1GVPA

Gene v protein (single-stranded dna binding protein)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Analyses of the stability and function of three surface mutants (R82C, K69H, and L32R) of the gene V protein from Ff phage by X-ray crystallography.
pubmed rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 11
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1997-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1gvpA00
4BA2I 3W1GA 4JI8L 3PCOB 4JV5Q 2PNHA 4BY1H 3ZJYC 2IY5B 1VQOA 4GN3B 4P72A 1J6QA 4IFDG 1VQ6A 5M3MG 1V43A 3NENA 1SE8A 2D0PA 4X64L 3HOZG 4IPCA 1HNZL 1PVOA 1UWVA 2QGQA 4BBSG 4BXXH 1VQEA 2V1CC 4LFBL 3JC66 2UUCL 3BJUA 1YIJA 2I5HA 2CWPA 1U5KA 1PYBA 2JEAI 5GQOA 2NZOA 1PH2A 2QA4A 4KHPL 3I2ZA 3HOVG 2Z6KA 4LF9Q 3PO2H 1K9MC 3U4VA 3KJOA 4YY3Q 2NN6G 1C0AA 3MXNB 4GLVB 5IP7H 3U58A 5BR8L 2JA5G 3HOWH 5M5YH 2ATWA 1I50H 4R4CA 3CMEA 1VQ7A 2JA6H 4ALPA 1Q81C 1XMOQ 4KHZA 5AJ3L 1X9NA 1YHAA 4YCUA 1VQHA 5IP9G 4X65L 1IBML 1IBKQ 4GN5A 1T9HA 3B6YA 2YYZA 1UE5A 4DUYQ 1E7ZA 2VL6A 1SFOH 1IBLL 4JI0Q 4A3FG 2A8VA 3UDGA 3A5UA 1AH9A 1N36Q 4A3IG 3CQZH 2WP8J 3OYYA 4OX9Q 3F2DA 2IX1A 4DR5L 3CCMA 3FP9A 2UUBL 3S14H 1LM0A 3S1NH 2UXCQ 4R4TA 4UP7A 4YCWA 1K83H 3TS2A 3I4NG 2ZJPA 4LF4Q 1N33Q 4B3RQ 4LF9L 4YY3L 3GTGH 3H15A 2KHJA 4MTNA 1Q1EA 2WAQG 5IY0A 4LF5L 3EBEA 1CKNB 4OXPA 1HR0Q 3CC2A 2CWAA 2B3GA 4YCVA 3J80c 3A5ZB 1XMOL 1VS0A 2K4KA 1G51A 2WAQE 1GVPA 1MKHA 1Q8KA 1VQCA 2VQFQ 1EUJA 3PO3G 3A0JA 1X55A 2UU9Q 4JBMA 3HOXH 1EYGA 1YVCA 1Z9FA 4DUYL 1KAWA 4JG2A 4JI0L 4LNQA 3ERSX 2RCNA 1MIUA 4JI5L 3PIPA 5LMNL 2VQEQ 4A76A 3ICEA 1KRSA 2OCEA 4ME3A 1N36L 3PUWA 2GVAA 4A3GG 1SRUA 1VQLA 1TWAH 3CAMA 3TS0A 4B3SL 2E2HH 5JEAJ 3J7ZC 2N8NA 3S1QH 4DV0Q 1KQSA 4LF4L 2ASBA 4B3RL 1V1QA 4A3BH 3GTMH 2PQAA 2OTJA 4GKJL 4DV6Q 4YWKA 1NBWA 4EQ5A 1HR0L 2E5LQ 2B63H 1I6HH 5IT9c 4P73A 4B3TQ 2MFIA 1FGUA 2Z6KC 3RR5A 3RNUA 4JI6Q 4UY8C 4X62L 1Z47A 2AKWB 2AMCB 3W5OA 3GTQH 3BZCA 2VQFL 3GTKH 4IO9A 1VQFA 2L15A 2BA0A 1GM5A 1JMCA 2NVTH 1EQQA 4JBJA 1CUKA 4HIKA 2ES2A 2N78A 1FJGL 2WFWA 3PUYA 5HY6A 3PUXA 1YBYA 3AFPA 3BZKA 3G71A 2QEXA 2VQEL 1L2FA 3F2CA 4LFCL 3OTOL 4DR4L 1N32Q 4YWMA 1YNXA 5IYCG 5ELNA 1WFQA 1J5EQ 4QL5A 1GD7A 2LSSA 4DV0L 4HJAA 2KBNA 1X3FA 1OXSC 4BBRH 4A3EH 1Y1WH 4B3ML 3K8AA 3KLWA 1TWCH 1XJVA 2JA7G 5IYBH 1EIYB 4DV1L 1HNZQ 1WI5A 5FJ8H 1TXYA 3GO5A 1BBWA 2JK8A 1GO3E 3CPFA 1Q7YC 2E5LL 1D8LA 3NEMA 4DV2L 5JEAG 2VW9A 1PH9A 2JA8G 4DV4Q 4XIGS 3GTJH 3HOUH 4MNOA 2KENA 2A1AA 1FVIA 4BY1G 1WJJA 4O2DA 2HT1A 4NXMQ 4K0KQ 5FLMH 3L7ZC 3A74A 3CP0A 5BR8Q 1QZHA 2BH8A 1I3QH 1VQ8A 3J7A5 3CCSA 1XNRQ 4NPSA 2HIVA 5AJ3Q 1S3OA 4DR2L 2C35B 1L1OB 1Q12A 4BXXG 4IOAA 4IPDA 1HNWQ 2LXJA 1N32L 4X6AH 3RLFA 4X65Q 1N8RC 4HIMA 5JJIA 1IBMQ 2YTXA 3ULLA 1J5EL 2JEBI 4L5SA 3I56A 4AIMA 1YITA 3PO2G 1TWGH 1IBLQ 1X3GA 1W3SA 4EX5A 1EFWA 1QUQA 1KC8C 3M3YH 4QQBX 2WB1G 3OW2A 1NMGA 5IP7G 1HJPA 4JOIA 1PH8A 3HOWG 1UE1A 1PV4A 1E3PA 3H0GH 1SN8A 1SROA 3ULJA 1Q82C 3UDXA 4JCVE 4HJ7A 2JA6G 4DR5Q 1Q86C 1RL2A 1CKMA 2UUBQ 1AE3A 2WB1E 1EIFA 1BBUA 2H5XA 4DV4L 3VDYA 4LUVA 2LXKA 2AHOB 2K75A 3M4OH 1OXUA 3S2DH 4IOCA 3S2HH 2Z0SA 4X66Q 1B70B 4DV7L 3JAMc 4NXML 4K0KL 2EQSA 1QVCA 4TVAB 3W1BA 3I55A 4R4QA 1YZ6A 4LF5Q 1HZCA 1CKOA 2ALYB 3E0EA 4QGUA 1VQIA 4MZ9A 1XNRL 1OXTA 2VUMH 1U0LA 1VQGA 1YHBA 2VY3A 1HNWL 3TEHB 3KDFB 1PH1A 2R7DA 1XPUA 2IHEA 2R7ZH 1L0WA 2PMZE 2R93H 4OONA 2N3SA 3GDEA 3STBD 2Q2IA 3J81c 1LUZA 1WCMH 4DV3L 2AWNA 4LF6L 4A3DH 4JI5Q 5LMNQ 5C3EH 3EIVA 1LYLA 3RN2A 5IE8A 1UE7A 2BH2A 4OO1G 4XTCS 1K73C 4H02A 1RIPA 4B3SQ 2YU9H 5C0XG 1N9WA 4DUZQ 1O7IA 2YTYA 4A3JH 2D0OA 2YV5A 1SR3A 3F8TA 3H3VI 4X66L 3HKSA 2D62A 4DK3C 1C7YA 2EIFA 3HOXG 4GKJQ 4BY7H 2IHFA 5J3BA 1OXVA 3GTLH 3HOYH 5HGQA 3S24A 3KF6A 4DV5Q 1NMFA 5C44H 4HIDA 1HNXL 4X62Q 4A93H 3PIOA 2ZJRA 1E1OA 4R4IA 1FJGQ 3CCQA 5M3FH 1EWIA 2KCMA 1Y14B 2OTLA 1VQKA 2I5MX 4A3BG 1IYJB 4GNXA 3CCLA 4LWCA 3KOJA 3Q8DA 3OTOQ 4LFCQ 4DR4Q 4OWWB 2B63G 4PG3A 4DPGA 1FL0A 1QVGA 1BKBA 4DUZL 2K14A 2HHHQ 3UDFA 1I94Q 1E1TA 1WOCA 4JOIC 4B3MQ 4IFDI 4A3CH 4YWLA 2F52A 3F1ZA 3CCUA 4DV1Q 2ZTCA 4P71A 3K81C 2ID0A 5E7NA 2R92H 1CSPA 3M9BA 4DV2Q 5LMUL 4NB3A 2DGYA 4DV5L 3S1MH 4DK6C 5EAYA 3J80i 2AWOA 5C4JH 1QUQB 1PH6A 1OXXK 4QIWE 3T1YL 1Q1BA 3T1HQ 1M1KC 1M90C 1HZ9A 5LMNW 5IYDH 4JI4Q 2NN6I 2Q2UA 4BBRG 4A3EG 2OWOA 3CPWA 1I5FA 1Y1WG 1YI2A 3PGZA 3L2PA 1PH3A 2BA1A 4R4OA 3U50C 5IYBG 3HFZB 5FJ8G 1ASZA 4DR2Q 1YJNA 1K8GA 2K5NA 4GOPA 1VQ9A 3PUVA 2XGTA 1BVSA 2MO1A 3HOUG 3M4QA 2HHHL 1LTLA 1HR0W 2K5HA 2KCTA 4APVA 1KIXA 1I94L 5FLMG 1SMXA 4LF7Q 1NJIC 1C9OA 1DGSA 5DLQE 4GLXA 4DR6Q 1A62A 1P16A 2K50A 1PHJA 3I4MH 1EQRA 4DAYB 1JT8A 3F2BA 2DUDA 3DM3A 4KLKA 1B7YB 2UXDQ 2NZHA 4JI3Q 4A3LH 1D7QA 3T1HL 1MJCA 4DV7Q 1X3EA 4C3IH 3STBC 3L0OA 4JI4L 1XTDA 1VCIA 1GKHA 1CKNA 1P8LA 4PZ7A 3RLOA 4JC0A 1VQBA 4QJFA 1E22A 1XMQQ 4JI7Q 3ER0A 5IWAQ 3GD7A 2R6GA 1Q46A 3H0GG 1VQNA 1EOVA 1YJ9A 2ZTDA 4IJLA 3I4MG 1VQ5A 2ZTEA 3KF8B 1NTGA 5C0XJ 2UUAL 3LGJA 5GAHC 4GNXC 1ASYA 4C2MH 1PA6A 5JJKA 1KHIA 3K7UC 4DV3Q 4LF6Q 1XNQQ 5ELOA 1MJEA 2MNAA 3SGIA 4LF7L 2PI2E 3H3VH 3I4OA 4JI1Q 4JBKA 4DR6L 5H1SE 1X65A 3FKIH 4A3MH 4WJ4A 2VUMG 4DR1Q 1XPRA 4AYBE 1K0RA 2I0QA 1XPOA 2Q2TA 1UE6A 4GNXB 2OQKA 1JJ2A 2UXDL 4JI3L 3K0XA 2R7ZG 2K5VA 3PSIA 2R93G 2N49A 1G6PA 5C4XH 2Y0SE 1WCMG 4LUZA 4HJ9A 1Y1VH 4OWXB 4GKKL 3CCRA 4A3DG 1JJCB 4A3KH 1CSQA 2JE6I 4AH6A 5C3EG 1XMQL 4JI7L 1HNXQ 3I7FA 2B29A 5IWAL 3M7NA 1HZAA 2PQAB 1SLJA 2VZAA 4LFAL 2MQHA 3PUZA 4JI2Q 4A3JG 4LW1A 1PH4A 3ULPA 3M85A 1PYSB 3CW2C 3UE0A 1XNQL 1OTCA 4UP8A 4OWTB 1KL9A 2NVYH 2RHQB 3BU2A 4C3HH 4Y7NH 4GS3A 3G6EA 1S72A 4BY7G 4GOPC 1H95A 5GADC 5M3MH 4JI1L 2MO0A 4DR7Q 3HOYG 3AYHB 4QY7A 2ZM6Q 3GTOH 3G4SA 1HZBA 4TQUS 3HOZH 4DR1L 5C44G 2UXBQ 4POFA 1VQAA 2F4VL 4BBSH 4IPHA 4RMFA 4A93G 3FHWA 4DNIA 3M4PA 3J81j 4GN4B 5JJLA 4BA1I 3K80C 3E9IA 5M3FG 4UP9A 1PH5A 3PF5A 2EXDA 3HOVH 3JAMi 4GOPB 4JV5L 1K3RA 2GN5A 5LMUQ 2IT1A 2JA5H 1VQDA 3IRBA 4R1JA 4AQYQ 3T1YQ 4YHHQ 2E2JH 1X54A 2NVQH 3U4ZA 3GTPH 4FDBA 3TQYA 4A4IA 4A75A 4HJ5A 4JI2L 2XTIA 2F3IA 1QVFA 4HIOA 2OQ0A 5IP9H 3J81i 4HJ8A 4NXNQ 4L5RC 2YTVA 4A3CG 1NY4A 1UEBA 3UDIA 3CCVA 3RZDH 3CXCA 3I4NH 4PZ8A 2I5LX 1L1OA 3UE1A 1R9TH 4A3FH 2R92G 4DR7L 2ZM6L 5FLXc 1VQJA 4O0AA 3E9HA 3CMAA 4LF8Q 3S15H 3S16H 3D31A 2UXBL 2FXQA 4A3IH 4JYAQ 4UPAA 3RN5A 3TRZA 1G291 1VQPA 5IYDG 2VS1A 1TWFH 1KXLA 4P75A 2JA9A 3KYHC 2NVXH 3CCEA 4IPGA 5GAGC 1IBKL 2HQLA 4RG1A 3RLNA 2ZJQA 1K8AC 4LUOA 4IJHA 3CCJA 4AQYL 4YHHL 3PF4A 5M5XH 1IL2A 4OX9L 3PO3H 1YJWA 5M5WH 2UXCL 4NXNL 3G48A 2PI2A 3EN2A 1KRTA 3CF5A 1W2BA 1A63A 1N33L 3AEVA 5GROA 4KI0A 1VQ4A 5K36G 2E2IH 2R7FA 3S17H 3AQQA 3KDFA 4DKAC 4DR3Q 1AE2A 1N34Q 4LF8L 4A3GH 2UUAQ 4JYAL 4A3LG 3CC7A 2GVBA 4P74A 1X56A 2HIXA 3AFQA 4J15A 2IX0A 1S40A 4OO1I 1YHQA 2UU9L 2RHSB 3NBHB 3K7AH 2CCZA 3S1RH 1A0IA 2K52A 5C0XI 4IFDJ 1JJGA 1E24A 4L5QA 1V9PA 3KJPA 3HKZG 4PZ6A 2JQOA 1YEZA 3PV0A 4C3JH 1PFSA 4JI8Q 4GKKQ 2RF4A 4L5TA 4WJ3M 2CFMA 3HKZE 4GLAC 3RZOH 3D0FA 1KD1C 1TWHH 3NELA 4DAMA 3FKIG 2CQOA 4PMWA 4X64Q 4DV6L 4LFAQ 4A3MG 3CD6A 4DR3L 1N34L 4POGA 3KFUA 4LFBQ 1WYDA 1JE5A 1NE3A 2Q2HA 3DLLA 2UUCQ 2KHIA 3KF6B 2JJQA 5IYCH 4B3TL 2VNUD 4JI6L 1L1OC 5GAEC 4AYBG 1VQMA 3CC4A 4KHPQ 5C4XG 1IZ6A 1Y1VG 1PH7A 2E8GA 3WWVA 4A3KG 1QZGA 2JA7H 4Y52H 2CKZB 1A8VA 2Y0SG 2A19A 2F4VQ 1JB7A 2JA8H 1IXRA 3MEFA 4JBWA 3TREA 1X6OA 1HH2P 1B8AA
chains in the Genus database with same CATH superfamily
3CRKC 4JV5Q 1VQOA 4C3HG 2WACA 4P72A 2A6ED 2VB3X 1VQ6A 4IFDG 2B2TA 1KLUD 3NBIA 4X64L 3HOZG 2F1MA 2V1CC 3VYTA 3C46A 3JC66 3BJUA 1YIJA 1MSGA 2JEAI 1G2TA 1IL8A 1SE4A 2NZOA 2QA4A 3M3YB 4KHPL 3HOVG 3U4VA 5LL6X 4YY3Q 3MXNB 3HOWH 1STYA 2ENBA 2M00A 2G5DA 4R4CA 3WDNA 3CMEA 1VQ7A 2JA6H 2FMMA 4ALPA 3PO2B 1O7LA 2EE1A 4XT3B 5AJ3L 3M4OB 2R3ZA 5EKLA 4X65L 2XIWA 3VA5A 3W3AA 4ZK9B 4DAYA 1B44D 2VL6A 3QOLA 3PIP3 4P2CB 3K58A 3HGBA 3KBXA 3UDGA 3A5UA 2MGSA 3K59A 4A3IG 4RH6A 4OX9Q 2R93B 2UXCQ 2UUBL 1LM0A 1WTPA 3VR6A 1K83H 4LF4Q 4LF9L 1DZ1A 3GTGH 4MTNA 1Q1EA 2WAQG 3CQZB 1S5BD 2NYZD 3S14B 3S1NB 4KN7C 1M8AA 4YCVA 1K0SA 1K28A 5C0XH 3NQTA 2WAQE 1MKHA 4F7XA 1IYVA 2KQ3A 4BY7B 1TKWB 2UU9Q 3GTLB 1K8OA 1EYGA 4DUYL 1KAWA 4LNQA 3ERSX 4CDEC 1STNA 2RCNA 2VQEQ 1GXDC 1LABA 3ICEA 2GVAA 1SRUA 3JAML 3HP3A 2F4IA 2HD3A 3J7ZC 3S1QH 1WD1A 1KQSA 4JK1C 2ASBA 3BZDB 4EVOA 4B3RL 4DFAA 1HXYD 2PQAA 2OTJA 1EL0A 4YWKA 1EY6A 2EY2A 3GQBA 2F0WA 2E5LQ 3RNUA 2EYMA 2B2YA 3F2UA 3W5OA 3A8JE 5I6YA 1GM5A 1VQFA 3LWEA 2BA0A 3GTKH 1ICFB 1FJGL 2B63B 3MA2B 3G71A 2F0UA 1I4GA 3F2CA 3OTOL 4DR4L 1WFQA 4QIWB 2CW0D 4DV0L 1GD7A 2EPBA 2LSSA 3Q24A 5D3DA 4HJAA 1Y1WH 4NMZA 4B3ML 3K8AA 1CHPD 1XJVA 1LTSD 5I9OA 1TXYA 1GO3E 1EY9A 4DV2L 1S5DD 2VW9A 4IUVA 4DV4Q 4XIGS 2C5CA 4MNOA 1EY8A 2KENA 2OXPA 2A1AA 2EY1A 4N9TA 1FVIA 3A74A 3CP0A 1QZHA 3J7A5 4F87A 4NPSA 2HIVA 4DR2L 1Q12A 3MFGA 1HNWQ 3NTHA 1D1KA 4DGZA 5JJIA 2YTXA 1MI2A 3ULLA 1J5EL 1NR4A 1YITA 3PO2G 3TDQA 3M3YH 1PH8A 3AU7A 3I72A 5IP7G 1PV4A 4QCLA 1SROA 1Q82C 5FOBB 4JCVE 2O4XA 5J1ZA 3VDYA 2X6GA 3MWYW 2AHOB 3M4OH 3AB9A 3JAMc 2EQSA 3X3NA 5KNBA 1A15A 3SXHA 1CKOA 2K5DA 2Z9HA 5ELBA 4FF3A 3I70A 3TSSA 2KHSA 5CV5A 3E6ZX 4DA2A 1U0LA 4RFBA 1AP0A 4CKEA 4AYBB 4I65A 2IHEA 2XNAC 2R93H 1Q8IA 3GDEA 1EZ6A 4X3TA 3J81c 4DV3L 4LF6L 2Y0SB 5LMNQ 1UE7A 4QMGA 2L12A 2N55A 3VR3A 5EQ0A 1BF4A 1SJED 3TZDA 2YTYA 1HA6A 4G7HC 3R2TA 4IUPA 3F8TA 3H3VI 4DK3C 1NR2A 1VF7A 4BY7H 4DU9A 2IHFA 3KF8A 5J3BA 