4J1MA

Crystal structure of staphylococcal nuclease variant delta+phs r105e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVEQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS R105E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4j1mA00
2F0UA 2F0OA 4PNYA 1KAAA 2PW7A 5KYIA 1A3UA 3QB3A 3QOLA 4NP5A 4KY6A 4ZQ3A 4IALA 4K5VA 3D4DA 4IUNA 3D6CA 3T13A 1U9RA 4KD3A 4R8NA 4ZUIA 1STNA 3PMFA 5KIXA 5ISRA 3EVQA 3NP8A 3OSOA 5CV7A 2RDFA 4DGZA 4E6IA 5KYLA 1A3VA 2PZUA 3MXPA 5IODA 4KV6A 5J22A 1JOQA 1F2ZA 4NMZA 5J1ZA 3HZXA 3V2TA 1KDBA 4KJNA 4K8IA 4KJOA 2EYJA 4H7BA 4HMIA 2EYPA 3SK4A 2SNMA 3MVVA 3U9OA 4EQNA 5IGFA 4MIUA 2EXZA 5C3WA 5CV6A 5HGTA 5IGEA 1STHA 1EQVA 2F0GA 4K6DA 4KTAA 5EGTA 3SK5A 2M00A 1RKNA 3T16A 3LX0A 5IGDA 2OEOA 3RUZA 2O4XA 4OL7A 2F3WA 5HURA 5CV5A 2WACA 3BDLA 4B9WA 1SYEA 4KD4A 1ENCA 5KGUA 1EY8A 4KY5A 5C6AA 1SNOA 1F2YA 2RBMA 2KHSA 4RKLA 2EYMA 3NUCA 2F0JA 1STBA 2F0QA 4J1MA 1SYGA 1KABA 4K14A 2F0MA 1SNMA 4QF4A 1EZ8A 5IGGA 4N9PA 5CV9A 2F0KA 4K2KA 4B9XA 4TRDA 5CR3A 4EQOA 1TR5A 1JOOA 2OF1A 5CC4A 1SYBA 2NUCA 4ME5A 4WRDA 5IIFA 3R3OA 5IGCA 5K5PA 3S9WA 3TP8A 3OWFA 5C5MA 5C3XA 1EY7A 1SYFA 3VA5A 3C1EA 3D8GA 1SNDA 3TMEA 1A2UA 1STGA 1JOKA 1SYCA 5I6WA 3ITPA 5DEHA 2F0SA 2SOBA 5DAUA 1EY4A 4EQPA 3DMUA 3SXHA 1KDAA 3SK6A 2PZWA 4NDXA 3DHQA 2F0LA 5NUCA 5J39A 5E1FA 3NQTA 4RKBA 1ENAA 1SYDA 5I9OA 4PMBA 2EYHA 3BDCA 2PZTA 3MHBA 4HTHA 4LAAA 5I6YA 1STAA 1NUCA 2RKSA 4HMJA 3TP6A 1SNCA 1EY5A 5CV8A 4PMCA 5JOBA 1EY0A 2ENBA 2F0NA 3HEJA 3MEHA 3OMGA 2PW5A 3P75A 4I65A 4K5XA 1SNQA 1JORA 2PQEA 3H6MA 5EKLA 1NSNS 3P1HA 1EYAA 3EJIA 3NHHA 3TP5A 5I9PA 5E3FA 4G57A 2F0WA 1II3A 3NK9A 2SNSA 4IZ8A 5C5LA 4F7XA 5C4ZA 5IOCA 2EYFA 4KY7A 4DFAA 1TQOA 4DF7A 2EYLA 4J6HA 2EY1A 2F0TA 2PYKA 4QMGA 1EY9A 2F3VA 1AEXA 4NKLA 2OXPA 3QOJA 1A3TA 4K8JA 2F0FA 2EY6A 1IHZA 3EROA 3OMCA 1F2MA 4ODGA 2EY2A 2LKVA 5EKKA 5CV4A 3NXWA 3SK8A 3TP7A 4F8MA 1STYA 1SNPA 3MZ5A 5KEEA 4K5WA 3C1FA 4EVOA 5F2DA 4KHVA 5JAVA 5KRUA 2F0IA 3SHLA 4YIJA 5IGBA 2F0VA 2F0DA 3ERQA 2EYOA 1EZ6A 2KQ3A 4ID6A 1EYDA 4N9TA 4K2LA 5M9OA 2F0EA 2F0HA 1EYCA 5C4HA 4S3SA 1A2TA 1EY6A 3D4WA 2F0PA 4WORA 1KDCA 1TT2A 2HQEA 4ZUJA 3SR1A 4DU9A 3E5SA 5CGKA 4QB4A 2EY5A 2QDBA
chains in the Genus database with same CATH superfamily
2AWNA 4PZ7A 3PIOA 2NWGA 2UUAL 1NAPA 4IALA 1SFOB 5JJKA 4A93B 1R4PB 1XWEA 2B8GA 1ZYRD 2RDFA 3OWEB 4C1NI 1VMCA 4H02A 2E2IB 4C3JG 3G6EA 1RIPA 3V2TA 1HUMA 3BZCA 3NE5B 2VUMB 1EWCA 1K9MC 5IGFA 5EGTA 3OTOL 2NZ1D 4BY7G 1DOLA 1S4ZA 5C0XI 2BA0A 4XT1B 5FK9C 4UP9A 1BCPC 3SEBA 3OIQA 4JI7Q 3ER0A 2RBMA 4OXPA 1AE2A 4IUTA 4P72A 1K8AC 4FNFA 4XQJA 2L1BA 1EWHA 3UDFA 4CGYB 4DR7L 5CC4A 3CCVA 1LLRD 2Y0SG 1TWAB 4NXNL 3S14B 3T51B 1YJNA 3C46A 1UEBA 2E76C 4UPAA 1HR0Q 3A7AB 4LFCQ 1OTCA 4K0KL 4GKJQ 2L0CA 4JI3Q 2FMMA 2RA4A 3BS1A 3FDTA 4GZYC 1XMQQ 3NSWA 2ENBA 1J5EL 2BH8A 3HEJA 4A3FB 3ICEA 4G57A 4KHPQ 1JWSD 2L4NA 1KL9A 2L11A 1EIGA 1YVCA 2EY1A 2A6ED 4QCLA 3KFUA 1G91A 4C3IB 3DEPA 3OMCA 4ODGA 5C44H 5M3FG 1BQQT 4R4IA 1X6OA 1Y14B 2EQSA 2ZM6L 3MZ5A 4K5WA 3GV6A 1CKMA 3F2DA 1IZ6A 5IGBA 1K83H 2VXWA 1LTGD 3TZUA 1T5EA 5FO9B 1SJHD 3A56A 2IX1A 1P8LA 4CDFC 1L0YB 2N55A 2Q8TA 1V1PB 1PH9A 3P20A 1Q86C 3BU2A 5AJ3L 1KAAA 3GV3A 1EFWA 3IAYA 1I4PA 4KD3A 4C56C 4A3CH 4Q0FA 4ZYSA 4H13C 1QUQA 2DJFC 5HY6A 2L12A 4KKSA 5ELOA 4LW1A 1KHIA 1PRTB 3TBIB 5KNDA 4MHEA 3TS0A 3HOUB 1OXTA 3H0GB 1EQVA 1SFOH 2JE6I 1Y1VB 4JYAL 4A93H 1B4OA 4AYBB 4AH6A 5CMDA 1Q82C 3K57A 5EJWA 4CKEA 1E2VA 1FJGL 4PZ8A 2E2IH 1NR2A 5I4DA 1RJTA 2FHTA 4UHVA 1BUVT 1TWHB 3HP3A 1EIFA 4L6TB 1CT1D 1D6EC 2VUMH 2R7ZG 3CQZB 1W6JA 1EZ8A 4JC0A 4QQBX 4G4KA 3VA5A 5JJZA 1A2UA 3PUVA 3R93A 1HA6A 1LTBD 4DR6Q 4PQXA 3S16B 3V05A 2K5VA 1LTID 3HOXB 2B63B 2QILA 2KVMA 1ENAA 4OWTB 1OXSC 1VQNA 2JXMB 4LAAA 3VA7A 2GA4B 2K5NA 1SNCA 5EBCA 4I65A 2PW5A 3HKZG 2ICEC 5ELEA 5FO7B 3P1HA 1WTRA 1HTPA 1VQLA 2F0WA 1L1OB 5C5LA 1Z7TA 3W2DA 1IBMQ 2MNAA 2LMCB 3DWAA 1IW7C 4LF9Q 2WV6D 1JB7A 2RHSB 3G7LA 4OGQC 4G7ZC 1IBLQ 4A3FH 1E1OA 2CCZA 2D9UA 1STYA 5BR8Q 1VQHA 3SHLA 4QIWE 1UNSA 3CAMA 4DR5L 1MKHA 4QL5A 2FJ2A 1I3QB 4WJ3M 2XWJB 4ZUJA 3KJPA 2F0PA 1HZCA 3G6JB 2J4XA 4P75A 4LNQA 3L2PA 2BCOA 2HHHL 2Z8LA 3E6ZX 5KYIA 1AN8A 1SDFA 4JVZA 4NP5A 5IP9G 1V1QA 4IURA 4A3EB 1IL8A 1K28A 4MNOA 4BBSB 1TKWB 1D7QA 3NP8A 3F2CA 3U9SA 5CYUA 2CH4A 2LSSA 3A54A 1N8RC 4K8IA 3EN2A 3MXNB 4MZ9A 3AEVA 2K5DA 1EIHA 1U0LA 2A6HC 3CCQA 5EPJA 4QGUA 2JEBI 4DUZQ 3BVMA 1RCVD 4DV0L 2NTSA 5HURA 2YTVA 4N8X1 4DAYA 2R92H 1PH6A 2B2YA 2JA5H 4DV4L 4DR1Q 2N3SA 4CJ2C 4TKOB 4LF5Q 4A3FG 5IP7G 3JAMi 1HZBA 3AB9A 3NENA 4EQOA 1QVCA 1TR5A 2OF1A 1X56A 1Y1VH 4NXML 2KA7A 3DWQA 1GUGA 4IPHA 3MA2B 4A3JB 4IJLA 3VR6A 4DV5Q 1H9KA 1TWHH 4C3IG 4HCEA 2IHFA 1HNXQ 2UUBQ 3CQZH 1GKHA 2IHEA 4HEDA 2V1CC 5NUCA 5E1FA 4A4IA 1SYDA 3W1GA 1PYBA 2UU9Q 4KHPL 1IYJB 4HMJA 5ELBA 2Y0SE 2Z9HA 5JOBA 1GO3E 3S16H 3PIO3 3HOYG 5KEEA 5I9PA 2DN8A 3HS0C 3HOXH 5COYA 2E5LL 2EXDA 3LGJA 2HT1A 3S2HH 3OW2A 4KY7A 1H9SB 1TQOA 2G5DA 1B3AA 5FLMG 3F1ZA 2NBFA 2PYKA 2I5MX 2A68C 2IL8A 3CKIB 1LT6D 2HCCA 4Y7NB 2KENA 3JAML 1A3TA 3BDOA 4JI5L 4X66Q 4P71A 2OTJA 4HJ7A 1FL0A 4B3RQ 3KLSX 1X32A 3I2ZA 4A3LG 3K7AH 1B9NA 1VQBA 5LMNL 3HOUG 2HIXA 2R93H 3GTKB 4J8QA 4N9TA 1ZEQX 4X3KA 3H0GG 4L63B 1XNRQ 2CW0C 4OX9L 3HOZH 2QW7A 2NB0A 5T1IA 1X3EA 1F9SA 5D3DA 4QB4A 1AH9A 1ML0D 4DUYQ 1K73C 3T4AC 1KIXA 2ZJQA 1XXGA 4AIMA 1PRTF 2MO0A 4OIKA 3T13A 1PH3A 4JG2A 1HUNA 3NBHA 3WDNA 1QE6A 2BOSA 1I3QH 2WP8J 2PZUA 4RWSC 4KV6A 1JOQA 1HFNA 1SMYD 2EOTA 3I4NB 3QIAA 2KUMA 3J81i 1PH4A 2N78A 3VYRA 4A3EH 1ZXTA 5IGDA 1O7ZA 3S1RH 2ES2A 4LF6L 1DYQA 1K8OA 2K7VA 4QIWB 2B63G 2CFMA 3PUWA 3Q0AA 1JJ2A 3X3MA 1M4VA 1SYEA 2CKZB 5FLXc 4GOPB 2K5WA 4KY5A 5ELNA 1WTOA 1I6HB 3K5MA 3PV0A 1PH2A 1QNUA 1FNWA 4K14A 3VR5A 1G6ZA 3TRZA 5C4XB 1YJ9A 4YCWA 2UUCL 1HNWQ 3P7JA 2P5ZX 1NTGA 1U4MA 1PRTD 4V0BA 5IGCA 1TIID 1SEBD 3C1EA 2C5CA 3RZOB 4JI4L 4ALPA 2HDLA 2XNAC 2ZXPA 4N8FA 4DKAC 4B3TL 2K6AA 2CH4W 3NELA 4GLAC 1AP0A 2NVTB 1L2FA 3EQLC 3J81L 4HTHA 3BDCA 1T5XD 1NUCA 4QJFA 1ZYRC 2UXCQ 2IY5B 1CTMA 2CWAA 1K8GA 3HOWB 4RA8A 4GKKQ 1N34Q 2MJ8A 1SRUA 2WKCA 1E24A 2EYFA 4CHTB 4DF7A 2RDHA 3MFYA 4YWLA 3ULJA 1KNEA 4EQ5A 2D2CC 2PPBC 2ZXRA 1S5FD 3AFQA 2EY6A 3EIVA 4BBSG 1J6QA 3W5OA 3U50C 3HKZE 3TP7A 1S5CD 2I07B 3J81j 3C1FA 5LL6S 4XQNA 1LTAD 3L7ZC 4ZK9B 1X3PA 4DAPA 4Y7NH 2LS01 1ESFA 1PH8A 1KAWA 1UUPA 2Y0SB 1T9HA 4YHHQ 1KLGD 1VQ7A 1DJRD 2AUJD 1EUJA 3K0YA 4MTKA 3M9BA 2EPBA 5IYBG 4ZAIA 3J80c 1GM5A 4JI1Q 1TU2B 3D4DA 4ZKCB 2WB1E 3I73A 1A8VA 5DNFA 4HAEA 5BN5A 4LF8L 4MTNA 4NMZA 4A3JG 2BDNA 4KJNA 1M8AA 1VS0A 1LT4D 5G3LF 1CM9A 1Q8KA 4K6DA 1JE5A 2GN5A 4X3UA 1C8CA 2OEOA 2A6EC 2E74C 2KBNA 2B2VC 2R3ZA 3M4YA 2A69D 3DLLA 1HNZQ 1FVIA 1TWCB 3DEOA 4DV2L 2D5DA 1ILQA 4WJ4A 4KN7C 3KDFB 1MIUA 3I4NH 1HQMC 3NUCA 3S24A 1D1IA 2CQOA 4JPBW 3K0XA 4XTCS 4HJ9A 4NW2A 4TRDA 5CR3A 4R4TA 3I7FA 3ND9A 1N33Q 1QILA 4ME5A 1JORA 1K0SA 1YEZA 1H9RA 5IWAL 5A2QL 1JICA 1I6HH 1VQJA 3CPWA 5IT9L 3C3LA 3WOFA 1EQRA 2JP1A 5G3LD 4F87A 2B2WA 4JBKA 3S2DB 3GTQB 1ILPA 3HOVG 1PA6A 2QKIC 2YU9B 4A3KH 1BDOA 1PZJD 2KHJA 2K04A 4DK0A 2GVAA 1XMOQ 1YBYA 2FFKB 4F7XA 5EQ0A 2X69A 3IKJA 3LWEA 2NVTH 2EYLA 4M1UB 1B2TA 4JI0L 2F3VA 5EPKA 1DOMA 2JA7B 3CCEA 2ZTCA 1NNXA 3U58A 1C7YA 1IHZA 3L9AX 4PMWA 2NZHA 3DXJC 1GHKA 3E3XA 4XYQA 1J9OA 4C3JH 3GTOB 4EVOA 5GADC 4LUOA 4KHVA 4XDXA 2OCEA 1EL0A 4X65L 4XQQA 1BO0A 4K2LA 3PO3B 1PZID 1I94L 4BY7H 2XGTA 3FKIB 1PTOF 1XNQL 1FGUA 1RTNA 5CGKA 1QZHA 1YNXA 5E7NA 2F0OA 1Q1BA 2PW7A 3M4OB 4RFBA 1CSQA 5C4XG 4LF4Q 2UXDQ 1B50A 4QUFA 1BBWA 5E4XA 2I46A 4KMUC 1F2ZA 3A5ZB 3S17B 2PO4A 4IQZA 3HG9A 4MIUA 2DJGC 1VQAA 3T16A 3A5UA 2D0OA 3UDGA 2RQXA 4B9WA 2O5JC 5C6AA 3BYTB 2EJMA 4JI2L 1S40A 1F2YA 2XN9C 4ZKBB 3HOWG 3QO2A 1PTOD 4POFA 2H4OA 4DV3Q 4POGA 1ENFA 3NEMA 3H3VC 1Y1WB 4WRDA 2E2HH 1SE4A 1VF5C 3TREA 4FVMA 3KLWA 1N32Q 5K36G 5EAYA 5I6WA 2EE1A 2WB1B 1VQDA 3QJYA 1WD1A 3BYYB 4BBRG 4KLKA 2QGQA 4A3GB 1HXYD 3EFXD 5M3FH 1OXUA 1GUNA 2XVSA 2G9HD 2VNUD 3SVMA 3MHBA 2HUGA 4JOIC 5BN3A 3VYSA 2AQ3B 2CQAA 1SNQA 3TDQA 4DNIA 1TXYA 2SNSA 4JI8Q 5IOCA 4AQYL 1XPUA 1IL2A 5LMNW 3S2DH 2VY3A 3GTQH 1JCKB 2YYZA 4NKLA 2OXPA 3EROA 5L37A 1I4QA 5C0XH 2YTYA 4ZCKA 1E2WA 1KQSA 1S5BD 4DV1Q 2YTXA 3K5LA 3FRPB 1CZGA 1X54A 1XYIA 3PO2G 2Z1CA 3ERQA 2KQ3A 2JA7H 4JI1L 3FPPA 1TY0A 4JI6Q 1WYDA 3RLOA 1JWMD 3GTOH 4LWCA 4A3BG 4TVAB 4PNYA 3S1NB 1RHPA 2WIIB 3I91A 3QOLA 1DD2A 2R7ZH 1VQOA 5IY0A 3T1YQ 1TY2A 3PMFA 4ZUIA 3H3VH 4KKUA 2F03A 1AFPA 3I8ZA 2ALYB 4KK7A 4A3IB 4B3SL 4ME3A 1K0RA 2BDOA 1GXDC 4KJOA 1Z6HA 3U9OA 4OHJA 5HGTA 4DR2Q 4KTAA 3HOYB 3RUZA 3GO5A 