3TN2A

Structure analysis of mip1-beta p8a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
68
structure length
68
Chain Sequence
b'APMGSDPATACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 4
publication title Structures of human CCL18, CCL3, and CCL4 reveal molecular determinants for quaternary structures and sensitivity to insulin-degrading enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 14
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tn2A00
1F9RA 2Q8TA 1X3PA 4ZLTF 1F9SA 1ML0D 2FINB 2KEEA 4X3SA 2KECA 2Q8RE 4IUTA 4IUVA 1G2TA 3R93A 2XIWA 1A15A 5D65A 4X3TA 1B50A 2KVMA 2RSNA 1MSHA 4IURA 1HUMA 5CBAE 2B2YA 1RTOA 3IL8A 2R3ZA 4XDXA 1EOTA 1BNZA 2L11A 4ZKCB 2N55A 4HAEA 1KNAA 1PDQA 1HFGA 2KUMA 2MPMA 4R9WA 1O7ZA 4U68A 2DY7A 1WTOA 1HUNA 2FFKB 5D14A 5EJWA 3I91A 2EE1A 1WD1A 1DZ1A 1LV9A 1RHPA 4RA8A 4X3KA 2IL8A 1F9QA 3QO2A 4OIKA 1IKMA 1U4LA 2K1BA 2X6LA 3SVMA 2KEDA 1WTXA 1HHVA 5T1GA 3P7JA 1EIGA 1IKLA 2FJ2A 2MJ8A 1NCVA 1XX8A 3MTSA 4QUCA 5CMDA 5JJZA 2FHTA 2NWGA 1B2TA 1G91A 2BDNA 3H91A 1IL8A 2B2VC 2K03A 2K01A 1ILPA 1G6ZA 1B53A 1NR2A 2J7ZA 2NYZD 2MP1A 2RVLA 3GV6A 1BF4A 1GUWA 3KBXA 5CORA 1SAPA 2K28A 3KUPA 2RA4A 1U4PA 1KNEA 1O7YA 4ZKBB 1AZPA 3GV3A 2HCCA 1AZQA 2MGSA 3DEPA 1DONA 1VMPA 1Q3LA 4RWSC 1G2SA 1RJTA 1PFBA 2JYOA 4QUFA 4LMQD 1F2LA 2VXWA 1RODA 1EQTA 1WTPA 5EQ0A 2HCIA 1QG7A 2HUGA 5CBEE 4NW2A 2B2VA 1PFNA 3UI2A 1SSOA 2H1EA 1JICA 2B2WC 4HSVA 2B2TC 5E4WC 1ESRA 1DOKA 5EPKA 3I8ZA 3Q6SA 4RAUC 1WTVA 1X32A 4HEDA 5EPJA 2L1BA 1WTWA 2L9HA 1PLFA 2HDMA 1MSGA 3FPUB 1X3QA 3I90A 1MI2A 1O80A 1B4OA 3G7LA 1BO0A 1WTRA 1M8AA 2B2UC 2D9UA 1ILQA 4O42A 3DM1A 4ZAIA 4XT1B 2JP1A 2M2LA 5EPLA 2EOTA 1HFNA 1XYIA 2SDFA 3N52A 4CJ2C 1WVLA 3TZDA 1QNKA 1DOLA 2B2WA 3LWEA 2B2TA 4OIJA 4X3UA 3TN2A 4CJ0B 1C8CA 1RTNA 2EPBA 4R8IA 1WD0A 4UAIA 2CVRA 5DNFA 1JE4A 1TVXA 4HCSA 1B3AA 4IUUA 1DOMA 2FMMA 1U4MA 3MWYW 1PFMA 1E0BA 1F9PA 1NR4A 1VMCA 2L4NA 2HDLA 2K04A 2B2UA 2NZ1D 1CA6A 2KOLA 2K05A 1WTQA 1CA5A 1NAPA 3D6WA 3ONAB 1EL0A 4IUQA 2X6GA 5COYA 1J9OA 3HP3A 2RSOA 1U4RA 1ZXTA 1QE6A 1BBXC 3I3CA 3FDTA 4CJ1B 1HA6A 1MGSA 4IUPA 4ZK9B 4MHEA 1SDFA 2B2YC 4XT3B 2L12A 5T1IA 2X69A 1AP0A 5EKIA 3IFDA 3F2UA 2N88A 1CM9A 5AFWA 3DEOA 5E4XA 1HRJA 4MN3A 1J8IA 2DY8A 1ICWA 1EIHA 1S4ZA 4DN4M
chains in the Genus database with same CATH superfamily
2H4OA 1F9RA 3OWEB 4RCOA 1A15A 1B50A 4AYBE 2KENA 1MIUA 4H7BA 2ZTCA 2F0QA 1KNAA 3VR3A 4BBRB 4A3IB 3SHLA 2Q2TA 3RLOA 1MHWC 4X3KA 2G9DA 2Z4IA 2MNAA 2EZVA 1U9RA 5IT9c 4A3DG 2R7ZB 1EIFA 5HGQA 2M00A 4HJAA 3W1GA 1BXTA 1A2UA 4HN7A 3K80C 2R93B 2K28A 4IALA 2RCNA 1YHAA 4IN3A 4PZ8A 4CDEC 1AZQA 4ME5A 4DAPA 2MGSA 3AYHB 3M4PA 4EQPA 1RJTA 3JC66 2J0TD 3H0GG 1X9NA 4PNYA 4PZ7A 2HCIA 2EJGC 4NXML 1VQEA 1RF2D 4N8FA 2ZXRA 5HURA 4DR4L 3UDXA 5CYUA 4B3RL 4L5RC 4DV1Q 1I50B 1S5CD 3HOUG 1XPUA 4BA1I 4A3EG 4RG1A 3AB9A 5IP9G 3HOVH 1D1IA 2SNSA 1BO0A 3ZYYX 4CKEA 4A3KG 5DLQE 1JC7A 1S5ED 2R7FA 3A54A 4XT1B 2BDOA 4JBKA 1SE3A 2OT2A 1Z6HA 5ELCA 3HGBA 4KY7A 4YY3Q 2F52A 3T1YL 4UAIA 4CDFC 1SMYC 2CVRA 1GUOA 1Q8KA 2TSSA 4DAYB 1I4HA 1JWMD 2A6HD 2MO1A 4QL5A 1VF5C 1AE3A 3KF6B 5FO8B 3U58A 1TWAH 1D6EC 3IFTA 4EQOA 3CF5A 2K7VA 3D6WA 4H13C 2HT1A 5ELBA 3GTGB 3CCJA 4JV5Q 3S17H 3T16A 3NBIA 4H44C 4ZUJA 3A8JE 3GTMB 4A3MH 1UE7A 5G3LD 1ET9A 3KJPA 4JI8Q 2X69A 3RN5A 1CKNB 1N8RC 3JAME 3GD7A 2ZJQA 4YHHQ 3KJOA 5CV8A 2CW0D 4OHJA 4IUVA 2UUCQ 2JA9A 5D65A 4C3JG 4DF7A 1L2FA 3SK6A 2RSNA 3S2HH 4BBRH 4A3IH 5FKAC 1EOTA 3BYTB 5C4JB 1F2MA 2KUMA 2E5LL 4FP5D 1VQ6A 1I4RA 4LF6Q 3K5LA 4LF9Q 1SFOB 2IL8A 2R7ZH 1N34L 2WKDA 4DUYL 4IQZA 4KN7C 1XX8A 5IYBG 2VY3A 2WAQB 4A3JB 3PMFA 4GNXB 4XQQA 1SNDA 4JI0Q 2BOSA 4IUNA 5K36H 4PMWA 3T53B 2PW5A 2YTYA 1BF4A 3TP6A 3J7ZC 1VQ5A 4JYAQ 3GV3A 4F88A 1C7YA 4LFBL 2DUDA 2QILA 1WYDA 3GTLB 1VS0A 1RODA 1TY0A 1RL2A 1VQOA 1WTPA 1CSQA 4NB3A 5FLMH 1I50H 2L15A 1BCPD 1VQMA 3K8AA 2PI2A 4QF4A 3AFPA 1CHQD 1VQ7A 1NSNS 3I90A 3A56A 1CZWA 1XNRL 5E3FA 1B4OA 2OEOA 2ALYB 1HFNA 5EBDA 1WTHA 2YTVA 1N32Q 2LKVA 3I4OA 3PUZA 4B3MQ 4GKKQ 4K5WA 3H6MA 1K8MA 4K6DA 1EQVA 3C3LA 1Q46A 3SK4A 5BN5A 1Q90A 2Z4HA 2EDGA 3TBIB 4WJWA 4J6HA 3CCMA 3GTGH 4LK1C 1E2VA 3FMCA 4MZ9A 2X6GA 4BY1B 3FDTA 1MGSA 3L7ZC 1QVCA 3BVZA 5DAUA 4JBMA 1S5BD 3IFDA 1LTAD 4R4CA 1HRJA 1GUNA 1PA6A 3OIPA 4LUZA 1ICWA 1B7YB 1SYDA 1AFPA 2Q8TA 3CPFA 2ZJRA 2K50A 2KECA 2Q8RE 3K5NA 4X3TA 5C4JH 2A1AA 3QIAA 1RTOA 2UXBQ 2F4VQ 4AYBB 2J4XA 3K7AB 3I4NB 4R9WA 2JA7G 4IPDA 1SFOH 5D14A 1PH3A 4JV5L 2EE1A 1AH9A 2EXDA 4JC0A 1EY9A 1EQRA 1TWFB 3R8BA 3BU2A 1WTXA 3GTQB 3UDIA 2DJFC 1HNWQ 4A3JH 1N36Q 3URYA 4QUCA 4L5QA 4RH6A 4QB4A 4R4TA 5C0XJ 4IPHA 2UUCL 1G6ZA 3ERSX 2HHHQ 4UP9A 4DV4L 1QILA 3GTLH 4FXGC 1K0SA 1UE1A 3J81E 1VMPA 5I2XA 4QUFA 3KLRA 3CCEA 1EQQA 4LF6L 1X65A 4HIKA 4C1NI 3CAMA 4LF9L 5EQ0A 1XTDA 2O4XA 1PH2A 3L2PA 3S16B 4HJ5A 4GLVB 4RKLA 1YHBA 4DV2Q 2B8FA 3S24A 2VQEQ 2KCNA 1G291 4FYDA 1NNXA 1O80A 4QIWE 2UXCQ 5IYDG 1JOQA 2BA0A 2WKCA 4JI0L 4ZAIA 4G7HC 3CCRA 3CHBD 2AQ1B 2PYKA 3GTOB 1SYGA 2K33A 4BS9A 4JYAL 1QNKA 4QCLA 3MEFA 1STEA 4KLKA 5AJ3Q 3CD6A 4K0KQ 1KRTA 3RR5A 2L4NA 1VMCA 1GUTA 4RCNA 3I4LA 1D7QA 1Z9FA 4BY1H 4QQBX 2A19A 1LM0A 2RSOA 1EU4A 1PTOD 3PUYA 3A55A 4C2MB 1F2ZA 1KDBA 3KOJA 4KK7A 2L12A 5LL6X 5T1IA 1IW7C 1ENAA 2MFIA 4J8QA 4HSPA 1I6VC 1NBWA 4DN4M 4HJ9A 1Y1VB 2F0TA 4V190 2NVTB 1QB5D 3NQTA 1CQFA 3PGZA 1AW7A 4RGOS 4HJ7A 3NQIA 4GN3B 1BDOA 3K7AH 4L8JA 3I4NH 1A2TA 4WORA 3VYUA 2ID0A 2AWOA 5IE8A 5IGCA 5IP7H 2E2HB 4WFN3 4A3MG 5JJIA 2RHQB 3JAMc 2GA4B 2A6EC 3GTQH 3QO2A 4OIKA 1TQOA 2K1BA 4DNIA 4DNTB 3STBC 2CH4A 3UE1A 3W3AA 1B3QA 1KQSA 5J3BA 2NTTA 4MNOA 1TY2A 2BDNA 1ILPA 2NVQB 2ZTEA 3H09A 4OWWB 1LUZA 4BBRG 3JAMi 4A3IG 4DAYA 3HOYB 4IPCA 2RA4A 1AEXA 2UXBL 3IKJA 1Q3LA 2F0GA 2R7ZG 1FR3A 1PRTB 3KLSX 5J1ZA 4NW2A 3RMHA 3BG3A 5IGDA 1OXXK 3I8ZA 3R2IA 3D8GA 1CKNA 2MQHA 3BZDB 1X3EA 1PLFA 2R93G 3GO5A 1SNMA 3G7LA 5K36G 1SYFA 3CC7A 4RHRA 3AMUA 4C1NK 3V05A 3PUWA 2HHHL 1K73C 5C3EB 3LWEA 3MHBA 1YI2A 2CHBD 3CC4A 3KLSA 1X54A 5FLMG 3EQLC 5EGTA 1TU2B 2NZ1D 5JOBA 1IYJB 1DYQA 4O2DA 5IIFA 2CH4W 4JI6Q 3UDFA 2KJXA 4BY7B 4DV2L 2VQEL 1PV4A 4C2MH 3MVVA 3NXWA 2PQEA 3CCQA 1KLUD 4CJ1B 1ESFA 1A62A 2I5LX 5C0XI 3BVMA 4JBWA 4GNXA 1MBYA 4IOCA 4LF8L 2K5QA 5IWAL 1Y1VH 4MTNA 5E4XA 5EBCA 1E2WA 1Q12A 2NVTH 2EYFA 1EY8A 1KC8C 4KI0A 1OXVA 3HKZE 1D2BA 3NK9A 3PIP3 2E2HH 1HUMA 1V1QA 2R3ZA 4XDXA 3PIOA 1YNJC 4ZKCB 1U5KA 3EROA 1O7ZA 3DWAA 2DY7A 4DR3Q 3DHQA 4FF2A 1HZ9A 1LTRD 1BOSA 2KHJA 4NXNQ 1RHPA 2F0PA 1CK1A 3MC0B 2JK8A 5T1GA 1KTKA 1GD7A 1DD2A 5KIXA 2NVQH 1VQFA 1L0WA 2NN6I 2NWGA 5C4XB 1H95A 1JE5A 1EY6A 5FJ8H 1M4VA 1IBMQ 5CC4A 4DK1A 4EX5A 2JA8G 1T5XD 1EU3A 1HTPA 1NE3A 1YBYA 2HCCA 3TSSA 1SR3A 2PNRC 3CMEA 1WI5A 2JYOA 2PQAA 4YCWA 1ICFB 5M3MB 3S9WA 2HUGA 2PW7A 1FGBD 1MD2D 2WAQG 4A3JG 1VQAA 5IGEA 4JCVE 3NELA 4LFCL 5C5LA 4A3LH 2HDMA 5KRUA 4A76A 3T13A 2XRQD 4O42A 4YWMA 2ASBA 4ULLA 5EPLA 3C46A 2EOTA 5C3EH 2HIXA 1LT3D 3H3VI 1GHKA 4FDBA 4K6LA 4CJ2C 3UDGA 1A3VA 1DOLA 1B70B 4KKUA 5GQOA 5ELFA 1WD0A 4G7OC 4FXDA 1PH5A 2JEBI 2BA1A 4BY7H 1OXTA 1CZGA 4DPGA 1AE2A 3LNNA 3J81i 4JOIC 2F0JA 1L1OB 4LNQA 3TS2A 1JMCA 1LT5D 1ZXTA 3EBEA 3HOVB 4DR2Q 4O0AA 3EFXD 4GKJL 5L37A 3OTOQ 4JPBW 2AKWB 1CUKA 1K28A 4X65Q 1JWSD 2ZT9C 3M3YB 2XWJB 3NEMA 5DM73 4CKCA 3CQZB 1J5EL 1BKBA 1S5FD 3H94A 4ZLTF 4KHPQ 1ML0D 1G2TA 4BY1G 4YCVA 4K5VA 1Y8PB 5A2QL 1EWCA 1BCPB 3D4RA 1NMFA 1HFGA 1VQNA 3U9SA 4J15A 3U4ZA 4DFAA 3I4MB 2XRSD 2WINB 4KKTA 1VQKA 5I9PA 3NP8A 2I0QA 4LF4L 3TDQA 2BE5C 1JOKA 3DLLA 5C4XH 2JQOA 4KY6A 1IKLA 3HG9A 2JJQA 1IL8A 2K03A 3VDYA 3NPPA 4OO1H 2ZXPA 4AYBG 3I4NG 3VA5A 4TQUS 1VQ4A 5IP7G 5GAEC 2IX0A 3S2HB 5M3MH 2V4DA 3EJIA 1G2SA 1NY4A 5J39A 4NXNL 1D8LA 4CGYB 2IHFA 3FRPB 1IYUA 4K14A 2E75C 4B08A 2JA5G 2WACA 1B9MA 4GS3A 3KFUA 3Q6SA 1R4QB 3A5ZB 3PSIA 1C0AA 1R4PB 4PG3A 1C9OA 2KA7A 2XTIA 1RKNA 3P20A 2VS1A 3D4DA 1IBML 3G48A 3TP5A 2B63B 1YNNC 1HNZQ 3J80E 1X6OA 3CRKC 3J7A5 1EYAA 1TKWB 2WV6D 1YZ6A 4ILWA 2NZHA 2KCCA 1DM0B 1H9SB 4HMIA 4A3FB 5LL6S 3FP9A 1HR0L 3OPOA 1ET6A 2NTSA 2HDLA 3E3XA 3ND8A 3O13A 3G71A 4KHZA 1SYCA 3ONAB 4LUOA 2RBMA 2ZXOA 1IL2A 3I3CA 1NMGA 3KDFA 4Q0FA 1RCVD 4DR1L 4MHEA 3F2BA 1JB3A 2B2YC 3I2ZA 1KAWA 3M3YH 3EVQA 2L5TA 3CQZH 1DGSA 1YJ9A 3DEOA 4S3SA 2K4KA 5JVH3 4IUTA 4WRDA 4Y7NB 1T5EA 1BQQT 3S1RB 1S3OA 3HZXA 1HZAA 3IRBA 1GVPA 1MSHA 1KHIA 1LTLA 3HKZB 3QOLA 5CBAE 3GTPB 5FO7B 3I4MH 1PDQA 1WTOA 2G9HD 1H9JA 3I72A 1SBBB 2Q2UA 3TRZA 2A69C 1QUQB 1Y1VG 1PRTF 3OTOL 2E2DC 3T56B 4X65L 3MXPA 1SJHD 3E0EA 3PUXA 3M85A 2FJ2A 2DN8A 2ZM6Q 2ZTDA 1PH9A 4KHPL 5ISRA 