1HNXL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hnxL00
3E9HA 4A3KG 1EIFA 4OONA 1N9WA 2Y0SG 2JA6H 4JI0Q 4A3GG 3HOZG 5IP9G 3FP9A 5C0XJ 4IOCA 2ALYB 4DAYB 3KF8B 3F8TA 3HOUH 3FHWA 1TXYA 4DUZQ 4DV3Q 3T1HL 4X62Q 1Q86C 1PVOA 1XNQL 2YTVA 2L15A 2F3IA 3J81c 3F2BA 4C2MH 2B63H 5AJ3L 4AH6A 4X65Q 4PZ7A 2F4VL 5ELNA 4MTNA 1YBYA 1XMQQ 1OXXK 1CKNA 3CC2A 4L5TA 3JAMc 2KCTA 1TWHH 4DR3Q 4X64L 2ZM6Q 2QA4A 2VUMG 2RF4A 5IYBH 2ZJRA 2UXCQ 4DKAC 3KJOA 1UE5A 1VQ8A 1PYBA 3HOWG 3TRZA 1YVCA 1BVSA 2WB1E 4A3IH 4JOIA 4DV2Q 3S16H 4A3DH 1VQ7A 2UUAQ 5C0XG 4YWLA 2D62A 2ES2A 1HNZL 4DR7L 3TREA 4DNIA 4DV4L 3J80i 1C7YA 1PH8A 1VQAA 1VQMA 1DGSA 2AWNA 5FJ8H 4DV5L 2CCZA 1B8AA 3PSIA 1YNXA 4B3ML 3NENA 1KD1C 3HOYH 1NMFA 2JEBI 5C4XH 5LMUL 1IBLL 2NVQH 3GTMH 2LXKA 1PH1A 1LM0A 3CAMA 3M4QA 5IP7H 3PIOA 2UUBL 2OQKA 3CPFA 1OXTA 3RN2A 1SFOH 1E7ZA 4JI0L 3S2DH 3AEVA 4LFBL 3KOJA 4BBSG 4GKJQ 4DR5Q 2IHFA 2OQ0A 4L5SA 4JI5Q 1Q1EA 3RNUA 2HHHQ 2ID0A 1K8GA 3H3VH 1Y1VH 5JJIA 2RCNA 4GLXA 1YHBA 3S17H 2Q2HA 4A3FG 2HQLA 4K0KQ 3CMEA 2Z0SA 1PH3A 4DR4Q 3S2HH 5M3MG 1XPOA 4JOIC 1Q12A 5JJKA 4QY7A 1X55A 1VQEA 4NXML 1X3GA 1GO3E 2V1CC 3NEMA 4DR1L 4DPGA 3Q8DA 3OTOL 3A5UA 3KLWA 3RLFA 1Q46A 4LW1A 2YYZA 2JA8G 4BA2I 2EXDA 3M85A 3PV0A 2JQOA 3HOVH 4JG2A 4DV7L 5GAEC 4DR3L 4KHPL 3K0XA 3I4MH 5DLQE 4A3BG 4P71A 2BA1A 1QUQA 5IWAQ 2N78A 3RZDH 1IL2A 3W5OA 2R7ZH 3E9IA 2R92H 3PGZA 2VY3A 3GTPH 2PNHA 4GN3B 2VQFQ 1I50H 1VQNA 3G48A 1HZAA 4JI8L 1NBWA 2UUAL 3CCRA 2YV5A 3E0EA 1QZHA 3OTOQ 1P16A 4DV6L 1VQ6A 2JA9A 3S15H 1E3PA 2XTIA 3PCOB 3CCJA 4AQYQ 2B63G 1N32L 1IYJB 3H0GG 2E5LQ 5IYDH 1BBWA 2OCEA 4OWWB 2BA0A 3PO3G 2R7FA 1K73C 5GADC 1FVIA 3ZJYC 3CXCA 3T1HQ 1Q1BA 1AH9A 4DK6C 1JT8A 4HIDA 1XNQQ 3PIPA 3BZKA 3MXNB 1QVGA 3J7ZC 4DR5L 4PZ6A 3RLOA 1YJWA 1E1OA 3CCMA 4JI4L 5LMNW 1X3EA 2HHHL 2HIVA 2OWOA 3J7A5 4O0AA 3HOXH 1XMOL 3NELA 2F4VQ 4A4IA 4A3IG 3EBEA 4DR4L 4JI7L 3M4PA 4JBJA 1IXRA 3I4OA 4XTCS 3S24A 1QVCA 3CCQA 1IZ6A 4GNXC 4X6AH 1EUJA 4X64Q 5GAHC 4GN4B 2JA5G 1MKHA 4YCWA 1K0RA 2CFMA 2IHEA 4HJAA 2R7DA 4JI3L 4DK3C 5FLMH 3HOYG 2A1AA 2Q2IA 2F52A 5C4XG 4LF8Q 2HT1A 1YI2A 1N8RC 4UPAA 2UXDL 3U58A 4IFDI 1HNZQ 2EIFA 1WFQA 1WOCA 1XTDA 3CP0A 1C9OA 3I56A 4DR7Q 2Q2TA 5M5YH 2I0QA 4KLKA 4LUOA 4DV5Q 4B3MQ 1VQGA 5C3EG 4DV1L 1JMCA 5IT9c 3L2PA 4POGA 5LMUQ 2K5VA 2ZTCA 2A8VA 3M4OH 1UE1A 4GKKL 4A3CG 1BKBA 4GNXB 3CPWA 2PQAA 3AQQA 4ME3A 1X3FA 3LGJA 4P73A 2UUBQ 2A19A 4AQYL 5ELOA 1GKHA 3GDEA 2PI2E 4LFBQ 4IFDJ 3STBD 1PH4A 2E5LL 2R93G 1NE3A 4PMWA 4HIMA 3GTOH 1O7IA 3I55A 4BY1H 4LFAQ 2MO1A 1VQDA 4EX5A 2OTLA 2CWPA 1X56A 3PUWA 1N34L 3HOVG 3EIVA 4QIWE 4A76A 1FJGL 4QQBX 1X54A 2K5HA 4YY3L 3I4MG 1SROA 4LUVA 3MEFA 3GTQH 3S1NH 4NXMQ 3ULPA 4DR1Q 1YJ9A 1U0LA 2D0OA 2WAQE 3NBHB 4MZ9A 2R7ZG 4ALPA 3AFQA 2AWOA 1IBML 4GOPA 3G6EA 4L5RC 1K83H 4DV7Q 1L1OA 3PF5A 4KHPQ 1G51A 3TS2A 2N49A 1YEZA 5M5WH 1Y1WG 4OX9L 4JI2L 3PUVA 3VDYA 4LF7L 1I5FA 2MFIA 2JA7G 4IOAA 4X66L 4NPSA 4HIOA 1KC8C 3PUYA 4JI8Q 4LF8L 5IYDG 3S1RH 2E2HH 1HJPA 2VS1A 4A3LH 1A8VA 5M3FH 4AYBE 3CCLA 4A3MH 3ULJA 4DV6Q 1S72A 1CKOA 1LTLA 4OO1G 2VNUD 2UU9L 1JJGA 1CKMA 3HKZG 2NZHA 1G291 1YIJA 4A3EH 1A62A 4RMFA 2K5NA 2KBNA 1N32Q 4APVA 4EQ5A 1I94L 4DR2L 4TQUS 3KDFA 5C44H 4BY7H 2WP8J 3T1YL 4R4OA 3GO5A 2IX1A 1PH2A 1ASYA 1KHIA 2DGYA 4NB3A 3PF4A 4WJ3M 1U5KA 1V1QA 4GS3A 2GVAA 4QL5A 1L1OC 4JI4Q 4LFAL 1PA6A 1D8LA 1XMOQ 1S40A 2KHJA 1VQBA 2RHQB 1PH9A 2CQOA 3U4VA 4JI7Q 3CCVA 1I3QH 4BBRH 5H1SE 2E2JH 1W2BA 1NY4A 4HJ9A 1EQRA 5GQOA 5HY6A 3S1QH 4JBMA 4GLVB 4YWMA 3A74A 1C0AA 4A93H 4JI3Q 4POFA 1WCMH 1CKNB 5M5XH 2HIXA 3KJPA 2Y0SE 1Q7YC 3S14H 5BR8L 1Z47A 4B3RL 1SR3A 2N3SA 1L2FA 1SRUA 4LF5L 2ASBA 2UXDQ 2JA6G 3HFZB 5IYCH 4UP7A 4JYAL 2IT1A 2ZTEA 4GLAC 1J6QA 1QZGA 1TWGH 4DV1Q 4A3KH 1WJJA 1K9MC 3HOUG 2YTYA 4BY1G 4GKKQ 2E2IH 3WWVA 4IPHA 1VQOA 1OXSC 3BU2A 4UY8C 5LMNQ 1HZBA 3W1GA 2Z6KA 5JEAJ 1VQJA 3I7FA 4JBWA 3G4SA 4DR6Q 4DV0Q 1WYDA 4P75A 2AMCB 2KCMA 1QVFA 3J80c 1R9TH 3L7ZC 1WI5A 1N34Q 2NN6I 1FJGQ 3A0JA 5E7NA 2WFWA 3F2CA 2NVYH 4YY3Q 5GAGC 1Z9FA 5IYBG 1Q8KA 3K80C 2ZJQA 3ERSX 3KF6A 3PO2H 4H02A 2Q2UA 4YWKA 2ZJPA 4A3DG 4JI1Q 1IBMQ 1KL9A 2VUMH 2UXBL 1GM5A 4HJ5A 4A3LG 4Y52H 1SLJA 3STBC 3TS0A 3HOWH 1NJIC 5M3FG 3TQYA 1RL2A 2D0PA 3M3YH 3J81i 4OX9Q 4JI2Q 5FJ8G 2WB1G 4LF7Q 1PYSB 4X66Q 3PUXA 3UDXA 4KHZA 1HZ9A 2KHIA 4C3JH 4DUYQ 2BH2A 4BXXH 2H5XA 2VQEL 4C3HH 2JJQA 5JEAG 3KYHC 2AKWB 1KRSA 2C35B 4NXNL 3TEHB 4BA1I 5IP7G 4AYBG 3CCSA 2UUCL 1VQLA 1XPUA 4BY7G 3CF5A 3U50C 1QUQB 3BZCA 5K36G 2UU9Q 4R1JA 3CMAA 1VQFA 3F2DA 1Y1VG 1LUZA 4R4QA 1KQSA 4BBSH 1I94Q 2ATWA 4DR2Q 2VW9A 4JV5L 4LNQA 4OXPA 3T1YQ 1N36L 4UP9A 4BBRG 1X6OA 2IX0A 5LMNL 5IY0A 1N36Q 1OXVA 4A3FH 1G6PA 3CC7A 1HR0W 4DV0L 4DR6L 4WJ4A 3JC66 1S3OA 4P74A 5JJLA 3RLNA 1CUKA 1J5EL 4LF9L 1P8LA 1YHQA 2JEAI 4IO9A 3S1MH 4FDBA 1V9PA 1WCMG 1V43A 5C0XI 3CC4A 2JA8H 3G71A 3IRBA 1OXUA 4HJ7A 1N33Q 2FXQA 3PUZA 1VQ4A 2R92G 5C4JH 2QEXA 4JI1L 4A3BH 3SGIA 1GVPA 4PG3A 5IE8A 3CCUA 4B3SL 5FLXc 3FKIH 1YITA 1X9NA 2MQHA 2GVBA 5BR8Q 3GTLH 1JE5A 4JC0A 3UDFA 4B3RQ 4LF5Q 4PZ8A 4YCVA 3CCEA 4LF6L 3I4NH 4DUYL 1HNWL 1AE2A 1VS0A 1XPRA 4JYAQ 1VQHA 2B29A 2QGQA 4IFDG 4IJLA 1TWAH 1GD7A 1X65A 3EN2A 1HNXQ 1PHJA 2N8NA 3OYYA 3J81j 1BBUA 3H0GH 4QJFA 1HR0L 1MJCA 1OTCA 3ICEA 3PO3H 4DAMA 1Q81C 1D7QA 2I5HA 2NZOA 3D31A 2YU9H 4JI6L 2CKZB 2I5LX 1EFWA 3RR5A 4LF4L 3HOXG 3PO2G 1FL0A 3K7UC 4O2DA 3GD7A 4YHHQ 1TWCH 4B3TL 3ULLA 1NTGA 3ER0A 4LFCQ 2PQAB 3K7AH 4GOPC 1KXLA 2GN5A 1E24A 1K8AC 2B3GA 4IPGA 1KAWA 3HKSA 4GN5A 1MJEA 3DM3A 1CSQA 5FLMG 3BJUA 4R4IA 1TWFH 4MNOA 4BXXG 2UXBQ 1ASZA 3OW2A 1B70B 1UE7A 2JA5H 3UE1A 2YTXA 1SE8A 2RHSB 5J3BA 1T9HA 3U4ZA 3L0OA 1N33L 3RN5A 3W1BA 2IY5B 1HH2P 2MO0A 4LUZA 1VQKA 3DLLA 1W3SA 1VQ9A 3K8AA 1XNRQ 2VQEQ 4GOPB 4P72A 1B7YB 1YJNA 4NXNQ 2UUCQ 5C3EH 4YCUA 1L1OB 4A3JH 2DUDA 1JB7A 4JBKA 4DUZL 1CSPA 1YHAA 4DV3L 1M1KC 4X62L 2JK8A 2LXJA 4HJ8A 2E8GA 1KIXA 4QGUA 1VCIA 1PH6A 1VQCA 4A3GH 1IBKQ 1SMXA 1HNXL 3HOZH 1HZCA 5IP9H 2NVTH 1EQQA 4JV5Q 2R93H 4X65L 2NVXH 4KI0A 3UDIA 2KENA 4Y7NH 2LSSA 1XMQL 2R6GA 4IJHA 2K14A 4LWCA 1Q82C 3KFUA 1H95A 5GROA 3GTGH 1VQPA 1VQIA 1A0IA 4L5QA 3I2ZA 2K50A 2BH8A 4YHHL 2ZM6L 1J5EQ 1SN8A 4LF9Q 4LFCL 1AE3A 1K3RA 2UXCL 2CWAA 3KDFB 1LYLA 3FKIG 3CD6A 5HGQA 3B6YA 2I5MX 4DV2L 2WAQG 2MNAA 1E1TA 4AIMA 1EYGA 5EAYA 4GNXA 1I6HH 3D0FA 2ZTDA 3I4NG 3GTJH 3AFPA 2AHOB 3AYHB 3H3VI 2PI2A 1NMGA 1Y1WH 1PH5A 4B3SQ 2JA7H 3HKZE 1PV4A 4A3MG 3UE0A 1JJCB 1A63A 1MIUA 4LF6Q 4A3EG 1HNWQ 1XNRL 2VL6A 1YZ6A 1EIYB 2Z6KC 3CW2C 1XJVA 4GKJL 5C44G 1RIPA 3JAMi 1PFSA 4C3IH 4A3CH 4JI5L 4JCVE 5AJ3Q 4K0KL 1HR0Q 3A5ZB 1EOVA 1UWVA 3M9BA 4UP8A 3UDGA 3GTKH 4R4TA 2EQSA 4RG1A 1IBKL 4JI6Q 4LF4Q 4A75A 2K4KA 1E22A 1EWIA 3H15A 4B3TQ 2XGTA 4OWTB 3CQZH 2VZAA 1JJ2A 1M90C 1FGUA 2JE6I 3M7NA 3F1ZA 4XIGS 5M3MH 4J15A 4R4CA 2NN6G 4TVAB 1PH7A 4A93G 5IWAL 2OTJA 1UE6A 4IPCA 1UEBA 4OWXB 2PMZE 1Y14B 3K81C 1VQ5A 4DV4Q 2VQFL 3RZOH 4IPDA 1L0WA 1KRTA 4OO1I 4A3JG 2K75A 5IYCG 4HIKA 1IBLQ 3KF6B 2K52A
chains in the Genus database with same CATH superfamily
2L4NA 2Y0SG 2JA6H 4OELB 3HOZG 3MEHA 1MSHA 3GTQB 3FP9A 4DAYB 4N9TA 5JVG3 1KDCA 5HURA 1FD7D 2FHTA 3KF8B 2J7ZA 3HOUH 3GQBA 3FHWA 4DUZQ 1PVOA 2BE5D 2J0TD 4H7BA 4LMQD 2F3IA 1JR0D 3J81c 3F2BA 5AJ3L 1V8QA 4AH6A 5JPNC 2F4VL 2I07B 5ELNA 1YBYA 2SEBD 1OXXK 2QKIC 1GUSA 3DEPA 3KBXA 3NHHA 3CC2A 3OWFA 2E2HB 1SNMA 1PFMA 2VUMG 2RF4A 3H09A 1VQ8A 1B50A 4K14A 1YVCA 1BVSA 3EA6A 1STAA 2EYLA 2E74C 4YWLA 2D62A 2ES2A 5IGCA 4C3JG 4BY7B 1LT3D 3HGBA 3TREA 4DNIA 4DV4L 3J80i 5FJ8H 1EWCA 4DV5L 1JOKA 1NMFA 3ONAB 5LMUL 2OQKA 3CPFA 1OXTA 1E7ZA 5JOBA 4JI0L 2BDNA 2NTTA 3M7GA 3K5LA 4DR5Q 2IHFA 1IYVA 2OQ0A 4L5SA 1Q1EA 2HHHQ 2ID0A 1W6KA 2Z1CA 4A3FG 3CMEA 2AQ1B 2HCIA 3S2HH 4DR4Q 2I46A 1XPOA 4JOIC 3TP8A 1VQEA 3Q22A 1AN8A 4NXML 3NEMA 4FF4A 3Q8DA 3KLWA 4K5XA 2EY1A 3BZDB 3GV6A 2EXDA 1F9SA 1KABA 2JQOA 2MJ8A 3HOVH 5GAEC 3K0XA 3I4MH 4A3BG 4Q0FA 2BA1A 2RVLA 5EBDA 3SK8A 1IL2A 1G8ZD 3OMCA 4F8MA 3OW7A 5M9OA 1CI3M 4JI8L 1NBWA 2UUAL 4RKLA 1TS2A 3DM1A 2YV5A 2EY2A 3E0EA 4BS9A 4DV6L 1P16A 4CJ1B 2A6HC 3PCOB 3KK7A 2B63G 4IUUA 4R9WA 1YNND 2BA0A 1GUOA 3PO3G 1FVIA 3ZJYC 3VR6A 4HIDA 1LTTD 4HCSA 5KNCA 3PIPA 3BZKA 3MXNB 1GUNA 3J7ZC 1E1OA 3DMUA 3M3YB 2XNAC 3J7A5 1BF4A 3E5SA 1XMOL 4A3IG 2R3ZA 4I7AA 3BYTB 1H9SA 4JI7L 4RKBA 2KVMA 5ELEA 3Q24A 3CCQA 4GNXC 1JORA 2JA5G 4YCWA 2IHEA 4JI3L 5C4HA 1ZKOA 5FLMH 2F52A 3K0YA 2HT1A 1STNA 4UPAA 1H9MA 2UXDL 3U58A 2L11A 4DR7Q 2EIFA 1WOCA 4QCLA 1XTDA 3CRKC 4B3MQ 4IURA 2JXMB 2B2TC 3TP7A 5IT9c 4POGA 4BY1B 1UE1A 4KY7A 4GNXB 1X3FA 5I9PA 1A6XA 3J81E 2E5LL 1NE3A 2B2UC 4HIMA 3GTOH 2F1MA 4BY1H 2OTLA 4EX5A 2CWPA 4DK0A 1N34L 1QWYA 4QIWB 4QIWE 3VA7A 1K83B 4DR1Q 1YJ9A 4MZ9A 1K0SA 4ALPA 1C8CA 3AFQA 1IBML 4ULLA 3U9OA 3ITPA 1XTCD 1K28A 1PMRA 5IGDA 1K83H 4P2CB 4DV7Q 2A69D 1YEZA 3KLSX 2F4IA 4A3MB 4JI2L 1J8IA 2O2LD 1I5FA 2PYKA 1AFPA 2F0KA 4HIOA 5IYDG 3S1RH 2VS1A 1A8VA 5C44B 4A3MH 2CH4A 1JJGA 1LTLA 1CKMA 1Y8OB 2K5NA 5KNDA 2KHSA 5JEAH 3FRPB 4TQUS 4OIJA 2WIIB 5C44H 3T1YL 4R4OA 3GO5A 5KYLA 4BBRB 1XYIA 1ASYA 1KHIA 3PF4A 4B9XA 2OEOA 3V96A 4LFAL 4A93B 2WV6D 4IUPA 2KHJA 1VQBA 2CQOA 1WCMB 4PV1C 3U4VA 4BBRH 3CCVA 2E2JH 4QB4A 3S14B 3A8JE 3ZYYX 4R8NA 1XX8A 4GLVB 4YWMA 4A93H 3IKJA 1TWGB 1WCMH 4A3GB 3S14H 2HDMA 4B3RL 2N3SA 4LF5L 3U9SA 3HFZB 4RGNA 1PDQA 1J6QA 2TMPA 1TWGH 3K6OA 4L6TB 2VB3X 1BQQT 1R9TB 1IW7C 3BU2A 4UY8C 