1Y8OB 2O4XA 1JT8A 3KLSA 2VQFQ 1D2BA 1N33L 4DXFA 5KGUA 1MSGA 1PZKD 5C0XG 1PFBA 4FF2A 3OOCA 2MGSA 4IPCA 4LF7Q 4CDDC 5D14A 3RZDB 4XT3B 4A3MG 2C35B 4DR3Q 3PCOB 3S9WA 3I55A 1SJED 3HRZC 1EY7A 3URYA 2PI2E 2JA7G 2JA8B 3CCMA 4KN4C 4O1NA 4G7HC 1D5ZC 1A6XA 5ELFA 1EEID 4I7AA 1MJCA 2RKSA 3CCLA 3HFZB 1K3RA 1PVOA 4IO9A 3OHXC 2VL6A 3PO3G 2RSNA 1L0XB 1VQIA 1O7LA 2CWPA 2JSOA 2Q8IB 3WOEA 3FKIG 3TP5A 2KCCA 3JC66 4NPSA 1YNND 4IFDI 1N36L 2F3IA 4JK1C 1E3PA 3T1HL 2LFNA 5IP9H 1EWIA 1WCMB 2Q8RE 1CHQD 5M5YB 4YY3Q 1LM0A 1PFSA 4DK3C 4OONA 2L9HA 5F2DA 1TWAH 2N88A 3S14H 3RN2A 1UAPA 4DAYB 1PRTC 1EZ6A 1EOVA 3MC0B 3MAQA 2NVXB 4YCVA 4DV7Q 2MFIA 1LTSD 1EY6A 2UXDL 2VQEL 2EY5A 3EA6A 3KF6A 3F2UA 2K33A 5FJ8G 1XJVA 3IL8A 3KF8A 5C0XJ 1MJEA 1EQTA 2E8GA 4UP8A 2BH2A 5IP7H 1Y1WG 4DV6Q 4HN7A 1CA5A 1V1PA 3MXPA 4LFAL 1DGSA 2PNHA 1KDBA 1BCPF 4LFBL 2IX3A 2WB1G 5H1SE 2EYPA 4HJ8A 3S1NH 1F9PA 4C3IH 4CDCC 5C3WA 4A3GG 2IPKD 1RTOA 3M7GA 1VQ4A 3O13A 1IYUA 1UE7A 2XRSD 3NWTA 4R8IA 3D6WA 5C4JB 4QUCA 3K58A 2F0QA 5FLXE 4B3MQ 1SE8A 4N9PA 2F0KA 4L5SA 2QCPX 2RSOA 4BY1G 1GOZA 3HOYH 3HGBA 4FO2A 2JQOA 5AFWA 1VMPA 3HKSA 1L1OC 1VQFA 4ZLTF 1GD7A 1ASYA 5FLMH 4IUPA 1EOTA 4I7ZC 4JBWA 1WTWA 4JI7L 2K1BA 2RCNA 2MO1A 3GTGB 3SXHA 1BCPD 2CHBD 1R9TB 1I4XA 1J8IA 2OTLA 4KHZA 2WKDA 1XX8A 5I6YA 3E0EA 3TQYA 4A3LH 3GP7A 3VR2A 3HOUH 2F0NA 4GS3A 3H0GH 4R4OA 1YIJA 1IBKQ 1HR0L 1NSNS 1YZ6A 3NK9A 4LFCL 4L5TA 2JA6B 4GKJL 1KRTA 4JI3L 3CXCA 3ZYYX 4IOAA 1WI5A 4P74A 4G7OC 1C4QA 4M8AA 1EY9A 2A69C 3K59A 1Y8PB 4DPGA 5HGQA 1XMQL 3N6RA 1GVPA 1LTRD 3NXWA 4BA2I 1B44D 4A3IG 4CKBA 3KOJA 1FR3A 5CORA 3AMUA 4GN4B 3H09A 1I5FA 2F0HA 4C3HB 3GTPB 4DR4Q 1I4HA 3T1YL 2B63H 4CJ1B 1NE3A 4A76A 2ICIA 2QEJC 4HIOA 5M5YH 3D31A 1SAPA 4L8JA 3E9HA 3I4LA 3D6CA 1OO9B 5KIXA 5FOBB 2K50A 1B9MA 1PLFA 1D5MC 3J80E 5FO8B 3HOVB 3FVQA 3PF4A 1MD2D 3LNNA 3L3OC 2EIFA 4DNRB 4GNXB 2JA8G 1HA5A 4V190 3ONAB 2M00A 3PQIA 3I4OA 5LMUQ 3CC2A 1LV9A 1PV4A 3A7LA 1RDPD 2WACA 2WFWA 4X3TA 4WFN3 4RAUC 1DXMA 5JPNC 2HCIA 4FF3A 1PYWD 3KJOA 4X62Q 1STBA 1CKOA 3Q24A 1S3OA 3PIPA 1PTOB 3DWPA 4UY8C 1P16A 1BBXC 3OWFA 1CQVA 3D8GA 2Q2HA 5IYDH 4CBVA 1XTDA 1BXTA 3H94A 1WCMG 3NQIA 5DAUA 4PZ6A 4FXGC 4HCSA 3CPFA 4BBSH 1L0WA 2DNEA 1S5ED 2A19A 1IKLA 1X55A 4X64Q 1FNUA 3VR3A 2PZTA 1JWUD 2VB2X 2RVLA 4DR6L 3OMGA 3R2TA 3K81C 4GNXC 3JAMc 2K14A 1D1KA 4R4QA 2UXBQ 3Q8DA 2PQAB 1KD1C 2Z6KC 5M3MB 5IYBH 2MUYA 3LWUA 4QMGA 5IE8A 1AEXA 1LABA 2KCMA 2TSSA 3KK7A 2VS1A 5ELDA 1CKNB 3KYHC 1UE5A 1E2ZA 1IBML 2JA6H 5JJIA 2K32A 4A3JH 4YIJA 2UUAQ 4R9WA 4LF9L 3J80L 2EVBA 4WJWA 2X6GA 4CKCA 4ID6A 1SE2A 2N49A 1MGSA 1X3GA 3D0FA 3MTSA 1TWFB 3WWVA 1IBLL 1IW7D 3I4MB 1TT2A 2IWHA 5IYDG 2QEXA 1OXXK 4LFBQ 5C3EG 4GOPC 5BR8L 4BBRB 3K5OA 4UDUC 1QJOA 2K28A 4IUNA 3OTOQ 1U9RA 5J3BA 2KCTA 3GTPH 1ESRA 4TSSA 2PCFB 3J7AV 4RCNA 2G9DA 1V43A 3DUZA 4Q5VA 4P73A 1ET6A 1YNJD 2Q2UA 4KKTA 4OELB 1RKNA 1EQQA 4DR7Q 1S5DD 1VQCA 2JA9A 4JW0A 3N52A 1MBYA 4NXNQ 1ENCA 3HOVH 1RL2A 3GTMB 2A8VA 1BNZA 2Z6BA 4DK6C 4F88A 3GTKH 4DXGA 5DM73 3NPPA 2L5TA 4K0KQ 1U4PA 4DUZL 3IRBA 2A73B 5K5PA 2JA6G 5C3XA 1KNAA 2WAQE 3PO2B 2A6HD 3J81c 3TS2A 1NBWA 4DR1L 2SOBA 1Q8IA 2LXKA 4LK1C 4LF5L 3E0JA 1ZKOA 2R7DA 1PFNA 1TS4A 2F0LA 1PTOH 1G51A 3KUPA 1QNKA 1HCZA 3NQTA 5EKIA 4RGOS 4DAMA 4A3BB 1IKMA 4U673 3QG1A 4DV5L 2K03A 1C9OA 1HNXL 4C3HG 2UUBL 1ICWA 1Q12A 2NN6I 2BE5D 3MFGA 2ZM6Q 2ZTDA 3PUXA 4JV5Q 4Y52H 2K4KA 1C0AA 2UU9L 3B6YA 5C4XH 3M4QA 4GN5A 1OXVA 2H1EA 1B70B 2NVYB 3SDZA 4FF1A 3QWNA 4FDBA 1PH1A 2QDLA 2SDFA 4ILWA 3PGZA 4O0AA 5AJ3Q 1JB3A 2F0VA 2B2VA 2F4VQ 3RZOH 3AU7A 1IXRA 1VQMA 1YHBA 2F0EA 1EIYB 4A3MB 4OO1I 5C4HA 1M90C 4UP7A 1SROA 4X66L 3D4WA 4WORA 2A68D 4GLVB 3E5SA 1Y69U 2QDBA 4B3RL 4JBMA 1G2TA 1A3UA 3QB3A 1PXUA 3HOWH 2GVBA 3TN2A 5DM63 1VQPA 1XNRL 4JYAQ 2NVQB 4DGZA 1TWFH 4O2DA 3S1MB 4A3DB 1FJGQ 3RD4A 1I4RA 3I4MH 2A74C 5K36H 4FF4A 2CW0D 5LHY1 4IPGA 4DUYL 1A15A 3ULLA 1VQKA 2K75A 3S1QB 4BBRH 2EXZA 5M5WB 4BA1I 3PF5A 4X62L 3LX0A 4OL7A 1R4QB 3BDLA 3STBD 1SNOA 1HZ9A 1H9MA 4RKLA 2B2TC 1SMXA 1GUSA 1KABA 4B9XA 2B39A 2VZAA 4P2CB 4IN3A 5IT9c 2RF4A 5D65A 5C5MA 5M3MG 3H15A 1STGA 3GTMH 3PUZA 1HR0W 4R1JA 2TMPA 4EQPA 3CC7A 2NYZD 1O78A 3SK6A 2M2LA 1VQ5A 2XWBB 1HNWL 1E7ZA 2LY7A 4RKBA 1BCPB 1S72A 2EYHA 4L5QA 3VYUA 3PO2H 1EY5A 4BXXG 3IFDA 5CBEE 4UAIA 4K5XA 3IFTA 3CHBD 4IOCA 3I4MG 3S15B 1KXLA 1TWCH 1NMGA 1YI2A 4Z9CB 4J6HA 4DR5Q 2F0TA 1DONA 4A3BH 4NB3A 1F9QA 1W2BA 2UXCL 2IT1A 2AHOB 1XPOA 3I90A 4OO1G 1SR3A 4GKKL 2WAQB 3AQQA 1N34L 4BWGB 2PNRC 1SNPA 2ZT9C 1XPRA 1Q81C 4HIKA 3CMAA 2JK8A 2HHHQ 2Z0SA 4FXKC 3MWYW 2EYOA 1RD9D 2BA1A 4BY1B 3CF5A 1SSOA 1PFMA 1E0BA 3SR1A 1CSPA 2K5HA 2J0TD 2NVYH 1LTLA 1VDZA 1WFQA 1BR9A 3CMEA 3PIP3 3MXUA 1SE3A 4KD4A 2ZJRA 4HR7B 2OWOA 2CVRA 1QUQB 2F0UA 2YU9H 4ZQ3A 3M3YB 4RGTA 3UE0A 4R8NA 1STNA 3EVQA 4DV0Q 2J7ZA 1SBBB 4A3MH 2QA4A 4OWWB 2I5HA 2FMCA 4YHHL 4DV4Q 3SK4A 4HMIA 2SNMA 3MVVA 5IGEA 2JJQA 4CDEC 4JOIA 1YJWA 1QVGA 2NVQH 3A55A 4NXMQ 2K01A 4IUVA 1HQRD 3H3VI 4RGNA 4RGMA 3I56A 3S1MH 4A3DH 2EJGC 2F52A 3MXGA 3RN5A 5LL6X 2VB3X 2EYMA 1H95A 1LTTD 5GQOA 4QF4A 3PO3H 3S1QH 5M5WH 1FGBD 5CV9A 5M5XB 2VW9A 3FKIH 1SYBA 2NUCA 1HNZL 3TMEA 1JOKA 3BZDB 3M4OH 1TS5A 1UE6A 1TWGB 3R8BA 1QCBD 5JEAH 2PZWA 4NDXA 1WTHA 3OYYA 2E5LQ 3ZJYC 2K05A 1AW7A 1VQEA 1CQFA 5T1GA 1STAA 4GN3B 2DNCA 3S17H 4JV5L 2ATWA 4HSPA 4GLXA 3CU7A 2EDGA 3P75A 3RMHA 3KF6B 4BS9A 4JI5Q 3RR5A 3KF8B 3EJIA 3Q22A 1N9WA 5E3FA 1II3A 1VQ8A 3TSSA 1QZGA 3VYTA 1QB5D 3A8IE 3A0JA 4RHRA 3F2BA 1HRJA 1FNVA 5FJ8H 4PG3A 5LMNQ 3CC4A 5EPLA 3QOJA 4OX9Q 2F4VL 5EKKA 3BG3A 1Y1WH 3OPOA 4A3DG 1WTQA 1PYSB 4F8MA 1XMOL 3S15H 3BJUA 2R92B 5JAVA 5KNCA 2JA5B 2KEEA 1SMYC 5KNBA 4A3GH 1EYCA 2DUDA 3GTLB 3RLNA 1JMCA 1V1OA 1BOSA 1KDCA 2HQEA 1HFGA 1ICFB 5JVH3 1V9PA 2JEAI 2E2JB 3GTJB 1CA6A 1A62A 3TEHB 3PSIA 5E4WC 2A5HA 1WTVA 5JEAG 2I5LX 1Z9FA 4LF6Q 2R7FA 4XXEA 5CV7A 5C44G 4BY1H 2O5IC 1UE1A 2EJFC 1WOCA 3M7NA 1F2LA 2F0GA 2SEBD 2UUCQ 3SK5A 3M3YH 2RCFA 3ULPA 5GAEC 4LF4L 5GAHC 4IFDH 3S2HB 4ABNA 2Q2IA 4RCOA 1B3QA 2DY8A 3TZDA 3CP0A 1YHQA 5JVG3 3L0OA 2AUKA 2KHSA 4JI4Q 2E75C 3CD6A 1IYVA 1WVLA 1SNMA 4B3TQ 2Q2TA 4A3CG 2IX0A 1YHAA 2AWOA 1WTXA 1JOOA 4TQUS 5CBAE 5D3IB 4H44C 1X9NA 2FXQA 3FHWA 2KOLA 1SYCA 3K7AB 2AKWB 3ITPA 3DM1A 2R93B 3OIPA 4RG1A 1PH5A 4DA2A 4JBJA 1CUKA 2B2UC 4C1NK 2WAQG 2H5XA 3HOZB 4DV3L 4A93G 5M5XH 5FKAC 3DHQA 4ULLA 2KECA 4A3IH 5I9OA 5C3EB 1N32L 1SN8A 2VUMG 1B1ZA 1GUTA 2B2YC 3H6MA 1TWGH 3NHHA 1D8LA 1YNJC 1AZPA 1LT3D 1Q1EA 2OQKA 3CRLC 4JCVE 3KBXA 3JAME 3BZKA 1BKBA 3K5NA 1Y8NB 1YITA 1V8QA 5JEAJ 4J15A 2RDGA 1KTKA 3D4RA 1D5XC 1X65A 2KEDA 3UE1A 4HIMA 3S1RB 4IFDG 3RZDH 2LKVA 1M1KC 1G8ZD 1Q3LA 3CCJA 4CJ0B 1U5KA 4JI8L 3GQBA 3RLFA 1JJCB 3I70A 1RF2D 2B2UA 2JA8H 1DOKA 2ASBA 1B8AA 1Z47A 4LMQD 3NBHB 1JJGA 2KHIA 4LF8Q 1B7YB 4DV1L 4H0LC 4A75A 5DLQE 1CI3M 1A63A 2HDMA 1L1OA 5I2XA 4X6AH 1CK1A 3NBIA 5IYCH 1VQ9A 3GTLH 3NWSA 3T53B 4DV2Q 5IODA 5J22A 1TS3A 3VR4A 2OQ0A 4JI6L 1NR4A 2B29A 5A35A 2XSCA 2E2JH 3GDEA 4K6LA 2BE5C 3GTJH 1WCMH 4DN4M 3C2PA 5M9OA 4U68A 1Q46A 2DGYA 1QVFA 1I4GA 1VF7A 2ZXOA 2F3WA 1EY8A 5IWAQ 2RHQB 4DNTB 3VDYA 1X3FA 2F0MA 2NVXH 4DR2L 4K2KA 1JQYD 2NZOA 5FLXL 4OEMB 1QG7A 3MEFA 2AMCB 2VQFL 4RH6A 2N8NA 3I3CA 3FEWX 4HSVA 1FD7D 5DEHA 4YCUA 4IFDJ 3J81E 4LF7L 5J39A 1W6KA 3MXNA 4DR3L 1Q7YC 2R92G 1U4LA 2JA5G 4JI0Q 3TP6A 1TVXA 1EYGA 3U4VA 1EU4A 4HIDA 1W3SA 5IYCG 5EKLA 1EYAA 1I6VC 1Y1VG 4AYBG 1K3BC 2OT2A 3BVGA 3D3RA 4C2MB 5C3EH 1AE3A 1VQGA 4X65Q 5C4JH 3J80i 1G2SA 2F0FA 1HPCA 4YWKA 3STBC 1I94Q 3FPUB 4DK1A 1AZQA 5CV4A 1XNQQ 1JE4A 1NJIC 1EFID 3SGIA 3W1BA 1TS2A 1I50B 1F77A 3GTGH 1BBUA 2PI2A 4YWMA 1K8MA 1R9TH 3KLRA 3HOXG 3UDIA 4DU9A 3BVZA 1ONLA 1FYCA 2KJXA 4YY3L 1ASZA 1Q90A 2R61A 2AQ2B 1GUOA 1SLJA 4KY6A 5GAGC 2ZJPA 3G71A 4K5VA 2L15A 1H9SA 5ISRA 4MN3A 3OSOA 5KYLA 1RODA 1GUWA 1A3VA 1PTOC 4DV7L 1EU3A 4PV1C 2XTIA 4DAVA 4JI2Q 2R6GA 5J1ZA 3HZXA 2KCNA 4A3KB 1G291 2R93G 2B3GA 1UWVA 3GD7A 3F8TA 3HOZG 2IJ0A 3J7YW 4O42A 4ZRZA 4DV6L 2M9VA 2PMZE 4GNXA 3G4SA 2NTTA 3AFPA 2WINB 1GHJA 2F0JA 1A0IA 2LXJA 2I0QA 4J1MA 2Z6KA 3W3AA 1MI2A 4C3HH 3A8JE 5JPMC 2K52A 5A2QE 4C3JB 1SYFA 1LO5D 2D0PA 1SNDA 2EZVA 3ND8A 1LT5D 1O80A 5IT9E 3CCSA 1DM0B 1BVSA 2F0SA 2ZTEA 4A3EG 3DMUA 1PH7A 1O7YA 4B3ML 3E9IA 3M85A 4BY7B 2Z4IA 4AQYQ 2JYOA 1H9JA 3U4ZA 3FP9A 4LJZC 1GJXA 2IW3A 4IJHA 4PMCA 5CV8A 2K5QA 3CCUA 4EX5A 4RHSA 2ID0A 2DY7A 5I2YA 3MEHA 1VQ6A 1CZWA 4GOPA 2PQEA 3EBEA 2D62A 4DFAA 1STEA 5BN4A 2L55A 1KLUD 1J5EQ 1KRSA 2XRQD 3J7A5 1BF4A 3CW2C 2PQAA 4OIJA 1IBKL 3K80C 4IUUA 2HQLA 2O2LD 3AYHB 1HTLD 3X3NA 4C2MH 2F0DA 4FXDA 2B2WC 4RMFA 3A8KE 1CKNA 2YV5A 4HJ5A 3DM3A 4APVA 1HH2P 2MHVA 2F1MA 4KI0A 4S3SA 2E2HB 4B3SQ 2B8FA 3UI2A 1E22A 1CFMA 1QWYA 3KBGA 2MQHA 4EGVA 2Z4HA 1HJPA 3K7UC 1I50H 1MHWC 1X3QA 4L5RC 1O7IA 4E6IA 1WD0A 5M3FB 4DR4L 3Q6SA 5EBDA 1C48A 5M3MH 4EQNA 3M4PA 1UEAB 2EYJA 4H7BA 3NTIA 2MP1A 4R4CA 5CV6A 5GROA 1STHA 2NN6H 2A1AA 5CV5A 4HJAA 5TSSA 4OWXB 1QOHA 1PDQA 1E1TA 1JR0D 2E2DC 4X3SA 4BXXH 1SYGA 5IGGA 3J7AF 5JJLA 3A74A 3FMCA 5LMUL 1LUZA 4FYDA 1KC8C 5IIFA 1DZ1A 3R3OA 4IUQA 1DCZA 3TP8A 3Q23A 1XTCD 1F9RA 2QF7A 1YNNC 3R2IA 4FP5D 3J7ZC 3V96A 2JN4A 1EY4A 3G48A 2MPMA 4OO1H 3RNUA 1KDAA 4XIGS 3QR8A 2V4DA 3K8AA 1WJJA 1N36Q 4PMBA 3CRKC 3T1HQ 1U4RA 4QY7A 3I4NG 5ELCA 1EY0A 2R7ZB 1G6PA 2PMZB 1LACA 1NMFA 3OW7A 5C44B 3I72A 4IZ8A 3KDFA 5C4ZA 3T56B 1LYLA 3NTKA 4X64L 1K83B 4LUVA 1VCIA 4K8JA 2X6LA 2NN6G 1MSHA 1SXTA 3ERSX 1F2MA 1HZAA 2XIWA 4LUZA 3SE0A 2EY2A 1ET9A 2HD3A 4IPDA 2FINB 1WTPA 3SK8A 2VQEQ 1PHJA 2UXBL 3NTHA 1NY4A 2HIVA 5KRUA 2F0IA 4AYBE 3CCRA 2C9OA 4A3KG 4XYOA 4B08A 3UDXA 1PMRA 1B53A 1EYDA 3K6OA 1HHVA 3PUYA 3HKZB 2F4IA 1A2TA 2AQ1B 2B2TA 1NCVA 4LFAQ 1EEFD 3H91A 1JC7A 1CHPD
