1BCPF

Binary complex of pertussis toxin and atp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
98
structure length
98
Chain Sequence
LPTHLYKNFTVQELALKLKGKNQEFCLTAFMSGRSLVRACLSDAGHEHDTWFDTMLGFAISAYALKSRIALTVEDSPYPGTPGDLLELQICPLNGYCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUSSIS TOXIN
publication title Crystal structure of the pertussis toxin-ATP complex: a molecular sensor.
pubmed doi rcsb
molecule tags Toxin
total genus 17
structure length 98
sequence length 98
chains with identical sequence L
ec nomenclature ec 2.4.2.-:
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF09276 Pertus-S5-tox Pertussis toxin S5 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bcpF00
5ELBA 1L0YB 1LTBD 1I4HA 3R8BA 1UUPA 1JQYD 1FNWA 1TS5A 3URYA 3BVGA 2J4XA 1SE3A 1SE2A 2AQ1B 1LTTD 1FD7D 3KLSX 1I4RA 1M4VA 1LTSD 3SEBA 1EEID 1S5FD 1I4XA 5FK9C 1BXTA 1KLGD 3MFGA 1PRTD 3DWPA 1PZID 1G8ZD 1RDPD 1SEBD 1D6EC 4DXGA 3BVMA 1V1OA 1LT5D 2IJ0A 2XRSD 3R2IA 1V1PA 1JR0D 1V1PB 4L6TB 1LLRD 4C56C 1PTOF 1EU3A 1CQVA 1DYQA 1GOZA 3BYTB 1EEFD 1JCKB 1LO5D 2NTTA 4BWGB 2SEBD 3MC0B 1FNUA 1LTAD 1L0XB 1CT1D 3GP7A 2Z8LA 4O1NA 5ELFA 1T5XD 1ESFA 1XTCD 2AQ3B 2QEJC 1LT4D 2O2LD 2XNAC 1QILA 1ET6A 2XRQD 2TSSA 4RGOS 1RF2D 2WV6D 4ZYSA 4Z9CB 1LT3D 4UDUC 3BVZA 1STEA 1BCPF 1AN8A 1DJRD 1S5ED 2RDGA 2AQ2B 1B44D 4RCOA 1F77A 1I4QA 1KLUD 2R61A 5D3IB 1FNVA 1XXGA 2RDHA 1I4GA 1D5ZC 1S5CD 1SXTA 5D3DA 1D5XC 4L63B 4RGMA 1SJHD 1CHQD 1JWSD 1PTOC 2NTSA 1PTOD 1UNSA 2G9HD 4K6LA 3R2TA 4RFBA 5ELEA 5ELCA 1PTOB 3O13A 1RD9D 1HA5A 1PZKD 2XN9C 1TS3A 1RCVD 1EFID 3EFXD 1EWCA 1PTOH 3OWEB 4RH6A 1LTGD 5ELDA 3V05A 1I4PA 3W2DA 3CHBD 1AW7A 3BYYB 3TSSA 2QILA 1S5DD 2ICIA 2CHBD 1JWMD 1SBBB 1SJED 1PRTF 5FKAC 1B1ZA 1EU4A 4RHRA 1HQRD 1SE4A 1LTID 1BCPC 4TSSA 1PYWD 1BCPD 1BCPB 1TS2A 1HTLD 5TSSA 1JWUD 1ET9A 1PRTC 1HXYD 3DWAA 1LTRD 1MD2D 1CHPD 1PRTB 1D5MC 1TY0A 2IPKD 3EA6A 4RGNA 1CK1A 1S5BD 1FGBD 4DXFA 1LT6D 1TY2A 1TS4A 3BZDB 1PZJD 3DWQA 4OHJA 1KTKA 4RGTA 4RHSA 5I4DA 1ENFA
chains in the Genus database with same CATH superfamily
1Y1VG 3TS0A 3CCJA 1MGSA 1F2YA 3HGBA 2CVRA 3NPPA 4OWXB 5LL6S 4NXNL 1WTVA 1EOVA 4KY6A 1EEID 3CC4A 1NSNS 4F8MA 5IGEA 1VQEA 4LW1A 3PUZA 3GTKB 4C1NI 3VR4A 1FR3A 5FOBB 1G8ZD 5KNDA 5C0XH 2DJGC 1NAPA 2IJ0A 1CUKA 1K83H 4IPHA 1BBUA 3Q6SA 1V1PB 2EYJA 2K28A 4LUZA 4DR1Q 4R4QA 2LSSA 2IX1A 5EPJA 2HDLA 1JJ2A 1CT1D 3HOUB 1OXSC 1ZYRC 2R92B 2VUMB 1QILA 4DGZA 2TSSA 3KDFB 1UE6A 3I2ZA 5BR8Q 4A3EB 1U4MA 2JA7G 1C9OA 5FLXL 3TZDA 3W5OA 4JI7Q 1WYDA 1XPUA 2VQEQ 1UE5A 1PA6A 4L5SA 4C3IG 2LS01 3I7FA 3NENA 2R61A 3TZUA 5CC4A 3NP8A 1HPCA 3UE1A 1QVCA 3TP5A 2NZOA 5FO9B 2QF7A 2K7VA 2ZTCA 1AZPA 3QIAA 1CA5A 1Y8OB 3ZJYC 3HOZH 3RZOB 2XN9C 5ISRA 2PZUA 2DUDA 4JPBW 1WTXA 3EFXD 1U0LA 3KF6A 3OWEB 5DAUA 4EQ5A 4IOAA 5CMDA 1IW7C 4DV6L 1HR0W 3HRZC 3T1YQ 5IYCH 1VQ5A 3U4ZA 4IFDJ 4N8FA 3PUWA 1HQRD 2GA4B 4KD4A 4CGYB 1EQTA 1VF7A 4HIOA 1IZ6A 3MAQA 4TVAB 3GTMB 5DM73 5T1IA 2AMCB 1EOTA 4CBVA 2RF4A 1IKLA 1LTLA 4JV5L 2UUCQ 3BZDB 3STBC 1Q3LA 1ENFA 2HIXA 3GV6A 2HD3A 3TS2A 4A3MB 1PH4A 1PH2A 1CTMA 4G4KA 3BVGA 4GNXA 2PI2A 2KOLA 3QOJA 1IBKL 4CDCC 5C4XB 3G6EA 1NR2A 2B2YC 4TRDA 5K36H 3J80i 1KLGD 5IYBG 4DUYL 2Z6KC 1IYUA 4I65A 4U673 3L7ZC 2JA6G 3E0JA 5ELOA 2EY1A 2KCMA 2KHSA 3PO2B 5KEEA 4K6DA 3MFYA 3GV3A 5C0XI 3BYTB 2WB1B 1LO5D 5EBDA 1STBA 3UDGA 1ZKOA 3HOUG 3JAMc 2R92G 2VUMG 2B39A 3DEPA 4RG1A 4XQNA 1TVXA 3MA2B 4KN4C 4YCWA 5C0XJ 1GM5A 4MZ9A 1EYDA 4A3EG 4RGOS 1G6PA 4B3TL 3H3VH 1I6VC 5KGUA 1EQQA 2N55A 3J7YW 1YHBA 1QUQA 5CORA 3ND8A 2F0WA 4B9XA 2ICEC 4HJ8A 1B44D 2Q8TA 2E2HB 2UXCL 2YU9B 1FNVA 1FVIA 4BA1I 1PH5A 2HCIA 2ES2A 4C3JH 1T5EA 3HFZB 1Q90A 3HOXB 4X64L 3KFUA 4YWLA 1C4QA 3TN2A 1PTOD 4X6AH 1VQ6A 1RIPA 3NEMA 4CHTB 1WTWA 2WP8J 2PCFB 1LTGD 3V05A 1XMOQ 1NTGA 1VMPA 2K5WA 4M8AA 3NBIA 1ZEQX 1WD1A 1RL2A 1SNDA 1IKMA 3IRBA 5EKKA 3IFTA 3A8KE 1LV9A 3C46A 2KCNA 1KAWA 1E1OA 2JK8A 1BCPC 1PYWD 1CKNA 3NWSA 4TQUS 1DOLA 2FMCA 2O5JC 1CKMA 4CDEC 1X32A 1JT8A 3N6RA 2QGQA 1EIYB 4IZ8A 1S5BD 3A5UA 4DR1L 3IAYA 1LT6D 5IYDH 1GO3E 4V0BA 4A3MG 2M00A 4GLXA 1E7ZA 2NVXH 3I4MH 1YITA 4MTKA 2PW5A 3BG3A 3J7AF 3S1MH 4XT1B 2L1BA 3T1HQ 2V4DA 5BR8L 5C4XG 1SYCA 1W6KA 1NE3A 4C3HH 4JI7L 1WOCA 3D3RA 3L9AX 2KEDA 1FJGQ 1S5FD 1SN8A 1GUNA 1EY6A 4UY8C 2F0HA 1R9TH 2NVQB 1SFOH 3CCQA 3NWTA 4Y7NB 2Q2UA 1ESRA 3PO2G 1SEBD 5M3FH 2JSOA 4RKLA 1DXMA 3AFQA 3SGIA 1QZHA 2D9UA 2WB1G 3E9HA 3NTHA 4ZQ3A 1YIJA 5DEHA 3I8ZA 3S1RH 1QB5D 5JPMC 4O2DA 1JCKB 1TU2B 2A6HD 5C3EB 1KRSA 3NSWA 4BWGB 1VQDA 2MP1A 1HNZQ 3MZ5A 1XJVA 2C9OA 3T1YL 3KJPA 2QEJC 2XNAC 2RCFA 3U50C 3G48A 1STAA 1YJWA 2Z9HA 5EJWA 1E24A 3BVZA 4L5RC 1B9NA 5C3XA 1FGUA 3S15B 4DNRB 2RDHA 3HOXG 1F2ZA 5M5XH 4EGVA 4U68A 2I0QA 1A8VA 1SXTA 2UUCL 3EJIA 2F4IA 4UAIA 3HEJA 1UNSA 3O13A 1HA5A 2ENBA 3SVMA 4DV3L 1PTOH 2ZTEA 2EXDA 1O7IA 1PFNA 3BYYB 1S40A 1OO9B 2L4NA 1TWCB 2Y0SB 4PZ6A 1BVSA 1KQSA 2WAQE 3GTPH 2QKIC 5J1ZA 4I7ZC 4FF4A 2NN6I 1IHZA 3E0EA 3S14B 4BXXG 5TSSA 2KCTA 3OIPA 5C4JB 1TWGB 1VQGA 1TWHB 3S2HB 4R8NA 2K5VA 1PH8A 4H7BA 2B2WC 3NBHB 1NMFA 1FYCA 4X65Q 4HJAA 4HSPA 1I4HA 2NVYH 4ZCKA 3SXHA 4OO1G 1AEXA 1X3QA 1Q1EA 3PIOA 4BY7B 4PZ8A 4GKKQ 4FF2A 3CP0A 5C44B 5IP9H 5A2QL 1SMXA 1BBXC 2B2YA 2K32A 3EIVA 1PRTD 3U58A 2Z6KA 4K8IA 1K0SA 4YY3Q 5A35A 2L0CA 4X66L 4DKAC 2OEOA 3OTOQ 1YNJD 4LMQD 5C3EG 5LHY1 1PTOF 2R7FA 3KYHC 2CFMA 1XMOL 4NDXA 3MC0B 1K8AC 3BZKA 4XTCS 1N33Q 3FKIH 3QG1A 4DV5Q 4GS3A 1ESFA 4YCUA 4A3JG 1VQMA 1H95A 4TKOB 3VR6A 1X55A 1LT3D 1I6HH 1CKOA 1YNND 4JI2Q 3OW2A 2K33A 1AN8A 1S5ED 1XX8A 1I3QH 2L55A 3M4QA 1GUGA 4NP5A 3S2DB 1D5ZC 2D62A 1E2VA 4CDDC 3PSIA 2OTJA 4Q5VA 3P75A 1BDOA 2A19A 4WJWA 1Z6HA 2VY3A 5KIXA 1MSGA 1MHWC 2K01A 3T1HL 2LFNA 5C5LA 1BBWA 3CMEA 1Q8IA 2EY2A 1EFID 3A54A 5G3LD 5HURA 4XYQA 2R93H 2BH8A 2Y0SG 5M5YH 4CKBA 1I94Q 1FJGL 2ICIA 3K7AB 3JAMi 4IUUA 2ZTDA 4HN7A 2E2JH 1PYBA 4OL7A 1EIHA 1LABA 2EYFA 4NMZA 1HNWL 4X62Q 2F0EA 4XXEA 3JC66 2KHIA 3DWAA 3SDZA 5LMNQ 3ZYYX 1OXXK 1D5MC 2PYKA 2KECA 4DXFA 2MQHA 1J8IA 1HNZL 1G2TA 4J1MA 1TKWB 3QB3A 1L0YB 1NBWA 3HOVB 2L15A 3SR1A 3F1ZA 2JA6H 1OXVA 4BY7G 4KHVA 1RODA 3KLRA 1Q12A 2G9DA 3CRLC 4KKTA 2ZJQA 2IX3A 3KBXA 4B3MQ 3LWEA 5C44G 2BE5D 1XYIA 5IGGA 3FEWX 3GTLB 3D6WA 3CCLA 1KDCA 4JI8Q 2Q8RE 4O0AA 3F8TA 1WTHA 4JC0A 1DOMA 1PXUA 3S16H 3DLLA 1JE4A 3PMFA 2HQEA 4A3KB 1V1PA 2VQFQ 3ONAB 1X3GA 3BDLA 3HS0C 5BN3A 4EQOA 4FO2A 4BY1H 4JI5Q 4A3CG 1L1OB 3DEOA 1XPOA 4ULLA 4POFA 4DAYB 3S1QH 1EQVA 2N88A 4IALA 3KDFA 1JMCA 1H9KA 3CCMA 1ET6A 2ATWA 3OW7A 2JA8H 4IOCA 1QE6A 1Y1WH 1MJEA 2MJ8A 1H9MA 2EVBA 3Q22A 2KUMA 4DK1A 2EY5A 2BH2A 2NWGA 1NUCA 4GLAC 4DFAA 2NB0A 4QL5A 4YCVA 5HGTA 4X3TA 4DR6Q 1TWAB 5D3DA 5JJLA 2J7ZA 5FJ8H 2E2IB 3GQBA 4ZLTF 4X65L 3CQZH 1HZ9A 1JWSD 1KNEA 2NTSA 2E76C 2K14A 5FLMH 1SMYC 1STGA 2SNMA 4L8JA 1B2TA 1QCBD 1CA6A 1SAPA 2HUGA 1A63A 2EQSA 1PFBA 1S5DD 4GN3B 3GD7A 2RHQB 1SNPA 3GTJH 3G71A 2L11A 1PRTF 4XQQA 4APVA 1PH6A 2F1MA 4YY3L 1EYAA 3EVQA 2GVBA 3OTOL 4LK1C 3K8AA 1GKHA 1BQQT 1VCIA 3I70A 1FGBD 4A3GG 2R7ZB 4A3DB 2F0SA 2AUJD 3J7A5 3HOVG 1N33L 1EWIA 3RLFA 3J81E 3M7NA 4DV5L 3C2PA 2Z6BA 2B2WA 5CV9A 4DK3C 2N78A 3HZXA 3ITPA 1RKNA 2VNUD 1EY7A 5C4HA 4JI1L 2AQ1B 4A3IH 1FD7D 1F2LA 4JI2L 4K2LA 4LNQA 1IL2A 1E22A 5EKIA 1D2BA 4AH6A 3CPFA 2JEAI 5GROA 4BBRB 3F2BA 4WJ4A 3ND9A 3LWUA 4WRDA 3H0GB 3NHHA 4A3KG 1P8LA 2UUBQ 1GHKA 2ALYB 3PF4A 3CAMA 3N52A 2F0LA 1N32Q 2PW7A 3OMCA 3GTGB 2GN5A 4G7OC 2MUYA 3U9SA 3I4OA 1HNXQ 5G3LF 2YTXA 3HKZE 3SE0A 1X3FA 2JA5H 2KENA 1I94L 4ILWA 4P73A 1C7YA 1Y14B 1B53A 3VR3A 1AZQA 4ME5A 4GN4B 1WCMH 3M3YH 1U4LA 5CV6A 3P20A 4UDUC 4JI3Q 1GUSA 4X62L 3PUXA 1DJRD 1HFNA 3HOWH 4P72A 5LMNL 3HOYH 4XYOA 4LUVA 3PO3B 2ZJPA 2XWBB 1EIGA 3RNUA 3JAML 2PQEA 1F9QA 2NVTH 3TQYA 3PGZA 3I55A 1D1KA 2SDFA 1YI2A 4B3ML 4QCLA 5F2DA 5J22A 3WDNA 3RZDB 3K6OA 2JEBI 4JI8L 3GTOB 1O80A 1YEZA 4DPGA 1GVPA 3IKJA 2LY7A 5AJ3L 3UDIA 1B7YB 3CPWA 2TMPA 1SR3A 4DK6C 1JE5A 4I7AA 2JJQA 1X3PA 2VQFL 3I3CA 2NUCA 3L2PA 2R7ZG 4A3DG 1CHPD 2UXDQ 1PRTB 1A3VA 4JI5L 4JI4Q 3F2DA 4UP9A 1TQOA 1HA6A 2ZJRA 4AQYQ 1SYGA 5JPNC 4IFDI 1KTKA 5E3FA 4A93B 4WORA 1H9RA 2A8VA 1LTBD 4H02A 2K5HA 1VQBA 3RLNA 2BDNA 3VR2A 1YHQA 5IIFA 3D0FA 4DAPA 4BBRG 3FPPA 1UEAB 3H0GG 3PF5A 3M4OB 4C2MB 2X6LA 5T1GA 4DR6L 1KC8C 4CDFC 2HCCA 4A3JH 3M85A 3MXPA 4ZKBB 3RMHA 3PIO3 4L6TB 2PQAB 1B4OA 2IX0A 1KXLA 2KA7A 1L1OC 3VYTA 5AFWA 3C1EA 1NCVA 1HJPA 1FNUA 1JB7A 1PVOA 2CH4W 4DN4M 1L0XB 2IT1A 