1HNXQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 22
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hnxQ00
1G291 1HZ9A 2Q2UA 4A3DG 1PVOA 1LM0A 4TQUS 4GLAC 3F2BA 2ZJRA 2YU9H 2F3IA 4LF4Q 2PI2A 3CPWA 4DV6Q 3HOVH 1KIXA 1U0LA 4A3FH 4MZ9A 2I5MX 4IFDG 3H0GG 4QQBX 1VQOA 4OWXB 1WJJA 1PHJA 4DR4Q 4HJ5A 2NVTH 2Z6KA 1B7YB 2ALYB 2NVXH 1X54A 1S40A 3S17H 4GKKQ 3NEMA 4PMWA 2RHQB 1P8LA 2F4VQ 3FKIH 1WCMH 2EQSA 2MO0A 3UDXA 4YY3L 2PI2E 2QA4A 2R93G 5C0XJ 1VQ4A 1XNRQ 5GADC 3CCVA 1A63A 2A19A 2Q2IA 1IZ6A 1HZAA 5GAEC 1OXTA 3CMAA 2KBNA 1SFOH 1TWFH 3HOXH 2VQFQ 4GN3B 2K5HA 4GLXA 1K0RA 1X55A 1KC8C 4DR7Q 1XJVA 4DUZQ 1K3RA 3CCUA 2JE6I 1HZBA 5IP7H 4WJ3M 2E2IH 4GKJQ 1HJPA 2MQHA 4JI4L 1CKOA 3EBEA 4IO9A 2VL6A 3PO2G 4JI5Q 2VW9A 1AE3A 2VS1A 3HOZH 2CCZA 3D31A 2D62A 3KDFA 4JBJA 4DKAC 2UUAL 1VQIA 1KRTA 4DNIA 1LTLA 3RNUA 1Q82C 2UUBL 4OX9L 1YVCA 1E24A 3U4VA 4UY8C 2PNHA 4KHZA 4KI0A 1PYBA 2JA7H 4FDBA 2ATWA 3STBD 2DUDA 3K7AH 1VQ8A 2IHEA 4BY1H 3D0FA 4LUVA 1E3PA 5IYBG 4DR6L 1B8AA 1E7ZA 4UP8A 1X9NA 1QUQB 3OW2A 4A76A 1HR0L 5IT9c 4R4QA 4NXNL 1VQGA 4YY3Q 1M90C 4APVA 5FLMG 3Q8DA 2UU9L 1Y1WH 2OWOA 5IYCG 5JJKA 1YHBA 2VUMG 3RN5A 4JCVE 4LNQA 1VS0A 2E2JH 1SMXA 4B3SL 4HJAA 1VQDA 1K83H 3RLOA 1U5KA 1TXYA 3GTLH 4R1JA 1YITA 3HOVG 3J81i 1VQ5A 2UUCQ 4DR1L 3S24A 1VQ7A 2ES2A 4DV5L 4A3FG 5FLXc 4JI4Q 2K14A 4JG2A 1N33Q 3PUZA 4DR3L 3GD7A 1J6QA 1L0WA 3I2ZA 5M5XH 4GOPC 2UUAQ 3UDGA 4A3BH 2R7ZH 3VDYA 2JJQA 4AQYL 2N49A 1QVFA 3NBHB 5IWAQ 1NTGA 1J5EL 3FKIG 1WCMG 2Q2TA 2UUBQ 4OX9Q 3GTPH 1HNWL 4DV0Q 1SRUA 2MO1A 4GS3A 4P74A 3NELA 3TS2A 5M3MH 2D0OA 4GN4B 4BA1I 1JJGA 4DR6Q 2VNUD 3MEFA 1ASZA 3M3YH 1HR0Q 3HOXG 4NXNQ 3F8TA 4XTCS 4A3IH 4LF7L 4OO1G 3ULLA 2UU9Q 1T9HA 5IP7G 1LUZA 4TVAB 5IE8A 1FJGL 2Y0SE 4P71A 1I5FA 4A3MH 1JB7A 3OYYA 4B3SQ 4BBSH 2R7DA 1JJ2A 3HOZG 2KENA 1W3SA 4LUZA 2UXBL 4QIWE 1YBYA 1BVSA 2AMCB 4DR1Q 2HIVA 4AIMA 4DV5Q 1TWHH 2K50A 2H5XA 3KDFB 3HOUH 4DV7L 1HH2P 5BR8L 4DR3Q 1VQMA 1N36L 2NVYH 1M1KC 2JA7G 3M7NA 3CC4A 4BY1G 3WWVA 1CKMA 2L15A 4AQYQ 3NENA 1KD1C 4DR2Q 1W2BA 2C35B 2K4KA 1J5EQ 1HNWQ 4JOIC 3K81C 1PH3A 4WJ4A 3PF4A 5C4JH 3OTOL 5LMNL 3CCSA 1Y1WG 1X65A 1QZHA 3PO3H 4K0KL 1Q1EA 1PH1A 2XTIA 4DV3L 3M4PA 4A3KH 4LWCA 1XNQL 4NPSA 4J15A 4IPDA 2I5HA 4LF7Q 3GTQH 1GD7A 2V1CC 1VQ6A 3KOJA 1JJCB 3J7ZC 1O7IA 3U4ZA 4C3JH 1FJGQ 3RZDH 1V1QA 2AHOB 1UE1A 3T1HL 1GKHA 2UXBQ 3F2CA 1FL0A 1VCIA 4JV5L 2JA8H 4DPGA 4Y7NH 4MTNA 1X6OA 4GNXC 1CSQA 2R7ZG 4A3BG 3PGZA 4LF8L 4YWLA 3GO5A 4C3HH 5BR8Q 1N36Q 1CSPA 2FXQA 4POGA 1JMCA 4YCUA 4X65L 4X6AH 2K52A 5M3MG 1OXSC 3CW2C 4YHHL 5M3FH 3IRBA 4LF6Q 2IX0A 4IJLA 4MNOA 1YI2A 1K73C 4LFBL 4A3IG 2Y0SG 1NJIC 3OTOQ 1TWGH 5IYCH 5LMNQ 3GDEA 3CXCA 1WYDA 1SROA 4K0KQ 4A3MG 2ID0A 4DV3Q 1JE5A 1VQEA 1H95A 4BBSG 4JOIA 3CMEA 3RLNA 2B29A 4P73A 4DV4L 1PA6A 1XNQQ 2OQ0A 3E0EA 4A75A 2KCMA 4LFCQ 3PUVA 4A3EH 1PH9A 3DM3A 3T1YL 1E22A 5IY0A 4LF9L 4IPGA 3HOUG 2HIXA 3T1HQ 4BXXH 1IBKL 1Q1BA 4JV5Q 4YWKA 2LXKA 2GVAA 1YEZA 3CC7A 1BBWA 4LF8Q 2VZAA 1GVPA 3A5UA 4JBKA 2K75A 2D0PA 3ERSX 5C0XG 1EFWA 4X65Q 4GNXA 3PO3G 4GKJL 2JEBI 3UE1A 2I0QA 4IOAA 4A3KG 1I6HH 3AYHB 4R4OA 2BH2A 4Y52H 3EN2A 4AH6A 2IT1A 4LFBQ 2K5VA 2CFMA 2WP8J 1RIPA 3JAMc 3E9HA 2YTYA 1FVIA 2WAQG 2E5LL 1PH4A 2UXDL 1IBMQ 1V9PA 3M85A 2VY3A 3J81j 1XMOL 1VQ9A 1PYSB 3F1ZA 1XMQL 3S14H 4HIDA 3AFQA 5LMNW 4DV4Q 4R4TA 4QGUA 1IL2A 3PUXA 2K5NA 1IXRA 2JA8G 1CKNA 3CPFA 5C44H 3RN2A 1VQLA 1HNXL 2OQKA 3J80c 1MKHA 2HHHL 2BH8A 2A8VA 1EIFA 5GROA 3T1YQ 4LF9Q 2R6GA 3S1QH 4BY7H 4DAYB 4A3LH 5ELOA 4NB3A 3U58A 3KF8B 5IP9H 1YJ9A 3GTOH 1CUKA 4PZ8A 4A4IA 2Z0SA 1UWVA 5M3FG 4B3TL 3S15H 4UP7A 4BBRH 4JC0A 3ER0A 1DGSA 3CD6A 3CF5A 3FP9A 3RR5A 4EX5A 3I7FA 1KHIA 2PMZE 3HOYH 2NN6I 3ULPA 2JA6H 1WFQA 3S1RH 1VQJA 3TEHB 3I4OA 1N8RC 3ZJYC 4C2MH 2OCEA 2AKWB 4JI1L 2E5LQ 2UXDQ 1I94L 1XMOQ 1VQCA 1UEBA 2B3GA 1BBUA 3A74A 4A3EG 1XMQQ 1UE6A 3CCRA 3PSIA 2PQAA 1V43A 1Q12A 2YYZA 3I4NH 4BXXG 3ICEA 1G6PA 2RCNA 1Q86C 3GTKH 1I3QH 1KAWA 4JI2L 3ULJA 2AWOA 1XPOA 1HNXQ 1G51A 1KL9A 1IYJB 3UDIA 4POFA 5C3EH 2OTLA 3S2HH 3S16H 1EOVA 3UDFA 3I55A 3AEVA 2Q2HA 4HIKA 1NMGA 2LSSA 2CWAA 2LXJA 4PG3A 1MIUA 1K8AC 4OWWB 3H3VI 1WOCA 5JEAJ 1Z47A 3RZOH 2KHJA 1SR3A 3UE0A 2YTXA 4C3IH 2ZTCA 4GNXB 4P75A 2B63H 4L5QA 1GM5A 2GN5A 1IBLL 1YHQA 5J3BA 5LMUL 4GOPA 1NY4A 1R9TH 4LFAL 2MNAA 4HJ9A 3M9BA 1Y1VH 2N3SA 1GO3E 4LW1A 3KJOA 2ASBA 2CKZB 4JI1Q 5C44G 1K8GA 1NMFA 1I94Q 4HIMA 3A0JA 1PFSA 1UE5A 2Z6KC 4R4CA 4BY7G 4A3LG 4NXML 1CKNB 1C0AA 4IPCA 4A3CH 3SGIA 5IP9G 4JI2Q 4YWMA 1PH7A 3A5ZB 3PUWA 2OTJA 1S72A 3KF6A 5AJ3L 4BBRG 5M5WH 3K8AA 2R92H 2BA0A 3K80C 5HGQA 2IHFA 2UXCL 3M4QA 4A93H 4DV7Q 1L1OC 3CCJA 3HOYG 1XPUA 2EIFA 3HKSA 2YTVA 2ZTDA 3G4SA 1A8VA 2JA6G 1BKBA 1TWCH 5GAGC 2KCTA 1VQBA 1IBLQ 4RG1A 5LMUQ 3CAMA 4DUZL 4JI0L 2JK8A 3PIPA 3PIOA 4LFAQ 1N32L 5DLQE 1MJCA 1YZ6A 3KLWA 3MXNB 4KLKA 3I4NG 1YJNA 5GQOA 3L0OA 4JI5L 2IX1A 3J7A5 1YHAA 1A0IA 3KJPA 5C3EG 4HJ7A 2PQAB 4HJ8A 3S2DH 1TWAH 4ME3A 4H02A 4JBMA 4NXMQ 2JQOA 1Q7YC 1NE3A 2VQEL 3JAMi 4YCVA 4DV2L 2XGTA 1EIYB 1E1OA 2RF4A 2NZHA 5EAYA 5AJ3Q 1SLJA 4DK6C 2JA5H 3S1NH 1QVCA 4EQ5A 2B63G 1SE8A 5C4XH 3L2PA 2UXCQ 2WFWA 3CC2A 4OO1I 3JC66 3KFUA 1Y14B 4DR5L 3PUYA 4A3JH 3J80i 1QZGA 4JI7L 1QVGA 3CQZH 4YHHQ 2F52A 2BA1A 1Y1VG 1VQKA 3HKZE 4GOPB 1YJWA 4B3RL 1VQPA 4JI8L 1L1OA 1UE7A 1OTCA 3CP0A 1X3FA 2ZM6L 5E7NA 3K0XA 4JI0Q 4KHPL 2UUCL 1JT8A 4IOCA 1N32Q 1PH2A 2N8NA 3W1BA 3B6YA 4LF5L 4O0AA 1N33L 4A3CG 3CCQA 1C9OA 2E2HH 3L7ZC 3I4MH 2R92G 3AQQA 4UP9A 4JI3L 2I5LX 3PCOB 1PH8A 5IWAL 2IY5B 3G48A 4A93G 2VQEQ 2EXDA 4DV2Q 1B70B 3F2DA 4DV0L 3KF6B 2WB1E 1IBKQ 1Q46A 3G71A 1ASYA 1D7QA 3BU2A 3GTJH 5IYDH 3BJUA 4JI6L 3GTMH 3HOWH 3K7UC 3G6EA 2GVBA 5FJ8H 1MJEA 4DR5Q 3CCLA 4JI7Q 4DUYL 1X56A 1EQRA 1N9WA 4IJHA 4AYBE 4B3RQ 1KRSA 4JI8Q 3TS0A 1OXXK 4OXPA 2ZM6Q 4A3GH 4KHPQ 4JYAL 1FGUA 1I50H 4P72A 4DAMA 2ZJPA 1HNZL 2HQLA 2ZJQA 1X3GA 3W5OA 4B3ML 1WI5A 4LF5Q 2NZOA 3U50C 1VQNA 5GAHC 5JJIA 4L5RC 4IFDI 4A3DH 4QJFA 3I56A 1X3EA 1XTDA 3H15A 1N34L 4DV1L 1PH6A 2JA5G 5K36G 4JI3Q 4QY7A 2HT1A 2HHHQ 4GLVB 4DR2L 5C4XG 4L5TA 3BZCA 1Q81C 4X64L 2JA9A 3H0GH 4A3JG 1XPRA 3HKZG 3J81c 3CCMA 4JI6Q 4B3TQ 1YNXA 3M4OH 2CQOA 3STBC 2ZTEA 4OWTB 1KQSA 1KXLA 5JJLA 1LYLA 4PZ6A 1E1TA 4BA2I 1AH9A 2R93H 3TQYA 3PF5A 4DUYQ 3H3VH 1EUJA 5ELNA 1L1OB 1EWIA 4X66L 3RLFA 4X62L 1IBML 1L2FA 5M5YH 2RHSB 1Q8KA 4IPHA 3I4MG 4LUOA 2A1AA 3DLLA 2DGYA 1A62A 3KYHC 3PV0A 1HNZQ 3CCEA 4LF4L 2AWNA 4DV6L 4JYAQ 5H1SE 4UPAA 2WB1G 3HFZB 1YIJA 4B3MQ 1SN8A 1EQQA 5C0XI 4OONA 1N34Q 3PO2H 5JEAG 4RMFA 1D8LA 1OXUA 5IYDG 4DV1Q 1VQHA 2MFIA 2QGQA 4DR4L 2YV5A 4HIOA 4LF6L 3BZKA 3HOWG 5HY6A 2QEXA 4GKKL 3TREA 1RL2A 4X64Q 5FJ8G 3W1GA 1C7YA 1EYGA 1NBWA 1PV4A 1Z9FA 2F4VL 3AFPA 2JEAI 4XIGS 2KHIA 1P16A 2R7FA 1QUQA 4R4IA 1S3OA 3FHWA 2N78A 4AYBG 1XNRL 4IFDJ 4ALPA 4QL5A 3GTGH 4L5SA 1VQAA 3TRZA 1K9MC 1VQFA 3LGJA 4DK3C 5IYBH 4PZ7A 4YCWA 3EIVA 4A3GG 1HZCA 4LFCL 2E8GA 2VQFL 1HR0W 4DR7L 3S1MH 5FLMH 1PH5A 2NN6G 2WAQE 4GN5A 3E9IA 4X66Q 4X62Q 1AE2A 2NVQH 2CWPA 4O2DA 4JBWA 1OXVA 2VUMH
chains in the Genus database with same CATH superfamily
2Q8RE 2Q2UA 1NR4A 5D65A 2F0MA 5JJZA 4LJZC 2F3IA 4LF4Q 2PI2A 4FF3A 1U0LA 5KEEA 2I5MX 3RZOB 4XT3B 4OWXB 2B63B 3NBHA 3GQBA 1B7YB 3MFYA 1DM0B 2M2LA 1S40A 5EKLA 3IFTA 4BWGB 1X32A 2MO0A 2PW7A 2AQ3B 1VQ4A 3FPPA 1A63A 2MGSA 3CCVA 4FYDA 2A19A 1ESFA 1OXTA 2F0TA 4XYQA 1PTOD 1SFOH 4XT1B 3A8JE 1G2SA 2K5HA 1DZ1A 4DR7Q 2DNEA 3ND8A 1K3RA 1SYBA 1HZBA 4NDXA 4JI4L 3EBEA 4ZYSA 1SEBD 3PO2G 1AE3A 3KDFA 4JBJA 2ENBA 4DNIA 4KY5A 3GTGB 2VXWA 4KI0A 4ZKBB 2L0CA 1EY8A 2ATWA 5IIFA 1LO5D 1XTCD 3K7AH 1VQ8A 1E3PA 4H7BA 4A76A 1CT1D 4R4QA 4NXNL 1VQGA 4L6TB 3Q8DA 3N52A 2UU9L 1Y1WH 2OWOA 1O7YA 2VUMG 3KLSA 4JCVE 1VS0A 4R1JA 3WOFA 3HOVG 1VQ5A 4DR1L 1VQ7A 2WACA 4N9TA 2O2LD 1L0WA 5M5XH 2UUAQ 2MHVA 1DONA 1QVFA 3CQZB 2G5DA 1FGBD 1SYFA 2UUBQ 4OX9Q 2Q2TA 1WCMG 3GTPH 4IUTA 2FFKB 2MO1A 1JJGA 2RBMA 4DR6Q 5DEHA 2RVLA 1HR0Q 4A3IH 2E2HB 5IP7G 1FJGL 2Y0SE 3I4MB 4KJOA 2FMMA 3T53B 1YBYA 2X69A 1CI3M 1LT4D 2M9VA 4ILWA 2B2WC 3HOWB 5BR8L 2JA7G 2NVYH 3TSSA 2G9DA 1WTHA 1H9MA 1ET6A 1Y1WB 2L15A 4AQYQ 3NENA 1KD1C 3J80E 4JOIC 2PNRC 5C4JH 2RSNA 1X65A 4DN4M 1L0XB 1I50B 2ICEC 2I5HA 1GD7A 1TS4A 2V1CC 4B9XA 3A7AB 3U4ZA 1V1QA 1UE1A 1CTMA 1RD9D 1FL0A 2EYOA 2JA8H 3GTPB 4GNXC 3PGZA 4FF1A 3QJYA 1N36Q 2B2VA 3HG9A 1B3QA 3R8BA 4A3IB 1D2BA 4X6AH 5M3MG 5J1ZA 1OXSC 4YHHL 3IRBA 4LF6Q 4G4KA 1EYAA 3ZYYX 5DM73 4MNOA 4UDUC 2JP1A 3T51B 1HTLD 1NJIC 5LMNQ 3GDEA 3VR6A 4DV3Q 1H95A 1JE5A 4IUQA 3MTSA 2B29A 3MXPA 3P1HA 2TMPA 2KCMA 2D9UA 1PYWD 2NVYB 4KN7C 3EQLC 2TSSA 5IY0A 1GHJA 1BXTA 3NUCA 3NXWA 1G8ZD 1AW7A 2LXKA 2E74C 5EPKA 2GVAA 3NSWA 3OPOA 2Q8IB 3Q22A 1ET9A 2F0QA 2SNSA 3TMEA 4ZKCB 1SE2A 1PTOB 3ERSX 1GUGA 1SDFA 1JCKB 3PO3G 2WAQB 2I0QA 2A69C 3AYHB 2BH2A 1B9NA 2CHBD 3UI2A 2K5VA 2WP8J 3T16A 2BDNA 1ILPA 4ZCKA 2QDBA 1VQ9A 3NBIA 4HIDA 5LMNW 4QGUA 2PYKA 4A3FB 3K0YA 4ZRZA 2K03A 2D5DA 1STNA 3K6OA 1HNXL 4GZYC 2HHHL 2BH8A 1EIFA 3S1QH 3VYUA 4C3HG 4KKSA 3KF8B 5IP9H 1UWVA 1LTGD 4B3TL 3S15H 4UP7A 4BBRH 2A6HC 1SNMA 3FP9A 3U9SA 4RHRA 4PMCA 2PMZE 3HOYH 5ELDA 2A5HA 4C1NI 3I4LA 1PRTF 3WDNA 1TVXA 2OF1A 3TEHB 3E5SA 5I2XA 5KRUA 3HOZB 3A74A 1BBUA 4H0LC 1UE6A 2YYZA 2L1BA 1CZWA 1G6PA 1I3QH 1G51A 1KL9A 2OTLA 1JORA 4R8NA 1NMGA 4J8QA 2LSSA 1PXUA 3W3AA 4KD4A 1G91A 1K8AC 1O78A 3H3VI 4L8JA 2KHJA 3R2IA 1SNPA 2ZTCA 4GNXB 3PIP3 