LXJA 4IUVA 4LF8Q 3M3YH 2QCPX 1BBWA 1EZ8A 2Q2TA 1LT4D 4KHVA 4KN7C 1BQQT 1S72A 1K28A 2JE6I 1O7IA 1L0XB 2ICIA 4LUZA 4RGNA 1PH4A 1MHWC 4DV5Q 4QUCA 2WINB 4IPDA 2JA8B 4NDXA 1STBA 4Y52H 1KIXA 1TS2A 5I9OA 1SE2A 2L12A 3CRLC 4IFDI 4A3FH 4U673 4DXFA 2K5DA 4CDDC 4C3JG 1O80A 4A3CG 1DOLA 2N78A 2OCEA 4XTCS 4XYOA 4K5WA 1C0AA 5KNCA 4MZ9A 1C4QA 1SMXA 1PYBA 4RHSA 1HR0L 4OO1G 1EEFD 4GZYC 3K80C 4R1JA 2K04A 1MSHA 2K01A 2HHHQ 1YVCA 2Z0SA 1PZJD 3ER0A 2JA7G 1HNZL 4UPAA 4JI0L 4WFN3 2HCCA 1WJJA 2IHEA 2OWOA 2IJ0A 1HA5A 2WKCA 1U9RA 2PZWA 3IL8A 5EPJA 4AQYL 1G291 4XQNA 1RODA 1S3OA 2CFMA 3HOXB 5J3BA 3C1EA 5JVH3 3S15H 2X69A 4S3SA 3F2DA 1VQGA 3SK8A 5K36G 3VR6A 3I91A 4JW0A 3MXNB 3U58A 1V1QA 5EPKA 3OWEB 4PZ7A 4NMZA 4A3DG 4RFBA 1XX8A 1YI2A 2AQ1B 5FLXE 3H3VC 1TT2A 3X3MA 1D8LA 5C0XH 1O7YA 2QDBA 1EY6A 1FGBD 3K5LA 1TS4A 1XPRA 3FEWX 2B8GA 1TWAH 1WI5A 5ELFA 3T1HQ 4XT3B 2F4VL 4P71A 2X6LA 4KKTA 1MBYA 2K5QA 5L37A 1E22A 2PNHA 1X3PA 1ESRA 1LTLA 5JEAG 4DUZQ 1SNCA 1H9SB 1E2VA 5M3FB 3GP7A 2O2LD 1ICFB 4HJ8A 2DY8A 1SNOA 2B2WC 1SNDA 3BVZA 1XMOQ 3BYYB 3WDNA 4FF3A 1YEZA 3MZ5A 1SE3A 2RSOA 5D3IB 4A3MH 1BKBA 1BF4A 4A3JB 2L15A 5C3EG 1BCPB 1I4PA 3HOUG 2AWOA 4FDBA 5LMUQ 1JB7A 1S5CD 3E3XA 2EIFA 1AN8A 1B53A 5E1FA 4B3SL 1QVFA 4A3LG 1SYDA 2Q2UA 3NQIA 4GN3B 3U9OA 1CZWA 4JI6L 2CH4A 5T1IA 4DUYL 2PNRC 1YNJC 3OW2A 1PH5A 2RA4A 4LFAQ 2E75C 4LF5Q 3IKJA 3HOYB 1L1OC 2Z6KC 2ASBA 1NJIC 3LX0A 4PZ6A 1J6QA 1VQAA 4HJ7A 2K33A 1PH2A 2UU9L 5J1ZA 2F3WA 4BXXH 2EJGC 4BBRH 2AQ3B 1XNRQ 4XXEA 3S1QH 3T13A 3VYRA 1Q82C 2HQEA 1DONA 1E1TA 2XTIA 4IJHA 4LMQD 1C9OA 2XVSA 5DM63 3VR5A 1UEAB 4CKBA 4A3KH 5IYCG 1IW7C 4KMUC 3NP8A 3CHBD 4K2LA 1JORA 1XXGA 2F3IA 2IT1A 1X55A 2VUMH 2IY5B 2ICEC 4KTAA 2YV5A 5AFWA 1Q46A 1OXTA 3QO2A 2ALYB 5G3LF 4XDXA 3OW7A 2CCZA 2KBNA 1W3SA 3MXGA 2CW0C 4KI0A 5A2QL 1PFNA 5C4XH 1KABA 4FF4A 1KDCA 2ZT9C 1TVXA 1GUGA 2PPBC 2NN6G 1CFMA 3BU2A 3JC66 1I6HB 3QOJA 1STNA 3J80c 1A62A 3QB3A 5FLMH 4AYBB 4RGTA 2VB2X 2IX1A 1FL0A 1TKWB 2MO1A 5IT9c 5E4XA 1M4VA 4JG2A 2ZJQA 3GTPB 4DAMA 5EQ0A 1VQLA 4XYQA 1EZ6A 1G91A 3EBEA 1TWCH 3PIPA 2VB3X 2Y0SE 2HD3A 1A15A 3GTQB 1HFGA 2QEXA 1NUCA 2A1AA 2NVXB 2RHSB 3RZDH 2EJMA 1LTRD 1D6EC 4TSSA 1Y1WB 4G7ZC 5EKLA 3X3NA 5IWAL 4NXMQ 4KY5A 1N36Q 2GVBA 3BZCA 1F2YA 2MP1A 1YBYA 4R4OA 2IX0A 4ZAIA 1VQBA 4JI2Q 4ZCKA 5CBEE 3NQTA 1Z6HA 1KDAA 4LF9L 1HZCA 3A7LA 2HIVA 4ME5A 2I5HA 4JC0A 2E2HH 3IFDA 1EIYB 4X65L 3OTOQ 5I4DA 4ZRZA 1STEA 2Z9HA 2F0PA 2YTYA 4KLKA 4X62L 4JI0Q 2LY7A 5JVG3 1XTDA 2QKIC 1VQ5A 3M3YB 1F9PA 1FJGQ 5IY0A 4NP5A 5FO9B 3KF6A 2A19A 1FNVA 1PXUA 1W6KA 4DR1L 2YYZA 2H4OA 2RHQB 4TQUS 1VQDA 1VQIA 2UUBL 4KJOA 1QUQA 3ND9A 3FKIG 1L0YB 5D65A 1BNZA 4FYDA 4H44C 2BDNA 3HOZG 4WORA 1SEBD 3T1YL 3BYTB 3K59A 1OO9B 1ENAA 5BN4A 3AQQA 5I2YA 4OONA 4POFA 4JI8Q 4A3FB 2B2YC 4GNXA 5EKIA 5I2XA 3OYYA 5CV8A 1JWSD 2K1BA 3F2UA 2E2JH 2D9UA 1PFBA 2EXZA 1GUOA 5FLXL 2EOTA 1KQSA 1B9MA 1YNNC
chains in the Genus database with same CATH topology
3G4SA 1L1OB 3GTJH 5FLXc 1WYDA 4JI2L 1CUKA 4IO9A 5M5YH 1K8AC 4R4CA 3TS0A 1VQHA 1HZBA 2MNAA 1W2BA 4A3BH 2K14A 1EWIA 3CCQA 3PIOA 4JI3Q 4B3TQ 1OXXK 1K83H 3ULPA 2QA4A 4QIWE 5M5XH 4B3ML 3J81j 3TS2A 1FVIA 4JBJA 5IYBH 3OTOL 1PHJA 2R92H 2WP8J 1PVOA 2ZM6Q 4DV4Q 2B3GA 1ASYA 1G51A 1TWFH 2R7ZG 1VQ4A 4JBKA 4KHPL 4OO1I 1GKHA 2H5XA 1FJGL 1E24A 3CD6A 3GTOH 3CCJA 3F2BA 4LF5L 1I6HH 4A3GG 3JAMc 1TWHH 1Y14B 3KDFB 2FXQA 3SGIA 3HKSA 4DUYQ 4LF4Q 2E5LQ 1OXVA 5IYDG 1IBLQ 2B63H 1VQKA 5IP9H 4BY7H 3CMAA 2KCTA 2Q2IA 2MO0A 1TXYA 2KENA 1VQFA 2ES2A 1TWGH 2Q2HA 4OX9L 5GADC 4APVA 4DV3L 3GTPH 3J80i 4UY8C 2N49A 3FP9A 2JEAI 4LFBQ 2PQAB 3M4OH 3CPFA 4YCVA 4LW1A 3GO5A 1MJEA 4DPGA 1RL2A 2Y0SG 3A74A 1WFQA 3AYHB 4A3FG 3L2PA 1MIUA 1CKOA 1VQ8A 3U4VA 4OWXB 1X56A 2K52A 1RIPA 3W1GA 2OQ0A 3NENA 2CWPA 3PCOB 4TVAB 3FKIH 4P73A 3JAMi 3GTQH 1GO3E 2NN6I 1YITA 3HOZH 3RLNA 3PUYA 4P75A 4JI8L 3H15A 4JCVE 4X66L 3HOVG 3CPWA 3CF5A 4BA2I 2VQEL 2NVXH 4C2MH 4NPSA 5GAEC 1DGSA 3CW2C 2JJQA 2VZAA 4PG3A 3I4NG 3BJUA 3S1RH 1UE7A 4JOIA 4NB3A 1A8VA 1K3RA 2LXKA 3ZJYC 3CCEA 1I94L 3PO3H 4DR4L 4HJ5A 5ELNA 2JA6H 4PMWA 1UE6A 1Y1WH 2AWNA 1UWVA 1PFSA 2HIXA 1HR0Q 2HT1A 4K0KQ 1HNWL 1SE8A 4NXNQ 1IXRA 4DR7L 3G6EA 3PO2H 3RNUA 2K50A 5LMNQ 1B7YB 3KLWA 4UP7A 4AH6A 4IOCA 2I0QA 1XPUA 1N32Q 1KRTA 5FJ8G 3HOWH 3KFUA 4JBMA 1VQJA 4PZ8A 3KF6B 4A93H 3NELA 2OTLA 1SLJA 1GD7A 1PH7A 1VQNA 2MQHA 2PI2A 1EFWA 2R6GA 1HNZQ 3U50C 3KJPA 1LUZA 3H3VH 4MNOA 1YNXA 3RZOH 4JI3L 4OWTB 4B3TL 5IP7G 3PUVA 3I2ZA 4JBWA 1FGUA 3S2HH 4AQYQ 2EQSA 3I4MG 5M3MG 1E3PA 1VQMA 4Y7NH 2ZM6L 2UXBL 4R4QA 1OTCA 1WCMG 2EXDA 2F52A 3CAMA 5GQOA 4JI1Q 3RLOA 4YY3Q 3TREA 4IPCA 3S14H 1H95A 3W1BA 2KCMA 2LXJA 2NVYH 2K75A 3HFZB 4LF8Q 3M3YH 3E9HA 1X3FA 1BBWA 5C44G 2D0PA 4HIOA 4GNXB 3ICEA 1YZ6A 2Q2TA 2D0OA 5C0XG 2E5LL 1HH2P 5C0XJ 1EIFA 1S72A 2R7ZH 4YHHL 1Q86C 4BBSG 4XIGS 1J5EQ 3FHWA 4YWMA 4GKJL 2JE6I 4LFCL 3UDXA 5C4JH 1CSQA 1O7IA 3IRBA 1X3EA 4A3EG 2WB1G 4A3GH 2N3SA 1X6OA 4LUZA 1N8RC 1T9HA 1VQPA 2KHIA 3E9IA 5M5WH 4DV5Q 1PH4A 1M90C 2DGYA 4GOPB 2E2IH 5IYDH 4IPDA 2ZJRA 3TRZA 3PV0A 1AE3A 1SROA 3CC7A 2F4VQ 4DKAC 4Y52H 3J81i 1KIXA 1HNXQ 4DV1Q 3CP0A 1JMCA 5JJLA 3M85A 4IFDI 3D0FA 4A3FH 4ALPA 3NEMA 4UP9A 1N9WA 1IBMQ 4YCWA 4A3CG 2N78A 2R93G 2OCEA 3K7UC 4GLAC 4XTCS 3EN2A 4C3IH 1I50H 1C0AA 4A3MG 1WOCA 5IWAQ 3HOVH 5GAHC 4JOIC 4MZ9A 1S40A 1SMXA 1PYBA 3PUWA 1HR0L 4K0KL 4OO1G 2ZJPA 1IBKQ 1CSPA 3M9BA 5LMNL 4O0AA 1NBWA 2CQOA 2KHJA 3K80C 1B70B 4R1JA 3I4NH 4C3HH 5H1SE 1A0IA 1EUJA 1HZAA 4RG1A 3PSIA 4J15A 4EX5A 4UP8A 3WWVA 1X3GA 2HHHQ 3B6YA 1YVCA 2Z0SA 4B3SQ 3ER0A 2JA7G 3J7A5 1HNZL 4HIMA 5FJ8H 4UPAA 4JI0L 4B3RQ 1WJJA 2IHEA 1K9MC 4QL5A 2OWOA 4JI5Q 4DR6Q 1D7QA 4JI4L 1PH9A 4LF6L 4AQYL 4JI6Q 4OXPA 1G291 1KL9A 1X9NA 4IPHA 3GTKH 1LYLA 1UEBA 1JT8A 1C7YA 1S3OA 2AHOB 2CFMA 5IP7H 4YY3L 1YJWA 5J3BA 4BXXG 3S15H 2VL6A 2C35B 4BBRG 4JYAL 1N34Q 1E7ZA 1VQGA 1L0WA 3F2DA 5M3MH 1QVFA 4LWCA 3I4MH 3D31A 3PF4A 5K36G 4DR1Q 2WAQE 1HJPA 1WCMH 3MXNB 2V1CC 4DR5Q 1V1QA 2ZTCA 3U58A 4PZ7A 1VQOA 2UU9Q 1OXSC 3TQYA 4A3DG 3KJOA 4DK3C 1YI2A 4GN4B 1J5EL 2AKWB 2WFWA 1UE5A 2IHFA 1Q8KA 2JA8G 2WAQG 5C44H 5BR8L 1VQ6A 4A3KG 1PV4A 2HQLA 5JJIA 1D8LA 3T1YQ 2JA9A 4DV5L 2ID0A 2OQKA 1K73C 2RF4A 4BBSH 1XPRA 1YIJA 1BBUA 4A76A 1TWAH 1WI5A 3T1HQ 4LF7Q 3CCMA 4GLVB 1NMGA 2VUMG 4GKKQ 2F4VL 4L5SA 4P71A 5AJ3L 4DR3Q 1AE2A 4A3EH 1YHQA 4A75A 2LSSA 4DV6Q 4DV1L 1KRSA 1E22A 2PNHA 3K7AH 2VY3A 5ELOA 1R9TH 2BH8A 1LTLA 1MJCA 3W5OA 3CMEA 5JEAG 2VQFQ 1EYGA 5JEAJ 3I7FA 3CCUA 1IBML 4EQ5A 4DUZQ 1HR0W 1JE5A 4MTNA 3TEHB 3DLLA 2K5NA 5C4XG 5EAYA 1SRUA 1XJVA 5LMNW 4IJLA 3GD7A 4HJ8A 1NY4A 4DAYB 1XMOQ 3EIVA 1XMQQ 2NVTH 4KHZA 3RN2A 1PYSB 4C3JH 3S2DH 4A3CH 1YEZA 2R93H 1QUQB 3VDYA 1P16A 4A3MH 1BKBA 2L15A 5C3EG 4BY1G 1LM0A 3K81C 3HOUG 2VW9A 2AWOA 3AFQA 3RR5A 4FDBA 4HIDA 5LMUQ 2YTVA 1JB7A 1V9PA 2EIFA 3I4OA 4YWKA 5FLMG 4GLXA 