1LTGD

The arg7lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the a subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Arg7Lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the A subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
molecule keywords HEAT-LABILE ENTEROTOXIN
total genus 20
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1995-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ltgD00
2SEBD 1BCPF 1RCVD 1PTOC 1SEBD 1CHPD 1PTOB 5FKAC 1SJED 1EEFD 1JWSD 1S5FD 1G8ZD 1XTCD 5ELDA 1LO5D 3KLSX 2CHBD 4RGOS 1LTTD 1LT5D 4ZYSA 3BVGA 4OHJA 1CK1A 1S5ED 1F77A 1AN8A 1S5DD 1MD2D 1PTOH 5ELBA 1KLUD 1T5XD 2O2LD 1TS4A 3MFGA 1LLRD 1HXYD 1UNSA 1SXTA 1RD9D 1ET6A 1FGBD 4O1NA 1STEA 4K6LA 1L0XB 2NTSA 1XXGA 1PYWD 2XN9C 3EFXD 1EWCA 1JQYD 1SE4A 4RHSA 5D3IB 2QEJC 1JWUD 4DXGA 1PRTB 1SBBB 3W2DA 3O13A 1BXTA 1JCKB 3URYA 1CQVA 3BVMA 1V1PA 2AQ3B 2NTTA 1PZID 3R8BA 1JWMD 1PTOF 1B44D 1TS3A 1KLGD 1V1PB 3MC0B 1SJHD 2WV6D 4RHRA 1EU4A 3EA6A 3TSSA 4RGTA 1EU3A 1ENFA 1ESFA 1LTID 1LTSD 1PZKD 1BCPD 1DYQA 1HQRD 1I4PA 2R61A 5FK9C 1UUPA 3R2TA 3DWQA 3V05A 1SE3A 4RH6A 5ELCA 4BWGB 3CHBD 1LTAD 1S5CD 1LT6D 1V1OA 4Z9CB 2Z8LA 1D6EC 1LTRD 1GOZA 4C56C 2AQ2B 1M4VA 3R2IA 1B1ZA 1D5MC 2IJ0A 1BCPB 3SEBA 2TSSA 1KTKA 3BZDB 2XNAC 1PRTC 1DJRD 1D5XC 5ELFA 1FNWA 1FNUA 1I4GA 1LT4D 1LTBD 1FNVA 4DXFA 4UDUC 4RCOA 5ELEA 1S5BD 1RF2D 1TS5A 2IPKD 2AQ1B 1AW7A 1LTGD 4L6TB 2RDGA 4RFBA 1EFID 1I4HA 4RGMA 4TSSA 2QILA 5TSSA 1BCPC 1I4QA 1QILA 1SE2A 1PRTD 4RGNA 1PTOD 1PZJD 1CHQD 1RDPD 1LT3D 1PRTF 2XRSD 1CT1D 1L0YB 3BYYB 3DWAA 2RDHA 3OWEB 2G9HD 1I4XA 1TS2A 1FD7D 1TY2A 3BYTB 3DWPA 4L63B 1EEID 1TY0A 1D5ZC 2J4XA 1ET9A 1I4RA 3GP7A 5D3DA 5I4DA 2ICIA 1HA5A 1HTLD 1JR0D 3BVZA 2XRQD
chains in the Genus database with same CATH superfamily
3J7YW 2R7DA 3FPPA 2PMZE 1PTOC 1SFOB 1CHPD 2KOLA 2K5HA 1KL9A 1TWFH 5FKAC 3CXCA 1KXLA 4GNXB 2K03A 4ZYSA 3C1EA 1X3PA 5LMNW 5JJKA 1YVCA 4KKSA 3FDTA 1KLUD 1M8AA 3K58A 3I4NB 4HEDA 1EOTA 2IT1A 1MHWC 1UE1A 1GHKA 1ET6A 1FGBD 3PSIA 1A3VA 1G291 4OEMB 2NTSA 5C3XA 3J81L 5C3WA 1ASYA 2K01A 2UU9Q 3TBIB 5M5XH 1R9TB 1RHPA 5EKLA 3P1HA 2YU9H 4OX9Q 4LFBQ 1J6QA 2BE5D 2EXZA 3LWEA 3S17H 4KTAA 1L1OA 1XMOL 1KQSA 1F2MA 1QB5D 3R93A 4C1NI 3SGIA 3P20A 2F3IA 5LL6S 4CJ0B 4NXML 4DUZQ 3DWQA 1M90C 3H0GG 4BWGB 3L9AX 1XPUA 4DR4L 1SNOA 2YTXA 3NTIA 5IYCH 4NXMQ 5FO9B 4A3GH 1B8AA 2Z8LA 4R8IA 2CCZA 2ID0A 3OW7A 5BN4A 1EZ8A 3SDZA 3D4WA 2Y0SE 3GQBA 3VYUA 4LF5L 4BBRG 1IBML 4KD3A 2QGQA 1EQTA 3AMUA 3KOJA 1FNWA 2PI2E 1OXXK 4KKTA 1QWYA 2F0OA 3G4SA 1HUMA 4POGA 1EWIA 1XX8A 2IWHA 1VQ4A 3RZOB 5IT9c 3ERQA 3ND8A 3M4OB 2KENA 3IRBA 3K80C 1PHJA 5TSSA 1I50B 5I6WA 1I6VC 2F3WA 4JI1L 1CM9A 2F4IA 3I8ZA 1X3FA 3OWEB 3HKZE 3KLWA 2QW7A 5L37A 1Q1BA 3I2ZA 4DR2Q 2KBNA 1A6XA 3M7NA 4K5XA 2I5HA 1K83B 1SDFA 5IT9L 3EA6A 4H0LC 4O42A 3X3NA 4GLVB 1AE3A 4BBSG 1PMRA 2D9UA 2B2VC 1SEBD 2AMCB 2B2TA 1DM0B 4JG2A 4DV4Q 4JV5L 3NTKA 5IOCA 2KCTA 2Z6KA 3PIPA 1HTPA 1X56A 1I6HH 1WYDA 3P7JA 1SNCA 3FKIH 1OXSC 3PMFA 4HJAA 5FLMG 4DV4L 4POFA 4JV5Q 5IYBH 4QMGA 2EZVA 1IW7C 3A8JE 1WD0A 1SXTA 3S9WA 3GTOB 4J6HA 1TQOA 1T9HA 4K5VA 4YHHQ 1H95A 3WWVA 2AWOA 1QNKA 1U5KA 3KLSA 1RODA 2VNUD 2K28A 3A56A 2NVQH 2KCNA 3G48A 3GTQB 2GA4B 4X66L 2E2HH 2MO1A 4DV3L 2EDGA 3O13A 3HGBA 1JORA 3ITPA 3MXUA 3J80c 4JI6L 2A1AA 3CCQA 2NN6I 2DJGC 1PH7A 1KAWA 3Q24A 1NCVA 4MTNA 4NP5A 1ENFA 3FVQA 5IGFA 1PH9A 1TU2B 1VQAA 3U50C 1LTSD 1DYQA 5FK9C 3AB9A 4CJ2C 1HZ9A 2XVSA 3RN5A 3VYTA 3HOVH 3PUVA 1N8RC 1UWVA 1HZAA 2F03A 1V1OA 4Z9CB 1STHA 1R4PB 1G6PA 3CMAA 2NUCA 3IAYA 1YBYA 1BBUA 2AQ2B 2PQEA 4UP8A 2BOSA 4A3MB 3BZDB 3S1NH 1VQOA 3H94A 4JW0A 5C4XH 1I4GA 4OO1H 1YNJD 3ERSX 3S2HB 1FNVA 2ZXRA 4DA2A 2HHHQ 4JCVE 1CA5A 1JJGA 2A6EC 5ISRA 4A3FH 3KDFA 3EQLC 4RGMA 2F0IA 1ENAA 1V8QA 1VF7A 3I4LA 1ONLA 3TQYA 4DV2L 1I4QA 3RD4A 2WB1G 1VQLA 1QZGA 4IURA 1CHQD 5GAHC 4A3DG 4A3BB 5FLXL 1L0YB 1HRJA 1TIID 3NWSA 1I94Q 3HOVG 1HR0Q 3CCEA 1EEID 2ZJRA 2OTJA 1W6KA 2K1BA 1HTLD 4APVA 3I4OA 1HNWL 1VDZA 4KN4C 4WFN3 2I0QA 1II3A 2A74C 2A6HC 2B63B 3HOYB 1LO5D 5C4ZA 4DR6L 3NHHA 4DNRB 1FJGQ 1WTWA 2HDMA 2KA7A 4CDCC 3T13A 5C0XI 1Y1WB 2AUKA 2WB1E 5LMUL 4X3TA 5JJZA 4IZ8A 1FJGL 2ATWA 5J3BA 3S2DB 4IPHA 5EBCA 2CKZB 1TWCB 1EYAA 1K3BC 4HN7A 3S1QH 1AZQA 2OWOA 2E75C 3HOWH 3AFQA 4YCUA 1S40A 3W2DA 5M5XB 3H3VI 2X69A 5HGTA 4AYBE 5K5PA 4IUNA 3U9SA 2JA8H 5HY6A 1JWMD 3CC4A 5LMNL 1LTLA 3A5ZB 4DR5Q 2NVTB 5DAUA 2LFNA 3QIAA 4KLKA 4X64Q 3BS1A 1EU4A 4CDDC 3C46A 4DNIA 5ELNA 1FL0A 1JT8A 2VUMG 2Q8TA 4KD4A 1UE6A 4DAYB 1HNZL 2DY8A 5C44G 5IGCA 2F0SA 4C1NK 3OOCA 4JK1C 2JXMB 2RVLA 1LTRD 2K52A 3M3YH 5IIFA 2XGTA 1JE5A 2F0FA 3R2IA 3PIO3 3M4YA 1GD7A 5FLXc 1J5EQ 4EQ5A 3J80L 3PO3B 5E1FA 1HNXQ 1MJCA 2I07B 3J7AF 1QOHA 5IGEA 2V1CC 1DONA 2FINB 3WOFA 5CV5A 1A3TA 1BBXC 4CDEC 3DXJC 1EFID 2LMCB 4JBWA 2QILA 1B4OA 1HNXL 1A8VA 1BCPC 4A3GG 2K5NA 5IYCG 1XMQL 4LUOA 4DN4M 5JPNC 1KD1C 3KBGA 4LUZA 4FF3A 2R7ZG 5BR8L 2B2YA 4GKKQ 4AQYL 1F9SA 3QB3A 3TP7A 2VB2X 3PUZA 2VY3A 2B2TC 1Y1VB 2AHOB 4YWMA 1G51A 3TP6A 4HCSA 2F0TA 5C3EH 1RTOA 1ZYRD 4G7OC 3X3MA 1G2TA 5I6YA 3K7AB 3QJYA 2B39A 1R4QB 5A35A 1WTHA 5IGGA 1L1OC 1X55A 4A3JG 5IT9E 3PO3H 4DR4Q 1DOLA 1MSGA 2AKWB 4K6LA 4JYAQ 4S3SA 2JA5G 3KFUA 4CHTB 4OO1G 1TWAH 2VW9A 1X3EA 5IYDG 4HAEA 1IYVA 1JQYD 4RHSA 1E2WA 4FXGC 2I5MX 4YCVA 4QJFA 1V1PA 1V1QA 2JYOA 3R8BA 5KNDA 1ESRA 1HUNA 2NVXB 4QB4A 3N6RA 3T53B 4RGTA 1QVCA 3SE0A 2DY7A 1NAPA 4ME5A 1TVXA 2WFWA 5JEAH 2FHTA 2R3ZA 2R92G 3CHBD 4LFCL 5FJ8G 3PCOB 2F0JA 1GM5A 1HPCA 4DU9A 2CW0C 3CCSA 1HFNA 4UP9A 4X66Q 2GVBA 5C4JH 2MPMA 2XNAC 1NMFA 1Q1EA 4Q0FA 1HH2P 1E7ZA 1SYFA 1TWHB 1SYDA 4DNTB 4JBMA 1PH3A 1PH6A 2IPKD 1SYEA 1UEBA 1Z6HA 1AE2A 4DK3C 2NZOA 5IYBG 1YJWA 2BH2A 1I4HA 3NXWA 4KHVA 4FDBA 4DV6L 3ULJA 4KK7A 2A68C 1RL2A 3BYYB 3WDNA 1TY2A 2CWAA 3ZYYX 2R93G 4R8NA 2UUBL 3BVZA 2J7ZA 3S14H 1EOVA 1XPOA 3BJUA 4JPBW 3S1RB 4A3LH 3L7ZC 5C5MA 1TT2A 3CRLC 3MZ5A 4FF1A 1G8ZD 5COYA 4AYBB 4YY3L 1VQMA 4HJ5A 3CCMA 5M3MH 2TMPA 1C7YA 3STBC 3HOVB 3KK7A 3NQTA 1K83H 3HKZB 1KDCA 4HMIA 2B2YC 3NBHA 1OO9B 1IBLQ 1HA6A 2IX3A 3T51B 3VR4A 2UUCQ 1O80A 2LSSA 1A2UA 1VQIA 2Y0SG 4A3LG 3MHBA 2ZTEA 1HQMC 1C0AA 1B44D 3NP8A 3SK8A 4QGUA 2VQEL 3D3RA 3C3LA 4A3JB 1EU3A 1K8GA 1PVOA 4C3IG 1XYIA 4JBJA 4XQQA 4JI6Q 4DR1Q 1AFPA 4GS3A 3VA7A 1VCIA 5CBAE 3IFTA 3V05A 2L5TA 4ID6A 4IJHA 3DMUA 1U4MA 4IALA 1LT6D 2JA8B 2KHJA 3HRZC 2E5LQ 4A3CH 4L5QA 1CSQA 1AEXA 5CV6A 2BDOA 2QEXA 1MBYA 2CQOA 4XYQA 1LM0A 2MO0A 4RKLA 4X3SA 2K7VA 1AZPA 4IUQA 3TMEA 3J81c 3KLRA 2RF4A 2XWBB 1STBA 2HIXA 4DR5L 4CGYB 1VMCA 5ELEA 3J7ZC 3GTLB 2AQ1B 1XNQQ 1EQQA 5FJ8H 3KF6B 3EJIA 1EQVA 3NQIA 1JJCB 1G2SA 4BY1G 1PYSB 3A74A 4JI4L 4FF2A 3DEPA 2OF1A 4OWWB 4RKBA 1IHZA 2UUCL 1NY4A 3HP3A 1HA5A 4WJ3M 1NMGA 1Q81C 4BY1H 4B3TL 1K0RA 5I2YA 2EY6A 2HIVA 4ILWA 3CW2C 1YHBA 1SMXA 1CUKA 3CCVA 1LTTD 1VQ8A 4U68A 1GXDC 3HOZH 1YHAA 1VQJA 3GTQH 2JE6I 1S5DD 1SFOH 4B9XA 4ALPA 1IXRA 4NDXA 2CVRA 2O2LD 1A3UA 1NTGA 3JAML 1DXMA 4HSVA 1PYBA 1FYCA 1LABA 4EVOA 3PQIA 3I56A 4DV0Q 1VS0A 2EQSA 4A3CG 1Y8NB 1MI2A 1PYWD 3G71A 1SRUA 1PH5A 4YWLA 1CZGA 3QWNA 3UI2A 2Z6KC 5IP9H 4LFAL 3CU7A 1MGSA 1SNDA 2ALYB 2PO4A 4CBVA 1CKMA 4B3ML 1XNRL 4E6IA 3PV0A 1W6JA 3T1HQ 1BF4A 3CCJA 4BBRB 3MC0B 1R9TH 2IY5B 2ZJQA 4RCNA 2K05A 3Q0AA 4GOPA 2VQFL 3TSSA 1VQ6A 2WP8J 3HKSA 5FO8B 1WTRA 5IP7H 1GUGA 1I4PA 2BA0A 4PMBA 1UUPA 4QQBX 2HQLA 5FOBB 5ELCA 3HOUG 1CTMA 2ENBA 2JA6G 4GN5A 4DAMA 5JPMC 2PNHA 3E0EA 1K73C 1KABA 1B70B 3H3VC 3HS0C 2HT1A 4CKEA 3MXPA 1CQFA 2EYJA 5GQOA 2PI2A 4LF8Q 1TWFB 3SXHA 4HJ9A 3IFDA 4OELB 5EBDA 4OGQC 3A8KE 4C2MH 1D7QA 4IN3A 4JC0A 4N9PA 3RLNA 3UDIA 2A6ED 3IL8A 3RLOA 1NSNS 1XMOQ 2K5DA 2N55A 4RFBA 3KF8B 3Q8DA 4N8X1 1LYLA 4LF9L 4BY7B 5C44H 4OL7A 3RNUA 1IZ6A 4PMWA 1I4XA 4ZRZA 1DOMA 4L5SA 3E6ZX 4YIJA 1JB7A 1CA6A 2R93H 2D62A 4ZAIA 4DK1A 5EJWA 1CKOA 2NBFA 2NVTH 3S1MB 4C3HG 1ASZA 1XMQQ 2EY1A 3GTGH 4TQUS 3CCUA 1VQDA 1B7YB 1Z47A 1EL0A 4WORA 2RKSA 2YV5A 3BDLA 4DK0A 1PH8A 3HOWB 2F0PA 1ILPA 1HFGA 1CK1A 4Y7NH 1O7ZA 1PTOH 1TWAB 4HJ7A 1SNPA 4K0KQ 1E24A 1JOOA 5M9OA 3D6WA 3HFZB 3GTPB 1TKWB 2EOTA 4XQNA 2EYFA 3VYSA 2C5CA 1BR9A 4GZYC 5G3LD 2YTVA 4G4KA 1Y1VH 5EKKA 3GO5A 1H9KA 1PZID 2UXCQ 4H7BA 4FNFA 1KLGD 3K5LA 3S2DH 4A93H 1PH1A 5BN3A 3I4MH 4RA8A 1QUQB 1S4ZA 1PZKD 2IW3A 2B2UA 4FXKC 5LMUQ 3I4MG 4A93B 1Y69U 2O5IC 4R4IA 1GUTA 1WTPA 1RJTA 1H9SB 2OEOA 2QKIC 2RBMA 2OXPA 4JI0L 1PH2A 5IYDH 