1B2TA 5JJKA 2B2VC 4EGVA 4FXKC 1UE5A 2RVLA 4UDUC 2ICIA 2WP8J 4XYQA 4B3TQ 3A0JA 3NBHB 2VUMB 1HPCA 1A3TA 3HOXB 1CFMA 2EY5A 5FK9C 5K5PA 4RWSC 1F2LA 2LXKA 2VXWA 3P1HA 3H15A 1XJVA 3G6EA 1B44D 1F77A 4NP5A 1Y14B 3UI2A 4DU9A 4I7AA 1JJCB 1OXUA 1VQGA 1GXDC 3HOYG 2A73B 5FJ8G 1MJEA 1WTRA 2B63H 4PMBA 1ILQA 1HQRD 1ZYRC 1QWYA 4KY5A 2SDFA 3FEWX 1HA5A 5KEEA 1DXMA 3FKIG 4ZYSA 4A3FH 4HIMA 5CV9A 3S14B 1SLJA 3J7AF 4OXPA 4WJ3M 1TXYA 1ASZA 1E0BA 3M4OB 1BBUA 1QVGA 5J22A 2KOLA 1K8OA 2R7DA 4A3LG 4X64Q 2RHSB 4L5SA 1WOCA 5GAGC 4IUQA 3HOZB 3K0YA 5COYA 3NWSA 4LF7Q 1U4RA 1QE6A 1SEBD 1STGA 4HIOA 4BWGB 3K6OA 4HIDA 4L63B 2EQSA 3HS0C 3T4AC 4IFDJ 3L3OC 4Z9CB 1S4ZA 4BBSB 2D62A 4Y7NH 4K8JA 4UY8C 3S1RH 4BY7G 3FPPA 3R93A 4BXXH 2XIWA 5JEAH 4OX9Q 2G5DA 3GTPH 4DV1L 3UE0A 1LT4D 3D6CA 4IZ8A 4XTCS 4DV7Q 4P2CB 3S2DB 2B29A 1J6QA 3IL8A 4LF5Q 4Y52H 4LUVA 5LMUQ 1JJGA 1PRTC 4UPAA 2OQKA 1GHJA 1WD1A 2UUBQ 1KD1C 1EUJA 3T51B 3S1QH 1TWCB 4A3GG 3NE5B 3U50C 4YY3L 3KYHC 4E6IA 2LMCB 1EIGA 2MJ8A 5G3LF 4XYOA 1G91A 3H91A 1OXSC 2K01A 2Q2HA 3I7FA 1I5FA 5CV6A 2VUMH 2R6GA 2YYZA 3VR2A 5FLXL 1UUPA 2R92B 3HOXH 1E7ZA 1GUWA 3KBXA 1SRUA 2QDBA 3QG1A 2QEXA 2EVBA 3A74A 1AZPA 2LS01 1Y8OB 2N49A 2VL6A 4JI8L 3OWFA 1PTOH 1VQJA 2Y0SE 3DWPA 3NTIA 1NJIC 1ENCA 4HCEA 3BZKA 5C4XG 4YHHL 2DNEA 3L0OA 3TQYA 1WJJA 3MXNA 3QWNA 4OO1G 1ASYA 1Q86C 4K8IA 2D0OA 4WJ4A 3EN2A 4F87A 3CRLC 1TS3A 1A63A 1VQBA 5E7NA 5BR8Q 4OWXB 1SE2A 1UAPA 3N52A 5M3MG 3S14H 3LGJA 1VQPA 3RZOB 1H9MA 3J80L 3ICEA 3M4OH 1JE4A 1B3AA 1LTID 2NN6H 1BVSA 4EQ5A 2SNMA 1V1PA 2WB1E 2ICEC 2K04A 1WTQA 4DV5Q 3HOZH 4JI7Q 2IX1A 2AQ3B 1FNUA 3HP3A 3J80c 1STAA 1BCPF 2PMZE 5A35A 2Z6KC 1SXTA 1L0YB 1BUVT 2IX3A 2LXJA 5BN4A 1JR0D 1LABA 2AMCB 4N9TA 4BBSH 1IXRA 5AFWA 4MN3A 1KRSA 1PYSB 1B8AA 1AN8A 1EY7A 1ZEQX 1X3PA 2JA6H 1GKHA 1F9SA 2FINB 4X66Q 4X3SA 3S2DH 5C4ZA 2SOBA 3OOCA 1LTSD 3HOVG 2A6HC 1VCIA 4X64L 4TSSA 2F3WA 1PZKD 2RDHA 1BNZA 4RGTA 2VB3X 4LF7L 1VQCA 4IJHA 3GTJB 1XWEA 2FFKB 2IJ0A 1TWCH 1JQYD 3HFZB 3I91A 4JI2Q 4DAMA 1K9MC 4B3SQ 1N32L 1LV9A 1RDPD 4B3ML 4GKKL 3WOFA 3F2CA 1U4LA 2XNAC 4G7ZC 4KTAA 3P7JA 3A7AB 4AQYQ 1E2ZA 3OSOA 3TS0A 3BDCA 2N78A 4ZQ3A 1ONLA 2R92H 5KGUA 4GN5A 2CWPA 1GUSA 2F0NA 4OX9L 2K5WA 2CW0C 5A2QE 1H9SA 2J7ZA 2PZWA 4DV7L 2C35B 4IO9A 4BA2I 1EY5A 4LF5L 5CGKA 2CWAA 5LMUL 4JI3Q 1CT1D 2GN5A 2UUBL 4K2KA 1CQVA 1FVIA 4M1UB 3WWVA 1IZ6A 1K3BC 1KABA 3U9OA 2E74C 3ULLA 2B2TC 2F3IA 1L1OC 4DR5Q 4IFDI 2A68D 2F03A 1GO3E 3S1MB 3BDLA 4R1JA 3RZOH 1PZJD 2F4VL 1K3RA 5F2DA 3KF6A 4FVMA 3TN2A 3AQQA 4R8IA 4POGA 1PH7A 4IUUA 3MWYW 4IOAA 1IHZA 3M7GA 1VQ8A 2IWHA 1HNWL 1LTTD 3VR6A 1QUQA 1N36L 5GROA 4UP8A 4RGMA 1BCPC 4GN4B 2SEBD 1KIXA 2K52A 2F0VA 1BBXC 1UEAB 1L0XB 2ENBA 5BR8L 4A3FG 1Q81C 4RHSA 4ZCKA 5EKIA 4YWKA 1W3SA 2N88A 1I3QB 2F0FA 2LFNA 1EY0A 1X56A 4C3HB 1KL9A 4X6AH 3NBHA 4JOIA 1FD7D 5M5WB 4MIUA 3M4YA 3F8TA 1E3PA 2NZOA 5M5XB 4KJNA 4DV5L 1YNND 3GTJH 2JEAI 2Z6BA 1SNPA 2UXCL 2OQ0A 2MPMA 1HJPA 2F0EA 1KAAA 5EJWA 1SNQA 1PH8A 3BDOA 4RA8A 2F0DA 4CBVA 3U4VA 2EYMA 2ES2A 1PTOF 1DJRD 4OONA 5I2YA 5AJ3L 2K14A 1H9KA 3TP7A 3MTSA 1SN8A 4K0KL 4X66L 2F3VA 2B39A 3CKIB 3HKZG 5CMDA 5JEAG 4BXXG 1S72A 4ZUIA 3K5MA 1YJWA 2UUAQ 2NYZD 5ELDA 3G4SA 3I73A 3GV6A 3RNUA 4Q5VA 3OW2A 1I4GA 1SMYD 3PUVA 5I6WA 5IYCH 1PFBA 3E6ZX 4JI2L 4B3SL 2A74C 2M9VA 1QG7A 3NHHA 1FYCA 2I5MX 3HRZC 3K81C 2H1EA 2Z0SA 4JI4Q 2Y0SB 4ALPA 2K6AA 1HNXQ 4AQYL 1PH6A 1I6HB 3GQBA 1YNXA 3S1MH 4OEMB 2VUMG 1QJOA 3RLFA 4QY7A 1SYEA 4C56C 3HOXG 2A69D 2NUCA 2JP1A 2JE6I 5CR3A 1XYIA 1HCZA 2N8NA 4CKBA 1WVLA 2OXPA 3TZDA 3M7NA 4JI3L 2O5IC 3X3MA 2F0IA 5TSSA 1X55A 1DOMA 3MXUA 2QA4A 1PFMA 1NR4A 1FL0A 2K05A 5GADC 1H9RA 3DUZA 4OELB 2VNUD 2NB0A 3WOEA 2WB1B 1SROA 3GP7A 4AIMA 2OTLA 3OMGA 1N9WA 4XIGS 1C48A 5EKLA 4DK0A 4KV6A 1VQDA 3PF5A 2QEJC 4N9PA 4KN4C 4LJZC 3Q0AA 1HA6A 3VYRA 4QIWB 1I3QH 1K8AC 1FNWA 4C3HH 3F2UA 5M5WH 1TR5A 5JAVA 1LTGD 5D3DA 2F4IA 1HTLD 2JSOA 2GVAA 2NN6G 2RKSA 4B3RQ 2QKIC 5C6AA 4PV1C 1CKOA 5M5XH 4QJFA 1PFSA 1LTBD 3AFQA 2EJMA 3FVQA 3DXJC 5KYIA 2B2YA 2I07B 2L55A 3RLNA 4XQNA 4GZYC 1YITA 5FOBB 4A4IA 3T1YQ 4BBSG 2Z1CA 5FO9B 3I55A 1PTOC 2KCMA 2X6LA 1VDZA 2KEDA 4DXGA 2MUYA 1W2BA 3HOWB 1SNCA 5JJZA 2UXDQ 5IOCA 5ELOA 2YV5A 3SR1A 4OWTB 1B53A 4NPSA 4V0BA 2RCFA 4FF3A 4JI6L 4DR6Q 4F8MA 3MA2B 1EEFD 2OTJA 4UP7A 1KNEA 5ELNA 2NBFA 4QMGA 3Q24A 4GOPC 2A5HA 3WDNA 1YVCA 2KBNA 3R2TA 3P75A 3D4WA 3OW7A 2E76C 2B2VA 3TEHB 1I6HH 1ESRA 3CC2A 5EPKA 5IODA 1WTVA 3C1FA 4HEDA 5EPJA 1UWVA 2L1BA 2R92G 1BR9A 3N6RA 1WFQA 5FLXE 3BZCA 2E5LQ 2AUJD 3CCUA 3S1NB 2RQXA 1I94Q 2PZTA 1HZBA 4RKBA 3TMEA 2VW9A 1ENFA 4DR3L 3CP0A 1N34Q 3E9IA 4R4IA 4POFA 1A8VA 2AWNA 1VQHA 2EY2A 4DUYQ 1VQLA 2V1CC 4G57A 3K59A 4MTKA 1S40A 2CQOA 1KLGD 2FMMA 5E1FA 1SJED 2PZUA 3J81j 4JI4L 5IT9L 5EAYA 1HNXL 4GLAC 1NAPA 1SMXA 3H3VC 1JOOA 1EL0A 5JJLA 1EEID 5KNBA 1E22A 1A0IA 4LFBQ 4JK1C 3VR5A 3GDEA 3NENA 4P73A 1SDFA 2ATWA 3W2DA 3TP8A 1PH4A 4C3IB 2E2IB 1LO5D 2XVSA 1R9TB 1YHQA 3SXHA 2Q2IA 3MEHA 2EY6A 2B3GA 1XNRQ 4IPGA 1S5DD 2PO4A 1WCMB 5IYDH 5C3XA 1GOZA 1JJ2A 3SEBA 1XMQQ 3K58A 2Q8IB 3VR4A 3OMCA 3FHWA 1XNQQ 3HOWH 4A3CH 4K2LA 3SVMA 1JWUD 1HHVA 2KCTA 4EQNA 3E0JA 2YU9B 4DGZA 5M9OA 2XGTA 1XTCD 2ZJPA 1U0LA 2OCEA 1LLRD 1A6XA 1KDCA 3K0XA 4DR2L 1EWIA 3MFGA 3PIPA 4A3BB 3RZDB 3HEJA 2K5DA 2AHOB 4RMFA 4CDCC 2B2WC 2EYJA 1Q8IA 4O1NA 1XXGA 1SNOA 3S1QB 1X32A 1V9PA 2UXDL 1Y1WB 3S1NH 5KNDA 3LWUA 4DAVA 3OHXC 1M8AA 2B2UC 2RDFA 4DR6L 2M2LA 1IW7D 4R4OA 4K5XA 4A75A 4R8NA 1HH2P 4ABNA 3CU7A 1M90C 5IYCG 1Y8NB 5C44B 5IGGA 3PO2B 1Q82C 2EPBA 2DGYA 5DNFA 1TVXA 4HCSA 5EKKA 3SDZA 4L5TA 5DEHA 1U4MA 1N33Q 1PTOB 3SK5A 3K57A 4KJOA 1JCKB 3TZUA 4F7XA 3IAYA 4DV4Q 1B1ZA 2A6ED 1EZ6A 2WIIB 2F0KA 1I94L 3DWQA 4NDXA 4C3IH 2JA8B 3STBD 3SE0A 1Z7TA 2E2IH 1AP0A 1R9TH 1SYBA 1TWHB 1QNUA 1J8IA 3V96A 2MO0A 4GOPB 4IFDH 1NTGA 4DV6Q 2N3SA 2KEEA 1WCMH 3KK7A 5CV7A 2EYOA 1X3GA 3KBGA 3PV0A 4TKOB 2OWOA 2Z6KA 5D3IB 1IBLQ 2R93H 3F2DA 1QZGA 4JW0A 4A93B 1EFID 3BJUA 3A5UA 1MKHA 2BH8A 2L11A 3SGIA 3HKSA 4HAEA 5C3EG 4U68A 2XWBB 3OIQA 4M8AA 3ULJA 3DMUA 1FNVA 3C1EA 1G6PA 2XN9C 3GTKB 2RDGA 2EYHA 4C3HG 1E1TA 1HNZL 3RUZA 3ERQA 3C2PA 1SE8A 1TT2A 2RF4A 2YU9H 2IY5B 1O7IA 5CV5A 1JT8A 1Z47A 5IGBA 4U673 3PQIA 2JA6B 1EYDA 2MP1A 3QJYA 2PPBC 1FJGQ 5JVG3 1SAPA 1O7YA 4A3BH 1XMQL 3RZDH 1XPOA 1DONA 4YWLA 1EQTA 4NKLA 4TVAB 3PO3B 1XNQL 1PXUA 2F0WA 1IYVA 3BVGA 4CHTB 4HSVA 5M3FB 5E4WC 3A8KE 1DOKA 1Y1WH 2PCFB 1V43A 4JBJA 3A7LA 2C9OA 4DV3Q 1PHJA 3I56A 2PQAB 1MSGA 5HGTA 3GTMH 4H0LC 3W1BA 1D1KA 4OO1I 1II3A 2D5DA 3S15B 5GAHC 5C0XH 1W6KA 1QZHA 2VZAA 3R3OA 5C44H 5LMNW 1D5MC 3PO2H 3BYYB 2B2TA 4OIJA 1QVFA 3KF8B 1EWHA 1RTNA 3X3NA 1L1OA 2Y0SG 3NSWA 5JEAJ 3PIO3 3Q22A 1TS2A 3A8IE 1YJNA 1STNA 5FLXc 1RIPA 1PYBA 1YNJD 4I65A 2ZM6L 1CA5A 1D5ZC 3AEVA 4YCUA 2JXMB 1V8QA 2PI2E 2JA8H 4HR7B 1EZ8A 2EY1A 1Q7YC 3K7UC 1K0RA 2VQFQ 1UEBA 1TWHH 4ZK9B 4B3TL 4DNRB 4X62Q 1BBWA 2R61A 2DY8A 3T1HQ 1EIHA 2HQEA 3RN2A 3I70A 4UHVA 3V2TA 2WB1G 1N33L 4A93H 2BH2A 4QGUA 4A3DB 2JA5B 2K5VA 3VA7A 2F1MA 4RGNA 2UU9Q 1TS4A 3W5OA 4CDDC 2B8GA 3GTKH 4OL7A 1YEZA 4RFBA 2HIVA 4G4KA 1O78A 2K5HA 2QDLA 2EXZA 2EIFA 2FMCA 1IKMA 3PF4A 5CV4A 3H0GB 4LWCA 2K5NA 4H02A 1NCVA 4DV6L 1FGUA 5HY6A 2FHTA 1K83B 1X3FA 5C4HA 1C4QA 3J80i 4AH6A 4JI1Q 1NR2A 1IBLL 4PQXA 3H3VH 3HOUB 5M5YB 4A3EB 1NUCA 1TIID 5BN3A 2E2JB 4JVZA 1OO9B 1I4QA 2EJFC 2LSSA 3NTHA 4A3KB 4LF8Q 3VYSA 3PO3H 1HQMC 3DEPA 5IWAQ 5JPNC 1B9NA 2NVXB 5I9OA 3HOWG 5M3FH 1KXLA 2EYLA 1DCZA 4A3CG 2AQ2B 2A8VA 3DM3A 3NTKA 1P8LA 2Z8LA 4J1MA 1JICA 4YIJA 3ZJYC 3S15H 2I46A 3Q8DA 4DKAC 1MI2A 1T9HA 1G8ZD 3DM1A 5C5MA 1FJGL 3I4MG 1G51A 4L6TB 3J7AV 4FNFA 5LMNQ 2IW3A 5H1SE 4CJ0B 1PVOA 5DM63 3JAML 4IJLA 4R4QA 3ND9A 2HQLA 4N8X1 1F9PA 3CPWA 1EIYB 1QOHA 1TWGB 3D0FA 2KQ3A 3QOJA 3QR8A 1QCBD 4DV3L 1CKMA 1I4PA 4DXFA 3CCSA 4XXEA 2QW7A 1JB7A 3MAQA 2YTXA 2E8GA 4DR7Q 4C3JB 1XMOQ 1PMRA 4DA2A 4DUZQ 1CHPD 1XPRA 1TWFH 2BE5D 2LY7A 2NVYB 4JI5Q 3CXCA 1E1OA 2JA5H 4A3DH 3NWTA 4B9WA 5IT9E 4LFCQ 3KDFB 2PNHA 3F1ZA 3TREA 3ULPA 1EY4A 4P71A 1D5XC 2BCOA 2H5XA 2B63G 1STHA 2F0UA 1HUNA 4C3IG 2D2CC 4LFAQ 2VQFL 3S16H 4P75A 4X62L 3H0GH 4DK6C 3FKIB 4KD3A 2O2LD 1HR0W 2Z9HA 3T1HL 4IFDG 4XQJA 1K83H 3MFYA 1V1OA 1M1KC 1WCMG 3HOUH 5M5YH 4A3EH 2E2JH 1IBKQ 1STYA 5IP9H 4PZ6A 1VQ9A 2UU9L 3GTOH 3K5OA 1Q1EA 4A3KH 4JI7L 2JN4A 1I4XA 3KUPA 3B6YA 4GLXA 3MZ5A 1HXYD 2NVXH 4GKJQ 5NUCA 4LMQD 3PCOB 2OF1A 2EYPA 5CBEE 1J5EQ 4DV0Q 1CTMA 2AUKA 1SSOA 3RD4A 3Q23A 2DJGC 1WTWA 2L9HA 4ME3A 3D31A 4FO2A 4FF4A 1X3QA 3L9AX 4LW1A 2CFMA 4JI1L 1LACA 4GOPA 2D9UA 1W6JA 1VQIA 3LX0A 2DNCA 4KMUC 1JORA 4A3BG 4LF4Q 2F0MA 1Q1BA 3OYYA 1C8CA 1MJCA 3QB3A 1RD9D 1EYGA 3E9HA 1TWGH 4A3GB 5IGFA 1Y1WG 2CCZA 1CA6A 2K75A 4HJ8A 1GM5A 2FXQA 4C3JH 4DK3C 2HD3A 4B9XA 3SK8A 3CCLA 5C0XG 1P16A 2IHEA 5C44G 3KLWA 4PMCA 1Y69U 4LAAA 2NVYH 3CW2C 2XSCA 3M9BA 5IY0A 3PO2G 5LMNL 4P72A 3M4QA 2JA7B 1CM9A 1TS5A 3G6JB 4I7ZC 1OTCA 4ODGA 5IYBH 5I4DA 3HOYH 2CKZB 3BS1A 4HMJA 2KVMA 4KKSA 2KHIA 2L0CA 4IURA 4TRDA 4DR5L 1PZID 2N55A 2VB2X 1UE6A 4DR7L 1XMOL 2F0OA 3E5SA 4DUZL 3FKIH 1EYCA 3NUCA 4APVA 3J81L 1DZ1A 4EVOA 2PMZB 1ZKOA 5I6YA 2F0LA 1F9QA 4NXMQ 1HR0Q 1CSPA 1F2YA 1O7LA 4JI5L 3EIVA 2WAQE 4DR4Q 1E24A 4A93G 3ER0A 2MHVA 3EA6A 1ZYRD 3HOZG 3KF8A 2KHSA 4KHVA 1HZCA 1LT6D 1EOVA 3J81c 5CORA 3VYTA 4DR1Q 1U4PA 4OGQC 4ZKBB 5LHY1 2D0PA 1K8GA 4LFAL 5C3WA 1LYLA 1KDAA 1VF7A 1EFWA 1PFNA 4FF1A 5KYLA 2QGQA 2JA6G 4ID6A 4RAUC 4HTHA 1GJXA 4NMZA 3FPUB 2I5HA 3MXGA 1IBKL 2F0SA 5ELEA 2TMPA 2WFWA 1CI3M 3D3RA 3PO3G 3MXNB 2B2WA 4X3UA 2O5JC 2C5CA 5M3FG 3CCVA 4A3GH 2QCPX 2QF7A 4DV0L 1SE4A 4GNXC 2GVBA 3AU7A 1A3UA 2IT1A 2B2UA 2F0HA 1STBA 5JPMC 4ZRZA 1GUGA 1PRTD 1TWAB 2UUAL 1J9OA 1PYWD 2K32A 4KD4A 5KNCA 1V1PB 4P74A 3CMAA 2CQAA 2JA7H 2P5ZX 2A68C 3ITPA 4IUPA 1UNSA 4XT3B 3S17B 3J7YW 4A3MB 1PH1A 2IPKD 4JG2A 1YIJA
