2YTXA

Solution structure of the second cold-shock domain of the human kiaa0885 protein (unr protein)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
97
structure length
97
Chain Sequence
GSSGSSGNIMLLKKKQARCQGVVCAMKEAFGFIERGDVVKEIFFHYSEFKGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NMR solution structures of the five constituent cold-shock domains (CSD) of the human UNR (upstream of N-ras) protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Cold shock domain-containing protein E1
total genus 5
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ytxA01
4IJHA 2AKWB 4NB3A 5ELOA 3L7ZC 4C3IH 4OX9Q 2JQOA 4YHHL 1N36L 1N32L 4DR5L 2E2IH 4A3CG 3J80c 4A3KH 2IX0A 5IP9H 1XMQQ 2R92G 4DR5Q 3W1GA 3HOZH 3K7AH 1ASYA 2BH8A 3HFZB 4DR6Q 3OYYA 2XTIA 1K0RA 2C35B 3A5UA 1UE1A 4DR2L 5BR8L 5C3EH 4HJAA 2R92H 2F52A 3S2DH 1NY4A 1YI2A 4RG1A 4C2MH 1VQBA 1VQ8A 2Q2UA 4JYAQ 2ASBA 4IFDJ 4JI0L 2K5VA 2RF4A 3RR5A 3VDYA 4A3EH 4A3JH 4X66L 3STBD 1IBKQ 2VZAA 4JI0Q 4DV6Q 2K75A 4JI8L 3HOXG 4DV1Q 3K8AA 2Y0SG 1Q12A 1J5EL 4DV6L 3GTPH 2LXKA 4Y7NH 4OO1G 3TS2A 4B3SQ 4DR1Q 3BJUA 2N8NA 2ZJPA 3FP9A 2BH2A 1HR0Q 5M5WH 3HKZG 1XJVA 1Z9FA 4DR1L 4IPHA 1VQIA 2UXCL 4WJ4A 4PG3A 3W5OA 1H95A 1VQNA 4QY7A 4A3DG 3G71A 1YHAA 4LWCA 1RL2A 4LF8L 3ULJA 1QVGA 2NVXH 4YY3Q 4JOIC 1MJCA 3KJPA 1VQDA 2ZM6L 5IYCG 5IYBH 1FL0A 2EQSA 5FJ8H 2ZM6Q 4HIOA 1XTDA 2JA9A 1EYGA 2JA5G 1QVFA 1VQOA 4BXXG 4B3ML 1M1KC 3S24A 1BBWA 4DR4Q 1XMQL 1JJGA 1HJPA 3CMEA 1X3FA 1KQSA 3RLFA 1AH9A 4YCVA 1Q82C 4P73A 2OQKA 1E22A 3S14H 4DR3L 1A8VA 5BR8Q 5C0XJ 2JJQA 4A3EG 1EOVA 1YHBA 3HOWH 5ELNA 1QVCA 2JA5H 1I50H 1KRSA 3CC4A 4JI4L 1CUKA 2MO0A 1X65A 3CCEA 1UE5A 4JBMA 3HOVH 3NENA 2OCEA 1Z47A 3PUXA 4PZ6A 3S15H 1P8LA 1K83H 4AH6A 1IBLQ 2L15A 1J5EQ 4BBSH 1KD1C 2JA7G 4DUZL 1YEZA 4Y52H 2RHSB 4A3IH 1IBLL 3I55A 2UXDL 3CC7A 2UUBQ 4LF6L 2OTLA 1BVSA 1HNZL 1EWIA 3MEFA 4GKKQ 4POGA 1E1TA 1VQFA 4A3BH 2Y0SE 4JV5Q 4A3MH 3CP0A 1HNZQ 3EIVA 4GKKL 4GN5A 3ICEA 1V1QA 1CKOA 2I5MX 2VUMG 1YJNA 3D31A 4X64L 1U5KA 1E3PA 1PVOA 3L0OA 1X54A 1V43A 3K81C 2UXBL 2R93G 3GTMH 4BBRH 5LMNL 2IX1A 2LXJA 1HZBA 5IYDH 1VQMA 3A0JA 2QGQA 1GVPA 3UE1A 4LF4L 4IFDI 1AE3A 2ALYB 2FXQA 1NJIC 5AJ3L 1LUZA 4LFBQ 3RLNA 4LFCQ 3KYHC 3M4QA 4IJLA 4DV4Q 4LF4Q 3TRZA 4GLAC 3M3YH 1YJ9A 4GNXA 1N34Q 3PGZA 4A3DH 1WYDA 4A76A 2DUDA 4LFCL 5GROA 3M9BA 1UWVA 5IYDG 1OXUA 4HJ7A 4HIMA 4JI7L 5JEAJ 4YCWA 3RN2A 3KF6A 4TQUS 1TWFH 2A8VA 3PO3G 2GVAA 1NE3A 3HKSA 4DUZQ 1K73C 1NMGA 2NZHA 4DV0Q 4LFAL 1KXLA 2R7ZH 2KENA 2R7DA 3WWVA 2Z0SA 5GAGC 4NXMQ 1HNWL 1PH5A 4JBWA 1EIYB 4OONA 4A3FG 1JJCB 2D62A 2ES2A 3H3VH 2A19A 1PV4A 3ULLA 1DGSA 2KHIA 3JC66 3CC2A 3DM3A 3F1ZA 1TWGH 1X3GA 4R1JA 1IZ6A 3I56A 3UDXA 3K80C 3RNUA 3CCQA 4EQ5A 3PUZA 3GDEA 1VQ5A 2CCZA 3CF5A 1QZGA 3S1NH 1CSQA 1N8RC 3CCVA 4JBJA 4NXNQ 1HNXQ 3CQZH 2IT1A 2UU9L 4LF9Q 3CPFA 2R7FA 4X65Q 1VQPA 1WJJA 3NELA 3M4PA 4LW1A 4IFDG 3PSIA 1XNRL 2HT1A 2AHOB 3I4OA 1YBYA 1I94L 2HHHL 5AJ3Q 2RCNA 2PI2E 4GLVB 4YWMA 5GADC 4LFBL 2MNAA 1XNRQ 3GTLH 1FGUA 4DV4L 3PF4A 2CKZB 2VL6A 1G51A 3S1RH 4JCVE 3RZDH 1P16A 4AQYL 2JA6H 1D8LA 1PH9A 4A3GG 2B29A 3UDFA 3CCMA 2A1AA 1PH6A 1QUQB 2LSSA 3NEMA 1PYBA 2QEXA 1VQCA 1OXSC 4POFA 2OWOA 1AE2A 1A0IA 1W3SA 2GN5A 4K0KQ 1Y1VG 3GTOH 1VQ9A 4R4QA 5EAYA 4NPSA 1HNWQ 4LF7L 4R4TA 5M3MG 4B3RQ 2VQFL 5JEAG 1YVCA 4JI1Q 4DV2L 4OWTB 5J3BA 1GD7A 2BA0A 3RZOH 1X56A 4QL5A 2JA8G 3S1QH 2I5LX 1GM5A 4JBKA 5M3FH 3U4ZA 1LTLA 5C44G 4JI6Q 3F2BA 1Y1VH 1ASZA 1PH4A 1MKHA 5HY6A 5IP7H 4AYBG 1GO3E 1I3QH 1B70B 2OQ0A 4JI6L 4MZ9A 3K0XA 4PZ8A 2HQLA 3PF5A 4NXNL 1CKMA 2H5XA 3FKIG 1M90C 3PIPA 1PA6A 4UY8C 3KFUA 1IYJB 4R4IA 4QJFA 1YHQA 4JYAL 1I5FA 3OTOL 4HJ9A 2Q2HA 4A3LG 1X3EA 4BBRG 2DGYA 3AFPA 4A93G 5M5YH 5E7NA 3U50C 2K4KA 2WP8J 5IYCH 5C4XG 3GTKH 4IO9A 4JI8Q 5FJ8G 3KDFA 4A3IG 3FKIH 3CCSA 1VQEA 1CKNA 1VS0A 1E7ZA 2QA4A 4HJ5A 2UUCQ 1XPOA 3T1HQ 2WAQE 1HR0W 1KIXA 3M7NA 1SN8A 1HR0L 2AMCB 4AIMA 1SROA 1YIJA 2ZTEA 5M3MH 1IL2A 5DLQE 3TREA 4DV7Q 4L5QA 4A3CH 4APVA 1EUJA 1XPRA 3J81c 1HH2P 1TXYA 2JA8H 4GKJQ 2B3GA 2KHJA 4DUYQ 4TVAB 1YITA 2KCTA 1JJ2A 2R93H 4OX9L 2F4VQ 3Q8DA 5C0XG 1XPUA 1C9OA 1N33L 1VQAA 3CMAA 3AYHB 4DAYB 3CCJA 3I7FA 4UP9A 4A75A 1N33Q 3GD7A 4DR6L 4B3MQ 3G4SA 1N32Q 4DR2Q 2ZTCA 1L0WA 4X62Q 2B63G 4EX5A 4XIGS 1RIPA 1VQLA 1IBML 4X62L 3BZCA 4DKAC 1UE7A 2I5HA 3OW2A 2CFMA 2KCMA 3W1BA 4LUZA 1IBMQ 3KLWA 3I2ZA 5FLXc 4YWLA 4A3KG 1TWHH 3B6YA 4IPDA 2IHEA 1E24A 1PH3A 1PH7A 3PIOA 5IT9c 4LUOA 5M3FG 4QQBX 1EIFA 3F8TA 3J7ZC 1PH1A 1PHJA 3HOVG 2UUCL 3FHWA 1E1OA 4GLXA 4DV1L 1SRUA 2WAQG 1EQRA 1YNXA 4QIWE 3T1YQ 2YTXA 3K7UC 3AEVA 4LF5Q 1FVIA 2UUBL 4LF6Q 1R9TH 4A3GH 3T1YL 5FLMG 2N78A 2NZOA 2VW9A 4L5SA 4IPGA 4LF5L 4R4CA 1VQGA 3HOXH 1Q1BA 3H0GH 4BXXH 1IXRA 2VQEL 2VY3A 1JB7A 2PI2A 4DV5Q 2UXCQ 2PQAB 4A93H 2VQEQ 4IPCA 4LF8Q 4DPGA 4DR7Q 4YY3L 3TS0A 3PO3H 1Q46A 5IP9G 3DLLA 1V9PA 1N36Q 2E5LQ 3HOYH 5JJKA 4JC0A 2K14A 3HOZG 3S16H 3H3VI 4OO1I 3KF8B 3KF6B 2NVTH 1NTGA 2E5LL 4P71A 2JEBI 2VS1A 1SE8A 2ZTDA 4UP7A 2K5HA 3A74A 2EXDA 1VQKA 1VQ6A 4DK3C 2NVYH 1XNQL 3CD6A 4BY7H 1Q7YC 1N34L 4GOPB 2Q2IA 4PMWA 4DR3Q 1YJWA 4P75A 4RMFA 3CXCA 1XNQQ 1K9MC 2EIFA 2N3SA 5GAEC 3HOYG 1G6PA 3E9HA 1WCMH 4X66Q 3UE0A 1IBKL 4BY1H 2D0OA 5K36G 2ID0A 1UE6A 4O0AA 3KJOA 2VNUD 3M85A 1OTCA 3J80i 1KAWA 2VUMH 2JE6I 1PH2A 4BA2I 2K5NA 4B3SL 3PO2H 1VQHA 2IHFA 2NVQH 2YYZA 1Q1EA 2CWPA 4JV5L 4JI2Q 2AWOA 3H0GG 1S40A 1MJEA 1WCMG 4BY1G 2ZJRA 1TWCH 4PZ7A 4J15A 2HIVA 3AQQA 3BU2A 4JI2L 2MO1A 1KL9A 1VQ4A 3I4MH 4BBSG 1Q86C 3G6EA 4ALPA 4O2DA 4GOPC 3F2CA 5GAHC 3CCLA 2XGTA 4IOCA 1QUQA 5LMNQ 1N9WA 1I6HH 2CQOA 1LYLA 2CWAA 2GVBA 1C0AA 1L1OC 4X64Q 1HZAA 3STBC 3F2DA 4WJ3M 4GNXC 3UDGA 3CCUA 3E9IA 1K8GA 4JG2A 4DR4L 5H1SE 4XTCS 3I4NG 2MFIA 4X6AH 2WB1G 4L5RC 1A62A 4JI3L 4LNQA 1Y1WG 2I0QA 3TEHB 2E2HH 4GS3A 2R7ZG 4JI7Q 3SGIA 3TQYA 4DV3Q 4A3FH 1T9HA 4JI4Q 5IP7G 1FJGL 4DV3L 1NBWA 4H02A 5LMUQ 3GTJH 2JA6G 5IYBG 4P74A 3S2HH 3EBEA 2E8GA 3U4VA 5LMUL 3GTGH 4GN4B 3EN2A 2KBNA 1Y14B 3S17H 1WI5A 4C3JH 3KOJA 3CPWA 2UXDQ 3RN5A 2WB1E 4B3RL 2WFWA 4LFAQ 4DAMA 3JAMi 4DV0L 4DV2Q 4NXML 5C4XH 3ULPA 1VCIA 1SR3A 2YV5A 4JI5L 1K8AC 3HOWG 1OXTA 1PH8A 1W2BA 5GQOA 3RLOA 1SFOH 4FDBA 4JI5Q 2B63H 1PFSA 3PV0A 4LF9L 4X65L 1JMCA 4YCUA 1XMOL 2UXBQ 4L5TA 3JAMc 3I4NH 2R6GA 2UUAQ 2IY5B 4A3JG 3PO2G 3H15A 4HIDA 4B3TL 2YU9H 3IRBA 2K52A 1B7YB 5HGQA 2UUAL 2OTJA 2JK8A 4DNIA 1OXVA 3PUWA 4A3BG 1KRTA 4JI3Q 4DK6C 1EFWA 1UEBA 1J6QA 1K3RA 4A3MG 1I94Q 1JE5A 2Q2TA 3I4MG 3PCOB 3L2PA 4P72A 1C7YA 1O7IA 1Q8KA 2V1CC 2ZJQA 5M5XH 1TWAH 3GO5A 3MXNB 5C4JH 3T1HL 4AQYQ 3CCRA 1X9NA 2E2JH 1FJGQ 3KDFB 2PNHA 3UDIA 4KHZA 3U58A 1SMXA 3CW2C 1Q81C 4LF7Q 5IE8A 1D7QA 2VQFQ 2Z6KA 3CAMA 4KI0A 1OXXK 1L1OA 4UPAA 3HOUG 2NN6I 4K0KL 1JT8A 4GNXB 3E0EA 4A4IA 1MIUA 4R4OA 3BZKA 1EQQA 1HZ9A 2N49A 2Z6KC 4JI1L 2K50A 5IWAL 4A3LH 2PMZE 1B8AA 4QGUA 3PUYA 4YHHQ 3GTQH 1A63A 5IWAQ 1LM0A 2BA1A 2YTYA 1QZHA 1S3OA 4UP8A 1X6OA 4AYBE 4HJ8A 3J7A5 3LGJA 2D0PA 2HIXA 1KHIA 1XMOQ 1HNXL 3OTOQ 4BY7G 1WOCA 4YWKA 4BA1I 4LUVA 5IY0A 3J81j 2UU9Q 4OWWB 1U0LA 1X55A 5C44H 4B3TQ 3ERSX 1L1OB 4HIKA 3S1MH 1HZCA 5JJLA 3G48A 2PQAA 4ME3A 5LMNW 2HHHQ 2F3IA 2AWNA 1GKHA 2YTVA 4C3HH 1G291 1YZ6A 5C0XI 3J81i 1VQ7A 2JA7H 1CKNB 3NBHB 2MQHA 4KHPL 3HKZE 1BKBA 3M4OH 4KLKA 1Y1WH 4GN3B 1VQJA 4MNOA 1NMFA 4KHPQ 2RHQB 1WFQA 3A5ZB 2ATWA 1SLJA 4DV7L 4IOAA 3HOUH 1CSPA 1L2FA 3ZJYC 4GKJL 4MTNA 3AFQA 1PYSB 5FLMH 3D0FA 1BBUA 2NN6G 3ER0A 4OXPA 4DV5L 4GOPA 2F4VL 1S72A 4OWXB 2JEAI 3PUVA 5JJIA 4JOIA 4DUYL 4DR7L 1KC8C 5C3EG
chains in the Genus database with same CATH superfamily
3DM1A 4KY6A 5ELOA 4C3IH 5IIFA 3L7ZC 3FRPB 1N32L 2JQOA 2PMZB 4RGOS 3KLSX 4QB4A 3VYTA 4H0LC 3A7AB 3LWEA 3M4OB 4HCEA 4DR6Q 4A93B 1K0RA 3TP7A 3A5UA 1M4VA 5C3EH 1I4HA 1YI2A 4RG1A 1VQ8A 1VQBA 2F0KA 1YNNC 4JI0L 3HGBA 3RR5A 2Z8LA 2E2JB 2HCCA 3VDYA 1JWUD 4A3EH 5G3LF 3GQBA 4JI0Q 2NVTB 4JI8L 3HOXG 4QCLA 3Q24A 2Y0SG 1F2YA 1Q12A 1J5EL 2LXKA 4OO1G 4IURA 4B3SQ 2N8NA 3S1QB 1RD9D 1XJVA 3PMFA 4DR1L 4IPHA 5C4HA 4G7HC 4WJ4A 4PG3A 4A3DG 3G71A 1I3QB 3ZYYX 4FF2A 1DOKA 1B44D 2QEJC 4OELB 3DWAA 2EQSA 2QDLA 4HIOA 2JA9A 1QVFA 1M1KC 1HJPA 5M5YB 1AH9A 1HHVA 4C3HB 1E2VA 4P73A 1BBXC 5D65A 4DR3L 3Q22A 2JJQA 1JQYD 1AN8A 4ODGA 3KBXA 5ELNA 2JA5H 1I50H 1VMPA 4PZ6A 1O7ZA 2E74C 2JA7G 1SEBD 2DNEA 4RH6A 1IBLL 2UXDL 2UUBQ 4ZUJA 1BVSA 4POGA 1E1TA 3VYRA 2Y0SE 1NUCA 4ME5A 1WTVA 3D31A 3H6MA 4X64L 1KDAA 4ZLTF 1CQVA 2HQEA 3K81C 1FNVA 2CH4A 1SNCA 5CR3A 1Z6HA 1A2UA 2F1MA 1O80A 1AE3A 1GUSA 2EYMA 3M4QA 4LF4Q 4KKTA 4EQPA 3M3YH 1EY7A 3PGZA 3M9BA 4HJ7A 2A74C 1TWCB 3MA2B 4JI7L 5D3IB 2EJFC 2A8VA 2GVAA 1NE3A 1NMGA 4DV0Q 4LFAL 4LK1C 3FMCA 2ICEC 3WWVA 4IUUA 4X3TA 4NXMQ 4OONA 3DWPA 2L9HA 5C4JB 3JC66 2F0EA 1ESFA 1LTID 4IFDH 1I4PA 4R1JA 1UNSA 1IZ6A 3RNUA 4EQ5A 3GDEA 3SVMA 3G6JB 2L1BA 4JBJA 4NXNQ 3T16A 2UU9L 3RZOB 1TIID 2R7FA 5A2QL 4KD3A 4LW1A 4OGQC 4I65A 2R7ZB 2CH4W 2F0GA 1TS5A 1T5XD 4KD4A 1D8LA 3E0JA 1SJHD 3A56A 4IUTA 2M9VA 3NEMA 2QEXA 1VQCA 2OWOA 1A0IA 2K5DA 3MHBA 5FK9C 3GTOH 2E2DC 1RCVD 3VA7A 2NYZD 4HN7A 3IFDA 4LF7L 4UHVA 1YVCA 4DV2L 2RCFA 3LWUA 5DM63 5J3BA 1E2WA 1EYAA 1GD7A 2JA8G 2I5LX 1F77A 4LJZC 3U4ZA 1LTLA 1UUPA 3DHQA 4L8JA 1EY5A 1RHPA 1I3QH 2OQ0A 3PF5A 4RHSA 3PIPA 2H1EA 3OWEB 4R4IA 1DXMA 2D9UA 4QJFA 1ET9A 5IGEA 3OTOL 1RKNA 4H7BA 1BR9A 3AFPA 4K5XA 1EIHA 2WP8J 3EJIA 5IYCH 2KHSA 4IO9A 1DOLA 4F8MA 4A3IG 3NHHA 2F3VA 4HJ5A 1VQEA 2UUCQ 2DJFC 3AU7A 3EVQA 2EPBA 1CFMA 5I6WA 