3LX0A

Crystal structure of staphylococcal nuclease variant delta+phs d21n at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
b'ATSTKKLHKEPATLIKAIDGNTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cooperative Proton Binding in a Cluster of Carboxylic Residues
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3lx0A00
1EYDA 1STHA 4KV6A 2OF1A 5E1FA 3SK8A 4WORA 4EVOA 1SYBA 3NP8A 4K2KA 4OL7A 2PW7A 4KY7A 1STNA 4WRDA 5DEHA 5CC4A 5IGFA 2SNSA 1EY6A 3E5SA 3V2TA 3MHBA 5I6WA 2EYFA 2PQEA 2EYJA 2EY2A 4EQOA 4ME5A 1A2UA 5CV6A 4ID6A 4HMJA 1SYGA 2EXZA 4H7BA 3S9WA 1JOQA 4ODGA 3BDLA 4ZUJA 1NSNS 5JOBA 3VA5A 1KAAA 3MZ5A 4HMIA 1A3TA 4KJNA 5I9PA 4QF4A 2O4XA 5KYIA 4J1MA 3D4WA 1TQOA 4HTHA 2EY5A 4J6HA 2M00A 5C3WA 3NQTA 3LX0A 3MEHA 1RKNA 2F0OA 1EY5A 2EYPA 2NUCA 3BDCA 1SNQA 1EYAA 2ENBA 2EYLA 1EZ8A 2KQ3A 3QB3A 2F0EA 5IGEA 5J39A 5J1ZA 2F0FA 1KDCA 1SYFA 1A2TA 4K8IA 5KYLA 4NP5A 1AEXA 2OEOA 1JORA 5CV8A 5IGCA 2RDFA 4DGZA 3SR1A 2F0VA 5KEEA 1EY7A 1EY4A 2F0NA 1IHZA 1STYA 3EROA 3TP7A 5EKLA 4PMBA 2F0SA 4N9TA 3U9OA 4KY5A 5C6AA 4ZQ3A 2F0QA 3SXHA 5M9OA 2KHSA 2SNMA 3OSOA 5HURA 1EQVA 1KDBA 3DHQA 4K5XA 3MVVA 4E6IA 4IZ8A 5DAUA 2PZWA 3TP5A 5IGGA 3NXWA 3SHLA 5IODA 3ERQA 2F0IA 2F0PA 4G57A 2EYHA 3C1EA 4KTAA 4KY6A 4PMCA 3OMGA 5C4HA 1F2MA 2EYMA 4N9PA 3D6CA 5IIFA 1A3VA 1II3A 2F0TA 1EYCA 3HEJA 4R8NA 2F0LA 4DFAA 4F8MA 5HGTA 5JAVA 4RKLA 2OXPA 1F2ZA 3NHHA 4IALA 4NMZA 5K5PA 2F0HA 5CV9A 4EQNA 1F2YA 1EY8A 4KD3A 5F2DA 5ISRA 1EY9A 1KDAA 5C5LA 4EQPA 4K2LA 1EY0A 5KRUA 3QOLA 2WACA 4DU9A 1TR5A 4MIUA 5KGUA 3H6MA 1TT2A 1SNDA 4QMGA 3DMUA 3TP6A 1ENCA 1SYCA 3D8GA 5CR3A 4NDXA 4DF7A 5IGDA 2PZTA 3SK6A 1SNMA 2RBMA 4K6DA 5C5MA 1ENAA 4K8JA 1SNCA 2LKVA 3TMEA 5IGBA 4KD4A 2SOBA 2F0MA 3QOJA 3MXPA 2F0KA 2PW5A 4KHVA 1EZ6A 3P1HA 5C4ZA 2F0WA 5I6YA 5I9OA 3ITPA 4S3SA 5NUCA 1STBA 3SK4A 4F7XA 1SNOA 2F3WA 3EVQA 2F0GA 2HQEA 5CV4A 3NUCA 4QB4A 5CGKA 1JOKA 2PZUA 4K5WA 5CV7A 3SK5A 3T13A 1NUCA 2EYOA 2EY1A 4K14A 5E3FA 2EY6A 5J22A 1STGA 4B9XA 3R3OA 5C3XA 3TP8A 2F0DA 4NKLA 3HZXA 1SYDA 4B9WA 3OMCA 4LAAA 3T16A 1SYEA 2RKSA 3C1FA 4ZUIA 1STAA 4PNYA 3PMFA 4IUNA 1SNPA 3OWFA 1KABA 5EGTA 3RUZA 4I65A 2PYKA 3NK9A 4TRDA 1U9RA 4YIJA 3D4DA 2F3VA 3P75A 4RKBA 5IOCA 3EJIA 2F0JA 4K5VA 1JOOA 4KJOA 5CV5A 2QDBA 2F0UA 1A3UA 5EKKA 5KIXA
chains in the Genus database with same CATH superfamily
4KV6A 3LWEA 2XWJB 5K36H 2K7VA 1YVCA 1OXUA 3GTPH 1VQIA 2IX0A 2IWHA 4WJWA 1SJHD 3A7LA 3BDLA 1KQSA 1OO9B 4BBRH 3MC0B 4KJNA 1A3TA 3BDOA 1S5BD 2ALYB 3HKZB 5JJLA 2UUAQ 3D4WA 1G2SA 3J81c 1OXSC 2M00A 3K7AH 1XYIA 3OW7A 3A8JE 1SDFA 1U4MA 4R9WA 3RNUA 4HJ9A 5J1ZA 3H0GH 3PIOA 1JICA 1SEBD 3AFPA 5EPKA 3ZYYX 1HA5A 1SE3A 2B2VA 4AQYL 5IYDG 2K5QA 3OIQA 4MNOA 3J80c 2A19A 2IHEA 4R1JA 1LT5D 1KDBA 3M4PA 3X3NA 4E6IA 1JCKB 5HGQA 5IE8A 1Q81C 1F77A 1Y1VG 2M9VA 2WIIB 2UXDL 2E2IB 1GM5A 1UAPA 4R8NA 1LTBD 3PO2B 1C7YA 4L5RC 1F2ZA 3A74A 1IYVA 5C5LA 3MXGA 3I7FA 3OYYA 4P74A 1M90C 4UY8C 4TSSA 3K8AA 4KHPL 4LF7L 1H9JA 3K59A 3S17H 2E2JB 4DK6C 2SEBD 5FO9B 2WINB 2J0TD 2N78A 5M3MB 1SXTA 2E2HB 2B2UA 1IYJB 3S1NB 3AU7A 4RAUC 1VQ8A 2F4VL 4F7XA 3Q22A 1FR3A 1IKMA 4L5QA 2ES2A 1CHPD 4BY1H 3SVMA 2EY6A 1NY4A 1S5ED 3B6YA 3M4YA 2P5ZX 1ILQA 2F0DA 1HFGA 3MAQA 4A3LG 2AKWB 4HSVA 5G3LF 4G7ZC 4DNIA 4L63B 4BBSG 1S5FD 2F0JA 1JOOA 4OX9Q 2MO1A 5DNFA 2OF1A 4JI2L 1HNWQ 2EXDA 2SNSA 3Q6SA 1LABA 5I6WA 1NMFA 2BE5D 4M8AA 1ZEQX 2QEJC 5HY6A 4A3DG 1GUWA 4XQJA 3FRPB 2EJFC 4ODGA 1C9OA 4A3JH 5I9PA 1B4OA 1Y8PB 1QUQB 3G4SA 4B08A 4ZKBB 1I94L 4PV1C 1KD1C 5C3EG 2JA5H 1W2BA 1CKNB 3Q8DA 4WFN3 5FLXL 4LUOA 4CJ2C 1V43A 4ALPA 5C4XG 1AW7A 2VB3X 2A69C 1QUQA 2I07B 5CBEE 3KJOA 3TS2A 4DV7L 4A3EB 4DGZA 5A2QE 1K28A 1TWCH 1MHWC 2F0NA 2PPBC 2KBNA 1BR9A 1G91A 1DXMA 1RL2A 1QWYA 3QO2A 3TQYA 1EQVA 1BQQT 1Z47A 3U4ZA 2F0IA 2C35B 3OMGA 3CW2C 3R93A 1PTOB 2HCCA 4OWXB 1VQ7A 2FINB 2EOTA 3U9SA 2F0HA 4EQNA 1X3GA 1GKHA 3A5UA 4B3ML 3F2CA 3BJUA 3ZJYC 3K81C 3IFTA 2RBMA 5C5MA 2Z0SA 2WFWA 2E76C 4KI0A 1G2TA 5D14A 4LK1C 3NELA 1O7LA 2CWAA 1UNSA 2I5LX 2JA8G 5M9OA 1BVSA 1UEBA 2KJXA 2JEBI 2QCPX 2WAQE 5CV7A 2RDGA 3CCJA 1WCMH 2JXMB 2WP8J 2R61A 2K03A 3KJPA 4NB3A 4AYBE 1EIHA 3E9IA 3R3OA 5AJ3L 1DYQA 1F2LA 2WV6D 4DN4M 4CGYB 1B50A 1WFQA 3HZXA 1SYDA 1JWMD 1TKWB 4DR7Q 4ZUIA 3PF5A 3Q24A 4I65A 4IPGA 4XQQA 1Y1VB 1D5XC 1HNXQ 2F0TA 1JJCB 1Z9FA 4OIKA 1WD1A 3OPOA 5EBCA 3SDZA 3PO3G 4EQOA 4JI6Q 1ICWA 1GD7A 5M5YB 3NTHA 4BBRG 1VS0A 4QGUA 4JI5Q 1EEID 4X66Q 2K6AA 2KOLA 4UHVA 2A68D 3GTJH 4RG1A 1BCPF 2IHFA 2XSCA 3GTOH 4JBJA 1QNUA 3KF8B 1J9OA 1PYSB 4FF3A 2ENBA 4WJ4A 1DOLA 4A76A 4K0KQ 2OEOA 1VF7A 1VQMA 1S40A 1LTLA 2E74C 4EQ5A 4JI1L 3KF8A 3AFQA 2A6ED 3A7AB 5CBAE 3DHQA 1STEA 5C44H 2YV5A 1TWHH 4BBSB 2VNUD 1C8CA 1CKMA 4HEDA 4JI5L 1SAPA 3CCMA 1SE4A 3ULJA 4CKEA 4ZK9B 4OEMB 3GTMB 2L5TA 1OTCA 2KENA 2WKCA 4O42A 5HGTA 3CCUA 2YTXA 1JB3A 1HH2P 4XQNA 5KRUA 4A3DB 1VQDA 4DUYL 1RODA 1JT8A 3HOWG 4LFAL 1LTRD 3PGZA 1K83H 1EWCA 1VF5C 3D8GA 4DF7A 1A15A 3HS0C 5C3EB 1LT6D 1GUTA 5I9OA 2ASBA 5DM63 2NN6I 3E0EA 5C4XB 1Q3LA 5IWAQ 5BR8L 1B1ZA 4BY1G 1VQKA 1ZYRC 1PTOD 1H9RA 2LS01 4A93G 1X54A 2NVTB 1AE2A 1Z6HA 2NN6H 3WDNA 4RFBA 4TRDA 5JPMC 3S14H 1BOSA 2KHJA 4DR6L 4U68A 1N36Q 1K0RA 4YY3L 4JBMA 2ZM6Q 4A3MG 3J81i 4KK7A 3V2TA 2VUMH 1XNQQ 2TSSA 3W2DA 4ME5A 3UDGA 2OT2A 2R6GA 1YEZA 1X65A 4DA2A 4ZUJA 5M3FH 1NSNS 3PIP3 2NB0A 1SFOH 2Q2UA 4DR4L 3BVMA 1EIFA 1TS2A 1YIJA 1C0AA 1YZ6A 1K73C 1MI2A 4AH6A 2BA0A 2JA8B 3J80i 1D7QA 1EY5A 3BDCA 3GTLB 2UUCL 4HJ7A 4BA1I 1RF2D 2F0FA 2CCZA 1A2TA 2R92H 2CWPA 3I4NG 2PNHA 1V1PB 4GZYC 2Q2HA 2D9UA 2ZM6L 2NVQH 1YNNC 4C3JG 4ZQ3A 1YITA 4JBKA 3X3MA 1SMYD 1V1PA 3NXWA 3SHLA 4KTAA 1D1KA 2K5DA 1Q1EA 3PO3B 3E0JA 1JQYD 3TZDA 1Y8NB 4HR7B 3QOLA 4DAMA 2D62A 4BBRB 2AQ1B 3CPFA 1NCVA 3CMEA 1Y14B 1PZJD 1CZGA 3SK6A 1RD9D 1X3FA 2HDLA 2VS1A 4KHZA 1KRTA 3VYSA 2D0OA 4JCVE 1XMOL 2PW5A 4IQZA 1S5CD 4RGNA 3J81j 4X6AH 1LTAD 2F0GA 3S24A 3NUCA 2O5IC 3T13A 2EY1A 1IKLA 1KRSA 3PUYA 2F4IA 4H02A 1S5DD 4NXMQ 5GROA 2LSSA 1LACA 3J7YW 1SMXA 3NBHB 4LF8Q 1SYEA 1PH9A 3N6RA 3HOXG 4GNXB 3K58A 3Q0AA 3GTQB 3NK9A 4MTKA 3HKZG 1SRUA 5CORA 5GAHC 1X3PA 3HKSA 3T1YQ 1N33L 1X55A 3S1RB 4LF4L 4WRDA 4JI4Q 4EQPA 1E22A 5E1FA 1FL0A 3NBHA 4CDFC 3HP3A 4DV5Q 4IFDI 1L2FA 1BCPC 3HOWB 1A2UA 3MXNB 5IYBH 1VQ4A 2NVYB 1XPRA 1ZKOA 4IURA 3EBEA 4GLXA 3S17B 5JOBA 4RWSC 3FPPA 3VYUA 5GQOA 3PIO3 4G7HC 4LF9L 2A73B 4IFDH 1QZHA 2C9OA 3MXNA 5FK9C 1E1OA 1EYAA 4ABNA 4BY1B 3QWNA 1YI2A 3L9AX 2HHHQ 3PO2G 4JV5Q 1MBYA 5KNDA 4IUQA 1PH7A 2F0SA 4TKOB 2F0QA 2L12A 3RN5A 3M3YH 4NW2A 1L1OB 3QJYA 1PH6A 1H9SB 1HUNA 1VQNA 3EN2A 5IODA 3ERQA 2LMCB 3K5OA 4TVAB 4N9PA 4R4QA 2IL8A 3TBIB 3K0XA 4A3MB 3I55A 5FLXE 4DFAA 5JAVA 1L1OA 2L55A 4NMZA 3H94A 1H9SA 1F2YA 3NBIA 2H4OA 2ZT9C 4LF6L 1HQMC 2XIWA 3PCOB 3JAMc 2K01A 1TR5A 3RD4A 2KA7A 1XX8A 3KUPA 3CRKC 1A0IA 2RF4A 1GUNA 1BBXC 2HHHL 1JJGA 1SNCA 2LKVA 3STBD 2UXBQ 3QOJA 3HKZE 3DEPA 1Y8OB 5JEAG 2XTIA 5I2XA 1PV4A 2K5HA 2F1MA 3HOYH 1I50B 2PZUA 1XPOA 1R4QB 3Q23A 3GTGB 3I4NB 1TWCB 3A5ZB 2VQEQ 1J6QA 4K14A 4FP5D 1EWHA 5J22A 3R2IA 1W6JA 3U4VA 4C2MH 4C3JB 1GUOA 1L0XB 3J7A5 3FDTA 5IYCG 3F2UA 1ONLA 3F1ZA 3CCLA 1U9RA 4OXPA 2VXWA 1ESFA 3BZKA 3UI2A 5EKKA 3VR5A 4JI0Q 1JWUD 4X65Q 3N52A 2LFNA 3L3OC 3K0YA 2CHBD 3E5SA 2B63G 3OWEB 4X62Q 1BNZA 1SLJA 2EY2A 1E1TA 1MJCA 4H44C 3J81L 1KNAA 2X69A 2A1AA 1HZ9A 2E75C 4OO1I 3GTKB 2AUKA 4RMFA 5AFWA 1N34Q 1TWFH 1WI5A 2YYZA 1EZ8A 2R92G 3I4OA 2UU9L 3KLSX 4ILWA 3J80L 1Y1WH 1AEXA 3VDYA 1IBLQ 1DOKA 2ICIA 2RDFA 4OO1H 2R93H 4BY7H 1N8RC 2HIVA 3IL8A 2O5JC 1YHBA 2EQSA 2B2YA 3HOXB 1EIYB 3E3XA 2Z6KC 4C3IG 1AFPA 1ET9A 4Q0FA 4DUZL 3TP5A 2B2TA 2H5XA 1GHJA 1TWAH 5C4HA 2K5VA 3S2DB 3K5MA 1HA6A 2EVBA 1N32Q 4Y52H 4A3IG 3M4OB 4EX5A 4P75A 4KKSA 4OWTB 2D2CC 3BZDB 1LTID 1LLRD 1MD2D 3T1HQ 2CH4W 3D3RA 2GVBA 2ATWA 3HOVG 4RGOS 3F2DA 1KC8C 1TT2A 5FLMG 3KBGA 1SNMA 1RHPA 1HFNA 4GLVB 4C1NI 3GO5A 4UP9A 1NE3A 1HJPA 1RTOA 3TREA 4RGTA 4S3SA 5T1GA 1PH2A 2Z9HA 2F3WA 5CV4A 2UUAL 3ND9A 3HOUG 2JA6G 1KLGD 4C1NK 1F9QA 1DCZA 3WOEA 2R7ZH 4FXGC 2AHOB 3P20A 5I2YA 4HSPA 1A63A 5TSSA 4DV2Q 1QILA 5BN3A 1SROA 4A3GG 2RHSB 1YNJC 2BA1A 4UAIA 3T16A 1AZPA 1AE3A 3J7ZC 1Y69U 3IRBA 3CHBD 4IUVA 2AWOA 4O1NA 3D4DA 2K32A 4MTNA 5E4WC 3G48A 3CCRA 5CV5A 4LMQD 3DXJC 1EYDA 2VB2X 1V1QA 3M4QA 1UWVA 2RHQB 4LW1A 5BN4A 2R3ZA 1U0LA 3PQIA 1O7YA 3S16H 1A8VA 3FKIH 2ICEC 2FFKB 4DR1Q 2R7FA 4BXXG 4OWWB 1JE4A 1QVGA 5C4JB 4MZ9A 3M85A 5I4DA 1D5ZC 4A3CH 3HOZG 3CPWA 2O2LD 1H95A 4A3KG 1JE5A 2BDNA 1HZBA 4DK3C 1RKNA 2KCTA 2XN9C 4L5SA 3I4MG 2NUCA 1TIID 4OIJA 5KYLA 1J5EQ 1XPUA 5KEEA 1VCIA 3J7AV 2V1CC 1RDPD 4Y7NH 