4A3FH

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3fH00
1VQEA 2WAQE 2PNHA 3K80C 4R4TA 3HOXH 4B3TQ 4YY3L 3FHWA 5C3EG 2ALYB 4P72A 2N3SA 3A5UA 2N49A 1HNZL 2WB1G 1M90C 5M3MG 4R4IA 2JE6I 1HZBA 1IBLQ 1OTCA 1L2FA 4HIKA 3J7A5 3BZCA 4A3MG 4JI0Q 4JYAQ 1UE6A 4IPDA 2VQEL 4A3EH 1N36L 2CWPA 4P73A 1I94Q 3SGIA 4RG1A 5FJ8G 4JBWA 1GO3E 3BZKA 1JMCA 4K0KL 2WFWA 2Z6KA 4GOPA 1PVOA 4DUZL 1N34Q 2ATWA 3PF5A 1HR0Q 1A63A 1PYBA 4A76A 1D7QA 5IT9c 4DV3L 1VQKA 1CKNB 1KRTA 1KQSA 2UXDQ 5EAYA 4GKKL 5IWAQ 1OXTA 2DGYA 4LWCA 4B3MQ 1IBMQ 4UP7A 4LF9Q 1KC8C 2NZOA 2RHSB 2K50A 3CCSA 4DV1L 1G51A 5GROA 1CKOA 3IRBA 4LF5L 1LYLA 3RN5A 4A3GG 1SROA 5IYDG 1SLJA 1SMXA 5C0XI 3CC7A 3S1MH 1HNWQ 1X54A 4X65L 4JI3L 4AYBG 3G6EA 2ZJPA 4BA1I 2LXKA 1J5EQ 1XTDA 1PA6A 2V1CC 1TWGH 4YWKA 1BKBA 1HNXQ 4DPGA 3LGJA 4BBSH 4L5QA 1EIFA 5M5WH 3KF6A 3PUWA 4JBMA 2VNUD 2B63H 1X9NA 2KHIA 2HHHL 4JG2A 2MO0A 2NVYH 2GVBA 3AYHB 3L2PA 1OXXK 4LFCL 4XTCS 4DV4Q 3RR5A 1OXVA 4KHPL 1N8RC 4MZ9A 4DUYQ 3CPFA 1HR0W 2R7ZH 3CQZH 4DR5Q 1QUQA 2VL6A 4DR4Q 2GVAA 3UDXA 5LMNQ 4YCWA 1KAWA 1W3SA 5LMUQ 3TQYA 1Q12A 2R92H 3PO2H 4O2DA 4DV0Q 2YTYA 4JBJA 1V43A 4DV7L 3T1HQ 1GM5A 4X66L 4AQYL 2YV5A 4C3IH 1WCMG 2RHQB 3KF8B 2E5LQ 1N32L 1HZCA 3K0XA 1GVPA 1IYJB 2UXCL 4OXPA 3PF4A 3A74A 2JA6H 4YWLA 4APVA 1EQQA 1Y1WG 3I4MH 3S1RH 3PO3H 2IHFA 2FXQA 4A3KG 1Q7YC 2JEAI 4OWTB 2GN5A 4QIWE 5IYCH 4LF7L 1YNXA 4YCUA 1HNZQ 1PYSB 3PV0A 5IP7G 5FLMG 3W1GA 1PH3A 3H3VH 5BR8L 4JI4L 4IFDJ 3HOWH 2EIFA 5M5YH 3HKSA 3FKIH 5LMNW 3H3VI 3CAMA 1P8LA 3E9IA 2VQEQ 1FVIA 4LF6Q 1L1OA 4L5TA 1Y1VG 2ASBA 1X3EA 4BY1G 3CCMA 1X55A 1XMQL 2UUCL 2YU9H 4X6AH 2JA7G 5K36G 1LM0A 1UE1A 1Q82C 4DR3L 4X62Q 1X6OA 1QVCA 3GTJH 3WWVA 3PGZA 3RN2A 1CKNA 1EFWA 4B3SL 3GD7A 3W5OA 1KL9A 2VS1A 3M4PA 4DR7Q 1T9HA 4DV6Q 4BBRH 4A3LH 3CC2A 4B3RL 2Y0SE 4JI8L 2BA0A 4HIOA 1PHJA 3K7UC 4GLXA 4DK6C 1CSQA 1E22A 1VQDA 2EXDA 1HZ9A 1VQPA 1QZHA 4DR6L 2BH8A 3K8AA 3OTOL 4X65Q 1XNQQ 1AE3A 2E2HH 2NVXH 1SE8A 1UWVA 2JQOA 3J81j 2ZTDA 1Q86C 3ULJA 4JCVE 4GNXA 1QZGA 1LTLA 1NE3A 2B29A 1V9PA 2RF4A 3HKZG 3L0OA 5IP9H 1D8LA 5GAEC 1VQHA 4A3CH 2E2JH 2Z6KC 1IXRA 4GOPC 3NBHB 3UE1A 4LUOA 1I5FA 2BA1A 5C0XG 1XJVA 4GKJQ 4OO1G 4JV5Q 1E3PA 4LFCQ 1X56A 2D62A 4IO9A 4KHPQ 2OTJA 4A3FG 4DAMA 2R7FA 2QEXA 3HOYH 1L0WA 1Q8KA 2JEBI 3AFQA 3PSIA 2UU9L 3M85A 3CPWA 2KBNA 2NVQH 1Z9FA 5C44G 3H0GH 2CWAA 4L5SA 4DV7Q 1C0AA 2PQAB 3D31A 3GTPH 1NMGA 3E9HA 2XTIA 2CCZA 4NXNL 4AYBE 3CF5A 4DNIA 2K5HA 4C3HH 1ASZA 3U50C 1N32Q 3ULLA 3CP0A 2R7ZG 2OQ0A 4A3BG 3UE0A 4UP9A 1N9WA 2K5VA 1VQ5A 3GTMH 3I4NG 1CUKA 3RZOH 3ER0A 2DUDA 2R92G 1S40A 4X64Q 4C3JH 2HT1A 1KHIA 2AKWB 4NB3A 1B70B 1SN8A 1PH4A 4A3DH 3U58A 3U4VA 4HIMA 3PUYA 3GTQH 2MFIA 3RLOA 1S72A 2E8GA 3CCRA 4LF7Q 2I5HA 3CCQA 4JI6L 5ELNA 1YHBA 1A62A 4DR1L 2R7DA 3M4OH 4BY7H 4UY8C 3ZJYC 4A93G 1P16A 4R4QA 1JJGA 2UUAL 1WFQA 3NELA 3OYYA 4Y7NH 2F52A 4IFDI 3PO3G 1K83H 2CKZB 3KDFA 4IPHA 4IPCA 3H15A 3I4MG 1JT8A 5C4JH 4JC0A 2I5LX 5FLXc 5IYCG 2UUCQ 1JE5A 4JI1Q 5GAHC 1I6HH 3L7ZC 2Z0SA 4LF8Q 2CFMA 1YIJA 4A3JG 2UXBQ 2PI2A 3HOWG 1O7IA 4HIDA 2K52A 3FKIG 2OTLA 1TWCH 2K75A 1I50H 5AJ3L 4POGA 4DR2Q 1KIXA 2BH2A 4JI2Q 5C3EH 1EQRA 4PG3A 3M9BA 1K0RA 1RL2A 4YHHQ 2D0PA 1E24A 3PUVA 2HQLA 1OXSC 1EUJA 1PH1A 1XNRQ 1VQOA 2HIXA 3OTOQ 3K81C 1MJEA 2QA4A 1UE7A 4RMFA 2LSSA 1A0IA 4A3MH 4P71A 2Q2TA 2F4VL 1L1OC 4UPAA 4A3IH 3I2ZA 2UUBQ 4LFAL 4OX9Q 1PH2A 5FJ8H 5GADC 3F8TA 3HOUH 4BXXG 3S2HH 4JI7L 5M5XH 1U0LA 5GAGC 3HOZG 2R93G 4P74A 3VDYA 3STBC 3AQQA 4HJ8A 1I3QH 4YY3Q 2L15A 2VQFL 4AIMA 1WI5A 5C4XH 4AH6A 3RLNA 3CXCA 4JI0L 4JYAL 3HOVG 4GLAC 1FGUA 3ULPA 2JA8G 3HFZB 1NMFA 1I94L 3OW2A 1EYGA 3M7NA 1NTGA 5IYBH 3GO5A 5IP9G 1CKMA 1PFSA 2VW9A 2I0QA 4JBKA 2ZJQA 5IYDH 4GOPB 4A3CG 1N36Q 2MNAA 3HOXG 4OWWB 1N34L 4PMWA 5JJIA 1VQGA 3DM3A 1XPOA 2AHOB 5JEAG 5E7NA 2OWOA 2AMCB 4P75A 3I7FA 4GNXC 1C9OA 3CCVA 4K0KQ 1B7YB 3GTLH 3S15H 4Y52H 4DUZQ 1QVGA 1K9MC 2ZTCA 3HKZE 5HY6A 3S24A 3HOYG 3ICEA 1YHQA 4B3ML 4DKAC 4DV3Q 5C0XJ 3RNUA 3T1YL 4GKKQ 1C7YA 3S14H 4OWXB 3A5ZB 5DLQE 1UEBA 4O0AA 3TREA 4A3EG 1Q81C 2EQSA 2K14A 1HNWL 4NPSA 1S3OA 4DV1Q 4TVAB 2Q2HA 1FJGL 4LF5Q 1G6PA 2WB1E 3A0JA 4H02A 4QGUA 2E2IH 3GDEA 3S1NH 2MO1A 3KF6B 2AWOA 4JI3Q 4QJFA 1KXLA 4GS3A 3PUZA 4QQBX 1IL2A 2LXJA 4ME3A 2OCEA 2YTVA 4QL5A 1N33L 3S17H 4DV4L 1YHAA 4A3DG 2PI2E 1XPUA 4DUYL 1VQJA 2HHHQ 4PZ7A 2ZM6L 3W1BA 1QUQB 4HJAA 1OXUA 2VUMH 5LMNL 2VZAA 1YBYA 2JK8A 4IFDG 3F2CA 3S2DH 3F1ZA 1Y1WH 4DV0L 3M3YH 3KYHC 4UP8A 4DAYB 4JOIA 1YJWA 2ZTEA 4KLKA 3I4OA 4GN3B 1VQFA 2JA9A 1E7ZA 2IHEA 2MQHA 4POFA 1PH8A 4BBSG 1BBWA 2NN6I 1VS0A 2B63G 1NBWA 5IE8A 2YTXA 4X66Q 2N78A 4AQYQ 1R9TH 1HZAA 4R1JA 1ASYA 4JI5L 3GTGH 4KHZA 2F4VQ 3PIOA 3MXNB 1YJ9A 3PCOB 3E0EA 1J6QA 4LNQA 3G48A 1Y1VH 4LFAQ 3KFUA 3K7AH 1YZ6A 2A8VA 2KENA 1Q1EA 4BY1H 3TS2A 2Y0SG 2IX0A 2UXCQ 3TRZA 4JI7Q 4A4IA 2N8NA 1VQCA 4LUVA 2JA7H 4IJLA 3U4ZA 1M1KC 3PO2G 1K8GA 4L5RC 4MNOA 4FDBA 1K3RA 3G4SA 1AH9A 2VQFQ 4IJHA 4GN4B 4DV2L 2B3GA 4EX5A 3TS0A 1YITA 4LF6L 1L1OB 1E1OA 4A3IG 3EN2A 5BR8Q 1PH5A 4JI4Q 3D0FA 2IT1A 1IZ6A 4YCVA 1X65A 1G291 2YYZA 4PZ8A 3HOUG 2JA6G 2WAQG 2JA5H 1GD7A 4NXML 1VQ8A 2A1AA 3EIVA 1JB7A 4LFBL 1Q1BA 3B6YA 1Y14B 4X62L 1XMQQ 1YVCA 5JJLA 5C4XG 5M3FH 5GQOA 1XMOL 1K73C 4DR7L 3J81i 4DV6L 2PMZE 2K4KA 3PUXA 4QY7A 3CMAA 4DR3Q 1FL0A 5IYBG 4B3SQ 3T1YQ 4DV5L 5IY0A 3J81c 4B3RQ 1PV4A 2HIVA 4JI8Q 4OO1I 4LF4L 2D0OA 1GKHA 4A3FH 1VQLA 1XNQL 1Z47A 1FJGQ 1VCIA 1AE2A 1SR3A 3TEHB 3UDIA 4C2MH 4XIGS 5M3MH 4GNXB 3CMEA 3UDGA 3CW2C 2ZJRA 1QVFA 5C44H 1IBKL 4DR6Q 1KD1C 4MTNA 2F3IA 2KCTA 1KRSA 4GLVB 1X3GA 2I5MX 3UDFA 2R6GA 3G71A 3RLFA 3CC4A 2KCMA 1B8AA 1NY4A 4B3TL 4GKJL 1MIUA 3MEFA 4A3LG 1LUZA 2ID0A 1PH9A 4JV5L 1N33Q 5JEAJ 4BBRG 3J7ZC 1A8VA 3CCJA 3JC66 3STBD 4A3BH 2ZM6Q 3F2DA 1SRUA 2JJQA 3I4NH 1Q46A 1TWFH 2Q2IA 3CCEA 1K8AC 1JJ2A 3JAMi 1IBLL 3GTKH 1TXYA 2RCNA 2CQOA 1VQMA 1PH6A 2OQKA 2UU9Q 4BA2I 4WJ4A 5J3BA 3JAMc 4IOCA 1WOCA 1MKHA 5HGQA 4A3GH 2XGTA 2PQAA 1W2BA 2Q2UA 4IPGA 4A93H 2IY5B 1UE5A 3NEMA 3F2BA 3BJUA 4JI5Q 4KI0A 2VUMG 1WYDA 1HR0L 4NXNQ 4EQ5A 1U5KA 1PH7A 4LW1A 3ERSX 1JJCB 2NVTH 1CSPA 4HJ7A 4X64L 2AWNA 3S1QH 1X3FA 2UXDL 5IWAL 2VY3A 3J80i 3KJOA 1VQAA 2NN6G 1IBML 4LF9L 4TQUS 3H0GG 2A19A 3KOJA 1VQNA 4A3JH 2WP8J 2K5NA 1EWIA 3AFPA 3J80c 1VQ4A 3DLLA 1BVSA 4DV2Q 1EOVA 4IOAA 3FP9A 4DK3C 3S16H 1NJIC 4YWMA 3CCUA 1VQ9A 1RIPA 1TWAH 3BU2A 1YEZA 1J5EL 4JI6Q 4DR1Q 1EIYB 4JOIC 3KDFB 1HJPA 2IX1A 1HNXL 4LUZA 1VQBA 3NENA 2UUAQ 3I55A 4HJ9A 4JI1L 3GTOH 3I56A 1HH2P 1E1TA 2QGQA 4NXMQ 4LF8L 3RZDH 2KHJA 1WCMH 1MJCA 1V1QA 4LFBQ 1VQIA 1TWHH 4R4CA 4A75A 2UXBL 3CD6A 2C35B 1SFOH 3AEVA 3Q8DA 1XMOQ 3PIPA 1YJNA 1XPRA 1DGSA 2NZHA 4DR5L 4BXXH 2ES2A 4DR4L 4DR2L 3EBEA 1VQ6A 4JI2L 4BY7G 3M4QA 5LMUL 4ALPA 4HJ5A 1BBUA 4YHHL 3HOZH 2R93H 4A3KH 4DV5Q 3T1HL 4GN5A 1XNRL 2H5XA 5AJ3Q 2JA5G 4R4OA 5ELOA 4WJ3M 4LF4Q 1VQ7A 3KLWA 1WJJA 3HOVH 4OONA 5IP7H 4J15A 5FLMH 3CCLA 5JJKA 2E5LL 2JA8H 1H95A 5M3FG 1IBKQ 2UUBL 4OX9L 3KJPA 4PZ6A 1YI2A 5H1SE
chains in the Genus database with same CATH superfamily
4R4TA 2PNHA 1JORA 3OOCA 1RF2D 4HTHA 5JEAH 5D65A 1ENFA 1NCVA 3NQTA 2ALYB 4P72A 3A5UA 2XRSD 1HNZL 2NZ1D 1PFMA 2P5ZX 4HCEA 5LHY1 4K8IA 2JE6I 4H13C 2ICEC 2BCOA 3J7A5 4JI0Q 4JYAQ 3S16B 3A8IE 5BN5A 2VQEL 2WKDA 3VYUA 4NP5A 2CQAA 3VA7A 4BWGB 4H7BA 1B1ZA 4K0KL 1SAPA 2WFWA 2EOTA 1A63A 4XDXA 3KBXA 3NPPA 1PYBA 4A76A 3TP7A 3S17B 4FYDA 1HCZA 1F77A 1KC8C 1IL8A 3C3LA 4EGVA 2RHSB 1QNUA 5C0XH 3CCSA 5GROA 1ICWA 3ND9A 1Y1WB 3S2DB 1G6ZA 5G3LF 1SNDA 5CV5A 3GQBA 3CC7A 1HNWQ 1RODA 4JI3L 3RMHA 5JPNC 3DMUA 3G6EA 1J5EQ 4BA1I 1PA6A 3BS1A 3LGJA 3KUPA 1EIFA 2RSOA 3KF6A 3PUWA 4JBMA 2B63H 3JAME 1EZ8A 2PYKA 2MO0A 2NVYH 1GUOA 4LFCL 1EQTA 1OXVA 1N8RC 4HMJA 2K01A 1EU3A 4DR5Q 2VL6A 2FMCA 1W3SA 3TQYA 3U9SA 3NWSA 4IQZA 4IUPA 3T1HQ 1GM5A 4KY7A 3QIAA 3VA5A 1WCMG 4QUCA 2ZXPA 1SJED 3PQIA 1N32L 2BDNA 1XTCD 3K0XA 3P7JA 4G7ZC 2K5DA 4YWLA 1Y1WG 3J80L 2QDBA 3FVQA 5CC4A 2K32A 1PTOB 3HKZB 1E2ZA 2GN5A 1BXTA 2RDHA 1PYSB 4N8X1 1PH3A 5JAVA 3HOWH 4KN7C 5M5YH 1RKNA 1RHPA 1CA6A 3VR4A 1L1OA 4L5TA 5C44B 1TY2A 3ZYYX 2F0TA 1X55A 1XMQL 1LM0A 1PFBA 3EJIA 1Q82C 3AU7A 4G4KA 4DR3L 1C8CA 1QOHA 3NQIA 1DM0B 2O5JC 4FNFA 3W5OA 3M4PA 2R7ZB 4KJOA 4BBRH 3CC2A 4B3RL 1CT1D 2Y0SE 3R2IA 1CZGA 4DK6C 1I4GA 2R92B 1VQPA 4UHVA 2BH8A 3OTOL 3QO2A 1CQFA 1UWVA 2L55A 2ZTDA 1LTLA 4A93B 3HKZG 3HP3A 3L0OA 5IP9H 1LT6D 4CHTB 2G9HD 5GAEC 3CRLC 3K58A 4KD3A 4GOPC 4OO1G 1I5FA 3S1QB 4IO9A 1ZKOA 4WRDA 4OHJA 1JWUD 1ZEQX 4DAMA 4KKSA 1JOKA 2JEBI 3PSIA 3PIO3 3M85A 2KBNA 5C44G 4JPBW 4L5SA 3FKIB 1BCPB 4CDCC 4I7AA 3VYRA 1CFMA 5IT9L 1QNKA 1D2BA 1SMYC 2ZXRA 4NXNL 2AQ3B 2O5IC 1UAPA 4DNIA 2B39A 1ASZA 2R7ZG 5KNBA 4UP9A 2K5VA 5A35A 1F9RA 2RVLA 2DUDA 2R92G 1B9NA 1S40A 4DA2A 4NB3A 1B70B 1SN8A 3GTQH 4HIMA 1BNZA 3MVVA 2I5HA 3H91A 5EBCA 3DXJC 3I90A 2B2VC 2R93B 1YHBA 3M4OH 4BY7H 4ULLA 4UY8C 4A93G 5CR3A 4OELB 1U4LA 5T1GA 1WFQA 3NELA 2F0EA 3J7YW 4IPHA 1H9KA 1SXTA 3QB3A 2I5LX 2UUCQ 1X3QA 2AUKA 4JI1Q 1SNCA 3L7ZC 2Z0SA 2MP1A 2KQ3A 5C5LA 4EQPA 2UXBQ 3IFDA 5A2QL 1STYA 3FKIG 1I50H 2BH2A 1EQRA 3M9BA 1E24A 3PUVA 2JXMB 3GV3A 1SYEA 4CKBA 3OMGA 2C5CA 3AB9A 5IGBA 2F4VL 2D2CC 4XXEA 4A3IH 5KRUA 2UUBQ 4OX9Q 5KNCA 2J4XA 3F8TA 4BXXG 5EPJA 3FPPA 3NSWA 4K5VA 1WTOA 2R93G 4K2LA 1PLFA 3VDYA 3TP5A 3FPUB 4AH6A 4JI0L 4JYAL 1GXDC 3IKJA 1FGUA 3A8KE 1NMFA 1STNA 1EYGA 4JBKA 1CKMA 3S1MB 2A68C 1HRJA 