1LTGD

The arg7lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the a subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title The Arg7Lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the A subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 20
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1995-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ltgD00
1BCPD 3DWPA 3EA6A 1LO5D 3O13A 2G9HD 3KLSX 4RHRA 2O2LD 1LTBD 2QEJC 3R2TA 1L0YB 4RGOS 1KLGD 1PRTC 1EU4A 1SE3A 5ELDA 1LLRD 1SE4A 1V1PB 1SJED 1DYQA 2J4XA 1V1OA 2RDHA 1BCPB 2QILA 1BCPF 1SEBD 3R2IA 4TSSA 1I4QA 4UDUC 1CHPD 4RGTA 3BVZA 2ICIA 1FGBD 1JWMD 1EEFD 1TS3A 2NTSA 5FKAC 2XRSD 1TY2A 4BWGB 1T5XD 2TSSA 1HXYD 1FD7D 1B1ZA 1PRTD 1LT6D 1EU3A 3MFGA 1S5BD 1SE2A 1JCKB 1FNUA 4RCOA 1TS2A 2XRQD 3V05A 3EFXD 1AW7A 1HA5A 2IJ0A 2NTTA 5I4DA 2AQ1B 3DWQA 1SJHD 1CT1D 1PZID 2WV6D 1ET9A 1HQRD 4DXGA 1TS4A 1I4HA 1JR0D 3BYYB 3BZDB 3URYA 1PTOB 1PTOF 3CHBD 1CQVA 2CHBD 1PRTB 1D5ZC 1PZJD 1UUPA 4OHJA 3MC0B 1ENFA 5ELEA 3DWAA 1PZKD 1D5MC 4DXFA 5ELCA 2SEBD 2R61A 3R8BA 1EEID 4K6LA 3W2DA 1EFID 1RDPD 1FNWA 1CHQD 1KLUD 3GP7A 1D5XC 1LT4D 4O1NA 1JQYD 2AQ2B 1MD2D 1QILA 2Z8LA 5TSSA 1L0XB 1XTCD 1PYWD 1LTID 1GOZA 1JWUD 4C56C 3OWEB 1STEA 1F77A 4RGMA 1CK1A 5ELFA 1LTAD 1LTRD 5D3DA 3BVGA 1D6EC 1PRTF 1BXTA 2AQ3B 2RDGA 1FNVA 1S5FD 3BYTB 1S5DD 1AN8A 1RD9D 1RCVD 4ZYSA 1XXGA 1LTGD 1PTOC 1LTTD 1I4GA 1DJRD 1BCPC 1LT3D 1S5ED 1UNSA 4RGNA 1M4VA 1TS5A 1B44D 5FK9C 1G8ZD 2IPKD 1TY0A 2XNAC 5ELBA 1EWCA 1JWSD 1S5CD 1RF2D 1PTOH 1SXTA 4RFBA 3SEBA 1ET6A 1I4RA 4L6TB 4L63B 4RH6A 1I4XA 5D3IB 1LTSD 1KTKA 1ESFA 1I4PA 1LT5D 1HTLD 1SBBB 2XN9C 3TSSA 3BVMA 4Z9CB 1PTOD 1V1PA 4RHSA
chains in the Genus database with same CATH superfamily
2MFIA 5HY6A 2UUCQ 4HN7A 2WAQG 1MI2A 4DAYA 5COYA 1TWHH 2A8VA 3I73A 4TVAB 1TWGB 4DUYL 2EDGA 1NUCA 3S15B 3S14B 1DYQA 3R2IA 1WCMB 3CCSA 2CQOA 2HIVA 4I7ZC 4DN4M 1Y1VB 5J1ZA 4BWGB 3CRKC 1TWCB 2EYLA 3G4SA 1W6KA 1G2SA 3M4OH 4PQXA 2O4XA 4K5XA 2K5WA 3I56A 3K57A 1JR0D 1LACA 1VQAA 3M4QA 4X66Q 3M4PA 4IUTA 1I6VC 4LJZC 1Z6HA 2K5QA 4K2KA 4OIJA 4A93B 2ZXPA 5EKKA 2L0CA 1RODA 5IGCA 2D5DA 2R61A 3AU7A 2B63G 1SAPA 1K8AC 1IBML 3STBD 2HT1A 1KHIA 4DV5L 4JV5Q 2K5HA 1E0BA 2Y0SE 1H9RA 3S1MH 2JA7B 1ONLA 2EYJA 4BA1I 4N9TA 3GTKH 5M5WB 3OWEB 2R7ZH 3NTIA 4PMWA 5ELFA 5IOCA 1PRTF 4KN4C 1H9KA 4LFCL 4OIKA 2BA1A 1RD9D 3P7JA 4JI7L 1PYSB 3TEHB 3CCUA 2DNEA 4OWTB 2PYKA 1RL2A 2I07B 2NN6G 5GAEC 5FK9C 3J81L 3BDOA 4LF9L 2KVMA 3S2HH 2VQFL 5LMNL 4JI2Q 4ZRZA 3OMGA 3S16H 3GTMB 5D3IB 3TBIB 4LF4L 2DJFC 4KK7A 1HRJA 4OX9Q 4BBRH 5CV5A 1B3QA 4GN3B 1N9WA 1Y8OB 1I5FA 3HOUH 2F1MA 4OO1G 1K83H 2OTJA 4IUQA 3QG1A 2KOLA 2WB1E 2YYZA 4YHHL 4NXMQ 1C4QA 1WFQA 4DV6L 1YHQA 5EBCA 5EPKA 2EY5A 2HQLA 5I9OA 3PUZA 2V4DA 1SR3A 2O5JC 4GKKL 1DOLA 3BVZA 2IT1A 1XNQL 3H3VI 2B2TA 1UE5A 1WTRA 1TS3A 4CBVA 1Z47A 3T1HL 5CC4A 1HNWL 2E74C 1W3SA 3IL8A 4GLVB 1HCZA 3A5ZB 4XTCS 5HURA 2KCNA 1EU3A 3Q24A 4RCOA 2QCPX 3D4RA 1XMOQ 1EY4A 2Z6KC 4MTNA 4FXDA 4HIMA 2NVQB 3D6CA 4NXNQ 1D1KA 3H6MA 1PFNA 1Y14B 4JBKA 2ZTDA 1K0SA 4HJAA 1SJHD 1YEZA 1YITA 1F2ZA 1HUNA 1EZ8A 1V43A 2MUYA 1U5KA 2VZAA 1Q3LA 4POGA 3HFZB 2K5VA 1QWYA 1IKLA 1STYA 2NVYH 5FO9B 4OHJA 4BY7G 1D5MC 1Y1VG 4QF4A 4JI0Q 4K6LA 3GQBA 3IFDA 1FNWA 2JP1A 1A15A 4X3TA 1HR0Q 2BOSA 3PUWA 1A62A 1LTID 5C6AA 4YY3Q 3PIP3 5IP9G 4PMBA 1NTGA 3J7AF 1JWUD 3EVQA 1STGA 1F77A 1BBXC 4A93G 5D3DA 4MNOA 1GUWA 2IHEA 1EY6A 2JYOA 5I2YA 2OEOA 3KOJA 2PW5A 1S5FD 4Q5VA 1S5DD 1XJVA 5DNFA 2KEDA 1PLFA 1G51A 1X3QA 1EYCA 5T1GA 5M3MH 1PYBA 2CW0C 2VL6A 5K5PA 3MXNA 2N8NA 1G6ZA 4L8JA 3GO5A 1SDFA 3CKIB 2JA7G 2EYPA 1V8QA 1B9NA 2JA5B 1HNXQ 5LHY1 1EZ6A 4ZCKA 4L6TB 1GO3E 1Y8NB 4XQNA 2ID0A 3CD6A 5CV4A 2KCMA 1VS0A 1CZWA 2BE5C 2UU9L 4N8FA 4JK1C 4FF2A 2F3WA 2F0LA 4HJ9A 4RHRA 1Y1WB 2R92H 1Z9FA 2N3SA 1KLGD 4HMIA 1PRTC 5ELDA 3K0XA 5IYCG 2JA6G 1UWVA 1PMRA 1PH7A 1EYDA 2RDHA 1FVIA 2E2JB 1DM0B 3CPWA 3D31A 5ELNA 5E4WC 5KNCA 2IWHA 1DONA 1T5XD 3KF8B 1AZPA 1O80A 2V1CC 2Z1CA 1DCZA 3HGBA 4K5WA 1NY4A 4L5RC 4DK1A 3I4MB 1S5BD 3PQIA 4ULLA 3C1FA 5IGEA 2AQ1B 4QIWB 3HOWG 3FMCA 1QZGA 1ET9A 5IYDG 4DR4L 1YJWA 3BYYB 2HD3A 1K28A 1PTOF 4J15A 5M5YB 1LABA 1SNMA 3HOYB 1GUTA 1A6XA 1B3AA 1Y69U 4DV0Q 4LF8Q 1ASZA 2PMZB 4K14A 5E3FA 5BR8Q 1M1KC 3HRZC 1BUVT 1XYIA 1EFID 2A69D 2HHHQ 3E5SA 2RSOA 2QGQA 3X3MA 1ESRA 4A3CH 3NBIA 5C4ZA 2F4VL 2Z8LA 2MGSA 5M5XH 4UP8A 1EY5A 4AQYQ 4X3SA 4JI1Q 1FGUA 3SK4A 1VMPA 1K3BC 5JPMC 1BXTA 5IE8A 5L37A 4K2LA 2H1EA 4Y52H 1AN8A 1F9SA 1FL0A 4V0BA 1BR9A 3HS0C 2FMCA 3MXGA 1I4GA 4BBSH 5E4XA 1BBUA 1X3PA 4FXGC 3U4ZA 2L1BA 3VR2A 5K36G 1WD1A 2NVXB 2TMPA 2X6LA 4IQZA 4N8X1 1ET6A 1VQJA 1PH2A 1E1OA 3K7UC 5C44H 1G6PA 2F0TA 3HOZB 5JEAG 5IP7G 1SBBB 3I72A 3KLWA 1ML0D 1RTNA 2A6ED 4GKJL 3PSIA 3KDFB 2B2TC 1ICFB 5LMUQ 1RTOA 3JAMi 2WACA 2UXDQ 4IFDI 3W1GA 2C9OA 1I3QH 4HJ8A 5C4JB 3BZKA 3GTLB 1F2MA 2M9VA 4IJLA 4WFN3 4P75A 2JA5G 3EN2A 1YJ9A 3CRLC 5CORA 3A55A 3M3YB 1IXRA 3ULPA 5IWAL 3GTPH 1CKNB 1WD0A 2ENBA 1X3EA 3GD7A 2NTSA 2A73B 5LMNW 3HKZB 1KIXA 1GHJA 4GLXA 4B3TL 5GAHC 1Y1WG 1IYJB 2A6HC 2ZXOA 1HA5A 2IJ0A 3WWVA 2F0VA 4PZ8A 3E3XA 1PZID 2BCOA 3NBHB 4FVMA 4DAYB 3RZOB 4JI6L 5ELEA 4LK1C 5C0XJ 2KHJA 5JJLA 5ELCA 4CKEA 2M00A 4DV1L 2PNHA 2E2IB 1EEID 4QQBX 2ES2A 3L7ZC 1RIPA 1RDPD 3I4MG 2ICEC 4DR2Q 4IUPA 4QIWE 5LL6S 5FJ8G 4PZ7A 1H9MA 2VNUD 4B3ML 5IT9L 5IGGA 1VMCA 4KKTA 2NWGA 1STEA 2RF4A 3L0OA 4KHPQ 4DV4L 2OWOA 4ZLTF 5C0XG 2VXWA 1VF7A 4C3HB 3HOYG 2Q2HA 4ME3A 2ZT9C 1M8AA 1EWIA 2F0IA 4JI4L 2I5HA 2F0JA 4XIGS 3H3VH 3T51B 4JI5Q 3DM1A 1PTOC 2XIWA 4A3JH 3S1QH 1M4VA 3RZDB 4OEMB 4FF1A 1TY0A 1ZEQX 3S1MB 1EYGA 2PQAB 4X3UA 2EE1A 2DNCA 3I4NH 1DOKA 1GD7A 3VYUA 1E1TA 4RAUC 4X62L 1Q7YC 1PDQA 1Q86C 1HUMA 4NW2A 1KXLA 3O13A 2KEEA 1N36Q 1SLJA 1HNZQ 4FF3A 2WAQB 3KLSX 4DV3L 2DJGC 3P1HA 1EOVA 1LV9A 1VQBA 3SHLA 3CCMA 2KUMA 3KF8A 3AFPA 1CA6A 1Q12A 2NYZD 4QJFA 3HOZG 3L2PA 3OIQA 1R9TH 1EOTA 5IYBH 3JAML 1STBA 1Q1EA 4AH6A 4PMCA 4CJ1B 4JI8L 1VQ6A 2A74C 3OYYA 4LF6L 1HR0W 4EVOA 1JWMD 4WJWA 1XX8A 1EIGA 1TY2A 3KUPA 4CGYB 1IBKL 1EQVA 1G291 1PH3A 2CQAA 3VR3A 1K0RA 2F0WA 4YCUA 5G3LF 4IOAA 1IBLQ 1EY9A 1XMQL 2WV6D 3OW2A 4KTAA 3S17B 1N33L 2MHVA 3J80i 5JJKA 1H95A 5CV6A 3GTOH 3LGJA 1KDBA 3ICEA 3HOVH 4BXXG 4WJ4A 4K0KL 4JCVE 3CMEA 3HKZG 4JYAQ 2F0OA 4FF4A 1NJIC 1CQFA 3A7LA 1BQQT 3ONAB 4KJOA 2Q8IB 3RLOA 4LUOA 4MZ9A 1AZQA 1AFPA 5KEEA 5CV9A 4HTHA 1PYWD 3U9OA 5M9OA 3T53B 2R93B 1TWAH 3K8AA 1RHPA 1DOMA 1CK1A 1EIYB 3NHHA 3G7LA 3QO2A 3J7A5 4A3FH 4OWWB 4A75A 1D1IA 1F9QA 2XSCA 3TQYA 4EQNA 2F0NA 1NCVA 5IGFA 2MNAA 3N6RA 4LFBL 3KDFA 1NR2A 5ELBA 5JJZA 2EZVA 2Z4HA 5JPNC 3SEBA 1L1OB 1RF2D 1SYFA 3SDZA 1YIJA 2VUMH 3PUVA 4IALA 2FFKB 2H5XA 4C3HG 3F2UA 3TP5A 4LMQD 1IL8A 3KBGA 5HGQA 1B8AA 2KJXA 2KA7A 4S3SA 3H91A 1U4LA 4C3JB 1C8CA 2MQHA 1SE4A 4PV1C 4HJ7A 1C0AA 1KNEA 4A3GB 1U4MA 2JN4A 2BDOA 1SJED 4R4QA 5C4XH 3S1RH 2QF7A 1TU2B 4QUFA 3CCQA 2IL8A 5I9PA 2R7ZG 2ICIA 4IPDA 4A3LH 4CJ2C 5LL6X 1PXUA 1VQKA 4LAAA 1EEFD 4ZKBB 1Q1BA 1H9JA 4K6DA 3NBHA 2WAQE 1B1ZA 4MTKA 2JA8B 3SGIA 2KCCA 1HA6A 3CCVA 1STAA 3EROA 4IOCA 3EIVA 5EPLA 4CDFC 3OTOQ 2RDFA 1VQOA 1P16A 1TS4A 1I4HA 2UXCL 3BZDB 1PTOB 5H1SE 3CHBD 5EGTA 4DKAC 4OXPA 3NK9A 1HPCA 4X64L 4A3MH 2PNRC 4C3IH 3AQQA 4BY7B 2HUGA 2UUCL 1NSNS 3H0GH 4CHTB 1J5EQ 5KIXA 1YZ6A 1N32Q 1IZ6A 3CQZH 4A3KH 1LT4D 5JJIA 3DEPA 2O5IC 3J80L 1EFWA 2ZM6Q 3K59A 4IFDH 2AWOA 1L0XB 4HSPA 1TQOA 2C5CA 1UE1A 5CYUA 1HZAA 4F88A 2PZTA 2MPMA 3RMHA 4HIDA 2I5MX 3CU7A 3G6JB 2LMCB 3BS1A 1LTAD 1EQRA 2MJ8A 4YIJA 4KD3A 1FNVA 2PQAA 3MVVA 1PVOA 1F9PA 4R4OA 3M7NA 1WTOA 1I50H 1D8LA 1SFOB 1VQDA 4LFAQ 3VR5A 2F0HA 4ZAIA 2F0SA 3CPFA 2F0PA 1G2TA 2BH2A 5JVG3 4A3DB 2K50A 5M5XB 2R93G 4PG3A 2N78A 4X66L 1FJGQ 1E22A 2B2UA 2B8FA 2WKCA 4DR5Q 3P20A 1VQEA 4QY7A 5C3EH 1JMCA 1Y8PB 3MXUA 3TREA 4DR3Q 3EA6A 4I7AA 3W5OA 5FO8B 2R7FA 3GV6A 4JV5L 4Y7NB 2QEJC 4ME5A 4LNQA 3NUCA 1SE3A 4JOIA 4QUCA 3FKIH 3PO2H 1S3OA 4K8JA 2G9DA 2JA6B 1OXTA 4YCVA 1II3A 4CKCA 2WIIB 3PIOA 3ND8A 1MJCA 1QG7A 1SROA 3DM3A 4BY1H 1I4QA 2CFMA 2IHFA 2B29A 3TZDA 2I5LX 1N8RC 4EQOA 4DR7Q 3OSOA 4UP9A 1QNUA 3CC2A 2B3GA 3ZYYX 1WVLA 3A74A 4C3JG 3STBC 2E76C 1SMYD 1I3QB 1WTXA 2GVBA 1U9RA 4H02A 5JVH3 1O78A 4B9XA 4A3GG 1VQCA 3HOWB 4JI2L 4C2MB 3ND9A 2AMCB 5DLQE 5M3FH 2CHBD 2PZWA 4OX9L 4IURA 3QWNA 1N34Q 1ILPA 4R1JA 3GTGB 4G4KA 4B3SQ 2JA8G 1MSHA 5CV7A 2F0DA 1MBYA 3QOJA 1HTPA 1I6HB 4NXML 