5EAYA

Crystal structure of a dna2 peptide in complex with rpa 70n
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
115
Chain Sequence
GQLSEGAIAAIMQKGDTNIKPILQVINIRPITSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 29
structure length 115
sequence length 118
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5eayA00
1WJJA 2EXDA 4LFAL 1HJPA 4BY7H 4HJ9A 1XNQL 2PQAB 2ZTDA 3HKSA 5M3MG 2WB1E 1OXSC 5LMNW 4IFDI 1KRSA 3D0FA 4B3SQ 3M4PA 3S1NH 4XIGS 5H1SE 2F4VL 2NZHA 1J6QA 3EBEA 4DNIA 1VS0A 4NPSA 1CSQA 2D62A 4UP8A 4BBRG 1IBKL 3HOWH 4B3TQ 4DV0L 3I4MH 3K8AA 1FL0A 1SN8A 3F2BA 5HGQA 3CQZH 3M3YH 2RCNA 4YWKA 4HJAA 3CCSA 1HNWQ 3HOVG 4DR3Q 4JI4Q 2ALYB 5FLMG 4DV5L 3U4VA 4AIMA 2UUAL 1IZ6A 5IP9H 2I0QA 3TS2A 1Z47A 1N34Q 3NENA 1UWVA 1EFWA 4DK3C 1E3PA 5IE8A 2RF4A 4GLAC 1KXLA 1BBWA 1IBLQ 2WAQG 1PH7A 1V9PA 1X65A 1HR0W 2PNHA 3M85A 4DUYL 1HNZQ 4NXML 1PYSB 2BA0A 3U50C 4OWXB 2OWOA 4H02A 4IPDA 2R7ZH 1TWHH 2KHJA 1MKHA 2JA9A 2MQHA 4JG2A 3MXNB 4OWTB 2GVBA 1GVPA 5DLQE 1K3RA 3STBD 3J81c 4A3MG 1YHQA 1Q7YC 1PH1A 2UUCQ 3ICEA 2JA8H 4A3GG 1DGSA 3NEMA 4LFCQ 1N32L 2CCZA 2ES2A 2E5LQ 4L5TA 5C3EG 4JI3Q 2YTXA 4BY7G 3CCRA 4HJ8A 1PYBA 4X62Q 2ZJRA 2R93G 3E9IA 4R4IA 1HNXQ 3I7FA 3J81j 4A3FG 1WYDA 4DR5L 4APVA 5BR8L 3HOUG 1VQ5A 2R92G 5AJ3Q 3BZKA 1X56A 4OX9L 2OTJA 3W1BA 2B63G 1CUKA 1MJCA 4C2MH 2JA5H 3J80c 3OTOQ 1WCMH 1KRTA 4DV4L 1Q81C 4PZ6A 2MO1A 3AFPA 3T1HL 1LTLA 3CXCA 4GOPA 1C9OA 3S1RH 4QQBX 4LUOA 1E22A 4A3KG 1JT8A 2JEBI 1D8LA 1VQOA 1XNQQ 3CD6A 4IFDJ 1OXTA 3ULPA 1UE1A 1CSPA 3NELA 4X64Q 4BXXG 3GTPH 3PUXA 2A19A 2N49A 2VS1A 4LF5Q 3E9HA 1QUQB 1YZ6A 1AE3A 1CKMA 2L15A 3HOXG 4P72A 1P8LA 1S72A 2IHEA 1VQ9A 3TQYA 2KCMA 1Y1WG 3S1QH 4B3RQ 1VQFA 3CPFA 1L1OA 1L0WA 2JA7G 2ASBA 3UDIA 5GAHC 3H3VI 3F2CA 3HOZG 4IFDG 3RZOH 2GN5A 2VQFQ 3GTKH 2K75A 3FKIH 4GN3B 4DV7Q 5M5XH 1G291 2A8VA 5EAYA 3L0OA 5IP7G 3J81i 1G51A 3PCOB 4AYBE 1L2FA 1NMFA 2VL6A 4NXNL 2HIVA 3CC4A 4JBKA 3PO2H 2K52A 4WJ4A 1JE5A 3RLNA 4GLXA 1PH4A 2E2HH 2HT1A 3U4ZA 4DV1Q 4B3ML 1HZCA 4NXMQ 4DR7Q 1PH6A 1V43A 2K5HA 5GADC 3KF8B 4HJ7A 2OQ0A 5LMUL 3F1ZA 4JV5Q 4JOIA 4BBSG 2OCEA 1QVCA 1JMCA 4GKKQ 2XGTA 4JI6L 1IBML 5FLXc 4TQUS 4QJFA 1U5KA 4NB3A 3STBC 4K0KQ 1N36L 4LF8Q 2WP8J 4A3IG 4R4QA 1UE5A 5FJ8H 2LXJA 3EIVA 3SGIA 5C44G 3HKZG 1UE6A 3J80i 4A4IA 1KAWA 3CCUA 1N8RC 4ME3A 3RLOA 4EQ5A 3OYYA 2MFIA 2IT1A 4JBWA 1LM0A 2I5MX 4IOCA 1KL9A 3RR5A 4A3DG 3KLWA 1HZAA 4HIMA 3DM3A 1M90C 2RHSB 2GVAA 1L1OB 1Y1VG 4LW1A 4DUZQ 3RN2A 4POFA 2CFMA 2F52A 1XNRQ 4ALPA 4JI7Q 4LFBL 2CKZB 3CCJA 1O7IA 1Z9FA 2I5LX 4DV4Q 4HIOA 2UUBL 1VCIA 4Y52H 1XMOL 1K8AC 2HHHQ 4JBMA 1SR3A 1SRUA 1Y14B 3L7ZC 4A3BH 4DR4L 4BY1G 2B29A 2ZM6L 2CWAA 1A62A 3CP0A 4YWMA 3H3VH 3I4NG 2VY3A 4JI5L 3TREA 1MJEA 3M4OH 3CCEA 1GO3E 2BH8A 5M3MH 5IYCG 1W2BA 1NY4A 1JJ2A 2VQEQ 3PIPA 1I94Q 2AWNA 3PSIA 3S1MH 3EN2A 2KHIA 1EYGA 3K0XA 4IJLA 4DK6C 2PI2A 2UXCQ 4JI8Q 3HOYG 1KQSA 5IYBH 4FDBA 4GLVB 1A8VA 3PO3G 3CMEA 3HOWG 1X55A 2Q2IA 5M5WH 2KENA 2WFWA 1XPUA 3G71A 1VQLA 4A3LG 2ZJPA 3S2HH 3JAMc 1K83H 3PUYA 1QZHA 4DKAC 1T9HA 3H15A 2A1AA 3ULLA 5FLMH 1YEZA 1XTDA 3AFQA 3T1YL 5IP9G 4YHHQ 1J5EQ 4JI2Q 5LMNQ 3GTGH 1HH2P 2ZTCA 4HJ5A 2K4KA 3H0GH 1QUQA 3PUWA 4DR2Q 1GD7A 1TWGH 3CMAA 1V1QA 1VQCA 4IPHA 3UDXA 2VNUD 4DR6L 4B3MQ 1EIFA 2NN6I 2Y0SG 3IRBA 4LF9Q 1XMQL 1K73C 4X6AH 2DUDA 1PFSA 4A3EG 4JC0A 4A3CG 3RN5A 5GAGC 1YJWA 3AEVA 3G48A 1X54A 3I2ZA 2MNAA 2C35B 4A3BG 1EQRA 2N78A 1RIPA 1JB7A 4GNXC 4GKJL 4IOAA 1SMXA 2UXDL 1S40A 1WOCA 3GDEA 1A63A 5C3EH 5IWAQ 2AMCB 4AQYL 4A76A 3K7UC 4EX5A 5M3FH 2R93H 4DV3Q 5JJLA 2Z0SA 4R4CA 2N3SA 1ASYA 5C4JH 3TRZA 1HR0Q 3S17H 2NVQH 1X9NA 1I3QH 2YTYA 4LF6L 4QY7A 3RZDH 4LFAQ 4YY3L 1PH3A 2JA5G 1VQHA 3PGZA 2E2JH 4RG1A 4LUVA 4OO1G 1VQ4A 3NBHB 1XMOQ 1AH9A 3CC7A 3S16H 2F4VQ 4LNQA 4LWCA 1FVIA 1LUZA 3GTQH 3HKZE 3WWVA 1B7YB 1IBKQ 1OTCA 2UU9L 1PH2A 2H5XA 1NE3A 4L5QA 4DV0Q 2ZJQA 1X3EA 3JAMi 3K81C 4JYAL 2NVYH 3DLLA 1UEBA 3W5OA 4A3JG 4L5RC 3CW2C 1VQNA 4B3SL 4XTCS 1YNXA 4JI1L 4LF7L 4JI0L 5IYDG 2R6GA 2BA1A 4DV5Q 4KI0A 1TXYA 4UPAA 2EQSA 2K5VA 3B6YA 3KF6B 4PG3A 3HOXH 1SLJA 4HIKA 2UUAQ 3PIOA 1YIJA 1SROA 2R7DA 3TEHB 4HIDA 1VQMA 3KFUA 4DR7L 4AH6A 2V1CC 4LUZA 2QA4A 4DR3L 4YWLA 1Q86C 2JA7H 4JI4L 3PUVA 1VQ6A 2ATWA 4IPGA 4DUYQ 1YHBA 2VUMG 5IY0A 2Q2TA 1IXRA 4C3JH 5IP7H 1D7QA 1E24A 3PV0A 1N34L 4GN4B 3E0EA 1AE2A 4OXPA 3CPWA 5IT9c 4A75A 1IBLL 4A93G 3KOJA 4TVAB 3GD7A 1VQ8A 1N32Q 3KJPA 2QEXA 2Z6KC 3ZJYC 1FJGL 1HNZL 2HQLA 4KLKA 1XPOA 4DAYB 3A0JA 2D0OA 5C0XJ 4R4OA 1QVFA 5C4XH 1NTGA 1KHIA 1VQPA 2UUCL 2WAQE 1Q1BA 3ERSX 3UDFA 1SFOH 4DR5Q 4LFCL 1IL2A 2I5HA 4X65L 5BR8Q 1YI2A 2IX1A 3CAMA 2E5LL 4A3IH 5FJ8G 4GS3A 3RNUA 2NVTH 1KD1C 4JI3L 2KBNA 5C44H 4OX9Q 1I6HH 2NZOA 4YCWA 4PMWA 4X62L 4IO9A 2CWPA 2JA6G 1TWFH 3AYHB 1Q8KA 2PMZE 3U58A 3I55A 5C0XG 2Y0SE 4A3DH 3T1HQ 1K8GA 2F3IA 3L2PA 2IHFA 2YTVA 3UE0A 2DGYA 2VW9A 5AJ3L 3GTLH 1Y1VH 4YY3Q 1Q12A 1WFQA 2ID0A 1YHAA 1Q82C 1YBYA 4P75A 4DPGA 2VZAA 5K36G 2IY5B 5GROA 3M9BA 1M1KC 4QL5A 3HFZB 1VQEA 1C0AA 1OXXK 1HZBA 4BY1H 3JC66 3A74A 2UU9Q 1NBWA 3ULJA 1YJNA 4BBRH 3S2DH 2K5NA 1U0LA 3PUZA 3I4NH 3I4MG 2XTIA 3BJUA 4JYAQ 3BU2A 5IYCH 2ZTEA 1UE7A 2JE6I 4LF4L 4LF7Q 4JI1Q 4AYBG 4X64L 3J7A5 4JI0Q 1FGUA 3UDGA 3HOVH 1TWCH 1OXUA 3HOYH 5IYBG 4LF5L 4OO1I 1K9MC 3PO3H 2E8GA 4R1JA 5J3BA 4A3LH 4B3RL 2K50A 1I50H 1P16A 1G6PA 3GO5A 4NXNQ 4UP9A 4PZ7A 4DR1L 4DAMA 1S3OA 2OTLA 3CCLA 2AWOA 4P74A 2VQFL 3F8TA 1VQDA 4DV7L 3CF5A 3CCQA 1GM5A 1OXVA 2R7ZG 4O2DA 2HIXA 2IX0A 5LMUQ 1XJVA 1XPRA 4JCVE 4DV2L 1PH9A 1N33L 3RLFA 3H0GG 4DV6L 1YVCA 3PO2G 1EIYB 3M7NA 4A3MH 4JI6Q 3KF6A 1IBMQ 2JA8G 4A3GH 4KHPL 3I4OA 2LXKA 4P71A 4L5SA 1QZGA 5JEAJ 1N36Q 1FJGQ 1EOVA 1VQJA 4RMFA 4DV1L 1B8AA 2E2IH 1I5FA 4C3IH 4Y7NH 4X66L 2KCTA 4A3EH 4A3CH 1SE8A 1PVOA 3UE1A 1KIXA 4JV5L 1B70B 1Q46A 3TS0A 1PA6A 4GNXA 2JK8A 5ELNA 2LSSA 4GKKL 2WB1G 4A3FH 5GAEC 1X6OA 4IPCA 4X65Q 4GN5A 1R9TH 1IYJB 3HOUH 4K0KL 3PF5A 4LF8L 4UY8C 2R92H 2YV5A 3BZCA 4QGUA 1CKNA 1EWIA 5M5YH 5M3FG 4WJ3M 2B63H 1QVGA 4LFBQ 5JEAG 1PH5A 3MEFA 1Q1EA 1WCMG 1C7YA 2UUBQ 1JJGA 1BBUA 3FHWA 4PZ8A 5E7NA 4DR4Q 3J7ZC 3OW2A 2UXBL 2ZM6Q 2R7FA 1VQAA 4DUZL 1PHJA 2D0PA 2JJQA 4GOPC 4A3KH 1PH8A 4JI5Q 1XNRL 3W1GA 4JI7L 1X3GA 1VQGA 4OONA 1JJCB 2OQKA 1MIUA 5JJKA 2HHHL 4BXXH 4POGA 2PI2E 4MZ9A 3KDFA 3AQQA 1E7ZA 4J15A 3CCVA 2YU9H 5JJIA 5C0XI 4B3TL 3Q8DA 4KHZA 4A3JH 1Y1WH 4LF4Q 4UP7A 2VQEL 1I94L 3CCMA 4R4TA 1HNWL 1N9WA 4MNOA 3HOZH 2UXCL 4JI8L 1L1OC 1YJ9A 1VQKA 3D31A 4BA2I 3A5ZB 5IYDH 4GNXB 3FKIG 3T1YQ 1K0RA 4OWWB 2BH2A 5GQOA 3G4SA 2AHOB 3M4QA 2NN6G 1YITA 3KJOA 1GKHA 2AKWB 2N8NA 3G6EA 3GTMH 2NVXH 1A0IA 2JQOA 4DR1Q 1BKBA 1PV4A 1VQBA 4IJHA 1ASZA 1CKNB 2PQAA 4P73A 1VQ7A 4DR6Q 3LGJA 4YCVA 3CC2A 3I56A 1XMQQ 2K14A 2VUMH 2RHQB 4JBJA 4YHHL 1J5EL 1N33Q 4JI2L 2EIFA 3FP9A 5LMNL 4O0AA 4DV2Q 2JEAI 4BA1I 4DV6Q 4BBSH 4DR2L 1KC8C 1E1TA 4A93H 4JOIC 2Z6KA 1NJIC 4KHPQ 3ER0A 1WI5A 4GKJQ 2UXDQ 2QGQA 2B3GA 3K7AH 4LF9L 3S15H 1H95A 4YCUA 1RL2A 4X66Q 1VQIA 3PF4A 4AQYQ 3VDYA 4QIWE 2Q2HA 5C4XG 4GOPB 3KDFB 5ELOA 1HNXL 2MO0A 4C3HH 3S14H 1E1OA 5HY6A 1EQQA 1HZ9A 1NMGA 3S24A 4LF6Q 5IWAL 1TWAH 3GTOH 4MTNA 1W3SA 2Q2UA 1X3FA 2YYZA 3KYHC 3A5UA 4DV3L 3K80C 2JA6H 1EUJA 3OTOL 1LYLA 2FXQA 3F2DA 1HR0L 2CQOA 1CKOA 2UXBQ 1BVSA 3GTJH
chains in the Genus database with same CATH superfamily
4EGVA 1B9NA 1NNXA 5M3MG 4Q0FA 3HG9A 2WB1E 2IX3A 3K58A 2L5TA 2HUGA 3URYA 3S1NH 1K3BC 2N55A 3GV3A 4DV0L 3K8AA 5HGQA 2YU9B 2DNCA 3CCSA 1CHPD 2JA7B 4AIMA 2F0OA 2I0QA 3TS2A 4IUPA 3NENA 1EFWA 3R93A 1KXLA 1IBLQ 1SBBB 1V9PA 1MSHA 1HR0W 1A15A 1PYSB 3U50C 2R7ZH 4OWXB 4H02A 5FLXE 2CQAA 4XYQA 4KKSA 4JG2A 3J81c 1GVPA 4A3MG 1K3RA 2UUCQ 2AQ2B 5CBAE 1PH1A 3ICEA 3QWNA 3DUZA 2L4NA 5C4XB 4LFCQ 2KOLA 2CCZA 2E5LQ 4DA2A 1SFOB 4JI3Q 4HJ8A 2JN4A 4A3IB 3E9IA 4CJ1B 4G4KA 1WYDA 3HOUG 2EYOA 1SE3A 4HCSA 4DAVA 1VQ5A 2R92G 4A3DB 1QB5D 4OX9L 2OTJA 1EQVA 3D4RA 1CUKA 1GHJA 4EQOA 3GTLB 4DV4L 2EY2A 1W6KA 2VB3X 3VR3A 3MZ5A 1Z7TA 1C9OA 3CHBD 4LUOA 2M2LA 4BY1B 4IFDJ 3VYSA 4DK1A 1I4XA 3ULPA 3NELA 2KJXA 1GUGA 3I4NB 4BXXG 1KAAA 2N49A 3K57A 3S1NB 1TWCB 3AB9A 1P8LA 4IQZA 3ERQA 2KCMA 2OF1A 3TP6A 2EZVA 2ASBA 1EWHA 2FMMA 3QOJA 3DEPA 3MEHA 2EDGA 1FNWA 2K75A 4GN3B 5ISRA 2X6GA 5IP7G 3PCOB 1BO0A 4NXNL 4B9XA 3CC4A 3J80L 4RH6A 3RLNA 4FF2A 5FKAC 3U4ZA 4N8FA 4A3GB 2OQ0A 3F1ZA 4JV5Q 2OCEA 1QVCA 2K5WA 5FK9C 1JMCA 3NQTA 5TSSA 3VR2A 1IBML 4JI6L 4TQUS 1U4LA 3U9OA 1KLUD 3TP5A 1R9TB 3SGIA 3J80i 1FD7D 1MD2D 1UEAB 1CT1D 3ND9A 4C3HG 4XQNA 4K14A 4IOCA 3QIAA 3DM3A 2ICIA 1Q3LA 3LWEA 2GVAA 1Y1VG 1F2ZA 3RN2A 4POFA 2F52A 1HFNA 2I5LX 2UUBL 2EJGC 4Y52H 1L0YB 1XMOL 5AFWA 4JBMA 3P7JA 4DR4L 3J7AF 4YWMA 4BY7G 2VY3A 4JI5L 1WTXA 1GO3E 4HSVA 1I94Q 2KHIA 5DNFA 4DK6C 4NKLA 2UXCQ 4PMBA 5FLXL 3V96A 4GLVB 1A8VA 1CZWA 3HOWG 3OHXC 3HOZB 4RWSC 1XPUA 3G71A 3E6ZX 1EY5A 1RODA 4KJNA 2B2UA 3JAMc 1QZHA 3ULLA 1PZID 3GTMB 2NVXB 5CV4A 1YNJC 1HQRD 1ESFA 5LMNQ 1CZGA 3GP7A 5C4HA 2CVRA 2K4KA 1K8MA 2HD3A 3PUWA 4BBSB 1VQCA 4V0BA 1A3UA 1EIFA 4LF9Q 5I2YA 5I6YA 1XMQL 1K73C 2DUDA 4ODGA 1EEFD 3I2ZA 4CKCA 4DGZA 2C35B 4ABNA 1ENCA 1HFGA 4CJ2C 3TDQA 1SMXA 3K0YA 3W2DA 5D3DA 3HRZC 4RCNA 2XIWA 2WINB 2M9VA 4DV3Q 1TWAB 1SNOA 1SXTA 4FXGC 3S17H 2EY1A 5C3WA 2FHTA 1I3QH 2MPMA 4KKUA 2JA5G 3PGZA 4WRDA 5L37A 4DNRB 3CC7A 1B9MA 1LUZA 1B7YB 4S3SA 1IBKQ 2ZJQA 1LTTD 3BDLA 3DLLA 5COYA 3CW2C 1NR2A 3TZUA 4XTCS 1YNXA 4JI1L 3PIP3 4LF7L 3I4MB 4JI0L 4EVOA 