1PDQA 3GDEA 4A3BH 4FF1A 3S14B 4DXFA 3P7JA 1VQAA 1JJ2A 3FMCA 2F0PA 4G57A 1IL2A 3C1EA 3VR6A 2K04A 1PRTF 3D6CA 2EE1A 3MFGA 4GS3A 2VUMB 3HEJA 2MO0A 1IZ6A 2B63B 4BA2I 5CV9A 1HUMA 4OX9L 1CZWA 3CQZB 2RA4A 1O7IA 1EY0A 4A3FG 5M3FB 4NPSA 3W1GA 3FVQA 1CKNA 1HNWL 4DV0Q 4XT3B 2YU9H 1PFNA 2NVXB 3H3VI 2K1BA 2B8GA 4DR5Q 4LJZC 1V8QA 5IP7G 2IY5B 3KK7A 2RCFA 4KHVA 5IP9H 2F0WA 4QL5A 2HCIA 4OELB 2IX1A 2R92B 2K14A 1EU3A 5E3FA 4GOPB 5M5WH 3H3VH 4DR2Q 2N88A 4IUTA 3H3VC 2K28A 2QDLA 1WTVA 4B9XA 2IPKD 4HJ8A 1D8LA 2OTJA 2L9HA 4DAPA 5C0XG 3OMCA 4LAAA 4C3IB 1H9KA 3VYRA 1JMCA 2KCNA 1PTOF 2KUMA 4GOPA 1G8ZD 1I6HB 5A35A 1BDOA 3P75A 4JC0A 4K6LA 4YCWA 3I2ZA 1PMRA 2J7ZA 1GHKA 1YJNA 2IT1A 4A3IB 4F87A 4K2KA 2JA7G 3RZOH 2BE5C 3M9BA 1B70B 3CC7A 1F9PA 1LT4D 3G6EA 1K8GA 1MIUA 3HOVB 1WYDA 1PH8A 3V96A 4H7BA 4JI7Q 4PMWA 3I91A 3FEWX 4ZYSA 3DEOA 3PV0A 3HGBA 4RHRA 4CKCA 5FO8B 4GKJQ 3KYHC 1RCVD 4IJHA 4X3SA 1HCZA 3W1BA 4P71A 4DV1Q 3HOUB 5K36G 2JA6B 3OOCA 3QB3A 2F0EA 3S15B 4K8IA 2B2YC 2DGYA 4LUVA 1GXDC 1C48A 1KNEA 2X6LA 3VR2A 1IHZA 4A3GB 1PLFA 1WOCA 1X3EA 2OWOA 3QR8A 5C6AA 3PUVA 2MPMA 3C2PA 1QE6A 3JAMi 5M5XB 1IBKQ 4IZ8A 3KLWA 2H1EA 5DM73 3KF6B 2B2VC 1VQCA 4JOIA 4DR7L 5GADC 1A3VA 1WVLA 2E8GA 2JE6I 1R9TB 1EOTA 3CKIB 3S1MB 1I4QA 3H0GG 4QIWE 4X64Q 1EIGA 2K4KA 1HNXL 1I4GA 4G7OC 3KF6A 2PMZB 2I0QA 1XXGA 3TP6A 3HOZB 1QOHA 2B39A 4A3KB 4JI6L 2JN4A 3NSWA 2Z1CA 5LMNQ 3I4MB 1F9RA 2CKZB 2M2LA 3S2HH 3GD7A 4X66L 3CRLC 2E2IH 3EVQA 3S1QB 1JOKA 4H0LC 1IW7D 1B3QA 1SE2A 1BF4A 1Q8KA 3W3AA 1TS4A 4DV4Q 3ULLA 3HG9A 2B2WA 4NKLA 2B2UC 2OCEA 5ELCA 5IT9E 4K0KL 3PMFA 1TWGB 4R8IA 2E2JH 4A4IA 1WTPA 1EOVA 3CXCA 2F3VA 1AN8A 1IBMQ 5M3MH 2A6HC 1CHQD 4KJOA 4MN3A 1G6PA 2E2HH 2F0UA 1VQGA 1A3UA 4IO9A 3S1NH 4JYAQ 1SYBA 1PFSA 1STNA 1EY6A 1FJGQ 2QGQA 2FHTA 4GLAC 4YCVA 4A3FB 2EZVA 4GKKQ 2K50A 4XYOA 4HCSA 1K8OA 4HIKA 2A68C 3VA5A 3KLRA 1J8IA 4FYDA 3OHXC 1LYLA 3LWUA 4J1MA 4IPDA 3MEHA 3A8KE 3BYTB 4N8X1 1L0WA 3CCVA 4QIWB 3TDQA 4CKBA 1IBML 5LMUQ 1G51A 4KN7C 4BWGB 4JYAL 1S4ZA 1PRTC 3TP7A 1FVIA 1R4PB 4PMBA 5IWAL 4QUFA 3J81E 4A3JG 1FJGL 3SXHA 1V1OA 2NBFA 3DWPA 2JQOA 2Q2TA 4IOCA 1SJED 2JA5G 4POFA 2Z8LA 2JA7B 5JVG3 1CM9A 1SR3A 1SSOA 3RMHA 2NZHA 2Q8IB 1OXVA 2OXPA 1B9NA 4CDEC 2PCFB 3E6ZX 1TY0A 3MTSA 3FHWA 1I4PA 3J80E 4A3EH 1EQQA 4K2LA 2Q2IA 1N36L 1SNDA 5JJIA 1XNQL 1HTLD 1X3QA 3IFDA 3NQIA 5I6YA 2HT1A 4X3UA 3KOJA 1XNRQ 4KN4C 1B44D 1STBA 4RCNA 5JPNC 5T1IA 3GTPB 1Y1WB 2B29A 1PTOH 2ZJQA 1A6XA 2EIFA 3BVZA 1EL0A 1PTOC 3SK5A 1NUCA 1ZXTA 4IJLA 2K05A 1VQ6A 1QJOA 3NWSA 1WTRA 2LXJA 4JPBW 1WJJA 1IL8A 2JJQA 1KABA 5EGTA 5IOCA 3K7AB 3UDFA 2UXCQ 2PQAB 1VQLA 2N49A 3ITPA 1PH1A 3H0GB 1M8AA 2BCOA 4HJAA 1WCMG 1NR4A 2PQAA 4FF2A 5IYDH 3QIAA 2OTLA 4ID6A 1B9MA 2CW0C 5JEAJ 4PZ8A 1CQFA 4HMIA 4WJ3M 1E2ZA 5ELOA 4GN3B 4XIGS 4JG2A 5H1SE 1HR0Q 1M4VA 1HZCA 1Y1VH 3I90A 3O13A 4CDCC 3ND8A 1PZID 4B3RQ 2K52A 4CBVA 1SNQA 1IYUA 1Q82C 1FYCA 2RSNA 1I3QH 2RSOA 5CV8A 4GNXA 5IGCA 1NR2A 1QB5D 2BH2A 1EY4A 3DWAA 3HRZC 3EROA 1U5KA 1ICFB 3U9OA 1QVCA 4Z9CB 5EQ0A 5M5YH 3OSOA 1SMYC 5HURA 1NMGA 1CI3M 3MVVA 3J7AF 1ENFA 5DAUA 2WB1G 3D4RA 1OXXK 4JI8Q 4NXML 4DK1A 4LF8L 1EEFD 5IIFA 2HD3A 3SEBA 3D31A 2ZTCA 4F8MA 4R4OA 1PXUA 2C5CA 3T1YL 1K3RA 5LL6X 5ISRA 4JI4L 4OHJA 1DM0B 1B53A 4DU9A 2Z6BA 3NPPA 3DMUA 1L0YB 1ENCA 2CH4A 3BVGA 1E7ZA 4DV5L 4A3LH 4HAEA 2QKIC 3K6OA 3M7NA 4K6DA 1TS5A 3OTOQ 5C44G 2JP1A 3KBXA 4BBSH 4XDXA 3K7UC 2DY8A 3F8TA 2Q8TA 1DJRD 1GOZA 4NXNQ 3GTMH 1JC7A 4QB4A 1E2VA 4K5WA 3H15A 4JI8L 5FJ8H 2E5LQ 1UE1A 2XVSA 4DR3Q 2DNCA 4A3DH 3TP8A 4A3BB 4A3JB 2V4DA 1BO0A 5IT9L 4KKTA 1P8LA 4B3TQ 4IUNA 1E0BA 4JV5L 2QW7A 1VDZA 3AQQA 4YIJA 4RKBA 2JA5B 2I46A 3UE1A 2G5DA 4O0AA 5C3EH 1NAPA 2QDBA 3RR5A 2DUDA 4ZRZA 2XWBB 1STHA 4WORA 5EPLA 5C4XH 2RCNA 1H9MA 1B3AA 1P16A 2EYJA 2DNEA 1XMQQ 1FNVA 1SYGA 1MSGA 4V190 1MGSA 4DV6Q 1EWIA 2NN6G 3A8IE 1MJEA 1EYGA 1DZ1A 1SN8A 5KYIA 5GAEC 4DR3L 3EA6A 3TEHB 4J6HA 2HQLA 2WB1E 3MA2B 4IPHA 4P2CB 3CMAA 2A8VA 1T5XD 1CUKA 2UXBL 1SYFA 4IUPA 1WTHA 4B3SQ 2VUMG 4LFBQ 3CD6A 3UDXA 5M3FG 4P73A 2SNMA 4X3TA 2VQEL 1VQ5A 2PZWA 2HDMA 1KTKA 3MWYW 4FO2A 1LTTD 1F2MA 1HXYD 2VZAA 3A55A 2JA8H 4MHEA 4QQBX 3GTLH 1G291 1WCMB 1EQTA 1B8AA 4LF5Q 4YWKA 3ICEA 1Q46A 2DN8A 1KDAA 4FNFA 1LO5D 4JI0L 3EIVA 4MIUA 4M1UB 4X65L 1X32A 4DNRB 2NWGA 3STBC 2VY3A 2DY7A 2I5HA 4PZ7A 4X62L 3TMEA 2JYOA 4LFCQ 1YBYA 1CQVA 3IAYA 1HQRD 4AQYQ 1EU4A 3DM1A 1TVXA 3MXUA 1B7YB 3G71A 3A54A 1S3OA 2GA4B 3I72A 2G9HD 3TZUA 1N34L 3PO3H 3TN2A 4X3KA 1QNKA 1K3BC 2Q8RE 3PF4A 2UXDQ 1B2TA 1NTGA 4B9WA 4LF5L 2CQOA 3GTJB 1IBLL 3CCSA 3AYHB 5ELNA 2WB1B 3LNNA 2PYKA 3GTOB 2K75A 3EJIA 2Y0SG 2IX3A 4R4IA 3BYYB 3SE0A 1I4XA 4LFCL 1NJIC 5IGFA 5DEHA 4LWCA 1PH5A 4UP7A 3CC4A 1KIXA 4LF7Q 4KHPQ 1W3SA 2EYFA 2LXKA 5LHY1 2DJGC 1KLUD 3UDIA 5CV6A 4DAYB 1Q8IA 1N32L 2FXQA 2SDFA 5ELFA 2AUJD 5C44B 4J8QA 2F4VQ 3T1HL 1TWHB 1MKHA 4DKAC 2JSOA 2G9DA 2PI2E 2EY5A 1K8MA 1RIPA 3GTQH 4GNXC 3NQTA 3S2HB 4DAYA 4FF4A 1ET6A 3S1RH 1QVFA 1FD7D 3T51B 4C3HH 3KDFB 5JJZA 1FGUA 2IJ0A 5C0XJ 1PH3A 1KL9A 1I4RA 2A69D 5IYBG 1K83B 3HOWH 2TMPA 2NVYH 1EQRA 1I6VC 3KDFA 4JI2Q 5D3IB 4HCEA 2AMCB 4IFDG 5IGGA 3RZDH 1E24A 3IKJA 2KEEA 4JK1C 4V0BA 4DV2L 4KMUC 4UDUC 4RKLA 1Q90A 3L2PA 5EPJA 2L4NA 1CT1D 2CQAA 5F2DA 3H91A 3NENA 1V9PA 1EY9A 1WTWA 1PFMA 3NTIA 1I94Q 3WOFA 4A93H 2EPBA 3VYTA 4F88A 1F9SA 1SYCA 1OXTA 3RLOA 2ID0A 2N8NA 3D0FA 5GAGC 1VQOA 1KXLA 2EJGC 1JB7A 4DK0A 2ZTEA 2SOBA 4UPAA 4DR1L 1LT3D 1L1OC 3A0JA 4DV7Q 1E3PA 3MEFA 2Y0SE 5NUCA 3VR3A 4L6TB 1AZQA 2WAQG 3SK4A 4RCOA 5FJ8G 5EJWA 5ELBA 4A3MH 2GVAA 4AYBG 2K5NA 1PRTB 1CFMA 2FMMA 3M7GA 1VMPA 3JC66 4DAVA 1ILPA 1AH9A 1SFOB 3C1FA 3CAMA 1VMCA 1J5EL 1TY2A 2RDHA 1TU2B 1ASYA 4HIMA 2KCMA 1EFID 4I7ZC 1YJWA 3NE5B 4QY7A 1HTPA 2BH8A 2D5DA 5KIXA 1HRJA 2JK8A 2KCCA 1PYWD 3CF5A 1PFBA 4KY7A 2DJFC 2PI2A 4GN4B 4B3MQ 3HOYG 4AIMA 1EUJA 5KNBA 4IOAA 1I50H 2VL6A 1NNXA 3GTGH 1CA6A 3I4NH 2NTSA 4FDBA 2NVQB 4C3JH 3VR4A 5EKIA 3MZ5A 2PMZE 4UP8A 4QF4A 1VQPA 3PUWA 1UEAB 1O80A 2QF7A 4HTHA 4DV0L 3TRZA 2EYPA 1XWEA 5AJ3Q 4DR5L 2KQ3A 5J39A 1UE7A 1QCBD 4NP5A 1PYBA 3BZCA 2JA9A 1JWSD 1EY7A 2B8FA 4HN7A 4QJFA 3K80C 5FLXc 1K8AC 3G7LA 1STYA 5EKLA 2L0CA 1VQ9A 2PO4A 2MQHA 2PNRC 4DR2L 1UUPA 3GTKH 3I56A 2Y0SB 2YTYA 1K0SA 5EAYA 2GN5A 4R4CA 1I4HA 4PMCA 3LGJA 3G6JB 4XXEA 2L11A 4G4KA 2VW9A 2MNAA 2KVMA 1LTGD 3RLNA 1Y1WG 4OO1G 2OQKA 2D0PA 2R93G 4HJ5A 2FJ2A 2WACA 3DWQA 4BY7G 4XYQA 2B2TC 3H6MA 4CDDC 1CK1A 2L15A 1YHAA 4NDXA 4ULLA 5D65A 3UE0A 1K9MC 4K8JA 3HOXH 4KD4A 2F0MA 2F0KA 1EZ6A 1D6EC 1M1KC 5LL6S 5C4ZA 2ZTDA 4JI7L 1GVPA 2A6HD 4FXDA 4JI1Q 2XRSD 1I3QB 5CGKA 3S2DH 2HQEA 1BCPB 1W6KA 3JAME 1QZGA 3M4OH 3PUZA 4GKJL 3E9HA 5G3LD 4DV1L 1ZYRD 1VQJA 1A62A 2IW3A 1Z7TA 2WKDA 2RKSA 5D3DA 4LUZA 4C56C 2X6GA 4DUYQ 3AB9A 3NEMA 3SK8A 4LFAQ 4EVOA 4POGA 2LY7A 5ELDA 1IBKL 4APVA 2R7ZG 5J3BA 4ZCKA 2F03A 3PO2H 2RVLA 3AEVA 3VA7A 4ZAIA 2XGTA 1PRTD 2YTVA 3M3YB 1Q1BA 4OGQC 3EQLC 2QA4A 3ULPA 4X64L 1IXRA 1T9HA 5BR8Q 2KECA 3LX0A 2F0OA 1DOMA 2WAQB 1CKOA 4C3HG 2EYLA 4ZKCB 2MHVA 5IGEA 1Q7YC 4AYBB 1FGBD 3CCEA 4RHSA 2MJ8A 4IPCA 5LMNL 1BBWA 3FKIG 1ESRA 3NTKA 2KEDA 2R7DA 5LMNW 4DR6Q 4A3CG 1I5FA 5C4JH 4YY3Q 1YNND 4O2DA 4DV4L 2NTTA 4BS9A 1RJTA 4PZ6A 2QEXA 4IUUA 2RQXA 4KY6A 1D1IA 5JEAH 1HZAA 1YNXA 3OIPA 4L5TA 3HOYB 4JI3Q 1II3A 3FP9A 1YJ9A 1EYCA 1SE8A 4PQXA 4IALA 5K5PA 4C2MB 2VQFQ 1X56A 4DR4Q 3ONAB 3R2TA 1DONA 3TS0A 2XNAC 2A6EC 1HPCA 4A3BG 1T5EA 2UUCQ 1TS3A 1XTDA 2Z4IA 1JORA 5IYCH 4GKKL 1E2WA 3MXPA 2B3GA 3U50C 4U673 3GV3A 1NBWA 4RA8A 4CJ0B 3L0OA 1S72A 1C4QA 1IW7C 4KLKA 1ML0D 3W5OA 1U4PA 3BU2A 2A5HA 2EYOA 4DV3Q 2B63H 4ME3A 1G6ZA 2E2DC 2Z4HA 3CQZH 4JI3L 4PG3A 1ASZA 2CW0D 5LMUL 3I3CA 1STAA 2NVXH 3OWFA 3RUZA 2VQFL 5IP9G 4EGVA 1TWFB 1CSPA 3BG3A 5E7NA 2K33A 1XJVA 3NP8A 2PW7A 3I73A 3T53B 4RH6A 5A2QL 3MHBA 4DXGA 1WD0A 2R93B 2PQEA 1Q12A 4N8FA 1XMOQ 4GOPC 4BY7B 1BCPD 1AP0A 1CSQA 3ERSX 3S9WA 1JOQA 1PA6A 1KAAA 4DV3L 2O4XA 4C3IH 2HIXA 1CTMA 1TWAB 3C46A 1D2BA 5CYUA 2ZJPA 1I6HH 3HFZB 1X6OA 3RN2A 2Z6KA 3U58A 4A3IH 2BOSA 1KDCA 1HNZQ 1FNUA 1RTNA 3WWVA 1XNRL 4YCUA 1N33Q 3HOVH 4LF4Q 4N9TA 1BUVT 4A75A 1O78A 5FLMH 2KHSA 3CP0A 3PUXA 4K5XA 5FO7B 1LV9A 3NWTA 4CJ1B 3T4AC 4XT1B 2EYMA 4DPGA 1Q86C 2CVRA 3HOUH 2R7ZB 2JA6H 3SGIA 3S15H 2J4XA 1DD2A 3F2BA 3T56B 2UXCL 2UUBQ 4LF9Q 4HIOA 2MFIA 1DGSA 2OQ0A 1UE6A 4JBWA 2QILA 5FKAC 1GUSA 4JW0A 4QMGA 4JVZA 4A3GH 5JJKA 5CR3A 1HNZL 1PVOA 4HIDA 5IGDA 3MFYA 4JOIC 4J15A 4YWMA 1ENAA 2HUGA 4Q5VA 2EDGA 5DLQE 3P1HA 5M5XH 2F3IA 3TSSA 4C3HB 4YHHQ 1KAWA 3JAML 4LNQA 3GQBA 3S16B 4IN3A 3I8ZA 2NZ1D 1R9TH 1O7ZA 3FKIB 1HR0L 3S1MH 3CU7A 2EJMA 1XTCD 1D5MC 2NYZD 4R4TA 4L8JA 1STGA 4B3RL 4BXXH 1JR0D 1HR0W 3RLFA 3A56A 3KLSA 1QG7A 5JVH3 2UUBL 3HOZH 4OONA 4PNYA 3RZDB 2AQ3B 2AWNA 3CCQA 3GP7A 1EFWA 1PHJA 4A3KH 3D6WA 1GJXA 4K5VA 4LF6Q 4ZLTF 1SBBB 2F52A 3I4MH 1BBUA 3FPUB 4OL7A 5CC4A 2B2WC 2NZOA 1VQEA 3S1QH 1PH4A 4A93B 1WTQA 2K5WA 1U4LA 4YHHL 4Y7NB 4HMJA 3R8BA 2EXZA 5EBDA 3DUZA 4P72A 1YHQA 2A74C 3EFXD 2FMCA 3GV6A 4FVMA 1TWGH 1TQOA 1KHIA 1N9WA 5C3WA 5M3MG 2ZXOA 1CA5A 1FNWA 1VQHA 2AQ2B 3OW2A 3PSIA 4DNTB 3AMUA 3OTOL 4FXKC 3PIPA 5IY0A 5KNCA 4I7AA 1VQFA 1LUZA 4RGMA 2F0VA 3SR1A 4NXNL 3DLLA 5L37A 3QG1A 4A3FH 2YU9B 2L1BA 4KY5A 2ZXPA 4KKUA 2E5LL 2NVTH 2XRQD 3DM3A 2MGSA 5IP7H 2EYHA 5COYA 1BXTA 5C0XI 5FOBB 2ZXRA 1WTXA 2MUYA 1MSHA 3K5NA 4B3TL 4QCLA 3KFUA 1LTSD 2F0LA 5M5WB 3NHHA 2ZJRA 1GO3E 1EY8A 4KD3A 2BDOA 5CMDA 1UE5A 1U4RA 5KGUA 3BS1A 2N55A 1WTOA 5C0XH 4QUCA 2I5MX 2PZTA 3K5LA 3K57A 3I70A 5IGBA 2UU9Q 1XMQL 5IT9c 4CHTB 3H09A 4DV6L 1TXYA 3C3LA 3RZOB 1SNOA 2JA7H 3URYA 3V05A 1BKBA 1GUGA 4XTCS 4A3EG 1LM0A 1VQBA 4H13C 4TQUS 4DUZQ 4IFDJ 4YWLA 5C3XA 2MP1A 2N3SA 2KHIA 1PZKD 4B3SL 5E4XA 5BN5A 4LFBL 1SNPA 1YNJD 1HHVA 3I4LA 4GN5A 3CC2A 3ER0A 2JEAI 5ELEA 1X9NA 2CFMA 3L7ZC
