1RD9D

Cholera toxin b-pentamer complexed with bivalent nitrophenol-galactoside ligand bv2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords cholera toxin B protein (CTB)
publication title Nonspanning bivalent ligands as improved surface receptor binding inhibitors of the cholera toxin B pentamer.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 25
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rd9D00
2IPKD 2RDGA 1LLRD 1LTAD 4L6TB 1LTBD 4RGTA 4RCOA 1EWCA 1LT3D 1L0XB 4RGOS 1KLGD 1DYQA 3R2TA 1DJRD 1TS2A 1TY0A 3BZDB 2ICIA 1B1ZA 1CK1A 4K6LA 1TS4A 1UNSA 1V1PA 1SE3A 1ET6A 4Z9CB 1BCPF 1CHPD 3DWAA 3BYTB 1AN8A 1S5ED 1JCKB 4BWGB 3SEBA 3R8BA 1I4QA 2WV6D 3BYYB 1M4VA 2NTSA 1BCPD 1EEID 3EA6A 1LT5D 2NTTA 5TSSA 3V05A 1S5BD 5ELEA 1SEBD 2SEBD 1ESFA 1LTID 1PZID 1XXGA 1F77A 1HA5A 1ET9A 1LT4D 1V1PB 2IJ0A 3DWQA 4OHJA 1SBBB 4RHRA 1S5DD 3KLSX 1CT1D 2Z8LA 2RDHA 3BVMA 1PRTF 1V1OA 1D5ZC 3MC0B 1I4XA 1RCVD 1BCPB 1AW7A 1FNWA 2O2LD 4UDUC 1PRTD 1I4PA 2TSSA 5FKAC 4RFBA 5FK9C 1LTGD 2QILA 1LTTD 3BVGA 1HQRD 3MFGA 1STEA 1LTRD 1RDPD 1SJHD 1SE2A 4RH6A 1D5XC 1UUPA 4RGMA 4DXGA 1JWSD 1B44D 1FNVA 1RF2D 1SJED 3URYA 1PRTC 1KTKA 2XRSD 1HXYD 2CHBD 4DXFA 1LT6D 2XN9C 1L0YB 3W2DA 2AQ2B 1I4GA 3TSSA 1BCPC 1FD7D 1MD2D 1PZKD 1I4RA 1PRTB 3EFXD 5ELCA 3GP7A 1ENFA 3DWPA 1LTSD 3R2IA 2R61A 1LO5D 1TY2A 1D6EC 1EEFD 2XNAC 2AQ3B 1PTOF 3O13A 1G8ZD 3OWEB 2XRQD 2AQ1B 1KLUD 1HTLD 5ELBA 1PZJD 1SE4A 1JQYD 1PTOD 2G9HD 4ZYSA 4O1NA 1FNUA 3BVZA 1FGBD 1I4HA 4RGNA 5D3IB 1JR0D 1PTOH 1JWUD 1S5FD 1EU4A 1QILA 1SXTA 1GOZA 2QEJC 1BXTA 1TS5A 1CHQD 1PTOC 1EU3A 1JWMD 5ELFA 1EFID 1D5MC 4TSSA 1XTCD 1S5CD 5D3DA 4C56C 4RHSA 1PTOB 4L63B 1CQVA 5I4DA 1T5XD 2J4XA 3CHBD 1RD9D 5ELDA 1TS3A 1PYWD
chains in the Genus database with same CATH superfamily
3HOWB 3K57A 4POFA 3OIPA 4HJ8A 4X66L 1RHPA 3QJYA 4X62L 1YVCA 2HQEA 1HUNA 4A3JB 1L0XB 4RGOS 1PH9A 1XYIA 2AHOB 3BZCA 2OTJA 3VR4A 1HPCA 3RZOB 4A93B 2E74C 1HNXQ 2BE5D 4HJ7A 3C46A 1SRUA 2R7ZB 2JA9A 3CCEA 1QCBD 1BVSA 1P8LA 2F0MA 4KN7C 4IPHA 4A3FB 5M3MG 3K58A 2B8FA 3Q6SA 3P7JA 4DV1Q 2F0FA 5ELEA 3JAML 1ESFA 2B63H 1KDBA 4BY7H 2OT2A 4KKTA 4GLVB 1NY4A 4LF8L 2HDLA 1VQ4A 1SR3A 3CAMA 3MC0B 1HNZL 1HR0W 2PPBC 2MPMA 2O2LD 4DR1L 4DU9A 4A3CG 3CP0A 3MVVA 2K1BA 4R4CA 2ZJRA 1QJOA 4DK6C 5AJ3L 1FNVA 1SYFA 5C44H 4FYDA 4X66Q 4X62Q 4BA2I 2NVYH 1A3VA 2F03A 2EYLA 1HZ9A 1GUWA 4HCSA 2PZTA 1WCMG 3J7AV 1DZ1A 5ELCA 3KJOA 1D1KA 4CBVA 3RLOA 2R61A 2ZTEA 3OWEB 1PTOF 1QUQA 3F2CA 1X32A 2DUDA 3V2TA 1LACA 4N9PA 1RODA 1U4MA 4DV6L 5EQ0A 3JAMc 4QGUA 2E2DC 1TS5A 3MZ5A 3VR2A 3OMCA 3HOVH 4LF8Q 1K3RA 1S5CD 4RCNA 1IHZA 3HZXA 1B53A 1T5XD 4A3MB 1K8AC 4J1MA 5D14A 5CV6A 4DR1Q 1Y1VB 4LFBQ 1Q7YC 1GUTA 2F0TA 3VYUA 2E2IB 1ZYRC 5CV7A 4QL5A 4X6AH 2BH2A 2O5JC 3PO2B 1AEXA 1DJRD 1UE1A 3N52A 4HR7B 2OWOA 2HDMA 4J6HA 1IYUA 1QG7A 3J7ZC 2F0WA 1VQGA 5GAGC 5IGDA 1PYBA 3PIO3 4BY1H 1WOCA 5GADC 1VQDA 1XMQQ 3CCVA 4KD3A 1BNZA 1SEBD 1NMFA 5IIFA 1PYSB 4GKJL 3J80L 1F77A 1HA5A 4DV6Q 4C1NK 2VY3A 4IOAA 3KBGA 4RHRA 2DN8A 1N9WA 3GTPB 3FDTA 1V1OA 2IX1A 1VF7A 2R92B 5EKLA 1C7YA 5C4ZA 4HN7A 4GKKQ 2JQOA 3PMFA 4QY7A 2SNSA 3D6WA 3NE5B 5IP9H 1HUMA 4YWKA 1MI2A 2EOTA 1STEA 2L12A 4NKLA 5FO7B 3OW2A 3E3XA 4EQOA 2EY1A 3C1EA 3VA5A 4LJZC 1HXYD 3PO3B 1G2TA 2NWGA 4C3HB 2Z6KC 4X3TA 1JMCA 5CYUA 1KRSA 4CJ2C 4JG2A 4OIJA 1ENFA 2BDOA 1W2BA 2PQAB 4TRDA 3FP9A 4ABNA 5CGKA 4GOPA 1TWCH 2I5HA 1PZJD 1TT2A 1B4OA 3ONAB 4KY6A 4CDEC 4IPCA 4QF4A 1IBKL 3NUCA 2E2HH 1IYJB 1TWFB 1N34L 3A8KE 1WTOA 1A8VA 3TP8A 5FLXL 3BJUA 1Q8KA 4IALA 4PV1C 4A3JG 4GKJQ 1JJCB 3DEOA 2F1MA 3J80c 4JI5L 4A93G 3WOFA 3UDGA 2PNRC 5FJ8G 2EJGC 1IL2A 1XTCD 4BBRG 4GNXB 4LUVA 2JSOA 1EQTA 2D9UA 3CRKC 3F1ZA 4A3FG 4JBJA 4LF9L 4HMIA 2RCNA 5C5MA 4EQPA 1VMPA 5KNBA 4AQYQ 2D2CC 2R6GA 1QNKA 3HKZB 2IX3A 2B2VC 2K5HA 2PYKA 2R7DA 3HOZB 1U4LA 3S1RB 4CKEA 1QVCA 2NB0A 3GTKB 4R9WA 5C5LA 1B50A 3KOJA 4KLKA 1UNSA 3NBIA 3H3VI 1Y1WB 1L0WA 2ZM6L 1V8QA 2OEOA 1DD2A 3FKIH 2NTSA 3M85A 1DCZA 2BE5C 1SYDA 5JEAG 2BOSA 2B2WA 3T1YL 4GLXA 1CA5A 1J5EQ 5FLXc 2RCFA 3DWQA 1EY4A 1CT1D 2PI2A 1ICFB 3ND8A 1TVXA 4DF7A 1Y8NB 1DOLA 2K6AA 1RCVD 1BCPB 2KHIA 4NB3A 5FKAC 2Q8TA 1HA6A 4XYQA 2QILA 1ESRA 1R9TB 2KHJA 1A63A 2PZWA 1YNXA 4IJLA 1FJGL 4M8AA 1W3SA 3CRLC 1L1OB 2RVLA 3PUWA 4LF9Q 1KTKA 1UEBA 2RSOA 1LTLA 1ILPA 3KFUA 4IOCA 1I4RA 4DV7L 1O7ZA 4RKBA 3K81C 5I9PA 1TY2A 3NTKA 4DV4Q 1WTQA 1WTPA 2ZM6Q 4HJ9A 1SE4A 1SNDA 4A3MG 3TP6A 1Y1VG 4ZYSA 5IT9E 2OXPA 4DKAC 4HJ5A 1SNQA 1JE4A 1NCVA 3W1BA 3T1YQ 4RWSC 3M9BA 2K14A 4IUQA 1JJ2A 2FHTA 4LAAA 3SK6A 1H9MA 5EPJA 4CDFC 2EJFC 4A3KG 2MHVA 1CHQD 4JI0L 1U0LA 1E3PA 1EU3A 2E2JB 3PF4A 5ELFA 4ODGA 3PV0A 4ZK9B 2JXMB 3F8TA 1YEZA 3X3MA 4Q5VA 3A5UA 3K0YA 1EZ6A 3DM1A 5M3FG 2EYOA 1E7ZA 2EVBA 3CHBD 1JT8A 1PV4A 3S17H 2NVQB 1VMCA 1STAA 2OTLA 4JW0A 3HKSA 4NW2A 4PZ6A 4YHHL 1GUGA 5IP7G 1XMOL 3HG9A 4PMCA 4RCOA 4GNXA 1FJGQ 4KJNA 2HCCA 5DNFA 4DNIA 3E0EA 2A69D 3HOXH 4B3ML 4LF5L 4K6LA 2LKVA 4O42A 1JOKA 2F0VA 1PH7A 1YHAA 1ML0D 5IYCG 4DV7Q 1V1PA 4IO9A 4UP9A 3S2HH 2A8VA 4A76A 1J9OA 1E2ZA 2R92G 2FMMA 4JBWA 3GTOB 2IT1A 1GO3E 3CCRA 1I4QA 1HR0L 1M4VA 1BCPD 3IFDA 1X56A 2EXDA 1I5FA 5GAHC 1I94Q 4LF6L 4DAPA 3I3CA 4QB4A 1Y8OB 2K52A 1T5EA 3PO3G 2EXZA 5ISRA 1X3FA 1KC8C 2M00A 4PZ8A 4EX5A 3H0GB 2N8NA 5IGGA 5JVG3 2R7FA 1MJEA 4JI7Q 4ZKBB 3BVGA 1SFOH 3CPWA 3E0JA 2UXBQ 2MGSA 4A75A 1JICA 1VQLA 1GHKA 4OIKA 4PMBA 1D5XC 1GJXA 2CFMA 2EZVA 1TQOA 1QB5D 3GO5A 1CZWA 3HOWH 5M5XB 1AZQA 1A3TA 2N88A 4TVAB 1IBLL 1PRTB 3BDLA 4O0AA 5JJKA 2UU9Q 3A7LA 5GAEC 1LO5D 1F2LA 2KCTA 3K7AH 3QB3A 5M3MB 2ES2A 4A93H 2UXDL 1YHBA 2LXJA 5C4XH 5IYDG 5CC4A 1HZAA 1JQYD 4XTCS 2R7ZH 4R4TA 3PUVA 3BZKA 3ULLA 1UE7A 1CTMA 1RJTA 1SMYD 4LF6Q 1PTOH 5IGFA 2KENA 1MIUA 1EU4A 2D62A 3HKZG 4JI6L 2WACA 3HOZG 3IKJA 4ZCKA 3GTGH 1N36Q 4L63B 5CV9A 1Y1WG 4IFDH 1M8AA 1TWHB 5CBEE 3G6EA 5C3EH 1PYWD 4XXEA 3J81L 1CA6A 2I5LX 2VB3X 1LTBD 1RTNA 1F2ZA 2EYPA 1HHVA 2NN6G 2C9OA 1PXUA 3KYHC 2YU9B 4N9TA 2R93H 2KCCA 1WCMB 1WTVA 3NWTA 3G71A 1Q81C 2K04A 3AU7A 1F2MA 3KBXA 1C8CA 4CKCA 3D3RA 2A19A 3M7GA 1I3QH 1CHPD 4BXXG 5EAYA 3BYYB 5JPNC 3GTQB 1WTWA 2BH8A 2EIFA 3V05A 3STBC 3NSWA 1G291 2A68C 3D31A 1ET9A 4R8IA 3S1MH 1BOSA 2HCIA 1BBWA 2K33A 1LUZA 5M5YB 3KF8A 2FJ2A 4IN3A 1PFSA 3U58A 4EQNA 4UDUC 1OXUA 1PRTD 4UP7A 1I50H 4OWWB 1EY6A 4HAEA 4O2DA 5EBCA 3VYRA 3J81c 3J7YW 1X6OA 3URYA 2JA6B 2E8GA 2JA5G 4KY5A 1IZ6A 4X64L 1U9RA 3HFZB 2E2IH 5ELOA 4DAYB 1I6VC 4ME5A 3PO2H 2D0PA 2JEAI 3QG1A 3IRBA 3O13A 1UEAB 2UXCQ 3K7UC 4FO2A 1VS0A 2Z9HA 4A3IB 3NQIA 4P71A 3MXNB 3J7A5 2CH4W 3BVZA 1FGBD 1VQFA 2B2TC 3MAQA 4CJ0B 1KDCA 1SXTA 2QEJC 3S1QB 5T1IA 1E24A 2RBMA 2KCMA 1QUQB 3A8JE 2ENBA 3E6ZX 1FYCA 2B8GA 1KHIA 2PO4A 1XNQQ 4B3TL 3SDZA 2PW7A 1ENAA 4OWXB 4DV1L 3GTPH 2IPKD 2RDGA 3BU2A 4RGTA 2PMZB 1H9SB 3HEJA 2A6HD 1WD0A 2JK8A 4Y7NB 1VQKA 1SLJA 3EVQA 1X3PA 2XIWA 5LL6S 3SXHA 3OTOQ 1CK1A 4X64Q 2QA4A 1Q1BA 2RA4A 1YIJA 3S15B 3LX0A 4KTAA 3H15A 1EFWA 1VQ5A 1JOOA 4C3HH 4RAUC 3H0GG 1NSNS 3DWAA 1JCKB 2I46A 3I73A 3LNNA 1DONA 1LYLA 2EJMA 4X65Q 5CR3A 3CPFA 3RLFA 2KHSA 3AQQA 1KQSA 2MO0A 3DMUA 4OX9Q 1S5DD 3KLSX 4LUZA 1Q86C 3K59A 1JE5A 3AYHB 2PQEA 4BBRB 2HHHQ 1AW7A 1VQ9A 4A3DH 4Y52H 1TR5A 5KEEA 1X3EA 3SGIA 1Z9FA 2LFNA 1L1OC 4DV2Q 4B3TQ 5BR8Q 1XJVA 1LTRD 1FL0A 3GDEA 1SJHD 2X69A 5K5PA 1SJED 3I4NB 3S1NH 1WTRA 4DXFA 2WB1B 3WWVA 2JA8H 1TWGB 4P2CB 2UUBL 2RF4A 3BDOA 3S9WA 4LFAQ 1VQ7A 4P72A 4U68A 2JA7B 1Q90A 5JVH3 1VQNA 2M9VA 2XNAC 4CJ1B 2MQHA 1G8ZD 4LFBL 4C1NI 5IWAL 3S1RH 1I6HB 4DAYA 4G7ZC 3KLWA 2I5MX 4FF1A 5K36H 3QWNA 2O5IC 2VQFQ 2XVSA 1SYCA 3TQYA 4K0KQ 3FVQA 3MXNA 3RN2A 1PFBA 3ICEA 2CQAA 5CBAE 1D2BA 4GOPB 1EQQA 5FLMG 2EYMA 4TSSA 4DR4Q 4GS3A 1SMYC 3RNUA 4A3BH 4JVZA 3KDFA 5I4DA 1HRJA 1VQBA 1RD9D 5HGQA 3DLLA 3G7LA 1XMQL 1JB3A 1KAWA 4PZ7A 5L37A 4YIJA 3AB9A 4HSVA 4G57A 2B2YA 3ZYYX 2VUMH 1B3QA 1MKHA 1DYQA 2V4DA 1F9PA 1GD7A 4KHZA 3MEHA 3BDCA 2Y0SB 4OWTB 1DM0B 2B2UC 3A56A 5M5WB 4YY3Q 4KY7A 1H9SA 2UUBQ 3GTLB 5C0XI 4GKKL 5IODA 4RMFA 5LL6X 4K2LA 4QQBX 1S5ED 2DY8A 3SEBA 4HIDA 1YI2A 2GA4B 3DXJC 3PIPA 4P74A 3SK4A 5IWAQ 4XT3B 4OGQC 3GTJB 1VCIA 1HQMC 1IXRA 1C0AA 3ZJYC 4LUOA 2SEBD 2KOLA 4MTNA 4L8JA 4C3IB 2JA6G 2NZOA 4A3KB 4I65A 1GM5A 1YITA 2XTIA 4QIWB 3TZUA 2AUJD 5IY0A 3S14B 4HIKA 5DLQE 5IYBG 2VXWA 3BVMA 1AE2A 1Y8PB 1V1QA 1U5KA 3NQTA 2CW0D 5M3FB 5BN3A 2K03A 1GHJA 3CCJA 5FK9C 3M4OB 3A55A 4A3IG 1RDPD 2KECA 4K8JA 5AFWA 