1HNXL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hnxL00
2GVBA 1K3RA 4GKJL 2Y0SE 1SLJA 4DR7Q 1JJ2A 4A3MG 3CC4A 1QZHA 4P71A 1VQMA 3U4ZA 2N8NA 2CKZB 3A5ZB 4JBKA 3CP0A 4LF8L 1QUQB 3CPFA 1K8AC 4LFCQ 2UXDQ 4XIGS 1VQ6A 4ALPA 5C4XG 5IP9G 3ZJYC 1K0RA 3I7FA 4TQUS 1YITA 1N33L 2WAQG 1E22A 3WWVA 3CPWA 5HY6A 4DV3Q 1XMQL 1H95A 1O7IA 5M5WH 1X55A 4A76A 3I4NG 1VQEA 2UXBQ 2MFIA 5JJLA 2Q2IA 3S2HH 1KC8C 3BZCA 1SFOH 2R7ZG 4BXXH 1BBUA 4A3FH 2F52A 4R4CA 1RIPA 3UDXA 5AJ3L 4DK6C 2ATWA 1JJCB 3TS2A 4L5RC 2Q2UA 3M9BA 1VQ4A 4L5TA 4A4IA 5C0XI 1QVCA 2ALYB 4X64L 1PV4A 4BA1I 1L1OC 1M1KC 4APVA 5IT9c 3ULJA 1J5EQ 4A3GH 1P16A 1I3QH 1NMFA 2PI2E 4GN4B 4GKKQ 3AQQA 4A3IG 1XJVA 5C0XG 2E5LQ 2VQFL 3J81i 4JV5Q 3K8AA 2OCEA 3OYYA 2JA9A 4P72A 2BH2A 3CF5A 4JBJA 5FJ8H 2AWOA 2H5XA 4OXPA 3S1NH 4YCWA 1VQBA 4LF4Q 1D8LA 3HOUH 4DR4Q 4IPCA 2B29A 4JI5L 3AFPA 4YWKA 3ERSX 4NXML 1VQIA 2VNUD 4GLVB 3KF8B 2B63H 3KFUA 4X65L 1PH1A 1Q8KA 3NENA 2Q2TA 3CAMA 2IT1A 2Q2HA 3J80i 5JEAJ 5M5YH 2XTIA 3PGZA 5HGQA 3CW2C 5LMUL 4A3JH 1LYLA 2UXCL 1YEZA 4YCUA 1PH9A 4BY1H 5M3FG 2JE6I 2YTXA 1XNQQ 2ZM6L 4X6AH 1UE5A 1N34Q 2QEXA 1NY4A 4A3EH 1IL2A 4DKAC 5H1SE 3CC2A 2MNAA 1VQ9A 1VS0A 4JI4Q 2NN6I 2YTYA 1U0LA 5IYBH 5FLXc 1N36Q 4X62Q 5C4JH 1PYSB 2BA0A 3GD7A 3UDGA 1S40A 1K9MC 4LF5Q 5LMNW 1Y1VH 4PG3A 1HNWQ 4JI8L 2CWAA 3CQZH 4HIDA 1WJJA 2MO1A 1PYBA 4LF7L 1KRTA 3HOVH 2ASBA 1PHJA 4JI3Q 4LFBL 4Y7NH 1Q82C 2FXQA 4DR3Q 3LGJA 4A3GG 3JC66 4DNIA 3ICEA 4WJ3M 4JI2L 4A3BG 4JOIC 2A8VA 4X66Q 4LF6L 4IFDJ 3I4OA 5FJ8G 4NB3A 2NVQH 4A3MH 1Q12A 4HJAA 4AQYL 3GTJH 1IBKQ 3A5UA 1OXUA 1PH4A 3HOUG 4DV5L 1IBLL 3KYHC 4KHZA 1GVPA 1VQPA 1PH7A 4DR6L 3OW2A 1L2FA 1LUZA 2KBNA 2WB1G 2RF4A 2NVYH 4PZ6A 5GAEC 2ES2A 1BKBA 1VCIA 1Q1BA 1X3GA 2CWPA 1EIFA 3L0OA 4NPSA 4O0AA 5IE8A 3T1HL 3AFQA 3GTKH 5EAYA 3I4NH 2K50A 1VQGA 4GN5A 2BA1A 4A3JG 4OO1I 1K8GA 5M5XH 1TWHH 4OWTB 2D0PA 4BY1G 3NEMA 1XMQQ 4B3RQ 2LXJA 1HJPA 2YV5A 4R1JA 1W3SA 4A3EG 2IHEA 2HT1A 1YHBA 3E0EA 4YY3Q 5AJ3Q 4B3TL 1EQQA 1YHAA 1TWFH 4POFA 4A3IH 1VQCA 2UUCL 1P8LA 2VUMH 1A0IA 3HOVG 1C7YA 1HZAA 4JI1L 2ZJRA 4A3LH 4DPGA 1Y14B 3E9HA 4NXNL 4DR5Q 2K52A 4DV6L 1UE6A 4DV0Q 2UUAQ 1A62A 4LWCA 1XPRA 2JK8A 2N3SA 4LUVA 1L1OA 4LFAL 1BBWA 1UE7A 3GO5A 2E2IH 3E9IA 1XNRL 4UP7A 3PO2G 3ER0A 2K5HA 5JEAG 4GS3A 4JI5Q 4UP9A 4NXMQ 1L1OB 1YJNA 1I5FA 4HIMA 3M7NA 2JA7G 2WAQE 3T1YL 4DUZQ 5M3FH 3U4VA 2KHIA 3G6EA 1SR3A 1YIJA 1TWAH 1XTDA 3PUXA 2OQ0A 1QVGA 1Z47A 2GN5A 3B6YA 3D31A 4LW1A 5M3MH 1HZBA 1X3EA 5IYCG 4DV4Q 3RLOA 5C3EH 1VQLA 5BR8Q 4R4OA 5J3BA 3STBC 3S1QH 1X56A 2ZM6Q 1B7YB 3UDFA 3TRZA 4P75A 5FLMG 3JAMi 2NZHA 5C44H 4DV2L 4RMFA 4IFDI 3S1RH 1HR0L 1G291 2N78A 2YTVA 1IBMQ 4YCVA 3PUZA 4DR2L 1EYGA 1SN8A 2AKWB 1T9HA 2PNHA 3FHWA 2CCZA 4A3BH 2VUMG 3M4PA 3IRBA 1JE5A 1MJCA 4LF7Q 1YNXA 4IFDG 4GNXC 3OTOQ 3HOXG 2JJQA 4DV7L 1PFSA 4A3LG 1I6HH 3PUYA 3GTQH 1KXLA 4YHHL 4A93H 1YHQA 4P73A 1EWIA 2UU9L 3RZOH 1I94L 2KHJA 3PF5A 1OXSC 2C35B 3M85A 4IOCA 1QZGA 5E7NA 3I4MH 4DR1L 4HJ7A 2AMCB 2KCMA 3HKSA 3UE1A 2R93H 2N49A 1WFQA 1HNXQ 1PH2A 1FL0A 3PCOB 4UP8A 2R7FA 2D62A 4AQYQ 1OTCA 3S16H 3CD6A 4JOIA 5IYDH 3K7AH 3SGIA 1Q81C 1B8AA 3F2DA 3CCVA 1TWCH 1X54A 1DGSA 4DV5Q 2JA6H 4L5QA 4DR6Q 3ULLA 2ZJPA 4QGUA 2VW9A 1HZCA 4MZ9A 4DR7L 1VQHA 3CXCA 1QVFA 2QGQA 1X65A 3TEHB 3T1HQ 2JQOA 2DUDA 1Q7YC 1VQ5A 4IPHA 1TXYA 4R4IA 3KJOA 2K75A 2MO0A 2VQEL 1PH6A 1BVSA 1VQFA 1PH3A 1PVOA 5M3MG 4IPGA 3TS0A 1N32Q 5C3EG 2E2HH 1M90C 2HHHL 4RG1A 2I5LX 2Z6KC 4DV3L 1TWGH 1CKNA 3RR5A 2F4VQ 2I5MX 3H15A 5LMNQ 2HIVA 5C44G 1S72A 1HNZL 4LF9Q 2UXBL 2JA5H 5GQOA 2RCNA 1X3FA 4B3SL 4KHPQ 2RHQB 1G51A 4B3TQ 4GOPC 3HOWG 4BXXG 4BBRH 2UUCQ 3GTGH 4JI6L 1CKNB 1VQJA 2ZJQA 2EQSA 3I2ZA 2NZOA 3MXNB 1Z9FA 1AE2A 2IX0A 4IPDA 4J15A 3GTLH 4A93G 1JJGA 3S1MH 3PO2H 1PA6A 5ELOA 4L5SA 5JJKA 2E2JH 3I4MG 4GKKL 1AH9A 3NELA 1VQAA 3DM3A 2CQOA 1YJ9A 4JV5L 2JA7H 1KIXA 2UUBL 4LFAQ 1PH8A 1GM5A 4JI0L 3HKZG 5IWAL 1B70B 4K0KL 1FGUA 4LF8Q 2ZTDA 5IYDG 3J81j 3CCMA 1E1OA 4A3KH 3PF4A 1U5KA 3KOJA 3W1GA 2PMZE 4QQBX 4AYBG 2JA6G 4DR4L 1FJGL 1EUJA 2JA8H 2R92H 3PO3G 4DUYL 1I50H 2R6GA 1XPOA 1N33Q 5IYCH 1KL9A 3G4SA 4EX5A 2R93G 3CCUA 2K5VA 1MJEA 1JMCA 5FLMH 1CSQA 3RN5A 4O2DA 1XMOL 1UEBA 1LM0A 3G48A 4QL5A 4JI7L 1C0AA 1E7ZA 1KAWA 4HJ9A 1YI2A 1ASYA 1YJWA 1N9WA 1WOCA 1XNQL 2CFMA 3Q8DA 1N34L 1HR0W 3MEFA 4TVAB 4X64Q 2NVTH 1V1QA 3HOXH 2JA5G 3BJUA 4DV1L 1MIUA 1HR0Q 4JYAL 4R4QA 4HJ5A 3J81c 2ID0A 4MNOA 4DR2Q 4BBRG 4HIOA 3BZKA 3TREA 1OXXK 3F2CA 1Q46A 2VQFQ 2YU9H 1X6OA 1HNWL 4H02A 3CCEA 1WI5A 4PZ7A 3W5OA 1VQ7A 3EN2A 4XTCS 4YHHQ 1IXRA 3K80C 2UU9Q 1I94Q 5IY0A 1NBWA 3S14H 4Y52H 1AE3A 3GDEA 4GNXA 2I5HA 4B3ML 2MQHA 1Q1EA 1LTLA 1L0WA 4GLAC 2A1AA 1A63A 4X65Q 3AYHB 3KJPA 3J80c 4A3KG 1IBKL 1RL2A 4LUOA 4GNXB 2GVAA 1KRSA 3F2BA 5LMUQ 2NVXH 1HZ9A 1VQ8A 3PUVA 2JA8G 3L2PA 2R92G 1G6PA 1C9OA 2UXCQ 2Y0SG 4ME3A 1GKHA 4C3IH 3GTMH 2OQKA 5GADC 2D0OA 1VQKA 2VQEQ 3HOYH 1SE8A 4OX9L 2VZAA 3L7ZC 2VL6A 2R7DA 3RZDH 4YWLA 1OXTA 3CCLA 3F1ZA 3HOWH 4HJ8A 2HHHQ 3H3VH 4B3RL 3HOZG 4JI8Q 4BY7G 4GKJQ 1JT8A 3DLLA 1HNZQ 4GLXA 2JEAI 4QY7A 4LFBQ 3CCRA 4B3SQ 4UY8C 4IJLA 2Z6KA 1VQDA 2B3GA 1K73C 4JBMA 4YY3L 4POGA 3S15H 5JJIA 4JI2Q 1KHIA 1EIYB 3RN2A 4GN3B 1Y1WH 4JI6Q 2KCTA 1PH5A 3M3YH 1EQRA 4AH6A 4LF6Q 1WYDA 4AIMA 1UWVA 1YBYA 4GOPA 2JEBI 1ASZA 2WP8J 4A75A 2VY3A 3TQYA 2IY5B 1A8VA 4DR5L 3PV0A 1IBLQ 1S3OA 1WCMH 4DV0L 2UUAL 2LSSA 3CCJA 3PO3H 5IP7H 4IO9A 2UUBQ 4JI0Q 4K0KQ 5IWAQ 2OWOA 4QJFA 4GOPB 3G71A 5GAGC 4BBSH 2IX1A 1YZ6A 2K14A 3ULPA 1OXVA 1FVIA 3FP9A 4LFCL 2UXDL 1CSPA 3PUWA 1FJGQ 1R9TH 3CMEA 4DUYQ 4BA2I 2K5NA 3FKIH 3RLNA 1J6QA 3RLFA 4DK3C 3CC7A 4C2MH 4DUZL 4IJHA 3H3VI 1KQSA 3HOYG 2K4KA 3EBEA 2PQAA 3H0GH 1XMOQ 3W1BA 2ZTEA 3UDIA 4DV4L 1E24A 3PSIA 4JG2A 4JI7Q 3S2DH 3S24A 5BR8L 3KLWA 3K81C 2PQAB 4JBWA 3AEVA 3I56A 2AHOB 2QA4A 3GTOH 4JI1Q 3BU2A 4A3DH 4DV1Q 4R4TA 1XPUA 4A3FG 4JYAQ 3K7UC 3STBD 4NXNQ 1J5EL 2KENA 4DV6Q 2BH8A 1IBML 1Y1WG 1EFWA 4EQ5A 1HH2P 4OWWB 3J7A5 3S17H 4LUZA 2E5LL 2WB1E 2VS1A 2OTJA 4A3CH 2A19A 3HKZE 2DGYA 3OTOL 2NN6G 1NTGA 1EOVA 2PI2A 1XNRQ 1V43A 3CMAA 3NBHB 4LF4L 4QIWE 4AYBE 1WCMG 4JCVE 4B3MQ 5C0XJ 1E1TA 1SRUA 2IHFA 5IP7G 5GAHC 4WJ4A 3J7ZC 1NJIC 3T1YQ 1IZ6A 3KF6A 1SROA 3HFZB 4BBSG 1HNXL 1CKOA 4YWMA 3U50C 4UPAA 3PIPA 1CUKA 1KD1C 2LXKA 2YYZA 1Q86C 4FDBA 4KLKA 1N8RC 1MKHA 5C4XH 3F8TA 5IP9H 1X9NA 1E3PA 2HIXA 2WFWA 3FKIG 3KF6B 2B63G 1NE3A 3JAMc 2V1CC 3HOZH 2XGTA 4BY7H 3KDFA 1CKMA 4OX9Q 3H0GG 4DAMA 1IYJB 4PZ8A 4DV2Q 3CCSA 3M4OH 4IOAA 4DAYB 1W2BA 1UE1A 2R7ZH 4JI4L 4HIKA 1N36L 2AWNA 2F3IA 2E8GA 4X62L 3U58A 2I0QA 3A74A 1N32L 4LF5L 1GO3E 1VQNA 4P74A 3RNUA 1GD7A 1K83H 3KDFB 3CCQA 2L15A 4PMWA 2HQLA 2F4VL 4A3DG 5LMNL 1V9PA 4DV7Q 3UE0A 4LF9L 4JI3L 3I55A 3M4QA 4C3JH 1JB7A 1YVCA 4OO1G 2EXDA 5IYBG 4DR3L 2EIFA 3GTPH 4KHPL 5ELNA 4OWXB 2ZTCA 3A0JA 2OTLA 3EIVA 1Y1VG 4DR1Q 2RHSB 1VQOA 4X66L 5DLQE 4OONA 4A3CG 5GROA 1SMXA 3VDYA 5K36G 4JC0A 3PIOA 4MTNA 4KI0A 1D7QA 4LNQA 2Z0SA 4C3HH 1QUQA 3K0XA 1NMGA 3D0FA
chains in the Genus database with same CATH superfamily
1O7ZA 1PTOH 1K3RA 5KNDA 2Y0SE 4DR7Q 1NCVA 4KD3A 3CC4A 1QZHA 2ASBA 3U4ZA 2CKZB 3CHBD 4TRDA 3CPFA 1K8AC 4LFCQ 5E1FA 1I6VC 2RDGA 4XIGS 5C4XG 1D5XC 4FF2A 3BZDB 3I7FA 3R3OA 3M4YA 3FVQA 2M2LA 1O7IA 3MXPA 3I4NG 4KJNA 1VQEA 5JJLA 2Q2IA 4A3FH 1AZQA 4R4CA 2HDMA 4XXEA 1AZPA 2Q2UA 1C48A 4RHRA 3W2DA 2ALYB 4Z9CB 1TVXA 2NN6H 4C3JG 1PV4A 1L1OC 1J5EQ 5CV6A 4A3GH 1I3QH 2A69D 2E76C 2NB0A 3AQQA 3VR2A 3J81i 2PZWA 3CF5A 5FJ8H 3R2IA 1D1KA 1U4LA 5G3LD 5E4XA 1ONLA 1D8LA 2GA4B 5IOCA 4HMIA 4IPCA 2B29A 2AQ3B 4YWKA 3ERSX 2VNUD 1JWUD 1S5FD 2L1BA 4GLVB 3WOEA 2B63H 3IL8A 3SK6A 2O5JC 1PH1A 3T53B 4FNFA 4X3TA 5KGUA 2IT1A 5M5YH 1KQSA 1LACA 1YEZA 2EYOA 1G2SA 1N34Q 2VB2X 1E2ZA 2WAQB 5H1SE 3CC2A 1A6XA 3OOCA 1VQ9A 1EYDA 1LTBD 4ZAIA 5C4JH 1EYAA 3GD7A 3M4OB 4DK0A 1HNWQ 5IGDA 2CWAA 3SXHA 4HIDA 4QB4A 3Q24A 2SOBA 3LGJA 4WJ3M 2XRQD 2A8VA 4F88A 2F0JA 3GTPB 4LF6L 2B2YC 2NVQH 4NB3A 1CA5A 1Q12A 3E6ZX 3KYHC 1VQPA 5JEAH 2MPMA 2E2DC 4OEMB 3NHHA 1BKBA 1VCIA 1X3GA 1FNVA 1LT3D 2WIIB 3I4NH 1JE4A 3MAQA 4RH6A 4A3JG 5BN5A 1F2LA 1EWHA 4IUUA 2LXJA 1HJPA 1W3SA 1U4PA 1O7YA 1E2WA 5AJ3Q 1EQQA 1DXMA 5C5MA 3EROA 1P8LA 1A0IA 1SYBA 1CQVA 3CRKC 3HOVG 4IFDH 1B50A 2BE5D 4IUNA 1IL8A 1NR4A 4DPGA 2EOTA 2EYMA 3C1FA 4DV6L 1UE6A 4C1NI 4LUVA 1CFMA 1L1OA 3BDOA 5AFWA 3GO5A 2E2IH 1SNDA 4K8JA 1SBBB 4K5XA 4QMGA 1HFNA 2O5IC 2K5HA 1HUNA 1DM0B 4UP9A 4NXMQ 2JA7G 3HOUB 1JWMD 1I4XA 4LAAA 2KHIA 5TSSA 3G6EA 1TWAH 3PUXA 5I2XA 2OT2A 3B6YA 1H9RA 1RDPD 3RLOA 2ENBA 5C3EH 4R4OA 3HG9A 3KBXA 4CHTB 5IT9L 3C2PA 5FLMG 4V190 4M1UB 5CV8A 4FO2A 3S1RH 4IN3A 4CGYB 2YTVA 3CRLC 5KNCA 1EYGA 1STNA 2CCZA 3IRBA 1JE5A 1I4RA 5IGCA 3HOXG 4A3LG 2F0VA 4A93H 1K8MA 4P73A 1EWIA 1YHQA 2NWGA 4RAUC 3M85A 4IOCA 1Y8NB 3EJIA 3I4MH 3HKSA 2EDGA 3ITPA 2B2TC 3PCOB 4UP8A 2R7FA 2D62A 1OTCA 3SK5A 3CD6A 2FHTA 2B2YA 3F2DA 1X54A 1X3PA 4K5WA 2XNAC 3VYUA 1EZ6A 3ULLA 3GTJB 4DR6Q 1ET6A 2VW9A 3BVMA 2A68D 1UEAB 4JPBW 2QGQA 4KTAA 3JAME 5FLXL 1Q7YC 2VQEL 2MO0A 5CV5A 3TSSA 5M3MG 1EEFD 4IPGA 3TS0A 2K5DA 2QW7A 2TSSA 1BCPC 2K1BA 1TWGH 1CKNA 1II3A 1QB5D 4XQQA 5M5XB 3H15A 2F4VQ 5LMNQ 2HIVA 4XDXA 3MXNA 2JA5H 4TKOB 4R9WA 4B3TQ 3IAYA 4GOPC 1A3VA 1VQJA 1PFBA 3WDNA 1F2ZA 3OMGA 1MHWC 1AE2A 1LTAD 1DYQA 4HCSA 5COYA 5I2YA 1LTSD 2E2JH 2F4IA 1AH9A 3NELA 2PO4A 4QF4A 4JV5L 2JA7H 1KIXA 4JI0L 5IWAL 1B70B 3HZXA 2F0NA 