3OMGA 3GTLH 2DY8A 2RDHA 4HIDA 1PRTD 2KEEA 2ZJRA 4U68A 3CCQA 4MTKA 3FPUB 4J1MA 3X3MA 2OTLA 4I7AA 2JA5B 1IYJB 1CZWA 2L0CA 2F0QA 3CCLA 2E2JB 2QDLA 1LT3D 4LFCQ 4OWWB 2B63G 2ZXPA 4WFN3 4DPGA 2HQEA 1J9OA 2HHHQ 1YNJD 1I94Q 3GV3A 3I4NB 2H1EA 4A3CH 4A3FB 4FVMA 3CCUA 4DF7A 2ID0A 5E3FA 4KJOA 3S16B 1CSPA 4NB3A 1JCKB 5EJWA 3J80i 4QIWE 1Q1BA 2TMPA 2QF7A 5IYDH 1STAA 4JI4Q 2Q2UA 2OWOA 3CPWA 2QDBA 3U50C 2A69C 4FXGC 3HFZB 1WTXA 5FJ8G 1LT4D 2K28A 2XGTA 3BG3A 3HOUG 4R9WA 1LTLA 2FINB 4APVA 1DXMA 5FLMG 4ZKCB 4K2KA 4FF4A 1EEID 3NE5B 5K36H 1PHJA 4M8AA 3F2BA 5CGKA 2NZHA 1GUGA 4G57A 5DM73 3T1HL 1MJCA 4FO2A 3STBC 1CKNA 3K7AB 4PZ7A 3RLOA 4DXFA 3H0GG 1Q90A 2ZTDA 3I4MG 4C3JB 2B2WA 3KF8B 4IURA 5DAUA 5KRUA 4GNXC 1ASYA 4C2MH 3RZOB 1KHIA 2K01A 5G3LF 1XNQQ 1MJEA 4H0LC 3D3RA 4DK0A 2B2VA 1BCPC 4DR6L 1QWYA 2PCFB 1KLGD 1XPRA 4AYBE 2Q2TA 5FO9B 2F0DA 1JJ2A 2PZUA 2K5VA 2Y0SE 4BS9A 4HJ9A 1PDQA 3MFYA 4A3DG 1SNMA 1XMQL 3DWQA 4JI7L 1HNXQ 5IWAL 1HZAA 3P75A 2VZAA 1TS2A 2F03A 1L0XB 5IGEA 3PUZA 1Y1VB 1EIHA 4JI2Q 4IALA 1PH4A 4N8FA 4U673 3CW2C 2EJMA 3C1FA 1KL9A 3BU2A 1S72A 1XXGA 3OOCA 4GS3A 3NWTA 3G6EA 2EJGC 4QF4A 2MO0A 4JI1L 4DR7Q 2ZM6Q 1ICWA 1PTOB 4POFA 2K5QA 2F4VL 1KTKA 3SK4A 3FHWA 1GJXA 4DNIA 4BA1I 3K80C 3E9IA 5M3MB 3DEPA 2WB1B 4C1NI 5M5YB 2NN6H 1I50B 2KOLA 2IT1A 2IWHA 2JA5H 3IRBA 3OW7A 4R1JA 5D3IB 4AQYQ 1G2SA 2E2JH 1J8IA 1WD0A 4EQPA 4HJ5A 5C4HA 1QVFA 5IP9H 1I4XA 1UEBA 3AMUA 3I4NH 1XTCD 3A8KE 2I5LX 3UE1A 4A3FH 2R92G 1QNUA 1CQFA 2K6AA 4IUNA 2KEDA 5C5LA 1VQJA 3S15H 3S16H 3EROA 4UPAA 3TRZA 1VQPA 1WTRA 2VS1A 1TWFH 5BN5A 1R9TB 4UHVA 1VDZA 2JA9A 4CKBA 2L11A 3CCEA 4RG1A 2ZJQA 4IUUA 4KY6A 4C56C 1QILA 4YHHL 3W2DA 1SEBD 4CDCC 3PF4A 2F0SA 3VYRA 4ZCKA 5E4WC 3DHQA 1I4RA 5GROA 4DKAC 2DJGC 4IUQA 4ZKBB 4DR3Q 1TWAB 1N34Q 4LF8L 5M5WB 1B50A 4C3IG 3A8IE 2IL8A 1RTOA 1S40A 1YHQA 3MVVA 3K7AH 1C48A 1A0IA 3MHBA 5C0XI 1TS4A 4ID6A 4IFDJ 2KUMA 3GTQB 1YEZA 3FPPA 3PV0A 4C3JH 1PFSA 1PFMA 2Q8IB 3V05A 3RZOH 3D0FA 4HCEA 1B9MA 4X64Q 1BCPF 4LFAQ 3KFUA 1BR9A 1PFNA 1NE3A 1WYDA 2EY5A 2Q2HA 5ELFA 2KHIA 1CM9A 3KF6B 3J7YW 3H94A 4OEMB 4B3TL 4BBRB 5I6WA 4JI6L 1L1OC 4KHPQ 2RDFA 1Y1VG 2B8GA 1IKLA 5ELCA 1PH7A 1DCZA 5CV9A 4A3KG 3CU7A 2CKZB 1TY0A 2A19A 3K57A 3FEWX 1GHJA 3TREA 1AZPA 3NQIA 1U9RA 2HUGA 3W1GA 2IY5B 1NNXA 2PNHA 3ZJYC 5JVH3 5BN3A 5IGDA 2A74C 2RKSA 4DK1A 3IFDA 5M3MG 1HUNA 3NENA 3IFTA 4RA8A 1HNZL 1UWVA 2QGQA 5J22A 4BBSG 5FLXE 5FO7B 1PTOH 2UUCL 1TWGB 1JWSD 3RUZA 1PH2A 4LF9Q 2KCNA 4GLVB 2R61A 4CHTB 5M5YH 5T1GA 1I50H 4HR7B 5AFWA 1X9NA 1RDPD 1RF2D 4YCUA 1VQHA 3ONAB 2QILA 1HUMA 3A7AB 4RWSC 1IBML 3I90A 1IBKQ 1A6XA 4DUYQ 1T9HA 1IBLL 2VUMB 2O5JC 5FK9C 3KK7A 4ULLA 3OYYA 2IX1A 5CV4A 4X3KA 3FP9A 3CCMA 4DR5L 5I9PA 4R4TA 4B3RQ 2LY7A 1CA6A 3H15A 3EBEA 1CA5A 2YU9B 2CWAA 2B3GA 3J80c 4A3JB 3A5ZB 1XMOL 1VS0A 3EFXD 5F2DA 1PMRA 1Q8KA 1VQCA 2RA4A 1EUJA 1LO5D 3PO3G 1V8QA 1X55A 4JBMA 3V96A 3HOYB 1MGSA 1YVCA 4JI0L 4JI5L 4A93B 5IIFA 1KRSA 2OCEA 4ME3A 4CJ0B 4ODGA 1TWAH 1ENFA 1KNAA 1QJOA 1Z6HA 3QO2A 4DV0Q 2B2TC 1V1QA 1C4QA 4GKJL 4DV6Q 4KKSA 3T51B 1NBWA 4EQ5A 1HR0L 4ABNA 1HQMC 4P73A 1D1IA 1IW7C 2V4DA 4X62L 2K05A 3EJIA 1UAPA 1TR5A 3GTQH 1DONA 2L15A 1EQQA 4JBJA 3MZ5A 2WFWA 3IAYA 5CV7A 1SNCA 5ELNA 2X6LA 3TMEA 3QWNA 1J5EQ 1WTWA 1X3FA 1OXSC 4BBRH 1IHZA 4ZRZA 2EY6A 4DV1L 2CH4A 3JAME 1BBWA 3CPFA 1PRTF 3NEMA 5JEAG 2L55A 1HTLD 2XSCA 1NCVA 1EU4A 1WJJA 4O2DA 1HTPA 5BR8Q 1VQ8A 4G4KA 1ML0D 2F0JA 3VR5A 3CCSA 5C6AA 1L1OB 4IPDA 2LXJA 1CFMA 4HIMA 1MD2D 3I56A 4AIMA 1FGBD 1TWGH 1HFNA 1X3GA 1KC8C 1ZXTA 2A69D 3HOWG 4XYQA 1UE1A 3HKZB 1SN8A 3ULJA 4HJ7A 2JA6G 1Q86C 1CKMA 1AE3A 1PFBA 2H5XA 2Z8LA 2XVSA 2K75A 4IOCA 4NXML 1GUWA 1QVCA 4LF5Q 4JPBW 2JXMB 3E0EA 2B2YC 1XNRL 2VUMH 1O7ZA 1VQGA 3TEHB 1K8MA 5DNFA 5C4XB 1XPUA 2R7ZH 1L0WA 2N3SA 2XRQD 3STBD 1EEFD 2Q2IA 1WCMH 4HMIA 2F0OA 1LYLA 2WIIB 1K73C 4H02A 1RIPA 1PLFA 2KCCA 4B3SQ 2YU9H 5C0XG 1N9WA 5IT9E 1O7IA 4HCSA 5JPMC 5LL6S 2D0OA 4A3JH 4Y7NB 1SR3A 3BDCA 1HA5A 3HKSA 2BDNA 1S4ZA 2EIFA 4HSVA 3D6CA 3H91A 3K5NA 1OXVA 3KLRA 3HOYH 1BCPD 2MPMA 1NMFA 2G9HD 4A93H 1DD2A 3PIOA 1HFGA 5M3FH 2KCMA 1KNEA 1VF5C 1X32A 2I5MX 3ERQA 1VQKA 3A7LA 5EGTA 4J6HA 5CBEE 2JN4A 1O78A 3TP8A 1PZID 3SVMA 2E75C 2C9OA 1RD9D 2CVRA 4DUZL 1X3QA 3MC0B 1E1TA 3OIQA 4HSPA 3U9OA 4YWLA 4OGQC 3K81C 5CR3A 5LMUL 1G91A 1B4OA 4DV5L 3J81L 5EAYA 1EOTA 3T1YL 2FJ2A 3T1HQ 4KD3A 2OEOA 4G7OC 1M90C 1HZ9A 2M2LA 4QUCA 2NN6I 1Y1WG 3PGZA 1HCZA 1PH3A 4R4OA 4RAUC 1STGA 3MXPA 1G6ZA 1TQOA 4GOPA 1VQ9A 2E74C 4K8JA 1HHVA 5IGCA 1KIXA 3TP7A 2Q8TA 1H9RA 3EQLC 2E2IB 3OWFA 1NJIC 1DGSA 1EY7A 5DLQE 4GLXA 4DR6Q 2K50A 4A3GB 4H7BA 4DAYB 5COYA 4A3LH 2MP1A 4DV7Q 1PZKD 5HGTA 1VCIA 1NAPA 2FFKB 3S1RB 4FXKC 3OIPA 1XMQQ 1EY5A 4JI7Q 1SNOA 1EYCA 5IWAQ 1YJ9A 3R8BA 3NTKA 1VQ5A 2X69A 2N88A 1NTGA 2ZT9C 1LT6D 2NTSA 1A2TA 3LGJA 5GAHC 2UUAL 5EBDA 4WRDA 3K7UC 4O42A 3H3VC 1TWHB 3SGIA 1T5XD 4S3SA 3VYUA 4LF7L 3I4OA 4JI1Q 5ELEA 5H1SE 1I4HA 1EQVA 4A3MH 4WJ4A 4C2MB 2NWGA 2I0QA 1XPOA 5ELDA 4CDFC 2UXDL 4JI3L 2J7ZA 4KY7A 2R93G 1G6PA 2N49A 3SDZA 5C4XH 4LMQD 2JA7B 1WTVA 4GKKL 1B3AA 1CSQA 2JA8B 4TRDA 2PQAB 4HTHA 1SLJA 4K5XA 1D5MC 1E2WA 1PTOC 4BY1B 3K5MA 4LW1A 1DJRD 2K5WA 4C1NK 1ILPA 1PYSB 3OSOA 4OWTB 4Y7NH 4BY7G 3SHLA 2K33A 2DJFC 4WORA 3QOJA 4IPHA 3WOFA 1EWHA 4GN4B 1XYIA 2FMCA 4UP9A 1E2ZA 4GOPB 4JV5L 1K3RA 2GN5A 1D5XC 4K5VA 2L1BA 3FDTA 4PMBA 4PMCA 4YHHQ 1BQQT 2KECA 3U4ZA 3CKIB 1LTAD 3CHBD 4HJ8A 1SFOB 4CKCA 5C3WA 4A3CG 3UDIA 2G9DA 2NBFA 4PZ8A 1K3BC 2B2WC 2NUCA 1LTID 1NSNS 4LF8Q 1CZGA 4RCOA 2FXQA 1SE2A 1BO0A 3MXUA 1SDFA 1G291 1FR3A 1U4MA 2PNRC 2BDOA 5IYDG 1KXLA 1F9SA 2B2VC 1MBYA 2A73B 3KYHC 2AQ1B 3S15B 1A3UA 1SBBB 5GAGC 2Z1CA 3DUZA 4OL7A 3LX0A 3SEBA 1TWFB 5J39A 2SOBA 3EA6A 4KK7A 2K04A 2RDGA 4OX9L 4K2LA 3HOXB 1FD7D 2UXCL 1YJWA 4NXNL 3G48A 2PI2A 3EN2A 3G7LA 1ZKOA 2F0EA 4KI0A 5K36G 2E2IH 5TSSA 3C1EA 1T5EA 3KDFA 5LHY1 4A3GH 3R3OA 4ZUIA 1X56A 4UAIA 3GTMB 2HIXA 1SSOA 4J15A 1U4RA 2UU9L 2RHSB 3S1RH 4L5QA 4XQQA 2JQOA 4PQXA 2IJ0A 4WJ3M 2H4OA 3QIAA 1KD1C 1TWHH 3NELA 2CQOA 3D4WA 3C2PA 3E0JA 2UUCQ 2SNSA 5IYCH 2VNUD 4A3EB 3CC4A 5GAEC 4AYBG 1TWCB 3N52A 3BDOA 1RHPA 2JA7H 4Y52H 2Y0SG 4XDXA 4EGVA 3A55A 2JA8H 1IXRA 2IW3A 4MN3A 4JBWA 1IW7D 1S5CD 1X6OA 1B8AA 4JI8L 3PCOB 3CRLC 4BY1H 1I3QB 2PW7A 4GN3B 1J6QA 1STBA 2OT2A 1V43A 5D65A 1SE8A 5I2XA 4LFBL 3NSWA 4BXXH 2JSOA 1JOKA 1JWMD 2AUKA 5CC4A 3U9SA 1I6VC 2CWPA 1RODA 4H13C 5GQOA 3RMHA 2Z6KA 4F88A 1K9MC 3KJOA 3LWUA 2NN6G 1C0AA 1D6EC 3U58A 2JA5G 1SMYC 1Q81C 1XMOQ 1UNSA 3S2DB 3S2HB 2WINB 1YHAA 4OIJA 5IP9G 4KY5A 3H6MA 4GN5A 3B6YA 1SFOH 2YYZA 4JI0Q 3I4NG 1E7ZA 1W6KA 4DNTB 4A3FG 5EPLA 1AN8A 2Q8RE 1AH9A 3K0YA 4KJNA 1EQTA 4K14A 4UP7A 4YCWA 3TS2A 2ZJPA 1LTRD 1N33Q 4CJ2C 2B2UA 4B9WA 5IY0A 4OO1H 1CKNB 4OXPA 1HR0Q 3CC2A 1ENCA 2E76C 3SK5A 2F0IA 4RKBA 2K4KA 2DNEA 3HG9A 1SAPA 1EFID 3BDLA 3A0JA 1Y8PB 3HOXH 1Z9FA 1RCVD 2NB0A 5C44B 1MIUA 2RVLA 4HN7A 3PIPA 5A2QE 5LMNL 4A76A 2VB2X 1N36L 3PUWA 1B9NA 1VQLA 2WV6D 5DEHA 4DNRB 3TS0A 5JEAJ 2IPKD 2JYOA 3QJYA 1FNWA 3GTMH 4A3BH 1S5FD 1QG7A 4HAEA 2F0KA 1I6HH 2IX3A 1FGUA 3E3XA 1JR0D 1Z47A 2AMCB 4C3JG 2VQFL 1JMCA 4HIKA 1CUKA 1IYUA 2MUYA 2ES2A 2EVBA 3TP5A 4NDXA 3PUYA 3I91A 5HY6A 1YBYA 3AFPA 3BZKA 2QEXA 2HCCA 4LFCL 5BN4A 1EWCA 2AQ2B 4DAPA 4Z9CB 4QL5A 1XX8A 2KBNA 1TS3A 4IN3A 2F0TA 3NK9A 3J80L 4A3EH 1TWCH 5IYBH 1EIYB 3DWAA 3GO5A 2JK8A 1Q7YC 1TVXA 1JOQA 5KYLA 1PH9A 1YNNC 3HRZC 2EOTA 1M4VA 3D8GA 4KKTA 2WKCA 4WJWA 2EDGA 3Q6SA 1BBXC 1JOOA 1SNDA 2HT1A 2O2LD 4NXMQ 2RSNA 1ZYRC 5KIXA 1I4QA 2BH8A 1I3QH 3TZUA 1ET6A 1XNRQ 5AJ3Q 1R4QB 4GZYC 4CJ1B 4IOAA 1N32L 2D5DA 4X6AH 1JICA 3RLFA 4X65Q 1N8RC 2L5TA 4L5SA 1KDBA 2JEBI 3LNNA 1QUQA 2BCOA 2WB1G 2NZ1D 1HJPA 4JOIA 5A35A 1LT5D 3DWPA 3UDXA 4KN4C 2UUBQ 2WB1E 1EIFA 2EYHA 4BWGB 4Q5VA 2XWJB 4LUVA 2LXKA 3S2DH 3S2HH 1SYDA 2Z0SA 3Q22A 4R8NA 1X3PA 4K0KL 1EIGA 3I55A 5M9OA 3FRPB 1YZ6A 4PNYA 1HZCA 3FKIB 1D5ZC 5IGFA 1FYCA 2ALYB 4RGOS 4QGUA 1VQIA 4MZ9A 3NXWA 4JW0A 2ZXRA 3T56B 2VY3A 3TN2A 1PH1A 2I46A 5C3XA 1WTOA 1A2UA 2CHBD 3NHHA 1LUZA 3PMFA 2AWNA 2JP1A 2EJFC 5C3EH 3EIVA 5IE8A 2BH2A 4XTCS 2R7ZB 1SNPA 1WCMB 4DUZQ 1MHWC 4C3HB 2NVYB 3HZXA 4KV6A 1KAAA 4X66L 2D62A 1C7YA 2RSOA 4OIKA 1SE3A 4DV5Q 5C44H 1HNXL 4ME5A 1E1OA 1GUSA 2MHVA 5I4DA 4R4IA 3HOVB 1TY2A 2HCIA 1FJGQ 2K7VA 3ND8A 4LWCA 4DAVA 3OTOQ 4DR4Q 4PG3A 3EVQA 5M3FB 1QVGA 1PTOD 3P7JA 3HEJA 3Q23A 3OMCA 1WOCA 4B3MQ 1TS5A 2F52A 3F1ZA 1II3A 5E7NA 5HURA 3O13A 4G7ZC 4DV2Q 3KLSA 4A3IB 2DGYA 4DK6C 2AWOA 1QUQB 4N8X1 1PH6A 4KD4A 1F77A 5CV8A 2NVXB 2WAQB 4BBRG 1GUTA 1I5FA 1YI2A 1CTMA 2PZWA 2Z6BA 1ASZA 4DR2Q 1K8GA 5M5XB 2K5NA 5KEEA 3PUVA 1BVSA 1B3QA 2MO1A 3M4QA 2QW7A 1SYBA 1HR0W 4IZ8A 2K5HA 1NUCA 1SMXA 4LF7Q 3T4AC 1C9OA 2ZXOA 1H9SA 1A62A 2SDFA 4QB4A 3DM3A 4KLKA 2UXDQ 2K03A 4JI3Q 4FNFA 2TSSA 1GKHA 1P8LA 3OWEB 1B1ZA 4JC0A 3J81E 4QJFA 2F0PA 1F2ZA 3ER0A 2R6GA 1EOVA 1LTGD 2K32A 5IOCA 1Y69U 5JJKA 4DV3Q 4LF6Q 3Q0AA 2KJXA 4RGTA 5ELOA 2B8FA 2CQAA 2VXWA 4JBKA 4KKUA 5JAVA 1MSHA 3FKIH 2VUMG 2DNCA 2OQKA 3K0XA 2R7ZG 3S9WA 4A3MB 1WCMG 3CCRA 5IGGA 2JE6I 1BDOA 1PRTB 2B29A 3M7NA 1CHQD 1B2TA 1JQYD 4LFAL 3NBHA 4A3JG 1AEXA 4UP8A 4C3HH 2NVYH 1FNUA 3BYTB 4IFDH 4GOPC 5GADC 3ZYYX 3AYHB 3HOYG 4QY7A 4TQUS 3HOZH 4DR1L 4I7ZC 1VQAA 2ICIA 4A93G 4RMFA 3M4PA 5JJLA 5KNDA 5M3FG 4K6LA 1PH5A 3PF5A 2EXDA 1CQVA 3HOVH 3J7AV 2LKVA 4K5WA 2Z4HA 1D2BA 1X54A 2XRSD 3GTPH 4FDBA 1Q3LA 3TQYA 4N9PA 1H9SB 1I4PA 3BVZA 2F3IA 