chains in the Genus database with same CATH topology
2H4OA 1F9RA 3OWEB 4RCOA 1A15A 1B50A 4H7BA 2F0QA 1KNAA 3VR3A 4BBRB 4A3IB 3SHLA 4X3KA 2G9DA 2Z4IA 2EZVA 1U9RA 2R7ZB 2M00A 1BXTA 1A2UA 4HN7A 2R93B 2K28A 4IALA 4IN3A 1AZQA 4ME5A 4DAPA 2MGSA 4EQPA 1RJTA 2J0TD 4PNYA 2HCIA 2EJGC 1RF2D 2ZXRA 5HURA 5CYUA 1I50B 1S5CD 4BA1I 3AB9A 1D1IA 2SNSA 1BO0A 3ZYYX 4CKEA 1JC7A 1S5ED 3A54A 4XT1B 2BDOA 1SE3A 2OT2A 1Z6HA 5ELCA 3HGBA 4KY7A 4UAIA 1SMYC 2CVRA 1GUOA 2TSSA 1I4HA 1JWMD 2A6HD 1VF5C 5FO8B 1D6EC 3IFTA 4EQOA 2K7VA 3D6WA 4H13C 5ELBA 3GTGB 3T16A 3NBIA 4H44C 4ZUJA 3A8JE 3GTMB 5G3LD 1ET9A 2X69A 3JAME 3GD7A 5CV8A 2CW0D 4OHJA 4IUVA 5D65A 4C3JG 4DF7A 3SK6A 2RSNA 5FKAC 1EOTA 3BYTB 5C4JB 1F2MA 2KUMA 4FP5D 1I4RA 3K5LA 1SFOB 2IL8A 2WKDA 4IQZA 4KN7C 1XX8A 2WAQB 4A3JB 3PMFA 4XQQA 1SNDA 2BOSA 4IUNA 5K36H 4PMWA 3T53B 2PW5A 1BF4A 3TP6A 3GV3A 4F88A 2QILA 3GTLB 1RODA 1TY0A 1WTPA 1BCPD 4QF4A 1CHQD 1NSNS 3I90A 3A56A 1CZWA 5E3FA 1B4OA 2OEOA 1HFNA 5EBDA 2LKVA 3PUZA 4K5WA 3H6MA 1K8MA 4K6DA 1EQVA 3C3LA 3SK4A 5BN5A 1Q90A 2Z4HA 2EDGA 3TBIB 4WJWA 4J6HA 4LK1C 1E2VA 3FMCA 2X6GA 4BY1B 3FDTA 1MGSA 3L7ZC 3BVZA 5DAUA 1S5BD 3IFDA 1LTAD 1HRJA 1GUNA 3OIPA 1ICWA 1SYDA 1AFPA 2Q8TA 2KECA 2Q8RE 3K5NA 4X3TA 3QIAA 1RTOA 4AYBB 2J4XA 3K7AB 3I4NB 4R9WA 5D14A 2EE1A 1EY9A 1TWFB 3R8BA 1WTXA 3GTQB 3URYA 4QUCA 4RH6A 4QB4A 5C0XJ 1G6ZA 1QILA 4FXGC 3J81E 1VMPA 5I2XA 4QUFA 3KLRA 4C1NI 5EQ0A 2O4XA 3S16B 4RKLA 2B8FA 2KCNA 1G291 4FYDA 1O80A 1JOQA 2BA0A 2WKCA 4ZAIA 4G7HC 3CHBD 2AQ1B 2PYKA 3GTOB 1SYGA 2K33A 4BS9A 1QNKA 4QCLA 1STEA 2L4NA 1VMCA 1GUTA 4RCNA 3I4LA 2RSOA 1EU4A 1PTOD 3PUYA 3A55A 4C2MB 1F2ZA 1KDBA 4KK7A 2L12A 5LL6X 5T1IA 1IW7C 1ENAA 4J8QA 4HSPA 1I6VC 4DN4M 1Y1VB 2F0TA 4V190 2NVTB 1QB5D 3NQTA 1CQFA 4RGOS 1AW7A 3NQIA 4L8JA 1BDOA 1A2TA 4WORA 3VYUA 2ID0A 2AWOA 5IGCA 2E2HB 4WFN3 2GA4B 2A6EC 3QO2A 4OIKA 1TQOA 2K1BA 4DNTB 3W3AA 2NTTA 1TY2A 2BDNA 1ILPA 2NVQB 3H09A 4DAYA 3HOYB 2RA4A 1AEXA 3IKJA 1Q3LA 2F0GA 1FR3A 1PRTB 3KLSX 5J1ZA 4NW2A 3RMHA 3BG3A 5IGDA 1OXXK 3I8ZA 3R2IA 3D8GA 3BZDB 1PLFA 3GO5A 1SNMA 3G7LA 5K36G 1SYFA 4RHRA 3AMUA 4C1NK 3V05A 3PUWA 5C3EB 3LWEA 3MHBA 2CHBD 3KLSA 3EQLC 5EGTA 1TU2B 2NZ1D 5JOBA 1DYQA 5IIFA 2KJXA 4BY7B 3MVVA 3NXWA 2PQEA 1KLUD 4CJ1B 1ESFA 5C0XI 3BVMA 4JBWA 1MBYA 2K5QA 5EBCA 5E4XA 1E2WA 1Q12A 2EYFA 1EY8A 4KI0A 1OXVA 1D2BA 3NK9A 3PIP3 1HUMA 2R3ZA 4XDXA 1YNJC 4ZKCB 3EROA 1O7ZA 3DWAA 2DY7A 3DHQA 4FF2A 1LTRD 1BOSA 1RHPA 2F0PA 1CK1A 3MC0B 5T1GA 1KTKA 1DD2A 5KIXA 2NN6I 2NWGA 5C4XB 1EY6A 1M4VA 5CC4A 4DK1A 1T5XD 1EU3A 1HTPA 2HCCA 3TSSA 2PNRC 2JYOA 5M3MB 3S9WA 2HUGA 2PW7A 1FGBD 1MD2D 5IGEA 5C5LA 2HDMA 5KRUA 3T13A 2XRQD 4O42A 4ULLA 5EPLA 3C46A 2EOTA 1LT3D 1GHKA 4K6LA 4CJ2C 1A3VA 1DOLA 4KKUA 5ELFA 1WD0A 4G7OC 4FXDA 2JEBI 2BA1A 1OXTA 1CZGA 3LNNA 2F0JA 1LT5D 1ZXTA 3HOVB 3EFXD 1JWSD 2ZT9C 3M3YB 2XWJB 5DM73 4CKCA 3CQZB 1S5FD 3H94A 4ZLTF 1ML0D 1G2TA 4K5VA 1Y8PB 5A2QL 1EWCA 1BCPB 3D4RA 1HFGA 3U9SA 4DFAA 3I4MB 2XRSD 2WINB 4KKTA 5I9PA 3NP8A 3TDQA 2BE5C 1JOKA 4KY6A 1IKLA 3HG9A 1IL8A 2K03A 3NPPA 4OO1H 2ZXPA 3VA5A 4TQUS 2IX0A 3S2HB 2V4DA 3EJIA 1G2SA 5J39A 4CGYB 3FRPB 1IYUA 4K14A 2E75C 4B08A 2WACA 1B9MA 3Q6SA 1R4QB 1R4PB 2KA7A 1RKNA 3P20A 3D4DA 3TP5A 2B63B 1YNNC 3J80E 3CRKC 1EYAA 1TKWB 2WV6D 4ILWA 2KCCA 1DM0B 1H9SB 4HMIA 4A3FB 5LL6S 3OPOA 1ET6A 2NTSA 2HDLA 3ND8A 3O13A 4KHZA 1SYCA 3ONAB 2RBMA 2ZXOA 3I3CA 4Q0FA 1RCVD 4MHEA 1JB3A 2B2YC 3EVQA 2L5TA 3DEOA 4S3SA 5JVH3 4IUTA 4WRDA 4Y7NB 1T5EA 1BQQT 3S1RB 3HZXA 1MSHA 3HKZB 3QOLA 5CBAE 3GTPB 5FO7B 1PDQA 1WTOA 2G9HD 1H9JA 3I72A 1SBBB 2A69C 1PRTF 2E2DC 3T56B 3MXPA 1SJHD 3PUXA 3M85A 2FJ2A 2DN8A 5ISRA 1B2TA 2B2VC 4EGVA 4FXKC 2RVLA 4UDUC 2ICIA 2WP8J 4XYQA 2VUMB 1HPCA 1A3TA 3HOXB 1CFMA 2EY5A 5FK9C 5K5PA 4RWSC 1F2LA 2VXWA 3P1HA 1B44D 1F77A 4NP5A 3UI2A 4DU9A 1OXUA 1GXDC 2A73B 1WTRA 4PMBA 1ILQA 1HQRD 1ZYRC 1QWYA 4KY5A 2SDFA 3FEWX 1HA5A 5KEEA 1DXMA 4ZYSA 5CV9A 3S14B 3J7AF 1E0BA 3M4OB 5J22A 2KOLA 1K8OA 4IUQA 3HOZB 3K0YA 5COYA 3NWSA 1U4RA 1QE6A 1SEBD 1STGA 4BWGB 3K6OA 4L63B 3HS0C 3T4AC 4IFDJ 3L3OC 4Z9CB 1S4ZA 4BBSB 2D62A 4K8JA 3FPPA 3R93A 2XIWA 5JEAH 4XTCS 1LT4D 3D6CA 4IZ8A 3S2DB 4P2CB 3IL8A 1PRTC 1GHJA 1WD1A 3T51B 1TWCB 3NE5B 4E6IA 2LMCB 1EIGA 2MJ8A 5G3LF 4XYOA 1G91A 3H91A 1OXSC 2K01A 5CV6A 2R6GA 2YYZA 3VR2A 5FLXL 1UUPA 2R92B 1GUWA 3KBXA 2QDBA 3QG1A 2EVBA 1AZPA 2LS01 1Y8OB 1PTOH 3OWFA 3DWPA 3NTIA 1ENCA 4HCEA 2DNEA 3MXNA 3QWNA 4OO1G 4K8IA 4F87A 3CRLC 1TS3A 1SE2A 1UAPA 3N52A 3RZOB 1H9MA 3J80L 1JE4A 1B3AA 1LTID 2NN6H 2SNMA 1V1PA 2ICEC 2K04A 1WTQA 2IX1A 2AQ3B 1FNUA 3HP3A 1STAA 1BCPF 5A35A 1SXTA 1L0YB 1BUVT 2IX3A 5BN4A 1JR0D 1LABA 4N9TA 5AFWA 4MN3A 1EY7A 1AN8A 1ZEQX 1X3PA 1F9SA 2FINB 4X3SA 5C4ZA 2SOBA 3OOCA 1LTSD 2A6HC 1VCIA 4TSSA 2F3WA 1PZKD 2RDHA 1BNZA 4RGTA 2VB3X 3GTJB 1XWEA 2FFKB 2IJ0A 1JQYD 3I91A 1LV9A 1RDPD 3WOFA 1U4LA 2XNAC 4G7ZC 4KTAA 3P7JA 3A7AB 1E2ZA 3OSOA 3BDCA 4ZQ3A 1ONLA 5KGUA 1GUSA 2F0NA 2K5WA 2CW0C 5A2QE 1H9SA 2J7ZA 2PZWA 4BA2I 1EY5A 5CGKA 1CT1D 4K2KA 1CQVA 4M1UB 1KABA 3U9OA 2E74C 2B2TC 4IFDI 2A68D 2F03A 3S1MB 3BDLA 1PZJD 5F2DA 4FVMA 3TN2A 4R8IA 4IUUA 3MWYW 1IHZA 3M7GA 2IWHA 1LTTD 3VR6A 4RGMA 1BCPC 2SEBD 2F0VA 1BBXC 1UEAB 1L0XB 2ENBA 4RHSA 5EKIA 2N88A 1I3QB 2F0FA 2LFNA 1EY0A 4C3HB 3NBHA 1FD7D 5M5WB 4MIUA 3M4YA 5M5XB 4KJNA 1YNND 2JEAI 1SNPA 2MPMA 2F0EA 1KAAA 5EJWA 1SNQA 3BDOA 4RA8A 2F0DA 4CBVA 2EYMA 1PTOF 1DJRD 5I2YA 1H9KA 3TP7A 3MTSA 2F3VA 2B39A 3CKIB 5CMDA 5JEAG 4ZUIA 3K5MA 2NYZD 5ELDA 3I73A 3GV6A 4Q5VA 1I4GA 1SMYD 3PUVA 5I6WA 1PFBA 3E6ZX 2A74C 2M9VA 1QG7A 3NHHA 1FYCA 3HRZC 2H1EA 2Y0SB 2K6AA 1I6HB 3GQBA 1QJOA 3RLFA 1SYEA 4C56C 2A69D 2NUCA 2JP1A 2JE6I 5CR3A 1XYIA 1HCZA 4CKBA 1WVLA 2OXPA 3TZDA 3M7NA 2O5IC 3X3MA 2F0IA 5TSSA 1DOMA 3MXUA 1PFMA 1NR4A 2K05A 1H9RA 3DUZA 2VNUD 3WOEA 2NB0A 2WB1B 3GP7A 3OMGA 4XIGS 1C48A 5EKLA 4DK0A 4KV6A 2QEJC 4N9PA 4KN4C 4LJZC 3Q0AA 1HA6A 3VYRA 4QIWB 1FNWA 3F2UA 1TR5A 5JAVA 1LTGD 5D3DA 2F4IA 1HTLD 2JSOA 2RKSA 2NN6G 2QKIC 5C6AA 4PV1C 1LTBD 2EJMA 3FVQA 3DXJC 5KYIA 2B2YA 2I07B 2L55A 4XQNA 4GZYC 5FOBB 2Z1CA 5FO9B 1PTOC 2X6LA 1VDZA 2KEDA 4DXGA 2MUYA 3HOWB 1SNCA 5JJZA 5IOCA 3SR1A 1B53A 4V0BA 4FF3A 4F8MA 3MA2B 1EEFD 1KNEA 2NBFA 4QMGA 3Q24A 2A5HA 3WDNA 3R2TA 3P75A 3D4WA 3OW7A 2E76C 2B2VA 1ESRA 5EPKA 5IODA 1WTVA 3C1FA 4HEDA 5EPJA 2L1BA 1BR9A 3N6RA 5FLXE 2AUJD 3S1NB 2RQXA 2PZTA 4RKBA 3TMEA 1ENFA 2AWNA 2EY2A 4G57A 3K59A 1KLGD 2FMMA 5E1FA 1SJED 2PZUA 5IT9L 1NAPA 3H3VC 1JOOA 1EL0A 1EEID 5KNBA 4JK1C 3VR5A 1SDFA 3W2DA 3TP8A 4C3IB 2E2IB 1LO5D 2XVSA 1R9TB 3SXHA 3MEHA 2EY6A 1S5DD 2PO4A 1WCMB 5C3XA 1GOZA 3SEBA 3K58A 2Q8IB 3VR4A 3OMCA 4K2LA 3SVMA 1JWUD 1HHVA 4EQNA 3E0JA 2YU9B 4DGZA 5M9OA 1XTCD 1LLRD 1A6XA 1KDCA 3MFGA 4A3BB 3RZDB 3HEJA 2K5DA 2B2WC 2EYJA 1Q8IA 4O1NA 1XXGA 1SNOA 3S1QB 1X32A 1Y1WB 5KNDA 3LWUA 4DAVA 3OHXC 1M8AA 2B2UC 2RDFA 2M2LA 1IW7D 4K5XA 4R8NA 4ABNA 3CU7A 1Y8NB 5C44B 5IGGA 3PO2B 2EPBA 5DNFA 1TVXA 4HCSA 5EKKA 3SDZA 5DEHA 1U4MA 1PTOB 3SK5A 3K57A 4KJOA 1JCKB 3TZUA 4F7XA 3IAYA 1B1ZA 2A6ED 1EZ6A 2WIIB 2F0KA 3DWQA 4NDXA 2JA8B 3SE0A 1Z7TA 1AP0A 1SYBA 1TWHB 1QNUA 1J8IA 3V96A 4IFDH 2KEEA 5CV7A 3KK7A 2EYOA 3KBGA 3PV0A 4TKOB 5D3IB 4A93B 1EFID 2L11A 4HAEA 4U68A 2XWBB 3OIQA 4M8AA 3DMUA 1FNVA 3C1EA 2XN9C 3GTKB 2RDGA 2EYHA 4C3HG 3RUZA 3ERQA 3C2PA 1TT2A 