5I6YA 1QZHA 3KBXA 2RBMA 2F0UA 1KL9A 3FVQA 4HSVA 2RHQB 1E2WA 3WOEA 3HG9A 2B63H 3OIPA 4XXEA 1U4PA 1PHJA 2IY5B 4GOPA 2JJQA 5J22A 1L1OA 4MN3A 3EQLC 4UAIA 4ZUJA 4GNXB 1JJCB 2D62A 1KDAA 1RCVD 4DV7Q 1JB3A 3LWUA 1XMOL 3E9HA 1NE3A 4NXNL 2D0PA 4CDEC 2K5NA 4XYOA 2E5LQ 1CKMA 3AB9A 3NTKA 2H4OA 3K7AH 2RCNA 4L63B 4RH6A 1UEBA 2EYHA 2L55A 3VYTA 5CV8A 3GTQH 1A2TA 4JI3Q 4LF5Q 3T13A 5EPJA 1JOOA 5EKIA 4JI0L 3CP0A 1WJJA 3DWPA 4LUVA 5AFWA 5IT9c 3TP8A 3U9SA 2X6GA 2CCZA 2NB0A 1XPRA 3UDFA 1L0YB 1ZKOA 4RGOS 1WYDA 3NWSA 1PH4A 1HR0L 4A3CG 3TMEA 1BKBA 2D0OA 4YY3L 4A3DG 1GKHA 4EX5A 1A3TA 2PPBC 1OO9B 3NWTA 4TSSA 5BN5A 3I90A 1VQLA 2VY3A 4WJ3M 2KCTA 1BNZA 1EIHA 1GHKA 1CZGA 2ZJRA 1FD7D 4B3RL 1LT6D 1G91A 2K05A 1LM0A 4E6IA 1EQQA 3HEJA 4CKBA 2NVTB 5C0XI 3VR4A 4DR1Q 3F2CA 1HNXL 1B70B 2SDFA 1GUSA 3EBEA 4Z9CB 3KFUA 1EL0A 4BS9A 3T56B 5C44G 1BOSA 1VQNA 4UP7A 1R9TB 1UUPA 5DM73 4H44C 3UDGA 3PCOB 2AWNA 2WFWA 3RLNA 3ITPA 4GLAC 1Q90A 1IHZA 2UXBQ 3S15H 1SYEA 3A8KE 3NTHA 3S14H 3G48A 5C5LA 2YU9B 1NNXA 5KRUA 5GROA 2HCCA 1WCMH 1ZXTA 1GUGA 3T1YQ 4IUUA 1JT8A 1JE5A 3FPUB 3F2BA 4QL5A 1JORA 3K80C 1Y1VH 2B2UC 1D7QA 4K5VA 1TWCH 2RDGA 1F2LA 2HCIA 1HZCA 2LY7A 1QJOA 3NQIA 5GQOA 3F1ZA 3S2DB 5IP9H 3IRBA 3HZXA 4JOIC 5EQ0A 3PO3B 3TN2A 1ENAA 1GUOA 4A93H 1HFNA 4TRDA 4YWMA 2EXZA 1LTSD 1YNND 1XNRQ 3MEHA 2KENA 4ID6A 2JSOA 5JEAJ 4DV0L 4LF8L 1YHBA 3PF4A 1A8VA 4DK0A 5BR8L 3D0FA 2HHHL 2JA7H 3R2TA 2KQ3A 3JC66 1Q8KA 2E2HH 4DF7A 4OGQC 1D2BA 2F0KA 5M5WH 1K8GA 5DEHA 4AQYL 4JBJA 1OXXK 3R3OA 4JI1L 4M8AA 1AE2A 1BCPF 1SEBD 1SNDA 2XWJB 4IUVA 2JK8A 3I4LA 4JPBW 5ELOA 5FLXL 2TSSA 3K58A 3K81C 5FO7B 4R4TA 4DNRB 4A3IB 3GTJB 5IYCH 5DAUA 1X54A 2A69C 1VF5C 1UEAB 3DWQA 2VQEQ 5E1FA 1J6QA 5IODA 4FDBA 1CT1D 4I65A 5FLMH 3GTMH 1WTQA 3S1RB 5J3BA 1IYVA 3MA2B 3KK7A 2R6GA 5KYIA 4LWCA 1C48A 3J7ZC 1OXUA 4CDDC 4GOPC 5LMUL 2CVRA 1L1OC 2OF1A 2VB3X 2MO0A 1X3GA 2UXDL 3PV0A 1TWHB 3MXPA 2NZ1D 2B2VC 3B6YA 5IYDH 4KMUC 4GNXA 1EUJA 2YTVA 4GZYC 3VA7A 4A4IA 3U58A 1GXDC 4HIKA 4LF7Q 3I3CA 2E8GA 3M7GA 2RA4A 1TVXA 3UE1A 1CFMA 3NPPA 5CBEE 2A6EC 2K14A 3F8TA 2NVQH 1OXVA 1TT2A 1LTTD 4EGVA 1DJRD 3T16A 3KJOA 3DLLA 1YNJD 3M4OB 3CQZB 4DUZL 4JBWA 3NENA 1O7YA 2LS01 2HDMA 3NXWA 1X65A 3ERSX 2UUAQ 4JBMA 1DZ1A 3FP9A 1KAWA 5CMDA 1KTKA 1NR4A 2L5TA 4UHVA 1NMGA 1ILQA 4H0LC 4WORA 4A3EH 3J80c 1PV4A 1W6JA 2AKWB 1O7IA 1BCPD 2PMZE 3HOVG 2R7DA 2MO1A 3Q23A 1KDCA 2B2YA 4WRDA 4L5QA 1WTVA 4QMGA 2K5DA 5K36H 1KABA 1I50B 4DR2L 2A68D 2OCEA 5AJ3Q 1XPUA 1MKHA 3PUYA 3PO3G 3OMCA 4KLKA 4F7XA 5IP7H 1C7YA 2QEXA 4KHPL 3GTKB 2R7ZB 3CMAA 5IT9E 2K7VA 1FGBD 1VQ7A 1A63A 4FO2A 4R4IA 1PFSA 4O0AA 1J8IA 2YTYA 1HXYD 4DV3Q 4JI5L 1YVCA 4RKLA 3P75A 1UE7A 1PH1A 2PZUA 2JA5H 1AW7A 2K04A 3G71A 2EY6A 5C3XA 1EWHA 3S2HB 1PFMA 1QNKA 3ZJYC 2K6AA 2JXMB 3DXJC 3S16B 2PQEA 4RKBA 1CTMA 1PZJD 2EY1A 4OWXB 3J81c 2EY2A 4FNFA 4U673 4BBRB 2WINB 2SEBD 2EPBA 1Y1WH 2KHIA 4P73A 1N36L 1HNZL 3HOUB 4A3IG 2QW7A 3UDXA 1D5XC 1K83B 4DNIA 2L11A 1JQYD 4HJ5A 3RNUA 1Q81C 2AQ2B 1PH6A 2IW3A 4EQPA 1K73C 1KAAA 1Q8IA 2E2JH 3LWEA 2PI2A 2K32A 5BN3A 1EY7A 3VYSA 2EYOA 3ULJA 4RGMA 5M3FB 4FXKC 2CWAA 2FJ2A 1HQMC 4A3LG 1YHAA 3HKZE 3I4MH 1X6OA 2NN6I 3FRPB 4NKLA 5EBDA 3SXHA 1X9NA 1UNSA 2SOBA 5BN4A 2M2LA 5FJ8H 3NQTA 2LKVA 2UUBQ 1HH2P 2XNAC 1EWCA 3I2ZA 1S5CD 3OHXC 5M5YH 1I4RA 2CKZB 2DUDA 5C0XH 1I4XA 3VR6A 3DUZA 3NEMA 3HOYH 1K3RA 1LT5D 1I4PA 1QVGA 1JJ2A 4OO1I 3A0JA 2IX3A 4ZUIA 4DR6L 3QJYA 4BA2I 2NVYB 2AUKA 4XQJA 1WTPA 3CW2C 5EKLA 1OXSC 2N49A 4JYAL 3H0GG 4O2DA 2O2LD 3FDTA 5HGTA 2FINB 1I94Q 3OW7A 4X65Q 3D4DA 1H9SB 4GOPB 1DXMA 1QUQB 1V1OA 4CJ0B 2NBFA 3BZCA 4UDUC 4DV2Q 1A2UA 2EJFC 4DPGA 2XRSD 4O42A 2F0GA 3FPPA 3U50C 1FNUA 2XRQD 1JB7A 5DM63 3E6ZX 5M3MB 1E7ZA 3SR1A 3Q8DA 1E2VA 3SK8A 3HOZH 1FR3A 1X55A 3H94A 4GNXC 1U4RA 2EYMA 1RKNA 3TP6A 5T1IA 2F0EA 3D6WA 5D14A 4HIOA 1ENFA 2KBNA 4LW1A 5C3EG 4A3BH 3W2DA 3C1EA 3MTSA 3NP8A 5C4JH 1KLUD 4NMZA 3CXCA 2YTXA 2ZXRA 3TP7A 3SE0A 2WB1B 3D4WA 4DUYQ 2R92B 1LTLA 1QILA 5TSSA 3M3YH 1BBWA 4XYQA 4X6AH 2CH4W 1STHA 3H3VC 5A2QE 2Q2IA 1VQ9A 4BXXH 4NPSA 2GVAA 1SNCA 2X69A 2AQ3B 4BBRG 4HR7B 1B2TA 1XXGA 2FMMA 3HOUG 2PCFB 3PF5A 2B2YC 1TS5A 1G8ZD 4FP5D 4RA8A 3OTOL 3MFYA 2DGYA 1SRUA 4RCNA 4P74A 1SE8A 1SSOA 4CDCC 3RZOH 5CGKA 3A56A 3CCEA 2DY7A 5M3FG 3TZUA 2RVLA 2E2IH 1SNPA 1IBMQ 1A3VA 2G9HD 1J5EL 4DV5Q 3AEVA 1N32L 3M9BA 3SVMA 1K8MA 1JC7A 2ZM6L 3TS0A 1BDOA 1F9RA 2EJGC 4P2CB 1V1PB 2K03A 3AFQA 3J80E 3S9WA 3V2TA 4C3HH 1BCPB 2QILA 3C2PA 2ZJPA 2EXDA 1CKOA 2LSSA 5C3WA 4G57A 4LFCQ 2G5DA 5C5MA 2K75A 2KECA 2F3VA 1QCBD 4JI7Q 2QDLA 3BG3A 1GUNA 4R8IA 3RZDH 1E2ZA 2EQSA 1TS2A 4IPHA 3UI2A 1MGSA 4LFAL 1PA6A 2Y0SG 1XTDA 4OL7A 5I4DA 4BBSB 2E2HB 1MHWC 2EOTA 4LF9Q 2VQFQ 3W1BA 3HOXH 5LMNQ 1TR5A 1HQRD 3KLRA 2XGTA 5D65A 1E24A 1FJGL 5FOBB 4LF4Q 3PIO3 5C44B 1BO0A 4K8IA 4DR5L 3A7AB 2ALYB 4MHEA 2VW9A 1PZKD 2F0FA 4KY5A 3LX0A 2N55A 3PMFA 4DR3L 1PH9A 1HZBA 3ERQA 1YJNA 1B4OA 2EVBA 4O1NA 2EYFA 3K5OA 5M3MG 3MEFA 4XT1B 4IO9A 4YHHQ 3CCJA 5FLXc 4IPGA 1TWFH 4DV6Q 1TKWB 1CUKA 2ZJQA 1NMFA 3IFTA 4DK3C 3J81E 2JEBI 5E7NA 4H7BA 4IZ8A 4C1NI 4GKKQ 1XNQQ 3GTPB 1IYUA 4DR7L 1A0IA 3BYTB 3T1HQ 1HNWQ 2WP8J 1V1QA 1LTGD 1QOHA 4QGUA 1T5EA 4RG1A 2WB1G 5GAGC 2R92G 2VS1A 3S17H 4DAVA 4RFBA 2RHSB 3PGZA 2N88A 4DK6C 2RQXA 3M4YA 3A8JE 2XN9C 2R3ZA 3RLFA 1B7YB 3QIAA 4V190 3BVMA 1N34L 2CWPA 1H9SA 2GN5A 1Z7TA 1IW7D 5EJWA 1QUQA 3GDEA 1LO5D 2CW0D 3Q0AA 3I7FA 4B3SL 3IAYA 1VQ5A 1KD1C 4JW0A 2B2VA 4J6HA 5CR3A 2R93H 1CI3M 2Z0SA 1SMYC 5F2DA 2D9UA 1WCMG 4ODGA 2BE5D 3K5MA 4QB4A 4A3EB 2HQEA 3S24A 4PZ6A 3U4VA 1HJPA 4XDXA 2AHOB 1PRTD 2F3IA 2EIFA 4DV7L 1JCKB 4AIMA 2ASBA 2NN6H 4UY8C 2ATWA 1HFGA 4A3JB 3S1QB 3RR5A 5A35A 1YBYA 2E5LL 1HHVA 1YNXA 1SN8A 3PIPA 2HIXA 1FYCA 1CA5A 1KNAA 4DXGA 2XWBB 1CQVA 4YWLA 3KF6A 4HCEA 3I4NB 4JI3L 4LF5L 1AH9A 2J0TD 3BJUA 3CC7A 2UU9Q 2J7ZA 4N9PA 4OO1H 3K5NA 2QKIC 4B3RQ 4XQQA 3S1NH 1IW7C 2F0MA 1ZYRD 4GN5A 3T4AC 4C3JH 4GS3A 3GP7A 1SYGA 4BBSG 4A3GH 1JOKA 1JE4A 4IPCA 1BF4A 1LYLA 2NZOA 4P71A 2IX1A 1SMXA 3N52A 3BVGA 3WOFA 2E2DC 4ILWA 5I6WA 3D3RA 1XPOA 5IIFA 2Z4IA 1EIFA 3I91A 4ZYSA 2JA8H 1TWGH 1LT3D 4POFA 3JAMc 1R4PB 1TIID 2L9HA 1CSQA 4DGZA 3E9IA 1TXYA 4DR1L 2Q2TA 1B9MA 2I0QA 1PTOH 4R4CA 5FLMG 4DR4Q 2IX0A 4AYBB 2A5HA 4KHZA 3G6EA 2OQKA 3E0JA 3H15A 1ESFA 3TSSA 4G7HC 4BY7H 1UAPA 3L3OC 4HCSA 3RD4A 2RSNA 1WTHA 1SNOA 4TQUS 4RMFA 1V1PA 2XTIA 1P8LA 2RCFA 4JVZA 3RN5A 1GM5A 3KLSA 3GTOB 1VQPA 3HOVB 1VCIA 1V9PA 1VQFA 3NSWA 2UXBL 1ZYRC 5KNDA 4G7OC 1AE3A 1LLRD 2F4VQ 5IGDA 3FHWA 4QCLA 3OWFA 1S4ZA 3LNNA 3T1YL 4L5TA 4F87A 3AMUA 2ZTEA 1K8OA 1TWAB 1S40A 4KD4A 4LUZA 1WTWA 2NUCA 4XT3B 5FKAC 3PUXA 3SK6A 2Q2UA 1SFOH 1NBWA 3AYHB 3TDQA 2DY8A 4A3FB 4MIUA 1Q82C 2GA4B 4KY6A 4A3DH 4KKUA 3UE0A 3K0YA 2F52A 3MZ5A 1OTCA 3J7AV 4ALPA 1SYCA 4APVA 4KKSA 4Q0FA 1XNRL 1AP0A 2SNSA 2B2WA 4GKJQ 2VUMB 3MC0B 4A3EG 4DXFA 3Q22A 5KYLA 4YWKA 4HEDA 2LXKA 2KHSA 4KHVA 2A6HD 4Y7NH 1F2YA 4IN3A 1CHQD 1MJEA 2QA4A 4EQ5A 1VQ4A 4A3JG 2JA6H 1IL2A 4JG2A 3RN2A 4HMJA 4NDXA 3V96A 5IWAQ 1LTRD 5C4XB 3KYHC 3I4NG 1VDZA 1YNNC 4OELB 1C9OA 2JE6I 3OPOA 2F03A 3BU2A 4B3TQ 4A3BB 4KN7C 1E3PA 4NP5A 1JICA 5FLXE 1S72A 2D2CC 2K4KA 3HOWH 2BA0A 2VQEL 4A76A 3FEWX 4C2MH 2B8GA 3I4OA 1XWEA 1VQHA 2FHTA 4KI0A 1K9MC 4OONA 3J81j 4JI6Q 3GTGH 5IYBG 3BDLA 1PTOD 2K01A 1NAPA 4A3MB 4C3IB 4DV1Q 5C4HA 1X32A 3NE5B 1EY8A 2A1AA 3CCRA 1SYDA 2Z6BA 3MWYW 3H0GB 1I6HH 1LTBD 4DUZQ 3QR8A 3QB3A 1DD2A 3EJIA 1R4QB 1EU4A 4A3KB 1AEXA 1PH5A 1QE6A 4AYBE 4B3MQ 2VB2X 2J4XA 4AYBG 3KJPA 4LF7L 3VA5A 4DV4Q 2EJMA 1LUZA 1CHPD 2ZTCA 3K5LA 2A19A 4JI4Q 5EAYA 4DAPA 1W2BA 2Q8TA 1A3UA 4IJHA 3K6OA 3I70A 1JJGA 2PI2E 2PO4A 5KGUA 3WDNA 1SE2A 5IY0A 3HP3A 4H13C 2OTLA 3V05A 3IKJA 3EFXD 4GN4B 2NTTA 1EY0A 2OXPA 4P72A 1WOCA 2UUAL 1CM9A 3URYA 3R93A 5JEAH 4G7ZC 3TRZA 4J1MA 1B50A 1PRTB 1D5ZC 5ISRA 4X62Q 3A8IE 1MIUA 2CH4A 1QVFA 2DN8A 4J8QA 3RUZA 2RKSA 5C3EB 3QOLA 3SK5A 2BH8A 3C46A 4DAMA 3J7YW 2JA9A 5GADC 3I55A 4A3FG 2JQOA 3HKSA 3A5UA 5AJ3L 1PH8A 1MD2D 1SYBA 4ABNA 2BDNA 3ULLA 1XTCD 4R9WA 1YNJC 3DMUA 3FKIB 3PO2B 4ZK9B 1GOZA 3HOXB 3GV3A 1KRSA 4JI8Q 4JC0A 4LF6Q 2VUMG 4BY1B 4IUNA 1L2FA 4NB3A 3A54A 3CF5A 2Q8RE 5CBAE 5I2XA 2HDLA 1T9HA 1IBKQ 3L9AX 3VYRA 1BCPC 1S5ED 2NZHA 4KJNA 4HAEA 2L12A 4M1UB 2NVTH 2FXQA 2XVSA 1B44D 2IPKD 2SNMA 1XMQQ 1JWSD 2A68C 3NELA 3Q6SA 3UDIA 3H09A 1TWFB 4DU9A 2F0QA 1N33Q 4DFAA 3MHBA 5C4XG 1STNA 2WKDA 4DA2A 5KNBA 2K1BA 4RWSC 4K0KQ 3JAME 3D8GA 4A3BG 5NUCA 1VQIA 2YU9H 4ZKCB 1IBLL 4ZQ3A 1BVSA 2C35B 2B39A 2YV5A 4IFDJ 4X3KA 4DNTB 1UE6A 2I46A 4RGTA 1EQTA 4DR6Q 2OT2A 1DGSA 3W3AA 1GVPA 1RJTA 1JOQA 2B2WC 4UPAA 4A3MG 4C3IG 2B63B 1EYAA 1X3FA 2P5ZX 1KC8C 3MFGA 3DEOA 4L5SA 3S2DH 3MAQA 2K28A 4LFBQ 2OQ0A 4B08A 2E75C 1O7ZA 2Y0SB 4A3KG 2UUBL 3PO3H 1KQSA 2PW7A 4FYDA 1WI5A 2L4NA 4IFDG 1GJXA 3K7AB 2K33A 1B53A 1MSGA 1X56A 5JAVA 2LXJA 3X3NA 3GTQB 1QB5D 1ASYA 3DWAA 1ENCA 3R8BA 1VQ8A 4KY7A 2Z9HA 2Z6KA 1SNQA 3E0EA 3CC4A 4KV6A 4F8MA 1Q46A 3TS2A 4B9WA 5J39A 1VQGA 3BDCA 2NVXH 1I94L 4R8NA 4PNYA 4X65L 2JEAI 1KRTA 4C56C 4TKOB 4U68A 2MP1A 3J81i 1L0WA 5IGBA 4DV2L 1D6EC 1HZ9A 2F4IA 3M85A 2K52A 3F2DA 4A3IH 3GTJH 3DHQA 3VDYA 1CKNA 1IKMA 3S1NB 4RGNA 1YI2A 3GTLH 1O7LA 2QDBA 4YCWA 1CSPA 3KF6B 1M90C 1ICWA 2AUJD 5A2QL 5JOBA 3OOCA 3FKIG 1SXTA 3PO2G 3I8ZA 2UXCQ 3CCLA 1J9OA 2L15A 3HOXG 5G3LD 4C1NK 1VQMA 1HTLD 4X64Q 2LFNA 3MXNB 4BY1G 3CAMA 3C3LA 3ER0A 1QVCA 1U0LA 1PFBA 4RHSA