4B3SL 3GDEA 1IL2A 4A3LG 3S1MH 4AIMA 1UE1A 3L0OA 4DV4L 1PH6A 1VQ7A 4B3RL 4B3MQ 4JI5L 4DV2Q 2Q2UA 3HOXG 1EOVA 1VQCA 4GN3B 2UXDQ 3ULJA 5DLQE 3S17H 1M1KC 4JI6L 4LF4L 2JA7H 3UE0A 4DUYL 4IOAA 1Q81C 2BA1A 3KOJA 1IBLL 2QGQA 2N8NA 4H02A 2K4KA 4KHPQ 3OW2A 1PH5A 4LUOA 3DM3A 2MFIA 4LFAQ 1MKHA 2YTXA 4JI7Q 4LF5Q 2GVAA 4P72A 1N34L 1L1OC 4LFBL 2Z6KC 2ASBA 1NJIC 4PZ6A 3GTGH 3S1NH 1J6QA 1VQAA 3UDFA 1K0RA 4DR5L 4HJ7A 1PH2A 2UU9L 4BXXH 2PI2E 4OX9Q 3Q8DA 1I5FA 4BBRH 2VNUD 4WJ4A 2CKZB 4O2DA 1XNRQ 3S1QH 2VS1A 2YU9H 3G71A 4DK6C 1Q82C 1QVCA 3A0JA 4X64Q 1N33Q 2RCNA 1E1TA 2XTIA 5GAGC 1K8GA 4A3DH 4IJHA 1EQQA 1C9OA 1VS0A 2JA8H 4HJAA 3BZKA 1B8AA 1YHAA 4DR3L 4A3KH 2A8VA 3UDGA 2UXCQ 1OXUA 3UE1A 5IYCG 1YHBA 4X66Q 3CXCA 5M3FG 4NXNL 2F3IA 4DV0Q 4HIKA 2IT1A 3M4PA 1X55A 2VQFL 2ATWA 3AEVA 2K5HA 1QZHA 2VUMH 2IY5B 1N32L 2I5MX 4ME3A 2YV5A 4HJ9A 1Q46A 3L7ZC 1OXTA 1HNWQ 2ZTEA 2ALYB 4JV5Q 4A3JG 3NBHB 4OWWB 4DR7Q 2CCZA 2KBNA 1W3SA 3K0XA 4LF9Q 2NZHA 4KI0A 2UUCQ 4WJ3M 3CCSA 5C4XH 4X65Q 1PH3A 3F2CA 3F1ZA 3F8TA 2E8GA 1CKNA 4X62Q 2D62A 1XPOA 1L2FA 5LMUL 2XGTA 3STBC 4JI1L 1Y1VG 2NN6G 4LNQA 1PH8A 3BU2A 3JC66 2R7DA 4IPGA 1L1OA 4A4IA 2Z6KA 5C3EH 4DV2L 3A5UA 1QZGA 2JA5G 4BY1H 4LF8L 3H3VI 3HOUH 2B29A 1A62A 3H0GG 3J80c 3G48A 2UXDL 2UXBQ 3AFPA 5JJKA 5FLMH 4A3LH 3HOYG 2JQOA 4R4IA 2OTJA 1XNQQ 4L5RC 2IX1A 1FL0A 1NTGA 2MO1A 1Q12A 5HGQA 5IT9c 2GN5A 2ZJQA 1Z47A 4JG2A 3HOXH 3K8AA 4A3IG 2UUBQ 4JI7L 1VCIA 4DAMA 4LFAL 1VQLA 4QQBX 3STBD 4DV7Q 3GTLH 3LGJA 2JK8A 5GROA 2K5VA 3EBEA 1TWCH 3E0EA 4YHHQ 3PIPA 2Y0SE 3MEFA 4DNIA 3CCRA 4LFCQ 3GTMH 4GKJQ 4RMFA 2AMCB 1BVSA 2QEXA 1XNRL 1HNXL 3I56A 2A1AA 1N33L 4X64L 4X6AH 1JJCB 5HY6A 4DR2Q 2RHSB 3KDFA 3RZDH 1KXLA 4L5QA 3ULLA 1Q1BA 2UUAQ 1KAWA 3CC2A 1AH9A 2UXCL 1E1OA 3S16H 1SFOH 5IWAL 1GM5A 4NXMQ 3KF8B 1N36Q 1IYJB 5IE8A 2CWAA 2PQAA 2GVBA 1X65A 4L5TA 3BZCA 1PA6A 4A3BG 4DV0L 1IBKL 1YBYA 1SR3A 4R4OA 3S24A 4GNXC 1I3QH 2IX0A 1VQBA 4BA1I 4R4TA 4YCUA 4QY7A 1U0LA 4JI2Q 5IYCH 3J7ZC 3CQZH 5IYBG 3CC4A 5M3FH 2R92G 4JV5L 2HHHL 1EQRA 1Q7YC 1IZ6A 4GN5A 4LF9L 1HZCA 3U4ZA 2UUCL 2HIVA 2I5HA 4JC0A 2E2HH 1EIYB 2ZTDA 4GOPC 3A5ZB 3UDIA 4X65L 1YJNA 3OTOQ 4AYBE 3PUXA 4A3JH 1PH1A 1SN8A 2NVQH 3CCLA 2YTYA 4KLKA 4X62L 2JEBI 2B63G 4JI0Q 1Q1EA 1VQEA 5IP9G 1XTDA 4P74A 4BY7G 3RLFA 4AYBG 1VQ5A 4JI4Q 4LF6Q 1FJGQ 5IY0A 3CCVA 4IFDG 1YJ9A 1VQ9A 4IFDJ 4POGA 4DR6L 3KF6A 2A19A 1G6PA 4YWLA 4DR1L 2YYZA 2PMZE 2RHQB 1NE3A 1A63A 1Y1VH 4TQUS 1XNQL 1VQDA 1VQIA 1KHIA 1NMFA 4JYAQ 4DV3Q 2JA5H 1ASZA 2UUBL 1QUQA 3J81c 3FKIG 1Z9FA 3H0GH 2I5LX 3KYHC 5E7NA 3HOZG 1GVPA 3HOYH 2WB1E 4DV7L 1V43A 3T1YL 2NZOA 2BA0A 4QJFA 3PUZA 4A3IH 3T1HL 4LF7L 3AQQA 3HKZE 1P8LA 3RN5A 4GKKL 5BR8Q 4OONA 3PO3G 1JJGA 3PGZA 4POFA 4JI8Q 4DV6L 1X54A 2JA6G 1U5KA 1Y1WG 3ERSX 2VQEQ 1KD1C 4DR2L 4GNXA 3HKZG 3PO2G 3I55A 4GS3A 3OYYA 4LUVA 3M4QA 5AJ3Q 1QVGA 5C0XI 1I94Q 4DUZL 2UUAL 3HOWG 1CKMA 4QGUA 4DR4Q 3PF5A 2BH2A 2E2JH 4A93G 1CKNB 1HZ9A 2DUDA 2R7FA 3M7NA 4NXML 1XMOL 1N36L 1KQSA 1XMQL 1KC8C 1JJ2A 4GOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S A;  1L1O B;  3GTJ H;  5FLX c;  1WYD A;  4JI2 L;  1CUK A;  4IO9 A;  5M5Y H;  1K8A C;  4R4C A;  3TS0 A;  1VQH A;  1HZB A;  2MNA A;  1W2B A;  4A3B H;  2K14 A;  1EWI A;  3CCQ A;  3PIO A;  4JI3 Q;  4B3T Q;  1OXX K;  1K83 H;  3ULP A;  2QA4 A;  4QIW E;  5M5X H;  4B3M L;  3J81 j;  3TS2 A;  1FVI A;  4JBJ A;  5IYB H;  3OTO L;  1PHJ A;  2R92 H;  2WP8 J;  1PVO A;  2ZM6 Q;  4DV4 Q;  2B3G A;  1ASY A;  1G51 A;  1TWF H;  2R7Z G;  1VQ4 A;  4JBK A;  4KHP L;  4OO1 I;  1GKH A;  2H5X A;  1FJG L;  1E24 A;  3CD6 A;  3GTO H;  3CCJ A;  3F2B A;  4LF5 L;  1I6H H;  4A3G G;  3JAM c;  1TWH H;  1Y14 B;  3KDF B;  2FXQ A;  3SGI A;  3HKS A;  4DUY Q;  4LF4 Q;  2E5L Q;  1OXV A;  5IYD G;  1IBL Q;  2B63 H;  1VQK A;  5IP9 H;  4BY7 H;  3CMA A;  2KCT A;  2Q2I A;  2MO0 A;  1TXY A;  2KEN A;  1VQF A;  2ES2 A;  1TWG H;  2Q2H A;  4OX9 L;  5GAD C;  4APV A;  4DV3 L;  3GTP H;  3J80 i;  4UY8 C;  2N49 A;  3FP9 A;  2JEA I;  4LFB Q;  2PQA B;  3M4O H;  3CPF A;  4YCV A;  4LW1 A;  3GO5 A;  1MJE A;  4DPG A;  1RL2 A;  2Y0S G;  3A74 A;  1WFQ A;  3AYH B;  4A3F G;  3L2P A;  1MIU A;  1CKO A;  1VQ8 A;  3U4V A;  4OWX B;  1X56 A;  2K52 A;  1RIP A;  3W1G A;  2OQ0 A;  3NEN A;  2CWP A;  3PCO B;  4TVA B;  3FKI H;  4P73 A;  3JAM i;  3GTQ H;  1GO3 E;  2NN6 I;  1YIT A;  3HOZ H;  3RLN A;  3PUY A;  4P75 A;  4JI8 L;  3H15 A;  4JCV E;  4X66 L;  3HOV G;  3CPW A;  3CF5 A;  4BA2 I;  2VQE L;  2NVX H;  4C2M H;  4NPS A;  5GAE C;  1DGS A;  3CW2 C;  2JJQ A;  2VZA A;  4PG3 A;  3I4N G;  3BJU A;  3S1R H;  1UE7 A;  4JOI A;  4NB3 A;  1A8V A;  1K3R A;  2LXK A;  3ZJY C;  3CCE A;  1I94 L;  3PO3 H;  4DR4 L;  4HJ5 A;  5ELN A;  2JA6 H;  4PMW A;  1UE6 A;  1Y1W H;  2AWN A;  1UWV A;  1PFS A;  2HIX A;  1HR0 Q;  2HT1 A;  4K0K Q;  1HNW L;  1SE8 A;  4NXN Q;  1IXR A;  4DR7 L;  3G6E A;  3PO2 H;  3RNU A;  2K50 A;  5LMN Q;  1B7Y B;  3KLW A;  4UP7 A;  4AH6 A;  4IOC A;  2I0Q A;  1XPU A;  1N32 Q;  1KRT A;  5FJ8 G;  3HOW H;  3KFU A;  4JBM A;  1VQJ A;  4PZ8 A;  3KF6 B;  4A93 H;  3NEL A;  2OTL A;  1SLJ A;  1GD7 A;  1PH7 A;  1VQN A;  2MQH A;  2PI2 A;  1EFW A;  2R6G A;  1HNZ Q;  3U50 C;  3KJP A;  1LUZ A;  3H3V H;  4MNO A;  1YNX A;  3RZO H;  4JI3 L;  4OWT B;  4B3T L;  5IP7 G;  3PUV A;  3I2Z A;  4JBW A;  1FGU A;  3S2H H;  4AQY Q;  2EQS A;  3I4M G;  5M3M G;  1E3P A;  1VQM A;  4Y7N H;  2ZM6 L;  2UXB L;  4R4Q A;  1OTC A;  1WCM G;  2EXD A;  2F52 A;  3CAM A;  5GQO A;  4JI1 Q;  3RLO A;  4YY3 Q;  3TRE A;  4IPC A;  3S14 H;  1H95 A;  3W1B A;  2KCM A;  2LXJ A;  2NVY H;  2K75 A;  3HFZ B;  4LF8 Q;  3M3Y H;  3E9H A;  1X3F A;  1BBW A;  5C44 G;  2D0P A;  4HIO A;  4GNX B;  3ICE A;  1YZ6 A;  2Q2T A;  2D0O A;  5C0X G;  2E5L L;  1HH2 P;  5C0X J;  1EIF A;  1S72 A;  2R7Z H;  4YHH L;  1Q86 C;  4BBS G;  4XIG S;  1J5E Q;  3FHW A;  4YWM A;  4GKJ L;  2JE6 I;  4LFC L;  3UDX A;  5C4J H;  1CSQ A;  1O7I A;  3IRB A;  1X3E A;  4A3E G;  2WB1 G;  4A3G H;  2N3S A;  1X6O A;  4LUZ A;  1N8R C;  1T9H A;  1VQP A;  2KHI A;  3E9I A;  5M5W H;  4DV5 Q;  1PH4 A;  1M90 C;  2DGY A;  4GOP B;  2E2I H;  5IYD H;  4IPD A;  2ZJR A;  3TRZ A;  3PV0 A;  1AE3 A;  1SRO A;  3CC7 A;  2F4V Q;  4DKA C;  4Y52 H;  3J81 i;  1KIX A;  1HNX Q;  4DV1 Q;  3CP0 A;  1JMC A;  5JJL A;  3M85 A;  4IFD I;  3D0F A;  4A3F H;  4ALP A;  3NEM A;  4UP9 A;  1N9W A;  1IBM Q;  4YCW A;  4A3C G;  2N78 A;  2R93 G;  2OCE A;  3K7U C;  4GLA C;  4XTC S;  3EN2 A;  4C3I H;  1I50 H;  1C0A A;  4A3M G;  1WOC A;  5IWA Q;  3HOV H;  5GAH C;  4JOI C;  4MZ9 A;  1S40 A;  1SMX A;  1PYB A;  3PUW A;  1HR0 L;  4K0K L;  4OO1 G;  2ZJP A;  1IBK Q;  1CSP A;  3M9B A;  5LMN L;  4O0A A;  1NBW A;  2CQO A;  2KHJ A;  3K80 C;  1B70 B;  4R1J A;  3I4N H;  4C3H H;  5H1S E;  1A0I A;  1EUJ A;  1HZA A;  4RG1 