1LTGD

The arg7lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the a subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title The Arg7Lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the A subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 20
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1995-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ltgD00
1LT5D 1L0YB 3DWAA 3BYYB 4RHRA 3MFGA 4DXFA 1EWCA 5I4DA 1HA5A 1LTGD 1FNUA 1RF2D 1I4HA 2QILA 1CK1A 1LT4D 2R61A 3KLSX 4L63B 4O1NA 1V1OA 2AQ1B 1LT3D 4Z9CB 1FNWA 1S5ED 1CHQD 3SEBA 1ET6A 5D3IB 1D6EC 1SJED 5ELCA 1LTRD 1BXTA 5D3DA 1LTBD 2SEBD 1SJHD 1V1PA 3V05A 4BWGB 3OWEB 2XN9C 1PZKD 1LO5D 1LTTD 1JWSD 1LTID 3R2TA 1D5ZC 1BCPB 3DWQA 1EEFD 1PTOH 1RD9D 1FGBD 2J4XA 4OHJA 3R2IA 1PZJD 4DXGA 2IPKD 1PRTF 4L6TB 1PTOB 2RDGA 3BYTB 1BCPF 3BVMA 5ELBA 3R8BA 1I4PA 1JQYD 1PTOF 2XNAC 3W2DA 4RGMA 4ZYSA 1PRTD 1CT1D 1SXTA 1F77A 2RDHA 1D5MC 1PRTC 1BCPD 1EEID 1BCPC 1I4QA 4UDUC 1SE2A 4RGOS 1I4RA 3DWPA 2CHBD 1UUPA 2Z8LA 1D5XC 1EU3A 1PTOD 1SEBD 2AQ3B 2NTTA 1XTCD 1STEA 2O2LD 1PTOC 1TY2A 2NTSA 1PRTB 1TS3A 1ESFA 1ENFA 1B1ZA 5FK9C 4RFBA 5ELEA 5ELDA 5FKAC 1LTSD 3BVGA 1TS4A 1TS5A 1AW7A 2AQ2B 1LTAD 1M4VA 1I4XA 4RH6A 1LT6D 1PYWD 1JWUD 2QEJC 1CQVA 1S5BD 1JR0D 1JWMD 1MD2D 1DYQA 1SBBB 1PZID 1RDPD 1B44D 1FD7D 1HXYD 1T5XD 1HQRD 1KLGD 1SE3A 1UNSA 3MC0B 1JCKB 1LLRD 3BVZA 1QILA 2XRQD 1RCVD 1V1PB 2WV6D 1EU4A 1EFID 2G9HD 3BZDB 2XRSD 4TSSA 2TSSA 1S5CD 1TS2A 2ICIA 3O13A 3EA6A 3CHBD 1ET9A 4RHSA 4C56C 1TY0A 5TSSA 3TSSA 1KTKA 1S5DD 1AN8A 3GP7A 1I4GA 2IJ0A 4K6LA 5ELFA 1FNVA 1XXGA 1HTLD 1SE4A 1GOZA 1KLUD 1CHPD 4RGNA 3EFXD 4RCOA 1DJRD 1S5FD 4RGTA 1L0XB 1G8ZD 3URYA
chains in the Genus database with same CATH superfamily
1XYIA 1N8RC 2L5TA 4X64L 4FP5D 3QJYA 4KJNA 2XSCA 3CU7A 4JI4L 1SYBA 3J81E 1HZBA 2PO4A 2G5DA 1LT3D 4LF5L 3SK6A 4JG2A 4B9WA 4NXML 3NBHB 4DV3L 3RN2A 1G2TA 3TS2A 3TN2A 4XT3B 1SNOA 5DAUA 3LGJA 1EY0A 3H15A 2ASBA 4DV4L 2Z9HA 2F0GA 1EEFD 1WYDA 1TWGB 3PO2B 3H09A 1EOVA 3S24A 3BYTB 4K14A 3HOYB 2EYFA 2WB1B 4BS9A 1B4OA 3HOVB 3NUCA 1J5EQ 3CRLC 4AYBB 3A5UA 3N6RA 2CKZB 1XNQL 3BZCA 1EYCA 1JOKA 3IAYA 3UDXA 5JJIA 1IYJB 2B2WA 1LACA 3DHQA 4G4KA 2YU9H 1EU3A 1MGSA 4ZCKA 3VYRA 3KFUA 3JAME 2A8VA 2E5LL 4JI2L 2A5HA 3KF6A 1NE3A 2CW0D 4QL5A 3ULPA 2K50A 2AQ2B 1FJGL 4QY7A 4JI3Q 2UXBL 2HHHL 5IYCH 3OMCA 1E7ZA 4Y52H 5M3MB 1S5BD 3NPPA 4A3BG 3PV0A 4FXKC 3FPPA 4CJ2C 5JAVA 4XIGS 4OWTB 1GKHA 1LLRD 1PA6A 1PV4A 4LJZC 4P75A 1WVLA 4POGA 1XWEA 3T1YQ 4JV5Q 1YVCA 3C1EA 3QB3A 1M8AA 4IFDJ 2BOSA 4XQNA 2Z6KA 3EJIA 2K7VA 4GLXA 2WAQG 3HRZC 3AMUA 2NVXB 1TWAH 1D2BA 3T1HQ 4OWXB 3KOJA 2Y0SB 4JI6Q 3S16H 4LF9Q 4YHHQ 1Z47A 5CORA 3VR5A 1L0YB 3P75A 4KN7C 3NQIA 3PSIA 1RTNA 3AFPA 2R61A 4RKBA 4IOAA 2K04A 1IBKQ 1NMGA 2UUCQ 4DV5Q 4P72A 3HOUG 4NMZA 3GTKH 1D5ZC 2JA5G 2P5ZX 4A3LH 5C4JH 3KDFA 2JXMB 4B3RL 4DV0Q 3AFQA 1S40A 3I4NB 1DZ1A 4M1UB 4IZ8A 2VQFL 4BA1I 3DEPA 2F0WA 4OX9L 1E22A 3R8BA 2KEDA 1U0LA 3K7UC 1M1KC 1KIXA 4IO9A 2XNAC 3Q23A 1F77A 3K7AH 1RL2A 1PRTC 2CWAA 3X3MA 1MJEA 4KN4C 2OXPA 4KKTA 2CHBD 4X62L 5JJLA 3AU7A 1K8MA 1OTCA 2QCPX 3D4WA 1WTPA 1VQ5A 3CW2C 3D6WA 2WACA 4EQOA 2MPMA 2OCEA 1BO0A 4DK0A 1KDBA 2IX1A 5KNCA 3CCMA 1A63A 1EWHA 4JK1C 2UXCL 4A4IA 4WJWA 5FO8B 1WD0A 1JWUD 2RCFA 4JI1L 3VR3A 3OTOQ 2EZVA 1HR0L 2QDBA 5C5LA 3KBGA 4GN4B 1PH7A 2PW5A 4K6DA 3WWVA 3D8GA 2NZOA 3HOZH 1STNA 5C4XH 2CQAA 3GTOH 2N78A 4OO1H 2PQEA 3FKIG 3VYTA 3OW2A 4C3JB 5GAEC 2UUAQ 4DNIA 2B63B 1EZ8A 2N8NA 4YCWA 3H0GG 3O13A 3GD7A 1B53A 2NVYB 2R7DA 1FL0A 5I9PA 3N52A 5M3FB 1R9TH 1CA5A 3M4OB 4B3SL 4IFDH 2FMCA 3VA5A 1EY9A 3UDIA 1YBYA 3KF8A 4R4TA 1DJRD 1VQFA 3PUZA 5I6WA 2R3ZA 1CFMA 2LSSA 3FDTA 3CD6A 4BY7H 4A3DG 4DXFA 5M5XH 4CJ1B 1GO3E 2HUGA 1HA5A 1F2YA 4X3SA 4A93H 3A0JA 1HTPA 1CTMA 1T9HA 4Y7NH 3SEBA 3U4ZA 4OXPA 3OIPA 4LUVA 5D3DA 2FJ2A 5M5WH 4DV2Q 2F0JA 2L11A 1R4QB 4G57A 4GNXB 2BDOA 1WTVA 2ZT9C 4FF1A 1KC8C 2K1BA 1JICA 2JA6B 1BCPB 5IT9E 4C3HH 1BOSA 1SYFA 4DF7A 2L12A 1STBA 3SGIA 1O7YA 4DAYA 4A3CH 1BCPF 2F3WA 5ELNA 5IIFA 1K0RA 4M8AA 4GOPC 5IP9G 1JT8A 2O4XA 5ELBA 5JJZA 1K3RA 4WORA 2R93G 4BBRH 1CZWA 1F2MA 2D0PA 1HNXL 4JCVE 2BE5D 4XQQA 1UUPA 3EVQA 4KHPL 2OF1A 4LK1C 5C3XA 4F8MA 3L7ZC 1B8AA 4DAPA 1IL8A 4EX5A 4JI8Q 2H1EA 3ITPA 1VQ9A 2F4VL 1DXMA 2NVQB 2F0DA 3DUZA 4LFBL 4QGUA 4PMBA 4RH6A 3RN5A 4IN3A 2KCTA 2RSOA 3PQIA 3Q6SA 1Q81C 4X3TA 4LF4L 3A55A 3T13A 3HOXH 2PI2A 5KNDA 1CKNA 1SE3A 2Y0SE 1CSPA 1TWFH 3NELA 3DM1A 1TS2A 4JI0L 3ZYYX 4R4OA 2ZM6Q 5L37A 5E4XA 2F0MA 5EAYA 2IJ0A 2VB2X 4YWKA 2JEAI 1YNJC 1EYDA 1KLUD 4ME5A 2E8GA 4RMFA 4OGQC 2DN8A 4LAAA 1S3OA 3A56A 4JI7L 1O7LA 3HS0C 4MTKA 3ICEA 1E2WA 3LWUA 1K8OA 3URYA 3HFZB 1CA6A 5I9OA 3AYHB 1PH6A 1SROA 3R93A 4HSVA 3CC2A 4HCEA 4DV6Q 4F87A 1C8CA 4FO2A 1BDOA 3E0JA 2AUJD 4LF8Q 1SJED 2L0CA 2AHOB 4CJ0B 1VQJA 1AP0A 1TWGH 1QB5D 4DU9A 1IYUA 1TWAB 1G6ZA 4JBKA 1TWCB 4LUOA 3CCJA 3HOVH 1PTOB 2EXZA 2PI2E 1QE6A 4KY7A 2MGSA 1JOOA 3PGZA 1DGSA 1P8LA 5CR3A 4X64Q 3KJPA 4IFDI 2L9HA 1AE3A 1PTOF 4DR2L 4JI4Q 2VB3X 1GD7A 3U58A 4WFN3 2R7ZG 4LF5Q 5C0XG 1T5EA 3K5MA 2Q2IA 4OIJA 2O2LD 4ZLTF 1YJNA 4DR4L 3I73A 3MXNA 1PRTB 2EYLA 1B3AA 1XPUA 4DV4Q 4ILWA 1VS0A 5FKAC 2NZHA 3GTKB 5M3MH 5C3WA 4CKBA 2K5HA 3GV3A 3GTMB 1PYWD 2ZTCA 2WAQB 4J1MA 2F0VA 1JOQA 4C2MH 5CV4A 4I7ZC 3CCEA 2ES2A 2XVSA 3K7AB 3STBD 1PH8A 4CHTB 4CGYB 3MC0B 4FF3A 1Y1VG 4PQXA 3S9WA 1K9MC 4QCLA 1NY4A 1HH2P 2KBNA 3B6YA 5CGKA 2E5LQ 4JI2Q 1G291 4NPSA 2M00A 5C44H 2A69D 3Q24A 4KK7A 3TSSA 1FJGQ 2V1CC 2QGQA 2HHHQ 2NVXH 1E1OA 2JA8G 5EJWA 3SHLA 3C2PA 4X6AH 3I56A 1WTHA 3FRPB 3HOUB 1MIUA 2B8FA 1TXYA 3TP7A 4BXXH 1DD2A 2JA5B 4CDEC 2K05A 5IY0A 3H94A 3OOCA 3KLRA 5IP7G 4FF2A 5C4XB 1ASZA 1I5FA 5EBDA 1ZYRD 4A75A 1G6PA 4RHRA 4HIOA 2IW3A 4K8IA 3D4DA 3UI2A 2QILA 1EYGA 3E6ZX 1MI2A 4H13C 2BH2A 1X6OA 3F2BA 2A68D 3SE0A 4DR1L 1C7YA 1JJCB 3GV6A 3HKSA 3V05A 1QNKA 2EY5A 3PIO3 3Q22A 2A6EC 1WCMG 2BA0A 5COYA 1SAPA 4R8IA 2RVLA 4DXGA 4IJLA 1XPOA 1GUSA 5HGQA 3QWNA 4X3KA 1NSNS 5M5XB 5CV5A 2QF7A 1Q46A 1X55A 1I4PA 1JQYD 4JBJA 3RUZA 3CCSA 1EWIA 3GTPB 4A93B 2F0PA 4JOIC 2E76C 3T53B 1YIJA 1HZAA 1A15A 1SYDA 4Y7NB 1I4RA 4A3JG 1ESRA 2J0TD 1SLJA 3OIQA 3AQQA 4QUCA 4AQYL 1ENCA 5M5WB 3H3VI 3H0GB 4IPDA 5JVH3 1VQBA 5JEAJ 4NXNL 4H44C 1K8GA 3HG9A 4GKKL 2K01A 4B3RQ 4LNQA 4FYDA 4RAUC 1VQ8A 1BNZA 3MEHA 1PFBA 2HCCA 3QO2A 1EY7A 2VQFQ 1YNNC 2A6HD 4DKAC 1DOLA 2VQEL 3CF5A 4OX9Q 2IX0A 1YZ6A 4BBRB 4C3JH 4P71A 3S15B 1YJ9A 2B63H 5T1IA 2G9DA 2JSOA 1VQGA 4ZKBB 3AB9A 4X62Q 4A3DB 1V1PB 4IUNA 1OXXK 3BU2A 1TWHB 1A8VA 1DOMA 1SNMA 4A3EG 3I55A 2ID0A 1S5CD 1B9MA 2A73B 4HJ8A 2ICIA 3TQYA 4KY6A 1PLFA 2RBMA 2JA9A 2Z6BA 3M4OH 5IOCA 5C6AA 2Q2UA 1HPCA 3OMGA 3S1RH 2UXCQ 4A3FG 5E3FA 5FO9B 2LFNA 3CCVA 2VS1A 2F0SA 2BDNA 4JI1Q 4DR6L 2NN6G 3PIPA 1HR0Q 4I7AA 1H9SA 1LYLA 2KVMA 3HOWG 4HJ7A 3GTLH 5FLMG 1VDZA 5J39A 4B9XA 3I3CA 3HOXB 1PYSB 2Q8IB 1TQOA 1PXUA 4DNRB 2KCMA 4JVZA 1TWFB 2VY3A 2K5QA 2KHJA 2R93B 3P1HA 1V1OA 3CMEA 2GVAA 5K36H 5FLXc 3TP6A 4ZUJA 5GADC 1Q7YC 3DEOA 1UEBA 1EZ6A 4LMQD 2HIXA 2JA6H 5LMNW 4B3SQ 2HT1A 3PO3G 1HNWL 2DJGC 4OHJA 1RD9D 3E9HA 4E6IA 1SE8A 2IPKD 4LW1A 3CC4A 3W2DA 3VR2A 4RGMA 1TKWB 1NAPA 1P16A 2Z4HA 4GNXC 1BF4A 3KLWA 1PFSA 4QMGA 1BCPC 4KLKA 2ZJQA 1H9RA 1QVFA 2DNEA 1Y1WG 4P73A 2CWPA 2TMPA 2NVQH 4IALA 4BY1G 1PH3A 1QOHA 5ELEA 2R92G 2WP8J 1I94L 1UE7A 2E2JH 5EPJA 5FJ8G 2M2LA 2Q8RE 4GOPA 3J7AF 1EOTA 1VQIA 2K32A 1KDAA 5JEAH 2IHEA 3NTHA 1VQ4A 1B3QA 4LF6L 1CI3M 1MD2D 2KA7A 5BR8L 3I72A 1HNXQ 4IPGA 4DV1L 3T16A 1IBML 4H0LC 1QCBD 2XGTA 2EY2A 1DOKA 1XMOL 1HUNA 2LS01 4KHPQ 2XRSD 2TSSA 5CV6A 5EGTA 3HEJA 2HCIA 2LMCB 3HKZG 2EE1A 5TSSA 2F4VQ 3M9BA 2DUDA 3HZXA 3SR1A 1QG7A 4LFBQ 4FXDA 5IGEA 4QQBX 3E9IA 4EQPA 5I2YA 1Y69U 3I70A 4QIWB 4ABNA 1GXDC 1S5FD 4LF4Q 4C2MB 2PZUA 1HHVA 3BDOA 1EWCA 1I3QH 5I4DA 1KRSA 2B2TC 2JQOA 3EBEA 3P7JA 4Z9CB 1U9RA 4JI0Q 4K2KA 3RZOH 2IX3A 2R7ZB 1X3FA 3NEMA 4LWCA 1QUQA 3W5OA 4XYOA 5C44B 4L8JA 2R6GA 1BXTA 1V1QA 1TWCH 3G48A 1E2ZA 4YCUA 1PHJA 4KD3A 1PTOH 2YTYA 4KD4A 4JI7Q 2B3GA 2SOBA 4EQNA 1JJGA 2X69A 3I4LA 1U4RA 2CCZA 4ZYSA 1W2BA 1E24A 3U4VA 4MTNA 1CSQA 4S3SA 5IWAL 3QG1A 1STYA 1IW7D 1W6KA 1N36L 1PTOC 3IFDA 1K8AC 4RWSC 1N34L 3VR4A 3NHHA 2K28A 3D4RA 1TS5A 3GTMH 3M7GA 4ZAIA 1LTAD 1IKLA 3NBHA 1XJVA 5FOBB 1V8QA 1GUTA 3OWFA 2PNRC 1D8LA 3MEFA 4DNTB 1SN8A 3M85A 1J6QA 4DA2A 4I65A 1D1KA 1DM0B 4DR2Q 1PZID 2IHFA 5A2QL 4RA8A 3FEWX 