1RD9D

Cholera toxin b-pentamer complexed with bivalent nitrophenol-galactoside ligand bv2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
b'TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cholera toxin B protein (CTB)
publication title Nonspanning bivalent ligands as improved surface receptor binding inhibitors of the cholera toxin B pentamer.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 25
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rd9D00
1LTID 3R8BA 3W2DA 3OWEB 1DJRD 1LT5D 1SBBB 1BCPC 1JWSD 2CHBD 1AW7A 1HTLD 1LTGD 2RDGA 5FKAC 3MFGA 4BWGB 1PRTC 1PZKD 1JCKB 1V1PB 3BVMA 2NTTA 3EA6A 3R2TA 1LTBD 1I4QA 4DXFA 3BYTB 1JWMD 4ZYSA 1CHPD 1PZID 1BCPB 5D3IB 1I4RA 3O13A 1B44D 1SXTA 4RH6A 1UUPA 1PRTB 1TS2A 1BCPD 1V1OA 1CQVA 1PRTD 1STEA 1SEBD 1V1PA 1I4GA 1LT4D 1TS5A 1LTAD 1M4VA 3URYA 1D5XC 1PYWD 4K6LA 1ET9A 2QEJC 2XNAC 1LT3D 1F77A 1FNVA 1SE3A 2Z8LA 1LO5D 1RD9D 1TY0A 1BXTA 1JQYD 3BYYB 1L0XB 1LTRD 1RCVD 3EFXD 1TS4A 1UNSA 4RGNA 3KLSX 3GP7A 1S5CD 2QILA 4RGMA 2ICIA 1EU4A 1I4PA 3MC0B 4RFBA 1AN8A 1EFID 1XTCD 2AQ3B 4RHSA 1KLUD 4C56C 1CT1D 1PTOC 3SEBA 1LLRD 2NTSA 5ELEA 1SJED 1I4XA 1KLGD 1G8ZD 3DWAA 2RDHA 4O1NA 2R61A 4RHRA 1D6EC 1LTSD 1BCPF 1PTOB 1SJHD 1ET6A 1I4HA 1FNWA 1HA5A 1ENFA 2XRQD 1PRTF 1PZJD 1PTOD 2WV6D 5FK9C 5ELDA 1S5DD 1T5XD 4OHJA 1B1ZA 1EEID 1RF2D 3BZDB 1S5FD 2IJ0A 2TSSA 4RCOA 1GOZA 1S5BD 1MD2D 4L63B 4L6TB 1PTOH 1DYQA 1LTTD 2AQ1B 1CHQD 4RGTA 1ESFA 1CK1A 1KTKA 5I4DA 3V05A 2AQ2B 2O2LD 1D5MC 2SEBD 3BVZA 3R2IA 1SE4A 4UDUC 4Z9CB 5ELBA 2IPKD 4RGOS 5ELCA 4DXGA 5D3DA 2G9HD 3DWPA 2XN9C 1HXYD 1TS3A 1EU3A 1HQRD 3TSSA 1D5ZC 4TSSA 5ELFA 5TSSA 1FGBD 1JWUD 1PTOF 2XRSD 3DWQA 1S5ED 1QILA 2J4XA 1EWCA 3CHBD 1L0YB 1TY2A 1FNUA 3BVGA 1SE2A 1EEFD 1LT6D 1RDPD 1JR0D 1XXGA 1FD7D
chains in the Genus database with same CATH superfamily
1VQEA 2JA5B 1GUSA 3BU2A 1GUWA 1P16A 4JI1L 5C6AA 2VW9A 5FKAC 1MJEA 2FMCA 4QB4A 2K03A 3B6YA 4A3DG 5L37A 3OWFA 4A3DH 1I4QA 1JORA 1HZAA 1HR0Q 3KK7A 1X9NA 1HNXL 2WINB 5EKIA 1MBYA 3PF5A 1O7LA 4LF5L 3GTQB 4LF5Q 2RVLA 4NXNQ 1PRTD 2R3ZA 5CV5A 2E2HH 4F88A 1N36L 1TS5A 4DNRB 4K6LA 2UUBL 1NY4A 2RSOA 4G7OC 3LGJA 4ZKCB 5I2YA 4N8FA 2MNAA 5LL6X 4FF2A 1A2UA 1KLUD 2FMMA 5IWAQ 2F0SA 1KNEA 3NTIA 2BOSA 5K36G 5K36H 4O42A 1I4XA 3DWAA 3I90A 4JI5Q 4OIKA 1BCPF 3T16A 1WTWA 3J7ZC 4QF4A 2E2JH 1L1OA 4TVAB 3H91A 2Y0SB 5KNCA 1ASYA 3STBC 2IJ0A 2TSSA 1VS0A 3QWNA 3X3NA 3FDTA 2PMZB 2DNCA 2EJMA 3AQQA 3FPUB 3K59A 3EROA 4A3GB 5IIFA 4A3MG 1BVSA 2AQ1B 1WTXA 4PMWA 2VXWA 3V05A 3K0YA 2E5LL 5ELBA 5KEEA 5JAVA 4H0LC 4P71A 3T56B 4LMQD 3M7GA 2Z4IA 3E3XA 5EQ0A 3UI2A 4YY3Q 1XPRA 2MGSA 5KNBA 2CKZB 4A93B 3M9BA 1I50H 4XYOA 1K8GA 3IRBA 3SXHA 3UDIA 3GTJB 4FF4A 2DGYA 4DAMA 4N9PA 3P20A 3P75A 1HA6A 1AH9A 5C5LA 1EWHA 1WI5A 2N3SA 4JI2Q 1NBWA 3ONAB 4OL7A 3GTMB 1U4LA 5IGBA 2UXDL 5BN4A 1J6QA 1LYLA 4R4QA 2UXDQ 3IL8A 3GTLH 2Y0SE 1AEXA 4LFCQ 4H13C 2NTTA 1HHVA 3EA6A 4XQQA 3BYTB 2CWPA 4ZYSA 2F3VA 2PMZE 5K5PA 2EQSA 2PO4A 4X65Q 4HIKA 3NELA 4P72A 3NTHA 4LFAL 5M9OA 2A68C 5J3BA 5HURA 4AQYQ 2NZHA 1LT4D 1Q46A 2EIFA 3T53B 2XNAC 4A3BB 3HOWB 5FLMG 1U4PA 2PQEA 3DMUA 5FLMH 1QVGA 4JOIA 1TS4A 3JC66 2WIIB 2RDFA 4RGMA 3QJYA 2A8VA 2RHQB 1RTOA 1EYAA 1F2LA 3J81j 4JI8L 3I55A 1K8OA 1J5EL 1ESRA 1D1KA 1J5EQ 2R92B 2M00A 3BDCA 2OF1A 1SSOA 1PH1A 1M90C 3EVQA 5CV6A 4LK1C 3K80C 1KIXA 1A2TA 1HR0W 1PZJD 2ZJQA 4B3TL 3MWYW 1EEID 2RCFA 2WAQB 3W1BA 5IGEA 5CR3A 4DK0A 3K7UC 4HJ7A 1Z7TA 1GOZA 1WOCA 4IJLA 2G9DA 4C3HB 2NZOA 2MUYA 2A1AA 2AKWB 4DV4L 1Z47A 1CK1A 1F2MA 1JMCA 3A8KE 1SFOB 1EIFA 2PQAA 3N6RA 2IY5B 2MFIA 4DNTB 2VB2X 1ZXTA 4DV2Q 1TWGB 2EDGA 4JI3L 1KQSA 2B2VA 2YTXA 2ZTEA 1DONA 2CCZA 1VQDA 1PMRA 2P5ZX 2LXKA 2XIWA 2LSSA 3DWQA 5GADC 1B4OA 1QILA 3S15H 2YV5A 4DAVA 2HQLA 4L5SA 1LM0A 2XSCA 2IL8A 4G7ZC 1JR0D 3Q0AA 1AW7A 5IT9c 2QA4A 3AEVA 4KD4A 4BWGB 1VQAA 1PRTC 5C44B 1SYGA 2I46A 2EY6A 2WAQE 1C8CA 3R2TA 1SYBA 1D8LA 1IBML 2CH4W 1IBMQ 2OEOA 2UUAQ 2CQAA 4UY8C 3I3CA 1E1OA 1H9SB 4N8X1 4EVOA 5IP7G 1LUZA 1UAPA 5IP7H 3OMGA 2K7VA 4B9WA 5IYCG 1UEBA 2X69A 3TEHB 4HIMA 3HOUB 2B2WA 3GTKH 2BDOA 5C0XI 5IYCH 4KKTA 1F9QA 1WD0A 1F77A 4QIWB 3TP6A 1ILPA 5CBEE 3TS0A 4PZ6A 5DLQE 3PO2B 3KBGA 2F0JA 1TIID 1QUQB 4HIDA 1AP0A 2ENBA 3I4MB 3QR8A 3J80i 2F0GA 2JA7B 1A3TA 1VDZA 2C35B 1SJED 2OCEA 1TQOA 4IO9A 4X6AH 1M8AA 3F1ZA 1KXLA 3I4NB 4WJ4A 2QKIC 4LF9L 3BS1A 2PW7A 1Y14B 1SMYD 1Y1WG 1Y1WH 4BS9A 2X6GA 1L1OC 1K8AC 2KCCA 1U5KA 1S40A 3S9WA 2B39A 3SK6A 1EWIA 4DK1A 1K83B 4JBMA 2Q8IB 2A69C 1TWAH 1ESFA 3J80E 2F0QA 3MVVA 3SVMA 4FVMA 1SN8A 1VMCA 2AHOB 2ZJRA 3IAYA 4B3MQ 4AH6A 2DJFC 4QIWE 5HY6A 3W5OA 3BJUA 3UE0A 1PH8A 3G6JB 3GTGH 2NVTH 1HCZA 3CC2A 1X3PA 2K6AA 2KJXA 4E6IA 1VQ5A 1KAAA 2BH2A 1SNPA 1UWVA 2F0KA 1DOMA 1X3EA 2OXPA 3TP7A 1TWCH 2F0HA 2RA4A 4NP5A 2BE5D 4ZQ3A 5I6WA 4GKJL 4A3DB 1VQ8A 3HKZG 4R4OA 2IX0A 1EEFD 1LT6D 1G6ZA 3E6ZX 4H02A 4X62L 4NDXA 3W2DA 4C1NK 1MSHA 1OO9B 2UU9Q 1MIUA 5M5YH 2F03A 1NCVA 2E2HB 1FVIA 1H9SA 4NMZA 2I0QA 1LTBD 1JWMD 3J7A5 5D3IB 4ABNA 1CZGA 3CQZH 2UXBL 4I65A 3KLSA 4RKBA 2PI2E 1JE5A 1EIHA 2UUCQ 2ICEC 3H0GH 3A0JA 5IGDA 1STHA 1OTCA 1UE1A 1YZ6A 2D5DA 1VQHA 3UE1A 5IGCA 2QEXA 2K50A 5AJ3L 1FNVA 3H3VH 4JOIC 2LXJA 4DV6Q 4C56C 2E2JB 1R4PB 1LLRD 3GTMH 4XQJA 1TT2A 2XVSA 4JBJA 1GHKA 3IFDA 4RA8A 1MKHA 3C1EA 1EY7A 5GQOA 3M4OH 5EKKA 4DR3Q 1CKNA 4DGZA 3MZ5A 4A3MB 1ENFA 4JBWA 5ELDA 3NE5B 1YJ9A 5M3MG 1B1ZA 1B2TA 1RF2D 2PI2A 5M3MH 4B3SQ 1EQVA 1Y69U 4PMBA 1BBWA 2JA8G 3K0XA 2JA8H 4YWKA 4MNOA 1HRJA 2DY7A 1CHQD 1I50B 1VQFA 3H15A 2O4XA 5C4HA 2N55A 4Z9CB 4O2DA 1X3FA 2VZAA 3CPFA 3HS0C 4JC0A 4CKBA 2K32A 2K01A 2PYKA 1IYUA 4PV1C 5GAEC 1PYBA 2RSNA 2D9UA 3EBEA 1IKMA 2E8GA 2IWHA 4OELB 1WD1A 3ULJA 3I91A 2B2VC 1WTHA 1U4RA 3HRZC 3J80L 3HOXG 3GTLB 3NBHA 4C1NI 1BF4A 1XPUA 3MFYA 3HOXH 3CCEA 1II3A 3K5MA 1TY2A 2MQHA 3K5NA 1SNQA 5EAYA 4A3EG 3I72A 1XXGA 1PFNA 4A3EH 3D4WA 3NQIA 2HHHL 3KFUA 3D8GA 2ALYB 4X66L 3L9AX 2HHHQ 1SAPA 3AYHB 1B9NA 4X66Q 5EJWA 1EIYB 1ONLA 4KHPQ 2F0TA 3GO5A 3RLNA 3Q23A 2E76C 2WACA 3OYYA 4OX9Q 3VYRA 1VQOA 5LL6S 2DN8A 2EY1A 3A5UA 1KL9A 4YCUA 3TBIB 1PV4A 5E3FA 4QUFA 4PG3A 4N9TA 1PYWD 4BA2I 1K8MA 1TWGH 2B2WC 4C3JG 3M3YH 4C3JH 1LO5D 3RZOH 3K8AA 3HZXA 1TVXA 1QOHA 1VQ4A 4XDXA 4DV3Q 2IX1A 3MXNA 1Q7YC 4ZLTF 4KKUA 5DM73 3PV0A 5T1IA 2ZT9C 1SMYC 3GQBA 2ID0A 5JJKA 4YWLA 4R4IA 1OXUA 3BZCA 1NE3A 4DR1L 1NUCA 5E4WC 4O1NA 2EYPA 1N33L 1TKWB 2IT1A 1ZKOA 2Z0SA 3I7FA 3J81E 2K5NA 1PRTF 4KLKA 4XTCS 4CBVA 3MXPA 3Q6SA 2KCNA 1I5FA 1HNZQ 1H9KA 5I9OA 1X56A 4KK7A 3S16H 4L63B 4WJ3M 4I7ZC 1N8RC 4DAYB 2WKDA 1SE4A 4FYDA 4RGOS 1YEZA 2GN5A 3S15B 4DXGA 4DAPA 5C4XG 4UHVA 1KABA 5C4XH 2Z1CA 4IPHA 1PFBA 4X64Q 3JAME 4Y7NH 4LJZC 3TP5A 2JSOA 4IUQA 1BKBA 2ZM6Q 1SROA 1XX8A 2EY5A 4MTNA 4DV1L 1FNUA 1Y8OB 3OIQA 4FDBA 4DV5L 4DR5L 2WFWA 3RN2A 4OO1G 4DV5Q 4DR6L 4OO1H 2H4OA 2HUGA 4DR6Q 2NZ1D 4RAUC 4LUZA 4ZAIA 3HOZG 1B70B 3HOZH 2JEBI 2N49A 4DV7L 1FJGQ 5I6YA 2OWOA 3GTKB 5I2XA 1U4MA 3S2DH 2EYFA 1PZID 1I4RA 4EQ5A 4JI0Q 4IUUA 3WOFA 2DJGC 3KDFB 3PO3G 5BN5A 1L2FA 3PO3H 4DF7A 1V1PA 4U673 1HNWQ 5D14A 1VQJA 2A6HD 3KJPA 4K8JA 5GAHC 4UP9A 1BO0A 3SHLA 2LS01 2A19A 4JI1Q 1RCVD 3OOCA 3KLSX 1XTDA 4DUYL 3OPOA 1XNQL 4JPBW 2O5IC 5NUCA 3CCJA 4ZRZA 1I6VC 1Y1WB 3S1MH 2WB1G 2NYZD 1HNXQ 5ELEA 1STGA 3V96A 1QNUA 2QGQA 1M1KC 2EYHA 2F0PA 1QJOA 1CSQA 1N36Q 1K0RA 1TWAB 2YYZA 3Q22A 4GNXA 2WKCA 3S14H 2CFMA 3R3OA 2UUBQ 4OHJA 4GKKL 4K14A 4KMUC 2F3WA 3CU7A 3S1QH 3EQLC 4KY7A 1VF5C 3CC7A 3PGZA 3AFQA 2KCTA 3PIP3 2MHVA 3GTGB 4L6TB 2NVTB 5M5WB 5GROA 2JK8A 3SGIA 2B8GA 3J81L 1PFMA 1SYEA 4BXXG 2LMCB 5KIXA 1TWCB 4BXXH 3E9HA 5ELCA 4DR2L 5D3DA 4DNIA 2E74C 4X3UA 4L5RC 3HKZB 4ALPA 2FHTA 2NVQH 5EPJA 1HQMC 3Q24A 5M5YB 1CFMA 3ICEA 4DK3C 1LTLA 4HN7A 1ZYRD 4U68A 1WTRA 4IZ8A 3I4LA 1IXRA 4RG1A 4A3MH 2CWAA 1SE2A 1X6OA 1D1IA 3PSIA 4L5TA 2F0DA 1S72A 3CQZB 3DUZA 1ICWA 2EY2A 2EJGC 1DJRD 1DZ1A 2E5LQ 2EOTA 3JAML 3A56A 2NVYH 1UE5A 1K3BC 3H0GB 1VQNA 3F2UA 1PVOA 4PZ8A 2EVBA 2EZVA 4L8JA 2C5CA 4RH6A 1MGSA 4XT3B 5CYUA 1S4ZA 3U9SA 1PH6A 2D2CC 5IGGA 1VQGA 4Q0FA 1VQLA 2IHEA 1M4VA 4K2KA 4JI7L 2JA6G 1W6JA 1LT3D 4JI7Q 2JA6H 1R4QB 3HKZE 5KNDA 1BXTA 3BYYB 4R4CA 3VYTA 3M4OB 3HG9A 3CKIB 5FO7B 1Y1VG 4IFDJ 1JT8A 4RFBA 2K5VA 1Y1VH 1O7YA 2NN6I 5A35A 4PNYA 3SEBA 2L55A 4KJNA 1GD7A 5M3MB 1EY8A 3MTSA 4J6HA 2Q2HA 2K75A 4JK1C 4HMIA 2R61A 4LFAQ 2JA8B 2Z6KA 3MEHA 2DNEA 2VQFL 5A2QL 3KUPA 1DM0B 3PQIA 4PZ7A 