4ZUIA 2O4XA 1YHAA 1ZYRD 2F52A 4DR2Q 4DR7Q 2K52A 3J81L 2ID0A 2Z4IA 1D7QA 4HIDA 1TWFH 1F9SA 4HIMA 3UE0A 3E9IA 3PO3G 2FFKB 3AB9A 4DR4Q 1A2UA 1Q8KA 1EIFA 2L9HA 4ZAIA 1Q7YC 1KNAA 3LX0A 4X3KA 2F0OA 2RQXA 2OCEA 4CJ2C 3CCEA 4JBJA 1LM0A 1VQNA 1RD9D 4BA2I 4HJ5A 1KHIA 5M3MH 2BOSA 2WFWA 1QNUA 3VYSA 1TIID 2ZT9C 4HMJA 1IBLQ 1HTPA 4LF8L 2MPMA 5IGFA 3J7ZC 2CH4A 4LUOA 1C8CA 1IW7D 3CU7A 5L37A 1PHJA 5I6YA 1DOKA 1K0RA 2A74C 3ULJA 3UDXA 1Q81C 3KBGA 2UUBL 4PV1C 4DA2A 1Y8PB 4A3BB 2OQ0A 1X9NA 4YIJA 2VW9A 2XSCA 4M1UB 1EFWA 3S17H 4A3FB 2HDMA 2PNRC 2Z1CA 4A93G 1HNXL 4O42A 1O7YA 5DNFA 2QDLA 3CF5A 3RUZA 1XPRA 4OHJA 3STBD 2D0PA 3NBHA 4ODGA 3KUPA 4R4IA 2HQLA 4GLVB 2A6HC 3K5OA 3T51B 2J4XA 3Q8DA 4JI3L 1SE3A 2A69C 1LTTD 1E2ZA 1WFQA 3TP7A 4HJ7A 4A3CH 3H6MA 5FK9C 1BXTA 2K5QA 4ZKCB 1K8GA 4A3LH 3VYUA 1CZWA 2KQ3A 4FP5D 5JAVA 1D6EC 5D14A 1K83B 2XWJB 1ENAA 1L2FA 2R3ZA 2EYHA 2Z4HA 3I90A 1YNXA 1EZ8A 1TXYA 3MEHA 4OEMB 1QVGA 3I4NH 2VB3X 3D8GA 2Z8LA 1IL8A 2VQEL 4N9TA 3J81c 1J5EQ 3AFPA 2EYOA 4DV1Q 5ELNA 1PFSA 2MO0A 1BKBA 4DR3Q 4DAMA 1VQ8A 3L3OC 1YVCA 4JI4L 3K5NA 5LMNW 4AQYL 3CC7A 1PH1A 1I5FA 4L63B 1HZAA 3OYYA 2RHSB 3HOZB 1EY4A 2FINB 1NNXA 1CFMA 2A6EC 2B63H 1V8QA 3AEVA 1U9RA 4NW2A 1KDBA 4BBSH 4KKUA 3M4PA 1STHA 1YZ6A 4R4OA 2UUAQ 1K8OA 4A3GH 2JE6I 1WI5A 4FF3A 4A3BG 3H3VI 2EPBA 5IY0A 2F0FA 3R93A 4QUFA 1R4PB 4GNXB 4KHPQ 1BCPD 5EBCA 1TS2A 2LMCB 3A0JA 4N8X1 5C4ZA 4A3FG 2KJXA 5IGBA 1ET9A 1LYLA 1PRTC 3ULLA 1LTRD 2A68C 1X3EA 3KJOA 1K9MC 4H44C 4LFCQ 4XIGS 2PI2E 4WJ3M 1STNA 2KCCA 2XGTA 4QF4A 2WAQB 4GOPB 4IJHA 4DR2L 4A4IA 1SYEA 2PNHA 1OTCA 1SYFA 4DR7L 3WOFA 1MI2A 1HUMA 2J0TD 2D5DA 3PIPA 5LMUQ 1VQJA 4L5TA 3VA7A 1Y1VH 5CV5A 5C0XG 4DR4L 3DXJC 4IPCA 3NXWA 1A6XA 4B3SQ 3CCUA 1I50H 5GAEC 3BVMA 1LUZA 2B8FA 4ZK9B 3D31A 5J3BA 3OPOA 1PMRA 4DUZQ 1L1OA 3G4SA 1E3PA 1OXTA 1N8RC 2L5TA 1ASYA 1HZBA 1IBLL 3NTKA 4DAYA 2AHOB 2PZTA 1C48A 3X3MA 3MTSA 3K80C 3S1NH 3MWYW 4ID6A 3I4LA 4AYBE 2LXJA 2KEEA 3AQQA 2DNEA 4Z9CB 1Z47A 1MKHA 3K7UC 2QEXA 2E2DC 5CV4A 3PQIA 4FF1A 1Z7TA 3IFDA 3KLSA 3BZCA 2AQ2B 2F0MA 1O7LA 1VQCA 1F77A 4QB4A 2SOBA 2OXPA 5D3IB 2JA7H 4LF6Q 1I4GA 4C3JB 2I07B 3A5ZB 2I5HA 3P1HA 3HOZG 1PYSB 2K4KA 3ERQA 3MXNB 1G91A 4C3IH 4IUVA 3DMUA 2F4VQ 2EIFA 3KOJA 3DM3A 5E7NA 5ELEA 4IUPA 1RCVD 2F0IA 1CZGA 1O78A 5IYCG 1AH9A 5ELDA 3E3XA 2XVSA 4IQZA 2YTVA 4MIUA 4OIKA 4KD3A 5JVG3 2B2VC 3F2UA 2N8NA 2YYZA 3TP6A 1B3QA 3W3AA 2BCOA 4QQBX 4KKSA 1HRJA 3FHWA 2WACA 1GHJA 4B08A 2FHTA 2X6GA 1VQOA 2AWOA 3A7AB 1ENCA 4DNIA 2D0OA 2F0KA 2H1EA 2NVXB 3GTQH 3I4MB 1DCZA 4R4TA 2B3GA 3KK7A 3S1MB 1Y69U 1BR9A 2EJMA 1J5EL 2AKWB 5M5WH 1UUPA 1ONLA 3HKSA 4DV1L 5K36G 3URYA 4C3HB 4Y52H 4DR3L 4IURA 2ZXRA 1LTSD 5GAHC 4P71A 1R9TB 4IPGA 3NK9A 1SFOB 4JI0Q 1I4XA 5IOCA 5M9OA 2PO4A 4KJNA 2IY5B 1EY0A 5M3FB 3T56B 4LF7Q 3GTKH 4KMUC 1VQKA 3UI2A 4FVMA 4DXGA 5IYBH 1LT5D 3S1RB 1QWYA 2EZVA 3K0XA 1EU3A 3PUVA 1EEFD 3K0YA 2NTTA 3S9WA 1K8MA 1T9HA 3D4DA 4QGUA 2UUAL 1LTAD 3RD4A 3A7LA 1T5XD 3C1FA 3H91A 4C1NK 1WVLA 3HOUH 1QG7A 3OHXC 1GUOA 2RSOA 3OMGA 4JCVE 4DK0A 2R92H 4R8IA 2VUMH 2Q8IB 4KHPL 3QWNA 1VQIA 1BCPF 1YJ9A 1SYBA 4A3EH 3BS1A 1U4RA 2F0QA 5M5XB 3NELA 3A74A 5HY6A 2X69A 1TT2A 2EYMA 4LF4Q 4ZRZA 3G6JB 5JJKA 4H13C 4UP7A 1M90C 2C5CA 5ELCA 1PTOB 2NN6G 4P75A 4JVZA 4EVOA 4HJ9A 3RZOH 1M1KC 2YV5A 2AUKA 5LMUL 5E1FA 1TR5A 5FLXE 4NXMQ 2F0VA 2PPBC 1Q82C 2JA9A 1WTQA 3UDFA 3NTIA 3GTPB 3OIQA 1E0BA 1UEBA 3FDTA 4B3SL 1Z9FA 2E8GA 3J81i 4KI0A 2F0PA 4LF9Q 5IYDG 1KAAA 4NB3A 2CW0C 2K04A 1MD2D 1WTPA 3GTMH 1O7ZA 3I4MG 1IYJB 4OX9Q 5COYA 3EROA 1HCZA 4DAVA 1EY9A 4IN3A 4GOPC 5JEAG 2IWHA 3RLOA 4GKKL 1RTOA 2NVYB 2V1CC 2OWOA 4LFBQ 4C3HG 4JW0A 3R8BA 4A3MH 1B50A 2LXKA 4S3SA 3MXUA 4KY7A 1M4VA 3TRZA 3V2TA 1H9SB 2QW7A 5M3FG 5C4XH 3MXGA 4QIWE 4LF6L 1ASZA 2UU9Q 1EY8A 4P74A 2PMZE 3CCRA 4KK7A 1JB3A 1A3TA 1NY4A 1QVFA 5CBEE 1PH9A 3M7GA 3R2IA 2F4VL 2PQAA 2CKZB 3NE5B 3PO2H 2Q2HA 3FKIB 2SEBD 4J15A 1G291 1W2BA 1JC7A 3J81j 3CCVA 3H3VC 3R3OA 1XTCD 3BJUA 1HHVA 3BDOA 1I6HB 1DM0B 1HH2P 2K5DA 2Q2IA 3ULPA 5BN4A 4OWTB 1EZ6A 4POGA 4NPSA 5JVH3 1AFPA 1JJCB 1JOKA 2AWNA 1I3QB 2FMMA 2ZM6Q 1VMCA 3T53B 4CKEA 3HKZB 4HCSA 3CCSA 1KLUD 3S24A 3W1GA 2E2HH 1X54A 2LKVA 4JBMA 2YU9H 3TP8A 1D5XC 4PQXA 5C6AA 4LF5Q 2R7DA 3FMCA 1SNQA 2HIVA 1GJXA 1CHQD 3HOXH 5CV7A 2K6AA 2KHJA 2IL8A 1VS0A 4XDXA 1IXRA 4DV2Q 1XMQQ 2R93B 4RH6A 5M5YB 4ZUJA 1SMYD 1SDFA 1UE1A 1P16A 5IE8A 5E4WC 1PH7A 4EX5A 3MEFA 4GZYC 4JI0L 2B2VA 4GKJQ 2XIWA 1SJED 1WD0A 2E2JB 3GO5A 1VDZA 1II3A 4LF7L 4TSSA 4DU9A 1UWVA 2F0JA 1EY5A 3EBEA 1NMGA 4IUTA 1TY0A 1JICA 2B8GA 5EPLA 4BXXH 4F87A 2NBFA 1PZJD 1L0WA 3IL8A 2JA6B 1AP0A 4CJ0B 4R4CA 3S17B 2JN4A 3TMEA 5IP9G 5KYLA 4KLKA 5IT9E 4OELB 4R9WA 1AE2A 5I9OA 3KLSX 2Q2TA 4OO1H 1EUJA 1B3AA 1BO0A 3MFGA 4MN3A 1OXUA 1DONA 4LJZC 3S16B 1XTDA 2NVQH 4Y7NH 2DY7A 4K2KA 5DM63 4FXGC 4LF4L 1SNCA 2I5LX 2Z0SA 4FYDA 2XRSD 2B2UA 1KRTA 4BY1B 3PIP3 3FKIG 2UXBQ 3P7JA 2RBMA 4HIKA 4OGQC 4ABNA 2F0GA 4CJ1B 1V1QA 3S1QB 4XT3B 5C3EH 4NXML 4DV7Q 2WINB 1LT4D 2L12A 1N36Q 5IWAQ 2JA8B 1Y1WB 4ZYSA 4QY7A 4WFN3 3KF8B 3HKZG 4QJFA 4LF9L 3E5SA 2VZAA 3K5LA 1AE3A 4OX9L 2K5NA 3ERSX 2JP1A 3S15H 4K0KQ 3DUZA 3CQZB 1WJJA 4RGMA 5IP7G 5EPKA 2A73B 1SJHD 5GQOA 4LFBL 1PTOC 4G7HC 2R93G 3AU7A 1JOQA 4J6HA 1TS3A 2QDBA 3I91A 2NYZD 3D6CA 3I56A 3GTJB 2EOTA 1UAPA 1SBBB 4RWSC 4DV3Q 2UU9L 1SE4A 1TWCH 3T16A 1X56A 4IUQA 3FRPB 3SK6A 4FXKC 1VQ4A 1JWUD 3S14H 1S4ZA 4F88A 3QR8A 4IPDA 4RGNA 5HGQA 1TY2A 5C4JH 1TWGH 1TWHH 3H09A 1K3RA 2VS1A 4RHSA 3S2HH 4GOPA 2VL6A 2F3IA 4JOIA 1N34Q 3J7AV 1ICWA 1EYGA 1D1IA 4A3IB 1MSHA 3NQTA 2K05A 2CWAA 1M8AA 2CCZA 2ZM6L 4BY7H 1SSOA 2WB1E 3T13A 5C44H 4X3UA 1N32L 2FJ2A 5FLXc 1KABA 3DWPA 1LACA 4LF5L 4OO1I 3OSOA 1CM9A 1KIXA 4BY1G 1ZXTA 4HAEA 3CC2A 2DGYA 1VQLA 1JR0D 3J80E 4C56C 1A62A 4A76A 1KD1C 1DYQA 4DV2L 1XMQL 2JA5B 3GDEA 4LFAQ 2IW3A 1RJTA 2RSNA 4X66Q 4JBKA 2JA8G 1UE7A 2EDGA 1Y1WG 4GKJL 1G51A 2JQOA 1WCMB 3M3YB 1G6ZA 2BA1A 2B29A 5A2QE 3CRKC 4YWMA 1E1TA 5BN5A 3HP3A 3TBIB 1RF2D 2EXZA 4PMCA 4PZ7A 2SNSA 4V190 2B2TA 2ZXPA 4HSVA 3HOWB 1D8LA 5I6WA 5KNBA 2F3WA 3HOYB 2NN6H 2RDGA 3D4RA 5DLQE 5FJ8G 5IT9L 1F2MA 1ICFB 1XNQQ 3QOLA 3MXNA 3S2DH 4KV6A 4UPAA 2HHHQ 5FLMG 1KL9A 4DNTB 2HT1A 2NVTB 4HMIA 1HQMC 2G9HD 4PNYA 4HTHA 2WKCA 3KF6B 1I4PA 1Q46A 3SK8A 3W2DA 2VXWA 4DV4Q 5KRUA 2MNAA 3TSSA 1EWHA 1K73C 2QA4A 3Q24A 2UXDL 5JEAH 3K81C 3K7AH 1A3UA 1B1ZA 4OIJA 4IFDG 3M4YA 4K5XA 5CV8A 3VYRA 2MO1A 2F3VA 1VQ9A 4P2CB 4NKLA 3EN2A 2IPKD 2UXBL 1WTOA 1HZCA 4ME3A 1HNWQ 3L0OA 2IHFA 3OOCA 5ELBA 1V9PA 3WWVA 4DV7L 4A3IG 1N36L 4PG3A 4KTAA 5IWAL 1WTRA 1JQYD 1DGSA 3HOVH 4B3RQ 5FO7B 1Q1BA 3FP9A 5H1SE 1HR0Q 1SE2A 3DHQA 4KJOA 2OTLA 2A69D 5IODA 3FPUB 1R4QB 4OWWB 4UHVA 3D4WA 3WOEA 3GTLH 2F0DA 4QUCA 3BDCA 2O5IC 5C3WA 1SRUA 4K0KL 4A3JB 1SNMA 4DF7A 3I73A 4HR7B 2F0TA 3MVVA 1YNJC 3CMAA 1CSPA 2DY8A 2JA5G 4A3KH 3A8IE 2NZHA 2QCPX 5K5PA 2WIIB 4XQJA 1WCMG 4PMBA 4K8JA 1W6JA 4KY5A 2EJFC 3SK5A 5JJZA 1VQFA 4HEDA 3W1BA 2DNCA 2O2LD 3K57A 3HOWG 1DZ1A 1IBMQ 2K1BA 1TWFB 2WV6D 3HOYG 4F7XA 2H5XA 1YNNC 3CXCA 1QUQB 3SK4A 4H0LC 3KLWA 4IUNA 5IT9c 4KN7C 4RCOA 3SHLA 1GXDC 5KNCA 1EYCA 1NJIC 1NR4A 1TWAH 4FNFA 2Y0SE 4AYBB 4DR5Q 1G2SA 1K3BC 4MTNA 1A2TA 1STYA 1N34L 2K75A 2E2IH 4JI6Q 5M3MB 4HCEA 2A6ED 1PZKD 1SROA 1HUNA 2E5LQ 3DM1A 4K14A 5E4XA 3V96A 1V43A 3OWFA 3J80L 3TDQA 2KBNA 2YTYA 5EGTA 1IYVA 2MGSA 1DD2A 5CBAE 1JJGA 5CYUA 1A0IA 1JWMD 2ASBA 4RHRA 3A8JE 4JK1C 2RA4A 1CSQA 2H4OA 3ICEA 1HTLD 1CKNB 1JORA 2A1AA 1HXYD 1EQRA 1F9PA 2EYPA 4DV0Q 2A68D 2G5DA 1CQFA 1CK1A 1YJNA 1GUWA 4LFAL 4YWKA 5JEAJ 2OQKA 4JYAQ 3DWQA 2R7ZH 4MHEA 4RGTA 3NQIA 4MNOA 4A3DH 1ILPA 2MFIA 2F0NA 1E2WA 2EE1A 1FNWA 4L5QA 1TS5A 2WKDA 4KHZA 2BE5C 2EYLA 1GD7A 4RCNA 1H9SA 3SEBA 2OT2A 4J8QA 1A15A 1B8AA 5D65A 4YHHQ 4K5WA 1PV4A 1H9JA 1XNQL 5C5MA 2VB2X 4BBRH 2WAQG 4JI1Q 2HHHL 1MBYA 1PH3A 4FDBA 5FO8B 1XNRQ 3H0GH 1CI3M 1LLRD 3I4NB 4B9WA 1PLFA 1MIUA 3GTGH 2GVAA 4DV4L 3Q0AA 2CQAA 4O1NA 5ELFA 2MHVA 2F0UA 3A55A 2EY6A 2CWPA 1J9OA 3HG9A 5IP7H 2XRQD 2M9VA 3Q23A 3EQLC 1ILQA 2CQOA 1STEA 2JXMB 4NXNQ 5I2YA 3H94A 2B2UC 4JBWA 5EQ0A 1I4QA 1BOSA 1QOHA 3MHBA 4AYBG 3I72A 5JJIA 1W3SA 3QJYA 5M3MG 3PO3H 1RHPA 2B63B 2C35B 2NZ1D 4K5VA 4RA8A 3FVQA 4RFBA 4B3RL 5NUCA 4BBSB 3CD6A 1F9RA 1U4PA 4IJLA 3VR5A 3M9BA 5CGKA 3J80c 1HR0L 2K03A 3CHBD 4A3GB 1VQ7A 3RZDH 1BNZA 3GTOH 2QILA 4C3JG 1YBYA 5I2XA 3RN2A 4LAAA 4LFCL 3VDYA 5FKAC 2BA0A 4Q0FA 2KVMA 2FXQA 5GADC 2PZWA 4GN5A 3G7LA 4AIMA 3RN5A 3RR5A 1N9WA 1VF5C 4RKBA 3JAME 3EA6A 1SLJA 5AJ3Q 1KDAA 1JOOA 1S72A 1TS4A 3K58A 1J6QA 2RDFA 1B9MA 5IGDA 1B70B 1QNKA 2RKSA 3QO2A 3A56A 1BF4A 4A93H 2JYOA 2K50A 1SYDA 1ML0D 1IBML 5KYIA 4ALPA 2D2CC 3C3LA 1RTNA 4GNXC 1VQPA 1QZGA 4A3LG 1U5KA 1I4RA 1Y1VB 4G57A 3CW2C 5CR3A 4UP8A 1XWEA 4JG2A 2ZXOA 2I46A 4DV6Q 2I5MX 4CKCA 3AYHB 5EAYA 5EKLA 4DUZL 2F03A 3M4OH 4C2MH 4BS9A 1I50B 1K28A 1VQAA 1PZID 1RDPD 2XTIA 1QJOA 4RAUC 3U9OA 3LNNA 4DR5L 4QMGA 3I4NG 1V1OA 4JOIC 4JI6L 1PFMA 3F2CA 3BU2A 1PDQA 1CQVA 2N3SA 4X3SA 1GOZA 2E5LL 4PMWA 3PUYA 4R1JA 3U4VA 4EQNA 4QIWB 4JV5Q 2N49A 3ER0A 4OONA 3S1NB 2RCNA 3GP7A 1Q86C 4OXPA 2IHEA 2PMZB 2AQ3B 3T4AC 2RVLA 5JOBA 3LGJA 3KF8A 3PV0A 1X65A 1IBKQ 3B6YA 4E6IA 3H15A 4G7ZC 2JA7B 4DV0L 2E75C 1BUVT 1XXGA 4DUYQ 1S5CD 4C3IB 2B63G 3AMUA 1FL0A 4JYAL 1EL0A 2DJFC 1S3OA 4LWCA 3K59A 4BBSG 2M2LA 4A75A 4IFDH 4IO9A 2OF1A 4K6LA 3R2TA 2P5ZX 3VA5A 2DN8A 4EQPA 1EWCA 1SE8A 2EJGC 2B2TC 5LL6X 1AW7A 2R6GA 3TEHB 4YHHL 1GUTA 4FXDA 2CHBD 5IGCA 1Y8NB 1EU4A 4B3TQ 1LTID 1VQHA 5GAGC 1XNRL 2BDOA 2E74C 4LF8Q 1BCPB 4A3BH 3NUCA 2A5HA 2CW0D 3K5MA 5I9PA 4RMFA 2UXCQ 1X6OA 3GTQB 3PCOB 4A3FH 1C0AA 3E6ZX 1SNOA 5J39A 4N9PA 1MJCA 3X3NA 5I4DA 3CKIB 1HFGA 3TREA 4X64Q 5M5WB