5C5MA 1JJ2A 1QNUA 5CBAE 5CYUA 4R9WA 2EJFC 4PMWA 1X3GA 4DR4Q 2ZTDA 3A8JE 2VUMG 1K28A 1I50B 3TP5A 1EYAA 1HZ9A 4IPHA 1TY0A 3QR8A 3J80c 4B3MQ 3HOUH 2HDMA 2EY6A 3KLSA 2KECA 3M3YH 2JA5H 1Q8KA 4O42A 3TP8A 3U50C 1G2SA 1NR4A 4J8QA 1QZHA 1AZQA 2XTIA 3PUVA 4DR5L 2NVTH 1V43A 1FVIA 4L5RC 3MFGA 1X3EA 1HR0W 2R7FA 2JA7G 4DK6C 3OHXC 3KLSX 2AQ1B 3VYSA 4APVA 3T56B 4FXGC 2A74C 3RMHA 1VQNA 4HMJA 5ELCA 1LTRD 4BBSG 3Q0AA 1RIPA 4MNOA 3S1RB 1IKMA 3OWEB 4O2DA 1A3UA 4HJ9A 2L15A 2J4XA 3A7AB 1SFOH 1NCVA 1L1OB 3GTLB 5CV7A 4FDBA 3GDEA 1MKHA 3BVMA 3GTPH 2OTJA 1Y8PB 1EIFA 5DM63 5C3EG 2IWHA 2WB1E 1PRTD 2RCNA 3FKIH 1D5MC 4AYBE 1EEID 1I4QA 2DGYA 1NR2A 3H0GH 4DR1Q 2Z0SA 2ZJRA 2I5MX 1A2TA 1KXLA 3W3AA 3G6JB 1YEZA 2WINB 1TS4A 4DK3C 4A3KG 4OONA 1IBLL 1UAPA 3NQTA 4A3IG 1JR0D 1DYQA 3S15H 2XWBB 3S1NH 4JOIA 3RLOA 3HOWB 4A3DH 1EL0A 3DMUA 5ISRA 1N32Q 3TMEA 1RKNA 1TWHH 1NNXA 1JCKB 2F0UA 5AJ3L 4JYAL 2XRQD 1NUCA 1Y14B 2G9HD 4AQYQ 4TSSA 3CHBD 4NXNQ 1W6JA 2E2JB 1I4GA 5JOBA 4GKKQ 2F0TA 3MHBA 4LFAL 2OEOA 5CV9A 1A3TA 3K57A 1GOZA 2ZTEA 3GTGB 2I5HA 2VQEQ 4HIMA 4RCOA 2E2HB 3J80i 5IP9H 5C0XJ 2OTLA 4WJ3M 2R93H 2K5WA 1E0BA 5H1SE 1LTGD 3R3OA 3TZDA 1S4ZA 4UP8A 4DV7L 2FMMA 3A5ZB 1E2VA 4GLAC 1SYEA 1MSGA 2JYOA 3PF5A 2MUYA 1EY6A 1SYCA 2I46A 1PDQA 3J81c 2HQEA 5J1ZA 1WFQA 2N49A 1WTQA 4C3IG 4DR6Q 3W1GA 5EPKA 2EOTA 3R2IA 1EIHA 2HIVA 2D2CC 4L5SA 1WJJA 3PO2G 2B8GA 4X65L 3H3VH 2Z6KC 3HOYG 4DN4M 5FLXL 1YHQA 4L5TA 1VQHA 2I07B 1I3QB 4XXEA 5M5YB 4AYBG 1IYVA 1D7QA 2B2UC 1A6XA 1SNCA 1BVSA 1ICFB 4LUZA 3D6CA 3RZOB 4KHVA 1G51A 4RGOS 3OPOA 4R4IA 1IZ6A 1II3A 2EYJA 3J7ZC 3ER0A 3HGBA 2WFWA 2DY8A 4H7BA 1HNWQ 5GAHC 2YYZA 3KYHC 2CQOA 3H3VC 1XMQL 2RSNA 4K0KL 2EY1A 2L55A 4YWLA 3UDGA 1ICWA 1HFNA 3KK7A 1XPRA 3I2ZA 4ALPA 3JAMc 3E5SA 4CKCA 5M3MG 4A3BB 4V0BA 1LM0A 4CDFC 2FFKB 3M4PA 4GNXA 1SMXA 2RDFA 1HUMA 5E1FA 3TEHB 3S14H 1HQRD 1KLGD 3PMFA 3PUXA 4FNFA 5ELOA 1STAA 2VZAA 1KAAA 1XTDA 1K3BC 1X3QA 2BA1A 3V96A 3K5NA 4R4CA 4B3ML 1I94Q 4DR7Q 5IYDG 1EFWA 1YNJD 4XYQA 4U68A 4LF6Q 5LL6S 5J22A 1W3SA 5BR8Q 2Y0SG 1LABA 4UY8C 1BKBA 4CBVA 4X3UA 4CDCC 4ODGA 4DV1Q 1IBMQ 2K5DA 2K5VA 3DLLA 1C4QA 4H02A 1Y8OB 4TQUS 2KUMA 1XMOQ 4GKJL 2R7ZH 4N9PA 5DM73 5C0XH 2PNHA 4B08A 1S5ED 2ALYB 3CXCA 4BA2I 1EY4A 4LF7L 1SMYC 1KHIA 3TZUA 2Q2TA 5EKIA 3UDFA 1PZKD 3MTSA 3MXUA 3M3YB 1LO5D 1ZKOA 1VF5C 5IGBA 3S1QH 2QA4A 2LXJA 3J81i 2KQ3A 2DNCA 3I4NG 2NVTB 2EDGA 4PMCA 3HP3A 1E3PA 2B2TA 4HJ5A 4EVOA 3I4MG 2E75C 1CUKA 1SXTA 1CT1D 1NJIC 3S1MH 3VDYA 2K5NA 2F1MA 5M9OA 2NB0A 1Y1VH 2PQAB 1NBWA 2NTTA 1XTCD 3J80E 1XNRL 4A3GG 3I7FA 1ESFA 4DFAA 1F2LA 3J7YW 4WRDA 1MSHA 4TKOB 5ELDA 4R4QA 1AW7A 2IT1A 2WIIB 1A3VA 1SFOB 2JA8H 3T4AC 1CM9A 1D1IA 2Q8TA 2K6AA 3K0XA 3RR5A 5I2XA 2MP1A 1Q3LA 5IP7H 1N32L 2A1AA 3M4YA 1KNAA 4C1NK 4CKEA 3FKIB 1VQAA 3K80C 3JAMi 1KABA 3S2HB 1M90C 5IWAQ 3NSWA 1I50H 1IL2A 1HNZL 1EU4A 2F0HA 4MN3A 1N36Q 1BUVT 3L3OC 3QOLA 1N34Q 5KYLA 3CKIB 3EA6A 1U4LA 1ET9A 1TR5A 2K52A 4P2CB 4KI0A 3U9SA 1A0IA 5M3FG 1WCMH 2BCOA 3C1FA 4UHVA 2I5LX 3SDZA 3S1NB 1QVGA 1L0XB 2OWOA 5G3LD 3DWAA 1PH4A 1FYCA 2GVBA 2ZXOA 3J80L 5BN5A 5C3EB 4YY3L 3KF6B 4K8JA 3BS1A 4L63B 4O1NA 2UU9L 4A3JH 3MXGA 2B2YC 1CHQD 1Q1BA 1JB3A 1IXRA 4IPCA 4HR7B 3S2DH 1SNDA 3J81j 5KNBA 1H9KA 2A6ED 1AZPA 4K5VA 1WTXA 1KQSA 1JWSD 4YCVA 2K14A 4PZ6A 5HURA 3FP9A 4KV6A 4A3MG 4L6TB 1GHKA 4DR5Q 1X54A 4GS3A 5KIXA 4N9TA 1J9OA 5IT9c 4JI5L 2JK8A 3TREA 4DUYL 3X3NA 3H6MA 3I90A 1CKOA 1L1OC 1S72A 4A3EH 1STEA 2B39A 5IE8A 1ENFA 2K4KA 3OYYA 2AWOA 5C0XI 2CW0C 4HN7A 4A3FH 5CC4A 1Q90A 2KENA 4IUQA 2NN6H 1Z7TA 1YNND 2C9OA 4NP5A 2AKWB 4DK1A 2F4IA 3HOWH 2UUBL 5FLMH 4PZ8A 2WAQE 4XDXA 1B44D 2E2IH 3K59A 1YI2A 2VNUD 2IY5B 3FHWA 4IUPA 1QILA 5DNFA 3MA2B 3NENA 2F0KA 4G7ZC 3K5OA 5KRUA 2EYPA 1SDFA 2X6GA 4C56C 4DR7L 3KDFB 5IYBH 4MIUA 1UE6A 2XIWA 3FVQA 3GTGH 3PO3H 1XXGA 2EJGC 5IYCG 1HTLD 1OXVA 1PH5A 1IBLQ 1PFNA 2E2HH 3G71A 1X9NA 4C3IB 1U4PA 3Q8DA 1AH9A 2EYMA 4IJHA 3EFXD 2VXWA 1C48A 3S14B 3T51B 5J3BA 1PH9A 1SNQA 4JYAQ 5AJ3Q 4NW2A 1K0SA 1I4HA 4PZ7A 2CFMA 4J15A 2Q2HA 5KGUA 3BJUA 1HZCA 2JP1A 3C46A 1PVOA 1ET6A 3GTJH 1D6EC 1Y1WH 1VQCA 1VQPA 1GVPA 1RHPA 5EKKA 1U5KA 2EYOA 4LFAQ 2GN5A 1V1PA 4BY1H 2FINB 2XN9C 5CBEE 2R92H 1IW7C 1XX8A 5LHY1 1UE1A 3L9AX 5FJ8H 4DAMA 3R2TA 5LMUL 4N8X1 2C35B 1BBUA 1STHA 1YJWA 1PZJD 3CAMA 1B70B 1KDCA 3I8ZA 2EXDA 2OQ0A 4POFA 3CCLA 2BH8A 5M5YH 1TVXA 5A2QE 1K83H 5JJKA 3ND8A 1ASYA 4C1NI 1X65A 4DV7Q 3J81L 3C3LA 1YHBA 1BCPD 4OWWB 1EQTA 2Z4IA 1EUJA 3MFYA 4RG1A 1N33L 1I6VC 1QZGA 1QVCA 1EIGA 1SEBD 3QIAA 2AQ3B 4OEMB 2KJXA 4ZRZA 1HA6A 4KKSA 3KF8B 2H4OA 4FVMA 1LTSD 3MWYW 1O7IA 4A3BH 1GHJA 3TS0A 1VQEA 3CRKC 4GN3B 5IODA 4A3LG 3S1QB 3ULJA 2QEJC 2RF4A 4X65Q 2A19A 5G3LF 1SBBB 2B2UA 3BDLA 1EY5A 4KMUC 1T5XD 2I0QA 1KD1C 3LWEA 3MZ5A 3S1MB 1UNSA 3F2DA 1TIID 1Y1VB 3EIVA 1EFID 3NXWA 1L0WA 3IL8A 1ENAA 2K75A 5JPNC 3JAML 3MXPA 2MJ8A 1VQKA 4DAYB 3I91A 1XMQQ 4HTHA 4K0KQ 1AN8A 2FHTA 2JA8B 1VQ7A 3KBXA 5DEHA 5E4WC 2F0EA 1J8IA 1PFMA 4RGNA 2N55A 4HSPA 4IQZA 2JJQA 1LV9A 4JBWA 3HOZG 2KCCA 5C4XG 3G4SA 3UE0A 2NN6I 5CV8A 4OO1G 2PCFB 2NYZD 4QJFA 1VF7A 1PYBA 4HCSA 3FMCA 1RF2D 4QB4A 3TBIB 1U4MA 3A8KE 3I4MB 5I6YA 1OXSC 4RKLA 4JW0A 5GAGC 1FNWA 4N8FA 3DXJC 4Q0FA 4RCNA 1FGUA 2B2VC 1BQQT 1ZEQX 5HY6A 4A3GB 2X6LA 3EQLC 4PG3A 3S17B 1WCMB 3WOFA 4DR3L 4IFDG 1LTID 2PPBC 4OIKA 2MHVA 3GQBA 1CKNB 1UE5A 2MO0A 4AIMA 2QKIC 2ZXRA 3QOJA 3CC7A 3NK9A 3G6EA 4V190 2O5JC 2MO1A 3PIP3 3BDCA 4BY7G 1GUOA 1WTWA 1HRJA 4GKJQ 2RDHA 3NTKA 2NBFA 4HIKA 1SYGA 4A93G 1GJXA 3A74A 2D5DA 2YTXA 4UDUC 1FR3A 4A3JB 4LFCL 3DWPA 2BE5C 3MAQA 3NP8A 1D5XC 1PTOD 2MQHA 2VUMH 1CQFA 3V2TA 1VQ6A 4LF7Q 3U9OA 3S2DB 2JN4A 2XWJB 4YWMA 3A54A 5KYIA 1ONLA 2Z1CA 3BVGA 1RODA 4B3TL 1JB7A 1YITA 2ZJPA 2F0QA 1GM5A 3RZDH 4C3HG 5C4HA 2ENBA 4A3CG 2NZ1D 4DAVA 1Q82C 1UWVA 4X66L 1UEAB 3EN2A 5EBCA 5LL6X 4DUZL 4BBRG 3L2PA 3S2HH 3F8TA 5GROA 3CQZB 4EGVA 1O78A 2VL6A 4ZK9B 4IUTA 1YHAA 2JA7H 2WV6D 1Y8NB 5D65A 3K6OA 4A3EB 1XNRQ 1WI5A 3PIOA 1ILPA 2JE6I 4HEDA 2K33A 3OW7A 4MHEA 2PMZB 4ZUIA 4BBSH 1A62A 1S5DD 3CCUA 4A3FB 1FNVA 4HMIA 2D9UA 2MFIA 4PNYA 1TT2A 2H5XA 2RHQB 1B50A 4QIWE 2E2IB 4A3MB 1PH1A 1BBXC 2UXDQ 2KEEA 1B2TA 3D3RA 4CDDC 5FLXE 1E1TA 3HOXG 2VW9A 5C3EH 3MXNB 2CH4A 1PH2A 3OSOA 4OELB 1J5EL 1HNZQ 4KJOA 1KNEA 4XT1B 3CPFA 4IOCA 2CVRA 2B2WC 1C0AA 3SK5A 3BG3A 1LTBD 2SEBD 1SJHD 4YIJA 1Z9FA 4BWGB 3PO3B 2M9VA 4JC0A 2FXQA 3K0YA 2QEXA 4A3KH 3CP0A 1MBYA 2ICEC 3DWQA 4JI3L 4P74A 1STGA 5K5PA 5D14A 4A3IH 4NB3A 2F52A 2KOLA 1O7ZA 2AUKA 3BZKA 1Q12A 3GTQH 1X3PA 2F0NA 2F0IA 2MNAA 3ERQA 4YY3Q 2B2YA 1I6HH 2UU9Q 3I4OA 4ME3A 1F9RA 1G91A 1N9WA 3GTJB 1Y1WB 3T1YL 3A8IE 1TY2A 4JV5L 2NTSA 3WDNA 2OT2A 2YU9B 3VA7A 4BY1B 1SNPA 4RFBA 2RQXA 3WOEA 2R92B 3M7NA 3G7LA 2QW7A 4GN5A 1ML0D 4NKLA 3SK4A 5IGFA 2KHIA 5BN3A 5IT9L 4Q5VA 4KY5A 1R4PB 2WB1G 1TU2B 5BN4A 3HOVG 3K81C 4IUVA 3T1HL 5FO7B 3ONAB 2E2DC 2YTVA 2D0OA 4JI6L 4LF9L 4JI5Q 1K83B 2SNMA 1CKMA 4YHHL 4A76A 4DUYQ 3L0OA 4J6HA 1L1OA 1H9MA 3STBC 1H9JA 2WKCA 4AH6A 1IHZA 1RCVD 5A35A 3BZDB 1RTOA 3D31A 1OXTA 3CMAA 2ZXPA 2F3VA 3HKZB 5LMNQ 2HQLA 1IBKL 1KTKA 4TRDA 3VYUA 4DPGA 2A69C 4HAEA 4OO1I 4TVAB 2UUCL 2IL8A 4C3IH 4DV5L 3JC66 1CHPD 1QWYA 2UUBQ 5EKLA 3ERSX 4OL7A 3PO2H 5AFWA 4DV0L 2DY7A 4RGTA 1JORA 1F9PA 2AWNA 3TDQA 3UE1A 4U673 3HOYH 3S16B 2JEBI 1LT5D 3NBIA 3BYYB 1ZYRC 2YV5A 3RLFA 1CK1A 1JMCA 1LT4D 5T1GA 4XQJA 2EVBA 5NUCA 3SK8A 1H95A 3SXHA 1KAWA 1VCIA 5IGCA 2PW7A 5D3IB 1F2ZA 2A68C 2AMCB 4IURA 4NXMQ 1Q8IA 2LXKA 5C44G 2NUCA 4DV3Q 5E7NA 1ZXTA 3LX0A 1DONA 2N88A 1LTTD 3VR6A 1HFGA 2RHSB 1VQLA 2L4NA 2V4DA 2J7ZA 4UPAA 3TRZA 1PRTF 4BXXG 1C9OA 3DM3A 3W1BA 3OTOL 5C4JB 3K8AA 1GUNA 3RNUA 1X32A 4PV1C 2CH4W 3RD4A 1WOCA 1XNQQ 1SE2A 1X56A 2UUAL 2Z8LA 4F7XA 3ULLA 3P20A 1H9SB 1TS3A 2EIFA 2EYHA 4K5XA 1DCZA 1OO9B 5IGGA 4HIDA 3NWTA 1SRUA 1VQOA 5LMUQ 3FPUB 5IYDH 3PUWA 3AEVA 1M4VA 3EROA 1I4XA 4QUFA 1LT6D 2UXBQ 4DGZA 3IRBA 1CQVA 2PMZE 1QJOA 2LY7A 2HDLA 1AFPA 4JBMA 3H91A 1WTRA 2A6HC 5JPMC 4HJAA 1LTLA 3K5LA 4G7HC 5KEEA 1EQQA 1JC7A 3F1ZA 2F03A 3HOZB 5IGDA 4L5QA 3IKJA 3K58A 1WD1A 3GTOB 1N33Q 1K73C 1EQVA 2SNSA 2SDFA 4G7OC 4EQ5A 2VUMB 5EQ0A 4KHZA 4K2LA 1L2FA 3SVMA 3J7AV 2F3IA 4RHSA 2PYKA 1JE5A 1NTGA 4UAIA 2QDLA 1RJTA 3GO5A 3D0FA 3GP7A 2C5CA 4DV2L 3RZDB 1BR9A 3NTIA 4JPBW 3CCQA 1WTOA 4GZYC 1R9TB 1GUGA 3ZJYC 1F9SA 4NDXA 1VMPA 2UXDL 5GQOA 4R8NA 3PF4A 3I4NH 1SE4A 1CZGA 4KKUA 4C3JG 2ATWA 2B63G 3I4MH 3LNNA 3CCRA 1FNUA 2JA7B 4BY7B 1KRTA 1B7YB 1VQMA 2F0OA 4WJ4A 2NWGA 3M4QA 2LKVA 4UP7A 4GOPB 1MJCA 2HD3A 4A3GH 4BBSB 1SMYD 4ZKCB 3S17H 3MVVA 2RKSA 4JI8L 1MHWC 1PMRA 2EPBA 3CPWA 1FGBD 4ID6A 3NE5B 2L1BA 4C3HB 2OQKA 2RDGA 4R1JA 2O5IC 3PUYA 5F2DA 2PZWA 1O80A 4ZQ3A 4F88A 3F2CA 4UP9A 1Q86C 2B2VA 5K36G 2F0FA 1EQRA 2B29A 2GA4B 2PZTA 2E74C 3PCOB 2EJMA 1B9NA 4ULLA 1B1ZA 1Q1EA 5FK9C 1A2UA 3KJOA 2JA6G 3F2UA 2NVYH 2ZM6L 4FF4A 4DR3Q 2D62A 1JE4A 4A3KB 5CMDA 5M3FH 1SSOA 4A3IB 3HKZE 1LUZA 2F0LA 5DLQE 1SR3A 3GTQB 1JWMD 5JVG3 1YNXA 2DJFC 3CQZH 1RDPD 4MZ9A 1FD7D 1HXYD 1QUQB 2WKDA 1ILQA 2RA4A 1I6HB 1EY8A 2EQSA 4XTCS 1AEXA 3NWSA 3ND9A 1VMCA 2KCNA 3BVZA 4LFCQ 3J7A5 1V9PA 3IFTA 1HJPA 1NMFA 2KHSA 5LMNL 4DV6L 1GUWA 1VQDA 1EIYB 1HQMC 3E0EA 3A7LA 2K03A 2N3SA 4K5WA 4LF8L 1OXUA 4B3TQ 1KL9A 4K6LA 3KUPA 1AE2A 5ELFA 2PQAA 1F9QA 5HGTA 3RLNA 5IYBG 5EPLA 1BBWA 1Z6HA 4GLVB 4O0AA 5JEAG 4A3MH 4X66Q 4QF4A 4KTAA 4DUZQ 1HCZA 5C4ZA 4IUUA 1G8ZD 3E3XA
