4J1MA

Crystal structure of staphylococcal nuclease variant delta+phs r105e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVEQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS R105E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4j1mA00
5M9OA 3MXPA 4KHVA 2SNSA 2F0WA 2EYPA 1TR5A 3ITPA 4EQPA 5KYIA 3SK6A 1SYCA 4KD3A 5C5MA 2NUCA 2F0DA 2F0LA 4KV6A 4TRDA 2F0TA 2F0KA 3TP8A 2EXZA 5NUCA 2F0GA 3QB3A 4K5WA 4OL7A 2PZWA 4RKLA 5EKLA 4IUNA 4ZQ3A 1KABA 3OMGA 1AEXA 4NKLA 1NSNS 4QB4A 5KIXA 2WACA 4E6IA 4H7BA 4YIJA 4R8NA 2PYKA 1A2TA 2SNMA 5J22A 2EY5A 3U9OA 1EY4A 3OWFA 5F2DA 2KQ3A 3SK5A 2LKVA 4HMIA 5CV6A 2F3WA 3H6MA 5HURA 3RUZA 2OXPA 1EY8A 4WRDA 3MZ5A 4DF7A 5C3XA 5C6AA 3S9WA 1EY9A 2F3VA 3ERQA 5IGGA 1SYBA 2F0NA 3SK8A 5DAUA 3R3OA 2RDFA 4G57A 2F0IA 1RKNA 4EQNA 1EQVA 3NUCA 4KD4A 2F0FA 3D4WA 5IGDA 3DHQA 1JOQA 5KRUA 1NUCA 3HZXA 4HMJA 1IHZA 1JOOA 1STNA 1SYGA 1SYDA 2F0JA 1SYFA 3EROA 4KY5A 3VA5A 4DGZA 1A3UA 5KGUA 3T16A 2F0PA 1EY6A 3D6CA 4NMZA 1SNQA 3TP6A 1ENCA 2QDBA 3C1EA 3D4DA 3MEHA 4HTHA 4ME5A 4N9TA 5CV4A 4KJNA 1SNPA 2EYFA 1U9RA 2EY6A 4NDXA 5I6WA 1ENAA 5EKKA 3QOJA 2EY1A 2F0MA 3C1FA 3LX0A 1EYCA 4QF4A 2EYJA 2RBMA 4RKBA 5DEHA 4F8MA 3T13A 1A3VA 4K8IA 2F0UA 5EGTA 5IGCA 2F0VA 4ODGA 5KEEA 4IZ8A 3SK4A 5J1ZA 4N9PA 1EY5A 4I65A 2M00A 1EY0A 2EYOA 4KY6A 5IGEA 5IGFA 3TP5A 1STAA 1KDCA 5IODA 3NQTA 3NXWA 3P1HA 2EYMA 3OSOA 1SNMA 3V2TA 3NK9A 4EQOA 5JAVA 5CC4A 4K5XA 4K6DA 2EYLA 2KHSA 4KY7A 3OMCA 3P75A 4WORA 4DFAA 5CV8A 4J1MA 3E5SA 2O4XA 1KDBA 5KYLA 2F0QA 4PNYA 1TT2A 1KAAA 4K2LA 2F0SA 5CGKA 2RKSA 2OF1A 1KDAA 1JOKA 3EVQA 1EY7A 1STYA 3DMUA 4K5VA 3MVVA 3D8GA 4KJOA 5IOCA 4KTAA 3EJIA 1F2YA 1SNCA 2EY2A 4NP5A 1SNOA 4PMBA 5C4ZA 2EYHA 1F2ZA 1STBA 4LAAA 3SHLA 3SXHA 1SYEA 4S3SA 4B9XA 1EZ6A 4IALA 1F2MA 4B9WA 5ISRA 2F0OA 2F0EA 3MHBA 2PW5A 4QMGA 4K14A 4ZUIA 5I9PA 1EYDA 5CV5A 5J39A 3TP7A 4DU9A 4ID6A 5C3WA 2PZUA 5CV7A 2OEOA 5E3FA 5C4HA 2ENBA 5I9OA 4K8JA 3HEJA 5HGTA 5C5LA 1EYAA 3SR1A 2PQEA 3NHHA 4K2KA 1A3TA 4PMCA 5I6YA 4J6HA 5K5PA 3QOLA 5CR3A 1II3A 5IGBA 1TQOA 2PW7A 3TMEA 5IIFA 2HQEA 3BDLA 2PZTA 4F7XA 5E1FA 1A2UA 1EZ8A 4EVOA 1STGA 4ZUJA 2SOBA 3NP8A 1STHA 2F0HA 3BDCA 1JORA 4MIUA 5CV9A 3PMFA 1SNDA 5JOBA
chains in the Genus database with same CATH superfamily
5M9OA 1EQRA 4IPHA 4JV5L 1O78A 4LFAQ 2NUCA 4MNOA 1NMFA 1G291 1QILA 3G6JB 2JA6H 4WJ4A 2PZWA 2NYZD 1LTRD 5C4XH 5FLXc 1HNWQ 4XDXA 1MIUA 3VR6A 1A2TA 1PRTB 3K5OA 3VR4A 1EY4A 3ULLA 4DXFA 2KQ3A 3SK5A 2LKVA 1FJGL 1N8RC 1EY8A 3H0GH 4OGQC 2Y0SG 1DCZA 1GO3E 3IL8A 1D8LA 3I4OA 1KNAA 3DHQA 3KF8A 3R2TA 4KI0A 1S3OA 4BBRH 4HSVA 1U5KA 2CWAA 5DLQE 5IWAL 1CHPD 4NXML 4RGTA 1G6ZA 1D1KA 5C0XJ 2KECA 3IAYA 1I3QH 3W1BA 5M3MH 1EOTA 4K8IA 5C4JH 5T1IA 1D2BA 1JJGA 4X3TA 4B3MQ 2AQ2B 2N55A 2N3SA 1K83H 2AHOB 2EYMA 3OSOA 4L5SA 2BCOA 5CC4A 1YI2A 4KY7A 1K8GA 3I2ZA 4DR3Q 5IYDG 3PCOB 3NBHB 3BS1A 3GTOB 1HA5A 3CMAA 2UXCL 2F0SA 3EVQA 3PUXA 2FMMA 4OO1H 4HIDA 1F2ZA 4JI3L 1BBWA 1CQVA 4OEMB 4LFBQ 3RZOB 1PDQA 5L37A 4A3CH 1QVGA 2ZXRA 3CCEA 5C4HA 5E3FA 1HNXL 3I3CA 4C1NK 4DAYA 4JYAL 3FVQA 4BS9A 3FHWA 1XMOL 3GTGH 1PH1A 2MNAA 2IT1A 3U58A 1TWCB 5EKIA 3TMEA 2B2UA 1SBBB 1GOZA 3S17B 2JYOA 4LF8L 1XYIA 3HOXB 5KYIA 3I91A 1LUZA 3P7JA 1MD2D 2B2TC 2F0TA 5GQOA 4DV1L 3TP8A 4GOPB 4RKLA 4CDFC 4BY7G 1R9TH 3KK7A 3DLLA 1MBYA 1NSNS 3F2BA 4QCLA 4RCNA 1ESFA 2RA4A 5JEAG 4A3JB 3VYSA 5E4XA 1XJVA 2KCNA 3BVZA 1RL2A 1RF2D 4APVA 1X6OA 1KL9A 3KJOA 3NBIA 3S2HB 4JBJA 2Q2UA 5EQ0A 3BZCA 3KDFB 1G8ZD 1EIFA 2TMPA 1Q90A 3STBC 1PMRA 1BCPF 1B70B 3M9BA 2HT1A 3KJPA 2QEXA 1S5CD 1CQFA 1OXVA 4IFDI 1HTLD 4LJZC 5TSSA 3I4NB 1CZGA 2CFMA 1BCPC 4K6LA 3CXCA 1V8QA 4FXGC 1EWCA 2L15A 1D5XC 2UUBQ 5CYUA 2DNEA 3PO2H 1FVIA 2A19A 5K36G 4KY6A 5IGEA 1VQ5A 1HZAA 3I72A 4QL5A 2FINB 5ELDA 2R93H 3T1YL 1K3RA 2NVYH 3OMCA 3D6WA 4J1MA 4QUFA 2R92G 2VS1A 3CRKC 5FKAC 3J7AV 4A3GB 5IP9G 1ONLA 3PO3H 1C9OA 1STYA 3DMUA 3NQIA 4KJOA 5KNCA 1IKMA 1SNCA 1TIID 4A3BG 4S3SA 1EZ6A 1GUOA 1ICWA 2L5TA 1EYDA 2N78A 4PZ7A 1PV4A 1EYGA 1PTOF 5CV7A 4AH6A 2I5LX 2PMZB 3M7GA 1W6KA 2ENBA 4K8JA 5EBCA 3TS2A 2NVQH 1SMYD 2VUMB 2XIWA 3TZDA 5IIFA 3I7FA 3LNNA 5LMUL 1EEFD 2A6ED 4Q0FA 1PH8A 4A3DH 2VQFQ 1E22A 4JBMA 2LXJA 4A76A 1TS4A 4KHVA 4JI7Q 2SNSA 3VDYA 4DR7Q 5M5YH 3K57A 5C5MA 3EIVA 1C8CA 2E2DC 1XX8A 2B39A 1V1QA 1FD7D 3PUYA 4AYBG 3E3XA 2E2IH 3UDIA 1R4PB 1KABA 4NKLA 1I4RA 4HN7A 4YCUA 4H7BA 4NPSA 4DNRB 3VA7A 4IJLA 1I94Q 2R7ZG 3L3OC 2PNHA 1E7ZA 1TU2B 2F52A 2UUCQ 3J7A5 2XNAC 2OTLA 1VQMA 3DEOA 1B50A 5DAUA 4B3TQ 3BJUA 2DY8A 1GUNA 2BA1A 3OPOA 2PCFB 3UI2A 3RMHA 4LFAL 2CQOA 5ELBA 2NVTB 3GTLH 4FF3A 2B3GA 2MJ8A 3M4YA 4B3SQ 4H13C 1HNWL 1GHJA 3MEHA 2JA8H 3GTMB 3H09A 4U68A 5J22A 4KJNA 2EY6A 3S1RH 2YTVA 4XIGS 3C1FA 4BXXG 4QF4A 2AMCB 2KEEA 4DR5L 2JJQA 3D4RA 1VQAA 2O5IC 4A93B 2F0VA 1SEBD 4BY1G 1PH3A 3RZDH 3A74A 2GN5A 2B2WA 1SNMA 4QGUA 3CC4A 5C44H 2JXMB 4GKKQ 2AUJD 3KF8B 4ALPA 1VQFA 3RLNA 4TKOB 4JBWA 4C3HB 1MJEA 1EFWA 1B8AA 1NR2A 2OF1A 5EBDA 3T53B 4UY8C 5IP9H 3S15B 1RTNA 1GUSA 2X6GA 2J4XA 3GQBA 1QCBD 5BN3A 3DWAA 4Q5VA 2MP1A 5I2YA 1SRUA 1QVFA 5I9PA 1TY2A 3S2DH 1AZPA 5FLMG 4CDEC 5C0XH 5JJZA 5ELCA 4B3ML 3HEJA 4XQQA 4UP9A 2E75C 1VQHA 3NHHA 4PMCA 2QDLA 2EXDA 4DK1A 2PZTA 4DR3L 3GTQB 3SK6A 3HG9A 1BDOA 2N88A 1TR5A 4KLKA 3NPPA 4HR7B 1HR0Q 4C2MB 2A73B 2F0DA 2K5DA 4LFBL 3GTPB 4JI8Q 3I70A 4IUNA 1LV9A 1N36Q 2BDNA 1DGSA 1SJED 2KEDA 4WRDA 1QZGA 3MA2B 3PIO3 1GXDC 3M4OB 1VMPA 2ZT9C 3A8JE 2MHVA 3GTOH 2WB1E 3GP7A 3WDNA 5J3BA 1DOMA 1KQSA 1CSPA 3BVGA 4HTHA 3R93A 5CV4A 4NDXA 1JWSD 2K04A 4KN4C 3HOUB 5D3IB 4C3IG 1EL0A 1B3AA 1NNXA 1VF5C 1E1OA 3KFUA 4L5QA 5EGTA 4GOPC 2A8VA 4DV0Q 2KCTA 4A3FG 1LLRD 1OO9B 1SMYC 2BE5D 1VS0A 1GM5A 2P5ZX 2PQAB 2ASBA 1WTOA 1D7QA 4MZ9A 2A6EC 1TWCH 2K1BA 4ME3A 1ASYA 2K01A 2AKWB 3Q22A 3S17H 1AFPA 2KCCA 2VXWA 1L1OB 2N49A 3HOXH 2RSOA 1EY7A 1QOHA 5IYCG 1YITA 2EY2A 2QILA 1MHWC 1YNND 3HOWG 5T1GA 1A62A 2UUBL 2V4DA 2DJFC 1TKWB 2HDLA 4HIOA 3PIP3 1QZHA 3S16B 2DJGC 4R4IA 1BBXC 4J6HA 4IO9A 1II3A 4DNTB 4HJ5A 4LK1C 3S2HH 1I4XA 2SOBA 3NP8A 1STHA 3BDCA 4KHZA 5FOBB 3AU7A 1CT1D 2K5NA 3CPWA 4DV1Q 4LF7L 4BBSG 1H9MA 2CW0D 2LS01 1C4QA 5LHY1 1I4PA 1Y14B 3I55A 1EWHA 1I50B 1VQJA 2Y0SB 3SE0A 1VQGA 1HJPA 3URYA 1QWYA 4QB4A 4QY7A 4R8NA 4XT1B 1BNZA 3PV0A 1CK1A 5HURA 3H6MA 3CQZH 1P8LA 5I2XA 1KLGD 3MZ5A 1IBLQ 3J81E 2MFIA 3S9WA 1EY9A 1Q86C 2JA6G 2C5CA 2UU9Q 1PXUA 4M1UB 3S14H 1PZKD 2LMCB 1RKNA 4JI7L 2K05A 4DR7L 4H0LC 3Q8DA 4A3GH 5IY0A 2ZM6Q 3MXUA 3PF4A 4RGMA 1IHZA 1JOOA 1STNA 1SYGA 3EROA 4AIMA 3G7LA 5FJ8H 1IYJB 3FKIG 4FP5D 3H0GG 4C56C 4GLXA 2B2VC 1I94L 1PZID 4JI2Q 1UE5A 1B2TA 5JPMC 2Q8RE 2B29A 1VQNA 3DWQA 4IZ8A 3MFGA 1LT3D 4BA1I 1K9MC 4BBRG 3TP5A 1HR0W 4B3TL 1MKHA 1QNKA 1K8MA 2AUKA 1RIPA 4QUCA 4CDCC 5JAVA 4EX5A 1PH4A 3NENA 2KHSA 2MQHA 3A56A 5CV8A 3WWVA 2NZOA 3UDGA 1UEBA 2R7DA 3DXJC 4B3SL 1X32A 4R4TA 4V0BA 3QIAA 4I7ZC 3J7ZC 4IOAA 1X54A 3ONAB 2D0PA 2H5XA 3D31A 4LAAA 1JB3A 4WJWA 1SLJA 1F2MA 1CFMA 2KUMA 3E0EA 2XGTA 2H1EA 4FF1A 3A7LA 3PF5A 2XRSD 4U673 5AJ3Q 1K28A 4R4QA 5H1SE 3FPUB 5FO9B 1NR4A 2X6LA 1KTKA 4OX9Q 2IX3A 1LO5D 4JG2A 4GKKL 3BVMA 4O1NA 1Z6HA 2PW7A 1I6VC 3EQLC 4OO1G 1PTOB 1T5XD 2XN9C 1EZ8A 5M5XB 2SDFA 1LTAD 4YY3Q 3E9IA 5M5WB 4A3CG 1J5EQ 3TEHB 3IKJA 1BKBA 2DN8A 4OWXB 4DAMA 1NAPA 2R7FA 1FNWA 1XMQQ 5NUCA 3GTJH 1DOLA 1QUQA 1E2WA 2YTXA 1AEXA 1JWMD 1VQKA 2K5WA 1FL0A 1H9SA 3G4SA 4C3JB 1WTRA 2E2JH 5C3EH 5ELNA 4R9WA 3RR5A 4DV3Q 1I6HH 1O7ZA 2ZJPA 3HOZB 2B2VA 2QA4A 1BO0A 1IL2A 2BA0A 3SK8A 3S24A 1VQ4A 2BH2A 2DY7A 2HIVA 5IT9c 2CKZB 1LTLA 1HR0L 4RMFA 4C3HH 2NN6H 5M3FG 4G7HC 1NUCA 2L1BA 1UNSA 4JI8L 1Y1WB 1JJ2A 2ZTDA 2A68D 1CKNA 3D4DA 4RHSA 5I6WA 1YNNC 4X65Q 1ENAA 1QNUA 2Z6KC 4QJFA 2F0MA 4DR5Q 3K58A 3MFYA 1JMCA 3FKIH 1L0YB 1N36L 1JR0D 3AYHB 3AMUA 3KLWA 1VF7A 3F1ZA 1DM0B 4N9PA 2EYOA 3R2IA 1V1PB 1W6JA 2F4IA 3TZUA 4A3IB 4ZRZA 1N34Q 3C46A 3CAMA 1LT6D 1RDPD 2CW0C 2YV5A 3L7ZC 2WB1G 4C2MH 4KTAA 4DUZQ 3PO2G 4RA8A 1N9WA 2FXQA 2K52A 1R4QB 4UDUC 3SHLA 1ZKOA 2Q2IA 3A8IE 3I4MB 1F9SA 3OIQA 4DV0L 2R93G 3D3RA 1NBWA 2K03A 4ID6A 1JICA 4BA2I 2Z4HA 1VQBA 2EPBA 3UE0A 5IYBG 4DA2A 4HCSA 1AN8A 3PO3G 1AH9A 3ULPA 3DEPA 4F7XA 1VQ8A 3PUWA 3I56A 3T56B 4DV4Q 3M4OH 1E2ZA 1GHKA 2Q8TA 3C3LA 1SN8A 2K5QA 4MIUA 3PMFA 1SNDA 3A0JA 4E6IA 1HFNA 2LSSA 1D5MC 2XRQD 2JA7B 3EA6A 2F0KA 1TS5A 4DV5Q 2F1MA 1TY0A 1I4GA 1L1OC 1OXXK 1IBKQ 3NSWA 1EIHA 2D5DA 3Q24A 4DR2Q 5BR8L 4A3DG 1PRTD 5COYA 1N33Q 4GS3A 4QIWB 2F3VA 1GUTA 1ZEQX 5GAHC 1SE4A 4ZLTF 2YU9B 1RD9D 2IW3A 1XWEA 4KD4A 4AQYQ 1JORA 2PO4A 1XTDA 3RLFA 3G6EA 4BY1B 5M3FH 1YHQA 1DONA 3CC7A 1TWFH 2EYJA 2G5DA 1PYBA 