1GVPA

Gene v protein (single-stranded dna binding protein)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
publication title Analyses of the stability and function of three surface mutants (R82C, K69H, and L32R) of the gene V protein from Ff phage by X-ray crystallography.
pubmed rcsb
source organism Escherichia coli
total genus 11
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1997-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1gvpA00
4AH6A 1BBWA 3U4ZA 1XPRA 1VQ7A 4JI4L 2YTVA 3IRBA 3K0XA 3KOJA 2BH2A 4R1JA 1KHIA 1CKNA 1IZ6A 2C35B 3KDFA 2WB1E 4UP8A 1QUQB 3TEHB 4IO9A 2UXDQ 4A93G 3BZCA 4DAMA 1PYSB 2ATWA 3CCJA 2OTLA 3E9HA 4RG1A 1PV4A 1N8RC 1VQGA 4OO1I 4PMWA 1EFWA 5IE8A 4QQBX 4IFDJ 1XMOQ 4LUOA 1PH4A 2UU9L 1TWFH 5IP9H 3GTLH 1GM5A 4IOAA 1N32L 4HIMA 4DV1Q 1MIUA 1ASYA 4L5SA 1KQSA 3GTOH 5HGQA 3PO3G 1BBUA 2N8NA 4P71A 2UUAQ 1BKBA 1LTLA 3HKZG 2UXDL 4YCVA 1G51A 1VQLA 3J7A5 2K52A 3KFUA 4GNXC 1YBYA 2K14A 1WI5A 3OTOQ 3HKZE 3U58A 3M4PA 3GTKH 4A3GG 4A3IH 4J15A 1XMOL 3BJUA 1PH1A 4BBRG 3PGZA 4JI2Q 1HH2P 1VQIA 2ID0A 4QJFA 4JV5Q 2GVBA 1TWAH 1UWVA 3CC7A 4DV1L 5C3EG 2D0PA 2DUDA 1B70B 1CKNB 3J81i 4HIOA 3KDFB 5IYDH 4A3FH 4A93H 4IPGA 2UUAL 3JAMc 4R4QA 4A3KG 1PH5A 3EIVA 5FLXc 4L5QA 1PFSA 4LF4Q 1K0RA 5M3MG 1VQKA 3J80i 3OTOL 1W3SA 4C2MH 3S1MH 3CXCA 1FL0A 1SR3A 3MXNB 4GS3A 3J7ZC 1YEZA 4OONA 1Q82C 4OWXB 1SFOH 3FKIG 4YY3Q 3KYHC 4MZ9A 4BY1H 3PUXA 4JI2L 3HOXH 4JV5L 2ZJQA 3H0GH 4LW1A 3U4VA 2NZOA 2PNHA 1J5EQ 4DNIA 3PF4A 1EOVA 1Y14B 1P16A 3STBC 4DR2Q 1W2BA 3W1GA 2ASBA 2QA4A 2R7DA 4A3EG 1JJCB 4DV4Q 4R4OA 3HFZB 5C0XJ 4LF4L 1XJVA 1A0IA 2KBNA 2HT1A 4DV3Q 2D62A 5M3FH 3RLNA 1AE2A 4GN4B 3WWVA 3K7AH 5LMNQ 1CKMA 4LF6Q 4YY3L 2NN6G 1TWCH 3NELA 3M4OH 5JEAJ 3B6YA 2Z0SA 3JC66 3L0OA 1PVOA 2XGTA 4A3BH 1K3RA 2E5LQ 4BXXG 3L2PA 4DR5Q 3KLWA 1KC8C 2QGQA 3M3YH 1J5EL 1Y1WG 1OXUA 2R93H 5GAHC 4DR2L 2R7FA 4AQYQ 1EIYB 1VQAA 1Z47A 3K8AA 4JBMA 4DV4L 3CCQA 2Z6KC 1N33Q 3I7FA 3RNUA 3I4MH 1E24A 4JI6Q 1RL2A 4DV3L 4BA2I 1VS0A 5EAYA 2V1CC 2AWOA 1HJPA 2K4KA 2K5HA 3RN2A 4BBSG 3I2ZA 5LMNL 4DV5Q 4LF6L 2RHQB 2IX1A 1PA6A 1VQJA 2RCNA 4R4CA 4GOPA 3OW2A 4JI1Q 4P74A 3JAMi 4KHZA 4APVA 4YWMA 1NTGA 2E5LL 1SLJA 4DR5L 4RMFA 4A3DH 1T9HA 4HJ8A 1YJ9A 2YV5A 4JOIA 1L1OC 4AQYL 2JA6H 1B8AA 2R92G 2UXCQ 4OX9Q 1N33L 3KJOA 4O2DA 4A76A 3UE0A 4JI6L 4LF5Q 1AE3A 4BY7G 2VQFQ 3HKSA 3D31A 3HOUG 3I4NH 5IY0A 4HJ5A 2WFWA 2E2JH 2Q2UA 3ICEA 5M5YH 4H02A 1A62A 4L5TA 4DV5L 4P75A 4BXXH 1HZ9A 3S1QH 4JI5Q 4JI1L 5FJ8H 1EYGA 2L15A 4IPHA 1Q8KA 5H1SE 1ASZA 5GAGC 3CCVA 1K83H 2JQOA 2YU9H 1OXSC 2N49A 2LXKA 3EBEA 4A3LH 3J81j 2UXCL 4OX9L 1HNZQ 2YTXA 1VQ8A 2JK8A 2UUCQ 4LF5L 3CC2A 4UY8C 1KXLA 5JJKA 2VQFL 4A3MH 3S16H 4DV6Q 1E3PA 4QL5A 4JBJA 1Y1VG 4GOPB 2EQSA 1B7YB 4FDBA 1XTDA 2I0QA 3H3VI 2OQKA 5GQOA 3SGIA 3Q8DA 3PIOA 4JI5L 3CMAA 3CCUA 3VDYA 3H15A 1IBKQ 4IFDG 4DR4Q 2F3IA 3T1YQ 1MJEA 3UDXA 1IL2A 1VQ5A 1HNZL 4BY7H 2K50A 3GTPH 2UUCL 3L7ZC 1X56A 4A75A 4DV6L 2VUMH 1C9OA 2E2HH 2I5HA 3G4SA 1CUKA 4JBWA 2VW9A 1FVIA 4NPSA 2KENA 4GN3B 3CCMA 1PH7A 1HNXQ 4JI7Q 3H3VH 4X66Q 1IBKL 4DR4L 2B3GA 4DK6C 3GTMH 2PI2E 3T1YL 1KRSA 1BVSA 1UE6A 1VQFA 4BA1I 1E7ZA 2GVAA 2A8VA 1NY4A 1VQHA 2CKZB 3S17H 4WJ3M 4JI0Q 4LUVA 3ULLA 1LUZA 1X6OA 1EUJA 1CKOA 3GD7A 3GTGH 1Q46A 1Y1VH 4DK3C 5IYBG 3CD6A 1EIFA 2H5XA 2NVTH 3AFPA 2R7ZG 1SN8A 2PI2A 4OWWB 1NMFA 2KCMA 2VZAA 2K5VA 4NB3A 4PZ6A 3I56A 2F4VQ 1V1QA 2ALYB 2A1AA 3HOZG 3F2DA 4POGA 2MFIA 2JA5G 3M9BA 1HNXL 1WCMG 3U50C 4JI7L 1UEBA 4X66L 3PO3H 2GN5A 4Y52H 4B3TQ 1VCIA 5DLQE 1J6QA 1S72A 3W5OA 3ER0A 1E1TA 3PCOB 4DR6Q 3CF5A 1I6HH 1YNXA 5JJIA 3KF8B 2B63G 4JI0L 5IYCG 3GTJH 1X9NA 2OWOA 4IOCA 1NE3A 4BBSH 4A3GH 1I5FA 5C0XG 1Q81C 2OTJA 3BZKA 3NEMA 2JJQA 2K5NA 4LUZA 4GOPC 2F4VL 2EXDA 4BBRH 1HR0Q 1V43A 4GNXA 1JE5A 3W1BA 5C3EH 1EQQA 1CSPA 2JEAI 3TS2A 3A74A 2Q2IA 5JEAG 2JA8G 3KF6A 2MO0A 4A3KH 4B3TL 3G48A 2JA7G 5C4XG 3UDIA 3GTQH 4JYAQ 3CCEA 4DR6L 1Q12A 3TRZA 3M7NA 1I94Q 5M3MH 2KCTA 5IYBH 3M85A 1HR0W 4LFCQ 4YCUA 4DR1Q 1WFQA 4HJ7A 2CCZA 2VY3A 5ELOA 1VQMA 1WJJA 4OXPA 3HOVG 2NN6I 1OTCA 1WOCA 1Z9FA 1VQ4A 2BH8A 3HOZH 4LFBQ 3FKIH 2JA5H 1VQBA 3D0FA 4DV0Q 3CCRA 1M1KC 2CWPA 1HR0L 1QZGA 3AEVA 1UE7A 3PSIA 3S1RH 4QY7A 2OQ0A 2R92H 3F1ZA 4KI0A 1A8VA 2HHHQ 2WAQG 4JCVE 4A3EH 4EX5A 4LFAQ 1PH6A 1VQEA 4JYAL 1G6PA 3T1HQ 3HOYG 3HOWG 1PH2A 4A3JG 4LFCL 1KAWA 2WAQE 4X65Q 5FLMG 4UPAA 1XPOA 4A3CG 2NVQH 3PUZA 4OWTB 4DR1L 3ERSX 2N78A 4X62Q 4HIKA 1OXTA 4HJ9A 4L5RC 1QVCA 1IBLQ 4C3JH 4LNQA 3G71A 2NVXH 4LFBL 2XTIA 5LMUQ 4LF7Q 4TQUS 4GNXB 2Q2TA 1FJGQ 4DV0L 3A5ZB 4DR7Q 1EQRA 1DGSA 3AYHB 4UP9A 3S15H 3F2BA 3KF6B 2ZJPA 3PIPA 1Y1WH 2HHHL 3RZOH 2MNAA 3K7UC 1X3FA 4KLKA 4LFAL 4B3SQ 5IP9G 3T1HL 2FXQA 2PQAA 1N36Q 2IHEA 4X65L 2CWAA 3NBHB 4JI8Q 2LXJA 4X62L 3TREA 3J81c 5K36G 2AKWB 1IBLL 1AH9A 4DV2Q 1PH8A 1PYBA 4GLXA 1JJGA 4LF7L 2ZJRA 5LMUL 4A3CH 2Z6KA 1H95A 1FJGL 1JT8A 4QIWE 1O7IA 4WJ4A 4DR7L 1D7QA 4P73A 4R4IA 4MTNA 3K80C 1YIJA 3J80c 2JEBI 3ULJA 4A3IG 1OXVA 1WYDA 3CW2C 4IPDA 4OO1G 4GKKQ 5M5XH 1X3EA 1X65A 3UDGA 2HIXA 3EN2A 1HZCA 4XIGS 1HZBA 2HQLA 3CPWA 1M90C 1JJ2A 4B3SL 1C0AA 1N36L 1JB7A 1IBMQ 3S2DH 1KRTA 1VQCA 4JI8L 3PUWA 3M4QA 4DR3Q 1SE8A 5IP7G 5IYDG 1SROA 4A3FG 3HOUH 1GD7A 3CMEA 1YZ6A 1D8LA 1L1OA 4DV2L 4A3JH 1C7YA 2IY5B 1OXXK 3FP9A 5JJLA 1N34Q 4IFDI 4DPGA 4ALPA 1JMCA 2AMCB 2VL6A 3PO2G 1KIXA 3I4OA 5GADC 3GDEA 4DKAC 4GKKL 5ELNA 2PQAB 1VQ9A 1X3GA 2DGYA 3PUYA 2F52A 2RF4A 3AFQA 3ULPA 3A0JA 4BY1G 1S40A 2JE6I 3HOXG 1PHJA 3RR5A 1IBML 4LF8Q 1VQ6A 4C3IH 4X64Q 2I5LX 3H0GG 1TWHH 1XNRQ 2Y0SG 2PMZE 4B3RQ 1E22A 4DR3L 5AJ3Q 1E1OA 3MEFA 1XMQQ 1QZHA 3UDFA 1NJIC 1XNQQ 2UXBQ 3AQQA 2ZTEA 4R4TA 2Y0SE 1N34L 1FGUA 3DLLA 1Q86C 1YITA 2JA9A 1YJWA 2I5MX 1K9MC 4LF9Q 2VQEQ 3TS0A 3PV0A 5M3FG 2IX0A 3RLFA 4C3HH 4QGUA 3PF5A 4ME3A 1X55A 4LF8L 5IP7H 1CSQA 2RHSB 4X64L 2AHOB 3PUVA 3A5UA 1XNRL 4A3BG 4B3RL 1L1OB 5AJ3L 1U0LA 2R93G 4B3MQ 4KHPQ 1XMQL 2UXBL 1VQPA 1GO3E 1PH3A 1XNQL 3CCLA 4PZ8A 4K0KQ 4LWCA 3PO2H 1SMXA 3I4MG 3CP0A 1GVPA 1YHAA 5IT9c 4UP7A 4Y7NH 2NZHA 4GKJQ 1IYJB 5IWAQ 2BA1A 3TQYA 4LF9L 2VQEL 4PZ7A 4IPCA 4AYBG 4JOIC 2WP8J 5C44G 4PG3A 1L0WA 4DUYQ 5GAEC 1K73C 2CQOA 1I3QH 3RLOA 3I55A 5J3BA 2R6GA 3FHWA 5C0XI 4AYBE 1QVGA 3NENA 4MNOA 1N9WA 1SRUA 5C4JH 4A3DG 2N3SA 1G291 2MO1A 2R7ZH 1I50H 4NXMQ 1RIPA 2CFMA 4B3ML 4KHPL 2IT1A 5M5WH 4DUZQ 1R9TH 2JA6G 3S1NH 4IJLA 4K0KL 1HZAA 4JG2A 1VQNA 2VS1A 1Q7YC 4GLAC 1P8LA 5BR8Q 1TWGH 4YWLA 1WCMH 2A19A 1A63A 4GKJL 4TVAB 1V9PA 5E7NA 4DV7Q 5IWAL 1HNWQ 3I4NG 1KL9A 4O0AA 3GO5A 1YI2A 2E8GA 4POFA 3RN5A 2D0OA 4DUYL 1YHBA 1MJCA 4IJHA 4DAYB 2K75A 3E9IA 2B63H 3RZDH 2ES2A 5IYCH 2IHFA 5FJ8G 1Q1BA 1PH9A 1UE1A 1Q1EA 1U5KA 1MKHA 4EQ5A 4GN5A 4P72A 4GLVB 2KHJA 5LMNW 2AWNA 1YHQA 1I94L 4XTCS 2MQHA 4NXML 2ZTCA 1XPUA 2B29A 3F2CA 1TXYA 4DUZL 2NVYH 3STBD 4NXNQ 4A3LG 4JI3Q 1QUQA 2ZTDA 3LGJA 1EWIA 2YYZA 5BR8L 1K8AC 2Q2HA 3ZJYC 4YHHQ 2UUBQ 4JBKA 2VNUD 3CPFA 1QVFA 5HY6A 5C44H 4DV7L 4A3MG 2JA8H 1HNWL 1L2FA 3S24A 5C4XH 2ZM6Q 2JA7H 3CC4A 1X54A 1YVCA 2QEXA 4JC0A 3DM3A 4JI4Q 3K81C 4YWKA 1GKHA 3CCSA 4HJAA 3BU2A 1IXRA 3E0EA 4A4IA 1VQDA 3HOVH 4AIMA 1K8GA 1LYLA 2YTYA 3F8TA 5GROA 4NXNL 3S2HH 4X6AH 3CQZH 4JI3L 4HIDA 1LM0A 2OCEA 2E2IH 2HIVA 2BA0A 2UUBL 4YHHL 1VQOA 2KHIA 3S14H 2LSSA 1KD1C 1NBWA 3OYYA 2VUMG 3KJPA 1NMGA 3UE1A 2ZM6L 1UE5A 3CAMA 1YJNA 2EIFA 3G6EA 2UU9Q 3HOWH 3HOYH 1N32Q 1S3OA 2WB1G 4YCWA 5FLMH
chains in the Genus database with same CATH superfamily
4DK0A 3HOVB 1TT2A 4R1JA 4X3SA 2RVLA 2WB1E 3KDFA 2UXDQ 2KCNA 3D6CA 1EYDA 3E9HA 4RG1A 1HUNA 3S14B 4OO1I 5IE8A 3TZUA 5NUCA 4IFDJ 5IP9H 1E2WA 3BYYB 4ODGA 3PO3G 4P71A 2UUAQ 3QR8A 2UXDL 1G51A 3CHBD 2L4NA 1VQLA 2WV6D 2QEJC 1YBYA 2K14A 1G91A 3HKZE 3U58A 3M4PA 3GTKH 1IKMA 1STGA 2EYMA 1WD0A 4OO1H 1DXMA 4RCOA 3GTLB 1PH1A 1PRTB 3HP3A 3CC7A 4HCEA 4RGOS 2XSCA 5C4ZA 1GUWA 2D0PA 5IYDH 1AP0A 2UUAL 3IFTA 3U9SA 5I9PA 4L5QA 2FINB 4RA8A 3U9OA 1ENFA 2LFNA 3K6OA 4MHEA 3FKIG 1EEFD 4MZ9A 2F0LA 4N8FA 2L12A 4CJ1B 4K8JA 1EOVA 1Y14B 3QOJA 2QA4A 4A3EG 1LTRD 1JJCB 3P20A 1LTTD 1F2LA 2F0GA 5BN3A 2KBNA 4DV3Q 3TDQA 1KDCA 1SYBA 3RLNA 4CKEA 2PMZB 2L0CA 3K7AH 2C9OA 2JYOA 5JEAJ 3IKJA 1OO9B 3K5LA 2XGTA 4FXKC 1Y1WG 2R93H 1CZGA 1TU2B 1EYAA 2R7FA 3ZYYX 1N33Q 3RNUA 2EE1A 3MXPA 2E76C 4DV3L 1VS0A 1D5MC 2V1CC 3RN2A 2K4KA 3I2ZA 4DV5Q 1EY9A 1TWCB 3M4OB 1VQJA 4R4CA 5KRUA 4I65A 3M3YB 5ELBA 4JOIA 3MZ5A 1L1OC 1N33L 3KJOA 1IL8A 1RJTA 1S5BD 1SMYD 1AE3A 1EOTA 3D31A 3HOUG 3J80L 2E2JH 1A62A 4L5TA 4DV5L 2QKIC 1HZ9A 3OOCA 1NUCA 5FJ8H 1WTWA 2CVRA 2R3ZA 3TBIB 2E75C 4KKSA 5H1SE 5GAGC 1QNUA 1ASZA 1AZPA 3NTHA 2N49A 2LXKA 1VMPA 3J81j 4KHVA 2WACA 3CC2A 4UY8C 3I4NB 3OIPA 1FNVA 1TR5A 4JBJA 1Y1VG 4GOPB 4ZCKA 2OQKA 3SGIA 4DU9A 3CCUA 2B2UC 1IBKQ 1YNND 2Z1CA 1K83B 1JWMD 2EDGA 2YU9B 3W3AA 3M4YA 1MJEA 4NMZA 2EY1A 2SNSA 2WKDA 1IL2A 4BY7H 1PTOB 2K50A 5ELEA 5E4XA 3V96A 2F3VA 3A54A 3K58A 2DN8A 3KF8A 2I46A 5BN4A 4A3MB 1X56A 1LT6D 2H4OA 5EKIA 4OEMB 3M7GA 2I5HA 3G4SA 1EEID 5JOBA 5L37A 4HSVA 1ILQA 5C6AA 3CCMA 1XTCD 1PH7A 1B3AA 4X66Q 1IBKL 4JI7Q 2F0HA 4QB4A 2PI2E 3JAML 2ICIA 1BVSA 1UE6A 1MD2D 3VYTA 1E7ZA 2CKZB 3ITPA 4WJ3M 3P75A 4JI0Q 1EQVA 1V8QA 1LUZA 1X6OA 3GD7A 1GXDC 2EOTA 2ZT9C 5IYBG 1SN8A 3MC0B 4OWWB 1RF2D 2KCMA 4PZ6A 1F2ZA 3HOZG 5FKAC 1J8IA 2MFIA 5I6WA 4JI7L 1UEBA 3SEBA 4X66L 4XYQA 4B3TQ 4EVOA 5DLQE 1O78A 3W5OA 2TSSA 3H91A 3S17B 5JJIA 1ZEQX 2B63G 4JI0L 3GTGB 1Y1VB 1X9NA 1NE3A 2F0OA 4BBSH 3A8JE 