2YTXA

Solution structure of the second cold-shock domain of the human kiaa0885 protein (unr protein)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
97
structure length
97
Chain Sequence
GSSGSSGNIMLLKKKQARCQGVVCAMKEAFGFIERGDVVKEIFFHYSEFKGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold shock domain-containing protein E1
publication title The NMR solution structures of the five constituent cold-shock domains (CSD) of the human UNR (upstream of N-ras) protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 5
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ytxA01
1A0IA 4OX9L 2ZJRA 4LNQA 4DV7Q 3J7A5 2A19A 4JC0A 4JI0Q 5M3MG 4P71A 3GTMH 4LF8L 2HHHL 1XMQL 3K7AH 5JJLA 3M9BA 4LFCL 1JE5A 1E3PA 1NJIC 1HNXQ 3UDFA 4GLXA 1PH4A 4A3CH 1YHQA 1FVIA 4LUOA 1HJPA 1G6PA 4GN4B 4GLAC 5GROA 1XTDA 5BR8Q 1YJ9A 2AWNA 3OTOL 2JA5H 3H3VH 4DR3L 3S1NH 1N36L 1VQGA 4BY7H 1QZHA 1PFSA 4A3DH 3T1HQ 4NXNL 2Q2IA 1UE6A 4C3HH 3NELA 5M3MH 2IHFA 4JYAQ 3EN2A 1JB7A 1LUZA 4DR2Q 2UUCQ 1N33Q 2CWAA 2D0PA 3J80c 4A3JH 2N3SA 4DR4Q 3L2PA 3PIPA 4OO1G 2KHJA 3G48A 5FLXc 2AMCB 4A3LH 2H5XA 2VS1A 4DV7L 1HR0W 1KXLA 2YV5A 4JI0L 3CCUA 5FJ8G 2C35B 1PA6A 3G71A 4DR1Q 4DR5Q 2UUAQ 5IYDH 2LXJA 1V1QA 2VZAA 1HNXL 1YEZA 4JI8Q 4DK6C 3GTJH 5GAEC 3OW2A 5BR8L 4O2DA 2CWPA 4DV5Q 2K50A 1EOVA 4R4QA 1CKOA 1D8LA 3CCEA 3S1MH 3T1HL 1SE8A 3KDFA 2AKWB 3PUYA 1XPRA 1JJGA 4A3FH 1HZAA 1UE1A 4L5QA 4PZ6A 5FJ8H 4JYAL 5C44G 4DR2L 3T1YQ 2UUCL 1L1OA 2K5HA 1N33L 4DV4Q 4DR4L 4MZ9A 3M85A 4DUYQ 1KIXA 4LF7Q 4Y52H 5JEAJ 3S15H 3KJOA 1TWGH 1NTGA 2ZM6Q 1N34Q 4A3GH 1Q81C 3CCLA 2JA7H 3HOWH 4GKJQ 1X55A 5JJKA 2JQOA 2K75A 4R4IA 3ULJA 3KF6A 2PNHA 5IYBG 3GTKH 2R7FA 4DR5L 3PGZA 4DR1L 2UUAL 3F2CA 3I4NH 2UXDQ 4UP8A 2ID0A 4GOPB 1YNXA 1IBLQ 2NN6G 1PV4A 4JI8L 3CF5A 3VDYA 3U4VA 3S2HH 2ES2A 3CCJA 1NE3A 4DV5L 4JI6Q 1QVGA 2R6GA 4NB3A 3NENA 1A8VA 4LUZA 1M90C 3E9HA 3ERSX 5HY6A 4JI5Q 5C3EG 3AYHB 3CXCA 3M3YH 3RN2A 3T1YL 4OO1I 4DV4L 1MIUA 4DUYL 4LF7L 5C4XG 2ZM6L 1N8RC 3UDIA 1N34L 4GKJL 4IJHA 1K9MC 2GVAA 1AE2A 2R93G 5IP7H 1VQEA 2HIVA 4DNIA 4FDBA 2VW9A 1G291 3GDEA 5IYCH 4JI4Q 3UE0A 4PZ8A 4IFDI 4IPDA 3BU2A 3PUXA 5AJ3Q 2UXDL 4O0AA 1I5FA 2Z0SA 1IBLL 4BBSH 4XIGS 1KQSA 1VQCA 3S24A 4YCUA 3WWVA 1UWVA 2K14A 5M3FG 4UP9A 5C0XG 1GVPA 4QY7A 4JI6L 1TXYA 1GKHA 4YWKA 3W1BA 4A4IA 1YVCA 3I4MH 4JI5L 1Q1EA 4P72A 1B8AA 4PZ7A 2JA8G 4KI0A 4B3TQ 2B3GA 3H15A 3M7NA 4JG2A 1S40A 1L2FA 1X3EA 1X3FA 4BBRG 4AYBE 4POFA 3RLNA 4HJ5A 4GS3A 2AHOB 1P8LA 3M4PA 4IPCA 3STBC 3I2ZA 2YTXA 4GN5A 2K52A 4A3MH 4JI4L 1LM0A 4DR3Q 3PO3H 1Q86C 3ZJYC 5AJ3L 4KLKA 2Q2TA 2DUDA 2Y0SE 3GTOH 4LFAQ 1SMXA 1EUJA 4A76A 3TEHB 5IP9G 1QVCA 1P16A 5GQOA 3CMAA 4JCVE 1VS0A 1X65A 4IPHA 4QIWE 4QL5A 4PMWA 4AYBG 5M5XH 4UP7A 4JBWA 3D31A 1E1TA 2WAQE 4A75A 1CKMA 3JAMc 4HJ8A 1PYSB 2EXDA 4H02A 1JJ2A 3AFQA 4B3TL 2IY5B 4WJ4A 3I4OA 2Y0SG 1DGSA 1X6OA 5H1SE 4KHPQ 5C0XJ 1J5EQ 1PH5A 2EQSA 1Y1WG 3JAMi 3CAMA 3CCVA 4A3KH 1VQLA 1GO3E 2Z6KA 3CC2A 3CP0A 4LF6Q 1JJCB 3HFZB 1ASZA 4OXPA 3IRBA 1L1OC 3A0JA 4HIOA 2WAQG 5JEAG 4JI7Q 3K7UC 3PO2H 4B3RQ 1SRUA 3PUWA 