3TN2A

Structure analysis of mip1-beta p8a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
68
structure length
68
Chain Sequence
APMGSDPATACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords C-C motif chemokine 4
publication title Structures of human CCL18, CCL3, and CCL4 reveal molecular determinants for quaternary structures and sensitivity to insulin-degrading enzyme.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tn2A00
4IUUA 3IL8A 1NR2A 1U4RA 3I90A 3UI2A 2L1BA 1X32A 3ONAB 4IURA 1DOMA 4IUQA 1J9OA 2KECA 4MN3A 4R9WA 4RAUC 3GV6A 2Q8TA 5JJZA 4XT1B 1B4OA 2HDMA 2NYZD 1NCVA 2HCCA 4UAIA 3DEOA 4IUPA 2XIWA 3F2UA 5E4WC 3I8ZA 5EPJA 2R3ZA 1S4ZA 3SVMA 2K05A 1O7ZA 2L9HA 2MGSA 1QE6A 1VMCA 2MP1A 3DM1A 1BO0A 2B2YA 1PLFA 4XT3B 2L4NA 1XYIA 1C8CA 1DONA 4IUTA 1O7YA 4HCSA 1IL8A 1CA5A 3N52A 2X6LA 1F9RA 5T1IA 1E0BA 2EE1A 2NWGA 4MHEA 2L11A 1F2LA 2B2WC 1X3QA 2L12A 5D14A 5COYA 1RHPA 2K1BA 2RVLA 2K28A 2EPBA 3KBXA 1KNAA 5AFWA 3R93A 4ZKCB 4X3TA 3D6WA 3G7LA 4X3UA 1WTXA 1HRJA 3LWEA 1DZ1A 1G2SA 1SDFA 1B3AA 1TVXA 2HCIA 2JYOA 2B2UC 1HUMA 2RA4A 1X3PA 2N88A 2BDNA 2M2LA 1ICWA 1ZXTA 1IKMA 1Q3LA 1EIGA 4ZLTF 2KVMA 1U4MA 2MPMA 1JICA 1JE4A 2FMMA 1U4LA 1AP0A 2B2TA 5T1GA 1CM9A 1SAPA 1MI2A 2EOTA 1RTOA 2K01A 4ZKBB 1HFNA 1G2TA 1HUNA 2B2VC 2KUMA 1ILPA 2DY8A 1RTNA 1PFNA 1IKLA 1EOTA 1RJTA 1EQTA 1ML0D 2FFKB 3MTSA 3Q6SA 4O42A 4ZK9B 1WVLA 1BBXC 2HUGA 2N55A 5CBAE 2HDLA 1QNKA 2X6GA 4NW2A 3TZDA 3MWYW 4RWSC 1XX8A 2IL8A 1LV9A 2X69A 2DY7A 3KUPA 3DEPA 1F9SA 4XDXA 4LMQD 4DN4M 1B53A 1KNEA 1WTWA 3P7JA 5E4XA 1VMPA 2FJ2A 1PDQA 4X3SA 1WD1A 1WTPA 1F9QA 1O80A 2RSNA 1A15A 1WTRA 1HHVA 1WTQA 1MSHA 1B50A 1EIHA 3IFDA 2B2YC 3GV3A 2KEDA 1J8IA 5CBEE 2B2WA 2FHTA 4U68A 5EPLA 1CA6A 4HAEA 2K04A 4OIKA 5EJWA 1ILQA 2MJ8A 3I3CA 5EPKA 4R8IA 1DOLA 1G91A 4X3KA 5D65A 5DNFA 4OIJA 1WTOA 2FINB 1NR4A 1MGSA 2B2UA 4RA8A 1RODA 4CJ2C 1B2TA 1GUWA 3FPUB 3HP3A 4QUCA 1QG7A 1EL0A 3QO2A 1SSOA 2JP1A 2NZ1D 2RSOA 1WD0A 1AZQA 1PFMA 4ZAIA 2K03A 5EKIA 1BF4A 1G6ZA 2Q8RE 3TN2A 2VXWA 1WTVA 1ESRA 5EQ0A 5CMDA 3I91A 4CJ0B 2D9UA 1DOKA 2CVRA 3H91A 2KOLA 1U4PA 1NAPA 2B2VA 1HFGA 1M8AA 1MSGA 1AZPA 2SDFA 2J7ZA 2H1EA 4HSVA 4IUVA 4CJ1B 1F9PA 1BNZA 2B2TC 1HA6A 3FDTA 4HEDA 2KEEA 5CORA 1PFBA 4QUFA
chains in the Genus database with same CATH superfamily
2EYFA 4L6TB 2G9HD 4IFDJ 3VR5A 2EJFC 1NR2A 4BBRB 2WV6D 3ONAB 1DOMA 4DAMA 2EXZA 2TSSA 1BQQT 3TS0A 3EIVA 1GUNA 1O7IA 3M4OH 3X3MA 4UAIA 2CFMA 3KLWA 1S4ZA 1D2BA 4IPGA 1QE6A 4AQYL 5C0XI 1TWGH 2NVXB 5GROA 3NTKA 4BBRG 3T1HL 2UUAQ 1V1PA 2QEXA 2F0UA 1B70B 4UP8A 1PHJA 1XTCD 2NWGA 2O5IC 1PRTF 1T5XD 4LK1C 1X55A 2XWJB 2D0PA 2QDBA 4X3UA 1VQBA 3T13A 1VQ7A 1R4PB 4A3GB 1FGBD 5IY0A 1K73C 3FP9A 2F0KA 4A4IA 1IXRA 4XYQA 1U4LA 2IY5B 2KCNA 4WFN3 4DV0Q 1HR0L 4C1NK 3VYUA 4I7ZC 5L37A 2ALYB 2D5DA 4U673 4ZRZA 1EQTA 2KHIA 3HKSA 3HOZH 1K8OA 2RF4A 4A3GG 3P20A 4K2KA 1QNKA 2JA5H 2HQEA 3DXJC 1XTDA 5AJ3L 3CCLA 1VQLA 1YI2A 5LL6X 2BDOA 4G7ZC 5I6YA 2IT1A 5CV6A 4JW0A 1HNWL 1WYDA 1VQEA 1A6XA 3GTKH 2O4XA 4C1NI 4A3MG 1JCKB 3ULLA 1CTMA 1A0IA 1VF5C 1RL2A 1PTOB 1STNA 4TVAB 4A3KB 3S1QB 4FXDA 4ILWA 2K04A 2Q8IB 1NTGA 4HIKA 1GD7A 3TP7A 1WTOA 4K5VA 1VF7A 1VDZA 1M4VA 3OPOA 2YV5A 1EEFD 4A3KG 4R4TA 1G6ZA 3C1EA 3M7GA 3GTOH 4RHSA 5K36G 1EWIA 1GUSA 3W1GA 1VQKA 2CCZA 1S5ED 1X54A 3FHWA 4TKOB 5GADC 4A3BH 4JI8L 1QZGA 2B2TC 3K5LA 2XSCA 1HZ9A 2EYPA 1KDBA 3IL8A 3M3YB 2VB3X 1LTSD 4JI4Q 1J9OA 2UUCL 1ET6A 5JJZA 1NCVA 4PMCA 1EIFA 1F2ZA 1SMYD 2L9HA 2PNHA 3ND9A 3C3LA 4H02A 4KJOA 1BBUA 3N52A 4RG1A 5IGGA 1JB3A 1GHKA 5M5XB 1F9RA 1CUKA 1XMQL 4WJ4A 4JI7L 1NUCA 1D5XC 2LMCB 2QGQA 1XXGA 4FF1A 5COYA 2OCEA 3S2HH 5CR3A 5JPNC 2KHJA 1CFMA 3R93A 4DFAA 2JA6H 2NVYB 5IP7G 5IYBH 2RHSB 1VQ6A 4A3CH 1SYGA 1V9PA 2BDNA 4RHRA 3RZOH 5I2XA 3OTOL 4C3IB 4N9PA 4DNIA 4TQUS 3HOUH 1Q46A 2B2TA 4N9TA 2BA0A 3I72A 4RKLA 2EJGC 1STAA 1OXXK 2J0TD 4JI6L 3MZ5A 2A6HD 1RJTA 2JN4A 4DV7L 4C3IG 1BKBA 4JG2A 3HOWH 4RWSC 5M3MB 4A3FB 1X3GA 2L0CA 5IIFA 1WTWA 1KDAA 4QCLA 1I4QA 1SMXA 1PVOA 4P75A 2TMPA 5I9OA 1Y14B 4AYBE 1XNRL 3KDFB 5DAUA 5H1SE 5LMNQ 4ALPA 1CQFA 4A3FG 4K0KQ 5CBEE 4XYOA 4DR3Q 3N6RA 1HTLD 3S24A 1BCPD 5EJWA 4AYBB 1HNZL 1FYCA 3I3CA 1YHAA 4BBRH 1VQ5A 3U50C 2OXPA 4RA8A 3E0JA 1RCVD 1EL0A 1JT8A 4HJ5A 1SNQA 1SSOA 2KCMA 3TDQA 1WD0A 2HHHQ 1HR0W 1J5EL 1A63A 4AYBG 2NVXH 4IJLA 1YNJD 3S1NB 1QVFA 2KOLA 1EY6A 4NXNL 1YJNA 1NAPA 2H4OA 1B1ZA 5IGBA 4LF4Q 2SDFA 2H1EA 1QCBD 1SBBB 3SK8A 3WOFA 4IFDH 3NELA 4DR6Q 2XTIA 4JOIC 5ELBA 3H15A 1L0YB 3OYYA 1GUOA 5KNCA 3HZXA 3NBHA 5DLQE 4GOPB 4OEMB 2NYZD 1IHZA 5E4WC 4A3GH 2R92B 2EDGA 2XIWA 4DR4Q 2C35B 4FXGC 1I4PA 3E3XA 1G8ZD 1YHBA 1UAPA 4KMUC 4GOPC 4LFBL 4PQXA 2I0QA 3QB3A 1G51A 3J80c 1IL8A 4OX9L 2EYHA 5DM73 3HOYB 2Z6BA 2I46A 3VA7A 3OW2A 3TRZA 3BYTB 3KDFA 1E0BA 2L11A 1EFWA 3HOVB 2L12A 1GHJA 2XRSD 3P75A 2R92G 4QL5A 1CKNA 2LY7A 3D6WA 3K80C 3CC4A 4ABNA 4DXFA 4IN3A 5J1ZA 1E2WA 2DN8A 1B9MA 3CCUA 3HOYG 4KN4C 2AUJD 3HOVG 2Z4HA 1E2VA 3S14B 1ET9A 3KF8B 4EQ5A 1WOCA 1YEZA 2F0JA 3CCMA 1S40A 1PTOH 1CHQD 4ZKBB 1RTOA 5CYUA 4IOAA 3VR4A 3A0JA 5IP9G 1TWHH 2PZWA 5K36H 2BE5D 2ZTEA 2GA4B 3D31A 2GN5A 2N55A 5CBAE 1NBWA 2IJ0A 4NW2A 3UDGA 1ZYRD 5C3EB 2AQ3B 4JI5L 1LTGD 5CV8A 3CAMA 5M5YB 3P7JA 4LF5Q 1G6PA 1VQNA 3VYTA 4GOPA 2AQ1B 4BBSB 4IJHA 1WTRA 3KK7A 1CZWA 4DR1Q 2LKVA 2F03A 4NKLA 2RCNA 4H44C 1M1KC 2PW7A 5C0XG 1STEA 4QJFA 1N33L 3M3YH 1Y1VB 5EPKA 2CH4W 4PZ7A 5D65A 3T4AC 2YTYA 2F1MA 2F0VA 5K5PA 1AZQA 3K7AH 2JE6I 4P74A 4ZAIA 2WAQG 3F2CA 1YNND 2D62A 2ZTDA 5IP7H 1Y1VG 1LO5D 2JEBI 2NTTA 5M5XH 3RZDB 1PFBA 1TWCH 5HGTA 4B08A 2NVYH 1Y8OB 1GOZA 5IYCG 2JK8A 5DEHA 1IZ6A 1VQ4A 3PO3B 1JJ2A 3CRLC 1YHQA 4C3IH 3WDNA 4QMGA 3I8ZA 2F52A 2PNRC 4B3ML 4GLVB 1XNQL 1IYVA 4HIDA 2IW3A 4BY1G 2AHOB 1XYIA 2P5ZX 4IUTA 1S5DD 1XJVA 5E7NA 2GVBA 1EYGA 3U4ZA 3PO3G 5D14A 2UU9L 1JR0D 3MXNB 4HR7B 5M3MH 4A3FH 4DV1Q 1A2TA 3SR1A 3HEJA 1L0XB 3PGZA 3E5SA 4ME3A 2UXCL 1HUMA 2WACA 1EU4A 3K7UC 3PUZA 3T1YL 1SYEA 1JICA 1JE4A 1CQVA 1EY7A 1PH9A 2Z0SA 1UE7A 4X6AH 4OWXB 3R2TA 3RLNA 4BA1I 3KJOA 4POGA 5FO7B 1PFNA 4Y7NB 2XN9C 1TWAB 3Q6SA 5CV4A 1JWUD 4IOCA 4K5XA 1XX8A 1FR3A 1WJJA 4LUVA 3I56A 3DEPA 3NSWA 4GKKQ 1ASYA 5E4XA 1VQOA 5CV9A 2ATWA 3S1NH 3NQIA 5ELDA 1S72A 3LGJA 4DV2Q 1QILA 1MSHA 1LM0A 3IFDA 3BDLA 4JI2Q 3I4LA 3CHBD 2WINB 1L0WA 3L7ZC 1LT3D 4R8IA 4HJ8A 2UXBQ 2A68D 3MXNA 4PMWA 3MFYA 1V1OA 2R92H 1RDPD 4QGUA 1PFMA 2F4IA 5EKIA 1LACA 1BF4A 1PV4A 3GTMB 5CMDA 3PIOA 3HOYH 3GTJH 2KENA 5FO8B 2EQSA 4HSVA 3HOVH 3RNUA 4IUNA 4IUUA 1EY4A 4M1UB 3BJUA 3BU2A 3UDFA 4KHPQ 1DD2A 3HOZB 3BYYB 3NE5B 1TY2A 5KNBA 4MN3A 3R8BA 3SGIA 5IP9H 4JV5Q 3OIQA 1GKHA 2A74C 2HCCA 3DEOA 2K5DA 3S14H 4LUOA 3X3NA 3NK9A 2RCFA 2K05A 1VQFA 1KIXA 1XWEA 4G57A 3HOZG 2ZT9C 2NVQB 2F0EA 2KCCA 4HCEA 4BA2I 3A5ZB 1HA5A 1L1OB 4FXKC 2RVLA 2K5NA 5C3EH 1B7YB 3I2ZA 1K0SA 1Y69U 3A56A 4Z9CB 4DUYQ 3PIPA 3VR3A 1L1OC 3DWPA 2K7VA 5JJIA 2Q2UA 2F3WA 4BBSH 1SRUA 1L2FA 4A3DB 2AWOA 4O2DA 4LF7Q 4DAYB 4ULLA 5T1GA 4DKAC 2EOTA 4R4OA 2A69D 1Y1VH 5IT9L 1JB7A 1Q8IA 4O42A 4M8AA 2HDLA 2AMCB 5JEAJ 2KCTA 1OXTA 4X62L 5ELEA 2LSSA 3AB9A 3H3VC 5IYCH 3ND8A 3CMAA 4Y52H 5A2QL 2MHVA 3ERQA 4IO9A 3RZDH 3TQYA 2VQEL 2QF7A 2F0HA 3KLSX 1SNMA 4U68A 1FJGQ 3D3RA 3CCQA 3J80E 2MJ8A 2ID0A 2EY5A 4FVMA 1EQQA 2E5LQ 1HQMC 1WFQA 1NR4A 1HNXQ 3T16A 3BS1A 3PO3H 4CKBA 2QA4A 2R7FA 1R9TB 4DR2Q 2BOSA 5C4XB 2F4VQ 2F0DA 1BBWA 1QZHA 2K5QA 4RGMA 1AFPA 3E9HA 1V1PB 2JXMB 1EY5A 4LWCA 1QOHA 4J6HA 3I4MB 1K8GA 4DAYA 2OQ0A 1GUGA 1SJHD 1HA6A 3I4OA 4R4CA 5C4XG 1N34L 2KHSA 3B6YA 1N36L 4UP7A 4IUQA 1SE4A 2I5HA 2AWNA 3QG1A 1YIJA 4GKJL 2ASBA 3TP6A 3CF5A 1AE3A 4OO1H 2F0IA 4CDDC 1VMCA 3A8JE 5GAGC 1I4RA 2HIXA 4HIOA 4EX5A 1E2ZA 2JA8H 1VQJA 1YNXA 1BCPF 2X6LA 5CV7A 3OWFA 4DV6L 3R3OA 4Y7NH 1TWAH 2F0PA 3NUCA 5EKLA 1IBLQ 4YIJA 2N88A 3K57A 2Z1CA 2M2LA 4DV4L 3C46A 1XPOA 1PYSB 2CH4A 3QOLA 4GN3B 3CQZB 2MPMA 4OELB 2A73B 2FMMA 3HG9A 1YBYA 4DV5L 1FNVA 2K5WA 1MKHA 1G2TA 3CKIB 2DY8A 3J81i 2EYLA 1WVLA 2F3VA 4DGZA 2R7DA 3MWYW 1T9HA 1FNWA 2R61A 1SR3A 1F9SA 4G7OC 3EROA 3GTMH 5HURA 4B3SQ 1F9QA 4IFDG 1PH4A 1NSNS 3J81j 4LFAQ 1KQSA 2NVTB 3S9WA 1EY9A 1K3BC 2F0LA 2KEDA 1TU2B 4HAEA 4ZUIA 4MNOA 5EGTA 5CGKA 3CCJA 4E6IA 1H9MA 5KYLA 2PPBC 1CT1D 4DUZQ 1K28A 2FINB 3PIO3 1SE8A 4CJ2C 2UXDQ 1TY0A 1OTCA 3DWQA 1CSQA 1YVCA 1K0RA 2Q8RE 3KOJA 2BH2A 3S16B 3JAML 4X66Q 4HMIA 4CJ0B 2D9UA 5ISRA 5IWAQ 2F0MA 3AFPA 1EWHA 3HRZC 3KF6A 4L63B 3A7LA 2B3GA 2NVQH 3I7FA 4V190 2E2JB 3M4QA 4OWWB 1U4RA 1QB5D 1TWHB 1SMYC 4OXPA 1I94Q 5KRUA 4K0KL 3RUZA 3GV6A 1PZID 1UNSA 5BN5A 3JAMi 5EPJA 1IBML 