2YTXA

Solution structure of the second cold-shock domain of the human kiaa0885 protein (unr protein)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
97
structure length
97
Chain Sequence
GSSGSSGNIMLLKKKQARCQGVVCAMKEAFGFIERGDVVKEIFFHYSEFKGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Cold shock domain-containing protein E1
publication title The NMR solution structures of the five constituent cold-shock domains (CSD) of the human UNR (upstream of N-ras) protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ytxA01
1HR0Q 3HOVH 2YU9H 1N34L 1WCMH 2WB1G 2VQFL 1VQNA 2YV5A 2C35B 1V9PA 1J5EQ 3CQZH 2E2JH 2R92G 2AMCB 4QY7A 4GKKL 3UDFA 2IX1A 1O7IA 3E0EA 1XTDA 3F2CA 1Y14B 4K0KQ 4GOPB 4YCVA 3KOJA 3W1BA 5IP7G 4BBSG 3D0FA 3GTLH 5BR8L 2Q2UA 1K73C 1UWVA 4GN5A 3TS2A 1VQKA 3E9IA 3T1YL 3ULPA 5C0XI 4JI3L 3HOXG 3AEVA 3B6YA 3S1MH 1IBML 4BY1H 1BKBA 4DUZQ 3CD6A 2MO1A 3GDEA 2EQSA 1EOVA 3L7ZC 3A74A 3S24A 3ULLA 3STBD 5C4XH 1EUJA 2NVXH 1S40A 4JV5Q 3CCEA 1EYGA 4DUYQ 1I94L 4LF9L 1X3GA 4TQUS 4IPHA 3G71A 1XMOQ 1YJWA 4JI2L 2R93G 2A1AA 2OQKA 3TREA 4KHZA 2UUCL 2UXBQ 1VQOA 4DR1Q 2QEXA 2PNHA 4QL5A 2OWOA 3DLLA 3GTQH 4LFAL 1XNRQ 3CW2C 1XNQL 2UUAQ 1VQMA 2Q2IA 3RN2A 1QVGA 1AE3A 1X3FA 2Q2HA 3JC66 3RR5A 3CMEA 2NVTH 4YCUA 3AQQA 5LMNW 4LF7L 3JAMi 4QJFA 2BH2A 1TWHH 4A93G 5IY0A 2IHFA 5LMUQ 1JT8A 2WFWA 2F4VQ 1CUKA 3H0GH 1E3PA 4DV3L 1B8AA 3I4NH 1YJNA 3GD7A 1VQAA 3J80c 4DV4L 4TVAB 3CPWA 2HIXA 3S14H 1Q12A 3FHWA 4LFCL 3S16H 1WOCA 1YNXA 2VZAA 2MO0A 4GNXB 5IYDH 4IOAA 4OO1G 1CSQA 2YTVA 2JJQA 5IYBH 1HH2P 3J7A5 4WJ4A 3PUZA 3HOUH 1LTLA 3H3VI 3L0OA 2ZM6L 3W1GA 4A75A 4A76A 1SMXA 3OTOQ 1WCMG 3T1HL 1KAWA 1X3EA 1SR3A 3PIOA 3VDYA 1KD1C 4UPAA 3S2HH 3UDGA 3M3YH 3J81j 1Y1WH 2B3GA 2EXDA 4R4CA 3S1RH 4ME3A 3EIVA 1A62A 4LF6L 4UY8C 2PI2E 3AFQA 4IJHA 1FJGL 3AFPA 1SE8A 1VQCA 2NZHA 1PH6A 5GAGC 1WJJA 4X62L 2VQEQ 5IWAQ 4IPGA 1VCIA 4A3LH 2N3SA 4LF5L 4BY1G 4LFBQ 1OXTA 1X6OA 4OWTB 1XPRA 2BA1A 4DR3Q 5C4XG 1JMCA 2MQHA 4GNXC 3KJOA 1J5EL 4XIGS 1P8LA 1N9WA 4K0KL 1X65A 3M4PA 1VQFA 3ER0A 4L5TA 3SGIA 4GLAC 5C0XG 3G4SA 2N8NA 2ZTDA 1MKHA 1NTGA 1Z47A 2A19A 4LW1A 3W5OA 3E9HA 5IYCH 1AH9A 3HOWH 4A3JG 5J3BA 1A63A 1CKOA 1Q82C 3KYHC 1HNZQ 1L2FA 4C3IH 4DUZL 4P73A 4AYBE 3DM3A 5EAYA 3PF4A 4JV5L 2D0PA 3J81i 4C3JH 2CKZB 4A3BH 4DUYL 1K83H 1XMOL 4Y52H 5GADC 4A3EH 4B3MQ 2K14A 2RHQB 4DV7L 2GVBA 1VQEA 3AYHB 1MIUA 4R4QA 2KCMA 2KENA 3UDXA 4DR1L 4QQBX 3I4NG 1D7QA 1SFOH 2ASBA 4IFDJ 1XNRL 3NEMA 1K9MC 1Q8KA 4H02A 2UUAL 1E7ZA 1H95A 2Z6KA 2K52A 3I56A 2AHOB 3CC7A 5IYDG 4P71A 3BZCA 4AIMA 2JA6H 1JJ2A 1VQ7A 3GTMH 1TWFH 4RMFA 4WJ3M 1BVSA 1KIXA 3HOUG 1KC8C 1UE1A 3UE0A 4BXXH 2F4VL 1L0WA 5C4JH 2GN5A 3K0XA 1CSPA 4MTNA 1KL9A 3JAMc 4O0AA 5AJ3Q 5M3MH 4RG1A 1X9NA 3CPFA 4HJ5A 2Z6KC 1C0AA 2DGYA 1Y1WG 2CWPA 3M9BA 3PGZA 4JI4Q 2YYZA 4JC0A 4JCVE 2RHSB 4DR2Q 4A3IH 1N36Q 1M1KC 4DR6Q 1KXLA 4PMWA 4DR7Q 4IJLA 1C9OA 4X64Q 5LMNQ 2ZTCA 4DV5Q 2Y0SE 3CAMA 2I5HA 4P74A 3CCJA 4O2DA 1HZ9A 1VQDA 3I4OA 4JBKA 3PUYA 1N33Q 4A3LG 2KHJA 3K81C 1QZHA 3M4QA 3CCUA 4ALPA 4HJ8A 3OTOL 2CQOA 3TQYA 1E1TA 1KRSA 2E8GA 1XPOA 4GS3A 4PZ7A 1PH9A 2ZJQA 2R7ZH 2XGTA 1Z9FA 2GVAA 4BY7H 1OXXK 1PV4A 2ZJRA 3GTPH 2K5VA 1IBLL 4A3DG 2VQEL 1RL2A 3HKZE 5IYCG 5IWAL 2UXCQ 1YHBA 2YTYA 2AWNA 4JI1Q 4C3HH 3PF5A 1MJEA 4GKJQ 4LFBL 3HFZB 4Y7NH 3HOYH 4HJ9A 3GTOH 4BBRH 1TWAH 2B29A 4IPDA 4X6AH 4A3BG 1K3RA 3KF8B 4NPSA 1QZGA 4JYAQ 2WP8J 1BBWA 4DKAC 1L1OB 4GN4B 4A3EG 3RZDH 2E5LQ 1Q1EA 2JA5H 4IO9A 3L2PA 5IE8A 2I0QA 1E1OA 2NN6I 3UE1A 4A3KH 2UUBL 3Q8DA 4R4OA 1YIJA 4HIKA 1YZ6A 4JBWA 3STBC 4NXNQ 5E7NA 4PZ8A 5M5XH 2HQLA 1PH7A 1JB7A 1D8LA 1KHIA 4A3MG 4OXPA 3UDIA 4IFDI 2JA6G 4X65Q 1WI5A 4EQ5A 2L15A 1L1OA 2JK8A 2K4KA 3KLWA 1SRUA 3I7FA 2MFIA 2WAQG 1PFSA 1FVIA 1V43A 4DR5Q 5M3FH 1PYSB 1UE6A 2EIFA 1QVFA 2IX0A 1X54A 4YCWA 3A0JA 3ZJYC 1KQSA 5M3MG 2JQOA 3HOZH 2BA0A 5DLQE 3A5ZB 2HHHQ 1A0IA 3GTGH 4DV2Q 2VL6A 5C44H 4A3IG 1LUZA 3TRZA 2WB1E 3HOVG 1L1OC 3G6EA 4IOCA 3RLOA 4JI6L 4QIWE 2UXDQ 1JJGA 2IY5B 3CCRA 2ATWA 2NVQH 3S1NH 2IT1A 1UE7A 1X56A 3G48A 1YITA 4DAMA 2PQAB 4R1JA 4DV0Q 3D31A 1UEBA 3PO2H 5AJ3L 3H3VH 1UE5A 3PUVA 4A4IA 1I50H 2JA7H 2R7ZG 4JI4L 2JEBI 2Z0SA 3PSIA 4DR2L 2K75A 1N36L 4DR6L 2LSSA 2JE6I 1HR0L 1HZBA 2H5XA 1IBKQ 1W3SA 4BY7G 2KHIA 5LMNL 4DV5L 1IZ6A 4A3GH 3OW2A 5ELOA 2VW9A 2PQAA 1VQ8A 4DNIA 1N33L 4LF4Q 2IHEA 1HNWQ 1HJPA 2F52A 4LUVA 4POGA 5JJIA 3M85A 5JEAJ 2UU9Q 2F3IA 3K7AH 1YJ9A 4OX9Q 3HOYG 4BBRG 1YBYA 4OWXB 5FLXc 2ZTEA 1N32Q 3FP9A 2K5HA 1AE2A 3F1ZA 4AQYQ 2HT1A 4LWCA 1OXUA 5GROA 1K8GA 4R4TA 3WWVA 3I4MH 2R92H 2JA5G 1PH1A 4LF8Q 1CKMA 4A3KG 5FJ8H 4EX5A 1IL2A 2UXCL 4BBSH 4JI1L 1C7YA 2K50A 1U5KA 1NE3A 3H0GG 1XNQQ 5IT9c 3HOXH 2UXBL 5FLMH 4GLXA 1GD7A 4J15A 4JOIA 3RLFA 4POFA 3RNUA 4JYAL 1W2BA 3U4ZA 4KI0A 3K8AA 4LUOA 2E5LL 4LF7Q 2CFMA 1G291 4NB3A 4DK3C 3PUXA 4KLKA 4UP9A 3J80i 4X66Q 5M3FG 1I6HH 2MNAA 4P72A 1SN8A 1PVOA 1EFWA 3HOZG 3S2DH 5IYBG 3KFUA 1Y1VH 5LMUL 4IFDG 2D0OA 4NXNL 5C44G 4LNQA 4APVA 4JOIC 1R9TH 3KDFA 3CF5A 4KHPQ 2QA4A 1NJIC 4X65L 1IXRA 2OTJA 2RF4A 4DK6C 1N8RC 3CP0A 2OTLA 4L5RC 4DAYB 5C3EH 3F2DA 1EIFA 1EQRA 4DR5L 4MZ9A 2VUMH 3EN2A 2B63H 1VQIA 1KRTA 4XTCS 3PO2G 2R6GA 4OO1I 2JA7G 4B3RQ 3MEFA 5GQOA 2HHHL 2ES2A 4YWLA 4DV2L 3TEHB 3FKIH 2JA9A 3S15H 1LM0A 2UXDL 1JJCB 5ELNA 1TWCH 5IP9H 4YWKA 4A3GG 1Q1BA 4YHHQ 2KBNA 1GO3E 3ULJA 1VQJA 3GO5A 3PV0A 1PH3A 1I5FA 2A8VA 1QUQA 1V1QA 1YHQA 1VQPA 5GAEC 4B3SQ 3PIPA 3K80C 4DV6Q 4B3TQ 4HJAA 3HOWG 1VQ6A 1B70B 3MXNB 1X55A 4DR4Q 3F8TA 1IBKL 3I55A 3I4MG 5JJKA 3J7ZC 3KF6A 4DR3L 2AWOA 2DUDA 1BBUA 4JG2A 2N78A 5FJ8G 2OCEA 1ASYA 4LF4L 3S17H 1HNWL 4NXMQ 2UU9L 4OX9L 5FLMG 2CCZA 2E2IH 3GTKH 4UP7A 3CCSA 2Q2TA 1N32L 2AKWB 4AQYL 4A3FH 1PHJA 2V1CC 1Q46A 1GVPA 4JI0Q 3PUWA 4JI7Q 1K0RA 4JI8Q 3GTJH 1HNZL 3BU2A 4P75A 3NENA 1G6PA 2ALYB 4GOPA 4LF8L 1E24A 5K36G 1VQBA 2OQ0A 1DGSA 2I5LX 1Q86C 1RIPA 4DV7Q 1PH4A 1HNXQ 1Y1VG 2ID0A 1XPUA 4DV1Q 4OWWB 2I5MX 4B3ML 2K5NA 4GN3B 4BXXG 1XMQQ 3CMAA 4A3JH 3J81c 4C2MH 3K7UC 3U4VA 1Q7YC 1HR0W 3I2ZA 4AYBG 5HGQA 1P16A 4GOPC 2PI2A 5C3EG 1NMFA 2VUMG 4HIMA 1Q81C 4X66L 3CXCA 2B63G 1PYBA 1VQGA 1OXSC 1TXYA 4IPCA 4JI5Q 3ERSX 1E22A 3FKIG 3PO3H 4JBJA 4YY3Q 4LF5Q 3CCLA 4KHPL 3RLNA 5IP9G 3EBEA 1WYDA 3CCVA 4A3CH 2VY3A 3F2BA 1ASZA 4QGUA 1N34Q 2VQFQ 1NY4A 1OTCA 1WFQA 2JA8H 1EQQA 1NMGA 5GAHC 4AH6A 4DR7L 3KJPA 4GKKQ 3CC2A 3BJUA 1PH2A 4X64L 4JBMA 4YWMA 4B3RL 4R4IA 1A8VA 1MJCA 4DPGA 3CC4A 1GKHA 5BR8Q 1G51A 1HZAA 2LXJA 2R7DA 3T1YQ 4GNXA 3IRBA 3CCQA 4JI3Q 4BA2I 3M7NA 1IBMQ 4YHHL 1VQHA 1SLJA 4LUZA 1VQLA 2PMZE 1EIYB 3HKSA 1IBLQ 3PCOB 4OONA 2Y0SG 1FL0A 1YVCA 2VS1A 1I94Q 4LF9Q 5C0XJ 4JI2Q 4B3SL 5JEAG 4DV6L 3NELA 4B3TL 4A3FG 2NZOA 2YTXA 5IP7H 2UUCQ 4DR4L 2CWAA 4GKJL 1TWGH 4LFAQ 4GLVB 3NBHB 5HY6A 2N49A 3RZOH 4PG3A 1SROA 3KDFB 2NN6G 2RCNA 2WAQE 3U50C 4L5QA 2E2HH 4L5SA 4A3DH 2UUBQ 3U58A 1J6QA 5JJLA 4NXML 3OYYA 3HKZG 1XJVA 3CCMA 2BH8A 1U0LA 2R7FA 4MNOA 1PH8A 1YHAA 3A5UA 2R93H 1OXVA 1EWIA 1FGUA 4JI0L 1PA6A 4DV3Q 1CKNB 2XTIA 4PZ6A 2ZJPA 1PH5A 4JI8L 4JI7L 2JEAI 1M90C 1I3QH 4DV4Q 1HZCA 3RN5A 4UP8A 1YEZA 2NVYH 1B7YB 4LFCQ 3ICEA 1HNXL 2FXQA 4DV1L 3H15A 4HJ7A 3M4OH 4FDBA 1VQ4A 1XMQL 3PO3G 4A93H 5H1SE 4HIDA 1CKNA 3TS0A 1JE5A 2VNUD 2ZM6Q 4A3CG 1QUQB 1VS0A 4A3MH 1IYJB 4JI6Q 3T1HQ 3BZKA 2JA8G 1LYLA 2QGQA 1VQ9A 2KCTA 2D62A 1K8AC 4BA1I 2HIVA 1NBWA 3KF6B 4LF6Q 2LXKA 4JI5L 1QVCA 1YI2A 1GM5A 1FJGQ 5M5YH 3S1QH 4DV0L 4YY3L 5M5WH 1T9HA 4X62Q 3LGJA 4HIOA 1S3OA 1VQ5A 1S72A
chains in the Genus database with same CATH superfamily
1HR0Q 3HOVH 1VQNA 5KYLA 2YV5A 2CH4A 1LT5D 4GKKL 1I4GA 2R92G 4QY7A 5DEHA 1K8OA 2IX1A 1DM0B 4DN4M 1XTDA 4K0KQ 5JOBA 1XXGA 3NUCA 1B9NA 2NUCA 5IP7G 3GTLH 1TY0A 4HCSA 1NNXA 4XYOA 5C0XI 5JAVA 2I07B 1VMCA 3CD6A 2EQSA 2QCPX 1EYGA 3H3VC 4TQUS 2A1AA 4HR7B 2K03A 3V96A 1VQOA 1WVLA 4KN4C 3GTQH 1XNRQ 3ZYYX 3JC66 1CI3M 4HSVA 3AQQA 2H1EA 3WOFA 3JAMi 4QJFA 4UAIA 3OIQA 5LMUQ 5IGEA 3AMUA 5M3MB 4FYDA 4KY5A 3F2UA 4TVAB 2XN9C 2IWHA 4A3IB 3A8IE 4GNXB 1SEBD 2B63B 5IYDH 4OO1G 2M2LA 2YTVA 4KJNA 4WJWA 4JVZA 1IW7D 3PUZA 3HOUH 1LTLA 3H3VI 3OTOQ 2A68D 3PIOA 3MEHA 3MA2B 3MXGA 4ZUJA 1TS4A 2WKDA 3K5NA 4R4CA 4ME3A 4BY7B 2J4XA 2PI2E 2DN8A 5GAGC 4IPGA 1FNWA 2H4OA 3I3CA 2XNAC 4DR3Q 1JOQA 4BBRB 5C4XG 5DNFA 2KOLA 3A8JE 1P8LA 4WFN3 3CRLC 5IGFA 3IFTA 1EY4A 4KY6A 3SDZA 5C0XG 4GLAC 1MKHA 1NTGA 3W5OA 2A19A 4LW1A 3X3MA 3E9HA 1AH9A 4A3FB 5J3BA 4ZRZA 3TZUA 3GTJB 5KGUA 3PF4A 2DNCA 1RTOA 1DCZA 4JV5L 3J81i 4A3BH 4DUYL 3VA5A 4Y52H 5GADC 4A3EH 4B3MQ 2F0SA 5D3IB 4OGQC 4Z9CB 1BCPB 3UDXA 4DR1L 2ASBA 3D6WA 3I56A 3CC7A 1KABA 4AIMA 2JA6H 1E2VA 5C5MA 4WJ3M 1BVSA 3SE0A 1QB5D 4MTNA 1CSPA 3JAMc 1X9NA 1IL8A 5M3MH 4RG1A 4RHSA 1Y1WG 2QKIC 3PGZA 2LMCB 2RHSB 4A3IH 2F0DA 4DR6Q 1U4PA 4IJLA 4X64Q 2SNMA 2ZTCA 3MXUA 3CCJA 1DOKA 2KECA 1HZ9A 3I4OA 4JBKA 1N33Q 1EY0A 3DEOA 1YNND 1E1TA 2RDHA 1KRSA 4CDEC 2A6ED 2KEEA 4PZ7A 3BS1A 1PH9A 2R7ZH 3R8BA 2K5WA 2XGTA 1KTKA 4BY7H 2R92B 3P75A 1OXXK 2EVBA 3JAME 3GTPH 1IBLL 2VQEL 3HKZE 1OO9B 2EY5A 2XWBB 1HFGA 5IYCG 2K04A 2AWNA 1RD9D 2RVLA 4XT3B 4JI1Q 2EXZA 3PF5A 2EYHA 4LFBL 5ELEA 3KLRA 2SNSA 3GTOH 4BBRH 3RZOB 4XQQA 1TWAH 4C3JG 3OWEB 3KF8B 4NPSA 1QZGA 2WP8J 4X3UA 4K5VA 2KCNA 1GUNA 1STEA 4XQNA 1RF2D 3UI2A 1X32A 1LT6D 1R4QB 1SAPA 2MGSA 2F0FA 1WTWA 1D8LA 5T1IA 4A3MG 2NVYB 4IFDI 1J8IA 1WI5A 2KCCA 2KQ3A 3KLWA 2K4KA 4PV1C 4IUTA 5I9OA 1SRUA 5LHY1 2MFIA 3ONAB 2L9HA 1PFSA 1Q90A 1V43A 2B2VC 4JPBW 5M3FH 