1A3TA 2MNAA 4KD4A 2XWJB 2WACA 3I7FA 3S15H 3GTLH 2IL8A 3LWUA 3ICEA 5HY6A 2DY7A 1YHQA 4DF7A 4HN7A 1JQYD 2XVSA 5C0XJ 4DV3Q 3DEPA 3J7AV 4NW2A 1D5MC 1S5ED 1C7YA 1E2VA 3BZDB 3PMFA 2Y0SB 1IYVA 2EQSA 1HNWL 4NPSA 2E76C 1S3OA 5ELBA 1SNOA 2WB1E 2LFNA 2AWOA 2Z1CA 5JOBA 3SK4A 1N33L 1YHAA 2F0MA 2HHHQ 2ZM6L 1ET6A 3I91A 3T56B 1YBYA 2JK8A 4F7XA 4U673 5C4XB 4JK1C 4DAYB 1STHA 2ZTEA 4POFA 3NE5B 2NN6I 1PZKD 4X66Q 4JI5L 3GTGH 3PIOA 3PCOB 2ENBA 1Y1VH 4LFAQ 3URYA 4CBVA 1YZ6A 2A8VA 4BY1H 2Y0SG 2IX0A 1H9RA 3SK6A 3U4ZA 2EVBA 4L5RC 1GUWA 2JYOA 1K3RA 3G4SA 2VQFQ 4IJHA 4DK1A 3R8BA 4EX5A 1EIHA 1GHKA 1E1OA 1PH5A 4JI4Q 2E2IB 3S1NB 1X65A 2JA5H 1GD7A 1HQMC 1VQ8A 1RCVD 3EIVA 1LTRD 4NMZA 1EWCA 3OIPA 5C4XG 1K73C 2E2JB 3A8JE 3J81i 4ZYSA 3KLSX 1LTBD 4QY7A 4FP5D 1KABA 1GUSA 4B3SQ 3T1YQ 2F0FA 4DV5L 3J81c 1ILQA 1PV4A 4JI8Q 4LF4L 2D0OA 3TBIB 1GKHA 4A3FH 1VQLA 5FK9C 1PDQA 3ITPA 2K33A 1BR9A 3TEHB 3UDIA 4LMQD 4DR6Q 3GTPB 3UDGA 1IBKL 1R9TB 4GLVB 1X3GA 2R6GA 1KDBA 2KCMA 4IN3A 1MIUA 1D5ZC 3MEFA 4CGYB 2EZVA 1PH9A 4A3LG 2CH4A 2KEDA 1EY4A 3Q0AA 3CCJA 5EPLA 5FO8B 3STBD 3TMEA 5JVH3 3SK5A 2L4NA 2RCFA 3F2DA 2JJQA 4KMUC 3I4NH 3CCEA 2Q2IA 2EJFC 1ILPA 4R8NA 1KDCA 2CQOA 1CQVA 1PH6A 1SYBA 2OQKA 3K57A 4WJ4A 1J8IA 1WOCA 4G57A 2L11A 4IPGA 2IY5B 3NEMA 4Z9CB 5LL6S 1HR0L 4EQ5A 1S5BD 4RWSC 4LW1A 3HEJA 1CSPA 3TDQA 1O7ZA 2UXDL 5M3FB 1ENAA 1O80A 4TQUS 3VR3A 1VDZA 3C1FA 1D5XC 4OL7A 4RA8A 4DXGA 1BVSA 1A3UA 3DHQA 1WTVA 2F0LA 5C3EB 2EYJA 2CVRA 4DR1Q 2WB1B 3KDFB 4JOIC 4C2MB 3LWEA 4K5XA 3D4WA 2EYPA 4LUZA 1HNXL 2IX1A 3RUZA 3PIP3 3NENA 3I55A 4JI1L 3RZDH 1VQIA 1SE2A 2UXBL 2C35B 3S2HB 1ICFB 1I6VC 4WJWA 1XMOQ 1YJNA 1XPRA 4DR4L 1TY0A 5CV4A 4IUNA 1E2WA 3M4QA 2EY1A 4HJ5A 4IUQA 3GTKB 2KECA 2L0CA 1LV9A 1PTOC 3HRZC 3P75A 3KLWA 2WINB 3HOVH 2E5LL 3ONAB 5KNDA 5M3FG 2UUBL 4OX9L 4XQNA 3W1BA 1YI2A 2ICIA 4AYBB 3FDTA 4E6IA 4OIJA 4KJNA 1JOOA 3D4RA 1EY0A 4LAAA 1AN8A 3FHWA 3D4DA 5C3EG 5K36H 2N49A 4XYOA 2WB1G 1A2TA 4R4IA 1O7YA 1HZBA 1PXUA 1HQRD 3BZCA 4RKLA 1JWSD 1HTLD 1CTMA 1TWAB 2CWPA 3J81E 2R61A 1G91A 3V05A 5FJ8G 4JBWA 1GO3E 1SYDA 3O13A 4RFBA 4GOPA 1F9SA 1O7LA 4RGNA 5JPMC 3P20A 4DV3L 5CMDA 2HQEA 1SFOB 5EAYA 1DJRD 2F0KA 3LX0A 1DYQA 2DGYA 4LWCA 1IBMQ 2NZOA 1G51A 1CKOA 5KYLA 1LYLA 1X54A 4AYBG 2A69D 2ZJPA 5E1FA 2LXKA 1XTDA 2V1CC 4X3UA 1LABA 4FF2A 1JICA 4DPGA 4BBSH 3SVMA 4F88A 2VNUD 1X9NA 4ZUJA 1BCPC 2HHHL 1G2SA 2FINB 5KEEA 1OXXK 3RR5A 1B3QA 2CW0C 3CPFA 2Q8IB 1RJTA 2X6GA 2JA7B 3CQZH 2B2VA 3JAML 4YCWA 1KAWA 5LMUQ 1B50A 1JB3A 1Q12A 3PO2H 5ELDA 2YTYA 1V43A 4DV7L 1EEFD 2KA7A 4X66L 2YV5A 3OW7A 2ZXOA 2RHQB 2EY6A 3KF8B 4DXFA 3OHXC 2M00A 2MPMA 4OXPA 4V0BA 4L63B 3MXNA 1IYUA 3S1RH 1DONA 2FXQA 1SE4A 2JEAI 1AZQA 4QIWE 4LF7L 1STAA 4K2KA 2XRQD 2DJGC 3N52A 5IP7G 3W1GA 5FLMG 4JI4L 2XN9C 1G2TA 2F0QA 3H3VI 1PFNA 1QE6A 4LF6Q 2EE1A 4CDEC 4ILWA 1SYGA 3FMCA 4CJ0B 4QUFA 4BS9A 1X3EA 3AMUA 1F2YA 3D3RA 5CORA 4X6AH 1HXYD 2JA7G 1UE1A 4X62Q 1QVCA 4B3SL 4M8AA 4DR7Q 2VS1A 4HSVA 4U68A 1T9HA 4DV6Q 1X32A 4JI8L 5CGKA 2IX3A 1CSQA 3G7LA 1E22A 1DOMA 4ZRZA 4DR6L 1DD2A 2CH4W 1Z7TA 1RTOA 4X65Q 1XNQQ 5FOBB 2JQOA 3D8GA 4JCVE 3T51B 1TS3A 1V9PA 4A3CH 2Z6KC 4V190 5C0XG 4XT3B 2BA1A 4PV1C 1X56A 4KHPQ 3NWTA 3SDZA 5NUCA 1LTAD 3EQLC 3HOWB 5M5YB 1VMCA 1LACA 3SK8A 1NMGA 2K05A 2XTIA 3K5LA 3CF5A 5G3LD 4C3HH 3U50C 3ULLA 3CP0A 2SDFA 1BDOA 1EQVA 3UE0A 3KK7A 1WCMB 3RZOH 1TWHB 5FO7B 3LNNA 4X64Q 5FLXE 2HT1A 1PH4A 2AKWB 4A3DH 5L37A 1S72A 3SE0A 4OEMB 5J22A 3HOZB 1A62A 2A6EC 4DR1L 2PCFB 1P16A 4IFDH 4R4QA 1JJGA 1CK1A 5M9OA 1LO5D 2EYOA 4B08A 3Q24A 2VXWA 4Y7NH 2F52A 4K6LA 1NSNS 5F2DA 1ML0D 1CHPD 2F0JA 3D6WA 3WDNA 1D1KA 1MD2D 1GHJA 4WFN3 3HOXB 4X3SA 2O4XA 3HOWG 1Y69U 1DOLA 1TWCH 5CBEE 4POGA 1KIXA 4JI2Q 1H9SB 4PG3A 1RL2A 4FF4A 1S5DD 1XNRQ 4A3EB 3K81C 2QA4A 5KYIA 2LSSA 1A0IA 4P71A 3I2ZA 3EFXD 3T13A 3HOUH 2HDMA 5M5XH 5GAGC 4QCLA 3HOZG 4HJ8A 1I3QH 4YY3Q 2HUGA 2L15A 4FF1A 5C6AA 3RLNA 2QW7A 1JE4A 3ULPA 1F9QA 4KKUA 3D6CA 3OW2A 3M7NA 3M4OB 1NTGA 5IYBH 5IP9G 1MHWC 2ZT9C 3HOXG 3K0YA 1TWGB 4JVZA 2FJ2A 3FEWX 2AHOB 4DNRB 2J0TD 1B7YB 4Y52H 4DUZQ 1QVGA 1TU2B 2ZTCA 3E3XA 5ELEA 2DN8A 2K03A 4GKKQ 3S14H 4OWXB 1STEA 1KLGD 1I50B 1A3VA 4A3EG 1A2UA 4XT1B 1Q81C 2C9OA 4DV1Q 2Q2HA 1FJGL 1G6PA 4L6TB 2E75C 1HTPA 3GDEA 4ZQ3A 4GS3A 4F8MA 4G7HC 1IL2A 1MSGA 3I70A 2OCEA 2YTVA 4QL5A 4A3IB 4H44C 3S17H 4S3SA 2PI2E 1XPUA 5ELFA 1EYDA 2JA6B 2G5DA 1QUQB 3Q6SA 4ZCKA 1YNJD 4CJ2C 3S2DH 1Y1WH 1D6EC 4ABNA 3KYHC 4JOIA 1QILA 4NKLA 1PRTC 3I4OA 4FXDA 2MQHA 2QILA 1NBWA 4IZ8A 5IE8A 4R1JA 4MTKA 2F0NA 1YJ9A 5LL6X 3E0EA 4LNQA 1LLRD 4WORA 2YU9B 3GTLB 2KENA 2UXCQ 4JI7Q 4A4IA 1KDAA 4LUVA 2K04A 1KLUD 2LY7A 3GTJB 1K8GA 2Q8TA 3A7AB 2D5DA 1AH9A 4DV2L 2HCCA 2A74C 1YITA 2V4DA 4LF6L 4A3IG 5BR8Q 1K8MA 5HGTA 1L0XB 1LTID 3D0FA 1IZ6A 1BF4A 4YCVA 1IKLA 1G291 2PW7A 1PMRA 3DM1A 2JA6G 1QCBD 2BE5D 4NXML 5K5PA 1TS4A 4X62L 2PNRC 4J6HA 2EYHA 5GQOA 1PTOH 4DR7L 3BYYB 1ZXTA 4DV6L 2PMZE 2L12A 2K4KA 4OO1H 3I4LA 2HIVA 1XNQL 3H0GB 1VCIA 1AE2A 1SR3A 5M3MH 3U58A 4GNXB 3NP8A 4XIGS 2ZJRA 5C44H 1KD1C 4MTNA 1SNPA 1FYCA 3RLFA 2FMMA 1B8AA 3GP7A 2OEOA 1LUZA 1NR4A 1ZYRD 2M2LA 5JEAJ 1WVLA 3J7ZC 4HMIA 3GTMB 2FFKB 4XYQA 1EY7A 1OO9B 4C3JB 4B9XA 2F0GA 1Q46A 1JJ2A 3MWYW 3X3NA 1VQMA 2UU9Q 1XWEA 2PW5A 5EKLA 5J3BA 5HGQA 1MKHA 4ZKCB 4A3GH 2I46A 2XGTA 2XIWA 4A93H 2JA5B 5ISRA 1R4QB 3BJUA 3CHBD 1K83B 1SEBD 1EEID 2LMCB 4K6DA 1UNSA 1JJCB 2OT2A 3C1EA 5KIXA 2NVTH 4X64L 3S1QH 1GUTA 3C2PA 1I6HB 1FNUA 5ELCA 4DGZA 1ESFA 3J7AF 3H0GG 1VQNA 1PYWD 3K6OA 1VQ4A 3DLLA 3FP9A 2JN4A 1VQ9A 3CCUA 3FRPB 1RIPA 2KCCA 3BU2A 3DWPA 4FXKC 1J5EL 4KKTA 4JI6Q 1YNND 2G9DA 3X3MA 1GOZA 1X3PA 2UUAQ 1MBYA 4A3MB 4HJ9A 2XWBB 3GTOH 3I56A 2L5TA 2R3ZA 4C3JG 2KHJA 4LFBQ 4R4CA 4A75A 3MFGA 3Q8DA 4RHRA 2NZHA 4HEDA 4DR5L 4BXXH 2ES2A 4JI2L 2F0OA 2R93H 4A3KH 3T1HL 4EQNA 1AZPA 1XNRL 2H5XA 2JA5G 4KY6A 5EKKA 1VQ7A 1WJJA 4J15A 4DK0A 2LS01 1MSHA 3KJPA 3TZUA 3T4AC 1TVXA 2WAQE 1PTOF 3K80C 4B3TQ 1CHQD 4YY3L 2IPKD 1WD1A 2M9VA 2N3SA 2AQ2B 1IBLQ 4OGQC 1L2FA 4A3MG 1UE6A 3G6JB 1LTSD 4P73A 1I94Q 5I2XA 3I3CA 2B2TA 4RG1A 4B9WA 3RD4A 1JMCA 1STGA 2Z6KA 3TP8A 1HUNA 4DUZL 3PF5A 3RZDB 5IGFA 3J81L 1KQSA 1UUPA 4GKKL 5IWAQ 1OXTA 4DN4M 2B8GA 4B3MQ 4QF4A 4UP7A 4LF9Q 4DV1L 3E0JA 3IRBA 3RN5A 1SROA 5IYDG 1QWYA 1SLJA 1SMXA 5C0XI 3S1MH 1LT3D 2WV6D 3NXWA 4L5QA 5M5WH 1SE3A 4JG2A 5CV8A 3AYHB 3L2PA 1EL0A 5I9OA 1IKMA 1HR0W 3OPOA 5D14A 3UDXA 1BCPF 1K28A 4DAYA 4C3IH 3M7GA 4Q0FA 1V1PB 1K8OA 1WTPA 1HFGA 3BDOA 1HZCA 3H94A 1IYJB 2UXCL 2Q8RE 3PF4A 4X3TA 4XQJA 1WD0A 3PO3H 1EQQA 4O42A 3I4MH 1U4MA 4OWTB 1V1OA 5IYCH 2JP1A 2MHVA 1YNXA 4YCUA 1HNZQ 2RDGA 2SNSA 3PV0A 1JWMD 5BR8L 2EIFA 3IL8A 2XNAC 3HKSA 5LMNW 3QR8A 3CAMA 1P8LA 3E9IA 2VQEQ 2NTSA 3BYTB 1TS5A 2ASBA 2K6AA 2UUCL 5K36G 2NWGA 3SR1A 1X6OA 4L8JA 1R4PB 3V96A 4PMBA 1EFWA 3GD7A 4A3LH 4A3BB 1GUGA 3CQZB 2F3VA 4PQXA 3K7UC 4GLXA 1TWFB 3OMCA 2A6HD 1QZHA 3K8AA 1VMPA 1V8QA 1T5XD 2E2HH 1SE8A 4KK7A 1IW7D 2NVXH 1QZGA 1NE3A 4F87A 1NR2A 3T16A 1D8LA 1VF5C 2E2JH 1XJVA 5EJWA 3NBHB 3UE1A 4DU9A 4JV5Q 1HFNA 4LFCQ 3DWQA 3EVQA 3IAYA 1EIGA 1NUCA 3HOYH 1Q8KA 4HSPA 5C3XA 2PZUA 2UU9L 3CPWA 4A3JB 2NVQH 4IALA 3I8ZA 1LTTD 2CWAA 1C0AA 2PQAB 3D31A 3GTPH 2PZWA 1CA5A 2L1BA 1KNEA 5CV9A 2CCZA 4RCOA 1I4QA 1H9MA 1N32Q 2K5HA 1DCZA 2OQ0A 4A3BG 1EWHA 1N9WA 3A56A 1VQ5A 1KHIA 1F2ZA 3U4VA 3PUYA 3RLOA 4QB4A 2PQEA 3WOFA 2J7ZA 4JI6L 2R7DA 3ZJYC 1ENCA 3BVMA 5FLXL 2UUAL 3OYYA 3I73A 1SSOA 3H3VC 2BDOA 2CKZB 3KDFA 2JA8B 1B44D 4IPCA 5C4JH 4NDXA 1Y8NB 5FLXc 3NTHA 2EXZA 2CFMA 1YIJA 4A3JG 2WKCA 1C48A 1CI3M 4MN3A 2K52A 1CM9A 2OTLA 5C4ZA 1F2LA 5C3EH 1K0RA 1S5CD 4YHHQ 2D0PA 1EY6A 1OXSC 1PH1A 3TZDA 2HIXA 3OTOQ 4DAVA 1MJEA 1QG7A 1FD7D 2Q2TA 5T1IA 4UPAA 3VR5A 3M4YA 4LFAL 1PH2A 3EA6A 5FJ8H 5BN3A 4RGTA 3S2HH 5I6WA 1U0LA 2RA4A 3NBHA 4IURA 3STBC 2IWHA 2VQFL 4A3DB 4AIMA 1WI5A 4DNTB 2A5HA 1C4QA 3NK9A 3WOEA 2JA8G 3HFZB 3CU7A 1I94L 1GUNA 2H1EA 2RDFA 3GO5A 3Q23A 2KCNA 4A3CG 1N36Q 1E0BA 4PMWA 5JJIA 3DM3A 3KBGA 2Z4IA 5E4WC 5E7NA 5JEAG 2OWOA 1W6JA 4GNXC 1C9OA 2B63B 3R3OA 1K9MC 3HKZE 2NVYB 4B3ML 2DNEA 2E2DC 3L3OC 3R93A 1DZ1A 1S4ZA 3A55A 3RNUA 3T1YL 3ERQA 1SNQA 1UEBA 1VF7A 4O0AA 3TREA 1DXMA 1ESRA 4TVAB 4LF5Q 4UAIA 3A54A 2NTTA 5FKAC 2MO1A 2QDLA 3KF6B 2L9HA 3IFTA 2X6LA 3PUZA 3VR2A 2LXJA 4ME3A 4CKCA 2B2WC 2B2TC 4A3DG 3NTKA 3HOUB 1VQJA 5M5XB 2EJMA 2VUMH 4IFDG 3F2CA 3F1ZA 1KTKA 3N6RA 3M3YH 4UP8A 2NN6H 4FVMA 1YJWA 4RAUC 2IJ0A 3MFYA 4GN3B 1VQFA 1Y8PB 1E7ZA 2JA9A 5E3FA 1PH8A 1BBWA 3OSOA 2B63G 1SMYD 2F0UA 1A15A 2N78A 4AQYQ 2OF1A 2B2YA 2F4VQ 3KF8A 4X3KA 2F0DA 3K7AH 1PRTF 1Q1EA 3TS2A 3TRZA 2GA4B 5CBAE 2JA7H 2O2LD 1M1KC 2AQ1B 3NBIA 4FDBA 3S14B 1F9PA 4TKOB 4BBRB 1LT4D 2N88A 3TS0A 1L1OB 5IIFA 3EN2A 4IUVA 1LT5D 3HOUG 2YYZA 4PZ8A 5FO9B 1JB7A 1FNWA 2HDLA 3B6YA 1Y14B 1YVCA 1XMOL 1GJXA 3PUXA 3CMAA 1G8ZD 2F0HA 1FL0A 5IYBG 5IY0A 1QJOA 1EY9A 4K5WA 4YIJA 1Z47A 4I7ZC 3CMEA 1FR3A 2A69C 3CW2C 1DOKA 2KCTA 2I5MX 2E74C 3MTSA 1NY4A 2ID0A 4JV5L 3C46A 1N33Q 4BBRG 4KN4C 2I07B 2SNMA 1TS2A 3HGBA 2ZM6Q 1U4RA 1WTHA 1K8AC 4QIWB 3GTQB 3HS0C 1BUVT 4BA2I 4N8FA 3TSSA 2A68D 1QB5D 2AUJD 2TSSA 2H4OA 4BY7B 4IOCA 1W2BA 2EPBA 4JI5Q 1WYDA 1PH7A 3ERSX 4TSSA 1AFPA 1X3FA 2F4IA 2VY3A 3J80i 3KJOA 1IBML 3QOJA 3K59A 3SXHA 2Z4HA 3KOJA 3J80c 3AFPA 3KLSA 5KGUA 4IUUA 3S16H 4YWMA 5J1ZA 3K5NA 1EIYB 5M3MB 1HJPA 2RQXA 3S9WA 1M8AA 3NTIA 4J8QA 1RD9D 2F3WA 1KNAA 