1HNXL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hnxL00
1WFQA 4JI5Q 3KDFB 1GM5A 1I94L 1VCIA 4JI2L 2R7ZG 4DUZL 4JI4Q 4AQYQ 2R92G 4HIMA 1BKBA 2EQSA 1N32Q 3WWVA 1U0LA 1YHQA 1L2FA 4BY7G 1FL0A 3E0EA 4ME3A 4BY1H 2BH2A 4R4TA 3HOUH 3HOZH 2B29A 1PH2A 4OO1I 4A4IA 1XMOL 4YCWA 1KL9A 4C3HH 1MJCA 1YJWA 4JOIA 1LTLA 2R6GA 1TWFH 3PCOB 4AYBE 4DR6Q 2UU9Q 1A8VA 1N9WA 2ZM6Q 4DUYL 3RNUA 1XNRL 3TS0A 3EN2A 4JYAL 1VS0A 3RZDH 4JBJA 2PQAB 2PNHA 4LFAQ 3SGIA 4R4OA 3W1BA 1SE8A 2AWOA 2EXDA 1HNZQ 5M3MG 4LF4L 4B3RL 4O2DA 2HIVA 3CCMA 4BBSG 1B7YB 1S3OA 3J81c 4A3EG 3KYHC 1V9PA 5H1SE 3GTGH 4DV1Q 4P75A 1VQNA 5JJLA 3BU2A 4DR4L 2KHJA 1MKHA 4DV4L 1FJGL 3ER0A 1VQLA 4GN5A 4LF7L 2OQ0A 1I94Q 1Q12A 4J15A 1J5EL 3F2DA 4DUZQ 1HR0W 4KHPL 4JOIC 3S2HH 1PH1A 4A3MG 1VQ9A 4L5QA 1YHAA 3PO2G 2WB1E 3G71A 1YI2A 1WJJA 2E5LL 4BA2I 3RN2A 3AFPA 1KRSA 1E22A 5C0XI 1QVFA 2CWAA 2ZJPA 4QGUA 2NN6I 2WAQG 4QIWE 4Y7NH 3F2BA 2R93H 4DUYQ 1CKNA 1HJPA 1WCMH 4KI0A 1XNRQ 1PH5A 4GKKL 3OW2A 4JYAQ 4DV3Q 3NENA 3I7FA 2VNUD 1EQRA 1Z9FA 2RF4A 1AH9A 4IPHA 4B3RQ 2UUBL 4LF4Q 2WP8J 2F4VL 1I3QH 3MEFA 5LMNL 5LMNW 4A3IH 2JA6H 3TREA 1UE7A 4YHHL 1JB7A 4DV7Q 3AYHB 4PG3A 2JEAI 4HJ9A 1UWVA 2K14A 3K8AA 4GLAC 4O0AA 2R7ZH 4JI8L 4NPSA 4DR4Q 1B70B 3CCRA 1YBYA 5AJ3L 4QY7A 4FDBA 4BBRG 3Q8DA 2C35B 4DV4Q 3S1NH 4DPGA 4BY7H 3NEMA 1I6HH 1HZCA 4IPDA 2YU9H 2WFWA 4LF7Q 2VQEL 1FVIA 4PZ7A 3JC66 1Q82C 2JE6I 3PUZA 3CC7A 1PYSB 4JI7L 5IWAL 4HIOA 1J5EQ 1HR0Q 1JMCA 2ATWA 3CPFA 1MJEA 5IYBG 2CWPA 3KOJA 1PHJA 2QGQA 3BZKA 1IBML 2BH8A 2B63G 2H5XA 3E9HA 1M90C 1HNWL 3TQYA 2E5LQ 2LSSA 3PUWA 4DAMA 2MO1A 3T1YQ 1TWAH 1Q86C 2UXCL 2AKWB 1C9OA 3PIOA 4B3SQ 4BBSH 4K0KQ 3GTJH 1K8GA 2PMZE 1PV4A 4H02A 4A3EH 1Q8KA 4DR7L 3PUXA 4UP9A 3CCVA 2ZJQA 1E1OA 3S1QH 1YZ6A 4HIDA 2KENA 1KHIA 2UUBQ 5LMNQ 4A93G 1YVCA 2VQFL 4R4CA 2EIFA 1G291 3F1ZA 1KC8C 4A3GG 4X65L 2MQHA 4YHHQ 5FJ8G 4TVAB 3U4VA 4A3KG 2KBNA 5IYCG 1E7ZA 4LF5L 3KJPA 4JI8Q 3A5UA 3PO3H 1PH4A 5ELOA 3STBD 3JAMi 1L0WA 2GVBA 4A3CG 4A3MH 1N36Q 4YWMA 1SRUA 3B6YA 2NZHA 2OTJA 1CKOA 4XIGS 2D0PA 3K7AH 4L5TA 3PO2H 4JG2A 3AFQA 4JBMA 4LUZA 4DR5L 4JI7Q 1XNQL 5HY6A 1PYBA 1CKNB 1HZAA 3F2CA 5M3FG 3S15H 3ULPA 3OTOL 1XMQQ 1IBMQ 2N3SA 5C3EG 2HT1A 4LFCQ 3JAMc 4LFBL 4OX9L 5C4XG 3UE1A 1HNWQ 4RMFA 2ES2A 4LF8L 4EX5A 1GD7A 1YEZA 4DR1Q 1ASZA 3A74A 2NVQH 2UXCQ 1VQIA 3J81i 3DM3A 2K5HA 2VS1A 4DR7Q 1BBUA 1N34Q 1K0RA 4YWKA 1IBLL 2HHHL 1KIXA 2MO0A 3CD6A 1X56A 1TWGH 1TXYA 1Y1VG 2YTVA 2R7FA 2F52A 3OYYA 2ZTCA 4LUOA 4OONA 3KF6A 2F3IA 4BBRH 3E9IA 5IYDG 3H3VH 2IT1A 1SFOH 4X65Q 1YNXA 5GAGC 1X54A 2B3GA 1P8LA 2YV5A 3I4MG 3M85A 4LF5Q 1NMFA 1UEBA 2Q2HA 3A0JA 5M5XH 3RN5A 2Q2UA 3CC2A 4OWWB 3HOVG 2FXQA 3FP9A 3CF5A 2OCEA 2CQOA 5IYBH 2NVTH 2JK8A 2B63H 1YITA 1XPOA 5GAEC 1KD1C 1Q1BA 4A3DG 4DV0L 4JV5Q 1X9NA 1N8RC 1N33L 4P72A 1EUJA 3UE0A 3L2PA 2VL6A 3CP0A 4DR5Q 3HKZG 3PO3G 4RG1A 4IFDI 2RCNA 4JI2Q 4B3TL 3BJUA 3OTOQ 2ID0A 1EWIA 3GD7A 4LFBQ 3KJOA 4R4IA 1HNXL 3M7NA 1EFWA 1VQ5A 3DLLA 2GVAA 5FLMG 1XMOQ 1HH2P 1CSPA 4DV2L 1K9MC 3RLFA 4A93H 1YHBA 1VQPA 1RIPA 2DGYA 4A3GH 2N49A 5FJ8H 4A3KH 2Y0SG 4GLXA 4A75A 2A8VA 5IYCH 1IBLQ 3FHWA 4OWTB 2E8GA 2HHHQ 4WJ4A 1IZ6A 1NTGA 1X55A 3S24A 1CKMA 1VQOA 4L5SA 4A3FG 2JA5G 5IP9G 4A3CH 4A76A 5C4JH 2K5VA 1HZ9A 1W2BA 1K73C 3HOWG 4P74A 3I2ZA 4C3JH 3PSIA 2I5HA 2IHFA 4UPAA 4IJHA 4MZ9A 5M3FH 4PZ8A 2JA7G 1G51A 5C3EH 1Y1WG 4DAYB 1S40A 4DK3C 4LWCA 2GN5A 2CKZB 4DV0Q 2Q2TA 4POFA 1FJGQ 5C4XH 2L15A 3EIVA 1N33Q 1CUKA 2YTYA 2NZOA 3TEHB 3RLNA 1DGSA 1V1QA 2MFIA 4UP8A 4B3TQ 4KHPQ 1PH9A 4LF6L 1JE5A 2RHSB 3KF8B 4XTCS 4L5RC 1PFSA 1HNXQ 3KF6B 3MXNB 4X62L 1P16A 3CPWA 3S1RH 1Y1VH 1QVGA 2OQKA 4DV2Q 4A3LH 5GADC 2JA8G 4GS3A 1X6OA 5IYDH 1I50H 2NVXH 5ELNA 4X66L 1M1KC 4GN4B 4EQ5A 1VQ7A 3I4MH 1BBWA 1JJCB 3G48A 4OWXB 4BA1I 4GOPA 1S72A 4GKKQ 4R4QA 4YY3L 2UXBL 1TWHH 3HOVH 5JJKA 5IY0A 4GNXC 4JI5L 4LNQA 3G6EA 3LGJA 1PH8A 2F4VQ 4OO1G 2UUCL 1GO3E 3KFUA 4A3DH 4HJ8A 1R9TH 1SLJA 1VQBA 4GN3B 2ZTEA 2Z6KC 4APVA 5C0XJ 5K36G 3I56A 4LF9L 2YYZA 4KHZA 1VQEA 1A63A 1JT8A 4B3ML 3HFZB 1EIYB 3L0OA 3M9BA 4QL5A 5AJ3Q 1VQHA 2I5LX 1YIJA 4DR6L 2UU9L 1OXSC 2ZM6L 3K81C 2MNAA 2VQEQ 2D0OA 4JI1L 5FLMH 1E3PA 1XTDA 2DUDA 5GAHC 3VDYA 1U5KA 3ULLA 1Z47A 3H3VI 4IOAA 5IWAQ 4WJ3M 4LF6Q 1XJVA 3CAMA 1L1OC 3BZCA 3GTLH 2A1AA 3W1GA 1KXLA 2Z0SA 2JQOA 1AE2A 5E7NA 4P73A 4NB3A 4GOPC 4X62Q 3M4PA 3IRBA 3U50C 1PH7A 4DV1L 1QUQB 4A3FH 2JA5H 5IP9H 4QQBX 3CMEA 3FKIG 5C44G 3PGZA 3ZJYC 1K8AC 3S2DH 4X66Q 2E2HH 3HOWH 4GNXB 1Q81C 3H0GG 2VUMG 5JEAJ 4YY3Q 2UXBQ 4OXPA 4YCVA 4PMWA 4JCVE 1ASYA 4AYBG 3NELA 1HZBA 4GLVB 4UP7A 2JA7H 1X3EA 1IBKL 4AH6A 1Y1WH 4A3LG 1J6QA 2VQFQ 1LUZA 1NY4A 2V1CC 1A0IA 2UUCQ 1PH6A 2E2JH 2K75A 3AEVA 4A3JG 2IX1A 5C0XG 3PF5A 3CC4A 3GTQH 4YCUA 3I55A 2NN6G 4LF9Q 1SROA 3CCSA 2ALYB 2JEBI 3PUYA 2BA0A 4GKJL 5FLXc 2IHEA 4B3MQ 3I4OA 1O7IA 4DV6L 2JA9A 4MNOA 3K7UC 4BXXG 2KCMA 3H15A 1CSQA 4AIMA 3NBHB 1EIFA 3GTPH 3PF4A 2K4KA 3CXCA 4HJ7A 2AWNA 1Q7YC 1WI5A 3F8TA 3I4NG 1OXXK 1X3GA 1L1OB 1AE3A 1Q46A 4LUVA 4JI1Q 4DV3L 1H95A 1QVCA 3W5OA 2JA8H 1XNQQ 3RR5A 1VQJA 1EQQA 4GOPB 4NXNL 4DR3L 3GDEA 2KHIA 4Y52H 2A19A 1IYJB 3HOYH 4JBWA 4HJAA 4LW1A 1Q1EA 1VQFA 1KRTA 4C3IH 4OX9Q 2PI2E 1OXVA 4DV7L 3HOXG 3GTKH 5EAYA 3S1MH 4LF8Q 1VQMA 4MTNA 1OXTA 3CW2C 4HIKA 1V43A 2YTXA 2WB1G 3HKZE 1W3SA 2KCTA 5JEAG 2E2IH 1B8AA 3S16H 2LXKA 2HQLA 2OWOA 4IPCA 2UXDL 1T9HA 2IY5B 1KQSA 1E24A 3PUVA 1JJGA 3UDGA 1IBKQ 1OXUA 1HR0L 1XPRA 3U4ZA 3STBC 4PZ6A 5IP7G 1QUQA 5IT9c 4DR2L 3S14H 2OTLA 3ICEA 3GTOH 4HJ5A 4R1JA 4C2MH 2CCZA 4DNIA 2R7DA 2WAQE 3L7ZC 1IXRA 3AQQA 4GNXA 4ALPA 1SN8A 4UY8C 1XPUA 4A3BG 2Y0SE 4GKJQ 1G6PA 2IX0A 3T1YL 1LM0A 3CQZH 5DLQE 4DV6Q 4B3SL 2RHQB 4K0KL 3S17H 3KDFA 2Z6KA 1NJIC 5JJIA 1NMGA 2QA4A 1LYLA 3HKSA 2I5MX 2UUAL 1GKHA 1TWCH 2XGTA 2XTIA 4BY1G 1YJ9A 1D8LA 3HOUG 3HOZG 1C0AA 1MIUA 3FKIH 5C44H 1VQ8A 4TQUS 5GQOA 1EOVA 3CCQA 3CCLA 4JI3L 4DR3Q 1NE3A 4NXNQ 4JI6L 3PIPA 3UDXA 5IE8A 5BR8L 3H0GH 5LMUL 1WYDA 2VUMH 2VZAA 4JBKA 4NXML 3PV0A 1SR3A 4X6AH 3UDFA 1E1TA 2K5NA 2R92H 1X3FA 3J7ZC 1L1OA 3D0FA 1X65A 4YWLA 2PQAA 2N78A 4A3JH 1JJ2A 1N36L 3TS2A 1QZGA 2VW9A 4IPGA 3HOYG 1GVPA 4JI0L 2UXDQ 3ULJA 3T1HL 3K80C 3M4OH 4IFDJ 3G4SA 4X64L 4IOCA 3ERSX 4DV5L 3CCEA 1VQ4A 4IJLA 1PVOA 1VQCA 1RL2A 1EYGA 4BXXH 4JI4L 2NVYH 3CMAA 4AQYL 1XMQL 2ASBA 3KLWA 4DR2Q 3GTMH 1N32L 1VQDA 4LFCL 4POGA 3TRZA 1D7QA 3I4NH 5GROA 5HGQA 2QEXA 1UE5A 1KAWA 3RZOH 1K3RA 1NBWA 5M5WH 4JC0A 3GO5A 2D62A 4DR1L 5M3MH 3UDIA 1C7YA 1PA6A 1VQGA 4P71A 3J80i 1UE6A 1N34L 3HOXH 2UUAQ 3EBEA 2K52A 1VQAA 1I5FA 2VY3A 1A62A 1VQ6A 5J3BA 4LFAL 1IL2A 1Y14B 1HNZL 4JI3Q 1SMXA 4JI6Q 2BA1A 5M5YH 5BR8Q 3A5ZB 5LMUQ 2HIXA 4IO9A 3D31A 2R93G 4NXMQ 1WOCA 1WCMG 4QJFA 1YJNA 1K83H 1UE1A 1QZHA 3J81j 1BVSA 2N8NA 2JJQA 3J80c 2ZJRA 3CCUA 2LXJA 3CCJA 3J7A5 2ZTDA 2K50A 1FGUA 2AHOB 5IP7H 2CFMA 1VQKA 4A3IG 2JA6G 2AMCB 3RLOA 2Q2IA 3U58A 2PI2A 4IFDG 1OTCA 4JI0Q 4JV5L 3T1HQ 3M3YH 4A3BH 4KLKA 4X64Q 2I0QA 4DKAC 3M4QA 1PH3A 3K0XA 4DV5Q 4DK6C
chains in the Genus database with same CATH superfamily
4JI5Q 2R7ZG 1K28A 1PRTB 4AQYQ 2EQSA 1DM0B 2C5CA 4C3IB 1A3VA 3S1MB 2D5DA 1MJCA 1G8ZD 1QNUA 4JOIA 1LTLA 3I73A 1RTNA 4AYBE 2ZXPA 4DR6Q 4FXGC 2UU9Q 4A3KB 2C9OA 1N9WA 3AMUA 1CM9A 1SYGA 5IT9E 3E0JA 2EYJA 4LFAQ 3W1BA 2EYFA 3P7JA 5M3MG 1MGSA 4N8X1 2HIVA 2G9DA 3GTOB 3KYHC 1V9PA 3A8IE 3GTGH 1KLUD 3MFYA 4DR4L 2PZWA 4M1UB 3DWQA 1MKHA 3PIO3 4Q5VA 2Z4IA 1STBA 1B2TA 2QEJC 3ER0A 4LF7L 1LT3D 3NTHA 3QWNA 2A6EC 1QOHA 3FKIB 3A55A 4J15A 1J5EL 1PH1A 4A3MG 2EXZA 3HEJA 3GV3A 4L5QA 1EL0A 3S1RB 2WB1E 4J1MA 1WJJA 2CVRA 5CBAE 1QJOA 2BDOA 4A3JB 2WAQG 4KI0A 2XSCA 4K2LA 4DV3Q 3NENA 3I7FA 1AH9A 2SOBA 1ENAA 2SNMA 2WP8J 3MEFA 5DM73 1HFNA 3T56B 3TREA 1UE7A 4F87A 4YHHL 4DV7Q 2JEAI 4HJ9A 1L0XB 3RZOB 3K8AA 4GLAC 3RD4A 3TBIB 2CH4A 2B2UA 4DR4Q 1G2SA 5AJ3L 4FDBA 4BBRG 3Q8DA 4BY7H 3NEMA 3HOXB 2YU9H 4LF7Q 1XXGA 5FO7B 4CJ2C 1ICFB 1PYSB 1J5EQ 4OIJA 1HHVA 1MJEA 3TP6A 3KOJA 2QGQA 1NSNS 2H5XA 4QIWB 2LSSA 3PUWA 4OEMB 2MO1A 3PIOA 5KYIA 3HOWB 2K03A 1K8GA 4V0BA 2O5IC 3PUXA 2DJFC 3BVGA 3MTSA 1YZ6A 4HIDA 3MXGA 2E75C 5J1ZA 2VQFL 1SSOA 2MQHA 4YHHQ 5CV6A 1E7ZA 2PPBC 4LF5L 1WTPA 5E1FA 4X3SA 3MXUA 4UHVA 3STBD 2F0OA 3BDLA 3S9WA 1SRUA 4ZQ3A 3MEHA 3K7AH 3PO2H 3AFQA 2JA8B 5C5LA 1PYBA 1O80A 1HZAA 3S15H 3ULPA 3OTOL 4K6LA 3K58A 3UE1A 2PMZB 4O1NA 1V1PA 3A74A 3DM3A 3SK4A 2MJ8A 2E2IB 2VS1A 1BBUA 2ENBA 3K59A 4YWKA 3H91A 5D65A 4DK0A 1KIXA 3X3MA 1X56A 2R7FA 2K1BA 3KF6A 2IT1A 3NQTA 1P8LA 3I4MG 3VA7A 3M85A 3MA2B 4LF5Q 3CQZB 3V05A 2B63H 1KD1C 4A3DG 4PMCA 4OGQC 4JV5Q 1AP0A 1I6VC 1TWCB 1EUJA 3L2PA 4N9TA 3HKZG 3PO3G 3QB3A 4JI2Q 4B3TL 3OTOQ 4FF1A 3P75A 3OW7A 2Q8TA 3SEBA 1HNXL 4ZAIA 5K5PA 1HA5A 1HH2P 4KN4C 4RCNA 3RLFA 2F3VA 1YHBA 1EY8A 2DGYA 4BY7B 4XDXA 2J7ZA 1SBBB 4QB4A 5IYCH 4OWTB 2E8GA 2XNAC 1UEAB 1X55A 1LLRD 3S24A 4A3FG 2JA5G 4A3CH 5J39A 3G6JB 3WOEA 1W2BA 3K6OA 1ICWA 2I5HA 2QW7A 4UPAA 2FMCA 2L55A 4MZ9A 1AEXA 5M3FH 1G51A 3P1HA 4DAYB 5I6WA 2LS01 1S40A 1V8QA 1FJGQ 1TS2A 3BG3A 5C4XH 4CKCA 2YTYA 5DNFA 4CGYB 2JSOA 4B3TQ 1MSGA 1PH9A 1YNJD 4L5RC 4XTCS 4C1NI 3P20A 5LL6X 1HNXQ 3SK5A 2IL8A 2RDFA 1EZ8A 4X62L 1P16A 4A3LH 1X6OA 3D6CA 2NVXH 2MP1A 3K5NA 1SNQA 2PCFB 2EOTA 1JJCB 4A3BB 2OXPA 4C3IG 1ML0D 5JJKA 3HOVH 2FJ2A 5IY0A 1CZWA 4I65A 4GNXC 1D2BA 2EYLA 1Q3LA 1WTHA 1GO3E 1DONA 1B50A 4O42A 2NZ1D 4APVA 5K36G 3ND9A 4LF9L 4KHZA 4DNRB 4C3HB 4B3ML 