1HNXQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 22
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hnxQ00
3U50C 1XMQQ 2F3IA 3K81C 1CSPA 2WB1E 4A4IA 4A3LG 2I0QA 3ERSX 4LF9Q 2UXDQ 1Z9FA 1WJJA 3UDXA 1KD1C 2ZJPA 2EXDA 2JA8H 2FXQA 1E1OA 5M5XH 5IYBH 1X6OA 2Y0SG 4KHPL 2YV5A 1PA6A 3M9BA 3GDEA 3CMAA 2UXCL 4JI7Q 4RG1A 4UP9A 1HJPA 4R1JA 1YHAA 3GO5A 2IT1A 5C0XI 4NXNL 1VQMA 1J5EQ 2E8GA 1HZAA 3GTPH 2WB1G 2ID0A 3CD6A 1DGSA 1V43A 4UY8C 1NBWA 5LMUL 4KHZA 4GNXA 1VQEA 1K8GA 1Q1EA 2VW9A 4NPSA 4AYBG 2JA8G 3S2DH 5M3MH 3FP9A 3RR5A 2JEAI 1AH9A 3F2BA 4A3DG 2UXBL 4GS3A 3K8AA 2AKWB 1XMOL 2D0PA 1IBMQ 2JA6H 3KLWA 2B3GA 4LNQA 2UU9L 3FKIG 3ZJYC 4DR1L 1FGUA 1S72A 2E2IH 4H02A 4HJAA 3PUYA 3PUWA 2XGTA 1N8RC 3E0EA 4OONA 2VQFL 3S15H 1EIYB 4GLAC 4X66Q 2PQAA 2BH8A 4JI5L 3G6EA 2LSSA 2BA0A 1W2BA 1XJVA 2UUBL 1S40A 3NELA 5IYDH 4GN4B 1HNZQ 5AJ3L 5M3MG 1VQJA 3BU2A 2E2JH 4OWWB 4DV1Q 1C7YA 1VS0A 4MNOA 2ASBA 4BXXH 1XNQL 1UE7A 3STBC 1G291 4FDBA 2HHHL 3CC4A 4L5RC 2V1CC 1HNZL 3AQQA 4JV5L 3CCJA 1PH1A 5IWAQ 3CF5A 3SGIA 3T1YQ 1YIJA 1N34Q 1XPUA 2YU9H 4BA2I 4GKKQ 1C0AA 4DUZQ 4L5SA 4TQUS 4JYAL 1YZ6A 1IYJB 3GD7A 2A8VA 4A3KG 3GTLH 2OCEA 1YJ9A 3KFUA 1E22A 2NN6I 4UP8A 2D0OA 4B3TQ 4DR1Q 2RHQB 5FJ8H 5LMNL 1OTCA 2I5LX 4DV2Q 2VS1A 3ICEA 1ASYA 2LXJA 1IBML 4DK6C 2JQOA 3CCRA 2KENA 4JI2Q 1PH7A 5IP9H 1GVPA 2Q2HA 1BVSA 2PNHA 2A1AA 3CCMA 3KJOA 1YJNA 1WCMH 1HZ9A 4QIWE 4DV4L 5LMUQ 1QVCA 4JV5Q 4DV4Q 3HKZE 4KI0A 5C0XG 4NB3A 4QJFA 1IBKL 5M3FH 1CKMA 2YTYA 3AFPA 4BBRH 4GLXA 4JBJA 1N36Q 5GQOA 2B63H 3S24A 4A3LH 4A3EH 5FJ8G 4JI6L 2D62A 4Y7NH 5AJ3Q 4EX5A 1W3SA 4MTNA 3TQYA 4POGA 3U4ZA 4JBWA 3RLFA 1V1QA 4P74A 3CAMA 3J80i 1OXUA 5GAEC 2UUAL 3OTOQ 2UUCL 1OXTA 4R4TA 3G71A 2ZTCA 3GTMH 4A3FG 1VQ6A 1SFOH 2R7ZH 4XIGS 4BY1G 1JJ2A 2JA5G 3CCVA 1MIUA 5H1SE 1VQ8A 4JCVE 1Y14B 4DUZL 3M7NA 1E3PA 1L1OB 3MEFA 4RMFA 3J80c 4OXPA 2VQEQ 4KLKA 4DV7L 3KJPA 4IOAA 1KQSA 3W1GA 5M3FG 2E5LL 3PUXA 1HH2P 5JEAG 2NZOA 3U58A 1U5KA 4LFBQ 4LUVA 3K7UC 3W1BA 2R93H 3PO3G 1XNQQ 2CWAA 4YWMA 5JEAJ 3M85A 4BY7G 1OXSC 2R7FA 4A93G 4GKJQ 4HJ8A 4DR4Q 4NXML 1XNRQ 1Q81C 1VQLA 2QEXA 1I94L 1HZCA 3CPWA 4ME3A 1VQFA 1PH8A 4B3ML 2RHSB 1KL9A 4EQ5A 3FKIH 4JOIA 3TRZA 2ZJQA 3NEMA 1VQ9A 4LF8Q 1PYBA 3I4OA 4L5QA 1N36L 2K5HA 4DV5L 4LF5Q 4OX9L 1L1OC 4P75A 1LYLA 2K5VA 4JI8L 3M4PA 2WAQE 3H15A 3PIOA 1TWHH 2NN6G 1VQNA 2MFIA 4HIOA 1EQQA 1CKOA 2RF4A 3K7AH 2HHHQ 4BY7H 1LUZA 3CC7A 2Z0SA 1TWGH 4C3JH 1FVIA 1VQ5A 5IYCH 4LFAL 2R92H 1NY4A 2E2HH 4UPAA 1O7IA 1UWVA 1SRUA 1PYSB 3KYHC 2MO1A 1PH9A 1SROA 3ULJA 5LMNQ 5C44G 1IBLQ 3PGZA 1PH5A 2ES2A 1NMFA 1HR0L 4BY1H 1HR0Q 1VQAA 2YTXA 3HOWH 3I4MH 3S17H 3S1MH 4LF4Q 1EUJA 4LF7L 4NXMQ 2N49A 1XNRL 4GKJL 2PI2A 2ALYB 2R93G 3KDFA 3EBEA 3CC2A 4DR2L 3L2PA 5IP7G 4R4OA 4IFDG 1B7YB 1GO3E 4IPDA 4PG3A 4X66L 4X62Q 4OX9Q 2DGYA 1WYDA 1HNWQ 2A19A 4DR5Q 2KHIA 5M5WH 4DV6L 3I4MG 4NXNQ 4DPGA 3J7ZC 4IPHA 1HZBA 4YWKA 4IJLA 3EIVA 1N32L 3OYYA 4YHHL 3I7FA 1YNXA 2LXKA 2AMCB 4ALPA 4X65L 3AYHB 3RZOH 4DR4L 4DUYL 1N32Q 1EFWA 1Q12A 1I5FA 3PF5A 4A3KH 3CW2C 2Q2IA 1CKNA 1QVGA 3H3VI 1S3OA 1U0LA 3ULPA 4B3RL 1VQBA 2E5LQ 3PO2H 1JJGA 1NTGA 2F4VL 2N78A 1VQ4A 1RL2A 4DV5Q 5IYDG 3HOZH 4JI1L 3D0FA 1Q46A 1YVCA 4YCWA 3GTQH 2AWNA 1M90C 1GM5A 1JT8A 1X3FA 5FLMH 4GOPB 3HOUG 4DV3L 4R4CA 4TVAB 1N33L 3I56A 1I94Q 1YJWA 4IPCA 1VQIA 4JI5Q 3RLNA 3JAMi 2HIXA 3H3VH 1EQRA 3GTOH 3M4QA 4GN5A 2F52A 2IY5B 2VZAA 1FJGQ 4A3EG 2B29A 1VCIA 1Q82C 1YEZA 3H0GH 2KBNA 1K73C 1KRTA 4JI1Q 4DK3C 3J81i 1Y1WH 1IBLL 4JBMA 1IL2A 1I50H 1CSQA 4POFA 3S1NH 3S14H 2EQSA 2MQHA 1MKHA 1VQOA 2I5MX 2Z6KC 2CQOA 2AWOA 4PZ6A 2GN5A 3L7ZC 4QL5A 1HNXL 1A63A 1RIPA 3F1ZA 5ELOA 3HOXG 3S1RH 3STBD 4HIDA 1QZHA 4OWTB 2JA5H 3PF4A 4A93H 4MZ9A 1Y1VH 3TREA 4DUYQ 2OWOA 1VQCA 2PMZE 2KCMA 3UE1A 3BZKA 4AYBE 2UUAQ 4L5TA 4LF5L 4A75A 3H0GG 5K36G 1NE3A 4LF8L 2HQLA 1QUQB 2I5HA 1VQPA 2IX1A 4IFDI 1V9PA 1BBUA 1EWIA 4DKAC 3CCSA 4APVA 2C35B 4GKKL 1VQHA 3KF6B 4HJ5A 2UU9Q 1YBYA 5GROA 3CPFA 1A0IA 2IHEA 2ZJRA 1YHQA 1K0RA 3AEVA 3HOZG 4JI0L 2UXBQ 3KF8B 4GNXC 2R7DA 4J15A 1HNXQ 1VQKA 3MXNB 3J81j 2OTLA 5C4XG 1T9HA 4OO1G 4QGUA 2VUMH 4O2DA 3Q8DA 2N8NA 5HGQA 2BH2A 1HR0W 5IY0A 2YYZA 3A74A 1CUKA 3PV0A 3S1QH 4AQYQ 2K75A 3CCQA 4LW1A 3RLOA 3GTJH 3CCUA 3HKSA 2JA9A 2KCTA 3OW2A 2IX0A 1JJCB 1WI5A 4DR5L 3RZDH 2JJQA 3NENA 4IFDJ 1AE3A 4P72A 4YCUA 4Y52H 5IWAL 1JMCA 1Z47A 3RNUA 4HJ9A 3CMEA 2KHJA 3HOYH 5GADC 1CKNB 1WCMG 3A5ZB 3ER0A 1YI2A 3HOXH 3DLLA 1B70B 2Z6KA 2ZM6Q 2VUMG 4JI4L 1I3QH 1BBWA 3CP0A 3UE0A 2GVAA 3PIPA 4HIKA 4B3SQ 4X6AH 1YITA 5JJIA 1UE1A 1G51A 2F4VQ 1TWCH 3GTGH 4A3GG 1XMQL 2N3SA 2UUBQ 2BA1A 4A3MG 2K4KA 2ZTEA 2JK8A 1KC8C 1G6PA 2K5NA 1KHIA 3NBHB 1C9OA 2XTIA 3L0OA 1J5EL 2CKZB 4A3CG 1KXLA 3I4NH 5J3BA 1FJGL 1IZ6A 3G4SA 3DM3A 4DV2L 1VQ7A 1E7ZA 4A3FH 2R7ZG 3AFQA 1NMGA 2IHFA 2QA4A 1WOCA 4P73A 4DV3Q 1N33Q 4DR3Q 2JA7H 3RN2A 1Q1BA 5C44H 3TEHB 4QQBX 3BJUA 4DV6Q 2OQ0A 1EIFA 4A3MH 4LF9L 3HFZB 3CXCA 1JE5A 1XTDA 2MNAA 3RN5A 1N34L 2NVQH 3PO3H 4LFBL 3S16H 4A3BG 1X65A 1AE2A 1SE8A 3TS0A 2ATWA 4DR2Q 1FL0A 3KOJA 1VQDA 1KAWA 4K0KQ 3B6YA 1PH4A 4YCVA 4DV1L 1X9NA 3BZCA 4WJ4A 5JJKA 1PV4A 5DLQE 4DAYB 4QY7A 4C3HH 1Q86C 4LWCA 2Y0SE 4LFCQ 2JA7G 2UXCQ 1PVOA 5FLXc 1D7QA 3KF6A 1KIXA 4OO1I 4DAMA 2K52A 3J7A5 5IT9c 4GLVB 4O0AA 1VQGA 4PZ7A 3GTKH 1GD7A 1OXVA 4BBSG 5FLMG 1QUQA 3HOUH 4A3DH 1UEBA 3T1HL 2WAQG 1X3GA 3T1YL 5C4JH 4YWLA 2K50A 5GAHC 4A3JG 5IYCG 1XMOQ 4BA1I 5C4XH 2VQEL 4DV7Q 4LF6L 4B3RQ 4HIMA 4JI4Q 2ZM6L 4XTCS 1E24A 3E9HA 4JI2L 1YHBA 1SMXA 2VY3A 2ZTDA 4DR3L 4LUZA 1R9TH 5C3EG 4IO9A 4A3IH 4LF7Q 4C2MH 4R4QA 2R6GA 4LF4L 4X65Q 3VDYA 3HOWG 1TXYA 4AIMA 2CFMA 2VL6A 2VQFQ 4YHHQ 3F2DA 1KRSA 1SN8A 4JI3Q 2PI2E 4UP7A 5HY6A 3WWVA 1L0WA 5M5YH 2WFWA 3CQZH 4JOIC 1Y1VG 2JA6G 2NZHA 5E7NA 2HT1A 4JBKA 2H5XA 1L1OA 4DR7Q 4PMWA 1X55A 3E9IA 1TWAH 2YTVA 3PSIA 4LFAQ 5IP7H 1WFQA 1N9WA 5BR8Q 4GOPA 3D31A 4DNIA 3EN2A 5BR8L 3I55A 1MJEA 2CCZA 3M4OH 4A3GH 1X56A 2MO0A 2OTJA 1Y1WG 4X64L 2HIVA 3FHWA 4P71A 1Q8KA 5ELNA 2L15A 4JC0A 2RCNA 4HJ7A 4R4IA 3T1HQ 2Q2TA 1NJIC 3S2HH 1XPRA 1K83H 4BBSH 2JE6I 2OQKA 4JI3L 3A5UA 1PH6A 1QVFA 1L2FA 3M3YH 5LMNW 4A3CH 1BKBA 3TS2A 5EAYA 1QZGA 4OWXB 4X64Q 2B63G 1I6HH 1B8AA 2EIFA 4A76A 3UDIA 3PO2G 3I2ZA 3F8TA 3K80C 4WJ3M 4A3BH 1UE5A 4JI0Q 1K8AC 4LF6Q 3U4VA 1UE6A 2DUDA 2NVXH 1IXRA 4IOCA 2K14A 4PZ8A 3UDFA 2NVYH 3CCEA 4C3IH 1A62A 3HOYG 3HKZG 2QGQA 1MJCA 1PH2A 3LGJA 3K0XA 1EOVA 5IP9G 3KDFB 4JI7L 1GKHA 2CWPA 3IRBA 4IPGA 3OTOL 4JG2A 2UUCQ 4AQYL 5C0XJ 4DV0L 4DR6L 5IYBG 1E1TA 3PUZA 1SLJA 1X3EA 4B3TL 4JYAQ 3HOVH 3ULLA 1K3RA 3PUVA 5GAGC 4BBRG 4JI6Q 1X54A 1PH3A 1P16A 3I4NG 4LFCL 4K0KL 4GN3B 3F2CA 4AH6A 4GOPC 1Q7YC 2UXDL 1IBKQ 1HNWL 3CCLA 4DR7L 4BXXG 1PFSA 1EYGA 2PQAB 4JI8Q 5JJLA 3JC66 4IJHA 1K9MC 4B3SL 2GVBA 3A0JA 5IE8A 2NVTH 4A3JH 4LUOA 1JB7A 1TWFH 3W5OA 4YY3Q 4B3MQ 3G48A 1D8LA 1LM0A 1H95A 3HOVG 1LTLA 2AHOB 4KHPQ 1OXXK 4DV0Q 4DR6Q 2WP8J 5C3EH 1A8VA 1P8LA 2JEBI 3J81c 4A3IG 2VNUD 1PHJA 4YY3L 2Q2UA 2R92G 1SR3A 4GNXB 3PCOB 1J6QA 3JAMc 1XPOA 1M1KC 4X62L 3UDGA 1ASZA
chains in the Genus database with same CATH superfamily
2O5IC 3LWUA 2WB1E 4K2KA 4A4IA 2I0QA 3ERSX 1F2LA 3NQTA 3HS0C 1KD1C 4L8JA 2FXQA 2F4IA 1PTOH 2F0GA 1CTMA 2Y0SG 2PW7A 4QUCA 1PA6A 3M9BA 2UXCL 2BDNA 4XYOA 4UP9A 2XIWA 3LX0A 5C0XI 2E8GA 2WIIB 3SHLA 5C44B 2X69A 1JWSD 1SFOB 5LMUL 2V4DA 4KD4A 4AYBG 2JA8G 5M3MH 3FP9A 1AH9A 3PO2B 4GS3A 2VXWA 3ERQA 2A6EC 1E2VA 3ZJYC 1FGUA 1S72A 1I4XA 4H02A 4ZLTF 4HJAA 4MTKA 4J8QA 2PPBC 2XGTA 1YNND 5JOBA 2VQFL 3S15H 1W2BA 4X66Q 1IKMA 3G6EA 2O5JC 2BA0A 1S40A 3RD4A 3K58A 1D2BA 2E2JH 1RODA 2QF7A 3M4YA 4DV1Q 1VS0A 4BXXH 5BN4A 1G291 4X3UA 4L5RC 4DK1A 3AQQA 3H6MA 1EZ8A 3CF5A 3T1YQ 4BA2I 1C0AA 5BN3A 4TQUS 2VUMB 3DEOA 3MVVA 2FJ2A 4A3FB 2NN6I 4UP8A 2D0OA 4DR1Q 2RHQB 5FJ8H 5LMNL 1JB3A 4I65A 1ASYA 2LXJA 1PRTD 1GVPA 4TRDA 1BVSA 2A1AA 2FHTA 3D4RA 1YJNA 1M4VA 1WCMH 4DV4L 1QVCA 1RCVD 4IUVA 1SBBB 4QJFA 4XT3B 4N9PA 2YTYA 4JBJA 3S24A 4A3EH 2D62A 3MZ5A 5EGTA 3T13A 3RLFA 3OTOQ 4R4TA 1Q3LA 3ND9A 3M7NA 1E3PA 2L12A 3MEFA 4A3DB 4KLKA 3KJPA 2BE5D 5CV9A 5JEAG 4LFBQ 4LUVA 1GUNA 1DOLA 5JEAJ 4BY7G 1ZEQX 2R7FA 2CVRA 4GKJQ 4MHEA 5CV4A 1EU3A 5L37A 2TMPA 2QEXA 2DJGC 2ICIA 3S2HB 1KTKA 3EQLC 3CPWA 1VQFA 1LTID 4B3ML 3K5MA 1KL9A 3K5NA 1PFNA 3NEMA 4QB4A 1S5ED 4BS9A 4Q0FA 1L1OC 3OHXC 4P75A 1LYLA 1KDCA 2K7VA 5T1GA 3AMUA 1PTOD 1TWHH 1EQQA 4HIOA 1V8QA 3K7AH 2HHHQ 2B8GA 3CC7A 2NVYB 1HPCA 1SRUA 1STHA 3FRPB 5LMNQ 1IBLQ 1PH5A 2ES2A 4A3IB 2PZWA 3S17H 3Q23A 3S1MH 3SEBA 2KHSA 4LF4Q 1XNRL 4GKJL 2LY7A 1CHPD 2ZXPA 3KDFA 5J22A 1K8MA 2EY6A 3BVGA 3A54A 2CHBD 3L2PA 1T5XD 4IFDG 1B7YB 1GO3E 1RJTA 4X62Q 2DGYA 2SDFA 2KHIA 4DV6L 3I4MG 4DPGA 3OYYA 3V05A 2LXKA 4EQOA 2F0IA 1Q12A 4A3KH 4IFDH 1JCKB 1EY0A 2Q2IA 3H3VI 4B3RL 2B2YA 4ILWA 3DWQA 4K8IA 3H91A 2F4VL 1O78A 5FLXL 3HOZH 4JI1L 5CV8A 2EYPA 3GTQH 1DOMA 4GOPB 2YU9B 2KOLA 3I56A 3KLRA 2I07B 1VQIA 2A69D 3HP3A 3JAMi 4NDXA 3M4QA 2OT2A 3D3RA 5IGEA 4GN5A 5IIFA 2F52A 2VZAA 1VCIA 1KRTA 4DK3C 1IBLL 2E76C 1IL2A 1I50H 3KLSX 1CQFA 1AEXA 3S2DB 2NZ1D 4DU9A 1EY7A 2KCCA 1I3QB 5I6WA 1I4GA 2AWOA 5A2QE 3L7ZC 1SSOA 4LFCQ 4HIDA 3PF4A 1U4LA 4MZ9A 3UE1A 4OGQC 2KCMA 1HRJA 2WKCA 1EIGA 4LF5L 1JOKA 3NWTA 1NE3A 1D1IA 3QJYA 2EVBA 5HURA 1BBUA 4O42A 1STEA 2F1MA 4GKKL 4HJ5A 1AZQA 1A0IA 2ZJRA 5TSSA 1K0RA 3TP5A 3AEVA 2PO4A 4KN7C 3KF8B 2LKVA 1MBYA 1T9HA 4O2DA 5HGQA 3A55A 3I4LA 1PFMA 