3HOYH 1T9HA 2K5WA 3MFYA 5H1SE 2F0SA 1EYGA 3RN5A 1EY9A 1PRTC 4NDXA 1VDZA 1WFQA 4R4IA 4AYBB 1J8IA 2H1EA 4LF7Q 4DR6L 3TSSA 3EFXD 4KKSA 3RZDH 1QE6A 5DEHA 4DK0A 2K28A 2V1CC 3OPOA 1EIHA 3NBHA 5ELBA 3HOUH 5C3WA 1M90C 3KF6A 1B9MA 1UAPA 2PMZE 1Q3LA 4AQYL 4A3EB 3EN2A 1S3OA 5D3IB 2A6ED 2JYOA 3AEVA 1Q1EA 1A62A 4FXGC 5EKKA 3MXGA 1ZEQX 3B6YA 4HCEA 5C0XH 4B9XA 1YNNC 2IL8A 4JI8Q 4ZKCB 4H13C 5EGTA 2VW9A 4P75A 5E1FA 3K6OA 4RHSA 4BBSH 1QVFA 1IW7C 2F4VQ 1TIID 1K0RA 2Q2UA 4OO1G 2FINB 4LWCA 4WFN3 1J5EL 2K05A 5C4JB 2DY7A 4NXML 2WAQB 2ICIA 3NELA 5LMNW 4DR6Q 1KRTA 1N32Q 3OWFA 3ND9A 1SYGA 4A3LG 1BBUA 4AH6A 2IW3A 2ZTDA 3S2DB 4WRDA 4BWGB 1GKHA 3M4QA 3EA6A 3TS0A 1MBYA 1LT5D 2A5HA 2H4OA 4E6IA 1KDAA 1U4RA 4JOIA 3A54A 3CMEA 2WB1E 5M3MH 3ERSX 1V1PB 1OXXK 1GUSA 3I4NG 3C2PA 1YHQA 5NUCA 2WB1G 4IFDJ 2OQKA 4JV5L 3I70A 4DFAA 5JAVA 2RDHA 4AIMA 3ERQA 4DV4L 1K8GA 1BBXC 1Y69U 2B63B 4BY7B 3AMUA 3GV6A 1A2TA 1KL9A 2JA7G 5IOCA 1B70B 1VQMA 2L11A 2ZXOA 3RMHA 1E2VA 2EDGA 3F2BA 4A3CH 2CHBD 4IUPA 2XN9C 4DV3L 4R4QA 1MD2D 1Q46A 4NXMQ 1JORA 3W1GA 1SAPA 3D6CA 1LTSD 3QIAA 1CKOA 4H0LC 4G7OC 4L5TA 2RHQB 1O7YA 5C44B 2DJFC 4KD4A 3GTMH 1WCMH 1HFNA 1HTLD 1KLUD 3I91A 2JE6I 2Q8RE 4K8IA 3CXCA 1D8LA 1OXTA 2SDFA 1PH6A 4NXNQ 1STGA 4A3GG 4OELB 1YBYA 1QILA 3H94A 1IKMA 1VQAA 4PMWA 3U9OA 3ULPA 5A2QE 1VQIA 3PIOA 4FVMA 2B29A 4MZ9A 3ER0A 2EE1A 4KHVA 5FO9B 2Y0SG 2MP1A 4JV5Q 1YZ6A 2EY5A 4R8NA 3NHHA 4JPBW 1QZHA 1CZGA 2EYFA 3JC66 4DV0Q 5ELDA 1STNA 1I94L 5M5YH 3P75A 1LLRD 2F52A 3OW7A 3U50C 3HOVB 5JJIA 3I90A 1STHA 2JA5B 2A73B 3NEMA 2EY2A 3FMCA 1RKNA 1AE3A 2F3WA 1TS2A 4C3IG 1F2YA 3BZDB 1KXLA 2YTXA 3LWEA 4DV3Q 4X3SA 3QO2A 4R4OA 4B3SQ 1IYVA 1R4QB 3I55A 1BCPF 4PQXA 3BYTB 1XTDA 2JP1A 4JI7L 1EUJA 4FF3A 2NVTH 2UXBL 4IZ8A 4DA2A 4HJAA 1CQFA 4TQUS 2NTTA 2PI2E 3SE0A 5IGCA 2VS1A 3I4LA 3KLRA 4BA1I 2E5LQ 2Z0SA 2VQEQ 1STBA 3CD6A 2HIXA 4FXKC 4F8MA 3VYSA 4BY1B 1KIXA 4AYBG 2UU9L 4DUZQ 1NE3A 1HNWQ 4MHEA 1M1KC 3I7FA 2AWNA 2Q2HA 4ZRZA 5C4HA 2K7VA 2F0OA 4LW1A 3Q22A 4V190 4LF4Q 1LTGD 5CMDA 2Z6BA 3L2PA 5J1ZA 1AH9A 3S16H 1XX8A 3QR8A 1CKNA 4JCVE 4IFDI 4MN3A 2K01A 5DM73 1Z6HA 1WI5A 2E76C 1F9RA 3KUPA 5T1GA 3TP5A 3KF8B 4A3EG 3NWSA 3CCMA 3T53B 1W6KA 1K28A 1B3AA 1NAPA 5CV4A 1I4GA 3TN2A 3U4ZA 1N36L 5LHY1 1VQCA 2L5TA 5A35A 3DEPA 3VYTA 4CKBA 5IE8A 5G3LD 1ASZA 2RQXA 1PDQA 4G4KA 2DNCA 5J22A 3Q24A 1UE5A 1XPOA 4R1JA 4RKLA 4I7ZC 1OTCA 3WDNA 3CCQA 2WAQE 3NK9A 1K83H 1HFGA 1EYDA 4FF2A 1TWCB 2NZ1D 3NENA 3E9HA 1JWMD 2WAQG 1VQJA 1SNOA 1SE8A 5KYLA 3AFPA 4YCUA 4A3JH 3VDYA 2F0KA 2D0OA 4EQ5A 2J4XA 3U9SA 3RZOH 2F0UA 2WP8J 1TS3A 4NMZA 2KVMA 5FJ8H 1YJWA 2ZXPA 1HZBA 2F3VA 4BBRH 3HKZE 1E1OA 1X55A 1LT3D 4HEDA 4JYAQ 4A3FH 5I2YA 1KABA 5IGBA 2F0DA 4GN5A 4IUUA 2C5CA 1AN8A 3CW2C 2B63G 4BY7G 2MJ8A 5CV8A 3R93A 1YJNA 1WTHA 2EPBA 5TSSA 2CKZB 1ZXTA 1K8MA 4HMJA 5JEAH 1RIPA 2IHFA 2JEBI 2WIIB 2AKWB 1SBBB 2B2WC 3FKIB 1HTPA 1HZCA 1IBMQ 5HY6A 1JOQA 4F88A 1PRTF 2FFKB 1D5ZC 3VR6A 5IT9L 5J3BA 5E7NA 2YYZA 2K5QA 4UPAA 1FNWA 2RHSB 4XIGS 1Q82C 1K9MC 3UE1A 4CGYB 1I4PA 1VQEA 2F0QA 2UXCL 4RFBA 5C44G 4GN3B 3MFGA 4B9WA 1TKWB 3K5OA 3H09A 2L15A 2TMPA 1H9KA 3MXUA 4KK7A 4J15A 3L0OA 3VR3A 3MXPA 2ICEC 2IX0A 4UP8A 4FP5D 1FD7D 2LXKA 4UHVA 1MSGA 3NPPA 3JAME 1ZYRD 1U4PA 1PMRA 1XNQL 3OOCA 4F87A 4A4IA 1NNXA 1ILQA 1EEFD 4B3RL 2VNUD 2XRQD 1S72A 4JI3L 4U673 3HP3A 5M5WH 5CV5A 3P20A 3DM3A 1VQPA 1NR4A 1DOKA 5BN5A 3K5MA 3ITPA 4RGNA 3HOVG 2WKDA 2BA0A 2KEEA 2UUAQ 1B8AA 4POGA 4A3MH 3KLSA 3PF5A 4UAIA 4X3KA 1Y1VH 4ZUIA 3OTOL 3GTJH 3G6JB 1C4QA 3D4WA 2SOBA 4ID6A 3I4OA 3L3OC 4HIOA 1CQVA 4A3KH 5LMNL 4DR7L 1LABA 2OQ0A 1EOVA 1N8RC 5EJWA 3T16A 3UDIA 1XNRQ 4DV5L 4X65L 2QCPX 1EIGA 2RSNA 4WJ3M 2KCNA 5M3FH 4C2MB 4ALPA 2LS01 4OX9L 1FGUA 2J7ZA 3KDFB 3NXWA 1CSQA 3S17B 3D4RA 5IP7H 2N55A 4GNXC 2MUYA 4BY1G 1G6ZA 4QUCA 2HHHL 3M7NA 3T1HL 3I72A 2VB2X 3OYYA 3AFQA 5KGUA 4QCLA 4DV2L 1HCZA 5BR8L 1EIFA 4ILWA 4DR3Q 4K5VA 3G4SA 4B3RQ 2CWAA 2BA1A 1KNAA 1UE6A 5IYCH 4JI3Q 4GZYC 5C0XJ 1S5BD 2R92H 3D4DA 1EY7A 3S2HB 1LTID 2NUCA 1PZID 3V96A 1NBWA 1X54A 3PIP3 1K0SA 2F3IA 2AWOA 2I0QA 5IP9G 4DR5Q 4FNFA 3RLNA 4LFAL 1CUKA 1G6PA 2C35B 3PO3H 4TKOB 3CMAA 2ZJQA 2ZXRA 3FHWA 2NN6I 2A69C 2AMCB 5LMNQ 4DR7Q 1HQRD 2EYHA 3K0XA 2Z6KA 1MHWC 2VQFL 4DV5Q 4MTKA 4RGMA 1EY0A 2K5VA 2P5ZX 4L5SA 4K0KL 1PFMA 2XRSD 2ID0A 1PH4A 2CVRA 1ASYA 3FPPA 1SDFA 4HSPA 1SFOB 1BCPC 3I2ZA 4IUTA 4DR4L 4BS9A 3DWPA 1TWFH 4IURA 5JJLA 1EYCA 1PVOA 2N78A 1EWIA 1ICWA 3J80E 2AQ3B 3T1HQ 5I9OA 3JAMi 1RL2A 1ENCA 3M4YA 4Q0FA 3RUZA 3F2DA 2UUCQ 2PZUA 2ATWA 4WJWA 2QDBA 2RDFA 3S2DH 3K7AB 5IYDH 4XQNA 3PQIA 5C4XB 3C3LA 1KD1C 3PO2G 4YY3L 4OL7A 3NBHB 2RKSA 4CDDC 3KF6B 2Z1CA 4XQJA 1PTOB 3TDQA 4DUYQ 3HOZH 1X65A 2B2VA 3E9IA 3GTKH 2QDLA 2N49A 2CQOA 4ZUJA 5FOBB 3GTGB 1BKBA 1Y1WH 1EWCA 2CH4A 1XWEA 2OCEA 1K73C 5C3EB 1B1ZA 1FR3A 3FKIG 3HRZC 2NN6H 5FLXE 4C3JB 4JBKA 4Z9CB 4JI1L 4KN4C 5ELNA 1VQ6A 2XWJB 1TWAB 3R8BA 2R93B 1SSOA 2F0GA 2DGYA 1VQ8A 3VR5A 4BXXH 3IL8A 4K5WA 4A3GB 1N33L 3MTSA 1I3QB 3TZDA 3A0JA 5COYA 4LF7L 2IJ0A 1R9TH 1II3A 4H44C 2VZAA 1YJ9A 3R3OA 2TSSA 3S1MB 3W3AA 4K5XA 4OEMB 3CU7A 2NVXB 3SK8A 1EY5A 5EPKA 1X9NA 3GQBA 3PUXA 3QOLA 1QNUA 1I50B 1L0YB 1A6XA 4XYOA 2AQ2B 5DM63 1PZKD 5D65A 4JI8L 4EGVA 3L9AX 1PH5A 2JA5H 1OXSC 1H9RA 3R2IA 2R3ZA 3IAYA 3LWUA 1HNZQ 4LK1C 1MSHA 2VL6A 4YCWA 5E4XA 4JI1Q 2IY5B 2F4VL 1V43A 1Z47A 1STYA 1G51A 1AZPA 1PTOD 3J80i 1PHJA 2E2JH 4EVOA 3FPUB 1I4HA 2HIVA 5AJ3Q 1EQVA 5GQOA 4V0BA 4LFCL 1S5FD 2HD3A 1GOZA 3NTHA 1N33Q 1BXTA 2NVQH 1O7IA 3TEHB 2D5DA 3K8AA 1N32L 1BR9A 1YNJD 2EY6A 1EQRA 5C6AA 5D3DA 3T4AC 1HH2P 2F0JA 2L55A 3M3YB 1JJGA 4LMQD 5JOBA 3EJIA 3HOXG 4L6TB 3EROA 1SROA 1KLGD 4PNYA 3D0FA 3GTOH 2E75C 3I4MB 2XWBB 1CI3M 1MGSA 1EZ8A 1O80A 5KIXA 1NJIC 1PLFA 5EBDA 3ULJA 1SE3A 5E4WC 1O78A 2O4XA 2OF1A 1EEID 5I6YA 1GUNA 2Z4IA 3H6MA 3H0GH 4OXPA 4IPDA 1NMGA 1K8OA 1P16A 1QWYA 3CQZB 5FO8B 4MNOA 4LFCQ 1XPRA 2Z8LA 3TMEA 1WVLA 2Q8IB 2A6HC 1K3BC 3CCUA 3Q23A 5M5XH 1SN8A 2KA7A 5IGEA 3PUZA 3HOWG 3GV3A 2F4IA 4DXGA 4NXNL 3S24A 1RF2D 4ME3A 3BG3A 2LMCB 4A3DB 4ZAIA 1LT6D 3W2DA 2ZTCA 1WTXA 3U4VA 2LY7A 5C4XG 1EOTA 3N6RA 2QW7A 2K50A 2R7ZG 1CKNB 3S1NB 4DV0L 1CM9A 5I2XA 3UDXA 2JA8B 3K5LA 2IHEA 4S3SA 5JEAJ 1KAAA 5KYIA 1F9SA 1E1TA 1ZKOA 1JR0D 2A1AA 3IFTA 2WINB 1TWHH 1Y14B 1PH8A 3EIVA 1SMXA 1OXVA 4IFDG 3NP8A 5C3EG 4WORA 4B3SL 2K5NA 1PH3A 3MHBA 3K80C 3STBD 4DNTB 3H3VC 2ASBA 4C56C 2IWHA 2A68D 4IUVA 4C3JG 5EKIA 2YU9H 1GVPA 2N3SA 1SNCA 5FLMH 1EY8A 5LMUL 2NVYB 2CCZA 3LGJA 2MFIA 2R93G 4ULLA 1IBKQ 2NZHA 1PA6A 4RA8A 1OO9B 4F7XA 2VQEL 2E5LL 4A3BB 1N34Q 3FEWX 1CFMA 3SHLA 3R2TA 2Y0SE 4IQZA 1ONLA 3MA2B 4B08A 4DUZL 1HNWL 3GTQH 3OMGA 2B2YC 2Z4HA 4JI5Q 4IUNA 2EQSA 1E0BA 1S4ZA 2CWPA 1DGSA 4LF4L 3Q8DA 5I6WA 4LNQA 2LSSA 5CORA 2MNAA 2DJGC 2VUMB 4ZQ3A 1QZGA 1JC7A 2XSCA 2G9DA 4JC0A 1PFNA 1UWVA 4HIMA 5HURA 4HTHA 4QIWE 4L5QA 1MJCA 5F2DA 3J81E 2B39A 4OHJA 5M9OA 3TBIB 2J0TD 5DAUA 1QVGA 3Q0AA 2JA6H 1I4XA 3SVMA 2L9HA 4OO1I 2MO1A 4P73A 3OSOA 1NTGA 2JN4A 1L2FA 4NPSA 4RG1A 3TREA 5IYBH 3PUYA 1LTTD 4JI2L 3TP7A 2PQAA 4MIUA 5LMUQ 4KKUA 1D7QA 3J81j 1XPUA 4N8X1 4AYBE 1LM0A 1W6JA 2ZJPA 4A3IH 4UY8C 3H3VH 3WOEA 4K6DA 3VA7A 3EQLC 2WFWA 3HOYB 4C2MH 5J39A 5G3LF 3S1QH 2B2TA 2AQ1B 1KNEA 2XGTA 2HT1A 1BUVT 5E3FA 3SR1A 3RD4A 3RZDB 1VF5C 4JYAL 4KHPL 2CW0C 3CC4A 2JJQA 3RR5A 1E2WA 1Z7TA 1PTOC 3HOUB 2K75A 3I4MG 1D5MC 1HJPA 5GROA 4FDBA 2B3GA 5KNCA 4Y7NH 4NP5A 1G2SA 4DAVA 1LTAD 1SNMA 4JI2Q 1J6QA 1YNJC 3S15H 3DUZA 1O7LA 4KI0A 4GOPC 1VQHA 4BBSB 2HUGA 4C3HG 1Q8IA 2F0PA 1TY0A 4DAMA 1IBML 4OO1H 3H91A 4JI0Q 4H7BA 1NR2A 3FRPB 4I7AA 3K5NA 2E2HB 1PH1A 3DHQA 2A6EC 1ET6A 3A5ZB 4KMUC 2NYZD 3QOJA 3I56A 3TRZA 4G7HC 1IKLA 4FF4A 4YWLA 4A3LH 4FXDA 4YHHQ 2GVBA 1XMOQ 2HQLA 3M4PA 1WJJA 3CC7A 1XXGA 2SNMA 4DPGA 4KHPQ 2NBFA 4A3DG 3EBEA 3A8IE 4IPGA 1WD1A 4B3MQ 4LF5Q 4JOIC 1L1OA 2K4KA 1BF4A 3MEFA 3A7AB 3UI2A 2X6LA 3J81i 2DNEA 3I4NH 4XQQA 4N8FA 2F0HA 4QUFA 2BCOA 1TWGH 4DNRB 4CHTB 5A2QL 2KQ3A 1HR0Q 2JA8G 1TXYA 1UUPA 2G5DA 2PW5A 2UUAL 2QGQA 1B44D 4CDCC 1EIYB 2KEDA 2JA7H 3TS2A 1D1IA 5C3XA 4JBMA 4GN4B 4H02A 3CKIB 1I6HH 2M2LA 1A0IA 3GD7A 3GP7A 3NTIA 3OIQA 3UDFA 1B7YB 1LV9A 5K36G 1A2UA 3MWYW 1B9NA 5BN4A 2F0EA 1XNRL 2K32A 3X3NA 3KJPA 3KK7A 4O1NA 1SNPA 1FNUA 1DXMA 4YWMA 4C3JH 3T13A 4L5RC 4WJ4A 3CF5A 1G91A 2GVAA 4J8QA 4DR2L 2PNHA 1RTOA 2I07B 4DK3C 2QEXA 3GTMB 4A3BG 1TWAH 4OONA 4YCVA 5KNDA 1SYBA 1IBLQ 3E5SA 4A3GH 1TU2B 2F0LA 2QF7A 1IL8A 1X3GA 1Q12A 1GXDC 4DR3L 1A3UA 2KJXA 1H9JA 2VUMG 2UXDQ 2KUMA 4GLAC 1R4PB 2B2UA 4JI4L 3GTLH 2H5XA 1SYEA 2ALYB 3CCSA 3PSIA 4KJOA 3CCLA 2Q2TA 1WYDA 5EPLA 4DR5L 4JI6Q 2NVXH 1TS4A 4APVA 3G48A 5JJZA 4C3IH 5JPMC 5IT9c 3PCOB 2PCFB 3PGZA 1C9OA 2A74C 3L7ZC 3S14H 3J7AF 4QJFA 3C1FA 2WV6D 3D8GA 4DK1A 2WKCA 4K2KA 1X3QA 2QKIC 3A74A 1E22A 1CKMA 1S40A 1C48A 1GUOA 1LT4D 3HGBA 1BO0A 1EYAA 4DR2Q 3M4OH 2NVTB 1DOMA 2K5DA 2L4NA 1CSPA 3HOYG 2L1BA 2ZT9C 3BS1A 2YV5A 2UUCL 4K14A 2AUKA 3W5OA 3HOXB 4DN4M 4ZLTF 1B2TA 1YNND 4RH6A 1SE2A 4DGZA 1JWSD 4IJHA 1H95A 1V9PA 4XDXA 2X6GA 3I8ZA 3M3YH 1QOHA 4JI4Q 4XT1B 3T51B 4M1UB 1AFPA 1HNXL 2EYJA 2L0CA 3CC2A 1IW7D 4JK1C 3S16B 4PG3A 2KBNA 2Q2IA 3HOUG 4A3EH 4KV6A 2GN5A 3UE0A 4X3UA 2YTVA 2F0IA 4DUYL 5KRUA 1D6EC 3I4MH 1JB7A 3P1HA 2G9HD 1BDOA 5C0XG 1EL0A 2FXQA 3SK5A 2F0NA 1A15A 1JWUD 2BDNA 4QMGA 1F9QA 2FMCA 1NUCA 1BQQT 4BBSG 3T56B 1VQOA 1EFID 5HGTA 1FVIA 3HS0C 1PH2A 3OHXC 1AP0A 3CQZH 3F2UA 5C4JH 1K83B 2YTYA 1EWHA