A;  3PSI A;  4J15 A;  4EX5 A;  4UP8 A;  3WWV A;  1X3G A;  2HHH Q;  3B6Y A;  1YVC A;  2Z0S A;  4B3S Q;  3ER0 A;  2JA7 G;  3J7A 5;  1HNZ L;  4HIM A;  5FJ8 H;  4UPA A;  4JI0 L;  4B3R Q;  1WJJ A;  2IHE A;  1K9M C;  4QL5 A;  2OWO A;  4JI5 Q;  4DR6 Q;  1D7Q A;  4JI4 L;  1PH9 A;  4LF6 L;  4AQY L;  4JI6 Q;  4OXP A;  1G29 1;  1KL9 A;  1X9N A;  4IPH A;  3GTK H;  1LYL A;  1UEB A;  1JT8 A;  1C7Y A;  1S3O A;  2AHO B;  2CFM A;  5IP7 H;  4YY3 L;  1YJW A;  5J3B A;  4BXX G;  3S15 H;  2VL6 A;  2C35 B;  4BBR G;  4JYA L;  1N34 Q;  1E7Z A;  1VQG A;  1L0W A;  3F2D A;  5M3M H;  1QVF A;  4LWC A;  3I4M H;  3D31 A;  3PF4 A;  5K36 G;  4DR1 Q;  2WAQ E;  1HJP A;  1WCM H;  3MXN B;  2V1C C;  4DR5 Q;  1V1Q A;  2ZTC A;  3U58 A;  4PZ7 A;  1VQO A;  2UU9 Q;  1OXS C;  3TQY A;  4A3D G;  3KJO A;  4DK3 C;  1YI2 A;  4GN4 B;  1J5E L;  2AKW B;  2WFW A;  1UE5 A;  2IHF A;  1Q8K A;  2JA8 G;  2WAQ G;  5C44 H;  5BR8 L;  1VQ6 A;  4A3K G;  1PV4 A;  2HQL A;  5JJI A;  1D8L A;  3T1Y Q;  2JA9 A;  4DV5 L;  2ID0 A;  2OQK A;  1K73 C;  2RF4 A;  4BBS H;  1XPR A;  1YIJ A;  1BBU A;  4A76 A;  1TWA H;  1WI5 A;  3T1H Q;  4LF7 Q;  3CCM A;  4GLV B;  1NMG A;  2VUM G;  4GKK Q;  2F4V L;  4L5S A;  4P71 A;  5AJ3 L;  4DR3 Q;  1AE2 A;  4A3E H;  1YHQ A;  4A75 A;  2LSS A;  4DV6 Q;  4DV1 L;  1KRS A;  1E22 A;  2PNH A;  3K7A H;  2VY3 A;  5ELO A;  1R9T H;  2BH8 A;  1LTL A;  1MJC A;  3W5O A;  3CME A;  5JEA G;  2VQF Q;  1EYG A;  5JEA J;  3I7F A;  3CCU A;  1IBM L;  4EQ5 A;  4DUZ Q;  1HR0 W;  1JE5 A;  4MTN A;  3TEH B;  3DLL A;  2K5N A;  5C4X G;  5EAY A;  1SRU A;  1XJV A;  5LMN W;  4IJL A;  3GD7 A;  4HJ8 A;  1NY4 A;  4DAY B;  1XMO Q;  3EIV A;  1XMQ Q;  2NVT H;  4KHZ A;  3RN2 A;  1PYS B;  4C3J H;  3S2D H;  4A3C H;  1YEZ A;  2R93 H;  1QUQ B;  3VDY A;  1P16 A;  4A3M H;  1BKB A;  2L15 A;  5C3E G;  4BY1 G;  1LM0 A;  3K81 C;  3HOU G;  2VW9 A;  2AWO A;  3AFQ A;  3RR5 A;  4FDB A;  4HID A;  5LMU Q;  2YTV A;  1JB7 A;  1V9P A;  2EIF A;  3I4O A;  4YWK A;  5FLM G;  4GLX A;  4B3S L;  3GDE A;  1IL2 A;  4A3L G;  3S1M H;  4AIM A;  1UE1 A;  3L0O A;  4DV4 L;  1PH6 A;  1VQ7 A;  4B3R L;  4B3M Q;  4JI5 L;  4DV2 Q;  2Q2U A;  3HOX G;  1EOV A;  1VQC A;  4GN3 B;  2UXD Q;  3ULJ A;  5DLQ E;  3S17 H;  1M1K C;  4JI6 L;  4LF4 L;  2JA7 H;  3UE0 A;  4DUY L;  4IOA A;  1Q81 C;  2BA1 A;  3KOJ A;  1IBL L;  2QGQ A;  2N8N A;  4H02 A;  2K4K A;  4KHP Q;  3OW2 A;  1PH5 A;  4LUO A;  3DM3 A;  2MFI A;  4LFA Q;  1MKH A;  2YTX A;  4JI7 Q;  4LF5 Q;  2GVA A;  4P72 A;  1N34 L;  1L1O C;  4LFB L;  2Z6K C;  2ASB A;  1NJI C;  4PZ6 A;  3GTG H;  3S1N H;  1J6Q A;  1VQA A;  3UDF A;  1K0R A;  4DR5 L;  4HJ7 A;  1PH2 A;  2UU9 L;  4BXX H;  2PI2 E;  4OX9 Q;  3Q8D A;  1I5F A;  4BBR H;  2VNU D;  4WJ4 A;  2CKZ B;  4O2D A;  1XNR Q;  3S1Q H;  2VS1 A;  2YU9 H;  3G71 A;  4DK6 C;  1Q82 C;  1QVC A;  3A0J A;  4X64 Q;  1N33 Q;  2RCN A;  1E1T A;  2XTI A;  5GAG C;  1K8G A;  4A3D H;  4IJH A;  1EQQ A;  1C9O A;  1VS0 A;  2JA8 H;  4HJA A;  3BZK A;  1B8A A;  1YHA A;  4DR3 L;  4A3K H;  2A8V A;  3UDG A;  2UXC Q;  1OXU A;  3UE1 A;  5IYC G;  1YHB A;  4X66 Q;  3CXC A;  5M3F G;  4NXN L;  2F3I A;  4DV0 Q;  4HIK A;  2IT1 A;  3M4P A;  1X55 A;  2VQF L;  2ATW A;  3AEV A;  2K5H A;  1QZH A;  2VUM H;  2IY5 B;  1N32 L;  2I5M X;  4ME3 A;  2YV5 A;  4HJ9 A;  1Q46 A;  3L7Z C;  1OXT A;  1HNW Q;  2ZTE A;  2ALY B;  4JV5 Q;  4A3J G;  3NBH B;  4OWW B;  4DR7 Q;  2CCZ A;  2KBN A;  1W3S A;  3K0X A;  4LF9 Q;  2NZH A;  4KI0 A;  2UUC Q;  4WJ3 M;  3CCS A;  5C4X H;  4X65 Q;  1PH3 A;  3F2C A;  3F1Z A;  3F8T A;  2E8G A;  1CKN A;  4X62 Q;  2D62 A;  1XPO A;  1L2F A;  5LMU L;  2XGT A;  3STB C;  4JI1 L;  1Y1V G;  2NN6 G;  4LNQ A;  1PH8 A;  3BU2 A;  3JC6 6;  2R7D A;  4IPG A;  1L1O A;  4A4I A;  2Z6K A;  5C3E H;  4DV2 L;  3A5U A;  1QZG A;  2JA5 G;  4BY1 H;  4LF8 L;  3H3V I;  3HOU H;  2B29 A;  1A62 A;  3H0G G;  3J80 c;  3G48 A;  2UXD L;  2UXB Q;  3AFP A;  5JJK A;  5FLM H;  4A3L H;  3HOY G;  2JQO A;  4R4I A;  2OTJ A;  1XNQ Q;  4L5R C;  2IX1 A;  1FL0 A;  1NTG A;  2MO1 A;  1Q12 A;  5HGQ A;  5IT9 c;  2GN5 A;  2ZJQ A;  1Z47 A;  4JG2 A;  3HOX H;  3K8A A;  4A3I G;  2UUB Q;  4JI7 L;  1VCI A;  4DAM A;  4LFA L;  1VQL A;  4QQB X;  3STB D;  4DV7 Q;  3GTL H;  3LGJ A;  2JK8 A;  5GRO A;  2K5V A;  3EBE A;  1TWC H;  3E0E A;  4YHH Q;  3PIP A;  2Y0S E;  3MEF A;  4DNI A;  3CCR A;  4LFC Q;  3GTM H;  4GKJ Q;  4RMF A;  2AMC B;  1BVS A;  2QEX A;  1XNR L;  1HNX L;  3I56 A;  2A1A A;  1N33 L;  4X64 L;  4X6A H;  1JJC B;  5HY6 A;  4DR2 Q;  2RHS B;  3KDF A;  3RZD H;  1KXL A;  4L5Q A;  3ULL A;  1Q1B A;  2UUA Q;  1KAW A;  3CC2 A;  1AH9 A;  2UXC L;  1E1O A;  3S16 H;  1SFO H;  5IWA L;  1GM5 A;  4NXM Q;  3KF8 B;  1N36 Q;  1IYJ B;  5IE8 A;  2CWA A;  2PQA A;  2GVB A;  1X65 A;  4L5T A;  3BZC A;  1PA6 A;  4A3B G;  4DV0 L;  1IBK L;  1YBY A;  1SR3 A;  4R4O A;  3S24 A;  4GNX C;  1I3Q H;  2IX0 A;  1VQB A;  4BA1 I;  4R4T A;  4YCU A;  4QY7 A;  1U0L A;  4JI2 Q;  5IYC H;  3J7Z C;  3CQZ H;  5IYB G;  3CC4 A;  5M3F H;  2R92 G;  4JV5 L;  2HHH L;  1EQR A;  1Q7Y C;  1IZ6 A;  4GN5 A;  4LF9 L;  1HZC A;  3U4Z A;  2UUC L;  2HIV A;  2I5H A;  4JC0 A;  2E2H H;  1EIY B;  2ZTD A;  4GOP C;  3A5Z B;  3UDI A;  4X65 L;  1YJN A;  3OTO Q;  4AYB E;  3PUX A;  4A3J H;  1PH1 A;  1SN8 A;  2NVQ H;  3CCL A;  2YTY A;  4KLK A;  4X62 L;  2JEB I;  2B63 G;  4JI0 Q;  1Q1E A;  1VQE A;  5IP9 G;  1XTD A;  4P74 A;  4BY7 G;  3RLF A;  4AYB G;  1VQ5 A;  4JI4 Q;  4LF6 Q;  1FJG Q;  5IY0 A;  3CCV A;  4IFD G;  1YJ9 A;  1VQ9 A;  4IFD J;  4POG A;  4DR6 L;  3KF6 A;  2A19 A;  1G6P A;  4YWL A;  4DR1 L;  2YYZ A;  2PMZ E;  2RHQ B;  1NE3 A;  1A63 A;  1Y1V H;  4TQU S;  1XNQ L;  1VQD A;  1VQI A;  1KHI A;  1NMF A;  4JYA Q;  4DV3 Q;  2JA5 H;  1ASZ A;  2UUB L;  1QUQ A;  3J81 c;  3FKI G;  1Z9F A;  3H0G H;  2I5L X;  3KYH C;  5E7N A;  3HOZ G;  1GVP A;  3HOY H;  2WB1 E;  4DV7 L;  1V43 A;  3T1Y L;  2NZO A;  2BA0 A;  4QJF A;  3PUZ A;  4A3I H;  3T1H L;  4LF7 L;  3AQQ A;  3HKZ E;  1P8L A;  3RN5 A;  4GKK L;  5BR8 Q;  4OON A;  3PO3 G;  1JJG A;  3PGZ A;  4POF A;  4JI8 Q;  4DV6 L;  1X54 A;  2JA6 G;  1U5K A;  1Y1W G;  3ERS X;  2VQE Q;  1KD1 C;  4DR2 L;  4GNX A;  3HKZ G;  3PO2 G;  3I55 A;  4GS3 A;  3OYY A;  4LUV A;  3M4Q A;  5AJ3 Q;  1QVG A;  5C0X I;  1I94 Q;  4DUZ L;  2UUA L;  3HOW G;  1CKM A;  4QGU A;  4DR4 Q;  3PF5 A;  2BH2 A;  2E2J H;  4A93 G;  1CKN B;  1HZ9 A;  2DUD A;  2R7F A;  3M7N A;  4NXM L;  1XMO L;  1N36 L;  1KQS A;  1XMQ L;  1KC8 C;  1JJ2 A;  4GOP A; 
#chains in the Genus database with same CATH topology