chains in the Genus database with same CATH topology
1MGSA 1F2YA 3HGBA 2CVRA 3NPPA 5LL6S 1WTVA 4KY6A 1EEID 1NSNS 4F8MA 5IGEA 3PUZA 3GTKB 4C1NI 3VR4A 1FR3A 5FOBB 1G8ZD 5KNDA 5C0XH 1NAPA 2IJ0A 3Q6SA 1V1PB 2EYJA 2K28A 2IX1A 5EPJA 2HDLA 1CT1D 3HOUB 1OXSC 1ZYRC 2R92B 2VUMB 1QILA 4DGZA 2TSSA 4A3EB 1U4MA 5FLXL 3TZDA 4C3IG 2LS01 2R61A 3TZUA 5CC4A 3NP8A 1HPCA 3TP5A 5FO9B 2QF7A 2K7VA 1AZPA 3QIAA 1CA5A 1Y8OB 3RZOB 2XN9C 5ISRA 2PZUA 1WTXA 3EFXD 3OWEB 5DAUA 5CMDA 1IW7C 3HRZC 4IFDJ 3PUWA 1HQRD 2GA4B 4KD4A 4CGYB 1EQTA 1VF7A 3MAQA 3GTMB 5DM73 5T1IA 1EOTA 4CBVA 1IKLA 3BZDB 1Q3LA 1ENFA 3GV6A 4A3MB 1CTMA 4G4KA 3BVGA 2KOLA 3QOJA 5C4XB 1NR2A 2B2YC 4TRDA 5K36H 1KLGD 1IYUA 4I65A 4U673 3L7ZC 3E0JA 2EY1A 3PO2B 2KHSA 5KEEA 4K6DA 3MFYA 3GV3A 5C0XI 3BYTB 2WB1B 1LO5D 5EBDA 1STBA 1ZKOA 2B39A 3DEPA 4XQNA 1TVXA 3MA2B 4KN4C 5C0XJ 1EYDA 4RGOS 1I6VC 5KGUA 2N55A 3J7YW 5CORA 3ND8A 2F0WA 4B9XA 2ICEC 1B44D 2Q8TA 2E2HB 2YU9B 1FNVA 4BA1I 2HCIA 1T5EA 1Q90A 3HOXB 1C4QA 3TN2A 1PTOD 4CHTB 1WTWA 2WP8J 2PCFB 1LTGD 3V05A 1VMPA 2K5WA 4M8AA 3NBIA 1ZEQX 1WD1A 1SNDA 1IKMA 5EKKA 3IFTA 3A8KE 1LV9A 3C46A 2KCNA 1BCPC 1PYWD 4TQUS 3NWSA 1DOLA 2FMCA 2O5JC 1X32A 3N6RA 4IZ8A 1S5BD 3IAYA 1LT6D 4V0BA 2M00A 2PW5A 3BG3A 3J7AF 4XT1B 2L1BA 2V4DA 1SYCA 1W6KA 3D3RA 3L9AX 2KEDA 1S5FD 1GUNA 1EY6A 2F0HA 2NVQB 3NWTA 4Y7NB 1ESRA 1SEBD 2JSOA 4RKLA 1DXMA 2D9UA 3NTHA 4ZQ3A 5DEHA 3I8ZA 1QB5D 5JPMC 1JCKB 1TU2B 2A6HD 5C3EB 4BWGB 3NSWA 2MP1A 3MZ5A 2C9OA 2QEJC 2XNAC 1STAA 5EJWA 3BVZA 1B9NA 5C3XA 3S15B 4DNRB 2RDHA 1F2ZA 4EGVA 4U68A 1SXTA 3EJIA 2F4IA 4UAIA 3HEJA 1UNSA 3O13A 1HA5A 2ENBA 3SVMA 1PTOH 1PFNA 3BYYB 1OO9B 2L4NA 1TWCB 2Y0SB 2QKIC 5J1ZA 4I7ZC 4FF4A 2NN6I 1IHZA 3S14B 5TSSA 3OIPA 5C4JB 1TWGB 1TWHB 3S2HB 4R8NA 4H7BA 2B2WC 1FYCA 4HSPA 1I4HA 3SXHA 4OO1G 1AEXA 1X3QA 1Q1EA 4BY7B 4FF2A 5C44B 5A2QL 1BBXC 2B2YA 2K32A 1PRTD 4K8IA 5A35A 2L0CA 2OEOA 1YNJD 4LMQD 5LHY1 1PTOF 4NDXA 3MC0B 4XTCS 3QG1A 1ESFA 4TKOB 3VR6A 1LT3D 1YNND 2K33A 1AN8A 1S5ED 1XX8A 2L55A 1GUGA 4NP5A 3S2DB 1D5ZC 2D62A 1E2VA 4Q5VA 3P75A 1BDOA 4WJWA 1Z6HA 5KIXA 1MSGA 2K01A 2LFNA 5C5LA 1Q8IA 2EY2A 1EFID 3A54A 5G3LD 5HURA 4XYQA 4CKBA 2ICIA 3K7AB 4IUUA 4HN7A 4OL7A 1EIHA 1LABA 2EYFA 4NMZA 2F0EA 4XXEA 3DWAA 3SDZA 3ZYYX 1OXXK 1D5MC 2PYKA 2KECA 4DXFA 1J8IA 1G2TA 4J1MA 1TKWB 3QB3A 1L0YB 3HOVB 3SR1A 1OXVA 4KHVA 1RODA 3KLRA 1Q12A 2G9DA 3CRLC 4KKTA 2IX3A 3KBXA 3LWEA 2BE5D 1XYIA 5IGGA 3FEWX 3GTLB 3D6WA 1KDCA 2Q8RE 1DOMA 1PXUA 1JE4A 3PMFA 2HQEA 4A3KB 1V1PA 3ONAB 5BN3A 3BDLA 3HS0C 4EQOA 4FO2A 3DEOA 4ULLA 1EQVA 2N88A 4IALA 1H9KA 1ET6A 3OW7A 1QE6A 2MJ8A 1H9MA 2EVBA 3Q22A 2KUMA 4DK1A 2EY5A 2NWGA 1NUCA 4DFAA 2NB0A 5HGTA 4X3TA 1TWAB 5D3DA 2J7ZA 2E2IB 3GQBA 4ZLTF 1JWSD 1KNEA 2NTSA 2E76C 1SMYC 1STGA 2SNMA 4L8JA 1B2TA 1QCBD 1CA6A 1SAPA 2HUGA 1PFBA 1S5DD 3GD7A 1SNPA 2L11A 1PRTF 4XQQA 2F1MA 1EYAA 3EVQA 4LK1C 1BQQT 1VCIA 3I70A 1FGBD 2R7ZB 4A3DB 2F0SA 2AUJD 3RLFA 3J81E 3M7NA 3C2PA 2B2WA 5CV9A 3HZXA 3ITPA 1RKNA 2VNUD 1EY7A 5C4HA 2AQ1B 1FD7D 1F2LA 4K2LA 5EKIA 1D2BA 2JEAI 4BBRB 3ND9A 3LWUA 4WRDA 3H0GB 3NHHA 1GHKA 3N52A 2F0LA 2PW7A 3OMCA 3GTGB 4G7OC 2MUYA 3U9SA 5G3LF 3SE0A 4ILWA 1B53A 3VR3A 1AZQA 4ME5A 1U4LA 5CV6A 3P20A 4UDUC 1GUSA 3PUXA 1DJRD 1HFNA 4XYOA 3PO3B 2XWBB 1EIGA 3JAML 2PQEA 1F9QA 1D1KA 2SDFA 4QCLA 5F2DA 5J22A 3WDNA 3RZDB 3K6OA 2JEBI 3GTOB 1O80A 3IKJA 2LY7A 2TMPA 1X3PA 3I3CA 2NUCA 1CHPD 1PRTB 1A3VA 1TQOA 1HA6A 1SYGA 5JPNC 4IFDI 1KTKA 5E3FA 4A93B 4WORA 1H9RA 1LTBD 2BDNA 3VR2A 5IIFA 4DAPA 3FPPA 1UEAB 3M4OB 4C2MB 2X6LA 5T1GA 2HCCA 3M85A 3MXPA 4ZKBB 3RMHA 3PIO3 4L6TB 1B4OA 2IX0A 2KA7A 3VYTA 5AFWA 3C1EA 1NCVA 1FNUA 4DN4M 1L0XB 2IT1A 4ZUIA 2O4XA 1ZYRD 3J81L 2ID0A 2Z4IA 1F9SA 2FFKB 3AB9A 1A2UA 4ZAIA 2L9HA 1KNAA 3LX0A 4X3KA 2F0OA 2RQXA 4CJ2C 1RD9D 4BA2I 2BOSA 1QNUA 3VYSA 1TIID 2ZT9C 4HMJA 1HTPA 2MPMA 5IGFA 1C8CA 1IW7D 3CU7A 5I6YA 1DOKA 2A74C 3KBGA 4PV1C 4DA2A 1Y8PB 4A3BB 4YIJA 2XSCA 4M1UB 4A3FB 2HDMA 2PNRC 2Z1CA 4O42A 1O7YA 5DNFA 3RUZA 4OHJA 3NBHA 4ODGA 3KUPA 2A6HC 3K5OA 3T51B 2J4XA 1SE3A 2A69C 1LTTD 1E2ZA 3TP7A 3H6MA 5FK9C 1BXTA 2K5QA 4ZKCB 3VYUA 1CZWA 2KQ3A 4FP5D 5JAVA 1D6EC 5D14A 1K83B 2XWJB 1ENAA 2R3ZA 2EYHA 2Z4HA 3I90A 1EZ8A 3MEHA 2VB3X 3D8GA 2Z8LA 1IL8A 4N9TA 2EYOA 3L3OC 3K5NA 4L63B 3HOZB 1EY4A 2FINB 1CFMA 2A6EC 1V8QA 1U9RA 4NW2A 1KDBA 4KKUA 1STHA 1K8OA 2JE6I 4FF3A 2EPBA 2F0FA 3R93A 4QUFA 1R4PB 1BCPD 5EBCA 1TS2A 2LMCB 5C4ZA 2KJXA 5IGBA 1ET9A 1PRTC 1LTRD 2A68C 4H44C 4XIGS 1STNA 2KCCA 4QF4A 2WAQB 1SYEA 1SYFA 3WOFA 1MI2A 1HUMA 2J0TD 2D5DA 3VA7A 5CV5A 5C0XG 3DXJC 3NXWA 1A6XA 3BVMA 2B8FA 4ZK9B 3D31A 3OPOA 1PMRA 1OXTA 2L5TA 3NTKA 4DAYA 2PZTA 1C48A 3X3MA 3MTSA 3MWYW 4ID6A 3I4LA 2KEEA 2DNEA 4Z9CB 1Z47A 2E2DC 5CV4A 4FF1A 1Z7TA 3IFDA 3KLSA 2AQ2B 2F0MA 1O7LA 1F77A 4QB4A 2SOBA 2OXPA 5D3IB 1I4GA 4C3JB 2I07B 3P1HA 3ERQA 1G91A 4IUVA 3DMUA 5ELEA 4IUPA 1RCVD 2F0IA 1CZGA 1O78A 5ELDA 2XVSA 4IQZA 4MIUA 4OIKA 4KD3A 5JVG3 2B2VC 3F2UA 2YYZA 3TP6A 3W3AA 2BCOA 4KKSA 1HRJA 2WACA 1GHJA 4B08A 2FHTA 2X6GA 2AWOA 3A7AB 1ENCA 2F0KA 2H1EA 2NVXB 3I4MB 1DCZA 3KK7A 3S1MB 1Y69U 1BR9A 2EJMA 1UUPA 1ONLA 5K36G 3URYA 4C3HB 4IURA 2ZXRA 1LTSD 1R9TB 3NK9A 1SFOB 1I4XA 5IOCA 5M9OA 2PO4A 4KJNA 1EY0A 5M3FB 3T56B 4KMUC 3UI2A 4FVMA 4DXGA 1LT5D 3S1RB 1QWYA 2EZVA 1EU3A 3PUVA 1EEFD 3K0YA 2NTTA 3S9WA 1K8MA 3D4DA 1LTAD 3RD4A 3A7LA 1T5XD 3C1FA 3H91A 4C1NK 1WVLA 1QG7A 3OHXC 1GUOA 2RSOA 3OMGA 4DK0A 4R8IA 2Q8IB 3QWNA 1BCPF 1SYBA 3BS1A 1U4RA 2F0QA 5M5XB 2X69A 1TT2A 2EYMA 4ZRZA 3G6JB 4H13C 2C5CA 5ELCA 1PTOB 2NN6G 4EVOA 2AUKA 5E1FA 1TR5A 5FLXE 2F0VA 2PPBC 1WTQA 3NTIA 3GTPB 3OIQA 1E0BA 3FDTA 4KI0A 2F0PA 1KAAA 2CW0C 2K04A 1MD2D 1WTPA 1O7ZA 5COYA 3EROA 1HCZA 4DAVA 1EY9A 4IN3A 5JEAG 2IWHA 1RTOA 2NVYB 4C3HG 3R8BA 1B50A 4S3SA 3MXUA 4KY7A 1M4VA 3V2TA 1H9SB 3MXGA 1EY8A 4KK7A 1JB3A 1A3TA 5CBEE 3M7GA 3R2IA 3NE5B 3FKIB 2SEBD 1G291 1JC7A 3H3VC 3R3OA 1XTCD 1HHVA 3BDOA 1I6HB 1DM0B 2K5DA 5BN4A 1EZ6A 5JVH3 1AFPA 1JOKA 2AWNA 1I3QB 2FMMA 1VMCA 3T53B 4CKEA 3HKZB 4HCSA 1KLUD 2LKVA 3TP8A 1D5XC 4PQXA 5C6AA 3FMCA 1SNQA 1GJXA 1CHQD 5CV7A 2K6AA 2IL8A 4XDXA 2R93B 4RH6A 5M5YB 4ZUJA 1SMYD 1SDFA 5E4WC 4GZYC 2B2VA 2XIWA 1SJED 1WD0A 2E2JB 3GO5A 1VDZA 1II3A 4TSSA 4DU9A 2F0JA 1EY5A 4IUTA 1TY0A 1JICA 5EPLA 2B8GA 4F87A 2NBFA 1PZJD 3IL8A 2JA6B 1AP0A 4CJ0B 3S17B 3TMEA 5KYLA 5IT9E 4R9WA 5I9OA 3KLSX 4OO1H 1B3AA 1BO0A 3MFGA 4MN3A 1OXUA 1DONA 4LJZC 3S16B 2DY7A 4K2KA 5DM63 4FXGC 1SNCA 4FYDA 2XRSD 2B2UA 4BY1B 3PIP3 3P7JA 2RBMA 4OGQC 4ABNA 2F0GA 4CJ1B 3S1QB 4XT3B 2WINB 1LT4D 2L12A 2JA8B 1Y1WB 4ZYSA 4WFN3 3E5SA 3K5LA 2JP1A 3DUZA 3CQZB 4RGMA 5EPKA 2A73B 1SJHD 1PTOC 4G7HC 3AU7A 1JOQA 4J6HA 1TS3A 2QDBA 3I91A 2NYZD 3D6CA 3GTJB 2EOTA 1UAPA 1SBBB 4RWSC 1SE4A 3T16A 4IUQA 3FRPB 3SK6A 4FXKC 1JWUD 1S4ZA 4F88A 4RGNA 1TY2A 3H09A 4RHSA 3J7AV 1ICWA 1D1IA 4A3IB 1MSHA 3NQTA 2K05A 1M8AA 1SSOA 3T13A 4X3UA 2FJ2A 1KABA 3DWPA 1LACA 4OO1I 3OSOA 1CM9A 1ZXTA 4HAEA 1JR0D 3J80E 4C56C 1DYQA 2JA5B 2IW3A 1RJTA 2RSNA 2EDGA 1WCMB 3M3YB 1G6ZA 2BA1A 5A2QE 3CRKC 5BN5A 3HP3A 3TBIB 1RF2D 2EXZA 4PMCA 2SNSA 4V190 2B2TA 2ZXPA 4HSVA 3HOWB 5I6WA 5KNBA 2F3WA 3HOYB 2NN6H 2RDGA 3D4RA 5IT9L 1F2MA 3QOLA 3MXNA 4KV6A 