3D4DA 2AMCB 2TMPA 4AIMA 2B2UA 5M3MH 3TREA 3NTIA 4A3CH 4APVA 4CJ1B 1EUJA 1HQMC 3J81c 1VMCA 3EA6A 2JA8H 3QG1A 4TVAB 4Y7NB 1JJ2A 2R93H 1VDZA 1KNAA 2F4VQ 4WJWA 2X6LA 4OIJA 2JSOA 2NZ1D 3GD7A 1J8IA 2ZTCA 3EQLC 5FKAC 4XIGS 4RGMA 1VQLA 1IBML 2A68C 4R8IA 3KLWA 4MN3A 4XQNA 1T5EA 1PFBA 3DEOA 1EQTA 1PH7A 5IT9c 3PIO3 4PQXA 5KNCA 3J7ZC 3HOVG 1E1OA 1STEA 4GLXA 4DV1L 1SRUA 2OF1A 1IKLA 3K7UC 2EYFA 2UUBL 4C3IB 1R9TH 2A6EC 2G9DA 2N78A 2VW9A 1TY0A 1IXRA 4DNRB 1BQQT 4C3JB 2K1BA 2VQEQ 4LF8Q 2Z1CA 3BVMA 2C9OA 4DAVA 3HRZC 4KMUC 5IP9G 3DLLA 4FVMA 2E5LQ 4JC0A 3HOZG 3D6WA 2PZTA 3KF6B 1A15A 1D1KA 2KUMA 2VS1A 2K5HA 1VQKA 1U9RA 1MSHA 1QILA 4DR3Q 4P75A 4RMFA 1G6PA 3C1EA 4U68A 4BY1H 3UE0A 2ID0A 1UE6A 4O0AA 3U9OA 2VNUD 1LV9A 1KAWA 3PO2H 1VQHA 3MXNA 2YYZA 2CW0D 3SXHA 4A3DB 1C48A 3H0GG 1S40A 1ICFB 2DN8A 3M4YA 3I90A 4BWGB 2HIVA 5DM73 3AQQA 4JI2L 3A8IE 1VQ4A 2SEBD 1Q86C 1EYCA 3G6EA 4OHJA 4DN4M 5LMNQ 1N9WA 1I6HH 5J1ZA 2EXZA 3STBC 4WJ3M 4GNXC 2K33A 1K8GA 4DR4L 1EWCA 5IGBA 3GP7A 1SYFA 2TSSA 3H94A 3BYTB 1G6ZA 2RSOA 1T9HA 4JI4Q 3I72A 4A3GB 5LMUQ 1DOMA 4P74A 3K5NA 3EBEA 3MEHA 5LMUL 5ELFA 1Y14B 3J81E 1WI5A 1SJED 2PQEA 3CPWA 2Z4IA 3R93A 3VYSA 4DV2Q 4FF3A 2WKDA 4UDUC 1SBBB 1SR3A 2YV5A 4JI5L 4RKLA 1D5XC 3NK9A 1BDOA 1A3VA 4X3SA 5GQOA 1PMRA 5I2YA 3LX0A 1JMCA 2DY8A 1CA5A 4XDXA 2MGSA 1FYCA 2K52A 1B7YB 4OEMB 4NW2A 5HGQA 3HP3A 4RAUC 4A3BG 1KRTA 1EFWA 2PNRC 4CDDC 1LTAD 1I94Q 1JE5A 1ENCA 3I4MG 3S2DB 3TN2A 4WRDA 4HAEA 1SNQA 3T1HL 2WINB 4A3BB 2G9HD 5CV9A 1Q81C 2PO4A 4CGYB 5IE8A 1D7QA 2Z6KA 4KI0A 1QCBD 1L1OA 3HOUG 1JT8A 1BOSA 4CKCA 1R9TB 1HZ9A 4JI1L 1A3TA 1A3UA 4R8NA 1B8AA 3PUYA 4YHHQ 2KJXA 5IWAQ 1LM0A 2BA1A 3D6CA 4RCNA 4HJ8A 2KEEA 2HIXA 4BY7G 3OTOQ 5IY0A 4BA1I 2UU9Q 5C5MA 4H13C 4JVZA 1E0BA 4FNFA 2MP1A 5CORA 4B3TQ 4DAYA 3ERSX 3FDTA 3SE0A 1HZCA 2VB3X 3A7LA 2HHHQ 4A3KB 1GKHA 3NTHA 4C3HH 1VQ7A 3NBHB 4KHPL 4CBVA 3DWQA 5CV8A 3BDLA 1ZXTA 2XRQD 5C0XH 1EYDA 5T1GA 4KN7C 1CSPA 3HOUH 1S5DD 1F2LA 3HS0C 4B9XA 5LL6X 3PUVA 2SNSA 2Z6BA 4DR7L 2R92G 3NE5B 2F4IA 3PIP3 3S1MB 4NB3A 2AQ2B 2E2IH 2BDNA 3X3NA 4A3CG 3J80c 1D2BA 1ZEQX 3OYYA 2XTIA 2C35B 3NWTA 1UE1A 2EY2A 4DR2L 5BR8L 5JVG3 1NY4A 4IFDJ 4ZK9B 2ASBA 3KK7A 1SMYC 3STBD 2Q8RE 1SNMA 2VZAA 4DV6Q 2F0QA 4DV1Q 3G7LA 3GTOB 2ENBA 1XWEA 3VYUA 4DV6L 1B9NA 3GTPH 4Y7NH 1EQVA 3SK8A 4DR1Q 3FP9A 1Z9FA 5FLXE 4BY1B 1VQIA 4XYOA 2UXCL 3W5OA 1SSOA 4QY7A 1B9MA 3TP8A 4LWCA 1RL2A 4LF8L 1PTOF 1YNND 4TSSA 4KKUA 5IYBH 5FLXL 1QJOA 5FJ8H 3KLSA 2ZM6Q 4UAIA 1FD7D 1BUVT 1XTDA 2F3WA 2FHTA 2JA5G 1STNA 1TWGB 3MVVA 3K58A 3T4AC 3S24A 1B3AA 3CMEA 1X3FA 2QW7A 3RLFA 3U9SA 1KQSA 2BCOA 2WIIB 1E22A 3S14H 3S1NB 1EOVA 2QILA 3MXGA 3I4NB 4K8IA 3D4WA 1D1IA 5IGGA 4JI4L 3CCEA 4JBMA 3HOVH 1RDPD 1TS2A 3BDOA 3S15H 1IBLQ 2L15A 2WAQB 3K57A 2RHSB 2IX3A 3A8JE 2OTLA 1TS4A 3MEFA 2EVBA 4GKKQ 3L9AX 4C3JG 4A3MH 1H9SB 2XN9C 3CP0A 4GKKL 2XWBB 1V1QA 1D5ZC 1AW7A 1O7YA 1YJNA 3NBHA 1NCVA 1E3PA 3L0OA 1X54A 2B2YA 1U4LA 2IX1A 3OSOA 1HZBA 4O1NA 1VQMA 3A0JA 2O5JC 3UE1A 4K5VA 2ALYB 1NJIC 1YNJC 2JYOA 2ZXPA 4E6IA 4LFBQ 3TRZA 5I4DA 3N52A 1WYDA 3P7JA 4M1UB 4A76A 5IYDG 3PQIA 5C5LA 4FF4A 3N6RA 1F9RA 5JEAJ 3RN2A 1F2ZA 2MPMA 2ICIA 2LMCB 1X3PA 2SNMA 2NZHA 4R9WA 1BCPD 5K5PA 2R7DA 1HNWL 2Z0SA 2MUYA 1TVXA 1PH5A 1EIYB 1JJCB 3H3VH 4OO1H 1RODA 1TWAB 1PXUA 1SYBA 3A55A 3CCQA 3CF5A 1BCPC 2AQ1B 1QZGA 3S1NH 1CSQA 1N8RC 1X3QA 1HNXQ 3CQZH 1SNPA 3CPFA 3P75A 1WJJA 3M4PA 4DA2A 2MJ8A 2AHOB 1QWYA 2HHHL 1I94L 5GADC 4LFBL 3GTLH 4DV4L 2O2LD 2VL6A 3RZDH 1FGBD 4AQYL 4EVOA 2JA6H 1SYEA 2EDGA 2A1AA 3FPPA 2LSSA 5BN5A 4JW0A 4H44C 1VQ9A 2B2VC 4R4QA 5EAYA 4NPSA 5M3MG 4V0BA 4B3RQ 2VQFL 1PRTC 1K3BC 4RFBA 4DGZA 1I4RA 3S1QH 3K59A 1GM5A 5M3FH 4EGVA 1Y1VH 4U673 2F0UA 1ASZA 1EZ6A 4KHVA 1F9SA 1MKHA 1NAPA 5HY6A 4AYBG 1STYA 2NVXB 3VA5A 4DNTB 4HSVA 4PZ8A 5J22A 4NXNL 1CTMA 4OIKA 3FKIG 2ZXOA 4UY8C 5C4ZA 4K8JA 2R93B 1IL8A 2L4NA 2EE1A 3S16B 3BYYB 2DGYA 2F0DA 1SYDA 5E7NA 3U50C 1WTWA 3C46A 1A6XA 3KDFA 3CCSA 5FO8B 4X3KA 3T1HQ 1SN8A 5IT9L 3I3CA 1YIJA 1VF7A 2ZTEA 1IL2A 5DLQE 5KYLA 4DV7Q 1HH2P 1TXYA 4GKJQ 3R3OA 4K6LA 1PTOB 2KCTA 4OX9L 2OT2A 3TMEA 5C0XG 1VQAA 3ITPA 2A69C 3AYHB 4ILWA 4DAYB 3I7FA 4FP5D 4UP9A 1N33Q 5I9PA 3G4SA 1N32Q 1L0WA 2XIWA 2LY7A 4XT3B 2B63G 1RIPA 2MHVA 4DKAC 2I5HA 1M8AA 1SE2A 2KCMA 4C3HG 3O13A 3W1BA 1LT3D 3B6YA 4IPDA 1PH3A 4L6TB 3PIOA 4LUOA 5M3FG 5I6YA 1KTKA 1PHJA 3S14B 3UI2A 1S4ZA 1EY4A 1Z7TA 3AB9A 2WAQG 2NVYB 3AEVA 4LF5Q 1FVIA 4XT1B 1HCZA 1ILQA 5M3FB 1VQGA 3H0GH 2VQEL 4N8FA 4G7ZC 2PI2A 3MC0B 1Q46A 1R4QB 1V9PA 1N36Q 4ZAIA 3S16H 5G3LD 3MAQA 1NTGA 3OMGA 1V8QA 2EYLA 1EU3A 2JEBI 2ZTDA 3GTPB 2EXDA 1XNQL 3FKIB 3TZUA 1YJWA 2A6HD 3HOYG 3K6OA 1GUGA 2N3SA 4BBRB 5GAEC 3E9HA 3NSWA 3HOXB 2A5HA 3M85A 1OTCA 2PW7A 4B3SL 5COYA 2NVQH 1HXYD 2PPBC 3PO3B 3HKZB 2I46A 2K7VA 4MIUA 4JI2Q 1WCMG 1WTHA 2QKIC 4O42A 3GTJB 1EEID 1KL9A 3I4MH 4BBSG 2QCPX 1HA6A 2LFNA 4O2DA 5GAHC 2XGTA 4IOCA 3NQTA 1LYLA 2GVBA 2VB2X 1L1OC 5EBCA 4X64Q 2B2VA 3F2DA 3CCUA 5CBAE 5H1SE 3KLRA 4QMGA 2CW0C 2WB1G 1A62A 3QOLA 2I0QA 3C3LA 4GS3A 3X3MA 2J0TD 1O78A 1SYCA 3IFTA 4A3FH 1I4XA 2L11A 1NBWA 2DNCA 4H02A 3MXUA 2E8GA 3W3AA 3EN2A 2JN4A 3RN5A 2WB1E 4B3RL 2IL8A 5E4WC 4NXML 1U4RA 1XX8A 3HOWG 1PH8A 4EQNA 1I6VC 3SK4A 1PTOH 3CKIB 1STHA 4X65L 2UXBQ 4RKBA 2FJ2A 3HOWB 2UUAQ 4HIDA 4B3TL 3S2HB 1MD2D 2UUAL 3PUWA 1JORA 1UEBA 1BNZA 3HZXA 1U4MA 2L12A 2Q2TA 4DF7A 3L2PA 3VR2A 5M5XH 1TWAH 3MXNB 1FJGQ 4ZUIA 3CCRA 5E4XA 2PNHA 3UDIA 3CW2C 1BF4A 2RDHA 4UPAA 4K0KL 2NN6I 4RWSC 2K32A 1Q90A 1CZGA 3CU7A 1EQQA 2K50A 2PMZE 2HUGA 3GTQH 3A8KE 5J39A 2YTYA 2KECA 4UP8A 3J7A5 3LGJA 2NTTA 1Y8NB 2XSCA 1HNXL 1IYVA 1U0LA 2QDBA 2R3ZA 4DXFA 1L1OB 1WD0A 3G48A 2F3IA 3OMCA 4PV1C 3J81i 4IUPA 1CI3M 4I7AA 2MQHA 1BKBA 1STAA 3S17B 4GN3B 1VQJA 1DCZA 1GUNA 1AP0A 2RHQB 1WFQA 3A5ZB 4PMCA 4DV7L 1ILPA 1V1OA 2F03A 3BVZA 3ZJYC 4CDFC 3AFQA 1XYIA 1PYSB 2PCFB 2NN6G 2K5WA 3D0FA 2VUMB 2CHBD 4GOPA 2F4VL 1S72A 4OWXB 3NWSA 1PZJD 2A6ED 5JJIA 5EBDA 4JOIA 2I07B 5C3EG 5T1IA 4IJHA 2AKWB 5KRUA 4OX9Q 1N36L 3A54A 4A3KH 3D3RA 5DAUA 4K14A 5ELEA 3GTKB 4DR5Q 2BH8A 5EKIA 4HJAA 2F52A 4JYAQ 4C2MH 1QNUA 1EIGA 3TSSA 2K5VA 1HA5A 1S5BD 3HOYB 1EY8A 2K75A 3NTKA 2F0TA 3K8AA 2PYKA 2VXWA 3R8BA 2EYJA 2HDMA 1EEFD 3EROA 4Q0FA 3J81L 5JVH3 2BH2A 2XRSD 3TBIB 3HKZG 1EY6A 2B2TC 4IZ8A 1WCMB 1H95A 1VQNA 3GTQB 1WVLA 1YHAA 3OIPA 3ULJA 1QVGA 4BBSB 3KJPA 1SMYD 1VQDA 2E76C 1GOZA 3WOEA 1G2SA 2R61A 5CV4A 3VR6A 1TS3A 1EYGA 1VQOA 4DR4Q 1JJGA 1BBWA 1XMQL 5IOCA 1GHKA 2OQKA 2WB1B 2PZUA 5BR8Q 5C0XJ 2EY5A 1Y8PB 1KRSA 3CC4A 2YU9B 1X65A 1UE5A 3NENA 2OCEA 1Z47A 2RDGA 4KJNA 1P8LA 1K83H 1J5EQ 4BBSH 1KD1C 4DUZL 1PRTF 4Y52H 3QIAA 5C3WA 3SHLA 1Y69U 1O7LA 4LF6L 1GHJA 1EWIA 5M9OA 4A3BH 5KEEA 4K6DA 3EIVA 3JAME 3ICEA 1JOOA 2I5MX 2VUMG 4HR7B 3JAML 4FXKC 1NNXA 1U5KA 1H9KA 1PVOA 4OL7A 1V43A 5C3EB 3SDZA 3GTMH 4BBRH 4N9PA 2LXJA 2B2WA 1WTQA 1KLUD 2QGQA 5D14A 1GVPA 4KKSA 3RMHA 5BN4A 4LF4L 5AJ3L 3V96A 3KYHC 4A3IB 4GLAC 1C8CA 1N34Q 1OXUA 2NUCA 1TR5A 2K6AA 5CBEE 3I4MB 1TWFH 2J4XA 5IT9E 3PO3G 1ZYRC 3J80E 1K73C 3GTLB 3MFYA 5GAGC 5ELDA 4FYDA 1QG7A 4A3FG 3K5OA 4HTHA 4JPBW 1PV4A 1BCPB 3CC2A 4C1NI 2EY1A 1AEXA 1TWGH 4DXGA 3P1HA 4IUNA 3I56A 1FNUA 4ID6A 1VQ5A 2E2HB 2B2YC 4CDEC 2EZVA 2IT1A 3K5MA 4LF9Q 2X69A 4X65Q 1VQPA 3NELA 1JB3A 4IFDG 1EFID 2NTSA 4QUCA 1XNRL 1TU2B 2G5DA 2LKVA 3DEPA 3I4OA 1AFPA 5AJ3Q 2RCNA 2PI2E 4GLVB 2MNAA 1XNRQ 2IWHA 1FGUA 3PF4A 3C2PA 2CKZB 1G51A 2M2LA 1J9OA 2IPKD 1P16A 2OEOA 3MWYW 3WOFA 2B29A 3UDFA 3CCMA 5CC4A 4A3GG 1PH6A 1QUQB 2F0PA 2M00A 1PYBA 1CHQD 1AE2A 4K0KQ 3AMUA 1NSNS 1QNKA 3ND9A 3QJYA 5JEAG 4JI1Q 2JXMB 4OWTB 5BN3A 4QF4A 3H09A 2BA0A 3RZOH 4QL5A 3BDCA 4JBKA 1D5MC 3ND8A 3F2BA 1PH4A 1PRTB 4JI6L 5IP7H 1F2MA 3K0XA 2JA8B 1CKMA 2H5XA 1CM9A 3KFUA 1IYJB 4JYAL 4A3LG 4HJ9A 1LT5D 3HG9A 4QIWB 5M5YH 3D8GA 2K4KA 5C4XG 1X32A 1PFMA 2AQ3B 3NUCA 1CKNA 1E7ZA 2D5DA 1KIXA 3M7NA 1HR0L 5C4XB 4B9WA 5EPKA 1LLRD 5JEAH 3Q6SA 2F0FA 1SFOB 2KHJA 4DUYQ 1RF2D 2BE5C 1S5CD 4L63B 1HFGA 3QB3A 4B08A 3Q8DA 1C9OA 1N33L 4EQOA 1LABA 3CCJA 1EU4A 5L37A 5CGKA 4A75A 1D6EC 4B3MQ 1STGA 4DR2Q 4CJ0B 2O5IC 1V1PA 1PLFA 1Y1WB 1ENFA 2BE5D 5C3XA 3RZDB 1UE7A 3OW2A 2CFMA 3IKJA 1QOHA 3OPOA 1K28A 3W2DA 1IBMQ 3I2ZA 1B3QA 5FLXc 1I4GA 4A3KG 2IHEA 1E24A 1TQOA 4K5WA 4QQBX 1EIFA 3V05A 2FMMA 3FHWA 4QIWE 1II3A 1YNXA 3T1YQ 1PZKD 2YTXA 3D4RA 4LF6Q 3T1YL 1IW7C 5CV5A 1WD1A 1DYQA 2NZOA 4L5SA 3CRKC 1TWFB 3HOVB 3L3OC 2VY3A 3HOZB 3I8ZA 5KYIA 4A93H 2WACA 4IUQA 1ML0D 1CK1A 4I7ZC 3SK5A 2NVQB 5JJZA 1W6KA 4A3JB 4Z9CB 5JJKA 2K14A 3H3VI 5IGDA 4OO1I 1S5ED 2E5LL 1SE3A 1SE8A 3A74A 2KCCA 1VQ6A 2NVYH 1N34L 4GOPB 1RTNA 3CHBD 3CXCA 1XNQQ 1HUMA 1K9MC 3BVGA 3H0GB 3R2TA 3K0YA 3J80i 2VUMH 4KJOA 4BA2I 1ONLA 2K5NA 1Q1EA 3J7AF 5CYUA 3QO2A 2AWOA 2IW3A 4BY1G 4A3FB 4F7XA 4J15A 3J80L 3BU2A 2MO1A 5IGFA 1LTRD 1WTPA 4HEDA 4GOPC 3F2CA 1GUOA 2K03A 4DFAA 2CQOA 1PTOC 4C2MB 3UDGA 3E9IA 5EKLA 3IAYA 4JG2A 1Y8OB 2KVMA 5E1FA 3S15B 5FOBB 5EGTA 4RGTA 4IQZA 2RQXA 4L5RC 1PYWD 1LO5D 1Y1WG 1LACA 3TEHB 1HFNA 2R7ZG 3TQYA 1JWMD 1CA6A 1CHPD 1U4PA 3MFGA 4DV3L 3GTJH 4G7OC 1I4QA 3S2HH 2DY7A 4GN4B 4WFN3 2PZWA 4C3JH 3KOJA 4ZYSA 1SYGA 4KTAA 2UXDQ 4DAMA 4LFAQ 4DV0L 1B50A 4C3IG 1LTGD 1SXTA 2JP1A 1VCIA 1K8AC 1OXTA 2J7ZA 4M8AA 1W2BA 1AZQA 1SFOH 3RLOA 4FDBA 1PFSA 1VF5C 5DEHA 5K36H 4YCUA 1XMOL 1JOQA 1PFNA 1HTLD 4KY7A 2R6GA 4A3JG 2AUKA 3KUPA 2RKSA 3IRBA 2OTJA 2JK8A 5JOBA 4DNIA 4HMIA 4QUFA 5KNBA 4JI3Q 4DK6C 1J6QA 1K3RA 