4A3FH

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3fH00
3PUZA 2JJQA 2HHHQ 3T1YQ 2IT1A 4LF7Q 1N33L 5GAHC 3CCEA 1NY4A 3SGIA 5IP7H 3J80i 2K5NA 4X66Q 3Q8DA 1YHAA 5C3EG 4P72A 1VQMA 4A76A 3U4VA 3PUYA 3PSIA 4IO9A 2XGTA 4OO1I 3HOWH 4P75A 1DGSA 1Y1VH 2I5LX 1NTGA 2OQ0A 4LUOA 5M3MG 4HIDA 4X62Q 3S1NH 4P73A 1UE1A 5M3FG 3E9HA 4DR7L 3T1HL 4X66L 4JI7L 1N36Q 1E1OA 2B63H 2Z6KA 3EBEA 4GNXB 3GD7A 4DR3Q 2Q2IA 1PVOA 2MO1A 3KF8B 4OX9Q 1PYSB 3PO3G 3CC2A 3S17H 4XIGS 4OO1G 2VQEL 4DUZQ 4LUZA 3W5OA 1X3EA 5IYBH 2Q2HA 3PIOA 1XJVA 4A3LG 3H0GG 3TQYA 1QZGA 4IPGA 4ME3A 4P71A 4DK3C 1X3GA 2AWOA 3LGJA 2CWAA 4A3BH 3NENA 2R7ZH 1OXSC 1PH9A 1D8LA 4OX9L 4BXXH 4LFAQ 3M4OH 4TQUS 3BU2A 3FKIG 1X55A 3EIVA 2ZM6Q 1AE3A 1QVGA 4AYBG 4HJAA 3CD6A 4A3DG 4MTNA 4JBKA 4BY1G 3CCQA 2UUBQ 3DM3A 1HNZL 3IRBA 3S24A 2I5MX 1XNRQ 1E24A 2D0OA 1X65A 4NB3A 3UDIA 2RF4A 4OONA 3GTKH 5JJLA 4GN3B 1VQDA 2C35B 5IY0A 4A4IA 4B3SL 2VZAA 4A75A 3PF5A 2ZM6L 2JA8H 3GTLH 4A3MH 1OXTA 4A3IH 4UPAA 5IP9G 4JI0L 2ASBA 1E3PA 1JJ2A 3S14H 2K5VA 3S15H 1HNXL 4R4CA 3OTOL 1C9OA 3M3YH 4IPCA 3CQZH 2VUMG 3HOUG 4QL5A 1VQ6A 4GOPC 1X54A 4YCUA 2DUDA 5GAEC 1PH6A 3MEFA 1PA6A 4JBWA 2LXKA 2ATWA 4LFBQ 5ELOA 5H1SE 1HNWQ 4RG1A 1N32L 5LMUL 2PMZE 2RCNA 2CQOA 3CP0A 1SE8A 2PQAB 1JB7A 1XMOQ 1YHBA 3HOVH 3A5ZB 4GN4B 4LUVA 2CCZA 2Y0SG 1PYBA 1KRSA 4C3IH 2MNAA 2ZJPA 3CCJA 1GD7A 1U5KA 3CPWA 1H95A 1NE3A 4LFBL 2ZTCA 5JEAJ 3TRZA 3HKZE 1Q46A 1UEBA 4ALPA 4B3TQ 2WB1G 3ERSX 3D31A 1VQ9A 3S1MH 3M85A 3AFPA 3A5UA 4JV5L 3A74A 4EX5A 1G6PA 1LUZA 4JI8L 4OWTB 1SFOH 3M4QA 4JI1L 4AH6A 4QQBX 3TEHB 4DUYQ 4LFCQ 3HOZH 4X64L 3EN2A 1XNQL 3S2DH 4UP8A 1GKHA 4YHHQ 3RZOH 1CSQA 2YYZA 4B3TL 4R4TA 4R4IA 3J81i 3GTQH 3I4NG 2UU9Q 3K81C 1GM5A 2UXBQ 1VQ4A 4MNOA 1Y1WH 4YCVA 1WOCA 1WYDA 1MIUA 4A3KH 4DR6Q 4DV5Q 1HR0Q 4LFCL 1I5FA 1OTCA 1L1OA 1EFWA 3J7A5 2HIVA 1VQGA 1K8GA 2JEAI 1I94L 4YHHL 5M5WH 3AYHB 1FJGL 4JOIC 4BBSH 2R92G 4IJHA 3I4MG 1W2BA 2JA9A 3S1RH 1HNWL 1I6HH 5K36G 2E2IH 1E1TA 1SMXA 4A3EH 1LYLA 3RN2A 4DR6L 4DV5L 1KC8C 2B29A 3CCLA 3NELA 1ASYA 4K0KQ 3GO5A 2JE6I 1VQKA 1EUJA 2VL6A 1EIYB 1HZCA 2Y0SE 4P74A 5LMNQ 2JA6G 3HOUH 1EQRA 4IFDI 1PHJA 2AWNA 1VQJA 1N33Q 1K0RA 2F4VL 3E9IA 2ZTDA 3FHWA 4JI4Q 1MJCA 2WB1E 3UE1A 3L2PA 4Y7NH 1FVIA 3WWVA 1WCMH 4HJ9A 2PNHA 3ULPA 4APVA 1IXRA 3S16H 5C4XG 4DR5L 4DV2L 1PH1A 4GKJL 3M4PA 4IFDG 4OXPA 1CKNB 2LXJA 5GADC 1L2FA 3F2DA 2ZJQA 5FLXc 4JI4L 3UDGA 5IYDG 3HOWG 3PF4A 3I4OA 4TVAB 3PO2G 1SLJA 4BY7H 3CW2C 2HIXA 2CKZB 1CUKA 2KHIA 4X65L 3T1HQ 4DR7Q 1YITA 4JI7Q 3ULLA 2CWPA 2QEXA 4GKKL 1J5EL 2YTXA 2K5HA 2VQEQ 3G71A 1K83H 4A3GH 3UDXA 2NN6I 5C44H 1IL2A 3CCMA 1JMCA 4Y52H 2R93H 3KFUA 4JG2A 1FL0A 4LF9L 2A19A 3F2BA 4A3BG 3OYYA 1C0AA 1PH7A 1A63A 2NVQH 3CPFA 1KHIA 1S3OA 1I50H 3J80c 1Q7YC 2NN6G 3PUVA 2K4KA 1HNZQ 1VQCA 4C3HH 4DV6Q 2I0QA 3KJOA 4LNQA 1X9NA 3PUWA 4GOPA 3I55A 4GLXA 3CCRA 1N34Q 4B3SQ 3HKZG 5C3EH 4UY8C 1WI5A 2FXQA 2BH2A 2JA7H 4PZ7A 4DKAC 1A62A 2JA8G 3ICEA 3PUXA 1YJWA 4JI0Q 1Q82C 2JEBI 1VCIA 3HFZB 5M3MH 3J81j 4DV6L 2VQFQ 4BA1I 2Q2UA 1K3RA 1IYJB 1HNXQ 3OTOQ 2IHEA 3GTGH 5M3FH 2BH8A 3S2HH 1N34L 2JA5G 1KQSA 4A3JG 2N8NA 3UDFA 5JJIA 1HZBA 4JI6L 3S1QH 2UUCL 1Q8KA 3RLFA 2L15A 3PO3H 1HZ9A 1N32Q 4BBRH 4JI2Q 2VQFL 5LMUQ 1IBLQ 1S72A 1QVFA 2IX1A 1YJNA 4IOCA 2PI2E 5C4JH 3PCOB 4A3DH 1K9MC 4A3LH 3NBHB 3H0GH 1S40A 3KF6B 4POFA 1UE7A 1UE5A 1E7ZA 1BBWA 5IYCG 3F1ZA 2K14A 5C0XI 3KYHC 3AQQA 4GNXC 1Y14B 1IBLL 4JI2L 4DR4L 5FJ8G 4A93G 2Z6KC 5M5YH 4JV5Q 1LTLA 3BJUA 3HOXG 4JI8Q 3AEVA 4DV0Q 1HZAA 3OW2A 4FDBA 4IPDA 4R4QA 1FGUA 3PGZA 4JI1Q 4HIMA 1M90C 3D0FA 4BY1H 1BKBA 4QJFA 1EYGA 1YEZA 4X64Q 1XNQQ 1OXXK 4KLKA 5C0XG 1Q1BA 4R4OA 3BZCA 2JQOA 2UUAL 4GLAC 1NBWA 4YWLA 2RHQB 2I5HA 3MXNB 4DNIA 4LF4Q 1YVCA 5E7NA 2GVBA 4DV0L 1VS0A 5IP9H 4DV3Q 1P16A 2BA1A 1VQBA 4YCWA 1YI2A 4DR2L 4LF5L 1ASZA 2ZJRA 1AH9A 2PQAA 2R7FA 3KDFA 1I94Q 5JJKA 4LF4L 1FJGQ 1VQIA 2N78A 2RHSB 1Q12A 4DV1L 2KBNA 4EQ5A 2VUMH 1TWCH 3CAMA 1IZ6A 4JCVE 5ELNA 1XTDA 1PFSA 4DV3L 1Q1EA 2HQLA 3M7NA 1SN8A 4WJ4A 1UE6A 4DAMA 3ZJYC 1MJEA 4IPHA 2IHFA 1L1OB 4UP7A 3GTJH 4UP9A 3H3VI 1QUQA 4LF6L 2KENA 4PZ6A 1V9PA 1KRTA 1YHQA 2WP8J 3M9BA 2F4VQ 5AJ3L 4HIOA 1YIJA 5IT9c 3JAMi 2UXCL 1YJ9A 5IWAL 2IX0A 1WCMG 1XMQL 3B6YA 4DR5Q 1G51A 4DV2Q 2Q2TA 1T9HA 4LF8L 4GKJQ 2GVAA 3GTOH 2AHOB 5FLMG 3AFQA 4DV4L 2ES2A 1Q81C 1XPRA 2KCMA 1YNXA 2V1CC 1OXVA 1NMFA 5IP7G 3I4NH 4X65Q 1X56A 3BZKA 3HKSA 4HJ5A 4GKKQ 1X3FA 1J5EQ 3K8AA 3CXCA 1VQFA 2OWOA 2B3GA 4NXNL 4DV7L 4B3RL 1Y1VG 1AE2A 2QA4A 4A3GG 1SRUA 2R92H 2DGYA 1TWAH 4LF9Q 4WJ3M 4JBJA 4POGA 2QGQA 3I56A 3CCVA 2B63G 2UXDL 1A0IA 1NMGA 1CKOA 1K8AC 1Z9FA 1VQAA 4A3CH 3G6EA 1KD1C 3U58A 2E2HH 4IFDJ 4X6AH 1HH2P 4DR1L 2AMCB 3I7FA 4MZ9A 1K73C 4NXMQ 3GTMH 5IYBG 3KLWA 1L1OC 4QIWE 2NZHA 1HJPA 1CSPA 1MKHA 1I3QH 2ID0A 3G48A 3F8TA 3W1BA 4YY3L 2R7ZG 3DLLA 1XPUA 1HR0W 4JI5Q 4BXXG 4A3FH 3GTPH 4AQYQ 4JI3L 5BR8Q 5C4XH 4NXML 2E5LL 1JE5A 1W3SA 2JA7G 1BVSA 2GN5A 2N49A 1R9TH 3ULJA 2HHHL 3T1YL 5DLQE 4C3JH 4LF7L 3PO2H 5IYDH 4O0AA 4R1JA 1SR3A 3KJPA 2YV5A 2K50A 1V43A 4JI5L 1KXLA 4GOPB 3U4ZA 4AQYL 2F3IA 5BR8L 1NJIC 1X6OA 4GNXA 2K52A 2Z0SA 1CKMA 1KAWA 5LMNW 3PIPA 4A3MG 1GO3E 4PZ8A 4KHZA 4L5QA 4A3IG 5HY6A 2UUCQ 2CFMA 2E8GA 4JI6Q 1PH2A 4L5SA 4IJLA 2MO0A 4BBRG 1VQHA 4YWMA 1B8AA 3UE0A 4X62L 3KOJA 3PV0A 2NZOA 1IBKQ 5J3BA 1N36L 1N9WA 2YU9H 2NVXH 4OWXB 3RLOA 4DR3L 3TREA 5GQOA 4DR4Q 2N3SA 1KIXA 3CCUA 2E2JH 1V1QA 4DUZL 2WAQG 1YBYA 3G4SA 2OQKA 2R7DA 4B3MQ 1D7QA 2IY5B 3STBC 1IBKL 4NPSA 3HOVG 2D0PA 5IE8A 4BA2I 1EIFA 3FP9A 4L5TA 4DAYB 3L0OA 4HJ7A 4AIMA 2UUAQ 3FKIH 4LFAL 4O2DA 2NVTH 2PI2A 1M1KC 4B3ML 4JC0A 3CMAA 1PH3A 2YTYA 2UUBL 4LF5Q 4DR2Q 3JC66 4HJ8A 2EXDA 4JOIA 2VW9A 3HOZG 1JJCB 2AKWB 1XNRL 1RIPA 1G291 1A8VA 3KF6A 1WFQA 2JA5H 1U0LA 4RMFA 4DV1Q 1PH8A 4JYAL 1L0WA 4A3JH 1UWVA 2NVYH 2ALYB 1LM0A 2OCEA 3RR5A 1VQ7A 5GROA 3CCSA 1Y1WG 5JEAG 3U50C 5M5XH 4A3KG 1VQEA 3E0EA 4LWCA 4JYAQ 1JT8A 1GVPA 2F52A 2VS1A 3K80C 4GLVB 4YWKA 4DK6C 3KDFB 5C0XJ 1VQ5A 4LF6Q 2BA0A 2ZTEA 3A0JA 4GS3A 5IYCH 4BBSG 3CC4A 2VNUD 3W1GA 3HOYG 1EOVA 2KHJA 5AJ3Q 2KCTA 4QGUA 2R6GA 4A3EG 3TS2A 2UXCQ 4PG3A 1Z47A 2WAQE 5IWAQ 3GDEA 4HIKA 4A93H 1SROA 5FJ8H 2K75A 3CF5A 4J15A 1EWIA 1TWGH 3HOXH 5EAYA 4AYBE 3RZDH 1XMQQ 2OTLA 4L5RC 4LF8Q 3HOYH 1XMOL 4DV4Q 1QUQB 1QZHA 1B7YB 1TWHH 4OWWB 3RN5A 2MFIA 1VQLA 3K7UC 2HT1A 3RLNA 2YTVA 3J81c 2WFWA 2EQSA 3K0XA 1QVCA 3K7AH 3STBD 1TWFH 2A1AA 2JK8A 4DUYL 4KHPQ 1YZ6A 4NXNQ 4DV7Q 4KI0A 4H02A 4LW1A 1XPOA 3NEMA 4B3RQ 2A8VA 4PMWA 2VY3A 1WJJA 1N8RC 1KL9A 1VQPA 1PH4A 4BY7G 4C2MH 1J6QA 1O7IA 1IBMQ 2UU9L 1Q86C 3F2CA 1VQNA 2D62A 3VDYA 2UXBL 2UXDQ 3H15A 1PV4A 1VQOA 5GAGC 4KHPL 1HR0L 3ER0A 4A3CG 1B70B 1P8LA 3JAMc 3I2ZA 3J7ZC 4DR1Q 2MQHA 5C44G 4DPGA 1VQ8A 4JBMA 4GN5A 3I4MH 4IOAA 2LSSA 1IBML 1TXYA 5HGQA 3TS0A 2R93G 3CC7A 3L7ZC 2EIFA 4YY3Q 1E22A 1C7YA 2OTJA 1EQQA 3RNUA 4K0KL 1OXUA 4A3FG 4JI3Q 1BBUA 1PH5A 2XTIA 2H5XA 1JJGA 4XTCS 2JA6H 1RL2A 3H3VH 2E5LQ 5FLMH 5LMNL 1CKNA 3CMEA 4QY7A
chains in the Genus database with same CATH superfamily
2JJQA 5GAHC 1NY4A 1LO5D 4UHVA 2EJFC 3QIAA 3K59A 3QB3A 5CORA 1YHAA 5C3EG 2R92B 2LMCB 3P75A 4P72A 1VQMA 3I4MB 4IO9A 3NK9A 4OO1I 2HDLA 3IL8A 3OMCA 5CBAE 4X62Q 5EKKA 3GTMB 1E1OA 1AW7A 2Z6KA 3EBEA 1EYCA 1PVOA 2Q2IA 4OX9Q 1STYA 3S17H 4LUZA 3W5OA 3GTPB 1X3EA 4A3DG 1SSOA 1XJVA 4ME3A 4J8QA 5JOBA 3VR4A 2AWOA 4XQJA 2EYPA 1TS5A 4RKLA 1PH9A 1D8LA 1F2LA 1R9TB 4OX9L 3DMUA 1ET9A 1K8OA 1JOQA 3NBIA 3C1EA 3NTHA 3IRBA 4KY7A 1HNZL 4LAAA 4HEDA 3NTKA 4K6LA 4NB3A 1E2ZA 1SJHD 2EOTA 2RF4A 2DN8A 5JJLA 1X3QA 5IY0A 5KEEA 4B3SL 3KLSX 4A3IH 5IP9G 1ESRA 2K03A 4ZCKA 2NYZD 1E3PA 1EEID 4U68A 2NVXB 3S14H 1DM0B 2F0KA 3CQZH 4DXFA 2DUDA 4KY6A 1WTPA 3KUPA 1F9QA 2GA4B 2LXKA 3K5OA 5CMDA 1GUOA 4RG1A 1KDAA 5LMUL 3CP0A 3PIP3 1SE8A 1JB7A 3GTKB 5IGDA 3D3RA 4GN4B 2JA8B 2QEJC 1WD1A 3CPWA 1DOKA 4RA8A 1C48A 3MXNA 1Q46A 4CBVA 4B3TQ 4RKBA 3A5UA 3FPPA 1RTNA 1E2WA 4NP5A 2F0OA 4JI8L 1SFOH 4AH6A 4QQBX 1OO9B 1PTOH 2K28A 3M7GA 4DUYQ 3BS1A 4LFCQ 2A6HC 1XNQL 3C1FA 2I46A 4YHHQ 4B3TL 3GTQH 2AQ3B 3K81C 1FYCA 1MIUA 4DV5Q 4LFCL 3SK4A 1I5FA 3BDCA 2HIVA 4YHHL 1DYQA 5EJWA 1TWGB 1FJGL 3X3MA 3HOXB 3C3LA 4BBSH 4IJHA 3H91A 3S1RH 2SNMA 1F77A 2E2IH 4X3KA 4A3EH 1LYLA 3EFXD 4DV5L 2B29A 1O80A 5EKIA 1ASYA 3S2DB 4KKSA 1CFMA 1HZCA 2KCCA 5LMNQ 2F0UA 2J0TD 4KV6A 1VQJA 1N33Q 3FHWA 2AUKA 4JI4Q 3CRKC 2WB1E 3L2PA 4Y7NH 2CHBD 1IXRA 4K8JA 3I91A 5M5WB 4GKJL 5T1GA 1EEFD 2L12A 4IUVA 4IFDG 4OXPA 4PQXA 5GADC 1L2FA 3HOWG 4JI4L 3UDGA 3PO2G 1D5MC 1A63A 1SLJA 3E5SA 5ELBA 3EROA 1A3UA 3ULLA 4E6IA 2QEXA 2K5HA 2MGSA 2A6HD 4K8IA 4ZUJA 1IL2A 1WCMB 2EDGA 2ZXRA 3CCMA 1JMCA 4Y52H 4JG2A 4O1NA 1A3TA 2DJFC 2AQ2B 4A3BG 2RSOA 1DONA 1Q7YC 5FO9B 3K5NA 3SK5A 3T53B 4C3HH 4LNQA 2I0QA 5EBCA 2KA7A 1Y1VB 2VB2X 4A3GB 5C3EH 3ICEA 1I4PA 1WI5A 1A62A 1VCIA 3J81j 4UDUC 4BA1I 1LT3D 3OTOQ 4KD3A 2NVQB 4CDDC 4B9WA 1I50B 1PXUA 2AQ1B 3UDFA 2F0FA 5IGGA 1SBBB 5IODA 2R7ZB 1IBLQ 2IX1A 1WTRA 5C4JH 1SAPA 4A3DH 3NBHB 1S40A 5KNDA 2LS01 2N88A 3NUCA 1IBLL 1I4XA 1Y14B 4A93G 1KDCA 5FJ8G 4JV5Q 5EPKA 3BJUA 1HZAA 4IPDA 2F0SA 3HOYG 4RH6A 4JI1Q 3D0FA 4QJFA 1PFMA 4X64Q 1KDBA 1OXXK 3RUZA 1Q1BA 2QDLA 2JQOA 4LF4Q 4GLAC 1ESFA 1HXYD 5E7NA 2GVBA 1VS0A 4QB4A 5FOBB 5I2XA 5IP9H 4DV3Q 1VQBA 1R4QB 2RCFA 4YCWA 1AH9A 3MWYW 2R7FA 3KDFA 5JJKA 5KNCA 4HMJA 4EVOA 4LF4L 4HN7A 1A6XA 2K5WA 2I07B 3BDOA 2KBNA 2O5IC 1TT2A 