chains in the Genus database with same CATH topology
2AWNA 2NWGA 1NAPA 4IALA 1SFOB 4A93B 1R4PB 1XWEA 2B8GA 1ZYRD 2RDFA 3OWEB 4C1NI 1VMCA 2E2IB 4C3JG 3V2TA 1HUMA 3NE5B 2VUMB 1EWCA 5IGFA 5EGTA 2NZ1D 1DOLA 1S4ZA 5C0XI 2BA0A 4XT1B 5FK9C 1BCPC 3SEBA 3OIQA 2RBMA 4IUTA 4FNFA 4XQJA 2L1BA 1EWHA 4CGYB 5CC4A 1LLRD 1TWAB 3S14B 3T51B 3C46A 2E76C 3A7AB 2L0CA 2FMMA 2RA4A 3BS1A 3FDTA 4GZYC 3NSWA 2ENBA 3HEJA 4A3FB 4G57A 1JWSD 2L4NA 2L11A 1EIGA 2EY1A 2A6ED 4QCLA 1G91A 4C3IB 3DEPA 3OMCA 4ODGA 1BQQT 3MZ5A 4K5WA 3GV6A 5IGBA 2VXWA 1LTGD 3TZUA 1T5EA 5FO9B 1SJHD 3A56A 2IX1A 1L0YB 2N55A 2Q8TA 1V1PB 3P20A 1KAAA 3GV3A 3IAYA 1I4PA 4KD3A 4C56C 4Q0FA 4ZYSA 4H13C 2L12A 4KKSA 1PRTB 3TBIB 5KNDA 4MHEA 3HOUB 1OXTA 3H0GB 1EQVA 2JE6I 1Y1VB 1B4OA 4AYBB 5CMDA 3K57A 5EJWA 4CKEA 1E2VA 1NR2A 5I4DA 1RJTA 2FHTA 1BUVT 1TWHB 3HP3A 4L6TB 1CT1D 1D6EC 3CQZB 1W6JA 1EZ8A 4G4KA 3VA5A 5JJZA 1A2UA 3PUVA 3R93A 1HA6A 1LTBD 4PQXA 3S16B 3V05A 1LTID 3HOXB 2B63B 2QILA 2KVMA 1ENAA 1OXSC 2JXMB 4LAAA 3VA7A 2GA4B 1SNCA 5EBCA 4I65A 2PW5A 2ICEC 5ELEA 5FO7B 3P1HA 1WTRA 1HTPA 2F0WA 5C5LA 1Z7TA 3W2DA 2LMCB 3DWAA 1IW7C 2WV6D 3G7LA 4OGQC 4G7ZC 2D9UA 1STYA 3SHLA 1UNSA 2FJ2A 1I3QB 2XWJB 4ZUJA 2F0PA 3G6JB 2J4XA 2BCOA 2Z8LA 3E6ZX 5KYIA 1AN8A 1SDFA 4A3EB 4NP5A 4IURA 1IL8A 4BBSB 1TKWB 3NP8A 3U9SA 5CYUA 3A54A 4K8IA 2K5DA 1EIHA 2A6HC 5EPJA 2JEBI 3BVMA 1RCVD 2NTSA 5HURA 4DAYA 2B2YA 4CJ2C 4TKOB 3AB9A 4EQOA 1TR5A 2OF1A 2KA7A 3DWQA 1GUGA 3MA2B 4A3JB 3VR6A 1H9KA 4C3IG 4HCEA 4HEDA 5NUCA 5E1FA 1SYDA 4HMJA 5ELBA 5JOBA 3PIO3 5KEEA 5I9PA 2DN8A 3HS0C 5COYA 4KY7A 1H9SB 1TQOA 1B3AA 2IL8A 2NBFA 2PYKA 2A68C 3CKIB 1LT6D 2HCCA 4Y7NB 3JAML 1A3TA 3BDOA 3KLSX 1X32A 1B9NA 3GTKB 4J8QA 4N9TA 1ZEQX 4X3KA 4L63B 2CW0C 2NB0A 5T1IA 1F9SA 5D3DA 4QB4A 1ML0D 3T4AC 1XXGA 1PRTF 4OIKA 3T13A 1HUNA 3NBHA 3WDNA 1QE6A 2BOSA 2WP8J 2PZUA 4RWSC 4KV6A 1JOQA 1HFNA 1SMYD 2EOTA 3I4NB 3QIAA 2KUMA 3VYRA 1ZXTA 5IGDA 1O7ZA 1DYQA 1K8OA 2K7VA 4QIWB 3PUWA 3Q0AA 3X3MA 1M4VA 1SYEA 2K5WA 4KY5A 1WTOA 1I6HB 3K5MA 3PV0A 1QNUA 1FNWA 4K14A 3VR5A 1G6ZA 5C4XB 3P7JA 1U4MA 1PRTD 4V0BA 5IGCA 1TIID 1SEBD 3C1EA 2C5CA 3RZOB 2HDLA 2XNAC 2ZXPA 2K6AA 1AP0A 2NVTB 3EQLC 3J81L 4HTHA 3BDCA 1T5XD 1NUCA 1ZYRC 1CTMA 3HOWB 4RA8A 2MJ8A 2WKCA 2EYFA 4CHTB 4DF7A 2RDHA 3MFYA 1KNEA 2D2CC 2PPBC 2ZXRA 1S5FD 2EY6A 3TP7A 1S5CD 2I07B 3C1FA 5LL6S 4XQNA 1LTAD 3L7ZC 4ZK9B 1X3PA 4DAPA 2LS01 1ESFA 1UUPA 2Y0SB 1KLGD 1DJRD 2AUJD 3K0YA 2EPBA 4ZAIA 1TU2B 3D4DA 4ZKCB 3I73A 5DNFA 4HAEA 5BN5A 4NMZA 2BDNA 4KJNA 1M8AA 1LT4D 5G3LF 1CM9A 4K6DA 4X3UA 1C8CA 2OEOA 2A6EC 2E74C 3M4YA 2B2VC 2R3ZA 2A69D 1TWCB 3DEOA 2D5DA 1ILQA 4KN7C 1HQMC 3NUCA 1D1IA 4XTCS 4NW2A 4TRDA 5CR3A 3ND9A 1QILA 4ME5A 1JORA 1H9RA 5A2QL 1JICA 5IT9L 3C3LA 3WOFA 2JP1A 5G3LD 4F87A 2B2WA 3S2DB 3GTQB 1ILPA 2QKIC 2YU9B 1BDOA 1PZJD 2K04A 4DK0A 2FFKB 4F7XA 5EQ0A 2X69A 3IKJA 3LWEA 2EYLA 4M1UB 1B2TA 2F3VA 5EPKA 1DOMA 2JA7B 1IHZA 3L9AX 4PMWA 3DXJC 1GHKA 4XYQA 1J9OA 3GTOB 4EVOA 4KHVA 4XDXA 1EL0A 4XQQA 1BO0A 4K2LA 3PO3B 1PZID 3FKIB 1PTOF 1RTNA 5CGKA 2F0OA 1Q1BA 2PW7A 3M4OB 4RFBA 1B50A 4QUFA 5E4XA 2I46A 4KMUC 1F2ZA 3S17B 2PO4A 4IQZA 3HG9A 4MIUA 3T16A 2RQXA 4B9WA 2O5JC 5C6AA 3BYTB 2EJMA 1F2YA 2XN9C 4ZKBB 3QO2A 1PTOD 2H4OA 1ENFA 3H3VC 1Y1WB 4WRDA 1SE4A 1VF5C 4FVMA 5K36G 5I6WA 2EE1A 2WB1B 3QJYA 1WD1A 3BYYB 4A3GB 1HXYD 3EFXD 1OXUA 1GUNA 2XVSA 2G9HD 2VNUD 3SVMA 3MHBA 2HUGA 5BN3A 3VYSA 2AQ3B 2CQAA 1SNQA 3TDQA 2SNSA 5IOCA 1JCKB 2YYZA 4NKLA 2OXPA 3EROA 1I4QA 5C0XH 1E2WA 1S5BD 3K5LA 3FRPB 1CZGA 1XYIA 2Z1CA 3ERQA 2KQ3A 3FPPA 1TY0A 1JWMD 4PNYA 3S1NB 1RHPA 2WIIB 3I91A 3QOLA 1DD2A 1TY2A 3PMFA 4ZUIA 4KKUA 2F03A 1AFPA 3I8ZA 4KK7A 4A3IB 2BDOA 1GXDC 4KJOA 1Z6HA 3U9OA 4OHJA 5HGTA 4KTAA 3HOYB 3RUZA 3GO5A 1Y8OB 2O4XA 3KLSA 1D2BA 4DXFA 5KGUA 1MSGA 1PZKD 5C0XG 1PFBA 4FF2A 3OOCA 2MGSA 5D14A 3RZDB 4XT3B 3S9WA 1SJED 3HRZC 1EY7A 3URYA 2JA8B 4KN4C 4O1NA 4G7HC 1D5ZC 1A6XA 5ELFA 1EEID 2RKSA 3OHXC 2RSNA 1L0XB 2Q8IB 1O7LA 2JSOA 3WOEA 3TP5A 2KCCA 1YNND 4IFDI 4JK1C 2LFNA 1WCMB 2Q8RE 1CHQD 5M5YB 2L9HA 5F2DA 2N88A 1UAPA 1PRTC 1EZ6A 3MC0B 3MAQA 2NVXB 1LTSD 1EY6A 2EY5A 3EA6A 3F2UA 2K33A 3IL8A 3KF8A 5C0XJ 1EQTA 4HN7A 1CA5A 1V1PA 3MXPA 1KDBA 1BCPF 2IX3A 2EYPA 1F9PA 5C3WA 2IPKD 1RTOA 3M7GA 3O13A 1IYUA 2XRSD 4R8IA 3NWTA 3D6WA 5C4JB 4QUCA 3K58A 2F0QA 5FLXE 4N9PA 2F0KA 2QCPX 2RSOA 1GOZA 3HGBA 4FO2A 5AFWA 1VMPA 4ZLTF 4IUPA 1EOTA 4I7ZC 4JBWA 1WTWA 2K1BA 3GTGB 3SXHA 1BCPD 2CHBD 1R9TB 1I4XA 1J8IA 4KHZA 2WKDA 5I6YA 1XX8A 3GP7A 3VR2A 2F0NA 1NSNS 3NK9A 2JA6B 3ZYYX 4G7OC 1C4QA 4M8AA 1EY9A 2A69C 3K59A 1Y8PB 3N6RA 1LTRD 3NXWA 4BA2I 1B44D 4CKBA 1FR3A 5CORA 3AMUA 3H09A 2F0HA 4C3HB 3GTPB 1I4HA 4CJ1B 2ICIA 2QEJC 3D31A 1SAPA 4L8JA 3I4LA 3D6CA 1OO9B 5KIXA 5FOBB 1B9MA 1PLFA 1D5MC 3J80E 5FO8B 3HOVB 3FVQA 1MD2D 3LNNA 3L3OC 4DNRB 1HA5A 4V190 3ONAB 2M00A 1LV9A 3A7LA 1RDPD 2WACA 4X3TA 4WFN3 4RAUC 1DXMA 5JPNC 2HCIA 4FF3A 1PYWD 1STBA 3Q24A 1PTOB 3DWPA 1BBXC 3OWFA 1CQVA 3D8GA 4CBVA 1BXTA 3H94A 5DAUA 3NQIA 4FXGC 4HCSA 2DNEA 1S5ED 1IKLA 1FNUA 3VR3A 2PZTA 1JWUD 2VB2X 2RVLA 3OMGA 3R2TA 1D1KA 5M3MB 2MUYA 3LWUA 4QMGA 1AEXA 1LABA 2TSSA 3KK7A 5ELDA 1E2ZA 2K32A 4YIJA 4R9WA 3J80L 2EVBA 4WJWA 2X6GA 4CKCA 4ID6A 1SE2A 1MGSA 3MTSA 1TWFB 1IW7D 3I4MB 1TT2A 2IWHA 1OXXK 4BBRB 3K5OA 4UDUC 1QJOA 2K28A 4IUNA 1U9RA 1ESRA 4TSSA 2PCFB 3J7AV 4RCNA 2G9DA 1V43A 3DUZA 4Q5VA 1ET6A 1YNJD 4KKTA 1RKNA 1S5DD 3N52A 1MBYA 1ENCA 3GTMB 1BNZA 4F88A 4DXGA 5DM73 3NPPA 2L5TA 1U4PA 2A73B 5K5PA 5C3XA 1KNAA 3PO2B 2A6HD 2SOBA 1Q8IA 4LK1C 3E0JA 1ZKOA 1PFNA 1TS4A 2F0LA 1PTOH 3KUPA 1QNKA 1HCZA 3NQTA 5EKIA 4RGOS 4A3BB 1IKMA 4U673 3QG1A 2K03A 4C3HG 1ICWA 1Q12A 2NN6I 2BE5D 3MFGA 3PUXA 1OXVA 2H1EA 2NVYB 3SDZA 4FF1A 3QWNA 2SDFA 4ILWA 1JB3A 2F0VA 2B2VA 3AU7A 2F0EA 4A3MB 4OO1I 5C4HA 3D4WA 4WORA 2A68D 3E5SA 1Y69U 2QDBA 1G2TA 1A3UA 1PXUA 3QB3A 3TN2A 5DM63 2NVQB 4DGZA 3S1MB 4A3DB 3RD4A 1I4RA 2A74C 5K36H 4FF4A 2CW0D 5LHY1 1A15A 3S1QB 2EXZA 5M5WB 4BA1I 3LX0A 4OL7A 1R4QB 3BDLA 1SNOA 1H9MA 4RKLA 2B2TC 1GUSA 1KABA 4B9XA 2B39A 4P2CB 4IN3A 5D65A 5C5MA 1STGA 3PUZA 4EQPA 2TMPA 2NYZD 1O78A 3SK6A 2M2LA 2XWBB 2LY7A 4RKBA 1BCPB 2EYHA 3VYUA 1EY5A 3IFDA 5CBEE 4UAIA 4K5XA 3IFTA 3CHBD 3S15B 4Z9CB 4J6HA 2F0TA 1DONA 1F9QA 2IT1A 3I90A 4OO1G 2WAQB 4BWGB 2PNRC 1SNPA 2ZT9C 4FXKC 3MWYW 2EYOA 1RD9D 2BA1A 4BY1B 1SSOA 1PFMA 1E0BA 3SR1A 2J0TD 1VDZA 1BR9A 3PIP3 3MXUA 1SE3A 4KD4A 4HR7B 2CVRA 2F0UA 4ZQ3A 3M3YB 4RGTA 4R8NA 1STNA 3EVQA 2J7ZA 1SBBB 2FMCA 3SK4A 4HMIA 2SNMA 3MVVA 5IGEA 3A55A 2K01A 4IUVA 1HQRD 4RGNA 4RGMA 2EJGC 3MXGA 5LL6X 2VB3X 2EYMA 1LTTD 4QF4A 1FGBD 5CV9A 5M5XB 1SYBA 2NUCA 3TMEA 1JOKA 3BZDB 1TS5A 1TWGB 3R8BA 1QCBD 5JEAH 2PZWA 4NDXA 2K05A 1AW7A 1CQFA 5T1GA 1STAA 2DNCA 4HSPA 3CU7A 2EDGA 3P75A 3RMHA 4BS9A 3EJIA 3Q22A 5E3FA 1II3A 3TSSA 3VYTA 1QB5D 3A8IE 4RHRA 1HRJA 1FNVA 5EPLA 3QOJA 5EKKA 3BG3A 3OPOA 1WTQA 4F8MA 2R92B 5JAVA 5KNCA 2JA5B 2KEEA 1SMYC 5KNBA 1EYCA 3GTLB 1BOSA 1V1OA 1KDCA 2HQEA 1HFGA 5JVH3 2JEAI 2E2JB 3GTJB 1CA6A 5E4WC 2A5HA 1WTVA 5JEAG 4XXEA 5CV7A 2O5IC 2EJFC 3M7NA 1F2LA 2F0GA 2SEBD 3SK5A 4IFDH 3S2HB 4ABNA 4RCOA 2DY8A 3TZDA 5JVG3 2AUKA 2KHSA 2E75C 1IYVA 1WVLA 1SNMA 2IX0A 2AWOA 1WTXA 1JOOA 4TQUS 5CBAE 5D3IB 4H44C 2KOLA 1SYCA 3K7AB 3ITPA 3DM1A 2R93B 3OIPA 4DA2A 2B2UC 4C1NK 3HOZB 5FKAC 3DHQA 4ULLA 2KECA 5I9OA 5C3EB 1B1ZA 1GUTA 2B2YC 3H6MA 3NHHA 1YNJC 1AZPA 1LT3D 1Q1EA 3CRLC 3KBXA 3JAME 3K5NA 1Y8NB 1V8QA 5JEAJ 2RDGA 1KTKA 