1BQQT 2DNCA 2QGQA 2K5WA 3K5OA 1WCMH 1AP0A 3L9AX 4RGOS 1TWHH 3CD6A 3UI2A 3AEVA 1DGSA 5J39A 3EBEA 1VQ6A 4BY7G 5LMUL 4ALPA 5I6YA 1XYIA 4PNYA 3ND8A 1BBUA 4YHHL 3HOZH 4DV5Q 4RGMA 5AJ3Q 4WJ3M 4LF4Q 5EKIA 1H9SA 2X69A 4OONA 5JJKA 4A3GB 1H95A 5DNFA 4EQOA 1IBKQ 4PZ6A 2JSOA 4HR7B 1VQEA 2EDGA 2EYLA 3HOXH 2NVTB 3S15B 1J9OA 2KOLA 1K3BC 4LJZC 1M90C 2F0PA 5M3MG 4MIUA 2PZTA 3KLRA 1B2TA 3K5MA 1UEAB 5DAUA 2Z9HA 4HIKA 1OTCA 1W6KA 4P2CB 1FGBD 4IPDA 4A3EH 1N36L 5TSSA 3MXPA 3SGIA 3E5SA 1B9MA 5DM73 3BZKA 1EYAA 1PVOA 1N34Q 2F0VA 3GTOB 1WTWA 2ATWA 1MGSA 1HR0Q 1D7QA 3DEOA 5IT9c 1VQKA 1CKNB 1KRTA 4CDFC 2UXDQ 1Q3LA 2K50A 5IOCA 4LF5L 5D3DA 3MHBA 2DY8A 4A3KB 4A3GG 4LK1C 3HG9A 4ZK9B 3DWAA 4X65L 4CKEA 3CKIB 4N9PA 5DEHA 1TWGH 4YWKA 1BKBA 1Y8OB 5C3WA 1HNXQ 2XSCA 1SJHD 1HUMA 3GTGB 2KHIA 3QJYA 2GVBA 1Y1VB 4DV4Q 4XTCS 4BY1B 4KHPL 4MZ9A 4DUYQ 3QG1A 1XXGA 2R7ZH 3SHLA 1QUQA 1XX8A 4DR4Q 2GVAA 5LMNQ 5CV6A 5JVG3 2R92H 1STBA 4O2DA 4DV0Q 4JBJA 4K8JA 5EPKA 4FO2A 4AQYL 2NBFA 3J80E 2KUMA 3MXGA 3E6ZX 2E5LQ 1TKWB 1ET9A 1A6XA 1GVPA 3A74A 3OIQA 2JA6H 4APVA 2EY5A 2IHFA 4OIKA 3W2DA 4A3KG 1Q7YC 2EYFA 1HA6A 2NUCA 3OWEB 3OWFA 1CZWA 4RCNA 3H3VH 4RKBA 3NUCA 4IFDJ 1KAAA 3DUZA 1ONLA 5CYUA 3FKIH 2HCIA 1LTGD 1U4PA 4A3FB 1FVIA 1Y1VG 2EYMA 2HD3A 1I4HA 1O78A 1RTNA 1AEXA 4BY1G 5M5WB 3CCMA 2YU9H 1WTRA 2B2YC 3Q22A 5C5MA 5E4XA 3W3AA 4KV6A 3GTJH 3WWVA 1SYFA 3PGZA 4C1NI 3RN2A 1CKNA 1KL9A 1BBXC 4HIOA 2BA0A 1PHJA 3I4NB 1PTOD 1VQDA 2EXDA 1HZ9A 1M4VA 1AE3A 4C3IB 3J81j 1Q86C 3ULJA 4GNXA 3MA2B 2B29A 2RF4A 2K1BA 2QEJC 2B2UA 1VQHA 1IXRA 4GKJQ 4LUOA 2NB0A 3PO3B 4CJ1B 3I4MB 1E3PA 2D62A 2OTJA 4A3FG 1YNJC 2R7FA 2QEXA 5IT9E 1L0WA 2QCPX 3AFQA 4ID6A 1Z9FA 3H0GH 4EVOA 5COYA 4DV7Q 2F1MA 1D1IA 3E9HA 3QOLA 2B2WA 4AYBE 4CDDC 2QF7A 2DJFC 3GTMH 3I4NG 1CUKA 3H09A 3ER0A 1PZID 4C3JH 4ZLTF 5I2YA 3SEBA 2PMZB 2BOSA 2MFIA 5D3IB 2E8GA 5BN4A 3CCRA 4LF7Q 4C3IG 4ODGA 3CCQA 5ELNA 1RDPD 4I65A 2CHBD 1IHZA 5EGTA 2E2HB 3HOVB 2NVXB 4IFDI 3PO3G 1K83H 5A2QE 3I4MG 3H15A 1BCPD 1F2MA 2MJ8A 3NHHA 2BE5C 2D9UA 4JC0A 2K5QA 1JT8A 1EFID 5IYCG 3F2UA 1JE5A 5GAHC 1I6HH 3P1HA 4LF8Q 2CW0D 2WIIB 4KTAA 2PI2A 1O7IA 4HIDA 1BOSA 5EBDA 1NNXA 1S5FD 2K75A 5IODA 5AJ3L 3HOYB 4DR2Q 2NVQB 5JJZA 1JCKB 2HQLA 1EUJA 1VQOA 1UE7A 4RMFA 4A3MH 1B53A 2B8FA 1EZ6A 1L1OC 5I9PA 1U9RA 5GADC 4JI7L 1ZYRC 2TMPA 3HZXA 1SNMA 4P74A 3AQQA 2LKVA 1NAPA 5C4XH 2QKIC 3H6MA 3CXCA 3HOVG 4GLAC 4RH6A 1HPCA 1WTQA 2I0QA 1PFSA 2VW9A 2ZJQA 2F0IA 5IYDH 4GOPB 3QWNA 4OWWB 1N34L 1VQGA 1XPOA 4BBSB 3V2TA 2AMCB 4P75A 5C4JB 4K0KQ 3CCVA 3HOYG 4J1MA 3S24A 1JC7A 4DKAC 1PRTB 3VR6A 4M1UB 4N9TA 4H0LC 3A5ZB 5DLQE 2N55A 4C56C 2K14A 3A7LA 3PO2B 4RHSA 3BG3A 3R2TA 3A0JA 4H02A 4QGUA 2E2IH 3S1NH 2FHTA 1YNNC 4JI3Q 4QJFA 1KXLA 3GV6A 1I4XA 4C1NK 5IGCA 4QQBX 3BDLA 2RBMA 2SOBA 4ME5A 4DV4L 1BO0A 2EY2A 4K14A 4DUYL 2WAQB 4PZ7A 4HJAA 1OXUA 4UDUC 3S1RB 2K28A 4HCSA 5LMNL 2VZAA 1H9JA 3TP6A 4DV0L 2VB2X 1JOQA 4KLKA 4BBSG 2IHEA 3BVZA 2KVMA 1VS0A 2YTXA 1R9TH 1HZAA 1ASYA 4KHZA 2RSNA 3MXNB 1V1PA 4IUTA 4KY5A 5AFWA 1J6QA 3G48A 3KFUA 1K0SA 4QMGA 4ZKBB 5C4HA 1B3AA 5IGDA 2N8NA 1VQCA 1I4PA 1Z6HA 4IJLA 3PO2G 2MUYA 1L0YB 5I4DA 4MNOA 4GN4B 2NYZD 2B3GA 2A6ED 4TRDA 1EU4A 2IT1A 4HAEA 2F0SA 4R9WA 1FNVA 2WAQG 1HHVA 2A1AA 2K7VA 4LFBL 1Q1BA 1T5EA 1XMQQ 5JJLA 3VYTA 5M3FH 3U9OA 1SBBB 2KEEA 2VUMB 4DR3Q 3MAQA 1II3A 1HA5A 4B3RQ 3M3YB 2SEBD 4OO1I 1EOTA 4DAPA 1FJGQ 2OXPA 3MZ5A 4C2MH 1QVFA 4ZAIA 2F03A 4O1NA 1TT2A 4GZYC 4XQQA 5EQ0A 2F3IA 1KRSA 2IW3A 3UDFA 1SDFA 3G71A 3CC4A 4GKJL 1Q90A 4B3TL 4C3HB 3K7AB 2Z8LA 4PMCA 1A8VA 2Z6BA 3JC66 3TN2A 3RZOB 4A3BH 1TIID 1SRUA 1JR0D 1TWFH 2VB3X 2EJGC 3JAMi 1IBLL 3GTKH 1TXYA 2RCNA 2F0WA 4MHEA 2RKSA 3JAMc 2KJXA 3CRKC 2PQAA 3BVGA 2Q2UA 1UE5A 3F2BA 1PZJD 4Y7NB 4KI0A 2VUMG 2PO4A 4NXNQ 1U5KA 2A73B 4HJ7A 2AWNA 1Q8IA 5IWAL 5HURA 3T53B 2B2UC 4FXGC 1VQAA 2NN6G 4LF9L 2A19A 4A3JH 1TWCB 2K5NA 1EWIA 2WP8J 4DV2Q 1EOVA 4IOAA 1I4RA 4DK3C 1NJIC 5DM63 1TWAH 2PPBC 1YEZA 4C3HG 1EYCA 3BDCA 4DFAA 1VQBA 1MI2A 1AW7A 3MC0B 3VYSA 2KHSA 4JW0A 1HH2P 1E1TA 4NXMQ 4LF8L 5CV7A 1MJCA 1V1QA 3I72A 4Q5VA 4KHVA 3MXUA 1SFOH 1WTXA 5IGEA 3PIPA 3MEHA 1EY8A 4DR2L 1I3QB 4R8IA 2MGSA 1TQOA 4GN5A 1PRTD 4FF3A 1SYCA 4R4OA 5ELOA 1B4OA 4ZUIA 2A6HC 3EROA 5IP7H 5FLMH 3CCLA 4G7OC 1TR5A 2JA8H 1EY5A 1IW7C 5IGGA 5H1SE
chains in the Genus database with same CATH topology
1VQEA 2WAQE 2PNHA 3K80C 4R4TA 3HOXH 4B3TQ 4YY3L 3FHWA 5C3EG 2ALYB 4P72A 2N3SA 3A5UA 2N49A 1HNZL 2WB1G 1M90C 5M3MG 4R4IA 2JE6I 1HZBA 1IBLQ 1OTCA 1L2FA 4HIKA 3J7A5 3BZCA 4A3MG 4JI0Q 4JYAQ 1UE6A 4IPDA 2VQEL 4A3EH 1N36L 2CWPA 4P73A 1I94Q 3SGIA 4RG1A 5FJ8G 4JBWA 1GO3E 3BZKA 1JMCA 4K0KL 2WFWA 2Z6KA 4GOPA 1PVOA 4DUZL 1N34Q 2ATWA 3PF5A 1HR0Q 1A63A 1PYBA 4A76A 1D7QA 5IT9c 4DV3L 1VQKA 1CKNB 1KRTA 1KQSA 2UXDQ 5EAYA 4GKKL 5IWAQ 1OXTA 2DGYA 4LWCA 4B3MQ 1IBMQ 4UP7A 4LF9Q 1KC8C 2NZOA 2RHSB 2K50A 3CCSA 4DV1L 1G51A 5GROA 1CKOA 3IRBA 4LF5L 1LYLA 3RN5A 4A3GG 1SROA 5IYDG 1SLJA 1SMXA 5C0XI 3CC7A 3S1MH 1HNWQ 1X54A 4X65L 4JI3L 4AYBG 3G6EA 2ZJPA 4BA1I 2LXKA 1J5EQ 1XTDA 1PA6A 2V1CC 1TWGH 4YWKA 1BKBA 1HNXQ 4DPGA 3LGJA 4BBSH 4L5QA 1EIFA 5M5WH 3KF6A 3PUWA 4JBMA 2VNUD 2B63H 1X9NA 2KHIA 2HHHL 4JG2A 2MO0A 2NVYH 2GVBA 3AYHB 3L2PA 1OXXK 4LFCL 4XTCS 4DV4Q 3RR5A 1OXVA 4KHPL 1N8RC 4MZ9A 4DUYQ 3CPFA 1HR0W 2R7ZH 3CQZH 4DR5Q 1QUQA 2VL6A 4DR4Q 2GVAA 3UDXA 5LMNQ 4YCWA 1KAWA 1W3SA 5LMUQ 3TQYA 1Q12A 2R92H 3PO2H 4O2DA 4DV0Q 2YTYA 4JBJA 1V43A 4DV7L 3T1HQ 1GM5A 4X66L 4AQYL 2YV5A 4C3IH 1WCMG 2RHQB 3KF8B 2E5LQ 1N32L 1HZCA 3K0XA 1GVPA 1IYJB 2UXCL 4OXPA 3PF4A 3A74A 2JA6H 4YWLA 4APVA 1EQQA 1Y1WG 3I4MH 3S1RH 3PO3H 2IHFA 2FXQA 4A3KG 1Q7YC 2JEAI 4OWTB 2GN5A 4QIWE 5IYCH 4LF7L 1YNXA 4YCUA 1HNZQ 1PYSB 3PV0A 5IP7G 5FLMG 3W1GA 1PH3A 3H3VH 5BR8L 4JI4L 4IFDJ 3HOWH 2EIFA 5M5YH 3HKSA 3FKIH 5LMNW 3H3VI 3CAMA 1P8LA 3E9IA 2VQEQ 1FVIA 4LF6Q 1L1OA 4L5TA 1Y1VG 2ASBA 1X3EA 4BY1G 3CCMA 1X55A 1XMQL 2UUCL 2YU9H 4X6AH 2JA7G 5K36G 1LM0A 1UE1A 1Q82C 4DR3L 4X62Q 1X6OA 1QVCA 3GTJH 3WWVA 3PGZA 3RN2A 1CKNA 1EFWA 4B3SL 3GD7A 3W5OA 1KL9A 2VS1A 3M4PA 4DR7Q 1T9HA 4DV6Q 4BBRH 4A3LH 3CC2A 4B3RL 2Y0SE 4JI8L 2BA0A 4HIOA 1PHJA 3K7UC 4GLXA 4DK6C 1CSQA 1E22A 1VQDA 2EXDA 1HZ9A 1VQPA 1QZHA 4DR6L 2BH8A 3K8AA 3OTOL 4X65Q 1XNQQ 1AE3A 2E2HH 2NVXH 1SE8A 1UWVA 2JQOA 3J81j 2ZTDA 1Q86C 3ULJA 4JCVE 4GNXA 1QZGA 1LTLA 1NE3A 2B29A 1V9PA 2RF4A 3HKZG 3L0OA 5IP9H 1D8LA 5GAEC 1VQHA 4A3CH 2E2JH 2Z6KC 1IXRA 4GOPC 3NBHB 3UE1A 4LUOA 1I5FA 2BA1A 5C0XG 1XJVA 4GKJQ 4OO1G 4JV5Q 1E3PA 4LFCQ 1X56A 2D62A 4IO9A 4KHPQ 2OTJA 4A3FG 4DAMA 2R7FA 2QEXA 3HOYH 1L0WA 1Q8KA 2JEBI 3AFQA 3PSIA 2UU9L 3M85A 3CPWA 2KBNA 2NVQH 1Z9FA 5C44G 3H0GH 2CWAA 4L5SA 4DV7Q 1C0AA 2PQAB 3D31A 3GTPH 1NMGA 3E9HA 2XTIA 2CCZA 4NXNL 4AYBE 3CF5A 4DNIA 2K5HA 4C3HH 1ASZA 3U50C 1N32Q 3ULLA 3CP0A 2R7ZG 2OQ0A 4A3BG 3UE0A 4UP9A 1N9WA 2K5VA 1VQ5A 3GTMH 3I4NG 1CUKA 3RZOH 3ER0A 2DUDA 2R92G 1S40A 4X64Q 4C3JH 2HT1A 1KHIA 2AKWB 4NB3A 1B70B 1SN8A 1PH4A 4A3DH 3U58A 3U4VA 4HIMA 3PUYA 3GTQH 2MFIA 3RLOA 1S72A 2E8GA 3CCRA 4LF7Q 2I5HA 3CCQA 4JI6L 5ELNA 1YHBA 1A62A 4DR1L 2R7DA 3M4OH 4BY7H 4UY8C 3ZJYC 4A93G 1P16A 4R4QA 1JJGA 2UUAL 1WFQA 3NELA 3OYYA 4Y7NH 2F52A 4IFDI 3PO3G 1K83H 2CKZB 3KDFA 4IPHA 4IPCA 3H15A 3I4MG 1JT8A 5C4JH 4JC0A 2I5LX 5FLXc 5IYCG 2UUCQ 1JE5A 4JI1Q 5GAHC 1I6HH 3L7ZC 2Z0SA 4LF8Q 2CFMA 1YIJA 4A3JG 2UXBQ 2PI2A 3HOWG 1O7IA 4HIDA 2K52A 3FKIG 2OTLA 1TWCH 2K75A 1I50H 5AJ3L 4POGA 4DR2Q 1KIXA 2BH2A 4JI2Q 5C3EH 1EQRA 4PG3A 3M9BA 1K0RA 1RL2A 4YHHQ 2D0PA 1E24A 3PUVA 2HQLA 1OXSC 1EUJA 1PH1A 1XNRQ 1VQOA 2HIXA 3OTOQ 3K81C 1MJEA 2QA4A 1UE7A 4RMFA 2LSSA 1A0IA 4A3MH 4P71A 2Q2TA 2F4VL 1L1OC 4UPAA 4A3IH 3I2ZA 2UUBQ 4LFAL 4OX9Q 1PH2A 5FJ8H 5GADC 3F8TA 3HOUH 4BXXG 3S2HH 4JI7L 5M5XH 1U0LA 5GAGC 3HOZG 2R93G 4P74A 3VDYA 3STBC 3AQQA 4HJ8A 1I3QH 4YY3Q 2L15A 2VQFL 4AIMA 1WI5A 5C4XH 4AH6A 3RLNA 3CXCA 4JI0L 4JYAL 3HOVG 4GLAC 1FGUA 3ULPA 2JA8G 3HFZB 1NMFA 1I94L 3OW2A 1EYGA 3M7NA 1NTGA 5IYBH 3GO5A 5IP9G 1CKMA 1PFSA 2VW9A 2I0QA 4JBKA 2ZJQA 5IYDH 4GOPB 4A3CG 1N36Q 2MNAA 3HOXG 4OWWB 1N34L 4PMWA 5JJIA 1VQGA 3DM3A 1XPOA 2AHOB 5JEAG 5E7NA 2OWOA 2AMCB 4P75A 3I7FA 4GNXC 1C9OA 3CCVA 4K0KQ 1B7YB 3GTLH 3S15H 4Y52H 4DUZQ 1QVGA 1K9MC 2ZTCA 3HKZE 5HY6A 3S24A 3HOYG 3ICEA 1YHQA 4B3ML 4DKAC 4DV3Q 5C0XJ 3RNUA 3T1YL 4GKKQ 1C7YA 3S14H 4OWXB 3A5ZB 5DLQE 1UEBA 4O0AA 3TREA 4A3EG 1Q81C 2EQSA 2K14A 1HNWL 4NPSA 1S3OA 4DV1Q 4TVAB 2Q2HA 1FJGL 4LF5Q 1G6PA 2WB1E 3A0JA 4H02A 4QGUA 2E2IH 3GDEA 3S1NH 2MO1A 3KF6B 2AWOA 4JI3Q 4QJFA 1KXLA 4GS3A 3PUZA 4QQBX 1IL2A 2LXJA 4ME3A 2OCEA 2YTVA 4QL5A 1N33L 3S17H 4DV4L 1YHAA 4A3DG 2PI2E 1XPUA 4DUYL 1VQJA 2HHHQ 4PZ7A 2ZM6L 3W1BA 1QUQB 4HJAA 1OXUA 2VUMH 5LMNL 2VZAA 1YBYA 2JK8A 4IFDG 3F2CA 3S2DH 3F1ZA 1Y1WH 4DV0L 3M3YH 3KYHC 4UP8A 4DAYB 4JOIA 1YJWA 2ZTEA 4KLKA 3I4OA 4GN3B 1VQFA 2JA9A 1E7ZA 2IHEA 2MQHA 4POFA 1PH8A 4BBSG 1BBWA 2NN6I 1VS0A 2B63G 1NBWA 5IE8A 2YTXA 4X66Q 2N78A 4AQYQ 1R9TH 1HZAA 4R1JA 1ASYA 4JI5L 3GTGH 4KHZA 2F4VQ 3PIOA 3MXNB 1YJ9A 3PCOB 3E0EA 1J6QA 4LNQA 3G48A 1Y1VH 4LFAQ 3KFUA 3K7AH 1YZ6A 2A8VA 2KENA 1Q1EA 4BY1H 3TS2A 2Y0SG 2IX0A 2UXCQ 3TRZA 4JI7Q 4A4IA 2N8NA 1VQCA 4LUVA 2JA7H 4IJLA 3U4ZA 1M1KC 3PO2G 1K8GA 4L5RC 4MNOA 4FDBA 1K3RA 3G4SA 1AH9A 2VQFQ 4IJHA 4GN4B 4DV2L 2B3GA 4EX5A 3TS0A 1YITA 4LF6L 1L1OB 1E1OA 4A3IG 3EN2A 5BR8Q 1PH5A 4JI4Q 3D0FA 2IT1A 1IZ6A 4YCVA 1X65A 1G291 2YYZA 