2RBMA 3K59A 3S1QH 2ZXRA 4V190 4P2CB 4MN3A 3DEPA 2K03A 4NMZA 3RLOA 2SNMA 2JXMB 3GTJH 2Q8TA 2JA9A 4JYAQ 4DR5L 1JJCB 2JJQA 1OO9B 1Z47A 1T5EA 2HDMA 5GADC 1CKNB 5EBDA 1YI2A 2K28A 2ZM6Q 2Z6KA 2VUMG 2NVXB 1BR9A 1II3A 3CP0A 4JW0A 2GVAA 1TIID 4BBRB 1JOQA 4FXGC 2UUBQ 2XRSD 3CKIB 2BDOA 1KHIA 4A3CG 3I4NH 5J3BA 4ZK9B 3G4SA 4KJNA 4K14A 3IL8A 3N6RA 3GTJB 1ENFA 1U4RA 4QQBX 3BJUA 3BYTB 4A3MH 3NHHA 4LFBL 2M00A 3PO3H 1I4RA 1AZPA 3K5LA 4A93B 4A3BG 2F3WA 1HTPA 1VQDA 2K04A 3B6YA 1X9NA 4WJ4A 4XXEA 3KF8A 5DLQE 4QY7A 2UXCQ 1NR4A 5FLXc 4OO1I 2DY8A 4GLVB 1XX8A 1I6VC 3QOJA 2LMCB 1QG7A 5A2QL 4BY7B 4RGNA 4XQNA 3V2TA 5IYCG 1D5XC 1BXTA 3NSWA 3OOCA 1XMOQ 2JA6B 3MXUA 4K5WA 1E24A 3E9HA 4JI2L 2ZTDA 2VY3A 1FR3A 4C56C 4LF7Q 4C2MH 4LF4L 2H1EA 3VDYA 1EOTA 3HOWG 1TXYA 2CFMA 2VL6A 2WV6D 3F2DA 4DXFA 1LABA 1EEFD 2HD3A 4JPBW 2K5QA 3BYYB 1IHZA 2H5XA 3HGBA 4EQNA 1ICWA 4PMWA 5DAUA 4GOPA 1N9WA 2ZT9C 1KNAA 3D31A 5BR8Q 3EN2A 4R9WA 2CCZA 4A3GH 5LL6S 5M3MB 1H9RA 1Y1WG 4P71A 3VYSA 1Q8KA 5ELCA 5ELNA 3CU7A 1XPRA 3FVQA 2FMMA 4BBSH 2OQKA 1HA6A 4CKBA 1QVFA 4A3CH 4A3KB 3S1MB 1QZGA 4X64Q 3D6WA 1I6HH 4A76A 3UDIA 3T51B 1STAA 2RDGA 1BCPD 1TKWB 3SK4A 4I7ZC 3GTGB 3HOYB 1BNZA 2NVTB 2Q8RE 4BWGB 1PRTC 2DUDA 2K14A 1I4HA 3UDFA 2NVYH 1A62A 1QJOA 1S5CD 2EPBA 3KDFB 2MGSA 2NYZD 3IRBA 3OTOL 4ABNA 4AQYL 1D1KA 3PUZA 3IAYA 1SLJA 3P75A 3PUVA 4JI6Q 4F87A 1P16A 4LFCL 2B2TC 2J0TD 3M4OB 5JJLA 1B3QA 5JVH3 4B3SL 2GVBA 2G5DA 5M9OA 3A8KE 5FO8B 5M5WB 1D8LA 1LM0A 4YIJA 4UHVA 5M5YB 4DR6Q 4Q5VA 1P8LA 2VNUD 2Y0SB 3KBXA 1AW7A 1SR3A 1UEAB 3FPUB 4H7BA 1J6QA 5ELBA 4K2LA 1BQQT 3S1RH 1K28A 3UDGA 1CSPA 4ULLA 4A3LG 3X3MA 4LF9Q 2B2WA 3UDXA 1DXMA 4NP5A 3MHBA 2ZJPA 2JA8H 1TY0A 4OIKA 2QCPX 2Z4IA 4CDFC 1E1OA 5M5XH 5JPNC 1BF4A 3I72A 3DM1A 3GO5A 2IT1A 2IX3A 1EWHA 5CV6A 1S5BD 3QIAA 3CD6A 1V43A 4QUFA 1K8OA 4RWSC 5CYUA 4GZYC 2VW9A 1WD0A 1HHVA 1Z6HA 2JEAI 1TU2B 1CT1D 4C3IB 2AKWB 3I3CA 2D0PA 3P20A 1LTTD 2B3GA 1GUOA 3FKIG 1A2UA 2E2IH 3PUWA 1N8RC 3QB3A 2CW0C 4OONA 1CZGA 4X3KA 2UUBL 1WTVA 2K1BA 5IYDH 4GN4B 4C3JG 5AJ3L 1HNZQ 1KDAA 4CKEA 3I70A 1IW7D 2HHHL 3GTQB 4JV5L 4HMJA 3VR6A 2YU9H 1PRTF 4JYAL 1YZ6A 3GD7A 5ELFA 1ILQA 3GTLH 3KFUA 1E22A 4B3TQ 5E1FA 1LLRD 4KY6A 3ICEA 1LO5D 3CQZB 1MHWC 1PDQA 3CCMA 4EQPA 3KJOA 2K6AA 4DV4Q 4NB3A 5M3FH 3X3NA 3AFPA 3QWNA 4GLXA 4A3LH 3PIP3 3HOZB 4Y7NH 5AJ3Q 4MTNA 2QW7A 1E0BA 2M9VA 3TQYA 5CGKA 4JBWA 1OXUA 1A15A 2ZTCA 1VQ6A 1SFOH 4BY1G 4U68A 1VQ8A 4JCVE 4ZQ3A 1L1OB 3J80c 1S5DD 1TWGB 4PNYA 3W1GA 4PMCA 1HH2P 2NZOA 1LT5D 1U5KA 3PO3G 2CWAA 4IUTA 2N55A 1OXSC 3NTKA 4HJ8A 4DR4Q 4HSPA 4NXML 1Q81C 4BBSB 1VQLA 2L1BA 3HRZC 4Y7NB 1LV9A 4G57A 3FKIH 2NTTA 2E2DC 3TRZA 1VQ9A 1EYCA 1J9OA 2K5HA 1WTQA 2X6GA 1W6JA 1VQNA 2RF4A 4C3JH 1PFBA 1TWGH 1FVIA 2R92H 1NY4A 2XN9C 4UPAA 2E2HH 1TS5A 1TWFB 3KYHC 5D3IB 2HQEA 3ULJA 3E6ZX 4RHRA 5EJWA 2QDBA 1NMFA 2KA7A 4C2MB 3I4MH 3Q24A 4KN4C 3FMCA 2PYKA 1FYCA 2DJFC 4FYDA 4OO1H 2ALYB 2NVQB 1RTOA 1E2WA 4R4OA 4B9WA 3IKJA 4KTAA 4PG3A 2QKIC 2VB3X 1WTPA 5I2YA 1WYDA 1IKLA 4OX9Q 2A19A 3OIQA 4DR5Q 1HNWQ 4NXNQ 3J7ZC 3TZDA 3EIVA 4YHHL 1WTHA 3I7FA 4OL7A 2MHVA 3GTLB 2AMCB 4X65L 1SYFA 3AYHB 3OW7A 4DR4L 1N32Q 3HOVB 1S3OA 1U0LA 4XQQA 5K5PA 1VQBA 4C3JB 3TSSA 1NTGA 2A6HD 3TBIB 1VQ4A 5IYDG 3C3LA 1Q46A 1GM5A 2P5ZX 1H9SA 1X3FA 3HOUG 2A5HA 3URYA 3NP8A 3I4NB 1I94Q 4IPCA 2MPMA 3FKIB 2B8FA 2HIXA 1EQRA 5JJZA 4LJZC 1DM0B 2IY5B 1FJGQ 1YEZA 3H0GH 2BOSA 2F0FA 2E75C 1STGA 1SNQA 3S1NH 2B2VC 1DONA 2GN5A 4QL5A 1HNXL 1GJXA 1RIPA 3F1ZA 3HOXG 2JA5H 3STBD 2XSCA 4OELB 5I4DA 1Y1VH 1ML0D 2OWOA 2PMZE 3I73A 2UUAQ 4L5TA 1TY2A 2KCNA 3W2DA 1EWIA 4APVA 1EU4A 2B2YC 3CPFA 3HOZG 2ZXOA 2R7DA 2NBFA 4OO1G 4QGUA 2N8NA 4F8MA 3A74A 1PTOB 4CJ1B 1B4OA 3CCQA 3PIO3 4LW1A 1VMCA 3HKSA 1A2TA 3OW2A 2DNCA 3RZDH 1AE3A 4YCUA 3RNUA 1SE4A 1SAPA 3I91A 3HOYH 5FK9C 3VYUA 1LACA 3A5ZB 3DLLA 1B70B 1MSHA 1BBWA 4FF1A 4B3SQ 1SNDA 4B08A 1UE1A 1G51A 5C5MA 1TWCH 4A3JB 3GTGH 1AFPA 2WAQB 2JK8A 2ZTEA 2K5NA 4QF4A 1J5EL 4HEDA 2XTIA 1FJGL 4DAVA 1PZKD 1IZ6A 3DM3A 1VQ7A 3AFQA 1ONLA 1NMGA 3OPOA 2QA4A 1WOCA 4P73A 4DV3Q 1N33Q 4DR3Q 2JA7H 1EY6A 1Q1BA 3TEHB 2OQ0A 3CXCA 1XTDA 1N34L 3BZDB 2JA5B 3S16H 1X65A 3DMUA 1SE8A 2DN8A 2Z9HA 3G6JB 4DV1L 4R8IA 1A3VA 1BCPC 1WVLA 1Q86C 1PV4A 1B9MA 2JA7G 1PVOA 2M2LA 3JAML 3KF6A 1KIXA 4EGVA 1F9SA 5CR3A 1VQGA 4PZ7A 3NBIA 4BBSG 4A3DH 1QUQA 1UEBA 1U4MA 1X3GA 4A3GB 2K50A 1V1PA 2B2UC 3CHBD 3M7GA 4LF6L 1RDPD 5C3WA 2VQEL 4DV7Q 2EYHA 4A3MB 4B3RQ 5JPMC 4MIUA 3C1FA 1F2ZA 1SMXA 4DR3L 2OXPA 1R9TH 5C3EG 4IO9A 1TVXA 3ZYYX 3VA7A 4X65Q 4KKUA 4XDXA 1LTAD 1UAPA 3NQIA 5I6YA 3C1EA 4S3SA 5M5YH 2WFWA 3J7YW 1Y1VG 1QILA 3RZOB 2JA6G 2NZHA 5E7NA 3J81L 2HT1A 4V0BA 3SR1A 4KMUC 1GOZA 1QE6A 2YTVA 2B2TA 5IP7H 5KGUA 5DM73 4TKOB 4ZUJA 5BR8L 3M4OH 4KJOA 1X56A 2OTJA 1JQYD 1STNA 1SYGA 3U9SA 2A6HC 1UUPA 1Q8IA 2RCNA 5CV7A 4R4IA 1NJIC 4DNTB 3S2HH 1PH6A 1MI2A 2I46A 1MGSA 5LMNW 2QILA 1BKBA 4ZYSA 4KK7A 2B63G 3EFXD 1HTLD 2RSNA 2EY1A 2KJXA 4JI0Q 3U4VA 2NVXH 4IOCA 3QR8A 3CCEA 3HKZG 2QGQA 4K5XA 4M1UB 1EOVA 4OEMB 3E3XA 5IP9G 4JI7L 1GKHA 2K5DA 3Q6SA 3S1QB 4K8JA 4DV0L 1X3EA 4B3TL 3HOVH 1XTCD 3HOUB 4KKSA 1K3RA 5GAGC 4BBRG 1X54A 5ELEA 4GN3B 1Q7YC 4AH6A 4GOPC 2UXDL 1HNWL 4C3IG 2R61A 1PFSA 2PQAB 4JI8Q 4E6IA 4IJHA 1K9MC 1R9TB 3A0JA 2EJMA 5IE8A 2NVTH 1JB7A 1WTRA 4NW2A 4X3SA 2FFKB 3W5OA 3G48A 1RF2D 5I9OA 4KHPQ 1NSNS 1OXXK 2WP8J 1B53A 4A3IG 1A8VA 2JEBI 4CKCA 4YY3L 2Z6BA 2Q2UA 1BO0A 2G9HD 5EPKA 3RUZA 1ENCA 4GNXB 3QG1A 1M1KC 5C4ZA 1F9QA 2F0DA 3U50C 2F3IA 3K81C 4NKLA 1I50B 1CQVA 5CBAE 2D2CC 2F0TA 4FXKC 2A73B 1L0YB 1EYDA 4RKBA 4HTHA 4JK1C 1X6OA 5D65A 2YV5A 3GDEA 4G7ZC 1JR0D 2F0NA 1HJPA 4R1JA 1YHAA 1VQMA 4CJ2C 1HZAA 4KHVA 2WB1G 3DHQA 5E4WC 1DGSA 1NBWA 1QCBD 4KHZA 4HAEA 4GNXA 4HSVA 5ISRA 2MJ8A 3S2DH 2L11A 1C48A 3F2BA 4A3DG 2UXBL 2JA6H 1XMOL 3KLWA 2D9UA 2L0CA 1EEID 3I90A 2N88A 1KLGD 3S17B 4RA8A 1B3AA 3PUYA 3FEWX 3NWSA 3E0EA 2PMZB 1LT4D 1EIYB 4GLAC 2PQAA 2BH8A 3EVQA 1XJVA 3A7LA 4DXGA 1YNNC 3BU2A 4WORA 4OWWB 5I2XA 4MNOA 3PO3B 1UE7A 1X3PA 4FDBA 1TWHB 3DUZA 5EPLA 3CRKC 4FP5D 5IWAQ 3SGIA 4GKKQ 1NNXA 1XPUA 2F03A 1D5MC 4L5SA 1Y1VB 2ENBA 3C46A 4A3KG 5I9PA 1ZYRC 1SNOA 3AB9A 2MUYA 2L4NA 1OTCA 2I5LX 4DV2Q 3WOEA 4DK6C 5EPJA 5KNCA 3NPPA 2KENA 1JWMD 5IP9H 2Q2HA 2IWHA 1YNJD 5CMDA 1EQVA 4DN4M 4QIWB 4ZUIA 1LTSD 4JV5Q 1X32A 2B63H 4BBRH 2RDHA 5LL6X 2CH4W 4RGMA 2F0OA 5T1IA 5FJ8G 5C3XA 4EX5A 3U4ZA 1S4ZA 1B1ZA 1EZ6A 3J80E 1PMRA 1V1QA 3CAMA 4P74A 3J80i 5GAEC 1OXTA 2F0PA 2F0LA 2R7ZH 3TP7A 5C4JB 2Z1CA 1JJ2A 4A93G 3CCVA 1EIHA 3OIPA 3S1NB 1Y14B 3K6OA 4IOAA 2VQEQ 4DV7L 4RGTA 3D6CA 3KK7A 5M3FG 3PUXA 3EA6A 3QO2A 2B2UA 5COYA 1EQTA 3K7UC 1XNQQ 1LT3D 2NN6H 1J8IA 3H94A 2EJFC 3SK5A 1XNRQ 1DZ1A 1I94L 4TSSA 3TMEA 1RHPA 4EQ5A 2XVSA 4JOIA 1EYAA 1KAAA 2ZJQA 3I4OA 3VA5A 4LF5Q 2A68D 2J7ZA 4G7HC 4JI8L 3M4PA 2WAQE 4G7OC 4H0LC 5KIXA 3HZXA 3PIOA 2MFIA 2F0EA 3T4AC 4A3BB 4C1NK 1VF7A 4LFAL 1O7IA 3TN2A 2MO1A 4AYBB 2JA8B 1SROA 5G3LF 3A56A 4WJWA 3GV3A 3PGZA 2XRQD 1HR0L 4BY1H 1G8ZD 1AN8A 2LS01 4N8X1 3GTMB 3M3YB 4LF7L 2IPKD 1TQOA 5C6AA 5HGTA 2R93G 3Q0AA 1H9KA 4DR2L 1NCVA 4IUUA 5IP7G 1LTGD 3BVZA 1SNCA 4X66L 3J81E 4ZRZA 3DWPA 2E2HB 1XYIA 4YWKA 1HZBA 2RQXA 3SXHA 2JYOA 3MFGA 1A3UA 3V96A 2PZTA 3U9OA 3MEHA 4DUYL 1EFWA 1I5FA 1CHQD 1QVGA 1GUWA 4FXDA 4XYQA 4HMIA 5C4XB 2E5LQ 3PO2H 2IJ0A 1JJGA 1BCPB 1G2TA 5JAVA 1RL2A 2CH4A 3D0FA 1YVCA 2HDLA 2AWNA 2O2LD 1JOOA 1M90C 5FLMH 4DV3L 1N33L 1B2TA 5C5LA 3WDNA 1YJWA 3RLNA 4HCSA 3H3VH 3GTOH 3GTKB 1EL0A 1LT6D 3LWEA 1CZWA 1KLUD 3VR3A 4A3EG 3P1HA 2KBNA 4JBMA 4JI1Q 1Y1WH 2BE5C 1SYCA 3IFTA 1X3QA 4POFA 3S14H 2EQSA 2MQHA 1TS4A 1VQOA 2L55A 2I5MX 1EY4A 4RFBA 5ELOA 1QZHA 4A93H 4F7XA 5IT9L 2EY2A 4DUYQ 2F0MA 3GP7A 5M3FB 4AYBE 3FPPA 1ESRA 5IGCA 4A75A 5K36G 1EFID 1W6KA 4LF8L 1VQPA 5DNFA 1F2MA 1HQMC 4ZKCB 4DKAC 1CI3M 1VQHA 1TT2A 5EKLA 1YBYA 2EYFA 3GTPB 3EJIA 3NTIA 4JI0L 2UXBQ 4DAYA 4RHSA 4GNXC 1SYDA 1HNXQ 4IUNA 3MXNB 2ICEC 2OTLA 5C4XG 1EWCA 2BH2A 1HR0W 4HCEA 1SXTA 2KEDA 1H9SB 1HUMA 1CA6A 4KV6A 1BDOA 2KCTA 4IFDJ 1RD9D 3NENA 5EKKA 4Y52H 1DD2A 5J1ZA 5IWAL 1JMCA 3H09A 3CMEA 2KHJA 1PTOF 3ER0A 3HOXH 2B2VA 4JI4L 1I3QH 3NBHA 3UE0A 4HIKA 4X6AH 4FF4A 1PZJD 5IGDA 1XMQL 1DJRD 1D6EC 2BA1A 4A3MG 1DOKA 2K4KA 1G6PA 4CDEC 1HXYD 3NBHB 3L0OA 1HQRD 1KXLA 2CKZB 3D4DA 4J6HA 5A35A 4DV2L 3HKZB 4IZ8A 5IODA 4A3FH 4CJ0B 3MFYA 4Z9CB 5KEEA 5KNDA 3AU7A 2C5CA 4RH6A 4UAIA 4DV6Q 1EIFA 1Y8PB 4OIJA 3HFZB 1JE5A 2MNAA 2NVQH 2B63B 5D14A 1WCMB 3TS0A 2ATWA 1FL0A 4C1NI 1KAWA 4K0KQ 3MXNA 1PH4A 3R2TA 3BS1A 1GUGA 4ME5A 1FNVA 4DAYB 1IL8A 1D7QA 2WB1B 2KUMA 2K52A 2A69C 4KD3A 3GTKH 1IW7C 1GD7A 1OXVA 5FLMG 3TZUA 4R8NA 3T1HL 2PCFB 1RKNA 3T1YL 3K5OA 3IFDA 4YWLA 3BDOA 4IN3A 1SMYC 2PQEA 2HCCA 1YHBA 2HCIA 4LUZA 2RA4A 3TDQA 3G7LA 5CBEE 5EBCA 2AQ1B 4C3HB 2EZVA 4AIMA 2VQFQ 2SNSA 3HG9A 5D3DA 1FD7D 4PQXA 4YHHQ 1KRSA 1SN8A 4JI3Q 2PI2E 4UP7A 5HY6A 3WWVA 3GTOB 2NWGA 4RAUC 5DEHA 4JOIC 5E4XA 1I6HB 2RVLA 4JBKA 2RCFA 1L1OA 2K32A 4DR7Q 2EDGA 3C2PA 4LFAQ 3E9IA 3PSIA 4UY8C 4DNIA 3I55A 2K05A 4J1MA 4DAPA 2IW3A 4X64L 2HIVA 2L5TA 4FNFA 2L15A 4JC0A 3K0YA 4HJ7A 3T1HQ 2Q2TA 2BCOA 3D8GA 1K83H 1C8CA 3A5UA 3OSOA 2F0HA 3UI2A 3M3YH 3BG3A 1ZYRD 3TS2A 1K0SA 1VF5C 2O4XA 5EAYA 1CA5A 4N8FA 5C4HA 5KRUA 4IQZA 3K80C 1GXDC 1UE5A 3MC0B 3WOFA 5BN5A 1K8AC 2F0JA 4LF6Q 4CDDC 1FGBD 1UE6A 1EY5A 3NK9A 1O7YA 2EE1A 3LGJA 2G9DA 3J7AF 1D5ZC 2CWPA 4IPGA 3I8ZA 