1TWCH 4JCVE 5ELNA 1XTDA 4DV3L 1S5ED 1DXMA 4MN3A 4WJ4A 2A74C 1HFNA 1MJEA 5EPJA 2DJGC 1L1OB 1EU3A 2F3VA 3BYTB 4RWSC 5C6AA 4HSPA 1YHQA 2F4VQ 4CDCC 4DN4M 1STHA 3I70A 5IT9c 4Q5VA 2G9DA 2KCNA 2IX0A 3T13A 1IKLA 2KCMA 3P20A 1YNXA 1JQYD 2M2LA 2FHTA 3X3NA 4X65Q 3NQTA 1CK1A 3BZKA 4HJ5A 3IFTA 1X3FA 4ZYSA 1A2TA 3K8AA 3VYSA 3CXCA 2OWOA 2B3GA 3DXJC 1TS4A 3OWFA 1SRUA 3SHLA 2B2YC 2DGYA 1SE3A 2B63G 2UXDL 1JICA 3TBIB 1CQFA 1NMGA 1SYFA 1Z9FA 1B3AA 1VQAA 3U58A 4KK7A 3DUZA 2LY7A 1HQRD 1WD0A 5IYBG 1HJPA 2CH4W 3VYTA 3OMGA 1CSPA 4XT3B 4S3SA 3G48A 4RFBA 1Q90A 3QJYA 2HUGA 4R8IA 3DLLA 3DEPA 1XPUA 1PTOC 3HEJA 4AQYQ 3DM1A 4JI3L 1FD7D 1W3SA 2JA7G 1TWAB 4IFDH 4ZAIA 4I7ZC 3NPPA 4K6DA 3PO2H 1SR3A 2E2HB 1KXLA 1LLRD 4AQYL 4R8NA 1X6OA 3WDNA 2K52A 2Z0SA 4LK1C 1KAWA 5DNFA 5IIFA 5LMNW 4A3MG 4JI6Q 5HY6A 1S5FD 1PH2A 2G9HD 1ZYRC 2A69C 2MO0A 4BBRG 3IKJA 2NZOA 5DEHA 3NQIA 5J3BA 3T51B 4ZK9B 1PTOF 4DR4Q 4KN7C 1YBYA 3A8KE 3G4SA 1PRTF 2R7DA 4B3MQ 1G91A 3HOVG 1I4GA 2D0PA 1LTGD 5DM73 2A6EC 4C3IG 4DAYB 4L5TA 2PQEA 1D5XC 4AIMA 2NVTH 2PI2A 1VMPA 4B3ML 2SNSA 2F0HA 1EY0A 2YTYA 2K5DA 4LF5Q 1ZKOA 5JPMC 4DR2Q 2EXDA 4TRDA 5ISRA 3NHHA 2FINB 2E2JB 1PTOD 1L0WA 1ENFA 1VQ7A 2ALYB 1STBA 2OCEA 4DXGA 5JEAG 3U50C 1PRTD 4A3KG 1VQEA 3MTSA 3T4AC 2BOSA 4YWKA 3FKIB 4C1NI 2QF7A 3SE0A 5M5YB 5D3DA 4AYBB 4CDEC 5JVG3 1EOVA 2KHJA 1NNXA 2UXCQ 2WAQE 4HIKA 4A93H 5FJ8H 1EWIA 2NB0A 1ZYRD 5EAYA 2A69D 4L5RC 3HOYH 3P7JA 1IHZA 1DZ1A 3ITPA 5M5XB 2MFIA 3FDTA 2RQXA 3LX0A 3OW7A 2AUJD 3HOUB 1CZWA 3K7AH 2WKDA 1TWFH 1I4HA 2A68D 2JK8A 1YZ6A 1XPOA 4H02A 4LW1A 2F03A 1CM9A 1VQPA 2L1BA 2UU9L 2KUMA 1YNJC 1EFID 1H9MA 1VQOA 5GAGC 3W2DA 1GUSA 4ZKCB 1HR0L 4JVZA 2Z4HA 1P8LA 1HCZA 2WB1B 4DPGA 3GQBA 1EZ8A 4JBMA 1QNUA 4DNTB 4IOAA 1TXYA 3OSOA 5HGQA 3TS0A 1C7YA 3QG1A 2RDFA 3O13A 4RHRA 4L63B 1PH5A 2XTIA 3W3AA 1JJGA 4XTCS 2KJXA 1RL2A 2JA6H 4C2MB 2B2TC 1SMYC 2ZXOA 3PUZA 2HHHQ 3T1YQ 3J80i 3SR1A 2K5NA 3FMCA 5COYA 2F4IA 4P2CB 4A76A 3MAQA 2B8FA 2XGTA 5A2QE 1DGSA 4HIDA 1L0YB 3ERQA 4P73A 1UE1A 3T1HL 4JI7L 1N36Q 1HA5A 5IT9E 4K2KA 2B63H 4DF7A 1ONLA 4KTAA 3PO3G 4XIGS 4DUZQ 5IYBH 2Q2HA 3H0GG 3TQYA 5NUCA 5CV7A 3KBXA 4P71A 4DK3C 2KEDA 1H9KA 1YNJD 3NENA 5L37A 1Y8OB 4C3JB 4LFAQ 3M4OH 4TQUS 3BU2A 4KHVA 1JWUD 3EIVA 1A3VA 1QVGA 4HJAA 5I6WA 4MTNA 1UNSA 4BY1G 1D6EC 3DM3A 3TP6A 2UUBQ 3S24A 1XNRQ 4H7BA 2F0JA 3S17B 4OGQC 1JR0D 1VQDA 2C35B 4A4IA 4A75A 4A3MH 2E2DC 2DY7A 2ASBA 2B2UC 2YU9B 1SMYD 4H0LC 1HNXL 4R4CA 3M3YH 2VUMG 1SNDA 1VQ6A 4ODGA 1X54A 3MEFA 3K57A 2BDNA 4JBWA 4LFBQ 5ELOA 1HNWQ 1N32L 2PMZE 2PYKA 1XMOQ 3WOEA 1KLGD 3HOVH 4LUVA 4IZ8A 4C3IH 5A2QL 2C9OA 1U4RA 2MNAA 1SE2A 4LFBL 1STNA 4XQQA 1UEBA 5CYUA 3S14B 1LTAD 3S1MH 2JA5B 5CBEE 1SYBA 2B2WA 4OWTB 4A3JB 4G7OC 2NVYB 2EXZA 3LWUA 3IAYA 3EN2A 4OIJA 3RZOH 4C56C 1Z6HA 1QE6A 1Q3LA 1VQ4A 2BE5C 4K14A 4YCVA 1SEBD 2XRSD 4A3KH 4RHSA 1OTCA 1L1OA 3NP8A 1K8GA 1I94L 5T1IA 3AYHB 3SK8A 3NSWA 2R92G 3I4MG 5C3WA 1SFOB 1I6HH 5K36G 1E1TA 1SMXA 4M8AA 1S5BD 4KMUC 2JE6I 1PRTB 2Y0SE 3MXGA 3GTQB 5CV5A 4EQPA 1EWCA 3N6RA 1MJCA 3UE1A 3WWVA 1KABA 3UI2A 3SEBA 4DR5L 4DV2L 5AFWA 4BBSB 3TP5A 5HGTA 2E2IB 2LXJA 5IYDG 3PF4A 3I4OA 3BVGA 5DM63 2HIXA 2KHIA 1BOSA 5IGFA 5EPLA 4L8JA 1J5EL 1STAA 1K83H 3SDZA 2NN6I 3E3XA 4Y7NB 3EVQA 4HCSA 1FL0A 4IUUA 4LF9L 1EYDA 1EY7A 3URYA 2JXMB 3F2BA 2BE5D 4PMBA 3OYYA 1LV9A 1BF4A 1PH7A 2IPKD 2PW5A 4QMGA 1HFGA 1HNZQ 4CKBA 3L3OC 4OEMB 2PCFB 3PUWA 3MA2B 1MSGA 1VMCA 1N34Q 4B3SQ 3HKZG 1LT4D 4UY8C 3S1NB 2JA8G 4PZ7A 3ND8A 3PUXA 2ZXPA 2JEBI 3K0YA 2O5JC 1LT5D 2F0MA 2VQFQ 3HS0C 2IHEA 3S2HH 2BH8A 2DNCA 1N34L 1KQSA 2ICEC 3V2TA 2N8NA 1D2BA 1CA6A 3H6MA 2CH4A 2EYJA 2UUCL 3PO3H 2L15A 4C3HB 1K0SA 5LMUQ 2VQFL 1YJNA 4IOCA 3PCOB 1K9MC 4BWGB 3H0GH 3MXUA 4POFA 1E7ZA 4DAYA 5C0XI 5D3IB 1CZGA 1EIGA 3AQQA 1JC7A 4TSSA 2Z6KC 3MC0B 3TSSA 3HOXG 3D8GA 4JI8Q 4DV0Q 3OW2A 5ELCA 1FGUA 1WTWA 4BY1H 4HR7B 1BKBA 3WOFA 1XNQQ 3PIO3 3BZCA 4IN3A 4MIUA 4F88A 3AU7A 1YVCA 4DV0L 2D5DA 2PZWA 3HGBA 2KQ3A 2XNAC 4QCLA 2L11A 2WAQB 1FJGQ 2VUMH 4DA2A 1Q12A 4ID6A 1IZ6A 1FGBD 2LFNA 2HQLA 1SN8A 4DK0A 3QOLA 3ZJYC 2IHFA 1TVXA 1JB3A 2XIWA 4LF6L 4PZ6A 1V9PA 3M9BA 2P5ZX 3HOZB 5LL6X 3JAMi 5IWAL 1WCMG 1T9HA 4GKJQ 2SDFA 4JPBW 3GTOH 1TWCB 4CJ2C 4WFN3 3AFQA 4DV4L 3L9AX 1XPRA 1Q81C 3A55A 2QCPX 5CV6A 1S5DD 1OXVA 2XVSA 2F0TA 2PW7A 3RD4A 1X56A 2VB3X 2N55A 4NXNL 1F9SA 1BDOA 2HCCA 5D14A 1Y1VG 3TP7A 3Q24A 1AE2A 4FXDA 4A3GG 2R92H 5KYLA 4POGA 5J1ZA 3CCVA 5E1FA 1A0IA 1K8AC 1CKOA 1K8MA 2FMMA 4DR1L 1PMRA 1Y8NB 4NXMQ 3GTMH 4QIWE 1B2TA 3FRPB 1I3QH 2ID0A 2R7ZG 1TIID 4BXXG 4A3FH 3GTPH 4OHJA 5JAVA 4BY7B 2L55A 1U9RA 4NXML 2E5LL 1KNEA 1BVSA 2GN5A 2EY6A 2N49A 1R9TH 4LF7L 5IYDH 1ET6A 4O0AA 4R1JA 5C4ZA 1UAPA 1TR5A 1V43A 2K50A 3U4ZA 5C44B 1NJIC 2R93B 3PIPA 4KHZA 4IUQA 4BS9A 2NBFA 2E8GA 5ELDA 4XQNA 4L5SA 1HQMC 1D1KA 5CR3A 1B8AA 1II3A 1IBKQ 4L6TB 1N9WA 5CV8A 2NVXH 3RLOA 4DR3L 5GQOA 4ILWA 1KIXA 1XX8A 3KLSA 5K5PA 2XSCA 1IBKL 4NPSA 5IOCA 4IUPA 1EIFA 3FP9A 4PV1C 2BDOA 1IW7C 3E6ZX 2RDHA 4O2DA 3GTGB 1M1KC 2PPBC 5M3FB 3CMAA 2ENBA 3A7LA 5LHY1 1G6ZA 2KOLA 1C8CA 1EU4A 2MJ8A 4H13C 1NCVA 4JOIA 1JJCB 5DAUA 1RIPA 1G291 2PMZB 1XWEA 3CCSA 1Y1WG 2F0PA 3I90A 3VR5A 2K01A 4PNYA 1SNMA 4LWCA 4JYAQ 2K6AA 4GLVB 5KIXA 1SXTA 4DFAA 5C0XJ 2BA0A 2ZTEA 2NVTB 1LTTD 2EYHA 3CC4A 3OPOA 1SROA 4JYAL 1TWGH 3HOXH 3RZDH 1AN8A 2HDMA 1B7YB 3ND9A 2HT1A 1VF7A 4XDXA 2A73B 1TQOA 2EQSA 1QVCA 2PZTA 4KHPQ 4M1UB 4U673 1NSNS 1FR3A 2VY3A 1WJJA 1IW7D 3VDYA 2UXBL 1TY0A 3I72A 2UXDQ 2Y0SB 1QB5D 2B2VA 4KHPL 4ZUIA 5IGCA 4A3CG 1B70B 1F9RA 3EJIA 2H4OA 1VQ8A 4GN5A 2Q8TA 2LSSA 1IKMA 3K7AB 1E22A 3GV3A 4X3SA 1ILPA 2OTJA 3GP7A 4K0KL 4H44C 3R3OA 4JI3Q 3I4NB 2K05A 3H3VH 1ICWA 3QWNA 4ZRZA 3NWTA 5I9PA 1U4PA 3Q0AA 1EQTA 3U4VA 3PUYA 3HOWH 4P75A 2OQ0A 1Y1VH 2I5LX 1NTGA 3HZXA 4LUOA 5M3MG 2NTTA 4DR7L 3E9HA 2JA6B 3ONAB 3GD7A 1LT6D 3VR6A 4OO1G 1I4QA 3CC2A 1G2TA 2VQEL 3J81E 2JYOA 4A3LG 5C4XB 3N52A 1QZGA 4IPGA 5LL6S 4KY5A 4A3BH 2R7ZH 1OXSC 4BXXH 1JCKB 1R4PB 5HURA 2F0EA 3FKIG 4N9TA 1B1ZA 1X55A 2X6LA 1AE3A 2OXPA 4AYBG 2JSOA 3CD6A 3OOCA 5J39A 3CCQA 1WTVA 4XXEA 3V05A 2D0OA 3UDIA 2E75C 4OONA 4GN3B 3PF5A 3CHBD 3GTLH 4NMZA 3VA5A 1OXTA 4UPAA 4JI0L 1STEA 1CTMA 1K3BC 1JJ2A 1QG7A 2EJMA 4IPCA 3HOUG 4ZLTF 2DNEA 4GOPC 4YCUA 5GAEC 3BVZA 1PA6A 4KJOA 5H1SE 2M9VA 2KHSA 2QILA 2RCNA 2QW7A 1YHBA 1M4VA 2NUCA 3A5ZB 2SEBD 1XXGA 1KRSA 4CJ1B 4A3MB 2ZJPA 2PNRC 3U9SA 2ZTCA 3HKZE 3TN2A 4ALPA 1DJRD 2WB1G 3AFPA 1RKNA 3K6OA 4B08A 3TEHB 1CA5A 3J81L 1CT1D 1EIHA 4UP8A 3Q23A 1CSQA 2YYZA 4R4IA 2PO4A 2UU9Q 1BQQT 4RGTA 3J7YW 3HRZC 1Y1WH 1WOCA 3HOVB 3GV6A 1HR0Q 2B2TA 2A6ED 3J7A5 1HPCA 1BUVT 3S15B 2EYOA 2JA9A 1KC8C 3VR3A 3CCLA 3NELA 2WIIB 1VDZA 3DHQA 2VL6A 1AZPA 1EIYB 1VQKA 4TKOB 4I7AA 4P74A 1LTBD 4IFDI 1LABA 4CJ0B 1K0RA 4A3KB 3E9IA 2ZTDA 1M8AA 2OEOA 1FVIA 4K5WA 4QUCA 3S16H 2RKSA 1PH1A 3U9OA 5I6YA 2Z6BA 3M4PA 4V0BA 3M4YA 4FF2A 4K5VA 5I4DA 1CKNB 2ZJQA 3F2DA 4C3JG 4TVAB 1MGSA 3CW2C 2LKVA 1CUKA 3T1HQ 2F0GA 2EJGC 4IQZA 4JI7Q 2CWPA 4GKKL 1VF5C 4QIWB 2FFKB 3G71A 2O2LD 1O7YA 4KJNA 1IL8A 4FF1A 1ZXTA 3I73A 3TZDA 1F9PA 1RODA 1C0AA 3CU7A 4ULLA 1HA6A 1S3OA 2B2UA 5EGTA 1HRJA 3PUVA 2K4KA 1VQCA 4DV6Q 5BN3A 3TMEA 2K04A 3I55A 5EKLA 3CCRA 2FXQA 3P1HA 2BH2A 1PZJD 2JA7H 4DKAC 5I2YA 1F2ZA 1Q82C 3D6WA 1SDFA 1B50A 3HFZB 4OELB 5M3MH 4DV6L 2Q2UA 1K3RA 1IYJB 1HNXQ 3SVMA 4QF4A 2JA5G 3H09A 4IUNA 2TMPA 4A3JG 5JJIA 1EY9A 3S1QH 1Q8KA 3D6CA 3RLFA 4OO1H 1N32Q 5BN4A 4BBRH 4JI2Q 1QVFA 5E4XA 1Y69U 4A3LH 1UE7A 1UE5A 1BBWA 5IYCG 1CI3M 5FLXE 2A5HA 3H3VC 1V1OA 4GNXC 3A8JE 4JI2L 1G8ZD 5M5YH 2D2CC 1BNZA 1A2UA 4R4QA 1M90C 3PGZA 3KBGA 4HIMA 1BR9A 4DAVA 1EYGA 1S4ZA 1YEZA 4A3IB 4KLKA 4FF3A 2HQEA 4IURA 3BYYB 4FP5D 4DNIA 1NBWA 4YWLA 2RHQB 2UUAL 3MEHA 3CQZB 1T5EA 4ME5A 3H0GB 3FVQA 1SE4A 1P16A 2WV6D 2BA1A 3G7LA 2ZJRA 1ASZA 2WKCA 2PQAA 1Y8PB 2FMCA 3QO2A 1I94Q 3HOUH 1SNQA 4DV1L 4EQ5A 1MSHA 4F8MA 5JEAH 4BY1B 1PFSA 1NR2A 2WINB 1Q1EA 1EYAA 1SYEA 1V1PA 4CHTB 4FYDA 4KD4A 1EWHA 3GTJH 4UP9A 2R3ZA 1KRTA 2WP8J 1K28A 5AJ3L 1EOTA 1ENAA 1PTOB 3R2IA 1YJ9A 2XWJB 1XMQL 3B6YA 4DR5Q 1G51A 4DV2Q 2Q2TA 4LF8L 2VUMB 5JPNC 2AHOB 5FLMG 1RJTA 2ES2A 1RD9D 1RTOA 4CKEA 1EY6A 3LWEA 1GHJA 5IP7G 1W6KA 2XRQD 4DAPA 1E2VA 4RGMA 5FLXL 4QUFA 3TP8A 3A54A 3HKSA 3S1RB 2L0CA 2E74C 1J5EQ 1PDQA 1VQFA 4O42A 4A3EB 4DV7L 4B3RL 4K2LA 2F1MA 1GHKA 5J22A 1BCPC 4LF9Q 4WJ3M 1CHQD 1BO0A 3GTOB 5FKAC 1SJED 1KD1C 4ZKBB 4IFDJ 4X6AH 3I7FA 2EY2A 3KLWA 1L1OC 2XWBB 2OF1A 2NZHA 2EYLA 3J80L 4YY3L 3F8TA 4C3HG 2E76C 1HR0W 4JI5Q 4RCOA 1TY2A 1B3QA 5BR8Q 1CHPD 1H9JA 5C5LA 4C3JH 4J6HA 2HD3A 3KJPA 2YV5A 4JI5L 4GOPB 1BCPF 2F3IA 5BR8L 1RCVD 1CKMA 3LNNA 1AFPA 1GO3E 4L5QA 2UUCQ 2CFMA 1I3QB 5KNBA 2EE1A 4IJLA 1KLUD 1VQHA 4A3FB 4HAEA 1PLFA 4X62L 1FNUA 4PMCA 5IGBA 1E0BA 2YU9H 1MI2A 3HP3A 4OWXB 3I8ZA 2N3SA 1HTPA 2VXWA 3CCUA 2WAQG 1D7QA 1GJXA 3H94A 1LTRD 1HUNA 5C3EB 5IE8A 3CKIB 1BCPD 4FO2A 1SYCA 1L0XB 3L0OA 2RVLA 3RMHA 4DK1A 2NTSA 1DOLA 3MXPA 4JC0A 1XYIA 3V96A 3EA6A 1ML0D 5M9OA 3JC66 3E0JA 1A15A 1GUNA 4XYQA 3HOZG 2AKWB 5KRUA 1A8VA 3KF6A 1WFQA 4C1NK 1U0LA 1PH8A 3VR2A 1I4RA 5C4JB 4A3JH 2JA5H 4A3DB 1UWVA 2MUYA 2NVYH 1LM0A 3RR5A 1S5CD 5GROA 3DWQA 3E0EA 4V190 2Z9HA 1XTCD 1JT8A 1PZKD 2F52A 1VQ5A 2F0WA 4DK6C 2IX3A 4LF6Q 3HKZB 4GS3A 5IYCH 4QY7A 5F2DA 4PG3A 1Z47A 5IWAQ 3GDEA 4J15A 2OTLA 4AYBE 5EBDA 1J8IA 3J7AV 4DV4Q 1QUQB 1TWHH 4WJWA 4F87A 2V4DA 