1F2ZA 2PCFB 3BZDB 2ZJPA 1HH2P 3S24A 4DN4M 5IY0A 3M4QA 1RTNA 1B50A 3A5ZB 1LV9A 1SNCA 3J80c 2KCMA 3RMHA 3CCUA 1XMOL 5LMNL 4JI8Q 1C0AA 1KRTA 1YBYA 4X3SA 1HUNA 3HOXB 4HJ5A 1SYFA 1JICA 1UEAB 3CRKC 2KOLA 4NXML 1BQQT 3VR3A 4K0KL 3T1YL 4NXMQ 3CC4A 4LW1A 1VQ6A 4A3EB 3D4RA 3T1YQ 1E24A 4B3TQ 3NXWA 1JE4A 2EXDA 1U9RA 3HOYG 4DUZL 4EGVA 1S5ED 4F8MA 1Q82C 4BY7G 1F9PA 3HOYH 1EWCA 2HT1A 4RWSC 3I73A 3BVGA 3OMCA 5DEHA 3G48A 4DV4Q 1RODA 4X3KA 1K3RA 2L1BA 1S3OA 2HD3A 2B63G 4LAAA 1SDFA 2B63H 1HTLD 2HCCA 4AYBG 1JOKA 3FHWA 2IX3A 1WTQA 1IKLA 2PZTA 3BVMA 3RZDH 1E1TA 2L9HA 2A6HC 1TU2B 4K6DA 1JC7A 3M3YB 3O13A 3OSOA 1EY4A 4C3JB 4JI3Q 3CD6A 3RZOB 1HZBA 2X6LA 5EBCA 4JV5L 1DXMA 3TZUA 4A3JG 1Y8PB 4A3JH 1SMXA 3CCSA 2D62A 1VQKA 4GN4B 4ZUJA 4IPGA 3HP3A 4R8NA 2OTJA 5FO9B 1L0XB 3I8ZA 2QILA 1I3QH 4HR7B 1EFID 2J7ZA 3K58A 1BUVT 2B2YA 1B3QA 4EQOA 4JI4L 2JA9A 1Q8KA 4Q5VA 4LF4L 2A5HA 3SDZA 2IW3A 3AFPA 3PIO3 4FXGC 1C4QA 2YTVA 3L2PA 3S16B 4HSPA 1WYDA 3KJOA 1LABA 4KTAA 1AZQA 2JYOA 4GNXC 2D0OA 3MAQA 3OHXC 4HJ8A 1K73C 1CKOA 2F0OA 3VR4A 1MD2D 1W2BA 4KHVA 1PTOH 5C4XB 1QE6A 4Y7NB 4ZUIA 5I4DA 3M4YA 4QJFA 4UDUC 1MSGA 3G7LA 1PHJA 5C0XG 5C3EG 2A6ED 5I9PA 3MHBA 3S1NH 3PUWA 4OIJA 5C3EH 1HPCA 2RF4A 1QZGA 4LF9Q 2ZXPA 5J1ZA 4OWXB 1JOQA 3KF6B 1EU3A 1J8IA 2K14A 4OWTB 3CW2C 2GVAA 4GZYC 3KYHC 3HOZB 4YCVA 1EOVA 5BR8L 3DEOA 2QDBA 3QG1A 4KHZA 2Z9HA 4JW0A 5BR8Q 3S2DB 5C4JH 1RDPD 3G6EA 3V2TA 3RLFA 1BDOA 5CC4A 3LWEA 2F0UA 4X3TA 4FO2A 3PO3B 4IJHA 3VR6A 1OXTA 4A3FG 5M5WH 1QCBD 4XXEA 4F7XA 3KBXA 4A3FH 5EKLA 2M2LA 4DV0L 2E75C 1UUPA 1EY9A 2CQOA 4XT1B 3R93A 1TWFH 4K5VA 2R93G 4GKJQ 3X3MA 2KBNA 3ND8A 2R93H 5CV8A 4DR4L 3S1MB 1D5XC 1NAPA 5E7NA 4R8IA 4DR4Q 2WB1B 3QOJA 4MN3A 5EGTA 4X62Q 1IZ6A 4LF7L 4J15A 4CJ2C 1D7QA 2F0LA 4LF8L 1GKHA 1ILQA 5ELOA 3ULPA 3S14B 3GTPB 1D2BA 2ZTDA 1IYJB 2FJ2A 3S1QB 2UXBQ 3J81c 4QQBX 1XWEA 2SNSA 4JBKA 1T9HA 1ENCA 1X65A 2Z6KC 4YHHL 1QUQA 4YHHQ 2AUKA 4JVZA 3U9OA 2RQXA 5FLXL 3P7JA 3KF8B 5AJ3Q 4GLXA 2NB0A 1DGSA 1SRUA 4CKEA 2VUMG 1F9SA 4ILWA 2G5DA 1VQPA 2VUMH 2NVQB 2GVBA 1A62A 5IOCA 2SEBD 5JJIA 1ML0D 1RKNA 5M3FG 1B7YB 2WB1E 2HQEA 2KEDA 4ID6A 3F2BA 4CDCC 5M3FH 3JAMc 3DM1A 3I4OA 1TS3A 1SE8A 3VR5A 1FGBD 1TR5A 3TN2A 2VY3A 1TXYA 2NVYB 1CA6A 4JI6L 4KD3A 4LWCA 1KD1C 1RL2A 4KN7C 3SR1A 1SNMA 1OXVA 2ASBA 2CHBD 4UAIA 1PLFA 3H3VC 3QIAA 1JCKB 4HTHA 2QCPX 1PA6A 3E0JA 1E22A 3NK9A 2JA6B 5FJ8G 2UXCL 3DXJC 5FJ8H 4B3RL 1SYCA 1WTVA 4LF6L 4R9WA 4BA1I 5T1GA 2UXCQ 3S17H 4LF6Q 1Y1VB 4B9XA 1G6PA 1Q1EA 1PXUA 3RR5A 1E2VA 2QEJC 3NPPA 2N78A 1WCMG 3TDQA 2D0PA 1WCMH 2BA0A 4CDDC 2K05A 1VQBA 2B2YC 1EOTA 1EYCA 4V190 3PF4A 2F0WA 5J22A 3A7LA 3H6MA 2KENA 1R9TB 4QUCA 4MHEA 3FRPB 2RKSA 2RDHA 3CAMA 3KF8A 3STBD 3G71A 3J81i 1H9JA 1PFSA 4JG2A 2OTLA 3U4ZA 1SJHD 3PUXA 2LKVA 3NENA 5FO8B 4IN3A 3NWSA 2I5HA 1S5DD 3K5LA 4C3IG 5JEAG 5JVG3 1EQRA 1A8VA 2OQKA 4C3IH 4S3SA 5JEAH 3HOVG 1N32L 2A6EC 3P1HA 3HOVH 2FFKB 3LX0A 5KYIA 5GAGC 5E4XA 2KHIA 3CCMA 4GLVB 4QY7A 2OT2A 4RKLA 1KTKA 2AQ2B 2NUCA 2OQ0A 4DR1Q 4HCSA 1IBLL 3HOYB 4K5WA 2ZTCA 1N33Q 4BY7B 1NMGA 4V0BA 3DWPA 3ZYYX 2CVRA 3TQYA 3JAMi 2L5TA 4KY6A 1O7ZA 4K5XA 5TSSA 2K1BA 2B63B 2JEAI 3A8JE 2H5XA 4A4IA 4AYBB 4LUVA 4BBRG 4GLAC 2JXMB 3RZDB 1G51A 1HZ9A 3M7NA 4RCNA 1AFPA 1ENAA 3CHBD 4BBRH 3EIVA 1VQ9A 4IFDI 3LWUA 3K7AH 4ULLA 1FD7D 1SBBB 4HSVA 2AWOA 1NTGA 1JB3A 2BE5C 1N34L 5KGUA 4A3JB 5C3XA 1PZKD 2A68D 4DXFA 4HMJA 2ATWA 1B44D 4L5QA 1F2YA 4HEDA 1GUNA 3EN2A 4I7AA 1I3QB 4G57A 1CQVA 3QO2A 5CMDA 3PIPA 1STAA 1HJPA 4DV1Q 4RMFA 3WWVA 3GTOH 4DR5Q 4J8QA 1NR4A 4A3KG 1STBA 3KLRA 4A3LG 5M5XH 4O0AA 3KOJA 3PUZA 4A3KH 4F87A 4FXDA 4DKAC 4A3LH 3NTKA 4BY1G 1AN8A 5JPMC 3K81C 4DV7Q 1NNXA 2AQ3B 3QOLA 3T1HL 4BY1H 4AYBE 2O5JC 1L1OB 2PZWA 1KDBA 3U58A 3D4DA 3RLOA 3W3AA 3TREA 1HFGA 3A55A 1SNOA 1I6HH 4P74A 1PTOB 4OGQC 5LMUL 3CF5A 3PMFA 2XRQD 5CV9A 1K28A 5FK9C 2F0VA 5A2QE 1O78A 4HJ9A 2HDMA 1YVCA 1A6XA 3S1NB 2YU9H 1VQCA 1VCIA 5C3EB 4OONA 2CH4A 5IODA 2IHFA 4DUYQ 1XNQQ 5FOBB 4HIOA 4HJAA 1YHBA 4G4KA 4C2MB 3F2CA 2PNRC 4KI0A 1C48A 4UPAA 3EJIA 2B2UA 4DFAA 2MO0A 4POFA 3L3OC 3OIPA 4CKCA 5C4JB 1ZEQX 1K9MC 3GTPH 4PMCA 1HR0L 4J1MA 4DAYA 2CW0D 4GKKQ 3RUZA 3GV3A 4NXNL 4GS3A 3TS2A 3NBIA 1Q86C 1MJCA 3QB3A 3CCLA 1EY5A 1L0YB 3NSWA 2LY7A 4A3FB 3BDLA 3ULLA 1KHIA 4XYQA 3VYSA 3OWEB 1CUKA 1TWFB 4G7HC 1W6KA 4IALA 1CI3M 5EBDA 4YIJA 2R93B 4DR2Q 1B8AA 4DA2A 3I56A 1IL2A 1GUTA 1QZHA 1NSNS 2Q2IA 5IWAL 1CHPD 1BCPB 4GN3B 4HCEA 2B2TA 3BZKA 4JI5L 1O80A 4K8IA 3BG3A 3OW7A 5JEAJ 3HEJA 1I4GA 1W3SA 3PUVA 5ELNA 1PYSB 5CGKA 5IP9G 4GOPB 1IBKL 1H9RA 5IP9H 1IBKQ 5IYDG 1QB5D 1CZWA 5FLXc 5IYDH 3KDFA 2R7FA 3EFXD 2VS1A 2V1CC 4RGNA 1A63A 4H7BA 1I4PA 1MHWC 4CGYB 4AIMA 4OWWB 4EQPA 1JJCB 3ND9A 1O7IA 4QMGA 3LNNA 3HGBA 1CM9A 4RHRA 3DLLA 1Q90A 1X54A 1G291 2VUMB 3S1RH 4YY3L 1FNWA 3BDOA 1PTOD 3ERSX 1X55A 2WV6D 5COYA 2A69D 3H94A 3M85A 1IYVA 2GA4B 1YJWA 2PQAB 1BNZA 5M3FB 3D3RA 3SE0A 4NKLA 2AUJD 2A73B 2EYLA 1V43A 2B8FA 1LTTD 5IGFA 2NVXH 4JI2L 4QCLA 4K2LA 3C3LA 2VNUD 1IHZA 2N8NA 2O2LD 4BBSG 4XQNA 2KQ3A 4BBSH 2K04A 4LFCL 2F3IA 3CCQA 2VQFQ 4H44C 1WJJA 4ME3A 3CMAA 5DAUA 4XIGS 3GDEA 3C46A 2NN6G 1D5ZC 2NBFA 3A54A 4X65L 1R9TH 1JWUD 2NN6H 2PW5A 3F8TA 1EFWA 4CJ0B 1KDAA 3TRZA 2SDFA 4TQUS 4P75A 1TWHH 3D31A 3H09A 2Q2TA 3M4PA 4AQYL 1A3UA 3ER0A 4QL5A 1XMOQ 1A15A 4QGUA 3T4AC 3OTOL 5LMNQ 2B3GA 2VL6A 3OTOQ 1WTPA 2F52A 5D65A 2ZXRA 3S17B 1JWSD 4IUTA 3PIOA 2KVMA 3MFGA 3MXUA 3F2DA 2MPMA 3CMEA 2E2DC 2F1MA 5EPLA 1C7YA 4LFBL 4K0KQ 4LFBQ 2AWNA 1Z9FA 2HIVA 2KECA 4YCWA 4GOPA 1FGUA 5F2DA 1IW7D 1BCPD 1H9MA 1WCMB 4DUZQ 2PPBC 4BY7H 3L7ZC 3TP8A 1QNKA 3UDGA 1VF7A 2HDLA 4GN5A 3URYA 2EXZA 1Z6HA 2RCNA 3MXGA 1SE3A 2Z8LA 3ZJYC 1YNND 3GP7A 3SK8A 1PH4A 1SLJA 2L11A 1XTCD 4IUNA 4TKOB 2BCOA 4IOAA 2L4NA 1Q8IA 4MZ9A 3PCOB 1HZCA 1Y8NB 4C3IB 2FINB 3I70A 1KLGD 3HOVB 4JV5Q 2A74C 3DM3A 3T51B 4P73A 1RHPA 2VQEL 1WTOA 1VMPA 2VQEQ 1ET6A 1SNDA 1HA5A 1KAWA 4DV2L 1X3QA 1XJVA 1S5FD 4A75A 1GUOA 5FLXE 2XWJB 1PH7A 3NEMA 5HGQA 1DYQA 4JI4Q 4LF4Q 1BBUA 2Q2UA 2EYMA 1Q3LA 2CW0C 5HGTA 5JJZA 5JOBA 3R2IA 3BVZA 1L0WA 3NHHA 2E2IH 2B2UC 2IPKD 1YHQA 5J39A 4IPCA 4BBRB 4NW2A 5EPKA 2LFNA 2R7DA 3FKIG 3I2ZA 2JQOA 1HXYD 3FKIH 3K7AB 3FVQA 4Y52H 2UUAL 1YITA 1STNA 5CORA 4DK6C 1G91A 1G2SA 4JCVE 3CP0A 5BN3A 2K4KA 2J4XA 5G3LF 1E7ZA 1KC8C 3S2HH 2BDNA 1ICFB 4DR7L 1LTID 1NJIC 4DR7Q 3E9IA 2F0MA 2JE6I 1A0IA 1ZYRC 3VA7A 3SK4A 5C0XH 1B9MA 1RIPA 1EZ8A 3CCRA 1B53A 4A3IG 5ISRA 1YJNA 3C2PA 1X3GA 2R7ZG 4DPGA 4A3IH 3GTOB 2SOBA 2R7ZH 4C2MH 5M5XB 4A3KB 2JA5G 2PZUA 1A3VA 3A74A 3GD7A 2JA5H 1E2WA 1I94L 2B2TC 1EZ6A 1H95A 1I94Q 2XGTA 1XMQL 2I5LX 4BY1B 4WJWA 2RHSB 4KY5A 1XMQQ 1GVPA 4EX5A 1E0BA 3NP8A 2V4DA 4FXKC 3K57A 2Q8RE 4WRDA 1TY0A 1JQYD 3GTQH 1I6HB 4WFN3 2ICIA 1CKNB 3FP9A 4IQZA 1GXDC 3CPWA 5LMNW 3C1FA 1YI2A 1PTOC 4DV0Q 1QWYA 1EYGA 2YU9B 1DCZA 1G8ZD 4FF3A 4B3ML 3D6CA 2EJFC 3L0OA 1YNXA 5CV7A 1V9PA 1CQFA 1AZPA 1K0SA 4ZKBB 1KNAA 4OXPA 4LF7Q 4JYAL 1DOLA 3FPPA 1CA5A 1S5BD 4JYAQ 4LF8Q 3HKSA 3MEFA 2ES2A 3TMEA 4RGTA 1F9RA 2Y0SG 3K6OA 3AU7A 2UU9L 5DNFA 1D5MC 2QW7A 3NBHB 4KN4C 4KV6A 1PH5A 4A3GG 2KHJA 4A3GH 3H3VI 2N88A 3TSSA 1HTPA 3NUCA 2EPBA 5ELFA 1HFNA 2K5QA 5G3LD 3VDYA 2EE1A 2B29A 2VB3X 2XRSD 4NPSA 1QVFA 2J0TD 5AFWA 2UUCL 2HCIA 2MO1A 1U0LA 3H0GG 4A3CG 4A93G 3KF6A 5CV4A 2XWBB 4A3CH 4CJ1B 4A93H 3R8BA 1IW7C 1BCPC 2R6GA 3UDFA 1VQIA 1YNJD 3NQTA 3GTJH 1V8QA 4DV6L 1N9WA 1STYA 2WP8J 4CHTB 1PH3A 1NR2A 5IT9E 2KHSA 3SK5A 2M9VA 1OXSC 2K52A 1JJ2A 3CCVA 3CRLC 3E5SA 1SXTA 3VR2A 4GOPC 1YNNC 4KKSA 1UE7A 1CKMA 2K33A 2K5WA 3MXNB 5LHY1 1V1OA 1ASZA 1BOSA 4JI6Q 4DR3L 1GUGA 1STEA 2F4VL 1EQQA 4ODGA 3IFTA 1YHAA 2F4VQ 2F0IA 4LNQA 1DD2A 2HIXA 4B3SL 2AMCB 3GV6A 1SYDA 4OEMB 1VQ7A 3RNUA 4MIUA 1UNSA 4YWMA 2Q8TA 1S5CD 1EU4A 3S1RB 1FR3A 1OXXK 4RHSA 3TZDA 1EIGA 1GO3E 1CT1D 1JJGA 4A3BG 3VYUA 3HOWG 4NB3A 3WDNA 4A3BH 2BA1A 4B3RQ 3HOWH 3IKJA 1KRSA 1Q81C 3A8IE 4IURA 4DU9A 2H1EA 4M8AA 1QVCA 2NVXB 1NMFA 1T5EA 4ZK9B 2EYOA 5H1SE 2XTIA 3RD4A 1T5XD 2PNHA 1PH2A 2K28A 4BBSB 1FL0A 2R92G 2DUDA 4IUVA 1GHJA 2R92H 1EUJA 2C9OA 1PDQA 5C0XJ 1CSPA 1EYDA 1AE2A 3U50C 2L0CA 1V1QA 4MTKA 3HFZB 1E3PA 2WAQG 2F0EA 3K5OA 1TWHB 3J7AV 4C3HG 3AB9A 1IL8A 1DOKA 4C3HH 3A7AB 2G9HD 2KA7A 4KHPL 2XN9C 4M1UB 5C4ZA 4OX9L 1BR9A 4TSSA 4FF1A 3RN5A 1J9OA 1N32Q 1QG7A 4ME5A 2KUMA 4A76A 1SFOH 1XNRL 5JPNC 3VA5A 1XNRQ 5C5MA 2JJQA 2MJ8A 5C3WA 3AMUA 2DY8A 1UE6A 1EY6A 2BH8A 2ZXOA 1VQMA 2KEEA 4UP7A 1LT5D 1IBLQ 2FXQA 4DV3L 1LTGD 2RDGA 2QF7A 1V1PB 1LACA 2SNMA 2L12A 4FP5D 5JVH3 1JOOA 5DM63 2EYJA 1PRTB 2JN4A 1TS2A 1E2ZA 3PUYA 5C44G 4P2CB 1SEBD 3N52A 5IE8A 5C44H 1LTAD 3Q8DA 3UDXA 5E1FA 1ET9A 5IYBG 3KLWA 1JB7A 5JJLA 5IYBH 1GM5A 1HNZL 5IT9L 2F4IA 1Q1BA 1RD9D 3W1GA 3OW2A 1WFQA 1LTRD 4CDFC 1N34Q 3MC0B 3DHQA 3J7YW 1BBXC 1EL0A 4GNXB 3FEWX 3HOUG 1SR3A 4IUPA 4APVA 3HOUH 2NTSA 2F0NA 4ZCKA 4IFDG 3FMCA 1WVLA 4IFDH 2NWGA 2Z6BA 3WOEA 3PO2G 1D6EC 1LTSD 3PO2H 4OO1I 4IOCA 2RBMA 1I4HA 3I4MG 1MI2A 2TMPA 2JA7G 3I4MH 2JP1A 4LUOA 4X64L 4R4TA 2JA7H 2E2IB 2K5HA 4POGA 1XYIA 5CBAE 3G4SA 3I4NG 2ZM6L 4CDEC 4R1JA 4RCOA 3I4NH 4B08A 2K5DA 3D6WA 1CTMA 5KRUA 3T1HQ 3FKIB 1YIJA 4TRDA 3E0EA 1EQTA 3T13A 1B3AA 4PQXA 3U4VA 3D0FA 3MA2B 1XPOA 1AE3A 1HUMA 2I07B 1P8LA 4WORA 2YTYA 2Z4HA 3J7AF 3S2HB 1FJGL 1GJXA 2I5MX 5LMUQ 3DEPA 1PH9A 1K83H 2L15A 1HQRD 3CXCA 5KYLA 4JI0L 2F0FA 1PTOF 4FNFA 4EQNA 1C9OA 1X32A 1YNJC 1G2TA 4HAEA 3NWTA 1EY0A 4A3IB 2QDLA 2MP1A 4UP8A 2R7ZB 1HNWL 1FYCA 3ITPA 1KDCA 1RJTA 4KJOA 1Q12A 4IPDA 3ERQA
