1HNXL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hnxL00
3DLLA 3BZCA 4DAMA 2K52A 4NPSA 1K3RA 5C0XI 2VW9A 3PGZA 4OX9Q 4QIWE 1S40A 2MQHA 2N49A 3EBEA 2I0QA 3SGIA 4C2MH 4X64Q 1VQIA 5LMUL 4HJ9A 4A4IA 1QUQA 4IJHA 3IRBA 5C4XH 4B3MQ 2PMZE 1FJGL 2F52A 3RLNA 4DPGA 5IP7H 1IBLQ 3G71A 2UUAL 1N32Q 3PF4A 1UE6A 4JI8L 1WI5A 4IFDI 1KAWA 2NZHA 4DK3C 4DV4L 2XGTA 1Q1BA 2K5NA 5C0XG 2ZJQA 3KLWA 4JBKA 4A3EG 2QGQA 2Q2TA 3UDIA 4LF8Q 1X55A 4BBSG 1HNXL 4QJFA 1EQRA 2JEAI 4R4OA 4P72A 1AE2A 4JYAQ 4XTCS 1UE7A 4R4TA 1V9PA 2MO1A 4DV2L 3KDFB 1X6OA 4GOPC 4LFCL 4A3FH 4JI0Q 1NJIC 5BR8Q 1SRUA 3CCUA 3GTPH 3ULPA 1X9NA 5JJLA 1XJVA 3I4MG 2NVYH 5M3MH 4JG2A 4A3MG 4A93H 1Z9FA 4YCUA 4DK6C 3PUWA 4B3TQ 4JI3Q 3M7NA 2E2HH 3A0JA 3HOXH 1QZGA 4DUZQ 1NY4A 3BU2A 4AQYQ 3CD6A 3S1QH 4Y52H 4A3IG 1KXLA 4P75A 1YIJA 1LUZA 1Q8KA 4BXXG 4A3CH 3PIOA 3H3VI 3AYHB 1KC8C 2CKZB 1PH5A 1Y14B 2PQAA 3FHWA 4LF9Q 1N33Q 1V43A 1X3FA 1X3EA 2JA8G 1YBYA 1SE8A 3I2ZA 4DV3L 1XPOA 1CKMA 1RIPA 3PV0A 2IX0A 4JOIC 1EIFA 3AFQA 1U0LA 2UUCQ 4BA2I 5JEAJ 1VQCA 2GN5A 2EIFA 3FKIH 3OYYA 4APVA 2E2IH 2OCEA 3GTGH 1PV4A 1I3QH 2YU9H 3OTOQ 1VCIA 1D7QA 1XPUA 1E24A 2LXKA 4DR4Q 1D8LA 1A62A 1Y1VH 5IYCG 5GAEC 5AJ3Q 4IOCA 1YITA 1N34Q 2R92G 1XNRL 5C3EG 1IYJB 3LGJA 1IBMQ 3HOZH 4JI7Q 3RNUA 1T9HA 3ULLA 1WYDA 2I5MX 3CC4A 3HKZE 2HIVA 4DV7Q 1M90C 3S17H 2OWOA 3K0XA 4OXPA 3HOYH 2VQFL 4A3BH 4KHPL 1KHIA 1I94Q 3GTOH 2OQ0A 5C44H 1N8RC 1PH9A 1N36Q 5M5WH 2JA5H 2B29A 4DR1L 1YHQA 1NTGA 2DUDA 2EXDA 2JQOA 4JI2Q 1W2BA 1GM5A 1HNZL 2R6GA 1FGUA 4R4QA 5IWAL 5IYDG 1XMOL 4A3GG 4HJ7A 4WJ4A 1VQMA 3PF5A 2UXCQ 2UXDL 3NEMA 1VQDA 1PH4A 3RLFA 3PCOB 2OTLA 2LXJA 3A74A 1CKNB 4R4IA 4NXNL 5JEAG 1C7YA 3L0OA 4DR5Q 4PZ8A 4FDBA 2Q2UA 4YCVA 2AMCB 3AQQA 1BBUA 1A8VA 4DV0Q 4GNXA 1JJCB 3W1GA 3I56A 1XMQQ 3KF6A 2AKWB 4DV6L 3H0GH 4H02A 1W3SA 3PO2G 4PG3A 5IYBG 1M1KC 4MTNA 2VNUD 2K5VA 2KENA 1XNQQ 4JI5L 2PQAB 5DLQE 1VQJA 1Q46A 1EFWA 2YV5A 3AFPA 4BBRH 3J81j 5LMNQ 1VQ8A 4K0KQ 2BA0A 3HKZG 1YEZA 4YHHL 4A75A 2ZM6L 1BVSA 2JK8A 3GTLH 4DR6Q 2UXBQ 1TWGH 1HZ9A 3L7ZC 2BH8A 3CMEA 1K83H 1HH2P 1E3PA 3GTJH 4DV5L 1VQLA 5JJKA 4ALPA 1SFOH 3AEVA 2YTXA 4A3JH 4POGA 2ZTCA 4NXMQ 1Q82C 4A76A 1JMCA 1A0IA 3UDGA 2JA7H 1AE3A 1JE5A 3A5ZB 2E8GA 3I4OA 3J80i 5M5YH 1KL9A 3K81C 3STBD 1HR0Q 4JI4L 4IFDJ 1GO3E 1X54A 4QY7A 4Y7NH 4DUYL 1PHJA 4AH6A 4DR3Q 3K7UC 4JBMA 1HZAA 3HKSA 4LF5L 4GN3B 3CC2A 1JT8A 3D31A 4JI6L 1EQQA 1YZ6A 2IT1A 3JAMi 5LMUQ 3F8TA 3UE0A 4AYBE 4EQ5A 2NVTH 1PVOA 2QA4A 5FJ8G 1DGSA 1S3OA 1L1OB 1FJGQ 3RR5A 3CCMA 2HHHL 3KFUA 3CQZH 2UUAQ 5GADC 5IY0A 2JJQA 4JI8Q 4IPHA 4DV4Q 2NN6I 2WB1E 4C3IH 2ID0A 1HNWL 5JJIA 4TVAB 1SROA 4LFAL 1OXXK 4A3DH 3PUXA 2F4VL 4YWMA 4JI1L 3L2PA 1HNXQ 5M3MG 2VQEQ 4JV5L 1I5FA 4ME3A 3U4ZA 1V1QA 3CC7A 3OW2A 1JB7A 1ASZA 3EIVA 1VQPA 3M4QA 4DV2Q 4GKKL 1AH9A 1PH1A 4LFCQ 2HQLA 1K0RA 1E7ZA 4HIKA 1IL2A 3HOUH 1EOVA 3RZOH 4HJ8A 4LFBL 2YTYA 3UE1A 1C0AA 3UDXA 4P71A 1JJGA 4IFDG 2JA6H 4IJLA 5E7NA 2AWOA 3STBC 1FVIA 4C3JH 2D0OA 2MNAA 2R93G 1TXYA 3T1YL 3HOVG 2WP8J 4DV1L 1K9MC 2E5LL 2K50A 2MFIA 4AYBG 4LWCA 1S72A 1VQ4A 3M4OH 4LF4L 1QVCA 3GD7A 4AIMA 4IOAA 3CXCA 4PMWA 2ZTDA 1EIYB 2AHOB 2RHSB 3PO3G 3GO5A 2WB1G 4OWTB 3G4SA 3MXNB 4KLKA 2D62A 1P8LA 3S24A 3U58A 3PUVA 4R4CA 1VQOA 4GLVB 1YJWA 4B3SL 4YWKA 1YHBA 4QL5A 4DV3Q 4OO1I 5FLXc 1O7IA 3K80C 4UY8C 4QGUA 2VS1A 3TREA 2NVXH 1B8AA 4BBSH 1Y1VG 2A1AA 4GN5A 1L1OC 4L5RC 3TEHB 2KHIA 3HOZG 2Z6KC 3I4NG 1QUQB 3PSIA 3T1HL 2B63G 1TWFH 1L0WA 4B3RL 3B6YA 4C3HH 4O0AA 3GTQH 4A3BG 2CQOA 2VUMG 1Q12A 1OTCA 3KF8B 4GS3A 4NB3A 5C44G 2FXQA 4HJ5A 3I4MH 3UDFA 3S14H 2AWNA 4GOPA 4A3MH 1PH7A 1HR0W 1XNRQ 5K36G 4LF7L 1VQEA 4LNQA 3BJUA 1WCMH 3E9HA 1BBWA 1XPRA 5HGQA 2OQKA 5IP9G 1E1OA 1GVPA 2KCTA 4KHZA 1IZ6A 2QEXA 2DGYA 4POFA 2VQFQ 1IXRA 3CPFA 4A3LG 1JJ2A 4KHPQ 1KQSA 2R7ZG 3CCRA 1J5EL 4DR1Q 4A3KH 4X65L 3DM3A 1HNZQ 4EX5A 5IWAQ 2WFWA 2GVBA 1XMOQ 4LUOA 4YCWA 5EAYA 4DR7L 2JA8H 3J7ZC 2UXDQ 1J6QA 1I6HH 4NXNQ 4OWWB 3WWVA 5FLMH 1CSPA 3ICEA 4PZ6A 2A8VA 3J81c 2WAQE 3M4PA 4IPGA 4DV6Q 2EQSA 3J7A5 5IE8A 1HZBA 1KRSA 4JI5Q 4YY3L 4BY7H 4JOIA 1TWHH 4LF6L 3CP0A 4UPAA 4X6AH 1SMXA 2KHJA 3MEFA 2R7FA 3G48A 3F2BA 3GDEA 2VZAA 5IYCH 2KBNA 4YHHQ 1PFSA 5C4JH 2R92H 4X66L 2ZM6Q 4UP8A 1C9OA 2UUBL 3S16H 3S15H 1FL0A 4KI0A 4DV5Q 3M85A 4GN4B 3U4VA 1YI2A 4IO9A 2PI2A 3FP9A 1VQAA 2VL6A 4BY1H 2N78A 4JI4Q 3S2HH 1IBKL 3ZJYC 5C4XG 4DUYQ 2LSSA 4X62L 3PUYA 5IP7G 1Q81C 1MJEA 4LF5Q 3TS2A 4A3GH 3CAMA 1E1TA 2NZOA 1CUKA 2WAQG 4JI6Q 1GKHA 5M3FH 1K8GA 4GKJL 1MJCA 5GQOA 3GTMH 2K5HA 2HHHQ 2KCMA 3S1RH 1EUJA 1TWAH 1NBWA 4PZ7A 5GROA 5IYBH 4A3FG 1Y1WH 3PO2H 1HNWQ 3PIPA 4DNIA 3F2DA 1PH6A 4JC0A 4DR2L 4LFAQ 2IHFA 1X65A 2F4VQ 3GTKH 4JI1Q 2H5XA 3I55A 3HOWH 1I50H 1X3GA 3ERSX 4JV5Q 3KJPA 1VQGA 4GKKQ 4XIGS 4A93G 1B7YB 4LUZA 2BH2A 1N9WA 5ELNA 4RMFA 2RCNA 2UU9L 3HOXG 4LFBQ 4GNXB 3RN5A 3RLOA 2CCZA 1U5KA 3KF6B 2XTIA 2ZJRA 2F3IA 1OXSC 4L5SA 2NN6G 4OX9L 1VQFA 1PA6A 4A3CG 2MO0A 1YVCA 4L5QA 4X64L 4LUVA 1TWCH 4BXXH 3D0FA 3T1YQ 1VQ5A 4DV1Q 4B3ML 3M9BA 1SR3A 2I5HA 3EN2A 1UEBA 1IBLL 2E5LQ 1N32L 1VS0A 3E0EA 4LF4Q 1Z47A 2BA1A 1PH8A 1NMFA 1VQ7A 3K8AA 2A19A 2VQEL 1UE5A 4LF8L 5GAHC 2B3GA 5FJ8H 2ES2A 4JYAL 2RHQB 4MNOA 1RL2A 1Q86C 3FKIG 1PYSB 1G51A 4B3SQ 3G6EA 4J15A 1VQ9A 4LW1A 2Y0SE 3H15A 4JI0L 1H95A 4TQUS 5BR8L 5J3BA 2CFMA 3CCSA 3RZDH 2GVAA 1VQBA 4A3EH 1X56A 5LMNW 1UWVA 3CCLA 3S1NH 1WCMG 3CW2C 4UP9A 4HIMA 4B3TL 1OXUA 1SN8A 4JI3L 3T1HQ 3F1ZA 1E22A 1CKNA 1MIUA 4B3RQ 4DUZL 4AQYL 2I5LX 1PH2A 3HOYG 2HT1A 1KRTA 3F2CA 2K14A 4DKAC 4OO1G 4A3KG 1Q7YC 2JA5G 4LF7Q 1VQNA 1G291 2R93H 2Z0SA 1BKBA 3S2DH 3HOVH 2C35B 3CMAA 1A63A 1PYBA 4QQBX 4GNXC 1GD7A 1VQKA 4LF9L 1N33L 1LTLA 3W5OA 2ASBA 1CKOA 1WJJA 5FLMG 2JEBI 4A3IH 2ZJPA 3PO3H 5IT9c 3VDYA 1J5EQ 3E9IA 3KYHC 4DAYB 2Y0SG 2N3SA 4JCVE 4YWLA 4X65Q 2L15A 2IX1A 2N8NA 1YHAA 3NBHB 3KJOA 2UUCL 2Q2IA 4DR7Q 3H0GG 4BY7G 3W1BA 2K4KA 5ELOA 2YTVA 3TQYA 2VY3A 3OTOL 3JC66 1P16A 5HY6A 4BBRG 1XTDA 3S1MH 4DR4L 2PNHA 5AJ3L 3J80c 1B70B 1WFQA 4GLXA 2K75A 4HJAA 1K73C 2ALYB 1N34L 3I4NH 1IBML 4JI7L 4YY3Q 1WOCA 1QZHA 2B63H 1HJPA 2RF4A 3H3VH 3RN2A 4LF6Q 3CCEA 4DV7L 1VQ6A 2VUMH 4MZ9A 1ASYA 2CWAA 1L1OA 4BY1G 3ULJA 3CCQA 4A3JG 1I94L 1NMGA 1SLJA 2PI2E 2Z6KA 1VQHA 4O2DA 1OXTA 3JAMc 4HIDA 1N36L 2R7DA 3I7FA 4X66Q 2JA7G 1KIXA 2UUBQ 1Q1EA 4JI2L 4BA1I 5C3EH 2V1CC 2NVQH 5IP9H 4JBJA 4OONA 3TRZA 2Q2HA 2UXCL 1CSQA 1YNXA 5M3FG 4A3LH 2JE6I 5H1SE 2R7ZH 3PUZA 2IHEA 4R1JA 1HZCA 4DR5L 3BZKA 1IBKQ 1LM0A 3KDFA 3A5UA 1G6PA 4DV0L 3CCVA 4X62Q 2E2JH 1Y1WG 1YJNA 1XMQL 1QVFA 4GOPB 1LYLA 5IYDH 1NE3A 3TS0A 1XNQL 3HOWG 4A3DG 3NENA 5GAGC 1KD1C 4GKJQ 1EWIA 4GLAC 1QVGA 2IY5B 3CPWA 3M3YH 4UP7A 2HIXA 2YYZA 3K7AH 4P74A 5LMNL 1EYGA 3HFZB 3NELA 4K0KL 5C0XJ 1OXVA 3CF5A 1UE1A 4IPDA 3HOUG 1L2FA 4DR6L 2UXBL 4IPCA 2OTJA 4DR2Q 2ZTEA 3KOJA 4WJ3M 4OWXB 4HIOA 1MKHA 3CCJA 1R9TH 3ER0A 3U50C 2JA9A 1YJ9A 4P73A 1PH3A 2ATWA 2JA6G 5M5XH 4NXML 3J81i 2D0PA 1K8AC 2CWPA 1HR0L 4L5TA 2UU9Q 4JBWA 4RG1A 3Q8DA 4DR3L
chains in the Genus database with same CATH superfamily
2DNCA 4NPSA 1EY9A 1K3RA 2E2DC 2F0SA 3BVZA 2MQHA 4C2MH 5LMUL 4HJ9A 1QUQA 2I07B 5C4XH 2F52A 2RQXA 5IP7H 3PIO3 2EJFC 1N32Q 4IFDI 2O5IC 4EQPA 4JBKA 4M8AA 4A3EG 2QGQA 4BBSG 5TSSA 1HNXL 2WV6D 1SDFA 4R4OA 4P72A 4JYAQ 2B2YA 2FINB 4DV2L 3FPPA 2F0EA 2KOLA 1B1ZA 1SRUA 3CCUA 1A3TA 3ULPA 2OEOA 1IKLA 3NK9A 1CK1A 3I4MG 5M3MH 4JG2A 1QJOA 4A3MG 4DK6C 1B53A 3DWQA 3PUWA 2BDNA 1O7YA 1NY4A 3BU2A 3S1QH 1WD0A 1PFBA 1I4XA 1Q8KA 2NWGA 2RA4A 2EYHA 3H3VI 2M9VA 2CKZB 3KLSX 2EJGC 4LF9Q 4ZLTF 5ELBA 1X3FA 1X3EA 3TSSA 1RTOA 1XPOA 1RIPA 3PV0A 3GP7A 2IX0A 2JXMB 1DXMA 1U0LA 2XRQD 5EPJA 3GTGH 3NTIA 2Z1CA 3OIPA 1WTXA 3D4WA 1JC7A 3RMHA 1N34Q 3NWTA 4AYBB 2PQEA 1II3A 1IBMQ 3EVQA 4XYQA 2F0TA 3PO3B 2L55A 2HIVA 1F9SA 4KTAA 3K0XA 3HOYH 4L8JA 2GA4B 3K5LA 2OQ0A 5LL6S 3F2UA 4DR1L 1NTGA 4JI2Q 1HNZL 5FKAC 1FGUA 1K28A 5IWAL 1KAAA 1VQMA 1FNUA 1VQDA 1PH4A 5JEAG 4HAEA 3HOZB 1C7YA 4YCVA 3AQQA 2EY2A 3QIAA 3W1GA 3S17B 5EPKA 1XMQQ 4DV6L 4H02A 4A3BB 1W3SA 3N6RA 1M1KC 2KCCA 5C44B 4MTNA 4XDXA 4FF1A 1BF4A 2F0NA 1EZ8A 2PQAB 5DLQE 4DNRB 1Q46A 3AFPA 4KN4C 1HQMC 1YEZA 4A75A 2K33A 4DR6Q 4LMQD 3I91A 4RFBA 4XQQA 3L7ZC 2BH8A 1RF2D 3AEVA 4MIUA 1SMYD 2YTXA 4A3JH 4POGA 2ZTCA 3PQIA 4A76A 2E2JB 5G3LD 1AE3A 1KL9A 3STBD 2JN4A 1B4OA 1X54A 3BS1A 4DUYL 1PHJA 4JBMA 1HXYD 3HKSA 4GN3B 1TIID 2MPMA 3TP6A 2EYPA 3K7AB 3X3NA 1CQVA 2IT1A 3UE0A 5LL6X 1DGSA 3RR5A 5J22A 3KFUA 3CQZH 2JJQA 1D1IA 3KF8A 1WTVA 5M5XB 1SROA 1OXXK 2F0PA 3RUZA 4Y7NB 4JV5L 4ZCKA 3A7AB 2NTTA 3H3VC 3OW2A 1ASZA 4Q0FA 3H6MA 3M4QA 1VQPA 4LFCQ 1G8ZD 3P7JA 2C9OA 3VA7A 2YTYA 1SMYC 1C0AA 1JJGA 4IFDG 1K8MA 4TRDA 3C46A 1CFMA 5E7NA 3STBC 1FVIA 4C3JH 1KTKA 5D14A 3T1YL 1GUNA 4DV1L 1K9MC 2E5LL 2K50A 5DNFA 4AYBG 3A54A 3M4OH 4DFAA 4LF4L 3GD7A 5E3FA 2ZTDA 3PO3G 2B2TA 1Q90A 4RGMA 3PUVA 1VQOA 1YJWA 2F0QA 2EYMA 1XTCD 1KDBA 1YHBA 2NVYB 4OO1I 1JE4A 3HRZC 4DXFA 4A93B 2VS1A 1Y1VG 2A1AA 1EZ6A 2E2HB 3HOXB 1SBBB 5F2DA 1JQYD 3HOZG 1V1PA 3NWSA 1TWFH 2J0TD 1L0WA 4B3RL 4A3BG 2CQOA 1OTCA 4GS3A 5C44G 2FXQA 3SK4A 4F87A 4HJ5A 3UDFA 3S14H 5EGTA 2H4OA 1WCMH 4XYOA 2F0IA 2EY6A 5EKIA 1DOMA 2VQFQ 1QG7A 2RVLA 1KQSA 1TR5A 4A3KH 4X65L 4HMJA 2YU9B 2R3ZA 3BDOA 4RHSA 5CBAE 4EQNA 2G5DA 5BN4A 3ICEA 4PZ6A 5IGBA 2A8VA 2WAQE 4O1NA 4ZUJA 4QF4A 4MN3A 3GTOB 4BY7H 4JOIA 2L0CA 5M5WB 2JA5B 3PIP3 1QNKA 2KBNA 4YHHQ 1PFSA 2R92H 