chains in the Genus database with same CATH topology
4KV6A 3LWEA 2XWJB 5K36H 2K7VA 1OXUA 2IX0A 2IWHA 4WJWA 1SJHD 3A7LA 3BDLA 1OO9B 3MC0B 4KJNA 1A3TA 3BDOA 1S5BD 3HKZB 3D4WA 1G2SA 1OXSC 2M00A 1XYIA 3OW7A 3A8JE 1SDFA 1U4MA 4R9WA 5J1ZA 1JICA 1SEBD 5EPKA 3ZYYX 1HA5A 1SE3A 2B2VA 2K5QA 3OIQA 1LT5D 1KDBA 3X3NA 4E6IA 1JCKB 1F77A 2M9VA 2WIIB 2E2IB 1UAPA 4R8NA 1LTBD 3PO2B 1F2ZA 1IYVA 5C5LA 3MXGA 4TSSA 1H9JA 3K59A 2E2JB 5FO9B 2SEBD 2WINB 2J0TD 5M3MB 1SXTA 2E2HB 2B2UA 3S1NB 3AU7A 4RAUC 4F7XA 3Q22A 1FR3A 1IKMA 1CHPD 3SVMA 2EY6A 1S5ED 3M4YA 1ILQA 2F0DA 1HFGA 3MAQA 4HSVA 5G3LF 4G7ZC 4L63B 1S5FD 2F0JA 1JOOA 5DNFA 2OF1A 2SNSA 3Q6SA 1LABA 5I6WA 2BE5D 4M8AA 1ZEQX 2QEJC 1GUWA 4XQJA 3FRPB 2EJFC 4ODGA 5I9PA 1B4OA 1Y8PB 4B08A 4ZKBB 4PV1C 4WFN3 5FLXL 4CJ2C 1V43A 1AW7A 2VB3X 2A69C 2I07B 5CBEE 4A3EB 4DGZA 5A2QE 2F0NA 2PPBC 1BR9A 1G91A 1DXMA 1QWYA 3QO2A 1EQVA 1BQQT 1Z47A 2F0IA 3OMGA 3R93A 1PTOB 2HCCA 2FINB 2EOTA 3U9SA 2F0HA 4EQNA 3IFTA 2RBMA 5C5MA 2E76C 4KI0A 1G2TA 5D14A 4LK1C 1O7LA 1UNSA 5M9OA 2KJXA 2JEBI 2QCPX 5CV7A 2RDGA 2JXMB 2WP8J 2R61A 2K03A 1EIHA 3R3OA 1DYQA 1F2LA 2WV6D 4DN4M 4CGYB 1B50A 3HZXA 1SYDA 1JWMD 1TKWB 4ZUIA 3Q24A 4I65A 4XQQA 1Y1VB 1D5XC 2F0TA 4OIKA 1WD1A 3OPOA 5EBCA 3SDZA 4EQOA 1ICWA 5M5YB 3NTHA 1EEID 2K6AA 2KOLA 2A68D 1BCPF 2XSCA 1QNUA 1J9OA 4FF3A 2ENBA 1DOLA 2OEOA 1VF7A 2E74C 3KF8A 2A6ED 3A7AB 5CBAE 3DHQA 1STEA 4BBSB 2VNUD 1C8CA 4HEDA 1SAPA 1SE4A 4CKEA 4ZK9B 3GTMB 2L5TA 4O42A 2WKCA 5HGTA 1JB3A 4XQNA 5KRUA 4A3DB 1RODA 1LTRD 1EWCA 1VF5C 3D8GA 4DF7A 1A15A 3HS0C 5C3EB 1LT6D 1GUTA 5I9OA 5DM63 2NN6I 5C4XB 1Q3LA 1B1ZA 1ZYRC 1PTOD 1H9RA 2LS01 2NVTB 1Z6HA 2NN6H 3WDNA 4RFBA 4TRDA 5JPMC 1BOSA 4U68A 4KK7A 3V2TA 2TSSA 3W2DA 4ME5A 2OT2A 2R6GA 4DA2A 4ZUJA 1NSNS 3PIP3 2NB0A 3BVMA 1TS2A 1MI2A 2BA0A 2JA8B 1EY5A 3BDCA 3GTLB 4BA1I 1RF2D 2F0FA 1A2TA 1V1PB 4GZYC 2D9UA 1YNNC 4C3JG 4ZQ3A 3X3MA 1SMYD 1V1PA 3NXWA 3SHLA 4KTAA 1D1KA 2K5DA 1Q1EA 3PO3B 3E0JA 1JQYD 3TZDA 1Y8NB 4HR7B 3QOLA 2D62A 4BBRB 2AQ1B 1NCVA 1PZJD 1CZGA 3SK6A 1RD9D 2HDLA 4KHZA 3VYSA 2PW5A 4IQZA 1S5CD 4RGNA 1LTAD 2F0GA 3NUCA 2O5IC 3T13A 2EY1A 1IKLA 3PUYA 2F4IA 1S5DD 3J7YW 1LACA 1SYEA 3N6RA 3K58A 3Q0AA 3GTQB 3NK9A 5CORA 1X3PA 3S1RB 4WRDA 4EQPA 5E1FA 3NBHA 3HP3A 4IFDI 1BCPC 3HOWB 1A2UA 2NVYB 1ZKOA 4IURA 3S17B 5JOBA 4RWSC 3FPPA 3VYUA 3PIO3 4G7HC 2A73B 4IFDH 2C9OA 3MXNA 5FK9C 1EYAA 4ABNA 4BY1B 3QWNA 3L9AX 1MBYA 5KNDA 4IUQA 2F0SA 4TKOB 2F0QA 2L12A 4NW2A 3QJYA 1HUNA 1H9SB 5IODA 3ERQA 2LMCB 3K5OA 4N9PA 2IL8A 3TBIB 4A3MB 5FLXE 4DFAA 5JAVA 2L55A 4NMZA 3H94A 1H9SA 1F2YA 3NBIA 2H4OA 2ZT9C 1HQMC 2XIWA 2K01A 1TR5A 3RD4A 2KA7A 1XX8A 3KUPA 3CRKC 1GUNA 1BBXC 1SNCA 2LKVA 3QOJA 3DEPA 1Y8OB 5JEAG 5I2XA 2F1MA 1I50B 2PZUA 1R4QB 3Q23A 3GTGB 3I4NB 1TWCB 4K14A 4FP5D 1EWHA 5J22A 3R2IA 1W6JA 4C3JB 1GUOA 1L0XB 3FDTA 3F2UA 1ONLA 1U9RA 2VXWA 1ESFA 3UI2A 5EKKA 3VR5A 1JWUD 3N52A 2LFNA 3L3OC 3K0YA 2CHBD 3E5SA 3OWEB 1BNZA 2EY2A 4H44C 3J81L 1KNAA 2X69A 2E75C 4OO1I 3GTKB 2AUKA 5AFWA 2YYZA 1EZ8A 3KLSX 4ILWA 3J80L 1AEXA 1DOKA 2ICIA 2RDFA 4OO1H 3IL8A 2O5JC 2B2YA 3HOXB 4C3IG 1AFPA 1ET9A 4Q0FA 3TP5A 2B2TA 1GHJA 5C4HA 1HA6A 3S2DB 3K5MA 2EVBA 3M4OB 4KKSA 2D2CC 3BZDB 1LLRD 1LTID 1MD2D 3D3RA 4RGOS 1TT2A 3KBGA 1SNMA 1RHPA 1HFNA 4C1NI 3GO5A 1RTOA 4RGTA 4S3SA 5T1GA 2F3WA 5CV4A 3ND9A 1KLGD 4C1NK 1F9QA 1DCZA 3WOEA 4FXGC 3P20A 5I2YA 4HSPA 5TSSA 1QILA 5BN3A 1YNJC 2BA1A 4UAIA 3T16A 1AZPA 1Y69U 3CHBD 4IUVA 2AWOA 4O1NA 3D4DA 2K32A 5E4WC 5JVH3 5CV5A 4LMQD 3DXJC 1EYDA 2VB2X 5BN4A 2R3ZA 1O7YA 2ICEC 2FFKB 1JE4A 5C4JB 3M85A 5I4DA 1D5ZC 2O2LD 2BDNA 1RKNA 2XN9C 2NUCA 1TIID 4OIJA 5KYLA 5KEEA 1VCIA 3J7AV 1RDPD 1PDQA 4FF1A 3S14B 4DXFA 3P7JA 3FMCA 2F0PA 4G57A 3C1EA 3VR6A 2K04A 1PRTF 3D6CA 2EE1A 3MFGA 2VUMB 3HEJA 2B63B 4BA2I 5CV9A 1HUMA 1CZWA 3CQZB 2RA4A 1EY0A 5M3FB 3FVQA 4XT3B 1PFNA 2NVXB 2K1BA 2B8GA 4LJZC 1V8QA 3KK7A 4KHVA 2F0WA 2HCIA 2IX1A 2R92B 1EU3A 5E3FA 2N88A 4IUTA 3H3VC 2K28A 1WTVA 4B9XA 2IPKD 2L9HA 4DAPA 5C0XG 3OMCA 4LAAA 4C3IB 1H9KA 3VYRA 2KCNA 1PTOF 2KUMA 1G8ZD 1I6HB 5A35A 1BDOA 3P75A 4K6LA 1PMRA 2J7ZA 1GHKA 2IT1A 4A3IB 4F87A 4K2KA 2BE5C 1F9PA 1LT4D 3HOVB 3V96A 4H7BA 4PMWA 3I91A 3FEWX 4ZYSA 3DEOA 3PV0A 3HGBA 4RHRA 4CKCA 5FO8B 1RCVD 4X3SA 1HCZA 3HOUB 5K36G 2JA6B 3OOCA 3QB3A 2F0EA 3S15B 4K8IA 2B2YC 1GXDC 1C48A 1KNEA 2X6LA 3VR2A 1IHZA 4A3GB 1PLFA 5C6AA 3PUVA 2MPMA 3C2PA 1QE6A 5M5XB 4IZ8A 2H1EA 5DM73 2B2VC 1A3VA 1WVLA 2JE6I 1R9TB 1EOTA 3CKIB 3S1MB 1I4QA 1EIGA 1I4GA 4G7OC 2PMZB 1XXGA 3TP6A 3HOZB 1QOHA 2B39A 4A3KB 3NSWA 2Z1CA 3I4MB 1F9RA 2M2LA 3GD7A 3CRLC 3EVQA 3S1QB 1JOKA 4H0LC 1IW7D 1SE2A 1BF4A 3W3AA 1TS4A 3HG9A 2B2WA 4NKLA 2B2UC 5ELCA 5IT9E 3PMFA 1TWGB 4R8IA 1WTPA 2F3VA 1AN8A 2A6HC 1CHQD 4MN3A 4KJOA 2F0UA 1A3UA 1SYBA 1STNA 1EY6A 2FHTA 4A3FB 2EZVA 4XYOA 4HCSA 1K8OA 2A68C 3VA5A 3KLRA 1J8IA 4FYDA 3OHXC 3LWUA 4J1MA 3MEHA 3A8KE 3BYTB 4QIWB 3TDQA 4CKBA 4KN7C 4BWGB 1S4ZA 1PRTC 3TP7A 1R4PB 4PMBA 4QUFA 3J81E 3SXHA 1V1OA 2NBFA 3DWPA 1SJED 2Z8LA 2JA7B 5JVG3 1CM9A 1SSOA 3RMHA 2Q8IB 1OXVA 2OXPA 1B9NA 2PCFB 3E6ZX 1TY0A 3MTSA 1I4PA 3J80E 4K2LA 1SNDA 1HTLD 1X3QA 3IFDA 3NQIA 5I6YA 4X3UA 4KN4C 1B44D 1STBA 4RCNA 5JPNC 5T1IA 3GTPB 1Y1WB 1PTOH 1A6XA 3BVZA 1EL0A 1PTOC 3SK5A 1NUCA 1ZXTA 2K05A 1QJOA 3NWSA 1WTRA 1IL8A 1KABA 5EGTA 5IOCA 3K7AB 3ITPA 3H0GB 1M8AA 2BCOA 1NR4A 4FF2A 3QIAA 4ID6A 1B9MA 2CW0C 5JEAJ 1CQFA 4HMIA 1E2ZA 4XIGS 1M4VA 3I90A 3O13A 3ND8A 1PZID 4CBVA 1SNQA 1IYUA 1FYCA 2RSNA 2RSOA 5CV8A 5IGCA 1NR2A 1QB5D 1EY4A 3DWAA 3HRZC 3EROA 3U9OA 4Z9CB 5EQ0A 3OSOA 1SMYC 5HURA 1CI3M 3MVVA 3J7AF 1ENFA 5DAUA 3D4RA 1OXXK 4DK1A 1EEFD 5IIFA 3SEBA 3D31A 4F8MA 1PXUA 2C5CA 5LL6X 5ISRA 4OHJA 1DM0B 1B53A 4DU9A 3NPPA 3DMUA 1L0YB 1ENCA 3BVGA 4HAEA 2QKIC 3K6OA 3M7NA 4K6DA 1TS5A 2JP1A 3KBXA 4XDXA 2DY8A 2Q8TA 1DJRD 1GOZA 1JC7A 4QB4A 1E2VA 4K5WA 2XVSA 2DNCA 3TP8A 4A3BB 4A3JB 2V4DA 1BO0A 5IT9L 4KKTA 4IUNA 1E0BA 1VDZA 4YIJA 4RKBA 2JA5B 2I46A 1NAPA 2QDBA 4ZRZA 2XWBB 1STHA 4WORA 5EPLA 1H9MA 1B3AA 2EYJA 2DNEA 1FNVA 1SYGA 1MSGA 4V190 1MGSA 2NN6G 3A8IE 1DZ1A 5KYIA 3EA6A 4J6HA 3MA2B 4P2CB 1T5XD 1SYFA 4IUPA 2SNMA 4X3TA 2PZWA 2HDMA 1KTKA 3MWYW 1LTTD 1F2MA 1HXYD 4FO2A 3A55A 4MHEA 1G291 1WCMB 1EQTA 2DN8A 1KDAA 4FNFA 1LO5D 4MIUA 4M1UB 1X32A 4DNRB 2NWGA 2DY7A 3TMEA 2JYOA 1CQVA 3IAYA 1HQRD 1EU4A 3DM1A 1TVXA 3MXUA 3A54A 2GA4B 3I72A 3TZUA 2G9HD 3TN2A 4X3KA 1QNKA 2Q8RE 1B2TA 4B9WA 3GTJB 2WB1B 3LNNA 2PYKA 3GTOB 3EJIA 2IX3A 3BYYB 3SE0A 1I4XA 5IGFA 5DEHA 2EYFA 5LHY1 1KLUD 5CV6A 1Q8IA 2SDFA 5ELFA 2AUJD 5C44B 4J8QA 1TWHB 2G9DA 2JSOA 2EY5A 1K8MA 3S2HB 3NQTA 4DAYA 4FF4A 1ET6A 1FD7D 3T51B 5JJZA 2IJ0A 5C0XJ 1I4RA 2A69D 1K83B 2TMPA 1I6VC 5D3IB 4HCEA 4IFDG 5IGGA 3IKJA 2KEEA 4JK1C 4V0BA 4KMUC 4UDUC 4RKLA 1Q90A 5EPJA 2L4NA 1CT1D 2CQAA 5F2DA 3H91A 1EY9A 1WTWA 1PFMA 3NTIA 3WOFA 2EPBA 3VYTA 4F88A 1F9SA 1SYCA 1OXTA 2ID0A 2EJGC 4DK0A 2SOBA 1LT3D 5NUCA 3VR3A 4L6TB 1AZQA 3SK4A 4RCOA 5EJWA 5ELBA 1PRTB 1CFMA 2FMMA 3M7GA 1VMPA 4DAVA 1ILPA 1SFOB 3C1FA 1VMCA 1TY2A 2RDHA 1TU2B 1EFID 4I7ZC 3NE5B 1HTPA 2D5DA 5KIXA 1HRJA 2KCCA 1PYWD 1PFBA 4KY7A 5KNBA 1CA6A 2NTSA 2NVQB 3VR4A 5EKIA 3MZ5A 4QF4A 3PUWA 1UEAB 1O80A 2QF7A 4HTHA 2EYPA 1XWEA 2KQ3A 5J39A 1QCBD 4NP5A 1JWSD 1EY7A 2B8FA 4HN7A 3G7LA 1STYA 5EKLA 2L0CA 2PO4A 2PNRC 1UUPA 2Y0SB 1I4HA 4PMCA 3G6JB 4XXEA 2L11A 4G4KA 2KVMA 1LTGD 4OO1G 2FJ2A 2WACA 3DWQA 4XYQA 2B2TC 3H6MA 