3AU7A 5IGBA 1VQJA 4JBWA 5DM63 4DR6Q 5A2QL 4DXFA 3SE0A 1R9TH 1LV9A 2A73B 4FF1A 1CFMA 5E7NA 1JQYD 4YY3Q 1Z9FA 4R8IA 1Q8KA 3KF6A 4M1UB 1SYEA 1HUMA 1KL9A 3I91A 2BOSA 4DAYA 2O4XA 4EQOA 3MXGA 3KF8A 1RKNA 1NJIC 5M3FG 5J1ZA 1STEA 1TS5A 2WB1G 3TZUA 3PUXA 4X66Q 4DUYQ 2BH2A 5IT9E 4JPBW 4FO2A 1TQOA 3KYHC 2AKWB 1F9QA 4BA1I 4DF7A 4AYBG 3CF5A 4WORA 2NWGA 3HG9A 4RA8A 2UU9Q 3CMAA 2F0NA 3A7AB 1FGBD 2B8GA 3DEOA 2RDGA 1R4QB 1WD1A 4MTKA 1T5EA 4JV5L 2L5TA 2IWHA 4LNQA 2F0EA 3R2TA 5DNFA 2IL8A 2PPBC 4QF4A 5EPKA 1HR0W 3JC66 1HA5A 1O7YA 1S3OA 3SK6A 3RLNA 1J5EL 1A15A 2KQ3A 4XYQA 4LF9L 2JEAI 3R2IA 1V9PA 2HUGA 1BDOA 1EU4A 2F3WA 4UHVA 1NNXA 4Z9CB 5ELBA 3G71A 1OXUA 2R92G 2FXQA 2QEXA 1STGA 3NTIA 3FMCA 2A68D 1SYDA 3FKIH 5FLXc 5G3LF 1ET6A 3O13A 3G7LA 3CU7A 3EJIA 3H0GB 1WTPA 4CDCC 1U4PA 1AE2A 1VS0A 3OOCA 5NUCA 2QGQA 5A35A 4IJLA 1TWHB 1JCKB 3H0GH 2O5IC 1M8AA 2NB0A 1OTCA 3ICEA 1HHVA 2I5HA 1FR3A 3H3VC 1EFWA 2X69A 5I4DA 1FL0A 3PO2G 3K7UC 4O2DA 3H94A 3GD7A 1Y69U 1TWFB 4B3TL 4LFCQ 3BDOA 2PQAB 3NQTA 4JVZA 3DHQA 1WTOA 1RJTA 4HEDA 2B2VC 4C56C 1KDAA 4G7HC 2ENBA 1O7ZA 3TMEA 1TWFH 4HN7A 4MNOA 1S5ED 1B70B 1UE7A 1OO9B 2EYOA 4J6HA 4H13C 5CBEE 5KIXA 2YTXA 5J3BA 3AB9A 3QB3A 1H9JA 1VQKA 4KV6A 3MXNA 1VQ9A 3K8AA 3FPPA 4MIUA 1QCBD 2R93B 1L1OB 1SDFA 2DUDA 2JK8A 4HJ8A 2E8GA 3GTGB 3J7YW 5ELFA 1BR9A 1CM9A 1LTSD 2J4XA 1MD2D 4C1NK 2R93H 2R7ZB 4RCNA 3EQLC 1H95A 5GROA 3GTGH 3I72A 2BH8A 2AQ2B 3GTJB 4PMCA 1SAPA 2F0PA 3KDFB 2JA7B 1HFGA 1E1TA 1EYGA 5CYUA 4GNXA 2ZTDA 1V1OA 3A8IE 3GTJH 3AFPA 1PH5A 4HCEA 4KMUC 3HKZB 5D14A 2JA7H 3HKZE 1EEFD 5FO7B 3UE0A 1JJCB 3OWEB 5C0XH 2A5HA 2EY5A 3BS1A 5T1GA 1GXDC 4JI5L 5AJ3Q 4K0KL 3A5ZB 1PFNA 4UP8A 3M9BA 4CDFC 5C3XA 4R4TA 3BVZA 3FDTA 1GHJA 1PLFA 5CV6A 5CV5A 2LFNA 1DOKA 2A6ED 1PTOF 4MN3A 2VZAA 3MXUA 4OL7A 1SMYD 4J15A 4TVAB 1PH7A 5IWAL 1UE6A 2PMZB 1G2SA 2PMZE 5FLXE 1Y14B 3K81C 4DV4Q 4QMGA 2VXWA 4IPDA 1Y8PB 3BYYB 2F0DA 4A3JG 5IYCG 3BG3A 3OTOL 4A3KG 1N9WA 4F7XA 4JI0Q 4J8QA 4C2MB 1JOOA 1W6JA 1Q86C 4X62Q 3SK4A 1XNQL 4X3KA 2QDBA 2YTVA 1HTLD 1D1IA 4C2MH 5M5WB 4PZ7A 2M00A 1LLRD 1XMQQ 2B8FA 4A3DB 3S16B 1F2ZA 2KCTA 1DONA 1M4VA 3A54A 2ZM6Q 1EEID 2F0VA 5IYBH 2QA4A 2UXCQ 3SK5A 1UE5A 2DJGC 3QR8A 3HOYB 4A3DH 3S16H 3GTMB 2NVQB 2UUAQ 5CGKA 4CHTB 1DOMA 3L3OC 1HNZL 3C46A 1SFOB 3S2DB 2F0JA 4C3HG 1VQAA 1PH8A 2AWNA 1YNXA 3BVMA 3NENA 3HOYH 4XYOA 3GTMH 2NVQH 1Y1VB 4U68A 1FNWA 3CAMA 5FK9C 3S17B 2UUBL 3D6CA 3S2DH 1QNUA 1SFOH 5E3FA 4FXDA 4DK1A 4BBSG 4GKJQ 4TRDA 1CZWA 4RFBA 1HQMC 3RNUA 1K8GA 2Z4IA 5JJIA 1Y1VH 4GLXA 1YHBA 3S17H 1QOHA 3VA5A 1PH3A 5M3MG 5JJKA 3NE5B 2MPMA 1X55A 5L37A 4HR7B 4DPGA 4F87A 1ICFB 2XRQD 3A5UA 3RZDB 3VR4A 4XDXA 2EPBA 3RLFA 2G9HD 4LW1A 3V2TA 2JA8G 1PTOB 3M85A 2H4OA 3PV0A 4JG2A 1WTHA 1Q90A 2X6LA 5DLQE 1QJOA 1ZYRC 3RZDH 1LTBD 3W5OA 3S15B 3P75A 3PGZA 2VQFQ 4O42A 4KTAA 3G48A 1HZAA 1PTOH 2EOTA 2ZXPA 5CV9A 4RCOA 3CCRA 4CDEC 3KLSA 3OHXC 1VQ6A 3OIQA 3S15H 4S3SA 1F77A 3VYRA 3CCJA 3D3RA 3ND9A 5CC4A 5E4WC 2E5LQ 1BBWA 2OCEA 4IFDH 3HOXB 1STBA 4OGQC 3T1HQ 1Q1BA 4DK6C 5J39A 1B4OA 2N88A 3I73A 2RQXA 4JI4L 2F0OA 4O0AA 3HOXH 2RKSA 1F9PA 4A4IA 3EBEA 4PNYA 3M4PA 4JBJA 1EL0A 3I4OA 4XTCS 3NUCA 3S24A 2DY8A 4X64Q 1MBYA 5LL6X 1MKHA 1X3PA 5M5YB 2R7DA 4DAVA 1G91A 2Q2IA 5G3LD 3T16A 1YI2A 1N8RC 3M4OB 1S4ZA 2IX3A 3CP0A 3I56A 5M5YH 1HA6A 1S5CD 4RAUC 4A3CG 2K5VA 2ZTCA 5IIFA 4IN3A 5IOCA 3M4OH 3CPWA 2PQAA 3AQQA 3P7JA 3C1EA 2A19A 1GKHA 4LFBQ 2LY7A 3CKIB 3C1FA 1O7IA 4K6LA 4LFAQ 2QW7A 1U4RA 1VQDA 3NK9A 1WD0A 1TS3A 3HOVG 2K5HA 1WTRA 3I4MG 3GTQH 3ULPA 2WAQB 2WAQE 3R8BA 4ILWA 1E2ZA 2D2CC 1NCVA 1L1OA 3PF5A 4KHPQ 3TS2A 2N49A 3NSWA 4OX9L 1HTPA 2B2YC 4LF7L 2AUKA 1SE2A 3PUYA 2E2HH 1HJPA 1JB3A 4A3LH 4CJ0B 1B9NA 3ULJA 3J81L 1G291 4FXKC 4WFN3 4C3IG 1A62A 4RMFA 3VYUA 3RMHA 1N32Q 5J22A 4EQ5A 1I94L 4DR2L 3KDFA 4BY7H 1EFID 1PH2A 5K36H 2DGYA 4NB3A 2PW5A 2ZXOA 4GS3A 4QL5A 1TY2A 5CV4A 2F0FA 3UI2A 1ILQA 3PMFA 2M9VA 5H1SE 1NY4A 2K7VA 3OPOA 4ZAIA 1BUVT 2NN6H 1C0AA 4NMZA 1KNAA 4V0BA 1CKNB 2Y0SB 2HIXA 1Q7YC 2Y0SE 5K5PA 3HOZB 5BR8L 2NZ1D 5BN3A 4UP7A 5ELCA 2G9DA 4DV1Q 1K9MC 1PRTF 2YTYA 4BY1G 4GKKQ 4DGZA 4KKUA 1VQOA 2R61A 1OXSC 1HZBA 3W1GA 2NBFA 5JEAJ 3G4SA 3I7FA 2BCOA 3EVQA 3J80c 1PTOD 2VUMB 2IPKD 1WI5A 4G57A 1FJGQ 3F2CA 2EYHA 2WFWA 2XSCA 1LT5D 2CVRA 2ZJQA 4XT3B 4H02A 2ZJPA 4C3JB 2UXBL 1ML0D 3MAQA 5EKIA 2VUMH 4HJ5A 3STBC 3TS0A 3M3YH 4XT1B 2K33A 1PYSB 3V05A 4C3JH 4BXXH 5FOBB 2BDOA 1BXTA 5JEAG 5IP7G 1JC7A 3CCSA 4FVMA 1QUQB 1A3UA 1JICA 1LTAD 4R1JA 4A3FB 1R4PB 2WKDA 3F2DA 4R4QA 3D6WA 2ATWA 2VW9A 1LTRD 4OXPA 5CORA 4UP9A 4BBRG 1X6OA 2IX0A 5LMNL 1S5FD 4A3FH 3RZOB 4WJ4A 2WACA 5JJLA 3QJYA 5C4JB 2F0WA 4A3BB 1MHWC 1YHQA 4IO9A 4FDBA 1WCMG 1ENFA 5C0XI 2K5WA 1PRTC 3GTLB 3IRBA 3NWSA 3PUZA 5C4JH 4JI1L 4A3BH 3SGIA 1EYAA 1GVPA 4TSSA 3DWQA 4PG3A 5IGGA 5IE8A 5IT9L 2DNCA 3GTLH 2B63B 4JC0A 2XRSD 4PZ8A 3T51B 3CCEA 3PO3B 3W2DA 1HNWL 1XPRA 4JYAQ 2YU9B 2K03A 4G7OC 1GD7A 1TWCB 4L63B 4KJNA 1E2VA 3OYYA 2N8NA 1BBUA 2FINB 1VF7A 4QJFA 1HR0L 3T4AC 3PO3H 4DAMA 5CMDA 4A3IB 1D7QA 2YU9H 2NUCA 2I5LX 2B2WC 4ODGA 1TWCH 2F0GA 3ER0A 2JA5B 2OT2A 1KXLA 2K04A 2GN5A 1KAWA 1YNJC 5FO8B 3KUPA 2JA5H 1SE4A 3UE1A 1SE8A 2K28A 1N33L 4HMJA 3W1BA 2IY5B 1HH2P 1TS4A 1W3SA 5C6AA 2VQEQ 1LTGD 4P72A 1IYUA 2ICIA 4NXNQ 2UUCQ 3DWPA 3D8GA 1JB7A 4JBKA 5CR3A 4DUZL 4ABNA 2EYMA 1VCIA 1QE6A 1PH6A 1VQCA 4A3GH 3J80E 1SMXA 4DN4M 4RGOS 1HZCA 5IP9H 4CKEA 1N36Q 2LSSA 5E1FA 4IJHA 1I50B 2DN8A 3E3XA 4JW0A 1VQPA 1VQIA 4L5QA 1I6HB 2K50A 5EKLA 4FYDA 1SN8A 1C48A 1LYLA 3FKIG 1HRJA 4FNFA 2QDLA 2Z4HA 5EAYA 1I6HH 2AQ3B 2AHOB 2XIWA 3AYHB 4O1NA 3EROA 3VR3A 5LHY1 4B3SQ 3FPUB 4LF6Q 3QWNA 3GTKB 5CBAE 4A3EG 1ESFA 3PIP3 1XNRL 1DOLA 2Z6KC 1A2UA 3CW2C 1ICWA 3JAMi 3NXWA 3HP3A 1EY8A 1UWVA 2CW0C 3GTKH 4LF4Q 1IBKL 4JI6Q 2K4KA 4NDXA 1I6VC 3J7AF 1JJ2A 2A6HD 3F1ZA 4XIGS 1LO5D 4R4CA 2FMMA 2EVBA 3NTHA 1JE4A 4IPCA 1F9RA 2GA4B 4ZKBB 4CKBA 2SOBA 1VQ5A 4XQQA 3Q23A 4FF3A 1L0WA 2KA7A 4FP5D 1BBXC 4N9PA 2K52A 3E9HA 3NPPA 1EIFA 1EY6A 1STYA 2QEJC 5C0XJ 4IOCA 2KECA 2RSNA 1SJED 3F8TA 1UNSA 1TXYA 4DV3Q 2K5QA 1KTKA 1XXGA 3VYTA 1RD9D 2RSOA 2L15A 2KCCA 4F88A 4X65Q 3Q6SA 1CKNA 4L5TA 3JAMc 3NWTA 1TWHH 5E4XA 3A55A 1SYFA 5I6WA 5FLXL 3KJOA 3HOWG 2WB1B 2WB1E 4JOIA 4DV2Q 4CBVA 1VQ7A 5C4XB 5C0XG 1WTWA 3K5NA 4DR7L 1GUWA 5DEHA 2JN4A 4WJWA 1B3QA 1VQMA 2CCZA 4B3ML 3K58A 1KD1C 4IQZA 2JEBI 3I3CA 5C4XH 3PIO3 4J1MA 1IBLL 2LXKA 1LM0A 2Q8RE 3KOJA 3BDLA 4K5WA 2PNRC 3S1QB 3IAYA 3H3VH 3VR2A 5ISRA 1UAPA 2Z0SA 1X3GA 1SXTA 2V1CC 4DR1L 2R92B 1Q46A 3K5OA 1A3TA 2YYZA 2K05A 5EPLA 1LACA 4DV7L 4DR3L 3BDCA 2E2IB 4P71A 1QUQA 1LTID 2R7ZH 2QF7A 2R92H 3T53B 2PNHA 4GN3B 1F2MA 1VQNA 1J9OA 1I4QA 1QZHA 2KEEA 1V1PB 1AP0A 3SDZA 2JA9A 1PFBA 4IUQA 3SHLA 1BO0A 2RDHA 1FYCA 3PO2B 1EY5A 5GADC 3CXCA 4OO1H 1EQVA 1MI2A 1RDPD 1IL8A 4IUTA 1QVGA 2B2TA 1X3EA 2HIVA 1VMCA 4KN4C 2OWOA 3NELA 2F4VQ 1STHA 4EQPA 1IXRA 4ZCKA 1QVCA 4X6AH 2B2UA 4IUNA 1IW7D 2CFMA 4HJAA 4KY5A 4DK3C 2L12A 2BE5C 1AZPA 3HOYG 1CZGA 4ZKCB 1WFQA 1C9OA 2I0QA 4KLKA 2NTSA 4DV5Q 1GHKA 5C3EG 1JMCA 3R93A 3DWAA 3L2PA 5LMUQ 4KKSA 1BKBA 4ME3A 3LGJA 3LWEA 4AQYL 1XWEA 2PI2E 4IFDJ 1MGSA 1PH4A 5I2XA 2SDFA 1SYGA 2EJMA 1S5DD 4QQBX 4K8IA 4YY3L 1SROA 3MEFA 3FVQA 1GUTA 3TSSA 4NXMQ 3NBHB 2D0OA 1TT2A 2P5ZX 2XN9C 4K2KA 1PZJD 2AWOA 3LNNA 4L5RC 1H9SB 3LWUA 1G51A 4DA2A 2MGSA 5M5WH 1Y1WG 2MP1A 3PUVA 5D3IB 4X66L 3SR1A 4JI8Q 4LF8L 1B53A 4DV6Q 4KJOA 4U673 2VNUD 2UU9L 3A8KE 2NZHA 3D4WA 3TDQA 3I4LA 1YIJA 1KDBA 1EYCA 4ID6A 5EQ0A 1B2TA 2IW3A 2IX1A 1HUNA 3DUZA 4WJ3M 1U5KA 1V1QA 2F0TA 3RUZA 1EWHA 2KJXA 2RCFA 1PA6A 1TU2B 1D8LA 3RD4A 1XMOQ 2JSOA 1S40A 2RHQB 1PH9A 5CV8A 4JI7Q 3C2PA 1W2BA 1Q3LA 4HTHA 1YNNC 4A3JB 4JBMA 1CT1D 3TP5A 4JI3Q 4POFA 5TSSA 1BNZA 1X3QA 4A3KB 1NR2A 3VYSA 3A7LA 1Z47A 2QCPX 2UXDQ 1L2FA 1SRUA 2Z8LA 2JA6G 4ZQ3A 5IYCH 4HSPA 1QZGA 2Q8TA 4A3KH 1WJJA 3DXJC 1IKMA 3HOUG 3NQIA 5LMNQ 2Z6KA 3BVGA 1I4HA 2LKVA 2D5DA 2AMCB 2KCMA 2CH4W 1ZXTA 3L7ZC 1N34Q 4X3UA 1PXUA 1IKLA 5D65A 2EE1A 3ERSX 1CA5A 2Q2UA 4YWKA 1I4GA 4JI1Q 1IBMQ 1GM5A 4C3HB 1CHQD 4A3LG 1SLJA 4B08A 1RL2A 2D0PA 3J81i 4JI2Q 5FJ8G 1SSOA 1HZ9A 2H5XA 3LX0A 2OXPA 4C3HH 5EJWA 2C35B 4BBSB 1U4LA 3MTSA 3TEHB 4BY7G 1O7LA 1CA6A 1VQLA 3HS0C 5K36G 5F2DA 2ZXRA 1VQFA 5EPJA 5M3MB 1LUZA 4K2LA 1CTMA 5FO9B 4BBSH 3X3NA 1CK1A 2A69C 4E6IA 3QO2A 3T1YQ 5IY0A 1H9RA 1OXVA 2JA8B 1FNUA 3WDNA 4DV0L 5IGFA 1P8LA 1CQVA 3CC4A 1V43A 2L55A 2JA8H 2RBMA 1ENAA 4HJ7A 1N33Q 1VQ4A 1EIGA 3I4NB 2EXZA 2JP1A 4HSVA 4PMBA 4PQXA 1YITA 1TWAB 2GVBA 5KRUA 2B2VA 3UDFA 4B3RQ 4LF5Q 3I4NH 2B29A 2EJGC 4HAEA 1TWAH 5ELDA 1B1ZA 1X65A 3EN2A 3OMGA 1E0BA 3J81j 1LABA 1MJCA 4CDDC 1Q81C 1E2WA 3D31A 2NZOA 1D5ZC 4B9WA 2CKZB 1H9KA 4LAAA 2OF1A 2QILA 3ULLA 3URYA 4IUVA 4GOPC 2PW7A 4LK1C 1U9RA 5EKKA 4RHSA 1K8AC 2WKCA 3HKSA 2RDFA 1V1PA 1MJEA 1CSQA 1NUCA 3BJUA 4X3SA 4R4IA 5FLMG 4BXXG 1G6ZA 3IL8A 2L1BA 1DD2A 3L0OA 3K5MA 5HGTA 4LUZA 3KBGA 4Q5VA 1DXMA 3DLLA 3S2HB 1XNRQ 4GOPB 1BCPF 3CRLC 2NVTB 2A74C 3HZXA 2NVXB 1ESRA 4A3CH 1YHAA 2PZTA 2EDGA 4X62L 2LXJA 1KIXA 3HOVB 4EQNA 1IBKQ 1HNXL 3HOZH 3I4MB 2DJFC 2NVTH 2FJ2A 5IODA 4JV5Q 1KLUD 4KK7A 2NVXH 3UDIA 1JOQA 2KENA 2EY6A 1XMQL 2R6GA 1JWUD 2K14A 3KFUA 4FXGC 1A0IA 2F0MA 4UDUC 4YHHL 3W3AA 3MA2B 2ZM6L 5C5MA 1J5EQ 4LF9Q 1AE3A 2UXCL 2F0QA 3B6YA 2MNAA 2MHVA 3Q0AA 2G5DA 3D0FA 1Y8NB 2FFKB 2K01A 3MWYW 3H3VI 1KAAA 2PI2A 2DY7A 2HDLA 5KNBA 