4A3MG 3T56B 1LT6D 1G8ZD 3PCOB 3QWNA 1UEAB 4P72A 1FR3A 1O7IA 2ZJQA 1TT2A 2OXPA 5C4JH 3GO5A 2E2JH 1X9NA 3KDFB 5CMDA 3NP8A 4MHEA 4KHZA 4A3MB 1SMXA 1PTOD 4WORA 1V1PB 4GNXB 3KF8A 3CQZB 3E0EA 1I6HB 3DMUA 4R4OA 4DU9A 3BZKA 4KY5A 2E75C 1SNOA 1ENAA 1TY2A 2LS01 2N49A 5IWAL 1MGSA 1YNJD 4A3LH 4QGUA 4K2KA 3HOUB 1QZHA 2RDFA 1S3OA 1RJTA 5NUCA 1X6OA 5CV7A 2D0PA 1KHIA 1XMOQ 1WOCA 4YWKA 4OWWB 1IKMA 1X55A 3H91A 5CV6A 3S1MH 4HIKA 5F2DA 2PQAA 4ME3A 4ULLA 5LMNW 2ZT9C 1EY9A 2YTVA 5C0XI 1G291 1YZ6A 2JA7H 1CKNB 2B8FA 2NN6H 3HKZE 3M4OH 1Q3LA 4KLKA 1Y1WH 3MZ5A 5IGCA 4MNOA 1NMFA 4KHPQ 2HD3A 1SLJA 1Y1VB 1L2FA 4GKJL 3J7YW 4MTNA 5FLMH 2F0JA 3ER0A 4OXPA 4DV5L 1GUWA 1IW7D 5JPNC 2L5TA 2RA4A 4YHHL 4DR5L 2IX0A 5IP9H 3OIQA 1XMQQ 1KLGD 2P5ZX 3W1GA 3K7AH 1KDCA 3HFZB 1ASYA 3HOZH 1B2TA 1WTRA 4XQJA 4KN4C 1HQRD 2R92H 3S2DH 2N88A 3RUZA 2Q2UA 4ZQ3A 2K28A 2RBMA 5M5XB 2RF4A 4A3JH 4X66L 1LTBD 1IBKQ 2K04A 2F0MA 1CT1D 2B2WC 2L0CA 1R4PB 4ZRZA 5JAVA 3ERQA 1H9MA 4FXGC 1LTTD 1G2TA 3T13A 3TS2A 1UAPA 1EOTA 3BJUA 3TZDA 2ZJPA 1HR0Q 2K5QA 5M5WH 1I50B 4DAPA 1CQFA 4K2LA 2KA7A 4YY3Q 2NVXH 4JOIC 1MJCA 2ZM6L 5IYCG 1FL0A 2A68D 2F0IA 1LTSD 4A3EB 1MHWC 3VR3A 4BXXG 4B3ML 5FO7B 4G4KA 3CRLC 4YCVA 1Q82C 5EQ0A 4HMJA 3OW7A 1A8VA 2XVSA 2EJMA 2D2CC 4A3EG 1YHBA 3HOWH 1JOKA 1QVCA 2HCIA 1HUNA 1CUKA 2MO0A 5HURA 3PUXA 3Q23A 4J8QA 4AH6A 2K05A 1YEZA 1H9JA 2JA6B 4A3IH 3I55A 3CC7A 1HNZL 4P2CB 1VQFA 4JV5Q 3SEBA 1HNZQ 2FMCA 3DUZA 2GA4B 2E2IB 4GN5A 1CKOA 2HDLA 1B53A 3E5SA 1XTCD 3OWFA 2R92B 2NB0A 2UXBL 2R93G 5LMNL 3URYA 3R2IA 5IYDH 3C1FA 4IFDI 2FXQA 3QOJA 1LUZA 2KCNA 3RLNA 4LFCQ 4IJLA 4DV4Q 1CZWA 4GZYC 4LAAA 1YJ9A 4GNXA 4A3DH 4RCOA 2DUDA 4LFCL 5GROA 1UWVA 4HIMA 3SK6A 4YCWA 3QR8A 3KF6A 3K5LA 3FPUB 4DK1A 4TQUS 3HEJA 3HKSA 1XXGA 4DUZQ 1KXLA 2B8GA 2R7ZH 2KENA 3M7GA 4X3UA 4JBWA 2ES2A 2D62A 1SE4A 2B2TA 2A19A 2XNAC 3ULLA 1DGSA 2KHIA 3DM3A 3F1ZA 1X3GA 1IYUA 1JR0D 3UDXA 3K80C 3I91A 3PUZA 2CCZA 4G57A 3CCVA 2WKCA 1K8OA 4BY7B 1ZYRD 1BO0A 2JA5B 5AFWA 1BCPF 1JE4A 1SDFA 3PSIA 2HT1A 1IHZA 1HRJA 1JC7A 3GTGB 1YBYA 3E3XA 2C5CA 4YWMA 1K83B 3P20A 2BDOA 3S1RH 3IL8A 4JCVE 1PH9A 3TP6A 2Z4HA 5KNDA 4FO2A 1OXSC 4POFA 1W3SA 2GN5A 1Y1VG 4ZKCB 5KGUA 3LNNA 1HNWQ 4R4TA 1S5FD 4N9TA 1QE6A 3I4LA 1X56A 3MXPA 3DXJC 5C44G 2F0OA 4JI6Q 4CDCC 1MI2A 2EY6A 5M3MB 1W6JA 5A2QE 1EY0A 1GO3E 1B70B 1SNDA 4MZ9A 2HQLA 3S1RB 5TSSA 2EYPA 3TDQA 5EJWA 1M90C 1PA6A 1K8MA 2XWJB 1YHQA 1I5FA 2Q2HA 1X3EA 4BBRG 4A93G 1H9SA 1EWHA 2IJ0A 1AZPA 1L0YB 4JI8Q 3GTKH 5FJ8G 4IALA 3FKIH 1FNWA 1VS0A 2QA4A 5E3FA 4J1MA 1XPOA 2WAQE 1HR0W 4C56C 1K0SA 1C4QA 1SROA 1STBA 4L5QA 1XPRA 2CQAA 1KNEA 2B3GA 3E6ZX 4HCSA 1YITA 1ICWA 4TRDA 2F0HA 3TP5A 1XPUA 3CMAA 1DONA 4Q5VA 2B39A 3NPPA 3S9WA 4DR6L 2AUJD 3T51B 4X62Q 2N55A 4PNYA 4EX5A 2SDFA 3FEWX 5I2XA 4X62L 3BZCA 3GTMB 1KDBA 2KQ3A 4LUZA 4YWLA 1TWHH 2FFKB 2NWGA 4LMQD 1EZ8A 3F8TA 4N8X1 5IODA 1PH1A 1JICA 2UUCL 4CHTB 5HGTA 1EQRA 1NR4A 1GJXA 3I70A 1B4OA 4NKLA 5FLMG 4A3GH 4IPGA 4LF5L 5ISRA 4R4CA 1A2TA 3HOXH 1Q1BA 4BXXH 2F0SA 1JB7A 4DV5Q 2UXCQ 4NDXA 2F0WA 2PQAB 3FVQA 3NQIA 4RGNA 4DK0A 4IPCA 4DPGA 4DR7Q 4YY3L 3TS0A 3PO3H 4F87A 2A73B 3V2TA 5C44B 3HOYH 1TWHB 4CKEA 4ABNA 3KF8B 2NVTH 2H4OA 4P71A 5FO9B 5KIXA 2F0NA 4UP7A 3H3VC 2EOTA 1SAPA 2QF7A 1JWSD 4DK3C 1H9RA 1DD2A 3CD6A 4BY7H 1Q7YC 2B2UC 2Q2IA 4PMWA 5JPMC 2EIFA 1WCMH 4X66Q 1IBKL 2D0OA 3I73A 2BOSA 5DNFA 5K36G 2Y0SB 3KJOA 4TKOB 3Q0AA 3T53B 4HSPA 2JE6I 1PH2A 2IHFA 2CWPA 3M3YB 4JV5L 4NP5A 3ONAB 1MJEA 2A6HC 4FXDA 2ZJRA 1TWCH 1JCKB 4PZ7A 1HTPA 4ALPA 3CCLA 3EFXD 1QUQA 4JK1C 4PMBA 3OHXC 4MTKA 2CWAA 1C0AA 5EKKA 1HZAA 2F0LA 2Q8IB 3BZDB 5ELBA 5C6AA 2CVRA 3BG3A 4KV6A 3OOCA 4KK7A 2Q8TA 4XTCS 3I4NG 2MFIA 4X6AH 4JI3L 4LNQA 1L0XB 2B63B 2E2HH 2FINB 4IUVA 3SGIA 4JI7Q 1MSGA 4DV3Q 3KBGA 1B1ZA 4XYQA 3NBIA 5IP7G 5M5WB 1ESRA 1FJGL 2JA6G 5IYBG 1F9PA 4IN3A 3GV6A 2JA7B 3U4VA 3GTGH 4CJ2C 2KBNA 5D3DA 3S17H 2WFWA 3NXWA 3JAMi 4FF1A 3RD4A 1QB5D 1WTOA 5C4XH 1KABA 4RHRA 4XXEA 3ULPA 5LL6S 4ZCKA 1GUTA 2DJGC 4JI5Q 2B63H 3PV0A 2EYOA 4LF9L 1DM0B 4F88A 4L5TA 3JAMc 3I4NH 2IY5B 5I9OA 3PO2G 3H15A 1PRTD 4XQQA 2YU9H 1G91A 1HPCA 2Z9HA 1OXVA 4ZKBB 1EL0A 3WDNA 2WV6D 4C1NK 2RSNA 4BS9A 3PO2B 1C7YA 4NMZA 2X6GA 1ZKOA 1Q8KA 2V1CC 3MTSA 1PDQA 4AQYQ 1DJRD 2O4XA 2F0VA 3U58A 4LF7Q 2VQFQ 3CAMA 4YIJA 1OXXK 4CKBA 3VR5A 3BS1A 4S3SA 4A4IA 4J6HA 1MIUA 3SR1A 2Z6KC 2EJGC 5LHY1 1A63A 2NBFA 1GXDC 2L55A 5A35A 3VR4A 2SOBA 4AYBE 2V4DA 1RTOA 3J81j 4LUVA 3J7AV 2KEDA 4V190 1BXTA 5C44H 5JJLA 2RVLA 2AWNA 2A69D 2K01A 3F2UA 2ZXRA 2EYHA 3K7AB 1LT4D 1E2ZA 1F9QA 2PW5A 4RA8A 2ATWA 1OO9B 5EPLA 1TKWB 1MBYA 3GV3A 4IOAA 5EPJA 1DZ1A 1Q8IA 1WTXA 1PZID 1BBUA 1ET6A 1KAAA 2KOLA 2JEAI 1NR2A 5ELCA 4DUYL 4AYBB 1KC8C
chains in the Genus database with same CATH topology
4IJHA 2AKWB 4NB3A 5ELOA 3L7ZC 4C3IH 4OX9Q 2JQOA 4YHHL 1N36L 1N32L 4DR5L 2E2IH 4A3CG 3J80c 4A3KH 2IX0A 5IP9H 1XMQQ 2R92G 4DR5Q 3W1GA 3HOZH 3K7AH 1ASYA 2BH8A 3HFZB 4DR6Q 3OYYA 2XTIA 1K0RA 2C35B 3A5UA 1UE1A 4DR2L 5BR8L 5C3EH 4HJAA 2R92H 2F52A 3S2DH 1NY4A 1YI2A 4RG1A 4C2MH 1VQBA 1VQ8A 2Q2UA 4JYAQ 2ASBA 4IFDJ 4JI0L 2K5VA 2RF4A 3RR5A 3VDYA 4A3EH 4A3JH 4X66L 3STBD 1IBKQ 2VZAA 4JI0Q 4DV6Q 2K75A 4JI8L 3HOXG 4DV1Q 3K8AA 2Y0SG 1Q12A 1J5EL 4DV6L 3GTPH 2LXKA 4Y7NH 4OO1G 3TS2A 4B3SQ 4DR1Q 3BJUA 2N8NA 2ZJPA 3FP9A 2BH2A 1HR0Q 5M5WH 3HKZG 1XJVA 1Z9FA 4DR1L 4IPHA 1VQIA 2UXCL 4WJ4A 4PG3A 3W5OA 1H95A 1VQNA 4QY7A 4A3DG 3G71A 1YHAA 4LWCA 1RL2A 4LF8L 3ULJA 1QVGA 2NVXH 4YY3Q 4JOIC 1MJCA 3KJPA 1VQDA 2ZM6L 5IYCG 5IYBH 1FL0A 2EQSA 5FJ8H 2ZM6Q 4HIOA 1XTDA 2JA9A 1EYGA 2JA5G 1QVFA 1VQOA 4BXXG 4B3ML 1M1KC 3S24A 1BBWA 4DR4Q 1XMQL 1JJGA 1HJPA 3CMEA 1X3FA 1KQSA 3RLFA 1AH9A 4YCVA 1Q82C 4P73A 2OQKA 1E22A 3S14H 4DR3L 1A8VA 5BR8Q 5C0XJ 2JJQA 4A3EG 1EOVA 1YHBA 3HOWH 5ELNA 1QVCA 2JA5H 1I50H 1KRSA 3CC4A 4JI4L 1CUKA 2MO0A 1X65A 3CCEA 1UE5A 4JBMA 3HOVH 3NENA 2OCEA 1Z47A 3PUXA 4PZ6A 3S15H 1P8LA 1K83H 4AH6A 1IBLQ 2L15A 1J5EQ 4BBSH 1KD1C 2JA7G 4DUZL 1YEZA 4Y52H 2RHSB 4A3IH 1IBLL 3I55A 2UXDL 3CC7A 2UUBQ 4LF6L 2OTLA 1BVSA 1HNZL 1EWIA 3MEFA 4GKKQ 4POGA 1E1TA 1VQFA 4A3BH 2Y0SE 4JV5Q 4A3MH 3CP0A 1HNZQ 3EIVA 4GKKL 4GN5A 3ICEA 1V1QA 1CKOA 2I5MX 2VUMG 1YJNA 3D31A 4X64L 1U5KA 1E3PA 1PVOA 3L0OA 1X54A 1V43A 3K81C 2UXBL 2R93G 3GTMH 4BBRH 5LMNL 2IX1A 2LXJA 1HZBA 5IYDH 1VQMA 3A0JA 2QGQA 1GVPA 3UE1A 4LF4L 4IFDI 1AE3A 2ALYB 2FXQA 1NJIC 5AJ3L 1LUZA 4LFBQ 3RLNA 4LFCQ 3KYHC 3M4QA 4IJLA 4DV4Q 4LF4Q 3TRZA 4GLAC 3M3YH 1YJ9A 4GNXA 1N34Q 3PGZA 4A3DH 1WYDA 4A76A 2DUDA 4LFCL 5GROA 3M9BA 1UWVA 5IYDG 1OXUA 4HJ7A 4HIMA 4JI7L 5JEAJ 4YCWA 3RN2A 3KF6A 4TQUS 1TWFH 2A8VA 3PO3G 2GVAA 1NE3A 3HKSA 4DUZQ 1K73C 1NMGA 2NZHA 4DV0Q 4LFAL 1KXLA 2R7ZH 2KENA 2R7DA 3WWVA 2Z0SA 5GAGC 4NXMQ 1HNWL 1PH5A 4JBWA 1EIYB 4OONA 4A3FG 1JJCB 2D62A 2ES2A 3H3VH 2A19A 1PV4A 3ULLA 1DGSA 2KHIA 3JC66 3CC2A 3DM3A 3F1ZA 1TWGH 1X3GA 4R1JA 1IZ6A 3I56A 3UDXA 3K80C 3RNUA 3CCQA 4EQ5A 3PUZA 3GDEA 1VQ5A 2CCZA 3CF5A 1QZGA 3S1NH 1CSQA 1N8RC 3CCVA 4JBJA 4NXNQ 1HNXQ 3CQZH 2IT1A 2UU9L 4LF9Q 3CPFA 2R7FA 4X65Q 1VQPA 1WJJA 3NELA 3M4PA 4LW1A 4IFDG 3PSIA 1XNRL 2HT1A 2AHOB 3I4OA 1YBYA 1I94L 2HHHL 5AJ3Q 2RCNA 2PI2E 4GLVB 4YWMA 5GADC 4LFBL 2MNAA 1XNRQ 3GTLH 1FGUA 4DV4L 3PF4A 2CKZB 2VL6A 1G51A 3S1RH 4JCVE 3RZDH 1P16A 4AQYL 2JA6H 1D8LA 1PH9A 4A3GG 2B29A 3UDFA 3CCMA 2A1AA 1PH6A 1QUQB 2LSSA 3NEMA 1PYBA 2QEXA 1VQCA 1OXSC 4POFA 2OWOA 1AE2A 1A0IA 1W3SA 2GN5A 4K0KQ 1Y1VG 3GTOH 1VQ9A 4R4QA 5EAYA 4NPSA 1HNWQ 4LF7L 4R4TA 5M3MG 4B3RQ 2VQFL 5JEAG 1YVCA 4JI1Q 4DV2L 4OWTB 5J3BA 1GD7A 2BA0A 3RZOH 1X56A 4QL5A 2JA8G 3S1QH 2I5LX 1GM5A 4JBKA 5M3FH 3U4ZA 1LTLA 5C44G 4JI6Q 3F2BA 1Y1VH 1ASZA 1PH4A 1MKHA 5HY6A 5IP7H 4AYBG 1GO3E 1I3QH 1B70B 2OQ0A 4JI6L 4MZ9A 3K0XA 4PZ8A 2HQLA 3PF5A 4NXNL 1CKMA 2H5XA 3FKIG 1M90C 3PIPA 1PA6A 4UY8C 3KFUA 1IYJB 4R4IA 4QJFA 1YHQA 4JYAL 1I5FA 3OTOL 4HJ9A 2Q2HA 4A3LG 1X3EA 4BBRG 2DGYA 3AFPA 4A93G 5M5YH 5E7NA 3U50C 2K4KA 2WP8J 5IYCH 5C4XG 3GTKH 4IO9A 4JI8Q 5FJ8G 3KDFA 4A3IG 3FKIH 3CCSA 1VQEA 1CKNA 1VS0A 1E7ZA 2QA4A 4HJ5A 2UUCQ 1XPOA 3T1HQ 2WAQE 1HR0W 1KIXA 3M7NA 1SN8A 1HR0L 2AMCB 4AIMA 1SROA 1YIJA 2ZTEA 5M3MH 1IL2A 5DLQE 3TREA 4DV7Q 4L5QA 4A3CH 4APVA 1EUJA 1XPRA 3J81c 1HH2P 1TXYA 2JA8H 4GKJQ 2B3GA 2KHJA 4DUYQ 4TVAB 1YITA 2KCTA 1JJ2A 2R93H 4OX9L 2F4VQ 3Q8DA 5C0XG 1XPUA 1C9OA 1N33L 1VQAA 3CMAA 3AYHB 4DAYB 3CCJA 3I7FA 4UP9A 4A75A 1N33Q 3GD7A 4DR6L 4B3MQ 3G4SA 1N32Q 4DR2Q 2ZTCA 1L0WA 4X62Q 2B63G 4EX5A 4XIGS 1RIPA 1VQLA 1IBML 4X62L 3BZCA 4DKAC 1UE7A 2I5HA 3OW2A 2CFMA 2KCMA 3W1BA 4LUZA 1IBMQ 3KLWA 3I2ZA 5FLXc 4YWLA 4A3KG 1TWHH 3B6YA 4IPDA 2IHEA 1E24A 1PH3A 1PH7A 3PIOA 5IT9c 4LUOA 5M3FG 4QQBX 1EIFA 3F8TA 3J7ZC 1PH1A 1PHJA 3HOVG 2UUCL 3FHWA 1E1OA 4GLXA 4DV1L 1SRUA 2WAQG 1EQRA 1YNXA 4QIWE 3T1YQ 2YTXA 3K7UC 3AEVA 4LF5Q 1FVIA 2UUBL 4LF6Q 1R9TH 4A3GH 3T1YL 5FLMG 2N78A 2NZOA 2VW9A 4L5SA 4IPGA 4LF5L 4R4CA 1VQGA 3HOXH 1Q1BA 3H0GH 4BXXH 1IXRA 2VQEL 2VY3A 1JB7A 2PI2A 4DV5Q 2UXCQ 2PQAB 4A93H 2VQEQ 4IPCA 4LF8Q 4DPGA 4DR7Q 4YY3L 3TS0A 3PO3H 1Q46A 5IP9G 3DLLA 1V9PA 1N36Q 2E5LQ 3HOYH 5JJKA 4JC0A 2K14A 3HOZG 3S16H 3H3VI 4OO1I 3KF8B 3KF6B 2NVTH 1NTGA 2E5LL 4P71A 2JEBI 2VS1A 1SE8A 2ZTDA 4UP7A 2K5HA 3A74A 2EXDA 1VQKA 1VQ6A 4DK3C 2NVYH 1XNQL 3CD6A 4BY7H 1Q7YC 1N34L 4GOPB 2Q2IA 4PMWA 4DR3Q 1YJWA 4P75A 4RMFA 3CXCA 1XNQQ 1K9MC 2EIFA 2N3SA 5GAEC 3HOYG 1G6PA 3E9HA 1WCMH 4X66Q 3UE0A 1IBKL 4BY1H 2D0OA 5K36G 2ID0A 1UE6A 4O0AA 3KJOA 2VNUD 3M85A 1OTCA 3J80i 