4DV3L 2ZJPA 3KYHC 1EWIA 1K8AC 4LFAL 2VUMG 1VQ8A 5EAYA 2IX1A 1VQNA 4P74A 4UY8C 2LSSA 1XNRQ 4JI2Q 1U5KA 2E2JH 2I5MX 2VNUD 1TWCH 4XTCS 3I7FA 1Z47A 3S2DH 2AWOA 1R9TH 4A3BG 4JBKA 3PUZA 1VQPA 4LFBQ 1PYBA 1SLJA 4UPAA 3J80i 3W1GA 2UXBQ 1FL0A 4KHPL 1HNWQ 1IL2A 3UDXA 1J5EL 4RG1A 4DAMA 1E1OA 4LF6L 4JV5Q 1VQ9A 2PMZE 3BZCA 5ELOA 1K8GA 1K3RA 4C3IH 3HOVG 1VQKA 3BZKA 4JOIA 4OWTB 4JI7L 1Q12A 4B3RL 1VQHA 3G4SA 1Q46A 1VQJA 3HOXG 1YJWA 5C4JH 4TQUS 2WFWA 2R7DA 4X64Q 1IBMQ 1XNRL 4GLVB 3TRZA 4JI2L 4LUVA 3F2DA 2R92G 4P75A 2JA9A 1V9PA 1OXTA 1LYLA 4OWXB 1O7IA 1WCMG 3U4ZA 3J81c 4LFBL 3ULPA 1CKNB 4RMFA 2R7ZG 1M1KC 3HOYG 1HZ9A 2UXBL 3RN5A 1IYJB 4DPGA 1BKBA 1HZCA 4R4CA 1HNWL 2FXQA 3J7ZC 4JV5L 1PVOA 1LTLA 2NVYH 1OTCA 4X65Q 1XMOQ 4OONA 3TS0A 4DV1Q 2MO0A 1VQDA 4YHHQ 1GM5A 2V1CC 4DR6Q 2N8NA 5C44H 1XPUA 4APVA 1YITA 3CD6A 3F2BA 3NBHB 3RLFA 3TQYA 4GNXB 3PIOA 3PF4A 3CPFA 1BBUA 3Q8DA 3HOUG 2A1AA 2KCTA 3KF8B 1T9HA 4AH6A 3FKIG 4X66Q 5IYBH 3HKSA 4R4TA 4X64L 1IBML 3S1QH 1UE5A 1OXSC 3S16H 2UUBQ 2VQFQ 2ALYB 3EBEA 3AFPA 1TWHH 2D0OA 1S72A 3S17H 4YWMA 2B63G 1AE3A 3CW2C 1FJGQ 4C3JH 4OWWB 2NVQH 3ER0A 3H0GG 3ULLA 1PHJA 1EIYB 2OQKA 2I0QA 3BJUA 2MQHA 1Y1VG 1VQBA 3OYYA 4HIDA 5FLMG 3KDFB 4IO9A 1Q7YC 1HR0Q 3MEFA 1VQIA 1C0AA 3K80C 3HOZG 1OXUA 3U58A 4X65L 1JMCA 3DM3A 1XMOL 5C3EH 4DV1L 1E24A 4YHHL 2WP8J 4DR6L 1X56A 1NY4A 2JA6G 2BA0A 1PH8A 1MJCA 2YYZA 1MKHA 4DK3C 2KENA 1I94Q 2PQAB 5C4XH 2E8GA 4IFDJ 2JEBI 4IOAA 3K0XA 4GN3B 2UXCQ 2Z6KC 1QUQB 3KF6B 4JI1Q 1SFOH 3M4QA 1VQAA 2OTLA 2RF4A 3I55A 3K81C 2QEXA 4JBMA 3FP9A 4X66L 2R93H 4MNOA 5LMNW 2XGTA 1EQRA 2UUBL 4P73A 2KCMA 4BY1G 2VQFL 3UDGA 1IZ6A 1TWFH 1Z9FA 3F1ZA 2D62A 3CCRA 1PH6A 2JK8A 1FJGL 1A63A 4A93G 2I5LX 1UE7A 4YY3Q 5M3FH 3STBD 1YJNA 4J15A 1PH1A 2IT1A 1HR0L 1CUKA 4DV3Q 1EFWA 1QZGA 1YIJA 1TWAH 2NN6I 1SR3A 3B6YA 2JA8H 2CQOA 4R1JA 2ATWA 1XJVA 5IT9c 4BY1H 1KAWA 1I94L 1HH2P 1W3SA 4A3EG 4BBRH 2UXCL 4HJ9A 3GTQH 4B3MQ 3PCOB 5E7NA 4JI1L 1BVSA 2KBNA 4IJLA 3L7ZC 4JOIC 3M4OH 3RZOH 2CCZA 1UEBA 4DV6L 2GN5A 1YHAA 2EIFA 1BBWA 5IP9H 1KRTA 4YY3L 4IPGA 5DLQE 5K36G 1PH2A 1C9OA 3ICEA 4A3CG 2NVTH 3RNUA 3CC7A 1WI5A 4NXMQ 4POGA 2BH2A 2JA5G 1X3GA 2MFIA 4BY7G 1CSQA 2E2IH 5GAGC 2L15A 1KL9A 1Y14B 2GVBA 2I5HA 3KLWA 4QGUA 5C0XI 3G6EA 4A3DG 4NPSA 1RIPA 4A3IG 1U0LA 3SGIA 1WOCA 2JEAI 1Y1WH 4B3ML 4HJAA 2N49A 3LGJA 5J3BA 1YZ6A 4A3JG 4QJFA 4LF5Q 2JE6I 3A74A 2RHSB 2NZHA 1A62A 4YWLA 4A3LG 4BA1I 1IXRA 2IHEA 3RR5A 5LMNQ 4IOCA 1CKNA 4K0KQ 4DKAC 5IYDG 1EIFA 1HZBA 3KJPA 4X62Q 2VUMH 1SROA 1MJEA 4A3IH 4L5TA 1XNQQ 2BA1A 2Q2HA 4QQBX 1HNZQ 4DUZQ 3NEMA 4GOPA 4NXML 3PV0A 5ELNA 1Q82C 3MXNB 1VQ6A 1WYDA 4GNXA 2IX0A 5IWAQ 1C7YA 1GD7A 4TVAB 1I50H 4B3SQ 2OTJA 3RZDH 1B7YB 2NVXH 4A3FG 1K73C 3PSIA 2OQ0A 1NMGA 1KC8C 4LF9Q 2MO1A 2ASBA 4AQYQ 3HOVH 4DR7Q 2VY3A 4LF5L 1JT8A 1AH9A 3A5ZB 4A3GG 2KHIA 1VQFA 3I56A 4IFDG 2JA7G 3HOWG 1NBWA 3CC4A 1WFQA 2BH8A 2HQLA 3J81i 5LMNL 4GKKQ 1KRSA 2HIXA 3HOXH 1X9NA 4K0KL 4DV2Q 4X6AH 4X62L 3I4NG 2RCNA 3PUVA 2A8VA 4JBJA 1E22A 4C2MH 2UU9Q 2HT1A 1NMFA 1XNQL 2R92H 2PI2E 1HNZL 4DUZL 1YI2A 3H3VI 4R4OA 1WCMH 