1Q8KA 3TMEA 2R3ZA 4HJAA 4A3DH 3SE0A 3V96A 1PH3A 5F2DA 3CCSA 2MGSA 5I9PA 4PNYA 2MP1A 1TS3A 1EWCA 3RN5A 1ASZA 2YU9B 3PIP3 1QVGA 1VQ9A 3AFQA 5BN3A 2HHHL 4HJ9A 3TBIB 2K50A 4JI3Q 3NHHA 1RHPA 2Q2HA 4LF6L 3WWVA 4J15A 5JVG3 4QQBX 1HRJA 4OWTB 2Z6KC 3G4SA 2A6HC 3K7AB 1Q3LA 4ZLTF 1ENAA 4JK1C 2RDGA 4YWKA 4X65L 3DLLA 1HUNA 4DR4L 5IGDA 1Q86C 1DJRD 2IX3A 3GDEA 4X64L 2IX1A 1TWCB 1WTHA 4G7HC 4XQNA 5JJLA 1BCPB 4JI1L 1R9TH 1UE1A 2Q2TA 5C4XH 1E22A 1IBKL 2PQEA 1BCPC 4FO2A 3KBGA 2I5LX 1Y1WB 1CI3M 3MEFA 4FNFA 2KQ3A 4R4IA 1CZGA 5D3IB 3I4MH 1RIPA 4J1MA 4L8JA 2FHTA 3UE0A 4IALA 3OMCA 4B3RQ 3PUYA 1JORA 1YNJC 3KJPA 1DGSA 3NBHB 4KY7A 2Z6KA 4K6LA 1Y1WG 4QB4A 2DGYA 1HR0Q 2ZXOA 5I2YA 4R1JA 4L5QA 4RGNA 4UP9A 1KC8C 1F2YA 2VXWA 3I73A 3VYSA 2CVRA 1K3RA 4HMJA 5AJ3Q 1HFGA 4F88A 2J7ZA 4B9WA 5M3MG 1EY8A 4JCVE 2NZHA 3HOXB 1HNWQ 4K6DA 1CKNB 3D6CA 3C1FA 3A5UA 4LF9L 2N3SA 5JAVA 1LT5D 2VZAA 1LTID 2OQKA 2ZM6L 3U58A 3KYHC 3HOXG 3CQZH 4R8NA 1FNUA 3PQIA 4KHVA 3CCVA 2VL6A 5BN4A 2IX0A 1N9WA 3OHXC 2EE1A 4RKBA 1MIUA 4IPCA 1N32L 3U9SA 4NP5A 2PQAB 3J7A5 2CQOA 2R7ZB 4ODGA 2WP8J 5J22A 2K52A 4KI0A 4JI8Q 3DM3A 5IODA 4LF8L 5BR8L 2BE5C 4DR7L 3K5NA 2HD3A 1EIYB 5M5WB 2NVTH 2R7ZG 1ESFA 1ZYRC 2UUCQ 1JJGA 1RTNA 3GTJB 2VUMB 3FMCA 1V1QA 1EOTA 2EXDA 3J7AF 1PRTD 3QR8A 5IYDH 4ZK9B 2JQOA 1VS0A 1Q1EA 1HXYD 3H6MA 1LV9A 2H5XA 4A3LH 1XMQQ 1HZBA 4JI7Q 2MO0A 3S16H 1AEXA 1CKOA 4ZQ3A 1WTPA 4YCUA 2VY3A 4AH6A 1ENFA 3CCRA 1I6HB 1IW7C 2VQFL 2CWPA 2E2JH 4RH6A 2EY6A 5M3FB 1SXTA 5NUCA 2VB2X 1NMGA 2PZTA 1D8LA 3SK6A 1YNNC 4X3KA 2A19A 2DJFC 2A6ED 2PQAA 1GJXA 1MHWC 3D4DA 3HP3A 2OTLA 3QO2A 1PH2A 3I70A 5M3FG 4JI6Q 1A8VA 2K5VA 1JMCA 2EIFA 2ZJPA 4DV7Q 3E0EA 1TXYA 2QEJC 3OSOA 2YU9H 3MEHA 1MSGA 1NNXA 2PO4A 4CBVA 5C3EG 4IUVA 4LFCQ 2UUBL 1XMOL 4JI0L 3IRBA 3CRKC 3F2DA 2PI2A 4IPDA 5GAHC 1QWYA 4KHZA 4KKSA 4EQPA 2F0NA 2PMZE 4BBSG 1IW7D 2Z4IA 4R9WA 5IGCA 1XNRQ 3FKIB 1HNZQ 2KA7A 4IUPA 3Q23A 2PMZB 3DM1A 4JPBW 4GZYC 5C44B 5T1IA 4KKUA 1FD7D 1HTPA 2SOBA 3PCOB 3PUXA 4MZ9A 4O1NA 3FKIG 2ENBA 2DUDA 1B3QA 2SEBD 1BUVT 2EZVA 1X6OA 4QIWE 1WTXA 1G291 4DK6C 3H0GB 1HCZA 3LWEA 2AUKA 1PYWD 2F0FA 3PV0A 4QIWB 1D7QA 3TEHB 4IFDI 4RFBA 4V0BA 4POFA 5A35A 1Y1WH 4KHPL 2B39A 4DR5Q 5LMUQ 2F0WA 2B2VC 2KUMA 4CGYB 1BXTA 1LYLA 2B29A 4KK7A 1HZAA 1S5FD 2FFKB 1PH1A 3ULJA 3URYA 1SFOB 2NZOA 3CCEA 3EBEA 2L15A 1X65A 3J7YW 4LFBQ 3BG3A 2ZJRA 4DV3Q 4H0LC 4OX9Q 2XWBB 3GD7A 4DN4M 1Q7YC 4X3SA 5C4ZA 1WD1A 1I3QB 3D4RA 3W1BA 4A3IB 1HHVA 4C2MB 4NXML 1WTQA 1YJWA 1K9MC 2A68C 2KBNA 3QOJA 1IL2A 4FP5D 3HOXH 1STHA 4N8X1 1CA6A 3A8KE 2JA8B 3ZYYX 4GN4B 3R2IA 1DOLA 3A8IE 2I5MX 3MFGA 2J4XA 4A3IG 4LF7L 1MGSA 4OO1G 3P1HA 5G3LD 3OWEB 4S3SA 1XPRA 4FF2A 3S15B 1DXMA 3VA5A 2JA8G 4K8IA 2PYKA 1DOKA 2E2IB 4JI5Q 2JA7B 2B2VA 3CXCA 1VQPA 1H9KA 1HQRD 4HEDA 1DM0B 1F2LA 3LWUA 1KABA 2R7ZH 1X32A 3G6EA 2XNAC 3K0YA 2YTVA 1AH9A 2JA7G 1Z9FA 2Q8TA 2EYMA 1FJGL 3KLSA 5FLXL 1B4OA 2HDMA 2Q2IA 4KD3A 1PYBA 5M5WH 3J7ZC 1HNXL 2DJGC 1DONA 3MHBA 3NWTA 2IHFA 2CWAA 2KJXA 1TWFH 2VUMH 1HZCA 2O2LD 1C9OA 5KNDA 3TZUA 4B3TL 4RMFA 2QILA 5AFWA 2IHEA 1VQCA 2EJMA 4HTHA 2CW0D 1B3AA 2JYOA 1U5KA 1BOSA 3M85A 3AEVA 2A69C 1OXSC 5JJKA 1A3TA 1J6QA 3V05A 2WFWA 1I6HH 2VS1A 3DUZA 5M3FH 1CM9A 1C48A 4APVA 1S5BD 1KL9A 2G9DA 3EFXD 3SXHA 5CV5A 1TS4A 3CC7A 4B3MQ 1VQHA 2X6GA 1PA6A 1PFSA 2OEOA 2BH8A 3QWNA 4BS9A 2DY7A 2D0OA 4GNXA 5FK9C 2WB1E 4DAPA 3AYHB 1PDQA 2L55A 3GTGB 1SN8A 2RDFA 3K5MA 3GP7A 2QCPX 1GUTA 4A3JB 2WB1B 4NB3A 1EIHA 3MVVA 2DNEA 3H09A 2UXCQ 5ELFA 3NEMA 1KTKA 4NDXA 1ILQA 2YYZA 4YHHQ 3Q24A 4WJWA 3T1YQ 4JBJA 3T51B 5DNFA 4CDCC 1F2MA 2UUAL 4A3DG 3RN2A 4A3JG 2WB1G 4P71A 3OOCA 3FKIH 1QG7A 4K5WA 3U4VA 3L0OA 1TKWB 1Q82C 1X9NA 5C4JB 1ESRA 1SYCA 1KXLA 4I7AA 2LXJA 4WJ3M 1A3UA 5C44H 5KYIA 4LUZA 4A75A 1O78A 3D0FA 4CJ1B 4JYAQ 1LABA 5FLXc 5EBCA 1JWSD 3FRPB 4ZCKA 3MAQA 4PMBA 2V1CC 4B3SL 1IYUA 1HPCA 1EZ8A 3H0GH 2KECA 2PZUA 2JEAI 1A3VA 4DV0L 4RAUC 3BVGA 5IE8A 2LFNA 2WIIB 2D2CC 1IKMA 2M9VA 2RDHA 1II3A 1SNDA 4HN7A 2BA1A 4LJZC 5C5MA 4DNTB 1C8CA 1O7YA 3HS0C 1KD1C 2A1AA 3BZKA 4MHEA 1KDCA 5JEAG 3RLFA 3CPWA 3STBD 1SFOH 5IWAL 4NPSA 3TSSA 4ZKCB 2CHBD 4KY5A 1NE3A 3L3OC 4CHTB 2F0OA 1W6KA 4L5SA 2HCIA 1VQIA 1OXVA 3I4MG 1I3QH 3D8GA 4OL7A 4RCOA 4A3IH 2E75C 1EIGA 4C2MH 4CKCA 2FMCA 1D5MC 1ICFB 1ZEQX 2K33A 3VR2A 3TP5A 1UEBA 2V4DA 1W2BA 4DNRB 2IWHA 3HGBA 1IKLA 5E1FA 2A8VA 3MTSA 2FXQA 5KGUA 3NQTA 1P16A 3TZDA 4JBMA 1EYAA 3J81L 1N8RC 3M9BA 4Q0FA 4GN5A 1Q1BA 4G4KA 1NJIC 3SEBA 3S15H 3ERSX 1SLJA 2EYOA 1KRSA 5IT9c 3GTLB 3KF6B 3E6ZX 2E2IH 1QUQA 3A55A 2JA7H 2B63B 4JI4L 2B2YC 4F7XA 1MD2D 1AN8A 5EPLA 1LTBD 1EQRA 4WRDA 2EVBA 3F2BA 2B63G 3S17B 1I4XA 1GUWA 4QUCA 4QY7A 4OGQC 4P73A 2R6GA 2MQHA 4KV6A 5M9OA 3ZJYC 1WTVA 1IYJB 2JSOA 1U0LA 3I91A 1H9SB 3IFTA 3FEWX 4RGOS 3H91A 2E76C 5GAEC 4DAVA 1KLUD 1AZPA 2OT2A 4X62Q 1BNZA 3GTQB 2OWOA 2LS01 2BCOA 3K58A 3I90A 1Z6HA 2XGTA 3RLOA 4EGVA 1M90C 2A5HA 1SYBA 3BDOA 1OXUA 1A62A 2VQEQ 5FLMH 1Q12A 4XT1B 4B3RL 3F2UA 3NP8A 5TSSA 3SVMA 5KIXA 3OW7A 2AQ2B 4XT3B 2B2YA 4I65A 2L4NA 4HCSA 5IYDG 3TP8A 2F0QA 1MJCA 1V8QA 1PH6A 4A3MB 5JVH3 1DYQA 4A3LG 2K28A 2OTJA 3KLRA 5LMNL 5FOBB 1SDFA 4DR3L 1X3PA 2RKSA 3GTGH 4RGTA 3ITPA 1N34Q 4YY3Q 1B8AA 4Q5VA 4A3JH 1HH2P 1N36Q 3GTPB 4UY8C 3J81c 3RMHA 1H9SA 1WCMB 4GKJQ 1Y8PB 2LXKA 3H94A 4TRDA 1PTOC 4ID6A 4OO1I 3PF5A 3H3VH 5IOCA 1YITA 4LF4L 1SE3A 3KUPA 2HIVA 1K83B 4BXXH 4DV6Q 4YWMA 3M4YA 1WCMG 2FJ2A 5C4JH 1WI5A 4DR6L 4UDUC 4DXGA 3T56B 2RQXA 3C2PA 3NPPA 1J8IA 3J7AV 4DV4Q 1UUPA 1FGUA 2ICIA 3G48A 2F0SA 4N8FA 3CU7A 4AQYQ 2CQAA 2N49A 3F1ZA 3MXPA 4BWGB 4DK0A 4DV5Q 3T1HQ 5JEAH 2MFIA 1LTTD 1PXUA 1Z7TA 1I5FA 1KAWA 3TN2A 1PTOD 5C5LA 4A76A 5EAYA 4AIMA 2K14A 5J3BA 4DA2A 5ELOA 1F9PA 1LTRD 3NXWA 4OIJA 1JOKA 4PZ8A 3AU7A 3LX0A 3S1RB 3JAMc 1X56A 1VQGA 3J80L 2DNCA 4WORA 1YJ9A 1E3PA 1AW7A 1RD9D 2IPKD 1PLFA 5ELNA 3EQLC 3BZCA 4JVZA 2K32A 4C3HB 1V43A 3ER0A 3BVMA 2NUCA 3SK5A 4LF5L 1BVSA 1VQAA 2Z9HA 3J80i 3Q8DA 2K6AA 4DK1A 3SHLA 2F0GA 3KBXA 1SYDA 2QKIC 4IPHA 2EY2A 3G6JB 5G3LF 4DR1L 2Y0SE 1I50B 1EYCA 4YCVA 4LFCL 1PRTB 1HJPA 4C3HG 2RA4A 1GXDC 1E7ZA 3GTLH 3PMFA 3SK4A 1SNOA 1ZXTA 2Y0SB 3L9AX 2B63H 1PRTC 2O5JC 4ME5A 1SNPA 3MA2B 4ZUJA 2XRQD 3CC2A 4GLAC 1IBMQ 4L5RC 1C4QA 3I4NB 3WOEA 2R93B 2Y0SG 5FLXE 3S17H 1SYFA 4XQJA 2SNMA 1T5EA 2IL8A 3PF4A 2L5TA 1STBA 1LT6D 1B53A 2B8FA 3ULPA 4CKEA 3CMEA 2JA9A 4KN7C 1I4HA 5EBDA 4LF6Q 3I4NG 2PI2E 5D3DA 2R93G 1D5ZC 2ZJQA 3H3VI 3EN2A 3UDXA 3NWSA 2A6EC 5E3FA 3GTQH 1RF2D 4IZ8A 4A3EB 3SDZA 4HJ7A 5LMNW 4C3JB 1TWFB 3PUVA 2MNAA 4UHVA 4IQZA 4DR5L 5LMUL 3EA6A 3VR6A 5CC4A 3I55A 1B2TA 1GVPA 4HIMA 1UEAB 3FPUB 4MIUA 4X65Q 3BZDB 1CSPA 2QDLA 1TR5A 4A3EG 2NTSA 4X64Q 4NMZA 2ZTCA 4C3JG 2VUMG 4DV1L 2E2DC 5IGEA 4JI1Q 4DV3L 3PUWA 1M8AA 1H9JA 1JC7A 2OF1A 1IBKQ 4A3MH 3LNNA 4PG3A 2PW5A 3OTOQ 1TS5A 1KLGD 4IURA 5C0XJ 1AE2A 4CDEC 1LTAD 2EY1A 2NN6G 1RKNA 4RCNA 3GTPH 4XQQA 1O7ZA 4UPAA 3S1QH 4A3KH 2N78A 5IT9E 4P2CB 1WCMH 1CA5A 4PZ6A 3HFZB 4JOIA 4GKKL 3V2TA 1PZKD 2C9OA 2ICEC 3TREA 1JWMD 1EUJA 4DV2L 1K83H 3QJYA 4QF4A 4JI2L 4A93B 5A2QE 1TVXA 1SE2A 4BY7B 4KD4A 1PH5A 1ICWA 3S2DB 1LTLA 3TS2A 3FVQA 2WAQE 2KVMA 4LF9Q 2ES2A 2E2HB 2UXBL 1W3SA 3S1MB 2NBFA 1CKMA 5JOBA 1HFNA 3MXGA 2WAQB 4XIGS 4A93G 2ZM6Q 1ILPA 1S5CD 2K75A 1H95A 1O7LA 4BY7G 4DU9A 1ML0D 2F0TA 3W2DA 1J5EQ 5IGFA 1BBXC 2HUGA 1TT2A 2B8GA 1D1IA 1K8AC 4J8QA 4NXNQ 1EZ6A 4KLKA 5LL6S 4XDXA 4LMQD 4B9XA 3BDCA 1KNEA 2M00A 5C44G 1UE6A 4EVOA 1N32Q 1ZKOA 1O80A 3PO2B 3KF8A 5FO9B 2I07B 3E9IA 4LAAA 2HT1A 3GV3A 4JV5L 4KTAA 1E24A 3H0GG 4KKTA 1STYA 1NY4A 3S1RH 4LF8Q 4BY1B 5BR8Q 1NMFA 2C5CA 1BDOA 4DR7Q 3PO2G 1GM5A 1CK1A 1RODA 4TSSA 1EOVA 3OMGA 4YWLA 2RSOA 3AMUA 2E8GA 3D4WA 3DWAA 3EVQA 5EQ0A 3U9OA 1PH7A 4C3HH 3GO5A 5I6WA 3GQBA 4DUYL 1R4QB 1CHPD 1UE5A 1KRTA 3J81E 2K4KA 2E74C 4R4QA 4YCWA 5HGQA 5C4HA 3NTHA 1I50H 3FPPA 1JQYD 2RHQB 1ENCA 1KAAA 1TIID 2VQFQ 5I4DA 1GO3E 5CORA 4EQOA 4YHHL 5GQOA 1TS2A 3PSIA 1QVCA 3CP0A 4K8JA 3K59A 4OONA 3M7NA 2CW0C 1U9RA 2ZXRA 2N8NA 3I4NH 2R93H 3A54A 3VDYA 2K1BA 1Q81C 1KNAA 1I4GA 4GNXB 1LT4D 4KJNA 4K14A 5FJ8G 4JYAL 1PZJD 1TQOA 2B2UC 3A7AB 1W6JA 4O0AA 1XMOQ 2UUBQ 3W5OA 3M4OB 4JI0Q 1N33Q 2MO1A 4GNXC 2NB0A 1E1TA 1U4MA 3DMUA 2E5LL 3NBIA 1EU3A 1TWGB 1SAPA 3AQQA 1LLRD 4A3EH 4DR2L 1X3EA 4JBKA 4P72A 3UDIA 4C3JH 2F4VL 2WKDA 3M4PA 2PCFB 4H13C 2F3IA 4FF4A 1VQMA 3K8AA 4L5TA 1YZ6A 3K0XA 1P8LA 3EJIA 1DCZA 3JAME 1UWVA 4GLXA 3K6OA 1LUZA 4ZYSA 1MJEA 1VMPA 4JBWA 4MTKA 1JE5A 2QW7A 1A15A 4F87A 2NN6H 3Q22A 2VW9A 4KY6A 1B50A 2VNUD 1SJED 4DPGA 1MBYA 1A2UA 3HKZE 3G71A 5FLMG 3O13A 1SNCA 1G91A 1XNQQ 4GS3A 1XPUA 4XXEA 2B2UA 2JA5B 3HKZB 4F8MA 1OO9B 1EYDA 1EFID 1F77A 2K03A 2AKWB 5FKAC 1SEBD 2UU9Q 5JPMC 3GTKB 3F8TA 3MC0B 4DF7A 1JJCB 1I6VC 2JA5G 3OIPA 1IBLL 3HKZG 3Q0AA 3K5OA 2KEEA 4QUFA 1JOOA 1C7YA 5C6AA 3UI2A 2XVSA 2L1BA 4DK3C 5C0XH 4NXMQ 5LHY1 4A93H 5M5YH 2HQLA 4FDBA 4BY7H 4C56C 1Z47A 1FVIA 1D6EC 3S2DH 1PMRA 2E2HH 4LNQA 3STBC 5ELCA 3CW2C 3S1MH 2GVAA 4CDFC 3GTOB 1BO0A 4FYDA 1QNUA 4A3BB 1H9RA 2G5DA 1B9NA 1VCIA 2B2WC 2WKCA 1X3QA 1C0AA 3IAYA 2EYJA 4BXXG 1K8MA 2EPBA 3L2PA 3ICEA 4X3TA 3G7LA 5HY6A 4EQNA 4LFAL 3UE1A 1EY0A 4HSPA 1DZ1A 1G2SA 2CKZB 5C3WA 2JJQA 3NENA 1JOQA 1PTOF 2RBMA 4A3BG 3QIAA 1QUQB 3PO2H 3CPFA 1ONLA 3T53B 4DUZL 1AP0A 3IKJA 3BVZA 2Z8LA 4K2LA 1MI2A 3RD4A 2K01A 2UXDL 3VYRA 4BY1H 5J39A 1SROA 4PV1C 3K81C 4X66L 1PH8A 3KFUA 3S2HB 1BR9A 3W3AA 1L1OA 4OHJA 4MTNA 1VQDA 2JA6B 3CD6A 2X69A 4B3TQ 3DHQA 2K5HA 5C3XA 3RZOB 1B44D 2RSNA 1I94L 3HOUB 4XTCS 2JA6G 4JC0A 2B2WA 5IYBG 3MXUA 4OIKA 4A3CG 1VQ8A 3JC66 4YY3L 4LW1A 2NN6I 3A74A 2MUYA 1E1OA 2YTXA 3HOWB 3HOUG 3NTIA 4FF3A 5DM63 4H7BA 2JP1A 2NZ1D 5KEEA 1QJOA 1EEID 4JI3L 1X3FA 1D1KA 1Q90A 5FJ8H 5EKKA 1Y8NB 1S3OA 1U4PA 1KHIA 2ZXPA 1FL0A 1EQVA 2SNSA 3RR5A 3HOWG 1STGA 3FDTA