1CK1A 4NDXA 4ULLA 5D65A 4K8JA 4KD4A 2F0MA 2F0KA 1EZ6A 1D6EC 5LL6S 5C4ZA 2A6HD 4FXDA 2XRSD 1I3QB 5CGKA 2HQEA 1BCPB 1W6KA 3JAME 3PUZA 5G3LD 1ZYRD 2IW3A 1Z7TA 2WKDA 2RKSA 5D3DA 4C56C 2X6GA 3AB9A 3SK8A 4EVOA 2LY7A 5ELDA 2F03A 2RVLA 3VA7A 4ZAIA 1PRTD 3M3YB 1Q1BA 4OGQC 3EQLC 2KECA 3LX0A 2F0OA 1DOMA 2WAQB 4C3HG 2EYLA 4ZKCB 2MHVA 5IGEA 4AYBB 1FGBD 4RHSA 2MJ8A 1ESRA 3NTKA 2KEDA 1YNND 2NTTA 4BS9A 1RJTA 4IUUA 2RQXA 4KY6A 1D1IA 5JEAH 3OIPA 3HOYB 1II3A 1EYCA 4PQXA 4IALA 5K5PA 4C2MB 3ONAB 3R2TA 1DONA 2XNAC 2A6EC 1HPCA 1T5EA 1TS3A 2Z4IA 1JORA 1E2WA 3MXPA 4U673 3GV3A 4RA8A 4CJ0B 1C4QA 1IW7C 1ML0D 1U4PA 2A5HA 2EYOA 1G6ZA 2E2DC 2Z4HA 2CW0D 3I3CA 1STAA 3OWFA 3RUZA 4EGVA 1TWFB 3BG3A 2K33A 3NP8A 2PW7A 3I73A 3T53B 4RH6A 5A2QL 3MHBA 4DXGA 1WD0A 2R93B 2PQEA 1Q12A 4BY7B 1BCPD 1AP0A 3S9WA 1JOQA 1KAAA 2O4XA 1CTMA 1TWAB 3C46A 1D2BA 5CYUA 2BOSA 1KDCA 1FNUA 1RTNA 4N9TA 1BUVT 1O78A 2KHSA 3PUXA 4K5XA 5FO7B 1LV9A 3NWTA 4CJ1B 3T4AC 4XT1B 2EYMA 2CVRA 2R7ZB 2J4XA 1DD2A 3T56B 4JBWA 2QILA 5FKAC 1GUSA 4QMGA 5CR3A 5IGDA 3MFYA 1ENAA 2HUGA 4Q5VA 2EDGA 3P1HA 3TSSA 4C3HB 3JAML 3GQBA 3S16B 4IN3A 3I8ZA 2NZ1D 1O7ZA 3FKIB 3CU7A 2EJMA 1XTCD 1D5MC 2NYZD 4L8JA 1STGA 1JR0D 3RLFA 3A56A 3KLSA 1QG7A 4PNYA 3RZDB 2AQ3B 2AWNA 3GP7A 3D6WA 1GJXA 4K5VA 4ZLTF 1SBBB 3FPUB 4OL7A 5CC4A 2B2WC 4A93B 1WTQA 2K5WA 1U4LA 4Y7NB 4HMJA 3R8BA 2EXZA 5EBDA 3DUZA 2A74C 3EFXD 2FMCA 3GV6A 4FVMA 1TQOA 5C3WA 1CA5A 2ZXOA 1FNWA 2AQ2B 4DNTB 3AMUA 4FXKC 5KNCA 4RGMA 3SR1A 2F0VA 3QG1A 2YU9B 2L1BA 4KY5A 2ZXPA 4KKUA 2XRQD 2MGSA 2EYHA 5COYA 1BXTA 5C0XI 5FOBB 2ZXRA 1WTXA 2MUYA 1MSHA 3K5NA 4QCLA 1LTSD 2F0LA 5M5WB 3NHHA 1EY8A 4KD3A 2BDOA 5CMDA 1U4RA 5KGUA 3BS1A 2N55A 1WTOA 5C0XH 4QUCA 2PZTA 3K5LA 3K57A 3I70A 5IGBA 4CHTB 3H09A 3C3LA 3RZOB 1SNOA 3URYA 3V05A 1GUGA 4XTCS 4H13C 4TQUS 4IFDJ 5C3XA 2MP1A 1PZKD 5E4XA 5BN5A 1SNPA 1YNJD 1HHVA 3I4LA 2JEAI 5ELEA 3L7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYD A;  1STH A;  4KV6 A;  2OF1 A;  5E1F A;  3SK8 A;  4WOR A;  4EVO A;  1SYB A;  3NP8 A;  4K2K A;  4OL7 A;  2PW7 A;  4KY7 A;  1STN A;  4WRD A;  5DEH A;  5CC4 A;  5IGF A;  2SNS A;  1EY6 A;  3E5S A;  3V2T A;  3MHB A;  5I6W A;  2EYF A;  2PQE A;  2EYJ A;  2EY2 A;  4EQO A;  4ME5 A;  1A2U A;  5CV6 A;  4ID6 A;  4HMJ A;  1SYG A;  2EXZ A;  4H7B A;  3S9W A;  1JOQ A;  4ODG A;  3BDL A;  4ZUJ A;  1NSN S;  5JOB A;  3VA5 A;  1KAA A;  3MZ5 A;  4HMI A;  1A3T A;  4KJN A;  5I9P A;  4QF4 A;  2O4X A;  5KYI A;  4J1M A;  3D4W A;  1TQO A;  4HTH A;  2EY5 A;  4J6H A;  2M00 A;  5C3W A;  3NQT A;  3LX0 A;  3MEH A;  1RKN A;  2F0O A;  1EY5 A;  2EYP A;  2NUC A;  3BDC A;  1SNQ A;  1EYA A;  2ENB A;  2EYL A;  1EZ8 A;  2KQ3 A;  3QB3 A;  2F0E A;  5IGE A;  5J39 A;  5J1Z A;  2F0F A;  1KDC A;  1SYF A;  1A2T A;  4K8I A;  5KYL A;  4NP5 A;  1AEX A;  2OEO A;  1JOR A;  5CV8 A;  5IGC A;  2RDF A;  4DGZ A;  3SR1 A;  2F0V A;  5KEE A;  1EY7 A;  1EY4 A;  2F0N A;  1IHZ A;  1STY A;  3ERO A;  3TP7 A;  5EKL A;  4PMB A;  2F0S A;  4N9T A;  3U9O A;  4KY5 A;  5C6A A;  4ZQ3 A;  2F0Q A;  3SXH A;  5M9O A;  2KHS A;  2SNM A;  3OSO A;  5HUR A;  1EQV A;  1KDB A;  3DHQ A;  4K5X A;  3MVV A;  4E6I A;  4IZ8 A;  5DAU A;  2PZW A;  3TP5 A;  5IGG A;  3NXW A;  3SHL A;  5IOD A;  3ERQ A;  2F0I A;  2F0P A;  4G57 A;  2EYH A;  3C1E A;  4KTA A;  4KY6 A;  4PMC A;  3OMG A;  5C4H A;  1F2M A;  2EYM A;  4N9P A;  3D6C A;  5IIF A;  1A3V A;  1II3 A;  2F0T A;  1EYC A;  3HEJ A;  4R8N A;  2F0L A;  4DFA A;  4F8M A;  5HGT A;  5JAV A;  4RKL A;  2OXP A;  1F2Z A;  3NHH A;  4IAL A;  4NMZ A;  5K5P A;  2F0H A;  5CV9 A;  4EQN A;  1F2Y A;  1EY8 A;  4KD3 A;  5F2D A;  5ISR A;  1EY9 A;  1KDA A;  5C5L A;  4EQP A;  4K2L A;  1EY0 A;  5KRU A;  3QOL A;  2WAC A;  4DU9 A;  1TR5 A;  4MIU A;  5KGU A;  3H6M A;  1TT2 A;  1SND A;  4QMG A;  3DMU A;  3TP6 A;  1ENC A;  1SYC A;  3D8G A;  5CR3 A;  4NDX A;  4DF7 A;  5IGD A;  2PZT A;  3SK6 A;  1SNM A;  2RBM A;  4K6D A;  5C5M A;  1ENA A;  4K8J A;  1SNC A;  2LKV A;  3TME A;  5IGB A;  4KD4 A;  2SOB A;  2F0M A;  3QOJ A;  3MXP A;  2F0K A;  2PW5 A;  4KHV A;  1EZ6 A;  3P1H A;  5C4Z A;  2F0W A;  5I6Y A;  5I9O A;  3ITP A;  4S3S A;  5NUC A;  1STB A;  3SK4 A;  4F7X A;  1SNO A;  2F3W A;  3EVQ A;  2F0G A;  2HQE A;  5CV4 A;  3NUC A;  4QB4 A;  5CGK A;  1JOK A;  2PZU A;  4K5W A;  5CV7 A;  3SK5 A;  3T13 A;  1NUC A;  2EYO A;  2EY1 A;  4K14 A;  5E3F A;  2EY6 A;  5J22 A;  1STG A;  4B9X A;  3R3O A;  5C3X A;  3TP8 A;  2F0D A;  4NKL A;  3HZX A;  1SYD A;  4B9W A;  3OMC A;  4LAA A;  3T16 A;  1SYE A;  2RKS A;  3C1F A;  4ZUI A;  1STA A;  4PNY A;  3PMF A;  4IUN A;  1SNP A;  3OWF A;  1KAB A;  5EGT A;  3RUZ A;  4I65 A;  2PYK A;  3NK9 A;  4TRD A;  1U9R A;  4YIJ A;  3D4D A;  2F3V A;  3P75 A;  4RKB A;  5IOC A;  3EJI A;  2F0J A;  4K5V A;  1JOO A;  4KJO A;  5CV5 A;  2QDB A;  2F0U A;  1A3U A;  5EKK A;  5KIX A; 
#chains in the Genus database with same CATH topology
 4KV6 A;  3LWE A;  2XWJ B;  5K36 H;  2K7V A;  1YVC A;  1OXU A;  3GTP H;  1VQI A;  2IX0 A;  2IWH A;  4WJW A;  1SJH D;  3A7L A;  3BDL A;  1KQS A;  1OO9 B;  4BBR H;  3MC0 B;  4KJN A;  1A3T A;  3BDO A;  1S5B D;  2ALY B;  3HKZ B;  5JJL A;  2UUA Q;  3D4W A;  1G2S A;  3J81 c;  1OXS C;  2M00 A;  3K7A H;  1XYI A;  3OW7 A;  3A8J E;  1SDF A;  1U4M A;  4R9W A;  3RNU A;  4HJ9 A;  5J1Z A;  3H0G H;  3PIO A;  1JIC A;  1SEB D;  3AFP A;  5EPK A;  3ZYY X;  1HA5 A;  1SE3 A;  2B2V A;  4AQY L;  5IYD G;  2K5Q A;  3OIQ A;  4MNO A;  3J80 c;  2A19 A;  2IHE A;  4R1J A;  1LT5 D;  1KDB A;  3M4P A;  3X3N A;  4E6I A;  1JCK B;  5HGQ A;  5IE8 A;  1Q81 C;  1F77 A;  1Y1V G;  2M9V A;  2WII B;  2UXD L;  2E2I B;  1GM5 A;  1UAP A;  4R8N A;  1LTB D;  3PO2 B;  1C7Y A;  4L5R C;  1F2Z A;  3A74 A;  1IYV A;  5C5L A;  3MXG A;  3I7F A;  3OYY A;  4P74 A;  1M90 C;  4UY8 C;  4TSS A;  3K8A A;  4KHP L;  4LF7 L;  1H9J A;  3K59 A;  3S17 H;  2E2J B;  4DK6 C;  2SEB D;  5FO9 B;  2WIN B;  2J0T D;  2N78 A;  5M3M B;  1SXT A;  2E2H B;  2B2U A;  1IYJ B;  3S1N B;  3AU7 A;  4RAU C;  1VQ8 A;  2F4V L;  4F7X A;  3Q22 A;  1FR3 A;  1IKM A;  4L5Q A;  2ES2 A;  1CHP D;  4BY1 H;  3SVM A;  2EY6 A;  1NY4 A;  1S5E D;  3B6Y A;  3M4Y A;  2P5Z X;  1ILQ A;  2F0D A;  1HFG A;  3MAQ A;  4A3L G;  2AKW B;  4HSV A;  5G3L F;  4G7Z C;  4DNI A;  4L63 B;  4BBS G;  1S5F D;  2F0J A;  1JOO A;  4OX9 Q;  2MO1 A;  5DNF A;  2OF1 A;  4JI2 L;  1HNW Q;  2EXD A;  2SNS A;  3Q6S A;  1LAB A;  5I6W A;  1NMF A;  2BE5 D;  4M8A A;  1ZEQ X;  2QEJ C;  5HY6 A;  4A3D G;  1GUW A;  4XQJ A;  3FRP B;  2EJF C;  4ODG A;  1C9O A;  4A3J H;  5I9P A;  1B4O A;  1Y8P B;  1QUQ B;  3G4S A;  4B08 A;  4ZKB B;  1I94 L;  4PV1 C;  1KD1 C;  5C3E G;  2JA5 H;  1W2B A;  1CKN B;  3Q8D A;  4WFN 3;  5FLX L;  4LUO A;  4CJ2 C;  1V43 A;  4ALP A;  5C4X G;  1AW7 A;  2VB3 X;  2A69 C;  1QUQ A;  2I07 B;  5CBE E;  3KJO A;  3TS2 A;  4DV7 L;  4A3E B;  4DGZ A;  5A2Q E;  1K28 A;  1TWC H;  1MHW C;  2F0N A;  2PPB C;  2KBN A;  1BR9 A;  1G91 A;  1DXM A;  1RL2 A;  1QWY A;  3QO2 A;  3TQY A;  1EQV A;  1BQQ T;  1Z47 A;  3U4Z A;  2F0I A;  2C35 B;  3OMG A;  3CW2 C;  3R93 A;  1PTO B;  2HCC A;  4OWX B;  1VQ7 A;  2FIN B;  2EOT A;  3U9S A;  2F0H A;  4EQN A;  1X3G A;  1GKH A;  3A5U A;  4B3M L;  3F2C A;  3BJU A;  3ZJY C;  3K81 C;  3IFT A;  2RBM A;  5C5M A;  2Z0S A;  2WFW A;  2E76 C;  4KI0 A;  1G2T A;  5D14 A;  4LK1 C;  3NEL A;  1O7L A;  2CWA A;  1UNS A;  2I5L X;  2JA8 G;  5M9O A;  1BVS A;  1UEB A;  2KJX A;  2JEB I;  2QCP X;  2WAQ E;  5CV7 A;  2RDG A;  3CCJ A;  1WCM H;  2JXM B;  2WP8 J;  2R61 A;  2K03 A;  3KJP A;  4NB3 A;  4AYB E;  1EIH A;  3E9I A;  3R3O A;  5AJ3 L;  1DYQ A;  1F2L A;  2WV6 D;  4DN4 M;  4CGY B;  1B50 A;  1WFQ A;  3HZX A;  1SYD A;  1JWM D;  1TKW B;  4DR7 Q;  4ZUI A;  3PF5 A;  3Q24 A;  4I65 A;  4IPG A;  4XQQ A;  1Y1V B;  1D5X C;  1HNX Q;  2F0T A;  1JJC B;  1Z9F A;  4OIK A;  1WD1 A;  3OPO A;  5EBC A;  3SDZ A;  3PO3 G;  4EQO A;  4JI6 Q;  1ICW A;  1GD7 A;  5M5Y B;  3NTH A;  4BBR G;  1VS0 A;  4QGU A;  4JI5 Q;  1EEI D;  4X66 Q;  2K6A A;  2KOL A;  4UHV A;  2A68 D;  3GTJ H;  4RG1 A;  1BCP F;  2IHF A;  2XSC A;  3GTO H;  4JBJ A;  1QNU A;  3KF8 B;  1J9O A;  1PYS B;  4FF3 A;  2ENB A;  4WJ4 A;  1DOL A;  4A76 A;  4K0K Q;  2OEO A;  1VF7 A;  1VQM A;  1S40 A;  1LTL A;  2E74 C;  4EQ5 A;  4JI1 L;  3KF8 A;  3AFQ A;  2A6E D;  3A7A B;  5CBA E;  3DHQ A;  1STE A;  5C44 H;  2YV5 A;  1TWH H;  4BBS B;  2VNU D;  1C8C A;  1CKM A;  4HED A;  4JI5 L;  1SAP A;  3CCM A;  1SE4 A;  3ULJ A;  4CKE A;  4ZK9 B;  4OEM B;  3GTM B;  2L5T