3RN5A 4K5XA 1T5XD 3K7UC 1QNKA 3VYRA 2YTVA 3J81c 4FNFA 3AMUA 4DUYL 4NXNQ 4J1MA 5CV4A 5A35A 2F0NA 4IUTA 4PMWA 2A8VA 4BY7G 1N8RC 1KL9A 2SOBA 1J6QA 3RZDB 1Q86C 3F2CA 1HHVA 2EY5A 1FNVA 1GXDC 3I2ZA 4DR1Q 2MQHA 5C44G 3I4MH 5G3LF 5K36H 2L4NA 2R93G 1NUCA 1TU2B 3RNUA 1EL0A 1OXUA 4FVMA 4X3UA 1BBUA 1KAAA 2H5XA 4EQNA 2E5LQ 1IYUA 5FLMH 5LMNL 1CKNA 4LF7Q 2IT1A 1N33L 1WVLA 3Q6SA 3CCEA 3OWEB 3SGIA 2BCOA 1QOHA 5IP7H 3MFYA 4X66Q 3Q8DA 3DEOA 3PSIA 1IYVA 1ILQA 5G3LD 2JP1A 4RGOS 3S1NH 5M3FG 4CDFC 3FPUB 2IWHA 4X66L 3T16A 4GNXB 4DR3Q 1JWMD 2MO1A 3KF8B 1PYSB 4IALA 3D4WA 3PIOA 1ZEQX 4WORA 1X3GA 3F2UA 3LGJA 4N9PA 2CWAA 1AEXA 3HOWB 4KKTA 3PO2B 2CVRA 2X6GA 1ICFB 4ABNA 2KECA 1D1IA 2ZM6Q 1LTSD 2KEEA 4JBKA 1B9NA 3JAME 2I5MX 1E24A 1X65A 3QOJA 3GTKH 2JA8H 2VZAA 3KLRA 2ZM6L 3MFGA 3KK7A 1RF2D 3DWAA 1B44D 4A3BB 2K5VA 3OTOL 1C9OA 1D5ZC 1H9SB 4QL5A 2R61A 1PH6A 1TS3A 1O7ZA 2D9UA 2ATWA 5C3XA 4FXKC 1LTID 3SXHA 1F2MA 1Q8IA 2CQOA 2PQAB 1W6JA 3GTLB 1LACA 2CCZA 2Y0SG 1PYBA 1TKWB 3VYUA 3CCJA 1GD7A 1U5KA 4FF4A 1H95A 1NE3A 1WTXA 5JEAJ 3TRZA 2HCIA 1VQ9A 3ERSX 3D31A 1V1PB 1X32A 3M85A 4JV5L 3A74A 4EX5A 1G6PA 1LUZA 3M4QA 4JI1L 2G5DA 3HOZH 4X64L 2B2YA 1DOMA 4F7XA 1GUWA 2J4XA 3MHBA 3S2DH 1GKHA 1JE4A 1SYDA 2B39A 1BCPB 4R4TA 3J81i 1V8QA 3I4NG 4R9WA 1GM5A 2UXBQ 4MNOA 1WYDA 1B53A 4DR6Q 1QWYA 5I9OA 1YNNC 1EFWA 3MVVA 3HG9A 1VQGA 2JEAI 4A93B 1EZ6A 5M5WH 4Z9CB 5E3FA 4JOIC 1W2BA 2F0QA 3JAML 3HOYB 3MZ5A 4DR6L 3QR8A 3RN2A 3PQIA 4K0KQ 3GO5A 2MPMA 1EUJA 1O7LA 2JA6G 1EQRA 1UEAB 1PHJA 2AWNA 4YIJA 5D65A 1Y1WB 2F4VL 1NAPA 3BDLA 1TWFB 3A7AB 4HJ9A 1WCMH 3ULPA 2PNHA 4KKUA 4APVA 3OHXC 5C4XG 5ELEA 1GUTA 1WTQA 4ZQ3A 5FLXc 2B8GA 3G6JB 3FEWX 4RGNA 4WRDA 4BY7H 4G4KA 4DR7Q 2CKZB 4X65L 1YITA 1B4OA 1EY8A 2F3WA 3TZUA 1QJOA 1RDPD 2YTXA 2VQEQ 4A3GH 3UDXA 2F0DA 5C44H 4LJZC 5JVH3 3S16B 2R93H 3KFUA 2K32A 2A19A 1MBYA 4KN4C 2DY8A 2IL8A 1YNND 1O78A 2NVQH 3BZDB 3CPFA 1KHIA 1I50H 2B2VC 2RSNA 3J80c 2NN6G 4HMIA 1PRTC 1PYWD 3PMFA 3BG3A 3KJOA 1X9NA 4GOPA 4GLXA 4G57A 4MTKA 3VA7A 1YJWA 5CV9A 4JI0Q 1AP0A 2QKIC 2B63B 1RHPA 1TS2A 5KGUA 1GOZA 3GTGH 5E4WC 1HTLD 5M3FH 1X3PA 5FO8B 1HZBA 4JI6L 1HZ9A 1S72A 2PI2E 3M4OB 3KF6B 2A68C 1F2YA 2JA7B 3F1ZA 2K14A 2K5QA 4HCEA 1FNWA 5FO7B 3KYHC 5M3MB 4DR4L 4Q0FA 1LTLA 3AB9A 1UUPA 3AEVA 4FDBA 3OIPA 1NR4A 2RA4A 5TSSA 3S1QB 5C0XG 4R4OA 4B9XA 1QCBD 4BBRB 3MXNB 2I5HA 2F0IA 2JN4A 3M3YB 1JOKA 1BBXC 1H9RA 5C4HA 2IJ0A 1SNPA 1YI2A 4DR2L 4LF5L 3K5MA 1DCZA 2Z8LA 2RHSB 1VQIA 2N78A 1PFNA 2EYFA 2RBMA 1GUGA 3CAMA 1SNOA 2L9HA 4C3IB 5IGEA 3M7NA 1UE6A 4RCNA 4DAMA 2IW3A 4IPHA 1KTKA 3D4DA 5CGKA 2H1EA 4UP7A 3H3VI 1QUQA 2KENA 4FXGC 3S1MB 1DD2A 4HIOA 1YIJA 3NXWA 2UXCL 2NWGA 3R8BA 3RZOB 2GVAA 1KNAA 2EVBA 2EY1A 2V1CC 1NMFA 3I4NH 4CKCA 3GTJB 2C5CA 2WACA 4GKKQ 1I6HB 5FK9C 2K33A 5CC4A 2QA4A 2RDGA 2K1BA 2TSSA 1WTOA 1TWAH 2NZ1D 2Z1CA 4JBJA 4G7ZC 2QGQA 3I56A 3NTIA 3C2PA 4A3CH 3G6EA 2E2HH 3CRLC 3IFDA 4DU9A 1HH2P 5JJZA 3DWPA 2AMCB 4MZ9A 1K73C 1STGA 4NDXA 4RAUC 3S9WA 1Z7TA 3A8IE 1MKHA 3W1BA 3R2TA 1U4LA 2F0LA 1EY4A 3I4LA 4I65A 5C4XH 2QDBA 1PZID 1B9MA 1JE5A 4NW2A 4XT1B 3K58A 2HHHL 3ULJA 3T1YL 5DLQE 4OIKA 1MHWC 2KVMA 1K83B 2FJ2A 1JOOA 1JWSD 3Q22A 4GNXA 3KF8A 4PZ8A 4A3IG 3BVMA 2L5TA 4YWMA 5KYIA 3UE0A 3KOJA 3PV0A 1N36L 3TREA 2X69A 4JK1C 2E2JH 1V1QA 4DUZL 1AZQA 2OQKA 2NN6H 2IY5B 3STBC 2Q8IB 4BA2I 1EY5A 3SK6A 5BN5A 4MHEA 3C46A 3A56A 4HJ7A 2UUAQ 3FKIH 4LFAL 3NWSA 3S2HB 4G7HC 3NE5B 1PH3A 2OT2A 1SNCA 2Z4IA 4N8FA 1SYGA 2UUBL 2PZUA 4OL7A 4GZYC 4HJ8A 2EZVA 3I3CA 2VW9A 1XNRL 4XYOA 3PO3B 1H9SA 3NBHA 4RMFA 1G2SA 2ICIA 4DV1Q 2XN9C 1MD2D 4DGZA 5M5XH 4LMQD 3J80E 2CW0C 1GVPA 2VS1A 3K80C 3KDFB 5ELFA 3A0JA 1HUMA 4N8X1 2F0VA 4BBSG 2VNUD 3W1GA 5AJ3Q 2KCTA 3OIQA 4QGUA 2R6GA 4A3EG 3TS2A 2EPBA 4UAIA 1HNWL 2MP1A 3CF5A 2K75A 3S15H 1XMQQ 3TDQA 4LF8Q 5C5MA 2J7ZA 5IT9L 1XMOL 2CQAA 1EQVA 1QZHA 2MHVA 1C4QA 2Q8RE 5EQ0A 1WTHA 5C0XH 4OWWB 1VQLA 4X3TA 1ENCA 3ZYYX 3RLNA 4EGVA 2ZT9C 2WFWA 3K0XA 1J9OA 3STBD 2A1AA 4DV7Q 4KI0A 4B3RQ 3NEMA 1BXTA 2K7VA 3K5LA 1QILA 1U4MA 1PH4A 4C2MH 4DNRB 1O7IA 1IBMQ 1VQNA 2D62A 3H15A 1PV4A 3R93A 2M00A 1TWHB 2O4XA 3ER0A 2B2WC 3JAMc 3J7ZC 1PFBA 4NKLA 3J7AF 1IBML 3CC7A 3L7ZC 1CQVA 2EIFA 4HTHA 4YY3Q 4HSVA 4JW0A 3EQLC 4EQOA 1EQQA 3T56B 4A3FG 2CW0D 4CGYB 2EYMA 1JORA 3D4RA 3CMEA 1I6VC
chains in the Genus database with same CATH topology
3PUZA 2JJQA 2HHHQ 3T1YQ 2IT1A 4LF7Q 1N33L 5GAHC 3CCEA 1NY4A 3SGIA 5IP7H 3J80i 2K5NA 4X66Q 3Q8DA 1YHAA 5C3EG 4P72A 1VQMA 4A76A 3U4VA 3PUYA 3PSIA 4IO9A 2XGTA 4OO1I 3HOWH 4P75A 1DGSA 1Y1VH 2I5LX 1NTGA 2OQ0A 4LUOA 5M3MG 4HIDA 4X62Q 3S1NH 4P73A 1UE1A 5M3FG 3E9HA 4DR7L 3T1HL 4X66L 4JI7L 1N36Q 1E1OA 2B63H 2Z6KA 3EBEA 4GNXB 3GD7A 4DR3Q 2Q2IA 1PVOA 2MO1A 3KF8B 4OX9Q 1PYSB 3PO3G 3CC2A 3S17H 4XIGS 4OO1G 2VQEL 4DUZQ 4LUZA 3W5OA 1X3EA 5IYBH 2Q2HA 3PIOA 1XJVA 4A3LG 3H0GG 3TQYA 1QZGA 4IPGA 4ME3A 4P71A 4DK3C 1X3GA 2AWOA 3LGJA 2CWAA 4A3BH 3NENA 2R7ZH 1OXSC 1PH9A 1D8LA 4OX9L 4BXXH 4LFAQ 3M4OH 4TQUS 3BU2A 3FKIG 1X55A 3EIVA 2ZM6Q 1AE3A 1QVGA 4AYBG 4HJAA 3CD6A 4A3DG 4MTNA 4JBKA 4BY1G 3CCQA 2UUBQ 3DM3A 1HNZL 3IRBA 3S24A 2I5MX 1XNRQ 1E24A 2D0OA 1X65A 4NB3A 3UDIA 2RF4A 4OONA 3GTKH 5JJLA 4GN3B 1VQDA 2C35B 5IY0A 4A4IA 4B3SL 2VZAA 4A75A 3PF5A 2ZM6L 2JA8H 3GTLH 4A3MH 1OXTA 4A3IH 4UPAA 5IP9G 4JI0L 2ASBA 1E3PA 1JJ2A 3S14H 2K5VA 3S15H 1HNXL 4R4CA 3OTOL 1C9OA 3M3YH 4IPCA 3CQZH 2VUMG 3HOUG 4QL5A 1VQ6A 4GOPC 1X54A 4YCUA 2DUDA 5GAEC 1PH6A 3MEFA 1PA6A 4JBWA 2LXKA 2ATWA 4LFBQ 5ELOA 5H1SE 1HNWQ 4RG1A 1N32L 5LMUL 2PMZE 2RCNA 2CQOA 3CP0A 1SE8A 2PQAB 1JB7A 1XMOQ 1YHBA 3HOVH 3A5ZB 4GN4B 4LUVA 2CCZA 2Y0SG 1PYBA 1KRSA 4C3IH 2MNAA 2ZJPA 3CCJA 1GD7A 1U5KA 3CPWA 1H95A 1NE3A 4LFBL 2ZTCA 5JEAJ 3TRZA 3HKZE 1Q46A 1UEBA 4ALPA 4B3TQ 2WB1G 3ERSX 3D31A 1VQ9A 3S1MH 3M85A 3AFPA 3A5UA 4JV5L 3A74A 4EX5A 1G6PA 1LUZA 4JI8L 4OWTB 1SFOH 3M4QA 4JI1L 4AH6A 4QQBX 3TEHB 4DUYQ 4LFCQ 3HOZH 4X64L 3EN2A 1XNQL 3S2DH 4UP8A 1GKHA 4YHHQ 3RZOH 1CSQA 2YYZA 4B3TL 4R4TA 4R4IA 3J81i 3GTQH 3I4NG 2UU9Q 3K81C 1GM5A 2UXBQ 1VQ4A 4MNOA 1Y1WH 4YCVA 1WOCA 1WYDA 1MIUA 4A3KH 4DR6Q 4DV5Q 1HR0Q 4LFCL 1I5FA 1OTCA 1L1OA 1EFWA 3J7A5 2HIVA 1VQGA 1K8GA 2JEAI 1I94L 4YHHL 5M5WH 3AYHB 1FJGL 4JOIC 4BBSH 2R92G 4IJHA 3I4MG 1W2BA 2JA9A 3S1RH 1HNWL 1I6HH 5K36G 2E2IH 1E1TA 1SMXA 4A3EH 1LYLA 3RN2A 4DR6L 4DV5L 1KC8C 2B29A 3CCLA 3NELA 1ASYA 4K0KQ 3GO5A 2JE6I 1VQKA 1EUJA 2VL6A 1EIYB 1HZCA 2Y0SE 4P74A 5LMNQ 2JA6G 3HOUH 1EQRA 4IFDI 1PHJA 2AWNA 1VQJA 1N33Q 1K0RA 2F4VL 3E9IA 2ZTDA 3FHWA 4JI4Q 1MJCA 2WB1E 3UE1A 3L2PA 4Y7NH 1FVIA 3WWVA 1WCMH 4HJ9A 2PNHA 3ULPA 4APVA 1IXRA 3S16H 5C4XG 4DR5L 4DV2L 1PH1A 4GKJL 3M4PA 4IFDG 4OXPA 1CKNB 2LXJA 5GADC 1L2FA 3F2DA 2ZJQA 5FLXc 4JI4L 3UDGA 5IYDG 3HOWG 3PF4A 3I4OA 4TVAB 3PO2G 1SLJA 4BY7H 3CW2C 2HIXA 2CKZB 1CUKA 2KHIA 4X65L 3T1HQ 4DR7Q 1YITA 4JI7Q 3ULLA 2CWPA 2QEXA 4GKKL 1J5EL 2YTXA 2K5HA 2VQEQ 3G71A 1K83H 4A3GH 3UDXA 2NN6I 5C44H 1IL2A 3CCMA 1JMCA 4Y52H 2R93H 3KFUA 4JG2A 1FL0A 4LF9L 2A19A 3F2BA 4A3BG 3OYYA 1C0AA 1PH7A 1A63A 2NVQH 3CPFA 1KHIA 1S3OA 1I50H 3J80c 1Q7YC 2NN6G 3PUVA 2K4KA 1HNZQ 1VQCA 4C3HH 4DV6Q 2I0QA 3KJOA 4LNQA 1X9NA 3PUWA 4GOPA 3I55A 4GLXA 3CCRA 1N34Q 4B3SQ 3HKZG 5C3EH 4UY8C 1WI5A 2FXQA 2BH2A 2JA7H 4PZ7A 4DKAC 1A62A 2JA8G 3ICEA 3PUXA 1YJWA 4JI0Q 1Q82C 2JEBI 1VCIA 3HFZB 5M3MH 3J81j 4DV6L 2VQFQ 4BA1I 2Q2UA 1K3RA 1IYJB 1HNXQ 3OTOQ 2IHEA 3GTGH 5M3FH 2BH8A 3S2HH 1N34L 2JA5G 1KQSA 4A3JG 2N8NA 3UDFA 5JJIA 1HZBA 4JI6L 3S1QH 2UUCL 1Q8KA 3RLFA 2L15A 3PO3H 1HZ9A 1N32Q 4BBRH 4JI2Q 2VQFL 5LMUQ 1IBLQ 1S72A 1QVFA 2IX1A 1YJNA 4IOCA 2PI2E 5C4JH 3PCOB 4A3DH 1K9MC 4A3LH 3NBHB 3H0GH 1S40A 3KF6B 4POFA 1UE7A 1UE5A 1E7ZA 1BBWA 5IYCG 3F1ZA 2K14A 5C0XI 3KYHC 3AQQA 4GNXC 1Y14B 1IBLL 4JI2L 4DR4L 5FJ8G 4A93G 2Z6KC 5M5YH 4JV5Q 1LTLA 3BJUA 3HOXG 4JI8Q 3AEVA 4DV0Q 1HZAA 3OW2A 4FDBA 4IPDA 4R4QA 1FGUA 3PGZA 4JI1Q 4HIMA 1M90C 3D0FA 4BY1H 1BKBA 4QJFA 1EYGA 1YEZA 4X64Q 1XNQQ 1OXXK 4KLKA 5C0XG 1Q1BA 4R4OA 3BZCA 2JQOA 2UUAL 4GLAC 1NBWA 4YWLA 2RHQB 2I5HA 3MXNB 4DNIA 4LF4Q 1YVCA 5E7NA 2GVBA 4DV0L 1VS0A 5IP9H 4DV3Q 1P16A 2BA1A 1VQBA 4YCWA 1YI2A 4DR2L 4LF5L 1ASZA 2ZJRA 1AH9A 2PQAA 2R7FA 3KDFA 1I94Q 5JJKA 4LF4L 1FJGQ 1VQIA 2N78A 2RHSB 1Q12A 4DV1L 2KBNA 4EQ5A 2VUMH 1TWCH 3CAMA 1IZ6A 4JCVE 5ELNA 1XTDA 1PFSA 4DV3L 1Q1EA 2HQLA 3M7NA 1SN8A 4WJ4A 1UE6A 4DAMA 3ZJYC 1MJEA 4IPHA 2IHFA 1L1OB 4UP7A 3GTJH 4UP9A 3H3VI 1QUQA 4LF6L 2KENA 4PZ6A 1V9PA 1KRTA 1YHQA 2WP8J 3M9BA 2F4VQ 5AJ3L 4HIOA 1YIJA 5IT9c 3JAMi 2UXCL 1YJ9A 5IWAL 2IX0A 1WCMG 1XMQL 3B6YA 4DR5Q 1G51A 4DV2Q 2Q2TA 1T9HA 4LF8L 4GKJQ 2GVAA 3GTOH 2AHOB 5FLMG 3AFQA 4DV4L 2ES2A 1Q81C 1XPRA 2KCMA 1YNXA 2V1CC 1OXVA 1NMFA 5IP7G 3I4NH 4X65Q 1X56A 3BZKA 3HKSA 4HJ5A 4GKKQ 1X3FA 1J5EQ 3K8AA 3CXCA 1VQFA 2OWOA 2B3GA 4NXNL 4DV7L 4B3RL 1Y1VG 1AE2A 2QA4A 4A3GG 1SRUA 2R92H 2DGYA 1TWAH 4LF9Q 4WJ3M 4JBJA 4POGA 2QGQA 3I56A 3CCVA 2B63G 2UXDL 1A0IA 1NMGA 1CKOA 1K8AC 1Z9FA 1VQAA 4A3CH 3G6EA 1KD1C 3U58A 2E2HH 4IFDJ 4X6AH 1HH2P 4DR1L 2AMCB 3I7FA 4MZ9A 1K73C 4NXMQ 3GTMH 5IYBG 3KLWA 1L1OC 4QIWE 2NZHA 1HJPA 1CSPA 1MKHA 1I3QH 2ID0A 3G48A 3F8TA 3W1BA 4YY3L 2R7ZG 3DLLA 1XPUA 1HR0W 4JI5Q 4BXXG 4A3FH 3GTPH 4AQYQ 4JI3L 5BR8Q 5C4XH 4NXML 2E5LL 1JE5A 1W3SA 2JA7G 1BVSA 2GN5A 2N49A 1R9TH 3ULJA 2HHHL 3T1YL 5DLQE 4C3JH 4LF7L 3PO2H 5IYDH 4O0AA 4R1JA 1SR3A 3KJPA 2YV5A 2K50A 1V43A 4JI5L 1KXLA 4GOPB 3U4ZA 4AQYL 