1BOSA 1Q81C 2OTJA 3BZKA 3NEMA 4LUZA 4GOPC 1EIHA 4C3JG 3QJYA 5C3EH 4RHRA 2JEAI 2R61A 2O5IC 1HTPA 3L3OC 4J8QA 5D3DA 4B3TL 5C4XG 3UDIA 1I6HB 3EA6A 4LMQD 3CCEA 4JYAQ 1Q12A 3TRZA 3M7NA 2KCTA 1HR0W 3GTJB 4LFCQ 2B2VA 4YCUA 1KLUD 4HJ7A 1VQMA 3NBHA 3D8GA 1JICA 4L8JA 4BBRB 1CA5A 1VQBA 4DV0Q 4ZLTF 1QZGA 3AEVA 4KY5A 1PFBA 2OQ0A 2L5TA 5EPJA 1SNCA 2HHHQ 4A3KB 5KYIA 3GTQB 2OEOA 4JCVE 2F0PA 4JYAL 3A7LA 4A3JG 4LFCL 4IUNA 5JVH3 3W2DA 4OWTB 4L63B 1BQQT 3HOZB 3G71A 4FXDA 5FOBB 3FRPB 4GNXB 2A6ED 1FJGQ 4DV0L 4DR7Q 3S1RB 1SYCA 1Q3LA 5DAUA 3PIPA 2HHHL 5JAVA 5JVG3 1X3FA 4KLKA 3E3XA 3MXGA 1QJOA 4G7ZC 4C3JB 4QCLA 1AH9A 2NVXB 2X6LA 1PYBA 3SDZA 2NZ1D 3OMCA 4KV6A 1VDZA 2ZJRA 1H95A 1FJGL 3R8BA 4DR7L 5C4XB 4R4IA 5J39A 1IW7C 1TKWB 3K80C 3J80c 4FXGC 4A3IG 1OXVA 4IPDA 4GKKQ 5J22A 2R92H 3P1HA 1D1KA 1STEA 4KKUA 3OWFA 1IBMQ 2TMPA 1KRTA 5IGDA 3PUWA 3P7JA 3EJIA 1T5XD 1SROA 3NXWA 4A3FG 3TP8A 4KTAA 3J80E 1YZ6A 2IY5B 3QOLA 4IFDI 4ALPA 1JMCA 1CK1A 1C4QA 2J7ZA 2VL6A 4IQZA 1I4PA 4DN4M 2K5WA 4GKKL 2PQAB 3ULPA 5FLXL 4BY1G 1S40A 3HOXG 2KCCA 1IBML 1VQ6A 2RCFA 4C3IH 1WD1A 2Y0SG 2PMZE 3SK6A 1H9SB 2ZTEA 3MVVA 3K57A 2DJFC 3MWYW 4IFDH 4CKCA 3E0JA 1YJWA 2EYHA 1K9MC 5EKLA 2VQEQ 1JCKB 2VB2X 4C3HH 1KABA 2HDMA 5IP7H 1TWHB 1A3TA 4A3BG 3PUVA 4IUPA 1MBYA 3UI2A 4JPBW 4B3MQ 4KHPQ 3NPPA 1H9JA 4K0KQ 3CCLA 4DNTB 4LWCA 1SMXA 1IYVA 1B1ZA 1GVPA 4GKJQ 2NZHA 1UNSA 5IWAQ 2BA1A 2VQEL 4AYBG 4CDFC 4PG3A 1Z7TA 1L0WA 4H44C 3RLOA 1QVGA 2R7ZH 2CFMA 4B3ML 4KHPL 4HN7A 4DUZQ 2JA6G 3S1NH 4KK7A 4K0KL 1S5FD 1VQNA 1WVLA 2RBMA 2A19A 1A63A 4GKJL 5G3LF 4TVAB 1NR2A 1V9PA 2MP1A 5E7NA 1BCPD 4DV7Q 1D6EC 4HTHA 1O7ZA 5IWAL 1PFMA 2D0OA 1I3QB 5A35A 5CYUA 3E9IA 3RZDH 2IHFA 3KK7A 3A8IE 1BUVT 1YHQA 1I94L 1I50B 4P72A 5LMNW 2KHJA 1JB3A 2MQHA 4OELB 4DUZL 4OHJA 4JI3Q 5LL6S 1QUQA 2PQEA 3I3CA 1FD7D 1WCMB 2M00A 2BDNA 2VNUD 1K8AC 2PNRC 2Q2HA 4X3TA 4JVZA 3CPFA 2F0JA 3DHQA 1QVFA 1YNNC 4DV7L 1QG7A 2EZVA 2PZUA 3CC4A 2X69A 1X54A 4A3BB 2XRQD 1LT4D 4JI4Q 3ONAB 4IALA 4HJAA 3HOVH 4HMIA 1LYLA 1D5ZC 4JI3L 2OCEA 4IUTA 3TSSA 2BA0A 4Q0FA 5EQ0A 3S14H 1KD1C 3OYYA 3KJPA 4YCWA 2UU9Q 1N32Q 1S3OA 1PRTD 4AH6A 1VQ7A 4JI4L 2YTVA 3IRBA 1CKNA 2C35B 4IO9A 3S2HB 3TEHB 3VYUA 3CQZB 1VQGA 2WAQB 1EFWA 4ZUJA 4QQBX 5I9OA 4LUOA 1PH4A 2UU9L 3GTLH 2ICEC 1N32L 4HIMA 1MIUA 4DNRB 2ZXRA 4CKBA 5DEHA 5K36H 1M4VA 1STBA 3NK9A 1WTRA 1HA6A 3D4RA 4KN7C 3OTOQ 2XN9C 4X3KA 4A3GG 5EBCA 4K2KA 4R8IA 1TWFB 3PGZA 4JI2Q 1HH2P 1VQIA 2FJ2A 1Y8OB 3SK5A 3J7AV 2KVMA 3J81i 1B70B 2ZXPA 3AB9A 3KDFB 5KNDA 4V190 4R4QA 3EIVA 4ZKCB 5FLXc 2K1BA 1PFSA 2K33A 1D2BA 5M3MG 5IT9L 1VQKA 3OTOL 1W3SA 1O7LA 3CXCA 1CI3M 1FL0A 3CKIB 2BDOA 3VR2A 4YIJA 4OONA 4OWXB 4YY3Q 3ND8A 2PCFB 4JI2L 4ID6A 1TWAB 4K14A 5FLXE 3BS1A 3Q24A 2NZOA 3DMUA 1J5EQ 4DNIA 2MJ8A 2BOSA 1PZID 4DR2Q 1W2BA 3H6MA 3W1GA 2ASBA 3D4DA 2AQ3B 4DV4Q 1E2VA 1NR4A 1XJVA 1R4QB 2DNCA 1EL0A 1LTBD 1AE2A 5I4DA 3D6WA 4YY3L 1MI2A 1KTKA 1TWCH 3M4OH 3CRKC 2Z0SA 1BXTA 4CJ0B 2E5LQ 3L2PA 3KLWA 3M3YH 1J5EL 1HPCA 5GAHC 4DR2L 1NCVA 1EIYB 1VQAA 1Z47A 4K5VA 4JBMA 4IUVA 3T56B 2Z6KC 4DV4L 1GUTA 3I7FA 1E24A 4JI6Q 5M3FB 2Q8TA 2IPKD 3BYTB 3X3MA 2AWOA 2K5HA 4RGNA 1PA6A 4ME5A 1QNKA 4YWMA 2E5LL 2JSOA 2MGSA 3IL8A 4KY6A 4HJ8A 1B4OA 1B8AA 2UXCQ 4OX9Q 3I4MB 4V0BA 1PTOD 4O2DA 4JI6L 3BVGA 2VQFQ 5KYLA 3I4NH 2QCPX 4JK1C 4UHVA 1V1OA 2Q2UA 3EVQA 1VF5C 4UDUC 1PMRA 5IIFA 4A3DB 3PIP3 4IPHA 4KN4C 1U4PA 1SYGA 3GV3A 4K5WA 1K83H 2YU9H 2KUMA 1I4XA 4A3LH 2UXCL 4OX9L 1CZWA 2YTXA 4XT3B 1PTOH 1STHA 1KXLA 5CMDA 2VQFL 4A3MH 4DGZA 4DV6Q 5M5YB 4QL5A 4F87A 1B7YB 2WINB 1F9QA 4H0LC 5GQOA 3CMAA 2LMCB 3PIO3 2F3IA 1JC7A 3VR3A 2G5DA 5FO7B 4WRDA 2JN4A 1UUPA 1EU4A 1QILA 4X3UA 3C2PA 3WOFA 1FNUA 4TKOB 2A6HC 4DV6L 1Q90A 1C8CA 1C9OA 1JE4A 2DY7A 1CUKA 2VW9A 1FVIA 4GN3B 3HG9A 2QILA 2I07B 4M8AA 1IW7D 1Y69U 3SK4A 2K28A 1PLFA 1GJXA 4BA1I 1W6JA 4PNYA 2GVAA 3Q0AA 1VQHA 1IHZA 1SAPA 3VR4A 3S17H 1NAPA 3GTPB 2O5JC 3NUCA 1Z6HA 3GTGH 4ABNA 3TP7A 1Y1VH 2VUMB 1BCPC 2PI2A 1DCZA 4QMGA 2A1AA 3PQIA 2JA5G 4JW0A 3GTMB 2K05A 2B39A 5E3FA 4Y52H 4S3SA 1J6QA 4DR6Q 3CF5A 1SYFA 1I6HH 1A15A 1KNEA 3KF8B 3VYRA 5IYCG 1UEAB 3GTJH 4RGTA 2NVTB 4CHTB 3VA5A 5C0XG 2EXDA 4BBRH 1HR0Q 3PO3B 4XXEA 3A74A 2JA8G 1CFMA 3KF6A 4A3KH 2JA7G 2EJFC 3GTQH 4DR6L 3T13A 5D65A 1ML0D 5IYBH 1GUGA 1WFQA 1ONLA 3H09A 1GOZA 4OXPA 2NN6I 4OIKA 3HOZH 4FNFA 1M1KC 2CWPA 1HR0L 2K04A 1EYCA 1PRTC 4QY7A 3S1RH 1CT1D 4FF1A 1HHVA 1PDQA 4G7OC 1HA5A 4RH6A 2K01A 4XQJA 3HOWG 3HOYG 4FO2A 1KAWA 2WAQE 3ERSX 2N88A 4C3JH 3FKIB 1Q8IA 2JA5B 2NVXH 2XTIA 2NN6H 4OL7A 3A5ZB 3H3VC 1DGSA 3AYHB 2RDGA 4UP9A 3F2BA 5KIXA 4K6DA 3DXJC 4A3EB 3K59A 1IKLA 3Q23A 2HD3A 2D9UA 5IP9G 2FXQA 2AUJD 2NVQB 5I6YA 4ZYSA 3NBHB 4JI8Q 1ZYRD 4P2CB 2K5DA 2CH4A 2AKWB 4DV2Q 5CBAE 4GLXA 1JJGA 2XNAC 1EY0A 3OIQA 1Y1WB 4MTNA 2PW7A 1BO0A 4HEDA 3RZOB 3MHBA 1WYDA 3CW2C 4OO1G 3UDGA 2HIXA 4XIGS 1HZCA 3CPWA 1HZBA 2KA7A 1M90C 3C3LA 2EYFA 4JI8L 4K5XA 5IYDG 2Q8RE 1VMCA 1HQRD 1GD7A 1I4GA 4U68A 4DV2L 1D8LA 1L1OA 1OXXK 2B2YA 4HSPA 5JJLA 1N34Q 2IX3A 2E74C 4DPGA 2F0DA 1STYA 2F1MA 3D3RA 3NTKA 1KIXA 2VXWA 5GADC 4DKAC 3HOYB 1S5CD 3MTSA 5M5XB 5ELNA 1X3GA 1M8AA 3PUYA 2F52A 3AFQA 5CR3A 3A0JA 3S2DB 5A2QL 3RR5A 1F9PA 4X64Q 1TWHH 3HOUB 4B3RQ 5AJ3Q 3KBXA 3MEFA 1QZHA 3UDFA 3T16A 1N34L 1Q86C 2J0TD 2F0TA 2JA9A 2NYZD 2I5MX 2OT2A 1X3PA 4FVMA 2IX0A 3RLFA 4QGUA 2B2VC 4QIWB 3PF5A 4ME3A 1TY0A 4XQQA 2B2WA 1CSQA 2L11A 4X64L 3A5UA 4B3RL 5AJ3L 1SJED 2R93G 4IUQA 1TY2A 1HCZA 1GO3E 1PZKD 5D3IB 3TMEA 3GTKB 1EWHA 2K5QA 3CP0A 1WTPA 4FYDA 3KUPA 1U4RA 3T51B 3TQYA 1PYWD 4ILWA 2FHTA 5GAEC 5COYA 3FDTA 1HFNA 1I3QH 2HCCA 1PTOC 2N3SA 3AMUA 3RUZA 1I50H 2EYOA 5EGTA 1RIPA 3MFGA 4IJLA 4JG2A 1Q7YC 2CH4W 5BR8Q 4E6IA 4PMCA 4Y7NB 1WCMH 4B9XA 5DNFA 1HNWQ 1KL9A 4FF4A 4IJHA 5AFWA 2PW5A 2ES2A 5FJ8G 1Q1BA 3TN2A 1MKHA 3I70A 4POGA 2AWNA 4F88A 4K2LA 3DEPA 4XTCS 1R9TB 1GHKA 3QB3A 3F2CA 4HMJA 3FVQA 2O4XA 3LGJA 5BR8L 3R93A 3ZJYC 4YHHQ 2A68D 2UUBQ 4JBKA 1X3QA 5HY6A 4FP5D 1CHQD 2O2LD 1HNWL 1L2FA 3S24A 2B63B 2QEXA 1SNPA 3OWEB 5C5LA 3A8KE 2Z4HA 2IJ0A 3HEJA 1GKHA 2A69D 4YWKA 3CCSA 5CGKA 4AIMA 1DOLA 2NVYB 3F8TA 3S2HH 1WTQA 3CQZH 2LKVA 2EJMA 2HIVA 2HUGA 2UUBL 4YHHL 1EIGA 2DY8A 3UE1A 3HGBA 2EIFA 3G6EA 3AU7A 1B44D 5K5PA 1VQFA 2WB1G 5FLMH 2EPBA 1BBWA 3V2TA 2QDLA 3K0XA 2M9VA 1CQVA 3KOJA 2BH2A 1KHIA 1IZ6A 1BCPF 1QUQB 3F2UA 4C56C 2FFKB 2D2CC 4HCSA 4A93G 2E2IB 1PYSB 2ATWA 3CCJA 1RODA 4CDEC 1PV4A 4R9WA 4PMWA 5I2XA 1SYDA 1XMOQ 1CQFA 2BCOA 3CRLC 2VB3X 3MXNA 5CORA 4A3JB 1TWFH 1DONA 3HRZC 3QWNA 4DV1Q 1ASYA 1KQSA 5HGQA 3NTIA 3HKZG 2PZWA 2E2DC 3J7A5 1MSGA 2K52A 4GNXC 5JPMC 1WI5A 4L6TB 3URYA 4N9TA 5LHY1 4J15A 1ESRA 1CM9A 1EY8A 1XMOL 2ID0A 4QJFA 2GVBA 1TWAH 1PFNA 1UWVA 4DV1L 3GTOB 5C3EG 1PZJD 1S5DD 2DUDA 3J7AF 1CKNB 3BVZA 4MTKA 3JAMc 1PH5A 1RCVD 1SNDA 4LF4Q 2KHSA 3SXHA 1PRTF 4A3IB 4O42A 4OGQC 4GS3A 1RTOA 2A6HD 1Q82C 3KYHC 4KY7A 3JAME 1KNAA 3PUXA 5A2QE 2OF1A 2ZJQA 1A3UA 1FGBD 3H0GH 5DM63 4A3FB 4A93B 3PF4A 2RDHA 2R7DA 4R4OA 3HFZB 3R2IA 4LJZC 4LF4L 4C2MB 1A0IA 4BS9A 3S1MB 2HT1A 3TP5A 3EQLC 2D62A 5M3FH 1SFOB 5CV6A 4IN3A 4GN4B 3WWVA 2AQ2B 1CKMA 4BY1B 3HOXB 3NELA 3IFDA 1E2ZA 1V1PA 1LACA 3B6YA 3L0OA 3HKZB 4ZAIA 2Y0SB 4BXXG 3J7YW 1ZYRC 3T4AC 3QIAA 4AQYQ 2F0KA 3CCQA 3I4MH 1LABA 4J6HA 4EGVA 3KLRA 3NHHA 4BA2I 2P5ZX 4XQNA 1HJPA 2ZXOA 3K5NA 2RHQB 1JQYD 2IX1A 5KNBA 2FMCA 2XVSA 4PMBA 3I90A 4P74A 4JI1Q 3I72A 1ENAA 1SLJA 2MUYA 4A3DH 1HQMC 5HGTA 2YV5A 3J81L 1A3VA 4AQYL 2R92G 1BDOA 4A76A 4LF5Q 1DJRD 2A5HA 5ELCA 1AFPA 4AYBB 4HJ5A 2WFWA 2F4IA 5M5YH 4H02A 1WTOA 1I4RA 4TRDA 4P75A 4EQNA 3FMCA 2F0SA 4JI5Q 3E5SA 4JI1L 4I7ZC 5CV4A 5IOCA 1EYGA 2L15A 1Q8KA 2Q8IB 4CJ2C 2JQOA 3QO2A 2JA6B 1OXSC 5IGCA 1NNXA 2K32A 5C3WA 1HNZQ 2UUCQ 4C3IG 4LF5L 5JJKA 1GUSA 3VR6A 1KDBA 1E3PA 3NP8A 2EQSA 4RWSC 4FDBA 3S1QB 2K7VA 4XYOA 4N9PA 1ET6A 4PV1C 1B3QA 1F2MA 3H3VI 2GA4B 3VR5A 4JI5L 3VDYA 3H15A 4IFDG 5T1GA 2CW0C 5CV9A 3T1YQ 4DF7A 4F7XA 2AUKA 3GQBA 1VQ5A 1HNZL 4RKLA 4XT1B 3GTPH 2UUCL 3S16B 2CQAA 3R2TA 4A75A 2VUMH 4NW2A 1FR3A 1EY6A 2F3WA 2F0QA 5IODA 2KENA 3H3VH 1PTOF 3KLSA 2B3GA 3GTMH 3T1YL 1HRJA 1KRSA 2A8VA 1O7YA 4LUVA 3ULLA 4K8IA 1EUJA 1CKOA 1G8ZD 3FEWX 1STAA 1STNA 4DK3C 3ERQA 2NVTH 2R7ZG 3AFPA 2E2HB 1GUNA 4ZRZA 2F4VQ 3I56A 1SNOA 2K5VA 4HR7B 1G2SA 2X6GA 3F2DA 3KLSX 2PZTA 3M9BA 3PO3H 1SDFA 1F77A 1VCIA 2EYLA 5ELDA 4IZ8A 1S72A 3PCOB 1E1TA 2DJGC 1ENCA 4IOCA 2A68C 1ZKOA 2JP1A 2F4VL 1FNWA 4BWGB 1SE2A 1SNMA 1V43A 4ULLA 1JE5A 3TS2A 2QDBA 3OSOA 1TS2A 2A69C 5JEAG 3G48A 3BDCA 4ZK9B 2SNMA 3MXUA 3SHLA 4A3GB 4DR1Q 1T5EA 3FPUB 2CCZA 2VY3A 1H9KA 1SXTA 1WJJA 1EY4A 3HOVG 1TQOA 1WOCA 1Z9FA 2F0UA 3FKIH 2F0VA 2JA5H 3NQTA 2A73B 3D0FA 2KQ3A 3BDLA 3PSIA 4KI0A 1A8VA 3EROA 3WDNA 4A3EH 4EX5A 1II3A 1B50A 1VQEA 1K0SA 5M3MB 1G6PA 1KAAA 3MEHA 1PH2A 4LAAA 1RDPD 4A3CG 1XPOA 4UPAA 3SVMA 2NVQH 4KD4A 4DR1L 3S1NB 4X62Q 4L5RC 1IBLQ 1B53A 4NDXA 5D14A 4LF7Q 1JORA 1W6KA 3KF6B 1Y1WH 3TP6A 2Z4IA 2KEEA 3WOEA 3RZOH 3K7UC 4H7BA 1N36Q 4KD3A 3NE5B 2PPBC 1JR0D 1GUOA 4X62L 3J81c 3A56A 5K36G 1IBLL 1MGSA 2B2TA 4G7HC 4LF7L 1SSOA 2Z6KA 1JT8A 2H1EA 1D7QA 4P73A 3S15B 1YIJA 1SYEA 3I73A 3ULJA 3RD4A 5M5XH 3J81E 1X3EA 3DWQA 2F0MA 1C0AA 2F0WA 1N36L 2HDLA 3S2DH 4HAEA 1VQCA 4DFAA 1U4LA 3M4QA 1SE8A 3QG1A 3HOUH 1KDAA 2G9DA 2F0NA 1EY7A 1C7YA 2RDFA 2RQXA 3PO2G 3I4OA 4KMUC 1SEBD 3BZDB 1DD2A 2JE6I 2XWJB 4DAVA 1E1OA 1XMQQ 1HFGA 1RHPA 1NJIC 2UXBQ 1K8MA 3LNNA 2Y0SE 4QUFA 3GP7A 3DWAA 