2RBMA 3E6ZX 4RWSC 4DPGA 1XNRQ 3BYYB 3H91A 5IGCA 4GNXB 4X6AH 1IBLL 1BR9A 1NJIC 3S16H 3S1MB 2KA7A 4GLAC 1FR3A 2UU9L 3KF6B 4FF2A 1S72A 5LL6X 2JA8G 2RDGA 4K6DA 2ZM6L 4QQBX 3E5SA 1G6PA 1TT2A 3K8AA 2BDOA 1H9RA 4FXKC 1GVPA 2A1AA 1IYVA 1VQPA 4XTCS 3HOVB 3D8GA 1M8AA 1SFOB 5C4ZA 4JOIC 4JI2L 1I50H 1CTMA 4IALA 3ND8A 4IPGA 2ZXOA 4IUQA 3TRZA 1BF4A 3TP7A 5C44G 4P2CB 2CVRA 4KKSA 4FVMA 1U4LA 3J80E 2JA5G 4GN5A 5JVH3 2CWPA 4J15A 2RVLA 1FGUA 1EWIA 2WV6D 4ZCKA 1A15A 1SDFA 1WFQA 3CC2A 5CR3A 1TQOA 1ILQA 5IYBH 3L2PA 4LUVA 1YNJC 2F0HA 5E4WC 4PNYA 2AWNA 5ELOA 1U0LA 1Y1VB 2CH4W 2OT2A 4LF7Q 2QKIC 2FFKB 1EEID 5C0XG 2A68C 1IXRA 3QWNA 2EE1A 4A3MB 4FNFA 2B2TA 5AJ3L 4B08A 2WACA 1VQ7A 2L9HA 4JBKA 3K5LA 3S1NB 1B53A 5F2DA 4OX9L 3NTIA 4L5TA 4OO1I 4G4KA 4YCVA 1D5ZC 4YY3L 2BH8A 1SYBA 2YTYA 1QJOA 3JAME 4G57A 1J5EL 3J81L 3M4QA 1Q82C 4O0AA 3GTKB 2A74C 4X64Q 3O13A 1XMQL 5KGUA 3J81i 4NMZA 4V190 4JC0A 1MJCA 4N9TA 4B3RQ 1K8AC 1V9PA 5DM73 1XNQQ 1A6XA 1Y8NB 4H44C 4DV3L 1IZ6A 4LNQA 2WAQB 1MGSA 2ZJQA 4R1JA 2NVXB 5EJWA 3S1QB 4DR4Q 2MPMA 4GLVB 4JK1C 2B63B 5IGFA 5D3DA 4DN4M 3V2TA 1UE6A 4JI1Q 3M4PA 3CCSA 2Z8LA 3N52A 1CKMA 5M5XH 1S5BD 4ZK9B 2Q2HA 4ZKBB 3K7AH 3TREA 4OHJA 5M5WH 2EIFA 3NE5B 1JC7A 3ULJA 4A3KB 4X65L 2KVMA 1SNOA 2HCIA 4JI4Q 2NWGA 5ISRA 1AW7A 1PFBA 2UUAQ 1HTPA 4RFBA 5FK9C 5BN5A 3CF5A 4C3JH 3L9AX 1LTBD 5C3WA 1ZYRC 1PH6A 3HOYB 2HIXA 1PRTC 1PH5A 4Y52H 1AE3A 1SE8A 1Q3LA 2E2HH 1ESRA 2I0QA 1Q81C 2RQXA 3ZYYX 1HZCA 2HUGA 3HOXG 2JA5H 4BBSB 1N34L 3K59A 2C35B 5CV9A 3JC66 4DUZL 1HRJA 1V43A 1Q1BA 2K32A 4L8JA 1Y1WH 2JP1A 3KBXA 2IHEA 1Z47A 3QB3A 3TQYA 1KRSA 4A3EB 3MXNA 3OTOL 3OMGA 4POGA 2A69D 4N8X1 4YIJA 2Q2TA 3NWSA 2HCCA 5E7NA 5C4XB 1JWUD 4OWWB 1Y8PB 4IN3A 2E8GA 3MC0B 5A2QL 4PZ8A 1V1OA 4POFA 3N6RA 1X3QA 2NZ1D 4DKAC 4DV4L 5D65A 3A8KE 4A3IH 4DV2Q 3EN2A 1NE3A 2D9UA 1RTOA 3CP0A 3I4NG 2F0FA 3BYTB 3HZXA 4DV5L 3VA5A 2F0JA 3I8ZA 4X3SA 1EY6A 4DR1Q 4DAYB 2Z1CA 2QDBA 3C1EA 3HKZB 1IBKL 4FF4A 5IGDA 1O80A 3HFZB 3QOJA 4JW0A 4NB3A 4DR2L 1WVLA 4NW2A 1KRTA 5LMNQ 1DXMA 4TVAB 1N33L 1LTSD 2CCZA 3UDFA 4KN7C 4IFDJ 5M3MB 1SAPA 4A3GG 1S40A 1VMCA 1D6EC 5C4JB 3U50C 3G71A 3CCQA 1STAA 1KDCA 5FJ8G 4KHPL 1M1KC 3NK9A 3QO2A 3SGIA 2WKCA 4AQYL 3RN5A 2CH4A 1K83B 2O4XA 3UE1A 4DK3C 4LMQD 1SROA 4J8QA 1J9OA 1SE2A 4XXEA 2Z0SA 4EQ5A 3MVVA 3CRLC 3RZOH 1QVCA 3OWEB 2K28A 2L11A 5GROA 1BQQT 2EYHA 1XNRL 4B9XA 2VUMG 1LACA 2L55A 3X3MA 3MTSA 1X3EA 2RHSB 3HRZC 2OEOA 4A75A 1T9HA 1B7YB 2J0TD 3HS0C 3OYYA 2MGSA 1LT4D 2I5HA 3TN2A 3GV3A 2O5JC 2K14A 3GTGB 2HQEA 3BDLA 2UXDQ 5A35A 4EVOA 1EIGA 2YU9H 1C0AA 2EZVA 4ZUJA 4ABNA 4K0KQ 3BG3A 5JOBA 1P16A 2XSCA 3MXPA 1WCMB 2KBNA 2V1CC 3TBIB 3CCJA 2F0GA 4CKEA 2ID0A 4EGVA 3M85A 2I07B 3CPFA 5CORA 1XPUA 2K5VA 4L6TB 4A3JH 2PPBC 1TWHB 5BR8Q 1R9TB 1DZ1A 2K50A 4HMIA 3RUZA 2QW7A 3S1MH 1IKLA 2E76C 5C6AA 5EPKA 2B2YC 3K6OA 1B9MA 3KLSA 1ML0D 3J7AF 1LYLA 4EQNA 5C0XI 2JEAI 2JE6I 4A3LH 1BOSA 2HDMA 1CSQA 5C3EG 3C2PA 1YJWA 3I4NH 4A93G 1ZXTA 1JB7A 1H9JA 4DGZA 1PYSB 3HOVH 1VQIA 3TP6A 1ENCA 1HUMA 1G2SA 4DUYQ 4XYOA 5KNBA 3I73A 3CCMA 1EYCA 4DV6Q 2EOTA 4GZYC 1A3VA 1FYCA 5JVG3 1XPOA 1SSOA 1L0WA 3SDZA 5KEEA 4G7ZC 1T5EA 4PV1C 4GOPA 4GN4B 2NN6G 5EPJA 3U4VA 4XT3B 4C3HG 3J81c 4DR6Q 3Q0AA 2WB1B 2VW9A 1VQOA 4UAIA 3L0OA 4JI6Q 2ATWA 1EU3A 4X64L 3P75A 2R93B 1O7IA 5JJKA 2K33A 3QJYA 2C9OA 1NY4A 2K7VA 4B3RL 1RODA 1XNQL 1HH2P 3TSSA 4Y7NB 3KDFA 4A3MH 1X3PA 3CU7A 1BCPB 1N32L 1SYEA 2A69C 1U4RA 3DUZA 4DV7Q 3CCVA 5DNFA 3MHBA 2YYZA 3TDQA 1PLFA 3VYTA 4DR4L 1HQMC 5CMDA 1E2VA 4ZKCB 2VUMH 3S1NH 1WOCA 1Z9FA 3FPPA 5HGTA 4JI1L 3J80L 3AQQA 1SMXA 2IJ0A 4LF6Q 1Y69U 5G3LD 1F2LA 2RF4A 3J80i 1TWAB 3GTKH 5LMNW 2R3ZA 4EQPA 2JA9A 1SYCA 4JI4L 4A3DB 1CUKA 2UUAL 3AFPA 2DUDA 5M5YB 1TWGB 5BN4A 2I46A 1YJNA 1JQYD 3OW2A 2E2IB 1XXGA 4X66Q 1VCIA 1PFMA 2NVXH 1HXYD 3K5NA 2XTIA 2B63H 4BY7B 1EQTA 1UEAB 2F0NA 1K0RA 4YWKA 2OWOA 2NVTH 2A5HA 1PVOA 2F0IA 3HOUG 3GTMH 2PNRC 3JAML 3LWEA 4KY5A 1SYFA 4A3KH 4JI5Q 3CD6A 2L0CA 3PIOA 5A2QE 2J7ZA 4A4IA 4IJHA 1MI2A 4ME5A 4A93H 5EKKA 3JAMi 5IE8A 3V05A 2GVAA 4HIMA 2OQKA 3S1RB 3H94A 4CHTB 3AEVA 5JEAJ 4I65A 2X69A 2F4VQ 4DV2L 1YNJD 5IODA 3NXWA 1WTPA 2QF7A 4LFCQ 3EBEA 4WORA 3HP3A 4IUTA 4PZ6A 1S5FD 2ZXPA 2HD3A 3S15H 5C44B 4DR1L 1WD1A 5IT9E 4K5VA 3M7NA 5EAYA 2QCPX 1J6QA 3Q6SA 4PMBA 3ND9A 4QIWE 4F87A 1JE5A 5LMNL 4A3EH 2R92B 1G51A 1IBMQ 5FLXE 4R8IA 1IW7C 1G91A 4H02A 4A3BB 5KNDA 3S2DB 4HJ7A 3GTQH 1S5DD 2HQLA 2AWOA 5CBAE 5I6YA 2B2UC 1KNEA 1HNZQ 2HHHQ 5E1FA 3VR3A 4IFDH 1LABA 1STGA 2QEJC 3F8TA 1WTXA 1PTOD 4YHHQ 3PIPA 3GTPH 2G9HD 1I4QA 2FMCA 3OTOQ 1VDZA 4ZQ3A 1RHPA 4TQUS 3F2CA 2PYKA 1YIJA 1K8OA 2EY5A 3OWFA 4IOCA 2ZTEA 1WTQA 1ENFA 3HKSA 4AYBB 2OXPA 3I4LA 1WD0A 2M9VA 2UXDL 2IPKD 5IP7G 3WOEA 4NXNQ 4UHVA 1CKOA 4K0KL 4HEDA 2RSNA 1X56A 1O7LA 2R7ZB 4O2DA 2QGQA 1DJRD 1STEA 4HAEA 5KRUA 1JJCB 1WYDA 1YEZA 1PFNA 4HSPA 4R4OA 5KIXA 3HOUH 3T16A 3D6CA 1KHIA 5I4DA 2CHBD 2EYFA 4WFN3 1ZYRD 3BU2A 4FDBA 3LX0A 4L63B 3A5ZB 2Z6KA 1F9PA 3ZJYC 1OXUA 3BDOA 3LGJA 1EUJA 4OONA 3KLSX 1VQLA 5G3LF 3ER0A 1EY0A 1RJTA 4KHPQ 2A6HD 4P75A 1UE7A 2IX0A 3R8BA 4FYDA 4EQOA 2PMZE 3OW7A 4K5XA 4MHEA 1Q8KA 3M3YB 1PZJD 2MO1A 3IFTA 1WCMH 2RKSA 2LFNA 1EU4A 2VB2X 3EFXD 4KKTA 4DUYL 1Q7YC 4NP5A 4ILWA 3RLOA 4DV6L 4UPAA 3W1GA 5ELEA 2PW5A 1OXSC 4K14A 1GKHA 3DM1A 4ZUIA 4CBVA 2NN6I 3BZDB 3CCRA 3K0XA 1XPRA 1TWHH 2PZUA 1LM0A 4DR6L 3CCUA 3K0YA 1SR3A 1CHQD 4CDDC 4JI6L 4RCOA 3QOLA 1SE3A 2L4NA 3OHXC 1I4HA 1Q8IA 1E3PA 2LXKA 4CGYB 1SXTA 3QG1A 2WAQE 2PI2E 2PQAA 4DNIA 4C3JG 1YHAA 1JT8A 4XYQA 4BWGB 2IL8A 2EYPA 3KUPA 2RCFA 4DV7L 3HOZG 3A55A 5EKLA 4KMUC 1O7YA 3H3VC 2FHTA 2E5LL 3T1HQ 1L1OA 2IHFA 3U4ZA 3J80c 1SJHD 3U9OA 3NWTA 2RCNA 2NB0A 4DF7A 4LF6L 1MSGA 4O42A 3P20A 1Y1WG 3H15A 4UP8A 1G2TA 2K75A 1UWVA 3CQZB 2JQOA 3R3OA 1HHVA 5IP7H 2Z4IA 1Y8OB 1HQRD 3CW2C 2Z6BA 3NUCA 3RD4A 1TVXA 1BUVT 1Q1EA 4JVZA 2IY5B 2OQ0A 2WINB 3K7UC 4L5RC 4P72A 5GAGC 3PQIA 2ZJRA 3S14B 3W5OA 4TSSA 3H3VH 3FRPB 4G7OC 1C7YA 2WKDA 4Y7NH 2AQ3B 1SNPA 4GN3B 3DWPA 4LUZA 3KYHC 2ES2A 4X66L 5IYDH 3LWUA 4P74A 2K4KA 4A3IG 1QG7A 3MEFA 3MWYW 1WTVA 1VQDA 2F0UA 1X9NA 3SVMA 1CM9A 2D62A 3SK4A 5J1ZA 1EIYB 1EY5A 1F9QA 3ERSX 2B2WC 2EJGC 2LY7A 2JSOA 4C3IB 3VYUA 3NQTA 1B3QA 1X55A 1A0IA 3JAMc 2KOLA 1W3SA 3F2UA 3DM3A 4I7AA 1PTOC 2EYLA 4A3FB 1QUQB 3NELA 3I4MG 5KYLA 1TWAH 4JI5L 1GJXA 1H9SB 4KK7A 3J7YW 1BXTA 5FO7B 2EDGA 1KC8C 1AZQA 1N32Q 4HJ9A 2MO0A 1L0XB 1STBA 2ZTCA 4X62Q 1TWGH 2F0EA 2F0OA 3OIPA 4JOIA 1CA5A 5D14A 4DU9A 4JCVE 2F4VL 1DD2A 2B8GA 5C5LA 1L2FA 3SR1A 1PTOH 1NTGA 4K2KA 4BY7H 4LFCL 3HOWB 3BZKA 5DM63 3HKZE 2JA7G 1FNUA 1A2UA 1CKNB 5JEAH 4LF4Q 4DAPA 3E0JA 1MSHA 4MN3A 3RNUA 1PRTF 2N8NA 3FEWX 4XQJA 4DK6C 2F3IA 3OOCA 3SEBA 3FMCA 4TRDA 4JI0Q 3T51B 1IBML 3TS0A 4OL7A 1BVSA 2NZHA 1DYQA 4HCEA 2M2LA 3NEMA 3HOZH 1KAWA 1Q46A 3GTJB 2SNMA 4OELB 1VQ6A 2IX1A 5CV6A 4DXGA 1LTID 4HJ8A 5C3EB 2E2JB 2A6HC 1HNZL 2HHHL 2WFWA 1KIXA 1I6HB 3A54A 2VL6A 4GKJQ 4YHHL 3CCLA 1ICFB 1KLUD 4A3JG 2D0OA 2K5HA 2F03A 3D4WA 5K36H 2KHJA 4IUUA 3K5MA 4CJ2C 1SYDA 3AFQA 2JA6B 2EVBA 2SEBD 1J8IA 3GDEA 2R92H 4LW1A 5DEHA 1TS2A 1Z7TA 2KENA 4PMWA 3T4AC 4F8MA 1IL8A 1ET9A 2I5MX 2L12A 4LF5Q 1DOKA 2NTTA 4ODGA 4P71A 3MAQA 4NXNL 2UXBQ 2VZAA 4IUPA 3FKIB 4A3LG 3H0GB 1D1IA 3KLRA 4A3BH 2R6GA 3GO5A 2NTSA 3P1HA 2IWHA 2XWJB 3H3VI 3HOVG 3PUZA 4CKBA 1LT5D 1TS3A 4DFAA 2E74C 2CQAA 1KDBA 2F0QA 2G9DA 1BBUA 1KAAA 4K2LA 2VQEQ 4BBRB 5GADC 1HA6A 4LF9Q 5IOCA 3I4MH 5GAEC 3EJIA 4JV5Q 3SXHA 3PSIA 5IT9L 1I3QB 4QMGA 1KXLA 4ULLA 4YCWA 4HJAA 1HFGA 2JK8A 3G48A 2Y0SE 5FLXL 1A8VA 4IQZA 1Y1VG 2PQEA 1VQCA 1YHBA 1FJGQ 5IGBA 1GUGA 3K80C 1X3FA 2WIIB 4A3MG 2EJFC 1RCVD 4IUVA 2R7ZH 1PA6A 2JA7H 1GUWA 1A63A 1TXYA 1V1PA 3NTKA 2Q8IB 4F88A 2OTJA 3W3AA 1CZWA 2JEBI 1H9KA 3KBGA 5IWAQ 4NXMQ 1WJJA 4YWLA 3FP9A 1OTCA 4GNXC 3F2DA 2DGYA 2F3WA 3HGBA 4XQNA 4OIKA 5FO8B 5C3XA 5IGGA 4BXXH 1NCVA 2RDFA 1PH7A 4JPBW 3CMEA 3KOJA 4DAVA 4BY1H 3M3YH 4PQXA 4CKCA 4RG1A 3GV6A 5AFWA 1JOQA 5JJIA 2WAQG 4HMJA 3PUVA 3NBHA 5HGQA 2UXCQ 1PH9A 1SNQA 3UDXA 4FO2A 3MXGA 1U9RA 2B63G 3AB9A 3T1HL 1YZ6A 3K81C 1HZ9A 1IW7D 2EY1A 4RKBA 5M3FB 1FGBD 3T13A 4JI3Q 1TWFB 3I90A 1VQEA 1EFID 4FXDA 1HNXQ 1S5ED 2O2LD 4IPCA 1M90C 2VB3X 4JYAQ 1VQ9A 1NMGA 1XMOQ 2RDHA 4A3KG 3PGZA 1ASZA 1B1ZA 1F77A 2OCEA 2AQ1B 4R4CA 5FLMH 3CKIB 1QE6A 1I5FA 4ZYSA 1E0BA 1SFOH 3HOYG 1KDAA 4LF8Q 1UUPA 1K73C 1PH2A 1E24A 2RHQB 1B44D 2VNUD 4OXPA 1B4OA 2ICEC 1LTGD 5CV5A 3J81j 4YWMA 2XVSA 2GVBA 1YJ9A 4CJ1B 3NTHA 5I9OA 3PO2B 1S4ZA 3RN2A 2TSSA 4C1NI 1HUNA 4DK0A 5K5PA 1K0SA 2ICIA 3GD7A 3VR5A 1ET6A 1Y1VH 4RH6A 1GD7A 4GNXA 2NVYB 4A3EG 4HIKA 1PYWD 1JCKB 4KKUA 1PFSA 1X65A 5JPNC 1QB5D 1F9RA 2VQFL 2F0WA 3KF6A 3PO3B 3ITPA 4KD3A 4X62L 5C4XG 3IFDA 2F0LA 4KV6A 2EQSA 2EXZA 4K5WA 1CA6A 1WTWA 2E5LQ 1U4MA 4IFDG 3D0FA 4OWTB 1EOVA 1OXTA 2NVQB 4UP7A 5EPLA 4IURA 2R61A 4C3IH 2UUCL 3ERQA 1FNVA 4LF4L 1HPCA 4RAUC 4N8FA 1KD1C 3HKZG 4LWCA 3V96A 2B2YA 4MTKA 2D2CC 4IPDA 4X3UA 4A3FH 1EQVA 1XTCD 1YBYA 2GA4B 1PHJA 3T1YQ 4JI0L 1UAPA 2MUYA 5JJLA 2B8FA 2BOSA 1A3UA 4RHRA 2F0PA 5M3MG 3WOFA 2EJMA 1AE2A 4RGNA 2ALYB 1X3GA 5CBEE 1CI3M 3S1QH 3ICEA 3IRBA 4CJ0B 4M8AA 2XWBB 1JE4A 1EQQA 5IYCH 3A7AB 4ZAIA 1IYUA 4MTNA 2DNCA 3VYRA 2M00A 4WJ3M 1AP0A 5ELFA 5HY6A 4GKJL 3CHBD 3FDTA 3HOWH 1W2BA 1C48A 4X3KA 4OIJA 2VY3A 2FJ2A 1H95A 2JN4A 5LMUQ 3MXNB 1YVCA 3GTLB 5CGKA 1HZBA 4Z9CB 1JOKA 4P73A 3A5UA 3K7AB 3STBD 3QR8A 1F2YA 4AYBE 2H4OA 3B6YA 1UE1A 4PG3A 2JA8B 3HOYH 2NBFA 4B9WA 4LF5L 1WTHA 1BCPD 3Q23A 1U4PA 2WP8J 5J39A 2KHIA 1B9NA 2UXBL 2KCMA 4BBSH 2Z9HA 3RZDB 2K6AA 3W2DA 4RGOS 3VR2A 3X3NA 3E9HA 3U9SA 1EYAA 1Q12A 4LUOA 1LTTD 1M4VA 1WCMG 1A3TA 1WI5A 1HCZA 1E1TA 5LL6S 2BE5C 2E2HB 2PI2A 1YNXA 2JA5B 2VQEL 1K3BC 4LF9L 1ILPA 2KJXA