chains in the Genus database with same CATH topology
1XYIA 2L5TA 4FP5D 3QJYA 4KJNA 2XSCA 3CU7A 1SYBA 3J81E 2PO4A 1LT3D 3SK6A 4B9WA 1G2TA 3TN2A 4XT3B 1SNOA 5DAUA 1EY0A 2F0GA 1EEFD 1TWGB 3PO2B 3H09A 3BYTB 4K14A 3HOYB 2EYFA 2WB1B 4BS9A 1B4OA 3HOVB 3NUCA 3CRLC 4AYBB 3N6RA 1EYCA 1JOKA 3IAYA 2B2WA 1LACA 3DHQA 4G4KA 1EU3A 1MGSA 3VYRA 3JAME 2A5HA 2CW0D 2AQ2B 3OMCA 5M3MB 1S5BD 3NPPA 3PV0A 4FXKC 3FPPA 4CJ2C 5JAVA 4XIGS 1LLRD 4LJZC 1WVLA 1XWEA 3C1EA 3QB3A 1M8AA 4IFDJ 2BOSA 4XQNA 3EJIA 2K7VA 3HRZC 3AMUA 2NVXB 1D2BA 2Y0SB 1Z47A 5CORA 3VR5A 1L0YB 3P75A 4KN7C 3NQIA 1RTNA 2R61A 4RKBA 2K04A 4NMZA 1D5ZC 2JXMB 3I4NB 1DZ1A 4M1UB 4IZ8A 4BA1I 3DEPA 2F0WA 3R8BA 2KEDA 2XNAC 3Q23A 1F77A 1PRTC 3X3MA 4KN4C 2OXPA 4KKTA 2CHBD 3AU7A 1K8MA 2QCPX 3D4WA 1WTPA 3D6WA 2WACA 4EQOA 2MPMA 1BO0A 4DK0A 1KDBA 2IX1A 5KNCA 1EWHA 4JK1C 4WJWA 5FO8B 1WD0A 1JWUD 3VR3A 2EZVA 2QDBA 5C5LA 3KBGA 2PW5A 4K6DA 3D8GA 1STNA 2CQAA 4OO1H 2PQEA 3VYTA 4C3JB 2B63B 1EZ8A 3O13A 3GD7A 1B53A 2NVYB 5I9PA 3N52A 5M3FB 1CA5A 3M4OB 4IFDH 2FMCA 3VA5A 1EY9A 3KF8A 1DJRD 3PUZA 5I6WA 2R3ZA 1CFMA 3FDTA 4DXFA 4CJ1B 2HUGA 1HA5A 1F2YA 4X3SA 1HTPA 1CTMA 3SEBA 3OIPA 5D3DA 2FJ2A 2F0JA 2L11A 1R4QB 4G57A 2BDOA 1WTVA 2ZT9C 4FF1A 2K1BA 1JICA 2JA6B 1BCPB 5IT9E 1BOSA 1SYFA 4DF7A 2L12A 1STBA 1O7YA 4DAYA 1BCPF 2F3WA 5IIFA 4M8AA 2O4XA 5ELBA 5JJZA 4WORA 1CZWA 1F2MA 2BE5D 4XQQA 1UUPA 3EVQA 2OF1A 4LK1C 5C3XA 4F8MA 3L7ZC 4DAPA 1IL8A 2H1EA 3ITPA 1DXMA 2NVQB 2F0DA 3DUZA 4PMBA 4RH6A 4IN3A 2RSOA 3Q6SA 4X3TA 3A55A 3T13A 5KNDA 1SE3A 3DM1A 1TS2A 3ZYYX 5E4XA 2F0MA 2IJ0A 2VB2X 2JEAI 1YNJC 1EYDA 1KLUD 4ME5A 4OGQC 2DN8A 4LAAA 3A56A 1O7LA 3HS0C 1E2WA 3LWUA 1K8OA 3URYA 1CA6A 5I9OA 3R93A 4HSVA 4HCEA 4F87A 1C8CA 4FO2A 1BDOA 3E0JA 2AUJD 1SJED 2L0CA 4CJ0B 1AP0A 1QB5D 4DU9A 1IYUA 1TWAB 1G6ZA 1TWCB 1PTOB 2EXZA 1QE6A 4KY7A 2MGSA 1JOOA 5CR3A 4IFDI 2L9HA 1PTOF 2VB3X 4WFN3 5C0XG 1T5EA 3K5MA 4OIJA 4ZLTF 2O2LD 3I73A 3MXNA 1PRTB 2EYLA 1B3AA 4ILWA 5FKAC 3GTKB 5C3WA 4CKBA 3GV3A 3GTMB 1PYWD 2WAQB 4J1MA 2F0VA 1JOQA 5CV4A 4I7ZC 2XVSA 3K7AB 4CHTB 4CGYB 3MC0B 4FF3A 4PQXA 3S9WA 4QCLA 5CGKA 1G291 2M00A 2A69D 3Q24A 4KK7A 3TSSA 5EJWA 3SHLA 3C2PA 3FRPB 3HOUB 2B8FA 3TP7A 1DD2A 2JA5B 2K05A 3H94A 3OOCA 3KLRA 4FF2A 5C4XB 5EBDA 1ZYRD 4RHRA 2IW3A 4K8IA 3D4DA 3UI2A 2QILA 3E6ZX 1MI2A 4H13C 2A68D 3SE0A 3GV6A 3V05A 1QNKA 2EY5A 3PIO3 3Q22A 2A6EC 2BA0A 5COYA 1SAPA 4R8IA 2RVLA 4DXGA 1GUSA 3QWNA 4X3KA 1NSNS 5M5XB 5CV5A 2QF7A 1I4PA 1JQYD 3RUZA 3GTPB 4A93B 2F0PA 2E76C 3T53B 1A15A 1SYDA 4Y7NB 1I4RA 1ESRA 2J0TD 3OIQA 4QUCA 1ENCA 5M5WB 3H0GB 5JVH3 5JEAJ 4H44C 3HG9A 2K01A 4FYDA 4RAUC 1BNZA 3MEHA 1PFBA 2HCCA 3QO2A 1EY7A 1YNNC 2A6HD 1DOLA 2IX0A 4BBRB 3S15B 5T1IA 2G9DA 2JSOA 4ZKBB 3AB9A 4A3DB 1V1PB 4IUNA 1OXXK 1TWHB 1DOMA 1SNMA 2ID0A 1S5CD 1B9MA 2A73B 2ICIA 4KY6A 1PLFA 2RBMA 5IOCA 5C6AA 1HPCA 3OMGA 5E3FA 5FO9B 2LFNA 2F0SA 2BDNA 2NN6G 1H9SA 2KVMA 1VDZA 5J39A 4B9XA 3I3CA 3HOXB 2Q8IB 1TQOA 1PXUA 4DNRB 1TWFB 2K5QA 2R93B 3P1HA 1V1OA 5K36H 3TP6A 4ZUJA 3DEOA 1EZ6A 4LMQD 4OHJA 1RD9D 4E6IA 2IPKD 3W2DA 3VR2A 4RGMA 1TKWB 1NAPA 2Z4HA 1BF4A 4QMGA 1BCPC 1H9RA 2DNEA 2TMPA 4IALA 1QOHA 5ELEA 2WP8J 5EPJA 2M2LA 2Q8RE 3J7AF 1EOTA 2K32A 1KDAA 5JEAH 3NTHA 1CI3M 1MD2D 2KA7A 3I72A 3T16A 4H0LC 1QCBD 2EY2A 1DOKA 1HUNA 2LS01 2XRSD 2TSSA 5CV6A 5EGTA 3HEJA 2HCIA 2LMCB 2EE1A 5TSSA 3HZXA 3SR1A 1QG7A 4FXDA 5IGEA 4EQPA 5I2YA 1Y69U 3I70A 4QIWB 4ABNA 1GXDC 1S5FD 4C2MB 2PZUA 1HHVA 3BDOA 1EWCA 5I4DA 2B2TC 3P7JA 4Z9CB 1U9RA 4K2KA 2IX3A 2R7ZB 4XYOA 5C44B 4L8JA 2R6GA 1BXTA 1E2ZA 4KD3A 1PTOH 4KD4A 2SOBA 4EQNA 2X69A 3I4LA 1U4RA 4ZYSA 4S3SA 3QG1A 1STYA 1IW7D 1W6KA 1PTOC 3IFDA 4RWSC 3VR4A 3NHHA 2K28A 3D4RA 1TS5A 3M7GA 4ZAIA 1LTAD 1IKLA 3NBHA 5FOBB 1V8QA 1GUTA 3OWFA 2PNRC 3M85A 4DNTB 4DA2A 4I65A 1D1KA 1DM0B 1PZID 5A2QL 4RA8A 3FEWX 5C5MA 1QNUA 5CBAE 5CYUA 4R9WA 2EJFC 4PMWA 3A8JE 1I50B 3TP5A 1EYAA 1TY0A 2HDMA 2EY6A 3KLSA 2KECA 4O42A 3TP8A 1G2SA 1NR4A 4J8QA 1AZQA 3PUVA 1V43A 3MFGA 3OHXC 3KLSX 2AQ1B 3VYSA 3T56B 4FXGC 2A74C 3RMHA 4HMJA 5ELCA 1LTRD 3Q0AA 3S1RB 1IKMA 3OWEB 1A3UA 2J4XA 3A7AB 1NCVA 3GTLB 5CV7A 3BVMA 1Y8PB 5DM63 2IWHA 1PRTD 1D5MC 1EEID 1I4QA 1NR2A 1A2TA 3W3AA 3G6JB 2WINB 1TS4A 1UAPA 3NQTA 1JR0D 1DYQA 2XWBB 3HOWB 1EL0A 3DMUA 5ISRA 3TMEA 1RKNA 1JCKB 2F0UA 2XRQD 1NUCA 2G9HD 4TSSA 3CHBD 1W6JA 2E2JB 1I4GA 5JOBA 2F0TA 3MHBA 2OEOA 5CV9A 1A3TA 3K57A 1GOZA 3GTGB 4RCOA 2E2HB 5C0XJ 2K5WA 1E0BA 1LTGD 3R3OA 3TZDA 1S4ZA 2FMMA 1E2VA 1SYEA 1MSGA 2JYOA 2MUYA 1EY6A 1SYCA 2I46A 1PDQA 2HQEA 5J1ZA 1WTQA 4C3IG 5EPKA 2EOTA 3R2IA 1EIHA 2D2CC 2B8GA 4DN4M 5FLXL 2I07B 1I3QB 4XXEA 5M5YB 1IYVA 2B2UC 1A6XA 1SNCA 3D6CA 3RZOB 4KHVA 4RGOS 3OPOA 1II3A 2EYJA 3HGBA 4H7BA 2DY8A 2YYZA 3H3VC 2RSNA 1HFNA 2EY1A 2L55A 1ICWA 3KK7A 3E5SA 4CKCA 4A3BB 4V0BA 2FFKB 2RDFA 1HUMA 5E1FA 1HQRD 1KLGD 3PMFA 3PUXA 4FNFA 1STAA 1KAAA 1X3QA 2BA1A 3V96A 3K5NA 1YNJD 4XYQA 4U68A 5LL6S 5J22A 1LABA 4CBVA 4X3UA 4ODGA 2K5DA 1C4QA 1Y8OB 4TQUS 2KUMA 4N9PA 5DM73 5C0XH 4B08A 1S5ED 4BA2I 1EY4A 1SMYC 3TZUA 5EKIA 1PZKD 3MTSA 3MXUA 3M3YB 1LO5D 1ZKOA 1VF5C 5IGBA 2KQ3A 2DNCA 2NVTB 2EDGA 4PMCA 3HP3A 2B2TA 4EVOA 2E75C 1SXTA 1CT1D 2F1MA 5M9OA 2NB0A 2NTTA 1XTCD 3J80E 1ESFA 4DFAA 1F2LA 3J7YW 4WRDA 1MSHA 4TKOB 5ELDA 1AW7A 2IT1A 2WIIB 1A3VA 1SFOB 3T4AC 1CM9A 1D1IA 2Q8TA 2K6AA 5I2XA 2MP1A 1Q3LA 3M4YA 1KNAA 4C1NK 4CKEA 3FKIB 1KABA 3S2HB 3NSWA 1EU4A 2F0HA 4MN3A 1BUVT 3L3OC 3QOLA 5KYLA 3CKIB 3EA6A 1U4LA 1ET9A 1TR5A 4P2CB 4KI0A 3U9SA 2BCOA 3C1FA 3SDZA 3S1NB 1L0XB 5G3LD 3DWAA 1FYCA 2ZXOA 3J80L 5BN5A 5C3EB 4K8JA 3BS1A 4L63B 4O1NA 3MXGA 2B2YC 1CHQD 1Q1BA 1JB3A 4HR7B 1SNDA 5KNBA 1H9KA 2A6ED 1AZPA 4K5VA 1WTXA 1JWSD 5HURA 4KV6A 4L6TB 1GHKA 5KIXA 4N9TA 1J9OA 3X3NA 3H6MA 3I90A 1STEA 2B39A 1ENFA 2AWOA 5C0XI 2CW0C 4HN7A 5CC4A 1Q90A 4IUQA 2NN6H 1Z7TA 1YNND 2C9OA 4NP5A 4DK1A 2F4IA 4XDXA 1B44D 3K59A 2VNUD 4IUPA 1QILA 5DNFA 3MA2B 2F0KA 4G7ZC 3K5OA 5KRUA 2EYPA 1SDFA 2X6GA 4C56C 4MIUA 2XIWA 3FVQA 1XXGA 2EJGC 1HTLD 1OXVA 1PFNA 4C3IB 1U4PA 2EYMA 3EFXD 2VXWA 1C48A 3S14B 3T51B 1SNQA 4NW2A 1I4HA 5KGUA 2JP1A 3C46A 1ET6A 1D6EC 1RHPA 5EKKA 2EYOA 1V1PA 2FINB 2XN9C 5CBEE 1IW7C 1XX8A 5LHY1 3L9AX 3R2TA 1STHA 1PZJD 1KDCA 3I8ZA 1TVXA 5A2QE 3ND8A 4C1NI 3J81L 3C3LA 1BCPD 1EQTA 2Z4IA 3MFYA 1I6VC 1EIGA 1SEBD 2AQ3B 3QIAA 2KJXA 4ZRZA 1HA6A 4KKSA 2H4OA 4FVMA 1LTSD 3MWYW 1GHJA 3CRKC 5IODA 3S1QB 2QEJC 5G3LF 1SBBB 2B2UA 3BDLA 1EY5A 4KMUC 1T5XD 3LWEA 3MZ5A 3S1MB 1UNSA 1TIID 1Y1VB 1EFID 3NXWA 3IL8A 1ENAA 5JPNC 3JAML 3MXPA 2MJ8A 3I91A 4HTHA 1AN8A 2FHTA 2JA8B 3KBXA 5DEHA 5E4WC 2F0EA 1J8IA 1PFMA 4RGNA 2N55A 4HSPA 4IQZA 4JBWA 1LV9A 2KCCA 2NN6I 5CV8A 4OO1G 2PCFB 2NYZD 1VF7A 4HCSA 3FMCA 1RF2D 4QB4A 3TBIB 1U4MA 3A8KE 3I4MB 5I6YA 1OXSC 4RKLA 1FNWA 3DXJC 4Q0FA 4RCNA 2B2VC 1BQQT 1ZEQX 4A3GB 2X6LA 3EQLC 3S17B 1WCMB 3WOFA 4IFDG 1LTID 2PPBC 4OIKA 2MHVA 3GQBA 2QKIC 2ZXRA 3QOJA 3NK9A 4V190 2O5JC 3PIP3 3BDCA 1GUOA 1WTWA 1HRJA 2RDHA 3NTKA 2NBFA 1SYGA 1GJXA 2D5DA 4UDUC 1FR3A 4A3JB 3DWPA 2BE5C 3MAQA 3NP8A 1D5XC 1PTOD 1CQFA 3V2TA 3U9OA 3S2DB 2XWJB 3A54A 5KYIA 1ONLA 2Z1CA 3BVGA 1RODA 2F0QA 4C3HG 5C4HA 2ENBA 2NZ1D 4DAVA 1UEAB 5LL6X 5EBCA 3CQZB 4EGVA 1O78A 4ZK9B 4IUTA 2WV6D 1Y8NB 5D65A 3K6OA 4A3EB 1ILPA 2JE6I 4HEDA 2K33A 3OW7A 4MHEA 2PMZB 4ZUIA 1S5DD 4A3FB 1FNVA 4HMIA 2D9UA 4PNYA 1TT2A 1B50A 2E2IB 4A3MB 1BBXC 2KEEA 1B2TA 3D3RA 5FLXE 3OSOA 4KJOA 1KNEA 4XT1B 