2D5DA 1YITA 1I4HA 1GHJA 4LF9Q 3TS0A 1L0YB 1TS4A 1X55A 4DXFA 2DNEA 5EPKA 4DK1A 4DAYA 1QB5D 3MA2B 1L1OB 1XMQL 2UXBL 1ICWA 4O1NA 1VQPA 4PZ8A 1SBBB 1D5XC 1YHAA 5IT9c 4Y7NH 1IYJB 5IGFA 4LF9L 5CBEE 4PZ7A 1EZ8A 3KBGA 4IPCA 4JOIC 2WP8J 5C44G 4DUYQ 2OXPA 3NBIA 4B08A 4IUUA 3I55A 5J3BA 4KKTA 2R6GA 3FHWA 2LY7A 4AYBE 5IGEA 3E6ZX 3NENA 1N9WA 1SRUA 3DUZA 2MO1A 5IT9E 4NXMQ 1R9TH 3PO2B 5C3XA 2VS1A 1EWCA 4CDCC 3HS0C 5CV7A 2Z6BA 3Q6SA 3O13A 4Z9CB 3I4NG 5DM73 3GO5A 1YI2A 2E8GA 2EY2A 4DUYL 1YHBA 2K75A 2B63H 5C4JB 2RA4A 1U5KA 4EQ5A 4BBSG 4GLVB 3C1FA 1XPUA 5M5WB 4NXML 2NVYH 3GV6A 1TS3A 4A3LG 2KOLA 4ZQ3A 2EVBA 1TWGB 2ZTDA 1WTHA 1EWIA 5I2YA 2YYZA 4CDDC 4A3MG 4KJNA 1XXGA 5C4XH 2ZM6Q 1CHPD 5IGGA 1YVCA 1BF4A 3NQIA 4JC0A 1QE6A 3DM3A 3K81C 1KLGD 4G4KA 1IXRA 4A4IA 1VQDA 3OHXC 2B2YC 2KJXA 2YTYA 4RCNA 2AQ1B 1RTNA 4OIJA 5GROA 1DM0B 5E4WC 2E2IH 3NWTA 5FK9C 4ZUIA 3H94A 5C44B 5BN5A 1VQOA 2JA8B 3VYSA 2JA7B 1NBWA 2ZM6L 4R8NA 1YJNA 1AZQA 1JOQA 4A3JH 1R4PB 3U4ZA 1XPRA 2J4XA 4G57A 5JPNC 2WKCA 4UP8A 1XWEA 2IWHA 4UAIA 3BZCA 4DAMA 3OMGA 2EYJA 1DYQA 4PQXA 2OTLA 2F03A 5IGBA 1N8RC 4J1MA 2SDFA 1MSHA 1H9MA 3PMFA 4K6LA 1VF7A 2B2WC 3IAYA 4RKBA 3HOWB 4BBSB 1G2TA 1GM5A 4IOAA 4L5SA 3GTOH 1BBUA 2N8NA 1BR9A 1BKBA 1LTLA 2L1BA 5EPLA 1JOKA 4YCVA 1LLRD 3KFUA 3DM1A 4A3IH 1DOKA 4FF2A 3C1EA 3BJUA 4BBRG 2BE5D 4JV5Q 3FPPA 4XDXA 2XIWA 3N52A 4HIOA 4A3FH 4A93H 2B2UA 5TSSA 4IPGA 2CW0D 4A3KG 1IYUA 1RD9D 1K0RA 4FF3A 3J80i 5KNCA 4NKLA 4C2MH 3S1MH 1I4QA 1SR3A 3MXNB 3J7ZC 1YEZA 1SFOH 1QOHA 4BY1H 4JV5L 3HOXH 3DEOA 4F8MA 1K8OA 4LW1A 3U4VA 2PNHA 2RSNA 1P16A 3STBC 2HCIA 5C0XJ 2XWBB 2G9HD 2L55A 1JWUD 4DA2A 3L9AX 5LMNQ 4LF6Q 1K3BC 2NN6G 1G6ZA 3JC66 1PVOA 4A3BH 1K3RA 3G7LA 4DR5Q 1KC8C 2QGQA 3NSWA 1OXUA 2NBFA 3K8AA 1ICFB 1RL2A 1TIID 5EAYA 1YNJD 1A2TA 4CGYB 1X32A 3K7AB 3A7AB 5LMNL 2F0FA 4LF6L 1TVXA 2RCNA 4GOPA 3OW2A 4I7AA 1C48A 4KHZA 4APVA 3JAMi 2B8GA 1NTGA 4DR5L 4RMFA 4WFN3 4RAUC 2R93B 1ESFA 1T9HA 2LS01 1YJ9A 1S5ED 4ZKBB 2JA6H 1B2TA 3VA7A 5ELFA 3UE0A 4BY7G 3HKSA 5HURA 1EY5A 5IY0A 2F0IA 3ICEA 1HXYD 1V1PB 2JXMB 4BXXH 3S1QH 5E1FA 5EBDA 4RHSA 5C5MA 5CC4A 3CCVA 1XX8A 2EYPA 3EBEA 3I8ZA 2SEBD 3BDOA 1EZ6A 1F9SA 1VQ8A 1CTMA 2JK8A 2KEDA 4Q5VA 1LTGD 3D4WA 3S16H 2E2JB 1EFID 1B9NA 1LV9A 2Z8LA 1XTDA 2I0QA 3Q8DA 3PIOA 1LTID 1ZXTA 4DR4Q 3NWSA 3UDXA 1Y8NB 2Z9HA 3LWEA 3BG3A 1MHWC 5FO8B 3CU7A 3L7ZC 3TZDA 2A74C 4NP5A 2E2HH 3X3NA 5JJZA 4JBWA 4DXGA 4NPSA 1HNXQ 4DR4L 4DK6C 2K03A 4C1NK 1AW7A 4B9WA 4BY7B 1NY4A 1F2YA 2EY5A 3BVMA 1U9RA 1Q46A 3CD6A 1LTSD 1EIFA 2H5XA 3K0YA 3V05A 1NMFA 1EQTA 2VZAA 4NB3A 1V1QA 2ALYB 2CHBD 1FYCA 2WB1B 5CV8A 1HNXL 1WCMG 3U50C 1J9OA 2GN5A 3SR1A 3ER0A 5ISRA 4QUCA 1YNXA 3OW7A 2M2LA 2OWOA 1U4MA 2QF7A 4A3GH 1I5FA 1HUMA 3Q22A 2JJQA 2K5NA 2WIIB 5KEEA 2ENBA 1K28A 1JOOA 4GNXA 3W1BA 1EQQA 2MHVA 2XRSD 1SNQA 1CSPA 3MAQA 2Q2IA 3I4LA 2MO0A 1E0BA 1S4ZA 1QWYA 1I94Q 5M3MH 1SMYC 3M85A 1L0XB 1EU3A 2L9HA 4M1UB 1D1IA 3DWPA 5ELOA 1SE3A 1OTCA 1VQ4A 4LFBQ 2BH8A 1WTVA 1QCBD 3CCRA 2V4DA 5C3EB 1UE7A 4LK1C 1LO5D 4EQPA 3F1ZA 5EKKA 4GZYC 3SE0A 2WAQG 3N6RA 4LFAQ 1PH6A 3T1HQ 5J1ZA 5FLMG 4X65Q 3PUZA 2N55A 1NSNS 2N78A 4HIKA 1OXTA 4HJ9A 2EXZA 1QVCA 3SK8A 4LNQA 4KJOA 4LFBL 5LMUQ 4TQUS 2Q2TA 1EQRA 1F9RA 5JEAH 3S15H 2ZJPA 2RKSA 2MNAA 5LL6X 1RKNA 4LFAL 4B3SQ 1WTXA 3T1HL 2PQAA 3K5OA 2IHEA 1JWSD 4X65L 2CWAA 2LXJA 3TREA 2NWGA 1UAPA 1PH8A 5LMUL 2F0EA 1H9SA 4QIWE 1O7IA 4WJ4A 2BE5C 2SOBA 3EFXD 2JEBI 1X65A 4RFBA 3EN2A 1JJ2A 4A3CH 1HTLD 2HQLA 4B3SL 1DZ1A 1JB7A 1LTAD 4C3HG 1DOMA 5CV5A 5KGUA 4DR3Q 5IP7G 3CMEA 3FP9A 2EY6A 3S9WA 2AMCB 1TS5A 4MIUA 3GDEA 2NUCA 1BBXC 2R92B 1O80A 3RMHA 1VQ9A 2DGYA 2IL8A 2RF4A 1PHJA 4LF8Q 5G3LD 2I5LX 3H0GG 1PXUA 4DAPA 1XNRQ 1E22A 2K6AA 4H13C 4DR3L 1XNQQ 3I91A 3AQQA 4R4TA 1CA6A 1FGUA 3DLLA 1B9MA 4WORA 1AN8A 3LWUA 3PV0A 5M3FG 2NTTA 5FO9B 5C4HA 3C46A 2MPMA 4LF8L 4C3IB 2RHSB 2AHOB 1XNRL 2FMMA 1U0LA 1YNJC 1XNQL 1PH3A 2C5CA 3PO2H 2IW3A 3I4MG 4UP7A 4MN3A 4C3HB 3T53B 1K73C 1AEXA 2B8FA 2CQOA 5C0XI 4MNOA 5C4JH 4A3DG 1G291 1ILPA 2IT1A 5M5WH 2A6EC 5EJWA 2QW7A 1HZAA 3HZXA 4GLAC 1P8LA 4IURA 1TWGH 4YWLA 3ND9A 1LT5D 1SE4A 4EQOA 1BNZA 3R3OA 4O0AA 3H0GB 4POFA 3RN5A 1A6XA 1MJCA 3LX0A 4DAYB 3MFYA 2HQEA 5IYCH 1PH9A 1UE1A 1Q1EA 2B2TC 2R7ZB 4GN5A 3OPOA 1H9RA 4QF4A 4U673 5C0XH 2ZTCA 2B29A 3K5MA 1TXYA 3STBD 4NXNQ 1XYIA 2EJGC 5M9OA 5C44H 2JA8H 2JA7H 5F2DA 3G6JB 4C1NI 2PYKA 3RZDB 4RGMA 3BU2A 3E0EA 1K8GA 4NXNL 4X6AH 4HIDA 1LM0A 2NB0A 4TSSA 1ET9A 1LT3D 2KECA 4N8X1 5T1IA 1I6VC 3A55A 1A2UA 1BCPB 2KHIA 2LSSA 2RSOA 1SJHD 2VUMG 1NMGA 1UE5A 3CAMA 2NTSA 1Y8PB 3HOWH 3HOYH 4CBVA 2PO4A 4WJWA
chains in the Genus database with same CATH topology
4AH6A 1BBWA 3U4ZA 1XPRA 1VQ7A 4JI4L 2YTVA 3IRBA 3K0XA 3KOJA 2BH2A 4R1JA 1KHIA 1CKNA 1IZ6A 2C35B 3KDFA 2WB1E 4UP8A 1QUQB 3TEHB 4IO9A 2UXDQ 4A93G 3BZCA 4DAMA 1PYSB 2ATWA 3CCJA 2OTLA 3E9HA 4RG1A 1PV4A 1N8RC 1VQGA 4OO1I 4PMWA 1EFWA 5IE8A 4QQBX 4IFDJ 1XMOQ 4LUOA 1PH4A 2UU9L 1TWFH 5IP9H 3GTLH 1GM5A 4IOAA 1N32L 4HIMA 4DV1Q 1MIUA 1ASYA 4L5SA 1KQSA 3GTOH 5HGQA 3PO3G 1BBUA 2N8NA 4P71A 2UUAQ 1BKBA 1LTLA 3HKZG 2UXDL 4YCVA 1G51A 1VQLA 3J7A5 2K52A 3KFUA 4GNXC 1YBYA 2K14A 1WI5A 3OTOQ 3HKZE 3U58A 3M4PA 3GTKH 4A3GG 4A3IH 4J15A 1XMOL 3BJUA 1PH1A 4BBRG 3PGZA 4JI2Q 1HH2P 1VQIA 2ID0A 4QJFA 4JV5Q 2GVBA 1TWAH 1UWVA 3CC7A 4DV1L 5C3EG 2D0PA 2DUDA 1B70B 1CKNB 3J81i 4HIOA 3KDFB 5IYDH 4A3FH 4A93H 4IPGA 2UUAL 3JAMc 4R4QA 4A3KG 1PH5A 3EIVA 5FLXc 4L5QA 1PFSA 4LF4Q 1K0RA 5M3MG 1VQKA 3J80i 3OTOL 1W3SA 4C2MH 3S1MH 3CXCA 1FL0A 1SR3A 3MXNB 4GS3A 3J7ZC 1YEZA 4OONA 1Q82C 4OWXB 1SFOH 3FKIG 4YY3Q 3KYHC 4MZ9A 4BY1H 3PUXA 4JI2L 3HOXH 4JV5L 2ZJQA 3H0GH 4LW1A 3U4VA 2NZOA 2PNHA 1J5EQ 4DNIA 3PF4A 1EOVA 1Y14B 1P16A 3STBC 4DR2Q 1W2BA 3W1GA 2ASBA 2QA4A 2R7DA 4A3EG 1JJCB 4DV4Q 4R4OA 3HFZB 5C0XJ 4LF4L 1XJVA 1A0IA 2KBNA 2HT1A 4DV3Q 2D62A 5M3FH 3RLNA 1AE2A 4GN4B 3WWVA 3K7AH 5LMNQ 1CKMA 4LF6Q 4YY3L 2NN6G 1TWCH 3NELA 3M4OH 5JEAJ 3B6YA 2Z0SA 3JC66 3L0OA 1PVOA 2XGTA 4A3BH 1K3RA 2E5LQ 4BXXG 3L2PA 4DR5Q 3KLWA 1KC8C 2QGQA 3M3YH 1J5EL 1Y1WG 1OXUA 2R93H 5GAHC 4DR2L 2R7FA 4AQYQ 1EIYB 1VQAA 1Z47A 3K8AA 4JBMA 4DV4L 3CCQA 2Z6KC 1N33Q 3I7FA 3RNUA 3I4MH 1E24A 4JI6Q 1RL2A 4DV3L 4BA2I 1VS0A 5EAYA 2V1CC 2AWOA 1HJPA 2K4KA 2K5HA 3RN2A 4BBSG 3I2ZA 5LMNL 4DV5Q 4LF6L 2RHQB 2IX1A 1PA6A 1VQJA 2RCNA 4R4CA 4GOPA 3OW2A 4JI1Q 4P74A 3JAMi 4KHZA 4APVA 4YWMA 1NTGA 2E5LL 1SLJA 4DR5L 4RMFA 4A3DH 1T9HA 4HJ8A 1YJ9A 2YV5A 4JOIA 1L1OC 4AQYL 2JA6H 1B8AA 2R92G 2UXCQ 4OX9Q 1N33L 3KJOA 4O2DA 4A76A 3UE0A 4JI6L 4LF5Q 1AE3A 4BY7G 2VQFQ 3HKSA 3D31A 3HOUG 3I4NH 5IY0A 4HJ5A 2WFWA 2E2JH 2Q2UA 3ICEA 5M5YH 4H02A 1A62A 4L5TA 4DV5L 4P75A 4BXXH 1HZ9A 3S1QH 4JI5Q 4JI1L 5FJ8H 1EYGA 2L15A 4IPHA 1Q8KA 5H1SE 1ASZA 5GAGC 3CCVA 1K83H 2JQOA 2YU9H 1OXSC 2N49A 2LXKA 3EBEA 4A3LH 3J81j 2UXCL 4OX9L 1HNZQ 2YTXA 1VQ8A 2JK8A 2UUCQ 4LF5L 3CC2A 4UY8C 1KXLA 5JJKA 2VQFL 4A3MH 3S16H 4DV6Q 1E3PA 4QL5A 4JBJA 1Y1VG 4GOPB 2EQSA 1B7YB 4FDBA 1XTDA 2I0QA 3H3VI 2OQKA 5GQOA 3SGIA 3Q8DA 3PIOA 4JI5L 3CMAA 3CCUA 3VDYA 3H15A 1IBKQ 4IFDG 4DR4Q 2F3IA 3T1YQ 1MJEA 3UDXA 1IL2A 1VQ5A 1HNZL 4BY7H 2K50A 3GTPH 2UUCL 3L7ZC 1X56A 4A75A 4DV6L 2VUMH 1C9OA 2E2HH 2I5HA 3G4SA 1CUKA 4JBWA 2VW9A 1FVIA 4NPSA 2KENA 4GN3B 3CCMA 1PH7A 1HNXQ 4JI7Q 3H3VH 4X66Q 1IBKL 4DR4L 2B3GA 4DK6C 3GTMH 2PI2E 3T1YL 1KRSA 1BVSA 1UE6A 1VQFA 4BA1I 1E7ZA 2GVAA 2A8VA 1NY4A 1VQHA 2CKZB 3S17H 4WJ3M 4JI0Q 4LUVA 3ULLA 1LUZA 1X6OA 1EUJA 1CKOA 3GD7A 3GTGH 1Q46A 1Y1VH 4DK3C 5IYBG 3CD6A 1EIFA 2H5XA 2NVTH 3AFPA 2R7ZG 1SN8A 2PI2A 4OWWB 1NMFA 2KCMA 2VZAA 2K5VA 4NB3A 4PZ6A 3I56A 2F4VQ 1V1QA 2ALYB 2A1AA 3HOZG 3F2DA 4POGA 2MFIA 2JA5G 3M9BA 1HNXL 1WCMG 3U50C 4JI7L 1UEBA 4X66L 3PO3H 2GN5A 4Y52H 4B3TQ 1VCIA 5DLQE 1J6QA 1S72A 3W5OA 3ER0A 1E1TA 3PCOB 4DR6Q 3CF5A 1I6HH 1YNXA 5JJIA 3KF8B 2B63G 4JI0L 5IYCG 3GTJH 1X9NA 2OWOA 4IOCA 1NE3A 4BBSH 4A3GH 1I5FA 5C0XG 1Q81C 2OTJA 3BZKA 3NEMA 2JJQA 2K5NA 4LUZA 4GOPC 2F4VL 2EXDA 4BBRH 1HR0Q 1V43A 4GNXA 1JE5A 3W1BA 5C3EH 1EQQA 1CSPA 2JEAI 3TS2A 3A74A 2Q2IA 5JEAG 2JA8G 3KF6A 2MO0A 4A3KH 4B3TL 3G48A 2JA7G 5C4XG 3UDIA 3GTQH 4JYAQ 3CCEA 4DR6L 1Q12A 3TRZA 3M7NA 1I94Q 5M3MH 2KCTA 5IYBH 3M85A 1HR0W 4LFCQ 4YCUA 4DR1Q 1WFQA 4HJ7A 2CCZA 2VY3A 5ELOA 1VQMA 1WJJA 4OXPA 3HOVG 2NN6I 1OTCA 1WOCA 1Z9FA 1VQ4A 2BH8A 3HOZH 4LFBQ 3FKIH 2JA5H 1VQBA 3D0FA 4DV0Q 3CCRA 1M1KC 2CWPA 1HR0L 1QZGA 3AEVA 1UE7A 3PSIA 3S1RH 4QY7A 2OQ0A 2R92H 3F1ZA 4KI0A 1A8VA 2HHHQ 2WAQG 4JCVE 4A3EH 4EX5A 4LFAQ 1PH6A 1VQEA 4JYAL 1G6PA 3T1HQ 3HOYG 3HOWG 1PH2A 4A3JG 4LFCL 1KAWA 2WAQE 4X65Q 5FLMG 4UPAA 1XPOA 4A3CG 2NVQH 3PUZA 4OWTB 4DR1L 3ERSX 2N78A 4X62Q 4HIKA 1OXTA 4HJ9A 4L5RC 1QVCA 1IBLQ 4C3JH 4LNQA 3G71A 2NVXH 4LFBL 2XTIA 5LMUQ 4LF7Q 4TQUS 4GNXB 2Q2TA 1FJGQ 4DV0L 3A5ZB 4DR7Q 1EQRA 1DGSA 3AYHB 4UP9A 3S15H 3F2BA 3KF6B 2ZJPA 3PIPA 1Y1WH 2HHHL 3RZOH 2MNAA 3K7UC 1X3FA 4KLKA 4LFAL 4B3SQ 5IP9G 3T1HL 2FXQA 2PQAA 1N36Q 2IHEA 4X65L 2CWAA 3NBHB 4JI8Q 2LXJA 4X62L 3TREA 3J81c 5K36G 2AKWB 1IBLL 1AH9A 4DV2Q 1PH8A 1PYBA 4GLXA 1JJGA 4LF7L 2ZJRA 5LMUL 4A3CH 2Z6KA 1H95A 1FJGL 1JT8A 4QIWE 1O7IA 4WJ4A 4DR7L 1D7QA 4P73A 4R4IA 4MTNA 3K80C 1YIJA 3J80c 2JEBI 3ULJA 4A3IG 1OXVA 1WYDA 3CW2C 4IPDA 4OO1G 4GKKQ 5M5XH 1X3EA 1X65A 3UDGA 2HIXA 3EN2A 1HZCA 4XIGS 1HZBA 2HQLA 3CPWA 1M90C 1JJ2A 4B3SL 1C0AA 1N36L 1JB7A 1IBMQ 3S2DH 1KRTA 1VQCA 4JI8L 3PUWA 3M4QA 4DR3Q 1SE8A 5IP7G 5IYDG 1SROA 4A3FG 3HOUH 1GD7A 3CMEA 