2XTIA 3CCMA 5GADC 1N9WA 2OWOA 2DGYA 2K4KA 4PG3A 3KFUA 2JJQA 2R7ZH 5M5WH 3HOYH 3S1RH 2PQAA 3D0FA 2YTVA 4AIMA 5IWAL 2MNAA 2Q2UA 4B3SL 3S14H 3GTPH 1EYGA 1QUQA 1SN8A 2VQEQ 2QA4A 3A5UA 4HIMA 4LF9L 1B70B 4DR7L 4AQYL 1S3OA 3CCSA 1PH3A 1K0RA 3CQZH 1YBYA 4BXXG 1H95A 4JI3Q 3FHWA 2F4VQ 3F8TA 4DV0Q 1ASYA 4HJ7A 3HOUH 2YTYA 5IP7G 2OCEA 1KHIA 4GKKL 1J6QA 3FKIH 5IYCG 3EIVA 4DV2L 1L1OB 1KD1C 4L5SA 3DLLA 2UU9L 2F52A 1N32Q 4BBSG 1VCIA 2B63H 4ALPA 3GD7A 3GTGH 3AEVA 2N78A 3H0GH 3W5OA 5LMUQ 3U50C 1VQ5A 1Q8KA 1Y1VH 3HKZE 4BXXH 1W2BA 1V43A 4YCVA 3TREA 5HGQA 4HIKA 5GAHC 4EX5A 5FLMH 1PH7A 3I4MG 3PO2G 3E9IA 2VQEL 1YHBA 1VQMA 4BA2I 4LW1A 4DV6Q 3HOZH 4L5RC 1OXVA 1XPOA 3KOJA 2VL6A 3J81j 1Q1BA 3E0EA 1I3QH 4MTNA 1IBKQ 2JA6H 1I6HH 1FGUA 2ZTCA 4A3BH 3PF5A 4JI3L 1K83H 2F3IA 1WJJA 4DV0L 2F4VL 3CMEA 4LF4Q 3AQQA 3HKZG 2E5LQ 4A3MG 4EQ5A 4YCWA 3PO3G 2K5NA 1L0WA 2ZJQA 1QVFA 2E2HH 2QGQA 4OX9Q 1X54A 1EQQA 5M5YH 2ZTEA 1VQ4A 1N32L 2LXKA 2CKZB 1VQOA 2NZOA 4Y7NH 4LF8Q 2HHHQ 3K8AA 1XMQQ 4A93H 3UE1A 1G51A 5LMUL 4LFCQ 4WJ3M 4ME3A 5JJIA 2YU9H 1PH9A 2WB1E 3GO5A 3L0OA 3CPWA 4GOPC 1VQ7A 2ZTDA 2CFMA 3OTOQ 3TS2A 2B29A 5IE8A 1N36Q 4GNXC 1CSPA 4LWCA 3JC66 1IBKL 4DAYB 1D7QA 2RHQB 4A3KG 4NXNQ 4A3EH 1E7ZA 4KHZA 3RLOA 1OXXK 2PI2A 5IY0A 3CCQA 4LF4L 2WB1G 2E5LL 3GTLH 2K5VA 1RL2A
chains in the Genus database with same CATH superfamily
1LTID 1CQFA 3G6JB 2ZJRA 4DV7Q 2A19A 4LF8L 2HHHL 3TP5A 5L37A 1WD0A 1BQQT 1JE5A 2HCCA 3FDTA 1HNXQ 1NJIC 1PH4A 2A6ED 3S1RB 1EIGA 1YHQA 1Z7TA 2HDLA 3GTPB 1YJ9A 1SYDA 4DR3L 3S1NH 2FINB 1N36L 2F0GA 2NVQB 4A3DH 3CKIB 4C3HH 2F0IA 3CU7A 2IHFA 2WINB 3S2HH 4DR2Q 4DAVA 1C8CA 4OO1G 4K5WA 2KHJA 2PW5A 4DNTB 5FLXc 2EVBA 5JVG3 4A3LH 2VS1A 4ABNA 4JI0L 5FJ8G 1WD1A 1EQTA 4QMGA 2VZAA 1EEID 3L3OC 1Y1VB 2A68D 3DEPA 3S9WA 3J80E 2K33A 1EOVA 4R4QA 5C4HA 5KIXA 3CCEA 1AFPA 3S1MH 1J8IA 1SE8A 3KDFA 1I3QB 1I6HB 1H9MA 1HZAA 2VB3X 5FJ8H 3QJYA 3I90A 1K83B 4DK1A 2FMCA 4DR4L 4XQNA 2ZM6Q 1TWGH 1NTGA 4ODGA 4IFDH 1PRTC 3HOWH 3DMUA 1X55A 2PNHA 4OIJA 3GTKH 4DR5L 1BUVT 1RDPD 3PGZA 4Y7NB 3F2CA 3I4NH 2UXDQ 1X32A 4C3JG 4KY5A 1YNXA 1IBLQ 1PV4A 2B2YA 3CF5A 1KNAA 2ES2A 3CCJA 1NE3A 4DV5L 2K7VA 3ERSX 1EY6A 5C3EG 3T1YL 1IKMA 2N88A 1G8ZD 4LF7L 2KHSA 4IJHA 2E2IB 5E1FA 2Q8IB 4M1UB 5IP7H 1VQEA 1F9SA 2HIVA 4DNIA 3UE0A 3Q24A 4PZ8A 3D4RA 4O0AA 1UEAB 4BBSH 2RSOA 4RGNA 5ELCA 4U68A 5M3FG 2IPKD 5C0XG 1B2TA 1WTRA 2JA5B 1JORA 4RKLA 2DNCA 4BY7B 1YVCA 4HCSA 4JI5L 1I4RA 3DEOA 1CA6A 1B8AA 1XXGA 2JA8G 1JB3A 3H15A 1S40A 1ILQA 1JR0D 1L2FA 1X3FA 4AYBE 1NUCA 3RLNA 3MHBA 4GS3A 3STBC 4JI4L 3PO3H 1RTOA 2Y0SE 3KBXA 1GUWA 1EUJA 5I9PA 2N55A 4LMQD 5ELFA 3TEHB 5EPLA 2KECA 1QVCA 4QL5A 4PMWA 5D65A 3GTJB 1PZKD 2R61A 3D31A 2L5TA 2WAQE 4A75A 4HJ8A 2SNMA 1JJ2A 3VR2A 4B3TL 1ESFA 4HTHA 3I4OA 3N52A 4KHPQ 5C0XJ 1VQLA 3CAMA 4TKOB 1GO3E 4NKLA 2MUYA 1ASZA 2JA7B 3A0JA 3S14B 3U9SA 2L9HA 4ID6A 5JEAG 4CKEA 4H44C 1SRUA 3WDNA 2VUMG 1VQ8A 1HCZA 2P5ZX 4UY8C 1WTHA 2RDGA 1TWCH 2JN4A 4JW0A 1Z47A 3R2IA 2B2YC 5KYLA 3PUZA 4KK7A 4Q5VA 1VQPA 4JBKA 3RD4A 4N9TA 1FL0A 1HNWQ 3UDXA 4JV5Q 1ICFB 5CMDA 1VQ9A 