chains in the Genus database with same CATH topology
3HOWB 3K57A 3OIPA 1RHPA 3QJYA 2HQEA 1HUNA 4A3JB 1L0XB 4RGOS 1XYIA 3VR4A 1HPCA 3RZOB 4A93B 2E74C 2BE5D 3C46A 2R7ZB 1QCBD 2F0MA 4KN7C 4A3FB 3K58A 2B8FA 3Q6SA 3P7JA 2F0FA 5ELEA 3JAML 1ESFA 1KDBA 2OT2A 4KKTA 2HDLA 3MC0B 2PPBC 2MPMA 2O2LD 4DU9A 3MVVA 2K1BA 1QJOA 1FNVA 1SYFA 4FYDA 4BA2I 1A3VA 2F03A 2EYLA 1GUWA 4HCSA 2PZTA 3J7AV 1DZ1A 5ELCA 1D1KA 4CBVA 2R61A 3OWEB 1PTOF 1X32A 3V2TA 1LACA 4N9PA 1RODA 1U4MA 5EQ0A 2E2DC 1TS5A 3MZ5A 3VR2A 3OMCA 1S5CD 4RCNA 1IHZA 3HZXA 1B53A 1T5XD 4A3MB 4J1MA 5D14A 5CV6A 1Y1VB 1GUTA 2F0TA 3VYUA 2E2IB 1ZYRC 5CV7A 2O5JC 3PO2B 1AEXA 1DJRD 3N52A 4HR7B 2HDMA 4J6HA 1IYUA 1QG7A 2F0WA 5IGDA 3PIO3 4KD3A 1BNZA 1SEBD 5IIFA 3J80L 1F77A 1HA5A 4C1NK 3KBGA 4RHRA 2DN8A 3GTPB 3FDTA 1V1OA 2IX1A 1VF7A 2R92B 5EKLA 5C4ZA 4HN7A 3PMFA 2SNSA 3D6WA 3NE5B 1HUMA 1MI2A 2EOTA 1STEA 2L12A 4NKLA 5FO7B 4EQOA 2EY1A 3C1EA 3VA5A 4LJZC 1HXYD 3PO3B 1G2TA 2NWGA 4C3HB 4X3TA 5CYUA 4CJ2C 4OIJA 1ENFA 2BDOA 4TRDA 4ABNA 5CGKA 1PZJD 1TT2A 1B4OA 3ONAB 4KY6A 4QF4A 3NUCA 1TWFB 3A8KE 1WTOA 3TP8A 5FLXL 4IALA 4PV1C 3DEOA 2F1MA 3WOFA 2PNRC 2EJGC 1XTCD 2JSOA 1EQTA 2D9UA 3CRKC 4HMIA 5C5MA 4EQPA 1VMPA 5KNBA 2D2CC 2R6GA 1QNKA 3HKZB 2IX3A 2B2VC 2PYKA 3HOZB 1U4LA 3S1RB 4CKEA 2NB0A 3GTKB 4R9WA 5C5LA 1B50A 1UNSA 3NBIA 1Y1WB 1V8QA 2OEOA 1DD2A 2NTSA 3M85A 1DCZA 2BE5C 1SYDA 5JEAG 2BOSA 2B2WA 1CA5A 3DWQA 1EY4A 1CT1D 3ND8A 1TVXA 4DF7A 1Y8NB 1DOLA 2K6AA 1RCVD 1BCPB 5FKAC 2Q8TA 1HA6A 4XYQA 2QILA 1ESRA 1R9TB 2PZWA 4M8AA 3CRLC 2RVLA 3PUWA 1KTKA 2RSOA 1ILPA 1I4RA 1O7ZA 4RKBA 5I9PA 1TY2A 3NTKA 1WTQA 1WTPA 1SE4A 1SNDA 3TP6A 4ZYSA 5IT9E 2OXPA 1SNQA 1JE4A 1NCVA 4RWSC 4IUQA 2FHTA 4LAAA 3SK6A 1H9MA 5EPJA 2EJFC 2MHVA 1CHQD 1EU3A 2E2JB 5ELFA 4ODGA 3PV0A 4ZK9B 2JXMB 3X3MA 4Q5VA 3K0YA 1EZ6A 3DM1A 2EYOA 2EVBA 3CHBD 2NVQB 1VMCA 1STAA 4NW2A 1GUGA 3HG9A 4PMCA 4RCOA 4KJNA 2HCCA 5DNFA 2A69D 4K6LA 2LKVA 4O42A 1JOKA 2F0VA 1ML0D 1V1PA 1J9OA 1E2ZA 2FMMA 4JBWA 3GTOB 2IT1A 1I4QA 1M4VA 1BCPD 3IFDA 4DAPA 3I3CA 4QB4A 1Y8OB 1T5EA 2EXZA 5ISRA 2M00A 3H0GB 5IGGA 5JVG3 4ZKBB 3BVGA 3E0JA 2MGSA 1JICA 1GHKA 4OIKA 4PMBA 1D5XC 1GJXA 2EZVA 1TQOA 1QB5D 3GO5A 1CZWA 5M5XB 1AZQA 1A3TA 2N88A 1PRTB 3BDLA 3A7LA 1LO5D 1F2LA 3QB3A 5M3MB 5CC4A 1JQYD 4XTCS 3PUVA 1CTMA 1RJTA 1SMYD 1PTOH 5IGFA 1EU4A 2D62A 2WACA 3IKJA 4L63B 5CV9A 4IFDH 1M8AA 1TWHB 5CBEE 4XXEA 1PYWD 3J81L 1CA6A 2VB3X 1LTBD 1RTNA 1F2ZA 2EYPA 1HHVA 2NN6G 2C9OA 1PXUA 2YU9B 4N9TA 2KCCA 1WCMB 1WTVA 3NWTA 2K04A 3AU7A 1F2MA 3KBXA 1C8CA 4CKCA 3D3RA 3M7GA 1CHPD 3BYYB 5JPNC 3GTQB 1WTWA 3V05A 3NSWA 1G291 2A68C 3D31A 1ET9A 4R8IA 1BOSA 2HCIA 2K33A 5M5YB 3KF8A 2FJ2A 4IN3A 4EQNA 4UDUC 1OXUA 1PRTD 1EY6A 4HAEA 5EBCA 3VYRA 3J7YW 3URYA 2JA6B 4KY5A 1U9RA 1I6VC 4ME5A 2JEAI 3QG1A 3O13A 1UEAB 4FO2A 4A3IB 3NQIA 3BVZA 1FGBD 2B2TC 3MAQA 4CJ0B 1KDCA 1SXTA 2QEJC 3S1QB 5T1IA 2RBMA 3A8JE 2ENBA 3E6ZX 1FYCA 2B8GA 2PO4A 3SDZA 2PW7A 1ENAA 2IPKD 2RDGA 4RGTA 2PMZB 1H9SB 3HEJA 2A6HD 1WD0A 4Y7NB 3EVQA 1X3PA 2XIWA 5LL6S 3SXHA 1CK1A 1Q1BA 2RA4A 3S15B 3LX0A 4KTAA 1JOOA 4RAUC 1NSNS 3DWAA 1JCKB 2I46A 3I73A 3LNNA 1DONA 2EJMA 5CR3A 3RLFA 2KHSA 3DMUA 1S5DD 3KLSX 3K59A 2PQEA 4BBRB 1AW7A 1TR5A 5KEEA 2LFNA 1LTRD 1SJHD 2X69A 5K5PA 1SJED 3I4NB 1WTRA 4DXFA 2WB1B 1TWGB 4P2CB 3BDOA 3S9WA 4U68A 2JA7B 1Q90A 5JVH3 2M9VA 2XNAC 4CJ1B 1G8ZD 4C1NI 1I6HB 4DAYA 4G7ZC 4FF1A 5K36H 3QWNA 2O5IC 2XVSA 1SYCA 3FVQA 3MXNA 1PFBA 2CQAA 5CBAE 1D2BA 2EYMA 4TSSA 1SMYC 5I4DA 1HRJA 1RD9D 3G7LA 1JB3A 4YIJA 3AB9A 4HSVA 4G57A 2B2YA 3ZYYX 1DYQA 2V4DA 1F9PA 4KHZA 3MEHA 3BDCA 2Y0SB 1DM0B 2B2UC 3A56A 5M5WB 4KY7A 1H9SA 3GTLB 5C0XI 5IODA 5LL6X 4K2LA 1S5ED 2DY8A 3SEBA 2GA4B 3DXJC 3SK4A 4XT3B 4OGQC 3GTJB 1VCIA 1HQMC 2SEBD 2KOLA 4L8JA 4C3IB 4A3KB 4I65A 4QIWB 3TZUA 3S14B 2AUJD 2VXWA 3BVMA 1Y8PB 3NQTA 2CW0D 5M3FB 5BN3A 2K03A 1GHJA 5FK9C 3M4OB 3A55A 1RDPD 2KECA 4K8JA 5AFWA 2K5WA 3MFYA 2F0SA 1EY9A 1PRTC 4NDXA 1VDZA 4AYBB 1J8IA 2H1EA 3TSSA 3EFXD 4KKSA 1QE6A 5DEHA 4DK0A 2K28A 1EIHA 3OPOA 3NBHA 5ELBA 5C3WA 1B9MA 1UAPA 1Q3LA 4A3EB 5D3IB 2A6ED 2JYOA 1Q1EA 4FXGC 5EKKA 3MXGA 1ZEQX 4HCEA 5C0XH 4B9XA 1YNNC 2IL8A 4ZKCB 4H13C 5EGTA 5E1FA 3K6OA 4RHSA 1IW7C 1TIID 4OO1G 2FINB 4WFN3 2K05A 5C4JB 2DY7A 2WAQB 2ICIA 3OWFA 3ND9A 1SYGA 3S2DB 2IW3A 4WRDA 4BWGB 3EA6A 1MBYA 1LT5D 2A5HA 2H4OA 4E6IA 1KDAA 1U4RA 3A54A 1V1PB 1OXXK 1GUSA 3C2PA 5NUCA 4IFDJ 3I70A 4DFAA 5JAVA 2RDHA 3ERQA 1BBXC 2B63B 1Y69U 4BY7B 3AMUA 3GV6A 1A2TA 5IOCA 2L11A 2ZXOA 3RMHA 1E2VA 2EDGA 2CHBD 4IUPA 2XN9C 1MD2D 1JORA 1SAPA 3D6CA 1LTSD 3QIAA 4G7OC 4H0LC 1O7YA 5C44B 4KD4A 1HFNA 1HTLD 1KLUD 3I91A 2JE6I 2Q8RE 4K8IA 1OXTA 2SDFA 1STGA 1QILA 3H94A 1IKMA 3U9OA 4PMWA 5A2QE 4FVMA 2EE1A 4KHVA 5FO9B 2MP1A 2EY5A 4R8NA 3NHHA 1CZGA 2EYFA 5ELDA 1STNA 3P75A 1LLRD 3OW7A 3HOVB 3I90A 1STHA 2JA5B 2A73B 2EY2A 3FMCA 1RKNA 2F3WA 1TS2A 4C3IG 1F2YA 3BZDB 3LWEA 4X3SA 3QO2A 1IYVA 1R4QB 1BCPF 4PQXA 3BYTB 2JP1A 4FF3A 4IZ8A 4DA2A 1CQFA 4TQUS 2NTTA 3SE0A 5IGCA 4BA1I 3I4LA 3KLRA 1STBA 4FXKC 4F8MA 3VYSA 4BY1B 4MHEA 2AWNA 4ZRZA 5C4HA 2K7VA 2F0OA 3Q22A 4V190 1LTGD 5CMDA 5J1ZA 1XX8A 4IFDI 4MN3A 2K01A 5DM73 1Z6HA 2E76C 1F9RA 3KUPA 5T1GA 3TP5A 3NWSA 3T53B 1W6KA 1NAPA 1B3AA 5CV4A 1I4GA 3TN2A 5LHY1 2L5TA 5A35A 3DEPA 3VYTA 4CKBA 5G3LD 2RQXA 1PDQA 4G4KA 2DNCA 5J22A 3Q24A 4RKLA 4I7ZC 3WDNA 3NK9A 1HFGA 1EYDA 4FF2A 1TWCB 2NZ1D 1JWMD 1SNOA 5KYLA 2F0KA 2J4XA 3U9SA 2F0UA 2WP8J 1TS3A 4NMZA 2KVMA 2ZXPA 2F3VA 1LT3D 4HEDA 5I2YA 1KABA 5IGBA 2F0DA 4IUUA 2C5CA 1AN8A 2MJ8A 5CV8A 3R93A 2EPBA 5TSSA 1ZXTA 1K8MA 4HMJA 5JEAH 2JEBI 2WIIB 2B2WC 1SBBB 3FKIB 1HTPA 1JOQA 4F88A 1PRTF 2FFKB 1D5ZC 3VR6A 5IT9L 2YYZA 2K5QA 4XIGS 1FNWA 4CGYB 1I4PA 2F0QA 4RFBA 3MFGA 4B9WA 1TKWB 3K5OA 3H09A 2TMPA 1H9KA 3MXUA 4KK7A 3VR3A 3MXPA 2ICEC 2IX0A 4FP5D 1FD7D 1MSGA 3NPPA 3JAME 1ZYRD 1U4PA 1PMRA 3OOCA 4F87A 1EEFD 1ILQA 2VNUD 2XRQD 4U673 3HP3A 5CV5A 3P20A 1NR4A 1DOKA 5BN5A 3K5MA 3ITPA 4RGNA 2WKDA 2BA0A 2KEEA 3KLSA 4UAIA 4X3KA 4ZUIA 3G6JB 1C4QA 3D4WA 2SOBA 4ID6A 3L3OC 1CQVA 1LABA 5EJWA 3T16A 2QCPX 1EIGA 2RSNA 2KCNA 4C2MB 2LS01 2J7ZA 3NXWA 3S17B 3D4RA 2N55A 2MUYA 1G6ZA 4QUCA 3M7NA 3I72A 2VB2X 5KGUA 4QCLA 1HCZA 4ILWA 4K5VA 2BA1A 1KNAA 4GZYC 5C0XJ 1S5BD 3D4DA 1EY7A 3S2HB 1LTID 2NUCA 1PZID 3V96A 3PIP3 2AWOA 4FNFA 4TKOB 2ZXRA 2NN6I 2A69C 1HQRD 2EYHA 4RGMA 1EY0A 1PFMA 2XRSD 2ID0A 2CVRA 3FPPA 1SDFA 4HSPA 1SFOB 1BCPC 4IUTA 4BS9A 3DWPA 4IURA 1EYCA 3J80E 1ICWA 2AQ3B 5I9OA 1ENCA 3M4YA 4Q0FA 3RUZA 2PZUA 4WJWA 2QDBA 2RDFA 3K7AB 4XQNA 5C4XB 3C3LA 4OL7A 2RKSA 2Z1CA 4XQJA 1PTOB 3TDQA 2B2VA 4ZUJA 5FOBB 3GTGB 1EWCA 1XWEA 5C3EB 1B1ZA 1FR3A 3HRZC 2NN6H 5FLXE 4C3JB 4Z9CB 4KN4C 2XWJB 1TWAB 3R8BA 2R93B 1SSOA 2F0GA 3VR5A 3IL8A 4K5WA 4A3GB 3MTSA 1I3QB 3TZDA 5COYA 2IJ0A 1II3A 4H44C 3R3OA 2TSSA 3S1MB 3W3AA 4K5XA 3CU7A 2NVXB 3SK8A 1EY5A 5EPKA 3GQBA 3PUXA 3QOLA 1QNUA 1I50B 1L0YB 1A6XA 4XYOA 2AQ2B 5DM63 1PZKD 5D65A 4EGVA 3L9AX 1OXSC 1H9RA 3R2IA 2R3ZA 3IAYA 3LWUA 4LK1C 1MSHA 5E4XA 1V43A 1Z47A 1STYA 1AZPA 1PTOD 4EVOA 3FPUB 1I4HA 1EQVA 4V0BA 1S5FD 1GOZA 3NTHA 1BXTA 2D5DA 1BR9A 1YNJD 2EY6A 5C6AA 5D3DA 3T4AC 2F0JA 2L55A 3M3YB 4LMQD 5JOBA 3EJIA 4L6TB 3EROA 1KLGD 4PNYA 2E75C 3I4MB 2XWBB 1CI3M 1MGSA 1EZ8A 1O80A 5KIXA 1PLFA 5EBDA 1SE3A 5E4WC 1O78A 2O4XA 2OF1A 1EEID 5I6YA 1GUNA 2Z4IA 3H6MA 1K8OA 1QWYA 3CQZB 5FO8B 2Z8LA 3TMEA 1WVLA 2Q8IB 