2EIFA 4YCWA 3ZJYC 1BF4A 2JQOA 3HOZH 2BA0A 1PRTD 4ME5A 4J8QA 4ID6A 1L1OC 2F0WA 1JJGA 3R93A 1VMPA 3SHLA 3L9AX 2IT1A 5I6YA 1X56A 4X3TA 1DD2A 1LABA 3D31A 1UEBA 3PO2H 2G9DA 5JVH3 1UE5A 1CHQD 2JA7H 1UUPA 3SK5A 4RCNA 5TSSA 2YU9B 2A5HA 3Q6SA 2E2JB 1M4VA 1W3SA 1IW7C 4DK0A 4DV5L 4FF4A 2K33A 3OW2A 1T5EA 5ELOA 2F0VA 4LF4Q 2IHEA 1D2BA 2A68C 1A3TA 4TRDA 2F3IA 3HOYG 3NBIA 1KDBA 5FLXc 2E2IB 1N32Q 3F1ZA 5M9OA 4AQYQ 3EFXD 1K8GA 5C4XB 3ND8A 3DUZA 2R92H 1PH1A 3MFYA 4LF8Q 4IUQA 1LO5D 2A6HD 2X6GA 1C7YA 2RDFA 5CC4A 1XNQQ 5FLMH 3RLFA 1H9KA 1CFMA 4FF2A 4EQPA 4KY7A 2NVTB 1IHZA 2IL8A 2F0LA 2L4NA 1TWHB 3J80i 5K36H 4P72A 1SN8A 3TBIB 3K5OA 5FLXE 3S2DH 4UHVA 3C2PA 1Y1VH 1NR2A 3NBHA 3FRPB 4IFDG 4NXNL 5C44G 3BG3A 2QA4A 1IXRA 4DNTB 1G8ZD 2RF4A 1EIHA 1N8RC 4L5RC 3F2DA 2VUMH 2KA7A 1VQIA 5CV9A 4XTCS 1FD7D 3ND9A 3MEFA 2DJGC 3H91A 4NKLA 4YWLA 4DV2L 3FKIH 3H94A 2A69D 3S15H 1JORA 1Y1WB 5JJZA 4YWKA 3QIAA 1KAAA 4OO1H 3ULJA 1SYEA 3PV0A 1PH3A 2OXPA 1SYDA 5KEEA 1AEXA 1I5FA 4HEDA 1QUQA 2F0OA 1VQPA 5GAEC 1BXTA 3HOWG 1LT4D 3MXNB 1Y8PB 5C5LA 3I4MG 3I55A 3J7ZC 1ET6A 3Q0AA 1BBUA 3SXHA 2OCEA 3AU7A 1YNNC 2UU9L 2A6EC 3OSOA 4L63B 4OX9L 2CCZA 3VR2A 2E2IH 3GTKH 2Q2TA 1A3VA 4JI0Q 1Q46A 1II3A 2V1CC 3H09A 4I65A 5T1GA 1EWHA 4C3JB 4P75A 1D6EC 1G6PA 1ENFA 1DGSA 2Z4HA 1PH4A 1HNXQ 4DV1Q 4OWWB 1D1IA 3CMAA 3G7LA 5EBCA 1CQFA 1HR0W 5EKLA 2EJFC 1GXDC 1ONLA 1QILA 2O4XA 3C1FA 4A3MB 2PI2A 1NMFA 4HIMA 1EY9A 3IL8A 1VQGA 1TVXA 1TXYA 5C4JB 1A6XA 2KJXA 4EQOA 2PNRC 1STBA 1ML0D 1STGA 4KHPL 2DJFC 1U4RA 5IP9G 4H7BA 2VQFQ 1HRJA 1OTCA 1WFQA 3E6ZX 1EQQA 3CQZB 3KJPA 1B53A 1PH2A 1I4HA 3BDOA 1PRTC 4B3RL 1LTAD 5BR8Q 1G51A 1HZAA 2LXJA 3T1YQ 3CCQA 4JI3Q 3K59A 3K5LA 3J80E 2NVXB 4OONA 2Y0SG 2F0TA 1I94Q 3A8KE 1H9RA 2WINB 1UEAB 2NZOA 3C1EA 2UUCQ 3HOYB 4DR4L 4GKJL 2CVRA 4GLVB 5HY6A 2EYJA 3DMUA 1MD2D 2RCNA 2WAQE 1W6JA 2RCFA 4R9WA 2E2HH 3DWQA 1XJVA 3CCMA 2R7FA 2F0GA 3A5UA 4OIKA 5C4HA 5C6AA 4DV3Q 5M5XB 1PH5A 4JI7L 3EROA 5CV6A 5IGDA 4DV4Q 1LT3D 2L12A 2CHBD 4C1NI 1HZCA 3FDTA 3MTSA 3MZ5A 1B7YB 1O7ZA 3D4WA 2FXQA 4HJ7A 1AZPA 1K0SA 2NB0A 4A93H 3PO3G 4HIDA 1LTGD 5LL6S 3TS0A 5C44B 2VNUD 2ZM6Q 1XWEA 1VS0A 4A3MH 1IYJB 4KHVA 3BZKA 4CDDC 2NVQB 1K8AC 1V1OA 1JE4A 4HMIA 4RAUC 1GHJA 1QVCA 4YY3L 5M5WH 2KEDA 3W2DA 1VQ5A 1S3OA 1WCMH 1V9PA 1J5EQ 3CQZH 2AMCB 1PYWD 2OT2A 1Y14B 2ZXRA 1JCKB 2A69C 3TS2A 1K73C 2D9UA 5KYIA 3HOWB 3ULPA 3S1MH 5G3LF 4BY1H 3I4MB 4C3IB 3MXPA 1EOVA 3L7ZC 3A74A 3S24A 3ULLA 4X3KA 3STBD 1EUJA 2NVXH 5CBEE 4LF9L 4CDCC 4JI2L 2R93G 4F7XA 2UXBQ 2PNHA 4QL5A 2OWOA 1SFOB 1JB3A 2UUAQ 1EEID 2Q2IA 3M7GA 1G2TA 1JOOA 1X3FA 2G9HD 3K6OA 5EKIA 5K5PA 4YCUA 1TS2A 4LF7L 4WORA 2BH2A 3A55A 1EEFD 5KNBA 4F88A 5ELCA 2WFWA 2F4VQ 5EPLA 3IAYA 1B8AA 1F9PA 2HIXA 3S14H 1Q12A 1MBYA 1K28A 3FHWA 3Q23A 1HXYD 4LFCL 3S16H 2L55A 1Y8NB 1YNXA 2MO0A 1CSQA 3I91A 4ZKCB 4KD4A 4DAVA 1GOZA 3HEJA 3T1HL 1KAWA 1TWCB 1SR3A 3UDGA 2EXDA 1D5XC 1CA6A 1A62A 2XVSA 3MAQA 4LF6L 4UY8C 3AFQA 1SE8A 1VQCA 1NCVA 5IT9L 2F0PA 1WJJA 4X62L 2EJMA 3HG9A 5IWAQ 4DA2A 2N3SA 3D6CA 4RFBA 3TSSA 4OWTB 3KJOA 4XIGS 1H9MA 4K0KL 1X65A 3M4PA 2Y0SB 3ER0A 5KRUA 1SYFA 2N8NA 1C4QA 2ZT9C 3HOWH 4A3JG 2KVMA 1S5DD 1PFMA 4TKOB 1L2FA 1TT2A 4C3IH 1SXTA 3VR3A 5EKKA 4ZQ3A 1K83H 1Z7TA 1I4RA 2FFKB 1WTXA 4QF4A 2K14A 5CBAE 4QQBX 4B08A 3I4NG 2MP1A 1D7QA 1SFOH 4C2MB 1XNRL 3NEMA 5COYA 1H95A 3TDQA 2K52A 3I70A 3BZCA 1JJ2A 1QWYA 3SK4A 1KIXA 3PO3B 2NTTA 4KJOA 3K0XA 3GV3A 1EIGA 1QNUA 1KL9A 1SYGA 1Z6HA 1I50B 3HGBA 4KK7A 4HJ5A 2Z6KC 1C0AA 3M9BA 2YYZA 4JC0A 1CM9A 1YNJD 1N36Q 2RA4A 1M1KC 4PMWA 4FXKC 1GUWA 1C9OA 1TY2A 4CBVA 5LMNQ 2C9OA 1SNQA 2JYOA 3BVGA 4P74A 4PMCA 2QDLA 1WTPA 4A3LG 3M4QA 4ZAIA 1HA5A 3OTOL 2E8GA 3V2TA 1DOMA 1IYUA 1FYCA 2K7VA 3GP7A 1U4MA 4H13C 1AP0A 2UXCQ 1LTSD 4C3HH 3QOLA 1TWGB 3HFZB 3OHXC 4Y7NH 1MGSA 1EYCA 2B29A 4H0LC 4JYAQ 1FNUA 1BBWA 5CV8A 5D14A 4GN4B 4DKAC 2JA5H 2F03A 5IE8A 2I0QA 1I6HB 2B2VA 2UUBL 2R93B 1G2SA 1F9RA 3Q8DA 4HIKA 4JBWA 3STBC 2BDNA 1GUSA 5E7NA 2HQLA 2O5JC 1KHIA 2XRSD 4OXPA 4X65Q 4EQ5A 1NAPA 1L1OA 2JK8A 1Q8IA 3I7FA 3M4OB 1B1ZA 1SNMA 4DR5Q 2IX0A 1X54A 2PZTA 1BBXC 4XQJA 1PTOB 5CGKA 2E74C 4FNFA 4V190 3E3XA 2LKVA 3CCRA 4OEMB 3S1NH 3G48A 2F4IA 2Z8LA 3EA6A 4A4IA 3HS0C 1I50H 1QJOA 2JEBI 3PSIA 4DR6L 1IBKQ 2M9VA 2KHIA 4PMBA 1PZKD 2PQAA 4DNIA 1N33L 1HNWQ 1DOLA 3DEPA 2J7ZA 3LX0A 4POGA 4QCLA 4QUCA 4M1UB 5JEAJ 1YJ9A 2X6LA 4OWXB 4DFAA 2K5HA 5IIFA 4LWCA 1OXUA 5GROA 3NTKA 3HP3A 4A3KG 5FJ8H 4JI1L 3OOCA 4L8JA 3HZXA 4A3JB 4RHRA 4J15A 1A3UA 4HSPA 4KI0A 1EQVA 3K8AA 4EVOA 2DNEA 4ILWA 2Z1CA 2KUMA 4DK3C 4KLKA 4UP9A 4X66Q 2D2CC 1SE3A 1I6HH 5IYBG 3I4NB 2NTSA 1AZQA 2F0UA 1NJIC 1V1PA 2TSSA 2OTJA 3CP0A 1B3QA 1SNDA 1EIFA 2B63H 1G91A 3I4LA 5CV7A 1PTOH 4K6LA 3TEHB 3G6JB 3S2HB 3MHBA 5ELNA 5ELFA 3S1RB 1EQTA 1I4QA 4A3GG 1Q1BA 4YHHQ 1HHVA 1NSNS 2KBNA 3GO5A 3O13A 3KLSX 4G7HC 4F87A 1KLUD 3EJIA 1YNJC 2QILA 4DV6Q 4B3TQ 2FMMA 3E5SA 4HJAA 1VQ6A 1X55A 4K5WA 5JJKA 1AN8A 3KF6A 3M4YA 3RD4A 1L0XB 3MC0B 1QCBD 4I7ZC 4LF4L 1ILQA 3TZDA 4S3SA 3VR6A 4NXMQ 2HCIA 4RCOA 5JEAH 1N32L 3CCSA 2AKWB 4AQYL 4A3FH 2F0HA 4JI8Q 1HNZL 3GTJH 2K01A 3NSWA 5C3WA 2ALYB 2EZVA 4LF8L 4G4KA 1VQBA 2OQ0A 2K5QA 2NN6H 1H9SB 1ZXTA 4A3JH 3J81c 4K8JA 4AYBG 2B2TA 5C3EG 2I46A 1Q81C 3GTMB 1KLGD 1PYBA 1OXSC 2IJ0A 2Z9HA 5J1ZA 4IPCA 4XT1B 2O2LD 3ERSX 2NYZD 1E22A 1MHWC 4RA8A 5M5YB 1IKMA 1U4LA 4O42A 2AQ1B 5D65A 3CCLA 3FPUB 4A3CH 2VY3A 2GA4B 3NWTA 1N34Q 5EGTA 4DR7L 2JXMB 1CT1D 1E0BA 3J81E 1A8VA 2RBMA 3CC4A 5D3DA 1PTOD 4GNXA 3IRBA 1LTBD 1IBMQ 1VQHA 1SLJA 4LUZA 3D3RA 2F1MA 1EIYB 3HKSA 5IOCA 3TP7A 3PCOB 1IBLQ 2VS1A 5C0XJ 5JPNC 1Y8OB 5IP7H 4LFAQ 2FINB 2SDFA 4P2CB 5E4XA 1TU2B 3URYA 3RZOH 4PG3A 3KDFB 1JQYD 3U50C 1C8CA 3NPPA 4A3KB 4L5SA 2F0NA 4FF3A 3K0YA 4MN3A 1OXVA 1EWIA 2A74C 4JI0L 1AFPA 2AUKA 5C4ZA 1STYA 2NVYH 1HNXL 4DV1L 3EQLC 4NP5A 1WD1A 1VQ4A 2EJGC 5IGGA 3GTGB 1CKNA 1BCPD 1JE5A 3QJYA 5HURA 2JA8G 1LYLA 2QGQA 1VQ9A 2KCTA 3M3YB 1MSHA 1EY7A 1NBWA 3VYSA 1ZEQX 4J6HA 2LXKA 1BO0A 1SJHD 1YI2A 1GUGA 4YIJA 1PMRA 4PQXA 3A7AB 3BYTB 2RKSA 4KV6A 5M5YH 4DV0L 1FJGQ 1T9HA 3PIO3 4HIOA 1BUVT 1HTPA 4LF5Q 1HQRD 4IUVA 2YU9H 2WB1G 2VQFL 4ABNA 1DXMA 2E2JH 5BN5A 4A3GB 3UDFA 2R61A 3E0EA 3F2CA 1F2LA 4GOPB 5A2QL 3W1BA 3K7AB 3D0FA 2FMCA 5BR8L 2Q2UA 1UWVA 4GN5A 5KNCA 2Z6BA 1VQKA 3T1YL 3AEVA 1KNEA 4JI3L 3HOXG 3B6YA 5FKAC 4ZK9B 4DUZQ 2MO1A 5C4XH 1LTRD 1S40A 4RGTA 3SK8A 1STHA 1I94L 1X3GA 1XMOQ 1YJWA 1Q3LA 2OQKA 3C46A 4KHZA 5C0XH 2UUCL 5AFWA 2QEXA 5BN4A 3CW2C 1SE4A 3CHBD 1PDQA 2NVTH 3S9WA 1GJXA 5LMNW 4FXDA 1TWHH 2IPKD 2HCCA 5IY0A 2IHFA 3QOJA 2VB3X 1CUKA 4DV3L 1R9TB 1GUOA 3KF8A 3J80c 3DWPA 4DV4L 3CPWA 4IALA 1L0YB 4AYBB 5C3EB 2B2TC 3VR5A 3CRKC 5J39A 2JJQA 5IYBH 4BWGB 2SEBD 1HH2P 3J7A5 4N9PA 5FLXL 4WJ4A 3L0OA 1WTHA 2ZM6L 4NW2A 2N88A 3W1GA 4A75A 1ESFA 1SMXA 1X3EA 3VDYA 4UPAA 3M3YH 1Y1WH 4KKSA 4J1MA 1SNPA 3KLSA 3W3AA 1GHKA 4IJHA 1PH6A 4FVMA 4RWSC 1OXTA 2VB2X 4DXFA 4QB4A 2NZ1D 1S5CD 1JMCA 1J5EL 3DHQA 4GNXC 2BCOA 5KIXA 1N9WA 3S17B 1HFNA 3QO2A 1PTOC 1VQFA 4L5TA 4IUPA 4N9TA 3SGIA 3G4SA 4CJ1B 1X3QA 1CA5A 2ZTDA 1Z47A 5IYCH 1HCZA 1A63A 1CKOA 1Q82C 2NBFA 4JW0A 3DM3A 2D0PA 4C3JH 2CKZB 1TQOA 2A6HC 3A54A 4KMUC 3OW7A 4DV7L 1VQEA 3AYHB 1MIUA 1DYQA 4LJZC 1NR4A 5ELBA 4FP5D 4IFDJ 1ZYRD 2PW7A 1Q8KA 2N55A 4H02A 2UUAL 2Z6KA 4WRDA 4K2LA 2K28A 2RSOA 3IKJA 5IYDG 1PRTF 1VQ7A 2OEOA 4RMFA 3VR4A 2F0EA 3VYTA 1KC8C 3HOUG 1UE1A 2XIWA 2F4VL 1RTNA 2EYOA 5C4JH 5AJ3Q 4O0AA 5EBDA 1EYDA 2DGYA 1BQQT 2CWPA 2JP1A 4JI4Q 4DR2Q 4JCVE 2JA8B 1EZ6A 1ICFB 3K5MA 2Y0SE 3CAMA 4LMQD 3VYUA 1BCPC 4O2DA 1VQDA 5FOBB 4Q5VA 2KHJA 3K81C 4HTHA 4ALPA 5I2YA 2CQOA 2FJ2A 2ZJQA 4GS3A 1EU4A 2WB1B 1PZJD 4CKBA 2AUJD 3BDCA 3R2TA 2ZJRA 3SR1A 1WTVA 4A3DG 1RL2A 4MTKA 2B2WC 5IWAL 1RKNA 4GKJQ 3MFGA 4H44C 4UDUC 4E6IA 5IODA 3HOXB 3HOYH 2L0CA 3PQIA 3DXJC 5I9PA 1O7LA 4A3BG 1SSOA 3QB3A 4HAEA 1L1OB 4A3EG 2E5LQ 4IO9A 3L2PA 1E1OA 2NN6I 3FVQA 5DAUA 4R4OA 2KHSA 1CZGA 3AB9A 4G7ZC 4PZ8A 5M5XH 1JB7A 1HUMA 3UDIA 2JA6G 2L15A 2AQ3B 2B2UC 2MPMA 1FVIA 4Q0FA 4GZYC 1PYSB 5E4WC 2Q8IB 1I4PA 1CQVA 1KQSA 5M3MG 5IGBA 2EOTA 2PCFB 2ZXPA 5DM63 5DLQE 2XRQD 2HHHQ 4IFDH 1BOSA 2VL6A 1EYAA 5CV4A 5C44H 4A3IG 2EY1A 3KBGA 4JI6L 2UXDQ 4IOCA 1TR5A 2O5IC 2NVQH 1CHPD 1UE7A 1YITA 4DAMA 2PQAB 2NWGA 3TMEA 3Q24A 2R7ZG 2Z0SA 2K75A 3I90A 1N36L 2LSSA 2JE6I 2A73B 1HR0L 4BY7G 1O78A 2ENBA 4IZ8A 5LMNL 1IZ6A 4K14A 3GTLB 2M00A 4LUVA 5JJIA 1NUCA 1RHPA 1TS3A 2CQAA 4FXGC 3M85A 2QDBA 3J7AF 4BBRG 2L5TA 1MSGA 1QE6A 3K57A 3BVZA 2HT1A 3C3LA 1EU3A 4R4TA 3WWVA 3I4MH 4RKLA 1A15A 3NWSA 2B2YC 1TIID 4R8IA 1CKMA 2PW5A 2PYKA 4CKCA 1IL2A 2UXCL 4G57A 3GTQB 1A2TA 1C48A 4XYQA 5CMDA 1U5KA 1NE3A 3H0GG 4MIUA 3HOXH 3J7AV 1GD7A 3RNUA 1F2MA 4JYAL 5CR3A 1TS5A 2WACA 4LUOA 4I7AA 1PLFA 2CFMA 4LF7Q 4NB3A 1PFNA 3PUXA 2RSNA 5M3FG 3I8ZA 3HOZG 4ZYSA 1K8MA 2AQ2B 5LMUL 1EY8A 4CHTB 4JOIC 4X65L 1UAPA 1F9QA 4DK6C 2HDLA 1EQRA 4DR5L 1ZYRC 3PO2G 5J22A 3HOUB 4OO1I 2JA7G 3MVVA 5GQOA 1WTOA 1F77A 5E1FA 2JA9A 4IUUA 1LM0A 2HQEA 5IP9H 1TWCH 3HRZC 1SJED 2DY8A 2X69A 5EQ0A 4LK1C 2EDGA 4DAYA 3T13A 3N52A 1LTID 1CK1A 3KBXA 2EYLA 4B3SQ 3U9OA 3D4DA 3GQBA 3R3OA 4ZCKA 3F8TA 1R4PB 1IBKL 3NQTA 1SE2A 4DR3L 2DUDA 4JG2A 1GUTA 1HNWL 1XTCD 4A3DB 3I73A 1F9SA 5FLMG 1EWCA 2ZXOA 1GVPA 3D8GA 3PUWA 1I3QB 4A3BB 1O7YA 5K36G 4A3EB 1Q86C 1Y1VG 2ID0A 4B3ML 2K5NA 3PMFA 4GN3B 1PRTB 4BXXG 1XMQQ 1KDCA 3TP5A 4C2MH 4L6TB 3U4VA 4KN7C 3I2ZA 2ICIA 4GOPC 2JA6B 2VUMG 3D4RA 4X66L 3CXCA 