chains in the Genus database with same CATH topology
4HN7A 1MI2A 4DAYA 5COYA 3I73A 1TWGB 2EDGA 1NUCA 3S15B 3S14B 1DYQA 3R2IA 1WCMB 4I7ZC 4DN4M 1Y1VB 5J1ZA 4BWGB 3CRKC 1TWCB 2EYLA 1W6KA 1G2SA 4PQXA 2O4XA 4K5XA 2K5WA 3K57A 1JR0D 1LACA 4IUTA 1I6VC 4LJZC 1Z6HA 2K5QA 4K2KA 4OIJA 4A93B 2ZXPA 5EKKA 2L0CA 1RODA 5IGCA 2D5DA 2R61A 3AU7A 1SAPA 1E0BA 1H9RA 2JA7B 1ONLA 2EYJA 4BA1I 4N9TA 5M5WB 3OWEB 3NTIA 4PMWA 5ELFA 5IOCA 1PRTF 4KN4C 1H9KA 4OIKA 2BA1A 1RD9D 3P7JA 2DNEA 2PYKA 2I07B 2NN6G 5FK9C 3J81L 3BDOA 2KVMA 4ZRZA 3OMGA 3GTMB 5D3IB 3TBIB 4KK7A 1HRJA 5CV5A 1Y8OB 2F1MA 4OO1G 4IUQA 3QG1A 2KOLA 2YYZA 1C4QA 5EBCA 5EPKA 2EY5A 5I9OA 3PUZA 2V4DA 2O5JC 1DOLA 3BVZA 2IT1A 2B2TA 1WTRA 1TS3A 4CBVA 1Z47A 5CC4A 2E74C 3IL8A 1HCZA 4XTCS 5HURA 2KCNA 1EU3A 3Q24A 4RCOA 2QCPX 3D4RA 2NVQB 1EY4A 4FXDA 3D6CA 1D1KA 3H6MA 1PFNA 1SJHD 1F2ZA 1HUNA 1EZ8A 1V43A 2MUYA 1Q3LA 5FO9B 1QWYA 1IKLA 1STYA 4OHJA 1D5MC 4QF4A 4K6LA 3GQBA 3IFDA 1FNWA 2JP1A 1A15A 4X3TA 2BOSA 3PUWA 5C6AA 1LTID 3PIP3 4PMBA 3J7AF 1JWUD 3EVQA 1STGA 1F77A 1BBXC 5D3DA 1GUWA 1EY6A 2JYOA 5I2YA 2OEOA 2PW5A 1S5FD 4Q5VA 1S5DD 5DNFA 2KEDA 1PLFA 1X3QA 1EYCA 5T1GA 2CW0C 5K5PA 3MXNA 1G6ZA 4L8JA 3GO5A 1SDFA 3CKIB 2EYPA 1V8QA 1B9NA 2JA5B 5LHY1 1EZ6A 4L6TB 1Y8NB 4XQNA 2ID0A 5CV4A 1CZWA 2BE5C 4JK1C 4FF2A 2F3WA 2F0LA 1Y1WB 4RHRA 1KLGD 4HMIA 1PRTC 5ELDA 1PMRA 1EYDA 2RDHA 2E2JB 1DM0B 3D31A 5E4WC 5KNCA 2IWHA 1DONA 1T5XD 1AZPA 1O80A 2Z1CA 1DCZA 3HGBA 4K5WA 4DK1A 3I4MB 1S5BD 4ULLA 3C1FA 5IGEA 2AQ1B 4QIWB 3FMCA 1ET9A 3BYYB 1PTOF 5M5YB 1LABA 1SNMA 3HOYB 1GUTA 1A6XA 1B3AA 1Y69U 2PMZB 4K14A 5E3FA 3HRZC 1BUVT 1XYIA 1EFID 2A69D 3E5SA 2RSOA 3X3MA 1ESRA 3NBIA 5C4ZA 2Z8LA 2MGSA 1EY5A 4X3SA 3SK4A 1VMPA 5JPMC 1BXTA 4K2LA 2H1EA 1AN8A 1F9SA 4V0BA 1BR9A 3HS0C 2FMCA 3MXGA 1I4GA 5E4XA 4FXGC 1X3PA 2L1BA 3VR2A 5K36G 1WD1A 2NVXB 2TMPA 2X6LA 4IQZA 1ET6A 2F0TA 3HOZB 5JEAG 1SBBB 3I72A 1ML0D 1RTNA 2A6ED 2B2TC 1RTOA 2WACA 4IFDI 2C9OA 5C4JB 3GTLB 1F2MA 2M9VA 4WFN3 3CRLC 5CORA 3A55A 3M3YB 1WD0A 2ENBA 3GD7A 2NTSA 2A73B 3HKZB 1GHJA 2A6HC 2ZXOA 1HA5A 2IJ0A 2F0VA 1PZID 2BCOA 4FVMA 3RZOB 5ELEA 4LK1C 5C0XJ 5ELCA 4CKEA 2M00A 2E2IB 1EEID 3L7ZC 1RDPD 2ICEC 4IUPA 5LL6S 1H9MA 2VNUD 5IGGA 5IT9L 1VMCA 4KKTA 2NWGA 1STEA 4ZLTF 5C0XG 2VXWA 1VF7A 4C3HB 2ZT9C 1M8AA 2F0IA 2F0JA 4XIGS 3T51B 3DM1A 1PTOC 2XIWA 1M4VA 3RZDB 4FF1A 1TY0A 1ZEQX 3S1MB 4X3UA 2EE1A 2DNCA 1DOKA 3VYUA 4RAUC 1PDQA 1HUMA 4NW2A 3O13A 2KEEA 4FF3A 2WAQB 3KLSX 3P1HA 1LV9A 3SHLA 2KUMA 3KF8A 1CA6A 1Q12A 2NYZD 3OIQA 1EOTA 3JAML 1STBA 1Q1EA 4PMCA 4CJ1B 2A74C 4EVOA 1JWMD 4WJWA 1XX8A 1EIGA 1TY2A 3KUPA 4CGYB 1EQVA 1G291 2CQAA 3VR3A 2F0WA 5G3LF 1EY9A 2WV6D 4KTAA 3S17B 2MHVA 5CV6A 1KDBA 2F0OA 4FF4A 1CQFA 3A7LA 1BQQT 3ONAB 4KJOA 2Q8IB 1AZQA 1AFPA 5KEEA 5CV9A 4HTHA 1PYWD 3U9OA 5M9OA 3T53B 2R93B 1RHPA 1DOMA 1CK1A 3NHHA 3G7LA 3QO2A 1D1IA 1F9QA 2XSCA 4EQNA 2F0NA 1NCVA 5IGFA 3N6RA 1NR2A 5ELBA 5JJZA 2EZVA 2Z4HA 5JPNC 3SEBA 1RF2D 1SYFA 3SDZA 3PUVA 4IALA 2FFKB 4C3HG 3F2UA 3TP5A 4LMQD 1IL8A 3KBGA 2KJXA 2KA7A 4S3SA 3H91A 1U4LA 4C3JB 1C8CA 1SE4A 4PV1C 1KNEA 4A3GB 1U4MA 2BDOA 1SJED 2QF7A 1TU2B 4QUFA 2IL8A 5I9PA 2ICIA 4CJ2C 5LL6X 1PXUA 4LAAA 1EEFD 4ZKBB 1Q1BA 1H9JA 4K6DA 3NBHA 1B1ZA 2JA8B 2KCCA 1HA6A 1STAA 3EROA 5EPLA 2RDFA 1TS4A 1I4HA 3BZDB 1PTOB 3CHBD 5EGTA 3NK9A 1HPCA 2PNRC 4BY7B 2HUGA 1NSNS 4CHTB 5KIXA 1LT4D 3DEPA 2O5IC 3J80L 3K59A 4IFDH 2AWOA 1L0XB 4HSPA 1TQOA 2C5CA 4F88A 5CYUA 2PZTA 2MPMA 3RMHA 3CU7A 3G6JB 2LMCB 3BS1A 1LTAD 2MJ8A 4YIJA 4KD3A 1FNVA 3MVVA 1F9PA 3M7NA 1WTOA 1SFOB 3VR5A 2F0HA 4ZAIA 2F0SA 2F0PA 1G2TA 5JVG3 4A3DB 5M5XB 2B2UA 2B8FA 2WKCA 3P20A 1Y8PB 3MXUA 3EA6A 5FO8B 3GV6A 4Y7NB 2QEJC 4ME5A 3NUCA 1SE3A 4QUCA 4K8JA 2G9DA 2JA6B 1OXTA 1II3A 4CKCA 2WIIB 3ND8A 1QG7A 1I4QA 3TZDA 4EQOA 3OSOA 1QNUA 3ZYYX 1WVLA 4C3JG 2E76C 1SMYD 1I3QB 1WTXA 1U9RA 5JVH3 1O78A 4B9XA 3HOWB 4C2MB 3ND9A 2CHBD 2PZWA 4IURA 3QWNA 1ILPA 3GTGB 4G4KA 1MSHA 5CV7A 2F0DA 1MBYA 3QOJA 1HTPA 1I6HB 5I6YA 3KBXA 2RBMA 2F0UA 3FVQA 4HSVA 1E2WA 3WOEA 3HG9A 3OIPA 4XXEA 1U4PA 5J22A 4MN3A 3EQLC 4UAIA 4ZUJA 2D62A 1KDAA 1RCVD 1JB3A 3LWUA 4XYOA 3AB9A 3NTKA 2H4OA 4L63B 4RH6A 2EYHA 2L55A 3VYTA 5CV8A 1A2TA 3T13A 5EPJA 1JOOA 5EKIA 3DWPA 5AFWA 3TP8A 3U9SA 2X6GA 2NB0A 1L0YB 1ZKOA 4RGOS 3NWSA 3TMEA 1A3TA 2PPBC 1OO9B 3NWTA 4TSSA 5BN5A 3I90A 1BNZA 1EIHA 1GHKA 1CZGA 1FD7D 1LT6D 1G91A 2K05A 4E6IA 3HEJA 4CKBA 2NVTB 5C0XI 3VR4A 2SDFA 1GUSA 1EL0A 4BS9A 3T56B 1BOSA 1R9TB 1UUPA 5DM73 4H44C 2AWNA 3ITPA 1Q90A 1IHZA 1SYEA 3A8KE 3NTHA 5C5LA 2YU9B 5KRUA 2HCCA 1ZXTA 1GUGA 4IUUA 3FPUB 1JORA 2B2UC 4K5VA 2RDGA 1F2LA 2HCIA 2LY7A 1QJOA 3NQIA 3S2DB 3HZXA 5EQ0A 3PO3B 3TN2A 1ENAA 1GUOA 1HFNA 4TRDA 2EXZA 1LTSD 1YNND 3MEHA 4ID6A 2JSOA 5JEAJ 4DK0A 3R2TA 2KQ3A 4DF7A 4OGQC 1D2BA 2F0KA 5DEHA 1OXXK 3R3OA 4M8AA 1BCPF 1SEBD 1SNDA 2XWJB 4IUVA 3I4LA 5FLXL 2TSSA 3K58A 5FO7B 4DNRB 4A3IB 3GTJB 5DAUA 2A69C 1VF5C 1UEAB 3DWQA 5E1FA 5IODA 4I65A 1CT1D 1WTQA 3S1RB 1IYVA 3MA2B 3KK7A 2R6GA 5KYIA 1C48A 1OXUA 2CVRA 2OF1A 2VB3X 3PV0A 1TWHB 3MXPA 2NZ1D 2B2VC 4KMUC 4GZYC 3VA7A 1GXDC 3I3CA 3M7GA 2RA4A 1TVXA 1CFMA 3NPPA 5CBEE 2A6EC 1OXVA 1TT2A 1LTTD 4EGVA 1DJRD 3T16A 1YNJD 3M4OB 3CQZB 4JBWA 1O7YA 2LS01 2HDMA 3NXWA 1DZ1A 5CMDA 1KTKA 1NR4A 2L5TA 1ILQA 4H0LC 4WORA 1W6JA 1BCPD 3Q23A 1KDCA 2B2YA 4WRDA 1WTVA 4QMGA 2K5DA 5K36H 1KABA 1I50B 2A68D 3PUYA 3OMCA 4F7XA 3GTKB 2R7ZB 5IT9E 2K7VA 1FGBD 4FO2A 1J8IA 1HXYD 4RKLA 3P75A 2PZUA 1AW7A 2K04A 2EY6A 5C3XA 1EWHA 3S2HB 1PFMA 1QNKA 2K6AA 2JXMB 3DXJC 3S16B 2PQEA 4RKBA 1CTMA 1PZJD 2EY1A 2EY2A 4FNFA 4U673 4BBRB 2WINB 2SEBD 2EPBA 3HOUB 1D5XC 1K83B 2L11A 1JQYD 2AQ2B 2IW3A 4EQPA 1KAAA 1Q8IA 3LWEA 2K32A 5BN3A 1EY7A 3VYSA 2EYOA 4RGMA 5M3FB 4FXKC 2FJ2A 1HQMC 2NN6I 3FRPB 4NKLA 5EBDA 3SXHA 1UNSA 2SOBA 5BN4A 2M2LA 3NQTA 2LKVA 2XNAC 1EWCA 1S5CD 3OHXC 1I4RA 5C0XH 1I4XA 3VR6A 3DUZA 1LT5D 1I4PA 4OO1I 2IX3A 4ZUIA 3QJYA 4BA2I 2NVYB 2AUKA 4XQJA 1WTPA 5EKLA 1OXSC 2O2LD 3FDTA 5HGTA 2FINB 3OW7A 3D4DA 1H9SB 1DXMA 1V1OA 4CJ0B 2NBFA 4UDUC 1A2UA 2EJFC 2XRSD 4O42A 2F0GA 3FPPA 1FNUA 2XRQD 5DM63 3E6ZX 5M3MB 3SR1A 1E2VA 3SK8A 1FR3A 3H94A 1U4RA 2EYMA 1RKNA 3TP6A 5T1IA 2F0EA 3D6WA 5D14A 1ENFA 3W2DA 3C1EA 3MTSA 3NP8A 1KLUD 4NMZA 2ZXRA 3TP7A 3SE0A 2WB1B 3D4WA 2R92B 1QILA 5TSSA 4XYQA 1STHA 3H3VC 5A2QE 1SNCA 2X69A 2AQ3B 4HR7B 1B2TA 1XXGA 2FMMA 2PCFB 2B2YC 1TS5A 1G8ZD 4FP5D 4RA8A 3MFYA 4RCNA 1SSOA 5CGKA 3A56A 2DY7A 3TZUA 2RVLA 1SNPA 1A3VA 2G9HD 3SVMA 1K8MA 1JC7A 1BDOA 1F9RA 2EJGC 4P2CB 1V1PB 2K03A 3J80E 3S9WA 3V2TA 1BCPB 2QILA 3C2PA 5C3WA 4G57A 5C5MA 2KECA 2F3VA 1QCBD 3BG3A 1GUNA 4R8IA 1E2ZA 1TS2A 3UI2A 1MGSA 4OL7A 5I4DA 4BBSB 2E2HB 2EOTA 1TR5A 1HQRD 3KLRA 5D65A 5FOBB 3PIO3 5C44B 1BO0A 4K8IA 3A7AB 4MHEA 1PZKD 2F0FA 4KY5A 3LX0A 2N55A 3PMFA 3ERQA 1B4OA 2EVBA 4O1NA 2EYFA 3K5OA 4XT1B 1TKWB 3IFTA 3J81E 2JEBI 4H7BA 4IZ8A 4C1NI 3GTPB 1IYUA 3BYTB 2WP8J 1LTGD 1QOHA 1T5EA 4DAVA 4RFBA 2N88A 2RQXA 3M4YA 3A8JE 2XN9C 2R3ZA 3RLFA 3QIAA 4V190 3BVMA 1H9SA 5EJWA 1Z7TA 1IW7D 1LO5D 2CW0D 3Q0AA 3IAYA 2B2VA 4J6HA 5CR3A 1CI3M 1SMYC 5F2DA 2D9UA 4ODGA 2BE5D 3K5MA 4QB4A 4A3EB 2HQEA 4XDXA 1PRTD 1JCKB 2NN6H 1HFGA 4A3JB 3S1QB 5A35A 1HHVA 1FYCA 1CA5A 1KNAA 4DXGA 2XWBB 1CQVA 3I4NB 4HCEA 2J0TD 2J7ZA 4N9PA 4OO1H 3K5NA 2QKIC 4XQQA 1IW7C 2F0MA 1ZYRD 3T4AC 3GP7A 1SYGA 1JOKA 1JE4A 1BF4A 2IX1A 3N52A 3BVGA 3WOFA 2E2DC 4ILWA 5I6WA 3D3RA 5IIFA 