5EBDA 1RJTA 3JAML 1LTAD 4NW2A 4RGMA 1OXSC 2VQEQ 3NK9A 3RZDB 5FLMH 3VDYA 5GAHC 3H3VI 4WJ3M 2KJXA 2F03A 1L1OC 3GTLH 2A1AA 3W1GA 2JQOA 5E7NA 1U4PA 1LTSD 4X62Q 3MAQA 4DV1L 1GUOA 1PFBA 4M8AA 3FKIG 4EQPA 3CMEA 1K8AC 3OMCA 3J81L 2E2HH 4GNXB 3H0GG 5EGTA 1A6XA 4OXPA 1QILA 4JCVE 3NELA 2JA7H 1X3EA 1IBKL 1AN8A 5A35A 1J6QA 3VYSA 1A0IA 3KBGA 3PIP3 2B2VA 4EVOA 4A3JG 5C0XG 3I55A 2NN6G 3Q24A 4LF9Q 2K5DA 3CCSA 2ALYB 2JEBI 3PUYA 4B3MQ 4Z9CB 5BN5A 2ZT9C 3H15A 1CSQA 4AIMA 3R8BA 5CV9A 5NUCA 5J22A 5T1IA 2X6GA 1OXXK 4ME5A 1L1OB 3RR5A 3GDEA 2KECA 3HOYH 4JBWA 4HJAA 1Q1EA 2PI2E 3EROA 3HOXG 3GTKH 2XVSA 2R7ZB 3MHBA 2EY2A 3CW2C 3S1NB 2RDGA 2WIIB 5C4XB 1B8AA 3CHBD 2HQLA 4MHEA 2OWOA 2IY5B 1FNVA 5KIXA 1IBKQ 2F3WA 1SE4A 5IT9c 1EEFD 3S14H 2OTLA 5D14A 3TDQA 1E2VA 4R1JA 4UY8C 4ALPA 3AQQA 1G6PA 2JXMB 2Y0SE 3T1YL 1LM0A 1VF5C 5DLQE 2NVXB 4K0KL 3I8ZA 1QCBD 2Z6KA 5JJIA 1SEBD 3HOVB 1YJ9A 2F0NA 1C0AA 2OT2A 1F9SA 4TQUS 5GQOA 3CCQA 3FEWX 4KK7A 3PIPA 5IE8A 5IGFA 1Y8OB 1EYAA 1SR3A 1MHWC 1G6ZA 3BYTB 2R92H 1PTOH 5JJZA 4A3MB 3D0FA 4QCLA 2N78A 3TS2A 3M4OH 2O4XA 3K80C 5A2QE 4IFDJ 3J7YW 1MBYA 3ERSX 1HTLD 4IJLA 3I91A 1OO9B 1EU3A 2WAQB 5EPKA 2NVYH 3GTLB 2Z6BA 1G2TA 1N32L 4POGA 3I4NH 1VMCA 3PQIA 1H9MA 2EDGA 1JORA 1K3RA 3GO5A 5ELFA 2E2HB 1PA6A 2Z1CA 3SR1A 1MD2D 3J80i 4DGZA 1RCVD 1UE6A 1N34L 3KUPA 2F0KA 1I5FA 5J3BA 1Q90A 2HDLA 1IL8A 2BA1A 4IO9A 4QJFA 1UE1A 1B9NA 3J81j 1BVSA 1I4XA 4K14A 4RFBA 3C2PA 2LXJA 1ZYRC 4CDFC 4L6TB 1D5XC 4XYOA 3RLOA 2Q2IA 3U58A 3VYRA 4MTKA 3M3YH 1PH3A 1WFQA 3KDFB 1VCIA 2KHSA 2QILA 4DUZL 4IURA 1N32Q 3WWVA 1U0LA 1YHQA 1L2FA 4BY7G 1FL0A 4ME3A 4F8MA 1TS4A 2BH2A 4OO1I 2B29A 4A4IA 1YNNC 1HQRD 1C8CA 4WORA 2AQ1B 2PZUA 2GA4B 1PTOC 1Q8IA 3EN2A 3R93A 3LWEA 3X3NA 2PNHA 1SYBA 3SGIA 1SE8A 5IOCA 4LF4L 1EY0A 3S14B 3R3OA 3Q0AA 1TVXA 4P75A 5I2XA 1WTWA 2P5ZX 4KY7A 2KHJA 4I7ZC 2K04A 4UAIA 1DJRD 2A6HD 2N55A 1I4QA 2K7VA 2LY7A 4H0LC 4X3UA 4K8IA 1ET6A 1Q12A 4KHPL 4DUZQ 5IGBA 1W6JA 4FYDA 5EPJA 1BCPB 1I4PA 5CV5A 2B2YA 2F0EA 1IHZA 3L3OC 1YHAA 4AYBB 4DXFA 3PO2G 3G71A 4OIKA 1D1IA 2ZJPA 3I4MB 5EKKA 4Y7NH 4XQNA 1B3AA 2MHVA 1HJPA 4GKKL 2VNUD 3W2DA 1FNUA 4FO2A 1HQMC 1UUPA 4LF4Q 4TRDA 2NVYB 1I3QH 3LX0A 2F0MA 5LMNL 4A3IH 4A3DB 4IFDH 4HTHA 1R9TB 1HFGA 2SEBD 3BS1A 2KA7A 2K14A 2TMPA 1QE6A 2HCCA 4QUFA 1B70B 1L0YB 1I6HH 4IPDA 2MUYA 2NWGA 5KNDA 2JE6I 1T5EA 3SK8A 3CC7A 1HR0Q 2OF1A 2WB1B 2CWPA 1IBML 2BH8A 2B63G 4FF4A 2B8FA 2IW3A 1R4PB 1M90C 1HNWL 3TQYA 2H1EA 4A3FB 2BE5D 2JA5B 2L5TA 1TWAH 3S2DB 1LV9A 1C9OA 1FR3A 3A54A 3ONAB 4BBSH 1TKWB 4H02A 4UP9A 4R9WA 1A15A 2ZJQA 1PZID 2KENA 3V96A 4LJZC 4NKLA 5LMNQ 3BVMA 4G7ZC 2EIFA 1G291 4FNFA 5EBCA 1SYCA 4RKBA 2K01A 5IYCG 3KJPA 1PH4A 1TY0A 5ELOA 4CKBA 1EIHA 1L0WA 2GVBA 3GTPB 1LTBD 4A3CG 1XYIA 1N36Q 2CH4W 4YWMA 5JAVA 2B39A 1NNXA 1S5FD 1JE4A 4LUZA 3J81E 1CKNB 2LFNA 3F2CA 5M3FG 3NE5B 1IBMQ 4L8JA 1JOKA 1SMYC 3M4YA 4LFBL 4DAVA 3VR6A 2XRQD 5C4XG 1HNWQ 4RMFA 5EKLA 3KLSX 1GD7A 4DR1Q 2PO4A 4KY6A 2FINB 1IBLL 1TWGH 1TXYA 2EJGC 2ZTCA 1ENCA 1EY7A 1XX8A 2F3IA 3E9IA 3FPPA 3GV6A 1SFOH 1YNXA 2N88A 1E2ZA 5M5XH 2Q2UA 3HOVG 3RN5A 3CC2A 3FP9A 2OCEA 2CQOA 4K6DA 3TP7A 2L12A 4DV0L 2RCFA 2AUKA 4KJOA 4XT3B 1I3QB 4A3IB 1EWHA 3H0GB 3GD7A 5IIFA 2A5HA 4JK1C 2F1MA 4LFBQ 3KJOA 1LTGD 5KEEA 1VQ5A 1BDOA 2AUJD 3DLLA 2DY7A 4KMUC 5FLMG 1CSPA 1SE3A 1VQPA 1RIPA 1C4QA 4A3GH 1I6HB 5JPNC 3AU7A 3FVQA 1IBLQ 5CV7A 1NTGA 3ND8A 1HXYD 3CU7A 4JPBW 3GTMB 3A8JE 4IUNA 3ERQA 3I2ZA 3UI2A 2RA4A 1ZEQX 4RGTA 1EY5A 2A73B 4PZ8A 5BN3A 2JA7G 5C3EH 2R3ZA 3WDNA 4LWCA 2CKZB 4DV0Q 3SXHA 3EIVA 4JW0A 3T13A 1YNND 2NZOA 1QNKA 1NCVA 3QG1A 1BCPD 2MFIA 1JE5A 1PFSA 2E74C 1TQOA 2EJFC 3CPWA 1Y1VH 2OQKA 4GS3A 4YIJA 1I50H 1M1KC 4EQ5A 1VQ7A 4OWXB 4DF7A 4R4QA 2UXBL 1CQFA 2X69A 1A2UA 4LNQA 1PMRA 4XQQA 4ZKBB 1O7YA 2HQEA 1PTOF 2ZTEA 4GN3B 2B2WC 2Q8IB 3VA5A 3I56A 4QF4A 2YYZA 1VQEA 1A63A 2OEOA 3M9BA 2CQAA 5AJ3Q 3K57A 1ILPA 1ILQA 1BO0A 2ZM6L 1AZQA 3K81C 2MNAA 3C1EA 1SDFA 4JI1L 2B2TA 2DUDA 1QB5D 4PNYA 1TWGB 1U5KA 1HA6A 2NTSA 4C1NK 5IGEA 1SFOB 1XJVA 3BZCA 5KYLA 3DWPA 4P73A 3F2UA 3GTGB 3IRBA 2M9VA 5I4DA 1QUQB 1KNAA 5IP9H 3VR2A 4DK1A 1CI3M 5JEAJ 1JOOA 2UXBQ 3H6MA 2QDBA 4YCVA 4PMWA 4AYBG 3HS0C 4GLVB 2M2LA 5LHY1 4AH6A 1Y1WH 2VQFQ 3K0YA 1PH6A 2E2JH 2K75A 2PW5A 2IX1A 3AEVA 3ITPA 3CC4A 2WACA 4L63B 2Z4HA 2IHEA 4HEDA 4RWSC 4MN3A 4A3GB 3PF4A 1EIFA 3CXCA 3QJYA 3T53B 1PRTD 2AWNA 1WI5A 1BOSA 3I4NG 3I72A 4JI1Q 1GUSA 1S5ED 3W5OA 1B3QA 2A69C 3NUCA 1WTOA 4WJWA 5FK9C 4NXNL 5JPMC 3OSOA 3BVZA 1A2TA 3K5OA 4LW1A 3T4AC 4IUUA 5EAYA 2AQ3B 1OXTA 1V43A 4U68A 3J7AV 2WB1G 1W3SA 2YU9B 3S16H 4LAAA 3TZUA 4IPCA 1T9HA 2VXWA 1ENFA 1KQSA 3PUVA 1T5XD 5L37A 4ID6A 3UDGA 4FXDA 1J9OA 1XPRA 4RGOS 3DHQA 4I7AA 2KEEA 3N52A 3ICEA 2HCIA 5CC4A 4C2MH 4BWGB 2CCZA 3I3CA 4ZUJA 1SN8A 2EYPA 1I50B 1WD1A 4B3SL 1FGBD 3S17H 3KDFA 4U673 1NMGA 2QA4A 1LYLA 2I5MX 1WTVA 3T16A 2XTIA 5CBEE 1CFMA 5C44H 2TSSA 3CCLA 4NXNQ 1NE3A 2RSOA 3UDXA 5LMUL 1E2WA 3VYTA 2VUMH 4NXML 4ZUIA 2RQXA 4H44C 4ILWA 1LT4D 1O78A 2A74C 2BDNA 3NBHA 2F0GA 4X6AH 4TKOB 2F0HA 2EVBA 2JP1A 2L1BA 1X65A 4YWLA 1SYFA 4OHJA 2VW9A 1QZGA 1GVPA 3K7AB 3PO2B 1WTQA 3G4SA 4RHRA 3Q23A 1PVOA 3S15B 1RL2A 4R8IA 1EYGA 4JI4L 1XMQL 3NWSA 2Y0SB 4LFCL 2F0FA 1D7QA 2F0TA 2F0JA 2A6ED 1UE5A 1KAWA 4JC0A 1STNA 1EOTA 2D62A 5M3MH 3D3RA 3UDIA 1SJHD 1C7YA 1VQGA 3D4RA 3Q22A 1EYCA 3EBEA 2K52A 4KTAA 1GUNA 1A62A 1ONLA 1IL2A 3NQIA 1SMXA 5C5MA 5M5YH 5JEAH 5LMUQ 5FLXE 3D8GA 4QMGA 4NXMQ 1K3BC 1EU4A 1K83H 4XXEA 2JJQA 3J80c 2K6AA 5IP7H 2AHOB 1DOLA 5E4XA 2B63B 4A3IG 3LWUA 2AMCB 1QWYA 2L11A 1JICA 4IFDG 2DN8A 1OTCA 4KLKA 1I94L 2FHTA 4JI4Q 1BKBA 5FKAC 2PW7A 4BY1H 3HOUH 3EFXD 1XMOL 4YCWA 1KL9A 1TWFH 3PCOB 1SJED 1A8VA 1CA6A 1CTMA 4DUYL 3VR3A 3TMEA 1XNRL 3TS0A 1VS0A 1GUGA 2V4DA 2PQAB 4IUQA 2F4IA 2AWOA 3CCMA 4BBSG 3J81c 2CHBD 5H1SE 1I4RA 3HRZC 4DV1Q 4B9WA 5JJLA 5M3FB 3BU2A 2K5QA 1WTXA 1V1OA 1ESRA 3GP7A 5E4WC 3HGBA 3ZYYX 2OQ0A 4KKSA 1I94Q 4QUCA 1D5ZC 3CRLC 3F2DA 1HR0W 2EJMA 1K8MA 3MWYW 3IKJA 3S2HH 3BYYB 1LT6D 1FD7D 2XRSD 4BA2I 1K0SA 5C0XI 1E22A 1M4VA 4KD3A 4QGUA 2NN6I 2R93H 4DUYQ 1CKNA 5IGDA 1XNRQ 3D6WA 3OW2A 2Q8RE 2J4XA 1FYCA 2EY6A 2F4VL 5LMNW 4HCSA 5E3FA 1JB7A 1KDCA 3CRKC 3AYHB 4CDCC 1A3TA 4O0AA 4JI8L 1YBYA 4QY7A 2C35B 4DPGA 4LK1C 1HZCA 2F0LA 3JC66 5IWAL 4HIOA 4ZKCB 5M5YB 2ATWA 3CPFA 4CDDC 1PHJA 4HR7B 1NR4A 1PDQA 1GHKA 2A69D 4DAMA 3T1YQ 2UXCL 4DXGA 2AKWB 4K0KQ 1SE2A 3GTJH 5CR3A 1PV4A 4A3EH 1Q8KA 1QG7A 4DR7L 3CCVA 2F0PA 1RHPA 2JA7B 5CGKA 2PQEA 1KHIA 4KKUA 1NR2A 3F1ZA 4A3GG 1B53A 1HRJA 4BY1B 2G5DA 3HOUB 1TU2B 4JI8Q 4IALA 3PO3H 3JAMi 1BR9A 2H4OA 3B6YA 2OTJA 4P2CB 1CKOA 4XIGS 5C4ZA 1UNSA 1RD9D 4JG2A 4X3TA 4JBMA 5LL6S 4DR5L 1XNQL 2DNCA 3HOYB 2ZXOA 2N3SA 5C3EG 1LO5D 2HUGA 2HT1A 3KBXA 4OX9L 3GTKB 4LF8L 1ASZA 1FNWA 2NVQH 2UXCQ 1H9KA 3J81i 5G3LD 1UAPA 1PZJD 3TP5A 3SK6A 5ISRA 4DR7Q 1N34Q 3C3LA 1K0RA 2AQ2B 1GXDC 3NP8A 3TN2A 3K5MA 1BUVT 3CD6A 3VR5A 4FF2A 1Y1VG 3OYYA 4LUOA 3SHLA 2F52A 3H3VH 1X54A 1GUWA 2KEDA 4HSVA 1CQVA 5IGGA 2IWHA 2Z9HA 1U4RA 3QO2A 4OWWB 4EQOA 2FXQA 3CF5A 2DY8A 5IYBH 1YITA 1XPOA 2CW0C 3R2TA 5GAEC 4B08A 1U4LA 4P72A 3CP0A 4DR5Q 4RG1A 3QIAA 5M9OA 2EYOA 4S3SA 5KNCA 3M7NA 1EFWA 2GVAA 3L9AX 4IN3A 4DV2L 1PTOB 2R92B 4A93H 2FFKB 2N49A 3MXPA 3E6ZX 1SNCA 5FJ8H 4A3KH 1S5DD 1VMPA 2B2VC 2Y0SG 4A75A 2A8VA 3M4OB 3FHWA 1IZ6A 1EFID 2D9UA 1CKMA 1VQOA 2HDMA 5IP9G 3BDOA 3HP3A 5C4JH 4FP5D 4A76A 2HD3A 4JVZA 3I4NB 3TSSA 4C3JH 3PSIA 1B1ZA 4XYQA 1B44D 2IHFA 4IJHA 3A7LA 3RMHA 1LACA 1Y1WG 4ZLTF 4KKTA 1JCKB 2GN5A 5EKIA 2Q2TA 1TR5A 2L15A 1WD0A 1XTCD 3TEHB 1DGSA 1V1QA 4KHPQ 2EE1A 3DWAA 4LF6L 3KF8B 2RHSB 3IAYA 3TZDA 3MXNB 3S1RH 5FO8B 3H3VC 2JN4A 1QVGA 5CV8A 4DV2Q 4RHSA 1ZXTA 5GADC 5IYDH 5C4HA 4N8FA 1SNPA 4CJ0B 2XN9C 4NMZA 1BBWA 4GKKQ 3M3YB 2MGSA 4YY3L 1HCZA 1O7ZA 1EYDA 4JI5L 3MFGA 3JAME 3G6EA 1LTRD 5DM63 1PH8A 2O5JC 2UUCL 2K5WA 2BCOA 4HJ8A 4IZ8A 1SLJA 2Z6KC 2EYMA 3OHXC 1PZKD 5ELEA 3HFZB 1EZ6A 4DFAA 1SNMA 1VQHA 2I5LX 4ZYSA 4DR6L 1R4QB 2UU9L 2G9HD 4ZRZA 5I6YA 3MC0B 3QR8A 2D0OA 2QF7A 1E3PA 1XTDA 1Z47A 3T51B 4LF6Q 3FRPB 1KXLA 2Z0SA 4RAUC 3KLRA 1IYVA 4XT1B 4X3KA 3HZXA 3CKIB 4DAYA 4GOPC 1LTTD 1U9RA 3M4PA 3OIQA 4RH6A 4J6HA 3U50C 4WFN3 5C3WA 5C44G 5ELDA 3PGZA 3ZJYC 2XIWA 1Y8NB 1RODA 3HOWH 2WKDA 1TS5A 1Q81C 3O13A 2VUMG 2WKCA 4YY3Q 2NBFA 5FO9B 1JC7A 1ASYA 1HUNA 4A3LG 1A3UA 2UUCQ 2V1CC 4YCUA 1CK1A 3EVQA 1Y69U 3A7AB 5FLXc 4A93B 3I4OA 3I70A 1O7IA 2JA9A 1NUCA 4MNOA 3K7UC 4Y7NB 1YNJC 4HAEA 3F8TA 1EIGA 5C3XA 4DV3L 4LUVA 1AE3A 1H95A 3KLSA 2JA8H 1S4ZA 4GOPB 2L0CA 3NWTA 1EQVA 5C4JB 2K33A 4C3JB 1KRTA 4DV7L 1OXVA 1RF2D 2L9HA 1BQQT 4MTNA 4OO1H 1JOQA 1STAA 4HIKA 3HKZE 5JEAG 2KCTA 2KCNA 2E2IH 2UXDL 3OMGA 1Y8PB 3I4LA 5IODA 1ZYRD 1WTRA 3EA6A 3U4ZA 5C6AA 4PZ6A 1JWMD 5IP7G 1GOZA 4DR2L 3DXJC 3OWEB 1JQYD 4DNIA 2R7DA 4GNXA 4PV1C 1TWAB 1DD2A 3CQZH 1X3QA 4BBSB 3BDCA 2WINB 3HKSA 2UUAL 1GKHA 1TWCH 4BY1G 2Z8LA 3HOUG 5KRUA 1GHJA 4IUVA 4F88A 1MIUA 1VQ8A 3I90A 1STGA 4HCEA 1PTOD 4JBKA 3PV0A 3UDFA 1E1TA 4CDEC 4G7OC 2K5NA 1X3FA 3J7ZC 1L1OA 3E5SA 1BBXC 1J8IA 2PQAA 1JJ2A 5JOBA 3HOYG 4FXKC 1WVLA 4JI0L 2UXDQ 2NB0A 4X64L 4IOCA 2B2YC 3VYUA 2B8GA 2ICEC 4DV5L 5CYUA 2L4NA 1VQ4A 1VQCA 1C48A 4BXXH 5COYA 2CW0D 4NP5A 2ASBA 3KLWA 4DR2Q 3TRZA 2F0WA 5HGQA 2QEXA 1JWSD 5A2QL 5M5WH 1NBWA 2J0TD 3C1FA 4CJ1B 1KAAA 4RGNA 2DJGC 2UUAQ 1H9SB 2VY3A 3OPOA 2QDLA 1BCPF 3A8KE 1Y14B 