4I65A 1FL0A 4XT3B 3M85A 4IUQA 4PMBA 2F0OA 1EEFD 1HQRD 1VQAA 4BY1H 1WTWA 2MP1A 1IBKL 1M4VA 4X62L 4RCNA 1WTRA 1IW7D 3P20A 1E1TA 3IFTA 1CUKA 4BBRB 1A6XA 3D3RA 1SE3A 3NBIA 4J1MA 1BCPD 2K5HA 2D5DA 3J81L 3GTJB 4CKCA 1EUJA 1TWAH 1NBWA 1Y1WH 1SFOB 3VYUA 3F2DA 1UNSA 1TS3A 3E0JA 3GTKH 4JI1Q 5IOCA 3HOWH 3ERSX 3QO2A 3LNNA 2H1EA 3I72A 4A93G 5I9OA 2BH2A 1PTOB 2B8GA 5M3FB 4RMFA 2UU9L 3HOXG 4LFBQ 4GNXB 3JAME 2CCZA 2K05A 2NVTB 1JOQA 2F3IA 2ZXOA 1KLGD 1PA6A 4A3CG 4IQZA 1TWCH 4BXXH 4L6TB 3E5SA 4KN7C 1PTOF 3BVGA 5E4WC 1VQ5A 4G57A 1IW7C 3EN2A 1UEBA 1N32L 3E0EA 2C5CA 5D3IB 3BDLA 3K8AA 2VQEL 1BCPC 5KIXA 2B3GA 1DD2A 1ZXTA 2ES2A 4JYAL 2CH4W 2RBMA 4FXGC 1G51A 1H95A 1EYAA 2Y0SE 3OWFA 4LW1A 2JA6B 2MUYA 4ZKBB 2GVAA 2XVSA 5C0XH 2LMCB 1UWVA 3CW2C 5KNBA 4HIMA 3ERQA 1U4RA 3F1ZA 1AW7A 4E6IA 1PH2A 5I2YA 3F2CA 1YNNC 2K14A 4OO1G 2JA5G 1VQNA 3QOLA 3NHHA 2C35B 3CMAA 4GNXC 4LF9L 3S1NB 2ASBA 1CKOA 2JEBI 1J5EQ 3W2DA 4DAYB 3T51B 1YHAA 4DR7Q 2NBFA 4IN3A 1A2UA 2K4KA 5ELOA 3VYTA 2VY3A 2O5JC 1EL0A 1U4LA 2EZVA 2F03A 4BBRG 1XTDA 3S1MH 1N34L 4ZKCB 4DU9A 1GXDC 1RODA 1DM0B 1IBML 3A8JE 4YY3Q 2VB3X 3HEJA 1VQ6A 2VUMH 4NKLA 2PNRC 4JK1C 3ULJA 3CCQA 4M1UB 2Z6KA 4O2DA 1OXTA 3A8KE 1KIXA 2P5ZX 4JI2L 5T1IA 4CJ0B 1I6HB 3TRZA 1KLUD 2X69A 1PFNA 5IODA 1SAPA 1YNXA 5M3FG 5DM63 1QILA 2R7ZH 5A2QE 1SNCA 2B39A 1HZCA 5IT9L 3KDFA 1G6PA 1TWHB 4FF3A 1XMQL 2F0HA 5IYDH 3T13A 1NE3A 1O78A 2L1BA 1HFGA 1HUMA 4GLAC 4ZUIA 5C4ZA 5C3EB 4UP7A 2YYZA 4P74A 3S16B 1A2TA 3S15B 3NELA 2F0WA 2JSOA 3J80L 2DNEA 4DR6L 2ZTEA 2RDHA 2HCIA 3KOJA 2ENBA 3AU7A 3MXNA 1MKHA 3CCJA 1R9TH 2JA6G 2MJ8A 1Q3LA 1W6JA 2JYOA 5KNDA 1VMPA 1O80A 3Q8DA 1ET6A 4KD3A 2K52A 4DXGA 2VW9A 2I0QA 3PO2B 3MVVA 2CHBD 2PZUA 2PMZE 2DY8A 3PF4A 1MSGA 5FO8B 1WI5A 1KAWA 2NZHA 4DK3C 2RSNA 5ELCA 1Q1BA 2PO4A 3KLWA 3UDIA 1WTPA 1EQRA 2JEAI 4RWSC 5BN5A 1UE7A 3EA6A 2WKCA 1X6OA 4QCLA 4LFCL 3T53B 1A3VA 4C2MB 1NJIC 4JI0Q 3GTPH 4XT1B 1Z9FA 4YCUA 1C4QA 4B3TQ 4R9WA 3A0JA 1TKWB 3E6ZX 4Y52H 3NQTA 3VR4A 1E0BA 2NN6H 3QR8A 2Z8LA 2FJ2A 1RCVD 3AYHB 3DHQA 4DGZA 1PH5A 1Y14B 4CDEC 3RZDB 5M3MB 3NXWA 1CKMA 1AZQA 3AFQA 3CRLC 1EWCA 3TN2A 5FO9B 2A6ED 3HZXA 3FKIH 4X3TA 1R4PB 5E4XA 4APVA 2E2IH 1I3QH 3OSOA 2K7VA 5I6YA 1VCIA 2R93B 3S2DB 3HOVB 1Y8NB 5AJ3Q 5GAEC 4IOCA 1YITA 5C3EG 1EU3A 3LGJA 4JI7Q 1A3UA 3RNUA 1E2VA 1SSOA 1KABA 4OXPA 2VQFL 1I94Q 1N8RC 2D9UA 2B29A 1YHQA 2EXDA 4EGVA 5K36H 4R4QA 1CQFA 4HJ7A 2UXCQ 3PF5A 1R4QB 4KJNA 4RKBA 3RLFA 2OTLA 2LXJA 4NW2A 3A74A 2LS01 4PZ8A 4FDBA 2Q2UA 2AMCB 1A8VA 2A6EC 3OWEB 3KF6A 3H0GH 3PO2G 5IYBG 2VNUD 1LT5D 1VQJA 1S5BD 5DM73 3U9OA 1SYCA 2NVQB 3MXUA 1PLFA 4XXEA 4YHHL 2UXBQ 1QE6A 1HZ9A 3U9SA 1E3PA 5JJKA 5HURA 3CKIB 2OF1A 4IUPA 1I6VC 2PCFB 1A15A 2JA7H 1JE5A 1DZ1A 3V2TA 5M5YH 3MEHA 3K81C 1GO3E 3K7UC 5CV4A 4TSSA 1RD9D 3GV6A 1PZID 2K5QA 1HUNA 3D31A 4HCSA 4RAUC 2L9HA 3JAMi 3F8TA 2QA4A 5FJ8G 2XSCA 1PRTB 1D6EC 4B9WA 1CM9A 5GADC 5IY0A 4IPHA 5CV9A 2WB1E 4C3IH 2ID0A 2EOTA 5JJIA 3J81E 4TVAB 2WKDA 3PUXA 4YWMA 4JI1L 5M3MG 2VQEQ 1PRTF 1NUCA 3EIVA 3HS0C 1K0RA 3HOUH 4HIKA 1EQVA 1EOVA 3RZOH 4LFBL 4ILWA 3KUPA 4ID6A 2WIIB 3UDXA 3I4LA 2A5HA 1MGSA 5C5LA 1HA5A 4H0LC 2AWOA 2R93G 1LT6D 1TXYA 2WAQB 3OPOA 3HOVG 1FNWA 2WP8J 4UHVA 1QVCA 3FRPB 4AIMA 1B50A 1CHPD 3CXCA 5C4HA 4PMWA 1EIYB 1X32A 3IAYA 4A3FB 5EKLA 4OWTB 3G4SA 4RGTA 1TS4A 4KLKA 4CJ2C 4YWKA 5JVH3 4DV3Q 5FLXc 1O7IA 3K80C 3OW7A 3TBIB 4QGUA 2NVXH 1B8AA 4BBSH 1LTAD 1PRTC 4DAPA 3C2PA 3PSIA 1FNVA 3B6YA 4O0AA 3KF8B 3SK8A 5HGTA 3RD4A 3I4MH 2AWNA 5CYUA 1WTOA 4A3MH 1HR0W 1XNRQ 1JWMD 1BR9A 1BBWA 3ITPA 5IP9G 1E1OA 4KHZA 2RDFA 1RJTA 3BYYB 3BVMA 4K6DA 2SNSA 5A35A 1IXRA 5ISRA 1JJ2A 1SYDA 4DN4M 1J5EL 4RGOS 3G7LA 1AP0A 2NTSA 4HSVA 2E74C 4YCWA 5EAYA 4DR7L 2PYKA 1ONLA 1TS2A 4P2CB 1Y1VB 1WCMB 1EY7A 2PZTA 1KDAA 2L12A 3DM1A 1TVXA 2EQSA 2ZT9C 5IE8A 5FLXE 1KRSA 4JI5Q 4YY3L 2WINB 5JJZA 4A3KB 2KHJA 2M00A 4QUFA 2FMCA 2KQ3A 3R8BA 3KBXA 4UP8A 1LTRD 4KHVA 1V1PB 1HHVA 2Y0SB 2PI2A 3FP9A 2VL6A 1U9RA 4S3SA 4BY7B 3ZJYC 2K01A 1Q81C 2Q8IB 5IT9E 3EQLC 4U68A 2WAQG 2F0LA 2EDGA 3DXJC 5JEAH 1K8GA 2WACA 3GTLB 1H9MA 1EIHA 1TWGB 4J6HA 3SEBA 1K83B 2HHHQ 2KCMA 3S1RH 4A3FG 2HUGA 4BY1B 1PH6A 1CA6A 4LFAQ 1C48A 1I50H 1X3GA 3CRKC 4C3JG 4K8JA 3KJPA 2AQ3B 1G2TA 1N9WA 1PMRA 3RLOA 2EY5A 1U5KA 4L5SA 1S5FD 3V05A 1ESRA 1TWAB 1Y1WB 4L5QA 1M8AA 1UUPA 3BYTB 3D0FA 3HOWB 1DOKA 3M9BA 4RKLA 4A3DB 1SR3A 2I5HA 5EPLA 4NP5A 1Z47A 1EY8A 2KA7A 1E2WA 3EJIA 2R61A 3LWEA 4MNOA 1RL2A 3ND9A 1PYSB 1VQ9A 1GUOA 4JI0L 1ML0D 3OIQA 5J3BA 1VQBA 1X56A 5C3WA 5LMNW 4RHRA 1WCMG 4B3TL 2EPBA 3D6WA 1F2ZA 1MD2D 4N8X1 2KUMA 1JORA 2EYOA 1F9QA 2F0KA 4IZ8A 3A8IE 4A3KG 4G7OC 2XN9C 1BKBA 4CJ1B 1B44D 1A63A 5EBCA 4QQBX 2B2UC 1WTQA 4F7XA 1WJJA 4A3IH 1J9OA 3PO3H 1GJXA 3MFYA 1H9KA 3KYHC 2Y0SG 4JCVE 4IUVA 2IX1A 3NBHB 1XXGA 4C3HB 2Q2IA 1MI2A 1TY2A 3GTQB 4BY7G 4QMGA 4RA8A 3TQYA 4G7HC 2RKSA 1SYGA 1W6KA 4OIJA 1JWUD 4HSPA 2EY1A 2K04A 5HY6A 5AJ3L 4N8FA 2ALYB 3TDQA 2LY7A 1GUWA 2PMZB 1F2LA 4JI7L 1PFMA 4UAIA 3H3VH 4MZ9A 5EBDA 2F3VA 1ASYA 1QCBD 4BY1G 1I94L 1NMGA 1SLJA 2O4XA 2PI2E 3JAMc 1EY5A 2JA8B 2UUBQ 3BDCA 4BA1I 2V1CC 4JBJA 2F1MA 2CQAA 2HDLA 2J7ZA 2Q2HA 3S9WA 2UXCL 1CSQA 2IPKD 2JE6I 2TMPA 5H1SE 3MA2B 3PUZA 1JOKA 3BZKA 1NR4A 4V0BA 2E2JH 1Y1WG 1YJNA 3DWAA 1QVFA 4GOPB 1LYLA 4CHTB 2SEBD 1U4PA 3HOWG 4A3DG 5KNCA 1LABA 3NENA 5C4JB 4GKJQ 3OMGA 2IY5B 1SJHD 5DAUA 3K7AH 1IYUA 2G9DA 1DCZA 1UE1A 4PMCA 4IPDA 1DONA 1L2FA 2UXBL 2IL8A 4IPCA 4DR2Q 2OTJA 5EKKA 4HIOA 3S2HB 2AQ2B 2XIWA 2JA9A 2F4IA 3U50C 1YJ9A 3K0YA 1PH3A 5M5XH 2ATWA 3J81i 4A3GB 2CWPA 2L4NA 1EIGA 4J8QA 4JBWA 4RG1A 3I8ZA 2IJ0A 1PYWD 3DLLA 3BZCA 3GTMB 2ZXPA 1DJRD 4QIWE 2N49A 4KKTA 5LHY1 3EBEA 4X64Q 1LACA 1YNND 1SNOA 4B3MQ 4HEDA 1H9SA 2D2CC 3G71A 1XYIA 1IBLQ 1PTOD 1I4QA 3MTSA 2N88A 1BO0A 1SE2A 4F88A 3VR2A 5C0XG 2PZWA 4HMIA 2Q2TA 4DF7A 1I4PA 1H9RA 4R4TA 1V9PA 3KDFB 4GOPC 1WVLA 4C3HG 1V8QA 2AUKA 1X9NA 2JP1A 1JICA 3L3OC 2NVYH 4A93H 2FMMA 1BOSA 2E2HH 3HOXH 1ENFA 1QZGA 5JOBA 1BDOA 5JPMC 2V4DA 3Q22A 1KXLA 4P75A 3MFGA 3TP5A 4OIKA 4A3CH 1B9NA 1LTGD 3TZDA 1Y8PB 2Z4IA 1KC8C 1PTOC 3FHWA 2JA8G 1N33Q 1SE8A 1XX8A 4DV3L 2B2VC 3NP8A 1EIFA 2UUCQ 4BA2I 5JEAJ 3W3AA 2GN5A 3OYYA 4R8NA 1PV4A 2YU9H 2B2WC 1IHZA 1D7QA 1DOLA 1Y8OB 5CGKA 2LXKA 4DR4Q 1A62A 1SYFA 2KHSA 5IYCG 1S5CD 4XQNA 1XNRL 1IYJB 2KECA 3L9AX 1WYDA 2CVRA 3HKZE 1M90C 4H44C 2WB1B 4V190 4JW0A 3GTOH 4OO1H 1LTSD 1N36Q 1I3QB 5M5WH 4ODGA 2JA5H 1GUGA 2DUDA 2JQOA 1EY0A 2Z4HA 5IYDG 1X3PA 4A3GG 3NEMA 3PCOB 1Q8IA 1CKNB 1JCKB 2F0FA 4R4IA 3I4NB 1MBYA 1B3QA 3O13A 4C1NI 1TT2A 4GNXA 2B63B 4FO2A 4WFN3 2AKWB 4CDDC 1RHPA 2KENA 1XNQQ 2RCFA 4JI5L 1K8OA 3ND8A 3K5NA 1EFWA 3VR6A 4BBRH 3J81j 5LMNQ 4K0KQ 2BA0A 3NTKA 3CHBD 1BVSA 5FO7B 1SYBA 2JK8A 3CMEA 3LX0A 2CW0D 3GTJH 1VQLA 3SDZA 1K3BC 1QB5D 1I4RA 1SFOH 2A6HC 2QEJC 4NXMQ 1Q82C 1JMCA 1A0IA 1EY4A 3QWNA 1KNEA 3A5ZB 2E8GA 3J80i 4OGQC 2IWHA 4IFDJ 2HDMA 4AH6A 4DR3Q 3CC2A 1JT8A 3M3YB 1PTOH 4CKEA 1EQQA 3A7LA 5I4DA 1JWSD 2NVTH 1PVOA 1S3OA 1L1OB 3C1EA 1FJGQ 3CCMA 2HHHL 2UUAQ 5I6WA 4JI8Q 3KBGA 4DV4Q 4LFAL 5D65A 2G9HD 3ZYYX 4ME3A 3U4ZA 3VA5A 1V1QA 4NMZA 2IW3A 5D3DA 5CBEE 4I7AA 1IL2A 2CW0C 2F0MA 4HJ8A 1HCZA 4DAYA 3UE1A 2BDOA 2QILA 2K28A 5J1ZA 1SJED 4P71A 3OMCA 2JA6H 5C4XB 2EJMA 4LJZC 3URYA 2MNAA 4C3IB 1EYCA 3I73A 4ME5A 4DA2A 1S72A 4IOAA 3IKJA 2AHOB 3GO5A 2WB1G 3R2IA 3DUZA 2D62A 3S24A 4CKBA 4R4CA 5T1GA 2F0VA 4GLVB 3MC0B 4JVZA 4QB4A 4DK0A 2BOSA 4QL5A 2A69D 3TREA 1FD7D 2SNMA 1L1OC 3S1QB 2KHIA 4K5VA 3I4NG 1G91A 1QUQB 4K5XA 2B63G 1LLRD 2BCOA 3FEWX 2XWBB 1Q12A 2KEEA 2QKIC 1WD1A 4OL7A 5K36G 2TSSA 4LNQA 3BJUA 5I9PA 3E9HA 1XPRA 2OQKA 1CI3M 2NVXB 2KCTA 1IZ6A 2DY7A 4LK1C 2QEXA 4GZYC 4POFA 3A56A 1RTNA 4A3LG 4KHPQ 4Q5VA 3CCRA 3Q0AA 3GTGB 3DM3A 1C8CA 4EX5A 1B3AA 2GVBA 1XMOQ 4LUOA 2UXDQ 1I6HH 2A69C 3VYRA 2HQEA 4NXNQ 4OWWB 3WWVA 5FLMH 2F3WA 4F8MA 2HCCA 4IUUA 3J81c 4IPGA 2FHTA 3HOYB 4N9PA 2K32A 3WOEA 1TWHH 3SVMA 4U673 1ILQA 3CP0A 5C5MA 3MEFA 3ONAB 3G48A 3F2BA 2KEDA 1F9RA 2VZAA 2ZM6Q 4ZYSA 1UAPA 2UUBL 1CZGA 3S16H 3S15H 2NYZD 4KI0A 4DV5Q 3HP3A 3J7AV 2EVBA 4O42A 4JI4Q 1FGBD 5C4XG 1I4GA 2QW7A 5IP7G 4H13C 1BQQT 4LF5Q 4C3IG 3TS2A 4HN7A 3CAMA 2NZOA 5EQ0A 2B2YC 4JI6Q 4RGNA 2J4XA 1I4HA 3HG9A 4GKJL 1MJCA 5GQOA 1EU4A 5K5PA 1STAA 3PO2H 4PZ7A 5IYBH 4A3JB 1HNWQ 1GHKA 4DNIA 4DR2L 2F4VQ 3SE0A 2H5XA 3I55A 2VB2X 1VQGA 2ICIA 4GKKQ 4XIGS 1HPCA 1B7YB 3E3XA 1PRTD 2RCNA 2KVMA 3RN5A 1EOTA 4MTKA 2XTIA 1OXSC 3S1RB 1VQFA 5DEHA 2MO0A 1YVCA 1QOHA 3CQZB 4X64L 4LUVA 1T5EA 5IIFA 5IGFA 1D5ZC 4B3ML 1I50B 1IBLL 4CGYB 1G6ZA 1VS0A 4ULLA 5KYLA 3K59A 1VQ7A 3EROA 1UE5A 4R8IA 5FJ8H 1STGA 2RHQB 3NUCA 4B3SQ 3G6EA 3H15A 1Z7TA 4TQUS 5IGDA 4C3JB 5IGCA 1PZJD 1L0YB 3RZDH 4TKOB 4A3EH 4BS9A 3CCLA 4UP9A 3M4OB 1OXUA 1SN8A 3T1HQ 1E22A 1MIUA 5NUCA 3HOYG 3MXPA 4K2KA 3HGBA 1CZWA 1Q7YC 2R93H 4LF7Q 1G291 4OELB 1YNJD 2O2LD 2Z0SA 3S2DH 3HOVH 1PYBA 3K58A 1VQKA 1N33L 1LTLA 4K5WA 3W5OA 2KJXA 5IT9c 3E9IA 4DAVA 4N9TA 4YWLA 1TWFB 3KJOA 2UUCL 4Z9CB 1PZKD 3SHLA 3Q23A 1GUTA 3W1BA 3S14B 5CORA 1UEAB 2XNAC 4QIWB 1EFID 4DR4L 2PNHA 3J80c 1B70B 1WFQA 2DJGC 2K75A 4HJAA 4GLXA 1K73C 4HCEA 1JR0D 4A3IB 1WOCA 1HJPA 2RF4A 4LF6Q 3EFXD 4K6LA 2CWAA 4A3JG 4RH6A 5KGUA 1N36L 3I7FA 4X66Q 1YNJC 1O7ZA 4KKUA 4G7ZC 1Q1EA 5A2QL 5IP9H 2NVQH 4OONA 2HD3A 2SDFA 1TS5A 1QNUA 2F0JA 4KD4A 2QF7A 1CT1D 2IHEA 4G4KA 4R1JA 4FXKC 3A5UA 3CCVA 3D4RA 5EJWA 1NSNS 