2Z4IA 3I91A 4ZYSA 1LT3D 1R4PB 1TIID 2L9HA 4DGZA 1B9MA 1PTOH 2IX0A 4AYBB 2A5HA 4KHZA 3E0JA 1ESFA 3TSSA 4G7HC 1UAPA 3L3OC 4HCSA 3RD4A 2RSNA 4TQUS 1SNOA 1V1PA 3KLSA 3GTOB 3HOVB 1VCIA 3NSWA 1ZYRC 5KNDA 4G7OC 1LLRD 5IGDA 4QCLA 3OWFA 1S4ZA 3LNNA 4F87A 3AMUA 1K8OA 1TWAB 4KD4A 1WTWA 2NUCA 4XT3B 5FKAC 3PUXA 3SK6A 3TDQA 2DY8A 4A3FB 4MIUA 2GA4B 4KY6A 4KKUA 3K0YA 3MZ5A 3J7AV 1SYCA 4Q0FA 4KKSA 1AP0A 2SNSA 2B2WA 2VUMB 3MC0B 4DXFA 3Q22A 5KYLA 4HEDA 2KHSA 4KHVA 2A6HD 1F2YA 4IN3A 1CHQD 4HMJA 4NDXA 3V96A 1LTRD 5C4XB 1VDZA 1YNNC 3OPOA 2JE6I 2F03A 4A3BB 4KN7C 4NP5A 1JICA 5FLXE 2D2CC 2BA0A 3FEWX 2B8GA 1XWEA 2FHTA 4KI0A 3BDLA 1PTOD 2K01A 1NAPA 4A3MB 4C3IB 5C4HA 1X32A 3NE5B 1EY8A 1SYDA 3MWYW 3H0GB 1LTBD 3QB3A 1DD2A 3EJIA 1R4QB 1EU4A 4A3KB 1AEXA 1QE6A 2VB2X 2J4XA 3VA5A 2EJMA 1CHPD 3K5LA 4DAPA 2Q8TA 1A3UA 3K6OA 3I70A 2PO4A 5KGUA 3WDNA 1SE2A 3HP3A 4H13C 3V05A 3IKJA 3EFXD 2NTTA 1EY0A 2OXPA 1CM9A 3URYA 3R93A 5JEAH 4G7ZC 4J1MA 1B50A 1PRTB 1D5ZC 5ISRA 3A8IE 2DN8A 4J8QA 3RUZA 2RKSA 5C3EB 3QOLA 3SK5A 3C46A 3J7YW 1MD2D 1SYBA 4ABNA 2BDNA 1XTCD 4R9WA 1YNJC 3DMUA 3FKIB 3PO2B 4ZK9B 1GOZA 3HOXB 3GV3A 4BY1B 4IUNA 3A54A 2Q8RE 5CBAE 5I2XA 2HDLA 3L9AX 3VYRA 1BCPC 1S5ED 4KJNA 4HAEA 2L12A 4M1UB 2XVSA 1B44D 2IPKD 2SNMA 1JWSD 2A68C 3Q6SA 3H09A 1TWFB 4DU9A 2F0QA 4DFAA 3MHBA 1STNA 2WKDA 4DA2A 5KNBA 2K1BA 4RWSC 3JAME 3D8GA 5NUCA 4ZKCB 4ZQ3A 2B39A 4IFDJ 4X3KA 4DNTB 2I46A 4RGTA 1EQTA 2OT2A 3W3AA 1RJTA 1JOQA 2B2WC 4C3IG 2B63B 1EYAA 3MFGA 3DEOA 3MAQA 2K28A 4B08A 2E75C 1O7ZA 2Y0SB 2PW7A 4FYDA 2L4NA 4IFDG 1GJXA 3K7AB 2K33A 1B53A 1MSGA 5JAVA 3X3NA 3GTQB 1QB5D 3DWAA 1ENCA 3R8BA 4KY7A 1SNQA 4KV6A 4F8MA 4B9WA 5J39A 3BDCA 4R8NA 4PNYA 2JEAI 4C56C 4TKOB 4U68A 2MP1A 5IGBA 1D6EC 2F4IA 3M85A 3DHQA 1IKMA 3S1NB 4RGNA 1O7LA 2QDBA 1ICWA 2AUJD 5A2QL 5JOBA 3OOCA 1SXTA 3I8ZA 1J9OA 5G3LD 4C1NK 1HTLD 2LFNA 3C3LA 4Z9CB 1PFBA 4RHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCP D;  3DWP A;  3EA6 A;  1LO5 D;  3O13 A;  2G9H D;  3KLS X;  4RHR A;  2O2L D;  1LTB D;  2QEJ C;  3R2T A;  1L0Y B;  4RGO S;  1KLG D;  1PRT C;  1EU4 A;  1SE3 A;  5ELD A;  1LLR D;  1SE4 A;  1V1P B;  1SJE D;  1DYQ A;  2J4X A;  1V1O A;  2RDH A;  1BCP B;  2QIL A;  1BCP F;  1SEB D;  3R2I A;  4TSS A;  1I4Q A;  4UDU C;  1CHP D;  4RGT A;  3BVZ A;  2ICI A;  1FGB D;  1JWM D;  1EEF D;  1TS3 A;  2NTS A;  5FKA C;  2XRS D;  1TY2 A;  4BWG B;  1T5X D;  2TSS A;  1HXY D;  1FD7 D;  1B1Z A;  1PRT D;  1LT6 D;  1EU3 A;  3MFG A;  1S5B D;  1SE2 A;  1JCK B;  1FNU A;  4RCO A;  1TS2 A;  2XRQ D;  3V05 A;  3EFX D;  1AW7 A;  1HA5 A;  2IJ0 A;  2NTT A;  5I4D A;  2AQ1 B;  3DWQ A;  1SJH D;  1CT1 D;  1PZI D;  2WV6 D;  1ET9 A;  1HQR D;  4DXG A;  1TS4 A;  1I4H A;  1JR0 D;  3BYY B;  3BZD B;  3URY A;  1PTO B;  1PTO F;  3CHB D;  1CQV A;  2CHB D;  1PRT B;  1D5Z C;  1PZJ D;  1UUP A;  4OHJ A;  3MC0 B;  1ENF A;  5ELE A;  3DWA A;  1PZK D;  1D5M C;  4DXF A;  5ELC A;  2SEB D;  2R61 A;  3R8B A;  1EEI D;  4K6L A;  3W2D A;  1EFI D;  1RDP D;  1FNW A;  1CHQ D;  1KLU D;  3GP7 A;  1D5X C;  1LT4 D;  4O1N A;  1JQY D;  2AQ2 B;  1MD2 D;  1QIL A;  2Z8L A;  5TSS A;  1L0X B;  1XTC D;  1PYW D;  1LTI D;  1GOZ A;  1JWU D;  4C56 C;  3OWE B;  1STE A;  1F77 A;  4RGM A;  1CK1 A;  5ELF A;  1LTA D;  1LTR D;  5D3D A;  3BVG A;  1D6E C;  1PRT F;  1BXT A;  2AQ3 B;  2RDG A;  1FNV A;  1S5F D;  3BYT B;  1S5D D;  1AN8 A;  1RD9 D;  1RCV D;  4ZYS A;  1XXG A;  1LTG D;  1PTO C;  1LTT D;  1I4G A;  1DJR D;  1BCP C;  1LT3 D;  1S5E D;  1UNS A;  4RGN A;  1M4V A;  1TS5 A;  1B44 D;  5FK9 C;  1G8Z D;  2IPK D;  1TY0 A;  2XNA C;  5ELB A;  1EWC A;  1JWS D;  1S5C D;  1RF2 D;  1PTO H;  1SXT A;  4RFB A;  3SEB A;  1ET6 A;  1I4R A;  4L6T B;  4L63 B;  4RH6 A;  1I4X A;  5D3I B;  1LTS D;  1KTK A;  1ESF A;  1I4P A;  1LT5 D;  1HTL D;  1SBB B;  2XN9 C;  3TSS A;  3BVM A;  4Z9C B;  1PTO D;  1V1P A;  4RHS A; 
#chains in the Genus database with same CATH topology
 2MFI A;  5HY6 A;  2UUC Q;  4HN7 A;  2WAQ G;  1MI2 A;  4DAY A;  5COY A;  1TWH H;  2A8V A;  3I73 A;  4TVA B;  1TWG B;  4DUY L;  2EDG A;  1NUC A;  3S15 B;  3S14 B;  1DYQ A;  3R2I A;  1WCM B;  3CCS A;  2CQO A;  2HIV A;  4I7Z C;  4DN4 M;  1Y1V B;  5J1Z A;  4BWG B;  3CRK C;  1TWC B;  2EYL A;  3G4S A;  1W6K A;  1G2S A;  3M4O H;  4PQX A;  2O4X A;  4K5X A;  2K5W A;  3I56 A;  3K57 A;  1JR0 D;  1LAC A;  1VQA A;  3M4Q A;  4X66 Q;  3M4P A;  4IUT A;  1I6V C;  4LJZ C;  1Z6H A;  2K5Q A;  4K2K A;  4OIJ A;  4A93 B;  2ZXP A;  5EKK A;  2L0C A;  1ROD A;  5IGC A;  2D5D A;  2R61 A;  3AU7 A;  2B63 G;  1SAP A;  1K8A C;  1IBM L;  3STB D;  2HT1 A;  1KHI A;  4DV5 L;  4JV5 Q;  2K5H A;  1E0B A;  2Y0S E;  1H9R A;  3S1M H;  2JA7 B;  1ONL A;  2EYJ A;  4BA1 I;  4N9T A;  3GTK H;  5M5W B;  3OWE B;  2R7Z H;  3NTI A;  4PMW A;  5ELF A;  5IOC A;  1PRT F;  4KN4 C;  1H9K A;  4LFC L;  4OIK A;  2BA1 A;  1RD9 D;  3P7J A;  4JI7 L;  1PYS B;  3TEH B;  3CCU A;  2DNE A;  4OWT B;  2PYK A;  1RL2 A;  2I07 B;  2NN6 G;  5GAE C;  5FK9 C;  3J81 L;  3BDO A;  4LF9 L;  2KVM A;  3S2H H;  2VQF L;  5LMN L;  4JI2 Q;  4ZRZ A;  3OMG A;  3S16 H;  3GTM B;  5D3I B;  3TBI B;  4LF4 L;  2DJF C;  4KK7 A;  1HRJ A;  4OX9 Q;  4BBR H;  5CV5 A;  1B3Q A;  4GN3 B;  1N9W A;  1Y8O B;  1I5F A;  3HOU H;  2F1M A;  4OO1 G;  1K83 H;  2OTJ A;  4IUQ A;  3QG1 A;  2KOL A;  2WB1 E;  2YYZ A;  4YHH L;  4NXM Q;  1C4Q A;  1WFQ A;  4DV6 L;  1YHQ A;  5EBC A;  5EPK A;  2EY5 A;  2HQL A;  5I9O A;  3PUZ A;  2V4D A;  1SR3 A;  2O5J C;  4GKK L;  1DOL A;  3BVZ A;  2IT1 A;  1XNQ L;  3H3V I;  2B2T A;  1UE5 A;  1WTR A;  1TS3 A;  4CBV A;  1Z47 A;  3T1H L;  5CC4 A;  1HNW L;  2E74 C;  1W3S A;  3IL8 A;  4GLV B;  1HCZ A;  3A5Z B;  4XTC S;  5HUR A;  2KCN A;  1EU3 A;  3Q24 A;  4RCO A;  2QCP X;  3D4R A;  1XMO Q;  1EY4 A;  2Z6K C;  4MTN A;  4FXD A;  4HIM A;  2NVQ B;  3D6C A;  4NXN Q;  1D1K A;  3H6M A;  1PFN A;  1Y14 B;  4JBK A;  2ZTD A;  1K0S A;  4HJA A;  1SJH D;  1YEZ A;  1YIT A;  1F2Z A;  1HUN A;  1EZ8 A;  1V43 A;  2MUY A;  1U5K A;  2VZA A;  1Q3L A;  4POG A;  3HFZ B;  2K5V A;  1QWY A;  1IKL A;  1STY A;  2NVY H;  5FO9 B;  4OHJ A;  4BY7 G;  1D5M C;  1Y1V G;  4QF4 A;  4JI0 Q;  4K6L A;  3GQB A;  3IFD A;  1FNW A;  2JP1 A;  1A15 A;  4X3T A;  1HR0 Q;  2BOS A;  3PUW A;  1A62 A;  1LTI D;  5C6A A;  4YY3 Q;  3PIP 3;  5IP9 G;  4PMB A;  1NTG A;  3J7A F;  1JWU D;  3EVQ A;  1STG A;  1F77 A;  1BBX C;  4A93 G;  5D3D A;  4MNO A;  1GUW A;  2IHE A;  1EY6 A;  2JYO A;  5I2Y A;  2OEO A;  3KOJ A;  2PW5 A;  1S5F D;  4Q5V A;  1S5D D;  1XJV A;  5DNF A;  2KED A;  1PLF A;  1G51 A;  1X3Q A;  1EYC A;  5T1G A;  5M3M H;  1PYB A;  2CW0 C;  2VL6 A;  5K5P A;  3MXN A;  2N8N A;  1G6Z A;  4L8J A;  3GO5 A;  1SDF A;  3CKI B;  2JA7 G;  2EYP A;  1V8Q A;  1B9N A;  2JA5 B;  1HNX Q;  5LHY 1;  1EZ6 A;  4ZCK A;  4L6T B;  1GO3 E;  1Y8N B;  4XQN A;  2ID0 A;  3CD6 A;  5CV4 A;  2KCM A;  1VS0 A;  1CZW A;  2BE5 C;  2UU9 L;  4N8F A;  4JK1 C;  4FF2 A;  2F3W A;  2F0L A;  4HJ9 A;  4RHR A;  1Y1W B;  2R92 H;  1Z9F A;  2N3S A;  1KLG D;  4HMI A;  1PRT C;  5ELD A;  3K0X A;  5IYC G;  2JA6 G;  1UWV A;  1PMR A;  1PH7 A;  1EYD A;  2RDH A;  1FVI A;  2E2J B;  1DM0 B;  3CPW A;  3D31 A;  5ELN A;  5E4W C;  5KNC A;  2IWH A;  1DON A;  1T5X D;  3KF8 B;  1AZP A;  1O80 A;  2V1C C;  2Z1C A;  1DCZ A;  3HGB A;  4K5W A;  1NY4 A;  4L5R C;  4DK1 A;  3I4M B;  1S5B D;  3PQI A;  4ULL A;  3C1F A;  5IGE A;  2AQ1 B;  4QIW B;  3HOW G;  3FMC A;  1QZG A;  1ET9 A;  5IYD G;  4DR4 L;  1YJW A;  3BYY B;  2HD3 A;  1K28 A;  1PTO F;  4J15 A;  5M5Y B;  1LAB A;  1SNM A;  3HOY B;  1GUT A;  1A6X A;  1B3A A;  1Y69 U;  4DV0 Q;  4LF8 Q;  1ASZ A;  2PMZ B;  4K14 A;  5E3F A;  5BR8 Q;  1M1K C;  3HRZ C;  1BUV T;  1XYI A;  1EFI D;  2A69 D;  2HHH Q;  3E5S A;  2RSO A;  2QGQ A;  3X3M A;  1ESR A;  4A3C H;  3NBI A;  5C4Z A;  2F4V L;  2Z8L A;  2MGS A;  5M5X H;  4UP8 A;  1EY5 A;  4AQY Q;  4X3S A;  4JI1 Q;  1FGU A;  3SK4 A;  1VMP A;  1K3B C;  5JPM C;  1BXT A;  5IE8 A;  5L37 A;  4K2L A;  2H1E A;  4Y52 H;  1AN8 A;  1F9S A;  1FL0 A;  4V0B A;  1BR9 A;  3HS0 C;  2FMC A;  3MXG A;  1I4G A;  4BBS H;  5E4X A;  1BBU A;  1X3P A;  4FXG C;  3U4Z A;  2L1B A;  3VR2 A;  5K36 G;  1WD1 A;  2NVX B;  2TMP A;  2X6L A;  4IQZ A;  4N8X 1;  1ET6 A;  1VQJ A;  1PH2 A;  1E1O A;  3K7U C;  5C44 H;  1G6P A;  2F0T A;  3HOZ B;  5JEA