4A3KH 3CCMA 1E1OA 3R2TA 2F0SA 2PMZE 2XVSA 2JA6G 4DR4L 4DU9A 1EUJA 3G6JB 1I4GA 4EVOA 5A2QL 4K8IA 1XPOA 4EX5A 1HTLD 1K28A 3SK4A 3N6RA 1HA5A 4H0LC 1M8AA 5FLMH 3DEPA 2PZTA 4PNYA 1LM0A 3G48A 4QL5A 1C0AA 1MSGA 1ILQA 4KV6A 3PMFA 3HOXH 3BJUA 1MIUA 1HR0Q 4JYAL 4HJ5A 3J81c 4DR2Q 4BBRG 5CMDA 4ODGA 3OIPA 1I4QA 4QUCA 3SK8A 4WJWA 4H02A 3TZUA 3HRZC 4YHHQ 1HCZA 3K80C 4OELB 2UU9Q 1I94Q 2B2VC 3S14H 2C5CA 4B3ML 2MQHA 2PYKA 1GHJA 1J8IA 2A1AA 1RJTA 2SNSA 3VA7A 2WB1B 1B53A 1Y8OB 4GNXB 1KRSA 3HKZB 2NVXH 2JA8G 2B2TA 3L2PA 1VMPA 1VMCA 4KMUC 5J22A 1TKWB 4J8QA 1GUTA 4KHVA 1PRTC 1WTVA 1EY9A 3I90A 4HJ8A 1ZXTA 5KEEA 1GUNA 1IHZA 4ZQ3A 4HAEA 2J4XA 1C8CA 1VQDA 2X6LA 1K73C 4YY3L 2DNEA 4RCOA 3ND9A 4GN3B 1PH5A 1BOSA 4AH6A 4LF6Q 1WYDA 1YNJD 4CJ1B 4WFN3 4AIMA 2NTTA 1ESFA 4GOPA 1V1PB 1LV9A 5E3FA 1A8VA 3DMUA 1RTOA 1WCMH 2UUAL 2LSSA 2HCIA 2FMCA 5IP7H 3GTLB 2OWOA 4FVMA 4DFAA 2ZXOA 5GAGC 4G57A 3HP3A 1S5CD 1YZ6A 3ULPA 4BBSH 3FP9A 4C3HG 4LFCL 4ZLTF 4DUYQ 3EA6A 1EIGA 2KA7A 3FKIH 3RLNA 1J6QA 4DK3C 3H3VI 3DHQA 2R92B 3HOYG 2K4KA 2PQAA 2Y0SB 3MFGA 5EPKA 4JG2A 3S2DH 3A8JE 1W6KA 2F03A 4JBWA 4FXKC 1XPUA 2F0MA 1H9SB 1AP0A 2PQEA 1J5EL 2KENA 4DV6Q 1IBML 1VF7A 2FFKB 3NBHA 1Y1WG 3S17H 2PNRC 1D2BA 2PI2A 3O13A 2DY8A 2NUCA 1V43A 1I4HA 2PW7A 5C0XJ 1SRUA 5GAHC 3I3CA 2B2VA 4HSPA 3U50C 4CJ0B 2A6HC 4QCLA 3PIO3 1CUKA 4FDBA 2RKSA 4DAYA 5IP9H 1SMYD 2V1CC 3TP8A 2EZVA 2M9VA 1STYA 4QUFA 4IOAA 3CCSA 4NMZA 2HDLA 2JXMB 2R7ZH 5IT9E 3OHXC 1GJXA 4P74A 4PMWA 4A3DG 1B3AA 4LF9L 3HOWB 1JB7A 4OO1G 3M4QA 5IYBG 4KHPL 5ELDA 3NK9A 4OWXB 5EKLA 2ZTCA 3A0JA 1J9OA 2RHSB 1SAPA 3J80L 4RHSA 3NE5B 1B9NA 4N8X1 3S15B 3VDYA 3M3YB 3A7AB 2Z0SA 4C3HH 1JR0D 1F9SA 4A3MG 5I9OA 1GOZA 4P71A 1VQMA 3PO3B 4LF8L 4JBKA 1QUQB 2F0OA 2UXDQ 3I91A 1SE3A 4TQUS 1YITA 1D5MC 1E22A 3WWVA 3E3XA 5HY6A 1H95A 1BXTA 1CM9A 5D65A 5M5WH 4G4KA 4K6LA 1KC8C 1SFOH 4BXXH 2Z4IA 4DGZA 5AJ3L 2Z1CA 3UDXA 2R61A 3H0GB 3FRPB 4DK6C 2ATWA 1JJCB 4C56C 1EIHA 4K14A 1KDBA 3ZYYX 4L5TA 5JOBA 1K3BC 5JVG3 4BA1I 1IYUA 3BVZA 4DXFA 4A3IG 5C0XG 4JV5Q 3K8AA 2OCEA 5IGBA 3OYYA 4P72A 3F2UA 4F87A 2H5XA 2VB3X 3VYRA 3S1NH 2L11A 2NYZD 1NAPA 4DR4Q 3AFPA 4NXML 3NQTA 4ZYSA 3KF8B 3P1HA 3ONAB 4X65L 2F0LA 3K57A 2JYOA 4XYQA 5JEAJ 2Q2HA 2XTIA 3QWNA 3G7LA 1DOMA 4DK1A 2KECA 3V96A 4CJ2C 2UXCL 4YCUA 4BY1H 1BUVT 5M3FG 1ESRA 5C4XB 3I72A 1V1OA 4ABNA 1SNOA 3K6OA 2QEXA 4A3EH 4OO1H 2FJ2A 1VS0A 2YTYA 1U0LA 5IYBH 4X62Q 3J81E 1K9MC 5DAUA 4FP5D 1PYBA 2EY1A 2RA4A 4JI3Q 2B8GA 4Y7NH 2EVBA 5DM73 5FOBB 4A3GG 3JC66 3ICEA 1CZGA 4JI2L 1K0SA 2EXZA 4JOIC 4C3JB 4X66Q 4IFDJ 4G7OC 5FJ8G 1DJRD 1S5BD 4A3MH 1RTNA 1EY7A 5EBDA 2XSCA 5JPNC 1EU4A 3JAML 4ZRZA 2F0DA 4DR6L 1CHQD 3OW2A 1PLFA 4H13C 4LMQD 2NVYH 5GAEC 1IYVA 5LL6X 3FDTA 4ZK9B 4O0AA 1EIFA 5IE8A 3AFQA 5EAYA 2K50A 1VQGA 2L4NA 1SDFA 1RD9D 3BDLA 3QOJA 3MA2B 1TWHH 4BWGB 2D0PA 3NEMA 1AEXA 2YV5A 4R1JA 2ZT9C 4ZKBB 4X3KA 2HCCA 4YY3Q 4B3TL 3S2HB 1XTCD 4A3IH 4KY5A 2CW0C 2VUMH 1SE2A 4MN3A 1ILPA 3A55A 4OHJA 5IGGA 2ZJRA 2E74C 3K59A 3TDQA 1EEID 2UUAQ 4LWCA 3H94A 5LHY1 2JK8A 1HUMA 1B2TA 3E9IA 1KDAA 4N8FA 3PO2G 2F0TA 2MP1A 5D14A 5JEAG 4JI5Q 3A54A 4HIMA 4BS9A 1KABA 5EKIA 5M3FH 1RODA 1SR3A 1YIJA 1TU2B 3GV3A 3OWFA 3D31A 1A3UA 1A2TA 2PMZB 1U4MA 1IW7C 2PCFB 4A3JB 3EFXD 4P75A 4DA2A 5C44H 4DV2L 2A73B 2Q8RE 1ENCA 1W6JA 1HR0L 1G291 1BBXC 3TP6A 1IBMQ 4DR2L 1SN8A 1T9HA 3FHWA 3M4PA 1JORA 4LF7Q 4IFDG 4DV7L 2JJQA 3T16A 1Y1VB 2IX3A 4YHHL 3CQZB 1CZWA 1V1PA 3Q0AA 2UU9L 1I94L 2C35B 3HOVB 1ZEQX 1VDZA 4IUPA 1WD1A 2R93H 2N49A 1RKNA 4JOIA 1WTQA 3K7AH 3SGIA 1R4PB 1B8AA 3CCVA 4DV5Q 1DGSA 1Q3LA 4HN7A 2H1EA 4MZ9A 1VQHA 3CXCA 1UUPA 1QVFA 3TEHB 3T1HQ 3R8BA 2JQOA 2DUDA 2KOLA 3S1QB 5EJWA 1BVSA 3GTKB 2OF1A 5C3EG 1PMRA 4C3IG 5CR3A 1M90C 1HQMC 2E2HH 3U9OA 4DV3L 3RR5A 2I5MX 4DN4M 1S72A 4LF9Q 2UXBL 1NNXA 1X3FA 4KHPQ 2RHQB 2EYHA 2UUCQ 2SEBD 3NPPA 1SEBD 3D4DA 3J80E 1TWFB 2F0EA 4J15A 4A93G 3S1MH 3PO2H 1PA6A 4L5SA 5JJKA 3I4MG 5C4ZA 1SXTA 2CQOA 1PZJD 4LFAQ 1GM5A 5EPJA 1FGUA 4LF8Q 1U5KA 3KOJA 3W1GA 1F2MA 3LWUA 1O7LA 3QJYA 4DUYL 4H7BA 4L63B 1MJEA 5KIXA 1ML0D 3VYSA 2EPBA 1PTOF 2DJFC 2O4XA 1EOTA 3K5LA 1KAWA 4HJ9A 1YI2A 4EQPA 1WOCA 1XNQL 5M3MB 2A69C 3Q8DA 2JA5G 1KDCA 1HHVA 1SYGA 1MSHA 3AB9A 3QIAA 4HIOA 3BZKA 3TREA 3F2CA 2YU9H 4MIUA 5I4DA 3W5OA 4A3BB 1IXRA 2Q8TA 1NR2A 4RKLA 1JWSD 2XWJB 1I6HB 2I5HA 4J6HA 3GTQB 1Q1EA 1LTLA 1L0WA 1EYCA 3RZOB 4GLAC 4X65Q 5CV9A 4KD4A 4A3KG 2F0UA 3TZDA 5E4WC 2GVAA 3F2BA 3S16B 3PUVA 2UXCQ 2XN9C 1TWCB 4C3IH 2JA6B 3GTMH 2MUYA 1TS3A 1VQKA 1STBA 3L7ZC 1NUCA 3RZDH 2RDFA 4RWSC 3LX0A 2K04A 1JT8A 3DLLA 5EQ0A 3SVMA 3CCRA 4IJLA 2B3GA 4POGA 4JBMA 4JI2Q 1KHIA 3RN2A 4JI6Q 2KCTA 1EQRA 1STEA 2D2CC 1A2UA 4BBRB 3GTGB 2Z6BA 2WP8J 3BS1A 2VY3A 5L37A 4DV0L 3C1EA 3WOFA 3CCJA 2B2UC 3HEJA 2UUBQ 4DF7A 4PV1C 5D3DA 2JP1A 2UXDL 4IUQA 2WINB 1CSPA 3PUWA 1FJGQ 4XYOA 4KN7C 1V8QA 2K5NA 2ZXPA 3CC7A 3NTKA 1LLRD 2JA8B 1I50B 3EBEA 4F8MA 3NUCA 3DWAA 3W1BA 1XMOQ 3OPOA 3UDIA 4EQOA 4JI7Q 2BE5C 3S24A 3VA5A 2M00A 4IUTA 4CDDC 4ZUJA 2AHOB 2QA4A 3K5NA 1U4RA 2OEOA 3NWTA 3STBD 3RMHA 3NSWA 4L6TB 2L5TA 2QEJC 1M4VA 2NVTB 1EFWA 1F2YA 4XQJA 4OWWB 2EE1A 3KLRA 1WTXA 2A19A 1NTGA 1EY6A 2F0PA 1E0BA 1EFID 4QIWE 1WCMG 1ENAA 1E1TA 2LKVA 2IHFA 5IP7G 5CBEE 4WJ4A 3J7ZC 1IZ6A 4BBSG 1EY5A 1CKOA 4U673 4YWMA 4UPAA 1KD1C 2LXKA 4HR7B 1Y69U 3A7LA 3DM1A 1X9NA 1E3PA 2HIXA 2WFWA 3FKIG 3KF6B 5JJZA 1BQQT 1LO5D 2XGTA 3J81L 4DV2Q 4PZ8A 3M4OH 3RD4A 1CI3M 1W2BA 2CQAA 4K5VA 4FF3A 4M8AA 3HOYB 1N32L 2A74C 2EJGC 4X62L 3GV6A 1F9RA 3CCQA 3KDFB 2BDOA 2PPBC 4DV7Q 1V9PA 2L0CA 4JI3L 2EXDA 2EYLA 3GTPH 4NW2A 4P2CB 1CQFA 1CA6A 1VQOA 4HTHA 4X66L 3SDZA 1I4PA 4B08A 1Y1WB 3PIOA 4MTNA 4KI0A 4LNQA 2A68C 1NMGA 3D0FA 5EPLA 3I4LA 2ICEC 1STGA 1JJ2A 1SYEA 3GQBA 2NZ1D 2N8NA 1EU3A 1LT4D 2B2UA 1IKLA 3OMCA 4UDUC 5IP9G 2EY5A 1K0RA 3NXWA 1EZ8A 4DV3Q 1R9TB 1AN8A 1X55A 4A76A 2UXBQ 2MFIA 1DOLA 4C2MB 2R7ZG 2F52A 1PYWD 2H4OA 3TS2A 2JSOA 4L5RC 2F0HA 3M9BA 3TP7A 4ZUIA 5C0XI 5T1GA 4X64L 1LTGD 1M1KC 1BR9A 3D4RA 2RVLA 3MFYA 3ULJA 4APVA 2NTSA 1P16A 1NMFA 3P75A 2PI2E 4A3DB 3GTOB 1PFNA 3J7AF 5D3IB 2BH2A 4Q5VA 2AWOA 1T5EA 3MXGA 4OXPA 3SE0A 4YCWA 4LF4Q 3HOUH 1BCPF 1AFPA 4JI5L 1VQIA 5ELBA 4G7ZC 3KFUA 1Q8KA 3NENA 3UI2A 2Q2TA 1TY0A 2EYJA 3CAMA 2X6GA 5LMUL 3PGZA 2K05A 1LYLA 3MEHA 3BDCA 3MHBA 2JE6I 2AUJD 1XNQQ 4X6AH 1UE5A 1IL2A 4DKAC 2EYFA 3D3RA 4BXXG 1S4ZA 1QJOA 2NN6I 3HOZB 4BY7B 3Q23A 1PYSB 2BA0A 3P7JA 5LMNW 4U68A 3GP7A 1WJJA 2E75C 2MO1A 3QB3A 2KUMA 4LF7L 1Q82C 1K83B 2PW5A 3MXUA 2LY7A 5C3XA 2IW3A 1G8ZD 4KJOA 3SEBA 3I4OA 1TT2A 3GTJH 1U9RA 4OGQC 4DV5L 1IBLL 4E6IA 3MC0B 1PH7A 4GKJQ 1L2FA 1X32A 2KBNA 2WB1G 2RF4A 3ND8A 4PZ6A 2ES2A 3L0OA 2CWPA 3J7AV 3T1HL 1PTOB 1SNCA 4GN5A 3KLSA 5FKAC 3D6WA 2F1MA 1K8GA 5M5XH 5CORA 4BY1G 1XMQQ 3NQIA 5M9OA 4A3EG 2HT1A 3MZ5A 3K0YA 2HQEA 4DAVA 3E0EA 3BYTB 5A35A 1YHAA 2Z8LA 3SR1A 3I73A 4POFA 2UUCL 2B39A 4A3FB 2IPKD 5NUCA 4JI1L 2K5WA 1Y14B 1KNAA 1SSOA 2TMPA 3E9HA 4NKLA 4DV0Q 1G6ZA 2F0KA 3D4WA 1A62A 1XPRA 4I7ZC 4IZ8A 4A3GB 1PRTF 1I3QB 4RKBA 4LFAL 1UE7A 1B1ZA 2KCNA 1XNRL 1KLGD 2K5QA 5FO7B 1FNWA 1SNQA 4DAPA 4FXGC 3M7NA 1PFMA 1L1OB 1YJNA 2KEDA 2WACA 1YNND 4YIJA 1GUOA 1TS4A 2NBFA 1XTDA 5CYUA 2B63B 2OQ0A 1NSNS 1HZBA 1X3EA 5C4HA 4RA8A 1VQLA 1L0YB 2D5DA 5M5YB 1RHPA 1B9MA 2ZM6Q 4KY7A 3UDFA 3TRZA 2NZHA 4RMFA 4NP5A 4IFDI 1B44D 2N78A 3PUZA 2PNHA 4IUVA 4IALA 2VUMG 1ZYRC 2RBMA 2DJGC 1MJCA 1YNXA 4GNXC 1PFSA 3PUYA 4MTKA 4B9XA 2RQXA 1OXSC 3AMUA 5E7NA 4PMBA 3OW7A 4DR1L 4HJ7A 1F77A 3URYA 2KCMA 1HXYD 4RGOS 1PH2A 1SYCA 4AQYQ 4G7HC 1PTOD 5IYDH 3LNNA 2NVQB 3SHLA 1SMYC 2EY2A 3C46A 1LT6D 2ZJPA 1TY2A 2PZUA 5DNFA 4H44C 5FO8B 4DNRB 4R4IA 4DNTB 3KJOA 2K75A 1PH6A 4ZKCB 1PH3A 1TS2A 2QDBA 3H91A 1PVOA 2EJMA 1N32Q 3I4NB 4ILWA 3ERQA 4RG1A 2I5LX 3K58A 5C44G 2KVMA 2CHBD 2Z9HA 4F7XA 1G51A 3QG1A 3HOWG 2F0IA 4JI6L 1CKNB 3TN2A 3T13A 4Q0FA 4RGMA 2J0TD 2CH4A 3MXNB 2NZOA 1Z9FA 3FPPA 3GTLH 1D5ZC 5ELOA 5JVH3 4GKKL 2A6EC 2L55A 1TS5A 1YJ9A 2BCOA 4RGNA 2UUBL 2R93G 1PH8A 1UNSA 3J81j 1JC7A 4AYBG 1FJGL 2E2IB 3PO3G 4LJZC 2R92H 5EGTA 3CCUA 5IGEA 2I46A 1JMCA 4R8NA 2B2WC 1CSQA 2K7VA 3IFTA 5ELEA 1XMOL 1H9KA 1BF4A 1TWAB 2RCFA 4JI7L 1E7ZA 2ICIA 3T4AC 2B8FA 3MEFA 4TVAB 4X64Q 5C3EB 1V1QA 4R4QA 4MNOA 2P5ZX 3QO2A 1OXXK 1DOKA 3S1RB 1X6OA 3FPUB 2K28A 4XTCS 5I9PA 3MVVA 4JW0A 5IY0A 4Y52H 4GNXA 5KRUA 4A93B 3MTSA 3TMEA 4B9WA 3AYHB 5K5PA 3KJPA 3I4MB 1IBKL 4LUOA 5LMUQ 3DXJC 3LWEA 1HZ9A 1D1IA 5I6WA 1VQ8A 1G6PA 1C9OA 4KKSA 3KUPA 1GKHA 4ME3A 4QIWB 3H3VC 2OQKA 1G91A 1SE8A 1GHKA 2VZAA 2O2LD 2R7DA 4K2LA 4YWLA 1OXTA 3CCLA 3F1ZA 2CH4W 3HOWH 3H3VH 2HHHQ 1QG7A 1FNUA 4B3RL 3VR5A 1QCBD 1LABA 1HNZQ 5JAVA 2N55A 5HURA 4B3SQ 4UY8C 1TWGB 3S15H 1VF5C 5JJIA 1EIYB 2JA5B 3M3YH 1PZID 1D6EC 1TQOA 1YBYA 1LT5D 1BDOA 1BCPB 2QDLA 4A75A 1EQVA 3TQYA 4DR5L 3PV0A 1IBLQ 3PO3H 1SYFA 4K0KQ 4QJFA 4GOPB 2G5DA 2E2JB 2IX1A 1OXVA 2JA7B 2MGSA 1SNPA 1JOKA 3CMEA 2D9UA 4BA2I 4A3KB 5FK9C 1Z6HA 5DM63 1BO0A 3V2TA 4DUZL 4IJHA 2K6AA 3PIP3 3H0GH 2Q8IB 4JVZA 4K6DA 2ZTEA 4IURA 1H9SA 4DV4L 2SNMA 3K5OA 5BR8L 3KLWA 2B2WA 1JCKB 4I65A 1PDQA 2PQAB 4IQZA 3I56A 4UAIA 4JI1Q 4DV1Q 4R4TA 1QE6A 4EQ5A 3HOXB 1HH2P 3J7A5 4LUZA 2VS1A 4A3CH 1Y8PB 1QNUA 1CTMA 3OTOL 1EOVA 1XNRQ 3CMAA 3NBHB 4LF4L 4AYBE 2AQ1B 3KLSX 1FGBD 1WTPA 4ME5A 2BOSA 1NJIC 3S14B 1SROA 3A56A 3HFZB 1HNXL 2F0QA 1KAAA 2YYZA 4KLKA 1DCZA 1N8RC 4KKUA 1SNMA 5C4XH 3F8TA 