chains in the Genus database with same CATH topology
2EYFA 4L6TB 2G9HD 4IFDJ 3VR5A 2EJFC 1NR2A 4BBRB 2WV6D 3ONAB 1DOMA 2EXZA 2TSSA 1BQQT 1GUNA 3X3MA 4UAIA 1S4ZA 1D2BA 1QE6A 2NVXB 5C0XI 3NTKA 1V1PA 2F0UA 1XTCD 2NWGA 2O5IC 1PRTF 1T5XD 4LK1C 2XWJB 2QDBA 4X3UA 3T13A 1R4PB 4A3GB 1FGBD 2F0KA 4XYQA 1U4LA 2KCNA 4WFN3 4C1NK 3VYUA 4I7ZC 2D5DA 4U673 4ZRZA 1EQTA 1K8OA 3P20A 4K2KA 1QNKA 2HQEA 3DXJC 5LL6X 2BDOA 4G7ZC 5I6YA 2IT1A 5CV6A 1A6XA 2O4XA 4C1NI 1JCKB 1CTMA 1VF5C 1PTOB 1STNA 4A3KB 3S1QB 4FXDA 4ILWA 2K04A 2Q8IB 3TP7A 1WTOA 4K5VA 1VF7A 1VDZA 1M4VA 3OPOA 1EEFD 1G6ZA 3C1EA 3M7GA 4RHSA 5K36G 1GUSA 1S5ED 4TKOB 2B2TC 3K5LA 2XSCA 2EYPA 1KDBA 3IL8A 3M3YB 2VB3X 1LTSD 1J9OA 1ET6A 5JJZA 1NCVA 4PMCA 1F2ZA 1SMYD 2L9HA 3ND9A 3C3LA 4KJOA 3N52A 5IGGA 1JB3A 1GHKA 5M5XB 1F9RA 1NUCA 1D5XC 2LMCB 1XXGA 4FF1A 5COYA 5CR3A 5JPNC 1CFMA 3R93A 4DFAA 2NVYB 1SYGA 2BDNA 4RHRA 5I2XA 4C3IB 4N9PA 4TQUS 2B2TA 4N9TA 2BA0A 3I72A 4RKLA 2EJGC 1STAA 1OXXK 2J0TD 3MZ5A 2A6HD 1RJTA 4C3IG 4RWSC 5M3MB 4A3FB 2L0CA 5IIFA 1WTWA 1KDAA 4QCLA 1I4QA 2TMPA 5I9OA 5DAUA 1CQFA 5CBEE 4XYOA 3N6RA 1HTLD 1BCPD 5EJWA 4AYBB 1FYCA 3I3CA 2OXPA 4RA8A 3E0JA 1RCVD 1EL0A 1SNQA 1SSOA 3TDQA 1WD0A 1YNJD 3S1NB 2KOLA 1EY6A 1NAPA 2H4OA 1B1ZA 5IGBA 2SDFA 2H1EA 1QCBD 1SBBB 3SK8A 3WOFA 4IFDH 5ELBA 1L0YB 1GUOA 5KNCA 3HZXA 3NBHA 5E4WC 2NYZD 1IHZA 2R92B 2EDGA 2XIWA 4FXGC 1I4PA 1G8ZD 1UAPA 4KMUC 4PQXA 3QB3A 1IL8A 2EYHA 5DM73 3HOYB 2I46A 3VA7A 3BYTB 1E0BA 2L11A 3HOVB 2L12A 1GHJA 2XRSD 3P75A 2LY7A 3D6WA 4ABNA 4DXFA 4IN3A 5J1ZA 1E2WA 2DN8A 1B9MA 4KN4C 2AUJD 2Z4HA 1E2VA 3S14B 1ET9A 2F0JA 1PTOH 1CHQD 4ZKBB 1RTOA 5CYUA 3VR4A 2PZWA 5K36H 2BE5D 2GA4B 3D31A 2N55A 5CBAE 2IJ0A 4NW2A 1ZYRD 5C3EB 2AQ3B 1LTGD 5CV8A 5M5YB 3P7JA 3VYTA 2AQ1B 4BBSB 1WTRA 3KK7A 1CZWA 2LKVA 2F03A 4NKLA 4H44C 2PW7A 5C0XG 1STEA 1Y1VB 5EPKA 5D65A 3T4AC 2F1MA 2F0VA 5K5PA 1AZQA 2JE6I 4ZAIA 1YNND 2D62A 1LO5D 2JEBI 2NTTA 3RZDB 1PFBA 5HGTA 4B08A 1Y8OB 1GOZA 5DEHA 3PO3B 3CRLC 3WDNA 4QMGA 3I8ZA 2PNRC 1IYVA 2IW3A 1XYIA 4IUTA 1S5DD 5D14A 1JR0D 4HR7B 1A2TA 3SR1A 3HEJA 1L0XB 3E5SA 1HUMA 2WACA 1EU4A 3PUZA 1SYEA 1JICA 1JE4A 1CQVA 1EY7A 3R2TA 4BA1I 5FO7B 1PFNA 4Y7NB 2XN9C 1TWAB 3Q6SA 5CV4A 1JWUD 4K5XA 1XX8A 1FR3A 3DEPA 3NSWA 5E4XA 5CV9A 3NQIA 5ELDA 1QILA 1MSHA 3IFDA 3BDLA 3I4LA 3CHBD 2WINB 3L7ZC 1LT3D 4R8IA 2A68D 3MXNA 4PMWA 3MFYA 1V1OA 1RDPD 1PFMA 2F4IA 5EKIA 1LACA 1BF4A 3GTMB 5CMDA 5FO8B 4HSVA 4IUNA 4IUUA 1EY4A 4M1UB 1DD2A 3HOZB 3BYYB 3NE5B 1TY2A 5KNBA 4MN3A 3R8BA 3OIQA 2A74C 2HCCA 3DEOA 2K5DA 3X3NA 3NK9A 2K05A 1XWEA 4G57A 2ZT9C 2NVQB 2F0EA 2KCCA 4HCEA 4BA2I 1HA5A 4FXKC 2RVLA 1Y69U 3A56A 4Z9CB 3VR3A 3DWPA 2K7VA 2F3WA 4A3DB 2AWOA 4ULLA 5T1GA 2EOTA 2A69D 5IT9L 1Q8IA 4O42A 4M8AA 2HDLA 5JEAJ 1OXTA 5ELEA 3AB9A 3H3VC 3ND8A 5A2QL 2MHVA 3ERQA 2QF7A 2F0HA 3KLSX 1SNMA 4U68A 3D3RA 3J80E 2MJ8A 2ID0A 2EY5A 4FVMA 1HQMC 1NR4A 3T16A 3BS1A 4CKBA 1R9TB 2BOSA 5C4XB 2F0DA 2K5QA 4RGMA 1AFPA 1V1PB 2JXMB 1EY5A 1QOHA 4J6HA 3I4MB 1HA6A 4DAYA 1GUGA 1SJHD 2KHSA 4IUQA 1SE4A 2AWNA 3QG1A 3TP6A 4OO1H 2F0IA 1VMCA 3A8JE 1I4RA 1E2ZA 1BCPF 2X6LA 5CV7A 3OWFA 3R3OA 2F0PA 3NUCA 5EKLA 4YIJA 2N88A 3K57A 2Z1CA 2M2LA 3C46A 3QOLA 3CQZB 2MPMA 2A73B 2FMMA 3HG9A 1FNVA 2K5WA 1G2TA 3CKIB 2DY8A 2EYLA 1WVLA 2F3VA 4DGZA 3MWYW 1FNWA 2R61A 1F9SA 4G7OC 3EROA 5HURA 1F9QA 4IFDG 1NSNS 2NVTB 3S9WA 1EY9A 2F0LA 2KEDA 1TU2B 4HAEA 4ZUIA 5EGTA 5CGKA 4E6IA 1H9MA 5KYLA 2PPBC 1CT1D 3PIO3 2FINB 4CJ2C 1TY0A 3DWQA 2Q8RE 3S16B 3JAML 4HMIA 4CJ0B 2D9UA 5ISRA 2F0MA 1EWHA 3HRZC 4L63B 3A7LA 4V190 2E2JB 1U4RA 1QB5D 1TWHB 1SMYC 5KRUA 3RUZA 3GV6A 1PZID 1UNSA 5BN5A 5EPJA 3TMEA 2R3ZA 3SE0A 3V96A 5F2DA 2MGSA 5I9PA 4PNYA 2MP1A 1TS3A 1EWCA 2YU9B 3PIP3 5BN3A 3TBIB 3NHHA 1RHPA 5JVG3 1HRJA 2A6HC 1Q3LA 3K7AB 4ZLTF 1ENAA 4JK1C 2RDGA 1HUNA 5IGDA 1DJRD 2IX3A 2IX1A 1TWCB 4G7HC 4XQNA 1BCPB 2PQEA 1BCPC 4FO2A 3KBGA 1Y1WB 1CI3M 4FNFA 2KQ3A 1CZGA 5D3IB 4J1MA 4L8JA 2FHTA 4IALA 3OMCA 3PUYA 1JORA 1YNJC 4KY7A 4K6LA 4QB4A 2ZXOA 5I2YA 4RGNA 1F2YA 2VXWA 3I73A 3VYSA 2CVRA 4HMJA 1HFGA 4F88A 2J7ZA 4B9WA 1EY8A 3HOXB 4K6DA 3D6CA 3C1FA 5JAVA 1LT5D 1LTID 4R8NA 1FNUA 4KHVA 5BN4A 2IX0A 3OHXC 2EE1A 4RKBA 3U9SA 4NP5A 2R7ZB 4ODGA 2WP8J 5J22A 4KI0A 5IODA 2BE5C 3K5NA 5M5WB 1ESFA 1ZYRC 1RTNA 3GTJB 2VUMB 3FMCA 1EOTA 3J7AF 1PRTD 4ZK9B 1Q1EA 1HXYD 3H6MA 1LV9A 1AEXA 4ZQ3A 1WTPA 1ENFA 1I6HB 1IW7C 4RH6A 2EY6A 5M3FB 1SXTA 5NUCA 2VB2X 2PZTA 3SK6A 1YNNC 4X3KA 2A6ED 1GJXA 3D4DA 3HP3A 3QO2A 3I70A 2QEJC 3OSOA 3MEHA 1MSGA 2PO4A 4CBVA 4IUVA 3CRKC 1QWYA 4KHZA 4KKSA 4EQPA 2F0NA 1IW7D 2Z4IA 4R9WA 5IGCA 3FKIB 2KA7A 4IUPA 3Q23A 2PMZB 3DM1A 4GZYC 5C44B 5T1IA 4KKUA 1FD7D 1HTPA 2SOBA 3PUXA 4O1NA 2ENBA 2SEBD 1BUVT 2EZVA 1WTXA 1G291 3H0GB 1HCZA 3LWEA 2AUKA 1PYWD 2F0FA 3PV0A 4QIWB 4IFDI 4RFBA 4V0BA 5A35A 2B39A 2F0WA 2B2VC 2KUMA 4CGYB 1BXTA 4KK7A 1S5FD 2FFKB 3URYA 1SFOB 3J7YW 3BG3A 4H0LC 2XWBB 3GD7A 4DN4M 4X3SA 5C4ZA 1WD1A 1I3QB 3D4RA 4A3IB 1HHVA 4C2MB 1WTQA 2A68C 3QOJA 4FP5D 1STHA 1CA6A 3A8KE 2JA8B 3ZYYX 3R2IA 1DOLA 3A8IE 3MFGA 2J4XA 1MGSA 4OO1G 3P1HA 5G3LD 3OWEB 4S3SA 4FF2A 3S15B 1DXMA 3VA5A 4K8IA 2PYKA 1DOKA 2E2IB 2JA7B 2B2VA 1H9KA 1HQRD 4HEDA 1DM0B 1F2LA 3LWUA 1KABA 1X32A 2XNAC 3K0YA 2Q8TA 2EYMA 3KLSA 5FLXL 1B4OA 2HDMA 4KD3A 1DONA 3MHBA 3NWTA 2KJXA 2O2LD 5KNDA 3TZUA 2QILA 5AFWA 2EJMA 4HTHA 2CW0D 1B3AA 2JYOA 1BOSA 3M85A 2A69C 1OXSC 1A3TA 3V05A 3DUZA 1CM9A 1C48A 1S5BD 2G9DA 3EFXD 3SXHA 5CV5A 1TS4A 2X6GA 2OEOA 3QWNA 4BS9A 2DY7A 5FK9C 4DAPA 1PDQA 2L55A 3GTGB 2RDFA 3K5MA 3GP7A 2QCPX 1GUTA 4A3JB 2WB1B 1EIHA 3MVVA 2DNEA 3H09A 5ELFA 1KTKA 4NDXA 1ILQA 2YYZA 3Q24A 4WJWA 3T51B 5DNFA 1F2MA 3OOCA 1QG7A 4K5WA 1TKWB 5C4JB 1ESRA 1SYCA 1A3UA 5KYIA 1O78A 4CJ1B 1LABA 5EBCA 1JWSD 3FRPB 3MAQA 4PMBA 1IYUA 1HPCA 1EZ8A 2KECA 2PZUA 2JEAI 1A3VA 4RAUC 3BVGA 2LFNA 2WIIB 2D2CC 1IKMA 2M9VA 2RDHA 1II3A 1SNDA 4HN7A 2BA1A 4LJZC 5C5MA 4DNTB 1C8CA 1O7YA 3HS0C 4MHEA 1KDCA 5JEAG 3RLFA 3TSSA 4ZKCB 2CHBD 4KY5A 3L3OC 4CHTB 2F0OA 1W6KA 2HCIA 1OXVA 3D8GA 4OL7A 4RCOA 2E75C 1EIGA 4CKCA 2FMCA 1D5MC 1ZEQX 2K33A 3VR2A 3TP5A 2V4DA 4DNRB 2IWHA 3HGBA 1IKLA 5E1FA 3MTSA 5KGUA 3NQTA 3TZDA 1EYAA 3J81L 4Q0FA 1Q1BA 4G4KA 3SEBA 2EYOA 3GTLB 3E6ZX 2B63B 3A55A 2B2YC 4F7XA 1MD2D 1AN8A 5EPLA 1LTBD 4WRDA 2EVBA 3S17B 1I4XA 1GUWA 4QUCA 4OGQC 2R6GA 4KV6A 5M9OA 1WTVA 2JSOA 3IFTA 3I91A 1H9SB 4RGOS 3FEWX 3H91A 2E76C 4DAVA 1KLUD 1AZPA 2OT2A 3GTQB 1BNZA 2LS01 2BCOA 3K58A 3I90A 1Z6HA 4EGVA 2A5HA 1SYBA 3BDOA 1OXUA 1Q12A 4XT1B 3F2UA 3NP8A 5TSSA 3SVMA 5KIXA 3OW7A 2AQ2B 4XT3B 2B2YA 4I65A 2L4NA 4HCSA 3TP8A 2F0QA 1V8QA 4A3MB 5JVH3 1DYQA 2K28A 3KLRA 5FOBB 1SDFA 1X3PA 2RKSA 4RGTA 3ITPA 3GTPB 4Q5VA 3RMHA 1H9SA 1WCMB 1Y8PB 3H94A 4TRDA 1PTOC 4ID6A 4OO1I 5IOCA 1SE3A 3KUPA 1K83B 3M4YA 2FJ2A 4UDUC 4DXGA 3T56B 2RQXA 3C2PA 3NPPA 1J8IA 3J7AV 1UUPA 2ICIA 2F0SA 3CU7A 2CQAA 3MXPA 4BWGB 4DK0A 5JEAH 1LTTD 1PXUA 1Z7TA 3TN2A 1PTOD 5C5LA 4DA2A 1F9PA 1LTRD 4OIJA 3NXWA 1JOKA 3AU7A 3LX0A 3S1RB 3J80L 2DNCA 4WORA 1AW7A 1RD9D 2IPKD 1PLFA 3EQLC 2K32A 4C3HB 1V43A 3BVMA 2NUCA 3SK5A 2K6AA 4DK1A 3SHLA 2F0GA 3KBXA 1SYDA 2QKIC 2EY2A 3G6JB 5G3LF 1I50B 1EYCA 1PRTB 4C3HG 2RA4A 1GXDC 3PMFA 3SK4A 1SNOA 1ZXTA 2Y0SB 3L9AX 1PRTC 2O5JC 4ME5A 1SNPA 3MA2B 4ZUJA 2XRQD 1C4QA 3I4NB 3WOEA 2R93B 5FLXE 1SYFA 4XQJA 2SNMA 1T5EA 2IL8A 2L5TA 1STBA 