4O42A 1II3A 3OOCA 2R6GA 1RDPD 2EQSA 2K5VA 3B6YA 1SLJA 2WV6D 1BBXC 1SROA 5ELFA 1TS4A 4H7BA 4NMZA 2QA4A 1DCZA 2KEEA 1Q86C 4YWLA 2G9DA 1PFNA 4Q5VA 1CTMA 3H94A 4X3SA 4IPGA 4KHVA 1YHBA 2FJ2A 4OXPA 1IBLL 2A6HD 1ONLA 4A3BB 3EJIA 2WACA 1PTOD 2F03A 4DAYB 2D0OA 5C0XJ 3FPPA 1QVFA 3Q24A 1KHIA 5ELBA 2UUCL 1Q1BA 3T56B 4DR5Q 4LFCL 2E5LL 2WB1B 1PDQA 1KD1C 4JI3L 1I6HH 2NZOA 4PMWA 1Q8KA 2KUMA 1K8GA 1WCMB 3VYTA 2YTVA 4CGYB 2DGYA 1Q12A 1WFQA 2ID0A 3NWSA 4R8IA 1D6EC 2XVSA 4CJ0B 2Z9HA 3I90A 1M1KC 1E0BA 2MUYA 4RGOS 3TZDA 2UU9Q 1NBWA 3S2DH 5IYCH 4FXDA 2B2YC 2EE1A 5IGGA 3J7A5 5IYBG 4JK1C 2K05A 3OSOA 3PO3H 4CDEC 3RZOB 1PZJD 3FKIB 4PV1C 4FVMA 1I50H 4PZ7A 4DAMA 1S3OA 4PNYA 5HGTA 3PO2B 1VQDA 4K8JA 3SK6A 3CF5A 2K28A 3OMGA 2R7ZG 2E2HB 2SDFA 4IFDI 4OIJA 1PH9A 3TN2A 3D8GA 4A3MH 2KQ3A 3I4OA 1B3QA 1JE4A 5JEAJ 1N36Q 1VQJA 2E2IH 4KTAA 3NTKA 4C3IH 4Y7NH 4A3EH 2A6HC 4JV5L 1S5BD 1PTOC 4OL7A 5ELNA 3IKJA 1X6OA 4G7OC 4X65Q 3HOUH 3SEBA 3PF5A 1ICFB 4LAAA 1A6XA 2R92H 1CKNA 5M5YH 1EY6A 1Q1EA 1DYQA 1SNQA 2LS01 1PTOF 2A6ED 4DAYA 5J22A 2UXBL 3BYYB 1PHJA 1WTQA 2D0PA 2JJQA 4GOPC 1PH8A 3W1GA 1X3GA 1VQGA 1JJCB 4KY7A 4BXXH 5M3MB 5G3LD 4POGA 2EYFA 3Q22A 1IL8A 4B3TL 3Q8DA 3MTSA 4UP7A 1I94L 1ZXTA 4R4TA 3CCMA 3J81L 4MNOA 2UXCL 1L1OC 2EYJA 5IYDH 3D31A 1HRJA 4GNXB 3T1YQ 1K0RA 1JR0D 3I72A 1T5XD 2CH4A 1LTGD 3KJOA 1GKHA 1VF5C 2L0CA 1BKBA 2JSOA 4IJHA 2PQAA 3H0GB 4DR6Q 4YCVA 2PYKA 2FINB 2K14A 3NSWA 2F0UA 1N33Q 4C3JG 4RCOA 5LMNL 5I2XA 1JC7A 3I8ZA 4A93H 4JOIC 1NJIC 2RQXA 3ER0A 2RSOA 4LF9L 1Y69U 3OMCA 4AQYQ 3MXGA 4QIWE 3ZYYX 2P5ZX 5ELOA 1HNXL 4XT1B 4C3HH 2CHBD 3WDNA 5M3FB 3S14H 5DEHA 4N9PA 5C4JB 1HZ9A 3GTOH 3NPPA 3KUPA 1I4HA 1X3FA 4RAUC 3A5UA 3KLSA 4DV3L 2JA6H 3MXPA 1RCVD 1LYLA 3F2DA 1SYEA 5C0XH 3OWEB 5I9OA 5JVH3 2A6EC 2EXDA 3GTQB 2K32A 1JORA 4BY7H 4HJ9A 2ZTDA 3HKSA 1OXSC 1DD2A 5K36H 3D0FA 4HTHA 4RHSA 2NVYB 5H1SE 2K5QA 1VS0A 2AQ3B 4UP8A 1JWUD 4B9WA 4BBRG 1IBKL 5CR3A 3HOWH 3A54A 3CQZH 5KEEA 2IPKD 3M3YH 5IIFA 4YWKA 1SDFA 1CHQD 2EPBA 4IZ8A 3SHLA 1Z47A 1N34Q 5G3LF 1E3PA 1BBWA 4IN3A 3WOEA 1V1PB 2WAQG 5IGFA 1EY0A 1HXYD 3M85A 2F0DA 4BS9A 2F3VA 4IPDA 1TWHH 2KHJA 1MKHA 3RNUA 4TRDA 4X3KA 1PFBA 1WTPA 1DGSA 3NEMA 3NHHA 4DU9A 1H9JA 1SYDA 3HP3A 1F77A 4KN4C 1YNND 4HEDA 3CCRA 1EFID 1G6ZA 2ZJRA 2NVTB 1WTHA 4R4IA 4QUFA 3J81j 1STAA 2BCOA 4DR5L 1TVXA 4MIUA 1KNEA 5AJ3Q 3T4AC 5JJZA 4DF7A 3OPOA 1MJCA 2JA5H 1Y1VB 3OTOQ 3KF8A 5J1ZA 1E2VA 2MO1A 4PZ6A 3AFPA 2C5CA 2RCFA 3Q6SA 4KY6A 5IGEA 4GZYC 3S1RH 1RTNA 4A3KG 1CA5A 1XNQQ 2QKIC 1OXTA 1UE1A 1BQQT 2NTTA 1XXGA 2O4XA 2PZUA 3HOVB 1YZ6A 1AE3A 1CKMA 4UHVA 3G7LA 1Y1WG 3HOWB 3S1QH 4WORA 2QCPX 5EBDA 4FNFA 1VQFA 2OEOA 3F2CA 4IFDG 5ELCA 1KLGD 2GN5A 2VQFQ 2F0VA 5ELEA 4WJWA 5M5XH 1G291 2ZXOA 4AYBE 1L2FA 3D6WA 2J7ZA 2VL6A 3A7LA 5KYLA 4GLXA 3UI2A 2XWJB 2HT1A 4B3ML 4NXMQ 2J0TD 2PPBC 1JOKA 1SNMA 4C1NI 3NK9A 2B8FA 3SR1A 1WD0A 1U5KA 1GUTA 2B2WA 3IFTA 1N36L 4LF8Q 3J80E 4YIJA 3HKZG 4A4IA 3CCUA 1N8RC 1EY8A 3TSSA 2MFIA 3FPUB 1YNNC 2B63B 1CK1A 3RR5A 1RKNA 1CQVA 1XX8A 4K5XA 1M90C 2Q8IB 4DUZQ 2R61A 5E4WC 4LW1A 4BWGB 5JPNC 4JVZA 1VCIA 2HDMA 2HHHQ 5LL6X 1B53A 3ND8A 3K5OA 2B29A 2F0KA 5IYCG 1JJ2A 4ZUJA 3SDZA 4ZLTF 3EQLC 1NAPA 1EYGA 3K0XA 1ET6A 1PLFA 2PI2A 4IJLA 3OIQA 1KQSA 4IUTA 5IYBH 3PO3G 1QJOA 5M5WH 2WFWA 3MA2B 5CC4A 3PUYA 2DNEA 3C1FA 3H15A 1D5MC 2MHVA 2EY6A 5KNDA 3T1YL 5IT9E 5IP9G 1STNA 1LT5D 4X3UA 3GTGH 3LX0A 2E76C 2ZTCA 1HA5A 4NW2A 2IJ0A 3E3XA 1GD7A 1TWGH 3UDXA 4E6IA 4DR6L 1NR4A 2SNSA 1HCZA 4C3IG 4A3EG 4L6TB 2RBMA 3AEVA 3S15B 1S4ZA 1JB3A 3QOLA 1EQRA 2N78A 3S9WA 2QDLA 4NP5A 3EVQA 4KKTA 5C3EH 2BE5D 5BN5A 4AQYL 4A76A 3EFXD 5EPJA 4EX5A 1FYCA 5JJLA 2Z0SA 1H9MA 1HR0Q 2NVQH 2ENBA 5C5LA 4KMUC 1SAPA 4LFAQ 1PH3A 1VQHA 3GTJB 4RG1A 5JAVA 5EKIA 5FO8B 3HS0C 4HMJA 1AH9A 2K03A 4LNQA 4LWCA 1BOSA 3HKZE 2H5XA 2ICEC 1MGSA 3NTHA 1GHKA 3W3AA 2H4OA 3RD4A 1I6VC 2RDFA 4QUCA 3WOFA 4ZAIA 5IYDG 2BA1A 4XXEA 4UPAA 3HOXH 5M9OA 4PG3A 4ZUIA 1C4QA 3VA5A 4HIDA 3MVVA 2V1CC 1JICA 2V4DA 4X3TA 4N8X1 2XRSD 5BN3A 4QIWB 4DUYQ 3I73A 5CMDA 5I6WA 4C3JH 1STBA 3NBIA 1N34L 4CDCC 1PFMA 1AE2A 1STEA 3CPWA 1VMPA 2R7ZB 4A93G 3KOJA 4TVAB 2O5JC 2KVMA 1N32Q 3ZJYC 3A55A 3DHQA 1XPOA 3A0JA 4R4OA 1AFPA 1VQPA 2HDLA 4M1UB 2I5HA 1YI2A 3BG3A 3CAMA 5C44H 3P1HA 3T13A 2MJ8A 4RGTA 1C8CA 2JA6G 1TWFH 2BE5C 1EL0A 2PMZE 5C0XG 2B2VC 4L8JA 3T1HQ 4K2KA 3L2PA 2IHFA 5AJ3L 1SJHD 4YY3Q 2DJFC 1PXUA 1YHAA 4P75A 5K36G 1PRTB 2IY5B 5GROA 1BF4A 2JYOA 2D9UA 5IT9L 4ZCKA 1C0AA 1HZBA 3JC66 2SOBA 3A74A 2L12A 4BBRH 1EU4A 3PUZA 4F88A 4JYAQ 1F9RA 4LF4L 1ET9A 3Q23A 2BOSA 3SXHA 3HOYH 4OO1I 5FOBB 3BS1A 3K5NA 2E8GA 1MBYA 5J3BA 1VMCA 3VA7A 4A3LH 1I4RA 1PTOH 2NUCA 1QNKA 2AWOA 4P74A 2VQFL 3A8JE 1EY4A 3CCQA 2HIXA 1XJVA 2E75C 4JCVE 2A5HA 4KV6A 4DV2L 1YVCA 4ILWA 1EIYB 4P71A 4L5SA 1QZGA 1FJGQ 4RMFA 1I5FA 4X66L 2KCTA 1PVOA 3UE1A 1Q46A 1V8QA 1PA6A 2LSSA 5GAEC 3BDCA 2WIIB 4GN5A 4KJOA 5J39A 4LF8L 4UY8C 4L63B 3IAYA 2EYHA 2YV5A 4QGUA 3KLRA 1D5XC 2L9HA 4WJ3M 4LFBQ 3T51B 5JEAG 4CKEA 3TP8A 1BBUA 4PZ8A 3J7ZC 1LT6D 2G9HD 4J1MA 2R7FA 4DUZL 5A35A 3D4DA 4A3KH 3N52A 2WKCA 1BR9A 2MGSA 1MHWC 2OQKA 3MFGA 4K5WA 2HHHL 1O7ZA 2PI2E 3U9SA 3KDFA 1E7ZA 4AYBB 5T1GA 2BDOA 3CCVA 1ZYRD 4NDXA 2SEBD 4KHZA 4A3JH 1Y1WH 1A2UA 4IFDH 4BA2I 1U4RA 4HMIA 2K7VA 1V1OA 2RDHA 2AKWB 2N8NA 3G6EA 3TP7A 2JQOA 4DR1Q 1ASZA 5KGUA 1CKNB 2GA4B 3R2IA 3J81E 2WAQB 2VUMH 3NP8A 4BA1I 4DV6Q 1ML0D 4FXKC 3I70A 1E1TA 2M00A 4KHPQ 2LMCB 4GKJQ 1NCVA 2UXDQ 3K7AH 3MXUA 1VQIA 4UDUC 5C4XG 4CDFC 4GOPB 1NUCA 2FFKB 5C6AA 2X69A 5DM73 1EQQA 1NMGA 3S17B 4FP5D 3S24A 1K0SA 4MTNA 1I3QB 2YYZA 4EQPA 1EEID 3SE0A 1DM0B 1HR0L 4K6DA 3MXNA 4TSSA 2L55A 1F2MA 1WJJA 4LFAL 2PQAB 2KEDA 4RHRA 3MWYW 4G57A 3RMHA 1LT3D 1J6QA 3EBEA 1E2WA 1C48A 4NPSA 1CSQA 2D62A 2B2YA 1O78A 1H9SA 3KBXA 1SN8A 3OWFA 3F2BA 2RCNA 4HJAA 3CU7A 1HNWQ 4DR3Q 1ZYRC 4JI4Q 4RFBA 5EKLA 3U4VA 5KNCA 1FNUA 2SNMA 1E2ZA 1IZ6A 5IP9H 3DEOA 3H09A 1Y8OB 1U4PA 5ELDA 2Q8RE 3I4LA 4DUYL 1OO9B 5EGTA 2BA0A 2F1MA 3VR6A 2A73B 2JA9A 4M8AA 2GVBA 1B4OA 2B2TC 4IUNA 3NWTA 4A3GG 2JA8H 2HQEA 1RJTA 4IUVA 2XWBB 1GUOA 1N32L 2F0LA 4L5TA 5C3EG 1STYA 2YTXA 4X62Q 3HKZB 1I6HB 1FGBD 3X3MA 1SYFA 2K5DA 1HTLD 1DONA 1SYGA 4KD3A 4C2MH 1SNPA 3J80c 2F0GA 1MI2A 1LO5D 3EA6A 1Q81C 5E4XA 3T1HL 3CXCA 2QILA 4GOPA 1HTPA 3BDOA 4QQBX 1EU3A 1IKLA 1E22A 3M7GA 2JEBI 1D8LA 1VQOA 2EYLA 3V2TA 3S2DB 1SEBD 5D65A 1W6JA 3GTPH 2A19A 1PYWD 2VS1A 4LF5Q 3E9HA 1QUQB 3SK8A 1B50A 3HOXG 1VQ9A 1ZEQX 3PO3B 2EYMA 3TQYA 4B3RQ 1TKWB 3CPFA 1L1OA 2DY7A 3UDIA 5GAHC 3H3VI 3HOZG 3P20A 1I50B 3GTKH 1IYVA 1IW7D 1SMYD 2A8VA 5EAYA 3L0OA 3J81i 4F87A 4MTKA 2VXWA 2HIVA 4WJ4A 4JBKA 1JE5A 1PH4A 3IL8A 4A3MB 4DV1Q 4DR7Q 1V43A 5GADC 4B08A 2PMZB 3KF8B 4HJ7A 4JOIA 4BBSG 2E2IB 4Y7NB 4C3IB 4A3EB 3RUZA 3EROA 3H91A 1PZKD 5FLXc 3AMUA 1H9KA 4LJZC 3A8IE 4K0KQ 3KBGA 4R4QA 1UE5A 1WTWA 5C44G 1DOMA 1UE6A 3HOUB 1KAWA 1Y8PB 4ME5A 1G8ZD 4P2CB 2R92B 4EQ5A 3OYYA 4JBWA 1LM0A 2I5MX 1TT2A 5M5YB 1KL9A 5BN4A 1HZAA 2Q8TA 5CGKA 2EVBA 2CFMA 1XNRQ 2WKDA 4LFBL 3CCJA 1TIID 1Z9FA 4DV4Q 4HIOA 1SR3A 1LTSD 1SRUA 1Y14B 1BDOA 4EQNA 1EZ8A 1A62A 3M4OH 3FEWX 3DXJC 1W2BA 1NY4A 3S1MH 3PSIA 2EOTA 4XYOA 1QE6A 4JI8Q 1QILA 3I3CA 3HOYG 4FDBA 3CMEA 2XRQD 1HUMA 1LV9A 1CFMA 2AQ1B 2Q2IA 1VQLA 4A3LG 2ZJPA 2A69D 1EZ6A 1K83H 3H6MA 2K04A 1EYAA 5FLMH 5T1IA 1XTDA 3AFQA 1BUVT 1X32A 4I65A 4YHHQ 3QO2A 3GTKB 2F0NA 3H3VC 4HJ5A 1DZ1A 2L1BA 3VR4A 1ENFA 1CA6A 1QUQA 1IW7C 1SMYC 2IW3A 1QOHA 5JPMC 1BCPB 4A93B 2Y0SG 2F0MA 1PFSA 1B3AA 4JC0A 2CH4W 3R8BA 5GAGC 1YJWA 3G48A 4ZRZA 4ZYSA 4A3BG 3DWQA 2KCCA 1RIPA 1EWCA 4KD4A 1JB7A 4GNXC 4PMCA 4GKJL 4IOAA 1AEXA 4C3HB 1S40A 2UXDL 3S14B 5IWAQ 1KDCA 1Z6HA 1D1KA 3K7UC 2DY8A 2R93H 5EPLA 5JEAH 3GTOB 2N3SA 2JP1A 3DWPA 1K8OA 1TS2A 4KN7C 4FO2A 3JAML 2JA6B 3TBIB 2X6LA 1MSGA 2YTYA 4QF4A 4QY7A 1RD9D 5A2QL 3VYUA 3PQIA 2E2JH 1Y8NB 4LUVA 1X3QA 1U4MA 1XMOQ 3I91A 4BY7B 3S16H 2F4VQ 1FVIA 2PZTA 3WWVA 3SVMA 2UU9L 2PZWA 4LK1C 1PH2A 1J9OA 1X3EA 3K81C 5CORA 3JAMi 1UEBA 3LWUA 3W5OA 4A3JG 3FMCA 1VQNA 3M4OB 3CQZB 3M3YB 2PW7A 4DV5Q 1F9PA 4KI0A 2KHSA 4MN3A 3KF6B 2UUAQ 2K6AA 2LY7A 1VQMA 1YIJA 3KFUA 5IODA 2JA7H 4DR3L 1ENAA 4JI4L 1VQ6A 3FDTA 2LKVA 2F0SA 2VUMG 4RKBA 2Q2TA 2NB0A 3O13A 1D7QA 3FVQA 4K5VA 2ZXPA 1TWHB 2O5IC 1NSNS 1SYBA 2Z6KC 2HQLA 2KCNA 4UAIA 5C4XH 1NTGA 1A3TA 2WAQE 4Z9CB 1RF2D 3ERSX 3UDFA 1SFOH 1G2TA 2KECA 5BR8Q 4X65L 4A3IH 5FJ8G 1JQYD 4YCWA 1SE4A 4X62L 3MAQA 4IO9A 2CWPA 1EIHA 1UNSA 3I55A 2JA5B 2Y0SE 4A3DH 5D14A 2F3IA 4HSPA 3UE0A 3GTLH 2QW7A 4OELB 1LABA 1M8AA 1Q82C 5EPKA 3S1RB 3M9BA 1KABA 4QL5A 3A7AB 3K6OA 1XTCD 1OXXK 4BY1H 3ULJA 2K5NA 4ZQ3A 1QWYA 3I4NH 2XTIA 3BU2A 3NTIA 1UE7A 2JE6I 4LF7Q 4JI1Q 3M4YA 4JI0Q 1FGUA 3UDGA 1RHPA 1BCPF 1OXUA 1TWCH 3S1QB 1UAPA 4LF5L 1K9MC 1SNDA 5CV9A 2D5DA 3DWAA 4B3RL 5M5XB 3MHBA 1G91A 1G6PA 3GO5A 4J6HA 4UP9A 1KDBA 3CCLA 1LTID 3GTJH 1OXVA 4O2DA 5LMUQ 2IX0A 1N33L 3RLFA 3H0GG 1LTRD 3LNNA 3KF6A 2JA8G 2F0WA 4A3GH 3DMUA 2JEAI 1EOVA 4DV1L 4DR7L 1B8AA 1WTOA 2TMPA 1SE8A 4A3CH 1B70B 5CBEE 2BDNA 2A74C 4IPCA 1R9TH 2K33A 4K0KL 1QCBD 1HUNA 1A3VA 4G7ZC 1M4VA 3BZCA 1EWIA 5M3FG 1QVGA 1TS5A 4R8NA 1JJGA 4K8IA 4DXFA 3FHWA 3C1EA 1WD1A 2D2CC 5E7NA 2ZM6Q 1VQAA 2KA7A 1XNRL 2F4IA 4OO1H 5JJKA 3VR5A 4DAPA 3AQQA 3QB3A 4J15A 3J7AV 5JJIA 3D3RA 1O80A 4C1NK 2I46A 4XT3B 1AW7A 5M5WB 1CI3M 1N9WA 3HOZH 3QG1A 4JI8L 3A5ZB 3NQIA 1EYDA 2QDBA 2BH2A 3G4SA 1YNJD 3GTMH 2NVXH 1A0IA 3GTGB 