3NP8A 3TN2A 2MHVA 1H9JA 4K6DA 4JI5Q 2B8FA 1IKLA 3FKIG 3PO3H 4G7OC 2LFNA 3EBEA 3L3OC 1WYDA 3SK6A 3MWYW 1NY4A 1BR9A 1SDFA 1STAA 2LS01 3VA7A 4GKKQ 3BJUA 4X64L 5C3XA 4YWMA 4R4IA 1MJCA 5ELDA 1SMYD 3PIP3 1AW7A 1JWUD 2PZWA 2R7DA 4BA2I 2R7ZB 3M7NA 4YHHL 2BOSA 2PMZE 3GTPB 1FL0A 1HTLD 1EFID 2ICEC 2P5ZX 1EZ8A 1PZID 2SOBA 3OMCA 4QMGA 4DV6L 3N6RA 4B3TL 2YTXA 3GTOB 2CWAA 5I6WA 1TWGH 1TWAB 3NBHB 3P1HA 2N49A 2FHTA 3P7JA 2R3ZA 1SYBA 4DU9A 4L5QA 4A3DH 4NDXA 3U58A 1JICA 2UUBQ 4NXML 5JJLA 3HKZG 1ICWA 1X3PA 3NTIA 2R93H 4K8IA 3H0GB 1PA6A 1CKNB 2XTIA 2JEAI 4CGYB 4JI8L 2XSCA 1I3QH 4IUNA 2JSOA 3RN5A 4UP8A 1YEZA 5EPKA 2JN4A 4K5XA 5M3FB 4M8AA 1B9MA 3H15A 3M4OH 2HDMA 3HOZB 4FO2A 4B9WA 1QUQB 3LWUA 4R8NA 1DONA 4BA1I 2HIVA 1EY6A 2QF7A 4XDXA 5CV5A 3PO2B 1SYCA 2JA7B 1VF7A 1O80A 3LGJA 2L11A 1S72A 1HQMC 1ASYA 1N34L 2C35B 1J9OA 1KDAA 2Q8RE 5JPMC 1WTRA 1D1KA 1O7IA 1QNKA 3OPOA 4YCVA 2F0MA 4OHJA 3KOJA 4BBSG 5FO7B 1RDPD 3E9IA 1S5ED 4C56C 1QG7A 1IBML 5FO8B 1BKBA 5L37A 2RQXA 3GDEA 1S5BD 5CYUA 4JV5Q 3CCEA 4DUYQ 3G71A 4IPHA 2PMZB 1CTMA 3E0JA 3TREA 5EJWA 4DR1Q 4CKEA 3DLLA 4LFAL 1XNQL 4HN7A 1VQMA 3RN2A 1QVGA 2WKCA 1AE3A 2Q2HA 3RR5A 5DM73 3CMEA 1RJTA 4QUFA 3EVQA 4A93G 3S2DB 1TWFB 1Y1VB 1JT8A 2CW0D 3H0GH 1E3PA 2HUGA 3T53B 3I4NH 3BVMA 1YJNA 3GD7A 1VQAA 1WTQA 1FNVA 1WOCA 2VUMB 2VZAA 2DY7A 4IOAA 1STNA 5I4DA 3FKIB 4A76A 3S15B 1WCMG 3ITPA 1KD1C 3S2HH 3J81j 2B3GA 1G6ZA 5A2QE 5CORA 3S1RH 3EIVA 2VXWA 2PZUA 1FJGL 3AFPA 3QR8A 2NZHA 2VQEQ 3J7YW 1LLRD 1VCIA 2MUYA 4A3LH 4LF5L 4BY1G 4LFBQ 2EYMA 1X6OA 1XPRA 2BA1A 2MQHA 3RMHA 2K1BA 1VDZA 3RZDB 4O1NA 1I4XA 1SMYC 1B3AA 2CH4W 5G3LD 2WIIB 4ZLTF 3JAML 3GTKB 3SEBA 5LL6X 3KYHC 1B4OA 1HNZQ 4DUZL 3NXWA 3NK9A 4P73A 4XXEA 4AYBE 2PPBC 5EAYA 1QOHA 4U673 3U9SA 1XMOL 4ZKBB 2RHQB 2GVBA 3HKZB 4R4QA 2KCMA 2KENA 1K9MC 1ENCA 1E7ZA 2E75C 2EY6A 2AHOB 4EQNA 1JWSD 1FGBD 5BN3A 4P71A 4V0BA 3GTMH 1TWFH 4DAPA 3WDNA 4OIJA 3UE0A 4BXXH 1L0WA 2GN5A 2F0QA 3CPFA 3OIPA 1KXLA 3QG1A 4DR7Q 3DWAA 4DV5Q 2V4DA 3KK7A 2I5HA 2LY7A 2WV6D 3PUYA 2B2WA 1F2ZA 4X3SA 1QZHA 3CCUA 3T56B 1F2YA 4CJ0B 4HJ8A 5E3FA 3TQYA 1XPOA 2PO4A 2E76C 3ERQA 1Z9FA 2GVAA 2F3WA 4LAAA 1PV4A 2K5VA 1EOTA 1PXUA 3J81L 1YHBA 2YTYA 4BBSB 1MJEA 4MHEA 4C3IG 2EYPA 4RGOS 1D5MC 4HJ9A 1LTTD 4IPDA 4C1NK 4X6AH 1JOKA 1K3RA 4KD3A 3RZDH 4KTAA 2E2HB 1Q1EA 2B2UA 5HGTA 3WOEA 3UE1A 4A3KH 3TP8A 1SNCA 1A2UA 1YIJA 1DZ1A 1YZ6A 4NXNQ 2EYFA 1K3BC 4F8MA 1PH7A 4N8X1 2K32A 3NTHA 2WAQG 3BZDB 4A93B 1QVFA 1UE6A 3P20A 4DGZA 3A0JA 4HMJA 1IYVA 2K05A 4B9XA 1XYIA 3A5ZB 1V8QA 1A0IA 3GTGH 4DV2Q 1LUZA 3TRZA 2EE1A 2WB1E 3HOVG 2XWJB 1ENAA 3G6EA 2F0IA 3RLOA 4QIWE 4DF7A 2IY5B 1H9SA 2CW0C 2ATWA 3T16A 3FPPA 4BS9A 4DV0Q 4R1JA 5M5WB 5AJ3L 3H3VH 3PUVA 2Z4IA 4IN3A 1WCMB 4JI4L 2B39A 4DR2L 3V05A 1HZBA 2H5XA 3GV6A 5A35A 5F2DA 1UNSA 3Q22A 2B2YA 1CZWA 3R2IA 4A3GH 2VW9A 3CU7A 1VQ8A 4C3HG 1HJPA 3FEWX 1W6KA 2F52A 5JVG3 3T51B 2UU9Q 3S1MB 3K7AH 4OX9Q 1YBYA 4BY1B 2ZTEA 1JWMD 3FP9A 1AE2A 1BNZA 4RH6A 1S4ZA 3BYYB 3CKIB 1ET9A 2JA5G 1B2TA 2BE5D 1EY5A 1HA6A 4DXGA 1B44D 1FR3A 4EX5A 4BBSH 2RDGA 5KNDA 4CJ2C 2K50A 1RCVD 1D5ZC 3A7LA 2UXBL 5IT9c 4GLXA 4JOIA 4POFA 3TP6A 1W2BA 3U4ZA 2E5LL 1G291 2MNAA 1PVOA 1EFWA 3KFUA 2D0OA 3X3NA 4LNQA 3S14B 4APVA 1HUNA 1R9TH 3KDFA 3CF5A 4KHPQ 3S16B 2OTLA 1DJRD 4DAYB 5C3EH 4MZ9A 3EN2A 5IT9E 1KRTA 2R6GA 4ZUIA 4B3RQ 1PFBA 2C5CA 2HHHL 2ES2A 1KNAA 2PQEA 1ESRA 3FMCA 1XX8A 2Q8TA 1SNOA 1EL0A 2UXDL 1JJCB 2D5DA 1PTOF 4U68A 1VF5C 1GO3E 2J0TD 2IW3A 1VQJA 4QIWB 1JC7A 2A8VA 1V1QA 1YHQA 3OMGA 3PIPA 3K80C 1B70B 3A56A 4DR4Q 1E2ZA 2K5DA 2QEJC 2AWOA 1LV9A 2N78A 1B50A 5FJ8G 3S17H 2E2DC 2HD3A 3J80L 3MXNA 3QWNA 4UP7A 2F0JA 1PHJA 4N8FA 4JI7Q 1K0RA 3BU2A 3NENA 2F3VA 3VYRA 4GOPA 1K83B 5ISRA 1E24A 2TMPA 2I5LX 5EPJA 1RIPA 4DV7Q 1XPUA 2I5MX 1WD0A 3LWEA 1T5XD 3K7UC 1Q7YC 1JR0D 5HGQA 1P16A 3LNNA 2L1BA 4KKTA 1BCPF 2B63G 2WAQB 5I2XA 4PNYA 4ODGA 1ZKOA 3S1QB 1U9RA 1Y69U 4JBJA 4YY3Q 3KUPA 2G5DA 4FF1A 3RLNA 4DNRB 2EPBA 3CCVA 2IX3A 3F2BA 3HOVB 1ASZA 4QGUA 4RKBA 2JA8H 3NQIA 1NMGA 1E2WA 4AH6A 5FO9B 4ULLA 5GAHC 3CC2A 1TKWB 4JBMA 1M8AA 4TSSA 4EGVA 4DPGA 1GKHA 2B8GA 2F0KA 4DK1A 2QW7A 2EY2A 3I72A 5IGCA 1VQLA 4RGMA 1YVCA 4C3HB 4LF9Q 1ILPA 1LACA 4JI2Q 5JEAG 4B3SL 1I6VC 3NELA 5FK9C 1RODA 4Y7NB 4A3FG 4HCEA 4JK1C 3RUZA 4OL7A 4IURA 1SROA 2JA5B 3IFDA 2NN6G 1V1PB 3NHHA 4K2KA 2OF1A 1J6QA 3OYYA 1PH8A 2BH8A 1U0LA 4MNOA 1YHAA 4KKUA 1FGUA 3BDLA 4OELB 4PZ6A 2BE5C 2ZJPA 3DM1A 4IQZA 1M90C 4RGNA 1MI2A 1BDOA 4LFCQ 3ICEA 4NMZA 2MJ8A 1SBBB 4FDBA 1XMQL 3OWFA 1HPCA 5H1SE 3NE5B 5NUCA 4A3CG 4JI6Q 3T1HQ 3T4AC 1S5FD 2K6AA 2D62A 2BDOA 3S1NB 3SVMA 4CDFC 3KF6B 4LF6Q 4JI5L 1GM5A 3S1QH 4X62Q 3H6MA 3K58A
chains in the Genus database with same CATH topology
1HR0Q 3HOVH 2YU9H 1N34L 1WCMH 2WB1G 2VQFL 1VQNA 2YV5A 2C35B 1V9PA 1J5EQ 3CQZH 2E2JH 2R92G 2AMCB 4QY7A 4GKKL 3UDFA 2IX1A 1O7IA 3E0EA 1XTDA 3F2CA 1Y14B 4K0KQ 4GOPB 4YCVA 3KOJA 3W1BA 5IP7G 4BBSG 3D0FA 3GTLH 5BR8L 2Q2UA 1K73C 1UWVA 4GN5A 3TS2A 1VQKA 3E9IA 3T1YL 3ULPA 5C0XI 4JI3L 3HOXG 3AEVA 3B6YA 3S1MH 1IBML 4BY1H 1BKBA 4DUZQ 3CD6A 2MO1A 3GDEA 2EQSA 1EOVA 3L7ZC 3A74A 3S24A 3ULLA 3STBD 5C4XH 1EUJA 2NVXH 1S40A 4JV5Q 3CCEA 1EYGA 4DUYQ 1I94L 4LF9L 1X3GA 4TQUS 4IPHA 3G71A 1XMOQ 1YJWA 4JI2L 2R93G 2A1AA 2OQKA 3TREA 4KHZA 2UUCL 2UXBQ 1VQOA 4DR1Q 2QEXA 2PNHA 4QL5A 2OWOA 3DLLA 3GTQH 4LFAL 1XNRQ 3CW2C 1XNQL 2UUAQ 1VQMA 2Q2IA 3RN2A 1QVGA 1AE3A 1X3FA 2Q2HA 3JC66 3RR5A 3CMEA 2NVTH 4YCUA 3AQQA 5LMNW 4LF7L 3JAMi 4QJFA 2BH2A 1TWHH 4A93G 5IY0A 2IHFA 5LMUQ 1JT8A 2WFWA 2F4VQ 1CUKA 3H0GH 1E3PA 4DV3L 1B8AA 3I4NH 1YJNA 3GD7A 1VQAA 3J80c 4DV4L 4TVAB 3CPWA 2HIXA 3S14H 1Q12A 3FHWA 4LFCL 3S16H 1WOCA 1YNXA 2VZAA 2MO0A 4GNXB 5IYDH 4IOAA 4OO1G 1CSQA 2YTVA 2JJQA 5IYBH 1HH2P 3J7A5 4WJ4A 3PUZA 3HOUH 1LTLA 3H3VI 3L0OA 2ZM6L 3W1GA 4A75A 4A76A 1SMXA 3OTOQ 1WCMG 3T1HL 1KAWA 1X3EA 1SR3A 3PIOA 3VDYA 1KD1C 4UPAA 3S2HH 3UDGA 3M3YH 3J81j 1Y1WH 2B3GA 2EXDA 4R4CA 3S1RH 4ME3A 3EIVA 1A62A 4LF6L 4UY8C 2PI2E 3AFQA 4IJHA 1FJGL 3AFPA 1SE8A 1VQCA 2NZHA 1PH6A 5GAGC 1WJJA 4X62L 2VQEQ 5IWAQ 4IPGA 1VCIA 4A3LH 2N3SA 4LF5L 4BY1G 4LFBQ 1OXTA 1X6OA 4OWTB 1XPRA 2BA1A 4DR3Q 5C4XG 1JMCA 2MQHA 4GNXC 3KJOA 1J5EL 4XIGS 1P8LA 1N9WA 4K0KL 1X65A 3M4PA 1VQFA 3ER0A 4L5TA 3SGIA 4GLAC 5C0XG 3G4SA 2N8NA 2ZTDA 1MKHA 1NTGA 1Z47A 2A19A 4LW1A 3W5OA 3E9HA 5IYCH 1AH9A 3HOWH 4A3JG 5J3BA 1A63A 1CKOA 1Q82C 3KYHC 1HNZQ 1L2FA 4C3IH 4DUZL 4P73A 4AYBE 3DM3A 5EAYA 3PF4A 4JV5L 2D0PA 3J81i 4C3JH 2CKZB 4A3BH 4DUYL 1K83H 1XMOL 4Y52H 5GADC 4A3EH 4B3MQ 2K14A 2RHQB 4DV7L 2GVBA 1VQEA 3AYHB 1MIUA 4R4QA 2KCMA 2KENA 3UDXA 4DR1L 4QQBX 3I4NG 1D7QA 1SFOH 2ASBA 4IFDJ 1XNRL 3NEMA 1K9MC 1Q8KA 4H02A 2UUAL 1E7ZA 1H95A 2Z6KA 2K52A 3I56A 2AHOB 3CC7A 5IYDG 4P71A 3BZCA 4AIMA 2JA6H 1JJ2A 1VQ7A 3GTMH 1TWFH 4RMFA 4WJ3M 1BVSA 1KIXA 3HOUG 1KC8C 1UE1A 3UE0A 4BXXH 2F4VL 1L0WA 5C4JH 2GN5A 3K0XA 1CSPA 4MTNA 1KL9A 3JAMc 4O0AA 5AJ3Q 5M3MH 4RG1A 1X9NA 3CPFA 4HJ5A 2Z6KC 1C0AA 2DGYA 1Y1WG 2CWPA 3M9BA 3PGZA 4JI4Q 2YYZA 4JC0A 4JCVE 2RHSB 4DR2Q 4A3IH 1N36Q 1M1KC 4DR6Q 1KXLA 4PMWA 4DR7Q 4IJLA 1C9OA 4X64Q 5LMNQ 2ZTCA 4DV5Q 2Y0SE 3CAMA 2I5HA 4P74A 3CCJA 4O2DA 1HZ9A 1VQDA 3I4OA 4JBKA 3PUYA 1N33Q 4A3LG 2KHJA 3K81C 1QZHA 3M4QA 3CCUA 4ALPA 4HJ8A 3OTOL 2CQOA 3TQYA 1E1TA 1KRSA 2E8GA 1XPOA 4GS3A 4PZ7A 1PH9A 2ZJQA 2R7ZH 2XGTA 1Z9FA 2GVAA 4BY7H 1OXXK 1PV4A 2ZJRA 3GTPH 2K5VA 1IBLL 4A3DG 2VQEL 1RL2A 3HKZE 5IYCG 5IWAL 2UXCQ 1YHBA 2YTYA 2AWNA 4JI1Q 4C3HH 3PF5A 1MJEA 4GKJQ 4LFBL 3HFZB 4Y7NH 3HOYH 4HJ9A 3GTOH 4BBRH 1TWAH 2B29A 4IPDA 4X6AH 4A3BG 1K3RA 3KF8B 4NPSA 1QZGA 4JYAQ 2WP8J 1BBWA 4DKAC 1L1OB 4GN4B 4A3EG 3RZDH 2E5LQ 1Q1EA 2JA5H 4IO9A 3L2PA 5IE8A 2I0QA 1E1OA 2NN6I 3UE1A 4A3KH 2UUBL 3Q8DA 4R4OA 1YIJA 4HIKA 1YZ6A 4JBWA 3STBC 4NXNQ 5E7NA 4PZ8A 5M5XH 2HQLA 1PH7A 1JB7A 1D8LA 1KHIA 4A3MG 4OXPA 3UDIA 4IFDI 2JA6G 4X65Q 1WI5A 4EQ5A 2L15A 1L1OA 2JK8A 2K4KA 3KLWA 1SRUA 3I7FA 2MFIA 2WAQG 1PFSA 1FVIA 1V43A 4DR5Q 5M3FH 1PYSB 1UE6A 2EIFA 1QVFA 2IX0A 1X54A 4YCWA 3A0JA 3ZJYC 1KQSA 5M3MG 2JQOA 3HOZH 2BA0A 5DLQE 3A5ZB 2HHHQ 1A0IA 3GTGH 4DV2Q 2VL6A 5C44H 4A3IG 1LUZA 3TRZA 2WB1E 3HOVG 1L1OC 3G6EA 4IOCA 3RLOA 4JI6L 4QIWE 2UXDQ 1JJGA 2IY5B 3CCRA 2ATWA 2NVQH 3S1NH 2IT1A 1UE7A 1X56A 3G48A 1YITA 4DAMA 2PQAB 4R1JA 4DV0Q 3D31A 1UEBA 3PO2H 5AJ3L 3H3VH 1UE5A 3PUVA 4A4IA 1I50H 2JA7H 2R7ZG 4JI4L 2JEBI 2Z0SA 3PSIA 4DR2L 2K75A 1N36L 4DR6L 2LSSA 2JE6I 1HR0L 1HZBA 2H5XA 1IBKQ 1W3SA 4BY7G 2KHIA 5LMNL 4DV5L 1IZ6A 4A3GH 3OW2A 5ELOA 2VW9A 2PQAA 1VQ8A 4DNIA 1N33L 4LF4Q 2IHEA 1HNWQ 1HJPA 2F52A 4LUVA 4POGA 5JJIA 3M85A 5JEAJ 2UU9Q 2F3IA 3K7AH 1YJ9A 4OX9Q 3HOYG 4BBRG 1YBYA 4OWXB 5FLXc 2ZTEA 1N32Q 3FP9A 2K5HA 1AE2A 3F1ZA 4AQYQ 2HT1A 4LWCA 1OXUA 5GROA 1K8GA 4R4TA 3WWVA 3I4MH 2R92H 2JA5G 1PH1A 4LF8Q 1CKMA 4A3KG 5FJ8H 4EX5A 1IL2A 2UXCL 4BBSH 4JI1L 1C7YA 2K50A 1U5KA 1NE3A 3H0GG 1XNQQ 5IT9c 3HOXH 2UXBL 5FLMH 4GLXA 1GD7A 4J15A 4JOIA 3RLFA 4POFA 3RNUA 4JYAL 1W2BA 3U4ZA 4KI0A 3K8AA 4LUOA 2E5LL 4LF7Q 2CFMA 1G291 4NB3A 4DK3C 3PUXA 4KLKA 4UP9A 3J80i 4X66Q 5M3FG 1I6HH 2MNAA 4P72A 1SN8A 1PVOA 1EFWA 3HOZG 3S2DH 5IYBG 3KFUA 1Y1VH 5LMUL 4IFDG 2D0OA 4NXNL 5C44G 4LNQA 4APVA 4JOIC 1R9TH 3KDFA 3CF5A 4KHPQ 2QA4A 1NJIC 4X65L 1IXRA 2OTJA 2RF4A 4DK6C 1N8RC 3CP0A 2OTLA 4L5RC 4DAYB 5C3EH 3F2DA 1EIFA 1EQRA 4DR5L 4MZ9A 2VUMH 3EN2A 2B63H 1VQIA 1KRTA 4XTCS 3PO2G 2R6GA 4OO1I 2JA7G 4B3RQ 3MEFA 5GQOA 2HHHL 2ES2A 4YWLA 4DV2L 3TEHB 3FKIH 