3L3OC 2G9DA 5CGKA 1HTPA 5ISRA 3D8GA 1S5DD 2NVXB 4OX9Q 4DAMA 1O78A 4DAYB 2I0QA 2AWNA 2F3IA 3U58A 3A74A 2LFNA 1GO3E 1VQNA 4KN4C 3HS0C 3UE0A 4UHVA 3I55A 4C3JH 1YVCA 1ENFA 1BCPD 1WTRA 2KJXA 2EIFA 3VYTA 5DEHA 1PRTB 2OTLA 3EIVA 1Y1VG 4DR1Q 5DLQE 4OONA 2IL8A 5GROA 1SMXA 5K36G 4JC0A 5EBCA 1STAA 3NTHA 2R3ZA 3A8IE 3I70A 1QUQA 1C4QA 2SDFA 1WD0A 2GVBA 4GKJL 1SLJA 4C1NK 1WCMB 4N9TA 5LL6S 3A5ZB 3CP0A 4KKTA 2C9OA 1VQ6A 4ALPA 4BBSB 3ZJYC 3N52A 4J1MA 1N33L 2WAQG 1PXUA 3CPWA 1XMQL 4NDXA 3S2HH 3FKIB 4PMCA 5KYIA 3BZCA 1BBUA 1RIPA 1A15A 1HQRD 1VQ4A 4A4IA 3S2DB 1QVCA 4HEDA 5FO9B 2F0GA 5IT9c 5KNBA 4GN4B 4GKKQ 1XJVA 2G9HD 2E5LQ 2VQFL 3KBGA 3EVQA 4PQXA 2JA9A 3KF8A 4JBJA 2X69A 3DWQA 3S17B 1VQBA 4WRDA 5C6AA 3DEOA 4K2KA 5BN3A 3J80i 1GUGA 3HGBA 5HGQA 3CW2C 4A3JH 1EY8A 2IJ0A 3J7YW 1PH9A 1MI2A 2JN4A 2YTXA 2XWBB 2ZM6L 2DN8A 4MHEA 3TP5A 2L9HA 1NY4A 1H9MA 4CDEC 1STHA 2MNAA 4JI4Q 3EQLC 5FLXc 2OXPA 1N36Q 4S3SA 1XXGA 3UDGA 4LF5Q 1S40A 1PRTD 1Y1VH 4PG3A 2R7ZB 4JI8L 3CQZH 1ET9A 2DNCA 1KRTA 1PHJA 3HOVH 5K36H 3QR8A 4LFBL 2FXQA 4CKEA 4DR3Q 4DNIA 1KLUD 5CV4A 1EY4A 3I8ZA 4A3BG 4EGVA 4HJAA 5T1IA 5C5LA 4AQYL 1IBKQ 3A5UA 1OXUA 2EYPA 4X3UA 1PH4A 3HOUG 4KHZA 1GVPA 1LTID 2V4DA 3S1QH 1LUZA 1HFGA 2F0FA 4C3HB 3U9SA 3BVGA 1Q1BA 4NPSA 3GTKH 3VR6A 4WORA 5G3LF 2BA1A 1LTRD 4OO1I 2MHVA 3BYYB 3S9WA 4OWTB 4B3RQ 4RFBA 1F9PA 2IHEA 1YHBA 5J1ZA 3Q22A 5M5WB 3NWSA 1WTHA 3E0JA 1TWFH 1VQCA 1SFOB 4HSVA 3M7GA 2RSNA 1O80A 1C7YA 1HZAA 4A3LH 4NXNL 3OWEB 1ICWA 4DR5Q 2K52A 3D6CA 1T5XD 3Q6SA 3DUZA 1WTOA 2N3SA 3QOLA 2Z4HA 3OSOA 1BBWA 2FINB 1L0XB 3H6MA 4O1NA 1RCVD 2K33A 4UP7A 1DZ1A 3E5SA 3IFDA 3ER0A 2RDHA 4GS3A 1I5FA 3S1NB 2WAQE 3T1YL 4CBVA 4DUZQ 3NP8A 3U4VA 3V05A 5HGTA 1B4OA 1JICA 2F3WA 1OO9B 1QVGA 1Z47A 2GN5A 2RSOA 4LW1A 5M3MH 4DV4Q 2A6HD 5IYCG 5EKKA 5BR8Q 5J3BA 3STBC 1X56A 3CKIB 4R8IA 1B7YB 2XRSD 3JAMi 1FD7D 4BY1B 2LMCB 4YCVA 4A3EB 4HMJA 2AKWB 3VR4A 4A3BH 5CV7A 2HUGA 1QWYA 1F9QA 3FMCA 3OTOQ 4FF1A 1I6HH 2WKCA 3GTQH 1KXLA 1FYCA 1EWCA 3RZOH 2KHJA 3PF5A 1QZGA 1DD2A 4Y7NB 2AMCB 3UE1A 3KK7A 3MWYW 1WFQA 1HNXQ 3S16H 1FL0A 3DWPA 1EQTA 1Q81C 1TWCH 4HCEA 4A3MB 2JA6H 4L5QA 4QGUA 1HZCA 4DR7L 2KHSA 1X65A 2HD3A 5C3WA 1VQ5A 4IPHA 1TXYA 2NVYB 1VQFA 1JOOA 3IKJA 3NTIA 1HA6A 2K32A 5CC4A 2HHHL 2Z6KC 2KQ3A 3TBIB 1HNZL 1TWHB 1WTWA 3NBIA 5GQOA 4CKCA 2RCNA 4B3SL 4CDFC 1DONA 1MD2D 3CU7A 4BBRH 3GTGH 3C3LA 4OL7A 2ZJQA 2DY7A 2EQSA 4FXDA 1LTTD 3I2ZA 2EY6A 1WVLA 2IX0A 4IPDA 4A3IB 1JJGA 2VUMB 4RGTA 3X3MA 1XX8A 1HRJA 1B3QA 1VQAA 3DM3A 2WKDA 5I6YA 5ELFA 4K0KL 3HKZG 4XT3B 2ZTDA 5IYDG 3PF4A 1ZYRD 4LK1C 4QQBX 5KYLA 1QOHA 5ELCA 2JA8H 1I50H 2R6GA 1N33Q 5IYCH 1KL9A 3G4SA 5CBAE 4JK1C 2K5VA 4OIJA 4DXGA 1JOQA 2LS01 3T56B 3K5MA 3W3AA 3RN5A 4O2DA 5M3FB 1YNJC 1UEBA 2MJ8A 1ASYA 1Q90A 3X3NA 1R4QB 1N9WA 1YJWA 1IKMA 2CFMA 1FR3A 1HR0W 1N34L 2NVTH 1KNEA 1QILA 4FF4A 3VR3A 4DV1L 1MBYA 1S5ED 2ID0A 2VXWA 1GUWA 5C44B 1KTKA 4ZCKA 1Q46A 2F3VA 2VQFQ 1HNWL 3CCEA 1WI5A 4PZ7A 1VQ7A 3EN2A 5IGFA 1Q8IA 1NBWA 1AE3A 3GDEA 1GXDC 3L9AX 2QCPX 1A63A 2BDNA 3J80c 4N9PA 5IODA 1RL2A 2R93B 1PZKD 1XWEA 2R92G 1QNKA 3PQIA 2QKIC 2Y0SG 3K7AB 4XQNA 4AYBB 2A6ED 2D0OA 5GADC 2ZXRA 4CKBA 2VQEQ 3HOYH 4OX9L 2K01A 5JPMC 2QILA 2VL6A 5FLXE 1EL0A 2AUKA 3T51B 5BN4A 3R93A 3HOZG 4JI8Q 4I7AA 4BY7G 1MGSA 5C4JB 1SJHD 4GLXA 2JEAI 4QY7A 4LFBQ 4CDCC 2E2HB 5IIFA 2Z6KA 1EY0A 1SJED 1CK1A 1Y1WH 1GUSA 2K03A 1UWVA 1ASZA 2JEBI 1G2TA 2CW0D 2XIWA 2IY5B 1SYDA 3FEWX 1S3OA 4KY6A 1AW7A 1X3QA 4IO9A 4JI0Q 3S1MB 3PO2B 4KK7A 5IWAQ 3G71A 2K14A 1FVIA 2L12A 1R9TH 5F2DA 4OIKA 3RLFA 4C2MH 5A2QE 3RUZA 5J39A 4TSSA 2J7ZA 2KCCA 2WV6D 1E24A 3PSIA 3K81C 1BNZA 3BG3A 3AEVA 4A3DH 3GTOH 3BU2A 4A3FG 4JYAQ 3K7UC 1IW7D 4NXNQ 4V0BA 2FMMA 2BH8A 1UAPA 2N88A 1XYIA 2I07B 1JQYD 2E5LL 2WB1E 2OTJA 4X3SA 2A5HA 3AU7A 3HKZE 2DGYA 2NN6G 3A8KE 3P20A 2YU9B 4EQNA 1Z7TA 1ZKOA 1YNNC 4JCVE 4B3MQ 1E2VA 1K8OA 3T1YQ 3KF6A 1HPCA 1JB3A 1RF2D 3PIPA 1Q86C 1MKHA 1H9JA 2QF7A 3OIQA 2IWHA 2B63G 1NE3A 3JAMc 3HOZH 4BY7H 3KDFA 1CKMA 2KEEA 3H0GG 1IYJB 4ID6A 4C3IB 3GTMB 1UE1A 4JI4L 4HIKA 1N36L 4XT1B 2E8GA 2CVRA 2EJFC 4LF5L 3RNUA 4ULLA 1GD7A 1K83H 1CT1D 3RZDB 2L15A 4O42A 2HQLA 2F4VL 4RCNA 5LMNL 1SE4A 1CHPD 1TIID 4DR3L 5ELNA 3H09A 1PTOC 5C0XH 4A3CG 2AQ2B 1ICFB 1A3TA 4GZYC 1D7QA 2F0WA 1TR5A 3K0XA 4L8JA 4FYDA
chains in the Genus database with same CATH topology
2GVBA 1K3RA 4GKJL 2Y0SE 1SLJA 4DR7Q 1JJ2A 4A3MG 3CC4A 1QZHA 4P71A 1VQMA 3U4ZA 2N8NA 2CKZB 3A5ZB 4JBKA 3CP0A 4LF8L 1QUQB 3CPFA 1K8AC 4LFCQ 2UXDQ 4XIGS 1VQ6A 4ALPA 5C4XG 5IP9G 3ZJYC 1K0RA 3I7FA 4TQUS 1YITA 1N33L 2WAQG 1E22A 3WWVA 3CPWA 5HY6A 4DV3Q 1XMQL 1H95A 1O7IA 5M5WH 1X55A 4A76A 3I4NG 1VQEA 2UXBQ 2MFIA 5JJLA 2Q2IA 3S2HH 1KC8C 3BZCA 1SFOH 2R7ZG 4BXXH 1BBUA 4A3FH 2F52A 4R4CA 1RIPA 3UDXA 5AJ3L 4DK6C 2ATWA 1JJCB 3TS2A 4L5RC 2Q2UA 3M9BA 1VQ4A 4L5TA 4A4IA 5C0XI 1QVCA 2ALYB 4X64L 1PV4A 4BA1I 1L1OC 1M1KC 4APVA 5IT9c 3ULJA 1J5EQ 4A3GH 1P16A 1I3QH 1NMFA 2PI2E 4GN4B 4GKKQ 3AQQA 4A3IG 1XJVA 5C0XG 2E5LQ 2VQFL 3J81i 4JV5Q 3K8AA 2OCEA 3OYYA 2JA9A 4P72A 2BH2A 3CF5A 4JBJA 5FJ8H 2AWOA 2H5XA 4OXPA 3S1NH 4YCWA 1VQBA 4LF4Q 1D8LA 3HOUH 4DR4Q 4IPCA 2B29A 4JI5L 3AFPA 4YWKA 3ERSX 4NXML 1VQIA 2VNUD 4GLVB 3KF8B 2B63H 3KFUA 4X65L 1PH1A 1Q8KA 3NENA 2Q2TA 3CAMA 2IT1A 2Q2HA 3J80i 5JEAJ 5M5YH 2XTIA 3PGZA 5HGQA 3CW2C 5LMUL 4A3JH 1LYLA 2UXCL 1YEZA 4YCUA 1PH9A 4BY1H 5M3FG 2JE6I 2YTXA 1XNQQ 2ZM6L 4X6AH 1UE5A 1N34Q 2QEXA 1NY4A 4A3EH 1IL2A 4DKAC 5H1SE 3CC2A 2MNAA 1VQ9A 1VS0A 4JI4Q 2NN6I 2YTYA 1U0LA 5IYBH 5FLXc 1N36Q 4X62Q 5C4JH 1PYSB 2BA0A 3GD7A 3UDGA 1S40A 1K9MC 4LF5Q 5LMNW 1Y1VH 4PG3A 1HNWQ 4JI8L 2CWAA 3CQZH 4HIDA 1WJJA 2MO1A 1PYBA 4LF7L 1KRTA 3HOVH 2ASBA 1PHJA 4JI3Q 4LFBL 4Y7NH 1Q82C 2FXQA 4DR3Q 3LGJA 4A3GG 3JC66 4DNIA 3ICEA 4WJ3M 4JI2L 4A3BG 4JOIC 2A8VA 4X66Q 4LF6L 4IFDJ 3I4OA 5FJ8G 4NB3A 2NVQH 4A3MH 1Q12A 4HJAA 4AQYL 3GTJH 1IBKQ 3A5UA 1OXUA 1PH4A 3HOUG 4DV5L 1IBLL 3KYHC 4KHZA 1GVPA 1VQPA 1PH7A 4DR6L 3OW2A 1L2FA 1LUZA 2KBNA 2WB1G 2RF4A 2NVYH 4PZ6A 5GAEC 2ES2A 1BKBA 1VCIA 1Q1BA 1X3GA 2CWPA 1EIFA 3L0OA 4NPSA 4O0AA 5IE8A 3T1HL 3AFQA 3GTKH 5EAYA 3I4NH 2K50A 1VQGA 4GN5A 2BA1A 4A3JG 4OO1I 1K8GA 5M5XH 1TWHH 4OWTB 2D0PA 4BY1G 3NEMA 1XMQQ 4B3RQ 2LXJA 1HJPA 2YV5A 4R1JA 1W3SA 4A3EG 2IHEA 2HT1A 1YHBA 3E0EA 4YY3Q 5AJ3Q 4B3TL 1EQQA 1YHAA 1TWFH 4POFA 4A3IH 1VQCA 2UUCL 1P8LA 2VUMH 1A0IA 3HOVG 1C7YA 1HZAA 4JI1L 2ZJRA 4A3LH 4DPGA 1Y14B 3E9HA 4NXNL 4DR5Q 2K52A 4DV6L 1UE6A 4DV0Q 2UUAQ 1A62A 4LWCA 1XPRA 2JK8A 2N3SA 4LUVA 1L1OA 4LFAL 1BBWA 1UE7A 3GO5A 2E2IH 3E9IA 1XNRL 4UP7A 3PO2G 3ER0A 2K5HA 5JEAG 4GS3A 4JI5Q 4UP9A 4NXMQ 1L1OB 1YJNA 1I5FA 4HIMA 3M7NA 2JA7G 2WAQE 3T1YL 4DUZQ 5M3FH 3U4VA 2KHIA 3G6EA 1SR3A 1YIJA 1TWAH 1XTDA 3PUXA 2OQ0A 1QVGA 1Z47A 2GN5A 3B6YA 3D31A 4LW1A 5M3MH 1HZBA 1X3EA 5IYCG 4DV4Q 3RLOA 5C3EH 1VQLA 5BR8Q 4R4OA 5J3BA 3STBC 3S1QH 1X56A 2ZM6Q 1B7YB 3UDFA 3TRZA 4P75A 5FLMG 3JAMi 2NZHA 5C44H 4DV2L 4RMFA 4IFDI 3S1RH 1HR0L 1G291 2N78A 2YTVA 1IBMQ 4YCVA 3PUZA 4DR2L 1EYGA 1SN8A 2AKWB 1T9HA 2PNHA 3FHWA 2CCZA 4A3BH 2VUMG 3M4PA 3IRBA 1JE5A 1MJCA 4LF7Q 1YNXA 4IFDG 4GNXC 3OTOQ 3HOXG 2JJQA 4DV7L 1PFSA 4A3LG 1I6HH 3PUYA 3GTQH 1KXLA 4YHHL 4A93H 1YHQA 4P73A 1EWIA 2UU9L 3RZOH 1I94L 2KHJA 3PF5A 1OXSC 2C35B 3M85A 4IOCA 1QZGA 5E7NA 3I4MH 4DR1L 4HJ7A 2AMCB 2KCMA 3HKSA 3UE1A 2R93H 2N49A 1WFQA 1HNXQ 1PH2A 1FL0A 3PCOB 4UP8A 2R7FA 2D62A 4AQYQ 1OTCA 3S16H 3CD6A 4JOIA 5IYDH 3K7AH 3SGIA 1Q81C 1B8AA 3F2DA 3CCVA 1TWCH 1X54A 1DGSA 4DV5Q 2JA6H 4L5QA 4DR6Q 3ULLA 2ZJPA 4QGUA 2VW9A 1HZCA 4MZ9A 4DR7L 1VQHA 3CXCA 1QVFA 2QGQA 1X65A 3TEHB 3T1HQ 2JQOA 2DUDA 1Q7YC 1VQ5A 4IPHA 1TXYA 4R4IA 3KJOA 2K75A 2MO0A 2VQEL 1PH6A 1BVSA 1VQFA 1PH3A 1PVOA 5M3MG 4IPGA 3TS0A 1N32Q 5C3EG 2E2HH 1M90C 2HHHL 4RG1A 2I5LX 2Z6KC 4DV3L 1TWGH 1CKNA 3RR5A 2F4VQ 2I5MX 3H15A 5LMNQ 2HIVA 5C44G 1S72A 1HNZL 4LF9Q 2UXBL 2JA5H 5GQOA 2RCNA 1X3FA 4B3SL 4KHPQ 2RHQB 1G51A 4B3TQ 4GOPC 3HOWG 4BXXG 4BBRH 2UUCQ 3GTGH 4JI6L 1CKNB 1VQJA 2ZJQA 2EQSA 3I2ZA 2NZOA 3MXNB 1Z9FA 1AE2A 2IX0A 4IPDA 4J15A 3GTLH 4A93G 1JJGA 3S1MH 3PO2H 1PA6A 5ELOA 4L5SA 5JJKA 2E2JH 3I4MG 4GKKL 1AH9A 3NELA 1VQAA 3DM3A 2CQOA 1YJ9A 4JV5L 2JA7H 1KIXA 2UUBL 4LFAQ 1PH8A 1GM5A 4JI0L 3HKZG 5IWAL 1B70B 4K0KL 1FGUA 4LF8Q 2ZTDA 5IYDG 3J81j 3CCMA 1E1OA 4A3KH 3PF4A 1U5KA 3KOJA 3W1GA 2PMZE 4QQBX 4AYBG 2JA6G 4DR4L 1FJGL 1EUJA 2JA8H 2R92H 3PO3G 4DUYL 1I50H 2R6GA 1XPOA 1N33Q 5IYCH 1KL9A 3G4SA 4EX5A 2R93G 3CCUA 2K5VA 1MJEA 1JMCA 5FLMH 1CSQA 3RN5A 4O2DA 1XMOL 1UEBA 1LM0A 3G48A 4QL5A 4JI7L 1C0AA 1E7ZA 1KAWA 4HJ9A 1YI2A 1ASYA 1YJWA 1N9WA 1WOCA 1XNQL 2CFMA 3Q8DA 1N34L 1HR0W 3MEFA 4TVAB 4X64Q 2NVTH 1V1QA 3HOXH 2JA5G 3BJUA 4DV1L 1MIUA 1HR0Q 4JYAL 4R4QA 4HJ5A 3J81c 2ID0A 4MNOA 4DR2Q 4BBRG 4HIOA 3BZKA 3TREA 1OXXK 3F2CA 1Q46A 2VQFQ 2YU9H 1X6OA 1HNWL 4H02A 3CCEA 1WI5A 4PZ7A 3W5OA 1VQ7A 3EN2A 4XTCS 4YHHQ 1IXRA 3K80C 2UU9Q 1I94Q 5IY0A 1NBWA 3S14H 4Y52H 1AE3A 3GDEA 4GNXA 2I5HA 4B3ML 2MQHA 1Q1EA 1LTLA 1L0WA 4GLAC 2A1AA 1A63A 4X65Q 3AYHB 3KJPA 3J80c 4A3KG 1IBKL 1RL2A 4LUOA 4GNXB 2GVAA 1KRSA 3F2BA 5LMUQ 2NVXH 1HZ9A 1VQ8A 3PUVA 2JA8G 3L2PA 2R92G 1G6PA 1C9OA 2UXCQ 2Y0SG 4ME3A 1GKHA 4C3IH 3GTMH 2OQKA 5GADC 2D0OA 1VQKA 2VQEQ 3HOYH 1SE8A 4OX9L 2VZAA 3L7ZC 2VL6A 2R7DA 3RZDH 4YWLA 1OXTA 3CCLA 3F1ZA 3HOWH 4HJ8A 2HHHQ 3H3VH 4B3RL 3HOZG 4JI8Q 4BY7G 4GKJQ 1JT8A 3DLLA 1HNZQ 4GLXA 2JEAI 4QY7A 4LFBQ 