 1GUN A;  1L1O B;  3GTJ H;  4IZ8 A;  2F0F A;  4A3B H;  4H13 C;  5FO7 B;  1EWI A;  3KLS X;  1OXX K;  1K83 H;  1H9R A;  2Z6B A;  5CR3 A;  2B2U C;  2R92 H;  5K5P A;  1PVO A;  1IKM A;  1ASY A;  2OT2 A;  3S15 B;  1FNU A;  1I6V C;  3CCJ A;  3F2B A;  2FMM A;  1TWH H;  3H6M A;  3KDF B;  1TS3 A;  4DUY Q;  2F03 A;  3A54 A;  5IYD G;  1ONL A;  2L4N A;  1NCV A;  4ABN A;  5IP9 H;  3J7Y W;  3BZD B;  1MD2 D;  2Q2I A;  2MO0 A;  1TWG H;  5IIF A;  5GAD C;  4DV3 L;  1D5X C;  2JEA I;  3FP9 A;  4N9P A;  2BOS A;  1RF2 D;  2PQA B;  4JPB W;  2HCI A;  3ND8 A;  3GO5 A;  1TR5 A;  1TWA B;  3A74 A;  1WFQ A;  1QCB D;  3AYH B;  4DK0 A;  1WD0 A;  3SHL A;  1BXT A;  3NEN A;  4TVA B;  4DU9 A;  1II3 A;  3MWY W;  3HOV G;  4DN4 M;  3CF5 A;  4BA2 I;  2F0K A;  3H09 A;  4NPS A;  2R3Z A;  3R8B A;  3R2I A;  5I9P A;  2QF7 A;  3I4N G;  3BJU A;  1UE7 A;  3PO3 H;  1A8V A;  2P5Z X;  2PCF B;  3ZJY C;  3SVM A;  4DR4 L;  4V19 0;  2JA6 H;  4PMW A;  3J80 E;  1HNW L;  1SE8 A;  2PQE A;  4MIU A;  1NAP A;  5LMN Q;  2RSN A;  2I0Q A;  5IT9 E;  5FJ8 G;  2B2V C;  4A3M B;  4DAP A;  1HFN A;  4M1U B;  4A93 H;  3A8J E;  3KBX A;  3JAM E;  1PH7 A;  2MQH A;  3D6C A;  3SEB A;  2KEC A;  3RZO H;  1LUZ A;  4MNO A;  4JI3 L;  4B3T L;  1PTO H;  3PUV A;  3T51 B;  4JBW A;  5EJW A;  4C1N K;  3HP3 A;  5M3M G;  4Y7N H;  2ZM6 L;  5CGK A;  4OL7 A;  1OTC A;  5GQO A;  3RLO A;  4DAY A;  2F0I A;  1SE4 A;  4N9T A;  2EPB A;  2CHB D;  2DNE A;  4IPC A;  4F87 A;  2F0T A;  2K75 A;  3HFZ B;  1X3F A;  4CGY B;  1BOS A;  2D0O A;  1D2B A;  1O7Z A;  2E5L L;  2R7Z H;  2B8F A;  4BBR B;  2F0U A;  4YHH L;  4QUF A;  1ET6 A;  4YWM A;  1JWM D;  3S1Q B;  3IRB A;  5IGE A;  1X3E A;  4A3E G;  2WB1 G;  4M8A A;  1JB3 A;  1JOQ A;  4RA8 A;  1HRJ A;  2KHI A;  2DGY A;  2K32 A;  1DOM A;  3MC0 B;  3PV0 A;  2RQX A;  1SRO A;  1DD2 A;  5D3D A;  4A3K B;  4DKA C;  3J81 i;  4O1N A;  3NUC A;  5ISR A;  4DV1 Q;  1CQV A;  1EEI D;  3M85 A;  1W6J A;  3NEM A;  2VUM B;  4UP9 A;  1QJO A;  1IBM Q;  2JP1 A;  4YCW A;  3FDT A;  2R93 G;  1Q90 A;  5IWA Q;  4EQO A;  1S40 A;  4K0K L;  2ZJP A;  5C4X B;  1SBB B;  5H1S E;  4WJW A;  1A0I A;  3BVG A;  2Z4I A;  3I72 A;  4HN7 A;  4RG1 A;  3KLR A;  4CJ1 B;  4EX5 A;  3WWV A;  1X3G A;  5KND A;  1DOK A;  5EBC A;  4B3R Q;  1RCV D;  3TBI B;  4LF6 L;  1CI3 M;  2FHT A;  2A68 D;  1KL9 A;  4OIK A;  1X9N A;  3A55 A;  3GTK H;  1UEB A;  2X6G A;  5IGB A;  1JT8 A;  2AHO B;  1BCP F;  5IP7 H;  1B4O A;  3MXU A;  1LTS D;  2FJ2 A;  3D6W A;  1N34 Q;  3I4M H;  3PF4 A;  4EQN A;  4L8J A;  4DR1 Q;  1TWC B;  2WAQ E;  1HJP A;  2V1C C;  4DR5 Q;  3MTS A;  1VQO A;  4KY7 A;  4B9X A;  3TQY A;  1Y8P B;  2M2L A;  4EGV A;  1J5E L;  5G3L D;  2AKW B;  2OXP A;  2IHF A;  2WAQ G;  5KEE A;  1VQ6 A;  2EZV A;  1PTO C;  4MN3 A;  2XRS D;  3T1Y Q;  3RZD B;  2ID0 A;  2F0W A;  4EQP A;  1K73 C;  1BBU A;  4A76 A;  4I7Z C;  5AJ3 L;  1AE2 A;  4A75 A;  2LSS A;  1SYB A;  1X3Q A;  2Q8T A;  2VY3 A;  5JPM C;  5DAU A;  1MJC A;  3OMG A;  4CJ2 C;  2VQF Q;  1EYG A;  1RTO A;  3DMU A;  3I7F A;  4G4K A;  1JE5 A;  3TEH B;  1LAB A;  3ERO A;  1SRU A;  4DK1 A;  4IJL A;  1G8Z D;  1S5E D;  4KHZ A;  2K05 A;  4C3J H;  2PW5 A;  3S2D H;  4A3C H;  3LWU A;  2E2H B;  2RKS A;  3VDY A;  1NSN S;  5DEH A;  3T56 B;  4BY1 G;  5LHY 1;  2OF1 A;  4OO1 H;  3AFQ A;  1IL2 A;  3KF8 A;  3GDE A;  5C3W A;  1UE1 A;  1TY2 A;  3RMH A;  4DV4 L;  1VQ7 A;  1TS5 A;  4MTK A;  4JI5 L;  1EOV A;  1VQC A;  4CDC C;  1B9N A;  3S17 H;  1M1K C;  1HQM C;  2JA7 H;  3UE0 A;  4Q5V A;  1QOH A;  1Q81 C;  3P20 A;  2QGQ A;  2K4K A;  4LUO A;  3DM3 A;  2MFI A;  5BN3 A;  1RKN A;  2YTX A;  3NWS A;  4JI7 Q;  1GUS A;  1QE6 A;  1A2U A;  5CV9 A;  3S1N H;  1JC7 A;  1RDP D;  1ILQ A;  1I5F A;  1ZYR C;  2VNU D;  5K36 H;  4JK1 C;  2YU9 H;  1QVC A;  4X64 Q;  4ULL A;  1N33 Q;  1KLU D;  2RCN A;  1F9S A;  2O5I C;  1K8G A;  4A3D H;  2K7V A;  1VS0 A;  3MEH A;  4HJA A;  5BN5 A;  2E2J B;  1YHA A;  4DR3 L;  1OXU A;  2L55 A;  1YHB A;  2EYH A;  3MAQ A;  3ITP A;  3BS1 A;  1AEX A;  4ZK9 B;  1WTX A;  1E2Z A;  4OHJ A;  3GTJ B;  2F3V A;  2K5H A;  2I5M X;  2K6A A;  4HJ9 A;  4ZKB B;  2RBM A;  3DHQ A;  1HNW Q;  4A3B B;  3HZX A;  4JV5 Q;  2D5D A;  3NBH B;  5JEA H;  4K8J A;  1K83 B;  2NZH A;  2UUC Q;  3TSS A;  3CCS A;  2R92 B;  3F1Z A;  1B44 D;  2E8G A;  1CKN A;  2D62 A;  1XPO A;  5C5L A;  3J80 L;  1CHP D;  3STB C;  1KTK A;  1Y1V G;  5C3E H;  4A4I A;  4DV2 L;  1U4R A;  4J1M A;  2JA5 G;  1TWH B;  3A5U A;  3H3V I;  3HOU H;  5IT9 L;  1DCZ A;  2UXD L;  3H0G G;  3G48 A;  3EA6 A;  3AFP A;  1BDO A;  3G6J B;  4A3L H;  3J7A V;  2JQO A;  3K6O A;  3JAM L;  1XNQ Q;  4L5R C;  1TWG B;  2NZ1 D;  2GN5 A;  4A3I G;  3K8A A;  1D1K A;  3SK4 A;  4CDE C;  4QQB X;  3LGJ A;  2JK8 A;  3E0E A;  4YHH Q;  3R93 A;  1SDF A;  3AMU A;  3MEF A;  2QW7 A;  3GTM H;  2PMZ B;  2AMC B;  4IQZ A;  1BVS A;  4F88 A;  4KKS A;  5JOB A;  3V05 A;  3SK5 A;  1EYD A;  2SNM A;  2DJG C;  1JJC B;  5HY6 A;  4DR2 Q;  1KXL A;  3PO3 B;  3SK6 A;  3K58 A;  1AH9 A;  5ELB A;  2JA6 B;  2UXC L;  3S16 H;  2VXW A;  4DNR B;  3HKZ B;  1GM5 A;  1PRT C;  1IYJ B;  2LMC B;  4O42 A;  4L5T A;  5KNB A;  4DV0 L;  1IBK L;  1WD1 A;  3C3L A;  4A93 B;  1PMR A;  4GNX C;  1PFM A;  1QNU A;  4YCU A;  1U0L A;  1PLF A;  3I8Z A;  5IYC H;  4L6T B;  2NTS A;  3CQZ H;  5IYB G;  3RZO B;  2QDL A;  4GN5 A;  3U4Z A;  1PTO B;  3RD4 A;  4I65 A;  2V4D A;  3K57 A;  4Y7N B;  3PUX A;  1SN8 A;  2SEB D;  4B08 A;  2B63 G;  4HSP A;  5I6W A;  1Q1E A;  4BY7 G;  2KQ3 A;  4IAL A;  4LF6 Q;  1YJ9 A;  4IFD J;  4K14 A;  5IGG A;  3W2D A;  4CJ0 B;  4RKB A;  3CKI B;  2R7Z B;  3DUZ A;  2NN6 H;  3T4A C;  3VA5 A;  2MJ8 A;  1NMF A;  1ASZ A;  1A3V A;  1QNK A;  4HSV A;  3J81 c;  2I5L X;  2L9H A;  3KYH C;  5E7N A;  5C3X A;  3BVM A;  4DV7 L;  1V43 A;  4IUQ A;  2BE5 C;  4J6H A;  3PUZ A;  5C6A A;  4K6L A;  2HDL A;  2QIL A;  1JJG A;  5IOC A;  3V96 A;  1U5K A;  2I46 A;  1UUP A;  3VYS A;  3PO2 G;  4GS3 A;  4LUV A;  3M4Q A;  5AJ3 Q;  1D1I A;  1EU4 A;  5C0X I;  1I94 Q;  2F0G A;  3GQB A;  2UUA L;  1CKM A;  3HEJ A;  3HOW G;  3PF5 A;  3SDZ A;  2R7F A;  1DZ1 A;  3MFY A;  1EU3 A;  1JJ2 A;  5EGT A;  4GOP A;  3G4S A;  4Z9C B;  4RGO S;  4RGM A;  4RWS C;  1K8A C;  3TS0 A;  1VQH A;  2MPM A;  1H9K A;  2F0O A;  2JYO A;  4PMC A;  3TP7 A;  2QA4 A;  4K8I A;  5M5X H;  3TS2 A;  3GTK B;  2WP8 J;  1EIH A;  2XWB B;  1UNS A;  1S5F D;  4DV4 Q;  3K0Y A;  1G51 A;  1TWF H;  3M4Y A;  4JBK A;  1V1P A;  2KVM A;  3I4M B;  3CD6 A;  3GTO H;  4A3G G;  3JAM c;  3SGI A;  5E4W C;  1NR4 A;  4OX9 L;  4HAE A;  4HED A;  4KN4 C;  1SYC A;  4XQJ A;  3M4O H;  1RL2 A;  2Y0S G;  1MIU A;  1CKO A;  3FMC A;  1JQY D;  2EY5 A;  2IPK D;  4K5X A;  3W1G A;  2CWP A;  3FKI H;  1WTH A;  2A6E C;  1GO3 E;  2NN6 I;  4C3I G;  1YIT A;  3HOZ H;  4DNT B;  4DXG A;  1EIG A;  1LT3 D;  2VQE L;  2EJF C;  3NPP A;  3R2T A;  4C2M H;  1DGS A;  2JJQ A;  2VZA A;  3DXJ C;  2F0E A;  2EYL A;  4IN3 A;  1K3R A;  4C3H G;  5ELE A;  1SMY C;  3BG3 A;  4HJ5 