5EAYA

Crystal structure of a dna2 peptide in complex with rpa 70n
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
115
Chain Sequence
GQLSEGAIAAIMQKGDTNIKPILQVINIRPITSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 115
sequence length 118
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5eayA00
1HNWQ 3PUYA 1MJEA 3SGIA 5GAGC 1T9HA 2ZJRA 3CCUA 1VQPA 1Q7YC 3KDFB 4FDBA 3I4MH 1PVOA 1UE5A 4HIKA 3AEVA 1X54A 5JJKA 3IRBA 3M4PA 4DV2L 3PF5A 4DR7L 1AH9A 4A3CG 2HQLA 1W2BA 4NXNQ 2HIVA 4GN5A 3KF6A 4A3IG 4B3RQ 2E8GA 4DV4L 3CD6A 1IXRA 3ERSX 4WJ3M 1Q12A 3F2CA 2CWPA 1N8RC 1YHQA 2UXBL 3B6YA 1EFWA 1EIFA 1MKHA 1SR3A 2WP8J 4H02A 4P71A 2LSSA 5LMNW 4JI7L 3S14H 3GD7A 4A75A 1QUQB 1WFQA 4RMFA 2IY5B 2E2IH 4QJFA 1W3SA 4R4IA 1EYGA 2F4VQ 2AWOA 3CCMA 2OQKA 2KCMA 2GN5A 4LF5L 1XNQQ 3I4NG 2KHJA 2ASBA 3CXCA 5LMNQ 3PV0A 1WOCA 5GQOA 1IL2A 2YTVA 3H0GG 4QIWE 1PH9A 3I4NH 4GN3B 4PZ7A 5J3BA 2JA7G 1LTLA 3TQYA 4C3HH 4X62Q 3H0GH 4JOIC 2R92H 1YJWA 1EQQA 3HKSA 2JA7H 4GKJL 2E5LL 1UE6A 4K0KL 2L15A 2UU9Q 4GN4B 3HOZG 1A0IA 1J5EL 4IFDJ 1G6PA 4LFAQ 4JI3Q 1TWAH 1Y1WG 3S1MH 3D31A 4BA2I 1IBKL 1YIJA 2I0QA 1KIXA 1A8VA 1KRSA 4JI4L 2AHOB 3S16H 5GROA 2OWOA 2VUMH 4X65L 4DV5L 3ZJYC 1Y1WH 1I94Q 1UE1A 3S1RH 2KCTA 2K4KA 4YWKA 1XPOA 2NVXH 4IPGA 3JAMc 1K83H 4B3TQ 3J81c 2KENA 3ICEA 1XMOQ 1QVFA 1VQ7A 1O7IA 2ZTDA 2QEXA 1EWIA 3BZCA 4JI8Q 3CPWA 2K5HA 3NELA 2OCEA 4HJ8A 4OX9Q 4A3GG 3RR5A 4DR6Q 4BXXG 4C3JH 1VQGA 1IBMQ 1LYLA 4ALPA 4X66Q 1KD1C 1HNXQ 2WB1G 3G71A 4A3GH 4LFBQ 1YBYA 2K50A 1NY4A 1YHBA 3HFZB 4IJHA 5FLMH 2NVTH 4JV5L 4YWLA 1B70B 1SMXA 2R7ZG 2V1CC 2KBNA 2EQSA 4GKKQ 4BA1I 1XPUA 4IOAA 3K7AH 4AQYL 2BA1A 4UP8A 5FLXc 3PSIA 4DV3Q 3PUVA 1VQMA 1PH3A 2R7ZH 4BY7G 3G4SA 4LUVA 1X65A 1J6QA 1VQLA 3F8TA 2H5XA 3F2DA 4QQBX 5C0XG 2R93G 2DGYA 1Y1VG 3HOUG 2CQOA 3T1YL 4BY7H 1PV4A 2OTJA 4IFDI 1NE3A 5BR8L 2Q2UA 4JI0L 1KL9A 4YHHL 5HY6A 3RZDH 2R93H 1FL0A 4Y7NH 3CMAA 3S15H 1UE7A 3JAMi 3HOXG 1Y1VH 1GKHA 3J81i 3HOUH 4JI5L 5IYDG 1CUKA 1OXVA 1QUQA 3M3YH 4DR7Q 1VQOA 4DNIA 2HHHL 1V43A 4DUZL 2R6GA 3RLNA 2WAQE 4DV0L 4DV4Q 2ZJQA 4A3LH 4JC0A 3VDYA 1N33L 1BBWA 1E7ZA 4MNOA 1CKOA 4UP7A 4PMWA 4APVA 4KLKA 3AQQA 2KHIA 2YTXA 4EX5A 5M5WH 3GTKH 1SN8A 2UXBQ 5H1SE 2AWNA 2WFWA 5EAYA 1X3FA 4DR4L 3F2BA 1Q46A 1QVCA 3RNUA 1XNRL 1Q82C 3KOJA 5K36G 3TRZA 1M1KC 3T1HL 2YTYA 5JJLA 5M5XH 1NJIC 3UDGA 4R4TA 2D62A 1Q86C 4OO1G 1YJ9A 2YYZA 4R4QA 4JI2Q 3U50C 1FVIA 4A3FG 2Q2TA 4DK3C 2YV5A 3CCRA 2JEBI 4LF5Q 3KFUA 4DR1L 4JI1L 2CWAA 2UUCL 1FJGL 4POFA 4BY1H 1E1OA 1VQ5A 4A3FH 2EIFA 1CKMA 1SROA 3HKZE 2MO1A 3NENA 1EIYB 1TWFH 1VQIA 3OTOL 4A3JG 4DR3L 3E0EA 2JEAI 2GVAA 2PQAB 2E5LQ 4K0KQ 1WI5A 3STBD 1QVGA 3RZOH 1J5EQ 3KJOA 1KQSA 4A3JH 4JI6Q 3L2PA 4LWCA 5E7NA 1IBKQ 4MTNA 3CCSA 1HZAA 4GOPB 5HGQA 4JI4Q 3W1GA 4A93G 2RHQB 2E2JH 4X65Q 3PGZA 4DV5Q 3AFQA 4HIMA 4A3IH 4A3BG 4BBSG 3S1NH 1A62A 1PFSA 1PH1A 1OTCA 1XTDA 1VQBA 1KHIA 1VQDA 2PMZE 4DV6L 1X9NA 1WCMG 1N34Q 4BBSH 3CC4A 1X6OA 3PUZA 1M90C 1EUJA 3M4QA 1IBLL 3RN5A 1SLJA 1C7YA 1WCMH 2NN6I 1YI2A 4YY3L 2JA9A 4KI0A 1A63A 1K73C 1PH7A 3JC66 2XGTA 1FGUA 2PNHA 1VQ9A 1VQ6A 1JT8A 1R9TH 4UY8C 2AKWB 2JQOA 1Q1BA 4AYBG 5IP9G 1Z9FA 3STBC 4JBKA 4P73A 3J7ZC 3S1QH 4JV5Q 4JYAL 1G51A 1RIPA 4QL5A 2OTLA 1X3EA 2VNUD 2RCNA 5GAEC 4AIMA 4P75A 3S17H 4AQYQ 4X6AH 3GTGH 1HZ9A 1PYBA 4OWTB 1XMQL 1GO3E 3G48A 2UUBL 4OONA 4DKAC 1JB7A 3I4OA 2IHFA 3HOZH 4A3DG 4A76A 3I56A 3H3VH 1DGSA 1NTGA 2VY3A 3T1YQ 1TXYA 2VW9A 1RL2A 4JI0Q 2I5LX 3KLWA 1TWGH 2AMCB 1NBWA 4UPAA 5IWAL 1ASYA 2ES2A 3KF8B 2BH8A 1V9PA 2JA5G 2Y0SE 4A3DH 2ZTEA 4DR2L 1N36Q 1S3OA 4GNXA 2GVBA 3UDXA 2R7FA 3DLLA 4DUYL 1HNWL 3OYYA 2HHHQ 2JA5H 4LFCL 5IYBG 2A1AA 4DUZQ 4DV0Q 4DAMA 5C44G 3BZKA 4YCWA 2F3IA 4LF9L 1N33Q 1E3PA 4C3IH 2E2HH 5C44H 1Q1EA 2LXKA 4L5SA 3GO5A 4DR4Q 5DLQE 2HT1A 2N8NA 1XNRQ 4IJLA 3CW2C 4BXXH 1GM5A 4DR5L 3PUXA 2VQEL 3T1HQ 3KDFA 1H95A 2MQHA 2K5VA 5IE8A 2PQAA 2JJQA 4B3SL 4IPCA 4OWWB 4IOCA 2N78A 5JJIA 1B7YB 4JI1Q 1X56A 2UUCQ 1FJGQ 4P74A 3KF6B 2EXDA 3GDEA 1PHJA 2ATWA 1GVPA 3PUWA 3PO2G 3FHWA 1VQ4A 1PYSB 5JEAG 3CC7A 4YWMA 2K75A 3HOWG 3OTOQ 1I50H 3S24A 4DR3Q 3PO2H 1BVSA 2IHEA 3F1ZA 4DV2Q 2VL6A 2ZTCA 3HOWH 1OXXK 1QZHA 4GLVB 3HOXH 3OW2A 3CCQA 1PH2A 1JMCA 5IYDH 2RHSB 2I5HA 2OQ0A 5ELNA 1VCIA 1X55A 2F52A 1P8LA 3WWVA 1YJNA 2BH2A 4IPHA 4GNXC 4GLAC 3TS2A 1IZ6A 4HIOA 4DV6Q 4DV7L 3GTJH 3CC2A 4P72A 1XPRA 4JI7Q 3K80C 1VQJA 2IX1A 2Z6KA 1IBLQ 4A3EG 4B3ML 2D0OA 4O0AA 1VQFA 2ALYB 3UE1A 4YY3Q 2B29A 4OO1I 3K7UC 4B3TL 4A3EH 1L1OB 3M85A 2ID0A 3BU2A 4NXML 4DK6C 4A93H 3L7ZC 4L5TA 3CCJA 4KHZA 3U4ZA 4OX9L 3HOVG 4JYAQ 1GD7A 2ZM6L 4DR6L 2K5NA 3DM3A 4LF6L 4LUOA 4LNQA 4ME3A 4TVAB 4X66L 3HOVH 4GKJQ 1YITA 4X64L 4GOPC 3LGJA 1HZCA 4NPSA 1L2FA 1S40A 1XMQQ 5C3EG 1VQCA 3EIVA 3H15A 2UUBQ 2VQFL 4XTCS 2IT1A 3E9HA 2JK8A 4LF7L 3W5OA 3GTQH 3W1BA 5C4JH 1CKNB 1N9WA 3BJUA 4JBMA 1PH4A 1C9OA 4R1JA 3MXNB 5IT9c 1HR0L 2UXDL 4RG1A 5GAHC 1BKBA 1VS0A 1G291 2MFIA 2NVQH 1VQEA 2WAQG 4DR2Q 3PO3G 4A3BH 2N49A 3I4MG 1AE2A 4NB3A 1QZGA 3I55A 1ASZA 1JE5A 3M9BA 1YNXA 4DUYQ 3RN2A 1E24A 4LFCQ 3PF4A 3PO3H 5AJ3L 5IP7G 1HJPA 3M7NA 4A3CH 5M5YH 2R7DA 3EBEA 1IYJB 2UUAL 2QA4A 4LF9Q 2K14A 3UE0A 4L5RC 2VS1A 3U4VA 5IP7H 3CP0A 4KHPL 4QY7A 5IY0A 2Z6KC 4AH6A 1OXTA 1BBUA 4HJ7A 1EOVA 1Q8KA 3GTLH 4DR5Q 2VQEQ 4JBJA 3I2ZA 5LMUL 1YHAA 4LF8L 5IP9H 2VZAA 2DUDA 4PZ8A 4B3SQ 5C0XJ 3EN2A 2JA8G 3HKZG 1XJVA 4OXPA 3H3VI 1OXSC 4A4IA 5JEAJ 2NN6G 3AYHB 4LF4L 2XTIA 4PG3A 4WJ4A 4BBRG 1AE3A 2CCZA 2JA8H 1P16A 2WB1E 4DV1L 1KC8C 4JI2L 1PH5A 5BR8Q 4BBRH 1UWVA 4YHHQ 1S72A 1HNZL 1LM0A 2A8VA 2UXCL 3ULLA 3CCEA 1PH6A 1N32L 2I5MX 1VQHA 4JI5Q 2R92G 1MIUA 2B3GA 3GTOH 1HZBA 1U0LA 4J15A 1Y14B 3UDIA 5IYCG 3I7FA 4QGUA 3CQZH 3TREA 2NZOA 1JJGA 1L1OA 4DPGA 2YU9H 3HOYG 4OWXB 5IYCH 5IYBH 3J81j 3PIPA 1SFOH 4JI6L 1V1QA 4IPDA 3A74A 4NXNL 3CMEA 2VUMG 3MEFA 1X3GA 4O2DA 4HIDA 3J80c 4POGA 3HOYH 3FP9A 4B3RL 4DV7Q 1JJ2A 1KXLA 2HIXA 3Q8DA 3A5ZB 2Q2HA 3CCLA 1YEZA 3PCOB 3RLOA 4UP9A 4B3MQ 3ULJA 2N3SA 4C2MH 2B63G 1TWCH 1VQ8A 3D0FA 3E9IA 1N34L 2PI2A 4JCVE 2B63H 4A3KG 4R4CA 1K8GA 4GLXA 3NBHB 1KAWA 1UEBA 3KYHC 4DR1Q 4NXMQ 1HH2P 1PH8A 2C35B 3ER0A 4GOPA 2F4VL 5ELOA 1KRTA 4A3KH 1CKNA 5C0XI 1U5KA 3S2DH 3TEHB 3CF5A 2ZM6Q 5M3FG 4LF6Q 1HR0W 5FLMG 1XNQL 2Q2IA 5LMNL 1TWHH 1I5FA 3CCVA 4X64Q 1MJCA 5M3FH 1Q81C 1D7QA 2D0PA 1K8AC 3M4OH 2VQFQ 4X62L 1E22A 1WYDA 2IX0A 4XIGS 2Y0SG 3TS0A 4PZ6A 4LF7Q 1VQNA 3J7A5 2UU9L 2UXDQ 2RF4A 1HR0Q 1CSPA 3J80i 3CAMA 1SE8A 4JI3L 4HJAA 4IO9A 4LFAL 2JA6G 3GTMH 1I6HH 3K0XA 4A3MG 2Z0SA 1L1OC 4YCUA 3G6EA 1I94L 2JA6H 4IFDG 5AJ3Q 1D8LA 4L5QA 2LXJA 5C4XG 4A3MH 1SRUA 4MZ9A 2UUAQ 1N36L 2PI2E 4A3LG 4DAYB 3ULPA 1WJJA 4YCVA 1Z47A 5C4XH 1XMOL 4KHPQ 1VQAA 2ZJPA 4R4OA 5FJ8G 5GADC 1L0WA 1K3RA 1E1TA 2K52A 4JI8L 5M3MG 1LUZA 4EQ5A 3L0OA 1OXUA 3A0JA 2CFMA 2JE6I 1NMFA 5FJ8H 2NZHA 4Y52H 3FKIG 1YZ6A 4TQUS 3PIOA 3A5UA 5M3MH 5LMUQ 3AFPA 4LF8Q 1PA6A 1IBML 2A19A 4HJ9A 4GNXB 1JJCB 1HNXL 4LUZA 4LFBL 3FKIH 3K81C 3K8AA 4JBWA 4GS3A 1YVCA 4LF4Q 3U58A 3UDFA 4GKKL 4LW1A 1CSQA 4AYBE 2CKZB 1K0RA 1EQRA 4BY1G 2MNAA 4DV1Q 2NVYH 3RLFA 2MO0A 2QGQA 4JG2A 3NEMA 5C3EH 2BA0A 2FXQA 3KJPA 4DV3L 1VQKA 4JOIA 5IWAQ 1HNZQ 2UXCQ 1NMGA 1K9MC 3CPFA 1C0AA 3GTPH 1N32Q 4HJ5A 1B8AA 1I3QH 3S2HH
chains in the Genus database with same CATH superfamily
3CRKC 1LTSD 1T9HA 3I70A 2A68C 3A7AB 2Q8TA 5JJKA 2NUCA 3IRBA 4WJWA 3Q23A 3PF5A 1AH9A 3J81L 1IXRA 4WJ3M 2F0OA 3TP5A 2R3ZA 3B6YA 1EIFA 1MKHA 1SR3A 2F0JA 2LSSA 5LMNW 3GD7A 4L8JA 1TKWB 3CU7A 4XYOA 3GTOB 2MGSA 3E0JA 4R4IA 3CCMA 2KCMA 4ZUJA 5KNDA 5LMNQ 5EPKA 5GQOA 3Q0AA 2F0PA 4KKUA 2F0MA 2SDFA 5HURA 4H44C 1A2TA 1II3A 3HG9A 3S1RB 1YJWA 4GKJL 1UE6A 2AQ1B 2L15A 1K83B 4GN4B 1A0IA 1J5EL 2UU9Q 1G6PA 5EPJA 2F0QA 5T1GA 1YIJA 5CMDA 4JI4L 1QNKA 3S16H 3X3MA 4X65L 4DV5L 3ZJYC 3SE0A 1UE1A 4ZKBB 3S1RH 2K1BA 3SK5A 1K83H 4B3TQ 3ICEA 1STAA 1KNAA 1UEAB 3A54A 1XMOQ 2KECA 1Q8IA 2OCEA 1VDZA 4DR6Q 1B4OA 2P5ZX 1IBMQ 1LYLA 5FOBB 1KD1C 4HTHA 5FLMH 4XYQA 1NY4A 3BDCA 4IJHA 2JA6B 2EQSA 4EQPA 1XPUA 1LTAD 4KK7A 4FF3A 3NE5B 2J7ZA 4LUVA 1J6QA 3F8TA 3F2DA 5C0XG 2DGYA 3KUPA 3HOUG 4C1NK 3T1YL 4IFDI 5BR8L 4JI0L 2RSOA 2R93H 2F0GA 1UE7A 1SEBD 1Y1VH 5IYDG 3H09A 1A3VA 2L11A 2K7VA 1KTKA 2HHHL 2R6GA 1D1IA 3RLNA 2WAQE 5A35A 2VB2X 2PYKA 5CR3A 5KYIA 1E7ZA 2IY5B 1IW7D 2UXBQ 3AQQA 3OWEB 1I4RA 5EAYA 5CV5A 5J1ZA 1CHQD 1XNRL 3GTPB 1NJIC 2F0UA 2YYZA 1LLRD 3C46A 3U50C 1FVIA 5I9PA 2JEBI 1A15A 2CWAA 4OO1H 1SBBB 1E1OA 1H9JA 2K04A 1VQIA 1TIID 2E5LQ 2EYFA 2RSNA 3TBIB 3JAME 1SE2A 1KDBA 5I2XA 1DM0B 3LX0A 5E7NA 1S5CD 1WCMB 1HZAA 3K58A 1WTXA 1RCVD 4BBSG 2XRSD 3FMCA 4HIMA 2NBFA 3T51B 2F0NA 2F3WA 1X9NA 4DV6L 1N34Q 3CC4A 2WIIB 1C7YA 3I4NB 1WCMH 2NN6I 3AMUA 1A63A 2K28A 3H0GB 1H9SB 1QG7A 1SYGA 1F9RA 2Q8RE 1FD7D 5G3LD 1HFNA 3OMCA 2IPKD 1KABA 5I4DA 1Q1BA 1WTQA 5IP9G 4I65A 3STBC 4FF4A 3HOZB 4ZKCB 4JYAL 1RHPA 1X3EA 1LT4D 1TWGB 1MGSA 1W6JA 5JPNC 1HZ9A 4OWTB 1XMQL 1GO3E 3G48A 4DKAC 2JA5B 1JB7A 3I4OA 2IHFA 3HOZH 1K3BC 3H3VH 1U4MA 3RUZA 1V1OA 1DGSA 1GJXA 2VW9A 1B3QA 2KEEA 1UUPA 3OIQA 3MVVA 1TWGH 2AMCB 4HCEA 1QOHA 2F0KA 3P1HA 4NMZA 4UDUC 4DUYL 3BS1A 2JA5H 4A3GB 4YCWA 3VYTA 1NSNS 1N33Q 5D14A 4DR4Q 5IGDA 5DLQE 2Z8LA 4QIWB 3TDQA 1BCPD 1GUGA 5KGUA 4Q5VA 2VQEL 4KY7A 4K8IA 3T1HQ 1H95A 2VB3X 2L55A 2NTTA 2PQAA 1PYWD 4B3SL 1SNDA 5ELBA 3TP8A 5JJIA 1B7YB 3HOWB 2UUCQ 4P74A 1GHJA 1K8OA 1CQVA 1TU2B 2N55A 2EYMA 3FVQA 4CDFC 2IHEA 4IN3A 