1VQBA 1VQ7A 4P73A 1S5DD 1TWGB 3K5MA 4JBJA 4YHHL 3HZXA 2PO4A 3FP9A 2OXPA 4BBSH 3L3OC 3A56A 3HGBA 1WI5A 5LL6S 2B3GA 3K59A 3PF4A 3VDYA 1F2YA 5C3EB 3KDFB 2RSNA 2J4XA 2MO0A 4R9WA 1E1OA 5HY6A 1U9RA 3CKIB 1EY9A 1AP0A 4LF6Q 5IWAL 1TWAH 2NVQB 1D2BA 1W3SA 2Q2UA 1SSOA 5JVG3 5LHY1 2RA4A 2B2VA 3K80C 2DN8A 3OTOL 2A68D 2FXQA 2CQOA 4DN4M 1CKOA 2UXBQ 1BVSA 3X3NA 1AZPA 3T53B 2E74C 1HJPA 1XNQL 5LMNW 1KRSA 4B3SQ 3M4PA 3FRPB 4XIGS 2F0IA 2LFNA 2F4VL 2NZHA 1TU2B 4DNIA 2F0EA 4B3TQ 3I4MH 1FL0A 1X3PA 3HOXB 2Z4IA 5CV5A 3HOVG 3BVZA 2ALYB 1PRTD 2DJGC 5FLMG 2B2UC 4DNTB 4DV5L 3D6CA 2UUAL 2JXMB 2B8GA 1UWVA 4FYDA 4DK3C 4ZKCB 5IE8A 2RF4A 1R4PB 4GLAC 4C3JB 4HAEA 1PH7A 1X65A 2PNHA 1HNZQ 4NXML 4ID6A 2OWOA 4F8MA 2F0PA 4OWTB 2MQHA 2HCIA 5DLQE 3STBD 3MXNB 1Q7YC 1YHQA 4A3BH 1UUPA 1CQFA 4QCLA 2ES2A 1TY0A 1VF7A 3E5SA 5KYIA 1PYBA 5IGBA 5K5PA 2R93G 1HNXQ 3I7FA 1JWSD 5C44B 4A3FG 4APVA 1H9SB 1TWFB 5BR8L 3BZKA 1X56A 2NYZD 1BNZA 3W1BA 2B63G 1TY2A 1Q8IA 1L0XB 1WCMH 1EYCA 3GV6A 2Z4HA 1KRTA 1WVLA 1LTLA 2XSCA 3D4WA 2A68C 2C9OA 5C5MA 2Z8LA 1JT8A 4OGQC 3CD6A 4BBRB 1JOQA 1CSPA 5IOCA 4X64Q 1XYIA 3PUXA 4ZKBB 5EQ0A 3GQBA 2PW5A 2H1EA 2L15A 4P72A 1JOOA 1S72A 3HOYB 2IHEA 1L0WA 2JA7G 1O7YA 1D1IA 1PTOB 3RZOH 2ZXRA 3FKIH 4DV7Q 2B39A 1F9SA 3DM1A 1PRTC 2AUKA 3OIPA 1G51A 1ZKOA 4H44C 4U673 2NN6H 1NMFA 2OT2A 4LMQD 3V05A 1TR5A 3PO2H 2K52A 4WFN3 3BVMA 1T5EA 2MP1A 2E2HH 4HN7A 1HZCA 1GUSA 1PH6A 4J8QA 2K5HA 3KK7A 5LMUL 2Y0SB 1PRTF 1F2LA 5DM63 4GKKQ 2XGTA 4KY5A 2FMCA 4QJFA 4NB3A 3STBC 2WP8J 4A3IG 2PQEA 5FJ8H 2LXJA 3EIVA 3KLSX 5FO9B 4ME3A 2G5DA 3RLOA 1HA6A 2IT1A 2VB2X 4IUUA 4RGNA 4A3DG 3KLWA 4CBVA 4HIMA 1S5CD 2RHSB 1L1OB 4ALPA 1R4QB 4JI7Q 2CKZB 2PNRC 1O7IA 4A3KB 1K8AC 1Q90A 3L7ZC 4XDXA 4BY1G 1BXTA 2ZM6L 2CWAA 3MFYA 1SNCA 3CP0A 3H3VH 3I4NG 3TREA 4JW0A 1MJEA 3CCEA 5M3MH 2BH8A 5E1FA 2VQEQ 3PIPA 2AWNA 3EN2A 4A3JB 1Y1WB 3NUCA 4XQJA 1STHA 1X55A 2KENA 4ZK9B 1GUNA 3ONAB 3S2HH 1KDAA 4DKAC 2NTSA 1T9HA 3QJYA 2A1AA 5KRUA 4PQXA 1YEZA 1DXMA 2CW0D 1TQOA 2F0QA 5DAUA 5IGDA 1J5EQ 3C3LA 4JI2Q 3PIO3 1HH2P 2PCFB 1HQMC 3H0GH 3SK4A 4DR2Q 2VUMB 2N88A 3CMAA 1V1QA 4IPHA 3N6RA 2VNUD 4B3MQ 2NN6I 4X6AH 3IRBA 2TSSA 3TMEA 4A3CG 3RN5A 2B2TA 1CM9A 3K7AB 1X54A 5CV6A 1F9QA 2MNAA 4K6LA 4TKOB 2F0FA 1QG7A 1WOCA 3GDEA 1A63A 1LTAD 1H9RA 2AMCB 2E2DC 5C3XA 5M3FH 3C2PA 4FF4A 4R4CA 5FO7B 1ASYA 5C4JH 3TRZA 1FR3A 1X9NA 3SK5A 4LF6L 3RZDH 4YY3L 1SE2A 4V190 4FF3A 4OO1G 2Z6BA 4DFAA 4QB4A 1A2TA 3NBHB 1VQ4A 3R3OA 1B44D 4U68A 3QR8A 3GTQH 4F7XA 5IGCA 1GXDC 1OTCA 4FF1A 1NE3A 4L5QA 3JAME 4DV0Q 1EOTA 3AU7A 1IHZA 4JYAL 2NVYH 4L5RC 1B1ZA 4B3SL 3CRLC 5A2QE 4IURA 5EKKA 1TXYA 1EY7A 1ICWA 2AUJD 2RVLA 4HIKA 1JCKB 3PIOA 2RKSA 2I07B 2R7DA 3TEHB 3PMFA 4AH6A 4LUZA 3S2HB 3PUVA 2NWGA 2ATWA 5IY0A 5KNBA 1IXRA 2XN9C 1DOKA 5IP7H 4ULLA 1E24A 2CW0C 3PV0A 4GN4B 3E0EA 2QEJC 5IT9c 4A75A 3GD7A 1VQ8A 1VDZA 3KJPA 2QEXA 1FJGL 5HURA 1HNZL 2JA8B 4KLKA 1XWEA 1LACA 1IL2A 2HCCA 2IX1A 1K28A 1QNUA 3T16A 1J8IA 2F3WA 4GS3A 2NVTH 4XQQA 2KBNA 4OX9Q 1WTRA 4IALA 2EXZA 3BVGA 2NBFA 3AYHB 3U58A 4C56C 4C2MB 1KNAA 1HPCA 2VW9A 5E3FA 1Y1VH 1KTKA 3MC0B 4N9TA 3RZDB 1YBYA 4DPGA 2VZAA 3HFZB 4QMGA 1TS3A 1VQEA 3NE5B 4HR7B 2IL8A 2EJMA 1YJNA 3GTPB 1U0LA 3I4MG 4RGMA 3BJUA 2ZTEA 4H13C 3NXWA 4AYBG 4X64L 3HOVH 1SJED 2F0HA 4IUQA 5I4DA 1GUWA 1LT4D 3NBHA 4R1JA 1ILQA 2K50A 4DK0A 1P16A 3HEJA 3J7YW 4NXNQ 3P75A 4O1NA 4DR1L 2OTLA 3F8TA 5I9PA 5CYUA 4DV7L 1DOLA 1GM5A 1XPRA 5EJWA 4DV6L 2ZT9C 3BZDB 3M7NA 4JI6Q 1IBMQ 1RTOA 4KHPL 4OHJA 2LXKA 1GJXA 3ITPA 3OW7A 5F2DA 1KIXA 3TS0A 4MHEA 4GNXA 4K2LA 2JK8A 4RA8A 3E0JA 4GKKL 1ILPA 2WB1G 2NZ1D 4A3FH 1O7LA 1IYJB 3R2TA 4I7AA 1BCPD 2B63H 2IWHA 1PH5A 3MEFA 3F2UA 1PMRA 1WCMG 2XNAC 3Q0AA 1C7YA 2UUBQ 4DR4Q 3OW2A 1AZQA 1ESRA 1STGA 4JI5Q 4JI7L 1JWMD 4OONA 1I4GA 4G7HC 1MIUA 5CV8A 4OIKA 4MZ9A 2EYPA 3S1MB 1DJRD 4JPBW 4HCEA 5EBCA 2YU9H 5C0XI 3K5LA 1GOZA 1SYCA 4LF4Q 5CV7A 2VQEL 4CHTB 1HNWL 3L9AX 1AN8A 2EJFC 1YJ9A 1K83B 1VQKA 2A69C 3FKIG 5JOBA 4OWWB 2K1BA 1S5FD 1B2TA 3BYTB 2O2LD 5GQOA 2AHOB 3CRKC 2NN6G 3M4QA 1YITA 4H0LC 2R3ZA 1PV4A 3PO2G 5NUCA 1S5ED 2RDGA 4CKBA 3LGJA 3CC2A 3I56A 2EY5A 1I4PA 1XMQQ 3IFDA 1HHVA 2RHQB 1J5EL 4JI2L 2EIFA 4I7ZC 4O0AA 4DV2Q 3VYRA 2K01A 3G6JB 1I4QA 4DR2L 1KC8C 4CDDC 2Z6KA 4OEMB 1FNVA 1G2SA 2QGQA 3S15H 1H95A 4YCUA 1RL2A 4X66Q 2B2WC 5D3IB 2QF7A 4KK7A 2Q2HA 1EQTA 4RKLA 4DXGA 2R93B 1LTBD 2Z1CA 4A3FB 1WTVA 1IYUA 2F0JA 1V1PA 1IKMA 3KYHC 1EUJA 1EIGA 1BCPC 1LLRD 1D5ZC 2E2JB 3C46A 5C4ZA 2F0TA 5KIXA 2L11A 3A8KE 3S16B
chains in the Genus database with same CATH topology
1WJJA 2EXDA 4LFAL 1HJPA 4BY7H 4HJ9A 1XNQL 2PQAB 2ZTDA 3HKSA 5M3MG 2WB1E 1OXSC 5LMNW 4IFDI 1KRSA 3D0FA 4B3SQ 3M4PA 3S1NH 4XIGS 5H1SE 2F4VL 2NZHA 1J6QA 3EBEA 4DNIA 1VS0A 4NPSA 1CSQA 2D62A 4UP8A 4BBRG 1IBKL 3HOWH 4B3TQ 4DV0L 3I4MH 3K8AA 1FL0A 1SN8A 3F2BA 5HGQA 3CQZH 3M3YH 2RCNA 4YWKA 4HJAA 3CCSA 1HNWQ 3HOVG 4DR3Q 4JI4Q 2ALYB 5FLMG 4DV5L 3U4VA 4AIMA 2UUAL 1IZ6A 5IP9H 2I0QA 3TS2A 1Z47A 1N34Q 3NENA 1UWVA 1EFWA 4DK3C 1E3PA 5IE8A 2RF4A 4GLAC 1KXLA 1BBWA 1IBLQ 2WAQG 1PH7A 1V9PA 1X65A 1HR0W 2PNHA 3M85A 4DUYL 1HNZQ 4NXML 1PYSB 2BA0A 3U50C 4OWXB 2OWOA 4H02A 4IPDA 2R7ZH 1TWHH 2KHJA 1MKHA 2JA9A 2MQHA 4JG2A 3MXNB 4OWTB 2GVBA 1GVPA 5DLQE 1K3RA 3STBD 3J81c 4A3MG 1YHQA 1Q7YC 1PH1A 2UUCQ 3ICEA 2JA8H 4A3GG 1DGSA 3NEMA 4LFCQ 1N32L 2CCZA 2ES2A 2E5LQ 4L5TA 5C3EG 4JI3Q 2YTXA 4BY7G 3CCRA 4HJ8A 1PYBA 4X62Q 2ZJRA 2R93G 3E9IA 4R4IA 1HNXQ 3I7FA 3J81j 4A3FG 1WYDA 4DR5L 4APVA 5BR8L 3HOUG 1VQ5A 2R92G 5AJ3Q 3BZKA 1X56A 4OX9L 2OTJA 3W1BA 2B63G 1CUKA 1MJCA 4C2MH 2JA5H 3J80c 3OTOQ 1WCMH 1KRTA 4DV4L 1Q81C 4PZ6A 2MO1A 3AFPA 3T1HL 1LTLA 3CXCA 4GOPA 1C9OA 3S1RH 4QQBX 4LUOA 1E22A 4A3KG 1JT8A 2JEBI 1D8LA 1VQOA 1XNQQ 3CD6A 4IFDJ 1OXTA 3ULPA 1UE1A 1CSPA 3NELA 4X64Q 4BXXG 3GTPH 3PUXA 2A19A 2N49A 2VS1A 4LF5Q 3E9HA 1QUQB 1YZ6A 1AE3A 1CKMA 2L15A 3HOXG 4P72A 1P8LA 1S72A 2IHEA 1VQ9A 3TQYA 2KCMA 1Y1WG 3S1QH 4B3RQ 1VQFA 3CPFA 1L1OA 1L0WA 2JA7G 2ASBA 3UDIA 5GAHC 3H3VI 3F2CA 3HOZG 4IFDG 3RZOH 2GN5A 2VQFQ 3GTKH 2K75A 3FKIH 4GN3B 4DV7Q 5M5XH 1G291 2A8VA 5EAYA 3L0OA 5IP7G 3J81i 1G51A 3PCOB 4AYBE 1L2FA 1NMFA 2VL6A 4NXNL 2HIVA 3CC4A 4JBKA 3PO2H 2K52A 4WJ4A 1JE5A 3RLNA 4GLXA 1PH4A 2E2HH 2HT1A 3U4ZA 4DV1Q 4B3ML 1HZCA 4NXMQ 4DR7Q 1PH6A 1V43A 2K5HA 5GADC 3KF8B 4HJ7A 2OQ0A 5LMUL 3F1ZA 4JV5Q 4JOIA 4BBSG 2OCEA 1QVCA 1JMCA 4GKKQ 2XGTA 4JI6L 1IBML 5FLXc 4TQUS 4QJFA 1U5KA 4NB3A 3STBC 4K0KQ 1N36L 4LF8Q 2WP8J 4A3IG 4R4QA 1UE5A 5FJ8H 2LXJA 3EIVA 3SGIA 5C44G 3HKZG 1UE6A 3J80i 4A4IA 1KAWA 3CCUA 1N8RC 4ME3A 3RLOA 4EQ5A 3OYYA 2MFIA 2IT1A 4JBWA 1LM0A 2I5MX 4IOCA 1KL9A 3RR5A 4A3DG 3KLWA 1HZAA 4HIMA 3DM3A 1M90C 2RHSB 2GVAA 1L1OB 1Y1VG 4LW1A 4DUZQ 3RN2A 4POFA 2CFMA 2F52A 1XNRQ 4ALPA 4JI7Q 4LFBL 2CKZB 3CCJA 1O7IA 1Z9FA 2I5LX 4DV4Q 4HIOA 2UUBL 1VCIA 4Y52H 1XMOL 1K8AC 2HHHQ 4JBMA 1SR3A 1SRUA 1Y14B 3L7ZC 4A3BH 4DR4L 4BY1G 2B29A 2ZM6L 2CWAA 1A62A 3CP0A 4YWMA 3H3VH 3I4NG 2VY3A 4JI5L 3TREA 1MJEA 3M4OH 3CCEA 1GO3E 2BH8A 5M3MH 5IYCG 1W2BA 1NY4A 1JJ2A 2VQEQ 3PIPA 1I94Q 2AWNA 3PSIA 3S1MH 3EN2A 2KHIA 1EYGA 3K0XA 4IJLA 4DK6C 2PI2A 2UXCQ 4JI8Q 3HOYG 1KQSA 5IYBH 4FDBA 4GLVB 1A8VA 3PO3G 3CMEA 3HOWG 1X55A 2Q2IA 5M5WH 2KENA 2WFWA 1XPUA 3G71A 1VQLA 4A3LG 2ZJPA 3S2HH 3JAMc 1K83H 3PUYA 1QZHA 4DKAC 1T9HA 3H15A 2A1AA 3ULLA 5FLMH 1YEZA 1XTDA 3AFQA 3T1YL 5IP9G 4YHHQ 1J5EQ 4JI2Q 5LMNQ 3GTGH 1HH2P 2ZTCA 4HJ5A 2K4KA 3H0GH 1QUQA 3PUWA 4DR2Q 1GD7A 1TWGH 3CMAA 1V1QA 1VQCA 4IPHA 3UDXA 2VNUD 4DR6L 4B3MQ 1EIFA 2NN6I 2Y0SG 3IRBA 4LF9Q 1XMQL 1K73C 4X6AH 2DUDA 1PFSA 4A3EG 4JC0A 4A3CG 3RN5A 5GAGC 1YJWA 3AEVA 3G48A 1X54A 3I2ZA 2MNAA 2C35B 4A3BG 1EQRA 2N78A 1RIPA 1JB7A 4GNXC 4GKJL 4IOAA 1SMXA 2UXDL 1S40A 1WOCA 3GDEA 1A63A 5C3EH 5IWAQ 2AMCB 4AQYL 4A76A 3K7UC 4EX5A 5M3FH 2R93H 4DV3Q 5JJLA 2Z0SA 4R4CA 2N3SA 1ASYA 5C4JH 3TRZA 1HR0Q 3S17H 2NVQH 1X9NA 1I3QH 2YTYA 4LF6L 4QY7A 3RZDH 4LFAQ 4YY3L 1PH3A 2JA5G 1VQHA 3PGZA 2E2JH 4RG1A 4LUVA 4OO1G 1VQ4A 3NBHB 1XMOQ 1AH9A 3CC7A 3S16H 2F4VQ 4LNQA 4LWCA 1FVIA 1LUZA 3GTQH 3HKZE 3WWVA 1B7YB 1IBKQ 1OTCA 2UU9L 1PH2A 2H5XA 1NE3A 4L5QA 4DV0Q 2ZJQA 1X3EA 3JAMi 3K81C 4JYAL 2NVYH 3DLLA 1UEBA 3W5OA 4A3JG 4L5RC 3CW2C 1VQNA 4B3SL 4XTCS 1YNXA 4JI1L 4LF7L 4JI0L 5IYDG 2R6GA 2BA1A 4DV5Q 4KI0A 1TXYA 4UPAA 2EQSA 2K5VA 3B6YA 3KF6B 4PG3A 3HOXH 1SLJA 4HIKA 2UUAQ 3PIOA 1YIJA 1SROA 2R7DA 3TEHB 4HIDA 1VQMA 3KFUA 4DR7L 4AH6A 2V1CC 4LUZA 2QA4A 4DR3L 4YWLA 1Q86C 2JA7H 4JI4L 3PUVA 1VQ6A 2ATWA 4IPGA 4DUYQ 1YHBA 2VUMG 5IY0A 2Q2TA 1IXRA 4C3JH 5IP7H 1D7QA 1E24A 3PV0A 1N34L 4GN4B 3E0EA 1AE2A 4OXPA 3CPWA 5IT9c 4A75A 1IBLL 4A93G 3KOJA 4TVAB 3GD7A 1VQ8A 1N32Q 3KJPA 2QEXA 2Z6KC 3ZJYC 1FJGL 1HNZL 2HQLA 4KLKA 1XPOA 4DAYB 3A0JA 2D0OA 5C0XJ 4R4OA 1QVFA 5C4XH 1NTGA 1KHIA 1VQPA 2UUCL 2WAQE 1Q1BA 3ERSX 3UDFA 1SFOH 4DR5Q 4LFCL 1IL2A 2I5HA 4X65L 5BR8Q 1YI2A 2IX1A 3CAMA 2E5LL 4A3IH 5FJ8G 4GS3A 3RNUA 2NVTH 1KD1C 4JI3L 2KBNA 5C44H 4OX9Q 1I6HH 2NZOA 4YCWA 4PMWA 4X62L 4IO9A 2CWPA 2JA6G 1TWFH 3AYHB 1Q8KA 2PMZE 3U58A 3I55A 5C0XG 2Y0SE 4A3DH 3T1HQ 1K8GA 2F3IA 3L2PA 2IHFA 2YTVA 3UE0A 2DGYA 2VW9A 5AJ3L 3GTLH 1Y1VH 4YY3Q 1Q12A 1WFQA 2ID0A 1YHAA 1Q82C 1YBYA 4P75A 4DPGA 2VZAA 5K36G 2IY5B 5GROA 3M9BA 1M1KC 4QL5A 3HFZB 1VQEA 1C0AA 1OXXK 1HZBA 4BY1H 3JC66 3A74A 2UU9Q 1NBWA 3ULJA 1YJNA 4BBRH 3S2DH 2K5NA 1U0LA 3PUZA 3I4NH 3I4MG 2XTIA 3BJUA 4JYAQ 3BU2A 5IYCH 2ZTEA 1UE7A 2JE6I 4LF4L 4LF7Q 