1H9JA 4DFAA 1C4QA 2SOBA 3I4NG 1AP0A 4K0KL 3F2CA 3MAQA 5ELDA 4RGOS 3BVMA 4BXXG 1F77A 3JC66 3DXJC 1HUNA 2F0VA 4LUOA 2DY7A 4B3MQ 1H95A 4O1NA 3HOVG 1PTOC 4DV0Q 1SDFA 2KQ3A 3DWAA 2H4OA 4ZAIA 2NUCA 2R92G 4N9TA 3PCOB 3JAMc 1XPOA 5CV5A 4X62L 4CBVA 2A68C 1XMQQ 1Z7TA 2C9OA 2EY5A 3W3AA 3A8IE 3MTSA 4RCOA 3MWYW 2UXDQ 1Z9FA 1WJJA 2EXDA 4L6TB 1RTNA 5IYBH 1GHJA 2EYLA 4KHPL 1JWUD 5JVG3 2XWJB 4K6DA 3CMAA 4JI7Q 4RG1A 1HCZA 1QOHA 4NXNL 1J5EQ 1STYA 2GA4B 3QOLA 3GTPH 2F0QA 2ID0A 1B50A 4WFN3 3R93A 1VQEA 1K8GA 1Q1EA 4NPSA 1KDBA 2OEOA 3RR5A 2K33A 4XQJA 3MXGA 3K8AA 3NE5B 2SEBD 5AFWA 1IBMQ 2AQ3B 4LNQA 2UU9L 1MSGA 4DR1L 3NTHA 5M5XB 2F0SA 1O7LA 4CHTB 4JI5L 2R7ZB 2LSSA 3NELA 4ID6A 1B44D 5M3MG 1Y1WB 1VQJA 1C7YA 3T53B 4IURA 4PV1C 2ASBA 3VYRA 1XNQL 3STBC 3CC4A 1QB5D 1V1OA 5EKIA 2Z8LA 2V1CC 5IGBA 1WTWA 1HNZL 3CCJA 1PH1A 1N34Q 1YIJA 4DUZQ 1BOSA 1ENAA 4X3TA 1XXGA 2LFNA 1IYJB 2A8VA 5IOCA 2OCEA 4K5VA 4LAAA 1YJ9A 1H9MA 5C3EB 2XNAC 3BDLA 3HOWB 2AQ2B 1BUVT 2VS1A 1IBML 2FMCA 1DCZA 2IL8A 2JQOA 3CCRA 1PH7A 4JI2Q 2DNEA 1F9RA 1SYBA 2PNHA 1ET9A 3D4WA 4QIWE 1HZ9A 1PZID 5LMUQ 2JP1A 3E0JA 2A6ED 3HKZE 4FVMA 4KI0A 3NUCA 5C0XG 1U9RA 1IBKL 1CKMA 1N36Q 1Y8OB 5GQOA 4DF7A 4JI6L 1W3SA 4POGA 2UUAL 2UUCL 1VDZA 3G71A 3GTMH 4A3FG 3FDTA 4XIGS 2JA5G 1MIUA 5H1SE 1NAPA 5C0XH 4DUZL 1Y69U 1L0XB 4RMFA 4OXPA 5FLXE 5IGGA 1KQSA 1CFMA 2E5LL 3U58A 3SK8A 1TWCB 3W1BA 2R93H 3A8JE 4YWMA 3M85A 3A7AB 4H13C 5FOBB 2E2IB 2QEJC 1F9PA 1U4PA 1HZCA 1XWEA 4ME3A 1PH8A 2PW5A 2RDFA 2RHSB 1B9NA 1SMYD 5E3FA 4LF8Q 4U673 2JA7B 1PYBA 4L5QA 1N36L 1O7ZA 4DV5L 4OX9L 1GUSA 2K5VA 1ESFA 1UNSA 3H15A 2NN6G 1CKOA 3F2UA 4BY7H 5EQ0A 1LUZA 4DK0A 2Z0SA 4CDCC 1VQ5A 1TWAB 5IYCH 4ODGA 1SEBD 1UWVA 1PYSB 1DYQA 1KNEA 1PH9A 1JE4A 4HR7B 4PMBA 5C44G 4IUPA 4WRDA 2D5DA 1HR0Q 1VQAA 2YTXA 3HOWH 1S5FD 5J39A 3ONAB 1EUJA 3NXWA 3RZDB 4IALA 4NXMQ 2N49A 3S1RB 5G3LD 2PI2A 2XWBB 3EBEA 3VYTA 3CC2A 2F0KA 4QCLA 3ND8A 4IPDA 5IT9E 3MA2B 1E2ZA 1WTOA 5M5WH 1A3TA 2KEEA 4IPHA 4KY7A 4IJLA 1N32L 2EYJA 1YNXA 4KY5A 4ALPA 1HFNA 3RZOH 3S9WA 5DM63 1JICA 3H3VC 3PF5A 1CK1A 3CW2C 1CKNA 1QNUA 4G4KA 1IYVA 3ULPA 5JEAH 5CORA 2N78A 4ZCKA 4DV5Q 5IGFA 4YCWA 1JT8A 1SJED 4R4CA 4TVAB 4KKTA 1QNKA 4JI5Q 1CM9A 3GQBA 3H0GB 5K36H 2B29A 1Q82C 3SK6A 1K73C 3J81i 1CSQA 1EY8A 3HOXB 3HEJA 1R4PB 1MKHA 2Z6KC 2CQOA 2F0WA 4PZ6A 1A63A 4EVOA 4OWTB 2B2WC 4RKLA 5KYLA 3TREA 3S16B 5FO9B 3Q22A 3SVMA 1VQCA 4FF2A 3BZKA 1V1PB 3L3OC 3H0GG 1FNUA 3SE0A 2HQLA 1QUQB 2CW0D 2I5HA 2K01A 2IX1A 4IFDI 2EXZA 1V9PA 1F2YA 3CCSA 2C35B 3KF6B 2UU9Q 5GROA 1SE3A 3CRLC 2EYMA 2IHEA 1YHQA 3KUPA 4J15A 1VQKA 3J81j 3ITPA 2R93B 2VUMH 3Q8DA 5IY0A 2YYZA 3PV0A 1CUKA 2JSOA 4AQYQ 2K75A 1BBXC 1KABA 3E5SA 3CCUA 3VR4A 2Z4HA 2IX0A 1WI5A 4P72A 5NUCA 4ZKBB 1NUCA 4HJ9A 3S15B 1WCMG 3R2IA 3P7JA 5CC4A 1GUTA 3PIPA 1YITA 5JJIA 2F4VQ 2K5WA 3VR5A 1O80A 2RKSA 3OWFA 4A3GG 2N3SA 4F88A 3OMGA 1MD2D 4DNRB 4B9XA 1KC8C 1ICFB 1C9OA 2QDLA 3TP8A 4DA2A 2FINB 1E7ZA 2R7ZG 2EOTA 2IHFA 1G91A 1PRTB 3BDCA 3RN2A 3MXPA 5C44H 1GHKA 1ZKOA 2NTSA 2X6LA 2A74C 5F2DA 1JORA 4LF9L 3RN5A 1SE2A 1TS2A 4DGZA 1TR5A 2EJGC 1PXUA 5FKAC 1SJHD 1AE2A 2WACA 4DR2Q 3KOJA 4H44C 2KECA 1IYUA 3OWEB 3TP6A 4YCVA 2VB2X 3BZCA 2L9HA 5JJKA 2F3VA 1QWYA 4LMQD 5KYIA 4C3HH 4LWCA 2Y0SE 2EYOA 4M8AA 1Q90A 4DAMA 3J7A5 5IT9c 2KVMA 5FO7B 1ZXTA 4O0AA 3HOUH 3T56B 2WAQG 3K7AB 5C4JH 4OHJA 5GAHC 4A3JG 4BA1I 5C4XH 1A6XA 2HUGA 4HIMA 4JI4Q 2ZM6L 3R3OA 4XTCS 1G2SA 2E74C 3OMCA 4RCNA 1R4QB 4A3IH 3R8BA 4BY1B 3L9AX 2R6GA 4R4QA 1SNPA 3PQIA 1VMPA 1L0WA 3CQZH 4I7AA 2JN4A 1WTXA 2WKDA 1ET6A 1TWAH 1X55A 4LK1C 1EY9A 1WFQA 1MJEA 1NR2A 1LTBD 2B39A 2MO0A 4L63B 3FHWA 3KBGA 2PNRC 4A3EB 2JE6I 4JI3L 2F0UA 1I4QA 1L2FA 3T16A 3PMFA 4QMGA 1WD1A 1M8AA 2R3ZA 3RMHA 1SYEA 4OWXB 1B8AA 4UDUC 2EIFA 1I4PA 1HA5A 1LTRD 3PO2G 3I2ZA 3F8TA 1PLFA 4WJ3M 4A3BH 1SNMA 4FF3A 2AUKA 1TS3A 2OF1A 1IXRA 3SDZA 4PZ8A 2J4XA 4C3IH 3HOYG 1PH2A 1MJCA 3K0XA 1Y8NB 3LNNA 1HFGA 1STBA 1BCPF 4JG2A 2UUCQ 2Q8IB 2CQAA 3EROA 5C0XJ 4DR6L 5IYBG 1E1TA 1K83B 1K3BC 2RSOA 3I4MB 3ULLA 3GV6A 3KLSA 5LHY1 2PZUA 1PH3A 2AUJD 2NB0A 4CGYB 4JVZA 1IBKQ 4HN7A 3CCLA 5KNBA 1YNJC 4DR7L 2E2JB 1EYGA 4XT1B 4K6LA 2R92B 1G6ZA 4A3JH 1TWFH 1ILPA 2WINB 4YY3Q 3J7AV 3K57A 4FO2A 1LTLA 2AHOB 3VR2A 3JAME 3O13A 3J80L 5C3EH 3J81c 2TSSA 1PHJA 1JC7A 2MP1A 4IUQA 1PYWD 4C3HG 3N52A 3S14B 1FNWA 1ASZA
chains in the Genus database with same CATH topology
3U50C 1XMQQ 2F3IA 3K81C 1CSPA 2WB1E 4A4IA 4A3LG 2I0QA 3ERSX 4LF9Q 2UXDQ 1Z9FA 1WJJA 3UDXA 1KD1C 2ZJPA 2EXDA 2JA8H 2FXQA 1E1OA 5M5XH 5IYBH 1X6OA 2Y0SG 4KHPL 2YV5A 1PA6A 3M9BA 3GDEA 3CMAA 2UXCL 4JI7Q 4RG1A 4UP9A 1HJPA 4R1JA 1YHAA 3GO5A 2IT1A 5C0XI 4NXNL 1VQMA 1J5EQ 2E8GA 1HZAA 3GTPH 2WB1G 2ID0A 3CD6A 1DGSA 1V43A 4UY8C 1NBWA 5LMUL 4KHZA 4GNXA 1VQEA 1K8GA 1Q1EA 2VW9A 4NPSA 4AYBG 2JA8G 3S2DH 5M3MH 3FP9A 3RR5A 2JEAI 1AH9A 3F2BA 4A3DG 2UXBL 4GS3A 3K8AA 2AKWB 1XMOL 2D0PA 1IBMQ 2JA6H 3KLWA 2B3GA 4LNQA 2UU9L 3FKIG 3ZJYC 4DR1L 1FGUA 1S72A 2E2IH 4H02A 4HJAA 3PUYA 3PUWA 2XGTA 1N8RC 3E0EA 4OONA 2VQFL 3S15H 1EIYB 4GLAC 4X66Q 2PQAA 2BH8A 4JI5L 3G6EA 2LSSA 2BA0A 1W2BA 1XJVA 2UUBL 1S40A 3NELA 5IYDH 4GN4B 1HNZQ 5AJ3L 5M3MG 1VQJA 3BU2A 2E2JH 4OWWB 4DV1Q 1C7YA 1VS0A 4MNOA 2ASBA 4BXXH 1XNQL 1UE7A 3STBC 1G291 4FDBA 2HHHL 3CC4A 4L5RC 2V1CC 1HNZL 3AQQA 4JV5L 3CCJA 1PH1A 5IWAQ 3CF5A 3SGIA 3T1YQ 1YIJA 1N34Q 1XPUA 2YU9H 4BA2I 4GKKQ 1C0AA 4DUZQ 4L5SA 4TQUS 4JYAL 1YZ6A 1IYJB 3GD7A 2A8VA 4A3KG 3GTLH 2OCEA 1YJ9A 3KFUA 1E22A 2NN6I 4UP8A 2D0OA 4B3TQ 4DR1Q 2RHQB 5FJ8H 5LMNL 1OTCA 2I5LX 4DV2Q 2VS1A 3ICEA 1ASYA 2LXJA 1IBML 4DK6C 2JQOA 3CCRA 2KENA 4JI2Q 1PH7A 5IP9H 1GVPA 2Q2HA 1BVSA 2PNHA 2A1AA 3CCMA 3KJOA 1YJNA 1WCMH 1HZ9A 4QIWE 4DV4L 5LMUQ 1QVCA 4JV5Q 4DV4Q 3HKZE 4KI0A 5C0XG 4NB3A 4QJFA 1IBKL 5M3FH 1CKMA 2YTYA 3AFPA 4BBRH 4GLXA 4JBJA 1N36Q 5GQOA 2B63H 3S24A 4A3LH 4A3EH 5FJ8G 4JI6L 2D62A 4Y7NH 5AJ3Q 4EX5A 1W3SA 4MTNA 3TQYA 4POGA 3U4ZA 4JBWA 3RLFA 1V1QA 4P74A 3CAMA 3J80i 1OXUA 5GAEC 2UUAL 3OTOQ 2UUCL 1OXTA 4R4TA 3G71A 2ZTCA 3GTMH 4A3FG 1VQ6A 1SFOH 2R7ZH 4XIGS 4BY1G 1JJ2A 2JA5G 3CCVA 1MIUA 5H1SE 1VQ8A 4JCVE 1Y14B 4DUZL 3M7NA 1E3PA 1L1OB 3MEFA 4RMFA 3J80c 4OXPA 2VQEQ 4KLKA 4DV7L 3KJPA 4IOAA 1KQSA 3W1GA 5M3FG 2E5LL 3PUXA 1HH2P 5JEAG 2NZOA 3U58A 1U5KA 4LFBQ 4LUVA 3K7UC 3W1BA 2R93H 3PO3G 1XNQQ 2CWAA 4YWMA 5JEAJ 3M85A 4BY7G 1OXSC 2R7FA 4A93G 4GKJQ 4HJ8A 4DR4Q 4NXML 1XNRQ 1Q81C 1VQLA 2QEXA 1I94L 1HZCA 3CPWA 4ME3A 1VQFA 1PH8A 4B3ML 2RHSB 1KL9A 4EQ5A 3FKIH 4JOIA 3TRZA 2ZJQA 3NEMA 1VQ9A 4LF8Q 1PYBA 3I4OA 4L5QA 1N36L 2K5HA 4DV5L 4LF5Q 4OX9L 1L1OC 4P75A 1LYLA 2K5VA 4JI8L 3M4PA 2WAQE 3H15A 3PIOA 1TWHH 2NN6G 1VQNA 2MFIA 4HIOA 1EQQA 1CKOA 2RF4A 3K7AH 2HHHQ 4BY7H 1LUZA 3CC7A 2Z0SA 1TWGH 4C3JH 1FVIA 1VQ5A 5IYCH 4LFAL 2R92H 1NY4A 2E2HH 4UPAA 1O7IA 1UWVA 1SRUA 1PYSB 3KYHC 2MO1A 1PH9A 1SROA 3ULJA 5LMNQ 5C44G 1IBLQ 3PGZA 1PH5A 2ES2A 1NMFA 1HR0L 4BY1H 1HR0Q 1VQAA 2YTXA 3HOWH 3I4MH 3S17H 3S1MH 4LF4Q 1EUJA 4LF7L 4NXMQ 2N49A 1XNRL 4GKJL 2PI2A 2ALYB 2R93G 3KDFA 3EBEA 3CC2A 4DR2L 3L2PA 5IP7G 4R4OA 4IFDG 1B7YB 1GO3E 4IPDA 4PG3A 4X66L 4X62Q 4OX9Q 2DGYA 1WYDA 1HNWQ 2A19A 4DR5Q 2KHIA 5M5WH 4DV6L 3I4MG 4NXNQ 4DPGA 3J7ZC 4IPHA 1HZBA 4YWKA 4IJLA 3EIVA 1N32L 3OYYA 4YHHL 3I7FA 1YNXA 2LXKA 2AMCB 4ALPA 4X65L 3AYHB 3RZOH 4DR4L 4DUYL 1N32Q 1EFWA 1Q12A 1I5FA 3PF5A 4A3KH 3CW2C 2Q2IA 1CKNA 1QVGA 3H3VI 1S3OA 1U0LA 3ULPA 4B3RL 1VQBA 2E5LQ 3PO2H 1JJGA 1NTGA 2F4VL 2N78A 1VQ4A 1RL2A 4DV5Q 5IYDG 3HOZH 4JI1L 3D0FA 1Q46A 1YVCA 4YCWA 3GTQH 2AWNA 1M90C 1GM5A 1JT8A 1X3FA 5FLMH 4GOPB 3HOUG 4DV3L 4R4CA 4TVAB 1N33L 3I56A 1I94Q 1YJWA 4IPCA 1VQIA 4JI5Q 3RLNA 3JAMi 2HIXA 3H3VH 1EQRA 3GTOH 3M4QA 4GN5A 2F52A 2IY5B 2VZAA 1FJGQ 4A3EG 2B29A 1VCIA 1Q82C 1YEZA 3H0GH 2KBNA 1K73C 1KRTA 4JI1Q 4DK3C 3J81i 1Y1WH 1IBLL 4JBMA 1IL2A 1I50H 1CSQA 4POFA 3S1NH 3S14H 2EQSA 2MQHA 1MKHA 1VQOA 2I5MX 2Z6KC 2CQOA 2AWOA 4PZ6A 2GN5A 3L7ZC 4QL5A 1HNXL 1A63A 1RIPA 3F1ZA 5ELOA 3HOXG 3S1RH 3STBD 4HIDA 1QZHA 4OWTB 2JA5H 3PF4A 4A93H 4MZ9A 1Y1VH 3TREA 4DUYQ 2OWOA 1VQCA 2PMZE 2KCMA 3UE1A 3BZKA 4AYBE 2UUAQ 4L5TA 4LF5L 4A75A 3H0GG 5K36G 1NE3A 4LF8L 2HQLA 1QUQB 2I5HA 1VQPA 2IX1A 4IFDI 1V9PA 1BBUA 1EWIA 4DKAC 3CCSA 4APVA 2C35B 4GKKL 1VQHA 3KF6B 4HJ5A 2UU9Q 1YBYA 5GROA 3CPFA 1A0IA 2IHEA 2ZJRA 1YHQA 1K0RA 3AEVA 3HOZG 4JI0L 2UXBQ 3KF8B 4GNXC 2R7DA 4J15A 1HNXQ 1VQKA 3MXNB 3J81j 2OTLA 5C4XG 1T9HA 4OO1G 4QGUA 2VUMH 4O2DA 3Q8DA 2N8NA 5HGQA 2BH2A 1HR0W 5IY0A 2YYZA 3A74A 1CUKA 3PV0A 3S1QH 4AQYQ 2K75A 3CCQA 4LW1A 3RLOA 3GTJH 3CCUA 3HKSA 2JA9A 2KCTA 3OW2A 2IX0A 1JJCB 1WI5A 4DR5L 3RZDH 2JJQA 3NENA 4IFDJ 1AE3A 4P72A 4YCUA 4Y52H 5IWAL 1JMCA 1Z47A 3RNUA 4HJ9A 3CMEA 2KHJA 3HOYH 5GADC 1CKNB 1WCMG 3A5ZB 3ER0A 1YI2A 3HOXH 3DLLA 1B70B 2Z6KA 2ZM6Q 2VUMG 4JI4L 1I3QH 1BBWA 3CP0A 3UE0A 2GVAA 3PIPA 4HIKA 4B3SQ 4X6AH 1YITA 5JJIA 1UE1A 1G51A 2F4VQ 1TWCH 3GTGH 4A3GG 1XMQL 2N3SA 2UUBQ 2BA1A 4A3MG 2K4KA 2ZTEA 2JK8A 1KC8C 1G6PA 2K5NA 1KHIA 3NBHB 1C9OA 2XTIA 3L0OA 1J5EL 2CKZB 4A3CG 1KXLA 3I4NH 5J3BA 1FJGL 1IZ6A 3G4SA 3DM3A 4DV2L 1VQ7A 1E7ZA 4A3FH 2R7ZG 3AFQA 1NMGA 2IHFA 2QA4A 1WOCA 4P73A 4DV3Q 1N33Q 4DR3Q 2JA7H 3RN2A 1Q1BA 5C44H 3TEHB 4QQBX 3BJUA 4DV6Q 2OQ0A 1EIFA 4A3MH 4LF9L 3HFZB 3CXCA 1JE5A 1XTDA 2MNAA 3RN5A 1N34L 2NVQH 3PO3H 4LFBL 3S16H 4A3BG 1X65A 1AE2A 1SE8A 3TS0A 2ATWA 4DR2Q 1FL0A 3KOJA 1VQDA 1KAWA 4K0KQ 3B6YA 1PH4A 4YCVA 4DV1L 