chains in the Genus database with same CATH topology
2JA5B 1GUSA 1GUWA 5C6AA 5FKAC 2FMCA 4QB4A 2K03A 3OWFA 1I4QA 1JORA 3KK7A 2WINB 5EKIA 1MBYA 1O7LA 3GTQB 2RVLA 1PRTD 2R3ZA 5CV5A 4F88A 1TS5A 4DNRB 4K6LA 2RSOA 4G7OC 4ZKCB 5I2YA 5LL6X 4FF2A 1A2UA 1KLUD 2FMMA 2F0SA 1KNEA 3NTIA 2BOSA 5K36G 5K36H 4O42A 1I4XA 3DWAA 3I90A 4OIKA 1BCPF 3T16A 1WTWA 4QF4A 3H91A 2Y0SB 5KNCA 2IJ0A 2TSSA 3QWNA 3X3NA 3FDTA 2PMZB 2DNCA 2EJMA 3FPUB 3K59A 4A3GB 3EROA 5IIFA 2AQ1B 1WTXA 4PMWA 2VXWA 3V05A 3K0YA 5ELBA 5KEEA 5JAVA 4H0LC 3T56B 4LMQD 3M7GA 2Z4IA 3UI2A 5EQ0A 2MGSA 5KNBA 4A93B 4XYOA 3SXHA 3GTJB 4FF4A 4N9PA 3P20A 3P75A 1HA6A 5C5LA 1EWHA 3ONAB 4OL7A 3GTMB 1U4LA 5IGBA 5BN4A 3IL8A 1AEXA 4H13C 2NTTA 1HHVA 3EA6A 4XQQA 3BYTB 4ZYSA 2F3VA 5K5PA 2PO4A 3NTHA 5M9OA 2A68C 5HURA 1LT4D 3T53B 2XNAC 4A3BB 3HOWB 1U4PA 2PQEA 3DMUA 1TS4A 2WIIB 2RDFA 4RGMA 3QJYA 1RTOA 1EYAA 1F2LA 1K8OA 1ESRA 1D1KA 2R92B 2M00A 3BDCA 2OF1A 1SSOA 3EVQA 5CV6A 4LK1C 1A2TA 1PZJD 3MWYW 1EEID 2WAQB 5IGEA 5CR3A 4DK0A 1Z7TA 1GOZA 2G9DA 4C3HB 2MUYA 1Z47A 1CK1A 1F2MA 3A8KE 1SFOB 3N6RA 4DNTB 2VB2X 1ZXTA 1TWGB 2EDGA 2B2VA 1DONA 1PMRA 2XIWA 3DWQA 1B4OA 1QILA 4DAVA 2XSCA 2IL8A 4G7ZC 1JR0D 3Q0AA 1AW7A 4KD4A 4BWGB 1PRTC 5C44B 1SYGA 2I46A 2EY6A 1C8CA 3R2TA 1SYBA 2OEOA 2CQAA 3I3CA 1H9SB 4EVOA 1UAPA 3OMGA 2K7VA 4B9WA 2X69A 3HOUB 2B2WA 2BDOA 5C0XI 4KKTA 1F9QA 1WD0A 1F77A 4QIWB 3TP6A 1ILPA 5CBEE 3PO2B 3KBGA 2F0JA 1TIID 1AP0A 2ENBA 3I4MB 2F0GA 2JA7B 1A3TA 1VDZA 1SJED 1TQOA 1M8AA 3I4NB 2QKIC 3BS1A 2PW7A 1SMYD 4BS9A 2X6GA 2KCCA 3S9WA 2B39A 3SK6A 4DK1A 1K83B 2Q8IB 2A69C 1ESFA 3J80E 2F0QA 3MVVA 3SVMA 4FVMA 1VMCA 3IAYA 3G6JB 1HCZA 1X3PA 2K6AA 2KJXA 4E6IA 1KAAA 1SNPA 2F0KA 1DOMA 2OXPA 3TP7A 2F0HA 2RA4A 4NP5A 2BE5D 4ZQ3A 5I6WA 4A3DB 2IX0A 1EEFD 1LT6D 1G6ZA 3E6ZX 4NDXA 3W2DA 4C1NK 1MSHA 1OO9B 2F03A 1NCVA 2E2HB 1H9SA 4NMZA 1LTBD 1JWMD 5D3IB 4ABNA 1CZGA 4I65A 3KLSA 4RKBA 1EIHA 2ICEC 5IGDA 1STHA 2D5DA 5IGCA 1FNVA 4C56C 2E2JB 1R4PB 1LLRD 4XQJA 1TT2A 2XVSA 1GHKA 3IFDA 4RA8A 3C1EA 1EY7A 5EKKA 4DGZA 3MZ5A 4A3MB 1ENFA 4JBWA 5ELDA 3NE5B 1B1ZA 1B2TA 1RF2D 1EQVA 1Y69U 4PMBA 1HRJA 2DY7A 1CHQD 1I50B 2O4XA 5C4HA 2N55A 4Z9CB 3HS0C 4CKBA 2K32A 2K01A 2PYKA 1IYUA 4PV1C 2RSNA 2D9UA 1IKMA 2IWHA 1WD1A 3I91A 2B2VC 3HRZC 1U4RA 3J80L 3GTLB 3NBHA 4C1NI 1BF4A 3MFYA 1II3A 3K5MA 1TY2A 3K5NA 1SNQA 3I72A 1XXGA 1PFNA 3D4WA 3NQIA 3D8GA 3L9AX 1SAPA 1B9NA 5EJWA 1ONLA 2F0TA 3GO5A 3Q23A 2E76C 2WACA 3VYRA 5LL6S 2DN8A 2EY1A 3TBIB 5E3FA 4QUFA 4N9TA 1PYWD 4BA2I 1K8MA 2B2WC 4C3JG 1LO5D 3HZXA 1TVXA 1QOHA 4XDXA 2IX1A 3MXNA 4ZLTF 4KKUA 5DM73 3PV0A 5T1IA 2ZT9C 1SMYC 3GQBA 2ID0A 1OXUA 1NUCA 5E4WC 4O1NA 2EYPA 1TKWB 2IT1A 1ZKOA 3J81E 1PRTF 4XTCS 4CBVA 3MXPA 3Q6SA 2KCNA 1H9KA 5I9OA 4KK7A 4L63B 4I7ZC 2WKDA 1SE4A 4FYDA 4RGOS 3S15B 4DXGA 4DAPA 1KABA 2Z1CA 1PFBA 3JAME 4LJZC 3TP5A 2JSOA 4IUQA 1XX8A 2EY5A 1FNUA 1Y8OB 3OIQA 4OO1G 4OO1H 2H4OA 2HUGA 2NZ1D 4RAUC 4ZAIA 2JEBI 5I6YA 3GTKB 5I2XA 1U4MA 2EYFA 1PZID 1I4RA 4IUUA 3WOFA 5BN5A 4DF7A 1V1PA 4U673 5D14A 2A6HD 4K8JA 1BO0A 3SHLA 2LS01 1RCVD 3OOCA 3KLSX 3OPOA 2O5IC 5NUCA 4ZRZA 1I6VC 1Y1WB 2NYZD 5ELEA 1STGA 3V96A 1QNUA 2EYHA 2F0PA 1QJOA 1TWAB 2YYZA 3Q22A 2WKCA 3R3OA 4OHJA 4K14A 4KMUC 2F3WA 3CU7A 3EQLC 4KY7A 1VF5C 3PIP3 2MHVA 3GTGB 4L6TB 2NVTB 5M5WB 2B8GA 3J81L 1PFMA 1SYEA 2LMCB 5KIXA 1TWCB 5ELCA 5D3DA 2E74C 4X3UA 3HKZB 2FHTA 5EPJA 1HQMC 3Q24A 5M5YB 1CFMA 4HN7A 1ZYRD 4U68A 1WTRA 4IZ8A 3I4LA 1SE2A 1D1IA 2F0DA 3CQZB 3DUZA 1ICWA 2EY2A 2EJGC 1DJRD 1DZ1A 2EOTA 3JAML 3A56A 3H0GB 3F2UA 2EVBA 2EZVA 4L8JA 2C5CA 4RH6A 1MGSA 4XT3B 5CYUA 1S4ZA 3U9SA 2D2CC 5IGGA 4Q0FA 1M4VA 4K2KA 1W6JA 1LT3D 1R4QB 5KNDA 1BXTA 3BYYB 3VYTA 3M4OB 3HG9A 3CKIB 5FO7B 4IFDJ 4RFBA 2NN6I 1O7YA 5A35A 4PNYA 3SEBA 2L55A 4KJNA 5M3MB 1EY8A 3MTSA 4J6HA 4JK1C 4HMIA 2R61A 2JA8B 3MEHA 2DNEA 5A2QL 3KUPA 1DM0B 1F2ZA 2PCFB 3BZDB 4DN4M 1RTNA 1B50A 1LV9A 1SNCA 3RMHA 4X3SA 1HUNA 3HOXB 1SYFA 1JICA 1UEAB 3CRKC 2KOLA 1BQQT 3VR3A 4A3EB 3D4RA 3NXWA 1JE4A 1U9RA 4EGVA 4F8MA 1S5ED 1F9PA 1EWCA 4RWSC 3I73A 3BVGA 3OMCA 5DEHA 1RODA 4X3KA 2L1BA 4LAAA 1SDFA 1HTLD 2HCCA 1JOKA 2IX3A 1WTQA 1IKLA 2PZTA 3BVMA 2L9HA 2A6HC 1TU2B 4K6DA 1JC7A 3M3YB 3O13A 3OSOA 1EY4A 4C3JB 3RZOB 2X6LA 5EBCA 1DXMA 3TZUA 1Y8PB 2D62A 4ZUJA 3HP3A 4R8NA 5FO9B 1L0XB 3I8ZA 2QILA 4HR7B 1EFID 2J7ZA 3K58A 1BUVT 2B2YA 4EQOA 4Q5VA 2A5HA 3SDZA 2IW3A 3PIO3 4FXGC 1C4QA 3S16B 4HSPA 1LABA 4KTAA 1AZQA 2JYOA 3MAQA 3OHXC 2F0OA 3VR4A 1MD2D 4KHVA 1PTOH 5C4XB 1QE6A 4Y7NB 4ZUIA 5I4DA 3M4YA 4UDUC 1MSGA 3G7LA 5C0XG 2A6ED 5I9PA 3MHBA 3PUWA 4OIJA 1HPCA 2ZXPA 5J1ZA 1JOQA 1EU3A 1J8IA 4GZYC 3HOZB 3DEOA 2QDBA 3QG1A 4KHZA 3S2DB 1RDPD 3V2TA 3RLFA 1BDOA 5CC4A 3LWEA 2F0UA 4X3TA 4FO2A 3PO3B 3VR6A 1OXTA 1QCBD 4XXEA 4F7XA 3KBXA 5EKLA 2M2LA 2E75C 1UUPA 1EY9A 4XT1B 3R93A 4K5VA 3X3MA 3ND8A 5CV8A 3S1MB 1D5XC 1NAPA 4R8IA 2WB1B 3QOJA 4MN3A 5EGTA 4CJ2C 2F0LA 1ILQA 3S14B 3GTPB 1D2BA 2FJ2A 3S1QB 1XWEA 2SNSA 1ENCA 2AUKA 3U9OA 2RQXA 5FLXL 3P7JA 2NB0A 4CKEA 1F9SA 4ILWA 2NVQB 5IOCA 2SEBD 1ML0D 1RKNA 2HQEA 2KEDA 4ID6A 3DM1A 1TS3A 3VR5A 1FGBD 1TR5A 3TN2A 2NVYB 1CA6A 4KD3A 4KN7C 3SR1A 1SNMA 1OXVA 2CHBD 4UAIA 1PLFA 3H3VC 3QIAA 1JCKB 4HTHA 2QCPX 3E0JA 3NK9A 2JA6B 3DXJC 1SYCA 1WTVA 4R9WA 4BA1I 5T1GA 1Y1VB 4B9XA 1Q1EA 1PXUA 1E2VA 2QEJC 3NPPA 3TDQA 2BA0A 2K05A 2B2YC 1EOTA 1EYCA 4V190 2F0WA 5J22A 3A7LA 3H6MA 1R9TB 4QUCA 4MHEA 3FRPB 2RKSA 2RDHA 3KF8A 1H9JA 1SJHD 3PUXA 2LKVA 5FO8B 4IN3A 3NWSA 1S5DD 3K5LA 4C3IG 5JEAG 5JVG3 5JEAH 4S3SA 2A6EC 3P1HA 2FFKB 3LX0A 5KYIA 5E4XA 2OT2A 4RKLA 1KTKA 2AQ2B 2NUCA 4HCSA 3HOYB 4K5WA 4BY7B 4V0BA 3DWPA 3ZYYX 2CVRA 2L5TA 4KY6A 1O7ZA 4K5XA 5TSSA 2K1BA 2B63B 2JEAI 3A8JE 4AYBB 3RZDB 2JXMB 3M7NA 1AFPA 4RCNA 1ENAA 3CHBD 4IFDI 3LWUA 4ULLA 1FD7D 1SBBB 4HSVA 2AWOA 1JB3A 2BE5C 5KGUA 4A3JB 5C3XA 1PZKD 2A68D 4DXFA 4HMJA 1B44D 1F2YA 4HEDA 1GUNA 1I3QB 4G57A 1CQVA 3QO2A 5CMDA 1STAA 4J8QA 1NR4A 1STBA 3KLRA 4FXDA 3PUZA 4F87A 3NTKA 1AN8A 5JPMC 2AQ3B 3QOLA 2O5JC 2PZWA 1KDBA 3D4DA 3W3AA 1HFGA 3A55A 1SNOA 1PTOB 4OGQC 3PMFA 2XRQD 5CV9A 5FK9C 2F0VA 5A2QE 1O78A 2HDMA 1A6XA 3S1NB 1VCIA 5C3EB 5IODA 5FOBB 4G4KA 4C2MB 2PNRC 4KI0A 1C48A 3EJIA 2B2UA 4DFAA 3L3OC 3OIPA 4CKCA 5C4JB 1ZEQX 4PMCA 4J1MA 4DAYA 2CW0D 3RUZA 3GV3A 3NBIA 3QB3A 1EY5A 1L0YB 3NSWA 2LY7A 4A3FB 3BDLA 4XYQA 3VYSA 3OWEB 1TWFB 4G7HC 1W6KA 4IALA 1CI3M 5EBDA 4YIJA 2R93B 4DA2A 1GUTA 1NSNS 1CHPD 1BCPB 4HCEA 2B2TA 1O80A 4K8IA 3BG3A 3OW7A 5JEAJ 3HEJA 1I4GA 3PUVA 5CGKA 1H9RA 1QB5D 1CZWA 3EFXD 4RGNA 4H7BA 1I4PA 4CGYB 4EQPA 3ND9A 4QMGA 3HGBA 1CM9A 3LNNA 4RHRA 1Q90A 1G291 2VUMB 1FNWA 3BDOA 1PTOD 2WV6D 5COYA 2A69D 3H94A 3M85A 1IYVA 2GA4B 1BNZA 5M3FB 3D3RA 3SE0A 4NKLA 2AUJD 2A73B 2EYLA 1V43A 2B8FA 1LTTD 5IGFA 4QCLA 4K2LA 3C3LA 2VNUD 1IHZA 2O2LD 4XQNA 2KQ3A 2K04A 4H44C 5DAUA 4XIGS 3C46A 2NN6G 1D5ZC 2NBFA 3A54A 1JWUD 2NN6H 2PW5A 4CJ0B 1KDAA 2SDFA 4TQUS 3D31A 3H09A 1A3UA 1A15A 3T4AC 1WTPA 5D65A 2ZXRA 3S17B 1JWSD 4IUTA 2KVMA 3MFGA 3MXUA 2MPMA 2E2DC 2F1MA 5EPLA 2AWNA 2KECA 5F2DA 1IW7D 1BCPD 1H9MA 1WCMB 2PPBC 3L7ZC 3TP8A 1QNKA 1VF7A 2HDLA 3URYA 2EXZA 1Z6HA 3MXGA 1SE3A 2Z8LA 1YNND 3GP7A 3SK8A 2L11A 1XTCD 4IUNA 4TKOB 2BCOA 2L4NA 1Q8IA 1Y8NB 4C3IB 2FINB 3I70A 1KLGD 3HOVB 2A74C 3T51B 1WTOA 1RHPA 1VMPA 1ET6A 1SNDA 1HA5A 1X3QA 1S5FD 1GUOA 5FLXE 2XWJB 1DYQA 2EYMA 1Q3LA 2CW0C 