G;  5IP7 G;  1SBB B;  3I72 A;  3KLW A;  1ML0 D;  1RTN A;  2A6E D;  4GKJ L;  3PSI A;  3KDF B;  2B2T C;  1ICF B;  5LMU Q;  1RTO A;  3JAM i;  2WAC A;  2UXD Q;  4IFD I;  3W1G A;  2C9O A;  1I3Q H;  4HJ8 A;  5C4J B;  3BZK A;  3GTL B;  1F2M A;  2M9V A;  4IJL A;  4WFN 3;  4P75 A;  2JA5 G;  3EN2 A;  1YJ9 A;  3CRL C;  5COR A;  3A55 A;  3M3Y B;  1IXR A;  3ULP A;  5IWA L;  3GTP H;  1CKN B;  1WD0 A;  2ENB A;  1X3E A;  3GD7 A;  2NTS A;  2A73 B;  5LMN W;  3HKZ B;  1KIX A;  1GHJ A;  4GLX A;  4B3T L;  5GAH C;  1Y1W G;  1IYJ B;  2A6H C;  2ZXO A;  1HA5 A;  2IJ0 A;  3WWV A;  2F0V A;  4PZ8 A;  3E3X A;  1PZI D;  2BCO A;  3NBH B;  4FVM A;  4DAY B;  3RZO B;  4JI6 L;  5ELE A;  4LK1 C;  5C0X J;  2KHJ A;  5JJL A;  5ELC A;  4CKE A;  2M00 A;  4DV1 L;  2PNH A;  2E2I B;  1EEI D;  4QQB X;  2ES2 A;  3L7Z C;  1RIP A;  1RDP D;  3I4M G;  2ICE C;  4DR2 Q;  4IUP A;  4QIW E;  5LL6 S;  5FJ8 G;  4PZ7 A;  1H9M A;  2VNU D;  4B3M L;  5IT9 L;  5IGG A;  1VMC A;  4KKT A;  2NWG A;  1STE A;  2RF4 A;  3L0O A;  4KHP Q;  4DV4 L;  2OWO A;  4ZLT F;  5C0X G;  2VXW A;  1VF7 A;  4C3H B;  3HOY G;  2Q2H A;  4ME3 A;  2ZT9 C;  1M8A A;  1EWI A;  2F0I A;  4JI4 L;  2I5H A;  2F0J A;  4XIG S;  3H3V H;  3T51 B;  4JI5 Q;  3DM1 A;  1PTO C;  2XIW A;  4A3J H;  3S1Q H;  1M4V A;  3RZD B;  4OEM B;  4FF1 A;  1TY0 A;  1ZEQ X;  3S1M B;  1EYG A;  2PQA B;  4X3U A;  2EE1 A;  2DNC A;  3I4N H;  1DOK A;  1GD7 A;  3VYU A;  1E1T A;  4RAU C;  4X62 L;  1Q7Y C;  1PDQ A;  1Q86 C;  1HUM A;  4NW2 A;  1KXL A;  3O13 A;  2KEE A;  1N36 Q;  1SLJ A;  1HNZ Q;  4FF3 A;  2WAQ B;  3KLS X;  4DV3 L;  2DJG C;  3P1H A;  1EOV A;  1LV9 A;  1VQB A;  3SHL A;  3CCM A;  2KUM A;  3KF8 A;  3AFP A;  1CA6 A;  1Q12 A;  2NYZ D;  4QJF A;  3HOZ G;  3L2P A;  3OIQ A;  1R9T H;  1EOT A;  5IYB H;  3JAM L;  1STB A;  1Q1E A;  4AH6 A;  4PMC A;  4CJ1 B;  4JI8 L;  1VQ6 A;  2A74 C;  3OYY A;  4LF6 L;  1HR0 W;  4EVO A;  1JWM D;  4WJW A;  1XX8 A;  1EIG A;  1TY2 A;  3KUP A;  4CGY B;  1IBK L;  1EQV A;  1G29 1;  1PH3 A;  2CQA A;  3VR3 A;  1K0R A;  2F0W A;  4YCU A;  5G3L F;  4IOA A;  1IBL Q;  1EY9 A;  1XMQ L;  2WV6 D;  3OW2 A;  4KTA A;  3S17 B;  1N33 L;  2MHV A;  3J80 i;  5JJK A;  1H95 A;  5CV6 A;  3GTO H;  3LGJ A;  1KDB A;  3ICE A;  3HOV H;  4BXX G;  4WJ4 A;  4K0K L;  4JCV E;  3CME A;  3HKZ G;  4JYA Q;  2F0O A;  4FF4 A;  1NJI C;  1CQF A;  3A7L A;  1BQQ T;  3ONA B;  4KJO A;  2Q8I B;  3RLO A;  4LUO A;  4MZ9 A;  1AZQ A;  1AFP A;  5KEE A;  5CV9 A;  4HTH A;  1PYW D;  3U9O A;  5M9O A;  3T53 B;  2R93 B;  1TWA H;  3K8A A;  1RHP A;  1DOM A;  1CK1 A;  1EIY B;  3NHH A;  3G7L A;  3QO2 A;  3J7A 5;  4A3F H;  4OWW B;  4A75 A;  1D1I A;  1F9Q A;  2XSC A;  3TQY A;  4EQN A;  2F0N A;  1NCV A;  5IGF A;  2MNA A;  3N6R A;  4LFB L;  3KDF A;  1NR2 A;  5ELB A;  5JJZ A;  2EZV A;  2Z4H A;  5JPN C;  3SEB A;  1L1O B;  1RF2 D;  1SYF A;  3SDZ A;  1YIJ A;  2VUM H;  3PUV A;  4IAL A;  2FFK B;  2H5X A;  4C3H G;  3F2U A;  3TP5 A;  4LMQ D;  1IL8 A;  3KBG A;  5HGQ A;  1B8A A;  2KJX A;  2KA7 A;  4S3S A;  3H91 A;  1U4L A;  4C3J B;  1C8C A;  2MQH A;  1SE4 A;  4PV1 C;  4HJ7 A;  1C0A A;  1KNE A;  4A3G B;  1U4M A;  2JN4 A;  2BDO A;  1SJE D;  4R4Q A;  5C4X H;  3S1R H;  2QF7 A;  1TU2 B;  4QUF A;  3CCQ A;  2IL8 A;  5I9P A;  2R7Z G;  2ICI A;  4IPD A;  4A3L H;  4CJ2 C;  5LL6 X;  1PXU A;  1VQK A;  4LAA A;  1EEF D;  4ZKB B;  1Q1B A;  1H9J A;  4K6D A;  3NBH A;  2WAQ E;  1B1Z A;  4MTK A;  2JA8 B;  3SGI A;  2KCC A;  1HA6 A;  3CCV A;  1STA A;  3ERO A;  4IOC A;  3EIV A;  5EPL A;  4CDF C;  3OTO Q;  2RDF A;  1VQO A;  1P16 A;  1TS4 A;  1I4H A;  2UXC L;  3BZD B;  1PTO B;  5H1S E;  3CHB D;  5EGT A;  4DKA C;  4OXP A;  3NK9 A;  1HPC A;  4X64 L;  4A3M H;  2PNR C;  4C3I H;  3AQQ A;  4BY7 B;  2HUG A;  2UUC L;  1NSN S;  3H0G H;  4CHT B;  1J5E Q;  5KIX A;  1YZ6 A;  1N32 Q;  1IZ6 A;  3CQZ H;  4A3K H;  1LT4 D;  5JJI A;  3DEP A;  2O5I C;  3J80 L;  1EFW A;  2ZM6 Q;  3K59 A;  4IFD H;  2AWO A;  1L0X B;  4HSP A;  1TQO A;  2C5C A;  1UE1 A;  5CYU A;  1HZA A;  4F88 A;  2PZT A;  2MPM A;  3RMH A;  4HID A;  2I5M X;  3CU7 A;  3G6J B;  2LMC B;  3BS1 A;  1LTA D;  1EQR A;  2MJ8 A;  4YIJ A;  4KD3 A;  1FNV A;  2PQA A;  3MVV A;  1PVO A;  1F9P A;  4R4O A;  3M7N A;  1WTO A;  1I50 H;  1D8L A;  1SFO B;  1VQD A;  4LFA Q;  3VR5 A;  2F0H A;  4ZAI A;  2F0S A;  3CPF A;  2F0P A;  1G2T A;  2BH2 A;  5JVG 3;  4A3D B;  2K50 A;  5M5X B;  2R93 G;  4PG3 A;  2N78 A;  4X66 L;  1FJG Q;  1E22 A;  2B2U A;  2B8F A;  2WKC A;  4DR5 Q;  3P20 A;  1VQE A;  4QY7 A;  5C3E H;  1JMC A;  1Y8P B;  3MXU A;  3TRE A;  4DR3 Q;  3EA6 A;  4I7A A;  3W5O A;  5FO8 B;  2R7F A;  3GV6 A;  4JV5 L;  4Y7N B;  2QEJ C;  4ME5 A;  4LNQ A;  3NUC A;  1SE3 A;  4JOI A;  4QUC A;  3FKI H;  3PO2 H;  1S3O A;  4K8J A;  2G9D A;  2JA6 B;  1OXT A;  4YCV A;  1II3 A;  4CKC A;  2WII B;  3PIO A;  3ND8 A;  1MJC A;  1QG7 A;  1SRO A;  3DM3 A;  4BY1 H;  1I4Q A;  2CFM A;  2IHF A;  2B29 A;  3TZD A;  2I5L X;  1N8R C;  4EQO A;  4DR7 Q;  3OSO A;  4UP9 A;  1QNU A;  3CC2 A;  2B3G A;  3ZYY X;  1WVL A;  3A74 A;  4C3J G;  3STB C;  2E76 C;  1SMY D;  1I3Q B;  1WTX A;  2GVB A;  1U9R A;  4H02 A;  5JVH 3;  1O78 A;  4B9X A;  4A3G G;  1VQC A;  3HOW B;  4JI2 L;  4C2M B;  3ND9 A;  2AMC B;  5DLQ E;  5M3F H;  2CHB D;  2PZW A;  4OX9 L;  4IUR A;  3QWN A;  1N34 Q;  1ILP A;  4R1J A;  3GTG B;  4G4K A;  4B3S Q;  2JA8 G;  1MSH A;  5CV7 A;  2F0D A;  1MBY A;  3QOJ A;  1HTP A;  1I6H B;  4NXM L;  5I6Y A;  1QZH A;  3KBX A;  2RBM A;  2F0U A;  1KL9 A;  3FVQ A;  4HSV A;  2RHQ B;  1E2W A;  3WOE A;  3HG9 A;  2B63 H;  3OIP A;  4XXE A;  1U4P A;  1PHJ A;  2IY5 B;  4GOP A;  2JJQ A;  5J22 A;  1L1O A;  4MN3 A;  3EQL C;  4UAI A;  4ZUJ A;  4GNX B;  1JJC B;  2D62 A;  1KDA A;  1RCV D;  4DV7 Q;  1JB3 A;  3LWU A;  1XMO L;  3E9H A;  1NE3 A;  4NXN L;  2D0P A;  4CDE C;  2K5N A;  4XYO A;  2E5L Q;  1CKM A;  3AB9 A;  3NTK A;  2H4O A;  3K7A H;  2RCN A;  4L63 B;  4RH6 A;  1UEB A;  2EYH A;  2L55 A;  3VYT A;  5CV8 A;  3GTQ H;  1A2T A;  4JI3 Q;  4LF5 Q;  3T13 A;  5EPJ A;  1JOO A;  5EKI A;  4JI0 L;  3CP0 A;  1WJJ A;  3DWP A;  4LUV A;  5AFW A;  5IT9 c;  3TP8 A;  3U9S A;  2X6G A;  2CCZ A;  2NB0 A;  1XPR A;  3UDF A;  1L0Y B;  1ZKO A;  4RGO S;  1WYD A;  3NWS A;  1PH4 A;  1HR0 L;  4A3C G;  3TME A;  1BKB A;  2D0O A;  4YY3 L;  4A3D G;  1GKH A;  4EX5 A;  1A3T A;  2PPB C;  1OO9 B;  3NWT A;  4TSS A;  5BN5 A;  3I90 A;  1VQL A;  2VY3 A;  4WJ3 M;  2KCT A;  1BNZ A;  1EIH A;  1GHK A;  1CZG A;  2ZJR A;  1FD7 D;  4B3R L;  1LT6 D;  1G91 A;  2K05 A;  1LM0 A;  4E6I A;  1EQQ A;  3HEJ A;  4CKB A;  2NVT B;  5C0X I;  3VR4 A;  4DR1 Q;  3F2C A;  1HNX L;  1B70 B;  2SDF A;  1GUS A;  3EBE A;  4Z9C B;  3KFU A;  1EL0 A;  4BS9 A;  3T56 B;  5C44 G;  1BOS A;  1VQN A;  4UP7 A;  1R9T B;  1UUP A;  5DM7 3;  4H44 C;  3UDG A;  3PCO B;  2AWN A;  2WFW A;  3RLN A;  3ITP A;  4GLA C;  1Q90 A;  1IHZ A;  2UXB Q;  3S15 H;  1SYE A;  3A8K E;  3NTH A;  3S14 H;  3G48 A;  5C5L A;  2YU9 B;  1NNX A;  5KRU A;  5GRO A;  2HCC A;  1WCM H;  1ZXT A;  1GUG A;  3T1Y Q;  4IUU A;  1JT8 A;  1JE5 A;  3FPU B;  3F2B A;  4QL5 A;  1JOR A;  3K80 C;  1Y1V H;  2B2U C;  1D7Q A;  4K5V A;  1TWC H;  2RDG A;  1F2L A;  2HCI A;  1HZC A;  2LY7 A;  1QJO A;  3NQI A;  5GQO A;  3F1Z A;  3S2D B;  5IP9 H;  3IRB A;  3HZX A;  4JOI C;  5EQ0 A;  3PO3 B;  3TN2 A;  1ENA A;  1GUO A;  4A93 H;  1HFN A;  4TRD A;  4YWM A;  2EXZ A;  1LTS D;  1YNN D;  1XNR Q;  3MEH A;  2KEN A;  4ID6 A;  2JSO A;  5JEA J;  4DV0 L;  4LF8 L;  1YHB A;  3PF4 A;  1A8V A;  4DK0 A;  5BR8 L;  3D0F A;  2HHH L;  2JA7 H;  3R2T A;  2KQ3 A;  3JC6 6;  1Q8K A;  2E2H H;  4DF7 A;  4OGQ C;  1D2B A;  2F0K A;  5M5W H;  1K8G A;  5DEH A;  4AQY L;  4JBJ A;  1OXX K;  3R3O A;  4JI1 L;  4M8A A;  1AE2 A;  1BCP F;  1SEB D;  1SND A;  2XWJ B;  4IUV A;  2JK8 A;  3I4L A;  4JPB W;  5ELO A;  5FLX L;  2TSS A;  3K58 A;  3K81 C;  5FO7 B;  4R4T A;  4DNR B;  4A3I B;  3GTJ B;  5IYC H;  5DAU A;  1X54 A;  2A69 C;  1VF5 C;  1UEA B;  3DWQ A;  2VQE Q;  5E1F A;  1J6Q A;  5IOD A;  4FDB A;  1CT1 D;  4I65 A;  5FLM H;  3GTM H;  1WTQ A;  3S1R B;  5J3B A;  1IYV A;  3MA2 B;  3KK7 A;  2R6G A;  5KYI A;  4LWC A;  1C48 A;  3J7Z C;  1OXU A;  4CDD C;  4GOP C;  5LMU L;  2CVR A;  1L1O C;  2OF1 A;  2VB3 X;  2MO0 A;  1X3G A;  2UXD L;  3PV0 A;  1TWH B;  