4DNTB 2NVTB 4HMIA 1HQMC 2G9HD 4PNYA 4HTHA 2WKCA 1I4PA 3SK8A 3W2DA 2VXWA 5KRUA 3TSSA 1EWHA 3Q24A 5JEAH 1B1ZA 1A3UA 4OIJA 4IFDG 3M4YA 4K5XA 5CV8A 3VYRA 2F3VA 4P2CB 4NKLA 2IPKD 1WTOA 3OOCA 5ELBA 4KTAA 1WTRA 1JQYD 5FO7B 1Q1BA 1SE2A 3DHQA 4KJOA 2A69D 5IODA 3FPUB 1R4QB 3D4WA 3WOEA 2F0DA 4QUCA 3BDCA 2O5IC 5C3WA 4A3JB 1SNMA 4DF7A 3I73A 4HR7B 2F0TA 3MVVA 1YNJC 2DY8A 3A8IE 2QCPX 5K5PA 2WIIB 4XQJA 4PMBA 4K8JA 1W6JA 4KY5A 2EJFC 3SK5A 5JJZA 4HEDA 2DNCA 2O2LD 3K57A 1DZ1A 2K1BA 1TWFB 2WV6D 4F7XA 1YNNC 3SK4A 4H0LC 4IUNA 4KN7C 4RCOA 3SHLA 1GXDC 5KNCA 1EYCA 1NR4A 4FNFA 4AYBB 1G2SA 1A2TA 1STYA 5M3MB 4HCEA 2A6ED 1PZKD 1HUNA 3DM1A 4K14A 5E4XA 3V96A 1V43A 3OWFA 3J80L 3TDQA 5EGTA 1IYVA 2MGSA 1DD2A 5CBAE 5CYUA 1JWMD 4RHRA 3A8JE 4JK1C 2RA4A 2H4OA 1HTLD 1JORA 1HXYD 1F9PA 2EYPA 2A68D 1CQFA 1CK1A 1GUWA 5JEAJ 3DWQA 4MHEA 4RGTA 3NQIA 1ILPA 2F0NA 1E2WA 2EE1A 1FNWA 1TS5A 2WKDA 4KHZA 2BE5C 2EYLA 4RCNA 1H9SA 3SEBA 2OT2A 4J8QA 1A15A 5D65A 4K5WA 1H9JA 5C5MA 2VB2X 1MBYA 5FO8B 1CI3M 1LLRD 3I4NB 4B9WA 1PLFA 3Q0AA 2CQAA 4O1NA 5ELFA 2MHVA 2F0UA 3A55A 2EY6A 1J9OA 3HG9A 2XRQD 2M9VA 3Q23A 3EQLC 1ILQA 1STEA 2JXMB 5I2YA 3H94A 2B2UC 4JBWA 5EQ0A 1I4QA 1BOSA 1QOHA 3MHBA 3I72A 3QJYA 1RHPA 2B63B 2NZ1D 4K5VA 4RA8A 3FVQA 4RFBA 4BBSB 5NUCA 1F9RA 1U4PA 3VR5A 5CGKA 2K03A 3CHBD 4A3GB 1BNZA 2QILA 4C3JG 5I2XA 4LAAA 5FKAC 2BA0A 4Q0FA 2KVMA 2PZWA 3G7LA 1VF5C 4RKBA 3JAME 3EA6A 1KDAA 1JOOA 1TS4A 3K58A 2RDFA 1B9MA 5IGDA 1QNKA 2RKSA 3QO2A 3A56A 1BF4A 2JYOA 1SYDA 1ML0D 5KYIA 2D2CC 3C3LA 1RTNA 1I4RA 1Y1VB 4G57A 5CR3A 1XWEA 2ZXOA 2I46A 4CKCA 5EKLA 2F03A 4BS9A 1I50B 1PZID 1RDPD 1QJOA 4RAUC 3U9OA 3LNNA 4QMGA 1V1OA 1PFMA 1PDQA 1CQVA 4X3SA 1GOZA 4PMWA 3PUYA 4EQNA 4QIWB 3S1NB 3GP7A 2PMZB 2AQ3B 3T4AC 2RVLA 5JOBA 3KF8A 3PV0A 4E6IA 4G7ZC 2JA7B 2E75C 1BUVT 1XXGA 1S5CD 4C3IB 3AMUA 1EL0A 3K59A 2M2LA 4IFDH 2OF1A 4K6LA 3R2TA 3VA5A 2DN8A 4EQPA 1EWCA 2EJGC 2B2TC 5LL6X 1AW7A 2R6GA 4FXDA 1GUTA 2CHBD 5IGCA 1Y8NB 1EU4A 1LTID 2BDOA 2E74C 1BCPB 3NUCA 2A5HA 2CW0D 3K5MA 5I9PA 3GTQB 3E6ZX 1SNOA 5J39A 4N9PA 3X3NA 5I4DA 3CKIB 1HFGA 5M5WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELB A;  1L0Y B;  1LTB D;  1I4H A;  3R8B A;  1UUP A;  1JQY D;  1FNW A;  1TS5 A;  3URY A;  3BVG A;  2J4X A;  1SE3 A;  1SE2 A;  2AQ1 B;  1LTT D;  1FD7 D;  3KLS X;  1I4R A;  1M4V A;  1LTS D;  3SEB A;  1EEI D;  1S5F D;  1I4X A;  5FK9 C;  1BXT A;  1KLG D;  3MFG A;  1PRT D;  3DWP A;  1PZI D;  1G8Z D;  1RDP D;  1SEB D;  1D6E C;  4DXG A;  3BVM A;  1V1O A;  1LT5 D;  2IJ0 A;  2XRS D;  3R2I A;  1V1P A;  1JR0 D;  1V1P B;  4L6T B;  1LLR D;  4C56 C;  1PTO F;  1EU3 A;  1CQV A;  1DYQ A;  1GOZ A;  3BYT B;  1EEF D;  1JCK B;  1LO5 D;  2NTT A;  4BWG B;  2SEB D;  3MC0 B;  1FNU A;  1LTA D;  1L0X B;  1CT1 D;  3GP7 A;  2Z8L A;  4O1N A;  5ELF A;  1T5X D;  1ESF A;  1XTC D;  2AQ3 B;  2QEJ C;  1LT4 D;  2O2L D;  2XNA C;  1QIL A;  1ET6 A;  2XRQ D;  2TSS A;  4RGO S;  1RF2 D;  2WV6 D;  4ZYS A;  4Z9C B;  1LT3 D;  4UDU C;  3BVZ A;  1STE A;  1BCP F;  1AN8 A;  1DJR D;  1S5E D;  2RDG A;  2AQ2 B;  1B44 D;  4RCO A;  1F77 A;  1I4Q A;  1KLU D;  2R61 A;  5D3I B;  1FNV A;  1XXG A;  2RDH A;  1I4G A;  1D5Z C;  1S5C D;  1SXT A;  5D3D A;  1D5X C;  4L63 B;  4RGM A;  1SJH D;  1CHQ D;  1JWS D;  1PTO C;  2NTS A;  1PTO D;  1UNS A;  2G9H D;  4K6L A;  3R2T A;  4RFB A;  5ELE A;  5ELC A;  1PTO B;  3O13 A;  1RD9 D;  1HA5 A;  1PZK D;  2XN9 C;  1TS3 A;  1RCV D;  1EFI D;  3EFX D;  1EWC A;  1PTO H;  3OWE B;  4RH6 A;  1LTG D;  5ELD A;  3V05 A;  1I4P A;  3W2D A;  3CHB D;  1AW7 A;  3BYY B;  3TSS A;  2QIL A;  1S5D D;  2ICI A;  2CHB D;  1JWM D;  1SBB B;  1SJE D;  1PRT F;  5FKA C;  1B1Z A;  1EU4 A;  4RHR A;  1HQR D;  1SE4 A;  1LTI D;  1BCP C;  4TSS A;  1PYW D;  1BCP D;  1BCP B;  1TS2 A;  1HTL D;  5TSS A;  1JWU D;  1ET9 A;  1PRT C;  1HXY D;  3DWA A;  1LTR D;  1MD2 D;  1CHP D;  1PRT B;  1D5M C;  1TY0 A;  2IPK D;  3EA6 A;  4RGN A;  1CK1 A;  1S5B D;  1FGB D;  4DXF A;  1LT6 D;  1TY2 A;  1TS4 A;  3BZD B;  1PZJ D;  3DWQ A;  4OHJ A;  1KTK A;  4RGT A;  4RHS A;  5I4D A;  1ENF A; 
#chains in the Genus database with same CATH topology
 1Y1V G;  3TS0 A;  3CCJ A;  1MGS A;  1F2Y A;  3HGB A;  2CVR A;  3NPP A;  4OWX B;  5LL6 S;  4NXN L;  1WTV A;  1EOV A;  4KY6 A;  1EEI D;  3CC4 A;  1NSN S;  4F8M A;  5IGE A;  1VQE A;  4LW1 A;  3PUZ A;  3GTK B;  4C1N I;  3VR4 A;  1FR3 A;  5FOB B;  1G8Z D;  5KND A;  5C0X H;  2DJG C;  1NAP A;  2IJ0 A;  1CUK A;  1K83 H;  4IPH A;  1BBU A;  3Q6S A;  1V1P B;  2EYJ A;  2K28 A;  4LUZ A;  4DR1 Q;  4R4Q A;  2LSS A;  2IX1 A;  5EPJ A;  2HDL A;  1JJ2 A;  1CT1 D;  3HOU B;  1OXS C;  1ZYR C;  2R92 B;  2VUM B;  1QIL A;  4DGZ A;  2TSS A;  3KDF B;  1UE6 A;  3I2Z A;  5BR8 Q;  4A3E B;  1U4M A;  2JA7 G;  1C9O A;  5FLX L;  3TZD A;  3W5O A;  4JI7 Q;  1WYD A;  1XPU A;  2VQE Q;  1UE5 A;  1PA6 A;  4L5S A;  4C3I G;  2LS0 1;  3I7F A;  3NEN A;  2R61 A;  3TZU A;  5CC4 A;  3NP8 A;  1HPC A;  3UE1 A;  1QVC A;  3TP5 A;  2NZO A;  5FO9 B;  2QF7 A;  2K7V A;  2ZTC A;  1AZP A;  3QIA A;  1CA5 A;  1Y8O B;  3ZJY C;  3HOZ H;  3RZO B;  2XN9 C;  5ISR A;  2PZU A;  2DUD A;  4JPB W;  1WTX A;  3EFX D;  1U0L A;  3KF6 A;  3OWE B;  5DAU A;  4EQ5 A;  4IOA A;  5CMD A;  1IW7 C;  4DV6 L;  1HR0 W;  3HRZ C;  3T1Y Q;  5IYC H;  1VQ5 A;  3U4Z A;  4IFD J;  4N8F A;  3PUW A;  1HQR D;  2GA4 B;  4KD4 A;  4CGY B;  1EQT A;  1VF7 A;  4HIO A;  1IZ6 A;  3MAQ A;  4TVA B;  3GTM B;  5DM7 3;  5T1I A;  2AMC B;  1EOT A;  4CBV A;  2RF4 A;  1IKL A;  1LTL A;  4JV5 L;  2UUC Q;  3BZD B;  3STB C;  1Q3L A;  1ENF A;  2HIX A;  3GV6 A;  2HD3 A;  3TS2 A;  4A3M B;  1PH4 A;  1PH2 A;  1CTM A;  4G4K A;  3BVG A;  4GNX A;  2PI2 A;  2KOL A;  3QOJ A;  1IBK L;  4CDC C;  5C4X B;  3G6E A;  1NR2 A;  2B2Y C;  4TRD A;  5K36 H;  3J80 i;  1KLG D;  5IYB G;  4DUY L;  2Z6K C;  1IYU A;  4I65 A;  4U67 3;  3L7Z C;  2JA6 G;  3E0J A;  5ELO A;  2EY1 A;  2KCM A;  2KHS A;  3PO2 B;  5KEE A;  4K6D A;  3MFY A;  3GV3 A;  5C0X I;  3BYT B;  2WB1 B;  1LO5 D;  5EBD A;  1STB A;  3UDG A;  1ZKO A;  3HOU G;  3JAM c;  2R92 G;  2VUM G;  2B39 A;  3DEP A;  4RG1 A;  4XQN A;  1TVX A;  3MA2 B;  4KN4 C;  4YCW A;  5C0X J;  1GM5 A;  4MZ9 A;  1EYD A;  4A3E G;  4RGO S;  1G6P A;  4B3T L;  3H3V H;  1I6V C;  5KGU A;  1EQQ A;  2N55 A;  3J7Y W;  1YHB A;  1QUQ A;  5COR A;  3ND8 A;  2F0W A;  4B9X A;  2ICE C;  4HJ8 A;  1B44 D;  2Q8T A;  2E2H B;  2UXC L;  2YU9 B;  1FNV A;  1FVI A;  4BA1 I;  1PH5 A;  2HCI A;  2ES2 A;  4C3J H;  1T5E A;  3HFZ B;  1Q90 A;  3HOX B;  4X64 L;  3KFU A;  4YWL A;  1C4Q A;  3TN2 A;  1PTO D;  4X6A H;  1VQ6 A;  1RIP A;  3NEM A;  4CHT B;  1WTW A;  2WP8 J;  2PCF B;  1LTG D;  3V05 A;  1XMO Q;  1NTG A;  1VMP A;  2K5W A;  4M8A A;  3NBI A;  1ZEQ X;  1WD1 A;  1RL2 A;  1SND A;  1IKM A;  3IRB A;  5EKK A;  3IFT A;  3A8K E;  1LV9 A;  3C46 A;  2KCN A;  1KAW A;  1E1O A;  2JK8 A;  1BCP C;  1PYW D;  1CKN A;  3NWS A;  4TQU S;  1DOL A;  2FMC A;  2O5J C;  1CKM A;  4CDE C;  1X32 A;  1JT8 A;  3N6R A;  2QGQ A;  1EIY B;  4IZ8 A;  1S5B D;  3A5U A;  4DR1 L;  3IAY A;  1LT6 D;  5IYD H;  1GO3 E;  4V0B A;  4A3M G;  2M00 A;  4GLX A;  1E7Z A;  2NVX H;  3I4M H;  1YIT A;  4MTK A;  2PW5 A;  3BG3 A;  3J7A F;  3S1M H;  4XT1 B;  2L1B A;  3T1H Q;  2V4D A;  5BR8 L;  5C4X G;  1SYC A;  1W6K A;  1NE3 A;  4C3H H;  4JI7 L;  1WOC A;  3D3R A;  3L9A X;  2KED A;  1FJG Q;  1S5F D;  1SN8 A;  1GUN A;  1EY6 A;  4UY8 C;  2F0H A;  1R9T H;  2NVQ B;  1SFO H;  3CCQ A;  3NWT A;  4Y7N B;  2Q2U A;  1ESR A;  3PO2 G;  1SEB D;  5M3F H;  2JSO A;  4RKL A;  1DXM A;  3AFQ A;  3SGI A;  1QZH A;  2D9U A;  2WB1 G;  3E9H A;  3NTH A;  4ZQ3 A;  1YIJ A;  5DEH A;  3I8Z A;  3S1R H;  1QB5 D;  5JPM C;  4O2D A;  1JCK B;  1TU2 B;  2A6H D;  5C3E B;  1KRS A;  3NSW A;  4BWG B;  1VQD A;  2MP1 A;  1HNZ Q;  3MZ5 A;  1XJV A;  2C9O A;  3T1Y L;  3KJP A;  2QEJ C;  2XNA C;  2RCF A;  3U50 C;  3G48 A;  1STA A;  1YJW A;  2Z9H A;  5EJW A;  1E24 A;  3BVZ A;  4L5R C;  1B9N A;  5C3X A;  1FGU A;  3S15 B;  4DNR B;  2RDH A;  3HOX G;  1F2Z A;  5M5X H;  4EGV A;  4U68 A;  2I0Q A;  1A8V A;  1SXT A;  2UUC L;  3EJI A;  2F4I A;  4UAI A;  3HEJ A;  1UNS A;  3O13 A;  1HA5 A;  2ENB A;  3SVM A;  4DV3 L;  1PTO H;  2ZTE A;  2EXD A;  1O7I A;  1PFN A;  3BYY B;  1S40 A;  1OO9 B;  2L4N A;  1TWC B;  2Y0S B;  4PZ6 A;  1BVS A;  1KQS A;  2WAQ E;  3GTP H;  2QKI C;  