1LT6D 1B53A 2B8FA 4CKEA 4KN7C 1I4HA 5EBDA 5D3DA 1D5ZC 3NWSA 2A6EC 5E3FA 1RF2D 4IZ8A 4A3EB 3SDZA 4C3JB 1TWFB 3PUVA 4IQZA 3EA6A 3VR6A 5CC4A 1B2TA 1UEAB 3FPUB 4MIUA 3BZDB 1TR5A 2NTSA 4NMZA 4C3JG 2E2DC 5IGEA 3PUWA 1M8AA 1H9JA 1JC7A 2OF1A 3LNNA 2PW5A 1TS5A 1KLGD 4IURA 5C0XJ 1LTAD 2EY1A 2NN6G 1RKNA 4RCNA 4XQQA 1O7ZA 5IT9E 4P2CB 1CA5A 3V2TA 1PZKD 2C9OA 2ICEC 1JWMD 3QJYA 4QF4A 4A93B 5A2QE 1TVXA 1SE2A 4BY7B 4KD4A 1ICWA 3S2DB 3FVQA 2KVMA 2E2HB 3S1MB 2NBFA 5JOBA 1HFNA 3MXGA 2WAQB 4XIGS 1ILPA 1S5CD 1O7LA 4DU9A 1ML0D 2F0TA 3W2DA 5IGFA 1BBXC 2HUGA 1TT2A 2B8GA 1D1IA 4J8QA 1EZ6A 5LL6S 4XDXA 4LMQD 4B9XA 3BDCA 1KNEA 2M00A 4EVOA 1ZKOA 1O80A 3PO2B 3KF8A 5FO9B 2I07B 4LAAA 3GV3A 4KTAA 4KKTA 1STYA 4BY1B 2C5CA 1BDOA 1CK1A 1RODA 4TSSA 3OMGA 2RSOA 3AMUA 3D4WA 3DWAA 3EVQA 5EQ0A 3U9OA 3GO5A 5I6WA 3GQBA 1R4QB 1CHPD 3J81E 2E74C 5C4HA 3NTHA 3FPPA 1JQYD 1ENCA 1KAAA 1TIID 5I4DA 5CORA 4EQOA 1TS2A 4K8JA 3K59A 3M7NA 2CW0C 1U9RA 2ZXRA 3A54A 2K1BA 1KNAA 1I4GA 1LT4D 4KJNA 4K14A 1PZJD 1TQOA 2B2UC 3A7AB 1W6JA 3M4OB 2NB0A 1U4MA 3DMUA 3NBIA 1EU3A 1TWGB 1SAPA 1LLRD 2WKDA 2PCFB 4H13C 4FF4A 3EJIA 1DCZA 3JAME 3K6OA 4ZYSA 1VMPA 4JBWA 1A15A 4F87A 2NN6H 3Q22A 4KY6A 1B50A 2VNUD 1SJED 1A2UA 1MBYA 3O13A 1SNCA 1G91A 4XXEA 2B2UA 2JA5B 3HKZB 4F8MA 1OO9B 1EYDA 1EFID 1F77A 2K03A 5FKAC 1SEBD 5JPMC 3GTKB 3MC0B 4DF7A 1I6VC 3OIPA 3Q0AA 3K5OA 2KEEA 4QUFA 1JOOA 5C6AA 3UI2A 2XVSA 2L1BA 5C0XH 5LHY1 4C56C 1Z47A 1D6EC 1PMRA 5ELCA 3GTOB 1BO0A 4FYDA 1QNUA 4A3BB 1H9RA 1B9NA 1VCIA 2B2WC 2WKCA 1X3QA 3IAYA 2EYJA 1K8MA 2EPBA 4X3TA 3G7LA 4EQNA 1EY0A 4HSPA 1DZ1A 1G2SA 5C3WA 1JOQA 1PTOF 2RBMA 3QIAA 1ONLA 3T53B 1AP0A 3IKJA 3BVZA 2Z8LA 4K2LA 1MI2A 3RD4A 2K01A 3VYRA 5J39A 4PV1C 3S2HB 1BR9A 3W3AA 4OHJA 2JA6B 2X69A 3DHQA 5C3XA 3RZOB 1B44D 2RSNA 3HOUB 4XTCS 2B2WA 3MXUA 4OIKA 2NN6I 2MUYA 3HOWB 3NTIA 4FF3A 5DM63 4H7BA 2JP1A 2NZ1D 5KEEA 1QJOA 1EEID 1D1KA 1Q90A 5EKKA 1Y8NB 1U4PA 2ZXPA 1EQVA 2SNSA 1STGA 3FDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUU A;  3IL8 A;  1NR2 A;  1U4R A;  3I90 A;  3UI2 A;  2L1B A;  1X32 A;  3ONA B;  4IUR A;  1DOM A;  4IUQ A;  1J9O A;  2KEC A;  4MN3 A;  4R9W A;  4RAU C;  3GV6 A;  2Q8T A;  5JJZ A;  4XT1 B;  1B4O A;  2HDM A;  2NYZ D;  1NCV A;  2HCC A;  4UAI A;  3DEO A;  4IUP A;  2XIW A;  3F2U A;  5E4W C;  3I8Z A;  5EPJ A;  2R3Z A;  1S4Z A;  3SVM A;  2K05 A;  1O7Z A;  2L9H A;  2MGS A;  1QE6 A;  1VMC A;  2MP1 A;  3DM1 A;  1BO0 A;  2B2Y A;  1PLF A;  4XT3 B;  2L4N A;  1XYI A;  1C8C A;  1DON A;  4IUT A;  1O7Y A;  4HCS A;  1IL8 A;  1CA5 A;  3N52 A;  2X6L A;  1F9R A;  5T1I A;  1E0B A;  2EE1 A;  2NWG A;  4MHE A;  2L11 A;  1F2L A;  2B2W C;  1X3Q A;  2L12 A;  5D14 A;  5COY A;  1RHP A;  2K1B A;  2RVL A;  2K28 A;  2EPB A;  3KBX A;  1KNA A;  5AFW A;  3R93 A;  4ZKC B;  4X3T A;  3D6W A;  3G7L A;  4X3U A;  1WTX A;  1HRJ A;  3LWE A;  1DZ1 A;  1G2S A;  1SDF A;  1B3A A;  1TVX A;  2HCI A;  2JYO A;  2B2U C;  1HUM A;  2RA4 A;  1X3P A;  2N88 A;  2BDN A;  2M2L A;  1ICW A;  1ZXT A;  1IKM A;  1Q3L A;  1EIG A;  4ZLT F;  2KVM A;  1U4M A;  2MPM A;  1JIC A;  1JE4 A;  2FMM A;  1U4L A;  1AP0 A;  2B2T A;  5T1G A;  1CM9 A;  1SAP A;  1MI2 A;  2EOT A;  1RTO A;  2K01 A;  4ZKB B;  1HFN A;  1G2T A;  1HUN A;  2B2V C;  2KUM A;  1ILP A;  2DY8 A;  1RTN A;  1PFN A;  1IKL A;  1EOT A;  1RJT A;  1EQT A;  1ML0 D;  2FFK B;  3MTS A;  3Q6S A;  4O42 A;  4ZK9 B;  1WVL A;  1BBX C;  2HUG A;  2N55 A;  5CBA E;  2HDL A;  1QNK A;  2X6G A;  4NW2 A;  3TZD A;  3MWY W;  4RWS C;  1XX8 A;  2IL8 A;  1LV9 A;  2X69 A;  2DY7 A;  3KUP A;  3DEP A;  1F9S A;  4XDX A;  4LMQ D;  4DN4 M;  1B53 A;  1KNE A;  1WTW A;  3P7J A;  5E4X A;  1VMP A;  2FJ2 A;  1PDQ A;  4X3S A;  1WD1 A;  1WTP A;  1F9Q A;  1O80 A;  2RSN A;  1A15 A;  1WTR A;  1HHV A;  1WTQ A;  1MSH A;  1B50 A;  1EIH A;  3IFD A;  2B2Y C;  3GV3 A;  2KED A;  1J8I A;  5CBE E;  2B2W A;  2FHT A;  4U68 A;  5EPL A;  1CA6 A;  4HAE A;  2K04 A;  4OIK A;  5EJW A;  1ILQ A;  2MJ8 A;  3I3C A;  5EPK A;  4R8I A;  1DOL A;  1G91 A;  4X3K A;  5D65 A;  5DNF A;  4OIJ A;  1WTO A;  2FIN B;  1NR4 A;  1MGS A;  2B2U A;  4RA8 A;  1ROD A;  4CJ2 C;  1B2T A;  1GUW A;  3FPU B;  3HP3 A;  4QUC A;  1QG7 A;  1EL0 A;  3QO2 A;  1SSO A;  2JP1 A;  2NZ1 D;  2RSO A;  1WD0 A;  1AZQ A;  1PFM A;  4ZAI A;  2K03 A;  5EKI A;  1BF4 A;  1G6Z A;  2Q8R E;  3TN2 A;  2VXW A;  1WTV A;  1ESR A;  5EQ0 A;  5CMD A;  3I91 A;  4CJ0 B;  2D9U A;  1DOK A;  2CVR A;  3H91 A;  2KOL A;  1U4P A;  1NAP A;  2B2V A;  1HFG A;  1M8A A;  1MSG A;  1AZP A;  2SDF A;  2J7Z A;  2H1E A;  4HSV A;  4IUV A;  4CJ1 B;  1F9P A;  1BNZ A;  2B2T C;  1HA6 A;  3FDT A;  4HED A;  2KEE A;  5COR A;  1PFB A;  4QUF A; 
#chains in the Genus database with same CATH topology
 2EYF A;  4L6T B;  2G9H D;  4IFD J;  3VR5 A;  2EJF C;  1NR2 A;  4BBR B;  2WV6 D;  3ONA B;  1DOM A;  4DAM A;  2EXZ A;  2TSS A;  1BQQ T;  3TS0 A;  3EIV A;  1GUN A;  1O7I A;  3M4O H;  3X3M A;  4UAI A;  2CFM A;  3KLW A;  1S4Z A;  1D2B A;  4IPG A;  1QE6 A;  4AQY L;  5C0X I;  1TWG H;  2NVX B;  5GRO A;  3NTK A;  4BBR G;  3T1H L;  2UUA Q;  1V1P A;  2QEX A;  2F0U A;  1B70 B;  4UP8 A;  1PHJ A;  1XTC D;  2NWG A;  2O5I C;  1PRT F;  1T5X D;  4LK1 C;  1X55 A;  2XWJ B;  2D0P A;  2QDB A;  4X3U A;  1VQB A;  3T13 A;  1VQ7 A;  1R4P B;  4A3G B;  1FGB D;  5IY0 A;  1K73 C;  3FP9 A;  2F0K A;  4A4I A;  1IXR A;  4XYQ A;  1U4L A;  2IY5 B;  2KCN A;  4WFN 3;  4DV0 Q;  1HR0 L;  4C1N K;  3VYU A;  4I7Z C;  5L37 A;  2ALY B;  2D5D A;  4U67 3;  4ZRZ A;  1EQT A;  2KHI A;  3HKS A;  3HOZ H;  1K8O A;  2RF4 A;  4A3G G;  3P20 A;  4K2K A;  1QNK A;  2JA5 H;  2HQE A;  3DXJ C;  1XTD A;  5AJ3 L;  3CCL A;  1VQL A;  1YI2 A;  5LL6 X;  2BDO A;  4G7Z C;  5I6Y A;  2IT1 A;  5CV6 A;  4JW0 A;  1HNW L;  1WYD A;  1VQE A;  1A6X A;  3GTK H;  2O4X A;  4C1N I;  4A3M G;  1JCK B;  3ULL A;  1CTM A;  1A0I A;  1VF5 C;  1RL2 A;  1PTO B;  1STN A;  4TVA B;  4A3K B;  3S1Q B;  4FXD A;  4ILW A;  2K04 A;  2Q8I B;  1NTG A;  4HIK A;  1GD7 A;  3TP7 A;  1WTO A;  4K5V A;  1VF7 A;  1VDZ A;  1M4V A;  3OPO A;  2YV5 A;  1EEF D;  4A3K G;  4R4T A;  1G6Z A;  3C1E A;  3M7G A;  3GTO H;  4RHS A;  5K36 G;  1EWI A;  1GUS A;  3W1G A;  1VQK A;  2CCZ A;  1S5E D;  1X54 A;  3FHW A;  4TKO B;  5GAD C;  4A3B H;  4JI8 L;  1QZG A;  2B2T C;  3K5L A;  2XSC A;  1HZ9 A;  2EYP A;  1KDB A;  3IL8 A;  3M3Y B;  2VB3 X;  1LTS D;  4JI4 Q;  1J9O A;  2UUC L;  1ET6 A;  5JJZ A;  1NCV A;  4PMC A;  1EIF A;  1F2Z A;  1SMY D;  2L9H A;  2PNH A;  3ND9 A;  3C3L A;  4H02 A;  4KJO A;  1BBU A;  3N52 A;  4RG1 A;  5IGG A;  1JB3 A;  1GHK A;  5M5X B;  1F9R A;  1CUK A;  1XMQ L;  4WJ4 A;  4JI7 L;  1NUC A;  1D5X C;  2LMC B;  2QGQ A;  1XXG A;  4FF1 A;  5COY A;  2OCE A;  3S2H H;  5CR3 A;  5JPN C;  2KHJ A;  1CFM A;  3R93 A;  4DFA A;  2JA6 H;  2NVY B;  5IP7 G;  5IYB H;  2RHS B;  1VQ6 A;  4A3C H;  1SYG A;  1V9P A;  2BDN A;  4RHR A;  3RZO H;  5I2X A;  3OTO L;  4C3I B;  4N9P A;  4DNI A;  4TQU S;  3HOU H;  1Q46 A;  2B2T A;  4N9T A;  2BA0 A;  3I72 A;  4RKL A;  2EJG C;  1STA A;  1OXX K;  2J0T D;  4JI6 L;  3MZ5 A;  2A6H D;  1RJT A;  2JN4 A;  4DV7 L;  4C3I G;  1BKB A;  4JG2 A;  3HOW H;  4RWS C;  5M3M B;  4A3F B;  1X3G A;  2L0C A;  5IIF A;  1WTW A;  1KDA A;  4QCL A;  1I4Q A;  1SMX A;  1PVO A;  4P75 A;  2TMP A;  5I9O A;  1Y14 B;  4AYB E;  1XNR L;  3KDF B;  5DAU A;  5H1S E;  5LMN Q;  4ALP A;  1CQF A;  4A3F G;  4K0K Q;  5CBE E;  4XYO A;  4DR3 Q;  3N6R A;  1HTL D;  3S24 A;  1BCP D;  5EJW A;  4AYB B;  1HNZ L;  1FYC A;  3I3C A;  1YHA A;  4BBR H;  1VQ5 A;  3U50 C;  2OXP A;  4RA8 A;  3E0J A;  1RCV D;  1EL0 A;  1JT8 A;  4HJ5 A;  1SNQ A;  1SSO A;  2KCM A;  3TDQ A;  1WD0 A;  2HHH Q;  1HR0 W;  1J5E L;  1A63 A;  4AYB G;  2NVX H;  4IJL A;  1YNJ D;  3S1N B;  1QVF A;  2KOL A;  1EY6 A;  4NXN L;  1YJN A;  1NAP A;  2H4O A;  1B1Z A;  5IGB A;  4LF4 Q;  2SDF A;  2H1E A;  1QCB D;  1SBB B;  3SK8 A;  3WOF A;  4IFD H;  3NEL A;  4DR6 Q;  2XTI A;  4JOI C;  5ELB A;  3H15 A;  1L0Y B;  3OYY A;  1GUO A;  5KNC A;  3HZX A;  3NBH A;  5DLQ E;  4GOP B;  4OEM B;  2NYZ D;  1IHZ A;  5E4W C;  4A3G H;  2R92 B;  2EDG A;  2XIW A;  4DR4 Q;  2C35 B;  4FXG C;  1I4P A;  3E3X A;  1G8Z D;  1YHB A;  1UAP A;  4KMU C;  4GOP C;  4LFB L;  4PQX A;  2I0Q A;  3QB3 A;  1G51 A;  3J80 c;  1IL8 A;  4OX9 L;  2EYH A;  5DM7 3;  3HOY B;  2Z6B A;  2I46 A;  3VA7 A;  3OW2 A;  3TRZ A;  3BYT B;  3KDF A;  1E0B A;  2L11 A;  1EFW A;  3HOV B;  2L12 A;  1GHJ A;  2XRS D;  3P75 A;  2R92 G;  