chains in the Genus database with same CATH topology
5M9OA 1O78A 2NUCA 1G291 1QILA 3G6JB 2PZWA 2NYZD 1LTRD 4XDXA 3VR6A 1A2TA 1PRTB 3K5OA 3VR4A 1EY4A 4DXFA 2KQ3A 3SK5A 2LKVA 1EY8A 4OGQC 1DCZA 3IL8A 1KNAA 3DHQA 3KF8A 3R2TA 4KI0A 4HSVA 1CHPD 4RGTA 1G6ZA 1D1KA 5C0XJ 2KECA 3IAYA 1EOTA 4K8IA 5T1IA 1D2BA 4X3TA 2AQ2B 2N55A 2EYMA 3OSOA 2BCOA 5CC4A 4KY7A 3BS1A 3GTOB 1HA5A 2F0SA 3EVQA 3PUXA 2FMMA 4OO1H 1F2ZA 1CQVA 3RZOB 1PDQA 2ZXRA 5C4HA 5E3FA 3I3CA 4C1NK 4DAYA 3FVQA 4BS9A 2IT1A 1TWCB 5EKIA 3TMEA 2B2UA 1SBBB 1GOZA 3S17B 2JYOA 1XYIA 3HOXB 5KYIA 3I91A 3P7JA 1MD2D 2B2TC 2F0TA 3TP8A 4RKLA 3KK7A 1MBYA 1NSNS 4QCLA 4RCNA 1ESFA 2RA4A 5JEAG 4A3JB 3VYSA 5E4XA 2KCNA 3BVZA 1RF2D 3NBIA 3S2HB 5EQ0A 1G8ZD 2TMPA 1Q90A 1PMRA 1BCPF 1S5CD 1CQFA 1OXVA 4IFDI 1HTLD 4LJZC 5TSSA 3I4NB 1CZGA 1BCPC 4K6LA 1V8QA 4FXGC 1EWCA 1D5XC 5CYUA 2DNEA 5K36G 4KY6A 5IGEA 3I72A 2FINB 5ELDA 3OMCA 3D6WA 4J1MA 4QUFA 4A3GB 3CRKC 5FKAC 3J7AV 1ONLA 1STYA 3DMUA 3NQIA 4KJOA 5KNCA 1IKMA 1SNCA 1TIID 4S3SA 1EZ6A 1GUOA 1ICWA 2L5TA 1EYDA 1PTOF 5CV7A 2PMZB 3M7GA 1W6KA 2ENBA 4K8JA 5EBCA 1SMYD 2VUMB 2XIWA 3TZDA 5IIFA 3LNNA 1EEFD 2A6ED 4Q0FA 1TS4A 4KHVA 2SNSA 3K57A 5C5MA 1C8CA 2E2DC 1XX8A 2B39A 1FD7D 3PUYA 1R4PB 1KABA 4NKLA 1I4RA 4HN7A 4H7BA 4DNRB 3VA7A 3L3OC 1TU2B 2XNAC 3DEOA 1B50A 5DAUA 2DY8A 1GUNA 2BA1A 3OPOA 2PCFB 3UI2A 3RMHA 5ELBA 2NVTB 4FF3A 2MJ8A 3M4YA 4H13C 1GHJA 3MEHA 3GTMB 3H09A 4U68A 5J22A 4KJNA 2EY6A 4XIGS 3C1FA 4QF4A 2KEEA 3D4RA 2O5IC 4A93B 2F0VA 1SEBD 2B2WA 1SNMA 2JXMB 2AUJD 4TKOB 4JBWA 4C3HB 1NR2A 2OF1A 5EBDA 3T53B 3S15B 1RTNA 1GUSA 2X6GA 5BN3A 2J4XA 1QCBD 3GQBA 3DWAA 4Q5VA 2MP1A 5I2YA 5I9PA 1TY2A 1AZPA 5C0XH 5JJZA 5ELCA 3HEJA 4XQQA 2E75C 3NHHA 4PMCA 4DK1A 2PZTA 3GTQB 3SK6A 3HG9A 1BDOA 2N88A 1TR5A 3NPPA 4HR7B 4C2MB 2A73B 2F0DA 2K5DA 3GTPB 3I70A 4IUNA 1LV9A 2BDNA 1SJED 2KEDA 4WRDA 3MA2B 3PIO3 1GXDC 3M4OB 1VMPA 2ZT9C 3A8JE 2MHVA 3GP7A 3WDNA 1DOMA 3BVGA 4HTHA 3R93A 5CV4A 4NDXA 1JWSD 2K04A 4KN4C 3HOUB 5D3IB 4C3IG 1EL0A 1B3AA 1VF5C 5EGTA 1LLRD 1OO9B 1SMYC 2BE5D 1WTOA 2A6EC 2K1BA 2K01A 3Q22A 1AFPA 2KCCA 2VXWA 2RSOA 1EY7A 1QOHA 2EY2A 2QILA 1YNND 5T1GA 2V4DA 1TKWB 2HDLA 3PIP3 3S16B 1BBXC 4J6HA 1II3A 4DNTB 4LK1C 1I4XA 2SOBA 3NP8A 1STHA 3BDCA 4KHZA 5FOBB 3AU7A 1CT1D 1H9MA 2CW0D 2LS01 1C4QA 5LHY1 1I4PA 1EWHA 1I50B 2Y0SB 3SE0A 3URYA 1QWYA 4QB4A 4R8NA 4XT1B 1BNZA 3PV0A 1CK1A 5HURA 3H6MA 5I2XA 1KLGD 3MZ5A 3J81E 3S9WA 1EY9A 2C5CA 1PXUA 4M1UB 1PZKD 2LMCB 1RKNA 2K05A 4H0LC 3MXUA 4RGMA 1IHZA 1JOOA 1STNA 1SYGA 3EROA 3G7LA 4FP5D 4C56C 2B2VC 1PZID 1B2TA 5JPMC 2Q8RE 3DWQA 4IZ8A 3MFGA 1LT3D 4BA1I 3TP5A 1QNKA 1K8MA 2AUKA 4QUCA 5JAVA 2KHSA 3A56A 5CV8A 3DXJC 1X32A 4V0BA 3QIAA 4I7ZC 3ONAB 3D31A 4LAAA 1JB3A 4WJWA 1F2MA 1CFMA 2KUMA 2H1EA 4FF1A 3A7LA 2XRSD 4U673 3FPUB 5FO9B 1NR4A 2X6LA 1KTKA 2IX3A 1LO5D 3BVMA 4O1NA 1Z6HA 2PW7A 1I6VC 3EQLC 4OO1G 1PTOB 1T5XD 2XN9C 1EZ8A 5M5XB 2SDFA 1LTAD 5M5WB 3IKJA 2DN8A 1NAPA 1FNWA 5NUCA 1DOLA 1E2WA 1AEXA 1JWMD 2K5WA 1H9SA 4C3JB 1WTRA 4R9WA 1O7ZA 3HOZB 2B2VA 1BO0A 2BA0A 3SK8A 2DY7A 2NN6H 4G7HC 1NUCA 2L1BA 1UNSA 1Y1WB 3D4DA 2A68D 4RHSA 5I6WA 1YNNC 1ENAA 1QNUA 2F0MA 3K58A 3MFYA 1L0YB 1JR0D 3AMUA 1VF7A 1DM0B 4N9PA 2EYOA 3R2IA 1V1PB 1W6JA 2F4IA 3TZUA 4A3IB 4ZRZA 3C46A 1LT6D 1RDPD 2CW0C 3L7ZC 4KTAA 4RA8A 4UDUC 1R4QB 3SHLA 1ZKOA 3I4MB 3A8IE 1F9SA 3OIQA 3D3RA 2K03A 4ID6A 1JICA 4BA2I 2Z4HA 2EPBA 4DA2A 4HCSA 1AN8A 3DEPA 4F7XA 3PUWA 3T56B 1E2ZA 1GHKA 2Q8TA 3C3LA 2K5QA 4MIUA 3PMFA 1SNDA 4E6IA 1HFNA 1D5MC 2XRQD 2JA7B 3EA6A 2F0KA 1TS5A 2F1MA 1TY0A 1I4GA 1OXXK 3NSWA 1EIHA 2D5DA 3Q24A 1PRTD 5COYA 4QIWB 2F3VA 1GUTA 1ZEQX 1SE4A 4ZLTF 2YU9B 1RD9D 2IW3A 1XWEA 4KD4A 1JORA 2PO4A 3RLFA 4BY1B 1DONA 2EYJA 2RBMA 3E6ZX 4RWSC 3BYYB 3H91A 5IGCA 1BR9A 3S1MB 2KA7A 1FR3A 4FF2A 5LL6X 2RDGA 4K6DA 3E5SA 1TT2A 2BDOA 1H9RA 4FXKC 1IYVA 4XTCS 3HOVB 3D8GA 1M8AA 1SFOB 5C4ZA 1CTMA 4IALA 3ND8A 2ZXOA 4IUQA 1BF4A 3TP7A 4P2CB 2CVRA 4KKSA 4FVMA 1U4LA 3J80E 5JVH3 2RVLA 2WV6D 1A15A 1SDFA 5CR3A 1TQOA 1ILQA 1YNJC 2F0HA 5E4WC 4PNYA 2AWNA 1Y1VB 2OT2A 2QKIC 2FFKB 1EEID 5C0XG 2A68C 3QWNA 2EE1A 4A3MB 4FNFA 2B2TA 4B08A 2WACA 2L9HA 3K5LA 3S1NB 1B53A 5F2DA 3NTIA 4OO1I 4G4KA 1D5ZC 1SYBA 1QJOA 3JAME 4G57A 3J81L 3GTKB 2A74C 3O13A 5KGUA 4NMZA 4V190 4N9TA 5DM73 1A6XA 1Y8NB 4H44C 2WAQB 1MGSA 2NVXB 5EJWA 3S1QB 2MPMA 4JK1C 2B63B 5IGFA 5D3DA 4DN4M 3V2TA 2Z8LA 3N52A 1S5BD 4ZK9B 4ZKBB 4OHJA 3NE5B 1JC7A 4A3KB 2KVMA 1SNOA 2HCIA 2NWGA 5ISRA 1AW7A 1PFBA 1HTPA 4RFBA 5FK9C 5BN5A 3L9AX 1LTBD 5C3WA 1ZYRC 3HOYB 1PRTC 1Q3LA 1ESRA 2RQXA 3ZYYX 2HUGA 4BBSB 3K59A 5CV9A 1HRJA 1V43A 1Q1BA 2K32A 4L8JA 2JP1A 3KBXA 1Z47A 3QB3A 4A3EB 3MXNA 3OMGA 2A69D 4YIJA 3NWSA 2HCCA 5C4XB 1JWUD 1Y8PB 4IN3A 3MC0B 5A2QL 1V1OA 3N6RA 1X3QA 2NZ1D 5D65A 3A8KE 2D9UA 1RTOA 2F0FA 3BYTB 3HZXA 3VA5A 2F0JA 3I8ZA 4X3SA 1EY6A 2Z1CA 2QDBA 3C1EA 3HKZB 4FF4A 5IGDA 1O80A 3QOJA 1WVLA 4NW2A 1DXMA 1LTSD 4KN7C 4IFDJ 5M3MB 1SAPA 1VMCA 1D6EC 5C4JB 1STAA 1KDCA 3NK9A 3QO2A 2WKCA 1K83B 2O4XA 4LMQD 4J8QA 1J9OA 1SE2A 4XXEA 3MVVA 3CRLC 3OWEB 2K28A 2L11A 1BQQT 2EYHA 4B9XA 1LACA 2L55A 3X3MA 3MTSA 3HRZC 2OEOA 2J0TD 3HS0C 2MGSA 1LT4D 3TN2A 3GV3A 2O5JC 3GTGB 2HQEA 3BDLA 5A35A 4EVOA 1EIGA 2EZVA 4ZUJA 4ABNA 3BG3A 5JOBA 2XSCA 3MXPA 1WCMB 3TBIB 2F0GA 4CKEA 2ID0A 4EGVA 3M85A 2I07B 5CORA 4L6TB 2PPBC 1TWHB 1R9TB 1DZ1A 4HMIA 3RUZA 1IKLA 2E76C 5C6AA 5EPKA 2B2YC 3K6OA 1B9MA 3KLSA 1ML0D 3J7AF 4EQNA 5C0XI 2JEAI 2JE6I 1BOSA 2HDMA 3C2PA 1ZXTA 1H9JA 4DGZA 3TP6A 1ENCA 1HUMA 1G2SA 4XYOA 5KNBA 3I73A 1EYCA 2EOTA 4GZYC 1A3VA 1FYCA 5JVG3 1SSOA 3SDZA 5KEEA 4G7ZC 1T5EA 4PV1C 4C3HG 2NN6G 5EPJA 4XT3B 3Q0AA 2WB1B 4UAIA 1EU3A 3P75A 2R93B 2K33A 3QJYA 2C9OA 2K7VA 1RODA 3TSSA 4Y7NB 1X3PA 3CU7A 1BCPB 1SYEA 2A69C 1U4RA 3DUZA 5DNFA 3MHBA 2YYZA 3TDQA 1PLFA 3VYTA 1HQMC 5CMDA 1E2VA 4ZKCB 3FPPA 5HGTA 3J80L 2IJ0A 1Y69U 5G3LD 1F2LA 1TWAB 2R3ZA 4EQPA 1SYCA 4A3DB 5M5YB 1TWGB 5BN4A 2I46A 1JQYD 2E2IB 1XXGA 1VCIA 1PFMA 1HXYD 3K5NA 4BY7B 1EQTA 1UEAB 2F0NA 2A5HA 2F0IA 2PNRC 3JAML 3LWEA 4KY5A 1SYFA 2L0CA 5A2QE 2J7ZA 1MI2A 4ME5A 5EKKA 3V05A 3S1RB 3H94A 4CHTB 5JEAJ 4I65A 2X69A 1YNJD 5IODA 3NXWA 1WTPA 2QF7A 4WORA 3HP3A 4IUTA 1S5FD 2ZXPA 5C44B 1WD1A 5IT9E 4K5VA 3M7NA 2QCPX 3Q6SA 4PMBA 3ND9A 4F87A 2R92B 5FLXE 4R8IA 1IW7C 1G91A 4A3BB 5KNDA 3S2DB 1S5DD 2AWOA 5CBAE 5I6YA 2B2UC 1KNEA 5E1FA 3VR3A 4IFDH 1LABA 1STGA 2QEJC 1WTXA 1PTOD 2G9HD 1I4QA 2FMCA 1VDZA 4ZQ3A 1RHPA 4TQUS 2PYKA 1K8OA 2EY5A 3OWFA 1WTQA 1ENFA 4AYBB 2OXPA 3I4LA 1WD0A 2M9VA 2IPKD 3WOEA 4HEDA 2RSNA 1O7LA 2R7ZB 1DJRD 1STEA 4HAEA 5KRUA 4HSPA 1PFNA 5KIXA 3T16A 3D6CA 5I4DA 2CHBD 2EYFA 4WFN3 1ZYRD 3LX0A 4L63B 1F9PA 1OXUA 3BDOA 3KLSX 5G3LF 1EY0A 1RJTA 2A6HD 3R8BA 2IX0A 4FYDA 4EQOA 4MHEA 3OW7A 4K5XA 3M3YB 1PZJD 3IFTA 2RKSA 2LFNA 1EU4A 2VB2X 3EFXD 4KKTA 4NP5A 4ILWA 5ELEA 2PW5A 1OXSC 4K14A 3DM1A 4ZUIA 4CBVA 2NN6I 3BZDB 2PZUA 3K0YA 1CHQD 4RCOA 3QOLA 1SE3A 2L4NA 3OHXC 1I4HA 1Q8IA 4CGYB 1SXTA 3QG1A 4C3JG 4XYQA 4BWGB 2IL8A 2EYPA 3KUPA 3A55A 5EKLA 4KMUC 1O7YA 3H3VC 2FHTA 1SJHD 3U9OA 3NWTA 2NB0A 4DF7A 1MSGA 4O42A 3P20A 1G2TA 3CQZB 3R3OA 1HHVA 2Z4IA 1Y8OB 1HQRD 3NUCA 3RD4A 1TVXA 1BUVT 1Q1EA 2WINB 3S14B 4TSSA 3FRPB 4G7OC 2WKDA 2AQ3B 1SNPA 3DWPA 3LWUA 1QG7A 3MWYW 1WTVA 2F0UA 3SVMA 1CM9A 2D62A 3SK4A 5J1ZA 1EY5A 1F9QA 2B2WC 2EJGC 2LY7A 2JSOA 4C3IB 3VYUA 3NQTA 2KOLA 3F2UA 1PTOC 2EYLA 4A3FB 5KYLA 1GJXA 1H9SB 4KK7A 3J7YW 1BXTA 5FO7B 2EDGA 1AZQA 1L0XB 1STBA 