2UUBQ 2SDFA 1Y1VG 1YIJA 3NUCA 4DV1L 4AQYQ 3OIPA 5C4XG 3ER0A 4Q5VA 3S1QB 4JI0Q 1DJRD 1D5XC 1LT4D 2E2JH 1VQCA 1VQNA 1IL8A 3BG3A 3KF8A 2DNCA 2E8GA 4M1UB 4TSSA 5AFWA 3L3OC 4DKAC 2Q2IA 4L5TA 1PRTD 3I7FA 3DM3A 2EVBA 5JJIA 1AH9A 4KY7A 4DF7A 3TZDA 3RUZA 1Q90A 4JI5Q 1Z7TA 3K7UC 2E2IH 4JI1Q 4JI8Q 2ICIA 2RCNA 2LXKA 3GTPH 5M5YB 3D4DA 5KEEA 3K0YA 1WTVA 1PDQA 5KRUA 1BKBA 3V2TA 1IL2A 1HR0L 5CV4A 2E2DC 4K8JA 4G7HC 5BN5A 3J81E 2D0OA 4GNXA 3VR3A 1RKNA 4DAPA 4YCWA 4J1MA 3TS2A 4C3IB 1KC8C 3STBD 3GTKB 4GOPC 3CC7A 4LFCQ 3EROA 5EPKA 1EY5A 4CKBA 2ZTCA 3SHLA 2ZT9C 1CI3M 4B3RQ 4J15A 2FJ2A 2XIWA 3T1HL 4PZ7A 3PO2H 3TP5A 2OQ0A 1WCMB 3H91A 5DLQE 2QA4A 3M3YB 3TZUA 3Q6SA 1O78A 1UAPA 3KUPA 2B8FA 4BBSH 1F9QA 1KDBA 1U4LA 5M5YH 4QL5A 1TWGB 5T1IA 1L2FA 3HOUH 1QG7A 2ZXPA 1Q7YC 1QUQA 3GTOH 4OIJA 4DR6Q 1JOQA 1ML0D 3H09A 2A19A 3TP8A 5ELOA 3I70A 4DV2Q 1EY6A 1HQRD 5E3FA 1YNXA 3FKIB 3R2TA 1SE3A 1I5FA 2MHVA 2WKDA 4CDFC 1YHQA 1S72A 2O4XA 1GUSA 4AYBG 2UUAL 1HJPA 4LJZC 1VQ5A 5JJLA 1D6EC 1NR4A 1KAAA 2PPBC 1HNZQ 5I9OA 3VYRA 3JAMi 1B1ZA 1CKNB 1W3SA 1NNXA 2TSSA 4JOIA 4LFBL 5I2XA 3CRKC 1AP0A 4OWXB 2K4KA 4ZK9B 1IYUA 4YY3Q 2B2WC 1YNJC 1WFQA 1LV9A 5EPLA 4JBKA 4F8MA 4A4IA 4C3JB 1SAPA 1CFMA 1HR0W 1E2VA 1DCZA 2RDGA 2F1MA 2EJMA 2QDLA 3H0GH 3OMCA 4X62L 4L5RC 3HOZG 2K5QA 1PRTF 1EY9A 1XNQL 4NPSA 2FFKB 3AEVA 3OTOL 4P71A 2B8GA 1P16A 1TY0A 1EIFA 1I4RA 1O7YA 1SROA 5AJ3Q 1Q86C 5JEAG 2A73B 4A3DH 4HTHA 2EYOA 4X65Q 2JA5B 1PXUA 3PUWA 3U58A 1KRSA 4OWTB 5ELDA 2YYZA 2HCCA 1F2ZA 2G9DA 1STAA 2PW5A 4EQPA 2UUAQ 1BVSA 1ZYRC 4TKOB 3S24A 1U4PA 3VR2A 3S17B 4A3JH 4IPDA 2XN9C 3A0JA 1QJOA 1A63A 5FLXE 2EYMA 2MUYA 2QEJC 1PRTB 1Q46A 3UDXA 1ICFB 5M3FB 1PLFA 4A3EH 3D31A 2AQ3B 4KJNA 1GVPA 2ZM6L 1BOSA 1WCMH 2R6GA 1SJHD 4EGVA 5C6AA 3S14B 1STGA 2YTYA 4BA2I 2E2JB 1GJXA 1D8LA 5IGBA 3K59A 2ES2A 1WVLA 2K5VA 1LTID 2B2UC 2VS1A 5GAEC 2R7ZH 2LXJA 1BCPD 2EYHA 1K8MA 2C9OA 2LS01 2E74C 2MGSA 3PUYA 3CF5A 3E3XA 2L15A 2R7FA 4IOAA 5JVH3 1STNA 2F3VA 4LMQD 4QF4A 2D5DA 2F0WA 3RR5A 1MSHA 3FRPB 2A68D 4ZCKA 1D1IA 3TREA 1A15A 3AFPA 3RZOH 3I55A 4GLAC 4XIGS 1B53A 4X3KA 4K14A 4A75A 4JI7Q 4NMZA 2F4VL 2EY2A 2WAQE 3HOXH 1SYCA 2UXCL 2R92B 2PNRC 3K57A 1EIYB 1EIHA 1SMYC 4BXXG 3FKIG 2B3GA 2K75A 3F8TA 4RG1A 3MXNA 4UDUC 4ODGA 2Q2UA 1B3QA 2IHFA 2VZAA 2VUMB 2FMMA 4H44C 2KEDA 5DM73 5M3MB 1SE2A 4F87A 2RCFA 2NB0A 2HCIA 1SR3A 3GTJH 1BDOA 1VMPA 1RIPA 3L2PA 3F2BA 1DD2A 4I7AA 3C2PA 3S15B 1X54A 4EQNA 1FGUA 3A7AB 4V190 2H5XA 3GV3A 2IX0A 3JAME 1QVGA 3VA5A 2SNSA 2CWPA 4Y7NB 5EQ0A 3TN2A 1JWSD 3BDCA 4MN3A 1BBWA 3PIP3 2JA8G 2EIFA 2NN6H 2HHHL 2C35B 4GNXC 1KHIA 1F77A 3KYHC 3HOXG 4AH6A 4IFDJ 3HOWG 1QCBD 3K6OA 3TS0A 2XTIA 2L12A 1EUJA 2Q8RE 4O1NA 4DAVA 1DZ1A 2GVAA 3MVVA 4O0AA 1STEA 1IBKQ 1I94L 3RZDH 1WD1A 2Z1CA 1GHJA 1KDAA 5C4JB 2LKVA 2DNEA 4IUPA 2KHIA 1X3GA 4NKLA 1B9NA 4JI8L 2K14A 4BY7H 5J22A 1WTXA 4NW2A 4U673 1U4RA 3NK9A 4A3DB 2BA1A 3ICEA 3WOEA 1X9NA 3NBIA 2XSCA 4RHRA 3MA2B 2R92H 3RZDB 1W2BA 4WJ4A 4A3IB 2BDNA 4R9WA 1YEZA 4DV6Q 2R61A 3T4AC 1JB3A 2Z4HA 4A3EG 3H0GB 2F0VA 2A8VA 2F0GA 1S5CD 2MP1A 1K9MC 2B63G 4XDXA 3HOYG 2WIIB 2UXDL 3JAMc 4XTCS 1GOZA 2RA4A 2Z4IA 4DR7L 2IJ0A 4HCEA 4QUCA 3SEBA 1N36Q 3CAMA 4OXPA 2EE1A 1STYA 4XT3B 4BA1I 1H9JA 1PFMA 3I4MB 4DXFA 4DR7Q 3FHWA 5E7NA 1X3QA 1S5BD 2R93B 1E3PA 1VQBA 1WTQA 4JVZA 3M85A 1L0WA 4K0KL 4BS9A 1BQQT 2L9HA 1PZJD 4A3KH 4YHHL 5T1GA 2K5WA 3OMGA 2B63H 3HOYH 2F0UA 4MIUA 1CT1D 4MTKA 1TS2A 1FD7D 2VXWA 1V9PA 5LHY1 5D3DA 3J80E 1K8AC 1EFWA 2PMZB 1JR0D 4NXNQ 4Y52H 2IHEA 2XRQD 4N9TA 4K5WA 4DR3Q 4GOPB 2BCOA 2CH4A 2DGYA 1Y8PB 4L8JA 1XTCD 2VQEQ 2CHBD 4LF4Q 5CORA 2KECA 2WKCA 1HNWQ 3MEFA 2K50A 5C4HA 4GKJQ 1BNZA 3EIVA 1T5XD 2CW0D 3QO2A 4LF9Q 3S1MH 1MIUA 3W1GA 2L0CA 1EYCA 4PQXA 2PCFB 1PV4A 2EYLA 2I46A 3NWTA 1F2LA 3EFXD 2N8NA 5LMNQ 1SE4A 3GTJB 4DXGA 3E5SA 4FVMA 3TDQA 1VQGA 1C9OA 1NUCA 4QCLA 4KY6A 4KN7C 1GUWA 2SOBA 4A3EB 5KYIA 4ABNA 4K2LA 4B3TQ 4A3BG 1JMCA 1TS3A 4RAUC 1V1PB 4BY1B 1DGSA 2A6HD 2WB1B 2L4NA 1HZCA 1EY0A 3U9OA 3UDGA 1EIGA 4CJ1B 1J8IA 3G6EA 1ESFA 5KNBA 1C48A 2PZWA 3L0OA 1H9RA 1EY4A 2BH8A 1IKLA 1I3QB 4RH6A 1HZBA 1I50H 2VQFQ 3P75A 3F1ZA 5GAGC 4LK1C 2A69D 1N34Q 3PO2G 3H3VH 4NXNL 4DPGA 1I3QH 2HUGA 2Q2TA 1UEAB 2DN8A 3NE5B 1D5MC 1TR5A 1OXVA 1D2BA 3T1YQ 1FNUA 4HJ8A 3H15A 2Q2HA 5K36G 5IY0A 4F7XA 3D4RA 1K8OA 2WINB 1PFBA 3A5UA 3K5NA 3CCLA 3GTMB 3BU2A 4KI0A 4BBRH 1K28A 1VQ9A 2JSOA 2PZUA 3VDYA 3CPFA 1N9WA 3PO2B 2RHQB 1CSPA 2EJFC 4V0BA 4OIKA 4UHVA 3KJOA 2Y0SB 1F9RA 3DWPA 1TWCH 1V43A 5KNCA 1QNUA 5KIXA 1KIXA 4DV1Q 4B3MQ 4LF8L 1XNRQ 4P74A 1BCPF 1RCVD 5J1ZA 4DV5Q 1ZKOA 2N49A 2UXBQ 1PA6A 3CMEA 1F9PA 2KQ3A 4ZLTF 5IP9G 1Q82C 1Q8IA 3KJPA 3LNNA 5KGUA 4A3KG 3I4NG 3K81C 4X65L 1AN8A 1PFSA 4XXEA 1VQHA 5JAVA 2UXBL 4K8IA 3H6MA 1H9SA 3NEMA 1LLRD 4A3FG 3CC2A 3W5OA 2MNAA 1QVFA 4KV6A 3PUXA 1E1OA 4HIOA 4FO2A 4MZ9A 1E0BA 4BBSB 4QIWB 2D2CC 1TWGH 2M9VA 1I6HB 3I90A 3URYA 1CQVA 5D14A 2F4VQ 5DM63 2AUJD 2QDBA 4LF7Q 1E22A 2PW7A 2NVYH 2G5DA 2JA9A 2EPBA 3DHQA 4C3HB 5DEHA 1EY8A 1YZ6A 3PF4A 4KHPL 1XTDA 2L11A 3EN2A 2CQAA 1EYDA 2QCPX 4ME3A 1KNEA 4PV1C 3OTOQ 1Y1WG 2N78A 1EYGA 3OHXC 3NPPA 1A0IA 4QUFA 5M3FH 2E76C 3RN2A 5GADC 4BY7G 1X32A 4OONA 1IYJB 2K6AA 3MAQA 1YNND 3HKZG 2JA7H 1EQRA 2SNMA 2E2IB 2FXQA 3OYYA 5CV7A 4JI2Q 1TS5A 2N88A 2Z0SA 4L6TB 3I91A 4A76A 2RSNA 1RTNA 3W3AA 5C3EB 1SMYD 1OTCA 1WJJA 3VR6A 2ICEC 2F0MA 1PTOD 1YNNC 1LT3D 2NVQB 2EY5A 2G9HD 4IOCA 3M4QA 4L63B 4ZUIA 3GP7A 1D5ZC 2NZ1D 2PQAA 2ZTDA 1YITA 4XQJA 4A3IG 3E9IA 4P73A 1B2TA 4GKJL 3DLLA 4HIDA 3EVQA 4ZQ3A 1B9MA 3FEWX 3KLSX 1LT5D 4B3SQ 3CQZB 5A2QE 3M9BA 3OIQA 2OCEA 2EXDA 1X65A 3OW2A 2K32A 5CV9A 4B3RL 5ELBA 1E1TA 4LW1A 3PGZA 4J8QA 2EYPA 3GTMH 1UNSA 4PG3A 3GDEA 4X62Q 4BXXH 1CKNA 5M3MG 2UXDQ 3K7AH 3MTSA 5FO7B 1SNQA 3CQZH 3UE1A 3G6JB 2PZTA 4ULLA 4LNQA 1SBBB 1KRTA 1BXTA 2F0QA 2IL8A 5D65A 1O7IA 2GN5A 1VQPA 3SK6A 4R1JA 1B50A 5IP7G 1YJNA 3LX0A 2WAQG 3NSWA 2JA7B 2M2LA 2MFIA 3VR5A 1CZWA 4R4OA 3BZKA 3J81i 4HR7B 3DUZA 4A3KB 3G7LA 4DV7L 5JVG3 1WCMG 2ZJPA 1N36L 4PZ6A 2RQXA 2QF7A 3IKJA 3CPWA 1K3RA 1SYGA 3M4PA 2J0TD 1M4VA 2JA7G 4I65A 4K2KA 5IWAQ 1ENCA 4IUUA 3JC66 3OWFA 1BCPB 1VF5C 1KTKA 3N52A 2EJGC 3F2CA 5C0XH 4KMUC 1VQKA 2NVYB 5M3FG 4RCOA 3ZJYC 4PNYA 5IGDA 3GD7A 4X3UA 1Z9FA 1Y1WH 1VQ7A 2HQEA 2F0LA 2JP1A 5CR3A 3ULPA 1N32Q 3QOJA 4RWSC 1N33Q 3DWAA 1MKHA 1WOCA 3QOLA 1NJIC 3QR8A 3HOXB 1XWEA 3HEJA 1GO3E 2KHSA 4LF6L 1D1KA 1SYBA 2A69C 2JQOA 1L1OB 4WRDA 5CMDA 4C2MB 1HCZA 1LACA 1PTOB 1EEFD 1H9MA 5DNFA 4RGOS 2KVMA 5CBEE 1PFNA 4R4CA 4OO1I 4DR3L 1DOKA 3K8AA 2JA5H 4UAIA 3OPOA 1IW7D 3J81j 3PO3G 1JE4A 3NBHB 2HDLA 3FPUB 1RD9D 2UU9L 1VQFA 5C4XB 1IKMA 1OXTA 3A8IE 1ICWA 2E5LL 4A3MH 5C3EG 1A62A 1EWCA 3AQQA 1B3AA 2Z9HA 3J7A5 5IWAL 4C3JG 1KNAA 5AJ3L 2NYZD 1BO0A 4M8AA 1EY7A 5H1SE 1JCKB 4X64L 5C44B 5C5LA 3BVMA 3T1YL 4GKKL 2D0PA 1J5EL 4KJOA 4AIMA 4DFAA 1X6OA 2WV6D 4KKUA 5HURA 4YWKA 4LFAQ 2VL6A 4GN4B 5EKIA 4B9WA 2K33A 4C3HH 4RMFA 2MJ8A 5HGQA 4IFDH 3SR1A 4LF5Q 1TXYA 3B6YA 4UY8C 2NWGA 4FP5D 3HOZB 4TVAB 3I3CA 3HZXA 1F2YA 1GUOA 4C56C 1QE6A 1XPRA 1M1KC 1O7LA 5K36H 4KHZA 2ZXOA 4FXDA 2VB3X 4DV5L 2P5ZX 3FP9A 3K0XA 1XJVA 1PRTC 1UE7A 5ELFA 1G91A 1S3OA 1P8LA 4UPAA 2L1BA 1RF2D 1T5EA 3CP0A 3KF6A 2M00A 1NBWA 1AW7A 3SVMA 3BZCA 1QZHA 3GV6A 4LWCA 4HIMA 4ZKBB 4DR2L 1OXUA 4RGNA 3GTLH 4N8FA 5E4WC 3K5OA 2JJQA 3DM1A 4A3FB 3W1BA 4IUTA 4G7ZC 5KYLA 3C1FA 3AYHB 5EGTA 2YU9B 3MWYW 2A5HA 4PZ8A 4HIKA 5JEAJ 2H1EA 1YJ9A 4G57A 3K5MA 3F2UA 3S16B 4OHJA 1S5ED 4JYAL 1MD2D 1IBKL 4C3JH 2FMCA 1ZXTA 4TRDA 5IODA 3D0FA 4IUVA 4A3MG 4GN3B 3NELA 1Q12A 1A2TA 3R3OA 4K6DA 5JOBA 3ONAB 1JC7A 3RLFA 4IJLA 3MXGA 1SLJA 2PYKA 4DUYL 3AU7A 1C4QA 2NZHA 2IX1A 2I5LX 1PTOF 3KDFB 4KHPQ 2F0DA 1J9OA 5EAYA 2E2HB 4JI2L 1TWHH 2DJFC 4OX9L 4B3SL 3GTKH 2CH4W 3S2HH 3TRZA 3T56B 2R7ZB 2ZM6Q 2LY7A 1EWHA 3S1NB 1LUZA 2JEAI 3MFYA 4IQZA 4IPCA 4XYOA 4A93G 4HSPA 1SE8A 1LTAD 4A3GB 3ULLA 1UE5A 1WTOA 3S16H 1IBLL 3PF5A 3S1RH 4FYDA 4I7ZC 1Q3LA 3ND9A 3PIOA 5CYUA 5M5WB 5BR8Q 4JI3L 5C0XJ 5GROA 4JOIC 1JICA 1Y14B 3Q23A 3UE0A 4PMCA 3FMCA 4R4TA 3J80i 5J39A 2OQKA 1SSOA 3CKIB 5C0XG 3I4NH 4JI7L 2F0NA 3KBXA 4CKCA 1N33L 1IBMQ 1E2ZA 2JK8A 2KCCA 3M4OH 1WI5A 1U0LA 2F0HA 1QILA 2DUDA 2Q8IB 3A55A 4LF6Q 4IFDI 1RDPD 2AWNA 2X6LA 3D6CA 1JJ2A 2RDFA 3DEOA 3I73A 4P72A 3EBEA 1N34L 3BYTB 3E0JA 2X6GA 5I4DA 2J4XA 3NTHA 1JOKA 4DUYQ 1MJEA 4MHEA 3J7AV 1SN8A 2SEBD 4C3IH 4KY5A 5EPJA 1SJED 4H02A 1S5FD 2XWJB 2K04A 4DK6C 4IO9A 4DAYA 2H4OA 4DGZA 3BVGA 1GUNA 4EX5A 5CV8A 1G6ZA 4MNOA 4DV0L 4UP7A 3MFGA 5E4XA 1TS4A 1HXYD 3LWUA 1FVIA 1YI2A 4LF4L 4O2DA 3V96A 4DV7Q 4IPGA 2B29A 1N32L 2F52A 3I72A 5CC4A 2WAQB 2NVXH 2B2VA 3SK4A 5FLMH 3S15H 1L0XB 1HHVA 2OT2A 3T16A 2KEEA 1XXGA 2NN6G 3MEHA 2JEBI 1ZEQX 5D3IB 4JI3Q 3A7LA 1JWUD 2Z6BA 4WJWA 1Q8KA 5A2QL 2F0EA 3LGJA 2MQHA 1NR2A 2NTTA 2PQAB 2VUMH 4H13C 4ZUJA 3NENA 2N3SA 4ZKCB 1SNMA 2JA6H 4DV3Q 2V4DA 1ILQA 1K0SA 2HD3A 2ASBA 4IFDG 4A3IH 4FF4A 3CD6A 3M7GA 4LAAA 3U4ZA 3D8GA 5LL6X 1C8CA 4A3BH 2RHSB 4P75A 2JA6B 3RMHA 4GLXA 4QY7A 3HOUB 5NUCA 4DR1L 4XT1B 1NE3A 3E9HA 2RSOA 2JN4A 4JI5L 3CCRA 5CGKA 2F0KA 4P2CB 2KCMA 5IE8A 2O5JC 1BUVT 5F2DA 3BDOA 3GTGB 1U9RA 1Y8OB 2L55A 5I9PA 1LTBD 5M5WH 3U4VA 3Q22A 4LUVA 4B08A 2KUMA 4LF7L 2B2WA 3TEHB 1VQEA 3HG9A 5G3LF 1PH4A 4QIWE 2OTLA 4JI4Q 3MXNB 1LTGD 3UDFA 4HMJA 4R4QA 4F88A 3A54A 4DUZL 1EZ6A 2BE5C 2KJXA 2XRSD 2CFMA 3SK5A 2RDHA 4NB3A 4EQOA 2WACA 3OSOA 3QG1A 1ET9A 1GKHA 1FR3A 3F2DA 4X6AH