2A6HC 3Q23A 2KA7A 5IGEA 3PUZA 3GV3A 2F4IA 4DXGA 1RF2D 3BG3A 2LMCB 4A3DB 4ZAIA 1LT6D 3W2DA 1WTXA 2LY7A 1EOTA 3N6RA 3S1NB 1CM9A 5I2XA 2JA8B 3K5LA 4S3SA 5JEAJ 1KAAA 5KYIA 1F9SA 1ZKOA 1JR0D 3IFTA 2WINB 4IFDG 1OXVA 3NP8A 4WORA 3MHBA 4DNTB 3H3VC 4C56C 2IWHA 2A68D 4IUVA 4C3JG 5EKIA 1SNCA 1EY8A 2NVYB 4ULLA 4RA8A 1OO9B 4F7XA 4A3BB 3FEWX 1CFMA 3SHLA 3R2TA 4IQZA 1ONLA 3MA2B 4B08A 3OMGA 2B2YC 2Z4HA 4IUNA 1E0BA 1S4ZA 5I6WA 5CORA 2VUMB 4ZQ3A 1JC7A 2XSCA 2G9DA 1PFNA 5HURA 4HTHA 5F2DA 3J81E 2B39A 4OHJA 5M9OA 3TBIB 2J0TD 5DAUA 3Q0AA 1I4XA 3SVMA 2L9HA 4OO1I 3OSOA 3PUYA 1LTTD 3TP7A 4MIUA 4KKUA 1W6JA 3WOEA 4K6DA 3VA7A 3EQLC 3HOYB 5J39A 5G3LF 2B2TA 2AQ1B 1KNEA 1BUVT 5E3FA 3SR1A 3RD4A 3RZDB 1VF5C 2CW0C 1E2WA 1Z7TA 1PTOC 3HOUB 1D5MC 5KNCA 4NP5A 1G2SA 4DAVA 1LTAD 1SNMA 1YNJC 3DUZA 1O7LA 4KI0A 4BBSB 2HUGA 4C3HG 1Q8IA 2F0PA 1TY0A 4OO1H 3H91A 4H7BA 1NR2A 3FRPB 3K5NA 2E2HB 3DHQA 2A6EC 1ET6A 4KMUC 2NYZD 3QOJA 4G7HC 1IKLA 4FF4A 4FXDA 1XXGA 2SNMA 2NBFA 1WD1A 3A8IE 1BF4A 3A7AB 3UI2A 2X6LA 2DNEA 4XQQA 2F0HA 4QUFA 2BCOA 4DNRB 4CHTB 5A2QL 2KQ3A 1UUPA 2PW5A 1B44D 2KEDA 1D1IA 5C3XA 3CKIB 2M2LA 3GD7A 3GP7A 3NTIA 3OIQA 1LV9A 5K36G 1A2UA 3MWYW 1B9NA 5BN4A 2F0EA 2K32A 3X3NA 3KK7A 4O1NA 1SNPA 1FNUA 1DXMA 3T13A 1G91A 4J8QA 1RTOA 2I07B 3GTMB 5KNDA 1SYBA 3E5SA 1TU2B 2F0LA 2QF7A 1IL8A 1Q12A 1GXDC 1A3UA 2KJXA 1H9JA 2KUMA 1R4PB 2B2UA 1SYEA 4KJOA 5EPLA 1TS4A 5JJZA 5JPMC 2PCFB 2A74C 3L7ZC 3J7AF 3C1FA 2WV6D 3D8GA 4DK1A 2WKCA 4K2KA 1X3QA 2QKIC 1C48A 1GUOA 1LT4D 3HGBA 1BO0A 1EYAA 2NVTB 1DOMA 2K5DA 2L4NA 2L1BA 2ZT9C 3BS1A 4K14A 2AUKA 3HOXB 4DN4M 4ZLTF 1B2TA 1YNND 4RH6A 1SE2A 4DGZA 1JWSD 4XDXA 2X6GA 3I8ZA 1QOHA 4XT1B 3T51B 4M1UB 1AFPA 2EYJA 2L0CA 1IW7D 4JK1C 3S16B 4KV6A 4X3UA 2F0IA 5KRUA 1D6EC 3P1HA 2G9HD 1BDOA 5C0XG 1EL0A 3SK5A 2F0NA 1A15A 1JWUD 2BDNA 4QMGA 1F9QA 2FMCA 1NUCA 1BQQT 3T56B 1EFID 5HGTA 3HS0C 3OHXC 1AP0A 3F2UA 1K83B 1EWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IPK D;  2RDG A;  1LLR D;  1LTA D;  4L6T B;  1LTB D;  4RGT A;  4RCO A;  1EWC A;  1LT3 D;  1L0X B;  4RGO S;  1KLG D;  1DYQ A;  3R2T A;  1DJR D;  1TS2 A;  1TY0 A;  3BZD B;  2ICI A;  1B1Z A;  1CK1 A;  4K6L A;  1TS4 A;  1UNS A;  1V1P A;  1SE3 A;  1ET6 A;  4Z9C B;  1BCP F;  1CHP D;  3DWA A;  3BYT B;  1AN8 A;  1S5E D;  1JCK B;  4BWG B;  3SEB A;  3R8B A;  1I4Q A;  2WV6 D;  3BYY B;  1M4V A;  2NTS A;  1BCP D;  1EEI D;  3EA6 A;  1LT5 D;  2NTT A;  5TSS A;  3V05 A;  1S5B D;  5ELE A;  1SEB D;  2SEB D;  1ESF A;  1LTI D;  1PZI D;  1XXG A;  1F77 A;  1HA5 A;  1ET9 A;  1LT4 D;  1V1P B;  2IJ0 A;  3DWQ A;  4OHJ A;  1SBB B;  4RHR A;  1S5D D;  3KLS X;  1CT1 D;  2Z8L A;  2RDH A;  3BVM A;  1PRT F;  1V1O A;  1D5Z C;  3MC0 B;  1I4X A;  1RCV D;  1BCP B;  1AW7 A;  1FNW A;  2O2L D;  4UDU C;  1PRT D;  1I4P A;  2TSS A;  5FKA C;  4RFB A;  5FK9 C;  1LTG D;  2QIL A;  1LTT D;  3BVG A;  1HQR D;  3MFG A;  1STE A;  1LTR D;  1RDP D;  1SJH D;  1SE2 A;  4RH6 A;  1D5X C;  1UUP A;  4RGM A;  4DXG A;  1JWS D;  1B44 D;  1FNV A;  1RF2 D;  1SJE D;  3URY A;  1PRT C;  1KTK A;  2XRS D;  1HXY D;  2CHB D;  4DXF A;  1LT6 D;  2XN9 C;  1L0Y B;  3W2D A;  2AQ2 B;  1I4G A;  3TSS A;  1BCP C;  1FD7 D;  1MD2 D;  1PZK D;  1I4R A;  1PRT B;  3EFX D;  5ELC A;  3GP7 A;  1ENF A;  3DWP A;  1LTS D;  3R2I A;  2R61 A;  1LO5 D;  1TY2 A;  1D6E C;  1EEF D;  2XNA C;  2AQ3 B;  1PTO F;  3O13 A;  1G8Z D;  3OWE B;  2XRQ D;  2AQ1 B;  1KLU D;  1HTL D;  5ELB A;  1PZJ D;  1SE4 A;  1JQY D;  1PTO D;  2G9H D;  4ZYS A;  4O1N A;  1FNU A;  3BVZ A;  1FGB D;  1I4H A;  4RGN A;  5D3I B;  1JR0 D;  1PTO H;  1JWU D;  1S5F D;  1EU4 A;  1QIL A;  1SXT A;  1GOZ A;  2QEJ C;  1BXT A;  1TS5 A;  1CHQ D;  1PTO C;  1EU3 A;  1JWM D;  5ELF A;  1EFI D;  1D5M C;  4TSS A;  1XTC D;  1S5C D;  5D3D A;  4C56 C;  4RHS A;  1PTO B;  4L63 B;  1CQV A;  5I4D A;  1T5X D;  2J4X A;  3CHB D;  1RD9 D;  5ELD A;  1TS3 A;  1PYW D; 
#chains in the Genus database with same CATH topology
 3HOW B;  3K57 A;  4POF A;  3OIP A;  4HJ8 A;  4X66 L;  1RHP A;  3QJY A;  4X62 L;  1YVC A;  2HQE A;  1HUN A;  4A3J B;  1L0X B;  4RGO S;  1PH9 A;  1XYI A;  2AHO B;  3BZC A;  2OTJ A;  3VR4 A;  1HPC A;  3RZO B;  4A93 B;  2E74 C;  1HNX Q;  2BE5 D;  4HJ7 A;  3C46 A;  1SRU A;  2R7Z B;  2JA9 A;  3CCE A;  1QCB D;  1BVS A;  1P8L A;  2F0M A;  4KN7 C;  4IPH A;  4A3F B;  5M3M G;  3K58 A;  2B8F A;  3Q6S A;  3P7J A;  4DV1 Q;  2F0F A;  5ELE A;  3JAM L;  1ESF A;  2B63 H;  1KDB A;  4BY7 H;  2OT2 A;  4KKT A;  4GLV B;  1NY4 A;  4LF8 L;  2HDL A;  1VQ4 A;  1SR3 A;  3CAM A;  3MC0 B;  1HNZ L;  1HR0 W;  2PPB C;  2MPM A;  2O2L D;  4DR1 L;  4DU9 A;  4A3C G;  3CP0 A;  3MVV A;  2K1B A;  4R4C A;  2ZJR A;  1QJO A;  4DK6 C;  5AJ3 L;  1FNV A;  1SYF A;  5C44 H;  4FYD A;  4X66 Q;  4X62 Q;  4BA2 I;  2NVY H;  1A3V A;  2F03 A;  2EYL A;  1HZ9 A;  1GUW A;  4HCS A;  2PZT A;  1WCM G;  3J7A V;  1DZ1 A;  5ELC A;  3KJO A;  1D1K A;  4CBV A;  3RLO A;  2R61 A;  2ZTE A;  3OWE B;  1PTO F;  1QUQ A;  3F2C A;  1X32 A;  2DUD A;  3V2T A;  1LAC A;  4N9P A;  1ROD A;  1U4M A;  4DV6 L;  5EQ0 A;  3JAM c;  4QGU A;  2E2D C;  1TS5 A;  3MZ5 A;  3VR2 A;  3OMC A;  3HOV H;  4LF8 Q;  1K3R A;  1S5C D;  4RCN A;  1IHZ A;  3HZX A;  1B53 A;  1T5X D;  4A3M B;  1K8A C;  4J1M A;  5D14 A;  5CV6 A;  4DR1 Q;  1Y1V B;  4LFB Q;  1Q7Y C;  1GUT A;  2F0T A;  3VYU A;  2E2I B;  1ZYR C;  5CV7 A;  4QL5 A;  4X6A H;  2BH2 A;  2O5J C;  3PO2 B;  1AEX A;  1DJR D;  1UE1 A;  3N52 A;  4HR7 B;  2OWO A;  2HDM A;  4J6H A;  1IYU A;  1QG7 A;  3J7Z C;  2F0W A;  1VQG A;  5GAG C;  5IGD A;  1PYB A;  3PIO 3;  4BY1 H;  1WOC A;  5GAD C;  1VQD A;  1XMQ Q;  3CCV A;  4KD3 A;  1BNZ A;  1SEB D;  1NMF A;  5IIF A;  1PYS B;  4GKJ L;  3J80 L;  1F77 A;  1HA5 A;  4DV6 Q;  4C1N K;  2VY3 A;  4IOA A;  3KBG A;  4RHR A;  2DN8 A;  1N9W A;  3GTP B;  3FDT A;  1V1O A;  2IX1 A;  1VF7 A;  2R92 B;  5EKL A;  1C7Y A;  5C4Z A;  4HN7 A;  4GKK Q;  2JQO A;  3PMF A;  4QY7 A;  2SNS A;  3D6W A;  3NE5 B;  5IP9 H;  1HUM A;  4YWK A;  1MI2 A;  2EOT A;  1STE A;  2L12 A;  4NKL A;  5FO7 B;  3OW2 A;  3E3X A;  4EQO A;  2EY1 A;  3C1E A;  3VA5 A;  4LJZ C;  1HXY D;  3PO3 B;  1G2T A;  2NWG A;  4C3H B;  2Z6K C;  4X3T A;  1JMC A;  5CYU A;  1KRS A;  4CJ2 C;  4JG2 A;  4OIJ A;  1ENF A;  2BDO A;  1W2B A;  2PQA B;  4TRD A;  3FP9 A;  4ABN A;  5CGK A;  4GOP A;  1TWC H;  2I5H A;  1PZJ D;  1TT2 A;  1B4O A;  3ONA B;  4KY6 A;  4CDE C;  4IPC A;  4QF4 A;  1IBK L;  3NUC A;  2E2H H;  1IYJ B;  1TWF B;  1N34 L;  3A8K E;  1WTO A;  1A8V A;  3TP8 A;  5FLX L;  3BJU A;  1Q8K A;  4IAL A;  4PV1 C;  4A3J G;  4GKJ Q;  1JJC B;  3DEO A;  2F1M A;  3J80 c;  4JI5 L;  4A93 G;  3WOF A;  3UDG A;  2PNR C;  5FJ8 G;  2EJG C;  1IL2 A;  1XTC D;  4BBR G;  4GNX B;  4LUV A;  2JSO A;  1EQT A;  2D9U A;  3CRK C;  3F1Z A;  4A3F G;  4JBJ A;  4LF9 L;  4HMI A;  2RCN A;  5C5M A;  4EQP A;  1VMP A;  5KNB A;  4AQY Q;  2D2C C;  2R6G A;  1QNK A;  3HKZ B;  2IX3 A;  2B2V C;  2K5H A;  2PYK A;  2R7D A;  3HOZ B;  1U4L A;  3S1R B;  4CKE A;  1QVC A;  2NB0 A;  3GTK B;  4R9W A;  5C5L A;  1B50 A;  3KOJ A;  4KLK A;  1UNS A;  3NBI A;  3H3V I;  1Y1W B;  1L0W A;  2ZM6 L;  1V8Q A;  2OEO A;  1DD2 A;  3FKI H;  2NTS A;  3M85 A;  1DCZ A;  2BE5 C;  1SYD A;  5JEA G;  2BOS A;  2B2W A;  3T1Y L;  4GLX A;  1CA5 A;  1J5E Q;  5FLX c;  2RCF A;  3DWQ A;  1EY4 A;  1CT1 D;  2PI2 A;  1ICF B;  3ND8 A;  1TVX A;  4DF7 A;  1Y8N B;  1DOL A;  2K6A A;  1RCV D;  1BCP B;  2KHI A;  4NB3 A;  5FKA C;  2Q8T A;  1HA6 A;  4XYQ A;  2QIL A;  1ESR A;  1R9T B;  2KHJ A;  1A63 A;  2PZW A;  1YNX A;  4IJL A;  1FJG L;  4M8A A;  1W3S A;  3CRL C;  1L1O B;  2RVL A;  3PUW A;  4LF9 Q;  1KTK A;  1UEB A;  2RSO A;  1LTL A;  1ILP A;  3KFU A;  4IOC A;  1I4R A;  4DV7 L;  1O7Z A;  4RKB A;  3K81 C;  5I9P A;  1TY2 A;  3NTK A;  4DV4 Q;  1WTQ A;  1WTP A;  2ZM6 Q;  4HJ9 A;  1SE4 A;  1SND A;  4A3M G;  3TP6 A;  1Y1V G;  4ZYS A;  5IT9 E;  2OXP A;  4DKA C;  4HJ5 A;  1SNQ A;  1JE4 A;  1NCV A;  3W1B A;  3T1Y Q;  4RWS C;  3M9B A;  2K14 A;  4IUQ A;  1JJ2 A;  2FHT A;  4LAA A;  3SK6 A;  1H9M A;  5EPJ A;  4CDF C;  2EJF C;  4A3K G;  2MHV A;  1CHQ D;  4JI0 L;  1U0L A;  1E3P A;  1EU3 A;  2E2J B;  3PF4 A;  5ELF A;  4ODG A;  3PV0 A;  4ZK9 B;  2JXM B;  3F8T A;  1YEZ A;  3X3M A;  4Q5V A;  3A5U A;  3K0Y A;  1EZ6 A;  3DM1 A;  5M3F G;  2EYO A;  1E7Z