5EPJA 3PIO3 1GM5A 2GN5A 1AN8A 5LHY1 1IBLL 1KDAA 5CV9A 5LMUL 5CR3A 1NY4A 2MNAA 2QF7A 3K5OA 4OHJA 3S1QB 3KJOA 1Q8IA 4HEDA 1I94Q 2WINB 1Q3LA 4R4CA 2OEOA 4BBRB 2R7ZB 3BVGA 4A3CH 1SJED 1PH7A 4UHVA 4DAVA 1HFGA 3PUWA 4OIJA 3KF6A 2R92H 4ODGA 1HHVA 3K8AA 1BO0A 1E2WA 3K80C 2B2UA 1JE4A 4F87A 2UXCL 4DFAA 5CMDA 5ELCA 1L1OC 3VR5A 4HMIA 2JA6G 2ZTDA 3G4SA 2LY7A 3SK4A 2IJ0A 2Y0SB 1HUNA 4MHEA 1A3VA 2CW0C 1A3TA 1V1OA 4RG1A 4JI0L 4LAAA 1I3QB 1E2ZA 1RJTA 1U4LA 1N32L 5DLQE 1YZ6A 3KLWA 1S5FD 3MXNB 3I4NG 5K5PA 2K33A 2N88A 1TWHB 1YHAA 2EYPA 1A0IA 3KJPA 1CFMA 3MZ5A 5C3EG 1I4GA 1TWAH 2XSCA 2NZ1D 3VR2A 4PMBA 1Q7YC 4DV2L 3JAMi 1Z7TA 2R3ZA 3IL8A 2RF4A 5AJ3Q 1SLJA 3S1NH 1QVCA 2B63G 3L2PA 4A3KB 4OO1I 3JC66 4A3JH 1QZGA 5EBDA 2BA1A 2GA4B 1MSHA 4GOPB 4B3RL 3P20A 2HCCA 3K0XA 3KUPA 4ULLA 1JT8A 4IOCA 1Q90A 5KIXA 4DK1A 4O0AA 1N33L 3L7ZC 4N8X1 4ID6A 4K6LA 3W2DA 5F2DA 1S5DD 3G48A 5M3FB 1GUOA 3F2DA 3BG3A 3BU2A 1MGSA 3GTJH 3FRPB 1WTPA 1TWGB 5E3FA 4JI6L 2Z1CA 3G6EA 1PRTD 2GVBA 4N9PA 3K5NA 3R2TA 4JI7Q 1E2VA 1G6ZA 3A56A 1X56A 1DOKA 1EQRA 1N9WA 1V8QA 3EROA 3OMGA 4HSPA 4IJHA 4A3EB 5IGDA 2ZM6Q 4KHPQ 2HUGA 1HA6A 1RCVD 2A6ED 2NN6H 1X3GA 1WI5A 2NZOA 3HS0C 1HRJA 5JJIA 3K57A 4L5RC 4QJFA 1X3EA 5K36G 3MAQA 4K5VA 4QY7A 4JI3Q 4GLVB 3S9WA 4DR2L 1CQVA 4H13C 2KJXA 2EYMA 5E4XA 1LV9A 4EVOA 1AZQA 3H0GH 1LTID 3Q6SA 4XQQA 5KNBA 4FXDA 1YNXA 4RWSC 2ZTEA 1E1TA 1I4QA 4BA2I 2PZWA 4OEMB 4DUYQ 1EUJA 1L1OB 1EWIA 1QOHA 1RTNA 1RF2D 2P5ZX 4BY7B 2B2VC 3I4MG 3BZDB 2DGYA 1A62A 3PV0A 3GTJB 3EFXD 1STEA 5FO9B 4HN7A 5C0XI 1N34Q 5FLXL 1OXUA 2PMZB 1JWMD 4HIOA 3BZKA 1SNQA 3HOWG 2RKSA 1ZYRD 4GKKL 3VYRA 1RL2A 3I72A 4X64Q 5FJ8G 3S1RB 4XIGS 1P16A 3QG1A 1QUQA 4IFDJ 4RKLA 3LGJA 2K1BA 1XXGA 2E8GA 1IW7C 4RGOS 2CH4A 2KUMA 1AE2A 4O2DA 1C9OA 1G291 1HZ9A 3S16B 1RDPD 1LM0A 4TQUS 2YU9H 3H0GB 3KF8A 2RCFA 2XN9C 4FNFA 3I90A 3I91A 2LFNA 1VQOA 4DR4Q 4HJ5A 2NVTH 1STAA 2ALYB 2DNCA 3NEMA 4PMWA 4IQZA 4RCNA 3RMHA 3FKIH 3UDXA 2F4VQ 2DN8A 4YY3L 2R93G 2QA4A 2XVSA 5GADC 2Q2IA 2BE5D 1HZAA 1ZEQX 3CMAA 2KBNA 4PV1C 2F0GA 3HOXH 2VQFQ 4GLXA 2F0SA 1KC8C 4KKUA 5CYUA 2JE6I 4IUNA 1HJPA 4F88A 5M5WB 1PTOF 2VL6A 2N55A 1SJHD 1MD2D 2VW9A 1F77A 4V0BA 1BDOA 2XWBB 4DKAC 1SXTA 4C1NK 1YVCA 1TWCB 3U4VA 3A54A 3K58A 4KHZA 1WTQA 4BY1H 2IHEA 2RDFA 5IYBG 2X6LA 1B8AA 5D3DA 1E7ZA 1KDBA 4UP8A 3OW2A 1F9RA 5IT9c 4KKTA 1GXDC 2NYZD 5FLMG 2VB3X 2YU9B 3RN5A 3S2DB 2O5JC 2E2JH 5I6WA 4B3SL 1LTAD 3GV3A 1TXYA 1VF7A 3GTLH 5C4HA 5EKIA 2KOLA 3J81i 1LT6D 1S5CD 2ES2A 4A3FG 4ZAIA 4JI4Q 2JA5B 4JG2A 2FHTA 3FKIB 4RA8A 4QMGA 3I2ZA 1GUSA 4A3BH 2AQ1B 5KNDA 5IWAQ 1HNWL 3QO2A 1SRUA 3HOXB 4P74A 3MXNA 3OW7A 5EJWA 1SMYD 3VA7A 4NXNQ 2AUKA 4LF7L 4OO1G 3MXUA 2UU9Q 4CDCC 4TVAB 4A3MH 1JB7A 3OYYA 1WTVA 4BBSH 2R7DA 4O1NA 3HOZG 2UXBL 5EPLA 1BVSA 2AMCB 2ZXPA 4DR1Q 4AIMA 4KV6A 4BY1B 3J80L 2K50A 3HOUH 3GTMB 3SK6A 1BCPD 1M1KC 1WD1A 3CC4A 3BYYB 5BN4A 5C6AA 1W2BA 2C35B 1EY6A 1IL8A 2OXPA 3OTOL 3OWEB 1QZHA 1BUVT 3M4PA 1NAPA 4J15A 3NWSA 1VQ6A 1O7IA 4C3JH 1FJGQ 3SE0A 1SE3A 2AHOB 1BR9A 3T1HL 2BDOA 4EQNA 4DPGA 1DJRD 2R7ZG 4LF8L 4YWLA 3V2TA 5JPNC 3DHQA 1DCZA 5BR8Q 3M4OB 4YCUA 5ELFA 1TY2A 2K52A 1OO9B 4V190 3CW2C 1BCPC 3N6RA 4IJLA 1YI2A 1RODA 4FF4A 1I4XA 2Y0SG 1B50A 1WYDA 4QUFA 1VQEA 4DV4L 1A2UA 1PA6A 3HOUB 2OQ0A 3DEPA 4A75A 5ELBA 4LFCQ 3M4YA 4C56C 1PH9A 2V4DA 4FXGC 5HGTA 3BVZA 1IBKL 4BXXH 1Q1BA 2B8GA 4YWKA 3CKIB 1BBWA 1SNDA 4FO2A 1GVPA 2FJ2A 2K75A 5C0XG 1SYGA 1C48A 1ESRA 2JEBI 3UE1A 4A3KG 1D1IA 4C3JB 2IX3A 4AH6A 2NVQB 3E9HA 2E5LL 1PH4A 1LLRD 2CQAA 3TN2A 2L55A 2UXDL 3M85A 1XMOL 1PYSB 3RD4A 1ILQA 3C46A 2MJ8A 3PUXA 1RTOA 3NE5B 3V05A 2HQEA 3QOJA 5E1FA 1CKNA 3OIQA 3CPFA 2A68C 5BN5A 5C44H 1EEFD 2KEDA 4UAIA 3U9OA 2F0JA 1I4PA 5FO7B 2EY5A 4KK7A 5GROA 2R6GA 4A3LH 4DAYB 5KYIA 1R4PB 3U58A 2EDGA 3GTOH 4PZ8A 2Z0SA 5M3FG 1EIGA 1Z6HA 5JVG3 2AUJD 2F3WA 3ER0A 4JC0A 1DGSA 3CD6A 2EY2A 1SFOB 3PMFA 2C5CA 5J39A 2KQ3A 4F8MA 3I4OA 2F0KA 5IGEA 4C2MH 2OCEA 2AKWB 4JI1L 1H9JA 4DA2A 1VQCA 1Y8NB 4O42A 4A3EG 3IAYA 3PSIA 1V43A 1Q12A 2J7ZA 5C3WA 5CC4A 3ULJA 1HNXQ 1IKMA 3S2HH 3UDFA 3I55A 3AEVA 2Q2HA 3EA6A 4N8FA 3K7AB 2LXJA 5KYLA 3OIPA 1TKWB 1WOCA 5JEAJ 1SR3A 3UE0A 2YTXA 4C3IH 4P75A 4L5QA 2DJFC 2IW3A 4IN3A 1PFMA 1R9TH 4OL7A 1Y1VH 1GO3E 1BCPB 1Y8OB 3KBGA 1K8GA 2ASBA 4HIMA 3GTOB 3F2UA 2K5QA 2PO4A 3H91A 5M5XB 4BY7G 4NXML 4IPCA 1MBYA 4K6DA 4YWMA 2G9HD 3A5ZB 2OTJA 1S72A 1U4PA 3O13A 1EZ8A 3DWPA 4CJ1B 3M4QA 4A93H 1GUTA 4DV7Q 1JC7A 2A69D 3CCJA 1LTBD 2EY6A 5GAGC 4WJWA 2KCTA 1STBA 2EYJA 1IBLQ 5LMUQ 2EZVA 3CAMA 2OT2A 1HTPA 3DEOA 1YJNA 5GQOA 3L0OA 1U9RA 3J81E 1H9SB 2MP1A 5CV7A 5CBEE 1QWYA 1HQRD 2PQAB 4ME3A 2JQOA 2F0OA 1NE3A 2VQEL 4C3IB 1YNNC 2B2TA 1EIYB 2A6HD 4I7AA 5EAYA 4DK6C 5C4JB 1R9TB 1SYCA 3ERQA 1SE8A 3NPPA 5C4XH 2F03A 1Y1VB 2UXCQ 1O7ZA 2K6AA 3KFUA 1TT2A 2CVRA 4JK1C 5COYA 4DR5L 3CHBD 1TS3A 3I3CA 3HKZE 1XX8A 1B3AA 1UE7A 3CP0A 1X3FA 4JI0Q 4RGTA 1N32Q 2JA8B 3B6YA 3P7JA 1JICA 3CCQA 4A93B 3AQQA 4KTAA 4UP9A 2JXMB 2I5LX 1PH8A 5IOCA 3E3XA 2L9HA 4MN3A 1CK1A 4DV2Q 4IURA 1SYEA 2WB1E 3MC0B 1ASYA 5JEAH 3QB3A 5IYDH 3EJIA 1QE6A 4ZQ3A 1GOZA 3DWQA 2K05A 4AYBE 4B3RQ 3TS0A 1OXXK 1I4RA 4NW2A 4A3GH 3VR4A 3TBIB 1FGUA 1HNZL 2ZJQA 4DAMA 1JQYD 3NTHA 3T4AC 1EQTA 3U50C 2B39A 3L3OC 1XTDA 4DV1L 2JA5G 2WKDA 2K28A 3NHHA 4IUPA 1JOQA 1LTRD 4RKBA 5C5LA 2JA9A 4RH6A 1ZXTA 1V1PB 2H1EA 3G7LA 2CW0D 1XPRA 2NTSA 3CRLC 4JI6Q 2F0DA 1DOLA 5LL6S 3STBC 4OWTB 5JJLA 3C3LA 1LYLA 4PZ6A 4ABNA 1A3UA 4X66L 1IBML 3C2PA 3K5MA 1L2FA 5M5YH 2RHSB 1Q8KA 2EE1A 2K5DA 2WV6D 3NP8A 3DLLA 3KYHC 2AWNA 5AFWA 4DV6L 4UPAA 3HFZB 3S15B 1EQQA 3E0JA 4ZK9B 3PO2H 3NQTA 5IGBA 4LF6L 3HOYB 5HY6A 3FPUB 3TREA 2R61A 4DK0A 1PV4A 3IFDA 2JEAI 3TP5A 1ZKOA 1S3OA 1XNRL 2N78A 3ITPA 2HDMA 3TRZA 1VQFA 1MI2A 3EIVA 5EGTA 4RAUC 1HZCA 3K59A 1F2LA 3S1MH 1PH5A 3E9IA 4JBWA 4GKJL 2VUMH 4A3DG 4CHTB 1PVOA 3F2BA 2ZJRA 4GLAC 3CPWA 1IKLA 3HOVH 1KIXA 1D1KA 4IFDG 4E6IA 2JYOA 1EY0A 2Z6KA 1AP0A 1CZGA 2NVXH 1X54A 3S17H 4GKKQ 1SNCA 1P8LA 2RHQB 5M5YB 1HPCA 4K2LA 1WCMH 2EQSA 1PDQA 4CBVA 2EJMA 5GAEC 1TWFH 4M1UB 5M9OA 4GN3B 4QUCA 1PFNA 4DUZQ 3CCUA 5IP7H 4WJ3M 2E2IH 5I6YA 2R92B 3KBXA 3TP8A 1TR5A 4ZUJA 2C9OA 4IO9A 4JI5Q 3D31A 2D62A 3IKJA 3T56B 1KRTA 3X3NA 4HCSA 5I9OA 1LTLA 1QNKA 1Q82C 1E24A 4UY8C 1JWUD 2O4XA 2JA7H 1K28A 3ONAB 4RGNA 4TSSA 4LUVA 1CA5A 1X9NA 4YY3Q 1JB3A 2LS01 1U4RA 1TU2B 5IYCG 4KHVA 3HOVB 1YHBA 5JJKA 1TWAB 1SMXA 4HJAA 1VQDA 1K83H 4J6HA 1U5KA 3FEWX 2QKIC 4MIUA 5KNCA 3I70A 2NBFA 1YITA 1J8IA 1STGA 2UUCQ 1B1ZA 2QDLA 3S24A 1D5ZC 4DV5L 5FLXc 3S1NB 3S17B 2F4IA 1JR0D 3A8KE 4OELB 4DR3L 1ENFA 1J6QA 1F2ZA 1WCMB 2IPKD 3UDGA 4F7XA 4A3JB 4QF4A 2JJQA 3HKZB 3NBHB 1J5EL 1NTGA 1FNVA 1H9KA 1HA5A 4DV0Q 4GS3A 3NELA 1C8CA 3DUZA 5M3MH 4GN4B 4BA1I 2VNUD 1IW7D 3MEFA 2E2IB 1ASZA 3M3YH 1DYQA 4H44C 3F8TA 1H9SA 1I4HA 1T9HA 5L37A 5IE8A 1C4QA 2EY1A 2NTTA 4B3SQ 1JJ2A 2EJFC 2WB1B 1W3SA 4LUZA 3AU7A 2JA7B 3R3OA 4DU9A 5C5MA 2H5XA 3KDFB 3J7AF 1HH2P 3H09A 2EPBA 4HAEA 3WWVA 1HQMC 4JVZA 1CKMA 2RDGA 4AYBB 1HNWQ 2K4KA 3NWTA 2I07B 4WJ4A 1BCPF 1PH3A 3BDLA 3PF4A 3MWYW 1UEAB 4U68A 1Y1WG 1LABA 3PO3H 4K0KL 1Q1EA 1PH1A 3AMUA 4LWCA 1XNQL 4IPDA 4LF7Q 2KEEA 3GTQH 1ENAA 3NK9A 3J7ZC 4CDEC 3RZDH 4RHSA 1GKHA 2UXBQ 1VCIA 4JV5L 4Y7NH 4MTKA 5M3MB 1PMRA 3TZDA 1F2MA 2MUYA 3FMCA 4C3HH 1CSPA 2FXQA 2BCOA 2Z4HA 1JMCA 4X65L 4POGA 4JW0A 2IX0A 1F9SA 1K73C 4LFBL 4A3IG 4QIWB 3D3RA 3OTOQ 5IYCH 3ND9A 3CXCA 1SROA 2ID0A 4JOIA 3MHBA 4P73A 3E0EA 2ZT9C 1NR2A 1Y69U 3D6WA 3DM3A 3T1YL 1E22A 4LF9L 3T1HQ 1CHPD 3HEJA 4TRDA 3CC7A 4LF8Q 2VZAA 5ELEA 4BS9A 2D0PA 3VYSA 1PFBA 4DXGA 4GNXA 4CGYB 1I6HH 4FVMA 1BF4A 4R4OA 4Y52H 3H94A 3RZDB 1RIPA 3A55A 1KNEA 2YTYA 2WAQG 3Q24A 1V9PA 3J81j 4Y7NB 5DNFA 1K0SA 1XMQL 1O80A 3S14H 1K3BC 3AFQA 4DV4Q 4R4TA 2LMCB 4KN4C 2JA8G 4QCLA 4C3HB 3RN2A 3PQIA 3NQIA 3J80c 1MKHA 1BBXC 2NVTB 2A8VA 5ELOA 1EWCA 2E75C 1CUKA 4A4IA 1XWEA 1T5EA 4FP5D 1KTKA 2EOTA 2RDHA 3CF5A 3RR5A 4EX5A 3I7FA 1F2YA 1DXMA 2NN6I 3ULPA 2JA6H 4G7ZC 1L0YB 1N8RC 5C4ZA 5EQ0A 4KJNA 2E5LQ 2KCCA 2UXDQ 1WTXA 5I2YA 1XMOQ 2B3GA 3QR8A 5CBAE 2PPBC 3I4NH 1B4OA 2B2UC 3GTKH 1EFID 1KAWA 4JI2L 1IYJB 4POFA 5C3EH 3E6ZX 1EY5A 3JAME 1EOVA 1I6HB 1PZID 4HIKA 1IYVA 1FR3A 4OWWB 1LACA 3RZOH 5G3LF 2Z8LA 2F0PA 4G57A 4HMJA 2B63H 1QNUA 1YHQA 4R9WA 2E2JB 4GOPA 3TZUA 3GTLB 4WORA 4LFAL 4HJ9A 3M9BA 2F3VA 2N3SA 5IGGA 1QILA 4LW1A 2CKZB 4JI1Q 3LNNA 4X3KA 1UE5A 3RUZA 2Z6KC 5A2QE 2Z9HA 1C0AA 4A3BB 3SGIA 1QCBD 5IP9G 4NMZA 4BBRG 4I65A 1LT3D 3QWNA 3HZXA 2IHFA 4FF2A 3BS1A 1M8AA 3LWEA 1K8OA 3HOYG 2EIFA 2YTVA 1A8VA 1SE4A 2F0WA 1BKBA 3R93A 4FXKC 3FVQA 5HURA 1VQBA 4A3MB 1BNZA 5JPMC 4BBSB 2JK8A 3PIPA 3PIOA 2RQXA 1MJCA 5C3EB 2A68D 3A7LA 3I73A 2E2DC 1O7LA 2NWGA 4HJ8A 4XYOA 1B44D 4H02A 2IL8A 4NXMQ 1IHZA 3D4WA 1WTWA 2XGTA 5CORA 2NZHA 5K36H 3OHXC 2XRSD 2WFWA 3CC2A 1Y14B 3PUYA 4HSVA 1QVGA 3CQZH 1YNJC 4YHHQ 2PW5A 1YJWA 1ICFB 1VQPA 4JI8L 1L1OA 1UAPA 1OTCA 5E7NA 2Q8TA 2PZUA 3C1FA 1PH2A 3W1BA 3VR3A 4LF5L 4A3CG 2KECA 2E2HH 1ONLA 1CQFA 2WKCA 1VDZA 2F0NA 4K5XA 3I4MH 2R92G 3H3VC 3BDOA 3NTKA 3PCOB 5IWAL 2IY5B 2VQEQ 1B70B 3KF6B 3G71A 3BJUA 4DGZA 1CHQD 3HOWH 3BDCA 5FJ8H 1MJEA 1EOTA 2K5WA 3VA5A 4DR5Q 2KHSA 1NUCA 4TKOB 4U673 1PTOC 4JYAL 1EL0A 1I50H 4P72A 1GJXA 1PZJD 4B3ML 3D8GA 2EXZA 4IFDI 3I56A 3SDZA 3CRKC 1KNAA 3HGBA 2HHHQ 3T13A 2K04A 1LT5D 1Q81C 1NNXA 5G3LD 1EYDA 4X3SA 1J9OA 5C3XA 4A3JG 1SAPA 3HKZG 4B3TQ 