chains in the Genus database with same CATH topology
3J7YW 3FPPA 1PTOC 1SFOB 1CHPD 2KOLA 5FKAC 2K03A 4ZYSA 3C1EA 1X3PA 4KKSA 3FDTA 1KLUD 1M8AA 3K58A 3I4NB 4HEDA 1EOTA 2IT1A 1GHKA 1ET6A 1FGBD 1A3VA 1G291 2NTSA 5C3XA 3J81L 5C3WA 2K01A 3TBIB 1R9TB 1RHPA 5EKLA 3P1HA 2BE5D 2EXZA 3LWEA 4KTAA 1F2MA 1QB5D 3R93A 4C1NI 3P20A 5LL6S 4CJ0B 3DWQA 4BWGB 3L9AX 1SNOA 3NTIA 5FO9B 2Z8LA 4R8IA 2ID0A 3OW7A 5BN4A 1EZ8A 3SDZA 3D4WA 3GQBA 3VYUA 4KD3A 3AMUA 1EQTA 1FNWA 1OXXK 4KKTA 1QWYA 2F0OA 1HUMA 1XX8A 2IWHA 3RZOB 3ERQA 3ND8A 3M4OB 5TSSA 1I50B 5I6WA 1I6VC 2F3WA 1CM9A 2F4IA 3I8ZA 3OWEB 1Q1BA 1A6XA 3M7NA 4K5XA 5IT9L 1K83B 1SDFA 3EA6A 4H0LC 4O42A 3X3NA 1PMRA 2D9UA 2B2VC 1SEBD 2B2TA 1DM0B 3NTKA 5IOCA 1HTPA 3P7JA 1SNCA 3PMFA 1OXSC 4QMGA 2EZVA 1IW7C 3A8JE 1WD0A 1SXTA 3S9WA 3GTOB 4J6HA 1TQOA 4K5VA 2AWOA 1QNKA 3KLSA 1RODA 2VNUD 2K28A 3A56A 3GTQB 2KCNA 2GA4B 2EDGA 3O13A 3HGBA 1JORA 3ITPA 3MXUA 2NN6I 3Q24A 1NCVA 4NP5A 1ENFA 3FVQA 5IGFA 1TU2B 1LTSD 1DYQA 5FK9C 3AB9A 4CJ2C 2XVSA 3VYTA 3PUVA 2F03A 1V1OA 4Z9CB 1STHA 1R4PB 2NUCA 3IAYA 2AQ2B 2PQEA 2BOSA 4A3MB 3BZDB 3H94A 1I4GA 4OO1H 1YNJD 3S2HB 1FNVA 2ZXRA 4DA2A 1CA5A 2A6EC 5ISRA 3EQLC 4RGMA 2F0IA 1ENAA 1V8QA 1VF7A 3I4LA 1ONLA 1I4QA 3RD4A 4IURA 1CHQD 4A3BB 5FLXL 1L0YB 1HRJA 1TIID 3NWSA 1EEID 1W6KA 2K1BA 1HTLD 1VDZA 4KN4C 4WFN3 1II3A 3HOYB 2A74C 2A6HC 2B63B 1LO5D 5C4ZA 3NHHA 4DNRB 1WTWA 2HDMA 2KA7A 5C0XI 3T13A 1Y1WB 2AUKA 4X3TA 5JJZA 4IZ8A 3S2DB 5EBCA 1TWCB 1EYAA 4HN7A 1AZQA 2E75C 3W2DA 5M5XB 2X69A 5HGTA 5K5PA 4IUNA 3U9SA 1JWMD 2NVTB 5DAUA 2LFNA 3QIAA 3BS1A 1EU4A 3C46A 2Q8TA 4KD4A 2DY8A 5IGCA 2F0SA 4C1NK 3OOCA 4JK1C 2JXMB 2RVLA 1LTRD 5IIFA 2F0FA 3R2IA 3PIO3 3M4YA 3J80L 3PO3B 5E1FA 2I07B 3J7AF 1QOHA 5IGEA 1DONA 2FINB 3WOFA 5CV5A 1A3TA 1BBXC 3DXJC 1EFID 2LMCB 4JBWA 2QILA 1B4OA 1BCPC 4DN4M 5JPNC 3KBGA 4FF3A 2B2YA 1F9SA 3QB3A 3TP7A 2VB2X 3PUZA 2B2TC 1Y1VB 3TP6A 4HCSA 2F0TA 4G7OC 1RTOA 1ZYRD 3X3MA 1G2TA 5I6YA 3K7AB 3QJYA 2B39A 1R4QB 5A35A 5IGGA 5IT9E 1DOLA 1MSGA 4K6LA 4S3SA 4CHTB 4OO1G 4HAEA 1IYVA 1JQYD 4RHSA 1E2WA 4FXGC 1V1PA 2JYOA 3R8BA 5KNDA 1ESRA 1HUNA 2NVXB 4QB4A 3N6RA 3T53B 4RGTA 3SE0A 2DY7A 1NAPA 4ME5A 1TVXA 5JEAH 2FHTA 2R3ZA 3CHBD 2F0JA 1HPCA 4DU9A 2CW0C 1HFNA 2MPMA 2XNAC 1Q1EA 4Q0FA 1SYFA 1TWHB 1SYDA 4DNTB 2IPKD 1SYEA 1Z6HA 1I4HA 3NXWA 4KHVA 4KK7A 2A68C 3BYYB 3WDNA 1TY2A 3ZYYX 4R8NA 3BVZA 2J7ZA 3S1RB 3L7ZC 5C5MA 1TT2A 3CRLC 3MZ5A 4FF1A 1G8ZD 5COYA 4AYBB 2TMPA 3HOVB 3KK7A 3NQTA 4HMIA 3HKZB 1KDCA 2B2YC 3NBHA 1OO9B 1HA6A 2IX3A 3T51B 3VR4A 1O80A 1A2UA 3MHBA 1HQMC 1B44D 3NP8A 3SK8A 3D3RA 3C3LA 4A3JB 1EU3A 4C3IG 1XYIA 4XQQA 1AFPA 3VA7A 1VCIA 5CBAE 3IFTA 3V05A 2L5TA 4ID6A 3DMUA 1U4MA 4IALA 1LT6D 2JA8B 3HRZC 1AEXA 5CV6A 2BDOA 1MBYA 4XYQA 4RKLA 4X3SA 2K7VA 1AZPA 4IUQA 3TMEA 3KLRA 2XWBB 1STBA 4CGYB 1VMCA 5ELEA 3GTLB 2AQ1B 3EJIA 1EQVA 3NQIA 1G2SA 4FF2A 3DEPA 2OF1A 4RKBA 1IHZA 3HP3A 1HA5A 5I2YA 2EY6A 4ILWA 1LTTD 4U68A 1GXDC 2JE6I 1S5DD 4B9XA 4NDXA 2CVRA 2O2LD 1A3UA 3JAML 1DXMA 4HSVA 1FYCA 1LABA 4EVOA 1Y8NB 1MI2A 1PYWD 1CZGA 3QWNA 3UI2A 3CU7A 1MGSA 1SNDA 2PO4A 4CBVA 4E6IA 3PV0A 1W6JA 1BF4A 4BBRB 3MC0B 4RCNA 2K05A 3Q0AA 3TSSA 2WP8J 5FO8B 1WTRA 1GUGA 1I4PA 2BA0A 4PMBA 1UUPA 5FOBB 5ELCA 1CTMA 2ENBA 5JPMC 1KABA 3H3VC 3HS0C 4CKEA 3MXPA 1CQFA 2EYJA 1TWFB 3SXHA 3IFDA 5EBDA 4OGQC 3A8KE 4IN3A 4N9PA 2A6ED 3IL8A 1NSNS 2K5DA 2N55A 4RFBA 4BY7B 4OL7A 4PMWA 1I4XA 4ZRZA 1DOMA 3E6ZX 4YIJA 1CA6A 2D62A 4ZAIA 4DK1A 5EJWA 2NBFA 3S1MB 4C3HG 2EY1A 4TQUS 1Z47A 1EL0A 4WORA 2RKSA 3BDLA 4DK0A 3HOWB 2F0PA 1ILPA 1HFGA 1CK1A 1O7ZA 1PTOH 1TWAB 1SNPA 1JOOA 5M9OA 3D6WA 3GTPB 1TKWB 2EOTA 4XQNA 2EYFA 3VYSA 2C5CA 1BR9A 4GZYC 5G3LD 4G4KA 5EKKA 3GO5A 1H9KA 1PZID 4H7BA 4FNFA 1KLGD 3K5LA 5BN3A 4RA8A 1S4ZA 1PZKD 2IW3A 2B2UA 4FXKC 4A93B 1Y69U 2O5IC 1GUTA 1WTPA 1RJTA 1H9SB 2OEOA 2QKIC 2RBMA 2OXPA 2SDFA 3NUCA 3OIPA 4Q5VA 3S1QB 1DJRD 1D5XC 1LT4D 1IL8A 3BG3A 3KF8A 2DNCA 4M1UB 4TSSA 5AFWA 3L3OC 1PRTD 2EVBA 4KY7A 4DF7A 3TZDA 3RUZA 1Q90A 1Z7TA 2ICIA 5M5YB 3D4DA 5KEEA 3K0YA 1WTVA 1PDQA 5KRUA 3V2TA 5CV4A 2E2DC 4K8JA 4G7HC 5BN5A 3J81E 3VR3A 1RKNA 4DAPA 4J1MA 4C3IB 3GTKB 3EROA 5EPKA 1EY5A 4CKBA 3SHLA 2ZT9C 1CI3M 2FJ2A 2XIWA 3TP5A 1WCMB 3H91A 3M3YB 3TZUA 3Q6SA 1O78A 1UAPA 3KUPA 2B8FA 1F9QA 1KDBA 1U4LA 1TWGB 5T1IA 1QG7A 2ZXPA 4OIJA 1JOQA 1ML0D 3H09A 3TP8A 3I70A 1EY6A 1HQRD 5E3FA 3R2TA 3FKIB 1SE3A 2MHVA 2WKDA 2O4XA 1GUSA 4LJZC 1D6EC 1NR4A 1KAAA 2PPBC 5I9OA 3VYRA 1B1ZA 2TSSA 5I2XA 3CRKC 1AP0A 4ZK9B 1IYUA 2B2WC 1YNJC 1LV9A 5EPLA 4F8MA 4C3JB 1SAPA 1CFMA 1E2VA 1DCZA 2RDGA 2F1MA 2EJMA 3OMCA 2K5QA 1PRTF 1EY9A 2FFKB 2B8GA 1TY0A 1I4RA 1O7YA 5JEAG 2A73B 4HTHA 2EYOA 2JA5B 1PXUA 3PUWA 5ELDA 2YYZA 2HCCA 1F2ZA 2G9DA 1STAA 2PW5A 4EQPA 1ZYRC 4TKOB 1U4PA 3VR2A 3S17B 2XN9C 1QJOA 5FLXE 2EYMA 2MUYA 2QEJC 1PRTB 5M3FB 1PLFA 3D31A 2AQ3B 4KJNA 1BOSA 2R6GA 1SJHD 4EGVA 5C6AA 3S14B 1STGA 4BA2I 2E2JB 1GJXA 3K59A 5IGBA 1WVLA 1LTID 2B2UC 1BCPD 2EYHA 1K8MA 2C9OA 2LS01 2E74C 2MGSA 3PUYA 5JVH3 1STNA 2F3VA 4LMQD 4QF4A 2D5DA 2F0WA 1MSHA 3FRPB 2A68D 1D1IA 1A15A 4XIGS 1B53A 4X3KA 4K14A 4NMZA 2EY2A 1SYCA 2R92B 2PNRC 3K57A 1EIHA 1SMYC 4UDUC 3MXNA 4ODGA 2VUMB 2FMMA 4H44C 2KEDA 5DM73 5M3MB 1SE2A 4F87A 2NB0A 2HCIA 1BDOA 1VMPA 1DD2A 3C2PA 3S15B 4EQNA 3A7AB 4V190 3GV3A 2IX0A 3JAME 3VA5A 2SNSA 4Y7NB 5EQ0A 3TN2A 1JWSD 3BDCA 4MN3A 3PIP3 2NN6H 1F77A 4IFDJ 1QCBD 3K6OA 2L12A 2Q8RE 4O1NA 4DAVA 1DZ1A 3MVVA 1STEA 1WD1A 2Z1CA 1GHJA 1KDAA 5C4JB 2LKVA 2DNEA 4IUPA 4NKLA 1B9NA 5J22A 1WTXA 4NW2A 4U673 1U4RA 3NK9A 4A3DB 2BA1A 3WOEA 3NBIA 2XSCA 4RHRA 3MA2B 3RZDB 4A3IB 2BDNA 4R9WA 2R61A 3T4AC 1JB3A 2Z4HA 3H0GB 2F0VA 2F0GA 1S5CD 2MP1A 4XDXA 2WIIB 4XTCS 1GOZA 2RA4A 2Z4IA 2IJ0A 4HCEA 4QUCA 3SEBA 2EE1A 4XT3B 1STYA 4BA1I 1H9JA 1PFMA 3I4MB 4DXFA 1X3QA 1S5BD 2R93B 1WTQA 3M85A 4BS9A 1BQQT 2L9HA 1PZJD 5T1GA 2K5WA 3OMGA 2F0UA 4MIUA 1CT1D 1TS2A 1FD7D 2VXWA 5LHY1 5D3DA 3J80E 2PMZB 1JR0D 4N9TA 2XRQD 4K5WA 2BCOA 1Y8PB 4L8JA 1XTCD 2CHBD 5CORA 2KECA 2WKCA 5C4HA 1BNZA 1T5XD 2CW0D 3QO2A 2L0CA 1EYCA 4PQXA 2PCFB 2EYLA 2I46A 3NWTA 1F2LA 3EFXD 1SE4A 3GTJB 4DXGA 3E5SA 4FVMA 3TDQA 1NUCA 4QCLA 4KY6A 4KN7C 1GUWA 2SOBA 4A3EB 5KYIA 4ABNA 4K2LA 1TS3A 4RAUC 1V1PB 4BY1B 2A6HD 2WB1B 2L4NA 1EY0A 3U9OA 1EIGA 4CJ1B 1J8IA 1ESFA 5KNBA 1C48A 2PZWA 1H9RA 1EY4A 1IKLA 1I3QB 4RH6A 3P75A 4LK1C 2A69D 2HUGA 1UEAB 2DN8A 3NE5B 1D5MC 1TR5A 1OXVA 1D2BA 1FNUA 5K36G 4F7XA 3D4RA 1K8OA 2WINB 1PFBA 3K5NA 3GTMB 4KI0A 2JSOA 2PZUA 3PO2B 2EJFC 4V0BA 4OIKA 2Y0SB 1F9RA 3DWPA 1V43A 5KNCA 1QNUA 5KIXA 1BCPF 1RCVD 5J1ZA 1ZKOA 1F9PA 2KQ3A 4ZLTF 1Q8IA 3LNNA 5KGUA 1AN8A 4XXEA 5JAVA 4K8IA 3H6MA 1H9SA 1LLRD 4KV6A 3PUXA 4FO2A 1E0BA 4BBSB 4QIWB 2D2CC 2M9VA 1I6HB 3I90A 3URYA 1CQVA 5D14A 5DM63 2AUJD 2QDBA 2PW7A 2EPBA 3DHQA 4C3HB 5DEHA 1EY8A 2L11A 2CQAA 1EYDA 2QCPX 1KNEA 4PV1C 3OHXC 3NPPA 4QUFA 2E76C 1X32A 2K6AA 3MAQA 1YNND 2SNMA 2E2IB 5CV7A 1TS5A 2N88A 4L6TB 3I91A 2RSNA 1RTNA 3W3AA 5C3EB 1SMYD 3VR6A 2ICEC 2F0MA 1PTOD 1YNNC 1LT3D 2NVQB 2EY5A 2G9HD 4L63B 4ZUIA 1D5ZC 2NZ1D 3GP7A 4XQJA 1B2TA 3EVQA 4ZQ3A 1B9MA 3FEWX 3KLSX 1LT5D 3CQZB 5A2QE 3OIQA 2K32A 5CV9A 5ELBA 4J8QA 2EYPA 1UNSA 3MTSA 5FO7B 1SNQA 3G6JB 2PZTA 4ULLA 1SBBB 1BXTA 2F0QA 2IL8A 5D65A 3SK6A 1B50A 3LX0A 3NSWA 2JA7B 2M2LA 3VR5A 1CZWA 4HR7B 3DUZA 4A3KB 3G7LA 5JVG3 2RQXA 2QF7A 3IKJA 1SYGA 2J0TD 1M4VA 4I65A 4K2KA 1ENCA 