2F3IA 5BR8L 1NJIC 1X6OA 4GNXA 2K52A 2Z0SA 1CKMA 1KAWA 5LMNW 3PIPA 4A3MG 1GO3E 4PZ8A 4KHZA 4L5QA 4A3IG 5HY6A 2UUCQ 2CFMA 2E8GA 4JI6Q 1PH2A 4L5SA 4IJLA 2MO0A 4BBRG 1VQHA 4YWMA 1B8AA 3UE0A 4X62L 3KOJA 3PV0A 2NZOA 1IBKQ 5J3BA 1N36L 1N9WA 2YU9H 2NVXH 4OWXB 3RLOA 4DR3L 3TREA 5GQOA 4DR4Q 2N3SA 1KIXA 3CCUA 2E2JH 1V1QA 4DUZL 2WAQG 1YBYA 3G4SA 2OQKA 2R7DA 4B3MQ 1D7QA 2IY5B 3STBC 1IBKL 4NPSA 3HOVG 2D0PA 5IE8A 4BA2I 1EIFA 3FP9A 4L5TA 4DAYB 3L0OA 4HJ7A 4AIMA 2UUAQ 3FKIH 4LFAL 4O2DA 2NVTH 2PI2A 1M1KC 4B3ML 4JC0A 3CMAA 1PH3A 2YTYA 2UUBL 4LF5Q 4DR2Q 3JC66 4HJ8A 2EXDA 4JOIA 2VW9A 3HOZG 1JJCB 2AKWB 1XNRL 1RIPA 1G291 1A8VA 3KF6A 1WFQA 2JA5H 1U0LA 4RMFA 4DV1Q 1PH8A 4JYAL 1L0WA 4A3JH 1UWVA 2NVYH 2ALYB 1LM0A 2OCEA 3RR5A 1VQ7A 5GROA 3CCSA 1Y1WG 5JEAG 3U50C 5M5XH 4A3KG 1VQEA 3E0EA 4LWCA 4JYAQ 1JT8A 1GVPA 2F52A 2VS1A 3K80C 4GLVB 4YWKA 4DK6C 3KDFB 5C0XJ 1VQ5A 4LF6Q 2BA0A 2ZTEA 3A0JA 4GS3A 5IYCH 4BBSG 3CC4A 2VNUD 3W1GA 3HOYG 1EOVA 2KHJA 5AJ3Q 2KCTA 4QGUA 2R6GA 4A3EG 3TS2A 2UXCQ 4PG3A 1Z47A 2WAQE 5IWAQ 3GDEA 4HIKA 4A93H 1SROA 5FJ8H 2K75A 3CF5A 4J15A 1EWIA 1TWGH 3HOXH 5EAYA 4AYBE 3RZDH 1XMQQ 2OTLA 4L5RC 4LF8Q 3HOYH 1XMOL 4DV4Q 1QUQB 1QZHA 1B7YB 1TWHH 4OWWB 3RN5A 2MFIA 1VQLA 3K7UC 2HT1A 3RLNA 2YTVA 3J81c 2WFWA 2EQSA 3K0XA 1QVCA 3K7AH 3STBD 1TWFH 2A1AA 2JK8A 4DUYL 4KHPQ 1YZ6A 4NXNQ 4DV7Q 4KI0A 4H02A 4LW1A 1XPOA 3NEMA 4B3RQ 2A8VA 4PMWA 2VY3A 1WJJA 1N8RC 1KL9A 1VQPA 1PH4A 4BY7G 4C2MH 1J6QA 1O7IA 1IBMQ 2UU9L 1Q86C 3F2CA 1VQNA 2D62A 3VDYA 2UXBL 2UXDQ 3H15A 1PV4A 1VQOA 5GAGC 4KHPL 1HR0L 3ER0A 4A3CG 1B70B 1P8LA 3JAMc 3I2ZA 3J7ZC 4DR1Q 2MQHA 5C44G 4DPGA 1VQ8A 4JBMA 4GN5A 3I4MH 4IOAA 2LSSA 1IBML 1TXYA 5HGQA 3TS0A 2R93G 3CC7A 3L7ZC 2EIFA 4YY3Q 1E22A 1C7YA 2OTJA 1EQQA 3RNUA 4K0KL 1OXUA 4A3FG 4JI3Q 1BBUA 1PH5A 2XTIA 2H5XA 1JJGA 4XTCS 2JA6H 1RL2A 3H3VH 2E5LQ 5FLMH 5LMNL 1CKNA 3CMEA 4QY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUZ A;  2JJQ A;  2HHH Q;  3T1Y Q;  2IT1 A;  4LF7 Q;  1N33 L;  5GAH C;  3CCE A;  1NY4 A;  3SGI A;  5IP7 H;  3J80 i;  2K5N A;  4X66 Q;  3Q8D A;  1YHA A;  5C3E G;  4P72 A;  1VQM A;  4A76 A;  3U4V A;  3PUY A;  3PSI A;  4IO9 A;  2XGT A;  4OO1 I;  3HOW H;  4P75 A;  1DGS A;  1Y1V H;  2I5L X;  1NTG A;  2OQ0 A;  4LUO A;  5M3M G;  4HID A;  4X62 Q;  3S1N H;  4P73 A;  1UE1 A;  5M3F G;  3E9H A;  4DR7 L;  3T1H L;  4X66 L;  4JI7 L;  1N36 Q;  1E1O A;  2B63 H;  2Z6K A;  3EBE A;  4GNX B;  3GD7 A;  4DR3 Q;  2Q2I A;  1PVO A;  2MO1 A;  3KF8 B;  4OX9 Q;  1PYS B;  3PO3 G;  3CC2 A;  3S17 H;  4XIG S;  4OO1 G;  2VQE L;  4DUZ Q;  4LUZ A;  3W5O A;  1X3E A;  5IYB H;  2Q2H A;  3PIO A;  1XJV A;  4A3L G;  3H0G G;  3TQY A;  1QZG A;  4IPG A;  4ME3 A;  4P71 A;  4DK3 C;  1X3G A;  2AWO A;  3LGJ A;  2CWA A;  4A3B H;  3NEN A;  2R7Z H;  1OXS C;  1PH9 A;  1D8L A;  4OX9 L;  4BXX H;  4LFA Q;  3M4O H;  4TQU S;  3BU2 A;  3FKI G;  1X55 A;  3EIV A;  2ZM6 Q;  1AE3 A;  1QVG A;  4AYB G;  4HJA A;  3CD6 A;  4A3D G;  4MTN A;  4JBK A;  4BY1 G;  3CCQ A;  2UUB Q;  3DM3 A;  1HNZ L;  3IRB A;  3S24 A;  2I5M X;  1XNR Q;  1E24 A;  2D0O A;  1X65 A;  4NB3 A;  3UDI A;  2RF4 A;  4OON A;  3GTK H;  5JJL A;  4GN3 B;  1VQD A;  2C35 B;  5IY0 A;  4A4I A;  4B3S L;  2VZA A;  4A75 A;  3PF5 A;  2ZM6 L;  2JA8 H;  3GTL H;  4A3M H;  1OXT A;  4A3I H;  4UPA A;  5IP9 G;  4JI0 L;  2ASB A;  1E3P A;  1JJ2 A;  3S14 H;  2K5V A;  3S15 H;  1HNX L;  4R4C A;  3OTO L;  1C9O A;  3M3Y H;  4IPC A;  3CQZ H;  2VUM G;  3HOU G;  4QL5 A;  1VQ6 A;  4GOP C;  1X54 A;  4YCU A;  2DUD A;  5GAE C;  1PH6 A;  3MEF A;  1PA6 A;  4JBW A;  2LXK A;  2ATW A;  4LFB Q;  5ELO A;  5H1S E;  1HNW Q;  4RG1 A;  1N32 L;  5LMU L;  2PMZ E;  2RCN A;  2CQO A;  3CP0 A;  1SE8 A;  2PQA B;  1JB7 A;  1XMO Q;  1YHB A;  3HOV H;  3A5Z B;  4GN4 B;  4LUV A;  2CCZ A;  2Y0S G;  1PYB A;  1KRS A;  4C3I H;  2MNA A;  2ZJP A;  3CCJ A;  1GD7 A;  1U5K A;  3CPW A;  1H95 A;  1NE3 A;  4LFB L;  2ZTC A;  5JEA J;  3TRZ A;  3HKZ E;  1Q46 A;  1UEB A;  4ALP A;  4B3T Q;  2WB1 G;  3ERS X;  3D31 A;  1VQ9 A;  3S1M H;  3M85 A;  3AFP A;  3A5U A;  4JV5 L;  3A74 A;  4EX5 A;  1G6P A;  1LUZ A;  4JI8 L;  4OWT B;  1SFO H;  3M4Q A;  4JI1 L;  4AH6 A;  4QQB X;  3TEH B;  4DUY Q;  4LFC Q;  3HOZ H;  4X64 L;  3EN2 A;  1XNQ L;  3S2D H;  4UP8 A;  1GKH A;  4YHH Q;  3RZO H;  1CSQ A;  2YYZ A;  4B3T L;  4R4T A;  4R4I A;  3J81 i;  3GTQ H;  3I4N G;  2UU9 Q;  3K81 C;  1GM5 A;  2UXB Q;  1VQ4 A;  4MNO A;  1Y1W H;  4YCV A;  1WOC A;  1WYD A;  1MIU A;  4A3K H;  4DR6 Q;  4DV5 Q;  1HR0 Q;  4LFC L;  1I5F A;  1OTC A;  1L1O A;  1EFW A;  3J7A 5;  2HIV A;  1VQG A;  1K8G A;  2JEA I;  1I94 L;  4YHH L;  5M5W H;  3AYH B;  1FJG L;  4JOI C;  4BBS H;  2R92 G;  4IJH A;  3I4M G;  1W2B A;  2JA9 A;  3S1R H;  1HNW L;  1I6H H;  5K36 G;  2E2I H;  1E1T A;  1SMX A;  4A3E H;  1LYL A;  3RN2 A;  4DR6 L;  4DV5 L;  1KC8 C;  2B29 A;  3CCL A;  3NEL A;  1ASY A;  4K0K Q;  3GO5 A;  2JE6 I;  1VQK A;  1EUJ A;  2VL6 A;  1EIY B;  1HZC A;  2Y0S E;  4P74 A;  5LMN Q;  2JA6 G;  3HOU H;  1EQR A;  4IFD I;  1PHJ A;  2AWN A;  1VQJ A;  1N33 Q;  1K0R A;  2F4V L;  3E9I A;  2ZTD A;  3FHW A;  4JI4 Q;  1MJC A;  2WB1 E;  3UE1 A;  3L2P A;  4Y7N H;  1FVI A;  3WWV A;  1WCM H;  4HJ9 A;  2PNH A;  3ULP A;  4APV A;  1IXR A;  3S16 H;  5C4X G;  4DR5 L;  4DV2 L;  1PH1 A;  4GKJ L;  3M4P A;  4IFD G;  4OXP A;  1CKN B;  2LXJ A;  5GAD C;  1L2F A;  3F2D A;  2ZJQ A;  5FLX c;  4JI4 L;  3UDG A;  5IYD G;  3HOW G;  3PF4 A;  3I4O A;  4TVA B;  3PO2 G;  1SLJ A;  4BY7 H;  3CW2 C;  2HIX A;  2CKZ B;  1CUK A;  2KHI A;  4X65 L;  3T1H Q;  4DR7 Q;  1YIT A;  4JI7 Q;  3ULL A;  2CWP A;  2QEX A;  4GKK L;  1J5E L;  2YTX A;  2K5H A;  2VQE Q;  3G71 A;  1K83 H;  4A3G H;  3UDX A;  2NN6 I;  5C44 H;  1IL2 A;  3CCM A;  1JMC A;  4Y52 H;  2R93 H;  3KFU A;  4JG2 A;  1FL0 A;  4LF9 L;  2A19 A;  3F2B A;  4A3B G;  3OYY A;  1C0A A;  1PH7 A;  1A63 A;  2NVQ H;  3CPF A;  1KHI A;  1S3O A;  1I50 H;  3J80 c;  1Q7Y C;  2NN6 G;  3PUV A;  2K4K A;  1HNZ Q;  1VQC A;  4C3H H;  4DV6 Q;  2I0Q A;  3KJO A;  4LNQ A;  1X9N A;  3PUW A;  4GOP A;  3I55 A;  4GLX A;  3CCR A;  1N34 Q;  4B3S Q;  3HKZ G;  5C3E H;  4UY8 C;  1WI5 A;  2FXQ A;  2BH2 A;  2JA7 H;  4PZ7 A;  4DKA C;  1A62 A;  2JA8 G;  3ICE A;  3PUX A;  1YJW A;  4JI0 Q;  1Q82 C;  2JEB I;  1VCI A;  3HFZ B;  5M3M H;  3J81 j;  4DV6 L;  2VQF Q;  4BA1 I;  2Q2U A;  1K3R A;  1IYJ B;  1HNX Q;  3OTO Q;  2IHE A;  3GTG H;  5M3F H;  2BH8 A;  3S2H H;  1N34 L;  2JA5 G;  1KQS A;  4A3J G;  2N8N A;  3UDF A;  5JJI A;  1HZB A;  4JI6 L;  3S1Q H;  2UUC L;  1Q8K A;  3RLF A;  2L15 A;  3PO3 H;  1HZ9 A;  1N32 Q;  4BBR H;  4JI2 Q;  2VQF L;  5LMU Q;  1IBL Q;  1S72 A;  1QVF A;  2IX1 A;  1YJN A;  4IOC A;  2PI2 E;  5C4J H;  3PCO B;  4A3D H;  1K9M C;  4A3L H;  3NBH B;  3H0G H;  1S40 A;  3KF6 B;  4POF A;  1UE7 A;  1UE5 A;  1E7Z A;  1BBW A;  5IYC G;  3F1Z A;  2K14 A;  5C0X I;  3KYH C;  3AQQ A;  4GNX C;  1Y14 B;  1IBL L;  4JI2 L;  4DR4 L;  5FJ8 G;  4A93 G;  2Z6K C;  5M5Y H;  4JV5 Q;  1LTL A;  3BJU A;  3HOX G;  4JI8 Q;  3AEV A;  4DV0 Q;  1HZA A;  3OW2 A;  4FDB A;  4IPD A;  4R4Q A;  1FGU A;  3PGZ A;  4JI1 Q;  4HIM A;  1M90 C;  3D0F A;  4BY1 H;  1BKB A;  4QJF A;  1EYG A;  1YEZ A;  4X64 Q;  1XNQ Q;  1OXX K;  4KLK A;  5C0X G;  1Q1B A;  4R4O A;  3BZC A;  2JQO A;  2UUA L;  4GLA C;  1NBW A;  4YWL A;  2RHQ B;  2I5H A;  3MXN B;  4DNI A;  4LF4 Q;  1YVC A;  5E7N A;  2GVB A;  4DV0 L;  1VS0 A;  5IP9 H;  4DV3 Q;  1P16 A;  2BA1 A;  1VQB A;  4YCW A;  1YI2 A;  4DR2 L;  4LF5 L;  1ASZ A;  2ZJR A;  1AH9 A;  2PQA A;  2R7F A;  3KDF A;  1I94 Q;  5JJK A;  4LF4 L;  1FJG Q;  1VQI A;  2N78 A;  2RHS B;  1Q12 A;  4DV1 L;  2KBN A;  4EQ5 A;  2VUM H;  1TWC H;  3CAM A;  1IZ6 A;  4JCV E;  5ELN A;  1XTD A;  1PFS A;  4DV3 L;  1Q1E A;  2HQL A;  3M7N A;  1SN8 A;  4WJ4 A;  1UE6 A;  4DAM A;  3ZJY C;  1MJE A;  4IPH A;  2IHF A;  1L1O B;  4UP7 A;  3GTJ H;  4UP9 A;  3H3V I;  1QUQ A;  4LF6 L;  2KEN A;  4PZ6 A;  1V9P A;  1KRT A;  1YHQ A;  2WP8 J;  3M9B A;  2F4V Q;  5AJ3 L;  4HIO A;  1YIJ A;  5IT9 c;  3JAM i;  2UXC L;  1YJ9 A;  5IWA L;  2IX0 A;  1WCM G;  1XMQ L;  3B6Y A;  4DR5 Q;  1G51 A;  4DV2 Q;  2Q2T A;  1T9H A;  4LF8 L;  4GKJ Q;  2GVA A;  3GTO H;  2AHO B;  5FLM G;  3AFQ A;  4DV4 L;  2ES2 A;  1Q81 C;  1XPR A;  2KCM A;  1YNX A;  2V1C C;  1OXV A;  1NMF A;  5IP7 G;  3I4N H;  4X65 Q;  1X56 A;  3BZK A;  3HKS A;  4HJ5 A;  4GKK Q;  1X3F A;  1J5E Q;  3K8A A;  3CXC A;  1VQF A;  2OWO A;  2B3G A;  4NXN L;  4DV7 L;  4B3R L;  1Y1V G;  1AE2 A;  2QA4 A;  4A3G G;  1SRU A;  2R92 H;  2DGY A;  1TWA H;  4LF9 Q;  4WJ3 M;  4JBJ A;  4POG A;  2QGQ A;  3I56 A;  3CCV A;  2B63 G;  2UXD L;  1A0I A;  1NMG A;  1CKO A;  1K8A C;  1Z9F A;  1VQA A;  4A3C H;  3G6E A;  1KD1 C;  3U58 A;  2E2H H;  4IFD J;  4X6A H;  1HH2 P;  4DR1 L;  2AMC B;  3I7F A;  4MZ9 A;  1K73 C;  4NXM Q;  3GTM H;  5IYB G;  3KLW A;  1L1O C;  4QIW E;  2NZH A;  1HJP A;  1CSP A;  1MKH A;  1I3Q H;  2ID0 A;  3G48 A;  3F8T A;  3W1B A;  4YY3 L;  2R7Z G;  3DLL A;  1XPU A;  1HR0 W;  4JI5 Q;  4BXX G;  4A3F H;  3GTP H;  4AQY Q;  4JI3 L;  5BR8 Q;  5C4X H;  4NXM L;  2E5L L;  1JE5 A;  1W3S A;  2JA7 G;  1BVS A;  2GN5 A;  2N49 A;  1R9T H;  3ULJ A;  2HHH L;  3T1Y L;  5DLQ E;  4C3J H;  4LF7 L;  3PO2 H;  5IYD H;  4O0A A;  4R1J A;  1SR3 