4HIOA 2OQ0A 4KTAA 4NXNQ 1BNZA 1NY4A 3E5SA 2HDLA 5FLXc 3CMAA 1HQRD 2D2CC 1SYFA 3D31A 2UXBL 4A3IH 2XWBB 2EZVA 4NW2A 2EYFA 4J8QA 2NVXH 4ILWA 3SK8A 2DN8A 3KBGA 2HQLA 1R4PB 4ZUJA 1IBKL 3RLNA 3H09A 4IJHA 1SMYD 5M5XH 1QE6A 1KRTA 1F2LA 1A63A 4DXGA 2A68C 1VQ4A 1OO9B 3AQQA 4M1UB 1AE2A 2E2HB 2A6HC 1AW7A 4JYAL 4TSSA 4A3LG 3CC7A 3GV6A 4P74A 1DOLA 3A56A 4OO1I 3IL8A 3QG1A 3NBHB 2CCZA 3I4LA 3ITPA 5E1FA 2K52A 4L8JA 1STEA 1JC7A 3SR1A 1JJGA 1V9PA 3HKZG 2DY7A 4PZ6A 2NVTB 2KVMA 4JI8Q 5KGUA 5EBCA 2BE5C 2CFMA 3HKZE 5I2YA 1JWUD 2SEBD 1QOHA 2QKIC 4PMWA 4DV6L 4A3MG 3CD6A 1QNKA 4LFBQ 3DLLA 2J0TD 4RHSA 1KABA 1S5ED 1EZ8A 5C4XG 1IZ6A 1EY4A 4HEDA 2E8GA 1XWEA 2F4VQ 3GTJB 1JB7A 3HOUB 1STHA 3MEFA 3VA7A 1GOZA 1JB3A 3URYA 1KDAA 3K5LA 5EPJA 5IT9L 2J4XA 2D0PA 4IPCA 1BUVT 1PVOA 1ENAA 1VQEA 4Q0FA 5IGBA 2I5HA 1U5KA 1PYBA 3HS0C 3I2ZA 4CBVA 3PO2H 3NTIA 1F2MA 4R8IA 2I07B 3H0GB 2HDMA 4MHEA 3D6WA 5IP7H 5KYIA 5BR8L 3I4MB 2ATWA 2SNMA 1YNND 4JVZA 4KHZA 2O5IC 3VYSA 1UEAB 1ZYRD 2WKDA 2RCFA 1F2YA 1UE5A 2OF1A 2A8VA 2QEJC 1H9MA 1N36Q 3CQZH 2WP8J 3F2DA 3NP8A 4ZAIA 3S14H 3S1NH 1RJTA 1ESFA 4A3DB 2PMZB 2P5ZX 4FF1A 2F0GA 4YY3L 2KHJA 4LF5L 3IKJA 2A5HA 1G51A 1GVPA 2VQFQ 2F0HA 3QB3A 2AQ3B 4JG2A 1U4PA 1RKNA 1DYQA 1ET9A 2PZTA 1H9KA 4A3GG 1H9JA 4V0BA 3CAMA 4B3SL 2E2HH 2N8NA 3C3LA 3TBIB 4LF4L 4KMUC 3GP7A 1ZEQX 3NWSA 2M9VA 1LTBD 5CORA 2B63H 5IT9c 4B3TQ 2MFIA 5EKKA 2Z6KC 4YIJA 3RR5A 1U4LA 4JI6Q 4UY8C 4A3BB 4EQNA 1AFPA 2AKWB 3BZCA 4IO9A 2NVTH 5C4ZA 2N78A 2A6EC 2R92B 1I6HB 1SYCA 1ONLA 5K5PA 3S1MB 5C4JB 1DOMA 3M4YA 3PUXA 1BXTA 2VQEL 1L2FA 4DN4M 1WVLA 1N32Q 4YWMA 1YNXA 5IYCG 2LS01 4L6TB 3BYYB 3KLWA 2JA7G 1HNZQ 1WI5A 2RQXA 5FJ8H 2E5LL 1D8LA 1QCBD 2F0MA 4KHVA 2JA8G 3GTJH 3HOUH 2B2UC 1CI3M 1LTTD 4BY1G 3VR2A 4K0KQ 5FLMH 4E6IA 3L7ZC 5JVG3 4LJZC 2KA7A 1S3OA 2C35B 3RD4A 1SYEA 1PTOF 4BXXG 4C3IB 5ISRA 3T13A 4O1NA 1IBMQ 2MJ8A 3P20A 1IBLQ 1G8ZD 1W3SA 4EQOA 4EX5A 1EFWA 4QQBX 1UUPA 4OELB 1WTQA 3OW2A 1NMGA 2CH4W 1E3PA 2L9HA 3H0GH 4XT1B 3I4MH 1KDCA 4DR5Q 1RL2A 1BBUA 4B9XA 3J80E 4DV4L 3BS1A 3DEOA 1OXUA 1AZQA 4X66Q 1B70B 4DV7L 4NP5A 3W1BA 4TVAB 1A3VA 2K1BA 4R4QA 4HMJA 5JJZA 4LK1C 1OXTA 1SXTA 1YHBA 3PIO3 1HNWL 3I8ZA 3KDFB 2R7DA 2PMZE 2F0FA 4OONA 4A3KB 1EYDA 1WTHA 1V1OA 2LMCB 4A3DH 4JI5Q 4RKLA 3K6OA 3RN2A 4OO1G 1Y8NB 2F0NA 2YV5A 5C3EB 2PPBC 1LV9A 2NTTA 4GKJQ 3HOXG 3GTOB 3L3OC 5HGQA 3I3CA 4BBSB 2EYPA 3S24A 3KF6A 1L0YB 1PYWD 4RHRA 4XYOA 4X62Q 1DM0B 3BVMA 3QR8A 2CW0C 1EWIA 2RBMA 4OHJA 1Y14B 2D9UA 1CT1D 4ZYSA 4A3BG 4GNXA 4K6DA 3KOJA 3Q8DA 2NVQB 1FL0A 5E4XA 1BKBA 4ZLTF 2K14A 1EYAA 3UDFA 2F3WA 5D14A 3MXGA 2PW5A 3RZDB 4JOIC 1RTNA 4IFDI 1TU2B 4DV1Q 1EU3A 2ZTCA 4P71A 4RCNA 1F9QA 2R92H 3M9BA 3SE0A 3S1MH 3A54A 5C4JH 1OXXK 4FF2A 3I73A 1GUNA 1M1KC 5EKIA 4UDUC 5LMNW 1PXUA 4A3EG 2F0LA 1O80A 1LLRD 3L2PA 2BA1A 5IYBG 4V190 1YJNA 4IUTA 5CBAE 4K8IA 3PO3B 1PZJD 2HHHL 5CYUA 3M7GA 2KCTA 1I94L 3S17B 1O7YA 1P16A 3D4RA 1EQRA 1JT8A 5FO8B 3VR4A 2DUDA 1B7YB 1D7QA 1VMPA 1X3EA 4C3IH 3L0OA 2B39A 1XTDA 4JI4L 1QB5D 5JPNC 1VQBA 4B08A 1E22A 4X3SA 3GD7A 1VQNA 1Q46A 3KUPA 5NUCA 4IJLA 2ZTEA 5C0XJ 1PA6A 5JOBA 3BVGA 1DOKA 2MNAA 2PI2E 2A68D 3H3VH 1C8CA 4FYDA 1X65A 3NPPA 4F8MA 4DR1Q 1PRTC 1K0RA 1UE6A 4GNXB 2A6HD 3T53B 1V1PA 2BOSA 3PSIA 1JORA 3P1HA 4LUZA 1Y1VH 1SYGA 1F9RA 4OWXB 1BCPB 1ESRA 4XXEA 1JJCB 4A3KH 5C3EG 4RGNA 4AH6A 3D4DA 3K5OA 1EY0A 3FVQA 1Y8OB 3I7FA 2PQEA 1GHKA 4CGYB 3T16A 2MQHA 3UI2A 1YNJC 3ULPA 1HRJA 3M85A 1LACA 3UE0A 2BE5D 1XNQL 1OTCA 2RHQB 5C5MA 1H95A 5M3MH 1W6JA 2E2DC 4H44C 3GTOH 3G4SA 1HZBA 1ILQA 4TKOB 5C44G 2UXBQ 4BBSH 2QCPX 1FNVA 3J81j 1SJHD 1E2VA 5A2QL 3DXJC 4CDDC 3OHXC 3JAMi 3HOWB 1A3TA 4FP5D 3HOZB 1BOSA 5LMUQ 2JA6B 1VQDA 2LFNA 4IQZA 5CV6A 2EXZA 3T1YQ 2EYOA 2NVQH 4X3UA 3R2IA 4A4IA 4A75A 4JI2L 2XTIA 5FKAC 4XQNA 3FMCA 3J81i 4L5RC 2YTVA 3PQIA 5EPKA 3RZDH 1TT2A 3CCVA 2F0VA 3CXCA 1L1OA 1R9TH 3GTPB 4DR7L 5CMDA 2ZM6L 1B53A 3E9HA 4O0AA 3ND9A 2FHTA 4JYAQ 3RN5A 1K83B 5KNCA 3NUCA 3GTGB 4P75A 5G3LD 3TP6A 3MAQA 2AUJD 4MIUA 4IPGA 1IKMA 2PYKA 3DM1A 1K8AC 1SNQA 4LUOA 3CCJA 4AQYL 2ICEC 1IL2A 3MXNA 5IODA 3PO3H 5M5WH 3CF5A 1W2BA 4FXDA 1N33L 3AEVA 1E0BA 3OPOA 2PO4A 1V1PB 2R7FA 3S17H 1CK1A 3KLSX 3SK6A 2L4NA 4XQJA 2UUAQ 2XN9C 1GUOA 3S1QB 2GVBA 3MEHA 3J7AF 3AFQA 2IX0A 1VMCA 5DM63 2GA4B 1E24A 3KJPA 2F3VA 3GTKB 3DMUA 4GKKQ 2EYLA 2RF4A 2Z4IA 4L5TA 3N6RA 5FLXL 4NKLA 1JE4A 4L63B 4GLAC 5L37A 2EYJA 3MTSA 4QUFA 4DAMA 3FKIG 4BA2I 4RGMA 4DR3L 1N34L 3V2TA 4POGA 4PV1C 1JE5A 2JJQA 1F9PA 1TIID 1Y1WB 1VQMA 4LAAA 1Z7TA 3WOEA 3WWVA 1QZGA 1A8VA 3L9AX 3R93A 4ZQ3A 5T1IA 1HPCA 5JEAH 3G6JB 1HH2P
chains in the Genus database with same CATH topology
4BA2I 3W1GA 4JI8L 3PCOB 4JV5Q 2PNHA 4BY1H 3ZJYC 2IY5B 1VQOA 4GN3B 4P72A 1J6QA 4IFDG 1VQ6A 5M3MG 1V43A 3NENA 1SE8A 2D0PA 4X64L 3HOZG 4IPCA 1HNZL 1PVOA 1UWVA 2QGQA 4BBSG 4BXXH 1VQEA 2V1CC 4LFBL 3JC66 2UUCL 3BJUA 1YIJA 2I5HA 2CWPA 1U5KA 1PYBA 2JEAI 5GQOA 2NZOA 1PH2A 2QA4A 4KHPL 3I2ZA 3HOVG 2Z6KA 4LF9Q 3PO2H 1K9MC 3U4VA 3KJOA 4YY3Q 2NN6G 1C0AA 3MXNB 4GLVB 5IP7H 3U58A 5BR8L 2JA5G 3HOWH 5M5YH 2ATWA 1I50H 4R4CA 3CMEA 1VQ7A 2JA6H 4ALPA 1Q81C 1XMOQ 4KHZA 5AJ3L 1X9NA 1YHAA 4YCUA 1VQHA 5IP9G 4X65L 1IBML 1IBKQ 4GN5A 1T9HA 3B6YA 2YYZA 1UE5A 4DUYQ 1E7ZA 2VL6A 1SFOH 1IBLL 4JI0Q 4A3FG 2A8VA 3UDGA 3A5UA 1AH9A 1N36Q 4A3IG 3CQZH 2WP8J 3OYYA 4OX9Q 3F2DA 2IX1A 4DR5L 3CCMA 3FP9A 2UUBL 3S14H 1LM0A 3S1NH 2UXCQ 4R4TA 4UP7A 4YCWA 1K83H 3TS2A 3I4NG 2ZJPA 4LF4Q 1N33Q 4B3RQ 4LF9L 4YY3L 3GTGH 3H15A 2KHJA 4MTNA 1Q1EA 2WAQG 5IY0A 4LF5L 3EBEA 1CKNB 4OXPA 1HR0Q 3CC2A 2CWAA 2B3GA 4YCVA 3J80c 3A5ZB 1XMOL 1VS0A 2K4KA 1G51A 2WAQE 1GVPA 1MKHA 1Q8KA 1VQCA 2VQFQ 1EUJA 3PO3G 3A0JA 1X55A 2UU9Q 4JBMA 3HOXH 1EYGA 1YVCA 1Z9FA 4DUYL 1KAWA 4JG2A 4JI0L 4LNQA 3ERSX 2RCNA 1MIUA 4JI5L 3PIPA 5LMNL 2VQEQ 4A76A 3ICEA 1KRSA 2OCEA 4ME3A 1N36L 3PUWA 2GVAA 4A3GG 1SRUA 1VQLA 1TWAH 3CAMA 3TS0A 4B3SL 2E2HH 5JEAJ 3J7ZC 2N8NA 3S1QH 4DV0Q 1KQSA 4LF4L 2ASBA 4B3RL 1V1QA 4A3BH 3GTMH 2PQAA 2OTJA 4GKJL 4DV6Q 4YWKA 1NBWA 4EQ5A 1HR0L 2E5LQ 2B63H 1I6HH 5IT9c 4P73A 4B3TQ 2MFIA 1FGUA 2Z6KC 3RR5A 3RNUA 4JI6Q 4UY8C 4X62L 1Z47A 2AKWB 2AMCB 3W5OA 3GTQH 3BZCA 2VQFL 3GTKH 4IO9A 1VQFA 2L15A 2BA0A 1GM5A 1JMCA 2NVTH 1EQQA 4JBJA 1CUKA 4HIKA 2ES2A 2N78A 1FJGL 2WFWA 3PUYA 5HY6A 3PUXA 1YBYA 3AFPA 3BZKA 3G71A 2QEXA 2VQEL 1L2FA 3F2CA 4LFCL 3OTOL 4DR4L 1N32Q 4YWMA 1YNXA 5IYCG 5ELNA 1WFQA 1J5EQ 4QL5A 1GD7A 2LSSA 4DV0L 4HJAA 2KBNA 1X3FA 1OXSC 4BBRH 4A3EH 1Y1WH 4B3ML 3K8AA 3KLWA 1TWCH 1XJVA 2JA7G 5IYBH 1EIYB 4DV1L 1HNZQ 1WI5A 5FJ8H 1TXYA 3GO5A 1BBWA 2JK8A 1GO3E 3CPFA 1Q7YC 2E5LL 1D8LA 3NEMA 4DV2L 5JEAG 2VW9A 1PH9A 2JA8G 4DV4Q 4XIGS 3GTJH 3HOUH 4MNOA 2KENA 2A1AA 1FVIA 4BY1G 1WJJA 4O2DA 2HT1A 4NXMQ 4K0KQ 5FLMH 3L7ZC 3A74A 3CP0A 5BR8Q 1QZHA 2BH8A 1I3QH 1VQ8A 3J7A5 3CCSA 1XNRQ 4NPSA 2HIVA 5AJ3Q 1S3OA 4DR2L 2C35B 1L1OB 1Q12A 4BXXG 4IOAA 4IPDA 1HNWQ 2LXJA 1N32L 4X6AH 3RLFA 4X65Q 1N8RC 4HIMA 5JJIA 1IBMQ 2YTXA 3ULLA 1J5EL 2JEBI 4L5SA 3I56A 4AIMA 1YITA 3PO2G 1TWGH 1IBLQ 1X3GA 1W3SA 4EX5A 1EFWA 1QUQA 1KC8C 3M3YH 4QQBX 2WB1G 3OW2A 1NMGA 5IP7G 1HJPA 4JOIA 1PH8A 3HOWG 1UE1A 1PV4A 1E3PA 3H0GH 1SN8A 1SROA 3ULJA 1Q82C 3UDXA 4JCVE 4HJ7A 2JA6G 4DR5Q 1Q86C 1RL2A 1CKMA 2UUBQ 1AE3A 2WB1E 1EIFA 1BBUA 2H5XA 4DV4L 3VDYA 4LUVA 2LXKA 2AHOB 2K75A 3M4OH 1OXUA 3S2DH 4IOCA 3S2HH 2Z0SA 4X66Q 1B70B 4DV7L 3JAMc 4NXML 4K0KL 2EQSA 1QVCA 4TVAB 3W1BA 3I55A 4R4QA 1YZ6A 4LF5Q 1HZCA 1CKOA 2ALYB 3E0EA 4QGUA 1VQIA 4MZ9A 1XNRL 1OXTA 2VUMH 1U0LA 1VQGA 1YHBA 2VY3A 1HNWL 3TEHB 3KDFB 1PH1A 2R7DA 1XPUA 2IHEA 2R7ZH 1L0WA 2PMZE 2R93H 4OONA 2N3SA 3GDEA 3STBD 2Q2IA 3J81c 1LUZA 1WCMH 4DV3L 2AWNA 4LF6L 4A3DH 4JI5Q 5LMNQ 5C3EH 3EIVA 1LYLA 3RN2A 5IE8A 1UE7A 2BH2A 4OO1G 4XTCS 1K73C 4H02A 1RIPA 4B3SQ 2YU9H 5C0XG 1N9WA 4DUZQ 1O7IA 2YTYA 4A3JH 2D0OA 2YV5A 1SR3A 3F8TA 3H3VI 4X66L 3HKSA 2D62A 4DK3C 1C7YA 2EIFA 3HOXG 4GKJQ 4BY7H 2IHFA 5J3BA 1OXVA 3GTLH 3HOYH 5HGQA 3S24A 3KF6A 4DV5Q 1NMFA 5C44H 4HIDA 1HNXL 4X62Q 4A93H 3PIOA 2ZJRA 1E1OA 4R4IA 1FJGQ 3CCQA 5M3FH 1EWIA 2KCMA 1Y14B 2OTLA 1VQKA 2I5MX 4A3BG 1IYJB 4GNXA 3CCLA 4LWCA 3KOJA 3Q8DA 3OTOQ 4LFCQ 4DR4Q 4OWWB 2B63G 4PG3A 4DPGA 1FL0A 1QVGA 1BKBA 4DUZL 2K14A 2HHHQ 3UDFA 1I94Q 1E1TA 1WOCA 4JOIC 4B3MQ 4IFDI 4A3CH 4YWLA 2F52A 3F1ZA 3CCUA 4DV1Q 2ZTCA 4P71A 3K81C 2ID0A 5E7NA 2R92H 1CSPA 3M9BA 4DV2Q 5LMUL 4NB3A 2DGYA 4DV5L 3S1MH 4DK6C 5EAYA 3J80i 2AWOA 5C4JH 1QUQB 1PH6A 1OXXK 4QIWE 3T1YL 1Q1BA 3T1HQ 1M1KC 1M90C 1HZ9A 5LMNW 5IYDH 4JI4Q 2NN6I 2Q2UA 4BBRG 4A3EG 2OWOA 3CPWA 1I5FA 1Y1WG 1YI2A 3PGZA 3L2PA 1PH3A 2BA1A 4R4OA 3U50C 5IYBG 3HFZB 5FJ8G 1ASZA 4DR2Q 1YJNA 1K8GA 2K5NA 4GOPA 1VQ9A 3PUVA 2XGTA 1BVSA 2MO1A 3HOUG 3M4QA 2HHHL 1LTLA 1HR0W 2K5HA 2KCTA 4APVA 1KIXA 1I94L 5FLMG 1SMXA 4LF7Q 1NJIC 1C9OA 1DGSA 5DLQE 4GLXA 4DR6Q 1A62A 1P16A 2K50A 1PHJA 3I4MH 1EQRA 4DAYB 1JT8A 3F2BA 2DUDA 3DM3A 4KLKA 1B7YB 2UXDQ 2NZHA 4JI3Q 4A3LH 1D7QA 3T1HL 1MJCA 4DV7Q 1X3EA 4C3IH 3STBC 3L0OA 4JI4L 1XTDA 1VCIA 1GKHA 1CKNA 1P8LA 4PZ7A 3RLOA 4JC0A 1VQBA 4QJFA 1E22A 1XMQQ 4JI7Q 3ER0A 5IWAQ 3GD7A 2R6GA 1Q46A 3H0GG 1VQNA 1EOVA 1YJ9A 2ZTDA 4IJLA 3I4MG 1VQ5A 2ZTEA 3KF8B 1NTGA 5C0XJ 2UUAL 3LGJA 5GAHC 4GNXC 1ASYA 4C2MH 1PA6A 5JJKA 1KHIA 3K7UC 4DV3Q 4LF6Q 1XNQQ 5ELOA 1MJEA 2MNAA 3SGIA 4LF7L 2PI2E 3H3VH 3I4OA 4JI1Q 4JBKA 4DR6L 5H1SE 1X65A 3FKIH 4A3MH 4WJ4A 2VUMG 4DR1Q 1XPRA 4AYBE 1K0RA 2I0QA 1XPOA 2Q2TA 1UE6A 4GNXB 2OQKA 