3H09A 1BUVT 3TP7A 1SNQA 1STHA 1XNQL 3K57A 1MSHA 1KD1C 5GAGC 2R92B 1EWIA 2HIXA 5ELEA 5LMNL 4ZK9B 1EYGA 4K0KL 3CF5A 2RDGA 5COYA 1L0XB 1SNDA 5G3LF 4OWXB 2A74C 4DNTB 3KLSA 4B08A 1STYA 3J80E 1SYEA 4NXML 2N55A 1F9PA 1U4MA 2D0PA 2EYJA 3K5MA 2B2TC 1HRJA 3QB3A 4DR3L 4DAMA 5C0XI 1HTPA 3PGZA 4OX9Q 1S40A 3SGIA 4PV1C 1VQIA 4A4IA 4IJHA 3IRBA 2L11A 2PW7A 1FJGL 3RLNA 4DPGA 2UUAL 3GTKB 3NTHA 1UE6A 2DJFC 4JI8L 1TU2B 4DV4L 2XGTA 3HKZB 2K5NA 2ZJQA 4LF8Q 1S5ED 1X55A 4CDCC 4QJFA 1KNAA 3MZ5A 1AE2A 3MWYW 4XTCS 2NUCA 2MO1A 4A3FH 4X3KA 5BR8Q 4UDUC 3LWUA 1TWCB 3VYSA 4C1NK 5JJLA 1XJVA 3T16A 5FK9C 1BXTA 4IUTA 4JI3Q 2AQ1B 3M7NA 4KY6A 4FVMA 4DUZQ 4AQYQ 1AZPA 3CD6A 4RCOA 2X6GA 4MHEA 3KLRA 4A3IG 5JAVA 1YIJA 1LUZA 1SNMA 4IFDH 3PIOA 2A73B 3GQBA 4ZQ3A 5FOBB 2PQAA 1ILPA 1V43A 3CU7A 1YBYA 2FFKB 1RKNA 3I2ZA 5C3XA 4JOIC 1D5XC 2EXZA 1VQCA 1GOZA 2EIFA 1ZEQX 2OCEA 4L63B 5CV6A 1EWHA 1H9SB 3OTOQ 1XPUA 2QCPX 1E24A 1D8LA 1Y1VH 2K5WA 2F0DA 2R92G 1VF5C 3HOZH 1F77A 1T9HA 3ULLA 2I5MX 5C6AA 3R3OA 3CC4A 3IFDA 4DV7Q 3S17H 2OWOA 4KHPL 4A3BH 1KHIA 5C44H 1PH9A 2MHVA 1GM5A 1W2BA 2R6GA 4FF2A 1XMOL 4WJ4A 1FYCA 2UXDL 2BE5D 3S1MB 1KDCA 1OO9B 4K8IA 4NXNL 3KK7A 3L0OA 4DR5Q 4OHJA 5CC4A 1J8IA 1BBUA 4DV0Q 2B2UA 1JJCB 3I56A 3MXGA 2VUMB 2F0UA 4PG3A 3VR5A 1ICFB 2K5VA 3Q6SA 3D6CA 4X3UA 2M2LA 4KK7A 1FR3A 2YV5A 1VQ8A 1VF7A 3HKZG 1LTBD 2ZM6L 3GTLH 1HA6A 4H7BA 1TWGH 1XWEA 5KRUA 1HFNA 1K83H 1HH2P 2R7ZB 4DV5L 4I7ZC 3SK5A 4ALPA 1D2BA 4DK1A 3I3CA 1G2SA 1GUSA 1BCPB 3UDGA 2L5TA 2PW5A 4BXXG 3I4OA 1HR0Q 4JI4L 2K5DA 2Q8TA 4Y7NH 1AEXA 4QY7A 3NPPA 1HZAA 4LF5L 2BE5C 2A68D 1IKMA 4JI6L 2B8FA 1YZ6A 5AFWA 4CBVA 1SE4A 1WTHA 1BCPF 5LMUQ 4EQ5A 4AYBE 3K5OA 3DWPA 1F2YA 2ICEC 1R9TB 3NSWA 2NN6I 1HNWL 4A3DH 2F4VL 3L2PA 1HNXQ 1I5FA 3CC7A 1JB7A 3AMUA 4GKKL 3QJYA 4DV2Q 1AH9A 3Q24A 1PH1A 2HQLA 1E7ZA 3D8GA 5ELDA 4KY5A 2VXWA 3DEOA 3C1FA 3NBHA 4IJLA 3WDNA 2D0OA 2AUJD 3MAQA 3SXHA 1D5MC 2A68C 2MFIA 4LWCA 1V1OA 1VQ4A 1E2ZA 2IX3A 2RHSB 3VR3A 5L37A 2Z9HA 1GHJA 3MXNB 1P8LA 3U58A 3MHBA 4FNFA 3K6OA 3GTPB 1SEBD 3R2TA 4B3SL 1TQOA 4UY8C 1AFPA 2ZXRA 4GN5A 4L5RC 3TEHB 1O7LA 2Z6KC 1ESFA 3T1HL 4FP5D 4C3HH 5CV5A 3GTQH 2VUMG 2KCNA 4NB3A 1PXUA 4ABNA 1JB3A 4IUNA 2PPBC 4GOPA 3IL8A 3NQIA 1PH7A 4ZAIA 3SR1A 1VQEA 4WORA 4LF7L 5HGQA 1GVPA 1X3QA 2DGYA 1B2TA 3QOJA 3CPFA 5BN3A 4LAAA 2R7ZG 2A6HD 3G6JB 1ZYRD 3FKIB 4DR1Q 2K6AA 2E2IB 1HNZQ 1EYDA 1STBA 2OT2A 5IWAQ 2WFWA 5KEEA 3DEPA 4K2LA 2JA8H 3J7ZC 1K0SA 1ET9A 1J6QA 4KY7A 1EY6A 4FF4A 1CSPA 5FLXL 1CTMA 3SK6A 3M4PA 2I46A 5E1FA 4DV6Q 2QDLA 3J7A5 1H9JA 2B2VA 3H94A 1HZBA 4K14A 1CA5A 3R93A 4LF6L 2OXPA 4UPAA 3X3MA 4X6AH 1SMXA 3PMFA 2R7FA 1BNZA 3GDEA 5IYCH 5C4JH 4X66L 1C9OA 2B2WA 1VDZA 3T4AC 5IGEA 3M7GA 4GN4B 3TMEA 3U4VA 1YI2A 4IO9A 1JOOA 1LT4D 1ZYRC 4B9XA 1DYQA 3H0GB 2N78A 1LV9A 1D1KA 1F2MA 3D4DA 1STNA 4PNYA 4C56C 3S2HH 2XRSD 4DUYQ 2LSSA 3PUYA 3N52A 1MJEA 3A55A 3FPUB 4A3GH 4FXDA 2NB0A 1GKHA 5M3FH 3GTMH 4WJWA 1TY0A 4CDFC 5GROA 3H91A 3J7AF 1EEID 3PIPA 4JC0A 3C3LA 2JA7B 2IHFA 2CH4A 1X65A 5CMDA 5M5YB 1STEA 5IGGA 1S4ZA 4JV5Q 3M4YA 2QDBA 3UI2A 1SXTA 1CHQD 3BG3A 4HTHA 4LUZA 5ELNA 1LO5D 1SNPA 2RSOA 1Y69U 3P1HA 5JVG3 3KF6B 2ZJRA 3OHXC 1RDPD 1IYVA 2NN6G 4OX9L 1PDQA 1LTID 1EQTA 3DMUA 2SOBA 2K1BA 3T1YQ 4DV1Q 3J7YW 2E5LQ 1NR2A 4EVOA 4LF4Q 2BA1A 5CV7A 1PH8A 1NMFA 1B9MA 3GV3A 2A19A 2F0GA 4LF8L 5KYIA 3HOUB 5GAHC 3RZOB 4X3SA 1IL8A 2XWJB 2Q8RE 1Q86C 3FKIG 4J15A 2NZ1D 5BR8L 3T56B 2EYLA 1AN8A 2CFMA 2E75C 3CCSA 4YIJA 4WRDA 5CR3A 3S1NH 5M9OA 2DN8A 4JI3L 3BZDB 4QUCA 3FMCA 1CKNA 1NAPA 3TP8A 4B3RQ 4DUZL 4AQYL 1Z6HA 2I5LX 3I70A 2HT1A 1KRTA 4DKAC 1QWYA 3QG1A 1ENAA 1LT3D 3WOFA 1GD7A 4A3EB 4BBSB 4NDXA 5FLMG 1ENCA 2K03A 2ZJPA 5CV8A 4KV6A 3VDYA 5ELFA 2E76C 2N3SA 4X65Q 1NCVA 2L15A 2N8NA 4ZRZA 3H0GG 4XQJA 3I4MB 4HR7B 2YTVA 4A3MB 3OTOL 4KKSA 1S5DD 3JC66 4PQXA 1P16A 3FVQA 4KMUC 5J39A 3OOCA 2LKVA 3I4NH 4FYDA 2B63H 1QZHA 3RN2A 3CCEA 2LFNA 4DV7L 3I90A 1L1OA 4IURA 1ZKOA 1VQHA 2JA7G 1BBXC 4HIDA 2R7DA 5JPNC 5C3EH 3V96A 3AB9A 1T5XD 5I2XA 4A3LH 1MHWC 4JPBW 4OEMB 1NNXA 1VMCA 2X6LA 4DR5L 1IBKQ 1LM0A 4DV0L 3P75A 4X62Q 3FDTA 3TS0A 1ICWA 2EE1A 2MGSA 3TZUA 4IALA 4KJOA 1QVGA 3CPWA 3M3YH 3HFZB 5C0XJ 1OXVA 3HOUG 2Z6BA 1HTLD 4WJ3M 3ER0A 4BWGB 4P73A 2EYFA 4EQOA 1K8AC 3JAML 1HR0L 4L5TA 2UU9Q 1LTTD 3NE5B
chains in the Genus database with same CATH topology
3DLLA 3BZCA 4DAMA 2K52A 4NPSA 1K3RA 5C0XI 2VW9A 3PGZA 4OX9Q 4QIWE 1S40A 2MQHA 2N49A 3EBEA 2I0QA 3SGIA 4C2MH 4X64Q 1VQIA 5LMUL 4HJ9A 4A4IA 1QUQA 4IJHA 3IRBA 5C4XH 4B3MQ 2PMZE 1FJGL 2F52A 3RLNA 4DPGA 5IP7H 1IBLQ 3G71A 2UUAL 1N32Q 3PF4A 1UE6A 4JI8L 1WI5A 4IFDI 1KAWA 2NZHA 4DK3C 4DV4L 2XGTA 1Q1BA 2K5NA 5C0XG 2ZJQA 3KLWA 4JBKA 4A3EG 2QGQA 2Q2TA 3UDIA 4LF8Q 1X55A 4BBSG 1HNXL 4QJFA 1EQRA 2JEAI 4R4OA 4P72A 1AE2A 4JYAQ 4XTCS 1UE7A 4R4TA 1V9PA 2MO1A 4DV2L 3KDFB 1X6OA 4GOPC 4LFCL 4A3FH 4JI0Q 1NJIC 5BR8Q 1SRUA 3CCUA 3GTPH 3ULPA 1X9NA 5JJLA 1XJVA 3I4MG 2NVYH 5M3MH 4JG2A 4A3MG 4A93H 1Z9FA 4YCUA 4DK6C 3PUWA 4B3TQ 4JI3Q 3M7NA 2E2HH 3A0JA 3HOXH 1QZGA 4DUZQ 1NY4A 3BU2A 4AQYQ 3CD6A 3S1QH 4Y52H 4A3IG 1KXLA 4P75A 1YIJA 1LUZA 1Q8KA 4BXXG 4A3CH 3PIOA 3H3VI 3AYHB 1KC8C 2CKZB 1PH5A 1Y14B 2PQAA 3FHWA 4LF9Q 1N33Q 1V43A 1X3FA 1X3EA 2JA8G 1YBYA 1SE8A 3I2ZA 4DV3L 1XPOA 1CKMA 1RIPA 3PV0A 2IX0A 4JOIC 1EIFA 3AFQA 1U0LA 2UUCQ 4BA2I 5JEAJ 1VQCA 2GN5A 2EIFA 3FKIH 3OYYA 4APVA 2E2IH 2OCEA 3GTGH 1PV4A 1I3QH 2YU9H 3OTOQ 1VCIA 1D7QA 1XPUA 1E24A 2LXKA 4DR4Q 1D8LA 1A62A 1Y1VH 5IYCG 5GAEC 5AJ3Q 4IOCA 1YITA 1N34Q 2R92G 1XNRL 5C3EG 1IYJB 3LGJA 1IBMQ 3HOZH 4JI7Q 3RNUA 1T9HA 3ULLA 1WYDA 2I5MX 3CC4A 3HKZE 2HIVA 4DV7Q 1M90C 3S17H 2OWOA 3K0XA 4OXPA 3HOYH 2VQFL 4A3BH 4KHPL 1KHIA 1I94Q 3GTOH 2OQ0A 5C44H 1N8RC 1PH9A 1N36Q 5M5WH 2JA5H 2B29A 4DR1L 1YHQA 1NTGA 2DUDA 2EXDA 2JQOA 4JI2Q 1W2BA 1GM5A 1HNZL 2R6GA 1FGUA 4R4QA 5IWAL 5IYDG 1XMOL 4A3GG 4HJ7A 4WJ4A 1VQMA 3PF5A 2UXCQ 2UXDL 3NEMA 1VQDA 1PH4A 3RLFA 3PCOB 2OTLA 2LXJA 3A74A 1CKNB 4R4IA 4NXNL 5JEAG 1C7YA 3L0OA 4DR5Q 4PZ8A 4FDBA 2Q2UA 4YCVA 2AMCB 3AQQA 1BBUA 1A8VA 4DV0Q 4GNXA 1JJCB 3W1GA 3I56A 1XMQQ 3KF6A 2AKWB 4DV6L 3H0GH 4H02A 1W3SA 3PO2G 4PG3A 5IYBG 1M1KC 4MTNA 2VNUD 2K5VA 2KENA 1XNQQ 4JI5L 2PQAB 5DLQE 1VQJA 1Q46A 1EFWA 2YV5A 3AFPA 4BBRH 3J81j 5LMNQ 1VQ8A 4K0KQ 2BA0A 3HKZG 1YEZA 4YHHL 4A75A 2ZM6L 1BVSA 2JK8A 3GTLH 4DR6Q 2UXBQ 1TWGH 1HZ9A 3L7ZC 2BH8A 3CMEA 1K83H 1HH2P 1E3PA 3GTJH 4DV5L 1VQLA 5JJKA 4ALPA 1SFOH 3AEVA 2YTXA 4A3JH 4POGA 2ZTCA 4NXMQ 1Q82C 4A76A 1JMCA 1A0IA 3UDGA 2JA7H 1AE3A 1JE5A 3A5ZB 2E8GA 3I4OA 3J80i 5M5YH 1KL9A 3K81C 3STBD 1HR0Q 4JI4L 4IFDJ 1GO3E 1X54A 4QY7A 4Y7NH 4DUYL 1PHJA 4AH6A 4DR3Q 3K7UC 4JBMA 1HZAA 3HKSA 4LF5L 4GN3B 3CC2A 1JT8A 3D31A 4JI6L 1EQQA 1YZ6A 2IT1A 3JAMi 5LMUQ 3F8TA 3UE0A 4AYBE 4EQ5A 2NVTH 1PVOA 2QA4A 5FJ8G 1DGSA 1S3OA 1L1OB 1FJGQ 3RR5A 3CCMA 2HHHL 3KFUA 3CQZH 2UUAQ 5GADC 5IY0A 2JJQA 4JI8Q 4IPHA 4DV4Q 2NN6I 2WB1E 4C3IH 2ID0A 1HNWL 5JJIA 4TVAB 1SROA 4LFAL 1OXXK 4A3DH 3PUXA 2F4VL 4YWMA 4JI1L 3L2PA 1HNXQ 5M3MG 2VQEQ 4JV5L 1I5FA 4ME3A 3U4ZA 1V1QA 3CC7A 3OW2A 1JB7A 1ASZA 3EIVA 1VQPA 3M4QA 4DV2Q 4GKKL 1AH9A 1PH1A 4LFCQ 2HQLA 1K0RA 1E7ZA 4HIKA 1IL2A 3HOUH 1EOVA 3RZOH 4HJ8A 4LFBL 2YTYA 3UE1A 1C0AA 3UDXA 4P71A 1JJGA 4IFDG 2JA6H 4IJLA 5E7NA 2AWOA 3STBC 1FVIA 4C3JH 2D0OA 2MNAA 2R93G 1TXYA 3T1YL 3HOVG 2WP8J 4DV1L 1K9MC 2E5LL 2K50A 2MFIA 4AYBG 4LWCA 1S72A 1VQ4A 3M4OH 4LF4L 1QVCA 3GD7A 4AIMA 4IOAA 3CXCA 4PMWA 2ZTDA 1EIYB 2AHOB 2RHSB 3PO3G 3GO5A 2WB1G 4OWTB 3G4SA 3MXNB 4KLKA 2D62A 1P8LA 3S24A 3U58A 3PUVA 4R4CA 1VQOA 4GLVB 1YJWA 4B3SL 4YWKA 1YHBA 4QL5A 4DV3Q 4OO1I 5FLXc 1O7IA 3K80C 4UY8C 4QGUA 2VS1A 3TREA 2NVXH 1B8AA 4BBSH 1Y1VG 2A1AA 4GN5A 1L1OC 4L5RC 3TEHB 2KHIA 3HOZG 2Z6KC 3I4NG 1QUQB 3PSIA 3T1HL 2B63G 1TWFH 1L0WA 4B3RL 3B6YA 4C3HH 4O0AA 3GTQH 4A3BG 2CQOA 2VUMG 1Q12A 1OTCA 3KF8B 4GS3A 4NB3A 5C44G 2FXQA 4HJ5A 3I4MH 3UDFA 3S14H 2AWNA 4GOPA 4A3MH 1PH7A 1HR0W 1XNRQ 5K36G 4LF7L 1VQEA 4LNQA 3BJUA 1WCMH 3E9HA 1BBWA 1XPRA 5HGQA 2OQKA 5IP9G 1E1OA 1GVPA 2KCTA 4KHZA 1IZ6A 2QEXA 2DGYA 4POFA 2VQFQ 1IXRA 3CPFA 4A3LG 1JJ2A 4KHPQ 1KQSA 2R7ZG 3CCRA 1J5EL 4DR1Q 4A3KH 4X65L 3DM3A 1HNZQ 4EX5A 5IWAQ 2WFWA 2GVBA 1XMOQ 4LUOA 4YCWA 5EAYA 4DR7L 2JA8H 3J7ZC 2UXDQ 1J6QA 1I6HH 4NXNQ 4OWWB 3WWVA 5FLMH 1CSPA 3ICEA 4PZ6A 2A8VA 3J81c 2WAQE 3M4PA 4IPGA 4DV6Q 2EQSA 3J7A5 5IE8A 1HZBA 1KRSA 4JI5Q 4YY3L 4BY7H 4JOIA 1TWHH 4LF6L 3CP0A 4UPAA 4X6AH 1SMXA 2KHJA 3MEFA 2R7FA 3G48A 3F2BA 3GDEA 2VZAA 5IYCH 2KBNA 4YHHQ 1PFSA 5C4JH 2R92H 4X66L 2ZM6Q 4UP8A 1C9OA 2UUBL 3S16H 3S15H 1FL0A 4KI0A 4DV5Q 3M85A 4GN4B 3U4VA 1YI2A 4IO9A 2PI2A 3FP9A 1VQAA 2VL6A 4BY1H 2N78A 4JI4Q 3S2HH 1IBKL 3ZJYC 5C4XG 4DUYQ 2LSSA 4X62L 3PUYA 5IP7G 1Q81C 1MJEA 4LF5Q 3TS2A 4A3GH 3CAMA 1E1TA 2NZOA 1CUKA 2WAQG 4JI6Q 1GKHA 5M3FH 1K8GA 4GKJL 1MJCA 5GQOA 3GTMH 2K5HA 2HHHQ 2KCMA 3S1RH 1EUJA 1TWAH 1NBWA 4PZ7A 5GROA 5IYBH 4A3FG 1Y1WH 3PO2H 1HNWQ 3PIPA 4DNIA 3F2DA 1PH6A 4JC0A 4DR2L 4LFAQ 2IHFA 1X65A 2F4VQ 3GTKH 4JI1Q 2H5XA 3I55A 3HOWH 1I50H 1X3GA 3ERSX 4JV5Q 3KJPA 1VQGA 4GKKQ 4XIGS 4A93G 1B7YB 4LUZA 2BH2A 1N9WA 5ELNA 4RMFA 2RCNA 2UU9L 3HOXG 4LFBQ 4GNXB 3RN5A 3RLOA 2CCZA 1U5KA 3KF6B 2XTIA 2ZJRA 2F3IA 1OXSC 4L5SA 2NN6G 4OX9L 1VQFA 1PA6A 4A3CG 2MO0A 1YVCA 4L5QA 4X64L 4LUVA 1TWCH 4BXXH 3D0FA 3T1YQ 1VQ5A 4DV1Q 4B3ML 3M9BA 1SR3A 2I5HA 3EN2A 1UEBA 1IBLL 2E5LQ 1N32L 1VS0A 3E0EA 4LF4Q 