4JW0A 3F1ZA 5JEAH 3HOWH 1ILQA 4GLVB 3OSOA 3CCQA 3MFYA 2I5HA 4RGMA 4R9WA 5ELNA 4GNXC 1L0YB 1R4QB 1HFGA 4TSSA 3GTJH 1QCBD 1HQMC 3NQIA 2Z6KA 3KBGA 1IBLQ 2QF7A 2D0OA 3I72A 3K6OA 1VQFA 2ALYB 3VR3A 1JR0D 1R4PB 4A3EH 4ME5A 3M7GA 1PFBA 3RZOB 4OEMB 2Z6BA 1WTVA 5CBEE 3L7ZC 3VYSA 3U4ZA 5C4JB 1O80A 1GD7A 2ZM6L 2E2JB 1M8AA 5CV4A 4LUOA 4FO2A 2NVQB 2PNRC 4X66L 3HOVH 4GKJQ 4GOPC 2F0SA 3IKJA 1L2FA 1LTRD 5C3EG 2UUBQ 3ND8A 3E9HA 1OO9B 5IGFA 5M5YB 5C4JH 4JBMA 5EGTA 2UXDL 1ICFB 1G291 2NVQH 1EYAA 4DR2Q 1EY8A 4J1MA 1EIGA 1DYQA 1YNXA 2E76C 1E24A 4LFCQ 3PF4A 2EE1A 3DWAA 4A3CH 5M5YH 3EVQA 4KN7C 3EBEA 2UUAL 1IYJB 2RA4A 4LF9Q 1QWYA 3K5NA 3UE0A 5IP7H 4L63B 3CP0A 4EGVA 4WRDA 1BBUA 4TRDA 4JVZA 4HJ7A 4RGTA 3QWNA 4CJ2C 1J9OA 3SR1A 5CV9A 2K5QA 1MBYA 1YHAA 1Y8NB 2BOSA 5E3FA 2CH4A 2C9OA 5JEAJ 2NN6G 5KEEA 4WJ4A 4DU9A 4BBRG 2CCZA 4DV1L 4I7ZC 5BR8Q 1NUCA 5JOBA 4C3IB 1FNUA 1LM0A 1NR2A 1DXMA 5C44B 3NK9A 1PH6A 1VQHA 4RHSA 1HZBA 1U0LA 2FINB 1Y14B 2X6LA 4J15A 4E6IA 4KTAA 3I7FA 2EXZA 3QOJA 3FEWX 3R2TA 3TREA 2N88A 4DPGA 3HOYG 4OWXB 5EJWA 1FR3A 5IGGA 4K8JA 2XWBB 5IYCH 1FNWA 4DN4M 1KXLA 3CRLC 3MXGA 2RBMA 3NXWA 4HMIA 4MHEA 1AW7A 4B3MQ 3S2DB 2ICEC 2PI2A 1GHKA 2Z4IA 4JCVE 4R4CA 3VA5A 4DGZA 1K8GA 1HUMA 3A55A 3KLSX 1EOTA 3KYHC 4NXMQ 2C35B 4GOPA 1X32A 2EOTA 4A3KH 3VYRA 3MXUA 4OIKA 3S2DH 2KJXA 5M3FG 2TSSA 3K57A 3MA2B 2Q2IA 5LMNL 5IT9E 1PXUA 1MJCA 4KKSA 1D7QA 5TSSA 4FXKC 1KNEA 2FMMA 2F0HA 1E22A 1WYDA 2IX0A 4LF7Q 3I3CA 3J7A5 2UU9L 3NTKA 1CSPA 4K5WA 3OIPA 4HJAA 3GTMH 2JP1A 2XSCA 1PLFA 1CFMA 3R3OA 5AJ3Q 1D8LA 4L5QA 1D5ZC 1SRUA 1N36L 5M3MB 4A3LG 1XTCD 4CBVA 1WJJA 1S5BD 1Z47A 1XMOL 4KHPQ 1EWCA 1LUZA 3L0OA 1OXUA 1U9RA 3A0JA 2F0VA 2JE6I 3FKIG 5FKAC 4TQUS 3PIOA 5M3MH 1STEA 1IBML 4HJ9A 4O42A 4RWSC 3DWPA 3K81C 4JBWA 2EY6A 2O5IC 3U58A 1EFID 1W2BA 3BYTB 3R8BA 1JOOA 4JOIA 2F0TA 3BG3A 1K9MC 3TMEA 1QILA 1JWSD 4HJ5A 2B2WA 3J80E 3SGIA 5CORA 1I4QA 4FDBA 1SMYC 3D6WA 1UE5A 1GUTA 3S14B 1SNMA 3JAML 3MWYW 4B3RQ 3KF6A 3H3VC 2E8GA 3RD4A 4V0BA 3ERSX 5G3LF 1SNPA 4NP5A 2LFNA 2CWPA 3M4YA 5BN5A 2UXBL 4KJNA 1EFWA 1EIHA 3S14H 4A75A 1QUQB 4ABNA 1SJED 3QOLA 1EYGA 1ET6A 5E4WC 1XNQQ 2KHJA 2ASBA 2DY7A 3S1MB 3LWUA 4C3HG 3ERQA 4MN3A 2VUMB 3S9WA 1TWCB 1EQQA 4DAYA 2E5LL 1NAPA 4Z9CB 2VXWA 4LFAQ 3S1MH 4OL7A 2H4OA 2I0QA 4K6DA 1A8VA 1KRSA 1NCVA 2VUMH 1G2TA 3DM1A 4EVOA 1ZEQX 4YWKA 4KY5A 1TT2A 3DUZA 3J81c 3H94A 1VQ7A 1O7IA 2NVTB 2QEXA 4JI8Q 3CPWA 2K5HA 3V2TA 2C5CA 4BXXG 1Q3LA 1VQGA 3HEJA 2NWGA 4ALPA 5C5MA 4X66Q 1HNXQ 4FVMA 1YBYA 2K50A 4KD4A 2NVTH 1SMXA 4WORA 2KBNA 4BA1I 2A6ED 3S15B 4X3KA 3HOUB 3PSIA 4HCSA 3VR6A 1PH3A 4BY7G 3G4SA 3W2DA 1X65A 1RTOA 2CQOA 1SYBA 1XWEA 3S15H 3GTKB 1DONA 3HOUH 1TS4A 4DR7Q 1VQOA 2OXPA 4DNIA 3K5OA 2FHTA 4RKBA 2ZJQA 5AFWA 5M5XB 1N33L 2FMCA 2K01A 4KLKA 2KHIA 3GTKH 5I6WA 2AWNA 4DR4L 3RNUA 1PZKD 4RKLA 1Q82C 1BNZA 5K36G 3TRZA 1I3QB 2M00A 3T1HL 5M5XH 3UDGA 4R4TA 1KLUD 4A3FG 5LL6X 3EROA 4DR1L 2UUCL 2F1MA 3LNNA 1AP0A 2EIFA 3SVMA 4R8NA 3A8JE 1CKMA 1LO5D 1STBA 4A3IB 1A6XA 5IGBA 4A3JG 2A69D 5IGEA 4K0KQ 4ZLTF 1QVGA 3DWQA 3KJOA 1KQSA 1J8IA 3K59A 2RDGA 2QKIC 3VR5A 4GOPB 5HGQA 4IUPA 4A93G 4A3BG 3D4WA 4A3IH 1VF5C 3S1NH 1MD2D 1PFSA 1PH1A 1KHIA 2I07B 4BBSH 2K32A 1EUJA 1IBLL 3PMFA 1YI2A 1K73C 3JC66 3GV3A 3J7AF 1VQ9A 3KK7A 2AKWB 5FLXE 2QCPX 2QW7A 3PIO3 4RGNA 1G51A 3S16B 1DD2A 4M1UB 2VNUD 1KDAA 2RCNA 4CDCC 5GAEC 4KHVA 3TP6A 4AIMA 1PYBA 5DAUA 5J22A 2UUBL 4OONA 2J4XA 1EQVA 4ZRZA 4A76A 3HZXA 1NTGA 1TXYA 3Q6SA 3MXPA 2I5LX 4RH6A 1ASYA 2ES2A 4RGOS 2K05A 1V9PA 1E2VA 4DR2L 1N36Q 4DAPA 2GVBA 4FF2A 1B53A 1VMPA 1HNWL 4LFCL 5IYBG 1EY6A 5T1IA 2B8FA 4DV0Q 4DAMA 2BE5C 4LF9L 1E3PA 2JN4A 1HPCA 2WB1B 2LXKA 5CV8A 5LL6S 4DAVA 4L5SA 2RCFA 5EBCA 5IOCA 3Q22A 3QG1A 2N8NA 1B2TA 3CW2C 3TZUA 3QB3A 1GM5A 3PUXA 1E0BA 1SYEA 2CW0D 2IX3A 2R93B 2NB0A 4OWWB 1Y1VB 2F0IA 3KF6B 2EY5A 2EXDA 3HOXB 3TN2A 2ATWA 2DN8A 2L1BA 1F77A 1PYSB 3A8KE 3CC7A 1I50H 5IT9L 4B08A 4Q0FA 1I4GA 3HOXH 1S5FD 1JMCA 2G9HD 2D2CC 1C8CA 1X55A 1IZ6A 4HIOA 2XNAC 4P72A 1ZXTA 3UI2A 1LT6D 1VQJA 1RD9D 2PQEA 2ZT9C 3TP7A 1WD1A 4B3ML 4O0AA 3UE1A 2A6HD 4YY3Q 2B29A 4OO1I 1H9KA 1PTOF 3M85A 1WTHA 4DA2A 1PRTF 1RODA 1FGBD 1RF2D 1PMRA 5CV6A 4ULLA 5E1FA 4DK6C 4NXML 4LMQD 4DF7A 2KCCA 3CCJA 3A8IE 3GTQB 4OX9L 2L12A 4LNQA 2QDLA 4ZAIA 1HTPA 4NPSA 1HZCA 3OWFA 1S40A 5C5LA 3H15A 1Y8OB 4XTCS 1BDOA 4LF7L 3GTQH 4DXGA 1N9WA 1PH4A 3MXNB 5EKIA 1VS0A 1U4LA 1JOQA 2WAQG 1EYDA 2L4NA 5ISRA 2B2TA 3H6MA 4N8FA 1AE2A 4UHVA 3J80L 3RN2A 3M9BA 5AJ3L 1HJPA 4B9WA 3SHLA 2R7DA 4AYBB 1F9SA 2QA4A 2K14A 4KHPL 4QY7A 2Z6KC 1QJOA 4CHTB 1EY4A 1ESFA 5ELEA 1PTOC 4RCNA 1PRTC 2VZAA 5ELCA 5A2QE 1EZ8A 1S5DD 3EN2A 1XJVA 4OXPA 3H3VI 2TMPA 2XTIA 2F0DA 4PG3A 2EJMA 2WB1E 4JI2L 2YU9B 1PH5A 4BBRH 3C1EA 3CCEA 3HOYB 3UDIA 2NZOA 1L1OA 1X3QA 2YU9H 1G91A 4JI6L 4ZYSA 4B3RL 4O2DA 4POGA 3HOYH 3FP9A 4G57A 1JJ2A 2HIXA 3Q8DA 1RJTA 3A56A 4UP9A 2RQXA 2N3SA 3URYA 1IHZA 1Z6HA 3LWEA 1U4RA 1Y8PB 3NHHA 4K2LA 2EYJA 2E2DC 4DR1Q 1C4QA 3ER0A 1CKNA 1I6VC 4X3TA 1BF4A 4LF6Q 1XNQL 2IL8A 5FLMG 1YNJD 3ND9A 1YNNC 2NYZD 5M3FH 1HTLD 3KLRA 1Q81C 1A2UA 5C3XA 3GTJB 1ZKOA 2VQFQ 3P75A 2RKSA 4XIGS 2Q8IB 3BVGA 4A3EB 1LT5D 4LFAL 2JA6G 1WTOA 4A3MG 1Z7TA 3G6EA 4YCUA 4IFDG 2HCIA 3GQBA 4UAIA 5C4XG 1QNUA 3X3NA 3ULPA 3HOVB 1UAPA 3ITPA 1DOKA 5DEHA 1VQAA 2ZJPA 1HA6A 2A68D 5GADC 4V190 1L0WA 4JPBW 2K52A 3K5LA 4JI8L 4RAUC 1CA6A 3CHBD 2CFMA 5JJZA 2NZHA 3KLSA 3KF8A 2L9HA 5LMUQ 2EZVA 4LF8Q 3AFPA 5D65A 1HNXL 4LUZA 5C4ZA 3FKIH 2EPBA 2ZXOA 4GS3A 1T5EA 3S2HB 3AU7A 1SJHD 3UDFA 4LW1A 4AYBE 3I4MB 3RLFA 1VQKA 4JG2A 3NEMA 3KJPA 1HNZQ 1LTGD 1B8AA 1I4HA 3S2HH 1HNWQ 3PUYA 1B9NA 5GAGC 3CCUA 2MP1A 3I4MH 1PVOA 5I9OA 3AEVA 1X54A 1O7ZA 3SK8A 4DV2L 4LJZC 4DR7L 1LTBD 2B2UA 2HQLA 2HIVA 2E2IB 1F2ZA 1Q12A 1STGA 4RHRA 4H13C 3F2CA 1D6EC 3HKZB 2ZXPA 1VF7A 3BVMA 4XT1B 4RMFA 5CYUA 3GP7A 1PZID 2E2IH 1W3SA 2F4VQ 2AWOA 2R92B 2OQKA 5JVH3 5FLXL 3I4NG 3CXCA 1LT3D 3PV0A 2YTVA 3H0GG 4QIWE 5J3BA 2JA7G 2Z9HA 3TQYA 4C3HH 1ICWA 2IJ0A 4JOIC 2R92H 2NVXB 4K0KL 3HOZG 1AZPA 2B2WC 1Y1WG 2AHOB 1FYCA 5GROA 2OWOA 4A3KB 1I94Q 2DY8A 4CJ0B 2O2LD 5C4HA 2KCTA 1JCKB 2NVXH 3JAMc 1JQYD 4C3JB 2DJGC 1V1PA 1GUWA 3SK4A 3P7JA 1B1ZA 2ZTDA 1EWIA 1DOLA 1GOZA 3K5MA 1MSGA 4HSVA 4OX9Q 4A3GG 4C3JH 2Y0SB 1I4XA 3GTMB 5ELDA 3G71A 1YHBA 2R7ZG 2V1CC 4IOAA 4S3SA 3K7AH 3M3YB 4CDEC 1AEXA 4QQBX 2KCNA 1EEFD 1K0SA 1CHPD 4BY7H 1PV4A 2OTJA 3HP3A 1STNA 4YHHL 3OPOA 3RZDH 2SEBD 3CMAA 1T5XD 5M5WB 1GKHA 3J81i 3M3YH 4JI5L 1CUKA 1EQTA 4I7AA 1V43A 4BS9A 4OELB 4DV0L 2QILA 4DV4Q 4KN4C 3I8ZA 1BBWA 2EJFC 1CKOA 4UP7A 4PMWA 5M5WH 1SN8A 5H1SE 1DOMA 4NW2A 3F2BA 1Q46A 4BY1B 1QVCA 4A3FB 3KOJA 2YTYA 5JJLA 4DNTB 2MUYA 2D62A 4JI2Q 5K36H 4U68A 2Q2TA 4DK3C 2YV5A 3KFUA 4LF5Q 3BZDB 3NUCA 4A3JB 2SOBA 2MPMA 4BY1H 2HCCA 4A3FH 1G6ZA 1SYFA 2K6AA 2MO1A 3HKZE 1TWFH 2GVAA 4A93B 2PQAB 3STBD 1BOSA 5E4XA 3MHBA 4A3JH 1IW7C 4JI6Q 3L2PA 4LWCA 1IBKQ 4MTNA 3CCSA 3ONAB 2RDFA 3AFQA 1BQQT 1A62A 1XTDA 1VQBA 4A93H 2A5HA 1R9TB 5IIFA 1M90C 3M4QA 3RN5A 1SLJA 1E2WA 3QIAA 4YY3L 2JA9A 5LHY1 1B3AA 1ENCA 3GTGB 1VQ6A 1JC7A 1R9TH 4RA8A 2WKCA 2ICIA 3H91A 3MC0B 3S1QH 4JBKA 4P73A 3J7ZC 4JV5Q 4F7XA 2OTLA 5A2QL 4X3SA 1EU3A 4AQYQ 2IW3A 3GTGH 1PTOB 4EQOA 4X6AH 1PRTB 3QR8A 1EL0A 3MFGA 4A3DG 2K5WA 2B2YA 5KNCA 2VY3A 1HA5A 1RL2A 1I4PA 5IWAL 2E2HB 1NBWA 4UPAA 3G7LA 3KF8B 2Y0SE 2ZTEA 1BCPF 3WOFA 1S3OA 1PTOH 2R7FA 2F0WA 1CTMA 2A1AA 4C3IG 4DUZQ 3J7AV 5C44G 3BZKA 2HUGA 2E2HH 2LMCB 2BDNA 3HGBA 3GO5A 2HT1A 4IJLA 2PZTA 2RDHA 5I6YA 2I46A 3KDFA 2MQHA 2JJQA 2CVRA 2EY2A 1XXGA 4IOCA 4JI1Q 3HRZC 1FJGQ 1F9QA 3FDTA 1GVPA 3PUWA 1XX8A 3PO2G 5HGTA 1K28A 3FHWA 4YWMA 3OTOQ 3S24A 5C0XH 4DR3Q 1BVSA 1H9MA 2FFKB 2VL6A 4DV2Q 3VR4A 1OXXK 1QZHA 1SNCA 3OW2A 2WV6D 4CKCA 5IYDH 1EZ6A 2FJ2A 1H9SA 3QO2A 2EYOA 5NUCA 1VCIA 2F52A 3HS0C 1P8LA 2BH2A 1BCPC 1CT1D 1L0XB 1BUVT 4TKOB 4HMJA 4K6LA 5BN4A 4MTKA 4N9TA 2MJ8A 3SDZA 2IX1A 2Z4HA 1WTWA 3K7UC 1BBXC 1ET9A 2ID0A 4N9PA 1WVLA 4HAEA 3BU2A 3MEHA 1PFNA 3ZYYX 3R2IA 3T56B 4N8X1 4C1NI 2K5NA 4LF6L 1WD0A 4ME3A 3S1NB 3D3RA 1MSHA 4B9XA 3RMHA 4BBSB 1SYCA 3EIVA 2VQFL 2OT2A 2WAQB 2JK8A 3W5OA 4J8QA 2K5DA 4R1JA 5IT9c 5GAHC 1BKBA 5I2YA 1VQEA 1SXTA 2HQEA 3PO3G 2N49A 4IUNA 1QZGA 2PW5A 3I55A 1JE5A 1H9RA 3T16A 5C6AA 4IURA 1SSOA 3GTLB 2F3VA 2B39A 5IODA 1O78A 3I4LA 4OIJA 2CH4W 1JWUD 5IY0A 1GUNA 1ZYRD 3EFXD 3MTSA 1EOVA 4F87A 1Q8KA 3GTLH 3DMUA 1CI3M 4DR5Q 1IKLA 4CDDC 5LMUL 2M9VA 4LF8L 5IP9H 4X3UA 5C0XJ 2JA8G 4A4IA 2O4XA 3I91A 3SEBA 2B2VA 2X6GA 3IFTA 1KC8C 3MZ5A 3TZDA 4YHHQ 1UWVA 2IWHA 1S72A 1HNZL 2A8VA 3ULLA 4KKTA 1RDPD 1C48A 4JI5Q 1K8MA 1MIUA 3GTOH 1A3UA 4QGUA 3NWTA 4C2MB 2GA4B 1JJGA 3D8GA 4QCLA 2B2TC 1V1QA 3N52A 3A74A 3CMEA 2VUMG 3IL8A 3MEFA 5IGCA 3J80c 2HD3A 4DV7Q 3A5ZB 2Q2HA 4EQNA 3PCOB 5CBAE 3RLOA 3ULJA 4C2MH 2B63G 1W6KA 4HEDA 1VQ8A 1WTRA 1ESRA 3E9IA 4F8MA 1I50B 1ILPA 5F2DA 2BDOA 4GLXA 3TSSA 1PH8A 2F4VL 5ELOA 1KRTA 2KOLA 1U5KA 1SE4A 3TEHB 5CC4A 1HR0W 2J0TD 2R61A 1CQFA 1I5FA 3CCVA 1I6HB 4X64Q 2DNCA 3CKIB 2D0PA 1BR9A 2X69A 3W3AA 4G7ZC 2B8GA 2XRQD 4OGQC 4PZ6A 4A3MB 3V96A 3KBXA 1F2MA 2EJGC 2RF4A 1HR0Q 2LKVA 2WINB 4K2KA 1SE8A 2QEJC 4PQXA 5C4XB 1I6HH 3VYUA 3K0XA 2Z0SA 3GV6A 1L1OC 2JA6H 1I94L 3BDLA 3DXJC 1QB5D 2LXJA 4A3MH 4MZ9A 4IFDH 2PI2E 4DAYB 2XN9C 4YCVA 5C4XH 1DJRD 4QUFA 3K0YA 3PIP3 5FJ8G 1SMYD 1E1TA 1K3RA 2HDMA 1VMCA 2EVBA 2SNSA 5C3EB 3MAQA 1NMFA 4Y52H 1DCZA 3A5UA 1LABA 1EY5A 1TS5A 