1YZ6A 1D8LA 1L1OA 4DV2L 4A3JH 1C7YA 2IY5B 1OXXK 3FP9A 5JJLA 1N34Q 4IFDI 4DPGA 4ALPA 1JMCA 2AMCB 2VL6A 3PO2G 1KIXA 3I4OA 5GADC 3GDEA 4DKAC 4GKKL 5ELNA 2PQAB 1VQ9A 1X3GA 2DGYA 3PUYA 2F52A 2RF4A 3AFQA 3ULPA 3A0JA 4BY1G 1S40A 2JE6I 3HOXG 1PHJA 3RR5A 1IBML 4LF8Q 1VQ6A 4C3IH 4X64Q 2I5LX 3H0GG 1TWHH 1XNRQ 2Y0SG 2PMZE 4B3RQ 1E22A 4DR3L 5AJ3Q 1E1OA 3MEFA 1XMQQ 1QZHA 3UDFA 1NJIC 1XNQQ 2UXBQ 3AQQA 2ZTEA 4R4TA 2Y0SE 1N34L 1FGUA 3DLLA 1Q86C 1YITA 2JA9A 1YJWA 2I5MX 1K9MC 4LF9Q 2VQEQ 3TS0A 3PV0A 5M3FG 2IX0A 3RLFA 4C3HH 4QGUA 3PF5A 4ME3A 1X55A 4LF8L 5IP7H 1CSQA 2RHSB 4X64L 2AHOB 3PUVA 3A5UA 1XNRL 4A3BG 4B3RL 1L1OB 5AJ3L 1U0LA 2R93G 4B3MQ 4KHPQ 1XMQL 2UXBL 1VQPA 1GO3E 1PH3A 1XNQL 3CCLA 4PZ8A 4K0KQ 4LWCA 3PO2H 1SMXA 3I4MG 3CP0A 1GVPA 1YHAA 5IT9c 4UP7A 4Y7NH 2NZHA 4GKJQ 1IYJB 5IWAQ 2BA1A 3TQYA 4LF9L 2VQEL 4PZ7A 4IPCA 4AYBG 4JOIC 2WP8J 5C44G 4PG3A 1L0WA 4DUYQ 5GAEC 1K73C 2CQOA 1I3QH 3RLOA 3I55A 5J3BA 2R6GA 3FHWA 5C0XI 4AYBE 1QVGA 3NENA 4MNOA 1N9WA 1SRUA 5C4JH 4A3DG 2N3SA 1G291 2MO1A 2R7ZH 1I50H 4NXMQ 1RIPA 2CFMA 4B3ML 4KHPL 2IT1A 5M5WH 4DUZQ 1R9TH 2JA6G 3S1NH 4IJLA 4K0KL 1HZAA 4JG2A 1VQNA 2VS1A 1Q7YC 4GLAC 1P8LA 5BR8Q 1TWGH 4YWLA 1WCMH 2A19A 1A63A 4GKJL 4TVAB 1V9PA 5E7NA 4DV7Q 5IWAL 1HNWQ 3I4NG 1KL9A 4O0AA 3GO5A 1YI2A 2E8GA 4POFA 3RN5A 2D0OA 4DUYL 1YHBA 1MJCA 4IJHA 4DAYB 2K75A 3E9IA 2B63H 3RZDH 2ES2A 5IYCH 2IHFA 5FJ8G 1Q1BA 1PH9A 1UE1A 1Q1EA 1U5KA 1MKHA 4EQ5A 4GN5A 4P72A 4GLVB 2KHJA 5LMNW 2AWNA 1YHQA 1I94L 4XTCS 2MQHA 4NXML 2ZTCA 1XPUA 2B29A 3F2CA 1TXYA 4DUZL 2NVYH 3STBD 4NXNQ 4A3LG 4JI3Q 1QUQA 2ZTDA 3LGJA 1EWIA 2YYZA 5BR8L 1K8AC 2Q2HA 3ZJYC 4YHHQ 2UUBQ 4JBKA 2VNUD 3CPFA 1QVFA 5HY6A 5C44H 4DV7L 4A3MG 2JA8H 1HNWL 1L2FA 3S24A 5C4XH 2ZM6Q 2JA7H 3CC4A 1X54A 1YVCA 2QEXA 4JC0A 3DM3A 4JI4Q 3K81C 4YWKA 1GKHA 3CCSA 4HJAA 3BU2A 1IXRA 3E0EA 4A4IA 1VQDA 3HOVH 4AIMA 1K8GA 1LYLA 2YTYA 3F8TA 5GROA 4NXNL 3S2HH 4X6AH 3CQZH 4JI3L 4HIDA 1LM0A 2OCEA 2E2IH 2HIVA 2BA0A 2UUBL 4YHHL 1VQOA 2KHIA 3S14H 2LSSA 1KD1C 1NBWA 3OYYA 2VUMG 3KJPA 1NMGA 3UE1A 2ZM6L 1UE5A 3CAMA 1YJNA 2EIFA 3G6EA 2UU9Q 3HOWH 3HOYH 1N32Q 1S3OA 2WB1G 4YCWA 5FLMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AH6 A;  1BBW A;  3U4Z A;  1XPR A;  1VQ7 A;  4JI4 L;  2YTV A;  3IRB A;  3K0X A;  3KOJ A;  2BH2 A;  4R1J A;  1KHI A;  1CKN A;  1IZ6 A;  2C35 B;  3KDF A;  2WB1 E;  4UP8 A;  1QUQ B;  3TEH B;  4IO9 A;  2UXD Q;  4A93 G;  3BZC A;  4DAM A;  1PYS B;  2ATW A;  3CCJ A;  2OTL A;  3E9H A;  4RG1 A;  1PV4 A;  1N8R C;  1VQG A;  4OO1 I;  4PMW A;  1EFW A;  5IE8 A;  4QQB X;  4IFD J;  1XMO Q;  4LUO A;  1PH4 A;  2UU9 L;  1TWF H;  5IP9 H;  3GTL H;  1GM5 A;  4IOA A;  1N32 L;  4HIM A;  4DV1 Q;  1MIU A;  1ASY A;  4L5S A;  1KQS A;  3GTO H;  5HGQ A;  3PO3 G;  1BBU A;  2N8N A;  4P71 A;  2UUA Q;  1BKB A;  1LTL A;  3HKZ G;  2UXD L;  4YCV A;  1G51 A;  1VQL A;  3J7A 5;  2K52 A;  3KFU A;  4GNX C;  1YBY A;  2K14 A;  1WI5 A;  3OTO Q;  3HKZ E;  3U58 A;  3M4P A;  3GTK H;  4A3G G;  4A3I H;  4J15 A;  1XMO L;  3BJU A;  1PH1 A;  4BBR G;  3PGZ A;  4JI2 Q;  1HH2 P;  1VQI A;  2ID0 A;  4QJF A;  4JV5 Q;  2GVB A;  1TWA H;  1UWV A;  3CC7 A;  4DV1 L;  5C3E G;  2D0P A;  2DUD A;  1B70 B;  1CKN B;  3J81 i;  4HIO A;  3KDF B;  5IYD H;  4A3F H;  4A93 H;  4IPG A;  2UUA L;  3JAM c;  4R4Q A;  4A3K G;  1PH5 A;  3EIV A;  5FLX c;  4L5Q A;  1PFS A;  4LF4 Q;  1K0R A;  5M3M G;  1VQK A;  3J80 i;  3OTO L;  1W3S A;  4C2M H;  3S1M H;  3CXC A;  1FL0 A;  1SR3 A;  3MXN B;  4GS3 A;  3J7Z C;  1YEZ A;  4OON A;  1Q82 C;  4OWX B;  1SFO H;  3FKI G;  4YY3 Q;  3KYH C;  4MZ9 A;  4BY1 H;  3PUX A;  4JI2 L;  3HOX H;  4JV5 L;  2ZJQ A;  3H0G H;  4LW1 A;  3U4V A;  2NZO A;  2PNH A;  1J5E Q;  4DNI A;  3PF4 A;  1EOV A;  1Y14 B;  1P16 A;  3STB C;  4DR2 Q;  1W2B A;  3W1G A;  2ASB A;  2QA4 A;  2R7D A;  4A3E G;  1JJC B;  4DV4 Q;  4R4O A;  3HFZ B;  5C0X J;  4LF4 L;  1XJV A;  1A0I A;  2KBN A;  2HT1 A;  4DV3 Q;  2D62 A;  5M3F H;  3RLN A;  1AE2 A;  4GN4 B;  3WWV A;  3K7A H;  5LMN Q;  1CKM A;  4LF6 Q;  4YY3 L;  2NN6 G;  1TWC H;  3NEL A;  3M4O H;  5JEA J;  3B6Y A;  2Z0S A;  3JC6 6;  3L0O A;  1PVO A;  2XGT A;  4A3B H;  1K3R A;  2E5L Q;  4BXX G;  3L2P A;  4DR5 Q;  3KLW A;  1KC8 C;  2QGQ A;  3M3Y H;  1J5E L;  1Y1W G;  1OXU A;  2R93 H;  5GAH C;  4DR2 L;  2R7F A;  4AQY Q;  1EIY B;  1VQA A;  1Z47 A;  3K8A A;  4JBM A;  4DV4 L;  3CCQ A;  2Z6K C;  1N33 Q;  3I7F A;  3RNU A;  3I4M H;  1E24 A;  4JI6 Q;  1RL2 A;  4DV3 L;  4BA2 I;  1VS0 A;  5EAY A;  2V1C C;  2AWO A;  1HJP A;  2K4K A;  2K5H A;  3RN2 A;  4BBS G;  3I2Z A;  5LMN L;  4DV5 Q;  4LF6 L;  2RHQ B;  2IX1 A;  1PA6 A;  1VQJ A;  2RCN A;  4R4C A;  4GOP A;  3OW2 A;  4JI1 Q;  4P74 A;  3JAM i;  4KHZ A;  4APV A;  4YWM A;  1NTG A;  2E5L L;  1SLJ A;  4DR5 L;  4RMF A;  4A3D H;  1T9H A;  4HJ8 A;  1YJ9 A;  2YV5 A;  4JOI A;  1L1O C;  4AQY L;  2JA6 H;  1B8A A;  2R92 G;  2UXC Q;  4OX9 Q;  1N33 L;  3KJO A;  4O2D A;  4A76 A;  3UE0 A;  4JI6 L;  4LF5 Q;  1AE3 A;  4BY7 G;  2VQF Q;  3HKS A;  3D31 A;  3HOU G;  3I4N H;  5IY0 A;  4HJ5 A;  2WFW A;  2E2J H;  2Q2U A;  3ICE A;  5M5Y H;  4H02 A;  1A62 A;  4L5T A;  4DV5 L;  4P75 A;  4BXX H;  1HZ9 A;  3S1Q H;  4JI5 Q;  4JI1 L;  5FJ8 H;  1EYG A;  2L15 A;  4IPH A;  1Q8K A;  5H1S E;  1ASZ A;  5GAG C;  3CCV A;  1K83 H;  2JQO A;  2YU9 H;  1OXS C;  2N49 A;  2LXK A;  3EBE A;  4A3L H;  3J81 j;  2UXC L;  4OX9 L;  1HNZ Q;  2YTX A;  1VQ8 A;  2JK8 A;  2UUC Q;  4LF5 L;  3CC2 A;  4UY8 C;  1KXL A;  5JJK A;  2VQF L;  4A3M H;  3S16 H;  4DV6 Q;  1E3P A;  4QL5 A;  4JBJ A;  1Y1V G;  4GOP B;  2EQS A;  1B7Y B;  4FDB A;  1XTD A;  2I0Q A;  3H3V I;  2OQK A;  5GQO A;  3SGI A;  3Q8D A;  3PIO A;  4JI5 L;  3CMA A;  3CCU A;  3VDY A;  3H15 A;  1IBK Q;  4IFD G;  4DR4 Q;  2F3I A;  3T1Y Q;  1MJE A;  3UDX A;  1IL2 A;  1VQ5 A;  1HNZ L;  4BY7 H;  2K50 A;  3GTP H;  2UUC L;  3L7Z C;  1X56 A;  4A75 A;  4DV6 L;  2VUM H;  1C9O A;  2E2H H;  2I5H A;  3G4S A;  1CUK A;  4JBW A;  2VW9 A;  1FVI A;  4NPS A;  2KEN A;  4GN3 B;  3CCM A;  1PH7 A;  1HNX Q;  4JI7 Q;  3H3V H;  4X66 Q;  1IBK L;  4DR4 L;  2B3G A;  4DK6 C;  3GTM H;  2PI2 E;  3T1Y L;  1KRS A;  1BVS A;  1UE6 A;  1VQF A;  4BA1 I;  1E7Z A;  2GVA A;  2A8V A;  1NY4 A;  1VQH A;  2CKZ B;  3S17 H;  4WJ3 M;  4JI0 Q;  4LUV A;  3ULL A;  1LUZ A;  1X6O A;  1EUJ A;  1CKO A;  3GD7 A;  3GTG H;  1Q46 A;  1Y1V H;  4DK3 C;  5IYB G;  3CD6 A;  1EIF A;  2H5X A;  2NVT H;  3AFP A;  2R7Z G;  1SN8 A;  2PI2 A;  4OWW B;  1NMF A;  2KCM A;  2VZA A;  2K5V A;  4NB3 A;  4PZ6 A;  3I56 A;  2F4V Q;  1V1Q A;  2ALY B;  2A1A A;  3HOZ G;  3F2D A;  4POG A;  2MFI A;  2JA5 G;  3M9B A;  1HNX L;  1WCM G;  3U50 C;  4JI7 L;  1UEB A;  4X66 L;  3PO3 H;  2GN5 A;  4Y52 H;  4B3T Q;  1VCI A;  5DLQ E;  1J6Q A;  1S72 A;  3W5O A;  3ER0 A;  1E1T A;  3PCO B;  4DR6 Q;  3CF5 A;  1I6H H;  1YNX A;  5JJI A;  3KF8 B;  2B63 G;  4JI0 L;  5IYC G;  3GTJ H;  1X9N A;  2OWO A;  4IOC A;  1NE3 A;  4BBS H;  4A3G H;  1I5F A;  5C0X G;  1Q81 C;  2OTJ A;  3BZK A;  3NEM A;  2JJQ A;  2K5N A;  4LUZ A;  4GOP C;  2F4V L;  2EXD A;  4BBR H;  1HR0 Q;  1V43 A;  4GNX A;  1JE5 A;  3W1B A;  5C3E H;  1EQQ A;  1CSP A;  2JEA I;  3TS2 A;  3A74 A;  2Q2I A;  5JEA G;  2JA8 G;  3KF6 A;  2MO0 A;  4A3K H;  4B3T L;  3G48 A;  2JA7 G;  5C4X G;  3UDI A;  3GTQ H;  4JYA Q;  3CCE A;  4DR6 L;  1Q12 A;  3TRZ A;  3M7N A;  1I94 Q;  5M3M H;  2KCT A;  5IYB H;  3M85 A;  1HR0 W;  4LFC Q;  4YCU A;  4DR1 Q;  1WFQ A;  4HJ7 A;  2CCZ A;  2VY3 A;  5ELO A;  1VQM A;  1WJJ A;  4OXP A;  3HOV G;  2NN6 I;  1OTC A;  1WOC A;  1Z9F A;  1VQ4 A;  2BH8 A;  3HOZ H;  4LFB Q;  3FKI H;  2JA5 H;  1VQB A;  3D0F A;  4DV0 Q;  3CCR A;  1M1K C;  2CWP A;  1HR0 L;  1QZG A;  3AEV A;  1UE7 A;  3PSI A;  3S1R H;  4QY7 A;  2OQ0 A;  2R92 H;  3F1Z A;  4KI0 A;  1A8V A;  2HHH Q;  2WAQ G;  4JCV E;  4A3E H;  4EX5 A;  4LFA Q;  1PH6 A;  1VQE A;  4JYA L;  1G6P A;  3T1H Q;  3HOY G;  3HOW G;  1PH2 A;  4A3J G;  4LFC L;  1KAW A;  2WAQ E;  4X65 Q;  5FLM G;  4UPA A;  1XPO A;  4A3C G;  2NVQ H;  3PUZ A;  4OWT B;  4DR1 L;  3ERS X;  2N78 A;  4X62 Q;  4HIK A;  1OXT A;  4HJ9 A;  4L5R C;  1QVC A;  1IBL Q;  4C3J H;  4LNQ A;  3G71 A;  2NVX H;  4LFB L;  2XTI A;  5LMU Q;  4LF7 Q;  4TQU S;  4GNX B;  2Q2T A;  1FJG Q;  4DV0 L;  3A5Z B;  4DR7 Q;  1EQR A;  1DGS A;  3AYH B;  4UP9 A;  3S15 H;  3F2B A;  3KF6 B;  2ZJP A;  3PIP A;  1Y1W H;  2HHH L;  3RZO H;  2MNA A;  3K7U C;  1X3F A;  4KLK A;  4LFA L;  4B3S Q;  5IP9 G;  3T1H L;  2FXQ A;  2PQA A;  1N36 Q;  2IHE A;  4X65 L;  2CWA A;  3NBH B;  4JI8 Q;  2LXJ A;  4X62 L;  3TRE A;  3J81 c;  5K36 G;  2AKW B;  1IBL L;  1AH9 A;  4DV2 Q;  1PH8 A;  1PYB A;  4GLX A;  1JJG A;  4LF7 L;  2ZJR A;  5LMU L;  4A3C H;  2Z6K A;  1H95 A;  1FJG L;  1JT8 A;  4QIW E;  1O7I A;  4WJ4 A;  4DR7 L;  1D7Q A;  4P73 A;  4R4I A;  4MTN A;  3K80 C;  1YIJ A;  3J80 c;  2JEB I;  3ULJ A;  4A3I G;  1OXV A;  1WYD A;  3CW2 C;  4IPD A;  4OO1 G;  4GKK Q;  5M5X H;  1X3E A;  1X65 A;  3UDG A;  2HIX A;  3EN2 A;  1HZC A;  4XIG S;  1HZB A;  2HQL A;  3CPW A;  1M90 C;  1JJ2 A;  4B3S L;  1C0A A;  1N36 L;  1JB7 A;  1IBM Q;  3S2D H;  1KRT A;  1VQC A;  4JI8 L;  3PUW A;  3M4Q A;  4DR3 Q;  1SE8 A;  5IP7 G;  5IYD G;  1SRO A;  4A3F G;  3HOU H;  1GD7 A;  3CME A;  1YZ6 A;  1D8L A;  1L1O A;  4DV2 L;  4A3J H;  1C7Y A;  2IY5 B;  1OXX K;  3FP9 A;  5JJL