3MXP A;  2NZ1 D;  2B2V C;  3B6Y A;  5IYD H;  4KMU C;  4GNX A;  1EUJ A;  2YTV A;  4GZY C;  3VA7 A;  4A4I A;  3U58 A;  1GXD C;  4HIK A;  4LF7 Q;  3I3C A;  2E8G A;  3M7G A;  2RA4 A;  1TVX A;  3UE1 A;  1CFM A;  3NPP A;  5CBE E;  2A6E C;  2K14 A;  3F8T A;  2NVQ H;  1OXV A;  1TT2 A;  1LTT D;  4EGV A;  1DJR D;  3T16 A;  3KJO A;  3DLL A;  1YNJ D;  3M4O B;  3CQZ B;  4DUZ L;  4JBW A;  3NEN A;  1O7Y A;  2LS0 1;  2HDM A;  3NXW A;  1X65 A;  3ERS X;  2UUA Q;  4JBM A;  1DZ1 A;  3FP9 A;  1KAW A;  5CMD A;  1KTK A;  1NR4 A;  2L5T A;  4UHV A;  1NMG A;  1ILQ A;  4H0L C;  4WOR A;  4A3E H;  3J80 c;  1PV4 A;  1W6J A;  2AKW B;  1O7I A;  1BCP D;  2PMZ E;  3HOV G;  2R7D A;  2MO1 A;  3Q23 A;  1KDC A;  2B2Y A;  4WRD A;  4L5Q A;  1WTV A;  4QMG A;  2K5D A;  5K36 H;  1KAB A;  1I50 B;  4DR2 L;  2A68 D;  2OCE A;  5AJ3 Q;  1XPU A;  1MKH A;  3PUY A;  3PO3 G;  3OMC A;  4KLK A;  4F7X A;  5IP7 H;  1C7Y A;  2QEX A;  4KHP L;  3GTK B;  2R7Z B;  3CMA A;  5IT9 E;  2K7V A;  1FGB D;  1VQ7 A;  1A63 A;  4FO2 A;  4R4I A;  1PFS A;  4O0A A;  1J8I A;  2YTY A;  1HXY D;  4DV3 Q;  4JI5 L;  1YVC A;  4RKL A;  3P75 A;  1UE7 A;  1PH1 A;  2PZU A;  2JA5 H;  1AW7 A;  2K04 A;  3G71 A;  2EY6 A;  5C3X A;  1EWH A;  3S2H B;  1PFM A;  1QNK A;  3ZJY C;  2K6A A;  2JXM B;  3DXJ C;  3S16 B;  2PQE A;  4RKB A;  1CTM A;  1PZJ D;  2EY1 A;  4OWX B;  3J81 c;  2EY2 A;  4FNF A;  4U67 3;  4BBR B;  2WIN B;  2SEB D;  2EPB A;  1Y1W H;  2KHI A;  4P73 A;  1N36 L;  1HNZ L;  3HOU B;  4A3I G;  2QW7 A;  3UDX A;  1D5X C;  1K83 B;  4DNI A;  2L11 A;  1JQY D;  4HJ5 A;  3RNU A;  1Q81 C;  2AQ2 B;  1PH6 A;  2IW3 A;  4EQP A;  1K73 C;  1KAA A;  1Q8I A;  2E2J H;  3LWE A;  2PI2 A;  2K32 A;  5BN3 A;  1EY7 A;  3VYS A;  2EYO A;  3ULJ A;  4RGM A;  5M3F B;  4FXK C;  2CWA A;  2FJ2 A;  1HQM C;  4A3L G;  1YHA A;  3HKZ E;  3I4M H;  1X6O A;  2NN6 I;  3FRP B;  4NKL A;  5EBD A;  3SXH A;  1X9N A;  1UNS A;  2SOB A;  5BN4 A;  2M2L A;  5FJ8 H;  3NQT A;  2LKV A;  2UUB Q;  1HH2 P;  2XNA C;  1EWC A;  3I2Z A;  1S5C D;  3OHX C;  5M5Y H;  1I4R A;  2CKZ B;  2DUD A;  5C0X H;  1I4X A;  3VR6 A;  3DUZ A;  3NEM A;  3HOY H;  1K3R A;  1LT5 D;  1I4P A;  1QVG A;  1JJ2 A;  4OO1 I;  3A0J A;  2IX3 A;  4ZUI A;  4DR6 L;  3QJY A;  4BA2 I;  2NVY B;  2AUK A;  4XQJ A;  1WTP A;  3CW2 C;  5EKL A;  1OXS C;  2N49 A;  4JYA L;  3H0G G;  4O2D A;  2O2L D;  3FDT A;  5HGT A;  2FIN B;  1I94 Q;  3OW7 A;  4X65 Q;  3D4D A;  1H9S B;  4GOP B;  1DXM A;  1QUQ B;  1V1O A;  4CJ0 B;  2NBF A;  3BZC A;  4UDU C;  4DV2 Q;  1A2U A;  2EJF C;  4DPG A;  2XRS D;  4O42 A;  2F0G A;  3FPP A;  3U50 C;  1FNU A;  2XRQ D;  1JB7 A;  5DM6 3;  3E6Z X;  5M3M B;  1E7Z A;  3SR1 A;  3Q8D A;  1E2V A;  3SK8 A;  3HOZ H;  1FR3 A;  1X55 A;  3H94 A;  4GNX C;  1U4R A;  2EYM A;  1RKN A;  3TP6 A;  5T1I A;  2F0E A;  3D6W A;  5D14 A;  4HIO A;  1ENF A;  2KBN A;  4LW1 A;  5C3E G;  4A3B H;  3W2D A;  3C1E A;  3MTS A;  3NP8 A;  5C4J H;  1KLU D;  4NMZ A;  3CXC A;  2YTX A;  2ZXR A;  3TP7 A;  3SE0 A;  2WB1 B;  3D4W A;  4DUY Q;  2R92 B;  1LTL A;  1QIL A;  5TSS A;  3M3Y H;  1BBW A;  4XYQ A;  4X6A H;  2CH4 W;  1STH A;  3H3V C;  5A2Q E;  2Q2I A;  1VQ9 A;  4BXX H;  4NPS A;  2GVA A;  1SNC A;  2X69 A;  2AQ3 B;  4BBR G;  4HR7 B;  1B2T A;  1XXG A;  2FMM A;  3HOU G;  2PCF B;  3PF5 A;  2B2Y C;  1TS5 A;  1G8Z D;  4FP5 D;  4RA8 A;  3OTO L;  3MFY A;  2DGY A;  1SRU A;  4RCN A;  4P74 A;  1SE8 A;  1SSO A;  4CDC C;  3RZO H;  5CGK A;  3A56 A;  3CCE A;  2DY7 A;  5M3F G;  3TZU A;  2RVL A;  2E2I H;  1SNP A;  1IBM Q;  1A3V A;  2G9H D;  1J5E L;  4DV5 Q;  3AEV A;  1N32 L;  3M9B A;  3SVM A;  1K8M A;  1JC7 A;  2ZM6 L;  3TS0 A;  1BDO A;  1F9R A;  2EJG C;  4P2C B;  1V1P B;  2K03 A;  3AFQ A;  3J80 E;  3S9W A;  3V2T A;  4C3H H;  1BCP B;  2QIL A;  3C2P A;  2ZJP A;  2EXD A;  1CKO A;  2LSS A;  5C3W A;  4G57 A;  4LFC Q;  2G5D A;  5C5M A;  2K75 A;  2KEC A;  2F3V A;  1QCB D;  4JI7 Q;  2QDL A;  3BG3 A;  1GUN A;  4R8I A;  3RZD H;  1E2Z A;  2EQS A;  1TS2 A;  4IPH A;  3UI2 A;  1MGS A;  4LFA L;  1PA6 A;  2Y0S G;  1XTD A;  4OL7 A;  5I4D A;  4BBS B;  2E2H B;  1MHW C;  2EOT A;  4LF9 Q;  2VQF Q;  3W1B A;  3HOX H;  5LMN Q;  1TR5 A;  1HQR D;  3KLR A;  2XGT A;  5D65 A;  1E24 A;  1FJG L;  5FOB B;  4LF4 Q;  3PIO 3;  5C44 B;  1BO0 A;  4K8I A;  4DR5 L;  3A7A B;  2ALY B;  4MHE A;  2VW9 A;  1PZK D;  2F0F A;  4KY5 A;  3LX0 A;  2N55 A;  3PMF A;  4DR3 L;  1PH9 A;  1HZB A;  3ERQ A;  1YJN A;  1B4O A;  2EVB A;  4O1N A;  2EYF A;  3K5O A;  5M3M G;  3MEF A;  4XT1 B;  4IO9 A;  4YHH Q;  3CCJ A;  5FLX c;  4IPG A;  1TWF H;  4DV6 Q;  1TKW B;  1CUK A;  2ZJQ A;  1NMF A;  3IFT A;  4DK3 C;  3J81 E;  2JEB I;  5E7N A;  4H7B A;  4IZ8 A;  4C1N I;  4GKK Q;  1XNQ Q;  3GTP B;  1IYU A;  4DR7 L;  1A0I A;  3BYT B;  3T1H Q;  1HNW Q;  2WP8 J;  1V1Q A;  1LTG D;  1QOH A;  4QGU A;  1T5E A;  4RG1 A;  2WB1 G;  5GAG C;  2R92 G;  2VS1 A;  3S17 H;  4DAV A;  4RFB A;  2RHS B;  3PGZ A;  2N88 A;  4DK6 C;  2RQX A;  3M4Y A;  3A8J E;  2XN9 C;  2R3Z A;  3RLF A;  1B7Y B;  3QIA A;  4V19 0;  3BVM A;  1N34 L;  2CWP A;  1H9S A;  2GN5 A;  1Z7T A;  1IW7 D;  5EJW A;  1QUQ A;  3GDE A;  1LO5 D;  2CW0 D;  3Q0A A;  3I7F A;  4B3S L;  3IAY A;  1VQ5 A;  1KD1 C;  4JW0 A;  2B2V A;  4J6H A;  5CR3 A;  2R93 H;  1CI3 M;  2Z0S A;  1SMY C;  5F2D A;  2D9U A;  1WCM G;  4ODG A;  2BE5 D;  3K5M A;  4QB4 A;  4A3E B;  2HQE A;  3S24 A;  4PZ6 A;  3U4V A;  1HJP A;  4XDX A;  2AHO B;  1PRT D;  2F3I A;  2EIF A;  4DV7 L;  1JCK B;  4AIM A;  2ASB A;  2NN6 H;  4UY8 C;  2ATW A;  1HFG A;  4A3J B;  3S1Q B;  3RR5 A;  5A35 A;  1YBY A;  2E5L L;  1HHV A;  1YNX A;  1SN8 A;  3PIP A;  2HIX A;  1FYC A;  1CA5 A;  1KNA A;  4DXG A;  2XWB B;  1CQV A;  4YWL A;  3KF6 A;  4HCE A;  3I4N B;  4JI3 L;  4LF5 L;  1AH9 A;  2J0T D;  3BJU A;  3CC7 A;  2UU9 Q;  2J7Z A;  4N9P A;  4OO1 H;  3K5N A;  2QKI C;  4B3R Q;  4XQQ A;  3S1N H;  1IW7 C;  2F0M A;  1ZYR D;  4GN5 A;  3T4A C;  4C3J H;  4GS3 A;  3GP7 A;  1SYG A;  4BBS G;  4A3G H;  1JOK A;  1JE4 A;  4IPC A;  1BF4 A;  1LYL A;  2NZO A;  4P71 A;  2IX1 A;  1SMX A;  3N52 A;  3BVG A;  3WOF A;  2E2D C;  4ILW A;  5I6W A;  3D3R A;  1XPO A;  5IIF A;  2Z4I A;  1EIF A;  3I91 A;  4ZYS A;  2JA8 H;  1TWG H;  1LT3 D;  4POF A;  3JAM c;  1R4P B;  1TII D;  2L9H A;  1CSQ A;  4DGZ A;  3E9I A;  1TXY A;  4DR1 L;  2Q2T A;  1B9M A;  2I0Q A;  1PTO H;  4R4C A;  5FLM G;  4DR4 Q;  2IX0 A;  4AYB B;  2A5H A;  4KHZ A;  3G6E A;  2OQK A;  3E0J A;  3H15 A;  1ESF A;  3TSS A;  4G7H C;  4BY7 H;  1UAP A;  3L3O C;  4HCS A;  3RD4 A;  2RSN A;  1WTH A;  1SNO A;  4TQU S;  4RMF A;  1V1P A;  2XTI A;  1P8L A;  2RCF A;  4JVZ A;  3RN5 A;  1GM5 A;  3KLS A;  3GTO B;  1VQP A;  3HOV B;  1VCI A;  1V9P A;  1VQF A;  3NSW A;  2UXB L;  1ZYR C;  5KND A;  4G7O C;  1AE3 A;  1LLR D;  2F4V Q;  5IGD A;  3FHW A;  4QCL A;  3OWF A;  1S4Z A;  3LNN A;  3T1Y L;  4L5T A;  4F87 A;  3AMU A;  2ZTE A;  1K8O A;  1TWA B;  1S40 A;  4KD4 A;  4LUZ A;  1WTW A;  2NUC A;  4XT3 B;  5FKA C;  3PUX A;  3SK6 A;  2Q2U A;  1SFO H;  1NBW A;  3AYH B;  3TDQ A;  2DY8 A;  4A3F B;  4MIU A;  1Q82 C;  2GA4 B;  4KY6 A;  4A3D H;  4KKU A;  3UE0 A;  3K0Y A;  2F52 A;  3MZ5 A;  1OTC A;  3J7A V;  4ALP A;  1SYC A;  4APV A;  4KKS A;  4Q0F A;  1XNR L;  1AP0 A;  2SNS A;  2B2W A;  4GKJ Q;  2VUM B;  3MC0 B;  4A3E G;  4DXF A;  3Q22 A;  5KYL A;  4YWK A;  4HED A;  2LXK A;  2KHS A;  4KHV A;  2A6H D;  4Y7N H;  1F2Y A;  4IN3 A;  1CHQ D;  1MJE A;  2QA4 A;  4EQ5 A;  1VQ4 A;  4A3J G;  2JA6 H;  1IL2 A;  4JG2 A;  3RN2 A;  4HMJ A;  4NDX A;  3V96 A;  5IWA Q;  1LTR D;  5C4X B;  3KYH C;  3I4N G;  1VDZ A;  1YNN C;  4OEL B;  1C9O A;  2JE6 I;  3OPO A;  2F03 A;  3BU2 A;  4B3T Q;  4A3B B;  4KN7 C;  1E3P A;  4NP5 A;  1JIC A;  5FLX E;  1S72 A;  2D2C C;  2K4K A;  3HOW H;  2BA0 A;  2VQE L;  4A76 A;  3FEW X;  4C2M H;  2B8G A;  3I4O A;  1XWE A;  1VQH A;  2FHT A;  4KI0 A;  1K9M C;  4OON A;  3J81 j;  4JI6 Q;  3GTG H;  5IYB G;  3BDL A;  1PTO D;  2K01 A;  1NAP A;  4A3M B;  4C3I B;  4DV1 Q;  5C4H A;  1X32 A;  3NE5 B;  1EY8 A;  2A1A A;  3CCR A;  1SYD A;  2Z6B A;  3MWY W;  3H0G B;  1I6H H;  1LTB D;  4DUZ Q;  3QR8 A;  3QB3 A;  1DD2 A;  3EJI A;  1R4Q B;  1EU4 A;  4A3K B;  1AEX A;  1PH5 A;  1QE6 A;  4AYB E;  4B3M Q;  2VB2 X;  2J4X A;  4AYB G;  3KJP A;  4LF7 L;  3VA5 A;  4DV4 Q;  2EJM