1Z7TA 3EFXD 4C3IB 4A3MG 4QUCA 3FEWX 1I4PA 1YZ6A 1EIYB 1XJVA 3J80L 5IGEA 3NBHA 5C44G 4GKJL 1PFSA 4C3IH 1ZYRD 1EZ6A 2F0SA 2A68C 4RG1A 2HD3A 4KN7C 1E22A 2WINB 3F2UA 4B3TQ 2XGTA 4OWTB 5CV7A 1FGUA 3M7NA 2EYFA 3TN2A 1BCPC 5JPMC 1EIHA 4N8FA 3MVVA 1EY9A 1DJRD 4A93G 2XWBB 1HPCA 4OWXB 2F0UA 1KNEA 2F0HA 3NTKA 2VQFL 2F03A 3RZOH 3H6MA 2E75C 1VF5C 1KRTA 4OO1I 4XXEA 3GTOB 2K75A 1IBLQ 3MC0B 4HIKA 4ZLTF 4OONA 3HRZC 4A3GG 4KD3A 4MHEA 5IP9G 2ALYB 2O5JC 1BCPB 1EY4A 1ZEQX 3D4RA 1HQRD 3T1HL 1K3BC 2D9UA 4GZYC 1PRTB 2B63H 1RTNA 1KLGD 4MTNA 2F0IA 5EGTA 5JJZA 3S1RB 1TVXA 4DR3Q 4X64L 1I4RA 5JAVA 2ZJRA 4DKAC 1PYBA 3TRZA 5KGUA 4A3IH 3J7AV 3MHBA 2PQEA 3S9WA 2AUJD 4I7ZC 3KLRA 1C7YA 1DGSA 1L0XB 1B8AA 1EY0A 3PSIA 1FNVA 1A2TA 1II3A 1PH1A 3M4QA 5IP7H 1EY7A 5C5LA 3PIOA 1I4XA 3RN2A 1DYQA 4ZUIA 3AEVA 4LFBL 2E2JB 1SNPA 4OEMB 4JI5Q 2VB2X 2RCNA 2V4DA 3P1HA 4K0KQ 2Q2HA 4G4KA 2HQLA 1SE3A 2K5DA 1Q12A 4QY7A 1G2TA 1GO3E 2DNEA 2MUYA 3GTPB 4BA2I 4KY6A 4CKCA 2H1EA 4KHPL 1SNDA 5IWAQ 2N78A 5D3DA 3E9IA 2HQEA 4L8JA 2VY3A 3GTPH 1I50H 1NAPA 1IHZA 3E0JA 5T1IA 1UUPA 3OTOQ 2A6EC 2L0CA 1E3PA 2XTIA 3GP7A 4AQYQ 1X32A 2ICEC 1B44D 1N32L 1IYJB 3H0GG 1SMYC 4OWWB 5IYDH 2R7FA 1K73C 4IZ8A 4ZUJA 1AH9A 1JT8A 2FMCA 1XNQQ 1UEAB 4DR5L 4PZ6A 3RLOA 1YJWA 3CCMA 5LMNW 2HHHL 1RCVD 5DAUA 1QILA 1K8MA 4DR4L 4KKTA 4XQNA 1IZ6A 2KUMA 1EUJA 5GAHC 4GN4B 1K0RA 2A1AA 4BWGB 5C4XG 4LF8Q 5AFWA 1B3AA 4IFDI 1HNZQ 2Q2TA 1JWSD 4LUOA 1VQGA 4DV1L 1QG7A 1EQTA 2A8VA 4GKKL 4H0LC 2B2YA 4P73A 2UUBQ 5ELOA 3SVMA 1RODA 3GDEA 1ONLA 4JK1C 3STBD 3S1NB 2R93G 4PMWA 2PZWA 1PZKD 3I8ZA 3I55A 4CGYB 2MO1A 3T13A 3C3LA 4DAPA 1BOSA 1PYWD 1X56A 3PUWA 2X6GA 2Z9HA 3EIVA 4A76A 1FJGL 1X54A 3FKIB 4LUVA 4DFAA 1GJXA 3S1NH 1ILPA 2R7ZG 1U0LA 2EZVA 4DNRB 4GOPA 1S5BD 5BN4A 3G6EA 4RH6A 1SYCA 5M3FB 1RHPA 3VDYA 3CHBD 2MFIA 2JA7G 4IOAA 4NPSA 3R3OA 2EYPA 4A3EB 1KC8C 4RGMA 1D2BA 1BCPD 3E6ZX 4K8JA 5EBCA 4AYBB 5C4ZA 5M3FH 2F3VA 4AYBE 3CCLA 4KHVA 1S72A 1CKOA 4OO1G 3HKZG 4DXGA 1PRTD 2N55A 4A3EH 2KBNA 2B39A 4APVA 2WP8J 2IJ0A 3JAML 1I3QB 2KOLA 1AEXA 4YIJA 3H91A 2GVAA 4JI4Q 1L1OC 1SBBB 5A2QE 1K8OA 4DU9A 1I3QH 5M5XB 1SYBA 4HJ9A 1EQRA 5GQOA 5HY6A 3S1QH 2PZUA 3A74A 1F2YA 1LT4D 5M5XH 3KJPA 5I2YA 1SR3A 2ASBA 1RF2D 4JYAL 2IT1A 2NYZD 2ZTEA 4GLAC 2EYJA 4WRDA 1EZ8A 3I70A 1SNOA 1YNJD 2E2IH 3WWVA 4IPHA 3P20A 1LT6D 2XWJB 3N6RA 4TKOB 2NVYB 1HXYD 2HCCA 2L9HA 4NKLA 4DV0Q 1WYDA 4P75A 1QVFA 1SNQA 5I6YA 2NN6I 3A0JA 4C1NI 2C5CA 2NVYH 3HOWB 5GAGC 5IYBG 1U4MA 2E76C 3K80C 2PCFB 3PO2H 3IFDA 2JYOA 3QOJA 1RTOA 4OIKA 4A3DG 1VMPA 3MZ5A 1WVLA 3TZDA 4ZYSA 3TP6A 4Y52H 3HOWH 2Q8IB 3WOFA 3TQYA 1MSGA 4OX9Q 4LF7Q 3UDXA 4KHZA 2KHIA 3NBIA 2VQEL 2JJQA 1KRSA 4NXNL 3IFTA 2UUCL 1XPUA 4OHJA 3U50C 1WTVA 3BZCA 2SNMA 1L0YB 1F2LA 5KEEA 2XVSA 3G6JB 2M2LA 4M8AA 3SXHA 1D5XC 1Y1VG 4N8X1 4X3TA 1KQSA 1I94Q 4DR2Q 3S1MB 1N36L 1D1KA 3M4YA 5BN5A 3A56A 1HCZA 1G6PA 1ENCA 3CC7A 4DR6L 4P74A 4NP5A 1CUKA 3S1MH 3MFYA 3JAME 1TIID 4K6DA 4RGTA 5I9OA 1NR4A 4HMIA 3D4DA 2B2WA 5LL6S 2CW0D 1AW7A 3CCUA 4B3SL 1X9NA 1VDZA 2MQHA 3GV3A 5BR8Q 4I65A 1TKWB 1D6EC 1JE5A 4UAIA 3N52A 4YCVA 4LF6L 1JWMD 5KYIA 4DUYL 1CHPD 5JVH3 1VQHA 4IFDG 3MFGA 1HNXQ 4G7ZC 1TR5A 1PHJA 3L9AX 1QB5D 2LS01 4V190 3K7AB 1EU3A 2CQAA 2RA4A 1NSNS 4LF4L 1ET9A 4JI6L 1D5MC 3RR5A 3HOXG 3ERQA 3WOEA 4YHHQ 2K32A 2E2DC 1NTGA 3K7AH 2Z6BA 4EGVA 4ZRZA 1E24A 2B3GA 4IPGA 4GN5A 1TY0A 3QOLA 3OSOA 3DM3A 3PQIA 4IALA 4RWSC 2UXBQ 1B9MA 1WTQA 1ASZA 1SJHD 3OW2A 4ME5A 3I90A 1SNCA 1O80A 1AZQA 2RHSB 1T9HA 3QG1A 3U4ZA 5C3EB 4RHRA 1DZ1A 3RN5A 1GOZA 1DCZA 4LJZC 2KEDA 1PTOC 2MO0A 1SEBD 3K59A 1B7YB 3OIPA 1YJNA 5C3EH 4YCUA 4A3JH 4H44C 4Y7NB 1CSPA 4DV3L 1M1KC 1HFNA 4QGUA 4ZK9B 2CHBD 1EQQA 4X65L 2PO4A 4KI0A 1O78A 2K1BA 4Y7NH 1Q82C 4LWCA 1T5XD 4KD4A 3SEBA 4FF2A 3I2ZA 4DNTB 4QUFA 4K5VA 1K3RA 4LFCL 2CWAA 1Y1WB 3CD6A 5C3WA 2C9OA 5HGQA 2I5MX 4DV2L 2WAQG 4AIMA 2LMCB 3I4NG 4EVOA 3NP8A 4XQJA 1NMGA 1Y1WH 1WTXA 4CJ2C 3QIAA 1PV4A 3MXPA 1A63A 3HEJA 1MIUA 1GUGA 1HNWQ 2VL6A 1CQFA 2F0LA 1QNKA 5DM73 1RIPA 3ND8A 2TSSA 4NW2A 5COYA 4JCVE 3CQZB 1HR0Q 1EOVA 3UDGA 1EYDA 2EQSA 4A75A 3K57A 1EWIA 3H15A 3X3MA 2KCNA 2EJFC 3CQZH 2SNSA 1M90C 2JE6I 1A3VA 3T56B 3AMUA 3VR5A 5M3MH 2K6AA 2NN6G 2OTJA 1DM0B 3TBIB 1UEBA 1Z6HA 2JA6B 1Q8IA 1C4QA 5FKAC 1EOTA 3HOUB 3KF6B 2ZT9C 1PZID
chains in the Genus database with same CATH topology
3E9HA 4A3KG 1EIFA 4OONA 1N9WA 2Y0SG 2JA6H 4JI0Q 4A3GG 3HOZG 5IP9G 3FP9A 5C0XJ 4IOCA 2ALYB 4DAYB 3KF8B 3F8TA 3HOUH 3FHWA 1TXYA 4DUZQ 4DV3Q 3T1HL 4X62Q 1Q86C 1PVOA 1XNQL 2YTVA 2L15A 2F3IA 3J81c 3F2BA 4C2MH 2B63H 5AJ3L 4AH6A 4X65Q 4PZ7A 2F4VL 5ELNA 4MTNA 1YBYA 1XMQQ 1OXXK 1CKNA 3CC2A 4L5TA 3JAMc 2KCTA 1TWHH 4DR3Q 4X64L 2ZM6Q 2QA4A 2VUMG 2RF4A 5IYBH 2ZJRA 2UXCQ 4DKAC 3KJOA 1UE5A 1VQ8A 1PYBA 3HOWG 3TRZA 1YVCA 1BVSA 2WB1E 4A3IH 4JOIA 4DV2Q 3S16H 4A3DH 1VQ7A 2UUAQ 5C0XG 4YWLA 2D62A 2ES2A 1HNZL 4DR7L 3TREA 4DNIA 4DV4L 3J80i 1C7YA 1PH8A 1VQAA 1VQMA 1DGSA 2AWNA 5FJ8H 4DV5L 2CCZA 1B8AA 3PSIA 1YNXA 4B3ML 3NENA 1KD1C 3HOYH 1NMFA 2JEBI 5C4XH 5LMUL 1IBLL 2NVQH 3GTMH 2LXKA 1PH1A 1LM0A 3CAMA 3M4QA 5IP7H 3PIOA 2UUBL 2OQKA 3CPFA 1OXTA 3RN2A 1SFOH 1E7ZA 4JI0L 3S2DH 3AEVA 4LFBL 3KOJA 4BBSG 4GKJQ 4DR5Q 2IHFA 2OQ0A 4L5SA 4JI5Q 1Q1EA 3RNUA 2HHHQ 2ID0A 1K8GA 3H3VH 1Y1VH 5JJIA 2RCNA 4GLXA 1YHBA 3S17H 2Q2HA 4A3FG 2HQLA 4K0KQ 3CMEA 2Z0SA 1PH3A 4DR4Q 3S2HH 5M3MG 1XPOA 4JOIC 1Q12A 5JJKA 4QY7A 1X55A 1VQEA 4NXML 1X3GA 1GO3E 2V1CC 3NEMA 4DR1L 4DPGA 3Q8DA 3OTOL 3A5UA 3KLWA 3RLFA 1Q46A 4LW1A 2YYZA 2JA8G 4BA2I 2EXDA 3M85A 3PV0A 2JQOA 3HOVH 4JG2A 4DV7L 5GAEC 4DR3L 4KHPL 3K0XA 3I4MH 5DLQE 4A3BG 4P71A 2BA1A 1QUQA 5IWAQ 2N78A 3RZDH 1IL2A 3W5OA 2R7ZH 3E9IA 2R92H 3PGZA 2VY3A 3GTPH 2PNHA 4GN3B 2VQFQ 1I50H 1VQNA 3G48A 1HZAA 4JI8L 1NBWA 2UUAL 3CCRA 2YV5A 3E0EA 1QZHA 3OTOQ 1P16A 4DV6L 1VQ6A 2JA9A 3S15H 1E3PA 2XTIA 3PCOB 3CCJA 4AQYQ 2B63G 1N32L 1IYJB 3H0GG 2E5LQ 5IYDH 1BBWA 2OCEA 4OWWB 2BA0A 3PO3G 2R7FA 1K73C 5GADC 1FVIA 3ZJYC 3CXCA 3T1HQ 1Q1BA 1AH9A 4DK6C 1JT8A 4HIDA 1XNQQ 3PIPA 3BZKA 3MXNB 1QVGA 3J7ZC 4DR5L 4PZ6A 3RLOA 1YJWA 1E1OA 3CCMA 4JI4L 5LMNW 1X3EA 2HHHL 2HIVA 2OWOA 3J7A5 4O0AA 3HOXH 1XMOL 3NELA 2F4VQ 4A4IA 4A3IG 3EBEA 4DR4L 4JI7L 3M4PA 4JBJA 1IXRA 3I4OA 4XTCS 3S24A 1QVCA 3CCQA 1IZ6A 4GNXC 4X6AH 1EUJA 4X64Q 5GAHC 4GN4B 2JA5G 1MKHA 4YCWA 1K0RA 2CFMA 2IHEA 4HJAA 2R7DA 4JI3L 4DK3C 5FLMH 3HOYG 2A1AA 2Q2IA 2F52A 5C4XG 4LF8Q 2HT1A 1YI2A 1N8RC 4UPAA 2UXDL 3U58A 4IFDI 1HNZQ 2EIFA 1WFQA 1WOCA 1XTDA 3CP0A 1C9OA 3I56A 4DR7Q 2Q2TA 5M5YH 2I0QA 4KLKA 4LUOA 4DV5Q 4B3MQ 1VQGA 5C3EG 4DV1L 1JMCA 5IT9c 3L2PA 4POGA 5LMUQ 2K5VA 2ZTCA 2A8VA 3M4OH 1UE1A 4GKKL 4A3CG 1BKBA 4GNXB 3CPWA 2PQAA 3AQQA 4ME3A 1X3FA 3LGJA 4P73A 2UUBQ 2A19A 4AQYL 5ELOA 1GKHA 3GDEA 2PI2E 4LFBQ 4IFDJ 3STBD 1PH4A 2E5LL 2R93G 1NE3A 4PMWA 4HIMA 3GTOH 1O7IA 3I55A 4BY1H 4LFAQ 2MO1A 1VQDA 4EX5A 2OTLA 2CWPA 1X56A 3PUWA 1N34L 3HOVG 3EIVA 4QIWE 4A76A 1FJGL 4QQBX 1X54A 2K5HA 4YY3L 3I4MG 1SROA 4LUVA 3MEFA 3GTQH 3S1NH 4NXMQ 3ULPA 4DR1Q 1YJ9A 1U0LA 2D0OA 2WAQE 3NBHB 4MZ9A 2R7ZG 4ALPA 3AFQA 2AWOA 1IBML 4GOPA 3G6EA 4L5RC 1K83H 4DV7Q 1L1OA 3PF5A 4KHPQ 1G51A 3TS2A 2N49A 1YEZA 5M5WH 1Y1WG 4OX9L 4JI2L 3PUVA 3VDYA 4LF7L 1I5FA 2MFIA 2JA7G 4IOAA 4X66L 4NPSA 4HIOA 1KC8C 3PUYA 4JI8Q 4LF8L 5IYDG 3S1RH 2E2HH 1HJPA 2VS1A 4A3LH 1A8VA 5M3FH 4AYBE 3CCLA 4A3MH 3ULJA 4DV6Q 1S72A 1CKOA 1LTLA 4OO1G 2VNUD 2UU9L 1JJGA 1CKMA 3HKZG 2NZHA 1G291 1YIJA 4A3EH 1A62A 4RMFA 2K5NA 2KBNA 1N32Q 4APVA 4EQ5A 1I94L 4DR2L 4TQUS 3KDFA 5C44H 4BY7H 2WP8J 3T1YL 4R4OA 3GO5A 2IX1A 1PH2A 1ASYA 1KHIA 2DGYA 4NB3A 3PF4A 4WJ3M 1U5KA 1V1QA 4GS3A 2GVAA 4QL5A 1L1OC 4JI4Q 4LFAL 1PA6A 1D8LA 1XMOQ 1S40A 2KHJA 1VQBA 2RHQB 1PH9A 2CQOA 3U4VA 4JI7Q 3CCVA 1I3QH 4BBRH 5H1SE 2E2JH 1W2BA 1NY4A 4HJ9A 1EQRA 5GQOA 5HY6A 3S1QH 4JBMA 4GLVB 4YWMA 3A74A 1C0AA 4A93H 4JI3Q 4POFA 1WCMH 1CKNB 5M5XH 2HIXA 3KJPA 2Y0SE 1Q7YC 3S14H 5BR8L 1Z47A 4B3RL 1SR3A 2N3SA 1L2FA 1SRUA 4LF5L 2ASBA 2UXDQ 2JA6G 3HFZB 5IYCH 4UP7A 4JYAL 2IT1A 2ZTEA 4GLAC 1J6QA 1QZGA 1TWGH 4DV1Q 4A3KH 1WJJA 1K9MC 3HOUG 2YTYA 4BY1G 4GKKQ 2E2IH 3WWVA 4IPHA 1VQOA 1OXSC 3BU2A 4UY8C 5LMNQ 1HZBA 3W1GA 2Z6KA 5JEAJ 1VQJA 3I7FA 4JBWA 3G4SA 4DR6Q 4DV0Q 1WYDA 4P75A 2AMCB 2KCMA 1QVFA 3J80c 1R9TH 3L7ZC 1WI5A 1N34Q 2NN6I 1FJGQ 3A0JA 5E7NA 2WFWA 3F2CA 2NVYH 4YY3Q 5GAGC 1Z9FA 5IYBG 1Q8KA 3K80C 2ZJQA 3ERSX 3KF6A 3PO2H 4H02A 2Q2UA 4YWKA 2ZJPA 4A3DG 4JI1Q 1IBMQ 1KL9A 2VUMH 2UXBL 1GM5A 4HJ5A 4A3LG 4Y52H 1SLJA 3STBC 3TS0A 3HOWH 1NJIC 5M3FG 3TQYA 1RL2A 2D0PA 3M3YH 3J81i 4OX9Q 4JI2Q 5FJ8G 2WB1G 4LF7Q 1PYSB 4X66Q 3PUXA 3UDXA 4KHZA 1HZ9A 2KHIA 4C3JH 4DUYQ 2BH2A 4BXXH 2H5XA 2VQEL 4C3HH 2JJQA 5JEAG 3KYHC 2AKWB 1KRSA 2C35B 4NXNL 3TEHB 4BA1I 5IP7G 4AYBG 3CCSA 2UUCL 1VQLA 1XPUA 4BY7G 3CF5A 3U50C 1QUQB 3BZCA 5K36G 2UU9Q 4R1JA 3CMAA 1VQFA 3F2DA 1Y1VG 1LUZA 4R4QA 1KQSA 4BBSH 1I94Q 2ATWA 4DR2Q 2VW9A 4JV5L 4LNQA 4OXPA 3T1YQ 1N36L 4UP9A 4BBRG 1X6OA 2IX0A 5LMNL 5IY0A 1N36Q 1OXVA 4A3FH 1G6PA 3CC7A 1HR0W 4DV0L 4DR6L 4WJ4A 3JC66 1S3OA 4P74A 5JJLA 3RLNA 1CUKA 1J5EL 4LF9L 1P8LA 1YHQA 2JEAI 4IO9A 3S1MH 4FDBA 1V9PA 1WCMG 1V43A 5C0XI 3CC4A 2JA8H 3G71A 3IRBA 1OXUA 4HJ7A 1N33Q 2FXQA 3PUZA 1VQ4A 2R92G 5C4JH 2QEXA 4JI1L 4A3BH 3SGIA 1GVPA 4PG3A 5IE8A 3CCUA 4B3SL 5FLXc 3FKIH 1YITA 1X9NA 2MQHA 2GVBA 5BR8Q 3GTLH 1JE5A 4JC0A 3UDFA 4B3RQ 4LF5Q 4PZ8A 4YCVA 3CCEA 4LF6L 3I4NH 