4IUUA 3OWFA 1BCPB 1VF5C 1KTKA 3N52A 2EJGC 5C0XH 4KMUC 2NVYB 4RCOA 4PNYA 5IGDA 3GD7A 4X3UA 2HQEA 2F0LA 2JP1A 5CR3A 3QOJA 4RWSC 3DWAA 3QOLA 3HOXB 1XWEA 3HEJA 2KHSA 1D1KA 1SYBA 2A69C 5CMDA 4WRDA 4C2MB 1HCZA 1LACA 1PTOB 1EEFD 1H9MA 5DNFA 4RGOS 2KVMA 5CBEE 1PFNA 4OO1I 1DOKA 4UAIA 3OPOA 1IW7D 1JE4A 2HDLA 3FPUB 1RD9D 5C4XB 1IKMA 1OXTA 3A8IE 1ICWA 1EWCA 1B3AA 4C3JG 1KNAA 2NYZD 1BO0A 4M8AA 1EY7A 1JCKB 5C44B 5C5LA 3BVMA 4KJOA 4DFAA 2WV6D 4KKUA 5HURA 5EKIA 4B9WA 2K33A 2MJ8A 4IFDH 3SR1A 2NWGA 4FP5D 3HOZB 3I3CA 3HZXA 1F2YA 1GUOA 4C56C 1QE6A 1O7LA 5K36H 4KHZA 2ZXOA 4FXDA 2VB3X 1PRTC 5ELFA 1G91A 2L1BA 1RF2D 1T5EA 2M00A 1AW7A 3SVMA 3GV6A 4ZKBB 1OXUA 4RGNA 5E4WC 3K5OA 3DM1A 4A3FB 4IUTA 4G7ZC 5KYLA 3C1FA 5EGTA 2YU9B 3MWYW 2A5HA 5JEAJ 2H1EA 4G57A 3K5MA 3F2UA 3S16B 4OHJA 1S5ED 1MD2D 2FMCA 1ZXTA 4TRDA 5IODA 4IUVA 1Q12A 1A2TA 3R3OA 4K6DA 5JOBA 3ONAB 1JC7A 3RLFA 3MXGA 2PYKA 3AU7A 1C4QA 2IX1A 1PTOF 2F0DA 1J9OA 2E2HB 3T56B 2R7ZB 2LY7A 1EWHA 3S1NB 2JEAI 3MFYA 4IQZA 4XYOA 4HSPA 1LTAD 4A3GB 1WTOA 4FYDA 4I7ZC 1Q3LA 3ND9A 5CYUA 5M5WB 5C0XJ 1JICA 3Q23A 4PMCA 3FMCA 5J39A 1SSOA 3CKIB 5C0XG 2F0NA 3KBXA 4CKCA 1E2ZA 2KCCA 2F0HA 1QILA 2Q8IB 3A55A 4IFDI 1RDPD 2AWNA 2X6LA 3D6CA 2RDFA 3DEOA 3I73A 3BYTB 3E0JA 2X6GA 5I4DA 2J4XA 3NTHA 1JOKA 3J7AV 4MHEA 2SEBD 4KY5A 5EPJA 1SJED 1S5FD 2XWJB 2K04A 4DAYA 2H4OA 4DGZA 3BVGA 1GUNA 5CV8A 1G6ZA 3MFGA 5E4XA 1TS4A 1HXYD 3LWUA 3V96A 3I72A 5CC4A 2WAQB 2B2VA 3SK4A 1L0XB 1HHVA 2OT2A 3T16A 2KEEA 1XXGA 2NN6G 3MEHA 2JEBI 1ZEQX 5D3IB 3A7LA 1JWUD 4WJWA 5A2QL 2F0EA 1NR2A 2NTTA 4H13C 4ZUJA 4ZKCB 1SNMA 2V4DA 1ILQA 4IFDG 4FF4A 3M7GA 4LAAA 5LL6X 3D8GA 1C8CA 2JA6B 3RMHA 3HOUB 5NUCA 4XT1B 2RSOA 5CGKA 2F0KA 4P2CB 2O5JC 1BUVT 5F2DA 3BDOA 3GTGB 1U9RA 1Y8OB 2L55A 5I9PA 1LTBD 3Q22A 4B08A 2KUMA 2B2WA 3HG9A 5G3LF 1LTGD 4HMJA 4F88A 3A54A 1EZ6A 2BE5C 2KJXA 2XRSD 3SK5A 2RDHA 4EQOA 2WACA 3OSOA 3QG1A 1ET9A 1FR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SEB D;  1BCP F;  1RCV D;  1PTO C;  1SEB D;  1CHP D;  1PTO B;  5FKA C;  1SJE D;  1EEF D;  1JWS D;  1S5F D;  1G8Z D;  1XTC D;  5ELD A;  1LO5 D;  3KLS X;  2CHB D;  4RGO S;  1LTT D;  1LT5 D;  4ZYS A;  3BVG A;  4OHJ A;  1CK1 A;  1S5E D;  1F77 A;  1AN8 A;  1S5D D;  1MD2 D;  1PTO H;  5ELB A;  1KLU D;  1T5X D;  2O2L D;  1TS4 A;  3MFG A;  1LLR D;  1HXY D;  1UNS A;  1SXT A;  1RD9 D;  1ET6 A;  1FGB D;  4O1N A;  1STE A;  4K6L A;  1L0X B;  2NTS A;  1XXG A;  1PYW D;  2XN9 C;  3EFX D;  1EWC A;  1JQY D;  1SE4 A;  4RHS A;  5D3I B;  2QEJ C;  1JWU D;  4DXG A;  1PRT B;  1SBB B;  3W2D A;  3O13 A;  1BXT A;  1JCK B;  3URY A;  1CQV A;  3BVM A;  1V1P A;  2AQ3 B;  2NTT A;  1PZI D;  3R8B A;  1JWM D;  1PTO F;  1B44 D;  1TS3 A;  1KLG D;  1V1P B;  3MC0 B;  1SJH D;  2WV6 D;  4RHR A;  1EU4 A;  3EA6 A;  3TSS A;  4RGT A;  1EU3 A;  1ENF A;  1ESF A;  1LTI D;  1LTS D;  1PZK D;  1BCP D;  1DYQ A;  1HQR D;  1I4P A;  2R61 A;  5FK9 C;  1UUP A;  3R2T A;  3DWQ A;  3V05 A;  1SE3 A;  4RH6 A;  5ELC A;  4BWG B;  3CHB D;  1LTA D;  1S5C D;  1LT6 D;  1V1O A;  4Z9C B;  2Z8L A;  1D6E C;  1LTR D;  1GOZ A;  4C56 C;  2AQ2 B;  1M4V A;  3R2I A;  1B1Z A;  1D5M C;  2IJ0 A;  1BCP B;  3SEB A;  2TSS A;  1KTK A;  3BZD B;  2XNA C;  1PRT C;  1DJR D;  1D5X C;  5ELF A;  1FNW A;  1FNU A;  1I4G A;  1LT4 D;  1LTB D;  1FNV A;  4DXF A;  4UDU C;  4RCO A;  5ELE A;  1S5B D;  1RF2 D;  1TS5 A;  2IPK D;  2AQ1 B;  1AW7 A;  1LTG D;  4L6T B;  2RDG A;  4RFB A;  1EFI D;  1I4H A;  4RGM A;  4TSS A;  2QIL A;  5TSS A;  1BCP C;  1I4Q A;  1QIL A;  1SE2 A;  1PRT D;  4RGN A;  1PTO D;  1PZJ D;  1CHQ D;  1RDP D;  1LT3 D;  1PRT F;  2XRS D;  1CT1 D;  1L0Y B;  3BYY B;  3DWA A;  2RDH A;  3OWE B;  2G9H D;  1I4X A;  1TS2 A;  1FD7 D;  1TY2 A;  3BYT B;  3DWP A;  4L63 B;  1EEI D;  1TY0 A;  1D5Z C;  2J4X A;  1ET9 A;  1I4R A;  3GP7 A;  5D3D A;  5I4D A;  2ICI A;  1HA5 A;  1HTL D;  1JR0 D;  3BVZ A;  2XRQ D; 
#chains in the Genus database with same CATH topology
 3J7Y W;  2R7D A;  3FPP A;  2PMZ E;  1PTO C;  1SFO B;  1CHP D;  2KOL A;  2K5H A;  1KL9 A;  1TWF H;  5FKA C;  3CXC A;  1KXL A;  4GNX B;  2K03 A;  4ZYS A;  3C1E A;  1X3P A;  5LMN W;  5JJK A;  1YVC A;  4KKS A;  3FDT A;  1KLU D;  1M8A A;  3K58 A;  3I4N B;  4HED A;  1EOT A;  2IT1 A;  1MHW C;  1UE1 A;  1GHK A;  1ET6 A;  1FGB D;  3PSI A;  1A3V A;  1G29 1;  4OEM B;  2NTS A;  5C3X A;  3J81 L;  5C3W A;  1ASY A;  2K01 A;  2UU9 Q;  3TBI B;  5M5X H;  1R9T B;  1RHP A;  5EKL A;  3P1H A;  2YU9 H;  4OX9 Q;  4LFB Q;  1J6Q A;  2BE5 D;  2EXZ A;  3LWE A;  3S17 H;  4KTA A;  1L1O A;  1XMO L;  1KQS A;  1F2M A;  1QB5 D;  3R93 A;  4C1N I;  3SGI A;  3P20 A;  2F3I A;  5LL6 S;  4CJ0 B;  4NXM L;  4DUZ Q;  3DWQ A;  1M90 C;  3H0G G;  4BWG B;  3L9A X;  1XPU A;  4DR4 L;  1SNO A;  2YTX A;  3NTI A;  5IYC H;  4NXM Q;  5FO9 B;  4A3G H;  1B8A A;  2Z8L A;  4R8I A;  2CCZ A;  2ID0 A;  3OW7 A;  5BN4 A;  1EZ8 A;  3SDZ A;  3D4W A;  2Y0S E;  3GQB A;  3VYU A;  4LF5 L;  4BBR G;  1IBM L;  4KD3 A;  2QGQ A;  1EQT A;  3AMU A;  3KOJ A;  1FNW A;  2PI2 E;  1OXX K;  4KKT A;  1QWY A;  2F0O A;  3G4S A;  1HUM A;  4POG A;  1EWI A;  1XX8 A;  2IWH A;  1VQ4 A;  3RZO B;  5IT9 c;  3ERQ A;  3ND8 A;  3M4O B;  2KEN A;  3IRB A;  3K80 C;  1PHJ A;  5TSS A;  1I50 B;  5I6W A;  1I6V C;  2F3W A;  4JI1 L;  1CM9 A;  2F4I A;  3I8Z A;  1X3F A;  3OWE B;  3HKZ E;  3KLW A;  2QW7 A;  5L37 A;  1Q1B A;  3I2Z A;  4DR2 Q;  2KBN A;  1A6X A;  3M7N A;  4K5X A;  2I5H A;  1K83 B;  1SDF A;  5IT9 L;  3EA6 A;  4H0L C;  4O42 A;  3X3N A;  4GLV B;  1AE3 A;  4BBS G;  1PMR A;  2D9U A;  2B2V C;  1SEB D;  2AMC B;  2B2T A;  1DM0 B;  4JG2 A;  4DV4 Q;  4JV5 L;  3NTK A;  5IOC A;  2KCT A;  2Z6K A;  3PIP A;  1HTP A;  1X56 A;  1I6H H;  1WYD A;  3P7J A;  1SNC A;  3FKI H;  1OXS C;  3PMF A;  4HJA A;  5FLM G;  4DV4 L;  4POF A;  4JV5 Q;  5IYB H;  4QMG A;  2EZV A;  1IW7 C;  3A8J E;  1WD0 A;  1SXT A;  3S9W A;  3GTO B;  4J6H A;  1TQO A;  1T9H A;  4K5V A;  4YHH Q;  1H95 A;  3WWV A;  2AWO A;  1QNK A;  1U5K A;  3KLS A;  1ROD A;  2VNU D;  2K28 A;  3A56 A;  2NVQ H;  2KCN A;  3G48 A;  3GTQ B;  2GA4 B;  4X66 L;  2E2H H;  2MO1 A;  4DV3 L;  2EDG A;  3O13 A;  3HGB A;  1JOR A;  3ITP A;  3MXU A;  3J80 c;  4JI6 L;  2A1A A;  3CCQ A;  2NN6 I;  2DJG C;  1PH7 A;  1KAW A;  3Q24 A;  1NCV A;  4MTN A;  4NP5 A;  1ENF A;  3FVQ A;  5IGF A;  1PH9 A;  1TU2 B;  1VQA A;  3U50 C;  1LTS D;  1DYQ A;  5FK9 C;  3AB9 A;  4CJ2 C;  1HZ9 A;  2XVS A;  3RN5 A;  3VYT A;  3HOV H;  3PUV A;  1N8R C;  1UWV A;  1HZA A;  2F03 A;  1V1O A;  4Z9C B;  1STH A;  1R4P B;  1G6P A;  3CMA A;  2NUC A;  3IAY A;  1YBY A;  1BBU A;  2AQ2 B;  2PQE A;  4UP8 A;  2BOS A;  4A3M B;  3BZD B;  3S1N H;  1VQO A;  3H94 A;  4JW0 A;  5C4X H;  1I4G A;  4OO1 H;  1YNJ D;  3ERS X;  3S2H B;  1FNV A;  2ZXR A;  4DA2 A;  2HHH Q;  4JCV E;  1CA5 A;  1JJG A;  2A6E C;  5ISR A;  4A3F H;  3KDF A;  3EQL C;  4RGM A;  2F0I A;  1ENA A;  1V8Q A;  1VF7 A;  3I4L A;  1ONL A;  3TQY A;  4DV2 L;  1I4Q A;  3RD4 A;  2WB1 G;  1VQL A;  1QZG A;  4IUR A;  1CHQ D;  5GAH C;  4A3D G;  4A3B B;  5FLX L;  1L0Y B;  1HRJ A;  1TII D;  3NWS A;  1I94 Q;  3HOV G;  1HR0 Q;  3CCE A;  1EEI D;  2ZJR A;  2OTJ A;  1W6K A;  2K1B A;  1HTL D;  4APV A;  3I4O A;  1HNW L;  1VDZ A;  4KN4 C;  4WFN 3;  2I0Q A;  1II3 A;  2A74 C;  2A6H C;  2B63 B;  3HOY B;  1LO5 D;  5C4Z A;  4DR6 L;  3NHH A;  4DNR B;  1FJG Q;  1WTW A;  2HDM A;  2KA7 A;  4CDC C;  3T13 A;  5C0X I;  1Y1W B;  2AUK A;  2WB1 E;  5LMU L;  4X3T A;  5JJZ A;  4IZ8 A;  1FJG L;  2ATW A;  5J3B A;  3S2D B;  4IPH A;  5EBC A;  2CKZ B;  1TWC B;  1EYA A;  1K3B C;  4HN7 A;  3S1Q H;  1AZQ A;  2OWO A;  2E75 C;  3HOW H;  3AFQ A;  4YCU A;  1S40 A;  3W2D A;  5M5X B;  3H3V I;  2X69 A;  5HGT A;  4AYB E;  5K5P A;  4IUN A;  3U9S A;  2JA8 H;  5HY6 A;  1JWM D;  3CC4 A;  5LMN L;  1LTL A;  3A5Z B;  4DR5 Q;  2NVT B;  5DAU A;  2LFN A;  3QIA A;  4KLK A;  4X64 Q;  3BS1 A;  1EU4 A;  4CDD C;  3C46 A;  4DNI A;  5ELN A;  1FL0 A;  1JT8 A;  2VUM G;  2Q8T A;  4KD4 A;  1UE6 A;  4DAY B;  1HNZ L;  2DY8 A;  5C44 G;  5IGC A;  2F0S A;  4C1N K;  3OOC A;  4JK1 C;  2JXM B;  2RVL A;  1LTR D;  2K52 A;  3M3Y H;  5IIF A;  2XGT A;  1JE5 A;  2F0F A;  3R2I A;  3PIO 3;  3M4Y A;  1GD7 A;  5FLX c;  1J5E Q;  4EQ5 A;  3J80 L;  3PO3 B;  5E1F A;  1HNX Q;  1MJC A;  2I07 B;  3J7A F;  1QOH A;  