A;  1BR9 A;  5ELN A;  1UE6 A;  1BCP D;  2AWN A;  1HR0 Q;  2HT1 A;  4XQQ A;  4DR7 L;  4C3J B;  4B9W A;  3RNU A;  3S2D B;  4IOC A;  4AH6 A;  1I4G A;  1X32 A;  3KFU A;  4JBM A;  4HTH A;  4PZ8 A;  3KF6 B;  3TP8 A;  2EE1 A;  1VQN A;  4FVM A;  4BS9 A;  3VYU A;  1HNZ Q;  2BDO A;  3KJP A;  4OWT B;  3S17 B;  2A69 D;  4AQY Q;  2EQS A;  2JA7 B;  1E3P A;  1VQM A;  2SDF A;  3U9S A;  2UXB L;  1WCM G;  2F52 A;  1CK1 A;  3TRE A;  5KIX A;  1BO0 A;  5HGT A;  3S14 H;  1H95 A;  1PRT B;  3W1B A;  1G6Z A;  2A6H D;  4ZKC B;  4ID6 A;  2KJX A;  3E9H A;  3DWP A;  5C44 G;  3S1N B;  4GNX B;  3ICE A;  5C0X J;  1EIF A;  4BBS G;  3FHW A;  4LFC L;  3UDX A;  4PQX A;  2YU9 B;  3LWE A;  3MXP A;  2SOB A;  2G5D A;  1VQP A;  3E9I A;  5M5W H;  5IYD H;  3KUP A;  4A3D B;  2ZJR A;  1C48 A;  3TRZ A;  4HR7 B;  2F4V Q;  3PIO 3;  3N6R A;  2DN8 A;  3HS0 C;  2WV6 D;  3CP0 A;  1RD9 D;  3D0F A;  1GUW A;  1K3B C;  1N9W A;  5EBD A;  4HMJ A;  3HRZ C;  1KNA A;  3K7U C;  3EVQ A;  3HOV H;  3G7L A;  4JOI C;  4DA2 A;  3PUW A;  4K5V A;  1STH A;  2KOL A;  2C9O A;  1IBK Q;  1CSP A;  3M9B A;  4R8N A;  1K0S A;  1NBW A;  2CQO A;  2KHJ A;  3I4N H;  1B70 B;  1DYQ A;  1EUJ A;  1HZA A;  3J81 E;  4J15 A;  3K5M A;  1VDZ A;  2KEE A;  2M00 A;  1EYA A;  2JSO A;  3B6Y A;  4B3S Q;  1KNE A;  1Z7T A;  5DNF A;  3J7A 5;  5D14 A;  4HIM A;  5FJ8 H;  3FPU B;  4OEM B;  5C3E B;  1K9M C;  3HOU B;  3LNN A;  1H9J A;  4JI4 L;  2EYJ A;  5KYL A;  4IUP A;  1CTM A;  1R4Q B;  4JI6 Q;  4IPH A;  1SNQ A;  4YY3 L;  3IFT A;  5COR A;  2VL6 A;  4FXK C;  2C35 B;  1QIL A;  4JYA L;  3OIP A;  1E7Z A;  1L0W A;  5M3M H;  1HQR D;  5KYI A;  1A6X A;  1B2T A;  4UHV A;  5TSS A;  3I73 A;  3EQL C;  3OIQ A;  2ZTC A;  2UU9 Q;  3GTM B;  2J0T D;  3TME A;  3HG9 A;  3KJO A;  4DK3 C;  2LKV A;  1UE5 A;  2JA8 G;  1Q8K A;  5IGD A;  1STA A;  4HMI A;  4DV5 L;  1VMP A;  3V2T A;  4GLV B;  3S16 B;  2LFN A;  4A3E H;  1YHQ A;  2MUY A;  1Q3L A;  1F77 A;  4J8Q A;  3K7A H;  2BH8 A;  1WTW A;  3CME A;  3ERQ A;  3CCU A;  4EQ5 A;  1AP0 A;  4MTN A;  1LAC A;  1QG7 A;  2K5N A;  3CQZ B;  3K5N A;  1SYE A;  5LMN W;  3GD7 A;  4RKL A;  2MHV A;  1NY4 A;  4N8F A;  2FMC A;  4DAY B;  3BDL A;  3EIV A;  3RN2 A;  5F2D A;  1BUV T;  2R93 H;  4KKU A;  1MI2 A;  1LM0 A;  1LO5 D;  3K81 C;  2RVL A;  4HID A;  2YTV A;  2Q8I B;  1V9P A;  2DNC A;  4GLX A;  3OPO A;  1Y8N B;  3S1M H;  3L0O A;  1PH6 A;  3HOX G;  1SJE D;  2IX3 A;  5DLQ E;  1AFP A;  5EKK A;  4LF4 L;  3KOJ A;  1IHZ A;  2N8N A;  3ZYY X;  1O78 A;  1SXT A;  1FR3 A;  2RDG A;  1MKH A;  4C56 C;  1JR0 D;  2GVA A;  3A56 A;  4P72 A;  1WTQ A;  3GTG H;  2XIW A;  3GV6 A;  1K0R A;  1S5B D;  2F0M A;  4OX9 Q;  3Q8D A;  3BDC A;  4WJ4 A;  2F4I A;  2XSC A;  2VS1 A;  3G71 A;  4DK6 C;  1YNJ D;  2Z1C A;  5GAG C;  1EQQ A;  3BZK A;  1B8A A;  3FPP A;  4RCO A;  1EY8 A;  2A8V A;  3UE1 A;  4X3S A;  2PO4 A;  5M3F G;  1EL0 A;  4HIK A;  3M4P A;  2ATW A;  3AEV A;  1QZH A;  4ME3 A;  4ZUJ A;  2BE5 D;  1B50 A;  2ZTE A;  4A3J G;  1MSG A;  4DR7 Q;  1JIC A;  2H1E A;  3K0X A;  4LF9 Q;  1ENF A;  3E5S A;  4WJ3 M;  5M5X B;  1IW7 D;  4R8I A;  4X65 Q;  1VMC A;  3F2C A;  1XYI A;  3F8T A;  1S5D D;  2KCN A;  4X62 Q;  1CHQ D;  1TWF B;  2PZT A;  5LMU L;  1RTN A;  4OGQ C;  2XGT A;  4JI1 L;  3GTO B;  1PH8 A;  2R7D A;  1QZG A;  4BY1 H;  1R4P B;  2NTT A;  2B29 A;  2CW0 D;  2KCC A;  1PTO F;  1V8Q A;  1CA6 A;  2UXB Q;  1T5E A;  3HOY G;  2OTJ A;  4ZLT F;  3Q23 A;  3A8I E;  3NXW A;  2UUB Q;  3H91 A;  4LFA L;  5J22 A;  3M4O B;  1CZG A;  3GTL H;  4ZUI A;  5GRO A;  2K5V A;  1GUT A;  5CV6 A;  4DNI A;  3FKI B;  3CCR A;  4LFC Q;  2Q8R E;  4RMF A;  1I4Q A;  3HOZ B;  1XNR L;  1JE4 A;  1HNX L;  3I56 A;  4C2M B;  4X6A H;  3FVQ A;  4IUN A;  4L5Q A;  3ULL A;  4QCL A;  2J7Z A;  2PW7 A;  1DJR D;  5C4H A;  1F9Q A;  3KK7 A;  1SFO H;  3KF8 B;  2CWA A;  3D4R A;  4FF1 A;  1PA6 A;  3S24 A;  1I3Q H;  4BA1 I;  1J8I A;  4R4T A;  2NWG A;  4QY7 A;  2QEJ C;  2XNA C;  1Q7Y C;  1IZ6 A;  4DF7 A;  1Q8I A;  1TY0 A;  4GOP C;  3VYT A;  3A5Z B;  3D4W A;  2A5H A;  3UDI A;  1SNM A;  2B2T A;  1GHK A;  4AYB E;  3MFG A;  3Q0A A;  2NVQ H;  3C2P A;  2E74 C;  3DEP A;  5DM7 3;  3S14 B;  1VQE A;  4P74 A;  4AYB G;  5ELC A;  1LT6 D;  4JI4 Q;  3TZD A;  4IFD G;  1VQ9 A;  1KLG D;  5E3F A;  5T1G A;  4DR6 L;  1G6P A;  2E76 C;  3J81 L;  1A63 A;  3I70 A;  1Y1V H;  1WTO A;  3QJY A;  5C4Z A;  4JYA Q;  4DV3 Q;  2JA5 H;  2B39 A;  5LL6 S;  3H0G H;  5M5W B;  1LTT D;  2TMP A;  2BA0 A;  1EY0 A;  4CDF C;  4CBV A;  4A3I H;  4LF7 L;  1JOO A;  2DY7 A;  4GKK L;  1SYF A;  4DV6 L;  1U4L A;  1X54 A;  3PQI A;  5NUC A;  1Y1W G;  3ERS X;  1QVG A;  2F0V A;  4QGU A;  3HOV B;  4DR4 Q;  2BH2 A;  1CKN B;  1HZ9 A;  3M7N A;  3I90 A;  4ODG A;  4NXM L;  4KJN A;  1N36 L;  2B2V A;  3SE0 A;  2NUC A;  3I4N B;  2KUM A;  1XMQ L;  1KC8 C;  2AUK A;  5KGU A;  3TP5 A;  3AB9 A;  4OEL B;  4L63 B;  5JPN C;  1WYD A;  4KD4 A;  4JI2 L;  2F0L A;  5M5Y H;  1B3Q A;  4R4C A;  2JN4 A;  4JI3 Q;  3PIO A;  4B3T Q;  3WOE A;  3ULP A;  4B3M L;  3AU7 A;  1WTR A;  5IYB H;  3OTO L;  1PHJ A;  1EWC A;  1FYC A;  1YNN D;  2ZM6 Q;  5CC4 A;  3IAY A;  2LS0 1;  1B3A A;  1PZK D;  2B3G A;  3S9W A;  2L0C A;  4KHP L;  4OO1 I;  5M3M B;  1XTC D;  1FJG L;  1E24 A;  5FKA C;  1TU2 B;  1Y14 B;  4LF4 Q;  2FXQ A;  1HUN A;  3HKS A;  2E5L Q;  1OXV A;  2B63 H;  3NBH A;  3SR1 A;  1VQK A;  3Q22 A;  4BY7 H;  3CMA A;  2PZU A;  2KCT A;  3C46 A;  2KEN A;  2Q2H A;  2D2C C;  4HCS A;  4X3T A;  4APV A;  4UY8 C;  1A3U A;  1EOT A;  4YCV A;  1K8M A;  1F2Z A;  4LW1 A;  1MJE A;  1PRT F;  5KRU A;  2EYP A;  4A3F G;  3L2P A;  2CVR A;  2M9V A;  4LJZ C;  1VQ8 A;  4OWX B;  1X56 A;  2WB1 B;  4A3E B;  2OQ0 A;  3PCO B;  4P73 A;  5A35 A;  1HHV A;  3K7A B;  3RLN A;  3PUY A;  4P75 A;  4JI8 L;  2BCO A;  4JCV E;  4X66 L;  3URY A;  1H9M A;  2A74 C;  4X3K A;  3MXN A;  3E0J A;  4PG3 A;  4UDU C;  3S1R H;  5JJL A;  3TN2 A;  3OSO A;  2HIX A;  4K0K Q;  4IUR A;  2I07 B;  3G6E A;  3PO2 H;  3HGB A;  1B7Y B;  3KLW A;  2R93 B;  1KRT A;  3HOW H;  1HUM A;  1VQJ A;  2WKD A;  3NEL A;  2OTL A;  1SLJ A;  2NYZ D;  1GD7 A;  3OOC A;  1PZI D;  1SJH D;  1TQO A;  2R6G A;  3S1M B;  2F0S A;  4H0L C;  3I2Z A;  3CRK C;  1FGU A;  3S2H H;  1H9S A;  3O13 A;  4QIW B;  3C1F A;  5JAV A;  3CAM A;  4JI1 Q;  2KCM A;  2NVY H;  1ML0 D;  2D0P A;  3GTG B;  4HIO A;  2F0D A;  4K2K A;  1YZ6 A;  2KHS A;  5C0X G;  1HH2 P;  1Q86 C;  4XIG S;  1J5E Q;  4GKJ L;  5C4J H;  1K8O A;  1CSQ A;  2K28 A;  1HCZ A;  1WTV A;  4A3G H;  5LL6 X;  2N3S A;  1X6O A;  1N8R C;  3NSW A;  1T9H A;  1M90 C;  4LAA A;  2E2I H;  4GOP B;  1CA5 A;  1AE3 A;  4F7X A;  2WAQ B;  3CC7 A;  3BDO A;  1HNX Q;  2F0Q A;  1JMC A;  1F9R A;  2DJF C;  4ALP A;  1U4M A;  3J7A F;  4DGZ A;  3QIA A;  4NKL A;  