A;  1OTC A;  2KEN A;  2WKC A;  4O42 A;  5HGT A;  3CCU A;  2YTX A;  1JB3 A;  1HH2 P;  4XQN A;  5KRU A;  4A3D B;  1VQD A;  4DUY L;  1ROD A;  1JT8 A;  3HOW G;  4LFA L;  1LTR D;  3PGZ A;  1K83 H;  1EWC A;  1VF5 C;  3D8G A;  4DF7 A;  1A15 A;  3HS0 C;  5C3E B;  1LT6 D;  1GUT A;  5I9O A;  2ASB A;  5DM6 3;  2NN6 I;  3E0E A;  5C4X B;  1Q3L A;  5IWA Q;  5BR8 L;  1B1Z A;  4BY1 G;  1VQK A;  1ZYR C;  1PTO D;  1H9R A;  2LS0 1;  4A93 G;  1X54 A;  2NVT B;  1AE2 A;  1Z6H A;  2NN6 H;  3WDN A;  4RFB A;  4TRD A;  5JPM C;  3S14 H;  1BOS A;  2KHJ A;  4DR6 L;  4U68 A;  1N36 Q;  1K0R A;  4YY3 L;  4JBM A;  2ZM6 Q;  4A3M G;  3J81 i;  4KK7 A;  3V2T A;  2VUM H;  1XNQ Q;  2TSS A;  3W2D A;  4ME5 A;  3UDG A;  2OT2 A;  2R6G A;  1YEZ A;  1X65 A;  4DA2 A;  4ZUJ A;  5M3F H;  1NSN S;  3PIP 3;  2NB0 A;  1SFO H;  2Q2U A;  4DR4 L;  3BVM A;  1EIF A;  1TS2 A;  1YIJ A;  1C0A A;  1YZ6 A;  1K73 C;  1MI2 A;  4AH6 A;  2BA0 A;  2JA8 B;  3J80 i;  1D7Q A;  1EY5 A;  3BDC A;  3GTL B;  2UUC L;  4HJ7 A;  4BA1 I;  1RF2 D;  2F0F A;  2CCZ A;  1A2T A;  2R92 H;  2CWP A;  3I4N G;  2PNH A;  1V1P B;  4GZY C;  2Q2H A;  2D9U A;  2ZM6 L;  2NVQ H;  1YNN C;  4C3J G;  4ZQ3 A;  1YIT A;  4JBK A;  3X3M A;  1SMY D;  1V1P A;  3NXW A;  3SHL A;  4KTA A;  1D1K A;  2K5D A;  1Q1E A;  3PO3 B;  3E0J A;  1JQY D;  3TZD A;  1Y8N B;  4HR7 B;  3QOL A;  4DAM A;  2D62 A;  4BBR B;  2AQ1 B;  3CPF A;  1NCV A;  3CME A;  1Y14 B;  1PZJ D;  1CZG A;  3SK6 A;  1RD9 D;  1X3F A;  2HDL A;  2VS1 A;  4KHZ A;  1KRT A;  3VYS A;  2D0O A;  4JCV E;  1XMO L;  2PW5 A;  4IQZ A;  1S5C D;  4RGN A;  3J81 j;  4X6A H;  1LTA D;  2F0G A;  3S24 A;  3NUC A;  2O5I C;  3T13 A;  2EY1 A;  1IKL A;  1KRS A;  3PUY A;  2F4I A;  4H02 A;  1S5D D;  4NXM Q;  5GRO A;  2LSS A;  1LAC A;  3J7Y W;  1SMX A;  3NBH B;  4LF8 Q;  1SYE A;  1PH9 A;  3N6R A;  3HOX G;  4GNX B;  3K58 A;  3Q0A A;  3GTQ B;  3NK9 A;  4MTK A;  3HKZ G;  1SRU A;  5COR A;  5GAH C;  1X3P A;  3HKS A;  3T1Y Q;  1N33 L;  1X55 A;  3S1R B;  4LF4 L;  4WRD A;  4JI4 Q;  4EQP A;  1E22 A;  5E1F A;  1FL0 A;  3NBH A;  4CDF C;  3HP3 A;  4DV5 Q;  4IFD I;  1L2F A;  1BCP C;  3HOW B;  1A2U A;  3MXN B;  5IYB H;  1VQ4 A;  2NVY B;  1XPR A;  1ZKO A;  4IUR A;  3EBE A;  4GLX A;  3S17 B;  5JOB A;  4RWS C;  3FPP A;  3VYU A;  5GQO A;  3PIO 3;  4G7H C;  4LF9 L;  2A73 B;  4IFD H;  1QZH A;  2C9O A;  3MXN A;  5FK9 C;  1E1O A;  1EYA A;  4ABN A;  4BY1 B;  3QWN A;  1YI2 A;  3L9A X;  2HHH Q;  3PO2 G;  4JV5 Q;  1MBY A;  5KND A;  4IUQ A;  1PH7 A;  2F0S A;  4TKO B;  2F0Q A;  2L12 A;  3RN5 A;  3M3Y H;  4NW2 A;  1L1O B;  3QJY A;  1PH6 A;  1H9S B;  1HUN A;  1VQN A;  3EN2 A;  5IOD A;  3ERQ A;  2LMC B;  3K5O A;  4TVA B;  4N9P A;  4R4Q A;  2IL8 A;  3TBI B;  3K0X A;  4A3M B;  3I55 A;  5FLX E;  4DFA A;  5JAV A;  1L1O A;  2L55 A;  4NMZ A;  3H94 A;  1H9S A;  1F2Y A;  3NBI A;  2H4O A;  2ZT9 C;  4LF6 L;  1HQM C;  2XIW A;  3PCO B;  3JAM c;  2K01 A;  1TR5 A;  3RD4 A;  2KA7 A;  1XX8 A;  3KUP A;  3CRK C;  1A0I A;  2RF4 A;  1GUN A;  1BBX C;  2HHH L;  1JJG A;  1SNC A;  2LKV A;  3STB D;  2UXB Q;  3QOJ A;  3HKZ E;  3DEP A;  1Y8O B;  5JEA G;  2XTI A;  5I2X A;  1PV4 A;  2K5H A;  2F1M A;  3HOY H;  1I50 B;  2PZU A;  1XPO A;  1R4Q B;  3Q23 A;  3GTG B;  3I4N B;  1TWC B;  3A5Z B;  2VQE Q;  1J6Q A;  4K14 A;  4FP5 D;  1EWH A;  5J22 A;  3R2I A;  1W6J A;  3U4V A;  4C2M H;  4C3J B;  1GUO A;  1L0X B;  3J7A 5;  3FDT A;  5IYC G;  3F2U A;  1ONL A;  3F1Z A;  3CCL A;  1U9R A;  4OXP A;  2VXW A;  1ESF A;  3BZK A;  3UI2 A;  5EKK A;  3VR5 A;  4JI0 Q;  1JWU D;  4X65 Q;  3N52 A;  2LFN A;  3L3O C;  3K0Y A;  2CHB D;  3E5S A;  2B63 G;  3OWE B;  4X62 Q;  1BNZ A;  1SLJ A;  2EY2 A;  1E1T A;  1MJC A;  4H44 C;  3J81 L;  1KNA A;  2X69 A;  2A1A A;  1HZ9 A;  2E75 C;  4OO1 I;  3GTK B;  2AUK A;  4RMF A;  5AFW A;  1N34 Q;  1TWF H;  1WI5 A;  2YYZ A;  1EZ8 A;  2R92 G;  3I4O A;  2UU9 L;  3KLS X;  4ILW A;  3J80 L;  1Y1W H;  1AEX A;  3VDY A;  1IBL Q;  1DOK A;  2ICI A;  2RDF A;  4OO1 H;  2R93 H;  4BY7 H;  1N8R C;  2HIV A;  3IL8 A;  2O5J C;  1YHB A;  2EQS A;  2B2Y A;  3HOX B;  1EIY B;  3E3X A;  2Z6K C;  4C3I G;  1AFP A;  1ET9 A;  4Q0F A;  4DUZ L;  3TP5 A;  2B2T A;  2H5X A;  1GHJ A;  1TWA H;  5C4H A;  2K5V A;  3S2D B;  3K5M A;  1HA6 A;  2EVB A;  1N32 Q;  4Y52 H;  4A3I G;  3M4O B;  4EX5 A;  4P75 A;  4KKS A;  4OWT B;  2D2C C;  3BZD B;  1LTI D;  1LLR D;  1MD2 D;  3T1H Q;  2CH4 W;  3D3R A;  2GVB A;  2ATW A;  3HOV G;  4RGO S;  3F2D A;  1KC8 C;  1TT2 A;  5FLM G;  3KBG A;  1SNM A;  1RHP A;  1HFN A;  4GLV B;  4C1N I;  3GO5 A;  4UP9 A;  1NE3 A;  1HJP A;  1RTO A;  3TRE A;  4RGT A;  4S3S A;  5T1G A;  1PH2 A;  2Z9H A;  2F3W A;  5CV4 A;  2UUA L;  3ND9 A;  3HOU G;  2JA6 G;  1KLG D;  4C1N K;  1F9Q A;  1DCZ A;  3WOE A;  2R7Z H;  4FXG C;  2AHO B;  3P20 A;  5I2Y A;  4HSP A;  1A63 A;  5TSS A;  4DV2 Q;  1QIL A;  5BN3 A;  1SRO A;  4A3G G;  2RHS B;  1YNJ C;  2BA1 A;  4UAI A;  3T16 A;  1AZP A;  1AE3 A;  3J7Z C;  1Y69 U;  3IRB A;  3CHB D;  4IUV A;  2AWO A;  4O1N A;  3D4D A;  2K32 A;  4MTN A;  5E4W C;  3G48 A;  3CCR A;  5CV5 A;  4LMQ D;  3DXJ C;  1EYD A;  2VB2 X;  1V1Q A;  3M4Q A;  1UWV A;  2RHQ B;  4LW1 A;  5BN4 A;  2R3Z A;  1U0L A;  3PQI A;  1O7Y A;  3S16 H;  1A8V A;  3FKI H;  2ICE C;  2FFK B;  4DR1 Q;  2R7F A;  4BXX G;  4OWW B;  1JE4 A;  1QVG A;  5C4J B;  4MZ9 A;  3M85 A;  5I4D A;  1D5Z C;  4A3C H;  3HOZ G;  3CPW A;  2O2L D;  1H95 A;  4A3K G;  1JE5 A;  2BDN A;  1HZB A;  4DK3 C;  1RKN A;  2KCT A;  2XN9 C;  4L5S A;  3I4M G;  2NUC A;  1TII D;  4OIJ A;  5KYL A;  1J5E Q;  1XPU A;  5KEE A;  1VCI A;  3J7A V;  2V1C C;  1RDP D;  4Y7N H;  1PDQ A;  3GDE A;  4A3B H;  4FF1 A;  3S14 B;  4DXF A;  3P7J A;  1VQA A;  1JJ2 A;  3FMC A;  2F0P A;  4G57 A;  1IL2 A;  3C1E A;  3VR6 A;  2K04 A;  1PRT F;  3D6C A;  2EE1 A;  3MFG A;  4GS3 A;  2VUM B;  3HEJ A;  2MO0 A;  1IZ6 A;  2B63 B;  4BA2 I;  5CV9 A;  1HUM A;  4OX9 L;  1CZW A;  3CQZ B;  2RA4 A;  1O7I A;  1EY0 A;  4A3F G;  5M3F B;  4NPS A;  3W1G A;  3FVQ A;  1CKN A;  1HNW L;  4DV0 Q;  4XT3 B;  2YU9 H;  1PFN A;  2NVX B;  3H3V I;  2K1B A;  2B8G A;  4DR5 Q;  4LJZ C;  1V8Q A;  5IP7 G;  2IY5 B;  3KK7 A;  2RCF A;  4KHV A;  5IP9 H;  2F0W A;  4QL5 A;  2HCI A;  4OEL B;  2IX1 A;  2R92 B;  2K14 A;  1EU3 A;  5E3F A;  4GOP B;  5M5W H;  3H3V H;  4DR2 Q;  2N88 A;  4IUT A;  3H3V C;  2K28 A;  2QDL A;  1WTV A;  4B9X A;  2IPK D;  4HJ8 A;  1D8L A;  2OTJ A;  2L9H A;  4DAP A;  5C0X G;  3OMC A;  4LAA A;  4C3I B;  1H9K A;  3VYR A;  1JMC A;  2KCN A;  1PTO F;  2KUM A;  4GOP A;  1G8Z D;  1I6H B;  5A35 A;  1BDO A;  3P75 A;  4JC0 A;  4K6L A;  4YCW A;  3I2Z A;  1PMR A;  2J7Z A;  1GHK A;  1YJN A;  2IT1 A;  4A3I B;  4F87 A;  4K2K A;  2JA7 G;  3RZO H;  2BE5 C;  3M9B A;  1B70 B;  3CC7 A;  1F9P A;  1LT4 D;  3G6E A;  1K8G A;  1MIU A;  3HOV B;  1WYD A;  1PH8 A;  3V96 A;  4H7B A;  4JI7 Q;  4PMW A;  3I91 A;  3FEW X;  4ZYS A;  3DEO A;  3PV0 A;  3HGB A;  4RHR A;  4CKC A;  5FO8 B;  4GKJ Q;  3KYH C;  1RCV D;  4IJH A;  4X3S A;  1HCZ A;  3W1B A;  4P71 A;  4DV1 Q;  3HOU B;  5K36 G;  2JA6 B;  3OOC A;  3QB3 A;  2F0E A;  3S15 B;  4K8I A;  2B2Y C;  2DGY A;  4LUV A;  1GXD C;  1C48 A;  1KNE A;  2X6L A;  3VR2 A;  1IHZ A;  4A3G B;  1PLF A;  1WOC A;  1X3E A;  2OWO A;  3QR8 A;  5C6A A;  3PUV A;  2MPM A;  3C2P A;  1QE6 A;  3JAM i;  5M5X B;  1IBK Q;  4IZ8 A;  3KLW A;  2H1E A;  5DM7 3;  3KF6 B;  2B2V C;  1VQC A;  4JOI A;  4DR7 L;  5GAD C;  1A3V A;  1WVL A;  2E8G A;  2JE6 I;  1R9T B;  1EOT A;  3CKI B;  3S1M B;  1I4Q A;  3H0G G;  4QIW E;  4X64 Q;  1EIG A;  2K4K A;  1HNX L;  1I4G A;  4G7O C;  3KF6 A;  2PMZ B;  2I0Q A;  1XXG A;  3TP6 A;  3HOZ B;  1QOH A;  2B39 A;  4A3K B;  4JI6 L;  2JN4 A;  3NSW A;  2Z1C A;  5LMN Q;  3I4M B;  1F9R A;  2CKZ B;  2M2L A;  3S2H H;  3GD7 A;  4X66 L;  3CRL C;  2E2I H;  3EVQ A;  3S1Q B;  1JOK A;  4H0L C;  1IW7 D;  1B3Q A;  1SE2 A;  1BF4 A;  1Q8K A;  3W3A A;  1TS4 A;  4DV4 Q;  3ULL A;  3HG9 A;  2B2W A;  4NKL A;  2B2U C;  2OCE A;  5ELC A;  5IT9 E;  4K0K L;  3PMF A;  1TWG B;  4R8I A;  2E2J H;  4A4I A;  1WTP A;  1EOV A;  3CXC A;  2F3V A;  1AN8 A;  1IBM Q;  5M3M H;  2A6H C;  1CHQ D;  4KJO A;  4MN3 A;  1G6P A;  2E2H H;  2F0U A;  1VQG A;  1A3U A;  4IO9 A;  3S1N H;  4JYA Q;  1SYB A;  1PFS A;  1STN A;  1EY6 A;  1FJG Q;  2QGQ A;  2FHT A;  4GLA C;  4YCV A;  4A3F B;  2EZV A;  4GKK Q;  2K50 A;  4XYO A;  4HCS A;  1K8O A;  4HIK A;  2A68 C;  3VA5 A;  3KLR A;  1J8I A;  4FYD A;  3OHX C;  1LYL A;  3LWU A;  4J1M A;  4IPD