A;  3KJP A;  2YV5 A;  2K50 A;  1V43 A;  4JI5 L;  1KXL A;  4GOP B;  3U4Z A;  4AQY L;  2F3I A;  5BR8 L;  1NJI C;  1X6O A;  4GNX A;  2K52 A;  2Z0S A;  1CKM A;  1KAW A;  5LMN W;  3PIP A;  4A3M G;  1GO3 E;  4PZ8 A;  4KHZ A;  4L5Q A;  4A3I G;  5HY6 A;  2UUC Q;  2CFM A;  2E8G A;  4JI6 Q;  1PH2 A;  4L5S A;  4IJL A;  2MO0 A;  4BBR G;  1VQH A;  4YWM A;  1B8A A;  3UE0 A;  4X62 L;  3KOJ A;  3PV0 A;  2NZO A;  1IBK Q;  5J3B A;  1N36 L;  1N9W A;  2YU9 H;  2NVX H;  4OWX B;  3RLO A;  4DR3 L;  3TRE A;  5GQO A;  4DR4 Q;  2N3S A;  1KIX A;  3CCU A;  2E2J H;  1V1Q A;  4DUZ L;  2WAQ G;  1YBY A;  3G4S A;  2OQK A;  2R7D A;  4B3M Q;  1D7Q A;  2IY5 B;  3STB C;  1IBK L;  4NPS A;  3HOV G;  2D0P A;  5IE8 A;  4BA2 I;  1EIF A;  3FP9 A;  4L5T A;  4DAY B;  3L0O A;  4HJ7 A;  4AIM A;  2UUA Q;  3FKI H;  4LFA L;  4O2D A;  2NVT H;  2PI2 A;  1M1K C;  4B3M L;  4JC0 A;  3CMA A;  1PH3 A;  2YTY A;  2UUB L;  4LF5 Q;  4DR2 Q;  3JC6 6;  4HJ8 A;  2EXD A;  4JOI A;  2VW9 A;  3HOZ G;  1JJC B;  2AKW B;  1XNR L;  1RIP A;  1G29 1;  1A8V A;  3KF6 A;  1WFQ A;  2JA5 H;  1U0L A;  4RMF A;  4DV1 Q;  1PH8 A;  4JYA L;  1L0W A;  4A3J H;  1UWV A;  2NVY H;  2ALY B;  1LM0 A;  2OCE A;  3RR5 A;  1VQ7 A;  5GRO A;  3CCS A;  1Y1W G;  5JEA G;  3U50 C;  5M5X H;  4A3K G;  1VQE A;  3E0E A;  4LWC A;  4JYA Q;  1JT8 A;  1GVP A;  2F52 A;  2VS1 A;  3K80 C;  4GLV B;  4YWK A;  4DK6 C;  3KDF B;  5C0X J;  1VQ5 A;  4LF6 Q;  2BA0 A;  2ZTE A;  3A0J A;  4GS3 A;  5IYC H;  4BBS G;  3CC4 A;  2VNU D;  3W1G A;  3HOY G;  1EOV A;  2KHJ A;  5AJ3 Q;  2KCT A;  4QGU A;  2R6G A;  4A3E G;  3TS2 A;  2UXC Q;  4PG3 A;  1Z47 A;  2WAQ E;  5IWA Q;  3GDE A;  4HIK A;  4A93 H;  1SRO A;  5FJ8 H;  2K75 A;  3CF5 A;  4J15 A;  1EWI A;  1TWG H;  3HOX H;  5EAY A;  4AYB E;  3RZD H;  1XMQ Q;  2OTL A;  4L5R C;  4LF8 Q;  3HOY H;  1XMO L;  4DV4 Q;  1QUQ B;  1QZH A;  1B7Y B;  1TWH H;  4OWW B;  3RN5 A;  2MFI A;  1VQL A;  3K7U C;  2HT1 A;  3RLN A;  2YTV A;  3J81 c;  2WFW A;  2EQS A;  3K0X A;  1QVC A;  3K7A H;  3STB D;  1TWF H;  2A1A A;  2JK8 A;  4DUY L;  4KHP Q;  1YZ6 A;  4NXN Q;  4DV7 Q;  4KI0 A;  4H02 A;  4LW1 A;  1XPO A;  3NEM A;  4B3R Q;  2A8V A;  4PMW A;  2VY3 A;  1WJJ A;  1N8R C;  1KL9 A;  1VQP A;  1PH4 A;  4BY7 G;  4C2M H;  1J6Q A;  1O7I A;  1IBM Q;  2UU9 L;  1Q86 C;  3F2C A;  1VQN A;  2D62 A;  3VDY A;  2UXB L;  2UXD Q;  3H15 A;  1PV4 A;  1VQO A;  5GAG C;  4KHP L;  1HR0 L;  3ER0 A;  4A3C G;  1B70 B;  1P8L A;  3JAM c;  3I2Z A;  3J7Z C;  4DR1 Q;  2MQH A;  5C44 G;  4DPG A;  1VQ8 A;  4JBM A;  4GN5 A;  3I4M H;  4IOA A;  2LSS A;  1IBM L;  1TXY A;  5HGQ A;  3TS0 A;  2R93 G;  3CC7 A;  3L7Z C;  2EIF A;  4YY3 Q;  1E22 A;  1C7Y A;  2OTJ A;  1EQQ A;  3RNU A;  4K0K L;  1OXU A;  4A3F G;  4JI3 Q;  1BBU A;  1PH5 A;  2XTI A;  2H5X A;  1JJG A;  4XTC S;  2JA6 H;  1RL2 A;  3H3V H;  2E5L Q;  5FLM H;  5LMN L;  1CKN A;  3CME A;  4QY7 A; 
#chains in the Genus database with same CATH topology
 2JJQ A;  5GAH C;  1NY4 A;  1LO5 D;  4UHV A;  2EJF C;  3QIA A;  3K59 A;  3QB3 A;  5COR A;  1YHA A;  5C3E G;  2R92 B;  2LMC B;  3P75 A;  4P72 A;  1VQM A;  3I4M B;  4IO9 A;  3NK9 A;  4OO1 I;  2HDL A;  3IL8 A;  3OMC A;  5CBA E;  4X62 Q;  5EKK A;  3GTM B;  1E1O A;  1AW7 A;  2Z6K A;  3EBE A;  1EYC A;  1PVO A;  2Q2I A;  4OX9 Q;  1STY A;  3S17 H;  4LUZ A;  3W5O A;  3GTP B;  1X3E A;  4A3D G;  1SSO A;  1XJV A;  4ME3 A;  4J8Q A;  5JOB A;  3VR4 A;  2AWO A;  4XQJ A;  2EYP A;  1TS5 A;  4RKL A;  1PH9 A;  1D8L A;  1F2L A;  1R9T B;  4OX9 L;  3DMU A;  1ET9 A;  1K8O A;  1JOQ A;  3NBI A;  3C1E A;  3NTH A;  3IRB A;  4KY7 A;  1HNZ L;  4LAA A;  4HED A;  3NTK A;  4K6L A;  4NB3 A;  1E2Z A;  1SJH D;  2EOT A;  2RF4 A;  2DN8 A;  5JJL A;  1X3Q A;  5IY0 A;  5KEE A;  4B3S L;  3KLS X;  4A3I H;  5IP9 G;  1ESR A;  2K03 A;  4ZCK A;  2NYZ D;  1E3P A;  1EEI D;  4U68 A;  2NVX B;  3S14 H;  1DM0 B;  2F0K A;  3CQZ H;  4DXF A;  2DUD A;  4KY6 A;  1WTP A;  3KUP A;  1F9Q A;  2GA4 B;  2LXK A;  3K5O A;  5CMD A;  1GUO A;  4RG1 A;  1KDA A;  5LMU L;  3CP0 A;  3PIP 3;  1SE8 A;  1JB7 A;  3GTK B;  5IGD A;  3D3R A;  4GN4 B;  2JA8 B;  2QEJ C;  1WD1 A;  3CPW A;  1DOK A;  4RA8 A;  1C48 A;  3MXN A;  1Q46 A;  4CBV A;  4B3T Q;  4RKB A;  3A5U A;  3FPP A;  1RTN A;  1E2W A;  4NP5 A;  2F0O A;  4JI8 L;  1SFO H;  4AH6 A;  4QQB X;  1OO9 B;  1PTO H;  2K28 A;  3M7G A;  4DUY Q;  3BS1 A;  4LFC Q;  2A6H C;  1XNQ L;  3C1F A;  2I46 A;  4YHH Q;  4B3T L;  3GTQ H;  2AQ3 B;  3K81 C;  1FYC A;  1MIU A;  4DV5 Q;  4LFC L;  3SK4 A;  1I5F A;  3BDC A;  2HIV A;  4YHH L;  1DYQ A;  5EJW A;  1TWG B;  1FJG L;  3X3M A;  3HOX B;  3C3L A;  4BBS H;  4IJH A;  3H91 A;  3S1R H;  2SNM A;  1F77 A;  2E2I H;  4X3K A;  4A3E H;  1LYL A;  3EFX D;  4DV5 L;  2B29 A;  1O80 A;  5EKI A;  1ASY A;  3S2D B;  4KKS A;  1CFM A;  1HZC A;  2KCC A;  5LMN Q;  2F0U A;  2J0T D;  4KV6 A;  1VQJ A;  1N33 Q;  3FHW A;  2AUK A;  4JI4 Q;  3CRK C;  2WB1 E;  3L2P A;  4Y7N H;  2CHB D;  1IXR A;  4K8J A;  3I91 A;  5M5W B;  4GKJ L;  5T1G A;  1EEF D;  2L12 A;  4IUV A;  4IFD G;  4OXP A;  4PQX A;  5GAD C;  1L2F A;  3HOW G;  4JI4 L;  3UDG A;  3PO2 G;  1D5M C;  1A63 A;  1SLJ A;  3E5S A;  5ELB A;  3ERO A;  1A3U A;  3ULL A;  4E6I A;  2QEX A;  2K5H A;  2MGS A;  2A6H D;  4K8I A;  4ZUJ A;  1IL2 A;  1WCM B;  2EDG A;  2ZXR A;  3CCM A;  1JMC A;  4Y52 H;  4JG2 A;  4O1N A;  1A3T A;  2DJF C;  2AQ2 B;  4A3B G;  2RSO A;  1DON A;  1Q7Y C;  5FO9 B;  3K5N A;  3SK5 A;  3T53 B;  4C3H H;  4LNQ A;  2I0Q A;  5EBC A;  2KA7 A;  1Y1V B;  2VB2 X;  4A3G B;  5C3E H;  3ICE A;  1I4P A;  1WI5 A;  1A62 A;  1VCI A;  3J81 j;  4UDU C;  4BA1 I;  1LT3 D;  3OTO Q;  4KD3 A;  2NVQ B;  4CDD C;  4B9W A;  1I50 B;  1PXU A;  2AQ1 B;  3UDF A;  2F0F A;  5IGG A;  1SBB B;  5IOD A;  2R7Z B;  1IBL Q;  2IX1 A;  1WTR A;  5C4J H;  1SAP A;  4A3D H;  3NBH B;  1S40 A;  5KND A;  2LS0 1;  2N88 A;  3NUC A;  1IBL L;  1I4X A;  1Y14 B;  4A93 G;  1KDC A;  5FJ8 G;  4JV5 Q;  5EPK A;  3BJU A;  1HZA A;  4IPD A;  2F0S A;  3HOY G;  4RH6 A;  4JI1 Q;  3D0F A;  4QJF A;  1PFM A;  4X64 Q;  1KDB A;  1OXX K;  3RUZ A;  1Q1B A;  2QDL A;  2JQO A;  4LF4 Q;  4GLA C;  1ESF A;  1HXY D;  5E7N A;  2GVB A;  1VS0 A;  4QB4 A;  5FOB B;  5I2X A;  5IP9 H;  4DV3 Q;  1VQB A;  1R4Q B;  2RCF A;  4YCW A;  1AH9 A;  3MWY W;  2R7F A;  3KDF A;  5JJK A;  5KNC A;  4HMJ A;  4EVO A;  4LF4 L;  4HN7 A;  1A6X A;  2K5W A;  2I07 B;  3BDO A;  2KBN A;  2O5I C;  1TT2 A;  1TWC H;  4JCV E;  5ELN A;  1XTD A;  4DV3 L;  1S5E D;  1DXM A;  4MN3 A;  4WJ4 A;  2A74 C;  1HFN A;  1MJE A;  5EPJ A;  2DJG C;  1L1O B;  1EU3 A;  2F3V A;  3BYT B;  4RWS C;  5C6A A;  4HSP A;  1YHQ A;  2F4V Q;  4CDC C;  4DN4 M;  1STH A;  3I70 A;  5IT9 c;  4Q5V A;  2G9D A;  2KCN A;  2IX0 A;  3T13 A;  1IKL A;  2KCM A;  3P20 A;  1YNX A;  1JQY D;  2M2L A;  2FHT A;  3X3N A;  4X65 Q;  3NQT A;  1CK1 A;  3BZK A;  4HJ5 A;  3IFT A;  1X3F A;  4ZYS A;  1A2T A;  3K8A A;  3VYS A;  3CXC A;  2OWO A;  2B3G A;  3DXJ C;  1TS4 A;  3OWF A;  1SRU A;  3SHL A;  2B2Y C;  2DGY A;  1SE3 A;  2B63 G;  2UXD L;  1JIC A;  3TBI B;  1CQF A;  1NMG A;  1SYF A;  1Z9F A;  1B3A A;  1VQA A;  3U58 A;  4KK7 A;  3DUZ A;  2LY7 A;  1HQR D;  1WD0 A;  5IYB G;  1HJP A;  2CH4 W;  3VYT A;  3OMG A;  1CSP A;  4XT3 B;  4S3S A;  3G48 A;  4RFB A;  1Q90 A;  3QJY A;  2HUG A;  4R8I A;  3DLL A;  3DEP A;  1XPU A;  1PTO C;  3HEJ A;  4AQY Q;  3DM1 A;  4JI3 L;  1FD7 D;  1W3S A;  2JA7 G;  1TWA B;  4IFD H;  4ZAI A;  4I7Z C;  3NPP A;  4K6D A;  3PO2 H;  1SR3 A;  2E2H B;  1KXL A;  1LLR D;  4AQY L;  4R8N A;  1X6O A;  3WDN A;  2K52 A;  2Z0S A;  4LK1 C;  1KAW A;  5DNF A;  5IIF A;  5LMN W;  4A3M G;  4JI6 Q;  5HY6 A;  1S5F D;  1PH2 A;  2G9H D;  1ZYR C;  2A69 C;  2MO0 A;  4BBR G;  3IKJ A;  2NZO A;  5DEH A;  3NQI A;  5J3B A;  3T51 B;  4ZK9 B;  1PTO F;  4DR4 Q;  4KN7 C;  1YBY A;  3A8K E;  3G4S A;  1PRT F;  2R7D A;  4B3M Q;  1G91 A;  3HOV G;  1I4G A;  2D0P A;  1LTG D;  5DM7 3;  2A6E C;  4C3I G;  4DAY B;  4L5T A;  2PQE A;  1D5X C;  4AIM A;  2NVT H;  2PI2 A;  1VMP A;  4B3M L;  2SNS A;  2F0H A;  1EY0 A;  2YTY A;  2K5D A;  4LF5 Q;  1ZKO A;  5JPM C;  4DR2 Q;  2EXD A;  4TRD A;  5ISR A;  3NHH A;  2FIN B;  2E2J B;  1PTO D;  1L0W A;  1ENF A;  1VQ7 A;  2ALY B;  1STB A;  2OCE A;  4DXG A;  5JEA G;  3U50 C;  1PRT D;  4A3K G;  1VQE A;  3MTS A;  3T4A C;  2BOS A;  4YWK A;  3FKI B;  4C1N I;  2QF7 A;  3SE0 A;  5M5Y B;  5D3D A;  4AYB B;  4CDE C;  5JVG 3;  1EOV A;  2KHJ A;  1NNX A;  2UXC Q;  2WAQ E;  4HIK A;  4A93 H;  5FJ8 H;  1EWI A;  2NB0 A;  1ZYR D;  5EAY A;  2A69 D;  4L5R C;  3HOY H;  3P7J A;  1IHZ A;  1DZ1 A;  3ITP A;  5M5X B;  2MFI A;  3FDT A;  2RQX A;  3LX0 A;  3OW7 A;  2AUJ D;  3HOU B;  1CZW A;  3K7A H;  2WKD A;  1TWF H;  1I4H A;  2A68 D;  2JK8 A;  1YZ6 A;  1XPO A;  4H02 A;  4LW1 A;  2F03 A;  1CM9 A;  1VQP A;  2L1B A;  2UU9 L;  2KUM A;  1YNJ C;  1EFI D;  1H9M A;  1VQO A;  5GAG C;  3W2D A;  1GUS A;  4ZKC B;  1HR0 L;  4JVZ A;  2Z4H A;  1P8L A;  1HCZ A;  2WB1 B;  4DPG A;  3GQB A;  1EZ8 A;  4JBM A;  1QNU A;  4DNT B;  4IOA A;  1TXY A;  3OSO A;  5HGQ A;  3TS0 A;  1C7Y A;  3QG1 A;  2RDF A;  3O13 A;  4RHR A;  4L63 B;  1PH5 A;  2XTI A;  3W3A A;  1JJG A;  4XTC S;  2KJX A;  1RL2 A;  2JA6 H;  4C2M B;  2B2T C;  1SMY C;  2ZXO A;  3PUZ A;  2HHH Q;  