A;  2EVB A;  3CHB D;  1JT8 A;  1PV4 A;  3S17 H;  2NVQ B;  1VMC A;  1STA A;  2OTL A;  4JW0 A;  3HKS A;  4NW2 A;  4PZ6 A;  4YHH L;  1GUG A;  5IP7 G;  1XMO L;  3HG9 A;  4PMC A;  4RCO A;  4GNX A;  1FJG Q;  4KJN A;  2HCC A;  5DNF A;  4DNI A;  3E0E A;  2A69 D;  3HOX H;  4B3M L;  4LF5 L;  4K6L A;  2LKV A;  4O42 A;  1JOK A;  2F0V A;  1PH7 A;  1YHA A;  1ML0 D;  5IYC G;  4DV7 Q;  1V1P A;  4IO9 A;  4UP9 A;  3S2H H;  2A8V A;  4A76 A;  1J9O A;  1E2Z A;  2R92 G;  2FMM A;  4JBW A;  3GTO B;  2IT1 A;  1GO3 E;  3CCR A;  1I4Q A;  1HR0 L;  1M4V A;  1BCP D;  3IFD A;  1X56 A;  2EXD A;  1I5F A;  5GAH C;  1I94 Q;  4LF6 L;  4DAP A;  3I3C A;  4QB4 A;  1Y8O B;  2K52 A;  1T5E A;  3PO3 G;  2EXZ A;  5ISR A;  1X3F A;  1KC8 C;  2M00 A;  4PZ8 A;  4EX5 A;  3H0G B;  2N8N A;  5IGG A;  5JVG 3;  2R7F A;  1MJE A;  4JI7 Q;  4ZKB B;  3BVG A;  1SFO H;  3CPW A;  3E0J A;  2UXB Q;  2MGS A;  4A75 A;  1JIC A;  1VQL A;  1GHK A;  4OIK A;  4PMB A;  1D5X C;  1GJX A;  2CFM A;  2EZV A;  1TQO A;  1QB5 D;  3GO5 A;  1CZW A;  3HOW H;  5M5X B;  1AZQ A;  1A3T A;  2N88 A;  4TVA B;  1IBL L;  1PRT B;  3BDL A;  4O0A A;  5JJK A;  2UU9 Q;  3A7L A;  5GAE C;  1LO5 D;  1F2L A;  2KCT A;  3K7A H;  3QB3 A;  5M3M B;  2ES2 A;  4A93 H;  2UXD L;  1YHB A;  2LXJ A;  5C4X H;  5IYD G;  5CC4 A;  1HZA A;  1JQY D;  4XTC S;  2R7Z H;  4R4T A;  3PUV A;  3BZK A;  3ULL A;  1UE7 A;  1CTM A;  1RJT A;  1SMY D;  4LF6 Q;  1PTO H;  5IGF A;  2KEN A;  1MIU A;  1EU4 A;  2D62 A;  3HKZ G;  4JI6 L;  2WAC A;  3HOZ G;  3IKJ A;  4ZCK A;  3GTG H;  1N36 Q;  4L63 B;  5CV9 A;  1Y1W G;  4IFD H;  1M8A A;  1TWH B;  5CBE E;  3G6E A;  5C3E H;  1PYW D;  4XXE A;  3J81 L;  1CA6 A;  2I5L X;  2VB3 X;  1LTB D;  1RTN A;  1F2Z A;  2EYP A;  1HHV A;  2NN6 G;  2C9O A;  1PXU A;  3KYH C;  2YU9 B;  4N9T A;  2R93 H;  2KCC A;  1WCM B;  1WTV A;  3NWT A;  3G71 A;  1Q81 C;  2K04 A;  3AU7 A;  1F2M A;  3KBX A;  1C8C A;  4CKC A;  3D3R A;  2A19 A;  3M7G A;  1I3Q H;  1CHP D;  4BXX G;  5EAY A;  3BYY B;  5JPN C;  3GTQ B;  1WTW A;  2BH8 A;  2EIF A;  3V05 A;  3STB C;  3NSW A;  1G29 1;  2A68 C;  3D31 A;  1ET9 A;  4R8I A;  3S1M H;  1BOS A;  2HCI A;  1BBW A;  2K33 A;  1LUZ A;  5M5Y B;  3KF8 A;  2FJ2 A;  4IN3 A;  1PFS A;  3U58 A;  4EQN A;  4UDU C;  1OXU A;  1PRT D;  4UP7 A;  1I50 H;  4OWW B;  1EY6 A;  4HAE A;  4O2D A;  5EBC A;  3VYR A;  3J81 c;  3J7Y W;  1X6O A;  3URY A;  2JA6 B;  2E8G A;  2JA5 G;  4KY5 A;  1IZ6 A;  4X64 L;  1U9R A;  3HFZ B;  2E2I H;  5ELO A;  4DAY B;  1I6V C;  4ME5 A;  3PO2 H;  2D0P A;  2JEA I;  3QG1 A;  3IRB A;  3O13 A;  1UEA B;  2UXC Q;  3K7U C;  4FO2 A;  1VS0 A;  2Z9H A;  4A3I B;  3NQI A;  4P71 A;  3MXN B;  3J7A 5;  2CH4 W;  3BVZ A;  1FGB D;  1VQF A;  2B2T C;  3MAQ A;  4CJ0 B;  1KDC A;  1SXT A;  2QEJ C;  3S1Q B;  5T1I A;  1E24 A;  2RBM A;  2KCM A;  1QUQ B;  3A8J E;  2ENB A;  3E6Z X;  1FYC A;  2B8G A;  1KHI A;  2PO4 A;  1XNQ Q;  4B3T L;  3SDZ A;  2PW7 A;  1ENA A;  4OWX B;  4DV1 L;  3GTP H;  2IPK D;  2RDG A;  3BU2 A;  4RGT A;  2PMZ B;  1H9S B;  3HEJ A;  2A6H D;  1WD0 A;  2JK8 A;  4Y7N B;  1VQK A;  1SLJ A;  3EVQ A;  1X3P A;  2XIW A;  5LL6 S;  3SXH A;  3OTO Q;  1CK1 A;  4X64 Q;  2QA4 A;  1Q1B A;  2RA4 A;  1YIJ A;  3S15 B;  3LX0 A;  4KTA A;  3H15 A;  1EFW A;  1VQ5 A;  1JOO A;  4C3H H;  4RAU C;  3H0G G;  1NSN S;  3DWA A;  1JCK B;  2I46 A;  3I73 A;  3LNN A;  1DON A;  1LYL A;  2EJM A;  4X65 Q;  5CR3 A;  3CPF A;  3RLF A;  2KHS A;  3AQQ A;  1KQS A;  2MO0 A;  3DMU A;  4OX9 Q;  1S5D D;  3KLS X;  4LUZ A;  1Q86 C;  3K59 A;  1JE5 A;  3AYH B;  2PQE A;  4BBR B;  2HHH Q;  1AW7 A;  1VQ9 A;  4A3D H;  4Y52 H;  1TR5 A;  5KEE A;  1X3E A;  3SGI A;  1Z9F A;  2LFN A;  1L1O C;  4DV2 Q;  4B3T Q;  5BR8 Q;  1XJV A;  1LTR D;  1FL0 A;  3GDE A;  1SJH D;  2X69 A;  5K5P A;  1SJE D;  3I4N B;  3S1N H;  1WTR A;  4DXF A;  2WB1 B;  3WWV A;  2JA8 H;  1TWG B;  4P2C B;  2UUB L;  2RF4 A;  3BDO A;  3S9W A;  4LFA Q;  1VQ7 A;  4P72 A;  4U68 A;  2JA7 B;  1Q90 A;  5JVH 3;  1VQN A;  2M9V A;  2XNA C;  4CJ1 B;  2MQH A;  1G8Z D;  4LFB L;  4C1N I;  5IWA L;  3S1R H;  1I6H B;  4DAY A;  4G7Z C;  3KLW A;  2I5M X;  4FF1 A;  5K36 H;  3QWN A;  2O5I C;  2VQF Q;  2XVS A;  1SYC A;  3TQY A;  4K0K Q;  3FVQ A;  3MXN A;  3RN2 A;  1PFB A;  3ICE A;  2CQA A;  5CBA E;  1D2B A;  4GOP B;  1EQQ A;  5FLM G;  2EYM A;  4TSS A;  4DR4 Q;  4GS3 A;  1SMY C;  3RNU A;  4A3B H;  4JVZ A;  3KDF A;  5I4D A;  1HRJ A;  1VQB A;  1RD9 D;  5HGQ A;  3DLL A;  3G7L A;  1XMQ L;  1JB3 A;  1KAW A;  4PZ7 A;  5L37 A;  4YIJ A;  3AB9 A;  4HSV A;  4G57 A;  2B2Y A;  3ZYY X;  2VUM H;  1B3Q A;  1MKH A;  1DYQ A;  2V4D A;  1F9P A;  1GD7 A;  4KHZ A;  3MEH A;  3BDC A;  2Y0S B;  4OWT B;  1DM0 B;  2B2U C;  3A56 A;  5M5W B;  4YY3 Q;  4KY7 A;  1H9S A;  2UUB Q;  3GTL B;  5C0X I;  4GKK L;  5IOD A;  4RMF A;  5LL6 X;  4K2L A;  4QQB X;  1S5E D;  2DY8 A;  3SEB A;  4HID A;  1YI2 A;  2GA4 B;  3DXJ C;  3PIP A;  4P74 A;  3SK4 A;  5IWA Q;  4XT3 B;  4OGQ C;  3GTJ B;  1VCI A;  1HQM C;  1IXR A;  1C0A A;  3ZJY C;  4LUO A;  2SEB D;  2KOL A;  4MTN A;  4L8J A;  4C3I B;  2JA6 G;  2NZO A;  4A3K B;  4I65 A;  1GM5 A;  1YIT A;  2XTI A;  4QIW B;  3TZU A;  2AUJ D;  5IY0 A;  3S14 B;  4HIK A;  5DLQ E;  5IYB G;  2VXW A;  3BVM A;  1AE2 A;  1Y8P B;  1V1Q A;  1U5K A;  3NQT A;  2CW0 D;  5M3F B;  5BN3 A;  2K03 A;  1GHJ A;  3CCJ A;  5FK9 C;  3M4O B;  3A55 A;  4A3I G;  1RDP D;  2KEC A;  4K8J A;  5AFW A;  3HOY H;  1T9H A;  2K5W A;  3MFY A;  5H1S E;  2F0S A;  1EYG A;  3RN5 A;  1EY9 A;  1PRT C;  4NDX A;  1VDZ A;  1WFQ A;  4R4I A;  4AYB B;  1J8I A;  2H1E A;  4LF7 Q;  4DR6 L;  3TSS A;  3EFX D;  4KKS A;  3RZD H;  1QE6 A;  5DEH A;  4DK0 A;  2K28 A;  2V1C C;  3OPO A;  1EIH A;  3NBH A;  5ELB A;  3HOU H;  5C3W A;  1M90 C;  3KF6 A;  1B9M A;  1UAP A;  2PMZ E;  1Q3L A;  4AQY L;  4A3E B;  3EN2 A;  1S3O A;  5D3I B;  2A6E D;  2JYO A;  3AEV A;  1Q1E A;  1A62 A;  4FXG C;  5EKK A;  3MXG A;  1ZEQ X;  3B6Y A;  4HCE A;  5C0X H;  4B9X A;  1YNN C;  2IL8 A;  4JI8 Q;  4ZKC B;  4H13 C;  5EGT A;  2VW9 A;  4P75 A;  5E1F A;  3K6O A;  4RHS A;  4BBS H;  1QVF A;  1IW7 C;  2F4V Q;  1TII D;  1K0R A;  2Q2U A;  4OO1 G;  2FIN B;  4LWC A;  4WFN 3;  1J5E L;  2K05 A;  5C4J B;  2DY7 A;  4NXM L;  2WAQ B;  2ICI A;  3NEL A;  5LMN W;  4DR6 Q;  1KRT A;  1N32 Q;  3OWF A;  3ND9 A;  1SYG A;  4A3L G;  1BBU A;  4AH6 A;  2IW3 A;  2ZTD A;  3S2D B;  4WRD A;  4BWG B;  1GKH A;  3M4Q A;  3EA6 A;  3TS0 A;  1MBY A;  1LT5 D;  2A5H A;  2H4O A;  4E6I A;  1KDA A;  1U4R A;  4JOI A;  3A54 A;  3CME A;  2WB1 E;  5M3M H;  3ERS X;  1V1P B;  1OXX K;  1GUS A;  3I4N G;  3C2P A;  1YHQ A;  5NUC A;  2WB1 G;  4IFD J;  2OQK A;  4JV5 L;  3I70 A;  4DFA A;  5JAV A;  2RDH A;  4AIM A;  3ERQ A;  4DV4 L;  1K8G A;  1BBX C;  1Y69 U;  2B63 B;  4BY7 B;  3AMU A;  3GV6 A;  1A2T A;  1KL9 A;  2JA7 G;  5IOC A;  1B70 B;  1VQM A;  2L11 A;  2ZXO A;  3RMH A;  1E2V A;  2EDG A;  3F2B A;  4A3C H;  2CHB D;  4IUP A;  2XN9 C;  4DV3 L;  4R4Q A;  1MD2 D;  1Q46 A;  4NXM Q;  1JOR A;  3W1G A;  1SAP A;  3D6C A;  1LTS D;  3QIA A;  1CKO A;  4H0L C;  4G7O C;  4L5T A;  2RHQ B;  1O7Y A;  5C44 B;  2DJF C;  4KD4 A;  3GTM H;  1WCM H;  1HFN A;  1HTL D;  1KLU D;  3I91 A;  2JE6 I;  2Q8R E;  4K8I A;  3CXC A;  1D8L A;  1OXT A;  2SDF A;  1PH6 A;  4NXN Q;  1STG A;  4A3G G;  4OEL B;  1YBY A;  1QIL A;  3H94 A;  1IKM A;  1VQA A;  4PMW A;  3U9O A;  3ULP A;  5A2Q E;  1VQI A;  3PIO A;  4FVM A;  2B29 A;  4MZ9 A;  3ER0 A;  2EE1 A;  4KHV A;  5FO9 B;  2Y0S G;  2MP1 A;  4JV5 Q;  1YZ6 A;  2EY5 A;  4R8N A;  3NHH A;  4JPB W;  1QZH A;  1CZG A;  2EYF A;  3JC6 6;  4DV0 Q;  5ELD A;  1STN A;  1I94 L;  5M5Y H;  3P75 A;  1LLR D;  2F52 A;  3OW7 A;  3U50 C;  3HOV B;  5JJI A;  3I90 A;  1STH A;  2JA5 B;  2A73 B;  3NEM A;  2EY2 A;  3FMC A;  1RKN A;  1AE3 A;  2F3W A;  1TS2 A;  4C3I G;  1F2Y A;  3BZD B;  1KXL A;  2YTX A;  3LWE A;  4DV3 Q;  4X3S A;  3QO2 A;  4R4O A;  4B3S Q;  1IYV A;  1R4Q B;  3I55 A;  1BCP F;  4PQX A;  3BYT B;  1XTD A;  2JP1 A;  4JI7 L;  1EUJ A;  4FF3 A;  2NVT H;  2UXB L;  4IZ8 A;  4DA2 A;  4HJA A;  1CQF A;  4TQU S;  2NTT A;  2PI2 E;  3SE0 A;  5IGC A;  2VS1 A;  3I4L A;  3KLR A;  4BA1 I;  2E5L Q;  2Z0S A;  2VQE Q;  1STB A;  3CD6 A;  2HIX A;  4FXK C;  4F8M A;  3VYS A;  4BY1 B;  1KIX A;  4AYB G;  2UU9 L;  4DUZ Q;  1NE3 A;  1HNW