1JJ2A 2UXDL 4JI3L 3K0XA 2R7ZG 2K5VA 3PSIA 2R93G 2N49A 1G6PA 5C4XH 2Y0SE 1WCMG 4LUZA 4HJ9A 1Y1VH 4OWXB 4GKKL 3CCRA 4A3DG 1JJCB 4A3KH 1CSQA 2JE6I 4AH6A 5C3EG 1XMQL 4JI7L 1HNXQ 3I7FA 2B29A 5IWAL 3M7NA 1HZAA 2PQAB 1SLJA 2VZAA 4LFAL 2MQHA 3PUZA 4JI2Q 4A3JG 4LW1A 1PH4A 3ULPA 3M85A 1PYSB 3CW2C 3UE0A 1XNQL 1OTCA 4UP8A 4OWTB 1KL9A 2NVYH 2RHQB 3BU2A 4C3HH 4Y7NH 4GS3A 3G6EA 1S72A 4BY7G 4GOPC 1H95A 5GADC 5M3MH 4JI1L 2MO0A 4DR7Q 3HOYG 3AYHB 4QY7A 2ZM6Q 3GTOH 3G4SA 1HZBA 4TQUS 3HOZH 4DR1L 5C44G 2UXBQ 4POFA 1VQAA 2F4VL 4BBSH 4IPHA 4RMFA 4A93G 3FHWA 4DNIA 3M4PA 3J81j 4GN4B 5JJLA 4BA1I 3K80C 3E9IA 5M3FG 4UP9A 1PH5A 3PF5A 2EXDA 3HOVH 3JAMi 4GOPB 4JV5L 1K3RA 2GN5A 5LMUQ 2IT1A 2JA5H 1VQDA 3IRBA 4R1JA 4AQYQ 3T1YQ 4YHHQ 2E2JH 1X54A 2NVQH 3U4ZA 3GTPH 4FDBA 3TQYA 4A4IA 4A75A 4HJ5A 4JI2L 2XTIA 2F3IA 1QVFA 4HIOA 2OQ0A 5IP9H 3J81i 4HJ8A 4NXNQ 4L5RC 2YTVA 4A3CG 1NY4A 1UEBA 3UDIA 3CCVA 3RZDH 3CXCA 3I4NH 4PZ8A 2I5LX 1L1OA 3UE1A 1R9TH 4A3FH 2R92G 4DR7L 2ZM6L 5FLXc 1VQJA 4O0AA 3E9HA 3CMAA 4LF8Q 3S15H 3S16H 3D31A 2UXBL 2FXQA 4A3IH 4JYAQ 4UPAA 3RN5A 3TRZA 1G291 1VQPA 5IYDG 2VS1A 1TWFH 1KXLA 4P75A 2JA9A 3KYHC 2NVXH 3CCEA 4IPGA 5GAGC 1IBKL 2HQLA 4RG1A 3RLNA 2ZJQA 1K8AC 4LUOA 4IJHA 3CCJA 4AQYL 4YHHL 3PF4A 5M5XH 1IL2A 4OX9L 3PO3H 1YJWA 5M5WH 2UXCL 4NXNL 3G48A 2PI2A 3EN2A 1KRTA 3CF5A 1W2BA 1A63A 1N33L 3AEVA 5GROA 4KI0A 1VQ4A 5K36G 2E2IH 2R7FA 3S17H 3AQQA 3KDFA 4DKAC 4DR3Q 1AE2A 1N34Q 4LF8L 4A3GH 2UUAQ 4JYAL 4A3LG 3CC7A 2GVBA 4P74A 1X56A 2HIXA 3AFQA 4J15A 2IX0A 1S40A 4OO1I 1YHQA 2UU9L 2RHSB 3NBHB 3K7AH 2CCZA 3S1RH 1A0IA 2K52A 5C0XI 4IFDJ 1JJGA 1E24A 4L5QA 1V9PA 3KJPA 3HKZG 4PZ6A 2JQOA 1YEZA 3PV0A 4C3JH 1PFSA 4JI8Q 4GKKQ 2RF4A 4L5TA 4WJ3M 2CFMA 3HKZE 4GLAC 3RZOH 3D0FA 1KD1C 1TWHH 3NELA 4DAMA 3FKIG 2CQOA 4PMWA 4X64Q 4DV6L 4LFAQ 4A3MG 3CD6A 4DR3L 1N34L 4POGA 3KFUA 4LFBQ 1WYDA 1JE5A 1NE3A 2Q2HA 3DLLA 2UUCQ 2KHIA 3KF6B 2JJQA 5IYCH 4B3TL 2VNUD 4JI6L 1L1OC 5GAEC 4AYBG 1VQMA 3CC4A 4KHPQ 5C4XG 1IZ6A 1Y1VG 1PH7A 2E8GA 3WWVA 4A3KG 1QZGA 2JA7H 4Y52H 2CKZB 1A8VA 2Y0SG 2A19A 2F4VQ 1JB7A 2JA8H 1IXRA 3MEFA 4JBWA 3TREA 1X6OA 1HH2P 1B8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BA2 I;  3W1G A;  4JI8 L;  3PCO B;  4JV5 Q;  2PNH A;  4BY1 H;  3ZJY C;  2IY5 B;  1VQO A;  4GN3 B;  4P72 A;  1J6Q A;  4IFD G;  1VQ6 A;  5M3M G;  1V43 A;  3NEN A;  1SE8 A;  2D0P A;  4X64 L;  3HOZ G;  4IPC A;  1HNZ L;  1PVO A;  1UWV A;  2QGQ A;  4BBS G;  4BXX H;  1VQE A;  2V1C C;  4LFB L;  3JC6 6;  2UUC L;  3BJU A;  1YIJ A;  2I5H A;  2CWP A;  1U5K A;  1PYB A;  2JEA I;  5GQO A;  2NZO A;  1PH2 A;  2QA4 A;  4KHP L;  3I2Z A;  3HOV G;  2Z6K A;  4LF9 Q;  3PO2 H;  1K9M C;  3U4V A;  3KJO A;  4YY3 Q;  2NN6 G;  1C0A A;  3MXN B;  4GLV B;  5IP7 H;  3U58 A;  5BR8 L;  2JA5 G;  3HOW H;  5M5Y H;  2ATW A;  1I50 H;  4R4C A;  3CME A;  1VQ7 A;  2JA6 H;  4ALP A;  1Q81 C;  1XMO Q;  4KHZ A;  5AJ3 L;  1X9N A;  1YHA A;  4YCU A;  1VQH A;  5IP9 G;  4X65 L;  1IBM L;  1IBK Q;  4GN5 A;  1T9H A;  3B6Y A;  2YYZ A;  1UE5 A;  4DUY Q;  1E7Z A;  2VL6 A;  1SFO H;  1IBL L;  4JI0 Q;  4A3F G;  2A8V A;  3UDG A;  3A5U A;  1AH9 A;  1N36 Q;  4A3I G;  3CQZ H;  2WP8 J;  3OYY A;  4OX9 Q;  3F2D A;  2IX1 A;  4DR5 L;  3CCM A;  3FP9 A;  2UUB L;  3S14 H;  1LM0 A;  3S1N H;  2UXC Q;  4R4T A;  4UP7 A;  4YCW A;  1K83 H;  3TS2 A;  3I4N G;  2ZJP A;  4LF4 Q;  1N33 Q;  4B3R Q;  4LF9 L;  4YY3 L;  3GTG H;  3H15 A;  2KHJ A;  4MTN A;  1Q1E A;  2WAQ G;  5IY0 A;  4LF5 L;  3EBE A;  1CKN B;  4OXP A;  1HR0 Q;  3CC2 A;  2CWA A;  2B3G A;  4YCV A;  3J80 c;  3A5Z B;  1XMO L;  1VS0 A;  2K4K A;  1G51 A;  2WAQ E;  1GVP A;  1MKH A;  1Q8K A;  1VQC A;  2VQF Q;  1EUJ A;  3PO3 G;  3A0J A;  1X55 A;  2UU9 Q;  4JBM A;  3HOX H;  1EYG A;  1YVC A;  1Z9F A;  4DUY L;  1KAW A;  4JG2 A;  4JI0 L;  4LNQ A;  3ERS X;  2RCN A;  1MIU A;  4JI5 L;  3PIP A;  5LMN L;  2VQE Q;  4A76 A;  3ICE A;  1KRS A;  2OCE A;  4ME3 A;  1N36 L;  3PUW A;  2GVA A;  4A3G G;  1SRU A;  1VQL A;  1TWA H;  3CAM A;  3TS0 A;  4B3S L;  2E2H H;  5JEA J;  3J7Z C;  2N8N A;  3S1Q H;  4DV0 Q;  1KQS A;  4LF4 L;  2ASB A;  4B3R L;  1V1Q A;  4A3B H;  3GTM H;  2PQA A;  2OTJ A;  4GKJ L;  4DV6 Q;  4YWK A;  1NBW A;  4EQ5 A;  1HR0 L;  2E5L Q;  2B63 H;  1I6H H;  5IT9 c;  4P73 A;  4B3T Q;  2MFI A;  1FGU A;  2Z6K C;  3RR5 A;  3RNU A;  4JI6 Q;  4UY8 C;  4X62 L;  1Z47 A;  2AKW B;  2AMC B;  3W5O A;  3GTQ H;  3BZC A;  2VQF L;  3GTK H;  4IO9 A;  1VQF A;  2L15 A;  2BA0 A;  1GM5 A;  1JMC A;  2NVT H;  1EQQ A;  4JBJ A;  1CUK A;  4HIK A;  2ES2 A;  2N78 A;  1FJG L;  2WFW A;  3PUY A;  5HY6 A;  3PUX A;  1YBY A;  3AFP A;  3BZK A;  3G71 A;  2QEX A;  2VQE L;  1L2F A;  3F2C A;  4LFC L;  3OTO L;  4DR4 L;  1N32 Q;  4YWM A;  1YNX A;  5IYC G;  5ELN A;  1WFQ A;  1J5E Q;  4QL5 A;  1GD7 A;  2LSS A;  4DV0 L;  4HJA A;  2KBN A;  1X3F A;  1OXS C;  4BBR H;  4A3E H;  1Y1W H;  4B3M L;  3K8A A;  3KLW A;  1TWC H;  1XJV A;  2JA7 G;  5IYB H;  1EIY B;  4DV1 L;  1HNZ Q;  1WI5 A;  5FJ8 H;  1TXY A;  3GO5 A;  1BBW A;  2JK8 A;  1GO3 E;  3CPF A;  1Q7Y C;  2E5L L;  1D8L A;  3NEM A;  4DV2 L;  5JEA G;  2VW9 A;  1PH9 A;  2JA8 G;  4DV4 Q;  4XIG S;  3GTJ H;  3HOU H;  4MNO A;  2KEN A;  2A1A A;  1FVI A;  4BY1 G;  1WJJ A;  4O2D A;  2HT1 A;  4NXM Q;  4K0K Q;  5FLM H;  3L7Z C;  3A74 A;  3CP0 A;  5BR8 Q;  1QZH A;  2BH8 A;  1I3Q H;  1VQ8 A;  3J7A 5;  3CCS A;  1XNR Q;  4NPS A;  2HIV A;  5AJ3 Q;  1S3O A;  4DR2 L;  2C35 B;  1L1O B;  1Q12 A;  4BXX G;  4IOA A;  4IPD A;  1HNW Q;  2LXJ A;  1N32 L;  4X6A H;  3RLF A;  4X65 Q;  1N8R C;  4HIM A;  5JJI A;  1IBM Q;  2YTX A;  3ULL A;  1J5E L;  2JEB I;  4L5S A;  3I56 A;  4AIM A;  1YIT A;  3PO2 G;  1TWG H;  1IBL Q;  1X3G A;  1W3S A;  4EX5 A;  1EFW A;  1QUQ A;  1KC8 C;  3M3Y H;  4QQB X;  2WB1 G;  3OW2 A;  1NMG A;  5IP7 G;  1HJP A;  4JOI A;  1PH8 A;  3HOW G;  1UE1 A;  1PV4 A;  1E3P A;  3H0G H;  1SN8 A;  1SRO A;  3ULJ A;  1Q82 C;  3UDX A;  4JCV E;  4HJ7 A;  2JA6 G;  4DR5 Q;  1Q86 C;  1RL2 A;  1CKM A;  2UUB Q;  1AE3 A;  2WB1 E;  1EIF A;  1BBU A;  2H5X A;  4DV4 L;  3VDY A;  4LUV A;  2LXK A;  2AHO B;  2K75 A;  3M4O H;  1OXU A;  3S2D H;  4IOC A;  3S2H H;  2Z0S A;  4X66 Q;  1B70 B;  4DV7 L;  3JAM c;  4NXM L;  4K0K L;  2EQS A;  1QVC A;  4TVA B;  3W1B A;  3I55 A;  4R4Q A;  1YZ6 A;  4LF5 Q;  1HZC A;  1CKO A;  2ALY B;  3E0E A;  4QGU A;  1VQI A;  4MZ9 A;  1XNR L;  1OXT A;  2VUM H;  1U0L A;  1VQG A;  1YHB A;  2VY3 A;  1HNW L;  3TEH B;  3KDF B;  1PH1 A;  2R7D A;  1XPU A;  2IHE A;  2R7Z H;  1L0W A;  2PMZ E;  2R93 H;  4OON A;  2N3S A;  3GDE A;  3STB D;  2Q2I A;  3J81 c;  1LUZ A;  1WCM H;  4DV3 L;  2AWN A;  4LF6 L;  4A3D H;  4JI5 Q;  5LMN Q;  5C3E H;  3EIV A;  1LYL A;  3RN2 A;  5IE8 A;  1UE7 A;  2BH2 A;  4OO1 G;  4XTC S;  1K73 C;  4H02 A;  1RIP A;  4B3S Q;  2YU9 H;  5C0X G;  1N9W A;  4DUZ Q;  1O7I A;  2YTY A;  4A3J H;  2D0O A;  2YV5 A;  1SR3 A;  3F8T A;  3H3V I;  4X66 L;  3HKS A;  2D62 A;  4DK3 C;  1C7Y A;  2EIF A;  3HOX G;  4GKJ Q;  4BY7 H;  2IHF A;  5J3B A;  1OXV A;  3GTL H;  3HOY H;  5HGQ A;  3S24 A;  3KF6 A;  4DV5 Q;  1NMF A;  5C44 H;  4HID A;  1HNX L;  4X62 Q;  4A93 H;  3PIO A;  2ZJR A;  1E1O A;  4R4I A;  1FJG Q;  3CCQ A;  5M3F H;  1EWI A;  2KCM A;  1Y14 B;  2OTL A;  1VQK A;  2I5M X;  4A3B G;  1IYJ B;  4GNX A;  3CCL A;  4LWC A;  3KOJ A;  3Q8D A;  3OTO Q;  4LFC Q;  4DR4 Q;  4OWW B;  2B63 G;  4PG3 A;  4DPG A;  1FL0 A;  1QVG A;  1BKB A;  4DUZ L;  2K14 A;  2HHH Q;  3UDF A;  1I94 Q;  1E1T A;  1WOC A;  4JOI C;  4B3M Q;  4IFD I;  4A3C H;  4YWL A;  2F52 A;  3F1Z A;  3CCU A;  4DV1 Q;  2ZTC A;  4P71 A;  3K81 C;  2ID0 A;  5E7N A;  2R92 H;  1CSP A;  3M9B A;  4DV2 Q;  5LMU L;  4NB3 A;  2DGY A;  4DV5 L;  3S1M H;  4DK6 C;  5EAY A;  3J80 i;  2AWO A;  5C4J H;  1QUQ B;  1PH6 A;  1OXX K;  4QIW E;  3T1Y L;  1Q1B A;  3T1H Q;  1M1K C;  1M90 C;  1HZ9 A;  5LMN W;  5IYD H;  4JI4 Q;  2NN6 I;  2Q2U A;  4BBR G;  4A3E G;  2OWO A;  3CPW A;  1I5F A;  1Y1W G;  1YI2 A;  3PGZ A;  3L2P A;  1PH3 A;  2BA1 A;  4R4O A;  3U50 C;  5IYB G;  3HFZ B;  5FJ8 G;  1ASZ A;  4DR2 Q;  1YJN A;  1K8G A;  2K5N A;  4GOP A;  1VQ9 A;  3PUV A;  2XGT A;  1BVS A;  2MO1 A;  3HOU G;  3M4Q A;  2HHH L;  1LTL A;  1HR0 W;  2K5H A;  2KCT A;  4APV A;  1KIX A;  1I94 L;  5FLM G;  1SMX A;  4LF7 Q;  1NJI C;  1C9O A;  1DGS A;  5DLQ E;  4GLX A;  4DR6 Q;  1A62 A;  1P16 A;  2K50 A;  1PHJ A;  3I4M H;  1EQR A;  4DAY B;  1JT8 A;  3F2B A;  2DUD A;  3DM3 A;  4KLK A;  1B7Y B;  2UXD Q;  2NZH A;  4JI3 Q;  4A3L H;  1D7Q A;  3T1H L;  1MJC A;  4DV7 Q;  1X3E A;  4C3I H;  3STB C;  3L0O A;  4JI4 L;  1XTD A;  1VCI A;  1GKH A;  1CKN A;  1P8L A;  4PZ7 A;  3RLO A;  4JC0 A;  1VQB A;  4QJF A;  1E22 A;  1XMQ Q;  4JI7 Q;  3ER0 A;  5IWA Q;  3GD7 A;  2R6G A;  1Q46 A;  3H0G G;  1VQN A;  1EOV A;  1YJ9 A;  2ZTD A;  4IJL A;  3I4M G;  1VQ5 A;  2ZTE A;  3KF8 B;  1NTG A;  5C0X J;  2UUA L;  3LGJ A;  5GAH C;  4GNX C;  1ASY A;  4C2M H;  1PA6 A;  5JJK A;  1KHI A;  3K7U C;  4DV3 Q;  4LF6 Q;  1XNQ Q;  5ELO A;  1MJE A;  2MNA A;  3SGI A;  4LF7 L;  2PI2 E;  3H3V H;  3I4O A;  4JI1 Q;  4JBK A;  4DR6 L;  5H1S E;  1X65 A;  3FKI H;  4A3M H;  4WJ4 A;  2VUM G;  4DR1 Q;  1XPR A;  4AYB E;  1K0R A;  2I0Q A;  1XPO A;  2Q2T A;  1UE6 A;  4GNX B;  2OQK A;  1JJ2 A;  2UXD L;  4JI3 L;  3K0X A;  2R7Z G;  2K5V A;  3PSI A;  2R93 G;  2N49 A;  1G6P