3T16 A;  4GLA C;  3EN2 A;  4C3I H;  1I50 H;  4A3M G;  1WOC A;  1ENC A;  5GAH C;  1CT1 D;  1DM0 B;  1HTP A;  1V1P B;  5LMN L;  2FIN B;  4O0A A;  2A68 C;  1A3T A;  1IYU A;  1EFI D;  4C3H H;  4F8M A;  3DWA A;  4YIJ A;  3PSI A;  4UP8 A;  2EY6 A;  2OEO A;  1AZQ A;  4FXD A;  4U68 A;  4UAI A;  4BWG B;  1RHP A;  1NNX A;  3NTK A;  1EWH A;  4QL5 A;  4BY1 B;  4JI5 Q;  3CU7 A;  1D7Q A;  1PH9 A;  3TP6 A;  1WVL A;  3E6Z X;  4OXP A;  1ZEQ X;  1LYL A;  3I3C A;  1RJT A;  2KED A;  1C7Y A;  1YJW A;  4BXX G;  2PYK A;  4BBR G;  4XT1 B;  3OHX C;  5C5M A;  4DR6 Q;  3GTL B;  4LWC A;  1QB5 D;  3D31 A;  1G2S A;  1WCM H;  1OXS C;  4QB4 A;  4GN4 B;  2WFW A;  5C44 H;  5BR8 L;  4A3K G;  4QMG A;  1PV4 A;  2HQL A;  5JJI A;  3VR2 A;  2JA9 A;  1HA6 A;  2OQK A;  2RF4 A;  1JWU D;  2NBF A;  4BBS H;  1YIJ A;  1LTA D;  4LF7 Q;  3CCM A;  5I6Y A;  1NMG A;  1SYG A;  2VUM G;  4GKK Q;  1SFO B;  4L5S A;  4DR3 Q;  4DV6 Q;  4DV1 L;  1KRS A;  2C5C A;  2G9D A;  5ELO A;  2J4X A;  1R9T H;  2F1M A;  2CQA A;  3W5O A;  1EQT A;  1I3Q B;  5JEA J;  1IBM L;  5FK9 C;  3R3O A;  4RCN A;  1HR0 W;  1PTO D;  1LT5 D;  3DLL A;  5C4X G;  2KA7 A;  5EAY A;  1XJV A;  4G7O C;  2WII B;  1F2L A;  3OWF A;  4R9W A;  2EYO A;  1XMQ Q;  2NVT H;  1PYS B;  5CV5 A;  4I7A A;  1QUQ B;  4IUU A;  1P16 A;  4N8X 1;  1PYW D;  1G2T A;  2NVQ B;  4P2C B;  2VW9 A;  1FNW A;  1LTI D;  3RR5 A;  3TZU A;  1GJX A;  4FO2 A;  3I4O A;  4YWK A;  5FLM G;  1AZP A;  2EYF A;  3MHB A;  4AIM A;  3UI2 A;  4B3R L;  2SNS A;  3NE5 B;  4B3M Q;  4DV2 Q;  4OIJ A;  2UXD Q;  3ULJ A;  4CKE A;  4IOA A;  1Y1V B;  4DAV A;  1IBL L;  2BA1 A;  3QR8 A;  4TKO B;  4H02 A;  2RDF A;  4KHP Q;  2JA5 B;  3QOL A;  3H0G B;  4LK1 C;  4X3U A;  1N34 L;  5ELD A;  3I4L A;  2HUG A;  4LFB L;  3UDF A;  5CMD A;  4DR5 L;  4A3I B;  2PI2 E;  4FF2 A;  4KY6 A;  3D8G A;  4RAU C;  2CKZ B;  4O2D A;  4ZYS A;  4G57 A;  2FFK B;  3A0J A;  3EJI A;  5CYU A;  2WAC A;  4HCE A;  3GV3 A;  1I4R A;  2JA8 H;  3VR4 A;  2UXC Q;  1LLR D;  1IKL A;  1ZXT A;  2B2W A;  3UDG A;  3OMC A;  1ZKO A;  2AUJ D;  4X66 Q;  3CXC A;  1D5M C;  1ZYR D;  2L11 A;  4NXN L;  2IWH A;  4DV0 Q;  2VQF L;  4H7B A;  2EY2 A;  1IL8 A;  2N88 A;  1N32 L;  1D5Z C;  1ESF A;  4TRD A;  4IUT A;  5M5Y B;  3L7Z C;  1WTP A;  3DM1 A;  4OWW B;  3D3R A;  2CH4 W;  2RCF A;  2E2D C;  1GXD C;  1PH3 A;  3RUZ A;  2IW3 A;  2GA4 B;  1L2F A;  2O4X A;  5CV4 A;  1LTG D;  4LNQ A;  3WOF A;  1O7L A;  4IPG A;  5IOD A;  1L1O A;  2Z6K A;  4LF8 L;  3W3A A;  4FP5 D;  2B2T C;  2B63 B;  5JJK A;  4BY7 B;  4FNF A;  3MA2 B;  5CV7 A;  4R4I A;  4WRD A;  1HTL D;  1NTG A;  5HGQ A;  1Q12 A;  2EYM A;  1Z47 A;  3HOX H;  1XWE A;  4JI7 L;  1VCI A;  1E2W A;  5FO8 B;  3STB D;  4DV7 Q;  4G7H C;  3Q6S A;  2XN9 C;  1ILP A;  2MGS A;  4GKJ Q;  3P75 A;  1A2T A;  2AQ2 B;  2N55 A;  1DXM A;  2XRQ D;  3Q24 A;  1N33 L;  4X64 L;  1SAP A;  2G9H D;  1I4X A;  3NHH A;  2ZXR A;  3KDF A;  2Z4H A;  3S1R B;  2EVB A;  3L3O C;  1Q1B A;  2UUA Q;  1KAW A;  3NTI A;  1VF7 A;  3CC2 A;  1E1O A;  3PO2 B;  4K6D A;  5IE8 A;  1M8A A;  2PQA A;  1X65 A;  4A3B G;  1LTB D;  1UAP A;  3HOW B;  1SR3 A;  2EY1 A;  1SSO A;  3P7J A;  3J7Z C;  1EYC A;  3CC4 A;  5M3F H;  2R92 G;  4JV5 L;  1C8C A;  2HHH L;  1EQR A;  1VF5 C;  2UUC L;  1I4H A;  3S2H B;  2ZTD A;  1IYV A;  1PRT D;  1TII D;  1YJN A;  2L1B A;  4KV6 A;  2F0H A;  1PH1 A;  4A3J H;  3CCL A;  5EPL A;  2JEB I;  5IGC A;  5IP9 G;  4KD3 A;  2NVY B;  3RLF A;  2IL8 A;  4DFA A;  3CCV A;  4POG A;  1EY4 A;  1QWY A;  4YWL A;  1NE3 A;  2PMZ E;  3A8K E;  1XNQ L;  2ZXO A;  1CQF A;  5C4J B;  1KHI A;  3A7A B;  4A3G B;  1U4P A;  2Z8L A;  1Z9F A;  2E2I B;  4PMB A;  1GVP A;  3HOY H;  2WB1 E;  1J9O A;  4PV1 C;  5IGF A;  2NZO A;  3NBI A;  3TDQ A;  4QJF A;  3NTH A;  3FRP B;  1EQV A;  4ZQ3 A;  3T1H L;  3D4D A;  3HKZ E;  1P8L A;  3RN5 A;  5BR8 Q;  3PO3 G;  3PGZ A;  2Y0S B;  2JA6 G;  2VQE Q;  4MHE A;  5FOB B;  3VR3 A;  4DR2 L;  1KD1 C;  4RH6 A;  3HKZ G;  3I55 A;  3EFX D;  4C3I B;  1I50 B;  4DUZ L;  4A93 G;  2DUD A;  1BBX C;  1XMO L;  2ENB A;  2NB0 A;  3SXH A;  2TSS A;  2JXM B;  4C3H B;  5FLX c;  1B1Z A;  1CUK A;  2HDM A;  2RDH A;  4IO9 A;  3P1H A;  1S4Z A;  1HZB A;  1CM9 A;  1STG A;  3DWQ A;  2K14 A;  2MNA A;  1W2B A;  1EY5 A;  3CCQ A;  3K5O A;  4QIW E;  3PIP 3;  3J81 j;  1NR2 A;  1FVI A;  4JBJ A;  2A73 B;  2XWJ B;  3N52 A;  2O5J C;  1GOZ A;  1HPC A;  3VA7 A;  1VQ4 A;  2R7Z G;  1KAA A;  3QG1 A;  3M7G A;  4KK7 A;  1F2M A;  4CHT B;  1GKH A;  2H5X A;  4ILW A;  1EY7 A;  1I6H H;  4LF5 L;  1WCM B;  3T53 B;  1IBL Q;  1AW7 A;  4E6I A;  1KDB A;  5JJZ A;  2ES2 A;  1TXY A;  1VQF A;  5C44 B;  4IFD H;  3GTP H;  3J80 i;  1E0B A;  2N49 A;  3MVV A;  1SNP A;  4QF4 A;  4LFB Q;  2EDG A;  2B2Y A;  1MGS A;  3CPF A;  3QWN A;  4FXG C;  4Q0F A;  4EVO A;  4BBS B;  4DPG A;  4PNY A;  2F0N A;  1BCP C;  5CBA E;  3U4V A;  2K52 A;  1RIP A;  1PDQ A;  1LV9 A;  3JAM i;  3GTQ H;  1R9T B;  5A2Q E;  3H15 A;  3CPW A;  1JCK B;  2NVX H;  5GAE C;  1Y8O B;  3CW2 C;  3H94 A;  1T5X D;  1STY A;  4C1N I;  4NB3 A;  4JOI A;  2LXK A;  4NW2 A;  3CCE A;  1I94 L;  1Y1W H;  1UWV A;  1PFS A;  2NVT B;  3NWT A;  2A69 C;  4NXN Q;  1IXR A;  3KBG A;  2K50 A;  3ONA B;  1XPU A;  4UP7 A;  1ICW A;  3NK9 A;  2A6E D;  4RHR A;  1EY9 A;  1N32 Q;  2B2U A;  2R61 A;  1FD7 D;  3PMF A;  1HXY D;  2L5T A;  2A6H C;  2PI2 A;  4V0B A;  5M9O A;  1EFW A;  1JOK A;  5COY A;  5HUR A;  3U50 C;  3H3V H;  3L9A X;  1YNX A;  1SMY D;  1ET9 A;  3DEO A;  5IP7 G;  2K03 A;  2F0J A;  3KLS A;  2K5W A;  3I4M G;  4R4Q A;  2EXD A;  4CKC A;  2ZXP A;  4YY3 Q;  1V1O A;  1GHJ A;  5J39 A;  4JVZ A;  1Y69 U;  2LXJ A;  4IUV A;  4LF8 Q;  3M3Y H;  2QCP X;  1BBW A;  1EZ8 A;  2Q2T A;  1LT4 D;  4KHV A;  4KN7 C;  1BQQ T;  1S72 A;  1K28 A;  2JE6 I;  1O7I A;  1L0X B;  2ICI A;  4LUZ A;  4RGN A;  1PH4 A;  1MHW C;  4DV5 Q;  4QUC A;  2WIN B;  4IPD A;  2JA8 B;  4NDX A;  1STB A;  4Y52 H;  1KIX A;  1TS2 A;  5I9O A;  1SE2 A;  2L12 A;  3CRL C;  4IFD I;  4A3F H;  4U67 3;  4DXF A;  2K5D A;  4CDD C;  4C3J G;  1O80 A;  4A3C G;  1DOL A;  2N78 A;  2OCE A;  4XTC S;  4XYO A;  4K5W A;  1C0A A;  5KNC A;  4MZ9 A;  1C4Q A;  1SMX A;  1PYB A;  4RHS A;  1HR0 L;  4OO1 G;  1EEF D;  4GZY C;  3K80 C;  4R1J A;  2K04 A;  1MSH A;  2K01 A;  2HHH Q;  1YVC A;  2Z0S A;  1PZJ D;  3ER0 A;  2JA7 G;  1HNZ L;  4UPA A;  4JI0 L;  4WFN 3;  2HCC A;  1WJJ A;  2IHE A;  2OWO A;  2IJ0 A;  1HA5 A;  2WKC A;  1U9R A;  2PZW A;  3IL8 A;  5EPJ A;  4AQY L;  1G29 1;  4XQN A;  1ROD A;  1S3O A;  2CFM A;  3HOX B;  5J3B A;  3C1E A;  5JVH 3;  3S15 H;  2X69 A;  4S3S A;  3F2D A;  1VQG A;  3SK8 A;  5K36 G;  3VR6 A;  3I91 A;  4JW0 A;  3MXN B;  3U58 A;  1V1Q A;  5EPK A;  3OWE B;  4PZ7 A;  4NMZ A;  4A3D G;  4RFB A;  1XX8 A;  1YI2 