2CVRA 2B2WC 3SK5A 3BG3A 1LTBD 2SEBD 1SJHD 4YIJA 4BWGB 3PO3B 2M9VA 3K0YA 3DWQA 1MBYA 2ICEC 1STGA 5K5PA 5D14A 2KOLA 1O7ZA 2AUKA 1Q12A 1X3PA 2F0NA 2F0IA 3ERQA 2B2YA 1F9RA 1G91A 3GTJB 1Y1WB 3A8IE 1TY2A 2NTSA 3WDNA 2OT2A 2YU9B 3VA7A 4BY1B 1SNPA 4RFBA 2RQXA 3WOEA 2R92B 3M7NA 3G7LA 4NKLA 1ML0D 3SK4A 5IGFA 5BN3A 5IT9L 4Q5VA 4KY5A 1R4PB 1TU2B 5BN4A 4IUVA 5FO7B 3ONAB 2E2DC 1K83B 2SNMA 4J6HA 1H9MA 1H9JA 2WKCA 1IHZA 1RCVD 5A35A 3BZDB 1RTOA 3D31A 1OXTA 2ZXPA 2F3VA 3HKZB 1KTKA 4TRDA 3VYUA 2A69C 4HAEA 4OO1I 2IL8A 1CHPD 1QWYA 5EKLA 4OL7A 5AFWA 2DY7A 4RGTA 1JORA 1F9PA 2AWNA 3TDQA 4U673 3S16B 2JEBI 1LT5D 3NBIA 3BYYB 1ZYRC 3RLFA 1CK1A 1LT4D 5T1GA 4XQJA 2EVBA 5NUCA 3SK8A 3SXHA 1VCIA 5IGCA 2PW7A 5D3IB 1F2ZA 2A68C 4IURA 1Q8IA 2NUCA 1ZXTA 3LX0A 1DONA 2N88A 1LTTD 3VR6A 1HFGA 2L4NA 2V4DA 2J7ZA 1PRTF 5C4JB 1GUNA 1X32A 4PV1C 3RD4A 1SE2A 2Z8LA 4F7XA 3P20A 1H9SB 1TS3A 2EYHA 4K5XA 1DCZA 1OO9B 5IGGA 3NWTA 3FPUB 3PUWA 1M4VA 3EROA 1I4XA 4QUFA 1LT6D 4DGZA 1CQVA 1QJOA 2LY7A 2HDLA 1AFPA 3H91A 1WTRA 2A6HC 5JPMC 3K5LA 4G7HC 5KEEA 1JC7A 2F03A 3HOZB 5IGDA 3IKJA 3K58A 1WD1A 3GTOB 1EQVA 2SNSA 2SDFA 4G7OC 2VUMB 5EQ0A 4KHZA 4K2LA 3SVMA 3J7AV 4RHSA 2PYKA 4UAIA 1RJTA 3GO5A 3GP7A 2C5CA 3RZDB 1BR9A 3NTIA 1WTOA 4GZYC 1R9TB 1GUGA 1F9SA 4NDXA 1VMPA 4R8NA 1SE4A 1CZGA 4KKUA 4C3JG 3LNNA 1FNUA 2JA7B 4BY7B 2F0OA 2NWGA 2LKVA 4BBSB 1SMYD 4ZKCB 3MVVA 2RKSA 1PMRA 2EPBA 1FGBD 4ID6A 3NE5B 2L1BA 4C3HB 2RDGA 2O5IC 3PUYA 5F2DA 2PZWA 1O80A 4ZQ3A 4F88A 2B2VA 5K36G 2F0FA 2GA4B 2PZTA 2E74C 2EJMA 1B9NA 4ULLA 1B1ZA 1Q1EA 5FK9C 1A2UA 3F2UA 4FF4A 2D62A 1JE4A 4A3KB 5CMDA 1SSOA 4A3IB 2F0LA 3GTQB 1JWMD 5JVG3 1RDPD 1FD7D 1HXYD 2WKDA 1ILQA 2RA4A 1I6HB 1EY8A 4XTCS 1AEXA 3NWSA 3ND9A 1VMCA 2KCNA 3BVZA 3IFTA 2KHSA 1GUWA 1HQMC 3A7LA 2K03A 4K5WA 1OXUA 4K6LA 3KUPA 5ELFA 1F9QA 5HGTA 5EPLA 1Z6HA 5JEAG 4QF4A 4KTAA 1HCZA 5C4ZA 4IUUA 1G8ZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT5 D;  1L0Y B;  3DWA A;  3BYY B;  4RHR A;  3MFG A;  4DXF A;  1EWC A;  5I4D A;  1HA5 A;  1LTG D;  1FNU A;  1RF2 D;  1I4H A;  2QIL A;  1CK1 A;  1LT4 D;  2R61 A;  3KLS X;  4L63 B;  4O1N A;  1V1O A;  2AQ1 B;  1LT3 D;  4Z9C B;  1FNW A;  1S5E D;  1CHQ D;  3SEB A;  1ET6 A;  5D3I B;  1D6E C;  1SJE D;  5ELC A;  1LTR D;  1BXT A;  5D3D A;  1LTB D;  2SEB D;  1SJH D;  1V1P A;  3V05 A;  4BWG B;  3OWE B;  2XN9 C;  1PZK D;  1LO5 D;  1LTT D;  1JWS D;  1LTI D;  3R2T A;  1D5Z C;  1BCP B;  3DWQ A;  1EEF D;  1PTO H;  1RD9 D;  1FGB D;  2J4X A;  4OHJ A;  3R2I A;  1PZJ D;  4DXG A;  2IPK D;  1PRT F;  4L6T B;  1PTO B;  2RDG A;  3BYT B;  1BCP F;  3BVM A;  5ELB A;  3R8B A;  1I4P A;  1JQY D;  1PTO F;  2XNA C;  3W2D A;  4RGM A;  4ZYS A;  1PRT D;  1CT1 D;  1SXT A;  1F77 A;  2RDH A;  1D5M C;  1PRT C;  1BCP D;  1EEI D;  1BCP C;  1I4Q A;  4UDU C;  1SE2 A;  4RGO S;  1I4R A;  3DWP A;  2CHB D;  1UUP A;  2Z8L A;  1D5X C;  1EU3 A;  1PTO D;  1SEB D;  2AQ3 B;  2NTT A;  1XTC D;  1STE A;  2O2L D;  1PTO C;  1TY2 A;  2NTS A;  1PRT B;  1TS3 A;  1ESF A;  1ENF A;  1B1Z A;  5FK9 C;  4RFB A;  5ELE A;  5ELD A;  5FKA C;  1LTS D;  3BVG A;  1TS4 A;  1TS5 A;  1AW7 A;  2AQ2 B;  1LTA D;  1M4V A;  1I4X A;  4RH6 A;  1LT6 D;  1PYW D;  1JWU D;  2QEJ C;  1CQV A;  1S5B D;  1JR0 D;  1JWM D;  1MD2 D;  1DYQ A;  1SBB B;  1PZI D;  1RDP D;  1B44 D;  1FD7 D;  1HXY D;  1T5X D;  1HQR D;  1KLG D;  1SE3 A;  1UNS A;  3MC0 B;  1JCK B;  1LLR D;  3BVZ A;  1QIL A;  2XRQ D;  1RCV D;  1V1P B;  2WV6 D;  1EU4 A;  1EFI D;  2G9H D;  3BZD B;  2XRS D;  4TSS A;  2TSS A;  1S5C D;  1TS2 A;  2ICI A;  3O13 A;  3EA6 A;  3CHB D;  1ET9 A;  4RHS A;  4C56 C;  1TY0 A;  5TSS A;  3TSS A;  1KTK A;  1S5D D;  1AN8 A;  3GP7 A;  1I4G A;  2IJ0 A;  4K6L A;  5ELF A;  1FNV A;  1XXG A;  1HTL D;  1SE4 A;  1GOZ A;  1KLU D;  1CHP D;  4RGN A;  3EFX D;  4RCO A;  1DJR D;  1S5F D;  4RGT A;  1L0X B;  1G8Z D;  3URY A; 
#chains in the Genus database with same CATH topology
 1XYI A;  1N8R C;  2L5T A;  4X64 L;  4FP5 D;  3QJY A;  4KJN A;  2XSC A;  3CU7 A;  4JI4 L;  1SYB A;  3J81 E;  1HZB A;  2PO4 A;  2G5D A;  1LT3 D;  4LF5 L;  3SK6 A;  4JG2 A;  4B9W A;  4NXM L;  3NBH B;  4DV3 L;  3RN2 A;  1G2T A;  3TS2 A;  3TN2 A;  4XT3 B;  1SNO A;  5DAU A;  3LGJ A;  1EY0 A;  3H15 A;  2ASB A;  4DV4 L;  2Z9H A;  2F0G A;  1EEF D;  1WYD A;  1TWG B;  3PO2 B;  3H09 A;  1EOV A;  3S24 A;  3BYT B;  4K14 A;  3HOY B;  2EYF A;  2WB1 B;  4BS9 A;  1B4O A;  3HOV B;  3NUC A;  1J5E Q;  3CRL C;  4AYB B;  3A5U A;  3N6R A;  2CKZ B;  1XNQ L;  3BZC A;  1EYC A;  1JOK A;  3IAY A;  3UDX A;  5JJI A;  1IYJ B;  2B2W A;  1LAC A;  3DHQ A;  4G4K A;  2YU9 H;  1EU3 A;  1MGS A;  4ZCK A;  3VYR A;  3KFU A;  3JAM E;  2A8V A;  2E5L L;  4JI2 L;  2A5H A;  3KF6 A;  1NE3 A;  2CW0 D;  4QL5 A;  3ULP A;  2K50 A;  2AQ2 B;  1FJG L;  4QY7 A;  4JI3 Q;  2UXB L;  2HHH L;  5IYC H;  3OMC A;  1E7Z A;  4Y52 H;  5M3M B;  1S5B D;  3NPP A;  4A3B G;  3PV0 A;  4FXK C;  3FPP A;  4CJ2 C;  5JAV A;  4XIG S;  4OWT B;  1GKH A;  1LLR D;  1PA6 A;  1PV4 A;  4LJZ C;  4P75 A;  1WVL A;  4POG A;  1XWE A;  3T1Y Q;  4JV5 Q;  1YVC A;  3C1E A;  3QB3 A;  1M8A A;  4IFD J;  2BOS A;  4XQN A;  2Z6K A;  3EJI A;  2K7V A;  4GLX A;  2WAQ G;  3HRZ C;  3AMU A;  2NVX B;  1TWA H;  1D2B A;  3T1H Q;  4OWX B;  3KOJ A;  2Y0S B;  4JI6 Q;  3S16 H;  4LF9 Q;  4YHH Q;  1Z47 A;  5COR A;  3VR5 A;  1L0Y B;  3P75 A;  4KN7 C;  3NQI A;  3PSI A;  1RTN A;  3AFP A;  2R61 A;  4RKB A;  4IOA A;  2K04 A;  1IBK Q;  1NMG A;  2UUC Q;  4DV5 Q;  4P72 A;  3HOU G;  4NMZ A;  3GTK H;  1D5Z C;  2JA5 G;  2P5Z X;  4A3L H;  5C4J H;  3KDF A;  2JXM B;  4B3R L;  4DV0 Q;  3AFQ A;  1S40 A;  3I4N B;  1DZ1 A;  4M1U B;  4IZ8 A;  2VQF L;  4BA1 I;  3DEP A;  2F0W A;  4OX9 L;  1E22 A;  3R8B A;  2KED A;  1U0L A;  3K7U C;  1M1K C;  1KIX A;  4IO9 A;  2XNA C;  3Q23 A;  1F77 A;  3K7A H;  1RL2 A;  1PRT C;  2CWA A;  3X3M A;  1MJE A;  4KN4 C;  2OXP A;  4KKT A;  2CHB D;  4X62 L;  5JJL A;  3AU7 A;  1K8M A;  1OTC A;  2QCP X;  3D4W A;  1WTP A;  1VQ5 A;  3CW2 C;  3D6W A;  2WAC A;  4EQO A;  2MPM A;  2OCE A;  1BO0 A;  4DK0 A;  1KDB A;  2IX1 A;  5KNC A;  3CCM A;  1A63 A;  1EWH A;  4JK1 C;  2UXC L;  4A4I A;  4WJW A;  5FO8 B;  1WD0 A;  1JWU D;  2RCF A;  4JI1 L;  3VR3 A;  3OTO Q;  2EZV A;  1HR0 L;  2QDB A;  5C5L A;  3KBG A;  4GN4 B;  1PH7 A;  2PW5 A;  4K6D A;  3WWV A;  3D8G A;  2NZO A;  3HOZ H;  1STN A;  5C4X H;  2CQA A;  3GTO H;  2N78 A;  4OO1 H;  2PQE A;  3FKI G;  3VYT A;  3OW2 A;  4C3J B;  5GAE C;  2UUA Q;  4DNI A;  2B63 B;  1EZ8 A;  2N8N A;  4YCW A;  3H0G G;  3O13 A;  3GD7 A;  1B53 A;  2NVY B;  2R7D A;  1FL0 A;  5I9P A;  3N52 A;  5M3F B;  1R9T H;  1CA5 A;  3M4O B;  4B3S L;  4IFD H;  2FMC A;  3VA5 A;  1EY9 A;  3UDI A;  1YBY A;  3KF8 A;  4R4T A;  1DJR D;  1VQF A;  3PUZ A;  5I6W A;  2R3Z A;  1CFM A;  2LSS A;  3FDT A;  3CD6 A;  4BY7 H;  4A3D G;  4DXF A;  5M5X H;  4CJ1 B;  1GO3 E;  2HUG A;  1HA5 A;  1F2Y A;  4X3S A;  4A93 H;  3A0J A;  1HTP A;  1CTM A;  1T9H A;  4Y7N H;  3SEB A;  3U4Z A;  4OXP A;  3OIP A;  4LUV A;  5D3D A;  2FJ2 A;  5M5W H;  4DV2 Q;  2F0J A;  2L11 A;  1R4Q B;  4G57 A;  4GNX B;  2BDO A;  1WTV A;  2ZT9 C;  4FF1 A;  1KC8 C;  2K1B A;  1JIC A;  2JA6 B;  1BCP B;  5IT9 E;  4C3H H;  1BOS A;  1SYF A;  4DF7 A;  2L12 A;  1STB A;  3SGI A;  1O7Y A;  4DAY A;  4A3C H;  1BCP F;  2F3W A;  5ELN A;  5IIF A;  1K0R A;  4M8A A;  4GOP C;  5IP9 G;  1JT8 A;  2O4X A;  5ELB A;  5JJZ A;  1K3R A;  4WOR A;  2R93 G;  4BBR H;  1CZW A;  1F2M A;  2D0P A;  1HNX L;  4JCV E;  2BE5 D;  4XQQ A;  1UUP A;  3EVQ A;  4KHP L;  2OF1 A;  4LK1 C;  5C3X A;  4F8M A;  3L7Z C;  1B8A A;  4DAP A;  1IL8 A;  4EX5 A;  4JI8 Q;  2H1E A;  3ITP A;  1VQ9 A;  2F4V L;  1DXM A;  2NVQ B;  2F0D A;  3DUZ A;  4LFB L;  4QGU A;  4PMB A;  4RH6 A;  3RN5 A;  4IN3 A;  2KCT A;  2RSO A;  3PQI A;  3Q6S A;  1Q81 C;  4X3T A;  4LF4 L;  3A55 A;  3T13 A;  3HOX H;  2PI2 A;  5KND A;  1CKN A;  1SE3 A;  2Y0S E;  1CSP A;  1TWF H;  3NEL A;  3DM1 A;  1TS2 A;  4JI0 L;  3ZYY X;  4R4O A;  2ZM6 Q;  5L37 A;  5E4X A;  2F0M A;  5EAY A;  2IJ0 A;  2VB2 X;  4YWK A;  2JEA I;  1YNJ C;  1EYD A;  1KLU D;  4ME5 A;  2E8G A;  4RMF A;  4OGQ C;  2DN8 A;  4LAA A;  1S3O A;  3A56 A;  4JI7 L;  1O7L A;  3HS0 C;  4MTK A;  3ICE A;  1E2W A;  3LWU A;  1K8O A;  3URY A;  3HFZ B;  1CA6 A;  5I9O A;  3AYH B;  1PH6 