1X9NA 3BZCA 4WJ4A 5JJKA 1PV4A 5DLQE 4DAYB 4QY7A 4C3HH 1Q86C 4LWCA 2Y0SE 4LFCQ 2JA7G 2UXCQ 1PVOA 5FLXc 1D7QA 3KF6A 1KIXA 4OO1I 4DAMA 2K52A 3J7A5 5IT9c 4GLVB 4O0AA 1VQGA 4PZ7A 3GTKH 1GD7A 1OXVA 4BBSG 5FLMG 1QUQA 3HOUH 4A3DH 1UEBA 3T1HL 2WAQG 1X3GA 3T1YL 5C4JH 4YWLA 2K50A 5GAHC 4A3JG 5IYCG 1XMOQ 4BA1I 5C4XH 2VQEL 4DV7Q 4LF6L 4B3RQ 4HIMA 4JI4Q 2ZM6L 4XTCS 1E24A 3E9HA 4JI2L 1YHBA 1SMXA 2VY3A 2ZTDA 4DR3L 4LUZA 1R9TH 5C3EG 4IO9A 4A3IH 4LF7Q 4C2MH 4R4QA 2R6GA 4LF4L 4X65Q 3VDYA 3HOWG 1TXYA 4AIMA 2CFMA 2VL6A 2VQFQ 4YHHQ 3F2DA 1KRSA 1SN8A 4JI3Q 2PI2E 4UP7A 5HY6A 3WWVA 1L0WA 5M5YH 2WFWA 3CQZH 4JOIC 1Y1VG 2JA6G 2NZHA 5E7NA 2HT1A 4JBKA 2H5XA 1L1OA 4DR7Q 4PMWA 1X55A 3E9IA 1TWAH 2YTVA 3PSIA 4LFAQ 5IP7H 1WFQA 1N9WA 5BR8Q 4GOPA 3D31A 4DNIA 3EN2A 5BR8L 3I55A 1MJEA 2CCZA 3M4OH 4A3GH 1X56A 2MO0A 2OTJA 1Y1WG 4X64L 2HIVA 3FHWA 4P71A 1Q8KA 5ELNA 2L15A 4JC0A 2RCNA 4HJ7A 4R4IA 3T1HQ 2Q2TA 1NJIC 3S2HH 1XPRA 1K83H 4BBSH 2JE6I 2OQKA 4JI3L 3A5UA 1PH6A 1QVFA 1L2FA 3M3YH 5LMNW 4A3CH 1BKBA 3TS2A 5EAYA 1QZGA 4OWXB 4X64Q 2B63G 1I6HH 1B8AA 2EIFA 4A76A 3UDIA 3PO2G 3I2ZA 3F8TA 3K80C 4WJ3M 4A3BH 1UE5A 4JI0Q 1K8AC 4LF6Q 3U4VA 1UE6A 2DUDA 2NVXH 1IXRA 4IOCA 2K14A 4PZ8A 3UDFA 2NVYH 3CCEA 4C3IH 1A62A 3HOYG 3HKZG 2QGQA 1MJCA 1PH2A 3LGJA 3K0XA 1EOVA 5IP9G 3KDFB 4JI7L 1GKHA 2CWPA 3IRBA 4IPGA 3OTOL 4JG2A 2UUCQ 4AQYL 5C0XJ 4DV0L 4DR6L 5IYBG 1E1TA 3PUZA 1SLJA 1X3EA 4B3TL 4JYAQ 3HOVH 3ULLA 1K3RA 3PUVA 5GAGC 4BBRG 4JI6Q 1X54A 1PH3A 1P16A 3I4NG 4LFCL 4K0KL 4GN3B 3F2CA 4AH6A 4GOPC 1Q7YC 2UXDL 1IBKQ 1HNWL 3CCLA 4DR7L 4BXXG 1PFSA 1EYGA 2PQAB 4JI8Q 5JJLA 3JC66 4IJHA 1K9MC 4B3SL 2GVBA 3A0JA 5IE8A 2NVTH 4A3JH 4LUOA 1JB7A 1TWFH 3W5OA 4YY3Q 4B3MQ 3G48A 1D8LA 1LM0A 1H95A 3HOVG 1LTLA 2AHOB 4KHPQ 1OXXK 4DV0Q 4DR6Q 2WP8J 5C3EH 1A8VA 1P8LA 2JEBI 3J81c 4A3IG 2VNUD 1PHJA 4YY3L 2Q2UA 2R92G 1SR3A 4GNXB 3PCOB 1J6QA 3JAMc 1XPOA 1M1KC 4X62L 3UDGA 1ASZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U50 C;  1XMQ Q;  2F3I A;  3K81 C;  1CSP A;  2WB1 E;  4A4I A;  4A3L G;  2I0Q A;  3ERS X;  4LF9 Q;  2UXD Q;  1Z9F A;  1WJJ A;  3UDX A;  1KD1 C;  2ZJP A;  2EXD A;  2JA8 H;  2FXQ A;  1E1O A;  5M5X H;  5IYB H;  1X6O A;  2Y0S G;  4KHP L;  2YV5 A;  1PA6 A;  3M9B A;  3GDE A;  3CMA A;  2UXC L;  4JI7 Q;  4RG1 A;  4UP9 A;  1HJP A;  4R1J A;  1YHA A;  3GO5 A;  2IT1 A;  5C0X I;  4NXN L;  1VQM A;  1J5E Q;  2E8G A;  1HZA A;  3GTP H;  2WB1 G;  2ID0 A;  3CD6 A;  1DGS A;  1V43 A;  4UY8 C;  1NBW A;  5LMU L;  4KHZ A;  4GNX A;  1VQE A;  1K8G A;  1Q1E A;  2VW9 A;  4NPS A;  4AYB G;  2JA8 G;  3S2D H;  5M3M H;  3FP9 A;  3RR5 A;  2JEA I;  1AH9 A;  3F2B A;  4A3D G;  2UXB L;  4GS3 A;  3K8A A;  2AKW B;  1XMO L;  2D0P A;  1IBM Q;  2JA6 H;  3KLW A;  2B3G A;  4LNQ A;  2UU9 L;  3FKI G;  3ZJY C;  4DR1 L;  1FGU A;  1S72 A;  2E2I H;  4H02 A;  4HJA A;  3PUY A;  3PUW A;  2XGT A;  1N8R C;  3E0E A;  4OON A;  2VQF L;  3S15 H;  1EIY B;  4GLA C;  4X66 Q;  2PQA A;  2BH8 A;  4JI5 L;  3G6E A;  2LSS A;  2BA0 A;  1W2B A;  1XJV A;  2UUB L;  1S40 A;  3NEL A;  5IYD H;  4GN4 B;  1HNZ Q;  5AJ3 L;  5M3M G;  1VQJ A;  3BU2 A;  2E2J H;  4OWW B;  4DV1 Q;  1C7Y A;  1VS0 A;  4MNO A;  2ASB A;  4BXX H;  1XNQ L;  1UE7 A;  3STB C;  1G29 1;  4FDB A;  2HHH L;  3CC4 A;  4L5R C;  2V1C C;  1HNZ L;  3AQQ A;  4JV5 L;  3CCJ A;  1PH1 A;  5IWA Q;  3CF5 A;  3SGI A;  3T1Y Q;  1YIJ A;  1N34 Q;  1XPU A;  2YU9 H;  4BA2 I;  4GKK Q;  1C0A A;  4DUZ Q;  4L5S A;  4TQU S;  4JYA L;  1YZ6 A;  1IYJ B;  3GD7 A;  2A8V A;  4A3K G;  3GTL H;  2OCE A;  1YJ9 A;  3KFU A;  1E22 A;  2NN6 I;  4UP8 A;  2D0O A;  4B3T Q;  4DR1 Q;  2RHQ B;  5FJ8 H;  5LMN L;  1OTC A;  2I5L X;  4DV2 Q;  2VS1 A;  3ICE A;  1ASY A;  2LXJ A;  1IBM L;  4DK6 C;  2JQO A;  3CCR A;  2KEN A;  4JI2 Q;  1PH7 A;  5IP9 H;  1GVP A;  2Q2H A;  1BVS A;  2PNH A;  2A1A A;  3CCM A;  3KJO A;  1YJN A;  1WCM H;  1HZ9 A;  4QIW E;  4DV4 L;  5LMU Q;  1QVC A;  4JV5 Q;  4DV4 Q;  3HKZ E;  4KI0 A;  5C0X G;  4NB3 A;  4QJF A;  1IBK L;  5M3F H;  1CKM A;  2YTY A;  3AFP A;  4BBR H;  4GLX A;  4JBJ A;  1N36 Q;  5GQO A;  2B63 H;  3S24 A;  4A3L H;  4A3E H;  5FJ8 G;  4JI6 L;  2D62 A;  4Y7N H;  5AJ3 Q;  4EX5 A;  1W3S A;  4MTN A;  3TQY A;  4POG A;  3U4Z A;  4JBW A;  3RLF A;  1V1Q A;  4P74 A;  3CAM A;  3J80 i;  1OXU A;  5GAE C;  2UUA L;  3OTO Q;  2UUC L;  1OXT A;  4R4T A;  3G71 A;  2ZTC A;  3GTM H;  4A3F G;  1VQ6 A;  1SFO H;  2R7Z H;  4XIG S;  4BY1 G;  1JJ2 A;  2JA5 G;  3CCV A;  1MIU A;  5H1S E;  1VQ8 A;  4JCV E;  1Y14 B;  4DUZ L;  3M7N A;  1E3P A;  1L1O B;  3MEF A;  4RMF A;  3J80 c;  4OXP A;  2VQE Q;  4KLK A;  4DV7 L;  3KJP A;  4IOA A;  1KQS A;  3W1G A;  5M3F G;  2E5L L;  3PUX A;  1HH2 P;  5JEA G;  2NZO A;  3U58 A;  1U5K A;  4LFB Q;  4LUV A;  3K7U C;  3W1B A;  2R93 H;  3PO3 G;  1XNQ Q;  2CWA A;  4YWM A;  5JEA J;  3M85 A;  4BY7 G;  1OXS C;  2R7F A;  4A93 G;  4GKJ Q;  4HJ8 A;  4DR4 Q;  4NXM L;  1XNR Q;  1Q81 C;  1VQL A;  2QEX A;  1I94 L;  1HZC A;  3CPW A;  4ME3 A;  1VQF A;  1PH8 A;  4B3M L;  2RHS B;  1KL9 A;  4EQ5 A;  3FKI H;  4JOI A;  3TRZ A;  2ZJQ A;  3NEM A;  1VQ9 A;  4LF8 Q;  1PYB A;  3I4O A;  4L5Q A;  1N36 L;  2K5H A;  4DV5 L;  4LF5 Q;  4OX9 L;  1L1O C;  4P75 A;  1LYL A;  2K5V A;  4JI8 L;  3M4P A;  2WAQ E;  3H15 A;  3PIO A;  1TWH H;  2NN6 G;  1VQN A;  2MFI A;  4HIO A;  1EQQ A;  1CKO A;  2RF4 A;  3K7A H;  2HHH Q;  4BY7 H;  1LUZ A;  3CC7 A;  2Z0S A;  1TWG H;  4C3J H;  1FVI A;  1VQ5 A;  5IYC H;  4LFA L;  2R92 H;  1NY4 A;  2E2H H;  4UPA A;  1O7I A;  1UWV A;  1SRU A;  1PYS B;  3KYH C;  2MO1 A;  1PH9 A;  1SRO A;  3ULJ A;  5LMN Q;  5C44 G;  1IBL Q;  3PGZ A;  1PH5 A;  2ES2 A;  1NMF A;  1HR0 L;  4BY1 H;  1HR0 Q;  1VQA A;  2YTX A;  3HOW H;  3I4M H;  3S17 H;  3S1M H;  4LF4 Q;  1EUJ A;  4LF7 L;  4NXM Q;  2N49 A;  1XNR L;  4GKJ L;  2PI2 A;  2ALY B;  2R93 G;  3KDF A;  3EBE A;  3CC2 A;  4DR2 L;  3L2P A;  5IP7 G;  4R4O A;  4IFD G;  1B7Y B;  1GO3 E;  4IPD A;  4PG3 A;  4X66 L;  4X62 Q;  4OX9 Q;  2DGY A;  1WYD A;  1HNW Q;  2A19 A;  4DR5 Q;  2KHI A;  5M5W H;  4DV6 L;  3I4M G;  4NXN Q;  4DPG A;  3J7Z C;  4IPH A;  1HZB A;  4YWK A;  4IJL A;  3EIV A;  1N32 L;  3OYY A;  4YHH L;  3I7F A;  1YNX A;  2LXK A;  2AMC B;  4ALP A;  4X65 L;  3AYH B;  3RZO H;  4DR4 L;  4DUY L;  1N32 Q;  1EFW A;  1Q12 A;  1I5F A;  3PF5 A;  4A3K H;  3CW2 C;  2Q2I A;  1CKN A;  1QVG A;  3H3V I;  1S3O A;  1U0L A;  3ULP A;  4B3R L;  1VQB A;  2E5L Q;  3PO2 H;  1JJG A;  1NTG A;  2F4V L;  2N78 A;  1VQ4 A;  1RL2 A;  4DV5 Q;  5IYD G;  3HOZ H;  4JI1 L;  3D0F A;  1Q46 A;  1YVC A;  4YCW A;  3GTQ H;  2AWN A;  1M90 C;  1GM5 A;  1JT8 A;  1X3F A;  5FLM H;  4GOP B;  3HOU G;  4DV3 L;  4R4C A;  4TVA B;  1N33 L;  3I56 A;  1I94 Q;  1YJW A;  4IPC A;  1VQI A;  4JI5 Q;  3RLN A;  3JAM i;  2HIX A;  3H3V H;  1EQR A;  3GTO H;  3M4Q A;  4GN5 A;  2F52 A;  2IY5 B;  2VZA A;  1FJG Q;  4A3E G;  2B29 A;  1VCI A;  1Q82 C;  1YEZ A;  3H0G H;  2KBN A;  1K73 C;  1KRT A;  4JI1 Q;  4DK3 C;  3J81 i;  1Y1W H;  1IBL L;  4JBM A;  1IL2 A;  1I50 H;  1CSQ A;  4POF A;  3S1N H;  3S14 H;  2EQS A;  2MQH A;  1MKH A;  1VQO A;  2I5M X;  2Z6K C;  2CQO A;  2AWO A;  4PZ6 A;  2GN5 A;  3L7Z C;  4QL5 A;  1HNX L;  1A63 A;  1RIP A;  3F1Z A;  5ELO A;  3HOX G;  3S1R H;  3STB D;  4HID A;  1QZH A;  4OWT B;  2JA5 H;  3PF4 A;  4A93 H;  4MZ9 A;  1Y1V H;  3TRE A;  4DUY Q;  2OWO A;  1VQC A;  2PMZ E;  2KCM A;  3UE1 A;  3BZK A;  4AYB E;  2UUA Q;  4L5T A;  4LF5 L;  4A75 A;  3H0G G;  5K36 G;  1NE3 A;  4LF8 L;  2HQL A;  1QUQ B;  2I5H A;  1VQP A;  2IX1 A;  4IFD I;  1V9P A;  1BBU A;  1EWI A;  4DKA C;  3CCS A;  4APV A;  2C35 B;  4GKK L;  1VQH A;  3KF6 B;  4HJ5 A;  2UU9 Q;  1YBY A;  5GRO A;  3CPF A;  1A0I A;  2IHE A;  2ZJR A;  1YHQ A;  1K0R A;  3AEV A;  3HOZ G;  4JI0 L;  2UXB Q;  3KF8 B;  4GNX C;  2R7D A;  4J15 A;  1HNX Q;  1VQK A;  3MXN B;  3J81 j;  2OTL A;  5C4X G;  1T9H A;  4OO1 G;  4QGU A;  2VUM H;  4O2D A;  3Q8D A;  2N8N A;  5HGQ A;  2BH2 A;  1HR0 W;  5IY0 A;  2YYZ A;  3A74 A;  1CUK A;  3PV0 A;  3S1Q H;  4AQY Q;  2K75 A;  3CCQ A;  4LW1 A;  3RLO A;  3GTJ H;  3CCU A;  3HKS A;  2JA9 A;  2KCT A;  3OW2 A;  2IX0 A;  1JJC B;  1WI5 A;  4DR5 L;  3RZD H;  2JJQ A;  3NEN A;  4IFD J;  1AE3 A;  4P72 A;  4YCU A;  4Y52 H;  5IWA L;  1JMC A;  1Z47 A;  3RNU A;  4HJ9 A;  3CME A;  2KHJ A;  3HOY H;  5GAD C;  1CKN B;  1WCM G;  3A5Z B;  3ER0 A;  1YI2 A;  3HOX H;  3DLL A;  1B70 B;  2Z6K A;  2ZM6 Q;  2VUM G;  4JI4 L;  1I3Q H;  1BBW A;  3CP0 A;  3UE0 A;  2GVA A;  3PIP A;  4HIK A;  4B3S Q;  4X6A H;  1YIT A;  5JJI A;  1UE1 A;  1G51 A;  2F4V Q;  1TWC H;  3GTG H;  4A3G G;  1XMQ L;  2N3S A;  2UUB Q;  2BA1 A;  4A3M G;  2K4K A;  2ZTE A;  2JK8 A;  1KC8 C;  1G6P A;  2K5N A;  1KHI A;  3NBH B;  1C9O A;  2XTI A;  3L0O A;  1J5E L;  2CKZ B;  4A3C G;  1KXL A;  3I4N H;  5J3B A;  1FJG L;  1IZ6 A;  3G4S A;  3DM3 A;  4DV2 L;  1VQ7 A;  1E7Z A;  4A3F H;  2R7Z G;  3AFQ A;  1NMG A;  2IHF A;  2QA4 A;  1WOC A;  4P73 A;  4DV3 Q;  1N33 Q;  4DR3 Q;  2JA7 H;  3RN2 A;  1Q1B A;  5C44 H;  3TEH B;  4QQB X;  3BJU A;  4DV6 Q;  2OQ0 A;  1EIF A;  4A3M H;  4LF9 L;  3HFZ B;  3CXC A;  1JE5 A;  1XTD A;  2MNA A;  3RN5 A;  1N34 L;  2NVQ H;  3PO3 H;  4LFB L;  3S16 H;  4A3B G;  1X65 A;  1AE2 A;  1SE8 A;  3TS0 A;  2ATW A;  4DR2 Q;  1FL0 A;  3KOJ A;  1VQD