2JA9A 3S15H 1LM0A 2UXDL 1JJCB 5ELNA 1TWCH 5IP9H 4YWKA 4A3GG 1Q1BA 4YHHQ 2KBNA 1GO3E 3ULJA 1VQJA 3GO5A 3PV0A 1PH3A 1I5FA 2A8VA 1QUQA 1V1QA 1YHQA 1VQPA 5GAEC 4B3SQ 3PIPA 3K80C 4DV6Q 4B3TQ 4HJAA 3HOWG 1VQ6A 1B70B 3MXNB 1X55A 4DR4Q 3F8TA 1IBKL 3I55A 3I4MG 5JJKA 3J7ZC 3KF6A 4DR3L 2AWOA 2DUDA 1BBUA 4JG2A 2N78A 5FJ8G 2OCEA 1ASYA 4LF4L 3S17H 1HNWL 4NXMQ 2UU9L 4OX9L 5FLMG 2CCZA 2E2IH 3GTKH 4UP7A 3CCSA 2Q2TA 1N32L 2AKWB 4AQYL 4A3FH 1PHJA 2V1CC 1Q46A 1GVPA 4JI0Q 3PUWA 4JI7Q 1K0RA 4JI8Q 3GTJH 1HNZL 3BU2A 4P75A 3NENA 1G6PA 2ALYB 4GOPA 4LF8L 1E24A 5K36G 1VQBA 2OQ0A 1DGSA 2I5LX 1Q86C 1RIPA 4DV7Q 1PH4A 1HNXQ 1Y1VG 2ID0A 1XPUA 4DV1Q 4OWWB 2I5MX 4B3ML 2K5NA 4GN3B 4BXXG 1XMQQ 3CMAA 4A3JH 3J81c 4C2MH 3K7UC 3U4VA 1Q7YC 1HR0W 3I2ZA 4AYBG 5HGQA 1P16A 4GOPC 2PI2A 5C3EG 1NMFA 2VUMG 4HIMA 1Q81C 4X66L 3CXCA 2B63G 1PYBA 1VQGA 1OXSC 1TXYA 4IPCA 4JI5Q 3ERSX 1E22A 3FKIG 3PO3H 4JBJA 4YY3Q 4LF5Q 3CCLA 4KHPL 3RLNA 5IP9G 3EBEA 1WYDA 3CCVA 4A3CH 2VY3A 3F2BA 1ASZA 4QGUA 1N34Q 2VQFQ 1NY4A 1OTCA 1WFQA 2JA8H 1EQQA 1NMGA 5GAHC 4AH6A 4DR7L 3KJPA 4GKKQ 3CC2A 3BJUA 1PH2A 4X64L 4JBMA 4YWMA 4B3RL 4R4IA 1A8VA 1MJCA 4DPGA 3CC4A 1GKHA 5BR8Q 1G51A 1HZAA 2LXJA 2R7DA 3T1YQ 4GNXA 3IRBA 3CCQA 4JI3Q 4BA2I 3M7NA 1IBMQ 4YHHL 1VQHA 1SLJA 4LUZA 1VQLA 2PMZE 1EIYB 3HKSA 1IBLQ 3PCOB 4OONA 2Y0SG 1FL0A 1YVCA 2VS1A 1I94Q 4LF9Q 5C0XJ 4JI2Q 4B3SL 5JEAG 4DV6L 3NELA 4B3TL 4A3FG 2NZOA 2YTXA 5IP7H 2UUCQ 4DR4L 2CWAA 4GKJL 1TWGH 4LFAQ 4GLVB 3NBHB 5HY6A 2N49A 3RZOH 4PG3A 1SROA 3KDFB 2NN6G 2RCNA 2WAQE 3U50C 4L5QA 2E2HH 4L5SA 4A3DH 2UUBQ 3U58A 1J6QA 5JJLA 4NXML 3OYYA 3HKZG 1XJVA 3CCMA 2BH8A 1U0LA 2R7FA 4MNOA 1PH8A 1YHAA 3A5UA 2R93H 1OXVA 1EWIA 1FGUA 4JI0L 1PA6A 4DV3Q 1CKNB 2XTIA 4PZ6A 2ZJPA 1PH5A 4JI8L 4JI7L 2JEAI 1M90C 1I3QH 4DV4Q 1HZCA 3RN5A 4UP8A 1YEZA 2NVYH 1B7YB 4LFCQ 3ICEA 1HNXL 2FXQA 4DV1L 3H15A 4HJ7A 3M4OH 4FDBA 1VQ4A 1XMQL 3PO3G 4A93H 5H1SE 4HIDA 1CKNA 3TS0A 1JE5A 2VNUD 2ZM6Q 4A3CG 1QUQB 1VS0A 4A3MH 1IYJB 4JI6Q 3T1HQ 3BZKA 2JA8G 1LYLA 2QGQA 1VQ9A 2KCTA 2D62A 1K8AC 4BA1I 2HIVA 1NBWA 3KF6B 4LF6Q 2LXKA 4JI5L 1QVCA 1YI2A 1GM5A 1FJGQ 5M5YH 3S1QH 4DV0L 4YY3L 5M5WH 1T9HA 4X62Q 3LGJA 4HIOA 1S3OA 1VQ5A 1S72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 Q;  3HOV H;  2YU9 H;  1N34 L;  1WCM H;  2WB1 G;  2VQF L;  1VQN A;  2YV5 A;  2C35 B;  1V9P A;  1J5E Q;  3CQZ H;  2E2J H;  2R92 G;  2AMC B;  4QY7 A;  4GKK L;  3UDF A;  2IX1 A;  1O7I A;  3E0E A;  1XTD A;  3F2C A;  1Y14 B;  4K0K Q;  4GOP B;  4YCV A;  3KOJ A;  3W1B A;  5IP7 G;  4BBS G;  3D0F A;  3GTL H;  5BR8 L;  2Q2U A;  1K73 C;  1UWV A;  4GN5 A;  3TS2 A;  1VQK A;  3E9I A;  3T1Y L;  3ULP A;  5C0X I;  4JI3 L;  3HOX G;  3AEV A;  3B6Y A;  3S1M H;  1IBM L;  4BY1 H;  1BKB A;  4DUZ Q;  3CD6 A;  2MO1 A;  3GDE A;  2EQS A;  1EOV A;  3L7Z C;  3A74 A;  3S24 A;  3ULL A;  3STB D;  5C4X H;  1EUJ A;  2NVX H;  1S40 A;  4JV5 Q;  3CCE A;  1EYG A;  4DUY Q;  1I94 L;  4LF9 L;  1X3G A;  4TQU S;  4IPH A;  3G71 A;  1XMO Q;  1YJW A;  4JI2 L;  2R93 G;  2A1A A;  2OQK A;  3TRE A;  4KHZ A;  2UUC L;  2UXB Q;  1VQO A;  4DR1 Q;  2QEX A;  2PNH A;  4QL5 A;  2OWO A;  3DLL A;  3GTQ H;  4LFA L;  1XNR Q;  3CW2 C;  1XNQ L;  2UUA Q;  1VQM A;  2Q2I A;  3RN2 A;  1QVG A;  1AE3 A;  1X3F A;  2Q2H A;  3JC6 6;  3RR5 A;  3CME A;  2NVT H;  4YCU A;  3AQQ A;  5LMN W;  4LF7 L;  3JAM i;  4QJF A;  2BH2 A;  1TWH H;  4A93 G;  5IY0 A;  2IHF A;  5LMU Q;  1JT8 A;  2WFW A;  2F4V Q;  1CUK A;  3H0G H;  1E3P A;  4DV3 L;  1B8A A;  3I4N H;  1YJN A;  3GD7 A;  1VQA A;  3J80 c;  4DV4 L;  4TVA B;  3CPW A;  2HIX A;  3S14 H;  1Q12 A;  3FHW A;  4LFC L;  3S16 H;  1WOC A;  1YNX A;  2VZA A;  2MO0 A;  4GNX B;  5IYD H;  4IOA A;  4OO1 G;  1CSQ A;  2YTV A;  2JJQ A;  5IYB H;  1HH2 P;  3J7A 5;  4WJ4 A;  3PUZ A;  3HOU H;  1LTL A;  3H3V I;  3L0O A;  2ZM6 L;  3W1G A;  4A75 A;  4A76 A;  1SMX A;  3OTO Q;  1WCM G;  3T1H L;  1KAW A;  1X3E A;  1SR3 A;  3PIO A;  3VDY A;  1KD1 C;  4UPA A;  3S2H H;  3UDG A;  3M3Y H;  3J81 j;  1Y1W H;  2B3G A;  2EXD A;  4R4C A;  3S1R H;  4ME3 A;  3EIV A;  1A62 A;  4LF6 L;  4UY8 C;  2PI2 E;  3AFQ A;  4IJH A;  1FJG L;  3AFP A;  1SE8 A;  1VQC A;  2NZH A;  1PH6 A;  5GAG C;  1WJJ A;  4X62 L;  2VQE Q;  5IWA Q;  4IPG A;  1VCI A;  4A3L H;  2N3S A;  4LF5 L;  4BY1 G;  4LFB Q;  1OXT A;  1X6O A;  4OWT B;  1XPR A;  2BA1 A;  4DR3 Q;  5C4X G;  1JMC A;  2MQH A;  4GNX C;  3KJO A;  1J5E L;  4XIG S;  1P8L A;  1N9W A;  4K0K L;  1X65 A;  3M4P A;  1VQF A;  3ER0 A;  4L5T A;  3SGI A;  4GLA C;  5C0X G;  3G4S A;  2N8N A;  2ZTD A;  1MKH A;  1NTG A;  1Z47 A;  2A19 A;  4LW1 A;  3W5O A;  3E9H A;  5IYC H;  1AH9 A;  3HOW H;  4A3J G;  5J3B A;  1A63 A;  1CKO A;  1Q82 C;  3KYH C;  1HNZ Q;  1L2F A;  4C3I H;  4DUZ L;  4P73 A;  4AYB E;  3DM3 A;  5EAY A;  3PF4 A;  4JV5 L;  2D0P A;  3J81 i;  4C3J H;  2CKZ B;  4A3B H;  4DUY L;  1K83 H;  1XMO L;  4Y52 H;  5GAD C;  4A3E H;  4B3M Q;  2K14 A;  2RHQ B;  4DV7 L;  2GVB A;  1VQE A;  3AYH B;  1MIU A;  4R4Q A;  2KCM A;  2KEN A;  3UDX A;  4DR1 L;  4QQB X;  3I4N G;  1D7Q A;  1SFO H;  2ASB A;  4IFD J;  1XNR L;  3NEM A;  1K9M C;  1Q8K A;  4H02 A;  2UUA L;  1E7Z A;  1H95 A;  2Z6K A;  2K52 A;  3I56 A;  2AHO B;  3CC7 A;  5IYD G;  4P71 A;  3BZC A;  4AIM A;  2JA6 H;  1JJ2 A;  1VQ7 A;  3GTM H;  1TWF H;  4RMF A;  4WJ3 M;  1BVS A;  1KIX A;  3HOU G;  1KC8 C;  1UE1 A;  3UE0 A;  4BXX H;  2F4V L;  1L0W A;  5C4J H;  2GN5 A;  3K0X A;  1CSP A;  4MTN A;  1KL9 A;  3JAM c;  4O0A A;  5AJ3 Q;  5M3M H;  4RG1 A;  1X9N A;  3CPF A;  4HJ5 A;  2Z6K C;  1C0A A;  2DGY A;  1Y1W G;  2CWP A;  3M9B A;  3PGZ A;  4JI4 Q;  2YYZ A;  4JC0 A;  4JCV E;  2RHS B;  4DR2 Q;  4A3I H;  1N36 Q;  1M1K C;  4DR6 Q;  1KXL A;  4PMW A;  4DR7 Q;  4IJL A;  1C9O A;  4X64 Q;  5LMN Q;  2ZTC A;  4DV5 Q;  2Y0S E;  3CAM A;  2I5H A;  4P74 A;  3CCJ A;  4O2D A;  1HZ9 A;  1VQD A;  3I4O A;  4JBK A;  3PUY A;  1N33 Q;  4A3L G;  2KHJ A;  3K81 C;  1QZH A;  3M4Q A;  3CCU A;  4ALP A;  4HJ8 A;  3OTO L;  2CQO A;  3TQY A;  1E1T A;  1KRS A;  2E8G A;  1XPO A;  4GS3 A;  4PZ7 A;  1PH9 A;  2ZJQ A;  2R7Z H;  2XGT A;  1Z9F A;  2GVA A;  4BY7 H;  1OXX K;  1PV4 A;  2ZJR A;  3GTP H;  2K5V A;  1IBL L;  4A3D G;  2VQE L;  1RL2 A;  3HKZ E;  5IYC G;  5IWA L;  2UXC Q;  1YHB A;  2YTY A;  2AWN A;  4JI1 Q;  4C3H H;  3PF5 A;  1MJE A;  4GKJ Q;  4LFB L;  3HFZ B;  4Y7N H;  3HOY H;  4HJ9 A;  3GTO H;  4BBR H;  1TWA H;  2B29 A;  4IPD A;  4X6A H;  4A3B G;  1K3R A;  3KF8 B;  4NPS A;  1QZG A;  4JYA Q;  2WP8 J;  1BBW A;  4DKA C;  1L1O B;  4GN4 B;  4A3E G;  3RZD H;  2E5L Q;  1Q1E A;  2JA5 H;  4IO9 A;  3L2P A;  5IE8 A;  2I0Q A;  1E1O A;  2NN6 I;  3UE1 A;  4A3K H;  2UUB L;  3Q8D A;  4R4O A;  1YIJ A;  4HIK A;  1YZ6 A;  4JBW A;  3STB C;  4NXN Q;  5E7N A;  4PZ8 A;  5M5X H;  2HQL A;  1PH7 A;  1JB7 A;  1D8L A;  1KHI A;  4A3M G;  4OXP A;  3UDI A;  4IFD I;  2JA6 G;  4X65 Q;  1WI5 A;  4EQ5 A;  2L15 A;  1L1O A;  2JK8 A;  2K4K A;  3KLW A;  1SRU A;  3I7F A;  2MFI A;  2WAQ G;  1PFS A;  1FVI A;  1V43 A;  4DR5 Q;  5M3F H;  1PYS B;  1UE6 A;  2EIF A;  1QVF A;  2IX0 A;  1X54 A;  4YCW A;  3A0J A;  3ZJY C;  1KQS A;  5M3M G;  2JQO A;  3HOZ H;  2BA0 A;  5DLQ E;  3A5Z B;  2HHH Q;  1A0I A;  3GTG H;  4DV2 Q;  2VL6 A;  5C44 H;  4A3I G;  1LUZ A;  3TRZ A;  2WB1 E;  3HOV G;  1L1O C;  3G6E A;  4IOC A;  3RLO A;  4JI6 L;  4QIW E;  2UXD Q;  1JJG A;  2IY5 B;  3CCR A;  2ATW A;  2NVQ H;  3S1N H;  2IT1 A;  1UE7 A;  1X56 A;  3G48 A;  1YIT A;  4DAM A;  2PQA B;  4R1J A;  4DV0 Q;  3D31 A;  1UEB A;  3PO2 H;  5AJ3 L;  3H3V H;  1UE5 A;  3PUV A;  4A4I A;  1I50 H;  2JA7 H;  2R7Z G;  4JI4 L;  2JEB I;  2Z0S A;  3PSI A;  4DR2 L;  2K75 A;  1N36 L;  4DR6 L;  2LSS A;  2JE6 I;  1HR0 L;  1HZB A;  2H5X A;  1IBK Q;  1W3S A;  4BY7 G;  2KHI A;  5LMN L;  4DV5 L;  1IZ6 A;  4A3G H;  3OW2 A;  5ELO A;  2VW9 A;  2PQA A;  1VQ8 A;  4DNI A;  1N33 L;  4LF4 Q;  2IHE A;  1HNW Q;  1HJP A;  2F52 A;  4LUV A;  4POG A;  5JJI A;  3M85 A;  5JEA J;  2UU9 Q;  2F3I A;  3K7A H;  1YJ9 A;  4OX9 Q;  3HOY G;  4BBR G;  1YBY A;  4OWX B;  5FLX c;  2ZTE A;  1N32 Q;  3FP9 A;  2K5H A;  1AE2 A;  3F1Z A;  4AQY Q;  2HT1 A;  4LWC A;  1OXU A;  5GRO A;  1K8G A;  4R4T A;  3WWV A;  3I4M H;  2R92 H;  2JA5 G;  1PH1 A;  4LF8 Q;  1CKM A;  4A3K G;  5FJ8 H;  4EX5 A;  1IL2 A;  2UXC L;  4BBS H;  4JI1 L;  1C7Y A;  2K50 A;  1U5K A;  1NE3 A;  3H0G G;  1XNQ Q;  5IT9 c;  3HOX H;  2UXB L;  5FLM H;  4GLX A;  1GD7 A;  4J15 A;  4JOI A;  3RLF A;  4POF A;  3RNU A;  4JYA L;  1W2B A;  3U4Z A;  4KI0 A;  3K8A A;  4LUO A;  2E5L L;  4LF7 Q;  2CFM A;  1G29 1;  4NB3 A;  4DK3 C;  3PUX A;  4KLK A;  4UP9 A;  3J80 i;  4X66 Q;  5M3F G;  1I6H H;  2MNA A;  4P72 A;  1SN8 A;  1PVO A;  1EFW A;  3HOZ G;  3S2D H;  5IYB G;  3KFU A;  1Y1V H;  5LMU L;  4IFD G;  2D0O A;  4NXN L;  5C44 G;  4LNQ A;  4APV A;  4JOI C;  1R9T H;  3KDF A;  3CF5 A;  4KHP Q;  2QA4 A;  1NJI C;  4X65 L;  1IXR A;  2OTJ A;  2RF4 A;  4DK6 C;  1N8R C;  3CP0 A;  2OTL A;  4L5R C;  4DAY B;  5C3E H;  3F2D A;  1EIF A;  1EQR A;  4DR5 L;  4MZ9 A;  2VUM H;  3EN2 A;  2B63 H;  1VQI A;  1KRT A;  4XTC S;  3PO2 G;  2R6G A;  4OO1 I;  2JA7 G;  4B3R Q;  3MEF A;  5GQO A;  2HHH L;  2ES2 A;  4YWL A;  4DV2 L;  3TEH B;  3FKI H;  2JA9 A;  3S15 H;  1LM0 A;  2UXD L;  1JJC B;  5ELN A;  1TWC H;  5IP9 H;  4YWK A;  4A3G G;  1Q1B A;  4YHH Q;  2KBN A;  1GO3 E;  