A;  1N34 Q;  4IFD I;  4DPG A;  4ALP A;  1JMC A;  2AMC B;  2VL6 A;  3PO2 G;  1KIX A;  3I4O A;  5GAD C;  3GDE A;  4DKA C;  4GKK L;  5ELN A;  2PQA B;  1VQ9 A;  1X3G A;  2DGY A;  3PUY A;  2F52 A;  2RF4 A;  3AFQ A;  3ULP A;  3A0J A;  4BY1 G;  1S40 A;  2JE6 I;  3HOX G;  1PHJ A;  3RR5 A;  1IBM L;  4LF8 Q;  1VQ6 A;  4C3I H;  4X64 Q;  2I5L X;  3H0G G;  1TWH H;  1XNR Q;  2Y0S G;  2PMZ E;  4B3R Q;  1E22 A;  4DR3 L;  5AJ3 Q;  1E1O A;  3MEF A;  1XMQ Q;  1QZH A;  3UDF A;  1NJI C;  1XNQ Q;  2UXB Q;  3AQQ A;  2ZTE A;  4R4T A;  2Y0S E;  1N34 L;  1FGU A;  3DLL A;  1Q86 C;  1YIT A;  2JA9 A;  1YJW A;  2I5M X;  1K9M C;  4LF9 Q;  2VQE Q;  3TS0 A;  3PV0 A;  5M3F G;  2IX0 A;  3RLF A;  4C3H H;  4QGU A;  3PF5 A;  4ME3 A;  1X55 A;  4LF8 L;  5IP7 H;  1CSQ A;  2RHS B;  4X64 L;  2AHO B;  3PUV A;  3A5U A;  1XNR L;  4A3B G;  4B3R L;  1L1O B;  5AJ3 L;  1U0L A;  2R93 G;  4B3M Q;  4KHP Q;  1XMQ L;  2UXB L;  1VQP A;  1GO3 E;  1PH3 A;  1XNQ L;  3CCL A;  4PZ8 A;  4K0K Q;  4LWC A;  3PO2 H;  1SMX A;  3I4M G;  3CP0 A;  1GVP A;  1YHA A;  5IT9 c;  4UP7 A;  4Y7N H;  2NZH A;  4GKJ Q;  1IYJ B;  5IWA Q;  2BA1 A;  3TQY A;  4LF9 L;  2VQE L;  4PZ7 A;  4IPC A;  4AYB G;  4JOI C;  2WP8 J;  5C44 G;  4PG3 A;  1L0W A;  4DUY Q;  5GAE C;  1K73 C;  2CQO A;  1I3Q H;  3RLO A;  3I55 A;  5J3B A;  2R6G A;  3FHW A;  5C0X I;  4AYB E;  1QVG A;  3NEN A;  4MNO A;  1N9W A;  1SRU A;  5C4J H;  4A3D G;  2N3S A;  1G29 1;  2MO1 A;  2R7Z H;  1I50 H;  4NXM Q;  1RIP A;  2CFM A;  4B3M L;  4KHP L;  2IT1 A;  5M5W H;  4DUZ Q;  1R9T H;  2JA6 G;  3S1N H;  4IJL A;  4K0K L;  1HZA A;  4JG2 A;  1VQN A;  2VS1 A;  1Q7Y C;  4GLA C;  1P8L A;  5BR8 Q;  1TWG H;  4YWL A;  1WCM H;  2A19 A;  1A63 A;  4GKJ L;  4TVA B;  1V9P A;  5E7N A;  4DV7 Q;  5IWA L;  1HNW Q;  3I4N G;  1KL9 A;  4O0A A;  3GO5 A;  1YI2 A;  2E8G A;  4POF A;  3RN5 A;  2D0O A;  4DUY L;  1YHB A;  1MJC A;  4IJH A;  4DAY B;  2K75 A;  3E9I A;  2B63 H;  3RZD H;  2ES2 A;  5IYC H;  2IHF A;  5FJ8 G;  1Q1B A;  1PH9 A;  1UE1 A;  1Q1E A;  1U5K A;  1MKH A;  4EQ5 A;  4GN5 A;  4P72 A;  4GLV B;  2KHJ A;  5LMN W;  2AWN A;  1YHQ A;  1I94 L;  4XTC S;  2MQH A;  4NXM L;  2ZTC A;  1XPU A;  2B29 A;  3F2C A;  1TXY A;  4DUZ L;  2NVY H;  3STB D;  4NXN Q;  4A3L G;  4JI3 Q;  1QUQ A;  2ZTD A;  3LGJ A;  1EWI A;  2YYZ A;  5BR8 L;  1K8A C;  2Q2H A;  3ZJY C;  4YHH Q;  2UUB Q;  4JBK A;  2VNU D;  3CPF A;  1QVF A;  5HY6 A;  5C44 H;  4DV7 L;  4A3M G;  2JA8 H;  1HNW L;  1L2F A;  3S24 A;  5C4X H;  2ZM6 Q;  2JA7 H;  3CC4 A;  1X54 A;  1YVC A;  2QEX A;  4JC0 A;  3DM3 A;  4JI4 Q;  3K81 C;  4YWK A;  1GKH A;  3CCS A;  4HJA A;  3BU2 A;  1IXR A;  3E0E A;  4A4I A;  1VQD A;  3HOV H;  4AIM A;  1K8G A;  1LYL A;  2YTY A;  3F8T A;  5GRO A;  4NXN L;  3S2H H;  4X6A H;  3CQZ H;  4JI3 L;  4HID A;  1LM0 A;  2OCE A;  2E2I H;  2HIV A;  2BA0 A;  2UUB L;  4YHH L;  1VQO A;  2KHI A;  3S14 H;  2LSS A;  1KD1 C;  1NBW A;  3OYY A;  2VUM G;  3KJP A;  1NMG A;  3UE1 A;  2ZM6 L;  1UE5 A;  3CAM A;  1YJN A;  2EIF A;  3G6E A;  2UU9 Q;  3HOW H;  3HOY H;  1N32 Q;  1S3O A;  2WB1 G;  4YCW A;  5FLM H; 
#chains in the Genus database with same CATH topology
 4DK0 A;  3HOV B;  1TT2 A;  4R1J A;  4X3S A;  2RVL A;  2WB1 E;  3KDF A;  2UXD Q;  2KCN A;  3D6C A;  1EYD A;  3E9H A;  4RG1 A;  1HUN A;  3S14 B;  4OO1 I;  5IE8 A;  3TZU A;  5NUC A;  4IFD J;  5IP9 H;  1E2W A;  3BYY B;  4ODG A;  3PO3 G;  4P71 A;  2UUA Q;  3QR8 A;  2UXD L;  1G51 A;  3CHB D;  2L4N A;  1VQL A;  2WV6 D;  2QEJ C;  1YBY A;  2K14 A;  1G91 A;  3HKZ E;  3U58 A;  3M4P A;  3GTK H;  1IKM A;  1STG A;  2EYM A;  1WD0 A;  4OO1 H;  1DXM A;  4RCO A;  3GTL B;  1PH1 A;  1PRT B;  3HP3 A;  3CC7 A;  4HCE A;  4RGO S;  2XSC A;  5C4Z A;  1GUW A;  2D0P A;  5IYD H;  1AP0 A;  2UUA L;  3IFT A;  3U9S A;  5I9P A;  4L5Q A;  2FIN B;  4RA8 A;  3U9O A;  1ENF A;  2LFN A;  3K6O A;  4MHE A;  3FKI G;  1EEF D;  4MZ9 A;  2F0L A;  4N8F A;  2L12 A;  4CJ1 B;  4K8J A;  1EOV A;  1Y14 B;  3QOJ A;  2QA4 A;  4A3E G;  1LTR D;  1JJC B;  3P20 A;  1LTT D;  1F2L A;  2F0G A;  5BN3 A;  2KBN A;  4DV3 Q;  3TDQ A;  1KDC A;  1SYB A;  3RLN A;  4CKE A;  2PMZ B;  2L0C A;  3K7A H;  2C9O A;  2JYO A;  5JEA J;  3IKJ A;  1OO9 B;  3K5L A;  2XGT A;  4FXK C;  1Y1W G;  2R93 H;  1CZG A;  1TU2 B;  1EYA A;  2R7F A;  3ZYY X;  1N33 Q;  3RNU A;  2EE1 A;  3MXP A;  2E76 C;  4DV3 L;  1VS0 A;  1D5M C;  2V1C C;  3RN2 A;  2K4K A;  3I2Z A;  4DV5 Q;  1EY9 A;  1TWC B;  3M4O B;  1VQJ A;  4R4C A;  5KRU A;  4I65 A;  3M3Y B;  5ELB A;  4JOI A;  3MZ5 A;  1L1O C;  1N33 L;  3KJO A;  1IL8 A;  1RJT A;  1S5B D;  1SMY D;  1AE3 A;  1EOT A;  3D31 A;  3HOU G;  3J80 L;  2E2J H;  1A62 A;  4L5T A;  4DV5 L;  2QKI C;  1HZ9 A;  3OOC A;  1NUC A;  5FJ8 H;  1WTW A;  2CVR A;  2R3Z A;  3TBI B;  2E75 C;  4KKS A;  5H1S E;  5GAG C;  1QNU A;  1ASZ A;  1AZP A;  3NTH A;  2N49 A;  2LXK A;  1VMP A;  3J81 j;  4KHV A;  2WAC A;  3CC2 A;  4UY8 C;  3I4N B;  3OIP A;  1FNV A;  1TR5 A;  4JBJ A;  1Y1V G;  4GOP B;  4ZCK A;  2OQK A;  3SGI A;  4DU9 A;  3CCU A;  2B2U C;  1IBK Q;  1YNN D;  2Z1C A;  1K83 B;  1JWM D;  2EDG A;  2YU9 B;  3W3A A;  3M4Y A;  1MJE A;  4NMZ A;  2EY1 A;  2SNS A;  2WKD A;  1IL2 A;  4BY7 H;  1PTO B;  2K50 A;  5ELE A;  5E4X A;  3V96 A;  2F3V A;  3A54 A;  3K58 A;  2DN8 A;  3KF8 A;  2I46 A;  5BN4 A;  4A3M B;  1X56 A;  1LT6 D;  2H4O A;  5EKI A;  4OEM B;  3M7G A;  2I5H A;  3G4S A;  1EEI D;  5JOB A;  5L37 A;  4HSV A;  1ILQ A;  5C6A A;  3CCM A;  1XTC D;  1PH7 A;  1B3A A;  4X66 Q;  1IBK L;  4JI7 Q;  2F0H A;  4QB4 A;  2PI2 E;  3JAM L;  2ICI A;  1BVS A;  1UE6 A;  1MD2 D;  3VYT A;  1E7Z A;  2CKZ B;  3ITP A;  4WJ3 M;  3P75 A;  4JI0 Q;  1EQV A;  1V8Q A;  1LUZ A;  1X6O A;  3GD7 A;  1GXD C;  2EOT A;  2ZT9 C;  5IYB G;  1SN8 A;  3MC0 B;  4OWW B;  1RF2 D;  2KCM A;  4PZ6 A;  1F2Z A;  3HOZ G;  5FKA C;  1J8I A;  2MFI A;  5I6W A;  4JI7 L;  1UEB A;  3SEB A;  4X66 L;  4XYQ A;  4B3T Q;  4EVO A;  5DLQ E;  1O78 A;  3W5O A;  2TSS A;  3H91 A;  3S17 B;  5JJI A;  1ZEQ X;  2B63 G;  4JI0 L;  3GTG B;  1Y1V B;  1X9N A;  1NE3 A;  2F0O A;  4BBS H;  3A8J E;  1BOS A;  1Q81 C;  2OTJ A;  3BZK A;  3NEM A;  4LUZ A;  4GOP C;  1EIH A;  4C3J G;  3QJY A;  5C3E H;  4RHR A;  2JEA I;  2R61 A;  2O5I C;  1HTP A;  3L3O C;  4J8Q A;  5D3D A;  4B3T L;  5C4X G;  3UDI A;  1I6H B;  3EA6 A;  4LMQ D;  3CCE A;  4JYA Q;  1Q12 A;  3TRZ A;  3M7N A;  2KCT A;  1HR0 W;  3GTJ B;  4LFC Q;  2B2V A;  4YCU A;  1KLU D;  4HJ7 A;  1VQM A;  3NBH A;  3D8G A;  1JIC A;  4L8J A;  4BBR B;  1CA5 A;  1VQB A;  4DV0 Q;  4ZLT F;  1QZG A;  3AEV A;  4KY5 A;  1PFB A;  2OQ0 A;  2L5T A;  5EPJ A;  1SNC A;  2HHH Q;  4A3K B;  5KYI A;  3GTQ B;  2OEO A;  4JCV E;  2F0P A;  4JYA L;  3A7L A;  4A3J G;  4LFC L;  4IUN A;  5JVH 3;  3W2D A;  4OWT B;  4L63 B;  1BQQ T;  3HOZ B;  3G71 A;  4FXD A;  5FOB B;  3FRP B;  4GNX B;  2A6E D;  1FJG Q;  4DV0 L;  4DR7 Q;  3S1R B;  1SYC A;  1Q3L A;  5DAU A;  3PIP A;  2HHH L;  5JAV A;  5JVG 3;  1X3F A;  4KLK A;  3E3X A;  3MXG A;  1QJO A;  4G7Z C;  4C3J B;  4QCL A;  1AH9 A;  2NVX B;  2X6L A;  1PYB A;  3SDZ A;  2NZ1 D;  3OMC A;  4KV6 A;  1VDZ A;  2ZJR A;  1H95 A;  1FJG L;  3R8B A;  4DR7 L;  5C4X B;  4R4I A;  5J39 A;  1IW7 C;  1TKW B;  3K80 C;  3J80 c;  4FXG C;  4A3I G;  1OXV A;  4IPD A;  4GKK Q;  5J22 A;  2R92 H;  3P1H A;  1D1K A;  1STE A;  4KKU A;  3OWF A;  1IBM Q;  2TMP A;  1KRT A;  5IGD A;  3PUW A;  3P7J A;  3EJI A;  1T5X D;  1SRO A;  3NXW A;  4A3F G;  3TP8 A;  4KTA A;  3J80 E;  1YZ6 A;  2IY5 B;  3QOL A;  4IFD I;  4ALP A;  1JMC A;  1CK1 A;  1C4Q A;  2J7Z A;  2VL6 A;  4IQZ A;  1I4P A;  4DN4 M;  2K5W A;  4GKK L;  2PQA B;  3ULP A;  5FLX L;  4BY1 G;  1S40 A;  3HOX G;  2KCC A;  1IBM L;  1VQ6 A;  2RCF A;  4C3I H;  1WD1 A;  2Y0S G;  2PMZ E;  3SK6 A;  1H9S B;  2ZTE A;  3MVV A;  3K57 A;  2DJF C;  3MWY W;  4IFD H;  4CKC A;  3E0J A;  1YJW A;  2EYH A;  1K9M C;  5EKL A;  2VQE Q;  1JCK B;  2VB2 X;  4C3H H;  1KAB A;  2HDM A;  5IP7 H;  1TWH B;  1A3T A;  4A3B G;  3PUV A;  4IUP A;  1MBY A;  3UI2 A;  4JPB W;  4B3M Q;  4KHP Q;  3NPP A;  1H9J A;  4K0K Q;  3CCL A;  4DNT B;  4LWC A;  1SMX A;  1IYV A;  1B1Z A;  1GVP A;  4GKJ Q;  2NZH A;  1UNS A;  5IWA Q;  2BA1 A;  2VQE L;  4AYB G;  4CDF C;  4PG3 A;  1Z7T A;  1L0W A;  4H44 C;  3RLO A;  1QVG A;  2R7Z H;  2CFM A;  4B3M L;  4KHP L;  4HN7 A;  4DUZ Q;  2JA6 G;  3S1N H;  4KK7 A;  4K0K L;  1S5F D;  1VQN A;  1WVL A;  2RBM A;  2A19 A;  1A63 A;  4GKJ L;  5G3L F;  4TVA B;  1NR2 A;  1V9P A;  2MP1 A;  5E7N A;  1BCP D;  4DV7 Q;  1D6E C;  4HTH A;  1O7Z A;  5IWA L;  1PFM A;  2D0O A;  1I3Q B;  5A35 A;  5CYU A;  3E9I A;  3RZD H;  2IHF A;  3KK7 A;  3A8I E;  1BUV T;  1YHQ A;  1I94 L;  1I50 B;  4P72 A;  5LMN W;  2KHJ A;  1JB3 A;  2MQH A;  4OEL B;  4DUZ L;  4OHJ A;  4JI3 Q;  5LL6 S;  1QUQ A;  2PQE A;  3I3C A;  1FD7 D;  1WCM B;  2M00 A;  2BDN A;  2VNU D;  1K8A C;  2PNR C;  2Q2H A;  4X3T A;  4JVZ A;  3CPF A;  2F0J A;  3DHQ A;  1QVF A;  1YNN C;  4DV7 L;  1QG7 A;  2EZV A;  2PZU A;  3CC4 A;  2X69 A;  1X54 A;  4A3B B;  2XRQ D;  1LT4 D;  4JI4 Q;  3ONA B;  4IAL A;  4HJA A;  3HOV H;  4HMI A;  1LYL A;  1D5Z C;  4JI3 L;  2OCE A;  4IUT A;  3TSS A;  2BA0 A;  4Q0F A;  5EQ0 A;  3S14 H;  1KD1 C;  3OYY A;  3KJP A;  4YCW A;  2UU9 Q;  1N32 Q;  1S3O A;  1PRT D;  4AH6 A;  1VQ7 A;  4JI4 L;  2YTV A;  3IRB