A;  1KAW A;  4K0K Q;  3B6Y A;  1PH4 A;  4YCV A;  4DV1 L;  1X9N A;  3BZC A;  4WJ4 A;  5JJK A;  1PV4 A;  5DLQ E;  4DAY B;  4QY7 A;  4C3H H;  1Q86 C;  4LWC A;  2Y0S E;  4LFC Q;  2JA7 G;  2UXC Q;  1PVO A;  5FLX c;  1D7Q A;  3KF6 A;  1KIX A;  4OO1 I;  4DAM A;  2K52 A;  3J7A 5;  5IT9 c;  4GLV B;  4O0A A;  1VQG A;  4PZ7 A;  3GTK H;  1GD7 A;  1OXV A;  4BBS G;  5FLM G;  1QUQ A;  3HOU H;  4A3D H;  1UEB A;  3T1H L;  2WAQ G;  1X3G A;  3T1Y L;  5C4J H;  4YWL A;  2K50 A;  5GAH C;  4A3J G;  5IYC G;  1XMO Q;  4BA1 I;  5C4X H;  2VQE L;  4DV7 Q;  4LF6 L;  4B3R Q;  4HIM A;  4JI4 Q;  2ZM6 L;  4XTC S;  1E24 A;  3E9H A;  4JI2 L;  1YHB A;  1SMX A;  2VY3 A;  2ZTD A;  4DR3 L;  4LUZ A;  1R9T H;  5C3E G;  4IO9 A;  4A3I H;  4LF7 Q;  4C2M H;  4R4Q A;  2R6G A;  4LF4 L;  4X65 Q;  3VDY A;  3HOW G;  1TXY A;  4AIM A;  2CFM A;  2VL6 A;  2VQF Q;  4YHH Q;  3F2D A;  1KRS A;  1SN8 A;  4JI3 Q;  2PI2 E;  4UP7 A;  5HY6 A;  3WWV A;  1L0W A;  5M5Y H;  2WFW A;  3CQZ H;  4JOI C;  1Y1V G;  2JA6 G;  2NZH A;  5E7N A;  2HT1 A;  4JBK A;  2H5X A;  1L1O A;  4DR7 Q;  4PMW A;  1X55 A;  3E9I A;  1TWA H;  2YTV A;  3PSI A;  4LFA Q;  5IP7 H;  1WFQ A;  1N9W A;  5BR8 Q;  4GOP A;  3D31 A;  4DNI A;  3EN2 A;  5BR8 L;  3I55 A;  1MJE A;  2CCZ A;  3M4O H;  4A3G H;  1X56 A;  2MO0 A;  2OTJ A;  1Y1W G;  4X64 L;  2HIV A;  3FHW A;  4P71 A;  1Q8K A;  5ELN A;  2L15 A;  4JC0 A;  2RCN A;  4HJ7 A;  4R4I A;  3T1H Q;  2Q2T A;  1NJI C;  3S2H H;  1XPR A;  1K83 H;  4BBS H;  2JE6 I;  2OQK A;  4JI3 L;  3A5U A;  1PH6 A;  1QVF A;  1L2F A;  3M3Y H;  5LMN W;  4A3C H;  1BKB A;  3TS2 A;  5EAY A;  1QZG A;  4OWX B;  4X64 Q;  2B63 G;  1I6H H;  1B8A A;  2EIF A;  4A76 A;  3UDI A;  3PO2 G;  3I2Z A;  3F8T A;  3K80 C;  4WJ3 M;  4A3B H;  1UE5 A;  4JI0 Q;  1K8A C;  4LF6 Q;  3U4V A;  1UE6 A;  2DUD A;  2NVX H;  1IXR A;  4IOC A;  2K14 A;  4PZ8 A;  3UDF A;  2NVY H;  3CCE A;  4C3I H;  1A62 A;  3HOY G;  3HKZ G;  2QGQ A;  1MJC A;  1PH2 A;  3LGJ A;  3K0X A;  1EOV A;  5IP9 G;  3KDF B;  4JI7 L;  1GKH A;  2CWP A;  3IRB A;  4IPG A;  3OTO L;  4JG2 A;  2UUC Q;  4AQY L;  5C0X J;  4DV0 L;  4DR6 L;  5IYB G;  1E1T A;  3PUZ A;  1SLJ A;  1X3E A;  4B3T L;  4JYA Q;  3HOV H;  3ULL A;  1K3R A;  3PUV A;  5GAG C;  4BBR G;  4JI6 Q;  1X54 A;  1PH3 A;  1P16 A;  3I4N G;  4LFC L;  4K0K L;  4GN3 B;  3F2C A;  4AH6 A;  4GOP C;  1Q7Y C;  2UXD L;  1IBK Q;  1HNW L;  3CCL A;  4DR7 L;  4BXX G;  1PFS A;  1EYG A;  2PQA B;  4JI8 Q;  5JJL A;  3JC6 6;  4IJH A;  1K9M C;  4B3S L;  2GVB A;  3A0J A;  5IE8 A;  2NVT H;  4A3J H;  4LUO A;  1JB7 A;  1TWF H;  3W5O A;  4YY3 Q;  4B3M Q;  3G48 A;  1D8L A;  1LM0 A;  1H95 A;  3HOV G;  1LTL A;  2AHO B;  4KHP Q;  1OXX K;  4DV0 Q;  4DR6 Q;  2WP8 J;  5C3E H;  1A8V A;  1P8L A;  2JEB I;  3J81 c;  4A3I G;  2VNU D;  1PHJ A;  4YY3 L;  2Q2U A;  2R92 G;  1SR3 A;  4GNX B;  3PCO B;  1J6Q A;  3JAM c;  1XPO A;  1M1K C;  4X62 L;  3UDG A;  1ASZ A; 
#chains in the Genus database with same CATH topology
 2O5I C;  3LWU A;  2WB1 E;  4K2K A;  4A4I A;  2I0Q A;  3ERS X;  1F2L A;  3NQT A;  3HS0 C;  1KD1 C;  4L8J A;  2FXQ A;  2F4I A;  1PTO H;  2F0G A;  1CTM A;  2Y0S G;  2PW7 A;  4QUC A;  1PA6 A;  3M9B A;  2UXC L;  2BDN A;  4XYO A;  4UP9 A;  2XIW A;  3LX0 A;  5C0X I;  2E8G A;  2WII B;  3SHL A;  5C44 B;  2X69 A;  1JWS D;  1SFO B;  5LMU L;  2V4D A;  4KD4 A;  4AYB G;  2JA8 G;  5M3M H;  3FP9 A;  1AH9 A;  3PO2 B;  4GS3 A;  2VXW A;  3ERQ A;  2A6E C;  1E2V A;  3ZJY C;  1FGU A;  1S72 A;  1I4X A;  4H02 A;  4ZLT F;  4HJA A;  4MTK A;  4J8Q A;  2PPB C;  2XGT A;  1YNN D;  5JOB A;  2VQF L;  3S15 H;  1W2B A;  4X66 Q;  1IKM A;  3G6E A;  2O5J C;  2BA0 A;  1S40 A;  3RD4 A;  3K58 A;  1D2B A;  2E2J H;  1ROD A;  2QF7 A;  3M4Y A;  4DV1 Q;  1VS0 A;  4BXX H;  5BN4 A;  1G29 1;  4X3U A;  4L5R C;  4DK1 A;  3AQQ A;  3H6M A;  1EZ8 A;  3CF5 A;  3T1Y Q;  4BA2 I;  1C0A A;  5BN3 A;  4TQU S;  2VUM B;  3DEO A;  3MVV A;  2FJ2 A;  4A3F B;  2NN6 I;  4UP8 A;  2D0O A;  4DR1 Q;  2RHQ B;  5FJ8 H;  5LMN L;  1JB3 A;  4I65 A;  1ASY A;  2LXJ A;  1PRT D;  1GVP A;  4TRD A;  1BVS A;  2A1A A;  2FHT A;  3D4R A;  1YJN A;  1M4V A;  1WCM H;  4DV4 L;  1QVC A;  1RCV D;  4IUV A;  1SBB B;  4QJF A;  4XT3 B;  4N9P A;  2YTY A;  4JBJ A;  3S24 A;  4A3E H;  2D62 A;  3MZ5 A;  5EGT A;  3T13 A;  3RLF A;  3OTO Q;  4R4T A;  1Q3L A;  3ND9 A;  3M7N A;  1E3P A;  2L12 A;  3MEF A;  4A3D B;  4KLK A;  3KJP A;  2BE5 D;  5CV9 A;  5JEA G;  4LFB Q;  4LUV A;  1GUN A;  1DOL A;  5JEA J;  4BY7 G;  1ZEQ X;  2R7F A;  2CVR A;  4GKJ Q;  4MHE A;  5CV4 A;  1EU3 A;  5L37 A;  2TMP A;  2QEX A;  2DJG C;  2ICI A;  3S2H B;  1KTK A;  3EQL C;  3CPW A;  1VQF A;  1LTI D;  4B3M L;  3K5M A;  1KL9 A;  3K5N A;  1PFN A;  3NEM A;  4QB4 A;  1S5E D;  4BS9 A;  4Q0F A;  1L1O C;  3OHX C;  4P75 A;  1LYL A;  1KDC A;  2K7V A;  5T1G A;  3AMU A;  1PTO D;  1TWH H;  1EQQ A;  4HIO A;  1V8Q A;  3K7A H;  2HHH Q;  2B8G A;  3CC7 A;  2NVY B;  1HPC A;  1SRU A;  1STH A;  3FRP B;  5LMN Q;  1IBL Q;  1PH5 A;  2ES2 A;  4A3I B;  2PZW A;  3S17 H;  3Q23 A;  3S1M H;  3SEB A;  2KHS A;  4LF4 Q;  1XNR L;  4GKJ L;  2LY7 A;  1CHP D;  2ZXP A;  3KDF A;  5J22 A;  1K8M A;  2EY6 A;  3BVG A;  3A54 A;  2CHB D;  3L2P A;  1T5X D;  4IFD G;  1B7Y B;  1GO3 E;  1RJT A;  4X62 Q;  2DGY A;  2SDF A;  2KHI A;  4DV6 L;  3I4M G;  4DPG A;  3OYY A;  3V05 A;  2LXK A;  4EQO A;  2F0I A;  1Q12 A;  4A3K H;  4IFD H;  1JCK B;  1EY0 A;  2Q2I A;  3H3V I;  4B3R L;  2B2Y A;  4ILW A;  3DWQ A;  4K8I A;  3H91 A;  2F4V L;  1O78 A;  5FLX L;  3HOZ H;  4JI1 L;  5CV8 A;  2EYP A;  3GTQ H;  1DOM A;  4GOP B;  2YU9 B;  2KOL A;  3I56 A;  3KLR A;  2I07 B;  1VQI A;  2A69 D;  3HP3 A;  3JAM i;  4NDX A;  3M4Q A;  2OT2 A;  3D3R A;  5IGE A;  4GN5 A;  5IIF A;  2F52 A;  2VZA A;  1VCI A;  1KRT A;  4DK3 C;  1IBL L;  2E76 C;  1IL2 A;  1I50 H;  3KLS X;  1CQF A;  1AEX A;  3S2D B;  2NZ1 D;  4DU9 A;  1EY7 A;  2KCC A;  1I3Q B;  5I6W A;  1I4G A;  2AWO A;  5A2Q E;  3L7Z C;  1SSO A;  4LFC Q;  4HID A;  3PF4 A;  1U4L A;  4MZ9 A;  3UE1 A;  4OGQ C;  2KCM A;  1HRJ A;  2WKC A;  1EIG A;  4LF5 L;  1JOK A;  3NWT A;  1NE3 A;  1D1I A;  3QJY A;  2EVB A;  5HUR A;  1BBU A;  4O42 A;  1STE A;  2F1M A;  4GKK L;  4HJ5 A;  1AZQ A;  1A0I A;  2ZJR A;  5TSS A;  1K0R A;  3TP5 A;  3AEV A;  2PO4 A;  4KN7 C;  3KF8 B;  2LKV A;  1MBY A;  1T9H A;  4O2D A;  5HGQ A;  3A55 A;  3I4L A;  1PFM A;  2RBM A;  3K59 A;  3S1Q H;  2ZXR A;  4V19 0;  4P2C B;  4MN3 A;  3DEP A;  2K03 A;  4NMZ A;  3RLO A;  2SNM A;  2JXM B;  3GTJ H;  2Q8T A;  2JA9 A;  4JYA Q;  4DR5 L;  1JJC B;  2JJQ A;  1OO9 B;  1Z47 A;  1T5E A;  2HDM A;  5GAD C;  1CKN B;  5EBD A;  1YI2 A;  2K28 A;  2ZM6 Q;  2Z6K A;  2VUM G;  2NVX B;  1BR9 A;  1II3 A;  3CP0 A;  4JW0 A;  2GVA A;  1TII D;  4BBR B;  1JOQ A;  4FXG C;  2UUB Q;  2XRS D;  3CKI B;  2BDO A;  1KHI A;  4A3C G;  3I4N H;  5J3B A;  4ZK9 B;  3G4S A;  4KJN A;  4K14 A;  3IL8 A;  3N6R A;  3GTJ B;  1ENF A;  1U4R A;  4QQB X;  3BJU A;  3BYT B;  4A3M H;  3NHH A;  4LFB L;  2M00 A;  3PO3 H;  1I4R A;  1AZP A;  3K5L A;  4A93 B;  4A3B G;  2F3W A;  1HTP A;  1VQD A;  2K04 A;  3B6Y A;  1X9N A;  4WJ4 A;  4XXE A;  3KF8 A;  5DLQ E;  4QY7 A;  2UXC Q;  1NR4 A;  5FLX c;  4OO1 I;  2DY8 A;  4GLV B;  1XX8 A;  1I6V C;  3QOJ A;  2LMC B;  1QG7 A;  5A2Q L;  4BY7 B;  4RGN A;  4XQN A;  3V2T A;  5IYC G;  1D5X C;  1BXT A;  3NSW A;  3OOC A;  1XMO Q;  2JA6 B;  3MXU A;  4K5W A;  1E24 A;  3E9H A;  4JI2 L;  2ZTD A;  2VY3 A;  1FR3 A;  4C56 C;  4LF7 Q;  4C2M H;  4LF4 L;  2H1E A;  3VDY A;  1EOT A;  3HOW G;  1TXY A;  2CFM A;  2VL6 A;  2WV6 D;  3F2D A;  4DXF A;  1LAB A;  1EEF D;  2HD3 A;  4JPB W;  2K5Q A;  3BYY B;  1IHZ A;  2H5X A;  3HGB A;  4EQN A;  1ICW A;  4PMW A;  5DAU A;  4GOP A;  1N9W A;  2ZT9 C;  1KNA A;  3D31 A;  5BR8 Q;  3EN2 A;  4R9W A;  2CCZ A;  4A3G H;  5LL6 S;  5M3M B;  1H9R A;  1Y1W G;  4P71 A;  3VYS A;  1Q8K A;  5ELC A;  5ELN A;  3CU7 A;  1XPR A;  3FVQ A;  2FMM A;  4BBS H;  2OQK A;  1HA6 A;  4CKB A;  1QVF A;  4A3C H;  4A3K B;  3S1M B;  1QZG A;  4X64 Q;  3D6W A;  1I6H H;  4A76 A;  3UDI A;  3T51 B;  1STA A;  2RDG A;  1BCP D;  1TKW B;  3SK4 A;  4I7Z C;  3GTG B;  3HOY B;  1BNZ A;  2NVT B;  2Q8R E;  4BWG B;  1PRT C;  2DUD A;  2K14 A;  1I4H A;  3UDF A;  2NVY H;  1A62 A;  1QJO A;  1S5C D;  2EPB A;  3KDF B;  2MGS A;  2NYZ D;  3IRB A;  3OTO L;  4ABN A;  4AQY L;  1D1K A;  3PUZ A;  3IAY A;  1SLJ A;  3P75 A;  3PUV A;  4JI6 Q;  4F87 A;  1P16 A;  4LFC L;  2B2T C;  2J0T D;  3M4O B;  5JJL A;  1B3Q A;  5JVH 3;  4B3S L;  2GVB A;  2G5D A;  5M9O A;  3A8K E;  5FO8 B;  5M5W B;  1D8L A;  1LM0 A;  4YIJ A;  4UHV A;  5M5Y B;  4DR6 Q;  4Q5V A;  1P8L A;  2VNU D;  2Y0S B;  3KBX A;  1AW7 A;  1SR3 A;  1UEA B;  3FPU B;  4H7B A;  1J6Q A;  5ELB A;  4K2L A;  1BQQ T;  3S1R H;  1K28 A;  3UDG A;  1CSP A;  4ULL A;  4A3L G;  3X3M A;  4LF9 Q;  2B2W A;  3UDX A;  1DXM A;  4NP5 A;  3MHB A;  2ZJP A;  2JA8 H;  1TY0 A;  4OIK A;  2QCP X;  2Z4I A;  4CDF C;  1E1O A;  5M5X H;  5JPN C;  1BF4 A;  3I72 A;  3DM1 A;  3GO5 A;  2IT1 A;  2IX3 A;  1EWH A;  5CV6 A;  1S5B D;  3QIA A;  3CD6 A;  1V43 A;  4QUF A;  1K8O A;  4RWS C;  5CYU A;  4GZY C;  2VW9 A;  1WD0 A;  1HHV A;  1Z6H A;  2JEA I;  1TU2 B;  1CT1 D;  4C3I B;  2AKW B;  3I3C A;  2D0P A;  3P20 A;  1LTT D;  2B3G