3D4RA 1D5XC 2KEDA 3S1RB 4IFDG 2LKVA 1G8ZD 1Q3LA 4CJ0B 3GQBA 3RLFA 3I70A 1RF2D 2B2UA 1DOKA 1Z47A 4LMQD 4H0LC 1CI3M 2HDMA 5I2XA 1CK1A 3NBIA 3NWSA 3T53B 5IODA 5J22A 1TS3A 3VR4A 1NR4A 5A35A 2XSCA 4K6LA 2BE5C 4DN4M 3C2PA 5M9OA 4U68A 1I4GA 1VF7A 2ZXOA 2F3WA 1EY8A 4DNTB 2F0MA 4K2KA 1JQYD 5FLXL 1QG7A 4RH6A 3I3CA 4HSVA 3FEWX 1FD7D 5DEHA 4IFDJ 3J81E 5J39A 1W6KA 3MXNA 1U4LA 3TP6A 1TVXA 1EU4A 5EKLA 1EYAA 1I6VC 2OT2A 3BVGA 3D3RA 4C2MB 1G2SA 2F0FA 1HPCA 3FPUB 4DK1A 1AZQA 5CV4A 1JE4A 1EFID 1TS2A 1I50B 1F77A 1K8MA 3KLRA 4DU9A 3BVZA 1ONLA 1FYCA 2KJXA 1Q90A 2R61A 2AQ2B 1GUOA 4KY6A 4K5VA 1H9SA 5ISRA 4MN3A 3OSOA 5KYLA 1RODA 1GUWA 1A3VA 1PTOC 1EU3A 4PV1C 4DAVA 2R6GA 5J1ZA 3HZXA 2KCNA 4A3KB 1G291 3GD7A 2IJ0A 3J7YW 4O42A 4ZRZA 2M9VA 2NTTA 2WINB 1GHJA 2F0JA 4J1MA 3W3AA 1MI2A 3A8JE 5JPMC 5A2QE 4C3JB 1SYFA 1LO5D 1SNDA 2EZVA 3ND8A 1LT5D 1O80A 5IT9E 1DM0B 2F0SA 3DMUA 1O7YA 3M85A 4BY7B 2Z4IA 2JYOA 1H9JA 4LJZC 1GJXA 2IW3A 5CV8A 4PMCA 2K5QA 4RHSA 2ID0A 2DY7A 5I2YA 3MEHA 1CZWA 2PQEA 2D62A 4DFAA 1STEA 5BN4A 2L55A 1KLUD 2XRQD 1BF4A 4OIJA 4IUUA 2O2LD 1HTLD 3X3NA 2F0DA 4FXDA 2B2WC 3A8KE 2MHVA 4KI0A 2F1MA 4S3SA 2E2HB 3UI2A 2B8FA 1CFMA 1QWYA 3KBGA 4EGVA 2Z4HA 1X3QA 4E6IA 1WD0A 5M3FB 3Q6SA 5EBDA 1C48A 4EQNA 1UEAB 2EYJA 4H7BA 3NTIA 2MP1A 5CV6A 1STHA 2NN6H 5CV5A 5TSSA 1QOHA 1PDQA 1JR0D 2E2DC 4X3SA 1SYGA 5IGGA 3J7AF 3FMCA 4FYDA 5IIFA 1DZ1A 3R3OA 4IUQA 1DCZA 3TP8A 3Q23A 1XTCD 1F9RA 2QF7A 1YNNC 3R2IA 4FP5D 3V96A 1EY4A 2MPMA 4OO1H 1KDAA 4XIGS 2V4DA 4PMBA 3CRKC 1U4RA 5ELCA 1EY0A 2R7ZB 2PMZB 1LACA 3OW7A 5C44B 3I72A 4IZ8A 5C4ZA 3T56B 3NTKA 1K83B 1VCIA 4K8JA 2X6LA 2NN6G 1MSHA 1SXTA 1F2MA 2XIWA 3SE0A 2EY2A 1ET9A 2FINB 1WTPA 3SK8A 3NTHA 5KRUA 2F0IA 2C9OA 4XYOA 4B08A 1PMRA 1B53A 1EYDA 3K6OA 1HHVA 3PUYA 3HKZB 2F4IA 1A2TA 2AQ1B 2B2TA 1NCVA 1EEFD 3H91A 1JC7A 1CHPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0U A;  2F0O A;  4PNY A;  1KAA A;  2PW7 A;  5KYI A;  1A3U A;  3QB3 A;  3QOL A;  4NP5 A;  4KY6 A;  4ZQ3 A;  4IAL A;  4K5V A;  3D4D A;  4IUN A;  3D6C A;  3T13 A;  1U9R A;  4KD3 A;  4R8N A;  4ZUI A;  1STN A;  3PMF A;  5KIX A;  5ISR A;  3EVQ A;  3NP8 A;  3OSO A;  5CV7 A;  2RDF A;  4DGZ A;  4E6I A;  5KYL A;  1A3V A;  2PZU A;  3MXP A;  5IOD A;  4KV6 A;  5J22 A;  1JOQ A;  1F2Z A;  4NMZ A;  5J1Z A;  3HZX A;  3V2T A;  1KDB A;  4KJN A;  4K8I A;  4KJO A;  2EYJ A;  4H7B A;  4HMI A;  2EYP A;  3SK4 A;  2SNM A;  3MVV A;  3U9O A;  4EQN A;  5IGF A;  4MIU A;  2EXZ A;  5C3W A;  5CV6 A;  5HGT A;  5IGE A;  1STH A;  1EQV A;  2F0G A;  4K6D A;  4KTA A;  5EGT A;  3SK5 A;  2M00 A;  1RKN A;  3T16 A;  3LX0 A;  5IGD A;  2OEO A;  3RUZ A;  2O4X A;  4OL7 A;  2F3W A;  5HUR A;  5CV5 A;  2WAC A;  3BDL A;  4B9W A;  1SYE A;  4KD4 A;  1ENC A;  5KGU A;  1EY8 A;  4KY5 A;  5C6A A;  1SNO A;  1F2Y A;  2RBM A;  2KHS A;  4RKL A;  2EYM A;  3NUC A;  2F0J A;  1STB A;  2F0Q A;  4J1M A;  1SYG A;  1KAB A;  4K14 A;  2F0M A;  1SNM A;  4QF4 A;  1EZ8 A;  5IGG A;  4N9P A;  5CV9 A;  2F0K A;  4K2K A;  4B9X A;  4TRD A;  5CR3 A;  4EQO A;  1TR5 A;  1JOO A;  2OF1 A;  5CC4 A;  1SYB A;  2NUC A;  4ME5 A;  4WRD A;  5IIF A;  3R3O A;  5IGC A;  5K5P A;  3S9W A;  3TP8 A;  3OWF A;  5C5M A;  5C3X A;  1EY7 A;  1SYF A;  3VA5 A;  3C1E A;  3D8G A;  1SND A;  3TME A;  1A2U A;  1STG A;  1JOK A;  1SYC A;  5I6W A;  3ITP A;  5DEH A;  2F0S A;  2SOB A;  5DAU A;  1EY4 A;  4EQP A;  3DMU A;  3SXH A;  1KDA A;  3SK6 A;  2PZW A;  4NDX A;  3DHQ A;  2F0L A;  5NUC A;  5J39 A;  5E1F A;  3NQT A;  4RKB A;  1ENA A;  1SYD A;  5I9O A;  4PMB A;  2EYH A;  3BDC A;  2PZT A;  3MHB A;  4HTH A;  4LAA A;  5I6Y A;  1STA A;  1NUC A;  2RKS A;  4HMJ A;  3TP6 A;  1SNC A;  1EY5 A;  5CV8 A;  4PMC A;  5JOB A;  1EY0 A;  2ENB A;  2F0N A;  3HEJ A;  3MEH A;  3OMG A;  2PW5 A;  3P75 A;  4I65 A;  4K5X A;  1SNQ A;  1JOR A;  2PQE A;  3H6M A;  5EKL A;  1NSN S;  3P1H A;  1EYA A;  3EJI A;  3NHH A;  3TP5 A;  5I9P A;  5E3F A;  4G57 A;  2F0W A;  1II3 A;  3NK9 A;  2SNS A;  4IZ8 A;  5C5L A;  4F7X A;  5C4Z A;  5IOC A;  2EYF A;  4KY7 A;  4DFA A;  1TQO A;  4DF7 A;  2EYL A;  4J6H A;  2EY1 A;  2F0T A;  2PYK A;  4QMG A;  1EY9 A;  2F3V A;  1AEX A;  4NKL A;  2OXP A;  3QOJ A;  1A3T A;  4K8J A;  2F0F A;  2EY6 A;  1IHZ A;  3ERO A;  3OMC A;  1F2M A;  4ODG A;  2EY2 A;  2LKV A;  5EKK A;  5CV4 A;  3NXW A;  3SK8 A;  3TP7 A;  4F8M A;  1STY A;  1SNP A;  3MZ5 A;  5KEE A;  4K5W A;  3C1F A;  4EVO A;  5F2D A;  4KHV A;  5JAV A;  5KRU A;  2F0I A;  3SHL A;  4YIJ A;  5IGB A;  2F0V A;  2F0D A;  3ERQ A;  2EYO A;  1EZ6 A;  2KQ3 A;  4ID6 A;  1EYD A;  4N9T A;  4K2L A;  5M9O A;  2F0E A;  2F0H A;  1EYC A;  5C4H A;  4S3S A;  1A2T A;  1EY6 A;  3D4W A;  2F0P A;  4WOR A;  1KDC A;  1TT2 A;  2HQE A;  4ZUJ A;  3SR1 A;  4DU9 A;  3E5S A;  5CGK A;  4QB4 A;  2EY5 A;  2QDB A; 
#chains in the Genus database with same CATH topology
 2AWN A;  4PZ7 A;  3PIO A;  2NWG A;  2UUA L;  1NAP A;  4IAL A;  1SFO B;  5JJK A;  4A93 B;  1R4P B;  1XWE A;  2B8G A;  1ZYR D;  2RDF A;  3OWE B;  4C1N I;  1VMC A;  4H02 A;  2E2I B;  4C3J G;  3G6E A;  1RIP A;  3V2T A;  1HUM A;  3BZC A;  3NE5 B;  2VUM B;  1EWC A;  1K9M C;  5IGF A;  5EGT A;  3OTO L;  2NZ1 D;  4BY7 G;  1DOL A;  1S4Z A;  5C0X I;  2BA0 A;  4XT1 B;  5FK9 C;  4UP9 A;  1BCP C;  3SEB A;  3OIQ A;  4JI7 Q;  3ER0 A;  2RBM A;  4OXP A;  1AE2 A;  4IUT A;  4P72 A;  1K8A C;  4FNF A;  4XQJ A;  2L1B A;  1EWH A;  3UDF A;  4CGY B;  4DR7 L;  5CC4 A;  3CCV A;  1LLR D;  2Y0S G;  1TWA B;  4NXN L;  3S14 B;  3T51 B;  1YJN A;  3C46 A;  1UEB A;  2E76 C;  4UPA A;  1HR0 Q;  3A7A B;  4LFC Q;  1OTC A;  4K0K L;  4GKJ Q;  2L0C A;  4JI3 Q;  2FMM A;  2RA4 A;  3BS1 A;  3FDT A;  4GZY C;  1XMQ Q;  3NSW A;  2ENB A;  1J5E L;  2BH8 A;  3HEJ A;  4A3F B;  3ICE A;  4G57 A;  4KHP Q;  1JWS D;  2L4N A;  1KL9 A;  2L11 A;  1EIG A;  1YVC A;  2EY1 A;  2A6E D;  4QCL A;  3KFU A;  1G91 A;  4C3I B;  3DEP A;  3OMC A;  4ODG A;  5C44 H;  5M3F G;  1BQQ T;  4R4I A;  1X6O A;  1Y14 B;  2EQS A;  2ZM6 L;  3MZ5 A;  4K5W A;  3GV6 A;  1CKM A;  3F2D A;  1IZ6 A;  5IGB A;  1K83 H;  2VXW A;  1LTG D;  3TZU A;  1T5E A;  5FO9 B;  1SJH D;  3A56 A;  2IX1 A;  1P8L A;  4CDF C;  1L0Y B;  2N55 A;  2Q8T A;  1V1P B;  1PH9 A;  3P20 A;  1Q86 C;  3BU2 A;  5AJ3 L;  1KAA A;  3GV3 A;  1EFW A;  3IAY A;  1I4P A;  4KD3 A;  4C56 C;  4A3C H;  4Q0F A;  4ZYS A;  4H13 C;  1QUQ A;  2DJF C;  5HY6 A;  2L12 A;  4KKS A;  5ELO A;  4LW1 A;  1KHI A;  1PRT B;  3TBI B;  5KND A;  4MHE A;  3TS0 A;  3HOU B;  1OXT A;  3H0G B;  1EQV A;  1SFO H;  2JE6 I;  1Y1V B;  4JYA L;  4A93 H;  1B4O A;  4AYB B;  4AH6 A;  5CMD A;  1Q82 C;  3K57 A;  5EJW A;  4CKE A;  1E2V A;  1FJG L;  4PZ8 A;  2E2I H;  1NR2 A;  5I4D A;  1RJT A;  2FHT A;  4UHV A;  1BUV T;  1TWH B;  3HP3 A;  1EIF A;  4L6T B;  1CT1 D;  1D6E C;  2VUM H;  2R7Z G;  3CQZ B;  1W6J A;  1EZ8 A;  4JC0 A;  4QQB X;  4G4K A;  3VA5 A;  5JJZ A;  1A2U A;  3PUV A;  3R93 A;  1HA6 A;  1LTB D;  4DR6 Q;  4PQX A;  3S16 B;  3V05 A;  2K5V A;  1LTI D;  3HOX B;  2B63 B;  2QIL A;  2KVM A;  1ENA A;  4OWT B;  1OXS C;  1VQN A;  2JXM B;  4LAA A;  3VA7 A;  2GA4 B;  2K5N A;  1SNC A;  5EBC A;  4I65 A;  2PW5 A;  3HKZ G;  2ICE C;  5ELE A;  5FO7 B;  3P1H A;  1WTR A;  1HTP A;  1VQL A;  2F0W A;  1L1O B;  5C5L A;  1Z7T A;  3W2D A;  1IBM Q;  2MNA A;  2LMC B;  3DWA A;  1IW7 C;  4LF9 Q;  2WV6 D;  1JB7 A;  2RHS B;  3G7L A;  4OGQ C;  4G7Z C;  1IBL Q;  4A3F H;  1E1O A;  2CCZ A;  2D9U A;  1STY A;  5BR8 Q;  1VQH A;  3SHL A;  4QIW E;  1UNS A;  3CAM A;  4DR5 L;  1MKH A;  4QL5 A;  2FJ2 A;  1I3Q B;  4WJ3 M;  2XWJ B;  4ZUJ A;  3KJP A;  2F0P A;  1HZC A;  3G6J B;  2J4X A;  4P75 A;  4LNQ A;  3L2P A;  2BCO A;  2HHH L;  2Z8L A;  3E6Z X;  5KYI A;  1AN8 A;  1SDF A;  4JVZ A;  4NP5 A;  5IP9 G;  1V1Q A;  4IUR A;  4A3E B;  1IL8 A;  1K28 A;  4MNO A;  4BBS B;  1TKW B;  1D7Q A;  3NP8 A;  3F2C A;  3U9S A;  5CYU A;  2CH4 A;  2LSS A;  3A54 A;  1N8R C;  4K8I A;  3EN2 A;  3MXN B;  4MZ9 A;  3AEV A;  2K5D A;  1EIH A;  1U0L A;  2A6H C;  3CCQ A;  5EPJ A;  4QGU A;  2JEB I;  4DUZ Q;  3BVM A;  1RCV D;  4DV0 L;  2NTS A;  5HUR A;  2YTV A;  4N8X 1;  4DAY A;  2R92 H;  1PH6 A;  2B2Y A;  2JA5 H;  4DV4 L;  4DR1 Q;  2N3S A;  4CJ2 C;  4TKO B;  4LF5 Q;  4A3F G;  5IP7 G;  3JAM i;  1HZB A;  3AB9 A;  3NEN A;  4EQO A;  1QVC A;  1TR5 A;  2OF1 A;  1X56 A;  1Y1V H;  4NXM L;  2KA7 A;  3DWQ A;  1GUG A;  4IPH A;  3MA2 B;  4A3J B;  4IJL A;  3VR6 A;  4DV5 Q;  1H9K A;  1TWH H;  4C3I G;  4HCE A;  2IHF A;  1HNX Q;  2UUB Q;  3CQZ H;  