2F0OA 2F0EA 3OIPA 1CA5A 5D14A 4DU9A 1DD2A 2B8GA 5C5LA 3SR1A 1PTOH 4K2KA 3HOWB 5DM63 1FNUA 1A2UA 5JEAH 4DAPA 3E0JA 1MSHA 4MN3A 1PRTF 3FEWX 4XQJA 3OOCA 3SEBA 3FMCA 4TRDA 3T51B 4OL7A 4HCEA 1DYQA 2M2LA 3GTJB 2SNMA 2IX1A 5CV6A 4DXGA 1LTID 2E2JB 5C3EB 2A6HC 1I6HB 3A54A 1KLUD 2F03A 3D4WA 5K36H 4IUUA 3K5MA 4CJ2C 1SYDA 2JA6B 2EVBA 2SEBD 1J8IA 5DEHA 1TS2A 1Z7TA 4PMWA 4F8MA 3T4AC 1IL8A 1ET9A 2L12A 1DOKA 2NTTA 4ODGA 3MAQA 4IUPA 3FKIB 3H0GB 1D1IA 3KLRA 2R6GA 3GO5A 2NTSA 3P1HA 2IWHA 2XWJB 3PUZA 4CKBA 1LT5D 1TS3A 4DFAA 2E74C 2CQAA 1KDBA 2F0QA 2G9DA 1KAAA 4K2LA 4BBRB 1HA6A 5IOCA 3EJIA 3SXHA 5IT9L 1I3QB 4QMGA 4ULLA 1HFGA 5FLXL 4IQZA 2PQEA 5IGBA 1GUGA 2WIIB 2EJFC 1RCVD 4IUVA 1GUWA 1V1PA 3NTKA 2Q8IB 4F88A 3W3AA 1CZWA 2JEBI 1H9KA 3KBGA 2F3WA 3HGBA 4XQNA 4OIKA 5FO8B 5C3XA 5IGGA 1NCVA 2RDFA 4DAVA 4PQXA 4CKCA 3GV6A 5AFWA 1JOQA 4HMJA 3PUVA 3NBHA 1SNQA 4FO2A 3MXGA 1U9RA 3AB9A 1IW7D 2EY1A 4RKBA 5M3FB 1FGBD 3T13A 1TWFB 3I90A 1EFID 4FXDA 1S5ED 2O2LD 2VB3X 2RDHA 1B1ZA 1F77A 2AQ1B 3CKIB 1QE6A 4ZYSA 1E0BA 1KDAA 1UUPA 1B44D 2VNUD 1B4OA 2ICEC 1LTGD 5CV5A 2XVSA 4CJ1B 3NTHA 5I9OA 3PO2B 1S4ZA 2TSSA 4C1NI 1HUNA 4DK0A 5K5PA 2ICIA 3GD7A 3VR5A 1ET6A 4RH6A 2NVYB 1PYWD 1JCKB 4KKUA 5JPNC 1QB5D 1F9RA 2F0WA 3PO3B 3ITPA 4KD3A 3IFDA 2F0LA 4KV6A 2EXZA 4K5WA 1CA6A 1WTWA 1U4MA 4IFDG 1OXTA 2NVQB 5EPLA 4IURA 2R61A 3ERQA 1FNVA 1HPCA 4RAUC 3V96A 2B2YA 4X3UA 2D2CC 1EQVA 1XTCD 2GA4B 1UAPA 2MUYA 2B8FA 2BOSA 1A3UA 4RHRA 2F0PA 3WOFA 2EJMA 4RGNA 5CBEE 1CI3M 4CJ0B 4M8AA 2XWBB 1JE4A 3A7AB 4ZAIA 1IYUA 3VYRA 2DNCA 2M00A 1AP0A 5ELFA 3CHBD 3FDTA 1C48A 4X3KA 4OIJA 2FJ2A 3GTLB 5CGKA 4Z9CB 1JOKA 3K7AB 1F2YA 2H4OA 2JA8B 2NBFA 4B9WA 1BCPD 3Q23A 1U4PA 2WP8J 5J39A 1B9NA 3RZDB 2K6AA 3W2DA 4RGOS 3VR2A 3X3NA 3U9SA 1EYAA 1Q12A 1LTTD 1M4VA 1A3TA 1HCZA 5LL6S 2BE5C 2E2HB 2JA5B 1ILPA 2KJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M9O A;  3MXP A;  4KHV A;  2SNS A;  2F0W A;  2EYP A;  1TR5 A;  3ITP A;  4EQP A;  5KYI A;  3SK6 A;  1SYC A;  4KD3 A;  5C5M A;  2NUC A;  2F0D A;  2F0L A;  4KV6 A;  4TRD A;  2F0T A;  2F0K A;  3TP8 A;  2EXZ A;  5NUC A;  2F0G A;  3QB3 A;  4K5W A;  4OL7 A;  2PZW A;  4RKL A;  5EKL A;  4IUN A;  4ZQ3 A;  1KAB A;  3OMG A;  1AEX A;  4NKL A;  1NSN S;  4QB4 A;  5KIX A;  2WAC A;  4E6I A;  4H7B A;  4YIJ A;  4R8N A;  2PYK A;  1A2T A;  2SNM A;  5J22 A;  2EY5 A;  3U9O A;  1EY4 A;  3OWF A;  5F2D A;  2KQ3 A;  3SK5 A;  2LKV A;  4HMI A;  5CV6 A;  2F3W A;  3H6M A;  5HUR A;  3RUZ A;  2OXP A;  1EY8 A;  4WRD A;  3MZ5 A;  4DF7 A;  5C3X A;  5C6A A;  3S9W A;  1EY9 A;  2F3V A;  3ERQ A;  5IGG A;  1SYB A;  2F0N A;  3SK8 A;  5DAU A;  3R3O A;  2RDF A;  4G57 A;  2F0I A;  1RKN A;  4EQN A;  1EQV A;  3NUC A;  4KD4 A;  2F0F A;  3D4W A;  5IGD A;  3DHQ A;  1JOQ A;  5KRU A;  1NUC A;  3HZX A;  4HMJ A;  1IHZ A;  1JOO A;  1STN A;  1SYG A;  1SYD A;  2F0J A;  1SYF A;  3ERO A;  4KY5 A;  3VA5 A;  4DGZ A;  1A3U A;  5KGU A;  3T16 A;  2F0P A;  1EY6 A;  3D6C A;  4NMZ A;  1SNQ A;  3TP6 A;  1ENC A;  2QDB A;  3C1E A;  3D4D A;  3MEH A;  4HTH A;  4ME5 A;  4N9T A;  5CV4 A;  4KJN A;  1SNP A;  2EYF A;  1U9R A;  2EY6 A;  4NDX A;  5I6W A;  1ENA A;  5EKK A;  3QOJ A;  2EY1 A;  2F0M A;  3C1F A;  3LX0 A;  1EYC A;  4QF4 A;  2EYJ A;  2RBM A;  4RKB A;  5DEH A;  4F8M A;  3T13 A;  1A3V A;  4K8I A;  2F0U A;  5EGT A;  5IGC A;  2F0V A;  4ODG A;  5KEE A;  4IZ8 A;  3SK4 A;  5J1Z A;  4N9P A;  1EY5 A;  4I65 A;  2M00 A;  1EY0 A;  2EYO A;  4KY6 A;  5IGE A;  5IGF A;  3TP5 A;  1STA A;  1KDC A;  5IOD A;  3NQT A;  3NXW A;  3P1H A;  2EYM A;  3OSO A;  1SNM A;  3V2T A;  3NK9 A;  4EQO A;  5JAV A;  5CC4 A;  4K5X A;  4K6D A;  2EYL A;  2KHS A;  4KY7 A;  3OMC A;  3P75 A;  4WOR A;  4DFA A;  5CV8 A;  4J1M A;  3E5S A;  2O4X A;  1KDB A;  5KYL A;  2F0Q A;  4PNY A;  1TT2 A;  1KAA A;  4K2L A;  2F0S A;  5CGK A;  2RKS A;  2OF1 A;  1KDA A;  1JOK A;  3EVQ A;  1EY7 A;  1STY A;  3DMU A;  4K5V A;  3MVV A;  3D8G A;  4KJO A;  5IOC A;  4KTA A;  3EJI A;  1F2Y A;  1SNC A;  2EY2 A;  4NP5 A;  1SNO A;  4PMB A;  5C4Z A;  2EYH A;  1F2Z A;  1STB A;  4LAA A;  3SHL A;  3SXH A;  1SYE A;  4S3S A;  4B9X A;  1EZ6 A;  4IAL A;  1F2M A;  4B9W A;  5ISR A;  2F0O A;  2F0E A;  3MHB A;  2PW5 A;  4QMG A;  4K14 A;  4ZUI A;  5I9P A;  1EYD A;  5CV5 A;  5J39 A;  3TP7 A;  4DU9 A;  4ID6 A;  5C3W A;  2PZU A;  5CV7 A;  2OEO A;  5E3F A;  5C4H A;  2ENB A;  5I9O A;  4K8J A;  3HEJ A;  5HGT A;  5C5L A;  1EYA A;  3SR1 A;  2PQE A;  3NHH A;  4K2K A;  1A3T A;  4PMC A;  5I6Y A;  4J6H A;  5K5P A;  3QOL A;  5CR3 A;  1II3 A;  5IGB A;  1TQO A;  2PW7 A;  3TME A;  5IIF A;  2HQE A;  3BDL A;  2PZT A;  4F7X A;  5E1F A;  1A2U A;  1EZ8 A;  4EVO A;  1STG A;  4ZUJ A;  2SOB A;  3NP8 A;  1STH A;  2F0H A;  3BDC A;  1JOR A;  4MIU A;  5CV9 A;  3PMF A;  1SND A;  5JOB A; 
#chains in the Genus database with same CATH topology
 5M9O A;  1EQR A;  4IPH A;  4JV5 L;  1O78 A;  4LFA Q;  2NUC A;  4MNO A;  1NMF A;  1G29 1;  1QIL A;  3G6J B;  2JA6 H;  4WJ4 A;  2PZW A;  2NYZ D;  1LTR D;  5C4X H;  5FLX c;  1HNW Q;  4XDX A;  1MIU A;  3VR6 A;  1A2T A;  1PRT B;  3K5O A;  3VR4 A;  1EY4 A;  3ULL A;  4DXF A;  2KQ3 A;  3SK5 A;  2LKV A;  1FJG L;  1N8R C;  1EY8 A;  3H0G H;  4OGQ C;  2Y0S G;  1DCZ A;  1GO3 E;  3IL8 A;  1D8L A;  3I4O A;  1KNA A;  3DHQ A;  3KF8 A;  3R2T A;  4KI0 A;  1S3O A;  4BBR H;  4HSV A;  1U5K A;  2CWA A;  5DLQ E;  5IWA L;  1CHP D;  4NXM L;  4RGT A;  1G6Z A;  1D1K A;  5C0X J;  2KEC A;  3IAY A;  1I3Q H;  3W1B A;  5M3M H;  1EOT A;  4K8I A;  5C4J H;  5T1I A;  1D2B A;  1JJG A;  4X3T A;  4B3M Q;  2AQ2 B;  2N55 A;  2N3S A;  1K83 H;  2AHO B;  2EYM A;  3OSO A;  4L5S A;  2BCO A;  5CC4 A;  1YI2 A;  4KY7 A;  1K8G A;  3I2Z A;  4DR3 Q;  5IYD G;  3PCO B;  3NBH B;  3BS1 A;  3GTO B;  1HA5 A;  3CMA A;  2UXC L;  2F0S A;  3EVQ A;  3PUX A;  2FMM A;  4OO1 H;  4HID A;  1F2Z A;  4JI3 L;  1BBW A;  1CQV A;  4OEM B;  4LFB Q;  3RZO B;  1PDQ A;  5L37 A;  4A3C H;  1QVG A;  2ZXR A;  3CCE A;  5C4H A;  5E3F A;  1HNX L;  3I3C A;  4C1N K;  4DAY A;  4JYA L;  3FVQ A;  4BS9 A;  3FHW A;  1XMO L;  3GTG H;  1PH1 A;  2MNA A;  2IT1 A;  3U58 A;  1TWC B;  5EKI A;  3TME A;  2B2U A;  1SBB B;  1GOZ A;  3S17 B;  2JYO A;  4LF8 L;  1XYI A;  3HOX B;  5KYI A;  3I91 A;  1LUZ A;  3P7J A;  1MD2 D;  2B2T C;  2F0T A;  5GQO A;  4DV1 L;  3TP8 A;  4GOP B;  4RKL A;  4CDF C;  4BY7 G;  1R9T H;  3KK7 A;  3DLL A;  1MBY A;  1NSN S;  3F2B A;  4QCL A;  4RCN A;  1ESF A;  2RA4 A;  5JEA G;  4A3J B;  3VYS A;  5E4X A;  1XJV A;  2KCN A;  3BVZ A;  1RL2 A;  1RF2 D;  4APV A;  1X6O A;  1KL9 A;  3KJO A;  3NBI A;  3S2H B;  4JBJ A;  2Q2U A;  5EQ0 A;  3BZC A;  3KDF B;  1G8Z D;  1EIF A;  2TMP A;  1Q90 A;  3STB C;  1PMR A;  1BCP F;  1B70 B;  3M9B A;  2HT1 A;  3KJP A;  2QEX A;  1S5C D;  1CQF A;  1OXV A;  4IFD I;  1HTL D;  4LJZ C;  5TSS A;  3I4N B;  1CZG A;  2CFM A;  1BCP C;  4K6L A;  3CXC A;  1V8Q A;  4FXG C;  1EWC A;  2L15 A;  1D5X C;  2UUB Q;  5CYU A;  2DNE A;  3PO2 H;  1FVI A;  2A19 A;  5K36 G;  4KY6 A;  5IGE A;  1VQ5 A;  1HZA A;  3I72 A;  4QL5 A;  2FIN B;  5ELD A;  2R93 H;  3T1Y L;  1K3R A;  2NVY H;  3OMC A;  3D6W A;  4J1M A;  4QUF A;  2R92 G;  2VS1 A;  3CRK C;  5FKA C;  3J7A V;  4A3G B;  5IP9 G;  1ONL A;  3PO3 H;  1C9O A;  1STY A;  3DMU A;  3NQI A;  4KJO A;  5KNC A;  1IKM A;  1SNC A;  1TII D;  4A3B G;  4S3S A;  1EZ6 A;  1GUO A;  1ICW A;  2L5T A;  1EYD A;  2N78 A;  4PZ7 A;  1PV4 A;  1EYG A;  1PTO F;  5CV7 A;  4AH6 A;  2I5L X;  2PMZ B;  3M7G A;  1W6K A;  2ENB A;  4K8J A;  5EBC A;  3TS2 A;  2NVQ H;  1SMY D;  2VUM B;  2XIW A;  3TZD A;  5IIF A;  3I7F A;  3LNN A;  5LMU L;  1EEF D;  2A6E D;  4Q0F A;  1PH8 A;  4A3D H;  2VQF Q;  1E22 A;  4JBM A;  2LXJ A;  4A76 A;  1TS4 A;  4KHV A;  4JI7 Q;  2SNS A;  3VDY A;  4DR7 Q;  5M5Y H;  3K57 A;  5C5M A;  3EIV A;  1C8C A;  2E2D C;  1XX8 A;  2B39 A;  1V1Q A;  1FD7 D;  3PUY A;  4AYB G;  3E3X A;  2E2I H;  3UDI A;  1R4P B;  1KAB A;  4NKL A;  1I4R A;  4HN7 A;  4YCU A;  4H7B A;  4NPS A;  4DNR B;  3VA7 A;  4IJL A;  1I94 Q;  2R7Z G;  3L3O C;  2PNH A;  1E7Z A;  1TU2 B;  2F52 A;  2UUC Q;  3J7A 5;  2XNA C;  2OTL A;  1VQM A;  3DEO A;  1B50 A;  5DAU A;  4B3T Q;  3BJU A;  2DY8 A;  1GUN A;  2BA1 A;  3OPO A;  2PCF B;  3UI2 A;  3RMH A;  4LFA L;  2CQO A;  5ELB A;  2NVT B;  3GTL H;  4FF3 A;  2B3G A;  2MJ8 A;  3M4Y A;  4B3S Q;  4H13 C;  1HNW L;  1GHJ A;  3MEH A;  2JA8 H;  3GTM B;  3H09 A;  4U68 A;  5J22 A;  4KJN A;  2EY6 A;  3S1R H;  2YTV A;  4XIG S;  3C1F A;  4BXX G;  4QF4 A;  