A;  3MEH A;  3A8K E;  3BYT B;  4N8X 1;  1L0W A;  3CCV A;  4QIW B;  3TDQ A;  4CKB A;  1IBM L;  5LMU Q;  1G51 A;  4KN7 C;  4BWG B;  4JYA L;  1S4Z A;  1PRT C;  3TP7 A;  1FVI A;  1R4P B;  4PMB A;  5IWA L;  4QUF A;  3J81 E;  4A3J G;  1FJG L;  3SXH A;  1V1O A;  2NBF A;  3DWP A;  2JQO A;  2Q2T A;  4IOC A;  1SJE D;  2JA5 G;  4POF A;  2Z8L A;  2JA7 B;  5JVG 3;  1CM9 A;  1SR3 A;  1SSO A;  3RMH A;  2NZH A;  2Q8I B;  1OXV A;  2OXP A;  1B9N A;  4CDE C;  2PCF B;  3E6Z X;  1TY0 A;  3MTS A;  3FHW A;  1I4P A;  3J80 E;  4A3E H;  1EQQ A;  4K2L A;  2Q2I A;  1N36 L;  1SND A;  5JJI A;  1XNQ L;  1HTL D;  1X3Q A;  3IFD A;  3NQI A;  5I6Y A;  2HT1 A;  4X3U A;  3KOJ A;  1XNR Q;  4KN4 C;  1B44 D;  1STB A;  4RCN A;  5JPN C;  5T1I A;  3GTP B;  1Y1W B;  2B29 A;  1PTO H;  2ZJQ A;  1A6X A;  2EIF A;  3BVZ A;  1EL0 A;  1PTO C;  3SK5 A;  1NUC A;  1ZXT A;  4IJL A;  2K05 A;  1VQ6 A;  1QJO A;  3NWS A;  1WTR A;  2LXJ A;  4JPB W;  1WJJ A;  1IL8 A;  2JJQ A;  1KAB A;  5EGT A;  5IOC A;  3K7A B;  3UDF A;  2UXC Q;  2PQA B;  1VQL A;  2N49 A;  3ITP A;  1PH1 A;  3H0G B;  1M8A A;  2BCO A;  4HJA A;  1WCM G;  1NR4 A;  2PQA A;  4FF2 A;  5IYD H;  3QIA A;  2OTL A;  4ID6 A;  1B9M A;  2CW0 C;  5JEA J;  4PZ8 A;  1CQF A;  4HMI A;  4WJ3 M;  1E2Z A;  5ELO A;  4GN3 B;  4XIG S;  4JG2 A;  5H1S E;  1HR0 Q;  1M4V A;  1HZC A;  1Y1V H;  3I90 A;  3O13 A;  4CDC C;  3ND8 A;  1PZI D;  4B3R Q;  2K52 A;  4CBV A;  1SNQ A;  1IYU A;  1Q82 C;  1FYC A;  2RSN A;  1I3Q H;  2RSO A;  5CV8 A;  4GNX A;  5IGC A;  1NR2 A;  1QB5 D;  2BH2 A;  1EY4 A;  3DWA A;  3HRZ C;  3ERO A;  1U5K A;  1ICF B;  3U9O A;  1QVC A;  4Z9C B;  5EQ0 A;  5M5Y H;  3OSO A;  1SMY C;  5HUR A;  1NMG A;  1CI3 M;  3MVV A;  3J7A F;  1ENF A;  5DAU A;  2WB1 G;  3D4R A;  1OXX K;  4JI8 Q;  4NXM L;  4DK1 A;  4LF8 L;  1EEF D;  5IIF A;  2HD3 A;  3SEB A;  3D31 A;  2ZTC A;  4F8M A;  4R4O A;  1PXU A;  2C5C A;  3T1Y L;  1K3R A;  5LL6 X;  5ISR A;  4JI4 L;  4OHJ A;  1DM0 B;  1B53 A;  4DU9 A;  2Z6B A;  3NPP A;  3DMU A;  1L0Y B;  1ENC A;  2CH4 A;  3BVG A;  1E7Z A;  4DV5 L;  4A3L H;  4HAE A;  2QKI C;  3K6O A;  3M7N A;  4K6D A;  1TS5 A;  3OTO Q;  5C44 G;  2JP1 A;  3KBX A;  4BBS H;  4XDX A;  3K7U C;  2DY8 A;  3F8T A;  2Q8T A;  1DJR D;  1GOZ A;  4NXN Q;  3GTM H;  1JC7 A;  4QB4 A;  1E2V A;  4K5W A;  3H15 A;  4JI8 L;  5FJ8 H;  2E5L Q;  1UE1 A;  2XVS A;  4DR3 Q;  2DNC A;  4A3D H;  3TP8 A;  4A3B B;  4A3J B;  2V4D A;  1BO0 A;  5IT9 L;  4KKT A;  1P8L A;  4B3T Q;  4IUN A;  1E0B A;  4JV5 L;  2QW7 A;  1VDZ A;  3AQQ A;  4YIJ A;  4RKB A;  2JA5 B;  2I46 A;  3UE1 A;  2G5D A;  4O0A A;  5C3E H;  1NAP A;  2QDB A;  3RR5 A;  2DUD A;  4ZRZ A;  2XWB B;  1STH A;  4WOR A;  5EPL A;  5C4X H;  2RCN A;  1H9M A;  1B3A A;  1P16 A;  2EYJ A;  2DNE A;  1XMQ Q;  1FNV A;  1SYG A;  1MSG A;  4V19 0;  1MGS A;  4DV6 Q;  1EWI A;  2NN6 G;  3A8I E;  1MJE A;  1EYG A;  1DZ1 A;  1SN8 A;  5KYI A;  5GAE C;  4DR3 L;  3EA6 A;  3TEH B;  4J6H A;  2HQL A;  2WB1 E;  3MA2 B;  4IPH A;  4P2C B;  3CMA A;  2A8V A;  1T5X D;  1CUK A;  2UXB L;  1SYF A;  4IUP A;  1WTH A;  4B3S Q;  2VUM G;  4LFB Q;  3CD6 A;  3UDX A;  5M3F G;  4P73 A;  2SNM A;  4X3T A;  2VQE L;  1VQ5 A;  2PZW A;  2HDM A;  1KTK A;  3MWY W;  4FO2 A;  1LTT D;  1F2M A;  1HXY D;  2VZA A;  3A55 A;  2JA8 H;  4MHE A;  4QQB X;  3GTL H;  1G29 1;  1WCM B;  1EQT A;  1B8A A;  4LF5 Q;  4YWK A;  3ICE A;  1Q46 A;  2DN8 A;  1KDA A;  4FNF A;  1LO5 D;  4JI0 L;  3EIV A;  4MIU A;  4M1U B;  4X65 L;  1X32 A;  4DNR B;  2NWG A;  3STB C;  2VY3 A;  2DY7 A;  2I5H A;  4PZ7 A;  4X62 L;  3TME A;  2JYO A;  4LFC Q;  1YBY A;  1CQV A;  3IAY A;  1HQR D;  4AQY Q;  1EU4 A;  3DM1 A;  1TVX A;  3MXU A;  1B7Y B;  3G71 A;  3A54 A;  1S3O A;  2GA4 B;  3I72 A;  2G9H D;  3TZU A;  1N34 L;  3PO3 H;  3TN2 A;  4X3K A;  1QNK A;  1K3B C;  2Q8R E;  3PF4 A;  2UXD Q;  1B2T A;  1NTG A;  4B9W A;  4LF5 L;  2CQO A;  3GTJ B;  1IBL L;  3CCS A;  3AYH B;  5ELN A;  2WB1 B;  3LNN A;  2PYK A;  3GTO B;  2K75 A;  3EJI A;  2Y0S G;  2IX3 A;  4R4I A;  3BYY B;  3SE0 A;  1I4X A;  4LFC L;  1NJI C;  5IGF A;  5DEH A;  4LWC A;  1PH5 A;  4UP7 A;  3CC4 A;  1KIX A;  4LF7 Q;  4KHP Q;  1W3S A;  2EYF A;  2LXK A;  5LHY 1;  2DJG C;  1KLU D;  3UDI A;  5CV6 A;  4DAY B;  1Q8I A;  1N32 L;  2FXQ A;  2SDF A;  5ELF A;  2AUJ D;  5C44 B;  4J8Q A;  2F4V Q;  3T1H L;  1TWH B;  1MKH A;  4DKA C;  2JSO A;  2G9D A;  2PI2 E;  2EY5 A;  1K8M A;  1RIP A;  3GTQ H;  4GNX C;  3NQT A;  3S2H B;  4DAY A;  4FF4 A;  1ET6 A;  3S1R H;  1QVF A;  1FD7 D;  3T51 B;  4C3H H;  3KDF B;  5JJZ A;  1FGU A;  2IJ0 A;  5C0X J;  1PH3 A;  1KL9 A;  1I4R A;  2A69 D;  5IYB G;  1K83 B;  3HOW H;  2TMP A;  2NVY H;  1EQR A;  1I6V C;  3KDF A;  4JI2 Q;  5D3I B;  4HCE A;  2AMC B;  4IFD G;  5IGG A;  3RZD H;  1E24 A;  3IKJ A;  2KEE A;  4JK1 C;  4V0B A;  4DV2 L;  4KMU C;  4UDU C;  4RKL A;  1Q90 A;  3L2P A;  5EPJ A;  2L4N A;  1CT1 D;  2CQA A;  5F2D A;  3H91 A;  3NEN A;  1V9P A;  1EY9 A;  1WTW A;  1PFM A;  3NTI A;  1I94 Q;  3WOF A;  4A93 H;  2EPB A;  3VYT A;  4F88 A;  1F9S A;  1SYC A;  1OXT A;  3RLO A;  2ID0 A;  2N8N A;  3D0F A;  5GAG C;  1VQO A;  1KXL A;  2EJG C;  1JB7 A;  4DK0 A;  2ZTE A;  2SOB A;  4UPA A;  4DR1 L;  1LT3 D;  1L1O C;  3A0J A;  4DV7 Q;  1E3P A;  3MEF A;  2Y0S E;  5NUC A;  3VR3 A;  4L6T B;  1AZQ A;  2WAQ G;  3SK4 A;  4RCO A;  5FJ8 G;  5EJW A;  5ELB A;  4A3M H;  2GVA A;  4AYB G;  2K5N A;  1PRT B;  1CFM A;  2FMM A;  3M7G A;  1VMP A;  3JC6 6;  4DAV A;  1ILP A;  1AH9 A;  1SFO B;  3C1F A;  3CAM A;  1VMC A;  1J5E L;  1TY2 A;  2RDH A;  1TU2 B;  1ASY A;  4HIM A;  2KCM A;  1EFI D;  4I7Z C;  1YJW A;  3NE5 B;  4QY7 A;  1HTP A;  2BH8 A;  2D5D A;  5KIX A;  1HRJ A;  2JK8 A;  2KCC A;  1PYW D;  3CF5 A;  1PFB A;  4KY7 A;  2DJF C;  2PI2 A;  4GN4 B;  4B3M Q;  3HOY G;  4AIM A;  1EUJ A;  5KNB A;  4IOA A;  1I50 H;  2VL6 A;  1NNX A;  3GTG H;  1CA6 A;  3I4N H;  2NTS A;  4FDB A;  2NVQ B;  4C3J H;  3VR4 A;  5EKI A;  3MZ5 A;  2PMZ E;  4UP8 A;  4QF4 A;  1VQP A;  3PUW A;  1UEA B;  1O80 A;  2QF7 A;  4HTH A;  4DV0 L;  3TRZ A;  2EYP A;  1XWE A;  5AJ3 Q;  4DR5 L;  2KQ3 A;  5J39 A;  1UE7 A;  1QCB D;  4NP5 A;  1PYB A;  3BZC A;  2JA9 A;  1JWS D;  1EY7 A;  2B8F A;  4HN7 A;  4QJF A;  3K80 C;  5FLX c;  1K8A C;  3G7L A;  1STY A;  5EKL A;  2L0C A;  1VQ9 A;  2PO4 A;  2MQH A;  2PNR C;  4DR2 L;  1UUP A;  3GTK H;  3I56 A;  2Y0S B;  2YTY A;  1K0S A;  5EAY A;  2GN5 A;  4R4C A;  1I4H A;  4PMC A;  3LGJ A;  3G6J B;  4XXE A;  2L11 A;  4G4K A;  2VW9 A;  2MNA A;  2KVM A;  1LTG D;  3RLN A;  1Y1W G;  4OO1 G;  2OQK A;  2D0P A;  2R93 G;  4HJ5 A;  2FJ2 A;  2WAC A;  3DWQ A;  4BY7 G;  4XYQ A;  2B2T C;  3H6M A;  4CDD C;  1CK1 A;  2L15 A;  1YHA A;  4NDX A;  4ULL A;  5D65 A;  3UE0 A;  1K9M C;  4K8J A;  3HOX H;  4KD4 A;  2F0M A;  2F0K A;  1EZ6 A;  1D6E C;  1M1K C;  5LL6 S;  5C4Z A;  2ZTD A;  4JI7 L;  1GVP A;  2A6H D;  4FXD A;  4JI1 Q;  2XRS D;  1I3Q B;  5CGK A;  3S2D H;  2HQE A;  1BCP B;  1W6K A;  3JAM E;  1QZG A;  3M4O H;  3PUZ A;  4GKJ L;  3E9H A;  5G3L D;  4DV1 L;  1ZYR D;  1VQJ A;  1A62 A;  2IW3 A;  1Z7T A;  2WKD A;  2RKS A;  5D3D A;  4LUZ A;  4C56 C;  2X6G A;  4DUY Q;  3AB9 A;  3NEM A;  3SK8 A;  4LFA Q;  4EVO A;  4POG A;  2LY7 A;  5ELD A;  1IBK L;  4APV A;  2R7Z G;  5J3B A;  4ZCK A;  2F03 A;  3PO2 H;  2RVL A;  3AEV A;  3VA7 A;  4ZAI A;  2XGT A;  1PRT D;  2YTV A;  3M3Y B;  1Q1B A;  4OGQ C;  3EQL C;  2QA4 A;  3ULP A;  4X64 L;  1IXR A;  1T9H A;  5BR8 Q;  2KEC A;  3LX0 A;  2F0O A;  1DOM A;  2WAQ B;  1CKO A;  4C3H G;  2EYL A;  4ZKC B;  2MHV A;  5IGE A;  1Q7Y C;  4AYB B;  1FGB D;  3CCE A;  4RHS A;  2MJ8 A;  4IPC A;  5LMN L;  1BBW A;  3FKI G;  1ESR A;  3NTK A;  2KED A;  2R7D A;  5LMN W;  4DR6 Q;  4A3C G;  1I5F A;  5C4J H;  4YY3 Q;  1YNN D;  4O2D A;  4DV4 L;  2NTT A;  4BS9 A;  1RJT A;  4PZ6 A;  2QEX A;  4IUU A;  2RQX A;  4KY6 A;  1D1I A;  5JEA H;  1HZA A;  1YNX A;  3OIP A;  4L5T A;  3HOY B;  4JI3 Q;  1II3 A;  3FP9 A;  1YJ9 A;  1EYC A;  1SE8 A;  4PQX A;  4IAL A;  5K5P A;  4C2M B;  2VQF Q;  1X56 A;  4DR4 Q;  3ONA B;  3R2T A;  1DON A;  3TS0 A;  2XNA C;  2A6E C;  1HPC A;  4A3B G;  1T5E A;  2UUC Q;  1TS3 A;  1XTD A;  2Z4I A;  1JOR A;  5IYC H;  4GKK L;  1E2W A;  3MXP A;  2B3G A;  3U50 C;  4U67 3;  3GV3 A;  1NBW A;  4RA8 A;  4CJ0 B;  3L0O A;  1S72 A;  1C4Q A;  1IW7 C;  4KLK A;  1ML0 D;  3W5O A;  1U4P A;  3BU2 A;  2A5H A;  2EYO A;  4DV3 Q;  2B63 H;  4ME3 A;  1G6Z A;  2E2D C;  2Z4H A;  3CQZ H;  4JI3 L;  4PG3 A;  1ASZ A;  2CW0 D;  5LMU