5IGE A;  2V1C C;  1DON A;  2FIN B;  3WOF A;  5CV5 A;  1A3T A;  1BBX C;  4CDE C;  3DXJ C;  1EFI D;  2LMC B;  4JBW A;  2QIL A;  1B4O A;  1HNX L;  1A8V A;  1BCP C;  4A3G G;  2K5N A;  5IYC G;  1XMQ L;  4LUO A;  4DN4 M;  5JPN C;  1KD1 C;  3KBG A;  4LUZ A;  4FF3 A;  2R7Z G;  5BR8 L;  2B2Y A;  4GKK Q;  4AQY L;  1F9S A;  3QB3 A;  3TP7 A;  2VB2 X;  3PUZ A;  2VY3 A;  2B2T C;  1Y1V B;  2AHO B;  4YWM A;  1G51 A;  3TP6 A;  4HCS A;  2F0T A;  5C3E H;  1RTO A;  1ZYR D;  4G7O C;  3X3M A;  1G2T A;  5I6Y A;  3K7A B;  3QJY A;  2B39 A;  1R4Q B;  5A35 A;  1WTH A;  5IGG A;  1L1O C;  1X55 A;  4A3J G;  5IT9 E;  3PO3 H;  4DR4 Q;  1DOL A;  1MSG A;  2AKW B;  4K6L A;  4JYA Q;  4S3S A;  2JA5 G;  3KFU A;  4CHT B;  4OO1 G;  1TWA H;  2VW9 A;  1X3E A;  5IYD G;  4HAE A;  1IYV A;  1JQY D;  4RHS A;  1E2W A;  4FXG C;  2I5M X;  4YCV A;  4QJF A;  1V1P A;  1V1Q A;  2JYO A;  3R8B A;  5KND A;  1ESR A;  1HUN A;  2NVX B;  4QB4 A;  3N6R A;  3T53 B;  4RGT A;  1QVC A;  3SE0 A;  2DY7 A;  1NAP A;  4ME5 A;  1TVX A;  2WFW A;  5JEA H;  2FHT A;  2R3Z A;  2R92 G;  3CHB D;  4LFC L;  5FJ8 G;  3PCO B;  2F0J A;  1GM5 A;  1HPC A;  4DU9 A;  2CW0 C;  3CCS A;  1HFN A;  4UP9 A;  4X66 Q;  2GVB A;  5C4J H;  2MPM A;  2XNA C;  1NMF A;  1Q1E A;  4Q0F A;  1HH2 P;  1E7Z A;  1SYF A;  1TWH B;  1SYD A;  4DNT B;  4JBM A;  1PH3 A;  1PH6 A;  2IPK D;  1SYE A;  1UEB A;  1Z6H A;  1AE2 A;  4DK3 C;  2NZO A;  5IYB G;  1YJW A;  2BH2 A;  1I4H A;  3NXW A;  4KHV A;  4FDB A;  4DV6 L;  3ULJ A;  4KK7 A;  2A68 C;  1RL2 A;  3BYY B;  3WDN A;  1TY2 A;  2CWA A;  3ZYY X;  2R93 G;  4R8N A;  2UUB L;  3BVZ A;  2J7Z A;  3S14 H;  1EOV A;  1XPO A;  3BJU A;  4JPB W;  3S1R B;  4A3L H;  3L7Z C;  5C5M A;  1TT2 A;  3CRL C;  3MZ5 A;  4FF1 A;  1G8Z D;  5COY A;  4AYB B;  4YY3 L;  1VQM A;  4HJ5 A;  3CCM A;  5M3M H;  2TMP A;  1C7Y A;  3STB C;  3HOV B;  3KK7 A;  3NQT A;  1K83 H;  3HKZ B;  1KDC A;  4HMI A;  2B2Y C;  3NBH A;  1OO9 B;  1IBL Q;  1HA6 A;  2IX3 A;  3T51 B;  3VR4 A;  2UUC Q;  1O80 A;  2LSS A;  1A2U A;  1VQI A;  2Y0S G;  4A3L G;  3MHB A;  2ZTE A;  1HQM C;  1C0A A;  1B44 D;  3NP8 A;  3SK8 A;  4QGU A;  2VQE L;  3D3R A;  3C3L A;  4A3J B;  1EU3 A;  1K8G A;  1PVO A;  4C3I G;  1XYI A;  4JBJ A;  4XQQ A;  4JI6 Q;  4DR1 Q;  1AFP A;  4GS3 A;  3VA7 A;  1VCI A;  5CBA E;  3IFT A;  3V05 A;  2L5T A;  4ID6 A;  4IJH A;  3DMU A;  1U4M A;  4IAL A;  1LT6 D;  2JA8 B;  2KHJ A;  3HRZ C;  2E5L Q;  4A3C H;  4L5Q A;  1CSQ A;  1AEX A;  5CV6 A;  2BDO A;  2QEX A;  1MBY A;  2CQO A;  4XYQ A;  1LM0 A;  2MO0 A;  4RKL A;  4X3S A;  2K7V A;  1AZP A;  4IUQ A;  3TME A;  3J81 c;  3KLR A;  2RF4 A;  2XWB B;  1STB A;  2HIX A;  4DR5 L;  4CGY B;  1VMC A;  5ELE A;  3J7Z C;  3GTL B;  2AQ1 B;  1XNQ Q;  1EQQ A;  5FJ8 H;  3KF6 B;  3EJI A;  1EQV A;  3NQI A;  1JJC B;  1G2S A;  4BY1 G;  1PYS B;  3A74 A;  4JI4 L;  4FF2 A;  3DEP A;  2OF1 A;  4OWW B;  4RKB A;  1IHZ A;  2UUC L;  1NY4 A;  3HP3 A;  1HA5 A;  4WJ3 M;  1NMG A;  1Q81 C;  4BY1 H;  4B3T L;  1K0R A;  5I2Y A;  2EY6 A;  2HIV A;  4ILW A;  3CW2 C;  1YHB A;  1SMX A;  1CUK A;  3CCV A;  1LTT D;  1VQ8 A;  4U68 A;  1GXD C;  3HOZ H;  1YHA A;  1VQJ A;  3GTQ H;  2JE6 I;  1S5D D;  1SFO H;  4B9X A;  4ALP A;  1IXR A;  4NDX A;  2CVR A;  2O2L D;  1A3U A;  1NTG A;  3JAM L;  1DXM A;  4HSV A;  1PYB A;  1FYC A;  1LAB A;  4EVO A;  3PQI A;  3I56 A;  4DV0 Q;  1VS0 A;  2EQS A;  4A3C G;  1Y8N B;  1MI2 A;  1PYW D;  3G71 A;  1SRU A;  1PH5 A;  4YWL A;  1CZG A;  3QWN A;  3UI2 A;  2Z6K C;  5IP9 H;  4LFA L;  3CU7 A;  1MGS A;  1SND A;  2ALY B;  2PO4 A;  4CBV A;  1CKM A;  4B3M L;  1XNR L;  4E6I A;  3PV0 A;  1W6J A;  3T1H Q;  1BF4 A;  3CCJ A;  4BBR B;  3MC0 B;  1R9T H;  2IY5 B;  2ZJQ A;  4RCN A;  2K05 A;  3Q0A A;  4GOP A;  2VQF L;  3TSS A;  1VQ6 A;  2WP8 J;  3HKS A;  5FO8 B;  1WTR A;  5IP7 H;  1GUG A;  1I4P A;  2BA0 A;  4PMB A;  1UUP A;  4QQB X;  2HQL A;  5FOB B;  5ELC A;  3HOU G;  1CTM A;  2ENB A;  2JA6 G;  4GN5 A;  4DAM A;  5JPM C;  2PNH A;  3E0E A;  1K73 C;  1KAB A;  1B70 B;  3H3V C;  3HS0 C;  2HT1 A;  4CKE A;  3MXP A;  1CQF A;  2EYJ A;  5GQO A;  2PI2 A;  4LF8 Q;  1TWF B;  3SXH A;  4HJ9 A;  3IFD A;  4OEL B;  5EBD A;  4OGQ C;  3A8K E;  4C2M H;  1D7Q A;  4IN3 A;  4JC0 A;  4N9P A;  3RLN A;  3UDI A;  2A6E D;  3IL8 A;  3RLO A;  1NSN S;  1XMO Q;  2K5D A;  2N55 A;  4RFB A;  3KF8 B;  3Q8D A;  4N8X 1;  1LYL A;  4LF9 L;  4BY7 B;  5C44 H;  4OL7 A;  3RNU A;  1IZ6 A;  4PMW A;  1I4X A;  4ZRZ A;  1DOM A;  4L5S A;  3E6Z X;  4YIJ A;  1JB7 A;  1CA6 A;  2R93 H;  2D62 A;  4ZAI A;  4DK1 A;  5EJW A;  1CKO A;  2NBF A;  2NVT H;  3S1M B;  4C3H G;  1ASZ A;  1XMQ Q;  2EY1 A;  3GTG H;  4TQU S;  3CCU A;  1VQD A;  1B7Y B;  1Z47 A;  1EL0 A;  4WOR A;  2RKS A;  2YV5 A;  3BDL A;  4DK0 A;  1PH8 A;  3HOW B;  2F0P A;  1ILP A;  1HFG A;  1CK1 A;  4Y7N H;  1O7Z A;  1PTO H;  1TWA B;  4HJ7 A;  1SNP A;  4K0K Q;  1E24 A;  1JOO A;  5M9O A;  3D6W A;  3HFZ B;  3GTP B;  1TKW B;  2EOT A;  4XQN A;  2EYF A;  3VYS A;  2C5C A;  1BR9 A;  4GZY C;  5G3L D;  2YTV A;  4G4K A;  1Y1V H;  5EKK A;  3GO5 A;  1H9K A;  1PZI D;  2UXC Q;  4H7B A;  4FNF A;  1KLG D;  3K5L A;  3S2D H;  4A93 H;  1PH1 A;  5BN3 A;  3I4M H;  4RA8 A;  1QUQ B;  1S4Z A;  1PZK D;  2IW3 A;  2B2U A;  4FXK C;  5LMU Q;  3I4M G;  4A93 B;  1Y69 U;  2O5I C;  4R4I A;  1GUT A;  1WTP A;  1RJT A;  1H9S B;  2OEO A;  2QKI C;  2RBM A;  2OXP A;  4JI0 L;  1PH2 A;  5IYD H;  2UUB Q;  2SDF A;  1Y1V G;  1YIJ A;  3NUC A;  4DV1 L;  4AQY Q;  3OIP A;  5C4X G;  3ER0 A;  4Q5V A;  3S1Q B;  4JI0 Q;  1DJR D;  1D5X C;  1LT4 D;  2E2J H;  1VQC A;  1VQN A;  1IL8 A;  3BG3 A;  3KF8 A;  2DNC A;  2E8G A;  4M1U B;  4TSS A;  5AFW A;  3L3O C;  4DKA C;  2Q2I A;  4L5T A;  1PRT D;  3I7F A;  3DM3 A;  2EVB A;  5JJI A;  1AH9 A;  4KY7 A;  4DF7 A;  3TZD A;  3RUZ A;  1Q90 A;  4JI5 Q;  1Z7T A;  3K7U C;  2E2I H;  4JI1 Q;  4JI8 Q;  2ICI A;  2RCN A;  2LXK A;  3GTP H;  5M5Y B;  3D4D A;  5KEE A;  3K0Y A;  1WTV A;  1PDQ A;  5KRU A;  1BKB A;  3V2T A;  1IL2 A;  1HR0 L;  5CV4 A;  2E2D C;  4K8J A;  4G7H C;  5BN5 A;  3J81 E;  2D0O A;  4GNX A;  3VR3 A;  1RKN A;  4DAP A;  4YCW A;  4J1M A;  3TS2 A;  4C3I B;  1KC8 C;  3STB D;  3GTK B;  4GOP C;  3CC7 A;  4LFC Q;  3ERO A;  5EPK A;  1EY5 A;  4CKB A;  2ZTC A;  3SHL A;  2ZT9 C;  1CI3 M;  4B3R Q;  4J15 A;  2FJ2 A;  2XIW A;  3T1H L;  4PZ7 A;  3PO2 H;  3TP5 A;  2OQ0 A;  1WCM B;  3H91 A;  5DLQ E;  2QA4 A;  3M3Y B;  3TZU A;  3Q6S A;  1O78 A;  1UAP A;  3KUP A;  2B8F A;  4BBS H;  1F9Q A;  1KDB A;  1U4L A;  5M5Y H;  4QL5 A;  1TWG B;  5T1I A;  1L2F A;  3HOU H;  1QG7 A;  2ZXP A;  1Q7Y C;  1QUQ A;  3GTO H;  4OIJ A;  4DR6 Q;  1JOQ A;  1ML0 D;  3H09 A;  2A19 A;  3TP8 A;  5ELO A;  3I70 A;  4DV2 Q;  1EY6 A;  1HQR D;  5E3F A;  1YNX A;  3FKI B;  3R2T A;  1SE3 A;  1I5F A;  2MHV A;  2WKD A;  4CDF C;  1YHQ A;  1S72 A;  2O4X A;  1GUS A;  4AYB G;  2UUA L;  1HJP A;  4LJZ C;  1VQ5 A;  5JJL A;  1D6E C;  1NR4 A;  1KAA A;  2PPB C;  1HNZ Q;  5I9O A;  3VYR A;  3JAM i;  1B1Z A;  1CKN B;  1W3S A;  1NNX A;  2TSS A;  4JOI A;  4LFB L;  5I2X A;  3CRK C;  1AP0 A;  4OWX B;  2K4K A;  4ZK9 B;  1IYU A;  4YY3 Q;  2B2W C;  1YNJ C;  1WFQ A;  1LV9 A;  5EPL A;  4JBK A;  4F8M A;  4A4I A;  4C3J B;  1SAP A;  1CFM A;  1HR0 W;  1E2V A;  1DCZ A;  2RDG A;  2F1M A;  2EJM A;  2QDL A;  3H0G H;  3OMC A;  4X62 L;  4L5R C;  3HOZ G;  2K5Q A;  1PRT F;  1EY9 A;  1XNQ L;  4NPS A;  2FFK B;  3AEV A;  3OTO L;  4P71 A;  2B8G A;  1P16 A;  1TY0 A;  1EIF A;  1I4R A;  1O7Y A;  1SRO A;  5AJ3 Q;  1Q86 C;  5JEA G;  2A73 B;  4A3D H;  4HTH A;  2EYO A;  4X65 Q;  2JA5 B;  1PXU A;  3PUW A;  3U58 A;  1KRS A;  4OWT B;  5ELD A;  2YYZ A;  2HCC A;  1F2Z A;  2G9D A;  1STA A;  2PW5 A;  4EQP A;  2UUA Q;  1BVS A;  1ZYR C;  4TKO B;  3S24 A;  1U4P A;  3VR2 A;  3S17 B;  4A3J H;  4IPD A;  2XN9 C;  3A0J A;  1QJO A;  1A63 A;  5FLX E;  2EYM A;  2MUY A;  2QEJ C;  1PRT B;  1Q46 A;  3UDX A;  1ICF B;  5M3F B;  1PLF A;  4A3E H;  3D31 A;  2AQ3 B;  4KJN A;  1GVP A;  2ZM6 L;  1BOS A;  1WCM H;  2R6G A;  1SJH D;  4EGV A;  5C6A A;  3S14 B;  1STG A;  2YTY A;  4BA2 I;  2E2J B;  1GJX A;  1D8L A;  5IGB A;  3K59 A;  2ES2 A;  1WVL A;  2K5V A;  1LTI D;  2B2U C;  2VS1 A;  5GAE C;  2R7Z H;  2LXJ A;  1BCP D;  2EYH A;  1K8M A;  2C9O A;  2LS0 1;  2E74 C;  2MGS A;  3PUY A;  3CF5 A;  