5HGTA 5JJZA 5JOBA 3R2IA 3BVZA 3NHHA 2B2UC 2IPKD 5J39A 4BBRB 4NW2A 5EPKA 2LFNA 3K7AB 1HXYD 3FVQA 1STNA 5CORA 1G91A 1G2SA 5BN3A 2J4XA 5G3LF 2BDNA 1LTID 2F0MA 2JE6I 1ZYRC 5C0XH 3VA7A 3SK4A 1B9MA 1EZ8A 1B53A 5ISRA 3C2PA 3GTOB 2SOBA 5M5XB 4A3KB 2PZUA 1A3VA 3GD7A 1E2WA 2B2TC 1EZ6A 4BY1B 4WJWA 4KY5A 1E0BA 3NP8A 2V4DA 4FXKC 3K57A 2Q8RE 4WRDA 1TY0A 1JQYD 1I6HB 4WFN3 2ICIA 4IQZA 1GXDC 3C1FA 1PTOC 1QWYA 2YU9B 1DCZA 1G8ZD 4FF3A 3D6CA 2EJFC 5CV7A 1CQFA 1AZPA 4ZKBB 1KNAA 1DOLA 3FPPA 1CA5A 1S5BD 3TMEA 4RGTA 1F9RA 3K6OA 3AU7A 5DNFA 1D5MC 4KN4C 4KV6A 2N88A 3TSSA 1HTPA 3NUCA 2EPBA 5ELFA 1HFNA 2K5QA 5G3LD 2EE1A 2VB3X 2XRSD 2J0TD 5AFWA 2HCIA 5CV4A 2XWBB 4CJ1B 3R8BA 1IW7C 1BCPC 2R6GA 1YNJD 3NQTA 1V8QA 1STYA 2WP8J 4CHTB 1NR2A 5IT9E 2KHSA 3SK5A 2M9VA 1OXSC 3CRLC 3E5SA 1SXTA 3VR2A 1YNNC 4KKSA 2K33A 2K5WA 5LHY1 1V1OA 1BOSA 1GUGA 1STEA 4ODGA 3IFTA 2F0IA 1DD2A 3GV6A 1SYDA 4MIUA 1UNSA 2Q8TA 1S5CD 1EU4A 3S1RB 1FR3A 1OXXK 4RHSA 3TZDA 1EIGA 1CT1D 3VYUA 3WDNA 2BA1A 3IKJA 3A8IE 4IURA 4DU9A 2H1EA 4M8AA 2NVXB 1T5EA 4ZK9B 2EYOA 3RD4A 1T5XD 2K28A 4BBSB 4IUVA 1GHJA 2C9OA 1PDQA 5C0XJ 1EYDA 2L0CA 2F0EA 3K5OA 1TWHB 3J7AV 4C3HG 3AB9A 1IL8A 1DOKA 3A7AB 2G9HD 2KA7A 2XN9C 4M1UB 5C4ZA 1BR9A 4TSSA 4FF1A 1J9OA 1QG7A 4ME5A 2KUMA 5JPNC 3VA5A 5C5MA 2MJ8A 5C3WA 3AMUA 2DY8A 1EY6A 2ZXOA 2KEEA 1LT5D 1LTGD 2RDGA 2QF7A 1V1PB 1LACA 2SNMA 2L12A 4FP5D 5JVH3 1JOOA 5DM63 2EYJA 1PRTB 1TS2A 1E2ZA 3PUYA 4P2CB 1SEBD 3N52A 1LTAD 5E1FA 1ET9A 5IT9L 2F4IA 1Q1BA 1RD9D 1LTRD 3MC0B 3DHQA 3J7YW 1BBXC 1EL0A 3FEWX 4IUPA 2NTSA 2F0NA 4IFDG 3FMCA 1WVLA 4IFDH 2NWGA 3WOEA 1D6EC 1LTSD 4OO1I 2RBMA 1I4HA 1MI2A 2TMPA 2JP1A 2E2IB 1XYIA 5CBAE 4RCOA 4B08A 2K5DA 3D6WA 1CTMA 5KRUA 3FKIB 4TRDA 3T13A 1EQTA 1B3AA 4PQXA 3MA2B 1HUMA 2I07B 4WORA 2Z4HA 3J7AF 3S2HB 1GJXA 3DEPA 1HQRD 5KYLA 2F0FA 1PTOF 4FNFA 4EQNA 1X32A 1YNJC 1G2TA 4HAEA 3NWTA 1EY0A 4A3IB 2MP1A 2R7ZB 1FYCA 3ITPA 1KDCA 1RJTA 4KJOA 1Q12A 3ERQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTI D;  3R8B A;  3W2D A;  3OWE B;  1DJR D;  1LT5 D;  1SBB B;  1BCP C;  1JWS D;  2CHB D;  1AW7 A;  1HTL D;  1LTG D;  2RDG A;  5FKA C;  3MFG A;  4BWG B;  1PRT C;  1PZK D;  1JCK B;  1V1P B;  3BVM A;  2NTT A;  3EA6 A;  3R2T A;  1LTB D;  1I4Q A;  4DXF A;  3BYT B;  1JWM D;  4ZYS A;  1CHP D;  1PZI D;  1BCP B;  5D3I B;  1I4R A;  3O13 A;  1B44 D;  1SXT A;  4RH6 A;  1UUP A;  1PRT B;  1TS2 A;  1BCP D;  1V1O A;  1CQV A;  1PRT D;  1STE A;  1SEB D;  1V1P A;  1I4G A;  1LT4 D;  1TS5 A;  1LTA D;  1M4V A;  3URY A;  1D5X C;  1PYW D;  4K6L A;  1ET9 A;  2QEJ C;  2XNA C;  1LT3 D;  1F77 A;  1FNV A;  1SE3 A;  2Z8L A;  1LO5 D;  1RD9 D;  1TY0 A;  1BXT A;  1JQY D;  3BYY B;  1L0X B;  1LTR D;  1RCV D;  3EFX D;  1TS4 A;  1UNS A;  4RGN A;  3KLS X;  3GP7 A;  1S5C D;  2QIL A;  4RGM A;  2ICI A;  1EU4 A;  1I4P A;  3MC0 B;  4RFB A;  1AN8 A;  1EFI D;  1XTC D;  2AQ3 B;  4RHS A;  1KLU D;  4C56 C;  1CT1 D;  1PTO C;  3SEB A;  1LLR D;  2NTS A;  5ELE A;  1SJE D;  1I4X A;  1KLG D;  1G8Z D;  3DWA A;  2RDH A;  4O1N A;  2R61 A;  4RHR A;  1D6E C;  1LTS D;  1BCP F;  1PTO B;  1SJH D;  1ET6 A;  1I4H A;  1FNW A;  1HA5 A;  1ENF A;  2XRQ D;  1PRT F;  1PZJ D;  1PTO D;  2WV6 D;  5FK9 C;  5ELD A;  1S5D D;  1T5X D;  4OHJ A;  1B1Z A;  1EEI D;  1RF2 D;  3BZD B;  1S5F D;  2IJ0 A;  2TSS A;  4RCO A;  1GOZ A;  1S5B D;  1MD2 D;  4L63 B;  4L6T B;  1PTO H;  1DYQ A;  1LTT D;  2AQ1 B;  1CHQ D;  4RGT A;  1ESF A;  1CK1 A;  1KTK A;  5I4D A;  3V05 A;  2AQ2 B;  2O2L D;  1D5M C;  2SEB D;  3BVZ A;  3R2I A;  1SE4 A;  4UDU C;  4Z9C B;  5ELB A;  2IPK D;  4RGO S;  5ELC A;  4DXG A;  5D3D A;  2G9H D;  3DWP A;  2XN9 C;  1HXY D;  1TS3 A;  1EU3 A;  1HQR D;  3TSS A;  1D5Z C;  4TSS A;  5ELF A;  5TSS A;  1FGB D;  1JWU D;  1PTO F;  2XRS D;  3DWQ A;  1S5E D;  1QIL A;  2J4X A;  1EWC A;  3CHB D;  1L0Y B;  1TY2 A;  1FNU A;  3BVG A;  1SE2 A;  1EEF D;  1LT6 D;  1RDP D;  1JR0 D;  1XXG A;  1FD7 D; 
#chains in the Genus database with same CATH topology
 1VQE A;  2JA5 B;  1GUS A;  3BU2 A;  1GUW A;  1P16 A;  4JI1 L;  5C6A A;  2VW9 A;  5FKA C;  1MJE A;  2FMC A;  4QB4 A;  2K03 A;  3B6Y A;  4A3D G;  5L37 A;  3OWF A;  4A3D H;  1I4Q A;  1JOR A;  1HZA A;  1HR0 Q;  3KK7 A;  1X9N A;  1HNX L;  2WIN B;  5EKI A;  1MBY A;  3PF5 A;  1O7L A;  4LF5 L;  3GTQ B;  4LF5 Q;  2RVL A;  4NXN Q;  1PRT D;  2R3Z A;  5CV5 A;  2E2H H;  4F88 A;  1N36 L;  1TS5 A;  4DNR B;  4K6L A;  2UUB L;  1NY4 A;  2RSO A;  4G7O C;  3LGJ A;  4ZKC B;  5I2Y A;  4N8F A;  2MNA A;  5LL6 X;  4FF2 A;  1A2U A;  1KLU D;  2FMM A;  5IWA Q;  2F0S A;  1KNE A;  3NTI A;  2BOS A;  5K36 G;  5K36 H;  4O42 A;  1I4X A;  3DWA A;  3I90 A;  4JI5 Q;  4OIK A;  1BCP F;  3T16 A;  1WTW A;  3J7Z C;  4QF4 A;  2E2J H;  1L1O A;  4TVA B;  3H91 A;  2Y0S B;  5KNC A;  1ASY A;  3STB C;  2IJ0 A;  2TSS A;  1VS0 A;  3QWN A;  3X3N A;  3FDT A;  2PMZ B;  2DNC A;  2EJM A;  3AQQ A;  3FPU B;  3K59 A;  3ERO A;  4A3G B;  5IIF A;  4A3M G;  1BVS A;  2AQ1 B;  1WTX A;  4PMW A;  2VXW A;  3V05 A;  3K0Y A;  2E5L L;  5ELB A;  5KEE A;  5JAV A;  4H0L C;  4P71 A;  3T56 B;  4LMQ D;  3M7G A;  2Z4I A;  3E3X A;  5EQ0 A;  3UI2 A;  4YY3 Q;  1XPR A;  2MGS A;  5KNB A;  2CKZ B;  4A93 B;  3M9B A;  1I50 H;  4XYO A;  1K8G A;  3IRB A;  3SXH A;  3UDI A;  3GTJ B;  4FF4 A;  2DGY A;  4DAM A;  4N9P A;  3P20 A;  3P75 A;  1HA6 A;  1AH9 A;  5C5L A;  1EWH A;  1WI5 A;  2N3S A;  4JI2 Q;  1NBW A;  3ONA B;  4OL7 A;  3GTM B;  1U4L A;  5IGB A;  2UXD L;  5BN4 A;  1J6Q A;  1LYL A;  4R4Q A;  2UXD Q;  3IL8 A;  3GTL H;  2Y0S E;  1AEX A;  4LFC Q;  4H13 C;  2NTT A;  1HHV A;  3EA6 A;  4XQQ A;  3BYT B;  2CWP A;  4ZYS A;  2F3V A;  2PMZ E;  5K5P A;  2EQS A;  2PO4 A;  4X65 Q;  4HIK A;  3NEL A;  4P72 A;  3NTH A;  4LFA L;  5M9O A;  2A68 C;  5J3B A;  5HUR A;  4AQY Q;  2NZH A;  1LT4 D;  1Q46 A;  2EIF A;  3T53 B;  2XNA C;  4A3B B;  3HOW B;  5FLM G;  1U4P A;  2PQE A;  3DMU A;  5FLM H;  1QVG A;  4JOI A;  1TS4 A;  3JC6 6;  2WII B;  2RDF A;  4RGM A;  3QJY A;  2A8V A;  2RHQ B;  1RTO A;  1EYA A;  1F2L A;  3J81 j;  4JI8 L;  3I55 A;  1K8O A;  1J5E L;  1ESR A;  1D1K A;  1J5E Q;  2R92 B;  2M00 A;  3BDC A;  2OF1 A;  1SSO A;  1PH1 A;  1M90 C;  3EVQ A;  5CV6 A;  4LK1 C;  3K80 C;  1KIX A;  1A2T A;  1HR0 W;  1PZJ D;  2ZJQ A;  4B3T L;  3MWY W;  1EEI D;  2RCF A;  2WAQ B;  3W1B A;  5IGE A;  5CR3 A;  4DK0 A;  3K7U C;  4HJ7 A;  1Z7T A;  1GOZ A;  1WOC A;  4IJL A;  2G9D A;  4C3H B;  2NZO A;  2MUY A;  2A1A A;  2AKW B;  4DV4 L;  1Z47 A;  1CK1 A;  1F2M A;  1JMC A;  3A8K E;  1SFO B;  1EIF A;  2PQA A;  3N6R A;  2IY5 B;  2MFI A;  4DNT B;  2VB2 X;  1ZXT A;  4DV2 Q;  1TWG B;  2EDG A;  4JI3 L;  1KQS A;  2B2V A;  2YTX A;  2ZTE A;  1DON A;  2CCZ A;  1VQD A;  1PMR A;  2P5Z X;  2LXK A;  2XIW A;  2LSS A;  3DWQ A;  5GAD C;  1B4O A;  1QIL A;  3S15 H;  2YV5 A;  4DAV A;  2HQL A;  4L5S A;  1LM0 A;  2XSC A;  2IL8 A;  4G7Z C;  1JR0 D;  3Q0A A;  1AW7 A;  5IT9 c;  2QA4 A;  3AEV A;  4KD4 A;  4BWG B;  1VQA A;  1PRT C;  5C44 B;  1SYG A;  2I46 A;  2EY6 A;  2WAQ E;  1C8C A;  3R2T A;  1SYB A;  1D8L A;  1IBM L;  2CH4 W;  1IBM Q;  2OEO A;  2UUA Q;  2CQA A;  4UY8 C;  3I3C A;  1E1O A;  1H9S B;  4N8X 1;  4EVO A;  5IP7 G;  1LUZ A;  1UAP A;  5IP7 H;  3OMG A;  2K7V A;  4B9W A;  5IYC G;  1UEB A;  2X69 A;  3TEH B;  4HIM A;  3HOU B;  2B2W A;  3GTK H;  2BDO A;  5C0X I;  5IYC H;  4KKT A;  1F9Q A;  1WD0 A;  1F77 A;  4QIW B;  3TP6 A;  1ILP A;  5CBE E;  3TS0 A;  4PZ6 A;  5DLQ E;  3PO2 B;  3KBG A;  2F0J A;  1TII D;  1QUQ B;  4HID A;  1AP0 A;  2ENB A;  3I4M B;  3QR8 A;  3J80 i;  2F0G A;  2JA7 B;  1A3T A;  1VDZ A;  2C35 B;  1SJE D;  2OCE A;  1TQO A;  4IO9 A;  4X6A H;  1M8A A;  3F1Z A;  1KXL A;  3I4N B;  4WJ4 A;  2QKI C;  4LF9 L;  3BS1 A;  2PW7 A;  1Y14 B;  1SMY D;  1Y1W G;  1Y1W H;  4BS9 A;  2X6G A;  1L1O C;  1K8A C;  2KCC A;  1U5K A;  1S40 A;  3S9W A;  2B39 A;  3SK6 A;  1EWI A;  4DK1 A;  1K83 B;  4JBM A;  2Q8I B;  2A69 C;  1TWA H;  1ESF A;  3J80 E;  2F0Q A;  3MVV A;  3SVM A;  4FVM A;  1SN8 A;  1VMC A;  2AHO B;  2ZJR A;  3IAY A;  4B3M Q;  4AH6 A;  2DJF C;  4QIW E;  5HY6 A;  3W5O A;  3BJU A;  3UE0 A;  1PH8 A;  3G6J B;  3GTG H;  2NVT H;  1HCZ A;  3CC2 A;  1X3P A;  2K6A A;  2KJX A;  4E6I A;  1VQ5 A;  1KAA A;  2BH2 A;  1SNP A;  1UWV A;  2F0K A;  1DOM A;  1X3E A;  2OXP A;  3TP7 A;  1TWC H;  2F0H