1Z47A 2BA1A 1PH8A 1NMFA 1VQ7A 3K8AA 2A19A 2VQEL 1UE5A 4LF8L 5GAHC 2B3GA 5FJ8H 2ES2A 4JYAL 2RHQB 4MNOA 1RL2A 1Q86C 3FKIG 1PYSB 1G51A 4B3SQ 3G6EA 4J15A 1VQ9A 4LW1A 2Y0SE 3H15A 4JI0L 1H95A 4TQUS 5BR8L 5J3BA 2CFMA 3CCSA 3RZDH 2GVAA 1VQBA 4A3EH 1X56A 5LMNW 1UWVA 3CCLA 3S1NH 1WCMG 3CW2C 4UP9A 4HIMA 4B3TL 1OXUA 1SN8A 4JI3L 3T1HQ 3F1ZA 1E22A 1CKNA 1MIUA 4B3RQ 4DUZL 4AQYL 2I5LX 1PH2A 3HOYG 2HT1A 1KRTA 3F2CA 2K14A 4DKAC 4OO1G 4A3KG 1Q7YC 2JA5G 4LF7Q 1VQNA 1G291 2R93H 2Z0SA 1BKBA 3S2DH 3HOVH 2C35B 3CMAA 1A63A 1PYBA 4QQBX 4GNXC 1GD7A 1VQKA 4LF9L 1N33L 1LTLA 3W5OA 2ASBA 1CKOA 1WJJA 5FLMG 2JEBI 4A3IH 2ZJPA 3PO3H 5IT9c 3VDYA 1J5EQ 3E9IA 3KYHC 4DAYB 2Y0SG 2N3SA 4JCVE 4YWLA 4X65Q 2L15A 2IX1A 2N8NA 1YHAA 3NBHB 3KJOA 2UUCL 2Q2IA 4DR7Q 3H0GG 4BY7G 3W1BA 2K4KA 5ELOA 2YTVA 3TQYA 2VY3A 3OTOL 3JC66 1P16A 5HY6A 4BBRG 1XTDA 3S1MH 4DR4L 2PNHA 5AJ3L 3J80c 1B70B 1WFQA 4GLXA 2K75A 4HJAA 1K73C 2ALYB 1N34L 3I4NH 1IBML 4JI7L 4YY3Q 1WOCA 1QZHA 2B63H 1HJPA 2RF4A 3H3VH 3RN2A 4LF6Q 3CCEA 4DV7L 1VQ6A 2VUMH 4MZ9A 1ASYA 2CWAA 1L1OA 4BY1G 3ULJA 3CCQA 4A3JG 1I94L 1NMGA 1SLJA 2PI2E 2Z6KA 1VQHA 4O2DA 1OXTA 3JAMc 4HIDA 1N36L 2R7DA 3I7FA 4X66Q 2JA7G 1KIXA 2UUBQ 1Q1EA 4JI2L 4BA1I 5C3EH 2V1CC 2NVQH 5IP9H 4JBJA 4OONA 3TRZA 2Q2HA 2UXCL 1CSQA 1YNXA 5M3FG 4A3LH 2JE6I 5H1SE 2R7ZH 3PUZA 2IHEA 4R1JA 1HZCA 4DR5L 3BZKA 1IBKQ 1LM0A 3KDFA 3A5UA 1G6PA 4DV0L 3CCVA 4X62Q 2E2JH 1Y1WG 1YJNA 1XMQL 1QVFA 4GOPB 1LYLA 5IYDH 1NE3A 3TS0A 1XNQL 3HOWG 4A3DG 3NENA 5GAGC 1KD1C 4GKJQ 1EWIA 4GLAC 1QVGA 2IY5B 3CPWA 3M3YH 4UP7A 2HIXA 2YYZA 3K7AH 4P74A 5LMNL 1EYGA 3HFZB 3NELA 4K0KL 5C0XJ 1OXVA 3CF5A 1UE1A 4IPDA 3HOUG 1L2FA 4DR6L 2UXBL 4IPCA 2OTJA 4DR2Q 2ZTEA 3KOJA 4WJ3M 4OWXB 4HIOA 1MKHA 3CCJA 1R9TH 3ER0A 3U50C 2JA9A 1YJ9A 4P73A 1PH3A 2ATWA 2JA6G 5M5XH 4NXML 3J81i 2D0PA 1K8AC 2CWPA 1HR0L 4L5TA 2UU9Q 4JBWA 4RG1A 3Q8DA 4DR3L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLL A;  3BZC A;  4DAM A;  2K52 A;  4NPS A;  1K3R A;  5C0X I;  2VW9 A;  3PGZ A;  4OX9 Q;  4QIW E;  1S40 A;  2MQH A;  2N49 A;  3EBE A;  2I0Q A;  3SGI A;  4C2M H;  4X64 Q;  1VQI A;  5LMU L;  4HJ9 A;  4A4I A;  1QUQ A;  4IJH A;  3IRB A;  5C4X H;  4B3M Q;  2PMZ E;  1FJG L;  2F52 A;  3RLN A;  4DPG A;  5IP7 H;  1IBL Q;  3G71 A;  2UUA L;  1N32 Q;  3PF4 A;  1UE6 A;  4JI8 L;  1WI5 A;  4IFD I;  1KAW A;  2NZH A;  4DK3 C;  4DV4 L;  2XGT A;  1Q1B A;  2K5N A;  5C0X G;  2ZJQ A;  3KLW A;  4JBK A;  4A3E G;  2QGQ A;  2Q2T A;  3UDI A;  4LF8 Q;  1X55 A;  4BBS G;  1HNX L;  4QJF A;  1EQR A;  2JEA I;  4R4O A;  4P72 A;  1AE2 A;  4JYA Q;  4XTC S;  1UE7 A;  4R4T A;  1V9P A;  2MO1 A;  4DV2 L;  3KDF B;  1X6O A;  4GOP C;  4LFC L;  4A3F H;  4JI0 Q;  1NJI C;  5BR8 Q;  1SRU A;  3CCU A;  3GTP H;  3ULP A;  1X9N A;  5JJL A;  1XJV A;  3I4M G;  2NVY H;  5M3M H;  4JG2 A;  4A3M G;  4A93 H;  1Z9F A;  4YCU A;  4DK6 C;  3PUW A;  4B3T Q;  4JI3 Q;  3M7N A;  2E2H H;  3A0J A;  3HOX H;  1QZG A;  4DUZ Q;  1NY4 A;  3BU2 A;  4AQY Q;  3CD6 A;  3S1Q H;  4Y52 H;  4A3I G;  1KXL A;  4P75 A;  1YIJ A;  1LUZ A;  1Q8K A;  4BXX G;  4A3C H;  3PIO A;  3H3V I;  3AYH B;  1KC8 C;  2CKZ B;  1PH5 A;  1Y14 B;  2PQA A;  3FHW A;  4LF9 Q;  1N33 Q;  1V43 A;  1X3F A;  1X3E A;  2JA8 G;  1YBY A;  1SE8 A;  3I2Z A;  4DV3 L;  1XPO A;  1CKM A;  1RIP A;  3PV0 A;  2IX0 A;  4JOI C;  1EIF A;  3AFQ A;  1U0L A;  2UUC Q;  4BA2 I;  5JEA J;  1VQC A;  2GN5 A;  2EIF A;  3FKI H;  3OYY A;  4APV A;  2E2I H;  2OCE A;  3GTG H;  1PV4 A;  1I3Q H;  2YU9 H;  3OTO Q;  1VCI A;  1D7Q A;  1XPU A;  1E24 A;  2LXK A;  4DR4 Q;  1D8L A;  1A62 A;  1Y1V H;  5IYC G;  5GAE C;  5AJ3 Q;  4IOC A;  1YIT A;  1N34 Q;  2R92 G;  1XNR L;  5C3E G;  1IYJ B;  3LGJ A;  1IBM Q;  3HOZ H;  4JI7 Q;  3RNU A;  1T9H A;  3ULL A;  1WYD A;  2I5M X;  3CC4 A;  3HKZ E;  2HIV A;  4DV7 Q;  1M90 C;  3S17 H;  2OWO A;  3K0X A;  4OXP A;  3HOY H;  2VQF L;  4A3B H;  4KHP L;  1KHI A;  1I94 Q;  3GTO H;  2OQ0 A;  5C44 H;  1N8R C;  1PH9 A;  1N36 Q;  5M5W H;  2JA5 H;  2B29 A;  4DR1 L;  1YHQ A;  1NTG A;  2DUD A;  2EXD A;  2JQO A;  4JI2 Q;  1W2B A;  1GM5 A;  1HNZ L;  2R6G A;  1FGU A;  4R4Q A;  5IWA L;  5IYD G;  1XMO L;  4A3G G;  4HJ7 A;  4WJ4 A;  1VQM A;  3PF5 A;  2UXC Q;  2UXD L;  3NEM A;  1VQD A;  1PH4 A;  3RLF A;  3PCO B;  2OTL A;  2LXJ A;  3A74 A;  1CKN B;  4R4I A;  4NXN L;  5JEA G;  1C7Y A;  3L0O A;  4DR5 Q;  4PZ8 A;  4FDB A;  2Q2U A;  4YCV A;  2AMC B;  3AQQ A;  1BBU A;  1A8V A;  4DV0 Q;  4GNX A;  1JJC B;  3W1G A;  3I56 A;  1XMQ Q;  3KF6 A;  2AKW B;  4DV6 L;  3H0G H;  4H02 A;  1W3S A;  3PO2 G;  4PG3 A;  5IYB G;  1M1K C;  4MTN A;  2VNU D;  2K5V A;  2KEN A;  1XNQ Q;  4JI5 L;  2PQA B;  5DLQ E;  1VQJ A;  1Q46 A;  1EFW A;  2YV5 A;  3AFP A;  4BBR H;  3J81 j;  5LMN Q;  1VQ8 A;  4K0K Q;  2BA0 A;  3HKZ G;  1YEZ A;  4YHH L;  4A75 A;  2ZM6 L;  1BVS A;  2JK8 A;  3GTL H;  4DR6 Q;  2UXB Q;  1TWG H;  1HZ9 A;  3L7Z C;  2BH8 A;  3CME A;  1K83 H;  1HH2 P;  1E3P A;  3GTJ H;  4DV5 L;  1VQL A;  5JJK A;  4ALP A;  1SFO H;  3AEV A;  2YTX A;  4A3J H;  4POG A;  2ZTC A;  4NXM Q;  1Q82 C;  4A76 A;  1JMC A;  1A0I A;  3UDG A;  2JA7 H;  1AE3 A;  1JE5 A;  3A5Z B;  2E8G A;  3I4O A;  3J80 i;  5M5Y H;  1KL9 A;  3K81 C;  3STB D;  1HR0 Q;  4JI4 L;  4IFD J;  1GO3 E;  1X54 A;  4QY7 A;  4Y7N H;  4DUY L;  1PHJ A;  4AH6 A;  4DR3 Q;  3K7U C;  4JBM A;  1HZA A;  3HKS A;  4LF5 L;  4GN3 B;  3CC2 A;  1JT8 A;  3D31 A;  4JI6 L;  1EQQ A;  1YZ6 A;  2IT1 A;  3JAM i;  5LMU Q;  3F8T A;  3UE0 A;  4AYB E;  4EQ5 A;  2NVT H;  1PVO A;  2QA4 A;  5FJ8 G;  1DGS A;  1S3O A;  1L1O B;  1FJG Q;  3RR5 A;  3CCM A;  2HHH L;  3KFU A;  3CQZ H;  2UUA Q;  5GAD C;  5IY0 A;  2JJQ A;  4JI8 Q;  4IPH A;  4DV4 Q;  2NN6 I;  2WB1 E;  4C3I H;  2ID0 A;  1HNW L;  5JJI A;  4TVA B;  1SRO A;  4LFA L;  1OXX K;  4A3D H;  3PUX A;  2F4V L;  4YWM A;  4JI1 L;  3L2P A;  1HNX Q;  5M3M G;  2VQE Q;  4JV5 L;  1I5F A;  4ME3 A;  3U4Z A;  1V1Q A;  3CC7 A;  3OW2 A;  1JB7 A;  1ASZ A;  3EIV A;  1VQP A;  3M4Q A;  4DV2 Q;  4GKK L;  1AH9 A;  1PH1 A;  4LFC Q;  2HQL A;  1K0R A;  1E7Z A;  4HIK A;  1IL2 A;  3HOU H;  1EOV A;  3RZO H;  4HJ8 A;  4LFB L;  2YTY A;  3UE1 A;  1C0A A;  3UDX A;  4P71 A;  1JJG A;  4IFD G;  2JA6 H;  4IJL A;  5E7N A;  2AWO A;  3STB C;  1FVI A;  4C3J H;  2D0O A;  2MNA A;  2R93 G;  1TXY A;  3T1Y L;  3HOV G;  2WP8 J;  4DV1 L;  1K9M C;  2E5L L;  2K50 A;  2MFI A;  4AYB G;  4LWC A;  1S72 A;  1VQ4 A;  3M4O H;  4LF4 L;  1QVC A;  3GD7 A;  4AIM A;  4IOA A;  3CXC A;  4PMW A;  2ZTD A;  1EIY B;  2AHO B;  2RHS B;  3PO3 G;  3GO5 A;  2WB1 G;  4OWT B;  3G4S A;  3MXN B;  4KLK A;  2D62 A;  1P8L A;  3S24 A;  3U58 A;  3PUV A;  4R4C A;  1VQO A;  4GLV B;  1YJW A;  4B3S L;  4YWK A;  1YHB A;  4QL5 A;  4DV3 Q;  4OO1 I;  5FLX c;  1O7I A;  3K80 C;  4UY8 C;  4QGU A;  2VS1 A;  3TRE A;  2NVX H;  1B8A A;  4BBS H;  1Y1V G;  2A1A A;  4GN5 A;  1L1O C;  4L5R C;  3TEH B;  2KHI A;  3HOZ G;  2Z6K C;  3I4N G;  1QUQ B;  3PSI A;  3T1H L;  2B63 G;  1TWF H;  1L0W A;  4B3R L;  3B6Y A;  4C3H H;  4O0A A;  3GTQ H;  4A3B G;  2CQO A;  2VUM G;  1Q12 A;  1OTC A;  3KF8 B;  4GS3 A;  4NB3 A;  5C44 G;  2FXQ A;  4HJ5 A;  3I4M H;  3UDF A;  3S14 H;  2AWN A;  4GOP A;  4A3M H;  1PH7 A;  1HR0 W;  1XNR Q;  5K36 G;  4LF7 L;  1VQE A;  4LNQ A;  3BJU A;  1WCM H;  3E9H A;  1BBW A;  1XPR A;  5HGQ A;  2OQK A;  5IP9 G;  1E1O A;  1GVP A;  2KCT A;  4KHZ A;  1IZ6 A;  2QEX A;  2DGY A;  4POF A;  2VQF Q;  1IXR A;  3CPF A;  4A3L G;  1JJ2 A;  4KHP Q;  1KQS A;  2R7Z G;  3CCR A;  1J5E L;  4DR1 Q;  4A3K H;  4X65 L;  3DM3 A;  1HNZ Q;  4EX5 A;  5IWA Q;  2WFW A;  2GVB A;  1XMO Q;  4LUO A;  4YCW A;  5EAY A;  4DR7 L;  2JA8 H;  3J7Z C;  2UXD Q;  1J6Q A;  1I6H H;  4NXN Q;  4OWW B;  3WWV A;  5FLM H;  1CSP A;  3ICE A;  4PZ6 A;  2A8V A;  3J81 c;  2WAQ E;  3M4P A;  4IPG A;  4DV6 Q;  2EQS A;  3J7A 5;  5IE8 A;  1HZB A;  1KRS A;  4JI5 Q;  4YY3 L;  4BY7 H;  4JOI A;  1TWH H;  4LF6 L;  3CP0 A;  4UPA A;  4X6A H;  1SMX A;  2KHJ A;  3MEF A;  2R7F A;  3G48 A;  3F2B A;  3GDE A;  2VZA A;  5IYC H;  2KBN A;  4YHH Q;  1PFS A;  5C4J H;  2R92 H;  4X66 L;  2ZM6 Q;  4UP8 A;  1C9O A;  2UUB L;  3S16 H;  3S15 H;  1FL0 A;  4KI0 A;  4DV5 Q;  3M85 A;  4GN4 B;  3U4V A;  1YI2 A;  4IO9 A;  2PI2 A;  3FP9 A;  1VQA A;  2VL6 A;  4BY1 H;  2N78 A;  4JI4 Q;  3S2H H;  1IBK L;  3ZJY C;  5C4X G;  4DUY Q;  2LSS A;  4X62 L;  3PUY A;  5IP7 G;  1Q81 C;  1MJE A;  4LF5 Q;  3TS2 A;  4A3G H;  3CAM A;  1E1T A;  2NZO A;  1CUK A;  2WAQ G;  4JI6 Q;  1GKH A;  5M3F H;  1K8G A;  4GKJ L;  1MJC A;  5GQO A;  3GTM H;  2K5H A;  2HHH Q;  2KCM A;  3S1R H;  1EUJ A;  1TWA H;  1NBW A;  4PZ7 A;  5GRO A;  5IYB H;  4A3F G;  1Y1W H;  3PO2 H;  1HNW Q;  3PIP A;  4DNI A;  3F2D A;  1PH6 A;  4JC0 A;  4DR2 L;  4LFA Q;  2IHF A;  1X65 A;  2F4V Q;  3GTK H;  4JI1 Q;  2H5X A;  3I55 A;  3HOW H;  1I50 H;  1X3G A;  3ERS X;  4JV5 Q;  3KJP A;  1VQG A;  4GKK Q;  4XIG S;  4A93 G;  1B7Y B;  4LUZ A;  2BH2 A;  1N9W A;  5ELN A;  4RMF A;  2RCN A;  2UU9 L;  3HOX G;  4LFB Q;  4GNX B;  3RN5 A;  3RLO A;  2CCZ A;  1U5K A;  3KF6 B;  2XTI A;  2ZJR A;  2F3I A;  1OXS C;  4L5S A;  2NN6 G;  4OX9 L;  1VQF A;  1PA6 A;  4A3C G;  2MO0 A;  1YVC A;  4L5Q A;  4X64 L;  4LUV A;  1TWC H;  4BXX H;  3D0F A;  3T1Y Q;  1VQ5 A;  4DV1 Q;  4B3M L;  3M9B A;  1SR3 