5CV5A 1Z47A 5IGBA 4U673 2JA6B 1EYDA 2MP1A 3QJYA 2PPBC 5JVG3 1SAPA 1O7YA 1DONA 1EQTA 4NKLA 3PO3B 1PXUA 2F0WA 1IYVA 3BVGA 4CHTB 4HSVA 5M3FB 5E4WC 3A8KE 1DOKA 2PCFB 1V43A 3A7LA 2C9OA 1MSGA 5HGTA 4H0LC 1D1KA 4OO1I 1II3A 2D5DA 3S15B 5C0XH 1W6KA 3R3OA 1D5MC 3BYYB 2B2TA 4OIJA 1EWHA 1RTNA 3X3NA 3NSWA 5JEAJ 3PIO3 3Q22A 1TS2A 3A8IE 1STNA 1YNJD 4I65A 1CA5A 1D5ZC 2JXMB 1V8QA 4HR7B 1EZ8A 2EY1A 4ZK9B 4DNRB 2R61A 2DY8A 1EIHA 2HQEA 3I70A 3V2TA 2JA5B 4A3DB 3VA7A 2F1MA 4RGNA 1TS4A 2B8GA 4OL7A 4RFBA 4G4KA 1O78A 2EXZA 2FMCA 1IKMA 5CV4A 3H0GB 1NCVA 2FHTA 1K83B 5C4HA 1C4QA 1NR2A 4PQXA 3HOUB 5M5YB 4A3EB 1NUCA 1TIID 5BN3A 2E2JB 1OO9B 1I4QA 2EJFC 3NTHA 4A3KB 3VYSA 1HQMC 3DEPA 5JPNC 1B9NA 2NVXB 5I9OA 2EYLA 1DCZA 2AQ2B 3NTKA 2Z8LA 4J1MA 1JICA 4YIJA 2I46A 1MI2A 1G8ZD 3DM1A 5C5MA 3J7AV 4L6TB 4FNFA 2IW3A 4CJ0B 5DM63 3JAML 3ND9A 1F9PA 1QOHA 1TWGB 2KQ3A 3QOJA 1QCBD 1I4PA 4DXFA 4XXEA 3MAQA 4C3JB 1PMRA 4DA2A 1CHPD 2BE5D 2LY7A 2NVYB 3NWTA 4B9WA 5IT9E 1EY4A 1D5XC 2BCOA 1STHA 2F0UA 1HUNA 4C3IG 2D2CC 3FKIB 4KD3A 2O2LD 4IFDG 4XQJA 3MFYA 1V1OA 1STYA 3K5OA 1Q1EA 1I4XA 3KUPA 3MZ5A 1HXYD 5NUCA 4LMQD 2OF1A 2EYPA 5CBEE 1CTMA 2AUKA 1SSOA 3RD4A 3Q23A 1WTWA 2L9HA 3D31A 4FO2A 4FF4A 1X3QA 3L9AX 1LACA 2D9UA 1W6JA 3LX0A 2DNCA 4KMUC 1JORA 2F0MA 1Q1BA 1C8CA 3QB3A 1RD9D 4A3GB 5IGFA 1CA6A 4B9XA 3SK8A 5C0XG 4PMCA 1Y69U 4LAAA 2XSCA 2JA7B 1CM9A 1TS5A 3G6JB 4I7ZC 4ODGA 5I4DA 3BS1A 4HMJA 2KVMA 4KKSA 2L0CA 4TRDA 4IURA 1PZID 2N55A 2VB2X 2F0OA 3E5SA 1EYCA 3NUCA 3J81L 1DZ1A 4EVOA 2PMZB 1ZKOA 5I6YA 2F0LA 1F9QA 1O7LA 1F2YA 2MHVA 3EA6A 1ZYRD 3KF8A 2KHSA 4KHVA 1LT6D 5CORA 3VYTA 1U4PA 4OGQC 4ZKBB 5LHY1 5C3WA 1KDAA 1VF7A 1PFNA 4FF1A 5KYLA 4ID6A 4RAUC 4HTHA 1GJXA 4NMZA 3FPUB 3MXGA 2F0SA 5ELEA 2TMPA 1CI3M 3D3RA 2B2WA 4X3UA 2O5JC 2C5CA 2QCPX 2QF7A 1SE4A 3AU7A 1A3UA 2IT1A 2B2UA 2F0HA 1STBA 5JPMC 4ZRZA 1GUGA 1PRTD 1TWAB 1J9OA 1PYWD 2K32A 4KD4A 5KNCA 1V1PB 2CQAA 3ITPA 2A68C 4IUPA 1UNSA 4XT3B 3S17B 3J7YW 4A3MB 2IPKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9R A;  2Q8T A;  1X3P A;  4ZLT F;  1F9S A;  1ML0 D;  2FIN B;  2KEE A;  4X3S A;  2KEC A;  2Q8R E;  4IUT A;  4IUV A;  1G2T A;  3R93 A;  2XIW A;  1A15 A;  5D65 A;  4X3T A;  1B50 A;  2KVM A;  2RSN A;  1MSH A;  4IUR A;  1HUM A;  5CBA E;  2B2Y A;  1RTO A;  3IL8 A;  2R3Z A;  4XDX A;  1EOT A;  1BNZ A;  2L11 A;  4ZKC B;  2N55 A;  4HAE A;  1KNA A;  1PDQ A;  1HFG A;  2KUM A;  2MPM A;  4R9W A;  1O7Z A;  4U68 A;  2DY7 A;  1WTO A;  1HUN A;  2FFK B;  5D14 A;  5EJW A;  3I91 A;  2EE1 A;  1WD1 A;  1DZ1 A;  1LV9 A;  1RHP A;  4RA8 A;  4X3K A;  2IL8 A;  1F9Q A;  3QO2 A;  4OIK A;  1IKM A;  1U4L A;  2K1B A;  2X6L A;  3SVM A;  2KED A;  1WTX A;  1HHV A;  5T1G A;  3P7J A;  1EIG A;  1IKL A;  2FJ2 A;  2MJ8 A;  1NCV A;  1XX8 A;  3MTS A;  4QUC A;  5CMD A;  5JJZ A;  2FHT A;  2NWG A;  1B2T A;  1G91 A;  2BDN A;  3H91 A;  1IL8 A;  2B2V C;  2K03 A;  2K01 A;  1ILP A;  1G6Z A;  1B53 A;  1NR2 A;  2J7Z A;  2NYZ D;  2MP1 A;  2RVL A;  3GV6 A;  1BF4 A;  1GUW A;  3KBX A;  5COR A;  1SAP A;  2K28 A;  3KUP A;  2RA4 A;  1U4P A;  1KNE A;  1O7Y A;  4ZKB B;  1AZP A;  3GV3 A;  2HCC A;  1AZQ A;  2MGS A;  3DEP A;  1DON A;  1VMP A;  1Q3L A;  4RWS C;  1G2S A;  1RJT A;  1PFB A;  2JYO A;  4QUF A;  4LMQ D;  1F2L A;  2VXW A;  1ROD A;  1EQT A;  1WTP A;  5EQ0 A;  2HCI A;  1QG7 A;  2HUG A;  5CBE E;  4NW2 A;  2B2V A;  1PFN A;  3UI2 A;  1SSO A;  2H1E A;  1JIC A;  2B2W C;  4HSV A;  2B2T C;  5E4W C;  1ESR A;  1DOK A;  5EPK A;  3I8Z A;  3Q6S A;  4RAU C;  1WTV A;  1X32 A;  4HED A;  5EPJ A;  2L1B A;  1WTW A;  2L9H A;  1PLF A;  2HDM A;  1MSG A;  3FPU B;  1X3Q A;  3I90 A;  1MI2 A;  1O80 A;  1B4O A;  3G7L A;  1BO0 A;  1WTR A;  1M8A A;  2B2U C;  2D9U A;  1ILQ A;  4O42 A;  3DM1 A;  4ZAI A;  4XT1 B;  2JP1 A;  2M2L A;  5EPL A;  2EOT A;  1HFN A;  1XYI A;  2SDF A;  3N52 A;  4CJ2 C;  1WVL A;  3TZD A;  1QNK A;  1DOL A;  2B2W A;  3LWE A;  2B2T A;  4OIJ A;  4X3U A;  3TN2 A;  4CJ0 B;  1C8C A;  1RTN A;  2EPB A;  4R8I A;  1WD0 A;  4UAI A;  2CVR A;  5DNF A;  1JE4 A;  1TVX A;  4HCS A;  1B3A A;  4IUU A;  1DOM A;  2FMM A;  1U4M A;  3MWY W;  1PFM A;  1E0B A;  1F9P A;  1NR4 A;  1VMC A;  2L4N A;  2HDL A;  2K04 A;  2B2U A;  2NZ1 D;  1CA6 A;  2KOL A;  2K05 A;  1WTQ A;  1CA5 A;  1NAP A;  3D6W A;  3ONA B;  1EL0 A;  4IUQ A;  2X6G A;  5COY A;  1J9O A;  3HP3 A;  2RSO A;  1U4R A;  1ZXT A;  1QE6 A;  1BBX C;  3I3C A;  3FDT A;  4CJ1 B;  1HA6 A;  1MGS A;  4IUP A;  4ZK9 B;  4MHE A;  1SDF A;  2B2Y C;  4XT3 B;  2L12 A;  5T1I A;  2X69 A;  1AP0 A;  5EKI A;  3IFD A;  3F2U A;  2N88 A;  1CM9 A;  5AFW A;  3DEO A;  5E4X A;  1HRJ A;  4MN3 A;  1J8I A;  2DY8 A;  1ICW A;  1EIH A;  1S4Z A;  4DN4 M; 
#chains in the Genus database with same CATH topology
 2H4O A;  1F9R A;  3OWE B;  4RCO A;  1A15 A;  1B50 A;  4AYB E;  2KEN A;  1MIU A;  4H7B A;  2ZTC A;  2F0Q A;  1KNA A;  3VR3 A;  4BBR B;  4A3I B;  3SHL A;  2Q2T A;  3RLO A;  1MHW C;  4X3K A;  2G9D A;  2Z4I A;  2MNA A;  2EZV A;  1U9R A;  5IT9 c;  4A3D G;  2R7Z B;  1EIF A;  5HGQ A;  2M00 A;  4HJA A;  3W1G A;  1BXT A;  1A2U A;  4HN7 A;  3K80 C;  2R93 B;  2K28 A;  4IAL A;  2RCN A;  1YHA A;  4IN3 A;  4PZ8 A;  4CDE C;  1AZQ A;  4ME5 A;  4DAP A;  2MGS A;  3AYH B;  3M4P A;  4EQP A;  1RJT A;  3JC6 6;  2J0T D;  3H0G G;  1X9N A;  4PNY A;  4PZ7 A;  2HCI A;  2EJG C;  4NXM L;  1VQE A;  1RF2 D;  4N8F A;  2ZXR A;  5HUR A;  4DR4 L;  3UDX A;  5CYU A;  4B3R L;  4L5R C;  4DV1 Q;  1I50 B;  1S5C D;  3HOU G;  1XPU A;  4BA1 I;  4A3E G;  4RG1 A;  3AB9 A;  5IP9 G;  3HOV H;  1D1I A;  2SNS A;  1BO0 A;  3ZYY X;  4CKE A;  4A3K G;  5DLQ E;  1JC7 A;  1S5E D;  2R7F A;  3A54 A;  4XT1 B;  2BDO A;  4JBK A;  1SE3 A;  2OT2 A;  1Z6H A;  5ELC A;  3HGB A;  4KY7 A;  4YY3 Q;  2F52 A;  3T1Y L;  4UAI A;  4CDF C;  1SMY C;  2CVR A;  1GUO A;  1Q8K A;  2TSS A;  4DAY B;  1I4H A;  1JWM D;  2A6H D;  2MO1 A;  4QL5 A;  1VF5 C;  1AE3 A;  3KF6 B;  5FO8 B;  3U58 A;  1TWA H;  1D6E C;  3IFT A;  4EQO A;  3CF5 A;  2K7V A;  3D6W A;  4H13 C;  2HT1 A;  5ELB A;  3GTG B;  3CCJ A;  4JV5 Q;  3S17 H;  3T16 A;  3NBI A;  4H44 C;  4ZUJ A;  3A8J E;  3GTM B;  4A3M H;  1UE7 A;  5G3L D;  1ET9 A;  3KJP A;  4JI8 Q;  2X69 A;  3RN5 A;  1CKN B;  1N8R C;  3JAM E;  3GD7 A;  2ZJQ A;  4YHH Q;  3KJO A;  5CV8 A;  2CW0 D;  4OHJ A;  4IUV A;  2UUC Q;  2JA9 A;  5D65 A;  4C3J G;  4DF7 A;  1L2F A;  3SK6 A;  2RSN A;  3S2H H;  4BBR H;  4A3I H;  5FKA C;  1EOT A;  3BYT B;  5C4J B;  1F2M A;  2KUM A;  2E5L L;  4FP5 D;  1VQ6 A;  1I4R A;  4LF6 Q;  3K5L A;  4LF9 Q;  1SFO B;  2IL8 A;  2R7Z H;  1N34 L;  2WKD A;  4DUY L;  4IQZ A;  4KN7 C;  1XX8 A;  5IYB G;  2VY3 A;  2WAQ B;  4A3J B;  3PMF A;  4GNX B;  4XQQ A;  1SND A;  4JI0 Q;  2BOS A;  4IUN A;  5K36 H;  4PMW A;  3T53 B;  2PW5 A;  2YTY A;  1BF4 A;  3TP6 A;  3J7Z C;  1VQ5 A;  4JYA Q;  3GV3 A;  4F88 A;  1C7Y A;  4LFB L;  2DUD A;  2QIL A;  1WYD A;  3GTL B;  1VS0 A;  1ROD A;  1TY0 A;  1RL2 A;  1VQO A;  1WTP A;  1CSQ A;  4NB3 A;  5FLM H;  1I50 H;  2L15 A;  1BCP D;  1VQM A;  3K8A A;  2PI2 A;  4QF4 A;  3AFP A;  1CHQ D;  1VQ7 A;  1NSN S;  3I90 A;  3A56 A;  1CZW A;  1XNR L;  5E3F A;  1B4O A;  2OEO A;  2ALY B;  1HFN A;  5EBD A;  1WTH A;  2YTV A;  1N32 Q;  2LKV A;  3I4O A;  3PUZ A;  4B3M Q;  4GKK Q;  4K5W A;  3H6M A;  1K8M A;  4K6D A;  1EQV A;  3C3L A;  1Q46 A;  3SK4 A;  5BN5 A;  1Q90 A;  2Z4H A;  2EDG A;  3TBI B;  4WJW A;  4J6H A;  3CCM A;  3GTG H;  4LK1 C;  1E2V A;  3FMC A;  4MZ9 A;  2X6G A;  4BY1 B;  3FDT A;  1MGS A;  3L7Z C;  1QVC A;  3BVZ A;  5DAU A;  4JBM A;  1S5B D;  3IFD A;  1LTA D;  4R4C A;  1HRJ A;  1GUN A;  1PA6 A;  3OIP A;  4LUZ A;  1ICW A;  1B7Y B;  1SYD A;  1AFP A;  2Q8T A;  3CPF A;  2ZJR A;  2K50 A;  2KEC A;  2Q8R E;  3K5N A;  4X3T A;  5C4J H;  2A1A A;  3QIA A;  1RTO A;  2UXB Q;  2F4V Q;  4AYB B;  2J4X A;  3K7A B;  3I4N B;  4R9W A;  2JA7 G;  4IPD A;  1SFO H;  5D14 A;  1PH3 A;  4JV5 L;  2EE1 A;  1AH9 A;  2EXD A;  4JC0 A;  1EY9 A;  1EQR A;  1TWF B;  3R8B A;  3BU2 A;  1WTX A;  3GTQ B;  3UDI A;  2DJF C;  1HNW Q;  4A3J H;  1N36 Q;  3URY A;  4QUC A;  4L5Q A;  4RH6 A;  4QB4 A;  4R4T A;  5C0X J;  4IPH A;  2UUC L;  1G6Z A;  3ERS X;  2HHH Q;  4UP9 A;  4DV4 L;  1QIL A;  3GTL H;  4FXG C;  1K0S A;  1UE1 A;  3J81 E;  1VMP A;  5I2X A;  4QUF A;  3KLR A;  3CCE A;  1EQQ A;  4LF6 L;  1X65 A;  4HIK A;  4C1N I;  3CAM A;  4LF9 L;  5EQ0 A;  1XTD A;  2O4X A;  1PH2 A;  3L2P A;  3S16 B;  4HJ5 A;  4GLV B;  4RKL A;  1YHB A;  4DV2 Q;  2B8F