4C3IH 1R4PB 1F9RA 1S5ED 1IL8A 1D1KA 4JOIA 4HMJA 4JI7L 1LTSD 4BWGB 3EQLC 1TT2A 2NBFA 1YJWA 4QB4A 4A3BB 3TRZA 1XNRL 1HPCA 4K2KA 4JI2L 4LUVA 1HRJA 1V9PA 5C4ZA 2BDNA 3U4ZA 1NR4A 5FLXL 1K8OA 4RMFA 1JICA 2RDFA 1BKBA 5BN3A 1OTCA 1TS2A 1XMOQ 5C3XA 4DV1Q 2MO0A 1VQDA 4FF2A 5C44H 5LL6X 1XPUA 3SK8A 3RLFA 1DCZA 3A8JE 3TQYA 3CPFA 1HQMC 3HKZB 4A3MB 1SEBD 3J81E 2KCTA 5EKLA 1T9HA 5IYBH 4FXKC 1EWCA 4X64L 1IBML 2D5DA 4IUPA 4TSSA 5BN5A 1ML0D 1PTOH 2LFNA 1XX8A 4KMUC 5M5XB 3CW2C 2NVQH 4V0BA 1STEA 3BJUA 2MQHA 1Y1VG 3DWQA 1Q7YC 3MFGA 2R3ZA 4XYOA 4X3UA 1OXUA 1JMCA 4X65L 2M2LA 4YHHL 4FP5D 4HSVA 2JA6G 2EY6A 2YYZA 2KENA 5C4XH 3SK4A 1O7ZA 2JEBI 2XNAC 2A69D 1ONLA 2WB1B 4X3KA 4IOAA 1QUQB 3KF6B 2RF4A 3I55A 4N8X1 4X66L 3BYYB 2UUBL 1TWFH 1A2TA 2D62A 4A3JB 2JK8A 5EBCA 5FO9B 4O1NA 1K0SA 3G7LA 1SYCA 4IN3A 4X3TA 3STBD 1YJNA 4J15A 1TY2A 1CUKA 4DV3Q 1EFWA 3E5SA 1YIJA 1G6ZA 1SR3A 1S4ZA 4FXDA 1EY0A 5IT9c 2X6GA 4B3MQ 3HZXA 4JI1L 3A7AB 2EYOA 4JOIC 4IJLA 5C4JB 1RODA 3NTKA 4KY6A 2SDFA 5KNCA 4A3FB 1UEBA 2GN5A 4IUQA 4KKTA 1VMPA 1QILA 1FR3A 5K36G 3AU7A 4A3CG 3URYA 2JA5G 4BY7G 1SYGA 2E2IH 2NVYB 2I5HA 3G6EA 4NPSA 1SE4A 1NNXA 1WOCA 2JEAI 5J3BA 3DHQA 3M4YA 4LF5Q 3FVQA 1TS5A 3OHXC 1A62A 3NWSA 4DNRB 4BA1I 2KCCA 3RR5A 1CKNA 1HZBA 1SROA 2CQAA 3BDLA 5NUCA 5CC4A 2BA1A 4I7AA 2NTTA 4NXML 5ELNA 1JWSD 3C1EA 2BCOA 3NBHA 1VQ6A 1JWUD 1C7YA 1GD7A 4TVAB 2PCFB 1G2TA 1QNKA 2MHVA 2OTJA 1B7YB 2NVXH 1K8MA 1LV9A 3I72A 3VA5A 2E74C 1NMGA 2VY3A 1SFOB 3A5ZB 4MIUA 3I56A 2JA7G 2R93B 2AUKA 5CORA 1WFQA 4I65A 3BZDB 5LMNL 1CA5A 3SK5A 4K0KL 2AQ2B 2CVRA 4X62L 3E0JA 1SNCA 2OT2A 4JBJA 2A8VA 2UU9Q 1XNQL 1HNZL 4DUZL 1Y8NB 5IGDA 5DEHA 3I3CA 1JQYD 4NDXA 1QJOA 2RBMA 1TWAB 1TR5A 3OWEB 4QF4A 3HOYH 3D0FA 2Q2UA 3S14H 3DM1A 1SN8A 4HIMA 4BBRB 4LF9L 3X3MA 1RF2D 3CCSA 3CQZH 4FNFA 1IW7D 3F8TA 4DV0Q 3HOUH 4HJ7A 2PQEA 5IYCG 4U673 1KD1C 5CBAE 3T16A 1SBBB 3QWNA 4ZRZA 5KEEA 1R4QB 2LS01 5DM63 2NVTB 4WFN3 4WJWA 5ISRA 3TREA 2XSCA 4HIKA 5GAHC 4EX5A 3BDOA 3PIO3 1MD2D 3KOJA 1Y1WB 2CHBD 1FGUA 2ZTCA 4A3BH 1L0XB 4JI3L 2MGSA 3LWEA 4OELB 4ZLTF 3SVMA 2KCNA 1KDAA 4JK1C 3HKZG 4A3MG 2K5NA 2E2HH 1T5EA 3NTHA 1B53A 2ZTEA 4B9WA 1N32L 1LO5D 2CKZB 1PXUA 1SNDA 1XMQQ 5F2DA 4LFCQ 4ME3A 2YU9H 3HEJA 4FYDA 2DJGC 1XWEA 2F03A 2CFMA 1EU4A 3OTOQ 1LT5D 2CW0C 2Z6BA 4LWCA 1D7QA 1IBKL 4DAYB 1L0YB 2X69A 1EZ8A 1SNOA 2WACA 1STBA 2WB1G 2E5LL 2DNEA 4I7ZC 3PO2G 1A0IA 2JP1A 3Q0AA 4OX9L 4LNQA 1EQVA 2L11A 3J7A5 4JC0A 5IT9L 4P71A 4K8IA 2R92B 2F0QA 3NP8A 5JJLA 3M9BA 1WCMB 2EY2A 4F87A 1QE6A 2A6EC 4OL7A 5DNFA 1HJPA 5GROA 5BR8Q 1XTDA 4V190 2XRSD 4OHJA 3K58A 1QZHA 2PO4A 3MXPA 1SE3A 5IGFA 3NELA 4H0LC 3EN2A 1JB7A 2UUCQ 2CWAA 4A3JH 4PMCA 1IKLA 1CK1A 4C56C 3PIPA 1ICWA 2H1EA 1EOTA 3QO2A 1KXLA 1O7LA 3ZYYX 4XDXA 2C35B 1UNSA 2EY1A 2G9DA 2KOLA 3G71A 4DR1Q 2UUAQ 5IYDH 2LXJA 1KABA 1X3QA 3H0GB 1A15A 3CHBD 1KDBA 4O2DA 3HOZB 3T1HL 3PUYA 4CJ0B 3BVZA 1XPRA 3VR3A 4G57A 4A3FH 4L5QA 4JVZA 4JYAL 1N33L 4DV4Q 4MZ9A 4DUYQ 1KIXA 3S15H 3KJOA 1N34Q 4GKJQ 3CCLA 2JA8B 2JQOA 3ULJA 4GZYC 3KF6A 2HCIA 5M5YB 3GTQB 1BR9A 3T56B 3V96A 2PZWA 1AEXA 