2AMC B;  2KEE A;  4DR5 L;  2JJQ A;  3D4R A;  1VQA A;  2O5I C;  4A93 B;  2F0V A;  1SEB D;  4BY1 G;  1PH3 A;  3RZD H;  3A74 A;  2GN5 A;  2B2W A;  1SNM A;  4QGU A;  3CC4 A;  5C44 H;  2JXM B;  4GKK Q;  2AUJ D;  3KF8 B;  4ALP A;  1VQF A;  3RLN A;  4TKO B;  4JBW A;  4C3H B;  1MJE A;  1EFW A;  1B8A A;  1NR2 A;  2OF1 A;  5EBD A;  3T53 B;  4UY8 C;  5IP9 H;  3S15 B;  1RTN A;  1GUS A;  2X6G A;  2J4X A;  3GQB A;  1QCB D;  5BN3 A;  3DWA A;  4Q5V A;  2MP1 A;  5I2Y A;  1SRU A;  1QVF A;  5I9P A;  1TY2 A;  3S2D H;  1AZP A;  5FLM G;  4CDE C;  5C0X H;  5JJZ A;  5ELC A;  4B3M L;  3HEJ A;  4XQQ A;  4UP9 A;  2E75 C;  1VQH A;  3NHH A;  4PMC A;  2QDL A;  2EXD A;  4DK1 A;  2PZT A;  4DR3 L;  3GTQ B;  3SK6 A;  3HG9 A;  1BDO A;  2N88 A;  1TR5 A;  4KLK A;  3NPP A;  4HR7 B;  1HR0 Q;  4C2M B;  2A73 B;  2F0D A;  2K5D A;  4LFB L;  3GTP B;  4JI8 Q;  3I70 A;  4IUN A;  1LV9 A;  1N36 Q;  2BDN A;  1DGS A;  1SJE D;  2KED A;  4WRD A;  1QZG A;  3MA2 B;  3PIO 3;  1GXD C;  3M4O B;  1VMP A;  2ZT9 C;  3A8J E;  2MHV A;  3GTO H;  2WB1 E;  3GP7 A;  3WDN A;  5J3B A;  1DOM A;  1KQS A;  1CSP A;  3BVG A;  4HTH A;  3R93 A;  5CV4 A;  4NDX A;  1JWS D;  2K04 A;  4KN4 C;  3HOU B;  5D3I B;  4C3I G;  1EL0 A;  1B3A A;  1NNX A;  1VF5 C;  1E1O A;  3KFU A;  4L5Q A;  5EGT A;  4GOP C;  2A8V A;  4DV0 Q;  2KCT A;  4A3F G;  1LLR D;  1OO9 B;  1SMY C;  2BE5 D;  1VS0 A;  1GM5 A;  2P5Z X;  2PQA B;  2ASB A;  1WTO A;  1D7Q A;  4MZ9 A;  2A6E C;  1TWC H;  2K1B A;  4ME3 A;  1ASY A;  2K01 A;  2AKW B;  3Q22 A;  3S17 H;  1AFP A;  2KCC A;  2VXW A;  1L1O B;  2N49 A;  3HOX H;  2RSO A;  1EY7 A;  1QOH A;  5IYC G;  1YIT A;  2EY2 A;  2QIL A;  1MHW C;  1YNN D;  3HOW G;  5T1G A;  1A62 A;  2UUB L;  2V4D A;  2DJF C;  1TKW B;  2HDL A;  4HIO A;  3PIP 3;  1QZH A;  3S16 B;  2DJG C;  4R4I A;  1BBX C;  4J6H A;  4IO9 A;  1II3 A;  4DNT B;  4HJ5 A;  4LK1 C;  3S2H H;  1I4X A;  2SOB A;  3NP8 A;  1STH A;  3BDC A;  4KHZ A;  5FOB B;  3AU7 A;  1CT1 D;  2K5N A;  3CPW A;  4DV1 Q;  4LF7 L;  4BBS G;  1H9M A;  2CW0 D;  2LS0 1;  1C4Q A;  5LHY 1;  1I4P A;  1Y14 B;  3I55 A;  1EWH A;  1I50 B;  1VQJ A;  2Y0S B;  3SE0 A;  1VQG A;  1HJP A;  3URY A;  1QWY A;  4QB4 A;  4QY7 A;  4R8N A;  4XT1 B;  1BNZ A;  3PV0 A;  1CK1 A;  5HUR A;  3H6M A;  3CQZ H;  1P8L A;  5I2X A;  1KLG D;  3MZ5 A;  1IBL Q;  3J81 E;  2MFI A;  3S9W A;  1EY9 A;  1Q86 C;  2JA6 G;  2C5C A;  2UU9 Q;  1PXU A;  4M1U B;  3S14 H;  1PZK D;  2LMC B;  1RKN A;  4JI7 L;  2K05 A;  4DR7 L;  4H0L C;  3Q8D A;  4A3G H;  5IY0 A;  2ZM6 Q;  3MXU A;  3PF4 A;  4RGM A;  1IHZ A;  1JOO A;  1STN A;  1SYG A;  3ERO A;  4AIM A;  3G7L A;  5FJ8 H;  1IYJ B;  3FKI G;  4FP5 D;  3H0G G;  4C56 C;  4GLX A;  2B2V C;  1I94 L;  1PZI D;  4JI2 Q;  1UE5 A;  1B2T A;  5JPM C;  2Q8R E;  2B29 A;  1VQN A;  3DWQ A;  4IZ8 A;  3MFG A;  1LT3 D;  4BA1 I;  1K9M C;  4BBR G;  3TP5 A;  1HR0 W;  4B3T L;  1MKH A;  1QNK A;  1K8M A;  2AUK A;  1RIP A;  4QUC A;  4CDC C;  5JAV A;  4EX5 A;  1PH4 A;  3NEN A;  2KHS A;  2MQH A;  3A56 A;  5CV8 A;  3WWV A;  2NZO A;  3UDG A;  1UEB A;  2R7D A;  3DXJ C;  4B3S L;  1X32 A;  4R4T A;  4V0B A;  3QIA A;  4I7Z C;  3J7Z C;  4IOA A;  1X54 A;  3ONA B;  2D0P A;  2H5X A;  3D31 A;  4LAA A;  1JB3 A;  4WJW A;  1SLJ A;  1F2M A;  1CFM A;  2KUM A;  3E0E A;  2XGT A;  2H1E A;  4FF1 A;  3A7L A;  3PF5 A;  2XRS D;  4U67 3;  5AJ3 Q;  1K28 A;  4R4Q A;  5H1S E;  3FPU B;  5FO9 B;  1NR4 A;  2X6L A;  1KTK A;  4OX9 Q;  2IX3 A;  1LO5 D;  4JG2 A;  4GKK L;  3BVM A;  4O1N A;  1Z6H A;  2PW7 A;  1I6V C;  3EQL C;  4OO1 G;  1PTO B;  1T5X D;  2XN9 C;  1EZ8 A;  5M5X B;  2SDF A;  1LTA D;  4YY3 Q;  3E9I A;  5M5W B;  4A3C G;  1J5E Q;  3TEH B;  3IKJ A;  1BKB A;  2DN8 A;  4OWX B;  4DAM A;  1NAP A;  2R7F A;  1FNW A;  1XMQ Q;  5NUC A;  3GTJ H;  1DOL A;  1QUQ A;  1E2W A;  2YTX A;  1AEX A;  1JWM D;  1VQK A;  2K5W A;  1FL0 A;  1H9S A;  3G4S A;  4C3J B;  1WTR A;  2E2J H;  5C3E H;  5ELN A;  4R9W A;  3RR5 A;  4DV3 Q;  1I6H H;  1O7Z A;  2ZJP A;  3HOZ B;  2B2V A;  2QA4 A;  1BO0 A;  1IL2 A;  2BA0 A;  3SK8 A;  3S24 A;  1VQ4 A;  2BH2 A;  2DY7 A;  2HIV A;  5IT9 c;  2CKZ B;  1LTL A;  1HR0 L;  4RMF A;  4C3H H;  2NN6 H;  5M3F G;  4G7H C;  1NUC A;  2L1B A;  1UNS A;  4JI8 L;  1Y1W B;  1JJ2 A;  2ZTD A;  2A68 D;  1CKN A;  3D4D A;  4RHS A;  5I6W A;  1YNN C;  4X65 Q;  1ENA A;  1QNU A;  2Z6K C;  4QJF A;  2F0M A;  4DR5 Q;  3K58 A;  3MFY A;  1JMC A;  3FKI H;  1L0Y B;  1N36 L;  1JR0 D;  3AYH B;  3AMU A;  3KLW A;  1VF7 A;  3F1Z A;  1DM0 B;  4N9P A;  2EYO A;  3R2I A;  1V1P B;  1W6J A;  2F4I A;  3TZU A;  4A3I B;  4ZRZ A;  1N34 Q;  3C46 A;  3CAM A;  1LT6 D;  1RDP D;  2CW0 C;  2YV5 A;  3L7Z C;  2WB1 G;  4C2M H;  4KTA A;  4DUZ Q;  3PO2 G;  4RA8 A;  1N9W A;  2FXQ A;  2K52 A;  1R4Q B;  4UDU C;  3SHL A;  1ZKO A;  2Q2I A;  3A8I E;  3I4M B;  1F9S A;  3OIQ A;  4DV0 L;  2R93 G;  3D3R A;  1NBW A;  2K03 A;  4ID6 A;  1JIC A;  4BA2 I;  2Z4H A;  1VQB A;  2EPB A;  3UE0 A;  5IYB G;  4DA2 A;  4HCS A;  1AN8 A;  3PO3 G;  1AH9 A;  3ULP A;  3DEP A;  4F7X A;  1VQ8 A;  3PUW A;  3I56 A;  3T56 B;  4DV4 Q;  3M4O H;  1E2Z A;  1GHK A;  2Q8T A;  3C3L A;  1SN8 A;  2K5Q A;  4MIU A;  3PMF A;  1SND A;  3A0J A;  4E6I A;  1HFN A;  2LSS A;  1D5M C;  2XRQ D;  2JA7 B;  3EA6 A;  2F0K A;  1TS5 A;  4DV5 Q;  2F1M A;  1TY0 A;  1I4G A;  1L1O C;  1OXX K;  1IBK Q;  3NSW A;  1EIH A;  2D5D A;  3Q24 A;  4DR2 Q;  5BR8 L;  4A3D G;  1PRT D;  5COY A;  1N33 Q;  4GS3 A;  4QIW B;  2F3V A;  1GUT A;  1ZEQ X;  5GAH C;  1SE4 A;  4ZLT F;  2YU9 B;  1RD9 D;  2IW3 A;  1XWE A;  4KD4 A;  4AQY Q;  1JOR A;  2PO4 A;  1XTD A;  3RLF A;  3G6E A;  4BY1 B;  5M3F H;  1YHQ A;  1DON A;  3CC7 A;  1TWF H;  2EYJ A;  2G5D A;  1PYB A;  2RBM A;  3E6Z X;  4RWS C;  4DPG A;  1XNR Q;  3BYY B;  3H91 A;  5IGC A;  4GNX B;  4X6A H;  1IBL L;  1BR9 A;  1NJI C;  3S16 H;  3S1M B;  2KA7 A;  4GLA C;  1FR3 A;  2UU9 L;  3KF6 B;  4FF2 A;  1S72 A;  5LL6 X;  2JA8 G;  2RDG A;  4K6D A;  2ZM6 L;  4QQB X;  3E5S A;  1G6P A;  1TT2 A;  3K8A A;  2BDO A;  1H9R A;  4FXK C;  1GVP A;  2A1A A;  1IYV A;  1VQP A;  4XTC S;  3HOV B;  3D8G A;  1M8A A;  1SFO B;  5C4Z A;  4JOI C;  4JI2 L;  1I50 H;  1CTM A;  4IAL A;  3ND8 A;  4IPG A;  2ZXO A;  4IUQ A;  3TRZ A;  1BF4 A;  3TP7 A;  5C44 G;  4P2C B;  2CVR A;  4KKS A;  4FVM A;  1U4L A;  3J80 E;  2JA5 G;  4GN5 A;  5JVH 3;  2CWP A;  4J15 A;  2RVL A;  1FGU A;  1EWI A;  2WV6 D;  4ZCK A;  1A15 A;  1SDF A;  1WFQ A;  3CC2 A;  5CR3 A;  1TQO A;  1ILQ A;  5IYB H;  3L2P A;  4LUV A;  1YNJ C;  2F0H A;  5E4W C;  4PNY A;  2AWN A;  5ELO A;  1U0L A;  1Y1V B;  2CH4 W;  2OT2 A;  4LF7 Q;  2QKI C;  2FFK B;  1EEI D;  5C0X G;  2A68 C;  1IXR A;  3QWN A;  2EE1 A;  4A3M B;  4FNF A;  2B2T A;  5AJ3 L;  4B08 A;  2WAC A;  1VQ7 A;  2L9H A;  4JBK A;  3K5L A;  3S1N B;  1B53 A;  5F2D A;  4OX9 L;  3NTI A;  4L5T A;  4OO1 I;  4G4K A;  4YCV A;  1D5Z C;  4YY3 L;  2BH8 A;  1SYB A;  2YTY A;  1QJO A;  3JAM E;  4G57 A;  1J5E L;  3J81 L;  3M4Q A;  1Q82 C;  4O0A A;  3GTK B;  2A74 C;  4X64 Q;  3O13 A;  1XMQ L;  5KGU A;  3J81 i;  4NMZ A;  4V19 0;  4JC0 A;  1MJC A;  4N9T A;  4B3R Q;  1K8A C;  1V9P A;  5DM7 3;  1XNQ Q;  1A6X A;  1Y8N B;  4H44 C;  4DV3 L;  1IZ6 A;  4LNQ A;  2WAQ B;  1MGS A;  2ZJQ A;  4R1J A;  2NVX B;  5EJW A;  3S1Q B;  4DR4 Q;  2MPM A;  4GLV B;  4JK1 C;  2B63 B;  5IGF A;  5D3D A;  4DN4 M;  3V2T A;  1UE6 A;  4JI1 Q;  3M4P A;  3CCS A;  2Z8L A;  3N52 A;  1CKM A;  5M5X H;  1S5B D;  4ZK9 B;  2Q2H A;  4ZKB B;  3K7A H;  3TRE A;  4OHJ A;  5M5W H;  2EIF A;  3NE5 B;  1JC7 A;  3ULJ A;  4A3K B;  4X65 L;  2KVM A;  1SNO A;  2HCI A;  4JI4 Q;  2NWG A;  5ISR A;  1AW7 A;  1PFB A;  2UUA Q;  1HTP A;  4RFB A;  5FK9 C;  5BN5 A;  3CF5 A;  4C3J H;  3L9A X;  1LTB D;  5C3W A;  1ZYR C;  1PH6 A;  3HOY B;  2HIX A;  1PRT C;  1PH5 A;  4Y52 H;  1AE3 A;  1SE8 A;  1Q3L A;  2E2H H;  1ESR A;  2I0Q A;  1Q81 C;  2RQX A;  3ZYY X;  1HZC A;  2HUG A;  3HOX G;  2JA5 H;  4BBS B;  1N34 L;  3K59 A;  2C35 B;  5CV9 A;  3JC6 6;  4DUZ L;  1HRJ A;  1V43 A;  1Q1B A;  2K32 A;  4L8J A;  1Y1W H;  2JP1 A;  3KBX A;  2IHE A;  1Z47 A;  3QB3 A;  3TQY A;  1KRS A;  4A3E B;  3MXN A;  3OTO L;  3OMG A;  4POG A;  2A69 D;  4N8X 1;  4YIJ A;  2Q2T A;  3NWS A;  2HCC A;  5E7N A;  5C4X B;  1JWU D;  4OWW B;  1Y8P B;  4IN3 A;  2E8G A;  3MC0 B;  5A2Q L;  4PZ8 A;  1V1O A;  4POF A;  3N6R A;  1X3Q A;  2NZ1 D;  4DKA C;  4DV4 L;  5D65 A;  3A8K E;  4A3I H;  4DV2 Q;  3EN2 A;  1NE3 A;  2D9U A;  1RTO A;  3CP0 A;  3I4N G;  2F0F A;  