1ICWA 1HXYD 1KABA 2CQOA 4YIJA 5IGCA 1DOMA 4EQOA 1B53A 2R93H 3LWUA 3TQYA 5C44B 1EY7A 3H3VH 5ELNA 4X62L 1II3A 4ME5A 4IPHA 2PCFB 2A1AA 3X3MA 4LF4L 4CKEA 3CCEA 1HNZQ 5IT9E 1YNND 2WB1G 1YIJA 1D5XC 1FNWA 1SN8A 5CV4A 1XYIA 4OONA 4CKBA 4RMFA 1D8LA 4DV1Q 2QGQA 2YV5A 1WTRA 2PQEA 2QEXA 2DY8A 4J1MA 1F9PA 3TP6A 4AYBG 4C2MB 2EJGC 4ALPA 1PTOH 4L5SA 1VQAA 1K9MC 5IYBH 4PZ7A 4YCWA 4LFCL 1HR0W 4HTHA 4DR7L 5FLMH 2NN6G 4X66Q 1IBMQ 1JWSD 2CWPA 1OXVA 4CDFC 3S2HB 5A35A 2H4OA 5CGKA 1BOSA 4G7HC 3D4DA 1QG7A 4DV6Q 3HRZC 4IUUA 3HP3A 5ISRA 4A3FH 4MZ9A 5LL6X 2L11A 3H0GG 4QQBX 1WJJA 1PHJA 4K8JA 2R93B 2XWJB 1EQVA 4CJ0B 2PI2E 2BOSA 1WD0A 2NUCA 5C0XJ 1XNRQ 2E76C 1M4VA 1IZ6A 1ENCA 1QJOA 3SEBA 1K0RA 1X55A 4OO1H 1XJVA 4GKJQ 3VYTA 1EU3A 2MQHA 1CKOA 2SOBA 2VS1A 3HOZH 3DMUA 1PLFA 4X3TA 3L9AX 2CCZA 4OIKA 2UUAL 1VQIA 1AEXA 5KGUA 3RNUA 2UUBL 3WOEA 5IODA 4OX9L 2O5IC 2LKVA 2PNHA 1PYBA 2JSOA 4FDBA 3SK8A 3STBD 3CU7A 2DUDA 3D0FA 4DR6L 3M7GA 4KD3A 2J0TD 1QUQB 1HR0L 1SBBB 4Q0FA 3J7YW 1M90C 4APVA 5NUCA 4DF7A 4LNQA 3RLOA 2SNMA 1PZKD 2FMCA 4Q5VA 2K14A 1W6JA 1S5BD 5I9PA 1N33Q 4WRDA 3PUZA 5C4XB 3GD7A 4GOPC 1T5XD 1TIID 1CA6A 2R7ZH 3VDYA 1UNSA 2M00A 2N49A 4AQYL 3FKIG 1W6KA 3TS2A 3SVMA 2D0OA 3GP7A 3HOXG 1MSGA 4XTCS 2I46A 1SYDA 3ULLA 2RSOA 3BVMA 2EYHA 1LUZA 2ZXRA 1I5FA 4P71A 1A2TA 2F0IA 1EEID 2KENA 5TSSA 2SDFA 4QIWE 4IZ8A 2HIVA 2K01A 1H9RA 1EYCA 4DV5Q 1LTSD 1TWHH 2HD3A 5DAUA 1UUPA 4DV7L 4DR3Q 1N36L 1VQMA 2B2YA 3M7NA 1EZ6A 4BY1G 1AZPA 4DR2Q 1J5EQ 3K81C 5C0XH 4IUVA 1A6XA 5LMNL 3CCSA 4A3GB 2XTIA 4DV3L 2QCPX 4A3KH 1B9MA 3D6CA 4NPSA 4P2CB 5CV8A 4DNTB 3KOJA 1JJCB 4I7ZC 4NP5A 3F2CA 3A8IE 4DAYA 4MTNA 1X6OA 4A3BG 1CSQA 2AQ2B 3P75A 3GO5A 4XQNA 3MXGA 1HFNA 2WIIB 5M3FH 1HUMA 1TWGH 1S5ED 1JOOA 1EWHA 4K0KQ 4A3MG 1D5MC 4EGVA 4BBSG 2HCIA 3RLNA 3CMEA 1XNQQ 2DJGC 3PUVA 3PO2B 2Z6BA 2L12A 4A3EH 5E4WC 5J22A 4IPGA 3HOUG 2HIXA 4OGQC 4QB4A 4JV5Q 3KK7A 1FNUA 1YEZA 1SSOA 4Z9CB 1U4MA 3D4RA 3A5UA 4JBKA 1BQQT 4M8AA 1EFWA 4X65Q 5IGFA 1S4ZA 4IOAA 4B9WA 2J4XA 2F0EA 3S1MB 3EN2A 1X3PA 2IT1A 4LFBQ 2CFMA 3SR1A 4RFBA 3JAMc 1FYCA 2VUMB 1FVIA 2XNAC 1WVLA 2B8FA 2VY3A 4C3JG 3AB9A 3F1ZA 4R8IA 2VB2X 1IL2A 2K5NA 1IXRA 1VQLA 3OSOA 2OQKA 4KY6A 4G7OC 3T1YQ 4LF9Q 4BY7H 1WTOA 2NVXB 3SHLA 3K5LA 4NB3A 1YJ9A 4L63B 3URYA 5T1GA 1GUNA 2L4NA 1Y8PB 3MEHA 1TWFB 1KHIA 1VF5C 2FINB 3DXJC 1WFQA 3QOLA 3S1RH 1IYUA 2L5TA 1AFPA 1E0BA 1VQJA 3ZJYC 1JOKA 3J7AV 1I94L 1EIHA 1UEBA 3Q0AA 3JAML 1XMQQ 3CCRA 2PQAA 4BXXG 3V96A 3ICEA 3KLRA 2RCNA 1Q86C 4KMUC 1XPOA 2AWOA 2F0VA 3UDIA 2CH4W 4X3UA 3H6MA 1RHPA 4IALA 3S16H 1KLGD 5T1IA 2CWAA 4PG3A 1MIUA 4PNYA 1Z47A 3MA2B 3GV6A 1KAAA 1ML0D 5J3BA 2PZTA 1PRTC 1K83B 4DXFA 3TDQA 4HCEA 5A2QL 3FDTA 1CM9A 1FD7D 2ICIA 3EVQA 5BN3A 5C44G 1NMFA 2B2TC 3DM1A 1TY0A 3A0JA 1PFSA 2DY7A 3KLSX 5EBCA 5D14A 5JVH3 4A3LG 1CKNB 1GUWA 1EU4A 2A6EC 4LK1C 2EVBA 4JI2Q 5FOBB 2F0FA 5M5WH 5AJ3L 5I4DA 4JPBW 2BA0A 2EYFA 2MPMA 5HGQA 3OMCA 3M3YB 1XPUA 3HKSA 2Z4IA 4ZUIA 1TWCH 2QILA 2B2WA 4DUZL 4LFAQ 4KLKA 2D2CC 2QW7A 4JI5L 2IX1A 3J7A5 4CDDC 5FKAC 2F0UA 3DWAA 4HJ7A 3S2DH 1TS5A 4JBMA 1KLUD 4CJ2C 4ZLTF 4YCVA 2X6GA 1RKNA 5JOBA 1E1OA 1STYA 1TQOA 4PQXA 3TP7A 2JA5H 1V1PA 4C3IG 4EQ5A 3PO3B 3G6JB 4LMQD 4DNRB 1ZYRC 5FO8B 3J80i 4JI7L 3GTQB 3QIAA 2IWHA 1Y1VG 2F52A 2KCNA 1VQKA 2ZM6L 4KHPL 2UUCL 1VMCA 2N8NA 2EYLA 2XIWA 3I8ZA 1LTTD 2RA4A 1G2TA 4K2KA 5CV5A 2XRQD 4CKCA 4JI3L 1I6VC 2KVMA 1NCVA 4A93G 2F0HA 1TS2A 2EXDA 4HR7B 1KDCA 4DV0L 3SK5A 1IBKQ 1Q46A 1D7QA 4RGMA 1X3QA 3GTMH 5D3IB 3K7UC 1VMPA 5JAVA 3Q23A 5FK9C 3CCLA 1R4QB 2NB0A 4DUYL 3LX0A 1HCZA 1K8MA 1KRSA 4JI8Q 4OXPA 2BE5C 1STHA 1B2TA 5DM63 2B2YC 1GHKA 2ZJPA 1EY9A 2HQLA 1PRTB 3W5OA 4LF5Q 1VQNA 2F0LA 5GAHC 4A3DH 1EY4A 3H15A 1N34L 2K7VA 1PH6A 3SXHA 2HT1A 2A73B 5C4XG 4L5TA 3BZCA 4X64L 4WFN3 4IFDH 4K8IA 2K32A 4B08A 5CV6A 3J81c 3CCMA 4RCOA 3MFGA 3M4OH 3S14B 1KQSA 1KXLA 4XQJA 1AH9A 4K14A 2KA7A 3PF5A 5IT9L 1NSNS 1D6EC 2F1MA 2QEJC 3RLFA 3MVVA 4LUOA 4DAPA 4EQPA 4JYAQ 5H1SE 2A74C 4B3MQ 4KY7A 5JEAG 5IYDG 4DR4L 1VQHA 2MFIA 1F9QA 2ZXOA 1DD2A 2JA6B 3W1GA 4XXEA 1C7YA 1NBWA 1EYGA 1Z9FA 1YNJD 2JN4A 3AFPA 3C1EA 2KHIA 4NKLA 5FLXE 2F4VL 2R7FA 4R4IA 3OOCA 3FHWA 1A15A 4S3SA 4QL5A 3GTGH 3BYTB 4DK3C 2SEBD 1MHWC 3OWFA 3J81L 3I4NB 4A3GG 2HDLA 2VQFL 4A3DB 1SNOA 1QB5D 5EKKA 3GTKB 1SMYC 2WAQE 4GN5A 4K5WA 2NVQH 4X62Q 3NTIA 4XDXA
chains in the Genus database with same CATH topology
1G291 1HZ9A 2Q2UA 4A3DG 1PVOA 1LM0A 4TQUS 4GLAC 3F2BA 2ZJRA 2YU9H 2F3IA 4LF4Q 2PI2A 3CPWA 4DV6Q 3HOVH 1KIXA 1U0LA 4A3FH 4MZ9A 2I5MX 4IFDG 3H0GG 4QQBX 1VQOA 4OWXB 1WJJA 1PHJA 4DR4Q 4HJ5A 2NVTH 2Z6KA 1B7YB 2ALYB 2NVXH 1X54A 1S40A 3S17H 4GKKQ 3NEMA 4PMWA 2RHQB 1P8LA 2F4VQ 3FKIH 1WCMH 2EQSA 2MO0A 3UDXA 4YY3L 2PI2E 2QA4A 2R93G 5C0XJ 1VQ4A 1XNRQ 5GADC 3CCVA 1A63A 2A19A 2Q2IA 1IZ6A 1HZAA 5GAEC 1OXTA 3CMAA 2KBNA 1SFOH 1TWFH 3HOXH 2VQFQ 4GN3B 2K5HA 4GLXA 1K0RA 1X55A 1KC8C 4DR7Q 1XJVA 4DUZQ 1K3RA 3CCUA 2JE6I 1HZBA 5IP7H 4WJ3M 2E2IH 4GKJQ 1HJPA 2MQHA 4JI4L 1CKOA 3EBEA 4IO9A 2VL6A 3PO2G 4JI5Q 2VW9A 1AE3A 2VS1A 3HOZH 2CCZA 3D31A 2D62A 3KDFA 4JBJA 4DKAC 2UUAL 1VQIA 1KRTA 4DNIA 1LTLA 3RNUA 1Q82C 2UUBL 4OX9L 1YVCA 1E24A 3U4VA 4UY8C 2PNHA 4KHZA 4KI0A 1PYBA 2JA7H 4FDBA 2ATWA 3STBD 2DUDA 3K7AH 1VQ8A 2IHEA 4BY1H 3D0FA 4LUVA 1E3PA 5IYBG 4DR6L 1B8AA 1E7ZA 4UP8A 1X9NA 1QUQB 3OW2A 4A76A 1HR0L 5IT9c 4R4QA 4NXNL 1VQGA 4YY3Q 1M90C 4APVA 5FLMG 3Q8DA 2UU9L 1Y1WH 2OWOA 5IYCG 5JJKA 1YHBA 2VUMG 3RN5A 4JCVE 4LNQA 1VS0A 2E2JH 1SMXA 4B3SL 4HJAA 1VQDA 1K83H 3RLOA 1U5KA 1TXYA 3GTLH 4R1JA 1YITA 3HOVG 3J81i 1VQ5A 2UUCQ 4DR1L 3S24A 1VQ7A 2ES2A 4DV5L 4A3FG 5FLXc 4JI4Q 2K14A 4JG2A 1N33Q 3PUZA 4DR3L 3GD7A 1J6QA 1L0WA 3I2ZA 5M5XH 4GOPC 2UUAQ 3UDGA 4A3BH 2R7ZH 3VDYA 2JJQA 4AQYL 2N49A 1QVFA 3NBHB 5IWAQ 1NTGA 1J5EL 3FKIG 1WCMG 2Q2TA 2UUBQ 4OX9Q 3GTPH 1HNWL 4DV0Q 1SRUA 2MO1A 4GS3A 4P74A 3NELA 3TS2A 5M3MH 2D0OA 4GN4B 4BA1I 1JJGA 4DR6Q 2VNUD 3MEFA 1ASZA 3M3YH 1HR0Q 3HOXG 4NXNQ 3F8TA 4XTCS 4A3IH 4LF7L 4OO1G 3ULLA 2UU9Q 1T9HA 5IP7G 1LUZA 4TVAB 5IE8A 1FJGL 2Y0SE 4P71A 1I5FA 4A3MH 1JB7A 3OYYA 4B3SQ 4BBSH 2R7DA 1JJ2A 3HOZG 2KENA 1W3SA 4LUZA 2UXBL 4QIWE 1YBYA 1BVSA 2AMCB 4DR1Q 2HIVA 4AIMA 4DV5Q 1TWHH 2K50A 2H5XA 3KDFB 3HOUH 4DV7L 1HH2P 5BR8L 4DR3Q 1VQMA 1N36L 2NVYH 1M1KC 2JA7G 3M7NA 3CC4A 4BY1G 3WWVA 1CKMA 2L15A 4AQYQ 3NENA 1KD1C 4DR2Q 1W2BA 2C35B 2K4KA 1J5EQ 1HNWQ 4JOIC 3K81C 1PH3A 4WJ4A 3PF4A 5C4JH 3OTOL 5LMNL 3CCSA 1Y1WG 1X65A 1QZHA 3PO3H 4K0KL 1Q1EA 1PH1A 2XTIA 4DV3L 3M4PA 4A3KH 4LWCA 1XNQL 4NPSA 4J15A 4IPDA 2I5HA 4LF7Q 3GTQH 1GD7A 2V1CC 1VQ6A 3KOJA 1JJCB 3J7ZC 1O7IA 3U4ZA 4C3JH 1FJGQ 3RZDH 1V1QA 2AHOB 1UE1A 3T1HL 1GKHA 2UXBQ 3F2CA 1FL0A 1VCIA 4JV5L 2JA8H 4DPGA 4Y7NH 4MTNA 1X6OA 4GNXC 1CSQA 2R7ZG 4A3BG 3PGZA 4LF8L 4YWLA 3GO5A 4C3HH 5BR8Q 1N36Q 1CSPA 2FXQA 4POGA 1JMCA 4YCUA 4X65L 4X6AH 2K52A 5M3MG 1OXSC 3CW2C 4YHHL 5M3FH 3IRBA 4LF6Q 2IX0A 4IJLA 4MNOA 1YI2A 1K73C 4LFBL 4A3IG 2Y0SG 1NJIC 3OTOQ 1TWGH 5IYCH 5LMNQ 3GDEA 3CXCA 1WYDA 1SROA 4K0KQ 4A3MG 2ID0A 4DV3Q 1JE5A 1VQEA 1H95A 4BBSG 4JOIA 3CMEA 3RLNA 2B29A 4P73A 4DV4L 1PA6A 1XNQQ 2OQ0A 3E0EA 4A75A 2KCMA 4LFCQ 3PUVA 4A3EH 1PH9A 3DM3A 3T1YL 1E22A 5IY0A 4LF9L 4IPGA 3HOUG 2HIXA 3T1HQ 4BXXH 1IBKL 1Q1BA 4JV5Q 4YWKA 2LXKA 2GVAA 1YEZA 3CC7A 1BBWA 4LF8Q 2VZAA 1GVPA 3A5UA 4JBKA 2K75A 2D0PA 3ERSX 5C0XG 1EFWA 4X65Q 4GNXA 3PO3G 4GKJL 2JEBI 3UE1A 2I0QA 4IOAA 4A3KG 1I6HH 3AYHB 4R4OA 2BH2A 4Y52H 3EN2A 4AH6A 2IT1A 4LFBQ 2K5VA 2CFMA 2WP8J 1RIPA 3JAMc 3E9HA 2YTYA 1FVIA 2WAQG 2E5LL 1PH4A 2UXDL 1IBMQ 1V9PA 3M85A 2VY3A 3J81j 1XMOL 1VQ9A 1PYSB 3F1ZA 1XMQL 3S14H 4HIDA 3AFQA 5LMNW 4DV4Q 4R4TA 4QGUA 1IL2A 3PUXA 2K5NA 1IXRA 2JA8G 1CKNA 3CPFA 5C44H 3RN2A 1VQLA 1HNXL 2OQKA 3J80c 1MKHA 2HHHL 2BH8A 2A8VA 1EIFA 5GROA 3T1YQ 4LF9Q 2R6GA 3S1QH 4BY7H 4DAYB 4A3LH 5ELOA 4NB3A 3U58A 3KF8B 5IP9H 1YJ9A 3GTOH 1CUKA 4PZ8A 4A4IA 2Z0SA 1UWVA 5M3FG 4B3TL 3S15H 4UP7A 4BBRH 4JC0A 3ER0A 1DGSA 3CD6A 3CF5A 3FP9A 3RR5A 4EX5A 3I7FA 1KHIA 2PMZE 3HOYH 2NN6I 3ULPA 2JA6H 1WFQA 3S1RH 1VQJA 3TEHB 3I4OA 1N8RC 3ZJYC 4C2MH 2OCEA 2AKWB 4JI1L 2E5LQ 2UXDQ 1I94L 1XMOQ 1VQCA 1UEBA 2B3GA 1BBUA 3A74A 4A3EG 1XMQQ 1UE6A 3CCRA 3PSIA 2PQAA 1V43A 1Q12A 2YYZA 3I4NH 4BXXG 3ICEA 1G6PA 2RCNA 1Q86C 3GTKH 1I3QH 1KAWA 4JI2L 3ULJA 2AWOA 1XPOA 1HNXQ 1G51A 1KL9A 1IYJB 3UDIA 4POFA 5C3EH 2OTLA 3S2HH 3S16H 1EOVA 3UDFA 3I55A 3AEVA 2Q2HA 4HIKA 1NMGA 2LSSA 2CWAA 2LXJA 4PG3A 1MIUA 1K8AC 4OWWB 3H3VI 1WOCA 5JEAJ 1Z47A 3RZOH 2KHJA 1SR3A 3UE0A 2YTXA 4C3IH 2ZTCA 4GNXB 4P75A 2B63H 4L5QA 1GM5A 2GN5A 1IBLL 1YHQA 5J3BA 5LMUL 4GOPA 1NY4A 1R9TH 4LFAL 2MNAA 4HJ9A 3M9BA 1Y1VH 2N3SA 1GO3E 4LW1A 3KJOA 2ASBA 2CKZB 4JI1Q 5C44G 1K8GA 1NMFA 1I94Q 4HIMA 3A0JA 1PFSA 1UE5A 2Z6KC 4R4CA 4BY7G 4A3LG 4NXML 1CKNB 1C0AA 4IPCA 4A3CH 3SGIA 5IP9G 4JI2Q 4YWMA 1PH7A 3A5ZB 3PUWA 2OTJA 1S72A 3KF6A 5AJ3L 4BBRG 5M5WH 3K8AA 2R92H 2BA0A 3K80C 5HGQA 2IHFA 2UXCL 3M4QA 4A93H 4DV7Q 1L1OC 3CCJA 3HOYG 1XPUA 2EIFA 3HKSA 2YTVA 2ZTDA 3G4SA 1A8VA 2JA6G 1BKBA 1TWCH 5GAGC 2KCTA 1VQBA 1IBLQ 4RG1A 5LMUQ 3CAMA 4DUZL 4JI0L 2JK8A 3PIPA 3PIOA 4LFAQ 1N32L 5DLQE 1MJCA 1YZ6A 3KLWA 3MXNB 4KLKA 3I4NG 1YJNA 5GQOA 3L0OA 4JI5L 2IX1A 3J7A5 1YHAA 1A0IA 3KJPA 5C3EG 4HJ7A 2PQAB 4HJ8A 3S2DH 1TWAH 4ME3A 4H02A 4JBMA 4NXMQ 2JQOA 1Q7YC 1NE3A 2VQEL 3JAMi 4YCVA 4DV2L 2XGTA 1EIYB 1E1OA 2RF4A 2NZHA 5EAYA 5AJ3Q 1SLJA 4DK6C 2JA5H 3S1NH 1QVCA 