1HNZL 5JVG3 1KDAA 3A5ZB 2HIXA 2RKSA 1JWUD 5I9PA 2R93G 1EQTA 1WOCA 1YJNA 1QZHA 5M5XB 2E2DC 5TSSA 2N8NA 2ZJRA 3IL8A 3CCUA 3J7A5 3NSWA 4JI0Q 4JV5L 1VDZA 4A3BH 4X64Q 2I0QA 4DV5Q 1GM5A 1CHQD 2RVLA 2EY5A 4JI2L 2R92G 4HIMA 1KDBA 4KD4A 3E0EA 3HOZH 4R4TA 1D6EC 1PH2A 1X3PA 4C3HH 1YJWA 4EQNA 2R6GA 1DXMA 4RA8A 2ZM6Q 3RNUA 3FMCA 4JYAL 2WV6D 3DUZA 1BXTA 3RZDH 4JBJA 3GQBA 2LMCB 4R4OA 4TSSA 4B3RL 1HNZQ 2EXDA 1STEA 4O2DA 1ESFA 4K5WA 1B7YB 1S3OA 2F0DA 4A3EG 4G4KA 1SYDA 4LMQD 5KNBA 1VQNA 1Z7TA 5C3EB 4K5VA 2I07B 4DV4L 3EQLC 1FJGL 1VQLA 2XWBB 4HN7A 3URYA 4GN5A 5D3IB 3FDTA 5ELBA 3OOCA 1D1KA 4JOIC 5F2DA 1VQ9A 1Y1VB 1YI2A 4MIUA 2E5LL 3RN2A 3AFPA 1KRSA 4CHTB 1QVFA 1B4OA 2CWAA 1SMYD 4QIWE 1SNDA 3F2BA 1WCMH 4Q0FA 4ZK9B 1PH5A 1PRTF 1DCZA 4JYAQ 1EQRA 1Z9FA 2RF4A 4IPHA 3FPUB 4B3RQ 2UUBL 2QKIC 2JA6H 2EPBA 1EY9A 3G7LA 1IKMA 4PG3A 1UWVA 5M5WB 2R7ZH 5ELCA 4NPSA 1GJXA 3CCRA 2XWJB 1JR0D 4G57A 3S1NH 4DV4Q 1STHA 3E3XA 2WFWA 2VQEL 1FVIA 4PZ7A 3NTIA 1DOMA 1TIID 1Q82C 1LT5D 3PUZA 5DAUA 4JI7L 1JMCA 2I46A 5IYBG 4K8JA 3C46A 3BZKA 1PFMA 4EGVA 4RCOA 1RKNA 1F2YA 1TS3A 3E9HA 3J7AF 2E5LQ 1D5MC 1BNZA 2D2CC 1Q86C 2NYZD 3KK7A 4B3SQ 1SXTA 4F7XA 2PMZE 4E6IA 2RBMA 3J80L 2LKVA 1HTPA 4DNTB 1E1OA 1O7LA 2RDHA 3S1QH 5FOBB 1ZKOA 1GUTA 3LNNA 1BF4A 1Y1WB 2UUBQ 4KN7C 2B2UC 1YVCA 4A93G 4R4CA 1I4HA 2E2JB 1KC8C 4X65L 5FJ8G 2R61A 2A6HC 4TVAB 3U4VA 4A3KG 3HOZB 2KBNA 1H9JA 5EJWA 3A5UA 1AZPA 5DEHA 4KV6A 4KY5A 5HURA 3DEPA 4A3MH 2ZXRA 4H13C 1KLGD 2NZHA 2D0PA 4L5TA 4C3JG 4GZYC 3BZDB 1S5BD 1EY4A 4JI7Q 5HY6A 1XMQQ 5BN4A 4LFCQ 3JAMc 4K5XA 2ES2A 4IUPA 4EX5A 1YEZA 5HGTA 1VQIA 2O2LD 3NBIA 2K5HA 1IKLA 3S16B 3KF8A 2HHHL 3OWFA 2MO0A 2YTVA 3IFDA 4OONA 1VF7A 4BBRH 3MXNA 5IYDG 4IUTA 1CHPD 3NTKA 4X65Q 5GAGC 2B3GA 4DAPA 2YV5A 4C2MB 4PQXA 1K8OA 1NMFA 1UEBA 2Q2HA 3A0JA 5CV4A 5T1GA 4J8QA 2B2TC 5IT9L 1U4MA 4K2KA 2NVTH 3S17B 2JK8A 1Q1BA 1WCMB 3QOLA 1X9NA 1F77A 1N8RC 1TT2A 1IW7C 1N33L 3UE0A 1NAPA 2VL6A 5C44B 4N9PA 4IFDI 2RCNA 4KJNA 2JA6B 2BE5C 1G91A 3BJUA 2ID0A 3N6RA 3M7GA 1EWIA 1PLFA 3SVMA 2MPMA 2PNRC 2VUMB 2K05A 2EY1A 4R4IA 3K5LA 1CT1D 1KTKA 1XMOQ 1K9MC 2A68C 3DMUA 1E0BA 4GLXA 1MSHA 2HHHQ 4WJ4A 4L5SA 3SE0A 1EWCA 2K5VA 1HZ9A 1K73C 3HOWG 4P74A 2KUMA 2KCCA 5M3MB 4FF3A 5EQ0A 1II3A 4DK3C 1LTID 1V1PB 4CBVA 4POFA 4XQJA 1N33Q 3S1QB 1CUKA 3W3AA 3RLNA 1JB3A 3TP8A 4UP8A 3H09A 5I2YA 4HMIA 1K83B 5CMDA 3KF6B 4RKLA 4FVMA 2JA8G 2EZVA 4UDUC 2RSNA 5ELNA 4X66L 4GN4B 1AW7A 3I4MH 3G48A 4GOPA 1S72A 4BA1I 2JYOA 2E76C 1TWHH 3LGJA 2F4VQ 4OO1G 3KFUA 4A3DH 2NTTA 4V190 1M8AA 1R9TH 1VQBA 1XWEA 5C0XJ 1JT8A 1TWFB 1EIYB 3L0OA 5KGUA 4QL5A 5IGCA 1KNEA 1Z6HA 1YIJA 1S5CD 1F9PA 3VR4A 1KABA 3ULLA 4IOAA 4ODGA 3OIPA 5IWAQ 4BBRB 1SAPA 5AFWA 3Q6SA 3CAMA 5I9OA 1DOKA 2PZTA 1AE2A 2KVMA 4NB3A 1PH7A 2K32A 2K28A 4A3FH 2JA5H 4QQBX 2F0UA 4B9XA 2NVTB 3S2DH 4X66Q 3A56A 5D3DA 1CA5A 3NPPA 3R2IA 4ULLA 5JVH3 1HZBA 4UP7A 1LABA 2VB3X 3SDZA 1LUZA 1NY4A 3S2HB 2SDFA 3PF5A 3GTQH 4CKEA 2SNSA 4DN4M 1SROA 2BA0A 4GKJL 1BCPC 4DV6L 4BXXG 2KCMA 3GTPH 1CZGA 2R93B 3NBHB 1F2LA 2K4KA 4HJ7A 2FMMA 1X32A 1Q7YC 1RDPD 1X3GA 1Q46A 1QVCA 1XNQQ 1VQJA 2IX3A 1EQQA 4DR3L 2VB2X 1B9MA 2KHIA 1IYJB 2A19A 4Y52H 3U9OA 3U9SA 1VQFA 4WRDA 4C3IH 4OX9Q 2IJ0A 1TY2A 4BS9A 3S1MH 4LF8Q 1VQMA 1EY6A 5EPLA 4DA2A 1H9SA 3RUZA 2YTXA 5G3LF 1EEID 2LXKA 5K36H 1HUMA 1E24A 1JJGA 3PMFA 1OXUA 1HR0L 1H9RA 3STBC 1QUQA 5CORA 3GTOH 4H7BA 1W6KA 1SNOA 4HJ5A 2WAQE 3L7ZC 1IXRA 1F9QA 4HMJA 4HSPA 4A3BG 1XPUA 1SYEA 4GKJQ 2IX0A 1PYWD 4PMBA 4DV6Q 4G7HC 3GTJB 2RHQB 4IQZA 2NUCA 1I4GA 4A3EB 3D4WA 1NJIC 1PFNA 2B2WA 1STYA 1TWHB 2XGTA 3HOZG 2F0QA 1D8LA 1DZ1A 1IYUA 3FKIH 4C3HG 1EOVA 3D4DA 4JI3L 4NDXA 2EYHA 4DR3Q 4JI6L 5BR8L 3H0GH 1F9RA 1WYDA 2QCPX 2VZAA 3V2TA 3HKZB 2M00A 3PO3B 1DYQA 2X6LA 4A3JH 3AB9A 5C0XH 4C56C 1N36L 4IPGA 1MI2A 3QOJA 3ULJA 3T1HL 2NN6H 1RTOA 3MZ5A 4OELB 2F0VA 3CCEA 4KHVA 2BOSA 2KQ3A 3WOFA 4ABNA 3DM1A 3CMAA 4AQYL 3GTMH 1AFPA 3J80E 1VQDA 2F0SA 1IW7D 5GROA 1ET9A 1PRTC 3RZOH 2NVQB 4DR1L 4ZCKA 3IFTA 2KOLA 2DNEA 1PXUA 2PYKA 4P71A 3EJIA 3HOXH 1VQAA 4DU9A 2ICIA 1VQ6A 2A68D 3HG9A 4LFAL 1F2ZA 4JI3Q 4JI6Q 5BR8Q 3D31A 3GTQB 2F0IA 1WCMG 3NHHA 3CCJA 3H94A 2ZTDA 2K50A 1FGUA 3NXWA 2CFMA 1VQKA 2JA6G 2PI2A 1F2MA 2IPKD 3T1HQ 3MVVA 5FLXL 1HPCA 4R8NA 4OL7A 4DKAC 3M4QA 3K0XA 3DEOA 4DK6C
chains in the Genus database with same CATH topology
1WFQA 4JI5Q 3KDFB 1GM5A 1I94L 1VCIA 4JI2L 2R7ZG 4DUZL 4JI4Q 4AQYQ 2R92G 4HIMA 1BKBA 2EQSA 1N32Q 3WWVA 1U0LA 1YHQA 1L2FA 4BY7G 1FL0A 3E0EA 4ME3A 4BY1H 2BH2A 4R4TA 3HOUH 3HOZH 2B29A 1PH2A 4OO1I 4A4IA 1XMOL 4YCWA 1KL9A 4C3HH 1MJCA 1YJWA 4JOIA 1LTLA 2R6GA 1TWFH 3PCOB 4AYBE 4DR6Q 2UU9Q 1A8VA 1N9WA 2ZM6Q 4DUYL 3RNUA 1XNRL 3TS0A 3EN2A 4JYAL 1VS0A 3RZDH 4JBJA 2PQAB 2PNHA 4LFAQ 3SGIA 4R4OA 3W1BA 1SE8A 2AWOA 2EXDA 1HNZQ 5M3MG 4LF4L 4B3RL 4O2DA 2HIVA 3CCMA 4BBSG 1B7YB 1S3OA 3J81c 4A3EG 3KYHC 1V9PA 5H1SE 3GTGH 4DV1Q 4P75A 1VQNA 5JJLA 3BU2A 4DR4L 2KHJA 1MKHA 4DV4L 1FJGL 3ER0A 1VQLA 4GN5A 4LF7L 2OQ0A 1I94Q 1Q12A 4J15A 1J5EL 3F2DA 4DUZQ 1HR0W 4KHPL 4JOIC 3S2HH 1PH1A 4A3MG 1VQ9A 4L5QA 1YHAA 3PO2G 2WB1E 3G71A 1YI2A 1WJJA 2E5LL 4BA2I 3RN2A 3AFPA 1KRSA 1E22A 5C0XI 1QVFA 2CWAA 2ZJPA 4QGUA 2NN6I 2WAQG 4QIWE 4Y7NH 3F2BA 2R93H 4DUYQ 1CKNA 1HJPA 1WCMH 4KI0A 1XNRQ 1PH5A 4GKKL 3OW2A 4JYAQ 4DV3Q 3NENA 3I7FA 2VNUD 1EQRA 1Z9FA 2RF4A 1AH9A 4IPHA 4B3RQ 2UUBL 4LF4Q 2WP8J 2F4VL 1I3QH 3MEFA 5LMNL 5LMNW 4A3IH 2JA6H 3TREA 1UE7A 4YHHL 1JB7A 4DV7Q 3AYHB 4PG3A 2JEAI 4HJ9A 1UWVA 2K14A 3K8AA 4GLAC 4O0AA 2R7ZH 4JI8L 4NPSA 4DR4Q 1B70B 3CCRA 1YBYA 5AJ3L 4QY7A 4FDBA 4BBRG 3Q8DA 2C35B 4DV4Q 3S1NH 4DPGA 4BY7H 3NEMA 1I6HH 1HZCA 4IPDA 2YU9H 2WFWA 4LF7Q 2VQEL 1FVIA 4PZ7A 3JC66 1Q82C 2JE6I 3PUZA 3CC7A 1PYSB 4JI7L 5IWAL 4HIOA 1J5EQ 1HR0Q 1JMCA 2ATWA 3CPFA 1MJEA 5IYBG 2CWPA 3KOJA 1PHJA 2QGQA 3BZKA 1IBML 2BH8A 2B63G 2H5XA 3E9HA 1M90C 1HNWL 3TQYA 2E5LQ 2LSSA 3PUWA 4DAMA 2MO1A 3T1YQ 1TWAH 1Q86C 2UXCL 2AKWB 1C9OA 3PIOA 4B3SQ 4BBSH 4K0KQ 3GTJH 1K8GA 2PMZE 1PV4A 4H02A 4A3EH 1Q8KA 4DR7L 3PUXA 4UP9A 3CCVA 2ZJQA 1E1OA 3S1QH 1YZ6A 4HIDA 2KENA 1KHIA 2UUBQ 5LMNQ 4A93G 1YVCA 2VQFL 4R4CA 2EIFA 1G291 3F1ZA 1KC8C 4A3GG 4X65L 2MQHA 4YHHQ 5FJ8G 4TVAB 3U4VA 4A3KG 2KBNA 5IYCG 1E7ZA 4LF5L 3KJPA 4JI8Q 3A5UA 3PO3H 1PH4A 5ELOA 3STBD 3JAMi 1L0WA 2GVBA 4A3CG 4A3MH 1N36Q 4YWMA 1SRUA 3B6YA 2NZHA 2OTJA 1CKOA 4XIGS 2D0PA 3K7AH 4L5TA 3PO2H 4JG2A 3AFQA 4JBMA 4LUZA 4DR5L 4JI7Q 1XNQL 5HY6A 1PYBA 1CKNB 1HZAA 3F2CA 5M3FG 3S15H 3ULPA 3OTOL 1XMQQ 1IBMQ 2N3SA 5C3EG 2HT1A 4LFCQ 3JAMc 4LFBL 4OX9L 5C4XG 3UE1A 1HNWQ 4RMFA 2ES2A 4LF8L 4EX5A 1GD7A 1YEZA 4DR1Q 1ASZA 3A74A 2NVQH 2UXCQ 1VQIA 3J81i 3DM3A 2K5HA 2VS1A 4DR7Q 1BBUA 1N34Q 1K0RA 4YWKA 1IBLL 2HHHL 1KIXA 2MO0A 3CD6A 1X56A 1TWGH 1TXYA 1Y1VG 2YTVA 2R7FA 2F52A 3OYYA 2ZTCA 4LUOA 4OONA 3KF6A 2F3IA 4BBRH 3E9IA 5IYDG 3H3VH 2IT1A 1SFOH 4X65Q 1YNXA 5GAGC 1X54A 2B3GA 1P8LA 2YV5A 3I4MG 3M85A 4LF5Q 1NMFA 1UEBA 2Q2HA 3A0JA 5M5XH 3RN5A 2Q2UA 3CC2A 4OWWB 3HOVG 2FXQA 3FP9A 3CF5A 2OCEA 2CQOA 5IYBH 2NVTH 2JK8A 2B63H 1YITA 1XPOA 5GAEC 1KD1C 1Q1BA 4A3DG 4DV0L 4JV5Q 1X9NA 1N8RC 1N33L 4P72A 1EUJA 3UE0A 3L2PA 2VL6A 3CP0A 4DR5Q 3HKZG 3PO3G 4RG1A 4IFDI 2RCNA 4JI2Q 4B3TL 3BJUA 3OTOQ 2ID0A 1EWIA 3GD7A 4LFBQ 3KJOA 4R4IA 1HNXL 3M7NA 1EFWA 1VQ5A 3DLLA 2GVAA 5FLMG 1XMOQ 1HH2P 1CSPA 4DV2L 1K9MC 3RLFA 4A93H 1YHBA 1VQPA 1RIPA 2DGYA 4A3GH 2N49A 5FJ8H 4A3KH 2Y0SG 4GLXA 4A75A 2A8VA 5IYCH 1IBLQ 3FHWA 4OWTB 2E8GA 2HHHQ 4WJ4A 1IZ6A 1NTGA 1X55A 3S24A 1CKMA 1VQOA 4L5SA 4A3FG 2JA5G 5IP9G 4A3CH 4A76A 5C4JH 2K5VA 1HZ9A 1W2BA 1K73C 3HOWG 4P74A 3I2ZA 4C3JH 3PSIA 2I5HA 2IHFA 4UPAA 4IJHA 4MZ9A 5M3FH 4PZ8A 2JA7G 1G51A 5C3EH 1Y1WG 4DAYB 1S40A 4DK3C 4LWCA 2GN5A 2CKZB 4DV0Q 2Q2TA 4POFA 1FJGQ 5C4XH 2L15A 3EIVA 1N33Q 1CUKA 2YTYA 2NZOA 3TEHB 3RLNA 1DGSA 1V1QA 2MFIA 4UP8A 4B3TQ 4KHPQ 1PH9A 4LF6L 1JE5A 2RHSB 3KF8B 4XTCS 4L5RC 1PFSA 1HNXQ 3KF6B 3MXNB 4X62L 1P16A 3CPWA 3S1RH 1Y1VH 1QVGA 2OQKA 4DV2Q 4A3LH 5GADC 2JA8G 4GS3A 1X6OA 5IYDH 1I50H 2NVXH 5ELNA 4X66L 1M1KC 4GN4B 4EQ5A 1VQ7A 3I4MH 1BBWA 1JJCB 3G48A 4OWXB 4BA1I 4GOPA 1S72A 4GKKQ 4R4QA 4YY3L 2UXBL 1TWHH 3HOVH 5JJKA 5IY0A 4GNXC 4JI5L 4LNQA 3G6EA 3LGJA 1PH8A 2F4VQ 4OO1G 2UUCL 1GO3E 3KFUA 4A3DH 4HJ8A 1R9TH 1SLJA 1VQBA 4GN3B 2ZTEA 2Z6KC 4APVA 5C0XJ 5K36G 3I56A 4LF9L 2YYZA 4KHZA 1VQEA 1A63A 1JT8A 4B3ML 3HFZB 1EIYB 3L0OA 3M9BA 4QL5A 5AJ3Q 1VQHA 2I5LX 1YIJA 4DR6L 2UU9L 1OXSC 2ZM6L 3K81C 2MNAA 2VQEQ 2D0OA 4JI1L 5FLMH 1E3PA 1XTDA 2DUDA 5GAHC 3VDYA 1U5KA 3ULLA 1Z47A 3H3VI 4IOAA 5IWAQ 4WJ3M 4LF6Q 1XJVA 3CAMA 1L1OC 3BZCA 3GTLH 2A1AA 3W1GA 1KXLA 2Z0SA 2JQOA 1AE2A 5E7NA 4P73A 4NB3A 4GOPC 4X62Q 3M4PA 3IRBA 3U50C 1PH7A 4DV1L 1QUQB 4A3FH 2JA5H 5IP9H 4QQBX 3CMEA 3FKIG 5C44G 3PGZA 3ZJYC 1K8AC 3S2DH 4X66Q 2E2HH 3HOWH 4GNXB 1Q81C 3H0GG 2VUMG 5JEAJ 4YY3Q 2UXBQ 4OXPA 4YCVA 4PMWA 4JCVE 1ASYA 4AYBG 3NELA 1HZBA 4GLVB 4UP7A 2JA7H 1X3EA 1IBKL 4AH6A 1Y1WH 4A3LG 1J6QA 2VQFQ 1LUZA 1NY4A 2V1CC 1A0IA 2UUCQ 1PH6A 2E2JH 2K75A 3AEVA 4A3JG 2IX1A 5C0XG 3PF5A 3CC4A 3GTQH 4YCUA 3I55A 2NN6G 4LF9Q 1SROA 3CCSA 2ALYB 2JEBI 3PUYA 2BA0A 4GKJL 5FLXc 2IHEA 4B3MQ 3I4OA 1O7IA 4DV6L 2JA9A 4MNOA 3K7UC 4BXXG 2KCMA 3H15A 1CSQA 4AIMA 3NBHB 1EIFA 3GTPH 3PF4A 2K4KA 3CXCA 4HJ7A 2AWNA 1Q7YC 1WI5A 3F8TA 3I4NG 1OXXK 1X3GA 1L1OB 1AE3A 1Q46A 4LUVA 4JI1Q 4DV3L 1H95A 1QVCA 3W5OA 2JA8H 1XNQQ 3RR5A 1VQJA 1EQQA 4GOPB 