1KAWA 2VUMH 2JE6I 1PH2A 4BA2I 2K5NA 4B3SL 3PO2H 1VQHA 2IHFA 2NVQH 2YYZA 1Q1EA 2CWPA 4JV5L 4JI2Q 2AWOA 3H0GG 1S40A 1MJEA 1WCMG 4BY1G 2ZJRA 1TWCH 4PZ7A 4J15A 2HIVA 3AQQA 3BU2A 4JI2L 2MO1A 1KL9A 1VQ4A 3I4MH 4BBSG 1Q86C 3G6EA 4ALPA 4O2DA 4GOPC 3F2CA 5GAHC 3CCLA 2XGTA 4IOCA 1QUQA 5LMNQ 1N9WA 1I6HH 2CQOA 1LYLA 2CWAA 2GVBA 1C0AA 1L1OC 4X64Q 1HZAA 3STBC 3F2DA 4WJ3M 4GNXC 3UDGA 3CCUA 3E9IA 1K8GA 4JG2A 4DR4L 5H1SE 4XTCS 3I4NG 2MFIA 4X6AH 2WB1G 4L5RC 1A62A 4JI3L 4LNQA 1Y1WG 2I0QA 3TEHB 2E2HH 4GS3A 2R7ZG 4JI7Q 3SGIA 3TQYA 4DV3Q 4A3FH 1T9HA 4JI4Q 5IP7G 1FJGL 4DV3L 1NBWA 4H02A 5LMUQ 3GTJH 2JA6G 5IYBG 4P74A 3S2HH 3EBEA 2E8GA 3U4VA 5LMUL 3GTGH 4GN4B 3EN2A 2KBNA 1Y14B 3S17H 1WI5A 4C3JH 3KOJA 3CPWA 2UXDQ 3RN5A 2WB1E 4B3RL 2WFWA 4LFAQ 4DAMA 3JAMi 4DV0L 4DV2Q 4NXML 5C4XH 3ULPA 1VCIA 1SR3A 2YV5A 4JI5L 1K8AC 3HOWG 1OXTA 1PH8A 1W2BA 5GQOA 3RLOA 1SFOH 4FDBA 4JI5Q 2B63H 1PFSA 3PV0A 4LF9L 4X65L 1JMCA 4YCUA 1XMOL 2UXBQ 4L5TA 3JAMc 3I4NH 2R6GA 2UUAQ 2IY5B 4A3JG 3PO2G 3H15A 4HIDA 4B3TL 2YU9H 3IRBA 2K52A 1B7YB 5HGQA 2UUAL 2OTJA 2JK8A 4DNIA 1OXVA 3PUWA 4A3BG 1KRTA 4JI3Q 4DK6C 1EFWA 1UEBA 1J6QA 1K3RA 4A3MG 1I94Q 1JE5A 2Q2TA 3I4MG 3PCOB 3L2PA 4P72A 1C7YA 1O7IA 1Q8KA 2V1CC 2ZJQA 5M5XH 1TWAH 3GO5A 3MXNB 5C4JH 3T1HL 4AQYQ 3CCRA 1X9NA 2E2JH 1FJGQ 3KDFB 2PNHA 3UDIA 4KHZA 3U58A 1SMXA 3CW2C 1Q81C 4LF7Q 5IE8A 1D7QA 2VQFQ 2Z6KA 3CAMA 4KI0A 1OXXK 1L1OA 4UPAA 3HOUG 2NN6I 4K0KL 1JT8A 4GNXB 3E0EA 4A4IA 1MIUA 4R4OA 3BZKA 1EQQA 1HZ9A 2N49A 2Z6KC 4JI1L 2K50A 5IWAL 4A3LH 2PMZE 1B8AA 4QGUA 3PUYA 4YHHQ 3GTQH 1A63A 5IWAQ 1LM0A 2BA1A 2YTYA 1QZHA 1S3OA 4UP8A 1X6OA 4AYBE 4HJ8A 3J7A5 3LGJA 2D0PA 2HIXA 1KHIA 1XMOQ 1HNXL 3OTOQ 4BY7G 1WOCA 4YWKA 4BA1I 4LUVA 5IY0A 3J81j 2UU9Q 4OWWB 1U0LA 1X55A 5C44H 4B3TQ 3ERSX 1L1OB 4HIKA 3S1MH 1HZCA 5JJLA 3G48A 2PQAA 4ME3A 5LMNW 2HHHQ 2F3IA 2AWNA 1GKHA 2YTVA 4C3HH 1G291 1YZ6A 5C0XI 3J81i 1VQ7A 2JA7H 1CKNB 3NBHB 2MQHA 4KHPL 3HKZE 1BKBA 3M4OH 4KLKA 1Y1WH 4GN3B 1VQJA 4MNOA 1NMFA 4KHPQ 2RHQB 1WFQA 3A5ZB 2ATWA 1SLJA 4DV7L 4IOAA 3HOUH 1CSPA 1L2FA 3ZJYC 4GKJL 4MTNA 3AFQA 1PYSB 5FLMH 3D0FA 1BBUA 2NN6G 3ER0A 4OXPA 4DV5L 4GOPA 2F4VL 1S72A 4OWXB 2JEAI 3PUVA 5JJIA 4JOIA 4DUYL 4DR7L 1KC8C 5C3EG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJH A;  2AKW B;  4NB3 A;  5ELO A;  3L7Z C;  4C3I H;  4OX9 Q;  2JQO A;  4YHH L;  1N36 L;  1N32 L;  4DR5 L;  2E2I H;  4A3C G;  3J80 c;  4A3K H;  2IX0 A;  5IP9 H;  1XMQ Q;  2R92 G;  4DR5 Q;  3W1G A;  3HOZ H;  3K7A H;  1ASY A;  2BH8 A;  3HFZ B;  4DR6 Q;  3OYY A;  2XTI A;  1K0R A;  2C35 B;  3A5U A;  1UE1 A;  4DR2 L;  5BR8 L;  5C3E H;  4HJA A;  2R92 H;  2F52 A;  3S2D H;  1NY4 A;  1YI2 A;  4RG1 A;  4C2M H;  1VQB A;  1VQ8 A;  2Q2U A;  4JYA Q;  2ASB A;  4IFD J;  4JI0 L;  2K5V A;  2RF4 A;  3RR5 A;  3VDY A;  4A3E H;  4A3J H;  4X66 L;  3STB D;  1IBK Q;  2VZA A;  4JI0 Q;  4DV6 Q;  2K75 A;  4JI8 L;  3HOX G;  4DV1 Q;  3K8A A;  2Y0S G;  1Q12 A;  1J5E L;  4DV6 L;  3GTP H;  2LXK A;  4Y7N H;  4OO1 G;  3TS2 A;  4B3S Q;  4DR1 Q;  3BJU A;  2N8N A;  2ZJP A;  3FP9 A;  2BH2 A;  1HR0 Q;  5M5W H;  3HKZ G;  1XJV A;  1Z9F A;  4DR1 L;  4IPH A;  1VQI A;  2UXC L;  4WJ4 A;  4PG3 A;  3W5O A;  1H95 A;  1VQN A;  4QY7 A;  4A3D G;  3G71 A;  1YHA A;  4LWC A;  1RL2 A;  4LF8 L;  3ULJ A;  1QVG A;  2NVX H;  4YY3 Q;  4JOI C;  1MJC A;  3KJP A;  1VQD A;  2ZM6 L;  5IYC G;  5IYB H;  1FL0 A;  2EQS A;  5FJ8 H;  2ZM6 Q;  4HIO A;  1XTD A;  2JA9 A;  1EYG A;  2JA5 G;  1QVF A;  1VQO A;  4BXX G;  4B3M L;  1M1K C;  3S24 A;  1BBW A;  4DR4 Q;  1XMQ L;  1JJG A;  1HJP A;  3CME A;  1X3F A;  1KQS A;  3RLF A;  1AH9 A;  4YCV A;  1Q82 C;  4P73 A;  2OQK A;  1E22 A;  3S14 H;  4DR3 L;  1A8V A;  5BR8 Q;  5C0X J;  2JJQ A;  4A3E G;  1EOV A;  1YHB A;  3HOW H;  5ELN A;  1QVC A;  2JA5 H;  1I50 H;  1KRS A;  3CC4 A;  4JI4 L;  1CUK A;  2MO0 A;  1X65 A;  3CCE A;  1UE5 A;  4JBM A;  3HOV H;  3NEN A;  2OCE A;  1Z47 A;  3PUX A;  4PZ6 A;  3S15 H;  1P8L A;  1K83 H;  4AH6 A;  1IBL Q;  2L15 A;  1J5E Q;  4BBS H;  1KD1 C;  2JA7 G;  4DUZ L;  1YEZ A;  4Y52 H;  2RHS B;  4A3I H;  1IBL L;  3I55 A;  2UXD L;  3CC7 A;  2UUB Q;  4LF6 L;  2OTL A;  1BVS A;  1HNZ L;  1EWI A;  3MEF A;  4GKK Q;  4POG A;  1E1T A;  1VQF A;  4A3B H;  2Y0S E;  4JV5 Q;  4A3M H;  3CP0 A;  1HNZ Q;  3EIV A;  4GKK L;  4GN5 A;  3ICE A;  1V1Q A;  1CKO A;  2I5M X;  2VUM G;  1YJN A;  3D31 A;  4X64 L;  1U5K A;  1E3P A;  1PVO A;  3L0O A;  1X54 A;  1V43 A;  3K81 C;  2UXB L;  2R93 G;  3GTM H;  4BBR H;  5LMN L;  2IX1 A;  2LXJ A;  1HZB A;  5IYD H;  1VQM A;  3A0J A;  2QGQ A;  1GVP A;  3UE1 A;  4LF4 L;  4IFD I;  1AE3 A;  2ALY B;  2FXQ A;  1NJI C;  5AJ3 L;  1LUZ A;  4LFB Q;  3RLN A;  4LFC Q;  3KYH C;  3M4Q A;  4IJL A;  4DV4 Q;  4LF4 Q;  3TRZ A;  4GLA C;  3M3Y H;  1YJ9 A;  4GNX A;  1N34 Q;  3PGZ A;  4A3D H;  1WYD A;  4A76 A;  2DUD A;  4LFC L;  5GRO A;  3M9B A;  1UWV A;  5IYD G;  1OXU A;  4HJ7 A;  4HIM A;  4JI7 L;  5JEA J;  4YCW A;  3RN2 A;  3KF6 A;  4TQU S;  1TWF H;  2A8V A;  3PO3 G;  2GVA A;  1NE3 A;  3HKS A;  4DUZ Q;  1K73 C;  1NMG A;  2NZH A;  4DV0 Q;  4LFA L;  1KXL A;  2R7Z H;  2KEN A;  2R7D A;  3WWV A;  2Z0S A;  5GAG C;  4NXM Q;  1HNW L;  1PH5 A;  4JBW A;  1EIY B;  4OON A;  4A3F G;  1JJC B;  2D62 A;  2ES2 A;  3H3V H;  2A19 A;  1PV4 A;  3ULL A;  1DGS A;  2KHI A;  3JC6 6;  3CC2 A;  3DM3 A;  3F1Z A;  1TWG H;  1X3G A;  4R1J A;  1IZ6 A;  3I56 A;  3UDX A;  3K80 C;  3RNU A;  3CCQ A;  4EQ5 A;  3PUZ A;  3GDE A;  1VQ5 A;  2CCZ A;  3CF5 A;  1QZG A;  3S1N H;  1CSQ A;  1N8R C;  3CCV A;  4JBJ A;  4NXN Q;  1HNX Q;  3CQZ H;  2IT1 A;  2UU9 L;  4LF9 Q;  3CPF A;  2R7F A;  4X65 Q;  1VQP A;  1WJJ A;  3NEL A;  3M4P A;  4LW1 A;  4IFD G;  3PSI A;  1XNR L;  2HT1 A;  2AHO B;  3I4O A;  1YBY A;  1I94 L;  2HHH L;  5AJ3 Q;  2RCN A;  2PI2 E;  4GLV B;  4YWM A;  5GAD C;  4LFB L;  2MNA A;  1XNR Q;  3GTL H;  1FGU A;  4DV4 L;  3PF4 A;  2CKZ B;  2VL6 A;  1G51 A;  3S1R H;  4JCV E;  3RZD H;  1P16 A;  4AQY L;  2JA6 H;  1D8L A;  1PH9 A;  4A3G G;  2B29 A;  3UDF A;  3CCM A;  2A1A A;  1PH6 A;  1QUQ B;  2LSS A;  3NEM A;  1PYB A;  2QEX A;  1VQC A;  1OXS C;  4POF A;  2OWO A;  1AE2 A;  1A0I A;  1W3S A;  2GN5 A;  4K0K Q;  1Y1V G;  3GTO H;  1VQ9 A;  4R4Q A;  5EAY A;  4NPS A;  1HNW Q;  4LF7 L;  4R4T A;  5M3M G;  4B3R Q;  2VQF L;  5JEA G;  1YVC A;  4JI1 Q;  4DV2 L;  4OWT B;  5J3B A;  1GD7 A;  2BA0 A;  3RZO H;  1X56 A;  4QL5 A;  2JA8 G;  3S1Q H;  2I5L X;  1GM5 A;  4JBK A;  5M3F H;  3U4Z A;  1LTL A;  5C44 G;  4JI6 Q;  3F2B A;  1Y1V H;  1ASZ A;  1PH4 A;  1MKH A;  5HY6 A;  5IP7 H;  4AYB G;  1GO3 E;  1I3Q H;  1B70 B;  2OQ0 A;  4JI6 L;  4MZ9 A;  3K0X A;  4PZ8 A;  2HQL A;  3PF5 A;  4NXN L;  1CKM A;  2H5X A;  3FKI G;  1M90 C;  3PIP A;  1PA6 A;  4UY8 C;  3KFU A;  1IYJ B;  4R4I A;  4QJF A;  1YHQ A;  4JYA L;  1I5F A;  3OTO L;  4HJ9 A;  2Q2H A;  4A3L G;  1X3E A;  4BBR G;  2DGY A;  3AFP A;  4A93 G;  5M5Y H;  5E7N A;  3U50 C;  2K4K A;  2WP8 J;  5IYC H;  5C4X G;  3GTK H;  4IO9 A;  4JI8 Q;  5FJ8 G;  3KDF A;  4A3I G;  3FKI H;  3CCS A;  1VQE A;  1CKN A;  1VS0 A;  1E7Z A;  2QA4 A;  4HJ5 A;  2UUC Q;  1XPO A;  3T1H Q;  2WAQ E;  1HR0 W;  1KIX A;  3M7N A;  1SN8 A;  1HR0 L;  2AMC B;  4AIM A;  1SRO A;  1YIJ A;  2ZTE A;  5M3M H;  1IL2 A;  5DLQ E;  3TRE A;  4DV7 Q;  4L5Q A;  4A3C H;  4APV A;  1EUJ A;  1XPR A;  3J81 c;  1HH2 P;  1TXY A;  2JA8 H;  4GKJ Q;  2B3G A;  2KHJ A;  4DUY Q;  4TVA B;  1YIT A;  2KCT A;  1JJ2 A;  2R93 H;  4OX9 L;  2F4V Q;  3Q8D A;  5C0X G;  1XPU A;  1C9O A;  1N33 L;  1VQA A;  3CMA A;  3AYH B;  4DAY B;  3CCJ A;  3I7F A;  4UP9 A;  4A75 A;  1N33 Q;  3GD7 A;  4DR6 L;  4B3M Q;  3G4S A;  1N32 Q;  4DR2 Q;  2ZTC A;  1L0W A;  4X62 Q;  2B63 G;  4EX5 A;  4XIG S;  1RIP A;  1VQL A;  1IBM L;  4X62 L;  3BZC A;  4DKA C;  1UE7 A;  2I5H A;  3OW2 A;  2CFM A;  2KCM A;  3W1B A;  4LUZ A;  1IBM Q;  3KLW A;  3I2Z A;  5FLX c;  4YWL A;  4A3K G;  1TWH H;  3B6Y A;  4IPD A;  2IHE A;  1E24 A;  1PH3 A;  1PH7 A;  3PIO A;  5IT9 c;  4LUO A;  5M3F G;  4QQB X;  1EIF A;  3F8T A;  3J7Z C;  1PH1 A;  1PHJ A;  3HOV G;  2UUC L;  3FHW A;  1E1O A;  4GLX A;  4DV1 L;  1SRU A;  2WAQ G;  1EQR A;  1YNX A;  4QIW E;  3T1Y Q;  2YTX A;  3K7U C;  3AEV A;  4LF5 Q;  1FVI A;  2UUB L;  4LF6 Q;  1R9T H;  4A3G H;  3T1Y L;  5FLM G;  2N78 A;  2NZO A;  2VW9 A;  4L5S A;  4IPG A;  4LF5 L;  4R4C A;  1VQG A;  3HOX H;  1Q1B A;  3H0G H;  4BXX H;  1IXR A;  2VQE L;  2VY3 A;  1JB7 A;  2PI2 A;  4DV5 Q;  2UXC Q;  2PQA B;  4A93 H;  2VQE Q;  4IPC A;  4LF8 Q;  4DPG A;  4DR7 Q;  4YY3 L;  3TS0 A;  3PO3 H;  1Q46 A;  5IP9 G;  3DLL A;  1V9P A;  1N36 Q;  2E5L Q;  3HOY H;  5JJK A;  4JC0 A;  2K14 A;  3HOZ G;  3S16 H;  3H3V I;  4OO1 I;  3KF8 B;  3KF6 B;  2NVT H;  1NTG A;  2E5L L;  4P71 A;  2JEB I;  2VS1 A;  1SE8 A;  2ZTD A;  4UP7 A;  2K5H A;  3A74 A;  2EXD A;  1VQK A;  1VQ6 A;  4DK3 C;  2NVY H;  1XNQ L;  3CD6 A;  4BY7 H;  1Q7Y C;  1N34 L;  4GOP B;  2Q2I A;  4PMW A;  4DR3 Q;  1YJW A;  4P75 A;  4RMF A;  3CXC A;  1XNQ Q;  1K9M C;  2EIF A;  2N3S A;  5GAE C;  3HOY G;  1G6P A;  3E9H A;  1WCM H;  4X66 Q;  3UE0 A;  1IBK L;  4BY1 H;  2D0O A;  5K36 G;  2ID0 A;  1UE6 A;  4O0A A;  3KJO A;  2VNU D;  3M85 A;  1OTC A;  3J80 i;  1KAW A;  2VUM H;  2JE6 I;  1PH2 A;  4BA2 I;  2K5N A;  4B3S L;  3PO2 H;  1VQH A;  2IHF A;  2NVQ H;  2YYZ A;  1Q1E A;  2CWP A;  4JV5 L;  