4EQ5A 2B63G 1SE8A 5C4XH 3L2PA 2UXCQ 2WFWA 3CC2A 4OO1I 3JC66 3KFUA 1Y14B 4DR5L 3PUYA 4A3JH 3J80i 1QZGA 4JI7L 1QVGA 3CQZH 4YHHQ 2F52A 2BA1A 1Y1VG 1VQKA 3HKZE 4GOPB 1YJWA 4B3RL 1VQPA 4JI8L 1L1OA 1UE7A 1OTCA 3CP0A 1X3FA 2ZM6L 5E7NA 3K0XA 4JI0Q 4KHPL 2UUCL 1JT8A 4IOCA 1N32Q 1PH2A 2N8NA 3W1BA 3B6YA 4LF5L 4O0AA 1N33L 4A3CG 3CCQA 1C9OA 2E2HH 3L7ZC 3I4MH 2R92G 3AQQA 4UP9A 4JI3L 2I5LX 3PCOB 1PH8A 5IWAL 2IY5B 3G48A 4A93G 2VQEQ 2EXDA 4DV2Q 1B70B 3F2DA 4DV0L 3KF6B 2WB1E 1IBKQ 1Q46A 3G71A 1ASYA 1D7QA 3BU2A 3GTJH 5IYDH 3BJUA 4JI6L 3GTMH 3HOWH 3K7UC 3G6EA 2GVBA 5FJ8H 1MJEA 4DR5Q 3CCLA 4JI7Q 4DUYL 1X56A 1EQRA 1N9WA 4IJHA 4AYBE 4B3RQ 1KRSA 4JI8Q 3TS0A 1OXXK 4OXPA 2ZM6Q 4A3GH 4KHPQ 4JYAL 1FGUA 1I50H 4P72A 4DAMA 2ZJPA 1HNZL 2HQLA 2ZJQA 1X3GA 3W5OA 4B3ML 1WI5A 4LF5Q 2NZOA 3U50C 1VQNA 5GAHC 5JJIA 4L5RC 4IFDI 4A3DH 4QJFA 3I56A 1X3EA 1XTDA 3H15A 1N34L 4DV1L 1PH6A 2JA5G 5K36G 4JI3Q 4QY7A 2HT1A 2HHHQ 4GLVB 4DR2L 5C4XG 4L5TA 3BZCA 1Q81C 4X64L 2JA9A 3H0GH 4A3JG 1XPRA 3HKZG 3J81c 3CCMA 4JI6Q 4B3TQ 1YNXA 3M4OH 2CQOA 3STBC 2ZTEA 4OWTB 1KQSA 1KXLA 5JJLA 1LYLA 4PZ6A 1E1TA 4BA2I 1AH9A 2R93H 3TQYA 3PF5A 4DUYQ 3H3VH 1EUJA 5ELNA 1L1OB 1EWIA 4X66L 3RLFA 4X62L 1IBML 1L2FA 5M5YH 2RHSB 1Q8KA 4IPHA 3I4MG 4LUOA 2A1AA 3DLLA 2DGYA 1A62A 3KYHC 3PV0A 1HNZQ 3CCEA 4LF4L 2AWNA 4DV6L 4JYAQ 5H1SE 4UPAA 2WB1G 3HFZB 1YIJA 4B3MQ 1SN8A 1EQQA 5C0XI 4OONA 1N34Q 3PO2H 5JEAG 4RMFA 1D8LA 1OXUA 5IYDG 4DV1Q 1VQHA 2MFIA 2QGQA 4DR4L 2YV5A 4HIOA 4LF6L 3BZKA 3HOWG 5HY6A 2QEXA 4GKKL 3TREA 1RL2A 4X64Q 5FJ8G 3W1GA 1C7YA 1EYGA 1NBWA 1PV4A 1Z9FA 2F4VL 3AFPA 2JEAI 4XIGS 2KHIA 1P16A 2R7FA 1QUQA 4R4IA 1S3OA 3FHWA 2N78A 4AYBG 1XNRL 4IFDJ 4ALPA 4QL5A 3GTGH 4L5SA 1VQAA 3TRZA 1K9MC 1VQFA 3LGJA 4DK3C 5IYBH 4PZ7A 4YCWA 3EIVA 4A3GG 1HZCA 4LFCL 2E8GA 2VQFL 1HR0W 4DR7L 3S1MH 5FLMH 1PH5A 2NN6G 2WAQE 4GN5A 3E9IA 4X66Q 4X62Q 1AE2A 2NVQH 2CWPA 4O2DA 4JBWA 1OXVA 2VUMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G29 1;  1HZ9 A;  2Q2U A;  4A3D G;  1PVO A;  1LM0 A;  4TQU S;  4GLA C;  3F2B A;  2ZJR A;  2YU9 H;  2F3I A;  4LF4 Q;  2PI2 A;  3CPW A;  4DV6 Q;  3HOV H;  1KIX A;  1U0L A;  4A3F H;  4MZ9 A;  2I5M X;  4IFD G;  3H0G G;  4QQB X;  1VQO A;  4OWX B;  1WJJ A;  1PHJ A;  4DR4 Q;  4HJ5 A;  2NVT H;  2Z6K A;  1B7Y B;  2ALY B;  2NVX H;  1X54 A;  1S40 A;  3S17 H;  4GKK Q;  3NEM A;  4PMW A;  2RHQ B;  1P8L A;  2F4V Q;  3FKI H;  1WCM H;  2EQS A;  2MO0 A;  3UDX A;  4YY3 L;  2PI2 E;  2QA4 A;  2R93 G;  5C0X J;  1VQ4 A;  1XNR Q;  5GAD C;  3CCV A;  1A63 A;  2A19 A;  2Q2I A;  1IZ6 A;  1HZA A;  5GAE C;  1OXT A;  3CMA A;  2KBN A;  1SFO H;  1TWF H;  3HOX H;  2VQF Q;  4GN3 B;  2K5H A;  4GLX A;  1K0R A;  1X55 A;  1KC8 C;  4DR7 Q;  1XJV A;  4DUZ Q;  1K3R A;  3CCU A;  2JE6 I;  1HZB A;  5IP7 H;  4WJ3 M;  2E2I H;  4GKJ Q;  1HJP A;  2MQH A;  4JI4 L;  1CKO A;  3EBE A;  4IO9 A;  2VL6 A;  3PO2 G;  4JI5 Q;  2VW9 A;  1AE3 A;  2VS1 A;  3HOZ H;  2CCZ A;  3D31 A;  2D62 A;  3KDF A;  4JBJ A;  4DKA C;  2UUA L;  1VQI A;  1KRT A;  4DNI A;  1LTL A;  3RNU A;  1Q82 C;  2UUB L;  4OX9 L;  1YVC A;  1E24 A;  3U4V A;  4UY8 C;  2PNH A;  4KHZ A;  4KI0 A;  1PYB A;  2JA7 H;  4FDB A;  2ATW A;  3STB D;  2DUD A;  3K7A H;  1VQ8 A;  2IHE A;  4BY1 H;  3D0F A;  4LUV A;  1E3P A;  5IYB G;  4DR6 L;  1B8A A;  1E7Z A;  4UP8 A;  1X9N A;  1QUQ B;  3OW2 A;  4A76 A;  1HR0 L;  5IT9 c;  4R4Q A;  4NXN L;  1VQG A;  4YY3 Q;  1M90 C;  4APV A;  5FLM G;  3Q8D A;  2UU9 L;  1Y1W H;  2OWO A;  5IYC G;  5JJK A;  1YHB A;  2VUM G;  3RN5 A;  4JCV E;  4LNQ A;  1VS0 A;  2E2J H;  1SMX A;  4B3S L;  4HJA A;  1VQD A;  1K83 H;  3RLO A;  1U5K A;  1TXY A;  3GTL H;  4R1J A;  1YIT A;  3HOV G;  3J81 i;  1VQ5 A;  2UUC Q;  4DR1 L;  3S24 A;  1VQ7 A;  2ES2 A;  4DV5 L;  4A3F G;  5FLX c;  4JI4 Q;  2K14 A;  4JG2 A;  1N33 Q;  3PUZ A;  4DR3 L;  3GD7 A;  1J6Q A;  1L0W A;  3I2Z A;  5M5X H;  4GOP C;  2UUA Q;  3UDG A;  4A3B H;  2R7Z H;  3VDY A;  2JJQ A;  4AQY L;  2N49 A;  1QVF A;  3NBH B;  5IWA Q;  1NTG A;  1J5E L;  3FKI G;  1WCM G;  2Q2T A;  2UUB Q;  4OX9 Q;  3GTP H;  1HNW L;  4DV0 Q;  1SRU A;  2MO1 A;  4GS3 A;  4P74 A;  3NEL A;  3TS2 A;  5M3M H;  2D0O A;  4GN4 B;  4BA1 I;  1JJG A;  4DR6 Q;  2VNU D;  3MEF A;  1ASZ A;  3M3Y H;  1HR0 Q;  3HOX G;  4NXN Q;  3F8T A;  4XTC S;  4A3I H;  4LF7 L;  4OO1 G;  3ULL A;  2UU9 Q;  1T9H A;  5IP7 G;  1LUZ A;  4TVA B;  5IE8 A;  1FJG L;  2Y0S E;  4P71 A;  1I5F A;  4A3M H;  1JB7 A;  3OYY A;  4B3S Q;  4BBS H;  2R7D A;  1JJ2 A;  3HOZ G;  2KEN A;  1W3S A;  4LUZ A;  2UXB L;  4QIW E;  1YBY A;  1BVS A;  2AMC B;  4DR1 Q;  2HIV A;  4AIM A;  4DV5 Q;  1TWH H;  2K50 A;  2H5X A;  3KDF B;  3HOU H;  4DV7 L;  1HH2 P;  5BR8 L;  4DR3 Q;  1VQM A;  1N36 L;  2NVY H;  1M1K C;  2JA7 G;  3M7N A;  3CC4 A;  4BY1 G;  3WWV A;  1CKM A;  2L15 A;  4AQY Q;  3NEN A;  1KD1 C;  4DR2 Q;  1W2B A;  2C35 B;  2K4K A;  1J5E Q;  1HNW Q;  4JOI C;  3K81 C;  1PH3 A;  4WJ4 A;  3PF4 A;  5C4J H;  3OTO L;  5LMN L;  3CCS A;  1Y1W G;  1X65 A;  1QZH A;  3PO3 H;  4K0K L;  1Q1E A;  1PH1 A;  2XTI A;  4DV3 L;  3M4P A;  4A3K H;  4LWC A;  1XNQ L;  4NPS A;  4J15 A;  4IPD A;  2I5H A;  4LF7 Q;  3GTQ H;  1GD7 A;  2V1C C;  1VQ6 A;  3KOJ A;  1JJC B;  3J7Z C;  1O7I A;  3U4Z A;  4C3J H;  1FJG Q;  3RZD H;  1V1Q A;  2AHO B;  1UE1 A;  3T1H L;  1GKH A;  2UXB Q;  3F2C A;  1FL0 A;  1VCI A;  4JV5 L;  2JA8 H;  4DPG A;  4Y7N H;  4MTN A;  1X6O A;  4GNX C;  1CSQ A;  2R7Z G;  4A3B G;  3PGZ A;  4LF8 L;  4YWL A;  3GO5 A;  4C3H H;  5BR8 Q;  1N36 Q;  1CSP A;  2FXQ A;  4POG A;  1JMC A;  4YCU A;  4X65 L;  4X6A H;  2K52 A;  5M3M G;  1OXS C;  3CW2 C;  4YHH L;  5M3F H;  3IRB A;  4LF6 Q;  2IX0 A;  4IJL A;  4MNO A;  1YI2 A;  1K73 C;  4LFB L;  4A3I G;  2Y0S G;  1NJI C;  3OTO Q;  1TWG H;  5IYC H;  5LMN Q;  3GDE A;  3CXC A;  1WYD A;  1SRO A;  4K0K Q;  4A3M G;  2ID0 A;  4DV3 Q;  1JE5 A;  1VQE A;  1H95 A;  4BBS G;  4JOI A;  3CME A;  3RLN A;  2B29 A;  4P73 A;  4DV4 L;  1PA6 A;  1XNQ Q;  2OQ0 A;  3E0E A;  4A75 A;  2KCM A;  4LFC Q;  3PUV A;  4A3E H;  1PH9 A;  3DM3 A;  3T1Y L;  1E22 A;  5IY0 A;  4LF9 L;  4IPG A;  3HOU G;  2HIX A;  3T1H Q;  4BXX H;  1IBK L;  1Q1B A;  4JV5 Q;  4YWK A;  2LXK A;  2GVA A;  1YEZ A;  3CC7 A;  1BBW A;  4LF8 Q;  2VZA A;  1GVP A;  3A5U A;  4JBK A;  2K75 A;  2D0P A;  3ERS X;  5C0X G;  1EFW A;  4X65 Q;  4GNX A;  3PO3 G;  4GKJ L;  2JEB I;  3UE1 A;  2I0Q A;  4IOA A;  4A3K G;  1I6H H;  3AYH B;  4R4O A;  2BH2 A;  4Y52 H;  3EN2 A;  4AH6 A;  2IT1 A;  4LFB Q;  2K5V A;  2CFM A;  2WP8 J;  1RIP A;  3JAM c;  3E9H A;  2YTY A;  1FVI A;  2WAQ G;  2E5L L;  1PH4 A;  2UXD L;  1IBM Q;  1V9P A;  3M85 A;  2VY3 A;  3J81 j;  1XMO L;  1VQ9 A;  1PYS B;  3F1Z A;  1XMQ L;  3S14 H;  4HID A;  3AFQ A;  5LMN W;  4DV4 Q;  4R4T A;  4QGU A;  1IL2 A;  3PUX A;  2K5N A;  1IXR A;  2JA8 G;  1CKN A;  3CPF A;  5C44 H;  3RN2 A;  1VQL A;  1HNX L;  2OQK A;  3J80 c;  1MKH A;  2HHH L;  2BH8 A;  2A8V A;  1EIF A;  5GRO A;  3T1Y Q;  4LF9 Q;  2R6G A;  3S1Q H;  4BY7 H;  4DAY B;  4A3L H;  5ELO A;  4NB3 A;  3U58 A;  3KF8 B;  5IP9 H;  1YJ9 A;  3GTO H;  1CUK A;  4PZ8 A;  4A4I A;  2Z0S A;  1UWV A;  5M3F G;  4B3T L;  3S15 H;  4UP7 A;  4BBR H;  4JC0 A;  3ER0 A;  1DGS A;  3CD6 A;  3CF5 A;  3FP9 A;  3RR5 A;  4EX5 A;  3I7F A;  1KHI A;  2PMZ E;  3HOY H;  2NN6 I;  3ULP A;  2JA6 H;  1WFQ A;  3S1R H;  1VQJ A;  3TEH B;  3I4O A;  1N8R C;  3ZJY C;  4C2M H;  2OCE A;  2AKW B;  4JI1 L;  2E5L Q;  2UXD Q;  1I94 L;  1XMO Q;  1VQC A;  1UEB A;  2B3G A;  1BBU A;  3A74 A;  4A3E G;  1XMQ Q;  1UE6 A;  3CCR A;  3PSI A;  2PQA A;  1V43 A;  1Q12 A;  2YYZ A;  3I4N H;  4BXX G;  3ICE A;  1G6P A;  2RCN A;  1Q86 C;  3GTK H;  1I3Q H;  1KAW A;  4JI2 L;  3ULJ A;  2AWO A;  1XPO A;  1HNX Q;  1G51 A;  1KL9 A;  1IYJ B;  3UDI A;  4POF A;  5C3E H;  2OTL A;  3S2H H;  3S16 H;  1EOV A;  3UDF A;  3I55 A;  3AEV A;  2Q2H A;  4HIK A;  1NMG A;  2LSS A;  2CWA A;  2LXJ A;  4PG3 A;  1MIU A;  1K8A C;  4OWW B;  3H3V I;  1WOC A;  5JEA J;  1Z47 A;  3RZO H;  2KHJ A;  1SR3 A;  3UE0 A;  2YTX A;  4C3I H;  2ZTC A;  4GNX B;  4P75 A;  2B63 H;  4L5Q A;  1GM5 A;  2GN5 A;  1IBL L;  1YHQ A;  5J3B A;  5LMU L;  4GOP A;  1NY4 A;  1R9T H;  4LFA L;  2MNA A;  4HJ9 A;  3M9B A;  1Y1V H;  2N3S A;  1GO3 E;  4LW1 A;  3KJO A;  2ASB A;  2CKZ B;  4JI1 Q;  5C44 G;  1K8G A;  1NMF A;  1I94 Q;  4HIM A;  3A0J A;  1PFS A;  1UE5 A;  2Z6K C;  4R4C A;  4BY7 G;  4A3L G;  4NXM L;  1CKN B;  1C0A A;  4IPC A;  4A3C H;  3SGI A;  5IP9 G;  4JI2 Q;  4YWM A;  1PH7 A;  3A5Z B;  3PUW A;  2OTJ A;  1S72 A;  3KF6 A;  5AJ3 L;  4BBR G;  5M5W H;  3K8A A;  2R92 H;  2BA0 A;  3K80 C;  5HGQ A;  2IHF A;  2UXC L;  3M4Q A;  4A93 H;  4DV7 Q;  1L1O C;  3CCJ A;  3HOY G;  1XPU A;  2EIF A;  3HKS A;  2YTV A;  2ZTD A;  3G4S A;  1A8V A;  2JA6 G;  1BKB A;  1TWC H;  5GAG C;  2KCT A;  1VQB A;  1IBL Q;  4RG1 A;  5LMU Q;  3CAM A;  4DUZ L;  4JI0 L;  2JK8 A;  3PIP A;  3PIO A;  4LFA Q;  1N32 L;  5DLQ E;  1MJC A;  1YZ6 A;  3KLW A;  3MXN B;  4KLK A;  3I4N G;  1YJN A;  5GQO A;  3L0O A;  4JI5 L;  2IX1 A;  3J7A 5;  1YHA A;  1A0I A;  3KJP A;  5C3E G;  4HJ7 A;  2PQA B;  4HJ8 A;  3S2D H;  1TWA H;  4ME3 A;  4H02 A;  4JBM A;  4NXM Q;  2JQO A;  1Q7Y C;  1NE3 A;  2VQE L;  3JAM i;  4YCV A;  4DV2 L;  2XGT A;  1EIY B;  1E1O A;  2RF4 A;  2NZH A;  5EAY