2G5DA 1LTID 2BCOA 2D5DA 2JXMB 3K8AA 4L6TB 1YVCA 4HR7B 4LF4Q 2KHSA 4KY6A 4F88A 2CKZB 1K0RA 1EQRA 2OF1A 5J39A 3NP8A 5C3EH 1A3TA 2BA0A 2FXQA 1PDQA 5IWAQ 2UXCQ 1U4PA 3CPFA 3L9AX 4IALA 3GTPH 1N32Q 1GUSA 1C0AA 2MHVA 1SNQA 3VR2A 1MJEA 1VQPA 2ZJRA 1Q7YC 1XYIA 1CK1A 3KDFB 3J7YW 5C3WA 1LACA 4HIKA 4NDXA 3M4PA 4NXNQ 4GN5A 4A3IG 1JE4A 4DV4L 3L3OC 3CD6A 1AFPA 2Z1CA 1N8RC 2EY1A 1YHQA 4PMBA 3BYYB 4P71A 2WP8J 4H02A 4BBRB 2OEOA 4JI7L 4ZUIA 1WFQA 4RFBA 2PPBC 1IKMA 1FNVA 4QJFA 4CJ1B 1S5ED 4IQZA 3OW7A 2JA7B 2GN5A 2L0CA 2NN6H 4LF5L 4FYDA 1HCZA 2PMZB 1TWAB 1WOCA 1IL2A 2XVSA 1V8QA 1STHA 1PH9A 3I4NH 4GN3B 4PZ7A 3BDOA 1LTLA 4X62Q 1Y1WB 2HDLA 4M8AA 1B44D 3H0GH 3HKSA 2JA7H 5M9OA 4IFDJ 1RKNA 4JI3Q 1TWAH 4BA2I 5COYA 3D31A 1IBKL 4WFN3 1Q90A 1KIXA 3EA6A 2G9DA 4O1NA 2KUMA 1Y1WH 4G7OC 2K4KA 4ILWA 2B2UC 1XPOA 4IPGA 2AQ2B 2KENA 1EYCA 2ZXRA 4XT3B 5M3FB 1QVFA 5KIXA 1NR4A 4P2CB 1GUOA 3I90A 3D4DA 3BZCA 3NELA 4HJ8A 3RR5A 1SAPA 2R7ZB 4DK0A 1EY7A 3C2PA 2WB1G 4A3GH 4LFBQ 3HFZB 4J6HA 4JV5L 4YWLA 1B70B 4GKKQ 1D2BA 4Y7NB 4AQYL 2BA1A 4UP8A 5FLXc 2CQAA 4DV3Q 3PUVA 3SXHA 1S4ZA 1VQMA 2R7ZH 1VQLA 2R93G 2H5XA 3NQTA 5JVG3 1ENFA 1Y1VG 3E6ZX 1NE3A 1SYDA 1D5XC 1KL9A 3NPPA 5HY6A 2Q2UA 1B9MA 1FL0A 4Y7NH 3JAMi 3HOXG 1IYUA 1OXVA 1QUQA 2NZ1D 3U9SA 1B50A 3FKIB 3DHQA 4DUZL 1AZQA 4A3LH 1TVXA 1KAAA 4JC0A 3VDYA 5FK9C 3I73A 4MNOA 3NTHA 1DZ1A 4APVA 4EX5A 2JSOA 2YTXA 4PV1C 2WFWA 1X3FA 3P20A 2A6EC 1BCPB 1STYA 4QB4A 1M1KC 4XQQA 1G2SA 1Q86C 4OO1G 1YJ9A 3D6CA 4R4QA 1D1KA 2L5TA 3CCRA 4JI1L 2RVLA 1FJGL 1JOKA 4POFA 4IUTA 1VQ5A 4ODGA 2EYLA 1SROA 4KJOA 3VA7A 2PZUA 3NENA 3U9OA 1EY9A 1EIYB 3OTOL 5EKLA 4DR3L 3E0EA 2JEAI 1WI5A 4PNYA 1SE3A 5EQ0A 3V05A 1Y69U 1J5EQ 3RZOH 3NBHA 1HHVA 3J81E 2EYPA 1F2LA 1TS2A 4JI4Q 3W1GA 3IAYA 2RHQB 4QF4A 2ENBA 2E2JH 4X65Q 3PGZA 4DV5Q 1O7YA 1BXTA 1OTCA 2PMZE 1VQDA 1WCMG 1X6OA 1EEID 4CKBA 4H7BA 4FP5D 4ZK9B 4C3HB 4KI0A 2AUJD 5L37A 4FNFA 1PH7A 1EU4A 3S17B 2XGTA 3SK6A 1IL8A 1QE6A 1FGUA 1GXDC 2PNHA 2SNMA 1JT8A 2BE5D 2JQOA 4UY8C 2KEDA 4AYBG 2A69C 2E74C 1Z9FA 1M4VA 5D3DA 2CHBD 1RIPA 4QL5A 2E75C 2O5JC 4A3DB 4P75A 1F2YA 3S17H 3OOCA 4K5VA 3E3XA 1D5MC 4ID6A 2LY7A 4H0LC 2F0LA 3I56A 2EYHA 1ML0D 3T1YQ 4JI0Q 3KLWA 5JPMC 4A3DH 2BH8A 2JYOA 2JA5G 1ONLA 5CGKA 4GNXA 3UDXA 1JORA 3DLLA 3OYYA 2HHHQ 1CA5A 4QUCA 2F3IA 1ZYRC 1KDCA 4C3IH 3K7AB 5C44H 1Q1EA 4KV6A 2XWJB 1XNRQ 4BXXH 2D9UA 4PMCA 4MIUA 4BY7B 4DR5L 1WTPA 2A74C 5IE8A 2F0EA 2K5VA 3RZDB 3DEPA 2PCFB 2WACA 3T13A 1LTTD 2KA7A 4IPCA 3PO2B 2PZWA 2LS01 2WKDA 2N78A 3QJYA 2K33A 1X56A 3GDEA 1PHJA 4FXDA 4KMUC 2DNEA 2V4DA 1IYVA 1VQ4A 5JEAG 1SNOA 1HXYD 2K75A 4FXGC 3HOWG 1TS3A 3PO2H 1EY0A 2ZTCA 2B2YC 1PH2A 4IZ8A 2RHSB 3G6JB 4DNRB 2OQ0A 4ZQ3A 3Q24A 3T4AC 1YJNA 3WWVA 4IPHA 4RCOA 4GLAC 3TS2A 3DEOA 2CW0C 1PFMA 4DV6Q 4XQNA 4DV7L 4JI7Q 3CC2A 1XPRA 3K80C 1X3PA 1ENAA 4LK1C 4A3EG 2KVMA 3F2UA 3WOEA 3PQIA 1TWFB 5JAVA 4B3TL 1L1OB 2H1EA 2NTSA 1LV9A 4IUQA 3EJIA 5EPLA 4L5TA 4KHZA 3HOVG 4JYAQ 4OHJA 3FPPA 4DR6L 3DM3A 2K03A 4IUVA 4TVAB 1YITA 4X64L 3LGJA 4A3BB 1XMQQ 1PTOD 1VQCA 4BWGB 2IT1A 1PRTD 3PO3B 4XDXA 1NNXA 3W1BA 1CKNB 3BJUA 1C9OA 1HR0L 4RG1A 2MFIA 1E2ZA 2A6HC 4K14A 3NSWA 4A3BH 3I4MG 4A3CG 4NB3A 1ASZA 4DUYQ 3S1QB 5DM63 3PO3H 2PW7A 5IP7G 3M7NA 1RTNA 4QMGA 3IFDA 5KNBA 4L5RC 2VS1A 3U4VA 4IUUA 4HN7A 5FO9B 4AH6A 4DXFA 1OXTA 2F0FA 1BO0A 5FO7B 4NKLA 2JA8B 1HQRD 4ZCKA 2EDGA 2VQEQ 4JBJA 3I2ZA 3NTIA 3OHXC 2DUDA 1CZGA 4PZ8A 1TY0A 4B3SQ 5DM73 3HKZG 1OXSC 4LF4L 3AYHB 4K5XA 4CKEA 4G7HC 1AE3A 3CQZB 2JA8H 1P16A 5K5PA 5FO8B 1EWHA 3FPUB 1SFOB 2UXCL 4R8IA 1HRJA 3WDNA 5EKKA 1N32L 2I5MX 2R92G 2B3GA 2QDBA 2PO4A 3C1FA 1O7LA 5CV7A 5IYCG 3OMGA 5KRUA 3CQZH 3NWSA 4C56C 1YNND 1UNSA 1MI2A 5IYBH 3J81j 3PIPA 1SFOH 4IPDA 5ELFA 4NXNL 2B63B 2AQ3B 1X3GA 4HIDA 3R93A 4LAAA 3D4RA 2KQ3A 5KYLA 3CCLA 2F03A 1HUNA 1YEZA 3AB9A 1TWCH 4FF1A 3D0FA 1N34L 1KLGD 1TWHB 2DJFC 2B63H 4A3KG 3NBHB 1KAWA 1UEBA 1HH2P 5D3IB 3M4OB 3FRPB 1CM9A 1TY2A 5BN3A 4C3JG 5C0XI 3MXNA 3O13A 4XXEA 3CF5A 2ZM6Q 3T53B 2AUKA 1TWHH 4G4KA 2B2VC 1I3QH 1PZJD 1K8AC 4U673 3M4OH 4X62L 1VQNA 2Y0SG 3TS0A 4GZYC 4KD3A 4DK1A 2UXDQ 4CGYB 3N6RA 3J80i 3CAMA 4IO9A 4JI3L 1JICA 1CZWA 3A7LA 2A73B 2UUAQ 3E5SA 4DFAA 3C3LA 4XQJA 3BVZA 4R4OA 1YNJC 5M3MG 4EQ5A 4HSPA 5EBDA 2NVYB 2F4IA 1JB3A 5FJ8H 1AN8A 1YZ6A 4JK1C 1F9PA 2XIWA 1PA6A 1MHWC 2A19A 4GNXB 1JJCB 4LFBL 1TQOA 1V1PB 3EQLC 1JWMD 4GKKL 1CSQA 2MNAA 4BY1G 4DV1Q 2NVYH 2MO0A 2QGQA 1SDFA 4DV3L 1G8ZD 1NMGA 3NBIA 4YIJA 5DNFA 1TR5A 3PUZA 2M2LA
chains in the Genus database with same CATH topology
1HNWQ 3PUYA 1MJEA 3SGIA 5GAGC 1T9HA 2ZJRA 3CCUA 1VQPA 1Q7YC 3KDFB 4FDBA 3I4MH 1PVOA 1UE5A 4HIKA 3AEVA 1X54A 5JJKA 3IRBA 3M4PA 4DV2L 3PF5A 4DR7L 1AH9A 4A3CG 2HQLA 1W2BA 4NXNQ 2HIVA 4GN5A 3KF6A 4A3IG 4B3RQ 2E8GA 4DV4L 3CD6A 1IXRA 3ERSX 4WJ3M 1Q12A 3F2CA 2CWPA 1N8RC 1YHQA 2UXBL 3B6YA 1EFWA 1EIFA 1MKHA 1SR3A 2WP8J 4H02A 4P71A 2LSSA 5LMNW 4JI7L 3S14H 3GD7A 4A75A 1QUQB 1WFQA 4RMFA 2IY5B 2E2IH 4QJFA 1W3SA 4R4IA 1EYGA 2F4VQ 2AWOA 3CCMA 2OQKA 2KCMA 2GN5A 4LF5L 1XNQQ 3I4NG 2KHJA 2ASBA 3CXCA 5LMNQ 3PV0A 1WOCA 5GQOA 1IL2A 2YTVA 3H0GG 4QIWE 1PH9A 3I4NH 4GN3B 4PZ7A 5J3BA 2JA7G 1LTLA 3TQYA 4C3HH 4X62Q 3H0GH 4JOIC 2R92H 1YJWA 1EQQA 3HKSA 2JA7H 4GKJL 2E5LL 1UE6A 4K0KL 2L15A 2UU9Q 4GN4B 3HOZG 1A0IA 1J5EL 4IFDJ 1G6PA 4LFAQ 4JI3Q 1TWAH 1Y1WG 3S1MH 3D31A 4BA2I 1IBKL 1YIJA 2I0QA 1KIXA 1A8VA 1KRSA 4JI4L 2AHOB 3S16H 5GROA 2OWOA 2VUMH 4X65L 4DV5L 3ZJYC 1Y1WH 1I94Q 1UE1A 3S1RH 2KCTA 2K4KA 4YWKA 1XPOA 2NVXH 4IPGA 3JAMc 1K83H 4B3TQ 3J81c 2KENA 3ICEA 1XMOQ 1QVFA 1VQ7A 1O7IA 2ZTDA 2QEXA 1EWIA 3BZCA 4JI8Q 3CPWA 2K5HA 3NELA 2OCEA 4HJ8A 4OX9Q 4A3GG 3RR5A 4DR6Q 4BXXG 4C3JH 1VQGA 1IBMQ 1LYLA 4ALPA 4X66Q 1KD1C 1HNXQ 2WB1G 3G71A 4A3GH 4LFBQ 1YBYA 2K50A 1NY4A 1YHBA 3HFZB 4IJHA 5FLMH 2NVTH 4JV5L 4YWLA 1B70B 1SMXA 2R7ZG 2V1CC 2KBNA 2EQSA 4GKKQ 4BA1I 1XPUA 4IOAA 3K7AH 4AQYL 2BA1A 4UP8A 5FLXc 3PSIA 4DV3Q 3PUVA 1VQMA 1PH3A 2R7ZH 4BY7G 3G4SA 4LUVA 1X65A 1J6QA 1VQLA 3F8TA 2H5XA 3F2DA 4QQBX 5C0XG 2R93G 2DGYA 1Y1VG 3HOUG 2CQOA 3T1YL 4BY7H 1PV4A 2OTJA 4IFDI 1NE3A 5BR8L 2Q2UA 4JI0L 1KL9A 4YHHL 5HY6A 3RZDH 2R93H 1FL0A 4Y7NH 3CMAA 3S15H 1UE7A 3JAMi 3HOXG 1Y1VH 1GKHA 3J81i 3HOUH 4JI5L 5IYDG 1CUKA 1OXVA 1QUQA 3M3YH 4DR7Q 1VQOA 4DNIA 2HHHL 1V43A 4DUZL 2R6GA 3RLNA 2WAQE 4DV0L 4DV4Q 2ZJQA 4A3LH 4JC0A 3VDYA 1N33L 1BBWA 1E7ZA 4MNOA 1CKOA 4UP7A 4PMWA 4APVA 4KLKA 3AQQA 2KHIA 2YTXA 4EX5A 5M5WH 3GTKH 1SN8A 2UXBQ 5H1SE 2AWNA 2WFWA 5EAYA 1X3FA 4DR4L 3F2BA 1Q46A 1QVCA 3RNUA 1XNRL 1Q82C 3KOJA 5K36G 3TRZA 1M1KC 3T1HL 2YTYA 5JJLA 5M5XH 1NJIC 3UDGA 4R4TA 2D62A 1Q86C 4OO1G 1YJ9A 2YYZA 4R4QA 4JI2Q 3U50C 1FVIA 4A3FG 2Q2TA 4DK3C 2YV5A 3CCRA 2JEBI 4LF5Q 3KFUA 4DR1L 4JI1L 2CWAA 2UUCL 1FJGL 4POFA 4BY1H 1E1OA 1VQ5A 4A3FH 2EIFA 1CKMA 1SROA 3HKZE 2MO1A 3NENA 1EIYB 1TWFH 1VQIA 3OTOL 4A3JG 4DR3L 3E0EA 2JEAI 2GVAA 2PQAB 2E5LQ 4K0KQ 1WI5A 3STBD 1QVGA 3RZOH 1J5EQ 3KJOA 1KQSA 4A3JH 4JI6Q 3L2PA 4LWCA 5E7NA 1IBKQ 4MTNA 3CCSA 1HZAA 4GOPB 5HGQA 4JI4Q 3W1GA 4A93G 2RHQB 2E2JH 4X65Q 3PGZA 4DV5Q 3AFQA 4HIMA 4A3IH 4A3BG 4BBSG 3S1NH 1A62A 1PFSA 1PH1A 1OTCA 1XTDA 1VQBA 1KHIA 1VQDA 2PMZE 4DV6L 1X9NA 1WCMG 1N34Q 4BBSH 3CC4A 1X6OA 3PUZA 1M90C 1EUJA 3M4QA 1IBLL 3RN5A 1SLJA 1C7YA 1WCMH 2NN6I 1YI2A 4YY3L 2JA9A 4KI0A 1A63A 1K73C 1PH7A 3JC66 2XGTA 1FGUA 2PNHA 1VQ9A 1VQ6A 1JT8A 1R9TH 4UY8C 2AKWB 2JQOA 1Q1BA 4AYBG 5IP9G 1Z9FA 3STBC 4JBKA 4P73A 3J7ZC 3S1QH 4JV5Q 4JYAL 1G51A 1RIPA 4QL5A 2OTLA 1X3EA 2VNUD 2RCNA 5GAEC 4AIMA 4P75A 3S17H 4AQYQ 4X6AH 3GTGH 1HZ9A 1PYBA 4OWTB 1XMQL 1GO3E 3G48A 2UUBL 4OONA 4DKAC 1JB7A 3I4OA 2IHFA 3HOZH 4A3DG 4A76A 3I56A 3H3VH 1DGSA 1NTGA 2VY3A 3T1YQ 1TXYA 2VW9A 1RL2A 4JI0Q 2I5LX 3KLWA 1TWGH 2AMCB 1NBWA 4UPAA 5IWAL 1ASYA 2ES2A 3KF8B 2BH8A 1V9PA 2JA5G 2Y0SE 4A3DH 2ZTEA 4DR2L 1N36Q 1S3OA 4GNXA 2GVBA 3UDXA 2R7FA 3DLLA 4DUYL 1HNWL 3OYYA 2HHHQ 2JA5H 4LFCL 5IYBG 2A1AA 4DUZQ 4DV0Q 4DAMA 5C44G 3BZKA 4YCWA 2F3IA 4LF9L 1N33Q 1E3PA 4C3IH 2E2HH 5C44H 1Q1EA 2LXKA 4L5SA 3GO5A 4DR4Q 5DLQE 2HT1A 2N8NA 1XNRQ 4IJLA 3CW2C 4BXXH 1GM5A 4DR5L 3PUXA 2VQEL 3T1HQ 3KDFA 1H95A 2MQHA 2K5VA 5IE8A 2PQAA 2JJQA 4B3SL 4IPCA 4OWWB 4IOCA 2N78A 5JJIA 1B7YB 4JI1Q 1X56A 2UUCQ 1FJGQ 4P74A 3KF6B 2EXDA 3GDEA 1PHJA 2ATWA 1GVPA 3PUWA 3PO2G 3FHWA 1VQ4A 1PYSB 5JEAG 3CC7A 4YWMA 2K75A 3HOWG 3OTOQ 1I50H 3S24A 4DR3Q 3PO2H 1BVSA 2IHEA 3F1ZA 4DV2Q 2VL6A 2ZTCA 3HOWH 1OXXK 1QZHA 4GLVB 3HOXH 3OW2A 3CCQA 1PH2A 1JMCA 5IYDH 2RHSB 2I5HA 2OQ0A 5ELNA 1VCIA 1X55A 2F52A 1P8LA 3WWVA 1YJNA 2BH2A 4IPHA 4GNXC 4GLAC 3TS2A 1IZ6A 4HIOA 4DV6Q 4DV7L 3GTJH 3CC2A 4P72A 1XPRA 4JI7Q 3K80C 1VQJA 2IX1A 2Z6KA 1IBLQ 4A3EG 4B3ML 2D0OA 4O0AA 1VQFA 2ALYB 3UE1A 4YY3Q 2B29A 4OO1I 3K7UC 4B3TL 4A3EH 1L1OB 3M85A 2ID0A 3BU2A 4NXML 4DK6C 4A93H 3L7ZC 4L5TA 3CCJA 4KHZA 3U4ZA 4OX9L 3HOVG 4JYAQ 1GD7A 2ZM6L 4DR6L 2K5NA 3DM3A 4LF6L 4LUOA 4LNQA 4ME3A 4TVAB 4X66L 3HOVH 4GKJQ 1YITA 4X64L 4GOPC 3LGJA 1HZCA 4NPSA 1L2FA 1S40A 1XMQQ 5C3EG 1VQCA 3EIVA 3H15A 2UUBQ 2VQFL 4XTCS 2IT1A 3E9HA 2JK8A 4LF7L 3W5OA 3GTQH 3W1BA 5C4JH 1CKNB 1N9WA 3BJUA 4JBMA 1PH4A 1C9OA 4R1JA 3MXNB 5IT9c 1HR0L 2UXDL 4RG1A 5GAHC 1BKBA 1VS0A 1G291 2MFIA 2NVQH 1VQEA 2WAQG 4DR2Q 3PO3G 4A3BH 2N49A 3I4MG 1AE2A 4NB3A 1QZGA 3I55A 1ASZA 1JE5A 3M9BA 1YNXA 4DUYQ 3RN2A 1E24A 4LFCQ 3PF4A 3PO3H 5AJ3L 5IP7G 1HJPA 3M7NA 4A3CH 5M5YH 2R7DA 3EBEA 1IYJB 2UUAL 2QA4A 4LF9Q 2K14A 3UE0A 