A;  2I5H A;  3EN2 A;  1UEB A;  1IBL L;  2E5L Q;  1N32 L;  1VS0 A;  3E0E A;  4LF4 Q;  1Z47 A;  2BA1 A;  1PH8 A;  1NMF A;  1VQ7 A;  3K8A A;  2A19 A;  2VQE L;  1UE5 A;  4LF8 L;  5GAH C;  2B3G A;  5FJ8 H;  2ES2 A;  4JYA L;  2RHQ B;  4MNO A;  1RL2 A;  1Q86 C;  3FKI G;  1PYS B;  1G51 A;  4B3S Q;  3G6E A;  4J15 A;  1VQ9 A;  4LW1 A;  2Y0S E;  3H15 A;  4JI0 L;  1H95 A;  4TQU S;  5BR8 L;  5J3B A;  2CFM A;  3CCS A;  3RZD H;  2GVA A;  1VQB A;  4A3E H;  1X56 A;  5LMN W;  1UWV A;  3CCL A;  3S1N H;  1WCM G;  3CW2 C;  4UP9 A;  4HIM A;  4B3T L;  1OXU A;  1SN8 A;  4JI3 L;  3T1H Q;  3F1Z A;  1E22 A;  1CKN A;  1MIU A;  4B3R Q;  4DUZ L;  4AQY L;  2I5L X;  1PH2 A;  3HOY G;  2HT1 A;  1KRT A;  3F2C A;  2K14 A;  4DKA C;  4OO1 G;  4A3K G;  1Q7Y C;  2JA5 G;  4LF7 Q;  1VQN A;  1G29 1;  2R93 H;  2Z0S A;  1BKB A;  3S2D H;  3HOV H;  2C35 B;  3CMA A;  1A63 A;  1PYB A;  4QQB X;  4GNX C;  1GD7 A;  1VQK A;  4LF9 L;  1N33 L;  1LTL A;  3W5O A;  2ASB A;  1CKO A;  1WJJ A;  5FLM G;  2JEB I;  4A3I H;  2ZJP A;  3PO3 H;  5IT9 c;  3VDY A;  1J5E Q;  3E9I A;  3KYH C;  4DAY B;  2Y0S G;  2N3S A;  4JCV E;  4YWL A;  4X65 Q;  2L15 A;  2IX1 A;  2N8N A;  1YHA A;  3NBH B;  3KJO A;  2UUC L;  2Q2I A;  4DR7 Q;  3H0G G;  4BY7 G;  3W1B A;  2K4K A;  5ELO A;  2YTV A;  3TQY A;  2VY3 A;  3OTO L;  3JC6 6;  1P16 A;  5HY6 A;  4BBR G;  1XTD A;  3S1M H;  4DR4 L;  2PNH A;  5AJ3 L;  3J80 c;  1B70 B;  1WFQ A;  4GLX A;  2K75 A;  4HJA A;  1K73 C;  2ALY B;  1N34 L;  3I4N H;  1IBM L;  4JI7 L;  4YY3 Q;  1WOC A;  1QZH A;  2B63 H;  1HJP A;  2RF4 A;  3H3V H;  3RN2 A;  4LF6 Q;  3CCE A;  4DV7 L;  1VQ6 A;  2VUM H;  4MZ9 A;  1ASY A;  2CWA A;  1L1O A;  4BY1 G;  3ULJ A;  3CCQ A;  4A3J G;  1I94 L;  1NMG A;  1SLJ A;  2PI2 E;  2Z6K A;  1VQH A;  4O2D A;  1OXT A;  3JAM c;  4HID A;  1N36 L;  2R7D A;  3I7F A;  4X66 Q;  2JA7 G;  1KIX A;  2UUB Q;  1Q1E A;  4JI2 L;  4BA1 I;  5C3E H;  2V1C C;  2NVQ H;  5IP9 H;  4JBJ A;  4OON A;  3TRZ A;  2Q2H A;  2UXC L;  1CSQ A;  1YNX A;  5M3F G;  4A3L H;  2JE6 I;  5H1S E;  2R7Z H;  3PUZ A;  2IHE A;  4R1J A;  1HZC A;  4DR5 L;  3BZK A;  1IBK Q;  1LM0 A;  3KDF A;  3A5U A;  1G6P A;  4DV0 L;  3CCV A;  4X62 Q;  2E2J H;  1Y1W G;  1YJN A;  1XMQ L;  1QVF A;  4GOP B;  1LYL A;  5IYD H;  1NE3 A;  3TS0 A;  1XNQ L;  3HOW G;  4A3D G;  3NEN A;  5GAG C;  1KD1 C;  4GKJ Q;  1EWI A;  4GLA C;  1QVG A;  2IY5 B;  3CPW A;  3M3Y H;  4UP7 A;  2HIX A;  2YYZ A;  3K7A H;  4P74 A;  5LMN L;  1EYG A;  3HFZ B;  3NEL A;  4K0K L;  5C0X J;  1OXV A;  3CF5 A;  1UE1 A;  4IPD A;  3HOU G;  1L2F A;  4DR6 L;  2UXB L;  4IPC A;  2OTJ A;  4DR2 Q;  2ZTE A;  3KOJ A;  4WJ3 M;  4OWX B;  4HIO A;  1MKH A;  3CCJ A;  1R9T H;  3ER0 A;  3U50 C;  2JA9 A;  1YJ9 A;  4P73 A;  1PH3 A;  2ATW A;  2JA6 G;  5M5X H;  4NXM L;  3J81 i;  2D0P A;  1K8A C;  2CWP A;  1HR0 L;  4L5T A;  2UU9 Q;  4JBW A;  4RG1 A;  3Q8D A;  4DR3 L; 
#chains in the Genus database with same CATH topology
 2DNC A;  4NPS A;  1EY9 A;  1K3R A;  2E2D C;  2F0S A;  3BVZ A;  2MQH A;  4C2M H;  5LMU L;  4HJ9 A;  1QUQ A;  2I07 B;  5C4X H;  2F52 A;  2RQX A;  5IP7 H;  3PIO 3;  2EJF C;  1N32 Q;  4IFD I;  2O5I C;  4EQP A;  4JBK A;  4M8A A;  4A3E G;  2QGQ A;  4BBS G;  5TSS A;  1HNX L;  2WV6 D;  1SDF A;  4R4O A;  4P72 A;  4JYA Q;  2B2Y A;  2FIN B;  4DV2 L;  3FPP A;  2F0E A;  2KOL A;  1B1Z A;  1SRU A;  3CCU A;  1A3T A;  3ULP A;  2OEO A;  1IKL A;  3NK9 A;  1CK1 A;  3I4M G;  5M3M H;  4JG2 A;  1QJO A;  4A3M G;  4DK6 C;  1B53 A;  3DWQ A;  3PUW A;  2BDN A;  1O7Y A;  1NY4 A;  3BU2 A;  3S1Q H;  1WD0 A;  1PFB A;  1I4X A;  1Q8K A;  2NWG A;  2RA4 A;  2EYH A;  3H3V I;  2M9V A;  2CKZ B;  3KLS X;  2EJG C;  4LF9 Q;  4ZLT F;  5ELB A;  1X3F A;  1X3E A;  3TSS A;  1RTO A;  1XPO A;  1RIP A;  3PV0 A;  3GP7 A;  2IX0 A;  2JXM B;  1DXM A;  1U0L A;  2XRQ D;  5EPJ A;  3GTG H;  3NTI A;  2Z1C A;  3OIP A;  1WTX A;  3D4W A;  1JC7 A;  3RMH A;  1N34 Q;  3NWT A;  4AYB B;  2PQE A;  1II3 A;  1IBM Q;  3EVQ A;  4XYQ A;  2F0T A;  3PO3 B;  2L55 A;  2HIV A;  1F9S A;  4KTA A;  3K0X A;  3HOY H;  4L8J A;  2GA4 B;  3K5L A;  2OQ0 A;  5LL6 S;  3F2U A;  4DR1 L;  1NTG A;  4JI2 Q;  1HNZ L;  5FKA C;  1FGU A;  1K28 A;  5IWA L;  1KAA A;  1VQM A;  1FNU A;  1VQD A;  1PH4 A;  5JEA G;  4HAE A;  3HOZ B;  1C7Y A;  4YCV A;  3AQQ A;  2EY2 A;  3QIA A;  3W1G A;  3S17 B;  5EPK A;  1XMQ Q;  4DV6 L;  4H02 A;  4A3B B;  1W3S A;  3N6R A;  1M1K C;  2KCC A;  5C44 B;  4MTN A;  4XDX A;  4FF1 A;  1BF4 A;  2F0N A;  1EZ8 A;  2PQA B;  5DLQ E;  4DNR B;  1Q46 A;  3AFP A;  4KN4 C;  1HQM C;  1YEZ A;  4A75 A;  2K33 A;  4DR6 Q;  4LMQ D;  3I91 A;  4RFB A;  4XQQ A;  3L7Z C;  2BH8 A;  1RF2 D;  3AEV A;  4MIU A;  1SMY D;  2YTX A;  4A3J H;  4POG A;  2ZTC A;  3PQI A;  4A76 A;  2E2J B;  5G3L D;  1AE3 A;  1KL9 A;  3STB D;  2JN4 A;  1B4O A;  1X54 A;  3BS1 A;  4DUY L;  1PHJ A;  4JBM A;  1HXY D;  3HKS A;  4GN3 B;  1TII D;  2MPM A;  3TP6 A;  2EYP A;  3K7A B;  3X3N A;  1CQV A;  2IT1 A;  3UE0 A;  5LL6 X;  1DGS A;  3RR5 A;  5J22 A;  3KFU A;  3CQZ H;  2JJQ A;  1D1I A;  3KF8 A;  1WTV A;  5M5X B;  1SRO A;  1OXX K;  2F0P A;  3RUZ A;  4Y7N B;  4JV5 L;  4ZCK A;  3A7A B;  2NTT A;  3H3V C;  3OW2 A;  1ASZ A;  4Q0F A;  3H6M A;  3M4Q A;  1VQP A;  4LFC Q;  1G8Z D;  3P7J A;  2C9O A;  3VA7 A;  2YTY A;  1SMY C;  1C0A A;  1JJG A;  4IFD G;  1K8M A;  4TRD A;  3C46 A;  1CFM A;  5E7N A;  3STB C;  1FVI A;  4C3J H;  1KTK A;  5D14 A;  3T1Y L;  1GUN A;  4DV1 L;  1K9M C;  2E5L L;  2K50 A;  5DNF A;  4AYB G;  3A54 A;  3M4O H;  4DFA A;  4LF4 L;  3GD7 A;  5E3F A;  2ZTD A;  3PO3 G;  2B2T A;  1Q90 A;  4RGM A;  3PUV A;  1VQO A;  1YJW A;  2F0Q A;  2EYM A;  1XTC D;  1KDB A;  1YHB A;  2NVY B;  4OO1 I;  1JE4 A;  3HRZ C;  4DXF A;  4A93 B;  2VS1 A;  1Y1V G;  2A1A A;  1EZ6 A;  2E2H B;  3HOX B;  1SBB B;  5F2D A;  1JQY D;  3HOZ G;  1V1P A;  3NWS A;  1TWF H;  2J0T D;  1L0W A;  4B3R L;  4A3B G;  2CQO A;  1OTC A;  4GS3 A;  5C44 G;  2FXQ A;  3SK4 A;  4F87 A;  4HJ5 A;  3UDF A;  3S14 H;  5EGT A;  2H4O A;  1WCM H;  4XYO A;  2F0I A;  2EY6 A;  5EKI A;  1DOM A;  2VQF Q;  1QG7 A;  2RVL A;  1KQS A;  1TR5 A;  4A3K H;  4X65 L;  4HMJ A;  2YU9 B;  2R3Z A;  3BDO A;  4RHS A;  5CBA E;  4EQN A;  2G5D A;  5BN4 A;  3ICE A;  4PZ6 A;  5IGB A;  2A8V A;  2WAQ E;  4O1N A;  4ZUJ A;  4QF4 A;  4MN3 A;  3GTO B;  4BY7 H;  4JOI A;  2L0C A;  5M5W B;  2JA5 B;  3PIP 3;  1QNK A;  2KBN A;  4YHH Q;  1PFS A;  2R92 H;  4I65 A;  1FL0 A;  4XT3 B;  3M85 A;  4IUQ A;  4PMB A;  2F0O A;  1EEF D;  1HQR D;  1VQA A;  4BY1 H;  1WTW A;  2MP1 A;  1IBK L;  1M4V A;  4X62 L;  4RCN A;  1WTR A;  1IW7 D;  3P20 A;  1E1T A;  3IFT A;  1CUK A;  4BBR B;  1A6X A;  3D3R A;  1SE3 A;  3NBI A;  4J1M A;  1BCP D;  2K5H A;  2D5D A;  3J81 L;  3GTJ B;  4CKC A;  1EUJ A;  1TWA H;  1NBW A;  1Y1W H;  1SFO B;  3VYU A;  3F2D A;  1UNS A;  1TS3 A;  3E0J A;  3GTK H;  4JI1 Q;  5IOC A;  3HOW H;  3ERS X;  3QO2 A;  3LNN A;  2H1E A;  3I72 A;  4A93 G;  5I9O A;  2BH2 A;  1PTO B;  2B8G A;  5M3F B;  4RMF A;  2UU9 L;  3HOX G;  4LFB Q;  4GNX B;  3JAM E;  2CCZ A;  2K05 A;  2NVT B;  1JOQ A;  2F3I A;  2ZXO A;  1KLG D;  1PA6 A;  4A3C G;  4IQZ A;  1TWC H;  4BXX H;  4L6T B;  3E5S A;  4KN7 C;  1PTO F;  3BVG A;  5E4W C;  1VQ5 A;  4G57 A;  1IW7 C;  3EN2 A;  1UEB A;  1N32 L;  3E0E A;  2C5C A;  5D3I B;  3BDL A;  3K8A A;  2VQE L;  1BCP C;  5KIX A;  2B3G A;  1DD2 A;  1ZXT A;  2ES2 A;  4JYA L;  2CH4 W;  2RBM A;  4FXG C;  1G51 A;  1H95 A;  1EYA A;  2Y0S E;  3OWF A;  4LW1 A;  2JA6 B;  2MUY A;  4ZKB B;  2GVA A;  2XVS A;  5C0X H;  2LMC B;  1UWV A;  3CW2 C;  5KNB A;  4HIM A;  3ERQ A;  1U4R A;  3F1Z A;  1AW7 A;  4E6I A;  1PH2 A;  5I2Y A;  3F2C A;  1YNN C;  2K14 A;  4OO1 G;  2JA5 G;  1VQN A;  3QOL A;  3NHH A;  2C35 B;  3CMA A;  4GNX C;  4LF9 L;  3S1N B;  2ASB A;  1CKO A;  2JEB I;  1J5E Q;  3W2D A;  4DAY B;  3T51 B;  1YHA A;  4DR7 Q;  2NBF A;  4IN3 A;  1A2U A;  2K4K A;  5ELO A;  3VYT A;  2VY3 A;  2O5J C;  1EL0 A;  1U4L A;  2EZV A;  2F03 A;  4BBR G;  1XTD A;  3S1M H;  1N34 L;  4ZKC B;  4DU9 A;  1GXD C;  1ROD A;  1DM0 B;  1IBM L;  3A8J E;  4YY3 Q;  2VB3 X;  3HEJ A;  1VQ6 A;  2VUM H;  4NKL A;  2PNR C;  4JK1 C;  3ULJ A;  3CCQ A;  4M1U B;  2Z6K A;  4O2D A;  1OXT A;  3A8K E;  1KIX A;  2P5Z X;  4JI2 L;  5T1I A;  4CJ0 B;  1I6H B;  3TRZ A;  1KLU D;  2X69 A;  1PFN A;  5IOD A;  1SAP A;  1YNX A;  5M3F G;  5DM6 3;  1QIL A;  2R7Z H;  5A2Q E;  1SNC A;  2B39 A;  1HZC A;  5IT9 L;  3KDF A;  1G6P A;  1TWH B;  4FF3 A;  1XMQ L;  2F0H A;  5IYD H;  3T13 A;  1NE3 A;  1O78 A;  2L1B A;  1HFG A;  1HUM A;  4GLA C;  4ZUI A;  5C4Z A;  5C3E B;  4UP7 A;  2YYZ A;  4P74 A;  3S16 B;  1A2T A;  3S15 B;  3NEL A;  2F0W A;  2JSO A;  3J80 L;  2DNE A;  4DR6 L;  2ZTE A;  2RDH A;  2HCI A;  3KOJ A;  2ENB A;  3AU7 A;  3MXN A;  1MKH A;  3CCJ A;  1R9T H;  2JA6 G;  2MJ8 A;  1Q3L A;  1W6J A;  2JYO A;  5KND A;  1VMP A;  1O80 A;  3Q8D A;  1ET6 A;  4KD3 A;  2K52 A;  4DXG A;  2VW9 A;  2I0Q A;  3PO2 B;  3MVV A;  2CHB D;  2PZU A;  2PMZ E;  2DY8 A;  3PF4 A;  1MSG A;  5FO8 B;  1WI5 A;  1KAW A;  2NZH A;  4DK3 C;  2RSN A;  5ELC A;  1Q1B A;  2PO4 A;  3KLW A;  3UDI A;  1WTP A;  1EQR A;  2JEA I;  4RWS C;  5BN5 A;  1UE7 A;  3EA6 A;  2WKC A;  1X6O A;  4QCL A;  4LFC L;  3T53 B;  1A3V A;  4C2M B;  