4QL5 A;  1CKN A;  2LY7 A;  3D6W A;  3K80 C;  3CC4 A;  4ABN A;  4DXF A;  4IN3 A;  5J1Z A;  1E2W A;  2DN8 A;  1B9M A;  3CCU A;  3HOY G;  4KN4 C;  2AUJ D;  3HOV G;  2Z4H A;  1E2V A;  3S14 B;  1ET9 A;  3KF8 B;  4EQ5 A;  1WOC A;  1YEZ A;  2F0J A;  3CCM A;  1S40 A;  1PTO H;  1CHQ D;  4ZKB B;  1RTO A;  5CYU A;  4IOA A;  3VR4 A;  3A0J A;  5IP9 G;  1TWH H;  2PZW A;  5K36 H;  2BE5 D;  2ZTE A;  2GA4 B;  3D31 A;  2GN5 A;  2N55 A;  5CBA E;  1NBW A;  2IJ0 A;  4NW2 A;  3UDG A;  1ZYR D;  5C3E B;  2AQ3 B;  4JI5 L;  1LTG D;  5CV8 A;  3CAM A;  5M5Y B;  3P7J A;  4LF5 Q;  1G6P A;  1VQN A;  3VYT A;  4GOP A;  2AQ1 B;  4BBS B;  4IJH A;  1WTR A;  3KK7 A;  1CZW A;  4DR1 Q;  2LKV A;  2F03 A;  4NKL A;  2RCN A;  4H44 C;  1M1K C;  2PW7 A;  5C0X G;  1STE A;  4QJF A;  1N33 L;  3M3Y H;  1Y1V B;  5EPK A;  2CH4 W;  4PZ7 A;  5D65 A;  3T4A C;  2YTY A;  2F1M A;  2F0V A;  5K5P A;  1AZQ A;  3K7A H;  2JE6 I;  4P74 A;  4ZAI A;  2WAQ G;  3F2C A;  1YNN D;  2D62 A;  2ZTD A;  5IP7 H;  1Y1V G;  1LO5 D;  2JEB I;  2NTT A;  5M5X H;  3RZD B;  1PFB A;  1TWC H;  5HGT A;  4B08 A;  2NVY H;  1Y8O B;  1GOZ A;  5IYC G;  2JK8 A;  5DEH A;  1IZ6 A;  1VQ4 A;  3PO3 B;  1JJ2 A;  3CRL C;  1YHQ A;  4C3I H;  3WDN A;  4QMG A;  3I8Z A;  2F52 A;  2PNR C;  4B3M L;  4GLV B;  1XNQ L;  1IYV A;  4HID A;  2IW3 A;  4BY1 G;  2AHO B;  1XYI A;  2P5Z X;  4IUT A;  1S5D D;  1XJV A;  5E7N A;  2GVB A;  1EYG A;  3U4Z A;  3PO3 G;  5D14 A;  2UU9 L;  1JR0 D;  3MXN B;  4HR7 B;  5M3M H;  4A3F H;  4DV1 Q;  1A2T A;  3SR1 A;  3HEJ A;  1L0X B;  3PGZ A;  3E5S A;  4ME3 A;  2UXC L;  1HUM A;  2WAC A;  1EU4 A;  3K7U C;  3PUZ A;  3T1Y L;  1SYE A;  1JIC A;  1JE4 A;  1CQV A;  1EY7 A;  1PH9 A;  2Z0S A;  1UE7 A;  4X6A H;  4OWX B;  3R2T A;  3RLN A;  4BA1 I;  3KJO A;  4POG A;  5FO7 B;  1PFN A;  4Y7N B;  2XN9 C;  1TWA B;  3Q6S A;  5CV4 A;  1JWU D;  4IOC A;  4K5X A;  1XX8 A;  1FR3 A;  1WJJ A;  4LUV A;  3I56 A;  3DEP A;  3NSW A;  4GKK Q;  1ASY A;  5E4X A;  1VQO A;  5CV9 A;  2ATW A;  3S1N H;  3NQI A;  5ELD A;  1S72 A;  3LGJ A;  4DV2 Q;  1QIL A;  1MSH A;  1LM0 A;  3IFD A;  3BDL A;  4JI2 Q;  3I4L A;  3CHB D;  2WIN B;  1L0W A;  3L7Z C;  1LT3 D;  4R8I A;  4HJ8 A;  2UXB Q;  2A68 D;  3MXN A;  4PMW A;  3MFY A;  1V1O A;  2R92 H;  1RDP D;  4QGU A;  1PFM A;  2F4I A;  5EKI A;  1LAC A;  1BF4 A;  1PV4 A;  3GTM B;  5CMD A;  3PIO A;  3HOY H;  3GTJ H;  2KEN A;  5FO8 B;  2EQS A;  4HSV A;  3HOV H;  3RNU A;  4IUN A;  4IUU A;  1EY4 A;  4M1U B;  3BJU A;  3BU2 A;  3UDF A;  4KHP Q;  1DD2 A;  3HOZ B;  3BYY B;  3NE5 B;  1TY2 A;  5KNB A;  4MN3 A;  3R8B A;  3SGI A;  5IP9 H;  4JV5 Q;  3OIQ A;  1GKH A;  2A74 C;  2HCC A;  3DEO A;  2K5D A;  3S14 H;  4LUO A;  3X3N A;  3NK9 A;  2RCF A;  2K05 A;  1VQF A;  1KIX A;  1XWE A;  4G57 A;  3HOZ G;  2ZT9 C;  2NVQ B;  2F0E A;  2KCC A;  4HCE A;  4BA2 I;  3A5Z B;  1HA5 A;  1L1O B;  4FXK C;  2RVL A;  2K5N A;  5C3E H;  1B7Y B;  3I2Z A;  1K0S A;  1Y69 U;  3A56 A;  4Z9C B;  4DUY Q;  3PIP A;  3VR3 A;  1L1O C;  3DWP A;  2K7V A;  5JJI A;  2Q2U A;  2F3W A;  4BBS H;  1SRU A;  1L2F A;  4A3D B;  2AWO A;  4O2D A;  4LF7 Q;  4DAY B;  4ULL A;  5T1G A;  4DKA C;  2EOT A;  4R4O A;  2A69 D;  1Y1V H;  5IT9 L;  1JB7 A;  1Q8I A;  4O42 A;  4M8A A;  2HDL A;  2AMC B;  5JEA J;  2KCT A;  1OXT A;  4X62 L;  5ELE A;  2LSS A;  3AB9 A;  3H3V C;  5IYC H;  3ND8 A;  3CMA A;  4Y52 H;  5A2Q L;  2MHV A;  3ERQ A;  4IO9 A;  3RZD H;  3TQY A;  2VQE L;  2QF7 A;  2F0H A;  3KLS X;  1SNM A;  4U68 A;  1FJG Q;  3D3R A;  3CCQ A;  3J80 E;  2MJ8 A;  2ID0 A;  2EY5 A;  4FVM A;  1EQQ A;  2E5L Q;  1HQM C;  1WFQ A;  1NR4 A;  1HNX Q;  3T16 A;  3BS1 A;  3PO3 H;  4CKB A;  2QA4 A;  2R7F A;  1R9T B;  4DR2 Q;  2BOS A;  5C4X B;  2F4V Q;  2F0D A;  1BBW A;  1QZH A;  2K5Q A;  4RGM A;  1AFP A;  3E9H A;  1V1P B;  2JXM B;  1EY5 A;  4LWC A;  1QOH A;  4J6H A;  3I4M B;  1K8G A;  4DAY A;  2OQ0 A;  1GUG A;  1SJH D;  1HA6 A;  3I4O A;  4R4C A;  5C4X G;  1N34 L;  2KHS A;  3B6Y A;  1N36 L;  4UP7 A;  4IUQ A;  1SE4 A;  2I5H A;  2AWN A;  3QG1 A;  1YIJ A;  4GKJ L;  2ASB A;  3TP6 A;  3CF5 A;  1AE3 A;  4OO1 H;  2F0I A;  4CDD C;  1VMC A;  3A8J E;  5GAG C;  1I4R A;  2HIX A;  4HIO A;  4EX5 A;  1E2Z A;  2JA8 H;  1VQJ A;  1YNX A;  1BCP F;  2X6L A;  5CV7 A;  3OWF A;  4DV6 L;  3R3O A;  4Y7N H;  1TWA H;  2F0P A;  3NUC A;  5EKL A;  1IBL Q;  4YIJ A;  2N88 A;  3K57 A;  2Z1C A;  2M2L A;  4DV4 L;  3C46 A;  1XPO A;  1PYS B;  2CH4 A;  3QOL A;  4GN3 B;  3CQZ B;  2MPM A;  4OEL B;  2A73 B;  2FMM A;  3HG9 A;  1YBY A;  4DV5 L;  1FNV A;  2K5W A;  1MKH A;  1G2T A;  3CKI B;  2DY8 A;  3J81 i;  2EYL A;  1WVL A;  2F3V A;  4DGZ A;  2R7D A;  3MWY W;  1T9H A;  1FNW A;  2R61 A;  1SR3 A;  1F9S A;  4G7O C;  3ERO A;  3GTM H;  5HUR A;  4B3S Q;  1F9Q A;  4IFD G;  1PH4 A;  1NSN S;  3J81 j;  4LFA Q;  1KQS A;  2NVT B;  3S9W A;  1EY9 A;  1K3B C;  2F0L A;  2KED A;  1TU2 B;  4HAE A;  4ZUI A;  4MNO A;  5EGT A;  5CGK A;  3CCJ A;  4E6I A;  1H9M A;  5KYL A;  2PPB C;  1CT1 D;  4DUZ Q;  1K28 A;  2FIN B;  3PIO 3;  1SE8 A;  4CJ2 C;  2UXD Q;  1TY0 A;  1OTC A;  3DWQ A;  1CSQ A;  1YVC A;  1K0R A;  2Q8R E;  3KOJ A;  2BH2 A;  3S16 B;  3JAM L;  4X66 Q;  4HMI A;  4CJ0 B;  2D9U A;  5ISR A;  5IWA Q;  2F0M A;  3AFP A;  1EWH A;  3HRZ C;  3KF6 A;  4L63 B;  3A7L A;  2B3G A;  2NVQ H;  3I7F A;  4V19 0;  2E2J B;  3M4Q A;  4OWW B;  1U4R A;  1QB5 D;  1TWH B;  1SMY C;  4OXP A;  1I94 Q;  5KRU A;  4K0K L;  3RUZ A;  3GV6 A;  1PZI D;  1UNS A;  5BN5 A;  3JAM i;  5EPJ A;  1IBM L;  1Q8K A;  3TME A;  2R3Z A;  4HJA A;  4A3D H;  3SE0 A;  3V96 A;  1PH3 A;  5F2D A;  3CCS A;  2MGS A;  5I9P A;  4PNY A;  2MP1 A;  1TS3 A;  1EWC A;  3RN5 A;  1ASZ A;  2YU9 B;  3PIP 3;  1QVG A;  1VQ9 A;  3AFQ A;  5BN3 A;  2HHH L;  4HJ9 A;  3TBI B;  2K50 A;  4JI3 Q;  3NHH A;  1RHP A;  2Q2H A;  4LF6 L;  3WWV A;  4J15 A;  5JVG 3;  4QQB X;  1HRJ A;  4OWT B;  2Z6K C;  3G4S A;  2A6H C;  3K7A B;  1Q3L A;  4ZLT F;  1ENA A;  4JK1 C;  2RDG A;  4YWK A;  4X65 L;  3DLL A;  1HUN A;  4DR4 L;  5IGD A;  1Q86 C;  1DJR D;  2IX3 A;  3GDE A;  4X64 L;  2IX1 A;  1TWC B;  1WTH A;  4G7H C;  4XQN A;  5JJL A;  1BCP B;  4JI1 L;  1R9T H;  1UE1 A;  2Q2T A;  5C4X H;  1E22 A;  1IBK L;  2PQE A;  1BCP C;  4FO2 A;  3KBG A;  2I5L X;  1Y1W B;  1CI3 M;  3MEF A;  4FNF A;  2KQ3 A;  4R4I A;  1CZG A;  5D3I B;  3I4M H;  1RIP A;  4J1M A;  4L8J A;  2FHT A;  3UE0 A;  4IAL A;  3OMC A;  4B3R Q;  3PUY A;  1JOR A;  1YNJ C;  3KJP A;  1DGS A;  3NBH B;  4KY7 A;  2Z6K A;  4K6L A;  1Y1W G;  4QB4 A;  2DGY A;  1HR0 Q;  2ZXO A;  5I2Y A;  4R1J A;  4L5Q A;  4RGN A;  4UP9 A;  1KC8 C;  1F2Y A;  2VXW A;  3I73 A;  3VYS A;  2CVR A;  1K3R A;  4HMJ A;  5AJ3 Q;  1HFG A;  4F88 A;  2J7Z A;  4B9W A;  5M3M G;  1EY8 A;  4JCV E;  2NZH A;  3HOX B;  1HNW Q;  4K6D A;  1CKN B;  3D6C A;  3C1F A;  3A5U A;  4LF9 L;  2N3S A;  5JAV A;  1LT5 D;  2VZA A;  1LTI D;  2OQK A;  2ZM6 L;  3U58 A;  3KYH C;  3HOX G;  3CQZ H;  4R8N A;  1FNU A;  3PQI A;  4KHV A;  3CCV A;  2VL6 A;  5BN4 A;  2IX0 A;  1N9W A;  3OHX C;  2EE1 A;  4RKB A;  1MIU A;  4IPC A;  1N32 L;  3U9S A;  4NP5 A;  2PQA B;  3J7A 5;  2CQO A;  2R7Z B;  4ODG A;  2WP8 J;  5J22 A;  2K52 A;  4KI0 A;  4JI8 Q;  3DM3 A;  5IOD A;  4LF8 L;  5BR8 L;  2BE5 C;  4DR7 L;  3K5N A;  2HD3 A;  1EIY B;  5M5W B;  2NVT H;  2R7Z G;  1ESF A;  1ZYR C;  2UUC Q;  1JJG A;  1RTN A;  3GTJ B;  2VUM B;  3FMC A;  1V1Q A;  1EOT A;  2EXD A;  3J7A F;  1PRT D;  3QR8 A;  5IYD H;  4ZK9 B;  2JQO A;  1VS0 A;  1Q1E A;  1HXY D;  3H6M A;  1LV9 A;  2H5X A;  4A3L H;  1XMQ Q;  1HZB A;  4JI7 Q;  2MO0 A;  3S16 H;  1AEX A;  1CKO A;  4ZQ3 A;  1WTP A;  4YCU A;  2VY3 A;  4AH6 A;  1ENF A;  3CCR A;  1I6H B;  1IW7 C;  2VQF L;  2CWP A;  2E2J H;  4RH6 A;  2EY6 A;  5M3F B;  1SXT A;  5NUC A;  2VB2 X;  1NMG A;  2PZT A;  1D8L A;  3SK6 A;  1YNN C;  4X3K A;  2A19 A;  2DJF C;  2A6E D;  2PQA A;  1GJX A;  1MHW C;  3D4D A;  3HP3 A;  2OTL A;  3QO2 A;  1PH2 A;  3I70 A;  5M3F G;  4JI6 Q;  1A8V A;  2K5V A;  1JMC A;  2EIF A;  2ZJP A;  4DV7 Q;  3E0E A;  1TXY A;  2QEJ C;  3OSO A;  2YU9 H;  3MEH A;  1MSG A;  1NNX A;  2PO4 A;  4CBV A;  5C3E G;  4IUV A;  4LFC Q;  2UUB L;  1XMO L;  4JI0 L;  3IRB A;  3CRK C;  3F2D A;  2PI2 A;  4IPD A;  5GAH C;  1QWY A;  4KHZ A;  4KKS A;  4EQP A;  2F0N A;  2PMZ E;  4BBS G;  1IW7 D;  2Z4I A;  4R9W A;  5IGC A;  1XNR Q;  3FKI B;  1HNZ Q;  2KA7 A;  4IUP A;  3Q23 A;  2PMZ B;  3DM1 A;  4JPB W;  4GZY C;  5C44 B;  5T1I A;  4KKU A;  1FD7 D;  1HTP