5J1Z A;  4I7Z C;  4FF4 A;  2NN6 I;  1IHZ A;  3E0E A;  3S14 B;  4BXX G;  5TSS A;  2KCT A;  3OIP A;  5C4J B;  1TWG B;  1VQG A;  1TWH B;  3S2H B;  4R8N A;  2K5V A;  1PH8 A;  4H7B A;  2B2W C;  3NBH B;  1NMF A;  1FYC A;  4X65 Q;  4HJA A;  4HSP A;  1I4H A;  2NVY H;  4ZCK A;  3SXH A;  4OO1 G;  1AEX A;  1X3Q A;  1Q1E A;  3PIO A;  4BY7 B;  4PZ8 A;  4GKK Q;  4FF2 A;  3CP0 A;  5C44 B;  5IP9 H;  5A2Q L;  1SMX A;  1BBX C;  2B2Y A;  2K32 A;  3EIV A;  1PRT D;  3U58 A;  2Z6K A;  4K8I A;  1K0S A;  4YY3 Q;  5A35 A;  2L0C A;  4X66 L;  4DKA C;  2OEO A;  3OTO Q;  1YNJ D;  4LMQ D;  5C3E G;  5LHY 1;  1PTO F;  2R7F A;  3KYH C;  2CFM A;  1XMO L;  4NDX A;  3MC0 B;  1K8A C;  3BZK A;  4XTC S;  1N33 Q;  3FKI H;  3QG1 A;  4DV5 Q;  4GS3 A;  1ESF A;  4YCU A;  4A3J G;  1VQM A;  1H95 A;  4TKO B;  3VR6 A;  1X55 A;  1LT3 D;  1I6H H;  1CKO A;  1YNN D;  4JI2 Q;  3OW2 A;  2K33 A;  1AN8 A;  1S5E D;  1XX8 A;  1I3Q H;  2L55 A;  3M4Q A;  1GUG A;  4NP5 A;  3S2D B;  1D5Z C;  2D62 A;  1E2V A;  4CDD C;  3PSI A;  2OTJ A;  4Q5V A;  3P75 A;  1BDO A;  2A19 A;  4WJW A;  1Z6H A;  2VY3 A;  5KIX A;  1MSG A;  1MHW C;  2K01 A;  3T1H L;  2LFN A;  5C5L A;  1BBW A;  3CME A;  1Q8I A;  2EY2 A;  1EFI D;  3A54 A;  5G3L D;  5HUR A;  4XYQ A;  2R93 H;  2BH8 A;  2Y0S G;  5M5Y H;  4CKB A;  1I94 Q;  1FJG L;  2ICI A;  3K7A B;  3JAM i;  4IUU A;  2ZTD A;  4HN7 A;  2E2J H;  1PYB A;  4OL7 A;  1EIH A;  1LAB A;  2EYF A;  4NMZ A;  1HNW L;  4X62 Q;  2F0E A;  4XXE A;  3JC6 6;  2KHI A;  3DWA A;  3SDZ A;  5LMN Q;  3ZYY X;  1OXX K;  1D5M C;  2PYK A;  2KEC A;  4DXF A;  2MQH A;  1J8I A;  1HNZ L;  1G2T A;  4J1M A;  1TKW B;  3QB3 A;  1L0Y B;  1NBW A;  3HOV B;  2L15 A;  3SR1 A;  3F1Z A;  2JA6 H;  1OXV A;  4BY7 G;  4KHV A;  1ROD A;  3KLR A;  1Q12 A;  2G9D A;  3CRL C;  4KKT A;  2ZJQ A;  2IX3 A;  3KBX A;  4B3M Q;  3LWE A;  5C44 G;  2BE5 D;  1XYI A;  5IGG A;  3FEW X;  3GTL B;  3D6W A;  3CCL A;  1KDC A;  4JI8 Q;  2Q8R E;  4O0A A;  3F8T A;  1WTH A;  4JC0 A;  1DOM A;  1PXU A;  3S16 H;  3DLL A;  1JE4 A;  3PMF A;  2HQE A;  4A3K B;  1V1P A;  2VQF Q;  3ONA B;  1X3G A;  3BDL A;  3HS0 C;  5BN3 A;  4EQO A;  4FO2 A;  4BY1 H;  4JI5 Q;  4A3C G;  1L1O B;  3DEO A;  1XPO A;  4ULL A;  4POF A;  4DAY B;  3S1Q H;  1EQV A;  2N88 A;  4IAL A;  3KDF A;  1JMC A;  1H9K A;  3CCM A;  1ET6 A;  2ATW A;  3OW7 A;  2JA8 H;  4IOC A;  1QE6 A;  1Y1W H;  1MJE A;  2MJ8 A;  1H9M A;  2EVB A;  3Q22 A;  2KUM A;  4DK1 A;  2EY5 A;  2BH2 A;  2NWG A;  1NUC A;  4GLA C;  4DFA A;  2NB0 A;  4QL5 A;  4YCV A;  5HGT A;  4X3T A;  4DR6 Q;  1TWA B;  5D3D A;  5JJL A;  2J7Z A;  5FJ8 H;  2E2I B;  3GQB A;  4ZLT F;  4X65 L;  3CQZ H;  1HZ9 A;  1JWS D;  1KNE A;  2NTS A;  2E76 C;  2K14 A;  5FLM H;  1SMY C;  1STG A;  2SNM A;  4L8J A;  1B2T A;  1QCB D;  1CA6 A;  1SAP A;  2HUG A;  1A63 A;  2EQS A;  1PFB A;  1S5D D;  4GN3 B;  3GD7 A;  2RHQ B;  1SNP A;  3GTJ H;  3G71 A;  2L11 A;  1PRT F;  4XQQ A;  4APV A;  1PH6 A;  2F1M A;  4YY3 L;  1EYA A;  3EVQ A;  2GVB A;  3OTO L;  4LK1 C;  3K8A A;  1GKH A;  1BQQ T;  1VCI A;  3I70 A;  1FGB D;  4A3G G;  2R7Z B;  4A3D B;  2F0S A;  2AUJ D;  3J7A 5;  3HOV G;  1N33 L;  1EWI A;  3RLF A;  3J81 E;  3M7N A;  4DV5 L;  3C2P A;  2Z6B A;  2B2W A;  5CV9 A;  4DK3 C;  2N78 A;  3HZX A;  3ITP A;  1RKN A;  2VNU D;  1EY7 A;  5C4H A;  4JI1 L;  2AQ1 B;  4A3I H;  1FD7 D;  1F2L A;  4JI2 L;  4K2L A;  4LNQ A;  1IL2 A;  1E22 A;  5EKI A;  1D2B A;  4AH6 A;  3CPF A;  2JEA I;  5GRO A;  4BBR B;  3F2B A;  4WJ4 A;  3ND9 A;  3LWU A;  4WRD A;  3H0G B;  3NHH A;  4A3K G;  1P8L A;  2UUB Q;  1GHK A;  2ALY B;  3PF4 A;  3CAM A;  3N52 A;  2F0L A;  1N32 Q;  2PW7 A;  3OMC A;  3GTG B;  2GN5 A;  4G7O C;  2MUY A;  3U9S A;  3I4O A;  1HNX Q;  5G3L F;  2YTX A;  3HKZ E;  3SE0 A;  1X3F A;  2JA5 H;  2KEN A;  1I94 L;  4ILW A;  4P73 A;  1C7Y A;  1Y14 B;  1B53 A;  3VR3 A;  1AZQ A;  4ME5 A;  4GN4 B;  1WCM H;  3M3Y H;  1U4L A;  5CV6 A;  3P20 A;  4UDU C;  4JI3 Q;  1GUS A;  4X62 L;  3PUX A;  1DJR D;  1HFN A;  3HOW H;  4P72 A;  5LMN L;  3HOY H;  4XYO A;  4LUV A;  3PO3 B;  2ZJP A;  2XWB B;  1EIG A;  3RNU A;  3JAM L;  2PQE A;  1F9Q A;  2NVT H;  3TQY A;  3PGZ A;  3I55 A;  1D1K A;  2SDF A;  1YI2 A;  4B3M L;  4QCL A;  5F2D A;  5J22 A;  3WDN A;  3RZD B;  3K6O A;  2JEB I;  4JI8 L;  3GTO B;  1O80 A;  1YEZ A;  4DPG A;  1GVP A;  3IKJ A;  2LY7 A;  5AJ3 L;  3UDI A;  1B7Y B;  3CPW A;  2TMP A;  1SR3 A;  4DK6 C;  1JE5 A;  4I7A A;  2JJQ A;  1X3P A;  2VQF L;  3I3C A;  2NUC A;  3L2P A;  2R7Z G;  4A3D G;  1CHP D;  2UXD Q;  1PRT B;  1A3V A;  4JI5 L;  4JI4 Q;  3F2D A;  4UP9 A;  1TQO A;  1HA6 A;  2ZJR A;  4AQY Q;  1SYG A;  5JPN C;  4IFD I;  1KTK A;  5E3F A;  4A93 B;  4WOR A;  1H9R A;  2A8V A;  1LTB D;  4H02 A;  2K5H A;  1VQB A;  3RLN A;  2BDN A;  3VR2 A;  1YHQ A;  5IIF A;  3D0F A;  4DAP A;  4BBR G;  3FPP A;  1UEA B;  3H0G G;  3PF5 A;  3M4O B;  4C2M B;  2X6L A;  5T1G A;  4DR6 L;  1KC8 C;  4CDF C;  2HCC A;  4A3J H;  3M85 A;  3MXP A;  4ZKB B;  3RMH A;  3PIO 3;  4L6T B;  2PQA B;  1B4O A;  2IX0 A;  1KXL A;  2KA7 A;  1L1O C;  3VYT A;  5AFW A;  3C1E A;  1NCV A;  1HJP A;  1FNU A;  1JB7 A;  1PVO A;  2CH4 W;  4DN4 M;  1L0X B;  2IT1 A;  4ZUI A;  2O4X A;  1YHA A;  1ZYR D;  2F52 A;  4DR2 Q;  4DR7 Q;  2K52 A;  3J81 L;  2ID0 A;  2Z4I A;  1D7Q A;  4HID A;  1TWF H;  1F9S A;  4HIM A;  3UE0 A;  3E9I A;  3PO3 G;  2FFK B;  3AB9 A;  4DR4 Q;  1A2U A;  1Q8K A;  1EIF A;  2L9H A;  4ZAI A;  1Q7Y C;  1KNA A;  3LX0 A;  4X3K A;  2F0O A;  2RQX A;  2OCE A;  4CJ2 C;  3CCE A;  4JBJ A;  1LM0 A;  1VQN A;  1RD9 D;  4BA2 I;  4HJ5 A;  1KHI A;  5M3M H;  2BOS A;  2WFW A;  1QNU A;  3VYS A;  1TII D;  2ZT9 C;  4HMJ A;  1IBL Q;  1HTP A;  4LF8 L;  2MPM A;  5IGF A;  3J7Z C;  2CH4 A;  4LUO A;  1C8C A;  1IW7 D;  3CU7 A;  5L37 A;  1PHJ A;  5I6Y A;  1DOK A;  1K0R A;  2A74 C;  3ULJ A;  3UDX A;  1Q81 C;  3KBG A;  2UUB L;  4PV1 C;  4DA2 A;  1Y8P B;  4A3B B;  2OQ0 A;  1X9N A;  4YIJ A;  2VW9 A;  2XSC A;  4M1U B;  1EFW A;  3S17 H;  4A3F B;  2HDM A;  2PNR C;  2Z1C A;  4A93 G;  1HNX L;  4O42 A;  1O7Y A;  5DNF A;  2QDL A;  3CF5 A;  3RUZ A;  1XPR A;  4OHJ A;  3STB D;  2D0P A;  3NBH A;  4ODG A;  3KUP A;  4R4I A;  2HQL A;  4GLV B;  2A6H C;  3K5O A;  3T51 B;  2J4X A;  3Q8D A;  4JI3 L;  1SE3 A;  2A69 C;  1LTT D;  1E2Z A;  1WFQ A;  3TP7 A;  4HJ7 A;  4A3C H;  3H6M A;  5FK9 C;  1BXT A;  2K5Q A;  4ZKC B;  1K8G A;  4A3L H;  3VYU A;  1CZW A;  2KQ3 A;  4FP5 D;  5JAV A;  1D6E C;  5D14 A;  1K83 B;  2XWJ B;  1ENA A;  1L2F A;  2R3Z A;  2EYH A;  2Z4H A;  3I90 A;  1YNX A;  1EZ8 A;  1TXY A;  3MEH A;  4OEM B;  1QVG A;  3I4N H;  2VB3 X;  3D8G A;  2Z8L A;  1IL8 A;  2VQE L;  4N9T A;  3J81 c;  1J5E Q;  3AFP A;  2EYO A;  4DV1 Q;  5ELN A;  1PFS A;  2MO0 A;  1BKB A;  4DR3 Q;  4DAM A;  1VQ8 A;  3L3O C;  1YVC A;  4JI4 L;  3K5N A;  5LMN W;  4AQY L;  3CC7 A;  1PH1 A;  1I5F A;  4L63 B;  1HZA A;  3OYY A;  2RHS B;  3HOZ B;  1EY4 A;  2FIN B;  1NNX A;  1CFM A;  2A6E C;  2B63 H;  1V8Q A;  3AEV A;  1U9R A;  4NW2 A;  1KDB A;  4BBS H;  4KKU A;  3M4P A;  1STH A;  1YZ6 A;  4R4O A;  2UUA Q;  1K8O A;  4A3G H;  2JE6 I;  1WI5 A;  4FF3 A;  4A3B G;  3H3V I;  2EPB A;  5IY0 A;  2F0F A;  3R93 A;  4QUF A;  1R4P B;  4GNX B;  4KHP Q;  1BCP D;  5EBC A;  1TS2 A;  2LMC B;  3A0J A;  4N8X 1;  5C4Z A;  4A3F G;  2KJX A;  5IGB A;  1ET9 A;  1LYL A;  1PRT C;  3ULL A;  1LTR D;  2A68 C;  1X3E A;  3KJO A;  1K9M C;  4H44 C;  4LFC Q;  4XIG S;  2PI2 E;  4WJ3 M;  1STN A;  2KCC A;  2XGT A;  4QF4 A;  2WAQ B;  4GOP B;  4IJH A;  4DR2 L;  4A4I A;  1SYE A;  2PNH A;  1OTC A;  1SYF A;  4DR7 L;  3WOF A;  1MI2 A;  1HUM A;  2J0T D;  2D5D A;  3PIP A;  5LMU Q;  1VQJ A;  4L5T A;  3VA7 A;  1Y1V H;  5CV5 A;  5C0X G;  4DR4 L;  3DXJ C;  4IPC A;  3NXW A;  1A6X A;  4B3S Q;  3CCU A;  1I50 H;  5GAE C;  3BVM A;  1LUZ A;  2B8F A;  4ZK9 B;  3D31 A;  5J3B A;  3OPO A;  1PMR A;  4DUZ Q;  1L1O A;  3G4S A;  1E3P A;  1OXT A;  1N8R C;  2L5T A;  1ASY A;  1HZB A;  1IBL L;  3NTK A;  4DAY A;  2AHO B;  2PZT A;  1C48 A;  3X3M A;  3MTS A;  3K80 C;  3S1N H;  3MWY W;  4ID6 A;  3I4L A;  4AYB E;  2LXJ A;  2KEE A;  3AQQ A;  2DNE A;  4Z9C B;  1Z47 A;  1MKH A;  3K7U C;  2QEX A;  2E2D C;  5CV4 A;  3PQI A;  4FF1 A;  1Z7T A;  3IFD A;  3KLS A;  3BZC A;  2AQ2 B;  2F0M A;  1O7L A;  1VQC A;  1F77 A;  4QB4 A;  2SOB A;  2OXP A;  5D3I B;  2JA7 H;  