4DUYL 1HNWL 1AE2A 1VS0A 1XPRA 4JYAQ 1VQHA 2B29A 2QGQA 4IFDG 4IJLA 1TWAH 1GD7A 1X65A 3EN2A 1HNXQ 1PHJA 2N8NA 3OYYA 3J81j 1BBUA 3H0GH 4QJFA 1HR0L 1MJCA 1OTCA 3ICEA 3PO3H 4DAMA 1Q81C 1D7QA 2I5HA 2NZOA 3D31A 2YU9H 4JI6L 2CKZB 2I5LX 1EFWA 3RR5A 4LF4L 3HOXG 3PO2G 1FL0A 3K7UC 4O2DA 3GD7A 4YHHQ 1TWCH 4B3TL 3ULLA 1NTGA 3ER0A 4LFCQ 2PQAB 3K7AH 4GOPC 1KXLA 2GN5A 1E24A 1K8AC 2B3GA 4IPGA 1KAWA 3HKSA 4GN5A 1MJEA 3DM3A 1CSQA 5FLMG 3BJUA 4R4IA 1TWFH 4MNOA 4BXXG 2UXBQ 1ASZA 3OW2A 1B70B 1UE7A 2JA5H 3UE1A 2YTXA 1SE8A 2RHSB 5J3BA 1T9HA 3U4ZA 3L0OA 1N33L 3RN5A 3W1BA 2IY5B 1HH2P 2MO0A 4LUZA 1VQKA 3DLLA 1W3SA 1VQ9A 3K8AA 1XNRQ 2VQEQ 4GOPB 4P72A 1B7YB 1YJNA 4NXNQ 2UUCQ 5C3EH 4YCUA 1L1OB 4A3JH 2DUDA 1JB7A 4JBKA 4DUZL 1CSPA 1YHAA 4DV3L 1M1KC 4X62L 2JK8A 2LXJA 4HJ8A 2E8GA 1KIXA 4QGUA 1VCIA 1PH6A 1VQCA 4A3GH 1IBKQ 1SMXA 1HNXL 3HOZH 1HZCA 5IP9H 2NVTH 1EQQA 4JV5Q 2R93H 4X65L 2NVXH 4KI0A 3UDIA 2KENA 4Y7NH 2LSSA 1XMQL 2R6GA 4IJHA 2K14A 4LWCA 1Q82C 3KFUA 1H95A 5GROA 3GTGH 1VQPA 1VQIA 1A0IA 4L5QA 3I2ZA 2K50A 2BH8A 4YHHL 2ZM6L 1J5EQ 1SN8A 4LF9Q 4LFCL 1AE3A 1K3RA 2UXCL 2CWAA 3KDFB 1LYLA 3FKIG 3CD6A 5HGQA 3B6YA 2I5MX 4DV2L 2WAQG 2MNAA 1E1TA 4AIMA 1EYGA 5EAYA 4GNXA 1I6HH 3D0FA 2ZTDA 3I4NG 3GTJH 3AFPA 2AHOB 3AYHB 3H3VI 2PI2A 1NMGA 1Y1WH 1PH5A 4B3SQ 2JA7H 3HKZE 1PV4A 4A3MG 3UE0A 1JJCB 1A63A 1MIUA 4LF6Q 4A3EG 1HNWQ 1XNRL 2VL6A 1YZ6A 1EIYB 2Z6KC 3CW2C 1XJVA 4GKJL 5C44G 1RIPA 3JAMi 1PFSA 4C3IH 4A3CH 4JI5L 4JCVE 5AJ3Q 4K0KL 1HR0Q 3A5ZB 1EOVA 1UWVA 3M9BA 4UP8A 3UDGA 3GTKH 4R4TA 2EQSA 4RG1A 1IBKL 4JI6Q 4LF4Q 4A75A 2K4KA 1E22A 1EWIA 3H15A 4B3TQ 2XGTA 4OWTB 3CQZH 2VZAA 1JJ2A 1M90C 1FGUA 2JE6I 3M7NA 3F1ZA 4XIGS 5M3MH 4J15A 4R4CA 2NN6G 4TVAB 1PH7A 4A93G 5IWAL 2OTJA 1UE6A 4IPCA 1UEBA 4OWXB 2PMZE 1Y14B 3K81C 1VQ5A 4DV4Q 2VQFL 3RZOH 4IPDA 1L0WA 1KRTA 4OO1I 4A3JG 2K75A 5IYCG 4HIKA 1IBLQ 3KF6B 2K52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9H A;  4A3K G;  1EIF A;  4OON A;  1N9W A;  2Y0S G;  2JA6 H;  4JI0 Q;  4A3G G;  3HOZ G;  5IP9 G;  3FP9 A;  5C0X J;  4IOC A;  2ALY B;  4DAY B;  3KF8 B;  3F8T A;  3HOU H;  3FHW A;  1TXY A;  4DUZ Q;  4DV3 Q;  3T1H L;  4X62 Q;  1Q86 C;  1PVO A;  1XNQ L;  2YTV A;  2L15 A;  2F3I A;  3J81 c;  3F2B A;  4C2M H;  2B63 H;  5AJ3 L;  4AH6 A;  4X65 Q;  4PZ7 A;  2F4V L;  5ELN A;  4MTN A;  1YBY A;  1XMQ Q;  1OXX K;  1CKN A;  3CC2 A;  4L5T A;  3JAM c;  2KCT A;  1TWH H;  4DR3 Q;  4X64 L;  2ZM6 Q;  2QA4 A;  2VUM G;  2RF4 A;  5IYB H;  2ZJR A;  2UXC Q;  4DKA C;  3KJO A;  1UE5 A;  1VQ8 A;  1PYB A;  3HOW G;  3TRZ A;  1YVC A;  1BVS A;  2WB1 E;  4A3I H;  4JOI A;  4DV2 Q;  3S16 H;  4A3D H;  1VQ7 A;  2UUA Q;  5C0X G;  4YWL A;  2D62 A;  2ES2 A;  1HNZ L;  4DR7 L;  3TRE A;  4DNI A;  4DV4 L;  3J80 i;  1C7Y A;  1PH8 A;  1VQA A;  1VQM A;  1DGS A;  2AWN A;  5FJ8 H;  4DV5 L;  2CCZ A;  1B8A A;  3PSI A;  1YNX A;  4B3M L;  3NEN A;  1KD1 C;  3HOY H;  1NMF A;  2JEB I;  5C4X H;  5LMU L;  1IBL L;  2NVQ H;  3GTM H;  2LXK A;  1PH1 A;  1LM0 A;  3CAM A;  3M4Q A;  5IP7 H;  3PIO A;  2UUB L;  2OQK A;  3CPF A;  1OXT A;  3RN2 A;  1SFO H;  1E7Z A;  4JI0 L;  3S2D H;  3AEV A;  4LFB L;  3KOJ A;  4BBS G;  4GKJ Q;  4DR5 Q;  2IHF A;  2OQ0 A;  4L5S A;  4JI5 Q;  1Q1E A;  3RNU A;  2HHH Q;  2ID0 A;  1K8G A;  3H3V H;  1Y1V H;  5JJI A;  2RCN A;  4GLX A;  1YHB A;  3S17 H;  2Q2H A;  4A3F G;  2HQL A;  4K0K Q;  3CME A;  2Z0S A;  1PH3 A;  4DR4 Q;  3S2H H;  5M3M G;  1XPO A;  4JOI C;  1Q12 A;  5JJK A;  4QY7 A;  1X55 A;  1VQE A;  4NXM L;  1X3G A;  1GO3 E;  2V1C C;  3NEM A;  4DR1 L;  4DPG A;  3Q8D A;  3OTO L;  3A5U A;  3KLW A;  3RLF A;  1Q46 A;  4LW1 A;  2YYZ A;  2JA8 G;  4BA2 I;  2EXD A;  3M85 A;  3PV0 A;  2JQO A;  3HOV H;  4JG2 A;  4DV7 L;  5GAE C;  4DR3 L;  4KHP L;  3K0X A;  3I4M H;  5DLQ E;  4A3B G;  4P71 A;  2BA1 A;  1QUQ A;  5IWA Q;  2N78 A;  3RZD H;  1IL2 A;  3W5O A;  2R7Z H;  3E9I A;  2R92 H;  3PGZ A;  2VY3 A;  3GTP H;  2PNH A;  4GN3 B;  2VQF Q;  1I50 H;  1VQN A;  3G48 A;  1HZA A;  4JI8 L;  1NBW A;  2UUA L;  3CCR A;  2YV5 A;  3E0E A;  1QZH A;  3OTO Q;  1P16 A;  4DV6 L;  1VQ6 A;  2JA9 A;  3S15 H;  1E3P A;  2XTI A;  3PCO B;  3CCJ A;  4AQY Q;  2B63 G;  1N32 L;  1IYJ B;  3H0G G;  2E5L Q;  5IYD H;  1BBW A;  2OCE A;  4OWW B;  2BA0 A;  3PO3 G;  2R7F A;  1K73 C;  5GAD C;  1FVI A;  3ZJY C;  3CXC A;  3T1H Q;  1Q1B A;  1AH9 A;  4DK6 C;  1JT8 A;  4HID A;  1XNQ Q;  3PIP A;  3BZK A;  3MXN B;  1QVG A;  3J7Z C;  4DR5 L;  4PZ6 A;  3RLO A;  1YJW A;  1E1O A;  3CCM A;  4JI4 L;  5LMN W;  1X3E A;  2HHH L;  2HIV A;  2OWO A;  3J7A 5;  4O0A A;  3HOX H;  1XMO L;  3NEL A;  2F4V Q;  4A4I A;  4A3I G;  3EBE A;  4DR4 L;  4JI7 L;  3M4P A;  4JBJ A;  1IXR A;  3I4O A;  4XTC S;  3S24 A;  1QVC A;  3CCQ A;  1IZ6 A;  4GNX C;  4X6A H;  1EUJ A;  4X64 Q;  5GAH C;  4GN4 B;  2JA5 G;  1MKH A;  4YCW A;  1K0R A;  2CFM A;  2IHE A;  4HJA A;  2R7D A;  4JI3 L;  4DK3 C;  5FLM H;  3HOY G;  2A1A A;  2Q2I A;  2F52 A;  5C4X G;  4LF8 Q;  2HT1 A;  1YI2 A;  1N8R C;  4UPA A;  2UXD L;  3U58 A;  4IFD I;  1HNZ Q;  2EIF A;  1WFQ A;  1WOC A;  1XTD A;  3CP0 A;  1C9O A;  3I56 A;  4DR7 Q;  2Q2T A;  5M5Y H;  2I0Q A;  4KLK A;  4LUO A;  4DV5 Q;  4B3M Q;  1VQG A;  5C3E G;  4DV1 L;  1JMC A;  5IT9 c;  3L2P A;  4POG A;  5LMU Q;  2K5V A;  2ZTC A;  2A8V A;  3M4O H;  1UE1 A;  4GKK L;  4A3C G;  1BKB A;  4GNX B;  3CPW A;  2PQA A;  3AQQ A;  4ME3 A;  1X3F A;  3LGJ A;  4P73 A;  2UUB Q;  2A19 A;  4AQY L;  5ELO A;  1GKH A;  3GDE A;  2PI2 E;  4LFB Q;  4IFD J;  3STB D;  1PH4 A;  2E5L L;  2R93 G;  1NE3 A;  4PMW A;  4HIM A;  3GTO H;  1O7I A;  3I55 A;  4BY1 H;  4LFA Q;  2MO1 A;  1VQD A;  4EX5 A;  2OTL A;  2CWP A;  1X56 A;  3PUW A;  1N34 L;  3HOV G;  3EIV A;  4QIW E;  4A76 A;  1FJG L;  4QQB X;  1X54 A;  2K5H A;  4YY3 L;  3I4M G;  1SRO A;  4LUV A;  3MEF A;  3GTQ H;  3S1N H;  4NXM Q;  3ULP A;  4DR1 Q;  1YJ9 A;  1U0L A;  2D0O A;  2WAQ E;  3NBH B;  4MZ9 A;  2R7Z G;  4ALP A;  3AFQ A;  2AWO A;  1IBM L;  4GOP A;  3G6E A;  4L5R C;  1K83 H;  4DV7 Q;  1L1O A;  3PF5 A;  4KHP Q;  1G51 A;  3TS2 A;  2N49 A;  1YEZ A;  5M5W H;  1Y1W G;  4OX9 L;  4JI2 L;  3PUV A;  3VDY A;  4LF7 L;  1I5F A;  2MFI A;  2JA7 G;  4IOA A;  4X66 L;  4NPS A;  4HIO A;  1KC8 C;  3PUY A;  4JI8 Q;  4LF8 L;  5IYD G;  3S1R H;  2E2H H;  1HJP A;  2VS1 A;  4A3L H;  1A8V A;  5M3F H;  4AYB E;  3CCL A;  4A3M H;  3ULJ A;  4DV6 Q;  1S72 A;  1CKO A;  1LTL A;  4OO1 G;  2VNU D;  2UU9 L;  1JJG A;  1CKM A;  3HKZ G;  2NZH A;  1G29 1;  1YIJ A;  4A3E H;  1A62 A;  4RMF A;  2K5N A;  2KBN A;  1N32 Q;  4APV A;  4EQ5 A;  1I94 L;  4DR2 L;  4TQU S;  3KDF A;  5C44 H;  4BY7 H;  2WP8 J;  3T1Y L;  4R4O A;  3GO5 A;  2IX1 A;  1PH2 A;  1ASY A;  1KHI A;  2DGY A;  4NB3 A;  3PF4 A;  4WJ3 M;  1U5K A;  1V1Q A;  4GS3 A;  2GVA A;  4QL5 A;  1L1O C;  4JI4 Q;  4LFA L;  1PA6 A;  1D8L A;  1XMO Q;  1S40 A;  2KHJ A;  1VQB A;  2RHQ B;  1PH9 A;  2CQO A;  3U4V A;  4JI7 Q;  3CCV A;  1I3Q H;  4BBR H;  5H1S E;  2E2J H;  1W2B A;  1NY4 A;  4HJ9 A;  1EQR A;  5GQO A;  5HY6 A;  3S1Q H;  4JBM A;  4GLV B;  4YWM A;  3A74 A;  1C0A A;  4A93 H;  4JI3 Q;  4POF A;  1WCM H;  1CKN B;  5M5X H;  2HIX A;  3KJP A;  2Y0S E;  1Q7Y C;  3S14 H;  5BR8 L;  1Z47 A;  4B3R L;  1SR3 A;  2N3S A;  1L2F A;  1SRU A;  4LF5 L;  2ASB A;  2UXD Q;  2JA6 G;  3HFZ B;  5IYC H;  4UP7 A;  4JYA L;  2IT1 A;  2ZTE A;  4GLA C;  1J6Q A;  1QZG A;  1TWG H;  4DV1 Q;  4A3K H;  1WJJ A;  1K9M C;  3HOU G;  2YTY A;  4BY1 G;  4GKK Q;  2E2I H;  3WWV A;  4IPH A;  1VQO A;  1OXS C;  3BU2 A;  4UY8 C;  5LMN Q;  1HZB A;  3W1G A;  2Z6K A;  5JEA J;  1VQJ A;  3I7F A;  4JBW A;  3G4S A;  4DR6 Q;  4DV0 Q;  1WYD A;  4P75 A;  2AMC B;  2KCM A;  1QVF A;  3J80 c;  1R9T H;  3L7Z C;  1WI5 A;  1N34 Q;  2NN6 I;  1FJG Q;  3A0J A;  5E7N A;  2WFW A;  3F2C A;  2NVY H;  4YY3 Q;  5GAG C;  1Z9F A;  5IYB G;  1Q8K A;  3K80 C;  2ZJQ A;  3ERS X;  3KF6 A;  3PO2 H;  4H02 A;  2Q2U A;  4YWK A;  2ZJP A;  4A3D G;  4JI1 Q;  1IBM Q;  1KL9 A;  2VUM H;  2UXB L;  1GM5 A;  4HJ5 A;  4A3L G;  4Y52 H;  1SLJ A;  3STB C;  3TS0 A;  3HOW H;  1NJI C;  5M3F G;  3TQY A;  1RL2 A;  2D0P A;  3M3Y H;  3J81 i;  4OX9 Q;  4JI2 Q;  5FJ8 G;  2WB1 G;  4LF7 Q;  1PYS B;  4X66 Q;  3PUX A;  3UDX A;  4KHZ A;  1HZ9 A;  2KHI A;  4C3J H;  4DUY Q;  2BH2 A;  4BXX H;  2H5X A;  2VQE L;  4C3H H;  2JJQ A;  5JEA G;  3KYH C;  2AKW B;  1KRS A;  2C35 B;  4NXN L;  3TEH B;  4BA1 I;  5IP7 G;  4AYB G;  3CCS A;  2UUC L;  1VQL A;  1XPU A;  4BY7 G;  3CF5 A;  3U50 C;  1QUQ B;  3BZC A;  5K36 G;  2UU9 Q;  4R1J A;  3CMA A;  1VQF A;  3F2D A;  1Y1V G;  1LUZ A;  4R4Q A;  1KQS A;  4BBS H;  1I94 Q;  2ATW A;  4DR2 Q;  2VW9 A;  4JV5 L;  4LNQ A;  4OXP A;  3T1Y Q;  1N36 L;  4UP9 A;  4BBR G;  1X6O A;  2IX0 A;  5LMN L;  5IY0 A;  1N36 Q;  1OXV A;  4A3F H;  1G6P A;  3CC7 A;  1HR0 W;  4DV0 L;  4DR6 L;  4WJ4 A;  3JC6 6;  1S3O A;  4P74 A;  5JJL A;  3RLN A;  1CUK A;  1J5E L;  4LF9 L;  1P8L A;  1YHQ A;  2JEA I;  4IO9 A;  3S1M H;  4FDB A;  1V9P A;  1WCM G;  1V43 A;  5C0X I;  3CC4 A;  2JA8 H;  3G71 A;  3IRB A;  1OXU A;  4HJ7 A;  1N33 Q;  2FXQ A;  3PUZ A;  1VQ4 A;  2R92 G;  5C4J H;  2QEX A;  4JI1 L;  4A3B H;  3SGI A;  1GVP A;  4PG3 A;  5IE8 A;  3CCU A;  4B3S L;  5FLX c;  3FKI H;  1YIT A;  1X9N A;  2MQH A;  2GVB A;  5BR8 Q;  3GTL H;  1JE5 