4JI1Q 4AYBG 4X64L 3J7A5 4JI0Q 1FGUA 3UDGA 3HOVH 1TWCH 1OXUA 3HOYH 5IYBG 4LF5L 4OO1I 1K9MC 3PO3H 2E8GA 4R1JA 5J3BA 4A3LH 4B3RL 2K50A 1I50H 1P16A 1G6PA 3GO5A 4NXNQ 4UP9A 4PZ7A 4DR1L 4DAMA 1S3OA 2OTLA 3CCLA 2AWOA 4P74A 2VQFL 3F8TA 1VQDA 4DV7L 3CF5A 3CCQA 1GM5A 1OXVA 2R7ZG 4O2DA 2HIXA 2IX0A 5LMUQ 1XJVA 1XPRA 4JCVE 4DV2L 1PH9A 1N33L 3RLFA 3H0GG 4DV6L 1YVCA 3PO2G 1EIYB 3M7NA 4A3MH 4JI6Q 3KF6A 1IBMQ 2JA8G 4A3GH 4KHPL 3I4OA 2LXKA 4P71A 4L5SA 1QZGA 5JEAJ 1N36Q 1FJGQ 1EOVA 1VQJA 4RMFA 4DV1L 1B8AA 2E2IH 1I5FA 4C3IH 4Y7NH 4X66L 2KCTA 4A3EH 4A3CH 1SE8A 1PVOA 3UE1A 1KIXA 4JV5L 1B70B 1Q46A 3TS0A 1PA6A 4GNXA 2JK8A 5ELNA 2LSSA 4GKKL 2WB1G 4A3FH 5GAEC 1X6OA 4IPCA 4X65Q 4GN5A 1R9TH 1IYJB 3HOUH 4K0KL 3PF5A 4LF8L 4UY8C 2R92H 2YV5A 3BZCA 4QGUA 1CKNA 1EWIA 5M5YH 5M3FG 4WJ3M 2B63H 1QVGA 4LFBQ 5JEAG 1PH5A 3MEFA 1Q1EA 1WCMG 1C7YA 2UUBQ 1JJGA 1BBUA 3FHWA 4PZ8A 5E7NA 4DR4Q 3J7ZC 3OW2A 2UXBL 2ZM6Q 2R7FA 1VQAA 4DUZL 1PHJA 2D0PA 2JJQA 4GOPC 4A3KH 1PH8A 4JI5Q 1XNRL 3W1GA 4JI7L 1X3GA 1VQGA 4OONA 1JJCB 2OQKA 1MIUA 5JJKA 2HHHL 4BXXH 4POGA 2PI2E 4MZ9A 3KDFA 3AQQA 1E7ZA 4J15A 3CCVA 2YU9H 5JJIA 5C0XI 4B3TL 3Q8DA 4KHZA 4A3JH 1Y1WH 4LF4Q 4UP7A 2VQEL 1I94L 3CCMA 4R4TA 1HNWL 1N9WA 4MNOA 3HOZH 2UXCL 4JI8L 1L1OC 1YJ9A 1VQKA 3D31A 4BA2I 3A5ZB 5IYDH 4GNXB 3FKIG 3T1YQ 1K0RA 4OWWB 2BH2A 5GQOA 3G4SA 2AHOB 3M4QA 2NN6G 1YITA 3KJOA 1GKHA 2AKWB 2N8NA 3G6EA 3GTMH 2NVXH 1A0IA 2JQOA 4DR1Q 1BKBA 1PV4A 1VQBA 4IJHA 1ASZA 1CKNB 2PQAA 4P73A 1VQ7A 4DR6Q 3LGJA 4YCVA 3CC2A 3I56A 1XMQQ 2K14A 2VUMH 2RHQB 4JBJA 4YHHL 1J5EL 1N33Q 4JI2L 2EIFA 3FP9A 5LMNL 4O0AA 4DV2Q 2JEAI 4BA1I 4DV6Q 4BBSH 4DR2L 1KC8C 1E1TA 4A93H 4JOIC 2Z6KA 1NJIC 4KHPQ 3ER0A 1WI5A 4GKJQ 2UXDQ 2QGQA 2B3GA 3K7AH 4LF9L 3S15H 1H95A 4YCUA 1RL2A 4X66Q 1VQIA 3PF4A 4AQYQ 3VDYA 4QIWE 2Q2HA 5C4XG 4GOPB 3KDFB 5ELOA 1HNXL 2MO0A 4C3HH 3S14H 1E1OA 5HY6A 1EQQA 1HZ9A 1NMGA 3S24A 4LF6Q 5IWAL 1TWAH 3GTOH 4MTNA 1W3SA 2Q2UA 1X3FA 2YYZA 3KYHC 3A5UA 4DV3L 3K80C 2JA6H 1EUJA 3OTOL 1LYLA 2FXQA 3F2DA 1HR0L 2CQOA 1CKOA 2UXBQ 1BVSA 3GTJH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJJ A;  2EXD A;  4LFA L;  1HJP A;  4BY7 H;  4HJ9 A;  1XNQ L;  2PQA B;  2ZTD A;  3HKS A;  5M3M G;  2WB1 E;  1OXS C;  5LMN W;  4IFD I;  1KRS A;  3D0F A;  4B3S Q;  3M4P A;  3S1N H;  4XIG S;  5H1S E;  2F4V L;  2NZH A;  1J6Q A;  3EBE A;  4DNI A;  1VS0 A;  4NPS A;  1CSQ A;  2D62 A;  4UP8 A;  4BBR G;  1IBK L;  3HOW H;  4B3T Q;  4DV0 L;  3I4M H;  3K8A A;  1FL0 A;  1SN8 A;  3F2B A;  5HGQ A;  3CQZ H;  3M3Y H;  2RCN A;  4YWK A;  4HJA A;  3CCS A;  1HNW Q;  3HOV G;  4DR3 Q;  4JI4 Q;  2ALY B;  5FLM G;  4DV5 L;  3U4V A;  4AIM A;  2UUA L;  1IZ6 A;  5IP9 H;  2I0Q A;  3TS2 A;  1Z47 A;  1N34 Q;  3NEN A;  1UWV A;  1EFW A;  4DK3 C;  1E3P A;  5IE8 A;  2RF4 A;  4GLA C;  1KXL A;  1BBW A;  1IBL Q;  2WAQ G;  1PH7 A;  1V9P A;  1X65 A;  1HR0 W;  2PNH A;  3M85 A;  4DUY L;  1HNZ Q;  4NXM L;  1PYS B;  2BA0 A;  3U50 C;  4OWX B;  2OWO A;  4H02 A;  4IPD A;  2R7Z H;  1TWH H;  2KHJ A;  1MKH A;  2JA9 A;  2MQH A;  4JG2 A;  3MXN B;  4OWT B;  2GVB A;  1GVP A;  5DLQ E;  1K3R A;  3STB D;  3J81 c;  4A3M G;  1YHQ A;  1Q7Y C;  1PH1 A;  2UUC Q;  3ICE A;  2JA8 H;  4A3G G;  1DGS A;  3NEM A;  4LFC Q;  1N32 L;  2CCZ A;  2ES2 A;  2E5L Q;  4L5T A;  5C3E G;  4JI3 Q;  2YTX A;  4BY7 G;  3CCR A;  4HJ8 A;  1PYB A;  4X62 Q;  2ZJR A;  2R93 G;  3E9I A;  4R4I A;  1HNX Q;  3I7F A;  3J81 j;  4A3F G;  1WYD A;  4DR5 L;  4APV A;  5BR8 L;  3HOU G;  1VQ5 A;  2R92 G;  5AJ3 Q;  3BZK A;  1X56 A;  4OX9 L;  2OTJ A;  3W1B A;  2B63 G;  1CUK A;  1MJC A;  4C2M H;  2JA5 H;  3J80 c;  3OTO Q;  1WCM H;  1KRT A;  4DV4 L;  1Q81 C;  4PZ6 A;  2MO1 A;  3AFP A;  3T1H L;  1LTL A;  3CXC A;  4GOP A;  1C9O A;  3S1R H;  4QQB X;  4LUO A;  1E22 A;  4A3K G;  1JT8 A;  2JEB I;  1D8L A;  1VQO A;  1XNQ Q;  3CD6 A;  4IFD J;  1OXT A;  3ULP A;  1UE1 A;  1CSP A;  3NEL A;  4X64 Q;  4BXX G;  3GTP H;  3PUX A;  2A19 A;  2N49 A;  2VS1 A;  4LF5 Q;  3E9H A;  1QUQ B;  1YZ6 A;  1AE3 A;  1CKM A;  2L15 A;  3HOX G;  4P72 A;  1P8L A;  1S72 A;  2IHE A;  1VQ9 A;  3TQY A;  2KCM A;  1Y1W G;  3S1Q H;  4B3R Q;  1VQF A;  3CPF A;  1L1O A;  1L0W A;  2JA7 G;  2ASB A;  3UDI A;  5GAH C;  3H3V I;  3F2C A;  3HOZ G;  4IFD G;  3RZO H;  2GN5 A;  2VQF Q;  3GTK H;  2K75 A;  3FKI H;  4GN3 B;  4DV7 Q;  5M5X H;  1G29 1;  2A8V A;  5EAY A;  3L0O A;  5IP7 G;  3J81 i;  1G51 A;  3PCO B;  4AYB E;  1L2F A;  1NMF A;  2VL6 A;  4NXN L;  2HIV A;  3CC4 A;  4JBK A;  3PO2 H;  2K52 A;  4WJ4 A;  1JE5 A;  3RLN A;  4GLX A;  1PH4 A;  2E2H H;  2HT1 A;  3U4Z A;  4DV1 Q;  4B3M L;  1HZC A;  4NXM Q;  4DR7 Q;  1PH6 A;  1V43 A;  2K5H A;  5GAD C;  3KF8 B;  4HJ7 A;  2OQ0 A;  5LMU L;  3F1Z A;  4JV5 Q;  4JOI A;  4BBS G;  2OCE A;  1QVC A;  1JMC A;  4GKK Q;  2XGT A;  4JI6 L;  1IBM L;  5FLX c;  4TQU S;  4QJF A;  1U5K A;  4NB3 A;  3STB C;  4K0K Q;  1N36 L;  4LF8 Q;  2WP8 J;  4A3I G;  4R4Q A;  1UE5 A;  5FJ8 H;  2LXJ A;  3EIV A;  3SGI A;  5C44 G;  3HKZ G;  1UE6 A;  3J80 i;  4A4I A;  1KAW A;  3CCU A;  1N8R C;  4ME3 A;  3RLO A;  4EQ5 A;  3OYY A;  2MFI A;  2IT1 A;  4JBW A;  1LM0 A;  2I5M X;  4IOC A;  1KL9 A;  3RR5 A;  4A3D G;  3KLW A;  1HZA A;  4HIM A;  3DM3 A;  1M90 C;  2RHS B;  2GVA A;  1L1O B;  1Y1V G;  4LW1 A;  4DUZ Q;  3RN2 A;  4POF A;  2CFM A;  2F52 A;  1XNR Q;  4ALP A;  4JI7 Q;  4LFB L;  2CKZ B;  3CCJ A;  1O7I A;  1Z9F A;  2I5L X;  4DV4 Q;  4HIO A;  2UUB L;  1VCI A;  4Y52 H;  1XMO L;  1K8A C;  2HHH Q;  4JBM A;  1SR3 A;  1SRU A;  1Y14 B;  3L7Z C;  4A3B H;  4DR4 L;  4BY1 G;  2B29 A;  2ZM6 L;  2CWA A;  1A62 A;  3CP0 A;  4YWM A;  3H3V H;  3I4N G;  2VY3 A;  4JI5 L;  3TRE A;  1MJE A;  3M4O H;  3CCE A;  1GO3 E;  2BH8 A;  5M3M H;  5IYC G;  1W2B A;  1NY4 A;  1JJ2 A;  2VQE Q;  3PIP A;  1I94 Q;  2AWN A;  3PSI A;  3S1M H;  3EN2 A;  2KHI A;  1EYG A;  3K0X A;  4IJL A;  4DK6 C;  2PI2 A;  2UXC Q;  4JI8 Q;  3HOY G;  1KQS A;  5IYB H;  4FDB A;  4GLV B;  1A8V A;  3PO3 G;  3CME A;  3HOW G;  1X55 A;  2Q2I A;  5M5W H;  2KEN A;  2WFW A;  1XPU A;  3G71 A;  1VQL A;  4A3L G;  2ZJP A;  3S2H H;  3JAM c;  1K83 H;  3PUY A;  1QZH A;  4DKA C;  1T9H A;  3H15 A;  2A1A A;  3ULL A;  5FLM H;  1YEZ A;  1XTD A;  3AFQ A;  3T1Y L;  5IP9 G;  4YHH Q;  1J5E Q;  4JI2 Q;  5LMN Q;  3GTG H;  1HH2 P;  2ZTC A;  4HJ5 A;  2K4K A;  3H0G H;  1QUQ A;  3PUW A;  4DR2 Q;  1GD7 A;  1TWG H;  3CMA A;  1V1Q A;  1VQC A;  4IPH A;  3UDX A;  2VNU D;  4DR6 L;  4B3M Q;  1EIF A;  2NN6 I;  2Y0S G;  3IRB A;  4LF9 Q;  1XMQ L;  1K73 C;  4X6A H;  2DUD A;  1PFS A;  4A3E G;  4JC0 A;  4A3C G;  3RN5 A;  5GAG C;  1YJW A;  3AEV A;  3G48 A;  1X54 A;  3I2Z A;  2MNA A;  2C35 B;  4A3B G;  1EQR A;  2N78 A;  1RIP A;  1JB7 A;  4GNX C;  4GKJ L;  4IOA A;  1SMX A;  2UXD L;  1S40 A;  1WOC A;  3GDE A;  1A63 A;  5C3E H;  5IWA Q;  2AMC B;  4AQY L;  4A76 A;  3K7U C;  4EX5 A;  5M3F H;  2R93 H;  4DV3 Q;  5JJL A;  2Z0S A;  4R4C A;  2N3S A;  1ASY A;  5C4J H;  3TRZ A;  1HR0 Q;  3S17 H;  2NVQ H;  1X9N A;  1I3Q H;  2YTY A;  4LF6 L;  4QY7 A;  3RZD H;  4LFA Q;  4YY3 L;  1PH3 A;  2JA5 G;  1VQH A;  3PGZ A;  2E2J H;  4RG1 A;  4LUV A;  4OO1 G;  1VQ4 A;  3NBH B;  1XMO Q;  1AH9 A;  3CC7 A;  3S16 H;  2F4V Q;  4LNQ A;  4LWC A;  1FVI A;  1LUZ A;  3GTQ H;  3HKZ E;  3WWV A;  1B7Y B;  1IBK Q;  1OTC A;  2UU9 L;  1PH2 A;  2H5X A;  1NE3 A;  4L5Q A;  4DV0 Q;  2ZJQ A;  1X3E A;  3JAM i;  3K81 C;  4JYA L;  2NVY H;  3DLL A;  1UEB A;  3W5O A;  4A3J G;  4L5R C;  3CW2 C;  1VQN A;  4B3S L;  4XTC S;  1YNX A;  4JI1 L;  4LF7 L;  4JI0 L;  5IYD G;  2R6G A;  2BA1 A;  4DV5 Q;  4KI0 A;  1TXY A;  4UPA A;  2EQS A;  2K5V A;  3B6Y A;  3KF6 B;  4PG3 A;  3HOX H;  1SLJ A;  4HIK A;  2UUA Q;  3PIO A;  1YIJ A;  1SRO A;  2R7D A;  3TEH B;  4HID A;  1VQM A;  3KFU A;  4DR7 L;  4AH6 A;  2V1C C;  4LUZ A;  2QA4 A;  4DR3 L;  4YWL A;  1Q86 C;  2JA7 H;  4JI4 L;  3PUV A;  1VQ6 A;  2ATW A;  4IPG A;  4DUY Q;  1YHB A;  2VUM G;  5IY0 A;  2Q2T A;  1IXR A;  4C3J H;  5IP7 H;  1D7Q A;  1E24 A;  3PV0 A;  1N34 L;  4GN4 B;  3E0E A;  1AE2 A;  4OXP A;  3CPW A;  5IT9 c;  4A75 A;  1IBL L;  4A93 G;  3KOJ A;  4TVA B;  3GD7 A;  1VQ8 A;  1N32 Q;  3KJP A;  2QEX A;  2Z6K C;  3ZJY C;  1FJG L;  1HNZ L;  2HQL A;  4KLK A;  1XPO A;  4DAY B;  3A0J A;  2D0O A;  5C0X J;  4R4O A;  1QVF A;  5C4X H;  1NTG A;  1KHI A;  1VQP A;  2UUC L;  2WAQ E;  1Q1B A;  3ERS X;  3UDF A;  1SFO H;  4DR5 Q;  4LFC L;  1IL2 A;  2I5H A;  4X65 L;  5BR8 Q;  1YI2 A;  2IX1 A;  3CAM A;  2E5L L;  4A3I H;  5FJ8 G;  4GS3 A;  3RNU A;  2NVT H;  1KD1 C;  4JI3 L;  2KBN A;  5C44 H;  4OX9 Q;  1I6H H;  2NZO A;  4YCW A;  4PMW A;  4X62 L;  4IO9 A;  2CWP A;  2JA6 G;  1TWF H;  3AYH B;  1Q8K A;  2PMZ E;  3U58 A;  3I55 A;  5C0X G;  2Y0S E;  4A3D H;  3T1H Q;  1K8G A;  2F3I A;  3L2P A;  2IHF A;  2YTV A;  3UE0 A;  2DGY A;  2VW9 A;  5AJ3 L;  3GTL H;  1Y1V H;  4YY3 Q;  1Q12 A;  1WFQ A;  2ID0 A;  1YHA A;  1Q82 C;  1YBY A;  4P75 A;  4DPG A;  2VZA A;  5K36 G;  2IY5 B;  5GRO A;  3M9B A;  1M1K C;  4QL5 A;  3HFZ B;  1VQE A;  1C0A A;  1OXX K;  1HZB A;  4BY1 H;  3JC6 6;  3A74 A;  2UU9 Q;  1NBW A;  3ULJ A;  1YJN A;  4BBR H;  3S2D H;  2K5N A;  1U0L A;  3PUZ A;  3I4N H;  3I4M G;  2XTI A;  3BJU A;  4JYA Q;  3BU2 A;  5IYC H;  2ZTE A;  1UE7 A;  2JE6 I;  4LF4 L;  4LF7 Q;  4JI1 Q;  4AYB G;  4X64 L;  3J7A 5;  