3ULJ A;  1VQJ A;  3GO5 A;  3PV0 A;  1PH3 A;  1I5F A;  2A8V A;  1QUQ A;  1V1Q A;  1YHQ A;  1VQP A;  5GAE C;  4B3S Q;  3PIP A;  3K80 C;  4DV6 Q;  4B3T Q;  4HJA A;  3HOW G;  1VQ6 A;  1B70 B;  3MXN B;  1X55 A;  4DR4 Q;  3F8T A;  1IBK L;  3I55 A;  3I4M G;  5JJK A;  3J7Z C;  3KF6 A;  4DR3 L;  2AWO A;  2DUD A;  1BBU A;  4JG2 A;  2N78 A;  5FJ8 G;  2OCE A;  1ASY A;  4LF4 L;  3S17 H;  1HNW L;  4NXM Q;  2UU9 L;  4OX9 L;  5FLM G;  2CCZ A;  2E2I H;  3GTK H;  4UP7 A;  3CCS A;  2Q2T A;  1N32 L;  2AKW B;  4AQY L;  4A3F H;  1PHJ A;  2V1C C;  1Q46 A;  1GVP A;  4JI0 Q;  3PUW A;  4JI7 Q;  1K0R A;  4JI8 Q;  3GTJ H;  1HNZ L;  3BU2 A;  4P75 A;  3NEN A;  1G6P A;  2ALY B;  4GOP A;  4LF8 L;  1E24 A;  5K36 G;  1VQB A;  2OQ0 A;  1DGS A;  2I5L X;  1Q86 C;  1RIP A;  4DV7 Q;  1PH4 A;  1HNX Q;  1Y1V G;  2ID0 A;  1XPU A;  4DV1 Q;  4OWW B;  2I5M X;  4B3M L;  2K5N A;  4GN3 B;  4BXX G;  1XMQ Q;  3CMA A;  4A3J H;  3J81 c;  4C2M H;  3K7U C;  3U4V A;  1Q7Y C;  1HR0 W;  3I2Z A;  4AYB G;  5HGQ A;  1P16 A;  4GOP C;  2PI2 A;  5C3E G;  1NMF A;  2VUM G;  4HIM A;  1Q81 C;  4X66 L;  3CXC A;  2B63 G;  1PYB A;  1VQG A;  1OXS C;  1TXY A;  4IPC A;  4JI5 Q;  3ERS X;  1E22 A;  3FKI G;  3PO3 H;  4JBJ A;  4YY3 Q;  4LF5 Q;  3CCL A;  4KHP L;  3RLN A;  5IP9 G;  3EBE A;  1WYD A;  3CCV A;  4A3C H;  2VY3 A;  3F2B A;  1ASZ A;  4QGU A;  1N34 Q;  2VQF Q;  1NY4 A;  1OTC A;  1WFQ A;  2JA8 H;  1EQQ A;  1NMG A;  5GAH C;  4AH6 A;  4DR7 L;  3KJP A;  4GKK Q;  3CC2 A;  3BJU A;  1PH2 A;  4X64 L;  4JBM A;  4YWM A;  4B3R L;  4R4I A;  1A8V A;  1MJC A;  4DPG A;  3CC4 A;  1GKH A;  5BR8 Q;  1G51 A;  1HZA A;  2LXJ A;  2R7D A;  3T1Y Q;  4GNX A;  3IRB A;  3CCQ A;  4JI3 Q;  4BA2 I;  3M7N A;  1IBM Q;  4YHH L;  1VQH A;  1SLJ A;  4LUZ A;  1VQL A;  2PMZ E;  1EIY B;  3HKS A;  1IBL Q;  3PCO B;  4OON A;  2Y0S G;  1FL0 A;  1YVC A;  2VS1 A;  1I94 Q;  4LF9 Q;  5C0X J;  4JI2 Q;  4B3S L;  5JEA G;  4DV6 L;  3NEL A;  4B3T L;  4A3F G;  2NZO A;  2YTX A;  5IP7 H;  2UUC Q;  4DR4 L;  2CWA A;  4GKJ L;  1TWG H;  4LFA Q;  4GLV B;  3NBH B;  5HY6 A;  2N49 A;  3RZO H;  4PG3 A;  1SRO A;  3KDF B;  2NN6 G;  2RCN A;  2WAQ E;  3U50 C;  4L5Q A;  2E2H H;  4L5S A;  4A3D H;  2UUB Q;  3U58 A;  1J6Q A;  5JJL A;  4NXM L;  3OYY A;  3HKZ G;  1XJV A;  3CCM A;  2BH8 A;  1U0L A;  2R7F A;  4MNO A;  1PH8 A;  1YHA A;  3A5U A;  2R93 H;  1OXV A;  1EWI A;  1FGU A;  4JI0 L;  1PA6 A;  4DV3 Q;  1CKN B;  2XTI A;  4PZ6 A;  2ZJP A;  1PH5 A;  4JI8 L;  4JI7 L;  2JEA I;  1M90 C;  1I3Q H;  4DV4 Q;  1HZC A;  3RN5 A;  4UP8 A;  1YEZ A;  2NVY H;  1B7Y B;  4LFC Q;  3ICE A;  1HNX L;  2FXQ A;  4DV1 L;  3H15 A;  4HJ7 A;  3M4O H;  4FDB A;  1VQ4 A;  1XMQ L;  3PO3 G;  4A93 H;  5H1S E;  4HID A;  1CKN A;  3TS0 A;  1JE5 A;  2VNU D;  2ZM6 Q;  4A3C G;  1QUQ B;  1VS0 A;  4A3M H;  1IYJ B;  4JI6 Q;  3T1H Q;  3BZK A;  2JA8 G;  1LYL A;  2QGQ A;  1VQ9 A;  2KCT A;  2D62 A;  1K8A C;  4BA1 I;  2HIV A;  1NBW A;  3KF6 B;  4LF6 Q;  2LXK A;  4JI5 L;  1QVC A;  1YI2 A;  1GM5 A;  1FJG Q;  5M5Y H;  3S1Q H;  4DV0 L;  4YY3 L;  5M5W H;  1T9H A;  4X62 Q;  3LGJ A;  4HIO A;  1S3O A;  1VQ5 A;  1S72 A; 
#chains in the Genus database with same CATH topology
 1HR0 Q;  3HOV H;  1VQN A;  5KYL A;  2YV5 A;  2CH4 A;  1LT5 D;  4GKK L;  1I4G A;  2R92 G;  4QY7 A;  5DEH A;  1K8O A;  2IX1 A;  1DM0 B;  4DN4 M;  1XTD A;  4K0K Q;  5JOB A;  1XXG A;  3NUC A;  1B9N A;  2NUC A;  5IP7 G;  3GTL H;  1TY0 A;  4HCS A;  1NNX A;  4XYO A;  5C0X I;  5JAV A;  2I07 B;  1VMC A;  3CD6 A;  2EQS A;  2QCP X;  1EYG A;  3H3V C;  4TQU S;  2A1A A;  4HR7 B;  2K03 A;  3V96 A;  1VQO A;  1WVL A;  4KN4 C;  3GTQ H;  1XNR Q;  3ZYY X;  3JC6 6;  1CI3 M;  4HSV A;  3AQQ A;  2H1E A;  3WOF A;  3JAM i;  4QJF A;  4UAI A;  3OIQ A;  5LMU Q;  5IGE A;  3AMU A;  5M3M B;  4FYD A;  4KY5 A;  3F2U A;  4TVA B;  2XN9 C;  2IWH A;  4A3I B;  3A8I E;  4GNX B;  1SEB D;  2B63 B;  5IYD H;  4OO1 G;  2M2L A;  2YTV A;  4KJN A;  4WJW A;  4JVZ A;  1IW7 D;  3PUZ A;  3HOU H;  1LTL A;  3H3V I;  3OTO Q;  2A68 D;  3PIO A;  3MEH A;  3MA2 B;  3MXG A;  4ZUJ A;  1TS4 A;  2WKD A;  3K5N A;  4R4C A;  4ME3 A;  4BY7 B;  2J4X A;  2PI2 E;  2DN8 A;  5GAG C;  4IPG A;  1FNW A;  2H4O A;  3I3C A;  2XNA C;  4DR3 Q;  1JOQ A;  4BBR B;  5C4X G;  5DNF A;  2KOL A;  3A8J E;  1P8L A;  4WFN 3;  3CRL C;  5IGF A;  3IFT A;  1EY4 A;  4KY6 A;  3SDZ A;  5C0X G;  4GLA C;  1MKH A;  1NTG A;  3W5O A;  2A19 A;  4LW1 A;  3X3M A;  3E9H A;  1AH9 A;  4A3F B;  5J3B A;  4ZRZ A;  3TZU A;  3GTJ B;  5KGU A;  3PF4 A;  2DNC A;  1RTO A;  1DCZ A;  4JV5 L;  3J81 i;  4A3B H;  4DUY L;  3VA5 A;  4Y52 H;  5GAD C;  4A3E H;  4B3M Q;  2F0S A;  5D3I B;  4OGQ C;  4Z9C B;  1BCP B;  3UDX A;  4DR1 L;  2ASB A;  3D6W A;  3I56 A;  3CC7 A;  1KAB A;  4AIM A;  2JA6 H;  1E2V A;  5C5M A;  4WJ3 M;  1BVS A;  3SE0 A;  1QB5 D;  4MTN A;  1CSP A;  3JAM c;  1X9N A;  1IL8 A;  5M3M H;  4RG1 A;  4RHS A;  1Y1W G;  2QKI C;  3PGZ A;  2LMC B;  2RHS B;  4A3I H;  2F0D A;  4DR6 Q;  1U4P A;  4IJL A;  4X64 Q;  2SNM A;  2ZTC A;  3MXU A;  3CCJ A;  1DOK A;  2KEC A;  1HZ9 A;  3I4O A;  4JBK A;  1N33 Q;  1EY0 A;  3DEO A;  1YNN D;  1E1T A;  2RDH A;  1KRS A;  4CDE C;  2A6E D;  2KEE A;  4PZ7 A;  3BS1 A;  1PH9 A;  2R7Z H;  3R8B A;  2K5W A;  2XGT A;  1KTK A;  4BY7 H;  2R92 B;  3P75 A;  1OXX K;  2EVB A;  3JAM E;  3GTP H;  1IBL L;  2VQE L;  3HKZ E;  1OO9 B;  2EY5 A;  2XWB B;  1HFG A;  5IYC G;  2K04 A;  2AWN A;  1RD9 D;  2RVL A;  4XT3 B;  4JI1 Q;  2EXZ A;  3PF5 A;  2EYH A;  4LFB L;  5ELE A;  3KLR A;  2SNS A;  3GTO H;  4BBR H;  3RZO B;  4XQQ A;  1TWA H;  4C3J G;  3OWE B;  3KF8 B;  4NPS A;  1QZG A;  2WP8 J;  4X3U A;  4K5V A;  2KCN A;  1GUN A;  1STE A;  4XQN A;  1RF2 D;  3UI2 A;  1X32 A;  1LT6 D;  1R4Q B;  1SAP A;  2MGS A;  2F0F A;  1WTW A;  1D8L A;  5T1I A;  4A3M G;  2NVY B;  4IFD I;  1J8I A;  1WI5 A;  2KCC A;  2KQ3 A;  3KLW A;  2K4K A;  4PV1 C;  4IUT A;  5I9O A;  1SRU A;  5LHY 1;  2MFI A;  3ONA B;  2L9H A;  1PFS A;  1Q90 A;  1V43 A;  2B2V C;  4JPB W;  5M3F H;  2EIF A;  4YCW A;  3ZJY C;  1BF4 A;  2JQO A;  3HOZ H;  2BA0 A;  1PRT D;  4ME5 A;  4J8Q A;  4ID6 A;  1L1O C;  2F0W A;  1JJG A;  3R93 A;  1VMP A;  3SHL A;  3L9A X;  2IT1 A;  5I6Y A;  1X56 A;  4X3T A;  1DD2 A;  1LAB A;  3D31 A;  1UEB A;  3PO2 H;  2G9D A;  5JVH 3;  1UE5 A;  1CHQ D;  2JA7 H;  1UUP A;  3SK5 A;  4RCN A;  5TSS A;  2YU9 B;  2A5H A;  3Q6S A;  2E2J B;  1M4V A;  1W3S A;  1IW7 C;  4DK0 A;  4DV5 L;  4FF4 A;  2K33 A;  3OW2 A;  1T5E A;  5ELO A;  2F0V A;  4LF4 Q;  2IHE A;  1D2B A;  2A68 C;  1A3T A;  4TRD A;  2F3I A;  3HOY G;  3NBI A;  1KDB A;  5FLX c;  2E2I B;  1N32 Q;  3F1Z A;  5M9O A;  4AQY Q;  3EFX D;  1K8G A;  5C4X B;  3ND8 A;  3DUZ A;  2R92 H;  1PH1 A;  3MFY A;  4LF8 Q;  4IUQ A;  1LO5 D;  2A6H D;  2X6G A;  1C7Y A;  2RDF A;  5CC4 A;  1XNQ Q;  5FLM H;  3RLF A;  1H9K A;  1CFM A;  4FF2 A;  4EQP A;  4KY7 A;  2NVT B;  1IHZ A;  2IL8 A;  2F0L A;  2L4N A;  1TWH B;  3J80 i;  5K36 H;  4P72 A;  1SN8 A;  3TBI B;  3K5O A;  5FLX E;  3S2D H;  4UHV A;  3C2P A;  1Y1V H;  1NR2 A;  3NBH A;  3FRP B;  4IFD G;  4NXN L;  5C44 G;  3BG3 A;  2QA4 A;  1IXR A;  4DNT B;  1G8Z D;  2RF4 A;  1EIH A;  1N8R C;  4L5R C;  3F2D A;  2VUM H;  2KA7 A;  1VQI A;  5CV9 A;  4XTC S;  1FD7 D;  3ND9 A;  3MEF A;  2DJG C;  3H91 A;  4NKL A;  4YWL A;  4DV2 L;  3FKI H;  3H94 A;  2A69 D;  3S15 H;  1JOR A;  1Y1W B;  5JJZ A;  4YWK A;  3QIA A;  1KAA A;  4OO1 H;  3ULJ A;  1SYE A;  3PV0 A;  1PH3 A;  2OXP A;  1SYD A;  5KEE A;  1AEX A;  1I5F A;  4HED A;  1QUQ A;  2F0O A;  1VQP A;  5GAE C;  1BXT A;  3HOW G;  1LT4 D;  3MXN B;  1Y8P B;  5C5L A;  3I4M G;  3I55 A;  3J7Z C;  1ET6 A;  3Q0A A;  1BBU A;  3SXH A;  2OCE A;  3AU7 A;  1YNN C;  2UU9 L;  2A6E C;  3OSO A;  4L63 B;  4OX9 L;  2CCZ A;  3VR2 A;  2E2I H;  3GTK H;  2Q2T A;  1A3V A;  4JI0 Q;  1Q46 A;  1II3 A;  2V1C C;  3H09 A;  4I65 A;  5T1G A;  1EWH A;  4C3J B;  4P75 A;  1D6E C;  1G6P A;  1ENF A;  1DGS A;  2Z4H A;  1PH4 A;  1HNX Q;  4DV1 Q;  4OWW B;  1D1I A;  3CMA A;  3G7L A;  5EBC A;  1CQF A;  1HR0 W;  5EKL A;  2EJF C;  1GXD C;  1ONL A;  1QIL A;  2O4X A;  3C1F A;  4A3M B;  2PI2 A;  1NMF A;  4HIM A;  1EY9 A;  3IL8 A;  1VQG A;  1TVX A;  1TXY A;  5C4J B;  1A6X A;  2KJX A;  4EQO A;  2PNR C;  1STB A;  1ML0 D;  1STG A;  4KHP L;  2DJF C;  1U4R A;  5IP9 G;  4H7B A;  2VQF Q;  1HRJ A;  1OTC A;  1WFQ A;  3E6Z X;  1EQQ A;  3CQZ B;  3KJP A;  1B53 A;  1PH2 A;  1I4H A;  3BDO A;  1PRT C;  4B3R L;  1LTA D;  5BR8 Q;  1G51 A;  1HZA A;  2LXJ A;  3T1Y Q;  3CCQ A;  4JI3 Q;  3K59 A;  3K5L A;  3J80 E;  2NVX B;  4OON A;  2Y0S G;  2F0T A;  1I94 Q;  3A8K E;  1H9R A;  2WIN B;  1UEA B;  2NZO A;  3C1E A;  2UUC Q;  3HOY B;  4DR4 L;  4GKJ L;  2CVR A;  4GLV B;  5HY6 A;  2EYJ A;  3DMU A;  1MD2 D;  2RCN A;  2WAQ E;  1W6J A;  2RCF A;  4R9W A;  2E2H H;  3DWQ A;  1XJV A;  3CCM A;  2R7F A;  2F0G A;  3A5U A;  4OIK A;  5C4H A;  5C6A A;  4DV3 Q;  5M5X B;  1PH5 A;  4JI7 L;  3ERO A;  5CV6 A;  5IGD A;  4DV4 Q;  1LT3 D;  2L12 A;  2CHB D;  4C1N I;  1HZC A;  3FDT A;  3MTS A;  3MZ5 A;  1B7Y B;  1O7Z A;  3D4W A;  2FXQ A;  4HJ7 A;  1AZP A;  1K0S A;  2NB0 A;  4A93 H;  3PO3 G;  4HID A;  1LTG D;  5LL6 S;  3TS0 A;  5C44 B;  2VNU D;  2ZM6 Q;  1XWE A;  1VS0 A;  4A3M H;  1IYJ B;  4KHV A;  3BZK A;  4CDD C;  2NVQ B;  1K8A C;  1V1O A;  1JE4 