3E3X A;  2L15 A;  2R7F A;  4IOA A;  5JVH 3;  1STN A;  2F3V A;  4LMQ D;  4QF4 A;  2D5D A;  2F0W A;  3RR5 A;  1MSH A;  3FRP B;  2A68 D;  4ZCK A;  1D1I A;  3TRE A;  1A15 A;  3AFP A;  3RZO H;  3I55 A;  4GLA C;  4XIG S;  1B53 A;  4X3K A;  4K14 A;  4A75 A;  4JI7 Q;  4NMZ A;  2F4V L;  2EY2 A;  2WAQ E;  3HOX H;  1SYC A;  2UXC L;  2R92 B;  2PNR C;  3K57 A;  1EIY B;  1EIH A;  1SMY C;  4BXX G;  3FKI G;  2B3G A;  2K75 A;  3F8T A;  4RG1 A;  3MXN A;  4UDU C;  4ODG A;  2Q2U A;  1B3Q A;  2IHF A;  2VZA A;  2VUM B;  2FMM A;  4H44 C;  2KED A;  5DM7 3;  5M3M B;  1SE2 A;  4F87 A;  2RCF A;  2NB0 A;  2HCI A;  1SR3 A;  3GTJ H;  1BDO A;  1VMP A;  1RIP A;  3L2P A;  3F2B A;  1DD2 A;  4I7A A;  3C2P A;  3S15 B;  1X54 A;  4EQN A;  1FGU A;  3A7A B;  4V19 0;  2H5X A;  3GV3 A;  2IX0 A;  3JAM E;  1QVG A;  3VA5 A;  2SNS A;  2CWP A;  4Y7N B;  5EQ0 A;  3TN2 A;  1JWS D;  3BDC A;  4MN3 A;  1BBW A;  3PIP 3;  2JA8 G;  2EIF A;  2NN6 H;  2HHH L;  2C35 B;  4GNX C;  1KHI A;  1F77 A;  3KYH C;  3HOX G;  4AH6 A;  4IFD J;  3HOW G;  1QCB D;  3K6O A;  3TS0 A;  2XTI A;  2L12 A;  1EUJ A;  2Q8R E;  4O1N A;  4DAV A;  1DZ1 A;  2GVA A;  3MVV A;  4O0A A;  1STE A;  1IBK Q;  1I94 L;  3RZD H;  1WD1 A;  2Z1C A;  1GHJ A;  1KDA A;  5C4J B;  2LKV A;  2DNE A;  4IUP A;  2KHI A;  1X3G A;  4NKL A;  1B9N A;  4JI8 L;  2K14 A;  4BY7 H;  5J22 A;  1WTX A;  4NW2 A;  4U67 3;  1U4R A;  3NK9 A;  4A3D B;  2BA1 A;  3ICE A;  3WOE A;  1X9N A;  3NBI A;  2XSC A;  4RHR A;  3MA2 B;  2R92 H;  3RZD B;  1W2B A;  4WJ4 A;  4A3I B;  2BDN A;  4R9W A;  1YEZ A;  4DV6 Q;  2R61 A;  3T4A C;  1JB3 A;  2Z4H A;  4A3E G;  3H0G B;  2F0V A;  2A8V A;  2F0G A;  1S5C D;  2MP1 A;  1K9M C;  2B63 G;  4XDX A;  3HOY G;  2WII B;  2UXD L;  3JAM c;  4XTC S;  1GOZ A;  2RA4 A;  2Z4I A;  4DR7 L;  2IJ0 A;  4HCE A;  4QUC A;  3SEB A;  1N36 Q;  3CAM A;  4OXP A;  2EE1 A;  1STY A;  4XT3 B;  4BA1 I;  1H9J A;  1PFM A;  3I4M B;  4DXF A;  4DR7 Q;  3FHW A;  5E7N A;  1X3Q A;  1S5B D;  2R93 B;  1E3P A;  1VQB A;  1WTQ A;  4JVZ A;  3M85 A;  1L0W A;  4K0K L;  4BS9 A;  1BQQ T;  2L9H A;  1PZJ D;  4A3K H;  4YHH L;  5T1G A;  2K5W A;  3OMG A;  2B63 H;  3HOY H;  2F0U A;  4MIU A;  1CT1 D;  4MTK A;  1TS2 A;  1FD7 D;  2VXW A;  1V9P A;  5LHY 1;  5D3D A;  3J80 E;  1K8A C;  1EFW A;  2PMZ B;  1JR0 D;  4NXN Q;  4Y52 H;  2IHE A;  2XRQ D;  4N9T A;  4K5W A;  4DR3 Q;  4GOP B;  2BCO A;  2CH4 A;  2DGY A;  1Y8P B;  4L8J A;  1XTC D;  2VQE Q;  2CHB D;  4LF4 Q;  5COR A;  2KEC A;  2WKC A;  1HNW Q;  3MEF A;  2K50 A;  5C4H A;  4GKJ Q;  1BNZ A;  3EIV A;  1T5X D;  2CW0 D;  3QO2 A;  4LF9 Q;  3S1M H;  1MIU A;  3W1G A;  2L0C A;  1EYC A;  4PQX A;  2PCF B;  1PV4 A;  2EYL A;  2I46 A;  3NWT A;  1F2L A;  3EFX D;  2N8N A;  5LMN Q;  1SE4 A;  3GTJ B;  4DXG A;  3E5S A;  4FVM A;  3TDQ A;  1VQG A;  1C9O A;  1NUC A;  4QCL A;  4KY6 A;  4KN7 C;  1GUW A;  2SOB A;  4A3E B;  5KYI A;  4ABN A;  4K2L A;  4B3T Q;  4A3B G;  1JMC A;  1TS3 A;  4RAU C;  1V1P B;  4BY1 B;  1DGS A;  2A6H D;  2WB1 B;  2L4N A;  1HZC A;  1EY0 A;  3U9O A;  3UDG A;  1EIG A;  4CJ1 B;  1J8I A;  3G6E A;  1ESF A;  5KNB A;  1C48 A;  2PZW A;  3L0O A;  1H9R A;  1EY4 A;  2BH8 A;  1IKL A;  1I3Q B;  4RH6 A;  1HZB A;  1I50 H;  2VQF Q;  3P75 A;  3F1Z A;  5GAG C;  4LK1 C;  2A69 D;  1N34 Q;  3PO2 G;  3H3V H;  4NXN L;  4DPG A;  1I3Q H;  2HUG A;  2Q2T A;  1UEA B;  2DN8 A;  3NE5 B;  1D5M C;  1TR5 A;  1OXV A;  1D2B A;  3T1Y Q;  1FNU A;  4HJ8 A;  3H15 A;  2Q2H A;  5K36 G;  5IY0 A;  4F7X A;  3D4R A;  1K8O A;  2WIN B;  1PFB A;  3A5U A;  3K5N A;  3CCL A;  3GTM B;  3BU2 A;  4KI0 A;  4BBR H;  1K28 A;  1VQ9 A;  2JSO A;  2PZU A;  3VDY A;  3CPF A;  1N9W A;  3PO2 B;  2RHQ B;  1CSP A;  2EJF C;  4V0B A;  4OIK A;  4UHV A;  3KJO A;  2Y0S B;  1F9R A;  3DWP A;  1TWC H;  1V43 A;  5KNC A;  1QNU A;  5KIX A;  1KIX A;  4DV1 Q;  4B3M Q;  4LF8 L;  1XNR Q;  4P74 A;  1BCP F;  1RCV D;  5J1Z A;  4DV5 Q;  1ZKO A;  2N49 A;  2UXB Q;  1PA6 A;  3CME A;  1F9P A;  2KQ3 A;  4ZLT F;  5IP9 G;  1Q82 C;  1Q8I A;  3KJP A;  3LNN A;  5KGU A;  4A3K G;  3I4N G;  3K81 C;  4X65 L;  1AN8 A;  1PFS A;  4XXE A;  1VQH A;  5JAV A;  2UXB L;  4K8I A;  3H6M A;  1H9S A;  3NEM A;  1LLR D;  4A3F G;  3CC2 A;  3W5O A;  2MNA A;  1QVF A;  4KV6 A;  3PUX A;  1E1O A;  4HIO A;  4FO2 A;  4MZ9 A;  1E0B A;  4BBS B;  4QIW B;  2D2C C;  1TWG H;  2M9V A;  1I6H B;  3I90 A;  3URY A;  1CQV A;  5D14 A;  2F4V Q;  5DM6 3;  2AUJ D;  2QDB A;  4LF7 Q;  1E22 A;  2PW7 A;  2NVY H;  2G5D A;  2JA9 A;  2EPB A;  3DHQ A;  4C3H B;  5DEH A;  1EY8 A;  1YZ6 A;  3PF4 A;  4KHP L;  1XTD A;  2L11 A;  3EN2 A;  2CQA A;  1EYD A;  2QCP X;  4ME3 A;  1KNE A;  4PV1 C;  3OTO Q;  1Y1W G;  2N78 A;  1EYG A;  3OHX C;  3NPP A;  1A0I A;  4QUF A;  5M3F H;  2E76 C;  3RN2 A;  5GAD C;  4BY7 G;  1X32 A;  4OON A;  1IYJ B;  2K6A A;  3MAQ A;  1YNN D;  3HKZ G;  2JA7 H;  1EQR A;  2SNM A;  2E2I B;  2FXQ A;  3OYY A;  5CV7 A;  4JI2 Q;  1TS5 A;  2N88 A;  2Z0S A;  4L6T B;  3I91 A;  4A76 A;  2RSN A;  1RTN A;  3W3A A;  5C3E B;  1SMY D;  1OTC A;  1WJJ A;  3VR6 A;  2ICE C;  2F0M A;  1PTO D;  1YNN C;  1LT3 D;  2NVQ B;  2EY5 A;  2G9H D;  4IOC A;  3M4Q A;  4L63 B;  4ZUI A;  3GP7 A;  1D5Z C;  2NZ1 D;  2PQA A;  2ZTD A;  1YIT A;  4XQJ A;  4A3I G;  3E9I A;  4P73 A;  1B2T A;  4GKJ L;  3DLL A;  4HID A;  3EVQ A;  4ZQ3 A;  1B9M A;  3FEW X;  3KLS X;  1LT5 D;  4B3S Q;  3CQZ B;  5A2Q E;  3M9B A;  3OIQ A;  2OCE A;  2EXD A;  1X65 A;  3OW2 A;  2K32 A;  5CV9 A;  4B3R L;  5ELB A;  1E1T A;  4LW1 A;  3PGZ A;  4J8Q A;  2EYP A;  3GTM H;  1UNS A;  4PG3 A;  3GDE A;  4X62 Q;  4BXX H;  1CKN A;  5M3M G;  2UXD Q;  3K7A H;  3MTS A;  5FO7 B;  1SNQ A;  3CQZ H;  3UE1 A;  3G6J B;  2PZT A;  4ULL A;  4LNQ A;  1SBB B;  1KRT A;  1BXT A;  2F0Q A;  2IL8 A;  5D65 A;  1O7I A;  2GN5 A;  1VQP A;  3SK6 A;  4R1J A;  1B50 A;  5IP7 G;  1YJN A;  3LX0 A;  2WAQ G;  3NSW A;  2JA7 B;  2M2L A;  2MFI A;  3VR5 A;  1CZW A;  4R4O A;  3BZK A;  3J81 i;  4HR7 B;  3DUZ A;  4A3K B;  3G7L A;  4DV7 L;  5JVG 3;  1WCM G;  2ZJP A;  1N36 L;  4PZ6 A;  2RQX A;  2QF7 A;  3IKJ A;  3CPW A;  1K3R A;  1SYG A;  3M4P A;  2J0T D;  1M4V A;  2JA7 G;  4I65 A;  4K2K A;  5IWA Q;  1ENC A;  4IUU A;  3JC6 6;  3OWF A;  1BCP B;  1VF5 C;  1KTK A;  3N52 A;  2EJG C;  3F2C A;  5C0X H;  4KMU C;  1VQK A;  2NVY B;  5M3F G;  4RCO A;  3ZJY C;  4PNY A;  5IGD A;  3GD7 A;  4X3U A;  1Z9F A;  1Y1W H;  1VQ7 A;  2HQE A;  2F0L A;  2JP1 A;  5CR3 A;  3ULP A;  1N32 Q;  3QOJ A;  4RWS C;  1N33 Q;  3DWA A;  1MKH A;  1WOC A;  3QOL A;  1NJI C;  3QR8 A;  3HOX B;  1XWE A;  3HEJ A;  1GO3 E;  2KHS A;  4LF6 L;  1D1K A;  1SYB A;  2A69 C;  2JQO A;  1L1O B;  4WRD A;  5CMD A;  4C2M B;  1HCZ A;  1LAC A;  1PTO B;  1EEF D;  1H9M A;  5DNF A;  4RGO S;  2KVM A;  5CBE E;  1PFN A;  4R4C A;  4OO1 I;  4DR3 L;  1DOK A;  3K8A A;  2JA5 H;  4UAI A;  3OPO A;  1IW7 D;  3J81 j;  3PO3 G;  1JE4 A;  3NBH B;  2HDL A;  3FPU B;  1RD9 D;  2UU9 L;  1VQF A;  5C4X B;  1IKM A;  1OXT A;  3A8I E;  1ICW A;  2E5L L;  4A3M H;  5C3E G;  1A62 A;  1EWC A;  3AQQ A;  1B3A A;  2Z9H A;  3J7A 5;  5IWA L;  4C3J G;  1KNA A;  5AJ3 L;  2NYZ D;  1BO0 A;  4M8A A;  1EY7 A;  5H1S E;  1JCK B;  4X64 L;  5C44 B;  5C5L A;  3BVM A;  3T1Y L;  4GKK L;  2D0P A;  1J5E L;  4KJO A;  4AIM A;  4DFA A;  1X6O A;  2WV6 D;  4KKU A;  5HUR A;  4YWK A;  4LFA Q;  2VL6 A;  4GN4 B;  5EKI A;  4B9W A;  2K33 A;  4C3H H;  4RMF A;  2MJ8 A;  5HGQ A;  4IFD H;  3SR1 A;  4LF5 Q;  1TXY A;  3B6Y A;  4UY8 C;  2NWG A;  4FP5 D;  3HOZ B;  4TVA B;  3I3C A;  3HZX A;  1F2Y A;  1GUO A;  4C56 C;  1QE6 A;  1XPR A;  1M1K C;  1O7L A;  5K36 H;  4KHZ A;  2ZXO A;  4FXD A;  2VB3 X;  4DV5 L;  2P5Z X;  3FP9 A;  3K0X A;  1XJV A;  1PRT C;  1UE7 A;  5ELF A;  1G91 A;  1S3O A;  1P8L A;  4UPA A;  2L1B A;  1RF2 D;  1T5E A;  3CP0 A;  3KF6 A;  2M00 A;  1NBW A;  1AW7 A;  3SVM A;  3BZC A;  1QZH A;  3GV6 A;  4LWC A;  4HIM A;  4ZKB B;  4DR2 L;  1OXU A;  4RGN A;  3GTL H;  4N8F A;  5E4W C;  3K5O A;  2JJQ A;  3DM1 A;  4A3F B;  3W1B A;  4IUT A;  4G7Z C;  5KYL A;  3C1F A;  3AYH B;  5EGT A;  2YU9 B;  3MWY W;  2A5H A;  4PZ8 A;  4HIK A;  5JEA J;  2H1E A;  1YJ9 A;  4G57 A;  3K5M A;  3F2U A;  3S16 B;  4OHJ A;  1S5E D;  4JYA L;  1MD2 D;  1IBK L;  4C3J H;  2FMC A;  1ZXT A;  4TRD A;  5IOD A;  3D0F A;  4IUV A;  4A3M G;  4GN3 B;  3NEL