4LF6 Q;  1I4G A;  4C3J B;  2I07 B;  3A5Z B;  2I5H A;  3P1H A;  3HOZ G;  1PYS B;  2K4K A;  3ERQ A;  3MXN B;  1G91 A;  4C3I H;  4IUV A;  3DMU A;  2F4V Q;  2EIF A;  3KOJ A;  3DM3 A;  5E7N A;  5ELE A;  4IUP A;  1RCV D;  2F0I A;  1CZG A;  1O78 A;  5IYC G;  1AH9 A;  5ELD A;  3E3X A;  2XVS A;  4IQZ A;  2YTV A;  4MIU A;  4OIK A;  4KD3 A;  5JVG 3;  2B2V C;  3F2U A;  2N8N A;  2YYZ A;  3TP6 A;  1B3Q A;  3W3A A;  2BCO A;  4QQB X;  4KKS A;  1HRJ A;  3FHW A;  2WAC A;  1GHJ A;  4B08 A;  2FHT A;  2X6G A;  1VQO A;  2AWO A;  3A7A B;  1ENC A;  4DNI A;  2D0O A;  2F0K A;  2H1E A;  2NVX B;  3GTQ H;  3I4M B;  1DCZ A;  4R4T A;  2B3G A;  3KK7 A;  3S1M B;  1Y69 U;  1BR9 A;  2EJM A;  1J5E L;  2AKW B;  5M5W H;  1UUP A;  1ONL A;  3HKS A;  4DV1 L;  5K36 G;  3URY A;  4C3H B;  4Y52 H;  4DR3 L;  4IUR A;  2ZXR A;  1LTS D;  5GAH C;  4P71 A;  1R9T B;  4IPG A;  3NK9 A;  1SFO B;  4JI0 Q;  1I4X A;  5IOC A;  5M9O A;  2PO4 A;  4KJN A;  2IY5 B;  1EY0 A;  5M3F B;  3T56 B;  4LF7 Q;  3GTK H;  4KMU C;  1VQK A;  3UI2 A;  4FVM A;  4DXG A;  5IYB H;  1LT5 D;  3S1R B;  1QWY A;  2EZV A;  3K0X A;  1EU3 A;  3PUV A;  1EEF D;  3K0Y A;  2NTT A;  3S9W A;  1K8M A;  1T9H A;  3D4D A;  4QGU A;  2UUA L;  1LTA D;  3RD4 A;  3A7L A;  1T5X D;  3C1F A;  3H91 A;  4C1N K;  1WVL A;  3HOU H;  1QG7 A;  3OHX C;  1GUO A;  2RSO A;  3OMG A;  4JCV E;  4DK0 A;  2R92 H;  4R8I A;  2VUM H;  2Q8I B;  4KHP L;  3QWN A;  1VQI A;  1BCP F;  1YJ9 A;  1SYB A;  4A3E H;  3BS1 A;  1U4R A;  2F0Q A;  5M5X B;  3NEL A;  3A74 A;  5HY6 A;  2X69 A;  1TT2 A;  2EYM A;  4LF4 Q;  4ZRZ A;  3G6J B;  5JJK A;  4H13 C;  4UP7 A;  1M90 C;  2C5C A;  5ELC A;  1PTO B;  2NN6 G;  4P75 A;  4JVZ A;  4EVO A;  4HJ9 A;  3RZO H;  1M1K C;  2YV5 A;  2AUK A;  5LMU L;  5E1F A;  1TR5 A;  5FLX E;  4NXM Q;  2F0V A;  2PPB C;  1Q82 C;  2JA9 A;  1WTQ A;  3UDF A;  3NTI A;  3GTP B;  3OIQ A;  1E0B A;  1UEB A;  3FDT A;  4B3S L;  1Z9F A;  2E8G A;  3J81 i;  4KI0 A;  2F0P A;  4LF9 Q;  5IYD G;  1KAA A;  4NB3 A;  2CW0 C;  2K04 A;  1MD2 D;  1WTP A;  3GTM H;  1O7Z A;  3I4M G;  1IYJ B;  4OX9 Q;  5COY A;  3ERO A;  1HCZ A;  4DAV A;  1EY9 A;  4IN3 A;  4GOP C;  5JEA G;  2IWH A;  3RLO A;  4GKK L;  1RTO A;  2NVY B;  2V1C C;  2OWO A;  4LFB Q;  4C3H G;  4JW0 A;  3R8B A;  4A3M H;  1B50 A;  2LXK A;  4S3S A;  3MXU A;  4KY7 A;  1M4V A;  3TRZ A;  3V2T A;  1H9S B;  2QW7 A;  5M3F G;  5C4X H;  3MXG A;  4QIW E;  4LF6 L;  1ASZ A;  2UU9 Q;  1EY8 A;  4P74 A;  2PMZ E;  3CCR A;  4KK7 A;  1JB3 A;  1A3T A;  1NY4 A;  1QVF A;  5CBE E;  1PH9 A;  3M7G A;  3R2I A;  2F4V L;  2PQA A;  2CKZ B;  3NE5 B;  3PO2 H;  2Q2H A;  3FKI B;  2SEB D;  4J15 A;  1G29 1;  1W2B A;  1JC7 A;  3J81 j;  3CCV A;  3H3V C;  3R3O A;  1XTC D;  3BJU A;  1HHV A;  3BDO A;  1I6H B;  1DM0 B;  1HH2 P;  2K5D A;  2Q2I A;  3ULP A;  5BN4 A;  4OWT B;  1EZ6 A;  4POG A;  4NPS A;  5JVH 3;  1AFP A;  1JJC B;  1JOK A;  2AWN A;  1I3Q B;  2FMM A;  2ZM6 Q;  1VMC A;  3T53 B;  4CKE A;  3HKZ B;  4HCS A;  3CCS A;  1KLU D;  3S24 A;  3W1G A;  2E2H H;  1X54 A;  2LKV A;  4JBM A;  2YU9 H;  3TP8 A;  1D5X C;  4PQX A;  5C6A A;  4LF5 Q;  2R7D A;  3FMC A;  1SNQ A;  2HIV A;  1GJX A;  1CHQ D;  3HOX H;  5CV7 A;  2K6A A;  2KHJ A;  2IL8 A;  1VS0 A;  4XDX A;  1IXR A;  4DV2 Q;  1XMQ Q;  2R93 B;  4RH6 A;  5M5Y B;  4ZUJ A;  1SMY D;  1SDF A;  1UE1 A;  1P16 A;  5IE8 A;  5E4W C;  1PH7 A;  4EX5 A;  3MEF A;  4GZY C;  4JI0 L;  2B2V A;  4GKJ Q;  2XIW A;  1SJE D;  1WD0 A;  2E2J B;  3GO5 A;  1VDZ A;  1II3 A;  4LF7 L;  4TSS A;  4DU9 A;  1UWV A;  2F0J A;  1EY5 A;  3EBE A;  1NMG A;  4IUT A;  1TY0 A;  1JIC A;  2B8G A;  5EPL A;  4BXX H;  4F87 A;  2NBF A;  1PZJ D;  1L0W A;  3IL8 A;  2JA6 B;  1AP0 A;  4CJ0 B;  4R4C A;  3S17 B;  2JN4 A;  3TME A;  5IP9 G;  5KYL A;  4KLK A;  5IT9 E;  4OEL B;  4R9W A;  1AE2 A;  5I9O A;  3KLS X;  2Q2T A;  4OO1 H;  1EUJ A;  1B3A A;  1BO0 A;  3MFG A;  4MN3 A;  1OXU A;  1DON A;  4LJZ C;  3S16 B;  1XTD A;  2NVQ H;  4Y7N H;  2DY7 A;  4K2K A;  5DM6 3;  4FXG C;  4LF4 L;  1SNC A;  2I5L X;  2Z0S A;  4FYD A;  2XRS D;  2B2U A;  1KRT A;  4BY1 B;  3PIP 3;  3FKI G;  2UXB Q;  3P7J A;  2RBM A;  4HIK A;  4OGQ C;  4ABN A;  2F0G A;  4CJ1 B;  1V1Q A;  3S1Q B;  4XT3 B;  5C3E H;  4NXM L;  4DV7 Q;  2WIN B;  1LT4 D;  2L12 A;  1N36 Q;  5IWA Q;  2JA8 B;  1Y1W B;  4ZYS A;  4QY7 A;  4WFN 3;  3KF8 B;  3HKZ G;  4QJF A;  4LF9 L;  3E5S A;  2VZA A;  3K5L A;  1AE3 A;  4OX9 L;  2K5N A;  3ERS X;  2JP1 A;  3S15 H;  4K0K Q;  3DUZ A;  3CQZ B;  1WJJ A;  4RGM A;  5IP7 G;  5EPK A;  2A73 B;  1SJH D;  5GQO A;  4LFB L;  1PTO C;  4G7H C;  2R93 G;  3AU7 A;  1JOQ A;  4J6H A;  1TS3 A;  2QDB A;  3I91 A;  2NYZ D;  3D6C A;  3I56 A;  3GTJ B;  2EOT A;  1UAP A;  1SBB B;  4RWS C;  4DV3 Q;  2UU9 L;  1SE4 A;  1TWC H;  3T16 A;  1X56 A;  4IUQ A;  3FRP B;  3SK6 A;  4FXK C;  1VQ4 A;  1JWU D;  3S14 H;  1S4Z A;  4F88 A;  3QR8 A;  4IPD A;  4RGN A;  5HGQ A;  1TY2 A;  5C4J H;  1TWG H;  1TWH H;  3H09 A;  1K3R A;  2VS1 A;  4RHS A;  3S2H H;  4GOP A;  2VL6 A;  2F3I A;  4JOI A;  1N34 Q;  3J7A V;  1ICW A;  1EYG A;  1D1I A;  4A3I B;  1MSH A;  3NQT A;  2K05 A;  2CWA A;  1M8A A;  2CCZ A;  2ZM6 L;  4BY7 H;  1SSO A;  2WB1 E;  3T13 A;  5C44 H;  4X3U A;  1N32 L;  2FJ2 A;  5FLX c;  1KAB A;  3DWP A;  1LAC A;  4LF5 L;  4OO1 I;  3OSO A;  1CM9 A;  1KIX A;  4BY1 G;  1ZXT A;  4HAE A;  3CC2 A;  2DGY A;  1VQL A;  1JR0 D;  3J80 E;  4C56 C;  1A62 A;  4A76 A;  1KD1 C;  1DYQ A;  4DV2 L;  1XMQ L;  2JA5 B;  3GDE A;  4LFA Q;  2IW3 A;  1RJT A;  2RSN A;  4X66 Q;  4JBK A;  2JA8 G;  1UE7 A;  2EDG A;  1Y1W G;  4GKJ L;  1G51 A;  2JQO A;  1WCM B;  3M3Y B;  1G6Z A;  2BA1 A;  2B29 A;  5A2Q E;  3CRK C;  4YWM A;  1E1T A;  5BN5 A;  3HP3 A;  3TBI B;  1RF2 D;  2EXZ A;  4PMC A;  4PZ7 A;  2SNS A;  4V19 0;  2B2T A;  2ZXP A;  4HSV A;  3HOW B;  1D8L A;  5I6W A;  5KNB A;  2F3W A;  3HOY B;  2NN6 H;  2RDG A;  3D4R A;  5DLQ E;  5FJ8 G;  5IT9 L;  1F2M A;  1ICF B;  1XNQ Q;  3QOL A;  3MXN A;  3S2D H;  4KV6 A;  4UPA A;  2HHH Q;  5FLM G;  1KL9 A;  4DNT B;  2HT1 A;  2NVT B;  4HMI A;  1HQM C;  2G9H D;  4PNY A;  4HTH A;  2WKC A;  3KF6 B;  1I4P A;  1Q46 A;  3SK8 A;  3W2D A;  2VXW A;  4DV4 Q;  5KRU A;  2MNA A;  3TSS A;  1EWH A;  1K73 C;  2QA4 A;  3Q24 A;  2UXD L;  5JEA H;  3K81 C;  3K7A H;  1A3U A;  1B1Z A;  4OIJ A;  4IFD G;  3M4Y A;  4K5X A;  5CV8 A;  3VYR A;  2MO1 A;  2F3V A;  1VQ9 A;  4P2C B;  4NKL A;  3EN2 A;  2IPK D;  2UXB L;  1WTO A;  1HZC A;  4ME3 A;  1HNW Q;  3L0O A;  2IHF A;  3OOC A;  5ELB A;  1V9P A;  3WWV A;  4DV7 L;  4A3I G;  1N36 L;  4PG3 A;  4KTA A;  5IWA L;  1WTR A;  1JQY D;  1DGS A;  3HOV H;  4B3R Q;  5FO7 B;  1Q1B A;  3FP9 A;  5H1S E;  1HR0 Q;  1SE2 A;  3DHQ A;  4KJO A;  2OTL A;  2A69 D;  5IOD A;  3FPU B;  1R4Q B;  4OWW B;  4UHV A;  3D4W A;  3WOE A;  3GTL H;  2F0D A;  4QUC A;  3BDC A;  2O5I C;  5C3W A;  1SRU A;  4K0K L;  4A3J B;  1SNM A;  4DF7 A;  3I73 A;  4HR7 B;  2F0T A;  3MVV A;  1YNJ C;  3CMA A;  1CSP A;  2DY8 A;  2JA5 G;  4A3K H;  3A8I E;  2NZH A;  2QCP X;  5K5P A;  2WII B;  4XQJ A;  1WCM G;  4PMB A;  4K8J A;  1W6J A;  4KY5 A;  2EJF C;  3SK5 A;  5JJZ A;  1VQF A;  4HED A;  3W1B A;  2DNC A;  2O2L D;  3K57 A;  3HOW G;  1DZ1 A;  1IBM Q;  2K1B A;  1TWF B;  2WV6 D;  3HOY G;  4F7X A;  2H5X A;  1YNN C;  3CXC A;  1QUQ B;  3SK4 A;  4H0L C;  3KLW A;  4IUN A;  5IT9 c;  4KN7 C;  4RCO A;  3SHL A;  1GXD C;  5KNC A;  1EYC A;  1NJI C;  1NR4 A;  1TWA H;  4FNF A;  2Y0S E;  4AYB B;  4DR5 Q;  1G2S A;  1K3B C;  4MTN A;  1A2T A;  1STY A;  1N34 L;  2K75 A;  2E2I H;  4JI6 Q;  5M3M B;  4HCE A;  2A6E D;  1PZK D;  1SRO A;  1HUN A;  2E5L Q;  3DM1 A;  4K14 A;  5E4X A;  3V96 A;  1V43 A;  3OWF A;  3J80 L;  3TDQ A;  2KBN A;  2YTY A;  5EGT A;  1IYV A;  2MGS A;  1DD2 A;  5CBA E;  1JJG A;  5CYU A;  1A0I A;  1JWM D;  2ASB A;  4RHR A;  3A8J E;  4JK1 C;  2RA4 A;  1CSQ A;  2H4O A;  3ICE A;  1HTL D;  1CKN B;  1JOR A;  2A1A A;  1HXY D;  1EQR A;  1F9P A;  2EYP A;  4DV0 Q;  2A68 D;  2G5D A;  1CQF A;  1CK1 A;  1YJN A;  1GUW A;  4LFA L;  4YWK A;  5JEA J;  2OQK A;  4JYA Q;  3DWQ A;  2R7Z H;  4MHE A;  4RGT A;  3NQI A;  4MNO A;  4A3D H;  1ILP A;  2MFI A;  2F0N A;  1E2W A;  2EE1 A;  1FNW A;  4L5Q A;  1TS5 A;  2WKD A;  4KHZ A;  2BE5 C;  2EYL A;  1GD7 A;  4RCN A;  1H9S A;  3SEB A;  2OT2 A;  4J8Q A;  1A15 A;  1B8A A;  5D65 A;  4YHH Q;  4K5W A;  