2NN6G 2SOBA 4JI8L 2EDGA 3U4VA 5A2QL 3VDYA 1QOHA 3M4OB 2Z9HA 3RZOB 1F9QA 5T1IA 4JI6Q 3J7YW 3EFXD 1QVGA 2K5DA 1A8VA 4LUZA 1H9SA 4LAAA 3AYHB 3KBGA 1CZGA 4OO1I 2B2VC 1CHPD 1B50A 1JOQA 3GTLB 3K5OA 4CDDC 5CBEE 3V2TA 2R93G 4FDBA 1G291 3GDEA 3GTMB 5I2YA 4IFDI 4IPDA 3PUXA 3K7AB 2PNRC 1STHA 1KQSA 5LL6S 4YCUA 2K14A 2F0SA 3K0YA 4UP9A 4QY7A 1XYIA 1TXYA 1GKHA 4YWKA 2VUMB 4A4IA 1JC7A 1GUNA 3A55A 5CGKA 1WVLA 4BBRG 5FO7B 1PYWD 4M8AA 4HJ5A 1MHWC 4KKUA 1HHVA 2KEEA 4GN5A 4KHVA 2V4DA 2K52A 3RZDB 3FMCA 5AJ3L 4KLKA 2DUDA 4LFAQ 1SMXA 4A76A 2WV6D 5IP9G 2B2UA 1Y69U 3CMAA 1P16A 5GQOA 1X65A 4IPHA 4QIWE 3VA7A 1E1TA 3QOJA 1DOKA 1CKMA 3JAMc 2A74C 1PYSB 3FPUB 2KVMA 2OF1A 1V8QA 1Y1WG 4LF6Q 3UI2A 2Z6KA 3HFZB 4Z9CB 4A3GB 1Q8IA 1WTOA 2B39A 3PUWA 1DD2A 4DV3L 2ZJPA 1EWIA 5AFWA 1CTMA 5EJWA 3DWPA 4R9WA 2XWBB 3D6CA 2I5MX 4CDEC 1WTPA 3I7FA 2EJFC 2AWOA 1TS4A 4LFBQ 5I6YA 2F0OA 4UPAA 3J80i 1SMYD 2UXBQ 3M3YB 3P7JA 3L9AX 4L6TB 3K5NA 3HP3A 4RG1A 1J5EL 2QEJC 1EFID 1KAAA 3BZCA 4OEMB 4G7OC 1K3RA 4JPBW 3A8IE 1OO9B 1YNND 1CQVA 4NMZA 4OWTB 2EY5A 1Q12A 4B3RL 1VQHA 4OO1H 4PQXA 2Z4IA 3G4SA 1A2UA 2JA6B 4TQUS 1JCKB 3F2DA 4EQNA 2R92G 4P75A 2JA9A 1WCMG 1ENFA 3ULPA 1CKNB 4RWSC 3I4MB 3P75A 3RN5A 4DPGA 4R4CA 4F7XA 1PZJD 2FXQA 1PVOA 4OONA 3TS0A 1GM5A 4DR6Q 4APVA 2EYPA 1YITA 3CD6A 3NBHB 1O80A 3PF4A 2F0LA 2HUGA 1RHPA 3FKIG 3GTOB 1PLFA 2FFKB 5J22A 2VQFQ 2ALYB 3AFPA 1V1PB 3S17H 5I6WA 2B63G 1AE3A 5EKKA 2B2UC 4C3JH 4K6LA 3ER0A 3H0GG 2I0QA 1F2MA 3I73A 3OYYA 2ICIA 5FLMG 1C0AA 3K80C 3HOZG 3U58A 4ZAIA 5C3EH 3DUZA 1DYQA 3VR4A 2QKIC 1PH8A 1MJCA 1MKHA 2A69C 4IFDJ 4DAYA 2PPBC 4HSPA 2UXCQ 2Z6KC 2IW3A 4K5VA 3FP9A 5G3LD 1JE4A 3OW7A 4P73A 1IZ6A 1STAA 4ZK9B 1FJGL 2E2JB 1A63A 2F0NA 1PFBA 1UE7A 5M3FH 2EYHA 1AP0A 5C0XH 1I4PA 3SEBA 1PH1A 2IT1A 1E2VA 4CJ2C 1HR0L 4NP5A 1STNA 1ENAA 3WOEA 1WTWA 2JA8H 2K01A 2L4NA 4R1JA 1XJVA 2EXZA 1I94L 1HH2P 4KV6A 1H9KA 2B2TC 4CGYB 3GTQH 3PCOB 5E7NA 4IUTA 2XWJB 1BVSA 4C1NI 3M4OH 5JPMC 3RZOH 3MWYW 2EIFA 4MTKA 2A5HA 2SEBD 4J6HA 4YIJA 1JOKA 4FF3A 4ZYSA 4YY3L 5M9OA 3ICEA 2KEDA 3VYTA 4POGA 2BH2A 2MFIA 5GAGC 4IALA 4QGUA 1KL9A 1Y14B 1BCPF 3KLWA 3WOFA 2ZXOA 2F0UA 3LGJA 1YZ6A 1UAPA 3TP6A 3JAML 3A74A 5JEAH 4IUVA 1U4MA 4RHSA 3S1QB 1UUPA 2IHEA 1AZPA 3NE5B 1TWHB 2QCPX 2VUMH 1EIFA 4DXFA 2BE5D 2K5QA 2ZT9C 1PTOF 3Q6SA 3H09A 3PQIA 2ZXPA 2IX0A 1HTLD 4B3SQ 1VF5C 3RZDH 1QG7A 3OSOA 2ASBA 2MO1A 4AQYQ 3K57A 1TS3A 4A3GG 3U9OA 4X3SA 2XIWA 1NBWA 2RVLA 2BH8A 5D3DA 3J81i 4DV2Q 5I9OA 2HT1A 5FK9C 4PMBA 2PI2E 5CV8A 3H3VI 2XTIA 5J1ZA 4OIKA 2EE1A 3RMHA 2X6LA 3S1RH 2PQAA 4AIMA 5IWAL 2F0HA 1GXDC 3GTPH 4FF1A 3A5UA 4C1NK 4DR7L 1F2YA 1WTXA 1CHQD 5LHY1 1PH3A 1K0RA 1KTKA 1IW7C 3NPPA 4BXXG 4IURA 2K05A 2EJGC 3X3NA 2LY7A 2OCEA 3Q22A 4GKKL 2LMCB 1TY0A 1J6QA 1IYUA 3EIVA 2BDOA 4RHRA 1I6VC 4AYBB 4KJNA 5C5MA 1ZXTA 5COYA 1NCVA 4J8QA 3PO2B 3AEVA 5CV9A 1VQ5A 1Q90A 1Y1VH 4BXXH 1RCVD 1LT6D 1EWHA 3I4MG 2J7ZA 1W6JA 2VQEL 2Y0SB 3NK9A 3T4AC 4L5RC 2VL6A 3J81j 1Q1BA 1I3QH 4MTNA 3S2DB 2JA6H 1I6HH 1K83H 2F4VL 2WAQB 1H9SB 2OEOA 3AQQA 2RSNA 1SYEA 2TSSA 1L0WA 3A54A 3A56A 1I4HA 