4JI2 Q;  2AWO A;  3H0G G;  1S40 A;  1MJE A;  1WCM G;  4BY1 G;  2ZJR A;  1TWC H;  4PZ7 A;  4J15 A;  2HIV A;  3AQQ A;  3BU2 A;  4JI2 L;  2MO1 A;  1KL9 A;  1VQ4 A;  3I4M H;  4BBS G;  1Q86 C;  3G6E A;  4ALP A;  4O2D A;  4GOP C;  3F2C A;  5GAH C;  3CCL A;  2XGT A;  4IOC A;  1QUQ A;  5LMN Q;  1N9W A;  1I6H H;  2CQO A;  1LYL A;  2CWA A;  2GVB A;  1C0A A;  1L1O C;  4X64 Q;  1HZA A;  3STB C;  3F2D A;  4WJ3 M;  4GNX C;  3UDG A;  3CCU A;  3E9I A;  1K8G A;  4JG2 A;  4DR4 L;  5H1S E;  4XTC S;  3I4N G;  2MFI A;  4X6A H;  2WB1 G;  4L5R C;  1A62 A;  4JI3 L;  4LNQ A;  1Y1W G;  2I0Q A;  3TEH B;  2E2H H;  4GS3 A;  2R7Z G;  4JI7 Q;  3SGI A;  3TQY A;  4DV3 Q;  4A3F H;  1T9H A;  4JI4 Q;  5IP7 G;  1FJG L;  4DV3 L;  1NBW A;  4H02 A;  5LMU Q;  3GTJ H;  2JA6 G;  5IYB G;  4P74 A;  3S2H H;  3EBE A;  2E8G A;  3U4V A;  5LMU L;  3GTG H;  4GN4 B;  3EN2 A;  2KBN A;  1Y14 B;  3S17 H;  1WI5 A;  4C3J H;  3KOJ A;  3CPW A;  2UXD Q;  3RN5 A;  2WB1 E;  4B3R L;  2WFW A;  4LFA Q;  4DAM A;  3JAM i;  4DV0 L;  4DV2 Q;  4NXM L;  5C4X H;  3ULP A;  1VCI A;  1SR3 A;  2YV5 A;  4JI5 L;  1K8A C;  3HOW G;  1OXT A;  1PH8 A;  1W2B A;  5GQO A;  3RLO A;  1SFO H;  4FDB A;  4JI5 Q;  2B63 H;  1PFS A;  3PV0 A;  4LF9 L;  4X65 L;  1JMC A;  4YCU A;  1XMO L;  2UXB Q;  4L5T A;  3JAM c;  3I4N H;  2R6G A;  2UUA Q;  2IY5 B;  4A3J G;  3PO2 G;  3H15 A;  4HID A;  4B3T L;  2YU9 H;  3IRB A;  2K52 A;  1B7Y B;  5HGQ A;  2UUA L;  2OTJ A;  2JK8 A;  4DNI A;  1OXV A;  3PUW A;  4A3B G;  1KRT A;  4JI3 Q;  4DK6 C;  1EFW A;  1UEB A;  1J6Q A;  1K3R A;  4A3M G;  1I94 Q;  1JE5 A;  2Q2T A;  3I4M G;  3PCO B;  3L2P A;  4P72 A;  1C7Y A;  1O7I A;  1Q8K A;  2V1C C;  2ZJQ A;  5M5X H;  1TWA H;  3GO5 A;  3MXN B;  5C4J H;  3T1H L;  4AQY Q;  3CCR A;  1X9N A;  2E2J H;  1FJG Q;  3KDF B;  2PNH A;  3UDI A;  4KHZ A;  3U58 A;  1SMX A;  3CW2 C;  1Q81 C;  4LF7 Q;  5IE8 A;  1D7Q A;  2VQF Q;  2Z6K A;  3CAM A;  4KI0 A;  1OXX K;  1L1O A;  4UPA A;  3HOU G;  2NN6 I;  4K0K L;  1JT8 A;  4GNX B;  3E0E A;  4A4I A;  1MIU A;  4R4O A;  3BZK A;  1EQQ A;  1HZ9 A;  2N49 A;  2Z6K C;  4JI1 L;  2K50 A;  5IWA L;  4A3L H;  2PMZ E;  1B8A A;  4QGU A;  3PUY A;  4YHH Q;  3GTQ H;  1A63 A;  5IWA Q;  1LM0 A;  2BA1 A;  2YTY A;  1QZH A;  1S3O A;  4UP8 A;  1X6O A;  4AYB E;  4HJ8 A;  3J7A 5;  3LGJ A;  2D0P A;  2HIX A;  1KHI A;  1XMO Q;  1HNX L;  3OTO Q;  4BY7 G;  1WOC A;  4YWK A;  4BA1 I;  4LUV A;  5IY0 A;  3J81 j;  2UU9 Q;  4OWW B;  1U0L A;  1X55 A;  5C44 H;  4B3T Q;  3ERS X;  1L1O B;  4HIK A;  3S1M H;  1HZC A;  5JJL A;  3G48 A;  2PQA A;  4ME3 A;  5LMN W;  2HHH Q;  2F3I A;  2AWN A;  1GKH A;  2YTV A;  4C3H H;  1G29 1;  1YZ6 A;  5C0X I;  3J81 i;  1VQ7 A;  2JA7 H;  1CKN B;  3NBH B;  2MQH A;  4KHP L;  3HKZ E;  1BKB A;  3M4O H;  4KLK A;  1Y1W H;  4GN3 B;  1VQJ A;  4MNO A;  1NMF A;  4KHP Q;  2RHQ B;  1WFQ A;  3A5Z B;  2ATW A;  1SLJ A;  4DV7 L;  4IOA A;  3HOU H;  1CSP A;  1L2F A;  3ZJY C;  4GKJ L;  4MTN A;  3AFQ A;  1PYS B;  5FLM H;  3D0F A;  1BBU A;  2NN6 G;  3ER0 A;  4OXP A;  4DV5 L;  4GOP A;  2F4V L;  1S72 A;  4OWX B;  2JEA I;  3PUV A;  5JJI A;  4JOI A;  4DUY L;  4DR7 L;  1KC8 C;  5C3E G; 
#chains in the Genus database with same CATH topology
 3DM1 A;  4KY6 A;  5ELO A;  4C3I H;  5IIF A;  3L7Z C;  3FRP B;  1N32 L;  2JQO A;  2PMZ B;  4RGO S;  3KLS X;  4QB4 A;  3VYT A;  4H0L C;  3A7A B;  3LWE A;  3M4O B;  4HCE A;  4DR6 Q;  4A93 B;  1K0R A;  3TP7 A;  3A5U A;  1M4V A;  5C3E H;  1I4H A;  1YI2 A;  4RG1 A;  1VQ8 A;  1VQB A;  2F0K A;  1YNN C;  4JI0 L;  3HGB A;  3RR5 A;  2Z8L A;  2E2J B;  2HCC A;  3VDY A;  1JWU D;  4A3E H;  5G3L F;  3GQB A;  4JI0 Q;  2NVT B;  4JI8 L;  3HOX G;  4QCL A;  3Q24 A;  2Y0S G;  1F2Y A;  1Q12 A;  1J5E L;  2LXK A;  4OO1 G;  4IUR A;  4B3S Q;  2N8N A;  3S1Q B;  1RD9 D;  1XJV A;  3PMF A;  4DR1 L;  4IPH A;  5C4H A;  4G7H C;  4WJ4 A;  4PG3 A;  4A3D G;  3G71 A;  1I3Q B;  3ZYY X;  4FF2 A;  1DOK A;  1B44 D;  2QEJ C;  4OEL B;  3DWA A;  2EQS A;  2QDL A;  4HIO A;  2JA9 A;  1QVF A;  1M1K C;  1HJP A;  5M5Y B;  1AH9 A;  1HHV A;  4C3H B;  1E2V A;  4P73 A;  1BBX C;  5D65 A;  4DR3 L;  3Q22 A;  2JJQ A;  1JQY D;  1AN8 A;  4ODG A;  3KBX A;  5ELN A;  2JA5 H;  1I50 H;  1VMP A;  4PZ6 A;  1O7Z A;  2E74 C;  2JA7 G;  1SEB D;  2DNE A;  4RH6 A;  1IBL L;  2UXD L;  2UUB Q;  4ZUJ A;  1BVS A;  4POG A;  1E1T A;  3VYR A;  2Y0S E;  1NUC A;  4ME5 A;  1WTV A;  3D31 A;  3H6M A;  4X64 L;  1KDA A;  4ZLT F;  1CQV A;  2HQE A;  3K81 C;  1FNV A;  2CH4 A;  1SNC A;  5CR3 A;  1Z6H A;  1A2U A;  2F1M A;  1O80 A;  1AE3 A;  1GUS A;  2EYM A;  3M4Q A;  4LF4 Q;  4KKT A;  4EQP A;  3M3Y H;  1EY7 A;  3PGZ A;  3M9B A;  4HJ7 A;  2A74 C;  1TWC B;  3MA2 B;  4JI7 L;  5D3I B;  2EJF C;  2A8V A;  2GVA A;  1NE3 A;  1NMG A;  4DV0 Q;  4LFA L;  4LK1 C;  3FMC A;  2ICE C;  3WWV A;  4IUU A;  4X3T A;  4NXM Q;  4OON A;  3DWP A;  2L9H A;  5C4J B;  3JC6 6;  2F0E A;  1ESF A;  1LTI D;  4IFD H;  1I4P A;  4R1J A;  1UNS A;  1IZ6 A;  3RNU A;  4EQ5 A;  3GDE A;  3SVM A;  3G6J B;  2L1B A;  4JBJ A;  4NXN Q;  3T16 A;  2UU9 L;  3RZO B;  1TII D;  2R7F A;  5A2Q L;  4KD3 A;  4LW1 A;  4OGQ C;  4I65 A;  2R7Z B;  2CH4 W;  2F0G A;  1TS5 A;  1T5X D;  4KD4 A;  1D8L A;  3E0J A;  1SJH D;  3A56 A;  4IUT A;  2M9V A;  3NEM A;  2QEX A;  1VQC A;  2OWO A;  1A0I A;  2K5D A;  3MHB A;  5FK9 C;  3GTO H;  2E2D C;  1RCV D;  3VA7 A;  2NYZ D;  4HN7 A;  3IFD A;  4LF7 L;  4UHV A;  1YVC A;  4DV2 L;  2RCF A;  3LWU A;  5DM6 3;  5J3B A;  1E2W A;  1EYA A;  1GD7 A;  2JA8 G;  2I5L X;  1F77 A;  4LJZ C;  3U4Z A;  1LTL A;  1UUP A;  3DHQ A;  4L8J A;  1EY5 A;  1RHP A;  1I3Q H;  2OQ0 A;  3PF5 A;  4RHS A;  3PIP A;  2H1E A;  3OWE B;  4R4I A;  1DXM A;  2D9U A;  4QJF A;  1ET9 A;  5IGE A;  3OTO L;  1RKN A;  4H7B A;  1BR9 A;  3AFP A;  4K5X A;  1EIH A;  2WP8 J;  3EJI A;  5IYC H;  2KHS A;  4IO9 A;  1DOL A;  4F8M A;  4A3I G;  3NHH A;  2F3V A;  4HJ5 A;  1VQE A;  2UUC Q;  2DJF C;  3AU7 A;  3EVQ A;  2EPB A;  1CFM A;  5I6W A;  3D4D A;  2AMC B;  2TMP A;  4AIM A;  2B2U A;  5M3M H;  3TRE A;  3NTI A;  4A3C H;  4APV A;  4CJ1 B;  1EUJ A;  1HQM C;  3J81 c;  1VMC A;  3EA6 A;  2JA8 H;  3QG1 A;  4TVA B;  4Y7N B;  1JJ2 A;  2R93 H;  1VDZ A;  1KNA A;  2F4V Q;  4WJW A;  2X6L A;  4OIJ A;  2JSO A;  2NZ1 D;  3GD7 A;  1J8I A;  2ZTC A;  3EQL C;  5FKA C;  4XIG S;  4RGM A;  1VQL A;  1IBM L;  2A68 C;  4R8I A;  3KLW A;  4MN3 A;  4XQN A;  1T5E A;  1PFB A;  3DEO A;  1EQT A;  1PH7 A;  5IT9 c;  3PIO 3;  4PQX A;  5KNC A;  3J7Z C;  3HOV G;  1E1O A;  1STE A;  4GLX A;  4DV1 L;  1SRU A;  2OF1 A;  1IKL A;  3K7U C;  2EYF A;  2UUB L;  4C3I B;  1R9T H;  2A6E C;  2G9D A;  2N78 A;  2VW9 A;  1TY0 A;  1IXR A;  4DNR B;  1BQQ T;  4C3J B;  2K1B A;  2VQE Q;  4LF8 Q;  2Z1C A;  3BVM A;  2C9O A;  4DAV A;  3HRZ C;  4KMU C;  5IP9 G;  3DLL A;  4FVM A;  2E5L Q;  4JC0 A;  3HOZ G;  3D6W A;  2PZT A;  3KF6 B;  1A15 A;  1D1K A;  2KUM A;  2VS1 A;  2K5H A;  1VQK A;  1U9R A;  1MSH A;  1QIL A;  4DR3 Q;  4P75 A;  4RMF A;  1G6P A;  3C1E A;  4U68 A;  4BY1 H;  3UE0 A;  2ID0 A;  1UE6 A;  4O0A A;  3U9O A;  2VNU D;  1LV9 A;  1KAW A;  3PO2 H;  1VQH A;  3MXN A;  2YYZ A;  2CW0 D;  3SXH A;  4A3D B;  1C48 A;  3H0G G;  1S40 A;  1ICF B;  2DN8 A;  3M4Y A;  3I90 A;  4BWG B;  2HIV A;  5DM7 3;  3AQQ A;  4JI2 L;  3A8I E;  1VQ4 A;  2SEB D;  1Q86 C;  1EYC A;  3G6E A;  4OHJ A;  4DN4 M;  5LMN Q;  1N9W A;  1I6H H;  5J1Z A;  2EXZ A;  3STB C;  4WJ3 M;  4GNX C;  2K33 A;  1K8G A;  4DR4 L;  1EWC A;  5IGB A;  3GP7 A;  1SYF A;  2TSS A;  3H94 A;  3BYT B;  1G6Z A;  2RSO A;  1T9H A;  4JI4 Q;  3I72 A;  4A3G B;  5LMU Q;  1DOM A;  4P74 A;  3K5N A;  3EBE A;  3MEH A;  5LMU L;  5ELF A;  1Y14 B;  3J81 E;  1WI5 A;  1SJE D;  2PQE A;  3CPW A;  2Z4I A;  3R93 A;  3VYS A;  4DV2 Q;  4FF3 A;  2WKD A;  4UDU C;  1SBB B;  1SR3 A;  2YV5 A;  4JI5 L;  4RKL A;  1D5X C;  3NK9 A;  1BDO A;  1A3V A;  4X3S A;  5GQO A;  1PMR A;  5I2Y A;  3LX0 A;  1JMC A;  2DY8 A;  1CA5 A;  4XDX A;  2MGS A;  1FYC A;  2K52 A;  1B7Y B;  4OEM B;  4NW2 A;  5HGQ A;  3HP3 A;  4RAU C;  4A3B G;  1KRT A;  1EFW A;  2PNR C;  4CDD C;  1LTA D;  1I94 Q;  1JE5 A;  1ENC A;  3I4M G;  3S2D B;  3TN2 A;  4WRD A;  4HAE A;  1SNQ A;  3T1H L;  2WIN B;  4A3B B;  2G9H D;  5CV9 A;  1Q81 C;  2PO4 A;  4CGY B;  5IE8 A;  1D7Q A;  2Z6K A;  4KI0 A;  1QCB D;  1L1O A;  3HOU G;  1JT8 A;  1BOS A;  4CKC A;  1R9T B;  1HZ9 A;  4JI1 L;  1A3T A;  1A3U A;  4R8N A;  1B8A A;  3PUY A;  4YHH Q;  2KJX A;  5IWA Q;  1LM0 A;  2BA1 A;  3D6C A;  4RCN A;  4HJ8 A;  2KEE A;  2HIX A;  4BY7 G;  3OTO Q;  5IY0 A;  4BA1 I;  2UU9 Q;  5C5M A;  4H13 C;  4JVZ A;  1E0B A;  4FNF A;  2MP1 A;  5COR A;  4B3T Q;  4DAY A;  3ERS X;  3FDT A;  3SE0 A;  1HZC A;  2VB3 X;  3A7L A;  2HHH Q;  4A3K B;  1GKH A;  3NTH A;  4C3H H;  1VQ7 A;  3NBH B;  4KHP L;  4CBV A;  3DWQ A;  5CV8 A;  3BDL A;  1ZXT A;  2XRQ D;  5C0X H;  1EYD A;  5T1G A;  4KN7 C;  1CSP A;  3HOU H;  1S5D D;  1F2L A;  3HS0 C;  4B9X A;  5LL6 X;  3PUV A;  2SNS A;  2Z6B A;  4DR7 L;  2R92 G;  3NE5 B;  2F4I A;  3PIP 3;  3S1M B;  4NB3 A;  2AQ2 B;  2E2I H;  2BDN A;  3X3N A;  4A3C G;  3J80 c;  1D2B A;  1ZEQ X;  3OYY A;  2XTI A;  2C35 B;  3NWT A;  1UE1 A;  2EY2 A;  4DR2 L;  5BR8 L;  5JVG 3;  1NY4 A;  4IFD J;  4ZK9 B;  2ASB A;  3KK7 A;  1SMY C;  3STB D;  2Q8R E;  1SNM A;  2VZA A;  4DV6 Q;  2F0Q A;  4DV1 Q;  