A;  1Q12 A;  1A2T A;  3R3O A;  4K6D A;  5JOB A;  3ONA B;  1JC7 A;  3RLF A;  4IJL A;  3MXG A;  1SLJ A;  2PYK A;  4DUY L;  3AU7 A;  1C4Q A;  2NZH A;  2IX1 A;  2I5L X;  1PTO F;  3KDF B;  4KHP Q;  2F0D A;  1J9O A;  5EAY A;  2E2H B;  4JI2 L;  1TWH H;  2DJF C;  4OX9 L;  4B3S L;  3GTK H;  2CH4 W;  3S2H H;  3TRZ A;  3T56 B;  2R7Z B;  2ZM6 Q;  2LY7 A;  1EWH A;  3S1N B;  1LUZ A;  2JEA I;  3MFY A;  4IQZ A;  4IPC A;  4XYO A;  4A93 G;  4HSP A;  1SE8 A;  1LTA D;  4A3G B;  3ULL A;  1UE5 A;  1WTO A;  3S16 H;  1IBL L;  3PF5 A;  3S1R H;  4FYD A;  4I7Z C;  1Q3L A;  3ND9 A;  3PIO A;  5CYU A;  5M5W B;  5BR8 Q;  4JI3 L;  5C0X J;  5GRO A;  4JOI C;  1JIC A;  1Y14 B;  3Q23 A;  3UE0 A;  4PMC A;  3FMC A;  4R4T A;  3J80 i;  5J39 A;  2OQK A;  1SSO A;  3CKI B;  5C0X G;  3I4N H;  4JI7 L;  2F0N A;  3KBX A;  4CKC A;  1N33 L;  1IBM Q;  1E2Z A;  2JK8 A;  2KCC A;  3M4O H;  1WI5 A;  1U0L A;  2F0H A;  1QIL A;  2DUD A;  2Q8I B;  3A55 A;  4LF6 Q;  4IFD I;  1RDP D;  2AWN A;  2X6L A;  3D6C A;  1JJ2 A;  2RDF A;  3DEO A;  3I73 A;  4P72 A;  3EBE A;  1N34 L;  3BYT B;  3E0J A;  2X6G A;  5I4D A;  2J4X A;  3NTH A;  1JOK A;  4DUY Q;  1MJE A;  4MHE A;  3J7A V;  1SN8 A;  2SEB D;  4C3I H;  4KY5 A;  5EPJ A;  1SJE D;  4H02 A;  1S5F D;  2XWJ B;  2K04 A;  4DK6 C;  4IO9 A;  4DAY A;  2H4O A;  4DGZ A;  3BVG A;  1GUN A;  4EX5 A;  5CV8 A;  1G6Z A;  4MNO A;  4DV0 L;  4UP7 A;  3MFG A;  5E4X A;  1TS4 A;  1HXY D;  3LWU A;  1FVI A;  1YI2 A;  4LF4 L;  4O2D A;  3V96 A;  4DV7 Q;  4IPG A;  2B29 A;  1N32 L;  2F52 A;  3I72 A;  5CC4 A;  2WAQ B;  2NVX H;  2B2V A;  3SK4 A;  5FLM H;  3S15 H;  1L0X B;  1HHV A;  2OT2 A;  3T16 A;  2KEE A;  1XXG A;  2NN6 G;  3MEH A;  2JEB I;  1ZEQ X;  5D3I B;  4JI3 Q;  3A7L A;  1JWU D;  2Z6B A;  4WJW A;  1Q8K A;  5A2Q L;  2F0E A;  3LGJ A;  2MQH A;  1NR2 A;  2NTT A;  2PQA B;  2VUM H;  4H13 C;  4ZUJ A;  3NEN A;  2N3S A;  4ZKC B;  1SNM A;  2JA6 H;  4DV3 Q;  2V4D A;  1ILQ A;  1K0S A;  2HD3 A;  2ASB A;  4IFD G;  4A3I H;  4FF4 A;  3CD6 A;  3M7G A;  4LAA A;  3U4Z A;  3D8G A;  5LL6 X;  1C8C A;  4A3B H;  2RHS B;  4P75 A;  2JA6 B;  3RMH A;  4GLX A;  4QY7 A;  3HOU B;  5NUC A;  4DR1 L;  4XT1 B;  1NE3 A;  3E9H A;  2RSO A;  2JN4 A;  4JI5 L;  3CCR A;  5CGK A;  2F0K A;  4P2C B;  2KCM A;  5IE8 A;  2O5J C;  1BUV T;  5F2D A;  3BDO A;  3GTG B;  1U9R A;  1Y8O B;  2L55 A;  5I9P A;  1LTB D;  5M5W H;  3U4V A;  3Q22 A;  4LUV A;  4B08 A;  2KUM A;  4LF7 L;  2B2W A;  3TEH B;  1VQE A;  3HG9 A;  5G3L F;  1PH4 A;  4QIW E;  2OTL A;  4JI4 Q;  3MXN B;  1LTG D;  3UDF A;  4HMJ A;  4R4Q A;  4F88 A;  3A54 A;  4DUZ L;  1EZ6 A;  2BE5 C;  2KJX A;  2XRS D;  2CFM A;  3SK5 A;  2RDH A;  4NB3 A;  4EQO A;  2WAC A;  3OSO A;  3QG1 A;  1ET9 A;  1GKH A;  1FR3 A;  3F2D A;  4X6A H; 
#chains in the Genus database with same CATH homology
 3J7Y W;  3FPP A;  1PTO C;  1SFO B;  1CHP D;  2KOL A;  5FKA C;  2K03 A;  4ZYS A;  3C1E A;  1X3P A;  4KKS A;  3FDT A;  1KLU D;  1M8A A;  3K58 A;  3I4N B;  4HED A;  1EOT A;  2IT1 A;  1GHK A;  1ET6 A;  1FGB D;  1A3V A;  1G29 1;  2NTS A;  5C3X A;  3J81 L;  5C3W A;  2K01 A;  3TBI B;  1R9T B;  1RHP A;  5EKL A;  3P1H A;  2BE5 D;  2EXZ A;  3LWE A;  4KTA A;  1F2M A;  1QB5 D;  3R93 A;  4C1N I;  3P20 A;  5LL6 S;  4CJ0 B;  3DWQ A;  4BWG B;  3L9A X;  1SNO A;  3NTI A;  5FO9 B;  2Z8L A;  4R8I A;  2ID0 A;  3OW7 A;  5BN4 A;  1EZ8 A;  3SDZ A;  3D4W A;  3GQB A;  3VYU A;  4KD3 A;  3AMU A;  1EQT A;  1FNW A;  1OXX K;  4KKT A;  1QWY A;  2F0O A;  1HUM A;  1XX8 A;  2IWH A;  3RZO B;  3ERQ A;  3ND8 A;  3M4O B;  5TSS A;  1I50 B;  5I6W A;  1I6V C;  2F3W A;  1CM9 A;  2F4I A;  3I8Z A;  3OWE B;  1Q1B A;  1A6X A;  3M7N A;  4K5X A;  5IT9 L;  1K83 B;  1SDF A;  3EA6 A;  4H0L C;  4O42 A;  3X3N A;  1PMR A;  2D9U A;  2B2V C;  1SEB D;  2B2T A;  1DM0 B;  3NTK A;  5IOC A;  1HTP A;  3P7J A;  1SNC A;  3PMF A;  1OXS C;  4QMG A;  2EZV A;  1IW7 C;  3A8J E;  1WD0 A;  1SXT A;  3S9W A;  3GTO B;  4J6H A;  1TQO A;  4K5V A;  2AWO A;  1QNK A;  3KLS A;  1ROD A;  2VNU D;  2K28 A;  3A56 A;  3GTQ B;  2KCN A;  2GA4 B;  2EDG A;  3O13 A;  3HGB A;  1JOR A;  3ITP A;  3MXU A;  2NN6 I;  3Q24 A;  1NCV A;  4NP5 A;  1ENF A;  3FVQ A;  5IGF A;  1TU2 B;  1LTS D;  1DYQ A;  5FK9 C;  3AB9 A;  4CJ2 C;  2XVS A;  3VYT A;  3PUV A;  2F03 A;  1V1O A;  4Z9C B;  1STH A;  1R4P B;  2NUC A;  3IAY A;  2AQ2 B;  2PQE A;  2BOS A;  4A3M B;  3BZD B;  3H94 A;  1I4G A;  4OO1 H;  1YNJ D;  3S2H B;  1FNV A;  2ZXR A;  4DA2 A;  1CA5 A;  2A6E C;  5ISR A;  3EQL C;  4RGM A;  2F0I A;  1ENA A;  1V8Q A;  1VF7 A;  3I4L A;  1ONL A;  1I4Q A;  3RD4 A;  4IUR A;  1CHQ D;  4A3B B;  5FLX L;  1L0Y B;  1HRJ A;  1TII D;  3NWS A;  1EEI D;  1W6K A;  2K1B A;  1HTL D;  1VDZ A;  4KN4 C;  4WFN 3;  1II3 A;  3HOY B;  2A74 C;  2A6H C;  2B63 B;  1LO5 D;  5C4Z A;  3NHH A;  4DNR B;  1WTW A;  2HDM A;  2KA7 A;  5C0X I;  3T13 A;  1Y1W B;  2AUK A;  4X3T A;  5JJZ A;  4IZ8 A;  3S2D B;  5EBC A;  1TWC B;  1EYA A;  4HN7 A;  1AZQ A;  2E75 C;  3W2D A;  5M5X B;  2X69 A;  5HGT A;  5K5P A;  4IUN A;  3U9S A;  1JWM D;  2NVT B;  5DAU A;  2LFN A;  3QIA A;  3BS1 A;  1EU4 A;  3C46 A;  2Q8T A;  4KD4 A;  2DY8 A;  5IGC A;  2F0S A;  4C1N K;  3OOC A;  4JK1 C;  2JXM B;  2RVL A;  1LTR D;  5IIF A;  2F0F A;  3R2I A;  3PIO 3;  3M4Y A;  3J80 L;  3PO3 B;  5E1F A;  2I07 B;  3J7A F;  1QOH A;  5IGE A;  1DON A;  2FIN B;  3WOF A;  5CV5 A;  1A3T A;  1BBX C;  3DXJ C;  1EFI D;  2LMC B;  4JBW A;  2QIL A;  1B4O A;  1BCP C;  4DN4 M;  5JPN C;  3KBG A;  4FF3 A;  2B2Y A;  1F9S A;  3QB3 A;  3TP7 A;  2VB2 X;  3PUZ A;  2B2T C;  1Y1V B;  3TP6 A;  4HCS A;  2F0T A;  4G7O C;  1RTO A;  1ZYR D;  3X3M A;  1G2T A;  5I6Y A;  3K7A B;  3QJY A;  2B39 A;  1R4Q B;  5A35 A;  5IGG A;  5IT9 E;  1DOL A;  1MSG A;  4K6L A;  4S3S A;  4CHT B;  4OO1 G;  4HAE A;  1IYV A;  1JQY D;  4RHS A;  1E2W A;  4FXG C;  1V1P A;  2JYO A;  3R8B A;  5KND A;  1ESR A;  1HUN A;  2NVX B;  4QB4 A;  3N6R A;  3T53 B;  4RGT A;  3SE0 A;  2DY7 A;  1NAP A;  4ME5 A;  1TVX A;  5JEA H;  2FHT A;  2R3Z A;  3CHB D;  2F0J A;  1HPC A;  4DU9 A;  2CW0 C;  1HFN A;  2MPM A;  2XNA C;  1Q1E A;  4Q0F A;  1SYF A;  1TWH B;  1SYD A;  4DNT B;  2IPK D;  1SYE A;  1Z6H A;  1I4H A;  3NXW A;  4KHV A;  4KK7 A;  2A68 C;  3BYY B;  3WDN A;  1TY2 A;  3ZYY X;  4R8N A;  3BVZ A;  2J7Z A;  3S1R B;  3L7Z C;  5C5M A;  1TT2 A;  3CRL C;  3MZ5 A;  4FF1 A;  1G8Z D;  5COY A;  4AYB B;  2TMP A;  3HOV B;  3KK7 A;  3NQT A;  4HMI A;  3HKZ B;  1KDC A;  2B2Y C;  3NBH A;  1OO9 B;  1HA6 A;  2IX3 A;  3T51 B;  3VR4 A;  1O80 A;  1A2U A;  3MHB A;  1HQM C;  1B44 D;  3NP8 A;  3SK8 A;  3D3R A;  3C3L A;  4A3J B;  1EU3 A;  4C3I G;  1XYI A;  4XQQ A;  1AFP A;  3VA7 A;  1VCI A;  5CBA E;  3IFT A;  3V05 A;  2L5T A;  4ID6 A;  3DMU A;  1U4M A;  4IAL A;  1LT6 D;  2JA8 B;  3HRZ C;  1AEX A;  5CV6 A;  2BDO A;  1MBY A;  4XYQ A;  4RKL A;  4X3S A;  2K7V A;  1AZP A;  4IUQ A;  3TME A;  3KLR A;  2XWB B;  1STB A;  4CGY B;  1VMC A;  5ELE A;  3GTL B;  2AQ1 B;  3EJI A;  1EQV A;  3NQI A;  1G2S A;  4FF2 A;  3DEP A;  2OF1 A;  4RKB A;  1IHZ A;  3HP3 A;  1HA5 A;  5I2Y A;  2EY6 A;  4ILW A;  1LTT D;  4U68 A;  1GXD C;  2JE6 I;  1S5D D;  4B9X A;  4NDX A;  2CVR A;  2O2L D;  1A3U A;  3JAM L;  1DXM A;  4HSV A;  1FYC A;  1LAB A;  4EVO A;  1Y8N B;  1MI2 A;  1PYW D;  1CZG A;  3QWN A;  3UI2 A;  3CU7 A;  1MGS A;  1SND A;  2PO4 A;  4CBV A;  4E6I A;  3PV0 A;  1W6J A;  1BF4 A;  4BBR B;  3MC0 B;  4RCN A;  2K05 A;  3Q0A A;  3TSS A;  2WP8 J;  5FO8 B;  1WTR A;  1GUG A;  1I4P A;  2BA0 A;  4PMB A;  1UUP A;  5FOB B;  5ELC A;  1CTM A;  2ENB A;  5JPM C;  1KAB A;  3H3V C;  3HS0 C;  4CKE A;  3MXP A;  1CQF A;  2EYJ A;  1TWF B;  3SXH A;  3IFD A;  5EBD A;  4OGQ C;  3A8K E;  4IN3 A;  4N9P A;  2A6E D;  3IL8 A;  1NSN S;  2K5D A;  2N55 A;  4RFB A;  4BY7 B;  4OL7 A;  4PMW A;  1I4X A;  4ZRZ A;  1DOM A;  3E6Z X;  4YIJ A;  1CA6 A;  2D62 A;  4ZAI A;  4DK1 A;  5EJW A;  2NBF A;  3S1M B;  4C3H G;  2EY1 A;  4TQU S;  1Z47 A;  1EL0 A;  4WOR A;  2RKS A;  3BDL A;  4DK0 A;  3HOW B;  2F0P A;  1ILP A;  1HFG A;  1CK1 A;  1O7Z A;  1PTO H;  1TWA B;  1SNP A;  1JOO A;  5M9O A;  3D6W A;  3GTP B;  1TKW B;  2EOT A;  4XQN A;  2EYF A;  3VYS A;  2C5C A;  1BR9 A;  4GZY C;  5G3L D;  4G4K A;  5EKK A;  3GO5 A;  1H9K A;  1PZI D;  4H7B A;  4FNF A;  1KLG D;  3K5L