A;  4JC0 A;  3UDF A;  4B3R Q;  4LF5 Q;  4PZ8 A;  4YCV A;  3CCE A;  4LF6 L;  3I4N H;  4DUY L;  1HNW L;  1AE2 A;  1VS0 A;  1XPR A;  4JYA Q;  1VQH A;  2B29 A;  2QGQ A;  4IFD G;  4IJL A;  1TWA H;  1GD7 A;  1X65 A;  3EN2 A;  1HNX Q;  1PHJ A;  2N8N A;  3OYY A;  3J81 j;  1BBU A;  3H0G H;  4QJF A;  1HR0 L;  1MJC A;  1OTC A;  3ICE A;  3PO3 H;  4DAM A;  1Q81 C;  1D7Q A;  2I5H A;  2NZO A;  3D31 A;  2YU9 H;  4JI6 L;  2CKZ B;  2I5L X;  1EFW A;  3RR5 A;  4LF4 L;  3HOX G;  3PO2 G;  1FL0 A;  3K7U C;  4O2D A;  3GD7 A;  4YHH Q;  1TWC H;  4B3T L;  3ULL A;  1NTG A;  3ER0 A;  4LFC Q;  2PQA B;  3K7A H;  4GOP C;  1KXL A;  2GN5 A;  1E24 A;  1K8A C;  2B3G A;  4IPG A;  1KAW A;  3HKS A;  4GN5 A;  1MJE A;  3DM3 A;  1CSQ A;  5FLM G;  3BJU A;  4R4I A;  1TWF H;  4MNO A;  4BXX G;  2UXB Q;  1ASZ A;  3OW2 A;  1B70 B;  1UE7 A;  2JA5 H;  3UE1 A;  2YTX A;  1SE8 A;  2RHS B;  5J3B A;  1T9H A;  3U4Z A;  3L0O A;  1N33 L;  3RN5 A;  3W1B A;  2IY5 B;  1HH2 P;  2MO0 A;  4LUZ A;  1VQK A;  3DLL A;  1W3S A;  1VQ9 A;  3K8A A;  1XNR Q;  2VQE Q;  4GOP B;  4P72 A;  1B7Y B;  1YJN A;  4NXN Q;  2UUC Q;  5C3E H;  4YCU A;  1L1O B;  4A3J H;  2DUD A;  1JB7 A;  4JBK A;  4DUZ L;  1CSP A;  1YHA A;  4DV3 L;  1M1K C;  4X62 L;  2JK8 A;  2LXJ A;  4HJ8 A;  2E8G A;  1KIX A;  4QGU A;  1VCI A;  1PH6 A;  1VQC A;  4A3G H;  1IBK Q;  1SMX A;  1HNX L;  3HOZ H;  1HZC A;  5IP9 H;  2NVT H;  1EQQ A;  4JV5 Q;  2R93 H;  4X65 L;  2NVX H;  4KI0 A;  3UDI A;  2KEN A;  4Y7N H;  2LSS A;  1XMQ L;  2R6G A;  4IJH A;  2K14 A;  4LWC A;  1Q82 C;  3KFU A;  1H95 A;  5GRO A;  3GTG H;  1VQP A;  1VQI A;  1A0I A;  4L5Q A;  3I2Z A;  2K50 A;  2BH8 A;  4YHH L;  2ZM6 L;  1J5E Q;  1SN8 A;  4LF9 Q;  4LFC L;  1AE3 A;  1K3R A;  2UXC L;  2CWA A;  3KDF B;  1LYL A;  3FKI G;  3CD6 A;  5HGQ A;  3B6Y A;  2I5M X;  4DV2 L;  2WAQ G;  2MNA A;  1E1T A;  4AIM A;  1EYG A;  5EAY A;  4GNX A;  1I6H H;  3D0F A;  2ZTD A;  3I4N G;  3GTJ H;  3AFP A;  2AHO B;  3AYH B;  3H3V I;  2PI2 A;  1NMG A;  1Y1W H;  1PH5 A;  4B3S Q;  2JA7 H;  3HKZ E;  1PV4 A;  4A3M G;  3UE0 A;  1JJC B;  1A63 A;  1MIU A;  4LF6 Q;  4A3E G;  1HNW Q;  1XNR L;  2VL6 A;  1YZ6 A;  1EIY B;  2Z6K C;  3CW2 C;  1XJV A;  4GKJ L;  5C44 G;  1RIP A;  3JAM i;  1PFS A;  4C3I H;  4A3C H;  4JI5 L;  4JCV E;  5AJ3 Q;  4K0K L;  1HR0 Q;  3A5Z B;  1EOV A;  1UWV A;  3M9B A;  4UP8 A;  3UDG A;  3GTK H;  4R4T A;  2EQS A;  4RG1 A;  1IBK L;  4JI6 Q;  4LF4 Q;  4A75 A;  2K4K A;  1E22 A;  1EWI A;  3H15 A;  4B3T Q;  2XGT A;  4OWT B;  3CQZ H;  2VZA A;  1JJ2 A;  1M90 C;  1FGU A;  2JE6 I;  3M7N A;  3F1Z A;  4XIG S;  5M3M H;  4J15 A;  4R4C A;  2NN6 G;  4TVA B;  1PH7 A;  4A93 G;  5IWA L;  2OTJ A;  1UE6 A;  4IPC A;  1UEB A;  4OWX B;  2PMZ E;  1Y14 B;  3K81 C;  1VQ5 A;  4DV4 Q;  2VQF L;  3RZO H;  4IPD A;  1L0W A;  1KRT A;  4OO1 I;  4A3J G;  2K75 A;  5IYC G;  4HIK A;  1IBL Q;  3KF6 B;  2K52 A; 
#chains in the Genus database with same CATH topology
 2L4N A;  2Y0S G;  2JA6 H;  4OEL B;  3HOZ G;  3MEH A;  1MSH A;  3GTQ B;  3FP9 A;  4DAY B;  4N9T A;  5JVG 3;  1KDC A;  5HUR A;  1FD7 D;  2FHT A;  3KF8 B;  2J7Z A;  3HOU H;  3GQB A;  3FHW A;  4DUZ Q;  1PVO A;  2BE5 D;  2J0T D;  4H7B A;  4LMQ D;  2F3I A;  1JR0 D;  3J81 c;  3F2B A;  5AJ3 L;  1V8Q A;  4AH6 A;  5JPN C;  2F4V L;  2I07 B;  5ELN A;  1YBY A;  2SEB D;  1OXX K;  2QKI C;  1GUS A;  3DEP A;  3KBX A;  3NHH A;  3CC2 A;  3OWF A;  2E2H B;  1SNM A;  1PFM A;  2VUM G;  2RF4 A;  3H09 A;  1VQ8 A;  1B50 A;  4K14 A;  1YVC A;  1BVS A;  3EA6 A;  1STA A;  2EYL A;  2E74 C;  4YWL A;  2D62 A;  2ES2 A;  5IGC A;  4C3J G;  4BY7 B;  1LT3 D;  3HGB A;  3TRE A;  4DNI A;  4DV4 L;  3J80 i;  5FJ8 H;  1EWC A;  4DV5 L;  1JOK A;  1NMF A;  3ONA B;  5LMU L;  2OQK A;  3CPF A;  1OXT A;  1E7Z A;  5JOB A;  4JI0 L;  2BDN A;  2NTT A;  3M7G A;  3K5L A;  4DR5 Q;  2IHF A;  1IYV A;  2OQ0 A;  4L5S A;  1Q1E A;  2HHH Q;  2ID0 A;  1W6K A;  2Z1C A;  4A3F G;  3CME A;  2AQ1 B;  2HCI A;  3S2H H;  4DR4 Q;  2I46 A;  1XPO A;  4JOI C;  3TP8 A;  1VQE A;  3Q22 A;  1AN8 A;  4NXM L;  3NEM A;  4FF4 A;  3Q8D A;  3KLW A;  4K5X A;  2EY1 A;  3BZD B;  3GV6 A;  2EXD A;  1F9S A;  1KAB A;  2JQO A;  2MJ8 A;  3HOV H;  5GAE C;  3K0X A;  3I4M H;  4A3B G;  4Q0F A;  2BA1 A;  2RVL A;  5EBD A;  3SK8 A;  1IL2 A;  1G8Z D;  3OMC A;  4F8M A;  3OW7 A;  5M9O A;  1CI3 M;  4JI8 L;  1NBW A;  2UUA L;  4RKL A;  1TS2 A;  3DM1 A;  2YV5 A;  2EY2 A;  3E0E A;  4BS9 A;  4DV6 L;  1P16 A;  4CJ1 B;  2A6H C;  3PCO B;  3KK7 A;  2B63 G;  4IUU A;  4R9W A;  1YNN D;  2BA0 A;  1GUO A;  3PO3 G;  1FVI A;  3ZJY C;  3VR6 A;  4HID A;  1LTT D;  4HCS A;  5KNC A;  3PIP A;  3BZK A;  3MXN B;  1GUN A;  3J7Z C;  1E1O A;  3DMU A;  3M3Y B;  2XNA C;  3J7A 5;  1BF4 A;  3E5S A;  1XMO L;  4A3I G;  2R3Z A;  4I7A A;  3BYT B;  1H9S A;  4JI7 L;  4RKB A;  2KVM A;  5ELE A;  3Q24 A;  3CCQ A;  4GNX C;  1JOR A;  2JA5 G;  4YCW A;  2IHE A;  4JI3 L;  5C4H A;  1ZKO A;  5FLM H;  2F52 A;  3K0Y A;  2HT1 A;  1STN A;  4UPA A;  1H9M A;  2UXD L;  3U58 A;  2L11 A;  4DR7 Q;  2EIF A;  1WOC A;  4QCL A;  1XTD A;  3CRK C;  4B3M Q;  4IUR A;  2JXM B;  2B2T C;  3TP7 A;  5IT9 c;  4POG A;  4BY1 B;  1UE1 A;  4KY7 A;  4GNX B;  1X3F A;  5I9P A;  1A6X A;  3J81 E;  2E5L L;  1NE3 A;  2B2U C;  4HIM A;  3GTO H;  2F1M A;  4BY1 H;  2OTL A;  4EX5 A;  2CWP A;  4DK0 A;  1N34 L;  1QWY A;  4QIW B;  4QIW E;  3VA7 A;  1K83 B;  4DR1 Q;  1YJ9 A;  4MZ9 A;  1K0S A;  4ALP A;  1C8C A;  3AFQ A;  1IBM L;  4ULL A;  3U9O A;  3ITP A;  1XTC D;  1K28 A;  1PMR A;  5IGD A;  1K83 H;  4P2C B;  4DV7 Q;  2A69 D;  1YEZ A;  3KLS X;  2F4I A;  4A3M B;  4JI2 L;  1J8I A;  2O2L D;  1I5F A;  2PYK A;  1AFP A;  2F0K A;  4HIO A;  5IYD G;  3S1R H;  2VS1 A;  1A8V A;  5C44 B;  4A3M H;  2CH4 A;  1JJG A;  1LTL A;  1CKM A;  1Y8O B;  2K5N A;  5KND A;  2KHS A;  5JEA H;  3FRP B;  4TQU S;  4OIJ A;  2WII B;  5C44 H;  3T1Y L;  4R4O A;  3GO5 A;  5KYL A;  4BBR B;  1XYI A;  1ASY A;  1KHI A;  3PF4 A;  4B9X A;  2OEO A;  3V96 A;  4LFA L;  4A93 B;  2WV6 D;  4IUP A;  2KHJ A;  1VQB A;  2CQO A;  1WCM B;  4PV1 C;  3U4V A;  4BBR H;  3CCV A;  2E2J H;  4QB4 A;  3S14 B;  3A8J E;  3ZYY X;  4R8N A;  1XX8 A;  4GLV B;  4YWM A;  4A93 H;  3IKJ A;  1TWG B;  1WCM H;  4A3G B;  3S14 H;  2HDM A;  4B3R L;  2N3S A;  4LF5 L;  3U9S A;  3HFZ B;  4RGN A;  1PDQ A;  1J6Q A;  2TMP A;  1TWG H;  3K6O A;  4L6T B;  2VB3 X;  1BQQ T;  1R9T B;  1IW7 C;  3BU2 A;  4UY8 C;  3AU7 A;  5IGB A;  1VQJ A;  4JBW A;  5DM6 3;  4DR6 Q;  5A2Q L;  4DXF A;  3SE0 A;  1R9T H;  1LV9 A;  2A73 B;  4FF1 A;  1CFM A;  5E7N A;  1JQY D;  4YY3 Q;  1Z9F A;  4R8I A;  1Q8K A;  3KF6 A;  4M1U B;  1SYE A;  1HUM A;  1KL9 A;  3I91 A;  2BOS A;  4DAY A;  2O4X A;  4EQO A;  3MXG A;  3KF8 A;  1RKN A;  1NJI C;  5M3F G;  5J1Z A;  1STE A;  1TS5 A;  2WB1 G;  3TZU A;  3PUX A;  4X66 Q;  4DUY Q;  2BH2 A;  5IT9 E;  4JPB W;  4FO2 A;  1TQO A;  3KYH C;  2AKW B;  1F9Q A;  4BA1 I;  4DF7 A;  4AYB G;  3CF5 A;  4WOR A;  2NWG A;  3HG9 A;  4RA8 A;  2UU9 Q;  3CMA A;  2F0N A;  3A7A B;  1FGB D;  2B8G A;  3DEO A;  2RDG A;  1R4Q B;  1WD1 A;  4MTK A;  1T5E A;  4JV5 L;  2L5T A;  2IWH A;  4LNQ A;  2F0E A;  3R2T A;  5DNF A;  2IL8 A;  2PPB C;  4QF4 A;  5EPK A;  1HR0 W;  3JC6 6;  1HA5 A;  1O7Y A;  1S3O A;  3SK6 A;  3RLN A;  1J5E L;  1A15 A;  2KQ3 A;  4XYQ A;  4LF9 L;  2JEA I;  3R2I A;  1V9P A;  2HUG A;  1BDO A;  1EU4 A;  2F3W A;  4UHV A;  1NNX A;  4Z9C B;  5ELB A;  3G71 A;  1OXU A;  2R92 G;  2FXQ A;  2QEX A;  1STG A;  3NTI A;  3FMC A;  2A68 D;  1SYD A;  3FKI H;  5FLX c;  5G3L F;  1ET6 A;  3O13 A;  3G7L A;  3CU7 A;  3EJI A;  3H0G B;  1WTP A;  4CDC C;  1U4P A;  1AE2 A;  1VS0 A;  3OOC A;  5NUC A;  2QGQ A;  5A35 A;  4IJL A;  1TWH B;  1JCK B;  3H0G H;  2O5I C;  1M8A A;  2NB0 A;  1OTC A;  3ICE A;  1HHV A;  2I5H A;  1FR3 A;  3H3V C;  1EFW A;  2X69 A;  5I4D A;  1FL0 A;  3PO2 G;  3K7U C;  4O2D A;  3H94 A;  3GD7 A;  1Y69 U;  1TWF B;  4B3T L;  4LFC Q;  3BDO A;  2PQA B;  3NQT A;  4JVZ A;  3DHQ A;  1WTO A;  1RJT A;  4HED A;  2B2V C;  4C56 C;  1KDA A;  4G7H C;  2ENB A;  1O7Z A;  3TME A;  1TWF H;  4HN7 A;  4MNO A;  1S5E D;  1B70 B;  1UE7 A;  1OO9 B;  2EYO A;  4J6H A;  4H13 C;  5CBE E;  5KIX A;  2YTX A;  5J3B A;  3AB9 A;  3QB3 A;  1H9J A;  1VQK A;  4KV6 A;  3MXN A;  1VQ9 A;  3K8A A;  3FPP A;  4MIU A;  1QCB D;  2R93 B;  1L1O B;  1SDF A;  2DUD A;  2JK8 A;  4HJ8 A;  2E8G A;  3GTG B;  3J7Y W;  5ELF A;  1BR9 A;  1CM9 A;  1LTS D;  2J4X A;  1MD2 D;  4C1N K;  2R93 H;  2R7Z B;  4RCN A;  3EQL C;  1H95 A;  5GRO A;  3GTG H;  3I72 A;  2BH8 A;  2AQ2 B;  3GTJ B;  4PMC A;  1SAP A;  2F0P A;  3KDF B;  2JA7 B;  1HFG A;  1E1T A;  1EYG A;  5CYU A;  4GNX A;  2ZTD A;  1V1O A;  3A8I E;  3GTJ H;  3AFP A;  1PH5 A;  4HCE A;  4KMU C;  3HKZ B;  5D14 A;  2JA7 H;  3HKZ E;  1EEF D;  5FO7 B;  3UE0 A;  1JJC B;  3OWE B;  5C0X H;  2A5H A;  2EY5 A;  3BS1 A;  5T1G A;  1GXD C;  4JI5 L;  5AJ3 Q;  4K0K L;  3A5Z B;  1PFN A;  4UP8 A;  3M9B A;  4CDF C;  5C3X A;  4R4T A;  3BVZ A;  3FDT A;  1GHJ A;  1PLF A;  5CV6 A;  5CV5 A;  2LFN A;  1DOK A;  2A6E D;  1PTO F;  4MN3 A;  2VZA A;  3MXU A;  4OL7 A;  1SMY D;  4J15 A;  4TVA B;  1PH7 A;  5IWA L;  1UE6 A;  2PMZ B;  1G2S A;  2PMZ E;  5FLX E;  1Y14 B;  3K81 C;  4DV4 Q;  4QMG A;  2VXW A;  4IPD A;  