A;  1LUZ A;  1CHP D;  2ZTC A;  3K5L A;  2A19 A;  4JI4 Q;  5EAY A;  4DAP A;  1W2B A;  2Q8T A;  1A3U A;  4IJH A;  3K6O A;  3I70 A;  1JJG A;  2PI2 E;  2PO4 A;  5KGU A;  3WDN A;  1SE2 A;  5IY0 A;  3HP3 A;  4H13 C;  2OTL A;  3V05 A;  3IKJ A;  3EFX D;  4GN4 B;  2NTT A;  1EY0 A;  2OXP A;  4P72 A;  1WOC A;  2UUA L;  1CM9 A;  3URY A;  3R93 A;  5JEA H;  4G7Z C;  3TRZ A;  4J1M A;  1B50 A;  1PRT B;  1D5Z C;  5ISR A;  4X62 Q;  3A8I E;  1MIU A;  2CH4 A;  1QVF A;  2DN8 A;  4J8Q A;  3RUZ A;  2RKS A;  5C3E B;  3QOL A;  3SK5 A;  2BH8 A;  3C46 A;  4DAM A;  3J7Y W;  2JA9 A;  5GAD C;  3I55 A;  4A3F G;  2JQO A;  3HKS A;  3A5U A;  5AJ3 L;  1PH8 A;  1MD2 D;  1SYB A;  4ABN A;  2BDN A;  3ULL A;  1XTC D;  4R9W A;  1YNJ C;  3DMU A;  3FKI B;  3PO2 B;  4ZK9 B;  1GOZ A;  3HOX B;  3GV3 A;  1KRS A;  4JI8 Q;  4JC0 A;  4LF6 Q;  2VUM G;  4BY1 B;  4IUN A;  1L2F A;  4NB3 A;  3A54 A;  3CF5 A;  2Q8R E;  5CBA E;  5I2X A;  2HDL A;  1T9H A;  1IBK Q;  3L9A X;  3VYR A;  1BCP C;  1S5E D;  2NZH A;  4KJN A;  4HAE A;  2L12 A;  4M1U B;  2NVT H;  2FXQ A;  2XVS A;  1B44 D;  2IPK D;  2SNM A;  1XMQ Q;  1JWS D;  2A68 C;  3NEL A;  3Q6S A;  3UDI A;  3H09 A;  1TWF B;  4DU9 A;  2F0Q A;  1N33 Q;  4DFA A;  3MHB A;  5C4X G;  1STN A;  2WKD A;  4DA2 A;  5KNB A;  2K1B A;  4RWS C;  4K0K Q;  3JAM E;  3D8G A;  4A3B G;  5NUC A;  1VQI A;  2YU9 H;  4ZKC B;  1IBL L;  4ZQ3 A;  1BVS A;  2C35 B;  2B39 A;  2YV5 A;  4IFD J;  4X3K A;  4DNT B;  1UE6 A;  2I46 A;  4RGT A;  1EQT A;  4DR6 Q;  2OT2 A;  1DGS A;  3W3A A;  1GVP A;  1RJT A;  1JOQ A;  2B2W C;  4UPA A;  4A3M G;  4C3I G;  2B63 B;  1EYA A;  1X3F A;  2P5Z X;  1KC8 C;  3MFG A;  3DEO A;  4L5S A;  3S2D H;  3MAQ A;  2K28 A;  4LFB Q;  2OQ0 A;  4B08 A;  2E75 C;  1O7Z A;  2Y0S B;  4A3K G;  2UUB L;  3PO3 H;  1KQS A;  2PW7 A;  4FYD A;  1WI5 A;  2L4N A;  4IFD G;  1GJX A;  3K7A B;  2K33 A;  1B53 A;  1MSG A;  1X56 A;  5JAV A;  2LXJ A;  3X3N A;  3GTQ B;  1QB5 D;  1ASY A;  3DWA A;  1ENC A;  3R8B A;  1VQ8 A;  4KY7 A;  2Z9H A;  2Z6K A;  1SNQ A;  3E0E A;  3CC4 A;  4KV6 A;  4F8M A;  1Q46 A;  3TS2 A;  4B9W A;  5J39 A;  1VQG A;  3BDC A;  2NVX H;  1I94 L;  4R8N A;  4PNY A;  4X65 L;  2JEA I;  1KRT A;  4C56 C;  4TKO B;  4U68 A;  2MP1 A;  3J81 i;  1L0W A;  5IGB A;  4DV2 L;  1D6E C;  1HZ9 A;  2F4I A;  3M85 A;  2K52 A;  3F2D A;  4A3I H;  3GTJ H;  3DHQ A;  3VDY A;  1CKN A;  1IKM A;  3S1N B;  4RGN A;  1YI2 A;  3GTL H;  1O7L A;  2QDB A;  4YCW A;  1CSP A;  3KF6 B;  1M90 C;  1ICW A;  2AUJ D;  5A2Q L;  5JOB A;  3OOC A;  3FKI G;  1SXT A;  3PO2 G;  3I8Z A;  2UXC Q;  3CCL A;  1J9O A;  2L15 A;  3HOX G;  5G3L D;  4C1N K;  1VQM A;  1HTL D;  4X64 Q;  2LFN A;  3MXN B;  4BY1 G;  3CAM A;  3C3L A;  3ER0 A;  1QVC A;  1U0L A;  1PFB A;  4RHS A; 
#chains in the Genus database with same CATH homology
 4HN7 A;  1MI2 A;  4DAY A;  5COY A;  3I73 A;  1TWG B;  2EDG A;  1NUC A;  3S15 B;  3S14 B;  1DYQ A;  3R2I A;  1WCM B;  4I7Z C;  4DN4 M;  1Y1V B;  5J1Z A;  4BWG B;  3CRK C;  1TWC B;  2EYL A;  1W6K A;  1G2S A;  4PQX A;  2O4X A;  4K5X A;  2K5W A;  3K57 A;  1JR0 D;  1LAC A;  4IUT A;  1I6V C;  4LJZ C;  1Z6H A;  2K5Q A;  4K2K A;  4OIJ A;  4A93 B;  2ZXP A;  5EKK A;  2L0C A;  1ROD A;  5IGC A;  2D5D A;  2R61 A;  3AU7 A;  1SAP A;  1E0B A;  1H9R A;  2JA7 B;  1ONL A;  2EYJ A;  4BA1 I;  4N9T A;  5M5W B;  3OWE B;  3NTI A;  4PMW A;  5ELF A;  5IOC A;  1PRT F;  4KN4 C;  1H9K A;  4OIK A;  2BA1 A;  1RD9 D;  3P7J A;  2DNE A;  2PYK A;  2I07 B;  2NN6 G;  5FK9 C;  3J81 L;  3BDO A;  2KVM A;  4ZRZ A;  3OMG A;  3GTM B;  5D3I B;  3TBI B;  4KK7 A;  1HRJ A;  5CV5 A;  1Y8O B;  2F1M A;  4OO1 G;  4IUQ A;  3QG1 A;  2KOL A;  2YYZ A;  1C4Q A;  5EBC A;  5EPK A;  2EY5 A;  5I9O A;  3PUZ A;  2V4D A;  2O5J C;  1DOL A;  3BVZ A;  2IT1 A;  2B2T A;  1WTR A;  1TS3 A;  4CBV A;  1Z47 A;  5CC4 A;  2E74 C;  3IL8 A;  1HCZ A;  4XTC S;  5HUR A;  2KCN A;  1EU3 A;  3Q24 A;  4RCO A;  2QCP X;  3D4R A;  2NVQ B;  1EY4 A;  4FXD A;  3D6C A;  1D1K A;  3H6M A;  1PFN A;  1SJH D;  1F2Z A;  1HUN A;  1EZ8 A;  1V43 A;  2MUY A;  1Q3L A;  5FO9 B;  1QWY A;  1IKL A;  1STY A;  4OHJ A;  1D5M C;  4QF4 A;  4K6L A;  3GQB A;  3IFD A;  1FNW A;  2JP1 A;  1A15 A;  4X3T A;  2BOS A;  3PUW A;  5C6A A;  1LTI D;  3PIP 3;  4PMB A;  3J7A F;  1JWU D;  3EVQ A;  1STG A;  1F77 A;  1BBX C;  5D3D A;  1GUW A;  1EY6 A;  2JYO A;  5I2Y A;  2OEO A;  2PW5 A;  1S5F D;  4Q5V A;  1S5D D;  5DNF A;  2KED A;  1PLF A;  1X3Q A;  1EYC A;  5T1G A;  2CW0 C;  5K5P A;  3MXN A;  1G6Z A;  4L8J A;  3GO5 A;  1SDF A;  3CKI B;  2EYP A;  1V8Q A;  1B9N A;  2JA5 B;  5LHY 1;  1EZ6 A;  4L6T B;  1Y8N B;  4XQN A;  2ID0 A;  5CV4 A;  1CZW A;  2BE5 C;  4JK1 C;  4FF2 A;  2F3W A;  2F0L A;  1Y1W B;  4RHR A;  1KLG D;  4HMI A;  1PRT C;  5ELD A;  1PMR A;  1EYD A;  2RDH A;  2E2J B;  1DM0 B;  3D31 A;  5E4W C;  5KNC A;  2IWH A;  1DON A;  1T5X D;  1AZP A;  1O80 A;  2Z1C A;  1DCZ A;  3HGB A;  4K5W A;  4DK1 A;  3I4M B;  1S5B D;  4ULL A;  3C1F A;  5IGE A;  2AQ1 B;  4QIW B;  3FMC A;  1ET9 A;  3BYY B;  1PTO F;  5M5Y B;  1LAB A;  1SNM A;  3HOY B;  1GUT A;  1A6X A;  1B3A A;  1Y69 U;  2PMZ B;  4K14 A;  5E3F A;  3HRZ C;  1BUV T;  1XYI A;  1EFI D;  2A69 D;  3E5S A;  2RSO A;  3X3M A;  1ESR A;  3NBI A;  5C4Z A;  2Z8L A;  2MGS A;  1EY5 A;  4X3S A;  3SK4 A;  1VMP A;  5JPM C;  1BXT A;  4K2L A;  2H1E A;  1AN8 A;  1F9S A;  4V0B A;  1BR9 A;  3HS0 C;  2FMC A;  3MXG A;  1I4G A;  5E4X A;  4FXG C;  1X3P A;  2L1B A;  3VR2 A;  5K36 G;  1WD1 A;  2NVX B;  2TMP A;  2X6L A;  4IQZ A;  1ET6 A;  2F0T A;  3HOZ B;  5JEA G;  1SBB B;  3I72 A;  1ML0 D;  1RTN A;  2A6E D;  2B2T C;  1RTO A;  2WAC A;  4IFD I;  2C9O A;  5C4J B;  3GTL B;  1F2M A;  2M9V A;  4WFN 3;  3CRL C;  5COR A;  3A55 A;  3M3Y B;  1WD0 A;  2ENB A;  3GD7 A;  2NTS A;  2A73 B;  3HKZ B;  1GHJ A;  2A6H C;  2ZXO A;  1HA5 A;  2IJ0 A;  2F0V A;  1PZI D;  2BCO A;  4FVM A;  3RZO B;  5ELE A;  4LK1 C;  5C0X J;  5ELC A;  4CKE A;  2M00 A;  2E2I B;  1EEI D;  3L7Z C;  1RDP D;  2ICE C;  4IUP A;  5LL6 S;  1H9M A;  2VNU D;  5IGG A;  5IT9 L;  1VMC A;  4KKT A;  2NWG A;  1STE A;  4ZLT F;  5C0X G;  2VXW A;  1VF7 A;  4C3H B;  2ZT9 C;  1M8A A;  2F0I A;  2F0J A;  4XIG S;  3T51 B;  3DM1 A;  1PTO C;  2XIW A;  1M4V A;  3RZD B;  4FF1 A;  1TY0 A;  1ZEQ X;  3S1M B;  4X3U A;  2EE1 A;  2DNC A;  1DOK A;  3VYU A;  4RAU C;  1PDQ A;  1HUM A;  4NW2 A;  3O13 A;  2KEE A;  4FF3 A;  2WAQ B;  3KLS X;  3P1H A;  1LV9 A;  3SHL A;  2KUM A;  3KF8 A;  1CA6 A;  1Q12 A;  2NYZ D;  3OIQ A;  1EOT A;  3JAM L;  1STB A;  1Q1E A;  4PMC A;  4CJ1 B;  2A74 C;  4EVO A;  1JWM D;  4WJW A;  1XX8 A;  1EIG A;  1TY2 A;  3KUP A;  4CGY B;  1EQV A;  1G29 1;  2CQA A;  3VR3 A;  2F0W A;  5G3L F;  1EY9 A;  2WV6 D;  4KTA A;  3S17 B;  2MHV A;  5CV6 A;  1KDB A;  2F0O A;  4FF4 A;  1CQF A;  3A7L A;  1BQQ T;  3ONA B;  4KJO A;  2Q8I B;  1AZQ A;  1AFP A;  5KEE A;  5CV9 A;  4HTH A;  1PYW D;  3U9O A;  5M9O A;  3T53 B;  2R93 B;  1RHP A;  1DOM A;  1CK1 A;  3NHH A;  3G7L A;  3QO2 A;  1D1I A;  1F9Q A;  2XSC A;  4EQN A;  2F0N A;  1NCV A;  5IGF A;  3N6R A;  1NR2 A;  5ELB A;  5JJZ A;  2EZV A;  2Z4H A;  5JPN C;  3SEB A;  1RF2 D;  1SYF A;  3SDZ A;  3PUV A;  4IAL A;  2FFK B;  4C3H G;  3F2U A;  3TP5 A;  4LMQ D;  1IL8 A;  3KBG A;  2KJX A;  2KA7 A;  4S3S A;  3H91 A;  1U4L A;  4C3J B;  1C8C A;  1SE4 A;  4PV1 C;  1KNE A;  4A3G B;  1U4M A;  2BDO A;  1SJE D;  2QF7 A;  1TU2 B;  4QUF A;  2IL8 A;  5I9P A;  2ICI A;  4CJ2 C;  5LL6 X;  1PXU A;  4LAA A;  1EEF D;  4ZKB B;  1Q1B A;  1H9J A;  4K6D A;  3NBH A;  1B1Z A;  2JA8 B;  2KCC A;  1HA6 A;  1STA A;  3ERO A;  5EPL A;  2RDF A;  1TS4 A;  1I4H A;  3BZD B;  1PTO B;  3CHB D;  5EGT A;  3NK9 A;  1HPC A;  2PNR C;  4BY7 B;  2HUG A;  1NSN S;  4CHT B;  5KIX A;  1LT4 D;  3DEP A;  2O5I C;  3J80 L;  3K59 A;  4IFD H;  2AWO A;  1L0X B;  4HSP A;  1TQO A;  2C5C A;  4F88 A;  5CYU A;  2PZT A;  2MPM A;  3RMH A;  3CU7 A;  3G6J B;  2LMC B;  3BS1 A;  1LTA D;  2MJ8 A;  4YIJ A;  4KD3 A;  1FNV A;  3MVV A;  1F9P A;  3M7N A;  1WTO A;  1SFO B;  3VR5 A;  2F0H A;  4ZAI A;  2F0S A;  2F0P A;  1G2T A;  5JVG 3;  4A3D B;  5M5X B;  2B2U A;  2B8F A;  2WKC A;  3P20 A;  1Y8P B;  3MXU A;  3EA6 A;  5FO8 B;  3GV6 A;  4Y7N B;  2QEJ C;  4ME5 A;  3NUC A;  1SE3 A;  4QUC A;  4K8J A;  2G9D A;  2JA6 B;  1OXT A;  