1NJI C;  4JI0 Q;  3GTP H;  4XT1 B;  1Z9F A;  4YCU A;  1C4Q A;  4B3T Q;  4R9W A;  3A0J A;  1TKW B;  3E6Z X;  4Y52 H;  3NQT A;  3VR4 A;  1E0B A;  2NN6 H;  3QR8 A;  2Z8L A;  2FJ2 A;  1RCV D;  3AYH B;  3DHQ A;  4DGZ A;  1PH5 A;  1Y14 B;  4CDE C;  3RZD B;  5M3M B;  3NXW A;  1CKM A;  1AZQ A;  3AFQ A;  3CRL C;  1EWC A;  3TN2 A;  5FO9 B;  2A6E D;  3HZX A;  3FKI H;  4X3T A;  1R4P B;  5E4X A;  4APV A;  2E2I H;  1I3Q H;  3OSO A;  2K7V A;  5I6Y A;  1VCI A;  2R93 B;  3S2D B;  3HOV B;  1Y8N B;  5AJ3 Q;  5GAE C;  4IOC A;  1YIT A;  5C3E G;  1EU3 A;  3LGJ A;  4JI7 Q;  1A3U A;  3RNU A;  1E2V A;  1SSO A;  1KAB A;  4OXP A;  2VQF L;  1I94 Q;  1N8R C;  2D9U A;  2B29 A;  1YHQ A;  2EXD A;  4EGV A;  5K36 H;  4R4Q A;  1CQF A;  4HJ7 A;  2UXC Q;  3PF5 A;  1R4Q B;  4KJN A;  4RKB A;  3RLF A;  2OTL A;  2LXJ A;  4NW2 A;  3A74 A;  2LS0 1;  4PZ8 A;  4FDB A;  2Q2U A;  2AMC B;  1A8V A;  2A6E C;  3OWE B;  3KF6 A;  3H0G H;  3PO2 G;  5IYB G;  2VNU D;  1LT5 D;  1VQJ A;  1S5B D;  5DM7 3;  3U9O A;  1SYC A;  2NVQ B;  3MXU A;  1PLF A;  4XXE A;  4YHH L;  2UXB Q;  1QE6 A;  1HZ9 A;  3U9S A;  1E3P A;  5JJK A;  5HUR A;  3CKI B;  2OF1 A;  4IUP A;  1I6V C;  2PCF B;  1A15 A;  2JA7 H;  1JE5 A;  1DZ1 A;  3V2T A;  5M5Y H;  3MEH A;  3K81 C;  1GO3 E;  3K7U C;  5CV4 A;  4TSS A;  1RD9 D;  3GV6 A;  1PZI D;  2K5Q A;  1HUN A;  3D31 A;  4HCS A;  4RAU C;  2L9H A;  3JAM i;  3F8T A;  2QA4 A;  5FJ8 G;  2XSC A;  1PRT B;  1D6E C;  4B9W A;  1CM9 A;  5GAD C;  5IY0 A;  4IPH A;  5CV9 A;  2WB1 E;  4C3I H;  2ID0 A;  2EOT A;  5JJI A;  3J81 E;  4TVA B;  2WKD A;  3PUX A;  4YWM A;  4JI1 L;  5M3M G;  2VQE Q;  1PRT F;  1NUC A;  3EIV A;  3HS0 C;  1K0R A;  3HOU H;  4HIK A;  1EQV A;  1EOV A;  3RZO H;  4LFB L;  4ILW A;  3KUP A;  4ID6 A;  2WII B;  3UDX A;  3I4L A;  2A5H A;  1MGS A;  5C5L A;  1HA5 A;  4H0L C;  2AWO A;  2R93 G;  1LT6 D;  1TXY A;  2WAQ B;  3OPO A;  3HOV G;  1FNW A;  2WP8 J;  4UHV A;  1QVC A;  3FRP B;  4AIM A;  1B50 A;  1CHP D;  3CXC A;  5C4H A;  4PMW A;  1EIY B;  1X32 A;  3IAY A;  4A3F B;  5EKL A;  4OWT B;  3G4S A;  4RGT A;  1TS4 A;  4KLK A;  4CJ2 C;  4YWK A;  5JVH 3;  4DV3 Q;  5FLX c;  1O7I A;  3K80 C;  3OW7 A;  3TBI B;  4QGU A;  2NVX H;  1B8A A;  4BBS H;  1LTA D;  1PRT C;  4DAP A;  3C2P A;  3PSI A;  1FNV A;  3B6Y A;  4O0A A;  3KF8 B;  3SK8 A;  5HGT A;  3RD4 A;  3I4M H;  2AWN A;  5CYU A;  1WTO A;  4A3M H;  1HR0 W;  1XNR Q;  1JWM D;  1BR9 A;  1BBW A;  3ITP A;  5IP9 G;  1E1O A;  4KHZ A;  2RDF A;  1RJT A;  3BYY B;  3BVM A;  4K6D A;  2SNS A;  5A35 A;  1IXR A;  5ISR A;  1JJ2 A;  1SYD A;  4DN4 M;  1J5E L;  4RGO S;  3G7L A;  1AP0 A;  2NTS A;  4HSV A;  2E74 C;  4YCW A;  5EAY A;  4DR7 L;  2PYK A;  1ONL A;  1TS2 A;  4P2C B;  1Y1V B;  1WCM B;  1EY7 A;  2PZT A;  1KDA A;  2L12 A;  3DM1 A;  1TVX A;  2EQS A;  2ZT9 C;  5IE8 A;  5FLX E;  1KRS A;  4JI5 Q;  4YY3 L;  2WIN B;  5JJZ A;  4A3K B;  2KHJ A;  2M00 A;  4QUF A;  2FMC A;  2KQ3 A;  3R8B A;  3KBX A;  4UP8 A;  1LTR D;  4KHV A;  1V1P B;  1HHV A;  2Y0S B;  2PI2 A;  3FP9 A;  2VL6 A;  1U9R A;  4S3S A;  4BY7 B;  3ZJY C;  2K01 A;  1Q81 C;  2Q8I B;  5IT9 E;  3EQL C;  4U68 A;  2WAQ G;  2F0L A;  2EDG A;  3DXJ C;  5JEA H;  1K8G A;  2WAC A;  3GTL B;  1H9M A;  1EIH A;  1TWG B;  4J6H A;  3SEB A;  1K83 B;  2HHH Q;  2KCM A;  3S1R H;  4A3F G;  2HUG A;  4BY1 B;  1PH6 A;  1CA6 A;  4LFA Q;  1C48 A;  1I50 H;  1X3G A;  3CRK C;  4C3J G;  4K8J A;  3KJP A;  2AQ3 B;  1G2T A;  1N9W A;  1PMR A;  3RLO A;  2EY5 A;  1U5K A;  4L5S A;  1S5F D;  3V05 A;  1ESR A;  1TWA B;  1Y1W B;  4L5Q A;  1M8A A;  1UUP A;  3BYT B;  3D0F A;  3HOW B;  1DOK A;  3M9B A;  4RKL A;  4A3D B;  1SR3 A;  2I5H A;  5EPL A;  4NP5 A;  1Z47 A;  1EY8 A;  2KA7 A;  1E2W A;  3EJI A;  2R61 A;  3LWE A;  4MNO A;  1RL2 A;  3ND9 A;  1PYS B;  1VQ9 A;  1GUO A;  4JI0 L;  1ML0 D;  3OIQ A;  5J3B A;  1VQB A;  1X56 A;  5C3W A;  5LMN W;  4RHR A;  1WCM G;  4B3T L;  2EPB A;  3D6W A;  1F2Z A;  1MD2 D;  4N8X 1;  2KUM A;  1JOR A;  2EYO A;  1F9Q A;  2F0K A;  4IZ8 A;  3A8I E;  4A3K G;  4G7O C;  2XN9 C;  1BKB A;  4CJ1 B;  1B44 D;  1A63 A;  5EBC A;  4QQB X;  2B2U C;  1WTQ A;  4F7X A;  1WJJ A;  4A3I H;  1J9O A;  3PO3 H;  1GJX A;  3MFY A;  1H9K A;  3KYH C;  2Y0S G;  4JCV E;  4IUV A;  2IX1 A;  3NBH B;  1XXG A;  4C3H B;  2Q2I A;  1MI2 A;  1TY2 A;  3GTQ B;  4BY7 G;  4QMG A;  4RA8 A;  3TQY A;  4G7H C;  2RKS A;  1SYG A;  1W6K A;  4OIJ A;  1JWU D;  4HSP A;  2EY1 A;  2K04 A;  5HY6 A;  5AJ3 L;  4N8F A;  2ALY B;  3TDQ A;  2LY7 A;  1GUW A;  2PMZ B;  1F2L A;  4JI7 L;  1PFM A;  4UAI A;  3H3V H;  4MZ9 A;  5EBD A;  2F3V A;  1ASY A;  1QCB D;  4BY1 G;  1I94 L;  1NMG A;  1SLJ A;  2O4X A;  2PI2 E;  3JAM c;  1EY5 A;  2JA8 B;  2UUB Q;  3BDC A;  4BA1 I;  2V1C C;  4JBJ A;  2F1M A;  2CQA A;  2HDL A;  2J7Z A;  2Q2H A;  3S9W A;  2UXC L;  1CSQ A;  2IPK D;  2JE6 I;  2TMP A;  5H1S E;  3MA2 B;  3PUZ A;  1JOK A;  3BZK A;  1NR4 A;  4V0B A;  2E2J H;  1Y1W G;  1YJN A;  3DWA A;  1QVF A;  4GOP B;  1LYL A;  4CHT B;  2SEB D;  1U4P A;  3HOW G;  4A3D G;  5KNC A;  1LAB A;  3NEN A;  5C4J B;  4GKJ Q;  3OMG A;  2IY5 B;  1SJH D;  5DAU A;  3K7A H;  1IYU A;  2G9D A;  1DCZ A;  1UE1 A;  4PMC A;  4IPD A;  1DON A;  1L2F A;  2UXB L;  2IL8 A;  4IPC A;  4DR2 Q;  2OTJ A;  5EKK A;  4HIO A;  3S2H B;  2AQ2 B;  2XIW A;  2JA9 A;  2F4I A;  3U50 C;  1YJ9 A;  3K0Y A;  1PH3 A;  5M5X H;  2ATW A;  3J81 i;  4A3G B;  2CWP A;  2L4N A;  1EIG A;  4J8Q A;  4JBW A;  4RG1 A;  3I8Z A;  2IJ0 A;  1PYW D;  3DLL A;  3BZC A;  3GTM B;  2ZXP A;  1DJR D;  4QIW E;  2N49 A;  4KKT A;  5LHY 1;  3EBE A;  4X64 Q;  1LAC A;  1YNN D;  1SNO A;  4B3M Q;  4HED A;  1H9S A;  2D2C C;  3G71 A;  1XYI A;  1IBL Q;  1PTO D;  1I4Q A;  3MTS A;  2N88 A;  1BO0 A;  1SE2 A;  4F88 A;  3VR2 A;  5C0X G;  2PZW A;  4HMI A;  2Q2T A;  4DF7 A;  1I4P A;  1H9R A;  4R4T A;  1V9P A;  3KDF B;  4GOP C;  1WVL A;  4C3H G;  1V8Q A;  2AUK A;  1X9N A;  2JP1 A;  1JIC A;  3L3O C;  2NVY H;  4A93 H;  2FMM A;  1BOS A;  2E2H H;  3HOX H;  1ENF A;  1QZG A;  5JOB A;  1BDO A;  5JPM C;  2V4D A;  3Q22 A;  1KXL A;  4P75 A;  3MFG A;  3TP5 A;  4OIK A;  4A3C H;  1B9N A;  1LTG D;  3TZD A;  1Y8P B;  2Z4I A;  1KC8 C;  1PTO C;  3FHW A;  2JA8 G;  1N33 Q;  1SE8 A;  1XX8 A;  4DV3 L;  2B2V C;  3NP8 A;  1EIF A;  2UUC Q;  4BA2 I;  5JEA J;  3W3A A;  2GN5 A;  3OYY A;  4R8N A;  1PV4 A;  2YU9 H;  2B2W C;  1IHZ A;  1D7Q A;  1DOL A;  1Y8O B;  5CGK A;  2LXK A;  4DR4 Q;  1A62 A;  1SYF A;  2KHS A;  5IYC G;  1S5C D;  4XQN A;  1XNR L;  1IYJ B;  2KEC A;  3L9A X;  1WYD A;  2CVR A;  3HKZ E;  1M90 C;  4H44 C;  2WB1 B;  4V19 0;  4JW0 A;  3GTO H;  4OO1 H;  1LTS D;  1N36 Q;  1I3Q B;  5M5W H;  4ODG A;  2JA5 H;  1GUG A;  2DUD A;  2JQO A;  1EY0 A;  2Z4H A;  5IYD G;  1X3P A;  4A3G G;  3NEM A;  3PCO B;  1Q8I A;  1CKN B;  1JCK B;  2F0F A;  4R4I A;  3I4N B;  1MBY A;  1B3Q A;  3O13 A;  4C1N I;  1TT2 A;  4GNX A;  2B63 B;  4FO2 A;  4WFN 3;  2AKW B;  4CDD C;  1RHP A;  2KEN A;  1XNQ Q;  2RCF A;  4JI5 L;  1K8O A;  3ND8 A;  3K5N A;  1EFW A;  3VR6 A;  4BBR H;  3J81 j;  5LMN Q;  4K0K Q;  2BA0 A;  3NTK A;  3CHB D;  1BVS A;  5FO7 B;  1SYB A;  2JK8 A;  3CME A;  3LX0 A;  2CW0 D;  3GTJ H;  1VQL A;  3SDZ A;  1K3B C;  1QB5 D;  1I4R A;  1SFO H;  2A6H C;  2QEJ C;  4NXM Q;  1Q82 C;  1JMC A;  1A0I A;  1EY4 A;  3QWN A;  1KNE A;  3A5Z B;  2E8G A;  3J80 i;  4OGQ C;  2IWH A;  4IFD J;  2HDM A;  4AH6 A;  4DR3 Q;  3CC2 A;  1JT8 A;  3M3Y B;  1PTO H;  4CKE A;  1EQQ A;  3A7L A;  5I4D A;  1JWS D;  2NVT H;  1PVO A;  1S3O A;  1L1O B;  3C1E A;  1FJG Q;  3CCM A;  2HHH L;  2UUA Q;  5I6W A;  4JI8 Q;  3KBG A;  4DV4 Q;  4LFA L;  5D65 A;  2G9H D;  3ZYY X;  4ME3 A;  3U4Z A;  3VA5 A;  1V1Q A;  4NMZ A;  2IW3 A;  5D3D A;  5CBE E;  4I7A A;  1IL2 A;  2CW0 C;  2F0M A;  4HJ8 A;  1HCZ A;  4DAY A;  3UE1 A;  2BDO A;  2QIL A;  2K28 A;  5J1Z A;  1SJE D;  4P71 A;  3OMC A;  2JA6 H;  5C4X B;  2EJM A;  4LJZ C;  3URY A;  2MNA A;  4C3I B;  1EYC A;  3I73 A;  4ME5 A;  4DA2 A;  1S72 A;  4IOA A;  3IKJ A;  2AHO B;  3GO5 A;  2WB1 G;  3R2I A;  3DUZ A;  2D62 A;  3S24 A;  4CKB A;  4R4C A;  5T1G A;  2F0V A;  4GLV B;  3MC0 B;  4JVZ A;  4QB4 A;  4DK0 A;  2BOS A;  4QL5 A;  2A69 D;  3TRE A;  1FD7 D;  2SNM A;  1L1O C;  3S1Q B;  2KHI A;  4K5V A;  3I4N G;  1G91 A;  1QUQ B;  4K5X A;  2B63 G;  1LLR D;  2BCO A;  3FEW X;  2XWB B;  1Q12 A;  2KEE A;  2QKI C;  1WD1 A;  4OL7 A;  5K36 G;  2TSS A;  4LNQ A;  3BJU A;  5I9P A;  3E9H A;  1XPR A;  2OQK A;  1CI3 M;  2NVX B;  2KCT A;  1IZ6 A;  2DY7 A;  4LK1 C;  2QEX A;  4GZY C;  4POF A;  3A56 A;  1RTN A;  4A3L G;  4KHP Q;  4Q5V A;  3CCR A;  3Q0A A;  3GTG B;  3DM3 A;  1C8C A;  4EX5 A;  1B3A A;  2GVB A;  1XMO Q;  4LUO A;  2UXD Q;  1I6H H;  2A69 C;  3VYR A;  2HQE A;  4NXN Q;  4OWW B;  3WWV A;  5FLM H;  2F3W A;  4F8M A;  2HCC A;  4IUU A;  3J81 c;  4IPG A;  2FHT A;  3HOY B;  4N9P A;  2K32 A;  3WOE A;  1TWH H;  3SVM A;  4U67 3;  1ILQ A;  3CP0 A;  5C5M A;  3MEF A;  3ONA B;  3G48 A;  3F2B A;  2KED A;  1F9R A;  2VZA A;  2ZM6 Q;  4ZYS A;  1UAP A;  2UUB L;  1CZG A;  3S16 H;  3S15 H;  2NYZ D;  4KI0 A;  4DV5 Q;  3HP3 A;  3J7A V;  2EVB A;  4O42 A;  4JI4 Q;  1FGB D;  5C4X G;  1I4G A;  2QW7 A;  5IP7 G;  4H13 C;  1BQQ T;  4LF5 Q;  4C3I G;  3TS2 A;  4HN7 A;  3CAM A;  2NZO