1Y8P B;  3BYY B;  2F0D A;  4A3J G;  5IYC G;  3BG3 A;  3OTO L;  4A3K G;  1N9W A;  4F7X A;  4JI0 Q;  4J8Q A;  4C2M B;  1JOO A;  1W6J A;  1Q86 C;  4X62 Q;  3SK4 A;  1XNQ L;  4X3K A;  2QDB A;  2YTV A;  1HTL D;  1D1I A;  4C2M H;  5M5W B;  4PZ7 A;  2M00 A;  1LLR D;  1XMQ Q;  2B8F A;  4A3D B;  3S16 B;  1F2Z A;  2KCT A;  1DON A;  1M4V A;  3A54 A;  2ZM6 Q;  1EEI D;  2F0V A;  5IYB H;  2QA4 A;  2UXC Q;  3SK5 A;  1UE5 A;  2DJG C;  3QR8 A;  3HOY B;  4A3D H;  3S16 H;  3GTM B;  2NVQ B;  2UUA Q;  5CGK A;  4CHT B;  1DOM A;  3L3O C;  1HNZ L;  3C46 A;  1SFO B;  3S2D B;  2F0J A;  4C3H G;  1VQA A;  1PH8 A;  2AWN A;  1YNX A;  3BVM A;  3NEN A;  3HOY H;  4XYO A;  3GTM H;  2NVQ H;  1Y1V B;  4U68 A;  1FNW A;  3CAM A;  5FK9 C;  3S17 B;  2UUB L;  3D6C A;  3S2D H;  1QNU A;  1SFO H;  5E3F A;  4FXD A;  4DK1 A;  4BBS G;  4GKJ Q;  4TRD A;  1CZW A;  4RFB A;  1HQM C;  3RNU A;  1K8G A;  2Z4I A;  5JJI A;  1Y1V H;  4GLX A;  1YHB A;  3S17 H;  1QOH A;  3VA5 A;  1PH3 A;  5M3M G;  5JJK A;  3NE5 B;  2MPM A;  1X55 A;  5L37 A;  4HR7 B;  4DPG A;  4F87 A;  1ICF B;  2XRQ D;  3A5U A;  3RZD B;  3VR4 A;  4XDX A;  2EPB A;  3RLF A;  2G9H D;  4LW1 A;  3V2T A;  2JA8 G;  1PTO B;  3M85 A;  2H4O A;  3PV0 A;  4JG2 A;  1WTH A;  1Q90 A;  2X6L A;  5DLQ E;  1QJO A;  1ZYR C;  3RZD H;  1LTB D;  3W5O A;  3S15 B;  3P75 A;  3PGZ A;  2VQF Q;  4O42 A;  4KTA A;  3G48 A;  1HZA A;  1PTO H;  2EOT A;  2ZXP A;  5CV9 A;  4RCO A;  3CCR A;  4CDE C;  3KLS A;  3OHX C;  1VQ6 A;  3OIQ A;  3S15 H;  4S3S A;  1F77 A;  3VYR A;  3CCJ A;  3D3R A;  3ND9 A;  5CC4 A;  5E4W C;  2E5L Q;  1BBW A;  2OCE A;  4IFD H;  3HOX B;  1STB A;  4OGQ C;  3T1H Q;  1Q1B A;  4DK6 C;  5J39 A;  1B4O A;  2N88 A;  3I73 A;  2RQX A;  4JI4 L;  2F0O A;  4O0A A;  3HOX H;  2RKS A;  1F9P A;  4A4I A;  3EBE A;  4PNY A;  3M4P A;  4JBJ A;  1EL0 A;  3I4O A;  4XTC S;  3NUC A;  3S24 A;  2DY8 A;  4X64 Q;  1MBY A;  5LL6 X;  1MKH A;  1X3P A;  5M5Y B;  2R7D A;  4DAV A;  1G91 A;  2Q2I A;  5G3L D;  3T16 A;  1YI2 A;  1N8R C;  3M4O B;  1S4Z A;  2IX3 A;  3CP0 A;  3I56 A;  5M5Y H;  1HA6 A;  1S5C D;  4RAU C;  4A3C G;  2K5V A;  2ZTC A;  5IIF A;  4IN3 A;  5IOC A;  3M4O H;  3CPW A;  2PQA A;  3AQQ A;  3P7J A;  3C1E A;  2A19 A;  1GKH A;  4LFB Q;  2LY7 A;  3CKI B;  3C1F A;  1O7I A;  4K6L A;  4LFA Q;  2QW7 A;  1U4R A;  1VQD A;  3NK9 A;  1WD0 A;  1TS3 A;  3HOV G;  2K5H A;  1WTR A;  3I4M G;  3GTQ H;  3ULP A;  2WAQ B;  2WAQ E;  3R8B A;  4ILW A;  1E2Z A;  2D2C C;  1NCV A;  1L1O A;  3PF5 A;  4KHP Q;  3TS2 A;  2N49 A;  3NSW A;  4OX9 L;  1HTP A;  2B2Y C;  4LF7 L;  2AUK A;  1SE2 A;  3PUY A;  2E2H H;  1HJP A;  1JB3 A;  4A3L H;  4CJ0 B;  1B9N A;  3ULJ A;  3J81 L;  1G29 1;  4FXK C;  4WFN 3;  4C3I G;  1A62 A;  4RMF A;  3VYU A;  3RMH A;  1N32 Q;  5J22 A;  4EQ5 A;  1I94 L;  4DR2 L;  3KDF A;  4BY7 H;  1EFI D;  1PH2 A;  5K36 H;  2DGY A;  4NB3 A;  2PW5 A;  2ZXO A;  4GS3 A;  4QL5 A;  1TY2 A;  5CV4 A;  2F0F A;  3UI2 A;  1ILQ A;  3PMF A;  2M9V A;  5H1S E;  1NY4 A;  2K7V A;  3OPO A;  4ZAI A;  1BUV T;  2NN6 H;  1C0A A;  4NMZ A;  1KNA A;  4V0B A;  1CKN B;  2Y0S B;  2HIX A;  1Q7Y C;  2Y0S E;  5K5P A;  3HOZ B;  5BR8 L;  2NZ1 D;  5BN3 A;  4UP7 A;  5ELC A;  2G9D A;  4DV1 Q;  1K9M C;  1PRT F;  2YTY A;  4BY1 G;  4GKK Q;  4DGZ A;  4KKU A;  1VQO A;  2R61 A;  1OXS C;  1HZB A;  3W1G A;  2NBF A;  5JEA J;  3G4S A;  3I7F A;  2BCO A;  3EVQ A;  3J80 c;  1PTO D;  2VUM B;  2IPK D;  1WI5 A;  4G57 A;  1FJG Q;  3F2C A;  2EYH A;  2WFW A;  2XSC A;  1LT5 D;  2CVR A;  2ZJQ A;  4XT3 B;  4H02 A;  2ZJP A;  4C3J B;  2UXB L;  1ML0 D;  3MAQ A;  5EKI A;  2VUM H;  4HJ5 A;  3STB C;  3TS0 A;  3M3Y H;  4XT1 B;  2K33 A;  1PYS B;  3V05 A;  4C3J H;  4BXX H;  5FOB B;  2BDO A;  1BXT A;  5JEA G;  5IP7 G;  1JC7 A;  3CCS A;  4FVM A;  1QUQ B;  1A3U A;  1JIC A;  1LTA D;  4R1J A;  4A3F B;  1R4P B;  2WKD A;  3F2D A;  4R4Q A;  3D6W A;  2ATW A;  2VW9 A;  1LTR D;  4OXP A;  5COR A;  4UP9 A;  4BBR G;  1X6O A;  2IX0 A;  5LMN L;  1S5F D;  4A3F H;  3RZO B;  4WJ4 A;  2WAC A;  5JJL A;  3QJY A;  5C4J B;  2F0W A;  4A3B B;  1MHW C;  1YHQ A;  4IO9 A;  4FDB A;  1WCM G;  1ENF A;  5C0X I;  2K5W A;  1PRT C;  3GTL B;  3IRB A;  3NWS A;  3PUZ A;  5C4J H;  4JI1 L;  4A3B H;  3SGI A;  1EYA A;  1GVP A;  4TSS A;  3DWQ A;  4PG3 A;  5IGG A;  5IE8 A;  5IT9 L;  2DNC A;  3GTL H;  2B63 B;  4JC0 A;  2XRS D;  4PZ8 A;  3T51 B;  3CCE A;  3PO3 B;  3W2D A;  1HNW L;  1XPR A;  4JYA Q;  2YU9 B;  2K03 A;  4G7O C;  1GD7 A;  1TWC B;  4L63 B;  4KJN A;  1E2V A;  3OYY A;  2N8N A;  1BBU A;  2FIN B;  1VF7 A;  4QJF A;  1HR0 L;  3T4A C;  3PO3 H;  4DAM A;  5CMD A;  4A3I B;  1D7Q A;  2YU9 H;  2NUC A;  2I5L X;  2B2W C;  4ODG A;  1TWC H;  2F0G A;  3ER0 A;  2JA5 B;  2OT2 A;  1KXL A;  2K04 A;  2GN5 A;  1KAW A;  1YNJ C;  5FO8 B;  3KUP A;  2JA5 H;  1SE4 A;  3UE1 A;  1SE8 A;  2K28 A;  1N33 L;  4HMJ A;  3W1B A;  2IY5 B;  1HH2 P;  1TS4 A;  1W3S A;  5C6A A;  2VQE Q;  1LTG D;  4P72 A;  1IYU A;  2ICI A;  4NXN Q;  2UUC Q;  3DWP A;  3D8G A;  1JB7 A;  4JBK A;  5CR3 A;  4DUZ L;  4ABN A;  2EYM A;  1VCI A;  1QE6 A;  1PH6 A;  1VQC A;  4A3G H;  3J80 E;  1SMX A;  4DN4 M;  4RGO S;  1HZC A;  5IP9 H;  4CKE A;  1N36 Q;  2LSS A;  5E1F A;  4IJH A;  1I50 B;  2DN8 A;  3E3X A;  4JW0 A;  1VQP A;  1VQI A;  4L5Q A;  1I6H B;  2K50 A;  5EKL A;  4FYD A;  1SN8 A;  1C48 A;  1LYL A;  3FKI G;  1HRJ A;  4FNF A;  2QDL A;  2Z4H A;  5EAY A;  1I6H H;  2AQ3 B;  2AHO B;  2XIW A;  3AYH B;  4O1N A;  3ERO A;  3VR3 A;  5LHY 1;  4B3S Q;  3FPU B;  4LF6 Q;  3QWN A;  3GTK B;  5CBA E;  4A3E G;  1ESF A;  3PIP 3;  1XNR L;  1DOL A;  2Z6K C;  1A2U A;  3CW2 C;  1ICW A;  3JAM i;  3NXW A;  3HP3 A;  1EY8 A;  1UWV A;  2CW0 C;  3GTK H;  4LF4 Q;  1IBK L;  4JI6 Q;  2K4K A;  4NDX A;  1I6V C;  3J7A F;  1JJ2 A;  2A6H D;  3F1Z A;  4XIG S;  1LO5 D;  4R4C A;  2FMM A;  2EVB A;  3NTH A;  1JE4 A;  4IPC A;  1F9R A;  2GA4 B;  4ZKB B;  4CKB A;  2SOB A;  1VQ5 A;  4XQQ A;  3Q23 A;  4FF3 A;  1L0W A;  2KA7 A;  4FP5 D;  1BBX C;  4N9P A;  2K52 A;  3E9H A;  3NPP A;  1EIF A;  1EY6 A;  1STY A;  2QEJ C;  5C0X J;  4IOC A;  2KEC A;  2RSN A;  1SJE D;  3F8T A;  1UNS A;  1TXY A;  4DV3 Q;  2K5Q A;  1KTK A;  1XXG A;  3VYT A;  1RD9 D;  2RSO A;  2L15 A;  2KCC A;  4F88 A;  4X65 Q;  3Q6S A;  1CKN A;  4L5T A;  3JAM c;  3NWT A;  1TWH H;  5E4X A;  3A55 A;  1SYF A;  5I6W A;  5FLX L;  3KJO A;  3HOW G;  2WB1 B;  2WB1 E;  4JOI A;  4DV2 Q;  4CBV A;  1VQ7 A;  5C4X B;  5C0X G;  1WTW A;  3K5N A;  4DR7 L;  1GUW A;  5DEH A;  2JN4 A;  4WJW A;  1B3Q A;  1VQM A;  2CCZ A;  4B3M L;  3K58 A;  1KD1 C;  4IQZ A;  2JEB I;  3I3C A;  5C4X H;  3PIO 3;  4J1M A;  1IBL L;  2LXK A;  1LM0 A;  2Q8R E;  3KOJ A;  3BDL A;  4K5W A;  2PNR C;  3S1Q B;  3IAY A;  3H3V H;  3VR2 A;  5ISR A;  1UAP A;  2Z0S A;  1X3G A;  1SXT A;  2V1C C;  4DR1 L;  2R92 B;  1Q46 A;  3K5O A;  1A3T A;  2YYZ A;  2K05 A;  5EPL A;  1LAC A;  4DV7 L;  4DR3 L;  3BDC A;  2E2I B;  4P71 A;  1QUQ A;  1LTI D;  2R7Z H;  2QF7 A;  2R92 H;  3T53 B;  2PNH A;  4GN3 B;  1F2M A;  1VQN A;  1J9O A;  1I4Q A;  1QZH A;  2KEE A;  1V1P B;  1AP0 A;  3SDZ A;  2JA9 A;  1PFB A;  4IUQ A;  3SHL A;  1BO0 A;  2RDH A;  1FYC A;  3PO2 B;  1EY5 A;  5GAD C;  3CXC A;  4OO1 H;  1EQV A;  1MI2 A;  1RDP D;  1IL8 A;  4IUT A;  1QVG A;  2B2T A;  1X3E A;  2HIV A;  1VMC A;  4KN4 C;  2OWO A;  3NEL A;  2F4V Q;  1STH A;  4EQP A;  1IXR A;  4ZCK A;  1QVC A;  4X6A H;  2B2U A;  4IUN A;  1IW7 D;  2CFM A;  4HJA A;  4KY5 A;  4DK3 C;  2L12 A;  2BE5 C;  1AZP A;  3HOY G;  1CZG A;  4ZKC B;  1WFQ A;  1C9O A;  2I0Q A;  4KLK A;  2NTS A;  4DV5 Q;  1GHK A;  5C3E G;  1JMC A;  3R93 A;  3DWA A;  3L2P A;  5LMU Q;  4KKS A;  1BKB A;  4ME3 A;  3LGJ A;  3LWE A;  4AQY L;  1XWE A;  2PI2 E;  4IFD J;  1MGS A;  1PH4 A;  5I2X A;  2SDF A;  1SYG A;  2EJM A;  1S5D D;  4QQB X;  4K8I A;  4YY3 L;  1SRO A;  3MEF A;  3FVQ A;  1GUT A;  3TSS A;  4NXM Q;  3NBH B;  2D0O A;  1TT2 A;  2P5Z X;  2XN9 C;  4K2K A;  1PZJ D;  2AWO A;  3LNN A;  4L5R C;  1H9S B;  3LWU A;  1G51 A;  4DA2 A;  2MGS A;  5M5W H;  1Y1W G;  2MP1 A;  3PUV A;  5D3I B;  4X66 L;  3SR1 A;  4JI8 Q;  4LF8 L;  1B53 A;  4DV6 Q;  4KJO A;  4U67 3;  2VNU D;  2UU9 L;  3A8K E;  2NZH A;  3D4W A;  3TDQ A;  3I4L A;  1YIJ A;  1KDB A;  1EYC A;  4ID6 A;  5EQ0 A;  1B2T A;  2IW3 A;  2IX1 A;  1HUN A;  3DUZ A;  4WJ3 M;  1U5K A;  1V1Q A;  2F0T A;  3RUZ A;  1EWH A;  2KJX A;  2RCF A;  1PA6 A;  1TU2 B;  1D8L A;  3RD4 A;  1XMO Q;  2JSO A;  1S40 A;  2RHQ B;  1PH9 A;  5CV8 A;  4JI7 Q;  3C2P A;  1W2B A;  1Q3L A;  4HTH A;  1YNN C;  4A3J B;  4JBM A;  1CT1 D;  3TP5 A;  4JI3 Q;  4POF A;  5TSS A;  1BNZ A;  1X3Q A;  4A3K B;  1NR2 A;  3VYS A;  3A7L A;  1Z47 A;  2QCP X;  2UXD Q;  1L2F A;  1SRU A;  2Z8L A;  2JA6 G;  4ZQ3 A;  5IYC H;  4HSP A;  1QZG A;  2Q8T A;  4A3K H;  1WJJ A;  3DXJ C;  1IKM A;  3HOU G;  3NQI A;  5LMN Q;  2Z6K A;  3BVG A;  1I4H A;  2LKV A;  2D5D A;  2AMC B;  2KCM A;  2CH4 W;  1ZXT A;  3L7Z C;  1N34 Q;  4X3U A;  1PXU A;  1IKL A;  5D65 A;  2EE1 A;  3ERS X;  1CA5 A;  2Q2U A;  4YWK A;  1I4G A;  4JI1 Q;  1IBM Q;  1GM5 A;  4C3H B;  1CHQ D;  4A3L G;  1SLJ A;  4B08 A;  1RL2 A;  2D0P A;  3J81 i;  4JI2 Q;  5FJ8 G;  1SSO A;  1HZ9 A;  2H5X A;  3LX0 A;  2OXP A;  4C3H H;  5EJW A;  2C35 B;  4BBS B;  1U4L