A;  5C4X H;  2Y0S E;  1WCM G;  4LUZ A;  4HJ9 A;  1Y1V H;  4OWX B;  4GKK L;  3CCR A;  4A3D G;  1JJC B;  4A3K H;  1CSQ A;  2JE6 I;  4AH6 A;  5C3E G;  1XMQ L;  4JI7 L;  1HNX Q;  3I7F A;  2B29 A;  5IWA L;  3M7N A;  1HZA A;  2PQA B;  1SLJ A;  2VZA A;  4LFA L;  2MQH A;  3PUZ A;  4JI2 Q;  4A3J G;  4LW1 A;  1PH4 A;  3ULP A;  3M85 A;  1PYS B;  3CW2 C;  3UE0 A;  1XNQ L;  1OTC A;  4UP8 A;  4OWT B;  1KL9 A;  2NVY H;  2RHQ B;  3BU2 A;  4C3H H;  4Y7N H;  4GS3 A;  3G6E A;  1S72 A;  4BY7 G;  4GOP C;  1H95 A;  5GAD C;  5M3M H;  4JI1 L;  2MO0 A;  4DR7 Q;  3HOY G;  3AYH B;  4QY7 A;  2ZM6 Q;  3GTO H;  3G4S A;  1HZB A;  4TQU S;  3HOZ H;  4DR1 L;  5C44 G;  2UXB Q;  4POF A;  1VQA A;  2F4V L;  4BBS H;  4IPH A;  4RMF A;  4A93 G;  3FHW A;  4DNI A;  3M4P A;  3J81 j;  4GN4 B;  5JJL A;  4BA1 I;  3K80 C;  3E9I A;  5M3F G;  4UP9 A;  1PH5 A;  3PF5 A;  2EXD A;  3HOV H;  3JAM i;  4GOP B;  4JV5 L;  1K3R A;  2GN5 A;  5LMU Q;  2IT1 A;  2JA5 H;  1VQD A;  3IRB A;  4R1J A;  4AQY Q;  3T1Y Q;  4YHH Q;  2E2J H;  1X54 A;  2NVQ H;  3U4Z A;  3GTP H;  4FDB A;  3TQY A;  4A4I A;  4A75 A;  4HJ5 A;  4JI2 L;  2XTI A;  2F3I A;  1QVF A;  4HIO A;  2OQ0 A;  5IP9 H;  3J81 i;  4HJ8 A;  4NXN Q;  4L5R C;  2YTV A;  4A3C G;  1NY4 A;  1UEB A;  3UDI A;  3CCV A;  3RZD H;  3CXC A;  3I4N H;  4PZ8 A;  2I5L X;  1L1O A;  3UE1 A;  1R9T H;  4A3F H;  2R92 G;  4DR7 L;  2ZM6 L;  5FLX c;  1VQJ A;  4O0A A;  3E9H A;  3CMA A;  4LF8 Q;  3S15 H;  3S16 H;  3D31 A;  2UXB L;  2FXQ A;  4A3I H;  4JYA Q;  4UPA A;  3RN5 A;  3TRZ A;  1G29 1;  1VQP A;  5IYD G;  2VS1 A;  1TWF H;  1KXL A;  4P75 A;  2JA9 A;  3KYH C;  2NVX H;  3CCE A;  4IPG A;  5GAG C;  1IBK L;  2HQL A;  4RG1 A;  3RLN A;  2ZJQ A;  1K8A C;  4LUO A;  4IJH A;  3CCJ A;  4AQY L;  4YHH L;  3PF4 A;  5M5X H;  1IL2 A;  4OX9 L;  3PO3 H;  1YJW A;  5M5W H;  2UXC L;  4NXN L;  3G48 A;  2PI2 A;  3EN2 A;  1KRT A;  3CF5 A;  1W2B A;  1A63 A;  1N33 L;  3AEV A;  5GRO A;  4KI0 A;  1VQ4 A;  5K36 G;  2E2I H;  2R7F A;  3S17 H;  3AQQ A;  3KDF A;  4DKA C;  4DR3 Q;  1AE2 A;  1N34 Q;  4LF8 L;  4A3G H;  2UUA Q;  4JYA L;  4A3L G;  3CC7 A;  2GVB A;  4P74 A;  1X56 A;  2HIX A;  3AFQ A;  4J15 A;  2IX0 A;  1S40 A;  4OO1 I;  1YHQ A;  2UU9 L;  2RHS B;  3NBH B;  3K7A H;  2CCZ A;  3S1R H;  1A0I A;  2K52 A;  5C0X I;  4IFD J;  1JJG A;  1E24 A;  4L5Q A;  1V9P A;  3KJP A;  3HKZ G;  4PZ6 A;  2JQO A;  1YEZ A;  3PV0 A;  4C3J H;  1PFS A;  4JI8 Q;  4GKK Q;  2RF4 A;  4L5T A;  4WJ3 M;  2CFM A;  3HKZ E;  4GLA C;  3RZO H;  3D0F A;  1KD1 C;  1TWH H;  3NEL A;  4DAM A;  3FKI G;  2CQO A;  4PMW A;  4X64 Q;  4DV6 L;  4LFA Q;  4A3M G;  3CD6 A;  4DR3 L;  1N34 L;  4POG A;  3KFU A;  4LFB Q;  1WYD A;  1JE5 A;  1NE3 A;  2Q2H A;  3DLL A;  2UUC Q;  2KHI A;  3KF6 B;  2JJQ A;  5IYC H;  4B3T L;  2VNU D;  4JI6 L;  1L1O C;  5GAE C;  4AYB G;  1VQM A;  3CC4 A;  4KHP Q;  5C4X G;  1IZ6 A;  1Y1V G;  1PH7 A;  2E8G A;  3WWV A;  4A3K G;  1QZG A;  2JA7 H;  4Y52 H;  2CKZ B;  1A8V A;  2Y0S G;  2A19 A;  2F4V Q;  1JB7 A;  2JA8 H;  1IXR A;  3MEF A;  4JBW A;  3TRE A;  1X6O A;  1HH2 P;  1B8A A; 
#chains in the Genus database with same CATH topology
 3CRK C;  4JV5 Q;  1VQO A;  4C3H G;  2WAC A;  4P72 A;  2A6E D;  2VB3 X;  1VQ6 A;  4IFD G;  2B2T A;  1KLU D;  3NBI A;  4X64 L;  3HOZ G;  2F1M A;  2V1C C;  3VYT A;  3C46 A;  3JC6 6;  3BJU A;  1YIJ A;  1MSG A;  2JEA I;  1G2T A;  1IL8 A;  1SE4 A;  2NZO A;  2QA4 A;  3M3Y B;  4KHP L;  3HOV G;  3U4V A;  5LL6 X;  4YY3 Q;  3MXN B;  3HOW H;  1STY A;  2ENB A;  2M00 A;  2G5D A;  4R4C A;  3WDN A;  3CME A;  1VQ7 A;  2JA6 H;  2FMM A;  4ALP A;  3PO2 B;  1O7L A;  2EE1 A;  4XT3 B;  5AJ3 L;  3M4O B;  2R3Z A;  5EKL A;  4X65 L;  2XIW A;  3VA5 A;  3W3A A;  4ZK9 B;  4DAY A;  1B44 D;  2VL6 A;  3QOL A;  3PIP 3;  4P2C B;  3K58 A;  3HGB A;  3KBX A;  3UDG A;  3A5U A;  2MGS A;  3K59 A;  4A3I G;  4RH6 A;  4OX9 Q;  2R93 B;  2UXC Q;  2UUB L;  1LM0 A;  1WTP A;  3VR6 A;  1K83 H;  4LF4 Q;  4LF9 L;  1DZ1 A;  3GTG H;  4MTN A;  1Q1E A;  2WAQ G;  3CQZ B;  1S5B D;  2NYZ D;  3S14 B;  3S1N B;  4KN7 C;  1M8A A;  4YCV A;  1K0S A;  1K28 A;  5C0X H;  3NQT A;  2WAQ E;  1MKH A;  4F7X A;  1IYV A;  2KQ3 A;  4BY7 B;  1TKW B;  2UU9 Q;  3GTL B;  1K8O A;  1EYG A;  4DUY L;  1KAW A;  4LNQ A;  3ERS X;  4CDE C;  1STN A;  2RCN A;  2VQE Q;  1GXD C;  1LAB A;  3ICE A;  2GVA A;  1SRU A;  3JAM L;  3HP3 A;  2F4I A;  2HD3 A;  3J7Z C;  3S1Q H;  1WD1 A;  1KQS A;  4JK1 C;  2ASB A;  3BZD B;  4EVO A;  4B3R L;  4DFA A;  1HXY D;  2PQA A;  2OTJ A;  1EL0 A;  4YWK A;  1EY6 A;  2EY2 A;  3GQB A;  2F0W A;  2E5L Q;  3RNU A;  2EYM A;  2B2Y A;  3F2U A;  3W5O A;  3A8J E;  5I6Y A;  1GM5 A;  1VQF A;  3LWE A;  2BA0 A;  3GTK H;  1ICF B;  1FJG L;  2B63 B;  3MA2 B;  3G71 A;  2F0U A;  1I4G A;  3F2C A;  3OTO L;  4DR4 L;  1WFQ A;  4QIW B;  2CW0 D;  4DV0 L;  1GD7 A;  2EPB A;  2LSS A;  3Q24 A;  5D3D A;  4HJA A;  1Y1W H;  4NMZ A;  4B3M L;  3K8A A;  1CHP D;  1XJV A;  1LTS D;  5I9O A;  1TXY A;  1GO3 E;  1EY9 A;  4DV2 L;  1S5D D;  2VW9 A;  4IUV A;  4DV4 Q;  4XIG S;  2C5C A;  4MNO A;  1EY8 A;  2KEN A;  2OXP A;  2A1A A;  2EY1 A;  4N9T A;  1FVI A;  3A74 A;  3CP0 A;  1QZH A;  3J7A 5;  4F87 A;  4NPS A;  2HIV A;  4DR2 L;  1Q12 A;  3MFG A;  1HNW Q;  3NTH A;  1D1K A;  4DGZ A;  5JJI A;  2YTX A;  1MI2 A;  3ULL A;  1J5E L;  1NR4 A;  1YIT A;  3PO2 G;  3TDQ A;  3M3Y H;  1PH8 A;  3AU7 A;  3I72 A;  5IP7 G;  1PV4 A;  4QCL A;  1SRO A;  1Q82 C;  5FOB B;  4JCV E;  2O4X A;  5J1Z A;  3VDY A;  2X6G A;  3MWY W;  2AHO B;  3M4O H;  3AB9 A;  3JAM c;  2EQS A;  3X3N A;  5KNB A;  1A15 A;  3SXH A;  1CKO A;  2K5D A;  2Z9H A;  5ELB A;  4FF3 A;  3I70 A;  3TSS A;  2KHS A;  5CV5 A;  3E6Z X;  4DA2 A;  1U0L A;  4RFB A;  1AP0 A;  4CKE A;  4AYB B;  4I65 A;  2IHE A;  2XNA C;  2R93 H;  1Q8I A;  3GDE A;  1EZ6 A;  4X3T A;  3J81 c;  4DV3 L;  4LF6 L;  2Y0S B;  5LMN Q;  1UE7 A;  4QMG A;  2L12 A;  2N55 A;  3VR3 A;  5EQ0 A;  1BF4 A;  1SJE D;  3TZD A;  2YTY A;  1HA6 A;  4G7H C;  3R2T A;  4IUP A;  3F8T A;  3H3V I;  4DK3 C;  1NR2 A;  1VF7 A;  4BY7 H;  4DU9 A;  2IHF A;  3KF8 A;  5J3B A;  3OMG A;  3GTL H;  2DY8 A;  2RDH A;  4HID A;  1PRT D;  2KEE A;  2ZJR A;  4U68 A;  3CCQ A;  4MTK A;  3FPU B;  4J1M A;  3X3M A;  2OTL A;  4I7A A;  2JA5 B;  1IYJ B;  1CZW A;  2L0C A;  2F0Q A;  3CCL A;  2E2J B;  2QDL A;  1LT3 D;  4LFC Q;  4OWW B;  2B63 G;  2ZXP A;  4WFN 3;  4DPG A;  2HQE A;  1J9O A;  2HHH Q;  1YNJ D;  1I94 Q;  3GV3 A;  3I4N B;  2H1E A;  4A3C H;  4A3F B;  4FVM A;  3CCU A;  4DF7 A;  2ID0 A;  5E3F A;  4KJO A;  3S16 B;  1CSP A;  4NB3 A;  1JCK B;  5EJW A;  3J80 i;  4QIW E;  1Q1B A;  2TMP A;  2QF7 A;  5IYD H;  1STA A;  4JI4 Q;  2Q2U A;  2OWO A;  3CPW A;  2QDB A;  3U50 C;  2A69 C;  4FXG C;  3HFZ B;  1WTX A;  5FJ8 G;  1LT4 D;  2K28 A;  2XGT A;  3BG3 A;  3HOU G;  4R9W A;  1LTL A;  2FIN B;  4APV A;  1DXM A;  5FLM G;  4ZKC B;  4K2K A;  4FF4 A;  1EEI D;  3NE5 B;  5K36 H;  1PHJ A;  4M8A A;  3F2B A;  5CGK A;  2NZH A;  1GUG A;  4G57 A;  5DM7 3;  3T1H L;  1MJC A;  4FO2 A;  3STB C;  1CKN A;  3K7A B;  4PZ7 A;  3RLO A;  4DXF A;  3H0G G;  1Q90 A;  2ZTD A;  3I4M G;  4C3J B;  2B2W A;  3KF8 B;  4IUR A;  5DAU A;  5KRU A;  4GNX C;  1ASY A;  4C2M H;  3RZO B;  1KHI A;  2K01 A;  5G3L F;  1XNQ Q;  1MJE A;  4H0L C;  3D3R A;  4DK0 A;  2B2V A;  1BCP C;  4DR6 L;  1QWY A;  2PCF B;  1KLG D;  1XPR A;  4AYB E;  2Q2T A;  5FO9 B;  2F0D A;  1JJ2 A;  2PZU A;  2K5V A;  2Y0S E;  4BS9 A;  4HJ9 A;  1PDQ A;  3MFY A;  4A3D G;  1SNM A;  1XMQ L;  3DWQ A;  4JI7 L;  1HNX Q;  5IWA L;  1HZA A;  3P75 A;  2VZA A;  1TS2 A;  2F03 A;  1L0X B;  5IGE A;  3PUZ A;  1Y1V B;  1EIH A;  4JI2 Q;  4IAL A;  1PH4 A;  4N8F A;  4U67 3;  3CW2 C;  2EJM A;  3C1F A;  1KL9 A;  3BU2 A;  1S72 A;  1XXG A;  3OOC A;  4GS3 A;  3NWT A;  3G6E A;  2EJG C;  4QF4 A;  2MO0 A;  4JI1 L;  4DR7 Q;  2ZM6 Q;  1ICW A;  1PTO B;  4POF A;  2K5Q A;  2F4V L;  1KTK A;  3SK4 A;  3FHW A;  1GJX A;  4DNI A;  4BA1 I;  3K80 C;  3E9I A;  5M3M B;  3DEP A;  2WB1 B;  4C1N I;  5M5Y B;  2NN6 H;  1I50 B;  2KOL A;  2IT1 A;  2IWH A;  2JA5 H;  3IRB A;  3OW7 A;  4R1J A;  5D3I B;  4AQY Q;  1G2S A;  2E2J H;  1J8I A;  1WD0 A;  4EQP A;  4HJ5 A;  5C4H A;  1QVF A;  5IP9 H;  1I4X A;  1UEB A;  3AMU A;  3I4N H;  1XTC D;  3A8K E;  2I5L X;  3UE1 A;  4A3F H;  2R92 G;  1QNU A;  1CQF A;  2K6A A;  4IUN A;  2KED A;  5C5L A;  1VQJ A;  3S15 H;  3S16 H;  3ERO A;  4UPA A;  3TRZ A;  1VQP A;  1WTR A;  2VS1 A;  1TWF H;  5BN5 A;  1R9T B;  4UHV A;  1VDZ A;  2JA9 A;  4CKB A;  2L11 A;  3CCE A;  4RG1 A;  2ZJQ A;  4IUU A;  4KY6 A;  4C56 C;  1QIL A;  4YHH L;  3W2D A;  1SEB D;  4CDC C;  3PF4 A;  2F0S A;  3VYR A;  4ZCK A;  5E4W C;  3DHQ A;  1I4R A;  5GRO A;  4DKA C;  2DJG C;  4IUQ A;  4ZKB B;  4DR3 Q;  1TWA B;  1N34 Q;  4LF8 L;  5M5W B;  1B50 A;  4C3I G;  3A8I E;  2IL8 A;  1RTO A;  1S40 A;  1YHQ A;  3MVV A;  3K7A H;  1C48 A;  1A0I A;  3MHB A;  5C0X I;  1TS4 A;  4ID6 A;  4IFD J;  2KUM A;  3GTQ B;  1YEZ A;  3FPP A;  3PV0 A;  4C3J H;  1PFS A;  1PFM A;  2Q8I B;  3V05 A;  3RZO H;  3D0F A;  4HCE A;  1B9M A;  4X64 Q;  1BCP F;  4LFA Q;  3KFU A;  1BR9 A;  1PFN A;  1NE3 A;  1WYD A;  2EY5 A;  2Q2H A;  5ELF A;  2KHI A;  1CM9 A;  3KF6 B;  3J7Y W;  3H94 A;  4OEM B;  4B3T L;  4BBR B;  5I6W A;  4JI6 L;  1L1O C;  4KHP Q;  2RDF A;  1Y1V G;  