1PV4 A;  1H9J A;  1XNQ L;  5C5M A;  2VB2 X;  4BBR H;  2WAQ G;  4JI1 Q;  2HHH L;  1MBY A;  1PH3 A;  4FDB A;  5FO8 B;  1XNR Q;  3H0G H;  1CI3 M;  1LLR D;  3I4N B;  4B9W A;  1PLF A;  1MIU A;  3GTG H;  2GVA A;  4DV4 L;  3Q0A A;  2CQA A;  4O1N A;  5ELF A;  2MHV A;  2F0U A;  3A55 A;  2EY6 A;  2CWP A;  1J9O A;  3HG9 A;  5IP7 H;  2XRQ D;  2M9V A;  3Q23 A;  3EQL C;  1ILQ A;  2CQO A;  1STE A;  2JXM B;  4NXN Q;  5I2Y A;  3H94 A;  2B2U C;  4JBW A;  5EQ0 A;  1I4Q A;  1BOS A;  1QOH A;  3MHB A;  4AYB G;  3I72 A;  5JJI A;  1W3S A;  3QJY A;  5M3M G;  3PO3 H;  1RHP A;  2B63 B;  2C35 B;  2NZ1 D;  4K5V A;  4RA8 A;  3FVQ A;  4RFB A;  4B3R L;  5NUC A;  4BBS B;  3CD6 A;  1F9R A;  1U4P A;  4IJL A;  3VR5 A;  3M9B A;  5CGK A;  3J80 c;  1HR0 L;  2K03 A;  3CHB D;  4A3G B;  1VQ7 A;  3RZD H;  1BNZ A;  3GTO H;  2QIL A;  4C3J G;  1YBY A;  5I2X A;  3RN2 A;  4LAA A;  4LFC L;  3VDY A;  5FKA C;  2BA0 A;  4Q0F A;  2KVM A;  2FXQ A;  5GAD C;  2PZW A;  4GN5 A;  3G7L A;  4AIM A;  3RN5 A;  3RR5 A;  1N9W A;  1VF5 C;  4RKB A;  3JAM E;  3EA6 A;  1SLJ A;  5AJ3 Q;  1KDA A;  1JOO A;  1S72 A;  1TS4 A;  3K58 A;  1J6Q A;  2RDF A;  1B9M A;  5IGD A;  1B70 B;  1QNK A;  2RKS A;  3QO2 A;  3A56 A;  1BF4 A;  4A93 H;  2JYO A;  2K50 A;  1SYD A;  1ML0 D;  1IBM L;  5KYI A;  4ALP A;  2D2C C;  3C3L A;  1RTN A;  4GNX C;  1VQP A;  1QZG A;  4A3L G;  1U5K A;  1I4R A;  1Y1V B;  4G57 A;  3CW2 C;  5CR3 A;  4UP8 A;  1XWE A;  4JG2 A;  2ZXO A;  2I46 A;  4DV6 Q;  2I5M X;  4CKC A;  3AYH B;  5EAY A;  5EKL A;  4DUZ L;  2F03 A;  3M4O H;  4C2M H;  4BS9 A;  1I50 B;  1K28 A;  1VQA A;  1PZI D;  1RDP D;  2XTI A;  1QJO A;  4RAU C;  3U9O A;  3LNN A;  4DR5 L;  4QMG A;  3I4N G;  1V1O A;  4JOI C;  4JI6 L;  1PFM A;  3F2C A;  3BU2 A;  1PDQ A;  1CQV A;  2N3S A;  4X3S A;  1GOZ A;  2E5L L;  4PMW A;  3PUY A;  4R1J A;  3U4V A;  4EQN A;  4QIW B;  4JV5 Q;  2N49 A;  3ER0 A;  4OON A;  3S1N B;  2RCN A;  3GP7 A;  1Q86 C;  4OXP A;  2IHE A;  2PMZ B;  2AQ3 B;  3T4A C;  2RVL A;  5JOB A;  3LGJ A;  3KF8 A;  3PV0 A;  1X65 A;  1IBK Q;  3B6Y A;  4E6I A;  3H15 A;  4G7Z C;  2JA7 B;  4DV0 L;  2E75 C;  1BUV T;  1XXG A;  4DUY Q;  1S5C D;  4C3I B;  2B63 G;  3AMU A;  1FL0 A;  4JYA L;  1EL0 A;  2DJF C;  1S3O A;  4LWC A;  3K59 A;  4BBS G;  2M2L A;  4A75 A;  4IFD H;  4IO9 A;  2OF1 A;  4K6L A;  3R2T A;  2P5Z X;  3VA5 A;  2DN8 A;  4EQP A;  1EWC A;  1SE8 A;  2EJG C;  2B2T C;  5LL6 X;  1AW7 A;  2R6G A;  3TEH B;  4YHH L;  1GUT A;  4FXD A;  2CHB D;  5IGC A;  1Y8N B;  1EU4 A;  4B3T Q;  1LTI D;  1VQH A;  5GAG C;  1XNR L;  2BDO A;  2E74 C;  4LF8 Q;  1BCP B;  4A3B H;  3NUC A;  2A5H A;  2CW0 D;  3K5M A;  5I9P A;  4RMF A;  2UXC Q;  1X6O A;  3GTQ B;  3PCO B;  4A3F H;  1C0A A;  3E6Z X;  1SNO A;  5J39 A;  4N9P A;  1MJC A;  3X3N A;  5I4D A;  3CKI B;  1HFG A;  3TRE A;  4X64 Q;  5M5W B; 
#chains in the Genus database with same CATH homology
 1MGS A;  1F2Y A;  3HGB A;  2CVR A;  3NPP A;  5LL6 S;  1WTV A;  4KY6 A;  1EEI D;  1NSN S;  4F8M A;  5IGE A;  3PUZ A;  3GTK B;  4C1N I;  3VR4 A;  1FR3 A;  5FOB B;  1G8Z D;  5KND A;  5C0X H;  1NAP A;  2IJ0 A;  3Q6S A;  1V1P B;  2EYJ A;  2K28 A;  2IX1 A;  5EPJ A;  2HDL A;  1CT1 D;  3HOU B;  1OXS C;  1ZYR C;  2R92 B;  2VUM B;  1QIL A;  4DGZ A;  2TSS A;  4A3E B;  1U4M A;  5FLX L;  3TZD A;  4C3I G;  2LS0 1;  2R61 A;  3TZU A;  5CC4 A;  3NP8 A;  1HPC A;  3TP5 A;  5FO9 B;  2QF7 A;  2K7V A;  1AZP A;  3QIA A;  1CA5 A;  1Y8O B;  3RZO B;  2XN9 C;  5ISR A;  2PZU A;  1WTX A;  3EFX D;  3OWE B;  5DAU A;  5CMD A;  1IW7 C;  3HRZ C;  4IFD J;  3PUW A;  1HQR D;  2GA4 B;  4KD4 A;  4CGY B;  1EQT A;  1VF7 A;  3MAQ A;  3GTM B;  5DM7 3;  5T1I A;  1EOT A;  4CBV A;  1IKL A;  3BZD B;  1Q3L A;  1ENF A;  3GV6 A;  4A3M B;  1CTM A;  4G4K A;  3BVG A;  2KOL A;  3QOJ A;  5C4X B;  1NR2 A;  2B2Y C;  4TRD A;  5K36 H;  1KLG D;  1IYU A;  4I65 A;  4U67 3;  3L7Z C;  3E0J A;  2EY1 A;  3PO2 B;  2KHS A;  5KEE A;  4K6D A;  3MFY A;  3GV3 A;  5C0X I;  3BYT B;  2WB1 B;  1LO5 D;  5EBD A;  1STB A;  1ZKO A;  2B39 A;  3DEP A;  4XQN A;  1TVX A;  3MA2 B;  4KN4 C;  5C0X J;  1EYD A;  4RGO S;  1I6V C;  5KGU A;  2N55 A;  3J7Y W;  5COR A;  3ND8 A;  2F0W A;  4B9X A;  2ICE C;  1B44 D;  2Q8T A;  2E2H B;  2YU9 B;  1FNV A;  4BA1 I;  2HCI A;  1T5E A;  1Q90 A;  3HOX B;  1C4Q A;  3TN2 A;  1PTO D;  4CHT B;  1WTW A;  2WP8 J;  2PCF B;  1LTG D;  3V05 A;  1VMP A;  2K5W A;  4M8A A;  3NBI A;  1ZEQ X;  1WD1 A;  1SND A;  1IKM A;  5EKK A;  3IFT A;  3A8K E;  1LV9 A;  3C46 A;  2KCN A;  1BCP C;  1PYW D;  4TQU S;  3NWS A;  1DOL A;  2FMC A;  2O5J C;  1X32 A;  3N6R A;  4IZ8 A;  1S5B D;  3IAY A;  1LT6 D;  4V0B A;  2M00 A;  2PW5 A;  3BG3 A;  3J7A F;  4XT1 B;  2L1B A;  2V4D A;  1SYC A;  1W6K A;  3D3R A;  3L9A X;  2KED A;  1S5F D;  1GUN A;  1EY6 A;  2F0H A;  2NVQ B;  3NWT A;  4Y7N B;  1ESR A;  1SEB D;  2JSO A;  4RKL A;  1DXM A;  2D9U A;  3NTH A;  4ZQ3 A;  5DEH A;  3I8Z A;  1QB5 D;  5JPM C;  1JCK B;  1TU2 B;  2A6H D;  5C3E B;  4BWG B;  3NSW A;  2MP1 A;  3MZ5 A;  2C9O A;  2QEJ C;  2XNA C;  1STA A;  5EJW A;  3BVZ A;  1B9N A;  5C3X A;  3S15 B;  4DNR B;  2RDH A;  1F2Z A;  4EGV A;  4U68 A;  1SXT A;  3EJI A;  2F4I A;  4UAI A;  3HEJ A;  1UNS A;  3O13 A;  1HA5 A;  2ENB A;  3SVM A;  1PTO H;  1PFN A;  3BYY B;  1OO9 B;  2L4N A;  1TWC B;  2Y0S B;  2QKI C;  5J1Z A;  4I7Z C;  4FF4 A;  2NN6 I;  1IHZ A;  3S14 B;  5TSS A;  3OIP A;  5C4J B;  1TWG B;  1TWH B;  3S2H B;  4R8N A;  4H7B A;  2B2W C;  1FYC A;  4HSP A;  1I4H A;  3SXH A;  4OO1 G;  1AEX A;  1X3Q A;  1Q1E A;  4BY7 B;  4FF2 A;  5C44 B;  5A2Q L;  1BBX C;  2B2Y A;  2K32 A;  1PRT D;  4K8I A;  5A35 A;  2L0C A;  2OEO A;  1YNJ D;  4LMQ D;  5LHY 1;  1PTO F;  4NDX A;  3MC0 B;  4XTC S;  3QG1 A;  1ESF A;  4TKO B;  3VR6 A;  1LT3 D;  1YNN D;  2K33 A;  1AN8 A;  1S5E D;  1XX8 A;  2L55 A;  1GUG A;  4NP5 A;  3S2D B;  1D5Z C;  2D62 A;  1E2V A;  4Q5V A;  3P75 A;  1BDO A;  4WJW A;  1Z6H A;  5KIX A;  1MSG A;  2K01 A;  2LFN A;  5C5L A;  1Q8I A;  2EY2 A;  1EFI D;  3A54 A;  5G3L D;  5HUR A;  4XYQ A;  4CKB A;  2ICI A;  3K7A B;  4IUU A;  4HN7 A;  4OL7 A;  1EIH A;  1LAB A;  2EYF A;  4NMZ A;  2F0E A;  4XXE A;  3DWA A;  3SDZ A;  3ZYY X;  1OXX K;  1D5M C;  2PYK A;  2KEC A;  4DXF A;  1J8I A;  1G2T A;  4J1M A;  1TKW B;  3QB3 A;  1L0Y B;  3HOV B;  3SR1 A;  1OXV A;  4KHV A;  1ROD A;  3KLR A;  1Q12 A;  2G9D A;  3CRL C;  4KKT A;  2IX3 A;  3KBX A;  3LWE A;  2BE5 D;  1XYI A;  5IGG A;  3FEW X;  3GTL B;  3D6W A;  1KDC A;  2Q8R E;  1DOM A;  1PXU A;  1JE4 A;  3PMF A;  2HQE A;  4A3K B;  1V1P A;  3ONA B;  5BN3 A;  3BDL A;  3HS0 C;  4EQO A;  4FO2 A;  3DEO A;  4ULL A;  1EQV A;  2N88 A;  4IAL A;  1H9K A;  1ET6 A;  3OW7 A;  1QE6 A;  2MJ8 A;  1H9M A;  2EVB A;  3Q22 A;  2KUM A;  4DK1 A;  2EY5 A;  2NWG A;  1NUC A;  4DFA A;  2NB0 A;  5HGT A;  4X3T A;  1TWA B;  5D3D A;  2J7Z A;  2E2I B;  3GQB A;  4ZLT F;  1JWS D;  1KNE A;  2NTS A;  2E76 C;  1SMY C;  1STG A;  2SNM A;  4L8J A;  1B2T A;  1QCB D;  1CA6 A;  1SAP A;  2HUG A;  1PFB A;  1S5D D;  3GD7 A;  1SNP A;  2L11 A;  1PRT F;  4XQQ A;  2F1M A;  1EYA A;  3EVQ A;  4LK1 C;  1BQQ T;  1VCI A;  3I70 A;  1FGB D;  2R7Z B;  4A3D B;  2F0S A;  2AUJ D;  3RLF A;  3J81 E;  3M7N A;  3C2P A;  2B2W A;  5CV9 A;  3HZX A;  3ITP A;  1RKN A;  2VNU D;  1EY7 A;  5C4H A;  2AQ1 B;  1FD7 D;  1F2L A;  4K2L A;  5EKI A;  1D2B A;  2JEA I;  4BBR B;  3ND9 A;  3LWU A;  4WRD A;  3H0G B;  3NHH A;  1GHK A;  3N52 A;  2F0L A;  2PW7 A;  3OMC A;  3GTG B;  4G7O C;  2MUY A;  3U9S A;  5G3L F;  3SE0 A;  4ILW A;  1B53 A;  3VR3 A;  1AZQ A;  4ME5 A;  1U4L A;  5CV6 A;  3P20 A;  4UDU C;  1GUS A;  3PUX A;  1DJR D;  1HFN A;  4XYO A;  3PO3 B;  2XWB B;  1EIG A;  3JAM L;  2PQE A;  1F9Q A;  1D1K A;  2SDF A;  4QCL A;  5F2D A;  5J22 A;  3WDN A;  3RZD B;  3K6O A;  2JEB I;  3GTO B;  1O80 A;  3IKJ A;  2LY7 A;  2TMP A;  1X3P A;  3I3C A;  2NUC A;  1CHP D;  1PRT B;  1A3V A;  1TQO A;  1HA6 A;  1SYG A;  5JPN C;  4IFD I;  1KTK A;  5E3F A;  4A93 B;  4WOR A;  1H9R A;  1LTB D;  2BDN A;  3VR2 A;  5IIF A;  4DAP A;  3FPP A;  1UEA B;  3M4O B;  4C2M B;  2X6L A;  5T1G A;  2HCC A;  3M85 A;  3MXP A;  4ZKB B;  3RMH A;  3PIO 3;  4L6T B;  1B4O A;  2IX0 A;  2KA7 A;  3VYT A;  5AFW A;  3C1E A;  1NCV A;  1FNU A;  4DN4 M;  1L0X B;  2IT1 A;  4ZUI A;  2O4X A;  1ZYR D;  3J81 L;  2ID0 A;  2Z4I A;  1F9S