3BYT B;  3HZX A;  4DV5 L;  3VA5 A;  2F0J A;  3I8Z A;  4X3S A;  1EY6 A;  4DR1 Q;  4DAY B;  2Z1C A;  2QDB A;  3C1E A;  3HKZ B;  1IBK L;  4FF4 A;  5IGD A;  1O80 A;  3HFZ B;  3QOJ A;  4JW0 A;  4NB3 A;  4DR2 L;  1WVL A;  4NW2 A;  1KRT A;  5LMN Q;  1DXM A;  4TVA B;  1N33 L;  1LTS D;  2CCZ A;  3UDF A;  4KN7 C;  4IFD J;  5M3M B;  1SAP A;  4A3G G;  1S40 A;  1VMC A;  1D6E C;  5C4J B;  3U50 C;  3G71 A;  3CCQ A;  1STA A;  1KDC A;  5FJ8 G;  4KHP L;  1M1K C;  3NK9 A;  3QO2 A;  3SGI A;  2WKC A;  4AQY L;  3RN5 A;  2CH4 A;  1K83 B;  2O4X A;  3UE1 A;  4DK3 C;  4LMQ D;  1SRO A;  4J8Q A;  1J9O A;  1SE2 A;  4XXE A;  2Z0S A;  4EQ5 A;  3MVV A;  3CRL C;  3RZO H;  1QVC A;  3OWE B;  2K28 A;  2L11 A;  5GRO A;  1BQQ T;  2EYH A;  1XNR L;  4B9X A;  2VUM G;  1LAC A;  2L55 A;  3X3M A;  3MTS A;  1X3E A;  2RHS B;  3HRZ C;  2OEO A;  4A75 A;  1T9H A;  1B7Y B;  2J0T D;  3HS0 C;  3OYY A;  2MGS A;  1LT4 D;  2I5H A;  3TN2 A;  3GV3 A;  2O5J C;  2K14 A;  3GTG B;  2HQE A;  3BDL A;  2UXD Q;  5A35 A;  4EVO A;  1EIG A;  2YU9 H;  1C0A A;  2EZV A;  4ZUJ A;  4ABN A;  4K0K Q;  3BG3 A;  5JOB A;  1P16 A;  2XSC A;  3MXP A;  1WCM B;  2KBN A;  2V1C C;  3TBI B;  3CCJ A;  2F0G A;  4CKE A;  2ID0 A;  4EGV A;  3M85 A;  2I07 B;  3CPF A;  5COR A;  1XPU A;  2K5V A;  4L6T B;  4A3J H;  2PPB C;  1TWH B;  5BR8 Q;  1R9T B;  1DZ1 A;  2K50 A;  4HMI A;  3RUZ A;  2QW7 A;  3S1M H;  1IKL A;  2E76 C;  5C6A A;  5EPK A;  2B2Y C;  3K6O A;  1B9M A;  3KLS A;  1ML0 D;  3J7A F;  1LYL A;  4EQN A;  5C0X I;  2JEA I;  2JE6 I;  4A3L H;  1BOS A;  2HDM A;  1CSQ A;  5C3E G;  3C2P A;  1YJW A;  3I4N H;  4A93 G;  1ZXT A;  1JB7 A;  1H9J A;  4DGZ A;  1PYS B;  3HOV H;  1VQI A;  3TP6 A;  1ENC A;  1HUM A;  1G2S A;  4DUY Q;  4XYO A;  5KNB A;  3I73 A;  3CCM A;  1EYC A;  4DV6 Q;  2EOT A;  4GZY C;  1A3V A;  1FYC A;  5JVG 3;  1XPO A;  1SSO A;  1L0W A;  3SDZ A;  5KEE A;  4G7Z C;  1T5E A;  4PV1 C;  4GOP A;  4GN4 B;  2NN6 G;  5EPJ A;  3U4V A;  4XT3 B;  4C3H G;  3J81 c;  4DR6 Q;  3Q0A A;  2WB1 B;  2VW9 A;  1VQO A;  4UAI A;  3L0O A;  4JI6 Q;  2ATW A;  1EU3 A;  4X64 L;  3P75 A;  2R93 B;  1O7I A;  5JJK A;  2K33 A;  3QJY A;  2C9O A;  1NY4 A;  2K7V A;  4B3R L;  1ROD A;  1XNQ L;  1HH2 P;  3TSS A;  4Y7N B;  3KDF A;  4A3M H;  1X3P A;  3CU7 A;  1BCP B;  1N32 L;  1SYE A;  2A69 C;  1U4R A;  3DUZ A;  4DV7 Q;  3CCV A;  5DNF A;  3MHB A;  2YYZ A;  3TDQ A;  1PLF A;  3VYT A;  4DR4 L;  1HQM C;  5CMD A;  1E2V A;  4ZKC B;  2VUM H;  3S1N H;  1WOC A;  1Z9F A;  3FPP A;  5HGT A;  4JI1 L;  3J80 L;  3AQQ A;  1SMX A;  2IJ0 A;  4LF6 Q;  1Y69 U;  5G3L D;  1F2L A;  2RF4 A;  3J80 i;  1TWA B;  3GTK H;  5LMN W;  2R3Z A;  4EQP A;  2JA9 A;  1SYC A;  4JI4 L;  4A3D B;  1CUK A;  2UUA L;  3AFP A;  2DUD A;  5M5Y B;  1TWG B;  5BN4 A;  2I46 A;  1YJN A;  1JQY D;  3OW2 A;  2E2I B;  1XXG A;  4X66 Q;  1VCI A;  1PFM A;  2NVX H;  1HXY D;  3K5N A;  2XTI A;  2B63 H;  4BY7 B;  1EQT A;  1UEA B;  2F0N A;  1K0R A;  4YWK A;  2OWO A;  2NVT H;  2A5H A;  1PVO A;  2F0I A;  3HOU G;  3GTM H;  2PNR C;  3JAM L;  3LWE A;  4KY5 A;  1SYF A;  4A3K H;  4JI5 Q;  3CD6 A;  2L0C A;  3PIO A;  5A2Q E;  2J7Z A;  4A4I A;  4IJH A;  1MI2 A;  4ME5 A;  4A93 H;  5EKK A;  3JAM i;  5IE8 A;  3V05 A;  2GVA A;  4HIM A;  2OQK A;  3S1R B;  3H94 A;  4CHT B;  3AEV A;  5JEA J;  4I65 A;  2X69 A;  2F4V Q;  4DV2 L;  1YNJ D;  5IOD A;  3NXW A;  1WTP A;  2QF7 A;  4LFC Q;  3EBE A;  4WOR A;  3HP3 A;  4IUT A;  4PZ6 A;  1S5F D;  2ZXP A;  2HD3 A;  3S15 H;  5C44 B;  4DR1 L;  1WD1 A;  5IT9 E;  4K5V A;  3M7N A;  5EAY A;  2QCP X;  1J6Q A;  3Q6S A;  4PMB A;  3ND9 A;  4QIW E;  4F87 A;  1JE5 A;  5LMN L;  4A3E H;  2R92 B;  1G51 A;  1IBM Q;  5FLX E;  4R8I A;  1IW7 C;  1G91 A;  4H02 A;  4A3B B;  5KND A;  3S2D B;  4HJ7 A;  3GTQ H;  1S5D D;  2HQL A;  2AWO A;  5CBA E;  5I6Y A;  2B2U C;  1KNE A;  1HNZ Q;  2HHH Q;  5E1F A;  3VR3 A;  4IFD H;  1LAB A;  1STG A;  2QEJ C;  3F8T A;  1WTX A;  1PTO D;  4YHH Q;  3PIP A;  3GTP H;  2G9H D;  1I4Q A;  2FMC A;  3OTO Q;  1VDZ A;  4ZQ3 A;  1RHP A;  4TQU S;  3F2C A;  2PYK A;  1YIJ A;  1K8O A;  2EY5 A;  3OWF A;  4IOC A;  2ZTE A;  1WTQ A;  1ENF A;  3HKS A;  4AYB B;  2OXP A;  3I4L A;  1WD0 A;  2M9V A;  2UXD L;  2IPK D;  5IP7 G;  3WOE A;  4NXN Q;  4UHV A;  1CKO A;  4K0K L;  4HED A;  2RSN A;  1X56 A;  1O7L A;  2R7Z B;  4O2D A;  2QGQ A;  1DJR D;  1STE A;  4HAE A;  5KRU A;  1JJC B;  1WYD A;  1YEZ A;  1PFN A;  4HSP A;  4R4O A;  5KIX A;  3HOU H;  3T16 A;  3D6C A;  1KHI A;  5I4D A;  2CHB D;  2EYF A;  4WFN 3;  1ZYR D;  3BU2 A;  4FDB A;  3LX0 A;  4L63 B;  3A5Z B;  2Z6K A;  1F9P A;  3ZJY C;  1OXU A;  3BDO A;  3LGJ A;  1EUJ A;  4OON A;  3KLS X;  1VQL A;  5G3L F;  3ER0 A;  1EY0 A;  1RJT A;  4KHP Q;  2A6H D;  4P75 A;  1UE7 A;  2IX0 A;  3R8B A;  4FYD A;  4EQO A;  2PMZ E;  3OW7 A;  4K5X A;  4MHE A;  1Q8K A;  3M3Y B;  1PZJ D;  2MO1 A;  3IFT A;  1WCM H;  2RKS A;  2LFN A;  1EU4 A;  2VB2 X;  3EFX D;  4KKT A;  4DUY L;  1Q7Y C;  4NP5 A;  4ILW A;  3RLO A;  4DV6 L;  4UPA A;  3W1G A;  5ELE A;  2PW5 A;  1OXS C;  4K14 A;  1GKH A;  3DM1 A;  4ZUI A;  4CBV A;  2NN6 I;  3BZD B;  3CCR A;  3K0X A;  1XPR A;  1TWH H;  2PZU A;  1LM0 A;  4DR6 L;  3CCU A;  3K0Y A;  1SR3 A;  1CHQ D;  4CDD C;  4JI6 L;  4RCO A;  3QOL A;  1SE3 A;  2L4N A;  3OHX C;  1I4H A;  1Q8I A;  1E3P A;  2LXK A;  4CGY B;  1SXT A;  3QG1 A;  2WAQ E;  2PI2 E;  2PQA A;  4DNI A;  4C3J G;  1YHA A;  1JT8 A;  4XYQ A;  4BWG B;  2IL8 A;  2EYP A;  3KUP A;  2RCF A;  4DV7 L;  3HOZ G;  3A55 A;  5EKL A;  4KMU C;  1O7Y A;  3H3V C;  2FHT A;  2E5L L;  3T1H Q;  1L1O A;  2IHF A;  3U4Z A;  3J80 c;  1SJH D;  3U9O A;  3NWT A;  2RCN A;  2NB0 A;  4DF7 A;  4LF6 L;  1MSG A;  4O42 A;  3P20 A;  1Y1W G;  3H15 A;  4UP8 A;  1G2T A;  2K75 A;  1UWV A;  3CQZ B;  2JQO A;  3R3O A;  1HHV A;  5IP7 H;  2Z4I A;  1Y8O B;  1HQR D;  3CW2 C;  2Z6B A;  3NUC A;  3RD4 A;  1TVX A;  1BUV T;  1Q1E A;  4JVZ A;  2IY5 B;  2OQ0 A;  2WIN B;  3K7U C;  4L5R C;  4P72 A;  5GAG C;  3PQI A;  2ZJR A;  3S14 B;  3W5O A;  4TSS A;  3H3V H;  3FRP B;  4G7O C;  1C7Y A;  2WKD A;  4Y7N H;  2AQ3 B;  1SNP A;  4GN3 B;  3DWP A;  4LUZ A;  3KYH C;  2ES2 A;  4X66 L;  5IYD H;  3LWU A;  4P74 A;  2K4K A;  4A3I G;  1QG7 A;  3MEF A;  3MWY W;  1WTV A;  1VQD A;  2F0U A;  1X9N A;  3SVM A;  1CM9 A;  2D62 A;  3SK4 A;  5J1Z A;  1EIY B;  1EY5 A;  1F9Q A;  3ERS X;  2B2W C;  2EJG C;  2LY7 A;  2JSO A;  4C3I B;  3VYU A;  3NQT A;  1B3Q A;  1X55 A;  1A0I A;  3JAM c;  2KOL A;  1W3S A;  3F2U A;  3DM3 A;  4I7A A;  1PTO C;  2EYL A;  4A3F B;  1QUQ B;  3NEL A;  3I4M G;  5KYL A;  1TWA H;  4JI5 L;  1GJX A;  1H9S B;  4KK7 A;  3J7Y W;  1BXT A;  5FO7 B;  2EDG A;  1KC8 C;  1AZQ A;  1N32 Q;  4HJ9 A;  2MO0 A;  1L0X B;  1STB A;  2ZTC A;  4X62 Q;  1TWG H;  2F0E A;  2F0O A;  3OIP A;  4JOI A;  1CA5 A;  5D14 A;  4DU9 A;  4JCV E;  2F4V L;  1DD2 A;  2B8G A;  5C5L A;  1L2F A;  3SR1 A;  1PTO H;  1NTG A;  4K2K A;  4BY7 H;  4LFC L;  3HOW B;  3BZK A;  5DM6 3;  3HKZ E;  2JA7 G;  1FNU A;  1A2U A;  1CKN B;  5JEA H;  4LF4 Q;  4DAP A;  3E0J A;  1MSH A;  4MN3 A;  3RNU A;  1PRT F;  2N8N A;  3FEW X;  4XQJ A;  4DK6 C;  2F3I A;  3OOC A;  3SEB A;  3FMC A;  4TRD A;  4JI0 Q;  3T51 B;  1IBM L;  3TS0 A;  4OL7 A;  1BVS A;  2NZH A;  1DYQ A;  4HCE A;  2M2L A;  3NEM A;  3HOZ H;  1KAW A;  1Q46 A;  3GTJ B;  2SNM A;  4OEL B;  1VQ6 A;  2IX1 A;  5CV6 A;  4DXG A;  1LTI D;  4HJ8 A;  5C3E B;  2E2J B;  2A6H C;  1HNZ L;  2HHH L;  2WFW A;  1KIX A;  1I6H B;  3A54 A;  2VL6 A;  4GKJ Q;  4YHH L;  3CCL A;  1ICF B;  1KLU D;  4A3J G;  2D0O A;  2K5H A;  2F03 A;  3D4W A;  5K36 H;  2KHJ A;  4IUU A;  3K5M A;  4CJ2 C;  1SYD A;  3AFQ A;  2JA6 B;  2EVB A;  2SEB D;  1J8I A;  3GDE A;  2R92 H;  4LW1 A;  5DEH A;  1TS2 A;  1Z7T A;  2KEN A;  4PMW A;  3T4A C;  4F8M A;  1IL8 A;  1ET9 A;  2I5M X;  2L12 A;  4LF5 Q;  1DOK A;  2NTT A;  4ODG A;  4P71 A;  3MAQ A;  4NXN L;  2UXB Q;  2VZA A;  4IUP A;  3FKI B;  4A3L G;  3H0G B;  1D1I A;  3KLR A;  4A3B H;  2R6G A;  3GO5 A;  2NTS A;  3P1H A;  2IWH A;  2XWJ B;  3H3V I;  3HOV G;  3PUZ A;  4CKB A;  1LT5 D;  1TS3 A;  4DFA A;  2E74 C;  2CQA A;  1KDB A;  2F0Q A;  2G9D A;  1BBU A;  1KAA A;  4K2L A;  2VQE Q;  4BBR B;  5GAD C;  1HA6 A;  4LF9 Q;  5IOC A;  3I4M H;  5GAE C;  3EJI A;  4JV5 Q;  3SXH A;  3PSI A;  5IT9 L;  1I3Q B;  4QMG A;  1KXL A;  4ULL A;  4YCW A;  4HJA A;  1HFG A;  2JK8 A;  3G48 A;  2Y0S E;  5FLX L;  1A8V A;  4IQZ A;  1Y1V G;  2PQE A;  1VQC A;  1YHB A;  1FJG Q;  5IGB A;  1GUG