1GKH A;  2IHE A;  4HED A;  2V1C C;  5NUC A;  5E1F A;  4A4I A;  1SYD A;  3W1G A;  1PYB A;  2UU9 Q;  4KHP L;  1IYJ B;  4HMJ A;  5ELB A;  2Y0S E;  2Z9H A;  5JOB A;  1GO3 E;  3S16 H;  3PIO 3;  3HOY G;  5KEE A;  5I9P A;  2DN8 A;  3HS0 C;  3HOX H;  5COY A;  2E5L L;  2EXD A;  3LGJ A;  2HT1 A;  3S2H H;  3OW2 A;  4KY7 A;  1H9S B;  1TQO A;  2G5D A;  1B3A A;  5FLM G;  3F1Z A;  2NBF A;  2PYK A;  2I5M X;  2A68 C;  2IL8 A;  3CKI B;  1LT6 D;  2HCC A;  4Y7N B;  2KEN A;  3JAM L;  1A3T A;  3BDO A;  4JI5 L;  4X66 Q;  4P71 A;  2OTJ A;  4HJ7 A;  1FL0 A;  4B3R Q;  3KLS X;  1X32 A;  3I2Z A;  4A3L G;  3K7A H;  1B9N A;  1VQB A;  5LMN L;  3HOU G;  2HIX A;  2R93 H;  3GTK B;  4J8Q A;  4N9T A;  1ZEQ X;  4X3K A;  3H0G G;  4L63 B;  1XNR Q;  2CW0 C;  4OX9 L;  3HOZ H;  2QW7 A;  2NB0 A;  5T1I A;  1X3E A;  1F9S A;  5D3D A;  4QB4 A;  1AH9 A;  1ML0 D;  4DUY Q;  1K73 C;  3T4A C;  1KIX A;  2ZJQ A;  1XXG A;  4AIM A;  1PRT F;  2MO0 A;  4OIK A;  3T13 A;  1PH3 A;  4JG2 A;  1HUN A;  3NBH A;  3WDN A;  1QE6 A;  2BOS A;  1I3Q H;  2WP8 J;  2PZU A;  4RWS C;  4KV6 A;  1JOQ A;  1HFN A;  1SMY D;  2EOT A;  3I4N B;  3QIA A;  2KUM A;  3J81 i;  1PH4 A;  2N78 A;  3VYR A;  4A3E H;  1ZXT A;  5IGD A;  1O7Z A;  3S1R H;  2ES2 A;  4LF6 L;  1DYQ A;  1K8O A;  2K7V A;  4QIW B;  2B63 G;  2CFM A;  3PUW A;  3Q0A A;  1JJ2 A;  3X3M A;  1M4V A;  1SYE A;  2CKZ B;  5FLX c;  4GOP B;  2K5W A;  4KY5 A;  5ELN A;  1WTO A;  1I6H B;  3K5M A;  3PV0 A;  1PH2 A;  1QNU A;  1FNW A;  4K14 A;  3VR5 A;  1G6Z A;  3TRZ A;  5C4X B;  1YJ9 A;  4YCW A;  2UUC L;  1HNW Q;  3P7J A;  2P5Z X;  1NTG A;  1U4M A;  1PRT D;  4V0B A;  5IGC A;  1TII D;  1SEB D;  3C1E A;  2C5C A;  3RZO B;  4JI4 L;  4ALP A;  2HDL A;  2XNA C;  2ZXP A;  4N8F A;  4DKA C;  4B3T L;  2K6A A;  2CH4 W;  3NEL A;  4GLA C;  1AP0 A;  2NVT B;  1L2F A;  3EQL C;  3J81 L;  4HTH A;  3BDC A;  1T5X D;  1NUC A;  4QJF A;  1ZYR C;  2UXC Q;  2IY5 B;  1CTM A;  2CWA A;  1K8G A;  3HOW B;  4RA8 A;  4GKK Q;  1N34 Q;  2MJ8 A;  1SRU A;  2WKC A;  1E24 A;  2EYF A;  4CHT B;  4DF7 A;  2RDH A;  3MFY A;  4YWL A;  3ULJ A;  1KNE A;  4EQ5 A;  2D2C C;  2PPB C;  2ZXR A;  1S5F D;  3AFQ A;  2EY6 A;  3EIV A;  4BBS G;  1J6Q A;  3W5O A;  3U50 C;  3HKZ E;  3TP7 A;  1S5C D;  2I07 B;  3J81 j;  3C1F A;  5LL6 S;  4XQN A;  1LTA D;  3L7Z C;  4ZK9 B;  1X3P A;  4DAP A;  4Y7N H;  2LS0 1;  1ESF A;  1PH8 A;  1KAW A;  1UUP A;  2Y0S B;  1T9H A;  4YHH Q;  1KLG D;  1VQ7 A;  1DJR D;  2AUJ D;  1EUJ A;  3K0Y A;  4MTK A;  3M9B A;  2EPB A;  5IYB G;  4ZAI A;  3J80 c;  1GM5 A;  4JI1 Q;  1TU2 B;  3D4D A;  4ZKC B;  2WB1 E;  3I73 A;  1A8V A;  5DNF A;  4HAE A;  5BN5 A;  4LF8 L;  4MTN A;  4NMZ A;  4A3J G;  2BDN A;  4KJN A;  1M8A A;  1VS0 A;  1LT4 D;  5G3L F;  1CM9 A;  1Q8K A;  4K6D A;  1JE5 A;  2GN5 A;  4X3U A;  1C8C A;  2OEO A;  2A6E C;  2E74 C;  2KBN A;  2B2V C;  2R3Z A;  3M4Y A;  2A69 D;  3DLL A;  1HNZ Q;  1FVI A;  1TWC B;  3DEO A;  4DV2 L;  2D5D A;  1ILQ A;  4WJ4 A;  4KN7 C;  3KDF B;  1MIU A;  3I4N H;  1HQM C;  3NUC A;  3S24 A;  1D1I A;  2CQO A;  4JPB W;  3K0X A;  4XTC S;  4HJ9 A;  4NW2 A;  4TRD A;  5CR3 A;  4R4T A;  3I7F A;  3ND9 A;  1N33 Q;  1QIL A;  4ME5 A;  1JOR A;  1K0S A;  1YEZ A;  1H9R A;  5IWA L;  5A2Q L;  1JIC A;  1I6H H;  1VQJ A;  3CPW A;  5IT9 L;  3C3L A;  3WOF A;  1EQR A;  2JP1 A;  5G3L D;  4F87 A;  2B2W A;  4JBK A;  3S2D B;  3GTQ B;  1ILP A;  3HOV G;  1PA6 A;  2QKI C;  2YU9 B;  4A3K H;  1BDO A;  1PZJ D;  2KHJ A;  2K04 A;  4DK0 A;  2GVA A;  1XMO Q;  1YBY A;  2FFK B;  4F7X A;  5EQ0 A;  2X69 A;  3IKJ A;  3LWE A;  2NVT H;  2EYL A;  4M1U B;  1B2T A;  4JI0 L;  2F3V A;  5EPK A;  1DOM A;  2JA7 B;  3CCE A;  2ZTC A;  1NNX A;  3U58 A;  1C7Y A;  1IHZ A;  3L9A X;  4PMW A;  2NZH A;  3DXJ C;  1GHK A;  3E3X A;  4XYQ A;  1J9O A;  4C3J H;  3GTO B;  4EVO A;  5GAD C;  4LUO A;  4KHV A;  4XDX A;  2OCE A;  1EL0 A;  4X65 L;  4XQQ A;  1BO0 A;  4K2L A;  3PO3 B;  1PZI D;  1I94 L;  4BY7 H;  2XGT A;  3FKI B;  1PTO F;  1XNQ L;  1FGU A;  1RTN A;  5CGK A;  1QZH A;  1YNX A;  5E7N A;  2F0O A;  1Q1B A;  2PW7 A;  3M4O B;  4RFB A;  1CSQ A;  5C4X G;  4LF4 Q;  2UXD Q;  1B50 A;  4QUF A;  1BBW A;  5E4X A;  2I46 A;  4KMU C;  1F2Z A;  3A5Z B;  3S17 B;  2PO4 A;  4IQZ A;  3HG9 A;  4MIU A;  2DJG C;  1VQA A;  3T16 A;  3A5U A;  2D0O A;  3UDG A;  2RQX A;  4B9W A;  2O5J C;  5C6A A;  3BYT B;  2EJM A;  4JI2 L;  1S40 A;  1F2Y A;  2XN9 C;  4ZKB B;  3HOW G;  3QO2 A;  1PTO D;  4POF A;  2H4O A;  4DV3 Q;  4POG A;  1ENF A;  3NEM A;  3H3V C;  1Y1W B;  4WRD A;  2E2H H;  1SE4 A;  1VF5 C;  3TRE A;  4FVM A;  3KLW A;  1N32 Q;  5K36 G;  5EAY A;  5I6W A;  2EE1 A;  2WB1 B;  1VQD A;  3QJY A;  1WD1 A;  3BYY B;  4BBR G;  4KLK A;  2QGQ A;  4A3G B;  1HXY D;  3EFX D;  5M3F H;  1OXU A;  1GUN A;  2XVS A;  2G9H D;  2VNU D;  3SVM A;  3MHB A;  2HUG A;  4JOI C;  5BN3 A;  3VYS A;  2AQ3 B;  2CQA A;  1SNQ A;  3TDQ A;  4DNI A;  1TXY A;  2SNS A;  4JI8 Q;  5IOC A;  4AQY L;  1XPU A;  1IL2 A;  5LMN W;  3S2D H;  2VY3 A;  3GTQ H;  1JCK B;  2YYZ A;  4NKL A;  2OXP A;  3ERO A;  5L37 A;  1I4Q A;  5C0X H;  2YTY A;  4ZCK A;  1E2W A;  1KQS A;  1S5B D;  4DV1 Q;  2YTX A;  3K5L A;  3FRP B;  1CZG A;  1X54 A;  1XYI A;  3PO2 G;  2Z1C A;  3ERQ A;  2KQ3 A;  2JA7 H;  4JI1 L;  3FPP A;  1TY0 A;  4JI6 Q;  1WYD A;  3RLO A;  1JWM D;  3GTO H;  4LWC A;  4A3B G;  4TVA B;  4PNY A;  3S1N B;  1RHP A;  2WII B;  3I91 A;  3QOL A;  1DD2 A;  2R7Z H;  1VQO A;  5IY0 A;  3T1Y Q;  1TY2 A;  3PMF A;  4ZUI A;  3H3V H;  4KKU A;  2F03 A;  1AFP A;  3I8Z A;  2ALY B;  4KK7 A;  4A3I B;  4B3S L;  4ME3 A;  1K0R A;  2BDO A;  1GXD C;  4KJO A;  1Z6H A;  3U9O A;  4OHJ A;  5HGT A;  4DR2 Q;  4KTA A;  3HOY B;  3RUZ A;  3GO5 A;  1Y8O B;  2O4X A;  1JT8 A;  3KLS A;  2VQF Q;  1D2B A;  1N33 L;  4DXF A;  5KGU A;  1MSG A;  1PZK D;  5C0X G;  1PFB A;  4FF2 A;  3OOC A;  2MGS A;  4IPC A;  4LF7 Q;  4CDD C;  5D14 A;  3RZD B;  4XT3 B;  4A3M G;  2C35 B;  4DR3 Q;  3PCO B;  3S9W A;  3I55 A;  1SJE D;  3HRZ C;  1EY7 A;  3URY A;  2PI2 E;  2JA7 G;  2JA8 B;  3CCM A;  4KN4 C;  4O1N A;  4G7H C;  1D5Z C;  1A6X A;  5ELF A;  1EEI D;  4I7A A;  1MJC A;  2RKS A;  3CCL A;  3HFZ B;  1K3R A;  1PVO A;  4IO9 A;  3OHX C;  2VL6 A;  3PO3 G;  2RSN A;  1L0X B;  1VQI A;  1O7L A;  2CWP A;  2JSO A;  2Q8I B;  3WOE A;  3FKI G;  3TP5 A;  2KCC A;  3JC6 6;  4NPS A;  1YNN D;  4IFD I;  1N36 L;  2F3I A;  4JK1 C;  1E3P A;  3T1H L;  2LFN A;  5IP9 H;  1EWI A;  1WCM B;  2Q8R E;  1CHQ D;  5M5Y B;  4YY3 Q;  1LM0 A;  1PFS A;  4DK3 C;  4OON A;  2L9H A;  5F2D A;  1TWA H;  2N88 A;  3S14 H;  3RN2 A;  1UAP A;  4DAY B;  1PRT C;  1EZ6 A;  1EOV A;  3MC0 B;  3MAQ A;  2NVX B;  4YCV A;  4DV7 Q;  2MFI A;  1LTS D;  1EY6 A;  2UXD L;  2VQE L;  2EY5 A;  3EA6 A;  3KF6 A;  3F2U A;  2K33 A;  5FJ8 G;  1XJV A;  3IL8 A;  3KF8 A;  5C0X J;  1MJE A;  1EQT A;  2E8G A;  4UP8 A;  2BH2 A;  5IP7 H;  1Y1W G;  4DV6 Q;  4HN7 A;  1CA5 A;  1V1P A;  3MXP A;  4LFA L;  1DGS A;  2PNH A;  1KDB A;  1BCP F;  4LFB L;  2IX3 A;  2WB1 G;  5H1S E;  2EYP A;  4HJ8 A;  3S1N H;  1F9P A;  4C3I H;  4CDC C;  5C3W A;  4A3G G;  2IPK D;  1RTO A;  3M7G A;  1VQ4 A;  3O13 A;  1IYU A;  1UE7 A;  2XRS D;  3NWT A;  4R8I A;  3D6W A;  5C4J B;  4QUC A;  3K58 A;  2F0Q A;  5FLX E;  4B3M Q;  1SE8 A;  4N9P A;  2F0K A;  4L5S A;  2QCP X;  2RSO A;  4BY1 G;  1GOZ A;  3HOY H;  3HGB A;  4FO2 A;  2JQO A;  5AFW A;  1VMP A;  3HKS A;  1L1O C;  1VQF A;  4ZLT F;  1GD7 A;  1ASY A;  5FLM H;  4IUP A;  1EOT A;  4I7Z C;  4JBW A;  1WTW A;  4JI7 L;  2K1B A;  2RCN A;  2MO1 A;  3GTG B;  3SXH A;  1BCP D;  2CHB D;  1R9T B;  1I4X A;  1J8I A;  2OTL A;  4KHZ A;  2WKD A;  1XX8 A;  5I6Y A;  3E0E A;  3TQY A;  4A3L H;  3GP7 A;  3VR2 A;  3HOU H;  2F0N A;  4GS3 A;  3H0G H;  4R4O A;  1YIJ A;  1IBK Q;  1HR0 L;  1NSN S;  1YZ6 A;  3NK9 A;  4LFC L;  4L5T A;  2JA6 B;  4GKJ L;  1KRT A;  4JI3 L;  3CXC A;  3ZYY X;  4IOA A;  1WI5 A;  4P74 A;  4G7O C;  1C4Q A;  4M8A A;  1EY9 A;  2A69 C;  3K59 A;  1Y8P B;  4DPG A;  5HGQ A;  1XMQ L;  3N6R A;  1GVP A;  1LTR D;  3NXW A;  4BA2 I;  1B44 D;  4A3I G;  4CKB A;  3KOJ A;  1FR3 A;  5COR A;  3AMU A;  4GN4 B;  3H09 A;  1I5F A;  2F0H A;  4C3H B;  3GTP B;  4DR4 Q;  1I4H A;  3T1Y L;  2B63 H;  4CJ1 B;  1NE3 A;  4A76 A;  2ICI A;  2QEJ C;  4HIO A;  5M5Y H;  3D31 A;  1SAP A;  4L8J A;  3E9H A;  3I4L A;  3D6C A;  1OO9 B;  5KIX A;  5FOB B;  2K50 A;  1B9M A;  1PLF A;  1D5M C;  3J80 E;  5FO8 B;  3HOV B;  3FVQ A;  3PF4 A;  1MD2 D;  3LNN A;  3L3O C;  2EIF A;  