A;  2AQ1 B;  5FLX E;  3H3V C;  1TT2 A;  3X3M A;  1D8L A;  5C0X H;  1O7Y A;  2QDB A;  1EY6 A;  1FGB D;  3K5L A;  1TS4 A;  1XPR A;  3FEW X;  2B8G A;  1TWA H;  1WI5 A;  5ELF A;  3T1H Q;  4XT3 B;  2F4V L;  4P71 A;  2X6L A;  4KKT A;  1MBY A;  2K5Q A;  5L37 A;  1E22 A;  2PNH A;  1X3P A;  1ESR A;  1LTL A;  5JEA G;  4DUZ Q;  1SNC A;  1H9S B;  1E2V A;  5M3F B;  3GP7 A;  2O2L D;  1ICF B;  4HJ8 A;  2DY8 A;  1SNO A;  2B2W C;  1SND A;  3BVZ A;  1XMO Q;  3BYY B;  3WDN A;  4FF3 A;  1YEZ A;  3MZ5 A;  1SE3 A;  2RSO A;  5D3I B;  4A3M H;  1BKB A;  1BF4 A;  4A3J B;  2L15 A;  5C3E G;  1BCP B;  1I4P A;  3HOU G;  2AWO A;  4FDB A;  5LMU Q;  1JB7 A;  1S5C D;  3E3X A;  2EIF A;  1AN8 A;  1B53 A;  5E1F A;  4B3S L;  1QVF A;  4A3L G;  1SYD A;  2Q2U A;  3NQI A;  4GN3 B;  3U9O A;  1CZW A;  4JI6 L;  2CH4 A;  5T1I A;  4DUY L;  2PNR C;  1YNJ C;  3OW2 A;  1PH5 A;  2RA4 A;  4LFA Q;  2E75 C;  4LF5 Q;  3IKJ A;  3HOY B;  1L1O C;  2Z6K C;  2ASB A;  1NJI C;  3LX0 A;  4PZ6 A;  1J6Q A;  1VQA A;  4HJ7 A;  2K33 A;  1PH2 A;  2UU9 L;  5J1Z A;  2F3W A;  4BXX H;  2EJG C;  4BBR H;  2AQ3 B;  1XNR Q;  4XXE A;  3S1Q H;  3T13 A;  3VYR A;  1Q82 C;  2HQE A;  1DON A;  1E1T A;  2XTI A;  4IJH A;  4LMQ D;  1C9O A;  2XVS A;  5DM6 3;  3VR5 A;  1UEA B;  4CKB A;  4A3K H;  5IYC G;  1IW7 C;  4KMU C;  3NP8 A;  3CHB D;  4K2L A;  1JOR A;  1XXG A;  2F3I A;  2IT1 A;  1X55 A;  2VUM H;  2IY5 B;  2ICE C;  4KTA A;  2YV5 A;  5AFW A;  1Q46 A;  1OXT A;  3QO2 A;  2ALY B;  5G3L F;  4XDX A;  3OW7 A;  2CCZ A;  2KBN A;  1W3S A;  3MXG A;  2CW0 C;  4KI0 A;  5A2Q L;  1PFN A;  5C4X H;  1KAB A;  4FF4 A;  1KDC A;  2ZT9 C;  1TVX A;  1GUG A;  2PPB C;  2NN6 G;  1CFM A;  3BU2 A;  3JC6 6;  1I6H B;  3QOJ A;  1STN A;  3J80 c;  1A62 A;  3QB3 A;  5FLM H;  4AYB B;  4RGT A;  2VB2 X;  2IX1 A;  1FL0 A;  1TKW B;  2MO1 A;  5IT9 c;  5E4X A;  1M4V A;  4JG2 A;  2ZJQ A;  3GTP B;  4DAM A;  5EQ0 A;  1VQL A;  4XYQ A;  1EZ6 A;  1G91 A;  3EBE A;  1TWC H;  3PIP A;  2VB3 X;  2Y0S E;  2HD3 A;  1A15 A;  3GTQ B;  1HFG A;  2QEX A;  1NUC A;  2A1A A;  2NVX B;  2RHS B;  3RZD H;  2EJM A;  1LTR D;  1D6E C;  4TSS A;  1Y1W B;  4G7Z C;  5EKL A;  3X3N A;  5IWA L;  4NXM Q;  4KY5 A;  1N36 Q;  2GVB A;  3BZC A;  1F2Y A;  2MP1 A;  1YBY A;  4R4O A;  2IX0 A;  4ZAI A;  1VQB A;  4JI2 Q;  4ZCK A;  5CBE E;  3NQT A;  1Z6H A;  1KDA A;  4LF9 L;  1HZC A;  3A7L A;  2HIV A;  4ME5 A;  2I5H A;  4JC0 A;  2E2H H;  3IFD A;  1EIY B;  4X65 L;  3OTO Q;  5I4D A;  4ZRZ A;  1STE A;  2Z9H A;  2F0P A;  2YTY A;  4KLK A;  4X62 L;  4JI0 Q;  2LY7 A;  5JVG 3;  1XTD A;  2QKI C;  1VQ5 A;  3M3Y B;  1F9P A;  1FJG Q;  5IY0 A;  4NP5 A;  5FO9 B;  3KF6 A;  2A19 A;  1FNV A;  1PXU A;  1W6K A;  4DR1 L;  2YYZ A;  2H4O A;  2RHQ B;  4TQU S;  1VQD A;  1VQI A;  2UUB L;  4KJO A;  1QUQ A;  3ND9 A;  3FKI G;  1L0Y B;  5D65 A;  1BNZ A;  4FYD A;  4H44 C;  2BDN A;  3HOZ G;  4WOR A;  1SEB D;  3T1Y L;  3BYT B;  3K59 A;  1OO9 B;  1ENA A;  5BN4 A;  3AQQ A;  5I2Y A;  4OON A;  4POF A;  4JI8 Q;  4A3F B;  2B2Y C;  4GNX A;  5EKI A;  5I2X A;  3OYY A;  5CV8 A;  1JWS D;  2K1B A;  3F2U A;  2E2J H;  2D9U A;  1PFB A;  2EXZ A;  1GUO A;  5FLX L;  2EOT A;  1KQS A;  1B9M A;  1YNN C; 
#chains in the Genus database with same CATH homology
 3G4S A;  1L1O B;  3GTJ H;  5FLX c;  1WYD A;  4JI2 L;  1CUK A;  4IO9 A;  5M5Y H;  1K8A C;  4R4C A;  3TS0 A;  1VQH A;  1HZB A;  2MNA A;  1W2B A;  4A3B H;  2K14 A;  1EWI A;  3CCQ A;  3PIO A;  4JI3 Q;  4B3T Q;  1OXX K;  1K83 H;  3ULP A;  2QA4 A;  4QIW E;  5M5X H;  4B3M L;  3J81 j;  3TS2 A;  1FVI A;  4JBJ A;  5IYB H;  3OTO L;  1PHJ A;  2R92 H;  2WP8 J;  1PVO A;  2ZM6 Q;  4DV4 Q;  2B3G A;  1ASY A;  1G51 A;  1TWF H;  2R7Z G;  1VQ4 A;  4JBK A;  4KHP L;  4OO1 I;  1GKH A;  2H5X A;  1FJG L;  1E24 A;  3CD6 A;  3GTO H;  3CCJ A;  3F2B A;  4LF5 L;  1I6H H;  4A3G G;  3JAM c;  1TWH H;  1Y14 B;  3KDF B;  2FXQ A;  3SGI A;  3HKS A;  4DUY Q;  4LF4 Q;  2E5L Q;  1OXV A;  5IYD G;  1IBL Q;  2B63 H;  1VQK A;  5IP9 H;  4BY7 H;  3CMA A;  2KCT A;  2Q2I A;  2MO0 A;  1TXY A;  2KEN A;  1VQF A;  2ES2 A;  1TWG H;  2Q2H A;  4OX9 L;  5GAD C;  4APV A;  4DV3 L;  3GTP H;  3J80 i;  4UY8 C;  2N49 A;  3FP9 A;  2JEA I;  4LFB Q;  2PQA B;  3M4O H;  3CPF A;  4YCV A;  4LW1 A;  3GO5 A;  1MJE A;  4DPG A;  1RL2 A;  2Y0S G;  3A74 A;  1WFQ A;  3AYH B;  4A3F G;  3L2P A;  1MIU A;  1CKO A;  1VQ8 A;  3U4V A;  4OWX B;  1X56 A;  2K52 A;  1RIP A;  3W1G A;  2OQ0 A;  3NEN A;  2CWP A;  3PCO B;  4TVA B;  3FKI H;  4P73 A;  3JAM i;  3GTQ H;  1GO3 E;  2NN6 I;  1YIT A;  3HOZ H;  3RLN A;  3PUY A;  4P75 A;  4JI8 L;  3H15 A;  4JCV E;  4X66 L;  3HOV G;  3CPW A;  3CF5 A;  4BA2 I;  2VQE L;  2NVX H;  4C2M H;  4NPS A;  5GAE C;  1DGS A;  3CW2 C;  2JJQ A;  2VZA A;  4PG3 A;  3I4N G;  3BJU A;  3S1R H;  1UE7 A;  4JOI A;  4NB3 A;  1A8V A;  1K3R A;  2LXK A;  3ZJY C;  3CCE A;  1I94 L;  3PO3 H;  4DR4 L;  4HJ5 A;  5ELN A;  2JA6 H;  4PMW A;  1UE6 A;  1Y1W H;  2AWN A;  1UWV A;  1PFS A;  2HIX A;  1HR0 Q;  2HT1 A;  4K0K Q;  1HNW L;  1SE8 A;  4NXN Q;  1IXR A;  4DR7 L;  3G6E A;  3PO2 H;  3RNU A;  2K50 A;  5LMN Q;  1B7Y B;  3KLW A;  4UP7 A;  4AH6 A;  4IOC A;  2I0Q A;  1XPU A;  1N32 Q;  1KRT A;  5FJ8 G;  3HOW H;  3KFU A;  4JBM A;  1VQJ A;  4PZ8 A;  3KF6 B;  4A93 H;  3NEL A;  2OTL A;  1SLJ A;  1GD7 A;  1PH7 A;  1VQN A;  2MQH A;  2PI2 A;  1EFW A;  2R6G A;  1HNZ Q;  3U50 C;  3KJP A;  1LUZ A;  3H3V H;  4MNO A;  1YNX A;  3RZO H;  4JI3 L;  4OWT B;  4B3T L;  5IP7 G;  3PUV A;  3I2Z A;  4JBW A;  1FGU A;  3S2H H;  4AQY Q;  2EQS A;  3I4M G;  5M3M G;  1E3P A;  1VQM A;  4Y7N H;  2ZM6 L;  2UXB L;  4R4Q A;  1OTC A;  1WCM G;  2EXD A;  2F52 A;  3CAM A;  5GQO A;  4JI1 Q;  3RLO A;  4YY3 Q;  3TRE A;  4IPC A;  3S14 H;  1H95 A;  3W1B A;  2KCM A;  2LXJ A;  2NVY H;  2K75 A;  3HFZ B;  4LF8 Q;  3M3Y H;  3E9H A;  1X3F A;  1BBW A;  5C44 G;  2D0P A;  4HIO A;  4GNX B;  3ICE A;  1YZ6 A;  2Q2T A;  2D0O A;  5C0X G;  2E5L L;  1HH2 P;  5C0X J;  1EIF A;  1S72 A;  2R7Z H;  4YHH L;  1Q86 C;  4BBS G;  4XIG S;  1J5E Q;  3FHW A;  4YWM A;  4GKJ L;  2JE6 I;  4LFC L;  3UDX A;  5C4J H;  1CSQ A;  1O7I A;  3IRB A;  1X3E A;  4A3E G;  2WB1 G;  4A3G H;  2N3S A;  1X6O A;  4LUZ A;  1N8R C;  1T9H A;  1VQP A;  2KHI A;  3E9I A;  5M5W H;  4DV5 Q;  1PH4 A;  1M90 C;  2DGY A;  4GOP B;  2E2I H;  5IYD H;  4IPD A;  2ZJR A;  3TRZ A;  3PV0 A;  1AE3 A;  1SRO A;  3CC7 A;  2F4V Q;  4DKA C;  4Y52 H;  3J81 i;  1KIX A;  1HNX Q;  4DV1 Q;  3CP0 A;  1JMC A;  5JJL A;  3M85 A;  4IFD I;  3D0F A;  4A3F H;  4ALP A;  3NEM A;  4UP9 A;  1N9W A;  1IBM Q;  4YCW A;  4A3C G;  2N78 A;  2R93 G;  2OCE A;  3K7U C;  4GLA C;  4XTC S;  3EN2 A;  4C3I H;  1I50 H;  1C0A A;  4A3M G;  1WOC A;  5IWA Q;  3HOV H;  5GAH C;  4JOI C;  4MZ9 A;  1S40 A;  1SMX A;  