A;  1SRO A;  3R93 A;  4HSV A;  3CC2 A;  4HCE A;  4DV6 Q;  4F87 A;  1C8C A;  4FO2 A;  1BDO A;  3E0J A;  2AUJ D;  4LF8 Q;  1SJE D;  2L0C A;  2AHO B;  4CJ0 B;  1VQJ A;  1AP0 A;  1TWG H;  1QB5 D;  4DU9 A;  1IYU A;  1TWA B;  1G6Z A;  4JBK A;  1TWC B;  4LUO A;  3CCJ A;  3HOV H;  1PTO B;  2EXZ A;  2PI2 E;  1QE6 A;  4KY7 A;  2MGS A;  1JOO A;  3PGZ A;  1DGS A;  1P8L A;  5CR3 A;  4X64 Q;  3KJP A;  4IFD I;  2L9H A;  1AE3 A;  1PTO F;  4DR2 L;  4JI4 Q;  2VB3 X;  1GD7 A;  3U58 A;  4WFN 3;  2R7Z G;  4LF5 Q;  5C0X G;  1T5E A;  3K5M A;  2Q2I A;  4OIJ A;  2O2L D;  4ZLT F;  1YJN A;  4DR4 L;  3I73 A;  3MXN A;  1PRT B;  2EYL A;  1B3A A;  1XPU A;  4DV4 Q;  4ILW A;  1VS0 A;  5FKA C;  2NZH A;  3GTK B;  5M3M H;  5C3W A;  4CKB A;  2K5H A;  3GV3 A;  3GTM B;  1PYW D;  2ZTC A;  2WAQ B;  4J1M A;  2F0V A;  1JOQ A;  4C2M H;  5CV4 A;  4I7Z C;  3CCE A;  2ES2 A;  2XVS A;  3K7A B;  3STB D;  1PH8 A;  4CHT B;  4CGY B;  3MC0 B;  4FF3 A;  1Y1V G;  4PQX A;  3S9W A;  1K9M C;  4QCL A;  1NY4 A;  1HH2 P;  2KBN A;  3B6Y A;  5CGK A;  2E5L Q;  4JI2 Q;  1G29 1;  4NPS A;  2M00 A;  5C44 H;  2A69 D;  3Q24 A;  4KK7 A;  3TSS A;  1FJG Q;  2V1C C;  2QGQ A;  2HHH Q;  2NVX H;  1E1O A;  2JA8 G;  5EJW A;  3SHL A;  3C2P A;  4X6A H;  3I56 A;  1WTH A;  3FRP B;  3HOU B;  1MIU A;  2B8F A;  1TXY A;  3TP7 A;  4BXX H;  1DD2 A;  2JA5 B;  4CDE C;  2K05 A;  5IY0 A;  3H94 A;  3OOC A;  3KLR A;  5IP7 G;  4FF2 A;  5C4X B;  1ASZ A;  1I5F A;  5EBD A;  1ZYR D;  4A75 A;  1G6P A;  4RHR A;  4HIO A;  2IW3 A;  4K8I A;  3D4D A;  3UI2 A;  2QIL A;  1EYG A;  3E6Z X;  1MI2 A;  4H13 C;  2BH2 A;  1X6O A;  3F2B A;  2A68 D;  3SE0 A;  4DR1 L;  1C7Y A;  1JJC B;  3GV6 A;  3HKS A;  3V05 A;  1QNK A;  2EY5 A;  3PIO 3;  3Q22 A;  2A6E C;  1WCM G;  2BA0 A;  5COY A;  1SAP A;  4R8I A;  2RVL A;  4DXG A;  4IJL A;  1XPO A;  1GUS A;  5HGQ A;  3QWN A;  4X3K A;  1NSN S;  5M5X B;  5CV5 A;  2QF7 A;  1Q46 A;  1X55 A;  1I4P A;  1JQY D;  4JBJ A;  3RUZ A;  3CCS A;  1EWI A;  3GTP B;  4A93 B;  2F0P A;  4JOI C;  2E76 C;  3T53 B;  1YIJ A;  1HZA A;  1A15 A;  1SYD A;  4Y7N B;  1I4R A;  4A3J G;  1ESR A;  2J0T D;  1SLJ A;  3OIQ A;  3AQQ A;  4QUC A;  4AQY L;  1ENC A;  5M5W B;  3H3V I;  3H0G B;  4IPD A;  5JVH 3;  1VQB A;  5JEA J;  4NXN L;  4H44 C;  1K8G A;  3HG9 A;  4GKK L;  2K01 A;  4B3R Q;  4LNQ A;  4FYD A;  4RAU C;  1VQ8 A;  1BNZ A;  3MEH A;  1PFB A;  2HCC A;  3QO2 A;  1EY7 A;  2VQF Q;  1YNN C;  2A6H D;  4DKA C;  1DOL A;  2VQE L;  3CF5 A;  4OX9 Q;  2IX0 A;  1YZ6 A;  4BBR B;  4C3J H;  4P71 A;  3S15 B;  1YJ9 A;  2B63 H;  5T1I A;  2G9D A;  2JSO A;  1VQG A;  4ZKB B;  3AB9 A;  4X62 Q;  4A3D B;  1V1P B;  4IUN A;  1OXX K;  3BU2 A;  1TWH B;  1A8V A;  1DOM A;  1SNM A;  4A3E G;  3I55 A;  2ID0 A;  1S5C D;  1B9M A;  2A73 B;  4HJ8 A;  2ICI A;  3TQY A;  4KY6 A;  1PLF A;  2RBM A;  2JA9 A;  2Z6B A;  3M4O H;  5IOC A;  5C6A A;  2Q2U A;  1HPC A;  3OMG A;  3S1R H;  2UXC Q;  4A3F G;  5E3F A;  5FO9 B;  2LFN A;  3CCV A;  2VS1 A;  2F0S A;  2BDN A;  4JI1 Q;  4DR6 L;  2NN6 G;  3PIP A;  1HR0 Q;  4I7A A;  1H9S A;  1LYL A;  2KVM A;  3HOW G;  4HJ7 A;  3GTL H;  5FLM G;  1VDZ A;  5J39 A;  4B9X A;  3I3C A;  3HOX B;  1PYS B;  2Q8I B;  1TQO A;  1PXU A;  4DNR B;  2KCM A;  4JVZ A;  1TWF B;  2VY3 A;  2K5Q A;  2KHJ A;  2R93 B;  3P1H A;  1V1O A;  3CME A;  2GVA A;  5K36 H;  5FLX c;  3TP6 A;  4ZUJ A;  5GAD C;  1Q7Y C;  3DEO A;  1UEB A;  1EZ6 A;  4LMQ D;  2HIX A;  2JA6 H;  5LMN W;  4B3S Q;  2HT1 A;  3PO3 G;  1HNW L;  2DJG C;  4OHJ A;  1RD9 D;  3E9H A;  4E6I A;  1SE8 A;  2IPK D;  4LW1 A;  3CC4 A;  3W2D A;  3VR2 A;  4RGM A;  1TKW B;  1NAP A;  1P16 A;  2Z4H A;  4GNX C;  1BF4 A;  3KLW A;  1PFS A;  4QMG A;  1BCP C;  4KLK A;  2ZJQ A;  1H9R A;  1QVF A;  2DNE A;  1Y1W G;  4P73 A;  2CWP A;  2TMP A;  2NVQ H;  4IAL A;  4BY1 G;  1PH3 A;  1QOH A;  5ELE A;  2R92 G;  2WP8 J;  1I94 L;  1UE7 A;  2E2J H;  5EPJ A;  5FJ8 G;  2M2L A;  2Q8R E;  4GOP A;  3J7A F;  1EOT A;  1VQI A;  2K32 A;  1KDA A;  5JEA H;  2IHE A;  3NTH A;  1VQ4 A;  1B3Q A;  4LF6 L;  1CI3 M;  1MD2 D;  2KA7 A;  5BR8 L;  3I72 A;  1HNX Q;  4IPG A;  4DV1 L;  3T16 A;  1IBM L;  4H0L C;  1QCB D;  2XGT A;  2EY2 A;  1DOK A;  1XMO L;  1HUN A;  2LS0 1;  4KHP Q;  2XRS D;  2TSS A;  5CV6 A;  5EGT A;  3HEJ A;  2HCI A;  2LMC B;  3HKZ G;  2EE1 A;  5TSS A;  2F4V Q;  3M9B A;  2DUD A;  3HZX A;  3SR1 A;  1QG7 A;  4LFB Q;  4FXD A;  5IGE A;  4QQB X;  3E9I A;  4EQP A;  5I2Y A;  1Y69 U;  3I70 A;  4QIW B;  4ABN A;  1GXD C;  1S5F D;  4LF4 Q;  4C2M B;  2PZU A;  1HHV A;  3BDO A;  1EWC A;  1I3Q H;  5I4D A;  1KRS A;  2B2T C;  2JQO A;  3EBE A;  3P7J A;  4Z9C B;  1U9R A;  4JI0 Q;  4K2K A;  3RZO H;  2IX3 A;  2R7Z B;  1X3F A;  3NEM A;  4LWC A;  1QUQ A;  3W5O A;  4XYO A;  5C44 B;  4L8J A;  2R6G A;  1BXT A;  1V1Q A;  1TWC H;  3G48 A;  1E2Z A;  4YCU A;  1PHJ A;  4KD3 A;  1PTO H;  2YTY A;  4KD4 A;  4JI7 Q;  2B3G A;  2SOB A;  4EQN A;  1JJG A;  2X69 A;  3I4L A;  1U4R A;  2CCZ A;  4ZYS A;  1W2B A;  1E24 A;  3U4V A;  4MTN A;  1CSQ A;  4S3S A;  5IWA L;  3QG1 A;  1STY A;  1IW7 D;  1W6K A;  1N36 L;  1PTO C;  3IFD A;  1K8A C;  4RWS C;  1N34 L;  3VR4 A;  3NHH A;  2K28 A;  3D4R A;  1TS5 A;  3GTM H;  3M7G A;  4ZAI A;  1LTA D;  1IKL A;  3NBH A;  1XJV A;  5FOB B;  1V8Q A;  1GUT A;  3OWF A;  2PNR C;  1D8L A;  3MEF A;  4DNT B;  1SN8 A;  3M85 A;  1J6Q A;  4DA2 A;  4I65 A;  1D1K A;  1DM0 B;  4DR2 Q;  1PZI D;  2IHF A;  5A2Q L;  4RA8 A;  3FEW X;  5C5M A;  1JJ2 A;  1QNU A;  5CBA E;  5CYU A;  4R9W A;  2EJF C;  4PMW A;  1X3G A;  4DR4 Q;  2ZTD A;  3A8J E;  2VUM G;  1K28 A;  1I50 B;  3TP5 A;  1EYA A;  1HZ9 A;  4IPH A;  1TY0 A;  3QR8 A;  3J80 c;  4B3M Q;  3HOU H;  2HDM A;  2EY6 A;  3KLS A;  2KEC A;  3M3Y H;  2JA5 H;  1Q8K A;  4O42 A;  3TP8 A;  3U50 C;  1G2S A;  1NR4 A;  4J8Q A;  1QZH A;  1AZQ A;  2XTI A;  3PUV A;  4DR5 L;  2NVT H;  1V43 A;  1FVI A;  4L5R C;  3MFG A;  1X3E A;  1HR0 W;  2R7F A;  2JA7 G;  4DK6 C;  3OHX C;  3KLS X;  2AQ1 B;  3VYS A;  4APV A;  3T56 B;  4FXG C;  2A74 C;  3RMH A;  1VQN A;  4HMJ A;  5ELC A;  1LTR D;  4BBS G;  3Q0A A;  1RIP A;  4MNO A;  3S1R B;  1IKM A;  3OWE B;  4O2D A;  1A3U A;  4HJ9 A;  2L15 A;  2J4X A;  3A7A B;  1SFO H;  1NCV A;  1L1O B;  3GTL B;  5CV7 A;  4FDB A;  3GDE A;  1MKH A;  3BVM A;  3GTP H;  2OTJ A;  1Y8P B;  1EIF A;  5DM6 3;  5C3E G;  2IWH A;  2WB1 E;  1PRT D;  2RCN A;  3FKI H;  1D5M C;  4AYB E;  1EEI D;  1I4Q A;  2DGY A;  1NR2 A;  3H0G H;  4DR1 Q;  2Z0S A;  2ZJR A;  2I5M X;  1A2T A;  1KXL A;  3W3A A;  3G6J B;  1YEZ A;  2WIN B;  1TS4 A;  4DK3 C;  4A3K G;  4OON A;  1IBL L;  1UAP A;  3NQT A;  4A3I G;  1JR0 D;  1DYQ A;  3S15 H;  2XWB B;  3S1N H;  4JOI A;  3RLO A;  3HOW B;  4A3D H;  1EL0 A;  3DMU A;  5ISR A;  1N32 Q;  3TME A;  1RKN A;  1TWH H;  1NNX A;  1JCK B;  2F0U A;  5AJ3 L;  4JYA L;  2XRQ D;  1NUC A;  1Y14 B;  2G9H D;  4AQY Q;  4TSS A;  3CHB D;  4NXN Q;  1W6J A;  2E2J B;  1I4G A;  5JOB A;  4GKK Q;  2F0T A;  3MHB A;  4LFA L;  2OEO A;  5CV9 A;  1A3T A;  3K57 A;  1GOZ A;  2ZTE A;  3GTG B;  2I5H A;  2VQE Q;  4HIM A;  4RCO A;  2E2H B;  3J80 i;  5IP9 H;  5C0X J;  2OTL A;  4WJ3 M;  2R93 H;  2K5W A;  1E0B A;  5H1S E;  1LTG D;  3R3O A;  3TZD A;  1S4Z A;  4UP8 A;  4DV7 L;  2FMM A;  3A5Z B;  1E2V A;  4GLA C;  1SYE A;  1MSG A;  2JYO A;  3PF5 A;  2MUY A;  1EY6 A;  1SYC A;  2I46 A;  1PDQ A;  3J81 c;  2HQE A;  5J1Z A;  1WFQ A;  2N49 A;  1WTQ A;  4C3I G;  4DR6 Q;  3W1G A;  5EPK A;  2EOT A;  3R2I A;  1EIH A;  2HIV A;  2D2C C;  4L5S A;  1WJJ A;  3PO2 G;  2B8G A;  4X65 L;  3H3V H;  2Z6K C;  3HOY G;  4DN4 M;  5FLX L;  1YHQ A;  4L5T A;  1VQH A;  2I07 B;  1I3Q B;  4XXE A;  5M5Y B;  4AYB G;  1IYV A;  1D7Q A;  2B2U C;  1A6X A;  1SNC A;  1BVS A;  1ICF B;  4LUZ A;  3D6C A;  3RZO B;  4KHV A;  1G51 A;  4RGO S;  3OPO A;  4R4I A;  1IZ6 A;  1II3 A;  2EYJ A;  3J7Z C;  3ER0 A;  3HGB A;  2WFW A;  2DY8 A;  4H7B A;  1HNW Q;  5GAH C;  2YYZ A;  3KYH C;  2CQO A;  3H3V C;  1XMQ L;  2RSN A;  4K0K L;  2EY1 A;  2L55 A;  4YWL A;  3UDG A;  1ICW A;  1HFN A;  3KK7 A;  1XPR A;  3I2Z A;  4ALP A;  3JAM c;  3E5S A;  4CKC A;  5M3M G;  4A3B B;  4V0B A;  1LM0 A;  4CDF C;  2FFK B;  3M4P A;  4GNX A;  1SMX A;  2RDF A;  1HUM A;  5E1F A;  3TEH B;  3S14 H;  1HQR D;  1KLG D;  3PMF A;  3PUX A;  4FNF A;  5ELO A;  1STA A;  2VZA