Q;  4MHE A;  1M1K C;  3I7F A;  2AWN A;  2Q2H A;  4ZRZ A;  5C4H A;  2K7V A;  2F0O A;  4LW1 A;  3Q22 A;  4V19 0;  4LF4 Q;  1LTG D;  5CMD A;  2Z6B A;  3L2P A;  5J1Z A;  1AH9 A;  3S16 H;  1XX8 A;  3QR8 A;  1CKN A;  4JCV E;  4IFD I;  4MN3 A;  2K01 A;  5DM7 3;  1Z6H A;  1WI5 A;  2E76 C;  1F9R A;  3KUP A;  5T1G A;  3TP5 A;  3KF8 B;  4A3E G;  3NWS A;  3CCM A;  3T53 B;  1W6K A;  1K28 A;  1B3A A;  1NAP A;  5CV4 A;  1I4G A;  3TN2 A;  3U4Z A;  1N36 L;  5LHY 1;  1VQC A;  2L5T A;  5A35 A;  3DEP A;  3VYT A;  4CKB A;  5IE8 A;  5G3L D;  1ASZ A;  2RQX A;  1PDQ A;  4G4K A;  2DNC A;  5J22 A;  3Q24 A;  1UE5 A;  1XPO A;  4R1J A;  4RKL A;  4I7Z C;  1OTC A;  3WDN A;  3CCQ A;  2WAQ E;  3NK9 A;  1K83 H;  1HFG A;  1EYD A;  4FF2 A;  1TWC B;  2NZ1 D;  3NEN A;  3E9H A;  1JWM D;  2WAQ G;  1VQJ A;  1SNO A;  1SE8 A;  5KYL A;  3AFP A;  4YCU A;  4A3J H;  3VDY A;  2F0K A;  2D0O A;  4EQ5 A;  2J4X A;  3U9S A;  3RZO H;  2F0U A;  2WP8 J;  1TS3 A;  4NMZ A;  2KVM A;  5FJ8 H;  1YJW A;  2ZXP A;  1HZB A;  2F3V A;  4BBR H;  3HKZ E;  1E1O A;  1X55 A;  1LT3 D;  4HED A;  4JYA Q;  4A3F H;  5I2Y A;  1KAB A;  5IGB A;  2F0D A;  4GN5 A;  4IUU A;  2C5C A;  1AN8 A;  3CW2 C;  2B63 G;  4BY7 G;  2MJ8 A;  5CV8 A;  3R93 A;  1YJN A;  1WTH A;  2EPB A;  5TSS A;  2CKZ B;  1ZXT A;  1K8M A;  4HMJ A;  5JEA H;  1RIP A;  2IHF A;  2JEB I;  2WII B;  2AKW B;  1SBB B;  2B2W C;  3FKI B;  1HTP A;  1HZC A;  1IBM Q;  5HY6 A;  1JOQ A;  4F88 A;  1PRT F;  2FFK B;  1D5Z C;  3VR6 A;  5IT9 L;  5J3B A;  5E7N A;  2YYZ A;  2K5Q A;  4UPA A;  1FNW A;  2RHS B;  4XIG S;  1Q82 C;  1K9M C;  3UE1 A;  4CGY B;  1I4P A;  1VQE A;  2F0Q A;  2UXC L;  4RFB A;  5C44 G;  4GN3 B;  3MFG A;  4B9W A;  1TKW B;  3K5O A;  3H09 A;  2L15 A;  2TMP A;  1H9K A;  3MXU A;  4KK7 A;  4J15 A;  3L0O A;  3VR3 A;  3MXP A;  2ICE C;  2IX0 A;  4UP8 A;  4FP5 D;  1FD7 D;  2LXK A;  4UHV A;  1MSG A;  3NPP A;  3JAM E;  1ZYR D;  1U4P A;  1PMR A;  1XNQ L;  3OOC A;  4F87 A;  4A4I A;  1NNX A;  1ILQ A;  1EEF D;  4B3R L;  2VNU D;  2XRQ D;  1S72 A;  4JI3 L;  4U67 3;  3HP3 A;  5M5W H;  5CV5 A;  3P20 A;  3DM3 A;  1VQP A;  1NR4 A;  1DOK A;  5BN5 A;  3K5M A;  3ITP A;  4RGN A;  3HOV G;  2WKD A;  2BA0 A;  2KEE A;  2UUA Q;  1B8A A;  4POG A;  4A3M H;  3KLS A;  3PF5 A;  4UAI A;  4X3K A;  1Y1V H;  4ZUI A;  3OTO L;  3GTJ H;  3G6J B;  1C4Q A;  3D4W A;  2SOB A;  4ID6 A;  3I4O A;  3L3O C;  4HIO A;  1CQV A;  4A3K H;  5LMN L;  4DR7 L;  1LAB A;  2OQ0 A;  1EOV A;  1N8R C;  5EJW A;  3T16 A;  3UDI A;  1XNR Q;  4DV5 L;  4X65 L;  2QCP X;  1EIG A;  2RSN A;  4WJ3 M;  2KCN A;  5M3F H;  4C2M B;  4ALP A;  2LS0 1;  4OX9 L;  1FGU A;  2J7Z A;  3KDF B;  3NXW A;  1CSQ A;  3S17 B;  3D4R A;  5IP7 H;  2N55 A;  4GNX C;  2MUY A;  4BY1 G;  1G6Z A;  4QUC A;  2HHH L;  3M7N A;  3T1H L;  3I72 A;  2VB2 X;  3OYY A;  3AFQ A;  5KGU A;  4QCL A;  4DV2 L;  1HCZ A;  5BR8 L;  1EIF A;  4ILW A;  4DR3 Q;  4K5V A;  3G4S A;  4B3R Q;  2CWA A;  2BA1 A;  1KNA A;  1UE6 A;  5IYC H;  4JI3 Q;  4GZY C;  5C0X J;  1S5B D;  2R92 H;  3D4D A;  1EY7 A;  3S2H B;  1LTI D;  2NUC A;  1PZI D;  3V96 A;  1NBW A;  1X54 A;  3PIP 3;  1K0S A;  2F3I A;  2AWO A;  2I0Q A;  5IP9 G;  4DR5 Q;  4FNF A;  3RLN A;  4LFA L;  1CUK A;  1G6P A;  2C35 B;  3PO3 H;  4TKO B;  3CMA A;  2ZJQ A;  2ZXR A;  3FHW A;  2NN6 I;  2A69 C;  2AMC B;  5LMN Q;  4DR7 Q;  1HQR D;  2EYH A;  3K0X A;  2Z6K A;  1MHW C;  2VQF L;  4DV5 Q;  4MTK A;  4RGM A;  1EY0 A;  2K5V A;  2P5Z X;  4L5S A;  4K0K L;  1PFM A;  2XRS D;  2ID0 A;  1PH4 A;  2CVR A;  1ASY A;  3FPP A;  1SDF A;  4HSP A;  1SFO B;  1BCP C;  3I2Z A;  4IUT A;  4DR4 L;  4BS9 A;  3DWP A;  1TWF H;  4IUR A;  5JJL A;  1EYC A;  1PVO A;  2N78 A;  1EWI A;  1ICW A;  3J80 E;  2AQ3 B;  3T1H Q;  5I9O A;  3JAM i;  1RL2 A;  1ENC A;  3M4Y A;  4Q0F A;  3RUZ A;  3F2D A;  2UUC Q;  2PZU A;  2ATW A;  4WJW A;  2QDB A;  2RDF A;  3S2D H;  3K7A B;  5IYD H;  4XQN A;  3PQI A;  5C4X B;  3C3L A;  1KD1 C;  3PO2 G;  4YY3 L;  4OL7 A;  3NBH B;  2RKS A;  4CDD C;  3KF6 B;  2Z1C A;  4XQJ A;  1PTO B;  3TDQ A;  4DUY Q;  3HOZ H;  1X65 A;  2B2V A;  3E9I A;  3GTK H;  2QDL A;  2N49 A;  2CQO A;  4ZUJ A;  5FOB B;  3GTG B;  1BKB A;  1Y1W H;  1EWC A;  2CH4 A;  1XWE A;  2OCE A;  1K73 C;  5C3E B;  1B1Z A;  1FR3 A;  3FKI G;  3HRZ C;  2NN6 H;  5FLX E;  4C3J B;  4JBK A;  4Z9C B;  4JI1 L;  4KN4 C;  5ELN A;  1VQ6 A;  2XWJ B;  1TWA B;  3R8B A;  2R93 B;  1SSO A;  2F0G A;  2DGY A;  1VQ8 A;  3VR5 A;  4BXX H;  3IL8 A;  4K5W A;  4A3G B;  1N33 L;  3MTS A;  1I3Q B;  3TZD A;  3A0J A;  5COY A;  4LF7 L;  2IJ0 A;  1R9T H;  1II3 A;  4H44 C;  2VZA A;  1YJ9 A;  3R3O A;  2TSS A;  3S1M B;  3W3A A;  4K5X A;  4OEM B;  3CU7 A;  2NVX B;  3SK8 A;  1EY5 A;  5EPK A;  1X9N A;  3GQB A;  3PUX A;  3QOL A;  1QNU A;  1I50 B;  1L0Y B;  1A6X A;  4XYO A;  2AQ2 B;  5DM6 3;  1PZK D;  5D65 A;  4JI8 L;  4EGV A;  3L9A X;  1PH5 A;  2JA5 H;  1OXS C;  1H9R A;  3R2I A;  2R3Z A;  3IAY A;  3LWU A;  1HNZ Q;  4LK1 C;  1MSH A;  2VL6 A;  4YCW A;  5E4X A;  4JI1 Q;  2IY5 B;  2F4V L;  1V43 A;  1Z47 A;  1STY A;  1G51 A;  1AZP A;  1PTO D;  3J80 i;  1PHJ A;  2E2J H;  4EVO A;  3FPU B;  1I4H A;  2HIV A;  5AJ3 Q;  1EQV A;  5GQO A;  4V0B A;  4LFC L;  1S5F D;  2HD3 A;  1GOZ A;  3NTH A;  1N33 Q;  1BXT A;  2NVQ H;  1O7I A;  3TEH B;  2D5D A;  3K8A A;  1N32 L;  1BR9 A;  1YNJ D;  2EY6 A;  1EQR A;  5C6A A;  5D3D A;  3T4A C;  1HH2 P;  2F0J A;  2L55 A;  3M3Y B;  1JJG A;  4LMQ D;  5JOB A;  3EJI A;  3HOX G;  4L6T B;  3ERO A;  1SRO A;  1KLG D;  4PNY A;  3D0F A;  3GTO H;  2E75 C;  3I4M B;  2XWB B;  1CI3 M;  1MGS A;  1EZ8 A;  1O80 A;  5KIX A;  1NJI C;  1PLF A;  5EBD A;  3ULJ A;  1SE3 A;  5E4W C;  1O78 A;  2O4X A;  2OF1 A;  1EEI D;  5I6Y A;  1GUN A;  2Z4I A;  3H6M A;  3H0G H;  4OXP A;  4IPD A;  1NMG A;  1K8O A;  1P16 A;  1QWY A;  3CQZ B;  5FO8 B;  4MNO A;  4LFC Q;  1XPR A;  2Z8L A;  3TME A;  1WVL A;  2Q8I B;  2A6H C;  1K3B C;  3CCU A;  3Q23 A;  5M5X H;  1SN8 A;  2KA7 A;  5IGE A;  3PUZ A;  3HOW G;  3GV3 A;  2F4I A;  4DXG A;  4NXN L;  3S24 A;  1RF2 D;  4ME3 A;  3BG3 A;  2LMC B;  4A3D B;  4ZAI A;  1LT6 D;  3W2D A;  2ZTC A;  1WTX A;  3U4V A;  2LY7 A;  5C4X G;  1EOT A;  3N6R A;  2QW7 A;  2K50 A;  2R7Z G;  1CKN B;  3S1N B;  4DV0 L;  1CM9 A;  5I2X A;  3UDX A;  2JA8 B;  3K5L A;  2IHE A;  4S3S A;  5JEA J;  1KAA A;  5KYI A;  1F9S A;  1E1T A;  1ZKO A;  1JR0 D;  2A1A A;  3IFT A;  2WIN B;  1TWH H;  1Y14 B;  1PH8 A;  3EIV A;  1SMX A;  1OXV A;  4IFD G;  3NP8 A;  5C3E G;  4WOR A;  4B3S L;  2K5N A;  1PH3 A;  3MHB A;  3K80 C;  3STB D;  4DNT B;  3H3V C;  2ASB A;  4C56 C;  2IWH A;  2A68 D;  4IUV A;  4C3J G;  5EKI A;  2YU9 H;  1GVP A;  2N3S A;  1SNC A;  5FLM H;  1EY8 A;  5LMU L;  2NVY B;  2CCZ A;  3LGJ A;  2MFI A;  2R93 G;  4ULL A;  1IBK Q;  2NZH A;  1PA6 A;  4RA8 A;  1OO9 B;  4F7X A;  2VQE L;  2E5L L;  4A3B B;  1N34 Q;  3FEW X;  1CFM A;  3SHL A;  3R2T A;  2Y0S E;  4IQZ A;  1ONL A;  3MA2 B;  4B08 A;  4DUZ L;  1HNW L;  3GTQ H;  3OMG A;  2B2Y C;  2Z4H A;  4JI5 Q;  4IUN A;  2EQS A;  1E0B A;  1S4Z A;  2CWP A;  1DGS A;  4LF4 L;  3Q8D A;  5I6W A;  4LNQ A;  2LSS A;  5COR A;  2MNA A;  2DJG C;  2VUM B;  4ZQ3 A;  1QZG A;  1JC7 A;  2XSC A;  2G9D A;  4JC0 A;  1PFN A;  1UWV A;  4HIM A;  5HUR A;  4HTH A;  4QIW E;  4L5Q A;  1MJC A;  5F2D A;  3J81 E;  2B39 A;  4OHJ A;  5M9O A;  3TBI B;  2J0T D;  5DAU A;  1QVG A;  3Q0A A;  2JA6 H;  1I4X A;  3SVM A;  2L9H A;  4OO1 I;  2MO1 A;  4P73 A;  3OSO A;  1NTG A;  2JN4 A;  1L2F A;  4NPS A;  4RG1 A;  3TRE A;  5IYB H;  3PUY A;  1LTT D;  4JI2 L;  3TP7 A;  2PQA A;  4MIU A;  5LMU Q;  4KKU A;  1D7Q A;  3J81 j;  1XPU A;  4N8X 1;  4AYB E;  1LM0 A;  1W6J A;  2ZJP A;  4A3I H;  4UY8 C;  3H3V H;  3WOE A;  4K6D A;  3VA7 A;  3EQL C;  2WFW A;  3HOY B;  4C2M H;  5J39 A;  5G3L F;  3S1Q H;  2B2T A;  2AQ1 B;  1KNE A;  2XGT A;  2HT1 A;  1BUV T;  5E3F A;  3SR1 A;  3RD4 A;  3RZD B;  1VF5 C;  4JYA L;  4KHP L;  2CW0 C;  3CC4 A;  2JJQ A;  3RR5 A;  1E2W A;  1Z7T A;  1PTO C;  3HOU B;  2K75 A;  3I4M G;  1D5M C;  1HJP A;  5GRO A;  4FDB A;  2B3G A;  5KNC A;  4Y7N H;  4NP5 A;  1G2S A;  4DAV A;  1LTA D;  1SNM A;  4JI2 Q;  1J6Q A;  1YNJ C;  3S15 H;  3DUZ A;  1O7L A;  4KI0 A;  4GOP C;  1VQH A;  4BBS B;  2HUG A;  4C3H G;  1Q8I A;  2F0P A;  1TY0 A;  4DAM A;  1IBM L;  4OO1 H;  3H91 