3T1Y Q;  3J80 i;  3SR1 A;  2K5N A;  3FMC A;  5COY A;  2F4I A;  4P2C B;  4A76 A;  3MAQ A;  2B8F A;  2XGT A;  5A2Q E;  1DGS A;  4HID A;  1L0Y B;  3ERQ A;  4P73 A;  1UE1 A;  3T1H L;  4JI7 L;  1N36 Q;  1HA5 A;  5IT9 E;  4K2K A;  2B63 H;  4DF7 A;  1ONL A;  4KTA A;  3PO3 G;  4XIG S;  4DUZ Q;  5IYB H;  2Q2H A;  3H0G G;  3TQY A;  5NUC A;  5CV7 A;  3KBX A;  4P71 A;  4DK3 C;  2KED A;  1H9K A;  1YNJ D;  3NEN A;  5L37 A;  1Y8O B;  4C3J B;  4LFA Q;  3M4O H;  4TQU S;  3BU2 A;  4KHV A;  1JWU D;  3EIV A;  1A3V A;  1QVG A;  4HJA A;  5I6W A;  4MTN A;  1UNS A;  4BY1 G;  1D6E C;  3DM3 A;  3TP6 A;  2UUB Q;  3S24 A;  1XNR Q;  4H7B A;  2F0J A;  3S17 B;  4OGQ C;  1JR0 D;  1VQD A;  2C35 B;  4A4I A;  4A75 A;  4A3M H;  2E2D C;  2DY7 A;  2ASB A;  2B2U C;  2YU9 B;  1SMY D;  4H0L C;  1HNX L;  4R4C A;  3M3Y H;  2VUM G;  1SND A;  1VQ6 A;  4ODG A;  1X54 A;  3MEF A;  3K57 A;  2BDN A;  4JBW A;  4LFB Q;  5ELO A;  1HNW Q;  1N32 L;  2PMZ E;  2PYK A;  1XMO Q;  3WOE A;  1KLG D;  3HOV H;  4LUV A;  4IZ8 A;  4C3I H;  5A2Q L;  2C9O A;  1U4R A;  2MNA A;  1SE2 A;  4LFB L;  1STN A;  4XQQ A;  1UEB A;  5CYU A;  3S14 B;  1LTA D;  3S1M H;  2JA5 B;  5CBE E;  1SYB A;  2B2W A;  4OWT B;  4A3J B;  4G7O C;  2NVY B;  2EXZ A;  3LWU A;  3IAY A;  3EN2 A;  4OIJ A;  3RZO H;  4C56 C;  1Z6H A;  1QE6 A;  1Q3L A;  1VQ4 A;  2BE5 C;  4K14 A;  4YCV A;  1SEB D;  2XRS D;  4A3K H;  4RHS A;  1OTC A;  1L1O A;  3NP8 A;  1K8G A;  1I94 L;  5T1I A;  3AYH B;  3SK8 A;  3NSW A;  2R92 G;  3I4M G;  5C3W A;  1SFO B;  1I6H H;  5K36 G;  1E1T A;  1SMX A;  4M8A A;  1S5B D;  4KMU C;  2JE6 I;  1PRT B;  2Y0S E;  3MXG A;  3GTQ B;  5CV5 A;  4EQP A;  1EWC A;  3N6R A;  1MJC A;  3UE1 A;  3WWV A;  1KAB A;  3UI2 A;  3SEB A;  4DR5 L;  4DV2 L;  5AFW A;  4BBS B;  3TP5 A;  5HGT A;  2E2I B;  2LXJ A;  5IYD G;  3PF4 A;  3I4O A;  3BVG A;  5DM6 3;  2HIX A;  2KHI A;  1BOS A;  5IGF A;  5EPL A;  4L8J A;  1J5E L;  1STA A;  1K83 H;  3SDZ A;  2NN6 I;  3E3X A;  4Y7N B;  3EVQ A;  4HCS A;  1FL0 A;  4IUU A;  4LF9 L;  1EYD A;  1EY7 A;  3URY A;  2JXM B;  3F2B A;  2BE5 D;  4PMB A;  3OYY A;  1LV9 A;  1BF4 A;  1PH7 A;  2IPK D;  2PW5 A;  4QMG A;  1HFG A;  1HNZ Q;  4CKB A;  3L3O C;  4OEM B;  2PCF B;  3PUW A;  3MA2 B;  1MSG A;  1VMC A;  1N34 Q;  4B3S Q;  3HKZ G;  1LT4 D;  4UY8 C;  3S1N B;  2JA8 G;  4PZ7 A;  3ND8 A;  3PUX A;  2ZXP A;  2JEB I;  3K0Y A;  2O5J C;  1LT5 D;  2F0M A;  2VQF Q;  3HS0 C;  2IHE A;  3S2H H;  2BH8 A;  2DNC A;  1N34 L;  1KQS A;  2ICE C;  3V2T A;  2N8N A;  1D2B A;  1CA6 A;  3H6M A;  2CH4 A;  2EYJ A;  2UUC L;  3PO3 H;  2L15 A;  4C3H B;  1K0S A;  5LMU Q;  2VQF L;  1YJN A;  4IOC A;  3PCO B;  1K9M C;  4BWG B;  3H0G H;  3MXU A;  4POF A;  1E7Z A;  4DAY A;  5C0X I;  5D3I B;  1CZG A;  1EIG A;  3AQQ A;  1JC7 A;  4TSS A;  2Z6K C;  3MC0 B;  3TSS A;  3HOX G;  3D8G A;  4JI8 Q;  4DV0 Q;  3OW2 A;  5ELC A;  1FGU A;  1WTW A;  4BY1 H;  4HR7 B;  1BKB A;  3WOF A;  1XNQ Q;  3PIO 3;  3BZC A;  4IN3 A;  4MIU A;  4F88 A;  3AU7 A;  1YVC A;  4DV0 L;  2D5D A;  2PZW A;  3HGB A;  2KQ3 A;  2XNA C;  4QCL A;  2L11 A;  2WAQ B;  1FJG Q;  2VUM H;  4DA2 A;  1Q12 A;  4ID6 A;  1IZ6 A;  1FGB D;  2LFN A;  2HQL A;  1SN8 A;  4DK0 A;  3QOL A;  3ZJY C;  2IHF A;  1TVX A;  1JB3 A;  2XIW A;  4LF6 L;  4PZ6 A;  1V9P A;  3M9B A;  2P5Z X;  3HOZ B;  5LL6 X;  3JAM i;  5IWA L;  1WCM G;  1T9H A;  4GKJ Q;  2SDF A;  4JPB W;  3GTO H;  1TWC B;  4CJ2 C;  4WFN 3;  3AFQ A;  4DV4 L;  3L9A X;  1XPR A;  1Q81 C;  3A55 A;  2QCP X;  5CV6 A;  1S5D D;  1OXV A;  2XVS A;  2F0T A;  2PW7 A;  3RD4 A;  1X56 A;  2VB3 X;  2N55 A;  4NXN L;  1F9S A;  1BDO A;  2HCC A;  5D14 A;  1Y1V G;  3TP7 A;  3Q24 A;  1AE2 A;  4FXD A;  4A3G G;  2R92 H;  5KYL A;  4POG A;  5J1Z A;  3CCV A;  5E1F A;  1A0I A;  1K8A C;  1CKO A;  1K8M A;  2FMM A;  4DR1 L;  1PMR A;  1Y8N B;  4NXM Q;  3GTM H;  4QIW E;  1B2T A;  3FRP B;  1I3Q H;  2ID0 A;  2R7Z G;  1TII D;  4BXX G;  4A3F H;  3GTP H;  4OHJ A;  5JAV A;  4BY7 B;  2L55 A;  1U9R A;  4NXM L;  2E5L L;  1KNE A;  1BVS A;  2GN5 A;  2EY6 A;  2N49 A;  1R9T H;  4LF7 L;  5IYD H;  1ET6 A;  4O0A A;  4R1J A;  5C4Z A;  1UAP A;  1TR5 A;  1V43 A;  2K50 A;  3U4Z A;  5C44 B;  1NJI C;  2R93 B;  3PIP A;  4KHZ A;  4IUQ A;  4BS9 A;  2NBF A;  2E8G A;  5ELD A;  4XQN A;  4L5S A;  1HQM C;  1D1K A;  5CR3 A;  1B8A A;  1II3 A;  1IBK Q;  4L6T B;  1N9W A;  5CV8 A;  2NVX H;  3RLO A;  4DR3 L;  5GQO A;  4ILW A;  1KIX A;  1XX8 A;  3KLS A;  5K5P A;  2XSC A;  1IBK L;  4NPS A;  5IOC A;  4IUP A;  1EIF A;  3FP9 A;  4PV1 C;  2BDO A;  1IW7 C;  3E6Z X;  2RDH A;  4O2D A;  3GTG B;  1M1K C;  2PPB C;  5M3F B;  3CMA A;  2ENB A;  3A7L A;  5LHY 1;  1G6Z A;  2KOL A;  1C8C A;  1EU4 A;  2MJ8 A;  4H13 C;  1NCV A;  4JOI A;  1JJC B;  5DAU A;  1RIP A;  1G29 1;  2PMZ B;  1XWE A;  3CCS A;  1Y1W G;  2F0P A;  3I90 A;  3VR5 A;  2K01 A;  4PNY A;  1SNM A;  4LWC A;  4JYA Q;  2K6A A;  4GLV B;  5KIX A;  1SXT A;  4DFA A;  5C0X J;  2BA0 A;  2ZTE A;  2NVT B;  1LTT D;  2EYH A;  3CC4 A;  3OPO A;  1SRO A;  4JYA L;  1TWG H;  3HOX H;  3RZD H;  1AN8 A;  2HDM A;  1B7Y B;  3ND9 A;  2HT1 A;  1VF7 A;  4XDX A;  2A73 B;  1TQO A;  2EQS A;  1QVC A;  2PZT A;  4KHP Q;  4M1U B;  4U67 3;  1NSN S;  1FR3 A;  2VY3 A;  1WJJ A;  1IW7 D;  3VDY A;  2UXB L;  1TY0 A;  3I72 A;  2UXD Q;  2Y0S B;  1QB5 D;  2B2V A;  4KHP L;  4ZUI A;  5IGC A;  4A3C G;  1B70 B;  1F9R A;  3EJI A;  2H4O A;  1VQ8 A;  4GN5 A;  2Q8T A;  2LSS A;  1IKM A;  3K7A B;  1E22 A;  3GV3 A;  4X3S A;  1ILP A;  2OTJ A;  3GP7 A;  4K0K L;  4H44 C;  3R3O A;  4JI3 Q;  3I4N B;  2K05 A;  3H3V H;  1ICW A;  3QWN A;  4ZRZ A;  3NWT A;  5I9P A;  1U4P A;  3Q0A A;  1EQT A;  3U4V A;  3PUY A;  3HOW H;  4P75 A;  2OQ0 A;  1Y1V H;  2I5L X;  1NTG A;  3HZX A;  4LUO A;  5M3M G;  2NTT A;  4DR7 L;  3E9H A;  2JA6 B;  3ONA B;  3GD7 A;  1LT6 D;  3VR6 A;  4OO1 G;  1I4Q A;  3CC2 A;  1G2T A;  2VQE L;  3J81 E;  2JYO A;  4A3L G;  5C4X B;  3N52 A;  1QZG A;  4IPG A;  5LL6 S;  4KY5 A;  4A3B H;  2R7Z H;  1OXS C;  4BXX H;  1JCK B;  1R4P B;  5HUR A;  2F0E A;  3FKI G;  4N9T A;  1B1Z A;  1X55 A;  2X6L A;  1AE3 A;  2OXP A;  4AYB G;  2JSO A;  3CD6 A;  3OOC A;  5J39 A;  3CCQ A;  1WTV A;  4XXE A;  3V05 A;  2D0O A;  3UDI A;  2E75 C;  4OON A;  4GN3 B;  3PF5 A;  3CHB D;  3GTL H;  4NMZ A;  3VA5 A;  1OXT A;  4UPA A;  4JI0 L;  1STE A;  1CTM A;  1K3B C;  1JJ2 A;  1QG7 A;  2EJM A;  4IPC A;  3HOU G;  4ZLT F;  2DNE A;  4GOP C;  4YCU A;  5GAE C;  3BVZ A;  1PA6 A;  4KJO A;  5H1S E;  2M9V A;  2KHS A;  2QIL A;  2RCN A;  2QW7 A;  1YHB A;  1M4V A;  2NUC A;  3A5Z B;  2SEB D;  1XXG A;  1KRS A;  4CJ1 B;  4A3M B;  2ZJP A;  2PNR C;  3U9S A;  2ZTC A;  3HKZ E;  3TN2 A;  4ALP A;  1DJR D;  2WB1 G;  3AFP A;  1RKN A;  3K6O A;  4B08 A;  3TEH B;  1CA5 A;  3J81 L;  1CT1 D;  1EIH A;  4UP8 A;  3Q23 A;  1CSQ A;  2YYZ A;  4R4I A;  2PO4 A;  2UU9 Q;  1BQQ T;  4RGT A;  3J7Y W;  3HRZ C;  1Y1W H;  1WOC A;  3HOV B;  3GV6 A;  1HR0 Q;  2B2T A;  2A6E D;  3J7A 5;  1HPC A;  1BUV T;  3S15 B;  2EYO A;  2JA9 A;  1KC8 C;  3VR3 A;  3CCL A;  3NEL A;  2WII B;  1VDZ A;  3DHQ A;  2VL6 A;  1AZP A;  1EIY B;  1VQK A;  4TKO B;  4I7A A;  4P74 A;  1LTB D;  4IFD I;  1LAB A;  4CJ0 B;  1K0R A;  4A3K B;  3E9I A;  2ZTD A;  1M8A A;  2OEO A;  1FVI A;  4K5W A;  4QUC A;  3S16 H;  2RKS A;  1PH1 A;  3U9O A;  5I6Y A;  2Z6B A;  3M4P A;  4V0B A;  3M4Y A;  4FF2 A;  4K5V A;  5I4D A;  1CKN B;  2ZJQ A;  3F2D A;  4C3J G;  4TVA B;  1MGS A;  3CW2 C;  2LKV A;  1CUK A;  3T1H Q;  2F0G A;  2EJG C;  4IQZ A;  4JI7 Q;  2CWP A;  4GKK L;  1VF5 C;  4QIW B;  2FFK B;  3G71 A;  2O2L D;  1O7Y A;  4KJN A;  1IL8 A;  4FF1 A;  1ZXT A;  3I73 A;  3TZD A;  1F9P A;  1ROD A;  1C0A A;  3CU7 A;  4ULL A;  1HA6 A;  1S3O A;  2B2U A;  5EGT A;  1HRJ A;  3PUV A;  2K4K A;  1VQC A;  4DV6 Q;  5BN3 A;  3TME A;  2K04 A;  3I55 A;  5EKL A;  3CCR A;  2FXQ A;  3P1H A;  2BH2 A;  1PZJ D;  2JA7 H;  4DKA C;  5I2Y A;  1F2Z A;  1Q82 C;  3D6W A;  1SDF A;  1B50 A;  3HFZ B;  4OEL B;  5M3M H;  4DV6 L;  2Q2U A;  1K3R A;  1IYJ B;  1HNX Q;  3SVM A;  4QF4 A;  2JA5 G;  3H09 A;  4IUN A;  2TMP A;  4A3J G;  5JJI A;  1EY9 A;  3S1Q H;  1Q8K A;  3D6C A;  3RLF A;  4OO1 H;  1N32 Q;  5BN4 A;  4BBR H;  4JI2 Q;  1QVF A;  5E4X A;  1Y69 U;  4A3L H;  1UE7 A;  1UE5 A;  1BBW A;  5IYC G;  1CI3 M;  5FLX E;  2A5H A;  3H3V C;  1V1O A;  4GNX C;  3A8J E;  4JI2 L;  1G8Z D;  5M5Y H;  2D2C C;  1BNZ A;  1A2U A;  4R4Q A;  1M90 C;  3PGZ A;  3KBG A;  4HIM A;  1BR9 A;  4DAV A;  1EYG A;  1S4Z A;  1YEZ A;  4A3I B;  4KLK A;  4FF3 A;  2HQE A;  4IUR A;  3BYY B;  4FP5 D;  4DNI A;  1NBW A;  4YWL A;  2RHQ B;  2UUA L;  3MEH A;  3CQZ B;  1T5E A;  4ME5 A;  3H0G B;  3FVQ A;  1SE4 A;  1P16 A;  2WV6 D;  2BA1 A;  3G7L A;  2ZJR A;  1ASZ A;  2WKC A;  2PQA A;  1Y8P B;  2FMC A;  3QO2 A;  1I94 Q;  3HOU H;  1SNQ A;  4DV1 L;  4EQ5 A;  1MSH A;  4F8M A;  5JEA H;  4BY1 B;  1PFS A;  1NR2 A;  2WIN B;  1Q1E A;  1EYA A;  1SYE A;  1V1P A;  4CHT B;  4FYD A;  4KD4 A;  1EWH A;  3GTJ H;  4UP9 A;  2R3Z A;  1KRT A;  2WP8 J;  1K28 A;  5AJ3 L;  1EOT A;  1ENA A;  1PTO B;  3R2I A;  1YJ9 A;  2XWJ B;  1XMQ L;  3B6Y A;  4DR5 Q;  1G51 A;  4DV2 Q;  2Q2T A;  4LF8 L;  2VUM B;  5JPN C;  2AHO B;  5FLM G;  1RJT A;  2ES2 A;  1RD9 D;  1RTO A;  4CKE A;  1EY6 A;  3LWE