4L5RC 2VS1A 3U4VA 5IP7H 3CP0A 4KHPL 4QY7A 5IY0A 2Z6KC 4AH6A 1OXTA 1BBUA 4HJ7A 1EOVA 1Q8KA 3GTLH 4DR5Q 2VQEQ 4JBJA 3I2ZA 5LMUL 1YHAA 4LF8L 5IP9H 2VZAA 2DUDA 4PZ8A 4B3SQ 5C0XJ 3EN2A 2JA8G 3HKZG 1XJVA 4OXPA 3H3VI 1OXSC 4A4IA 5JEAJ 2NN6G 3AYHB 4LF4L 2XTIA 4PG3A 4WJ4A 4BBRG 1AE3A 2CCZA 2JA8H 1P16A 2WB1E 4DV1L 1KC8C 4JI2L 1PH5A 5BR8Q 4BBRH 1UWVA 4YHHQ 1S72A 1HNZL 1LM0A 2A8VA 2UXCL 3ULLA 3CCEA 1PH6A 1N32L 2I5MX 1VQHA 4JI5Q 2R92G 1MIUA 2B3GA 3GTOH 1HZBA 1U0LA 4J15A 1Y14B 3UDIA 5IYCG 3I7FA 4QGUA 3CQZH 3TREA 2NZOA 1JJGA 1L1OA 4DPGA 2YU9H 3HOYG 4OWXB 5IYCH 5IYBH 3J81j 3PIPA 1SFOH 4JI6L 1V1QA 4IPDA 3A74A 4NXNL 3CMEA 2VUMG 3MEFA 1X3GA 4O2DA 4HIDA 3J80c 4POGA 3HOYH 3FP9A 4B3RL 4DV7Q 1JJ2A 1KXLA 2HIXA 3Q8DA 3A5ZB 2Q2HA 3CCLA 1YEZA 3PCOB 3RLOA 4UP9A 4B3MQ 3ULJA 2N3SA 4C2MH 2B63G 1TWCH 1VQ8A 3D0FA 3E9IA 1N34L 2PI2A 4JCVE 2B63H 4A3KG 4R4CA 1K8GA 4GLXA 3NBHB 1KAWA 1UEBA 3KYHC 4DR1Q 4NXMQ 1HH2P 1PH8A 2C35B 3ER0A 4GOPA 2F4VL 5ELOA 1KRTA 4A3KH 1CKNA 5C0XI 1U5KA 3S2DH 3TEHB 3CF5A 2ZM6Q 5M3FG 4LF6Q 1HR0W 5FLMG 1XNQL 2Q2IA 5LMNL 1TWHH 1I5FA 3CCVA 4X64Q 1MJCA 5M3FH 1Q81C 1D7QA 2D0PA 1K8AC 3M4OH 2VQFQ 4X62L 1E22A 1WYDA 2IX0A 4XIGS 2Y0SG 3TS0A 4PZ6A 4LF7Q 1VQNA 3J7A5 2UU9L 2UXDQ 2RF4A 1HR0Q 1CSPA 3J80i 3CAMA 1SE8A 4JI3L 4HJAA 4IO9A 4LFAL 2JA6G 3GTMH 1I6HH 3K0XA 4A3MG 2Z0SA 1L1OC 4YCUA 3G6EA 1I94L 2JA6H 4IFDG 5AJ3Q 1D8LA 4L5QA 2LXJA 5C4XG 4A3MH 1SRUA 4MZ9A 2UUAQ 1N36L 2PI2E 4A3LG 4DAYB 3ULPA 1WJJA 4YCVA 1Z47A 5C4XH 1XMOL 4KHPQ 1VQAA 2ZJPA 4R4OA 5FJ8G 5GADC 1L0WA 1K3RA 1E1TA 2K52A 4JI8L 5M3MG 1LUZA 4EQ5A 3L0OA 1OXUA 3A0JA 2CFMA 2JE6I 1NMFA 5FJ8H 2NZHA 4Y52H 3FKIG 1YZ6A 4TQUS 3PIOA 3A5UA 5M3MH 5LMUQ 3AFPA 4LF8Q 1PA6A 1IBML 2A19A 4HJ9A 4GNXB 1JJCB 1HNXL 4LUZA 4LFBL 3FKIH 3K81C 3K8AA 4JBWA 4GS3A 1YVCA 4LF4Q 3U58A 3UDFA 4GKKL 4LW1A 1CSQA 4AYBE 2CKZB 1K0RA 1EQRA 4BY1G 2MNAA 4DV1Q 2NVYH 3RLFA 2MO0A 2QGQA 4JG2A 3NEMA 5C3EH 2BA0A 2FXQA 3KJPA 4DV3L 1VQKA 4JOIA 5IWAQ 1HNZQ 2UXCQ 1NMGA 1K9MC 3CPFA 1C0AA 3GTPH 1N32Q 4HJ5A 1B8AA 1I3QH 3S2HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW Q;  3PUY A;  1MJE A;  3SGI A;  5GAG C;  1T9H A;  2ZJR A;  3CCU A;  1VQP A;  1Q7Y C;  3KDF B;  4FDB A;  3I4M H;  1PVO A;  1UE5 A;  4HIK A;  3AEV A;  1X54 A;  5JJK A;  3IRB A;  3M4P A;  4DV2 L;  3PF5 A;  4DR7 L;  1AH9 A;  4A3C G;  2HQL A;  1W2B A;  4NXN Q;  2HIV A;  4GN5 A;  3KF6 A;  4A3I G;  4B3R Q;  2E8G A;  4DV4 L;  3CD6 A;  1IXR A;  3ERS X;  4WJ3 M;  1Q12 A;  3F2C A;  2CWP A;  1N8R C;  1YHQ A;  2UXB L;  3B6Y A;  1EFW A;  1EIF A;  1MKH A;  1SR3 A;  2WP8 J;  4H02 A;  4P71 A;  2LSS A;  5LMN W;  4JI7 L;  3S14 H;  3GD7 A;  4A75 A;  1QUQ B;  1WFQ A;  4RMF A;  2IY5 B;  2E2I H;  4QJF A;  1W3S A;  4R4I A;  1EYG A;  2F4V Q;  2AWO A;  3CCM A;  2OQK A;  2KCM A;  2GN5 A;  4LF5 L;  1XNQ Q;  3I4N G;  2KHJ A;  2ASB A;  3CXC A;  5LMN Q;  3PV0 A;  1WOC A;  5GQO A;  1IL2 A;  2YTV A;  3H0G G;  4QIW E;  1PH9 A;  3I4N H;  4GN3 B;  4PZ7 A;  5J3B A;  2JA7 G;  1LTL A;  3TQY A;  4C3H H;  4X62 Q;  3H0G H;  4JOI C;  2R92 H;  1YJW A;  1EQQ A;  3HKS A;  2JA7 H;  4GKJ L;  2E5L L;  1UE6 A;  4K0K L;  2L15 A;  2UU9 Q;  4GN4 B;  3HOZ G;  1A0I A;  1J5E L;  4IFD J;  1G6P A;  4LFA Q;  4JI3 Q;  1TWA H;  1Y1W G;  3S1M H;  3D31 A;  4BA2 I;  1IBK L;  1YIJ A;  2I0Q A;  1KIX A;  1A8V A;  1KRS A;  4JI4 L;  2AHO B;  3S16 H;  5GRO A;  2OWO A;  2VUM H;  4X65 L;  4DV5 L;  3ZJY C;  1Y1W H;  1I94 Q;  1UE1 A;  3S1R H;  2KCT A;  2K4K A;  4YWK A;  1XPO A;  2NVX H;  4IPG A;  3JAM c;  1K83 H;  4B3T Q;  3J81 c;  2KEN A;  3ICE A;  1XMO Q;  1QVF A;  1VQ7 A;  1O7I A;  2ZTD A;  2QEX A;  1EWI A;  3BZC A;  4JI8 Q;  3CPW A;  2K5H A;  3NEL A;  2OCE A;  4HJ8 A;  4OX9 Q;  4A3G G;  3RR5 A;  4DR6 Q;  4BXX G;  4C3J H;  1VQG A;  1IBM Q;  1LYL A;  4ALP A;  4X66 Q;  1KD1 C;  1HNX Q;  2WB1 G;  3G71 A;  4A3G H;  4LFB Q;  1YBY A;  2K50 A;  1NY4 A;  1YHB A;  3HFZ B;  4IJH A;  5FLM H;  2NVT H;  4JV5 L;  4YWL A;  1B70 B;  1SMX A;  2R7Z G;  2V1C C;  2KBN A;  2EQS A;  4GKK Q;  4BA1 I;  1XPU A;  4IOA A;  3K7A H;  4AQY L;  2BA1 A;  4UP8 A;  5FLX c;  3PSI A;  4DV3 Q;  3PUV A;  1VQM A;  1PH3 A;  2R7Z H;  4BY7 G;  3G4S A;  4LUV A;  1X65 A;  1J6Q A;  1VQL A;  3F8T A;  2H5X A;  3F2D A;  4QQB X;  5C0X G;  2R93 G;  2DGY A;  1Y1V G;  3HOU G;  2CQO A;  3T1Y L;  4BY7 H;  1PV4 A;  2OTJ A;  4IFD I;  1NE3 A;  5BR8 L;  2Q2U A;  4JI0 L;  1KL9 A;  4YHH L;  5HY6 A;  3RZD H;  2R93 H;  1FL0 A;  4Y7N H;  3CMA A;  3S15 H;  1UE7 A;  3JAM i;  3HOX G;  1Y1V H;  1GKH A;  3J81 i;  3HOU H;  4JI5 L;  5IYD G;  1CUK A;  1OXV A;  1QUQ A;  3M3Y H;  4DR7 Q;  1VQO A;  4DNI A;  2HHH L;  1V43 A;  4DUZ L;  2R6G A;  3RLN A;  2WAQ E;  4DV0 L;  4DV4 Q;  2ZJQ A;  4A3L H;  4JC0 A;  3VDY A;  1N33 L;  1BBW A;  1E7Z A;  4MNO A;  1CKO A;  4UP7 A;  4PMW A;  4APV A;  4KLK A;  3AQQ A;  2KHI A;  2YTX A;  4EX5 A;  5M5W H;  3GTK H;  1SN8 A;  2UXB Q;  5H1S E;  2AWN A;  2WFW A;  5EAY A;  1X3F A;  4DR4 L;  3F2B A;  1Q46 A;  1QVC A;  3RNU A;  1XNR L;  1Q82 C;  3KOJ A;  5K36 G;  3TRZ A;  1M1K C;  3T1H L;  2YTY A;  5JJL A;  5M5X H;  1NJI C;  3UDG A;  4R4T A;  2D62 A;  1Q86 C;  4OO1 G;  1YJ9 A;  2YYZ A;  4R4Q A;  4JI2 Q;  3U50 C;  1FVI A;  4A3F G;  2Q2T A;  4DK3 C;  2YV5 A;  3CCR A;  2JEB I;  4LF5 Q;  3KFU A;  4DR1 L;  4JI1 L;  2CWA A;  2UUC L;  1FJG L;  4POF A;  4BY1 H;  1E1O A;  1VQ5 A;  4A3F H;  2EIF A;  1CKM A;  1SRO A;  3HKZ E;  2MO1 A;  3NEN A;  1EIY B;  1TWF H;  1VQI A;  3OTO L;  4A3J G;  4DR3 L;  3E0E A;  2JEA I;  2GVA A;  2PQA B;  2E5L Q;  4K0K Q;  1WI5 A;  3STB D;  1QVG A;  3RZO H;  1J5E Q;  3KJO A;  1KQS A;  4A3J H;  4JI6 Q;  3L2P A;  4LWC A;  5E7N A;  1IBK Q;  4MTN A;  3CCS A;  1HZA A;  4GOP B;  5HGQ A;  4JI4 Q;  3W1G A;  4A93 G;  2RHQ B;  2E2J H;  4X65 Q;  3PGZ A;  4DV5 Q;  3AFQ A;  4HIM A;  4A3I H;  4A3B G;  4BBS G;  3S1N H;  1A62 A;  1PFS A;  1PH1 A;  1OTC A;  1XTD A;  1VQB A;  1KHI A;  1VQD A;  2PMZ E;  4DV6 L;  1X9N A;  1WCM G;  1N34 Q;  4BBS H;  3CC4 A;  1X6O A;  3PUZ A;  1M90 C;  1EUJ A;  3M4Q A;  1IBL L;  3RN5 A;  1SLJ A;  1C7Y A;  1WCM H;  2NN6 I;  1YI2 A;  4YY3 L;  2JA9 A;  4KI0 A;  1A63 A;  1K73 C;  1PH7 A;  3JC6 6;  2XGT A;  1FGU A;  2PNH A;  1VQ9 A;  1VQ6 A;  1JT8 A;  1R9T H;  4UY8 C;  2AKW B;  2JQO A;  1Q1B A;  4AYB G;  5IP9 G;  1Z9F A;  3STB C;  4JBK A;  4P73 A;  3J7Z C;  3S1Q H;  4JV5 Q;  4JYA L;  1G51 A;  1RIP A;  4QL5 A;  2OTL A;  1X3E A;  2VNU D;  2RCN A;  5GAE C;  4AIM A;  4P75 A;  3S17 H;  4AQY Q;  4X6A H;  3GTG H;  1HZ9 A;  1PYB A;  4OWT B;  1XMQ L;  1GO3 E;  3G48 A;  2UUB L;  4OON A;  4DKA C;  1JB7 A;  3I4O A;  2IHF A;  3HOZ H;  4A3D G;  4A76 A;  3I56 A;  3H3V H;  1DGS A;  1NTG A;  2VY3 A;  3T1Y Q;  1TXY A;  2VW9 A;  1RL2 A;  4JI0 Q;  2I5L X;  3KLW A;  1TWG H;  2AMC B;  1NBW A;  4UPA A;  5IWA L;  1ASY A;  2ES2 A;  3KF8 B;  2BH8 A;  1V9P A;  2JA5 G;  2Y0S E;  4A3D H;  2ZTE A;  4DR2 L;  1N36 Q;  1S3O A;  4GNX A;  2GVB A;  3UDX A;  2R7F A;  3DLL A;  4DUY L;  1HNW L;  3OYY A;  2HHH Q;  2JA5 H;  4LFC L;  5IYB G;  2A1A A;  4DUZ Q;  4DV0 Q;  4DAM A;  5C44 G;  3BZK A;  4YCW A;  2F3I A;  4LF9 L;  1N33 Q;  1E3P A;  4C3I H;  2E2H H;  5C44 H;  1Q1E A;  2LXK A;  4L5S A;  3GO5 A;  4DR4 Q;  5DLQ E;  2HT1 A;  2N8N A;  1XNR Q;  4IJL A;  3CW2 C;  4BXX H;  1GM5 A;  4DR5 L;  3PUX A;  2VQE L;  3T1H Q;  3KDF A;  1H95 A;  2MQH A;  2K5V A;  5IE8 A;  2PQA A;  2JJQ A;  4B3S L;  4IPC A;  4OWW B;  4IOC A;  2N78 A;  5JJI A;  1B7Y B;  4JI1 Q;  1X56 A;  2UUC Q;  1FJG Q;  4P74 A;  3KF6 B;  2EXD A;  3GDE A;  1PHJ A;  2ATW A;  1GVP A;  3PUW A;  3PO2 G;  3FHW A;  1VQ4 A;  1PYS B;  5JEA G;  3CC7 A;  4YWM A;  2K75 A;  3HOW G;  3OTO Q;  1I50 H;  3S24 A;  4DR3 Q;  3PO2 H;  1BVS A;  2IHE A;  3F1Z A;  4DV2 Q;  2VL6 A;  2ZTC A;  3HOW H;  1OXX K;  1QZH A;  4GLV B;  3HOX H;  3OW2 A;  3CCQ A;  1PH2 A;  1JMC A;  5IYD H;  2RHS B;  2I5H A;  2OQ0 A;  5ELN A;  1VCI A;  1X55 A;  2F52 A;  1P8L A;  3WWV A;  1YJN A;  2BH2 A;  4IPH A;  4GNX C;  4GLA C;  3TS2 A;  1IZ6 A;  4HIO A;  4DV6 Q;  4DV7 L;  3GTJ H;  3CC2 A;  4P72 A;  1XPR A;  4JI7 Q;  3K80 C;  1VQJ A;  2IX1 A;  2Z6K A;  1IBL Q;  4A3E G;  4B3M L;  2D0O A;  4O0A A;  1VQF A;  2ALY B;  3UE1 A;  4YY3 Q;  2B29 A;  4OO1 I;  3K7U C;  4B3T L;  4A3E H;  1L1O B;  3M85 A;  2ID0 A;  3BU2 A;  4NXM L;  4DK6 C;  4A93 H;  3L7Z C;  4L5T A;  3CCJ A;  4KHZ A;  3U4Z A;  4OX9 L;  3HOV G;  4JYA Q;  1GD7 A;  2ZM6 L;  4DR6 L;  2K5N A;  3DM3 A;  4LF6 L;  4LUO A;  4LNQ A;  4ME3 A;  4TVA B;  4X66 L;  3HOV H;  4GKJ Q;  1YIT A;  4X64 L;  4GOP C;  3LGJ A;  1HZC A;  4NPS A;  1L2F A;  1S40 A;  1XMQ Q;  5C3E G;  1VQC A;  3EIV A;  3H15 A;  2UUB Q;  2VQF L;  4XTC S;  2IT1 A;  3E9H A;  2JK8 A;  4LF7 L;  3W5O A;  3GTQ H;  3W1B A;  5C4J H;  1CKN B;  1N9W A;  3BJU A;  4JBM A;  1PH4 A;  1C9O A;  4R1J A;  3MXN B;  5IT9 c;  1HR0 L;  2UXD L;  4RG1 A;  5GAH C;  1BKB A;  1VS0 A;  1G29 1;  2MFI A;  2NVQ H;  1VQE A;  2WAQ G;  4DR2 Q;  3PO3 G;  4A3B H;  2N49 A;  3I4M G;  1AE2 A;  4NB3 A;  1QZG A;  3I55 A;  1ASZ A;  1JE5 A;  3M9B A;  1YNX A;  4DUY Q;  3RN2 A;  1E24 A;  4LFC Q;  3PF4 A;  3PO3 H;  5AJ3 L;  5IP7 G;  1HJP A;  3M7N A;  4A3C H;  5M5Y H;  2R7D A;  3EBE A;  1IYJ B;  2UUA L;  2QA4 A;  4LF9 Q;  2K14 A;  3UE0 A;  4L5R C;  2VS1 A;  3U4V A;  