4NXNL 4DR3L 3GDEA 2KHIA 4Y52H 2A19A 1IYJB 3HOYH 4JBWA 4HJAA 4LW1A 1Q1EA 1VQFA 1KRTA 4C3IH 4OX9Q 2PI2E 1OXVA 4DV7L 3HOXG 3GTKH 5EAYA 3S1MH 4LF8Q 1VQMA 4MTNA 1OXTA 3CW2C 4HIKA 1V43A 2YTXA 2WB1G 3HKZE 1W3SA 2KCTA 5JEAG 2E2IH 1B8AA 3S16H 2LXKA 2HQLA 2OWOA 4IPCA 2UXDL 1T9HA 2IY5B 1KQSA 1E24A 3PUVA 1JJGA 3UDGA 1IBKQ 1OXUA 1HR0L 1XPRA 3U4ZA 3STBC 4PZ6A 5IP7G 1QUQA 5IT9c 4DR2L 3S14H 2OTLA 3ICEA 3GTOH 4HJ5A 4R1JA 4C2MH 2CCZA 4DNIA 2R7DA 2WAQE 3L7ZC 1IXRA 3AQQA 4GNXA 4ALPA 1SN8A 4UY8C 1XPUA 4A3BG 2Y0SE 4GKJQ 1G6PA 2IX0A 3T1YL 1LM0A 3CQZH 5DLQE 4DV6Q 4B3SL 2RHQB 4K0KL 3S17H 3KDFA 2Z6KA 1NJIC 5JJIA 1NMGA 2QA4A 1LYLA 3HKSA 2I5MX 2UUAL 1GKHA 1TWCH 2XGTA 2XTIA 4BY1G 1YJ9A 1D8LA 3HOUG 3HOZG 1C0AA 1MIUA 3FKIH 5C44H 1VQ8A 4TQUS 5GQOA 1EOVA 3CCQA 3CCLA 4JI3L 4DR3Q 1NE3A 4NXNQ 4JI6L 3PIPA 3UDXA 5IE8A 5BR8L 3H0GH 5LMUL 1WYDA 2VUMH 2VZAA 4JBKA 4NXML 3PV0A 1SR3A 4X6AH 3UDFA 1E1TA 2K5NA 2R92H 1X3FA 3J7ZC 1L1OA 3D0FA 1X65A 4YWLA 2PQAA 2N78A 4A3JH 1JJ2A 1N36L 3TS2A 1QZGA 2VW9A 4IPGA 3HOYG 1GVPA 4JI0L 2UXDQ 3ULJA 3T1HL 3K80C 3M4OH 4IFDJ 3G4SA 4X64L 4IOCA 3ERSX 4DV5L 3CCEA 1VQ4A 4IJLA 1PVOA 1VQCA 1RL2A 1EYGA 4BXXH 4JI4L 2NVYH 3CMAA 4AQYL 1XMQL 2ASBA 3KLWA 4DR2Q 3GTMH 1N32L 1VQDA 4LFCL 4POGA 3TRZA 1D7QA 3I4NH 5GROA 5HGQA 2QEXA 1UE5A 1KAWA 3RZOH 1K3RA 1NBWA 5M5WH 4JC0A 3GO5A 2D62A 4DR1L 5M3MH 3UDIA 1C7YA 1PA6A 1VQGA 4P71A 3J80i 1UE6A 1N34L 3HOXH 2UUAQ 3EBEA 2K52A 1VQAA 1I5FA 2VY3A 1A62A 1VQ6A 5J3BA 4LFAL 1IL2A 1Y14B 1HNZL 4JI3Q 1SMXA 4JI6Q 2BA1A 5M5YH 5BR8Q 3A5ZB 5LMUQ 2HIXA 4IO9A 3D31A 2R93G 4NXMQ 1WOCA 1WCMG 4QJFA 1YJNA 1K83H 1UE1A 1QZHA 3J81j 1BVSA 2N8NA 2JJQA 3J80c 2ZJRA 3CCUA 2LXJA 3CCJA 3J7A5 2ZTDA 2K50A 1FGUA 2AHOB 5IP7H 2CFMA 1VQKA 4A3IG 2JA6G 2AMCB 3RLOA 2Q2IA 3U58A 2PI2A 4IFDG 1OTCA 4JI0Q 4JV5L 3T1HQ 3M3YH 4A3BH 4KLKA 4X64Q 2I0QA 4DKAC 3M4QA 1PH3A 3K0XA 4DV5Q 4DK6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFQ A;  4JI5 Q;  3KDF B;  1GM5 A;  1I94 L;  1VCI A;  4JI2 L;  2R7Z G;  4DUZ L;  4JI4 Q;  4AQY Q;  2R92 G;  4HIM A;  1BKB A;  2EQS A;  1N32 Q;  3WWV A;  1U0L A;  1YHQ A;  1L2F A;  4BY7 G;  1FL0 A;  3E0E A;  4ME3 A;  4BY1 H;  2BH2 A;  4R4T A;  3HOU H;  3HOZ H;  2B29 A;  1PH2 A;  4OO1 I;  4A4I A;  1XMO L;  4YCW A;  1KL9 A;  4C3H H;  1MJC A;  1YJW A;  4JOI A;  1LTL A;  2R6G A;  1TWF H;  3PCO B;  4AYB E;  4DR6 Q;  2UU9 Q;  1A8V A;  1N9W A;  2ZM6 Q;  4DUY L;  3RNU A;  1XNR L;  3TS0 A;  3EN2 A;  4JYA L;  1VS0 A;  3RZD H;  4JBJ A;  2PQA B;  2PNH A;  4LFA Q;  3SGI A;  4R4O A;  3W1B A;  1SE8 A;  2AWO A;  2EXD A;  1HNZ Q;  5M3M G;  4LF4 L;  4B3R L;  4O2D A;  2HIV A;  3CCM A;  4BBS G;  1B7Y B;  1S3O A;  3J81 c;  4A3E G;  3KYH C;  1V9P A;  5H1S E;  3GTG H;  4DV1 Q;  4P75 A;  1VQN A;  5JJL A;  3BU2 A;  4DR4 L;  2KHJ A;  1MKH A;  4DV4 L;  1FJG L;  3ER0 A;  1VQL A;  4GN5 A;  4LF7 L;  2OQ0 A;  1I94 Q;  1Q12 A;  4J15 A;  1J5E L;  3F2D A;  4DUZ Q;  1HR0 W;  4KHP L;  4JOI C;  3S2H H;  1PH1 A;  4A3M G;  1VQ9 A;  4L5Q A;  1YHA A;  3PO2 G;  2WB1 E;  3G71 A;  1YI2 A;  1WJJ A;  2E5L L;  4BA2 I;  3RN2 A;  3AFP A;  1KRS A;  1E22 A;  5C0X I;  1QVF A;  2CWA A;  2ZJP A;  4QGU A;  2NN6 I;  2WAQ G;  4QIW E;  4Y7N H;  3F2B A;  2R93 H;  4DUY Q;  1CKN A;  1HJP A;  1WCM H;  4KI0 A;  1XNR Q;  1PH5 A;  4GKK L;  3OW2 A;  4JYA Q;  4DV3 Q;  3NEN A;  3I7F A;  2VNU D;  1EQR A;  1Z9F A;  2RF4 A;  1AH9 A;  4IPH A;  4B3R Q;  2UUB L;  4LF4 Q;  2WP8 J;  2F4V L;  1I3Q H;  3MEF A;  5LMN L;  5LMN W;  4A3I H;  2JA6 H;  3TRE A;  1UE7 A;  4YHH L;  1JB7 A;  4DV7 Q;  3AYH B;  4PG3 A;  2JEA I;  4HJ9 A;  1UWV A;  2K14 A;  3K8A A;  4GLA C;  4O0A A;  2R7Z H;  4JI8 L;  4NPS A;  4DR4 Q;  1B70 B;  3CCR A;  1YBY A;  5AJ3 L;  4QY7 A;  4FDB A;  4BBR G;  3Q8D A;  2C35 B;  4DV4 Q;  3S1N H;  4DPG A;  4BY7 H;  3NEM A;  1I6H H;  1HZC A;  4IPD A;  2YU9 H;  2WFW A;  4LF7 Q;  2VQE L;  1FVI A;  4PZ7 A;  3JC6 6;  1Q82 C;  2JE6 I;  3PUZ A;  3CC7 A;  1PYS B;  4JI7 L;  5IWA L;  4HIO A;  1J5E Q;  1HR0 Q;  1JMC A;  2ATW A;  3CPF A;  1MJE A;  5IYB G;  2CWP A;  3KOJ A;  1PHJ A;  2QGQ A;  3BZK A;  1IBM L;  2BH8 A;  2B63 G;  2H5X A;  3E9H A;  1M90 C;  1HNW L;  3TQY A;  2E5L Q;  2LSS A;  3PUW A;  4DAM A;  2MO1 A;  3T1Y Q;  1TWA H;  1Q86 C;  2UXC L;  2AKW B;  1C9O A;  3PIO A;  4B3S Q;  4BBS H;  4K0K Q;  3GTJ H;  1K8G A;  2PMZ E;  1PV4 A;  4H02 A;  4A3E H;  1Q8K A;  4DR7 L;  3PUX A;  4UP9 A;  3CCV A;  2ZJQ A;  1E1O A;  3S1Q H;  1YZ6 A;  4HID A;  2KEN A;  1KHI A;  2UUB Q;  5LMN Q;  4A93 G;  1YVC A;  2VQF L;  4R4C A;  2EIF A;  1G29 1;  3F1Z A;  1KC8 C;  4A3G G;  4X65 L;  2MQH A;  4YHH Q;  5FJ8 G;  4TVA B;  3U4V A;  4A3K G;  2KBN A;  5IYC G;  1E7Z A;  4LF5 L;  3KJP A;  4JI8 Q;  3A5U A;  3PO3 H;  1PH4 A;  5ELO A;  3STB D;  3JAM i;  1L0W A;  2GVB A;  4A3C G;  4A3M H;  1N36 Q;  4YWM A;  1SRU A;  3B6Y A;  2NZH A;  2OTJ A;  1CKO A;  4XIG S;  2D0P A;  3K7A H;  4L5T A;  3PO2 H;  4JG2 A;  3AFQ A;  4JBM A;  4LUZ A;  4DR5 L;  4JI7 Q;  1XNQ L;  5HY6 A;  1PYB A;  1CKN B;  1HZA A;  3F2C A;  5M3F G;  3S15 H;  3ULP A;  3OTO L;  1XMQ Q;  1IBM Q;  2N3S A;  5C3E G;  2HT1 A;  4LFC Q;  3JAM c;  4LFB L;  4OX9 L;  5C4X G;  3UE1 A;  1HNW Q;  4RMF A;  2ES2 A;  4LF8 L;  4EX5 A;  1GD7 A;  1YEZ A;  4DR1 Q;  1ASZ A;  3A74 A;  2NVQ H;  2UXC Q;  1VQI A;  3J81 i;  3DM3 A;  2K5H A;  2VS1 A;  4DR7 Q;  1BBU A;  1N34 Q;  1K0R A;  4YWK A;  1IBL L;  2HHH L;  1KIX A;  2MO0 A;  3CD6 A;  1X56 A;  1TWG H;  1TXY A;  1Y1V G;  2YTV A;  2R7F A;  2F52 A;  3OYY A;  2ZTC A;  4LUO A;  4OON A;  3KF6 A;  2F3I A;  4BBR H;  3E9I A;  5IYD G;  3H3V H;  2IT1 A;  1SFO H;  4X65 Q;  1YNX A;  5GAG C;  1X54 A;  2B3G A;  1P8L A;  2YV5 A;  3I4M G;  3M85 A;  4LF5 Q;  1NMF A;  1UEB A;  2Q2H A;  3A0J A;  5M5X H;  3RN5 A;  2Q2U A;  3CC2 A;  4OWW B;  3HOV G;  2FXQ A;  3FP9 A;  3CF5 A;  2OCE A;  2CQO A;  5IYB H;  2NVT H;  2JK8 A;  2B63 H;  1YIT A;  1XPO A;  5GAE C;  1KD1 C;  1Q1B A;  4A3D G;  4DV0 L;  4JV5 Q;  1X9N A;  1N8R C;  1N33 L;  4P72 A;  1EUJ A;  3UE0 A;  3L2P A;  2VL6 A;  3CP0 A;  4DR5 Q;  3HKZ G;  3PO3 G;  4RG1 A;  4IFD I;  2RCN A;  4JI2 Q;  4B3T L;  3BJU A;  3OTO Q;  2ID0 A;  1EWI A;  3GD7 A;  4LFB Q;  3KJO A;  4R4I A;  1HNX L;  3M7N A;  1EFW A;  1VQ5 A;  3DLL A;  2GVA A;  5FLM G;  1XMO Q;  1HH2 P;  1CSP A;  4DV2 L;  1K9M C;  3RLF A;  4A93 H;  1YHB A;  1VQP A;  1RIP A;  2DGY A;  4A3G H;  2N49 A;  5FJ8 H;  4A3K H;  2Y0S G;  4GLX A;  4A75 A;  2A8V A;  5IYC H;  1IBL Q;  3FHW A;  4OWT B;  2E8G A;  2HHH Q;  4WJ4 A;  1IZ6 A;  1NTG A;  1X55 A;  3S24 A;  1CKM A;  1VQO A;  4L5S A;  4A3F G;  2JA5 G;  5IP9 G;  4A3C H;  4A76 A;  5C4J H;  2K5V A;  1HZ9 A;  1W2B A;  1K73 C;  3HOW G;  4P74 A;  3I2Z A;  4C3J H;  3PSI A;  2I5H A;  2IHF A;  4UPA A;  4IJH A;  4MZ9 A;  5M3F H;  4PZ8 A;  2JA7 G;  1G51 A;  5C3E H;  1Y1W G;  4DAY B;  1S40 A;  4DK3 C;  4LWC A;  2GN5 A;  2CKZ B;  4DV0 Q;  2Q2T A;  4POF A;  1FJG Q;  5C4X H;  2L15 A;  3EIV A;  1N33 Q;  1CUK A;  2YTY A;  2NZO A;  3TEH B;  3RLN A;  1DGS A;  1V1Q A;  2MFI A;  4UP8 A;  4B3T Q;  4KHP Q;  1PH9 A;  4LF6 L;  1JE5 A;  2RHS B;  3KF8 B;  4XTC S;  4L5R C;  1PFS A;  1HNX Q;  3KF6 B;  3MXN B;  4X62 L;  1P16 A;  3CPW A;  3S1R H;  1Y1V H;  1QVG A;  2OQK A;  4DV2 Q;  4A3L H;  5GAD C;  2JA8 G;  4GS3 A;  1X6O A;  5IYD H;  1I50 H;  2NVX H;  5ELN A;  4X66 L;  1M1K C;  4GN4 B;  4EQ5 A;  1VQ7 A;  3I4M H;  1BBW A;  1JJC B;  3G48 A;  4OWX B;  4BA1 I;  4GOP A;  1S72 A;  4GKK Q;  4R4Q A;  4YY3 L;  2UXB L;  1TWH H;  3HOV H;  5JJK A;  5IY0 A;  4GNX C;  4JI5 L;  4LNQ A;  3G6E A;  3LGJ A;  1PH8 A;  2F4V Q;  4OO1 G;  2UUC L;  1GO3 E;  3KFU A;  4A3D H;  4HJ8 A;  1R9T H;  1SLJ A;  1VQB A;  4GN3 B;  2ZTE A;  2Z6K C;  4APV A;  5C0X J;  5K36 G;  3I56 A;  4LF9 L;  2YYZ A;  4KHZ A;  1VQE A;  1A63 A;  1JT8 A;  4B3M L;  3HFZ B;  1EIY B;  3L0O A;  3M9B A;  4QL5 A;  5AJ3 Q;  1VQH A;  2I5L X;  1YIJ A;  4DR6 L;  2UU9 L;  1OXS C;  2ZM6 L;  3K81 C;  2MNA A;  2VQE Q;  2D0O A;  4JI1 L;  5FLM H;  1E3P A;  1XTD A;  2DUD A;  5GAH C;  3VDY A;  1U5K A;  3ULL A;  1Z47 A;  3H3V I;  4IOA A;  5IWA Q;  4WJ3 M;  4LF6 Q;  1XJV A;  3CAM A;  1L1O C;  3BZC A;  3GTL H;  2A1A A;  3W1G A;  1KXL A;  2Z0S A;  2JQO A;  1AE2 A;  5E7N A;  4P73 A;  4NB3 A;  4GOP C;  4X62 Q;  3M4P A;  3IRB A;  3U50 C;  1PH7 A;  4DV1 L;  1QUQ B;  4A3F H;  2JA5 H;  5IP9 H;  4QQB X;  3CME A;  3FKI G;  5C44 G;  3PGZ A;  3ZJY C;  1K8A C;  3S2D H;  4X66 Q;  2E2H H;  3HOW H;  4GNX B;  1Q81 C;  3H0G G;  2VUM G;  5JEA J;  4YY3 Q;  2UXB Q;  4OXP A;  4YCV A;  4PMW A;  4JCV E;  1ASY A;  4AYB G;  3NEL A;  1HZB A;  4GLV B;  4UP7 A;  2JA7 H;  1X3E A;  1IBK L;  4AH6 A;  1Y1W H;  4A3L G;  1J6Q A;  2VQF Q;  1LUZ A;  1NY4 A;  2V1C C;  1A0I A;  2UUC Q;  1PH6 A;  2E2J H;  2K75 A;  3AEV A;  4A3J G;  2IX1 A;  5C0X G;  3PF5 A;  3CC4 A;  3GTQ H;  4YCU A;  3I55 A;  2NN6 G;  4LF9 Q;  1SRO A;  3CCS A;  2ALY B;  2JEB I;  3PUY A;  2BA0 A;  4GKJ L;  5FLX c;  2IHE A;  4B3M Q;  3I4O A;  1O7I A;  4DV6 L;  2JA9 A;  4MNO A;  3K7U C;  4BXX G;  2KCM A;  3H15 A;  1CSQ A;  4AIM A;  3NBH B;  1EIF A;  3GTP H;  3PF4 A;  2K4K A;  3CXC A;  4HJ7 A;  2AWN A;  1Q7Y C;  1WI5 A;  3F8T A;  3I4N G;  1OXX K;  1X3G A;  1L1O B;  1AE3 A;  1Q46 A;  4LUV A;  4JI1 Q;  4DV3 