4DNR B;  4GNX B;  2JA8 G;  1HA5 A;  4V19 0;  3ONA B;  2M00 A;  3PQI A;  3I4O A;  5LMU Q;  3CC2 A;  1LV9 A;  1PV4 A;  3A7L A;  1RDP D;  2WAC A;  2WFW A;  4X3T A;  4WFN 3;  4RAU C;  1DXM A;  5JPN C;  2HCI A;  4FF3 A;  1PYW D;  3KJO A;  4X62 Q;  1STB A;  1CKO A;  3Q24 A;  1S3O A;  3PIP A;  1PTO B;  3DWP A;  4UY8 C;  1P16 A;  1BBX C;  3OWF A;  1CQV A;  3D8G A;  2Q2H A;  5IYD H;  4CBV A;  1XTD A;  1BXT A;  3H94 A;  1WCM G;  3NQI A;  5DAU A;  4PZ6 A;  4FXG C;  4HCS A;  3CPF A;  4BBS H;  1L0W A;  2DNE A;  1S5E D;  2A19 A;  1IKL A;  1X55 A;  4X64 Q;  1FNU A;  3VR3 A;  2PZT A;  1JWU D;  2VB2 X;  2RVL A;  4DR6 L;  3OMG A;  3R2T A;  3K81 C;  4GNX C;  3JAM c;  2K14 A;  1D1K A;  4R4Q A;  2UXB Q;  3Q8D A;  2PQA B;  1KD1 C;  2Z6K C;  5M3M B;  5IYB H;  2MUY A;  3LWU A;  4QMG A;  5IE8 A;  1AEX A;  1LAB A;  2KCM A;  2TSS A;  3KK7 A;  2VS1 A;  5ELD A;  1CKN B;  3KYH C;  1UE5 A;  1E2Z A;  1IBM L;  2JA6 H;  5JJI A;  2K32 A;  4A3J H;  4YIJ A;  2UUA Q;  4R9W A;  4LF9 L;  3J80 L;  2EVB A;  4WJW A;  2X6G A;  4CKC A;  4ID6 A;  1SE2 A;  2N49 A;  1MGS A;  1X3G A;  3D0F A;  3MTS A;  1TWF B;  3WWV A;  1IBL L;  1IW7 D;  3I4M B;  1TT2 A;  2IWH A;  5IYD G;  2QEX A;  1OXX K;  4LFB Q;  5C3E G;  4GOP C;  5BR8 L;  4BBR B;  3K5O A;  4UDU C;  1QJO A;  2K28 A;  4IUN A;  3OTO Q;  1U9R A;  5J3B A;  2KCT A;  3GTP H;  1ESR A;  4TSS A;  2PCF B;  3J7A V;  4RCN A;  2G9D A;  1V43 A;  3DUZ A;  4Q5V A;  4P73 A;  1ET6 A;  1YNJ D;  2Q2U A;  4KKT A;  4OEL B;  1RKN A;  1EQQ A;  4DR7 Q;  1S5D D;  1VQC A;  2JA9 A;  4JW0 A;  3N52 A;  1MBY A;  4NXN Q;  1ENC A;  3HOV H;  1RL2 A;  3GTM B;  2A8V A;  1BNZ A;  2Z6B A;  4DK6 C;  4F88 A;  3GTK H;  4DXG A;  5DM7 3;  3NPP A;  2L5T A;  4K0K Q;  1U4P A;  4DUZ L;  3IRB A;  2A73 B;  5K5P A;  2JA6 G;  5C3X A;  1KNA A;  2WAQ E;  3PO2 B;  2A6H D;  3J81 c;  3TS2 A;  1NBW A;  4DR1 L;  2SOB A;  1Q8I A;  2LXK A;  4LK1 C;  4LF5 L;  3E0J A;  1ZKO A;  2R7D A;  1PFN A;  1TS4 A;  2F0L A;  1PTO H;  1G51 A;  3KUP A;  1QNK A;  1HCZ A;  3NQT A;  5EKI A;  4RGO S;  4DAM A;  4A3B B;  1IKM A;  4U67 3;  3QG1 A;  4DV5 L;  2K03 A;  1C9O A;  1HNX L;  4C3H G;  2UUB L;  1ICW A;  1Q12 A;  2NN6 I;  2BE5 D;  3MFG A;  2ZM6 Q;  2ZTD A;  3PUX A;  4JV5 Q;  4Y52 H;  2K4K A;  1C0A A;  2UU9 L;  3B6Y A;  5C4X H;  3M4Q A;  4GN5 A;  1OXV A;  2H1E A;  1B70 B;  2NVY B;  3SDZ A;  4FF1 A;  3QWN A;  4FDB A;  1PH1 A;  2QDL A;  2SDF A;  4ILW A;  3PGZ A;  4O0A A;  5AJ3 Q;  1JB3 A;  2F0V A;  2B2V A;  2F4V Q;  3RZO H;  3AU7 A;  1IXR A;  1VQM A;  1YHB A;  2F0E A;  1EIY B;  4A3M B;  4OO1 I;  5C4H A;  1M90 C;  4UP7 A;  1SRO A;  4X66 L;  3D4W A;  4WOR A;  2A68 D;  4GLV B;  3E5S A;  1Y69 U;  2QDB A;  4B3R L;  4JBM A;  1G2T A;  1A3U A;  3QB3 A;  1PXU A;  3HOW H;  2GVB A;  3TN2 A;  5DM6 3;  1VQP A;  1XNR L;  4JYA Q;  2NVQ B;  4DGZ A;  1TWF H;  4O2D A;  3S1M B;  4A3D B;  1FJG Q;  3RD4 A;  1I4R A;  3I4M H;  2A74 C;  5K36 H;  4FF4 A;  2CW0 D;  5LHY 1;  4IPG A;  4DUY L;  1A15 A;  3ULL A;  1VQK A;  2K75 A;  3S1Q B;  4BBR H;  2EXZ A;  5M5W B;  4BA1 I;  3PF5 A;  4X62 L;  3LX0 A;  4OL7 A;  1R4Q B;  3BDL A;  3STB D;  1SNO A;  1HZ9 A;  1H9M A;  4RKL A;  2B2T C;  1SMX A;  1GUS A;  1KAB A;  4B9X A;  2B39 A;  2VZA A;  4P2C B;  4IN3 A;  5IT9 c;  2RF4 A;  5D65 A;  5C5M A;  5M3M G;  3H15 A;  1STG A;  3GTM H;  3PUZ A;  1HR0 W;  4R1J A;  2TMP A;  4EQP A;  3CC7 A;  2NYZ D;  1O78 A;  3SK6 A;  2M2L A;  1VQ5 A;  2XWB B;  1HNW L;  1E7Z A;  2LY7 A;  4RKB A;  1BCP B;  1S72 A;  2EYH A;  4L5Q A;  3VYU A;  3PO2 H;  1EY5 A;  4BXX G;  3IFD A;  5CBE E;  4UAI A;  4K5X A;  3IFT A;  3CHB D;  4IOC A;  3I4M G;  3S15 B;  1KXL A;  1TWC H;  1NMG A;  1YI2 A;  4Z9C B;  4J6H A;  4DR5 Q;  2F0T A;  1DON A;  4A3B H;  4NB3 A;  1F9Q A;  1W2B A;  2UXC L;  2IT1 A;  2AHO B;  1XPO A;  3I90 A;  4OO1 G;  1SR3 A;  4GKK L;  2WAQ B;  3AQQ A;  1N34 L;  4BWG B;  2PNR C;  1SNP A;  2ZT9 C;  1XPR A;  1Q81 C;  4HIK A;  3CMA A;  2JK8 A;  2HHH Q;  2Z0S A;  4FXK C;  3MWY W;  2EYO A;  1RD9 D;  2BA1 A;  4BY1 B;  3CF5 A;  1SSO A;  1PFM A;  1E0B A;  3SR1 A;  1CSP A;  2K5H A;  2J0T D;  2NVY H;  1LTL A;  1VDZ A;  1WFQ A;  1BR9 A;  3CME A;  3PIP 3;  3MXU A;  1SE3 A;  4KD4 A;  2ZJR A;  4HR7 B;  2OWO A;  2CVR A;  1QUQ B;  2F0U A;  2YU9 H;  4ZQ3 A;  3M3Y B;  4RGT A;  3UE0 A;  4R8N A;  1STN A;  3EVQ A;  4DV0 Q;  2J7Z A;  1SBB B;  4A3M H;  2QA4 A;  4OWW B;  2I5H A;  2FMC A;  4YHH L;  4DV4 Q;  3SK4 A;  4HMI A;  2SNM A;  3MVV A;  5IGE A;  2JJQ A;  4CDE C;  4JOI A;  1YJW A;  1QVG A;  2NVQ H;  3A55 A;  4NXM Q;  2K01 A;  4IUV A;  1HQR D;  3H3V I;  4RGN A;  4RGM A;  3I56 A;  3S1M H;  4A3D H;  2EJG C;  2F52 A;  3MXG A;  3RN5 A;  5LL6 X;  2VB3 X;  2EYM A;  1H95 A;  1LTT D;  5GQO A;  4QF4 A;  3PO3 H;  3S1Q H;  5M5W H;  1FGB D;  5CV9 A;  5M5X B;  2VW9 A;  3FKI H;  1SYB A;  2NUC A;  1HNZ L;  3TME A;  1JOK A;  3BZD B;  3M4O H;  1TS5 A;  1UE6 A;  1TWG B;  3R8B A;  1QCB D;  5JEA H;  2PZW A;  4NDX A;  1WTH A;  3OYY A;  2E5L Q;  3ZJY C;  2K05 A;  1AW7 A;  1VQE A;  1CQF A;  5T1G A;  1STA A;  4GN3 B;  2DNC A;  3S17 H;  4JV5 L;  2ATW A;  4HSP A;  4GLX A;  3CU7 A;  2EDG A;  3P75 A;  3RMH A;  3KF6 B;  4BS9 A;  4JI5 Q;  3RR5 A;  3KF8 B;  3EJI A;  3Q22 A;  1N9W A;  5E3F A;  1II3 A;  1VQ8 A;  3TSS A;  1QZG A;  3VYT A;  1QB5 D;  3A8I E;  3A0J A;  4RHR A;  3F2B A;  1HRJ A;  1FNV A;  5FJ8 H;  4PG3 A;  5LMN Q;  3CC4 A;  5EPL A;  3QOJ A;  4OX9 Q;  2F4V L;  5EKK A;  3BG3 A;  1Y1W H;  3OPO A;  4A3D G;  1WTQ A;  1PYS B;  4F8M A;  1XMO L;  3S15 H;  3BJU A;  2R92 B;  5JAV A;  5KNC A;  2JA5 B;  2KEE A;  1SMY C;  5KNB A;  4A3G H;  1EYC A;  2DUD A;  3GTL B;  3RLN A;  1JMC A;  1V1O A;  1BOS A;  1KDC A;  2HQE A;  1HFG A;  1ICF B;  5JVH 3;  1V9P A;  2JEA I;  2E2J B;  3GTJ B;  1CA6 A;  1A62 A;  3TEH B;  3PSI A;  5E4W C;  2A5H A;  1WTV A;  5JEA G;  2I5L X;  1Z9F A;  4LF6 Q;  2R7F A;  4XXE A;  5CV7 A;  5C44 G;  4BY1 H;  2O5I C;  1UE1 A;  2EJF C;  1WOC A;  3M7N A;  1F2L A;  2F0G A;  2SEB D;  2UUC Q;  3SK5 A;  3M3Y H;  2RCF A;  3ULP A;  5GAE C;  4LF4 L;  5GAH C;  4IFD H;  3S2H B;  4ABN A;  2Q2I A;  4RCO A;  1B3Q A;  2DY8 A;  3TZD A;  3CP0 A;  1YHQ A;  5JVG 3;  3L0O A;  2AUK A;  2KHS A;  4JI4 Q;  2E75 C;  3CD6 A;  1IYV A;  1WVL A;  1SNM A;  4B3T Q;  2Q2T A;  4A3C G;  2IX0 A;  1YHA A;  2AWO A;  1WTX A;  1JOO A;  4TQU S;  5CBA E;  5D3I B;  4H44 C;  1X9N A;  2FXQ A;  3FHW A;  2KOL A;  1SYC A;  3K7A B;  2AKW B;  3ITP A;  3DM1 A;  2R93 B;  3OIP A;  4RG1 A;  1PH5 A;  4DA2 A;  4JBJ A;  1CUK A;  2B2U C;  4C1N K;  2WAQ G;  2H5X A;  3HOZ B;  4DV3 L;  4A93 G;  5M5X H;  5FKA C;  3DHQ A;  4ULL A;  2KEC A;  4A3I H;  5I9O A;  5C3E B;  1N32 L;  1SN8 A;  2VUM G;  1B1Z A;  1GUT A;  2B2Y C;  3H6M A;  1TWG H;  3NHH A;  1D8L A;  1YNJ C;  1AZP A;  1LT3 D;  1Q1E A;  2OQK A;  3CRL C;  4JCV E;  3KBX A;  3JAM E;  3BZK A;  1BKB A;  3K5N A;  1Y8N B;  1YIT A;  1V8Q A;  5JEA J;  4J15 A;  2RDG A;  1KTK A;  3D4R A;  1D5X C;  1X65 A;  2KED A;  3UE1 A;  4HIM A;  3S1R B;  4IFD G;  3RZD H;  2LKV A;  1M1K C;  1G8Z D;  1Q3L A;  3CCJ A;  4CJ0 B;  1U5K A;  4JI8 L;  3GQB A;  3RLF A;  1JJC B;  3I70 A;  1RF2 D;  2B2U A;  2JA8 H;  1DOK A;  2ASB A;  1B8A A;  1Z47 A;  4LMQ D;  3NBH B;  1JJG A;  2KHI A;  4LF8 Q;  1B7Y B;  4DV1 L;  4H0L C;  4A75 A;  5DLQ E;  1CI3 M;  1A63 A;  2HDM A;  1L1O A;  5I2X A;  4X6A H;  1CK1 A;  3NBI A;  5IYC H;  1VQ9 A;  3GTL H;  3NWS A;  3T53 B;  4DV2 Q;  5IOD A;  5J22 A;  1TS3 A;  3VR4 A;  2OQ0 A;  4JI6 L;  1NR4 A;  2B29 A;  5A35 A;  2XSC A;  2E2J H;  3GDE A;  4K6L A;  2BE5 C;  3GTJ H;  1WCM H;  4DN4 M;  3C2P A;  5M9O A;  4U68 A;  1Q46 A;  2DGY A;  1QVF A;  1I4G A;  1VF7 A;  2ZXO A;  2F3W A;  1EY8 A;  5IWA Q;  2RHQ B;  4DNT B;  3VDY A;  1X3F A;  2F0M A;  2NVX H;  4DR2 L;  4K2K A;  1JQY D;  2NZO A;  5FLX L;  4OEM B;  1QG7 A;  3MEF A;  2AMC B;  2VQF L;  4RH6 A;  2N8N A;  3I3C A;  3FEW X;  4HSV A;  1FD7 D;  5DEH A;  4YCU A;  4IFD J;  3J81 E;  4LF7 L;  5J39 A;  1W6K A;  3MXN A;  4DR3 L;  1Q7Y C;  2R92 G;  1U4L A;  2JA5 G;  4JI0 Q;  3TP6 A;  1TVX A;  1EYG A;  3U4V A;  1EU4 A;  4HID A;  1W3S A;  5IYC G;  5EKL A;  1EYA A;  1I6V C;  1Y1V G;  4AYB G;  1K3B C;  2OT2 A;  3BVG A;  3D3R A;  4C2M B;  5C3E H;  1AE3 A;  1VQG A;  4X65 Q;  5C4J H;  3J80 i;  1G2S A;  2F0F A;  1HPC A;  4YWK A;  3STB C;  1I94 Q;  3FPU B;  4DK1 A;  1AZQ A;  5CV4 A;  1XNQ Q;  1JE4 A;  1NJI C;  1EFI D;  3SGI A;  3W1B A;  1TS2 A;  1I50 B;  1F77 A;  