A;  1GUO A;  3FKI G;  1A2U A;  2E2I H;  3PUW A;  1N8R C;  3QB3 A;  2CW0 C;  4OON A;  1CZG A;  4X3K A;  2UUB L;  1WTV A;  2K1B A;  5IYD H;  4GN4 B;  4C3J G;  5AJ3 L;  1HNZ Q;  1KDA A;  4CKE A;  3I70 A;  1IW7 D;  2HHH L;  3GTQ B;  4JV5 L;  4HMJ A;  3VR6 A;  2YU9 H;  1PRT F;  4JYA L;  1YZ6 A;  3GD7 A;  5ELF A;  1ILQ A;  3GTL H;  3KFU A;  1E22 A;  4B3T Q;  5E1F A;  1LLR D;  4KY6 A;  3ICE A;  1LO5 D;  3CQZ B;  1MHW C;  1PDQ A;  3CCM A;  4EQP A;  3KJO A;  2K6A A;  4DV4 Q;  4NB3 A;  5M3F H;  3X3N A;  3AFP A;  3QWN A;  4GLX A;  4A3L H;  3PIP 3;  3HOZ B;  4Y7N H;  5AJ3 Q;  4MTN A;  2QW7 A;  1E0B A;  2M9V A;  3TQY A;  5CGK A;  4JBW A;  1OXU A;  1A15 A;  2ZTC A;  1VQ6 A;  1SFO H;  4BY1 G;  4U68 A;  1VQ8 A;  4JCV E;  4ZQ3 A;  1L1O B;  3J80 c;  1S5D D;  1TWG B;  4PNY A;  3W1G A;  4PMC A;  1HH2 P;  2NZO A;  1LT5 D;  1U5K A;  3PO3 G;  2CWA A;  4IUT A;  2N55 A;  1OXS C;  3NTK A;  4HJ8 A;  4DR4 Q;  4HSP A;  4NXM L;  1Q81 C;  4BBS B;  1VQL A;  2L1B A;  3HRZ C;  4Y7N B;  1LV9 A;  4G57 A;  3FKI H;  2NTT A;  2E2D C;  3TRZ A;  1VQ9 A;  1EYC A;  1J9O A;  2K5H A;  1WTQ A;  2X6G A;  1W6J A;  1VQN A;  2RF4 A;  4C3J H;  1PFB A;  1TWG H;  1FVI A;  2R92 H;  1NY4 A;  2XN9 C;  4UPA A;  2E2H H;  1TS5 A;  1TWF B;  3KYH C;  5D3I B;  2HQE A;  3ULJ A;  3E6Z X;  4RHR A;  5EJW A;  2QDB A;  1NMF A;  2KA7 A;  4C2M B;  3I4M H;  3Q24 A;  4KN4 C;  3FMC A;  2PYK A;  1FYC A;  2DJF C;  4FYD A;  4OO1 H;  2ALY B;  2NVQ B;  1RTO A;  1E2W A;  4R4O A;  4B9W A;  3IKJ A;  4KTA A;  4PG3 A;  2QKI C;  2VB3 X;  1WTP A;  5I2Y A;  1WYD A;  1IKL A;  4OX9 Q;  2A19 A;  3OIQ A;  4DR5 Q;  1HNW Q;  4NXN Q;  3J7Z C;  3TZD A;  3EIV A;  4YHH L;  1WTH A;  3I7F A;  4OL7 A;  2MHV A;  3GTL B;  2AMC B;  4X65 L;  1SYF A;  3AYH B;  3OW7 A;  4DR4 L;  1N32 Q;  3HOV B;  1S3O A;  1U0L A;  4XQQ A;  5K5P A;  1VQB A;  4C3J B;  3TSS A;  1NTG A;  2A6H D;  3TBI B;  1VQ4 A;  5IYD G;  3C3L A;  1Q46 A;  1GM5 A;  2P5Z X;  1H9S A;  1X3F A;  3HOU G;  2A5H A;  3URY A;  3NP8 A;  3I4N B;  1I94 Q;  4IPC A;  2MPM A;  3FKI B;  2B8F A;  2HIX A;  1EQR A;  5JJZ A;  4LJZ C;  1DM0 B;  2IY5 B;  1FJG Q;  1YEZ A;  3H0G H;  2BOS A;  2F0F A;  2E75 C;  1STG A;  1SNQ A;  3S1N H;  2B2V C;  1DON A;  2GN5 A;  4QL5 A;  1HNX L;  1GJX A;  1RIP A;  3F1Z A;  3HOX G;  2JA5 H;  3STB D;  2XSC A;  4OEL B;  5I4D A;  1Y1V H;  1ML0 D;  2OWO A;  2PMZ E;  3I73 A;  2UUA Q;  4L5T A;  1TY2 A;  2KCN A;  3W2D A;  1EWI A;  4APV A;  1EU4 A;  2B2Y C;  3CPF A;  3HOZ G;  2ZXO A;  2R7D A;  2NBF A;  4OO1 G;  4QGU A;  2N8N A;  4F8M A;  3A74 A;  1PTO B;  4CJ1 B;  1B4O A;  3CCQ A;  3PIO 3;  4LW1 A;  1VMC A;  3HKS A;  1A2T A;  3OW2 A;  2DNC A;  3RZD H;  1AE3 A;  4YCU A;  3RNU A;  1SE4 A;  1SAP A;  3I91 A;  3HOY H;  5FK9 C;  3VYU A;  1LAC A;  3A5Z B;  3DLL A;  1B70 B;  1MSH A;  1BBW A;  4FF1 A;  4B3S Q;  1SND A;  4B08 A;  1UE1 A;  1G51 A;  5C5M A;  1TWC H;  4A3J B;  3GTG H;  1AFP A;  2WAQ B;  2JK8 A;  2ZTE A;  2K5N A;  4QF4 A;  1J5E L;  4HED A;  2XTI A;  1FJG L;  4DAV A;  1PZK D;  1IZ6 A;  3DM3 A;  1VQ7 A;  3AFQ A;  1ONL A;  1NMG A;  3OPO A;  2QA4 A;  1WOC A;  4P73 A;  4DV3 Q;  1N33 Q;  4DR3 Q;  2JA7 H;  1EY6 A;  1Q1B A;  3TEH B;  2OQ0 A;  3CXC A;  1XTD A;  1N34 L;  3BZD B;  2JA5 B;  3S16 H;  1X65 A;  3DMU A;  1SE8 A;  2DN8 A;  2Z9H A;  3G6J B;  4DV1 L;  4R8I A;  1A3V A;  1BCP C;  1WVL A;  1Q86 C;  1PV4 A;  1B9M A;  2JA7 G;  1PVO A;  2M2L A;  3JAM L;  3KF6 A;  1KIX A;  4EGV A;  1F9S A;  5CR3 A;  1VQG A;  4PZ7 A;  3NBI A;  4BBS G;  4A3D H;  1QUQ A;  1UEB A;  1U4M A;  1X3G A;  4A3G B;  2K50 A;  1V1P A;  2B2U C;  3CHB D;  3M7G A;  4LF6 L;  1RDP D;  5C3W A;  2VQE L;  4DV7 Q;  2EYH A;  4A3M B;  4B3R Q;  5JPM C;  4MIU A;  3C1F A;  1F2Z A;  1SMX A;  4DR3 L;  2OXP A;  1R9T H;  5C3E G;  4IO9 A;  1TVX A;  3ZYY X;  3VA7 A;  4X65 Q;  4KKU A;  4XDX A;  1LTA D;  1UAP A;  3NQI A;  5I6Y A;  3C1E A;  4S3S A;  5M5Y H;  2WFW A;  3J7Y W;  1Y1V G;  1QIL A;  3RZO B;  2JA6 G;  2NZH A;  5E7N A;  3J81 L;  2HT1 A;  4V0B A;  3SR1 A;  4KMU C;  1GOZ A;  1QE6 A;  2YTV A;  2B2T A;  5IP7 H;  5KGU A;  5DM7 3;  4TKO B;  4ZUJ A;  5BR8 L;  3M4O H;  4KJO A;  1X56 A;  2OTJ A;  1JQY D;  1STN A;  1SYG A;  3U9S A;  2A6H C;  1UUP A;  1Q8I A;  2RCN A;  5CV7 A;  4R4I A;  1NJI C;  4DNT B;  3S2H H;  1PH6 A;  1MI2 A;  2I46 A;  1MGS A;  5LMN W;  2QIL A;  1BKB A;  4ZYS A;  4KK7 A;  2B63 G;  3EFX D;  1HTL D;  2RSN A;  2EY1 A;  2KJX A;  4JI0 Q;  3U4V A;  2NVX H;  4IOC A;  3QR8 A;  3CCE A;  3HKZ G;  2QGQ A;  4K5X A;  4M1U B;  1EOV A;  4OEM B;  3E3X A;  5IP9 G;  4JI7 L;  1GKH A;  2K5D A;  3Q6S A;  3S1Q B;  4K8J A;  4DV0 L;  1X3E A;  4B3T L;  3HOV H;  1XTC D;  3HOU B;  4KKS A;  1K3R A;  5GAG C;  4BBR G;  1X54 A;  5ELE A;  4GN3 B;  1Q7Y C;  4AH6 A;  4GOP C;  2UXD L;  1HNW L;  4C3I G;  2R61 A;  1PFS A;  2PQA B;  4JI8 Q;  4E6I A;  4IJH A;  1K9M C;  1R9T B;  3A0J A;  2EJM A;  5IE8 A;  2NVT H;  1JB7 A;  1WTR A;  4NW2 A;  4X3S A;  2FFK B;  3W5O A;  3G48 A;  1RF2 D;  5I9O A;  4KHP Q;  1NSN S;  1OXX K;  2WP8 J;  1B53 A;  4A3I G;  1A8V A;  2JEB I;  4CKC A;  4YY3 L;  2Z6B A;  2Q2U A;  1BO0 A;  2G9H D;  5EPK A;  3RUZ A;  1ENC A;  4GNX B;  3QG1 A;  1M1K C;  5C4Z A;  1F9Q A;  2F0D A;  3U50 C;  2F3I A;  3K81 C;  4NKL A;  1I50 B;  1CQV A;  5CBA E;  2D2C C;  2F0T A;  4FXK C;  2A73 B;  1L0Y B;  1EYD A;  4RKB A;  4HTH A;  4JK1 C;  1X6O A;  5D65 A;  2YV5 A;  3GDE A;  4G7Z C;  1JR0 D;  2F0N A;  1HJP A;  4R1J A;  1YHA A;  1VQM A;  4CJ2 C;  1HZA A;  4KHV A;  2WB1 G;  3DHQ A;  5E4W C;  1DGS A;  1NBW A;  1QCB D;  4KHZ A;  4HAE A;  4GNX A;  4HSV A;  5ISR A;  2MJ8 A;  3S2D H;  2L11 A;  1C48 A;  3F2B A;  4A3D G;  2UXB L;  2JA6 H;  1XMO L;  3KLW A;  2D9U A;  2L0C A;  1EEI D;  3I90 A;  2N88 A;  1KLG D;  3S17 B;  4RA8 A;  1B3A A;  3PUY A;  3FEW X;  3NWS A;  3E0E A;  2PMZ B;  1LT4 D;  1EIY B;  4GLA C;  2PQA A;  2BH8 A;  3EVQ A;  1XJV A;  3A7L A;  4DXG A;  1YNN C;  3BU2 A;  4WOR A;  4OWW B;  5I2X A;  4MNO A;  3PO3 B;  1UE7 A;  1X3P A;  4FDB A;  1TWH B;  3DUZ A;  5EPL A;  3CRK C;  4FP5 D;  5IWA Q;  3SGI A;  4GKK Q;  1NNX A;  1XPU A;  2F03 A;  1D5M C;  4L5S A;  1Y1V B;  2ENB A;  3C46 A;  4A3K G;  5I9P A;  1ZYR C;  1SNO A;  3AB9 A;  2MUY A;  2L4N A;  1OTC A;  2I5L X;  4DV2 Q;  3WOE A;  4DK6 C;  5EPJ A;  5KNC A;  3NPP A;  2KEN A;  1JWM D;  5IP9 H;  2Q2H A;  2IWH A;  1YNJ D;  5CMD A;  1EQV A;  4DN4 M;  4QIW B;  4ZUI A;  1LTS D;  4JV5 Q;  1X32 A;  2B63 H;  4BBR H;  2RDH A;  5LL6 X;  2CH4 W;  4RGM A;  2F0O A;  5T1I A;  5FJ8 G;  5C3X A;  4EX5 A;  3U4Z A;  1S4Z A;  1B1Z A;  1EZ6 A;  3J80 E;  1PMR A;  1V1Q A;  3CAM A;  4P74 A;  3J80 i;  5GAE C;  1OXT A;  2F0P A;  2F0L A;  2R7Z H;  3TP7 A;  5C4J B;  2Z1C A;  1JJ2 A;  4A93 G;  3CCV A;  1EIH A;  3OIP A;  3S1N B;  1Y14 B;  3K6O A;  4IOA A;  2VQE Q;  4DV7 L;  4RGT A;  3D6C A;  3KK7 A;  5M3F G;  3PUX A;  3EA6 A;  3QO2 A;  2B2U A;  5COY A;  1EQT A;  3K7U C;  1XNQ Q;  1LT3 D;  2NN6 H;  1J8I A;  3H94 A;  2EJF C;  3SK5 A;  1XNR Q;  1DZ1 A;  1I94 L;  4TSS A;  3TME A;  1RHP A;  4EQ5 A;  2XVS A;  4JOI A;  1EYA A;  1KAA A;  2ZJQ A;  3I4O A;  3VA5 A;  4LF5 Q;  2A68 D;  2J7Z A;  4G7H C;  4JI8 L;  3M4P A;  2WAQ E;  4G7O C;  4H0L C;  5KIX A;  3HZX A;  3PIO A;  2MFI A;  2F0E A;  3T4A C;  4A3B B;  4C1N K;  1VF7 A;  4LFA L;  1O7I A;  3TN2 A;  2MO1 A;  4AYB B;  2JA8 B;  1SRO A;  5G3L F;  3A56 A;  4WJW A;  3GV3 A;  3PGZ A;  2XRQ D;  1HR0 L;  4BY1 H;  1G8Z D;  1AN8 A;  2LS0 1;  4N8X 1;  3GTM B;  3M3Y B;  4LF7 L;  2IPK D;  1TQO A;  5C6A A;  5HGT A;  2R93 G;  3Q0A A;  1H9K A;  4DR2 L;  1NCV A;  4IUU A;  5IP7 G;  1LTG D;  3BVZ A;  1SNC A;  4X66 L;  3J81 E;  4ZRZ A;  3DWP A;  2E2H B;  1XYI A;  4YWK A;  1HZB A;  2RQX A;  3SXH A;  2JYO A;  3MFG A;  1A3U A;  3V96 A;  2PZT A;  3U9O A;  3MEH A;  4DUY L;  1EFW A;  1I5F A;  1CHQ D;  1QVG A;  1GUW A;  4FXD A;  4XYQ A;  4HMI A;  5C4X B;  2E5L Q;  3PO2 H;  2IJ0 A;  1JJG A;  1BCP B;  1G2T A;  5JAV A;  1RL2 A;  2CH4 A;  3D0F A;  1YVC A;  2HDL A;  2AWN A;  2O2L D;  1JOO A;  1M90 C;  5FLM H;  4DV3 L;  1N33 L;  1B2T A;  5C5L A;  3WDN A;  1YJW A;  3RLN A;  4HCS A;  3H3V H;  3GTO H;  3GTK B;  1EL0 A;  1LT6 D;  3LWE A;  1CZW A;  1KLU D;  3VR3 A;  4A3E G;  3P1H A;  2KBN A;  4JBM A;  4JI1 Q;  1Y1W H;  2BE5 C;  1SYC A;  3IFT A;  1X3Q A;  4POF A;  3S14 H;  2EQS A;  2MQH A;  1TS4 A;  1VQO A;  2L55 A;  2I5M X;  1EY4 A;  4RFB A;  5ELO A;  1QZH A;  4A93 H;  4F7X A;  5IT9 L;  2EY2 A;  4DUY Q;  2F0M A;  3GP7 A;  5M3F B;  4AYB E;  3FPP A;  1ESR A;  5IGC A;  4A75 A;  5K36 G;  1EFI D;  1W6K A;  4LF8 L;  1VQP A;  5DNF A;  1F2M A;  1HQM C;  4ZKC B;  4DKA C;  1CI3 M;  1VQH A;  1TT2 A;  5EKL A;  1YBY A;  2EYF A;  3GTP B;  3EJI A;  3NTI A;  4JI0 L;  2UXB Q;  4DAY A;  4RHS A;  4GNX C;  1SYD A;  1HNX Q;  4IUN A;  3MXN B;  2ICE C;  2OTL A;  5C4X G;  1EWC A;  2BH2 A;  1HR0 W;  4HCE A;  1SXT A;  2KED A;  1H9S B;  1HUM A;  1CA6 A;  4KV6 A;  1BDO A;  2KCT A;  4IFD J;  1RD9 D;  3NEN A;  5EKK A;  4Y52 H;  1DD2 A;  5J1Z A;  5IWA L;  1JMC A;  3H09 A;  3CME A;  2KHJ A;  1PTO F;  3ER0 A;  3HOX H;  2B2V A;  4JI4 L;  1I3Q H;  3NBH A;  3UE0 A;  4HIK A;  4X6A H;  4FF4 A;  1PZJ D;  5IGD A;  1XMQ L;  1DJR D;  1D6E C;  2BA1 A;  4A3M G;  