3CCRA 4B3SQ 4UY8C 4IJLA 2Z6KA 1VQDA 2B3GA 1K73C 4JBMA 4YY3L 4POGA 3S15H 5JJIA 4JI2Q 1KHIA 1EIYB 3RN2A 4GN3B 1Y1WH 4JI6Q 2KCTA 1PH5A 3M3YH 1EQRA 4AH6A 4LF6Q 1WYDA 4AIMA 1UWVA 1YBYA 4GOPA 2JEBI 1ASZA 2WP8J 4A75A 2VY3A 3TQYA 2IY5B 1A8VA 4DR5L 3PV0A 1IBLQ 1S3OA 1WCMH 4DV0L 2UUAL 2LSSA 3CCJA 3PO3H 5IP7H 4IO9A 2UUBQ 4JI0Q 4K0KQ 5IWAQ 2OWOA 4QJFA 4GOPB 3G71A 5GAGC 4BBSH 2IX1A 1YZ6A 2K14A 3ULPA 1OXVA 1FVIA 3FP9A 4LFCL 2UXDL 1CSPA 3PUWA 1FJGQ 1R9TH 3CMEA 4DUYQ 4BA2I 2K5NA 3FKIH 3RLNA 1J6QA 3RLFA 4DK3C 3CC7A 4C2MH 4DUZL 4IJHA 3H3VI 1KQSA 3HOYG 2K4KA 3EBEA 2PQAA 3H0GH 1XMOQ 3W1BA 2ZTEA 3UDIA 4DV4L 1E24A 3PSIA 4JG2A 4JI7Q 3S2DH 3S24A 5BR8L 3KLWA 3K81C 2PQAB 4JBWA 3AEVA 3I56A 2AHOB 2QA4A 3GTOH 4JI1Q 3BU2A 4A3DH 4DV1Q 4R4TA 1XPUA 4A3FG 4JYAQ 3K7UC 3STBD 4NXNQ 1J5EL 2KENA 4DV6Q 2BH8A 1IBML 1Y1WG 1EFWA 4EQ5A 1HH2P 4OWWB 3J7A5 3S17H 4LUZA 2E5LL 2WB1E 2VS1A 2OTJA 4A3CH 2A19A 3HKZE 2DGYA 3OTOL 2NN6G 1NTGA 1EOVA 2PI2A 1XNRQ 1V43A 3CMAA 3NBHB 4LF4L 4QIWE 4AYBE 1WCMG 4JCVE 4B3MQ 5C0XJ 1E1TA 1SRUA 2IHFA 5IP7G 5GAHC 4WJ4A 3J7ZC 1NJIC 3T1YQ 1IZ6A 3KF6A 1SROA 3HFZB 4BBSG 1HNXL 1CKOA 4YWMA 3U50C 4UPAA 3PIPA 1CUKA 1KD1C 2LXKA 2YYZA 1Q86C 4FDBA 4KLKA 1N8RC 1MKHA 5C4XH 3F8TA 5IP9H 1X9NA 1E3PA 2HIXA 2WFWA 3FKIG 3KF6B 2B63G 1NE3A 3JAMc 2V1CC 3HOZH 2XGTA 4BY7H 3KDFA 1CKMA 4OX9Q 3H0GG 4DAMA 1IYJB 4PZ8A 4DV2Q 3CCSA 3M4OH 4IOAA 4DAYB 1W2BA 1UE1A 2R7ZH 4JI4L 4HIKA 1N36L 2AWNA 2F3IA 2E8GA 4X62L 3U58A 2I0QA 3A74A 1N32L 4LF5L 1GO3E 1VQNA 4P74A 3RNUA 1GD7A 1K83H 3KDFB 3CCQA 2L15A 4PMWA 2HQLA 2F4VL 4A3DG 5LMNL 1V9PA 4DV7Q 3UE0A 4LF9L 4JI3L 3I55A 3M4QA 4C3JH 1JB7A 1YVCA 4OO1G 2EXDA 5IYBG 4DR3L 2EIFA 3GTPH 4KHPL 5ELNA 4OWXB 2ZTCA 3A0JA 2OTLA 3EIVA 1Y1VG 4DR1Q 2RHSB 1VQOA 4X66L 5DLQE 4OONA 4A3CG 5GROA 1SMXA 3VDYA 5K36G 4JC0A 3PIOA 4MTNA 4KI0A 1D7QA 4LNQA 2Z0SA 4C3HH 1QUQA 3K0XA 1NMGA 3D0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GVB A;  1K3R A;  4GKJ L;  2Y0S E;  1SLJ A;  4DR7 Q;  1JJ2 A;  4A3M G;  3CC4 A;  1QZH A;  4P71 A;  1VQM A;  3U4Z A;  2N8N A;  2CKZ B;  3A5Z B;  4JBK A;  3CP0 A;  4LF8 L;  1QUQ B;  3CPF A;  1K8A C;  4LFC Q;  2UXD Q;  4XIG S;  1VQ6 A;  4ALP A;  5C4X G;  5IP9 G;  3ZJY C;  1K0R A;  3I7F A;  4TQU S;  1YIT A;  1N33 L;  2WAQ G;  1E22 A;  3WWV A;  3CPW A;  5HY6 A;  4DV3 Q;  1XMQ L;  1H95 A;  1O7I A;  5M5W H;  1X55 A;  4A76 A;  3I4N G;  1VQE A;  2UXB Q;  2MFI A;  5JJL A;  2Q2I A;  3S2H H;  1KC8 C;  3BZC A;  1SFO H;  2R7Z G;  4BXX H;  1BBU A;  4A3F H;  2F52 A;  4R4C A;  1RIP A;  3UDX A;  5AJ3 L;  4DK6 C;  2ATW A;  1JJC B;  3TS2 A;  4L5R C;  2Q2U A;  3M9B A;  1VQ4 A;  4L5T A;  4A4I A;  5C0X I;  1QVC A;  2ALY B;  4X64 L;  1PV4 A;  4BA1 I;  1L1O C;  1M1K C;  4APV A;  5IT9 c;  3ULJ A;  1J5E Q;  4A3G H;  1P16 A;  1I3Q H;  1NMF A;  2PI2 E;  4GN4 B;  4GKK Q;  3AQQ A;  4A3I G;  1XJV A;  5C0X G;  2E5L Q;  2VQF L;  3J81 i;  4JV5 Q;  3K8A A;  2OCE A;  3OYY A;  2JA9 A;  4P72 A;  2BH2 A;  3CF5 A;  4JBJ A;  5FJ8 H;  2AWO A;  2H5X A;  4OXP A;  3S1N H;  4YCW A;  1VQB A;  4LF4 Q;  1D8L A;  3HOU H;  4DR4 Q;  4IPC A;  2B29 A;  4JI5 L;  3AFP A;  4YWK A;  3ERS X;  4NXM L;  1VQI A;  2VNU D;  4GLV B;  3KF8 B;  2B63 H;  3KFU A;  4X65 L;  1PH1 A;  1Q8K A;  3NEN A;  2Q2T A;  3CAM A;  2IT1 A;  2Q2H A;  3J80 i;  5JEA J;  5M5Y H;  2XTI A;  3PGZ A;  5HGQ A;  3CW2 C;  5LMU L;  4A3J H;  1LYL A;  2UXC L;  1YEZ A;  4YCU A;  1PH9 A;  4BY1 H;  5M3F G;  2JE6 I;  2YTX A;  1XNQ Q;  2ZM6 L;  4X6A H;  1UE5 A;  1N34 Q;  2QEX A;  1NY4 A;  4A3E H;  1IL2 A;  4DKA C;  5H1S E;  3CC2 A;  2MNA A;  1VQ9 A;  1VS0 A;  4JI4 Q;  2NN6 I;  2YTY A;  1U0L A;  5IYB H;  5FLX c;  1N36 Q;  4X62 Q;  5C4J H;  1PYS B;  2BA0 A;  3GD7 A;  3UDG A;  1S40 A;  1K9M C;  4LF5 Q;  5LMN W;  1Y1V H;  4PG3 A;  1HNW Q;  4JI8 L;  2CWA A;  3CQZ H;  4HID A;  1WJJ A;  2MO1 A;  1PYB A;  4LF7 L;  1KRT A;  3HOV H;  2ASB A;  1PHJ A;  4JI3 Q;  4LFB L;  4Y7N H;  1Q82 C;  2FXQ A;  4DR3 Q;  3LGJ A;  4A3G G;  3JC6 6;  4DNI A;  3ICE A;  4WJ3 M;  4JI2 L;  4A3B G;  4JOI C;  2A8V A;  4X66 Q;  4LF6 L;  4IFD J;  3I4O A;  5FJ8 G;  4NB3 A;  2NVQ H;  4A3M H;  1Q12 A;  4HJA A;  4AQY L;  3GTJ H;  1IBK Q;  3A5U A;  1OXU A;  1PH4 A;  3HOU G;  4DV5 L;  1IBL L;  3KYH C;  4KHZ A;  1GVP A;  1VQP A;  1PH7 A;  4DR6 L;  3OW2 A;  1L2F A;  1LUZ A;  2KBN A;  2WB1 G;  2RF4 A;  2NVY H;  4PZ6 A;  5GAE C;  2ES2 A;  1BKB A;  1VCI A;  1Q1B A;  1X3G A;  2CWP A;  1EIF A;  3L0O A;  4NPS A;  4O0A A;  5IE8 A;  3T1H L;  3AFQ A;  3GTK H;  5EAY A;  3I4N H;  2K50 A;  1VQG A;  4GN5 A;  2BA1 A;  4A3J G;  4OO1 I;  1K8G A;  5M5X H;  1TWH H;  4OWT B;  2D0P A;  4BY1 G;  3NEM A;  1XMQ Q;  4B3R Q;  2LXJ A;  1HJP A;  2YV5 A;  4R1J A;  1W3S A;  4A3E G;  2IHE A;  2HT1 A;  1YHB A;  3E0E A;  4YY3 Q;  5AJ3 Q;  4B3T L;  1EQQ A;  1YHA A;  1TWF H;  4POF A;  4A3I H;  1VQC A;  2UUC L;  1P8L A;  2VUM H;  1A0I A;  3HOV G;  1C7Y A;  1HZA A;  4JI1 L;  2ZJR A;  4A3L H;  4DPG A;  1Y14 B;  3E9H A;  4NXN L;  4DR5 Q;  2K52 A;  4DV6 L;  1UE6 A;  4DV0 Q;  2UUA Q;  1A62 A;  4LWC A;  1XPR A;  2JK8 A;  2N3S A;  4LUV A;  1L1O A;  4LFA L;  1BBW A;  1UE7 A;  3GO5 A;  2E2I H;  3E9I A;  1XNR L;  4UP7 A;  3PO2 G;  3ER0 A;  2K5H A;  5JEA G;  4GS3 A;  4JI5 Q;  4UP9 A;  4NXM Q;  1L1O B;  1YJN A;  1I5F A;  4HIM A;  3M7N A;  2JA7 G;  2WAQ E;  3T1Y L;  4DUZ Q;  5M3F H;  3U4V A;  2KHI A;  3G6E A;  1SR3 A;  1YIJ A;  1TWA H;  1XTD A;  3PUX A;  2OQ0 A;  1QVG A;  1Z47 A;  2GN5 A;  3B6Y A;  3D31 A;  4LW1 A;  5M3M H;  1HZB A;  1X3E A;  5IYC G;  4DV4 Q;  3RLO A;  5C3E H;  1VQL A;  5BR8 Q;  4R4O A;  5J3B A;  3STB C;  3S1Q H;  1X56 A;  2ZM6 Q;  1B7Y B;  3UDF A;  3TRZ A;  4P75 A;  5FLM G;  3JAM i;  2NZH A;  5C44 H;  4DV2 L;  4RMF A;  4IFD I;  3S1R H;  1HR0 L;  1G29 1;  2N78 A;  2YTV A;  1IBM Q;  4YCV A;  3PUZ A;  4DR2 L;  1EYG A;  1SN8 A;  2AKW B;  1T9H A;  2PNH A;  3FHW A;  2CCZ A;  4A3B H;  2VUM G;  3M4P A;  3IRB A;  1JE5 A;  1MJC A;  4LF7 Q;  1YNX A;  4IFD G;  4GNX C;  3OTO Q;  3HOX G;  2JJQ A;  4DV7 L;  1PFS A;  4A3L G;  1I6H H;  3PUY A;  3GTQ H;  1KXL A;  4YHH L;  4A93 H;  1YHQ A;  4P73 A;  1EWI A;  2UU9 L;  3RZO H;  1I94 L;  2KHJ A;  3PF5 A;  1OXS C;  2C35 B;  3M85 A;  4IOC A;  1QZG A;  5E7N A;  3I4M H;  4DR1 L;  4HJ7 A;  2AMC B;  2KCM A;  3HKS A;  3UE1 A;  2R93 H;  2N49 A;  1WFQ A;  1HNX Q;  1PH2 A;  1FL0 A;  3PCO B;  4UP8 A;  2R7F A;  2D62 A;  4AQY Q;  1OTC A;  3S16 H;  3CD6 A;  4JOI A;  5IYD H;  3K7A H;  3SGI A;  1Q81 C;  1B8A A;  3F2D A;  3CCV A;  1TWC H;  1X54 A;  1DGS A;  4DV5 Q;  2JA6 H;  4L5Q A;  4DR6 Q;  3ULL A;  2ZJP A;  4QGU A;  2VW9 A;  1HZC A;  4MZ9 A;  4DR7 L;  1VQH A;  3CXC A;  1QVF A;  2QGQ A;  1X65 A;  3TEH B;  3T1H Q;  2JQO A;  2DUD A;  1Q7Y C;  1VQ5 A;  4IPH A;  1TXY A;  4R4I A;  3KJO A;  2K75 A;  2MO0 A;  2VQE L;  1PH6 A;  1BVS A;  1VQF A;  1PH3 A;  1PVO A;  5M3M G;  4IPG A;  3TS0 A;  1N32 Q;  5C3E G;  2E2H H;  1M90 C;  2HHH L;  4RG1 A;  2I5L X;  2Z6K C;  4DV3 L;  1TWG H;  1CKN A;  3RR5 A;  2F4V Q;  2I5M X;  3H15 A;  5LMN Q;  2HIV A;  5C44 G;  1S72 A;  1HNZ L;  4LF9 Q;  2UXB L;  2JA5 H;  5GQO A;  2RCN A;  1X3F A;  4B3S L;  4KHP Q;  2RHQ B;  1G51 A;  4B3T Q;  4GOP C;  3HOW G;  4BXX G;  4BBR H;  2UUC Q;  3GTG H;  4JI6 L;  1CKN B;  1VQJ A;  2ZJQ A;  2EQS A;  3I2Z A;  2NZO A;  3MXN B;  1Z9F A;  1AE2 A;  2IX0 A;  4IPD A;  4J15 A;  3GTL H;  4A93 G;  1JJG A;  3S1M H;  3PO2 H;  1PA6 A;  5ELO A;  4L5S A;  5JJK A;  2E2J H;  3I4M G;  4GKK L;  1AH9 A;  3NEL A;  1VQA A;  3DM3 A;  2CQO A;  1YJ9 A;  4JV5 L;  2JA7 H;  1KIX A;  2UUB L;  4LFA Q;  1PH8 A;  1GM5 A;  4JI0 L;  3HKZ G;  5IWA L;  1B70 B;  4K0K L;  1FGU A;  4LF8 Q;  2ZTD A;  5IYD G;  3J81 j;  3CCM A;  1E1O A;  4A3K H;  3PF4 A;  1U5K A;  3KOJ A;  3W1G A;  2PMZ E;  4QQB X;  4AYB G;  2JA6 G;  4DR4 L;  1FJG L;  1EUJ A;  2JA8 H;  2R92 H;  3PO3 G;  4DUY L;  1I50 H;  2R6G A;  1XPO A;  1N33 Q;  5IYC H;  1KL9 A;  3G4S A;  4EX5 A;  2R93 G;  3CCU A;  2K5V A;  1MJE A;  1JMC A;  5FLM H;  1CSQ A;  3RN5 A;  4O2D A;  1XMO L;  1UEB A;  1LM0 A;  3G48 A;  4QL5 A;  4JI7 L;  1C0A A;  1E7Z A;  1KAW A;  4HJ9 A;  1YI2 A;  1ASY A;  1YJW A;  1N9W A;  1WOC A;  1XNQ L;  2CFM A;  3Q8D A;  1N34 L;  1HR0 W;  3MEF A;  4TVA B;  4X64 Q;  2NVT H;  1V1Q A;  3HOX H;  2JA5 G;  3BJU A;  4DV1 L;  1MIU A;  1HR0 Q;  4JYA L;  4R4Q A;  4HJ5 A;  3J81 c;  2ID0 A;  4MNO A;  4DR2 Q;  4BBR G;  4HIO A;  3BZK A;  3TRE A;  1OXX K;  3F2C A;  1Q46 A;  2VQF Q;  2YU9 H;  1X6O A;  1HNW L;  4H02 A;  3CCE A;  1WI5 A;  4PZ7 A;  3W5O A;  1VQ7 A;  3EN2 A;  4XTC S;  4YHH Q;  1IXR A;  3K80 C;  2UU9 Q;  1I94 Q;  5IY0 A;  1NBW A;  3S14 H;  4Y52 H;  1AE3 A;  3GDE A;  4GNX A;  2I5H A;  4B3M L;  2MQH A;  1Q1E A;  1LTL A;  1L0W A;  4GLA C;  2A1A A;  1A63 A;  4X65 Q;  3AYH B;  3KJP A;  3J80 c;  4A3K G;  1IBK L;  1RL2 A;  4LUO A;  4GNX B;  2GVA A;  1KRS A;  3F2B A;  5LMU Q;  2NVX H;  1HZ9 A;  1VQ8 A;  3PUV A;  2JA8 G;  3L2P A;  2R92 G;  1G6P A;  1C9O A;  2UXC Q;  2Y0S G;  4ME3 A;  1GKH A;  4C3I H;  3GTM H;  2OQK A;  5GAD C;  2D0O A;  1VQK A;  2VQE Q;  3HOY H;  1SE8 A;  4OX9 L;  2VZA A;  3L7Z C;  2VL6 A;  2R7D A;  3RZD H;  4YWL A;  1OXT A;  3CCL A;  3F1Z A;  3HOW H;  4HJ8 A;  2HHH Q;  3H3V H;  4B3R L;  3HOZ G;  4JI8 