A;  5AJ3 Q;  1SLJ A;  4DK6 C;  2JA5 H;  3S1N H;  1QVC A;  4EQ5 A;  2B63 G;  1SE8 A;  5C4X H;  3L2P A;  2UXC Q;  2WFW A;  3CC2 A;  4OO1 I;  3JC6 6;  3KFU A;  1Y14 B;  4DR5 L;  3PUY A;  4A3J H;  3J80 i;  1QZG A;  4JI7 L;  1QVG A;  3CQZ H;  4YHH Q;  2F52 A;  2BA1 A;  1Y1V G;  1VQK A;  3HKZ E;  4GOP B;  1YJW A;  4B3R L;  1VQP A;  4JI8 L;  1L1O A;  1UE7 A;  1OTC A;  3CP0 A;  1X3F A;  2ZM6 L;  5E7N A;  3K0X A;  4JI0 Q;  4KHP L;  2UUC L;  1JT8 A;  4IOC A;  1N32 Q;  1PH2 A;  2N8N A;  3W1B A;  3B6Y A;  4LF5 L;  4O0A A;  1N33 L;  4A3C G;  3CCQ A;  1C9O A;  2E2H H;  3L7Z C;  3I4M H;  2R92 G;  3AQQ A;  4UP9 A;  4JI3 L;  2I5L X;  3PCO B;  1PH8 A;  5IWA L;  2IY5 B;  3G48 A;  4A93 G;  2VQE Q;  2EXD A;  4DV2 Q;  1B70 B;  3F2D A;  4DV0 L;  3KF6 B;  2WB1 E;  1IBK Q;  1Q46 A;  3G71 A;  1ASY A;  1D7Q A;  3BU2 A;  3GTJ H;  5IYD H;  3BJU A;  4JI6 L;  3GTM H;  3HOW H;  3K7U C;  3G6E A;  2GVB A;  5FJ8 H;  1MJE A;  4DR5 Q;  3CCL A;  4JI7 Q;  4DUY L;  1X56 A;  1EQR A;  1N9W A;  4IJH A;  4AYB E;  4B3R Q;  1KRS A;  4JI8 Q;  3TS0 A;  1OXX K;  4OXP A;  2ZM6 Q;  4A3G H;  4KHP Q;  4JYA L;  1FGU A;  1I50 H;  4P72 A;  4DAM A;  2ZJP A;  1HNZ L;  2HQL A;  2ZJQ A;  1X3G A;  3W5O A;  4B3M L;  1WI5 A;  4LF5 Q;  2NZO A;  3U50 C;  1VQN A;  5GAH C;  5JJI A;  4L5R C;  4IFD I;  4A3D H;  4QJF A;  3I56 A;  1X3E A;  1XTD A;  3H15 A;  1N34 L;  4DV1 L;  1PH6 A;  2JA5 G;  5K36 G;  4JI3 Q;  4QY7 A;  2HT1 A;  2HHH Q;  4GLV B;  4DR2 L;  5C4X G;  4L5T A;  3BZC A;  1Q81 C;  4X64 L;  2JA9 A;  3H0G H;  4A3J G;  1XPR A;  3HKZ G;  3J81 c;  3CCM A;  4JI6 Q;  4B3T Q;  1YNX A;  3M4O H;  2CQO A;  3STB C;  2ZTE A;  4OWT B;  1KQS A;  1KXL A;  5JJL A;  1LYL A;  4PZ6 A;  1E1T A;  4BA2 I;  1AH9 A;  2R93 H;  3TQY A;  3PF5 A;  4DUY Q;  3H3V H;  1EUJ A;  5ELN A;  1L1O B;  1EWI A;  4X66 L;  3RLF A;  4X62 L;  1IBM L;  1L2F A;  5M5Y H;  2RHS B;  1Q8K A;  4IPH A;  3I4M G;  4LUO A;  2A1A A;  3DLL A;  2DGY A;  1A62 A;  3KYH C;  3PV0 A;  1HNZ Q;  3CCE A;  4LF4 L;  2AWN A;  4DV6 L;  4JYA Q;  5H1S E;  4UPA A;  2WB1 G;  3HFZ B;  1YIJ A;  4B3M Q;  1SN8 A;  1EQQ A;  5C0X I;  4OON A;  1N34 Q;  3PO2 H;  5JEA G;  4RMF A;  1D8L A;  1OXU A;  5IYD G;  4DV1 Q;  1VQH A;  2MFI A;  2QGQ A;  4DR4 L;  2YV5 A;  4HIO A;  4LF6 L;  3BZK A;  3HOW G;  5HY6 A;  2QEX A;  4GKK L;  3TRE A;  1RL2 A;  4X64 Q;  5FJ8 G;  3W1G A;  1C7Y A;  1EYG A;  1NBW A;  1PV4 A;  1Z9F A;  2F4V L;  3AFP A;  2JEA I;  4XIG S;  2KHI A;  1P16 A;  2R7F A;  1QUQ A;  4R4I A;  1S3O A;  3FHW A;  2N78 A;  4AYB G;  1XNR L;  4IFD J;  4ALP A;  4QL5 A;  3GTG H;  4L5S A;  1VQA A;  3TRZ A;  1K9M C;  1VQF A;  3LGJ A;  4DK3 C;  5IYB H;  4PZ7 A;  4YCW A;  3EIV A;  4A3G G;  1HZC A;  4LFC L;  2E8G A;  2VQF L;  1HR0 W;  4DR7 L;  3S1M H;  5FLM H;  1PH5 A;  2NN6 G;  2WAQ E;  4GN5 A;  3E9I A;  4X66 Q;  4X62 Q;  1AE2 A;  2NVQ H;  2CWP A;  4O2D A;  4JBW A;  1OXV A;  2VUM H; 
#chains in the Genus database with same CATH topology
 2Q8R E;  2Q2U A;  1NR4 A;  5D65 A;  2F0M A;  5JJZ A;  4LJZ C;  2F3I A;  4LF4 Q;  2PI2 A;  4FF3 A;  1U0L A;  5KEE A;  2I5M X;  3RZO B;  4XT3 B;  4OWX B;  2B63 B;  3NBH A;  3GQB A;  1B7Y B;  3MFY A;  1DM0 B;  2M2L A;  1S40 A;  5EKL A;  3IFT A;  4BWG B;  1X32 A;  2MO0 A;  2PW7 A;  2AQ3 B;  1VQ4 A;  3FPP A;  1A63 A;  2MGS A;  3CCV A;  4FYD A;  2A19 A;  1ESF A;  1OXT A;  2F0T A;  4XYQ A;  1PTO D;  1SFO H;  4XT1 B;  3A8J E;  1G2S A;  2K5H A;  1DZ1 A;  4DR7 Q;  2DNE A;  3ND8 A;  1K3R A;  1SYB A;  1HZB A;  4NDX A;  4JI4 L;  3EBE A;  4ZYS A;  1SEB D;  3PO2 G;  1AE3 A;  3KDF A;  4JBJ A;  2ENB A;  4DNI A;  4KY5 A;  3GTG B;  2VXW A;  4KI0 A;  4ZKB B;  2L0C A;  1EY8 A;  2ATW A;  5IIF A;  1LO5 D;  1XTC D;  3K7A H;  1VQ8 A;  1E3P A;  4H7B A;  4A76 A;  1CT1 D;  4R4Q A;  4NXN L;  1VQG A;  4L6T B;  3Q8D A;  3N52 A;  2UU9 L;  1Y1W H;  2OWO A;  1O7Y A;  2VUM G;  3KLS A;  4JCV E;  1VS0 A;  4R1J A;  3WOF A;  3HOV G;  1VQ5 A;  4DR1 L;  1VQ7 A;  2WAC A;  4N9T A;  2O2L D;  1L0W A;  5M5X H;  2UUA Q;  2MHV A;  1DON A;  1QVF A;  3CQZ B;  2G5D A;  1FGB D;  1SYF A;  2UUB Q;  4OX9 Q;  2Q2T A;  1WCM G;  3GTP H;  4IUT A;  2FFK B;  2MO1 A;  1JJG A;  2RBM A;  4DR6 Q;  5DEH A;  2RVL A;  1HR0 Q;  4A3I H;  2E2H B;  5IP7 G;  1FJG L;  2Y0S E;  3I4M B;  4KJO A;  2FMM A;  3T53 B;  1YBY A;  2X69 A;  1CI3 M;  1LT4 D;  2M9V A;  4ILW A;  2B2W C;  3HOW B;  5BR8 L;  2JA7 G;  2NVY H;  3TSS A;  2G9D A;  1WTH A;  1H9M A;  1ET6 A;  1Y1W B;  2L15 A;  4AQY Q;  3NEN A;  1KD1 C;  3J80 E;  4JOI C;  2PNR C;  5C4J H;  2RSN A;  1X65 A;  4DN4 M;  1L0X B;  1I50 B;  2ICE C;  2I5H A;  1GD7 A;  1TS4 A;  2V1C C;  4B9X A;  3A7A B;  3U4Z A;  1V1Q A;  1UE1 A;  1CTM A;  1RD9 D;  1FL0 A;  2EYO A;  2JA8 H;  3GTP B;  4GNX C;  3PGZ A;  4FF1 A;  3QJY A;  1N36 Q;  2B2V A;  3HG9 A;  1B3Q A;  3R8B A;  4A3I B;  1D2B A;  4X6A H;  5M3M G;  5J1Z A;  1OXS C;  4YHH L;  3IRB A;  4LF6 Q;  4G4K A;  1EYA A;  3ZYY X;  5DM7 3;  4MNO A;  4UDU C;  2JP1 A;  3T51 B;  1HTL D;  1NJI C;  5LMN Q;  3GDE A;  3VR6 A;  4DV3 Q;  1H95 A;  1JE5 A;  4IUQ A;  3MTS A;  2B29 A;  3MXP A;  3P1H A;  2TMP A;  2KCM A;  2D9U A;  1PYW D;  2NVY B;  4KN7 C;  3EQL C;  2TSS A;  5IY0 A;  1GHJ A;  1BXT A;  3NUC A;  3NXW A;  1G8Z D;  1AW7 A;  2LXK A;  2E74 C;  5EPK A;  2GVA A;  3NSW A;  3OPO A;  2Q8I B;  3Q22 A;  1ET9 A;  2F0Q A;  2SNS A;  3TME A;  4ZKC B;  1SE2 A;  1PTO B;  3ERS X;  1GUG A;  1SDF A;  1JCK B;  3PO3 G;  2WAQ B;  2I0Q A;  2A69 C;  3AYH B;  2BH2 A;  1B9N A;  2CHB D;  3UI2 A;  2K5V A;  2WP8 J;  3T16 A;  2BDN A;  1ILP A;  4ZCK A;  2QDB A;  1VQ9 A;  3NBI A;  4HID A;  5LMN W;  4QGU A;  2PYK A;  4A3F B;  3K0Y A;  4ZRZ A;  2K03 A;  2D5D A;  1STN A;  3K6O A;  1HNX L;  4GZY C;  2HHH L;  2BH8 A;  1EIF A;  3S1Q H;  3VYU A;  4C3H G;  4KKS A;  3KF8 B;  5IP9 H;  1UWV A;  1LTG D;  4B3T L;  3S15 H;  4UP7 A;  4BBR H;  2A6H C;  1SNM A;  3FP9 A;  3U9S A;  4RHR A;  4PMC A;  2PMZ E;  3HOY H;  5ELD A;  2A5H A;  4C1N I;  3I4L A;  1PRT F;  3WDN A;  1TVX A;  2OF1 A;  3TEH B;  3E5S A;  5I2X A;  5KRU A;  3HOZ B;  3A74 A;  1BBU A;  4H0L C;  1UE6 A;  2YYZ A;  2L1B A;  1CZW A;  1G6P A;  1I3Q H;  1G51 A;  1KL9 A;  2OTL A;  1JOR A;  4R8N A;  1NMG A;  4J8Q A;  2LSS A;  1PXU A;  3W3A A;  4KD4 A;  1G91 A;  1K8A C;  1O78 A;  3H3V I;  4L8J A;  2KHJ A;  3R2I A;  1SNP A;  2ZTC A;  4GNX B;  3PIP 3;  5EPJ A;  3PIO 3;  1GM5 A;  2GN5 A;  1AN8 A;  5LHY 1;  1IBL L;  1KDA A;  5CV9 A;  5LMU L;  5CR3 A;  1NY4 A;  2MNA A;  2QF7 A;  3K5O A;  4OHJ A;  3S1Q B;  3KJO A;  1Q8I A;  4HED A;  1I94 Q;  2WIN B;  1Q3L A;  4R4C A;  2OEO A;  4BBR B;  2R7Z B;  3BVG A;  4A3C H;  1SJE D;  1PH7 A;  4UHV A;  4DAV A;  1HFG A;  3PUW A;  4OIJ A;  3KF6 A;  2R92 H;  4ODG A;  1HHV A;  3K8A A;  1BO0 A;  1E2W A;  3K80 C;  2B2U A;  1JE4 A;  4F87 A;  2UXC L;  4DFA A;  5CMD A;  5ELC A;  1L1O C;  3VR5 A;  4HMI A;  2JA6 G;  2ZTD A;  3G4S A;  2LY7 A;  3SK4 A;  2IJ0 A;  2Y0S B;  1HUN A;  4MHE A;  1A3V A;  2CW0 C;  1A3T A;  1V1O A;  4RG1 A;  4JI0 L;  4LAA A;  1I3Q B;  1E2Z A;  1RJT A;  1U4L A;  1N32 L;  5DLQ E;  1YZ6 A;  3KLW A;  1S5F D;  3MXN B;  3I4N G;  5K5P A;  2K33 A;  2N88 A;  1TWH B;  1YHA A;  2EYP A;  1A0I A;  3KJP A;  1CFM A;  3MZ5 A;  5C3E G;  1I4G A;  1TWA H;  2XSC A;  2NZ1 D;  3VR2 A;  4PMB A;  1Q7Y C;  4DV2 L;  3JAM i;  1Z7T A;  2R3Z A;  3IL8 A;  2RF4 A;  5AJ3 Q;  1SLJ A;  3S1N H;  1QVC A;  2B63 G;  3L2P A;  4A3K B;  4OO1 I;  3JC6 6;  4A3J H;  1QZG A;  5EBD A;  2BA1 A;  2GA4 B;  1MSH A;  4GOP B;  4B3R L;  3P20 A;  2HCC A;  3K0X A;  3KUP A;  4ULL A;  1JT8 A;  4IOC A;  1Q90 A;  5KIX A;  4DK1 A;  4O0A A;  1N33 L;  3L7Z C;  4N8X 1;  4ID6 A;  4K6L A;  3W2D A;  5F2D A;  1S5D D;  3G48 A;  5M3F B;  1GUO A;  3F2D A;  3BG3 A;  3BU2 A;  1MGS A;  3GTJ H;  3FRP B;  1WTP A;  1TWG B;  5E3F A;  4JI6 L;  2Z1C A;  3G6E A;  1PRT D;  2GVB A;  4N9P A;  3K5N A;  3R2T A;  4JI7 Q;  1E2V A;  1G6Z A;  3A56 A;  1X56 A;  1DOK A;  1EQR A;  1N9W A;  1V8Q A;  3ERO A;  3OMG A;  4HSP A;  4IJH A;  4A3E B;  5IGD A;  2ZM6 Q;  4KHP Q;  2HUG A;  1HA6 A;  1RCV D;  2A6E D;  2NN6 H;  1X3G A;  1WI5 A;  2NZO A;  3HS0 C;  1HRJ A;  5JJI A;  3K57 A;  4L5R C;  4QJF A;  1X3E A;  5K36 G;  3MAQ A;  4K5V A;  4QY7 A;  4JI3 Q;  4GLV B;  3S9W A;  4DR2 L;  1CQV A;  4H13 C;  2KJX A;  2EYM A;  5E4X A;  1LV9 A;  4EVO A;  1AZQ A;  3H0G H;  1LTI D;  3Q6S A;  4XQQ A;  5KNB A;  4FXD A;  1YNX A;  4RWS C;  2ZTE A;  1E1T A;  1I4Q A;  4BA2 I;  2PZW A;  4OEM B;  4DUY Q;  1EUJ A;  1L1O B;  1EWI A;  1QOH A;  1RTN A;  1RF2 D;  2P5Z X;  4BY7 B;  2B2V C;  3I4M G;  3BZD B;  2DGY A;  1A62 A;  3PV0 A;  3GTJ B;  3EFX D;  1STE A;  5FO9 B;  4HN7 A;  5C0X I;  1N34 Q;  5FLX L;  1OXU A;  2PMZ B;  1JWM D;  4HIO A;  3BZK A;  1SNQ A;  3HOW G;  2RKS A;  1ZYR D;  4GKK L;  3VYR A;  1RL2 A;  3I72 A;  4X64 Q;  5FJ8 G;  3S1R B;  4XIG S;  1P16 A;  3QG1 A;  1QUQ A;  4IFD J;  4RKL A;  3LGJ A;  2K1B A;  1XXG A;  2E8G A;  1IW7 C;  4RGO S;  2CH4 A;  2KUM A;  1AE2 A;  4O2D A;  1C9O A;  1G29 1;  1HZ9 A;  3S16 B;  1RDP D;  1LM0 A;  4TQU S;  2YU9 H;  3H0G B;  3KF8 A;  2RCF A;  2XN9 C;  4FNF A;  3I90 A;  3I91 A;  2LFN A;  1VQO A;  4DR4 Q;  4HJ5 A;  2NVT H;  1STA A;  2ALY B;  2DNC A;  3NEM A;  4PMW A;  4IQZ A;  4RCN