A;  1CKN A;  2C35 B;  4IO9 A;  3S2H B;  3TEH B;  3VYU A;  3CQZ B;  1VQG A;  2WAQ B;  1EFW A;  4ZUJ A;  4QQB X;  5I9O A;  4LUO A;  1PH4 A;  2UU9 L;  3GTL H;  2ICE C;  1N32 L;  4HIM A;  1MIU A;  4DNR B;  2ZXR A;  4CKB A;  5DEH A;  5K36 H;  1M4V A;  1STB A;  3NK9 A;  1WTR A;  1HA6 A;  3D4R A;  4KN7 C;  3OTO Q;  2XN9 C;  4X3K A;  4A3G G;  5EBC A;  4K2K A;  4R8I A;  1TWF B;  3PGZ A;  4JI2 Q;  1HH2 P;  1VQI A;  2FJ2 A;  1Y8O B;  3SK5 A;  3J7A V;  2KVM A;  3J81 i;  1B70 B;  2ZXP A;  3AB9 A;  3KDF B;  5KND A;  4V19 0;  4R4Q A;  3EIV A;  4ZKC B;  5FLX c;  2K1B A;  1PFS A;  2K33 A;  1D2B A;  5M3M G;  5IT9 L;  1VQK A;  3OTO L;  1W3S A;  1O7L A;  3CXC A;  1CI3 M;  1FL0 A;  3CKI B;  2BDO A;  3VR2 A;  4YIJ A;  4OON A;  4OWX B;  4YY3 Q;  3ND8 A;  2PCF B;  4JI2 L;  4ID6 A;  1TWA B;  4K14 A;  5FLX E;  3BS1 A;  3Q24 A;  2NZO A;  3DMU A;  1J5E Q;  4DNI A;  2MJ8 A;  2BOS A;  1PZI D;  4DR2 Q;  1W2B A;  3H6M A;  3W1G A;  2ASB A;  3D4D A;  2AQ3 B;  4DV4 Q;  1E2V A;  1NR4 A;  1XJV A;  1R4Q B;  2DNC A;  1EL0 A;  1LTB D;  1AE2 A;  5I4D A;  3D6W A;  4YY3 L;  1MI2 A;  1KTK A;  1TWC H;  3M4O H;  3CRK C;  2Z0S A;  1BXT A;  4CJ0 B;  2E5L Q;  3L2P A;  3KLW A;  3M3Y H;  1J5E L;  1HPC A;  5GAH C;  4DR2 L;  1NCV A;  1EIY B;  1VQA A;  1Z47 A;  4K5V A;  4JBM A;  4IUV A;  3T56 B;  2Z6K C;  4DV4 L;  1GUT A;  3I7F A;  1E24 A;  4JI6 Q;  5M3F B;  2Q8T A;  2IPK D;  3BYT B;  3X3M A;  2AWO A;  2K5H A;  4RGN A;  1PA6 A;  4ME5 A;  1QNK A;  4YWM A;  2E5L L;  2JSO A;  2MGS A;  3IL8 A;  4KY6 A;  4HJ8 A;  1B4O A;  1B8A A;  2UXC Q;  4OX9 Q;  3I4M B;  4V0B A;  1PTO D;  4O2D A;  4JI6 L;  3BVG A;  2VQF Q;  5KYL A;  3I4N H;  2QCP X;  4JK1 C;  4UHV A;  1V1O A;  2Q2U A;  3EVQ A;  1VF5 C;  4UDU C;  1PMR A;  5IIF A;  4A3D B;  3PIP 3;  4IPH A;  4KN4 C;  1U4P A;  1SYG A;  3GV3 A;  4K5W A;  1K83 H;  2YU9 H;  2KUM A;  1I4X A;  4A3L H;  2UXC L;  4OX9 L;  1CZW A;  2YTX A;  4XT3 B;  1PTO H;  1STH A;  1KXL A;  5CMD A;  2VQF L;  4A3M H;  4DGZ A;  4DV6 Q;  5M5Y B;  4QL5 A;  4F87 A;  1B7Y B;  2WIN B;  1F9Q A;  4H0L C;  5GQO A;  3CMA A;  2LMC B;  3PIO 3;  2F3I A;  1JC7 A;  3VR3 A;  2G5D A;  5FO7 B;  4WRD A;  2JN4 A;  1UUP A;  1EU4 A;  1QIL A;  4X3U A;  3C2P A;  3WOF A;  1FNU A;  4TKO B;  2A6H C;  4DV6 L;  1Q90 A;  1C8C A;  1C9O A;  1JE4 A;  2DY7 A;  1CUK A;  2VW9 A;  1FVI A;  4GN3 B;  3HG9 A;  2QIL A;  2I07 B;  4M8A A;  1IW7 D;  1Y69 U;  3SK4 A;  2K28 A;  1PLF A;  1GJX A;  4BA1 I;  1W6J A;  4PNY A;  2GVA A;  3Q0A A;  1VQH A;  1IHZ A;  1SAP A;  3VR4 A;  3S17 H;  1NAP A;  3GTP B;  2O5J C;  3NUC A;  1Z6H A;  3GTG H;  4ABN A;  3TP7 A;  1Y1V H;  2VUM B;  1BCP C;  2PI2 A;  1DCZ A;  4QMG A;  2A1A A;  3PQI A;  2JA5 G;  4JW0 A;  3GTM B;  2K05 A;  2B39 A;  5E3F A;  4Y52 H;  4S3S A;  1J6Q A;  4DR6 Q;  3CF5 A;  1SYF A;  1I6H H;  1A15 A;  1KNE A;  3KF8 B;  3VYR A;  5IYC G;  1UEA B;  3GTJ H;  4RGT A;  2NVT B;  4CHT B;  3VA5 A;  5C0X G;  2EXD A;  4BBR H;  1HR0 Q;  3PO3 B;  4XXE A;  3A74 A;  2JA8 G;  1CFM A;  3KF6 A;  4A3K H;  2JA7 G;  2EJF C;  3GTQ H;  4DR6 L;  3T13 A;  5D65 A;  1ML0 D;  5IYB H;  1GUG A;  1WFQ A;  1ONL A;  3H09 A;  1GOZ A;  4OXP A;  2NN6 I;  4OIK A;  3HOZ H;  4FNF A;  1M1K C;  2CWP A;  1HR0 L;  2K04 A;  1EYC A;  1PRT C;  4QY7 A;  3S1R H;  1CT1 D;  4FF1 A;  1HHV A;  1PDQ A;  4G7O C;  1HA5 A;  4RH6 A;  2K01 A;  4XQJ A;  3HOW G;  3HOY G;  4FO2 A;  1KAW A;  2WAQ E;  3ERS X;  2N88 A;  4C3J H;  3FKI B;  1Q8I A;  2JA5 B;  2NVX H;  2XTI A;  2NN6 H;  4OL7 A;  3A5Z B;  3H3V C;  1DGS A;  3AYH B;  2RDG A;  4UP9 A;  3F2B A;  5KIX A;  4K6D A;  3DXJ C;  4A3E B;  3K59 A;  1IKL A;  3Q23 A;  2HD3 A;  2D9U A;  5IP9 G;  2FXQ A;  2AUJ D;  2NVQ B;  5I6Y A;  4ZYS A;  3NBH B;  4JI8 Q;  1ZYR D;  4P2C B;  2K5D A;  2CH4 A;  2AKW B;  4DV2 Q;  5CBA E;  4GLX A;  1JJG A;  2XNA C;  1EY0 A;  3OIQ A;  1Y1W B;  4MTN A;  2PW7 A;  1BO0 A;  4HED A;  3RZO B;  3MHB A;  1WYD A;  3CW2 C;  4OO1 G;  3UDG A;  2HIX A;  4XIG S;  1HZC A;  3CPW A;  1HZB A;  2KA7 A;  1M90 C;  3C3L A;  2EYF A;  4JI8 L;  4K5X A;  5IYD G;  2Q8R E;  1VMC A;  1HQR D;  1GD7 A;  1I4G A;  4U68 A;  4DV2 L;  1D8L A;  1L1O A;  1OXX K;  2B2Y A;  4HSP A;  5JJL A;  1N34 Q;  2IX3 A;  2E74 C;  4DPG A;  2F0D A;  1STY A;  2F1M A;  3D3R A;  3NTK A;  1KIX A;  2VXW A;  5GAD C;  4DKA C;  3HOY B;  1S5C D;  3MTS A;  5M5X B;  5ELN A;  1X3G A;  1M8A A;  3PUY A;  2F52 A;  3AFQ A;  5CR3 A;  3A0J A;  3S2D B;  5A2Q L;  3RR5 A;  1F9P A;  4X64 Q;  1TWH H;  3HOU B;  4B3R Q;  5AJ3 Q;  3KBX A;  3MEF A;  1QZH A;  3UDF A;  3T16 A;  1N34 L;  1Q86 C;  2J0T D;  2F0T A;  2JA9 A;  2NYZ D;  2I5M X;  2OT2 A;  1X3P A;  4FVM A;  2IX0 A;  3RLF A;  4QGU A;  2B2V C;  4QIW B;  3PF5 A;  4ME3 A;  1TY0 A;  4XQQ A;  2B2W A;  1CSQ A;  2L11 A;  4X64 L;  3A5U A;  4B3R L;  5AJ3 L;  1SJE D;  2R93 G;  4IUQ A;  1TY2 A;  1HCZ A;  1GO3 E;  1PZK D;  5D3I B;  3TME A;  3GTK B;  1EWH A;  2K5Q A;  3CP0 A;  1WTP A;  4FYD A;  3KUP A;  1U4R A;  3T51 B;  3TQY A;  1PYW D;  4ILW A;  2FHT A;  5GAE C;  5COY A;  3FDT A;  1HFN A;  1I3Q H;  2HCC A;  1PTO C;  2N3S A;  3AMU A;  3RUZ A;  1I50 H;  2EYO A;  5EGT A;  1RIP A;  3MFG A;  4IJL A;  4JG2 A;  1Q7Y C;  2CH4 W;  5BR8 Q;  4E6I A;  4PMC A;  4Y7N B;  1WCM H;  4B9X A;  5DNF A;  1HNW Q;  1KL9 A;  4FF4 A;  4IJH A;  5AFW A;  2PW5 A;  2ES2 A;  5FJ8 G;  1Q1B A;  3TN2 A;  1MKH A;  3I70 A;  4POG A;  2AWN A;  4F88 A;  4K2L A;  3DEP A;  4XTC S;  1R9T B;  1GHK A;  3QB3 A;  3F2C A;  4HMJ A;  3FVQ A;  2O4X A;  3LGJ A;  5BR8 L;  3R93 A;  3ZJY C;  4YHH Q;  2A68 D;  2UUB Q;  4JBK A;  1X3Q A;  5HY6 A;  4FP5 D;  1CHQ D;  2O2L D;  1HNW L;  1L2F A;  3S24 A;  2B63 B;  2QEX A;  1SNP A;  3OWE B;  5C5L A;  3A8K E;  2Z4H A;  2IJ0 A;  3HEJ A;  1GKH A;  2A69 D;  4YWK A;  3CCS A;  5CGK A;  4AIM A;  1DOL A;  2NVY B;  3F8T A;  3S2H H;  1WTQ A;  3CQZ H;  2LKV A;  2EJM A;  2HIV A;  2HUG A;  2UUB L;  4YHH L;  1EIG A;  2DY8 A;  3UE1 A;  3HGB A;  2EIF A;  3G6E A;  3AU7 A;  1B44 D;  5K5P A;  1VQF A;  2WB1 G;  5FLM H;  2EPB A;  1BBW A;  3V2T A;  2QDL A;  3K0X A;  2M9V A;  1CQV A;  3KOJ A;  2BH2 A;  1KHI A;  1IZ6 A;  1BCP F;  1QUQ B;  3F2U A;  4C56 C;  2FFK B;  2D2C C;  4HCS A;  4A93 G;  2E2I B;  1PYS B;  2ATW A;  3CCJ A;  1ROD A;  4CDE C;  1PV4 A;  4R9W A;  4PMW A;  5I2X A;  1SYD A;  1XMO Q;  1CQF A;  2BCO A;  3CRL C;  2VB3 X;  3MXN A;  5COR A;  4A3J B;  1TWF H;  1DON A;  3HRZ C;  3QWN A;  4DV1 Q;  1ASY A;  1KQS A;  5HGQ A;  3NTI A;  3HKZ G;  2PZW A;  2E2D C;  3J7A 5;  1MSG A;  2K52 A;  4GNX C;  5JPM C;  1WI5 A;  4L6T B;  3URY A;  4N9T A;  5LHY 1;  4J15 A;  1ESR A;  1CM9 A;  1EY8 A;  1XMO L;  2ID0 A;  4QJF A;  2GVB A;  1TWA H;  1PFN A;  1UWV A;  4DV1 L;  3GTO B;  5C3E G;  1PZJ D;  1S5D D;  2DUD A;  3J7A F;  1CKN B;  3BVZ A;  4MTK A;  3JAM c;  1PH5 A;  1RCV D;  1SND A;  4LF4 Q;  2KHS A;  3SXH A;  1PRT F;  4A3I B;  4O42 A;  4OGQ C;  4GS3 A;  1RTO A;  2A6H D;  1Q82 C;  3KYH C;  4KY7 A;  3JAM E;  1KNA A;  3PUX A;  5A2Q E;  2OF1 A;  2ZJQ A;  1A3U A;  1FGB D;  3H0G H;  5DM6 3;  4A3F B;  4A93 B;  3PF4 A;  2RDH A;  2R7D A;  4R4O A;  3HFZ B;  3R2I A;  4LJZ C;  4LF4 L;  4C2M B;  1A0I A;  4BS9 A;  3S1M B;  2HT1 A;  3TP5 A;  3EQL C;  2D62 A;  5M3F H;  1SFO B;  5CV6 A;  4IN3 A;  4GN4 B;  3WWV A;  2AQ2 B;  1CKM A;  4BY1 B;  3HOX B;  3NEL A;  3IFD A;  1E2Z A;  1V1P A;  1LAC A;  3B6Y A;  3L0O A;  3HKZ B;  4ZAI A;  2Y0S B;  4BXX G;  3J7Y W;  1ZYR C;  3T4A C;  3QIA A;  4AQY Q;  2F0K A;  3CCQ A;  3I4M H;  1LAB A;  4J6H A;  4EGV A;  3KLR A;  3NHH A;  4BA2 I;  2P5Z X;  4XQN A;  1HJP A;  2ZXO A;  3K5N A;  2RHQ B;  1JQY D;  2IX1 A;  5KNB A;  2FMC A;  2XVS A;  4PMB A;  3I90 A;  4P74 A;  4JI1 Q;  3I72 A;  1ENA A;  1SLJ A;  2MUY A;  4A3D H;  1HQM C;  5HGT A;  2YV5 A;  3J81 L;  1A3V A;  4AQY L;  2R92 G;  1BDO A;  4A76 A;  4LF5 Q;  1DJR D;  2A5H A;  5ELC A;  1AFP A;  4AYB B;  4HJ5 A;  2WFW A;  2F4I A;  5M5Y H;  4H02 A;  1WTO A;  1I4R A;  4TRD A;  4P75 A;  4EQN A;  3FMC A;  2F0S A;  4JI5 Q;  3E5S A;  4JI1 L;  4I7Z C;  5CV4 A;  5IOC A;  1EYG A;  2L15 A;  1Q8K A;  2Q8I B;  4CJ2 C;  2JQO A;  3QO2 A;  2JA6 B;  1OXS C;  5IGC A;  1NNX A;  2K32 A;  5C3W A;  1HNZ Q;  2UUC Q;  4C3I G;  4LF5 L;  5JJK A;  1GUS A;  3VR6 A;  1KDB A;  1E3P A;  3NP8 A;  2EQS A;  4RWS C;  4FDB A;  3S1Q B;  2K7V A;  4XYO A;  4N9P A;  1ET6 A;  4PV1 C;  1B3Q A;  1F2M A;  3H3V I;  2GA4 B;  3VR5 A;  4JI5 L;  3VDY A;  3H15 A;  4IFD G;  5T1G A;  2CW0 C;  5CV9 A;  3T1Y Q;  4DF7 A;  4F7X A;  2AUK A;  3GQB A;  1VQ5 A;  1HNZ L;  4RKL A;  4XT1 B;  3GTP H;  2UUC L;  3S16 B;  2CQA A;  3R2T A;  4A75 A;  2VUM H;  4NW2 A;  1FR3 A;  1EY6 A;  2F3W A;  2F0Q A;  5IOD A;  2KEN A;  3H3V H;  1PTO F;  3KLS A;  2B3G A;  3GTM H;  3T1Y L;  1HRJ A;  1KRS A;  2A8V A;  1O7Y A;  4LUV A;  3ULL A;  4K8I A;  1EUJ A;  1CKO A;  1G8Z D;  3FEW X;  1STA A;  1STN A;  4DK3 C;  3ERQ A;  2NVT H;  2R7Z G;  3AFP A;  2E2H B;  1GUN A;  4ZRZ A;  2F4V Q;  3I56 A;  1SNO A;  2K5V A;  4HR7 B;  1G2S A;  2X6G A;  3F2D A;  3KLS X;  2PZT A;  3M9B A;  3PO3 H;  1SDF A;  1F77 A;  1VCI A;  2EYL A;  5ELD A;  4IZ8 A;  1S72 A;  3PCO B;  1E1T A;  2DJG C;  1ENC A;  4IOC A;  2A68 C;  1ZKO A;  2JP1 A;  2F4V L;  1FNW A;  4BWG B;  1SE2 A;  1SNM A;  1V43 A;  4ULL A;  1JE5 A;  3TS2 A;  2QDB