Q;  4BY7 G;  4GKJ Q;  1JT8 A;  3DLL A;  1HNZ Q;  4GLX A;  2JEA I;  4QY7 A;  4LFB Q;  3CCR A;  4B3S Q;  4UY8 C;  4IJL A;  2Z6K A;  1VQD A;  2B3G A;  1K73 C;  4JBM A;  4YY3 L;  4POG A;  3S15 H;  5JJI A;  4JI2 Q;  1KHI A;  1EIY B;  3RN2 A;  4GN3 B;  1Y1W H;  4JI6 Q;  2KCT A;  1PH5 A;  3M3Y H;  1EQR A;  4AH6 A;  4LF6 Q;  1WYD A;  4AIM A;  1UWV A;  1YBY A;  4GOP A;  2JEB I;  1ASZ A;  2WP8 J;  4A75 A;  2VY3 A;  3TQY A;  2IY5 B;  1A8V A;  4DR5 L;  3PV0 A;  1IBL Q;  1S3O A;  1WCM H;  4DV0 L;  2UUA L;  2LSS A;  3CCJ A;  3PO3 H;  5IP7 H;  4IO9 A;  2UUB Q;  4JI0 Q;  4K0K Q;  5IWA Q;  2OWO A;  4QJF A;  4GOP B;  3G71 A;  5GAG C;  4BBS H;  2IX1 A;  1YZ6 A;  2K14 A;  3ULP A;  1OXV A;  1FVI A;  3FP9 A;  4LFC L;  2UXD L;  1CSP A;  3PUW A;  1FJG Q;  1R9T H;  3CME A;  4DUY Q;  4BA2 I;  2K5N A;  3FKI H;  3RLN A;  1J6Q A;  3RLF A;  4DK3 C;  3CC7 A;  4C2M H;  4DUZ L;  4IJH A;  3H3V I;  1KQS A;  3HOY G;  2K4K A;  3EBE A;  2PQA A;  3H0G H;  1XMO Q;  3W1B A;  2ZTE A;  3UDI A;  4DV4 L;  1E24 A;  3PSI A;  4JG2 A;  4JI7 Q;  3S2D H;  3S24 A;  5BR8 L;  3KLW A;  3K81 C;  2PQA B;  4JBW A;  3AEV A;  3I56 A;  2AHO B;  2QA4 A;  3GTO H;  4JI1 Q;  3BU2 A;  4A3D H;  4DV1 Q;  4R4T A;  1XPU A;  4A3F G;  4JYA Q;  3K7U C;  3STB D;  4NXN Q;  1J5E L;  2KEN A;  4DV6 Q;  2BH8 A;  1IBM L;  1Y1W G;  1EFW A;  4EQ5 A;  1HH2 P;  4OWW B;  3J7A 5;  3S17 H;  4LUZ A;  2E5L L;  2WB1 E;  2VS1 A;  2OTJ A;  4A3C H;  2A19 A;  3HKZ E;  2DGY A;  3OTO L;  2NN6 G;  1NTG A;  1EOV A;  2PI2 A;  1XNR Q;  1V43 A;  3CMA A;  3NBH B;  4LF4 L;  4QIW E;  4AYB E;  1WCM G;  4JCV E;  4B3M Q;  5C0X J;  1E1T A;  1SRU A;  2IHF A;  5IP7 G;  5GAH C;  4WJ4 A;  3J7Z C;  1NJI C;  3T1Y Q;  1IZ6 A;  3KF6 A;  1SRO A;  3HFZ B;  4BBS G;  1HNX L;  1CKO A;  4YWM A;  3U50 C;  4UPA A;  3PIP A;  1CUK A;  1KD1 C;  2LXK A;  2YYZ A;  1Q86 C;  4FDB A;  4KLK A;  1N8R C;  1MKH A;  5C4X H;  3F8T A;  5IP9 H;  1X9N A;  1E3P A;  2HIX A;  2WFW A;  3FKI G;  3KF6 B;  2B63 G;  1NE3 A;  3JAM c;  2V1C C;  3HOZ H;  2XGT A;  4BY7 H;  3KDF A;  1CKM A;  4OX9 Q;  3H0G G;  4DAM A;  1IYJ B;  4PZ8 A;  4DV2 Q;  3CCS A;  3M4O H;  4IOA A;  4DAY B;  1W2B A;  1UE1 A;  2R7Z H;  4JI4 L;  4HIK A;  1N36 L;  2AWN A;  2F3I A;  2E8G A;  4X62 L;  3U58 A;  2I0Q A;  3A74 A;  1N32 L;  4LF5 L;  1GO3 E;  1VQN A;  4P74 A;  3RNU A;  1GD7 A;  1K83 H;  3KDF B;  3CCQ A;  2L15 A;  4PMW A;  2HQL A;  2F4V L;  4A3D G;  5LMN L;  1V9P A;  4DV7 Q;  3UE0 A;  4LF9 L;  4JI3 L;  3I55 A;  3M4Q A;  4C3J H;  1JB7 A;  1YVC A;  4OO1 G;  2EXD A;  5IYB G;  4DR3 L;  2EIF A;  3GTP H;  4KHP L;  5ELN A;  4OWX B;  2ZTC A;  3A0J A;  2OTL A;  3EIV A;  1Y1V G;  4DR1 Q;  2RHS B;  1VQO A;  4X66 L;  5DLQ E;  4OON A;  4A3C G;  5GRO A;  1SMX A;  3VDY A;  5K36 G;  4JC0 A;  3PIO A;  4MTN A;  4KI0 A;  1D7Q A;  4LNQ A;  2Z0S A;  4C3H H;  1QUQ A;  3K0X A;  1NMG A;  3D0F A; 
#chains in the Genus database with same CATH topology
 1O7Z A;  1PTO H;  1K3R A;  5KND A;  2Y0S E;  4DR7 Q;  1NCV A;  4KD3 A;  3CC4 A;  1QZH A;  2ASB A;  3U4Z A;  2CKZ B;  3CHB D;  4TRD A;  3CPF A;  1K8A C;  4LFC Q;  5E1F A;  1I6V C;  2RDG A;  4XIG S;  5C4X G;  1D5X C;  4FF2 A;  3BZD B;  3I7F A;  3R3O A;  3M4Y A;  3FVQ A;  2M2L A;  1O7I A;  3MXP A;  3I4N G;  4KJN A;  1VQE A;  5JJL A;  2Q2I A;  4A3F H;  1AZQ A;  4R4C A;  2HDM A;  4XXE A;  1AZP A;  2Q2U A;  1C48 A;  4RHR A;  3W2D A;  2ALY B;  4Z9C B;  1TVX A;  2NN6 H;  4C3J G;  1PV4 A;  1L1O C;  1J5E Q;  5CV6 A;  4A3G H;  1I3Q H;  2A69 D;  2E76 C;  2NB0 A;  3AQQ A;  3VR2 A;  3J81 i;  2PZW A;  3CF5 A;  5FJ8 H;  3R2I A;  1D1K A;  1U4L A;  5G3L D;  5E4X A;  1ONL A;  1D8L A;  2GA4 B;  5IOC A;  4HMI A;  4IPC A;  2B29 A;  2AQ3 B;  4YWK A;  3ERS X;  2VNU D;  1JWU D;  1S5F D;  2L1B A;  4GLV B;  3WOE A;  2B63 H;  3IL8 A;  3SK6 A;  2O5J C;  1PH1 A;  3T53 B;  4FNF A;  4X3T A;  5KGU A;  2IT1 A;  5M5Y H;  1KQS A;  1LAC A;  1YEZ A;  2EYO A;  1G2S A;  1N34 Q;  2VB2 X;  1E2Z A;  2WAQ B;  5H1S E;  3CC2 A;  1A6X A;  3OOC A;  1VQ9 A;  1EYD A;  1LTB D;  4ZAI A;  5C4J H;  1EYA A;  3GD7 A;  3M4O B;  4DK0 A;  1HNW Q;  5IGD A;  2CWA A;  3SXH A;  4HID A;  4QB4 A;  3Q24 A;  2SOB A;  3LGJ A;  4WJ3 M;  2XRQ D;  2A8V A;  4F88 A;  2F0J A;  3GTP B;  4LF6 L;  2B2Y C;  2NVQ H;  4NB3 A;  1CA5 A;  1Q12 A;  3E6Z X;  3KYH C;  1VQP A;  5JEA H;  2MPM A;  2E2D C;  4OEM B;  3NHH A;  1BKB A;  1VCI A;  1X3G A;  1FNV A;  1LT3 D;  2WII B;  3I4N H;  1JE4 A;  3MAQ A;  4RH6 A;  4A3J G;  5BN5 A;  1F2L A;  1EWH A;  4IUU A;  2LXJ A;  1HJP A;  1W3S A;  1U4P A;  1O7Y A;  1E2W A;  5AJ3 Q;  1EQQ A;  1DXM A;  5C5M A;  3ERO A;  1P8L A;  1A0I A;  1SYB A;  1CQV A;  3CRK C;  3HOV G;  4IFD H;  1B50 A;  2BE5 D;  4IUN A;  1IL8 A;  1NR4 A;  4DPG A;  2EOT A;  2EYM A;  3C1F A;  4DV6 L;  1UE6 A;  4C1N I;  4LUV A;  1CFM A;  1L1O A;  3BDO A;  5AFW A;  3GO5 A;  2E2I H;  1SND A;  4K8J A;  1SBB B;  4K5X A;  4QMG A;  1HFN A;  2O5I C;  2K5H A;  1HUN A;  1DM0 B;  4UP9 A;  4NXM Q;  2JA7 G;  3HOU B;  1JWM D;  1I4X A;  4LAA A;  2KHI A;  5TSS A;  3G6E A;  1TWA H;  3PUX A;  5I2X A;  2OT2 A;  3B6Y A;  1H9R A;  1RDP D;  3RLO A;  2ENB A;  5C3E H;  4R4O A;  3HG9 A;  3KBX A;  4CHT B;  5IT9 L;  3C2P A;  5FLM G;  4V19 0;  4M1U B;  5CV8 A;  4FO2 A;  3S1R H;  4IN3 A;  4CGY B;  2YTV A;  3CRL C;  5KNC A;  1EYG A;  1STN A;  2CCZ A;  3IRB A;  1JE5 A;  1I4R A;  5IGC A;  3HOX G;  4A3L G;  2F0V A;  4A93 H;  1K8M A;  4P73 A;  1EWI A;  1YHQ A;  2NWG A;  4RAU C;  3M85 A;  4IOC A;  1Y8N B;  3EJI A;  3I4M H;  3HKS A;  2EDG A;  3ITP A;  2B2T C;  3PCO B;  4UP8 A;  2R7F A;  2D62 A;  1OTC A;  3SK5 A;  3CD6 A;  2FHT A;  2B2Y A;  3F2D A;  1X54 A;  1X3P A;  4K5W A;  2XNA C;  3VYU A;  1EZ6 A;  3ULL A;  3GTJ B;  4DR6 Q;  1ET6 A;  2VW9 A;  3BVM A;  2A68 D;  1UEA B;  4JPB W;  2QGQ A;  4KTA A;  3JAM E;  5FLX L;  1Q7Y C;  2VQE L;  2MO0 A;  5CV5 A;  3TSS A;  5M3M G;  1EEF D;  4IPG A;  3TS0 A;  2K5D A;  2QW7 A;  2TSS A;  1BCP C;  2K1B A;  1TWG H;  1CKN A;  1II3 A;  1QB5 D;  4XQQ A;  5M5X B;  3H15 A;  2F4V Q;  5LMN Q;  2HIV A;  4XDX A;  3MXN A;  2JA5 H;  4TKO B;  4R9W A;  4B3T Q;  3IAY A;  4GOP C;  1A3V A;  1VQJ A;  1PFB A;  3WDN A;  1F2Z A;  3OMG A;  1MHW C;  1AE2 A;  1LTA D;  1DYQ A;  4HCS A;  5COY A;  5I2Y A;  1LTS D;  2E2J H;  2F4I A;  1AH9 A;  3NEL A;  2PO4 A;  4QF4 A;  4JV5 L;  2JA7 H;  1KIX A;  4JI0 L;  5IWA L;  1B70 B;  3HZX A;  2F0N A;  4A3K H;  3CCM A;  1E1O A;  3R2T A;  2F0S A;  2PMZ E;  2XVS A;  2JA6 G;  4DR4 L;  4DU9 A;  1EUJ A;  3G6J B;  1I4G A;  4EVO A;  5A2Q L;  4K8I A;  1XPO A;  4EX5 A;  1HTL D;  1K28 A;  3SK4 A;  3N6R A;  1HA5 A;  4H0L C;  1M8A A;  5FLM H;  3DEP A;  2PZT A;  4PNY A;  1LM0 A;  3G48 A;  4QL5 A;  1C0A A;  1MSG A;  1ILQ A;  4KV6 A;  3PMF A;  3HOX H;  3BJU A;  1MIU A;  1HR0 Q;  4JYA L;  4HJ5 A;  3J81 c;  4DR2 Q;  4BBR G;  5CMD A;  4ODG A;  3OIP A;  1I4Q A;  4QUC A;  3SK8 A;  4WJW A;  4H02 A;  3TZU A;  3HRZ C;  4YHH Q;  1HCZ A;  3K80 C;  4OEL B;  2UU9 Q;  1I94 Q;  2B2V C;  3S14 H;  2C5C A;  4B3M L;  2MQH A;  2PYK A;  1GHJ A;  1J8I A;  2A1A A;  1RJT A;  2SNS A;  3VA7 A;  2WB1 B;  1B53 A;  1Y8O B;  4GNX B;  1KRS A;  3HKZ B;  2NVX H;  2JA8 G;  2B2T A;  3L2P A;  1VMP A;  1VMC A;  4KMU C;  5J22 A;  1TKW B;  4J8Q A;  1GUT A;  4KHV A;  1PRT C;  1WTV A;  1EY9 A;  3I90 A;  4HJ8 A;  1ZXT A;  5KEE A;  1GUN A;  1IHZ A;  4ZQ3 A;  4HAE A;  2J4X A;  1C8C A;  1VQD A;  2X6L A;  1K73 C;  4YY3 L;  2DNE A;  4RCO A;  3ND9 A;  4GN3 B;  1PH5 A;  1BOS A;  4AH6 A;  4LF6 Q;  1WYD A;  1YNJ D;  4CJ1 B;  4WFN 3;  4AIM A;  2NTT A;  1ESF A;  4GOP A;  1V1P B;  1LV9 A;  5E3F A;  1A8V A;  3DMU A;  1RTO A;  1WCM H;  2UUA L;  2LSS A;  2HCI A;  2FMC A;  5IP7 H;  3GTL B;  2OWO A;  4FVM A;  4DFA A;  2ZXO A;  5GAG C;  4G57 A;  3HP3 A;  1S5C D;  1YZ6 A;  3ULP A;  4BBS H;  3FP9 A;  4C3H G;  4LFC L;  4ZLT F;  4DUY Q;  3EA6 A;  1EIG A;  2KA7 A;  3FKI H;  3RLN A;  1J6Q A;  4DK3 C;  3H3V I;  3DHQ A;  2R92 B;  3HOY G;  2K4K A;  2PQA A;  2Y0S B;  3MFG A;  5EPK A;  4JG2 A;  3S2D H;  3A8J E;  1W6K A;  2F03 A;  4JBW A;  4FXK C;  1XPU A;  2F0M A;  1H9S B;  1AP0 A;  2PQE A;  1J5E L;  2KEN A;  4DV6 Q;  1IBM L;  1VF7 A;  2FFK B;  3NBH A;  1Y1W G;  3S17 H;  2PNR C;  1D2B A;  2PI2 A;  3O13 A;  2DY8 A;  2NUC A;  1V43 A;  1I4H A;  2PW7 A;  5C0X J;  1SRU A;  5GAH C;  3I3C A;  2B2V A;  4HSP A;  3U50 C;  4CJ0 B;  2A6H C;  4QCL A;  3PIO 3;  1CUK A;  4FDB A;  2RKS A;  4DAY A;  5IP9 H;  1SMY D;  2V1C C;  3TP8 A;  2EZV A;  2M9V A;  1STY A;  4QUF A;  4IOA A;  3CCS A;  4NMZ A;  2HDL A;  2JXM B;  2R7Z H;  5IT9 E;  3OHX C;  1GJX A;  4P74 A;  4PMW A;  4A3D G;  1B3A A;  4LF9 L;  3HOW B;  1JB7 A;  4OO1 G;  3M4Q A;  5IYB G;  4KHP L;  5ELD A;  3NK9 A;  4OWX B;  5EKL A;  2ZTC A;  3A0J A;  1J9O A;  2RHS B;  1SAP A;  3J80 L;  4RHS A;  3NE5 B;  1B9N A;  4N8X 1;  3S15 B;  3VDY A;  3M3Y B;  3A7A B;  2Z0S A;  4C3H H;  1JR0 D;  1F9S A;  4A3M G;  5I9O A;  1GOZ A;  4P71 A;  1VQM A;  3PO3 B;  4LF8 L;  4JBK A;  1QUQ B;  2F0O A;  2UXD Q;  3I91 A;  1SE3 A;  4TQU S;  1YIT A;  1D5M C;  1E22 A;  3WWV A;  3E3X A;  5HY6 A;  1H95 A;  1BXT A;  1CM9 A;  5D65 A;  5M5W H;  4G4K A;  4K6L A;  1KC8 C;  1SFO H;  4BXX H;  2Z4I A;  4DGZ A;  5AJ3 L;  2Z1C A;  