A;  4HMI A;  4RAU C;  1GHJ A;  1QVC A;  4YY3 L;  5M5W H;  2KED A;  3W2D A;  1VQ5 A;  1S3O A;  1WCM H;  1V9P A;  1J5E Q;  3CQZ H;  2AMC B;  1PYW D;  2OT2 A;  1Y14 B;  2ZXR A;  1JCK B;  2A69 C;  3TS2 A;  1K73 C;  2D9U A;  5KYI A;  3HOW B;  3ULP A;  3S1M H;  5G3L F;  4BY1 H;  3I4M B;  4C3I B;  3MXP A;  1EOV A;  3L7Z C;  3A74 A;  3S24 A;  3ULL A;  4X3K A;  3STB D;  1EUJ A;  2NVX H;  5CBE E;  4LF9 L;  4CDC C;  4JI2 L;  2R93 G;  4F7X A;  2UXB Q;  2PNH A;  4QL5 A;  2OWO A;  1SFO B;  1JB3 A;  2UUA Q;  1EEI D;  2Q2I A;  3M7G A;  1G2T A;  1JOO A;  1X3F A;  2G9H D;  3K6O A;  5EKI A;  5K5P A;  4YCU A;  1TS2 A;  4LF7 L;  4WOR A;  2BH2 A;  3A55 A;  1EEF D;  5KNB A;  4F88 A;  5ELC A;  2WFW A;  2F4V Q;  5EPL A;  3IAY A;  1B8A A;  1F9P A;  2HIX A;  3S14 H;  1Q12 A;  1MBY A;  1K28 A;  3FHW A;  3Q23 A;  1HXY D;  4LFC L;  3S16 H;  2L55 A;  1Y8N B;  1YNX A;  2MO0 A;  1CSQ A;  3I91 A;  4ZKC B;  4KD4 A;  4DAV A;  1GOZ A;  3HEJ A;  3T1H L;  1KAW A;  1TWC B;  1SR3 A;  3UDG A;  2EXD A;  1D5X C;  1CA6 A;  1A62 A;  2XVS A;  3MAQ A;  4LF6 L;  4UY8 C;  3AFQ A;  1SE8 A;  1VQC A;  1NCV A;  5IT9 L;  2F0P A;  1WJJ A;  4X62 L;  2EJM A;  3HG9 A;  5IWA Q;  4DA2 A;  2N3S A;  3D6C A;  4RFB A;  3TSS A;  4OWT B;  3KJO A;  4XIG S;  1H9M A;  4K0K L;  1X65 A;  3M4P A;  2Y0S B;  3ER0 A;  5KRU A;  1SYF A;  2N8N A;  1C4Q A;  2ZT9 C;  3HOW H;  4A3J G;  2KVM A;  1S5D D;  1PFM A;  4TKO B;  1L2F A;  1TT2 A;  4C3I H;  1SXT A;  3VR3 A;  5EKK A;  4ZQ3 A;  1K83 H;  1Z7T A;  1I4R A;  2FFK B;  1WTX A;  4QF4 A;  2K14 A;  5CBA E;  4QQB X;  4B08 A;  3I4N G;  2MP1 A;  1D7Q A;  1SFO H;  4C2M B;  1XNR L;  3NEM A;  5COY A;  1H95 A;  3TDQ A;  2K52 A;  3I70 A;  3BZC A;  1JJ2 A;  1QWY A;  3SK4 A;  1KIX A;  3PO3 B;  2NTT A;  4KJO A;  3K0X A;  3GV3 A;  1EIG A;  1QNU A;  1KL9 A;  1SYG A;  1Z6H A;  1I50 B;  3HGB A;  4KK7 A;  4HJ5 A;  2Z6K C;  1C0A A;  3M9B A;  2YYZ A;  4JC0 A;  1CM9 A;  1YNJ D;  1N36 Q;  2RA4 A;  1M1K C;  4PMW A;  4FXK C;  1GUW A;  1C9O A;  1TY2 A;  4CBV A;  5LMN Q;  2C9O A;  1SNQ A;  2JYO A;  3BVG A;  4P74 A;  4PMC A;  2QDL A;  1WTP A;  4A3L G;  3M4Q A;  4ZAI A;  1HA5 A;  3OTO L;  2E8G A;  3V2T A;  1DOM A;  1IYU A;  1FYC A;  2K7V A;  3GP7 A;  1U4M A;  4H13 C;  1AP0 A;  2UXC Q;  1LTS D;  4C3H H;  3QOL A;  1TWG B;  3HFZ B;  3OHX C;  4Y7N H;  1MGS A;  1EYC A;  2B29 A;  4H0L C;  4JYA Q;  1FNU A;  1BBW A;  5CV8 A;  5D14 A;  4GN4 B;  4DKA C;  2JA5 H;  2F03 A;  5IE8 A;  2I0Q A;  1I6H B;  2B2V A;  2UUB L;  2R93 B;  1G2S A;  1F9R A;  3Q8D A;  4HIK A;  4JBW A;  3STB C;  2BDN A;  1GUS A;  5E7N A;  2HQL A;  2O5J C;  1KHI A;  2XRS D;  4OXP A;  4X65 Q;  4EQ5 A;  1NAP A;  1L1O A;  2JK8 A;  1Q8I A;  3I7F A;  3M4O B;  1B1Z A;  1SNM A;  4DR5 Q;  2IX0 A;  1X54 A;  2PZT A;  1BBX C;  4XQJ A;  1PTO B;  5CGK A;  2E74 C;  4FNF A;  4V19 0;  3E3X A;  2LKV A;  3CCR A;  4OEM B;  3S1N H;  3G48 A;  2F4I A;  2Z8L A;  3EA6 A;  4A4I A;  3HS0 C;  1I50 H;  1QJO A;  2JEB I;  3PSI A;  4DR6 L;  1IBK Q;  2M9V A;  2KHI A;  4PMB A;  1PZK D;  2PQA A;  4DNI A;  1N33 L;  1HNW Q;  1DOL A;  3DEP A;  2J7Z A;  3LX0 A;  4POG A;  4QCL A;  4QUC A;  4M1U B;  5JEA J;  1YJ9 A;  2X6L A;  4OWX B;  4DFA A;  2K5H A;  5IIF A;  4LWC A;  1OXU A;  5GRO A;  3NTK A;  3HP3 A;  4A3K G;  5FJ8 H;  4JI1 L;  3OOC A;  4L8J A;  3HZX A;  4A3J B;  4RHR A;  4J15 A;  1A3U A;  4HSP A;  4KI0 A;  1EQV A;  3K8A A;  4EVO A;  2DNE A;  4ILW A;  2Z1C A;  2KUM A;  4DK3 C;  4KLK A;  4UP9 A;  4X66 Q;  2D2C C;  1SE3 A;  1I6H H;  5IYB G;  3I4N B;  2NTS A;  1AZQ A;  2F0U A;  1NJI C;  1V1P A;  2TSS A;  2OTJ A;  3CP0 A;  1B3Q A;  1SND A;  1EIF A;  2B63 H;  1G91 A;  3I4L A;  5CV7 A;  1PTO H;  4K6L A;  3TEH B;  3G6J B;  3S2H B;  3MHB A;  5ELN A;  5ELF A;  3S1R B;  1EQT A;  1I4Q A;  4A3G G;  1Q1B A;  4YHH Q;  1HHV A;  1NSN S;  2KBN A;  3GO5 A;  3O13 A;  3KLS X;  4G7H C;  4F87 A;  1KLU D;  3EJI A;  1YNJ C;  2QIL A;  4DV6 Q;  4B3T Q;  2FMM A;  3E5S A;  4HJA A;  1VQ6 A;  1X55 A;  4K5W A;  5JJK A;  1AN8 A;  3KF6 A;  3M4Y A;  3RD4 A;  1L0X B;  3MC0 B;  1QCB D;  4I7Z C;  4LF4 L;  1ILQ A;  3TZD A;  4S3S A;  3VR6 A;  4NXM Q;  2HCI A;  4RCO A;  5JEA H;  1N32 L;  3CCS A;  2AKW B;  4AQY L;  4A3F H;  2F0H A;  4JI8 Q;  1HNZ L;  3GTJ H;  2K01 A;  3NSW A;  5C3W A;  2ALY B;  2EZV A;  4LF8 L;  4G4K A;  1VQB A;  2OQ0 A;  2K5Q A;  2NN6 H;  1H9S B;  1ZXT A;  4A3J H;  3J81 c;  4K8J A;  4AYB G;  2B2T A;  5C3E G;  2I46 A;  1Q81 C;  3GTM B;  1KLG D;  1PYB A;  1OXS C;  2IJ0 A;  2Z9H A;  5J1Z A;  4IPC A;  4XT1 B;  2O2L D;  3ERS X;  2NYZ D;  1E22 A;  1MHW C;  4RA8 A;  5M5Y B;  1IKM A;  1U4L A;  4O42 A;  2AQ1 B;  5D65 A;  3CCL A;  3FPU B;  4A3C H;  2VY3 A;  2GA4 B;  3NWT A;  1N34 Q;  5EGT A;  4DR7 L;  2JXM B;  1CT1 D;  1E0B A;  3J81 E;  1A8V A;  2RBM A;  3CC4 A;  5D3D A;  1PTO D;  4GNX A;  3IRB A;  1LTB D;  1IBM Q;  1VQH A;  1SLJ A;  4LUZ A;  3D3R A;  2F1M A;  1EIY B;  3HKS A;  5IOC A;  3TP7 A;  3PCO B;  1IBL Q;  2VS1 A;  5C0X J;  5JPN C;  1Y8O B;  5IP7 H;  4LFA Q;  2FIN B;  2SDF A;  4P2C B;  5E4X A;  1TU2 B;  3URY A;  3RZO H;  4PG3 A;  3KDF B;  1JQY D;  3U50 C;  1C8C A;  3NPP A;  4A3K B;  4L5S A;  2F0N A;  4FF3 A;  3K0Y A;  4MN3 A;  1OXV A;  1EWI A;  2A74 C;  4JI0 L;  1AFP A;  2AUK A;  5C4Z A;  1STY A;  2NVY H;  1HNX L;  4DV1 L;  3EQL C;  4NP5 A;  1WD1 A;  1VQ4 A;  2EJG C;  5IGG A;  3GTG B;  1CKN A;  1BCP D;  1JE5 A;  3QJY A;  5HUR A;  2JA8 G;  1LYL A;  2QGQ A;  1VQ9 A;  2KCT A;  3M3Y B;  1MSH A;  1EY7 A;  1NBW A;  3VYS A;  1ZEQ X;  4J6H A;  2LXK A;  1BO0 A;  1SJH D;  1YI2 A;  1GUG A;  4YIJ A;  1PMR A;  4PQX A;  3A7A B;  3BYT B;  2RKS A;  4KV6 A;  5M5Y H;  4DV0 L;  1FJG Q;  1T9H A;  3PIO 3;  4HIO A;  1BUV T;  1HTP A;  4LF5 Q;  1HQR D;  4IUV A;  2YU9 H;  2WB1 G;  2VQF L;  4ABN A;  1DXM A;  2E2J H;  5BN5 A;  4A3G B;  3UDF A;  2R61 A;  3E0E A;  3F2C A;  1F2L A;  4GOP B;  5A2Q L;  3W1B A;  3K7A B;  3D0F A;  2FMC A;  5BR8 L;  2Q2U A;  1UWV A;  4GN5 A;  5KNC A;  2Z6B A;  1VQK A;  3T1Y L;  3AEV A;  1KNE A;  4JI3 L;  3HOX G;  3B6Y A;  5FKA C;  4ZK9 B;  4DUZ Q;  2MO1 A;  5C4X H;  1LTR D;  1S40 A;  4RGT A;  3SK8 A;  1STH A;  1I94 L;  1X3G A;  1XMO Q;  1YJW A;  1Q3L A;  2OQK A;  3C46 A;  4KHZ A;  5C0X H;  2UUC L;  5AFW A;  2QEX A;  5BN4 A;  3CW2 C;  1SE4 A;  3CHB D;  1PDQ A;  2NVT H;  3S9W A;  1GJX A;  5LMN W;  4FXD A;  1TWH H;  2IPK D;  2HCC A;  5IY0 A;  2IHF A;  3QOJ A;  2VB3 X;  1CUK A;  4DV3 L;  1R9T B;  1GUO A;  3KF8 A;  3J80 c;  3DWP A;  4DV4 L;  3CPW A;  4IAL A;  1L0Y B;  4AYB B;  5C3E B;  2B2T C;  3VR5 A;  3CRK C;  5J39 A;  2JJQ A;  5IYB H;  4BWG B;  2SEB D;  1HH2 P;  3J7A 5;  4N9P A;  5FLX L;  4WJ4 A;  3L0O A;  1WTH A;  2ZM6 L;  4NW2 A;  2N88 A;  3W1G A;  4A75 A;  1ESF A;  1SMX A;  1X3E A;  3VDY A;  4UPA A;  3M3Y H;  1Y1W H;  4KKS A;  4J1M A;  1SNP A;  3KLS A;  3W3A A;  1GHK A;  4IJH A;  1PH6 A;  4FVM A;  4RWS C;  1OXT A;  2VB2 X;  4DXF A;  4QB4 A;  2NZ1 D;  1S5C D;  1JMC A;  1J5E L;  3DHQ A;  4GNX C;  2BCO A;  5KIX A;  1N9W A;  3S17 B;  1HFN A;  3QO2 A;  1PTO C;  1VQF A;  4L5T A;  4IUP A;  4N9T A;  3SGI A;  3G4S A;  4CJ1 B;  1X3Q A;  1CA5 A;  2ZTD A;  1Z47 A;  5IYC H;  1HCZ A;  1A63 A;  1CKO A;  1Q82 C;  2NBF A;  4JW0 A;  3DM3 A;  2D0P A;  4C3J H;  2CKZ B;  1TQO A;  2A6H C;  3A54 A;  4KMU C;  3OW7 A;  4DV7 L;  1VQE A;  3AYH B;  1MIU A;  1DYQ A;  4LJZ C;  1NR4 A;  5ELB A;  4FP5 D;  4IFD J;  1ZYR D;  2PW7 A;  1Q8K A;  2N55 A;  4H02 A;  2UUA L;  2Z6K A;  4WRD A;  4K2L A;  2K28 A;  2RSO A;  3IKJ A;  5IYD G;  1PRT F;  1VQ7 A;  2OEO A;  4RMF A;  3VR4 A;  2F0E A;  3VYT A;  1KC8 C;  3HOU G;  1UE1 A;  2XIW A;  2F4V L;  1RTN A;  2EYO A;  5C4J H;  5AJ3 Q;  4O0A A;  5EBD A;  1EYD A;  2DGY A;  1BQQ T;  2CWP A;  2JP1 A;  4JI4 Q;  4DR2 Q;  4JCV E;  2JA8 B;  1EZ6 A;  1ICF B;  3K5M A;  2Y0S E;  3CAM A;  4LMQ D;  3VYU A;  1BCP C;  4O2D A;  1VQD A;  5FOB B;  4Q5V A;  2KHJ A;  3K81 C;  4HTH A;  4ALP A;  5I2Y A;  2CQO A;  2FJ2 A;  2ZJQ A;  4GS3 A;  1EU4 A;  2WB1 B;  1PZJ D;  4CKB A;  2AUJ D;  3BDC A;  3R2T A;  2ZJR A;  3SR1 A;  1WTV A;  4A3D G;  1RL2 A;  4MTK A;  2B2W C;  5IWA L;  1RKN A;  4GKJ Q;  3MFG A;  4H44 C;  4UDU C;  4E6I A;  5IOD A;  3HOX B;  3HOY H;  2L0C A;  3PQI A;  3DXJ C;  5I9P A;  1O7L A;  4A3B G;  1SSO A;  3QB3 A;  4HAE A;  1L1O B;  4A3E G;  2E5L Q;  4IO9 A;  3L2P A;  1E1O A;  2NN6 I;  3FVQ A;  5DAU A;  4R4O A;  2KHS A;  1CZG A;  3AB9 A;  4G7Z C;  4PZ8 A;  5M5X H;  1JB7 A;  1HUM A;  3UDI A;  2JA6 G;  2L15 A;  2AQ3 B;  2B2U C;  2MPM A;  1FVI A;  4Q0F A;  4GZY C;  1PYS B;  5E4W C;  2Q8I B;  1I4P A;  1CQV A;  1KQS A;  5M3M G;  5IGB A;  2EOT A;  2PCF B;  2ZXP A;  5DM6 3;  5DLQ E;  2XRQ D;  2HHH Q;  4IFD H;  1BOS A;  2VL6 A;  1EYA A;  5CV4 A;  5C44 H;  4A3I G;  2EY1 A;  3KBG A;  4JI6 L;  2UXD Q;  4IOC A;  1TR5 A;  2O5I C;  2NVQ H;  1CHP D;  1UE7 A;  1YIT A;  4DAM A;  2PQA B;  2NWG A;  3TME A;  3Q24 A;  2R7Z G;  2Z0S A;  2K75 A;  3I90 A;  1N36 L;  2LSS A;  2JE6 I;  2A73 B;  1HR0 L;  4BY7 G;  1O78 A;  2ENB A;  4IZ8 A;  5LMN L;  1IZ6 A;  4K14 A;  3GTL B;  2M00 A;  4LUV A;  5JJI A;  1NUC A;  1RHP A;  1TS3 A;  2CQA A;  4FXG C;  3M85 A;  2QDB A;  3J7A F;  4BBR G;  2L5T A;  1MSG A;  1QE6 A;  3K57 A;  3BVZ A;  2HT1 A;  3C3L A;  1EU3 A;  4R4T A;  3WWV A;  3I4M