2B8G A;  1IKL A;  5ELC A;  1PH7 A;  1DCZ A;  5CV9 A;  4A3K G;  3CU7 A;  2CKZ B;  1TY0 A;  2A19 A;  3K57 A;  3FEW X;  1GHJ A;  3TRE A;  1AZP A;  3NQI A;  1U9R A;  2HUG A;  3W1G A;  2IY5 B;  1NNX A;  2PNH A;  3ZJY C;  5JVH 3;  5BN3 A;  5IGD A;  2A74 C;  2RKS A;  4DK1 A;  3IFD A;  5M3M G;  1HUN A;  3NEN A;  3IFT A;  4RA8 A;  1HNZ L;  1UWV A;  2QGQ A;  5J22 A;  4BBS G;  5FLX E;  5FO7 B;  1PTO H;  2UUC L;  1TWG B;  1JWS D;  3RUZ A;  1PH2 A;  4LF9 Q;  2KCN A;  4GLV B;  2R61 A;  4CHT B;  5M5Y H;  5T1G A;  1I50 H;  4HR7 B;  5AFW A;  1X9N A;  1RDP D;  1RF2 D;  4YCU A;  1VQH A;  3ONA B;  2QIL A;  1HUM A;  3A7A B;  4RWS C;  1IBM L;  3I90 A;  1IBK Q;  1A6X A;  4DUY Q;  1T9H A;  1IBL L;  2VUM B;  2O5J C;  5FK9 C;  3KK7 A;  4ULL A;  3OYY A;  2IX1 A;  5CV4 A;  4X3K A;  3FP9 A;  3CCM A;  4DR5 L;  5I9P A;  4R4T A;  4B3R Q;  2LY7 A;  1CA6 A;  3H15 A;  3EBE A;  1CA5 A;  2YU9 B;  2CWA A;  2B3G A;  3J80 c;  4A3J B;  3A5Z B;  1XMO L;  1VS0 A;  3EFX D;  5F2D A;  1PMR A;  1Q8K A;  1VQC A;  2RA4 A;  1EUJ A;  1LO5 D;  3PO3 G;  1V8Q A;  1X55 A;  4JBM A;  3V96 A;  3HOY B;  1MGS A;  1YVC A;  4JI0 L;  4JI5 L;  4A93 B;  5IIF A;  1KRS A;  2OCE A;  4ME3 A;  4CJ0 B;  4ODG A;  1TWA H;  1ENF A;  1KNA A;  1QJO A;  1Z6H A;  3QO2 A;  4DV0 Q;  2B2T C;  1V1Q A;  1C4Q A;  4GKJ L;  4DV6 Q;  4KKS A;  3T51 B;  1NBW A;  4EQ5 A;  1HR0 L;  4ABN A;  1HQM C;  4P73 A;  1D1I A;  1IW7 C;  2V4D A;  4X62 L;  2K05 A;  3EJI A;  1UAP A;  1TR5 A;  3GTQ H;  1DON A;  2L15 A;  1EQQ A;  4JBJ A;  3MZ5 A;  2WFW A;  3IAY A;  5CV7 A;  1SNC A;  5ELN A;  2X6L A;  3TME A;  3QWN A;  1J5E Q;  1WTW A;  1X3F A;  1OXS C;  4BBR H;  1IHZ A;  4ZRZ A;  2EY6 A;  4DV1 L;  2CH4 A;  3JAM E;  1BBW A;  3CPF A;  1PRT F;  3NEM A;  5JEA G;  2L55 A;  1HTL D;  2XSC A;  1NCV A;  1EU4 A;  1WJJ A;  4O2D A;  1HTP A;  5BR8 Q;  1VQ8 A;  4G4K A;  1ML0 D;  2F0J A;  3VR5 A;  3CCS A;  5C6A A;  1L1O B;  4IPD A;  2LXJ A;  1CFM A;  4HIM A;  1MD2 D;  3I56 A;  4AIM A;  1FGB D;  1TWG H;  1HFN A;  1X3G A;  1KC8 C;  1ZXT A;  2A69 D;  3HOW G;  4XYQ A;  1UE1 A;  3HKZ B;  1SN8 A;  3ULJ A;  4HJ7 A;  2JA6 G;  1Q86 C;  1CKM A;  1AE3 A;  1PFB A;  2H5X A;  2Z8L A;  2XVS A;  2K75 A;  4IOC A;  4NXM L;  1GUW A;  1QVC A;  4LF5 Q;  4JPB W;  2JXM B;  3E0E A;  2B2Y C;  1XNR L;  2VUM H;  1O7Z A;  1VQG A;  3TEH B;  1K8M A;  5DNF A;  5C4X B;  1XPU A;  2R7Z H;  1L0W A;  2N3S A;  2XRQ D;  3STB D;  1EEF D;  2Q2I A;  1WCM H;  4HMI A;  2F0O A;  1LYL A;  2WII B;  1K73 C;  4H02 A;  1RIP A;  1PLF A;  2KCC A;  4B3S Q;  2YU9 H;  5C0X G;  1N9W A;  5IT9 E;  1O7I A;  4HCS A;  5JPM C;  5LL6 S;  2D0O A;  4A3J H;  4Y7N B;  1SR3 A;  3BDC A;  1HA5 A;  3HKS A;  2BDN A;  1S4Z A;  2EIF A;  4HSV A;  3D6C A;  3H91 A;  3K5N A;  1OXV A;  3KLR A;  3HOY H;  1BCP D;  2MPM A;  1NMF A;  2G9H D;  4A93 H;  1DD2 A;  3PIO A;  1HFG A;  5M3F H;  2KCM A;  1KNE A;  1VF5 C;  1X32 A;  2I5M X;  3ERQ A;  1VQK A;  3A7L A;  5EGT A;  4J6H A;  5CBE E;  2JN4 A;  1O78 A;  3TP8 A;  1PZI D;  3SVM A;  2E75 C;  2C9O A;  1RD9 D;  2CVR A;  4DUZ L;  1X3Q A;  3MC0 B;  1E1T A;  3OIQ A;  4HSP A;  3U9O A;  4YWL A;  4OGQ C;  3K81 C;  5CR3 A;  5LMU L;  1G91 A;  1B4O A;  4DV5 L;  3J81 L;  5EAY A;  1EOT A;  3T1Y L;  2FJ2 A;  3T1H Q;  4KD3 A;  2OEO A;  4G7O C;  1M90 C;  1HZ9 A;  2M2L A;  4QUC A;  2NN6 I;  1Y1W G;  3PGZ A;  1HCZ A;  1PH3 A;  4R4O A;  4RAU C;  1STG A;  3MXP A;  1G6Z A;  1TQO A;  4GOP A;  1VQ9 A;  2E74 C;  4K8J A;  1HHV A;  5IGC A;  1KIX A;  3TP7 A;  2Q8T A;  1H9R A;  3EQL C;  2E2I B;  3OWF A;  1NJI C;  1DGS A;  1EY7 A;  5DLQ E;  4GLX A;  4DR6 Q;  2K50 A;  4A3G B;  4H7B A;  4DAY B;  5COY A;  4A3L H;  2MP1 A;  4DV7 Q;  1PZK D;  5HGT A;  1VCI A;  1NAP A;  2FFK B;  3S1R B;  4FXK C;  3OIP A;  1XMQ Q;  1EY5 A;  4JI7 Q;  1SNO A;  1EYC A;  5IWA Q;  1YJ9 A;  3R8B A;  3NTK A;  1VQ5 A;  2X69 A;  2N88 A;  1NTG A;  2ZT9 C;  1LT6 D;  2NTS A;  1A2T A;  3LGJ A;  5GAH C;  2UUA L;  5EBD A;  4WRD A;  3K7U C;  4O42 A;  3H3V C;  1TWH B;  3SGI A;  1T5X D;  4S3S A;  3VYU A;  4LF7 L;  3I4O A;  4JI1 Q;  5ELE A;  5H1S E;  1I4H A;  1EQV A;  4A3M H;  4WJ4 A;  4C2M B;  2NWG A;  2I0Q A;  1XPO A;  5ELD A;  4CDF C;  2UXD L;  4JI3 L;  2J7Z A;  4KY7 A;  2R93 G;  1G6P A;  2N49 A;  3SDZ A;  5C4X H;  4LMQ D;  2JA7 B;  1WTV A;  4GKK L;  1B3A A;  1CSQ A;  2JA8 B;  4TRD A;  2PQA B;  4HTH A;  1SLJ A;  4K5X A;  1D5M C;  1E2W A;  1PTO C;  4BY1 B;  3K5M A;  4LW1 A;  1DJR D;  2K5W A;  4C1N K;  1ILP A;  1PYS B;  3OSO A;  4OWT B;  4Y7N H;  4BY7 G;  3SHL A;  2K33 A;  2DJF C;  4WOR A;  3QOJ A;  4IPH A;  3WOF A;  1EWH A;  4GN4 B;  1XYI A;  2FMC A;  4UP9 A;  1E2Z A;  4GOP B;  4JV5 L;  1K3R A;  2GN5 A;  1D5X C;  4K5V A;  2L1B A;  3FDT A;  4PMB A;  4PMC A;  4YHH Q;  1BQQ T;  2KEC A;  3U4Z A;  3CKI B;  1LTA D;  3CHB D;  4HJ8 A;  1SFO B;  4CKC A;  5C3W A;  4A3C G;  3UDI A;  2G9D A;  2NBF A;  4PZ8 A;  1K3B C;  2B2W C;  2NUC A;  1LTI D;  1NSN S;  4LF8 Q;  1CZG A;  4RCO A;  2FXQ A;  1SE2 A;  1BO0 A;  3MXU A;  1SDF A;  1G29 1;  1FR3 A;  1U4M A;  2PNR C;  2BDO A;  5IYD G;  1KXL A;  1F9S A;  2B2V C;  1MBY A;  2A73 B;  3KYH C;  2AQ1 B;  3S15 B;  1A3U A;  1SBB B;  5GAG C;  2Z1C A;  3DUZ A;  4OL7 A;  3LX0 A;  3SEB A;  1TWF B;  5J39 A;  2SOB A;  3EA6 A;  4KK7 A;  2K04 A;  2RDG A;  4OX9 L;  4K2L A;  3HOX B;  1FD7 D;  2UXC L;  1YJW A;  4NXN L;  3G48 A;  2PI2 A;  3EN2 A;  3G7L A;  1ZKO A;  2F0E A;  4KI0 A;  5K36 G;  2E2I H;  5TSS A;  3C1E A;  1T5E A;  3KDF A;  5LHY 1;  4A3G H;  3R3O A;  4ZUI A;  1X56 A;  4UAI A;  3GTM B;  2HIX A;  1SSO A;  4J15 A;  1U4R A;  2UU9 L;  2RHS B;  3S1R H;  4L5Q A;  4XQQ A;  2JQO A;  4PQX A;  2IJ0 A;  4WJ3 M;  2H4O A;  3QIA A;  1KD1 C;  1TWH H;  3NEL A;  2CQO A;  3D4W A;  3C2P A;  3E0J A;  2UUC Q;  2SNS A;  5IYC H;  2VNU D;  4A3E B;  3CC4 A;  5GAE C;  4AYB G;  1TWC B;  3N52 A;  3BDO A;  1RHP A;  2JA7 H;  4Y52 H;  2Y0S G;  4XDX A;  4EGV A;  3A55 A;  2JA8 H;  1IXR A;  2IW3 A;  4MN3 A;  4JBW A;  1IW7 D;  1S5C D;  1X6O A;  1B8A A;  4JI8 L;  3PCO B;  3CRL C;  4BY1 H;  1I3Q B;  2PW7 A;  4GN3 B;  1J6Q A;  1STB A;  2OT2 A;  1V43 A;  5D65 A;  1SE8 A;  5I2X A;  4LFB L;  3NSW A;  4BXX H;  2JSO A;  1JOK A;  1JWM D;  2AUK A;  5CC4 A;  3U9S A;  1I6V C;  2CWP A;  1ROD A;  4H13 C;  5GQO A;  3RMH A;  2Z6K A;  4F88 A;  1K9M C;  3KJO A;  3LWU A;  2NN6 G;  1C0A A;  1D6E C;  3U58 A;  2JA5 G;  1SMY C;  1Q81 C;  1XMO Q;  1UNS A;  3S2D B;  3S2H B;  2WIN B;  1YHA A;  4OIJ A;  5IP9 G;  4KY5 A;  3H6M A;  4GN5 A;  3B6Y A;  1SFO H;  2YYZ A;  4JI0 Q;  3I4N G;  1E7Z A;  1W6K A;  4DNT B;  4A3F G;  5EPL A;  1AN8 A;  2Q8R E;  1AH9 A;  3K0Y A;  4KJN A;  1EQT A;  4K14 A;  4UP7 A;  4YCW A;  3TS2 A;  2ZJP A;  1LTR D;  1N33 Q;  4CJ2 C;  2B2U A;  4B9W A;  5IY0 A;  4OO1 H;  1CKN B;  4OXP A;  1HR0 Q;  3CC2 A;  1ENC A;  2E76 C;  3SK5 A;  2F0I A;  4RKB A;  2K4K A;  2DNE A;  3HG9 A;  1SAP A;  1EFI D;  3BDL A;  3A0J A;  1Y8P B;  3HOX H;  1Z9F A;  1RCV D;  2NB0 A;  5C44 B;  1MIU A;  2RVL A;  4HN7 A;  3PIP A;  5A2Q E;  5LMN L;  4A76 A;  2VB2 X;  1N36 L;  3PUW A;  1B9N A;  1VQL A;  2WV6 D;  5DEH A;  4DNR B;  3TS0 A;  5JEA J;  2IPK D;  2JYO A;  3QJY A;  1FNW A;  3GTM H;  4A3B H;  1S5F D;  1QG7 A;  4HAE A;  2F0K A;  1I6H H;  2IX3 A;  1FGU A;  3E3X A;  1JR0 D;  1Z47 A;  2AMC B;  4C3J G;  2VQF L;  1JMC A;  4HIK A;  1CUK A;  1IYU A;  2MUY A;  2ES2 A;  2EVB A;  3TP5 A;  4NDX A;  3PUY A;  3I91 A;  5HY6 A;  1YBY A;  3AFP A;  3BZK A;  2QEX A;  2HCC A;  4LFC L;  5BN4 A;  1EWC A;  2AQ2 B;  4DAP A;  4Z9C B;  4QL5 A;  1XX8 A;  2KBN A;  1TS3 A;  4IN3 A;  2F0T A;  3NK9 A;  3J80 L;  4A3E H;  1TWC H;  5IYB H;  1EIY B;  3DWA A;  3GO5 A;  2JK8 A;  1Q7Y C;  1TVX A;  1JOQ A;  5KYL A;  1PH9 A;  1YNN C;  3HRZ C;  2EOT A;  1M4V A;  3D8G A;  4KKT A;  2WKC A;  4WJW A;  2EDG A;  3Q6S A;  1BBX C;  1JOO A;  1SND A;  2HT1 A;  2O2L D;  4NXM Q;  2RSN A;  1ZYR C;  5KIX A;  1I4Q A;  2BH8 A;  1I3Q H;  3TZU A;  1ET6 A;  1XNR Q;  5AJ3 Q;  1R4Q B;  4GZY C;  4CJ1 B;  4IOA A;  1N32 L;  2D5D A;  4X6A H;  1JIC A;  3RLF A;  4X65 Q;  1N8R C;  2L5T A;  4L5S A;  1KDB A;  2JEB I;  3LNN A;  1QUQ A;  2BCO A;  2WB1 G;  2NZ1 D;  1HJP A;  4JOI A;  5A35 A;  1LT5 D;  3DWP A;  3UDX A;  4KN4 C;  2UUB Q;  2WB1 E;  1EIF A;  2EYH A;  4BWG B;  4Q5V A;  2XWJ B;  4LUV A;  2LXK A;  3S2D H;  3S2H H;  1SYD A;  2Z0S A;  3Q22 A;  4R8N A;  1X3P A;  4K0K L;  1EIG A;  3I55 A;  5M9O A;  3FRP B;  1YZ6 A;  4PNY A;  1HZC A;  3FKI B;  1D5Z C;  5IGF A;  1FYC A;  2ALY B;  4RGO S;  4QGU A;  1VQI A;  4MZ9 A;  3NXW A;  4JW0 A;  2ZXR A;  3T56 B;  2VY3 A;  3TN2 A;  1PH1 A;  2I46 A;  5C3X A;  1WTO A;  1A2U A;  2CHB D;  3NHH A;  1LUZ A;  3PMF A;  2AWN A;  2JP1 A;  2EJF C;  5C3E H;  3EIV A;  5IE8 A;  2BH2 A;  4XTC S;  2R7Z B;  1SNP A;  1WCM B;  4DUZ Q;  1MHW C;  4C3H B;  2NVY B;  3HZX A;  4KV6 A;  1KAA A;  4X66 L;  2D62 A;  1C7Y A;  2RSO A;  4OIK A;  1SE3 A;  4DV5 Q;  5C44 H;  1HNX L;  4ME5 A;  1E1O A;  1GUS A;  2MHV A;  5I4D A;  4R4I A;  3HOV B;  1TY2 A;  2HCI A;  1FJG Q;  2K7V A;  3ND8 A;  4LWC A;  4DAV A;  3OTO Q;  4DR4 Q;  4PG3 A;  3EVQ A;  5M3F B;  1QVG A;  1PTO D;  3P7J A;  3HEJ A;  3Q23 A;  3OMC A;  1WOC A;  4B3M Q;  1TS5 A;  2F52 A;  3F1Z A;  1II3 A;  5E7N A;  5HUR A;  3O13 A;  4G7Z C;  4DV2 Q;  