L;  1H95 A;  1QVC A;  3W5O A;  2JA8 H;  1XNQ Q;  3RR5 A;  1VQJ A;  1EQQ A;  4GOP B;  4NXN L;  4DR3 L;  3GDE A;  2KHI A;  4Y52 H;  2A19 A;  1IYJ B;  3HOY H;  4JBW A;  4HJA A;  4LW1 A;  1Q1E A;  1VQF A;  1KRT A;  4C3I H;  4OX9 Q;  2PI2 E;  1OXV A;  4DV7 L;  3HOX G;  3GTK H;  5EAY A;  3S1M H;  4LF8 Q;  1VQM A;  4MTN A;  1OXT A;  3CW2 C;  4HIK A;  1V43 A;  2YTX A;  2WB1 G;  3HKZ E;  1W3S A;  2KCT A;  5JEA G;  2E2I H;  1B8A A;  3S16 H;  2LXK A;  2HQL A;  2OWO A;  4IPC A;  2UXD L;  1T9H A;  2IY5 B;  1KQS A;  1E24 A;  3PUV A;  1JJG A;  3UDG A;  1IBK Q;  1OXU A;  1HR0 L;  1XPR A;  3U4Z A;  3STB C;  4PZ6 A;  5IP7 G;  1QUQ A;  5IT9 c;  4DR2 L;  3S14 H;  2OTL A;  3ICE A;  3GTO H;  4HJ5 A;  4R1J A;  4C2M H;  2CCZ A;  4DNI A;  2R7D A;  2WAQ E;  3L7Z C;  1IXR A;  3AQQ A;  4GNX A;  4ALP A;  1SN8 A;  4UY8 C;  1XPU A;  4A3B G;  2Y0S E;  4GKJ Q;  1G6P A;  2IX0 A;  3T1Y L;  1LM0 A;  3CQZ H;  5DLQ E;  4DV6 Q;  4B3S L;  2RHQ B;  4K0K L;  3S17 H;  3KDF A;  2Z6K A;  1NJI C;  5JJI A;  1NMG A;  2QA4 A;  1LYL A;  3HKS A;  2I5M X;  2UUA L;  1GKH A;  1TWC H;  2XGT A;  2XTI A;  4BY1 G;  1YJ9 A;  1D8L A;  3HOU G;  3HOZ G;  1C0A A;  1MIU A;  3FKI H;  5C44 H;  1VQ8 A;  4TQU S;  5GQO A;  1EOV A;  3CCQ A;  3CCL A;  4JI3 L;  4DR3 Q;  1NE3 A;  4NXN Q;  4JI6 L;  3PIP A;  3UDX A;  5IE8 A;  5BR8 L;  3H0G H;  5LMU L;  1WYD A;  2VUM H;  2VZA A;  4JBK A;  4NXM L;  3PV0 A;  1SR3 A;  4X6A H;  3UDF A;  1E1T A;  2K5N A;  2R92 H;  1X3F A;  3J7Z C;  1L1O A;  3D0F A;  1X65 A;  4YWL A;  2PQA A;  2N78 A;  4A3J H;  1JJ2 A;  1N36 L;  3TS2 A;  1QZG A;  2VW9 A;  4IPG A;  3HOY G;  1GVP A;  4JI0 L;  2UXD Q;  3ULJ A;  3T1H L;  3K80 C;  3M4O H;  4IFD J;  3G4S A;  4X64 L;  4IOC A;  3ERS X;  4DV5 L;  3CCE A;  1VQ4 A;  4IJL A;  1PVO A;  1VQC A;  1RL2 A;  1EYG A;  4BXX H;  4JI4 L;  2NVY H;  3CMA A;  4AQY L;  1XMQ L;  2ASB A;  3KLW A;  4DR2 Q;  3GTM H;  1N32 L;  1VQD A;  4LFC L;  4POG A;  3TRZ A;  1D7Q A;  3I4N H;  5GRO A;  5HGQ A;  2QEX A;  1UE5 A;  1KAW A;  3RZO H;  1K3R A;  1NBW A;  5M5W H;  4JC0 A;  3GO5 A;  2D62 A;  4DR1 L;  5M3M H;  3UDI A;  1C7Y A;  1PA6 A;  1VQG A;  4P71 A;  3J80 i;  1UE6 A;  1N34 L;  3HOX H;  2UUA Q;  3EBE A;  2K52 A;  1VQA A;  1I5F A;  2VY3 A;  1A62 A;  1VQ6 A;  5J3B A;  4LFA L;  1IL2 A;  1Y14 B;  1HNZ L;  4JI3 Q;  1SMX A;  4JI6 Q;  2BA1 A;  5M5Y H;  5BR8 Q;  3A5Z B;  5LMU Q;  2HIX A;  4IO9 A;  3D31 A;  2R93 G;  4NXM Q;  1WOC A;  1WCM G;  4QJF A;  1YJN A;  1K83 H;  1UE1 A;  1QZH A;  3J81 j;  1BVS A;  2N8N A;  2JJQ A;  3J80 c;  2ZJR A;  3CCU A;  2LXJ A;  3CCJ A;  3J7A 5;  2ZTD A;  2K50 A;  1FGU A;  2AHO B;  5IP7 H;  2CFM A;  1VQK A;  4A3I G;  2JA6 G;  2AMC B;  3RLO A;  2Q2I A;  3U58 A;  2PI2 A;  4IFD G;  1OTC A;  4JI0 Q;  4JV5 L;  3T1H Q;  3M3Y H;  4A3B H;  4KLK A;  4X64 Q;  2I0Q A;  4DKA C;  3M4Q A;  1PH3 A;  3K0X A;  4DV5 Q;  4DK6 C; 
#chains in the Genus database with same CATH topology
 4JI5 Q;  2R7Z G;  1K28 A;  1PRT B;  4AQY Q;  2EQS A;  1DM0 B;  2C5C A;  4C3I B;  1A3V A;  3S1M B;  2D5D A;  1MJC A;  1G8Z D;  1QNU A;  4JOI A;  1LTL A;  3I73 A;  1RTN A;  4AYB E;  2ZXP A;  4DR6 Q;  4FXG C;  2UU9 Q;  4A3K B;  2C9O A;  1N9W A;  3AMU A;  1CM9 A;  1SYG A;  5IT9 E;  3E0J A;  2EYJ A;  4LFA Q;  3W1B A;  2EYF A;  3P7J A;  5M3M G;  1MGS A;  4N8X 1;  2HIV A;  2G9D A;  3GTO B;  3KYH C;  1V9P A;  3A8I E;  3GTG H;  1KLU D;  3MFY A;  4DR4 L;  2PZW A;  4M1U B;  3DWQ A;  1MKH A;  3PIO 3;  4Q5V A;  2Z4I A;  1STB A;  1B2T A;  2QEJ C;  3ER0 A;  4LF7 L;  1LT3 D;  3NTH A;  3QWN A;  2A6E C;  1QOH A;  3FKI B;  3A55 A;  4J15 A;  1J5E L;  1PH1 A;  4A3M G;  2EXZ A;  3HEJ A;  3GV3 A;  4L5Q A;  1EL0 A;  3S1R B;  2WB1 E;  4J1M A;  1WJJ A;  2CVR A;  5CBA E;  1QJO A;  2BDO A;  4A3J B;  2WAQ G;  4KI0 A;  2XSC A;  4K2L A;  4DV3 Q;  3NEN A;  3I7F A;  1AH9 A;  2SOB A;  1ENA A;  2SNM A;  2WP8 J;  3MEF A;  5DM7 3;  1HFN A;  3T56 B;  3TRE A;  1UE7 A;  4F87 A;  4YHH L;  4DV7 Q;  2JEA I;  4HJ9 A;  1L0X B;  3RZO B;  3K8A A;  4GLA C;  3RD4 A;  3TBI B;  2CH4 A;  2B2U A;  4DR4 Q;  1G2S A;  5AJ3 L;  4FDB A;  4BBR G;  3Q8D A;  4BY7 H;  3NEM A;  3HOX B;  2YU9 H;  4LF7 Q;  1XXG A;  5FO7 B;  4CJ2 C;  1ICF B;  1PYS B;  1J5E Q;  4OIJ A;  1HHV A;  1MJE A;  3TP6 A;  3KOJ A;  2QGQ A;  1NSN S;  2H5X A;  4QIW B;  2LSS A;  3PUW A;  4OEM B;  2MO1 A;  3PIO A;  5KYI A;  3HOW B;  2K03 A;  1K8G A;  4V0B A;  2O5I C;  3PUX A;  2DJF C;  3BVG A;  3MTS A;  1YZ6 A;  4HID A;  3MXG A;  2E75 C;  5J1Z A;  2VQF L;  1SSO A;  2MQH A;  4YHH Q;  5CV6 A;  1E7Z A;  2PPB C;  4LF5 L;  1WTP A;  5E1F A;  4X3S A;  3MXU A;  4UHV A;  3STB D;  2F0O A;  3BDL A;  3S9W A;  1SRU A;  4ZQ3 A;  3MEH A;  3K7A H;  3PO2 H;  3AFQ A;  2JA8 B;  5C5L A;  1PYB A;  1O80 A;  1HZA A;  3S15 H;  3ULP A;  3OTO L;  4K6L A;  3K58 A;  3UE1 A;  2PMZ B;  4O1N A;  1V1P A;  3A74 A;  3DM3 A;  3SK4 A;  2MJ8 A;  2E2I B;  2VS1 A;  1BBU A;  2ENB A;  3K59 A;  4YWK A;  3H91 A;  5D65 A;  4DK0 A;  1KIX A;  3X3M A;  1X56 A;  2R7F A;  2K1B A;  3KF6 A;  2IT1 A;  3NQT A;  1P8L A;  3I4M G;  3VA7 A;  3M85 A;  3MA2 B;  4LF5 Q;  3CQZ B;  3V05 A;  2B63 H;  1KD1 C;  4A3D G;  4PMC A;  4OGQ C;  4JV5 Q;  1AP0 A;  1I6V C;  1TWC B;  1EUJ A;  3L2P A;  4N9T A;  3HKZ G;  3PO3 G;  3QB3 A;  4JI2 Q;  4B3T L;  3OTO Q;  4FF1 A;  3P75 A;  3OW7 A;  2Q8T A;  3SEB A;  1HNX L;  4ZAI A;  5K5P A;  1HA5 A;  1HH2 P;  4KN4 C;  4RCN A;  3RLF A;  2F3V A;  1YHB A;  1EY8 A;  2DGY A;  4BY7 B;  4XDX A;  2J7Z A;  1SBB B;  4QB4 A;  5IYC H;  4OWT B;  2E8G A;  2XNA C;  1UEA B;  1X55 A;  1LLR D;  3S24 A;  4A3F G;  2JA5 G;  4A3C H;  5J39 A;  3G6J B;  3WOE A;  1W2B A;  3K6O A;  1ICW A;  2I5H A;  2QW7 A;  4UPA A;  2FMC A;  2L55 A;  4MZ9 A;  1AEX A;  5M3F H;  1G51 A;  3P1H A;  4DAY B;  5I6W A;  2LS0 1;  1S40 A;  1V8Q A;  1FJG Q;  1TS2 A;  3BG3 A;  5C4X H;  4CKC A;  2YTY A;  5DNF A;  4CGY B;  2JSO A;  4B3T Q;  1MSG A;  1PH9 A;  1YNJ D;  4L5R C;  4XTC S;  4C1N I;  3P20 A;  5LL6 X;  1HNX Q;  3SK5 A;  2IL8 A;  2RDF A;  1EZ8 A;  4X62 L;  1P16 A;  4A3L H;  1X6O A;  3D6C A;  2NVX H;  2MP1 A;  3K5N A;  1SNQ A;  2PCF B;  2EOT A;  1JJC B;  4A3B B;  2OXP A;  4C3I G;  1ML0 D;  5JJK A;  3HOV H;  2FJ2 A;  5IY0 A;  1CZW A;  4I65 A;  4GNX C;  1D2B A;  2EYL A;  1Q3L A;  1WTH A;  1GO3 E;  1DON A;  1B50 A;  4O42 A;  2NZ1 D;  4APV A;  5K36 G;  3ND9 A;  4LF9 L;  4KHZ A;  4DNR B;  4C3H B;  4B3M L;  5EBD A;  1RJT A;  3JAM L;  1LTA D;  4NW2 A;  4RGM A;  1OXS C;  2VQE Q;  3NK9 A;  3RZD B;  5FLM H;  3VDY A;  5GAH C;  3H3V I;  4WJ3 M;  2KJX A;  2F03 A;  1L1O C;  3GTL H;  2A1A A;  3W1G A;  2JQO A;  5E7N A;  1U4P A;  1LTS D;  4X62 Q;  3MAQ A;  4DV1 L;  1GUO A;  1PFB A;  4M8A A;  3FKI G;  4EQP A;  3CME A;  1K8A C;  3OMC A;  3J81 L;  2E2H H;  4GNX B;  3H0G G;  5EGT A;  1A6X A;  4OXP A;  1QIL A;  4JCV E;  3NEL A;  2JA7 H;  1X3E A;  1IBK L;  1AN8 A;  5A35 A;  1J6Q A;  3VYS A;  1A0I A;  3KBG A;  3PIP 3;  2B2V A;  4EVO A;  4A3J G;  5C0X G;  3I55 A;  2NN6 G;  3Q24 A;  4LF9 Q;  2K5D A;  3CCS A;  2ALY B;  2JEB I;  3PUY A;  4B3M Q;  4Z9C B;  5BN5 A;  2ZT9 C;  3H15 A;  1CSQ A;  4AIM A;  3R8B A;  5CV9 A;  5NUC A;  5J22 A;  5T1I A;  2X6G A;  1OXX K;  4ME5 A;  1L1O B;  3RR5 A;  3GDE A;  2KEC A;  3HOY H;  4JBW A;  4HJA A;  1Q1E A;  2PI2 E;  3ERO A;  3HOX G;  3GTK H;  2XVS A;  2R7Z B;  3MHB A;  2EY2 A;  3CW2 C;  3S1N B;  2RDG A;  2WII B;  5C4X B;  1B8A A;  3CHB D;  2HQL A;  4MHE A;  2OWO A;  2IY5 B;  1FNV A;  5KIX A;  1IBK Q;  2F3W A;  1SE4 A;  5IT9 c;  1EEF D;  3S14 H;  2OTL A;  5D14 A;  3TDQ A;  1E2V A;  4R1J A;  4UY8 C;  4ALP A;  3AQQ A;  1G6P A;  2JXM B;  2Y0S E;  3T1Y L;  1LM0 A;  1VF5 C;  5DLQ E;  2NVX B;  4K0K L;  3I8Z A;  1QCB D;  2Z6K A;  5JJI A;  1SEB D;  3HOV B;  1YJ9 A;  2F0N A;  1C0A A;  2OT2 A;  1F9S A;  4TQU S;  5GQO A;  3CCQ A;  3FEW X;  4KK7 A;  3PIP A;  5IE8 A;  5IGF A;  1Y8O B;  1EYA A;  1SR3 A;  1MHW C;  1G6Z A;  3BYT B;  2R92 H;  1PTO H;  5JJZ A;  4A3M B;  3D0F A;  4QCL A;  2N78 A;  3TS2 A;  3M4O H;  2O4X A;  3K80 C;  5A2Q E;  4IFD J;  3J7Y W;  1MBY A;  3ERS X;  1HTL D;  4IJL A;  3I91 A;  1OO9 B;  1EU3 A;  2WAQ B;  5EPK A;  2NVY H;  3GTL B;  2Z6B A;  1G2T A;  1N32 L;  4POG A;  3I4N H;  1VMC A;  3PQI A;  1H9M A;  2EDG A;  1JOR A;  1K3R A;  3GO5 A;  5ELF A;  2E2H B;  1PA6 A;  2Z1C A;  3SR1 A;  1MD2 D;  3J80 i;  4DGZ A;  1RCV D;  1UE6 A;  1N34 L;  3KUP A;  2F0K A;  1I5F A;  5J3B A;  1Q90 A;  2HDL A;  1IL8 A;  2BA1 A;  4IO9 A;  4QJF A;  1UE1 A;  1B9N A;  3J81 j;  1BVS A;  1I4X A;  4K14 A;  4RFB A;  3C2P A;  2LXJ A;  1ZYR C;  4CDF C;  4L6T B;  1D5X C;  4XYO A;  3RLO A;  2Q2I A;  3U58 A;  3VYR A;  4MTK A;  3M3Y H;  1PH3 A;  1WFQ A;  3KDF B;  1VCI A;  2KHS A;  2QIL A;  4DUZ L;  4IUR A;  1N32 Q;  3WWV A;  1U0L A;  1YHQ A;  1L2F A;  4BY7 G;  1FL0 A;  4ME3 A;  4F8M A;  1TS4 A;  2BH2 A;  4OO1 I;  2B29 A;  4A4I A;  1YNN C;  1HQR D;  1C8C A;  4WOR A;  2AQ1 B;  2PZU A;  2GA4 B;  1PTO C;  1Q8I A;  3EN2 A;  3R93 A;  3LWE A;  3X3N A;  2PNH A;  1SYB A;  3SGI A;  1SE8 A;  5IOC A;  4LF4 L;  1EY0 A;  3S14 B;  3R3O A;  3Q0A A;  1TVX A;  4P75 A;  5I2X A;  1WTW A;  2P5Z X;  4KY7 A;  2KHJ A;  4I7Z C;  2K04 A;  4UAI A;  1DJR D;  2A6H D;  2N55 A;  1I4Q A;  2K7V A;  