A;  5EQ0 A;  2B2Y C;  4JI6 Q;  4RGN A;  2J4X A;  1I4H A;  3HG9 A;  4GKJ L;  1MJC A;  5GQO A;  1EU4 A;  5K5P A;  1STA A;  3PO2 H;  4PZ7 A;  5IYB H;  4A3J B;  1HNW Q;  1GHK A;  4DNI A;  4DR2 L;  2F4V Q;  3SE0 A;  2H5X A;  3I55 A;  2VB2 X;  1VQG A;  2ICI A;  4GKK Q;  4XIG S;  1HPC A;  1B7Y B;  3E3X A;  1PRT D;  2RCN A;  2KVM A;  3RN5 A;  1EOT A;  4MTK A;  2XTI A;  1OXS C;  3S1R B;  1VQF A;  5DEH A;  2MO0 A;  1YVC A;  1QOH A;  3CQZ B;  4X64 L;  4LUV A;  1T5E A;  5IIF A;  5IGF A;  1D5Z C;  4B3M L;  1I50 B;  1IBL L;  4CGY B;  1G6Z A;  1VS0 A;  4ULL A;  5KYL A;  3K59 A;  1VQ7 A;  3ERO A;  1UE5 A;  4R8I A;  5FJ8 H;  1STG A;  2RHQ B;  3NUC A;  4B3S Q;  3G6E A;  3H15 A;  1Z7T A;  4TQU S;  5IGD A;  4C3J B;  5IGC A;  1PZJ D;  1L0Y B;  3RZD H;  4TKO B;  4A3E H;  4BS9 A;  3CCL A;  4UP9 A;  3M4O B;  1OXU A;  1SN8 A;  3T1H Q;  1E22 A;  1MIU A;  5NUC A;  3HOY G;  3MXP A;  4K2K A;  3HGB A;  1CZW A;  1Q7Y C;  2R93 H;  4LF7 Q;  1G29 1;  4OEL B;  1YNJ D;  2O2L D;  2Z0S A;  3S2D H;  3HOV H;  1PYB A;  3K58 A;  1VQK A;  1N33 L;  1LTL A;  4K5W A;  3W5O A;  2KJX A;  5IT9 c;  3E9I A;  4DAV A;  4N9T A;  4YWL A;  1TWF B;  3KJO A;  2UUC L;  4Z9C B;  1PZK D;  3SHL A;  3Q23 A;  1GUT A;  3W1B A;  3S14 B;  5COR A;  1UEA B;  2XNA C;  4QIW B;  1EFI D;  4DR4 L;  2PNH A;  3J80 c;  1B70 B;  1WFQ A;  2DJG C;  2K75 A;  4HJA A;  4GLX A;  1K73 C;  4HCE A;  1JR0 D;  4A3I B;  1WOC A;  1HJP A;  2RF4 A;  4LF6 Q;  3EFX D;  4K6L A;  2CWA A;  4A3J G;  4RH6 A;  5KGU A;  1N36 L;  3I7F A;  4X66 Q;  1YNJ C;  1O7Z A;  4KKU A;  4G7Z C;  1Q1E A;  5A2Q L;  5IP9 H;  2NVQ H;  4OON A;  2HD3 A;  2SDF A;  1TS5 A;  1QNU A;  2F0J A;  4KD4 A;  2QF7 A;  1CT1 D;  2IHE A;  4G4K A;  4R1J A;  4FXK C;  3A5U A;  3CCV A;  3D4R A;  5EJW A;  1NSN S;  3H09 A;  1BUV T;  3TP7 A;  1SNQ A;  1STH A;  1XNQ L;  3K57 A;  1MSH A;  1KD1 C;  5GAG C;  2R92 B;  1EWI A;  2HIX A;  5ELE A;  5LMN L;  4ZK9 B;  1EYG A;  4K0K L;  3CF5 A;  2RDG A;  5COY A;  1L0X B;  1SND A;  5G3L F;  4OWX B;  2A74 C;  4DNT B;  3KLS A;  4B08 A;  1STY A;  3J80 E;  1SYE A;  4NXM L;  2N55 A;  1F9P A;  1U4M A;  2D0P A;  2EYJ A;  3K5M A;  2B2T C;  1HRJ A;  3QB3 A;  4DR3 L;  4DAM A;  5C0X I;  1HTP A;  3PGZ A;  4OX9 Q;  1S40 A;  3SGI A;  4PV1 C;  1VQI A;  4A4I A;  4IJH A;  3IRB A;  2L11 A;  2PW7 A;  1FJG L;  3RLN A;  4DPG A;  2UUA L;  3GTK B;  3NTH A;  1UE6 A;  2DJF C;  4JI8 L;  1TU2 B;  4DV4 L;  2XGT A;  3HKZ B;  2K5N A;  2ZJQ A;  4LF8 Q;  1S5E D;  1X55 A;  4CDC C;  4QJF A;  1KNA A;  3MZ5 A;  1AE2 A;  3MWY W;  4XTC S;  2NUC A;  2MO1 A;  4A3F H;  4X3K A;  5BR8 Q;  4UDU C;  3LWU A;  1TWC B;  3VYS A;  4C1N K;  5JJL A;  1XJV A;  3T16 A;  5FK9 C;  1BXT A;  4IUT A;  4JI3 Q;  2AQ1 B;  3M7N A;  4KY6 A;  4FVM A;  4DUZ Q;  4AQY Q;  1AZP A;  3CD6 A;  4RCO A;  2X6G A;  4MHE A;  3KLR A;  4A3I G;  5JAV A;  1YIJ A;  1LUZ A;  1SNM A;  4IFD H;  3PIO A;  2A73 B;  3GQB A;  4ZQ3 A;  5FOB B;  2PQA A;  1ILP A;  1V43 A;  3CU7 A;  1YBY A;  2FFK B;  1RKN A;  3I2Z A;  5C3X A;  4JOI C;  1D5X C;  2EXZ A;  1VQC A;  1GOZ A;  2EIF A;  1ZEQ X;  2OCE A;  4L63 B;  5CV6 A;  1EWH A;  1H9S B;  3OTO Q;  1XPU A;  2QCP X;  1E24 A;  1D8L A;  1Y1V H;  2K5W A;  2F0D A;  2R92 G;  1VF5 C;  3HOZ H;  1F77 A;  1T9H A;  3ULL A;  2I5M X;  5C6A A;  3R3O A;  3CC4 A;  3IFD A;  4DV7 Q;  3S17 H;  2OWO A;  4KHP L;  4A3B H;  1KHI A;  5C44 H;  1PH9 A;  2MHV A;  1GM5 A;  1W2B A;  2R6G A;  4FF2 A;  1XMO L;  4WJ4 A;  1FYC A;  2UXD L;  2BE5 D;  3S1M B;  1KDC A;  1OO9 B;  4K8I A;  4NXN L;  3KK7 A;  3L0O A;  4DR5 Q;  4OHJ A;  5CC4 A;  1J8I A;  1BBU A;  4DV0 Q;  2B2U A;  1JJC B;  3I56 A;  3MXG A;  2VUM B;  2F0U A;  4PG3 A;  3VR5 A;  1ICF B;  2K5V A;  3Q6S A;  3D6C A;  4X3U A;  2M2L A;  4KK7 A;  1FR3 A;  2YV5 A;  1VQ8 A;  1VF7 A;  3HKZ G;  1LTB D;  2ZM6 L;  3GTL H;  1HA6 A;  4H7B A;  1TWG H;  1XWE A;  5KRU A;  1HFN A;  1K83 H;  1HH2 P;  2R7Z B;  4DV5 L;  4I7Z C;  3SK5 A;  4ALP A;  1D2B A;  4DK1 A;  3I3C A;  1G2S A;  1GUS A;  1BCP B;  3UDG A;  2L5T A;  2PW5 A;  4BXX G;  3I4O A;  1HR0 Q;  4JI4 L;  2K5D A;  2Q8T A;  4Y7N H;  1AEX A;  4QY7 A;  3NPP A;  1HZA A;  4LF5 L;  2BE5 C;  2A68 D;  1IKM A;  4JI6 L;  2B8F A;  1YZ6 A;  5AFW A;  4CBV A;  1SE4 A;  1WTH A;  1BCP F;  5LMU Q;  4EQ5 A;  4AYB E;  3K5O A;  3DWP A;  1F2Y A;  2ICE C;  1R9T B;  3NSW A;  2NN6 I;  1HNW L;  4A3D H;  2F4V L;  3L2P A;  1HNX Q;  1I5F A;  3CC7 A;  1JB7 A;  3AMU A;  4GKK L;  3QJY A;  4DV2 Q;  1AH9 A;  3Q24 A;  1PH1 A;  2HQL A;  1E7Z A;  3D8G A;  5ELD A;  4KY5 A;  2VXW A;  3DEO A;  3C1F A;  3NBH A;  4IJL A;  3WDN A;  2D0O A;  2AUJ D;  3MAQ A;  3SXH A;  1D5M C;  2A68 C;  2MFI A;  4LWC A;  1V1O A;  1VQ4 A;  1E2Z A;  2IX3 A;  2RHS B;  3VR3 A;  5L37 A;  2Z9H A;  1GHJ A;  3MXN B;  1P8L A;  3U58 A;  3MHB A;  4FNF A;  3K6O A;  3GTP B;  1SEB D;  3R2T A;  4B3S L;  1TQO A;  4UY8 C;  1AFP A;  2ZXR A;  4GN5 A;  4L5R C;  3TEH B;  1O7L A;  2Z6K C;  1ESF A;  3T1H L;  4FP5 D;  4C3H H;  5CV5 A;  3GTQ H;  2VUM G;  2KCN A;  4NB3 A;  1PXU A;  4ABN A;  1JB3 A;  4IUN A;  2PPB C;  4GOP A;  3IL8 A;  3NQI A;  1PH7 A;  4ZAI A;  3SR1 A;  1VQE A;  4WOR A;  4LF7 L;  5HGQ A;  1GVP A;  1X3Q A;  2DGY A;  1B2T A;  3QOJ A;  3CPF A;  5BN3 A;  4LAA A;  2R7Z G;  2A6H D;  3G6J B;  1ZYR D;  3FKI B;  4DR1 Q;  2K6A A;  2E2I B;  1HNZ Q;  1EYD A;  1STB A;  2OT2 A;  5IWA Q;  2WFW A;  5KEE A;  3DEP A;  4K2L A;  2JA8 H;  3J7Z C;  1K0S A;  1ET9 A;  1J6Q A;  4KY7 A;  1EY6 A;  4FF4 A;  1CSP A;  5FLX L;  1CTM A;  3SK6 A;  3M4P A;  2I46 A;  5E1F A;  4DV6 Q;  2QDL A;  3J7A 5;  1H9J A;  2B2V A;  3H94 A;  1HZB A;  4K14 A;  1CA5 A;  3R93 A;  4LF6 L;  2OXP A;  4UPA A;  3X3M A;  4X6A H;  1SMX A;  3PMF A;  2R7F A;  1BNZ A;  3GDE A;  5IYC H;  5C4J H;  4X66 L;  1C9O A;  2B2W A;  1VDZ A;  3T4A C;  5IGE A;  3M7G A;  4GN4 B;  3TME A;  3U4V A;  1YI2 A;  4IO9 A;  1JOO A;  1LT4 D;  1ZYR C;  4B9X A;  1DYQ A;  3H0G B;  2N78 A;  1LV9 A;  1D1K A;  1F2M A;  3D4D A;  1STN A;  4PNY A;  4C56 C;  3S2H H;  2XRS D;  4DUY Q;  2LSS A;  3PUY A;  3N52 A;  1MJE A;  3A55 A;  3FPU B;  4A3G H;  4FXD A;  2NB0 A;  1GKH A;  5M3F H;  3GTM H;  4WJW A;  1TY0 A;  4CDF C;  5GRO A;  3H91 A;  3J7A F;  1EEI D;  3PIP A;  4JC0 A;  3C3L A;  2JA7 B;  2IHF A;  2CH4 A;  1X65 A;  5CMD A;  5M5Y B;  1STE A;  5IGG A;  1S4Z A;  4JV5 Q;  3M4Y A;  2QDB A;  3UI2 A;  1SXT A;  1CHQ D;  3BG3 A;  4HTH A;  4LUZ A;  5ELN A;  1LO5 D;  1SNP A;  2RSO A;  1Y69 U;  3P1H A;  5JVG 3;  3KF6 B;  2ZJR A;  3OHX C;  1RDP D;  1IYV A;  2NN6 G;  4OX9 L;  1PDQ A;  1LTI D;  1EQT A;  3DMU A;  2SOB A;  2K1B A;  3T1Y Q;  4DV1 Q;  3J7Y W;  2E5L Q;  1NR2 A;  4EVO A;  4LF4 Q;  2BA1 A;  5CV7 A;  1PH8 A;  1NMF A;  1B9M A;  3GV3 A;  2A19 A;  2F0G A;  4LF8 L;  5KYI A;  3HOU B;  5GAH C;  3RZO B;  4X3S A;  1IL8 A;  2XWJ B;  2Q8R E;  1Q86 C;  3FKI G;  4J15 A;  2NZ1 D;  5BR8 L;  3T56 B;  2EYL A;  1AN8 A;  2CFM A;  2E75 C;  3CCS A;  4YIJ A;  4WRD A;  5CR3 A;  3S1N H;  5M9O A;  2DN8 A;  4JI3 L;  3BZD B;  4QUC A;  3FMC A;  1CKN A;  1NAP A;  3TP8 A;  4B3R Q;  4DUZ L;  4AQY L;  1Z6H A;  2I5L X;  3I70 A;  2HT1 A;  1KRT A;  4DKA C;  1QWY A;  3QG1 A;  1ENA A;  1LT3 D;  3WOF A;  1GD7 A;  4A3E B;  4BBS B;  4NDX A;  5FLM G;  1ENC A;  2K03 A;  2ZJP A;  5CV8 A;  4KV6 A;  3VDY A;  5ELF A;  2E76 C;  2N3S A;  4X65 Q;  1NCV A;  2L15 A;  2N8N A;  4ZRZ A;  3H0G G;  4XQJ A;  3I4M B;  4HR7 B;  2YTV A;  4A3M B;  3OTO L;  4KKS A;  1S5D D;  3JC6 6;  4PQX A;  1P16 A;  3FVQ A;  4KMU C;  5J39 A;  3OOC A;  2LKV A;  3I4N H;  4FYD A;  2B63 H;  1QZH A;  3RN2 A;  3CCE A;  2LFN A;  4DV7 L;  3I90 A;  1L1O A;  4IUR A;  1ZKO A;  1VQH A;  2JA7 G;  1BBX C;  4HID A;  2R7D A;  5JPN C;  5C3E H;  3V96 A;  3AB9 A;  1T5X D;  5I2X A;  4A3L H;  1MHW C;  4JPB W;  4OEM B;  1NNX A;  1VMC A;  2X6L A;  4DR5 L;  1IBK Q;  1LM0 A;  4DV0 L;  3P75 A;  4X62 Q;  3FDT A;  3TS0 A;  1ICW A;  2EE1 A;  2MGS A;  3TZU A;  4IAL A;  4KJO A;  1QVG A;  3CPW A;  3M3Y H;  3HFZ B;  5C0X J;  1OXV A;  3HOU G;  2Z6B A;  1HTL D;  4WJ3 M;  3ER0 A;  4BWG B;  4P73 A;  2EYF A;  4EQO A;  1K8A C;  3JAM L;  1HR0 L;  4L5T A;  2UU9 Q;  1LTT D;  3NE5 B; 
#chains in the Genus database with same CATH homology
 3DLL A;  3BZC A;  4DAM A;  2K52 A;  4NPS A;  1K3R A;  5C0X I;  2VW9 A;  3PGZ A;  4OX9 Q;  4QIW E;  1S40 A;  2MQH A;  2N49 A;  3EBE A;  2I0Q A;  3SGI A;  4C2M H;  4X64 Q;  1VQI A;  5LMU L;  4HJ9 A;  4A4I A;  1QUQ A;  4IJH A;  3IRB A;  5C4X H;  4B3M Q;  2PMZ E;  1FJG L;  2F52 A;  3RLN A;  4DPG A;  5IP7 H;  1IBL Q;  3G71 A;  2UUA L;  1N32 Q;  3PF4 A;  1UE6 A;  4JI8 L;  1WI5 A;  4IFD I;  1KAW A;  2NZH A;  4DK3 C;  4DV4 L;  2XGT A;  1Q1B A;  2K5N A;  5C0X G;  2ZJQ A;  3KLW A;  4JBK A;  4A3E G;  2QGQ A;  2Q2T A;  3UDI A;  4LF8 Q;  1X55 A;  4BBS G;  1HNX L;  4QJF A;  1EQR A;  2JEA I;  4R4O A;  4P72 A;  1AE2 A;  4JYA Q;  4XTC S;  1UE7 A;  4R4T A;  1V9P A;  2MO1 A;  4DV2 L;  3KDF B;  1X6O A;  4GOP C;  4LFC L;  4A3F H;  4JI0 Q;  1NJI C;  5BR8 Q;  1SRU A;  3CCU A;  3GTP H;  3ULP A;  1X9N A;  5JJL A;  1XJV A;  3I4M G;  2NVY H;  5M3M H;  4JG2 A;  4A3M G;  4A93 H;  1Z9F A;  4YCU A;  4DK6 C;  3PUW A;  4B3T Q;  4JI3 Q;  3M7N A;  2E2H H;  3A0J A;  3HOX H;  1QZG A;  4DUZ Q;  1NY4 A;  3BU2 A;  4AQY Q;  3CD6 A;  3S1Q H;  4Y52 H;  4A3I G;  1KXL A;  4P75 A;  1YIJ A;  1LUZ A;  1Q8K A;  4BXX G;  4A3C H;  3PIO A;  3H3V I;  3AYH B;  1KC8 C;  2CKZ B;  1PH5 A;  1Y14 B;  2PQA A;  3FHW A;  4LF9 Q;  1N33 Q;  1V43 A;  1X3F A;  1X3E A;  2JA8 G;  1YBY A;  1SE8 A;  3I2Z A;  4DV3 L;  1XPO A;  1CKM A;  1RIP A;  3PV0 A;  2IX0 A;  4JOI C;  1EIF A;  3AFQ A;  1U0L A;  2UUC Q;  4BA2 I;  5JEA J;  1VQC A;  2GN5 A;  2EIF A;  3FKI H;  3OYY A;  4APV A;  2E2I H;  2OCE A;  3GTG H;  1PV4 A;  1I3Q H;  2YU9 H;  3OTO Q;  1VCI A;  1D7Q A;  1XPU A;  1E24 A;  2LXK A;  4DR4 Q;  1D8L A;  1A62 A;  1Y1V H;  5IYC G;  5GAE C;  5AJ3 Q;  4IOC A;  1YIT A;  1N34 Q;  2R92 G;  1XNR L;  5C3E G;  1IYJ B;  3LGJ A;  1IBM Q;  3HOZ H;  4JI7 Q;  3RNU A;  1T9H A;  3ULL A;  1WYD A;  2I5M X;  3CC4 A;  3HKZ E;  2HIV A;  4DV7 Q;  1M90 C;  3S17 H;  2OWO A;  3K0X A;  4OXP A;  3HOY H;  2VQF L;  4A3B H;  4KHP L;  1KHI A;  1I94 Q;  3GTO H;  2OQ0 A;  5C44 H;  1N8R C;  1PH9 A;  1N36 Q;  5M5W H;  2JA5 H;  2B29 A;  4DR1 L;  1YHQ A;  1NTG A;  2DUD A;  2EXD A;  2JQO A;  4JI2 Q;  1W2B A;  1GM5 A;  1HNZ L;  2R6G A;  1FGU A;  4R4Q A;  5IWA L;  5IYD G;  1XMO L;  4A3G G;  4HJ7 A;  4WJ4 A;  1VQM A;  3PF5 A;  2UXC Q;  2UXD L;  3NEM A;  1VQD A;  1PH4 A;  3RLF A;  3PCO B;  2OTL A;  2LXJ A;  3A74 A;  1CKN B;  4R4I A;  4NXN L;  5JEA G;  1C7Y A;  3L0O A;  4DR5 Q;  4PZ8 A;  4FDB A;  2Q2U A;  4YCV A;  2AMC B;  3AQQ A;  1BBU A;  1A8V A;  4DV0 Q;  4GNX A;  1JJC B;  3W1G A;  3I56 A;  1XMQ Q;  3KF6 A;  2AKW B;  4DV6 L;  3H0G H;  4H02 A;  1W3S A;  3PO2 G;  4PG3 A;  5IYB G;  1M1K C;  4MTN A;  2VNU D;  2K5V A;  2KEN A;  1XNQ Q;  4JI5 L;  2PQA B;  5DLQ E;  1VQJ A;  1Q46 A;  1EFW A;  2YV5 A;  3AFP A;  4BBR H;  3J81 j;  5LMN Q;  1VQ8 A;  4K0K Q;  2BA0 A;  3HKZ G;  1YEZ A;  4YHH L;  4A75 A;  2ZM6 L;  1BVS A;  2JK8 A;  3GTL H;  4DR6 Q;  2UXB Q;  1TWG H;  1HZ9 A;  3L7Z C;  2BH8 A;  3CME A;  1K83 H;  1HH2 P;  1E3P A;  3GTJ H;  4DV5 L;  1VQL A;  5JJK A;  4ALP A;  1SFO H;  3AEV A;  2YTX A;  4A3J H;  4POG A;  2ZTC A;  4NXM Q;  1Q82 C;  4A76 A;  1JMC A;  1A0I A;  3UDG A;  2JA7 H;  1AE3 A;  1JE5 A;  3A5Z B;  2E8G A;  3I4O A;  3J80 i;  5M5Y H;  1KL9 A;  3K81 C;  3STB D;  1HR0 Q;  4JI4 L;  4IFD J;  1GO3 E;  1X54 A;  4QY7 A;  4Y7N H;  4DUY L;  1PHJ A;  4AH6 A;  4DR3 Q;  3K7U C;  4JBM A;  1HZA A;  3HKS A;  4LF5 L;  4GN3 B;  3CC2 A;  1JT8 A;  3D31 A;  4JI6 L;  1EQQ A;  1YZ6 A;  2IT1 A;  3JAM i;  5LMU Q;  3F8T A;  3UE0 A;  4AYB E;  4EQ5 A;  2NVT H;  1PVO A;  2QA4 A;  5FJ8 G;  1DGS A;  1S3O A;  1L1O B;  1FJG Q;  3RR5 A;  3CCM A;  2HHH L;  3KFU A;  3CQZ H;  2UUA Q;  5GAD C;  5IY0 A;  2JJQ A;  4JI8 Q;  4IPH A;  4DV4 Q;  2NN6 I;  2WB1 E;  4C3I H;  2ID0 A;  1HNW L;  5JJI A;  4TVA B;  1SRO A;  4LFA L;  1OXX K;  4A3D H;  3PUX A;  2F4V L;  4YWM A;  4JI1 L;  3L2P A;  1HNX Q;  5M3M G;  2VQE Q;  4JV5 L;  1I5F A;  4ME3 A;  3U4Z A;  1V1Q A;  3CC7 A;  3OW2 A;  1JB7 A;  1ASZ A;  3EIV A;  1VQP A;  3M4Q A;  4DV2 Q;  4GKK L;  1AH9 A;  1PH1 A;  4LFC Q;  2HQL A;  1K0R A;  1E7Z A;  4HIK A;  1IL2 A;  3HOU H;  1EOV A;  3RZO H;  4HJ8 A;  4LFB L;  2YTY A;  3UE1 A;  1C0A A;  3UDX A;  4P71 A;  1JJG A;  4IFD G;  2JA6 H;  4IJL A;  5E7N A;  2AWO A;  3STB C;  1FVI A;  4C3J H;  2D0O A;  2MNA A;  2R93 G;  1TXY A;  3T1Y L;  3HOV G;  2WP8 J;  4DV1 L;  1K9M C;  2E5L L;  2K50 A;  2MFI A;  4AYB G;  4LWC A;  1S72 A;  1VQ4 A;  3M4O H;  4LF4 L;  1QVC A;  3GD7 A;  4AIM A;  4IOA A;  3CXC A;  4PMW A;  2ZTD A;  1EIY B;  2AHO B;  2RHS B;  3PO3 G;  3GO5 A;  2WB1 G;  4OWT B;  3G4S A;  3MXN B;  4KLK A;  2D62 A;  1P8L A;  3S24 A;  3U58 A;  3PUV A;  4R4C A;  1VQO A;  4GLV B;  1YJW A;  4B3S L;  4YWK A;  1YHB A;  4QL5 A;  4DV3 Q;  4OO1 I;  5FLX c;  1O7I A;  3K80 C;  4UY8 C;  4QGU A;  2VS1 A;  3TRE A;  2NVX H;  1B8A A;  4BBS H;  1Y1V G;  2A1A A;  4GN5 A;  1L1O C;  4L5R C;  3TEH B;  2KHI A;  3HOZ G;  2Z6K C;  3I4N G;  1QUQ B;  3PSI A;  3T1H L;  2B63 G;  1TWF H;  1L0W A;  4B3R L;  3B6Y A;  4C3H H;  4O0A A;  3GTQ H;  4A3B G;  2CQO A;  2VUM G;  1Q12 A;  1OTC A;  3KF8 B;  4GS3 A;  4NB3 A;  5C44 G;  2FXQ A;  4HJ5 A;  3I4M H;  3UDF A;  3S14 H;  2AWN A;  4GOP A;  4A3M H;  1PH7 A;  1HR0 W;  1XNR Q;  5K36 G;  4LF7 L;  1VQE A;  4LNQ A;  3BJU A;  1WCM H;  3E9H A;  1BBW A;  1XPR A;  5HGQ A;  2OQK A;  5IP9 G;  1E1O A;  1GVP A;  2KCT A;  4KHZ A;  1IZ6 A;  2QEX A;  2DGY A;  4POF A;  2VQF Q;  1IXR A;  3CPF A;  4A3L G;  1JJ2 A;  4KHP Q;  1KQS A;  2R7Z G;  3CCR A;  1J5E L;  4DR1 Q;  4A3K H;  4X65 L;  3DM3 A;  1HNZ Q;  4EX5 A;  5IWA Q;  2WFW A;  2GVB A;  1XMO Q;  4LUO A;  4YCW A;  5EAY A;  4DR7 L;  2JA8 H;  3J7Z C;  2UXD Q;  1J6Q A;  1I6H H;  4NXN Q;  4OWW B;  3WWV A;  5FLM H;  1CSP A;  3ICE A;  4PZ6 A;  2A8V A;  3J81 c;  2WAQ E;  3M4P A;  4IPG A;  4DV6 Q;  2EQS A;  3J7A 5;  5IE8 A;  1HZB A;  1KRS A;  4JI5 Q;  4YY3 L;  4BY7 H;  4JOI A;  1TWH H;  4LF6 L;  3CP0 A;  4UPA A;  4X6A H;  1SMX A;  2KHJ A;  3MEF A;  2R7F A;  3G48 A;  3F2B A;  3GDE A;  2VZA A;  5IYC H;  2KBN A;  4YHH Q;  1PFS A;  5C4J H;  2R92 H;  4X66 L;  2ZM6 Q;  4UP8 A;  1C9O A;  2UUB L;  3S16 H;  3S15 H;  1FL0 A;  4KI0 A;  4DV5 Q;  3M85 A;  4GN4 B;  3U4V A;  1YI2 A;  4IO9 A;  2PI2 A;  3FP9 A;  1VQA A;  2VL6 A;  4BY1 H;  2N78 A;  4JI4 Q;  3S2H H;  1IBK L;  3ZJY C;  5C4X G;  4DUY Q;  2LSS A;  4X62 L;  3PUY A;  5IP7 G;  1Q81 C;  1MJE A;  4LF5 Q;  3TS2 A;  4A3G H;  3CAM A;  1E1T A;  2NZO A;  1CUK A;  2WAQ G;  4JI6 Q;  1GKH A;  5M3F H;  1K8G A;  4GKJ L;  1MJC A;  5GQO A;  3GTM H;  2K5H A;  2HHH Q;  2KCM A;  3S1R H;  1EUJ A;  1TWA H;  1NBW A;  4PZ7 A;  5GRO A;  5IYB H;  4A3F G;  1Y1W H;  3PO2 H;  1HNW Q;  3PIP A;  4DNI A;  3F2D A;  1PH6 A;  4JC0 A;  4DR2 L;  4LFA Q;  2IHF A;  1X65 A;  2F4V Q;  3GTK H;  4JI1 Q;  2H5X A;  3I55 A;  3HOW H;  1I50 H;  1X3G A;  3ERS X;  4JV5 Q;  3KJP A;  1VQG A;  4GKK Q;  4XIG S;  4A93 G;  1B7Y B;  4LUZ A;  2BH2 A;  1N9W A;  5ELN A;  4RMF A;  2RCN A;  2UU9 L;  3HOX G;  4LFB Q;  4GNX B;  3RN5 A;  3RLO A;  2CCZ A;  1U5K A;  3KF6 B;  2XTI A;  2ZJR A;  2F3I A;  1OXS C;  4L5S A;  2NN6 G;  4OX9 L;  1VQF A;  1PA6 A;  4A3C G;  2MO0 A;  1YVC A;  4L5Q A;  4X64 L;  4LUV A;  1TWC H;  4BXX H;  3D0F A;  3T1Y Q;  1VQ5 A;  4DV1 Q;  4B3M L;  3M9B A;  1SR3 A;  2I5H A;  3EN2 A;  1UEB A;  1IBL L;  2E5L Q;  1N32 L;  1VS0 A;  3E0E A;  4LF4 Q;  1Z47 A;  2BA1 A;  1PH8 A;  1NMF A;  1VQ7 A;  3K8A A;  2A19 A;  2VQE L;  1UE5 A;  4LF8 L;  5GAH C;  2B3G A;  5FJ8 H;  2ES2 A;  4JYA L;  2RHQ B;  4MNO A;  1RL2 A;  1Q86 C;  3FKI G;  1PYS B;  1G51 A;  4B3S Q;  3G6E A;  4J15 A;  1VQ9 A;  4LW1 A;  2Y0S E;  3H15 A;  4JI0 L;  1H95 A;  4TQU S;  5BR8 L;  5J3B A;  2CFM A;  3CCS A;  3RZD H;  2GVA A;  1VQB A;  4A3E H;  1X56 A;  5LMN W;  1UWV A;  3CCL A;  3S1N H;  1WCM G;  3CW2 C;  4UP9 A;  4HIM A;  4B3T L;  1OXU A;  1SN8 A;  4JI3 L;  3T1H Q;  3F1Z A;  1E22 A;  1CKN A;  1MIU A;  4B3R Q;  4DUZ L;  4AQY L;  2I5L X;  1PH2 A;  3HOY G;  2HT1 A;  1KRT A;  3F2C A;  2K14 A;  4DKA C;  4OO1 G;  4A3K G;  1Q7Y C;  2JA5 G;  4LF7 Q;  1VQN A;  1G29 1;  2R93 H;  2Z0S A;  1BKB A;  3S2D H;  3HOV H;  2C35 B;  3CMA A;  1A63 A;  1PYB A;  4QQB X;  4GNX C;  1GD7 A;  1VQK A;  4LF9 L;  1N33 L;  1LTL A;  3W5O A;  2ASB A;  1CKO A;  1WJJ A;  5FLM G;  2JEB I;  4A3I H;  2ZJP A;  3PO3 H;  5IT9 c;  3VDY A;  1J5E Q;  3E9I A;  3KYH C;  4DAY B;  2Y0S G;  2N3S A;  4JCV E;  4YWL A;  4X65 Q;  2L15 A;  2IX1 A;  2N8N A;  1YHA A;  3NBH B;  3KJO A;  2UUC L;  2Q2I A;  4DR7 Q;  3H0G G;  4BY7 G;  3W1B A;  2K4K A;  5ELO A;  2YTV A;  3TQY A;  2VY3 A;  3OTO L;  3JC6 6;  1P16 A;  5HY6 A;  4BBR G;  1XTD A;  3S1M H;  4DR4 L;  2PNH A;  5AJ3 L;  3J80 c;  1B70 B;  1WFQ A;  4GLX A;  2K75 A;  4HJA A;  1K73 C;  2ALY B;  1N34 L;  3I4N H;  1IBM L;  4JI7 L;  4YY3 Q;  1WOC A;  1QZH A;  2B63 H;  1HJP A;  2RF4 A;  3H3V H;  3RN2 A;  4LF6 Q;  3CCE A;  4DV7 L;  1VQ6 A;  2VUM H;  4MZ9 A;  1ASY A;  2CWA A;  1L1O A;  4BY1 G;  3ULJ A;  3CCQ A;  4A3J G;  1I94 L;  1NMG A;  1SLJ A;  2PI2 E;  2Z6K A;  1VQH A;  4O2D A;  1OXT A;  3JAM c;  4HID A;  1N36 L;  2R7D A;  3I7F A;  4X66 Q;  2JA7 G;  1KIX A;  2UUB Q;  1Q1E A;  4JI2 L;  4BA1 I;  5C3E H;  2V1C C;  2NVQ H;  5IP9 H;  4JBJ A;  4OON A;  3TRZ A;  2Q2H A;  2UXC L;  1CSQ A;  1YNX A;  5M3F G;  4A3L H;  2JE6 I;  5H1S E;  2R7Z H;  3PUZ A;  2IHE A;  4R1J A;  1HZC A;  4DR5 L;  3BZK A;  1IBK Q;  1LM0 A;  3KDF A;  3A5U A;  1G6P A;  4DV0 L;  3CCV A;  4X62 Q;  2E2J H;  1Y1W G;  1YJN A;  1XMQ L;  1QVF A;  4GOP B;  1LYL A;  5IYD H;  1NE3 A;  3TS0 A;  1XNQ L;  3HOW G;  4A3D G;  3NEN A;  5GAG C;  1KD1 C;  4GKJ Q;  1EWI A;  4GLA C;  1QVG A;  2IY5 B;  3CPW A;  3M3Y H;  4UP7 A;  2HIX A;  2YYZ A;  3K7A H;  4P74 A;  5LMN L;  1EYG A;  3HFZ B;  3NEL A;  4K0K L;  5C0X J;  1OXV A;  3CF5 A;  1UE1 A;  4IPD A;  3HOU G;  1L2F A;  4DR6 L;  2UXB L;  4IPC A;  2OTJ A;  4DR2 Q;  2ZTE A;  3KOJ A;  4WJ3 M;  4OWX B;  4HIO A;  1MKH A;  3CCJ A;  1R9T H;  3ER0 A;  3U50 C;  2JA9 A;  1YJ9 A;  4P73 A;  1PH3 A;  2ATW A;  2JA6 G;  5M5X H;  4NXM L;  3J81 i;  2D0P A;  1K8A C;  2CWP A;  1HR0 L;  4L5T A;  2UU9 Q;  4JBW A;  4RG1 A;  3Q8D A;  4DR3 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...