4PZ8A 3HOUG 2JA6G 2WAQG 2JA5H 1GD7A 4NXML 1VQ8A 2A1AA 3EIVA 1JB7A 4LFBL 1Q1BA 3B6YA 1Y14B 4X62L 1XMQQ 1YVCA 5JJLA 5C4XG 5M3FH 5GQOA 1XMOL 1K73C 4DR7L 3J81i 4DV6L 2PMZE 2K4KA 3PUXA 4QY7A 3CMAA 4DR3Q 1FL0A 5IYBG 4B3SQ 3T1YQ 4DV5L 5IY0A 3J81c 4B3RQ 1PV4A 2HIVA 4JI8Q 4OO1I 4LF4L 2D0OA 1GKHA 4A3FH 1VQLA 1XNQL 1Z47A 1FJGQ 1VCIA 1AE2A 1SR3A 3TEHB 3UDIA 4C2MH 4XIGS 5M3MH 4GNXB 3CMEA 3UDGA 3CW2C 2ZJRA 1QVFA 5C44H 1IBKL 4DR6Q 1KD1C 4MTNA 2F3IA 2KCTA 1KRSA 4GLVB 1X3GA 2I5MX 3UDFA 2R6GA 3G71A 3RLFA 3CC4A 2KCMA 1B8AA 1NY4A 4B3TL 4GKJL 1MIUA 3MEFA 4A3LG 1LUZA 2ID0A 1PH9A 4JV5L 1N33Q 5JEAJ 4BBRG 3J7ZC 1A8VA 3CCJA 3JC66 3STBD 4A3BH 2ZM6Q 3F2DA 1SRUA 2JJQA 3I4NH 1Q46A 1TWFH 2Q2IA 3CCEA 1K8AC 1JJ2A 3JAMi 1IBLL 3GTKH 1TXYA 2RCNA 2CQOA 1VQMA 1PH6A 2OQKA 2UU9Q 4BA2I 4WJ4A 5J3BA 3JAMc 4IOCA 1WOCA 1MKHA 5HGQA 4A3GH 2XGTA 2PQAA 1W2BA 2Q2UA 4IPGA 4A93H 2IY5B 1UE5A 3NEMA 3F2BA 3BJUA 4JI5Q 4KI0A 2VUMG 1WYDA 1HR0L 4NXNQ 4EQ5A 1U5KA 1PH7A 4LW1A 3ERSX 1JJCB 2NVTH 1CSPA 4HJ7A 4X64L 2AWNA 3S1QH 1X3FA 2UXDL 5IWAL 2VY3A 3J80i 3KJOA 1VQAA 2NN6G 1IBML 4LF9L 4TQUS 3H0GG 2A19A 3KOJA 1VQNA 4A3JH 2WP8J 2K5NA 1EWIA 3AFPA 3J80c 1VQ4A 3DLLA 1BVSA 4DV2Q 1EOVA 4IOAA 3FP9A 4DK3C 3S16H 1NJIC 4YWMA 3CCUA 1VQ9A 1RIPA 1TWAH 3BU2A 1YEZA 1J5EL 4JI6Q 4DR1Q 1EIYB 4JOIC 3KDFB 1HJPA 2IX1A 1HNXL 4LUZA 1VQBA 3NENA 2UUAQ 3I55A 4HJ9A 4JI1L 3GTOH 3I56A 1HH2P 1E1TA 2QGQA 4NXMQ 4LF8L 3RZDH 2KHJA 1WCMH 1MJCA 1V1QA 4LFBQ 1VQIA 1TWHH 4R4CA 4A75A 2UXBL 3CD6A 2C35B 1SFOH 3AEVA 3Q8DA 1XMOQ 3PIPA 1YJNA 1XPRA 1DGSA 2NZHA 4DR5L 4BXXH 2ES2A 4DR4L 4DR2L 3EBEA 1VQ6A 4JI2L 4BY7G 3M4QA 5LMUL 4ALPA 4HJ5A 1BBUA 4YHHL 3HOZH 2R93H 4A3KH 4DV5Q 3T1HL 4GN5A 1XNRL 2H5XA 5AJ3Q 2JA5G 4R4OA 5ELOA 4WJ3M 4LF4Q 1VQ7A 3KLWA 1WJJA 3HOVH 4OONA 5IP7H 4J15A 5FLMH 3CCLA 5JJKA 2E5LL 2JA8H 1H95A 5M3FG 1IBKQ 2UUBL 4OX9L 3KJPA 4PZ6A 1YI2A 5H1SE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQE A;  2WAQ E;  2PNH A;  3K80 C;  4R4T A;  3HOX H;  4B3T Q;  4YY3 L;  3FHW A;  5C3E G;  2ALY B;  4P72 A;  2N3S A;  3A5U A;  2N49 A;  1HNZ L;  2WB1 G;  1M90 C;  5M3M G;  4R4I A;  2JE6 I;  1HZB A;  1IBL Q;  1OTC A;  1L2F A;  4HIK A;  3J7A 5;  3BZC A;  4A3M G;  4JI0 Q;  4JYA Q;  1UE6 A;  4IPD A;  2VQE L;  4A3E H;  1N36 L;  2CWP A;  4P73 A;  1I94 Q;  3SGI A;  4RG1 A;  5FJ8 G;  4JBW A;  1GO3 E;  3BZK A;  1JMC A;  4K0K L;  2WFW A;  2Z6K A;  4GOP A;  1PVO A;  4DUZ L;  1N34 Q;  2ATW A;  3PF5 A;  1HR0 Q;  1A63 A;  1PYB A;  4A76 A;  1D7Q A;  5IT9 c;  4DV3 L;  1VQK A;  1CKN B;  1KRT A;  1KQS A;  2UXD Q;  5EAY A;  4GKK L;  5IWA Q;  1OXT A;  2DGY A;  4LWC A;  4B3M Q;  1IBM Q;  4UP7 A;  4LF9 Q;  1KC8 C;  2NZO A;  2RHS B;  2K50 A;  3CCS A;  4DV1 L;  1G51 A;  5GRO A;  1CKO A;  3IRB A;  4LF5 L;  1LYL A;  3RN5 A;  4A3G G;  1SRO A;  5IYD G;  1SLJ A;  1SMX A;  5C0X I;  3CC7 A;  3S1M H;  1HNW Q;  1X54 A;  4X65 L;  4JI3 L;  4AYB G;  3G6E A;  2ZJP A;  4BA1 I;  2LXK A;  1J5E Q;  1XTD A;  1PA6 A;  2V1C C;  1TWG H;  4YWK A;  1BKB A;  1HNX Q;  4DPG A;  3LGJ A;  4BBS H;  4L5Q A;  1EIF A;  5M5W H;  3KF6 A;  3PUW A;  4JBM A;  2VNU D;  2B63 H;  1X9N A;  2KHI A;  2HHH L;  4JG2 A;  2MO0 A;  2NVY H;  2GVB A;  3AYH B;  3L2P A;  1OXX K;  4LFC L;  4XTC S;  4DV4 Q;  3RR5 A;  1OXV A;  4KHP L;  1N8R C;  4MZ9 A;  4DUY Q;  3CPF A;  1HR0 W;  2R7Z H;  3CQZ H;  4DR5 Q;  1QUQ A;  2VL6 A;  4DR4 Q;  2GVA A;  3UDX A;  5LMN Q;  4YCW A;  1KAW A;  1W3S A;  5LMU Q;  3TQY A;  1Q12 A;  2R92 H;  3PO2 H;  4O2D A;  4DV0 Q;  2YTY A;  4JBJ A;  1V43 A;  4DV7 L;  3T1H Q;  1GM5 A;  4X66 L;  4AQY L;  2YV5 A;  4C3I H;  1WCM G;  2RHQ B;  3KF8 B;  2E5L Q;  1N32 L;  1HZC A;  3K0X A;  1GVP A;  1IYJ B;  2UXC L;  4OXP A;  3PF4 A;  3A74 A;  2JA6 H;  4YWL A;  4APV A;  1EQQ A;  1Y1W G;  3I4M H;  3S1R H;  3PO3 H;  2IHF A;  2FXQ A;  4A3K G;  1Q7Y C;  2JEA I;  4OWT B;  2GN5 A;  4QIW E;  5IYC H;  4LF7 L;  1YNX A;  4YCU A;  1HNZ Q;  1PYS B;  3PV0 A;  5IP7 G;  5FLM G;  3W1G A;  1PH3 A;  3H3V H;  5BR8 L;  4JI4 L;  4IFD J;  3HOW H;  2EIF A;  5M5Y H;  3HKS A;  3FKI H;  5LMN W;  3H3V I;  3CAM A;  1P8L A;  3E9I A;  2VQE Q;  1FVI A;  4LF6 Q;  1L1O A;  4L5T A;  1Y1V G;  2ASB A;  1X3E A;  4BY1 G;  3CCM A;  1X55 A;  1XMQ L;  2UUC L;  2YU9 H;  4X6A H;  2JA7 G;  5K36 G;  1LM0 A;  1UE1 A;  1Q82 C;  4DR3 L;  4X62 Q;  1X6O A;  1QVC A;  3GTJ H;  3WWV A;  3PGZ A;  3RN2 A;  1CKN A;  1EFW A;  4B3S L;  3GD7 A;  3W5O A;  1KL9 A;  2VS1 A;  3M4P A;  4DR7 Q;  1T9H A;  4DV6 Q;  4BBR H;  4A3L H;  3CC2 A;  4B3R L;  2Y0S E;  4JI8 L;  2BA0 A;  4HIO A;  1PHJ A;  3K7U C;  4GLX A;  4DK6 C;  1CSQ A;  1E22 A;  1VQD A;  2EXD A;  1HZ9 A;  1VQP A;  1QZH A;  4DR6 L;  2BH8 A;  3K8A A;  3OTO L;  4X65 Q;  1XNQ Q;  1AE3 A;  2E2H H;  2NVX H;  1SE8 A;  1UWV A;  2JQO A;  3J81 j;  2ZTD A;  1Q86 C;  3ULJ A;  4JCV E;  4GNX A;  1QZG A;  1LTL A;  1NE3 A;  2B29 A;  1V9P A;  2RF4 A;  3HKZ G;  3L0O A;  5IP9 H;  1D8L A;  5GAE C;  1VQH A;  4A3C H;  2E2J H;  2Z6K C;  1IXR A;  4GOP C;  3NBH B;  3UE1 A;  4LUO A;  1I5F A;  2BA1 A;  5C0X G;  1XJV A;  4GKJ Q;  4OO1 G;  4JV5 Q;  1E3P A;  4LFC Q;  1X56 A;  2D62 A;  4IO9 A;  4KHP Q;  2OTJ A;  4A3F G;  4DAM A;  2R7F A;  2QEX A;  3HOY H;  1L0W A;  1Q8K A;  2JEB I;  3AFQ A;  3PSI A;  2UU9 L;  3M85 A;  3CPW A;  2KBN A;  2NVQ H;  1Z9F A;  5C44 G;  3H0G H;  2CWA A;  4L5S A;  4DV7 Q;  1C0A A;  2PQA B;  3D31 A;  3GTP H;  1NMG A;  3E9H A;  2XTI A;  2CCZ A;  4NXN L;  4AYB E;  3CF5 A;  4DNI A;  2K5H A;  4C3H H;  1ASZ A;  3U50 C;  1N32 Q;  3ULL A;  3CP0 A;  2R7Z G;  2OQ0 A;  4A3B G;  3UE0 A;  4UP9 A;  1N9W A;  2K5V A;  1VQ5 A;  3GTM H;  3I4N G;  1CUK A;  3RZO H;  3ER0 A;  2DUD A;  2R92 G;  1S40 A;  4X64 Q;  4C3J H;  2HT1 A;  1KHI A;  2AKW B;  4NB3 A;  1B70 B;  1SN8 A;  1PH4 A;  4A3D H;  3U58 A;  3U4V A;  4HIM A;  3PUY A;  3GTQ H;  2MFI A;  3RLO A;  1S72 A;  2E8G A;  3CCR A;  4LF7 Q;  2I5H A;  3CCQ A;  4JI6 L;  5ELN A;  1YHB A;  1A62 A;  4DR1 L;  2R7D A;  3M4O H;  4BY7 H;  4UY8 C;  3ZJY C;  4A93 G;  1P16 A;  4R4Q A;  1JJG A;  2UUA L;  1WFQ A;  3NEL A;  3OYY A;  4Y7N H;  2F52 A;  4IFD I;  3PO3 G;  1K83 H;  2CKZ B;  3KDF A;  4IPH A;  4IPC A;  3H15 A;  3I4M G;  1JT8 A;  5C4J H;  4JC0 A;  2I5L X;  5FLX c;  5IYC G;  2UUC Q;  1JE5 A;  4JI1 Q;  5GAH C;  1I6H H;  3L7Z C;  2Z0S A;  4LF8 Q;  2CFM A;  1YIJ A;  4A3J G;  2UXB Q;  2PI2 A;  3HOW G;  1O7I A;  4HID A;  2K52 A;  3FKI G;  2OTL A;  1TWC H;  2K75 A;  1I50 H;  5AJ3 L;  4POG A;  4DR2 Q;  1KIX A;  2BH2 A;  4JI2 Q;  5C3E H;  1EQR A;  4PG3 A;  3M9B A;  1K0R A;  1RL2 A;  4YHH Q;  2D0P A;  1E24 A;  3PUV A;  2HQL A;  1OXS C;  1EUJ A;  1PH1 A;  1XNR Q;  1VQO A;  2HIX A;  3OTO Q;  3K81 C;  1MJE A;  2QA4 A;  1UE7 A;  4RMF A;  2LSS A;  1A0I A;  4A3M H;  4P71 A;  2Q2T A;  2F4V L;  1L1O C;  4UPA A;  4A3I H;  3I2Z A;  2UUB Q;  4LFA L;  4OX9 Q;  1PH2 A;  5FJ8 H;  5GAD C;  3F8T A;  3HOU H;  4BXX G;  3S2H H;  4JI7 L;  5M5X H;  1U0L A;  5GAG C;  3HOZ G;  2R93 G;  4P74 A;  3VDY A;  3STB C;  3AQQ A;  4HJ8 A;  1I3Q H;  4YY3 Q;  2L15 A;  2VQF L;  4AIM A;  1WI5 A;  5C4X H;  4AH6 A;  3RLN A;  3CXC A;  4JI0 L;  4JYA L;  3HOV G;  4GLA C;  1FGU A;  3ULP A;  2JA8 G;  3HFZ B;  1NMF A;  1I94 L;  3OW2 A;  1EYG A;  3M7N A;  1NTG A;  5IYB H;  3GO5 A;  5IP9 G;  1CKM A;  1PFS A;  2VW9 A;  2I0Q A;  4JBK A;  2ZJQ A;  5IYD H;  4GOP B;  4A3C G;  1N36 Q;  2MNA A;  3HOX G;  4OWW B;  1N34 L;  4PMW A;  5JJI A;  1VQG A;  3DM3 A;  1XPO A;  2AHO B;  5JEA G;  5E7N A;  2OWO A;  2AMC B;  4P75 A;  3I7F A;  4GNX C;  1C9O A;  3CCV A;  4K0K Q;  1B7Y B;  3GTL H;  3S15 H;  4Y52 H;  4DUZ Q;  1QVG A;  1K9M C;  2ZTC A;  3HKZ E;  5HY6 A;  3S24 A;  3HOY G;  3ICE A;  1YHQ A;  4B3M L;  4DKA C;  4DV3 Q;  5C0X J;  3RNU A;  3T1Y L;  4GKK Q;  1C7Y A;  3S14 H;  4OWX B;  3A5Z B;  5DLQ E;  1UEB A;  4O0A A;  3TRE A;  4A3E G;  1Q81 C;  2EQS A;  2K14 A;  1HNW L;  4NPS A;  1S3O A;  4DV1 Q;  4TVA B;  2Q2H A;  1FJG L;  4LF5 Q;  1G6P A;  2WB1 E;  3A0J A;  4H02 A;  4QGU A;  2E2I H;  3GDE A;  3S1N H;  2MO1 A;  3KF6 B;  2AWO A;  4JI3 Q;  4QJF A;  1KXL A;  4GS3 A;  3PUZ A;  4QQB X;  1IL2 A;  2LXJ A;  4ME3 A;  2OCE A;  2YTV A;  4QL5 A;  1N33 L;  3S17 H;  4DV4 L;  1YHA A;  4A3D G;  2PI2 E;  1XPU A;  4DUY L;  1VQJ A;  2HHH Q;  4PZ7 A;  2ZM6 L;  3W1B A;  1QUQ B;  4HJA A;  1OXU A;  2VUM H;  5LMN L;  2VZA A;  1YBY A;  2JK8 A;  4IFD G;  3F2C A;  3S2D H;  3F1Z A;  1Y1W H;  4DV0 L;  3M3Y H;  3KYH C;  4UP8 A;  4DAY B;  4JOI A;  1YJW A;  2ZTE A;  4KLK A;  3I4O A;  4GN3 B;  1VQF A;  2JA9 A;  1E7Z A;  2IHE A;  2MQH A;  4POF A;  1PH8 A;  4BBS G;  1BBW A;  2NN6 I;  1VS0 A;  2B63 G;  1NBW A;  5IE8 A;  2YTX A;  4X66 Q;  2N78 A;  4AQY Q;  1R9T H;  1HZA A;  4R1J A;  1ASY A;  4JI5 L;  3GTG H;  4KHZ A;  2F4V Q;  3PIO A;  3MXN B;  1YJ9 A;  3PCO B;  3E0E A;  1J6Q A;  4LNQ A;  3G48 A;  1Y1V H;  4LFA Q;  3KFU A;  3K7A H;  1YZ6 A;  2A8V A;  2KEN A;  1Q1E A;  4BY1 H;  3TS2 A;  2Y0S G;  2IX0 A;  2UXC Q;  3TRZ A;  4JI7 Q;  4A4I A;  2N8N A;  1VQC A;  4LUV A;  2JA7 H;  4IJL A;  3U4Z A;  1M1K C;  3PO2 G;  1K8G A;  4L5R C;  4MNO A;  4FDB A;  1K3R A;  3G4S A;  1AH9 A;  2VQF Q;  4IJH A;  4GN4 B;  4DV2 L;  2B3G A;  4EX5 A;  3TS0 A;  1YIT A;  4LF6 L;  1L1O B;  1E1O A;  4A3I G;  3EN2 A;  5BR8 