A;  3MTS A;  3TEH B;  4BY7 G;  1O7L A;  1CA6 A;  1VQL A;  3HS0 C;  5K36 G;  5F2D A;  2ZXR A;  1VQF A;  5EPJ A;  5M3M B;  1LUZ A;  4K2L A;  1CTM A;  5FO9 B;  4BBS H;  3X3N A;  1CK1 A;  2A69 C;  4E6I A;  3QO2 A;  3T1Y Q;  5IY0 A;  1H9R A;  1OXV A;  2JA8 B;  1FNU A;  3WDN A;  4DV0 L;  5IGF A;  1P8L A;  1CQV A;  3CC4 A;  1V43 A;  2L55 A;  2JA8 H;  2RBM A;  1ENA A;  4HJ7 A;  1N33 Q;  1VQ4 A;  1EIG A;  3I4N B;  2EXZ A;  2JP1 A;  4HSV A;  4PMB A;  4PQX A;  1YIT A;  1TWA B;  2GVB A;  5KRU A;  2B2V A;  3UDF A;  4B3R Q;  4LF5 Q;  3I4N H;  2B29 A;  2EJG C;  4HAE A;  1TWA H;  5ELD A;  1B1Z A;  1X65 A;  3EN2 A;  3OMG A;  1E0B A;  3J81 j;  1LAB A;  1MJC A;  4CDD C;  1Q81 C;  1E2W A;  3D31 A;  2NZO A;  1D5Z C;  4B9W A;  2CKZ B;  1H9K A;  4LAA A;  2OF1 A;  2QIL A;  3ULL A;  3URY A;  4IUV A;  4GOP C;  2PW7 A;  4LK1 C;  1U9R A;  5EKK A;  4RHS A;  1K8A C;  2WKC A;  3HKS A;  2RDF A;  1V1P A;  1MJE A;  1CSQ A;  1NUC A;  3BJU A;  4X3S A;  4R4I A;  5FLM G;  4BXX G;  1G6Z A;  3IL8 A;  2L1B A;  1DD2 A;  3L0O A;  3K5M A;  5HGT A;  4LUZ A;  3KBG A;  4Q5V A;  1DXM A;  3DLL A;  3S2H B;  1XNR Q;  4GOP B;  1BCP F;  3CRL C;  2NVT B;  2A74 C;  3HZX A;  2NVX B;  1ESR A;  4A3C H;  1YHA A;  2PZT A;  2EDG A;  4X62 L;  2LXJ A;  1KIX A;  3HOV B;  4EQN A;  1IBK Q;  1HNX L;  3HOZ H;  3I4M B;  2DJF C;  2NVT H;  2FJ2 A;  5IOD A;  4JV5 Q;  1KLU D;  4KK7 A;  2NVX H;  3UDI A;  1JOQ A;  2KEN A;  2EY6 A;  1XMQ L;  2R6G A;  1JWU D;  2K14 A;  3KFU A;  4FXG C;  1A0I A;  2F0M A;  4UDU C;  4YHH L;  3W3A A;  3MA2 B;  2ZM6 L;  5C5M A;  1J5E Q;  4LF9 Q;  1AE3 A;  2UXC L;  2F0Q A;  3B6Y A;  2MNA A;  2MHV A;  3Q0A A;  2G5D A;  3D0F A;  1Y8N B;  2FFK B;  2K01 A;  3MWY W;  3H3V I;  1KAA A;  2PI2 A;  2DY7 A;  2HDL A;  5KNB A;  1Z7T A;  3EFX D;  4C3I B;  4A3M G;  4QUC A;  3FEW X;  1I4P A;  1YZ6 A;  1EIY B;  1XJV A;  3J80 L;  5IGE A;  3NBH A;  5C44 G;  4GKJ L;  1PFS A;  4C3I H;  1ZYR D;  1EZ6 A;  2F0S A;  2A68 C;  4RG1 A;  2HD3 A;  4KN7 C;  1E22 A;  2WIN B;  3F2U A;  4B3T Q;  2XGT A;  4OWT B;  5CV7 A;  1FGU A;  3M7N A;  2EYF A;  3TN2 A;  1BCP C;  5JPM C;  1EIH A;  4N8F A;  3MVV A;  1EY9 A;  1DJR D;  4A93 G;  2XWB B;  1HPC A;  4OWX B;  2F0U A;  1KNE A;  2F0H A;  3NTK A;  2VQF L;  2F03 A;  3RZO H;  3H6M A;  2E75 C;  1VF5 C;  1KRT A;  4OO1 I;  4XXE A;  3GTO B;  2K75 A;  1IBL Q;  3MC0 B;  4HIK A;  4ZLT F;  4OON A;  3HRZ C;  4A3G G;  4KD3 A;  4MHE A;  5IP9 G;  2ALY B;  2O5J C;  1BCP B;  1EY4 A;  1ZEQ X;  3D4R A;  1HQR D;  3T1H L;  1K3B C;  2D9U A;  4GZY C;  1PRT B;  2B63 H;  1RTN A;  1KLG D;  4MTN A;  2F0I A;  5EGT A;  5JJZ A;  3S1R B;  1TVX A;  4DR3 Q;  4X64 L;  1I4R A;  5JAV A;  2ZJR A;  4DKA C;  1PYB A;  3TRZ A;  5KGU A;  4A3I H;  3J7A V;  3MHB A;  2PQE A;  3S9W A;  2AUJ D;  4I7Z C;  3KLR A;  1C7Y A;  1DGS A;  1L0X B;  1B8A A;  1EY0 A;  3PSI A;  1FNV A;  1A2T A;  1II3 A;  1PH1 A;  3M4Q A;  5IP7 H;  1EY7 A;  5C5L A;  3PIO A;  1I4X A;  3RN2 A;  1DYQ A;  4ZUI A;  3AEV A;  4LFB L;  2E2J B;  1SNP A;  4OEM B;  4JI5 Q;  2VB2 X;  2RCN A;  2V4D A;  3P1H A;  4K0K Q;  2Q2H A;  4G4K A;  2HQL A;  1SE3 A;  2K5D A;  1Q12 A;  4QY7 A;  1G2T A;  1GO3 E;  2DNE A;  2MUY A;  3GTP B;  4BA2 I;  4KY6 A;  4CKC A;  2H1E A;  4KHP L;  1SND A;  5IWA Q;  2N78 A;  5D3D A;  3E9I A;  2HQE A;  4L8J A;  2VY3 A;  3GTP H;  1I50 H;  1NAP A;  1IHZ A;  3E0J A;  5T1I A;  1UUP A;  3OTO Q;  2A6E C;  2L0C A;  1E3P A;  2XTI A;  3GP7 A;  4AQY Q;  1X32 A;  2ICE C;  1B44 D;  1N32 L;  1IYJ B;  3H0G G;  1SMY C;  4OWW B;  5IYD H;  2R7F A;  1K73 C;  4IZ8 A;  4ZUJ A;  1AH9 A;  1JT8 A;  2FMC A;  1XNQ Q;  1UEA B;  4DR5 L;  4PZ6 A;  3RLO A;  1YJW A;  3CCM A;  5LMN W;  2HHH L;  1RCV D;  5DAU A;  1QIL A;  1K8M A;  4DR4 L;  4KKT A;  4XQN A;  1IZ6 A;  2KUM A;  1EUJ A;  5GAH C;  4GN4 B;  1K0R A;  2A1A A;  4BWG B;  5C4X G;  4LF8 Q;  5AFW A;  1B3A A;  4IFD I;  1HNZ Q;  2Q2T A;  1JWS D;  4LUO A;  1VQG A;  4DV1 L;  1QG7 A;  1EQT A;  2A8V A;  4GKK L;  4H0L C;  2B2Y A;  4P73 A;  2UUB Q;  5ELO A;  3SVM A;  1ROD A;  3GDE A;  1ONL A;  4JK1 C;  3STB D;  3S1N B;  2R93 G;  4PMW A;  2PZW A;  1PZK D;  3I8Z A;  3I55 A;  4CGY B;  2MO1 A;  3T13 A;  3C3L A;  4DAP A;  1BOS A;  1PYW D;  1X56 A;  3PUW A;  2X6G A;  2Z9H A;  3EIV A;  4A76 A;  1FJG L;  1X54 A;  3FKI B;  4LUV A;  4DFA A;  1GJX A;  3S1N H;  1ILP A;  2R7Z G;  1U0L A;  2EZV A;  4DNR B;  4GOP A;  1S5B D;  5BN4 A;  3G6E A;  4RH6 A;  1SYC A;  5M3F B;  1RHP A;  3VDY A;  3CHB D;  2MFI A;  2JA7 G;  4IOA A;  4NPS A;  3R3O A;  2EYP A;  4A3E B;  1KC8 C;  4RGM A;  1D2B A;  1BCP D;  3E6Z X;  4K8J A;  5EBC A;  4AYB B;  5C4Z A;  5M3F H;  2F3V A;  4AYB E;  3CCL A;  4KHV A;  1S72 A;  1CKO A;  4OO1 G;  3HKZ G;  4DXG A;  1PRT D;  2N55 A;  4A3E H;  2KBN A;  2B39 A;  4APV A;  2WP8 J;  2IJ0 A;  3JAM L;  1I3Q B;  2KOL A;  1AEX A;  4YIJ A;  3H91 A;  2GVA A;  4JI4 Q;  1L1O C;  1SBB B;  5A2Q E;  1K8O A;  4DU9 A;  1I3Q H;  5M5X B;  1SYB A;  4HJ9 A;  1EQR A;  5GQO A;  5HY6 A;  3S1Q H;  2PZU A;  3A74 A;  1F2Y A;  1LT4 D;  5M5X H;  3KJP A;  5I2Y A;  1SR3 A;  2ASB A;  1RF2 D;  4JYA L;  2IT1 A;  2NYZ D;  2ZTE A;  4GLA C;  2EYJ A;  4WRD A;  1EZ8 A;  3I70 A;  1SNO A;  1YNJ D;  2E2I H;  3WWV A;  4IPH A;  3P20 A;  1LT6 D;  2XWJ B;  3N6R A;  4TKO B;  2NVY B;  1HXY D;  2HCC A;  2L9H A;  4NKL A;  4DV0 Q;  1WYD A;  4P75 A;  1QVF A;  1SNQ A;  5I6Y A;  2NN6 I;  3A0J A;  4C1N I;  2C5C A;  2NVY H;  3HOW B;  5GAG C;  5IYB G;  1U4M A;  2E76 C;  3K80 C;  2PCF B;  3PO2 H;  3IFD A;  2JYO A;  3QOJ A;  1RTO A;  4OIK A;  4A3D G;  1VMP A;  3MZ5 A;  1WVL A;  3TZD A;  4ZYS A;  3TP6 A;  4Y52 H;  3HOW H;  2Q8I B;  3WOF A;  3TQY A;  1MSG A;  4OX9 Q;  4LF7 Q;  3UDX A;  4KHZ A;  2KHI A;  3NBI A;  2VQE L;  2JJQ A;  1KRS A;  4NXN L;  3IFT A;  2UUC L;  1XPU A;  4OHJ A;  3U50 C;  1WTV A;  3BZC A;  2SNM A;  1L0Y B;  1F2L A;  5KEE A;  2XVS A;  3G6J B;  2M2L A;  4M8A A;  3SXH A;  1D5X C;  1Y1V G;  4N8X 1;  4X3T A;  1KQS A;  1I94 Q;  4DR2 Q;  3S1M B;  1N36 L;  1D1K A;  3M4Y A;  5BN5 A;  3A56 A;  1HCZ A;  1G6P A;  1ENC A;  3CC7 A;  4DR6 L;  4P74 A;  4NP5 A;  1CUK A;  3S1M H;  3MFY A;  3JAM E;  1TII D;  4K6D A;  4RGT A;  5I9O A;  1NR4 A;  4HMI A;  3D4D A;  2B2W A;  5LL6 S;  2CW0 D;  1AW7 A;  3CCU A;  4B3S L;  1X9N A;  1VDZ A;  2MQH A;  3GV3 A;  5BR8 Q;  4I65 A;  1TKW B;  1D6E C;  1JE5 A;  4UAI A;  3N52 A;  4YCV A;  4LF6 L;  1JWM D;  5KYI A;  4DUY L;  1CHP D;  5JVH 3;  1VQH A;  4IFD G;  3MFG A;  1HNX Q;  4G7Z C;  1TR5 A;  1PHJ A;  3L9A X;  1QB5 D;  2LS0 1;  4V19 0;  3K7A B;  1EU3 A;  2CQA A;  2RA4 A;  1NSN S;  4LF4 L;  1ET9 A;  4JI6 L;  1D5M C;  3RR5 A;  3HOX G;  3ERQ A;  3WOE A;  4YHH Q;  2K32 A;  2E2D C;  1NTG A;  3K7A H;  2Z6B A;  4EGV A;  4ZRZ A;  1E24 A;  2B3G A;  4IPG A;  4GN5 A;  1TY0 A;  3QOL A;  3OSO A;  3DM3 A;  3PQI A;  4IAL A;  4RWS C;  2UXB Q;  1B9M A;  1WTQ A;  1ASZ A;  1SJH D;  3OW2 A;  4ME5 A;  3I90 A;  1SNC A;  1O80 A;  1AZQ A;  2RHS B;  1T9H A;  3QG1 A;  3U4Z A;  5C3E B;  4RHR A;  1DZ1 A;  3RN5 A;  1GOZ A;  1DCZ A;  4LJZ C;  2KED A;  1PTO C;  2MO0 A;  1SEB D;  3K59 A;  1B7Y B;  3OIP A;  1YJN A;  5C3E H;  4YCU A;  4A3J H;  4H44 C;  4Y7N B;  1CSP A;  4DV3 L;  1M1K C;  1HFN A;  4QGU A;  4ZK9 B;  2CHB D;  1EQQ A;  4X65 L;  2PO4 A;  4KI0 A;  1O78 A;  2K1B A;  4Y7N H;  1Q82 C;  4LWC A;  1T5X D;  4KD4 A;  3SEB A;  4FF2 A;  3I2Z A;  4DNT B;  4QUF A;  4K5V A;  1K3R A;  4LFC L;  2CWA A;  1Y1W B;  3CD6 A;  5C3W A;  2C9O A;  5HGQ A;  2I5M X;  4DV2 L;  2WAQ G;  4AIM A;  2LMC B;  3I4N G;  4EVO A;  3NP8 A;  4XQJ A;  1NMG A;  1Y1W H;  1WTX A;  4CJ2 C;  3QIA A;  1PV4 A;  3MXP A;  1A63 A;  3HEJ A;  1MIU A;  1GUG A;  1HNW Q;  2VL6 A;  1CQF A;  2F0L A;  1QNK A;  5DM7 3;  1RIP A;  3ND8 A;  2TSS A;  4NW2 A;  5COY A;  4JCV E;  3CQZ B;  1HR0 Q;  1EOV A;  3UDG A;  1EYD A;  2EQS A;  4A75 A;  3K57 A;  1EWI A;  3H15 A;  3X3M A;  2KCN A;  2EJF C;  3CQZ H;  2SNS A;  1M90 C;  2JE6 I;  1A3V A;  3T56 B;  3AMU A;  3VR5 A;  5M3M H;  2K6A A;  2NN6 G;  2OTJ A;  1DM0 B;  3TBI B;  1UEB A;  1Z6H A;  2JA6 B;  1Q8I A;  1C4Q A;  5FKA C;  1EOT A;  3HOU B;  3KF6 B;  2ZT9 C;  1PZI D; 
#chains in the Genus database with same CATH homology