A;  2SOB A;  3PCO B;  3PUX A;  4MZ9 A;  4O1N A;  3FKI G;  2ENB A;  2DUD A;  1B3Q A;  2SEB D;  1BUV T;  2EZV A;  1X6O A;  4QIW E;  1WTX A;  1G29 1;  4DK6 C;  3H0G B;  1HCZ A;  3LWE A;  2AUK A;  1PYW D;  2F0F A;  3PV0 A;  4QIW B;  1D7Q A;  3TEH B;  4IFD I;  4RFB A;  4V0B A;  4POF A;  5A35 A;  1Y1W H;  4KHP L;  2B39 A;  4DR5 Q;  5LMU Q;  2F0W A;  2B2V C;  2KUM A;  4CGY B;  1BXT A;  1LYL A;  2B29 A;  4KK7 A;  1HZA A;  1S5F D;  2FFK B;  1PH1 A;  3ULJ A;  3URY A;  1SFO B;  2NZO A;  3CCE A;  3EBE A;  2L15 A;  1X65 A;  3J7Y W;  4LFB Q;  3BG3 A;  2ZJR A;  4DV3 Q;  4H0L C;  4OX9 Q;  2XWB B;  3GD7 A;  4DN4 M;  1Q7Y C;  4X3S A;  5C4Z A;  1WD1 A;  1I3Q B;  3D4R A;  3W1B A;  4A3I B;  1HHV A;  4C2M B;  4NXM L;  1WTQ A;  1YJW A;  1K9M C;  2A68 C;  2KBN A;  3QOJ A;  1IL2 A;  4FP5 D;  3HOX H;  1STH A;  4N8X 1;  1CA6 A;  3A8K E;  2JA8 B;  3ZYY X;  4GN4 B;  3R2I A;  1DOL A;  3A8I E;  2I5M X;  3MFG A;  2J4X A;  4A3I G;  4LF7 L;  1MGS A;  4OO1 G;  3P1H A;  5G3L D;  3OWE B;  4S3S A;  1XPR A;  4FF2 A;  3S15 B;  1DXM A;  3VA5 A;  2JA8 G;  4K8I A;  2PYK A;  1DOK A;  2E2I B;  4JI5 Q;  2JA7 B;  2B2V A;  3CXC A;  1VQP A;  1H9K A;  1HQR D;  4HED A;  1DM0 B;  1F2L A;  3LWU A;  1KAB A;  2R7Z H;  1X32 A;  3G6E A;  2XNA C;  3K0Y A;  2YTV A;  1AH9 A;  2JA7 G;  1Z9F A;  2Q8T A;  2EYM A;  1FJG L;  3KLS A;  5FLX L;  1B4O A;  2HDM A;  2Q2I A;  4KD3 A;  1PYB A;  5M5W H;  3J7Z C;  1HNX L;  2DJG C;  1DON A;  3MHB A;  3NWT A;  2IHF A;  2CWA A;  2KJX A;  1TWF H;  2VUM H;  1HZC A;  2O2L D;  1C9O A;  5KND A;  3TZU A;  4B3T L;  4RMF A;  2QIL A;  5AFW A;  2IHE A;  1VQC A;  2EJM A;  4HTH A;  2CW0 D;  1B3A A;  2JYO A;  1U5K A;  1BOS A;  3M85 A;  3AEV A;  2A69 C;  1OXS C;  5JJK A;  1A3T A;  1J6Q A;  3V05 A;  2WFW A;  1I6H H;  2VS1 A;  3DUZ A;  5M3F H;  1CM9 A;  1C48 A;  4APV A;  1S5B D;  1KL9 A;  2G9D A;  3EFX D;  3SXH A;  5CV5 A;  1TS4 A;  3CC7 A;  4B3M Q;  1VQH A;  2X6G A;  1PA6 A;  1PFS A;  2OEO A;  2BH8 A;  3QWN A;  4BS9 A;  2DY7 A;  2D0O A;  4GNX A;  5FK9 C;  2WB1 E;  4DAP A;  3AYH B;  1PDQ A;  2L55 A;  3GTG B;  1SN8 A;  2RDF A;  3K5M A;  3GP7 A;  2QCP X;  1GUT A;  4A3J B;  2WB1 B;  4NB3 A;  1EIH A;  3MVV A;  2DNE A;  3H09 A;  2UXC Q;  5ELF A;  3NEM A;  1KTK A;  4NDX A;  1ILQ A;  2YYZ A;  4YHH Q;  3Q24 A;  4WJW A;  3T1Y Q;  4JBJ A;  3T51 B;  5DNF A;  4CDC C;  1F2M A;  2UUA L;  4A3D G;  3RN2 A;  4A3J G;  2WB1 G;  4P71 A;  3OOC A;  3FKI H;  1QG7 A;  4K5W A;  3U4V A;  3L0O A;  1TKW B;  1Q82 C;  1X9N A;  5C4J B;  1ESR A;  1SYC A;  1KXL A;  4I7A A;  2LXJ A;  4WJ3 M;  1A3U A;  5C44 H;  5KYI A;  4LUZ A;  4A75 A;  1O78 A;  3D0F A;  4CJ1 B;  4JYA Q;  1LAB A;  5FLX c;  5EBC A;  1JWS D;  3FRP B;  4ZCK A;  3MAQ A;  4PMB A;  2V1C C;  4B3S L;  1IYU A;  1HPC A;  1EZ8 A;  3H0G H;  2KEC A;  2PZU A;  2JEA I;  1A3V A;  4DV0 L;  4RAU C;  3BVG A;  5IE8 A;  2LFN A;  2WII B;  2D2C C;  1IKM A;  2M9V A;  2RDH A;  1II3 A;  1SND A;  4HN7 A;  2BA1 A;  4LJZ C;  5C5M A;  4DNT B;  1C8C A;  1O7Y A;  3HS0 C;  1KD1 C;  2A1A A;  3BZK A;  4MHE A;  1KDC A;  5JEA G;  3RLF A;  3CPW A;  3STB D;  1SFO H;  5IWA L;  4NPS A;  3TSS A;  4ZKC B;  2CHB D;  4KY5 A;  1NE3 A;  3L3O C;  4CHT B;  2F0O A;  1W6K A;  4L5S A;  2HCI A;  1VQI A;  1OXV A;  3I4M G;  1I3Q H;  3D8G A;  4OL7 A;  4RCO A;  4A3I H;  2E75 C;  1EIG A;  4C2M H;  4CKC A;  2FMC A;  1D5M C;  1ICF B;  1ZEQ X;  2K33 A;  3VR2 A;  3TP5 A;  1UEB A;  2V4D A;  1W2B A;  4DNR B;  2IWH A;  3HGB A;  1IKL A;  5E1F A;  2A8V A;  3MTS A;  2FXQ A;  5KGU A;  3NQT A;  1P16 A;  3TZD A;  4JBM A;  1EYA A;  3J81 L;  1N8R C;  3M9B A;  4Q0F A;  4GN5 A;  1Q1B A;  4G4K A;  1NJI C;  3SEB A;  3S15 H;  3ERS X;  1SLJ A;  2EYO A;  1KRS A;  5IT9 c;  3GTL B;  3KF6 B;  3E6Z X;  2E2I H;  1QUQ A;  3A55 A;  2JA7 H;  2B63 B;  4JI4 L;  2B2Y C;  4F7X A;  1MD2 D;  1AN8 A;  5EPL A;  1LTB D;  1EQR A;  4WRD A;  2EVB A;  3F2B A;  2B63 G;  3S17 B;  1I4X A;  1GUW A;  4QUC A;  4QY7 A;  4OGQ C;  4P73 A;  2R6G A;  2MQH A;  4KV6 A;  5M9O A;  3ZJY C;  1WTV A;  1IYJ B;  2JSO A;  1U0L A;  3I91 A;  1H9S B;  3IFT A;  3FEW X;  4RGO S;  3H91 A;  2E76 C;  5GAE C;  4DAV A;  1KLU D;  1AZP A;  2OT2 A;  4X62 Q;  1BNZ A;  3GTQ B;  2OWO A;  2LS0 1;  2BCO A;  3K58 A;  3I90 A;  1Z6H A;  2XGT A;  3RLO A;  4EGV A;  1M90 C;  2A5H A;  1SYB A;  3BDO A;  1OXU A;  1A62 A;  2VQE Q;  5FLM H;  1Q12 A;  4XT1 B;  4B3R L;  3F2U A;  3NP8 A;  5TSS A;  3SVM A;  5KIX A;  3OW7 A;  2AQ2 B;  4XT3 B;  2B2Y A;  4I65 A;  2L4N A;  4HCS A;  5IYD G;  3TP8 A;  2F0Q A;  1MJC A;  1V8Q A;  1PH6 A;  4A3M B;  5JVH 3;  1DYQ A;  4A3L G;  2K28 A;  2OTJ A;  3KLR A;  5LMN L;  5FOB B;  1SDF A;  4DR3 L;  1X3P A;  2RKS A;  3GTG H;  4RGT A;  3ITP A;  1N34 Q;  4YY3 Q;  1B8A A;  4Q5V A;  4A3J H;  1HH2 P;  1N36 Q;  3GTP B;  4UY8 C;  3J81 c;  3RMH A;  1H9S A;  1WCM B;  4GKJ Q;  1Y8P B;  2LXK A;  3H94 A;  4TRD A;  1PTO C;  4ID6 A;  4OO1 I;  3PF5 A;  3H3V H;  5IOC A;  1YIT A;  4LF4 L;  1SE3 A;  3KUP A;  2HIV A;  1K83 B;  4BXX H;  4DV6 Q;  4YWM A;  3M4Y A;  1WCM G;  2FJ2 A;  5C4J H;  1WI5 A;  4DR6 L;  4UDU C;  4DXG A;  3T56 B;  2RQX A;  3C2P A;  3NPP A;  1J8I A;  3J7A V;  4DV4 Q;  1UUP A;  1FGU A;  2ICI A;  3G48 A;  2F0S A;  4N8F A;  3CU7 A;  4AQY Q;  2CQA A;  2N49 A;  3F1Z A;  3MXP A;  4BWG B;  4DK0 A;  4DV5 Q;  3T1H Q;  5JEA H;  2MFI A;  1LTT D;  1PXU A;  1Z7T A;  1I5F A;  1KAW A;  3TN2 A;  1PTO D;  5C5L A;  4A76 A;  5EAY A;  4AIM A;  2K14 A;  5J3B A;  4DA2 A;  5ELO A;  1F9P A;  1LTR D;  3NXW A;  4OIJ A;  1JOK A;  4PZ8 A;  3AU7 A;  3LX0 A;  3S1R B;  3JAM c;  1X56 A;  1VQG A;  3J80 L;  2DNC A;  4WOR A;  1YJ9 A;  1E3P A;  1AW7 A;  1RD9 D;  2IPK D;  1PLF A;  5ELN A;  3EQL C;  3BZC A;  4JVZ A;  2K32 A;  4C3H B;  1V43 A;  3ER0 A;  3BVM A;  2NUC A;  3SK5 A;  4LF5 L;  1BVS A;  1VQA A;  2Z9H A;  3J80 i;  3Q8D A;  2K6A A;  4DK1 A;  3SHL A;  2F0G A;  3KBX A;  1SYD A;  2QKI C;  4IPH A;  2EY2 A;  3G6J B;  5G3L F;  4DR1 L;  2Y0S E;  1I50 B;  1EYC A;  4YCV A;  4LFC L;  1PRT B;  1HJP A;  4C3H G;  2RA4 A;  1GXD C;  1E7Z A;  3GTL H;  3PMF A;  3SK4 A;  1SNO A;  1ZXT A;  2Y0S B;  3L9A X;  2B63 H;  1PRT C;  2O5J C;  4ME5 A;  1SNP A;  3MA2 B;  4ZUJ A;  2XRQ D;  3CC2 A;  4GLA C;  1IBM Q;  4L5R C;  1C4Q A;  3I4N B;  3WOE A;  2R93 B;  2Y0S G;  5FLX E;  3S17 H;  1SYF A;  4XQJ A;  2SNM A;  1T5E A;  2IL8 A;  3PF4 A;  2L5T A;  1STB A;  1LT6 D;  1B53 A;  2B8F A;  3ULP A;  4CKE A;  3CME A;  2JA9 A;  4KN7 C;  1I4H A;  5EBD A;  4LF6 Q;  3I4N G;  2PI2 E;  5D3D A;  2R93 G;  1D5Z C;  2ZJQ A;  3H3V I;  3EN2 A;  3UDX A;  3NWS A;  2A6E C;  5E3F A;  3GTQ H;  1RF2 D;  4IZ8 A;  4A3E B;  3SDZ A;  4HJ7 A;  5LMN W;  4C3J B;  1TWF B;  3PUV A;  2MNA A;  4UHV A;  4IQZ A;  4DR5 L;  5LMU L;  3EA6 A;  3VR6 A;  5CC4 A;  3I55 A;  1B2T A;  1GVP A;  4HIM A;  1UEA B;  3FPU B;  4MIU A;  4X65 Q;  3BZD B;  1CSP A;  2QDL A;  1TR5 A;  4A3E G;  2NTS A;  4X64 Q;  4NMZ A;  2ZTC A;  4C3J G;  2VUM G;  4DV1 L;  2E2D C;  5IGE A;  4JI1 Q;  4DV3 L;  3PUW A;  1M8A A;  1H9J A;  1JC7 A;  2OF1 A;  1IBK Q;  4A3M H;  3LNN A;  4PG3 A;  2PW5 A;  3OTO Q;  1TS5 A;  1KLG D;  4IUR A;  5C0X J;  1AE2 A;  4CDE C;  1LTA D;  2EY1 A;  2NN6 G;  1RKN A;  4RCN A;  3GTP H;  4XQQ A;  1O7Z A;  4UPA A;  3S1Q H;  4A3K H;  2N78 A;  5IT9 E;  4P2C B;  1WCM H;  1CA5 A;  4PZ6 A;  3HFZ B;  4JOI A;  4GKK L;  3V2T A;  1PZK D;  2C9O A;  2ICE C;  3TRE A;  1JWM D;  1EUJ A;  4DV2 L;  1K83 H;  3QJY A;  4QF4 A;  4JI2 L;  4A93 B;  5A2Q E;  1TVX A;  1SE2 A;  4BY7 B;  4KD4 A;  1PH5 A;  1ICW A;  3S2D B;  1LTL A;  3TS2 A;  3FVQ A;  2WAQ E;  2KVM A;  4LF9 Q;  2ES2 A;  2E2H B;  2UXB L;  1W3S A;  3S1M B;  2NBF A;  1CKM A;  5JOB A;  1HFN A;  3MXG A;  2WAQ B;  4XIG S;  4A93 G;  2ZM6 Q;  1ILP A;  1S5C D;  2K75 A;  1H95 A;  1O7L A;  4BY7 G;  4DU9 A;  1ML0 D;  2F0T A;  3W2D A;  1J5E Q;  5IGF A;  1BBX C;  2HUG A;  1TT2 A;  2B8G A;  1D1I A;  1K8A C;  4J8Q A;  4NXN Q;  1EZ6 A;  4KLK A;  5LL6 S;  4XDX A;  4LMQ D;  4B9X A;  3BDC A;  1KNE A;  2M00 A;  5C44 G;  1UE6 A;  4EVO A;  1N32 Q;  1ZKO A;  1O80 A;  3PO2 B;  3KF8 A;  5FO9 B;  2I07 B;  3E9I A;  4LAA A;  2HT1 A;  3GV3 A;  4JV5 L;  4KTA A;  1E24 A;  3H0G G;  4KKT A;  1STY A;  1NY4 A;  3S1R H;  4LF8 Q;  4BY1 B;  5BR8 Q;  1NMF A;  2C5C A;  1BDO A;  4DR7 Q;  3PO2 G;  1GM5 A;  1CK1 A;  1ROD A;  4TSS A;  1EOV A;  3OMG A;  4YWL A;  2RSO A;  3AMU A;  2E8G A;  3D4W A;  3DWA A;  3EVQ A;  5EQ0 A;  