A;  2RA4 A;  4NP5 A;  2BE5 D;  4ZQ3 A;  5I6W A;  4GKJ L;  4A3D B;  1VQ8 A;  3HKZ G;  4R4O A;  2IX0 A;  1EEF D;  1LT6 D;  1G6Z A;  3E6Z X;  4H02 A;  4X62 L;  4NDX A;  3W2D A;  4C1N K;  1MSH A;  1OO9 B;  2UU9 Q;  1MIU A;  5M5Y H;  2F03 A;  1NCV A;  2E2H B;  1FVI A;  1H9S A;  4NMZ A;  2I0Q A;  1LTB D;  1JWM D;  3J7A 5;  5D3I B;  4ABN A;  1CZG A;  3CQZ H;  2UXB L;  4I65 A;  3KLS A;  4RKB A;  2PI2 E;  1JE5 A;  1EIH A;  2UUC Q;  2ICE C;  3H0G H;  3A0J A;  5IGD A;  1STH A;  1OTC A;  1UE1 A;  1YZ6 A;  2D5D A;  1VQH A;  3UE1 A;  5IGC A;  2QEX A;  2K50 A;  5AJ3 L;  1FNV A;  3H3V H;  4JOI C;  2LXJ A;  4DV6 Q;  4C56 C;  2E2J B;  1R4P B;  1LLR D;  3GTM H;  4XQJ A;  1TT2 A;  2XVS A;  4JBJ A;  1GHK A;  3IFD A;  4RA8 A;  1MKH A;  3C1E A;  1EY7 A;  5GQO A;  3M4O H;  5EKK A;  4DR3 Q;  1CKN A;  4DGZ A;  3MZ5 A;  4A3M B;  1ENF A;  4JBW A;  5ELD A;  3NE5 B;  1YJ9 A;  5M3M G;  1B1Z A;  1B2T A;  1RF2 D;  2PI2 A;  5M3M H;  4B3S Q;  1EQV A;  1Y69 U;  4PMB A;  1BBW A;  2JA8 G;  3K0X A;  2JA8 H;  4YWK A;  4MNO A;  1HRJ A;  2DY7 A;  1CHQ D;  1I50 B;  1VQF A;  3H15 A;  2O4X A;  5C4H A;  2N55 A;  4Z9C B;  4O2D A;  1X3F A;  2VZA A;  3CPF A;  3HS0 C;  4JC0 A;  4CKB A;  2K32 A;  2K01 A;  2PYK A;  1IYU A;  4PV1 C;  5GAE C;  1PYB A;  2RSN A;  2D9U A;  3EBE A;  1IKM A;  2E8G A;  2IWH A;  4OEL B;  1WD1 A;  3ULJ A;  3I91 A;  2B2V C;  1WTH A;  1U4R A;  3HRZ C;  3J80 L;  3HOX G;  3GTL B;  3NBH A;  4C1N I;  1BF4 A;  1XPU A;  3MFY A;  3HOX H;  3CCE A;  1II3 A;  3K5M A;  1TY2 A;  2MQH A;  3K5N A;  1SNQ A;  5EAY A;  4A3E G;  3I72 A;  1XXG A;  1PFN A;  4A3E H;  3D4W A;  3NQI A;  2HHH L;  3KFU A;  3D8G A;  2ALY B;  4X66 L;  3L9A X;  2HHH Q;  1SAP A;  3AYH B;  1B9N A;  4X66 Q;  5EJW A;  1EIY B;  1ONL A;  4KHP Q;  2F0T A;  3GO5 A;  3RLN A;  3Q23 A;  2E76 C;  2WAC A;  3OYY A;  4OX9 Q;  3VYR A;  1VQO A;  5LL6 S;  2DN8 A;  2EY1 A;  3A5U A;  1KL9 A;  4YCU A;  3TBI B;  1PV4 A;  5E3F A;  4QUF A;  4PG3 A;  4N9T A;  1PYW D;  4BA2 I;  1K8M A;  1TWG H;  2B2W C;  4C3J G;  3M3Y H;  4C3J H;  1LO5 D;  3RZO H;  3K8A A;  3HZX A;  1TVX A;  1QOH A;  1VQ4 A;  4XDX A;  4DV3 Q;  2IX1 A;  3MXN A;  1Q7Y C;  4ZLT F;  4KKU A;  5DM7 3;  3PV0 A;  5T1I A;  2ZT9 C;  1SMY C;  3GQB A;  2ID0 A;  5JJK A;  4YWL A;  4R4I A;  1OXU A;  3BZC A;  1NE3 A;  4DR1 L;  1NUC A;  5E4W C;  4O1N A;  2EYP A;  1N33 L;  1TKW B;  2IT1 A;  1ZKO A;  2Z0S A;  3I7F A;  3J81 E;  2K5N A;  1PRT F;  4KLK A;  4XTC S;  4CBV A;  3MXP A;  3Q6S A;  2KCN A;  1I5F A;  1HNZ Q;  1H9K A;  5I9O A;  1X56 A;  4KK7 A;  3S16 H;  4L63 B;  4WJ3 M;  4I7Z C;  1N8R C;  4DAY B;  2WKD A;  1SE4 A;  4FYD A;  4RGO S;  1YEZ A;  2GN5 A;  3S15 B;  4DXG A;  4DAP A;  5C4X G;  4UHV A;  1KAB A;  5C4X H;  2Z1C A;  4IPH A;  1PFB A;  4X64 Q;  3JAM E;  4Y7N H;  4LJZ C;  3TP5 A;  2JSO A;  4IUQ A;  1BKB A;  2ZM6 Q;  1SRO A;  1XX8 A;  2EY5 A;  4MTN A;  4DV1 L;  1FNU A;  1Y8O B;  3OIQ A;  4FDB A;  4DV5 L;  4DR5 L;  2WFW A;  3RN2 A;  4OO1 G;  4DV5 Q;  4DR6 L;  4OO1 H;  2H4O A;  2HUG A;  4DR6 Q;  2NZ1 D;  4RAU C;  4LUZ A;  4ZAI A;  3HOZ G;  1B70 B;  3HOZ H;  2JEB I;  2N49 A;  4DV7 L;  1FJG Q;  5I6Y A;  2OWO A;  3GTK B;  5I2X A;  1U4M A;  3S2D H;  2EYF A;  1PZI D;  1I4R A;  4EQ5 A;  4JI0 Q;  4IUU A;  3WOF A;  2DJG C;  3KDF B;  3PO3 G;  5BN5 A;  1L2F A;  3PO3 H;  4DF7 A;  1V1P A;  4U67 3;  1HNW Q;  5D14 A;  1VQJ A;  2A6H D;  3KJP A;  4K8J A;  5GAH C;  4UP9 A;  1BO0 A;  3SHL A;  2LS0 1;  2A19 A;  4JI1 Q;  1RCV D;  3OOC A;  3KLS X;  1XTD A;  4DUY L;  3OPO A;  1XNQ L;  4JPB W;  2O5I C;  5NUC A;  3CCJ A;  4ZRZ A;  1I6V C;  1Y1W B;  3S1M H;  2WB1 G;  2NYZ D;  1HNX Q;  5ELE A;  1STG A;  3V96 A;  1QNU A;  2QGQ A;  1M1K C;  2EYH A;  2F0P A;  1QJO A;  1CSQ A;  1N36 Q;  1K0R A;  1TWA B;  2YYZ A;  3Q22 A;  4GNX A;  2WKC A;  3S14 H;  2CFM A;  3R3O A;  2UUB Q;  4OHJ A;  4GKK L;  4K14 A;  4KMU C;  2F3W A;  3CU7 A;  3S1Q H;  3EQL C;  4KY7 A;  1VF5 C;  3CC7 A;  3PGZ A;  3AFQ A;  2KCT A;  3PIP 3;  2MHV A;  3GTG B;  4L6T B;  2NVT B;  5M5W B;  5GRO A;  2JK8 A;  3SGI A;  2B8G A;  3J81 L;  1PFM A;  1SYE A;  4BXX G;  2LMC B;  5KIX A;  1TWC B;  4BXX H;  3E9H A;  5ELC A;  4DR2 L;  5D3D A;  4DNI A;  2E74 C;  4X3U A;  4L5R C;  3HKZ B;  4ALP A;  2FHT A;  2NVQ H;  5EPJ A;  1HQM C;  3Q24 A;  5M5Y B;  1CFM A;  3ICE A;  4DK3 C;  1LTL A;  4HN7 A;  1ZYR D;  4U68 A;  1WTR A;  4IZ8 A;  3I4L A;  1IXR A;  4RG1 A;  4A3M H;  2CWA A;  1SE2 A;  1X6O A;  1D1I A;  3PSI A;  4L5T A;  2F0D A;  1S72 A;  3CQZ B;  3DUZ A;  1ICW A;  2EY2 A;  2EJG C;  1DJR D;  1DZ1 A;  2E5L Q;  2EOT A;  3JAM L;  3A56 A;  2NVY H;  1UE5 A;  1K3B C;  3H0G B;  1VQN A;  3F2U A;  1PVO A;  4PZ8 A;  2EVB A;  2EZV A;  4L8J A;  2C5C A;  4RH6 A;  1MGS A;  4XT3 B;  5CYU A;  1S4Z A;  3U9S A;  1PH6 A;  2D2C C;  5IGG A;  1VQG A;  4Q0F A;  1VQL A;  2IHE A;  1M4V A;  4K2K A;  4JI7 L;  2JA6 G;  1W6J A;  1LT3 D;  4JI7 Q;  2JA6 H;  1R4Q B;  3HKZ E;  5KND A;  1BXT A;  3BYY B;  4R4C A;  3VYT A;  3M4O B;  3HG9 A;  3CKI B;  5FO7 B;  1Y1V G;  4IFD J;  1JT8 A;  4RFB A;  2K5V A;  1Y1V H;  1O7Y A;  2NN6 I;  5A35 A;  4PNY A;  3SEB A;  2L55 A;  4KJN A;  1GD7 A;  5M3M B;  1EY8 A;  3MTS A;  4J6H A;  2Q2H A;  2K75 A;  4JK1 C;  4HMI A;  2R61 A;  4LFA Q;  2JA8 B;  2Z6K A;  3MEH A;  2DNE A;  2VQF L;  5A2Q L;  3KUP A;  1DM0 B;  3PQI A;  4PZ7 A;  1F2Z A;  2PCF B;  3BZD B;  2ZJP A;  1HH2 P;  3S24 A;  4DN4 M;  5IY0 A;  3M4Q A;  1RTN A;  1B50 A;  3A5Z B;  1LV9 A;  1SNC A;  3J80 c;  2KCM A;  3RMH A;  3CCU A;  1XMO L;  5LMN L;  4JI8 Q;  1C0A A;  1KRT A;  1YBY A;  4X3S A;  1HUN A;  3HOX B;  4HJ5 A;  1SYF A;  1JIC A;  1UEA B;  3CRK C;  2KOL A;  4NXM L;  1BQQ T;  3VR3 A;  4K0K L;  3T1Y L;  4NXM Q;  3CC4 A;  4LW1 A;  1VQ6 A;  4A3E B;  3D4R A;  3T1Y Q;  1E24 A;  4B3T Q;  3NXW A;  1JE4 A;  2EXD A;  1U9R A;  3HOY G;  4DUZ L;  4EGV A;  1S5E D;  4F8M A;  1Q82 C;  4BY7 G;  1F9P A;  3HOY H;  1EWC A;  2HT1 A;  4RWS C;  3I73 A;  3BVG A;  3OMC A;  5DEH A;  3G48 A;  4DV4 Q;  1ROD A;  4X3K A;  1K3R A;  2L1B A;  1S3O A;  2HD3 A;  2B63 G;  4LAA A;  1SDF A;  2B63 H;  1HTL D;  2HCC A;  4AYB G;  1JOK A;  3FHW A;  2IX3 A;  1WTQ A;  1IKL A;  2PZT A;  3BVM A;  3RZD H;  1E1T A;  2L9H A;  2A6H C;  1TU2 B;  4K6D A;  1JC7 A;  3M3Y B;  3O13 A;  3OSO A;  1EY4 A;  4C3J B;  4JI3 Q;  3CD6 A;  3RZO B;  1HZB A;  2X6L A;  5EBC A;  4JV5 L;  1DXM A;  3TZU A;  4A3J G;  1Y8P B;  4A3J H;  1SMX A;  3CCS A;  2D62 A;  1VQK A;  4GN4 B;  4ZUJ A;  4IPG A;  3HP3 A;  4R8N A;  2OTJ A;  5FO9 B;  1L0X B;  3I8Z A;  2QIL A;  1I3Q H;  4HR7 B;  1EFI D;  2J7Z A;  3K58 A;  1BUV T;  2B2Y A;  1B3Q A;  4EQO A;  4JI4 L;  2JA9 A;  1Q8K A;  4Q5V A;  4LF4 L;  2A5H A;  3SDZ A;  2IW3 A;  3AFP A;  3PIO 3;  4FXG C;  1C4Q A;  2YTV A;  3L2P A;  3S16 B;  4HSP A;  1WYD A;  3KJO A;  1LAB A;  4KTA A;  1AZQ A;  2JYO A;  4GNX C;  2D0O A;  3MAQ A;  3OHX C;  4HJ8 A;  1K73 C;  1CKO A;  2F0O A;  3VR4 A;  1MD2 D;  1W2B A;  4KHV A;  1PTO H;  5C4X B;  1QE6 A;  4Y7N B;  4ZUI A;  5I4D A;  3M4Y A;  4QJF A;  4UDU C;  1MSG A;  3G7L A;  1PHJ A;  5C0X G;  5C3E G;  2A6E D;  5I9P A;  3MHB A;  3S1N H;  3PUW A;  4OIJ A;  5C3E H;  1HPC A;  2RF4 A;  1QZG A;  4LF9 Q;  2ZXP A;  5J1Z A;  4OWX B;  1JOQ A;  3KF6 B;  1EU3 A;  1J8I A;  2K14 A;  4OWT B;  3CW2 C;  2GVA A;  4GZY C;  3KYH C;  3HOZ B;  4YCV A;  1EOV A;  5BR8 L;  3DEO A;  2QDB A;  3QG1 A;  4KHZ A;  2Z9H A;  4JW0 A;  5BR8 Q;  3S2D B;  5C4J H;  1RDP D;  3G6E A;  3V2T A;  3RLF A;  1BDO A;  5CC4 A;  3LWE A;  2F0U A;  4X3T A;  4FO2 A;  3PO3 B;  4IJH A;  3VR6 A;  1OXT A;  4A3F G;  5M5W H;  1QCB D;  4XXE A;  4F7X A;  3KBX A;  4A3F H;  5EKL A;  2M2L A;  4DV0 L;  2E75 C;  1UUP A;  1EY9 A;  2CQO A;  4XT1 B;  3R93 A;  1TWF H;  4K5V A;  2R93 G;  4GKJ Q;  3X3M A;  2KBN A;  3ND8 A;  2R93 H;  5CV8 A;  4DR4 L;  3S1M B;  1D5X C;  1NAP A;  5E7N A;  4R8I A;  4DR4 Q;  2WB1 B;  3QOJ A;  4MN3 A;  5EGT A;  4X62 Q;  1IZ6 A;  4LF7 L;  4J15 A;  4CJ2 C;  1D7Q A;  2F0L A;  4LF8 L;  1GKH A;  1ILQ A;  5ELO A;  3ULP A;  3S14 B;  3GTP B;  1D2B A;  2ZTD A;  1IYJ B;  2FJ2 A;  3S1Q B;  2UXB Q;  3J81 c;  4QQB X;  1XWE A;  2SNS A;  4JBK A;  1T9H A;  1ENC A;  1X65 A;  2Z6K C;  4YHH L;  1QUQ A;  4YHH Q;  2AUK A;  4JVZ A;  3U9O A;  2RQX A;  5FLX L;  3P7J A;  3KF8 B;  5AJ3 