5IP7 H;  3CP0 A;  4KHP L;  4QY7 A;  5IY0 A;  2Z6K C;  4AH6 A;  1OXT A;  1BBU A;  4HJ7 A;  1EOV A;  1Q8K A;  3GTL H;  4DR5 Q;  2VQE Q;  4JBJ A;  3I2Z A;  5LMU L;  1YHA A;  4LF8 L;  5IP9 H;  2VZA A;  2DUD A;  4PZ8 A;  4B3S Q;  5C0X J;  3EN2 A;  2JA8 G;  3HKZ G;  1XJV A;  4OXP A;  3H3V I;  1OXS C;  4A4I A;  5JEA J;  2NN6 G;  3AYH B;  4LF4 L;  2XTI A;  4PG3 A;  4WJ4 A;  4BBR G;  1AE3 A;  2CCZ A;  2JA8 H;  1P16 A;  2WB1 E;  4DV1 L;  1KC8 C;  4JI2 L;  1PH5 A;  5BR8 Q;  4BBR H;  1UWV A;  4YHH Q;  1S72 A;  1HNZ L;  1LM0 A;  2A8V A;  2UXC L;  3ULL A;  3CCE A;  1PH6 A;  1N32 L;  2I5M X;  1VQH A;  4JI5 Q;  2R92 G;  1MIU A;  2B3G A;  3GTO H;  1HZB A;  1U0L A;  4J15 A;  1Y14 B;  3UDI A;  5IYC G;  3I7F A;  4QGU A;  3CQZ H;  3TRE A;  2NZO A;  1JJG A;  1L1O A;  4DPG A;  2YU9 H;  3HOY G;  4OWX B;  5IYC H;  5IYB H;  3J81 j;  3PIP A;  1SFO H;  4JI6 L;  1V1Q A;  4IPD A;  3A74 A;  4NXN L;  3CME A;  2VUM G;  3MEF A;  1X3G A;  4O2D A;  4HID A;  3J80 c;  4POG A;  3HOY H;  3FP9 A;  4B3R L;  4DV7 Q;  1JJ2 A;  1KXL A;  2HIX A;  3Q8D A;  3A5Z B;  2Q2H A;  3CCL A;  1YEZ A;  3PCO B;  3RLO A;  4UP9 A;  4B3M Q;  3ULJ A;  2N3S A;  4C2M H;  2B63 G;  1TWC H;  1VQ8 A;  3D0F A;  3E9I A;  1N34 L;  2PI2 A;  4JCV E;  2B63 H;  4A3K G;  4R4C A;  1K8G A;  4GLX A;  3NBH B;  1KAW A;  1UEB A;  3KYH C;  4DR1 Q;  4NXM Q;  1HH2 P;  1PH8 A;  2C35 B;  3ER0 A;  4GOP A;  2F4V L;  5ELO A;  1KRT A;  4A3K H;  1CKN A;  5C0X I;  1U5K A;  3S2D H;  3TEH B;  3CF5 A;  2ZM6 Q;  5M3F G;  4LF6 Q;  1HR0 W;  5FLM G;  1XNQ L;  2Q2I A;  5LMN L;  1TWH H;  1I5F A;  3CCV A;  4X64 Q;  1MJC A;  5M3F H;  1Q81 C;  1D7Q A;  2D0P A;  1K8A C;  3M4O H;  2VQF Q;  4X62 L;  1E22 A;  1WYD A;  2IX0 A;  4XIG S;  2Y0S G;  3TS0 A;  4PZ6 A;  4LF7 Q;  1VQN A;  3J7A 5;  2UU9 L;  2UXD Q;  2RF4 A;  1HR0 Q;  1CSP A;  3J80 i;  3CAM A;  1SE8 A;  4JI3 L;  4HJA A;  4IO9 A;  4LFA L;  2JA6 G;  3GTM H;  1I6H H;  3K0X A;  4A3M G;  2Z0S A;  1L1O C;  4YCU A;  3G6E A;  1I94 L;  2JA6 H;  4IFD G;  5AJ3 Q;  1D8L A;  4L5Q A;  2LXJ A;  5C4X G;  4A3M H;  1SRU A;  4MZ9 A;  2UUA Q;  1N36 L;  2PI2 E;  4A3L G;  4DAY B;  3ULP A;  1WJJ A;  4YCV A;  1Z47 A;  5C4X H;  1XMO L;  4KHP Q;  1VQA A;  2ZJP A;  4R4O A;  5FJ8 G;  5GAD C;  1L0W A;  1K3R A;  1E1T A;  2K52 A;  4JI8 L;  5M3M G;  1LUZ A;  4EQ5 A;  3L0O A;  1OXU A;  3A0J A;  2CFM A;  2JE6 I;  1NMF A;  5FJ8 H;  2NZH A;  4Y52 H;  3FKI G;  1YZ6 A;  4TQU S;  3PIO A;  3A5U A;  5M3M H;  5LMU Q;  3AFP A;  4LF8 Q;  1PA6 A;  1IBM L;  2A19 A;  4HJ9 A;  4GNX B;  1JJC B;  1HNX L;  4LUZ A;  4LFB L;  3FKI H;  3K81 C;  3K8A A;  4JBW A;  4GS3 A;  1YVC A;  4LF4 Q;  3U58 A;  3UDF A;  4GKK L;  4LW1 A;  1CSQ A;  4AYB E;  2CKZ B;  1K0R A;  1EQR A;  4BY1 G;  2MNA A;  4DV1 Q;  2NVY H;  3RLF A;  2MO0 A;  2QGQ A;  4JG2 A;  3NEM A;  5C3E H;  2BA0 A;  2FXQ A;  3KJP A;  4DV3 L;  1VQK A;  4JOI A;  5IWA Q;  1HNZ Q;  2UXC Q;  1NMG A;  1K9M C;  3CPF A;  1C0A A;  3GTP H;  1N32 Q;  4HJ5 A;  1B8A A;  1I3Q H;  3S2H H; 
#chains in the Genus database with same CATH topology
 3CRK C;  1LTS D;  1T9H A;  3I70 A;  2A68 C;  3A7A B;  2Q8T A;  5JJK A;  2NUC A;  3IRB A;  4WJW A;  3Q23 A;  3PF5 A;  1AH9 A;  3J81 L;  1IXR A;  4WJ3 M;  2F0O A;  3TP5 A;  2R3Z A;  3B6Y A;  1EIF A;  1MKH A;  1SR3 A;  2F0J A;  2LSS A;  5LMN W;  3GD7 A;  4L8J A;  1TKW B;  3CU7 A;  4XYO A;  3GTO B;  2MGS A;  3E0J A;  4R4I A;  3CCM A;  2KCM A;  4ZUJ A;  5KND A;  5LMN Q;  5EPK A;  5GQO A;  3Q0A A;  2F0P A;  4KKU A;  2F0M A;  2SDF A;  5HUR A;  4H44 C;  1A2T A;  1II3 A;  3HG9 A;  3S1R B;  1YJW A;  4GKJ L;  1UE6 A;  2AQ1 B;  2L15 A;  1K83 B;  4GN4 B;  1A0I A;  1J5E L;  2UU9 Q;  1G6P A;  5EPJ A;  2F0Q A;  5T1G A;  1YIJ A;  5CMD A;  4JI4 L;  1QNK A;  3S16 H;  3X3M A;  4X65 L;  4DV5 L;  3ZJY C;  3SE0 A;  1UE1 A;  4ZKB B;  3S1R H;  2K1B A;  3SK5 A;  1K83 H;  4B3T Q;  3ICE A;  1STA A;  1KNA A;  1UEA B;  3A54 A;  1XMO Q;  2KEC A;  1Q8I A;  2OCE A;  1VDZ A;  4DR6 Q;  1B4O A;  2P5Z X;  1IBM Q;  1LYL A;  5FOB B;  1KD1 C;  4HTH A;  5FLM H;  4XYQ A;  1NY4 A;  3BDC A;  4IJH A;  2JA6 B;  2EQS A;  4EQP A;  1XPU A;  1LTA D;  4KK7 A;  4FF3 A;  3NE5 B;  2J7Z A;  4LUV A;  1J6Q A;  3F8T A;  3F2D A;  5C0X G;  2DGY A;  3KUP A;  3HOU G;  4C1N K;  3T1Y L;  4IFD I;  5BR8 L;  4JI0 L;  2RSO A;  2R93 H;  2F0G A;  1UE7 A;  1SEB D;  1Y1V H;  5IYD G;  3H09 A;  1A3V A;  2L11 A;  2K7V A;  1KTK A;  2HHH L;  2R6G A;  1D1I A;  3RLN A;  2WAQ E;  5A35 A;  2VB2 X;  2PYK A;  5CR3 A;  5KYI A;  1E7Z A;  2IY5 B;  1IW7 D;  2UXB Q;  3AQQ A;  3OWE B;  1I4R A;  5EAY A;  5CV5 A;  5J1Z A;  1CHQ D;  1XNR L;  3GTP B;  1NJI C;  2F0U A;  2YYZ A;  1LLR D;  3C46 A;  3U50 C;  1FVI A;  5I9P A;  2JEB I;  1A15 A;  2CWA A;  4OO1 H;  1SBB B;  1E1O A;  1H9J A;  2K04 A;  1VQI A;  1TII D;  2E5L Q;  2EYF A;  2RSN A;  3TBI B;  3JAM E;  1SE2 A;  1KDB A;  5I2X A;  1DM0 B;  3LX0 A;  5E7N A;  1S5C D;  1WCM B;  1HZA A;  3K58 A;  1WTX A;  1RCV D;  4BBS G;  2XRS D;  3FMC A;  4HIM A;  2NBF A;  3T51 B;  2F0N A;  2F3W A;  1X9N A;  4DV6 L;  1N34 Q;  3CC4 A;  2WII B;  1C7Y A;  3I4N B;  1WCM H;  2NN6 I;  3AMU A;  1A63 A;  2K28 A;  3H0G B;  1H9S B;  1QG7 A;  1SYG A;  1F9R A;  2Q8R E;  1FD7 D;  5G3L D;  1HFN A;  3OMC A;  2IPK D;  1KAB A;  5I4D A;  1Q1B A;  1WTQ A;  5IP9 G;  4I65 A;  3STB C;  4FF4 A;  3HOZ B;  4ZKC B;  4JYA L;  1RHP A;  1X3E A;  1LT4 D;  1TWG B;  1MGS A;  1W6J A;  5JPN C;  1HZ9 A;  4OWT B;  1XMQ L;  1GO3 E;  3G48 A;  4DKA C;  2JA5 B;  1JB7 A;  3I4O A;  2IHF A;  3HOZ H;  1K3B C;  3H3V H;  1U4M A;  3RUZ A;  1V1O A;  1DGS A;  1GJX A;  2VW9 A;  1B3Q A;  2KEE A;  1UUP A;  3OIQ A;  3MVV A;  1TWG H;  2AMC B;  4HCE A;  1QOH A;  2F0K A;  3P1H A;  4NMZ A;  4UDU C;  4DUY L;  3BS1 A;  2JA5 H;  4A3G B;  4YCW A;  3VYT A;  1NSN S;  1N33 Q;  5D14 A;  4DR4 Q;  5IGD A;  5DLQ E;  2Z8L A;  4QIW B;  3TDQ A;  1BCP D;  1GUG A;  5KGU A;  4Q5V A;  2VQE L;  4KY7 A;  4K8I A;  3T1H Q;  1H95 A;  2VB3 X;  2L55 A;  2NTT A;  2PQA A;  1PYW D;  4B3S L;  1SND A;  5ELB A;  3TP8 A;  5JJI A;  1B7Y B;  3HOW B;  2UUC Q;  4P74 A;  1GHJ A;  1K8O A;  1CQV A;  1TU2 B;  2N55 A;  2EYM A;  3FVQ A;  4CDF C;  2IHE A;  4IN3 A;  4JW0 A;  3F1Z A;  5JEA H;  3HOW H;  1ILQ A;  4GLV B;  3OSO A;  3CCQ A;  3MFY A;  2I5H A;  4RGM A;  4R9W A;  5ELN A;  4GNX C;  1L0Y B;  1R4Q B;  1HFG A;  4TSS A;  3GTJ H;  1QCB D;  1HQM C;  3NQI A;  2Z6K A;  3KBG A;  1IBL Q;  2QF7 A;  2D0O A;  3I72 A;  3K6O A;  1VQF A;  2ALY B;  3VR3 A;  1JR0 D;  1R4P B;  4A3E H;  4ME5 A;  3M7G A;  1PFB A;  3RZO B;  4OEM B;  2Z6B A;  1WTV A;  5CBE E;  3L7Z C;  3VYS A;  3U4Z A;  5C4J B;  1O80 A;  1GD7 A;  2ZM6 L;  2E2J B;  1M8A A;  5CV4 A;  4LUO A;  4FO2 A;  2NVQ B;  2PNR C;  4X66 L;  3HOV H;  4GKJ Q;  4GOP C;  2F0S A;  3IKJ A;  1L2F A;  1LTR D;  5C3E G;  2UUB Q;  3ND8 A;  3E9H A;  1OO9 B;  5IGF A;  5M5Y B;  5C4J H;  4JBM A;  5EGT A;  2UXD L;  1ICF B;  1G29 1;  2NVQ H;  1EYA A;  4DR2 Q;  1EY8 A;  4J1M A;  1EIG A;  1DYQ A;  1YNX A;  2E76 C;  1E24 A;  4LFC Q;  3PF4 A;  2EE1 A;  3DWA A;  4A3C H;  5M5Y H;  3EVQ A;  4KN7 C;  3EBE A;  2UUA L;  1IYJ B;  2RA4 A;  4LF9 Q;  1QWY A;  3K5N A;  3UE0 A;  5IP7 H;  4L63 B;  3CP0 A;  4EGV A;  4WRD A;  1BBU A;  4TRD A;  4JVZ A;  4HJ7 A;  4RGT A;  3QWN A;  4CJ2 C;  1J9O A;  3SR1 A;  5CV9 A;  2K5Q A;  1MBY A;  1YHA A;  1Y8N B;  2BOS A;  5E3F A;  2CH4 A;  2C9O A;  5JEA J;  2NN6 G;  5KEE A;  4WJ4 A;  4DU9 A;  4BBR G;  2CCZ A;  4DV1 L;  4I7Z C;  5BR8 Q;  1NUC A;  5JOB A;  4C3I B;  1FNU A;  1LM0 A;  1NR2 A;  1DXM A;  5C44 B;  3NK9 A;  1PH6 A;  1VQH A;  4RHS A;  1HZB A;  1U0L A;  2FIN B;  1Y14 B;  2X6L A;  4J15 A;  4E6I A;  4KTA A;  3I7F A;  2EXZ A;  3QOJ A;  3FEW X;  3R2T A;  3TRE A;  2N88 A;  4DPG A;  3HOY G;  4OWX B;  5EJW A;  1FR3 A;  5IGG A;  4K8J A;  2XWB B;  5IYC H;  1FNW A;  4DN4 M;  1KXL A;  3CRL C;  3MXG A;  2RBM A;  3NXW A;  4HMI A;  4MHE A;  1AW7 A;  4B3M Q;  3S2D B;  2ICE C;  2PI2 A;  1GHK A;  2Z4I A;  4JCV E;  4R4C A;  3VA5 A;  4DGZ A;  1K8G A;  1HUM A;  3A55 A;  3KLS X;  1EOT A;  3KYH C;  4NXM Q;  2C35 B;  4GOP A;  1X32 A;  2EOT A;  4A3K H;  3VYR A;  3MXU A;  4OIK A;  3S2D H;  2KJX A;  5M3F G;  2TSS A;  3K57 A;  3MA2 B;  2Q2I A;  5LMN L;  5IT9 E;  1PXU A;  1MJC A;  4KKS A;  1D7Q A;  5TSS A;  4FXK C;  1KNE A;  2FMM A;  2F0H A;  1E22 A;  1WYD A;  2IX0 A;  4LF7 Q;  3I3C A;  3J7A 5;  2UU9 L;  3NTK A;  1CSP A;  4K5W A;  3OIP A;  4HJA A;  3GTM H;  2JP1 A;  2XSC A;  1PLF A;  1CFM A;  3R3O A;  5AJ3 Q;  1D8L A;  4L5Q A;  1D5Z C;  1SRU A;  1N36 L;  5M3M B;  4A3L G;  1XTC D;  4CBV A;  1WJJ A;  1S5B D;  1Z47 A;  1XMO L;  4KHP Q;  1EWC A;  1LUZ A;  3L0O A;  1OXU A;  1U9R A;  3A0J A;  2F0V A;  2JE6 I;  3FKI G;  5FKA C;  4TQU S;  3PIO A;  5M3M H;  1STE A;  1IBM L;  4HJ9 A;  4O42 A;  4RWS C;  3DWP A;  3K81 C;  4JBW A;  2EY6 A;  2O5I C;  3U58 A;  1EFI D;  1W2B A;  3BYT B;  3R8B A;  1JOO A;  4JOI A;  2F0T A;  3BG3 A;  1K9M C;  3TME A;  1QIL A;  1JWS D;  4HJ5 A;  2B2W A;  3J80 E;  3SGI A;  5COR A;  1I4Q A;  4FDB A;  1SMY C;  3D6W A;  1UE5 A;  1GUT A;  3S14 B;  1SNM A;  3JAM L;  3MWY W;  4B3R Q;  3KF6 A;  3H3V C;  2E8G A;  3RD4 A;  4V0B A;  3ERS X;  5G3L F;  1SNP A;  4NP5 A;  2LFN A;  2CWP A;  3M4Y A;  5BN5 A;  2UXB L;  