3G7L A;  3GTO B;  2ENB A;  1XWE A;  3VYU A;  4DV6 L;  1B9N A;  3GTP H;  4Y7N H;  1EQV A;  3SK8 A;  4DR1 Q;  3FP9 A;  1Z9F A;  5FLX E;  4BY1 B;  1VQI A;  4XYO A;  2UXC L;  3W5O A;  1SSO A;  4QY7 A;  1B9M A;  3TP8 A;  4LWC A;  1RL2 A;  4LF8 L;  1PTO F;  1YNN D;  4TSS A;  4KKU A;  5IYB H;  5FLX L;  1QJO A;  5FJ8 H;  3KLS A;  2ZM6 Q;  4UAI A;  1FD7 D;  1BUV T;  1XTD A;  2F3W A;  2FHT A;  2JA5 G;  1STN A;  1TWG B;  3MVV A;  3K58 A;  3T4A C;  3S24 A;  1B3A A;  3CME A;  1X3F A;  2QW7 A;  3RLF A;  3U9S A;  1KQS A;  2BCO A;  2WII B;  1E22 A;  3S14 H;  3S1N B;  1EOV A;  2QIL A;  3MXG A;  3I4N B;  4K8I A;  3D4W A;  1D1I A;  5IGG A;  4JI4 L;  3CCE A;  4JBM A;  3HOV H;  1RDP D;  1TS2 A;  3BDO A;  3S15 H;  1IBL Q;  2L15 A;  2WAQ B;  3K57 A;  2RHS B;  2IX3 A;  3A8J E;  2OTL A;  1TS4 A;  3MEF A;  2EVB A;  4GKK Q;  3L9A X;  4C3J G;  4A3M H;  1H9S B;  2XN9 C;  3CP0 A;  4GKK L;  2XWB B;  1V1Q A;  1D5Z C;  1AW7 A;  1O7Y A;  1YJN A;  3NBH A;  1NCV A;  1E3P A;  3L0O A;  1X54 A;  2B2Y A;  1U4L A;  2IX1 A;  3OSO A;  1HZB A;  4O1N A;  1VQM A;  3A0J A;  2O5J C;  3UE1 A;  4K5V A;  2ALY B;  1NJI C;  1YNJ C;  2JYO A;  2ZXP A;  4E6I A;  4LFB Q;  3TRZ A;  5I4D A;  3N52 A;  1WYD A;  3P7J A;  4M1U B;  4A76 A;  5IYD G;  3PQI A;  5C5L A;  4FF4 A;  3N6R A;  1F9R A;  5JEA J;  3RN2 A;  1F2Z A;  2MPM A;  2ICI A;  2LMC B;  1X3P A;  2SNM A;  2NZH A;  4R9W A;  1BCP D;  5K5P A;  2R7D A;  1HNW L;  2Z0S A;  2MUY A;  1TVX A;  1PH5 A;  1EIY B;  1JJC B;  3H3V H;  4OO1 H;  1ROD A;  1TWA B;  1PXU A;  1SYB A;  3A55 A;  3CCQ A;  3CF5 A;  1BCP C;  2AQ1 B;  1QZG A;  3S1N H;  1CSQ A;  1N8R C;  1X3Q A;  1HNX Q;  3CQZ H;  1SNP A;  3CPF A;  3P75 A;  1WJJ A;  3M4P A;  4DA2 A;  2MJ8 A;  2AHO B;  1QWY A;  2HHH L;  1I94 L;  5GAD C;  4LFB L;  3GTL H;  4DV4 L;  2O2L D;  2VL6 A;  3RZD H;  1FGB D;  4AQY L;  4EVO A;  2JA6 H;  1SYE A;  2EDG A;  2A1A A;  3FPP A;  2LSS A;  5BN5 A;  4JW0 A;  4H44 C;  1VQ9 A;  2B2V C;  4R4Q A;  5EAY A;  4NPS A;  5M3M G;  4V0B A;  4B3R Q;  2VQF L;  1PRT C;  1K3B C;  4RFB A;  4DGZ A;  1I4R A;  3S1Q H;  3K59 A;  1GM5 A;  5M3F H;  4EGV A;  1Y1V H;  4U67 3;  2F0U A;  1ASZ A;  1EZ6 A;  4KHV A;  1F9S A;  1MKH A;  1NAP A;  5HY6 A;  4AYB G;  1STY A;  2NVX B;  3VA5 A;  4DNT B;  4HSV A;  4PZ8 A;  5J22 A;  4NXN L;  1CTM A;  4OIK A;  3FKI G;  2ZXO A;  4UY8 C;  5C4Z A;  4K8J A;  2R93 B;  1IL8 A;  2L4N A;  2EE1 A;  3S16 B;  3BYY B;  2DGY A;  2F0D A;  1SYD A;  5E7N A;  3U50 C;  1WTW A;  3C46 A;  1A6X A;  3KDF A;  3CCS A;  5FO8 B;  4X3K A;  3T1H Q;  1SN8 A;  5IT9 L;  3I3C A;  1YIJ A;  1VF7 A;  2ZTE A;  1IL2 A;  5DLQ E;  5KYL A;  4DV7 Q;  1HH2 P;  1TXY A;  4GKJ Q;  3R3O A;  4K6L A;  1PTO B;  2KCT A;  4OX9 L;  2OT2 A;  3TME A;  5C0X G;  1VQA A;  3ITP A;  2A69 C;  3AYH B;  4ILW A;  4DAY B;  3I7F A;  4FP5 D;  4UP9 A;  1N33 Q;  5I9P A;  3G4S A;  1N32 Q;  1L0W A;  2XIW A;  2LY7 A;  4XT3 B;  2B63 G;  1RIP A;  2MHV A;  4DKA C;  2I5H A;  1M8A A;  1SE2 A;  2KCM A;  4C3H G;  3O13 A;  3W1B A;  1LT3 D;  3B6Y A;  4IPD A;  1PH3 A;  4L6T B;  3PIO A;  4LUO A;  5M3F G;  5I6Y A;  1KTK A;  1PHJ A;  3S14 B;  3UI2 A;  1S4Z A;  1EY4 A;  1Z7T A;  3AB9 A;  2WAQ G;  2NVY B;  3AEV A;  4LF5 Q;  1FVI A;  4XT1 B;  1HCZ A;  1ILQ A;  5M3F B;  1VQG A;  3H0G H;  2VQE L;  4N8F A;  4G7Z C;  2PI2 A;  3MC0 B;  1Q46 A;  1R4Q B;  1V9P A;  1N36 Q;  4ZAI A;  3S16 H;  5G3L D;  3MAQ A;  1NTG A;  3OMG A;  1V8Q A;  2EYL A;  1EU3 A;  2JEB I;  2ZTD A;  3GTP B;  2EXD A;  1XNQ L;  3FKI B;  3TZU A;  1YJW A;  2A6H D;  3HOY G;  3K6O A;  1GUG A;  2N3S A;  4BBR B;  5GAE C;  3E9H A;  3NSW A;  3HOX B;  2A5H A;  3M85 A;  1OTC A;  2PW7 A;  4B3S L;  5COY A;  2NVQ H;  1HXY D;  2PPB C;  3PO3 B;  3HKZ B;  2I46 A;  2K7V A;  4MIU A;  4JI2 Q;  1WCM G;  1WTH A;  2QKI C;  4O42 A;  3GTJ B;  1EEI D;  1KL9 A;  3I4M H;  4BBS G;  2QCP X;  1HA6 A;  2LFN A;  4O2D A;  5GAH C;  2XGT A;  4IOC A;  3NQT A;  1LYL A;  2GVB A;  2VB2 X;  1L1O C;  5EBC A;  4X64 Q;  2B2V A;  3F2D A;  3CCU A;  5CBA E;  5H1S E;  3KLR A;  4QMG A;  2CW0 C;  2WB1 G;  1A62 A;  3QOL A;  2I0Q A;  3C3L A;  4GS3 A;  3X3M A;  2J0T D;  1O78 A;  1SYC A;  3IFT A;  4A3F H;  1I4X A;  2L11 A;  1NBW A;  2DNC A;  4H02 A;  3MXU A;  2E8G A;  3W3A A;  3EN2 A;  2JN4 A;  3RN5 A;  2WB1 E;  4B3R L;  2IL8 A;  5E4W C;  4NXM L;  1U4R A;  1XX8 A;  3HOW G;  1PH8 A;  4EQN A;  1I6V C;  3SK4 A;  1PTO H;  3CKI B;  1STH A;  4X65 L;  2UXB Q;  4RKB A;  2FJ2 A;  3HOW B;  2UUA Q;  4HID A;  4B3T L;  3S2H B;  1MD2 D;  2UUA L;  3PUW A;  1JOR A;  1UEB A;  1BNZ A;  3HZX A;  1U4M A;  2L12 A;  2Q2T A;  4DF7 A;  3L2P A;  3VR2 A;  5M5X H;  1TWA H;  3MXN B;  1FJG Q;  4ZUI A;  3CCR A;  5E4X A;  2PNH A;  3UDI A;  3CW2 C;  1BF4 A;  2RDH A;  4UPA A;  4K0K L;  2NN6 I;  4RWS C;  2K32 A;  1Q90 A;  1CZG A;  3CU7 A;  1EQQ A;  2K50 A;  2PMZ E;  2HUG A;  3GTQ H;  3A8K E;  5J39 A;  2YTY A;  2KEC A;  4UP8 A;  3J7A 5;  3LGJ A;  2NTT A;  1Y8N B;  2XSC A;  1HNX L;  1IYV A;  1U0L A;  2QDB A;  2R3Z A;  4DXF A;  1L1O B;  1WD0 A;  3G48 A;  2F3I A;  3OMC A;  4PV1 C;  3J81 i;  4IUP A;  1CI3 M;  4I7A A;  2MQH A;  1BKB A;  1STA A;  3S17 B;  4GN3 B;  1VQJ A;  1DCZ A;  1GUN A;  1AP0 A;  2RHQ B;  1WFQ A;  3A5Z B;  4PMC A;  4DV7 L;  1ILP A;  1V1O A;  2F03 A;  3BVZ A;  3ZJY C;  4CDF C;  3AFQ A;  1XYI A;  1PYS B;  2PCF B;  2NN6 G;  2K5W A;  3D0F A;  2VUM B;  2CHB D;  4GOP A;  2F4V L;  1S72 A;  4OWX B;  3NWS A;  1PZJ D;  2A6E D;  5JJI A;  5EBD A;  4JOI A;  2I07 B;  5C3E G;  5T1I A;  4IJH A;  2AKW B;  5KRU A;  4OX9 Q;  1N36 L;  3A54 A;  4A3K H;  3D3R A;  5DAU A;  4K14 A;  5ELE A;  3GTK B;  4DR5 Q;  2BH8 A;  5EKI A;  4HJA A;  2F52 A;  4JYA Q;  4C2M H;  1QNU A;  1EIG A;  3TSS A;  2K5V A;  1HA5 A;  1S5B D;  3HOY B;  1EY8 A;  2K75 A;  3NTK A;  2F0T A;  3K8A A;  2PYK A;  2VXW A;  3R8B A;  2EYJ A;  2HDM A;  1EEF D;  3ERO A;  4Q0F A;  3J81 L;  5JVH 3;  2BH2 A;  2XRS D;  3TBI B;  3HKZ G;  1EY6 A;  2B2T C;  4IZ8 A;  1WCM B;  1H95 A;  1VQN A;  3GTQ B;  1WVL A;  1YHA A;  3OIP A;  3ULJ A;  1QVG A;  4BBS B;  3KJP A;  1SMY D;  1VQD A;  2E76 C;  1GOZ A;  3WOE A;  1G2S A;  2R61 A;  5CV4 A;  3VR6 A;  1TS3 A;  1EYG A;  1VQO A;  4DR4 Q;  1JJG A;  1BBW A;  1XMQ L;  5IOC A;  1GHK A;  2OQK A;  2WB1 B;  2PZU A;  5BR8 Q;  5C0X J;  2EY5 A;  1Y8P B;  1KRS A;  3CC4 A;  2YU9 B;  1X65 A;  1UE5 A;  3NEN A;  2OCE A;  1Z47 A;  2RDG A;  4KJN A;  1P8L A;  1K83 H;  1J5E Q;  4BBS H;  1KD1 C;  4DUZ L;  1PRT F;  4Y52 H;  3QIA A;  5C3W A;  3SHL A;  1Y69 U;  1O7L A;  4LF6 L;  1GHJ A;  1EWI A;  5M9O A;  4A3B H;  5KEE A;  4K6D A;  3EIV A;  3JAM E;  3ICE A;  1JOO A;  2I5M X;  2VUM G;  4HR7 B;  3JAM L;  4FXK C;  1NNX A;  1U5K A;  1H9K A;  1PVO A;  4OL7 A;  1V43 A;  5C3E B;  3SDZ A;  3GTM H;  4BBR H;  4N9P A;  2LXJ A;  2B2W A;  1WTQ A;  1KLU D;  2QGQ A;  5D14 A;  1GVP A;  4KKS A;  3RMH A;  5BN4 A;  4LF4 L;  5AJ3 L;  3V96 A;  3KYH C;  4A3I B;  4GLA C;  1C8C A;  1N34 Q;  1OXU A;  2NUC A;  1TR5 A;  2K6A A;  5CBE E;  3I4M B;  1TWF H;  2J4X A;  5IT9 E;  3PO3 G;  1ZYR C;  3J80 E;  1K73 C;  3GTL B;  3MFY A;  5GAG C;  5ELD A;  4FYD A;  1QG7 A;  4A3F G;  3K5O A;  4HTH A;  4JPB W;  1PV4 A;  1BCP B;  3CC2 A;  4C1N I;  2EY1 A;  1AEX A;  1TWG H;  4DXG A;  3P1H A;  4IUN A;  3I56 A;  1FNU A;  4ID6 A;  1VQ5 A;  2E2H B;  2B2Y C;  4CDE C;  2EZV A;  2IT1 A;  3K5M A;  4LF9 Q;  2X69 A;  4X65 Q;  1VQP A;  3NEL A;  1JB3 A;  4IFD G;  1EFI D;  2NTS A;  4QUC A;  1XNR L;  1TU2 B;  2G5D A;  2LKV A;  3DEP A;  3I4O A;  1AFP A;  5AJ3 Q;  2RCN A;  2PI2 E;  4GLV B;  2MNA A;  1XNR Q;  2IWH A;  1FGU A;  3PF4 A;  3C2P A;  2CKZ B;  1G51 A;  2M2L A;  1J9O A;  2IPK D;  1P16 A;  2OEO A;  3MWY W;  3WOF A;  2B29 A;  3UDF A;  3CCM A;  5CC4 A;  4A3G G;  1PH6 A;  1QUQ B;  2F0P A;  2M00 A;  1PYB A;  1CHQ D;  1AE2 A;  4K0K Q;  3AMU A;  1NSN S;  1QNK A;  3ND9 A;  3QJY A;  5JEA G;  4JI1 Q;  2JXM B;  4OWT B;  5BN3 A;  4QF4 A;  3H09 A;  2BA0 A;  3RZO H;  4QL5 A;  3BDC A;  4JBK A;  1D5M C;  3ND8 A;  3F2B A;  1PH4 A;  1PRT B;  4JI6 L;  5IP7 H;  1F2M A;  3K0X A;  2JA8 B;  1CKM A;  2H5X A;  1CM9 A;  3KFU A;  1IYJ B;  4JYA L;  4A3L G;  4HJ9 A;  1LT5 D;  3HG9 A;  4QIW B;  5M5Y H;  3D8G A;  2K4K A;  5C4X G;  1X32 A;  1PFM A;  2AQ3 B;  3NUC A;  1CKN A;  1E7Z A;  2D5D A;  1KIX A;  3M7N A;  1HR0 L;  5C4X B;  4B9W A;  5EPK A;  1LLR D;  5JEA H;  3Q6S A;  2F0F A;  1SFO B;  2KHJ A;  4DUY Q;  1RF2 D;  2BE5 C;  1S5C D;  4L63 B;  1HFG A;  3QB3 A;  4B08 A;  3Q8D A;  1C9O A;  1N33 L;  4EQO A;  1LAB A;  3CCJ A;  1EU4 A;  5L37 A;  5CGK A;  4A75 A;  1D6E C;  4B3M Q;  1STG A;  4DR2 Q;  4CJ0 B;  2O5I C;  1V1P A;  1PLF A;  1Y1W B;  1ENF A;  2BE5 D;  5C3X A;  3RZD B;  1UE7 A;  3OW2 A;  2CFM A;  3IKJ A;  1QOH A;  3OPO A;  1K28 A;  3W2D A;  1IBM Q;  3I2Z A;  1B3Q A;  5FLX c;  1I4G A;  4A3K G;  2IHE A;  1E24 A;  1TQO A;  4K5W A;  4QQB X;  1EIF A;  3V05 A;  2FMM A;  3FHW A;  4QIW E;  1II3 A;  1YNX A;  3T1Y Q;  1PZK D;  2YTX A;  3D4R A;  4LF6 Q;  3T1Y L;  1IW7 C;  5CV5 A;  1WD1 A;  1DYQ A;  2NZO A;  4L5S A;  3CRK C;  1TWF B;  3HOV B;  3L3O C;  2VY3 A;  3HOZ B;  3I8Z A;  5KYI A;  4A93 H;  2WAC A;  4IUQ A;  1ML0 D;  1CK1 A;  4I7Z C;  3SK5 A;  2NVQ B;  5JJZ A;  1W6K A;  4A3J B;  4Z9C B;  5JJK A;  2K14 A;  3H3V I;  5IGD A;  4OO1 I;  1S5E