Q;  4GLX A;  2NB0 A;  1DGS A;  1SRU A;  4CKE A;  2VUM G;  1F9S A;  4ILW A;  2G5D A;  1VQP A;  2VUM H;  2NVQ B;  2GVB A;  1A62 A;  5IOC A;  2SEB D;  5JJI A;  1ML0 D;  1RKN A;  5M3F G;  1B7Y B;  2WB1 E;  2HQE A;  2KED A;  4ID6 A;  3F2B A;  4CDC C;  5M3F H;  3JAM c;  3DM1 A;  3I4O A;  1TS3 A;  1SE8 A;  3VR5 A;  1FGB D;  1TR5 A;  3TN2 A;  2VY3 A;  1TXY A;  2NVY B;  1CA6 A;  4JI6 L;  4KD3 A;  4LWC A;  1KD1 C;  1RL2 A;  4KN7 C;  3SR1 A;  1SNM A;  1OXV A;  2ASB A;  2CHB D;  4UAI A;  1PLF A;  3H3V C;  3QIA A;  1JCK B;  4HTH A;  2QCP X;  1PA6 A;  3E0J A;  1E22 A;  3NK9 A;  2JA6 B;  5FJ8 G;  2UXC L;  3DXJ C;  5FJ8 H;  4B3R L;  1SYC A;  1WTV A;  4LF6 L;  4R9W A;  4BA1 I;  5T1G A;  2UXC Q;  3S17 H;  4LF6 Q;  1Y1V B;  4B9X A;  1G6P A;  1Q1E A;  1PXU A;  3RR5 A;  1E2V A;  2QEJ C;  3NPP A;  2N78 A;  1WCM G;  3TDQ A;  2D0P A;  1WCM H;  2BA0 A;  4CDD C;  2K05 A;  1VQB A;  2B2Y C;  1EOT A;  1EYC A;  4V19 0;  3PF4 A;  2F0W A;  5J22 A;  3A7L A;  3H6M A;  2KEN A;  1R9T B;  4QUC A;  4MHE A;  3FRP B;  2RKS A;  2RDH A;  3CAM A;  3KF8 A;  3STB D;  3G71 A;  3J81 i;  1H9J A;  1PFS A;  4JG2 A;  2OTL A;  3U4Z A;  1SJH D;  3PUX A;  2LKV A;  3NEN A;  5FO8 B;  4IN3 A;  3NWS A;  2I5H A;  1S5D D;  3K5L A;  4C3I G;  5JEA G;  5JVG 3;  1EQR A;  1A8V A;  2OQK A;  4C3I H;  4S3S A;  5JEA H;  3HOV G;  1N32 L;  2A6E C;  3P1H A;  3HOV H;  2FFK B;  3LX0 A;  5KYI A;  5GAG C;  5E4X A;  2KHI A;  3CCM A;  4GLV B;  4QY7 A;  2OT2 A;  4RKL A;  1KTK A;  2AQ2 B;  2NUC A;  2OQ0 A;  4DR1 Q;  4HCS A;  1IBL L;  3HOY B;  4K5W A;  2ZTC A;  1N33 Q;  4BY7 B;  1NMG A;  4V0B A;  3DWP A;  3ZYY X;  2CVR A;  3TQY A;  3JAM i;  2L5T A;  4KY6 A;  1O7Z A;  4K5X A;  5TSS A;  2K1B A;  2B63 B;  2JEA I;  3A8J E;  2H5X A;  4A4I A;  4AYB B;  4LUV A;  4BBR G;  4GLA C;  2JXM B;  3RZD B;  1G51 A;  1HZ9 A;  3M7N A;  4RCN A;  1AFP A;  1ENA A;  3CHB D;  4BBR H;  3EIV A;  1VQ9 A;  4IFD I;  3LWU A;  3K7A H;  4ULL A;  1FD7 D;  1SBB B;  4HSV A;  2AWO A;  1NTG A;  1JB3 A;  2BE5 C;  1N34 L;  5KGU A;  4A3J B;  5C3X A;  1PZK D;  2A68 D;  4DXF A;  4HMJ A;  2ATW A;  1B44 D;  4L5Q A;  1F2Y A;  4HED A;  1GUN A;  3EN2 A;  4I7A A;  1I3Q B;  4G57 A;  1CQV A;  3QO2 A;  5CMD A;  3PIP A;  1STA A;  1HJP A;  4DV1 Q;  4RMF A;  3WWV A;  3GTO H;  4DR5 Q;  4J8Q A;  1NR4 A;  4A3K G;  1STB A;  3KLR A;  4A3L G;  5M5X H;  4O0A A;  3KOJ A;  3PUZ A;  4A3K H;  4F87 A;  4FXD A;  4DKA C;  4A3L H;  3NTK A;  4BY1 G;  1AN8 A;  5JPM C;  3K81 C;  4DV7 Q;  1NNX A;  2AQ3 B;  3QOL A;  3T1H L;  4BY1 H;  4AYB E;  2O5J C;  1L1O B;  2PZW A;  1KDB A;  3U58 A;  3D4D A;  3RLO A;  3W3A A;  3TRE A;  1HFG A;  3A55 A;  1SNO A;  1I6H H;  4P74 A;  1PTO B;  4OGQ C;  5LMU L;  3CF5 A;  3PMF A;  2XRQ D;  5CV9 A;  1K28 A;  5FK9 C;  2F0V A;  5A2Q E;  1O78 A;  4HJ9 A;  2HDM A;  1YVC A;  1A6X A;  3S1N B;  2YU9 H;  1VQC A;  1VCI A;  5C3E B;  4OON A;  2CH4 A;  5IOD A;  2IHF A;  4DUY Q;  1XNQ Q;  5FOB B;  4HIO A;  4HJA A;  1YHB A;  4G4K A;  4C2M B;  3F2C A;  2PNR C;  4KI0 A;  1C48 A;  4UPA A;  3EJI A;  2B2U A;  4DFA A;  2MO0 A;  4POF A;  3L3O C;  3OIP A;  4CKC A;  5C4J B;  1ZEQ X;  1K9M C;  3GTP H;  4PMC A;  1HR0 L;  4J1M A;  4DAY A;  2CW0 D;  4GKK Q;  3RUZ A;  3GV3 A;  4NXN L;  4GS3 A;  3TS2 A;  3NBI A;  1Q86 C;  1MJC A;  3QB3 A;  3CCL A;  1EY5 A;  1L0Y B;  3NSW A;  2LY7 A;  4A3F B;  3BDL A;  3ULL A;  1KHI A;  4XYQ A;  3VYS A;  3OWE B;  1CUK A;  1TWF B;  4G7H C;  1W6K A;  4IAL A;  1CI3 M;  5EBD A;  4YIJ A;  2R93 B;  4DR2 Q;  1B8A A;  4DA2 A;  3I56 A;  1IL2 A;  1GUT A;  1QZH A;  1NSN S;  2Q2I A;  5IWA L;  1CHP D;  1BCP B;  4GN3 B;  4HCE A;  2B2T A;  3BZK A;  4JI5 L;  1O80 A;  4K8I A;  3BG3 A;  3OW7 A;  5JEA J;  3HEJ A;  1I4G A;  1W3S A;  3PUV A;  5ELN A;  1PYS B;  5CGK A;  5IP9 G;  4GOP B;  1IBK L;  1H9R A;  5IP9 H;  1IBK Q;  5IYD G;  1QB5 D;  1CZW A;  5FLX c;  5IYD H;  3KDF A;  2R7F A;  3EFX D;  2VS1 A;  2V1C C;  4RGN A;  1A63 A;  4H7B A;  1I4P A;  1MHW C;  4CGY B;  4AIM A;  4OWW B;  4EQP A;  1JJC B;  3ND9 A;  1O7I A;  4QMG A;  3LNN A;  3HGB A;  1CM9 A;  4RHR A;  3DLL A;  1Q90 A;  1X54 A;  1G29 1;  2VUM B;  3S1R H;  4YY3 L;  1FNW A;  3BDO A;  1PTO D;  3ERS X;  1X55 A;  2WV6 D;  5COY A;  2A69 D;  3H94 A;  3M85 A;  1IYV A;  2GA4 B;  1YJW A;  2PQA B;  1BNZ A;  5M3F B;  3D3R A;  3SE0 A;  4NKL A;  2AUJ D;  2A73 B;  2EYL A;  1V43 A;  2B8F A;  1LTT D;  5IGF A;  2NVX H;  4JI2 L;  4QCL A;  4K2L A;  3C3L A;  2VNU D;  1IHZ A;  2N8N A;  2O2L D;  4BBS G;  4XQN A;  2KQ3 A;  4BBS H;  2K04 A;  4LFC L;  2F3I A;  3CCQ A;  2VQF Q;  4H44 C;  1WJJ A;  4ME3 A;  3CMA A;  5DAU A;  4XIG S;  3GDE A;  3C46 A;  2NN6 G;  1D5Z C;  2NBF A;  3A54 A;  4X65 L;  1R9T H;  1JWU D;  2NN6 H;  2PW5 A;  3F8T A;  1EFW A;  4CJ0 B;  1KDA A;  3TRZ A;  2SDF A;  4TQU S;  4P75 A;  1TWH H;  3D31 A;  3H09 A;  2Q2T A;  3M4P A;  4AQY L;  1A3U A;  3ER0 A;  4QL5 A;  1XMO Q;  1A15 A;  4QGU A;  3T4A C;  3OTO L;  5LMN Q;  2B3G A;  2VL6 A;  3OTO Q;  1WTP A;  2F52 A;  5D65 A;  2ZXR A;  3S17 B;  1JWS D;  4IUT A;  3PIO A;  2KVM A;  3MFG A;  3MXU A;  3F2D A;  2MPM A;  3CME A;  2E2D C;  2F1M A;  5EPL A;  1C7Y A;  4LFB L;  4K0K Q;  4LFB Q;  2AWN A;  1Z9F A;  2HIV A;  2KEC A;  4YCW A;  4GOP A;  1FGU A;  5F2D A;  1IW7 D;  1BCP D;  1H9M A;  1WCM B;  4DUZ Q;  2PPB C;  4BY7 H;  3L7Z C;  3TP8 A;  1QNK A;  3UDG A;  1VF7 A;  2HDL A;  4GN5 A;  3URY A;  2EXZ A;  1Z6H A;  2RCN A;  3MXG A;  1SE3 A;  2Z8L A;  3ZJY C;  1YNN D;  3GP7 A;  3SK8 A;  1PH4 A;  1SLJ A;  2L11 A;  1XTC D;  4IUN A;  4TKO B;  2BCO A;  4IOA A;  2L4N A;  1Q8I A;  4MZ9 A;  3PCO B;  1HZC A;  1Y8N B;  4C3I B;  2FIN B;  3I70 A;  1KLG D;  3HOV B;  4JV5 Q;  2A74 C;  3DM3 A;  3T51 B;  4P73 A;  1RHP A;  2VQE L;  1WTO A;  1VMP A;  2VQE Q;  1ET6 A;  1SND A;  1HA5 A;  1KAW A;  4DV2 L;  1X3Q A;  1XJV A;  1S5F D;  4A75 A;  1GUO A;  5FLX E;  2XWJ B;  1PH7 A;  3NEM A;  5HGQ A;  1DYQ A;  4JI4 Q;  4LF4 Q;  1BBU A;  2Q2U A;  2EYM A;  1Q3L A;  2CW0 C;  5HGT A;  5JJZ A;  5JOB A;  3R2I A;  3BVZ A;  1L0W A;  3NHH A;  2E2I H;  2B2U C;  2IPK D;  1YHQ A;  5J39 A;  4IPC A;  4BBR B;  4NW2 A;  5EPK A;  2LFN A;  2R7D A;  3FKI G;  3I2Z A;  2JQO A;  1HXY D;  3FKI H;  3K7A B;  3FVQ A;  4Y52 H;  2UUA L;  1YIT A;  1STN A;  5COR A;  4DK6 C;  1G91 A;  1G2S A;  4JCV E;  3CP0 A;  5BN3 A;  2K4K A;  2J4X A;  5G3L F;  1E7Z A;  1KC8 C;  3S2H H;  2BDN A;  1ICF B;  4DR7 L;  1LTI D;  1NJI C;  4DR7 Q;  3E9I A;  2F0M A;  2JE6 I;  1A0I A;  1ZYR C;  3VA7 A;  3SK4 A;  5C0X H;  1B9M A;  1RIP A;  1EZ8 A;  3CCR A;  1B53 A;  4A3I G;  5ISR A;  1YJN A;  3C2P A;  1X3G A;  2R7Z G;  4DPG A;  4A3I H;  3GTO B;  2SOB A;  2R7Z H;  4C2M H;  5M5X B;  4A3K B;  2JA5 G;  2PZU A;  1A3V A;  3A74 A;  3GD7 A;  2JA5 H;  1E2W A;  1I94 L;  2B2T C;  1EZ6 A;  1H95 A;  1I94 Q;  2XGT A;  1XMQ L;  2I5L X;  4BY1 B;  4WJW A;  2RHS B;  4KY5 A;  1XMQ Q;  1GVP A;  4EX5 A;  1E0B A;  3NP8 A;  2V4D A;  4FXK C;  3K57 A;  2Q8R E;  4WRD A;  1TY0 A;  1JQY D;  3GTQ H;  1I6H B;  4WFN 3;  2ICI A;  1CKN B;  3FP9 A;  4IQZ A;  1GXD C;  3CPW A;  5LMN W;  3C1F A;  1YI2 A;  1PTO C;  4DV0 Q;  1QWY A;  1EYG A;  2YU9 B;  1DCZ A;  1G8Z D;  4FF3 A;  4B3M L;  3D6C A;  2EJF C;  3L0O A;  1YNX A;  5CV7 A;  1V9P A;  1CQF A;  1AZP A;  1K0S A;  4ZKB B;  1KNA A;  4OXP A;  4LF7 Q;  4JYA L;  1DOL A;  3FPP A;  1CA5 A;  1S5B D;  4JYA Q;  4LF8 Q;  3HKS A;  3MEF A;  2ES2 A;  3TME A;  4RGT A;  1F9R A;  2Y0S G;  3K6O A;  3AU7 A;  2UU9 L;  5DNF A;  1D5M C;  2QW7 A;  3NBH B;  4KN4 C;  4KV6 A;  1PH5 A;  4A3G G;  2KHJ A;  4A3G H;  3H3V I;  2N88 A;  3TSS A;  1HTP A;  3NUC A;  2EPB A;  5ELF A;  1HFN A;  2K5Q A;  5G3L D;  3VDY A;  2EE1 A;  2B29 A;  2VB3 X;  2XRS D;  4NPS A;  1QVF A;  2J0T D;  5AFW A;  2UUC L;  2HCI A;  2MO1 A;  1U0L A;  3H0G G;  4A3C G;  4A93 G;  3KF6 A;  5CV4 A;  2XWB B;  4A3C H;  4CJ1 B;  4A93 H;  3R8B A;  1IW7 C;  1BCP C;  2R6G A;  3UDF A;  1VQI A;  1YNJ D;  3NQT A;  3GTJ H;  1V8Q A;  4DV6 L;  1N9W A;  1STY A;  2WP8 J;  4CHT B;  1PH3 A;  1NR2 A;  5IT9 E;  2KHS A;  3SK5 A;  2M9V A;  1OXS C;  2K52 A;  1JJ2 A;  3CCV A;  3CRL C;  3E5S A;  1SXT A;  3VR2 A;  4GOP C;  1YNN C;  4KKS A;  1UE7 A;  1CKM A;  2K33 A;  2K5W A;  3MXN B;  5LHY 1;  1V1O A;  1ASZ A;  1BOS A;  4JI6 Q;  4DR3 L;  1GUG A;  