4JI0 Q;  1FGU A;  3UDG A;  3HOV H;  1TWC H;  1OXU A;  3HOY H;  5IYB G;  4LF5 L;  4OO1 I;  1K9M C;  3PO3 H;  2E8G A;  4R1J A;  5J3B A;  4A3L H;  4B3R L;  2K50 A;  1I50 H;  1P16 A;  1G6P A;  3GO5 A;  4NXN Q;  4UP9 A;  4PZ7 A;  4DR1 L;  4DAM A;  1S3O A;  2OTL A;  3CCL A;  2AWO A;  4P74 A;  2VQF L;  3F8T A;  1VQD A;  4DV7 L;  3CF5 A;  3CCQ A;  1GM5 A;  1OXV A;  2R7Z G;  4O2D A;  2HIX A;  2IX0 A;  5LMU Q;  1XJV A;  1XPR A;  4JCV E;  4DV2 L;  1PH9 A;  1N33 L;  3RLF A;  3H0G G;  4DV6 L;  1YVC A;  3PO2 G;  1EIY B;  3M7N A;  4A3M H;  4JI6 Q;  3KF6 A;  1IBM Q;  2JA8 G;  4A3G H;  4KHP L;  3I4O A;  2LXK A;  4P71 A;  4L5S A;  1QZG A;  5JEA J;  1N36 Q;  1FJG Q;  1EOV A;  1VQJ A;  4RMF A;  4DV1 L;  1B8A A;  2E2I H;  1I5F A;  4C3I H;  4Y7N H;  4X66 L;  2KCT A;  4A3E H;  4A3C H;  1SE8 A;  1PVO A;  3UE1 A;  1KIX A;  4JV5 L;  1B70 B;  1Q46 A;  3TS0 A;  1PA6 A;  4GNX A;  2JK8 A;  5ELN A;  2LSS A;  4GKK L;  2WB1 G;  4A3F H;  5GAE C;  1X6O A;  4IPC A;  4X65 Q;  4GN5 A;  1R9T H;  1IYJ B;  3HOU H;  4K0K L;  3PF5 A;  4LF8 L;  4UY8 C;  2R92 H;  2YV5 A;  3BZC A;  4QGU A;  1CKN A;  1EWI A;  5M5Y H;  5M3F G;  4WJ3 M;  2B63 H;  1QVG A;  4LFB Q;  5JEA G;  1PH5 A;  3MEF A;  1Q1E A;  1WCM G;  1C7Y A;  2UUB Q;  1JJG A;  1BBU A;  3FHW A;  4PZ8 A;  5E7N A;  4DR4 Q;  3J7Z C;  3OW2 A;  2UXB L;  2ZM6 Q;  2R7F A;  1VQA A;  4DUZ L;  1PHJ A;  2D0P A;  2JJQ A;  4GOP C;  4A3K H;  1PH8 A;  4JI5 Q;  1XNR L;  3W1G A;  4JI7 L;  1X3G A;  1VQG A;  4OON A;  1JJC B;  2OQK A;  1MIU A;  5JJK A;  2HHH L;  4BXX H;  4POG A;  2PI2 E;  4MZ9 A;  3KDF A;  3AQQ A;  1E7Z A;  4J15 A;  3CCV A;  2YU9 H;  5JJI A;  5C0X I;  4B3T L;  3Q8D A;  4KHZ A;  4A3J H;  1Y1W H;  4LF4 Q;  4UP7 A;  2VQE L;  1I94 L;  3CCM A;  4R4T A;  1HNW L;  1N9W A;  4MNO A;  3HOZ H;  2UXC L;  4JI8 L;  1L1O C;  1YJ9 A;  1VQK A;  3D31 A;  4BA2 I;  3A5Z B;  5IYD H;  4GNX B;  3FKI G;  3T1Y Q;  1K0R A;  4OWW B;  2BH2 A;  5GQO A;  3G4S A;  2AHO B;  3M4Q A;  2NN6 G;  1YIT A;  3KJO A;  1GKH A;  2AKW B;  2N8N A;  3G6E A;  3GTM H;  2NVX H;  1A0I A;  2JQO A;  4DR1 Q;  1BKB A;  1PV4 A;  1VQB A;  4IJH A;  1ASZ A;  1CKN B;  2PQA A;  4P73 A;  1VQ7 A;  4DR6 Q;  3LGJ A;  4YCV A;  3CC2 A;  3I56 A;  1XMQ Q;  2K14 A;  2VUM H;  2RHQ B;  4JBJ A;  4YHH L;  1J5E L;  1N33 Q;  4JI2 L;  2EIF A;  3FP9 A;  5LMN L;  4O0A A;  4DV2 Q;  2JEA I;  4BA1 I;  4DV6 Q;  4BBS H;  4DR2 L;  1KC8 C;  1E1T A;  4A93 H;  4JOI C;  2Z6K A;  1NJI C;  4KHP Q;  3ER0 A;  1WI5 A;  4GKJ Q;  2UXD Q;  2QGQ A;  2B3G A;  3K7A H;  4LF9 L;  3S15 H;  1H95 A;  4YCU A;  1RL2 A;  4X66 Q;  1VQI A;  3PF4 A;  4AQY Q;  3VDY A;  4QIW E;  2Q2H A;  5C4X G;  4GOP B;  3KDF B;  5ELO A;  1HNX L;  2MO0 A;  4C3H H;  3S14 H;  1E1O A;  5HY6 A;  1EQQ A;  1HZ9 A;  1NMG A;  3S24 A;  4LF6 Q;  5IWA L;  1TWA H;  3GTO H;  4MTN A;  1W3S A;  2Q2U A;  1X3F A;  2YYZ A;  3KYH C;  3A5U A;  4DV3 L;  3K80 C;  2JA6 H;  1EUJ A;  3OTO L;  1LYL A;  2FXQ A;  3F2D A;  1HR0 L;  2CQO A;  1CKO A;  2UXB Q;  1BVS A;  3GTJ H; 
#chains in the Genus database with same CATH topology
 4EGV A;  1B9N A;  1NNX A;  5M3M G;  4Q0F A;  3HG9 A;  2WB1 E;  2IX3 A;  3K58 A;  2L5T A;  2HUG A;  3URY A;  3S1N H;  1K3B C;  2N55 A;  3GV3 A;  4DV0 L;  3K8A A;  5HGQ A;  2YU9 B;  2DNC A;  3CCS A;  1CHP D;  2JA7 B;  4AIM A;  2F0O A;  2I0Q A;  3TS2 A;  4IUP A;  3NEN A;  1EFW A;  3R93 A;  1KXL A;  1IBL Q;  1SBB B;  1V9P A;  1MSH A;  1HR0 W;  1A15 A;  1PYS B;  3U50 C;  2R7Z H;  4OWX B;  4H02 A;  5FLX E;  2CQA A;  4XYQ A;  4KKS A;  4JG2 A;  3J81 c;  1GVP A;  4A3M G;  1K3R A;  2UUC Q;  2AQ2 B;  5CBA E;  1PH1 A;  3ICE A;  3QWN A;  3DUZ A;  2L4N A;  5C4X B;  4LFC Q;  2KOL A;  2CCZ A;  2E5L Q;  4DA2 A;  1SFO B;  4JI3 Q;  4HJ8 A;  2JN4 A;  4A3I B;  3E9I A;  4CJ1 B;  4G4K A;  1WYD A;  3HOU G;  2EYO A;  1SE3 A;  4HCS A;  4DAV A;  1VQ5 A;  2R92 G;  4A3D B;  1QB5 D;  4OX9 L;  2OTJ A;  1EQV A;  3D4R A;  1CUK A;  1GHJ A;  4EQO A;  3GTL B;  4DV4 L;  2EY2 A;  1W6K A;  2VB3 X;  3VR3 A;  3MZ5 A;  1Z7T A;  1C9O A;  3CHB D;  4LUO A;  2M2L A;  4BY1 B;  4IFD J;  3VYS A;  4DK1 A;  1I4X A;  3ULP A;  3NEL A;  2KJX A;  1GUG A;  3I4N B;  4BXX G;  1KAA A;  2N49 A;  3K57 A;  3S1N B;  1TWC B;  3AB9 A;  1P8L A;  4IQZ A;  3ERQ A;  2KCM A;  2OF1 A;  3TP6 A;  2EZV A;  2ASB A;  1EWH A;  2FMM A;  3QOJ A;  3DEP A;  3MEH A;  2EDG A;  1FNW A;  2K75 A;  4GN3 B;  5ISR A;  2X6G A;  5IP7 G;  3PCO B;  1BO0 A;  4NXN L;  4B9X A;  3CC4 A;  3J80 L;  4RH6 A;  3RLN A;  4FF2 A;  5FKA C;  3U4Z A;  4N8F A;  4A3G B;  2OQ0 A;  3F1Z A;  4JV5 Q;  2OCE A;  1QVC A;  2K5W A;  5FK9 C;  1JMC A;  3NQT A;  5TSS A;  3VR2 A;  1IBM L;  4JI6 L;  4TQU S;  1U4L A;  3U9O A;  1KLU D;  3TP5 A;  1R9T B;  3SGI A;  3J80 i;  1FD7 D;  1MD2 D;  1UEA B;  1CT1 D;  3ND9 A;  4C3H G;  4XQN A;  4K14 A;  4IOC A;  3QIA A;  3DM3 A;  2ICI A;  1Q3L A;  3LWE A;  2GVA A;  1Y1V G;  1F2Z A;  3RN2 A;  4POF A;  2F52 A;  1HFN A;  2I5L X;  2UUB L;  2EJG C;  4Y52 H;  1L0Y B;  1XMO L;  5AFW A;  4JBM A;  3P7J A;  4DR4 L;  3J7A F;  4YWM A;  4BY7 G;  2VY3 A;  4JI5 L;  1WTX A;  1GO3 E;  4HSV A;  1I94 Q;  2KHI A;  5DNF A;  4DK6 C;  4NKL A;  2UXC Q;  4PMB A;  5FLX L;  3V96 A;  4GLV B;  1A8V A;  1CZW A;  3HOW G;  3OHX C;  3HOZ B;  4RWS C;  1XPU A;  3G71 A;  3E6Z X;  1EY5 A;  1ROD A;  4KJN A;  2B2U A;  3JAM c;  1QZH A;  3ULL A;  1PZI D;  3GTM B;  2NVX B;  5CV4 A;  1YNJ C;  1HQR D;  1ESF A;  5LMN Q;  1CZG A;  3GP7 A;  5C4H A;  2CVR A;  2K4K A;  1K8M A;  2HD3 A;  3PUW A;  4BBS B;  1VQC A;  4V0B A;  1A3U A;  1EIF A;  4LF9 Q;  5I2Y A;  5I6Y A;  1XMQ L;  1K73 C;  2DUD A;  4ODG A;  1EEF D;  3I2Z A;  4CKC A;  4DGZ A;  2C35 B;  4ABN A;  1ENC A;  1HFG A;  4CJ2 C;  3TDQ A;  1SMX A;  3K0Y A;  3W2D A;  5D3D A;  3HRZ C;  4RCN A;  2XIW A;  2WIN B;  2M9V A;  4DV3 Q;  1TWA B;  1SNO A;  1SXT A;  4FXG C;  3S17 H;  2EY1 A;  5C3W A;  2FHT A;  1I3Q H;  2MPM A;  4KKU A;  2JA5 G;  3PGZ A;  4WRD A;  5L37 A;  4DNR B;  3CC7 A;  1B9M A;  1LUZ A;  1B7Y B;  4S3S A;  1IBK Q;  2ZJQ A;  1LTT D;  3BDL A;  3DLL A;  5COY A;  3CW2 C;  1NR2 A;  3TZU A;  4XTC S;  1YNX A;  4JI1 L;  3PIP 3;  4LF7 L;  3I4M B;  4JI0 L;  4EVO A;  4O42 A;  1II3 A;  3OOC A;  2R6G A;  1RDP D;  2EQS A;  2K5V A;  3B6Y A;  1SLJ A;  2WV6 D;  1BBX C;  1SRO A;  5ELF A;  1TS4 A;  4H7B A;  4NMZ A;  2QA4 A;  1DCZ A;  2KEE A;  1Q86 C;  4YWL A;  2G9D A;  1PFN A;  4Q5V A;  1CTM A;  3H94 A;  4X3S A;  4IPG A;  4KHV A;  1YHB A;  2FJ2 A;  4OXP A;  1IBL L;  2A6H D;  1ONL A;  4A3B B;  3EJI A;  2WAC A;  1PTO D;  2F03 A;  4DAY B;  2D0O A;  5C0X J;  3FPP A;  1QVF A;  3Q24 A;  1KHI A;  5ELB A;  2UUC L;  1Q1B A;  3T56 B;  4DR5 Q;  4LFC L;  2E5L L;  2WB1 B;  1PDQ A;  1KD1 C;  4JI3 L;  1I6H H;  2NZO A;  4PMW A;  1Q8K A;  2KUM A;  1K8G A;  1WCM B;  3VYT A;  2YTV A;  4CGY B;  2DGY A;  1Q12 A;  1WFQ A;  2ID0 A;  3NWS A;  4R8I A;  1D6E C;  2XVS A;  4CJ0 B;  2Z9H A;  3I90 A;  1M1K C;  1E0B A;  2MUY A;  4RGO S;  3TZD A;  2UU9 Q;  1NBW A;  3S2D H;  5IYC H;  4FXD A;  2B2Y C;  2EE1 A;  5IGG A;  3J7A 5;  5IYB G;  4JK1 C;  2K05 A;  3OSO A;  3PO3 H;  4CDE C;  3RZO B;  1PZJ D;  3FKI B;  4PV1 C;  4FVM A;  1I50 H;  4PZ7 A;  4DAM A;  1S3O A;  4PNY A;  5HGT A;  3PO2 B;  1VQD A;  4K8J A;  3SK6 A;  3CF5 A;  2K28 A;  3OMG A;  2R7Z G;  2E2H B;  2SDF A;  4IFD I;  4OIJ A;  1PH9 A;  3TN2 A;  3D8G A;  4A3M H;  2KQ3 A;  3I4O A;  1B3Q A;  1JE4 A;  5JEA J;  1N36 Q;  1VQJ A;  2E2I H;  4KTA A;  3NTK A;  4C3I H;  4Y7N H;  4A3E H;  2A6H C;  4JV5 L;  1S5B D;  1PTO C;  4OL7 A;  5ELN A;  3IKJ A;  1X6O A;  4G7O C;  4X65 Q;  3HOU H;  3SEB A;  3PF5 A;  1ICF B;  4LAA A;  1A6X A;  2R92 H;  1CKN A;  5M5Y H;  1EY6 A;  1Q1E A;  1DYQ A;  1SNQ A;  2LS0 1;  1PTO F;  2A6E D;  4DAY A;  5J22 A;  2UXB L;  3BYY B;  1PHJ A;  1WTQ A;  2D0P A;  2JJQ A;  4GOP C;  1PH8 A;  3W1G A;  1X3G A;  1VQG A;  1JJC B;  4KY7 A;  4BXX H;  5M3M B;  5G3L D;  4POG A;  2EYF A;  3Q22 A;  1IL8 A;  4B3T L;  3Q8D A;  3MTS A;  4UP7 A;  1I94 L;  1ZXT A;  4R4T A;  3CCM A;  3J81 L;  4MNO A;  2UXC L;  1L1O C;  2EYJ A;  5IYD H;  3D31 A;  1HRJ A;  4GNX B;  3T1Y Q;  1K0R A;  1JR0 D;  3I72 A;  1T5X D;  2CH4 A;  1LTG D;  3KJO A;  1GKH A;  1VF5 C;  2L0C A;  1BKB A;  2JSO A;  4IJH A;  2PQA A;  3H0G B;  4DR6 Q;  4YCV A;  2PYK A;  2FIN B;  2K14 A;  3NSW A;  2F0U A;  1N33 Q;  4C3J G;  4RCO A;  5LMN L;  5I2X A;  1JC7 A;  3I8Z A;  4A93 H;  4JOI C;  1NJI C;  2RQX A;  3ER0 A;  2RSO A;  4LF9 L;  1Y69 U;  3OMC A;  4AQY Q;  3MXG A;  4QIW E;  3ZYY X;  2P5Z X;  5ELO A;  1HNX L;  4XT1 B;  4C3H H;  2CHB D;  3WDN A;  5M3F B;  3S14 H;  5DEH A;  4N9P A;  5C4J B;  1HZ9 A;  3GTO H;  3NPP A;  3KUP A;  1I4H A;  1X3F A;  4RAU C;  3A5U A;  3KLS A;  4DV3 L;  2JA6 H;  3MXP A;  1RCV D;  1LYL A;  3F2D A;  1SYE A;  5C0X H;  3OWE B;  5I9O A;  5JVH 3;  2A6E C;  2EXD A;  3GTQ B;  2K32 A;  1JOR A;  4BY7 H;  4HJ9 A;  2ZTD A;  3HKS A;  1OXS C;  1DD2 A;  5K36 H;  3D0F A;  4HTH A;  4RHS A;  2NVY B;  5H1S E;  2K5Q A;  1VS0 A;  2AQ3 B;  4UP8 A;  1JWU D;  4B9W A;  4BBR G;  1IBK L;  5CR3 A;  3HOW H;  3A54 A;  3CQZ H;  5KEE A;  2IPK D;  3M3Y H;  5IIF A;  4YWK A;  1SDF A;  1CHQ D;  2EPB A;  4IZ8 A;  3SHL A;  1Z47 A;  1N34 Q;  5G3L F;  1E3P A;  1BBW A;  4IN3 A;  3WOE A;  1V1P B;  2WAQ G;  