3UDX A;  2R61 A;  3H0G B;  3FRP B;  4DK6 C;  2ATW A;  1JJC B;  4C56 C;  1EIH A;  4K14 A;  1KDB A;  3ZYY X;  4L5T A;  5JOB A;  1K3B C;  5JVG 3;  4BA1 I;  1IYU A;  3BVZ A;  4DXF A;  4A3I G;  5C0X G;  4JV5 Q;  3K8A A;  2OCE A;  5IGB A;  3OYY A;  4P72 A;  3F2U A;  4F87 A;  2H5X A;  2VB3 X;  3VYR A;  3S1N H;  2L11 A;  2NYZ D;  1NAP A;  4DR4 Q;  3AFP A;  4NXM L;  3NQT A;  4ZYS A;  3KF8 B;  3P1H A;  3ONA B;  4X65 L;  2F0L A;  3K57 A;  2JYO A;  4XYQ A;  5JEA J;  2Q2H A;  2XTI A;  3QWN A;  3G7L A;  1DOM A;  4DK1 A;  2KEC A;  3V96 A;  4CJ2 C;  2UXC L;  4YCU A;  4BY1 H;  1BUV T;  5M3F G;  1ESR A;  5C4X B;  3I72 A;  1V1O A;  4ABN A;  1SNO A;  3K6O A;  2QEX A;  4A3E H;  4OO1 H;  2FJ2 A;  1VS0 A;  2YTY A;  1U0L A;  5IYB H;  4X62 Q;  3J81 E;  1K9M C;  5DAU A;  4FP5 D;  1PYB A;  2EY1 A;  2RA4 A;  4JI3 Q;  2B8G A;  4Y7N H;  2EVB A;  5DM7 3;  5FOB B;  4A3G G;  3JC6 6;  3ICE A;  1CZG A;  4JI2 L;  1K0S A;  2EXZ A;  4JOI C;  4C3J B;  4X66 Q;  4IFD J;  4G7O C;  5FJ8 G;  1DJR D;  1S5B D;  4A3M H;  1RTN A;  1EY7 A;  5EBD A;  2XSC A;  5JPN C;  1EU4 A;  3JAM L;  4ZRZ A;  2F0D A;  4DR6 L;  1CHQ D;  3OW2 A;  1PLF A;  4H13 C;  4LMQ D;  2NVY H;  5GAE C;  1IYV A;  5LL6 X;  3FDT A;  4ZK9 B;  4O0A A;  1EIF A;  5IE8 A;  3AFQ A;  5EAY A;  2K50 A;  1VQG A;  2L4N A;  1SDF A;  1RD9 D;  3BDL A;  3QOJ A;  3MA2 B;  1TWH H;  4BWG B;  2D0P A;  3NEM A;  1AEX A;  2YV5 A;  4R1J A;  2ZT9 C;  4ZKB B;  4X3K A;  2HCC A;  4YY3 Q;  4B3T L;  3S2H B;  1XTC D;  4A3I H;  4KY5 A;  2CW0 C;  2VUM H;  1SE2 A;  4MN3 A;  1ILP A;  3A55 A;  4OHJ A;  5IGG A;  2ZJR A;  2E74 C;  3K59 A;  3TDQ A;  1EEI D;  2UUA Q;  4LWC A;  3H94 A;  5LHY 1;  2JK8 A;  1HUM A;  1B2T A;  3E9I A;  1KDA A;  4N8F A;  3PO2 G;  2F0T A;  2MP1 A;  5D14 A;  5JEA G;  4JI5 Q;  3A54 A;  4HIM A;  4BS9 A;  1KAB A;  5EKI A;  5M3F H;  1ROD A;  1SR3 A;  1YIJ A;  1TU2 B;  3GV3 A;  3OWF A;  3D31 A;  1A3U A;  1A2T A;  2PMZ B;  1U4M A;  1IW7 C;  2PCF B;  4A3J B;  3EFX D;  4P75 A;  4DA2 A;  5C44 H;  4DV2 L;  2A73 B;  2Q8R E;  1ENC A;  1W6J A;  1HR0 L;  1G29 1;  1BBX C;  3TP6 A;  1IBM Q;  4DR2 L;  1SN8 A;  1T9H A;  3FHW A;  3M4P A;  1JOR A;  4LF7 Q;  4IFD G;  4DV7 L;  2JJQ A;  3T16 A;  1Y1V B;  2IX3 A;  4YHH L;  3CQZ B;  1CZW A;  1V1P A;  3Q0A A;  2UU9 L;  1I94 L;  2C35 B;  3HOV B;  1ZEQ X;  1VDZ A;  4IUP A;  1WD1 A;  2R93 H;  2N49 A;  1RKN A;  4JOI A;  1WTQ A;  3K7A H;  3SGI A;  1R4P B;  1B8A A;  3CCV A;  4DV5 Q;  1DGS A;  1Q3L A;  4HN7 A;  2H1E A;  4MZ9 A;  1VQH A;  3CXC A;  1UUP A;  1QVF A;  3TEH B;  3T1H Q;  3R8B A;  2JQO A;  2DUD A;  2KOL A;  3S1Q B;  5EJW A;  1BVS A;  3GTK B;  2OF1 A;  5C3E G;  1PMR A;  4C3I G;  5CR3 A;  1M90 C;  1HQM C;  2E2H H;  3U9O A;  4DV3 L;  3RR5 A;  2I5M X;  4DN4 M;  1S72 A;  4LF9 Q;  2UXB L;  1NNX A;  1X3F A;  4KHP Q;  2RHQ B;  2EYH A;  2UUC Q;  2SEB D;  3NPP A;  1SEB D;  3D4D A;  3J80 E;  1TWF B;  2F0E A;  4J15 A;  4A93 G;  3S1M H;  3PO2 H;  1PA6 A;  4L5S A;  5JJK A;  3I4M G;  5C4Z A;  1SXT A;  2CQO A;  1PZJ D;  4LFA Q;  1GM5 A;  5EPJ A;  1FGU A;  4LF8 Q;  1U5K A;  3KOJ A;  3W1G A;  1F2M A;  3LWU A;  1O7L A;  3QJY A;  4DUY L;  4H7B A;  4L63 B;  1MJE A;  5KIX A;  1ML0 D;  3VYS A;  2EPB A;  1PTO F;  2DJF C;  2O4X A;  1EOT A;  3K5L A;  1KAW A;  4HJ9 A;  1YI2 A;  4EQP A;  1WOC A;  1XNQ L;  5M3M B;  2A69 C;  3Q8D A;  2JA5 G;  1KDC A;  1HHV A;  1SYG A;  1MSH A;  3AB9 A;  3QIA A;  4HIO A;  3BZK A;  3TRE A;  3F2C A;  2YU9 H;  4MIU A;  5I4D A;  3W5O A;  4A3B B;  1IXR A;  2Q8T A;  1NR2 A;  4RKL A;  1JWS D;  2XWJ B;  1I6H B;  2I5H A;  4J6H A;  3GTQ B;  1Q1E A;  1LTL A;  1L0W A;  1EYC A;  3RZO B;  4GLA C;  4X65 Q;  5CV9 A;  4KD4 A;  4A3K G;  2F0U A;  3TZD A;  5E4W C;  2GVA A;  3F2B A;  3S16 B;  3PUV A;  2UXC Q;  2XN9 C;  1TWC B;  4C3I H;  2JA6 B;  3GTM H;  2MUY A;  1TS3 A;  1VQK A;  1STB A;  3L7Z C;  1NUC A;  3RZD H;  2RDF A;  4RWS C;  3LX0 A;  2K04 A;  1JT8 A;  3DLL A;  5EQ0 A;  3SVM A;  3CCR A;  4IJL A;  2B3G A;  4POG A;  4JBM A;  4JI2 Q;  1KHI A;  3RN2 A;  4JI6 Q;  2KCT A;  1EQR A;  1STE A;  2D2C C;  1A2U A;  4BBR B;  3GTG B;  2Z6B A;  2WP8 J;  3BS1 A;  2VY3 A;  5L37 A;  4DV0 L;  3C1E A;  3WOF A;  3CCJ A;  2B2U C;  3HEJ A;  2UUB Q;  4DF7 A;  4PV1 C;  5D3D A;  2JP1 A;  2UXD L;  4IUQ A;  2WIN B;  1CSP A;  3PUW A;  1FJG Q;  4XYO A;  4KN7 C;  1V8Q A;  2K5N A;  2ZXP A;  3CC7 A;  3NTK A;  1LLR D;  2JA8 B;  1I50 B;  3EBE A;  4F8M A;  3NUC A;  3DWA A;  3W1B A;  1XMO Q;  3OPO A;  3UDI A;  4EQO A;  4JI7 Q;  2BE5 C;  3S24 A;  3VA5 A;  2M00 A;  4IUT A;  4CDD C;  4ZUJ A;  2AHO B;  2QA4 A;  3K5N A;  1U4R A;  2OEO A;  3NWT A;  3STB D;  3RMH A;  3NSW A;  4L6T B;  2L5T A;  2QEJ C;  1M4V A;  2NVT B;  1EFW A;  1F2Y A;  4XQJ A;  4OWW B;  2EE1 A;  3KLR A;  1WTX A;  2A19 A;  1NTG A;  1EY6 A;  2F0P A;  1E0B A;  1EFI D;  4QIW E;  1WCM G;  1ENA A;  1E1T A;  2LKV A;  2IHF A;  5IP7 G;  5CBE E;  4WJ4 A;  3J7Z C;  1IZ6 A;  4BBS G;  1EY5 A;  1CKO A;  4U67 3;  4YWM A;  4UPA A;  1KD1 C;  2LXK A;  4HR7 B;  1Y69 U;  3A7L A;  3DM1 A;  1X9N A;  1E3P A;  2HIX A;  2WFW A;  3FKI G;  3KF6 B;  5JJZ A;  1BQQ T;  1LO5 D;  2XGT A;  3J81 L;  4DV2 Q;  4PZ8 A;  3M4O H;  3RD4 A;  1CI3 M;  1W2B A;  2CQA A;  4K5V A;  4FF3 A;  4M8A A;  3HOY B;  1N32 L;  2A74 C;  2EJG C;  4X62 L;  3GV6 A;  1F9R A;  3CCQ A;  3KDF B;  2BDO A;  2PPB C;  4DV7 Q;  1V9P A;  2L0C A;  4JI3 L;  2EXD A;  2EYL A;  3GTP H;  4NW2 A;  4P2C B;  1CQF A;  1CA6 A;  1VQO A;  4HTH A;  4X66 L;  3SDZ A;  1I4P A;  4B08 A;  1Y1W B;  3PIO A;  4MTN A;  4KI0 A;  4LNQ A;  2A68 C;  1NMG A;  3D0F A;  5EPL A;  3I4L A;  2ICE C;  1STG A;  1JJ2 A;  1SYE A;  3GQB A;  2NZ1 D;  2N8N A;  1EU3 A;  1LT4 D;  2B2U A;  1IKL A;  3OMC A;  4UDU C;  5IP9 G;  2EY5 A;  1K0R A;  3NXW A;  1EZ8 A;  4DV3 Q;  1R9T B;  1AN8 A;  1X55 A;  4A76 A;  2UXB Q;  2MFI A;  1DOL A;  4C2M B;  2R7Z G;  2F52 A;  1PYW D;  2H4O A;  3TS2 A;  2JSO A;  4L5R C;  2F0H A;  3M9B A;  3TP7 A;  4ZUI A;  5C0X I;  5T1G A;  4X64 L;  1LTG D;  1M1K C;  1BR9 A;  3D4R A;  2RVL A;  3MFY A;  3ULJ A;  4APV A;  2NTS A;  1P16 A;  1NMF A;  3P75 A;  2PI2 E;  4A3D B;  3GTO B;  1PFN A;  3J7A F;  5D3I B;  2BH2 A;  4Q5V A;  2AWO A;  1T5E A;  3MXG A;  4OXP A;  3SE0 A;  4YCW A;  4LF4 Q;  3HOU H;  1BCP F;  1AFP A;  4JI5 L;  1VQI A;  5ELB A;  4G7Z C;  3KFU A;  1Q8K A;  3NEN A;  3UI2 A;  2Q2T A;  1TY0 A;  2EYJ A;  3CAM A;  2X6G A;  5LMU L;  3PGZ A;  2K05 A;  1LYL A;  3MEH A;  3BDC A;  3MHB A;  2JE6 I;  2AUJ D;  1XNQ Q;  4X6A H;  1UE5 A;  1IL2 A;  4DKA C;  2EYF A;  3D3R A;  4BXX G;  1S4Z A;  1QJO A;  2NN6 I;  3HOZ B;  4BY7 B;  3Q23 A;  1PYS B;  2BA0 A;  3P7J A;  5LMN W;  4U68 A;  3GP7 A;  1WJJ A;  2E75 C;  2MO1 A;  3QB3 A;  2KUM A;  4LF7 L;  1Q82 C;  1K83 B;  2PW5 A;  3MXU A;  2LY7 A;  5C3X A;  2IW3 A;  1G8Z D;  4KJO A;  3SEB A;  3I4O A;  1TT2 A;  3GTJ H;  1U9R A;  4OGQ C;  4DV5 L;  1IBL L;  4E6I A;  3MC0 B;  1PH7 A;  4GKJ Q;  1L2F A;  1X32 A;  2KBN A;  2WB1 G;  2RF4 A;  3ND8 A;  4PZ6 A;  2ES2 A;  3L0O A;  2CWP A;  3J7A V;  3T1H L;  1PTO B;  1SNC A;  4GN5 A;  3KLS A;  5FKA C;  3D6W A;  2F1M A;  1K8G A;  5M5X H;  5COR A;  4BY1 G;  1XMQ Q;  3NQI A;  5M9O A;  4A3E G;  2HT1 A;  3MZ5 A;  3K0Y A;  2HQE A;  4DAV A;  3E0E A;  3BYT B;  5A35 A;  1YHA A;  2Z8L A;  3SR1 A;  3I73 A;  4POF A;  2UUC L;  2B39 A;  4A3F B;  2IPK D;  5NUC A;  4JI1 L;  2K5W A;  1Y14 B;  1KNA A;  1SSO A;  2TMP A;  3E9H A;  4NKL A;  4DV0 Q;  1G6Z A;  2F0K A;  3D4W A;  1A62 A;  1XPR A;  4I7Z C;  4IZ8 A;  4A3G B;  1PRT F;  1I3Q B;  4RKB A;  4LFA L;  1UE7 A;  1B1Z A;  2KCN A;  1XNR L;  1KLG D;  2K5Q A;  5FO7 B;  1FNW A;  1SNQ A;  4DAP A;  4FXG C;  3M7N A;  1PFM A;  1L1O B;  1YJN A;  2KED A;  2WAC A;  1YNN D;  4YIJ A;  1GUO A;  1TS4 A;  2NBF A;  1XTD A;  5CYU A;  2B63 B;  2OQ0 A;  1NSN S;  1HZB A;  1X3E A;  5C4H A;  4RA8 A;  1VQL A;  1L0Y B;  2D5D A;  5M5Y B;  1RHP A;  1B9M A;  2ZM6 Q;  4KY7 A;  3UDF A;  3TRZ A;  2NZH A;  4RMF A;  4NP5 A;  4IFD I;  1B44 D;  2N78 A;  3PUZ A;  2PNH A;  4IUV A;  4IAL A;  2VUM G;  1ZYR C;  2RBM A;  2DJG C;  1MJC A;  1YNX A;  4GNX C;  1PFS A;  3PUY A;  4MTK A;  4B9X A;  2RQX A;  1OXS C;  3AMU A;  5E7N A;  4PMB A;  3OW7 A;  4DR1 L;  4HJ7 A;  1F77 A;  3URY A;  2KCM A;  1HXY D;  4RGO S;  1PH2 A;  1SYC A;  4AQY Q;  4G7H C;  1PTO D;  5IYD H;  3LNN A;  2NVQ B;  3SHL A;  1SMY C;  2EY2 A;  3C46 A;  1LT6 D;  2ZJP A;  1TY2 A;  2PZU A;  5DNF A;  4H44 C;  5FO8 B;  4DNR B;  4R4I A;  4DNT B;  3KJO A;  2K75 A;  1PH6 A;  4ZKC B;  1PH3 A;  1TS2 A;  2QDB A;  3H91 A;  1PVO A;  2EJM A;  1N32 Q;  3I4N B;  4ILW A;  3ERQ A;  4RG1 A;  2I5L X;  3K58 A;  5C44 G;  2KVM A;  2CHB D;  2Z9H A;  4F7X A;  1G51 A;  3QG1 A;  3HOW G;  2F0I A;  4JI6 L;  1CKN B;  3TN2 A;  3T13 A;  4Q0F A;  4RGM A;  2J0T D;  2CH4 A;  3MXN B;  2NZO A;  1Z9F A;  3FPP A;  3GTL H;  1D5Z C;  5ELO A;  5JVH 3;  4GKK L;  2A6E C;  2L55 A;  1TS5 A;  1YJ9 A;  2BCO A;  4RGN A;  2UUB L;  2R93 G;  1PH8 A;  1UNS A;  3J81 j;  1JC7 A;  4AYB G;  1FJG L;  2E2I B;  3PO3 G;  4LJZ C;  2R92 H;  5EGT A;  3CCU A;  5IGE A;  2I46 A;  1JMC A;  4R8N A;  2B2W C;  1CSQ A;  2K7V A;  3IFT A;  5ELE A;  1XMO L;  1H9K A;  1BF4 A;  1TWA B;  2RCF A;  4JI7 L;  1E7Z A;  2ICI