A;  4JI0 Q;  4H7B A;  1NR2 A;  3FRP B;  4I7A A;  3K5N A;  2E2H B;  1PH1 A;  3DHQ A;  2A6E C;  1ET6 A;  3A5Z B;  4KMU C;  2NYZ D;  3QOJ A;  3I56 A;  3TRZ A;  4G7H C;  1IKL A;  4FF4 A;  4YWL A;  4A3L H;  4FXD A;  4YHH Q;  2GVB A;  1XMO Q;  2HQL A;  3M4P A;  1WJJ A;  3CC7 A;  1XXG A;  2SNM A;  4DPG A;  4KHP Q;  2NBF A;  4A3D G;  3EBE A;  3A8I E;  4IPG A;  1WD1 A;  4B3M Q;  4LF5 Q;  4JOI C;  1L1O A;  2K4K A;  1BF4 A;  3MEF A;  3A7A B;  3UI2 A;  2X6L A;  3J81 i;  2DNE A;  3I4N H;  4XQQ A;  4N8F A;  2F0H A;  4QUF A;  2BCO A;  1TWG H;  4DNR B;  4CHT B;  5A2Q L;  2KQ3 A;  1HR0 Q;  2JA8 G;  1TXY A;  1UUP A;  2G5D A;  2PW5 A;  2UUA L;  2QGQ A;  1B44 D;  4CDC C;  1EIY B;  2KED A;  2JA7 H;  3TS2 A;  1D1I A;  5C3X A;  4JBM A;  4GN4 B;  4H02 A;  3CKI B;  1I6H H;  2M2L A;  1A0I A;  3GD7 A;  3GP7 A;  3NTI A;  3OIQ A;  3UDF A;  1B7Y B;  1LV9 A;  5K36 G;  1A2U A;  3MWY W;  1B9N A;  5BN4 A;  2F0E A;  1XNR L;  2K32 A;  3X3N A;  3KJP A;  3KK7 A;  4O1N A;  1SNP A;  1FNU A;  1DXM A;  4YWM A;  4C3J H;  3T13 A;  4L5R C;  4WJ4 A;  3CF5 A;  1G91 A;  2GVA A;  4J8Q A;  4DR2 L;  2PNH A;  1RTO A;  2I07 B;  4DK3 C;  2QEX A;  3GTM B;  4A3B G;  1TWA H;  4OON A;  4YCV A;  5KND A;  1SYB A;  1IBL Q;  3E5S A;  4A3G H;  1TU2 B;  2F0L A;  2QF7 A;  1IL8 A;  1X3G A;  1Q12 A;  1GXD C;  4DR3 L;  1A3U A;  2KJX A;  1H9J A;  2VUM G;  2UXD Q;  2KUM A;  4GLA C;  1R4P B;  2B2U A;  4JI4 L;  3GTL H;  2H5X A;  1SYE A;  2ALY B;  3CCS A;  3PSI A;  4KJO A;  3CCL A;  2Q2T A;  1WYD A;  5EPL A;  4DR5 L;  4JI6 Q;  2NVX H;  1TS4 A;  4APV A;  3G48 A;  5JJZ A;  4C3I H;  5JPM C;  5IT9 c;  3PCO B;  2PCF B;  3PGZ A;  1C9O A;  2A74 C;  3L7Z C;  3S14 H;  3J7A F;  4QJF A;  3C1F A;  2WV6 D;  3D8G A;  4DK1 A;  2WKC A;  4K2K A;  1X3Q A;  2QKI C;  3A74 A;  1E22 A;  1CKM A;  1S40 A;  1C48 A;  1GUO A;  1LT4 D;  3HGB A;  1BO0 A;  1EYA A;  4DR2 Q;  3M4O H;  2NVT B;  1DOM A;  2K5D A;  2L4N A;  1CSP A;  3HOY G;  2L1B A;  2ZT9 C;  3BS1 A;  2YV5 A;  2UUC L;  4K14 A;  2AUK A;  3W5O A;  3HOX B;  4DN4 M;  4ZLT F;  1B2T A;  1YNN D;  4RH6 A;  1SE2 A;  4DGZ A;  1JWS D;  4IJH A;  1H95 A;  1V9P A;  4XDX A;  2X6G A;  3I8Z A;  3M3Y H;  1QOH A;  4JI4 Q;  4XT1 B;  3T51 B;  4M1U B;  1AFP A;  1HNX L;  2EYJ A;  2L0C A;  3CC2 A;  1IW7 D;  4JK1 C;  3S16 B;  4PG3 A;  2KBN A;  2Q2I A;  3HOU G;  4A3E H;  4KV6 A;  2GN5 A;  3UE0 A;  4X3U A;  2YTV A;  2F0I A;  4DUY L;  5KRU A;  1D6E C;  3I4M H;  1JB7 A;  3P1H A;  2G9H D;  1BDO A;  5C0X G;  1EL0 A;  2FXQ A;  3SK5 A;  2F0N A;  1A15 A;  1JWU D;  2BDN A;  4QMG A;  1F9Q A;  2FMC A;  1NUC A;  1BQQ T;  4BBS G;  3T56 B;  1VQO A;  1EFI D;  5HGT A;  1FVI A;  3HS0 C;  1PH2 A;  3OHX C;  1AP0 A;  3CQZ H;  3F2U A;  5C4J H;  1K83 B;  2YTY A;  1EWH A; 
#chains in the Genus database with same CATH homology
 3HOW B;  3K57 A;  3OIP A;  1RHP A;  3QJY A;  2HQE A;  1HUN A;  4A3J B;  1L0X B;  4RGO S;  1XYI A;  3VR4 A;  1HPC A;  3RZO B;  4A93 B;  2E74 C;  2BE5 D;  3C46 A;  2R7Z B;  1QCB D;  2F0M A;  4KN7 C;  4A3F B;  3K58 A;  2B8F A;  3Q6S A;  3P7J A;  2F0F A;  5ELE A;  3JAM L;  1ESF A;  1KDB A;  2OT2 A;  4KKT A;  2HDL A;  3MC0 B;  2PPB C;  2MPM A;  2O2L D;  4DU9 A;  3MVV A;  2K1B A;  1QJO A;  1FNV A;  1SYF A;  4FYD A;  4BA2 I;  1A3V A;  2F03 A;  2EYL A;  1GUW A;  4HCS A;  2PZT A;  3J7A V;  1DZ1 A;  5ELC A;  1D1K A;  4CBV A;  2R61 A;  3OWE B;  1PTO F;  1X32 A;  3V2T A;  1LAC A;  4N9P A;  1ROD A;  1U4M A;  5EQ0 A;  2E2D C;  1TS5 A;  3MZ5 A;  3VR2 A;  3OMC A;  1S5C D;  4RCN A;  1IHZ A;  3HZX A;  1B53 A;  1T5X D;  4A3M B;  4J1M A;  5D14 A;  5CV6 A;  1Y1V B;  1GUT A;  2F0T A;  3VYU A;  2E2I B;  1ZYR C;  5CV7 A;  2O5J C;  3PO2 B;  1AEX A;  1DJR D;  3N52 A;  4HR7 B;  2HDM A;  4J6H A;  1IYU A;  1QG7 A;  2F0W A;  5IGD A;  3PIO 3;  4KD3 A;  1BNZ A;  1SEB D;  5IIF A;  3J80 L;  1F77 A;  1HA5 A;  4C1N K;  3KBG A;  4RHR A;  2DN8 A;  3GTP B;  3FDT A;  1V1O A;  2IX1 A;  1VF7 A;  2R92 B;  5EKL A;  5C4Z A;  4HN7 A;  3PMF A;  2SNS A;  3D6W A;  3NE5 B;  1HUM A;  1MI2 A;  2EOT A;  1STE A;  2L12 A;  4NKL A;  5FO7 B;  4EQO A;  2EY1 A;  3C1E A;  3VA5 A;  4LJZ C;  1HXY D;  3PO3 B;  1G2T A;  2NWG A;  4C3H B;  4X3T A;  5CYU A;  4CJ2 C;  4OIJ A;  1ENF A;  2BDO A;  4TRD A;  4ABN A;  5CGK A;  1PZJ D;  1TT2 A;  1B4O A;  3ONA B;  4KY6 A;  4QF4 A;  3NUC A;  1TWF B;  3A8K E;  1WTO A;  3TP8 A;  5FLX L;  4IAL A;  4PV1 C;  3DEO A;  2F1M A;  3WOF A;  2PNR C;  2EJG C;  1XTC D;  2JSO A;  1EQT A;  2D9U A;  3CRK C;  4HMI A;  5C5M A;  4EQP A;  1VMP A;  5KNB A;  2D2C C;  2R6G A;  1QNK A;  3HKZ B;  2IX3 A;  2B2V C;  2PYK A;  3HOZ B;  1U4L A;  3S1R B;  4CKE A;  2NB0 A;  3GTK B;  4R9W A;  5C5L A;  1B50 A;  1UNS A;  3NBI A;  1Y1W B;  1V8Q A;  2OEO A;  1DD2 A;  2NTS A;  3M85 A;  1DCZ A;  2BE5 C;  1SYD A;  5JEA G;  2BOS A;  2B2W A;  1CA5 A;  3DWQ A;  1EY4 A;  1CT1 D;  3ND8 A;  1TVX A;  4DF7 A;  1Y8N B;  1DOL A;  2K6A A;  1RCV D;  1BCP B;  5FKA C;  2Q8T A;  1HA6 A;  4XYQ A;  2QIL A;  1ESR A;  1R9T B;  2PZW A;  4M8A A;  3CRL C;  2RVL A;  3PUW A;  1KTK A;  2RSO A;  1ILP A;  1I4R A;  1O7Z A;  4RKB A;  5I9P A;  1TY2 A;  3NTK A;  1WTQ A;  1WTP A;  1SE4 A;  1SND A;  3TP6 A;  4ZYS A;  5IT9 E;  2OXP A;  1SNQ A;  1JE4 A;  1NCV A;  4RWS C;  4IUQ A;  2FHT A;  4LAA A;  3SK6 A;  1H9M A;  5EPJ A;  2EJF C;  2MHV A;  1CHQ D;  1EU3 A;  2E2J B;  5ELF A;  4ODG A;  3PV0 A;  4ZK9 B;  2JXM B;  3X3M A;  4Q5V A;  3K0Y A;  1EZ6 A;  3DM1 A;  2EYO A;  2EVB A;  3CHB D;  2NVQ B;  1VMC A;  1STA A;  4NW2 A;  1GUG A;  3HG9 A;  4PMC A;  4RCO A;  4KJN A;  2HCC A;  5DNF A;  2A69 D;  4K6L A;  2LKV A;  4O42 A;  1JOK A;  2F0V A;  1ML0 D;  1V1P A;  1J9O A;  1E2Z A;  2FMM A;  4JBW A;  3GTO B;  2IT1 A;  1I4Q A;  1M4V A;  1BCP D;  3IFD A;  4DAP A;  3I3C A;  4QB4 A;  1Y8O B;  1T5E A;  2EXZ A;  5ISR A;  2M00 A;  3H0G B;  5IGG A;  5JVG 3;  4ZKB B;  3BVG A;  3E0J A;  2MGS A;  1JIC A;  1GHK A;  4OIK A;  4PMB A;  1D5X C;  1GJX A;  2EZV A;  1TQO A;  1QB5 D;  3GO5 A;  1CZW A;  5M5X B;  1AZQ A;  1A3T A;  2N88 A;  1PRT B;  3BDL A;  3A7L A;  1LO5 D;  1F2L A;  3QB3 A;  5M3M B;  5CC4 A;  1JQY D;  4XTC S;  3PUV A;  1CTM A;  1RJT A;  1SMY D;  1PTO H;  5IGF A;  1EU4 A;  2D62 A;  2WAC A;  3IKJ A;  4L63 B;  5CV9 A;  4IFD H;  1M8A A;  1TWH B;  5CBE E;  4XXE A;  1PYW D;  3J81 L;  1CA6 A;  2VB3 X;  1LTB D;  1RTN A;  1F2Z A;  2EYP A;  1HHV A;  2NN6 G;  2C9O A;  1PXU A;  2YU9 B;  4N9T A;  2KCC A;  1WCM B;  1WTV A;  3NWT A;  2K04 A;  3AU7 A;  1F2M A;  3KBX A;  1C8C A;  4CKC A;  3D3R A;  3M7G A;  1CHP D;  3BYY B;  5JPN C;  3GTQ B;  1WTW A;  3V05 A;  3NSW A;  1G29 1;  2A68 C;  3D31 A;  1ET9 A;  4R8I A;  1BOS A;  2HCI A;  2K33 A;  5M5Y B;  3KF8 A;  2FJ2 A;  4IN3 A;  4EQN A;  4UDU C;  1OXU A;  1PRT D;  1EY6 A;  4HAE A;  5EBC A;  3VYR A;  3J7Y W;  3URY A;  2JA6 B;  4KY5 A;  1U9R A;  1I6V C;  4ME5 A;  2JEA I;  3QG1 A;  3O13 A;  1UEA B;  4FO2 A;  4A3I B;  3NQI A;  3BVZ A;  1FGB D;  2B2T C;  3MAQ A;  4CJ0 B;  1KDC A;  1SXT A;  2QEJ C;  3S1Q B;  5T1I A;  2RBM A;  3A8J E;  2ENB A;  3E6Z X;  1FYC A;  2B8G A;  2PO4 A;  3SDZ A;  2PW7 A;  1ENA A;  2IPK D;  2RDG A;  4RGT A;  2PMZ B;  1H9S B;  3HEJ A;  2A6H D;  1WD0 A;  4Y7N B;  3EVQ A;  1X3P A;  2XIW A;  5LL6 S;  3SXH A;  1CK1 A;  1Q1B A;  2RA4 A;  3S15 B;  3LX0 A;  4KTA A;  1JOO A;  4RAU C;  1NSN S;  3DWA A;  1JCK B;  2I46 A;  3I73 A;  3LNN A;  1DON A;  2EJM A;  5CR3 A;  3RLF A;  2KHS A;  3DMU A;  1S5D D;  3KLS X;  3K59 A;  2PQE A;  4BBR B;  1AW7 A;  1TR5 A;  5KEE A;  2LFN A;  1LTR D;  1SJH D;  2X69 A;  5K5P A;  1SJE D;  3I4N B;  1WTR A;  4DXF A;  2WB1 B;  1TWG B;  4P2C B;  3BDO A;  3S9W A;  4U68 A;  2JA7 B;  1Q90 A;  5JVH 3;  2M9V A;  2XNA C;  4CJ1 B;  1G8Z D;  4C1N I;  1I6H B;  4DAY A;  4G7Z C;  4FF1 A;  5K36 H;  3QWN A;  2O5I C;  2XVS A;  1SYC A;  3FVQ A;  3MXN A;  1PFB A;  2CQA A;  5CBA E;  1D2B A;  2EYM A;  4TSS A;  1SMY C;  5I4D A;  1HRJ A;  1RD9 D;  3G7L A;  1JB3 A;  4YIJ A;  3AB9 A;  4HSV A;  4G57 A;  2B2Y A;  3ZYY X;  1DYQ A;  2V4D A;  1F9P A;  4KHZ A;  3MEH A;  3BDC A;  2Y0S B;  1DM0 B;  2B2U C;  3A56 A;  5M5W B;  4KY7 A;  1H9S A;  3GTL B;  5C0X I;  5IOD A;  5LL6 X;  4K2L A;  1S5E D;  2DY8 A;  3SEB A;  2GA4 B;  3DXJ C;  3SK4 A;  4XT3 B;  4OGQ C;  3GTJ B;  1VCI A;  1HQM