4KJN A;  1EFW A;  1EIH A;  3S14 H;  4A75 A;  1QUQ B;  4ABN A;  1SJE D;  3QOL A;  1EYG A;  1ET6 A;  5E4W C;  1XNQ Q;  2KHJ A;  2ASB A;  2DY7 A;  3S1M B;  3LWU A;  4C3H G;  3ERQ A;  4MN3 A;  2VUM B;  3S9W A;  1TWC B;  1EQQ A;  4DAY A;  2E5L L;  1NAP A;  4Z9C B;  2VXW A;  4LFA Q;  3S1M H;  4OL7 A;  2H4O A;  2I0Q A;  4K6D A;  1A8V A;  1KRS A;  1NCV A;  2VUM H;  1G2T A;  3DM1 A;  4EVO A;  1ZEQ X;  4YWK A;  4KY5 A;  1TT2 A;  3DUZ A;  3J81 c;  3H94 A;  1VQ7 A;  1O7I A;  2NVT B;  2QEX A;  4JI8 Q;  3CPW A;  2K5H A;  3V2T A;  2C5C A;  4BXX G;  1Q3L A;  1VQG A;  3HEJ A;  2NWG A;  4ALP A;  5C5M A;  4X66 Q;  1HNX Q;  4FVM A;  1YBY A;  2K50 A;  4KD4 A;  2NVT H;  1SMX A;  4WOR A;  2KBN A;  4BA1 I;  2A6E D;  3S15 B;  4X3K A;  3HOU B;  3PSI A;  4HCS A;  3VR6 A;  1PH3 A;  4BY7 G;  3G4S A;  3W2D A;  1X65 A;  1RTO A;  2CQO A;  1SYB A;  1XWE A;  3S15 H;  3GTK B;  1DON A;  3HOU H;  1TS4 A;  4DR7 Q;  1VQO A;  2OXP A;  4DNI A;  3K5O A;  2FHT A;  4RKB A;  2ZJQ A;  5AFW A;  5M5X B;  1N33 L;  2FMC A;  2K01 A;  4KLK A;  2KHI A;  3GTK H;  5I6W A;  2AWN A;  4DR4 L;  3RNU A;  1PZK D;  4RKL A;  1Q82 C;  1BNZ A;  5K36 G;  3TRZ A;  1I3Q B;  2M00 A;  3T1H L;  5M5X H;  3UDG A;  4R4T A;  1KLU D;  4A3F G;  5LL6 X;  3ERO A;  4DR1 L;  2UUC L;  2F1M A;  3LNN A;  1AP0 A;  2EIF A;  3SVM A;  4R8N A;  3A8J E;  1CKM A;  1LO5 D;  1STB A;  4A3I B;  1A6X A;  5IGB A;  4A3J G;  2A69 D;  5IGE A;  4K0K Q;  4ZLT F;  1QVG A;  3DWQ A;  3KJO A;  1KQS A;  1J8I A;  3K59 A;  2RDG A;  2QKI C;  3VR5 A;  4GOP B;  5HGQ A;  4IUP A;  4A93 G;  4A3B G;  3D4W A;  4A3I H;  1VF5 C;  3S1N H;  1MD2 D;  1PFS A;  1PH1 A;  1KHI A;  2I07 B;  4BBS H;  2K32 A;  1EUJ A;  1IBL L;  3PMF A;  1YI2 A;  1K73 C;  3JC6 6;  3GV3 A;  3J7A F;  1VQ9 A;  3KK7 A;  2AKW B;  5FLX E;  2QCP X;  2QW7 A;  3PIO 3;  4RGN A;  1G51 A;  3S16 B;  1DD2 A;  4M1U B;  2VNU D;  1KDA A;  2RCN A;  4CDC C;  5GAE C;  4KHV A;  3TP6 A;  4AIM A;  1PYB A;  5DAU A;  5J22 A;  2UUB L;  4OON A;  2J4X A;  1EQV A;  4ZRZ A;  4A76 A;  3HZX A;  1NTG A;  1TXY A;  3Q6S A;  3MXP A;  2I5L X;  4RH6 A;  1ASY A;  2ES2 A;  4RGO S;  2K05 A;  1V9P A;  1E2V A;  4DR2 L;  1N36 Q;  4DAP A;  2GVB A;  4FF2 A;  1B53 A;  1VMP A;  1HNW L;  4LFC L;  5IYB G;  1EY6 A;  5T1I A;  2B8F A;  4DV0 Q;  4DAM A;  2BE5 C;  4LF9 L;  1E3P A;  2JN4 A;  1HPC A;  2WB1 B;  2LXK A;  5CV8 A;  5LL6 S;  4DAV A;  4L5S A;  2RCF A;  5EBC A;  5IOC A;  3Q22 A;  3QG1 A;  2N8N A;  1B2T A;  3CW2 C;  3TZU A;  3QB3 A;  1GM5 A;  3PUX A;  1E0B A;  1SYE A;  2CW0 D;  2IX3 A;  2R93 B;  2NB0 A;  4OWW B;  1Y1V B;  2F0I A;  3KF6 B;  2EY5 A;  2EXD A;  3HOX B;  3TN2 A;  2ATW A;  2DN8 A;  2L1B A;  1F77 A;  1PYS B;  3A8K E;  3CC7 A;  1I50 H;  5IT9 L;  4B08 A;  4Q0F A;  1I4G A;  3HOX H;  1S5F D;  1JMC A;  2G9H D;  2D2C C;  1C8C A;  1X55 A;  1IZ6 A;  4HIO A;  2XNA C;  4P72 A;  1ZXT A;  3UI2 A;  1LT6 D;  1VQJ A;  1RD9 D;  2PQE A;  2ZT9 C;  3TP7 A;  1WD1 A;  4B3M L;  4O0A A;  3UE1 A;  2A6H D;  4YY3 Q;  2B29 A;  4OO1 I;  1H9K A;  1PTO F;  3M85 A;  1WTH A;  4DA2 A;  1PRT F;  1ROD A;  1FGB D;  1RF2 D;  1PMR A;  5CV6 A;  4ULL A;  5E1F A;  4DK6 C;  4NXM L;  4LMQ D;  4DF7 A;  2KCC A;  3CCJ A;  3A8I E;  3GTQ B;  4OX9 L;  2L12 A;  4LNQ A;  2QDL A;  4ZAI A;  1HTP A;  4NPS A;  1HZC A;  3OWF A;  1S40 A;  5C5L A;  3H15 A;  1Y8O B;  4XTC S;  1BDO A;  4LF7 L;  3GTQ H;  4DXG A;  1N9W A;  1PH4 A;  3MXN B;  5EKI A;  1VS0 A;  1U4L A;  1JOQ A;  2WAQ G;  1EYD A;  2L4N A;  5ISR A;  2B2T A;  3H6M A;  4N8F A;  1AE2 A;  4UHV A;  3J80 L;  3RN2 A;  3M9B A;  5AJ3 L;  1HJP A;  4B9W A;  3SHL A;  2R7D A;  4AYB B;  1F9S A;  2QA4 A;  2K14 A;  4KHP L;  4QY7 A;  2Z6K C;  1QJO A;  4CHT B;  1EY4 A;  1ESF A;  5ELE A;  1PTO C;  4RCN A;  1PRT C;  2VZA A;  5ELC A;  5A2Q E;  1EZ8 A;  1S5D D;  3EN2 A;  1XJV A;  4OXP A;  3H3V I;  2TMP A;  2XTI A;  2F0D A;  4PG3 A;  2EJM A;  2WB1 E;  4JI2 L;  2YU9 B;  1PH5 A;  4BBR H;  3C1E A;  3CCE A;  3HOY B;  3UDI A;  2NZO A;  1L1O A;  1X3Q A;  2YU9 H;  1G91 A;  4JI6 L;  4ZYS A;  4B3R L;  4O2D A;  4POG A;  3HOY H;  3FP9 A;  4G57 A;  1JJ2 A;  2HIX A;  3Q8D A;  1RJT A;  3A56 A;  4UP9 A;  2RQX A;  2N3S A;  3URY A;  1IHZ A;  1Z6H A;  3LWE A;  1U4R A;  1Y8P B;  3NHH A;  4K2L A;  2EYJ A;  2E2D C;  4DR1 Q;  1C4Q A;  3ER0 A;  1CKN A;  1I6V C;  4X3T A;  1BF4 A;  4LF6 Q;  1XNQ L;  2IL8 A;  5FLM G;  1YNJ D;  3ND9 A;  1YNN C;  2NYZ D;  5M3F H;  1HTL D;  3KLR A;  1Q81 C;  1A2U A;  5C3X A;  3GTJ B;  1ZKO A;  2VQF Q;  3P75 A;  2RKS A;  4XIG S;  2Q8I B;  3BVG A;  4A3E B;  1LT5 D;  4LFA L;  2JA6 G;  1WTO A;  4A3M G;  1Z7T A;  3G6E A;  4YCU A;  4IFD G;  2HCI A;  3GQB A;  4UAI A;  5C4X G;  1QNU A;  3X3N A;  3ULP A;  3HOV B;  1UAP A;  3ITP A;  1DOK A;  5DEH A;  1VQA A;  2ZJP A;  1HA6 A;  2A68 D;  5GAD C;  4V19 0;  1L0W A;  4JPB W;  2K52 A;  3K5L A;  4JI8 L;  4RAU C;  1CA6 A;  3CHB D;  2CFM A;  5JJZ A;  2NZH A;  3KLS A;  3KF8 A;  2L9H A;  5LMU Q;  2EZV A;  4LF8 Q;  3AFP A;  5D65 A;  1HNX L;  4LUZ A;  5C4Z A;  3FKI H;  2EPB A;  2ZXO A;  4GS3 A;  1T5E A;  3S2H B;  3AU7 A;  1SJH D;  3UDF A;  4LW1 A;  4AYB E;  3I4M B;  3RLF A;  1VQK A;  4JG2 A;  3NEM A;  3KJP A;  1HNZ Q;  1LTG D;  1B8A A;  1I4H A;  3S2H H;  1HNW Q;  3PUY A;  1B9N A;  5GAG C;  3CCU A;  2MP1 A;  3I4M H;  1PVO A;  5I9O A;  3AEV A;  1X54 A;  1O7Z A;  3SK8 A;  4DV2 L;  4LJZ C;  4DR7 L;  1LTB D;  2B2U A;  2HQL A;  2HIV A;  2E2I B;  1F2Z A;  1Q12 A;  1STG A;  4RHR A;  4H13 C;  3F2C A;  1D6E C;  3HKZ B;  2ZXP A;  1VF7 A;  3BVM A;  4XT1 B;  4RMF A;  5CYU A;  3GP7 A;  1PZI D;  2E2I H;  1W3S A;  2F4V Q;  2AWO A;  2R92 B;  2OQK A;  5JVH 3;  5FLX L;  3I4N G;  3CXC A;  1LT3 D;  3PV0 A;  2YTV A;  3H0G G;  4QIW E;  5J3B A;  2JA7 G;  2Z9H A;  3TQY A;  4C3H H;  1ICW A;  2IJ0 A;  4JOI C;  2R92 H;  2NVX B;  4K0K L;  3HOZ G;  1AZP A;  2B2W C;  1Y1W G;  2AHO B;  1FYC A;  5GRO A;  2OWO A;  4A3K B;  1I94 Q;  2DY8 A;  4CJ0 B;  2O2L D;  5C4H A;  2KCT A;  1JCK B;  2NVX H;  3JAM c;  1JQY D;  4C3J B;  2DJG C;  1V1P A;  1GUW A;  3SK4 A;  3P7J A;  1B1Z A;  2ZTD A;  1EWI A;  1DOL A;  1GOZ A;  3K5M A;  1MSG A;  4HSV A;  4OX9 Q;  4A3G G;  4C3J H;  2Y0S B;  1I4X A;  3GTM B;  5ELD A;  3G71 A;  1YHB A;  2R7Z G;  2V1C C;  4IOA A;  4S3S A;  3K7A H;  3M3Y B;  4CDE C;  1AEX A;  4QQB X;  2KCN A;  1EEF D;  1K0S A;  1CHP D;  4BY7 H;  1PV4 A;  2OTJ A;  3HP3 A;  1STN A;  4YHH L;  3OPO A;  3RZD H;  2SEB D;  3CMA A;  1T5X D;  5M5W B;  1GKH A;  3J81 i;  3M3Y H;  4JI5 L;  1CUK A;  1EQT A;  4I7A A;  1V43 A;  4BS9 A;  4OEL B;  4DV0 L;  2QIL A;  4DV4 Q;  4KN4 C;  3I8Z A;  1BBW A;  2EJF C;  1CKO A;  4UP7 A;  4PMW A;  5M5W H;  1SN8 A;  5H1S E;  1DOM A;  4NW2 A;  3F2B A;  1Q46 A;  4BY1 B;  1QVC A;  4A3F B;  3KOJ A;  2YTY A;  5JJL A;  4DNT B;  2MUY A;  2D62 A;  4JI2 Q;  5K36 H;  4U68 A;  2Q2T A;  4DK3 C;  2YV5 A;  3KFU A;  4LF5 Q;  3BZD B;  3NUC A;  4A3J B;  2SOB A;  2MPM A;  4BY1 H;  2HCC A;  4A3F H;  1G6Z A;  1SYF A;  2K6A A;  2MO1 A;  3HKZ E;  1TWF H;  2GVA A;  4A93 B;  2PQA B;  3STB D;  1BOS A;  5E4X A;  3MHB A;  4A3J H;  1IW7 C;  4JI6 Q;  3L2P A;  4LWC A;  1IBK Q;  4MTN A;  3CCS A;  3ONA B;  2RDF A;  3AFQ A;  1BQQ T;  1A62 A;  1XTD A;  1VQB A;  4A93 H;  2A5H A;  1R9T B;  5IIF A;  1M90 C;  3M4Q A;  3RN5 A;  1SLJ A;  1E2W A;  3QIA A;  4YY3 L;  2JA9 A;  5LHY 1;  1B3A A;  1ENC A;  3GTG B;  1VQ6 A;  1JC7 A;  1R9T H;  4RA8 A;  2WKC A;  2ICI A;  3H91 A;  3MC0 B;  3S1Q H;  4JBK A;  4P73 A;  3J7Z C;  4JV5 Q;  4F7X A;  2OTL A;  5A2Q L;  4X3S A;  1EU3 A;  4AQY Q;  2IW3 A;  3GTG H;  1PTO B;  4EQO A;  4X6A H;  1PRT B;  3QR8 A;  1EL0 A;  3MFG A;  4A3D G;  2K5W A;  2B2Y A;  5KNC A;  2VY3 A;  1HA5 A;  1RL2 A;  1I4P A;  5IWA L;  2E2H B;  1NBW A;  4UPA A;  3G7L A;  3KF8 B;  2Y0S E;  2ZTE A;  1BCP F;  3WOF A;  1S3O A;  1PTO H;  2R7F A;  2F0W A;  1CTM A;  2A1A A;  4C3I G;  4DUZ Q;  3J7A V;  5C44 G;  3BZK A;  2HUG A;  2E2H H;  2LMC B;  2BDN A;  3HGB A;  3GO5 A;  2HT1 A;  4IJL A;  2PZT A;  2RDH A;  5I6Y A;  2I46 A;  3KDF A;  2MQH A;  2JJQ A;  2CVR A;  2EY2 A;  1XXG A;  4IOC A;  4JI1 Q;  3HRZ C;  1FJG Q;  1F9Q A;  3FDT A;  1GVP A;  3PUW A;  1XX8 A;  3PO2 G;  5HGT A;  1K28 A;  3FHW A;  4YWM A;  3OTO Q;  3S24 A;  5C0X H;  4DR3 Q;  1BVS A;  1H9M A;  2FFK B;  2VL6 A;  4DV2 Q;  3VR4 A;  1OXX K;  1QZH A;  1SNC A;  3OW2 A;  2WV6 D;  4CKC A;  5IYD H;  1EZ6 A;  2FJ2 A;  1H9S A;  3QO2 A;  2EYO A;  5NUC A;  1VCI A;  2F52 A;  3HS0 C;  1P8L A;  2BH2 A;  1BCP C;  1CT1 D;  1L0X B;  1BUV T;  4TKO B;  4HMJ A;  4K6L A;  5BN4 A;  4MTK A;  4N9T A;  2MJ8 A;  3SDZ A;  2IX1 A;  2Z4H A;  1WTW A;  3K7U C;  1BBX C;  1ET9 A;  2ID0 A;  4N9P A;  1WVL A;  4HAE A;  3BU2 A;  3MEH A;  1PFN A;  3ZYY X;  3R2I A;  3T56 B;  4N8X 1;  4C1N I;  2K5N A;  4LF6 L;  1WD0 A;  4ME3 A;  3S1N B;  3D3R A;  1MSH A;  4B9X A;  3RMH A;  4BBS B;  1SYC A;  3EIV A;  2VQF L;  2OT2 A;  2WAQ B;  2JK8 A;  3W5O A;  4J8Q A;  2K5D A;  4R1J A;  5IT9 c;  5GAH C;  1BKB A;  5I2Y A;  1VQE A;  1SXT A;  2HQE A;  3PO3 G;  2N49 A;  4IUN A;  1QZG A;  2PW5 A;  3I55 A;  1JE5 A;  1H9R A;  3T16 A;  5C6A A;  4IUR A;  1SSO A;  3GTL B;  2F3V A;  2B39 A;  5IOD A;  1O78 A;  3I4L A;  4OIJ A;  2CH4 W;  1JWU D;  5IY0 A;  1GUN A;  1ZYR D;  3EFX D;  3MTS A;  