5IGF A;  1EY0 A;  1HXY D;  3M85 A;  2F0D A;  4BS9 A;  2F3V A;  4IPD A;  1TWH H;  2KHJ A;  1MKH A;  3RNU A;  4TRD A;  4X3K A;  1PFB A;  1WTP A;  1DGS A;  3NEM A;  3NHH A;  4DU9 A;  1H9J A;  1SYD A;  3HP3 A;  1F77 A;  4KN4 C;  1YNN D;  4HED A;  3CCR A;  1EFI D;  1G6Z A;  2ZJR A;  2NVT B;  1WTH A;  4R4I A;  4QUF A;  3J81 j;  1STA A;  2BCO A;  4DR5 L;  1TVX A;  4MIU A;  1KNE A;  5AJ3 Q;  3T4A C;  5JJZ A;  4DF7 A;  3OPO A;  1MJC A;  2JA5 H;  1Y1V B;  3OTO Q;  3KF8 A;  5J1Z A;  1E2V A;  2MO1 A;  4PZ6 A;  3AFP A;  2C5C A;  2RCF A;  3Q6S A;  4KY6 A;  5IGE A;  4GZY C;  3S1R H;  1RTN A;  4A3K G;  1CA5 A;  1XNQ Q;  2QKI C;  1OXT A;  1UE1 A;  1BQQ T;  2NTT A;  1XXG A;  2O4X A;  2PZU A;  3HOV B;  1YZ6 A;  1AE3 A;  1CKM A;  4UHV A;  3G7L A;  1Y1W G;  3HOW B;  3S1Q H;  4WOR A;  2QCP X;  5EBD A;  4FNF A;  1VQF A;  2OEO A;  3F2C A;  4IFD G;  5ELC A;  1KLG D;  2GN5 A;  2VQF Q;  2F0V A;  5ELE A;  4WJW A;  5M5X H;  1G29 1;  2ZXO A;  4AYB E;  1L2F A;  3D6W A;  2J7Z A;  2VL6 A;  3A7L A;  5KYL A;  4GLX A;  3UI2 A;  2XWJ B;  2HT1 A;  4B3M L;  4NXM Q;  2J0T D;  2PPB C;  1JOK A;  1SNM A;  4C1N I;  3NK9 A;  2B8F A;  3SR1 A;  1WD0 A;  1U5K A;  1GUT A;  2B2W A;  3IFT A;  1N36 L;  4LF8 Q;  3J80 E;  4YIJ A;  3HKZ G;  4A4I A;  3CCU A;  1N8R C;  1EY8 A;  3TSS A;  2MFI A;  3FPU B;  1YNN C;  2B63 B;  1CK1 A;  3RR5 A;  1RKN A;  1CQV A;  1XX8 A;  4K5X A;  1M90 C;  2Q8I B;  4DUZ Q;  2R61 A;  5E4W C;  4LW1 A;  4BWG B;  5JPN C;  4JVZ A;  1VCI A;  2HDM A;  2HHH Q;  5LL6 X;  1B53 A;  3ND8 A;  3K5O A;  2B29 A;  2F0K A;  5IYC G;  1JJ2 A;  4ZUJ A;  3SDZ A;  4ZLT F;  3EQL C;  1NAP A;  1EYG A;  3K0X A;  1ET6 A;  1PLF A;  2PI2 A;  4IJL A;  3OIQ A;  1KQS A;  4IUT A;  5IYB H;  3PO3 G;  1QJO A;  5M5W H;  2WFW A;  3MA2 B;  5CC4 A;  3PUY A;  2DNE A;  3C1F A;  3H15 A;  1D5M C;  2MHV A;  2EY6 A;  5KND A;  3T1Y L;  5IT9 E;  5IP9 G;  1STN A;  1LT5 D;  4X3U A;  3GTG H;  3LX0 A;  2E76 C;  2ZTC A;  1HA5 A;  4NW2 A;  2IJ0 A;  3E3X A;  1GD7 A;  1TWG H;  3UDX A;  4E6I A;  4DR6 L;  1NR4 A;  2SNS A;  1HCZ A;  4C3I G;  4A3E G;  4L6T B;  2RBM A;  3AEV A;  3S15 B;  1S4Z A;  1JB3 A;  3QOL A;  1EQR A;  2N78 A;  3S9W A;  2QDL A;  4NP5 A;  3EVQ A;  4KKT A;  5C3E H;  2BE5 D;  5BN5 A;  4AQY L;  4A76 A;  3EFX D;  5EPJ A;  4EX5 A;  1FYC A;  5JJL A;  2Z0S A;  1H9M A;  1HR0 Q;  2NVQ H;  2ENB A;  5C5L A;  4KMU C;  1SAP A;  4LFA Q;  1PH3 A;  1VQH A;  3GTJ B;  4RG1 A;  5JAV A;  5EKI A;  5FO8 B;  3HS0 C;  4HMJ A;  1AH9 A;  2K03 A;  4LNQ A;  4LWC A;  1BOS A;  3HKZ E;  2H5X A;  2ICE C;  1MGS A;  3NTH A;  1GHK A;  3W3A A;  2H4O A;  3RD4 A;  1I6V C;  2RDF A;  4QUC A;  3WOF A;  4ZAI A;  5IYD G;  2BA1 A;  4XXE A;  4UPA A;  3HOX H;  5M9O A;  4PG3 A;  4ZUI A;  1C4Q A;  3VA5 A;  4HID A;  3MVV A;  2V1C C;  1JIC A;  2V4D A;  4X3T A;  4N8X 1;  2XRS D;  5BN3 A;  4QIW B;  4DUY Q;  3I73 A;  5CMD A;  5I6W A;  4C3J H;  1STB A;  3NBI A;  1N34 L;  4CDC C;  1PFM A;  1AE2 A;  1STE A;  3CPW A;  1VMP A;  2R7Z B;  4A93 G;  3KOJ A;  4TVA B;  2O5J C;  2KVM A;  1N32 Q;  3ZJY C;  3A55 A;  3DHQ A;  1XPO A;  3A0J A;  4R4O A;  1AFP A;  1VQP A;  2HDL A;  4M1U B;  2I5H A;  1YI2 A;  3BG3 A;  3CAM A;  5C44 H;  3P1H A;  3T13 A;  2MJ8 A;  4RGT A;  1C8C A;  2JA6 G;  1TWF H;  2BE5 C;  1EL0 A;  2PMZ E;  5C0X G;  2B2V C;  4L8J A;  3T1H Q;  4K2K A;  3L2P A;  2IHF A;  5AJ3 L;  1SJH D;  4YY3 Q;  2DJF C;  1PXU A;  1YHA A;  4P75 A;  5K36 G;  1PRT B;  2IY5 B;  5GRO A;  1BF4 A;  2JYO A;  2D9U A;  5IT9 L;  4ZCK A;  1C0A A;  1HZB A;  3JC6 6;  2SOB A;  3A74 A;  2L12 A;  4BBR H;  1EU4 A;  3PUZ A;  4F88 A;  4JYA Q;  1F9R A;  4LF4 L;  1ET9 A;  3Q23 A;  2BOS A;  3SXH A;  3HOY H;  4OO1 I;  5FOB B;  3BS1 A;  3K5N A;  2E8G A;  1MBY A;  5J3B A;  1VMC A;  3VA7 A;  4A3L H;  1I4R A;  1PTO H;  2NUC A;  1QNK A;  2AWO A;  4P74 A;  2VQF L;  3A8J E;  1EY4 A;  3CCQ A;  2HIX A;  1XJV A;  2E75 C;  4JCV E;  2A5H A;  4KV6 A;  4DV2 L;  1YVC A;  4ILW A;  1EIY B;  4P71 A;  4L5S A;  1QZG A;  1FJG Q;  4RMF A;  1I5F A;  4X66 L;  2KCT A;  1PVO A;  3UE1 A;  1Q46 A;  1V8Q A;  1PA6 A;  2LSS A;  5GAE C;  3BDC A;  2WII B;  4GN5 A;  4KJO A;  5J39 A;  4LF8 L;  4UY8 C;  4L63 B;  3IAY A;  2EYH A;  2YV5 A;  4QGU A;  3KLR A;  1D5X C;  2L9H A;  4WJ3 M;  4LFB Q;  3T51 B;  5JEA G;  4CKE A;  3TP8 A;  1BBU A;  4PZ8 A;  3J7Z C;  1LT6 D;  2G9H D;  4J1M A;  2R7F A;  4DUZ L;  5A35 A;  3D4D A;  4A3K H;  3N52 A;  2WKC A;  1BR9 A;  2MGS A;  1MHW C;  2OQK A;  3MFG A;  4K5W A;  2HHH L;  1O7Z A;  2PI2 E;  3U9S A;  3KDF A;  1E7Z A;  4AYB B;  5T1G A;  2BDO A;  3CCV A;  1ZYR D;  4NDX A;  2SEB D;  4KHZ A;  4A3J H;  1Y1W H;  1A2U A;  4IFD H;  4BA2 I;  1U4R A;  4HMI A;  2K7V A;  1V1O A;  2RDH A;  2AKW B;  2N8N A;  3G6E A;  3TP7 A;  2JQO A;  4DR1 Q;  1ASZ A;  5KGU A;  1CKN B;  2GA4 B;  3R2I A;  3J81 E;  2WAQ B;  2VUM H;  3NP8 A;  4BA1 I;  4DV6 Q;  1ML0 D;  4FXK C;  3I70 A;  1E1T A;  2M00 A;  4KHP Q;  2LMC B;  4GKJ Q;  1NCV A;  2UXD Q;  3K7A H;  3MXU A;  1VQI A;  4UDU C;  5C4X G;  4CDF C;  4GOP B;  1NUC A;  2FFK B;  5C6A A;  2X69 A;  5DM7 3;  1EQQ A;  1NMG A;  3S17 B;  4FP5 D;  3S24 A;  1K0S A;  4MTN A;  1I3Q B;  2YYZ A;  4EQP A;  1EEI D;  3SE0 A;  1DM0 B;  1HR0 L;  4K6D A;  3MXN A;  4TSS A;  2L55 A;  1F2M A;  1WJJ A;  4LFA L;  2PQA B;  2KED A;  4RHR A;  3MWY W;  4G57 A;  3RMH A;  1LT3 D;  1J6Q A;  3EBE A;  1E2W A;  1C48 A;  4NPS A;  1CSQ A;  2D62 A;  2B2Y A;  1O78 A;  1H9S A;  3KBX A;  1SN8 A;  3OWF A;  3F2B A;  2RCN A;  4HJA A;  3CU7 A;  1HNW Q;  4DR3 Q;  1ZYR C;  4JI4 Q;  4RFB A;  5EKL A;  3U4V A;  5KNC A;  1FNU A;  2SNM A;  1E2Z A;  1IZ6 A;  5IP9 H;  3DEO A;  3H09 A;  1Y8O B;  1U4P A;  5ELD A;  2Q8R E;  3I4L A;  4DUY L;  1OO9 B;  5EGT A;  2BA0 A;  2F1M A;  3VR6 A;  2A73 B;  2JA9 A;  4M8A A;  2GVB A;  1B4O A;  2B2T C;  4IUN A;  3NWT A;  4A3G G;  2JA8 H;  2HQE A;  1RJT A;  4IUV A;  2XWB B;  1GUO A;  1N32 L;  2F0L A;  4L5T A;  5C3E G;  1STY A;  2YTX A;  4X62 Q;  3HKZ B;  1I6H B;  1FGB D;  3X3M A;  1SYF A;  2K5D A;  1HTL D;  1DON A;  1SYG A;  4KD3 A;  4C2M H;  1SNP A;  3J80 c;  2F0G A;  1MI2 A;  1LO5 D;  3EA6 A;  1Q81 C;  5E4X A;  3T1H L;  3CXC A;  2QIL A;  4GOP A;  1HTP A;  3BDO A;  4QQB X;  1EU3 A;  1IKL A;  1E22 A;  3M7G A;  2JEB I;  1D8L A;  1VQO A;  2EYL A;  3V2T A;  3S2D B;  1SEB D;  5D65 A;  1W6J A;  3GTP H;  2A19 A;  1PYW D;  2VS1 A;  4LF5 Q;  3E9H A;  1QUQ B;  3SK8 A;  1B50 A;  3HOX G;  1VQ9 A;  1ZEQ X;  3PO3 B;  2EYM A;  3TQY A;  4B3R Q;  1TKW B;  3CPF A;  1L1O A;  2DY7 A;  3UDI A;  5GAH C;  3H3V I;  3HOZ G;  3P20 A;  1I50 B;  3GTK H;  1IYV A;  1IW7 D;  1SMY D;  2A8V A;  5EAY A;  3L0O A;  3J81 i;  4F87 A;  4MTK A;  2VXW A;  2HIV A;  4WJ4 A;  4JBK A;  1JE5 A;  1PH4 A;  3IL8 A;  4A3M B;  4DV1 Q;  4DR7 Q;  1V43 A;  5GAD C;  4B08 A;  2PMZ B;  3KF8 B;  4HJ7 A;  4JOI A;  4BBS G;  2E2I B;  4Y7N B;  4C3I B;  4A3E B;  3RUZ A;  3ERO A;  3H91 A;  1PZK D;  5FLX c;  3AMU A;  1H9K A;  4LJZ C;  3A8I E;  4K0K Q;  3KBG A;  4R4Q A;  1UE5 A;  1WTW A;  5C44 G;  1DOM A;  1UE6 A;  3HOU B;  1KAW A;  1Y8P B;  4ME5 A;  1G8Z D;  4P2C B;  2R92 B;  4EQ5 A;  3OYY A;  4JBW A;  1LM0 A;  2I5M X;  1TT2 A;  5M5Y B;  1KL9 A;  5BN4 A;  1HZA A;  2Q8T A;  5CGK A;  2EVB A;  2CFM A;  1XNR Q;  2WKD A;  4LFB L;  3CCJ A;  1TII D;  1Z9F A;  4DV4 Q;  4HIO A;  1SR3 A;  1LTS D;  1SRU A;  1Y14 B;  1BDO A;  4EQN A;  1EZ8 A;  1A62 A;  3M4O H;  3FEW X;  3DXJ C;  1W2B A;  1NY4 A;  3S1M H;  3PSI A;  2EOT A;  4XYO A;  1QE6 A;  4JI8 Q;  1QIL A;  3I3C A;  3HOY G;  4FDB A;  3CME A;  2XRQ D;  1HUM A;  1LV9 A;  1CFM A;  2AQ1 B;  2Q2I A;  1VQL A;  4A3L G;  2ZJP A;  2A69 D;  1EZ6 A;  1K83 H;  3H6M A;  2K04 A;  1EYA A;  5FLM H;  5T1I A;  1XTD A;  3AFQ A;  1BUV T;  1X32 A;  4I65 A;  4YHH Q;  3QO2 A;  3GTK B;  2F0N A;  3H3V C;  4HJ5 A;  1DZ1 A;  2L1B A;  3VR4 A;  1ENF A;  1CA6 A;  1QUQ A;  1IW7 C;  1SMY C;  2IW3 A;  1QOH A;  5JPM C;  1BCP B;  4A93 B;  2Y0S G;  2F0M A;  1PFS A;  1B3A A;  4JC0 A;  2CH4 W;  3R8B A;  5GAG C;  1YJW A;  3G48 A;  4ZRZ A;  4ZYS A;  4A3B G;  3DWQ A;  2KCC A;  1RIP A;  1EWC A;  4KD4 A;  1JB7 A;  4GNX C;  4PMC A;  4GKJ L;  4IOA A;  1AEX A;  4C3H B;  1S40 A;  2UXD L;  3S14 B;  5IWA Q;  1KDC A;  1Z6H A;  1D1K A;  3K7U C;  2DY8 A;  2R93 H;  5EPL A;  5JEA H;  3GTO B;  2N3S A;  2JP1 A;  3DWP A;  1K8O A;  1TS2 A;  4KN7 C;  4FO2 A;  3JAM L;  2JA6 B;  3TBI B;  2X6L A;  1MSG A;  2YTY A;  4QF4 A;  4QY7 A;  1RD9 D;  5A2Q L;  3VYU A;  3PQI A;  2E2J H;  1Y8N B;  4LUV A;  1X3Q A;  1U4M A;  1XMO Q;  3I91 A;  4BY7 B;  3S16 H;  2F4V Q;  1FVI A;  2PZT A;  3WWV A;  3SVM A;  2UU9 L;  2PZW A;  4LK1 C;  1PH2 A;  1J9O A;  1X3E A;  3K81 C;  5COR A;  3JAM i;  1UEB A;  3LWU A;  3W5O A;  4A3J G;  3FMC A;  1VQN A;  3M4O B;  3CQZ B;  3M3Y B;  2PW7 A;  4DV5 Q;  1F9P A;  4KI0 A;  2KHS A;  4MN3 A;  3KF6 B;  2UUA Q;  2K6A A;  2LY7 A;  1VQM A;  1YIJ A;  3KFU A;  5IOD A;  2JA7 H;  4DR3 L;  1ENA A;  4JI4 L;  1VQ6 A;  3FDT A;  2LKV A;  2F0S A;  2VUM G;  4RKB A;  2Q2T A;  2NB0 A;  3O13 A;  1D7Q A;  3FVQ A;  4K5V A;  2ZXP A;  1TWH B;  2O5I C;  1NSN S;  1SYB A;  2Z6K C;  2HQL A;  2KCN A;  4UAI A;  5C4X H;  1NTG A;  1A3T A;  2WAQ E;  4Z9C B;  1RF2 D;  3ERS X;  3UDF A;  1SFO H;  1G2T A;  2KEC A;  5BR8 Q;  