A;  1KAA A;  1XTD A;  1K3B C;  1X3Q A;  2BA1 A;  3V96 A;  3K5N A;  4R4C A;  4B3M L;  1I94 Q;  4DR7 Q;  5IYD G;  1EFW A;  1YNJ D;  4XYQ A;  4U68 A;  4LF6 Q;  5LL6 S;  5J22 A;  1W3S A;  5BR8 Q;  2Y0S G;  1LAB A;  4UY8 C;  1BKB A;  4CBV A;  4X3U A;  4CDC C;  4ODG A;  4DV1 Q;  1IBM Q;  2K5D A;  2K5V A;  3DLL A;  1C4Q A;  4H02 A;  1Y8O B;  4TQU S;  2KUM A;  1XMO Q;  4GKJ L;  2R7Z H;  4N9P A;  5DM7 3;  5C0X H;  2PNH A;  4B08 A;  1S5E D;  2ALY B;  3CXC A;  4BA2 I;  1EY4 A;  4LF7 L;  1SMY C;  1KHI A;  3TZU A;  2Q2T A;  5EKI A;  3UDF A;  1PZK D;  3MTS A;  3MXU A;  3M3Y B;  1LO5 D;  1ZKO A;  1VF5 C;  5IGB A;  3S1Q H;  2QA4 A;  2LXJ A;  3J81 i;  2KQ3 A;  2DNC A;  3I4N G;  2NVT B;  2EDG A;  4PMC A;  3HP3 A;  1E3P A;  2B2T A;  4HJ5 A;  4EVO A;  3I4M G;  2E75 C;  1CUK A;  1SXT A;  1CT1 D;  1NJI C;  3S1M H;  3VDY A;  2K5N A;  2F1M A;  5M9O A;  2NB0 A;  1Y1V H;  2PQA B;  1NBW A;  2NTT A;  1XTC D;  3J80 E;  1XNR L;  4A3G G;  3I7F A;  1ESF A;  4DFA A;  1F2L A;  3J7Y W;  4WRD A;  1MSH A;  4TKO B;  5ELD A;  4R4Q A;  1AW7 A;  2IT1 A;  2WII B;  1A3V A;  1SFO B;  2JA8 H;  3T4A C;  1CM9 A;  1D1I A;  2Q8T A;  2K6A A;  3K0X A;  3RR5 A;  5I2X A;  2MP1 A;  1Q3L A;  5IP7 H;  1N32 L;  2A1A A;  3M4Y A;  1KNA A;  4C1N K;  4CKE A;  3FKI B;  1VQA A;  3K80 C;  3JAM i;  1KAB A;  3S2H B;  1M90 C;  5IWA Q;  3NSW A;  1I50 H;  1IL2 A;  1HNZ L;  1EU4 A;  2F0H A;  4MN3 A;  1N36 Q;  1BUV T;  3L3O C;  3QOL A;  1N34 Q;  5KYL A;  3CKI B;  3EA6 A;  1U4L A;  1ET9 A;  1TR5 A;  2K52 A;  4P2C B;  4KI0 A;  3U9S A;  1A0I A;  5M3F G;  1WCM H;  2BCO A;  3C1F A;  4UHV A;  2I5L X;  3SDZ A;  3S1N B;  1QVG A;  1L0X B;  2OWO A;  5G3L D;  3DWA A;  1PH4 A;  1FYC A;  2GVB A;  2ZXO A;  3J80 L;  5BN5 A;  5C3E B;  4YY3 L;  3KF6 B;  4K8J A;  3BS1 A;  4L63 B;  4O1N A;  2UU9 L;  4A3J H;  3MXG A;  2B2Y C;  1CHQ D;  1Q1B A;  1JB3 A;  1IXR A;  4IPC A;  4HR7 B;  3S2D H;  1SND A;  3J81 j;  5KNB A;  1H9K A;  2A6E D;  1AZP A;  4K5V A;  1WTX A;  1KQS A;  1JWS D;  4YCV A;  2K14 A;  4PZ6 A;  5HUR A;  3FP9 A;  4KV6 A;  4A3M G;  4L6T B;  1GHK A;  4DR5 Q;  1X54 A;  4GS3 A;  5KIX A;  4N9T A;  1J9O A;  5IT9 c;  4JI5 L;  2JK8 A;  3TRE A;  4DUY L;  3X3N A;  3H6M A;  3I90 A;  1CKO A;  1L1O C;  1S72 A;  4A3E H;  1STE A;  2B39 A;  5IE8 A;  1ENF A;  2K4K A;  3OYY A;  2AWO A;  5C0X I;  2CW0 C;  4HN7 A;  4A3F H;  5CC4 A;  1Q90 A;  2KEN A;  4IUQ A;  2NN6 H;  1Z7T A;  1YNN D;  2C9O A;  4NP5 A;  2AKW B;  4DK1 A;  2F4I A;  3HOW H;  2UUB L;  5FLM H;  4PZ8 A;  2WAQ E;  4XDX A;  1B44 D;  2E2I H;  3K59 A;  1YI2 A;  2VNU D;  2IY5 B;  3FHW A;  4IUP A;  1QIL A;  5DNF A;  3MA2 B;  3NEN A;  2F0K A;  4G7Z C;  3K5O A;  5KRU A;  2EYP A;  1SDF A;  2X6G A;  4C56 C;  4DR7 L;  3KDF B;  5IYB H;  4MIU A;  1UE6 A;  2XIW A;  3FVQ A;  3GTG H;  3PO3 H;  1XXG A;  2EJG C;  5IYC G;  1HTL D;  1OXV A;  1PH5 A;  1IBL Q;  1PFN A;  2E2H H;  3G71 A;  1X9N A;  4C3I B;  1U4P A;  3Q8D A;  1AH9 A;  2EYM A;  4IJH A;  3EFX D;  2VXW A;  1C48 A;  3S14 B;  3T51 B;  5J3B A;  1PH9 A;  1SNQ A;  4JYA Q;  5AJ3 Q;  4NW2 A;  1K0S A;  1I4H A;  4PZ7 A;  2CFM A;  4J15 A;  2Q2H A;  5KGU A;  3BJU A;  1HZC A;  2JP1 A;  3C46 A;  1PVO A;  1ET6 A;  3GTJ H;  1D6E C;  1Y1W H;  1VQC A;  1VQP A;  1GVP A;  1RHP A;  5EKK A;  1U5K A;  2EYO A;  4LFA Q;  2GN5 A;  1V1P A;  4BY1 H;  2FIN B;  2XN9 C;  5CBE E;  2R92 H;  1IW7 C;  1XX8 A;  5LHY 1;  1UE1 A;  3L9A X;  5FJ8 H;  4DAM A;  3R2T A;  5LMU L;  4N8X 1;  2C35 B;  1BBU A;  1STH A;  1YJW A;  1PZJ D;  3CAM A;  1B70 B;  1KDC A;  3I8Z A;  2EXD A;  2OQ0 A;  4POF A;  3CCL A;  2BH8 A;  5M5Y H;  1TVX A;  5A2Q E;  1K83 H;  5JJK A;  3ND8 A;  1ASY A;  4C1N I;  1X65 A;  4DV7 Q;  3J81 L;  3C3L A;  1YHB A;  1BCP D;  4OWW B;  1EQT A;  2Z4I A;  1EUJ A;  3MFY A;  4RG1 A;  1N33 L;  1I6V C;  1QZG A;  1QVC A;  1EIG A;  1SEB D;  3QIA A;  2AQ3 B;  4OEM B;  2KJX A;  4ZRZ A;  1HA6 A;  4KKS A;  3KF8 B;  2H4O A;  4FVM A;  1LTS D;  3MWY W;  1O7I A;  4A3B H;  1GHJ A;  3TS0 A;  1VQE A;  3CRK C;  4GN3 B;  5IOD A;  4A3L G;  3S1Q B;  3ULJ A;  2QEJ C;  2RF4 A;  4X65 Q;  2A19 A;  5G3L F;  1SBB B;  2B2U A;  3BDL A;  1EY5 A;  4KMU C;  1T5X D;  2I0Q A;  1KD1 C;  3LWE A;  3MZ5 A;  3S1M B;  1UNS A;  3F2D A;  1TII D;  1Y1V B;  3EIV A;  1EFI D;  3NXW A;  1L0W A;  3IL8 A;  1ENA A;  2K75 A;  5JPN C;  3JAM L;  3MXP A;  2MJ8 A;  1VQK A;  4DAY B;  3I91 A;  1XMQ Q;  4HTH A;  4K0K Q;  1AN8 A;  2FHT A;  2JA8 B;  1VQ7 A;  3KBX A;  5DEH A;  5E4W C;  2F0E A;  1J8I A;  1PFM A;  4RGN A;  2N55 A;  4HSP A;  4IQZ A;  2JJQ A;  1LV9 A;  4JBW A;  3HOZ G;  2KCC A;  5C4X G;  3G4S A;  3UE0 A;  2NN6 I;  5CV8 A;  4OO1 G;  2PCF B;  2NYZ D;  4QJF A;  1VF7 A;  1PYB A;  4HCS A;  3FMC A;  1RF2 D;  4QB4 A;  3TBI B;  1U4M A;  3A8K E;  3I4M B;  5I6Y A;  1OXS C;  4RKL A;  4JW0 A;  5GAG C;  1FNW A;  4N8F A;  3DXJ C;  4Q0F A;  4RCN A;  1FGU A;  2B2V C;  1BQQ T;  1ZEQ X;  5HY6 A;  4A3G B;  2X6L A;  3EQL C;  4PG3 A;  3S17 B;  1WCM B;  3WOF A;  4DR3 L;  4IFD G;  1LTI D;  2PPB C;  4OIK A;  2MHV A;  3GQB A;  1CKN B;  1UE5 A;  2MO0 A;  4AIM A;  2QKI C;  2ZXR A;  3QOJ A;  3CC7 A;  3NK9 A;  3G6E A;  4V19 0;  2O5J C;  2MO1 A;  3PIP 3;  3BDC A;  4BY7 G;  1GUO A;  1WTW A;  1HRJ A;  4GKJ Q;  2RDH A;  3NTK A;  2NBF A;  4HIK A;  1SYG A;  4A93 G;  1GJX A;  3A74 A;  2D5D A;  2YTX A;  4UDU C;  1FR3 A;  4A3J B;  4LFC L;  3DWP A;  2BE5 C;  3MAQ A;  3NP8 A;  1D5X C;  1PTO D;  2MQH A;  2VUM H;  1CQF A;  3V2T A;  1VQ6 A;  4LF7 Q;  3U9O A;  3S2D B;  2JN4 A;  2XWJ B;  4YWM A;  3A54 A;  5KYI A;  1ONL A;  2Z1C A;  3BVG A;  1ROD A;  4B3T L;  1JB7 A;  1YIT A;  2ZJP A;  2F0Q A;  1GM5 A;  3RZD H;  4C3H G;  5C4H A;  2ENB A;  4A3C G;  2NZ1 D;  4DAV A;  1Q82 C;  1UWV A;  4X66 L;  1UEA B;  3EN2 A;  5EBC A;  5LL6 X;  4DUZ L;  4BBR G;  3L2P A;  3S2H H;  3F8T A;  5GRO A;  3CQZ B;  4EGV A;  1O78 A;  2VL6 A;  4ZK9 B;  4IUT A;  1YHA A;  2JA7 H;  2WV6 D;  1Y8N B;  5D65 A;  3K6O A;  4A3E B;  1XNR Q;  1WI5 A;  3PIO A;  1ILP A;  2JE6 I;  4HED A;  2K33 A;  3OW7 A;  4MHE A;  2PMZ B;  4ZUI A;  4BBS H;  1A62 A;  1S5D D;  3CCU A;  4A3F B;  1FNV A;  4HMI A;  2D9U A;  2MFI A;  4PNY A;  1TT2 A;  2H5X A;  2RHQ B;  1B50 A;  4QIW E;  2E2I B;  4A3M B;  1PH1 A;  1BBX C;  2UXD Q;  2KEE A;  1B2T A;  3D3R A;  4CDD C;  5FLX E;  1E1T A;  3HOX G;  2VW9 A;  5C3E H;  3MXN B;  2CH4 A;  1PH2 A;  3OSO A;  4OEL B;  1J5E L;  1HNZ Q;  4KJO A;  1KNE A;  4XT1 B;  3CPF A;  4IOC A;  2CVR A;  2B2W C;  1C0A A;  3SK5 A;  3BG3 A;  1LTB D;  2SEB D;  1SJH D;  4YIJ A;  1Z9F A;  4BWG B;  3PO3 B;  2M9V A;  4JC0 A;  2FXQ A;  3K0Y A;  2QEX A;  4A3K H;  3CP0 A;  1MBY A;  2ICE C;  3DWQ A;  4JI3 L;  4P74 A;  1STG A;  5K5P A;  5D14 A;  4A3I H;  4NB3 A;  2F52 A;  2KOL A;  1O7Z A;  2AUK A;  3BZK A;  1Q12 A;  3GTQ H;  1X3P A;  2F0N A;  2F0I A;  2MNA A;  3ERQ A;  4YY3 Q;  2B2Y A;  1I6H H;  2UU9 Q;  3I4O A;  4ME3 A;  1F9R A;  1G91 A;  1N9W A;  3GTJ B;  1Y1W B;  3T1Y L;  3A8I E;  1TY2 A;  4JV5 L;  2NTS A;  3WDN A;  2OT2 A;  2YU9 B;  3VA7 A;  4BY1 B;  1SNP A;  4RFB A;  2RQX A;  3WOE A;  2R92 B;  3M7N A;  3G7L A;  2QW7 A;  4GN5 A;  1ML0 D;  4NKL A;  3SK4 A;  5IGF A;  2KHI A;  5BN3 A;  5IT9 L;  4Q5V A;  4KY5 A;  1R4P B;  2WB1 G;  1TU2 B;  5BN4 A;  3HOV G;  3K81 C;  4IUV A;  3T1H L;  5FO7 B;  3ONA B;  2E2D C;  2YTV A;  2D0O A;  4JI6 L;  4LF9 L;  4JI5 Q;  1K83 B;  2SNM A;  1CKM A;  4YHH L;  4A76 A;  4DUY Q;  3L0O A;  4J6H A;  1L1O A;  1H9M A;  3STB C;  1H9J A;  2WKC A;  4AH6 A;  1IHZ A;  1RCV D;  5A35 A;  3BZD B;  1RTO A;  3D31 A;  1OXT A;  3CMA A;  2ZXP A;  2F3V A;  3HKZ B;  5LMN Q;  2HQL A;  1IBK L;  1KTK A;  4TRD A;  3VYU A;  4DPG A;  2A69 C;  4HAE A;  4OO1 I;  4TVA B;  2UUC L;  2IL8 A;  4C3I H;  4DV5 L;  3JC6 6;  1CHP D;  1QWY A;  2UUB Q;  5EKL A;  3ERS X;  4OL7 A;  3PO2 H;  5AFW A;  4DV0 L;  2DY7 A;  4RGT A;  1JOR A;  1F9P A;  2AWN A;  3TDQ A;  3UE1 A;  4U67 3;  3HOY H;  3S16 B;  2JEB I;  1LT5 D;  3NBI A;  3BYY B;  1ZYR C;  2YV5 A;  3RLF A;  1CK1 A;  1JMC A;  1LT4 D;  5T1G A;  4XQJ A;  2EVB A;  5NUC A;  3SK8 A;  1H95 A;  3SXH A;  1KAW A;  1VCI A;  5IGC A;  2PW7 A;  5D3I B;  1F2Z A;  2A68 C;  2AMC B;  4IUR A;  4NXM Q;  1Q8I A;  2LXK A;  5C44 G;  2NUC A;  4DV3 Q;  5E7N A;  1ZXT A;  3LX0 A;  1DON A;  