A;  3T4A C;  2B8F A;  3MEF A;  4TVA B;  4X64 Q;  5C3E B;  1V1Q A;  4R4Q A;  4MNO A;  2P5Z X;  3QO2 A;  1OXX K;  1DOK A;  3S1R B;  1X6O A;  3FPU B;  2K28 A;  4XTC S;  5I9P A;  3MVV A;  4JW0 A;  5IY0 A;  4Y52 H;  4GNX A;  5KRU A;  4A93 B;  3MTS A;  3TME A;  4B9W A;  3AYH B;  5K5P A;  3KJP A;  3I4M B;  1IBK L;  4LUO A;  5LMU Q;  3DXJ C;  3LWE A;  1HZ9 A;  1D1I A;  5I6W A;  1VQ8 A;  1G6P A;  1C9O A;  4KKS A;  3KUP A;  1GKH A;  4ME3 A;  4QIW B;  3H3V C;  2OQK A;  1G91 A;  1SE8 A;  1GHK A;  2VZA A;  2O2L D;  2R7D A;  4K2L A;  4YWL A;  1OXT A;  3CCL A;  3F1Z A;  2CH4 W;  3HOW H;  3H3V H;  2HHH Q;  1QG7 A;  1FNU A;  4B3R L;  3VR5 A;  1QCB D;  1LAB A;  1HNZ Q;  5JAV A;  2N55 A;  5HUR A;  4B3S Q;  4UY8 C;  1TWG B;  3S15 H;  1VF5 C;  5JJI A;  1EIY B;  2JA5 B;  3M3Y H;  1PZI D;  1D6E C;  1TQO A;  1YBY A;  1LT5 D;  1BDO A;  1BCP B;  2QDL A;  4A75 A;  1EQV A;  3TQY A;  4DR5 L;  3PV0 A;  1IBL Q;  3PO3 H;  1SYF A;  4K0K Q;  4QJF A;  4GOP B;  2G5D A;  2E2J B;  2IX1 A;  1OXV A;  2JA7 B;  2MGS A;  1SNP A;  1JOK A;  3CME A;  2D9U A;  4BA2 I;  4A3K B;  5FK9 C;  1Z6H A;  5DM6 3;  1BO0 A;  3V2T A;  4DUZ L;  4IJH A;  2K6A A;  3PIP 3;  3H0G H;  2Q8I B;  4JVZ A;  4K6D A;  2ZTE A;  4IUR A;  1H9S A;  4DV4 L;  2SNM A;  3K5O A;  5BR8 L;  3KLW A;  2B2W A;  1JCK B;  4I65 A;  1PDQ A;  2PQA B;  4IQZ A;  3I56 A;  4UAI A;  4JI1 Q;  4DV1 Q;  4R4T A;  1QE6 A;  4EQ5 A;  3HOX B;  1HH2 P;  3J7A 5;  4LUZ A;  2VS1 A;  4A3C H;  1Y8P B;  1QNU A;  1CTM A;  3OTO L;  1EOV A;  1XNR Q;  3CMA A;  3NBH B;  4LF4 L;  4AYB E;  2AQ1 B;  3KLS X;  1FGB D;  1WTP A;  4ME5 A;  2BOS A;  1NJI C;  3S14 B;  1SRO A;  3A56 A;  3HFZ B;  1HNX L;  2F0Q A;  1KAA A;  2YYZ A;  4KLK A;  1DCZ A;  1N8R C;  4KKU A;  1SNM A;  5C4X H;  3F8T A;  3L3O C;  2G9D A;  5CGK A;  1HTP A;  5ISR A;  3D8G A;  1S5D D;  2NVX B;  4OX9 Q;  4DAM A;  1O78 A;  4DAY B;  2I0Q A;  2AWN A;  2F3I A;  3U58 A;  3A74 A;  2LFN A;  1GO3 E;  1VQN A;  4KN4 C;  3HS0 C;  3UE0 A;  4UHV A;  3I55 A;  4C3J H;  1YVC A;  1ENF A;  1BCP D;  1WTR A;  2KJX A;  2EIF A;  3VYT A;  5DEH A;  1PRT B;  2OTL A;  3EIV A;  1Y1V G;  4DR1 Q;  5DLQ E;  4OON A;  2IL8 A;  5GRO A;  1SMX A;  5K36 G;  4JC0 A;  5EBC A;  1STA A;  3NTH A;  2R3Z A;  3A8I E;  3I70 A;  1QUQ A;  1C4Q A;  2SDF A;  1WD0 A;  2GVB A;  4GKJ L;  1SLJ A;  4C1N K;  1WCM B;  4N9T A;  5LL6 S;  3A5Z B;  3CP0 A;  4KKT A;  2C9O A;  1VQ6 A;  4ALP A;  4BBS B;  3ZJY C;  3N52 A;  4J1M A;  1N33 L;  2WAQ G;  1PXU A;  3CPW A;  1XMQ L;  4NDX A;  3S2H H;  3FKI B;  4PMC A;  5KYI A;  3BZC A;  1BBU A;  1RIP A;  1A15 A;  1HQR D;  1VQ4 A;  4A4I A;  3S2D B;  1QVC A;  4HED A;  5FO9 B;  2F0G A;  5IT9 c;  5KNB A;  4GN4 B;  4GKK Q;  1XJV A;  2G9H D;  2E5L Q;  2VQF L;  3KBG A;  3EVQ A;  4PQX A;  2JA9 A;  3KF8 A;  4JBJ A;  2X69 A;  3DWQ A;  3S17 B;  1VQB A;  4WRD A;  5C6A A;  3DEO A;  4K2K A;  5BN3 A;  3J80 i;  1GUG A;  3HGB A;  5HGQ A;  3CW2 C;  4A3J H;  1EY8 A;  2IJ0 A;  3J7Y W;  1PH9 A;  1MI2 A;  2JN4 A;  2YTX A;  2XWB B;  2ZM6 L;  2DN8 A;  4MHE A;  3TP5 A;  2L9H A;  1NY4 A;  1H9M A;  4CDE C;  1STH A;  2MNA A;  4JI4 Q;  3EQL C;  5FLX c;  2OXP A;  1N36 Q;  4S3S A;  1XXG A;  3UDG A;  4LF5 Q;  1S40 A;  1PRT D;  1Y1V H;  4PG3 A;  2R7Z B;  4JI8 L;  3CQZ H;  1ET9 A;  2DNC A;  1KRT A;  1PHJ A;  3HOV H;  5K36 H;  3QR8 A;  4LFB L;  2FXQ A;  4CKE A;  4DR3 Q;  4DNI A;  1KLU D;  5CV4 A;  1EY4 A;  3I8Z A;  4A3B G;  4EGV A;  4HJA A;  5T1I A;  5C5L A;  4AQY L;  1IBK Q;  3A5U A;  1OXU A;  2EYP A;  4X3U A;  1PH4 A;  3HOU G;  4KHZ A;  1GVP A;  1LTI D;  2V4D A;  3S1Q H;  1LUZ A;  1HFG A;  2F0F A;  4C3H B;  3U9S A;  3BVG A;  1Q1B A;  4NPS A;  3GTK H;  3VR6 A;  4WOR A;  5G3L F;  2BA1 A;  1LTR D;  4OO1 I;  2MHV A;  3BYY B;  3S9W A;  4OWT B;  4B3R Q;  4RFB A;  1F9P A;  2IHE A;  1YHB A;  5J1Z A;  3Q22 A;  5M5W B;  3NWS A;  1WTH A;  3E0J A;  1TWF H;  1VQC A;  1SFO B;  4HSV A;  3M7G A;  2RSN A;  1O80 A;  1C7Y A;  1HZA A;  4A3L H;  4NXN L;  3OWE B;  1ICW A;  4DR5 Q;  2K52 A;  3D6C A;  1T5X D;  3Q6S A;  3DUZ A;  1WTO A;  2N3S A;  3QOL A;  2Z4H A;  3OSO A;  1BBW A;  2FIN B;  1L0X B;  3H6M A;  4O1N A;  1RCV D;  2K33 A;  4UP7 A;  1DZ1 A;  3E5S A;  3IFD A;  3ER0 A;  2RDH A;  4GS3 A;  1I5F A;  3S1N B;  2WAQ E;  3T1Y L;  4CBV A;  4DUZ Q;  3NP8 A;  3U4V A;  3V05 A;  5HGT A;  1B4O A;  1JIC A;  2F3W A;  1OO9 B;  1QVG A;  1Z47 A;  2GN5 A;  2RSO A;  4LW1 A;  5M3M H;  4DV4 Q;  2A6H D;  5IYC G;  5EKK A;  5BR8 Q;  5J3B A;  3STB C;  1X56 A;  3CKI B;  4R8I A;  1B7Y B;  2XRS D;  3JAM i;  1FD7 D;  4BY1 B;  2LMC B;  4YCV A;  4A3E B;  4HMJ A;  2AKW B;  3VR4 A;  4A3B H;  5CV7 A;  2HUG A;  1QWY A;  1F9Q A;  3FMC A;  3OTO Q;  4FF1 A;  1I6H H;  2WKC A;  3GTQ H;  1KXL A;  1FYC A;  1EWC A;  3RZO H;  2KHJ A;  3PF5 A;  1QZG A;  1DD2 A;  4Y7N B;  2AMC B;  3UE1 A;  3KK7 A;  3MWY W;  1WFQ A;  1HNX Q;  3S16 H;  1FL0 A;  3DWP A;  1EQT A;  1Q81 C;  1TWC H;  4HCE A;  4A3M B;  2JA6 H;  4L5Q A;  4QGU A;  1HZC A;  4DR7 L;  2KHS A;  1X65 A;  2HD3 A;  5C3W A;  1VQ5 A;  4IPH A;  1TXY A;  2NVY B;  1VQF A;  1JOO A;  3IKJ A;  3NTI A;  1HA6 A;  2K32 A;  5CC4 A;  2HHH L;  2Z6K C;  2KQ3 A;  3TBI B;  1HNZ L;  1TWH B;  1WTW A;  3NBI A;  5GQO A;  4CKC A;  2RCN A;  4B3S L;  4CDF C;  1DON A;  1MD2 D;  3CU7 A;  4BBR H;  3GTG H;  3C3L A;  4OL7 A;  2ZJQ A;  2DY7 A;  2EQS A;  4FXD A;  1LTT D;  3I2Z A;  2EY6 A;  1WVL A;  2IX0 A;  4IPD A;  4A3I B;  1JJG A;  2VUM B;  4RGT A;  3X3M A;  1XX8 A;  1HRJ A;  1B3Q A;  1VQA A;  3DM3 A;  2WKD A;  5I6Y A;  5ELF A;  4K0K L;  3HKZ G;  4XT3 B;  2ZTD A;  5IYD G;  3PF4 A;  1ZYR D;  4LK1 C;  4QQB X;  5KYL A;  1QOH A;  5ELC A;  2JA8 H;  1I50 H;  2R6G A;  1N33 Q;  5IYC H;  1KL9 A;  3G4S A;  5CBA E;  4JK1 C;  2K5V A;  4OIJ A;  4DXG A;  1JOQ A;  2LS0 1;  3T56 B;  3K5M A;  3W3A A;  3RN5 A;  4O2D A;  5M3F B;  1YNJ C;  1UEB A;  2MJ8 A;  1ASY A;  1Q90 A;  3X3N A;  1R4Q B;  1N9W A;  1YJW A;  1IKM A;  2CFM A;  1FR3 A;  1HR0 W;  1N34 L;  2NVT H;  1KNE A;  1QIL A;  4FF4 A;  3VR3 A;  4DV1 L;  1MBY A;  1S5E D;  2ID0 A;  2VXW A;  1GUW A;  5C44 B;  1KTK A;  4ZCK A;  1Q46 A;  2F3V A;  2VQF Q;  1HNW L;  3CCE A;  1WI5 A;  4PZ7 A;  1VQ7 A;  3EN2 A;  5IGF A;  1Q8I A;  1NBW A;  1AE3 A;  3GDE A;  1GXD C;  3L9A X;  2QCP X;  1A63 A;  2BDN A;  3J80 c;  4N9P A;  5IOD A;  1RL2 A;  2R93 B;  1PZK D;  1XWE A;  2R92 G;  1QNK A;  3PQI A;  2QKI C;  2Y0S G;  3K7A B;  4XQN A;  4AYB B;  2A6E D;  2D0O A;  5GAD C;  2ZXR A;  4CKB A;  2VQE Q;  3HOY H;  4OX9 L;  2K01 A;  5JPM C;  2QIL A;  2VL6 A;  5FLX E;  1EL0 A;  2AUK A;  3T51 B;  5BN4 A;  3R93 A;  3HOZ G;  4JI8 Q;  4I7A A;  4BY7 G;  1MGS A;  5C4J B;  1SJH D;  4GLX A;  2JEA I;  4QY7 A;  4LFB Q;  4CDC C;  2E2H B;  5IIF A;  2Z6K A;  1EY0 A;  1SJE D;  1CK1 A;  1Y1W H;  1GUS A;  2K03 A;  1UWV A;  1ASZ A;  2JEB I;  1G2T A;  2CW0 D;  2XIW A;  2IY5 B;  1SYD A;  3FEW X;  1S3O A;  4KY6 A;  1AW7 A;  1X3Q A;  4IO9 A;  4JI0 Q;  3S1M B;  3PO2 B;  4KK7 A;  5IWA Q;  3G71 A;  2K14 A;  1FVI A;  2L12 A;  1R9T H;  5F2D A;  4OIK A;  3RLF A;  4C2M H;  5A2Q E;  3RUZ A;  5J39 A;  4TSS A;  2J7Z A;  2KCC A;  2WV6 D;  1E24 A;  3PSI A;  3K81 C;  1BNZ A;  3BG3 A;  3AEV A;  4A3D H;  3GTO H;  3BU2 A;  4A3F G;  4JYA Q;  3K7U C;  1IW7 D;  4NXN Q;  4V0B A;  2FMM A;  2BH8 A;  1UAP A;  2N88 A;  1XYI A;  2I07 B;  1JQY D;  2E5L L;  2WB1 E;  2OTJ A;  4X3S A;  2A5H A;  3AU7 A;  3HKZ E;  2DGY A;  2NN6 G;  3A8K E;  3P20 A;  2YU9 B;  4EQN A;  1Z7T A;  1ZKO A;  1YNN C;  4JCV E;  4B3M Q;  1E2V A;  1K8O A;  3T1Y Q;  3KF6 A;  1HPC A;  1JB3 A;  1RF2 D;  3PIP A;  1Q86 C;  1MKH A;  1H9J A;  2QF7 A;  3OIQ A;  2IWH A;  2B63 G;  1NE3 A;  3JAM c;  3HOZ H;  4BY7 H;  3KDF A;  1CKM A;  2KEE A;  3H0G G;  1IYJ B;  4ID6 A;  4C3I B;  3GTM B;  1UE1 A;  4JI4 L;  4HIK A;  1N36 L;  4XT1 B;  2E8G A;  2CVR A;  2EJF C;  4LF5 L;  3RNU A;  4ULL A;  1GD7 A;  1K83 H;  1CT1 D;  3RZD B;  2L15 A;  4O42 A;  2HQL A;  2F4V L;  4RCN A;  5LMN L;  1SE4 A;  1CHP D;  1TII D;  4DR3 L;  5ELN A;  3H09 A;  1PTO C;  5C0X H;  4A3C G;  2AQ2 B;  1ICF B;  1A3T A;  4GZY C;  1D7Q A;  2F0W A;  1TR5 A;  3K0X A;  4L8J A;  4FYD A; 
#chains in the Genus database with same CATH homology