3KLS A;  4A3I B;  2DGY A;  4DK6 C;  2AWO A;  1QUQ B;  4N8X 1;  1PH6 A;  4KD4 A;  1F77 A;  5CV8 A;  2NVX B;  2WAQ B;  4BBR G;  1GUT A;  1I5F A;  1YI2 A;  1CTM A;  2PZW A;  2Z6B A;  1ASZ A;  4DR2 Q;  1K8G A;  5M5X B;  2K5N A;  5KEE A;  3PUV A;  1BVS A;  1B3Q A;  2MO1 A;  3M4Q A;  2QW7 A;  1SYB A;  1HR0 W;  4IZ8 A;  2K5H A;  1NUC A;  1SMX A;  4LF7 Q;  3T4A C;  1C9O A;  2ZXO A;  1H9S A;  1A62 A;  2SDF A;  4QB4 A;  3DM3 A;  4KLK A;  2UXD Q;  2K03 A;  4JI3 Q;  4FNF A;  2TSS A;  1GKH A;  1P8L A;  3OWE B;  1B1Z A;  4JC0 A;  3J81 E;  4QJF A;  2F0P A;  1F2Z A;  3ER0 A;  2R6G A;  1EOV A;  1LTG D;  2K32 A;  5IOC A;  1Y69 U;  5JJK A;  4DV3 Q;  4LF6 Q;  3Q0A A;  2KJX A;  4RGT A;  5ELO A;  2B8F A;  2CQA A;  2VXW A;  4JBK A;  4KKU A;  5JAV A;  1MSH A;  3FKI H;  2VUM G;  2DNC A;  2OQK A;  3K0X A;  2R7Z G;  3S9W A;  4A3M B;  1WCM G;  3CCR A;  5IGG A;  2JE6 I;  1BDO A;  1PRT B;  2B29 A;  3M7N A;  1CHQ D;  1B2T A;  1JQY D;  4LFA L;  3NBH A;  4A3J G;  1AEX A;  4UP8 A;  4C3H H;  2NVY H;  1FNU A;  3BYT B;  4IFD H;  4GOP C;  5GAD C;  3ZYY X;  3AYH B;  3HOY G;  4QY7 A;  4TQU S;  3HOZ H;  4DR1 L;  4I7Z C;  1VQA A;  2ICI A;  4A93 G;  4RMF A;  3M4P A;  5JJL A;  5KND A;  5M3F G;  4K6L A;  1PH5 A;  3PF5 A;  2EXD A;  1CQV A;  3HOV H;  3J7A V;  2LKV A;  4K5W A;  2Z4H A;  1D2B A;  1X54 A;  2XRS D;  3GTP H;  4FDB A;  1Q3L A;  3TQY A;  4N9P A;  1H9S B;  1I4P A;  3BVZ A;  2F3I A;  4HIO A;  2OQ0 A;  4KTA A;  4NXN Q;  1BNZ A;  1NY4 A;  3E5S A;  2HDL A;  5FLX c;  3CMA A;  1HQR D;  2D2C C;  1SYF A;  3D31 A;  2UXB L;  4A3I H;  2XWB B;  2EZV A;  4NW2 A;  2EYF A;  4J8Q A;  2NVX H;  4ILW A;  3SK8 A;  2DN8 A;  3KBG A;  2HQL A;  1R4P B;  4ZUJ A;  1IBK L;  3RLN A;  3H09 A;  4IJH A;  1SMY D;  5M5X H;  1QE6 A;  1KRT A;  1F2L A;  1A63 A;  4DXG A;  2A68 C;  1VQ4 A;  1OO9 B;  3AQQ A;  4M1U B;  1AE2 A;  2E2H B;  2A6H C;  1AW7 A;  4JYA L;  4TSS A;  4A3L G;  3CC7 A;  3GV6 A;  4P74 A;  1DOL A;  3A56 A;  4OO1 I;  3IL8 A;  3QG1 A;  3NBH B;  2CCZ A;  3I4L A;  3ITP A;  5E1F A;  2K52 A;  4L8J A;  1STE A;  1JC7 A;  3SR1 A;  1JJG A;  1V9P A;  3HKZ G;  2DY7 A;  4PZ6 A;  2NVT B;  2KVM A;  4JI8 Q;  5KGU A;  5EBC A;  2BE5 C;  2CFM A;  3HKZ E;  5I2Y A;  1JWU D;  2SEB D;  1QOH A;  2QKI C;  4PMW A;  4DV6 L;  4A3M G;  3CD6 A;  1QNK A;  4LFB Q;  3DLL A;  2J0T D;  4RHS A;  1KAB A;  1S5E D;  1EZ8 A;  5C4X G;  1IZ6 A;  1EY4 A;  4HED A;  2E8G A;  1XWE A;  2F4V Q;  3GTJ B;  1JB7 A;  3HOU B;  1STH A;  3MEF A;  3VA7 A;  1GOZ A;  1JB3 A;  3URY A;  1KDA A;  3K5L A;  5EPJ A;  5IT9 L;  2J4X A;  2D0P A;  4IPC A;  1BUV T;  1PVO A;  1ENA A;  1VQE A;  4Q0F A;  5IGB A;  2I5H A;  1U5K A;  1PYB A;  3HS0 C;  3I2Z A;  4CBV A;  3PO2 H;  3NTI A;  1F2M A;  4R8I A;  2I07 B;  3H0G B;  2HDM A;  4MHE A;  3D6W A;  5IP7 H;  5KYI A;  5BR8 L;  3I4M B;  2ATW A;  2SNM A;  1YNN D;  4JVZ A;  4KHZ A;  2O5I C;  3VYS A;  1UEA B;  1ZYR D;  2WKD A;  2RCF A;  1F2Y A;  1UE5 A;  2OF1 A;  2A8V A;  2QEJ C;  1H9M A;  1N36 Q;  3CQZ H;  2WP8 J;  3F2D A;  3NP8 A;  4ZAI A;  3S14 H;  3S1N H;  1RJT A;  1ESF A;  4A3D B;  2PMZ B;  2P5Z X;  4FF1 A;  2F0G A;  4YY3 L;  2KHJ A;  4LF5 L;  3IKJ A;  2A5H A;  1G51 A;  1GVP A;  2VQF Q;  2F0H A;  3QB3 A;  2AQ3 B;  4JG2 A;  1U4P A;  1RKN A;  1DYQ A;  1ET9 A;  2PZT A;  1H9K A;  4A3G G;  1H9J A;  4V0B A;  3CAM A;  4B3S L;  2E2H H;  2N8N A;  3C3L A;  3TBI B;  4LF4 L;  4KMU C;  3GP7 A;  1ZEQ X;  3NWS A;  2M9V A;  1LTB D;  5COR A;  2B63 H;  5IT9 c;  4B3T Q;  2MFI A;  5EKK A;  2Z6K C;  4YIJ A;  3RR5 A;  1U4L A;  4JI6 Q;  4UY8 C;  4A3B B;  4EQN A;  1AFP A;  2AKW B;  3BZC A;  4IO9 A;  2NVT H;  5C4Z A;  2N78 A;  2A6E C;  2R92 B;  1I6H B;  1SYC A;  1ONL A;  5K5P A;  3S1M B;  5C4J B;  1DOM A;  3M4Y A;  3PUX A;  1BXT A;  2VQE L;  1L2F A;  4DN4 M;  1WVL A;  1N32 Q;  4YWM A;  1YNX A;  5IYC G;  2LS0 1;  4L6T B;  3BYY B;  3KLW A;  2JA7 G;  1HNZ Q;  1WI5 A;  2RQX A;  5FJ8 H;  2E5L L;  1D8L A;  1QCB D;  2F0M A;  4KHV A;  2JA8 G;  3GTJ H;  3HOU H;  2B2U C;  1CI3 M;  1LTT D;  4BY1 G;  3VR2 A;  4K0K Q;  5FLM H;  4E6I A;  3L7Z C;  5JVG 3;  4LJZ C;  2KA7 A;  1S3O A;  2C35 B;  3RD4 A;  1SYE A;  1PTO F;  4BXX G;  4C3I B;  5ISR A;  3T13 A;  4O1N A;  1IBM Q;  2MJ8 A;  3P20 A;  1IBL Q;  1G8Z D;  1W3S A;  4EQO A;  4EX5 A;  1EFW A;  4QQB X;  1UUP A;  4OEL B;  1WTQ A;  3OW2 A;  1NMG A;  2CH4 W;  1E3P A;  2L9H A;  3H0G H;  4XT1 B;  3I4M H;  1KDC A;  4DR5 Q;  1RL2 A;  1BBU A;  4B9X A;  3J80 E;  4DV4 L;  3BS1 A;  3DEO A;  1OXU A;  1AZQ A;  4X66 Q;  1B70 B;  4DV7 L;  4NP5 A;  3W1B A;  4TVA B;  1A3V A;  2K1B A;  4R4Q A;  4HMJ A;  5JJZ A;  4LK1 C;  1OXT A;  1SXT A;  1YHB A;  3PIO 3;  1HNW L;  3I8Z A;  3KDF B;  2R7D A;  2PMZ E;  2F0F A;  4OON A;  4A3K B;  1EYD A;  1WTH A;  1V1O A;  2LMC B;  4A3D H;  4JI5 Q;  4RKL A;  3K6O A;  3RN2 A;  4OO1 G;  1Y8N B;  2F0N A;  2YV5 A;  5C3E B;  2PPB C;  1LV9 A;  2NTT A;  4GKJ Q;  3HOX G;  3GTO B;  3L3O C;  5HGQ A;  3I3C A;  4BBS B;  2EYP A;  3S24 A;  3KF6 A;  1L0Y B;  1PYW D;  4RHR A;  4XYO A;  4X62 Q;  1DM0 B;  3BVM A;  3QR8 A;  2CW0 C;  1EWI A;  2RBM A;  4OHJ A;  1Y14 B;  2D9U A;  1CT1 D;  4ZYS A;  4A3B G;  4GNX A;  4K6D A;  3KOJ A;  3Q8D A;  2NVQ B;  1FL0 A;  5E4X A;  1BKB A;  4ZLT F;  2K14 A;  1EYA A;  3UDF A;  2F3W A;  5D14 A;  3MXG A;  2PW5 A;  3RZD B;  4JOI C;  1RTN A;  4IFD I;  1TU2 B;  4DV1 Q;  1EU3 A;  2ZTC A;  4P71 A;  4RCN A;  1F9Q A;  2R92 H;  3M9B A;  3SE0 A;  3S1M H;  3A54 A;  5C4J H;  1OXX K;  4FF2 A;  3I73 A;  1GUN A;  1M1K C;  5EKI A;  4UDU C;  5LMN W;  1PXU A;  4A3E G;  2F0L A;  1O80 A;  1LLR D;  3L2P A;  2BA1 A;  5IYB G;  4V19 0;  1YJN A;  4IUT A;  5CBA E;  4K8I A;  3PO3 B;  1PZJ D;  2HHH L;  5CYU A;  3M7G A;  2KCT A;  1I94 L;  3S17 B;  1O7Y A;  1P16 A;  3D4R A;  1EQR A;  1JT8 A;  5FO8 B;  3VR4 A;  2DUD A;  1B7Y B;  1D7Q A;  1VMP A;  1X3E A;  4C3I H;  3L0O A;  2B39 A;  1XTD A;  4JI4 L;  1QB5 D;  5JPN C;  1VQB A;  4B08 A;  1E22 A;  4X3S A;  3GD7 A;  1VQN A;  1Q46 A;  3KUP A;  5NUC A;  4IJL A;  2ZTE A;  5C0X J;  1PA6 A;  5JOB A;  3BVG A;  1DOK A;  2MNA A;  2PI2 E;  2A68 D;  3H3V H;  1C8C A;  4FYD A;  1X65 A;  3NPP A;  4F8M A;  4DR1 Q;  1PRT C;  1K0R A;  1UE6 A;  4GNX B;  2A6H D;  3T53 B;  1V1P A;  2BOS A;  3PSI A;  1JOR A;  3P1H A;  4LUZ A;  1Y1V H;  1SYG A;  1F9R A;  4OWX B;  1BCP B;  1ESR A;  4XXE A;  1JJC B;  4A3K H;  5C3E G;  4RGN A;  4AH6 A;  3D4D A;  3K5O A;  1EY0 A;  3FVQ A;  1Y8O B;  3I7F A;  2PQE A;  1GHK A;  4CGY B;  3T16 A;  2MQH A;  3UI2 A;  1YNJ C;  3ULP A;  1HRJ A;  3M85 A;  1LAC A;  3UE0 A;  2BE5 D;  1XNQ L;  1OTC A;  2RHQ B;  5C5M A;  1H95 A;  5M3M H;  1W6J A;  2E2D C;  4H44 C;  3GTO H;  3G4S A;  1HZB A;  1ILQ A;  4TKO B;  5C44 G;  2UXB Q;  4BBS H;  2QCP X;  1FNV A;  3J81 j;  1SJH D;  1E2V A;  5A2Q L;  3DXJ C;  4CDD C;  3OHX C;  3JAM i;  3HOW B;  1A3T A;  4FP5 D;  3HOZ B;  1BOS A;  5LMU Q;  2JA6 B;  1VQD A;  2LFN A;  4IQZ A;  5CV6 A;  2EXZ A;  3T1Y Q;  2EYO A;  2NVQ H;  4X3U A;  3R2I A;  4A4I A;  4A75 A;  4JI2 L;  2XTI A;  5FKA C;  4XQN A;  3FMC A;  3J81 i;  4L5R C;  2YTV A;  3PQI A;  5EPK A;  3RZD H;  1TT2 A;  3CCV A;  2F0V A;  3CXC A;  1L1O A;  1R9T H;  3GTP B;  4DR7 L;  5CMD A;  2ZM6 L;  1B53 A;  3E9H A;  4O0A A;  3ND9 A;  2FHT A;  4JYA Q;  3RN5 A;  1K83 B;  5KNC A;  3NUC A;  3GTG B;  4P75 A;  5G3L D;  3TP6 A;  3MAQ A;  2AUJ D;  4MIU A;  4IPG A;  1IKM A;  2PYK A;  3DM1 A;  1K8A C;  1SNQ A;  4LUO A;  3CCJ A;  4AQY L;  2ICE C;  1IL2 A;  3MXN A;  5IOD A;  3PO3 H;  5M5W H;  3CF5 A;  1W2B A;  4FXD A;  1N33 L;  3AEV A;  1E0B A;  3OPO A;  2PO4 A;  1V1P B;  2R7F A;  3S17 H;  1CK1 A;  3KLS X;  3SK6 A;  2L4N A;  4XQJ A;  2UUA Q;  2XN9 C;  1GUO A;  3S1Q B;  2GVB A;  3MEH A;  3J7A F;  3AFQ A;  2IX0 A;  1VMC A;  5DM6 3;  2GA4 B;  1E24 A;  3KJP A;  2F3V A;  3GTK B;  3DMU A;  4GKK Q;  2EYL A;  2RF4 A;  2Z4I A;  4L5T A;  3N6R A;  5FLX L;  4NKL A;  1JE4 A;  4L63 B;  4GLA C;  5L37 A;  2EYJ A;  3MTS A;  4QUF A;  4DAM A;  3FKI G;  4BA2 I;  4RGM A;  4DR3 L;  1N34 L;  3V2T A;  4POG A;  4PV1 C;  1JE5 A;  2JJQ A;  1F9P A;  1TII D;  1Y1W B;  1VQM A;  4LAA A;  1Z7T A;  3WOE A;  3WWV A;  1QZG A;  1A8V A;  3L9A X;  3R93 A;  4ZQ3 A;  5T1I A;  1HPC A;  5JEA H;  3G6J B;  1HH2 P; 
#chains in the Genus database with same CATH homology