A;  3S24 A;  2VQE Q;  2KCN A;  1G29 1;  4FYD A;  1NNX A;  1O80 A;  4QIW E;  2UXC Q;  5IYD G;  1JOQ A;  2BA0 A;  2WKC A;  4JI0 L;  4ZAI A;  4G7H C;  3CCR A;  3CHB D;  2AQ1 B;  2PYK A;  3GTO B;  1SYG A;  2K33 A;  4BS9 A;  4JYA L;  1QNK A;  4QCL A;  3MEF A;  1STE A;  4KLK A;  5AJ3 Q;  3CD6 A;  4K0K Q;  1KRT A;  3RR5 A;  2L4N A;  1VMC A;  1GUT A;  4RCN A;  3I4L A;  1D7Q A;  1Z9F A;  4BY1 H;  4QQB X;  2A19 A;  1LM0 A;  2RSO A;  1EU4 A;  1PTO D;  3PUY A;  3A55 A;  4C2M B;  1F2Z A;  1KDB A;  3KOJ A;  4KK7 A;  2L12 A;  5LL6 X;  5T1I A;  1IW7 C;  1ENA A;  2MFI A;  4J8Q A;  4HSP A;  1I6V C;  1NBW A;  4DN4 M;  4HJ9 A;  1Y1V B;  2F0T A;  4V19 0;  2NVT B;  1QB5 D;  3NQT A;  1CQF A;  3PGZ A;  1AW7 A;  4RGO S;  4HJ7 A;  3NQI A;  4GN3 B;  1BDO A;  3K7A H;  4L8J A;  3I4N H;  1A2T A;  4WOR A;  3VYU A;  2ID0 A;  2AWO A;  5IE8 A;  5IGC A;  5IP7 H;  2E2H B;  4WFN 3;  4A3M G;  5JJI A;  2RHQ B;  3JAM c;  2GA4 B;  2A6E C;  3GTQ H;  3QO2 A;  4OIK A;  1TQO A;  2K1B A;  4DNI A;  4DNT B;  3STB C;  2CH4 A;  3UE1 A;  3W3A A;  1B3Q A;  1KQS A;  5J3B A;  2NTT A;  4MNO A;  1TY2 A;  2BDN A;  1ILP A;  2NVQ B;  2ZTE A;  3H09 A;  4OWW B;  1LUZ A;  4BBR G;  3JAM i;  4A3I G;  4DAY A;  3HOY B;  4IPC A;  2RA4 A;  1AEX A;  2UXB L;  3IKJ A;  1Q3L A;  2F0G A;  2R7Z G;  1FR3 A;  1PRT B;  3KLS X;  5J1Z A;  4NW2 A;  3RMH A;  3BG3 A;  5IGD A;  1OXX K;  3I8Z A;  3R2I A;  3D8G A;  1CKN A;  2MQH A;  3BZD B;  1X3E A;  1PLF A;  2R93 G;  3GO5 A;  1SNM A;  3G7L A;  5K36 G;  1SYF A;  3CC7 A;  4RHR A;  3AMU A;  4C1N K;  3V05 A;  3PUW A;  2HHH L;  1K73 C;  5C3E B;  3LWE A;  3MHB A;  1YI2 A;  2CHB D;  3CC4 A;  3KLS A;  1X54 A;  5FLM G;  3EQL C;  5EGT A;  1TU2 B;  2NZ1 D;  5JOB A;  1IYJ B;  1DYQ A;  4O2D A;  5IIF A;  2CH4 W;  4JI6 Q;  3UDF A;  2KJX A;  4BY7 B;  4DV2 L;  2VQE L;  1PV4 A;  4C2M H;  3MVV A;  3NXW A;  2PQE A;  3CCQ A;  1KLU D;  4CJ1 B;  1ESF A;  1A62 A;  2I5L X;  5C0X I;  3BVM A;  4JBW A;  4GNX A;  1MBY A;  4IOC A;  4LF8 L;  2K5Q A;  5IWA L;  1Y1V H;  4MTN A;  5E4X A;  5EBC A;  1E2W A;  1Q12 A;  2NVT H;  2EYF A;  1EY8 A;  1KC8 C;  4KI0 A;  1OXV A;  3HKZ E;  1D2B A;  3NK9 A;  3PIP 3;  2E2H H;  1HUM A;  1V1Q A;  2R3Z A;  4XDX A;  3PIO A;  1YNJ C;  4ZKC B;  1U5K A;  3ERO A;  1O7Z A;  3DWA A;  2DY7 A;  4DR3 Q;  3DHQ A;  4FF2 A;  1HZ9 A;  1LTR D;  1BOS A;  2KHJ A;  4NXN Q;  1RHP A;  2F0P A;  1CK1 A;  3MC0 B;  2JK8 A;  5T1G A;  1KTK A;  1GD7 A;  1DD2 A;  5KIX A;  2NVQ H;  1VQF A;  1L0W A;  2NN6 I;  2NWG A;  5C4X B;  1H95 A;  1JE5 A;  1EY6 A;  5FJ8 H;  1M4V A;  1IBM Q;  5CC4 A;  4DK1 A;  4EX5 A;  2JA8 G;  1T5X D;  1EU3 A;  1HTP A;  1NE3 A;  1YBY A;  2HCC A;  3TSS A;  1SR3 A;  2PNR C;  3CME A;  1WI5 A;  2JYO A;  2PQA A;  4YCW A;  1ICF B;  5M3M B;  3S9W A;  2HUG A;  2PW7 A;  1FGB D;  1MD2 D;  2WAQ G;  4A3J G;  1VQA A;  5IGE A;  4JCV E;  3NEL A;  4LFC L;  5C5L A;  4A3L H;  2HDM A;  5KRU A;  4A76 A;  3T13 A;  2XRQ D;  4O42 A;  4YWM A;  2ASB A;  4ULL A;  5EPL A;  3C46 A;  2EOT A;  5C3E H;  2HIX A;  1LT3 D;  3H3V I;  1GHK A;  4FDB A;  4K6L A;  4CJ2 C;  3UDG A;  1A3V A;  1DOL A;  1B70 B;  4KKU A;  5GQO A;  5ELF A;  1WD0 A;  4G7O C;  4FXD A;  1PH5 A;  2JEB I;  2BA1 A;  4BY7 H;  1OXT A;  1CZG A;  4DPG A;  1AE2 A;  3LNN A;  3J81 i;  4JOI C;  2F0J A;  1L1O B;  4LNQ A;  3TS2 A;  1JMC A;  1LT5 D;  1ZXT A;  3EBE A;  3HOV B;  4DR2 Q;  4O0A A;  3EFX D;  4GKJ L;  5L37 A;  3OTO Q;  4JPB W;  2AKW B;  1CUK A;  1K28 A;  4X65 Q;  1JWS D;  2ZT9 C;  3M3Y B;  2XWJ B;  3NEM A;  5DM7 3;  4CKC A;  3CQZ B;  1J5E L;  1BKB A;  1S5F D;  3H94 A;  4ZLT F;  4KHP Q;  1ML0 D;  1G2T A;  4BY1 G;  4YCV A;  4K5V A;  1Y8P B;  5A2Q L;  1EWC A;  1BCP B;  3D4R A;  1NMF A;  1HFG A;  1VQN A;  3U9S A;  4J15 A;  3U4Z A;  4DFA A;  3I4M B;  2XRS D;  2WIN B;  4KKT A;  1VQK A;  5I9P A;  3NP8 A;  2I0Q A;  4LF4 L;  3TDQ A;  2BE5 C;  1JOK A;  3DLL A;  5C4X H;  2JQO A;  4KY6 A;  1IKL A;  3HG9 A;  2JJQ A;  1IL8 A;  2K03 A;  3VDY A;  3NPP A;  4OO1 H;  2ZXP A;  4AYB G;  3I4N G;  3VA5 A;  4TQU S;  1VQ4 A;  5IP7 G;  5GAE C;  2IX0 A;  3S2H B;  5M3M H;  2V4D A;  3EJI A;  1G2S A;  1NY4 A;  5J39 A;  4NXN L;  1D8L A;  4CGY B;  2IHF A;  3FRP B;  1IYU A;  4K14 A;  2E75 C;  4B08 A;  2JA5 G;  2WAC A;  1B9M A;  4GS3 A;  3KFU A;  3Q6S A;  1R4Q B;  3A5Z B;  3PSI A;  1C0A A;  1R4P B;  4PG3 A;  1C9O A;  2KA7 A;  2XTI A;  1RKN A;  3P20 A;  2VS1 A;  3D4D A;  1IBM L;  3G48 A;  3TP5 A;  2B63 B;  1YNN C;  1HNZ Q;  3J80 E;  1X6O A;  3CRK C;  3J7A 5;  1EYA A;  1TKW B;  2WV6 D;  1YZ6 A;  4ILW A;  2NZH A;  2KCC A;  1DM0 B;  1H9S B;  4HMI A;  4A3F B;  5LL6 S;  3FP9 A;  1HR0 L;  3OPO A;  1ET6 A;  2NTS A;  2HDL A;  3E3X A;  3ND8 A;  3O13 A;  3G71 A;  4KHZ A;  1SYC A;  3ONA B;  4LUO A;  2RBM A;  2ZXO A;  1IL2 A;  3I3C A;  1NMG A;  3KDF A;  4Q0F A;  1RCV D;  4DR1 L;  4MHE A;  3F2B A;  1JB3 A;  2B2Y C;  3I2Z A;  1KAW A;  3M3Y H;  3EVQ A;  2L5T A;  3CQZ H;  1DGS A;  1YJ9 A;  3DEO A;  4S3S A;  2K4K A;  5JVH 3;  4IUT A;  4WRD A;  4Y7N B;  1T5E A;  1BQQ T;  3S1R B;  1S3O A;  3HZX A;  1HZA A;  3IRB A;  1GVP A;  1MSH A;  1KHI A;  1LTL A;  3HKZ B;  3QOL A;  5CBA E;  3GTP B;  5FO7 B;  3I4M H;  1PDQ A;  1WTO A;  2G9H D;  1H9J A;  3I72 A;  1SBB B;  2Q2U A;  3TRZ A;  2A69 C;  1QUQ B;  1Y1V G;  1PRT F;  3OTO L;  2E2D C;  3T56 B;  4X65 L;  3MXP A;  1SJH D;  3E0E A;  3PUX A;  3M85 A;  2FJ2 A;  2DN8 A;  2ZM6 Q;  2ZTD A;  1PH9 A;  4KHP L;  5ISR A;  1B2T A;  5JJK A;  2B2V C;  4EGV A;  4FXK C;  1UE5 A;  2RVL A;  4UDU C;  2ICI A;  2WP8 J;  4XYQ A;  4B3T Q;  3A0J A;  3NBH B;  2VUM B;  1HPC A;  1A3T A;  3HOX B;  1CFM A;  2EY5 A;  5FK9 C;  5K5P A;  4RWS C;  1F2L A;  2LXK A;  2VXW A;  3P1H A;  3H15 A;  1XJV A;  3G6E A;  1B44 D;  1F77 A;  4NP5 A;  1Y14 B;  3UI2 A;  4DU9 A;  4I7A A;  1JJC B;  1OXU A;  1VQG A;  1GXD C;  3HOY G;  2A73 B;  5FJ8 G;  1MJE A;  1WTR A;  2B63 H;  4PMB A;  1ILQ A;  1HQR D;  1ZYR C;  1QWY A;  4KY5 A;  2SDF A;  3FEW X;  1HA5 A;  5KEE A;  1DXM A;  3FKI G;  4ZYS A;  4A3F H;  4HIM A;  5CV9 A;  3S14 B;  1SLJ A;  3J7A F;  4OXP A;  4WJ3 M;  1TXY A;  1ASZ A;  1E0B A;  3M4O B;  1BBU A;  1QVG A;  5J22 A;  2KOL A;  1K8O A;  2R7D A;  4A3L G;  4X64 Q;  2RHS B;  4L5S A;  1WOC A;  5GAG C;  4IUQ A;  3HOZ B;  3K0Y A;  5COY A;  3NWS A;  4LF7 Q;  1U4R A;  1QE6 A;  1SEB D;  1STG A;  4HIO A;  4BWG B;  3K6O A;  4HID A;  4L63 B;  2EQS A;  3HS0 C;  3T4A C;  4IFD J;  3L3O C;  4Z9C B;  1S4Z A;  4BBS B;  2D62 A;  4Y7N H;  4K8J A;  4UY8 C;  3S1R H;  4BY7 G;  3FPP A;  3R93 A;  4BXX H;  2XIW A;  5JEA H;  4OX9 Q;  2G5D A;  3GTP H;  4DV1 L;  3UE0 A;  1LT4 D;  3D6C A;  4IZ8 A;  4XTC S;  4DV7 Q;  4P2C B;  3S2D B;  2B29 A;  1J6Q A;  3IL8 A;  4LF5 Q;  4Y52 H;  4LUV A;  5LMU Q;  1JJG A;  1PRT C;  4UPA A;  2OQK A;  1GHJ A;  1WD1 A;  2UUB Q;  1KD1 C;  1EUJ A;  3T51 B;  3S1Q H;  1TWC B;  4A3G G;  3NE5 B;  3U50 C;  4YY3 L;  3KYH C;  4E6I A;  2LMC B;  1EIG A;  2MJ8 A;  5G3L F;  4XYO A;  1G91 A;  3H91 A;  1OXS C;  2K01 A;  2Q2H A;  3I7F A;  1I5F A;  5CV6 A;  2VUM H;  2R6G A;  2YYZ A;  3VR2 A;  5FLX L;  1UUP A;  2R92 B;  3HOX H;  1E7Z A;  1GUW A;  3KBX A;  1SRU A;  2QDB A;  3QG1 A;  2QEX A;  2EVB A;  3A74 A;  1AZP A;  2LS0 1;  1Y8O B;  2N49 A;  2VL6 A;  4JI8 L;  3OWF A;  1PTO H;  1VQJ A;  2Y0S E;  3DWP A;  3NTI A;  1NJI C;  1ENC A;  4HCE A;  3BZK A;  5C4X G;  4YHH L;  2DNE A;  3L0O A;  3TQY A;  1WJJ A;  3MXN A;  3QWN A;  4OO1 G;  1ASY A;  1Q86 C;  4K8I A;  2D0O A;  4WJ4 A;  3EN2 A;  4F87 A;  3CRL C;  1TS3 A;  1A63 A;  1VQB A;  5E7N A;  5BR8 Q;  4OWX B;  1SE2 A;  1UAP A;  3N52 A;  5M3M G;  3S14 H;  3LGJ A;  1VQP A;  3RZO B;  1H9M A;  3J80 L;  3ICE A;  3M4O H;  1JE4 A;  1B3A A;  1LTI D;  2NN6 H;  1BVS A;  4EQ5 A;  2SNM A;  1V1P A;  2WB1 E;  2ICE C;  2K04 A;  1WTQ A;  4DV5 Q;  3HOZ H;  4JI7 Q;  2IX1 A;  2AQ3 B;  1FNU A;  3HP3 A;  3J80 c;  1STA A;  1BCP F;  2PMZ E;  5A35 A;  2Z6K C;  1SXT A;  1L0Y B;  1BUV T;  2IX3 A;  2LXJ A;  5BN4 A;  1JR0 D;  1LAB A;  2AMC B;  4N9T A;  4BBS H;  1IXR A;  5AFW A;  4MN3 A;  1KRS A;  1PYS B;  1B8A A;  1AN8 A;  1EY7 A;  1ZEQ X;  1X3P A;  2JA6 H;  1GKH A;  1F9S A;  2FIN B;  4X66 Q;  4X3S A;  3S2D H;  5C4Z A;  2SOB A;  3OOC A;  1LTS D;  3HOV G;  2A6H C;  1VCI A;  4X64 L;  4TSS A;  2F3W A;  1PZK D;  2RDH A;  1BNZ A;  4RGT A;  2VB3 X;  4LF7 L;  1VQC A;  4IJH A;  3GTJ B;  1XWE A;  2FFK B;  2IJ0 A;  1TWC H;  1JQY D;  3HFZ B;  3I91 A;  