1X54A 2IJ0A 2XVSA 4H13C 2LXKA 4K6DA 5CV5A 4Y7NH 4LF8Q 2HHHQ 2F0EA 5LMUL 4Q0FA 5CV6A 2EPBA 5E4WC 2CH4W 2F0FA 4WRDA 3OIQA 1I50B 3R3OA 3A7LA 3MAQA 2B29A 1N36Q 2NWGA 2E76C 3KLSX 3JC66 3HOVB 4A3KG 1OXXK 4HMIA 4LF4L 1NY4A 1MSHA 3HOXB 3BVMA 4HR7B 2NTSA 1HFGA 4G7ZC 4C2MB 4JI0Q 2QW7A 5ELDA 2FJ2A 5FO8B 5K36H 1D5MC 3UDFA 4GLXA 2R7ZB 4A3CH 4XQJA 4GN4B 2F4IA 2JA5H 3H3VH 2A6HD 4BY7H 1LT3D 3VYUA 1PFSA 1QB5D 4NXNL 2Q2IA 1NR2A 2K28A 2K6AA 5ELBA 1LUZA 3TZUA 2D0PA 4HCEA 3TZDA 3J80c 4DR4Q 3G48A 1DXMA 2TMPA 2AMCB 1H9JA 2I07B 1A3TA 2H5XA 4R8NA 1EU3A 4DV7L 2MPMA 2YV5A 1HXYD 3CCUA 4DR5Q 1V1QA 3GTGB 1MGSA 5IGCA 1QNUA 1HNXL 3RUZA 1V1PA 3GTJH 3OW2A 5BN4A 2BOSA 3CRKC 3K59A 5G3LF 4DV5Q 4MHEA 5FLXE 1CKOA 5JJZA 2AKWB 1BBXC 4PZ6A 3FRPB 3T1YQ 4DR2L 1L1OA 1Y8OB 1HTPA 4LF7Q 4Y52H 4OGQC 3F2UA 2JA7H 1SXTA 5JJKA 4NW2A 2K75A 4R4IA 3W2DA 4A93B 3QB3A 2ID0A 1S5FD 2F0TA 4GOPB 1WTVA 2R6GA 1BO0A 3NENA 2WKDA 1M90C 4JI5Q 1SDFA 1BDOA 3CXCA 4A3EB 1ZKOA 2MP1A 1FYCA 1MIUA 3K5MA 3FEWX 2ZM6L 3UDIA 3E6ZX 3H6MA 2GVAA 1IYVA 1AE2A 2VW9A 3BDCA 4JI4Q 5IYCH 1ZEQX 2UXDL 1I5FA 2Z0SA 1GUGA 1IBLL 1VDZA 4XIGS 1YNJD 3S24A 1UWVA 5EPKA 1GVPA 3GV3A 2JXMB 1EYDA 1EY7A 3W1BA 3S1NB 4PZ7A 4A3DB 4A3IB 4B3TQ 2B3GA 2Z8LA 1PMRA 1SSOA 3M7NA 4JG2A 1SNQA 1K28A 1BOSA 2O4XA 1ZYRD 2AHOB 2VB2X 4IPCA 1A3UA 4A3MH 1FNVA 3MTSA 2B2VA 3ZJYC 2Q2TA 3NXWA 3LX0A 4PV1C 5C6AA 1ET9A 3A8KE 4JCVE 1EY8A 2O5IC 4AYBG 5M5XH 3DWAA 4UP7A 4RFBA 5KNDA 5EQ0A 1EYAA 3S1MB 4WJ4A 2Y0SG 1DGSA 1X6OA 5H1SE 3K6OA 3BYTB 4FO2A 3CC2A 3D3RA 2M9VA 3CP0A 1JJCB 1TWGB 2B2WA 5M5WB 1H9RA 4OXPA 3IRBA 2FMMA 3HOWB 1L1OC 1F2LA 2WAQG 4JI7Q 3K7UC 3VR5A 3PO2H 1PRTF 3OIPA 3GTKB 3KYHC 1K8AC 1GJXA 1HUNA 2IX1A 3SK6A 4P74A 1VQNA 2LSSA 1XNRQ 4JI2Q 2MJ8A 1U5KA 2VNUD 1CFMA 3S2DH 3FKIB 2NUCA 1SMYC 1SLJA 1T5XD 1DJRD 5JVH3 2B63B 3BVGA 5E3FA 4KHPL 4DGZA 4ZUIA 1E1OA 1K8GA 5ELOA 4EQPA 3HOVG 2IX3A 1YNNC 1VQKA 1HFNA 1KLUD 1EEFD 1W6KA 3BZKA 4KN7C 4ZKCB 3FPPA 5CV7A 1Q46A 3HOXG 5CV4A 1LTTD 5C4JH 2WFWA 4X64Q 2F0PA 1IBMQ 3GQBA 1M4VA 3J80L 1OXTA 1LYLA 4OWXB 2H4OA 3J81c 1EL0A 1C4QA 1HQRD 2R7ZG 3I8ZA 1HZ9A 1IYJB 1HZCA 1HNWL 1JWMD 3SE0A 1BCPD 1E0BA 3J7ZC 4JV5L 1GUOA 2NVYH 2G5DA 4X65Q 3NTIA 4YHHQ 2V1CC 2JYOA 3PIOA 1TQOA 2E2DC 4CJ1B 3PO3B 4AH6A 4X66Q 3HKSA 4R4TA 2O2LD 4RAUC 1UE5A 1OXSC 2UUBQ 3EBEA 2D0OA 1S72A 3MEHA 2NN6H 1EIYB 1PTOD 2RKSA 2NYZD 4PNYA 2B8FA 3OOCA 5C5LA 3D8GA 3MEFA 1VQIA 1GHKA 3DM3A 1XMOL 4DV1L 2WP8J 1X56A 1FGBD 2XRQD 4DK3C 2PQAB 4XT1B 4GN3B 3K0XA 3VYSA 3EROA 4JI1Q 1SFOH 2B2WC 3M4QA 1VQAA 1DOMA 2R93H 2XGTA 3H94A 1EQRA 5M3MB 3UDGA 2KCMA 4K14A 1Z9FA 3CCRA 3SR1A 4A93G 4K2LA 1V1OA 2I5LX 5E4XA 2RDHA 1QZGA 3VR6A 1TWAH 1E2WA 1G2SA 1FNWA 2B8GA 5IOCA 2KA7A 2WKCA 1EY9A 4C3IB 2ATWA 1KAWA 3GP7A 4A3EG 4BBRH 1DZ1A 4HJ9A 1PFMA 4J1MA 2KBNA 3L7ZC 4EQOA 1ET6A 5IP9H 3HGBA 1KRTA 3QG1A 4KJOA 4IPGA 1BCPB 3M7GA 1PH2A 3KK7A 2NVTH 3CC7A 3MVVA 4NXMQ 1X3GA 1CSQA 2L15A 4F88A 2GVBA 5C0XI 2KQ3A 1B44D 4A3DG 1RIPA 4A3IG 1U0LA 5C44B 1DM0B 4C3HG 2F0DA 4ZKBB 1Y1WH 5A35A 4HJAA 4B3ML 4HN7A 4QJFA 1LT4D 2EJMA 2RHSB 2NZHA 4N8FA 4A3LG 4RCNA 4EVOA 