3U9O A;  1PH7 A;  4C3H H;  3GO5 A;  5I6W A;  3GQB A;  4DUY L;  1R4Q B;  1CHP D;  1UE5 A;  1KRT A;  3J81 E;  2K4K A;  2E74 C;  4R4Q A;  4YCW A;  5HGQ A;  5C4H A;  3NTH A;  1I50 H;  3FPP A;  1JQY D;  2RHQ B;  1ENC A;  1KAA A;  1TII D;  2VQF Q;  5I4D A;  1GO3 E;  5COR A;  4EQO A;  4YHH L;  5GQO A;  1TS2 A;  3PSI A;  1QVC A;  3CP0 A;  4K8J A;  3K59 A;  4OON A;  3M7N A;  2CW0 C;  1U9R A;  2ZXR A;  2N8N A;  3I4N H;  2R93 H;  3A54 A;  3VDY A;  2K1B A;  1Q81 C;  1KNA A;  1I4G A;  4GNX B;  1LT4 D;  4KJN A;  4K14 A;  5FJ8 G;  4JYA L;  1PZJ D;  1TQO A;  2B2U C;  3A7A B;  1W6J A;  4O0A A;  1XMO Q;  2UUB Q;  3W5O A;  3M4O B;  4JI0 Q;  1N33 Q;  2MO1 A;  4GNX C;  2NB0 A;  1E1T A;  1U4M A;  3DMU A;  2E5L L;  3NBI A;  1EU3 A;  1TWG B;  1SAP A;  3AQQ A;  1LLR D;  4A3E H;  4DR2 L;  1X3E A;  4JBK A;  4P72 A;  3UDI A;  4C3J H;  2F4V L;  2WKD A;  3M4P A;  2PCF B;  4H13 C;  2F3I A;  4FF4 A;  1VQM A;  3K8A A;  4L5T A;  1YZ6 A;  3K0X A;  1P8L A;  3EJI A;  1DCZ A;  3JAM E;  1UWV A;  4GLX A;  3K6O A;  1LUZ A;  4ZYS A;  1MJE A;  1VMP A;  4JBW A;  4MTK A;  1JE5 A;  2QW7 A;  1A15 A;  4F87 A;  2NN6 H;  3Q22 A;  2VW9 A;  4KY6 A;  1B50 A;  2VNU D;  1SJE D;  4DPG A;  1MBY A;  1A2U A;  3HKZ E;  3G71 A;  5FLM G;  3O13 A;  1SNC A;  1G91 A;  1XNQ Q;  4GS3 A;  1XPU A;  4XXE A;  2B2U A;  2JA5 B;  3HKZ B;  4F8M A;  1OO9 B;  1EYD A;  1EFI D;  1F77 A;  2K03 A;  2AKW B;  5FKA C;  1SEB D;  2UU9 Q;  5JPM C;  3GTK B;  3F8T A;  3MC0 B;  4DF7 A;  1JJC B;  1I6V C;  2JA5 G;  3OIP A;  1IBL L;  3HKZ G;  3Q0A A;  3K5O A;  2KEE A;  4QUF A;  1JOO A;  1C7Y A;  5C6A A;  3UI2 A;  2XVS A;  2L1B A;  4DK3 C;  5C0X H;  4NXM Q;  5LHY 1;  4A93 H;  5M5Y H;  2HQL A;  4FDB A;  4BY7 H;  4C56 C;  1Z47 A;  1FVI A;  1D6E C;  3S2D H;  1PMR A;  2E2H H;  4LNQ A;  3STB C;  5ELC A;  3CW2 C;  3S1M H;  2GVA A;  4CDF C;  3GTO B;  1BO0 A;  4FYD A;  1QNU A;  4A3B B;  1H9R A;  2G5D A;  1B9N A;  1VCI A;  2B2W C;  2WKC A;  1X3Q A;  1C0A A;  3IAY A;  2EYJ A;  4BXX G;  1K8M A;  2EPB A;  3L2P A;  3ICE A;  4X3T A;  3G7L A;  5HY6 A;  4EQN A;  4LFA L;  3UE1 A;  1EY0 A;  4HSP A;  1DZ1 A;  1G2S A;  2CKZ B;  5C3W A;  2JJQ A;  3NEN A;  1JOQ A;  1PTO F;  2RBM A;  4A3B G;  3QIA A;  1QUQ B;  3PO2 H;  3CPF A;  1ONL A;  3T53 B;  4DUZ L;  1AP0 A;  3IKJ A;  3BVZ A;  2Z8L A;  4K2L A;  1MI2 A;  3RD4 A;  2K01 A;  2UXD L;  3VYR A;  4BY1 H;  5J39 A;  1SRO A;  4PV1 C;  3K81 C;  4X66 L;  1PH8 A;  3KFU A;  3S2H B;  1BR9 A;  3W3A A;  1L1O A;  4OHJ A;  4MTN A;  1VQD A;  2JA6 B;  3CD6 A;  2X69 A;  4B3T Q;  3DHQ A;  2K5H A;  5C3X A;  3RZO B;  1B44 D;  2RSN A;  1I94 L;  3HOU B;  4XTC S;  2JA6 G;  4JC0 A;  2B2W A;  5IYB G;  3MXU A;  4OIK A;  4A3C G;  1VQ8 A;  3JC6 6;  4YY3 L;  4LW1 A;  2NN6 I;  3A74 A;  2MUY A;  1E1O A;  2YTX A;  3HOW B;  3HOU G;  3NTI A;  4FF3 A;  5DM6 3;  4H7B A;  2JP1 A;  2NZ1 D;  5KEE A;  1QJO A;  1EEI D;  4JI3 L;  1X3F A;  1D1K A;  1Q90 A;  5FJ8 H;  5EKK A;  1Y8N B;  1S3O A;  1U4P A;  1KHI A;  2ZXP A;  1FL0 A;  1EQV A;  2SNS A;  3RR5 A;  3HOW G;  1STG A;  3FDT A; 
#chains in the Genus database with same CATH homology
 2EYF A;  4L6T B;  2G9H D;  4IFD J;  3VR5 A;  2EJF C;  1NR2 A;  4BBR B;  2WV6 D;  3ONA B;  1DOM A;  2EXZ A;  2TSS A;  1BQQ T;  1GUN A;  3X3M A;  4UAI A;  1S4Z A;  1D2B A;  1QE6 A;  2NVX B;  5C0X I;  3NTK A;  1V1P A;  2F0U A;  1XTC D;  2NWG A;  2O5I C;  1PRT F;  1T5X D;  4LK1 C;  2XWJ B;  2QDB A;  4X3U A;  3T13 A;  1R4P B;  4A3G B;  1FGB D;  2F0K A;  4XYQ A;  1U4L A;  2KCN A;  4WFN 3;  4C1N K;  3VYU A;  4I7Z C;  2D5D A;  4U67 3;  4ZRZ A;  1EQT A;  1K8O A;  3P20 A;  4K2K A;  1QNK A;  2HQE A;  3DXJ C;  5LL6 X;  2BDO A;  4G7Z C;  5I6Y A;  2IT1 A;  5CV6 A;  1A6X A;  2O4X A;  4C1N I;  1JCK B;  1CTM A;  1VF5 C;  1PTO B;  1STN A;  4A3K B;  3S1Q B;  4FXD A;  4ILW A;  2K04 A;  2Q8I B;  3TP7 A;  1WTO A;  4K5V A;  1VF7 A;  1VDZ A;  1M4V A;  3OPO A;  1EEF D;  1G6Z A;  3C1E A;  3M7G A;  4RHS A;  5K36 G;  1GUS A;  1S5E D;  4TKO B;  2B2T C;  3K5L A;  2XSC A;  2EYP A;  1KDB A;  3IL8 A;  3M3Y B;  2VB3 X;  1LTS D;  1J9O A;  1ET6 A;  5JJZ A;  1NCV A;  4PMC A;  1F2Z A;  1SMY D;  2L9H A;  3ND9 A;  3C3L A;  4KJO A;  3N52 A;  5IGG A;  1JB3 A;  1GHK A;  5M5X B;  1F9R A;  1NUC A;  1D5X C;  2LMC B;  1XXG A;  4FF1 A;  5COY A;  5CR3 A;  5JPN C;  1CFM A;  3R93 A;  4DFA A;  2NVY B;  1SYG A;  2BDN A;  4RHR A;  5I2X A;  4C3I B;  4N9P A;  4TQU S;  2B2T A;  4N9T A;  2BA0 A;  3I72 A;  4RKL A;  2EJG C;  1STA A;  1OXX K;  2J0T D;  3MZ5 A;  2A6H D;  1RJT A;  4C3I G;  4RWS C;  5M3M B;  4A3F B;  2L0C A;  5IIF A;  1WTW A;  1KDA A;  4QCL A;  1I4Q A;  2TMP A;  5I9O A;  5DAU A;  1CQF A;  5CBE E;  4XYO A;  3N6R A;  1HTL D;  1BCP D;  5EJW A;  4AYB B;  1FYC A;  3I3C A;  2OXP A;  4RA8 A;  3E0J A;  1RCV D;  1EL0 A;  1SNQ A;  1SSO A;  3TDQ A;  1WD0 A;  1YNJ D;  3S1N B;  2KOL A;  1EY6 A;  1NAP A;  2H4O A;  1B1Z A;  5IGB A;  2SDF A;  2H1E A;  1QCB D;  1SBB B;  3SK8 A;  3WOF A;  4IFD H;  5ELB A;  1L0Y B;  1GUO A;  5KNC A;  3HZX A;  3NBH A;  5E4W C;  2NYZ D;  1IHZ A;  2R92 B;  2EDG A;  2XIW A;  4FXG C;  1I4P A;  1G8Z D;  1UAP A;  4KMU C;  4PQX A;  3QB3 A;  1IL8 A;  2EYH A;  5DM7 3;  3HOY B;  2I46 A;  3VA7 A;  3BYT B;  1E0B A;  2L11 A;  3HOV B;  2L12 A;  1GHJ A;  2XRS D;  3P75 A;  2LY7 A;  3D6W A;  4ABN A;  4DXF A;  4IN3 A;  5J1Z A;  1E2W A;  2DN8 A;  1B9M A;  4KN4 C;  2AUJ D;  2Z4H A;  1E2V A;  3S14 B;  1ET9 A;  2F0J A;  1PTO H;  1CHQ D;  4ZKB B;  1RTO A;  5CYU A;  3VR4 A;  2PZW A;  5K36 H;  2BE5 D;  2GA4 B;  3D31 A;  2N55 A;  5CBA E;  2IJ0 A;  4NW2 A;  1ZYR D;  5C3E B;  2AQ3 B;  1LTG D;  5CV8 A;  5M5Y B;  3P7J A;  3VYT A;  2AQ1 B;  4BBS B;  1WTR A;  3KK7 A;  1CZW A;  2LKV A;  2F03 A;  4NKL A;  4H44 C;  2PW7 A;  5C0X G;  1STE A;  1Y1V B;  5EPK A;  5D65 A;  3T4A C;  2F1M A;  2F0V A;  5K5P A;  1AZQ A;  2JE6 I;  4ZAI A;  1YNN D;  2D62 A;  1LO5 D;  2JEB I;  2NTT A;  3RZD B;  1PFB A;  5HGT A;  4B08 A;  1Y8O B;  1GOZ A;  5DEH A;  3PO3 B;  3CRL C;  3WDN A;  4QMG A;  3I8Z A;  2PNR C;  1IYV A;  2IW3 A;  1XYI A;  4IUT A;  1S5D D;  5D14 A;  1JR0 D;  4HR7 B;  1A2T A;  3SR1 A;  3HEJ A;  1L0X B;  3E5S A;  1HUM A;  2WAC A;  1EU4 A;  3PUZ A;  1SYE A;  1JIC A;  1JE4 A;  1CQV A;  1EY7 A;  3R2T A;  4BA1 I;  5FO7 B;  1PFN A;  4Y7N B;  2XN9 C;  1TWA B;  3Q6S A;  5CV4 A;  1JWU D;  4K5X A;  1XX8 A;  1FR3 A;  3DEP A;  3NSW A;  5E4X A;  5CV9 A;  3NQI A;  5ELD A;  1QIL A;  1MSH A;  3IFD A;  3BDL A;  3I4L A;  3CHB D;  2WIN B;  3L7Z C;  1LT3 D;  4R8I A;  2A68 D;  3MXN A;  4PMW A;  3MFY A;  1V1O A;  1RDP D;  1PFM A;  2F4I A;  5EKI A;  1LAC A;  1BF4 A;  3GTM B;  5CMD A;  5FO8 B;  4HSV A;  4IUN A;  4IUU A;  1EY4 A;  4M1U B;  1DD2 A;  3HOZ B;  3BYY B;  3NE5 B;  1TY2 A;  5KNB A;  4MN3 A;  3R8B A;  3OIQ A;  2A74 C;  2HCC A;  3DEO A;  2K5D A;  3X3N A;  3NK9 A;  2K05 A;  1XWE A;  4G57 A;  2ZT9 C;  2NVQ B;  2F0E A;  2KCC A;  4HCE A;  4BA2 I;  1HA5 A;  4FXK C;  2RVL A;  1Y69 U;  3A56 A;  4Z9C B;  3VR3 A;  3DWP A;  2K7V A;  2F3W A;  4A3D B;  2AWO A;  4ULL A;  5T1G A;  2EOT A;  2A69 D;  5IT9 L;  1Q8I A;  4O42 A;  4M8A A;  2HDL A;  5JEA J;  1OXT A;  5ELE A;  3AB9 A;  3H3V C;  3ND8 A;  5A2Q L;  2MHV A;  3ERQ A;  2QF7 A;  2F0H A;  3KLS X;  1SNM A;  4U68 A;  3D3R A;  3J80 E;  2MJ8 A;  2ID0 A;  2EY5 A;  4FVM A;  1HQM C;  1NR4 A;  3T16 A;  3BS1 A;  4CKB A;  1R9T B;  2BOS A;  5C4X B;  2F0D A;  2K5Q A;  4RGM A;  1AFP A;  1V1P B;  2JXM B;  1EY5 A;  1QOH A;  4J6H A;  3I4M B;  1HA6 A;  4DAY A;  1GUG A;  1SJH D;  2KHS A;  4IUQ A;  1SE4 A;  2AWN A;  3QG1 A;  3TP6 A;  4OO1 H;  2F0I A;  1VMC A;  3A8J E;  1I4R A;  1E2Z A;  1BCP F;  2X6L A;  5CV7 A;  3OWF A;  3R3O A;  2F0P A;  3NUC A;  5EKL A;  4YIJ A;  2N88 A;  3K57 A;  2Z1C A;  2M2L A;  3C46 A;  3QOL A;  3CQZ B;  2MPM A;  2A73 B;  2FMM A;  3HG9 A;  1FNV A;  2K5W A;  1G2T A;  3CKI B;  2DY8 A;  2EYL A;  1WVL A;  2F3V A;  4DGZ A;  3MWY W;  1FNW A;  2R61 A;  1F9S A;  4G7O C;  3ERO A;  5HUR A;  1F9Q A;  4IFD G;  1NSN S;  2NVT B;  3S9W A;  1EY9 A;  2F0L A;  2KED A;  1TU2 B;  4HAE A;  4ZUI A;  5EGT A;  5CGK A;  4E6I A;  1H9M A;  5KYL A;  2PPB C;  1CT1 D;  3PIO 3;  2FIN B;  4CJ2 C;  1TY0 A;  3DWQ A;  2Q8R E;  3S16 B;  3JAM L;  4HMI A;  4CJ0 B;  2D9U A;  5ISR A;  2F0M A;  1EWH A;  3HRZ C;  4L63 B;  3A7L A;  4V19 0;  2E2J B;  1U4R A;  1QB5 D;  1TWH B;  1SMY C;  5KRU A;  3RUZ A;  3GV6 A;  1PZI D;  1UNS A;  5BN5 A;  