A;  3RMH A;  3FKI H;  3UDX A;  2F4V Q;  2DN8 A;  4YY3 L;  2R93 G;  2QA4 A;  2XVS A;  5GAD C;  2Q2I A;  2BE5 D;  1HZA A;  1ZEQ X;  3CMA A;  2KBN A;  4PV1 C;  2F0G A;  3HOX H;  2VQF Q;  4GLX A;  2F0S A;  1KC8 C;  4KKU A;  5CYU A;  2JE6 I;  4IUN A;  1HJP A;  4F88 A;  5M5W B;  1PTO F;  2VL6 A;  2N55 A;  1SJH D;  1MD2 D;  2VW9 A;  1F77 A;  4V0B A;  1BDO A;  2XWB B;  4DKA C;  1SXT A;  4C1N K;  1YVC A;  1TWC B;  3U4V A;  3A54 A;  3K58 A;  4KHZ A;  1WTQ A;  4BY1 H;  2IHE A;  2RDF A;  5IYB G;  2X6L A;  1B8A A;  5D3D A;  1E7Z A;  1KDB A;  4UP8 A;  3OW2 A;  1F9R A;  5IT9 c;  4KKT A;  1GXD C;  2NYZ D;  5FLM G;  2VB3 X;  2YU9 B;  3RN5 A;  3S2D B;  2O5J C;  2E2J H;  5I6W A;  4B3S L;  1LTA D;  3GV3 A;  1TXY A;  1VF7 A;  3GTL H;  5C4H A;  5EKI A;  2KOL A;  3J81 i;  1LT6 D;  1S5C D;  2ES2 A;  4A3F G;  4ZAI A;  4JI4 Q;  2JA5 B;  4JG2 A;  2FHT A;  3FKI B;  4RA8 A;  4QMG A;  3I2Z A;  1GUS A;  4A3B H;  2AQ1 B;  5KND A;  5IWA Q;  1HNW L;  3QO2 A;  1SRU A;  3HOX B;  4P74 A;  3MXN A;  3OW7 A;  5EJW A;  1SMY D;  3VA7 A;  4NXN Q;  2AUK A;  4LF7 L;  4OO1 G;  3MXU A;  2UU9 Q;  4CDC C;  4TVA B;  4A3M H;  1JB7 A;  3OYY A;  1WTV A;  4BBS H;  2R7D A;  4O1N A;  3HOZ G;  2UXB L;  5EPL A;  1BVS A;  2AMC B;  2ZXP A;  4DR1 Q;  4AIM A;  4KV6 A;  4BY1 B;  3J80 L;  2K50 A;  3HOU H;  3GTM B;  3SK6 A;  1BCP D;  1M1K C;  1WD1 A;  3CC4 A;  3BYY B;  5BN4 A;  5C6A A;  1W2B A;  2C35 B;  1EY6 A;  1IL8 A;  2OXP A;  3OTO L;  3OWE B;  1QZH A;  1BUV T;  3M4P A;  1NAP A;  4J15 A;  3NWS A;  1VQ6 A;  1O7I A;  4C3J H;  1FJG Q;  3SE0 A;  1SE3 A;  2AHO B;  1BR9 A;  3T1H L;  2BDO A;  4EQN A;  4DPG A;  1DJR D;  2R7Z G;  4LF8 L;  4YWL A;  3V2T A;  5JPN C;  3DHQ A;  1DCZ A;  5BR8 Q;  3M4O B;  4YCU A;  5ELF A;  1TY2 A;  2K52 A;  1OO9 B;  4V19 0;  3CW2 C;  1BCP C;  3N6R A;  4IJL A;  1YI2 A;  1ROD A;  4FF4 A;  1I4X A;  2Y0S G;  1B50 A;  1WYD A;  4QUF A;  1VQE A;  4DV4 L;  1A2U A;  1PA6 A;  3HOU B;  2OQ0 A;  3DEP A;  4A75 A;  5ELB A;  4LFC Q;  3M4Y A;  4C56 C;  1PH9 A;  2V4D A;  4FXG C;  5HGT A;  3BVZ A;  1IBK L;  4BXX H;  1Q1B A;  2B8G A;  4YWK A;  3CKI B;  1BBW A;  1SND A;  4FO2 A;  1GVP A;  2FJ2 A;  2K75 A;  5C0X G;  1SYG A;  1C48 A;  1ESR A;  2JEB I;  3UE1 A;  4A3K G;  1D1I A;  4C3J B;  2IX3 A;  4AH6 A;  2NVQ B;  3E9H A;  2E5L L;  1PH4 A;  1LLR D;  2CQA A;  3TN2 A;  2L55 A;  2UXD L;  3M85 A;  1XMO L;  1PYS B;  3RD4 A;  1ILQ A;  3C46 A;  2MJ8 A;  3PUX A;  1RTO A;  3NE5 B;  3V05 A;  2HQE A;  3QOJ A;  5E1F A;  1CKN A;  3OIQ A;  3CPF A;  2A68 C;  5BN5 A;  5C44 H;  1EEF D;  2KED A;  4UAI A;  3U9O A;  2F0J A;  1I4P A;  5FO7 B;  2EY5 A;  4KK7 A;  5GRO A;  2R6G A;  4A3L H;  4DAY B;  5KYI A;  1R4P B;  3U58 A;  2EDG A;  3GTO H;  4PZ8 A;  2Z0S A;  5M3F G;  1EIG A;  1Z6H A;  5JVG 3;  2AUJ D;  2F3W A;  3ER0 A;  4JC0 A;  1DGS A;  3CD6 A;  2EY2 A;  1SFO B;  3PMF A;  2C5C A;  5J39 A;  2KQ3 A;  4F8M A;  3I4O A;  2F0K A;  5IGE A;  4C2M H;  2OCE A;  2AKW B;  4JI1 L;  1H9J A;  4DA2 A;  1VQC A;  1Y8N B;  4O42 A;  4A3E G;  3IAY A;  3PSI A;  1V43 A;  1Q12 A;  2J7Z A;  5C3W A;  5CC4 A;  3ULJ A;  1HNX Q;  1IKM A;  3S2H H;  3UDF A;  3I55 A;  3AEV A;  2Q2H A;  3EA6 A;  4N8F A;  3K7A B;  2LXJ A;  5KYL A;  3OIP A;  1TKW B;  1WOC A;  5JEA J;  1SR3 A;  3UE0 A;  2YTX A;  4C3I H;  4P75 A;  4L5Q A;  2DJF C;  2IW3 A;  4IN3 A;  1PFM A;  1R9T H;  4OL7 A;  1Y1V H;  1GO3 E;  1BCP B;  1Y8O B;  3KBG A;  1K8G A;  2ASB A;  4HIM A;  3GTO B;  3F2U A;  2K5Q A;  2PO4 A;  3H91 A;  5M5X B;  4BY7 G;  4NXM L;  4IPC A;  1MBY A;  4K6D A;  4YWM A;  2G9H D;  3A5Z B;  2OTJ A;  1S72 A;  1U4P A;  3O13 A;  1EZ8 A;  3DWP A;  4CJ1 B;  3M4Q A;  4A93 H;  1GUT A;  4DV7 Q;  1JC7 A;  2A69 D;  3CCJ A;  1LTB D;  2EY6 A;  5GAG C;  4WJW A;  2KCT A;  1STB A;  2EYJ A;  1IBL Q;  5LMU Q;  2EZV A;  3CAM A;  2OT2 A;  1HTP A;  3DEO A;  1YJN A;  5GQO A;  3L0O A;  1U9R A;  3J81 E;  1H9S B;  2MP1 A;  5CV7 A;  5CBE E;  1QWY A;  1HQR D;  2PQA B;  4ME3 A;  2JQO A;  2F0O A;  1NE3 A;  2VQE L;  4C3I B;  1YNN C;  2B2T A;  1EIY B;  2A6H D;  4I7A A;  5EAY A;  4DK6 C;  5C4J B;  1R9T B;  1SYC A;  3ERQ A;  1SE8 A;  3NPP A;  5C4X H;  2F03 A;  1Y1V B;  2UXC Q;  1O7Z A;  2K6A A;  3KFU A;  1TT2 A;  2CVR A;  4JK1 C;  5COY A;  4DR5 L;  3CHB D;  1TS3 A;  3I3C A;  3HKZ E;  1XX8 A;  1B3A A;  1UE7 A;  3CP0 A;  1X3F A;  4JI0 Q;  4RGT A;  1N32 Q;  2JA8 B;  3B6Y A;  3P7J A;  1JIC A;  3CCQ A;  4A93 B;  3AQQ A;  4KTA A;  4UP9 A;  2JXM B;  2I5L X;  1PH8 A;  5IOC A;  3E3X A;  2L9H A;  4MN3 A;  1CK1 A;  4DV2 Q;  4IUR A;  1SYE A;  2WB1 E;  3MC0 B;  1ASY A;  5JEA H;  3QB3 A;  5IYD H;  3EJI A;  1QE6 A;  4ZQ3 A;  1GOZ A;  3DWQ A;  2K05 A;  4AYB E;  4B3R Q;  3TS0 A;  1OXX K;  1I4R A;  4NW2 A;  4A3G H;  3VR4 A;  3TBI B;  1FGU A;  1HNZ L;  2ZJQ A;  4DAM A;  1JQY D;  3NTH A;  3T4A C;  1EQT A;  3U50 C;  2B39 A;  3L3O C;  1XTD A;  4DV1 L;  2JA5 G;  2WKD A;  2K28 A;  3NHH A;  4IUP A;  1JOQ A;  1LTR D;  4RKB A;  5C5L A;  2JA9 A;  4RH6 A;  1ZXT A;  1V1P B;  2H1E A;  3G7L A;  2CW0 D;  1XPR A;  2NTS A;  3CRL C;  4JI6 Q;  2F0D A;  1DOL A;  5LL6 S;  3STB C;  4OWT B;  5JJL A;  3C3L A;  1LYL A;  4PZ6 A;  4ABN A;  1A3U A;  4X66 L;  1IBM L;  3C2P A;  3K5M A;  1L2F A;  5M5Y H;  2RHS B;  1Q8K A;  2EE1 A;  2K5D A;  2WV6 D;  3NP8 A;  3DLL A;  3KYH C;  2AWN A;  5AFW A;  4DV6 L;  4UPA A;  3HFZ B;  3S15 B;  1EQQ A;  3E0J A;  4ZK9 B;  3PO2 H;  3NQT A;  5IGB A;  4LF6 L;  3HOY B;  5HY6 A;  3FPU B;  3TRE A;  2R61 A;  4DK0 A;  1PV4 A;  3IFD A;  2JEA I;  3TP5 A;  1ZKO A;  1S3O A;  1XNR L;  2N78 A;  3ITP A;  2HDM A;  3TRZ A;  1VQF A;  1MI2 A;  3EIV A;  5EGT A;  4RAU C;  1HZC A;  3K59 A;  1F2L A;  3S1M H;  1PH5 A;  3E9I A;  4JBW A;  4GKJ L;  2VUM H;  4A3D G;  4CHT B;  1PVO A;  3F2B A;  2ZJR A;  4GLA C;  3CPW A;  1IKL A;  3HOV H;  1KIX A;  1D1K A;  4IFD G;  4E6I A;  2JYO A;  1EY0 A;  2Z6K A;  1AP0 A;  1CZG A;  2NVX H;  1X54 A;  3S17 H;  4GKK Q;  1SNC A;  1P8L A;  2RHQ B;  5M5Y B;  1HPC A;  4K2L A;  1WCM H;  2EQS A;  1PDQ A;  4CBV A;  2EJM A;  5GAE C;  1TWF H;  4M1U B;  5M9O A;  4GN3 B;  4QUC A;  1PFN A;  4DUZ Q;  3CCU A;  5IP7 H;  4WJ3 M;  2E2I H;  5I6Y A;  2R92 B;  3KBX A;  3TP8 A;  1TR5 A;  4ZUJ A;  2C9O A;  4IO9 A;  4JI5 Q;  3D31 A;  2D62 A;  3IKJ A;  3T56 B;  1KRT A;  3X3N A;  4HCS A;  5I9O A;  1LTL A;  1QNK A;  1Q82 C;  1E24 A;  4UY8 C;  1JWU D;  2O4X A;  2JA7 H;  1K28 A;  3ONA B;  4RGN A;  4TSS A;  4LUV A;  1CA5 A;  1X9N A;  4YY3 Q;  1JB3 A;  2LS0 1;  1U4R A;  1TU2 B;  5IYC G;  4KHV A;  3HOV B;  1YHB A;  5JJK A;  1TWA B;  1SMX A;  4HJA A;  1VQD A;  1K83 H;  4J6H A;  1U5K A;  3FEW X;  2QKI C;  4MIU A;  5KNC A;  3I70 A;  2NBF A;  1YIT A;  1J8I A;  1STG A;  2UUC Q;  1B1Z A;  2QDL A;  3S24 A;  1D5Z C;  4DV5 L;  5FLX c;  3S1N B;  3S17 B;  2F4I A;  1JR0 D;  3A8K E;  4OEL B;  4DR3 L;  1ENF A;  1J6Q A;  1F2Z A;  1WCM B;  2IPK D;  3UDG A;  4F7X A;  4A3J B;  4QF4 A;  2JJQ A;  3HKZ B;  3NBH B;  1J5E L;  1NTG A;  1FNV A;  1H9K A;  1HA5 A;  4DV0 Q;  4GS3 A;  3NEL A;  1C8C A;  3DUZ A;  5M3M H;  4GN4 B;  4BA1 I;  2VNU D;  1IW7 D;  3MEF A;  2E2I B;  1ASZ A;  3M3Y H;  1DYQ A;  4H44 C;  3F8T A;  1H9S A;  1I4H A;  1T9H A;  5L37 A;  5IE8 A;  1C4Q A;  2EY1 A;  2NTT A;  4B3S Q;  1JJ2 A;  2EJF C;  2WB1 B;  1W3S A;  4LUZ A;  3AU7 A;  2JA7 B;  3R3O A;  4DU9 A;  5C5M A;  2H5X A;  3KDF B;  3J7A F;  1HH2 P;  3H09 A;  2EPB A;  4HAE A;  3WWV A;  1HQM C;  4JVZ A;  1CKM A;  2RDG A;  4AYB B;  1HNW Q;  2K4K A;  3NWT A;  2I07 B;  4WJ4 A;  1BCP F;  1PH3 A;  3BDL A;  3PF4 A;  3MWY W;  1UEA B;  4U68 A;  1Y1W G;  1LAB A;  3PO3 H;  4K0K L;  1Q1E A;  1PH1 A;  3AMU A;  4LWC A;  1XNQ L;  4IPD A;  4LF7 Q;  2KEE A;  3GTQ H;  1ENA A;  3NK9 A;  3J7Z C;  4CDE C;  3RZD H;  4RHS A;  1GKH A;  2UXB Q;  1VCI A;  4JV5 L;  4Y7N H;  4MTK A;  5M3M B;  1PMR A;  3TZD A;  1F2M A;  2MUY A;  3FMC A;  4C3H H;  1CSP A;  2FXQ A;  2BCO A;  2Z4H A;  1JMC A;  4X65 L;  4POG A;  4JW0 A;  2IX0 A;  1F9S A;  1K73 C;  4LFB L;  4A3I G;  4QIW B;  3D3R A;  3OTO Q;  5IYC H;  3ND9 A;  3CXC A;  1SRO A;  2ID0 A;  4JOI A;  3MHB A;  4P73 A;  3E0E A;  2ZT9 C;  1NR2 A;  1Y69 U;  3D6W A;  3DM3 A;  3T1Y L;  1E22 A;  4LF9 L;  3T1H Q;  1CHP D;  3HEJ A;  4TRD A;  3CC7 A;  4LF8 Q;  2VZA A;  5ELE A;  4BS9 A;  2D0P A;  3VYS A;  1PFB A;  4DXG A;  4GNX A;  4CGY B;  1I6H H;  4FVM A;  1BF4 A;  4R4O A;  4Y52 H;  3H94 A;  3RZD B;  1RIP A;  3A55 A;  1KNE A;  2YTY A;  2WAQ G;  3Q24 A;  1V9P A;  3J81 j;  4Y7N B;  5DNF A;  1K0S A;  1XMQ L;  1O80 A;  3S14 H;  1K3B C;  3AFQ A;  4DV4 Q;  4R4T A;  2LMC B;  4KN4 C;  2JA8 G;  4QCL A;  4C3H B;  3RN2 A;  3PQI A;  3NQI A;  3J80 c;  1MKH A;  1BBX C;  2NVT B;  2A8V A;  5ELO A;  1EWC A;  2E75 C;  1CUK A;  4A4I A;  1XWE A;  1T5E A;  4FP5 D;  1KTK A;  2EOT A;  2RDH A;  3CF5 A;  3RR5 A;  4EX5 A;  3I7F A;  1F2Y A;  1DXM A;  2NN6 I;  3ULP A;  2JA6 H;  4G7Z C;  1L0Y B;  1N8R C;  5C4Z A;  5EQ0 A;  4KJN A;  2E5L Q;  2KCC A;  2UXD Q;  1WTX A;  5I2Y A;  1XMO Q;  2B3G A;  3QR8 A;  5CBA E;  2PPB C;  3I4N H;  1B4O A;  2B2U C;  3GTK H;  1EFI D;  1KAW A;  4JI2 L;  1IYJ B;  4POF A;  5C3E H;  3E6Z X;  1EY5 A;  3JAM E;  1EOV A;  1I6H B;  1PZI D;  4HIK A;  1IYV A;  1FR3 A;  4OWW B;  1LAC A;  3RZO H;  