A;  2FFK B;  3AB9 A;  1A2U A;  4ZAI A;  2L9H A;  1KNA A;  3LX0 A;  4X3K A;  2F0O A;  2RQX A;  4CJ2 C;  1RD9 D;  4BA2 I;  2BOS A;  1QNU A;  3VYS A;  1TII D;  2ZT9 C;  4HMJ A;  1HTP A;  2MPM A;  5IGF A;  1C8C A;  1IW7 D;  3CU7 A;  5I6Y A;  1DOK A;  2A74 C;  3KBG A;  4PV1 C;  4DA2 A;  1Y8P B;  4A3B B;  4YIJ A;  2XSC A;  4M1U B;  4A3F B;  2HDM A;  2PNR C;  2Z1C A;  4O42 A;  1O7Y A;  5DNF A;  3RUZ A;  4OHJ A;  3NBH A;  4ODG A;  3KUP A;  2A6H C;  3K5O A;  3T51 B;  2J4X A;  1SE3 A;  2A69 C;  1LTT D;  1E2Z A;  3TP7 A;  3H6M A;  5FK9 C;  1BXT A;  2K5Q A;  4ZKC B;  3VYU A;  1CZW A;  2KQ3 A;  4FP5 D;  5JAV A;  1D6E C;  5D14 A;  1K83 B;  2XWJ B;  1ENA A;  2R3Z A;  2EYH A;  2Z4H A;  3I90 A;  1EZ8 A;  3MEH A;  2VB3 X;  3D8G A;  2Z8L A;  1IL8 A;  4N9T A;  2EYO A;  3L3O C;  3K5N A;  4L63 B;  3HOZ B;  1EY4 A;  2FIN B;  1CFM A;  2A6E C;  1V8Q A;  1U9R A;  4NW2 A;  1KDB A;  4KKU A;  1STH A;  1K8O A;  2JE6 I;  4FF3 A;  2EPB A;  2F0F A;  3R93 A;  4QUF A;  1R4P B;  1BCP D;  5EBC A;  1TS2 A;  2LMC B;  5C4Z A;  2KJX A;  5IGB A;  1ET9 A;  1PRT C;  1LTR D;  2A68 C;  4H44 C;  4XIG S;  1STN A;  2KCC A;  4QF4 A;  2WAQ B;  1SYE A;  1SYF A;  3WOF A;  1MI2 A;  1HUM A;  2J0T D;  2D5D A;  3VA7 A;  5CV5 A;  5C0X G;  3DXJ C;  3NXW A;  1A6X A;  3BVM A;  2B8F A;  4ZK9 B;  3D31 A;  3OPO A;  1PMR A;  1OXT A;  2L5T A;  3NTK A;  4DAY A;  2PZT A;  1C48 A;  3X3M A;  3MTS A;  3MWY W;  4ID6 A;  3I4L A;  2KEE A;  2DNE A;  4Z9C B;  1Z47 A;  2E2D C;  5CV4 A;  4FF1 A;  1Z7T A;  3IFD A;  3KLS A;  2AQ2 B;  2F0M A;  1O7L A;  1F77 A;  4QB4 A;  2SOB A;  2OXP A;  5D3I B;  1I4G A;  4C3J B;  2I07 B;  3P1H A;  3ERQ A;  1G91 A;  4IUV A;  3DMU A;  5ELE A;  4IUP A;  1RCV D;  2F0I A;  1CZG A;  1O78 A;  5ELD A;  2XVS A;  4IQZ A;  4MIU A;  4OIK A;  4KD3 A;  5JVG 3;  2B2V C;  3F2U A;  2YYZ A;  3TP6 A;  3W3A A;  2BCO A;  4KKS A;  1HRJ A;  2WAC A;  1GHJ A;  4B08 A;  2FHT A;  2X6G A;  2AWO A;  3A7A B;  1ENC A;  2F0K A;  2H1E A;  2NVX B;  3I4M B;  1DCZ A;  3KK7 A;  3S1M B;  1Y69 U;  1BR9 A;  2EJM A;  1UUP A;  1ONL A;  5K36 G;  3URY A;  4C3H B;  4IUR A;  2ZXR A;  1LTS D;  1R9T B;  3NK9 A;  1SFO B;  1I4X A;  5IOC A;  5M9O A;  2PO4 A;  4KJN A;  1EY0 A;  5M3F B;  3T56 B;  4KMU C;  3UI2 A;  4FVM A;  4DXG A;  1LT5 D;  3S1R B;  1QWY A;  2EZV A;  1EU3 A;  3PUV A;  1EEF D;  3K0Y A;  2NTT A;  3S9W A;  1K8M A;  3D4D A;  1LTA D;  3RD4 A;  3A7L A;  1T5X D;  3C1F A;  3H91 A;  4C1N K;  1WVL A;  1QG7 A;  3OHX C;  1GUO A;  2RSO A;  3OMG A;  4DK0 A;  4R8I A;  2Q8I B;  3QWN A;  1BCP F;  1SYB A;  3BS1 A;  1U4R A;  2F0Q A;  5M5X B;  2X69 A;  1TT2 A;  2EYM A;  4ZRZ A;  3G6J B;  4H13 C;  2C5C A;  5ELC A;  1PTO B;  2NN6 G;  4EVO A;  2AUK A;  5E1F A;  1TR5 A;  5FLX E;  2F0V A;  2PPB C;  1WTQ A;  3NTI A;  3GTP B;  3OIQ A;  1E0B A;  3FDT A;  4KI0 A;  2F0P A;  1KAA A;  2CW0 C;  2K04 A;  1MD2 D;  1WTP A;  1O7Z A;  5COY A;  3ERO A;  1HCZ A;  4DAV A;  1EY9 A;  4IN3 A;  5JEA G;  2IWH A;  1RTO A;  2NVY B;  4C3H G;  3R8B A;  1B50 A;  4S3S A;  3MXU A;  4KY7 A;  1M4V A;  3V2T A;  1H9S B;  3MXG A;  1EY8 A;  4KK7 A;  1JB3 A;  1A3T A;  5CBE E;  3M7G A;  3R2I A;  3NE5 B;  3FKI B;  2SEB D;  1G29 1;  1JC7 A;  3H3V C;  3R3O A;  1XTC D;  1HHV A;  3BDO A;  1I6H B;  1DM0 B;  2K5D A;  5BN4 A;  1EZ6 A;  5JVH 3;  1AFP A;  1JOK A;  2AWN A;  1I3Q B;  2FMM A;  1VMC A;  3T53 B;  4CKE A;  3HKZ B;  4HCS A;  1KLU D;  2LKV A;  3TP8 A;  1D5X C;  4PQX A;  5C6A A;  3FMC A;  1SNQ A;  1GJX A;  1CHQ D;  5CV7 A;  2K6A A;  2IL8 A;  4XDX A;  2R93 B;  4RH6 A;  5M5Y B;  4ZUJ A;  1SMY D;  1SDF A;  5E4W C;  4GZY C;  2B2V A;  2XIW A;  1SJE D;  1WD0 A;  2E2J B;  3GO5 A;  1VDZ A;  1II3 A;  4TSS A;  4DU9 A;  2F0J A;  1EY5 A;  4IUT A;  1TY0 A;  1JIC A;  5EPL A;  2B8G A;  4F87 A;  2NBF A;  1PZJ D;  3IL8 A;  2JA6 B;  1AP0 A;  4CJ0 B;  3S17 B;  3TME A;  5KYL A;  5IT9 E;  4R9W A;  5I9O A;  3KLS X;  4OO1 H;  1B3A A;  1BO0 A;  3MFG A;  4MN3 A;  1OXU A;  1DON A;  4LJZ C;  3S16 B;  2DY7 A;  4K2K A;  5DM6 3;  4FXG C;  1SNC A;  4FYD A;  2XRS D;  2B2U A;  4BY1 B;  3PIP 3;  3P7J A;  2RBM A;  4OGQ C;  4ABN A;  2F0G A;  4CJ1 B;  3S1Q B;  4XT3 B;  2WIN B;  1LT4 D;  2L12 A;  2JA8 B;  1Y1W B;  4ZYS A;  4WFN 3;  3E5S A;  3K5L A;  2JP1 A;  3DUZ A;  3CQZ B;  4RGM A;  5EPK A;  2A73 B;  1SJH D;  1PTO C;  4G7H C;  3AU7 A;  1JOQ A;  4J6H A;  1TS3 A;  2QDB A;  3I91 A;  2NYZ D;  3D6C A;  3GTJ B;  2EOT A;  1UAP A;  1SBB B;  4RWS C;  1SE4 A;  3T16 A;  4IUQ A;  3FRP B;  3SK6 A;  4FXK C;  1JWU D;  1S4Z A;  4F88 A;  4RGN A;  1TY2 A;  3H09 A;  4RHS A;  3J7A V;  1ICW A;  1D1I A;  4A3I B;  1MSH A;  3NQT A;  2K05 A;  1M8A A;  1SSO A;  3T13 A;  4X3U A;  2FJ2 A;  1KAB A;  3DWP A;  1LAC A;  4OO1 I;  3OSO A;  1CM9 A;  1ZXT A;  4HAE A;  1JR0 D;  3J80 E;  4C56 C;  1DYQ A;  2JA5 B;  2IW3 A;  1RJT A;  2RSN A;  2EDG A;  1WCM B;  3M3Y B;  1G6Z A;  2BA1 A;  5A2Q E;  3CRK C;  5BN5 A;  3HP3 A;  3TBI B;  1RF2 D;  2EXZ A;  4PMC A;  2SNS A;  4V19 0;  2B2T A;  2ZXP A;  4HSV A;  3HOW B;  5I6W A;  5KNB A;  2F3W A;  3HOY B;  2NN6 H;  2RDG A;  3D4R A;  5IT9 L;  1F2M A;  3QOL A;  3MXN A;  4KV6 A;  4DNT B;  2NVT B;  4HMI A;  1HQM C;  2G9H D;  4PNY A;  4HTH A;  2WKC A;  1I4P A;  3SK8 A;  3W2D A;  2VXW A;  5KRU A;  3TSS A;  1EWH A;  3Q24 A;  5JEA H;  1B1Z A;  1A3U A;  4OIJ A;  4IFD G;  3M4Y A;  4K5X A;  5CV8 A;  3VYR A;  2F3V A;  4P2C B;  4NKL A;  2IPK D;  1WTO A;  3OOC A;  5ELB A;  4KTA A;  1WTR A;  1JQY D;  5FO7 B;  1Q1B A;  1SE2 A;  3DHQ A;  4KJO A;  2A69 D;  5IOD A;  3FPU B;  1R4Q B;  3D4W A;  3WOE A;  2F0D A;  4QUC A;  3BDC A;  2O5I C;  5C3W A;  4A3J B;  1SNM A;  4DF7 A;  3I73 A;  4HR7 B;  2F0T A;  3MVV A;  1YNJ C;  2DY8 A;  3A8I E;  2QCP X;  5K5P A;  2WII B;  4XQJ A;  4PMB A;  4K8J A;  1W6J A;  4KY5 A;  2EJF C;  3SK5 A;  5JJZ A;  4HED A;  2DNC A;  2O2L D;  3K57 A;  1DZ1 A;  2K1B A;  1TWF B;  2WV6 D;  4F7X A;  1YNN C;  3SK4 A;  4H0L C;  4IUN A;  4KN7 C;  4RCO A;  3SHL A;  1GXD C;  5KNC A;  1EYC A;  1NR4 A;  4FNF A;  4AYB B;  1G2S A;  1A2T A;  1STY A;  5M3M B;  4HCE A;  2A6E D;  1PZK D;  1HUN A;  3DM1 A;  4K14 A;  5E4X A;  3V96 A;  1V43 A;  3OWF A;  3J80 L;  3TDQ A;  5EGT A;  1IYV A;  2MGS A;  1DD2 A;  5CBA E;  5CYU A;  1JWM D;  4RHR A;  3A8J E;  4JK1 C;  2RA4 A;  2H4O A;  1HTL D;  1JOR A;  1HXY D;  1F9P A;  2EYP A;  2A68 D;  1CQF A;  1CK1 A;  1GUW A;  5JEA J;  3DWQ A;  4MHE A;  4RGT A;  3NQI A;  1ILP A;  2F0N A;  1E2W A;  2EE1 A;  1FNW A;  1TS5 A;  2WKD A;  4KHZ A;  2BE5 C;  2EYL A;  4RCN A;  1H9S A;  3SEB A;  2OT2 A;  4J8Q A;  1A15 A;  5D65 A;  4K5W A;  1H9J A;  5C5M A;  2VB2 X;  1MBY A;  5FO8 B;  1CI3 M;  1LLR D;  3I4N B;  4B9W A;  1PLF A;  3Q0A A;  2CQA A;  4O1N A;  5ELF A;  2MHV A;  2F0U A;  3A55 A;  2EY6 A;  1J9O A;  3HG9 A;  2XRQ D;  2M9V A;  3Q23 A;  3EQL C;  1ILQ A;  1STE A;  2JXM B;  5I2Y A;  3H94 A;  2B2U C;  4JBW A;  5EQ0 A;  1I4Q A;  1BOS A;  1QOH A;  3MHB A;  3I72 A;  3QJY A;  1RHP A;  2B63 B;  2NZ1 D;  4K5V A;  4RA8 A;  3FVQ A;  4RFB A;  4BBS B;  5NUC A;  1F9R A;  1U4P A;  3VR5 A;  5CGK A;  2K03 A;  3CHB D;  4A3G B;  1BNZ A;  2QIL A;  4C3J G;  5I2X A;  4LAA A;  5FKA C;  2BA0 A;  4Q0F A;  2KVM A;  2PZW A;  3G7L A;  1VF5 C;  4RKB A;  3JAM E;  3EA6 A;  1KDA A;  1JOO A;  1TS4 A;  3K58 A;  2RDF A;  1B9M A;  5IGD A;  1QNK A;  2RKS A;  3QO2 A;  3A56 A;  1BF4 A;  2JYO A;  1SYD A;  1ML0 D;  5KYI A;  2D2C C;  3C3L A;  1RTN A;  1I4R A;  1Y1V B;  4G57 A;  5CR3 A;  1XWE A;  2ZXO A;  2I46 A;  4CKC A;  5EKL A;  2F03 A;  4BS9 A;  1I50 B;  1PZI D;  1RDP D;  1QJO A;  4RAU C;  3U9O A;  3LNN A;  4QMG A;  1V1O A;  1PFM A;  1PDQ A;  1CQV A;  4X3S A;  1GOZ A;  4PMW A;  3PUY A;  4EQN A;  4QIW B;  3S1N B;  3GP7 A;  2PMZ B;  2AQ3 B;  3T4A C;  2RVL A;  5JOB A;  3KF8 A;  3PV0 A;  4E6I A;  4G7Z C;  2JA7 B;  2E75 C;  1BUV T;  1XXG A;  1S5C D;  4C3I B;  3AMU A;  1EL0 A;  3K59 A;  2M2L A;  4IFD H;  2OF1 A;  4K6L A;  3R2T A;  3VA5 A;  2DN8 A;  4EQP A;  1EWC A;  2EJG C;  2B2T C;  5LL6 X;  1AW7 A;  2R6G A;  4FXD A;  1GUT A;  2CHB D;  5IGC A;  1Y8N B;  1EU4 A;  1LTI D;  2BDO A;  2E74 C;  1BCP B;  3NUC A;  2A5H A;  2CW0 D;  3K5M A;  5I9P A;  3GTQ B;  3E6Z X;  1SNO A;  5J39 A;  4N9P A;  3X3N A;  5I4D A;  3CKI B;  1HFG A;  5M5W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...