1STE A;  2F4V L;  1EQQ A;  4ODG A;  3IFT A;  1YHA A;  2F4V Q;  2F0I A;  4LNQ A;  1DD2 A;  2HIX A;  4B3S L;  2AMC B;  3GV6 A;  1SYD A;  4OEM B;  1VQ7 A;  3RNU A;  4MIU A;  1UNS A;  4YWM A;  2Q8T A;  1S5C D;  1EU4 A;  3S1R B;  1FR3 A;  1OXX K;  4RHS A;  3TZD A;  1EIG A;  1GO3 E;  1CT1 D;  1JJG A;  4A3B G;  3VYU A;  3HOW G;  4NB3 A;  3WDN A;  4A3B H;  2BA1 A;  4B3R Q;  3HOW H;  3IKJ A;  1KRS A;  1Q81 C;  3A8I E;  4IUR A;  4DU9 A;  2H1E A;  4M8A A;  1QVC A;  2NVX B;  1NMF A;  1T5E A;  4ZK9 B;  2EYO A;  5H1S E;  2XTI A;  3RD4 A;  1T5X D;  2PNH A;  1PH2 A;  2K28 A;  4BBS B;  1FL0 A;  2R92 G;  2DUD A;  4IUV A;  1GHJ A;  2R92 H;  1EUJ A;  2C9O A;  1PDQ A;  5C0X J;  1CSP A;  1EYD A;  1AE2 A;  3U50 C;  2L0C A;  1V1Q A;  4MTK A;  3HFZ B;  1E3P A;  2WAQ G;  2F0E A;  3K5O A;  1TWH B;  3J7A V;  4C3H G;  3AB9 A;  1IL8 A;  1DOK A;  4C3H H;  3A7A B;  2G9H D;  2KA7 A;  4KHP L;  2XN9 C;  4M1U B;  5C4Z A;  4OX9 L;  1BR9 A;  4TSS A;  4FF1 A;  3RN5 A;  1J9O A;  1N32 Q;  1QG7 A;  4ME5 A;  2KUM A;  4A76 A;  1SFO H;  1XNR L;  5JPN C;  3VA5 A;  1XNR Q;  5C5M A;  2JJQ A;  2MJ8 A;  5C3W A;  3AMU A;  2DY8 A;  1UE6 A;  1EY6 A;  2BH8 A;  2ZXO A;  1VQM A;  2KEE A;  4UP7 A;  1LT5 D;  1IBL Q;  2FXQ A;  4DV3 L;  1LTG D;  2RDG A;  2QF7 A;  1V1P B;  1LAC A;  2SNM A;  2L12 A;  4FP5 D;  5JVH 3;  1JOO A;  5DM6 3;  2EYJ A;  1PRT B;  2JN4 A;  1TS2 A;  1E2Z A;  3PUY A;  5C44 G;  4P2C B;  1SEB D;  3N52 A;  5IE8 A;  5C44 H;  1LTA D;  3Q8D A;  3UDX A;  5E1F A;  1ET9 A;  5IYB G;  3KLW A;  1JB7 A;  5JJL A;  5IYB H;  1GM5 A;  1HNZ L;  5IT9 L;  2F4I A;  1Q1B A;  1RD9 D;  3W1G A;  3OW2 A;  1WFQ A;  1LTR D;  4CDF C;  1N34 Q;  3MC0 B;  3DHQ A;  3J7Y W;  1BBX C;  1EL0 A;  4GNX B;  3FEW X;  3HOU G;  1SR3 A;  4IUP A;  4APV A;  3HOU H;  2NTS A;  2F0N A;  4ZCK A;  4IFD G;  3FMC A;  1WVL A;  4IFD H;  2NWG A;  2Z6B A;  3WOE A;  3PO2 G;  1D6E C;  1LTS D;  3PO2 H;  4OO1 I;  4IOC A;  2RBM A;  1I4H A;  3I4M G;  1MI2 A;  2TMP A;  2JA7 G;  3I4M H;  2JP1 A;  4LUO A;  4X64 L;  4R4T A;  2JA7 H;  2E2I B;  2K5H A;  4POG A;  1XYI A;  5CBA E;  3G4S A;  3I4N G;  2ZM6 L;  4CDE C;  4R1J A;  4RCO A;  3I4N H;  4B08 A;  2K5D A;  3D6W A;  1CTM A;  5KRU A;  3T1H Q;  3FKI B;  1YIJ A;  4TRD A;  3E0E A;  1EQT A;  3T13 A;  1B3A A;  4PQX A;  3U4V A;  3D0F A;  3MA2 B;  1XPO A;  1AE3 A;  1HUM A;  2I07 B;  1P8L A;  4WOR A;  2YTY A;  2Z4H A;  3J7A F;  3S2H B;  1FJG L;  1GJX A;  2I5M X;  5LMU Q;  3DEP A;  1PH9 A;  1K83 H;  2L15 A;  1HQR D;  3CXC A;  5KYL A;  4JI0 L;  2F0F A;  1PTO F;  4FNF A;  4EQN A;  1C9O A;  1X32 A;  1YNJ C;  1G2T A;  4HAE A;  3NWT A;  1EY0 A;  4A3I B;  2QDL A;  2MP1 A;  4UP8 A;  2R7Z B;  1HNW L;  1FYC A;  3ITP A;  1KDC A;  1RJT A;  4KJO A;  1Q12 A;  4IPD A;  3ERQ A; 
#chains in the Genus database with same CATH homology
 2JA5 B;  1GUS A;  1GUW A;  5C6A A;  5FKA C;  2FMC A;  4QB4 A;  2K03 A;  3OWF A;  1I4Q A;  1JOR A;  3KK7 A;  2WIN B;  5EKI A;  1MBY A;  1O7L A;  3GTQ B;  2RVL A;  1PRT D;  2R3Z A;  5CV5 A;  4F88 A;  1TS5 A;  4DNR B;  4K6L A;  2RSO A;  4G7O C;  4ZKC B;  5I2Y A;  5LL6 X;  4FF2 A;  1A2U A;  1KLU D;  2FMM A;  2F0S A;  1KNE A;  3NTI A;  2BOS A;  5K36 G;  5K36 H;  4O42 A;  1I4X A;  3DWA A;  3I90 A;  4OIK A;  1BCP F;  3T16 A;  1WTW A;  4QF4 A;  3H91 A;  2Y0S B;  5KNC A;  2IJ0 A;  2TSS A;  3QWN A;  3X3N A;  3FDT A;  2PMZ B;  2DNC A;  2EJM A;  3FPU B;  3K59 A;  4A3G B;  3ERO A;  5IIF A;  2AQ1 B;  1WTX A;  4PMW A;  2VXW A;  3V05 A;  3K0Y A;  5ELB A;  5KEE A;  5JAV A;  4H0L C;  3T56 B;  4LMQ D;  3M7G A;  2Z4I A;  3UI2 A;  5EQ0 A;  2MGS A;  5KNB A;  4A93 B;  4XYO A;  3SXH A;  3GTJ B;  4FF4 A;  4N9P A;  3P20 A;  3P75 A;  1HA6 A;  5C5L A;  1EWH A;  3ONA B;  4OL7 A;  3GTM B;  1U4L A;  5IGB A;  5BN4 A;  3IL8 A;  1AEX A;  4H13 C;  2NTT A;  1HHV A;  3EA6 A;  4XQQ A;  3BYT B;  4ZYS A;  2F3V A;  5K5P A;  2PO4 A;  3NTH A;  5M9O A;  2A68 C;  5HUR A;  1LT4 D;  3T53 B;  2XNA C;  4A3B B;  3HOW B;  1U4P A;  2PQE A;  3DMU A;  1TS4 A;  2WII B;  2RDF A;  4RGM A;  3QJY A;  1RTO A;  1EYA A;  1F2L A;  1K8O A;  1ESR A;  1D1K A;  2R92 B;  2M00 A;  3BDC A;  2OF1 A;  1SSO A;  3EVQ A;  5CV6 A;  4LK1 C;  1A2T A;  1PZJ D;  3MWY W;  1EEI D;  2WAQ B;  5IGE A;  5CR3 A;  4DK0 A;  1Z7T A;  1GOZ A;  2G9D A;  4C3H B;  2MUY A;  1Z47 A;  1CK1 A;  1F2M A;  3A8K E;  1SFO B;  3N6R A;  4DNT B;  2VB2 X;  1ZXT A;  1TWG B;  2EDG A;  2B2V A;  1DON A;  1PMR A;  2XIW A;  3DWQ A;  1B4O A;  1QIL A;  4DAV A;  2XSC A;  2IL8 A;  4G7Z C;  1JR0 D;  3Q0A A;  1AW7 A;  4KD4 A;  4BWG B;  1PRT C;  5C44 B;  1SYG A;  2I46 A;  2EY6 A;  1C8C A;  3R2T A;  1SYB A;  2OEO A;  2CQA A;  3I3C A;  1H9S B;  4EVO A;  1UAP A;  3OMG A;  2K7V A;  4B9W A;  2X69 A;  3HOU B;  2B2W A;  2BDO A;  5C0X I;  4KKT A;  1F9Q A;  1WD0 A;  1F77 A;  4QIW B;  3TP6 A;  1ILP A;  5CBE E;  3PO2 B;  3KBG A;  2F0J A;  1TII D;  1AP0 A;  2ENB A;  3I4M B;  2F0G A;  2JA7 B;  1A3T A;  1VDZ A;  1SJE D;  1TQO A;  1M8A A;  3I4N B;  2QKI C;  3BS1 A;  2PW7 A;  1SMY D;  4BS9 A;  2X6G A;  2KCC A;  3S9W A;  2B39 A;  3SK6 A;  4DK1 A;  1K83 B;  2Q8I B;  2A69 C;  1ESF A;  3J80 E;  2F0Q A;  3MVV A;  3SVM A;  4FVM A;  1VMC A;  3IAY A;  3G6J B;  1HCZ A;  1X3P A;  2K6A A;  2KJX A;  4E6I A;  1KAA A;  1SNP A;  2F0K A;  1DOM A;  2OXP A;  3TP7 A;  2F0H A;  2RA4 A;  4NP5 A;  2BE5 D;  4ZQ3 A;  5I6W A;  4A3D B;  2IX0 A;  1EEF D;  1LT6 D;  1G6Z A;  3E6Z X;  4NDX A;  3W2D A;  4C1N K;  1MSH A;  1OO9 B;  2F03 A;  1NCV A;  2E2H B;  1H9S A;  4NMZ A;  1LTB D;  1JWM D;  5D3I B;  4ABN A;  1CZG A;  4I65 A;  3KLS A;  4RKB A;  1EIH A;  2ICE C;  5IGD A;  1STH A;  2D5D A;  5IGC A;  1FNV A;  4C56 C;  2E2J B;  1R4P B;  1LLR D;  4XQJ A;  1TT2 A;  2XVS A;  1GHK A;  3IFD A;  4RA8 A;  3C1E A;  1EY7 A;  5EKK A;  4DGZ A;  3MZ5 A;  4A3M B;  1ENF A;  4JBW A;  5ELD A;  3NE5 B;  1B1Z A;  1B2T A;  1RF2 D;  1EQV A;  1Y69 U;  4PMB A;  1HRJ A;  2DY7 A;  1CHQ D;  1I50 B;  2O4X A;  5C4H A;  2N55 A;  4Z9C B;  3HS0 C;  4CKB A;  2K32 A;  2K01 A;  2PYK A;  1IYU A;  4PV1 C;  2RSN A;  2D9U A;  1IKM A;  2IWH A;  1WD1 A;  3I91 A;  2B2V C;  3HRZ C;  1U4R A;  3J80 L;  3GTL B;  3NBH A;  4C1N I;  1BF4 A;  3MFY A;  1II3 A;  3K5M A;  1TY2 A;  3K5N A;  1SNQ A;  3I72 A;  1XXG A;  1PFN A;  3D4W A;  3NQI A;  3D8G A;  3L9A X;  1SAP A;  1B9N A;  5EJW A;  1ONL A;  2F0T A;  3GO5 A;  3Q23 A;  2E76 C;  2WAC A;  3VYR A;  5LL6 S;  2DN8 A;  2EY1 A;  3TBI B;  5E3F A;  4QUF A;  4N9T A;  1PYW D;  4BA2 I;  1K8M A;  2B2W C;  4C3J G;  1LO5 D;  3HZX A;  1TVX A;  1QOH A;  4XDX A;  2IX1 A;  3MXN A;  4ZLT F;  4KKU A;  5DM7 3;  3PV0 A;  5T1I A;  2ZT9 C;  1SMY C;  3GQB A;  2ID0 A;  1OXU A;  1NUC A;  5E4W C;  4O1N A;  2EYP A;  1TKW B;  2IT1 A;  1ZKO A;  3J81 E;  1PRT F;  4XTC S;  4CBV A;  3MXP A;  3Q6S A;  2KCN A;  1H9K A;  5I9O A;  4KK7 A;  4L63 B;  4I7Z C;  2WKD A;  1SE4 A;  4FYD A;  4RGO S;  3S15 B;  4DXG A;  4DAP A;  1KAB A;  2Z1C A;  1PFB A;  3JAM E;  4LJZ C;  3TP5 A;  2JSO A;  4IUQ A;  1XX8 A;  2EY5 A;  1FNU A;  1Y8O B;  3OIQ A;  4OO1 G;  4OO1 H;  2H4O A;  2HUG A;  2NZ1 D;  4RAU C;  4ZAI A;  2JEB I;  5I6Y A;  3GTK B;  5I2X A;  1U4M A;  2EYF A;  1PZI D;  1I4R A;  4IUU A;  3WOF A;  5BN5 A;  4DF7 A;  1V1P A;  4U67 3;  5D14 A;  2A6H D;  4K8J A;  1BO0 A;  3SHL A;  2LS0 1;  1RCV D;  3OOC A;  3KLS X;  3OPO A;  2O5I C;  5NUC A;  4ZRZ A;  1I6V C;  1Y1W B;  2NYZ D;  5ELE A;  1STG A;  3V96 A;  1QNU A;  2EYH A;  2F0P A;  1QJO A;  1TWA B;  2YYZ A;  3Q22 A;  2WKC A;  3R3O A;  4OHJ A;  4K14 A;  4KMU C;  2F3W A;  3CU7 A;  3EQL C;  4KY7 A;  1VF5 C;  3PIP 3;  2MHV A;  3GTG B;  4L6T B;  2NVT B;  5M5W B;  2B8G A;  3J81 L;  1PFM A;  1SYE A;  2LMC B;  5KIX A;  1TWC B;  5ELC A;  5D3D A;  2E74 C;  4X3U A;  3HKZ B;  2FHT A;  5EPJ A;  1HQM C;  3Q24 A;  5M5Y B;  1CFM A;  4HN7 A;  1ZYR D;  4U68 A;  1WTR A;  4IZ8 A;  3I4L A;  1SE2 A;  1D1I A;  2F0D A;  3CQZ B;  3DUZ A;  1ICW A;  2EY2 A;  2EJG C;  1DJR D;  1DZ1 A;  2EOT A;  3JAM L;  3A56 A;  3H0G B;  3F2U A;  2EVB A;  2EZV A;  4L8J A;  2C5C A;  4RH6 A;  1MGS A;  4XT3 B;  5CYU A;  1S4Z A;  3U9S A;  2D2C C;  5IGG A;  4Q0F A;  1M4V A;  4K2K A;  1W6J A;  1LT3 D;  1R4Q B;  5KND A;  1BXT A;  3BYY B;  3VYT A;  3M4O B;  3HG9 A;  3CKI B;  5FO7 B;  4IFD J;  4RFB A;  2NN6 I;  