 2GVB A;  1K3R A;  4GKJ L;  2Y0S E;  1SLJ A;  4DR7 Q;  1JJ2 A;  4A3M G;  3CC4 A;  1QZH A;  4P71 A;  1VQM A;  3U4Z A;  2N8N A;  2CKZ B;  3A5Z B;  4JBK A;  3CP0 A;  4LF8 L;  1QUQ B;  3CPF A;  1K8A C;  4LFC Q;  2UXD Q;  4XIG S;  1VQ6 A;  4ALP A;  5C4X G;  5IP9 G;  3ZJY C;  1K0R A;  3I7F A;  4TQU S;  1YIT A;  1N33 L;  2WAQ G;  1E22 A;  3WWV A;  3CPW A;  5HY6 A;  4DV3 Q;  1XMQ L;  1H95 A;  1O7I A;  5M5W H;  1X55 A;  4A76 A;  3I4N G;  1VQE A;  2UXB Q;  2MFI A;  5JJL A;  2Q2I A;  3S2H H;  1KC8 C;  3BZC A;  1SFO H;  2R7Z G;  4BXX H;  1BBU A;  4A3F H;  2F52 A;  4R4C A;  1RIP A;  3UDX A;  5AJ3 L;  4DK6 C;  2ATW A;  1JJC B;  3TS2 A;  4L5R C;  2Q2U A;  3M9B A;  1VQ4 A;  4L5T A;  4A4I A;  5C0X I;  1QVC A;  2ALY B;  4X64 L;  1PV4 A;  4BA1 I;  1L1O C;  1M1K C;  4APV A;  5IT9 c;  3ULJ A;  1J5E Q;  4A3G H;  1P16 A;  1I3Q H;  1NMF A;  2PI2 E;  4GN4 B;  4GKK Q;  3AQQ A;  4A3I G;  1XJV A;  5C0X G;  2E5L Q;  2VQF L;  3J81 i;  4JV5 Q;  3K8A A;  2OCE A;  3OYY A;  2JA9 A;  4P72 A;  2BH2 A;  3CF5 A;  4JBJ A;  5FJ8 H;  2AWO A;  2H5X A;  4OXP A;  3S1N H;  4YCW A;  1VQB A;  4LF4 Q;  1D8L A;  3HOU H;  4DR4 Q;  4IPC A;  2B29 A;  4JI5 L;  3AFP A;  4YWK A;  3ERS X;  4NXM L;  1VQI A;  2VNU D;  4GLV B;  3KF8 B;  2B63 H;  3KFU A;  4X65 L;  1PH1 A;  1Q8K A;  3NEN A;  2Q2T A;  3CAM A;  2IT1 A;  2Q2H A;  3J80 i;  5JEA J;  5M5Y H;  2XTI A;  3PGZ A;  5HGQ A;  3CW2 C;  5LMU L;  4A3J H;  1LYL A;  2UXC L;  1YEZ A;  4YCU A;  1PH9 A;  4BY1 H;  5M3F G;  2JE6 I;  2YTX A;  1XNQ Q;  2ZM6 L;  4X6A H;  1UE5 A;  1N34 Q;  2QEX A;  1NY4 A;  4A3E H;  1IL2 A;  4DKA C;  5H1S E;  3CC2 A;  2MNA A;  1VQ9 A;  1VS0 A;  4JI4 Q;  2NN6 I;  2YTY A;  1U0L A;  5IYB H;  5FLX c;  1N36 Q;  4X62 Q;  5C4J H;  1PYS B;  2BA0 A;  3GD7 A;  3UDG A;  1S40 A;  1K9M C;  4LF5 Q;  5LMN W;  1Y1V H;  4PG3 A;  1HNW Q;  4JI8 L;  2CWA A;  3CQZ H;  4HID A;  1WJJ A;  2MO1 A;  1PYB A;  4LF7 L;  1KRT A;  3HOV H;  2ASB A;  1PHJ A;  4JI3 Q;  4LFB L;  4Y7N H;  1Q82 C;  2FXQ A;  4DR3 Q;  3LGJ A;  4A3G G;  3JC6 6;  4DNI A;  3ICE A;  4WJ3 M;  4JI2 L;  4A3B G;  4JOI C;  2A8V A;  4X66 Q;  4LF6 L;  4IFD J;  3I4O A;  5FJ8 G;  4NB3 A;  2NVQ H;  4A3M H;  1Q12 A;  4HJA A;  4AQY L;  3GTJ H;  1IBK Q;  3A5U A;  1OXU A;  1PH4 A;  3HOU G;  4DV5 L;  1IBL L;  3KYH C;  4KHZ A;  1GVP A;  1VQP A;  1PH7 A;  4DR6 L;  3OW2 A;  1L2F A;  1LUZ A;  2KBN A;  2WB1 G;  2RF4 A;  2NVY H;  4PZ6 A;  5GAE C;  2ES2 A;  1BKB A;  1VCI A;  1Q1B A;  1X3G A;  2CWP A;  1EIF A;  3L0O A;  4NPS A;  4O0A A;  5IE8 A;  3T1H L;  3AFQ A;  3GTK H;  5EAY A;  3I4N H;  2K50 A;  1VQG A;  4GN5 A;  2BA1 A;  4A3J G;  4OO1 I;  1K8G A;  5M5X H;  1TWH H;  4OWT B;  2D0P A;  4BY1 G;  3NEM A;  1XMQ Q;  4B3R Q;  2LXJ A;  1HJP A;  2YV5 A;  4R1J A;  1W3S A;  4A3E G;  2IHE A;  2HT1 A;  1YHB A;  3E0E A;  4YY3 Q;  5AJ3 Q;  4B3T L;  1EQQ A;  1YHA A;  1TWF H;  4POF A;  4A3I H;  1VQC A;  2UUC L;  1P8L A;  2VUM H;  1A0I A;  3HOV G;  1C7Y A;  1HZA A;  4JI1 L;  2ZJR A;  4A3L H;  4DPG A;  1Y14 B;  3E9H A;  4NXN L;  4DR5 Q;  2K52 A;  4DV6 L;  1UE6 A;  4DV0 Q;  2UUA Q;  1A62 A;  4LWC A;  1XPR A;  2JK8 A;  2N3S A;  4LUV A;  1L1O A;  4LFA L;  1BBW A;  1UE7 A;  3GO5 A;  2E2I H;  3E9I A;  1XNR L;  4UP7 A;  3PO2 G;  3ER0 A;  2K5H A;  5JEA G;  4GS3 A;  4JI5 Q;  4UP9 A;  4NXM Q;  1L1O B;  1YJN A;  1I5F A;  4HIM A;  3M7N A;  2JA7 G;  2WAQ E;  3T1Y L;  4DUZ Q;  5M3F H;  3U4V A;  2KHI A;  3G6E A;  1SR3 A;  1YIJ A;  1TWA H;  1XTD A;  3PUX A;  2OQ0 A;  1QVG A;  1Z47 A;  2GN5 A;  3B6Y A;  3D31 A;  4LW1 A;  5M3M H;  1HZB A;  1X3E A;  5IYC G;  4DV4 Q;  3RLO A;  5C3E H;  1VQL A;  5BR8 Q;  4R4O A;  5J3B A;  3STB C;  3S1Q H;  1X56 A;  2ZM6 Q;  1B7Y B;  3UDF A;  3TRZ A;  4P75 A;  5FLM G;  3JAM i;  2NZH A;  5C44 H;  4DV2 L;  4RMF A;  4IFD I;  3S1R H;  1HR0 L;  1G29 1;  2N78 A;  2YTV A;  1IBM Q;  4YCV A;  3PUZ A;  4DR2 L;  1EYG A;  1SN8 A;  2AKW B;  1T9H A;  2PNH A;  3FHW A;  2CCZ A;  4A3B H;  2VUM G;  3M4P A;  3IRB A;  1JE5 A;  1MJC A;  4LF7 Q;  1YNX A;  4IFD G;  4GNX C;  3OTO Q;  3HOX G;  2JJQ A;  4DV7 L;  1PFS A;  4A3L G;  1I6H H;  3PUY A;  3GTQ H;  1KXL A;  4YHH L;  4A93 H;  1YHQ A;  4P73 A;  1EWI A;  2UU9 L;  3RZO H;  1I94 L;  2KHJ A;  3PF5 A;  1OXS C;  2C35 B;  3M85 A;  4IOC A;  1QZG A;  5E7N A;  3I4M H;  4DR1 L;  4HJ7 A;  2AMC B;  2KCM A;  3HKS A;  3UE1 A;  2R93 H;  2N49 A;  1WFQ A;  1HNX Q;  1PH2 A;  1FL0 A;  3PCO B;  4UP8 A;  2R7F A;  2D62 A;  4AQY Q;  1OTC A;  3S16 H;  3CD6 A;  4JOI A;  5IYD H;  3K7A H;  3SGI A;  1Q81 C;  1B8A A;  3F2D A;  3CCV A;  1TWC H;  1X54 A;  1DGS A;  4DV5 Q;  2JA6 H;  4L5Q A;  4DR6 Q;  3ULL A;  2ZJP A;  4QGU A;  2VW9 A;  1HZC A;  4MZ9 A;  4DR7 L;  1VQH A;  3CXC A;  1QVF A;  2QGQ A;  1X65 A;  3TEH B;  3T1H Q;  2JQO A;  2DUD A;  1Q7Y C;  1VQ5 A;  4IPH A;  1TXY A;  4R4I A;  3KJO A;  2K75 A;  2MO0 A;  2VQE L;  1PH6 A;  1BVS A;  1VQF A;  1PH3 A;  1PVO A;  5M3M G;  4IPG A;  3TS0 A;  1N32 Q;  5C3E G;  2E2H H;  1M90 C;  2HHH L;  4RG1 A;  2I5L X;  2Z6K C;  4DV3 L;  1TWG H;  1CKN A;  3RR5 A;  2F4V Q;  2I5M X;  3H15 A;  5LMN Q;  2HIV A;  5C44 G;  1S72 A;  1HNZ L;  4LF9 Q;  2UXB L;  2JA5 H;  5GQO A;  2RCN A;  1X3F A;  4B3S L;  4KHP Q;  2RHQ B;  1G51 A;  4B3T Q;  4GOP C;  3HOW G;  4BXX G;  4BBR H;  2UUC Q;  3GTG H;  4JI6 L;  1CKN B;  1VQJ A;  2ZJQ A;  2EQS A;  3I2Z A;  2NZO A;  3MXN B;  1Z9F A;  1AE2 A;  2IX0 A;  4IPD A;  4J15 A;  3GTL H;  4A93 G;  1JJG A;  3S1M H;  3PO2 H;  1PA6 A;  5ELO A;  4L5S A;  5JJK A;  2E2J H;  3I4M G;  4GKK L;  1AH9 A;  3NEL A;  1VQA A;  3DM3 A;  2CQO A;  1YJ9 A;  4JV5 L;  2JA7 H;  1KIX A;  2UUB L;  4LFA Q;  1PH8 A;  1GM5 A;  4JI0 L;  3HKZ G;  5IWA L;  1B70 B;  4K0K L;  1FGU A;  4LF8 Q;  2ZTD A;  5IYD G;  3J81 j;  3CCM A;  1E1O A;  4A3K H;  3PF4 A;  1U5K A;  3KOJ A;  3W1G A;  2PMZ E;  4QQB X;  4AYB G;  2JA6 G;  4DR4 L;  1FJG L;  1EUJ A;  2JA8 H;  2R92 H;  3PO3 G;  4DUY L;  1I50 H;  2R6G A;  1XPO A;  1N33 Q;  5IYC H;  1KL9 A;  3G4S A;  4EX5 A;  2R93 G;  3CCU A;  2K5V A;  1MJE A;  1JMC A;  5FLM H;  1CSQ A;  3RN5 A;  4O2D A;  1XMO L;  1UEB A;  1LM0 A;  3G48 A;  4QL5 A;  4JI7 L;  1C0A A;  1E7Z A;  1KAW A;  4HJ9 A;  1YI2 A;  1ASY A;  1YJW A;  1N9W A;  1WOC A;  1XNQ L;  2CFM A;  3Q8D A;  1N34 L;  1HR0 W;  3MEF A;  4TVA B;  4X64 Q;  2NVT H;  1V1Q A;  3HOX H;  2JA5 G;  3BJU A;  4DV1 L;  1MIU A;  1HR0 Q;  4JYA L;  4R4Q A;  4HJ5 A;  3J81 c;  2ID0 A;  4MNO A;  4DR2 Q;  4BBR G;  4HIO A;  3BZK A;  3TRE A;  1OXX K;  3F2C A;  1Q46 A;  2VQF Q;  2YU9 H;  1X6O A;  1HNW L;  4H02 A;  3CCE A;  1WI5 A;  4PZ7 A;  3W5O A;  1VQ7 A;  3EN2 A;  4XTC S;  4YHH Q;  1IXR A;  3K80 C;  2UU9 Q;  1I94 Q;  5IY0 A;  1NBW A;  3S14 H;  4Y52 H;  1AE3 A;  3GDE A;  4GNX A;  2I5H A;  4B3M L;  2MQH A;  1Q1E A;  1LTL A;  1L0W A;  4GLA C;  2A1A A;  1A63 A;  4X65 Q;  3AYH B;  3KJP A;  3J80 c;  4A3K G;  1IBK L;  1RL2 A;  4LUO A;  4GNX B;  2GVA A;  1KRS A;  3F2B A;  5LMU Q;  2NVX H;  1HZ9 A;  1VQ8 A;  3PUV A;  2JA8 G;  3L2P A;  2R92 G;  1G6P A;  1C9O A;  2UXC Q;  2Y0S G;  4ME3 A;  1GKH A;  4C3I H;  3GTM H;  2OQK A;  5GAD C;  2D0O A;  1VQK A;  2VQE Q;  3HOY H;  1SE8 A;  4OX9 L;  2VZA A;  3L7Z C;  2VL6 A;  2R7D A;  3RZD H;  4YWL A;  1OXT A;  3CCL A;  3F1Z A;  3HOW H;  4HJ8 A;  2HHH Q;  3H3V H;  4B3R L;  3HOZ G;  4JI8 Q;  4BY7 G;  4GKJ Q;  1JT8 A;  3DLL A;  1HNZ Q;  4GLX A;  2JEA I;  4QY7 A;  4LFB Q;  3CCR A;  4B3S Q;  4UY8 C;  4IJL A;  2Z6K A;  1VQD A;  2B3G A;  1K73 C;  4JBM A;  4YY3 L;  4POG A;  3S15 H;  5JJI A;  4JI2 Q;  1KHI A;  1EIY B;  3RN2 A;  4GN3 B;  1Y1W H;  4JI6 Q;  2KCT A;  1PH5 A;  3M3Y H;  1EQR A;  4AH6 A;  4LF6 Q;  1WYD A;  4AIM A;  1UWV A;  1YBY A;  4GOP A;  2JEB I;  1ASZ A;  2WP8 J;  4A75 A;  2VY3 A;  3TQY A;  2IY5 B;  1A8V A;  4DR5 L;  3PV0 A;  1IBL Q;  1S3O A;  1WCM H;  4DV0 L;  2UUA L;  2LSS A;  3CCJ A;  3PO3 H;  5IP7 H;  4IO9 A;  2UUB Q;  4JI0 Q;  4K0K Q;  5IWA Q;  2OWO A;  4QJF A;  4GOP B;  3G71 A;  5GAG C;  4BBS H;  2IX1 A;  1YZ6 A;  2K14 A;  3ULP A;  1OXV A;  1FVI A;  3FP9 A;  4LFC L;  2UXD L;  1CSP A;  3PUW A;  1FJG Q;  1R9T H;  3CME A;  4DUY Q;  4BA2 I;  2K5N A;  3FKI H;  3RLN A;  1J6Q A;  3RLF A;  4DK3 C;  3CC7 A;  4C2M H;  4DUZ L;  4IJH A;  3H3V I;  1KQS A;  3HOY G;  2K4K A;  3EBE A;  2PQA A;  3H0G H;  1XMO Q;  3W1B A;  2ZTE A;  3UDI A;  4DV4 L;  1E24 A;  3PSI A;  4JG2 A;  4JI7 Q;  3S2D H;  3S24 A;  5BR8 L;  3KLW A;  3K81 C;  2PQA B;  4JBW A;  3AEV A;  3I56 A;  2AHO B;  2QA4 A;  3GTO H;  4JI1 Q;  3BU2 A;  4A3D H;  4DV1 Q;  4R4T A;  1XPU A;  4A3F G;  4JYA Q;  3K7U C;  3STB D;  4NXN Q;  1J5E L;  2KEN A;  4DV6 Q;  2BH8 A;  1IBM L;  1Y1W G;  1EFW A;  4EQ5 A;  1HH2 P;  4OWW B;  3J7A 5;  3S17 H;  4LUZ A;  2E5L L;  2WB1 E;  2VS1 A;  2OTJ A;  4A3C H;  2A19 A;  3HKZ E;  2DGY A;  3OTO L;  2NN6 G;  1NTG A;  1EOV A;  2PI2 A;  1XNR Q;  1V43 A;  3CMA A;  3NBH B;  4LF4 L;  4QIW E;  4AYB E;  1WCM G;  4JCV E;  4B3M Q;  5C0X J;  1E1T A;  1SRU A;  2IHF A;  5IP7 G;  5GAH C;  4WJ4 A;  3J7Z C;  1NJI C;  3T1Y Q;  1IZ6 A;  3KF6 A;  1SRO A;  3HFZ B;  4BBS G;  1HNX L;  1CKO A;  4YWM A;  3U50 C;  4UPA A;  3PIP A;  1CUK A;  1KD1 C;  2LXK A;  2YYZ A;  1Q86 C;  4FDB A;  4KLK A;  1N8R C;  1MKH A;  5C4X H;  3F8T A;  5IP9 H;  1X9N A;  1E3P A;  2HIX A;  2WFW A;  3FKI G;  3KF6 B;  2B63 G;  1NE3 A;  3JAM c;  2V1C C;  3HOZ H;  2XGT A;  4BY7 H;  3KDF A;  1CKM A;  4OX9 Q;  3H0G G;  4DAM A;  1IYJ B;  4PZ8 A;  4DV2 Q;  3CCS A;  3M4O H;  4IOA A;  4DAY B;  1W2B A;  1UE1 A;  2R7Z H;  4JI4 L;  4HIK A;  1N36 L;  2AWN A;  2F3I A;  2E8G A;  4X62 L;  3U58 A;  2I0Q A;  3A74 A;  1N32 L;  4LF5 L;  1GO3 E;  1VQN A;  4P74 A;  3RNU A;  1GD7 A;  1K83 H;  3KDF B;  3CCQ A;  2L15 A;  4PMW A;  2HQL A;  2F4V L;  4A3D G;  5LMN L;  1V9P A;  4DV7 Q;  3UE0 A;  4LF9 L;  4JI3 L;  3I55 A;  3M4Q A;  4C3J H;  1JB7 A;  1YVC A;  4OO1 G;  2EXD A;  5IYB G;  4DR3 L;  2EIF A;  3GTP H;  4KHP L;  5ELN A;  4OWX B;  2ZTC A;  3A0J A;  2OTL A;  3EIV A;  1Y1V G;  4DR1 Q;  2RHS B;  1VQO A;  4X66 L;  5DLQ E;  4OON A;  4A3C G;  5GRO A;  1SMX A;  3VDY A;  5K36 G;  4JC0 A;  3PIO A;  4MTN A;  4KI0 A;  1D7Q A;  4LNQ A;  2Z0S A;  4C3H H;  1QUQ A;  3K0X A;  1NMG A;  3D0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...