H;  4RKL A;  1A15 A;  3NWS A;  2B2Y C;  1TII D;  4R8I A;  1CKM A;  2PW5 A;  2PYK A;  4CKC A;  1IL2 A;  2UXC L;  4G57 A;  3GTQ B;  1A2T A;  1C48 A;  4XYQ A;  5CMD A;  1U5K A;  1NE3 A;  3H0G G;  4MIU A;  3HOX H;  3J7A V;  1GD7 A;  3RNU A;  1F2M A;  4JYA L;  5CR3 A;  1TS5 A;  2WAC A;  4LUO A;  4I7A A;  1PLF A;  2CFM A;  4LF7 Q;  4NB3 A;  1PFN A;  3PUX A;  2RSN A;  5M3F G;  3I8Z A;  3HOZ G;  4ZYS A;  1K8M A;  2AQ2 B;  5LMU L;  1EY8 A;  4CHT B;  4JOI C;  4X65 L;  1UAP A;  1F9Q A;  4DK6 C;  2HDL A;  1EQR A;  4DR5 L;  1ZYR C;  3PO2 G;  5J22 A;  3HOU B;  4OO1 I;  2JA7 G;  3MVV A;  5GQO A;  1WTO A;  1F77 A;  5E1F A;  2JA9 A;  4IUU A;  1LM0 A;  2HQE A;  5IP9 H;  1TWC H;  3HRZ C;  1SJE D;  2DY8 A;  2X69 A;  5EQ0 A;  4LK1 C;  2EDG A;  4DAY A;  3T13 A;  3N52 A;  1LTI D;  1CK1 A;  3KBX A;  2EYL A;  4B3S Q;  3U9O A;  3D4D A;  3GQB A;  3R3O A;  4ZCK A;  3F8T A;  1R4P B;  1IBK L;  3NQT A;  1SE2 A;  4DR3 L;  2DUD A;  4JG2 A;  1GUT A;  1HNW L;  1XTC D;  4A3D B;  3I73 A;  1F9S A;  5FLM G;  1EWC A;  2ZXO A;  1GVP A;  3D8G A;  3PUW A;  1I3Q B;  4A3B B;  1O7Y A;  5K36 G;  4A3E B;  1Q86 C;  1Y1V G;  2ID0 A;  4B3M L;  2K5N A;  3PMF A;  4GN3 B;  1PRT B;  4BXX G;  1XMQ Q;  1KDC A;  3TP5 A;  4C2M H;  4L6T B;  3U4V A;  4KN7 C;  3I2Z A;  2ICI A;  4GOP C;  2JA6 B;  2VUM G;  3D4R A;  4X66 L;  3CXC A;  3NP8 A;  3TN2 A;  2MHV A;  1H9J A;  4K6D A;  4JI5 Q;  2B8F A;  1IKL A;  3FKI G;  3PO3 H;  4G7O C;  2LFN A;  3EBE A;  3L3O C;  1WYD A;  3SK6 A;  3MWY W;  1NY4 A;  1BR9 A;  1SDF A;  1STA A;  2LS0 1;  3VA7 A;  4GKK Q;  3BJU A;  4X64 L;  5C3X A;  4YWM A;  4R4I A;  1MJC A;  5ELD A;  1SMY D;  3PIP 3;  1AW7 A;  1JWU D;  2PZW A;  2R7D A;  4BA2 I;  2R7Z B;  3M7N A;  4YHH L;  2BOS A;  2PMZ E;  3GTP B;  1FL0 A;  1HTL D;  1EFI D;  2ICE C;  2P5Z X;  1EZ8 A;  1PZI D;  2SOB A;  3OMC A;  4QMG A;  4DV6 L;  3N6R A;  4B3T L;  2YTX A;  3GTO B;  2CWA A;  5I6W A;  1TWG H;  1TWA B;  3NBH B;  3P1H A;  2N49 A;  2FHT A;  3P7J A;  2R3Z A;  1SYB A;  4DU9 A;  4L5Q A;  4A3D H;  4NDX A;  3U58 A;  1JIC A;  2UUB Q;  4NXM L;  5JJL A;  3HKZ G;  1ICW A;  1X3P A;  3NTI A;  2R93 H;  4K8I A;  3H0G B;  1PA6 A;  1CKN B;  2XTI A;  2JEA I;  4CGY B;  4JI8 L;  2XSC A;  1I3Q H;  4IUN A;  2JSO A;  3RN5 A;  4UP8 A;  1YEZ A;  5EPK A;  2JN4 A;  4K5X A;  5M3F B;  4M8A A;  1B9M A;  3H15 A;  3M4O H;  2HDM A;  3HOZ B;  4FO2 A;  4B9W A;  1QUQ B;  3LWU A;  4R8N A;  1DON A;  4BA1 I;  2HIV A;  1EY6 A;  2QF7 A;  4XDX A;  5CV5 A;  3PO2 B;  1SYC A;  2JA7 B;  1VF7 A;  1O80 A;  3LGJ A;  2L11 A;  1S72 A;  1HQM C;  1ASY A;  1N34 L;  2C35 B;  1J9O A;  1KDA A;  2Q8R E;  5JPM C;  1WTR A;  1D1K A;  1O7I A;  1QNK A;  3OPO A;  4YCV A;  2F0M A;  4OHJ A;  3KOJ A;  4BBS G;  5FO7 B;  1RDP D;  3E9I A;  1S5E D;  4C56 C;  1QG7 A;  1IBM L;  5FO8 B;  1BKB A;  5L37 A;  2RQX A;  3GDE A;  1S5B D;  5CYU A;  4JV5 Q;  3CCE A;  4DUY Q;  3G71 A;  4IPH A;  2PMZ B;  1CTM A;  3E0J A;  3TRE A;  5EJW A;  4DR1 Q;  4CKE A;  3DLL A;  4LFA L;  1XNQ L;  4HN7 A;  1VQM A;  3RN2 A;  1QVG A;  2WKC A;  1AE3 A;  2Q2H A;  3RR5 A;  5DM7 3;  3CME A;  1RJT A;  4QUF A;  3EVQ A;  4A93 G;  3S2D B;  1TWF B;  1Y1V B;  1JT8 A;  2CW0 D;  3H0G H;  1E3P A;  2HUG A;  3T53 B;  3I4N H;  3BVM A;  1YJN A;  3GD7 A;  1VQA A;  1WTQ A;  1FNV A;  1WOC A;  2VUM B;  2VZA A;  2DY7 A;  4IOA A;  1STN A;  5I4D A;  3FKI B;  4A76 A;  3S15 B;  1WCM G;  3ITP A;  1KD1 C;  3S2H H;  3J81 j;  2B3G A;  1G6Z A;  5A2Q E;  5COR A;  3S1R H;  3EIV A;  2VXW A;  2PZU A;  1FJG L;  3AFP A;  3QR8 A;  2NZH A;  2VQE Q;  3J7Y W;  1LLR D;  1VCI A;  2MUY A;  4A3L H;  4LF5 L;  4BY1 G;  4LFB Q;  2EYM A;  1X6O A;  1XPR A;  2BA1 A;  2MQH A;  3RMH A;  2K1B A;  1VDZ A;  3RZD B;  4O1N A;  1I4X A;  1SMY C;  1B3A A;  2CH4 W;  5G3L D;  2WII B;  4ZLT F;  3JAM L;  3GTK B;  3SEB A;  5LL6 X;  3KYH C;  1B4O A;  1HNZ Q;  4DUZ L;  3NXW A;  3NK9 A;  4P73 A;  4XXE A;  4AYB E;  2PPB C;  5EAY A;  1QOH A;  4U67 3;  3U9S A;  1XMO L;  4ZKB B;  2RHQ B;  2GVB A;  3HKZ B;  4R4Q A;  2KCM A;  2KEN A;  1K9M C;  1ENC A;  1E7Z A;  2E75 C;  2EY6 A;  2AHO B;  4EQN A;  1JWS D;  1FGB D;  5BN3 A;  4P71 A;  4V0B A;  3GTM H;  1TWF H;  4DAP A;  3WDN A;  4OIJ A;  3UE0 A;  4BXX H;  1L0W A;  2GN5 A;  2F0Q A;  3CPF A;  3OIP A;  1KXL A;  3QG1 A;  4DR7 Q;  3DWA A;  4DV5 Q;  2V4D A;  3KK7 A;  2I5H A;  2LY7 A;  2WV6 D;  3PUY A;  2B2W A;  1F2Z A;  4X3S A;  1QZH A;  3CCU A;  3T56 B;  1F2Y A;  4CJ0 B;  4HJ8 A;  5E3F A;  3TQY A;  1XPO A;  2PO4 A;  2E76 C;  3ERQ A;  1Z9F A;  2GVA A;  2F3W A;  4LAA A;  1PV4 A;  2K5V A;  1EOT A;  1PXU A;  3J81 L;  1YHB A;  2YTY A;  4BBS B;  1MJE A;  4MHE A;  4C3I G;  2EYP A;  4RGO S;  1D5M C;  4HJ9 A;  1LTT D;  4IPD A;  4C1N K;  4X6A H;  1JOK A;  1K3R A;  4KD3 A;  3RZD H;  4KTA A;  2E2H B;  1Q1E A;  2B2U A;  5HGT A;  3WOE A;  3UE1 A;  4A3K H;  3TP8 A;  1SNC A;  1A2U A;  1YIJ A;  1DZ1 A;  1YZ6 A;  4NXN Q;  2EYF A;  1K3B C;  4F8M A;  1PH7 A;  4N8X 1;  2K32 A;  3NTH A;  2WAQ G;  3BZD B;  4A93 B;  1QVF A;  1UE6 A;  3P20 A;  4DGZ A;  3A0J A;  4HMJ A;  1IYV A;  2K05 A;  4B9X A;  1XYI A;  3A5Z B;  1V8Q A;  1A0I A;  3GTG H;  4DV2 Q;  1LUZ A;  3TRZ A;  2EE1 A;  2WB1 E;  3HOV G;  2XWJ B;  1ENA A;  3G6E A;  2F0I A;  3RLO A;  4QIW E;  4DF7 A;  2IY5 B;  1H9S A;  2CW0 C;  2ATW A;  3T16 A;  3FPP A;  4BS9 A;  4DV0 Q;  4R1J A;  5M5W B;  5AJ3 L;  3H3V H;  3PUV A;  2Z4I A;  4IN3 A;  1WCM B;  4JI4 L;  2B39 A;  4DR2 L;  3V05 A;  1HZB A;  2H5X A;  3GV6 A;  5A35 A;  5F2D A;  1UNS A;  3Q22 A;  2B2Y A;  1CZW A;  3R2I A;  4A3G H;  2VW9 A;  3CU7 A;  1VQ8 A;  4C3H G;  1HJP A;  3FEW X;  1W6K A;  2F52 A;  5JVG 3;  3T51 B;  2UU9 Q;  3S1M B;  3K7A H;  4OX9 Q;  1YBY A;  4BY1 B;  2ZTE A;  1JWM D;  3FP9 A;  1AE2 A;  1BNZ A;  4RH6 A;  1S4Z A;  3BYY B;  3CKI B;  1ET9 A;  2JA5 G;  1B2T A;  2BE5 D;  1EY5 A;  1HA6 A;  4DXG A;  1B44 D;  1FR3 A;  4EX5 A;  4BBS H;  2RDG A;  5KND A;  4CJ2 C;  2K50 A;  1RCV D;  1D5Z C;  3A7L A;  2UXB L;  5IT9 c;  4GLX A;  4JOI A;  4POF A;  3TP6 A;  1W2B A;  3U4Z A;  2E5L L;  1G29 1;  2MNA A;  1PVO A;  1EFW A;  3KFU A;  2D0O A;  3X3N A;  4LNQ A;  3S14 B;  4APV A;  1HUN A;  1R9T H;  3KDF A;  3CF5 A;  4KHP Q;  3S16 B;  2OTL A;  1DJR D;  4DAY B;  5C3E H;  4MZ9 A;  3EN2 A;  5IT9 E;  1KRT A;  2R6G A;  4ZUI A;  4B3R Q;  1PFB A;  2C5C A;  2HHH L;  2ES2 A;  1KNA A;  2PQE A;  1ESR A;  3FMC A;  1XX8 A;  2Q8T A;  1SNO A;  1EL0 A;  2UXD L;  1JJC B;  2D5D A;  1PTO F;  4U68 A;  1VF5 C;  1GO3 E;  2J0T D;  2IW3 A;  1VQJ A;  4QIW B;  1JC7 A;  2A8V A;  1V1Q A;  1YHQ A;  3OMG A;  3PIP A;  3K80 C;  1B70 B;  3A56 A;  4DR4 Q;  1E2Z A;  2K5D A;  2QEJ C;  2AWO A;  1LV9 A;  2N78 A;  1B50 A;  5FJ8 G;  3S17 H;  2E2D C;  2HD3 A;  3J80 L;  3MXN A;  3QWN A;  4UP7 A;  2F0J A;  1PHJ A;  4N8F A;  4JI7 Q;  1K0R A;  3BU2 A;  3NEN A;  2F3V A;  3VYR A;  4GOP A;  1K83 B;  5ISR A;  1E24 A;  2TMP A;  2I5L X;  5EPJ A;  1RIP A;  4DV7 Q;  1XPU A;  2I5M X;  1WD0 A;  3LWE A;  1T5X D;  3K7U C;  1Q7Y C;  1JR0 D;  5HGQ A;  1P16 A;  3LNN A;  2L1B A;  4KKT A;  1BCP F;  2B63 G;  2WAQ B;  5I2X A;  4PNY A;  4ODG A;  1ZKO A;  3S1Q B;  1U9R A;  1Y69 U;  4JBJ A;  4YY3 Q;  3KUP A;  2G5D A;  4FF1 A;  3RLN A;  4DNR B;  2EPB A;  3CCV A;  2IX3 A;  3F2B A;  3HOV B;  1ASZ A;  4QGU A;  4RKB A;  2JA8 H;  3NQI A;  1NMG A;  1E2W A;  4AH6 A;  5FO9 B;  4ULL A;  5GAH C;  3CC2 A;  1TKW B;  4JBM A;  1M8A A;  4TSS A;  4EGV A;  4DPG A;  1GKH A;  2B8G A;  2F0K A;  4DK1 A;  2QW7 A;  2EY2 A;  3I72 A;  5IGC A;  1VQL A;  4RGM A;  1YVC A;  4C3H B;  4LF9 Q;  1ILP A;  1LAC A;  4JI2 Q;  5JEA G;  4B3S L;  1I6V C;  3NEL A;  5FK9 C;  1ROD A;  4Y7N B;  4A3F G;  4HCE A;  4JK1 C;  3RUZ A;  4OL7 A;  4IUR A;  1SRO A;  2JA5 B;  3IFD A;  2NN6 G;  1V1P B;  3NHH A;  4K2K A;  2OF1 A;  1J6Q A;  3OYY A;  1PH8 A;  2BH8 A;  1U0L A;  4MNO A;  1YHA A;  4KKU A;  1FGU A;  3BDL A;  4OEL B;  4PZ6 A;  2BE5 C;  2ZJP A;  3DM1 A;  4IQZ A;  1M90 C;  4RGN A;  1MI2 A;  1BDO A;  4LFC Q;  3ICE A;  4NMZ A;  2MJ8 A;  1SBB B;  4FDB A;  1XMQ L;  3OWF A;  1HPC A;  5H1S E;  3NE5 B;  5NUC A;  4A3C G;  4JI6 Q;  3T1H Q;  3T4A C;  1S5F D;  2K6A A;  2D62 A;  2BDO A;  3S1N B;  3SVM A;  4CDF C;  3KF6 B;  4LF6 Q;  4JI5 L;  1GM5 A;  3S1Q H;  4X62 Q;  3H6M A;  3K58 A; 
#chains in the Genus database with same CATH homology