4JI2 Q;  4DAM A;  1K9M C;  4B3S Q;  1N32 L;  1LV9 A;  1RDP D;  4B3M L;  4GKK L;  3WOF A;  3F2C A;  1U4L A;  2XNA C;  4G7Z C;  4KTA A;  3P7J A;  3A7A B;  4AQY Q;  1E2Z A;  3OSO A;  3TS0 A;  3BDC A;  2N78 A;  4ZQ3 A;  1ONL A;  2R92 H;  5KGU A;  4GN5 A;  2CWP A;  1GUS A;  2F0N A;  4OX9 L;  2K5W A;  2CW0 C;  5A2Q E;  1H9S A;  2J7Z A;  2PZW A;  4DV7 L;  2C35 B;  4IO9 A;  4BA2 I;  1EY5 A;  4LF5 L;  5CGK A;  2CWA A;  5LMU L;  4JI3 Q;  1CT1 D;  2GN5 A;  2UUB L;  4K2K A;  1CQV A;  1FVI A;  4M1U B;  3WWV A;  1IZ6 A;  1K3B C;  1KAB A;  3U9O A;  2E74 C;  3ULL A;  2B2T C;  2F3I A;  1L1O C;  4DR5 Q;  4IFD I;  2A68 D;  2F03 A;  1GO3 E;  3S1M B;  3BDL A;  4R1J A;  3RZO H;  1PZJ D;  2F4V L;  1K3R A;  5F2D A;  3KF6 A;  4FVM A;  3TN2 A;  3AQQ A;  4R8I A;  4POG A;  1PH7 A;  4IUU A;  3MWY W;  4IOA A;  1IHZ A;  3M7G A;  1VQ8 A;  2IWH A;  1HNW L;  1LTT D;  3VR6 A;  1QUQ A;  1N36 L;  5GRO A;  4UP8 A;  4RGM A;  1BCP C;  4GN4 B;  2SEB D;  1KIX A;  2K52 A;  2F0V A;  1BBX C;  1UEA B;  1L0X B;  2ENB A;  5BR8 L;  4A3F G;  1Q81 C;  4RHS A;  4ZCK A;  5EKI A;  4YWK A;  1W3S A;  2N88 A;  1I3Q B;  2F0F A;  2LFN A;  1EY0 A;  1X56 A;  4C3H B;  1KL9 A;  4X6A H;  3NBH A;  4JOI A;  1FD7 D;  5M5W B;  4MIU A;  3M4Y A;  3F8T A;  1E3P A;  2NZO A;  5M5X B;  4KJN A;  4DV5 L;  1YNN D;  3GTJ H;  2JEA I;  2Z6B A;  1SNP A;  2UXC L;  2OQ0 A;  2MPM A;  1HJP A;  2F0E A;  1KAA A;  5EJW A;  1SNQ A;  1PH8 A;  3BDO A;  4RA8 A;  2F0D A;  4CBV A;  3U4V A;  2EYM A;  2ES2 A;  1PTO F;  1DJR D;  4OON A;  5I2Y A;  5AJ3 L;  2K14 A;  1H9K A;  3TP7 A;  3MTS A;  1SN8 A;  4K0K L;  4X66 L;  2F3V A;  2B39 A;  3CKI B;  3HKZ G;  5CMD A;  5JEA G;  4BXX G;  1S72 A;  4ZUI A;  3K5M A;  1YJW A;  2UUA Q;  2NYZ D;  5ELD A;  3G4S A;  3I73 A;  3GV6 A;  3RNU A;  4Q5V A;  3OW2 A;  1I4G A;  1SMY D;  3PUV A;  5I6W A;  5IYC H;  1PFB A;  3E6Z X;  4JI2 L;  4B3S L;  2A74 C;  2M9V A;  1QG7 A;  3NHH A;  1FYC A;  2I5M X;  3HRZ C;  3K81 C;  2H1E A;  2Z0S A;  4JI4 Q;  2Y0S B;  4ALP A;  2K6A A;  1HNX Q;  4AQY L;  1PH6 A;  1I6H B;  3GQB A;  1YNX A;  3S1M H;  4OEM B;  2VUM G;  1QJO A;  3RLF A;  4QY7 A;  1SYE A;  4C56 C;  3HOX G;  2A69 D;  2NUC A;  2JP1 A;  2JE6 I;  5CR3 A;  1XYI A;  1HCZ A;  2N8N A;  4CKB A;  1WVL A;  2OXP A;  3TZD A;  3M7N A;  4JI3 L;  2O5I C;  3X3M A;  2F0I A;  5TSS A;  1X55 A;  1DOM A;  3MXU A;  2QA4 A;  1PFM A;  1NR4 A;  1FL0 A;  2K05 A;  5GAD C;  1H9R A;  3DUZ A;  4OEL B;  2VNU D;  2NB0 A;  3WOE A;  2WB1 B;  1SRO A;  3GP7 A;  4AIM A;  2OTL A;  3OMG A;  1N9W A;  4XIG S;  1C48 A;  5EKL A;  4DK0 A;  4KV6 A;  1VQD A;  3PF5 A;  2QEJ C;  4N9P A;  4KN4 C;  4LJZ C;  3Q0A A;  1HA6 A;  3VYR A;  4QIW B;  1I3Q H;  1K8A C;  1FNW A;  4C3H H;  3F2U A;  5M5W H;  1TR5 A;  5JAV A;  1LTG D;  5D3D A;  2F4I A;  1HTL D;  2JSO A;  2GVA A;  2NN6 G;  2RKS A;  4B3R Q;  2QKI C;  5C6A A;  4PV1 C;  1CKO A;  5M5X H;  4QJF A;  1PFS A;  1LTB D;  3AFQ A;  2EJM A;  3FVQ A;  3DXJ C;  5KYI A;  2B2Y A;  2I07 B;  2L55 A;  3RLN A;  4XQN A;  4GZY C;  1YIT A;  5FOB B;  4A4I A;  3T1Y Q;  4BBS G;  2Z1C A;  5FO9 B;  3I55 A;  1PTO C;  2KCM A;  2X6L A;  1VDZ A;  2KED A;  4DXG A;  2MUY A;  1W2B A;  3HOW B;  1SNC A;  5JJZ A;  2UXD Q;  5IOC A;  5ELO A;  2YV5 A;  3SR1 A;  4OWT B;  1B53 A;  4NPS A;  4V0B A;  2RCF A;  4FF3 A;  4JI6 L;  4DR6 Q;  4F8M A;  3MA2 B;  1EEF D;  2OTJ A;  4UP7 A;  1KNE A;  5ELN A;  2NBF A;  4QMG A;  3Q24 A;  4GOP C;  2A5H A;  3WDN A;  1YVC A;  2KBN A;  3R2T A;  3P75 A;  3D4W A;  3OW7 A;  2E76 C;  2B2V A;  3TEH B;  1I6H H;  1ESR A;  3CC2 A;  5EPK A;  5IOD A;  1WTV A;  3C1F A;  4HED A;  5EPJ A;  1UWV A;  2L1B A;  2R92 G;  1BR9 A;  3N6R A;  1WFQ A;  5FLX E;  3BZC A;  2E5L Q;  2AUJ D;  3CCU A;  3S1N B;  2RQX A;  1I94 Q;  2PZT A;  1HZB A;  4RKB A;  3TME A;  2VW9 A;  1ENF A;  4DR3 L;  3CP0 A;  1N34 Q;  3E9I A;  4R4I A;  4POF A;  1A8V A;  2AWN A;  1VQH A;  2EY2 A;  4DUY Q;  1VQL A;  2V1C C;  4G57 A;  3K59 A;  4MTK A;  1S40 A;  2CQO A;  1KLG D;  2FMM A;  5E1F A;  1SJE D;  2PZU A;  3J81 j;  4JI4 L;  5IT9 L;  5EAY A;  1HNX L;  4GLA C;  1NAP A;  1SMX A;  3H3V C;  1JOO A;  1EL0 A;  5JJL A;  1EEI D;  5KNB A;  1E22 A;  1A0I A;  4LFB Q;  4JK1 C;  3VR5 A;  3GDE A;  3NEN A;  4P73 A;  1SDF A;  2ATW A;  3W2D A;  3TP8 A;  1PH4 A;  4C3I B;  2E2I B;  1LO5 D;  2XVS A;  1R9T B;  1YHQ A;  3SXH A;  2Q2I A;  3MEH A;  2EY6 A;  2B3G A;  1XNR Q;  4IPG A;  1S5D D;  2PO4 A;  1WCM B;  5IYD H;  5C3X A;  1GOZ A;  1JJ2 A;  3SEB A;  1XMQ Q;  3K58 A;  2Q8I B;  3VR4 A;  3OMC A;  3FHW A;  1XNQ Q;  3HOW H;  4A3C H;  4K2L A;  3SVM A;  1JWU D;  1HHV A;  2KCT A;  4EQN A;  3E0J A;  2YU9 B;  4DGZ A;  5M9O A;  2XGT A;  1XTC D;  2ZJP A;  1U0L A;  2OCE A;  1LLR D;  1A6X A;  1KDC A;  3K0X A;  4DR2 L;  1EWI A;  3MFG A;  3PIP A;  4A3B B;  3RZD B;  3HEJ A;  2K5D A;  2AHO B;  4RMF A;  4CDC C;  2B2W C;  2EYJ A;  1Q8I A;  4O1N A;  1XXG A;  1SNO A;  3S1Q B;  1X32 A;  1V9P A;  2UXD L;  1Y1W B;  3S1N H;  5KND A;  3LWU A;  4DAV A;  3OHX C;  1M8A A;  2B2U C;  2RDF A;  4DR6 L;  2M2L A;  1IW7 D;  4R4O A;  4K5X A;  4A75 A;  4R8N A;  1HH2 P;  4ABN A;  3CU7 A;  1M90 C;  5IYC G;  1Y8N B;  5C44 B;  5IGG A;  3PO2 B;  1Q82 C;  2EPB A;  2DGY A;  5DNF A;  1TVX A;  4HCS A;  5EKK A;  3SDZ A;  4L5T A;  5DEH A;  1U4M A;  1N33 Q;  1PTO B;  3SK5 A;  3K57 A;  4KJO A;  1JCK B;  3TZU A;  4F7X A;  3IAY A;  4DV4 Q;  1B1Z A;  2A6E D;  1EZ6 A;  2WII B;  2F0K A;  1I94 L;  3DWQ A;  4NDX A;  4C3I H;  2JA8 B;  3STB D;  3SE0 A;  1Z7T A;  2E2I H;  1AP0 A;  1R9T H;  1SYB A;  1TWH B;  1QNU A;  1J8I A;  3V96 A;  2MO0 A;  4GOP B;  4IFD H;  1NTG A;  4DV6 Q;  2N3S A;  2KEE A;  1WCM H;  3KK7 A;  5CV7 A;  2EYO A;  1X3G A;  3KBG A;  3PV0 A;  4TKO B;  2OWO A;  2Z6K A;  5D3I B;  1IBL Q;  2R93 H;  3F2D A;  1QZG A;  4JW0 A;  4A93 B;  1EFI D;  3BJU A;  3A5U A;  1MKH A;  2BH8 A;  2L11 A;  3SGI A;  3HKS A;  4HAE A;  5C3E G;  4U68 A;  2XWB B;  3OIQ A;  4M8A A;  3ULJ A;  3DMU A;  1FNV A;  3C1E A;  1G6P A;  2XN9 C;  3GTK B;  2RDG A;  2EYH A;  4C3H G;  1E1T A;  1HNZ L;  3RUZ A;  3ERQ A;  3C2P A;  1SE8 A;  1TT2 A;  2RF4 A;  2YU9 H;  2IY5 B;  1O7I A;  5CV5 A;  1JT8 A;  1Z47 A;  5IGB A;  4U67 3;  3PQI A;  2JA6 B;  1EYD A;  2MP1 A;  3QJY A;  2PPB C;  1FJG Q;  5JVG 3;  1SAP A;  1O7Y A;  4A3B H;  1XMQ L;  3RZD H;  1XPO A;  1DON A;  4YWL A;  1EQT A;  4NKL A;  4TVA B;  3PO3 B;  1XNQ L;  1PXU A;  2F0W A;  1IYV A;  3BVG A;  4CHT B;  4HSV A;  5M3F B;  5E4W C;  3A8K E;  1DOK A;  1Y1W H;  2PCF B;  1V43 A;  4JBJ A;  3A7L A;  2C9O A;  4DV3 Q;  1PHJ A;  3I56 A;  2PQA B;  1MSG A;  5HGT A;  3GTM H;  4H0L C;  3W1B A;  1D1K A;  4OO1 I;  1II3 A;  2D5D A;  3S15 B;  5GAH C;  5C0X H;  1W6K A;  1QZH A;  2VZA A;  3R3O A;  5C44 H;  5LMN W;  1D5M C;  3PO2 H;  3BYY B;  2B2T A;  4OIJ A;  1QVF A;  3KF8 B;  1EWH A;  1RTN A;  3X3N A;  1L1O A;  2Y0S G;  3NSW A;  5JEA J;  3PIO 3;  3Q22 A;  1TS2 A;  3A8I E;  1YJN A;  1STN A;  5FLX c;  1RIP A;  1PYB A;  1YNJ D;  4I65 A;  2ZM6 L;  1CA5 A;  1D5Z C;  3AEV A;  4YCU A;  2JXM B;  1V8Q A;  2PI2 E;  2JA8 H;  4HR7 B;  1EZ8 A;  2EY1 A;  1Q7Y C;  3K7U C;  1K0R A;  2VQF Q;  1UEB A;  1TWH H;  4ZK9 B;  4B3T L;  4DNR B;  4X62 Q;  1BBW A;  2R61 A;  2DY8 A;  3T1H Q;  1EIH A;  2HQE A;  3RN2 A;  3I70 A;  4UHV A;  3V2T A;  2WB1 G;  1N33 L;  4A93 H;  2BH2 A;  4QGU A;  4A3D B;  2JA5 B;  2K5V A;  3VA7 A;  2F1M A;  4RGN A;  2UU9 Q;  1TS4 A;  3W5O A;  4CDD C;  2B8G A;  3GTK H;  4OL7 A;  1YEZ A;  4RFB A;  2HIV A;  4G4K A;  1O78 A;  2K5H A;  2QDL A;  2EXZ A;  2EIF A;  2FMC A;  1IKM A;  3PF4 A;  5CV4 A;  3H0G B;  4LWC A;  2K5N A;  4H02 A;  1NCV A;  4DV6 L;  1FGU A;  5HY6 A;  2FHT A;  1K83 B;  1X3F A;  5C4H A;  1C4Q A;  3J80 i;  4AH6 A;  4JI1 Q;  1NR2 A;  1IBL L;  4PQX A;  3H3V H;  3HOU B;  5M5Y B;  4A3E B;  1NUC A;  1TII D;  5BN3 A;  2E2J B;  4JVZ A;  1OO9 B;  1I4Q A;  2EJF C;  2LSS A;  3NTH A;  4A3K B;  4LF8 Q;  3VYS A;  3PO3 H;  1HQM C;  3DEP A;  5IWA Q;  5JPN C;  1B9N A;  2NVX B;  5I9O A;  3HOW G;  5M3F H;  1KXL A;  2EYL A;  1DCZ A;  4A3C G;  2AQ2 B;  2A8V A;  3DM3 A;  3NTK A;  1P8L A;  2Z8L A;  4J1M A;  1JIC A;  4YIJ A;  3ZJY C;  3S15 H;  2I46 A;  3Q8D A;  4DKA C;  1MI2 A;  1T9H A;  1G8Z D;  3DM1 A;  5C5M A;  1FJG L;  3I4M G;  1G51 A;  4L6T B;  3J7A V;  4FNF A;  5LMN Q;  2IW3 A;  5H1S E;  4CJ0 B;  1PVO A;  5DM6 3;  3JAM L;  4IJL A;  4R4Q A;  3ND9 A;  2HQL A;  4N8X 1;  1F9P A;  3CPW A;  1EIY B;  