5G3L F;  2Z8L A;  2F0P A;  4G57 A;  4HMJ A;  2B63 H;  1QNU A;  1YHQ A;  4R9W A;  2E2J B;  4GOP A;  3TZU A;  3GTL B;  4WOR A;  4LFA L;  4HJ9 A;  3M9B A;  2F3V A;  2N3S A;  5IGG A;  1QIL A;  4LW1 A;  2CKZ B;  4JI1 Q;  3LNN A;  4X3K A;  1UE5 A;  3RUZ A;  2Z6K C;  5A2Q E;  2Z9H A;  1C0A A;  4A3B B;  3SGI A;  1QCB D;  5IP9 G;  4NMZ A;  4BBR G;  4I65 A;  1LT3 D;  3QWN A;  3HZX A;  2IHF A;  4FF2 A;  3BS1 A;  1M8A A;  3LWE A;  1K8O A;  3HOY G;  2EIF A;  2YTV A;  1A8V A;  1SE4 A;  2F0W A;  1BKB A;  3R93 A;  4FXK C;  3FVQ A;  5HUR A;  1VQB A;  4A3M B;  1BNZ A;  5JPM C;  4BBS B;  2JK8 A;  3PIP A;  3PIO A;  2RQX A;  1MJC A;  5C3E B;  2A68 D;  3A7L A;  3I73 A;  2E2D C;  1O7L A;  2NWG A;  4HJ8 A;  4XYO A;  1B44 D;  4H02 A;  2IL8 A;  4NXM Q;  1IHZ A;  3D4W A;  1WTW A;  2XGT A;  5COR A;  2NZH A;  5K36 H;  3OHX C;  2XRS D;  2WFW A;  3CC2 A;  1Y14 B;  3PUY A;  4HSV A;  1QVG A;  3CQZ H;  1YNJ C;  4YHH Q;  2PW5 A;  1YJW A;  1ICF B;  1VQP A;  4JI8 L;  1L1O A;  1UAP A;  1OTC A;  5E7N A;  2Q8T A;  2PZU A;  3C1F A;  1PH2 A;  3W1B A;  3VR3 A;  4LF5 L;  4A3C G;  2KEC A;  2E2H H;  1ONL A;  1CQF A;  2WKC A;  1VDZ A;  2F0N A;  4K5X A;  3I4M H;  2R92 G;  3H3V C;  3BDO A;  3NTK A;  3PCO B;  5IWA L;  2IY5 B;  2VQE Q;  1B70 B;  3KF6 B;  3G71 A;  3BJU A;  4DGZ A;  1CHQ D;  3HOW H;  3BDC A;  5FJ8 H;  1MJE A;  1EOT A;  2K5W A;  3VA5 A;  4DR5 Q;  2KHS A;  1NUC A;  4TKO B;  4U67 3;  1PTO C;  4JYA L;  1EL0 A;  1I50 H;  4P72 A;  1GJX A;  1PZJ D;  4B3M L;  3D8G A;  2EXZ A;  4IFD I;  3I56 A;  3SDZ A;  3CRK C;  1KNA A;  3HGB A;  2HHH Q;  3T13 A;  2K04 A;  1LT5 D;  1Q81 C;  1NNX A;  5G3L D;  1EYD A;  4X3S A;  1J9O A;  5C3X A;  4A3J G;  1SAP A;  3HKZ G;  4B3T Q;  1ICW A;  1HXY D;  1KAB A;  2CQO A;  4YIJ A;  5IGC A;  1DOM A;  4EQO A;  1B53 A;  2R93 H;  3LWU A;  3TQY A;  5C44 B;  1EY7 A;  3H3V H;  5ELN A;  4X62 L;  1II3 A;  4ME5 A;  4IPH A;  2PCF B;  2A1A A;  3X3M A;  4LF4 L;  4CKE A;  3CCE A;  1HNZ Q;  5IT9 E;  1YNN D;  2WB1 G;  1YIJ A;  1D5X C;  1FNW A;  1SN8 A;  5CV4 A;  1XYI A;  4OON A;  4CKB A;  4RMF A;  1D8L A;  4DV1 Q;  2QGQ A;  2YV5 A;  1WTR A;  2PQE A;  2QEX A;  2DY8 A;  4J1M A;  1F9P A;  3TP6 A;  4AYB G;  4C2M B;  2EJG C;  4ALP A;  1PTO H;  4L5S A;  1VQA A;  1K9M C;  5IYB H;  4PZ7 A;  4YCW A;  4LFC L;  1HR0 W;  4HTH A;  4DR7 L;  5FLM H;  2NN6 G;  4X66 Q;  1IBM Q;  1JWS D;  2CWP A;  1OXV A;  4CDF C;  3S2H B;  5A35 A;  2H4O A;  5CGK A;  1BOS A;  4G7H C;  3D4D A;  1QG7 A;  4DV6 Q;  3HRZ C;  4IUU A;  3HP3 A;  5ISR A;  4A3F H;  4MZ9 A;  5LL6 X;  2L11 A;  3H0G G;  4QQB X;  1WJJ A;  1PHJ A;  4K8J A;  2R93 B;  2XWJ B;  1EQV A;  4CJ0 B;  2PI2 E;  2BOS A;  1WD0 A;  2NUC A;  5C0X J;  1XNR Q;  2E76 C;  1M4V A;  1IZ6 A;  1ENC A;  1QJO A;  3SEB A;  1K0R A;  1X55 A;  4OO1 H;  1XJV A;  4GKJ Q;  3VYT A;  1EU3 A;  2MQH A;  1CKO A;  2SOB A;  2VS1 A;  3HOZ H;  3DMU A;  1PLF A;  4X3T A;  3L9A X;  2CCZ A;  4OIK A;  2UUA L;  1VQI A;  1AEX A;  5KGU A;  3RNU A;  2UUB L;  3WOE A;  5IOD A;  4OX9 L;  2O5I C;  2LKV A;  2PNH A;  1PYB A;  2JSO A;  4FDB A;  3SK8 A;  3STB D;  3CU7 A;  2DUD A;  3D0F A;  4DR6 L;  3M7G A;  4KD3 A;  2J0T D;  1QUQ B;  1HR0 L;  1SBB B;  4Q0F A;  3J7Y W;  1M90 C;  4APV A;  5NUC A;  4DF7 A;  4LNQ A;  3RLO A;  2SNM A;  1PZK D;  2FMC A;  4Q5V A;  2K14 A;  1W6J A;  1S5B D;  5I9P A;  1N33 Q;  4WRD A;  3PUZ A;  5C4X B;  3GD7 A;  4GOP C;  1T5X D;  1TII D;  1CA6 A;  2R7Z H;  3VDY A;  1UNS A;  2M00 A;  2N49 A;  4AQY L;  3FKI G;  1W6K A;  3TS2 A;  3SVM A;  2D0O A;  3GP7 A;  3HOX G;  1MSG A;  4XTC S;  2I46 A;  1SYD A;  3ULL A;  2RSO A;  3BVM A;  2EYH A;  1LUZ A;  2ZXR A;  1I5F A;  4P71 A;  1A2T A;  2F0I A;  1EEI D;  2KEN A;  5TSS A;  2SDF A;  4QIW E;  4IZ8 A;  2HIV A;  2K01 A;  1H9R A;  1EYC A;  4DV5 Q;  1LTS D;  1TWH H;  2HD3 A;  5DAU A;  1UUP A;  4DV7 L;  4DR3 Q;  1N36 L;  1VQM A;  2B2Y A;  3M7N A;  1EZ6 A;  4BY1 G;  1AZP A;  4DR2 Q;  1J5E Q;  3K81 C;  5C0X H;  4IUV A;  1A6X A;  5LMN L;  3CCS A;  4A3G B;  2XTI A;  4DV3 L;  2QCP X;  4A3K H;  1B9M A;  3D6C A;  4NPS A;  4P2C B;  5CV8 A;  4DNT B;  3KOJ A;  1JJC B;  4I7Z C;  4NP5 A;  3F2C A;  3A8I E;  4DAY A;  4MTN A;  1X6O A;  4A3B G;  1CSQ A;  2AQ2 B;  3P75 A;  3GO5 A;  4XQN A;  3MXG A;  1HFN A;  2WII B;  5M3F H;  1HUM A;  1TWG H;  1S5E D;  1JOO A;  1EWH A;  4K0K Q;  4A3M G;  1D5M C;  4EGV A;  4BBS G;  2HCI A;  3RLN A;  3CME A;  1XNQ Q;  2DJG C;  3PUV A;  3PO2 B;  2Z6B A;  2L12 A;  4A3E H;  5E4W C;  5J22 A;  4IPG A;  3HOU G;  2HIX A;  4OGQ C;  4QB4 A;  4JV5 Q;  3KK7 A;  1FNU A;  1YEZ A;  1SSO A;  4Z9C B;  1U4M A;  3D4R A;  3A5U A;  4JBK A;  1BQQ T;  4M8A A;  1EFW A;  4X65 Q;  5IGF A;  1S4Z A;  4IOA A;  4B9W A;  2J4X A;  2F0E A;  3S1M B;  3EN2 A;  1X3P A;  2IT1 A;  4LFB Q;  2CFM A;  3SR1 A;  4RFB A;  3JAM c;  1FYC A;  2VUM B;  1FVI A;  2XNA C;  1WVL A;  2B8F A;  2VY3 A;  4C3J G;  3AB9 A;  3F1Z A;  4R8I A;  2VB2 X;  1IL2 A;  2K5N A;  1IXR A;  1VQL A;  3OSO A;  2OQK A;  4KY6 A;  4G7O C;  3T1Y Q;  4LF9 Q;  4BY7 H;  1WTO A;  2NVX B;  3SHL A;  3K5L A;  4NB3 A;  1YJ9 A;  4L63 B;  3URY A;  5T1G A;  1GUN A;  2L4N A;  1Y8P B;  3MEH A;  1TWF B;  1KHI A;  1VF5 C;  2FIN B;  3DXJ C;  1WFQ A;  3QOL A;  3S1R H;  1IYU A;  2L5T A;  1AFP A;  1E0B A;  1VQJ A;  3ZJY C;  1JOK A;  3J7A V;  1I94 L;  1EIH A;  1UEB A;  3Q0A A;  3JAM L;  1XMQ Q;  3CCR A;  2PQA A;  4BXX G;  3V96 A;  3ICE A;  3KLR A;  2RCN A;  1Q86 C;  4KMU C;  1XPO A;  2AWO A;  2F0V A;  3UDI A;  2CH4 W;  4X3U A;  3H6M A;  1RHP A;  4IAL A;  3S16 H;  1KLG D;  5T1I A;  2CWA A;  4PG3 A;  1MIU A;  4PNY A;  1Z47 A;  3MA2 B;  3GV6 A;  1KAA A;  1ML0 D;  5J3B A;  2PZT A;  1PRT C;  1K83 B;  4DXF A;  3TDQ A;  4HCE A;  5A2Q L;  3FDT A;  1CM9 A;  1FD7 D;  2ICI A;  3EVQ A;  5BN3 A;  5C44 G;  1NMF A;  2B2T C;  3DM1 A;  1TY0 A;  3A0J A;  1PFS A;  2DY7 A;  3KLS X;  5EBC A;  5D14 A;  5JVH 3;  4A3L G;  1CKN B;  1GUW A;  1EU4 A;  2A6E C;  4LK1 C;  2EVB A;  4JI2 Q;  5FOB B;  2F0F A;  5M5W H;  5AJ3 L;  5I4D A;  4JPB W;  2BA0 A;  2EYF A;  2MPM A;  5HGQ A;  3OMC A;  3M3Y B;  1XPU A;  3HKS A;  2Z4I A;  4ZUI A;  1TWC H;  2QIL A;  2B2W A;  4DUZ L;  4LFA Q;  4KLK A;  2D2C C;  2QW7 A;  4JI5 L;  2IX1 A;  3J7A 5;  4CDD C;  5FKA C;  2F0U A;  3DWA A;  4HJ7 A;  3S2D H;  1TS5 A;  4JBM A;  1KLU D;  4CJ2 C;  4ZLT F;  4YCV A;  2X6G A;  1RKN A;  5JOB A;  1E1O A;  1STY A;  1TQO A;  4PQX A;  3TP7 A;  2JA5 H;  1V1P A;  4C3I G;  4EQ5 A;  3PO3 B;  3G6J B;  4LMQ D;  4DNR B;  1ZYR C;  5FO8 B;  3J80 i;  4JI7 L;  3GTQ B;  3QIA A;  2IWH A;  1Y1V G;  2F52 A;  2KCN A;  1VQK A;  2ZM6 L;  4KHP L;  2UUC L;  1VMC A;  2N8N A;  2EYL A;  2XIW A;  3I8Z A;  1LTT D;  2RA4 A;  1G2T A;  4K2K A;  5CV5 A;  2XRQ D;  4CKC A;  4JI3 L;  1I6V C;  2KVM A;  1NCV A;  4A93 G;  2F0H A;  1TS2 A;  2EXD A;  4HR7 B;  1KDC A;  4DV0 L;  3SK5 A;  1IBK Q;  1Q46 A;  1D7Q A;  4RGM A;  1X3Q A;  3GTM H;  5D3I B;  3K7U C;  1VMP A;  5JAV A;  3Q23 A;  5FK9 C;  3CCL A;  1R4Q B;  2NB0 A;  4DUY L;  3LX0 A;  1HCZ A;  1K8M A;  1KRS A;  4JI8 Q;  4OXP A;  2BE5 C;  1STH A;  1B2T A;  5DM6 3;  2B2Y C;  1GHK A;  2ZJP A;  1EY9 A;  2HQL A;  1PRT B;  3W5O A;  4LF5 Q;  1VQN A;  2F0L A;  5GAH C;  4A3D H;  1EY4 A;  3H15 A;  1N34 L;  2K7V A;  1PH6 A;  3SXH A;  2HT1 A;  2A73 B;  5C4X G;  4L5T A;  3BZC A;  4X64 L;  4WFN 3;  4IFD H;  4K8I A;  2K32 A;  4B08 A;  5CV6 A;  3J81 c;  3CCM A;  4RCO A;  3MFG A;  3M4O H;  3S14 B;  1KQS A;  1KXL A;  4XQJ A;  1AH9 A;  4K14 A;  2KA7 A;  3PF5 A;  5IT9 L;  1NSN S;  1D6E C;  2F1M A;  2QEJ C;  3RLF A;  3MVV A;  4LUO A;  4DAP A;  4EQP A;  4JYA Q;  5H1S E;  2A74 C;  4B3M Q;  4KY7 A;  5JEA G;  5IYD G;  4DR4 L;  1VQH A;  2MFI A;  1F9Q A;  2ZXO A;  1DD2 A;  2JA6 B;  3W1G A;  4XXE A;  1C7Y A;  1NBW A;  1EYG A;  1Z9F A;  1YNJ D;  2JN4 A;  3AFP A;  3C1E A;  2KHI A;  4NKL A;  5FLX E;  2F4V L;  2R7F A;  4R4I A;  3OOC A;  3FHW A;  1A15 A;  4S3S A;  4QL5 A;  3GTG H;  3BYT B;  4DK3 C;  2SEB D;  1MHW C;  3OWF A;  3J81 L;  3I4N B;  4A3G G;  2HDL A;  2VQF L;  4A3D B;  1SNO A;  1QB5 D;  5EKK A;  3GTK B;  1SMY C;  2WAQ E;  4GN5 A;  4K5W A;  2NVQ H;  4X62 Q;  3NTI A;  4XDX A; 
#chains in the Genus database with same CATH homology