3GTG H;  1BBU A;  2PI2 A;  4YWM A;  1K8M A;  1R9T H;  3KLR A;  3HOX G;  3UDI A;  4DU9 A;  3BVZ A;  1ONL A;  1FYC A;  2KJX A;  4YY3 L;  1ASZ A;  1Q90 A;  2R61 A;  2AQ2 B;  1GUO A;  1SLJ A;  4KY6 A;  5GAG C;  2ZJP A;  3G71 A;  4K5V A;  2L15 A;  1H9S A;  5ISR A;  4MN3 A;  3OSO A;  5KYL A;  1ROD A;  1GUW A;  1A3V A;  1PTO C;  4DV7 L;  1EU3 A;  4PV1 C;  2XTI A;  4DAV A;  4JI2 Q;  2R6G A;  5J1Z A;  3HZX A;  2KCN A;  4A3K B;  1G29 1;  2R93 G;  2B3G A;  1UWV A;  3GD7 A;  3F8T A;  3HOZ G;  2IJ0 A;  3J7Y W;  4O42 A;  4ZRZ A;  4DV6 L;  2M9V A;  2PMZ E;  4GNX A;  3G4S A;  2NTT A;  3AFP A;  2WIN B;  1GHJ A;  2F0J A;  1A0I A;  2LXJ A;  2I0Q A;  4J1M A;  2Z6K A;  3W3A A;  1MI2 A;  4C3H H;  3A8J E;  5JPM C;  2K52 A;  5A2Q E;  4C3J B;  1SYF A;  1LO5 D;  2D0P A;  1SND A;  2EZV A;  3ND8 A;  1LT5 D;  1O80 A;  5IT9 E;  3CCS A;  1DM0 B;  1BVS A;  2F0S A;  2ZTE A;  4A3E G;  3DMU A;  1PH7 A;  1O7Y A;  4B3M L;  3E9I A;  3M85 A;  4BY7 B;  2Z4I A;  4AQY Q;  2JYO A;  1H9J A;  3U4Z A;  3FP9 A;  4LJZ C;  1GJX A;  2IW3 A;  4IJH A;  4PMC A;  5CV8 A;  2K5Q A;  3CCU A;  4EX5 A;  4RHS A;  2ID0 A;  2DY7 A;  5I2Y A;  3MEH A;  1VQ6 A;  1CZW A;  4GOP A;  2PQE A;  3EBE A;  2D62 A;  4DFA A;  1STE A;  5BN4 A;  2L55 A;  1KLU D;  1J5E Q;  1KRS A;  2XRQ D;  3J7A 5;  1BF4 A;  3CW2 C;  2PQA A;  4OIJ A;  1IBK L;  3K80 C;  4IUU A;  2HQL A;  2O2L D;  3AYH B;  1HTL D;  3X3N A;  4C2M H;  2F0D A;  4FXD A;  2B2W C;  4RMF A;  3A8K E;  1CKN A;  2YV5 A;  4HJ5 A;  3DM3 A;  4APV A;  1HH2 P;  2MHV A;  2F1M A;  4KI0 A;  4S3S A;  2E2H B;  4B3S Q;  2B8F A;  3UI2 A;  1E22 A;  1CFM A;  1QWY A;  3KBG A;  2MQH A;  4EGV A;  2Z4H A;  1HJP A;  3K7U C;  1I50 H;  1MHW C;  1X3Q A;  4L5R C;  1O7I A;  4E6I A;  1WD0 A;  5M3F B;  4DR4 L;  3Q6S A;  5EBD A;  1C48 A;  5M3M H;  4EQN A;  3M4P A;  1UEA B;  2EYJ A;  4H7B A;  3NTI A;  2MP1 A;  4R4C A;  5CV6 A;  5GRO A;  1STH A;  2NN6 H;  2A1A A;  5CV5 A;  4HJA A;  5TSS A;  4OWX B;  1QOH A;  1PDQ A;  1E1T A;  1JR0 D;  2E2D C;  4X3S A;  4BXX H;  1SYG A;  5IGG A;  3J7A F;  5JJL A;  3A74 A;  3FMC A;  5LMU L;  1LUZ A;  4FYD A;  1KC8 C;  5IIF A;  1DZ1 A;  3R3O A;  4IUQ A;  1DCZ A;  3TP8 A;  3Q23 A;  1XTC D;  1F9R A;  2QF7 A;  1YNN C;  3R2I A;  4FP5 D;  3J7Z C;  3V96 A;  2JN4 A;  1EY4 A;  3G48 A;  2MPM A;  4OO1 H;  3RNU A;  1KDA A;  4XIG S;  3QR8 A;  2V4D A;  3K8A A;  1WJJ A;  1N36 Q;  4PMB A;  3CRK C;  3T1H Q;  1U4R A;  4QY7 A;  3I4N G;  5ELC A;  1EY0 A;  2R7Z B;  1G6P A;  2PMZ B;  1LAC A;  1NMF A;  3OW7 A;  5C44 B;  3I72 A;  4IZ8 A;  3KDF A;  5C4Z A;  3T56 B;  1LYL A;  3NTK A;  4X64 L;  1K83 B;  4LUV A;  1VCI A;  4K8J A;  2X6L A;  2NN6 G;  1MSH A;  1SXT A;  3ERS X;  1F2M A;  1HZA A;  2XIW A;  4LUZ A;  3SE0 A;  2EY2 A;  1ET9 A;  2HD3 A;  4IPD A;  2FIN B;  1WTP A;  3SK8 A;  2VQE Q;  1PHJ A;  2UXB L;  3NTH A;  1NY4 A;  2HIV A;  5KRU A;  2F0I A;  4AYB E;  3CCR A;  2C9O A;  4A3K G;  4XYO A;  4B08 A;  3UDX A;  1PMR A;  1B53 A;  1EYD A;  3K6O A;  1HHV A;  3PUY A;  3HKZ B;  2F4I A;  1A2T A;  2AQ1 B;  2B2T A;  1NCV A;  4LFA Q;  1EEF D;  3H91 A;  1JC7 A;  1CHP D; 
#chains in the Genus database with same CATH homology
 2AWN A;  2NWG A;  1NAP A;  4IAL A;  1SFO B;  4A93 B;  1R4P B;  1XWE A;  2B8G A;  1ZYR D;  2RDF A;  3OWE B;  4C1N I;  1VMC A;  2E2I B;  4C3J G;  3V2T A;  1HUM A;  3NE5 B;  2VUM B;  1EWC A;  5IGF A;  5EGT A;  2NZ1 D;  1DOL A;  1S4Z A;  5C0X I;  2BA0 A;  4XT1 B;  5FK9 C;  1BCP C;  3SEB A;  3OIQ A;  2RBM A;  4IUT A;  4FNF A;  4XQJ A;  2L1B A;  1EWH A;  4CGY B;  5CC4 A;  1LLR D;  1TWA B;  3S14 B;  3T51 B;  3C46 A;  2E76 C;  3A7A B;  2L0C A;  2FMM A;  2RA4 A;  3BS1 A;  3FDT A;  4GZY C;  3NSW A;  2ENB A;  3HEJ A;  4A3F B;  4G57 A;  1JWS D;  2L4N A;  2L11 A;  1EIG A;  2EY1 A;  2A6E D;  4QCL A;  1G91 A;  4C3I B;  3DEP A;  3OMC A;  4ODG A;  1BQQ T;  3MZ5 A;  4K5W A;  3GV6 A;  5IGB A;  2VXW A;  1LTG D;  3TZU A;  1T5E A;  5FO9 B;  1SJH D;  3A56 A;  2IX1 A;  1L0Y B;  2N55 A;  2Q8T A;  1V1P B;  3P20 A;  1KAA A;  3GV3 A;  3IAY A;  1I4P A;  4KD3 A;  4C56 C;  4Q0F A;  4ZYS A;  4H13 C;  2L12 A;  4KKS A;  1PRT B;  3TBI B;  5KND A;  4MHE A;  3HOU B;  1OXT A;  3H0G B;  1EQV A;  2JE6 I;  1Y1V B;  1B4O A;  4AYB B;  5CMD A;  3K57 A;  5EJW A;  4CKE A;  1E2V A;  1NR2 A;  5I4D A;  1RJT A;  2FHT A;  1BUV T;  1TWH B;  3HP3 A;  4L6T B;  1CT1 D;  1D6E C;  3CQZ B;  1W6J A;  1EZ8 A;  4G4K A;  3VA5 A;  5JJZ A;  1A2U A;  3PUV A;  3R93 A;  1HA6 A;  1LTB D;  4PQX A;  3S16 B;  3V05 A;  1LTI D;  3HOX B;  2B63 B;  2QIL A;  2KVM A;  1ENA A;  1OXS C;  2JXM B;  4LAA A;  3VA7 A;  2GA4 B;  1SNC A;  5EBC A;  4I65 A;  2PW5 A;  2ICE C;  5ELE A;  5FO7 B;  3P1H A;  1WTR A;  1HTP A;  2F0W A;  5C5L A;  1Z7T A;  3W2D A;  2LMC B;  3DWA A;  1IW7 C;  2WV6 D;  3G7L A;  4OGQ C;  4G7Z C;  2D9U A;  1STY A;  3SHL A;  1UNS A;  2FJ2 A;  1I3Q B;  2XWJ B;  4ZUJ A;  2F0P A;  3G6J B;  2J4X A;  2BCO A;  2Z8L A;  3E6Z X;  5KYI A;  1AN8 A;  1SDF A;  4A3E B;  4NP5 A;  4IUR A;  1IL8 A;  4BBS B;  1TKW B;  3NP8 A;  3U9S A;  5CYU A;  3A54 A;  4K8I A;  2K5D A;  1EIH A;  2A6H C;  5EPJ A;  2JEB I;  3BVM A;  1RCV D;  2NTS A;  5HUR A;  4DAY A;  2B2Y A;  4CJ2 C;  4TKO B;  3AB9 A;  4EQO A;  1TR5 A;  2OF1 A;  2KA7 A;  3DWQ A;  1GUG A;  3MA2 B;  4A3J B;  3VR6 A;  1H9K A;  4C3I G;  4HCE A;  4HED A;  5NUC A;  5E1F A;  1SYD A;  4HMJ A;  5ELB A;  5JOB A;  3PIO 3;  5KEE A;  5I9P A;  2DN8 A;  3HS0 C;  5COY A;  4KY7 A;  1H9S B;  1TQO A;  1B3A A;  2IL8 A;  2NBF A;  2PYK A;  2A68 C;  3CKI B;  1LT6 D;  2HCC A;  4Y7N B;  3JAM L;  1A3T A;  3BDO A;  3KLS X;  1X32 A;  1B9N A;  3GTK B;  4J8Q A;  4N9T A;  1ZEQ X;  4X3K A;  4L63 B;  2CW0 C;  2NB0 A;  5T1I A;  1F9S A;  5D3D A;  4QB4 A;  1ML0 D;  3T4A C;  1XXG A;  1PRT F;  4OIK A;  3T13 A;  1HUN A;  3NBH A;  3WDN A;  1QE6 A;  2BOS A;  2WP8 J;  2PZU A;  4RWS C;  4KV6 A;  1JOQ A;  1HFN A;  1SMY D;  2EOT A;  3I4N B;  3QIA A;  2KUM A;  3VYR A;  1ZXT A;  5IGD A;  1O7Z A;  1DYQ A;  1K8O A;  2K7V A;  4QIW B;  3PUW A;  3Q0A A;  3X3M A;  1M4V A;  1SYE A;  2K5W A;  4KY5 A;  1WTO A;  1I6H B;  3K5M A;  3PV0 A;  1QNU A;  1FNW A;  4K14 A;  3VR5 A;  1G6Z A;  5C4X B;  3P7J A;  1U4M A;  1PRT D;  4V0B A;  5IGC A;  1TII D;  1SEB D;  3C1E A;  2C5C A;  3RZO B;  2HDL A;  2XNA C;  2ZXP A;  2K6A A;  1AP0 A;  2NVT B;  3EQL C;  3J81 L;  4HTH A;  3BDC A;  1T5X D;  1NUC A;  1ZYR C;  1CTM A;  3HOW B;  4RA8 A;  2MJ8 A;  2WKC A;  2EYF A;  4CHT B;  4DF7 A;  2RDH A;  3MFY A;  1KNE A;  2D2C C;  2PPB C;  2ZXR A;  1S5F D;  2EY6 A;  3TP7 A;  1S5C D;  2I07 B;  3C1F A;  5LL6 S;  4XQN A;  1LTA D;  3L7Z C;  4ZK9 B;  1X3P A;  4DAP A;  2LS0 1;  1ESF A;  1UUP A;  2Y0S B;  1KLG D;  1DJR D;  2AUJ D;  3K0Y A;  2EPB A;  4ZAI A;  1TU2 B;  3D4D A;  4ZKC B;  3I73 A;  5DNF A;  4HAE A;  5BN5 A;  4NMZ A;  2BDN A;  4KJN A;  1M8A A;  1LT4 D;  5G3L F;  1CM9 A;  4K6D A;  4X3U A;  1C8C A;  2OEO A;  2A6E C;  2E74 C;  3M4Y A;  2B2V C;  2R3Z A;  2A69 D;  1TWC B;  3DEO A;  2D5D A;  1ILQ A;  4KN7 C;  1HQM C;  3NUC A;  1D1I A;  4XTC S;  4NW2 A;  4TRD A;  5CR3 A;  3ND9 A;  1QIL A;  4ME5 A;  1JOR A;  1H9R A;  5A2Q L;  1JIC A;  5IT9 L;  3C3L A;  3WOF A;  2JP1 A;  5G3L D;  4F87 A;  2B2W A;  3S2D B;  3GTQ B;  1ILP A;  2QKI C;  2YU9 B;  1BDO A;  1PZJ D;  2K04 A;  4DK0 A;  2FFK B;  4F7X A;  5EQ0 A;  2X69 A;  3IKJ A;  3LWE A;  2EYL A;  4M1U B;  1B2T A;  2F3V A;  5EPK A;  1DOM A;  2JA7 B;  1IHZ A;  3L9A X;  4PMW A;  3DXJ C;  1GHK A;  4XYQ A;  1J9O A;  3GTO B;  4EVO A;  4KHV A;  4XDX A;  1EL0 A;  4XQQ A;  1BO0 A;  4K2L A;  3PO3 B;  1PZI D;  3FKI B;  1PTO F;  1RTN A;  5CGK A;  2F0O A;  1Q1B A;  2PW7 A;  3M4O B;  4RFB A;  1B50 A;  4QUF A;  5E4X A;  2I46 A;  4KMU C;  1F2Z A;  3S17 B;  2PO4 A;  4IQZ A;  3HG9 A;  4MIU A;  3T16 A;  2RQX A;  4B9W A;  2O5J C;  5C6A A;  3BYT B;  2EJM A;  1F2Y A;  2XN9 C;  4ZKB B;  3QO2 A;  1PTO D;  2H4O A;  1ENF A;  3H3V C;  1Y1W B;  4WRD A;  1SE4 A;  1VF5 C;  4FVM A;  5K36 G;  5I6W A;  2EE1 A;  2WB1 B;  3QJY A;  1WD1 A;  3BYY B;  4A3G B;  1HXY D;  3EFX D;  1OXU A;  1GUN A;  2XVS A;  2G9H D;  2VNU D;  3SVM A;  3MHB A;  2HUG A;  5BN3 A;  3VYS A;  2AQ3 B;  2CQA A;  1SNQ A;  3TDQ A;  2SNS A;  5IOC A;  1JCK B;  2YYZ A;  4NKL A;  2OXP A;  3ERO A;  1I4Q A;  5C0X H;  1E2W A;  1S5B D;  3K5L A;  3FRP B;  1CZG A;  1XYI A;  2Z1C A;  3ERQ A;  2KQ3 A;  3FPP A;  1TY0 A;  1JWM D;  4PNY A;  3S1N B;  1RHP A;  2WII B;  3I91 A;  3QOL A;  1DD2 