Q;  1PH5 A;  4JI4 Q;  3D0F A;  2IT1 A;  1IZ6 A;  4YCV A;  1X65 A;  1G29 1;  2YYZ A;  4PZ8 A;  3HOU G;  2JA6 G;  2WAQ G;  2JA5 H;  1GD7 A;  4NXM L;  1VQ8 A;  2A1A A;  3EIV A;  1JB7 A;  4LFB L;  1Q1B A;  3B6Y A;  1Y14 B;  4X62 L;  1XMQ Q;  1YVC A;  5JJL A;  5C4X G;  5M3F H;  5GQO A;  1XMO L;  1K73 C;  4DR7 L;  3J81 i;  4DV6 L;  2PMZ E;  2K4K A;  3PUX A;  4QY7 A;  3CMA A;  4DR3 Q;  1FL0 A;  5IYB G;  4B3S Q;  3T1Y Q;  4DV5 L;  5IY0 A;  3J81 c;  4B3R Q;  1PV4 A;  2HIV A;  4JI8 Q;  4OO1 I;  4LF4 L;  2D0O A;  1GKH A;  4A3F H;  1VQL A;  1XNQ L;  1Z47 A;  1FJG Q;  1VCI A;  1AE2 A;  1SR3 A;  3TEH B;  3UDI A;  4C2M H;  4XIG S;  5M3M H;  4GNX B;  3CME A;  3UDG A;  3CW2 C;  2ZJR A;  1QVF A;  5C44 H;  1IBK L;  4DR6 Q;  1KD1 C;  4MTN A;  2F3I A;  2KCT A;  1KRS A;  4GLV B;  1X3G A;  2I5M X;  3UDF A;  2R6G A;  3G71 A;  3RLF A;  3CC4 A;  2KCM A;  1B8A A;  1NY4 A;  4B3T L;  4GKJ L;  1MIU A;  3MEF A;  4A3L G;  1LUZ A;  2ID0 A;  1PH9 A;  4JV5 L;  1N33 Q;  5JEA J;  4BBR G;  3J7Z C;  1A8V A;  3CCJ A;  3JC6 6;  3STB D;  4A3B H;  2ZM6 Q;  3F2D A;  1SRU A;  2JJQ A;  3I4N H;  1Q46 A;  1TWF H;  2Q2I A;  3CCE A;  1K8A C;  1JJ2 A;  3JAM i;  1IBL L;  3GTK H;  1TXY A;  2RCN A;  2CQO A;  1VQM A;  1PH6 A;  2OQK A;  2UU9 Q;  4BA2 I;  4WJ4 A;  5J3B A;  3JAM c;  4IOC A;  1WOC A;  1MKH A;  5HGQ A;  4A3G H;  2XGT A;  2PQA A;  1W2B A;  2Q2U A;  4IPG A;  4A93 H;  2IY5 B;  1UE5 A;  3NEM A;  3F2B A;  3BJU A;  4JI5 Q;  4KI0 A;  2VUM G;  1WYD A;  1HR0 L;  4NXN Q;  4EQ5 A;  1U5K A;  1PH7 A;  4LW1 A;  3ERS X;  1JJC B;  2NVT H;  1CSP A;  4HJ7 A;  4X64 L;  2AWN A;  3S1Q H;  1X3F A;  2UXD L;  5IWA L;  2VY3 A;  3J80 i;  3KJO A;  1VQA A;  2NN6 G;  1IBM L;  4LF9 L;  4TQU S;  3H0G G;  2A19 A;  3KOJ A;  1VQN A;  4A3J H;  2WP8 J;  2K5N A;  1EWI A;  3AFP A;  3J80 c;  1VQ4 A;  3DLL A;  1BVS A;  4DV2 Q;  1EOV A;  4IOA A;  3FP9 A;  4DK3 C;  3S16 H;  1NJI C;  4YWM A;  3CCU A;  1VQ9 A;  1RIP A;  1TWA H;  3BU2 A;  1YEZ A;  1J5E L;  4JI6 Q;  4DR1 Q;  1EIY B;  4JOI C;  3KDF B;  1HJP A;  2IX1 A;  1HNX L;  4LUZ A;  1VQB A;  3NEN A;  2UUA Q;  3I55 A;  4HJ9 A;  4JI1 L;  3GTO H;  3I56 A;  1HH2 P;  1E1T A;  2QGQ A;  4NXM Q;  4LF8 L;  3RZD H;  2KHJ A;  1WCM H;  1MJC A;  1V1Q A;  4LFB Q;  1VQI A;  1TWH H;  4R4C A;  4A75 A;  2UXB L;  3CD6 A;  2C35 B;  1SFO H;  3AEV A;  3Q8D A;  1XMO Q;  3PIP A;  1YJN A;  1XPR A;  1DGS A;  2NZH A;  4DR5 L;  4BXX H;  2ES2 A;  4DR4 L;  4DR2 L;  3EBE A;  1VQ6 A;  4JI2 L;  4BY7 G;  3M4Q A;  5LMU L;  4ALP A;  4HJ5 A;  1BBU A;  4YHH L;  3HOZ H;  2R93 H;  4A3K H;  4DV5 Q;  3T1H L;  4GN5 A;  1XNR L;  2H5X A;  5AJ3 Q;  2JA5 G;  4R4O A;  5ELO A;  4WJ3 M;  4LF4 Q;  1VQ7 A;  3KLW A;  1WJJ A;  3HOV H;  4OON A;  5IP7 H;  4J15 A;  5FLM H;  3CCL A;  5JJK A;  2E5L L;  2JA8 H;  1H95 A;  5M3F G;  1IBK Q;  2UUB L;  4OX9 L;  3KJP A;  4PZ6 A;  1YI2 A;  5H1S E; 
#chains in the Genus database with same CATH topology
 4R4T A;  2PNH A;  1JOR A;  3OOC A;  1RF2 D;  4HTH A;  5JEA H;  5D65 A;  1ENF A;  1NCV A;  3NQT A;  2ALY B;  4P72 A;  3A5U A;  2XRS D;  1HNZ L;  2NZ1 D;  1PFM A;  2P5Z X;  4HCE A;  5LHY 1;  4K8I A;  2JE6 I;  4H13 C;  2ICE C;  2BCO A;  3J7A 5;  4JI0 Q;  4JYA Q;  3S16 B;  3A8I E;  5BN5 A;  2VQE L;  2WKD A;  3VYU A;  4NP5 A;  2CQA A;  3VA7 A;  4BWG B;  4H7B A;  1B1Z A;  4K0K L;  1SAP A;  2WFW A;  2EOT A;  1A63 A;  4XDX A;  3KBX A;  3NPP A;  1PYB A;  4A76 A;  3TP7 A;  3S17 B;  4FYD A;  1HCZ A;  1F77 A;  1KC8 C;  1IL8 A;  3C3L A;  4EGV A;  2RHS B;  1QNU A;  5C0X H;  3CCS A;  5GRO A;  1ICW A;  3ND9 A;  1Y1W B;  3S2D B;  1G6Z A;  5G3L F;  1SND A;  5CV5 A;  3GQB A;  3CC7 A;  1HNW Q;  1ROD A;  4JI3 L;  3RMH A;  5JPN C;  3DMU A;  3G6E A;  1J5E Q;  4BA1 I;  1PA6 A;  3BS1 A;  3LGJ A;  3KUP A;  1EIF A;  2RSO A;  3KF6 A;  3PUW A;  4JBM A;  2B63 H;  3JAM E;  1EZ8 A;  2PYK A;  2MO0 A;  2NVY H;  1GUO A;  4LFC L;  1EQT A;  1OXV A;  1N8R C;  4HMJ A;  2K01 A;  1EU3 A;  4DR5 Q;  2VL6 A;  2FMC A;  1W3S A;  3TQY A;  3U9S A;  3NWS A;  4IQZ A;  4IUP A;  3T1H Q;  1GM5 A;  4KY7 A;  3QIA A;  3VA5 A;  1WCM G;  4QUC A;  2ZXP A;  1SJE D;  3PQI A;  1N32 L;  2BDN A;  1XTC D;  3K0X A;  3P7J A;  4G7Z C;  2K5D A;  4YWL A;  1Y1W G;  3J80 L;  2QDB A;  3FVQ A;  5CC4 A;  2K32 A;  1PTO B;  3HKZ B;  1E2Z A;  2GN5 A;  1BXT A;  2RDH A;  1PYS B;  4N8X 1;  1PH3 A;  5JAV A;  3HOW H;  4KN7 C;  5M5Y H;  1RKN A;  1RHP A;  1CA6 A;  3VR4 A;  1L1O A;  4L5T A;  5C44 B;  1TY2 A;  3ZYY X;  2F0T A;  1X55 A;  1XMQ L;  1LM0 A;  1PFB A;  3EJI A;  1Q82 C;  3AU7 A;  4G4K A;  4DR3 L;  1C8C A;  1QOH A;  3NQI A;  1DM0 B;  2O5J C;  4FNF A;  3W5O A;  3M4P A;  2R7Z B;  4KJO A;  4BBR H;  3CC2 A;  4B3R L;  1CT1 D;  2Y0S E;  3R2I A;  1CZG A;  4DK6 C;  1I4G A;  2R92 B;  1VQP A;  4UHV A;  2BH8 A;  3OTO L;  3QO2 A;  1CQF A;  1UWV A;  2L55 A;  2ZTD A;  1LTL A;  4A93 B;  3HKZ G;  3HP3 A;  3L0O A;  5IP9 H;  1LT6 D;  4CHT B;  2G9H D;  5GAE C;  3CRL C;  3K58 A;  4KD3 A;  4GOP C;  4OO1 G;  1I5F A;  3S1Q B;  4IO9 A;  1ZKO A;  4WRD A;  4OHJ A;  1JWU D;  1ZEQ X;  4DAM A;  4KKS A;  1JOK A;  2JEB I;  3PSI A;  3PIO 3;  3M85 A;  2KBN A;  5C44 G;  4JPB W;  4L5S A;  3FKI B;  1BCP B;  4CDC C;  4I7A A;  3VYR A;  1CFM A;  5IT9 L;  1QNK A;  1D2B A;  1SMY C;  2ZXR A;  4NXN L;  2AQ3 B;  2O5I C;  1UAP A;  4DNI A;  2B39 A;  1ASZ A;  2R7Z G;  5KNB A;  4UP9 A;  2K5V A;  5A35 A;  1F9R A;  2RVL A;  2DUD A;  2R92 G;  1B9N A;  1S40 A;  4DA2 A;  4NB3 A;  1B70 B;  1SN8 A;  3GTQ H;  4HIM A;  1BNZ A;  3MVV A;  2I5H A;  3H91 A;  5EBC A;  3DXJ C;  3I90 A;  2B2V C;  2R93 B;  1YHB A;  3M4O H;  4BY7 H;  4ULL A;  4UY8 C;  4A93 G;  5CR3 A;  4OEL B;  1U4L A;  5T1G A;  1WFQ A;  3NEL A;  2F0E A;  3J7Y W;  4IPH A;  1H9K A;  1SXT A;  3QB3 A;  2I5L X;  2UUC Q;  1X3Q A;  2AUK A;  4JI1 Q;  1SNC A;  3L7Z C;  2Z0S A;  2MP1 A;  2KQ3 A;  5C5L A;  4EQP A;  2UXB Q;  3IFD A;  5A2Q L;  1STY A;  3FKI G;  1I50 H;  2BH2 A;  1EQR A;  3M9B A;  1E24 A;  3PUV A;  2JXM B;  3GV3 A;  1SYE A;  4CKB A;  3OMG A;  2C5C A;  3AB9 A;  5IGB A;  2F4V L;  2D2C C;  4XXE A;  4A3I H;  5KRU A;  2UUB Q;  4OX9 Q;  5KNC A;  2J4X A;  3F8T A;  4BXX G;  5EPJ A;  3FPP A;  3NSW A;  4K5V A;  1WTO A;  2R93 G;  4K2L A;  1PLF A;  3VDY A;  3TP5 A;  3FPU B;  4AH6 A;  4JI0 L;  4JYA L;  1GXD C;  3IKJ A;  1FGU A;  3A8K E;  1NMF A;  1STN A;  1EYG A;  4JBK A;  1CKM A;  3S1M B;  2A68 C;  1HRJ A;  1A3T A;  2MNA A;  4KD4 A;  2XWJ B;  2WAC A;  3I7F A;  3S15 H;  3GTL H;  2IL8 A;  3LWU A;  3ICE A;  5HY6 A;  2DY7 A;  1YHQ A;  4DF7 A;  4HN7 A;  1JQY D;  2XVS A;  5C0X J;  4DV3 Q;  3DEP A;  3J7A V;  4NW2 A;  1D5M C;  1S5E D;  1C7Y A;  1E2V A;  3BZD B;  3PMF A;  2Y0S B;  1IYV A;  2EQS A;  1HNW L;  4NPS A;  2E76 C;  1S3O A;  5ELB A;  1SNO A;  2WB1 E;  2LFN A;  2AWO A;  2Z1C A;  5JOB A;  3SK4 A;  1N33 L;  1YHA A;  2F0M A;  2HHH Q;  2ZM6 L;  1ET6 A;  3I91 A;  3T56 B;  1YBY A;  2JK8 A;  4F7X A;  4U67 3;  5C4X B;  4JK1 C;  4DAY B;  1STH A;  2ZTE A;  4POF A;  3NE5 B;  2NN6 I;  1PZK D;  4X66 Q;  4JI5 L;  3GTG H;  3PIO A;  3PCO B;  2ENB A;  1Y1V H;  4LFA Q;  3URY A;  4CBV A;  1YZ6 A;  2A8V A;  4BY1 H;  2Y0S G;  2IX0 A;  1H9R A;  3SK6 A;  3U4Z A;  2EVB A;  4L5R C;  1GUW A;  2JYO A;  1K3R A;  3G4S A;  2VQF Q;  4IJH A;  4DK1 A;  3R8B A;  4EX5 A;  1EIH A;  1GHK A;  1E1O A;  1PH5 A;  4JI4 Q;  2E2I B;  3S1N B;  1X65 A;  2JA5 H;  1GD7 A;  1HQM C;  1VQ8 A;  1RCV D;  3EIV A;  1LTR D;  4NMZ A;  1EWC A;  3OIP A;  5C4X G;  1K73 C;  2E2J B;  3A8J E;  3J81 i;  4ZYS A;  3KLS X;  1LTB D;  4QY7 A;  4FP5 D;  1KAB A;  1GUS A;  4B3S Q;  3T1Y Q;  2F0F A;  4DV5 L;  3J81 c;  1ILQ A;  1PV4 A;  4JI8 Q;  4LF4 L;  2D0O A;  3TBI B;  1GKH A;  4A3F H;  1VQL A;  5FK9 C;  1PDQ A;  3ITP A;  2K33 A;  1BR9 A;  3TEH B;  3UDI A;  4LMQ D;  4DR6 Q;  3GTP B;  3UDG A;  1IBK L;  1R9T B;  4GLV B;  1X3G A;  2R6G A;  1KDB A;  2KCM A;  4IN3 A;  1MIU A;  1D5Z C;  3MEF A;  4CGY B;  2EZV A;  1PH9 A;  4A3L G;  2CH4 A;  2KED A;  1EY4 A;  3Q0A A;  3CCJ A;  5EPL A;  5FO8 B;  3STB D;  3TME A;  5JVH 3;  3SK5 A;  2L4N A;  2RCF A;  3F2D A;  2JJQ A;  4KMU C;  3I4N H;  3CCE A;  2Q2I A;  2EJF C;  1ILP A;  4R8N A;  1KDC A;  2CQO A;  1CQV A;  1PH6 A;  1SYB A;  2OQK A;  3K57 A;  4WJ4 A;  1J8I A;  1WOC A;  4G57 A;  2L11 A;  4IPG A;  2IY5 B;  3NEM A;  4Z9C B;  5LL6 S;  1HR0 L;  4EQ5 A;  1S5B D;  4RWS C;  4LW1 A;  3HEJ A;  1CSP A;  3TDQ A;  1O7Z A;  2UXD L;  5M3F B;  1ENA A;  1O80 A;  4TQU S;  3VR3 A;  1VDZ A;  3C1F A;  1D5X C;  4OL7 A;  4RA8 A;  4DXG A;  1BVS A;  1A3U A;  3DHQ A;  1WTV A;  2F0L A;  5C3E B;  2EYJ A;  2CVR A;  4DR1 Q;  2WB1 B;  3KDF B;  4JOI C;  4C2M B;  3LWE A;  4K5X A;  3D4W A;  2EYP A;  4LUZ A;  1HNX L;  2IX1 A;  3RUZ A;  3PIP 3;  3NEN A;  3I55 A;  4JI1 L;  3RZD H;  1VQI A;  1SE2 A;  2UXB L;  2C35 B;  3S2H B;  1ICF B;  1I6V C;  4WJW A;  1XMO Q;  1YJN A;  1XPR A;  4DR4 L;  1TY0 A;  5CV4 A;  4IUN A;  1E2W A;  3M4Q A;  2EY1 A;  4HJ5 A;  4IUQ A;  3GTK B;  2KEC A;  2L0C A;  1LV9 A;  1PTO C;  3HRZ C;  3P75 A;  3KLW A;  2WIN B;  3HOV H;  2E5L L;  3ONA B;  5KND A;  5M3F G;  2UUB L;  4OX9 L;  4XQN A;  3W1B A;  1YI2 A;  2ICI A;  4AYB B;  3FDT A;  4E6I A;  4OIJ A;  4KJN A;  1JOO A;  3D4R A;  1EY0 A;  4LAA A;  