A;  1GHJ A;  5IP7 G;  1W6K A;  2XRQ D;  4DAP A;  1E2V A;  4RGM A;  5FLX L;  4QUF A;  3TP8 A;  3A54 A;  3HKS A;  3S1R B;  2L0C A;  2E74 C;  1J5E Q;  1PDQ A;  1VQF A;  4O42 A;  4A3E B;  4DV7 L;  4B3R L;  4K2L A;  2F1M A;  1GHK A;  5J22 A;  1BCP C;  4LF9 Q;  4WJ3 M;  1CHQ D;  1BO0 A;  3GTO B;  5FKA C;  1SJE D;  1KD1 C;  4ZKB B;  4IFD J;  4X6A H;  3I7F A;  2EY2 A;  3KLW A;  1L1O C;  2XWB B;  2OF1 A;  2NZH A;  2EYL A;  3J80 L;  4YY3 L;  3F8T A;  4C3H G;  2E76 C;  1HR0 W;  4JI5 Q;  4RCO A;  1TY2 A;  1B3Q A;  5BR8 Q;  1CHP D;  1H9J A;  5C5L A;  4C3J H;  4J6H A;  2HD3 A;  3KJP A;  2YV5 A;  4JI5 L;  4GOP B;  1BCP F;  2F3I A;  5BR8 L;  1RCV D;  1CKM A;  3LNN A;  1AFP A;  1GO3 E;  4L5Q A;  2UUC Q;  2CFM A;  1I3Q B;  5KNB A;  2EE1 A;  4IJL A;  1KLU D;  1VQH A;  4A3F B;  4HAE A;  1PLF A;  4X62 L;  1FNU A;  4PMC A;  5IGB A;  1E0B A;  2YU9 H;  1MI2 A;  3HP3 A;  4OWX B;  3I8Z A;  2N3S A;  1HTP A;  2VXW A;  3CCU A;  2WAQ G;  1D7Q A;  1GJX A;  3H94 A;  1LTR D;  1HUN A;  5C3E B;  5IE8 A;  3CKI B;  1BCP D;  4FO2 A;  1SYC A;  1L0X B;  3L0O A;  2RVL A;  3RMH A;  4DK1 A;  2NTS A;  1DOL A;  3MXP A;  4JC0 A;  1XYI A;  3V96 A;  3EA6 A;  1ML0 D;  5M9O A;  3JC6 6;  3E0J A;  1A15 A;  1GUN A;  4XYQ A;  3HOZ G;  2AKW B;  5KRU A;  1A8V A;  3KF6 A;  1WFQ A;  4C1N K;  1U0L A;  1PH8 A;  3VR2 A;  1I4R A;  5C4J B;  4A3J H;  2JA5 H;  4A3D B;  1UWV A;  2MUY A;  2NVY H;  1LM0 A;  3RR5 A;  1S5C D;  5GRO A;  3DWQ A;  3E0E A;  4V19 0;  2Z9H A;  1XTC D;  1JT8 A;  1PZK D;  2F52 A;  1VQ5 A;  2F0W A;  4DK6 C;  2IX3 A;  4LF6 Q;  3HKZ B;  4GS3 A;  5IYC H;  4QY7 A;  5F2D A;  4PG3 A;  1Z47 A;  5IWA Q;  3GDE A;  4J15 A;  2OTL A;  4AYB E;  5EBD A;  1J8I A;  3J7A V;  4DV4 Q;  1QUQ B;  1TWH H;  4WJW A;  4F87 A;  2V4D A;  3RN5 A;  4K5X A;  1T5X D;  3K7U C;  1QNK A;  3VYR A;  2YTV A;  3J81 c;  4FNF A;  3AMU A;  4DUY L;  4NXN Q;  4J1M A;  5CV4 A;  5A35 A;  2F0N A;  4IUT A;  4PMW A;  2A8V A;  4BY7 G;  1N8R C;  1KL9 A;  2SOB A;  1J6Q A;  3RZD B;  1Q86 C;  3F2C A;  1HHV A;  2EY5 A;  1FNV A;  1GXD C;  3I2Z A;  4DR1 Q;  2MQH A;  5C44 G;  3I4M H;  5G3L F;  5K36 H;  2L4N A;  2R93 G;  1NUC A;  1TU2 B;  3RNU A;  1EL0 A;  1OXU A;  4FVM A;  4X3U A;  1BBU A;  1KAA A;  2H5X A;  4EQN A;  2E5L Q;  1IYU A;  5FLM H;  5LMN L;  1CKN A;  4LF7 Q;  2IT1 A;  1N33 L;  1WVL A;  3Q6S A;  3CCE A;  3OWE B;  3SGI A;  2BCO A;  1QOH A;  5IP7 H;  3MFY A;  4X66 Q;  3Q8D A;  3DEO A;  3PSI A;  1IYV A;  1ILQ A;  5G3L D;  2JP1 A;  4RGO S;  3S1N H;  5M3F G;  4CDF C;  3FPU B;  2IWH A;  4X66 L;  3T16 A;  4GNX B;  4DR3 Q;  1JWM D;  2MO1 A;  3KF8 B;  1PYS B;  4IAL A;  3D4W A;  3PIO A;  1ZEQ X;  4WOR A;  1X3G A;  3F2U A;  3LGJ A;  4N9P A;  2CWA A;  1AEX A;  3HOW B;  4KKT A;  3PO2 B;  2CVR A;  2X6G A;  1ICF B;  4ABN A;  2KEC A;  1D1I A;  2ZM6 Q;  1LTS D;  2KEE A;  4JBK A;  1B9N A;  3JAM E;  2I5M X;  1E24 A;  1X65 A;  3QOJ A;  3GTK H;  2JA8 H;  2VZA A;  3KLR A;  2ZM6 L;  3MFG A;  3KK7 A;  1RF2 D;  3DWA A;  1B44 D;  4A3B B;  2K5V A;  3OTO L;  1C9O A;  1D5Z C;  1H9S B;  4QL5 A;  2R61 A;  1PH6 A;  1TS3 A;  1O7Z A;  2D9U A;  2ATW A;  5C3X A;  4FXK C;  1LTI D;  3SXH A;  1F2M A;  1Q8I A;  2CQO A;  2PQA B;  1W6J A;  3GTL B;  1LAC A;  2CCZ A;  2Y0S G;  1PYB A;  1TKW B;  3VYU A;  3CCJ A;  1GD7 A;  1U5K A;  4FF4 A;  1H95 A;  1NE3 A;  1WTX A;  5JEA J;  3TRZ A;  2HCI A;  1VQ9 A;  3ERS X;  3D31 A;  1V1P B;  1X32 A;  3M85 A;  4JV5 L;  3A74 A;  4EX5 A;  1G6P A;  1LUZ A;  3M4Q A;  4JI1 L;  2G5D A;  3HOZ H;  4X64 L;  2B2Y A;  1DOM A;  4F7X A;  1GUW A;  2J4X A;  3MHB A;  3S2D H;  1GKH A;  1JE4 A;  1SYD A;  2B39 A;  1BCP B;  4R4T A;  3J81 i;  1V8Q A;  3I4N G;  4R9W A;  1GM5 A;  2UXB Q;  4MNO A;  1WYD A;  1B53 A;  4DR6 Q;  1QWY A;  5I9O A;  1YNN C;  1EFW A;  3MVV A;  3HG9 A;  1VQG A;  2JEA I;  4A93 B;  1EZ6 A;  5M5W H;  4Z9C B;  5E3F A;  4JOI C;  1W2B A;  2F0Q A;  3JAM L;  3HOY B;  3MZ5 A;  4DR6 L;  3QR8 A;  3RN2 A;  3PQI A;  4K0K Q;  3GO5 A;  2MPM A;  1EUJ A;  1O7L A;  2JA6 G;  1EQR A;  1UEA B;  1PHJ A;  2AWN A;  4YIJ A;  5D65 A;  1Y1W B;  2F4V L;  1NAP A;  3BDL A;  1TWF B;  3A7A B;  4HJ9 A;  1WCM H;  3ULP A;  2PNH A;  4KKU A;  4APV A;  3OHX C;  5C4X G;  5ELE A;  1GUT A;  1WTQ A;  4ZQ3 A;  5FLX c;  2B8G A;  3G6J B;  3FEW X;  4RGN A;  4WRD A;  4BY7 H;  4G4K A;  4DR7 Q;  2CKZ B;  4X65 L;  1YIT A;  1B4O A;  1EY8 A;  2F3W A;  3TZU A;  1QJO A;  1RDP D;  2YTX A;  2VQE Q;  4A3G H;  3UDX A;  2F0D A;  5C44 H;  4LJZ C;  5JVH 3;  3S16 B;  2R93 H;  3KFU A;  2K32 A;  2A19 A;  1MBY A;  4KN4 C;  2DY8 A;  2IL8 A;  1YNN D;  1O78 A;  2NVQ H;  3BZD B;  3CPF A;  1KHI A;  1I50 H;  2B2V C;  2RSN A;  3J80 c;  2NN6 G;  4HMI A;  1PRT C;  1PYW D;  3PMF A;  3BG3 A;  3KJO A;  1X9N A;  4GOP A;  4GLX A;  4G57 A;  4MTK A;  3VA7 A;  1YJW A;  5CV9 A;  4JI0 Q;  1AP0 A;  2QKI C;  2B63 B;  1RHP A;  1TS2 A;  5KGU A;  1GOZ A;  3GTG H;  5E4W C;  1HTL D;  5M3F H;  1X3P A;  5FO8 B;  1HZB A;  4JI6 L;  1HZ9 A;  1S72 A;  2PI2 E;  3M4O B;  3KF6 B;  2A68 C;  1F2Y A;  2JA7 B;  3F1Z A;  2K14 A;  2K5Q A;  4HCE A;  1FNW A;  5FO7 B;  3KYH C;  5M3M B;  4DR4 L;  4Q0F A;  1LTL A;  3AB9 A;  1UUP A;  3AEV A;  4FDB A;  3OIP A;  1NR4 A;  2RA4 A;  5TSS A;  3S1Q B;  5C0X G;  4R4O A;  4B9X A;  1QCB D;  4BBR B;  3MXN B;  2I5H A;  2F0I A;  2JN4 A;  3M3Y B;  1JOK A;  1BBX C;  1H9R A;  5C4H A;  2IJ0 A;  1SNP A;  1YI2 A;  4DR2 L;  4LF5 L;  3K5M A;  1DCZ A;  2Z8L A;  2RHS B;  1VQI A;  2N78 A;  1PFN A;  2EYF A;  2RBM A;  1GUG A;  3CAM A;  1SNO A;  2L9H A;  4C3I B;  5IGE A;  3M7N A;  1UE6 A;  4RCN A;  4DAM A;  2IW3 A;  4IPH A;  1KTK A;  3D4D A;  5CGK A;  2H1E A;  4UP7 A;  3H3V I;  1QUQ A;  2KEN A;  4FXG C;  3S1M B;  1DD2 A;  4HIO A;  1YIJ A;  3NXW A;  2UXC L;  2NWG A;  3R8B A;  3RZO B;  2GVA A;  1KNA A;  2EVB A;  2EY1 A;  2V1C C;  1NMF A;  3I4N H;  4CKC A;  3GTJ B;  2C5C A;  2WAC A;  4GKK Q;  1I6H B;  5FK9 C;  2K33 A;  5CC4 A;  2QA4 A;  2RDG A;  2K1B A;  2TSS A;  1WTO A;  1TWA H;  2NZ1 D;  2Z1C A;  4JBJ A;  4G7Z C;  2QGQ A;  3I56 A;  3NTI A;  3C2P A;  4A3C H;  3G6E A;  2E2H H;  3CRL C;  3IFD A;  4DU9 A;  1HH2 P;  5JJZ A;  3DWP A;  2AMC B;  4MZ9 A;  1K73 C;  1STG A;  4NDX A;  4RAU C;  3S9W A;  1Z7T A;  3A8I E;  1MKH A;  3W1B A;  3R2T A;  1U4L A;  2F0L A;  1EY4 A;  3I4L A;  4I65 A;  5C4X H;  2QDB A;  1PZI D;  1B9M A;  1JE5 A;  4NW2 A;  4XT1 B;  3K58 A;  2HHH L;  3ULJ A;  3T1Y L;  5DLQ E;  4OIK A;  1MHW C;  2KVM A;  1K83 B;  2FJ2 A;  1JOO A;  1JWS D;  3Q22 A;  4GNX A;  3KF8 A;  4PZ8 A;  4A3I G;  3BVM A;  2L5T A;  4YWM A;  5KYI A;  3UE0 A;  3KOJ A;  3PV0 A;  1N36 L;  3TRE A;  2X69 A;  4JK1 C;  2E2J H;  1V1Q A;  4DUZ L;  1AZQ A;  2OQK A;  2NN6 H;  2IY5 B;  3STB C;  2Q8I B;  4BA2 I;  1EY5 A;  3SK6 A;  5BN5 A;  4MHE A;  3C46 A;  3A56 A;  4HJ7 A;  2UUA Q;  3FKI H;  4LFA L;  3NWS A;  3S2H B;  4G7H C;  3NE5 B;  1PH3 A;  2OT2 A;  1SNC A;  2Z4I A;  4N8F A;  1SYG A;  2UUB L;  2PZU A;  4OL7 A;  4GZY C;  4HJ8 A;  2EZV A;  3I3C A;  2VW9 A;  1XNR L;  4XYO A;  3PO3 B;  1H9S A;  3NBH A;  4RMF A;  1G2S A;  2ICI A;  4DV1 Q;  2XN9 C;  1MD2 D;  4DGZ A;  5M5X H;  4LMQ D;  3J80 E;  2CW0 C;  1GVP A;  2VS1 A;  3K80 C;  3KDF B;  5ELF A;  3A0J A;  1HUM A;  4N8X 1;  2F0V A;  4BBS G;  2VNU D;  3W1G A;  5AJ3 Q;  2KCT A;  3OIQ A;  4QGU A;  2R6G A;  4A3E G;  3TS2 A;  2EPB A;  4UAI A;  1HNW L;  2MP1 A;  3CF5 A;  2K75 A;  3S15 H;  1XMQ Q;  3TDQ A;  4LF8 Q;  5C5M A;  2J7Z A;  5IT9 L;  1XMO L;  2CQA A;  1EQV A;  1QZH A;  2MHV A;  1C4Q A;  2Q8R E;  5EQ0 A;  1WTH A;  5C0X H;  4OWW B;  1VQL A;  4X3T A;  1ENC A;  3ZYY X;  3RLN A;  4EGV A;  2ZT9 C;  2WFW A;  3K0X A;  1J9O A;  3STB D;  2A1A A;  4DV7 Q;  4KI0 A;  4B3R Q;  3NEM A;  1BXT A;  2K7V A;  3K5L A;  1QIL A;  1U4M A;  1PH4 A;  4C2M H;  4DNR B;  1O7I A;  1IBM Q;  1VQN A;  2D62 A;  3H15 A;  1PV4 A;  3R93 A;  2M00 A;  1TWH B;  2O4X A;  3ER0 A;  2B2W C;  3JAM c;  3J7Z C;  1PFB A;  4NKL A;  3J7A F;  1IBM L;  3CC7 A;  3L7Z C;  1CQV A;  2EIF A;  4HTH A;  4YY3 Q;  4HSV A;  4JW0 A;  3EQL C;  4EQO A;  1EQQ A;  3T56 B;  4A3F G;  2CW0 D;  4CGY B;  2EYM A;  1JOR A;  3D4R A;  3CME A;  1I6V C; 
#chains in the Genus database with same CATH homology