A;  3K80 C;  1X3F A;  2WII B;  4A3M G;  2EJF C;  1RCV D;  4IUV A;  2R7Z H;  1PA6 A;  2JA7 H;  1GUW A;  1A63 A;  1TXY A;  1V1P A;  3NTK A;  2Q8I B;  4F88 A;  2OTJ A;  3W3A A;  1CZW A;  2JEB I;  1H9K A;  3KBG A;  5IWA Q;  4NXM Q;  1WJJ A;  4YWL A;  3FP9 A;  1OTC A;  4GNX C;  3F2D A;  2DGY A;  2F3W A;  3HGB A;  4XQN A;  4OIK A;  5FO8 B;  5C3X A;  5IGG A;  4BXX H;  1NCV A;  2RDF A;  1PH7 A;  4JPB W;  3CME A;  3KOJ A;  4DAV A;  4BY1 H;  3M3Y H;  4PQX A;  4CKC A;  4RG1 A;  3GV6 A;  5AFW A;  1JOQ A;  5JJI A;  2WAQ G;  4HMJ A;  3PUV A;  3NBH A;  5HGQ A;  2UXC Q;  1PH9 A;  1SNQ A;  3UDX A;  4FO2 A;  3MXG A;  1U9R A;  2B63 G;  3AB9 A;  3T1H L;  1YZ6 A;  3K81 C;  1HZ9 A;  1IW7 D;  2EY1 A;  4RKB A;  5M3F B;  1FGB D;  3T13 A;  4JI3 Q;  1TWF B;  3I90 A;  1VQE A;  1EFI D;  4FXD A;  1HNX Q;  1S5E D;  2O2L D;  4IPC A;  1M90 C;  2VB3 X;  4JYA Q;  1VQ9 A;  1NMG A;  1XMO Q;  2RDH A;  4A3K G;  3PGZ A;  1ASZ A;  1B1Z A;  1F77 A;  2OCE A;  2AQ1 B;  4R4C A;  5FLM H;  3CKI B;  1QE6 A;  1I5F A;  4ZYS A;  1E0B A;  1SFO H;  3HOY G;  1KDA A;  4LF8 Q;  1UUP A;  1K73 C;  1PH2 A;  1E24 A;  2RHQ B;  1B44 D;  2VNU D;  4OXP A;  1B4O A;  2ICE C;  1LTG D;  5CV5 A;  3J81 j;  4YWM A;  2XVS A;  2GVB A;  1YJ9 A;  4CJ1 B;  3NTH A;  5I9O A;  3PO2 B;  1S4Z A;  3RN2 A;  2TSS A;  4C1N I;  1HUN A;  4DK0 A;  5K5P A;  1K0S A;  2ICI A;  3GD7 A;  3VR5 A;  1ET6 A;  1Y1V H;  4RH6 A;  1GD7 A;  4GNX A;  2NVY B;  4A3E G;  4HIK A;  1PYW D;  1JCK B;  4KKU A;  1PFS A;  1X65 A;  5JPN C;  1QB5 D;  1F9R A;  2VQF L;  2F0W A;  3KF6 A;  3PO3 B;  3ITP A;  4KD3 A;  4X62 L;  5C4X G;  3IFD A;  2F0L A;  4KV6 A;  2EQS A;  2EXZ A;  4K5W A;  1CA6 A;  1WTW A;  2E5L Q;  1U4M A;  4IFD G;  3D0F A;  4OWT B;  1EOV A;  1OXT A;  2NVQ B;  4UP7 A;  5EPL A;  4IUR A;  2R61 A;  4C3I H;  2UUC L;  3ERQ A;  1FNV A;  4LF4 L;  1HPC A;  4RAU C;  4N8F A;  1KD1 C;  3HKZ G;  4LWC A;  3V96 A;  2B2Y A;  4MTK A;  2D2C C;  4IPD A;  4X3U A;  4A3F H;  1EQV A;  1XTC D;  1YBY A;  2GA4 B;  1PHJ A;  3T1Y Q;  4JI0 L;  1UAP A;  2MUY A;  5JJL A;  2B8F A;  2BOS A;  1A3U A;  4RHR A;  2F0P A;  5M3M G;  3WOF A;  2EJM A;  1AE2 A;  4RGN A;  2ALY B;  1X3G A;  5CBE E;  1CI3 M;  3S1Q H;  3ICE A;  3IRB A;  4CJ0 B;  4M8A A;  2XWB B;  1JE4 A;  1EQQ A;  5IYC H;  3A7A B;  4ZAI A;  1IYU A;  4MTN A;  2DNC A;  3VYR A;  2M00 A;  4WJ3 M;  1AP0 A;  5ELF A;  5HY6 A;  4GKJ L;  3CHB D;  3FDT A;  3HOW H;  1W2B A;  1C48 A;  4X3K A;  4OIJ A;  2VY3 A;  2FJ2 A;  1H95 A;  2JN4 A;  5LMU Q;  3MXN B;  1YVC A;  3GTL B;  5CGK A;  1HZB A;  4Z9C B;  1JOK A;  4P73 A;  3A5U A;  3K7A B;  3STB D;  3QR8 A;  1F2Y A;  4AYB E;  2H4O A;  3B6Y A;  1UE1 A;  4PG3 A;  2JA8 B;  3HOY H;  2NBF A;  4B9W A;  4LF5 L;  1WTH A;  1BCP D;  3Q23 A;  1U4P A;  2WP8 J;  5J39 A;  2KHI A;  1B9N A;  2UXB L;  2KCM A;  4BBS H;  2Z9H A;  3RZD B;  2K6A A;  3W2D A;  4RGO S;  3VR2 A;  3X3N A;  3E9H A;  3U9S A;  1EYA A;  1Q12 A;  4LUO A;  1LTT D;  1M4V A;  1WCM G;  1A3T A;  1WI5 A;  1HCZ A;  1E1T A;  5LL6 S;  2BE5 C;  2E2H B;  2PI2 A;  1YNX A;  2JA5 B;  2VQE L;  1K3B C;  4LF9 L;  1ILP A;  2KJX A; 
#chains in the Genus database with same CATH homology
 5M9O A;  1O78 A;  2NUC A;  1G29 1;  1QIL A;  3G6J B;  2PZW A;  2NYZ D;  1LTR D;  4XDX A;  3VR6 A;  1A2T A;  1PRT B;  3K5O A;  3VR4 A;  1EY4 A;  4DXF A;  2KQ3 A;  3SK5 A;  2LKV A;  1EY8 A;  4OGQ C;  1DCZ A;  3IL8 A;  1KNA A;  3DHQ A;  3KF8 A;  3R2T A;  4KI0 A;  4HSV A;  1CHP D;  4RGT A;  1G6Z A;  1D1K A;  5C0X J;  2KEC A;  3IAY A;  1EOT A;  4K8I A;  5T1I A;  1D2B A;  4X3T A;  2AQ2 B;  2N55 A;  2EYM A;  3OSO A;  2BCO A;  5CC4 A;  4KY7 A;  3BS1 A;  3GTO B;  1HA5 A;  2F0S A;  3EVQ A;  3PUX A;  2FMM A;  4OO1 H;  1F2Z A;  1CQV A;  3RZO B;  1PDQ A;  2ZXR A;  5C4H A;  5E3F A;  3I3C A;  4C1N K;  4DAY A;  3FVQ A;  4BS9 A;  2IT1 A;  1TWC B;  5EKI A;  3TME A;  2B2U A;  1SBB B;  1GOZ A;  3S17 B;  2JYO A;  1XYI A;  3HOX B;  5KYI A;  3I91 A;  3P7J A;  1MD2 D;  2B2T C;  2F0T A;  3TP8 A;  4RKL A;  3KK7 A;  1MBY A;  1NSN S;  4QCL A;  4RCN A;  1ESF A;  2RA4 A;  5JEA G;  4A3J B;  3VYS A;  5E4X A;  2KCN A;  3BVZ A;  1RF2 D;  3NBI A;  3S2H B;  5EQ0 A;  1G8Z D;  2TMP A;  1Q90 A;  1PMR A;  1BCP F;  1S5C D;  1CQF A;  1OXV A;  4IFD I;  1HTL D;  4LJZ C;  5TSS A;  3I4N B;  1CZG A;  1BCP C;  4K6L A;  1V8Q A;  4FXG C;  1EWC A;  1D5X C;  5CYU A;  2DNE A;  5K36 G;  4KY6 A;  5IGE A;  3I72 A;  2FIN B;  5ELD A;  3OMC A;  3D6W A;  4J1M A;  4QUF A;  4A3G B;  3CRK C;  5FKA C;  3J7A V;  1ONL A;  1STY A;  3DMU A;  3NQI A;  4KJO A;  5KNC A;  1IKM A;  1SNC A;  1TII D;  4S3S A;  1EZ6 A;  1GUO A;  1ICW A;  2L5T A;  1EYD A;  1PTO F;  5CV7 A;  2PMZ B;  3M7G A;  1W6K A;  2ENB A;  4K8J A;  5EBC A;  1SMY D;  2VUM B;  2XIW A;  3TZD A;  5IIF A;  3LNN A;  1EEF D;  2A6E D;  4Q0F A;  1TS4 A;  4KHV A;  2SNS A;  3K57 A;  5C5M A;  1C8C A;  2E2D C;  1XX8 A;  2B39 A;  1FD7 D;  3PUY A;  1R4P B;  1KAB A;  4NKL A;  1I4R A;  4HN7 A;  4H7B A;  4DNR B;  3VA7 A;  3L3O C;  1TU2 B;  2XNA C;  3DEO A;  1B50 A;  5DAU A;  2DY8 A;  1GUN A;  2BA1 A;  3OPO A;  2PCF B;  3UI2 A;  3RMH A;  5ELB A;  2NVT B;  4FF3 A;  2MJ8 A;  3M4Y A;  4H13 C;  1GHJ A;  3MEH A;  3GTM B;  3H09 A;  4U68 A;  5J22 A;  4KJN A;  2EY6 A;  4XIG S;  3C1F A;  4QF4 A;  2KEE A;  3D4R A;  2O5I C;  4A93 B;  2F0V A;  1SEB D;  2B2W A;  1SNM A;  2JXM B;  2AUJ D;  4TKO B;  4JBW A;  4C3H B;  1NR2 A;  2OF1 A;  5EBD A;  3T53 B;  3S15 B;  1RTN A;  1GUS A;  2X6G A;  5BN3 A;  2J4X A;  1QCB D;  3GQB A;  3DWA A;  4Q5V A;  2MP1 A;  5I2Y A;  5I9P A;  1TY2 A;  1AZP A;  5C0X H;  5JJZ A;  5ELC A;  3HEJ A;  4XQQ A;  2E75 C;  3NHH A;  4PMC A;  4DK1 A;  2PZT A;  3GTQ B;  3SK6 A;  3HG9 A;  1BDO A;  2N88 A;  1TR5 A;  3NPP A;  4HR7 B;  4C2M B;  2A73 B;  2F0D A;  2K5D A;  3GTP B;  3I70 A;  4IUN A;  1LV9 A;  2BDN A;  1SJE D;  2KED A;  4WRD A;  3MA2 B;  3PIO 3;  1GXD C;  3M4O B;  1VMP A;  2ZT9 C;  3A8J E;  2MHV A;  3GP7 A;  3WDN A;  1DOM A;  3BVG A;  4HTH A;  3R93 A;  5CV4 A;  4NDX A;  1JWS D;  2K04 A;  4KN4 C;  3HOU B;  5D3I B;  4C3I G;  1EL0 A;  1B3A A;  1VF5 C;  5EGT A;  1LLR D;  1OO9 B;  1SMY C;  2BE5 D;  1WTO A;  2A6E C;  2K1B A;  2K01 A;  3Q22 A;  1AFP A;  2KCC A;  2VXW A;  2RSO A;  1EY7 A;  1QOH A;  2EY2 A;  2QIL A;  1YNN D;  5T1G A;  2V4D A;  1TKW B;  2HDL A;  3PIP 3;  3S16 B;  1BBX C;  4J6H A;  1II3 A;  4DNT B;  4LK1 C;  1I4X A;  2SOB A;  3NP8 A;  1STH A;  3BDC A;  4KHZ A;  5FOB B;  3AU7 A;  1CT1 D;  1H9M A;  2CW0 D;  2LS0 1;  1C4Q A;  5LHY 1;  1I4P A;  1EWH A;  1I50 B;  2Y0S B;  3SE0 A;  3URY A;  1QWY A;  4QB4 A;  4R8N A;  4XT1 B;  1BNZ A;  3PV0 A;  1CK1 A;  5HUR A;  3H6M A;  5I2X A;  1KLG D;  3MZ5 A;  3J81 E;  3S9W A;  1EY9 A;  2C5C A;  1PXU A;  4M1U B;  1PZK D;  2LMC B;  1RKN A;  2K05 A;  4H0L C;  3MXU A;  4RGM A;  1IHZ A;  1JOO A;  1STN A;  1SYG A;  3ERO A;  3G7L A;  4FP5 D;  4C56 C;  2B2V C;  1PZI D;  1B2T A;  5JPM C;  2Q8R E;  3DWQ A;  4IZ8 A;  3MFG A;  1LT3 D;  4BA1 I;  3TP5 A;  1QNK A;  1K8M A;  2AUK A;  4QUC A;  5JAV A;  2KHS A;  3A56 A;  5CV8 A;  3DXJ C;  1X32 A;  4V0B A;  3QIA A;  4I7Z C;  3ONA B;  3D31 A;  4LAA A;  1JB3 A;  4WJW A;  1F2M A;  1CFM A;  2KUM A;  2H1E A;  4FF1 A;  3A7L A;  2XRS D;  4U67 3;  3FPU B;  5FO9 B;  1NR4 A;  2X6L A;  1KTK A;  2IX3 A;  1LO5 D;  3BVM A;  4O1N A;  1Z6H A;  2PW7 A;  1I6V C;  3EQL C;  4OO1 G;  1PTO B;  1T5X D;  2XN9 C;  1EZ8 A;  5M5X B;  2SDF A;  1LTA D;  5M5W B;  3IKJ A;  2DN8 A;  1NAP A;  1FNW A;  5NUC A;  1DOL A;  1E2W A;  1AEX A;  1JWM D;  2K5W A;  1H9S A;  4C3J B;  1WTR A;  4R9W A;  1O7Z A;  3HOZ B;  2B2V A;  1BO0 A;  2BA0 A;  3SK8 A;  2DY7 A;  2NN6 H;  4G7H C;  1NUC A;  2L1B A;  1UNS A;  1Y1W B;  3D4D A;  2A68 D;  4RHS A;  5I6W A;  1YNN C;  1ENA A;  1QNU A;  2F0M A;  3K58 A;  3MFY A;  1L0Y B;  1JR0 D;  3AMU A;  1VF7 A;  1DM0 B;  4N9P A;  2EYO A;  3R2I A;  1V1P B;  1W6J A;  2F4I A;  3TZU A;  4A3I B;  4ZRZ A;  3C46 A;  1LT6 D;  1RDP D;  2CW0 C;  3L7Z C;  4KTA A;  4RA8 A;  4UDU C;  1R4Q B;  3SHL A;  1ZKO A;  3I4M B;  3A8I E;  1F9S A;  3OIQ A;  3D3R A;  2K03 A;  4ID6 A;  1JIC A;  4BA2 I;  2Z4H A;  2EPB A;  4DA2 A;  4HCS A;  1AN8 A;  3DEP A;  4F7X A;  3PUW A;  3T56 B;  1E2Z A;  1GHK A;  2Q8T A;  3C3L A;  2K5Q A;  4MIU A;  3PMF A;  1SND A;  4E6I A;  1HFN A;  1D5M C;  2XRQ D;  2JA7 B;  3EA6 A;  2F0K A;  1TS5 A;  2F1M A;  1TY0 A;  1I4G A;  1OXX K;  3NSW A;  1EIH A;  2D5D A;  3Q24 A;  1PRT D;  5COY A;  4QIW