1AN8 A;  3FHW A;  3D4D A;  5C3E G;  5K36 H;  2N49 A;  4XYO A;  2WB1 G;  1A2T A;  4R4I A;  1O7Y A;  1HZB A;  1PXU A;  1HQR D;  3BZC A;  4RKL A;  1JWS D;  1HTL D;  1CTM A;  1TWA B;  2CWP A;  3J81 E;  2R61 A;  1G91 A;  3V05 A;  5FJ8 G;  4JBW A;  1GO3 E;  1SYD A;  3O13 A;  4RFB A;  4GOP A;  1F9S A;  1O7L A;  4RGN A;  5JPM C;  3P20 A;  4DV3 L;  5CMD A;  2HQE A;  1SFO B;  5EAY A;  1DJR D;  2F0K A;  3LX0 A;  1DYQ A;  2DGY A;  4LWC A;  1IBM Q;  2NZO A;  1G51 A;  1CKO A;  5KYL A;  1LYL A;  1X54 A;  4AYB G;  2A69 D;  2ZJP A;  5E1F A;  2LXK A;  1XTD A;  2V1C C;  4X3U A;  1LAB A;  4FF2 A;  1JIC A;  4DPG A;  4BBS H;  3SVM A;  4F88 A;  2VNU D;  1X9N A;  4ZUJ A;  1BCP C;  2HHH L;  1G2S A;  2FIN B;  5KEE A;  1OXX K;  3RR5 A;  1B3Q A;  2CW0 C;  3CPF A;  2Q8I B;  1RJT A;  2X6G A;  2JA7 B;  3CQZ H;  2B2V A;  3JAM L;  4YCW A;  1KAW A;  5LMU Q;  1B50 A;  1JB3 A;  1Q12 A;  3PO2 H;  5ELD A;  2YTY A;  1V43 A;  4DV7 L;  1EEF D;  2KA7 A;  4X66 L;  2YV5 A;  3OW7 A;  2ZXO A;  2RHQ B;  2EY6 A;  3KF8 B;  4DXF A;  3OHX C;  2M00 A;  2MPM A;  4OXP A;  4V0B A;  4L63 B;  3MXN A;  1IYU A;  3S1R H;  1DON A;  2FXQ A;  1SE4 A;  2JEA I;  1AZQ A;  4QIW E;  4LF7 L;  1STA A;  4K2K A;  2XRQ D;  2DJG C;  3N52 A;  5IP7 G;  3W1G A;  5FLM G;  4JI4 L;  2XN9 C;  1G2T A;  2F0Q A;  3H3V I;  1PFN A;  1QE6 A;  4LF6 Q;  2EE1 A;  4CDE C;  4ILW A;  1SYG A;  3FMC A;  4CJ0 B;  4QUF A;  4BS9 A;  1X3E A;  3AMU A;  1F2Y A;  3D3R A;  5COR A;  4X6A H;  1HXY D;  2JA7 G;  1UE1 A;  4X62 Q;  1QVC A;  4B3S L;  4M8A A;  4DR7 Q;  2VS1 A;  4HSV A;  4U68 A;  1T9H A;  4DV6 Q;  1X32 A;  4JI8 L;  5CGK A;  2IX3 A;  1CSQ A;  3G7L A;  1E22 A;  1DOM A;  4ZRZ A;  4DR6 L;  1DD2 A;  2CH4 W;  1Z7T A;  1RTO A;  4X65 Q;  1XNQ Q;  5FOB B;  2JQO A;  3D8G A;  4JCV E;  3T51 B;  1TS3 A;  1V9P A;  4A3C H;  2Z6K C;  4V19 0;  5C0X G;  4XT3 B;  2BA1 A;  4PV1 C;  1X56 A;  4KHP Q;  3NWT A;  3SDZ A;  5NUC A;  1LTA D;  3EQL C;  3HOW B;  5M5Y B;  1VMC A;  1LAC A;  3SK8 A;  1NMG A;  2K05 A;  2XTI A;  3K5L A;  3CF5 A;  5G3L D;  4C3H H;  3U50 C;  3ULL A;  3CP0 A;  2SDF A;  1BDO A;  1EQV A;  3UE0 A;  3KK7 A;  1WCM B;  3RZO H;  1TWH B;  5FO7 B;  3LNN A;  4X64 Q;  5FLX E;  2HT1 A;  1PH4 A;  2AKW B;  4A3D H;  5L37 A;  1S72 A;  3SE0 A;  4OEM B;  5J22 A;  3HOZ B;  1A62 A;  2A6E C;  4DR1 L;  2PCF B;  1P16 A;  4IFD H;  4R4Q A;  1JJG A;  1CK1 A;  5M9O A;  1LO5 D;  2EYO A;  4B08 A;  3Q24 A;  2VXW A;  4Y7N H;  2F52 A;  4K6L A;  1NSN S;  5F2D A;  1ML0 D;  1CHP D;  2F0J A;  3D6W A;  3WDN A;  1D1K A;  1MD2 D;  1GHJ A;  4WFN 3;  3HOX B;  4X3S A;  2O4X A;  3HOW G;  1Y69 U;  1DOL A;  1TWC H;  5CBE E;  4POG A;  1KIX A;  4JI2 Q;  1H9S B;  4PG3 A;  1RL2 A;  4FF4 A;  1S5D D;  1XNR Q;  4A3E B;  3K81 C;  2QA4 A;  5KYI A;  2LSS A;  1A0I A;  4P71 A;  3I2Z A;  3EFX D;  3T13 A;  3HOU H;  2HDM A;  5M5X H;  5GAG C;  4QCL A;  3HOZ G;  4HJ8 A;  1I3Q H;  4YY3 Q;  2HUG A;  2L15 A;  4FF1 A;  5C6A A;  3RLN A;  2QW7 A;  1JE4 A;  3ULP A;  1F9Q A;  4KKU A;  3D6C A;  3OW2 A;  3M7N A;  3M4O B;  1NTG A;  5IYB H;  5IP9 G;  1MHW C;  2ZT9 C;  3HOX G;  3K0Y A;  1TWG B;  4JVZ A;  2FJ2 A;  3FEW X;  2AHO B;  4DNR B;  2J0T D;  1B7Y B;  4Y52 H;  4DUZ Q;  1QVG A;  1TU2 B;  2ZTC A;  3E3X A;  5ELE A;  2DN8 A;  2K03 A;  4GKK Q;  3S14 H;  4OWX B;  1STE A;  1KLG D;  1I50 B;  1A3V A;  4A3E G;  1A2U A;  4XT1 B;  1Q81 C;  2C9O A;  4DV1 Q;  2Q2H A;  1FJG L;  1G6P A;  4L6T B;  2E75 C;  1HTP A;  3GDE A;  4ZQ3 A;  4GS3 A;  4F8M A;  4G7H C;  1IL2 A;  1MSG A;  3I70 A;  2OCE A;  2YTV A;  4QL5 A;  4A3I B;  4H44 C;  3S17 H;  4S3S A;  2PI2 E;  1XPU A;  5ELF A;  1EYD A;  2JA6 B;  2G5D A;  1QUQ B;  3Q6S A;  4ZCK A;  1YNJ D;  4CJ2 C;  3S2D H;  1Y1W H;  1D6E C;  4ABN A;  3KYH C;  4JOI A;  1QIL A;  4NKL A;  1PRT C;  3I4O A;  4FXD A;  2MQH A;  2QIL A;  1NBW A;  4IZ8 A;  5IE8 A;  4R1J A;  4MTK A;  2F0N A;  1YJ9 A;  5LL6 X;  3E0E A;  4LNQ A;  1LLR D;  4WOR A;  2YU9 B;  3GTL B;  2KEN A;  2UXC Q;  4JI7 Q;  4A4I A;  1KDA A;  4LUV A;  2K04 A;  1KLU D;  2LY7 A;  3GTJ B;  1K8G A;  2Q8T A;  3A7A B;  2D5D A;  1AH9 A;  4DV2 L;  2HCC A;  2A74 C;  1YIT A;  2V4D A;  4LF6 L;  4A3I G;  5BR8 Q;  1K8M A;  5HGT A;  1L0X B;  1LTI D;  3D0F A;  1IZ6 A;  1BF4 A;  4YCV A;  1IKL A;  1G29 1;  2PW7 A;  1PMR A;  3DM1 A;  2JA6 G;  1QCB D;  2BE5 D;  4NXM L;  5K5P A;  1TS4 A;  4X62 L;  2PNR C;  4J6H A;  2EYH A;  5GQO A;  1PTO H;  4DR7 L;  3BYY B;  1ZXT A;  4DV6 L;  2PMZ E;  2L12 A;  2K4K A;  4OO1 H;  3I4L A;  2HIV A;  1XNQ L;  3H0G B;  1VCI A;  1AE2 A;  1SR3 A;  5M3M H;  3U58 A;  4GNX B;  3NP8 A;  4XIG S;  2ZJR A;  5C44 H;  1KD1 C;  4MTN A;  1SNP A;  1FYC A;  3RLF A;  2FMM A;  1B8A A;  3GP7 A;  2OEO A;  1LUZ A;  1NR4 A;  1ZYR D;  2M2L A;  5JEA J;  1WVL A;  3J7Z C;  4HMI A;  3GTM B;  2FFK B;  4XYQ A;  1EY7 A;  1OO9 B;  4C3J B;  4B9X A;  2F0G A;  1Q46 A;  1JJ2 A;  3MWY W;  3X3N A;  1VQM A;  2UU9 Q;  1XWE A;  2PW5 A;  5EKL A;  5J3B A;  5HGQ A;  1MKH A;  4ZKC B;  4A3G H;  2I46 A;  2XGT A;  2XIW A;  4A93 H;  2JA5 B;  5ISR A;  1R4Q B;  3BJU A;  3CHB D;  1K83 B;  1SEB D;  1EEI D;  2LMC B;  4K6D A;  1UNS A;  1JJC B;  2OT2 A;  3C1E A;  5KIX A;  2NVT H;  4X64 L;  3S1Q H;  1GUT A;  3C2P A;  1I6H B;  1FNU A;  5ELC A;  4DGZ A;  1ESF A;  3J7A F;  3H0G G;  1VQN A;  1PYW D;  3K6O A;  1VQ4 A;  3DLL A;  3FP9 A;  2JN4 A;  1VQ9 A;  3CCU A;  3FRP B;  1RIP A;  2KCC A;  3BU2 A;  3DWP A;  4FXK C;  1J5E L;  4KKT A;  4JI6 Q;  1YNN D;  2G9D A;  3X3M A;  1GOZ A;  1X3P A;  2UUA Q;  1MBY A;  4A3M B;  4HJ9 A;  2XWB B;  3GTO H;  3I56 A;  2L5T A;  2R3Z A;  4C3J G;  2KHJ A;  4LFB Q;  4R4C A;  4A75 A;  3MFG A;  3Q8D A;  4RHR A;  2NZH A;  4HED A;  4DR5 L;  4BXX H;  2ES2 A;  4JI2 L;  2F0O A;  2R93 H;  4A3K H;  3T1H L;  4EQN A;  1AZP A;  1XNR L;  2H5X A;  2JA5 G;  4KY6 A;  5EKK A;  1VQ7 A;  1WJJ A;  4J15 A;  4DK0 A;  2LS0 1;  1MSH A;  3KJP A;  3TZU A;  3T4A C;  1TVX A;  2WAQ E;  1PTO F;  3K80 C;  4B3T Q;  1CHQ D;  4YY3 L;  2IPK D;  1WD1 A;  2M9V A;  2N3S A;  2AQ2 B;  1IBL Q;  4OGQ C;  1L2F A;  4A3M G;  1UE6 A;  3G6J B;  1LTS D;  4P73 A;  1I94 Q;  5I2X A;  3I3C A;  2B2T A;  4RG1 A;  4B9W A;  3RD4 A;  1JMC A;  1STG A;  2Z6K A;  3TP8 A;  1HUN A;  4DUZ L;  3PF5 A;  3RZD B;  5IGF A;  3J81 L;  1KQS A;  1UUP A;  4GKK L;  5IWA Q;  1OXT A;  4DN4 M;  2B8G A;  4B3M Q;  4QF4 A;  4UP7 A;  4LF9 Q;  4DV1 L;  3E0J A;  3IRB A;  3RN5 A;  1SRO A;  5IYD G;  1QWY A;  1SLJ A;  1SMX A;  5C0X I;  3S1M H;  1LT3 D;  2WV6 D;  3NXW A;  4L5Q A;  5M5W H;  1SE3 A;  4JG2 A;  5CV8 A;  3AYH B;  3L2P A;  1EL0 A;  5I9O A;  1IKM A;  1HR0 W;  3OPO A;  5D14 A;  3UDX A;  1BCP F;  1K28 A;  4DAY A;  4C3I H;  3M7G A;  4Q0F A;  1V1P B;  1K8O A;  1WTP A;  1HFG A;  3BDO A;  1HZC A;  3H94 A;  1IYJ B;  2UXC L;  2Q8R E;  3PF4 A;  4X3T A;  4XQJ A;  1WD0 A;  3PO3 H;  1EQQ A;  4O42 A;  3I4M H;  1U4M A;  4OWT B;  1V1O A;  5IYC H;  2JP1 A;  2MHV A;  1YNX A;  4YCU A;  1HNZ Q;  2RDG A;  2SNS A;  3PV0 A;  1JWM D;  5BR8 L;  2EIF A;  3IL8 A;  2XNA C;  3HKS A;  5LMN W;  3QR8 A;  3CAM A;  1P8L A;  3E9I A;  2VQE Q;  2NTS A;  3BYT B;  1TS5 A;  2ASB A;  2K6A A;  2UUC L;  5K36 G;  2NWG A;  3SR1 A;  1X6O A;  4L8J A;  1R4P B;  3V96 A;  4PMB A;  1EFW A;  3GD7 A;  4A3L H;  4A3B B;  1GUG A;  3CQZ B;  2F3V A;  4PQX A;  3K7U C;  4GLX A;  1TWF B;  3OMC A;  2A6H D;  1QZH A;  3K8A A;  1VMP A;  1V8Q A;  1T5X D;  2E2H H;  1SE8 A;  4KK7 A;  1IW7 D;  2NVX H;  1QZG A;  1NE3 A;  4F87 A;  1NR2 A;  3T16 A;  1D8L A;  1VF5 C;  2E2J H;  1XJV A;  5EJW A;  3NBH B;  3UE1 A;  4DU9 A;  4JV5 Q;  1HFN A;  4LFC Q;  3DWQ A;  3EVQ A;  3IAY A;  1EIG A;  1NUC A;  3HOY H;  1Q8K A;  4HSP A;  5C3X A;  2PZU A;  2UU9 L;  3CPW A;  4A3J B;  2NVQ H;  4IAL A;  3I8Z A;  1LTT D;  2CWA A;  1C0A A;  2PQA B;  3D31 A;  3GTP H;  2PZW A;  1CA5 A;  2L1B A;  1KNE A;  5CV9 A;  2CCZ A;  4RCO A;  1I4Q A;  1H9M A;  1N32 Q;  2K5H A;  1DCZ A;  2OQ0 A;  4A3B G;  1EWH A;  1N9W A;  3A56 A;  1VQ5 A;  1KHI A;  1F2Z A;  3U4V A;  3PUY A;  3RLO A;  4QB4 A;  2PQE A;  3WOF A;  2J7Z A;  4JI6 L;  2R7D A;  3ZJY C;  1ENC A;  3BVM A;  5FLX L;  2UUA L;  3OYY A;  3I73 A;  1SSO A;  3H3V C;  2BDO A;  2CKZ B;  3KDF A;  2JA8 B;  1B44 D;  4IPC A;  5C4J H;  4NDX A;  1Y8N B;  5FLX c;  3NTH A;  2EXZ A;  2CFM A;  1YIJ A;  4A3J G;  2WKC A;  1C48 A;  1CI3 M;  4MN3 A;  2K52 A;  1CM9 A;  2OTL A;  5C4Z A;  1F2L A;  5C3E H;  1K0R A;  1S5C D;  4YHH Q;  2D0P A;  1EY6 A;  1OXS C;  1PH1 A;  3TZD A;  2HIX A;  3OTO Q;  4DAV A;  1MJE A;  1QG7 A;  1FD7 D;  2Q2T A;  5T1I A;  4UPA A;  3VR5 A;  3M4Y A;  4LFA L;  1PH2 A;  3EA6 A;  5FJ8 H;  5BN3 A;  4RGT A;  3S2H H;  5I6W A;  1U0L A;  2RA4 A;  3NBH A;  4IUR A;  3STB C;  2IWH A;  2VQF L;  4A3D B;  4AIM A;  1WI5 A;  4DNT B;  2A5H A;  1C4Q A;  3NK9 A;  3WOE A;  2JA8 G;  3HFZ B;  3CU7 A;  1I94 L;  1GUN A;  2H1E A;  2RDF A;  3GO5 A;  3Q23 A;  2KCN A;  4A3C G;  1N36 Q;  1E0B A;  4PMW A;  5JJI A;  3DM3 A;  3KBG A;  2Z4I A;  5E4W C;  5E7N A;  5JEA G;  2OWO A;  1W6J A;  4GNX C;  1C9O A;  2B63 B;  3R3O A;  1K9M C;  3HKZ E;  2NVY B;  4B3M L;  2DNE A;  2E2D C;  3L3O C;  3R93 A;  1DZ1 A;  1S4Z A;  3A55 A;  3RNU A;  3T1Y L;  3ERQ A;  1SNQ A;  1UEB A;  1VF7 A;  4O0A A;  3TRE A;  1DXM A;  