1DOK A;  2K4K A;  1G6P A;  4CDE C;  1HXY D;  3NBH B;  3L0O A;  1HQR D;  1KXL A;  2CKZ B;  3D4D A;  4J6H A;  5A35 A;  4DV2 L;  3HKZ B;  4IZ8 A;  5IOD A;  4A3F H;  4CJ0 B;  3MFY A;  4Z9C B;  5KEE A;  5KND A;  3AU7 A;  2C5C A;  4RH6 A;  4UAI A;  4DV6 Q;  1EIF A;  1Y8P B;  4OIJ A;  3HFZ B;  1JE5 A;  2MNA A;  2NVQ H;  2B63 B;  5D14 A;  1WCM B;  3TS0 A;  2ATW A;  1FL0 A;  4C1N I;  1KAW A;  4K0K Q;  3MXN A;  1PH4 A;  3R2T A;  3BS1 A;  1GUG A;  4ME5 A;  1FNV A;  4DAY B;  1IL8 A;  1D7Q A;  2WB1 B;  2KUM A;  2K52 A;  2A69 C;  4KD3 A;  3GTK H;  1IW7 C;  1GD7 A;  1OXV A;  5FLM G;  3TZU A;  4R8N A;  3T1H L;  2PCF B;  1RKN A;  3T1Y L;  3K5O A;  3IFD A;  4YWL A;  3BDO A;  4IN3 A;  1SMY C;  2PQE A;  2HCC A;  1YHB A;  2HCI A;  4LUZ A;  2RA4 A;  3TDQ A;  3G7L A;  5CBE E;  5EBC A;  2AQ1 B;  4C3H B;  2EZV A;  4AIM A;  2VQF Q;  2SNS A;  3HG9 A;  5D3D A;  1FD7 D;  4PQX A;  4YHH Q;  1KRS A;  1SN8 A;  4JI3 Q;  2PI2 E;  4UP7 A;  5HY6 A;  3WWV A;  3GTO B;  2NWG A;  4RAU C;  5DEH A;  4JOI C;  5E4X A;  1I6H B;  2RVL A;  4JBK A;  2RCF A;  1L1O A;  2K32 A;  4DR7 Q;  2EDG A;  3C2P A;  4LFA Q;  3E9I A;  3PSI A;  4UY8 C;  4DNI A;  3I55 A;  2K05 A;  4J1M A;  4DAP A;  2IW3 A;  4X64 L;  2HIV A;  2L5T A;  4FNF A;  2L15 A;  4JC0 A;  3K0Y A;  4HJ7 A;  3T1H Q;  2Q2T A;  2BCO A;  3D8G A;  1K83 H;  1C8C A;  3A5U A;  3OSO A;  2F0H A;  3UI2 A;  3M3Y H;  3BG3 A;  1ZYR D;  3TS2 A;  1K0S A;  1VF5 C;  2O4X A;  5EAY A;  1CA5 A;  4N8F A;  5C4H A;  5KRU A;  4IQZ A;  3K80 C;  1GXD C;  1UE5 A;  3MC0 B;  3WOF A;  5BN5 A;  1K8A C;  2F0J A;  4LF6 Q;  4CDD C;  1FGB D;  1UE6 A;  1EY5 A;  3NK9 A;  1O7Y A;  2EE1 A;  3LGJ A;  2G9D A;  3J7A F;  1D5Z C;  2CWP A;  4IPG A;  3I8Z A;  1H9J A;  4DFA A;  1C4Q A;  2SOB A;  3I4N G;  1AP0 A;  4K0K L;  3F2C A;  3MAQ A;  5ELD A;  4RGO S;  3BVM A;  4BXX G;  1F77 A;  3JC6 6;  3DXJ C;  1HUN A;  2F0V A;  4LUO A;  2DY7 A;  4B3M Q;  1H95 A;  4O1N A;  3HOV G;  1PTO C;  4DV0 Q;  1SDF A;  2KQ3 A;  3DWA A;  2H4O A;  4ZAI A;  2NUC A;  2R92 G;  4N9T A;  3PCO B;  3JAM c;  1XPO A;  5CV5 A;  4X62 L;  4CBV A;  2A68 C;  1XMQ Q;  1Z7T A;  2C9O A;  2EY5 A;  3W3A A;  3A8I E;  3MTS A;  4RCO A;  3MWY W;  2UXD Q;  1Z9F A;  1WJJ A;  2EXD A;  4L6T B;  1RTN A;  5IYB H;  1GHJ A;  2EYL A;  4KHP L;  1JWU D;  5JVG 3;  2XWJ B;  4K6D A;  3CMA A;  4JI7 Q;  4RG1 A;  1HCZ A;  1QOH A;  4NXN L;  1J5E Q;  1STY A;  2GA4 B;  3QOL A;  3GTP H;  2F0Q A;  2ID0 A;  1B50 A;  4WFN 3;  3R93 A;  1VQE A;  1K8G A;  1Q1E A;  4NPS A;  1KDB A;  2OEO A;  3RR5 A;  2K33 A;  4XQJ A;  3MXG A;  3K8A A;  3NE5 B;  2SEB D;  5AFW A;  1IBM Q;  2AQ3 B;  4LNQ A;  2UU9 L;  1MSG A;  4DR1 L;  3NTH A;  5M5X B;  2F0S A;  1O7L A;  4CHT B;  4JI5 L;  2R7Z B;  2LSS A;  3NEL A;  4ID6 A;  1B44 D;  5M3M G;  1Y1W B;  1VQJ A;  1C7Y A;  3T53 B;  4IUR A;  4PV1 C;  2ASB A;  3VYR A;  1XNQ L;  3STB C;  3CC4 A;  1QB5 D;  1V1O A;  5EKI A;  2Z8L A;  2V1C C;  5IGB A;  1WTW A;  1HNZ L;  3CCJ A;  1PH1 A;  1N34 Q;  1YIJ A;  4DUZ Q;  1BOS A;  1ENA A;  4X3T A;  1XXG A;  2LFN A;  1IYJ B;  2A8V A;  5IOC A;  2OCE A;  4K5V A;  4LAA A;  1YJ9 A;  1H9M A;  5C3E B;  2XNA C;  3BDL A;  3HOW B;  2AQ2 B;  1BUV T;  2VS1 A;  1IBM L;  2FMC A;  1DCZ A;  2IL8 A;  2JQO A;  3CCR A;  1PH7 A;  4JI2 Q;  2DNE A;  1F9R A;  1SYB A;  2PNH A;  1ET9 A;  3D4W A;  4QIW E;  1HZ9 A;  1PZI D;  5LMU Q;  2JP1 A;  3E0J A;  2A6E D;  3HKZ E;  4FVM A;  4KI0 A;  3NUC A;  5C0X G;  1U9R A;  1IBK L;  1CKM A;  1N36 Q;  1Y8O B;  5GQO A;  4DF7 A;  4JI6 L;  1W3S A;  4POG A;  2UUA L;  2UUC L;  1VDZ A;  3G71 A;  3GTM H;  4A3F G;  3FDT A;  4XIG S;  2JA5 G;  1MIU A;  5H1S E;  1NAP A;  5C0X H;  4DUZ L;  1Y69 U;  1L0X B;  4RMF A;  4OXP A;  5FLX E;  5IGG A;  1KQS A;  1CFM A;  2E5L L;  3U58 A;  3SK8 A;  1TWC B;  3W1B A;  2R93 H;  3A8J E;  4YWM A;  3M85 A;  3A7A B;  4H13 C;  5FOB B;  2E2I B;  2QEJ C;  1F9P A;  1U4P A;  1HZC A;  1XWE A;  4ME3 A;  1PH8 A;  2PW5 A;  2RDF A;  2RHS B;  1B9N A;  1SMY D;  5E3F A;  4LF8 Q;  4U67 3;  2JA7 B;  1PYB A;  4L5Q A;  1N36 L;  1O7Z A;  4DV5 L;  4OX9 L;  1GUS A;  2K5V A;  1ESF A;  1UNS A;  3H15 A;  2NN6 G;  1CKO A;  3F2U A;  4BY7 H;  5EQ0 A;  1LUZ A;  4DK0 A;  2Z0S A;  4CDC C;  1VQ5 A;  1TWA B;  5IYC H;  4ODG A;  1SEB D;  1UWV A;  1PYS B;  1DYQ A;  1KNE A;  1PH9 A;  1JE4 A;  4HR7 B;  4PMB A;  5C44 G;  4IUP A;  4WRD A;  2D5D A;  1HR0 Q;  1VQA A;  2YTX A;  3HOW H;  1S5F D;  5J39 A;  3ONA B;  1EUJ A;  3NXW A;  3RZD B;  4IAL A;  4NXM Q;  2N49 A;  3S1R B;  5G3L D;  2PI2 A;  2XWB B;  3EBE A;  3VYT A;  3CC2 A;  2F0K A;  4QCL A;  3ND8 A;  4IPD A;  5IT9 E;  3MA2 B;  1E2Z A;  1WTO A;  5M5W H;  1A3T A;  2KEE A;  4IPH A;  4KY7 A;  4IJL A;  1N32 L;  2EYJ A;  1YNX A;  4KY5 A;  4ALP A;  1HFN A;  3RZO H;  3S9W A;  5DM6 3;  1JIC A;  3H3V C;  3PF5 A;  1CK1 A;  3CW2 C;  1CKN A;  1QNU A;  4G4K A;  1IYV A;  3ULP A;  5JEA H;  5COR A;  2N78 A;  4ZCK A;  4DV5 Q;  5IGF A;  4YCW A;  1JT8 A;  1SJE D;  4R4C A;  4TVA B;  4KKT A;  1QNK A;  4JI5 Q;  1CM9 A;  3GQB A;  3H0G B;  5K36 H;  2B29 A;  1Q82 C;  3SK6 A;  1K73 C;  3J81 i;  1CSQ A;  1EY8 A;  3HOX B;  3HEJ A;  1R4P B;  1MKH A;  2Z6K C;  2CQO A;  2F0W A;  4PZ6 A;  1A63 A;  4EVO A;  4OWT B;  2B2W C;  4RKL A;  5KYL A;  3TRE A;  3S16 B;  5FO9 B;  3Q22 A;  3SVM A;  1VQC A;  4FF2 A;  3BZK A;  1V1P B;  3L3O C;  3H0G G;  1FNU A;  3SE0 A;  2HQL A;  1QUQ B;  2CW0 D;  2I5H A;  2K01 A;  2IX1 A;  4IFD I;  2EXZ A;  1V9P A;  1F2Y A;  3CCS A;  2C35 B;  3KF6 B;  2UU9 Q;  5GRO A;  1SE3 A;  3CRL C;  2EYM A;  2IHE A;  1YHQ A;  3KUP A;  4J15 A;  1VQK A;  3J81 j;  3ITP A;  2R93 B;  2VUM H;  3Q8D A;  5IY0 A;  2YYZ A;  3PV0 A;  1CUK A;  2JSO A;  4AQY Q;  2K75 A;  1BBX C;  1KAB A;  3E5S A;  3CCU A;  3VR4 A;  2Z4H A;  2IX0 A;  1WI5 A;  4P72 A;  5NUC A;  4ZKB B;  1NUC A;  4HJ9 A;  3S15 B;  1WCM G;  3R2I A;  3P7J A;  5CC4 A;  1GUT A;  3PIP A;  1YIT A;  5JJI A;  2F4V Q;  2K5W A;  3VR5 A;  1O80 A;  2RKS A;  3OWF A;  4A3G G;  2N3S A;  4F88 A;  3OMG A;  1MD2 D;  4DNR B;  4B9X A;  1KC8 C;  1ICF B;  1C9O A;  2QDL A;  3TP8 A;  4DA2 A;  2FIN B;  1E7Z A;  2R7Z G;  2EOT A;  2IHF A;  1G91 A;  1PRT B;  3BDC A;  3RN2 A;  3MXP A;  5C44 H;  1GHK A;  1ZKO A;  2NTS A;  2X6L A;  2A74 C;  5F2D A;  1JOR A;  4LF9 L;  3RN5 A;  1SE2 A;  1TS2 A;  4DGZ A;  1TR5 A;  2EJG C;  1PXU A;  5FKA C;  1SJH D;  1AE2 A;  2WAC A;  4DR2 Q;  3KOJ A;  4H44 C;  2KEC A;  1IYU A;  3OWE B;  3TP6 A;  4YCV A;  2VB2 X;  3BZC A;  2L9H A;  5JJK A;  2F3V A;  1QWY A;  4LMQ D;  5KYI A;  4C3H H;  4LWC A;  2Y0S E;  2EYO A;  4M8A A;  1Q90 A;  4DAM A;  3J7A 5;  5IT9 c;  2KVM A;  5FO7 B;  1ZXT A;  4O0A A;  3HOU H;  3T56 B;  2WAQ G;  3K7A B;  5C4J H;  4OHJ A;  5GAH C;  4A3J G;  4BA1 I;  5C4X H;  1A6X A;  2HUG A;  4HIM A;  4JI4 Q;  2ZM6 L;  3R3O A;  4XTC S;  1G2S A;  2E74 C;  3OMC A;  4RCN A;  1R4Q B;  4A3I H;  3R8B A;  4BY1 B;  3L9A X;  2R6G A;  4R4Q A;  1SNP A;  3PQI A;  1VMP A;  1L0W A;  3CQZ H;  4I7A A;  2JN4 A;  1WTX A;  2WKD A;  1ET6 A;  1TWA H;  1X55 A;  4LK1 C;  1EY9 A;  1WFQ A;  1MJE A;  1NR2 A;  1LTB D;  2B39 A;  2MO0 A;  4L63 B;  3FHW A;  3KBG A;  2PNR C;  4A3E B;  2JE6 I;  4JI3 L;  2F0U A;  1I4Q A;  1L2F A;  3T16 A;  3PMF A;  4QMG A;  1WD1 A;  1M8A A;  2R3Z A;  3RMH A;  1SYE A;  4OWX B;  1B8A A;  4UDU C;  2EIF A;  1I4P A;  1HA5 A;  1LTR D;  3PO2 G;  3I2Z A;  3F8T A;  1PLF A;  4WJ3 M;  4A3B H;  1SNM A;  4FF3 A;  2AUK A;  1TS3 A;  2OF1 A;  1IXR A;  3SDZ A;  4PZ8 A;  2J4X A;  4C3I H;  3HOY G;  1PH2 A;  1MJC A;  3K0X A;  1Y8N B;  3LNN A;  1HFG A;  1STB A;  1BCP F;  4JG2 A;  2UUC Q;  2Q8I B;  2CQA A;  3ERO A;  5C0X J;  4DR6 L;  5IYB G;  1E1T A;  1K83 B;  1K3B C;  2RSO A;  3I4M B;  3ULL A;  3GV6 A;  3KLS A;  5LHY 1;  2PZU A;  1PH3 A;  2AUJ D;  2NB0 A;  4CGY B;  4JVZ A;  1IBK Q;  4HN7 A;  3CCL A;  5KNB A;  1YNJ C;  4DR7 L;  2E2J B;  1EYG A;  4XT1 B;  4K6L A;  2R92 B;  1G6Z A;  4A3J H;  1TWF H;  1ILP A;  2WIN B;  4YY3 Q;  3J7A V;  3K57 A;  4FO2 A;  1LTL A;  2AHO B;  3VR2 A;  3JAM E;  3O13 A;  3J80 L;  5C3E H;  3J81 c;  2TSS A;  1PHJ A;  1JC7 A;  2MP1 A;  4IUQ A;  1PYW D;  4C3H G;  3N52 A;  3S14 B;  1FNW A;  1ASZ A; 
#chains in the Genus database with same CATH homology