1IXRA 5LMNQ 1PTOB 2B2TA 4K0KQ 4DKAC 3KJPA 2BE5C 4X62Q 5EBDA 1MJEA 4A3IH 4QUCA 1XNQQ 2Q2HA 4CDFC 1HNZQ 4DUZQ 3LWUA 3NEMA 1TIID 4GOPA 2F3WA 2EYMA 4HAEA 1WYDA 4GNXA 4UDUC 5I4DA 2QDLA 1K73C 1IHZA 3KF8A 1CT1D 3PSIA 2OQ0A 5C4XB 4LF9Q 3D4DA 4LF5L 5DAUA 1VQFA 4IFDG 3MC0B 3HOWG 3D6WA 2DY7A 4CKBA 4DA2A 5K5PA 1TWFB 2F0JA 1X9NA 5CR3A 3I4NG 2RCNA 1E22A 4EGVA 5CYUA 2G9HD 2R92H 3KLSA 1SYFA 2ENBA 3C46A 2K1BA 4R4OA 1WCMH 3NQTA 5GADC 3TP8A 3MA2B 4PG3A 3KFUA 2JJQA 4MN3A 5DM73 5M5WH 5A2QE 5KRUA 3R2TA 1EYGA 2K32A 2K03A 3J7AV 3ITPA 3J81L 5IIFA 4JI3Q 1PDQA 5HGTA 1F9PA 2YTYA 5IP7G 1KHIA 1ESRA 5D14A 3FKIH 4K5XA 1L1OB 4O42A 3BS1A 4A3KB 4L5SA 3DLLA 2UU9L 3TN2A 3I70A 1N32Q 4BBSG 1LABA 3GV6A 2B63H 3ND9A 3P1HA 4TRDA 2N78A 3H0GH 3U50C 1Q8KA 3HKZE 1V43A 5FLMH 1PH7A 1YHBA 1J9OA 4BA2I 4DV6Q 3HOZH 1OXVA 1XPOA 4L63B 1HUMA 4QIWB 1R9TB 1IBKQ 3PF5A 4RGTA 4RH6A 3HS0C 2F3IA 1WJJA 4DV0L 2E5LQ 4EQ5A 3PO3G 2KUMA 4OX9Q 5M5YH 3IL8A 4B08A 2PZTA 3K5LA 3UE1A 2RA4A 4WJ3M 1PH9A 2EYJA 2WB1E 1VF7A 4GOPC 2ZTDA 4G4KA 4XT3B 2NVXB 4GNXC 1BNZA 1CSPA 5EGTA 1B1ZA 2RHQB 2EYLA 4XQQA 3RLOA 3GTLH 1HA5A 1KLGD 1ENCA 1SE2A 2OXPA 5M3MG 3GTMH 2CH4A 5J39A 4KKSA 2NB0A 3MXNA 3E3XA 3K7AH 1XMQL 4LFCL 3W3AA 1E3PA 1O7YA 3HOYB 1FVIA 4LUOA 2L12A 2A6HC 1F2ZA 3S16B 4GLAC 1G6PA 1MSGA 2AWNA 3OTOL 1VQGA 3KLRA 3KUPA 4G7HC 3QOLA 3T1HQ 5I2XA 3CQZB 1UE6A 3MFYA 4C3IG 2F1MA 5M3MH 4JYAQ 4WORA 1N33Q 2QF7A 1LLRD 2N3SA 2J0TD 3L2PA 3HOUB 1LTAD 4RKBA 4CKCA 2AQ3B 1HR0W 2FHTA 2JSOA 1PA6A 3IFTA 1FD7D 3CRLC 3MXGA 1O78A 4RA8A 4RCOA 1YEZA 1CM9A 3IKJA 4DAPA 2LKVA 4JI8Q 3HRZC 4DK6C 5GAEC 3EA6A 4QUFA 5BR8L 2CWPA 4RGMA 4FXGC 2K50A 2M00A 1D8LA 1B3AA 1D2BA 3SDZA 1JJGA 2DN8A 1UE1A 2PW7A 5C44G 2UUCL 1STYA 2K5HA 3M85A 2D9UA 5JEAJ 1PFNA 4A3GH 2F0KA 1Q81C 5C3WA 1PZID 1PRTD 2E2HB 1U4LA 5IYBG 4BY1B 3NHHA 2R7FA 4DR1L 2UUAL 1DOLA 4UP8A 2YU9B 3HG9A 2L0CA 4DN4M 3MZ5A 2AUJD 4NB3A 3DXJC 1XTCD 3E9HA 5HY6A 3M3YH 3OWFA 3NUCA 5IGGA 3RN2A 4B9XA 4DV4L 4DUYL 1B4OA 5C4XG 2C5CA 1N8RC 1N34L 3C2PA 4GKJL 1K9MC 5IGEA 2ICEC 3NWTA 1TVXA 5AJ3Q 3BU2A 1CZWA 1BXTA 3EJIA 1YNJC 1BF4A 2EOTA 1VQCA 3WWVA 5KYIA 4JI6L 1SYBA 3I4MH 1SNMA 4FVMA 1Q1EA 4P72A 3T51B 3QIAA 4KI0A 2NZ1D 4CHTB 4XXEA 1X3EA 1U4PA 4POFA 4KN4C 1ZYRC 2J4XA 2Q8TA 3D4WA 1EYCA 1P8LA 3M4PA 3I2ZA 1M8AA 2YTXA 5JOBA 1LM0A 3ERQA 4DR3Q 1Q86C 2GA4B 3GTOH 4KD3A 3N6RA 1EIHA 1D1IA 2PZUA 1VS0A 4JBWA 3R93A 2A73B 1B9NA 4LK1C 4H02A 2EXDA 3AFQA 2IY5B 1WTQA 1Q3LA 3TSSA 1F77A 1PRTB 1J5EQ 1PH5A 2EQSA 5T1GA 3JAMi 4A3KH 3CCVA 1DONA 3S15B 3AB9A 5KNBA 2I46A 4DK0A 4HIOA 4ULLA 4B3RQ 3ONAB 2D2CC 2L1BA 3TDQA 3JAME 4LFAL 5EAYA 1B3QA 1VMCA 5JAVA 2K04A 2E2JH 4CDCC 4XTCS 3IAYA 2F0WA 1LTBD 3C3LA 1R9TH 4ME5A 1PYBA 3QR8A 3W1GA 2Z4HA 4IUNA 4HEDA 1IL2A 1S5BD 4DAMA 4LF6L 2PMZE 2RQXA 4DXGA 3J7AF 4QCLA 3I4LA 1VQJA 4KY7A 1I4QA 1MI2A 2E75C 3H91A 2R7DA 4GLVB 2Q8RE 4P2CB 5D3IB 1LTGD 1Z6HA 1O7IA 2HQEA 2IL8A 4LFBL 1M1KC 3HOYG 2UXBL 1BCPC 3V05A 3PIP3 1LTLA 2HD3A 4RGOS 2N8NA 4ZQ3A 3F2BA 4GNXB 1BBUA 1KNEA 3Q8DA 3HOUG 3TMEA 2QILA 4ZCKA 2A1AA 2AQ1B 3KF8B 1U9RA 3S1QH 3S16H 1TWHH 4YWMA 