 1HR0 Q;  3HOV H;  2YU9 H;  1N34 L;  1WCM H;  2WB1 G;  2VQF L;  1VQN A;  2YV5 A;  2C35 B;  1V9P A;  1J5E Q;  3CQZ H;  2E2J H;  2R92 G;  2AMC B;  4QY7 A;  4GKK L;  3UDF A;  2IX1 A;  1O7I A;  3E0E A;  1XTD A;  3F2C A;  1Y14 B;  4K0K Q;  4GOP B;  4YCV A;  3KOJ A;  3W1B A;  5IP7 G;  4BBS G;  3D0F A;  3GTL H;  5BR8 L;  2Q2U A;  1K73 C;  1UWV A;  4GN5 A;  3TS2 A;  1VQK A;  3E9I A;  3T1Y L;  3ULP A;  5C0X I;  4JI3 L;  3HOX G;  3AEV A;  3B6Y A;  3S1M H;  1IBM L;  4BY1 H;  1BKB A;  4DUZ Q;  3CD6 A;  2MO1 A;  3GDE A;  2EQS A;  1EOV A;  3L7Z C;  3A74 A;  3S24 A;  3ULL A;  3STB D;  5C4X H;  1EUJ A;  2NVX H;  1S40 A;  4JV5 Q;  3CCE A;  1EYG A;  4DUY Q;  1I94 L;  4LF9 L;  1X3G A;  4TQU S;  4IPH A;  3G71 A;  1XMO Q;  1YJW A;  4JI2 L;  2R93 G;  2A1A A;  2OQK A;  3TRE A;  4KHZ A;  2UUC L;  2UXB Q;  1VQO A;  4DR1 Q;  2QEX A;  2PNH A;  4QL5 A;  2OWO A;  3DLL A;  3GTQ H;  4LFA L;  1XNR Q;  3CW2 C;  1XNQ L;  2UUA Q;  1VQM A;  2Q2I A;  3RN2 A;  1QVG A;  1AE3 A;  1X3F A;  2Q2H A;  3JC6 6;  3RR5 A;  3CME A;  2NVT H;  4YCU A;  3AQQ A;  5LMN W;  4LF7 L;  3JAM i;  4QJF A;  2BH2 A;  1TWH H;  4A93 G;  5IY0 A;  2IHF A;  5LMU Q;  1JT8 A;  2WFW A;  2F4V Q;  1CUK A;  3H0G H;  1E3P A;  4DV3 L;  1B8A A;  3I4N H;  1YJN A;  3GD7 A;  1VQA A;  3J80 c;  4DV4 L;  4TVA B;  3CPW A;  2HIX A;  3S14 H;  1Q12 A;  3FHW A;  4LFC L;  3S16 H;  1WOC A;  1YNX A;  2VZA A;  2MO0 A;  4GNX B;  5IYD H;  4IOA A;  4OO1 G;  1CSQ A;  2YTV A;  2JJQ A;  5IYB H;  1HH2 P;  3J7A 5;  4WJ4 A;  3PUZ A;  3HOU H;  1LTL A;  3H3V I;  3L0O A;  2ZM6 L;  3W1G A;  4A75 A;  4A76 A;  1SMX A;  3OTO Q;  1WCM G;  3T1H L;  1KAW A;  1X3E A;  1SR3 A;  3PIO A;  3VDY A;  1KD1 C;  4UPA A;  3S2H H;  3UDG A;  3M3Y H;  3J81 j;  1Y1W H;  2B3G A;  2EXD A;  4R4C A;  3S1R H;  4ME3 A;  3EIV A;  1A62 A;  4LF6 L;  4UY8 C;  2PI2 E;  3AFQ A;  4IJH A;  1FJG L;  3AFP A;  1SE8 A;  1VQC A;  2NZH A;  1PH6 A;  5GAG C;  1WJJ A;  4X62 L;  2VQE Q;  5IWA Q;  4IPG A;  1VCI A;  4A3L H;  2N3S A;  4LF5 L;  4BY1 G;  4LFB Q;  1OXT A;  1X6O A;  4OWT B;  1XPR A;  2BA1 A;  4DR3 Q;  5C4X G;  1JMC A;  2MQH A;  4GNX C;  3KJO A;  1J5E L;  4XIG S;  1P8L A;  1N9W A;  4K0K L;  1X65 A;  3M4P A;  1VQF A;  3ER0 A;  4L5T A;  3SGI A;  4GLA C;  5C0X G;  3G4S A;  2N8N A;  2ZTD A;  1MKH A;  1NTG A;  1Z47 A;  2A19 A;  4LW1 A;  3W5O A;  3E9H A;  5IYC H;  1AH9 A;  3HOW H;  4A3J G;  5J3B A;  1A63 A;  1CKO A;  1Q82 C;  3KYH C;  1HNZ Q;  1L2F A;  4C3I H;  4DUZ L;  4P73 A;  4AYB E;  3DM3 A;  5EAY A;  3PF4 A;  4JV5 L;  2D0P A;  3J81 i;  4C3J H;  2CKZ B;  4A3B H;  4DUY L;  1K83 H;  1XMO L;  4Y52 H;  5GAD C;  4A3E H;  4B3M Q;  2K14 A;  2RHQ B;  4DV7 L;  2GVB A;  1VQE A;  3AYH B;  1MIU A;  4R4Q A;  2KCM A;  2KEN A;  3UDX A;  4DR1 L;  4QQB X;  3I4N G;  1D7Q A;  1SFO H;  2ASB A;  4IFD J;  1XNR L;  3NEM A;  1K9M C;  1Q8K A;  4H02 A;  2UUA L;  1E7Z A;  1H95 A;  2Z6K A;  2K52 A;  3I56 A;  2AHO B;  3CC7 A;  5IYD G;  4P71 A;  3BZC A;  4AIM A;  2JA6 H;  1JJ2 A;  1VQ7 A;  3GTM H;  1TWF H;  4RMF A;  4WJ3 M;  1BVS A;  1KIX A;  3HOU G;  1KC8 C;  1UE1 A;  3UE0 A;  4BXX H;  2F4V L;  1L0W A;  5C4J H;  2GN5 A;  3K0X A;  1CSP A;  4MTN A;  1KL9 A;  3JAM c;  4O0A A;  5AJ3 Q;  5M3M H;  4RG1 A;  1X9N A;  3CPF A;  4HJ5 A;  2Z6K C;  1C0A A;  2DGY A;  1Y1W G;  2CWP A;  3M9B A;  3PGZ A;  4JI4 Q;  2YYZ A;  4JC0 A;  4JCV E;  2RHS B;  4DR2 Q;  4A3I H;  1N36 Q;  1M1K C;  4DR6 Q;  1KXL A;  4PMW A;  4DR7 Q;  4IJL A;  1C9O A;  4X64 Q;  5LMN Q;  2ZTC A;  4DV5 Q;  2Y0S E;  3CAM A;  2I5H A;  4P74 A;  3CCJ A;  4O2D A;  1HZ9 A;  1VQD A;  3I4O A;  4JBK A;  3PUY A;  1N33 Q;  4A3L G;  2KHJ A;  3K81 C;  1QZH A;  3M4Q A;  3CCU A;  4ALP A;  4HJ8 A;  3OTO L;  2CQO A;  3TQY A;  1E1T A;  1KRS A;  2E8G A;  1XPO A;  4GS3 A;  4PZ7 A;  1PH9 A;  2ZJQ A;  2R7Z H;  2XGT A;  1Z9F A;  2GVA A;  4BY7 H;  1OXX K;  1PV4 A;  2ZJR A;  3GTP H;  2K5V A;  1IBL L;  4A3D G;  2VQE L;  1RL2 A;  3HKZ E;  5IYC G;  5IWA L;  2UXC Q;  1YHB A;  2YTY A;  2AWN A;  4JI1 Q;  4C3H H;  3PF5 A;  1MJE A;  4GKJ Q;  4LFB L;  3HFZ B;  4Y7N H;  3HOY H;  4HJ9 A;  3GTO H;  4BBR H;  1TWA H;  2B29 A;  4IPD A;  4X6A H;  4A3B G;  1K3R A;  3KF8 B;  4NPS A;  1QZG A;  4JYA Q;  2WP8 J;  1BBW A;  4DKA C;  1L1O B;  4GN4 B;  4A3E G;  3RZD H;  2E5L Q;  1Q1E A;  2JA5 H;  4IO9 A;  3L2P A;  5IE8 A;  2I0Q A;  1E1O A;  2NN6 I;  3UE1 A;  4A3K H;  2UUB L;  3Q8D A;  4R4O A;  1YIJ A;  4HIK A;  1YZ6 A;  4JBW A;  3STB C;  4NXN Q;  5E7N A;  4PZ8 A;  5M5X H;  2HQL A;  1PH7 A;  1JB7 A;  1D8L A;  1KHI A;  4A3M G;  4OXP A;  3UDI A;  4IFD I;  2JA6 G;  4X65 Q;  1WI5 A;  4EQ5 A;  2L15 A;  1L1O A;  2JK8 A;  2K4K A;  3KLW A;  1SRU A;  3I7F A;  2MFI A;  2WAQ G;  1PFS A;  1FVI A;  1V43 A;  4DR5 Q;  5M3F H;  1PYS B;  1UE6 A;  2EIF A;  1QVF A;  2IX0 A;  1X54 A;  4YCW A;  3A0J A;  3ZJY C;  1KQS A;  5M3M G;  2JQO A;  3HOZ H;  2BA0 A;  5DLQ E;  3A5Z B;  2HHH Q;  1A0I A;  3GTG H;  4DV2 Q;  2VL6 A;  5C44 H;  4A3I G;  1LUZ A;  3TRZ A;  2WB1 E;  3HOV G;  1L1O C;  3G6E A;  4IOC A;  3RLO A;  4JI6 L;  4QIW E;  2UXD Q;  1JJG A;  2IY5 B;  3CCR A;  2ATW A;  2NVQ H;  3S1N H;  2IT1 A;  1UE7 A;  1X56 A;  3G48 A;  1YIT A;  4DAM A;  2PQA B;  4R1J A;  4DV0 Q;  3D31 A;  1UEB A;  3PO2 H;  5AJ3 L;  3H3V H;  1UE5 A;  3PUV A;  4A4I A;  1I50 H;  2JA7 H;  2R7Z G;  4JI4 L;  2JEB I;  2Z0S A;  3PSI A;  4DR2 L;  2K75 A;  1N36 L;  4DR6 L;  2LSS A;  2JE6 I;  1HR0 L;  1HZB A;  2H5X A;  1IBK Q;  1W3S A;  4BY7 G;  2KHI A;  5LMN L;  4DV5 L;  1IZ6 A;  4A3G H;  3OW2 A;  5ELO A;  2VW9 A;  2PQA A;  1VQ8 A;  4DNI A;  1N33 L;  4LF4 Q;  2IHE A;  1HNW Q;  1HJP A;  2F52 A;  4LUV A;  4POG A;  5JJI A;  3M85 A;  5JEA J;  2UU9 Q;  2F3I A;  3K7A H;  1YJ9 A;  4OX9 Q;  3HOY G;  4BBR G;  1YBY A;  4OWX B;  5FLX c;  2ZTE A;  1N32 Q;  3FP9 A;  2K5H A;  1AE2 A;  3F1Z A;  4AQY Q;  2HT1 A;  4LWC A;  1OXU A;  5GRO A;  1K8G A;  4R4T A;  3WWV A;  3I4M H;  2R92 H;  2JA5 G;  1PH1 A;  4LF8 Q;  1CKM A;  4A3K G;  5FJ8 H;  4EX5 A;  1IL2 A;  2UXC L;  4BBS H;  4JI1 L;  1C7Y A;  2K50 A;  1U5K A;  1NE3 A;  3H0G G;  1XNQ Q;  5IT9 c;  3HOX H;  2UXB L;  5FLM H;  4GLX A;  1GD7 A;  4J15 A;  4JOI A;  3RLF A;  4POF A;  3RNU A;  4JYA L;  1W2B A;  3U4Z A;  4KI0 A;  3K8A A;  4LUO A;  2E5L L;  4LF7 Q;  2CFM A;  1G29 1;  4NB3 A;  4DK3 C;  3PUX A;  4KLK A;  4UP9 A;  3J80 i;  4X66 Q;  5M3F G;  1I6H H;  2MNA A;  4P72 A;  1SN8 A;  1PVO A;  1EFW A;  3HOZ G;  3S2D H;  5IYB G;  3KFU A;  1Y1V H;  5LMU L;  4IFD G;  2D0O A;  4NXN L;  5C44 G;  4LNQ A;  4APV A;  4JOI C;  1R9T H;  3KDF A;  3CF5 A;  4KHP Q;  2QA4 A;  1NJI C;  4X65 L;  1IXR A;  2OTJ A;  2RF4 A;  4DK6 C;  1N8R C;  3CP0 A;  2OTL A;  4L5R C;  4DAY B;  5C3E H;  3F2D A;  1EIF A;  1EQR A;  4DR5 L;  4MZ9 A;  2VUM H;  3EN2 A;  2B63 H;  1VQI A;  1KRT A;  4XTC S;  3PO2 G;  2R6G A;  4OO1 I;  2JA7 G;  4B3R Q;  3MEF A;  5GQO A;  2HHH L;  2ES2 A;  4YWL A;  4DV2 L;  3TEH B;  3FKI H;  2JA9 A;  3S15 H;  1LM0 A;  2UXD L;  1JJC B;  5ELN A;  1TWC H;  5IP9 H;  4YWK A;  4A3G G;  1Q1B A;  4YHH Q;  2KBN A;  1GO3 E;  3ULJ A;  1VQJ A;  3GO5 A;  3PV0 A;  1PH3 A;  1I5F A;  2A8V A;  1QUQ A;  1V1Q A;  1YHQ A;  1VQP A;  5GAE C;  4B3S Q;  3PIP A;  3K80 C;  4DV6 Q;  4B3T Q;  4HJA A;  3HOW G;  1VQ6 A;  1B70 B;  3MXN B;  1X55 A;  4DR4 Q;  3F8T A;  1IBK L;  3I55 A;  3I4M G;  5JJK A;  3J7Z C;  3KF6 A;  4DR3 L;  2AWO A;  2DUD A;  1BBU A;  4JG2 A;  2N78 A;  5FJ8 G;  2OCE A;  1ASY A;  4LF4 L;  3S17 H;  1HNW L;  4NXM Q;  2UU9 L;  4OX9 L;  5FLM G;  2CCZ A;  2E2I H;  3GTK H;  4UP7 A;  3CCS A;  2Q2T A;  1N32 L;  2AKW B;  4AQY L;  4A3F H;  1PHJ A;  2V1C C;  1Q46 A;  1GVP A;  4JI0 Q;  3PUW A;  4JI7 Q;  1K0R A;  4JI8 Q;  3GTJ H;  1HNZ L;  3BU2 A;  4P75 A;  3NEN A;  1G6P A;  2ALY B;  4GOP A;  4LF8 L;  1E24 A;  5K36 G;  1VQB A;  2OQ0 A;  1DGS A;  2I5L X;  1Q86 C;  1RIP A;  4DV7 Q;  1PH4 A;  1HNX Q;  1Y1V G;  2ID0 A;  1XPU A;  4DV1 Q;  4OWW B;  2I5M X;  4B3M L;  2K5N A;  4GN3 B;  4BXX G;  1XMQ Q;  3CMA A;  4A3J H;  3J81 c;  4C2M H;  3K7U C;  3U4V A;  1Q7Y C;  1HR0 W;  3I2Z A;  4AYB G;  5HGQ A;  1P16 A;  4GOP C;  2PI2 A;  5C3E G;  1NMF A;  2VUM G;  4HIM A;  1Q81 C;  4X66 L;  3CXC A;  2B63 G;  1PYB A;  1VQG A;  1OXS C;  1TXY A;  4IPC A;  4JI5 Q;  3ERS X;  1E22 A;  3FKI G;  3PO3 H;  4JBJ A;  4YY3 Q;  4LF5 Q;  3CCL A;  4KHP L;  3RLN A;  5IP9 G;  3EBE A;  1WYD A;  3CCV A;  4A3C H;  2VY3 A;  3F2B A;  1ASZ A;  4QGU A;  1N34 Q;  2VQF Q;  1NY4 A;  1OTC A;  1WFQ A;  2JA8 H;  1EQQ A;  1NMG A;  5GAH C;  4AH6 A;  4DR7 L;  3KJP A;  4GKK Q;  3CC2 A;  3BJU A;  1PH2 A;  4X64 L;  4JBM A;  4YWM A;  4B3R L;  4R4I A;  1A8V A;  1MJC A;  4DPG A;  3CC4 A;  1GKH A;  5BR8 Q;  1G51 A;  1HZA A;  2LXJ A;  2R7D A;  3T1Y Q;  4GNX A;  3IRB A;  3CCQ A;  4JI3 Q;  4BA2 I;  3M7N A;  1IBM Q;  4YHH L;  1VQH A;  1SLJ A;  4LUZ A;  1VQL A;  2PMZ E;  1EIY B;  3HKS A;  1IBL Q;  3PCO B;  4OON A;  2Y0S G;  1FL0 A;  1YVC A;  2VS1 A;  1I94 Q;  4LF9 Q;  5C0X J;  4JI2 Q;  4B3S L;  5JEA G;  4DV6 L;  3NEL A;  4B3T L;  4A3F G;  2NZO A;  2YTX A;  5IP7 H;  2UUC Q;  4DR4 L;  2CWA A;  4GKJ L;  1TWG H;  4LFA Q;  4GLV B;  3NBH B;  5HY6 A;  2N49 A;  3RZO H;  4PG3 A;  1SRO A;  3KDF B;  2NN6 G;  2RCN A;  2WAQ E;  3U50 C;  4L5Q A;  2E2H H;  4L5S A;  4A3D H;  2UUB Q;  3U58 A;  1J6Q A;  5JJL A;  4NXM L;  3OYY A;  3HKZ G;  1XJV A;  3CCM A;  2BH8 A;  1U0L A;  2R7F A;  4MNO A;  1PH8 A;  1YHA A;  3A5U A;  2R93 H;  1OXV A;  1EWI A;  1FGU A;  4JI0 L;  1PA6 A;  4DV3 Q;  1CKN B;  2XTI A;  4PZ6 A;  2ZJP A;  1PH5 A;  4JI8 L;  4JI7 L;  2JEA I;  1M90 C;  1I3Q H;  4DV4 Q;  1HZC A;  3RN5 A;  4UP8 A;  1YEZ A;  2NVY H;  1B7Y B;  4LFC Q;  3ICE A;  1HNX L;  2FXQ A;  4DV1 L;  3H15 A;  4HJ7 A;  3M4O H;  4FDB A;  1VQ4 A;  1XMQ L;  3PO3 G;  4A93 H;  5H1S E;  4HID A;  1CKN A;  3TS0 A;  1JE5 A;  2VNU D;  2ZM6 Q;  4A3C G;  1QUQ B;  1VS0 A;  4A3M H;  1IYJ B;  4JI6 Q;  3T1H Q;  3BZK A;  2JA8 G;  1LYL A;  2QGQ A;  1VQ9 A;  2KCT A;  2D62 A;  1K8A C;  4BA1 I;  2HIV A;  1NBW A;  3KF6 B;  4LF6 Q;  2LXK A;  4JI5 L;  1QVC A;  1YI2 A;  1GM5 A;  1FJG Q;  5M5Y H;  3S1Q H;  4DV0 L;  4YY3 L;  5M5W H;  1T9H A;  4X62 Q;  3LGJ A;  4HIO A;  1S3O A;  1VQ5 A;  1S72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...