4X65 L;  4A3I H;  5FJ8 G;  1JQY D;  4YCW A;  1SE4 A;  4X62 L;  3MAQ A;  4IO9 A;  2CWP A;  1EIH A;  1UNS A;  3I55 A;  2JA5 B;  2Y0S E;  4A3D H;  5D14 A;  2F3I A;  4HSP A;  3UE0 A;  3GTL H;  2QW7 A;  4OEL B;  1LAB A;  1M8A A;  1Q82 C;  5EPK A;  3S1R B;  3M9B A;  1KAB A;  4QL5 A;  3A7A B;  3K6O A;  1XTC D;  1OXX K;  4BY1 H;  3ULJ A;  2K5N A;  4ZQ3 A;  1QWY A;  3I4N H;  2XTI A;  3BU2 A;  3NTI A;  1UE7 A;  2JE6 I;  4LF7 Q;  4JI1 Q;  3M4Y A;  4JI0 Q;  1FGU A;  3UDG A;  1RHP A;  1BCP F;  1OXU A;  1TWC H;  3S1Q B;  1UAP A;  4LF5 L;  1K9M C;  1SND A;  5CV9 A;  2D5D A;  3DWA A;  4B3R L;  5M5X B;  3MHB A;  1G91 A;  1G6P A;  3GO5 A;  4J6H A;  4UP9 A;  1KDB A;  3CCL A;  1LTI D;  3GTJ H;  1OXV A;  4O2D A;  5LMU Q;  2IX0 A;  1N33 L;  3RLF A;  3H0G G;  1LTR D;  3LNN A;  3KF6 A;  2JA8 G;  2F0W A;  4A3G H;  3DMU A;  2JEA I;  1EOV A;  4DV1 L;  4DR7 L;  1B8A A;  1WTO A;  2TMP A;  1SE8 A;  4A3C H;  1B70 B;  5CBE E;  2BDN A;  2A74 C;  4IPC A;  1R9T H;  2K33 A;  4K0K L;  1QCB D;  1HUN A;  1A3V A;  4G7Z C;  1M4V A;  3BZC A;  1EWI A;  5M3F G;  1QVG A;  1TS5 A;  4R8N A;  1JJG A;  4K8I A;  4DXF A;  3FHW A;  3C1E A;  1WD1 A;  2D2C C;  5E7N A;  2ZM6 Q;  1VQA A;  2KA7 A;  1XNR L;  2F4I A;  4OO1 H;  5JJK A;  3VR5 A;  4DAP A;  3AQQ A;  3QB3 A;  4J15 A;  3J7A V;  5JJI A;  3D3R A;  1O80 A;  4C1N K;  2I46 A;  4XT3 B;  1AW7 A;  5M5W B;  1CI3 M;  1N9W A;  3HOZ H;  3QG1 A;  4JI8 L;  3A5Z B;  3NQI A;  1EYD A;  2QDB A;  2BH2 A;  3G4S A;  1YNJ D;  3GTM H;  2NVX H;  1A0I A;  3GTG B;  1VQB A;  1VQ7 A;  4P73 A;  1S5D D;  1TWG B;  3K5M A;  4JBJ A;  4YHH L;  3HZX A;  2PO4 A;  3FP9 A;  2OXP A;  4BBS H;  3L3O C;  3A56 A;  3HGB A;  1WI5 A;  5LL6 S;  2B3G A;  3K59 A;  3PF4 A;  3VDY A;  1F2Y A;  5C3E B;  3KDF B;  2RSN A;  2J4X A;  2MO0 A;  4R9W A;  1E1O A;  5HY6 A;  1U9R A;  3CKI B;  1EY9 A;  1AP0 A;  4LF6 Q;  5IWA L;  1TWA H;  2NVQ B;  1D2B A;  1W3S A;  2Q2U A;  1SSO A;  5JVG 3;  5LHY 1;  2RA4 A;  2B2V A;  3K80 C;  2DN8 A;  3OTO L;  2A68 D;  2FXQ A;  2CQO A;  4DN4 M;  1CKO A;  2UXB Q;  1BVS A;  3X3N A;  1AZP A;  3T53 B;  2E74 C;  1HJP A;  1XNQ L;  5LMN W;  1KRS A;  4B3S Q;  3M4P A;  3FRP B;  4XIG S;  2F0I A;  2LFN A;  2F4V L;  2NZH A;  1TU2 B;  4DNI A;  2F0E A;  4B3T Q;  3I4M H;  1FL0 A;  1X3P A;  3HOX B;  2Z4I A;  5CV5 A;  3HOV G;  3BVZ A;  2ALY B;  1PRT D;  2DJG C;  5FLM G;  2B2U C;  4DNT B;  4DV5 L;  3D6C A;  2UUA L;  2JXM B;  2B8G A;  1UWV A;  4FYD A;  4DK3 C;  4ZKC B;  5IE8 A;  2RF4 A;  1R4P B;  4GLA C;  4C3J B;  4HAE A;  1PH7 A;  1X65 A;  2PNH A;  1HNZ Q;  4NXM L;  4ID6 A;  2OWO A;  4F8M A;  2F0P A;  4OWT B;  2MQH A;  2HCI A;  5DLQ E;  3STB D;  3MXN B;  1Q7Y C;  1YHQ A;  4A3B H;  1UUP A;  1CQF A;  4QCL A;  2ES2 A;  1TY0 A;  1VF7 A;  3E5S A;  5KYI A;  1PYB A;  5IGB A;  5K5P A;  2R93 G;  1HNX Q;  3I7F A;  1JWS D;  5C44 B;  4A3F G;  4APV A;  1H9S B;  1TWF B;  5BR8 L;  3BZK A;  1X56 A;  2NYZ D;  1BNZ A;  3W1B A;  2B63 G;  1TY2 A;  1Q8I A;  1L0X B;  1WCM H;  1EYC A;  3GV6 A;  2Z4H A;  1KRT A;  1WVL A;  1LTL A;  2XSC A;  3D4W A;  2A68 C;  2C9O A;  5C5M A;  2Z8L A;  1JT8 A;  4OGQ C;  3CD6 A;  4BBR B;  1JOQ A;  1CSP A;  5IOC A;  4X64 Q;  1XYI A;  3PUX A;  4ZKB B;  5EQ0 A;  3GQB A;  2PW5 A;  2H1E A;  2L15 A;  4P72 A;  1JOO A;  1S72 A;  3HOY B;  2IHE A;  1L0W A;  2JA7 G;  1O7Y A;  1D1I A;  1PTO B;  3RZO H;  2ZXR A;  3FKI H;  4DV7 Q;  2B39 A;  1F9S A;  3DM1 A;  1PRT C;  2AUK A;  3OIP A;  1G51 A;  1ZKO A;  4H44 C;  4U67 3;  2NN6 H;  1NMF A;  2OT2 A;  4LMQ D;  3V05 A;  1TR5 A;  3PO2 H;  2K52 A;  4WFN 3;  3BVM A;  1T5E A;  2MP1 A;  2E2H H;  4HN7 A;  1HZC A;  1GUS A;  1PH6 A;  4J8Q A;  2K5H A;  3KK7 A;  5LMU L;  2Y0S B;  1PRT F;  1F2L A;  5DM6 3;  4GKK Q;  2XGT A;  4KY5 A;  2FMC A;  4QJF A;  4NB3 A;  3STB C;  2WP8 J;  4A3I G;  2PQE A;  5FJ8 H;  2LXJ A;  3EIV A;  3KLS X;  5FO9 B;  4ME3 A;  2G5D A;  3RLO A;  1HA6 A;  2IT1 A;  2VB2 X;  4IUU A;  4RGN A;  4A3D G;  3KLW A;  4CBV A;  4HIM A;  1S5C D;  2RHS B;  1L1O B;  4ALP A;  1R4Q B;  4JI7 Q;  2CKZ B;  2PNR C;  1O7I A;  4A3K B;  1K8A C;  1Q90 A;  3L7Z C;  4XDX A;  4BY1 G;  1BXT A;  2ZM6 L;  2CWA A;  3MFY A;  1SNC A;  3CP0 A;  3H3V H;  3I4N G;  3TRE A;  4JW0 A;  1MJE A;  3CCE A;  5M3M H;  2BH8 A;  5E1F A;  2VQE Q;  3PIP A;  2AWN A;  3EN2 A;  4A3J B;  1Y1W B;  3NUC A;  4XQJ A;  1STH A;  1X55 A;  2KEN A;  4ZK9 B;  1GUN A;  3ONA B;  3S2H H;  1KDA A;  4DKA C;  2NTS A;  1T9H A;  3QJY A;  2A1A A;  5KRU A;  4PQX A;  1YEZ A;  1DXM A;  2CW0 D;  1TQO A;  2F0Q A;  5DAU A;  5IGD A;  1J5E Q;  3C3L A;  4JI2 Q;  3PIO 3;  1HH2 P;  2PCF B;  1HQM C;  3H0G H;  3SK4 A;  4DR2 Q;  2VUM B;  2N88 A;  3CMA A;  1V1Q A;  4IPH A;  3N6R A;  2VNU D;  4B3M Q;  2NN6 I;  4X6A H;  3IRB A;  2TSS A;  3TME A;  4A3C G;  3RN5 A;  2B2T A;  1CM9 A;  3K7A B;  1X54 A;  5CV6 A;  1F9Q A;  2MNA A;  4K6L A;  4TKO B;  2F0F A;  1QG7 A;  1WOC A;  3GDE A;  1A63 A;  1LTA D;  1H9R A;  2AMC B;  2E2D C;  5C3X A;  5M3F H;  3C2P A;  4FF4 A;  4R4C A;  5FO7 B;  1ASY A;  5C4J H;  3TRZ A;  1FR3 A;  1X9N A;  3SK5 A;  4LF6 L;  3RZD H;  4YY3 L;  1SE2 A;  4V19 0;  4FF3 A;  4OO1 G;  2Z6B A;  4DFA A;  4QB4 A;  1A2T A;  3NBH B;  1VQ4 A;  3R3O A;  1B44 D;  4U68 A;  3QR8 A;  3GTQ H;  4F7X A;  5IGC A;  1GXD C;  1OTC A;  4FF1 A;  1NE3 A;  4L5Q A;  3JAM E;  4DV0 Q;  1EOT A;  3AU7 A;  1IHZ A;  4JYA L;  2NVY H;  4L5R C;  1B1Z A;  4B3S L;  3CRL C;  5A2Q E;  4IUR A;  5EKK A;  1TXY A;  1EY7 A;  1ICW A;  2AUJ D;  2RVL A;  4HIK A;  1JCK B;  3PIO A;  2RKS A;  2I07 B;  2R7D A;  3TEH B;  3PMF A;  4AH6 A;  4LUZ A;  3S2H B;  3PUV A;  2NWG A;  2ATW A;  5IY0 A;  5KNB A;  1IXR A;  2XN9 C;  1DOK A;  5IP7 H;  4ULL A;  1E24 A;  2CW0 C;  3PV0 A;  4GN4 B;  3E0E A;  2QEJ C;  5IT9 c;  4A75 A;  3GD7 A;  1VQ8 A;  1VDZ A;  3KJP A;  2QEX A;  1FJG L;  5HUR A;  1HNZ L;  2JA8 B;  4KLK A;  1XWE A;  1LAC A;  1IL2 A;  2HCC A;  2IX1 A;  1K28 A;  1QNU A;  3T16 A;  1J8I A;  2F3W A;  4GS3 A;  2NVT H;  4XQQ A;  2KBN A;  4OX9 Q;  1WTR A;  4IAL A;  2EXZ A;  3BVG A;  2NBF A;  3AYH B;  3U58 A;  4C56 C;  4C2M B;  1KNA A;  1HPC A;  2VW9 A;  5E3F A;  1Y1V H;  1KTK A;  3MC0 B;  4N9T A;  3RZD B;  1YBY A;  4DPG A;  2VZA A;  3HFZ B;  4QMG A;  1TS3 A;  1VQE A;  3NE5 B;  4HR7 B;  2IL8 A;  2EJM A;  1YJN A;  3GTP B;  1U0L A;  3I4M G;  4RGM A;  3BJU A;  2ZTE A;  4H13 C;  3NXW A;  4AYB G;  4X64 L;  3HOV H;  1SJE D;  2F0H A;  4IUQ A;  5I4D A;  1GUW A;  1LT4 D;  3NBH A;  4R1J A;  1ILQ A;  2K50 A;  4DK0 A;  1P16 A;  3HEJ A;  3J7Y W;  4NXN Q;  3P75 A;  4O1N A;  4DR1 L;  2OTL A;  3F8T A;  5I9P A;  5CYU A;  4DV7 L;  1DOL A;  1GM5 A;  1XPR A;  5EJW A;  4DV6 L;  2ZT9 C;  3BZD B;  3M7N A;  4JI6 Q;  1IBM Q;  1RTO A;  4KHP L;  4OHJ A;  2LXK A;  1GJX A;  3ITP A;  3OW7 A;  5F2D A;  1KIX A;  3TS0 A;  4MHE A;  4GNX A;  4K2L A;  2JK8 A;  4RA8 A;  3E0J A;  4GKK L;  1ILP A;  2WB1 G;  2NZ1 D;  4A3F H;  1O7L A;  1IYJ B;  3R2T A;  4I7A A;  1BCP D;  2B63 H;  2IWH A;  1PH5 A;  3MEF A;  3F2U A;  1PMR A;  1WCM G;  2XNA C;  3Q0A A;  1C7Y A;  2UUB Q;  4DR4 Q;  3OW2 A;  1AZQ A;  1ESR A;  1STG A;  4JI5 Q;  4JI7 L;  1JWM D;  4OON A;  1I4G A;  4G7H C;  1MIU A;  5CV8 A;  4OIK A;  4MZ9 A;  2EYP A;  3S1M B;  1DJR D;  4JPB W;  4HCE A;  5EBC A;  2YU9 H;  5C0X I;  3K5L A;  1GOZ A;  1SYC A;  4LF4 Q;  5CV7 A;  2VQE L;  4CHT B;  1HNW L;  3L9A X;  1AN8 A;  2EJF C;  1YJ9 A;  1K83 B;  1VQK A;  2A69 C;  3FKI G;  5JOB A;  4OWW B;  2K1B A;  1S5F D;  1B2T A;  3BYT B;  2O2L D;  5GQO A;  2AHO B;  3CRK C;  2NN6 G;  3M4Q A;  1YIT A;  4H0L C;  2R3Z A;  1PV4 A;  3PO2 G;  5NUC A;  1S5E D;  2RDG A;  4CKB A;  3LGJ A;  3CC2 A;  3I56 A;  2EY5 A;  1I4P A;  1XMQ Q;  3IFD A;  1HHV A;  2RHQ B;  1J5E L;  4JI2 L;  2EIF A;  4I7Z C;  4O0A A;  4DV2 Q;  3VYR A;  2K01 A;  3G6J B;  1I4Q A;  4DR2 L;  1KC8 C;  4CDD C;  2Z6K A;  4OEM B;  1FNV A;  1G2S A;  2QGQ A;  3S15 H;  1H95 A;  4YCU A;  1RL2 A;  4X66 Q;  2B2W C;  5D3I B;  2QF7 A;  4KK7 A;  2Q2H A;  1EQT A;  4RKL A;  4DXG A;  2R93 B;  1LTB D;  2Z1C A;  4A3F B;  1WTV A;  1IYU A;  2F0J A;  1V1P A;  1IKM A;  3KYH C;  1EUJ A;  1EIG A;  1BCP C;  1LLR D;  1D5Z C;  2E2J B;  3C46 A;  5C4Z A;  2F0T A;  5KIX A;  2L11 A;  3A8K E;  3S16 B; 
#chains in the Genus database with same CATH homology