D;  2E5L L;  1SE3 A;  1SE8 A;  3A74 A;  2KCC A;  1VQ6 A;  2NVY H;  1N34 L;  4GOP B;  1RTN A;  3CHB D;  3CXC A;  1XNQ Q;  1HUM A;  1K9M C;  3BVG A;  3H0G B;  3R2T A;  3K0Y A;  3J80 i;  2VUM H;  4KJO A;  4BA2 I;  1ONL A;  2K5N A;  1Q1E A;  3J7A F;  5CYU A;  3QO2 A;  2AWO A;  2IW3 A;  4BY1 G;  4A3F B;  4F7X A;  4J15 A;  3J80 L;  3BU2 A;  2MO1 A;  5IGF A;  1LTR D;  1WTP A;  4HED A;  4GOP C;  3F2C A;  1GUO A;  2K03 A;  4DFA A;  2CQO A;  1PTO C;  4C2M B;  3UDG A;  3E9I A;  5EKL A;  3IAY A;  4JG2 A;  1Y8O B;  2KVM A;  5E1F A;  3S15 B;  5FOB B;  5EGT A;  4RGT A;  4IQZ A;  2RQX A;  4L5R C;  1PYW D;  1LO5 D;  1Y1W G;  1LAC A;  3TEH B;  1HFN A;  2R7Z G;  3TQY A;  1JWM D;  1CA6 A;  1CHP D;  1U4P A;  3MFG A;  4DV3 L;  3GTJ H;  4G7O C;  1I4Q A;  3S2H H;  2DY7 A;  4GN4 B;  4WFN 3;  2PZW A;  4C3J H;  3KOJ A;  4ZYS A;  1SYG A;  4KTA A;  2UXD Q;  4DAM A;  4LFA Q;  4DV0 L;  1B50 A;  4C3I G;  1LTG D;  1SXT A;  2JP1 A;  1VCI A;  1K8A C;  1OXT A;  2J7Z A;  4M8A A;  1W2B A;  1AZQ A;  1SFO H;  3RLO A;  4FDB A;  1PFS A;  1VF5 C;  5DEH A;  5K36 H;  4YCU A;  1XMO L;  1JOQ A;  1PFN A;  1HTL D;  4KY7 A;  2R6G A;  4A3J G;  2AUK A;  3KUP A;  2RKS A;  3IRB A;  2OTJ A;  2JK8 A;  5JOB A;  4DNI A;  4HMI A;  4QUF A;  5KNB A;  4JI3 Q;  4DK6 C;  1J6Q A;  1K3R A;  4A3M G;  3T56 B;  1LT6 D;  1G8Z D;  3PCO B;  3QWN A;  1UEA B;  4P72 A;  1FR3 A;  1O7I A;  2ZJQ A;  1TT2 A;  2OXP A;  5C4J H;  3GO5 A;  2E2J H;  1X9N A;  3KDF B;  5CMD A;  3NP8 A;  4MHE A;  4KHZ A;  4A3M B;  1SMX A;  1PTO D;  4WOR A;  1V1P B;  4GNX B;  3KF8 A;  3CQZ B;  3E0E A;  1I6H B;  3DMU A;  4R4O A;  4DU9 A;  3BZK A;  4KY5 A;  2E75 C;  1SNO A;  1ENA A;  1TY2 A;  2LS0 1;  2N49 A;  5IWA L;  1MGS A;  1YNJ D;  4A3L H;  4QGU A;  4K2K A;  3HOU B;  1QZH A;  2RDF A;  1S3O A;  1RJT A;  5NUC A;  1X6O A;  5CV7 A;  2D0P A;  1KHI A;  1XMO Q;  1WOC A;  4YWK A;  4OWW B;  1IKM A;  1X55 A;  3H91 A;  5CV6 A;  3S1M H;  4HIK A;  5F2D A;  2PQA A;  4ME3 A;  4ULL A;  5LMN W;  2ZT9 C;  1EY9 A;  2YTV A;  5C0X I;  1G29 1;  1YZ6 A;  2JA7 H;  1CKN B;  2B8F A;  2NN6 H;  3HKZ E;  3M4O H;  1Q3L A;  4KLK A;  1Y1W H;  3MZ5 A;  5IGC A;  4MNO A;  1NMF A;  4KHP Q;  2HD3 A;  1SLJ A;  1Y1V B;  1L2F A;  4GKJ L;  3J7Y W;  4MTN A;  5FLM H;  2F0J A;  3ER0 A;  4OXP A;  4DV5 L;  1GUW A;  1IW7 D;  5JPN C;  2L5T A;  2RA4 A;  4YHH L;  4DR5 L;  2IX0 A;  5IP9 H;  3OIQ A;  1XMQ Q;  1KLG D;  2P5Z X;  3W1G A;  3K7A H;  1KDC A;  3HFZ B;  1ASY A;  3HOZ H;  1B2T A;  1WTR A;  4XQJ A;  4KN4 C;  1HQR D;  2R92 H;  3S2D H;  2N88 A;  3RUZ A;  2Q2U A;  4ZQ3 A;  2K28 A;  2RBM A;  5M5X B;  2RF4 A;  4A3J H;  4X66 L;  1LTB D;  1IBK Q;  2K04 A;  2F0M A;  1CT1 D;  2B2W C;  2L0C A;  1R4P B;  4ZRZ A;  5JAV A;  3ERQ A;  1H9M A;  4FXG C;  1LTT D;  1G2T A;  3T13 A;  3TS2 A;  1UAP A;  1EOT A;  3BJU A;  3TZD A;  2ZJP A;  1HR0 Q;  2K5Q A;  5M5W H;  1I50 B;  4DAP A;  1CQF A;  4K2L A;  2KA7 A;  4YY3 Q;  2NVX H;  4JOI C;  1MJC A;  2ZM6 L;  5IYC G;  1FL0 A;  2A68 D;  2F0I A;  1LTS D;  4A3E B;  1MHW C;  3VR3 A;  4BXX G;  4B3M L;  5FO7 B;  4G4K A;  3CRL C;  4YCV A;  1Q82 C;  5EQ0 A;  4HMJ A;  3OW7 A;  1A8V A;  2XVS A;  2EJM A;  2D2C C;  4A3E G;  1YHB A;  3HOW H;  1JOK A;  1QVC A;  2HCI A;  1HUN A;  1CUK A;  2MO0 A;  5HUR A;  3PUX A;  3Q23 A;  4J8Q A;  4AH6 A;  2K05 A;  1YEZ A;  1H9J A;  2JA6 B;  4A3I H;  3I55 A;  3CC7 A;  1HNZ L;  4P2C B;  1VQF A;  4JV5 Q;  3SEB A;  1HNZ Q;  2FMC A;  3DUZ A;  2GA4 B;  2E2I B;  4GN5 A;  1CKO A;  2HDL A;  1B53 A;  3E5S A;  1XTC D;  3OWF A;  2R92 B;  2NB0 A;  2UXB L;  2R93 G;  5LMN L;  3URY A;  3R2I A;  5IYD H;  3C1F A;  4IFD I;  2FXQ A;  3QOJ A;  1LUZ A;  2KCN A;  3RLN A;  4LFC Q;  4IJL A;  4DV4 Q;  1CZW A;  4GZY C;  4LAA A;  1YJ9 A;  4GNX A;  4A3D H;  4RCO A;  2DUD A;  4LFC L;  5GRO A;  1UWV A;  4HIM A;  3SK6 A;  4YCW A;  3QR8 A;  3KF6 A;  3K5L A;  3FPU B;  4DK1 A;  4TQU S;  3HEJ A;  3HKS A;  1XXG A;  4DUZ Q;  1KXL A;  2B8G A;  2R7Z H;  2KEN A;  3M7G A;  4X3U A;  4JBW A;  2ES2 A;  2D62 A;  1SE4 A;  2B2T A;  2A19 A;  2XNA C;  3ULL A;  1DGS A;  2KHI A;  3DM3 A;  3F1Z A;  1X3G A;  1IYU A;  1JR0 D;  3UDX A;  3K80 C;  3I91 A;  3PUZ A;  2CCZ A;  4G57 A;  3CCV A;  2WKC A;  1K8O A;  4BY7 B;  1ZYR D;  1BO0 A;  2JA5 B;  5AFW A;  1BCP F;  1JE4 A;  1SDF A;  3PSI A;  2HT1 A;  1IHZ A;  1HRJ A;  1JC7 A;  3GTG B;  1YBY A;  3E3X A;  2C5C A;  4YWM A;  1K83 B;  3P20 A;  2BDO A;  3S1R H;  3IL8 A;  4JCV E;  1PH9 A;  3TP6 A;  2Z4H A;  5KND A;  4FO2 A;  1OXS C;  4POF A;  1W3S A;  2GN5 A;  1Y1V G;  4ZKC B;  5KGU A;  3LNN A;  1HNW Q;  4R4T A;  1S5F D;  4N9T A;  1QE6 A;  3I4L A;  1X56 A;  3MXP A;  3DXJ C;  5C44 G;  2F0O A;  4JI6 Q;  4CDC C;  1MI2 A;  2EY6 A;  5M3M B;  1W6J A;  5A2Q E;  1EY0 A;  1GO3 E;  1B70 B;  1SND A;  4MZ9 A;  2HQL A;  3S1R B;  5TSS A;  2EYP A;  3TDQ A;  5EJW A;  1M90 C;  1PA6 A;  1K8M A;  2XWJ B;  1YHQ A;  1I5F A;  2Q2H A;  1X3E A;  4BBR G;  4A93 G;  1H9S A;  1EWH A;  2IJ0 A;  1AZP A;  1L0Y B;  4JI8 Q;  3GTK H;  5FJ8 G;  4IAL A;  3FKI H;  1FNW A;  1VS0 A;  2QA4 A;  5E3F A;  4J1M A;  1XPO A;  2WAQ E;  1HR0 W;  4C56 C;  1K0S A;  1C4Q A;  1SRO A;  1STB A;  4L5Q A;  1XPR A;  2CQA A;  1KNE A;  2B3G A;  3E6Z X;  4HCS A;  1YIT A;  1ICW A;  4TRD A;  2F0H A;  3TP5 A;  1XPU A;  3CMA A;  1DON A;  4Q5V A;  2B39 A;  3NPP A;  3S9W A;  4DR6 L;  2AUJ D;  3T51 B;  4X62 Q;  2N55 A;  4PNY A;  4EX5 A;  2SDF A;  3FEW X;  5I2X A;  4X62 L;  3BZC A;  3GTM B;  1KDB A;  2KQ3 A;  4LUZ A;  4YWL A;  1TWH H;  2FFK B;  2NWG A;  4LMQ D;  1EZ8 A;  3F8T A;  4N8X 1;  5IOD A;  1PH1 A;  1JIC A;  2UUC L;  4CHT B;  5HGT A;  1EQR A;  1NR4 A;  1GJX A;  3I70 A;  1B4O A;  4NKL A;  5FLM G;  4A3G H;  4IPG A;  4LF5 L;  5ISR A;  4R4C A;  1A2T A;  3HOX H;  1Q1B A;  4BXX H;  2F0S A;  1JB7 A;  4DV5 Q;  2UXC Q;  4NDX A;  2F0W A;  2PQA B;  3FVQ A;  3NQI A;  4RGN A;  4DK0 A;  4IPC A;  4DPG A;  4DR7 Q;  4YY3 L;  3TS0 A;  3PO3 H;  4F87 A;  2A73 B;  3V2T A;  5C44 B;  3HOY H;  1TWH B;  4CKE A;  4ABN A;  3KF8 B;  2NVT H;  2H4O A;  4P71 A;  5FO9 B;  5KIX A;  2F0N A;  4UP7 A;  3H3V C;  2EOT A;  1SAP A;  2QF7 A;  1JWS D;  4DK3 C;  1H9R A;  1DD2 A;  3CD6 A;  4BY7 H;  1Q7Y C;  2B2U C;  2Q2I A;  4PMW A;  5JPM C;  2EIF A;  1WCM H;  4X66 Q;  1IBK L;  2D0O A;  3I73 A;  2BOS A;  5DNF A;  5K36 G;  2Y0S B;  3KJO A;  4TKO B;  3Q0A A;  3T53 B;  4HSP A;  2JE6 I;  1PH2 A;  2IHF A;  2CWP A;  3M3Y B;  4JV5 L;  4NP5 A;  3ONA B;  1MJE A;  2A6H C;  4FXD A;  2ZJR A;  1TWC H;  1JCK B;  4PZ7 A;  1HTP A;  4ALP A;  3CCL A;  3EFX D;  1QUQ A;  4JK1 C;  4PMB A;  3OHX C;  4MTK A;  2CWA A;  1C0A A;  5EKK A;  1HZA A;  2F0L A;  2Q8I B;  3BZD B;  5ELB A;  5C6A A;  2CVR A;  3BG3 A;  4KV6 A;  3OOC A;  4KK7 A;  2Q8T A;  4XTC S;  3I4N G;  2MFI A;  4X6A H;  4JI3 L;  4LNQ A;  1L0X B;  2B63 B;  2E2H H;  2FIN B;  4IUV A;  3SGI A;  4JI7 Q;  1MSG A;  4DV3 Q;  3KBG A;  1B1Z A;  4XYQ A;  3NBI A;  5IP7 G;  5M5W B;  1ESR A;  1FJG L;  2JA6 G;  5IYB G;  1F9P A;  4IN3 A;  3GV6 A;  2JA7 B;  3U4V A;  3GTG H;  4CJ2 C;  2KBN A;  5D3D A;  3S17 H;  2WFW A;  3NXW A;  3JAM i;  4FF1 A;  3RD4 A;  1QB5 D;  1WTO A;  5C4X H;  1KAB A;  4RHR A;  4XXE A;  3ULP A;  5LL6 S;  4ZCK A;  1GUT A;  2DJG C;  4JI5 Q;  2B63 H;  3PV0 A;  2EYO A;  4LF9 L;  1DM0 B;  4F88 A;  4L5T A;  3JAM c;  3I4N H;  2IY5 B;  5I9O A;  3PO2 G;  3H15 A;  1PRT D;  4XQQ A;  2YU9 H;  1G91 A;  1HPC A;  2Z9H A;  1OXV A;  4ZKB B;  1EL0 A;  3WDN A;  2WV6 D;  4C1N K;  2RSN A;  4BS9 A;  3PO2 B;  1C7Y A;  4NMZ A;  2X6G A;  1ZKO A;  1Q8K A;  2V1C C;  3MTS A;  1PDQ A;  4AQY Q;  1DJR D;  2O4X A;  2F0V A;  3U58 A;  4LF7 Q;  2VQF Q;  3CAM A;  4YIJ A;  1OXX K;  4CKB A;  3VR5 A;  3BS1 A;  4S3S A;  4A4I A;  4J6H A;  1MIU A;  3SR1 A;  2Z6K C;  2EJG C;  5LHY 1;  1A63 A;  2NBF A;  1GXD C;  2L55 A;  5A35 A;  3VR4 A;  2SOB A;  4AYB E;  2V4D A;  1RTO A;  3J81 j;  4LUV A;  3J7A V;  2KED A;  4V19 0;  1BXT A;  5C44 H;  5JJL A;  2RVL A;  2AWN A;  2A69 D;  2K01 A;  3F2U A;  2ZXR A;  2EYH A;  3K7A B;  1LT4 D;  1E2Z A;  1F9Q A;  2PW5 A;  4RA8 A;  2ATW A;  1OO9 B;  5EPL A;  1TKW B;  1MBY A;  3GV3 A;  4IOA A;  5EPJ A;  1DZ1 A;  1Q8I A;  1WTX A;  1PZI D;  1BBU A;  1ET6 A;  1KAA A;  2KOL A;  2JEA I;  1NR2 A;  5ELC A;  4DUY L;  4AYB B;  1KC8 C; 
#chains in the Genus database with same CATH homology