 3U50 C;  1XMQ Q;  2F3I A;  3K81 C;  1CSP A;  2WB1 E;  4A4I A;  4A3L G;  2I0Q A;  3ERS X;  4LF9 Q;  2UXD Q;  1Z9F A;  1WJJ A;  3UDX A;  1KD1 C;  2ZJP A;  2EXD A;  2JA8 H;  2FXQ A;  1E1O A;  5M5X H;  5IYB H;  1X6O A;  2Y0S G;  4KHP L;  2YV5 A;  1PA6 A;  3M9B A;  3GDE A;  3CMA A;  2UXC L;  4JI7 Q;  4RG1 A;  4UP9 A;  1HJP A;  4R1J A;  1YHA A;  3GO5 A;  2IT1 A;  5C0X I;  4NXN L;  1VQM A;  1J5E Q;  2E8G A;  1HZA A;  3GTP H;  2WB1 G;  2ID0 A;  3CD6 A;  1DGS A;  1V43 A;  4UY8 C;  1NBW A;  5LMU L;  4KHZ A;  4GNX A;  1VQE A;  1K8G A;  1Q1E A;  2VW9 A;  4NPS A;  4AYB G;  2JA8 G;  3S2D H;  5M3M H;  3FP9 A;  3RR5 A;  2JEA I;  1AH9 A;  3F2B A;  4A3D G;  2UXB L;  4GS3 A;  3K8A A;  2AKW B;  1XMO L;  2D0P A;  1IBM Q;  2JA6 H;  3KLW A;  2B3G A;  4LNQ A;  2UU9 L;  3FKI G;  3ZJY C;  4DR1 L;  1FGU A;  1S72 A;  2E2I H;  4H02 A;  4HJA A;  3PUY A;  3PUW A;  2XGT A;  1N8R C;  3E0E A;  4OON A;  2VQF L;  3S15 H;  1EIY B;  4GLA C;  4X66 Q;  2PQA A;  2BH8 A;  4JI5 L;  3G6E A;  2LSS A;  2BA0 A;  1W2B A;  1XJV A;  2UUB L;  1S40 A;  3NEL A;  5IYD H;  4GN4 B;  1HNZ Q;  5AJ3 L;  5M3M G;  1VQJ A;  3BU2 A;  2E2J H;  4OWW B;  4DV1 Q;  1C7Y A;  1VS0 A;  4MNO A;  2ASB A;  4BXX H;  1XNQ L;  1UE7 A;  3STB C;  1G29 1;  4FDB A;  2HHH L;  3CC4 A;  4L5R C;  2V1C C;  1HNZ L;  3AQQ A;  4JV5 L;  3CCJ A;  1PH1 A;  5IWA Q;  3CF5 A;  3SGI A;  3T1Y Q;  1YIJ A;  1N34 Q;  1XPU A;  2YU9 H;  4BA2 I;  4GKK Q;  1C0A A;  4DUZ Q;  4L5S A;  4TQU S;  4JYA L;  1YZ6 A;  1IYJ B;  3GD7 A;  2A8V A;  4A3K G;  3GTL H;  2OCE A;  1YJ9 A;  3KFU A;  1E22 A;  2NN6 I;  4UP8 A;  2D0O A;  4B3T Q;  4DR1 Q;  2RHQ B;  5FJ8 H;  5LMN L;  1OTC A;  2I5L X;  4DV2 Q;  2VS1 A;  3ICE A;  1ASY A;  2LXJ A;  1IBM L;  4DK6 C;  2JQO A;  3CCR A;  2KEN A;  4JI2 Q;  1PH7 A;  5IP9 H;  1GVP A;  2Q2H A;  1BVS A;  2PNH A;  2A1A A;  3CCM A;  3KJO A;  1YJN A;  1WCM H;  1HZ9 A;  4QIW E;  4DV4 L;  5LMU Q;  1QVC A;  4JV5 Q;  4DV4 Q;  3HKZ E;  4KI0 A;  5C0X G;  4NB3 A;  4QJF A;  1IBK L;  5M3F H;  1CKM A;  2YTY A;  3AFP A;  4BBR H;  4GLX A;  4JBJ A;  1N36 Q;  5GQO A;  2B63 H;  3S24 A;  4A3L H;  4A3E H;  5FJ8 G;  4JI6 L;  2D62 A;  4Y7N H;  5AJ3 Q;  4EX5 A;  1W3S A;  4MTN A;  3TQY A;  4POG A;  3U4Z A;  4JBW A;  3RLF A;  1V1Q A;  4P74 A;  3CAM A;  3J80 i;  1OXU A;  5GAE C;  2UUA L;  3OTO Q;  2UUC L;  1OXT A;  4R4T A;  3G71 A;  2ZTC A;  3GTM H;  4A3F G;  1VQ6 A;  1SFO H;  2R7Z H;  4XIG S;  4BY1 G;  1JJ2 A;  2JA5 G;  3CCV A;  1MIU A;  5H1S E;  1VQ8 A;  4JCV E;  1Y14 B;  4DUZ L;  3M7N A;  1E3P A;  1L1O B;  3MEF A;  4RMF A;  3J80 c;  4OXP A;  2VQE Q;  4KLK A;  4DV7 L;  3KJP A;  4IOA A;  1KQS A;  3W1G A;  5M3F G;  2E5L L;  3PUX A;  1HH2 P;  5JEA G;  2NZO A;  3U58 A;  1U5K A;  4LFB Q;  4LUV A;  3K7U C;  3W1B A;  2R93 H;  3PO3 G;  1XNQ Q;  2CWA A;  4YWM A;  5JEA J;  3M85 A;  4BY7 G;  1OXS C;  2R7F A;  4A93 G;  4GKJ Q;  4HJ8 A;  4DR4 Q;  4NXM L;  1XNR Q;  1Q81 C;  1VQL A;  2QEX A;  1I94 L;  1HZC A;  3CPW A;  4ME3 A;  1VQF A;  1PH8 A;  4B3M L;  2RHS B;  1KL9 A;  4EQ5 A;  3FKI H;  4JOI A;  3TRZ A;  2ZJQ A;  3NEM A;  1VQ9 A;  4LF8 Q;  1PYB A;  3I4O A;  4L5Q A;  1N36 L;  2K5H A;  4DV5 L;  4LF5 Q;  4OX9 L;  1L1O C;  4P75 A;  1LYL A;  2K5V A;  4JI8 L;  3M4P A;  2WAQ E;  3H15 A;  3PIO A;  1TWH H;  2NN6 G;  1VQN A;  2MFI A;  4HIO A;  1EQQ A;  1CKO A;  2RF4 A;  3K7A H;  2HHH Q;  4BY7 H;  1LUZ A;  3CC7 A;  2Z0S A;  1TWG H;  4C3J H;  1FVI A;  1VQ5 A;  5IYC H;  4LFA L;  2R92 H;  1NY4 A;  2E2H H;  4UPA A;  1O7I A;  1UWV A;  1SRU A;  1PYS B;  3KYH C;  2MO1 A;  1PH9 A;  1SRO A;  3ULJ A;  5LMN Q;  5C44 G;  1IBL Q;  3PGZ A;  1PH5 A;  2ES2 A;  1NMF A;  1HR0 L;  4BY1 H;  1HR0 Q;  1VQA A;  2YTX A;  3HOW H;  3I4M H;  3S17 H;  3S1M H;  4LF4 Q;  1EUJ A;  4LF7 L;  4NXM Q;  2N49 A;  1XNR L;  4GKJ L;  2PI2 A;  2ALY B;  2R93 G;  3KDF A;  3EBE A;  3CC2 A;  4DR2 L;  3L2P A;  5IP7 G;  4R4O A;  4IFD G;  1B7Y B;  1GO3 E;  4IPD A;  4PG3 A;  4X66 L;  4X62 Q;  4OX9 Q;  2DGY A;  1WYD A;  1HNW Q;  2A19 A;  4DR5 Q;  2KHI A;  5M5W H;  4DV6 L;  3I4M G;  4NXN Q;  4DPG A;  3J7Z C;  4IPH A;  1HZB A;  4YWK A;  4IJL A;  3EIV A;  1N32 L;  3OYY A;  4YHH L;  3I7F A;  1YNX A;  2LXK A;  2AMC B;  4ALP A;  4X65 L;  3AYH B;  3RZO H;  4DR4 L;  4DUY L;  1N32 Q;  1EFW A;  1Q12 A;  1I5F A;  3PF5 A;  4A3K H;  3CW2 C;  2Q2I A;  1CKN A;  1QVG A;  3H3V I;  1S3O A;  1U0L A;  3ULP A;  4B3R L;  1VQB A;  2E5L Q;  3PO2 H;  1JJG A;  1NTG A;  2F4V L;  2N78 A;  1VQ4 A;  1RL2 A;  4DV5 Q;  5IYD G;  3HOZ H;  4JI1 L;  3D0F A;  1Q46 A;  1YVC A;  4YCW A;  3GTQ H;  2AWN A;  1M90 C;  1GM5 A;  1JT8 A;  1X3F A;  5FLM H;  4GOP B;  3HOU G;  4DV3 L;  4R4C A;  4TVA B;  1N33 L;  3I56 A;  1I94 Q;  1YJW A;  4IPC A;  1VQI A;  4JI5 Q;  3RLN A;  3JAM i;  2HIX A;  3H3V H;  1EQR A;  3GTO H;  3M4Q A;  4GN5 A;  2F52 A;  2IY5 B;  2VZA A;  1FJG Q;  4A3E G;  2B29 A;  1VCI A;  1Q82 C;  1YEZ A;  3H0G H;  2KBN A;  1K73 C;  1KRT A;  4JI1 Q;  4DK3 C;  3J81 i;  1Y1W H;  1IBL L;  4JBM A;  1IL2 A;  1I50 H;  1CSQ A;  4POF A;  3S1N H;  3S14 H;  2EQS A;  2MQH A;  1MKH A;  1VQO A;  2I5M X;  2Z6K C;  2CQO A;  2AWO A;  4PZ6 A;  2GN5 A;  3L7Z C;  4QL5 A;  1HNX L;  1A63 A;  1RIP A;  3F1Z A;  5ELO A;  3HOX G;  3S1R H;  3STB D;  4HID A;  1QZH A;  4OWT B;  2JA5 H;  3PF4 A;  4A93 H;  4MZ9 A;  1Y1V H;  3TRE A;  4DUY Q;  2OWO A;  1VQC A;  2PMZ E;  2KCM A;  3UE1 A;  3BZK A;  4AYB E;  2UUA Q;  4L5T A;  4LF5 L;  4A75 A;  3H0G G;  5K36 G;  1NE3 A;  4LF8 L;  2HQL A;  1QUQ B;  2I5H A;  1VQP A;  2IX1 A;  4IFD I;  1V9P A;  1BBU A;  1EWI A;  4DKA C;  3CCS A;  4APV A;  2C35 B;  4GKK L;  1VQH A;  3KF6 B;  4HJ5 A;  2UU9 Q;  1YBY A;  5GRO A;  3CPF A;  1A0I A;  2IHE A;  2ZJR A;  1YHQ A;  1K0R A;  3AEV A;  3HOZ G;  4JI0 L;  2UXB Q;  3KF8 B;  4GNX C;  2R7D A;  4J15 A;  1HNX Q;  1VQK A;  3MXN B;  3J81 j;  2OTL A;  5C4X G;  1T9H A;  4OO1 G;  4QGU A;  2VUM H;  4O2D A;  3Q8D A;  2N8N A;  5HGQ A;  2BH2 A;  1HR0 W;  5IY0 A;  2YYZ A;  3A74 A;  1CUK A;  3PV0 A;  3S1Q H;  4AQY Q;  2K75 A;  3CCQ A;  4LW1 A;  3RLO A;  3GTJ H;  3CCU A;  3HKS A;  2JA9 A;  2KCT A;  3OW2 A;  2IX0 A;  1JJC B;  1WI5 A;  4DR5 L;  3RZD H;  2JJQ A;  3NEN A;  4IFD J;  1AE3 A;  4P72 A;  4YCU A;  4Y52 H;  5IWA L;  1JMC A;  1Z47 A;  3RNU A;  4HJ9 A;  3CME A;  2KHJ A;  3HOY H;  5GAD C;  1CKN B;  1WCM G;  3A5Z B;  3ER0 A;  1YI2 A;  3HOX H;  3DLL A;  1B70 B;  2Z6K A;  2ZM6 Q;  2VUM G;  4JI4 L;  1I3Q H;  1BBW A;  3CP0 A;  3UE0 A;  2GVA A;  3PIP A;  4HIK A;  4B3S Q;  4X6A H;  1YIT A;  5JJI A;  1UE1 A;  1G51 A;  2F4V Q;  1TWC H;  3GTG H;  4A3G G;  1XMQ L;  2N3S A;  2UUB Q;  2BA1 A;  4A3M G;  2K4K A;  2ZTE A;  2JK8 A;  1KC8 C;  1G6P A;  2K5N A;  1KHI A;  3NBH B;  1C9O A;  2XTI A;  3L0O A;  1J5E L;  2CKZ B;  4A3C G;  1KXL A;  3I4N H;  5J3B A;  1FJG L;  1IZ6 A;  3G4S A;  3DM3 A;  4DV2 L;  1VQ7 A;  1E7Z A;  4A3F H;  2R7Z G;  3AFQ A;  1NMG A;  2IHF A;  2QA4 A;  1WOC A;  4P73 A;  4DV3 Q;  1N33 Q;  4DR3 Q;  2JA7 H;  3RN2 A;  1Q1B A;  5C44 H;  3TEH B;  4QQB X;  3BJU A;  4DV6 Q;  2OQ0 A;  1EIF A;  4A3M H;  4LF9 L;  3HFZ B;  3CXC A;  1JE5 A;  1XTD A;  2MNA A;  3RN5 A;  1N34 L;  2NVQ H;  3PO3 H;  4LFB L;  3S16 H;  4A3B G;  1X65 A;  1AE2 A;  1SE8 A;  3TS0 A;  2ATW A;  4DR2 Q;  1FL0 A;  3KOJ A;  1VQD A;  1KAW A;  4K0K Q;  3B6Y A;  1PH4 A;  4YCV A;  4DV1 L;  1X9N A;  3BZC A;  4WJ4 A;  5JJK A;  1PV4 A;  5DLQ E;  4DAY B;  4QY7 A;  4C3H H;  1Q86 C;  4LWC A;  2Y0S E;  4LFC Q;  2JA7 G;  2UXC Q;  1PVO A;  5FLX c;  1D7Q A;  3KF6 A;  1KIX A;  4OO1 I;  4DAM A;  2K52 A;  3J7A 5;  5IT9 c;  4GLV B;  4O0A A;  1VQG A;  4PZ7 A;  3GTK H;  1GD7 A;  1OXV A;  4BBS G;  5FLM G;  1QUQ A;  3HOU H;  4A3D H;  1UEB A;  3T1H L;  2WAQ G;  1X3G A;  3T1Y L;  5C4J H;  4YWL A;  2K50 A;  5GAH C;  4A3J G;  5IYC G;  1XMO Q;  4BA1 I;  5C4X H;  2VQE L;  4DV7 Q;  4LF6 L;  4B3R Q;  4HIM A;  4JI4 Q;  2ZM6 L;  4XTC S;  1E24 A;  3E9H A;  4JI2 L;  1YHB A;  1SMX A;  2VY3 A;  2ZTD A;  4DR3 L;  4LUZ A;  1R9T H;  5C3E G;  4IO9 A;  4A3I H;  4LF7 Q;  4C2M H;  4R4Q A;  2R6G A;  4LF4 L;  4X65 Q;  3VDY A;  3HOW G;  1TXY A;  4AIM A;  2CFM A;  2VL6 A;  2VQF Q;  4YHH Q;  3F2D A;  1KRS A;  1SN8 A;  4JI3 Q;  2PI2 E;  4UP7 A;  5HY6 A;  3WWV A;  1L0W A;  5M5Y H;  2WFW A;  3CQZ H;  4JOI C;  1Y1V G;  2JA6 G;  2NZH A;  5E7N A;  2HT1 A;  4JBK A;  2H5X A;  1L1O A;  4DR7 Q;  4PMW A;  1X55 A;  3E9I A;  1TWA H;  2YTV A;  3PSI A;  4LFA Q;  5IP7 H;  1WFQ A;  1N9W A;  5BR8 Q;  4GOP A;  3D31 A;  4DNI A;  3EN2 A;  5BR8 L;  3I55 A;  1MJE A;  2CCZ A;  3M4O H;  4A3G H;  1X56 A;  2MO0 A;  2OTJ A;  1Y1W G;  4X64 L;  2HIV A;  3FHW A;  4P71 A;  1Q8K A;  5ELN A;  2L15 A;  4JC0 A;  2RCN A;  4HJ7 A;  4R4I A;  3T1H Q;  2Q2T A;  1NJI C;  3S2H H;  1XPR A;  1K83 H;  4BBS H;  2JE6 I;  2OQK A;  4JI3 L;  3A5U A;  1PH6 A;  1QVF A;  1L2F A;  3M3Y H;  5LMN W;  4A3C H;  1BKB A;  3TS2 A;  5EAY A;  1QZG A;  4OWX B;  4X64 Q;  2B63 G;  1I6H H;  1B8A A;  2EIF A;  4A76 A;  3UDI A;  3PO2 G;  3I2Z A;  3F8T A;  3K80 C;  4WJ3 M;  4A3B H;  1UE5 A;  4JI0 Q;  1K8A C;  4LF6 Q;  3U4V A;  1UE6 A;  2DUD A;  2NVX H;  1IXR A;  4IOC A;  2K14 A;  4PZ8 A;  3UDF A;  2NVY H;  3CCE A;  4C3I H;  1A62 A;  3HOY G;  3HKZ G;  2QGQ A;  1MJC A;  1PH2 A;  3LGJ A;  3K0X A;  1EOV A;  5IP9 G;  3KDF B;  4JI7 L;  1GKH A;  2CWP A;  3IRB A;  4IPG A;  3OTO L;  4JG2 A;  2UUC Q;  4AQY L;  5C0X J;  4DV0 L;  4DR6 L;  5IYB G;  1E1T A;  3PUZ A;  1SLJ A;  1X3E A;  4B3T L;  4JYA Q;  3HOV H;  3ULL A;  1K3R A;  3PUV A;  5GAG C;  4BBR G;  4JI6 Q;  1X54 A;  1PH3 A;  1P16 A;  3I4N G;  4LFC L;  4K0K L;  4GN3 B;  3F2C A;  4AH6 A;  4GOP C;  1Q7Y C;  2UXD L;  1IBK Q;  1HNW L;  3CCL A;  4DR7 L;  4BXX G;  1PFS A;  1EYG A;  2PQA B;  4JI8 Q;  5JJL A;  3JC6 6;  4IJH A;  1K9M C;  4B3S L;  2GVB A;  3A0J A;  5IE8 A;  2NVT H;  4A3J H;  4LUO A;  1JB7 A;  1TWF H;  3W5O A;  4YY3 Q;  4B3M Q;  3G48 A;  1D8L A;  1LM0 A;  1H95 A;  3HOV G;  1LTL A;  2AHO B;  4KHP Q;  1OXX K;  4DV0 Q;  4DR6 Q;  2WP8 J;  5C3E H;  1A8V A;  1P8L A;  2JEB I;  3J81 c;  4A3I G;  2VNU D;  1PHJ A;  4YY3 L;  2Q2U A;  2R92 G;  1SR3 A;  4GNX B;  3PCO B;  1J6Q A;  3JAM c;  1XPO A;  1M1K C;  4X62 L;  3UDG A;  1ASZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...