B;  2F3V A;  1GUT A;  1ZEQ X;  1SE4 A;  4ZLT F;  2YU9 B;  1RD9 D;  2IW3 A;  1XWE A;  4KD4 A;  1JOR A;  2PO4 A;  3RLF A;  4BY1 B;  1DON A;  2EYJ A;  2RBM A;  3E6Z X;  4RWS C;  3BYY B;  3H91 A;  5IGC A;  1BR9 A;  3S1M B;  2KA7 A;  1FR3 A;  4FF2 A;  5LL6 X;  2RDG A;  4K6D A;  3E5S A;  1TT2 A;  2BDO A;  1H9R A;  4FXK C;  1IYV A;  4XTC S;  3HOV B;  3D8G A;  1M8A A;  1SFO B;  5C4Z A;  1CTM A;  4IAL A;  3ND8 A;  2ZXO A;  4IUQ A;  1BF4 A;  3TP7 A;  4P2C B;  2CVR A;  4KKS A;  4FVM A;  1U4L A;  3J80 E;  5JVH 3;  2RVL A;  2WV6 D;  1A15 A;  1SDF A;  5CR3 A;  1TQO A;  1ILQ A;  1YNJ C;  2F0H A;  5E4W C;  4PNY A;  2AWN A;  1Y1V B;  2OT2 A;  2QKI C;  2FFK B;  1EEI D;  5C0X G;  2A68 C;  3QWN A;  2EE1 A;  4A3M B;  4FNF A;  2B2T A;  4B08 A;  2WAC A;  2L9H A;  3K5L A;  3S1N B;  1B53 A;  5F2D A;  3NTI A;  4OO1 I;  4G4K A;  1D5Z C;  1SYB A;  1QJO A;  3JAM E;  4G57 A;  3J81 L;  3GTK B;  2A74 C;  3O13 A;  5KGU A;  4NMZ A;  4V19 0;  4N9T A;  5DM7 3;  1A6X A;  1Y8N B;  4H44 C;  2WAQ B;  1MGS A;  2NVX B;  5EJW A;  3S1Q B;  2MPM A;  4JK1 C;  2B63 B;  5IGF A;  5D3D A;  4DN4 M;  3V2T A;  2Z8L A;  3N52 A;  1S5B D;  4ZK9 B;  4ZKB B;  4OHJ A;  3NE5 B;  1JC7 A;  4A3K B;  2KVM A;  1SNO A;  2HCI A;  2NWG A;  5ISR A;  1AW7 A;  1PFB A;  1HTP A;  4RFB A;  5FK9 C;  5BN5 A;  3L9A X;  1LTB D;  5C3W A;  1ZYR C;  3HOY B;  1PRT C;  1Q3L A;  1ESR A;  2RQX A;  3ZYY X;  2HUG A;  4BBS B;  3K59 A;  5CV9 A;  1HRJ A;  1V43 A;  1Q1B A;  2K32 A;  4L8J A;  2JP1 A;  3KBX A;  1Z47 A;  3QB3 A;  4A3E B;  3MXN A;  3OMG A;  2A69 D;  4YIJ A;  3NWS A;  2HCC A;  5C4X B;  1JWU D;  1Y8P B;  4IN3 A;  3MC0 B;  5A2Q L;  1V1O A;  3N6R A;  1X3Q A;  2NZ1 D;  5D65 A;  3A8K E;  2D9U A;  1RTO A;  2F0F A;  3BYT B;  3HZX A;  3VA5 A;  2F0J A;  3I8Z A;  4X3S A;  1EY6 A;  2Z1C A;  2QDB A;  3C1E A;  3HKZ B;  4FF4 A;  5IGD A;  1O80 A;  3QOJ A;  1WVL A;  4NW2 A;  1DXM A;  1LTS D;  4KN7 C;  4IFD J;  5M3M B;  1SAP A;  1VMC A;  1D6E C;  5C4J B;  1STA A;  1KDC A;  3NK9 A;  3QO2 A;  2WKC A;  1K83 B;  2O4X A;  4LMQ D;  4J8Q A;  1J9O A;  1SE2 A;  4XXE A;  3MVV A;  3CRL C;  3OWE B;  2K28 A;  2L11 A;  1BQQ T;  2EYH A;  4B9X A;  1LAC A;  2L55 A;  3X3M A;  3MTS A;  3HRZ C;  2OEO A;  2J0T D;  3HS0 C;  2MGS A;  1LT4 D;  3TN2 A;  3GV3 A;  2O5J C;  3GTG B;  2HQE A;  3BDL A;  5A35 A;  4EVO A;  1EIG A;  2EZV A;  4ZUJ A;  4ABN A;  3BG3 A;  5JOB A;  2XSC A;  3MXP A;  1WCM B;  3TBI B;  2F0G A;  4CKE A;  2ID0 A;  4EGV A;  3M85 A;  2I07 B;  5COR A;  4L6T B;  2PPB C;  1TWH B;  1R9T B;  1DZ1 A;  4HMI A;  3RUZ A;  1IKL A;  2E76 C;  5C6A A;  5EPK A;  2B2Y C;  3K6O A;  1B9M A;  3KLS A;  1ML0 D;  3J7A F;  4EQN A;  5C0X I;  2JEA I;  2JE6 I;  1BOS A;  2HDM A;  3C2P A;  1ZXT A;  1H9J A;  4DGZ A;  3TP6 A;  1ENC A;  1HUM A;  1G2S A;  4XYO A;  5KNB A;  3I73 A;  1EYC A;  2EOT A;  4GZY C;  1A3V A;  1FYC A;  5JVG 3;  1SSO A;  3SDZ A;  5KEE A;  4G7Z C;  1T5E A;  4PV1 C;  4C3H G;  2NN6 G;  5EPJ A;  4XT3 B;  3Q0A A;  2WB1 B;  4UAI A;  1EU3 A;  3P75 A;  2R93 B;  2K33 A;  3QJY A;  2C9O A;  2K7V A;  1ROD A;  3TSS A;  4Y7N B;  1X3P A;  3CU7 A;  1BCP B;  1SYE A;  2A69 C;  1U4R A;  3DUZ A;  5DNF A;  3MHB A;  2YYZ A;  3TDQ A;  1PLF A;  3VYT A;  1HQM C;  5CMD A;  1E2V A;  4ZKC B;  3FPP A;  5HGT A;  3J80 L;  2IJ0 A;  1Y69 U;  5G3L D;  1F2L A;  1TWA B;  2R3Z A;  4EQP A;  1SYC A;  4A3D B;  5M5Y B;  1TWG B;  5BN4 A;  2I46 A;  1JQY D;  2E2I B;  1XXG A;  1VCI A;  1PFM A;  1HXY D;  3K5N A;  4BY7 B;  1EQT A;  1UEA B;  2F0N A;  2A5H A;  2F0I A;  2PNR C;  3JAM L;  3LWE A;  4KY5 A;  1SYF A;  2L0C A;  5A2Q E;  2J7Z A;  1MI2 A;  4ME5 A;  5EKK A;  3V05 A;  3S1R B;  3H94 A;  4CHT B;  5JEA J;  4I65 A;  2X69 A;  1YNJ D;  5IOD A;  3NXW A;  1WTP A;  2QF7 A;  4WOR A;  3HP3 A;  4IUT A;  1S5F D;  2ZXP A;  5C44 B;  1WD1 A;  5IT9 E;  4K5V A;  3M7N A;  2QCP X;  3Q6S A;  4PMB A;  3ND9 A;  4F87 A;  2R92 B;  5FLX E;  4R8I A;  1IW7 C;  1G91 A;  4A3B B;  5KND A;  3S2D B;  1S5D D;  2AWO A;  5CBA E;  5I6Y A;  2B2U C;  1KNE A;  5E1F A;  3VR3 A;  4IFD H;  1LAB A;  1STG A;  2QEJ C;  1WTX A;  1PTO D;  2G9H D;  1I4Q A;  2FMC A;  1VDZ A;  4ZQ3 A;  1RHP A;  4TQU S;  2PYK A;  1K8O A;  2EY5 A;  3OWF A;  1WTQ A;  1ENF A;  4AYB B;  2OXP A;  3I4L A;  1WD0 A;  2M9V A;  2IPK D;  3WOE A;  4HED A;  2RSN A;  1O7L A;  2R7Z B;  1DJR D;  1STE A;  4HAE A;  5KRU A;  4HSP A;  1PFN A;  5KIX A;  3T16 A;  3D6C A;  5I4D A;  2CHB D;  2EYF A;  4WFN 3;  1ZYR D;  3LX0 A;  4L63 B;  1F9P A;  1OXU A;  3BDO A;  3KLS X;  5G3L F;  1EY0 A;  1RJT A;  2A6H D;  3R8B A;  2IX0 A;  4FYD A;  4EQO A;  4MHE A;  3OW7 A;  4K5X A;  3M3Y B;  1PZJ D;  3IFT A;  2RKS A;  2LFN A;  1EU4 A;  2VB2 X;  3EFX D;  4KKT A;  4NP5 A;  4ILW A;  5ELE A;  2PW5 A;  1OXS C;  4K14 A;  3DM1 A;  4ZUI A;  4CBV A;  2NN6 I;  3BZD B;  2PZU A;  3K0Y A;  1CHQ D;  4RCO A;  3QOL A;  1SE3 A;  2L4N A;  3OHX C;  1I4H A;  1Q8I A;  4CGY B;  1SXT A;  3QG1 A;  4C3J G;  4XYQ A;  4BWG B;  2IL8 A;  2EYP A;  3KUP A;  3A55 A;  5EKL A;  4KMU C;  1O7Y A;  3H3V C;  2FHT A;  1SJH D;  3U9O A;  3NWT A;  2NB0 A;  4DF7 A;  1MSG A;  4O42 A;  3P20 A;  1G2T A;  3CQZ B;  3R3O A;  1HHV A;  2Z4I A;  1Y8O B;  1HQR D;  3NUC A;  3RD4 A;  1TVX A;  1BUV T;  1Q1E A;  2WIN B;  3S14 B;  4TSS A;  3FRP B;  4G7O C;  2WKD A;  2AQ3 B;  1SNP A;  3DWP A;  3LWU A;  1QG7 A;  3MWY W;  1WTV A;  2F0U A;  3SVM A;  1CM9 A;  2D62 A;  3SK4 A;  5J1Z A;  1EY5 A;  1F9Q A;  2B2W C;  2EJG C;  2LY7 A;  2JSO A;  4C3I B;  3VYU A;  3NQT A;  2KOL A;  3F2U A;  1PTO C;  2EYL A;  4A3F B;  5KYL A;  1GJX A;  1H9S B;  4KK7 A;  3J7Y W;  1BXT A;  5FO7 B;  2EDG A;  1AZQ A;  1L0X B;  1STB A;  2F0O A;  2F0E A;  3OIP A;  1CA5 A;  5D14 A;  4DU9 A;  1DD2 A;  2B8G A;  5C5L A;  3SR1 A;  1PTO H;  4K2K A;  3HOW B;  5DM6 3;  1FNU A;  1A2U A;  5JEA H;  4DAP A;  3E0J A;  1MSH A;  4MN3 A;  1PRT F;  3FEW X;  4XQJ A;  3OOC A;  3SEB A;  3FMC A;  4TRD A;  3T51 B;  4OL7 A;  4HCE A;  1DYQ A;  2M2L A;  3GTJ B;  2SNM A;  2IX1 A;  5CV6 A;  4DXG A;  1LTI D;  2E2J B;  5C3E B;  2A6H C;  1I6H B;  3A54 A;  1KLU D;  2F03 A;  3D4W A;  5K36 H;  4IUU A;  3K5M A;  4CJ2 C;  1SYD A;  2JA6 B;  2EVB A;  2SEB D;  1J8I A;  5DEH A;  1TS2 A;  1Z7T A;  4PMW A;  4F8M A;  3T4A C;  1IL8 A;  1ET9 A;  2L12 A;  1DOK A;  2NTT A;  4ODG A;  3MAQ A;  4IUP A;  3FKI B;  3H0G B;  1D1I A;  3KLR A;  2R6G A;  3GO5 A;  2NTS A;  3P1H A;  2IWH A;  2XWJ B;  3PUZ A;  4CKB A;  1LT5 D;  1TS3 A;  4DFA A;  2E74 C;  2CQA A;  1KDB A;  2F0Q A;  2G9D A;  1KAA A;  4K2L A;  4BBR B;  1HA6 A;  5IOC A;  3EJI A;  3SXH A;  5IT9 L;  1I3Q B;  4QMG A;  4ULL A;  1HFG A;  5FLX L;  4IQZ A;  2PQE A;  5IGB A;  1GUG A;  2WII B;  2EJF C;  1RCV D;  4IUV A;  1GUW A;  1V1P A;  3NTK A;  2Q8I B;  4F88 A;  3W3A A;  1CZW A;  2JEB I;  1H9K A;  3KBG A;  2F3W A;  3HGB A;  4XQN A;  4OIK A;  5FO8 B;  5C3X A;  5IGG A;  1NCV A;  2RDF A;  4DAV A;  4PQX A;  4CKC A;  3GV6 A;  5AFW A;  1JOQ A;  4HMJ A;  3PUV A;  3NBH A;  1SNQ A;  4FO2 A;  3MXG A;  1U9R A;  3AB9 A;  1IW7 D;  2EY1 A;  4RKB A;  5M3F B;  1FGB D;  3T13 A;  1TWF B;  3I90 A;  1EFI D;  4FXD A;  1S5E D;  2O2L D;  2VB3 X;  2RDH A;  1B1Z A;  1F77 A;  2AQ1 B;  3CKI B;  1QE6 A;  4ZYS A;  1E0B A;  1KDA A;  1UUP A;  1B44 D;  2VNU D;  1B4O A;  2ICE C;  1LTG D;  5CV5 A;  2XVS A;  4CJ1 B;  3NTH A;  5I9O A;  3PO2 B;  1S4Z A;  2TSS A;  4C1N I;  1HUN A;  4DK0 A;  5K5P A;  2ICI A;  3GD7 A;  3VR5 A;  1ET6 A;  4RH6 A;  2NVY B;  1PYW D;  1JCK B;  4KKU A;  5JPN C;  1QB5 D;  1F9R A;  2F0W A;  3PO3 B;  3ITP A;  4KD3 A;  3IFD A;  2F0L A;  4KV6 A;  2EXZ A;  4K5W A;  1CA6 A;  1WTW A;  1U4M A;  4IFD G;  1OXT A;  2NVQ B;  5EPL A;  4IUR A;  2R61 A;  3ERQ A;  1FNV A;  1HPC A;  4RAU C;  3V96 A;  2B2Y A;  4X3U A;  2D2C C;  1EQV A;  1XTC D;  2GA4 B;  1UAP A;  2MUY A;  2B8F A;  2BOS A;  1A3U A;  4RHR A;  2F0P A;  3WOF A;  2EJM A;  4RGN A;  5CBE E;  1CI3 M;  4CJ0 B;  4M8A A;  2XWB B;  1JE4 A;  3A7A B;  4ZAI A;  1IYU A;  3VYR A;  2DNC A;  2M00 A;  1AP0 A;  5ELF A;  3CHB D;  3FDT A;  1C48 A;  4X3K A;  4OIJ A;  2FJ2 A;  3GTL B;  5CGK A;  4Z9C B;  1JOK A;  3K7A B;  1F2Y A;  2H4O A;  2JA8 B;  2NBF A;  4B9W A;  1BCP D;  3Q23 A;  1U4P A;  2WP8 J;  5J39 A;  1B9N A;  3RZD B;  2K6A A;  3W2D A;  4RGO S;  3VR2 A;  3X3N A;  3U9S A;  1EYA A;  1Q12 A;  1LTT D;  1M4V A;  1A3T A;  1HCZ A;  5LL6 S;  2BE5 C;  2E2H B;  2JA5 B;  1ILP A;  2KJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...