1QOH A;  1TWG B;  3D0F A;  2KQ3 A;  3QOJ A;  3QR8 A;  1QCB D;  4DV3 L;  1CKM A;  1I4P A;  4DXF A;  3CCS A;  4XXE A;  2QW7 A;  1JB7 A;  3MAQ A;  2YTX A;  2E8G A;  4DR7 Q;  4C3J B;  1XMO Q;  1PMR A;  4DA2 A;  4DUZ Q;  1CHP D;  1XPR A;  1TWF H;  2BE5 D;  2LY7 A;  2NVY B;  4JI5 Q;  3CXC A;  1E1O A;  2JA5 H;  4A3D H;  3NWT A;  4B9W A;  5IT9 E;  4LFC Q;  3KDF B;  2PNH A;  3F1Z A;  3TRE A;  3ULP A;  1EY4 A;  4P71 A;  1D5X C;  2BCO A;  2H5X A;  2B63 G;  1STH A;  2F0U A;  1HUN A;  4C3I G;  2D2C C;  4LFA Q;  2VQF L;  3S16 H;  4P75 A;  4X62 L;  3H0G H;  4DK6 C;  3FKI B;  4KD3 A;  2O2L D;  1HR0 W;  2Z9H A;  3T1H L;  4IFD G;  4XQJ A;  1K83 H;  3MFY A;  1V1O A;  1M1K C;  1WCM G;  3HOU H;  5M5Y H;  4A3E H;  2E2J H;  1IBK Q;  1STY A;  5IP9 H;  4PZ6 A;  1VQ9 A;  2UU9 L;  3GTO H;  3K5O A;  1Q1E A;  4A3K H;  4JI7 L;  2JN4 A;  1I4X A;  3KUP A;  3B6Y A;  4GLX A;  3MZ5 A;  1HXY D;  2NVX H;  4GKJ Q;  5NUC A;  4LMQ D;  3PCO B;  2OF1 A;  2EYP A;  5CBE E;  1J5E Q;  4DV0 Q;  1CTM A;  2AUK A;  1SSO A;  3RD4 A;  3Q23 A;  2DJG C;  1WTW A;  2L9H A;  4ME3 A;  3D31 A;  4FO2 A;  4FF4 A;  1X3Q A;  3L9A X;  4LW1 A;  2CFM A;  4JI1 L;  1LAC A;  4GOP A;  2D9U A;  1W6J A;  1VQI A;  3LX0 A;  2DNC A;  4KMU C;  1JOR A;  4A3B G;  4LF4 Q;  2F0M A;  1Q1B A;  3OYY A;  1C8C A;  1MJC A;  3QB3 A;  1RD9 D;  1EYG A;  3E9H A;  1TWG H;  4A3G B;  5IGF A;  1Y1W G;  2CCZ A;  1CA6 A;  2K75 A;  4HJ8 A;  1GM5 A;  2FXQ A;  4C3J H;  4DK3 C;  2HD3 A;  4B9X A;  3SK8 A;  3CCL A;  5C0X G;  1P16 A;  2IHE A;  5C44 G;  3KLW A;  4PMC A;  1Y69 U;  4LAA A;  2NVY H;  3CW2 C;  2XSC A;  3M9B A;  5IY0 A;  3PO2 G;  5LMN L;  4P72 A;  3M4Q A;  2JA7 B;  1CM9 A;  1TS5 A;  3G6J B;  4I7Z C;  1OTC A;  4ODG A;  5IYB H;  5I4D A;  3HOY H;  2CKZ B;  3BS1 A;  4HMJ A;  2KVM A;  4KKS A;  2KHI A;  2L0C A;  4IUR A;  4TRD A;  4DR5 L;  1PZI D;  2N55 A;  2VB2 X;  1UE6 A;  4DR7 L;  1XMO L;  2F0O A;  3E5S A;  4DUZ L;  3FKI H;  1EYC A;  3NUC A;  4APV A;  3J81 L;  1DZ1 A;  4EVO A;  2PMZ B;  1ZKO A;  5I6Y A;  2F0L A;  1F9Q A;  4NXM Q;  1HR0 Q;  1CSP A;  1F2Y A;  1O7L A;  4JI5 L;  3EIV A;  2WAQ E;  4DR4 Q;  1E24 A;  4A93 G;  3ER0 A;  2MHV A;  3EA6 A;  1ZYR D;  3HOZ G;  3KF8 A;  2KHS A;  4KHV A;  1HZC A;  1LT6 D;  1EOV A;  3J81 c;  5COR A;  3VYT A;  4DR1 Q;  1U4P A;  4OGQ C;  4ZKB B;  5LHY 1;  2D0P A;  1K8G A;  4LFA L;  5C3W A;  1LYL A;  1KDA A;  1VF7 A;  1EFW A;  1PFN A;  4FF1 A;  5KYL A;  2QGQ A;  2JA6 G;  4ID6 A;  4RAU C;  4HTH A;  1GJX A;  4NMZ A;  3FPU B;  2I5H A;  3MXG A;  1IBK L;  2F0S A;  5ELE A;  2TMP A;  2WFW A;  1CI3 M;  3D3R A;  3PO3 G;  3MXN B;  2B2W A;  4X3U A;  2O5J C;  2C5C A;  5M3F G;  3CCV A;  4A3G H;  2QCP X;  2QF7 A;  4DV0 L;  1SE4 A;  4GNX C;  2GVB A;  3AU7 A;  1A3U A;  2IT1 A;  2B2U A;  2F0H A;  1STB A;  5JPM C;  4ZRZ A;  1GUG A;  1PRT D;  1TWA B;  2UUA L;  1J9O A;  1PYW D;  2K32 A;  4KD4 A;  5KNC A;  1V1P B;  4P74 A;  3CMA A;  2CQA A;  2JA7 H;  2P5Z X;  2A68 C;  3ITP A;  4IUP A;  1UNS A;  4XT3 B;  3S17 B;  3J7Y W;  4A3M B;  1PH1 A;  2IPK D;  4JG2 A;  1YIJ A; 
#chains in the Genus database with same CATH homology
 2H4O A;  1F9R A;  3OWE B;  4RCO A;  1A15 A;  1B50 A;  4H7B A;  2F0Q A;  1KNA A;  3VR3 A;  4BBR B;  4A3I B;  3SHL A;  4X3K A;  2G9D A;  2Z4I A;  2EZV A;  1U9R A;  2R7Z B;  2M00 A;  1BXT A;  1A2U A;  4HN7 A;  2R93 B;  2K28 A;  4IAL A;  4IN3 A;  1AZQ A;  4ME5 A;  4DAP A;  2MGS A;  4EQP A;  1RJT A;  2J0T D;  4PNY A;  2HCI A;  2EJG C;  1RF2 D;  2ZXR A;  5HUR A;  5CYU A;  1I50 B;  1S5C D;  4BA1 I;  3AB9 A;  1D1I A;  2SNS A;  1BO0 A;  3ZYY X;  4CKE A;  1JC7 A;  1S5E D;  3A54 A;  4XT1 B;  2BDO A;  1SE3 A;  2OT2 A;  1Z6H A;  5ELC A;  3HGB A;  4KY7 A;  4UAI A;  1SMY C;  2CVR A;  1GUO A;  2TSS A;  1I4H A;  1JWM D;  2A6H D;  1VF5 C;  5FO8 B;  1D6E C;  3IFT A;  4EQO A;  2K7V A;  3D6W A;  4H13 C;  5ELB A;  3GTG B;  3T16 A;  3NBI A;  4H44 C;  4ZUJ A;  3A8J E;  3GTM B;  5G3L D;  1ET9 A;  2X69 A;  3JAM E;  3GD7 A;  5CV8 A;  2CW0 D;  4OHJ A;  4IUV A;  5D65 A;  4C3J G;  4DF7 A;  3SK6 A;  2RSN A;  5FKA C;  1EOT A;  3BYT B;  5C4J B;  1F2M A;  2KUM A;  4FP5 D;  1I4R A;  3K5L A;  1SFO B;  2IL8 A;  2WKD A;  4IQZ A;  4KN7 C;  1XX8 A;  2WAQ B;  4A3J B;  3PMF A;  4XQQ A;  1SND A;  2BOS A;  4IUN A;  5K36 H;  4PMW A;  3T53 B;  2PW5 A;  1BF4 A;  3TP6 A;  3GV3 A;  4F88 A;  2QIL A;  3GTL B;  1ROD A;  1TY0 A;  1WTP A;  1BCP D;  4QF4 A;  1CHQ D;  1NSN S;  3I90 A;  3A56 A;  1CZW A;  5E3F A;  1B4O A;  2OEO A;  1HFN A;  5EBD A;  2LKV A;  3PUZ A;  4K5W A;  3H6M A;  1K8M A;  4K6D A;  1EQV A;  3C3L A;  3SK4 A;  5BN5 A;  1Q90 A;  2Z4H A;  2EDG A;  3TBI B;  4WJW A;  4J6H A;  4LK1 C;  1E2V A;  3FMC A;  2X6G A;  4BY1 B;  3FDT A;  1MGS A;  3L7Z C;  3BVZ A;  5DAU A;  1S5B D;  3IFD A;  1LTA D;  1HRJ A;  1GUN A;  3OIP A;  1ICW A;  1SYD A;  1AFP A;  2Q8T A;  2KEC A;  2Q8R E;  3K5N A;  4X3T A;  3QIA A;  1RTO A;  4AYB B;  2J4X A;  3K7A B;  3I4N B;  4R9W A;  5D14 A;  2EE1 A;  1EY9 A;  1TWF B;  3R8B A;  1WTX A;  3GTQ B;  3URY A;  4QUC A;  4RH6 A;  4QB4 A;  5C0X J;  1G6Z A;  1QIL A;  4FXG C;  3J81 E;  1VMP A;  5I2X A;  4QUF A;  3KLR A;  4C1N I;  5EQ0 A;  2O4X A;  3S16 B;  4RKL A;  2B8F A;  2KCN A;  1G29 1;  4FYD A;  1O80 A;  1JOQ A;  2BA0 A;  2WKC A;  4ZAI A;  4G7H C;  3CHB D;  2AQ1 B;  2PYK A;  3GTO B;  1SYG A;  2K33 A;  4BS9 A;  1QNK A;  4QCL A;  1STE A;  2L4N A;  1VMC A;  1GUT A;  4RCN A;  3I4L A;  2RSO A;  1EU4 A;  1PTO D;  3PUY A;  3A55 A;  4C2M B;  1F2Z A;  1KDB A;  4KK7 A;  2L12 A;  5LL6 X;  5T1I A;  1IW7 C;  1ENA A;  4J8Q A;  4HSP A;  1I6V C;  4DN4 M;  1Y1V B;  2F0T A;  4V19 0;  2NVT B;  1QB5 D;  3NQT A;  1CQF A;  4RGO S;  1AW7 A;  3NQI A;  4L8J A;  1BDO A;  1A2T A;  4WOR A;  3VYU A;  2ID0 A;  2AWO A;  5IGC A;  2E2H B;  4WFN 3;  2GA4 B;  2A6E C;  3QO2 A;  4OIK A;  1TQO A;  2K1B A;  4DNT B;  3W3A A;  2NTT A;  1TY2 A;  2BDN A;  1ILP A;  2NVQ B;  3H09 A;  4DAY A;  3HOY B;  2RA4 A;  1AEX A;  3IKJ A;  1Q3L A;  2F0G A;  1FR3 A;  1PRT B;  3KLS X;  5J1Z A;  4NW2 A;  3RMH A;  3BG3 A;  5IGD A;  1OXX K;  3I8Z A;  3R2I A;  3D8G A;  3BZD B;  1PLF A;  3GO5 A;  1SNM A;  3G7L A;  5K36 G;  1SYF A;  4RHR A;  3AMU A;  4C1N K;  3V05 A;  3PUW A;  5C3E B;  3LWE A;  3MHB A;  2CHB D;  3KLS A;  3EQL C;  5EGT A;  1TU2 B;  2NZ1 D;  5JOB A;  1DYQ A;  5IIF A;  2KJX A;  4BY7 B;  3MVV A;  3NXW A;  2PQE A;  1KLU D;  4CJ1 B;  1ESF A;  5C0X I;  3BVM A;  4JBW A;  1MBY A;  2K5Q A;  5EBC A;  5E4X A;  1E2W A;  1Q12 A;  2EYF A;  1EY8 A;  4KI0 A;  1OXV A;  1D2B A;  3NK9 A;  3PIP 3;  1HUM A;  2R3Z A;  4XDX A;  1YNJ C;  4ZKC B;  3ERO A;  1O7Z A;  3DWA A;  2DY7 A;  3DHQ A;  4FF2 A;  1LTR D;  1BOS A;  1RHP A;  2F0P A;  1CK1 A;  3MC0 B;  5T1G A;  1KTK A;  1DD2 A;  5KIX A;  2NN6 I;  2NWG A;  5C4X B;  1EY6 A;  1M4V A;  5CC4 A;  4DK1 A;  1T5X D;  1EU3 A;  1HTP A;  2HCC A;  3TSS A;  2PNR C;  2JYO A;  5M3M B;  3S9W A;  2HUG A;  2PW7 A;  1FGB D;  1MD2 D;  5IGE A;  5C5L A;  2HDM A;  5KRU A;  3T13 A;  2XRQ D;  4O42 A;  4ULL A;  5EPL A;  3C46 A;  2EOT A;  1LT3 D;  1GHK A;  4K6L A;  4CJ2 C;  1A3V A;  1DOL A;  4KKU A;  5ELF A;  1WD0 A;  4G7O C;  4FXD A;  2JEB I;  2BA1 A;  1OXT A;  1CZG A;  3LNN A;  2F0J A;  1LT5 D;  1ZXT A;  3HOV B;  3EFX D;  1JWS D;  2ZT9 C;  3M3Y B;  2XWJ B;  5DM7 3;  4CKC A;  3CQZ B;  1S5F D;  3H94 A;  4ZLT F;  1ML0 D;  1G2T A;  4K5V A;  1Y8P B;  5A2Q L;  1EWC A;  1BCP B;  3D4R A;  1HFG A;  3U9S A;  4DFA A;  3I4M B;  2XRS D;  2WIN B;  4KKT A;  5I9P A;  3NP8 A;  3TDQ A;  2BE5 C;  1JOK A;  4KY6 A;  1IKL A;  3HG9 A;  1IL8 A;  2K03 A;  3NPP A;  4OO1 H;  2ZXP A;  3VA5 A;  4TQU S;  2IX0 A;  3S2H B;  2V4D A;  3EJI A;  1G2S A;  5J39 A;  4CGY B;  3FRP B;  1IYU A;  4K14 A;  2E75 C;  4B08 A;  2WAC A;  1B9M A;  3Q6S A;  1R4Q B;  1R4P B;  2KA7 A;  1RKN A;  3P20 A;  3D4D A;  3TP5 A;  2B63 B;  1YNN C;  3J80 E;  3CRK C;  1EYA A;  1TKW B;  2WV6 D;  4ILW A;  2KCC A;  1DM0 B;  1H9S B;  4HMI A;  4A3F B;  5LL6 S;  3OPO A;  1ET6 A;  2NTS A;  2HDL A;  3ND8 A;  3O13 A;  4KHZ A;  1SYC A;  3ONA B;  2RBM A;  2ZXO A;  3I3C A;  4Q0F A;  1RCV D;  4MHE A;  1JB3 A;  2B2Y C;  3EVQ A;  2L5T A;  3DEO A;  4S3S A;  5JVH 3;  4IUT A;  4WRD A;  4Y7N B;  1T5E A;  1BQQ T;  3S1R B;  3HZX A;  1MSH A;  3HKZ B;  3QOL A;  5CBA E;  3GTP B;  5FO7 B;  1PDQ A;  1WTO A;  2G9H D;  1H9J A;  3I72 A;  1SBB B;  2A69 C;  1PRT F;  2E2D C;  3T56 B;  3MXP A;  1SJH D;  3PUX A;  3M85 A;  