2LY7 A;  4H0L C;  4X3U A;  4K8I A;  1ET6 A;  1Q12 A;  4KHP L;  4DUZ Q;  5IGB A;  1W6J A;  4FYD A;  5EPJ A;  1BCP B;  1I4P A;  5CV5 A;  2B2Y A;  2F0E A;  1IHZ A;  3L3O C;  1YHA A;  4AYB B;  4DXF A;  3PO2 G;  3G71 A;  4OIK A;  1D1I A;  2ZJP A;  3I4M B;  5EKK A;  4Y7N H;  4XQN A;  1B3A A;  2MHV A;  1HJP A;  4GKK L;  2VNU D;  3W2D A;  1FNU A;  4FO2 A;  1HQM C;  1UUP A;  4LF4 Q;  4TRD A;  2NVY B;  1I3Q H;  3LX0 A;  2F0M A;  5LMN L;  4A3I H;  4A3D B;  4IFD H;  4HTH A;  1R9T B;  1HFG A;  2SEB D;  3BS1 A;  2KA7 A;  2K14 A;  2TMP A;  1QE6 A;  2HCC A;  4QUF A;  1B70 B;  1L0Y B;  1I6H H;  4IPD A;  2MUY A;  2NWG A;  5KND A;  2JE6 I;  1T5E A;  3SK8 A;  3CC7 A;  1HR0 Q;  2OF1 A;  2WB1 B;  2CWP A;  1IBM L;  2BH8 A;  2B63 G;  4FF4 A;  2B8F A;  2IW3 A;  1R4P B;  1M90 C;  1HNW L;  3TQY A;  2H1E A;  4A3F B;  2BE5 D;  2JA5 B;  2L5T A;  1TWA H;  3S2D B;  1LV9 A;  1C9O A;  1FR3 A;  3A54 A;  3ONA B;  4BBS H;  1TKW B;  4H02 A;  4UP9 A;  4R9W A;  1A15 A;  2ZJQ A;  1PZI D;  2KEN A;  3V96 A;  4LJZ C;  4NKL A;  5LMN Q;  3BVM A;  4G7Z C;  2EIF A;  1G29 1;  4FNF A;  5EBC A;  1SYC A;  4RKB A;  2K01 A;  5IYC G;  3KJP A;  1PH4 A;  1TY0 A;  5ELO A;  4CKB A;  1EIH A;  1L0W A;  2GVB A;  3GTP B;  1LTB D;  4A3C G;  1XYI A;  1N36 Q;  2CH4 W;  4YWM A;  5JAV A;  2B39 A;  1NNX A;  1S5F D;  1JE4 A;  4LUZ A;  3J81 E;  1CKN B;  2LFN A;  3F2C A;  5M3F G;  3NE5 B;  1IBM Q;  4L8J A;  1JOK A;  1SMY C;  3M4Y A;  4LFB L;  4DAV A;  3VR6 A;  2XRQ D;  5C4X G;  1HNW Q;  4RMF A;  5EKL A;  3KLS X;  1GD7 A;  4DR1 Q;  2PO4 A;  4KY6 A;  2FIN B;  1IBL L;  1TWG H;  1TXY A;  2EJG C;  2ZTC A;  1ENC A;  1EY7 A;  1XX8 A;  2F3I A;  3E9I A;  3FPP A;  3GV6 A;  1SFO H;  1YNX A;  2N88 A;  1E2Z A;  5M5X H;  2Q2U A;  3HOV G;  3RN5 A;  3CC2 A;  3FP9 A;  2OCE A;  2CQO A;  4K6D A;  3TP7 A;  2L12 A;  4DV0 L;  2RCF A;  2AUK A;  4KJO A;  4XT3 B;  1I3Q B;  4A3I B;  1EWH A;  3H0G B;  3GD7 A;  5IIF A;  2A5H A;  4JK1 C;  2F1M A;  4LFB Q;  3KJO A;  1LTG D;  5KEE A;  1VQ5 A;  1BDO A;  2AUJ D;  3DLL A;  2DY7 A;  4KMU C;  5FLM G;  1CSP A;  1SE3 A;  1VQP A;  1RIP A;  1C4Q A;  4A3G H;  1I6H B;  5JPN C;  3AU7 A;  3FVQ A;  1IBL Q;  5CV7 A;  1NTG A;  3ND8 A;  1HXY D;  3CU7 A;  4JPB W;  3GTM B;  3A8J E;  4IUN A;  3ERQ A;  3I2Z A;  3UI2 A;  2RA4 A;  1ZEQ X;  4RGT A;  1EY5 A;  2A73 B;  4PZ8 A;  5BN3 A;  2JA7 G;  5C3E H;  2R3Z A;  3WDN A;  4LWC A;  2CKZ B;  4DV0 Q;  3SXH A;  3EIV A;  4JW0 A;  3T13 A;  1YNN D;  2NZO A;  1QNK A;  1NCV A;  3QG1 A;  1BCP D;  2MFI A;  1JE5 A;  1PFS A;  2E74 C;  1TQO A;  2EJF C;  3CPW A;  1Y1V H;  2OQK A;  4GS3 A;  4YIJ A;  1I50 H;  1M1K C;  4EQ5 A;  1VQ7 A;  4OWX B;  4DF7 A;  4R4Q A;  2UXB L;  1CQF A;  2X69 A;  1A2U A;  4LNQ A;  1PMR A;  4XQQ A;  4ZKB B;  1O7Y A;  2HQE A;  1PTO F;  2ZTE A;  4GN3 B;  2B2W C;  2Q8I B;  3VA5 A;  3I56 A;  4QF4 A;  2YYZ A;  1VQE A;  1A63 A;  2OEO A;  3M9B A;  2CQA A;  5AJ3 Q;  3K57 A;  1ILP A;  1ILQ A;  1BO0 A;  2ZM6 L;  1AZQ A;  3K81 C;  2MNA A;  3C1E A;  1SDF A;  4JI1 L;  2B2T A;  2DUD A;  1QB5 D;  4PNY A;  1TWG B;  1U5K A;  1HA6 A;  2NTS A;  4C1N K;  5IGE A;  1SFO B;  1XJV A;  3BZC A;  5KYL A;  3DWP A;  4P73 A;  3F2U A;  3GTG B;  3IRB A;  2M9V A;  5I4D A;  1QUQ B;  1KNA A;  5IP9 H;  3VR2 A;  4DK1 A;  1CI3 M;  5JEA J;  1JOO A;  2UXB Q;  3H6M A;  2QDB A;  4YCV A;  4PMW A;  4AYB G;  3HS0 C;  4GLV B;  2M2L A;  5LHY 1;  4AH6 A;  1Y1W H;  2VQF Q;  3K0Y A;  1PH6 A;  2E2J H;  2K75 A;  2PW5 A;  2IX1 A;  3AEV A;  3ITP A;  3CC4 A;  2WAC A;  4L63 B;  2Z4H A;  2IHE A;  4HED A;  4RWS C;  4MN3 A;  4A3G B;  3PF4 A;  1EIF A;  3CXC A;  3QJY A;  3T53 B;  1PRT D;  2AWN A;  1WI5 A;  1BOS A;  3I4N G;  3I72 A;  4JI1 Q;  1GUS A;  1S5E D;  3W5O A;  1B3Q A;  2A69 C;  3NUC A;  1WTO A;  4WJW A;  5FK9 C;  4NXN L;  5JPM C;  3OSO A;  3BVZ A;  1A2T A;  3K5O A;  4LW1 A;  3T4A C;  4IUU A;  5EAY A;  2AQ3 B;  1OXT A;  1V43 A;  4U68 A;  3J7A V;  2WB1 G;  1W3S A;  2YU9 B;  3S16 H;  4LAA A;  3TZU A;  4IPC A;  1T9H A;  2VXW A;  1ENF A;  1KQS A;  3PUV A;  1T5X D;  5L37 A;  4ID6 A;  3UDG A;  4FXD A;  1J9O A;  1XPR A;  4RGO S;  3DHQ A;  4I7A A;  2KEE A;  3N52 A;  3ICE A;  2HCI A;  5CC4 A;  4C2M H;  4BWG B;  2CCZ A;  3I3C A;  4ZUJ A;  1SN8 A;  2EYP A;  1I50 B;  1WD1 A;  4B3S L;  1FGB D;  3S17 H;  3KDF A;  4U67 3;  1NMG A;  2QA4 A;  1LYL A;  2I5M X;  1WTV A;  3T16 A;  2XTI A;  5CBE E;  1CFM A;  5C44 H;  2TSS A;  3CCL A;  4NXN Q;  1NE3 A;  2RSO A;  3UDX A;  5LMU L;  1E2W A;  3VYT A;  2VUM H;  4NXM L;  4ZUI A;  2RQX A;  4H44 C;  4ILW A;  1LT4 D;  1O78 A;  2A74 C;  2BDN A;  3NBH A;  2F0G A;  4X6A H;  4TKO B;  2F0H A;  2EVB A;  2JP1 A;  2L1B A;  1X65 A;  4YWL A;  1SYF A;  4OHJ A;  2VW9 A;  1QZG A;  1GVP A;  3K7A B;  3PO2 B;  1WTQ A;  3G4S A;  4RHR A;  3Q23 A;  1PVO A;  3S15 B;  1RL2 A;  4R8I A;  1EYG A;  4JI4 L;  1XMQ L;  3NWS A;  2Y0S B;  4LFC L;  2F0F A;  1D7Q A;  2F0T A;  2F0J A;  2A6E D;  1UE5 A;  1KAW A;  4JC0 A;  1STN A;  1EOT A;  2D62 A;  5M3M H;  3D3R A;  3UDI A;  1SJH D;  1C7Y A;  1VQG A;  3D4R A;  3Q22 A;  1EYC A;  3EBE A;  2K52 A;  4KTA A;  1GUN A;  1A62 A;  1ONL A;  1IL2 A;  3NQI A;  1SMX A;  5C5M A;  5M5Y H;  5JEA H;  5LMU Q;  5FLX E;  3D8G A;  4QMG A;  4NXM Q;  1K3B C;  1EU4 A;  1K83 H;  4XXE A;  2JJQ A;  3J80 c;  2K6A A;  5IP7 H;  2AHO B;  1DOL A;  5E4X A;  2B63 B;  4A3I G;  3LWU A;  2AMC B;  1QWY A;  2L11 A;  1JIC A;  4IFD G;  2DN8 A;  1OTC A;  4KLK A;  1I94 L;  2FHT A;  4JI4 Q;  1BKB A;  5FKA C;  2PW7 A;  4BY1 H;  3HOU H;  3EFX D;  1XMO L;  4YCW A;  1KL9 A;  1TWF H;  3PCO B;  1SJE D;  1A8V A;  1CA6 A;  1CTM A;  4DUY L;  3VR3 A;  3TME A;  1XNR L;  3TS0 A;  1VS0 A;  1GUG A;  2V4D A;  2PQA B;  4IUQ A;  2F4I A;  2AWO A;  3CCM A;  4BBS G;  3J81 c;  2CHB D;  5H1S E;  1I4R A;  3HRZ C;  4DV1 Q;  4B9W A;  5JJL A;  5M3F B;  3BU2 A;  2K5Q A;  1WTX A;  1V1O A;  1ESR A;  3GP7 A;  5E4W C;  3HGB A;  3ZYY X;  2OQ0 A;  4KKS A;  1I94 Q;  4QUC A;  1D5Z C;  3CRL C;  3F2D A;  1HR0 W;  2EJM A;  1K8M A;  3MWY W;  3IKJ A;  3S2H H;  3BYY B;  1LT6 D;  1FD7 D;  2XRS D;  4BA2 I;  1K0S A;  5C0X I;  1E22 A;  1M4V A;  4KD3 A;  4QGU A;  2NN6 I;  2R93 H;  4DUY Q;  1CKN A;  5IGD A;  1XNR Q;  3D6W A;  3OW2 A;  2Q8R E;  2J4X A;  1FYC A;  2EY6 A;  2F4V L;  5LMN W;  4HCS A;  5E3F A;  1JB7 A;  1KDC A;  3CRK C;  3AYH B;  4CDC C;  1A3T A;  4O0A A;  4JI8 L;  1YBY A;  4QY7 A;  2C35 B;  4DPG A;  4LK1 C;  1HZC A;  2F0L A;  3JC6 6;  5IWA L;  4HIO A;  4ZKC B;  5M5Y B;  2ATW A;  3CPF A;  4CDD C;  1PHJ A;  4HR7 B;  1NR4 A;  1PDQ A;  1GHK A;  2A69 D;  4DAM A;  3T1Y Q;  2UXC L;  4DXG A;  2AKW B;  4K0K Q;  1SE2 A;  3GTJ H;  5CR3 A;  1PV4 A;  4A3E H;  1Q8K A;  1QG7 A;  4DR7 L;  3CCV A;  2F0P A;  1RHP A;  2JA7 B;  5CGK A;  2PQE A;  1KHI A;  4KKU A;  1NR2 A;  3F1Z A;  4A3G G;  1B53 A;  1HRJ A;  4BY1 B;  2G5D A;  3HOU B;  1TU2 B;  4JI8 Q;  4IAL A;  3PO3 H;  3JAM i;  1BR9 A;  2H4O A;  3B6Y A;  2OTJ A;  4P2C B;  1CKO A;  4XIG S;  5C4Z A;  1UNS A;  1RD9 D;  4JG2 A;  4X3T A;  4JBM A;  5LL6 S;  4DR5 L;  1XNQ L;  2DNC A;  3HOY B;  2ZXO A;  2N3S A;  5C3E G;  1LO5 D;  2HUG A;  2HT1 A;  3KBX A;  4OX9 L;  3GTK B;  4LF8 L;  1ASZ A;  1FNW A;  2NVQ H;  2UXC Q;  1H9K A;  3J81 i;  5G3L D;  1UAP A;  1PZJ D;  3TP5 A;  3SK6 A;  5ISR A;  4DR7 Q;  1N34 Q;  3C3L A;  1K0R A;  2AQ2 B;  1GXD C;  3NP8 A;  3TN2 A;  3K5M A;  1BUV T;  3CD6 A;  3VR5 A;  4FF2 A;  1Y1V G;  3OYY A;  4LUO A;  3SHL A;  2F52 A;  3H3V H;  1X54 A;  1GUW A;  2KED A;  4HSV A;  1CQV A;  5IGG A;  2IWH A;  2Z9H A;  1U4R A;  3QO2 A;  4OWW B;  4EQO A;  2FXQ A;  3CF5 A;  2DY8 A;  5IYB H;  1YIT A;  1XPO A;  2CW0 C;  3R2T A;  5GAE C;  4B08 A;  1U4L A;  4P72 A;  3CP0 A;  4DR5 Q;  4RG1 A;  3QIA A;  5M9O A;  2EYO A;  4S3S A;  5KNC A;  3M7N A;  1EFW A;  2GVA A;  3L9A X;  4IN3 A;  4DV2 L;  1PTO B;  2R92 B;  4A93 H;  2FFK B;  2N49 A;  3MXP A;  3E6Z X;  1SNC A;  5FJ8 H;  4A3K H;  1S5D D;  1VMP A;  2B2V C;  2Y0S G;  4A75 A;  2A8V A;  3M4O B;  3FHW A;  1IZ6 A;  1EFI D;  2D9U A;  1CKM A;  1VQO A;  2HDM A;  5IP9 G;  3BDO A;  3HP3 A;  5C4J H;  4FP5 D;  4A76 A;  2HD3 A;  4JVZ A;  3I4N B;  3TSS A;  4C3J H;  3PSI A;  1B1Z A;  4XYQ A;  1B44 D;  2IHF A;  4IJH A;  3A7L A;  3RMH A;  1LAC A;  1Y1W G;  4ZLT F;  4KKT A;  1JCK B;  2GN5 A;  5EKI A;  2Q2T A;  1TR5 A;  2L15 A;  1WD0 A;  1XTC D;  3TEH B;  1DGS A;  1V1Q A;  4KHP Q;  2EE1 A;  3DWA A;  4LF6 L;  3KF8 B;  2RHS B;  3IAY A;  3TZD A;  3MXN B;  3S1R H;  5FO8 B;  3H3V C;  2JN4 A;  1QVG A;  5CV8 A;  4DV2 Q;  4RHS A;  1ZXT A;  5GAD C;  5IYD H;  5C4H A;  4N8F A;  1SNP A;  4CJ0 B;  2XN9 C;  4NMZ A;  1BBW A;  4GKK Q;  3M3Y B;  2MGS A;  4YY3 L;  1HCZ A;  1O7Z A;  1EYD A;  4JI5 L;  3MFG A;  3JAM E;  3G6E A;  1LTR D;  5DM6 3;  1PH8 A;  2O5J C;  2UUC L;  2K5W A;  2BCO A;  4HJ8 A;  4IZ8 A;  1SLJ A;  2Z6K C;  2EYM A;  3OHX C;  1PZK D;  5ELE A;  3HFZ B;  1EZ6 A;  4DFA A;  1SNM A;  1VQH A;  2I5L X;  4ZYS A;  4DR6 L;  1R4Q B;  2UU9 L;  2G9H D;  4ZRZ A;  5I6Y A;  3MC0 B;  3QR8 A;  2D0O A;  2QF7 A;  1E3P A;  1XTD A;  1Z47 A;  3T51 B;  4LF6 Q;  3FRP B;  1KXL A;  2Z0S A;  4RAU C;  3KLR A;  1IYV A;  4XT1 B;  4X3K A;  3HZX A;  3CKI B;  4DAY A;  4GOP C;  1LTT D;  1U9R A;  3M4P A;  3OIQ A;  4RH6 A;  4J6H A;  3U50 C;  4WFN 3;  5C3W A;  5C44 G;  5ELD A;  3PGZ A;  3ZJY C;  2XIW A;  1Y8N B;  1ROD A;  3HOW H;  2WKD A;  1TS5 A;  1Q81 C;  3O13 A;  2VUM G;  2WKC A;  4YY3 Q;  2NBF A;  5FO9 B;  1JC7 A;  1ASY A;  1HUN A;  4A3L G;  1A3U A;  2UUC Q;  2V1C C;  4YCU A;  1CK1 A;  3EVQ A;  1Y69 U;  3A7A B;  5FLX c;  4A93 B;  3I4O A;  3I70 A;  1O7I A;  2JA9 A;  1NUC A;  4MNO A;  3K7U C;  4Y7N B;  1YNJ C;  4HAE A;  3F8T A;  1EIG A;  5C3X A;  4DV3 L;  4LUV A;  1AE3 A;  1H95 A;  3KLS A;  2JA8 H;  1S4Z A;  4GOP B;  2L0C A;  3NWT A;  1EQV A;  5C4J B;  2K33 A;  4C3J B;  1KRT A;  4DV7 L;  1OXV A;  1RF2 D;  2L9H A;  1BQQ T;  4MTN A;  4OO1 H;  1JOQ A;  1STA A;  4HIK A;  3HKZ E;  5JEA G;  2KCT A;  2KCN A;  2E2I H;  2UXD L;  3OMG A;  1Y8P B;  3I4L A;  5IOD A;  1ZYR D;  1WTR A;  3EA6 A;  3U4Z A;  5C6A A;  4PZ6 A;  1JWM D;  5IP7 G;  1GOZ A;  4DR2 L;  3DXJ C;  3OWE B;  1JQY D;  4DNI A;  2R7D A;  4GNX A;  4PV1 C;  1TWA B;  1DD2 A;  3CQZ H;  1X3Q A;  4BBS B;  3BDC A;  2WIN B;  3HKS A;  2UUA L;  1GKH A;  1TWC H;  4BY1 G;  2Z8L A;  3HOU G;  5KRU A;  1GHJ A;  4IUV A;  4F88 A;  1MIU A;  1VQ8 A;  3I90 A;  1STG A;  4HCE A;  1PTO D;  4JBK A;  3PV0 A;  3UDF A;  1E1T A;  4CDE C;  4G7O C;  2K5N A;  1X3F A;  3J7Z C;  1L1O A;  3E5S A;  1BBX C;  1J8I A;  2PQA A;  1JJ2 A;  5JOB A;  3HOY G;  4FXK C;  1WVL A;  4JI0 L;  2UXD Q;  2NB0 A;  4X64 L;  4IOC A;  2B2Y C;  3VYU A;  2B8G A;  2ICE C;  4DV5 L;  5CYU A;  2L4N A;  1VQ4 A;  1VQC A;  1C48 A;  4BXX H;  5COY A;  2CW0 D;  4NP5 A;  2ASB A;  3KLW A;  4DR2 Q;  3TRZ A;  2F0W A;  5HGQ A;  2QEX A;  1JWS D;  5A2Q L;  5M5W H;  1NBW A;  2J0T D;  3C1F A;  4CJ1 B;  1KAA A;  4RGN A;  2DJG C;  2UUA Q;  1H9S B;  2VY3 A;  3OPO A;  2QDL A;  1BCP F;  3A8K E;  1Y14 B;  1HNZ L;  5JVG 3;  1KDA A;  3A5Z B;  2HIX A;  2RKS A;  1JWU D;  5I9P A;  2R93 G;  1EQT A;  1WOC A;  1YJN A;  1QZH A;  5M5X B;  2E2D C;  5TSS A;  2N8N A;  2ZJR A;  3IL8 A;  3CCU A;  3J7A 5;  3NSW A;  4JI0 Q;  4JV5 L;  1VDZ A;  4A3B H;  4X64 Q;  2I0Q A;  4DV5 Q;  1GM5 A;  1CHQ D;  2RVL A;  2EY5 A;  4JI2 L;  2R92 G;  4HIM A;  1KDB A;  4KD4 A;  3E0E A;  3HOZ H;  4R4T A;  1D6E C;  1PH2 A;  1X3P A;  4C3H H;  1YJW A;  4EQN A;  2R6G A;  1DXM A;  4RA8 A;  2ZM6 Q;  3RNU A;  3FMC A;  4JYA L;  2WV6 D;  3DUZ A;  1BXT A;  3RZD H;  4JBJ A;  3GQB A;  2LMC B;  4R4O A;  4TSS A;  4B3R L;  1HNZ Q;  2EXD A;  1STE A;  4O2D A;  1ESF A;  4K5W A;  1B7Y B;  1S3O A;  2F0D A;  4A3E G;  4G4K A;  1SYD A;  4LMQ D;  5KNB A;  1VQN A;  1Z7T A;  5C3E B;  4K5V A;  2I07 B;  4DV4 L;  3EQL C;  1FJG L;  1VQL A;  2XWB B;  4HN7 A;  3URY A;  4GN5 A;  5D3I B;  3FDT A;  5ELB A;  3OOC A;  1D1K A;  4JOI C;  5F2D A;  1VQ9 A;  1Y1V B;  1YI2 A;  4MIU A;  2E5L L;  3RN2 A;  3AFP A;  1KRS A;  4CHT B;  1QVF A;  1B4O A;  2CWA A;  1SMY D;  4QIW E;  1SND A;  3F2B A;  1WCM H;  4Q0F A;  4ZK9 B;  1PH5 A;  1PRT F;  1DCZ A;  4JYA Q;  1EQR A;  1Z9F A;  2RF4 A;  4IPH A;  3FPU B;  4B3R Q;  2UUB L;  2QKI C;  2JA6 H;  2EPB A;  1EY9 A;  3G7L A;  1IKM A;  4PG3 A;  1UWV A;  5M5W B;  2R7Z H;  5ELC A;  4NPS A;  1GJX A;  3CCR A;  2XWJ B;  1JR0 D;  4G57 A;  3S1N H;  4DV4 Q;  1STH A;  3E3X A;  2WFW A;  2VQE L;  1FVI A;  4PZ7 A;  3NTI A;  1DOM A;  1TII D;  1Q82 C;  1LT5 D;  3PUZ A;  5DAU A;  4JI7 L;  1JMC A;  2I46 A;  5IYB G;  4K8J A;  3C46 A;  3BZK A;  1PFM A;  4EGV A;  4RCO A;  1RKN A;  1F2Y A;  1TS3 A;  3E9H A;  3J7A F;  2E5L Q;  1D5M C;  1BNZ A;  2D2C C;  1Q86 C;  2NYZ D;  3KK7 A;  4B3S Q;  1SXT A;  4F7X A;  2PMZ E;  4E6I A;  2RBM A;  3J80 L;  2LKV A;  1HTP A;  4DNT B;  1E1O A;  1O7L A;  2RDH A;  3S1Q H;  5FOB B;  1ZKO A;  1GUT A;  3LNN A;  1BF4 A;  1Y1W B;  2UUB Q;  4KN7 C;  2B2U C;  1YVC A;  4A93 G;  4R4C A;  1I4H A;  2E2J B;  1KC8 C;  4X65 L;  5FJ8 G;  2R61 A;  2A6H C;  4TVA B;  3U4V A;  4A3K G;  3HOZ B;  2KBN A;  1H9J A;  5EJW A;  3A5U A;  1AZP A;  5DEH A;  4KV6 A;  4KY5 A;  5HUR A;  3DEP A;  4A3M H;  2ZXR A;  4H13 C;  1KLG D;  2NZH A;  2D0P A;  4L5T A;  4C3J G;  4GZY C;  3BZD B;  1S5B D;  1EY4 A;  4JI7 Q;  5HY6 A;  1XMQ Q;  5BN4 A;  4LFC Q;  3JAM c;  4K5X A;  2ES2 A;  4IUP A;  4EX5 A;  1YEZ A;  5HGT A;  1VQI A;  2O2L D;  3NBI A;  2K5H A;  1IKL A;  3S16 B;  3KF8 A;  2HHH L;  3OWF A;  2MO0 A;  2YTV A;  3IFD A;  4OON A;  1VF7 A;  4BBR H;  3MXN A;  5IYD G;  4IUT A;  1CHP D;  3NTK A;  4X65 Q;  5GAG C;  2B3G A;  4DAP A;  2YV5 A;  4C2M B;  4PQX A;  1K8O A;  1NMF A;  1UEB A;  2Q2H A;  3A0J A;  5CV4 A;  5T1G A;  4J8Q A;  2B2T C;  5IT9 L;  1U4M A;  4K2K A;  2NVT H;  3S17 B;  2JK8 A;  1Q1B A;  1WCM B;  3QOL A;  1X9N A;  1F77 A;  1N8R C;  1TT2 A;  1IW7 C;  1N33 L;  3UE0 A;  1NAP A;  2VL6 A;  5C44 B;  4N9P A;  4IFD I;  2RCN A;  4KJN A;  2JA6 B;  2BE5 C;  1G91 A;  3BJU A;  2ID0 A;  3N6R A;  3M7G A;  1EWI A;  1PLF A;  3SVM A;  2MPM A;  2PNR C;  2VUM B;  2K05 A;  2EY1 A;  4R4I A;  3K5L A;  1CT1 D;  1KTK A;  1XMO Q;  1K9M C;  2A68 C;  3DMU A;  1E0B A;  4GLX A;  1MSH A;  2HHH Q;  4WJ4 A;  4L5S A;  3SE0 A;  1EWC A;  2K5V A;  1HZ9 A;  1K73 C;  3HOW G;  4P74 A;  2KUM A;  2KCC A;  5M3M B;  4FF3 A;  5EQ0 A;  1II3 A;  4DK3 C;  1LTI D;  1V1P B;  4CBV A;  4POF A;  4XQJ A;  1N33 Q;  3S1Q B;  1CUK A;  3W3A A;  3RLN A;  1JB3 A;  3TP8 A;  4UP8 A;  3H09 A;  5I2Y A;  4HMI A;  1K83 B;  5CMD A;  3KF6 B;  4RKL A;  4FVM A;  2JA8 G;  2EZV A;  4UDU C;  2RSN A;  5ELN A;  4X66 L;  4GN4 B;  1AW7 A;  3I4M H;  3G48 A;  4GOP A;  1S72 A;  4BA1 I;  2JYO A;  2E76 C;  1TWH H;  3LGJ A;  2F4V Q;  4OO1 G;  3KFU A;  4A3D H;  2NTT A;  4V19 0;  1M8A A;  1R9T H;  1VQB A;  1XWE A;  5C0X J;  1JT8 A;  1TWF B;  1EIY B;  3L0O A;  5KGU A;  4QL5 A;  5IGC A;  1KNE A;  1Z6H A;  1YIJ A;  1S5C D;  1F9P A;  3VR4 A;  1KAB A;  3ULL A;  4IOA A;  4ODG A;  3OIP A;  5IWA Q;  4BBR B;  1SAP A;  5AFW A;  3Q6S A;  3CAM A;  5I9O A;  1DOK A;  2PZT A;  1AE2 A;  2KVM A;  4NB3 A;  1PH7 A;  2K32 A;  2K28 A;  4A3F H;  2JA5 H;  4QQB X;  2F0U A;  4B9X A;  2NVT B;  3S2D H;  4X66 Q;  3A56 A;  5D3D A;  1CA5 A;  3NPP A;  3R2I A;  4ULL A;  5JVH 3;  1HZB A;  4UP7 A;  1LAB A;  2VB3 X;  3SDZ A;  1LUZ A;  1NY4 A;  3S2H B;  2SDF A;  3PF5 A;  3GTQ H;  4CKE A;  2SNS A;  4DN4 M;  1SRO A;  2BA0 A;  4GKJ L;  1BCP C;  4DV6 L;  4BXX G;  2KCM A;  3GTP H;  1CZG A;  2R93 B;  3NBH B;  1F2L A;  2K4K A;  4HJ7 A;  2FMM A;  1X32 A;  1Q7Y C;  1RDP D;  1X3G A;  1Q46 A;  1QVC A;  1XNQ Q;  1VQJ A;  2IX3 A;  1EQQ A;  4DR3 L;  2VB2 X;  1B9M A;  2KHI A;  1IYJ B;  2A19 A;  4Y52 H;  3U9O A;  3U9S A;  1VQF A;  4WRD A;  4C3I H;  4OX9 Q;  2IJ0 A;  1TY2 A;  4BS9 A;  3S1M H;  4LF8 Q;  1VQM A;  1EY6 A;  5EPL A;  4DA2 A;  1H9S A;  3RUZ A;  2YTX A;  5G3L F;  1EEI D;  2LXK A;  5K36 H;  1HUM A;  1E24 A;  1JJG A;  3PMF A;  1OXU A;  1HR0 L;  1H9R A;  3STB C;  1QUQ A;  5COR A;  3GTO H;  4H7B A;  1W6K A;  1SNO A;  4HJ5 A;  2WAQ E;  3L7Z C;  1IXR A;  1F9Q A;  4HMJ A;  4HSP A;  4A3B G;  1XPU A;  1SYE A;  4GKJ Q;  2IX0 A;  1PYW D;  4PMB A;  4DV6 Q;  4G7H C;  3GTJ B;  2RHQ B;  4IQZ A;  2NUC A;  1I4G A;  4A3E B;  3D4W A;  1NJI C;  1PFN A;  2B2W A;  1STY A;  1TWH B;  2XGT A;  3HOZ G;  2F0Q A;  1D8L A;  1DZ1 A;  1IYU A;  3FKI H;  4C3H G;  1EOV A;  3D4D A;  4JI3 L;  4NDX A;  2EYH A;  4DR3 Q;  4JI6 L;  5BR8 L;  3H0G H;  1F9R A;  1WYD A;  2QCP X;  2VZA A;  3V2T A;  3HKZ B;  2M00 A;  3PO3 B;  1DYQ A;  2X6L A;  4A3J H;  3AB9 A;  5C0X H;  4C56 C;  1N36 L;  4IPG A;  1MI2 A;  3QOJ A;  3ULJ A;  3T1H L;  2NN6 H;  1RTO A;  3MZ5 A;  4OEL B;  2F0V A;  3CCE A;  4KHV A;  2BOS A;  2KQ3 A;  3WOF A;  4ABN A;  3DM1 A;  3CMA A;  4AQY L;  3GTM H;  1AFP A;  3J80 E;  1VQD A;  2F0S A;  1IW7 D;  5GRO A;  1ET9 A;  1PRT C;  3RZO H;  2NVQ B;  4DR1 L;  4ZCK A;  3IFT A;  2KOL A;  2DNE A;  1PXU A;  2PYK A;  4P71 A;  3EJI A;  3HOX H;  1VQA A;  4DU9 A;  2ICI A;  1VQ6 A;  2A68 D;  3HG9 A;  4LFA L;  1F2Z A;  4JI3 Q;  4JI6 Q;  5BR8 Q;  3D31 A;  3GTQ B;  2F0I A;  1WCM G;  3NHH A;  3CCJ A;  3H94 A;  2ZTD A;  2K50 A;  1FGU A;  3NXW A;  2CFM A;  1VQK A;  2JA6 G;  2PI2 A;  1F2M A;  2IPK D;  3T1H Q;  3MVV A;  5FLX L;  1HPC A;  4R8N A;  4OL7 A;  4DKA C;  3M4Q A;  3K0X A;  3DEO A;  4DK6 C; 
#chains in the Genus database with same CATH homology