 4IJH A;  2AKW B;  4NB3 A;  5ELO A;  3L7Z C;  4C3I H;  4OX9 Q;  2JQO A;  4YHH L;  1N36 L;  1N32 L;  4DR5 L;  2E2I H;  4A3C G;  3J80 c;  4A3K H;  2IX0 A;  5IP9 H;  1XMQ Q;  2R92 G;  4DR5 Q;  3W1G A;  3HOZ H;  3K7A H;  1ASY A;  2BH8 A;  3HFZ B;  4DR6 Q;  3OYY A;  2XTI A;  1K0R A;  2C35 B;  3A5U A;  1UE1 A;  4DR2 L;  5BR8 L;  5C3E H;  4HJA A;  2R92 H;  2F52 A;  3S2D H;  1NY4 A;  1YI2 A;  4RG1 A;  4C2M H;  1VQB A;  1VQ8 A;  2Q2U A;  4JYA Q;  2ASB A;  4IFD J;  4JI0 L;  2K5V A;  2RF4 A;  3RR5 A;  3VDY A;  4A3E H;  4A3J H;  4X66 L;  3STB D;  1IBK Q;  2VZA A;  4JI0 Q;  4DV6 Q;  2K75 A;  4JI8 L;  3HOX G;  4DV1 Q;  3K8A A;  2Y0S G;  1Q12 A;  1J5E L;  4DV6 L;  3GTP H;  2LXK A;  4Y7N H;  4OO1 G;  3TS2 A;  4B3S Q;  4DR1 Q;  3BJU A;  2N8N A;  2ZJP A;  3FP9 A;  2BH2 A;  1HR0 Q;  5M5W H;  3HKZ G;  1XJV A;  1Z9F A;  4DR1 L;  4IPH A;  1VQI A;  2UXC L;  4WJ4 A;  4PG3 A;  3W5O A;  1H95 A;  1VQN A;  4QY7 A;  4A3D G;  3G71 A;  1YHA A;  4LWC A;  1RL2 A;  4LF8 L;  3ULJ A;  1QVG A;  2NVX H;  4YY3 Q;  4JOI C;  1MJC A;  3KJP A;  1VQD A;  2ZM6 L;  5IYC G;  5IYB H;  1FL0 A;  2EQS A;  5FJ8 H;  2ZM6 Q;  4HIO A;  1XTD A;  2JA9 A;  1EYG A;  2JA5 G;  1QVF A;  1VQO A;  4BXX G;  4B3M L;  1M1K C;  3S24 A;  1BBW A;  4DR4 Q;  1XMQ L;  1JJG A;  1HJP A;  3CME A;  1X3F A;  1KQS A;  3RLF A;  1AH9 A;  4YCV A;  1Q82 C;  4P73 A;  2OQK A;  1E22 A;  3S14 H;  4DR3 L;  1A8V A;  5BR8 Q;  5C0X J;  2JJQ A;  4A3E G;  1EOV A;  1YHB A;  3HOW H;  5ELN A;  1QVC A;  2JA5 H;  1I50 H;  1KRS A;  3CC4 A;  4JI4 L;  1CUK A;  2MO0 A;  1X65 A;  3CCE A;  1UE5 A;  4JBM A;  3HOV H;  3NEN A;  2OCE A;  1Z47 A;  3PUX A;  4PZ6 A;  3S15 H;  1P8L A;  1K83 H;  4AH6 A;  1IBL Q;  2L15 A;  1J5E Q;  4BBS H;  1KD1 C;  2JA7 G;  4DUZ L;  1YEZ A;  4Y52 H;  2RHS B;  4A3I H;  1IBL L;  3I55 A;  2UXD L;  3CC7 A;  2UUB Q;  4LF6 L;  2OTL A;  1BVS A;  1HNZ L;  1EWI A;  3MEF A;  4GKK Q;  4POG A;  1E1T A;  1VQF A;  4A3B H;  2Y0S E;  4JV5 Q;  4A3M H;  3CP0 A;  1HNZ Q;  3EIV A;  4GKK L;  4GN5 A;  3ICE A;  1V1Q A;  1CKO A;  2I5M X;  2VUM G;  1YJN A;  3D31 A;  4X64 L;  1U5K A;  1E3P A;  1PVO A;  3L0O A;  1X54 A;  1V43 A;  3K81 C;  2UXB L;  2R93 G;  3GTM H;  4BBR H;  5LMN L;  2IX1 A;  2LXJ A;  1HZB A;  5IYD H;  1VQM A;  3A0J A;  2QGQ A;  1GVP A;  3UE1 A;  4LF4 L;  4IFD I;  1AE3 A;  2ALY B;  2FXQ A;  1NJI C;  5AJ3 L;  1LUZ A;  4LFB Q;  3RLN A;  4LFC Q;  3KYH C;  3M4Q A;  4IJL A;  4DV4 Q;  4LF4 Q;  3TRZ A;  4GLA C;  3M3Y H;  1YJ9 A;  4GNX A;  1N34 Q;  3PGZ A;  4A3D H;  1WYD A;  4A76 A;  2DUD A;  4LFC L;  5GRO A;  3M9B A;  1UWV A;  5IYD G;  1OXU A;  4HJ7 A;  4HIM A;  4JI7 L;  5JEA J;  4YCW A;  3RN2 A;  3KF6 A;  4TQU S;  1TWF H;  2A8V A;  3PO3 G;  2GVA A;  1NE3 A;  3HKS A;  4DUZ Q;  1K73 C;  1NMG A;  2NZH A;  4DV0 Q;  4LFA L;  1KXL A;  2R7Z H;  2KEN A;  2R7D A;  3WWV A;  2Z0S A;  5GAG C;  4NXM Q;  1HNW L;  1PH5 A;  4JBW A;  1EIY B;  4OON A;  4A3F G;  1JJC B;  2D62 A;  2ES2 A;  3H3V H;  2A19 A;  1PV4 A;  3ULL A;  1DGS A;  2KHI A;  3JC6 6;  3CC2 A;  3DM3 A;  3F1Z A;  1TWG H;  1X3G A;  4R1J A;  1IZ6 A;  3I56 A;  3UDX A;  3K80 C;  3RNU A;  3CCQ A;  4EQ5 A;  3PUZ A;  3GDE A;  1VQ5 A;  2CCZ A;  3CF5 A;  1QZG A;  3S1N H;  1CSQ A;  1N8R C;  3CCV A;  4JBJ A;  4NXN Q;  1HNX Q;  3CQZ H;  2IT1 A;  2UU9 L;  4LF9 Q;  3CPF A;  2R7F A;  4X65 Q;  1VQP A;  1WJJ A;  3NEL A;  3M4P A;  4LW1 A;  4IFD G;  3PSI A;  1XNR L;  2HT1 A;  2AHO B;  3I4O A;  1YBY A;  1I94 L;  2HHH L;  5AJ3 Q;  2RCN A;  2PI2 E;  4GLV B;  4YWM A;  5GAD C;  4LFB L;  2MNA A;  1XNR Q;  3GTL H;  1FGU A;  4DV4 L;  3PF4 A;  2CKZ B;  2VL6 A;  1G51 A;  3S1R H;  4JCV E;  3RZD H;  1P16 A;  4AQY L;  2JA6 H;  1D8L A;  1PH9 A;  4A3G G;  2B29 A;  3UDF A;  3CCM A;  2A1A A;  1PH6 A;  1QUQ B;  2LSS A;  3NEM A;  1PYB A;  2QEX A;  1VQC A;  1OXS C;  4POF A;  2OWO A;  1AE2 A;  1A0I A;  1W3S A;  2GN5 A;  4K0K Q;  1Y1V G;  3GTO H;  1VQ9 A;  4R4Q A;  5EAY A;  4NPS A;  1HNW Q;  4LF7 L;  4R4T A;  5M3M G;  4B3R Q;  2VQF L;  5JEA G;  1YVC A;  4JI1 Q;  4DV2 L;  4OWT B;  5J3B A;  1GD7 A;  2BA0 A;  3RZO H;  1X56 A;  4QL5 A;  2JA8 G;  3S1Q H;  2I5L X;  1GM5 A;  4JBK A;  5M3F H;  3U4Z A;  1LTL A;  5C44 G;  4JI6 Q;  3F2B A;  1Y1V H;  1ASZ A;  1PH4 A;  1MKH A;  5HY6 A;  5IP7 H;  4AYB G;  1GO3 E;  1I3Q H;  1B70 B;  2OQ0 A;  4JI6 L;  4MZ9 A;  3K0X A;  4PZ8 A;  2HQL A;  3PF5 A;  4NXN L;  1CKM A;  2H5X A;  3FKI G;  1M90 C;  3PIP A;  1PA6 A;  4UY8 C;  3KFU A;  1IYJ B;  4R4I A;  4QJF A;  1YHQ A;  4JYA L;  1I5F A;  3OTO L;  4HJ9 A;  2Q2H A;  4A3L G;  1X3E A;  4BBR G;  2DGY A;  3AFP A;  4A93 G;  5M5Y H;  5E7N A;  3U50 C;  2K4K A;  2WP8 J;  5IYC H;  5C4X G;  3GTK H;  4IO9 A;  4JI8 Q;  5FJ8 G;  3KDF A;  4A3I G;  3FKI H;  3CCS A;  1VQE A;  1CKN A;  1VS0 A;  1E7Z A;  2QA4 A;  4HJ5 A;  2UUC Q;  1XPO A;  3T1H Q;  2WAQ E;  1HR0 W;  1KIX A;  3M7N A;  1SN8 A;  1HR0 L;  2AMC B;  4AIM A;  1SRO A;  1YIJ A;  2ZTE A;  5M3M H;  1IL2 A;  5DLQ E;  3TRE A;  4DV7 Q;  4L5Q A;  4A3C H;  4APV A;  1EUJ A;  1XPR A;  3J81 c;  1HH2 P;  1TXY A;  2JA8 H;  4GKJ Q;  2B3G A;  2KHJ A;  4DUY Q;  4TVA B;  1YIT A;  2KCT A;  1JJ2 A;  2R93 H;  4OX9 L;  2F4V Q;  3Q8D A;  5C0X G;  1XPU A;  1C9O A;  1N33 L;  1VQA A;  3CMA A;  3AYH B;  4DAY B;  3CCJ A;  3I7F A;  4UP9 A;  4A75 A;  1N33 Q;  3GD7 A;  4DR6 L;  4B3M Q;  3G4S A;  1N32 Q;  4DR2 Q;  2ZTC A;  1L0W A;  4X62 Q;  2B63 G;  4EX5 A;  4XIG S;  1RIP A;  1VQL A;  1IBM L;  4X62 L;  3BZC A;  4DKA C;  1UE7 A;  2I5H A;  3OW2 A;  2CFM A;  2KCM A;  3W1B A;  4LUZ A;  1IBM Q;  3KLW A;  3I2Z A;  5FLX c;  4YWL A;  4A3K G;  1TWH H;  3B6Y A;  4IPD A;  2IHE A;  1E24 A;  1PH3 A;  1PH7 A;  3PIO A;  5IT9 c;  4LUO A;  5M3F G;  4QQB X;  1EIF A;  3F8T A;  3J7Z C;  1PH1 A;  1PHJ A;  3HOV G;  2UUC L;  3FHW A;  1E1O A;  4GLX A;  4DV1 L;  1SRU A;  2WAQ G;  1EQR A;  1YNX A;  4QIW E;  3T1Y Q;  2YTX A;  3K7U C;  3AEV A;  4LF5 Q;  1FVI A;  2UUB L;  4LF6 Q;  1R9T H;  4A3G H;  3T1Y L;  5FLM G;  2N78 A;  2NZO A;  2VW9 A;  4L5S A;  4IPG A;  4LF5 L;  4R4C A;  1VQG A;  3HOX H;  1Q1B A;  3H0G H;  4BXX H;  1IXR A;  2VQE L;  2VY3 A;  1JB7 A;  2PI2 A;  4DV5 Q;  2UXC Q;  2PQA B;  4A93 H;  2VQE Q;  4IPC A;  4LF8 Q;  4DPG A;  4DR7 Q;  4YY3 L;  3TS0 A;  3PO3 H;  1Q46 A;  5IP9 G;  3DLL A;  1V9P A;  1N36 Q;  2E5L Q;  3HOY H;  5JJK A;  4JC0 A;  2K14 A;  3HOZ G;  3S16 H;  3H3V I;  4OO1 I;  3KF8 B;  3KF6 B;  2NVT H;  1NTG A;  2E5L L;  4P71 A;  2JEB I;  2VS1 A;  1SE8 A;  2ZTD A;  4UP7 A;  2K5H A;  3A74 A;  2EXD A;  1VQK A;  1VQ6 A;  4DK3 C;  2NVY H;  1XNQ L;  3CD6 A;  4BY7 H;  1Q7Y C;  1N34 L;  4GOP B;  2Q2I A;  4PMW A;  4DR3 Q;  1YJW A;  4P75 A;  4RMF A;  3CXC A;  1XNQ Q;  1K9M C;  2EIF A;  2N3S A;  5GAE C;  3HOY G;  1G6P A;  3E9H A;  1WCM H;  4X66 Q;  3UE0 A;  1IBK L;  4BY1 H;  2D0O A;  5K36 G;  2ID0 A;  1UE6 A;  4O0A A;  3KJO A;  2VNU D;  3M85 A;  1OTC A;  3J80 i;  1KAW A;  2VUM H;  2JE6 I;  1PH2 A;  4BA2 I;  2K5N A;  4B3S L;  3PO2 H;  1VQH A;  2IHF A;  2NVQ H;  2YYZ A;  1Q1E A;  2CWP A;  4JV5 L;  4JI2 Q;  2AWO A;  3H0G G;  1S40 A;  1MJE A;  1WCM G;  4BY1 G;  2ZJR A;  1TWC H;  4PZ7 A;  4J15 A;  2HIV A;  3AQQ A;  3BU2 A;  4JI2 L;  2MO1 A;  1KL9 A;  1VQ4 A;  3I4M H;  4BBS G;  1Q86 C;  3G6E A;  4ALP A;  4O2D A;  4GOP C;  3F2C A;  5GAH C;  3CCL A;  2XGT A;  4IOC A;  1QUQ A;  5LMN Q;  1N9W A;  1I6H H;  2CQO A;  1LYL A;  2CWA A;  2GVB A;  1C0A A;  1L1O C;  4X64 Q;  1HZA A;  3STB C;  3F2D A;  4WJ3 M;  4GNX C;  3UDG A;  3CCU A;  3E9I A;  1K8G A;  4JG2 A;  4DR4 L;  5H1S E;  4XTC S;  3I4N G;  2MFI A;  4X6A H;  2WB1 G;  4L5R C;  1A62 A;  4JI3 L;  4LNQ A;  1Y1W G;  2I0Q A;  3TEH B;  2E2H H;  4GS3 A;  2R7Z G;  4JI7 Q;  3SGI A;  3TQY A;  4DV3 Q;  4A3F H;  1T9H A;  4JI4 Q;  5IP7 G;  1FJG L;  4DV3 L;  1NBW A;  4H02 A;  5LMU Q;  3GTJ H;  2JA6 G;  5IYB G;  4P74 A;  3S2H H;  3EBE A;  2E8G A;  3U4V A;  5LMU L;  3GTG H;  4GN4 B;  3EN2 A;  2KBN A;  1Y14 B;  3S17 H;  1WI5 A;  4C3J H;  3KOJ A;  3CPW A;  2UXD Q;  3RN5 A;  2WB1 E;  4B3R L;  2WFW A;  4LFA Q;  4DAM A;  3JAM i;  4DV0 L;  4DV2 Q;  4NXM L;  5C4X H;  3ULP A;  1VCI A;  1SR3 A;  2YV5 A;  4JI5 L;  1K8A C;  3HOW G;  1OXT A;  1PH8 A;  1W2B A;  5GQO A;  3RLO A;  1SFO H;  4FDB A;  4JI5 Q;  2B63 H;  1PFS A;  3PV0 A;  4LF9 L;  4X65 L;  1JMC A;  4YCU A;  1XMO L;  2UXB Q;  4L5T A;  3JAM c;  3I4N H;  2R6G A;  2UUA Q;  2IY5 B;  4A3J G;  3PO2 G;  3H15 A;  4HID A;  4B3T L;  2YU9 H;  3IRB A;  2K52 A;  1B7Y B;  5HGQ A;  2UUA L;  2OTJ A;  2JK8 A;  4DNI A;  1OXV A;  3PUW A;  4A3B G;  1KRT A;  4JI3 Q;  4DK6 C;  1EFW A;  1UEB A;  1J6Q A;  1K3R A;  4A3M G;  1I94 Q;  1JE5 A;  2Q2T A;  3I4M G;  3PCO B;  3L2P A;  4P72 A;  1C7Y A;  1O7I A;  1Q8K A;  2V1C C;  2ZJQ A;  5M5X H;  1TWA H;  3GO5 A;  3MXN B;  5C4J H;  3T1H L;  4AQY Q;  3CCR A;  1X9N A;  2E2J H;  1FJG Q;  3KDF B;  2PNH A;  3UDI A;  4KHZ A;  3U58 A;  1SMX A;  3CW2 C;  1Q81 C;  4LF7 Q;  5IE8 A;  1D7Q A;  2VQF Q;  2Z6K A;  3CAM A;  4KI0 A;  1OXX K;  1L1O A;  4UPA A;  3HOU G;  2NN6 I;  4K0K L;  1JT8 A;  4GNX B;  3E0E A;  4A4I A;  1MIU A;  4R4O A;  3BZK A;  1EQQ A;  1HZ9 A;  2N49 A;  2Z6K C;  4JI1 L;  2K50 A;  5IWA L;  4A3L H;  2PMZ E;  1B8A A;  4QGU A;  3PUY A;  4YHH Q;  3GTQ H;  1A63 A;  5IWA Q;  1LM0 A;  2BA1 A;  2YTY A;  1QZH A;  1S3O A;  4UP8 A;  1X6O A;  4AYB E;  4HJ8 A;  3J7A 5;  3LGJ A;  2D0P A;  2HIX A;  1KHI A;  1XMO Q;  1HNX L;  3OTO Q;  4BY7 G;  1WOC A;  4YWK A;  4BA1 I;  4LUV A;  5IY0 A;  3J81 j;  2UU9 Q;  4OWW B;  1U0L A;  1X55 A;  5C44 H;  4B3T Q;  3ERS X;  1L1O B;  4HIK A;  3S1M H;  1HZC A;  5JJL A;  3G48 A;  2PQA A;  4ME3 A;  5LMN W;  2HHH Q;  2F3I A;  2AWN A;  1GKH A;  2YTV A;  4C3H H;  1G29 1;  1YZ6 A;  5C0X I;  3J81 i;  1VQ7 A;  2JA7 H;  1CKN B;  3NBH B;  2MQH A;  4KHP L;  3HKZ E;  1BKB A;  3M4O H;  4KLK A;  1Y1W H;  4GN3 B;  1VQJ A;  4MNO A;  1NMF A;  4KHP Q;  2RHQ B;  1WFQ A;  3A5Z B;  2ATW A;  1SLJ A;  4DV7 L;  4IOA A;  3HOU H;  1CSP A;  1L2F A;  3ZJY C;  4GKJ L;  4MTN A;  3AFQ A;  1PYS B;  5FLM H;  3D0F A;  1BBU A;  2NN6 G;  3ER0 A;  4OXP A;  4DV5 L;  4GOP A;  2F4V L;  1S72 A;  4OWX B;  2JEA I;  3PUV A;  5JJI A;  4JOI A;  4DUY L;  4DR7 L;  1KC8 C;  5C3E G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...