C;  2SEB D;  2KOL A;  4L8J A;  4C3I B;  4A3K B;  4I65 A;  4QIW B;  3TZU A;  3S14 B;  2AUJ D;  2VXW A;  3BVM A;  1Y8P B;  3NQT A;  2CW0 D;  5M3F B;  5BN3 A;  2K03 A;  1GHJ A;  5FK9 C;  3M4O B;  3A55 A;  1RDP D;  2KEC A;  4K8J A;  5AFW A;  2K5W A;  3MFY A;  2F0S A;  1EY9 A;  1PRT C;  4NDX A;  1VDZ A;  4AYB B;  1J8I A;  2H1E A;  3TSS A;  3EFX D;  4KKS A;  1QE6 A;  5DEH A;  4DK0 A;  2K28 A;  1EIH A;  3OPO A;  3NBH A;  5ELB A;  5C3W A;  1B9M A;  1UAP A;  1Q3L A;  4A3E B;  5D3I B;  2A6E D;  2JYO A;  1Q1E A;  4FXG C;  5EKK A;  3MXG A;  1ZEQ X;  4HCE A;  5C0X H;  4B9X A;  1YNN C;  2IL8 A;  4ZKC B;  4H13 C;  5EGT A;  5E1F A;  3K6O A;  4RHS A;  1IW7 C;  1TII D;  4OO1 G;  2FIN B;  4WFN 3;  2K05 A;  5C4J B;  2DY7 A;  2WAQ B;  2ICI A;  3OWF A;  3ND9 A;  1SYG A;  3S2D B;  2IW3 A;  4WRD A;  4BWG B;  3EA6 A;  1MBY A;  1LT5 D;  2A5H A;  2H4O A;  4E6I A;  1KDA A;  1U4R A;  3A54 A;  1V1P B;  1OXX K;  1GUS A;  3C2P A;  5NUC A;  4IFD J;  3I70 A;  4DFA A;  5JAV A;  2RDH A;  3ERQ A;  1BBX C;  2B63 B;  1Y69 U;  4BY7 B;  3AMU A;  3GV6 A;  1A2T A;  5IOC A;  2L11 A;  2ZXO A;  3RMH A;  1E2V A;  2EDG A;  2CHB D;  4IUP A;  2XN9 C;  1MD2 D;  1JOR A;  1SAP A;  3D6C A;  1LTS D;  3QIA A;  4G7O C;  4H0L C;  1O7Y A;  5C44 B;  4KD4 A;  1HFN A;  1HTL D;  1KLU D;  3I91 A;  2JE6 I;  2Q8R E;  4K8I A;  1OXT A;  2SDF A;  1STG A;  1QIL A;  3H94 A;  1IKM A;  3U9O A;  4PMW A;  5A2Q E;  4FVM A;  2EE1 A;  4KHV A;  5FO9 B;  2MP1 A;  2EY5 A;  4R8N A;  3NHH A;  1CZG A;  2EYF A;  5ELD A;  1STN A;  3P75 A;  1LLR D;  3OW7 A;  3HOV B;  3I90 A;  1STH A;  2JA5 B;  2A73 B;  2EY2 A;  3FMC A;  1RKN A;  2F3W A;  1TS2 A;  4C3I G;  1F2Y A;  3BZD B;  3LWE A;  4X3S A;  3QO2 A;  1IYV A;  1R4Q B;  1BCP F;  4PQX A;  3BYT B;  2JP1 A;  4FF3 A;  4IZ8 A;  4DA2 A;  1CQF A;  4TQU S;  2NTT A;  3SE0 A;  5IGC A;  4BA1 I;  3I4L A;  3KLR A;  1STB A;  4FXK C;  4F8M A;  3VYS A;  4BY1 B;  4MHE A;  2AWN A;  4ZRZ A;  5C4H A;  2K7V A;  2F0O A;  3Q22 A;  4V19 0;  1LTG D;  5CMD A;  5J1Z A;  1XX8 A;  4IFD I;  4MN3 A;  2K01 A;  5DM7 3;  1Z6H A;  2E76 C;  1F9R A;  3KUP A;  5T1G A;  3TP5 A;  3NWS A;  3T53 B;  1W6K A;  1NAP A;  1B3A A;  5CV4 A;  1I4G A;  3TN2 A;  5LHY 1;  2L5T A;  5A35 A;  3DEP A;  3VYT A;  4CKB A;  5G3L D;  2RQX A;  1PDQ A;  4G4K A;  2DNC A;  5J22 A;  3Q24 A;  4RKL A;  4I7Z C;  3WDN A;  3NK9 A;  1HFG A;  1EYD A;  4FF2 A;  1TWC B;  2NZ1 D;  1JWM D;  1SNO A;  5KYL A;  2F0K A;  2J4X A;  3U9S A;  2F0U A;  2WP8 J;  1TS3 A;  4NMZ A;  2KVM A;  2ZXP A;  2F3V A;  1LT3 D;  4HED A;  5I2Y A;  1KAB A;  5IGB A;  2F0D A;  4IUU A;  2C5C A;  1AN8 A;  2MJ8 A;  5CV8 A;  3R93 A;  2EPB A;  5TSS A;  1ZXT A;  1K8M A;  4HMJ A;  5JEA H;  2JEB I;  2WII B;  2B2W C;  1SBB B;  3FKI B;  1HTP A;  1JOQ A;  4F88 A;  1PRT F;  2FFK B;  1D5Z C;  3VR6 A;  5IT9 L;  2YYZ A;  2K5Q A;  4XIG S;  1FNW A;  4CGY B;  1I4P A;  2F0Q A;  4RFB A;  3MFG A;  4B9W A;  1TKW B;  3K5O A;  3H09 A;  2TMP A;  1H9K A;  3MXU A;  4KK7 A;  3VR3 A;  3MXP A;  2ICE C;  2IX0 A;  4FP5 D;  1FD7 D;  1MSG A;  3NPP A;  3JAM E;  1ZYR D;  1U4P A;  1PMR A;  3OOC A;  4F87 A;  1EEF D;  1ILQ A;  2VNU D;  2XRQ D;  4U67 3;  3HP3 A;  5CV5 A;  3P20 A;  1NR4 A;  1DOK A;  5BN5 A;  3K5M A;  3ITP A;  4RGN A;  2WKD A;  2BA0 A;  2KEE A;  3KLS A;  4UAI A;  4X3K A;  4ZUI A;  3G6J B;  1C4Q A;  3D4W A;  2SOB A;  4ID6 A;  3L3O C;  1CQV A;  1LAB A;  5EJW A;  3T16 A;  2QCP X;  1EIG A;  2RSN A;  2KCN A;  4C2M B;  2LS0 1;  2J7Z A;  3NXW A;  3S17 B;  3D4R A;  2N55 A;  2MUY A;  1G6Z A;  4QUC A;  3M7N A;  3I72 A;  2VB2 X;  5KGU A;  4QCL A;  1HCZ A;  4ILW A;  4K5V A;  2BA1 A;  1KNA A;  4GZY C;  5C0X J;  1S5B D;  3D4D A;  1EY7 A;  3S2H B;  1LTI D;  2NUC A;  1PZI D;  3V96 A;  3PIP 3;  2AWO A;  4FNF A;  4TKO B;  2ZXR A;  2NN6 I;  2A69 C;  1HQR D;  2EYH A;  4RGM A;  1EY0 A;  1PFM A;  2XRS D;  2ID0 A;  2CVR A;  3FPP A;  1SDF A;  4HSP A;  1SFO B;  1BCP C;  4IUT A;  4BS9 A;  3DWP A;  4IUR A;  1EYC A;  3J80 E;  1ICW A;  2AQ3 B;  5I9O A;  1ENC A;  3M4Y A;  4Q0F A;  3RUZ A;  2PZU A;  4WJW A;  2QDB A;  2RDF A;  3K7A B;  4XQN A;  5C4X B;  3C3L A;  4OL7 A;  2RKS A;  2Z1C A;  4XQJ A;  1PTO B;  3TDQ A;  2B2V A;  4ZUJ A;  5FOB B;  3GTG B;  1EWC A;  1XWE A;  5C3E B;  1B1Z A;  1FR3 A;  3HRZ C;  2NN6 H;  5FLX E;  4C3J B;  4Z9C B;  4KN4 C;  2XWJ B;  1TWA B;  3R8B A;  2R93 B;  1SSO A;  2F0G A;  3VR5 A;  3IL8 A;  4K5W A;  4A3G B;  3MTS A;  1I3Q B;  3TZD A;  5COY A;  2IJ0 A;  1II3 A;  4H44 C;  3R3O A;  2TSS A;  3S1M B;  3W3A A;  4K5X A;  3CU7 A;  2NVX B;  3SK8 A;  1EY5 A;  5EPK A;  3GQB A;  3PUX A;  3QOL A;  1QNU A;  1I50 B;  1L0Y B;  1A6X A;  4XYO A;  2AQ2 B;  5DM6 3;  1PZK D;  5D65 A;  4EGV A;  3L9A X;  1OXS C;  1H9R A;  3R2I A;  2R3Z A;  3IAY A;  3LWU A;  4LK1 C;  1MSH A;  5E4X A;  1V43 A;  1Z47 A;  1STY A;  1AZP A;  1PTO D;  4EVO A;  3FPU B;  1I4H A;  1EQV A;  4V0B A;  1S5F D;  1GOZ A;  3NTH A;  1BXT A;  2D5D A;  1BR9 A;  1YNJ D;  2EY6 A;  5C6A A;  5D3D A;  3T4A C;  2F0J A;  2L55 A;  3M3Y B;  4LMQ D;  5JOB A;  3EJI A;  4L6T B;  3ERO A;  1KLG D;  4PNY A;  2E75 C;  3I4M B;  2XWB B;  1CI3 M;  1MGS A;  1EZ8 A;  1O80 A;  5KIX A;  1PLF A;  5EBD A;  1SE3 A;  5E4W C;  1O78 A;  2O4X A;  2OF1 A;  1EEI D;  5I6Y A;  1GUN A;  2Z4I A;  3H6M A;  1K8O A;  1QWY A;  3CQZ B;  5FO8 B;  2Z8L A;  3TME A;  1WVL A;  2Q8I B;  2A6H C;  3Q23 A;  2KA7 A;  5IGE A;  3PUZ A;  3GV3 A;  2F4I A;  4DXG A;  1RF2 D;  3BG3 A;  2LMC B;  4A3D B;  4ZAI A;  1LT6 D;  3W2D A;  1WTX A;  2LY7 A;  1EOT A;  3N6R A;  3S1N B;  1CM9 A;  5I2X A;  2JA8 B;  3K5L A;  4S3S A;  5JEA J;  1KAA A;  5KYI A;  1F9S A;  1ZKO A;  1JR0 D;  3IFT A;  2WIN B;  4IFD G;  1OXV A;  3NP8 A;  4WOR A;  3MHB A;  4DNT B;  3H3V C;  4C56 C;  2IWH A;  2A68 D;  4IUV A;  4C3J G;  5EKI A;  1SNC A;  1EY8 A;  2NVY B;  4ULL A;  4RA8 A;  1OO9 B;  4F7X A;  4A3B B;  3FEW X;  1CFM A;  3SHL A;  3R2T A;  4IQZ A;  1ONL A;  3MA2 B;  4B08 A;  3OMG A;  2B2Y C;  2Z4H A;  4IUN A;  1E0B A;  1S4Z A;  5I6W A;  5COR A;  2VUM B;  4ZQ3 A;  1JC7 A;  2XSC A;  2G9D A;  1PFN A;  5HUR A;  4HTH A;  5F2D A;  3J81 E;  2B39 A;  4OHJ A;  5M9O A;  3TBI B;  2J0T D;  5DAU A;  3Q0A A;  1I4X A;  3SVM A;  2L9H A;  4OO1 I;  3OSO A;  3PUY A;  1LTT D;  3TP7 A;  4MIU A;  4KKU A;  1W6J A;  3WOE A;  4K6D A;  3VA7 A;  3EQL C;  3HOY B;  5J39 A;  5G3L F;  2B2T A;  2AQ1 B;  1KNE A;  1BUV T;  5E3F A;  3SR1 A;  3RD4 A;  3RZD B;  1VF5 C;  2CW0 C;  1E2W A;  1Z7T A;  1PTO C;  3HOU B;  1D5M C;  5KNC A;  4NP5 A;  1G2S A;  4DAV A;  1LTA D;  1SNM A;  1YNJ C;  3DUZ A;  1O7L A;  4KI0 A;  4BBS B;  2HUG A;  4C3H G;  1Q8I A;  2F0P A;  1TY0 A;  4OO1 H;  3H91 A;  4H7B A;  1NR2 A;  3FRP B;  3K5N A;  2E2H B;  3DHQ A;  2A6E C;  1ET6 A;  4KMU C;  2NYZ D;  3QOJ A;  4G7H C;  1IKL A;  4FF4 A;  4FXD A;  1XXG A;  2SNM A;  2NBF A;  1WD1 A;  3A8I E;  1BF4 A;  3A7A B;  3UI2 A;  2X6L A;  2DNE A;  4XQQ A;  2F0H A;  4QUF A;  2BCO A;  4DNR B;  4CHT B;  5A2Q L;  2KQ3 A;  1UUP A;  2PW5 A;  1B44 D;  2KED A;  1D1I A;  5C3X A;  3CKI B;  2M2L A;  3GD7 A;  3GP7 A;  3NTI A;  3OIQ A;  1LV9 A;  5K36 G;  1A2U A;  3MWY W;  1B9N A;  5BN4 A;  2F0E A;  2K32 A;  3X3N A;  3KK7 A;  4O1N A;  1SNP A;  1FNU A;  1DXM A;  3T13 A;  1G91 A;  4J8Q A;  1RTO A;  2I07 B;  3GTM B;  5KND A;  1SYB A;  3E5S A;  1TU2 B;  2F0L A;  2QF7 A;  1IL8 A;  1Q12 A;  1GXD C;  1A3U A;  2KJX A;  1H9J A;  2KUM A;  1R4P B;  2B2U A;  1SYE A;  4KJO A;  5EPL A;  1TS4 A;  5JJZ A;  5JPM C;  2PCF B;  2A74 C;  3L7Z C;  3J7A F;  3C1F A;  2WV6 D;  3D8G A;  4DK1 A;  2WKC A;  4K2K A;  1X3Q A;  2QKI C;  1C48 A;  1GUO A;  1LT4 D;  3HGB A;  1BO0 A;  1EYA A;  2NVT B;  1DOM A;  2K5D A;  2L4N A;  2L1B A;  2ZT9 C;  3BS1 A;  4K14 A;  2AUK A;  3HOX B;  4DN4 M;  4ZLT F;  1B2T A;  1YNN D;  4RH6 A;  1SE2 A;  4DGZ A;  1JWS D;  4XDX A;  2X6G A;  3I8Z A;  1QOH A;  4XT1 B;  3T51 B;  4M1U B;  1AFP A;  2EYJ A;  2L0C A;  1IW7 D;  4JK1 C;  3S16 B;  4KV6 A;  4X3U A;  2F0I A;  5KRU A;  1D6E C;  3P1H A;  2G9H D;  1BDO A;  5C0X G;  1EL0 A;  3SK5 A;  2F0N A;  1A15 A;  1JWU D;  2BDN A;  4QMG A;  1F9Q A;  2FMC A;  1NUC A;  1BQQ T;  3T56 B;  1EFI D;  5HGT A;  3HS0 C;  3OHX C;  1AP0 A;  3F2U A;  1K83 B;  1EWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...