1EOV A;  4F87 A;  1Q8K A;  3GTL H;  3DMU A;  1CI3 M;  4DR5 Q;  1IKL A;  4CDD C;  5LMU L;  2M9V A;  4LF8 L;  5IP9 H;  4X3U A;  5C0X J;  2JA8 G;  4A4I A;  2O4X A;  3I91 A;  3SEB A;  2B2V A;  2X6G A;  3IFT A;  1KC8 C;  3MZ5 A;  3TZD A;  4YHH Q;  1UWV A;  2IWH A;  1S72 A;  1HNZ L;  2A8V A;  3ULL A;  4KKT A;  1RDP D;  1C48 A;  4JI5 Q;  1K8M A;  1MIU A;  3GTO H;  1A3U A;  4QGU A;  3NWT A;  4C2M B;  2GA4 B;  1JJG A;  3D8G A;  4QCL A;  2B2T C;  1V1Q A;  3N52 A;  3A74 A;  3CME A;  2VUM G;  3IL8 A;  3MEF A;  5IGC A;  3J80 c;  2HD3 A;  4DV7 Q;  3A5Z B;  2Q2H A;  4EQN A;  3PCO B;  5CBA E;  3RLO A;  3ULJ A;  4C2M H;  2B63 G;  1W6K A;  4HED A;  1VQ8 A;  1WTR A;  1ESR A;  3E9I A;  4F8M A;  1I50 B;  1ILP A;  5F2D A;  2BDO A;  4GLX A;  3TSS A;  1PH8 A;  2F4V L;  5ELO A;  1KRT A;  2KOL A;  1U5K A;  1SE4 A;  3TEH B;  5CC4 A;  1HR0 W;  2J0T D;  2R61 A;  1CQF A;  1I5F A;  3CCV A;  1I6H B;  4X64 Q;  2DNC A;  3CKI B;  2D0P A;  1BR9 A;  2X69 A;  3W3A A;  4G7Z C;  2B8G A;  2XRQ D;  4OGQ C;  4PZ6 A;  4A3M B;  3V96 A;  3KBX A;  1F2M A;  2EJG C;  2RF4 A;  1HR0 Q;  2LKV A;  2WIN B;  4K2K A;  1SE8 A;  2QEJ C;  4PQX A;  5C4X B;  1I6H H;  3VYU A;  3K0X A;  2Z0S A;  3GV6 A;  1L1O C;  2JA6 H;  1I94 L;  3BDL A;  3DXJ C;  1QB5 D;  2LXJ A;  4A3M H;  4MZ9 A;  4IFD H;  2PI2 E;  4DAY B;  2XN9 C;  4YCV A;  5C4X H;  1DJR D;  4QUF A;  3K0Y A;  3PIP 3;  5FJ8 G;  1SMY D;  1E1T A;  1K3R A;  2HDM A;  1VMC A;  2EVB A;  2SNS A;  5C3E B;  3MAQ A;  1NMF A;  4Y52 H;  1DCZ A;  3A5U A;  1LAB A;  1EY5 A;  1TS5 A;  2G5D A;  1LTI D;  2BCO A;  2D5D A;  2JXM B;  3K8A A;  4L6T B;  1YVC A;  4HR7 B;  4LF4 Q;  2KHS A;  4KY6 A;  4F88 A;  2CKZ B;  1K0R A;  1EQR A;  2OF1 A;  5J39 A;  3NP8 A;  5C3E H;  1A3T A;  2BA0 A;  2FXQ A;  1PDQ A;  5IWA Q;  2UXC Q;  1U4P A;  3CPF A;  3L9A X;  4IAL A;  3GTP H;  1N32 Q;  1GUS A;  1C0A A;  2MHV A;  1SNQ A;  3VR2 A;  1MJE A;  1VQP A;  2ZJR A;  1Q7Y C;  1XYI A;  1CK1 A;  3KDF B;  3J7Y W;  5C3W A;  1LAC A;  4HIK A;  4NDX A;  3M4P A;  4NXN Q;  4GN5 A;  4A3I G;  1JE4 A;  4DV4 L;  3L3O C;  3CD6 A;  1AFP A;  2Z1C A;  1N8R C;  2EY1 A;  1YHQ A;  4PMB A;  3BYY B;  4P71 A;  2WP8 J;  4H02 A;  4BBR B;  2OEO A;  4JI7 L;  4ZUI A;  1WFQ A;  4RFB A;  2PPB C;  1IKM A;  1FNV A;  4QJF A;  4CJ1 B;  1S5E D;  4IQZ A;  3OW7 A;  2JA7 B;  2GN5 A;  2L0C A;  2NN6 H;  4LF5 L;  4FYD A;  1HCZ A;  2PMZ B;  1TWA B;  1WOC A;  1IL2 A;  2XVS A;  1V8Q A;  1STH A;  1PH9 A;  3I4N H;  4GN3 B;  4PZ7 A;  3BDO A;  1LTL A;  4X62 Q;  1Y1W B;  2HDL A;  4M8A A;  1B44 D;  3H0G H;  3HKS A;  2JA7 H;  5M9O A;  4IFD J;  1RKN A;  4JI3 Q;  1TWA H;  4BA2 I;  5COY A;  3D31 A;  1IBK L;  4WFN 3;  1Q90 A;  1KIX A;  3EA6 A;  2G9D A;  4O1N A;  2KUM A;  1Y1W H;  4G7O C;  2K4K A;  4ILW A;  2B2U C;  1XPO A;  4IPG A;  2AQ2 B;  2KEN A;  1EYC A;  2ZXR A;  4XT3 B;  5M3F B;  1QVF A;  5KIX A;  1NR4 A;  4P2C B;  1GUO A;  3I90 A;  3D4D A;  3BZC A;  3NEL A;  4HJ8 A;  3RR5 A;  1SAP A;  2R7Z B;  4DK0 A;  1EY7 A;  3C2P A;  2WB1 G;  4A3G H;  4LFB Q;  3HFZ B;  4J6H A;  4JV5 L;  4YWL A;  1B70 B;  4GKK Q;  1D2B A;  4Y7N B;  4AQY L;  2BA1 A;  4UP8 A;  5FLX c;  2CQA A;  4DV3 Q;  3PUV A;  3SXH A;  1S4Z A;  1VQM A;  2R7Z H;  1VQL A;  2R93 G;  2H5X A;  3NQT A;  5JVG 3;  1ENF A;  1Y1V G;  3E6Z X;  1NE3 A;  1SYD A;  1D5X C;  1KL9 A;  3NPP A;  5HY6 A;  2Q2U A;  1B9M A;  1FL0 A;  4Y7N H;  3JAM i;  3HOX G;  1IYU A;  1OXV A;  1QUQ A;  2NZ1 D;  3U9S A;  1B50 A;  3FKI B;  3DHQ A;  4DUZ L;  1AZQ A;  4A3L H;  1TVX A;  1KAA A;  4JC0 A;  3VDY A;  5FK9 C;  3I73 A;  4MNO A;  3NTH A;  1DZ1 A;  4APV A;  4EX5 A;  2JSO A;  2YTX A;  4PV1 C;  2WFW A;  1X3F A;  3P20 A;  2A6E C;  1BCP B;  1STY A;  4QB4 A;  1M1K C;  4XQQ A;  1G2S A;  1Q86 C;  4OO1 G;  1YJ9 A;  3D6C A;  4R4Q A;  1D1K A;  2L5T A;  3CCR A;  4JI1 L;  2RVL A;  1FJG L;  1JOK A;  4POF A;  4IUT A;  1VQ5 A;  4ODG A;  2EYL A;  1SRO A;  4KJO A;  3VA7 A;  2PZU A;  3NEN A;  3U9O A;  1EY9 A;  1EIY B;  3OTO L;  5EKL A;  4DR3 L;  3E0E A;  2JEA I;  1WI5 A;  4PNY A;  1SE3 A;  5EQ0 A;  3V05 A;  1Y69 U;  1J5E Q;  3RZO H;  3NBH A;  1HHV A;  3J81 E;  2EYP A;  1F2L A;  1TS2 A;  4JI4 Q;  3W1G A;  3IAY A;  2RHQ B;  4QF4 A;  2ENB A;  2E2J H;  4X65 Q;  3PGZ A;  4DV5 Q;  1O7Y A;  1BXT A;  1OTC A;  2PMZ E;  1VQD A;  1WCM G;  1X6O A;  1EEI D;  4CKB A;  4H7B A;  4FP5 D;  4ZK9 B;  4C3H B;  4KI0 A;  2AUJ D;  5L37 A;  4FNF A;  1PH7 A;  1EU4 A;  3S17 B;  2XGT A;  3SK6 A;  1IL8 A;  1QE6 A;  1FGU A;  1GXD C;  2PNH A;  2SNM A;  1JT8 A;  2BE5 D;  2JQO A;  4UY8 C;  2KED A;  4AYB G;  2A69 C;  2E74 C;  1Z9F A;  1M4V A;  5D3D A;  2CHB D;  1RIP A;  4QL5 A;  2E75 C;  2O5J C;  4A3D B;  4P75 A;  1F2Y A;  3S17 H;  3OOC A;  4K5V A;  3E3X A;  1D5M C;  4ID6 A;  2LY7 A;  4H0L C;  2F0L A;  3I56 A;  2EYH A;  1ML0 D;  3T1Y Q;  4JI0 Q;  3KLW A;  5JPM C;  4A3D H;  2BH8 A;  2JYO A;  2JA5 G;  1ONL A;  5CGK A;  4GNX A;  3UDX A;  1JOR A;  3DLL A;  3OYY A;  2HHH Q;  1CA5 A;  4QUC A;  2F3I A;  1ZYR C;  1KDC A;  4C3I H;  3K7A B;  5C44 H;  1Q1E A;  4KV6 A;  2XWJ B;  1XNR Q;  4BXX H;  2D9U A;  4PMC A;  4MIU A;  4BY7 B;  4DR5 L;  1WTP A;  2A74 C;  5IE8 A;  2F0E A;  2K5V A;  3RZD B;  3DEP A;  2PCF B;  2WAC A;  3T13 A;  1LTT D;  2KA7 A;  4IPC A;  3PO2 B;  2PZW A;  2LS0 1;  2WKD A;  2N78 A;  3QJY A;  2K33 A;  1X56 A;  3GDE A;  1PHJ A;  4FXD A;  4KMU C;  2DNE A;  2V4D A;  1IYV A;  1VQ4 A;  5JEA G;  1SNO A;  1HXY D;  2K75 A;  4FXG C;  3HOW G;  1TS3 A;  3PO2 H;  1EY0 A;  2ZTC A;  2B2Y C;  1PH2 A;  4IZ8 A;  2RHS B;  3G6J B;  4DNR B;  2OQ0 A;  4ZQ3 A;  3Q24 A;  3T4A C;  1YJN A;  3WWV A;  4IPH A;  4RCO A;  4GLA C;  3TS2 A;  3DEO A;  2CW0 C;  1PFM A;  4DV6 Q;  4XQN A;  4DV7 L;  4JI7 Q;  3CC2 A;  1XPR A;  3K80 C;  1X3P A;  1ENA A;  4LK1 C;  4A3E G;  2KVM A;  3F2U A;  3WOE A;  3PQI A;  1TWF B;  5JAV A;  4B3T L;  1L1O B;  2H1E A;  2NTS A;  1LV9 A;  4IUQ A;  3EJI A;  5EPL A;  4L5T A;  4KHZ A;  3HOV G;  4JYA Q;  4OHJ A;  3FPP A;  4DR6 L;  3DM3 A;  2K03 A;  4IUV A;  4TVA B;  1YIT A;  4X64 L;  3LGJ A;  4A3B B;  1XMQ Q;  1PTO D;  1VQC A;  4BWG B;  2IT1 A;  1PRT D;  3PO3 B;  4XDX A;  1NNX A;  3W1B A;  1CKN B;  3BJU A;  1C9O A;  1HR0 L;  4RG1 A;  2MFI A;  1E2Z A;  2A6H C;  4K14 A;  3NSW A;  4A3B H;  3I4M G;  4A3C G;  4NB3 A;  1ASZ A;  4DUY Q;  3S1Q B;  5DM6 3;  3PO3 H;  2PW7 A;  5IP7 G;  3M7N A;  1RTN A;  4QMG A;  3IFD A;  5KNB A;  4L5R C;  2VS1 A;  3U4V A;  4IUU A;  4HN7 A;  5FO9 B;  4AH6 A;  4DXF A;  1OXT A;  2F0F A;  1BO0 A;  5FO7 B;  4NKL A;  2JA8 B;  1HQR D;  4ZCK A;  2EDG A;  2VQE Q;  4JBJ A;  3I2Z A;  3NTI A;  3OHX C;  2DUD A;  1CZG A;  4PZ8 A;  1TY0 A;  4B3S Q;  5DM7 3;  3HKZ G;  1OXS C;  4LF4 L;  3AYH B;  4K5X A;  4CKE A;  4G7H C;  1AE3 A;  3CQZ B;  2JA8 H;  1P16 A;  5K5P A;  5FO8 B;  1EWH A;  3FPU B;  1SFO B;  2UXC L;  4R8I A;  1HRJ A;  3WDN A;  5EKK A;  1N32 L;  2I5M X;  2R92 G;  2B3G A;  2QDB A;  2PO4 A;  3C1F A;  1O7L A;  5CV7 A;  5IYC G;  3OMG A;  5KRU A;  3CQZ H;  3NWS A;  4C56 C;  1YNN D;  1UNS A;  1MI2 A;  5IYB H;  3J81 j;  3PIP A;  1SFO H;  4IPD A;  5ELF A;  4NXN L;  2B63 B;  2AQ3 B;  1X3G A;  4HID A;  3R93 A;  4LAA A;  3D4R A;  2KQ3 A;  5KYL A;  3CCL A;  2F03 A;  1HUN A;  1YEZ A;  3AB9 A;  1TWC H;  4FF1 A;  3D0F A;  1N34 L;  1KLG D;  1TWH B;  2DJF C;  2B63 H;  4A3K G;  3NBH B;  1KAW A;  1UEB A;  1HH2 P;  5D3I B;  3M4O B;  3FRP B;  1CM9 A;  1TY2 A;  5BN3 A;  4C3J G;  5C0X I;  3MXN A;  3O13 A;  4XXE A;  3CF5 A;  2ZM6 Q;  3T53 B;  2AUK A;  1TWH H;  4G4K A;  2B2V C;  1I3Q H;  1PZJ D;  1K8A C;  4U67 3;  3M4O H;  4X62 L;  1VQN A;  2Y0S G;  3TS0 A;  4GZY C;  4KD3 A;  4DK1 A;  2UXD Q;  4CGY B;  3N6R A;  3J80 i;  3CAM A;  4IO9 A;  4JI3 L;  1JIC A;  1CZW A;  3A7L A;  2A73 B;  2UUA Q;  3E5S A;  4DFA A;  3C3L A;  4XQJ A;  3BVZ A;  4R4O A;  1YNJ C;  5M3M G;  4EQ5 A;  4HSP A;  5EBD A;  2NVY B;  2F4I A;  1JB3 A;  5FJ8 H;  1AN8 A;  1YZ6 A;  4JK1 C;  1F9P A;  2XIW A;  1PA6 A;  1MHW C;  2A19 A;  4GNX B;  1JJC B;  4LFB L;  1TQO A;  1V1P B;  3EQL C;  1JWM D;  4GKK L;  1CSQ A;  2MNA A;  4BY1 G;  4DV1 Q;  2NVY H;  2MO0 A;  2QGQ A;  1SDF A;  4DV3 L;  1G8Z D;  1NMG A;  3NBI A;  4YIJ A;  5DNF A;  1TR5 A;  3PUZ A;  2M2L A; 
#chains in the Genus database with same CATH homology