1ESR A;  4TVA B;  4LF5 Q;  4UAI A;  3A54 A;  2NTT A;  5FKA C;  2MO1 A;  2QDL A;  3KF6 B;  2L9H A;  3IFT A;  2X6L A;  3PUZ A;  3VR2 A;  2LXJ A;  4ME3 A;  4CKC A;  2B2W C;  2B2T C;  4A3D G;  3NTK A;  3HOU B;  1VQJ A;  5M5X B;  2EJM A;  2VUM H;  4IFD G;  3F2C A;  3F1Z A;  1KTK A;  3N6R A;  3M3Y H;  4UP8 A;  2NN6 H;  4FVM A;  1YJW A;  4RAU C;  2IJ0 A;  3MFY A;  4GN3 B;  1VQF A;  1Y8P B;  1E7Z A;  2JA9 A;  5E3F A;  1PH8 A;  1BBW A;  3OSO A;  2B63 G;  1SMY D;  2F0U A;  1A15 A;  2N78 A;  4AQY Q;  2OF1 A;  2B2Y A;  2F4V Q;  3KF8 A;  4X3K A;  2F0D A;  3K7A H;  1PRT F;  1Q1E A;  3TS2 A;  3TRZ A;  2GA4 B;  5CBA E;  2JA7 H;  2O2L D;  1M1K C;  2AQ1 B;  3NBI A;  4FDB A;  3S14 B;  1F9P A;  4TKO B;  4BBR B;  1LT4 D;  2N88 A;  3TS0 A;  1L1O B;  5IIF A;  3EN2 A;  4IUV A;  1LT5 D;  3HOU G;  2YYZ A;  4PZ8 A;  5FO9 B;  1JB7 A;  1FNW A;  2HDL A;  3B6Y A;  1Y14 B;  1YVC A;  1XMO L;  1GJX A;  3PUX A;  3CMA A;  1G8Z D;  2F0H A;  1FL0 A;  5IYB G;  5IY0 A;  1QJO A;  1EY9 A;  4K5W A;  4YIJ A;  1Z47 A;  4I7Z C;  3CME A;  1FR3 A;  2A69 C;  3CW2 C;  1DOK A;  2KCT A;  2I5M X;  2E74 C;  3MTS A;  1NY4 A;  2ID0 A;  4JV5 L;  3C46 A;  1N33 Q;  4BBR G;  4KN4 C;  2I07 B;  2SNM A;  1TS2 A;  3HGB A;  2ZM6 Q;  1U4R A;  1WTH A;  1K8A C;  4QIW B;  3GTQ B;  3HS0 C;  1BUV T;  4BA2 I;  4N8F A;  3TSS A;  2A68 D;  1QB5 D;  2AUJ D;  2TSS A;  2H4O A;  4BY7 B;  4IOC A;  1W2B A;  2EPB A;  4JI5 Q;  1WYD A;  1PH7 A;  3ERS X;  4TSS A;  1AFP A;  1X3F A;  2F4I A;  2VY3 A;  3J80 i;  3KJO A;  1IBM L;  3QOJ A;  3K59 A;  3SXH A;  2Z4H A;  3KOJ A;  3J80 c;  3AFP A;  3KLS A;  5KGU A;  4IUU A;  3S16 H;  4YWM A;  5J1Z A;  3K5N A;  1EIY B;  5M3M B;  1HJP A;  2RQX A;  3S9W A;  1M8A A;  3NTI A;  4J8Q A;  1RD9 D;  2F3W A;  1KNA A;  1BQQ T;  2DNC A;  2QGQ A;  2K5W A;  3K5O A;  1WCM H;  1AP0 A;  3L9A X;  4RGO S;  1TWH H;  3CD6 A;  3UI2 A;  3AEV A;  1DGS A;  5J39 A;  3EBE A;  1VQ6 A;  4BY7 G;  5LMU L;  4ALP A;  5I6Y A;  1XYI A;  4PNY A;  3ND8 A;  1BBU A;  4YHH L;  3HOZ H;  4DV5 Q;  4RGM A;  5AJ3 Q;  4WJ3 M;  4LF4 Q;  5EKI A;  1H9S A;  2X69 A;  4OON A;  5JJK A;  4A3G B;  1H95 A;  5DNF A;  4EQO A;  1IBK Q;  4PZ6 A;  2JSO A;  4HR7 B;  1VQE A;  2EDG A;  2EYL A;  3HOX H;  2NVT B;  3S15 B;  1J9O A;  2KOL A;  1K3B C;  4LJZ C;  1M90 C;  2F0P A;  5M3M G;  4MIU A;  2PZT A;  3KLR A;  1B2T A;  3K5M A;  1UEA B;  5DAU A;  2Z9H A;  4HIK A;  1OTC A;  1W6K A;  4P2C B;  1FGB D;  4IPD A;  4A3E H;  1N36 L;  5TSS A;  3MXP A;  3SGI A;  3E5S A;  1B9M A;  5DM7 3;  3BZK A;  1EYA A;  1PVO A;  1N34 Q;  2F0V A;  3GTO B;  1WTW A;  2ATW A;  1MGS A;  1HR0 Q;  1D7Q A;  3DEO A;  5IT9 c;  1VQK A;  1CKN B;  1KRT A;  4CDF C;  2UXD Q;  1Q3L A;  2K50 A;  5IOC A;  4LF5 L;  5D3D A;  3MHB A;  2DY8 A;  4A3K B;  4A3G G;  4LK1 C;  3HG9 A;  4ZK9 B;  3DWA A;  4X65 L;  4CKE A;  3CKI B;  4N9P A;  5DEH A;  1TWG H;  4YWK A;  1BKB A;  1Y8O B;  5C3W A;  1HNX Q;  2XSC A;  1SJH D;  1HUM A;  3GTG B;  2KHI A;  3QJY A;  2GVB A;  1Y1V B;  4DV4 Q;  4XTC S;  4BY1 B;  4KHP L;  4MZ9 A;  4DUY Q;  3QG1 A;  1XXG A;  2R7Z H;  3SHL A;  1QUQ A;  1XX8 A;  4DR4 Q;  2GVA A;  5LMN Q;  5CV6 A;  5JVG 3;  2R92 H;  1STB A;  4O2D A;  4DV0 Q;  4JBJ A;  4K8J A;  5EPK A;  4FO2 A;  4AQY L;  2NBF A;  3J80 E;  2KUM A;  3MXG A;  3E6Z X;  2E5L Q;  1TKW B;  1ET9 A;  1A6X A;  1GVP A;  3A74 A;  3OIQ A;  2JA6 H;  4APV A;  2EY5 A;  2IHF A;  4OIK A;  3W2D A;  4A3K G;  1Q7Y C;  2EYF A;  1HA6 A;  2NUC A;  3OWE B;  3OWF A;  1CZW A;  4RCN A;  3H3V H;  4RKB A;  3NUC A;  4IFD J;  1KAA A;  3DUZ A;  1ONL A;  5CYU A;  3FKI H;  2HCI A;  1LTG D;  1U4P A;  4A3F B;  1FVI A;  1Y1V G;  2EYM A;  2HD3 A;  1I4H A;  1O78 A;  1RTN A;  1AEX A;  4BY1 G;  5M5W B;  3CCM A;  2YU9 H;  1WTR A;  2B2Y C;  3Q22 A;  5C5M A;  5E4X A;  3W3A A;  4KV6 A;  3GTJ H;  3WWV A;  1SYF A;  3PGZ A;  4C1N I;  3RN2 A;  1CKN A;  1KL9 A;  1BBX C;  4HIO A;  2BA0 A;  1PHJ A;  3I4N B;  1PTO D;  1VQD A;  2EXD A;  1HZ9 A;  1M4V A;  1AE3 A;  4C3I B;  3J81 j;  1Q86 C;  3ULJ A;  4GNX A;  3MA2 B;  2B29 A;  2RF4 A;  2K1B A;  2QEJ C;  2B2U A;  1VQH A;  1IXR A;  4GKJ Q;  4LUO A;  2NB0 A;  3PO3 B;  4CJ1 B;  3I4M B;  1E3P A;  2D62 A;  2OTJ A;  4A3F G;  1YNJ C;  2R7F A;  2QEX A;  5IT9 E;  1L0W A;  2QCP X;  3AFQ A;  4ID6 A;  1Z9F A;  3H0G H;  4EVO A;  5COY A;  4DV7 Q;  2F1M A;  1D1I A;  3E9H A;  3QOL A;  2B2W A;  4AYB E;  4CDD C;  2QF7 A;  2DJF C;  3GTM H;  3I4N G;  1CUK A;  3H09 A;  3ER0 A;  1PZI D;  4C3J H;  4ZLT F;  5I2Y A;  3SEB A;  2PMZ B;  2BOS A;  2MFI A;  5D3I B;  2E8G A;  5BN4 A;  3CCR A;  4LF7 Q;  4C3I G;  4ODG A;  3CCQ A;  5ELN A;  1RDP D;  4I65 A;  2CHB D;  1IHZ A;  5EGT A;  2E2H B;  3HOV B;  2NVX B;  4IFD I;  3PO3 G;  1K83 H;  5A2Q E;  3I4M G;  3H15 A;  1BCP D;  1F2M A;  2MJ8 A;  3NHH A;  2BE5 C;  2D9U A;  4JC0 A;  2K5Q A;  1JT8 A;  1EFI D;  5IYC G;  3F2U A;  1JE5 A;  5GAH C;  1I6H H;  3P1H A;  4LF8 Q;  2CW0 D;  2WII B;  4KTA A;  2PI2 A;  1O7I A;  4HID A;  1BOS A;  5EBD A;  1NNX A;  1S5F D;  2K75 A;  5IOD A;  5AJ3 L;  3HOY B;  4DR2 Q;  2NVQ B;  5JJZ A;  1JCK B;  2HQL A;  1EUJ A;  1VQO A;  1UE7 A;  4RMF A;  4A3M H;  1B53 A;  2B8F A;  1EZ6 A;  1L1O C;  5I9P A;  1U9R A;  5GAD C;  4JI7 L;  1ZYR C;  2TMP A;  3HZX A;  1SNM A;  4P74 A;  3AQQ A;  2LKV A;  1NAP A;  5C4X H;  2QKI C;  3H6M A;  3CXC A;  3HOV G;  4GLA C;  4RH6 A;  1HPC A;  1WTQ A;  2I0Q A;  1PFS A;  2VW9 A;  2ZJQ A;  2F0I A;  5IYD H;  4GOP B;  3QWN A;  4OWW B;  1N34 L;  1VQG A;  1XPO A;  4BBS B;  3V2T A;  2AMC B;  4P75 A;  5C4J B;  4K0K Q;  3CCV A;  3HOY G;  4J1M A;  3S24 A;  1JC7 A;  4DKA C;  1PRT B;  3VR6 A;  4M1U B;  4N9T A;  4H0L C;  3A5Z B;  5DLQ E;  2N55 A;  4C56 C;  2K14 A;  3A7L A;  3PO2 B;  4RHS A;  3BG3 A;  3R2T A;  3A0J A;  4H02 A;  4QGU A;  2E2I H;  3S1N H;  2FHT A;  1YNN C;  4JI3 Q;  4QJF A;  1KXL A;  3GV6 A;  1I4X A;  4C1N K;  5IGC A;  4QQB X;  3BDL A;  2RBM A;  2SOB A;  4ME5 A;  4DV4 L;  1BO0 A;  2EY2 A;  4K14 A;  4DUY L;  2WAQ B;  4PZ7 A;  4HJA A;  1OXU A;  4UDU C;  3S1R B;  2K28 A;  4HCS A;  5LMN L;  2VZA A;  1H9J A;  3TP6 A;  4DV0 L;  2VB2 X;  1JOQ A;  4KLK A;  4BBS G;  2IHE A;  3BVZ A;  2KVM A;  1VS0 A;  2YTX A;  1R9T H;  1HZA A;  1ASY A;  4KHZ A;  2RSN A;  3MXN B;  1V1P A;  4IUT A;  4KY5 A;  5AFW A;  1J6Q A;  3G48 A;  3KFU A;  1K0S A;  4QMG A;  4ZKB B;  5C4H A;  1B3A A;  5IGD A;  2N8N A;  1VQC A;  1I4P A;  1Z6H A;  4IJL A;  3PO2 G;  2MUY A;  1L0Y B;  5I4D A;  4MNO A;  4GN4 B;  2NYZ D;  2B3G A;  2A6E D;  4TRD A;  1EU4 A;  2IT1 A;  4HAE A;  2F0S A;  4R9W A;  1FNV A;  2WAQ G;  1HHV A;  2A1A A;  2K7V A;  4LFB L;  1Q1B A;  1T5E A;  1XMQ Q;  5JJL A;  3VYT A;  5M3F H;  3U9O A;  1SBB B;  2KEE A;  2VUM B;  4DR3 Q;  3MAQ A;  1II3 A;  1HA5 A;  4B3R Q;  3M3Y B;  2SEB D;  4OO1 I;  1EOT A;  4DAP A;  1FJG Q;  2OXP A;  3MZ5 A;  4C2M H;  1QVF A;  4ZAI A;  2F03 A;  4O1N A;  1TT2 A;  4GZY C;  4XQQ A;  5EQ0 A;  2F3I A;  1KRS A;  2IW3 A;  3UDF A;  1SDF A;  3G71 A;  3CC4 A;  4GKJ L;  1Q90 A;  4B3T L;  4C3H B;  3K7A B;  2Z8L A;  4PMC A;  1A8V A;  2Z6B A;  3JC6 6;  3TN2 A;  3RZO B;  4A3B H;  1TII D;  1SRU A;  1JR0 D;  1TWF H;  2VB3 X;  2EJG C;  3JAM i;  1IBL L;  3GTK H;  1TXY A;  2RCN A;  2F0W A;  4MHE A;  2RKS A;  3JAM c;  2KJX A;  3CRK C;  2PQA A;  3BVG A;  2Q2U A;  1UE5 A;  3F2B A;  1PZJ D;  4Y7N B;  4KI0 A;  2VUM G;  2PO4 A;  4NXN Q;  1U5K A;  2A73 B;  4HJ7 A;  2AWN A;  1Q8I A;  5IWA L;  5HUR A;  3T53 B;  2B2U C;  4FXG C;  1VQA A;  2NN6 G;  4LF9 L;  2A19 A;  4A3J H;  1TWC B;  2K5N A;  1EWI A;  2WP8 J;  4DV2 Q;  1EOV A;  4IOA A;  1I4R A;  4DK3 C;  1NJI C;  5DM6 3;  1TWA H;  2PPB C;  1YEZ A;  4C3H G;  1EYC A;  3BDC A;  4DFA A;  1VQB A;  1MI2 A;  1AW7 A;  3MC0 B;  3VYS A;  2KHS A;  4JW0 A;  1HH2 P;  1E1T A;  4NXM Q;  4LF8 L;  5CV7 A;  1MJC A;  1V1Q A;  3I72 A;  4Q5V A;  4KHV A;  3MXU A;  1SFO H;  1WTX A;  5IGE A;  3PIP A;  3MEH A;  1EY8 A;  4DR2 L;  1I3Q B;  4R8I A;  2MGS A;  1TQO A;  4GN5 A;  1PRT D;  4FF3 A;  1SYC A;  4R4O A;  5ELO A;  1B4O A;  4ZUI A;  2A6H C;  3ERO A;  5IP7 H;  5FLM H;  3CCL A;  4G7O C;  1TR5 A;  2JA8 H;  1EY5 A;  1IW7 C;  5IGG A;  5H1S E; 
#chains in the Genus database with same CATH homology