 1WJJ A;  2EXD A;  4LFA L;  1HJP A;  4BY7 H;  4HJ9 A;  1XNQ L;  2PQA B;  2ZTD A;  3HKS A;  5M3M G;  2WB1 E;  1OXS C;  5LMN W;  4IFD I;  1KRS A;  3D0F A;  4B3S Q;  3M4P A;  3S1N H;  4XIG S;  5H1S E;  2F4V L;  2NZH A;  1J6Q A;  3EBE A;  4DNI A;  1VS0 A;  4NPS A;  1CSQ A;  2D62 A;  4UP8 A;  4BBR G;  1IBK L;  3HOW H;  4B3T Q;  4DV0 L;  3I4M H;  3K8A A;  1FL0 A;  1SN8 A;  3F2B A;  5HGQ A;  3CQZ H;  3M3Y H;  2RCN A;  4YWK A;  4HJA A;  3CCS A;  1HNW Q;  3HOV G;  4DR3 Q;  4JI4 Q;  2ALY B;  5FLM G;  4DV5 L;  3U4V A;  4AIM A;  2UUA L;  1IZ6 A;  5IP9 H;  2I0Q A;  3TS2 A;  1Z47 A;  1N34 Q;  3NEN A;  1UWV A;  1EFW A;  4DK3 C;  1E3P A;  5IE8 A;  2RF4 A;  4GLA C;  1KXL A;  1BBW A;  1IBL Q;  2WAQ G;  1PH7 A;  1V9P A;  1X65 A;  1HR0 W;  2PNH A;  3M85 A;  4DUY L;  1HNZ Q;  4NXM L;  1PYS B;  2BA0 A;  3U50 C;  4OWX B;  2OWO A;  4H02 A;  4IPD A;  2R7Z H;  1TWH H;  2KHJ A;  1MKH A;  2JA9 A;  2MQH A;  4JG2 A;  3MXN B;  4OWT B;  2GVB A;  1GVP A;  5DLQ E;  1K3R A;  3STB D;  3J81 c;  4A3M G;  1YHQ A;  1Q7Y C;  1PH1 A;  2UUC Q;  3ICE A;  2JA8 H;  4A3G G;  1DGS A;  3NEM A;  4LFC Q;  1N32 L;  2CCZ A;  2ES2 A;  2E5L Q;  4L5T A;  5C3E G;  4JI3 Q;  2YTX A;  4BY7 G;  3CCR A;  4HJ8 A;  1PYB A;  4X62 Q;  2ZJR A;  2R93 G;  3E9I A;  4R4I A;  1HNX Q;  3I7F A;  3J81 j;  4A3F G;  1WYD A;  4DR5 L;  4APV A;  5BR8 L;  3HOU G;  1VQ5 A;  2R92 G;  5AJ3 Q;  3BZK A;  1X56 A;  4OX9 L;  2OTJ A;  3W1B A;  2B63 G;  1CUK A;  1MJC A;  4C2M H;  2JA5 H;  3J80 c;  3OTO Q;  1WCM H;  1KRT A;  4DV4 L;  1Q81 C;  4PZ6 A;  2MO1 A;  3AFP A;  3T1H L;  1LTL A;  3CXC A;  4GOP A;  1C9O A;  3S1R H;  4QQB X;  4LUO A;  1E22 A;  4A3K G;  1JT8 A;  2JEB I;  1D8L A;  1VQO A;  1XNQ Q;  3CD6 A;  4IFD J;  1OXT A;  3ULP A;  1UE1 A;  1CSP A;  3NEL A;  4X64 Q;  4BXX G;  3GTP H;  3PUX A;  2A19 A;  2N49 A;  2VS1 A;  4LF5 Q;  3E9H A;  1QUQ B;  1YZ6 A;  1AE3 A;  1CKM A;  2L15 A;  3HOX G;  4P72 A;  1P8L A;  1S72 A;  2IHE A;  1VQ9 A;  3TQY A;  2KCM A;  1Y1W G;  3S1Q H;  4B3R Q;  1VQF A;  3CPF A;  1L1O A;  1L0W A;  2JA7 G;  2ASB A;  3UDI A;  5GAH C;  3H3V I;  3F2C A;  3HOZ G;  4IFD G;  3RZO H;  2GN5 A;  2VQF Q;  3GTK H;  2K75 A;  3FKI H;  4GN3 B;  4DV7 Q;  5M5X H;  1G29 1;  2A8V A;  5EAY A;  3L0O A;  5IP7 G;  3J81 i;  1G51 A;  3PCO B;  4AYB E;  1L2F A;  1NMF A;  2VL6 A;  4NXN L;  2HIV A;  3CC4 A;  4JBK A;  3PO2 H;  2K52 A;  4WJ4 A;  1JE5 A;  3RLN A;  4GLX A;  1PH4 A;  2E2H H;  2HT1 A;  3U4Z A;  4DV1 Q;  4B3M L;  1HZC A;  4NXM Q;  4DR7 Q;  1PH6 A;  1V43 A;  2K5H A;  5GAD C;  3KF8 B;  4HJ7 A;  2OQ0 A;  5LMU L;  3F1Z A;  4JV5 Q;  4JOI A;  4BBS G;  2OCE A;  1QVC A;  1JMC A;  4GKK Q;  2XGT A;  4JI6 L;  1IBM L;  5FLX c;  4TQU S;  4QJF A;  1U5K A;  4NB3 A;  3STB C;  4K0K Q;  1N36 L;  4LF8 Q;  2WP8 J;  4A3I G;  4R4Q A;  1UE5 A;  5FJ8 H;  2LXJ A;  3EIV A;  3SGI A;  5C44 G;  3HKZ G;  1UE6 A;  3J80 i;  4A4I A;  1KAW A;  3CCU A;  1N8R C;  4ME3 A;  3RLO A;  4EQ5 A;  3OYY A;  2MFI A;  2IT1 A;  4JBW A;  1LM0 A;  2I5M X;  4IOC A;  1KL9 A;  3RR5 A;  4A3D G;  3KLW A;  1HZA A;  4HIM A;  3DM3 A;  1M90 C;  2RHS B;  2GVA A;  1L1O B;  1Y1V G;  4LW1 A;  4DUZ Q;  3RN2 A;  4POF A;  2CFM A;  2F52 A;  1XNR Q;  4ALP A;  4JI7 Q;  4LFB L;  2CKZ B;  3CCJ A;  1O7I A;  1Z9F A;  2I5L X;  4DV4 Q;  4HIO A;  2UUB L;  1VCI A;  4Y52 H;  1XMO L;  1K8A C;  2HHH Q;  4JBM A;  1SR3 A;  1SRU A;  1Y14 B;  3L7Z C;  4A3B H;  4DR4 L;  4BY1 G;  2B29 A;  2ZM6 L;  2CWA A;  1A62 A;  3CP0 A;  4YWM A;  3H3V H;  3I4N G;  2VY3 A;  4JI5 L;  3TRE A;  1MJE A;  3M4O H;  3CCE A;  1GO3 E;  2BH8 A;  5M3M H;  5IYC G;  1W2B A;  1NY4 A;  1JJ2 A;  2VQE Q;  3PIP A;  1I94 Q;  2AWN A;  3PSI A;  3S1M H;  3EN2 A;  2KHI A;  1EYG A;  3K0X A;  4IJL A;  4DK6 C;  2PI2 A;  2UXC Q;  4JI8 Q;  3HOY G;  1KQS A;  5IYB H;  4FDB A;  4GLV B;  1A8V A;  3PO3 G;  3CME A;  3HOW G;  1X55 A;  2Q2I A;  5M5W H;  2KEN A;  2WFW A;  1XPU A;  3G71 A;  1VQL A;  4A3L G;  2ZJP A;  3S2H H;  3JAM c;  1K83 H;  3PUY A;  1QZH A;  4DKA C;  1T9H A;  3H15 A;  2A1A A;  3ULL A;  5FLM H;  1YEZ A;  1XTD A;  3AFQ A;  3T1Y L;  5IP9 G;  4YHH Q;  1J5E Q;  4JI2 Q;  5LMN Q;  3GTG H;  1HH2 P;  2ZTC A;  4HJ5 A;  2K4K A;  3H0G H;  1QUQ A;  3PUW A;  4DR2 Q;  1GD7 A;  1TWG H;  3CMA A;  1V1Q A;  1VQC A;  4IPH A;  3UDX A;  2VNU D;  4DR6 L;  4B3M Q;  1EIF A;  2NN6 I;  2Y0S G;  3IRB A;  4LF9 Q;  1XMQ L;  1K73 C;  4X6A H;  2DUD A;  1PFS A;  4A3E G;  4JC0 A;  4A3C G;  3RN5 A;  5GAG C;  1YJW A;  3AEV A;  3G48 A;  1X54 A;  3I2Z A;  2MNA A;  2C35 B;  4A3B G;  1EQR A;  2N78 A;  1RIP A;  1JB7 A;  4GNX C;  4GKJ L;  4IOA A;  1SMX A;  2UXD L;  1S40 A;  1WOC A;  3GDE A;  1A63 A;  5C3E H;  5IWA Q;  2AMC B;  4AQY L;  4A76 A;  3K7U C;  4EX5 A;  5M3F H;  2R93 H;  4DV3 Q;  5JJL A;  2Z0S A;  4R4C A;  2N3S A;  1ASY A;  5C4J H;  3TRZ A;  1HR0 Q;  3S17 H;  2NVQ H;  1X9N A;  1I3Q H;  2YTY A;  4LF6 L;  4QY7 A;  3RZD H;  4LFA Q;  4YY3 L;  1PH3 A;  2JA5 G;  1VQH A;  3PGZ A;  2E2J H;  4RG1 A;  4LUV A;  4OO1 G;  1VQ4 A;  3NBH B;  1XMO Q;  1AH9 A;  3CC7 A;  3S16 H;  2F4V Q;  4LNQ A;  4LWC A;  1FVI A;  1LUZ A;  3GTQ H;  3HKZ E;  3WWV A;  1B7Y B;  1IBK Q;  1OTC A;  2UU9 L;  1PH2 A;  2H5X A;  1NE3 A;  4L5Q A;  4DV0 Q;  2ZJQ A;  1X3E A;  3JAM i;  3K81 C;  4JYA L;  2NVY H;  3DLL A;  1UEB A;  3W5O A;  4A3J G;  4L5R C;  3CW2 C;  1VQN A;  4B3S L;  4XTC S;  1YNX A;  4JI1 L;  4LF7 L;  4JI0 L;  5IYD G;  2R6G A;  2BA1 A;  4DV5 Q;  4KI0 A;  1TXY A;  4UPA A;  2EQS A;  2K5V A;  3B6Y A;  3KF6 B;  4PG3 A;  3HOX H;  1SLJ A;  4HIK A;  2UUA Q;  3PIO A;  1YIJ A;  1SRO A;  2R7D A;  3TEH B;  4HID A;  1VQM A;  3KFU A;  4DR7 L;  4AH6 A;  2V1C C;  4LUZ A;  2QA4 A;  4DR3 L;  4YWL A;  1Q86 C;  2JA7 H;  4JI4 L;  3PUV A;  1VQ6 A;  2ATW A;  4IPG A;  4DUY Q;  1YHB A;  2VUM G;  5IY0 A;  2Q2T A;  1IXR A;  4C3J H;  5IP7 H;  1D7Q A;  1E24 A;  3PV0 A;  1N34 L;  4GN4 B;  3E0E A;  1AE2 A;  4OXP A;  3CPW A;  5IT9 c;  4A75 A;  1IBL L;  4A93 G;  3KOJ A;  4TVA B;  3GD7 A;  1VQ8 A;  1N32 Q;  3KJP A;  2QEX A;  2Z6K C;  3ZJY C;  1FJG L;  1HNZ L;  2HQL A;  4KLK A;  1XPO A;  4DAY B;  3A0J A;  2D0O A;  5C0X J;  4R4O A;  1QVF A;  5C4X H;  1NTG A;  1KHI A;  1VQP A;  2UUC L;  2WAQ E;  1Q1B A;  3ERS X;  3UDF A;  1SFO H;  4DR5 Q;  4LFC L;  1IL2 A;  2I5H A;  4X65 L;  5BR8 Q;  1YI2 A;  2IX1 A;  3CAM A;  2E5L L;  4A3I H;  5FJ8 G;  4GS3 A;  3RNU A;  2NVT H;  1KD1 C;  4JI3 L;  2KBN A;  5C44 H;  4OX9 Q;  1I6H H;  2NZO A;  4YCW A;  4PMW A;  4X62 L;  4IO9 A;  2CWP A;  2JA6 G;  1TWF H;  3AYH B;  1Q8K A;  2PMZ E;  3U58 A;  3I55 A;  5C0X G;  2Y0S E;  4A3D H;  3T1H Q;  1K8G A;  2F3I A;  3L2P A;  2IHF A;  2YTV A;  3UE0 A;  2DGY A;  2VW9 A;  5AJ3 L;  3GTL H;  1Y1V H;  4YY3 Q;  1Q12 A;  1WFQ A;  2ID0 A;  1YHA A;  1Q82 C;  1YBY A;  4P75 A;  4DPG A;  2VZA A;  5K36 G;  2IY5 B;  5GRO A;  3M9B A;  1M1K C;  4QL5 A;  3HFZ B;  1VQE A;  1C0A A;  1OXX K;  1HZB A;  4BY1 H;  3JC6 6;  3A74 A;  2UU9 Q;  1NBW A;  3ULJ A;  1YJN A;  4BBR H;  3S2D H;  2K5N A;  1U0L A;  3PUZ A;  3I4N H;  3I4M G;  2XTI A;  3BJU A;  4JYA Q;  3BU2 A;  5IYC H;  2ZTE A;  1UE7 A;  2JE6 I;  4LF4 L;  4LF7 Q;  4JI1 Q;  4AYB G;  4X64 L;  3J7A 5;  4JI0 Q;  1FGU A;  3UDG A;  3HOV H;  1TWC H;  1OXU A;  3HOY H;  5IYB G;  4LF5 L;  4OO1 I;  1K9M C;  3PO3 H;  2E8G A;  4R1J A;  5J3B A;  4A3L H;  4B3R L;  2K50 A;  1I50 H;  1P16 A;  1G6P A;  3GO5 A;  4NXN Q;  4UP9 A;  4PZ7 A;  4DR1 L;  4DAM A;  1S3O A;  2OTL A;  3CCL A;  2AWO A;  4P74 A;  2VQF L;  3F8T A;  1VQD A;  4DV7 L;  3CF5 A;  3CCQ A;  1GM5 A;  1OXV A;  2R7Z G;  4O2D A;  2HIX A;  2IX0 A;  5LMU Q;  1XJV A;  1XPR A;  4JCV E;  4DV2 L;  1PH9 A;  1N33 L;  3RLF A;  3H0G G;  4DV6 L;  1YVC A;  3PO2 G;  1EIY B;  3M7N A;  4A3M H;  4JI6 Q;  3KF6 A;  1IBM Q;  2JA8 G;  4A3G H;  4KHP L;  3I4O A;  2LXK A;  4P71 A;  4L5S A;  1QZG A;  5JEA J;  1N36 Q;  1FJG Q;  1EOV A;  1VQJ A;  4RMF A;  4DV1 L;  1B8A A;  2E2I H;  1I5F A;  4C3I H;  4Y7N H;  4X66 L;  2KCT A;  4A3E H;  4A3C H;  1SE8 A;  1PVO A;  3UE1 A;  1KIX A;  4JV5 L;  1B70 B;  1Q46 A;  3TS0 A;  1PA6 A;  4GNX A;  2JK8 A;  5ELN A;  2LSS A;  4GKK L;  2WB1 G;  4A3F H;  5GAE C;  1X6O A;  4IPC A;  4X65 Q;  4GN5 A;  1R9T H;  1IYJ B;  3HOU H;  4K0K L;  3PF5 A;  4LF8 L;  4UY8 C;  2R92 H;  2YV5 A;  3BZC A;  4QGU A;  1CKN A;  1EWI A;  5M5Y H;  5M3F G;  4WJ3 M;  2B63 H;  1QVG A;  4LFB Q;  5JEA G;  1PH5 A;  3MEF A;  1Q1E A;  1WCM G;  1C7Y A;  2UUB Q;  1JJG A;  1BBU A;  3FHW A;  4PZ8 A;  5E7N A;  4DR4 Q;  3J7Z C;  3OW2 A;  2UXB L;  2ZM6 Q;  2R7F A;  1VQA A;  4DUZ L;  1PHJ A;  2D0P A;  2JJQ A;  4GOP C;  4A3K H;  1PH8 A;  4JI5 Q;  1XNR L;  3W1G A;  4JI7 L;  1X3G A;  1VQG A;  4OON A;  1JJC B;  2OQK A;  1MIU A;  5JJK A;  2HHH L;  4BXX H;  4POG A;  2PI2 E;  4MZ9 A;  3KDF A;  3AQQ A;  1E7Z A;  4J15 A;  3CCV A;  2YU9 H;  5JJI A;  5C0X I;  4B3T L;  3Q8D A;  4KHZ A;  4A3J H;  1Y1W H;  4LF4 Q;  4UP7 A;  2VQE L;  1I94 L;  3CCM A;  4R4T A;  1HNW L;  1N9W A;  4MNO A;  3HOZ H;  2UXC L;  4JI8 L;  1L1O C;  1YJ9 A;  1VQK A;  3D31 A;  4BA2 I;  3A5Z B;  5IYD H;  4GNX B;  3FKI G;  3T1Y Q;  1K0R A;  4OWW B;  2BH2 A;  5GQO A;  3G4S A;  2AHO B;  3M4Q A;  2NN6 G;  1YIT A;  3KJO A;  1GKH A;  2AKW B;  2N8N A;  3G6E A;  3GTM H;  2NVX H;  1A0I A;  2JQO A;  4DR1 Q;  1BKB A;  1PV4 A;  1VQB A;  4IJH A;  1ASZ A;  1CKN B;  2PQA A;  4P73 A;  1VQ7 A;  4DR6 Q;  3LGJ A;  4YCV A;  3CC2 A;  3I56 A;  1XMQ Q;  2K14 A;  2VUM H;  2RHQ B;  4JBJ A;  4YHH L;  1J5E L;  1N33 Q;  4JI2 L;  2EIF A;  3FP9 A;  5LMN L;  4O0A A;  4DV2 Q;  2JEA I;  4BA1 I;  4DV6 Q;  4BBS H;  4DR2 L;  1KC8 C;  1E1T A;  4A93 H;  4JOI C;  2Z6K A;  1NJI C;  4KHP Q;  3ER0 A;  1WI5 A;  4GKJ Q;  2UXD Q;  2QGQ A;  2B3G A;  3K7A H;  4LF9 L;  3S15 H;  1H95 A;  4YCU A;  1RL2 A;  4X66 Q;  1VQI A;  3PF4 A;  4AQY Q;  3VDY A;  4QIW E;  2Q2H A;  5C4X G;  4GOP B;  3KDF B;  5ELO A;  1HNX L;  2MO0 A;  4C3H H;  3S14 H;  1E1O A;  5HY6 A;  1EQQ A;  1HZ9 A;  1NMG A;  3S24 A;  4LF6 Q;  5IWA L;  1TWA H;  3GTO H;  4MTN A;  1W3S A;  2Q2U A;  1X3F A;  2YYZ A;  3KYH C;  3A5U A;  4DV3 L;  3K80 C;  2JA6 H;  1EUJ A;  3OTO L;  1LYL A;  2FXQ A;  3F2D A;  1HR0 L;  2CQO A;  1CKO A;  2UXB Q;  1BVS A;  3GTJ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...