1PYB A;  3PUW A;  1HR0 L;  4K0K L;  4OO1 G;  2ZJP A;  1IBK Q;  1CSP A;  3M9B A;  5LMN L;  4O0A A;  1NBW A;  2CQO A;  2KHJ A;  3K80 C;  1B70 B;  4R1J A;  3I4N H;  4C3H H;  5H1S E;  1A0I A;  1EUJ A;  1HZA A;  4RG1 A;  3PSI A;  4J15 A;  4EX5 A;  4UP8 A;  3WWV A;  1X3G A;  2HHH Q;  3B6Y A;  1YVC A;  2Z0S A;  4B3S Q;  3ER0 A;  2JA7 G;  3J7A 5;  1HNZ L;  4HIM A;  5FJ8 H;  4UPA A;  4JI0 L;  4B3R Q;  1WJJ A;  2IHE A;  1K9M C;  4QL5 A;  2OWO A;  4JI5 Q;  4DR6 Q;  1D7Q A;  4JI4 L;  1PH9 A;  4LF6 L;  4AQY L;  4JI6 Q;  4OXP A;  1G29 1;  1KL9 A;  1X9N A;  4IPH A;  3GTK H;  1LYL A;  1UEB A;  1JT8 A;  1C7Y A;  1S3O A;  2AHO B;  2CFM A;  5IP7 H;  4YY3 L;  1YJW A;  5J3B A;  4BXX G;  3S15 H;  2VL6 A;  2C35 B;  4BBR G;  4JYA L;  1N34 Q;  1E7Z A;  1VQG A;  1L0W A;  3F2D A;  5M3M H;  1QVF A;  4LWC A;  3I4M H;  3D31 A;  3PF4 A;  5K36 G;  4DR1 Q;  2WAQ E;  1HJP A;  1WCM H;  3MXN B;  2V1C C;  4DR5 Q;  1V1Q A;  2ZTC A;  3U58 A;  4PZ7 A;  1VQO A;  2UU9 Q;  1OXS C;  3TQY A;  4A3D G;  3KJO A;  4DK3 C;  1YI2 A;  4GN4 B;  1J5E L;  2AKW B;  2WFW A;  1UE5 A;  2IHF A;  1Q8K A;  2JA8 G;  2WAQ G;  5C44 H;  5BR8 L;  1VQ6 A;  4A3K G;  1PV4 A;  2HQL A;  5JJI A;  1D8L A;  3T1Y Q;  2JA9 A;  4DV5 L;  2ID0 A;  2OQK A;  1K73 C;  2RF4 A;  4BBS H;  1XPR A;  1YIJ A;  1BBU A;  4A76 A;  1TWA H;  1WI5 A;  3T1H Q;  4LF7 Q;  3CCM A;  4GLV B;  1NMG A;  2VUM G;  4GKK Q;  2F4V L;  4L5S A;  4P71 A;  5AJ3 L;  4DR3 Q;  1AE2 A;  4A3E H;  1YHQ A;  4A75 A;  2LSS A;  4DV6 Q;  4DV1 L;  1KRS A;  1E22 A;  2PNH A;  3K7A H;  2VY3 A;  5ELO A;  1R9T H;  2BH8 A;  1LTL A;  1MJC A;  3W5O A;  3CME A;  5JEA G;  2VQF Q;  1EYG A;  5JEA J;  3I7F A;  3CCU A;  1IBM L;  4EQ5 A;  4DUZ Q;  1HR0 W;  1JE5 A;  4MTN A;  3TEH B;  3DLL A;  2K5N A;  5C4X G;  5EAY A;  1SRU A;  1XJV A;  5LMN W;  4IJL A;  3GD7 A;  4HJ8 A;  1NY4 A;  4DAY B;  1XMO Q;  3EIV A;  1XMQ Q;  2NVT H;  4KHZ A;  3RN2 A;  1PYS B;  4C3J H;  3S2D H;  4A3C H;  1YEZ A;  2R93 H;  1QUQ B;  3VDY A;  1P16 A;  4A3M H;  1BKB A;  2L15 A;  5C3E G;  4BY1 G;  1LM0 A;  3K81 C;  3HOU G;  2VW9 A;  2AWO A;  3AFQ A;  3RR5 A;  4FDB A;  4HID A;  5LMU Q;  2YTV A;  1JB7 A;  1V9P A;  2EIF A;  3I4O A;  4YWK A;  5FLM G;  4GLX A;  4B3S L;  3GDE A;  1IL2 A;  4A3L G;  3S1M H;  4AIM A;  1UE1 A;  3L0O A;  4DV4 L;  1PH6 A;  1VQ7 A;  4B3R L;  4B3M Q;  4JI5 L;  4DV2 Q;  2Q2U A;  3HOX G;  1EOV A;  1VQC A;  4GN3 B;  2UXD Q;  3ULJ A;  5DLQ E;  3S17 H;  1M1K C;  4JI6 L;  4LF4 L;  2JA7 H;  3UE0 A;  4DUY L;  4IOA A;  1Q81 C;  2BA1 A;  3KOJ A;  1IBL L;  2QGQ A;  2N8N A;  4H02 A;  2K4K A;  4KHP Q;  3OW2 A;  1PH5 A;  4LUO A;  3DM3 A;  2MFI A;  4LFA Q;  1MKH A;  2YTX A;  4JI7 Q;  4LF5 Q;  2GVA A;  4P72 A;  1N34 L;  1L1O C;  4LFB L;  2Z6K C;  2ASB A;  1NJI C;  4PZ6 A;  3GTG H;  3S1N H;  1J6Q A;  1VQA A;  3UDF A;  1K0R A;  4DR5 L;  4HJ7 A;  1PH2 A;  2UU9 L;  4BXX H;  2PI2 E;  4OX9 Q;  3Q8D A;  1I5F A;  4BBR H;  2VNU D;  4WJ4 A;  2CKZ B;  4O2D A;  1XNR Q;  3S1Q H;  2VS1 A;  2YU9 H;  3G71 A;  4DK6 C;  1Q82 C;  1QVC A;  3A0J A;  4X64 Q;  1N33 Q;  2RCN A;  1E1T A;  2XTI A;  5GAG C;  1K8G A;  4A3D H;  4IJH A;  1EQQ A;  1C9O A;  1VS0 A;  2JA8 H;  4HJA A;  3BZK A;  1B8A A;  1YHA A;  4DR3 L;  4A3K H;  2A8V A;  3UDG A;  2UXC Q;  1OXU A;  3UE1 A;  5IYC G;  1YHB A;  4X66 Q;  3CXC A;  5M3F G;  4NXN L;  2F3I A;  4DV0 Q;  4HIK A;  2IT1 A;  3M4P A;  1X55 A;  2VQF L;  2ATW A;  3AEV A;  2K5H A;  1QZH A;  2VUM H;  2IY5 B;  1N32 L;  2I5M X;  4ME3 A;  2YV5 A;  4HJ9 A;  1Q46 A;  3L7Z C;  1OXT A;  1HNW Q;  2ZTE A;  2ALY B;  4JV5 Q;  4A3J G;  3NBH B;  4OWW B;  4DR7 Q;  2CCZ A;  2KBN A;  1W3S A;  3K0X A;  4LF9 Q;  2NZH A;  4KI0 A;  2UUC Q;  4WJ3 M;  3CCS A;  5C4X H;  4X65 Q;  1PH3 A;  3F2C A;  3F1Z A;  3F8T A;  2E8G A;  1CKN A;  4X62 Q;  2D62 A;  1XPO A;  1L2F A;  5LMU L;  2XGT A;  3STB C;  4JI1 L;  1Y1V G;  2NN6 G;  4LNQ A;  1PH8 A;  3BU2 A;  3JC6 6;  2R7D A;  4IPG A;  1L1O A;  4A4I A;  2Z6K A;  5C3E H;  4DV2 L;  3A5U A;  1QZG A;  2JA5 G;  4BY1 H;  4LF8 L;  3H3V I;  3HOU H;  2B29 A;  1A62 A;  3H0G G;  3J80 c;  3G48 A;  2UXD L;  2UXB Q;  3AFP A;  5JJK A;  5FLM H;  4A3L H;  3HOY G;  2JQO A;  4R4I A;  2OTJ A;  1XNQ Q;  4L5R C;  2IX1 A;  1FL0 A;  1NTG A;  2MO1 A;  1Q12 A;  5HGQ A;  5IT9 c;  2GN5 A;  2ZJQ A;  1Z47 A;  4JG2 A;  3HOX H;  3K8A A;  4A3I G;  2UUB Q;  4JI7 L;  1VCI A;  4DAM A;  4LFA L;  1VQL A;  4QQB X;  3STB D;  4DV7 Q;  3GTL H;  3LGJ A;  2JK8 A;  5GRO A;  2K5V A;  3EBE A;  1TWC H;  3E0E A;  4YHH Q;  3PIP A;  2Y0S E;  3MEF A;  4DNI A;  3CCR A;  4LFC Q;  3GTM H;  4GKJ Q;  4RMF A;  2AMC B;  1BVS A;  2QEX A;  1XNR L;  1HNX L;  3I56 A;  2A1A A;  1N33 L;  4X64 L;  4X6A H;  1JJC B;  5HY6 A;  4DR2 Q;  2RHS B;  3KDF A;  3RZD H;  1KXL A;  4L5Q A;  3ULL A;  1Q1B A;  2UUA Q;  1KAW A;  3CC2 A;  1AH9 A;  2UXC L;  1E1O A;  3S16 H;  1SFO H;  5IWA L;  1GM5 A;  4NXM Q;  3KF8 B;  1N36 Q;  1IYJ B;  5IE8 A;  2CWA A;  2PQA A;  2GVB A;  1X65 A;  4L5T A;  3BZC A;  1PA6 A;  4A3B G;  4DV0 L;  1IBK L;  1YBY A;  1SR3 A;  4R4O A;  3S24 A;  4GNX C;  1I3Q H;  2IX0 A;  1VQB A;  4BA1 I;  4R4T A;  4YCU A;  4QY7 A;  1U0L A;  4JI2 Q;  5IYC H;  3J7Z C;  3CQZ H;  5IYB G;  3CC4 A;  5M3F H;  2R92 G;  4JV5 L;  2HHH L;  1EQR A;  1Q7Y C;  1IZ6 A;  4GN5 A;  4LF9 L;  1HZC A;  3U4Z A;  2UUC L;  2HIV A;  2I5H A;  4JC0 A;  2E2H H;  1EIY B;  2ZTD A;  4GOP C;  3A5Z B;  3UDI A;  4X65 L;  1YJN A;  3OTO Q;  4AYB E;  3PUX A;  4A3J H;  1PH1 A;  1SN8 A;  2NVQ H;  3CCL A;  2YTY A;  4KLK A;  4X62 L;  2JEB I;  2B63 G;  4JI0 Q;  1Q1E A;  1VQE A;  5IP9 G;  1XTD A;  4P74 A;  4BY7 G;  3RLF A;  4AYB G;  1VQ5 A;  4JI4 Q;  4LF6 Q;  1FJG Q;  5IY0 A;  3CCV A;  4IFD G;  1YJ9 A;  1VQ9 A;  4IFD J;  4POG A;  4DR6 L;  3KF6 A;  2A19 A;  1G6P A;  4YWL A;  4DR1 L;  2YYZ A;  2PMZ E;  2RHQ B;  1NE3 A;  1A63 A;  1Y1V H;  4TQU S;  1XNQ L;  1VQD A;  1VQI A;  1KHI A;  1NMF A;  4JYA Q;  4DV3 Q;  2JA5 H;  1ASZ A;  2UUB L;  1QUQ A;  3J81 c;  3FKI G;  1Z9F A;  3H0G H;  2I5L X;  3KYH C;  5E7N A;  3HOZ G;  1GVP A;  3HOY H;  2WB1 E;  4DV7 L;  1V43 A;  3T1Y L;  2NZO A;  2BA0 A;  4QJF A;  3PUZ A;  4A3I H;  3T1H L;  4LF7 L;  3AQQ A;  3HKZ E;  1P8L A;  3RN5 A;  4GKK L;  5BR8 Q;  4OON A;  3PO3 G;  1JJG A;  3PGZ A;  4POF A;  4JI8 Q;  4DV6 L;  1X54 A;  2JA6 G;  1U5K A;  1Y1W G;  3ERS X;  2VQE Q;  1KD1 C;  4DR2 L;  4GNX A;  3HKZ G;  3PO2 G;  3I55 A;  4GS3 A;  3OYY A;  4LUV A;  3M4Q A;  5AJ3 Q;  1QVG A;  5C0X I;  1I94 Q;  4DUZ L;  2UUA L;  3HOW G;  1CKM A;  4QGU A;  4DR4 Q;  3PF5 A;  2BH2 A;  2E2J H;  4A93 G;  1CKN B;  1HZ9 A;  2DUD A;  2R7F A;  3M7N A;  4NXM L;  1XMO L;  1N36 L;  1KQS A;  1XMQ L;  1KC8 C;  1JJ2 A;  4GOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...