1II3 A;  4CKC A;  2WII B;  3ND8 A;  1QG7 A;  1I4Q A;  3TZD A;  4EQO A;  3OSO A;  1QNU A;  3ZYY X;  1WVL A;  4C3J G;  2E76 C;  1SMY D;  1I3Q B;  1WTX A;  1U9R A;  5JVH 3;  1O78 A;  4B9X A;  3HOW B;  4C2M B;  3ND9 A;  2CHB D;  2PZW A;  4IUR A;  3QWN A;  1ILP A;  3GTG B;  4G4K A;  1MSH A;  5CV7 A;  2F0D A;  1MBY A;  3QOJ A;  1HTP A;  1I6H B;  5I6Y A;  3KBX A;  2RBM A;  2F0U A;  3FVQ A;  4HSV A;  1E2W A;  3WOE A;  3HG9 A;  3OIP A;  4XXE A;  1U4P A;  5J22 A;  4MN3 A;  3EQL C;  4UAI A;  4ZUJ A;  2D62 A;  1KDA A;  1RCV D;  1JB3 A;  3LWU A;  4XYO A;  3AB9 A;  3NTK A;  2H4O A;  4L63 B;  4RH6 A;  2EYH A;  2L55 A;  3VYT A;  5CV8 A;  1A2T A;  3T13 A;  5EPJ A;  1JOO A;  5EKI A;  3DWP A;  5AFW A;  3TP8 A;  3U9S A;  2X6G A;  2NB0 A;  1L0Y B;  1ZKO A;  4RGO S;  3NWS A;  3TME A;  1A3T A;  2PPB C;  1OO9 B;  3NWT A;  4TSS A;  5BN5 A;  3I90 A;  1BNZ A;  1EIH A;  1GHK A;  1CZG A;  1FD7 D;  1LT6 D;  1G91 A;  2K05 A;  4E6I A;  3HEJ A;  4CKB A;  2NVT B;  5C0X I;  3VR4 A;  2SDF A;  1GUS A;  1EL0 A;  4BS9 A;  3T56 B;  1BOS A;  1R9T B;  1UUP A;  5DM7 3;  4H44 C;  2AWN A;  3ITP A;  1Q90 A;  1IHZ A;  1SYE A;  3A8K E;  3NTH A;  5C5L A;  2YU9 B;  5KRU A;  2HCC A;  1ZXT A;  1GUG A;  4IUU A;  3FPU B;  1JOR A;  2B2U C;  4K5V A;  2RDG A;  1F2L A;  2HCI A;  2LY7 A;  1QJO A;  3NQI A;  3S2D B;  3HZX A;  5EQ0 A;  3PO3 B;  3TN2 A;  1ENA A;  1GUO A;  1HFN A;  4TRD A;  2EXZ A;  1LTS D;  1YNN D;  3MEH A;  4ID6 A;  2JSO A;  5JEA J;  4DK0 A;  3R2T A;  2KQ3 A;  4DF7 A;  4OGQ C;  1D2B A;  2F0K A;  5DEH A;  1OXX K;  3R3O A;  4M8A A;  1BCP F;  1SEB D;  1SND A;  2XWJ B;  4IUV A;  3I4L A;  5FLX L;  2TSS A;  3K58 A;  5FO7 B;  4DNR B;  4A3I B;  3GTJ B;  5DAU A;  2A69 C;  1VF5 C;  1UEA B;  3DWQ A;  5E1F A;  5IOD A;  4I65 A;  1CT1 D;  1WTQ A;  3S1R B;  1IYV A;  3MA2 B;  3KK7 A;  2R6G A;  5KYI A;  1C48 A;  1OXU A;  2CVR A;  2OF1 A;  2VB3 X;  3PV0 A;  1TWH B;  3MXP A;  2NZ1 D;  2B2V C;  4KMU C;  4GZY C;  3VA7 A;  1GXD C;  3I3C A;  3M7G A;  2RA4 A;  1TVX A;  1CFM A;  3NPP A;  5CBE E;  2A6E C;  1OXV A;  1TT2 A;  1LTT D;  4EGV A;  1DJR D;  3T16 A;  1YNJ D;  3M4O B;  3CQZ B;  4JBW A;  1O7Y A;  2LS0 1;  2HDM A;  3NXW A;  1DZ1 A;  5CMD A;  1KTK A;  1NR4 A;  2L5T A;  1ILQ A;  4H0L C;  4WOR A;  1W6J A;  1BCP D;  3Q23 A;  1KDC A;  2B2Y A;  4WRD A;  1WTV A;  4QMG A;  2K5D A;  5K36 H;  1KAB A;  1I50 B;  2A68 D;  3PUY A;  3OMC A;  4F7X A;  3GTK B;  2R7Z B;  5IT9 E;  2K7V A;  1FGB D;  4FO2 A;  1J8I A;  1HXY D;  4RKL A;  3P75 A;  2PZU A;  1AW7 A;  2K04 A;  2EY6 A;  5C3X A;  1EWH A;  3S2H B;  1PFM A;  1QNK A;  2K6A A;  2JXM B;  3DXJ C;  3S16 B;  2PQE A;  4RKB A;  1CTM A;  1PZJ D;  2EY1 A;  2EY2 A;  4FNF A;  4U67 3;  4BBR B;  2WIN B;  2SEB D;  2EPB A;  3HOU B;  1D5X C;  1K83 B;  2L11 A;  1JQY D;  2AQ2 B;  2IW3 A;  4EQP A;  1KAA A;  1Q8I A;  3LWE A;  2K32 A;  5BN3 A;  1EY7 A;  3VYS A;  2EYO A;  4RGM A;  5M3F B;  4FXK C;  2FJ2 A;  1HQM C;  2NN6 I;  3FRP B;  4NKL A;  5EBD A;  3SXH A;  1UNS A;  2SOB A;  5BN4 A;  2M2L A;  3NQT A;  2LKV A;  2XNA C;  1EWC A;  1S5C D;  3OHX C;  1I4R A;  5C0X H;  1I4X A;  3VR6 A;  3DUZ A;  1LT5 D;  1I4P A;  4OO1 I;  2IX3 A;  4ZUI A;  3QJY A;  4BA2 I;  2NVY B;  2AUK A;  4XQJ A;  1WTP A;  5EKL A;  1OXS C;  2O2L D;  3FDT A;  5HGT A;  2FIN B;  3OW7 A;  3D4D A;  1H9S B;  1DXM A;  1V1O A;  4CJ0 B;  2NBF A;  4UDU C;  1A2U A;  2EJF C;  2XRS D;  4O42 A;  2F0G A;  3FPP A;  1FNU A;  2XRQ D;  5DM6 3;  3E6Z X;  5M3M B;  3SR1 A;  1E2V A;  3SK8 A;  1FR3 A;  3H94 A;  1U4R A;  2EYM A;  1RKN A;  3TP6 A;  5T1I A;  2F0E A;  3D6W A;  5D14 A;  1ENF A;  3W2D A;  3C1E A;  3MTS A;  3NP8 A;  1KLU D;  4NMZ A;  2ZXR A;  3TP7 A;  3SE0 A;  2WB1 B;  3D4W A;  2R92 B;  1QIL A;  5TSS A;  4XYQ A;  1STH A;  3H3V C;  5A2Q E;  1SNC A;  2X69 A;  2AQ3 B;  4HR7 B;  1B2T A;  1XXG A;  2FMM A;  2PCF B;  2B2Y C;  1TS5 A;  1G8Z D;  4FP5 D;  4RA8 A;  3MFY A;  4RCN A;  1SSO A;  5CGK A;  3A56 A;  2DY7 A;  3TZU A;  2RVL A;  1SNP A;  1A3V A;  2G9H D;  3SVM A;  1K8M A;  1JC7 A;  1BDO A;  1F9R A;  2EJG C;  4P2C B;  1V1P B;  2K03 A;  3J80 E;  3S9W A;  3V2T A;  1BCP B;  2QIL A;  3C2P A;  5C3W A;  4G57 A;  5C5M A;  2KEC A;  2F3V A;  1QCB D;  3BG3 A;  1GUN A;  4R8I A;  1E2Z A;  1TS2 A;  3UI2 A;  1MGS A;  4OL7 A;  5I4D A;  4BBS B;  2E2H B;  2EOT A;  1TR5 A;  1HQR D;  3KLR A;  5D65 A;  5FOB B;  3PIO 3;  5C44 B;  1BO0 A;  4K8I A;  3A7A B;  4MHE A;  1PZK D;  2F0F A;  4KY5 A;  3LX0 A;  2N55 A;  3PMF A;  3ERQ A;  1B4O A;  2EVB A;  4O1N A;  2EYF A;  3K5O A;  4XT1 B;  1TKW B;  3IFT A;  3J81 E;  2JEB I;  4H7B A;  4IZ8 A;  4C1N I;  3GTP B;  1IYU A;  3BYT B;  2WP8 J;  1LTG D;  1QOH A;  1T5E A;  4DAV A;  4RFB A;  2N88 A;  2RQX A;  3M4Y A;  3A8J E;  2XN9 C;  2R3Z A;  3RLF A;  3QIA A;  4V19 0;  3BVM A;  1H9S A;  5EJW A;  1Z7T A;  1IW7 D;  1LO5 D;  2CW0 D;  3Q0A A;  3IAY A;  2B2V A;  4J6H A;  5CR3 A;  1CI3 M;  1SMY C;  5F2D A;  2D9U A;  4ODG A;  2BE5 D;  3K5M A;  4QB4 A;  4A3E B;  2HQE A;  4XDX A;  1PRT D;  1JCK B;  2NN6 H;  1HFG A;  4A3J B;  3S1Q B;  5A35 A;  1HHV A;  1FYC A;  1CA5 A;  1KNA A;  4DXG A;  2XWB B;  1CQV A;  3I4N B;  4HCE A;  2J0T D;  2J7Z A;  4N9P A;  4OO1 H;  3K5N A;  2QKI C;  4XQQ A;  1IW7 C;  2F0M A;  1ZYR D;  3T4A C;  3GP7 A;  1SYG A;  1JOK A;  1JE4 A;  1BF4 A;  2IX1 A;  3N52 A;  3BVG A;  3WOF A;  2E2D C;  4ILW A;  5I6W A;  3D3R A;  5IIF A;  2Z4I A;  3I91 A;  4ZYS A;  1LT3 D;  1R4P B;  1TII D;  2L9H A;  4DGZ A;  1B9M A;  1PTO H;  2IX0 A;  4AYB B;  2A5H A;  4KHZ A;  3E0J A;  1ESF A;  3TSS A;  4G7H C;  1UAP A;  3L3O C;  4HCS A;  3RD4 A;  2RSN A;  4TQU S;  1SNO A;  1V1P A;  3KLS A;  3GTO B;  3HOV B;  1VCI A;  3NSW A;  1ZYR C;  5KND A;  4G7O C;  1LLR D;  5IGD A;  4QCL A;  3OWF A;  1S4Z A;  3LNN A;  4F87 A;  3AMU A;  1K8O A;  1TWA B;  4KD4 A;  1WTW A;  2NUC A;  4XT3 B;  5FKA C;  3PUX A;  3SK6 A;  3TDQ A;  2DY8 A;  4A3F B;  4MIU A;  2GA4 B;  4KY6 A;  4KKU A;  3K0Y A;  3MZ5 A;  3J7A V;  1SYC A;  4Q0F A;  4KKS A;  1AP0 A;  2SNS A;  2B2W A;  2VUM B;  3MC0 B;  4DXF A;  3Q22 A;  5KYL A;  4HED A;  2KHS A;  4KHV A;  2A6H D;  1F2Y A;  4IN3 A;  1CHQ D;  4HMJ A;  4NDX A;  3V96 A;  1LTR D;  5C4X B;  1VDZ A;  1YNN C;  3OPO A;  2JE6 I;  2F03 A;  4A3B B;  4KN7 C;  4NP5 A;  1JIC A;  5FLX E;  2D2C C;  2BA0 A;  3FEW X;  2B8G A;  1XWE A;  2FHT A;  4KI0 A;  3BDL A;  1PTO D;  2K01 A;  1NAP A;  4A3M B;  4C3I B;  5C4H A;  1X32 A;  3NE5 B;  1EY8 A;  1SYD A;  3MWY W;  3H0G B;  1LTB D;  3QB3 A;  1DD2 A;  3EJI A;  1R4Q B;  1EU4 A;  4A3K B;  1AEX A;  1QE6 A;  2VB2 X;  2J4X A;  3VA5 A;  2EJM A;  1CHP D;  3K5L A;  4DAP A;  2Q8T A;  1A3U A;  3K6O A;  3I70 A;  2PO4 A;  5KGU A;  3WDN A;  1SE2 A;  3HP3 A;  4H13 C;  3V05 A;  3IKJ A;  3EFX D;  2NTT A;  1EY0 A;  2OXP A;  1CM9 A;  3URY A;  3R93 A;  5JEA H;  4G7Z C;  4J1M A;  1B50 A;  1PRT B;  1D5Z C;  5ISR A;  3A8I E;  2DN8 A;  4J8Q A;  3RUZ A;  2RKS A;  5C3E B;  3QOL A;  3SK5 A;  3C46 A;  3J7Y W;  1MD2 D;  1SYB A;  4ABN A;  2BDN A;  1XTC D;  4R9W A;  1YNJ C;  3DMU A;  3FKI B;  3PO2 B;  4ZK9 B;  1GOZ A;  3HOX B;  3GV3 A;  4BY1 B;  4IUN A;  3A54 A;  2Q8R E;  5CBA E;  5I2X A;  2HDL A;  3L9A X;  3VYR A;  1BCP C;  1S5E D;  4KJN A;  4HAE A;  2L12 A;  4M1U B;  2XVS A;  1B44 D;  2IPK D;  2SNM A;  1JWS D;  2A68 C;  3Q6S A;  3H09 A;  1TWF B;  4DU9 A;  2F0Q A;  4DFA A;  3MHB A;  1STN A;  2WKD A;  4DA2 A;  5KNB A;  2K1B A;  4RWS C;  3JAM E;  3D8G A;  5NUC A;  4ZKC B;  4ZQ3 A;  2B39 A;  4IFD J;  4X3K A;  4DNT B;  2I46 A;  4RGT A;  1EQT A;  2OT2 A;  3W3A A;  1RJT A;  1JOQ A;  2B2W C;  4C3I G;  2B63 B;  1EYA A;  3MFG A;  3DEO A;  3MAQ A;  2K28 A;  4B08 A;  2E75 C;  1O7Z A;  2Y0S B;  2PW7 A;  4FYD A;  2L4N A;  4IFD G;  1GJX A;  3K7A B;  2K33 A;  1B53 A;  1MSG A;  5JAV A;  3X3N A;  3GTQ B;  1QB5 D;  3DWA A;  1ENC A;  3R8B A;  4KY7 A;  1SNQ A;  4KV6 A;  4F8M A;  4B9W A;  5J39 A;  3BDC A;  4R8N A;  4PNY A;  2JEA I;  4C56 C;  4TKO B;  4U68 A;  2MP1 A;  5IGB A;  1D6E C;  2F4I A;  3M85 A;  3DHQ A;  1IKM A;  3S1N B;  4RGN A;  1O7L A;  2QDB A;  1ICW A;  2AUJ D;  5A2Q L;  5JOB A;  3OOC A;  1SXT A;  3I8Z A;  1J9O A;  5G3L D;  4C1N K;  1HTL D;  2LFN A;  3C3L A;  4Z9C B;  1PFB A;  4RHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...