2FJ2 A;  2DN8 A;  5ISR A;  1B2T A;  2B2V C;  4EGV A;  4FXK C;  2RVL A;  4UDU C;  2ICI A;  2WP8 J;  4XYQ A;  2VUM B;  1HPC A;  1A3T A;  3HOX B;  1CFM A;  2EY5 A;  5FK9 C;  5K5P A;  4RWS C;  1F2L A;  2VXW A;  3P1H A;  1B44 D;  1F77 A;  4NP5 A;  3UI2 A;  4DU9 A;  1OXU A;  1GXD C;  2A73 B;  1WTR A;  4PMB A;  1ILQ A;  1HQR D;  1ZYR C;  1QWY A;  4KY5 A;  2SDF A;  3FEW X;  1HA5 A;  5KEE A;  1DXM A;  4ZYS A;  5CV9 A;  3S14 B;  3J7A F;  1E0B A;  3M4O B;  5J22 A;  2KOL A;  1K8O A;  4IUQ A;  3HOZ B;  3K0Y A;  5COY A;  3NWS A;  1U4R A;  1QE6 A;  1SEB D;  1STG A;  4BWG B;  3K6O A;  4L63 B;  3HS0 C;  3T4A C;  4IFD J;  3L3O C;  4Z9C B;  1S4Z A;  4BBS B;  2D62 A;  4K8J A;  3FPP A;  3R93 A;  2XIW A;  5JEA H;  4XTC S;  1LT4 D;  3D6C A;  4IZ8 A;  3S2D B;  4P2C B;  3IL8 A;  1PRT C;  1GHJ A;  1WD1 A;  3T51 B;  1TWC B;  3NE5 B;  4E6I A;  2LMC B;  1EIG A;  2MJ8 A;  5G3L F;  4XYO A;  1G91 A;  3H91 A;  1OXS C;  2K01 A;  5CV6 A;  2R6G A;  2YYZ A;  3VR2 A;  5FLX L;  1UUP A;  2R92 B;  1GUW A;  3KBX A;  2QDB A;  3QG1 A;  2EVB A;  1AZP A;  2LS0 1;  1Y8O B;  1PTO H;  3OWF A;  3DWP A;  3NTI A;  1ENC A;  4HCE A;  2DNE A;  3MXN A;  3QWN A;  4OO1 G;  4K8I A;  4F87 A;  3CRL C;  1TS3 A;  1SE2 A;  1UAP A;  3N52 A;  3RZO B;  1H9M A;  3J80 L;  1JE4 A;  1B3A A;  1LTI D;  2NN6 H;  2SNM A;  1V1P A;  2ICE C;  2K04 A;  1WTQ A;  2IX1 A;  2AQ3 B;  1FNU A;  3HP3 A;  1STA A;  1BCP F;  5A35 A;  1SXT A;  1L0Y B;  1BUV T;  2IX3 A;  5BN4 A;  1JR0 D;  1LAB A;  4N9T A;  5AFW A;  4MN3 A;  1EY7 A;  1AN8 A;  1ZEQ X;  1X3P A;  1F9S A;  2FIN B;  4X3S A;  5C4Z A;  2SOB A;  3OOC A;  1LTS D;  2A6H C;  1VCI A;  4TSS A;  2F3W A;  1PZK D;  2RDH A;  1BNZ A;  4RGT A;  2VB3 X;  3GTJ B;  1XWE A;  2FFK B;  2IJ0 A;  1JQY D;  3I91 A;  1LV9 A;  1RDP D;  3WOF A;  1U4L A;  2XNA C;  4G7Z C;  4KTA A;  3P7J A;  3A7A B;  1E2Z A;  3OSO A;  3BDC A;  4ZQ3 A;  1ONL A;  5KGU A;  1GUS A;  2F0N A;  2K5W A;  2CW0 C;  5A2Q E;  1H9S A;  2J7Z A;  2PZW A;  4BA2 I;  1EY5 A;  5CGK A;  1CT1 D;  4K2K A;  1CQV A;  4M1U B;  1KAB A;  3U9O A;  2E74 C;  2B2T C;  4IFD I;  2A68 D;  2F03 A;  3S1M B;  3BDL A;  1PZJ D;  5F2D A;  4FVM A;  3TN2 A;  4R8I A;  4IUU A;  3MWY W;  1IHZ A;  3M7G A;  2IWH A;  1LTT D;  3VR6 A;  4RGM A;  1BCP C;  2SEB D;  2F0V A;  1BBX C;  1UEA B;  1L0X B;  2ENB A;  4RHS A;  5EKI A;  2N88 A;  1I3Q B;  2F0F A;  2LFN A;  1EY0 A;  4C3H B;  3NBH A;  1FD7 D;  5M5W B;  4MIU A;  3M4Y A;  5M5X B;  4KJN A;  1YNN D;  2JEA I;  1SNP A;  2MPM A;  2F0E A;  1KAA A;  5EJW A;  1SNQ A;  3BDO A;  4RA8 A;  2F0D A;  4CBV A;  2EYM A;  1PTO F;  1DJR D;  5I2Y A;  1H9K A;  3TP7 A;  3MTS A;  2F3V A;  2B39 A;  3CKI B;  5CMD A;  5JEA G;  4ZUI A;  3K5M A;  2NYZ D;  5ELD A;  3I73 A;  3GV6 A;  4Q5V A;  1I4G A;  1SMY D;  3PUV A;  5I6W A;  1PFB A;  3E6Z X;  2A74 C;  2M9V A;  1QG7 A;  3NHH A;  1FYC A;  3HRZ C;  2H1E A;  2Y0S B;  2K6A A;  1I6H B;  3GQB A;  1QJO A;  3RLF A;  1SYE A;  4C56 C;  2A69 D;  2NUC A;  2JP1 A;  2JE6 I;  5CR3 A;  1XYI A;  1HCZ A;  4CKB A;  1WVL A;  2OXP A;  3TZD A;  3M7N A;  2O5I C;  3X3M A;  2F0I A;  5TSS A;  1DOM A;  3MXU A;  1PFM A;  1NR4 A;  2K05 A;  1H9R A;  3DUZ A;  2VNU D;  3WOE A;  2NB0 A;  2WB1 B;  3GP7 A;  3OMG A;  4XIG S;  1C48 A;  5EKL A;  4DK0 A;  4KV6 A;  2QEJ C;  4N9P A;  4KN4 C;  4LJZ C;  3Q0A A;  1HA6 A;  3VYR A;  4QIW B;  1FNW A;  3F2U A;  1TR5 A;  5JAV A;  1LTG D;  5D3D A;  2F4I A;  1HTL D;  2JSO A;  2RKS A;  2NN6 G;  2QKI C;  5C6A A;  4PV1 C;  1LTB D;  2EJM A;  3FVQ A;  3DXJ C;  5KYI A;  2B2Y A;  2I07 B;  2L55 A;  4XQN A;  4GZY C;  5FOB B;  2Z1C A;  5FO9 B;  1PTO C;  2X6L A;  1VDZ A;  2KED A;  4DXG A;  2MUY A;  3HOW B;  1SNC A;  5JJZ A;  5IOC A;  3SR1 A;  1B53 A;  4V0B A;  4FF3 A;  4F8M A;  3MA2 B;  1EEF D;  1KNE A;  2NBF A;  4QMG A;  3Q24 A;  2A5H A;  3WDN A;  3R2T A;  3P75 A;  3D4W A;  3OW7 A;  2E76 C;  2B2V A;  1ESR A;  5EPK A;  5IOD A;  1WTV A;  3C1F A;  4HED A;  5EPJ A;  2L1B A;  1BR9 A;  3N6R A;  5FLX E;  2AUJ D;  3S1N B;  2RQX A;  2PZT A;  4RKB A;  3TME A;  1ENF A;  2AWN A;  2EY2 A;  4G57 A;  3K59 A;  1KLG D;  2FMM A;  5E1F A;  1SJE D;  2PZU A;  5IT9 L;  1NAP A;  3H3V C;  1JOO A;  1EL0 A;  1EEI D;  5KNB A;  4JK1 C;  3VR5 A;  1SDF A;  3W2D A;  3TP8 A;  4C3I B;  2E2I B;  1LO5 D;  2XVS A;  1R9T B;  3SXH A;  3MEH A;  2EY6 A;  1S5D D;  2PO4 A;  1WCM B;  5C3X A;  1GOZ A;  3SEB A;  3K58 A;  2Q8I B;  3VR4 A;  3OMC A;  4K2L A;  3SVM A;  1JWU D;  1HHV A;  4EQN A;  3E0J A;  2YU9 B;  4DGZ A;  5M9O A;  1XTC D;  1LLR D;  1A6X A;  1KDC A;  3MFG A;  4A3B B;  3RZD B;  3HEJ A;  2K5D A;  2B2W C;  2EYJ A;  1Q8I A;  4O1N A;  1XXG A;  1SNO A;  3S1Q B;  1X32 A;  1Y1W B;  5KND A;  3LWU A;  4DAV A;  3OHX C;  1M8A A;  2B2U C;  2RDF A;  2M2L A;  1IW7 D;  4K5X A;  4R8N A;  4ABN A;  3CU7 A;  1Y8N B;  5C44 B;  5IGG A;  3PO2 B;  2EPB A;  5DNF A;  1TVX A;  4HCS A;  5EKK A;  3SDZ A;  5DEH A;  1U4M A;  1PTO B;  3SK5 A;  3K57 A;  4KJO A;  1JCK B;  3TZU A;  4F7X A;  3IAY A;  1B1Z A;  2A6E D;  1EZ6 A;  2WII B;  2F0K A;  3DWQ A;  4NDX A;  2JA8 B;  3SE0 A;  1Z7T A;  1AP0 A;  1SYB A;  1TWH B;  1QNU A;  1J8I A;  3V96 A;  4IFD H;  2KEE A;  5CV7 A;  3KK7 A;  2EYO A;  3KBG A;  3PV0 A;  4TKO B;  5D3I B;  4A93 B;  1EFI D;  2L11 A;  4HAE A;  4U68 A;  2XWB B;  3OIQ A;  4M8A A;  3DMU A;  1FNV A;  3C1E A;  2XN9 C;  3GTK B;  2RDG A;  2EYH A;  4C3H G;  3RUZ A;  3ERQ A;  3C2P A;  1TT2 A;  5CV5 A;  1Z47 A;  5IGB A;  4U67 3;  2JA6 B;  1EYD A;  2MP1 A;  3QJY A;  2PPB C;  5JVG 3;  1SAP A;  1O7Y A;  1DON A;  1EQT A;  4NKL A;  3PO3 B;  1PXU A;  2F0W A;  1IYV A;  3BVG A;  4CHT B;  4HSV A;  5M3F B;  5E4W C;  3A8K E;  1DOK A;  2PCF B;  1V43 A;  3A7L A;  2C9O A;  1MSG A;  5HGT A;  4H0L C;  1D1K A;  4OO1 I;  1II3 A;  2D5D A;  3S15 B;  5C0X H;  1W6K A;  3R3O A;  1D5M C;  3BYY B;  2B2T A;  4OIJ A;  1EWH A;  1RTN A;  3X3N A;  3NSW A;  5JEA J;  3PIO 3;  3Q22 A;  1TS2 A;  3A8I E;  1STN A;  1YNJ D;  4I65 A;  1CA5 A;  1D5Z C;  2JXM B;  1V8Q A;  4HR7 B;  1EZ8 A;  2EY1 A;  4ZK9 B;  4DNR B;  2R61 A;  2DY8 A;  1EIH A;  2HQE A;  3I70 A;  3V2T A;  2JA5 B;  4A3D B;  3VA7 A;  2F1M A;  4RGN A;  1TS4 A;  2B8G A;  4OL7 A;  4RFB A;  4G4K A;  1O78 A;  2EXZ A;  2FMC A;  1IKM A;  5CV4 A;  3H0G B;  1NCV A;  2FHT A;  1K83 B;  5C4H A;  1C4Q A;  1NR2 A;  4PQX A;  3HOU B;  5M5Y B;  4A3E B;  1NUC A;  1TII D;  5BN3 A;  2E2J B;  1OO9 B;  1I4Q A;  2EJF C;  3NTH A;  4A3K B;  3VYS A;  1HQM C;  3DEP A;  5JPN C;  1B9N A;  2NVX B;  5I9O A;  2EYL A;  1DCZ A;  2AQ2 B;  3NTK A;  2Z8L A;  4J1M A;  1JIC A;  4YIJ A;  2I46 A;  1MI2 A;  1G8Z D;  3DM1 A;  5C5M A;  3J7A V;  4L6T B;  4FNF A;  2IW3 A;  4CJ0 B;  5DM6 3;  3JAM L;  3ND9 A;  1F9P A;  1QOH A;  1TWG B;  2KQ3 A;  3QOJ A;  1QCB D;  1I4P A;  4DXF A;  4XXE A;  3MAQ A;  4C3J B;  1PMR A;  4DA2 A;  1CHP D;  2BE5 D;  2LY7 A;  2NVY B;  3NWT A;  4B9W A;  5IT9 E;  1EY4 A;  1D5X C;  2BCO A;  1STH A;  2F0U A;  1HUN A;  4C3I G;  2D2C C;  3FKI B;  4KD3 A;  2O2L D;  4IFD G;  4XQJ A;  3MFY A;  1V1O A;  1STY A;  3K5O A;  1Q1E A;  1I4X A;  3KUP A;  3MZ5 A;  1HXY D;  5NUC A;  4LMQ D;  2OF1 A;  2EYP A;  5CBE E;  1CTM A;  2AUK A;  1SSO A;  3RD4 A;  3Q23 A;  1WTW A;  2L9H A;  3D31 A;  4FO2 A;  4FF4 A;  1X3Q A;  3L9A X;  1LAC A;  2D9U A;  1W6J A;  3LX0 A;  2DNC A;  4KMU C;  1JOR A;  2F0M A;  1Q1B A;  1C8C A;  3QB3 A;  1RD9 D;  4A3G B;  5IGF A;  1CA6 A;  4B9X A;  3SK8 A;  5C0X G;  4PMC A;  1Y69 U;  4LAA A;  2XSC A;  2JA7 B;  1CM9 A;  1TS5 A;  3G6J B;  4I7Z C;  4ODG A;  5I4D A;  3BS1 A;  4HMJ A;  2KVM A;  4KKS A;  2L0C A;  4TRD A;  4IUR A;  1PZI D;  2N55 A;  2VB2 X;  2F0O A;  3E5S A;  1EYC A;  3NUC A;  3J81 L;  1DZ1 A;  4EVO A;  2PMZ B;  1ZKO A;  5I6Y A;  2F0L A;  1F9Q A;  1O7L A;  1F2Y A;  2MHV A;  3EA6 A;  1ZYR D;  3KF8 A;  2KHS A;  4KHV A;  1LT6 D;  5COR A;  3VYT A;  1U4P A;  4OGQ C;  4ZKB B;  5LHY 1;  5C3W A;  1KDA A;  1VF7 A;  1PFN A;  4FF1 A;  5KYL A;  4ID6 A;  4RAU C;  4HTH A;  1GJX A;  4NMZ A;  3FPU B;  3MXG A;  2F0S A;  5ELE A;  2TMP A;  1CI3 M;  3D3R A;  2B2W A;  4X3U A;  2O5J C;  2C5C A;  2QCP X;  2QF7 A;  1SE4 A;  3AU7 A;  1A3U A;  2IT1 A;  2B2U A;  2F0H A;  1STB A;  5JPM C;  4ZRZ A;  1GUG A;  1PRT D;  1TWA B;  1J9O A;  1PYW D;  2K32 A;  4KD4 A;  5KNC A;  1V1P B;  2CQA A;  3ITP A;  2A68 C;  4IUP A;  1UNS A;  4XT3 B;  3S17 B;  3J7Y W;  4A3M B;  2IPK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...