 3E9H A;  4A3K G;  1EIF A;  4OON A;  1N9W A;  2Y0S G;  2JA6 H;  4JI0 Q;  4A3G G;  3HOZ G;  5IP9 G;  3FP9 A;  5C0X J;  4IOC A;  2ALY B;  4DAY B;  3KF8 B;  3F8T A;  3HOU H;  3FHW A;  1TXY A;  4DUZ Q;  4DV3 Q;  3T1H L;  4X62 Q;  1Q86 C;  1PVO A;  1XNQ L;  2YTV A;  2L15 A;  2F3I A;  3J81 c;  3F2B A;  4C2M H;  2B63 H;  5AJ3 L;  4AH6 A;  4X65 Q;  4PZ7 A;  2F4V L;  5ELN A;  4MTN A;  1YBY A;  1XMQ Q;  1OXX K;  1CKN A;  3CC2 A;  4L5T A;  3JAM c;  2KCT A;  1TWH H;  4DR3 Q;  4X64 L;  2ZM6 Q;  2QA4 A;  2VUM G;  2RF4 A;  5IYB H;  2ZJR A;  2UXC Q;  4DKA C;  3KJO A;  1UE5 A;  1VQ8 A;  1PYB A;  3HOW G;  3TRZ A;  1YVC A;  1BVS A;  2WB1 E;  4A3I H;  4JOI A;  4DV2 Q;  3S16 H;  4A3D H;  1VQ7 A;  2UUA Q;  5C0X G;  4YWL A;  2D62 A;  2ES2 A;  1HNZ L;  4DR7 L;  3TRE A;  4DNI A;  4DV4 L;  3J80 i;  1C7Y A;  1PH8 A;  1VQA A;  1VQM A;  1DGS A;  2AWN A;  5FJ8 H;  4DV5 L;  2CCZ A;  1B8A A;  3PSI A;  1YNX A;  4B3M L;  3NEN A;  1KD1 C;  3HOY H;  1NMF A;  2JEB I;  5C4X H;  5LMU L;  1IBL L;  2NVQ H;  3GTM H;  2LXK A;  1PH1 A;  1LM0 A;  3CAM A;  3M4Q A;  5IP7 H;  3PIO A;  2UUB L;  2OQK A;  3CPF A;  1OXT A;  3RN2 A;  1SFO H;  1E7Z A;  4JI0 L;  3S2D H;  3AEV A;  4LFB L;  3KOJ A;  4BBS G;  4GKJ Q;  4DR5 Q;  2IHF A;  2OQ0 A;  4L5S A;  4JI5 Q;  1Q1E A;  3RNU A;  2HHH Q;  2ID0 A;  1K8G A;  3H3V H;  1Y1V H;  5JJI A;  2RCN A;  4GLX A;  1YHB A;  3S17 H;  2Q2H A;  4A3F G;  2HQL A;  4K0K Q;  3CME A;  2Z0S A;  1PH3 A;  4DR4 Q;  3S2H H;  5M3M G;  1XPO A;  4JOI C;  1Q12 A;  5JJK A;  4QY7 A;  1X55 A;  1VQE A;  4NXM L;  1X3G A;  1GO3 E;  2V1C C;  3NEM A;  4DR1 L;  4DPG A;  3Q8D A;  3OTO L;  3A5U A;  3KLW A;  3RLF A;  1Q46 A;  4LW1 A;  2YYZ A;  2JA8 G;  4BA2 I;  2EXD A;  3M85 A;  3PV0 A;  2JQO A;  3HOV H;  4JG2 A;  4DV7 L;  5GAE C;  4DR3 L;  4KHP L;  3K0X A;  3I4M H;  5DLQ E;  4A3B G;  4P71 A;  2BA1 A;  1QUQ A;  5IWA Q;  2N78 A;  3RZD H;  1IL2 A;  3W5O A;  2R7Z H;  3E9I A;  2R92 H;  3PGZ A;  2VY3 A;  3GTP H;  2PNH A;  4GN3 B;  2VQF Q;  1I50 H;  1VQN A;  3G48 A;  1HZA A;  4JI8 L;  1NBW A;  2UUA L;  3CCR A;  2YV5 A;  3E0E A;  1QZH A;  3OTO Q;  1P16 A;  4DV6 L;  1VQ6 A;  2JA9 A;  3S15 H;  1E3P A;  2XTI A;  3PCO B;  3CCJ A;  4AQY Q;  2B63 G;  1N32 L;  1IYJ B;  3H0G G;  2E5L Q;  5IYD H;  1BBW A;  2OCE A;  4OWW B;  2BA0 A;  3PO3 G;  2R7F A;  1K73 C;  5GAD C;  1FVI A;  3ZJY C;  3CXC A;  3T1H Q;  1Q1B A;  1AH9 A;  4DK6 C;  1JT8 A;  4HID A;  1XNQ Q;  3PIP A;  3BZK A;  3MXN B;  1QVG A;  3J7Z C;  4DR5 L;  4PZ6 A;  3RLO A;  1YJW A;  1E1O A;  3CCM A;  4JI4 L;  5LMN W;  1X3E A;  2HHH L;  2HIV A;  2OWO A;  3J7A 5;  4O0A A;  3HOX H;  1XMO L;  3NEL A;  2F4V Q;  4A4I A;  4A3I G;  3EBE A;  4DR4 L;  4JI7 L;  3M4P A;  4JBJ A;  1IXR A;  3I4O A;  4XTC S;  3S24 A;  1QVC A;  3CCQ A;  1IZ6 A;  4GNX C;  4X6A H;  1EUJ A;  4X64 Q;  5GAH C;  4GN4 B;  2JA5 G;  1MKH A;  4YCW A;  1K0R A;  2CFM A;  2IHE A;  4HJA A;  2R7D A;  4JI3 L;  4DK3 C;  5FLM H;  3HOY G;  2A1A A;  2Q2I A;  2F52 A;  5C4X G;  4LF8 Q;  2HT1 A;  1YI2 A;  1N8R C;  4UPA A;  2UXD L;  3U58 A;  4IFD I;  1HNZ Q;  2EIF A;  1WFQ A;  1WOC A;  1XTD A;  3CP0 A;  1C9O A;  3I56 A;  4DR7 Q;  2Q2T A;  5M5Y H;  2I0Q A;  4KLK A;  4LUO A;  4DV5 Q;  4B3M Q;  1VQG A;  5C3E G;  4DV1 L;  1JMC A;  5IT9 c;  3L2P A;  4POG A;  5LMU Q;  2K5V A;  2ZTC A;  2A8V A;  3M4O H;  1UE1 A;  4GKK L;  4A3C G;  1BKB A;  4GNX B;  3CPW A;  2PQA A;  3AQQ A;  4ME3 A;  1X3F A;  3LGJ A;  4P73 A;  2UUB Q;  2A19 A;  4AQY L;  5ELO A;  1GKH A;  3GDE A;  2PI2 E;  4LFB Q;  4IFD J;  3STB D;  1PH4 A;  2E5L L;  2R93 G;  1NE3 A;  4PMW A;  4HIM A;  3GTO H;  1O7I A;  3I55 A;  4BY1 H;  4LFA Q;  2MO1 A;  1VQD A;  4EX5 A;  2OTL A;  2CWP A;  1X56 A;  3PUW A;  1N34 L;  3HOV G;  3EIV A;  4QIW E;  4A76 A;  1FJG L;  4QQB X;  1X54 A;  2K5H A;  4YY3 L;  3I4M G;  1SRO A;  4LUV A;  3MEF A;  3GTQ H;  3S1N H;  4NXM Q;  3ULP A;  4DR1 Q;  1YJ9 A;  1U0L A;  2D0O A;  2WAQ E;  3NBH B;  4MZ9 A;  2R7Z G;  4ALP A;  3AFQ A;  2AWO A;  1IBM L;  4GOP A;  3G6E A;  4L5R C;  1K83 H;  4DV7 Q;  1L1O A;  3PF5 A;  4KHP Q;  1G51 A;  3TS2 A;  2N49 A;  1YEZ A;  5M5W H;  1Y1W G;  4OX9 L;  4JI2 L;  3PUV A;  3VDY A;  4LF7 L;  1I5F A;  2MFI A;  2JA7 G;  4IOA A;  4X66 L;  4NPS A;  4HIO A;  1KC8 C;  3PUY A;  4JI8 Q;  4LF8 L;  5IYD G;  3S1R H;  2E2H H;  1HJP A;  2VS1 A;  4A3L H;  1A8V A;  5M3F H;  4AYB E;  3CCL A;  4A3M H;  3ULJ A;  4DV6 Q;  1S72 A;  1CKO A;  1LTL A;  4OO1 G;  2VNU D;  2UU9 L;  1JJG A;  1CKM A;  3HKZ G;  2NZH A;  1G29 1;  1YIJ A;  4A3E H;  1A62 A;  4RMF A;  2K5N A;  2KBN A;  1N32 Q;  4APV A;  4EQ5 A;  1I94 L;  4DR2 L;  4TQU S;  3KDF A;  5C44 H;  4BY7 H;  2WP8 J;  3T1Y L;  4R4O A;  3GO5 A;  2IX1 A;  1PH2 A;  1ASY A;  1KHI A;  2DGY A;  4NB3 A;  3PF4 A;  4WJ3 M;  1U5K A;  1V1Q A;  4GS3 A;  2GVA A;  4QL5 A;  1L1O C;  4JI4 Q;  4LFA L;  1PA6 A;  1D8L A;  1XMO Q;  1S40 A;  2KHJ A;  1VQB A;  2RHQ B;  1PH9 A;  2CQO A;  3U4V A;  4JI7 Q;  3CCV A;  1I3Q H;  4BBR H;  5H1S E;  2E2J H;  1W2B A;  1NY4 A;  4HJ9 A;  1EQR A;  5GQO A;  5HY6 A;  3S1Q H;  4JBM A;  4GLV B;  4YWM A;  3A74 A;  1C0A A;  4A93 H;  4JI3 Q;  4POF A;  1WCM H;  1CKN B;  5M5X H;  2HIX A;  3KJP A;  2Y0S E;  1Q7Y C;  3S14 H;  5BR8 L;  1Z47 A;  4B3R L;  1SR3 A;  2N3S A;  1L2F A;  1SRU A;  4LF5 L;  2ASB A;  2UXD Q;  2JA6 G;  3HFZ B;  5IYC H;  4UP7 A;  4JYA L;  2IT1 A;  2ZTE A;  4GLA C;  1J6Q A;  1QZG A;  1TWG H;  4DV1 Q;  4A3K H;  1WJJ A;  1K9M C;  3HOU G;  2YTY A;  4BY1 G;  4GKK Q;  2E2I H;  3WWV A;  4IPH A;  1VQO A;  1OXS C;  3BU2 A;  4UY8 C;  5LMN Q;  1HZB A;  3W1G A;  2Z6K A;  5JEA J;  1VQJ A;  3I7F A;  4JBW A;  3G4S A;  4DR6 Q;  4DV0 Q;  1WYD A;  4P75 A;  2AMC B;  2KCM A;  1QVF A;  3J80 c;  1R9T H;  3L7Z C;  1WI5 A;  1N34 Q;  2NN6 I;  1FJG Q;  3A0J A;  5E7N A;  2WFW A;  3F2C A;  2NVY H;  4YY3 Q;  5GAG C;  1Z9F A;  5IYB G;  1Q8K A;  3K80 C;  2ZJQ A;  3ERS X;  3KF6 A;  3PO2 H;  4H02 A;  2Q2U A;  4YWK A;  2ZJP A;  4A3D G;  4JI1 Q;  1IBM Q;  1KL9 A;  2VUM H;  2UXB L;  1GM5 A;  4HJ5 A;  4A3L G;  4Y52 H;  1SLJ A;  3STB C;  3TS0 A;  3HOW H;  1NJI C;  5M3F G;  3TQY A;  1RL2 A;  2D0P A;  3M3Y H;  3J81 i;  4OX9 Q;  4JI2 Q;  5FJ8 G;  2WB1 G;  4LF7 Q;  1PYS B;  4X66 Q;  3PUX A;  3UDX A;  4KHZ A;  1HZ9 A;  2KHI A;  4C3J H;  4DUY Q;  2BH2 A;  4BXX H;  2H5X A;  2VQE L;  4C3H H;  2JJQ A;  5JEA G;  3KYH C;  2AKW B;  1KRS A;  2C35 B;  4NXN L;  3TEH B;  4BA1 I;  5IP7 G;  4AYB G;  3CCS A;  2UUC L;  1VQL A;  1XPU A;  4BY7 G;  3CF5 A;  3U50 C;  1QUQ B;  3BZC A;  5K36 G;  2UU9 Q;  4R1J A;  3CMA A;  1VQF A;  3F2D A;  1Y1V G;  1LUZ A;  4R4Q A;  1KQS A;  4BBS H;  1I94 Q;  2ATW A;  4DR2 Q;  2VW9 A;  4JV5 L;  4LNQ A;  4OXP A;  3T1Y Q;  1N36 L;  4UP9 A;  4BBR G;  1X6O A;  2IX0 A;  5LMN L;  5IY0 A;  1N36 Q;  1OXV A;  4A3F H;  1G6P A;  3CC7 A;  1HR0 W;  4DV0 L;  4DR6 L;  4WJ4 A;  3JC6 6;  1S3O A;  4P74 A;  5JJL A;  3RLN A;  1CUK A;  1J5E L;  4LF9 L;  1P8L A;  1YHQ A;  2JEA I;  4IO9 A;  3S1M H;  4FDB A;  1V9P A;  1WCM G;  1V43 A;  5C0X I;  3CC4 A;  2JA8 H;  3G71 A;  3IRB A;  1OXU A;  4HJ7 A;  1N33 Q;  2FXQ A;  3PUZ A;  1VQ4 A;  2R92 G;  5C4J H;  2QEX A;  4JI1 L;  4A3B H;  3SGI A;  1GVP A;  4PG3 A;  5IE8 A;  3CCU A;  4B3S L;  5FLX c;  3FKI H;  1YIT A;  1X9N A;  2MQH A;  2GVB A;  5BR8 Q;  3GTL H;  1JE5 A;  4JC0 A;  3UDF A;  4B3R Q;  4LF5 Q;  4PZ8 A;  4YCV A;  3CCE A;  4LF6 L;  3I4N H;  4DUY L;  1HNW L;  1AE2 A;  1VS0 A;  1XPR A;  4JYA Q;  1VQH A;  2B29 A;  2QGQ A;  4IFD G;  4IJL A;  1TWA H;  1GD7 A;  1X65 A;  3EN2 A;  1HNX Q;  1PHJ A;  2N8N A;  3OYY A;  3J81 j;  1BBU A;  3H0G H;  4QJF A;  1HR0 L;  1MJC A;  1OTC A;  3ICE A;  3PO3 H;  4DAM A;  1Q81 C;  1D7Q A;  2I5H A;  2NZO A;  3D31 A;  2YU9 H;  4JI6 L;  2CKZ B;  2I5L X;  1EFW A;  3RR5 A;  4LF4 L;  3HOX G;  3PO2 G;  1FL0 A;  3K7U C;  4O2D A;  3GD7 A;  4YHH Q;  1TWC H;  4B3T L;  3ULL A;  1NTG A;  3ER0 A;  4LFC Q;  2PQA B;  3K7A H;  4GOP C;  1KXL A;  2GN5 A;  1E24 A;  1K8A C;  2B3G A;  4IPG A;  1KAW A;  3HKS A;  4GN5 A;  1MJE A;  3DM3 A;  1CSQ A;  5FLM G;  3BJU A;  4R4I A;  1TWF H;  4MNO A;  4BXX G;  2UXB Q;  1ASZ A;  3OW2 A;  1B70 B;  1UE7 A;  2JA5 H;  3UE1 A;  2YTX A;  1SE8 A;  2RHS B;  5J3B A;  1T9H A;  3U4Z A;  3L0O A;  1N33 L;  3RN5 A;  3W1B A;  2IY5 B;  1HH2 P;  2MO0 A;  4LUZ A;  1VQK A;  3DLL A;  1W3S A;  1VQ9 A;  3K8A A;  1XNR Q;  2VQE Q;  4GOP B;  4P72 A;  1B7Y B;  1YJN A;  4NXN Q;  2UUC Q;  5C3E H;  4YCU A;  1L1O B;  4A3J H;  2DUD A;  1JB7 A;  4JBK A;  4DUZ L;  1CSP A;  1YHA A;  4DV3 L;  1M1K C;  4X62 L;  2JK8 A;  2LXJ A;  4HJ8 A;  2E8G A;  1KIX A;  4QGU A;  1VCI A;  1PH6 A;  1VQC A;  4A3G H;  1IBK Q;  1SMX A;  1HNX L;  3HOZ H;  1HZC A;  5IP9 H;  2NVT H;  1EQQ A;  4JV5 Q;  2R93 H;  4X65 L;  2NVX H;  4KI0 A;  3UDI A;  2KEN A;  4Y7N H;  2LSS A;  1XMQ L;  2R6G A;  4IJH A;  2K14 A;  4LWC A;  1Q82 C;  3KFU A;  1H95 A;  5GRO A;  3GTG H;  1VQP A;  1VQI A;  1A0I A;  4L5Q A;  3I2Z A;  2K50 A;  2BH8 A;  4YHH L;  2ZM6 L;  1J5E Q;  1SN8 A;  4LF9 Q;  4LFC L;  1AE3 A;  1K3R A;  2UXC L;  2CWA A;  3KDF B;  1LYL A;  3FKI G;  3CD6 A;  5HGQ A;  3B6Y A;  2I5M X;  4DV2 L;  2WAQ G;  2MNA A;  1E1T A;  4AIM A;  1EYG A;  5EAY A;  4GNX A;  1I6H H;  3D0F A;  2ZTD A;  3I4N G;  3GTJ H;  3AFP A;  2AHO B;  3AYH B;  3H3V I;  2PI2 A;  1NMG A;  1Y1W H;  1PH5 A;  4B3S Q;  2JA7 H;  3HKZ E;  1PV4 A;  4A3M G;  3UE0 A;  1JJC B;  1A63 A;  1MIU A;  4LF6 Q;  4A3E G;  1HNW Q;  1XNR L;  2VL6 A;  1YZ6 A;  1EIY B;  2Z6K C;  3CW2 C;  1XJV A;  4GKJ L;  5C44 G;  1RIP A;  3JAM i;  1PFS A;  4C3I H;  4A3C H;  4JI5 L;  4JCV E;  5AJ3 Q;  4K0K L;  1HR0 Q;  3A5Z B;  1EOV A;  1UWV A;  3M9B A;  4UP8 A;  3UDG A;  3GTK H;  4R4T A;  2EQS A;  4RG1 A;  1IBK L;  4JI6 Q;  4LF4 Q;  4A75 A;  2K4K A;  1E22 A;  1EWI A;  3H15 A;  4B3T Q;  2XGT A;  4OWT B;  3CQZ H;  2VZA A;  1JJ2 A;  1M90 C;  1FGU A;  2JE6 I;  3M7N A;  3F1Z A;  4XIG S;  5M3M H;  4J15 A;  4R4C A;  2NN6 G;  4TVA B;  1PH7 A;  4A93 G;  5IWA L;  2OTJ A;  1UE6 A;  4IPC A;  1UEB A;  4OWX B;  2PMZ E;  1Y14 B;  3K81 C;  1VQ5 A;  4DV4 Q;  2VQF L;  3RZO H;  4IPD A;  1L0W A;  1KRT A;  4OO1 I;  4A3J G;  2K75 A;  5IYC G;  4HIK A;  1IBL Q;  3KF6 B;  2K52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...