 1WFQ A;  4JI5 Q;  3KDF B;  1GM5 A;  1I94 L;  1VCI A;  4JI2 L;  2R7Z G;  4DUZ L;  4JI4 Q;  4AQY Q;  2R92 G;  4HIM A;  1BKB A;  2EQS A;  1N32 Q;  3WWV A;  1U0L A;  1YHQ A;  1L2F A;  4BY7 G;  1FL0 A;  3E0E A;  4ME3 A;  4BY1 H;  2BH2 A;  4R4T A;  3HOU H;  3HOZ H;  2B29 A;  1PH2 A;  4OO1 I;  4A4I A;  1XMO L;  4YCW A;  1KL9 A;  4C3H H;  1MJC A;  1YJW A;  4JOI A;  1LTL A;  2R6G A;  1TWF H;  3PCO B;  4AYB E;  4DR6 Q;  2UU9 Q;  1A8V A;  1N9W A;  2ZM6 Q;  4DUY L;  3RNU A;  1XNR L;  3TS0 A;  3EN2 A;  4JYA L;  1VS0 A;  3RZD H;  4JBJ A;  2PQA B;  2PNH A;  4LFA Q;  3SGI A;  4R4O A;  3W1B A;  1SE8 A;  2AWO A;  2EXD A;  1HNZ Q;  5M3M G;  4LF4 L;  4B3R L;  4O2D A;  2HIV A;  3CCM A;  4BBS G;  1B7Y B;  1S3O A;  3J81 c;  4A3E G;  3KYH C;  1V9P A;  5H1S E;  3GTG H;  4DV1 Q;  4P75 A;  1VQN A;  5JJL A;  3BU2 A;  4DR4 L;  2KHJ A;  1MKH A;  4DV4 L;  1FJG L;  3ER0 A;  1VQL A;  4GN5 A;  4LF7 L;  2OQ0 A;  1I94 Q;  1Q12 A;  4J15 A;  1J5E L;  3F2D A;  4DUZ Q;  1HR0 W;  4KHP L;  4JOI C;  3S2H H;  1PH1 A;  4A3M G;  1VQ9 A;  4L5Q A;  1YHA A;  3PO2 G;  2WB1 E;  3G71 A;  1YI2 A;  1WJJ A;  2E5L L;  4BA2 I;  3RN2 A;  3AFP A;  1KRS A;  1E22 A;  5C0X I;  1QVF A;  2CWA A;  2ZJP A;  4QGU A;  2NN6 I;  2WAQ G;  4QIW E;  4Y7N H;  3F2B A;  2R93 H;  4DUY Q;  1CKN A;  1HJP A;  1WCM H;  4KI0 A;  1XNR Q;  1PH5 A;  4GKK L;  3OW2 A;  4JYA Q;  4DV3 Q;  3NEN A;  3I7F A;  2VNU D;  1EQR A;  1Z9F A;  2RF4 A;  1AH9 A;  4IPH A;  4B3R Q;  2UUB L;  4LF4 Q;  2WP8 J;  2F4V L;  1I3Q H;  3MEF A;  5LMN L;  5LMN W;  4A3I H;  2JA6 H;  3TRE A;  1UE7 A;  4YHH L;  1JB7 A;  4DV7 Q;  3AYH B;  4PG3 A;  2JEA I;  4HJ9 A;  1UWV A;  2K14 A;  3K8A A;  4GLA C;  4O0A A;  2R7Z H;  4JI8 L;  4NPS A;  4DR4 Q;  1B70 B;  3CCR A;  1YBY A;  5AJ3 L;  4QY7 A;  4FDB A;  4BBR G;  3Q8D A;  2C35 B;  4DV4 Q;  3S1N H;  4DPG A;  4BY7 H;  3NEM A;  1I6H H;  1HZC A;  4IPD A;  2YU9 H;  2WFW A;  4LF7 Q;  2VQE L;  1FVI A;  4PZ7 A;  3JC6 6;  1Q82 C;  2JE6 I;  3PUZ A;  3CC7 A;  1PYS B;  4JI7 L;  5IWA L;  4HIO A;  1J5E Q;  1HR0 Q;  1JMC A;  2ATW A;  3CPF A;  1MJE A;  5IYB G;  2CWP A;  3KOJ A;  1PHJ A;  2QGQ A;  3BZK A;  1IBM L;  2BH8 A;  2B63 G;  2H5X A;  3E9H A;  1M90 C;  1HNW L;  3TQY A;  2E5L Q;  2LSS A;  3PUW A;  4DAM A;  2MO1 A;  3T1Y Q;  1TWA H;  1Q86 C;  2UXC L;  2AKW B;  1C9O A;  3PIO A;  4B3S Q;  4BBS H;  4K0K Q;  3GTJ H;  1K8G A;  2PMZ E;  1PV4 A;  4H02 A;  4A3E H;  1Q8K A;  4DR7 L;  3PUX A;  4UP9 A;  3CCV A;  2ZJQ A;  1E1O A;  3S1Q H;  1YZ6 A;  4HID A;  2KEN A;  1KHI A;  2UUB Q;  5LMN Q;  4A93 G;  1YVC A;  2VQF L;  4R4C A;  2EIF A;  1G29 1;  3F1Z A;  1KC8 C;  4A3G G;  4X65 L;  2MQH A;  4YHH Q;  5FJ8 G;  4TVA B;  3U4V A;  4A3K G;  2KBN A;  5IYC G;  1E7Z A;  4LF5 L;  3KJP A;  4JI8 Q;  3A5U A;  3PO3 H;  1PH4 A;  5ELO A;  3STB D;  3JAM i;  1L0W A;  2GVB A;  4A3C G;  4A3M H;  1N36 Q;  4YWM A;  1SRU A;  3B6Y A;  2NZH A;  2OTJ A;  1CKO A;  4XIG S;  2D0P A;  3K7A H;  4L5T A;  3PO2 H;  4JG2 A;  3AFQ A;  4JBM A;  4LUZ A;  4DR5 L;  4JI7 Q;  1XNQ L;  5HY6 A;  1PYB A;  1CKN B;  1HZA A;  3F2C A;  5M3F G;  3S15 H;  3ULP A;  3OTO L;  1XMQ Q;  1IBM Q;  2N3S A;  5C3E G;  2HT1 A;  4LFC Q;  3JAM c;  4LFB L;  4OX9 L;  5C4X G;  3UE1 A;  1HNW Q;  4RMF A;  2ES2 A;  4LF8 L;  4EX5 A;  1GD7 A;  1YEZ A;  4DR1 Q;  1ASZ A;  3A74 A;  2NVQ H;  2UXC Q;  1VQI A;  3J81 i;  3DM3 A;  2K5H A;  2VS1 A;  4DR7 Q;  1BBU A;  1N34 Q;  1K0R A;  4YWK A;  1IBL L;  2HHH L;  1KIX A;  2MO0 A;  3CD6 A;  1X56 A;  1TWG H;  1TXY A;  1Y1V G;  2YTV A;  2R7F A;  2F52 A;  3OYY A;  2ZTC A;  4LUO A;  4OON A;  3KF6 A;  2F3I A;  4BBR H;  3E9I A;  5IYD G;  3H3V H;  2IT1 A;  1SFO H;  4X65 Q;  1YNX A;  5GAG C;  1X54 A;  2B3G A;  1P8L A;  2YV5 A;  3I4M G;  3M85 A;  4LF5 Q;  1NMF A;  1UEB A;  2Q2H A;  3A0J A;  5M5X H;  3RN5 A;  2Q2U A;  3CC2 A;  4OWW B;  3HOV G;  2FXQ A;  3FP9 A;  3CF5 A;  2OCE A;  2CQO A;  5IYB H;  2NVT H;  2JK8 A;  2B63 H;  1YIT A;  1XPO A;  5GAE C;  1KD1 C;  1Q1B A;  4A3D G;  4DV0 L;  4JV5 Q;  1X9N A;  1N8R C;  1N33 L;  4P72 A;  1EUJ A;  3UE0 A;  3L2P A;  2VL6 A;  3CP0 A;  4DR5 Q;  3HKZ G;  3PO3 G;  4RG1 A;  4IFD I;  2RCN A;  4JI2 Q;  4B3T L;  3BJU A;  3OTO Q;  2ID0 A;  1EWI A;  3GD7 A;  4LFB Q;  3KJO A;  4R4I A;  1HNX L;  3M7N A;  1EFW A;  1VQ5 A;  3DLL A;  2GVA A;  5FLM G;  1XMO Q;  1HH2 P;  1CSP A;  4DV2 L;  1K9M C;  3RLF A;  4A93 H;  1YHB A;  1VQP A;  1RIP A;  2DGY A;  4A3G H;  2N49 A;  5FJ8 H;  4A3K H;  2Y0S G;  4GLX A;  4A75 A;  2A8V A;  5IYC H;  1IBL Q;  3FHW A;  4OWT B;  2E8G A;  2HHH Q;  4WJ4 A;  1IZ6 A;  1NTG A;  1X55 A;  3S24 A;  1CKM A;  1VQO A;  4L5S A;  4A3F G;  2JA5 G;  5IP9 G;  4A3C H;  4A76 A;  5C4J H;  2K5V A;  1HZ9 A;  1W2B A;  1K73 C;  3HOW G;  4P74 A;  3I2Z A;  4C3J H;  3PSI A;  2I5H A;  2IHF A;  4UPA A;  4IJH A;  4MZ9 A;  5M3F H;  4PZ8 A;  2JA7 G;  1G51 A;  5C3E H;  1Y1W G;  4DAY B;  1S40 A;  4DK3 C;  4LWC A;  2GN5 A;  2CKZ B;  4DV0 Q;  2Q2T A;  4POF A;  1FJG Q;  5C4X H;  2L15 A;  3EIV A;  1N33 Q;  1CUK A;  2YTY A;  2NZO A;  3TEH B;  3RLN A;  1DGS A;  1V1Q A;  2MFI A;  4UP8 A;  4B3T Q;  4KHP Q;  1PH9 A;  4LF6 L;  1JE5 A;  2RHS B;  3KF8 B;  4XTC S;  4L5R C;  1PFS A;  1HNX Q;  3KF6 B;  3MXN B;  4X62 L;  1P16 A;  3CPW A;  3S1R H;  1Y1V H;  1QVG A;  2OQK A;  4DV2 Q;  4A3L H;  5GAD C;  2JA8 G;  4GS3 A;  1X6O A;  5IYD H;  1I50 H;  2NVX H;  5ELN A;  4X66 L;  1M1K C;  4GN4 B;  4EQ5 A;  1VQ7 A;  3I4M H;  1BBW A;  1JJC B;  3G48 A;  4OWX B;  4BA1 I;  4GOP A;  1S72 A;  4GKK Q;  4R4Q A;  4YY3 L;  2UXB L;  1TWH H;  3HOV H;  5JJK A;  5IY0 A;  4GNX C;  4JI5 L;  4LNQ A;  3G6E A;  3LGJ A;  1PH8 A;  2F4V Q;  4OO1 G;  2UUC L;  1GO3 E;  3KFU A;  4A3D H;  4HJ8 A;  1R9T H;  1SLJ A;  1VQB A;  4GN3 B;  2ZTE A;  2Z6K C;  4APV A;  5C0X J;  5K36 G;  3I56 A;  4LF9 L;  2YYZ A;  4KHZ A;  1VQE A;  1A63 A;  1JT8 A;  4B3M L;  3HFZ B;  1EIY B;  3L0O A;  3M9B A;  4QL5 A;  5AJ3 Q;  1VQH A;  2I5L X;  1YIJ A;  4DR6 L;  2UU9 L;  1OXS C;  2ZM6 L;  3K81 C;  2MNA A;  2VQE Q;  2D0O A;  4JI1 L;  5FLM H;  1E3P A;  1XTD A;  2DUD A;  5GAH C;  3VDY A;  1U5K A;  3ULL A;  1Z47 A;  3H3V I;  4IOA A;  5IWA Q;  4WJ3 M;  4LF6 Q;  1XJV A;  3CAM A;  1L1O C;  3BZC A;  3GTL H;  2A1A A;  3W1G A;  1KXL A;  2Z0S A;  2JQO A;  1AE2 A;  5E7N A;  4P73 A;  4NB3 A;  4GOP C;  4X62 Q;  3M4P A;  3IRB A;  3U50 C;  1PH7 A;  4DV1 L;  1QUQ B;  4A3F H;  2JA5 H;  5IP9 H;  4QQB X;  3CME A;  3FKI G;  5C44 G;  3PGZ A;  3ZJY C;  1K8A C;  3S2D H;  4X66 Q;  2E2H H;  3HOW H;  4GNX B;  1Q81 C;  3H0G G;  2VUM G;  5JEA J;  4YY3 Q;  2UXB Q;  4OXP A;  4YCV A;  4PMW A;  4JCV E;  1ASY A;  4AYB G;  3NEL A;  1HZB A;  4GLV B;  4UP7 A;  2JA7 H;  1X3E A;  1IBK L;  4AH6 A;  1Y1W H;  4A3L G;  1J6Q A;  2VQF Q;  1LUZ A;  1NY4 A;  2V1C C;  1A0I A;  2UUC Q;  1PH6 A;  2E2J H;  2K75 A;  3AEV A;  4A3J G;  2IX1 A;  5C0X G;  3PF5 A;  3CC4 A;  3GTQ H;  4YCU A;  3I55 A;  2NN6 G;  4LF9 Q;  1SRO A;  3CCS A;  2ALY B;  2JEB I;  3PUY A;  2BA0 A;  4GKJ L;  5FLX c;  2IHE A;  4B3M Q;  3I4O A;  1O7I A;  4DV6 L;  2JA9 A;  4MNO A;  3K7U C;  4BXX G;  2KCM A;  3H15 A;  1CSQ A;  4AIM A;  3NBH B;  1EIF A;  3GTP H;  3PF4 A;  2K4K A;  3CXC A;  4HJ7 A;  2AWN A;  1Q7Y C;  1WI5 A;  3F8T A;  3I4N G;  1OXX K;  1X3G A;  1L1O B;  1AE3 A;  1Q46 A;  4LUV A;  4JI1 Q;  4DV3 L;  1H95 A;  1QVC A;  3W5O A;  2JA8 H;  1XNQ Q;  3RR5 A;  1VQJ A;  1EQQ A;  4GOP B;  4NXN L;  4DR3 L;  3GDE A;  2KHI A;  4Y52 H;  2A19 A;  1IYJ B;  3HOY H;  4JBW A;  4HJA A;  4LW1 A;  1Q1E A;  1VQF A;  1KRT A;  4C3I H;  4OX9 Q;  2PI2 E;  1OXV A;  4DV7 L;  3HOX G;  3GTK H;  5EAY A;  3S1M H;  4LF8 Q;  1VQM A;  4MTN A;  1OXT A;  3CW2 C;  4HIK A;  1V43 A;  2YTX A;  2WB1 G;  3HKZ E;  1W3S A;  2KCT A;  5JEA G;  2E2I H;  1B8A A;  3S16 H;  2LXK A;  2HQL A;  2OWO A;  4IPC A;  2UXD L;  1T9H A;  2IY5 B;  1KQS A;  1E24 A;  3PUV A;  1JJG A;  3UDG A;  1IBK Q;  1OXU A;  1HR0 L;  1XPR A;  3U4Z A;  3STB C;  4PZ6 A;  5IP7 G;  1QUQ A;  5IT9 c;  4DR2 L;  3S14 H;  2OTL A;  3ICE A;  3GTO H;  4HJ5 A;  4R1J A;  4C2M H;  2CCZ A;  4DNI A;  2R7D A;  2WAQ E;  3L7Z C;  1IXR A;  3AQQ A;  4GNX A;  4ALP A;  1SN8 A;  4UY8 C;  1XPU A;  4A3B G;  2Y0S E;  4GKJ Q;  1G6P A;  2IX0 A;  3T1Y L;  1LM0 A;  3CQZ H;  5DLQ E;  4DV6 Q;  4B3S L;  2RHQ B;  4K0K L;  3S17 H;  3KDF A;  2Z6K A;  1NJI C;  5JJI A;  1NMG A;  2QA4 A;  1LYL A;  3HKS A;  2I5M X;  2UUA L;  1GKH A;  1TWC H;  2XGT A;  2XTI A;  4BY1 G;  1YJ9 A;  1D8L A;  3HOU G;  3HOZ G;  1C0A A;  1MIU A;  3FKI H;  5C44 H;  1VQ8 A;  4TQU S;  5GQO A;  1EOV A;  3CCQ A;  3CCL A;  4JI3 L;  4DR3 Q;  1NE3 A;  4NXN Q;  4JI6 L;  3PIP A;  3UDX A;  5IE8 A;  5BR8 L;  3H0G H;  5LMU L;  1WYD A;  2VUM H;  2VZA A;  4JBK A;  4NXM L;  3PV0 A;  1SR3 A;  4X6A H;  3UDF A;  1E1T A;  2K5N A;  2R92 H;  1X3F A;  3J7Z C;  1L1O A;  3D0F A;  1X65 A;  4YWL A;  2PQA A;  2N78 A;  4A3J H;  1JJ2 A;  1N36 L;  3TS2 A;  1QZG A;  2VW9 A;  4IPG A;  3HOY G;  1GVP A;  4JI0 L;  2UXD Q;  3ULJ A;  3T1H L;  3K80 C;  3M4O H;  4IFD J;  3G4S A;  4X64 L;  4IOC A;  3ERS X;  4DV5 L;  3CCE A;  1VQ4 A;  4IJL A;  1PVO A;  1VQC A;  1RL2 A;  1EYG A;  4BXX H;  4JI4 L;  2NVY H;  3CMA A;  4AQY L;  1XMQ L;  2ASB A;  3KLW A;  4DR2 Q;  3GTM H;  1N32 L;  1VQD A;  4LFC L;  4POG A;  3TRZ A;  1D7Q A;  3I4N H;  5GRO A;  5HGQ A;  2QEX A;  1UE5 A;  1KAW A;  3RZO H;  1K3R A;  1NBW A;  5M5W H;  4JC0 A;  3GO5 A;  2D62 A;  4DR1 L;  5M3M H;  3UDI A;  1C7Y A;  1PA6 A;  1VQG A;  4P71 A;  3J80 i;  1UE6 A;  1N34 L;  3HOX H;  2UUA Q;  3EBE A;  2K52 A;  1VQA A;  1I5F A;  2VY3 A;  1A62 A;  1VQ6 A;  5J3B A;  4LFA L;  1IL2 A;  1Y14 B;  1HNZ L;  4JI3 Q;  1SMX A;  4JI6 Q;  2BA1 A;  5M5Y H;  5BR8 Q;  3A5Z B;  5LMU Q;  2HIX A;  4IO9 A;  3D31 A;  2R93 G;  4NXM Q;  1WOC A;  1WCM G;  4QJF A;  1YJN A;  1K83 H;  1UE1 A;  1QZH A;  3J81 j;  1BVS A;  2N8N A;  2JJQ A;  3J80 c;  2ZJR A;  3CCU A;  2LXJ A;  3CCJ A;  3J7A 5;  2ZTD A;  2K50 A;  1FGU A;  2AHO B;  5IP7 H;  2CFM A;  1VQK A;  4A3I G;  2JA6 G;  2AMC B;  3RLO A;  2Q2I A;  3U58 A;  2PI2 A;  4IFD G;  1OTC A;  4JI0 Q;  4JV5 L;  3T1H Q;  3M3Y H;  4A3B H;  4KLK A;  4X64 Q;  2I0Q A;  4DKA C;  3M4Q A;  1PH3 A;  3K0X A;  4DV5 Q;  4DK6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...