 1G29 1;  1HZ9 A;  2Q2U A;  4A3D G;  1PVO A;  1LM0 A;  4TQU S;  4GLA C;  3F2B A;  2ZJR A;  2YU9 H;  2F3I A;  4LF4 Q;  2PI2 A;  3CPW A;  4DV6 Q;  3HOV H;  1KIX A;  1U0L A;  4A3F H;  4MZ9 A;  2I5M X;  4IFD G;  3H0G G;  4QQB X;  1VQO A;  4OWX B;  1WJJ A;  1PHJ A;  4DR4 Q;  4HJ5 A;  2NVT H;  2Z6K A;  1B7Y B;  2ALY B;  2NVX H;  1X54 A;  1S40 A;  3S17 H;  4GKK Q;  3NEM A;  4PMW A;  2RHQ B;  1P8L A;  2F4V Q;  3FKI H;  1WCM H;  2EQS A;  2MO0 A;  3UDX A;  4YY3 L;  2PI2 E;  2QA4 A;  2R93 G;  5C0X J;  1VQ4 A;  1XNR Q;  5GAD C;  3CCV A;  1A63 A;  2A19 A;  2Q2I A;  1IZ6 A;  1HZA A;  5GAE C;  1OXT A;  3CMA A;  2KBN A;  1SFO H;  1TWF H;  3HOX H;  2VQF Q;  4GN3 B;  2K5H A;  4GLX A;  1K0R A;  1X55 A;  1KC8 C;  4DR7 Q;  1XJV A;  4DUZ Q;  1K3R A;  3CCU A;  2JE6 I;  1HZB A;  5IP7 H;  4WJ3 M;  2E2I H;  4GKJ Q;  1HJP A;  2MQH A;  4JI4 L;  1CKO A;  3EBE A;  4IO9 A;  2VL6 A;  3PO2 G;  4JI5 Q;  2VW9 A;  1AE3 A;  2VS1 A;  3HOZ H;  2CCZ A;  3D31 A;  2D62 A;  3KDF A;  4JBJ A;  4DKA C;  2UUA L;  1VQI A;  1KRT A;  4DNI A;  1LTL A;  3RNU A;  1Q82 C;  2UUB L;  4OX9 L;  1YVC A;  1E24 A;  3U4V A;  4UY8 C;  2PNH A;  4KHZ A;  4KI0 A;  1PYB A;  2JA7 H;  4FDB A;  2ATW A;  3STB D;  2DUD A;  3K7A H;  1VQ8 A;  2IHE A;  4BY1 H;  3D0F A;  4LUV A;  1E3P A;  5IYB G;  4DR6 L;  1B8A A;  1E7Z A;  4UP8 A;  1X9N A;  1QUQ B;  3OW2 A;  4A76 A;  1HR0 L;  5IT9 c;  4R4Q A;  4NXN L;  1VQG A;  4YY3 Q;  1M90 C;  4APV A;  5FLM G;  3Q8D A;  2UU9 L;  1Y1W H;  2OWO A;  5IYC G;  5JJK A;  1YHB A;  2VUM G;  3RN5 A;  4JCV E;  4LNQ A;  1VS0 A;  2E2J H;  1SMX A;  4B3S L;  4HJA A;  1VQD A;  1K83 H;  3RLO A;  1U5K A;  1TXY A;  3GTL H;  4R1J A;  1YIT A;  3HOV G;  3J81 i;  1VQ5 A;  2UUC Q;  4DR1 L;  3S24 A;  1VQ7 A;  2ES2 A;  4DV5 L;  4A3F G;  5FLX c;  4JI4 Q;  2K14 A;  4JG2 A;  1N33 Q;  3PUZ A;  4DR3 L;  3GD7 A;  1J6Q A;  1L0W A;  3I2Z A;  5M5X H;  4GOP C;  2UUA Q;  3UDG A;  4A3B H;  2R7Z H;  3VDY A;  2JJQ A;  4AQY L;  2N49 A;  1QVF A;  3NBH B;  5IWA Q;  1NTG A;  1J5E L;  3FKI G;  1WCM G;  2Q2T A;  2UUB Q;  4OX9 Q;  3GTP H;  1HNW L;  4DV0 Q;  1SRU A;  2MO1 A;  4GS3 A;  4P74 A;  3NEL A;  3TS2 A;  5M3M H;  2D0O A;  4GN4 B;  4BA1 I;  1JJG A;  4DR6 Q;  2VNU D;  3MEF A;  1ASZ A;  3M3Y H;  1HR0 Q;  3HOX G;  4NXN Q;  3F8T A;  4XTC S;  4A3I H;  4LF7 L;  4OO1 G;  3ULL A;  2UU9 Q;  1T9H A;  5IP7 G;  1LUZ A;  4TVA B;  5IE8 A;  1FJG L;  2Y0S E;  4P71 A;  1I5F A;  4A3M H;  1JB7 A;  3OYY A;  4B3S Q;  4BBS H;  2R7D A;  1JJ2 A;  3HOZ G;  2KEN A;  1W3S A;  4LUZ A;  2UXB L;  4QIW E;  1YBY A;  1BVS A;  2AMC B;  4DR1 Q;  2HIV A;  4AIM A;  4DV5 Q;  1TWH H;  2K50 A;  2H5X A;  3KDF B;  3HOU H;  4DV7 L;  1HH2 P;  5BR8 L;  4DR3 Q;  1VQM A;  1N36 L;  2NVY H;  1M1K C;  2JA7 G;  3M7N A;  3CC4 A;  4BY1 G;  3WWV A;  1CKM A;  2L15 A;  4AQY Q;  3NEN A;  1KD1 C;  4DR2 Q;  1W2B A;  2C35 B;  2K4K A;  1J5E Q;  1HNW Q;  4JOI C;  3K81 C;  1PH3 A;  4WJ4 A;  3PF4 A;  5C4J H;  3OTO L;  5LMN L;  3CCS A;  1Y1W G;  1X65 A;  1QZH A;  3PO3 H;  4K0K L;  1Q1E A;  1PH1 A;  2XTI A;  4DV3 L;  3M4P A;  4A3K H;  4LWC A;  1XNQ L;  4NPS A;  4J15 A;  4IPD A;  2I5H A;  4LF7 Q;  3GTQ H;  1GD7 A;  2V1C C;  1VQ6 A;  3KOJ A;  1JJC B;  3J7Z C;  1O7I A;  3U4Z A;  4C3J H;  1FJG Q;  3RZD H;  1V1Q A;  2AHO B;  1UE1 A;  3T1H L;  1GKH A;  2UXB Q;  3F2C A;  1FL0 A;  1VCI A;  4JV5 L;  2JA8 H;  4DPG A;  4Y7N H;  4MTN A;  1X6O A;  4GNX C;  1CSQ A;  2R7Z G;  4A3B G;  3PGZ A;  4LF8 L;  4YWL A;  3GO5 A;  4C3H H;  5BR8 Q;  1N36 Q;  1CSP A;  2FXQ A;  4POG A;  1JMC A;  4YCU A;  4X65 L;  4X6A H;  2K52 A;  5M3M G;  1OXS C;  3CW2 C;  4YHH L;  5M3F H;  3IRB A;  4LF6 Q;  2IX0 A;  4IJL A;  4MNO A;  1YI2 A;  1K73 C;  4LFB L;  4A3I G;  2Y0S G;  1NJI C;  3OTO Q;  1TWG H;  5IYC H;  5LMN Q;  3GDE A;  3CXC A;  1WYD A;  1SRO A;  4K0K Q;  4A3M G;  2ID0 A;  4DV3 Q;  1JE5 A;  1VQE A;  1H95 A;  4BBS G;  4JOI A;  3CME A;  3RLN A;  2B29 A;  4P73 A;  4DV4 L;  1PA6 A;  1XNQ Q;  2OQ0 A;  3E0E A;  4A75 A;  2KCM A;  4LFC Q;  3PUV A;  4A3E H;  1PH9 A;  3DM3 A;  3T1Y L;  1E22 A;  5IY0 A;  4LF9 L;  4IPG A;  3HOU G;  2HIX A;  3T1H Q;  4BXX H;  1IBK L;  1Q1B A;  4JV5 Q;  4YWK A;  2LXK A;  2GVA A;  1YEZ A;  3CC7 A;  1BBW A;  4LF8 Q;  2VZA A;  1GVP A;  3A5U A;  4JBK A;  2K75 A;  2D0P A;  3ERS X;  5C0X G;  1EFW A;  4X65 Q;  4GNX A;  3PO3 G;  4GKJ L;  2JEB I;  3UE1 A;  2I0Q A;  4IOA A;  4A3K G;  1I6H H;  3AYH B;  4R4O A;  2BH2 A;  4Y52 H;  3EN2 A;  4AH6 A;  2IT1 A;  4LFB Q;  2K5V A;  2CFM A;  2WP8 J;  1RIP A;  3JAM c;  3E9H A;  2YTY A;  1FVI A;  2WAQ G;  2E5L L;  1PH4 A;  2UXD L;  1IBM Q;  1V9P A;  3M85 A;  2VY3 A;  3J81 j;  1XMO L;  1VQ9 A;  1PYS B;  3F1Z A;  1XMQ L;  3S14 H;  4HID A;  3AFQ A;  5LMN W;  4DV4 Q;  4R4T A;  4QGU A;  1IL2 A;  3PUX A;  2K5N A;  1IXR A;  2JA8 G;  1CKN A;  3CPF A;  5C44 H;  3RN2 A;  1VQL A;  1HNX L;  2OQK A;  3J80 c;  1MKH A;  2HHH L;  2BH8 A;  2A8V A;  1EIF A;  5GRO A;  3T1Y Q;  4LF9 Q;  2R6G A;  3S1Q H;  4BY7 H;  4DAY B;  4A3L H;  5ELO A;  4NB3 A;  3U58 A;  3KF8 B;  5IP9 H;  1YJ9 A;  3GTO H;  1CUK A;  4PZ8 A;  4A4I A;  2Z0S A;  1UWV A;  5M3F G;  4B3T L;  3S15 H;  4UP7 A;  4BBR H;  4JC0 A;  3ER0 A;  1DGS A;  3CD6 A;  3CF5 A;  3FP9 A;  3RR5 A;  4EX5 A;  3I7F A;  1KHI A;  2PMZ E;  3HOY H;  2NN6 I;  3ULP A;  2JA6 H;  1WFQ A;  3S1R H;  1VQJ A;  3TEH B;  3I4O A;  1N8R C;  3ZJY C;  4C2M H;  2OCE A;  2AKW B;  4JI1 L;  2E5L Q;  2UXD Q;  1I94 L;  1XMO Q;  1VQC A;  1UEB A;  2B3G A;  1BBU A;  3A74 A;  4A3E G;  1XMQ Q;  1UE6 A;  3CCR A;  3PSI A;  2PQA A;  1V43 A;  1Q12 A;  2YYZ A;  3I4N H;  4BXX G;  3ICE A;  1G6P A;  2RCN A;  1Q86 C;  3GTK H;  1I3Q H;  1KAW A;  4JI2 L;  3ULJ A;  2AWO A;  1XPO A;  1HNX Q;  1G51 A;  1KL9 A;  1IYJ B;  3UDI A;  4POF A;  5C3E H;  2OTL A;  3S2H H;  3S16 H;  1EOV A;  3UDF A;  3I55 A;  3AEV A;  2Q2H A;  4HIK A;  1NMG A;  2LSS A;  2CWA A;  2LXJ A;  4PG3 A;  1MIU A;  1K8A C;  4OWW B;  3H3V I;  1WOC A;  5JEA J;  1Z47 A;  3RZO H;  2KHJ A;  1SR3 A;  3UE0 A;  2YTX A;  4C3I H;  2ZTC A;  4GNX B;  4P75 A;  2B63 H;  4L5Q A;  1GM5 A;  2GN5 A;  1IBL L;  1YHQ A;  5J3B A;  5LMU L;  4GOP A;  1NY4 A;  1R9T H;  4LFA L;  2MNA A;  4HJ9 A;  3M9B A;  1Y1V H;  2N3S A;  1GO3 E;  4LW1 A;  3KJO A;  2ASB A;  2CKZ B;  4JI1 Q;  5C44 G;  1K8G A;  1NMF A;  1I94 Q;  4HIM A;  3A0J A;  1PFS A;  1UE5 A;  2Z6K C;  4R4C A;  4BY7 G;  4A3L G;  4NXM L;  1CKN B;  1C0A A;  4IPC A;  4A3C H;  3SGI A;  5IP9 G;  4JI2 Q;  4YWM A;  1PH7 A;  3A5Z B;  3PUW A;  2OTJ A;  1S72 A;  3KF6 A;  5AJ3 L;  4BBR G;  5M5W H;  3K8A A;  2R92 H;  2BA0 A;  3K80 C;  5HGQ A;  2IHF A;  2UXC L;  3M4Q A;  4A93 H;  4DV7 Q;  1L1O C;  3CCJ A;  3HOY G;  1XPU A;  2EIF A;  3HKS A;  2YTV A;  2ZTD A;  3G4S A;  1A8V A;  2JA6 G;  1BKB A;  1TWC H;  5GAG C;  2KCT A;  1VQB A;  1IBL Q;  4RG1 A;  5LMU Q;  3CAM A;  4DUZ L;  4JI0 L;  2JK8 A;  3PIP A;  3PIO A;  4LFA Q;  1N32 L;  5DLQ E;  1MJC A;  1YZ6 A;  3KLW A;  3MXN B;  4KLK A;  3I4N G;  1YJN A;  5GQO A;  3L0O A;  4JI5 L;  2IX1 A;  3J7A 5;  1YHA A;  1A0I A;  3KJP A;  5C3E G;  4HJ7 A;  2PQA B;  4HJ8 A;  3S2D H;  1TWA H;  4ME3 A;  4H02 A;  4JBM A;  4NXM Q;  2JQO A;  1Q7Y C;  1NE3 A;  2VQE L;  3JAM i;  4YCV A;  4DV2 L;  2XGT A;  1EIY B;  1E1O A;  2RF4 A;  2NZH A;  5EAY A;  5AJ3 Q;  1SLJ A;  4DK6 C;  2JA5 H;  3S1N H;  1QVC A;  4EQ5 A;  2B63 G;  1SE8 A;  5C4X H;  3L2P A;  2UXC Q;  2WFW A;  3CC2 A;  4OO1 I;  3JC6 6;  3KFU A;  1Y14 B;  4DR5 L;  3PUY A;  4A3J H;  3J80 i;  1QZG A;  4JI7 L;  1QVG A;  3CQZ H;  4YHH Q;  2F52 A;  2BA1 A;  1Y1V G;  1VQK A;  3HKZ E;  4GOP B;  1YJW A;  4B3R L;  1VQP A;  4JI8 L;  1L1O A;  1UE7 A;  1OTC A;  3CP0 A;  1X3F A;  2ZM6 L;  5E7N A;  3K0X A;  4JI0 Q;  4KHP L;  2UUC L;  1JT8 A;  4IOC A;  1N32 Q;  1PH2 A;  2N8N A;  3W1B A;  3B6Y A;  4LF5 L;  4O0A A;  1N33 L;  4A3C G;  3CCQ A;  1C9O A;  2E2H H;  3L7Z C;  3I4M H;  2R92 G;  3AQQ A;  4UP9 A;  4JI3 L;  2I5L X;  3PCO B;  1PH8 A;  5IWA L;  2IY5 B;  3G48 A;  4A93 G;  2VQE Q;  2EXD A;  4DV2 Q;  1B70 B;  3F2D A;  4DV0 L;  3KF6 B;  2WB1 E;  1IBK Q;  1Q46 A;  3G71 A;  1ASY A;  1D7Q A;  3BU2 A;  3GTJ H;  5IYD H;  3BJU A;  4JI6 L;  3GTM H;  3HOW H;  3K7U C;  3G6E A;  2GVB A;  5FJ8 H;  1MJE A;  4DR5 Q;  3CCL A;  4JI7 Q;  4DUY L;  1X56 A;  1EQR A;  1N9W A;  4IJH A;  4AYB E;  4B3R Q;  1KRS A;  4JI8 Q;  3TS0 A;  1OXX K;  4OXP A;  2ZM6 Q;  4A3G H;  4KHP Q;  4JYA L;  1FGU A;  1I50 H;  4P72 A;  4DAM A;  2ZJP A;  1HNZ L;  2HQL A;  2ZJQ A;  1X3G A;  3W5O A;  4B3M L;  1WI5 A;  4LF5 Q;  2NZO A;  3U50 C;  1VQN A;  5GAH C;  5JJI A;  4L5R C;  4IFD I;  4A3D H;  4QJF A;  3I56 A;  1X3E A;  1XTD A;  3H15 A;  1N34 L;  4DV1 L;  1PH6 A;  2JA5 G;  5K36 G;  4JI3 Q;  4QY7 A;  2HT1 A;  2HHH Q;  4GLV B;  4DR2 L;  5C4X G;  4L5T A;  3BZC A;  1Q81 C;  4X64 L;  2JA9 A;  3H0G H;  4A3J G;  1XPR A;  3HKZ G;  3J81 c;  3CCM A;  4JI6 Q;  4B3T Q;  1YNX A;  3M4O H;  2CQO A;  3STB C;  2ZTE A;  4OWT B;  1KQS A;  1KXL A;  5JJL A;  1LYL A;  4PZ6 A;  1E1T A;  4BA2 I;  1AH9 A;  2R93 H;  3TQY A;  3PF5 A;  4DUY Q;  3H3V H;  1EUJ A;  5ELN A;  1L1O B;  1EWI A;  4X66 L;  3RLF A;  4X62 L;  1IBM L;  1L2F A;  5M5Y H;  2RHS B;  1Q8K A;  4IPH A;  3I4M G;  4LUO A;  2A1A A;  3DLL A;  2DGY A;  1A62 A;  3KYH C;  3PV0 A;  1HNZ Q;  3CCE A;  4LF4 L;  2AWN A;  4DV6 L;  4JYA Q;  5H1S E;  4UPA A;  2WB1 G;  3HFZ B;  1YIJ A;  4B3M Q;  1SN8 A;  1EQQ A;  5C0X I;  4OON A;  1N34 Q;  3PO2 H;  5JEA G;  4RMF A;  1D8L A;  1OXU A;  5IYD G;  4DV1 Q;  1VQH A;  2MFI A;  2QGQ A;  4DR4 L;  2YV5 A;  4HIO A;  4LF6 L;  3BZK A;  3HOW G;  5HY6 A;  2QEX A;  4GKK L;  3TRE A;  1RL2 A;  4X64 Q;  5FJ8 G;  3W1G A;  1C7Y A;  1EYG A;  1NBW A;  1PV4 A;  1Z9F A;  2F4V L;  3AFP A;  2JEA I;  4XIG S;  2KHI A;  1P16 A;  2R7F A;  1QUQ A;  4R4I A;  1S3O A;  3FHW A;  2N78 A;  4AYB G;  1XNR L;  4IFD J;  4ALP A;  4QL5 A;  3GTG H;  4L5S A;  1VQA A;  3TRZ A;  1K9M C;  1VQF A;  3LGJ A;  4DK3 C;  5IYB H;  4PZ7 A;  4YCW A;  3EIV A;  4A3G G;  1HZC A;  4LFC L;  2E8G A;  2VQF L;  1HR0 W;  4DR7 L;  3S1M H;  5FLM H;  1PH5 A;  2NN6 G;  2WAQ E;  4GN5 A;  3E9I A;  4X66 Q;  4X62 Q;  1AE2 A;  2NVQ H;  2CWP A;  4O2D A;  4JBW A;  1OXV A;  2VUM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...