A;  3OSO A;  1TS2 A;  2A69 C;  5JEA G;  3G48 A;  3BDC A;  4ZK9 B;  2SNM A;  3MXU A;  3SHL A;  4A3G B;  4DR1 Q;  1T5E A;  3FPU B;  2CCZ A;  2VY3 A;  1H9K A;  1SXT A;  1WJJ A;  1EY4 A;  3HOV G;  1TQO A;  1WOC A;  1Z9F A;  2F0U A;  3FKI H;  2F0V A;  2JA5 H;  3NQT A;  2A73 B;  3D0F A;  2KQ3 A;  3BDL A;  3PSI A;  4KI0 A;  1A8V A;  3ERO A;  3WDN A;  4A3E H;  4EX5 A;  1II3 A;  1B50 A;  1VQE A;  1K0S A;  5M3M B;  1G6P A;  1KAA A;  3MEH A;  1PH2 A;  4LAA A;  1RDP D;  4A3C G;  1XPO A;  4UPA A;  3SVM A;  2NVQ H;  4KD4 A;  4DR1 L;  3S1N B;  4X62 Q;  4L5R C;  1IBL Q;  1B53 A;  4NDX A;  5D14 A;  4LF7 Q;  1JOR A;  1W6K A;  3KF6 B;  1Y1W H;  3TP6 A;  2Z4I A;  2KEE A;  3WOE A;  3RZO H;  3K7U C;  4H7B A;  1N36 Q;  4KD3 A;  3NE5 B;  2PPB C;  1JR0 D;  1GUO A;  4X62 L;  3J81 c;  3A56 A;  5K36 G;  1IBL L;  1MGS A;  2B2T A;  4G7H C;  4LF7 L;  1SSO A;  2Z6K A;  1JT8 A;  2H1E A;  1D7Q A;  4P73 A;  3S15 B;  1YIJ A;  1SYE A;  3I73 A;  3ULJ A;  3RD4 A;  5M5X H;  3J81 E;  1X3E A;  3DWQ A;  2F0M A;  1C0A A;  2F0W A;  1N36 L;  2HDL A;  3S2D H;  4HAE A;  1VQC A;  4DFA A;  1U4L A;  3M4Q A;  1SE8 A;  3QG1 A;  3HOU H;  1KDA A;  2G9D A;  2F0N A;  1EY7 A;  1C7Y A;  2RDF A;  2RQX A;  3PO2 G;  3I4O A;  4KMU C;  1SEB D;  3BZD B;  1DD2 A;  2JE6 I;  2XWJ B;  4DAV A;  1E1O A;  1XMQ Q;  1HFG A;  1RHP A;  1NJI C;  2UXB Q;  1K8M A;  3LNN A;  2Y0S E;  4QUF A;  3GP7 A;  3DWA A;  2D5D A;  1YIT A;  1I4H A;  1GHJ A;  4LF9 Q;  3TS0 A;  1L0Y B;  1TS4 A;  1X55 A;  4DXF A;  2DNE A;  5EPK A;  4DK1 A;  4DAY A;  1QB5 D;  3MA2 B;  1L1O B;  1XMQ L;  2UXB L;  1ICW A;  4O1N A;  1VQP A;  4PZ8 A;  1SBB B;  1D5X C;  1YHA A;  5IT9 c;  4Y7N H;  1IYJ B;  5IGF A;  4LF9 L;  5CBE E;  4PZ7 A;  1EZ8 A;  3KBG A;  4IPC A;  4JOI C;  2WP8 J;  5C44 G;  4DUY Q;  2OXP A;  3NBI A;  4B08 A;  4IUU A;  3I55 A;  5J3B A;  4KKT A;  2R6G A;  3FHW A;  2LY7 A;  4AYB E;  5IGE A;  3E6Z X;  3NEN A;  1N9W A;  1SRU A;  3DUZ A;  2MO1 A;  5IT9 E;  4NXM Q;  1R9T H;  3PO2 B;  5C3X A;  2VS1 A;  1EWC A;  4CDC C;  3HS0 C;  5CV7 A;  2Z6B A;  3Q6S A;  3O13 A;  4Z9C B;  3I4N G;  5DM7 3;  3GO5 A;  1YI2 A;  2E8G A;  2EY2 A;  4DUY L;  1YHB A;  2K75 A;  2B63 H;  5C4J B;  2RA4 A;  1U5K A;  4EQ5 A;  4BBS G;  4GLV B;  3C1F A;  1XPU A;  5M5W B;  4NXM L;  2NVY H;  3GV6 A;  1TS3 A;  4A3L G;  2KOL A;  4ZQ3 A;  2EVB A;  1TWG B;  2ZTD A;  1WTH A;  1EWI A;  5I2Y A;  2YYZ A;  4CDD C;  4A3M G;  4KJN A;  1XXG A;  5C4X H;  2ZM6 Q;  1CHP D;  5IGG A;  1YVC A;  1BF4 A;  3NQI A;  4JC0 A;  1QE6 A;  3DM3 A;  3K81 C;  1KLG D;  4G4K A;  1IXR A;  4A4I A;  1VQD A;  3OHX C;  2B2Y C;  2KJX A;  2YTY A;  4RCN A;  2AQ1 B;  1RTN A;  4OIJ A;  5GRO A;  1DM0 B;  5E4W C;  2E2I H;  3NWT A;  5FK9 C;  4ZUI A;  3H94 A;  5C44 B;  5BN5 A;  1VQO A;  2JA8 B;  3VYS A;  2JA7 B;  1NBW A;  2ZM6 L;  4R8N A;  1YJN A;  1AZQ A;  1JOQ A;  4A3J H;  1R4P B;  3U4Z A;  1XPR A;  2J4X A;  4G57 A;  5JPN C;  2WKC A;  4UP8 A;  1XWE A;  2IWH A;  4UAI A;  3BZC A;  4DAM A;  3OMG A;  2EYJ A;  1DYQ A;  4PQX A;  2OTL A;  2F03 A;  5IGB A;  1N8R C;  4J1M A;  2SDF A;  1MSH A;  1H9M A;  3PMF A;  4K6L A;  1VF7 A;  2B2W C;  3IAY A;  4RKB A;  3HOW B;  4BBS B;  1G2T A;  1GM5 A;  4IOA A;  4L5S A;  3GTO H;  1BBU A;  2N8N A;  1BR9 A;  1BKB A;  1LTL A;  2L1B A;  5EPL A;  1JOK A;  4YCV A;  1LLR D;  3KFU A;  3DM1 A;  4A3I H;  1DOK A;  4FF2 A;  3C1E A;  3BJU A;  4BBR G;  2BE5 D;  4JV5 Q;  3FPP A;  4XDX A;  2XIW A;  3N52 A;  4HIO A;  4A3F H;  4A93 H;  2B2U A;  5TSS A;  4IPG A;  2CW0 D;  4A3K G;  1IYU A;  1RD9 D;  1K0R A;  4FF3 A;  3J80 i;  5KNC A;  4NKL A;  4C2M H;  3S1M H;  1I4Q A;  1SR3 A;  3MXN B;  3J7Z C;  1YEZ A;  1SFO H;  1QOH A;  4BY1 H;  4JV5 L;  3HOX H;  3DEO A;  4F8M A;  1K8O A;  4LW1 A;  3U4V A;  2PNH A;  2RSN A;  1P16 A;  3STB C;  2HCI A;  5C0X J;  2XWB B;  2G9H D;  2L55 A;  1JWU D;  4DA2 A;  3L9A X;  5LMN Q;  4LF6 Q;  1K3B C;  2NN6 G;  1G6Z A;  3JC6 6;  1PVO A;  4A3B H;  1K3R A;  3G7L A;  4DR5 Q;  1KC8 C;  2QGQ A;  3NSW A;  1OXU A;  2NBF A;  3K8A A;  1ICF B;  1RL2 A;  1TII D;  5EAY A;  1YNJ D;  1A2T A;  4CGY B;  1X32 A;  3K7A B;  3A7A B;  5LMN L;  2F0F A;  4LF6 L;  1TVX A;  2RCN A;  4GOP A;  3OW2 A;  4I7A A;  1C48 A;  4KHZ A;  4APV A;  3JAM i;  2B8G A;  1NTG A;  4DR5 L;  4RMF A;  4WFN 3;  4RAU C;  2R93 B;  1ESF A;  1T9H A;  2LS0 1;  1YJ9 A;  1S5E D;  4ZKB B;  2JA6 H;  1B2T A;  3VA7 A;  5ELF A;  3UE0 A;  4BY7 G;  3HKS A;  5HUR A;  1EY5 A;  5IY0 A;  2F0I A;  3ICE A;  1HXY D;  1V1P B;  2JXM B;  4BXX H;  3S1Q H;  5E1F A;  5EBD A;  4RHS A;  5C5M A;  5CC4 A;  3CCV A;  1XX8 A;  2EYP A;  3EBE A;  3I8Z A;  2SEB D;  3BDO A;  1EZ6 A;  1F9S A;  1VQ8 A;  1CTM A;  2JK8 A;  2KED A;  4Q5V A;  1LTG D;  3D4W A;  3S16 H;  2E2J B;  1EFI D;  1B9N A;  1LV9 A;  2Z8L A;  1XTD A;  2I0Q A;  3Q8D A;  3PIO A;  1LTI D;  1ZXT A;  4DR4 Q;  3NWS A;  3UDX A;  1Y8N B;  2Z9H A;  3LWE A;  3BG3 A;  1MHW C;  5FO8 B;  3CU7 A;  3L7Z C;  3TZD A;  2A74 C;  4NP5 A;  2E2H H;  3X3N A;  5JJZ A;  4JBW A;  4DXG A;  4NPS A;  1HNX Q;  4DR4 L;  4DK6 C;  2K03 A;  4C1N K;  1AW7 A;  4B9W A;  4BY7 B;  1NY4 A;  1F2Y A;  2EY5 A;  3BVM A;  1U9R A;  1Q46 A;  3CD6 A;  1LTS D;  1EIF A;  2H5X A;  3K0Y A;  3V05 A;  1NMF A;  1EQT A;  2VZA A;  4NB3 A;  1V1Q A;  2ALY B;  2CHB D;  1FYC A;  2WB1 B;  5CV8 A;  1HNX L;  1WCM G;  3U50 C;  1J9O A;  2GN5 A;  3SR1 A;  3ER0 A;  5ISR A;  4QUC A;  1YNX A;  3OW7 A;  2M2L A;  2OWO A;  1U4M A;  2QF7 A;  4A3G H;  1I5F A;  1HUM A;  3Q22 A;  2JJQ A;  2K5N A;  2WII B;  5KEE A;  2ENB A;  1K28 A;  1JOO A;  4GNX A;  3W1B A;  1EQQ A;  2MHV A;  2XRS D;  1SNQ A;  1CSP A;  3MAQ A;  2Q2I A;  3I4L A;  2MO0 A;  1E0B A;  1S4Z A;  1QWY A;  1I94 Q;  5M3M H;  1SMY C;  3M85 A;  1L0X B;  1EU3 A;  2L9H A;  4M1U B;  1D1I A;  3DWP A;  5ELO A;  1SE3 A;  1OTC A;  1VQ4 A;  4LFB Q;  2BH8 A;  1WTV A;  1QCB D;  3CCR A;  2V4D A;  5C3E B;  1UE7 A;  4LK1 C;  1LO5 D;  4EQP A;  3F1Z A;  5EKK A;  4GZY C;  3SE0 A;  2WAQ G;  3N6R A;  4LFA Q;  1PH6 A;  3T1H Q;  5J1Z A;  5FLM G;  4X65 Q;  3PUZ A;  2N55 A;  1NSN S;  2N78 A;  4HIK A;  1OXT A;  4HJ9 A;  2EXZ A;  1QVC A;  3SK8 A;  4LNQ A;  4KJO A;  4LFB L;  5LMU Q;  4TQU S;  2Q2T A;  1EQR A;  1F9R A;  5JEA H;  3S15 H;  2ZJP A;  2RKS A;  2MNA A;  5LL6 X;  1RKN A;  4LFA L;  4B3S Q;  1WTX A;  3T1H L;  2PQA A;  3K5O A;  2IHE A;  1JWS D;  4X65 L;  2CWA A;  2LXJ A;  3TRE A;  2NWG A;  1UAP A;  1PH8 A;  5LMU L;  2F0E A;  1H9S A;  4QIW E;  1O7I A;  4WJ4 A;  2BE5 C;  2SOB A;  3EFX D;  2JEB I;  1X65 A;  4RFB A;  3EN2 A;  1JJ2 A;  4A3C H;  1HTL D;  2HQL A;  4B3S L;  1DZ1 A;  1JB7 A;  1LTA D;  4C3H G;  1DOM A;  5CV5 A;  5KGU A;  4DR3 Q;  5IP7 G;  3CME A;  3FP9 A;  2EY6 A;  3S9W A;  2AMC B;  1TS5 A;  4MIU A;  3GDE A;  2NUC A;  1BBX C;  2R92 B;  1O80 A;  3RMH A;  1VQ9 A;  2DGY A;  2IL8 A;  2RF4 A;  1PHJ A;  4LF8 Q;  5G3L D;  2I5L X;  3H0G G;  1PXU A;  4DAP A;  1XNR Q;  1E22 A;  2K6A A;  4H13 C;  4DR3 L;  1XNQ Q;  3I91 A;  3AQQ A;  4R4T A;  1CA6 A;  1FGU A;  3DLL A;  1B9M A;  4WOR A;  1AN8 A;  3LWU A;  3PV0 A;  5M3F G;  2NTT A;  5FO9 B;  5C4H A;  3C46 A;  2MPM A;  4LF8 L;  4C3I B;  2RHS B;  2AHO B;  1XNR L;  2FMM A;  1U0L A;  1YNJ C;  1XNQ L;  1PH3 A;  2C5C A;  3PO2 H;  2IW3 A;  3I4M G;  4UP7 A;  4MN3 A;  4C3H B;  3T53 B;  1K73 C;  1AEX A;  2B8F A;  2CQO A;  5C0X I;  4MNO A;  5C4J H;  4A3D G;  1G29 1;  1ILP A;  2IT1 A;  5M5W H;  2A6E C;  5EJW A;  2QW7 A;  1HZA A;  3HZX A;  4GLA C;  1P8L A;  4IUR A;  1TWG H;  4YWL A;  3ND9 A;  1LT5 D;  1SE4 A;  4EQO A;  1BNZ A;  3R3O A;  4O0A A;  3H0G B;  4POF A;  3RN5 A;  1A6X A;  1MJC A;  3LX0 A;  4DAY B;  3MFY A;  2HQE A;  5IYC H;  1PH9 A;  1UE1 A;  1Q1E A;  2B2T C;  2R7Z B;  4GN5 A;  3OPO A;  1H9R A;  4QF4 A;  4U67 3;  5C0X H;  2ZTC A;  2B29 A;  3K5M A;  1TXY A;  3STB D;  4NXN Q;  1XYI A;  2EJG C;  5M9O A;  5C44 H;  2JA8 H;  2JA7 H;  5F2D A;  3G6J B;  4C1N I;  2PYK A;  3RZD B;  4RGM A;  3BU2 A;  3E0E A;  1K8G A;  4NXN L;  4X6A H;  4HID A;  1LM0 A;  2NB0 A;  4TSS A;  1ET9 A;  1LT3 D;  2KEC A;  4N8X 1;  5T1I A;  1I6V C;  3A55 A;  1A2U A;  1BCP B;  2KHI A;  2LSS A;  2RSO A;  1SJH D;  2VUM G;  1NMG A;  1UE5 A;  3CAM A;  2NTS A;  1Y8P B;  3HOW H;  3HOY H;  4CBV A;  2PO4 A;  4WJW A; 
#chains in the Genus database with same CATH homology