A;  5BN3 A;  4RA8 A;  1S4Z A;  1PZK D;  2IW3 A;  2B2U A;  4FXK C;  4A93 B;  1Y69 U;  2O5I C;  1GUT A;  1WTP A;  1RJT A;  1H9S B;  2OEO A;  2QKI C;  2RBM A;  2OXP A;  2SDF A;  3NUC A;  3OIP A;  4Q5V A;  3S1Q B;  1DJR D;  1D5X C;  1LT4 D;  1IL8 A;  3BG3 A;  3KF8 A;  2DNC A;  4M1U B;  4TSS A;  5AFW A;  3L3O C;  1PRT D;  2EVB A;  4KY7 A;  4DF7 A;  3TZD A;  3RUZ A;  1Q90 A;  1Z7T A;  2ICI A;  5M5Y B;  3D4D A;  5KEE A;  3K0Y A;  1WTV A;  1PDQ A;  5KRU A;  3V2T A;  5CV4 A;  2E2D C;  4K8J A;  4G7H C;  5BN5 A;  3J81 E;  3VR3 A;  1RKN A;  4DAP A;  4J1M A;  4C3I B;  3GTK B;  3ERO A;  5EPK A;  1EY5 A;  4CKB A;  3SHL A;  2ZT9 C;  1CI3 M;  2FJ2 A;  2XIW A;  3TP5 A;  1WCM B;  3H91 A;  3M3Y B;  3TZU A;  3Q6S A;  1O78 A;  1UAP A;  3KUP A;  2B8F A;  1F9Q A;  1KDB A;  1U4L A;  1TWG B;  5T1I A;  1QG7 A;  2ZXP A;  4OIJ A;  1JOQ A;  1ML0 D;  3H09 A;  3TP8 A;  3I70 A;  1EY6 A;  1HQR D;  5E3F A;  3R2T A;  3FKI B;  1SE3 A;  2MHV A;  2WKD A;  2O4X A;  1GUS A;  4LJZ C;  1D6E C;  1NR4 A;  1KAA A;  2PPB C;  5I9O A;  3VYR A;  1B1Z A;  2TSS A;  5I2X A;  3CRK C;  1AP0 A;  4ZK9 B;  1IYU A;  2B2W C;  1YNJ C;  1LV9 A;  5EPL A;  4F8M A;  4C3J B;  1SAP A;  1CFM A;  1E2V A;  1DCZ A;  2RDG A;  2F1M A;  2EJM A;  3OMC A;  2K5Q A;  1PRT F;  1EY9 A;  2FFK B;  2B8G A;  1TY0 A;  1I4R A;  1O7Y A;  5JEA G;  2A73 B;  4HTH A;  2EYO A;  2JA5 B;  1PXU A;  3PUW A;  5ELD A;  2YYZ A;  2HCC A;  1F2Z A;  2G9D A;  1STA A;  2PW5 A;  4EQP A;  1ZYR C;  4TKO B;  1U4P A;  3VR2 A;  3S17 B;  2XN9 C;  1QJO A;  5FLX E;  2EYM A;  2MUY A;  2QEJ C;  1PRT B;  5M3F B;  1PLF A;  3D31 A;  2AQ3 B;  4KJN A;  1BOS A;  2R6G A;  1SJH D;  4EGV A;  5C6A A;  3S14 B;  1STG A;  4BA2 I;  2E2J B;  1GJX A;  3K59 A;  5IGB A;  1WVL A;  1LTI D;  2B2U C;  1BCP D;  2EYH A;  1K8M A;  2C9O A;  2LS0 1;  2E74 C;  2MGS A;  3PUY A;  5JVH 3;  1STN A;  2F3V A;  4LMQ D;  4QF4 A;  2D5D A;  2F0W A;  1MSH A;  3FRP B;  2A68 D;  1D1I A;  1A15 A;  4XIG S;  1B53 A;  4X3K A;  4K14 A;  4NMZ A;  2EY2 A;  1SYC A;  2R92 B;  2PNR C;  3K57 A;  1EIH A;  1SMY C;  4UDU C;  3MXN A;  4ODG A;  2VUM B;  2FMM A;  4H44 C;  2KED A;  5DM7 3;  5M3M B;  1SE2 A;  4F87 A;  2NB0 A;  2HCI A;  1BDO A;  1VMP A;  1DD2 A;  3C2P A;  3S15 B;  4EQN A;  3A7A B;  4V19 0;  3GV3 A;  2IX0 A;  3JAM E;  3VA5 A;  2SNS A;  4Y7N B;  5EQ0 A;  3TN2 A;  1JWS D;  3BDC A;  4MN3 A;  3PIP 3;  2NN6 H;  1F77 A;  4IFD J;  1QCB D;  3K6O A;  2L12 A;  2Q8R E;  4O1N A;  4DAV A;  1DZ1 A;  3MVV A;  1STE A;  1WD1 A;  2Z1C A;  1GHJ A;  1KDA A;  5C4J B;  2LKV A;  2DNE A;  4IUP A;  4NKL A;  1B9N A;  5J22 A;  1WTX A;  4NW2 A;  4U67 3;  1U4R A;  3NK9 A;  4A3D B;  2BA1 A;  3WOE A;  3NBI A;  2XSC A;  4RHR A;  3MA2 B;  3RZD B;  4A3I B;  2BDN A;  4R9W A;  2R61 A;  3T4A C;  1JB3 A;  2Z4H A;  3H0G B;  2F0V A;  2F0G A;  1S5C D;  2MP1 A;  4XDX A;  2WII B;  4XTC S;  1GOZ A;  2RA4 A;  2Z4I A;  2IJ0 A;  4HCE A;  4QUC A;  3SEB A;  2EE1 A;  4XT3 B;  1STY A;  4BA1 I;  1H9J A;  1PFM A;  3I4M B;  4DXF A;  1X3Q A;  1S5B D;  2R93 B;  1WTQ A;  3M85 A;  4BS9 A;  1BQQ T;  2L9H A;  1PZJ D;  5T1G A;  2K5W A;  3OMG A;  2F0U A;  4MIU A;  1CT1 D;  1TS2 A;  1FD7 D;  2VXW A;  5LHY 1;  5D3D A;  3J80 E;  2PMZ B;  1JR0 D;  4N9T A;  2XRQ D;  4K5W A;  2BCO A;  1Y8P B;  4L8J A;  1XTC D;  2CHB D;  5COR A;  2KEC A;  2WKC A;  5C4H A;  1BNZ A;  1T5X D;  2CW0 D;  3QO2 A;  2L0C A;  1EYC A;  4PQX A;  2PCF B;  2EYL A;  2I46 A;  3NWT A;  1F2L A;  3EFX D;  1SE4 A;  3GTJ B;  4DXG A;  3E5S A;  4FVM A;  3TDQ A;  1NUC A;  4QCL A;  4KY6 A;  4KN7 C;  1GUW A;  2SOB A;  4A3E B;  5KYI A;  4ABN A;  4K2L A;  1TS3 A;  4RAU C;  1V1P B;  4BY1 B;  2A6H D;  2WB1 B;  2L4N A;  1EY0 A;  3U9O A;  1EIG A;  4CJ1 B;  1J8I A;  1ESF A;  5KNB A;  1C48 A;  2PZW A;  1H9R A;  1EY4 A;  1IKL A;  1I3Q B;  4RH6 A;  3P75 A;  4LK1 C;  2A69 D;  2HUG A;  1UEA B;  2DN8 A;  3NE5 B;  1D5M C;  1TR5 A;  1OXV A;  1D2B A;  1FNU A;  5K36 G;  4F7X A;  3D4R A;  1K8O A;  2WIN B;  1PFB A;  3K5N A;  3GTM B;  4KI0 A;  2JSO A;  2PZU A;  3PO2 B;  2EJF C;  4V0B A;  4OIK A;  2Y0S B;  1F9R A;  3DWP A;  1V43 A;  5KNC A;  1QNU A;  5KIX A;  1BCP F;  1RCV D;  5J1Z A;  1ZKO A;  1F9P A;  2KQ3 A;  4ZLT F;  1Q8I A;  3LNN A;  5KGU A;  1AN8 A;  4XXE A;  5JAV A;  4K8I A;  3H6M A;  1H9S A;  1LLR D;  4KV6 A;  3PUX A;  4FO2 A;  1E0B A;  4BBS B;  4QIW B;  2D2C C;  2M9V A;  1I6H B;  3I90 A;  3URY A;  1CQV A;  5D14 A;  5DM6 3;  2AUJ D;  2QDB A;  2PW7 A;  2EPB A;  3DHQ A;  4C3H B;  5DEH A;  1EY8 A;  2L11 A;  2CQA A;  1EYD A;  2QCP X;  1KNE A;  4PV1 C;  3OHX C;  3NPP A;  4QUF A;  2E76 C;  1X32 A;  2K6A A;  3MAQ A;  1YNN D;  2SNM A;  2E2I B;  5CV7 A;  1TS5 A;  2N88 A;  4L6T B;  3I91 A;  2RSN A;  1RTN A;  3W3A A;  5C3E B;  1SMY D;  3VR6 A;  2ICE C;  2F0M A;  1PTO D;  1YNN C;  1LT3 D;  2NVQ B;  2EY5 A;  2G9H D;  4L63 B;  4ZUI A;  1D5Z C;  2NZ1 D;  3GP7 A;  4XQJ A;  1B2T A;  3EVQ A;  4ZQ3 A;  1B9M A;  3FEW X;  3KLS X;  1LT5 D;  3CQZ B;  5A2Q E;  3OIQ A;  2K32 A;  5CV9 A;  5ELB A;  4J8Q A;  2EYP A;  1UNS A;  3MTS A;  5FO7 B;  1SNQ A;  3G6J B;  2PZT A;  4ULL A;  1SBB B;  1BXT A;  2F0Q A;  2IL8 A;  5D65 A;  3SK6 A;  1B50 A;  3LX0 A;  3NSW A;  2JA7 B;  2M2L A;  3VR5 A;  1CZW A;  4HR7 B;  3DUZ A;  4A3K B;  3G7L A;  5JVG 3;  2RQX A;  2QF7 A;  3IKJ A;  1SYG A;  2J0T D;  1M4V A;  4I65 A;  4K2K A;  1ENC A;  4IUU A;  3OWF A;  1BCP B;  1VF5 C;  1KTK A;  3N52 A;  2EJG C;  5C0X H;  4KMU C;  2NVY B;  4RCO A;  4PNY A;  5IGD A;  3GD7 A;  4X3U A;  2HQE A;  2F0L A;  2JP1 A;  5CR3 A;  3QOJ A;  4RWS C;  3DWA A;  3QOL A;  3HOX B;  1XWE A;  3HEJ A;  2KHS A;  1D1K A;  1SYB A;  2A69 C;  5CMD A;  4WRD A;  4C2M B;  1HCZ A;  1LAC A;  1PTO B;  1EEF D;  1H9M A;  5DNF A;  4RGO S;  2KVM A;  5CBE E;  1PFN A;  4OO1 I;  1DOK A;  4UAI A;  3OPO A;  1IW7 D;  1JE4 A;  2HDL A;  3FPU B;  1RD9 D;  5C4X B;  1IKM A;  1OXT A;  3A8I E;  1ICW A;  1EWC A;  1B3A A;  4C3J G;  1KNA A;  2NYZ D;  1BO0 A;  4M8A A;  1EY7 A;  1JCK B;  5C44 B;  5C5L A;  3BVM A;  4KJO A;  4DFA A;  2WV6 D;  4KKU A;  5HUR A;  5EKI A;  4B9W A;  2K33 A;  2MJ8 A;  4IFD H;  3SR1 A;  2NWG A;  4FP5 D;  3HOZ B;  3I3C A;  3HZX A;  1F2Y A;  1GUO A;  4C56 C;  1QE6 A;  1O7L A;  5K36 H;  4KHZ A;  2ZXO A;  4FXD A;  2VB3 X;  1PRT C;  5ELF A;  1G91 A;  2L1B A;  1RF2 D;  1T5E A;  2M00 A;  1AW7 A;  3SVM A;  3GV6 A;  4ZKB B;  1OXU A;  4RGN A;  5E4W C;  3K5O A;  3DM1 A;  4A3F B;  4IUT A;  4G7Z C;  5KYL A;  3C1F A;  5EGT A;  2YU9 B;  3MWY W;  2A5H A;  5JEA J;  2H1E A;  4G57 A;  3K5M A;  3F2U A;  3S16 B;  4OHJ A;  1S5E D;  1MD2 D;  2FMC A;  1ZXT A;  4TRD A;  5IOD A;  4IUV A;  1Q12 A;  1A2T A;  3R3O A;  4K6D A;  5JOB A;  3ONA B;  1JC7 A;  3RLF A;  3MXG A;  2PYK A;  3AU7 A;  1C4Q A;  2IX1 A;  1PTO F;  2F0D A;  1J9O A;  2E2H B;  3T56 B;  2R7Z B;  2LY7 A;  1EWH A;  3S1N B;  2JEA I;  3MFY A;  4IQZ A;  4XYO A;  4HSP A;  1LTA D;  4A3G B;  1WTO A;  4FYD A;  4I7Z C;  1Q3L A;  3ND9 A;  5CYU A;  5M5W B;  5C0X J;  1JIC A;  3Q23 A;  4PMC A;  3FMC A;  5J39 A;  1SSO A;  3CKI B;  5C0X G;  2F0N A;  3KBX A;  4CKC A;  1E2Z A;  2KCC A;  2F0H A;  1QIL A;  2Q8I B;  3A55 A;  4IFD I;  1RDP D;  2AWN A;  2X6L A;  3D6C A;  2RDF A;  3DEO A;  3I73 A;  3BYT B;  3E0J A;  2X6G A;  5I4D A;  2J4X A;  3NTH A;  1JOK A;  3J7A V;  4MHE A;  2SEB D;  4KY5 A;  5EPJ A;  1SJE D;  1S5F D;  2XWJ B;  2K04 A;  4DAY A;  2H4O A;  4DGZ A;  3BVG A;  1GUN A;  5CV8 A;  1G6Z A;  3MFG A;  5E4X A;  1TS4 A;  1HXY D;  3LWU A;  3V96 A;  3I72 A;  5CC4 A;  2WAQ B;  2B2V A;  3SK4 A;  1L0X B;  1HHV A;  2OT2 A;  3T16 A;  2KEE A;  1XXG A;  2NN6 G;  3MEH A;  2JEB I;  1ZEQ X;  5D3I B;  3A7L A;  1JWU D;  4WJW A;  5A2Q L;  2F0E A;  1NR2 A;  2NTT A;  4H13 C;  4ZUJ A;  4ZKC B;  1SNM A;  2V4D A;  1ILQ A;  4IFD G;  4FF4 A;  3M7G A;  4LAA A;  5LL6 X;  3D8G A;  1C8C A;  2JA6 B;  3RMH A;  3HOU B;  5NUC A;  4XT1 B;  2RSO A;  5CGK A;  2F0K A;  4P2C B;  2O5J C;  1BUV T;  5F2D A;  3BDO A;  3GTG B;  1U9R A;  1Y8O B;  2L55 A;  5I9P A;  1LTB D;  3Q22 A;  4B08 A;  2KUM A;  2B2W A;  3HG9 A;  5G3L F;  1LTG D;  4HMJ A;  4F88 A;  3A54 A;  1EZ6 A;  2BE5 C;  2KJX A;  2XRS D;  3SK5 A;  2RDH A;  4EQO A;  2WAC A;  3OSO A;  3QG1 A;  1ET9 A;  1FR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...