L;  3I3C A;  1STA A;  2NVX H;  3OWF A;  3RUZ A;  2VQF L;  5IP9 G;  4EGV A;  1TWF B;  1CSP A;  3BG3 A;  5E7N A;  2K33 A;  1XJV A;  3NP8 A;  2PW7 A;  3I73 A;  3T53 B;  4RH6 A;  5A2Q L;  3MHB A;  4DXG A;  1WD0 A;  2R93 B;  2PQE A;  1Q12 A;  4N8F A;  1XMO Q;  4GOP C;  4BY7 B;  1BCP D;  1AP0 A;  1CSQ A;  3ERS X;  3S9W A;  1JOQ A;  1PA6 A;  1KAA A;  4DV3 L;  2O4X A;  4C3I H;  2HIX A;  1CTM A;  1TWA B;  3C46 A;  1D2B A;  5CYU A;  2ZJP A;  1I6H H;  3HFZ B;  1X6O A;  3RN2 A;  2Z6K A;  3U58 A;  4A3I H;  2BOS A;  1KDC A;  1HNZ Q;  1FNU A;  1RTN A;  3WWV A;  1XNR L;  4YCU A;  1N33 Q;  3HOV H;  4LF4 Q;  4N9T A;  1BUV T;  4A75 A;  1O78 A;  5FLM H;  2KHS A;  3CP0 A;  3PUX A;  4K5X A;  5FO7 B;  1LV9 A;  3NWT A;  4CJ1 B;  3T4A C;  4XT1 B;  2EYM A;  4DPG A;  1Q86 C;  2CVR A;  3HOU H;  2R7Z B;  2JA6 H;  3SGI A;  3S15 H;  2J4X A;  1DD2 A;  3F2B A;  3T56 B;  2UXC L;  2UUB Q;  4LF9 Q;  4HIO A;  2MFI A;  1DGS A;  2OQ0 A;  1UE6 A;  4JBW A;  2QIL A;  5FKA C;  1GUS A;  4JW0 A;  4QMG A;  4JVZ A;  4A3G H;  5JJK A;  5CR3 A;  1HNZ L;  1PVO A;  4HID A;  5IGD A;  3MFY A;  4JOI C;  4J15 A;  4YWM A;  1ENA A;  2HUG A;  4Q5V A;  2EDG A;  5DLQ E;  3P1H A;  5M5X H;  2F3I A;  3TSS A;  4C3H B;  4YHH Q;  1KAW A;  3JAM L;  4LNQ A;  3GQB A;  3S16 B;  4IN3 A;  3I8Z A;  2NZ1 D;  1R9T H;  1O7Z A;  3FKI B;  1HR0 L;  3S1M H;  3CU7 A;  2EJM A;  1XTC D;  1D5M C;  2NYZ D;  4R4T A;  4L8J A;  1STG A;  4B3R L;  4BXX H;  1JR0 D;  1HR0 W;  3RLF A;  3A56 A;  3KLS A;  1QG7 A;  5JVH 3;  2UUB L;  3HOZ H;  4OON A;  4PNY A;  3RZD B;  2AQ3 B;  2AWN A;  3CCQ A;  3GP7 A;  1EFW A;  1PHJ A;  4A3K H;  3D6W A;  1GJX A;  4K5V A;  4LF6 Q;  4ZLT F;  1SBB B;  2F52 A;  3I4M H;  1BBU A;  3FPU B;  4OL7 A;  5CC4 A;  2B2W C;  2NZO A;  1VQE A;  3S1Q H;  1PH4 A;  4A93 B;  1WTQ A;  2K5W A;  1U4L A;  4YHH L;  4Y7N B;  4HMJ A;  3R8B A;  2EXZ A;  5EBD A;  3DUZ A;  4P72 A;  1YHQ A;  2A74 C;  3EFX D;  2FMC A;  3GV6 A;  4FVM A;  1TWG H;  1TQO A;  1KHI A;  1N9W A;  5C3W A;  5M3M G;  2ZXO A;  1CA5 A;  1FNW A;  1VQH A;  2AQ2 B;  3OW2 A;  3PSI A;  4DNT B;  3AMU A;  3OTO L;  4FXK C;  3PIP A;  5IY0 A;  5KNC A;  4I7A A;  1VQF A;  1LUZ A;  4RGM A;  2F0V A;  3SR1 A;  4NXN L;  3DLL A;  5L37 A;  3QG1 A;  4A3F H;  2YU9 B;  2L1B A;  4KY5 A;  2ZXP A;  4KKU A;  2E5L L;  2NVT H;  2XRQ D;  3DM3 A;  2MGS A;  5IP7 H;  2EYH A;  5COY A;  1BXT A;  5C0X I;  5FOB B;  2ZXR A;  1WTX A;  2MUY A;  1MSH A;  3K5N A;  4B3T L;  4QCL A;  3KFU A;  1LTS D;  2F0L A;  5M5W B;  3NHH A;  2ZJR A;  1GO3 E;  1EY8 A;  4KD3 A;  2BDO A;  5CMD A;  1UE5 A;  1U4R A;  5KGU A;  3BS1 A;  2N55 A;  1WTO A;  5C0X H;  4QUC A;  2I5M X;  2PZT A;  3K5L A;  3K57 A;  3I70 A;  5IGB A;  2UU9 Q;  1XMQ L;  5IT9 c;  4CHT B;  3H09 A;  4DV6 L;  1TXY A;  3C3L A;  3RZO B;  1SNO A;  2JA7 H;  3URY A;  3V05 A;  1BKB A;  1GUG A;  4XTC S;  4A3E G;  1LM0 A;  1VQB A;  4H13 C;  4TQU S;  4DUZ Q;  4IFD J;  4YWL A;  5C3X A;  2MP1 A;  2N3S A;  2KHI A;  1PZK D;  4B3S L;  5E4X A;  5BN5 A;  4LFB L;  1SNP A;  1YNJ D;  1HHV A;  3I4L A;  4GN5 A;  3CC2 A;  3ER0 A;  2JEA I;  5ELE A;  1X9N A;  2CFM A;  3L7Z C; 
#chains in the Genus database with same CATH homology
 4KV6 A;  3LWE A;  2XWJ B;  5K36 H;  2K7V A;  1OXU A;  2IX0 A;  2IWH A;  4WJW A;  1SJH D;  3A7L A;  3BDL A;  1OO9 B;  3MC0 B;  4KJN A;  1A3T A;  3BDO A;  1S5B D;  3HKZ B;  3D4W A;  1G2S A;  1OXS C;  2M00 A;  1XYI A;  3OW7 A;  3A8J E;  1SDF A;  1U4M A;  4R9W A;  5J1Z A;  1JIC A;  1SEB D;  5EPK A;  3ZYY X;  1HA5 A;  1SE3 A;  2B2V A;  2K5Q A;  3OIQ A;  1LT5 D;  1KDB A;  3X3N A;  4E6I A;  1JCK B;  1F77 A;  2M9V A;  2WII B;  2E2I B;  1UAP A;  4R8N A;  1LTB D;  3PO2 B;  1F2Z A;  1IYV A;  5C5L A;  3MXG A;  4TSS A;  1H9J A;  3K59 A;  2E2J B;  5FO9 B;  2SEB D;  2WIN B;  2J0T D;  5M3M B;  1SXT A;  2E2H B;  2B2U A;  3S1N B;  3AU7 A;  4RAU C;  4F7X A;  3Q22 A;  1FR3 A;  1IKM A;  1CHP D;  3SVM A;  2EY6 A;  1S5E D;  3M4Y A;  1ILQ A;  2F0D A;  1HFG A;  3MAQ A;  4HSV A;  5G3L F;  4G7Z C;  4L63 B;  1S5F D;  2F0J A;  1JOO A;  5DNF A;  2OF1 A;  2SNS A;  3Q6S A;  1LAB A;  5I6W A;  2BE5 D;  4M8A A;  1ZEQ X;  2QEJ C;  1GUW A;  4XQJ A;  3FRP B;  2EJF C;  4ODG A;  5I9P A;  1B4O A;  1Y8P B;  4B08 A;  4ZKB B;  4PV1 C;  4WFN 3;  5FLX L;  4CJ2 C;  1V43 A;  1AW7 A;  2VB3 X;  2A69 C;  2I07 B;  5CBE E;  4A3E B;  4DGZ A;  5A2Q E;  2F0N A;  2PPB C;  1BR9 A;  1G91 A;  1DXM A;  1QWY A;  3QO2 A;  1EQV A;  1BQQ T;  1Z47 A;  2F0I A;  3OMG A;  3R93 A;  1PTO B;  2HCC A;  2FIN B;  2EOT A;  3U9S A;  2F0H A;  4EQN A;  3IFT A;  2RBM A;  5C5M A;  2E76 C;  4KI0 A;  1G2T A;  5D14 A;  4LK1 C;  1O7L A;  1UNS A;  5M9O A;  2KJX A;  2JEB I;  2QCP X;  5CV7 A;  2RDG A;  2JXM B;  2WP8 J;  2R61 A;  2K03 A;  1EIH A;  3R3O A;  1DYQ A;  1F2L A;  2WV6 D;  4DN4 M;  4CGY B;  1B50 A;  3HZX A;  1SYD A;  1JWM D;  1TKW B;  4ZUI A;  3Q24 A;  4I65 A;  4XQQ A;  1Y1V B;  1D5X C;  2F0T A;  4OIK A;  1WD1 A;  3OPO A;  5EBC A;  3SDZ A;  4EQO A;  1ICW A;  5M5Y B;  3NTH A;  1EEI D;  2K6A A;  2KOL A;  2A68 D;  1BCP F;  2XSC A;  1QNU A;  1J9O A;  4FF3 A;  2ENB A;  1DOL A;  2OEO A;  1VF7 A;  2E74 C;  3KF8 A;  2A6E D;  3A7A B;  5CBA E;  3DHQ A;  1STE A;  4BBS B;  2VNU D;  1C8C A;  4HED A;  1SAP A;  1SE4 A;  4CKE A;  4ZK9 B;  3GTM B;  2L5T A;  4O42 A;  2WKC A;  5HGT A;  1JB3 A;  4XQN A;  5KRU A;  4A3D B;  1ROD A;  1LTR D;  1EWC A;  1VF5 C;  3D8G A;  4DF7 A;  1A15 A;  3HS0 C;  5C3E B;  1LT6 D;  1GUT A;  5I9O A;  5DM6 3;  2NN6 I;  5C4X B;  1Q3L A;  1B1Z A;  1ZYR C;  1PTO D;  1H9R A;  2LS0 1;  2NVT B;  1Z6H A;  2NN6 H;  3WDN A;  4RFB A;  4TRD A;  5JPM C;  1BOS A;  4U68 A;  4KK7 A;  3V2T A;  2TSS A;  3W2D A;  4ME5 A;  2OT2 A;  2R6G A;  4DA2 A;  4ZUJ A;  1NSN S;  3PIP 3;  2NB0 A;  3BVM A;  1TS2 A;  1MI2 A;  2BA0 A;  2JA8 B;  1EY5 A;  3BDC A;  3GTL B;  4BA1 I;  1RF2 D;  2F0F A;  1A2T A;  1V1P B;  4GZY C;  2D9U A;  1YNN C;  4C3J G;  4ZQ3 A;  3X3M A;  1SMY D;  1V1P A;  3NXW A;  3SHL A;  4KTA A;  1D1K A;  2K5D A;  1Q1E A;  3PO3 B;  3E0J A;  1JQY D;  3TZD A;  1Y8N B;  4HR7 B;  3QOL A;  2D62 A;  4BBR B;  2AQ1 B;  1NCV A;  1PZJ D;  1CZG A;  3SK6 A;  1RD9 D;  2HDL A;  4KHZ A;  3VYS A;  2PW5 A;  4IQZ A;  1S5C D;  4RGN A;  1LTA D;  2F0G A;  3NUC A;  2O5I C;  3T13 A;  2EY1 A;  1IKL A;  3PUY A;  2F4I A;  1S5D D;  3J7Y W;  1LAC A;  1SYE A;  3N6R A;  3K58 A;  3Q0A A;  3GTQ B;  3NK9 A;  5COR A;  1X3P A;  3S1R B;  4WRD A;  4EQP A;  5E1F A;  3NBH A;  3HP3 A;  4IFD I;  1BCP C;  3HOW B;  1A2U A;  2NVY B;  1ZKO A;  4IUR A;  3S17 B;  5JOB A;  4RWS C;  3FPP A;  3VYU A;  3PIO 3;  4G7H C;  2A73 B;  4IFD H;  2C9O A;  3MXN A;  5FK9 C;  1EYA A;  4ABN A;  4BY1 B;  3QWN A;  3L9A X;  1MBY A;  5KND A;  4IUQ A;  2F0S A;  4TKO B;  2F0Q A;  2L12 A;  4NW2 A;  3QJY A;  1HUN A;  1H9S B;  5IOD A;  3ERQ A;  2LMC B;  3K5O A;  4N9P A;  2IL8 A;  3TBI B;  4A3M B;  5FLX E;  4DFA A;  5JAV A;  2L55 A;  4NMZ A;  3H94 A;  1H9S A;  1F2Y A;  3NBI A;  2H4O A;  2ZT9 C;  1HQM C;  2XIW A;  2K01 A;  1TR5 A;  3RD4 A;  2KA7 A;  1XX8 A;  3KUP A;  3CRK C;  1GUN A;  1BBX C;  1SNC A;  2LKV A;  3QOJ A;  3DEP A;  1Y8O B;  5JEA G;  5I2X A;  2F1M A;  1I50 B;  2PZU A;  1R4Q B;  3Q23 A;  3GTG B;  3I4N B;  1TWC B;  4K14 A;  4FP5 D;  1EWH A;  5J22 A;  3R2I A;  1W6J A;  4C3J B;  1GUO A;  1L0X B;  3FDT A;  3F2U A;  1ONL A;  1U9R A;  2VXW A;  1ESF A;  3UI2 A;  5EKK A;  3VR5 A;  1JWU D;  3N52 A;  2LFN A;  3L3O C;  3K0Y A;  2CHB D;  3E5S A;  3OWE B;  1BNZ A;  2EY2 A;  4H44 C;  3J81 L;  1KNA A;  2X69 A;  2E75 C;  4OO1 I;  3GTK B;  2AUK A;  5AFW A;  2YYZ A;  1EZ8 A;  3KLS X;  4ILW A;  3J80 L;  1AEX A;  1DOK A;  2ICI A;  2RDF A;  4OO1 H;  3IL8 A;  2O5J C;  2B2Y A;  3HOX B;  4C3I G;  1AFP A;  1ET9 A;  4Q0F A;  3TP5 A;  2B2T A;  1GHJ A;  5C4H A;  1HA6 A;  3S2D B;  3K5M A;  2EVB A;  3M4O B;  4KKS A;  2D2C C;  3BZD B;  1LLR D;  1LTI D;  1MD2 D;  3D3R A;  4RGO S;  1TT2 A;  3KBG A;  1SNM A;  1RHP A;  1HFN A;  4C1N I;  3GO5 A;  1RTO A;  4RGT A;  4S3S A;  5T1G A;  2F3W A;  5CV4 A;  3ND9 A;  1KLG D;  4C1N K;  1F9Q A;  1DCZ A;  3WOE A;  4FXG C;  3P20 A;  5I2Y A;  4HSP A;  5TSS A;  1QIL A;  5BN3 A;  1YNJ C;  2BA1 A;  4UAI A;  3T16 A;  1AZP A;  1Y69 U;  3CHB D;  4IUV A;  2AWO A;  4O1N A;  3D4D A;  2K32 A;  5E4W C;  5JVH 3;  5CV5 A;  4LMQ D;  3DXJ C;  1EYD A;  2VB2 X;  5BN4 A;  2R3Z A;  1O7Y A;  2ICE C;  2FFK B;  1JE4 A;  5C4J B;  3M85 A;  5I4D A;  1D5Z C;  2O2L D;  2BDN A;  1RKN A;  2XN9 