 4BA2 I;  3W1G A;  4JI8 L;  3PCO B;  4JV5 Q;  2PNH A;  4BY1 H;  3ZJY C;  2IY5 B;  1VQO A;  4GN3 B;  4P72 A;  1J6Q A;  4IFD G;  1VQ6 A;  5M3M G;  1V43 A;  3NEN A;  1SE8 A;  2D0P A;  4X64 L;  3HOZ G;  4IPC A;  1HNZ L;  1PVO A;  1UWV A;  2QGQ A;  4BBS G;  4BXX H;  1VQE A;  2V1C C;  4LFB L;  3JC6 6;  2UUC L;  3BJU A;  1YIJ A;  2I5H A;  2CWP A;  1U5K A;  1PYB A;  2JEA I;  5GQO A;  2NZO A;  1PH2 A;  2QA4 A;  4KHP L;  3I2Z A;  3HOV G;  2Z6K A;  4LF9 Q;  3PO2 H;  1K9M C;  3U4V A;  3KJO A;  4YY3 Q;  2NN6 G;  1C0A A;  3MXN B;  4GLV B;  5IP7 H;  3U58 A;  5BR8 L;  2JA5 G;  3HOW H;  5M5Y H;  2ATW A;  1I50 H;  4R4C A;  3CME A;  1VQ7 A;  2JA6 H;  4ALP A;  1Q81 C;  1XMO Q;  4KHZ A;  5AJ3 L;  1X9N A;  1YHA A;  4YCU A;  1VQH A;  5IP9 G;  4X65 L;  1IBM L;  1IBK Q;  4GN5 A;  1T9H A;  3B6Y A;  2YYZ A;  1UE5 A;  4DUY Q;  1E7Z A;  2VL6 A;  1SFO H;  1IBL L;  4JI0 Q;  4A3F G;  2A8V A;  3UDG A;  3A5U A;  1AH9 A;  1N36 Q;  4A3I G;  3CQZ H;  2WP8 J;  3OYY A;  4OX9 Q;  3F2D A;  2IX1 A;  4DR5 L;  3CCM A;  3FP9 A;  2UUB L;  3S14 H;  1LM0 A;  3S1N H;  2UXC Q;  4R4T A;  4UP7 A;  4YCW A;  1K83 H;  3TS2 A;  3I4N G;  2ZJP A;  4LF4 Q;  1N33 Q;  4B3R Q;  4LF9 L;  4YY3 L;  3GTG H;  3H15 A;  2KHJ A;  4MTN A;  1Q1E A;  2WAQ G;  5IY0 A;  4LF5 L;  3EBE A;  1CKN B;  4OXP A;  1HR0 Q;  3CC2 A;  2CWA A;  2B3G A;  4YCV A;  3J80 c;  3A5Z B;  1XMO L;  1VS0 A;  2K4K A;  1G51 A;  2WAQ E;  1GVP A;  1MKH A;  1Q8K A;  1VQC A;  2VQF Q;  1EUJ A;  3PO3 G;  3A0J A;  1X55 A;  2UU9 Q;  4JBM A;  3HOX H;  1EYG A;  1YVC A;  1Z9F A;  4DUY L;  1KAW A;  4JG2 A;  4JI0 L;  4LNQ A;  3ERS X;  2RCN A;  1MIU A;  4JI5 L;  3PIP A;  5LMN L;  2VQE Q;  4A76 A;  3ICE A;  1KRS A;  2OCE A;  4ME3 A;  1N36 L;  3PUW A;  2GVA A;  4A3G G;  1SRU A;  1VQL A;  1TWA H;  3CAM A;  3TS0 A;  4B3S L;  2E2H H;  5JEA J;  3J7Z C;  2N8N A;  3S1Q H;  4DV0 Q;  1KQS A;  4LF4 L;  2ASB A;  4B3R L;  1V1Q A;  4A3B H;  3GTM H;  2PQA A;  2OTJ A;  4GKJ L;  4DV6 Q;  4YWK A;  1NBW A;  4EQ5 A;  1HR0 L;  2E5L Q;  2B63 H;  1I6H H;  5IT9 c;  4P73 A;  4B3T Q;  2MFI A;  1FGU A;  2Z6K C;  3RR5 A;  3RNU A;  4JI6 Q;  4UY8 C;  4X62 L;  1Z47 A;  2AKW B;  2AMC B;  3W5O A;  3GTQ H;  3BZC A;  2VQF L;  3GTK H;  4IO9 A;  1VQF A;  2L15 A;  2BA0 A;  1GM5 A;  1JMC A;  2NVT H;  1EQQ A;  4JBJ A;  1CUK A;  4HIK A;  2ES2 A;  2N78 A;  1FJG L;  2WFW A;  3PUY A;  5HY6 A;  3PUX A;  1YBY A;  3AFP A;  3BZK A;  3G71 A;  2QEX A;  2VQE L;  1L2F A;  3F2C A;  4LFC L;  3OTO L;  4DR4 L;  1N32 Q;  4YWM A;  1YNX A;  5IYC G;  5ELN A;  1WFQ A;  1J5E Q;  4QL5 A;  1GD7 A;  2LSS A;  4DV0 L;  4HJA A;  2KBN A;  1X3F A;  1OXS C;  4BBR H;  4A3E H;  1Y1W H;  4B3M L;  3K8A A;  3KLW A;  1TWC H;  1XJV A;  2JA7 G;  5IYB H;  1EIY B;  4DV1 L;  1HNZ Q;  1WI5 A;  5FJ8 H;  1TXY A;  3GO5 A;  1BBW A;  2JK8 A;  1GO3 E;  3CPF A;  1Q7Y C;  2E5L L;  1D8L A;  3NEM A;  4DV2 L;  5JEA G;  2VW9 A;  1PH9 A;  2JA8 G;  4DV4 Q;  4XIG S;  3GTJ H;  3HOU H;  4MNO A;  2KEN A;  2A1A A;  1FVI A;  4BY1 G;  1WJJ A;  4O2D A;  2HT1 A;  4NXM Q;  4K0K Q;  5FLM H;  3L7Z C;  3A74 A;  3CP0 A;  5BR8 Q;  1QZH A;  2BH8 A;  1I3Q H;  1VQ8 A;  3J7A 5;  3CCS A;  1XNR Q;  4NPS A;  2HIV A;  5AJ3 Q;  1S3O A;  4DR2 L;  2C35 B;  1L1O B;  1Q12 A;  4BXX G;  4IOA A;  4IPD A;  1HNW Q;  2LXJ A;  1N32 L;  4X6A H;  3RLF A;  4X65 Q;  1N8R C;  4HIM A;  5JJI A;  1IBM Q;  2YTX A;  3ULL A;  1J5E L;  2JEB I;  4L5S A;  3I56 A;  4AIM A;  1YIT A;  3PO2 G;  1TWG H;  1IBL Q;  1X3G A;  1W3S A;  4EX5 A;  1EFW A;  1QUQ A;  1KC8 C;  3M3Y H;  4QQB X;  2WB1 G;  3OW2 A;  1NMG A;  5IP7 G;  1HJP A;  4JOI A;  1PH8 A;  3HOW G;  1UE1 A;  1PV4 A;  1E3P A;  3H0G H;  1SN8 A;  1SRO A;  3ULJ A;  1Q82 C;  3UDX A;  4JCV E;  4HJ7 A;  2JA6 G;  4DR5 Q;  1Q86 C;  1RL2 A;  1CKM A;  2UUB Q;  1AE3 A;  2WB1 E;  1EIF A;  1BBU A;  2H5X A;  4DV4 L;  3VDY A;  4LUV A;  2LXK A;  2AHO B;  2K75 A;  3M4O H;  1OXU A;  3S2D H;  4IOC A;  3S2H H;  2Z0S A;  4X66 Q;  1B70 B;  4DV7 L;  3JAM c;  4NXM L;  4K0K L;  2EQS A;  1QVC A;  4TVA B;  3W1B A;  3I55 A;  4R4Q A;  1YZ6 A;  4LF5 Q;  1HZC A;  1CKO A;  2ALY B;  3E0E A;  4QGU A;  1VQI A;  4MZ9 A;  1XNR L;  1OXT A;  2VUM H;  1U0L A;  1VQG A;  1YHB A;  2VY3 A;  1HNW L;  3TEH B;  3KDF B;  1PH1 A;  2R7D A;  1XPU A;  2IHE A;  2R7Z H;  1L0W A;  2PMZ E;  2R93 H;  4OON A;  2N3S A;  3GDE A;  3STB D;  2Q2I A;  3J81 c;  1LUZ A;  1WCM H;  4DV3 L;  2AWN A;  4LF6 L;  4A3D H;  4JI5 Q;  5LMN Q;  5C3E H;  3EIV A;  1LYL A;  3RN2 A;  5IE8 A;  1UE7 A;  2BH2 A;  4OO1 G;  4XTC S;  1K73 C;  4H02 A;  1RIP A;  4B3S Q;  2YU9 H;  5C0X G;  1N9W A;  4DUZ Q;  1O7I A;  2YTY A;  4A3J H;  2D0O A;  2YV5 A;  1SR3 A;  3F8T A;  3H3V I;  4X66 L;  3HKS A;  2D62 A;  4DK3 C;  1C7Y A;  2EIF A;  3HOX G;  4GKJ Q;  4BY7 H;  2IHF A;  5J3B A;  1OXV A;  3GTL H;  3HOY H;  5HGQ A;  3S24 A;  3KF6 A;  4DV5 Q;  1NMF A;  5C44 H;  4HID A;  1HNX L;  4X62 Q;  4A93 H;  3PIO A;  2ZJR A;  1E1O A;  4R4I A;  1FJG Q;  3CCQ A;  5M3F H;  1EWI A;  2KCM A;  1Y14 B;  2OTL A;  1VQK A;  2I5M X;  4A3B G;  1IYJ B;  4GNX A;  3CCL A;  4LWC A;  3KOJ A;  3Q8D A;  3OTO Q;  4LFC Q;  4DR4 Q;  4OWW B;  2B63 G;  4PG3 A;  4DPG A;  1FL0 A;  1QVG A;  1BKB A;  4DUZ L;  2K14 A;  2HHH Q;  3UDF A;  1I94 Q;  1E1T A;  1WOC A;  4JOI C;  4B3M Q;  4IFD I;  4A3C H;  4YWL A;  2F52 A;  3F1Z A;  3CCU A;  4DV1 Q;  2ZTC A;  4P71 A;  3K81 C;  2ID0 A;  5E7N A;  2R92 H;  1CSP A;  3M9B A;  4DV2 Q;  5LMU L;  4NB3 A;  2DGY A;  4DV5 L;  3S1M H;  4DK6 C;  5EAY A;  3J80 i;  2AWO A;  5C4J H;  1QUQ B;  1PH6 A;  1OXX K;  4QIW E;  3T1Y L;  1Q1B A;  3T1H Q;  1M1K C;  1M90 C;  1HZ9 A;  5LMN W;  5IYD H;  4JI4 Q;  2NN6 I;  2Q2U A;  4BBR G;  4A3E G;  2OWO A;  3CPW A;  1I5F A;  1Y1W G;  1YI2 A;  3PGZ A;  3L2P A;  1PH3 A;  2BA1 A;  4R4O A;  3U50 C;  5IYB G;  3HFZ B;  5FJ8 G;  1ASZ A;  4DR2 Q;  1YJN A;  1K8G A;  2K5N A;  4GOP A;  1VQ9 A;  3PUV A;  2XGT A;  1BVS A;  2MO1 A;  3HOU G;  3M4Q A;  2HHH L;  1LTL A;  1HR0 W;  2K5H A;  2KCT A;  4APV A;  1KIX A;  1I94 L;  5FLM G;  1SMX A;  4LF7 Q;  1NJI C;  1C9O A;  1DGS A;  5DLQ E;  4GLX A;  4DR6 Q;  1A62 A;  1P16 A;  2K50 A;  1PHJ A;  3I4M H;  1EQR A;  4DAY B;  1JT8 A;  3F2B A;  2DUD A;  3DM3 A;  4KLK A;  1B7Y B;  2UXD Q;  2NZH A;  4JI3 Q;  4A3L H;  1D7Q A;  3T1H L;  1MJC A;  4DV7 Q;  1X3E A;  4C3I H;  3STB C;  3L0O A;  4JI4 L;  1XTD A;  1VCI A;  1GKH A;  1CKN A;  1P8L A;  4PZ7 A;  3RLO A;  4JC0 A;  1VQB A;  4QJF A;  1E22 A;  1XMQ Q;  4JI7 Q;  3ER0 A;  5IWA Q;  3GD7 A;  2R6G A;  1Q46 A;  3H0G G;  1VQN A;  1EOV A;  1YJ9 A;  2ZTD A;  4IJL A;  3I4M G;  1VQ5 A;  2ZTE A;  3KF8 B;  1NTG A;  5C0X J;  2UUA L;  3LGJ A;  5GAH C;  4GNX C;  1ASY A;  4C2M H;  1PA6 A;  5JJK A;  1KHI A;  3K7U C;  4DV3 Q;  4LF6 Q;  1XNQ Q;  5ELO A;  1MJE A;  2MNA A;  3SGI A;  4LF7 L;  2PI2 E;  3H3V H;  3I4O A;  4JI1 Q;  4JBK A;  4DR6 L;  5H1S E;  1X65 A;  3FKI H;  4A3M H;  4WJ4 A;  2VUM G;  4DR1 Q;  1XPR A;  4AYB E;  1K0R A;  2I0Q A;  1XPO A;  2Q2T A;  1UE6 A;  4GNX B;  2OQK A;  1JJ2 A;  2UXD L;  4JI3 L;  3K0X A;  2R7Z G;  2K5V A;  3PSI A;  2R93 G;  2N49 A;  1G6P A;  5C4X H;  2Y0S E;  1WCM G;  4LUZ A;  4HJ9 A;  1Y1V H;  4OWX B;  4GKK L;  3CCR A;  4A3D G;  1JJC B;  4A3K H;  1CSQ A;  2JE6 I;  4AH6 A;  5C3E G;  1XMQ L;  4JI7 L;  1HNX Q;  3I7F A;  2B29 A;  5IWA L;  3M7N A;  1HZA A;  2PQA B;  1SLJ A;  2VZA A;  4LFA L;  2MQH A;  3PUZ A;  4JI2 Q;  4A3J G;  4LW1 A;  1PH4 A;  3ULP A;  3M85 A;  1PYS B;  3CW2 C;  3UE0 A;  1XNQ L;  1OTC A;  4UP8 A;  4OWT B;  1KL9 A;  2NVY H;  2RHQ B;  3BU2 A;  4C3H H;  4Y7N H;  4GS3 A;  3G6E A;  1S72 A;  4BY7 G;  4GOP C;  1H95 A;  5GAD C;  5M3M H;  4JI1 L;  2MO0 A;  4DR7 Q;  3HOY G;  3AYH B;  4QY7 A;  2ZM6 Q;  3GTO H;  3G4S A;  1HZB A;  4TQU S;  3HOZ H;  4DR1 L;  5C44 G;  2UXB Q;  4POF A;  1VQA A;  2F4V L;  4BBS H;  4IPH A;  4RMF A;  4A93 G;  3FHW A;  4DNI A;  3M4P A;  3J81 j;  4GN4 B;  5JJL A;  4BA1 I;  3K80 C;  3E9I A;  5M3F G;  4UP9 A;  1PH5 A;  3PF5 A;  2EXD A;  3HOV H;  3JAM i;  4GOP B;  4JV5 L;  1K3R A;  2GN5 A;  5LMU Q;  2IT1 A;  2JA5 H;  1VQD A;  3IRB A;  4R1J A;  4AQY Q;  3T1Y Q;  4YHH Q;  2E2J H;  1X54 A;  2NVQ H;  3U4Z A;  3GTP H;  4FDB A;  3TQY A;  4A4I A;  4A75 A;  4HJ5 A;  4JI2 L;  2XTI A;  2F3I A;  1QVF A;  4HIO A;  2OQ0 A;  5IP9 H;  3J81 i;  4HJ8 A;  4NXN Q;  4L5R C;  2YTV A;  4A3C G;  1NY4 A;  1UEB A;  3UDI A;  3CCV A;  3RZD H;  3CXC A;  3I4N H;  4PZ8 A;  2I5L X;  1L1O A;  3UE1 A;  1R9T H;  4A3F H;  2R92 G;  4DR7 L;  2ZM6 L;  5FLX c;  1VQJ A;  4O0A A;  3E9H A;  3CMA A;  4LF8 Q;  3S15 H;  3S16 H;  3D31 A;  2UXB L;  2FXQ A;  4A3I H;  4JYA Q;  4UPA A;  3RN5 A;  3TRZ A;  1G29 1;  1VQP A;  5IYD G;  2VS1 A;  1TWF H;  1KXL A;  4P75 A;  2JA9 A;  3KYH C;  2NVX H;  3CCE A;  4IPG A;  5GAG C;  1IBK L;  2HQL A;  4RG1 A;  3RLN A;  2ZJQ A;  1K8A C;  4LUO A;  4IJH A;  3CCJ A;  4AQY L;  4YHH L;  3PF4 A;  5M5X H;  1IL2 A;  4OX9 L;  3PO3 H;  1YJW A;  5M5W H;  2UXC L;  4NXN L;  3G48 A;  2PI2 A;  3EN2 A;  1KRT A;  3CF5 A;  1W2B A;  1A63 A;  1N33 L;  3AEV A;  5GRO A;  4KI0 A;  1VQ4 A;  5K36 G;  2E2I H;  2R7F A;  3S17 H;  3AQQ A;  3KDF A;  4DKA C;  4DR3 Q;  1AE2 A;  1N34 Q;  4LF8 L;  4A3G H;  2UUA Q;  4JYA L;  4A3L G;  3CC7 A;  2GVB A;  4P74 A;  1X56 A;  2HIX A;  3AFQ A;  4J15 A;  2IX0 A;  1S40 A;  4OO1 I;  1YHQ A;  2UU9 L;  2RHS B;  3NBH B;  3K7A H;  2CCZ A;  3S1R H;  1A0I A;  2K52 A;  5C0X I;  4IFD J;  1JJG A;  1E24 A;  4L5Q A;  1V9P A;  3KJP A;  3HKZ G;  4PZ6 A;  2JQO A;  1YEZ A;  3PV0 A;  4C3J H;  1PFS A;  4JI8 Q;  4GKK Q;  2RF4 A;  4L5T A;  4WJ3 M;  2CFM A;  3HKZ E;  4GLA C;  3RZO H;  3D0F A;  1KD1 C;  1TWH H;  3NEL A;  4DAM A;  3FKI G;  2CQO A;  4PMW A;  4X64 Q;  4DV6 L;  4LFA Q;  4A3M G;  3CD6 A;  4DR3 L;  1N34 L;  4POG A;  3KFU A;  4LFB Q;  1WYD A;  1JE5 A;  1NE3 A;  2Q2H A;  3DLL A;  2UUC Q;  2KHI A;  3KF6 B;  2JJQ A;  5IYC H;  4B3T L;  2VNU D;  4JI6 L;  1L1O C;  5GAE C;  4AYB G;  1VQM A;  3CC4 A;  4KHP Q;  5C4X G;  1IZ6 A;  1Y1V G;  1PH7 A;  2E8G A;  3WWV A;  4A3K G;  1QZG A;  2JA7 H;  4Y52 H;  2CKZ B;  1A8V A;  2Y0S G;  2A19 A;  2F4V Q;  1JB7 A;  2JA8 H;  1IXR A;  3MEF A;  4JBW A;  3TRE A;  1X6O A;  1HH2 P;  1B8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...