2N88 A;  1LTT D;  3VR6 A;  1HFG A;  2RHS B;  1VQL A;  2L4N A;  2V4D A;  2J7Z A;  4UPA A;  3TRZ A;  1PRT F;  4BXX G;  1C9O A;  3DM3 A;  3W1B A;  3OTO L;  5C4J B;  3K8A A;  1GUN A;  3RNU A;  1X32 A;  4PV1 C;  2CH4 W;  3RD4 A;  1WOC A;  1XNQ Q;  1SE2 A;  1X56 A;  2UUA L;  2Z8L A;  4F7X A;  3ULL A;  3P20 A;  1H9S B;  1TS3 A;  2EIF A;  2EYH A;  4K5X A;  1DCZ A;  1OO9 B;  5IGG A;  4HID A;  3NWT A;  1SRU A;  1VQO A;  5LMU Q;  3FPU B;  5IYD H;  3PUW A;  3AEV A;  1M4V A;  3ERO A;  1I4X A;  4QUF A;  1LT6 D;  2UXB Q;  4DGZ A;  3IRB A;  1CQV A;  2PMZ E;  1QJO A;  2LY7 A;  2HDL A;  1AFP A;  4JBM A;  3H91 A;  1WTR A;  2A6H C;  5JPM C;  4HJA A;  1LTL A;  3K5L A;  4G7H C;  5KEE A;  1EQQ A;  1JC7 A;  3F1Z A;  2F03 A;  3HOZ B;  5IGD A;  4L5Q A;  3IKJ A;  3K58 A;  1WD1 A;  3GTO B;  1N33 Q;  1K73 C;  1EQV A;  2SNS A;  2SDF A;  4G7O C;  4EQ5 A;  2VUM B;  5EQ0 A;  4KHZ A;  4K2L A;  1L2F A;  3SVM A;  3J7A V;  2F3I A;  4RHS A;  2PYK A;  1JE5 A;  1NTG A;  4UAI A;  2QDL A;  1RJT A;  3GO5 A;  3D0F A;  3GP7 A;  2C5C A;  4DV2 L;  3RZD B;  1BR9 A;  3NTI A;  4JPB W;  3CCQ A;  1WTO A;  4GZY C;  1R9T B;  1GUG A;  3ZJY C;  1F9S A;  4NDX A;  1VMP A;  2UXD L;  5GQO A;  4R8N A;  3PF4 A;  3I4N H;  1SE4 A;  1CZG A;  4KKU A;  4C3J G;  2ATW A;  2B63 G;  3I4M H;  3LNN A;  3CCR A;  1FNU A;  2JA7 B;  4BY7 B;  1KRT A;  1B7Y B;  1VQM A;  2F0O A;  4WJ4 A;  2NWG A;  3M4Q A;  2LKV A;  4UP7 A;  4GOP B;  1MJC A;  2HD3 A;  4A3G H;  4BBS B;  1SMY D;  4ZKC B;  3S17 H;  3MVV A;  2RKS A;  4JI8 L;  1MHW C;  1PMR A;  2EPB A;  3CPW A;  1FGB D;  4ID6 A;  3NE5 B;  2L1B A;  4C3H B;  2OQK A;  2RDG A;  4R1J A;  2O5I C;  3PUY A;  5F2D A;  2PZW A;  1O80 A;  4ZQ3 A;  4F88 A;  3F2C A;  4UP9 A;  1Q86 C;  2B2V A;  5K36 G;  2F0F A;  1EQR A;  2B29 A;  2GA4 B;  2PZT A;  2E74 C;  3PCO B;  2EJM A;  1B9N A;  4ULL A;  1B1Z A;  1Q1E A;  5FK9 C;  1A2U A;  3KJO A;  2JA6 G;  3F2U A;  2NVY H;  2ZM6 L;  4FF4 A;  4DR3 Q;  2D62 A;  1JE4 A;  4A3K B;  5CMD A;  5M3F H;  1SSO A;  4A3I B;  3HKZ E;  1LUZ A;  2F0L A;  5DLQ E;  1SR3 A;  3GTQ B;  1JWM D;  5JVG 3;  1YNX A;  2DJF C;  3CQZ H;  1RDP D;  4MZ9 A;  1FD7 D;  1HXY D;  1QUQ B;  2WKD A;  1ILQ A;  2RA4 A;  1I6H B;  1EY8 A;  2EQS A;  4XTC S;  1AEX A;  3NWS A;  3ND9 A;  1VMC A;  2KCN A;  3BVZ A;  4LFC Q;  3J7A 5;  1V9P A;  3IFT A;  1HJP A;  1NMF A;  2KHS A;  5LMN L;  4DV6 L;  1GUW A;  1VQD A;  1EIY B;  1HQM C;  3E0E A;  3A7L A;  2K03 A;  2N3S A;  4K5W A;  4LF8 L;  1OXU A;  4B3T Q;  1KL9 A;  4K6L A;  3KUP A;  1AE2 A;  5ELF A;  2PQA A;  1F9Q A;  5HGT A;  3RLN A;  5IYB G;  5EPL A;  1BBW A;  1Z6H A;  4GLV B;  4O0A A;  5JEA G;  4A3M H;  4X66 Q;  4QF4 A;  4KTA A;  4DUZ Q;  1HCZ A;  5C4Z A;  4IUU A;  1G8Z D;  3E3X A; 
#chains in the Genus database with same CATH homology
 1XYI A;  2L5T A;  4FP5 D;  3QJY A;  4KJN A;  2XSC A;  3CU7 A;  1SYB A;  3J81 E;  2PO4 A;  1LT3 D;  3SK6 A;  4B9W A;  1G2T A;  3TN2 A;  4XT3 B;  1SNO A;  5DAU A;  1EY0 A;  2F0G A;  1EEF D;  1TWG B;  3PO2 B;  3H09 A;  3BYT B;  4K14 A;  3HOY B;  2EYF A;  2WB1 B;  4BS9 A;  1B4O A;  3HOV B;  3NUC A;  3CRL C;  4AYB B;  3N6R A;  1EYC A;  1JOK A;  3IAY A;  2B2W A;  1LAC A;  3DHQ A;  4G4K A;  1EU3 A;  1MGS A;  3VYR A;  3JAM E;  2A5H A;  2CW0 D;  2AQ2 B;  3OMC A;  5M3M B;  1S5B D;  3NPP A;  3PV0 A;  4FXK C;  3FPP A;  4CJ2 C;  5JAV A;  4XIG S;  1LLR D;  4LJZ C;  1WVL A;  1XWE A;  3C1E A;  3QB3 A;  1M8A A;  4IFD J;  2BOS A;  4XQN A;  3EJI A;  2K7V A;  3HRZ C;  3AMU A;  2NVX B;  1D2B A;  2Y0S B;  1Z47 A;  5COR A;  3VR5 A;  1L0Y B;  3P75 A;  4KN7 C;  3NQI A;  1RTN A;  2R61 A;  4RKB A;  2K04 A;  4NMZ A;  1D5Z C;  2JXM B;  3I4N B;  1DZ1 A;  4M1U B;  4IZ8 A;  4BA1 I;  3DEP A;  2F0W A;  3R8B A;  2KED A;  2XNA C;  3Q23 A;  1F77 A;  1PRT C;  3X3M A;  4KN4 C;  2OXP A;  4KKT A;  2CHB D;  3AU7 A;  1K8M A;  2QCP X;  3D4W A;  1WTP A;  3D6W A;  2WAC A;  4EQO A;  2MPM A;  1BO0 A;  4DK0 A;  1KDB A;  2IX1 A;  5KNC A;  1EWH A;  4JK1 C;  4WJW A;  5FO8 B;  1WD0 A;  1JWU D;  3VR3 A;  2EZV A;  2QDB A;  5C5L A;  3KBG A;  2PW5 A;  4K6D A;  3D8G A;  1STN A;  2CQA A;  4OO1 H;  2PQE A;  3VYT A;  4C3J B;  2B63 B;  1EZ8 A;  3O13 A;  3GD7 A;  1B53 A;  2NVY B;  5I9P A;  3N52 A;  5M3F B;  1CA5 A;  3M4O B;  4IFD H;  2FMC A;  3VA5 A;  1EY9 A;  3KF8 A;  1DJR D;  3PUZ A;  5I6W A;  2R3Z A;  1CFM A;  3FDT A;  4DXF A;  4CJ1 B;  2HUG A;  1HA5 A;  1F2Y A;  4X3S A;  1HTP A;  1CTM A;  3SEB A;  3OIP A;  5D3D A;  2FJ2 A;  2F0J A;  2L11 A;  1R4Q B;  4G57 A;  2BDO A;  1WTV A;  2ZT9 C;  4FF1 A;  2K1B A;  1JIC A;  2JA6 B;  1BCP B;  5IT9 E;  1BOS A;  1SYF A;  4DF7 A;  2L12 A;  1STB A;  1O7Y A;  4DAY A;  1BCP F;  2F3W A;  5IIF A;  4M8A A;  2O4X A;  5ELB A;  5JJZ A;  4WOR A;  1CZW A;  1F2M A;  2BE5 D;  4XQQ A;  1UUP A;  3EVQ A;  2OF1 A;  4LK1 C;  5C3X A;  4F8M A;  3L7Z C;  4DAP A;  1IL8 A;  2H1E A;  3ITP A;  1DXM A;  2NVQ B;  2F0D A;  3DUZ A;  4PMB A;  4RH6 A;  4IN3 A;  2RSO A;  3Q6S A;  4X3T A;  3A55 A;  3T13 A;  5KND A;  1SE3 A;  3DM1 A;  1TS2 A;  3ZYY X;  5E4X A;  2F0M A;  2IJ0 A;  2VB2 X;  2JEA I;  1YNJ C;  1EYD A;  1KLU D;  4ME5 A;  4OGQ C;  2DN8 A;  4LAA A;  3A56 A;  1O7L A;  3HS0 C;  1E2W A;  3LWU A;  1K8O A;  3URY A;  1CA6 A;  5I9O A;  3R93 A;  4HSV A;  4HCE A;  4F87 A;  1C8C A;  4FO2 A;  1BDO A;  3E0J A;  2AUJ D;  1SJE D;  2L0C A;  4CJ0 B;  1AP0 A;  1QB5 D;  4DU9 A;  1IYU A;  1TWA B;  1G6Z A;  1TWC B;  1PTO B;  2EXZ A;  1QE6 A;  4KY7 A;  2MGS A;  1JOO A;  5CR3 A;  4IFD I;  2L9H A;  1PTO F;  2VB3 X;  4WFN 3;  5C0X G;  1T5E A;  3K5M A;  4OIJ A;  4ZLT F;  2O2L D;  3I73 A;  3MXN A;  1PRT B;  2EYL A;  1B3A A;  4ILW A;  5FKA C;  3GTK B;  5C3W A;  4CKB A;  3GV3 A;  3GTM B;  1PYW D;  2WAQ B;  4J1M A;  2F0V A;  1JOQ A;  5CV4 A;  4I7Z C;  2XVS A;  3K7A B;  4CHT B;  4CGY B;  3MC0 B;  4FF3 A;  4PQX A;  3S9W A;  4QCL A;  5CGK A;  1G29 1;  2M00 A;  2A69 D;  3Q24 A;  4KK7 A;  3TSS A;  5EJW A;  3SHL A;  3C2P A;  3FRP B;  3HOU B;  2B8F A;  3TP7 A;  1DD2 A;  2JA5 B;  2K05 A;  3H94 A;  3OOC A;  3KLR A;  4FF2 A;  5C4X B;  5EBD A;  1ZYR D;  4RHR A;  2IW3 A;  4K8I A;  3D4D A;  3UI2 A;  2QIL A;  3E6Z X;  1MI2 A;  4H13 C;  2A68 D;  3SE0 A;  3GV6 A;  3V05 A;  1QNK A;  2EY5 A;  3PIO 3;  3Q22 A;  2A6E C;  2BA0 A;  5COY A;  1SAP A;  4R8I A;  2RVL A;  4DXG A;  1GUS A;  3QWN A;  4X3K A;  1NSN S;  5M5X B;  5CV5 A;  2QF7 A;  1I4P A;  1JQY D;  3RUZ A;  3GTP B;  4A93 B;  2F0P A;  2E76 C;  3T53 B;  1A15 A;  1SYD A;  4Y7N B;  1I4R A;  1ESR A;  2J0T D;  3OIQ A;  4QUC A;  1ENC A;  5M5W B;  3H0G B;  5JVH 3;  5JEA J;  4H44 C;  3HG9 A;  2K01 A;  4FYD A;  4RAU C;  1BNZ A;  3MEH A;  1PFB A;  2HCC A;  3QO2 A;  1EY7 A;  1YNN C;  2A6H D;  1DOL A;  2IX0 A;  4BBR B;  3S15 B;  5T1I A;  2G9D A;  2JSO A;  4ZKB B;  3AB9 A;  4A3D B;  1V1P B;  4IUN A;  1OXX K;  1TWH B;  1DOM A;  1SNM A;  2ID0 A;  1S5C D;  1B9M A;  2A73 B;  2ICI A;  4KY6 A;  1PLF A;  2RBM A;  5IOC A;  5C6A A;  1HPC A;  3OMG A;  5E3F A;  5FO9 B;  2LFN A;  2F0S A;  2BDN A;  2NN6 G;  1H9S A;  2KVM A;  1VDZ A;  5J39 A;  4B9X A;  3I3C A;  3HOX B;  2Q8I B;  1TQO A;  1PXU A;  4DNR B;  1TWF B;  2K5Q A;  2R93 B;  3P1H A;  1V1O A;  5K36 H;  3TP6 A;  4ZUJ A;  3DEO A;  1EZ6 A;  4LMQ D;  4OHJ A;  1RD9 D;  4E6I A;  2IPK D;  3W2D A;  3VR2 A;  4RGM A;  1TKW B;  1NAP A;  2Z4H A;  1BF4 A;  4QMG A;  1BCP C;  1H9R A;  2DNE A;  2TMP A;  4IAL A;  1QOH A;  5ELE A;  2WP8 J;  5EPJ A;  2M2L A;  2Q8R E;  3J7A F;  1EOT A;  2K32 A;  1KDA A;  5JEA H;  3NTH A;  1CI3 M;  1MD2 D;  2KA7 A;  3I72 A;  3T16 A;  4H0L C;  1QCB D;  2EY2 A;  1DOK A;  1HUN A;  2LS0 1;  2XRS D;  2TSS A;  5CV6 A;  5EGT A;  3HEJ A;  2HCI A;  2LMC B;  2EE1 A;  5TSS A;  3HZX A;  3SR1 A;  1QG7 A;  4FXD A;  5IGE A;  4EQP A;  5I2Y A;  1Y69 U;  3I70 A;  4QIW B;  4ABN A;  1GXD C;  1S5F D;  4C2M B;  2PZU A;  1HHV A;  3BDO A;  1EWC A;  5I4D A;  2B2T C;  3P7J A;  4Z9C B;  1U9R A;  4K2K A;  2IX3 A;  2R7Z B;  4XYO A;  5C44 B;  4L8J A;  2R6G A;  1BXT A;  1E2Z A;  4KD3 A;  1PTO H;  4KD4 A;  2SOB A;  4EQN A;  2X69 A;  3I4L A;  1U4R A;  4ZYS A;  4S3S A;  3QG1 A;  1STY A;  1IW7 D;  1W6K A;  1PTO C;  3IFD A;  4RWS C;  3VR4 A;  3NHH A;  2K28 A;  3D4R A;  1TS5 A;  3M7G A;  4ZAI A;  1LTA D;  1IKL A;  3NBH A;  5FOB B;  1V8Q