 3PUZ A;  2JJQ A;  2HHH Q;  3T1Y Q;  2IT1 A;  4LF7 Q;  1N33 L;  5GAH C;  3CCE A;  1NY4 A;  3SGI A;  5IP7 H;  3J80 i;  2K5N A;  4X66 Q;  3Q8D A;  1YHA A;  5C3E G;  4P72 A;  1VQM A;  4A76 A;  3U4V A;  3PUY A;  3PSI A;  4IO9 A;  2XGT A;  4OO1 I;  3HOW H;  4P75 A;  1DGS A;  1Y1V H;  2I5L X;  1NTG A;  2OQ0 A;  4LUO A;  5M3M G;  4HID A;  4X62 Q;  3S1N H;  4P73 A;  1UE1 A;  5M3F G;  3E9H A;  4DR7 L;  3T1H L;  4X66 L;  4JI7 L;  1N36 Q;  1E1O A;  2B63 H;  2Z6K A;  3EBE A;  4GNX B;  3GD7 A;  4DR3 Q;  2Q2I A;  1PVO A;  2MO1 A;  3KF8 B;  4OX9 Q;  1PYS B;  3PO3 G;  3CC2 A;  3S17 H;  4XIG S;  4OO1 G;  2VQE L;  4DUZ Q;  4LUZ A;  3W5O A;  1X3E A;  5IYB H;  2Q2H A;  3PIO A;  1XJV A;  4A3L G;  3H0G G;  3TQY A;  1QZG A;  4IPG A;  4ME3 A;  4P71 A;  4DK3 C;  1X3G A;  2AWO A;  3LGJ A;  2CWA A;  4A3B H;  3NEN A;  2R7Z H;  1OXS C;  1PH9 A;  1D8L A;  4OX9 L;  4BXX H;  4LFA Q;  3M4O H;  4TQU S;  3BU2 A;  3FKI G;  1X55 A;  3EIV A;  2ZM6 Q;  1AE3 A;  1QVG A;  4AYB G;  4HJA A;  3CD6 A;  4A3D G;  4MTN A;  4JBK A;  4BY1 G;  3CCQ A;  2UUB Q;  3DM3 A;  1HNZ L;  3IRB A;  3S24 A;  2I5M X;  1XNR Q;  1E24 A;  2D0O A;  1X65 A;  4NB3 A;  3UDI A;  2RF4 A;  4OON A;  3GTK H;  5JJL A;  4GN3 B;  1VQD A;  2C35 B;  5IY0 A;  4A4I A;  4B3S L;  2VZA A;  4A75 A;  3PF5 A;  2ZM6 L;  2JA8 H;  3GTL H;  4A3M H;  1OXT A;  4A3I H;  4UPA A;  5IP9 G;  4JI0 L;  2ASB A;  1E3P A;  1JJ2 A;  3S14 H;  2K5V A;  3S15 H;  1HNX L;  4R4C A;  3OTO L;  1C9O A;  3M3Y H;  4IPC A;  3CQZ H;  2VUM G;  3HOU G;  4QL5 A;  1VQ6 A;  4GOP C;  1X54 A;  4YCU A;  2DUD A;  5GAE C;  1PH6 A;  3MEF A;  1PA6 A;  4JBW A;  2LXK A;  2ATW A;  4LFB Q;  5ELO A;  5H1S E;  1HNW Q;  4RG1 A;  1N32 L;  5LMU L;  2PMZ E;  2RCN A;  2CQO A;  3CP0 A;  1SE8 A;  2PQA B;  1JB7 A;  1XMO Q;  1YHB A;  3HOV H;  3A5Z B;  4GN4 B;  4LUV A;  2CCZ A;  2Y0S G;  1PYB A;  1KRS A;  4C3I H;  2MNA A;  2ZJP A;  3CCJ A;  1GD7 A;  1U5K A;  3CPW A;  1H95 A;  1NE3 A;  4LFB L;  2ZTC A;  5JEA J;  3TRZ A;  3HKZ E;  1Q46 A;  1UEB A;  4ALP A;  4B3T Q;  2WB1 G;  3ERS X;  3D31 A;  1VQ9 A;  3S1M H;  3M85 A;  3AFP A;  3A5U A;  4JV5 L;  3A74 A;  4EX5 A;  1G6P A;  1LUZ A;  4JI8 L;  4OWT B;  1SFO H;  3M4Q A;  4JI1 L;  4AH6 A;  4QQB X;  3TEH B;  4DUY Q;  4LFC Q;  3HOZ H;  4X64 L;  3EN2 A;  1XNQ L;  3S2D H;  4UP8 A;  1GKH A;  4YHH Q;  3RZO H;  1CSQ A;  2YYZ A;  4B3T L;  4R4T A;  4R4I A;  3J81 i;  3GTQ H;  3I4N G;  2UU9 Q;  3K81 C;  1GM5 A;  2UXB Q;  1VQ4 A;  4MNO A;  1Y1W H;  4YCV A;  1WOC A;  1WYD A;  1MIU A;  4A3K H;  4DR6 Q;  4DV5 Q;  1HR0 Q;  4LFC L;  1I5F A;  1OTC A;  1L1O A;  1EFW A;  3J7A 5;  2HIV A;  1VQG A;  1K8G A;  2JEA I;  1I94 L;  4YHH L;  5M5W H;  3AYH B;  1FJG L;  4JOI C;  4BBS H;  2R92 G;  4IJH A;  3I4M G;  1W2B A;  2JA9 A;  3S1R H;  1HNW L;  1I6H H;  5K36 G;  2E2I H;  1E1T A;  1SMX A;  4A3E H;  1LYL A;  3RN2 A;  4DR6 L;  4DV5 L;  1KC8 C;  2B29 A;  3CCL A;  3NEL A;  1ASY A;  4K0K Q;  3GO5 A;  2JE6 I;  1VQK A;  1EUJ A;  2VL6 A;  1EIY B;  1HZC A;  2Y0S E;  4P74 A;  5LMN Q;  2JA6 G;  3HOU H;  1EQR A;  4IFD I;  1PHJ A;  2AWN A;  1VQJ A;  1N33 Q;  1K0R A;  2F4V L;  3E9I A;  2ZTD A;  3FHW A;  4JI4 Q;  1MJC A;  2WB1 E;  3UE1 A;  3L2P A;  4Y7N H;  1FVI A;  3WWV A;  1WCM H;  4HJ9 A;  2PNH A;  3ULP A;  4APV A;  1IXR A;  3S16 H;  5C4X G;  4DR5 L;  4DV2 L;  1PH1 A;  4GKJ L;  3M4P A;  4IFD G;  4OXP A;  1CKN B;  2LXJ A;  5GAD C;  1L2F A;  3F2D A;  2ZJQ A;  5FLX c;  4JI4 L;  3UDG A;  5IYD G;  3HOW G;  3PF4 A;  3I4O A;  4TVA B;  3PO2 G;  1SLJ A;  4BY7 H;  3CW2 C;  2HIX A;  2CKZ B;  1CUK A;  2KHI A;  4X65 L;  3T1H Q;  4DR7 Q;  1YIT A;  4JI7 Q;  3ULL A;  2CWP A;  2QEX A;  4GKK L;  1J5E L;  2YTX A;  2K5H A;  2VQE Q;  3G71 A;  1K83 H;  4A3G H;  3UDX A;  2NN6 I;  5C44 H;  1IL2 A;  3CCM A;  1JMC A;  4Y52 H;  2R93 H;  3KFU A;  4JG2 A;  1FL0 A;  4LF9 L;  2A19 A;  3F2B A;  4A3B G;  3OYY A;  1C0A A;  1PH7 A;  1A63 A;  2NVQ H;  3CPF A;  1KHI A;  1S3O A;  1I50 H;  3J80 c;  1Q7Y C;  2NN6 G;  3PUV A;  2K4K A;  1HNZ Q;  1VQC A;  4C3H H;  4DV6 Q;  2I0Q A;  3KJO A;  4LNQ A;  1X9N A;  3PUW A;  4GOP A;  3I55 A;  4GLX A;  3CCR A;  1N34 Q;  4B3S Q;  3HKZ G;  5C3E H;  4UY8 C;  1WI5 A;  2FXQ A;  2BH2 A;  2JA7 H;  4PZ7 A;  4DKA C;  1A62 A;  2JA8 G;  3ICE A;  3PUX A;  1YJW A;  4JI0 Q;  1Q82 C;  2JEB I;  1VCI A;  3HFZ B;  5M3M H;  3J81 j;  4DV6 L;  2VQF Q;  4BA1 I;  2Q2U A;  1K3R A;  1IYJ B;  1HNX Q;  3OTO Q;  2IHE A;  3GTG H;  5M3F H;  2BH8 A;  3S2H H;  1N34 L;  2JA5 G;  1KQS A;  4A3J G;  2N8N A;  3UDF A;  5JJI A;  1HZB A;  4JI6 L;  3S1Q H;  2UUC L;  1Q8K A;  3RLF A;  2L15 A;  3PO3 H;  1HZ9 A;  1N32 Q;  4BBR H;  4JI2 Q;  2VQF L;  5LMU Q;  1IBL Q;  1S72 A;  1QVF A;  2IX1 A;  1YJN A;  4IOC A;  2PI2 E;  5C4J H;  3PCO B;  4A3D H;  1K9M C;  4A3L H;  3NBH B;  3H0G H;  1S40 A;  3KF6 B;  4POF A;  1UE7 A;  1UE5 A;  1E7Z A;  1BBW A;  5IYC G;  3F1Z A;  2K14 A;  5C0X I;  3KYH C;  3AQQ A;  4GNX C;  1Y14 B;  1IBL L;  4JI2 L;  4DR4 L;  5FJ8 G;  4A93 G;  2Z6K C;  5M5Y H;  4JV5 Q;  1LTL A;  3BJU A;  3HOX G;  4JI8 Q;  3AEV A;  4DV0 Q;  1HZA A;  3OW2 A;  4FDB A;  4IPD A;  4R4Q A;  1FGU A;  3PGZ A;  4JI1 Q;  4HIM A;  1M90 C;  3D0F A;  4BY1 H;  1BKB A;  4QJF A;  1EYG A;  1YEZ A;  4X64 Q;  1XNQ Q;  1OXX K;  4KLK A;  5C0X G;  1Q1B A;  4R4O A;  3BZC A;  2JQO A;  2UUA L;  4GLA C;  1NBW A;  4YWL A;  2RHQ B;  2I5H A;  3MXN B;  4DNI A;  4LF4 Q;  1YVC A;  5E7N A;  2GVB A;  4DV0 L;  1VS0 A;  5IP9 H;  4DV3 Q;  1P16 A;  2BA1 A;  1VQB A;  4YCW A;  1YI2 A;  4DR2 L;  4LF5 L;  1ASZ A;  2ZJR A;  1AH9 A;  2PQA A;  2R7F A;  3KDF A;  1I94 Q;  5JJK A;  4LF4 L;  1FJG Q;  1VQI A;  2N78 A;  2RHS B;  1Q12 A;  4DV1 L;  2KBN A;  4EQ5 A;  2VUM H;  1TWC H;  3CAM A;  1IZ6 A;  4JCV E;  5ELN A;  1XTD A;  1PFS A;  4DV3 L;  1Q1E A;  2HQL A;  3M7N A;  1SN8 A;  4WJ4 A;  1UE6 A;  4DAM A;  3ZJY C;  1MJE A;  4IPH A;  2IHF A;  1L1O B;  4UP7 A;  3GTJ H;  4UP9 A;  3H3V I;  1QUQ A;  4LF6 L;  2KEN A;  4PZ6 A;  1V9P A;  1KRT A;  1YHQ A;  2WP8 J;  3M9B A;  2F4V Q;  5AJ3 L;  4HIO A;  1YIJ A;  5IT9 c;  3JAM i;  2UXC L;  1YJ9 A;  5IWA L;  2IX0 A;  1WCM G;  1XMQ L;  3B6Y A;  4DR5 Q;  1G51 A;  4DV2 Q;  2Q2T A;  1T9H A;  4LF8 L;  4GKJ Q;  2GVA A;  3GTO H;  2AHO B;  5FLM G;  3AFQ A;  4DV4 L;  2ES2 A;  1Q81 C;  1XPR A;  2KCM A;  1YNX A;  2V1C C;  1OXV A;  1NMF A;  5IP7 G;  3I4N H;  4X65 Q;  1X56 A;  3BZK A;  3HKS A;  4HJ5 A;  4GKK Q;  1X3F A;  1J5E Q;  3K8A A;  3CXC A;  1VQF A;  2OWO A;  2B3G A;  4NXN L;  4DV7 L;  4B3R L;  1Y1V G;  1AE2 A;  2QA4 A;  4A3G G;  1SRU A;  2R92 H;  2DGY A;  1TWA H;  4LF9 Q;  4WJ3 M;  4JBJ A;  4POG A;  2QGQ A;  3I56 A;  3CCV A;  2B63 G;  2UXD L;  1A0I A;  1NMG A;  1CKO A;  1K8A C;  1Z9F A;  1VQA A;  4A3C H;  3G6E A;  1KD1 C;  3U58 A;  2E2H H;  4IFD J;  4X6A H;  1HH2 P;  4DR1 L;  2AMC B;  3I7F A;  4MZ9 A;  1K73 C;  4NXM Q;  3GTM H;  5IYB G;  3KLW A;  1L1O C;  4QIW E;  2NZH A;  1HJP A;  1CSP A;  1MKH A;  1I3Q H;  2ID0 A;  3G48 A;  3F8T A;  3W1B A;  4YY3 L;  2R7Z G;  3DLL A;  1XPU A;  1HR0 W;  4JI5 Q;  4BXX G;  4A3F H;  3GTP H;  4AQY Q;  4JI3 L;  5BR8 Q;  5C4X H;  4NXM L;  2E5L L;  1JE5 A;  1W3S A;  2JA7 G;  1BVS A;  2GN5 A;  2N49 A;  1R9T H;  3ULJ A;  2HHH L;  3T1Y L;  5DLQ E;  4C3J H;  4LF7 L;  3PO2 H;  5IYD H;  4O0A A;  4R1J A;  1SR3 A;  3KJP A;  2YV5 A;  2K50 A;  1V43 A;  4JI5 L;  1KXL A;  4GOP B;  3U4Z A;  4AQY L;  2F3I A;  5BR8 L;  1NJI C;  1X6O A;  4GNX A;  2K52 A;  2Z0S A;  1CKM A;  1KAW A;  5LMN W;  3PIP A;  4A3M G;  1GO3 E;  4PZ8 A;  4KHZ A;  4L5Q A;  4A3I G;  5HY6 A;  2UUC Q;  2CFM A;  2E8G A;  4JI6 Q;  1PH2 A;  4L5S A;  4IJL A;  2MO0 A;  4BBR G;  1VQH A;  4YWM A;  1B8A A;  3UE0 A;  4X62 L;  3KOJ A;  3PV0 A;  2NZO A;  1IBK Q;  5J3B A;  1N36 L;  1N9W A;  2YU9 H;  2NVX H;  4OWX B;  3RLO A;  4DR3 L;  3TRE A;  5GQO A;  4DR4 Q;  2N3S A;  1KIX A;  3CCU A;  2E2J H;  1V1Q A;  4DUZ L;  2WAQ G;  1YBY A;  3G4S A;  2OQK A;  2R7D A;  4B3M Q;  1D7Q A;  2IY5 B;  3STB C;  1IBK L;  4NPS A;  3HOV G;  2D0P A;  5IE8 A;  4BA2 I;  1EIF A;  3FP9 A;  4L5T A;  4DAY B;  3L0O A;  4HJ7 A;  4AIM A;  2UUA Q;  3FKI H;  4LFA L;  4O2D A;  2NVT H;  2PI2 A;  1M1K C;  4B3M L;  4JC0 A;  3CMA A;  1PH3 A;  2YTY A;  2UUB L;  4LF5 Q;  4DR2 Q;  3JC6 6;  4HJ8 A;  2EXD A;  4JOI A;  2VW9 A;  3HOZ G;  1JJC B;  2AKW B;  1XNR L;  1RIP A;  1G29 1;  1A8V A;  3KF6 A;  1WFQ A;  2JA5 H;  1U0L A;  4RMF A;  4DV1 Q;  1PH8 A;  4JYA L;  1L0W A;  4A3J H;  1UWV A;  2NVY H;  2ALY B;  1LM0 A;  2OCE A;  3RR5 A;  1VQ7 A;  5GRO A;  3CCS A;  1Y1W G;  5JEA G;  3U50 C;  5M5X H;  4A3K G;  1VQE A;  3E0E A;  4LWC A;  4JYA Q;  1JT8 A;  1GVP A;  2F52 A;  2VS1 A;  3K80 C;  4GLV B;  4YWK A;  4DK6 C;  3KDF B;  5C0X J;  1VQ5 A;  4LF6 Q;  2BA0 A;  2ZTE A;  3A0J A;  4GS3 A;  5IYC H;  4BBS G;  3CC4 A;  2VNU D;  3W1G A;  3HOY G;  1EOV A;  2KHJ A;  5AJ3 Q;  2KCT A;  4QGU A;  2R6G A;  4A3E G;  3TS2 A;  2UXC Q;  4PG3 A;  1Z47 A;  2WAQ E;  5IWA Q;  3GDE A;  4HIK A;  4A93 H;  1SRO A;  5FJ8 H;  2K75 A;  3CF5 A;  4J15 A;  1EWI A;  1TWG H;  3HOX H;  5EAY A;  4AYB E;  3RZD H;  1XMQ Q;  2OTL A;  4L5R C;  4LF8 Q;  3HOY H;  1XMO L;  4DV4 Q;  1QUQ B;  1QZH A;  1B7Y B;  1TWH H;  4OWW B;  3RN5 A;  2MFI A;  1VQL A;  3K7U C;  2HT1 A;  3RLN A;  2YTV A;  3J81 c;  2WFW A;  2EQS A;  3K0X A;  1QVC A;  3K7A H;  3STB D;  1TWF H;  2A1A A;  2JK8 A;  4DUY L;  4KHP Q;  1YZ6 A;  4NXN Q;  4DV7 Q;  4KI0 A;  4H02 A;  4LW1 A;  1XPO A;  3NEM A;  4B3R Q;  2A8V A;  4PMW A;  2VY3 A;  1WJJ A;  1N8R C;  1KL9 A;  1VQP A;  1PH4 A;  4BY7 G;  4C2M H;  1J6Q A;  1O7I A;  1IBM Q;  2UU9 L;  1Q86 C;  3F2C A;  1VQN A;  2D62 A;  3VDY A;  2UXB L;  2UXD Q;  3H15 A;  1PV4 A;  1VQO A;  5GAG C;  4KHP L;  1HR0 L;  3ER0 A;  4A3C G;  1B70 B;  1P8L A;  3JAM c;  3I2Z A;  3J7Z C;  4DR1 Q;  2MQH A;  5C44 G;  4DPG A;  1VQ8 A;  4JBM A;  4GN5 A;  3I4M H;  4IOA A;  2LSS A;  1IBM L;  1TXY A;  5HGQ A;  3TS0 A;  2R93 G;  3CC7 A;  3L7Z C;  2EIF A;  4YY3 Q;  1E22 A;  1C7Y A;  2OTJ A;  1EQQ A;  3RNU A;  4K0K L;  1OXU A;  4A3F G;  4JI3 Q;  1BBU A;  1PH5 A;  2XTI A;  2H5X A;  1JJG A;  4XTC S;  2JA6 H;  1RL2 A;  3H3V H;  2E5L Q;  5FLM H;  5LMN L;  1CKN A;  3CME A;  4QY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...