 4AH6 A;  1BBW A;  3U4Z A;  1XPR A;  1VQ7 A;  4JI4 L;  2YTV A;  3IRB A;  3K0X A;  3KOJ A;  2BH2 A;  4R1J A;  1KHI A;  1CKN A;  1IZ6 A;  2C35 B;  3KDF A;  2WB1 E;  4UP8 A;  1QUQ B;  3TEH B;  4IO9 A;  2UXD Q;  4A93 G;  3BZC A;  4DAM A;  1PYS B;  2ATW A;  3CCJ A;  2OTL A;  3E9H A;  4RG1 A;  1PV4 A;  1N8R C;  1VQG A;  4OO1 I;  4PMW A;  1EFW A;  5IE8 A;  4QQB X;  4IFD J;  1XMO Q;  4LUO A;  1PH4 A;  2UU9 L;  1TWF H;  5IP9 H;  3GTL H;  1GM5 A;  4IOA A;  1N32 L;  4HIM A;  4DV1 Q;  1MIU A;  1ASY A;  4L5S A;  1KQS A;  3GTO H;  5HGQ A;  3PO3 G;  1BBU A;  2N8N A;  4P71 A;  2UUA Q;  1BKB A;  1LTL A;  3HKZ G;  2UXD L;  4YCV A;  1G51 A;  1VQL A;  3J7A 5;  2K52 A;  3KFU A;  4GNX C;  1YBY A;  2K14 A;  1WI5 A;  3OTO Q;  3HKZ E;  3U58 A;  3M4P A;  3GTK H;  4A3G G;  4A3I H;  4J15 A;  1XMO L;  3BJU A;  1PH1 A;  4BBR G;  3PGZ A;  4JI2 Q;  1HH2 P;  1VQI A;  2ID0 A;  4QJF A;  4JV5 Q;  2GVB A;  1TWA H;  1UWV A;  3CC7 A;  4DV1 L;  5C3E G;  2D0P A;  2DUD A;  1B70 B;  1CKN B;  3J81 i;  4HIO A;  3KDF B;  5IYD H;  4A3F H;  4A93 H;  4IPG A;  2UUA L;  3JAM c;  4R4Q A;  4A3K G;  1PH5 A;  3EIV A;  5FLX c;  4L5Q A;  1PFS A;  4LF4 Q;  1K0R A;  5M3M G;  1VQK A;  3J80 i;  3OTO L;  1W3S A;  4C2M H;  3S1M H;  3CXC A;  1FL0 A;  1SR3 A;  3MXN B;  4GS3 A;  3J7Z C;  1YEZ A;  4OON A;  1Q82 C;  4OWX B;  1SFO H;  3FKI G;  4YY3 Q;  3KYH C;  4MZ9 A;  4BY1 H;  3PUX A;  4JI2 L;  3HOX H;  4JV5 L;  2ZJQ A;  3H0G H;  4LW1 A;  3U4V A;  2NZO A;  2PNH A;  1J5E Q;  4DNI A;  3PF4 A;  1EOV A;  1Y14 B;  1P16 A;  3STB C;  4DR2 Q;  1W2B A;  3W1G A;  2ASB A;  2QA4 A;  2R7D A;  4A3E G;  1JJC B;  4DV4 Q;  4R4O A;  3HFZ B;  5C0X J;  4LF4 L;  1XJV A;  1A0I A;  2KBN A;  2HT1 A;  4DV3 Q;  2D62 A;  5M3F H;  3RLN A;  1AE2 A;  4GN4 B;  3WWV A;  3K7A H;  5LMN Q;  1CKM A;  4LF6 Q;  4YY3 L;  2NN6 G;  1TWC H;  3NEL A;  3M4O H;  5JEA J;  3B6Y A;  2Z0S A;  3JC6 6;  3L0O A;  1PVO A;  2XGT A;  4A3B H;  1K3R A;  2E5L Q;  4BXX G;  3L2P A;  4DR5 Q;  3KLW A;  1KC8 C;  2QGQ A;  3M3Y H;  1J5E L;  1Y1W G;  1OXU A;  2R93 H;  5GAH C;  4DR2 L;  2R7F A;  4AQY Q;  1EIY B;  1VQA A;  1Z47 A;  3K8A A;  4JBM A;  4DV4 L;  3CCQ A;  2Z6K C;  1N33 Q;  3I7F A;  3RNU A;  3I4M H;  1E24 A;  4JI6 Q;  1RL2 A;  4DV3 L;  4BA2 I;  1VS0 A;  5EAY A;  2V1C C;  2AWO A;  1HJP A;  2K4K A;  2K5H A;  3RN2 A;  4BBS G;  3I2Z A;  5LMN L;  4DV5 Q;  4LF6 L;  2RHQ B;  2IX1 A;  1PA6 A;  1VQJ A;  2RCN A;  4R4C A;  4GOP A;  3OW2 A;  4JI1 Q;  4P74 A;  3JAM i;  4KHZ A;  4APV A;  4YWM A;  1NTG A;  2E5L L;  1SLJ A;  4DR5 L;  4RMF A;  4A3D H;  1T9H A;  4HJ8 A;  1YJ9 A;  2YV5 A;  4JOI A;  1L1O C;  4AQY L;  2JA6 H;  1B8A A;  2R92 G;  2UXC Q;  4OX9 Q;  1N33 L;  3KJO A;  4O2D A;  4A76 A;  3UE0 A;  4JI6 L;  4LF5 Q;  1AE3 A;  4BY7 G;  2VQF Q;  3HKS A;  3D31 A;  3HOU G;  3I4N H;  5IY0 A;  4HJ5 A;  2WFW A;  2E2J H;  2Q2U A;  3ICE A;  5M5Y H;  4H02 A;  1A62 A;  4L5T A;  4DV5 L;  4P75 A;  4BXX H;  1HZ9 A;  3S1Q H;  4JI5 Q;  4JI1 L;  5FJ8 H;  1EYG A;  2L15 A;  4IPH A;  1Q8K A;  5H1S E;  1ASZ A;  5GAG C;  3CCV A;  1K83 H;  2JQO A;  2YU9 H;  1OXS C;  2N49 A;  2LXK A;  3EBE A;  4A3L H;  3J81 j;  2UXC L;  4OX9 L;  1HNZ Q;  2YTX A;  1VQ8 A;  2JK8 A;  2UUC Q;  4LF5 L;  3CC2 A;  4UY8 C;  1KXL A;  5JJK A;  2VQF L;  4A3M H;  3S16 H;  4DV6 Q;  1E3P A;  4QL5 A;  4JBJ A;  1Y1V G;  4GOP B;  2EQS A;  1B7Y B;  4FDB A;  1XTD A;  2I0Q A;  3H3V I;  2OQK A;  5GQO A;  3SGI A;  3Q8D A;  3PIO A;  4JI5 L;  3CMA A;  3CCU A;  3VDY A;  3H15 A;  1IBK Q;  4IFD G;  4DR4 Q;  2F3I A;  3T1Y Q;  1MJE A;  3UDX A;  1IL2 A;  1VQ5 A;  1HNZ L;  4BY7 H;  2K50 A;  3GTP H;  2UUC L;  3L7Z C;  1X56 A;  4A75 A;  4DV6 L;  2VUM H;  1C9O A;  2E2H H;  2I5H A;  3G4S A;  1CUK A;  4JBW A;  2VW9 A;  1FVI A;  4NPS A;  2KEN A;  4GN3 B;  3CCM A;  1PH7 A;  1HNX Q;  4JI7 Q;  3H3V H;  4X66 Q;  1IBK L;  4DR4 L;  2B3G A;  4DK6 C;  3GTM H;  2PI2 E;  3T1Y L;  1KRS A;  1BVS A;  1UE6 A;  1VQF A;  4BA1 I;  1E7Z A;  2GVA A;  2A8V A;  1NY4 A;  1VQH A;  2CKZ B;  3S17 H;  4WJ3 M;  4JI0 Q;  4LUV A;  3ULL A;  1LUZ A;  1X6O A;  1EUJ A;  1CKO A;  3GD7 A;  3GTG H;  1Q46 A;  1Y1V H;  4DK3 C;  5IYB G;  3CD6 A;  1EIF A;  2H5X A;  2NVT H;  3AFP A;  2R7Z G;  1SN8 A;  2PI2 A;  4OWW B;  1NMF A;  2KCM A;  2VZA A;  2K5V A;  4NB3 A;  4PZ6 A;  3I56 A;  2F4V Q;  1V1Q A;  2ALY B;  2A1A A;  3HOZ G;  3F2D A;  4POG A;  2MFI A;  2JA5 G;  3M9B A;  1HNX L;  1WCM G;  3U50 C;  4JI7 L;  1UEB A;  4X66 L;  3PO3 H;  2GN5 A;  4Y52 H;  4B3T Q;  1VCI A;  5DLQ E;  1J6Q A;  1S72 A;  3W5O A;  3ER0 A;  1E1T A;  3PCO B;  4DR6 Q;  3CF5 A;  1I6H H;  1YNX A;  5JJI A;  3KF8 B;  2B63 G;  4JI0 L;  5IYC G;  3GTJ H;  1X9N A;  2OWO A;  4IOC A;  1NE3 A;  4BBS H;  4A3G H;  1I5F A;  5C0X G;  1Q81 C;  2OTJ A;  3BZK A;  3NEM A;  2JJQ A;  2K5N A;  4LUZ A;  4GOP C;  2F4V L;  2EXD A;  4BBR H;  1HR0 Q;  1V43 A;  4GNX A;  1JE5 A;  3W1B A;  5C3E H;  1EQQ A;  1CSP A;  2JEA I;  3TS2 A;  3A74 A;  2Q2I A;  5JEA G;  2JA8 G;  3KF6 A;  2MO0 A;  4A3K H;  4B3T L;  3G48 A;  2JA7 G;  5C4X G;  3UDI A;  3GTQ H;  4JYA Q;  3CCE A;  4DR6 L;  1Q12 A;  3TRZ A;  3M7N A;  1I94 Q;  5M3M H;  2KCT A;  5IYB H;  3M85 A;  1HR0 W;  4LFC Q;  4YCU A;  4DR1 Q;  1WFQ A;  4HJ7 A;  2CCZ A;  2VY3 A;  5ELO A;  1VQM A;  1WJJ A;  4OXP A;  3HOV G;  2NN6 I;  1OTC A;  1WOC A;  1Z9F A;  1VQ4 A;  2BH8 A;  3HOZ H;  4LFB Q;  3FKI H;  2JA5 H;  1VQB A;  3D0F A;  4DV0 Q;  3CCR A;  1M1K C;  2CWP A;  1HR0 L;  1QZG A;  3AEV A;  1UE7 A;  3PSI A;  3S1R H;  4QY7 A;  2OQ0 A;  2R92 H;  3F1Z A;  4KI0 A;  1A8V A;  2HHH Q;  2WAQ G;  4JCV E;  4A3E H;  4EX5 A;  4LFA Q;  1PH6 A;  1VQE A;  4JYA L;  1G6P A;  3T1H Q;  3HOY G;  3HOW G;  1PH2 A;  4A3J G;  4LFC L;  1KAW A;  2WAQ E;  4X65 Q;  5FLM G;  4UPA A;  1XPO A;  4A3C G;  2NVQ H;  3PUZ A;  4OWT B;  4DR1 L;  3ERS X;  2N78 A;  4X62 Q;  4HIK A;  1OXT A;  4HJ9 A;  4L5R C;  1QVC A;  1IBL Q;  4C3J H;  4LNQ A;  3G71 A;  2NVX H;  4LFB L;  2XTI A;  5LMU Q;  4LF7 Q;  4TQU S;  4GNX B;  2Q2T A;  1FJG Q;  4DV0 L;  3A5Z B;  4DR7 Q;  1EQR A;  1DGS A;  3AYH B;  4UP9 A;  3S15 H;  3F2B A;  3KF6 B;  2ZJP A;  3PIP A;  1Y1W H;  2HHH L;  3RZO H;  2MNA A;  3K7U C;  1X3F A;  4KLK A;  4LFA L;  4B3S Q;  5IP9 G;  3T1H L;  2FXQ A;  2PQA A;  1N36 Q;  2IHE A;  4X65 L;  2CWA A;  3NBH B;  4JI8 Q;  2LXJ A;  4X62 L;  3TRE A;  3J81 c;  5K36 G;  2AKW B;  1IBL L;  1AH9 A;  4DV2 Q;  1PH8 A;  1PYB A;  4GLX A;  1JJG A;  4LF7 L;  2ZJR A;  5LMU L;  4A3C H;  2Z6K A;  1H95 A;  1FJG L;  1JT8 A;  4QIW E;  1O7I A;  4WJ4 A;  4DR7 L;  1D7Q A;  4P73 A;  4R4I A;  4MTN A;  3K80 C;  1YIJ A;  3J80 c;  2JEB I;  3ULJ A;  4A3I G;  1OXV A;  1WYD A;  3CW2 C;  4IPD A;  4OO1 G;  4GKK Q;  5M5X H;  1X3E A;  1X65 A;  3UDG A;  2HIX A;  3EN2 A;  1HZC A;  4XIG S;  1HZB A;  2HQL A;  3CPW A;  1M90 C;  1JJ2 A;  4B3S L;  1C0A A;  1N36 L;  1JB7 A;  1IBM Q;  3S2D H;  1KRT A;  1VQC A;  4JI8 L;  3PUW A;  3M4Q A;  4DR3 Q;  1SE8 A;  5IP7 G;  5IYD G;  1SRO A;  4A3F G;  3HOU H;  1GD7 A;  3CME A;  1YZ6 A;  1D8L A;  1L1O A;  4DV2 L;  4A3J H;  1C7Y A;  2IY5 B;  1OXX K;  3FP9 A;  5JJL A;  1N34 Q;  4IFD I;  4DPG A;  4ALP A;  1JMC A;  2AMC B;  2VL6 A;  3PO2 G;  1KIX A;  3I4O A;  5GAD C;  3GDE A;  4DKA C;  4GKK L;  5ELN A;  2PQA B;  1VQ9 A;  1X3G A;  2DGY A;  3PUY A;  2F52 A;  2RF4 A;  3AFQ A;  3ULP A;  3A0J A;  4BY1 G;  1S40 A;  2JE6 I;  3HOX G;  1PHJ A;  3RR5 A;  1IBM L;  4LF8 Q;  1VQ6 A;  4C3I H;  4X64 Q;  2I5L X;  3H0G G;  1TWH H;  1XNR Q;  2Y0S G;  2PMZ E;  4B3R Q;  1E22 A;  4DR3 L;  5AJ3 Q;  1E1O A;  3MEF A;  1XMQ Q;  1QZH A;  3UDF A;  1NJI C;  1XNQ Q;  2UXB Q;  3AQQ A;  2ZTE A;  4R4T A;  2Y0S E;  1N34 L;  1FGU A;  3DLL A;  1Q86 C;  1YIT A;  2JA9 A;  1YJW A;  2I5M X;  1K9M C;  4LF9 Q;  2VQE Q;  3TS0 A;  3PV0 A;  5M3F G;  2IX0 A;  3RLF A;  4C3H H;  4QGU A;  3PF5 A;  4ME3 A;  1X55 A;  4LF8 L;  5IP7 H;  1CSQ A;  2RHS B;  4X64 L;  2AHO B;  3PUV A;  3A5U A;  1XNR L;  4A3B G;  4B3R L;  1L1O B;  5AJ3 L;  1U0L A;  2R93 G;  4B3M Q;  4KHP Q;  1XMQ L;  2UXB L;  1VQP A;  1GO3 E;  1PH3 A;  1XNQ L;  3CCL A;  4PZ8 A;  4K0K Q;  4LWC A;  3PO2 H;  1SMX A;  3I4M G;  3CP0 A;  1GVP A;  1YHA A;  5IT9 c;  4UP7 A;  4Y7N H;  2NZH A;  4GKJ Q;  1IYJ B;  5IWA Q;  2BA1 A;  3TQY A;  4LF9 L;  2VQE L;  4PZ7 A;  4IPC A;  4AYB G;  4JOI C;  2WP8 J;  5C44 G;  4PG3 A;  1L0W A;  4DUY Q;  5GAE C;  1K73 C;  2CQO A;  1I3Q H;  3RLO A;  3I55 A;  5J3B A;  2R6G A;  3FHW A;  5C0X I;  4AYB E;  1QVG A;  3NEN A;  4MNO A;  1N9W A;  1SRU A;  5C4J H;  4A3D G;  2N3S A;  1G29 1;  2MO1 A;  2R7Z H;  1I50 H;  4NXM Q;  1RIP A;  2CFM A;  4B3M L;  4KHP L;  2IT1 A;  5M5W H;  4DUZ Q;  1R9T H;  2JA6 G;  3S1N H;  4IJL A;  4K0K L;  1HZA A;  4JG2 A;  1VQN A;  2VS1 A;  1Q7Y C;  4GLA C;  1P8L A;  5BR8 Q;  1TWG H;  4YWL A;  1WCM H;  2A19 A;  1A63 A;  4GKJ L;  4TVA B;  1V9P A;  5E7N A;  4DV7 Q;  5IWA L;  1HNW Q;  3I4N G;  1KL9 A;  4O0A A;  3GO5 A;  1YI2 A;  2E8G A;  4POF A;  3RN5 A;  2D0O A;  4DUY L;  1YHB A;  1MJC A;  4IJH A;  4DAY B;  2K75 A;  3E9I A;  2B63 H;  3RZD H;  2ES2 A;  5IYC H;  2IHF A;  5FJ8 G;  1Q1B A;  1PH9 A;  1UE1 A;  1Q1E A;  1U5K A;  1MKH A;  4EQ5 A;  4GN5 A;  4P72 A;  4GLV B;  2KHJ A;  5LMN W;  2AWN A;  1YHQ A;  1I94 L;  4XTC S;  2MQH A;  4NXM L;  2ZTC A;  1XPU A;  2B29 A;  3F2C A;  1TXY A;  4DUZ L;  2NVY H;  3STB D;  4NXN Q;  4A3L G;  4JI3 Q;  1QUQ A;  2ZTD A;  3LGJ A;  1EWI A;  2YYZ A;  5BR8 L;  1K8A C;  2Q2H A;  3ZJY C;  4YHH Q;  2UUB Q;  4JBK A;  2VNU D;  3CPF A;  1QVF A;  5HY6 A;  5C44 H;  4DV7 L;  4A3M G;  2JA8 H;  1HNW L;  1L2F A;  3S24 A;  5C4X H;  2ZM6 Q;  2JA7 H;  3CC4 A;  1X54 A;  1YVC A;  2QEX A;  4JC0 A;  3DM3 A;  4JI4 Q;  3K81 C;  4YWK A;  1GKH A;  3CCS A;  4HJA A;  3BU2 A;  1IXR A;  3E0E A;  4A4I A;  1VQD A;  3HOV H;  4AIM A;  1K8G A;  1LYL A;  2YTY A;  3F8T A;  5GRO A;  4NXN L;  3S2H H;  4X6A H;  3CQZ H;  4JI3 L;  4HID A;  1LM0 A;  2OCE A;  2E2I H;  2HIV A;  2BA0 A;  2UUB L;  4YHH L;  1VQO A;  2KHI A;  3S14 H;  2LSS A;  1KD1 C;  1NBW A;  3OYY A;  2VUM G;  3KJP A;  1NMG A;  3UE1 A;  2ZM6 L;  1UE5 A;  3CAM A;  1YJN A;  2EIF A;  3G6E A;  2UU9 Q;  3HOW H;  3HOY H;  1N32 Q;  1S3O A;  2WB1 G;  4YCW A;  5FLM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...