 1VQE A;  2WAQ E;  2PNH A;  3K80 C;  4R4T A;  3HOX H;  4B3T Q;  4YY3 L;  3FHW A;  5C3E G;  2ALY B;  4P72 A;  2N3S A;  3A5U A;  2N49 A;  1HNZ L;  2WB1 G;  1M90 C;  5M3M G;  4R4I A;  2JE6 I;  1HZB A;  1IBL Q;  1OTC A;  1L2F A;  4HIK A;  3J7A 5;  3BZC A;  4A3M G;  4JI0 Q;  4JYA Q;  1UE6 A;  4IPD A;  2VQE L;  4A3E H;  1N36 L;  2CWP A;  4P73 A;  1I94 Q;  3SGI A;  4RG1 A;  5FJ8 G;  4JBW A;  1GO3 E;  3BZK A;  1JMC A;  4K0K L;  2WFW A;  2Z6K A;  4GOP A;  1PVO A;  4DUZ L;  1N34 Q;  2ATW A;  3PF5 A;  1HR0 Q;  1A63 A;  1PYB A;  4A76 A;  1D7Q A;  5IT9 c;  4DV3 L;  1VQK A;  1CKN B;  1KRT A;  1KQS A;  2UXD Q;  5EAY A;  4GKK L;  5IWA Q;  1OXT A;  2DGY A;  4LWC A;  4B3M Q;  1IBM Q;  4UP7 A;  4LF9 Q;  1KC8 C;  2NZO A;  2RHS B;  2K50 A;  3CCS A;  4DV1 L;  1G51 A;  5GRO A;  1CKO A;  3IRB A;  4LF5 L;  1LYL A;  3RN5 A;  4A3G G;  1SRO A;  5IYD G;  1SLJ A;  1SMX A;  5C0X I;  3CC7 A;  3S1M H;  1HNW Q;  1X54 A;  4X65 L;  4JI3 L;  4AYB G;  3G6E A;  2ZJP A;  4BA1 I;  2LXK A;  1J5E Q;  1XTD A;  1PA6 A;  2V1C C;  1TWG H;  4YWK A;  1BKB A;  1HNX Q;  4DPG A;  3LGJ A;  4BBS H;  4L5Q A;  1EIF A;  5M5W H;  3KF6 A;  3PUW A;  4JBM A;  2VNU D;  2B63 H;  1X9N A;  2KHI A;  2HHH L;  4JG2 A;  2MO0 A;  2NVY H;  2GVB A;  3AYH B;  3L2P A;  1OXX K;  4LFC L;  4XTC S;  4DV4 Q;  3RR5 A;  1OXV A;  4KHP L;  1N8R C;  4MZ9 A;  4DUY Q;  3CPF A;  1HR0 W;  2R7Z H;  3CQZ H;  4DR5 Q;  1QUQ A;  2VL6 A;  4DR4 Q;  2GVA A;  3UDX A;  5LMN Q;  4YCW A;  1KAW A;  1W3S A;  5LMU Q;  3TQY A;  1Q12 A;  2R92 H;  3PO2 H;  4O2D A;  4DV0 Q;  2YTY A;  4JBJ A;  1V43 A;  4DV7 L;  3T1H Q;  1GM5 A;  4X66 L;  4AQY L;  2YV5 A;  4C3I H;  1WCM G;  2RHQ B;  3KF8 B;  2E5L Q;  1N32 L;  1HZC A;  3K0X A;  1GVP A;  1IYJ B;  2UXC L;  4OXP A;  3PF4 A;  3A74 A;  2JA6 H;  4YWL A;  4APV A;  1EQQ A;  1Y1W G;  3I4M H;  3S1R H;  3PO3 H;  2IHF A;  2FXQ A;  4A3K G;  1Q7Y C;  2JEA I;  4OWT B;  2GN5 A;  4QIW E;  5IYC H;  4LF7 L;  1YNX A;  4YCU A;  1HNZ Q;  1PYS B;  3PV0 A;  5IP7 G;  5FLM G;  3W1G A;  1PH3 A;  3H3V H;  5BR8 L;  4JI4 L;  4IFD J;  3HOW H;  2EIF A;  5M5Y H;  3HKS A;  3FKI H;  5LMN W;  3H3V I;  3CAM A;  1P8L A;  3E9I A;  2VQE Q;  1FVI A;  4LF6 Q;  1L1O A;  4L5T A;  1Y1V G;  2ASB A;  1X3E A;  4BY1 G;  3CCM A;  1X55 A;  1XMQ L;  2UUC L;  2YU9 H;  4X6A H;  2JA7 G;  5K36 G;  1LM0 A;  1UE1 A;  1Q82 C;  4DR3 L;  4X62 Q;  1X6O A;  1QVC A;  3GTJ H;  3WWV A;  3PGZ A;  3RN2 A;  1CKN A;  1EFW A;  4B3S L;  3GD7 A;  3W5O A;  1KL9 A;  2VS1 A;  3M4P A;  4DR7 Q;  1T9H A;  4DV6 Q;  4BBR H;  4A3L H;  3CC2 A;  4B3R L;  2Y0S E;  4JI8 L;  2BA0 A;  4HIO A;  1PHJ A;  3K7U C;  4GLX A;  4DK6 C;  1CSQ A;  1E22 A;  1VQD A;  2EXD A;  1HZ9 A;  1VQP A;  1QZH A;  4DR6 L;  2BH8 A;  3K8A A;  3OTO L;  4X65 Q;  1XNQ Q;  1AE3 A;  2E2H H;  2NVX H;  1SE8 A;  1UWV A;  2JQO A;  3J81 j;  2ZTD A;  1Q86 C;  3ULJ A;  4JCV E;  4GNX A;  1QZG A;  1LTL A;  1NE3 A;  2B29 A;  1V9P A;  2RF4 A;  3HKZ G;  3L0O A;  5IP9 H;  1D8L A;  5GAE C;  1VQH A;  4A3C H;  2E2J H;  2Z6K C;  1IXR A;  4GOP C;  3NBH B;  3UE1 A;  4LUO A;  1I5F A;  2BA1 A;  5C0X G;  1XJV A;  4GKJ Q;  4OO1 G;  4JV5 Q;  1E3P A;  4LFC Q;  1X56 A;  2D62 A;  4IO9 A;  4KHP Q;  2OTJ A;  4A3F G;  4DAM A;  2R7F A;  2QEX A;  3HOY H;  1L0W A;  1Q8K A;  2JEB I;  3AFQ A;  3PSI A;  2UU9 L;  3M85 A;  3CPW A;  2KBN A;  2NVQ H;  1Z9F A;  5C44 G;  3H0G H;  2CWA A;  4L5S A;  4DV7 Q;  1C0A A;  2PQA B;  3D31 A;  3GTP H;  1NMG A;  3E9H A;  2XTI A;  2CCZ A;  4NXN L;  4AYB E;  3CF5 A;  4DNI A;  2K5H A;  4C3H H;  1ASZ A;  3U50 C;  1N32 Q;  3ULL A;  3CP0 A;  2R7Z G;  2OQ0 A;  4A3B G;  3UE0 A;  4UP9 A;  1N9W A;  2K5V A;  1VQ5 A;  3GTM H;  3I4N G;  1CUK A;  3RZO H;  3ER0 A;  2DUD A;  2R92 G;  1S40 A;  4X64 Q;  4C3J H;  2HT1 A;  1KHI A;  2AKW B;  4NB3 A;  1B70 B;  1SN8 A;  1PH4 A;  4A3D H;  3U58 A;  3U4V A;  4HIM A;  3PUY A;  3GTQ H;  2MFI A;  3RLO A;  1S72 A;  2E8G A;  3CCR A;  4LF7 Q;  2I5H A;  3CCQ A;  4JI6 L;  5ELN A;  1YHB A;  1A62 A;  4DR1 L;  2R7D A;  3M4O H;  4BY7 H;  4UY8 C;  3ZJY C;  4A93 G;  1P16 A;  4R4Q A;  1JJG A;  2UUA L;  1WFQ A;  3NEL A;  3OYY A;  4Y7N H;  2F52 A;  4IFD I;  3PO3 G;  1K83 H;  2CKZ B;  3KDF A;  4IPH A;  4IPC A;  3H15 A;  3I4M G;  1JT8 A;  5C4J H;  4JC0 A;  2I5L X;  5FLX c;  5IYC G;  2UUC Q;  1JE5 A;  4JI1 Q;  5GAH C;  1I6H H;  3L7Z C;  2Z0S A;  4LF8 Q;  2CFM A;  1YIJ A;  4A3J G;  2UXB Q;  2PI2 A;  3HOW G;  1O7I A;  4HID A;  2K52 A;  3FKI G;  2OTL A;  1TWC H;  2K75 A;  1I50 H;  5AJ3 L;  4POG A;  4DR2 Q;  1KIX A;  2BH2 A;  4JI2 Q;  5C3E H;  1EQR A;  4PG3 A;  3M9B A;  1K0R A;  1RL2 A;  4YHH Q;  2D0P A;  1E24 A;  3PUV A;  2HQL A;  1OXS C;  1EUJ A;  1PH1 A;  1XNR Q;  1VQO A;  2HIX A;  3OTO Q;  3K81 C;  1MJE A;  2QA4 A;  1UE7 A;  4RMF A;  2LSS A;  1A0I A;  4A3M H;  4P71 A;  2Q2T A;  2F4V L;  1L1O C;  4UPA A;  4A3I H;  3I2Z A;  2UUB Q;  4LFA L;  4OX9 Q;  1PH2 A;  5FJ8 H;  5GAD C;  3F8T A;  3HOU H;  4BXX G;  3S2H H;  4JI7 L;  5M5X H;  1U0L A;  5GAG C;  3HOZ G;  2R93 G;  4P74 A;  3VDY A;  3STB C;  3AQQ A;  4HJ8 A;  1I3Q H;  4YY3 Q;  2L15 A;  2VQF L;  4AIM A;  1WI5 A;  5C4X H;  4AH6 A;  3RLN A;  3CXC A;  4JI0 L;  4JYA L;  3HOV G;  4GLA C;  1FGU A;  3ULP A;  2JA8 G;  3HFZ B;  1NMF A;  1I94 L;  3OW2 A;  1EYG A;  3M7N A;  1NTG A;  5IYB H;  3GO5 A;  5IP9 G;  1CKM A;  1PFS A;  2VW9 A;  2I0Q A;  4JBK A;  2ZJQ A;  5IYD H;  4GOP B;  4A3C G;  1N36 Q;  2MNA A;  3HOX G;  4OWW B;  1N34 L;  4PMW A;  5JJI A;  1VQG A;  3DM3 A;  1XPO A;  2AHO B;  5JEA G;  5E7N A;  2OWO A;  2AMC B;  4P75 A;  3I7F A;  4GNX C;  1C9O A;  3CCV A;  4K0K Q;  1B7Y B;  3GTL H;  3S15 H;  4Y52 H;  4DUZ Q;  1QVG A;  1K9M C;  2ZTC A;  3HKZ E;  5HY6 A;  3S24 A;  3HOY G;  3ICE A;  1YHQ A;  4B3M L;  4DKA C;  4DV3 Q;  5C0X J;  3RNU A;  3T1Y L;  4GKK Q;  1C7Y A;  3S14 H;  4OWX B;  3A5Z B;  5DLQ E;  1UEB A;  4O0A A;  3TRE A;  4A3E G;  1Q81 C;  2EQS A;  2K14 A;  1HNW L;  4NPS A;  1S3O A;  4DV1 Q;  4TVA B;  2Q2H A;  1FJG L;  4LF5 Q;  1G6P A;  2WB1 E;  3A0J A;  4H02 A;  4QGU A;  2E2I H;  3GDE A;  3S1N H;  2MO1 A;  3KF6 B;  2AWO A;  4JI3 Q;  4QJF A;  1KXL A;  4GS3 A;  3PUZ A;  4QQB X;  1IL2 A;  2LXJ A;  4ME3 A;  2OCE A;  2YTV A;  4QL5 A;  1N33 L;  3S17 H;  4DV4 L;  1YHA A;  4A3D G;  2PI2 E;  1XPU A;  4DUY L;  1VQJ A;  2HHH Q;  4PZ7 A;  2ZM6 L;  3W1B A;  1QUQ B;  4HJA A;  1OXU A;  2VUM H;  5LMN L;  2VZA A;  1YBY A;  2JK8 A;  4IFD G;  3F2C A;  3S2D H;  3F1Z A;  1Y1W H;  4DV0 L;  3M3Y H;  3KYH C;  4UP8 A;  4DAY B;  4JOI A;  1YJW A;  2ZTE A;  4KLK A;  3I4O A;  4GN3 B;  1VQF A;  2JA9 A;  1E7Z A;  2IHE A;  2MQH A;  4POF A;  1PH8 A;  4BBS G;  1BBW A;  2NN6 I;  1VS0 A;  2B63 G;  1NBW A;  5IE8 A;  2YTX A;  4X66 Q;  2N78 A;  4AQY Q;  1R9T H;  1HZA A;  4R1J A;  1ASY A;  4JI5 L;  3GTG H;  4KHZ A;  2F4V Q;  3PIO A;  3MXN B;  1YJ9 A;  3PCO B;  3E0E A;  1J6Q A;  4LNQ A;  3G48 A;  1Y1V H;  4LFA Q;  3KFU A;  3K7A H;  1YZ6 A;  2A8V A;  2KEN A;  1Q1E A;  4BY1 H;  3TS2 A;  2Y0S G;  2IX0 A;  2UXC Q;  3TRZ A;  4JI7 Q;  4A4I A;  2N8N A;  1VQC A;  4LUV A;  2JA7 H;  4IJL A;  3U4Z A;  1M1K C;  3PO2 G;  1K8G A;  4L5R C;  4MNO A;  4FDB A;  1K3R A;  3G4S A;  1AH9 A;  2VQF Q;  4IJH A;  4GN4 B;  4DV2 L;  2B3G A;  4EX5 A;  3TS0 A;  1YIT A;  4LF6 L;  1L1O B;  1E1O A;  4A3I G;  3EN2 A;  5BR8 Q;  1PH5 A;  4JI4 Q;  3D0F A;  2IT1 A;  1IZ6 A;  4YCV A;  1X65 A;  1G29 1;  2YYZ A;  4PZ8 A;  3HOU G;  2JA6 G;  2WAQ G;  2JA5 H;  1GD7 A;  4NXM L;  1VQ8 A;  2A1A A;  3EIV A;  1JB7 A;  4LFB L;  1Q1B A;  3B6Y A;  1Y14 B;  4X62 L;  1XMQ Q;  1YVC A;  5JJL A;  5C4X G;  5M3F H;  5GQO A;  1XMO L;  1K73 C;  4DR7 L;  3J81 i;  4DV6 L;  2PMZ E;  2K4K A;  3PUX A;  4QY7 A;  3CMA A;  4DR3 Q;  1FL0 A;  5IYB G;  4B3S Q;  3T1Y Q;  4DV5 L;  5IY0 A;  3J81 c;  4B3R Q;  1PV4 A;  2HIV A;  4JI8 Q;  4OO1 I;  4LF4 L;  2D0O A;  1GKH A;  4A3F H;  1VQL A;  1XNQ L;  1Z47 A;  1FJG Q;  1VCI A;  1AE2 A;  1SR3 A;  3TEH B;  3UDI A;  4C2M H;  4XIG S;  5M3M H;  4GNX B;  3CME A;  3UDG A;  3CW2 C;  2ZJR A;  1QVF A;  5C44 H;  1IBK L;  4DR6 Q;  1KD1 C;  4MTN A;  2F3I A;  2KCT A;  1KRS A;  4GLV B;  1X3G A;  2I5M X;  3UDF A;  2R6G A;  3G71 A;  3RLF A;  3CC4 A;  2KCM A;  1B8A A;  1NY4 A;  4B3T L;  4GKJ L;  1MIU A;  3MEF A;  4A3L G;  1LUZ A;  2ID0 A;  1PH9 A;  4JV5 L;  1N33 Q;  5JEA J;  4BBR G;  3J7Z C;  1A8V A;  3CCJ A;  3JC6 6;  3STB D;  4A3B H;  2ZM6 Q;  3F2D A;  1SRU A;  2JJQ A;  3I4N H;  1Q46 A;  1TWF H;  2Q2I A;  3CCE A;  1K8A C;  1JJ2 A;  3JAM i;  1IBL L;  3GTK H;  1TXY A;  2RCN A;  2CQO A;  1VQM A;  1PH6 A;  2OQK A;  2UU9 Q;  4BA2 I;  4WJ4 A;  5J3B A;  3JAM c;  4IOC A;  1WOC A;  1MKH A;  5HGQ A;  4A3G H;  2XGT A;  2PQA A;  1W2B A;  2Q2U A;  4IPG A;  4A93 H;  2IY5 B;  1UE5 A;  3NEM A;  3F2B A;  3BJU A;  4JI5 Q;  4KI0 A;  2VUM G;  1WYD A;  1HR0 L;  4NXN Q;  4EQ5 A;  1U5K A;  1PH7 A;  4LW1 A;  3ERS X;  1JJC B;  2NVT H;  1CSP A;  4HJ7 A;  4X64 L;  2AWN A;  3S1Q H;  1X3F A;  2UXD L;  5IWA L;  2VY3 A;  3J80 i;  3KJO A;  1VQA A;  2NN6 G;  1IBM L;  4LF9 L;  4TQU S;  3H0G G;  2A19 A;  3KOJ A;  1VQN A;  4A3J H;  2WP8 J;  2K5N A;  1EWI A;  3AFP A;  3J80 c;  1VQ4 A;  3DLL A;  1BVS A;  4DV2 Q;  1EOV A;  4IOA A;  3FP9 A;  4DK3 C;  3S16 H;  1NJI C;  4YWM A;  3CCU A;  1VQ9 A;  1RIP A;  1TWA H;  3BU2 A;  1YEZ A;  1J5E L;  4JI6 Q;  4DR1 Q;  1EIY B;  4JOI C;  3KDF B;  1HJP A;  2IX1 A;  1HNX L;  4LUZ A;  1VQB A;  3NEN A;  2UUA Q;  3I55 A;  4HJ9 A;  4JI1 L;  3GTO H;  3I56 A;  1HH2 P;  1E1T A;  2QGQ A;  4NXM Q;  4LF8 L;  3RZD H;  2KHJ A;  1WCM H;  1MJC A;  1V1Q A;  4LFB Q;  1VQI A;  1TWH H;  4R4C A;  4A75 A;  2UXB L;  3CD6 A;  2C35 B;  1SFO H;  3AEV A;  3Q8D A;  1XMO Q;  3PIP A;  1YJN A;  1XPR A;  1DGS A;  2NZH A;  4DR5 L;  4BXX H;  2ES2 A;  4DR4 L;  4DR2 L;  3EBE A;  1VQ6 A;  4JI2 L;  4BY7 G;  3M4Q A;  5LMU L;  4ALP A;  4HJ5 A;  1BBU A;  4YHH L;  3HOZ H;  2R93 H;  4A3K H;  4DV5 Q;  3T1H L;  4GN5 A;  1XNR L;  2H5X A;  5AJ3 Q;  2JA5 G;  4R4O A;  5ELO A;  4WJ3 M;  4LF4 Q;  1VQ7 A;  3KLW A;  1WJJ A;  3HOV H;  4OON A;  5IP7 H;  4J15 A;  5FLM H;  3CCL A;  5JJK A;  2E5L L;  2JA8 H;  1H95 A;  5M3F G;  1IBK Q;  2UUB L;  4OX9 L;  3KJP A;  4PZ6 A;  1YI2 A;  5H1S E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...