1O7Y A;  5A35 A;  4PNY A;  3SEB A;  2L55 A;  4KJN A;  5M3M B;  1EY8 A;  3MTS A;  4J6H A;  4JK1 C;  4HMI A;  2R61 A;  2JA8 B;  3MEH A;  2DNE A;  5A2Q L;  3KUP A;  1DM0 B;  1F2Z A;  2PCF B;  3BZD B;  4DN4 M;  1RTN A;  1B50 A;  1LV9 A;  1SNC A;  3RMH A;  4X3S A;  1HUN A;  3HOX B;  1SYF A;  1JIC A;  1UEA B;  3CRK C;  2KOL A;  1BQQ T;  3VR3 A;  4A3E B;  3D4R A;  3NXW A;  1JE4 A;  1U9R A;  4EGV A;  4F8M A;  1S5E D;  1F9P A;  1EWC A;  4RWS C;  3I73 A;  3BVG A;  3OMC A;  5DEH A;  1ROD A;  4X3K A;  2L1B A;  4LAA A;  1SDF A;  1HTL D;  2HCC A;  1JOK A;  2IX3 A;  1WTQ A;  1IKL A;  2PZT A;  3BVM A;  2L9H A;  2A6H C;  1TU2 B;  4K6D A;  1JC7 A;  3M3Y B;  3O13 A;  3OSO A;  1EY4 A;  4C3J B;  3RZO B;  2X6L A;  5EBC A;  1DXM A;  3TZU A;  1Y8P B;  2D62 A;  4ZUJ A;  3HP3 A;  4R8N A;  5FO9 B;  1L0X B;  3I8Z A;  2QIL A;  4HR7 B;  1EFI D;  2J7Z A;  3K58 A;  1BUV T;  2B2Y A;  4EQO A;  4Q5V A;  2A5H A;  3SDZ A;  2IW3 A;  3PIO 3;  4FXG C;  1C4Q A;  3S16 B;  4HSP A;  1LAB A;  4KTA A;  1AZQ A;  2JYO A;  3MAQ A;  3OHX C;  2F0O A;  3VR4 A;  1MD2 D;  4KHV A;  1PTO H;  5C4X B;  1QE6 A;  4Y7N B;  4ZUI A;  5I4D A;  3M4Y A;  4UDU C;  1MSG A;  3G7L A;  5C0X G;  2A6E D;  5I9P A;  3MHB A;  3PUW A;  4OIJ A;  1HPC A;  2ZXP A;  5J1Z A;  1JOQ A;  1EU3 A;  1J8I A;  4GZY C;  3HOZ B;  3DEO A;  2QDB A;  3QG1 A;  4KHZ A;  3S2D B;  1RDP D;  3V2T A;  3RLF A;  1BDO A;  5CC4 A;  3LWE A;  2F0U A;  4X3T A;  4FO2 A;  3PO3 B;  3VR6 A;  1OXT A;  1QCB D;  4XXE A;  4F7X A;  3KBX A;  5EKL A;  2M2L A;  2E75 C;  1UUP A;  1EY9 A;  4XT1 B;  3R93 A;  4K5V A;  3X3M A;  3ND8 A;  5CV8 A;  3S1M B;  1D5X C;  1NAP A;  4R8I A;  2WB1 B;  3QOJ A;  4MN3 A;  5EGT A;  4CJ2 C;  2F0L A;  1ILQ A;  3S14 B;  3GTP B;  1D2B A;  2FJ2 A;  3S1Q B;  1XWE A;  2SNS A;  1ENC A;  2AUK A;  3U9O A;  2RQX A;  5FLX L;  3P7J A;  2NB0 A;  4CKE A;  1F9S A;  4ILW A;  2NVQ B;  5IOC A;  2SEB D;  1ML0 D;  1RKN A;  2HQE A;  2KED A;  4ID6 A;  3DM1 A;  1TS3 A;  3VR5 A;  1FGB D;  1TR5 A;  3TN2 A;  2NVY B;  1CA6 A;  4KD3 A;  4KN7 C;  3SR1 A;  1SNM A;  1OXV A;  2CHB D;  4UAI A;  1PLF A;  3H3V C;  3QIA A;  1JCK B;  4HTH A;  2QCP X;  3E0J A;  3NK9 A;  2JA6 B;  3DXJ C;  1SYC A;  1WTV A;  4R9W A;  4BA1 I;  5T1G A;  1Y1V B;  4B9X A;  1Q1E A;  1PXU A;  1E2V A;  2QEJ C;  3NPP A;  3TDQ A;  2BA0 A;  2K05 A;  2B2Y C;  1EOT A;  1EYC A;  4V19 0;  2F0W A;  5J22 A;  3A7L A;  3H6M A;  1R9T B;  4QUC A;  4MHE A;  3FRP B;  2RKS A;  2RDH A;  3KF8 A;  1H9J A;  1SJH D;  3PUX A;  2LKV A;  5FO8 B;  4IN3 A;  3NWS A;  1S5D D;  3K5L A;  4C3I G;  5JEA G;  5JVG 3;  5JEA H;  4S3S A;  2A6E C;  3P1H A;  2FFK B;  3LX0 A;  5KYI A;  5E4X A;  2OT2 A;  4RKL A;  1KTK A;  2AQ2 B;  2NUC A;  4HCS A;  3HOY B;  4K5W A;  4BY7 B;  4V0B A;  3DWP A;  3ZYY X;  2CVR A;  2L5T A;  4KY6 A;  1O7Z A;  4K5X A;  5TSS A;  2K1B A;  2B63 B;  2JEA I;  3A8J E;  4AYB B;  3RZD B;  2JXM B;  3M7N A;  1AFP A;  4RCN A;  1ENA A;  3CHB D;  4IFD I;  3LWU A;  4ULL A;  1FD7 D;  1SBB B;  4HSV A;  2AWO A;  1JB3 A;  2BE5 C;  5KGU A;  4A3J B;  5C3X A;  1PZK D;  2A68 D;  4DXF A;  4HMJ A;  1B44 D;  1F2Y A;  4HED A;  1GUN A;  1I3Q B;  4G57 A;  1CQV A;  3QO2 A;  5CMD A;  1STA A;  4J8Q A;  1NR4 A;  1STB A;  3KLR A;  4FXD A;  3PUZ A;  4F87 A;  3NTK A;  1AN8 A;  5JPM C;  2AQ3 B;  3QOL A;  2O5J C;  2PZW A;  1KDB A;  3D4D A;  3W3A A;  1HFG A;  3A55 A;  1SNO A;  1PTO B;  4OGQ C;  3PMF A;  2XRQ D;  5CV9 A;  5FK9 C;  2F0V A;  5A2Q E;  1O78 A;  2HDM A;  1A6X A;  3S1N B;  1VCI A;  5C3E B;  5IOD A;  5FOB B;  4G4K A;  4C2M B;  2PNR C;  4KI0 A;  1C48 A;  3EJI A;  2B2U A;  4DFA A;  3L3O C;  3OIP A;  4CKC A;  5C4J B;  1ZEQ X;  4PMC A;  4J1M A;  4DAY A;  2CW0 D;  3RUZ A;  3GV3 A;  3NBI A;  3QB3 A;  1EY5 A;  1L0Y B;  3NSW A;  2LY7 A;  4A3F B;  3BDL A;  4XYQ A;  3VYS A;  3OWE B;  1TWF B;  4G7H C;  1W6K A;  4IAL A;  1CI3 M;  5EBD A;  4YIJ A;  2R93 B;  4DA2 A;  1GUT A;  1NSN S;  1CHP D;  1BCP B;  4HCE A;  2B2T A;  1O80 A;  4K8I A;  3BG3 A;  3OW7 A;  5JEA J;  3HEJ A;  1I4G A;  3PUV A;  5CGK A;  1H9R A;  1QB5 D;  1CZW A;  3EFX D;  4RGN A;  4H7B A;  1I4P A;  4CGY B;  4EQP A;  3ND9 A;  4QMG A;  3HGB A;  1CM9 A;  3LNN A;  4RHR A;  1Q90 A;  1G29 1;  2VUM B;  1FNW A;  3BDO A;  1PTO D;  2WV6 D;  5COY A;  2A69 D;  3H94 A;  3M85 A;  1IYV A;  2GA4 B;  1BNZ A;  5M3F B;  3D3R A;  3SE0 A;  4NKL A;  2AUJ D;  2A73 B;  2EYL A;  1V43 A;  2B8F A;  1LTT D;  5IGF A;  4QCL A;  4K2L A;  3C3L A;  2VNU D;  1IHZ A;  2O2L D;  4XQN A;  2KQ3 A;  2K04 A;  4H44 C;  5DAU A;  4XIG S;  3C46 A;  2NN6 G;  1D5Z C;  2NBF A;  3A54 A;  1JWU D;  2NN6 H;  2PW5 A;  4CJ0 B;  1KDA A;  2SDF A;  4TQU S;  3D31 A;  3H09 A;  1A3U A;  1A15 A;  3T4A C;  1WTP A;  5D65 A;  2ZXR A;  3S17 B;  1JWS D;  4IUT A;  2KVM A;  3MFG A;  3MXU A;  2MPM A;  2E2D C;  2F1M A;  5EPL A;  2AWN A;  2KEC A;  5F2D A;  1IW7 D;  1BCP D;  1H9M A;  1WCM B;  2PPB C;  3L7Z C;  3TP8 A;  1QNK A;  1VF7 A;  2HDL A;  3URY A;  2EXZ A;  1Z6H A;  3MXG A;  1SE3 A;  2Z8L A;  1YNN D;  3GP7 A;  3SK8 A;  2L11 A;  1XTC D;  4IUN A;  4TKO B;  2BCO A;  2L4N A;  1Q8I A;  1Y8N B;  4C3I B;  2FIN B;  3I70 A;  1KLG D;  3HOV B;  2A74 C;  3T51 B;  1WTO A;  1RHP A;  1VMP A;  1ET6 A;  1SND A;  1HA5 A;  1X3Q A;  1S5F D;  1GUO A;  5FLX E;  2XWJ B;  1DYQ A;  2EYM A;  1Q3L A;  2CW0 C;  5HGT A;  5JJZ A;  5JOB A;  3R2I A;  3BVZ A;  3NHH A;  2B2U C;  2IPK D;  5J39 A;  4BBR B;  4NW2 A;  5EPK A;  2LFN A;  3K7A B;  1HXY D;  3FVQ A;  1STN A;  5COR A;  1G91 A;  1G2S A;  5BN3 A;  2J4X A;  5G3L F;  2BDN A;  1LTI D;  2F0M A;  2JE6 I;  1ZYR C;  5C0X H;  3VA7 A;  3SK4 A;  1B9M A;  1EZ8 A;  1B53 A;  5ISR A;  3C2P A;  3GTO B;  2SOB A;  5M5X B;  4A3K B;  2PZU A;  1A3V A;  3GD7 A;  1E2W A;  2B2T C;  1EZ6 A;  4BY1 B;  4WJW A;  4KY5 A;  1E0B A;  3NP8 A;  2V4D A;  4FXK C;  3K57 A;  2Q8R E;  4WRD A;  1TY0 A;  1JQY D;  1I6H B;  4WFN 3;  2ICI A;  4IQZ A;  1GXD C;  3C1F A;  1PTO C;  1QWY A;  2YU9 B;  1DCZ A;  1G8Z D;  4FF3 A;  3D6C A;  2EJF C;  5CV7 A;  1CQF A;  1AZP A;  4ZKB B;  1KNA A;  1DOL A;  3FPP A;  1CA5 A;  1S5B D;  3TME A;  4RGT A;  1F9R A;  3K6O A;  3AU7 A;  5DNF A;  1D5M C;  4KN4 C;  4KV6 A;  2N88 A;  3TSS A;  1HTP A;  3NUC A;  2EPB A;  5ELF A;  1HFN A;  2K5Q A;  5G3L D;  2EE1 A;  2VB3 X;  2XRS D;  2J0T D;  5AFW A;  2HCI A;  5CV4 A;  2XWB B;  4CJ1 B;  3R8B A;  1IW7 C;  1BCP C;  2R6G A;  1YNJ D;  3NQT A;  1V8Q A;  1STY A;  2WP8 J;  4CHT B;  1NR2 A;  5IT9 E;  2KHS A;  3SK5 A;  2M9V A;  1OXS C;  3CRL C;  3E5S A;  1SXT A;  3VR2 A;  1YNN C;  4KKS A;  2K33 A;  2K5W A;  5LHY 1;  1V1O A;  1BOS A;  1GUG A;  1STE A;  4ODG A;  3IFT A;  2F0I A;  1DD2 A;  3GV6 A;  1SYD A;  4MIU A;  1UNS A;  2Q8T A;  1S5C D;  1EU4 A;  3S1R B;  1FR3 A;  1OXX K;  4RHS A;  3TZD A;  1EIG A;  1CT1 D;  3VYU A;  3WDN A;  2BA1 A;  3IKJ A;  3A8I E;  4IUR A;  4DU9 A;  2H1E A;  4M8A A;  2NVX B;  1T5E A;  4ZK9 B;  2EYO A;  3RD4 A;  1T5X D;  2K28 A;  4BBS B;  4IUV A;  1GHJ A;  2C9O A;  1PDQ A;  5C0X J;  1EYD A;  2L0C A;  2F0E A;  3K5O A;  1TWH B;  3J7A V;  4C3H G;  3AB9 A;  1IL8 A;  1DOK A;  3A7A B;  2G9H D;  2KA7 A;  2XN9 C;  4M1U B;  5C4Z A;  1BR9 A;  4TSS A;  4FF1 A;  1J9O A;  1QG7 A;  4ME5 A;  2KUM A;  5JPN C;  3VA5 A;  5C5M A;  2MJ8 A;  5C3W A;  3AMU A;  2DY8 A;  1EY6 A;  2ZXO A;  2KEE A;  1LT5 D;  1LTG D;  2RDG A;  2QF7 A;  1V1P B;  1LAC A;  2SNM A;  2L12 A;  4FP5 D;  5JVH 3;  1JOO A;  5DM6 3;  2EYJ A;  1PRT B;  1TS2 A;  1E2Z A;  3PUY A;  4P2C B;  1SEB D;  3N52 A;  1LTA D;  5E1F A;  1ET9 A;  5IT9 L;  2F4I A;  1Q1B A;  1RD9 D;  1LTR D;  3MC0 B;  3DHQ A;  3J7Y W;  1BBX C;  1EL0 A;  3FEW X;  4IUP A;  2NTS A;  2F0N A;  4IFD G;  3FMC A;  1WVL A;  4IFD H;  2NWG A;  3WOE A;  1D6E C;  1LTS D;  4OO1 I;  2RBM A;  1I4H A;  1MI2 A;  2TMP A;  2JP1 A;  2E2I B;  1XYI A;  5CBA E;  4RCO A;  4B08 A;  2K5D A;  3D6W A;  1CTM A;  5KRU A;  3FKI B;  4TRD A;  3T13 A;  1EQT A;  1B3A A;  4PQX A;  3MA2 B;  1HUM A;  2I07 B;  4WOR A;  2Z4H A;  3J7A F;  3S2H B;  1GJX A;  3DEP A;  1HQR D;  5KYL A;  2F0F A;  1PTO F;  4FNF A;  4EQN A;  1X32 A;  1YNJ C;  1G2T A;  4HAE A;  3NWT A;  1EY0 A;  4A3I B;  2MP1 A;  2R7Z B;  1FYC A;  3ITP A;  1KDC A;  1RJT A;  4KJO A;  1Q12 A;  3ERQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...