A;  1TY2 A;  3PMF A;  4ZUI A;  4KKU A;  2F03 A;  1AFP A;  3I8Z A;  4KK7 A;  4A3I B;  2BDO A;  1GXD C;  4KJO A;  1Z6H A;  3U9O A;  4OHJ A;  5HGT A;  4KTA A;  3HOY B;  3RUZ A;  3GO5 A;  1Y8O B;  2O4X A;  3KLS A;  1D2B A;  4DXF A;  5KGU A;  1MSG A;  1PZK D;  5C0X G;  1PFB A;  4FF2 A;  3OOC A;  2MGS A;  5D14 A;  3RZD B;  4XT3 B;  3S9W A;  1SJE D;  3HRZ C;  1EY7 A;  3URY A;  2JA8 B;  4KN4 C;  4O1N A;  4G7H C;  1D5Z C;  1A6X A;  5ELF A;  1EEI D;  2RKS A;  3OHX C;  2RSN A;  1L0X B;  2Q8I B;  1O7L A;  2JSO A;  3WOE A;  3TP5 A;  2KCC A;  1YNN D;  4IFD I;  4JK1 C;  2LFN A;  1WCM B;  2Q8R E;  1CHQ D;  5M5Y B;  2L9H A;  5F2D A;  2N88 A;  1UAP A;  1PRT C;  1EZ6 A;  3MC0 B;  3MAQ A;  2NVX B;  1LTS D;  1EY6 A;  2EY5 A;  3EA6 A;  3F2U A;  2K33 A;  3IL8 A;  3KF8 A;  5C0X J;  1EQT A;  4HN7 A;  1CA5 A;  1V1P A;  3MXP A;  1KDB A;  1BCP F;  2IX3 A;  2EYP A;  1F9P A;  5C3W A;  2IPK D;  1RTO A;  3M7G A;  3O13 A;  1IYU A;  2XRS D;  4R8I A;  3NWT A;  3D6W A;  5C4J B;  4QUC A;  3K58 A;  2F0Q A;  5FLX E;  4N9P A;  2F0K A;  2QCP X;  2RSO A;  1GOZ A;  3HGB A;  4FO2 A;  5AFW A;  1VMP A;  4ZLT F;  4IUP A;  1EOT A;  4I7Z C;  4JBW A;  1WTW A;  2K1B A;  3GTG B;  3SXH A;  1BCP D;  2CHB D;  1R9T B;  1I4X A;  1J8I A;  4KHZ A;  2WKD A;  5I6Y A;  1XX8 A;  3GP7 A;  3VR2 A;  2F0N A;  1NSN S;  3NK9 A;  2JA6 B;  3ZYY X;  4G7O C;  1C4Q A;  4M8A A;  1EY9 A;  2A69 C;  3K59 A;  1Y8P B;  3N6R A;  1LTR D;  3NXW A;  4BA2 I;  1B44 D;  4CKB A;  1FR3 A;  5COR A;  3AMU A;  3H09 A;  2F0H A;  4C3H B;  3GTP B;  1I4H A;  4CJ1 B;  2ICI A;  2QEJ C;  3D31 A;  1SAP A;  4L8J A;  3I4L A;  3D6C A;  1OO9 B;  5KIX A;  5FOB B;  1B9M A;  1PLF A;  1D5M C;  3J80 E;  5FO8 B;  3HOV B;  3FVQ A;  1MD2 D;  3LNN A;  3L3O C;  4DNR B;  1HA5 A;  4V19 0;  3ONA B;  2M00 A;  1LV9 A;  3A7L A;  1RDP D;  2WAC A;  4X3T A;  4WFN 3;  4RAU C;  1DXM A;  5JPN C;  2HCI A;  4FF3 A;  1PYW D;  1STB A;  3Q24 A;  1PTO B;  3DWP A;  1BBX C;  3OWF A;  1CQV A;  3D8G A;  4CBV A;  1BXT A;  3H94 A;  5DAU A;  3NQI A;  4FXG C;  4HCS A;  2DNE A;  1S5E D;  1IKL A;  1FNU A;  3VR3 A;  2PZT A;  1JWU D;  2VB2 X;  2RVL A;  3OMG A;  3R2T A;  1D1K A;  5M3M B;  2MUY A;  3LWU A;  4QMG A;  1AEX A;  1LAB A;  2TSS A;  3KK7 A;  5ELD A;  1E2Z A;  2K32 A;  4YIJ A;  4R9W A;  3J80 L;  2EVB A;  4WJW A;  2X6G A;  4CKC A;  4ID6 A;  1SE2 A;  1MGS A;  3MTS A;  1TWF B;  1IW7 D;  3I4M B;  1TT2 A;  2IWH A;  1OXX K;  4BBR B;  3K5O A;  4UDU C;  1QJO A;  2K28 A;  4IUN A;  1U9R A;  1ESR A;  4TSS A;  2PCF B;  3J7A V;  4RCN A;  2G9D A;  1V43 A;  3DUZ A;  4Q5V A;  1ET6 A;  1YNJ D;  4KKT A;  1RKN A;  1S5D D;  3N52 A;  1MBY A;  1ENC A;  3GTM B;  1BNZ A;  4F88 A;  4DXG A;  5DM7 3;  3NPP A;  2L5T A;  1U4P A;  2A73 B;  5K5P A;  5C3X A;  1KNA A;  3PO2 B;  2A6H D;  2SOB A;  1Q8I A;  4LK1 C;  3E0J A;  1ZKO A;  1PFN A;  1TS4 A;  2F0L A;  1PTO H;  3KUP A;  1QNK A;  1HCZ A;  3NQT A;  5EKI A;  4RGO S;  4A3B B;  1IKM A;  4U67 3;  3QG1 A;  2K03 A;  4C3H G;  1ICW A;  1Q12 A;  2NN6 I;  2BE5 D;  3MFG A;  3PUX A;  1OXV A;  2H1E A;  2NVY B;  3SDZ A;  4FF1 A;  3QWN A;  2SDF A;  4ILW A;  1JB3 A;  2F0V A;  2B2V A;  3AU7 A;  2F0E A;  4A3M B;  4OO1 I;  5C4H A;  3D4W A;  4WOR A;  2A68 D;  3E5S A;  1Y69 U;  2QDB A;  1G2T A;  1A3U A;  1PXU A;  3QB3 A;  3TN2 A;  5DM6 3;  2NVQ B;  4DGZ A;  3S1M B;  4A3D B;  3RD4 A;  1I4R A;  2A74 C;  5K36 H;  4FF4 A;  2CW0 D;  5LHY 1;  1A15 A;  3S1Q B;  2EXZ A;  5M5W B;  4BA1 I;  3LX0 A;  4OL7 A;  1R4Q B;  3BDL A;  1SNO A;  1H9M A;  4RKL A;  2B2T C;  1GUS A;  1KAB A;  4B9X A;  2B39 A;  4P2C B;  4IN3 A;  5D65 A;  5C5M A;  1STG A;  3PUZ A;  4EQP A;  2TMP A;  2NYZ D;  1O78 A;  3SK6 A;  2M2L A;  2XWB B;  2LY7 A;  4RKB A;  1BCP B;  2EYH A;  3VYU A;  1EY5 A;  3IFD A;  5CBE E;  4UAI A;  4K5X A;  3IFT A;  3CHB D;  3S15 B;  4Z9C B;  4J6H A;  2F0T A;  1DON A;  1F9Q A;  2IT1 A;  3I90 A;  4OO1 G;  2WAQ B;  4BWG B;  2PNR C;  1SNP A;  2ZT9 C;  4FXK C;  3MWY W;  2EYO A;  1RD9 D;  2BA1 A;  4BY1 B;  1SSO A;  1PFM A;  1E0B A;  3SR1 A;  2J0T D;  1VDZ A;  1BR9 A;  3PIP 3;  3MXU A;  1SE3 A;  4KD4 A;  4HR7 B;  2CVR A;  2F0U A;  4ZQ3 A;  3M3Y B;  4RGT A;  4R8N A;  1STN A;  3EVQ A;  2J7Z A;  1SBB B;  2FMC A;  3SK4 A;  4HMI A;  2SNM A;  3MVV A;  5IGE A;  3A55 A;  2K01 A;  4IUV A;  1HQR D;  4RGN A;  4RGM A;  2EJG C;  3MXG A;  5LL6 X;  2VB3 X;  2EYM A;  1LTT D;  4QF4 A;  1FGB D;  5CV9 A;  5M5X B;  1SYB A;  2NUC A;  3TME A;  1JOK A;  3BZD B;  1TS5 A;  1TWG B;  3R8B A;  1QCB D;  5JEA H;  2PZW A;  4NDX A;  2K05 A;  1AW7 A;  1CQF A;  5T1G A;  1STA A;  2DNC A;  4HSP A;  3CU7 A;  2EDG A;  3P75 A;  3RMH A;  4BS9 A;  3EJI A;  3Q22 A;  5E3F A;  1II3 A;  3TSS A;  3VYT A;  1QB5 D;  3A8I E;  4RHR A;  1HRJ A;  1FNV A;  5EPL A;  3QOJ A;  5EKK A;  3BG3 A;  3OPO A;  1WTQ A;  4F8M A;  2R92 B;  5JAV A;  5KNC A;  2JA5 B;  2KEE A;  1SMY C;  5KNB A;  1EYC A;  3GTL B;  1BOS A;  1V1O A;  1KDC A;  2HQE A;  1HFG A;  5JVH 3;  2JEA I;  2E2J B;  3GTJ B;  1CA6 A;  5E4W C;  2A5H A;  1WTV A;  5JEA G;  4XXE A;  5CV7 A;  2O5I C;  2EJF C;  3M7N A;  1F2L A;  2F0G A;  2SEB D;  3SK5 A;  4IFD H;  3S2H B;  4ABN A;  4RCO A;  2DY8 A;  3TZD A;  5JVG 3;  2AUK A;  2KHS A;  2E75 C;  1IYV A;  1WVL A;  1SNM A;  2IX0 A;  2AWO A;  1WTX A;  1JOO A;  4TQU S;  5CBA E;  5D3I B;  4H44 C;  2KOL A;  1SYC A;  3K7A B;  3ITP A;  3DM1 A;  2R93 B;  3OIP A;  4DA2 A;  2B2U C;  4C1N K;  3HOZ B;  5FKA C;  3DHQ A;  4ULL A;  2KEC A;  5I9O A;  5C3E B;  1B1Z A;  1GUT A;  2B2Y C;  3H6M A;  3NHH A;  1YNJ C;  1AZP A;  1LT3 D;  1Q1E A;  3CRL C;  3KBX A;  3JAM E;  3K5N A;  1Y8N B;  1V8Q A;  5JEA J;  2RDG A;  1KTK A;  3D4R A;  1D5X C;  2KED A;  3S1R B;  4IFD G;  2LKV A;  1G8Z D;  1Q3L A;  4CJ0 B;  3GQB A;  3RLF A;  3I70 A;  1RF2 D;  2B2U A;  1DOK A;  1Z47 A;  4LMQ D;  4H0L C;  1CI3 M;  2HDM A;  5I2X A;  1CK1 A;  3NBI A;  3NWS A;  3T53 B;  5IOD A;  5J22 A;  1TS3 A;  3VR4 A;  1NR4 A;  5A35 A;  2XSC A;  4K6L A;  2BE5 C;  4DN4 M;  3C2P A;  5M9O A;  4U68 A;  1I4G A;  1VF7 A;  2ZXO A;  2F3W A;  1EY8 A;  4DNT B;  2F0M A;  4K2K A;  1JQY D;  5FLX L;  1QG7 A;  4RH6 A;  3I3C A;  4HSV A;  3FEW X;  1FD7 D;  5DEH A;  4IFD J;  3J81 E;  5J39 A;  1W6K A;  3MXN A;  1U4L A;  3TP6 A;  1TVX A;  1EU4 A;  5EKL A;  1EYA A;  1I6V C;  2OT2 A;  3BVG A;  3D3R A;  4C2M B;  1G2S A;  2F0F A;  1HPC A;  3FPU B;  4DK1 A;  1AZQ A;  5CV4 A;  1JE4 A;  1EFI D;  1TS2 A;  1I50 B;  1F77 A;  1K8M A;  3KLR A;  4DU9 A;  3BVZ A;  1ONL A;  1FYC A;  2KJX A;  1Q90 A;  2R61 A;  2AQ2 B;  1GUO A;  4KY6 A;  4K5V A;  1H9S A;  5ISR A;  4MN3 A;  3OSO A;  5KYL A;  1ROD A;  1GUW A;  1A3V A;  1PTO C;  1EU3 A;  4PV1 C;  4DAV A;  2R6G A;  5J1Z A;  3HZX A;  2KCN A;  4A3K B;  1G29 1;  3GD7 A;  2IJ0 A;  3J7Y W;  4O42 A;  4ZRZ A;  2M9V A;  2NTT A;  2WIN B;  1GHJ A;  2F0J A;  4J1M A;  3W3A A;  1MI2 A;  3A8J E;  5JPM C;  5A2Q E;  4C3J B;  1SYF A;  1LO5 D;  1SND A;  2EZV A;  3ND8 A;  1LT5 D;  1O80 A;  5IT9 E;  1DM0 B;  2F0S A;  3DMU A;  1O7Y A;  3M85 A;  4BY7 B;  2Z4I A;  2JYO A;  1H9J A;  4LJZ C;  1GJX A;  2IW3 A;  5CV8 A;  4PMC A;  2K5Q A;  4RHS A;  2ID0 A;  2DY7 A;  5I2Y A;  3MEH A;  1CZW A;  2PQE A;  2D62 A;  4DFA A;  1STE A;  5BN4 A;  2L55 A;  1KLU D;  2XRQ D;  1BF4 A;  4OIJ A;  4IUU A;  2O2L D;  1HTL D;  3X3N A;  2F0D A;  4FXD A;  2B2W C;  3A8K E;  2MHV A;  4KI0 A;  2F1M A;  4S3S A;  2E2H B;  3UI2 A;  2B8F A;  1CFM A;  1QWY A;  3KBG A;  4EGV A;  2Z4H A;  1X3Q A;  4E6I A;  1WD0 A;  5M3F B;  3Q6S A;  5EBD A;  1C48 A;  4EQN A;  1UEA B;  2EYJ A;  4H7B A;  3NTI A;  2MP1 A;  5CV6 A;  1STH A;  2NN6 H;  5CV5 A;  5TSS A;  1QOH A;  1PDQ A;  1JR0 D;  2E2D C;  4X3S A;  1SYG A;  5IGG A;  3J7A F;  3FMC A;  4FYD A;  5IIF A;  1DZ1 A;  3R3O A;  4IUQ A;  1DCZ A;  3TP8 A;  3Q23 A;  1XTC D;  1F9R A;  2QF7 A;  1YNN C;  3R2I A;  4FP5 D;  3V96 A;  1EY4 A;  2MPM A;  4OO1 H;  1KDA A;  4XIG S;  2V4D A;  4PMB A;  3CRK C;  1U4R A;  5ELC A;  1EY0 A;  2R7Z B;  2PMZ B;  1LAC A;  3OW7 A;  5C44 B;  3I72 A;  4IZ8 A;  5C4Z A;  3T56 B;  3NTK A;  1K83 B;  1VCI A;  4K8J A;  2X6L A;  2NN6 G;  1MSH A;  1SXT A;  1F2M A;  2XIW A;  3SE0 A;  2EY2 A;  1ET9 A;  2FIN B;  1WTP A;  3SK8 A;  3NTH A;  5KRU A;  2F0I A;  2C9O A;  4XYO A;  4B08 A;  1PMR A;  1B53 A;  1EYD A;  3K6O A;  1HHV A;  3PUY A;  3HKZ B;  2F4I A;  1A2T A;  2AQ1 B;  2B2T A;  1NCV A;  1EEF D;  3H91 A;  1JC7 A;  1CHP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...