5EPJ A;  3TME A;  2R3Z A;  3SE0 A;  3V96 A;  5F2D A;  2MGS A;  5I9P A;  4PNY A;  2MP1 A;  1TS3 A;  1EWC A;  2YU9 B;  3PIP 3;  5BN3 A;  3TBI B;  3NHH A;  1RHP A;  5JVG 3;  1HRJ A;  2A6H C;  1Q3L A;  3K7A B;  4ZLT F;  1ENA A;  4JK1 C;  2RDG A;  1HUN A;  5IGD A;  1DJR D;  2IX3 A;  2IX1 A;  1TWC B;  4G7H C;  4XQN A;  1BCP B;  2PQE A;  1BCP C;  4FO2 A;  3KBG A;  1Y1W B;  1CI3 M;  4FNF A;  2KQ3 A;  1CZG A;  5D3I B;  4J1M A;  4L8J A;  2FHT A;  4IAL A;  3OMC A;  3PUY A;  1JOR A;  1YNJ C;  4KY7 A;  4K6L A;  4QB4 A;  2ZXO A;  5I2Y A;  4RGN A;  1F2Y A;  2VXW A;  3I73 A;  3VYS A;  2CVR A;  4HMJ A;  1HFG A;  4F88 A;  2J7Z A;  4B9W A;  1EY8 A;  3HOX B;  4K6D A;  3D6C A;  3C1F A;  5JAV A;  1LT5 D;  1LTI D;  4R8N A;  1FNU A;  4KHV A;  5BN4 A;  2IX0 A;  3OHX C;  2EE1 A;  4RKB A;  3U9S A;  4NP5 A;  2R7Z B;  4ODG A;  2WP8 J;  5J22 A;  4KI0 A;  5IOD A;  2BE5 C;  3K5N A;  5M5W B;  1ESF A;  1ZYR C;  1RTN A;  3GTJ B;  2VUM B;  3FMC A;  1EOT A;  3J7A F;  1PRT D;  4ZK9 B;  1Q1E A;  1HXY D;  3H6M A;  1LV9 A;  1AEX A;  4ZQ3 A;  1WTP A;  1ENF A;  1I6H B;  1IW7 C;  4RH6 A;  2EY6 A;  5M3F B;  1SXT A;  5NUC A;  2VB2 X;  2PZT A;  3SK6 A;  1YNN C;  4X3K A;  2A6E D;  1GJX A;  3D4D A;  3HP3 A;  3QO2 A;  3I70 A;  2QEJ C;  3OSO A;  3MEH A;  1MSG A;  2PO4 A;  4CBV A;  4IUV A;  3CRK C;  1QWY A;  4KHZ A;  4KKS A;  4EQP A;  2F0N A;  1IW7 D;  2Z4I A;  4R9W A;  5IGC A;  3FKI B;  2KA7 A;  4IUP A;  3Q23 A;  2PMZ B;  3DM1 A;  4GZY C;  5C44 B;  5T1I A;  4KKU A;  1FD7 D;  1HTP A;  2SOB A;  3PUX A;  4O1N A;  2ENB A;  2SEB D;  1BUV T;  2EZV A;  1WTX A;  1G29 1;  3H0G B;  1HCZ A;  3LWE A;  2AUK A;  1PYW D;  2F0F A;  3PV0 A;  4QIW B;  4IFD I;  4RFB A;  4V0B A;  5A35 A;  2B39 A;  2F0W A;  2B2V C;  2KUM A;  4CGY B;  1BXT A;  4KK7 A;  1S5F D;  2FFK B;  3URY A;  1SFO B;  3J7Y W;  3BG3 A;  4H0L C;  2XWB B;  3GD7 A;  4DN4 M;  4X3S A;  5C4Z A;  1WD1 A;  1I3Q B;  3D4R A;  4A3I B;  1HHV A;  4C2M B;  1WTQ A;  2A68 C;  3QOJ A;  4FP5 D;  1STH A;  1CA6 A;  3A8K E;  2JA8 B;  3ZYY X;  3R2I A;  1DOL A;  3A8I E;  3MFG A;  2J4X A;  1MGS A;  4OO1 G;  3P1H A;  5G3L D;  3OWE B;  4S3S A;  4FF2 A;  3S15 B;  1DXM A;  3VA5 A;  4K8I A;  2PYK A;  1DOK A;  2E2I B;  2JA7 B;  2B2V A;  1H9K A;  1HQR D;  4HED A;  1DM0 B;  1F2L A;  3LWU A;  1KAB A;  1X32 A;  2XNA C;  3K0Y A;  2Q8T A;  2EYM A;  3KLS A;  5FLX L;  1B4O A;  2HDM A;  4KD3 A;  1DON A;  3MHB A;  3NWT A;  2KJX A;  2O2L D;  5KND A;  3TZU A;  2QIL A;  5AFW A;  2EJM A;  4HTH A;  2CW0 D;  1B3A A;  2JYO A;  1BOS A;  3M85 A;  2A69 C;  1OXS C;  1A3T A;  3V05 A;  3DUZ A;  1CM9 A;  1C48 A;  1S5B D;  2G9D A;  3EFX D;  3SXH A;  5CV5 A;  1TS4 A;  2X6G A;  2OEO A;  3QWN A;  4BS9 A;  2DY7 A;  5FK9 C;  4DAP A;  1PDQ A;  2L55 A;  3GTG B;  2RDF A;  3K5M A;  3GP7 A;  2QCP X;  1GUT A;  4A3J B;  2WB1 B;  1EIH A;  3MVV A;  2DNE A;  3H09 A;  5ELF A;  1KTK A;  4NDX A;  1ILQ A;  2YYZ A;  3Q24 A;  4WJW A;  3T51 B;  5DNF A;  1F2M A;  3OOC A;  1QG7 A;  4K5W A;  1TKW B;  5C4J B;  1ESR A;  1SYC A;  1A3U A;  5KYI A;  1O78 A;  4CJ1 B;  1LAB A;  5EBC A;  1JWS D;  3FRP B;  3MAQ A;  4PMB A;  1IYU A;  1HPC A;  1EZ8 A;  2KEC A;  2PZU A;  2JEA I;  1A3V A;  4RAU C;  3BVG A;  2LFN A;  2WII B;  2D2C C;  1IKM A;  2M9V A;  2RDH A;  1II3 A;  1SND A;  4HN7 A;  2BA1 A;  4LJZ C;  5C5M A;  4DNT B;  1C8C A;  1O7Y A;  3HS0 C;  4MHE A;  1KDC A;  5JEA G;  3RLF A;  3TSS A;  4ZKC B;  2CHB D;  4KY5 A;  3L3O C;  4CHT B;  2F0O A;  1W6K A;  2HCI A;  1OXV A;  3D8G A;  4OL7 A;  4RCO A;  2E75 C;  1EIG A;  4CKC A;  2FMC A;  1D5M C;  1ZEQ X;  2K33 A;  3VR2 A;  3TP5 A;  2V4D A;  4DNR B;  2IWH A;  3HGB A;  1IKL A;  5E1F A;  3MTS A;  5KGU A;  3NQT A;  3TZD A;  1EYA A;  3J81 L;  4Q0F A;  1Q1B A;  4G4K A;  3SEB A;  2EYO A;  3GTL B;  3E6Z X;  2B63 B;  3A55 A;  2B2Y C;  4F7X A;  1MD2 D;  1AN8 A;  5EPL A;  1LTB D;  4WRD A;  2EVB A;  3S17 B;  1I4X A;  1GUW A;  4QUC A;  4OGQ C;  2R6G A;  4KV6 A;  5M9O A;  1WTV A;  2JSO A;  3IFT A;  3I91 A;  1H9S B;  4RGO S;  3FEW X;  3H91 A;  2E76 C;  4DAV A;  1KLU D;  1AZP A;  2OT2 A;  3GTQ B;  1BNZ A;  2LS0 1;  2BCO A;  3K58 A;  3I90 A;  1Z6H A;  4EGV A;  2A5H A;  1SYB A;  3BDO A;  1OXU A;  1Q12 A;  4XT1 B;  3F2U A;  3NP8 A;  5TSS A;  3SVM A;  5KIX A;  3OW7 A;  2AQ2 B;  4XT3 B;  2B2Y A;  4I65 A;  2L4N A;  4HCS A;  3TP8 A;  2F0Q A;  1V8Q A;  4A3M B;  5JVH 3;  1DYQ A;  2K28 A;  3KLR A;  5FOB B;  1SDF A;  1X3P A;  2RKS A;  4RGT A;  3ITP A;  3GTP B;  4Q5V A;  3RMH A;  1H9S A;  1WCM B;  1Y8P B;  3H94 A;  4TRD A;  1PTO C;  4ID6 A;  4OO1 I;  5IOC A;  1SE3 A;  3KUP A;  1K83 B;  3M4Y A;  2FJ2 A;  4UDU C;  4DXG A;  3T56 B;  2RQX A;  3C2P A;  3NPP A;  1J8I A;  3J7A V;  1UUP A;  2ICI A;  2F0S A;  3CU7 A;  2CQA A;  3MXP A;  4BWG B;  4DK0 A;  5JEA H;  1LTT D;  1PXU A;  1Z7T A;  3TN2 A;  1PTO D;  5C5L A;  4DA2 A;  1F9P A;  1LTR D;  4OIJ A;  3NXW A;  1JOK A;  3AU7 A;  3LX0 A;  3S1R B;  3J80 L;  2DNC A;  4WOR A;  1AW7 A;  1RD9 D;  2IPK D;  1PLF A;  3EQL C;  2K32 A;  4C3H B;  1V43 A;  3BVM A;  2NUC A;  3SK5 A;  2K6A A;  4DK1 A;  3SHL A;  2F0G A;  3KBX A;  1SYD A;  2QKI C;  2EY2 A;  3G6J B;  5G3L F;  1I50 B;  1EYC A;  1PRT B;  4C3H G;  2RA4 A;  1GXD C;  3PMF A;  3SK4 A;  1SNO A;  1ZXT A;  2Y0S B;  3L9A X;  1PRT C;  2O5J C;  4ME5 A;  1SNP A;  3MA2 B;  4ZUJ A;  2XRQ D;  1C4Q A;  3I4N B;  3WOE A;  2R93 B;  5FLX E;  1SYF A;  4XQJ A;  2SNM A;  1T5E A;  2IL8 A;  2L5T A;  1STB A;  1LT6 D;  1B53 A;  2B8F A;  4CKE A;  4KN7 C;  1I4H A;  5EBD A;  5D3D A;  1D5Z C;  3NWS A;  2A6E C;  5E3F A;  1RF2 D;  4IZ8 A;  4A3E B;  3SDZ A;  4C3J B;  1TWF B;  3PUV A;  4IQZ A;  3EA6 A;  3VR6 A;  5CC4 A;  1B2T A;  1UEA B;  3FPU B;  4MIU A;  3BZD B;  1TR5 A;  2NTS A;  4NMZ A;  4C3J G;  2E2D C;  5IGE A;  3PUW A;  1M8A A;  1H9J A;  1JC7 A;  2OF1 A;  3LNN A;  2PW5 A;  1TS5 A;  1KLG D;  4IUR A;  5C0X J;  1LTA D;  2EY1 A;  2NN6 G;  1RKN A;  4RCN A;  4XQQ A;  1O7Z A;  5IT9 E;  4P2C B;  1CA5 A;  3V2T A;  1PZK D;  2C9O A;  2ICE C;  1JWM D;  3QJY A;  4QF4 A;  4A93 B;  5A2Q E;  1TVX A;  1SE2 A;  4BY7 B;  4KD4 A;  1ICW A;  3S2D B;  3FVQ A;  2KVM A;  2E2H B;  3S1M B;  2NBF A;  5JOB A;  1HFN A;  3MXG A;  2WAQ B;  4XIG S;  1ILP A;  1S5C D;  1O7L A;  4DU9 A;  1ML0 D;  2F0T A;  3W2D A;  5IGF A;  1BBX C;  2HUG A;  1TT2 A;  2B8G A;  1D1I A;  4J8Q A;  1EZ6 A;  5LL6 S;  4XDX A;  4LMQ D;  4B9X A;  3BDC A;  1KNE A;  2M00 A;  4EVO A;  1ZKO A;  1O80 A;  3PO2 B;  3KF8 A;  5FO9 B;  2I07 B;  4LAA A;  3GV3 A;  4KTA A;  4KKT A;  1STY A;  4BY1 B;  2C5C A;  1BDO A;  1CK1 A;  1ROD A;  4TSS A;  3OMG A;  2RSO A;  3AMU A;  3D4W A;  3DWA A;  3EVQ A;  5EQ0 A;  3U9O A;  3GO5 A;  5I6W A;  3GQB A;  1R4Q B;  1CHP D;  3J81 E;  2E74 C;  5C4H A;  3NTH A;  3FPP A;  1JQY D;  1ENC A;  1KAA A;  1TII D;  5I4D A;  5COR A;  4EQO A;  1TS2 A;  4K8J A;  3K59 A;  3M7N A;  2CW0 C;  1U9R A;  2ZXR A;  3A54 A;  2K1B A;  1KNA A;  1I4G A;  1LT4 D;  4KJN A;  4K14 A;  1PZJ D;  1TQO A;  2B2U C;  3A7A B;  1W6J A;  3M4O B;  2NB0 A;  1U4M A;  3DMU A;  3NBI A;  1EU3 A;  1TWG B;  1SAP A;  1LLR D;  2WKD A;  2PCF B;  4H13 C;  4FF4 A;  3EJI A;  1DCZ A;  3JAM E;  3K6O A;  4ZYS A;  1VMP A;  4JBW A;  1A15 A;  4F87 A;  2NN6 H;  3Q22 A;  4KY6 A;  1B50 A;  2VNU D;  1SJE D;  1A2U A;  1MBY A;  3O13 A;  1SNC A;  1G91 A;  4XXE A;  2B2U A;  2JA5 B;  3HKZ B;  4F8M A;  1OO9 B;  1EYD A;  1EFI D;  1F77 A;  2K03 A;  5FKA C;  1SEB D;  5JPM C;  3GTK B;  3MC0 B;  4DF7 A;  1I6V C;  3OIP A;  3Q0A A;  3K5O A;  2KEE A;  4QUF A;  1JOO A;  5C6A A;  3UI2 A;  2XVS A;  2L1B A;  5C0X H;  5LHY 1;  4C56 C;  1Z47 A;  1D6E C;  1PMR A;  5ELC A;  3GTO B;  1BO0 A;  4FYD A;  1QNU A;  4A3B B;  1H9R A;  1B9N A;  1VCI A;  2B2W C;  2WKC A;  1X3Q A;  3IAY A;  2EYJ A;  1K8M A;  2EPB A;  4X3T A;  3G7L A;  4EQN A;  1EY0 A;  4HSP A;  1DZ1 A;  1G2S A;  5C3W A;  1JOQ A;  1PTO F;  2RBM A;  3QIA A;  1ONL A;  3T53 B;  1AP0 A;  3IKJ A;  3BVZ A;  2Z8L A;  4K2L A;  1MI2 A;  3RD4 A;  2K01 A;  3VYR A;  5J39 A;  4PV1 C;  3S2H B;  1BR9 A;  3W3A A;  4OHJ A;  2JA6 B;  2X69 A;  3DHQ A;  5C3X A;  3RZO B;  1B44 D;  2RSN A;  3HOU B;  4XTC S;  2B2W A;  3MXU A;  4OIK A;  2NN6 I;  2MUY A;  3HOW B;  3NTI A;  4FF3 A;  5DM6 3;  4H7B A;  2JP1 A;  2NZ1 D;  5KEE A;  1QJO A;  1EEI D;  1D1K A;  1Q90 A;  5EKK A;  1Y8N B;  1U4P A;  2ZXP A;  1EQV A;  2SNS A;  1STG A;  3FDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...