A;  1GUT A;  3OWF A;  2PNR C;  3M85 A;  4DNT B;  4DA2 A;  4I65 A;  1D1K A;  1DM0 B;  1PZI D;  5A2Q L;  4RA8 A;  3FEW X;  5C5M A;  1QNU A;  5CBA E;  5CYU A;  4R9W A;  2EJF C;  4PMW A;  3A8J E;  1I50 B;  3TP5 A;  1EYA A;  1TY0 A;  2HDM A;  2EY6 A;  3KLS A;  2KEC A;  4O42 A;  3TP8 A;  1G2S A;  1NR4 A;  4J8Q A;  1AZQ A;  3PUV A;  1V43 A;  3MFG A;  3OHX C;  3KLS X;  2AQ1 B;  3VYS A;  3T56 B;  4FXG C;  2A74 C;  3RMH A;  4HMJ A;  5ELC A;  1LTR D;  3Q0A A;  3S1R B;  1IKM A;  3OWE B;  1A3U A;  2J4X A;  3A7A B;  1NCV A;  3GTL B;  5CV7 A;  3BVM A;  1Y8P B;  5DM6 3;  2IWH A;  1PRT D;  1D5M C;  1EEI D;  1I4Q A;  1NR2 A;  1A2T A;  3W3A A;  3G6J B;  2WIN B;  1TS4 A;  1UAP A;  3NQT A;  1JR0 D;  1DYQ A;  2XWB B;  3HOW B;  1EL0 A;  3DMU A;  5ISR A;  3TME A;  1RKN A;  1JCK B;  2F0U A;  2XRQ D;  1NUC A;  2G9H D;  4TSS A;  3CHB D;  1W6J A;  2E2J B;  1I4G A;  5JOB A;  2F0T A;  3MHB A;  2OEO A;  5CV9 A;  1A3T A;  3K57 A;  1GOZ A;  3GTG B;  4RCO A;  2E2H B;  5C0X J;  2K5W A;  1E0B A;  1LTG D;  3R3O A;  3TZD A;  1S4Z A;  2FMM A;  1E2V A;  1SYE A;  1MSG A;  2JYO A;  2MUY A;  1EY6 A;  1SYC A;  2I46 A;  1PDQ A;  2HQE A;  5J1Z A;  1WTQ A;  4C3I G;  5EPK A;  2EOT A;  3R2I A;  1EIH A;  2D2C C;  2B8G A;  4DN4 M;  5FLX L;  2I07 B;  1I3Q B;  4XXE A;  5M5Y B;  1IYV A;  2B2U C;  1A6X A;  1SNC A;  3D6C A;  3RZO B;  4KHV A;  4RGO S;  3OPO A;  1II3 A;  2EYJ A;  3HGB A;  4H7B A;  2DY8 A;  2YYZ A;  3H3V C;  2RSN A;  1HFN A;  2EY1 A;  2L55 A;  1ICW A;  3KK7 A;  3E5S A;  4CKC A;  4A3B B;  4V0B A;  2FFK B;  2RDF A;  1HUM A;  5E1F A;  1HQR D;  1KLG D;  3PMF A;  3PUX A;  4FNF A;  1STA A;  1KAA A;  1X3Q A;  2BA1 A;  3V96 A;  3K5N A;  1YNJ D;  4XYQ A;  4U68 A;  5LL6 S;  5J22 A;  1LAB A;  4CBV A;  4X3U A;  4ODG A;  2K5D A;  1C4Q A;  1Y8O B;  4TQU S;  2KUM A;  4N9P A;  5DM7 3;  5C0X H;  4B08 A;  1S5E D;  4BA2 I;  1EY4 A;  1SMY C;  3TZU A;  5EKI A;  1PZK D;  3MTS A;  3MXU A;  3M3Y B;  1LO5 D;  1ZKO A;  1VF5 C;  5IGB A;  2KQ3 A;  2DNC A;  2NVT B;  2EDG A;  4PMC A;  3HP3 A;  2B2T A;  4EVO A;  2E75 C;  1SXT A;  1CT1 D;  2F1M A;  5M9O A;  2NB0 A;  2NTT A;  1XTC D;  3J80 E;  1ESF A;  4DFA A;  1F2L A;  3J7Y W;  4WRD A;  1MSH A;  4TKO B;  5ELD A;  1AW7 A;  2IT1 A;  2WII B;  1A3V A;  1SFO B;  3T4A C;  1CM9 A;  1D1I A;  2Q8T A;  2K6A A;  5I2X A;  2MP1 A;  1Q3L A;  3M4Y A;  1KNA A;  4C1N K;  4CKE A;  3FKI B;  1KAB A;  3S2H B;  3NSW A;  1EU4 A;  2F0H A;  4MN3 A;  1BUV T;  3L3O C;  3QOL A;  5KYL A;  3CKI B;  3EA6 A;  1U4L A;  1ET9 A;  1TR5 A;  4P2C B;  4KI0 A;  3U9S A;  2BCO A;  3C1F A;  3SDZ A;  3S1N B;  1L0X B;  5G3L D;  3DWA A;  1FYC A;  2ZXO A;  3J80 L;  5BN5 A;  5C3E B;  4K8J A;  3BS1 A;  4L63 B;  4O1N A;  3MXG A;  2B2Y C;  1CHQ D;  1Q1B A;  1JB3 A;  4HR7 B;  1SND A;  5KNB A;  1H9K A;  2A6E D;  1AZP A;  4K5V A;  1WTX A;  1JWS D;  5HUR A;  4KV6 A;  4L6T B;  1GHK A;  5KIX A;  4N9T A;  1J9O A;  3X3N A;  3H6M A;  3I90 A;  1STE A;  2B39 A;  1ENF A;  2AWO A;  5C0X I;  2CW0 C;  4HN7 A;  5CC4 A;  1Q90 A;  4IUQ A;  2NN6 H;  1Z7T A;  1YNN D;  2C9O A;  4NP5 A;  4DK1 A;  2F4I A;  4XDX A;  1B44 D;  3K59 A;  2VNU D;  4IUP A;  1QIL A;  5DNF A;  3MA2 B;  2F0K A;  4G7Z C;  3K5O A;  5KRU A;  2EYP A;  1SDF A;  2X6G A;  4C56 C;  4MIU A;  2XIW A;  3FVQ A;  1XXG A;  2EJG C;  1HTL D;  1OXV A;  1PFN A;  4C3I B;  1U4P A;  2EYM A;  3EFX D;  2VXW A;  1C48 A;  3S14 B;  3T51 B;  1SNQ A;  4NW2 A;  1I4H A;  5KGU A;  2JP1 A;  3C46 A;  1ET6 A;  1D6E C;  1RHP A;  5EKK A;  2EYO A;  1V1P A;  2FIN B;  2XN9 C;  5CBE E;  1IW7 C;  1XX8 A;  5LHY 1;  3L9A X;  3R2T A;  1STH A;  1PZJ D;  1KDC A;  3I8Z A;  1TVX A;  5A2Q E;  3ND8 A;  4C1N I;  3J81 L;  3C3L A;  1BCP D;  1EQT A;  2Z4I A;  3MFY A;  1I6V C;  1EIG A;  1SEB D;  2AQ3 B;  3QIA A;  2KJX A;  4ZRZ A;  1HA6 A;  4KKS A;  2H4O A;  4FVM A;  1LTS D;  3MWY W;  1GHJ A;  3CRK C;  5IOD A;  3S1Q B;  2QEJ C;  5G3L F;  1SBB B;  2B2U A;  3BDL A;  1EY5 A;  4KMU C;  1T5X D;  3LWE A;  3MZ5 A;  3S1M B;  1UNS A;  1TII D;  1Y1V B;  1EFI D;  3NXW A;  3IL8 A;  1ENA A;  5JPN C;  3JAM L;  3MXP A;  2MJ8 A;  3I91 A;  4HTH A;  1AN8 A;  2FHT A;  2JA8 B;  3KBX A;  5DEH A;  5E4W C;  2F0E A;  1J8I A;  1PFM A;  4RGN A;  2N55 A;  4HSP A;  4IQZ A;  4JBW A;  1LV9 A;  2KCC A;  2NN6 I;  5CV8 A;  4OO1 G;  2PCF B;  2NYZ D;  1VF7 A;  4HCS A;  3FMC A;  1RF2 D;  4QB4 A;  3TBI B;  1U4M A;  3A8K E;  3I4M B;  5I6Y A;  1OXS C;  4RKL A;  1FNW A;  3DXJ C;  4Q0F A;  4RCN A;  2B2V C;  1BQQ T;  1ZEQ X;  4A3G B;  2X6L A;  3EQL C;  3S17 B;  1WCM B;  3WOF A;  4IFD G;  1LTI D;  2PPB C;  4OIK A;  2MHV A;  3GQB A;  2QKI C;  2ZXR A;  3QOJ A;  3NK9 A;  4V19 0;  2O5J C;  3PIP 3;  3BDC A;  1GUO A;  1WTW A;  1HRJ A;  2RDH A;  3NTK A;  2NBF A;  1SYG A;  1GJX A;  2D5D A;  4UDU C;  1FR3 A;  4A3J B;  3DWP A;  2BE5 C;  3MAQ A;  3NP8 A;  1D5X C;  1PTO D;  1CQF A;  3V2T A;  3U9O A;  3S2D B;  2XWJ B;  3A54 A;  5KYI A;  1ONL A;  2Z1C A;  3BVG A;  1ROD A;  2F0Q A;  4C3H G;  5C4H A;  2ENB A;  2NZ1 D;  4DAV A;  1UEA B;  5LL6 X;  5EBC A;  3CQZ B;  4EGV A;  1O78 A;  4ZK9 B;  4IUT A;  2WV6 D;  1Y8N B;  5D65 A;  3K6O A;  4A3E B;  1ILP A;  2JE6 I;  4HED A;  2K33 A;  3OW7 A;  4MHE A;  2PMZ B;  4ZUI A;  1S5D D;  4A3F B;  1FNV A;  4HMI A;  2D9U A;  4PNY A;  1TT2 A;  1B50 A;  2E2I B;  4A3M B;  1BBX C;  2KEE A;  1B2T A;  3D3R A;  5FLX E;  3OSO A;  4KJO A;  1KNE A;  4XT1 B;  2CVR A;  2B2W C;  3SK5 A;  3BG3 A;  1LTB D;  2SEB D;  1SJH D;  4YIJ A;  4BWG B;  3PO3 B;  2M9V A;  3K0Y A;  3DWQ A;  1MBY A;  2ICE C;  1STG A;  5K5P A;  5D14 A;  2KOL A;  1O7Z A;  2AUK A;  1Q12 A;  1X3P A;  2F0N A;  2F0I A;  3ERQ A;  2B2Y A;  1F9R A;  1G91 A;  3GTJ B;  1Y1W B;  3A8I E;  1TY2 A;  2NTS A;  3WDN A;  2OT2 A;  2YU9 B;  3VA7 A;  4BY1 B;  1SNP A;  4RFB A;  2RQX A;  3WOE A;  2R92 B;  3M7N A;  3G7L A;  4NKL A;  1ML0 D;  3SK4 A;  5IGF A;  5BN3 A;  5IT9 L;  4Q5V A;  4KY5 A;  1R4P B;  1TU2 B;  5BN4 A;  4IUV A;  5FO7 B;  3ONA B;  2E2D C;  1K83 B;  2SNM A;  4J6H A;  1H9M A;  1H9J A;  2WKC A;  1IHZ A;  1RCV D;  5A35 A;  3BZD B;  1RTO A;  3D31 A;  1OXT A;  2ZXP A;  2F3V A;  3HKZ B;  1KTK A;  4TRD A;  3VYU A;  2A69 C;  4HAE A;  4OO1 I;  2IL8 A;  1CHP D;  1QWY A;  5EKL A;  4OL7 A;  5AFW A;  2DY7 A;  4RGT A;  1JOR A;  1F9P A;  2AWN A;  3TDQ A;  4U67 3;  3S16 B;  2JEB I;  1LT5 D;  3NBI A;  3BYY B;  1ZYR C;  3RLF A;  1CK1 A;  1LT4 D;  5T1G A;  4XQJ A;  2EVB A;  5NUC A;  3SK8 A;  3SXH A;  1VCI A;  5IGC A;  2PW7 A;  5D3I B;  1F2Z A;  2A68 C;  4IUR A;  1Q8I A;  2NUC A;  1ZXT A;  3LX0 A;  1DON A;  2N88 A;  1LTT D;  3VR6 A;  1HFG A;  2L4N A;  2V4D A;  2J7Z A;  1PRT F;  5C4J B;  1GUN A;  1X32 A;  4PV1 C;  3RD4 A;  1SE2 A;  2Z8L A;  4F7X A;  3P20 A;  1H9S B;  1TS3 A;  2EYH A;  4K5X A;  1DCZ A;  1OO9 B;  5IGG A;  3NWT A;  3FPU B;  3PUW A;  1M4V A;  3ERO A;  1I4X A;  4QUF A;  1LT6 D;  4DGZ A;  1CQV A;  1QJO A;  2LY7 A;  2HDL A;  1AFP A;  3H91 A;  1WTR A;  2A6H C;  5JPM C;  3K5L A;  4G7H C;  5KEE A;  1JC7 A;  2F03 A;  3HOZ B;  5IGD A;  3IKJ A;  3K58 A;  1WD1 A;  3GTO B;  1EQV A;  2SNS A;  2SDF A;  4G7O C;  2VUM B;  5EQ0 A;  4KHZ A;  4K2L A;  3SVM A;  3J7A V;  4RHS A;  2PYK A;  4UAI A;  1RJT A;  3GO5 A;  3GP7 A;  2C5C A;  3RZD B;  1BR9 A;  3NTI A;  1WTO A;  4GZY C;  1R9T B;  1GUG A;  1F9S A;  4NDX A;  1VMP A;  4R8N A;  1SE4 A;  1CZG A;  4KKU A;  4C3J G;  3LNN A;  1FNU A;  2JA7 B;  4BY7 B;  2F0O A;  2NWG A;  2LKV A;  4BBS B;  1SMY D;  4ZKC B;  3MVV A;  2RKS A;  1PMR A;  2EPB A;  1FGB D;  4ID6 A;  3NE5 B;  2L1B A;  4C3H B;  2RDG A;  2O5I C;  3PUY A;  5F2D A;  2PZW A;  1O80 A;  4ZQ3 A;  4F88 A;  2B2V A;  5K36 G;  2F0F A;  2GA4 B;  2PZT A;  2E74 C;  2EJM A;  1B9N A;  4ULL A;  1B1Z A;  1Q1E A;  5FK9 C;  1A2U A;  3F2U A;  4FF4 A;  2D62 A;  1JE4 A;  4A3K B;  5CMD A;  1SSO A;  4A3I B;  2F0L A;  3GTQ B;  1JWM D;  5JVG 3;  1RDP D;  1FD7 D;  1HXY D;  2WKD A;  1ILQ A;  2RA4 A;  1I6H B;  1EY8 A;  4XTC S;  1AEX A;  3NWS A;  3ND9 A;  1VMC A;  2KCN A;  3BVZ A;  3IFT A;  2KHS A;  1GUW A;  1HQM C;  3A7L A;  2K03 A;  4K5W A;  1OXU A;  4K6L A;  3KUP A;  5ELF A;  1F9Q A;  5HGT A;  5EPL A;  1Z6H A;  5JEA G;  4QF4 A;  4KTA A;  1HCZ A;  5C4Z A;  4IUU A;  1G8Z D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...