 1HNW Q;  3PUY A;  1MJE A;  3SGI A;  5GAG C;  1T9H A;  2ZJR A;  3CCU A;  1VQP A;  1Q7Y C;  3KDF B;  4FDB A;  3I4M H;  1PVO A;  1UE5 A;  4HIK A;  3AEV A;  1X54 A;  5JJK A;  3IRB A;  3M4P A;  4DV2 L;  3PF5 A;  4DR7 L;  1AH9 A;  4A3C G;  2HQL A;  1W2B A;  4NXN Q;  2HIV A;  4GN5 A;  3KF6 A;  4A3I G;  4B3R Q;  2E8G A;  4DV4 L;  3CD6 A;  1IXR A;  3ERS X;  4WJ3 M;  1Q12 A;  3F2C A;  2CWP A;  1N8R C;  1YHQ A;  2UXB L;  3B6Y A;  1EFW A;  1EIF A;  1MKH A;  1SR3 A;  2WP8 J;  4H02 A;  4P71 A;  2LSS A;  5LMN W;  4JI7 L;  3S14 H;  3GD7 A;  4A75 A;  1QUQ B;  1WFQ A;  4RMF A;  2IY5 B;  2E2I H;  4QJF A;  1W3S A;  4R4I A;  1EYG A;  2F4V Q;  2AWO A;  3CCM A;  2OQK A;  2KCM A;  2GN5 A;  4LF5 L;  1XNQ Q;  3I4N G;  2KHJ A;  2ASB A;  3CXC A;  5LMN Q;  3PV0 A;  1WOC A;  5GQO A;  1IL2 A;  2YTV A;  3H0G G;  4QIW E;  1PH9 A;  3I4N H;  4GN3 B;  4PZ7 A;  5J3B A;  2JA7 G;  1LTL A;  3TQY A;  4C3H H;  4X62 Q;  3H0G H;  4JOI C;  2R92 H;  1YJW A;  1EQQ A;  3HKS A;  2JA7 H;  4GKJ L;  2E5L L;  1UE6 A;  4K0K L;  2L15 A;  2UU9 Q;  4GN4 B;  3HOZ G;  1A0I A;  1J5E L;  4IFD J;  1G6P A;  4LFA Q;  4JI3 Q;  1TWA H;  1Y1W G;  3S1M H;  3D31 A;  4BA2 I;  1IBK L;  1YIJ A;  2I0Q A;  1KIX A;  1A8V A;  1KRS A;  4JI4 L;  2AHO B;  3S16 H;  5GRO A;  2OWO A;  2VUM H;  4X65 L;  4DV5 L;  3ZJY C;  1Y1W H;  1I94 Q;  1UE1 A;  3S1R H;  2KCT A;  2K4K A;  4YWK A;  1XPO A;  2NVX H;  4IPG A;  3JAM c;  1K83 H;  4B3T Q;  3J81 c;  2KEN A;  3ICE A;  1XMO Q;  1QVF A;  1VQ7 A;  1O7I A;  2ZTD A;  2QEX A;  1EWI A;  3BZC A;  4JI8 Q;  3CPW A;  2K5H A;  3NEL A;  2OCE A;  4HJ8 A;  4OX9 Q;  4A3G G;  3RR5 A;  4DR6 Q;  4BXX G;  4C3J H;  1VQG A;  1IBM Q;  1LYL A;  4ALP A;  4X66 Q;  1KD1 C;  1HNX Q;  2WB1 G;  3G71 A;  4A3G H;  4LFB Q;  1YBY A;  2K50 A;  1NY4 A;  1YHB A;  3HFZ B;  4IJH A;  5FLM H;  2NVT H;  4JV5 L;  4YWL A;  1B70 B;  1SMX A;  2R7Z G;  2V1C C;  2KBN A;  2EQS A;  4GKK Q;  4BA1 I;  1XPU A;  4IOA A;  3K7A H;  4AQY L;  2BA1 A;  4UP8 A;  5FLX c;  3PSI A;  4DV3 Q;  3PUV A;  1VQM A;  1PH3 A;  2R7Z H;  4BY7 G;  3G4S A;  4LUV A;  1X65 A;  1J6Q A;  1VQL A;  3F8T A;  2H5X A;  3F2D A;  4QQB X;  5C0X G;  2R93 G;  2DGY A;  1Y1V G;  3HOU G;  2CQO A;  3T1Y L;  4BY7 H;  1PV4 A;  2OTJ A;  4IFD I;  1NE3 A;  5BR8 L;  2Q2U A;  4JI0 L;  1KL9 A;  4YHH L;  5HY6 A;  3RZD H;  2R93 H;  1FL0 A;  4Y7N H;  3CMA A;  3S15 H;  1UE7 A;  3JAM i;  3HOX G;  1Y1V H;  1GKH A;  3J81 i;  3HOU H;  4JI5 L;  5IYD G;  1CUK A;  1OXV A;  1QUQ A;  3M3Y H;  4DR7 Q;  1VQO A;  4DNI A;  2HHH L;  1V43 A;  4DUZ L;  2R6G A;  3RLN A;  2WAQ E;  4DV0 L;  4DV4 Q;  2ZJQ A;  4A3L H;  4JC0 A;  3VDY A;  1N33 L;  1BBW A;  1E7Z A;  4MNO A;  1CKO A;  4UP7 A;  4PMW A;  4APV A;  4KLK A;  3AQQ A;  2KHI A;  2YTX A;  4EX5 A;  5M5W H;  3GTK H;  1SN8 A;  2UXB Q;  5H1S E;  2AWN A;  2WFW A;  5EAY A;  1X3F A;  4DR4 L;  3F2B A;  1Q46 A;  1QVC A;  3RNU A;  1XNR L;  1Q82 C;  3KOJ A;  5K36 G;  3TRZ A;  1M1K C;  3T1H L;  2YTY A;  5JJL A;  5M5X H;  1NJI C;  3UDG A;  4R4T A;  2D62 A;  1Q86 C;  4OO1 G;  1YJ9 A;  2YYZ A;  4R4Q A;  4JI2 Q;  3U50 C;  1FVI A;  4A3F G;  2Q2T A;  4DK3 C;  2YV5 A;  3CCR A;  2JEB I;  4LF5 Q;  3KFU A;  4DR1 L;  4JI1 L;  2CWA A;  2UUC L;  1FJG L;  4POF A;  4BY1 H;  1E1O A;  1VQ5 A;  4A3F H;  2EIF A;  1CKM A;  1SRO A;  3HKZ E;  2MO1 A;  3NEN A;  1EIY B;  1TWF H;  1VQI A;  3OTO L;  4A3J G;  4DR3 L;  3E0E A;  2JEA I;  2GVA A;  2PQA B;  2E5L Q;  4K0K Q;  1WI5 A;  3STB D;  1QVG A;  3RZO H;  1J5E Q;  3KJO A;  1KQS A;  4A3J H;  4JI6 Q;  3L2P A;  4LWC A;  5E7N A;  1IBK Q;  4MTN A;  3CCS A;  1HZA A;  4GOP B;  5HGQ A;  4JI4 Q;  3W1G A;  4A93 G;  2RHQ B;  2E2J H;  4X65 Q;  3PGZ A;  4DV5 Q;  3AFQ A;  4HIM A;  4A3I H;  4A3B G;  4BBS G;  3S1N H;  1A62 A;  1PFS A;  1PH1 A;  1OTC A;  1XTD A;  1VQB A;  1KHI A;  1VQD A;  2PMZ E;  4DV6 L;  1X9N A;  1WCM G;  1N34 Q;  4BBS H;  3CC4 A;  1X6O A;  3PUZ A;  1M90 C;  1EUJ A;  3M4Q A;  1IBL L;  3RN5 A;  1SLJ A;  1C7Y A;  1WCM H;  2NN6 I;  1YI2 A;  4YY3 L;  2JA9 A;  4KI0 A;  1A63 A;  1K73 C;  1PH7 A;  3JC6 6;  2XGT A;  1FGU A;  2PNH A;  1VQ9 A;  1VQ6 A;  1JT8 A;  1R9T H;  4UY8 C;  2AKW B;  2JQO A;  1Q1B A;  4AYB G;  5IP9 G;  1Z9F A;  3STB C;  4JBK A;  4P73 A;  3J7Z C;  3S1Q H;  4JV5 Q;  4JYA L;  1G51 A;  1RIP A;  4QL5 A;  2OTL A;  1X3E A;  2VNU D;  2RCN A;  5GAE C;  4AIM A;  4P75 A;  3S17 H;  4AQY Q;  4X6A H;  3GTG H;  1HZ9 A;  1PYB A;  4OWT B;  1XMQ L;  1GO3 E;  3G48 A;  2UUB L;  4OON A;  4DKA C;  1JB7 A;  3I4O A;  2IHF A;  3HOZ H;  4A3D G;  4A76 A;  3I56 A;  3H3V H;  1DGS A;  1NTG A;  2VY3 A;  3T1Y Q;  1TXY A;  2VW9 A;  1RL2 A;  4JI0 Q;  2I5L X;  3KLW A;  1TWG H;  2AMC B;  1NBW A;  4UPA A;  5IWA L;  1ASY A;  2ES2 A;  3KF8 B;  2BH8 A;  1V9P A;  2JA5 G;  2Y0S E;  4A3D H;  2ZTE A;  4DR2 L;  1N36 Q;  1S3O A;  4GNX A;  2GVB A;  3UDX A;  2R7F A;  3DLL A;  4DUY L;  1HNW L;  3OYY A;  2HHH Q;  2JA5 H;  4LFC L;  5IYB G;  2A1A A;  4DUZ Q;  4DV0 Q;  4DAM A;  5C44 G;  3BZK A;  4YCW A;  2F3I A;  4LF9 L;  1N33 Q;  1E3P A;  4C3I H;  2E2H H;  5C44 H;  1Q1E A;  2LXK A;  4L5S A;  3GO5 A;  4DR4 Q;  5DLQ E;  2HT1 A;  2N8N A;  1XNR Q;  4IJL A;  3CW2 C;  4BXX H;  1GM5 A;  4DR5 L;  3PUX A;  2VQE L;  3T1H Q;  3KDF A;  1H95 A;  2MQH A;  2K5V A;  5IE8 A;  2PQA A;  2JJQ A;  4B3S L;  4IPC A;  4OWW B;  4IOC A;  2N78 A;  5JJI A;  1B7Y B;  4JI1 Q;  1X56 A;  2UUC Q;  1FJG Q;  4P74 A;  3KF6 B;  2EXD A;  3GDE A;  1PHJ A;  2ATW A;  1GVP A;  3PUW A;  3PO2 G;  3FHW A;  1VQ4 A;  1PYS B;  5JEA G;  3CC7 A;  4YWM A;  2K75 A;  3HOW G;  3OTO Q;  1I50 H;  3S24 A;  4DR3 Q;  3PO2 H;  1BVS A;  2IHE A;  3F1Z A;  4DV2 Q;  2VL6 A;  2ZTC A;  3HOW H;  1OXX K;  1QZH A;  4GLV B;  3HOX H;  3OW2 A;  3CCQ A;  1PH2 A;  1JMC A;  5IYD H;  2RHS B;  2I5H A;  2OQ0 A;  5ELN A;  1VCI A;  1X55 A;  2F52 A;  1P8L A;  3WWV A;  1YJN A;  2BH2 A;  4IPH A;  4GNX C;  4GLA C;  3TS2 A;  1IZ6 A;  4HIO A;  4DV6 Q;  4DV7 L;  3GTJ H;  3CC2 A;  4P72 A;  1XPR A;  4JI7 Q;  3K80 C;  1VQJ A;  2IX1 A;  2Z6K A;  1IBL Q;  4A3E G;  4B3M L;  2D0O A;  4O0A A;  1VQF A;  2ALY B;  3UE1 A;  4YY3 Q;  2B29 A;  4OO1 I;  3K7U C;  4B3T L;  4A3E H;  1L1O B;  3M85 A;  2ID0 A;  3BU2 A;  4NXM L;  4DK6 C;  4A93 H;  3L7Z C;  4L5T A;  3CCJ A;  4KHZ A;  3U4Z A;  4OX9 L;  3HOV G;  4JYA Q;  1GD7 A;  2ZM6 L;  4DR6 L;  2K5N A;  3DM3 A;  4LF6 L;  4LUO A;  4LNQ A;  4ME3 A;  4TVA B;  4X66 L;  3HOV H;  4GKJ Q;  1YIT A;  4X64 L;  4GOP C;  3LGJ A;  1HZC A;  4NPS A;  1L2F A;  1S40 A;  1XMQ Q;  5C3E G;  1VQC A;  3EIV A;  3H15 A;  2UUB Q;  2VQF L;  4XTC S;  2IT1 A;  3E9H A;  2JK8 A;  4LF7 L;  3W5O A;  3GTQ H;  3W1B A;  5C4J H;  1CKN B;  1N9W A;  3BJU A;  4JBM A;  1PH4 A;  1C9O A;  4R1J A;  3MXN B;  5IT9 c;  1HR0 L;  2UXD L;  4RG1 A;  5GAH C;  1BKB A;  1VS0 A;  1G29 1;  2MFI A;  2NVQ H;  1VQE A;  2WAQ G;  4DR2 Q;  3PO3 G;  4A3B H;  2N49 A;  3I4M G;  1AE2 A;  4NB3 A;  1QZG A;  3I55 A;  1ASZ A;  1JE5 A;  3M9B A;  1YNX A;  4DUY Q;  3RN2 A;  1E24 A;  4LFC Q;  3PF4 A;  3PO3 H;  5AJ3 L;  5IP7 G;  1HJP A;  3M7N A;  4A3C H;  5M5Y H;  2R7D A;  3EBE A;  1IYJ B;  2UUA L;  2QA4 A;  4LF9 Q;  2K14 A;  3UE0 A;  4L5R C;  2VS1 A;  3U4V A;  5IP7 H;  3CP0 A;  4KHP L;  4QY7 A;  5IY0 A;  2Z6K C;  4AH6 A;  1OXT A;  1BBU A;  4HJ7 A;  1EOV A;  1Q8K A;  3GTL H;  4DR5 Q;  2VQE Q;  4JBJ A;  3I2Z A;  5LMU L;  1YHA A;  4LF8 L;  5IP9 H;  2VZA A;  2DUD A;  4PZ8 A;  4B3S Q;  5C0X J;  3EN2 A;  2JA8 G;  3HKZ G;  1XJV A;  4OXP A;  3H3V I;  1OXS C;  4A4I A;  5JEA J;  2NN6 G;  3AYH B;  4LF4 L;  2XTI A;  4PG3 A;  4WJ4 A;  4BBR G;  1AE3 A;  2CCZ A;  2JA8 H;  1P16 A;  2WB1 E;  4DV1 L;  1KC8 C;  4JI2 L;  1PH5 A;  5BR8 Q;  4BBR H;  1UWV A;  4YHH Q;  1S72 A;  1HNZ L;  1LM0 A;  2A8V A;  2UXC L;  3ULL A;  3CCE A;  1PH6 A;  1N32 L;  2I5M X;  1VQH A;  4JI5 Q;  2R92 G;  1MIU A;  2B3G A;  3GTO H;  1HZB A;  1U0L A;  4J15 A;  1Y14 B;  3UDI A;  5IYC G;  3I7F A;  4QGU A;  3CQZ H;  3TRE A;  2NZO A;  1JJG A;  1L1O A;  4DPG A;  2YU9 H;  3HOY G;  4OWX B;  5IYC H;  5IYB H;  3J81 j;  3PIP A;  1SFO H;  4JI6 L;  1V1Q A;  4IPD A;  3A74 A;  4NXN L;  3CME A;  2VUM G;  3MEF A;  1X3G A;  4O2D A;  4HID A;  3J80 c;  4POG A;  3HOY H;  3FP9 A;  4B3R L;  4DV7 Q;  1JJ2 A;  1KXL A;  2HIX A;  3Q8D A;  3A5Z B;  2Q2H A;  3CCL A;  1YEZ A;  3PCO B;  3RLO A;  4UP9 A;  4B3M Q;  3ULJ A;  2N3S A;  4C2M H;  2B63 G;  1TWC H;  1VQ8 A;  3D0F A;  3E9I A;  1N34 L;  2PI2 A;  4JCV E;  2B63 H;  4A3K G;  4R4C A;  1K8G A;  4GLX A;  3NBH B;  1KAW A;  1UEB A;  3KYH C;  4DR1 Q;  4NXM Q;  1HH2 P;  1PH8 A;  2C35 B;  3ER0 A;  4GOP A;  2F4V L;  5ELO A;  1KRT A;  4A3K H;  1CKN A;  5C0X I;  1U5K A;  3S2D H;  3TEH B;  3CF5 A;  2ZM6 Q;  5M3F G;  4LF6 Q;  1HR0 W;  5FLM G;  1XNQ L;  2Q2I A;  5LMN L;  1TWH H;  1I5F A;  3CCV A;  4X64 Q;  1MJC A;  5M3F H;  1Q81 C;  1D7Q A;  2D0P A;  1K8A C;  3M4O H;  2VQF Q;  4X62 L;  1E22 A;  1WYD A;  2IX0 A;  4XIG S;  2Y0S G;  3TS0 A;  4PZ6 A;  4LF7 Q;  1VQN A;  3J7A 5;  2UU9 L;  2UXD Q;  2RF4 A;  1HR0 Q;  1CSP A;  3J80 i;  3CAM A;  1SE8 A;  4JI3 L;  4HJA A;  4IO9 A;  4LFA L;  2JA6 G;  3GTM H;  1I6H H;  3K0X A;  4A3M G;  2Z0S A;  1L1O C;  4YCU A;  3G6E A;  1I94 L;  2JA6 H;  4IFD G;  5AJ3 Q;  1D8L A;  4L5Q A;  2LXJ A;  5C4X G;  4A3M H;  1SRU A;  4MZ9 A;  2UUA Q;  1N36 L;  2PI2 E;  4A3L G;  4DAY B;  3ULP A;  1WJJ A;  4YCV A;  1Z47 A;  5C4X H;  1XMO L;  4KHP Q;  1VQA A;  2ZJP A;  4R4O A;  5FJ8 G;  5GAD C;  1L0W A;  1K3R A;  1E1T A;  2K52 A;  4JI8 L;  5M3M G;  1LUZ A;  4EQ5 A;  3L0O A;  1OXU A;  3A0J A;  2CFM A;  2JE6 I;  1NMF A;  5FJ8 H;  2NZH A;  4Y52 H;  3FKI G;  1YZ6 A;  4TQU S;  3PIO A;  3A5U A;  5M3M H;  5LMU Q;  3AFP A;  4LF8 Q;  1PA6 A;  1IBM L;  2A19 A;  4HJ9 A;  4GNX B;  1JJC B;  1HNX L;  4LUZ A;  4LFB L;  3FKI H;  3K81 C;  3K8A A;  4JBW A;  4GS3 A;  1YVC A;  4LF4 Q;  3U58 A;  3UDF A;  4GKK L;  4LW1 A;  1CSQ A;  4AYB E;  2CKZ B;  1K0R A;  1EQR A;  4BY1 G;  2MNA A;  4DV1 Q;  2NVY H;  3RLF A;  2MO0 A;  2QGQ A;  4JG2 A;  3NEM A;  5C3E H;  2BA0 A;  2FXQ A;  3KJP A;  4DV3 L;  1VQK A;  4JOI A;  5IWA Q;  1HNZ Q;  2UXC Q;  1NMG A;  1K9M C;  3CPF A;  1C0A A;  3GTP H;  1N32 Q;  4HJ5 A;  1B8A A;  1I3Q H;  3S2H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...