C;  2NUC A;  1TII D;  4OIJ A;  5KYL A;  5KEE A;  1VCI A;  3J7A V;  1RDP D;  1PDQ A;  4FF1 A;  3S14 B;  4DXF A;  3P7J A;  3FMC A;  2F0P A;  4G57 A;  3C1E A;  3VR6 A;  2K04 A;  1PRT F;  3D6C A;  2EE1 A;  3MFG A;  2VUM B;  3HEJ A;  2B63 B;  4BA2 I;  5CV9 A;  1HUM A;  1CZW A;  3CQZ B;  2RA4 A;  1EY0 A;  5M3F B;  3FVQ A;  4XT3 B;  1PFN A;  2NVX B;  2K1B A;  2B8G A;  4LJZ C;  1V8Q A;  3KK7 A;  4KHV A;  2F0W A;  2HCI A;  2IX1 A;  2R92 B;  1EU3 A;  5E3F A;  2N88 A;  4IUT A;  3H3V C;  2K28 A;  1WTV A;  4B9X A;  2IPK D;  2L9H A;  4DAP A;  5C0X G;  3OMC A;  4LAA A;  4C3I B;  1H9K A;  3VYR A;  2KCN A;  1PTO F;  2KUM A;  1G8Z D;  1I6H B;  5A35 A;  1BDO A;  3P75 A;  4K6L A;  1PMR A;  2J7Z A;  1GHK A;  2IT1 A;  4A3I B;  4F87 A;  4K2K A;  2BE5 C;  1F9P A;  1LT4 D;  3HOV B;  3V96 A;  4H7B A;  4PMW A;  3I91 A;  3FEW X;  4ZYS A;  3DEO A;  3PV0 A;  3HGB A;  4RHR A;  4CKC A;  5FO8 B;  1RCV D;  4X3S A;  1HCZ A;  3HOU B;  5K36 G;  2JA6 B;  3OOC A;  3QB3 A;  2F0E A;  3S15 B;  4K8I A;  2B2Y C;  1GXD C;  1C48 A;  1KNE A;  2X6L A;  3VR2 A;  1IHZ A;  4A3G B;  1PLF A;  5C6A A;  3PUV A;  2MPM A;  3C2P A;  1QE6 A;  5M5X B;  4IZ8 A;  2H1E A;  5DM7 3;  2B2V C;  1A3V A;  1WVL A;  2JE6 I;  1R9T B;  1EOT A;  3CKI B;  3S1M B;  1I4Q A;  1EIG A;  1I4G A;  4G7O C;  2PMZ B;  1XXG A;  3TP6 A;  3HOZ B;  1QOH A;  2B39 A;  4A3K B;  3NSW A;  2Z1C A;  3I4M B;  1F9R A;  2M2L A;  3GD7 A;  3CRL C;  3EVQ A;  3S1Q B;  1JOK A;  4H0L C;  1IW7 D;  1SE2 A;  1BF4 A;  3W3A A;  1TS4 A;  3HG9 A;  2B2W A;  4NKL A;  2B2U C;  5ELC A;  5IT9 E;  3PMF A;  1TWG B;  4R8I A;  1WTP A;  2F3V A;  1AN8 A;  2A6H C;  1CHQ D;  4MN3 A;  4KJO A;  2F0U A;  1A3U A;  1SYB A;  1STN A;  1EY6 A;  2FHT A;  4A3F B;  2EZV A;  4XYO A;  4HCS A;  1K8O A;  2A68 C;  3VA5 A;  3KLR A;  1J8I A;  4FYD A;  3OHX C;  3LWU A;  4J1M A;  3MEH A;  3A8K E;  3BYT B;  4QIW B;  3TDQ A;  4CKB A;  4KN7 C;  4BWG B;  1S4Z A;  1PRT C;  3TP7 A;  1R4P B;  4PMB A;  4QUF A;  3J81 E;  3SXH A;  1V1O A;  2NBF A;  3DWP A;  1SJE D;  2Z8L A;  2JA7 B;  5JVG 3;  1CM9 A;  1SSO A;  3RMH A;  2Q8I B;  1OXV A;  2OXP A;  1B9N A;  2PCF B;  3E6Z X;  1TY0 A;  3MTS A;  1I4P A;  3J80 E;  4K2L A;  1SND A;  1HTL D;  1X3Q A;  3IFD A;  3NQI A;  5I6Y A;  4X3U A;  4KN4 C;  1B44 D;  1STB A;  4RCN A;  5JPN C;  5T1I A;  3GTP B;  1Y1W B;  1PTO H;  1A6X A;  3BVZ A;  1EL0 A;  1PTO C;  3SK5 A;  1NUC A;  1ZXT A;  2K05 A;  1QJO A;  3NWS A;  1WTR A;  1IL8 A;  1KAB A;  5EGT A;  5IOC A;  3K7A B;  3ITP A;  3H0G B;  1M8A A;  2BCO A;  1NR4 A;  4FF2 A;  3QIA A;  4ID6 A;  1B9M A;  2CW0 C;  5JEA J;  1CQF A;  4HMI A;  1E2Z A;  4XIG S;  1M4V A;  3I90 A;  3O13 A;  3ND8 A;  1PZI D;  4CBV A;  1SNQ A;  1IYU A;  1FYC A;  2RSN A;  2RSO A;  5CV8 A;  5IGC A;  1NR2 A;  1QB5 D;  1EY4 A;  3DWA A;  3HRZ C;  3ERO A;  3U9O A;  4Z9C B;  5EQ0 A;  3OSO A;  1SMY C;  5HUR A;  1CI3 M;  3MVV A;  3J7A F;  1ENF A;  5DAU A;  3D4R A;  1OXX K;  4DK1 A;  1EEF D;  5IIF A;  3SEB A;  3D31 A;  4F8M A;  1PXU A;  2C5C A;  5LL6 X;  5ISR A;  4OHJ A;  1DM0 B;  1B53 A;  4DU9 A;  3NPP A;  3DMU A;  1L0Y B;  1ENC A;  3BVG A;  4HAE A;  2QKI C;  3K6O A;  3M7N A;  4K6D A;  1TS5 A;  2JP1 A;  3KBX A;  4XDX A;  2DY8 A;  2Q8T A;  1DJR D;  1GOZ A;  1JC7 A;  4QB4 A;  1E2V A;  4K5W A;  2XVS A;  2DNC A;  3TP8 A;  4A3B B;  4A3J B;  2V4D A;  1BO0 A;  5IT9 L;  4KKT A;  4IUN A;  1E0B A;  1VDZ A;  4YIJ A;  4RKB A;  2JA5 B;  2I46 A;  1NAP A;  2QDB A;  4ZRZ A;  2XWB B;  1STH A;  4WOR A;  5EPL A;  1H9M A;  1B3A A;  2EYJ A;  2DNE A;  1FNV A;  1SYG A;  1MSG A;  4V19 0;  1MGS A;  2NN6 G;  3A8I E;  1DZ1 A;  5KYI A;  3EA6 A;  4J6H A;  3MA2 B;  4P2C B;  1T5X D;  1SYF A;  4IUP A;  2SNM A;  4X3T A;  2PZW A;  2HDM A;  1KTK A;  3MWY W;  1LTT D;  1F2M A;  1HXY D;  4FO2 A;  3A55 A;  4MHE A;  1G29 1;  1WCM B;  1EQT A;  2DN8 A;  1KDA A;  4FNF A;  1LO5 D;  4MIU A;  4M1U B;  1X32 A;  4DNR B;  2NWG A;  2DY7 A;  3TME A;  2JYO A;  1CQV A;  3IAY A;  1HQR D;  1EU4 A;  3DM1 A;  1TVX A;  3MXU A;  3A54 A;  2GA4 B;  3I72 A;  3TZU A;  2G9H D;  3TN2 A;  4X3K A;  1QNK A;  2Q8R E;  1B2T A;  4B9W A;  3GTJ B;  2WB1 B;  3LNN A;  2PYK A;  3GTO B;  3EJI A;  2IX3 A;  3BYY B;  3SE0 A;  1I4X A;  5IGF A;  5DEH A;  2EYF A;  5LHY 1;  1KLU D;  5CV6 A;  1Q8I A;  2SDF A;  5ELF A;  2AUJ D;  5C44 B;  4J8Q A;  1TWH B;  2G9D A;  2JSO A;  2EY5 A;  1K8M A;  3S2H B;  3NQT A;  4DAY A;  4FF4 A;  1ET6 A;  1FD7 D;  3T51 B;  5JJZ A;  2IJ0 A;  5C0X J;  1I4R A;  2A69 D;  1K83 B;  2TMP A;  1I6V C;  5D3I B;  4HCE A;  4IFD G;  5IGG A;  3IKJ A;  2KEE A;  4JK1 C;  4V0B A;  4KMU C;  4UDU C;  4RKL A;  1Q90 A;  5EPJ A;  2L4N A;  1CT1 D;  2CQA A;  5F2D A;  3H91 A;  1EY9 A;  1WTW A;  1PFM A;  3NTI A;  3WOF A;  2EPB A;  3VYT A;  4F88 A;  1F9S A;  1SYC A;  1OXT A;  2ID0 A;  2EJG C;  4DK0 A;  2SOB A;  1LT3 D;  5NUC A;  3VR3 A;  4L6T B;  1AZQ A;  3SK4 A;  4RCO A;  5EJW A;  5ELB A;  1PRT B;  1CFM A;  2FMM A;  3M7G A;  1VMP A;  4DAV A;  1ILP A;  1SFO B;  3C1F A;  1VMC A;  1TY2 A;  2RDH A;  1TU2 B;  1EFI D;  4I7Z C;  3NE5 B;  1HTP A;  2D5D A;  5KIX A;  1HRJ A;  2KCC A;  1PYW D;  1PFB A;  4KY7 A;  5KNB A;  1CA6 A;  2NTS A;  2NVQ B;  3VR4 A;  5EKI A;  3MZ5 A;  4QF4 A;  3PUW A;  1UEA B;  1O80 A;  2QF7 A;  4HTH A;  2EYP A;  1XWE A;  2KQ3 A;  5J39 A;  1QCB D;  4NP5 A;  1JWS D;  1EY7 A;  2B8F A;  4HN7 A;  3G7L A;  1STY A;  5EKL A;  2L0C A;  2PO4 A;  2PNR C;  1UUP A;  2Y0S B;  1I4H A;  4PMC A;  3G6J B;  4XXE A;  2L11 A;  4G4K A;  2KVM A;  1LTG D;  4OO1 G;  2FJ2 A;  2WAC A;  3DWQ A;  4XYQ A;  2B2T C;  3H6M A;  1CK1 A;  4NDX A;  4ULL A;  5D65 A;  4K8J A;  4KD4 A;  2F0M A;  2F0K A;  1EZ6 A;  1D6E C;  5LL6 S;  5C4Z A;  2A6H D;  4FXD A;  2XRS D;  1I3Q B;  5CGK A;  2HQE A;  1BCP B;  1W6K A;  3JAM E;  3PUZ A;  5G3L D;  1ZYR D;  2IW3 A;  1Z7T A;  2WKD A;  2RKS A;  5D3D A;  4C56 C;  2X6G A;  3AB9 A;  3SK8 A;  4EVO A;  2LY7 A;  5ELD A;  2F03 A;  2RVL A;  3VA7 A;  4ZAI A;  1PRT D;  3M3Y B;  1Q1B A;  4OGQ C;  3EQL C;  2KEC A;  3LX0 A;  2F0O A;  1DOM A;  2WAQ B;  4C3H G;  2EYL A;  4ZKC B;  2MHV A;  5IGE A;  4AYB B;  1FGB D;  4RHS A;  2MJ8 A;  1ESR A;  3NTK A;  2KED A;  1YNN D;  2NTT A;  4BS9 A;  1RJT A;  4IUU A;  2RQX A;  4KY6 A;  1D1I A;  5JEA H;  3OIP A;  3HOY B;  1II3 A;  1EYC A;  4PQX A;  4IAL A;  5K5P A;  4C2M B;  3ONA B;  3R2T A;  1DON A;  2XNA C;  2A6E C;  1HPC A;  1T5E A;  1TS3 A;  2Z4I A;  1JOR A;  1E2W A;  3MXP A;  4U67 3;  3GV3 A;  4RA8 A;  4CJ0 B;  1C4Q A;  1IW7 C;  1ML0 D;  1U4P A;  2A5H A;  2EYO A;  1G6Z A;  2E2D C;  2Z4H A;  2CW0 D;  3I3C A;  1STA A;  3OWF A;  3RUZ A;  4EGV A;  1TWF B;  3BG3 A;  2K33 A;  3NP8 A;  2PW7 A;  3I73 A;  3T53 B;  4RH6 A;  5A2Q L;  3MHB A;  4DXG A;  1WD0 A;  2R93 B;  2PQE A;  1Q12 A;  4BY7 B;  1BCP D;  1AP0 A;  3S9W A;  1JOQ A;  1KAA A;  2O4X A;  1CTM A;  1TWA B;  3C46 A;  1D2B A;  5CYU A;  2BOS A;  1KDC A;  1FNU A;  1RTN A;  4N9T A;  1BUV T;  1O78 A;  2KHS A;  3PUX A;  4K5X A;  5FO7 B;  1LV9 A;  3NWT A;  4CJ1 B;  3T4A C;  4XT1 B;  2EYM A;  2CVR A;  2R7Z B;  2J4X A;  1DD2 A;  3T56 B;  4JBW A;  2QIL A;  5FKA C;  1GUS A;  4QMG A;  5CR3 A;  5IGD A;  3MFY A;  1ENA A;  2HUG A;  4Q5V A;  2EDG A;  3P1H A;  3TSS A;  4C3H B;  3JAM L;  3GQB A;  3S16 B;  4IN3 A;  3I8Z A;  2NZ1 D;  1O7Z A;  3FKI B;  3CU7 A;  2EJM A;  1XTC D;  1D5M C;  2NYZ D;  4L8J A;  1STG A;  1JR0 D;  3RLF A;  3A56 A;  3KLS A;  1QG7 A;  4PNY A;  3RZD B;  2AQ3 B;  2AWN A;  3GP7 A;  3D6W A;  1GJX A;  4K5V A;  4ZLT F;  1SBB B;  3FPU B;  4OL7 A;  5CC4 A;  2B2W C;  4A93 B;  1WTQ A;  2K5W A;  1U4L A;  4Y7N B;  4HMJ A;  3R8B A;  2EXZ A;  5EBD A;  3DUZ A;  2A74 C;  3EFX D;  2FMC A;  3GV6 A;  4FVM A;  1TQO A;  5C3W A;  1CA5 A;  2ZXO A;  1FNW A;  2AQ2 B;  4DNT B;  3AMU A;  4FXK C;  5KNC A;  4RGM A;  3SR1 A;  2F0V A;  3QG1 A;  2YU9 B;  2L1B A;  4KY5 A;  2ZXP A;  4KKU A;  2XRQ D;  2MGS A;  2EYH A;  5COY A;  1BXT A;  5C0X I;  5FOB B;  2ZXR A;  1WTX A;  2MUY A;  1MSH A;  3K5N A;  4QCL A;  1LTS D;  2F0L A;  5M5W B;  3NHH A;  1EY8 A;  4KD3 A;  2BDO A;  5CMD A;  1U4R A;  5KGU A;  3BS1 A;  2N55 A;  1WTO A;  5C0X H;  4QUC A;  2PZT A;  3K5L A;  3K57 A;  3I70 A;  5IGB A;  4CHT B;  3H09 A;  3C3L A;  3RZO B;  1SNO A;  3URY A;  3V05 A;  1GUG A;  4XTC S;  4H13 C;  4TQU S;  4IFD J;  5C3X A;  2MP1 A;  1PZK D;  5E4X A;  5BN5 A;  1SNP A;  1YNJ D;  1HHV A;  3I4L A;  2JEA I;  5ELE A;  3L7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...