2O5JC 1FJGQ 1TU2B 4OWWB 1I4GA 1PTOC 3ULLA 1PHJA 2OQKA 5KGUA 4KD4A 5IGBA 1EY4A 1VQBA 4HIDA 1HR0Q 3KDFB 4IO9A 1II3A 4DR6L 1E24A 1GOZA 2BA0A 1EZ6A 4A3BG 1I94Q 2E8GA 1ILPA 3OMGA 2OTLA 2QDBA 3K81C 2QEXA 4JBMA 4MNOA 3I91A 2IWHA 4C3HB 5LMNW 4BY1G 1X3PA 2VQFL 1PH6A 3S2HB 3F1ZA 1LTRD 1RD9D 1AN8A 5IODA 4YY3Q 4F8MA 3P20A 4L8JA 4E6IA 1CI3M 2NN6I 3B6YA 1A3VA 2CQOA 2EYFA 4BY1H 1W3SA 2UXCL 1RJTA 1QWYA 5JPNC 4CBVA 3PMFA 2CCZA 3IFDA 4DV6L 1YHAA 1BBWA 2K5WA 5EPJA 5DLQE 3O13A 5FKAC 1NSNS 1C9OA 1D5XC 3RNUA 4H7BA 1WI5A 1SNPA 1KDCA 3I4NB 4S3SA 2SNSA 1K3BC 1Y8PB 1QCBD 1NAPA 3SGIA 4FF4A 2PMZB 1RTNA 2N49A 4A3JG 2JE6I 1U4RA 4YWLA 1STGA 3OPOA 2F3VA 2KJXA 4IOCA 2RCFA 5IYDG 3S17B 4C3JB 1LACA 3T53B 4ILWA 3H3VC 4L5TA 4IQZA 1MBYA 3OMCA 4QQBX 5ELEA 2VXWA 3PV0A 1Q82C 3MXNB 4K8JA 3NSWA 5IWAQ 4BS9A 5C3EB 1I50H 4BBSB 1SJHD 2DJFC 4A3FG 3SHLA 1KC8C 4LJZC 1E2ZA 4DR7Q 3HOVH 2EZVA 1JT8A 1AH9A 1S5DD 2A68C 2KHIA 3ND8A 3CC4A 3Q23A 2HQLA 4GKKQ 1KRSA 2HIXA 3HOXH 4X6AH 4DU9A 3PUVA 4R8IA 4C2MH 1NMFA 5M3FB 1YI2A 1C48A 3CCMA 2OWOA 1N9WA 2DGYA 3R8BA 2C9OA 2K4KA 5HURA 2R7ZH 3EVQA 2YTVA 2MNAA 4B3SL 2F0MA 1QUQA 2VQEQ 2QA4A 4KTAA 1G91A 1B70B 3NQIA 4AQYL 4IZ8A 4UAIA 1S3OA 3BG3A 5FOBB 3MXUA 1I4XA 1YBYA 2L55A 3VYRA 1H95A 5TSSA 3FHWA 1RKNA 2HDMA 2F4VQ 1ASYA 1FNUA 4DV2L 1AZQA 4N9PA 2F52A 1VCIA 3AMUA 1JOOA 3TP7A 4ALPA 3GD7A 3GTGH 3W5OA 5LMUQ 4ZUJA 1W2BA 4YCVA 5HGQA 1SJED 3E9IA 1VQMA 3T13A 4LW1A 3LNNA 1TWCB 1A6XA 3TBIB 3E0EA 2Z1CA 4IUUA 4XYQA 2DY8A 5EKIA 1GUSA 4UHVA 3CMEA 4LF4Q 1AW7A 1EY5A 2F0VA 4YCWA 3C1FA 2ZJQA 1QVFA 2PYKA 2QGQA 1EQQA 1VQ4A 1VQOA 2NZOA 2XN9C 3K8AA 2WIIB 1TKWB 1D5ZC 4A93H 1GHJA 1G51A 5JJIA 1SAPA 3SXHA 4DF7A 4DFAA 1HA6A 3L0OA 3GO5A 1GUTA 3CPWA 1VQ7A 1D6EC 3TS2A 5IE8A 2ZXRA 2CW0D 5IT9E 4NXNQ 3NBIA 4A3EH 1E7ZA 4KHZA 2PI2A 3CCQA 5IY0A 1B9MA 2K5VA 1RL2A 1S5CD
chains in the Genus database with same CATH topology
1A0IA 4OX9L 2ZJRA 4LNQA 4DV7Q 3J7A5 2A19A 4JC0A 4JI0Q 5M3MG 4P71A 3GTMH 4LF8L 2HHHL 1XMQL 3K7AH 5JJLA 3M9BA 4LFCL 1JE5A 1E3PA 1NJIC 1HNXQ 3UDFA 4GLXA 1PH4A 4A3CH 1YHQA 1FVIA 4LUOA 1HJPA 1G6PA 4GN4B 4GLAC 5GROA 1XTDA 5BR8Q 1YJ9A 2AWNA 3OTOL 2JA5H 3H3VH 4DR3L 3S1NH 1N36L 1VQGA 4BY7H 1QZHA 1PFSA 4A3DH 3T1HQ 4NXNL 2Q2IA 1UE6A 4C3HH 3NELA 5M3MH 2IHFA 4JYAQ 3EN2A 1JB7A 1LUZA 4DR2Q 2UUCQ 1N33Q 2CWAA 2D0PA 3J80c 4A3JH 2N3SA 4DR4Q 3L2PA 3PIPA 4OO1G 2KHJA 3G48A 5FLXc 2AMCB 4A3LH 2H5XA 2VS1A 4DV7L 1HR0W 1KXLA 2YV5A 4JI0L 3CCUA 5FJ8G 2C35B 1PA6A 3G71A 4DR1Q 4DR5Q 2UUAQ 5IYDH 2LXJA 1V1QA 2VZAA 1HNXL 1YEZA 4JI8Q 4DK6C 3GTJH 5GAEC 3OW2A 5BR8L 4O2DA 2CWPA 4DV5Q 2K50A 1EOVA 4R4QA 1CKOA 1D8LA 3CCEA 3S1MH 3T1HL 1SE8A 3KDFA 2AKWB 3PUYA 1XPRA 1JJGA 4A3FH 1HZAA 1UE1A 4L5QA 4PZ6A 5FJ8H 4JYAL 5C44G 4DR2L 3T1YQ 2UUCL 1L1OA 2K5HA 1N33L 4DV4Q 4DR4L 4MZ9A 3M85A 4DUYQ 1KIXA 4LF7Q 4Y52H 5JEAJ 3S15H 3KJOA 1TWGH 1NTGA 2ZM6Q 1N34Q 4A3GH 1Q81C 3CCLA 2JA7H 3HOWH 4GKJQ 1X55A 5JJKA 2JQOA 2K75A 4R4IA 3ULJA 3KF6A 2PNHA 5IYBG 3GTKH 2R7FA 4DR5L 3PGZA 4DR1L 2UUAL 3F2CA 3I4NH 2UXDQ 4UP8A 2ID0A 4GOPB 1YNXA 1IBLQ 2NN6G 1PV4A 4JI8L 3CF5A 3VDYA 3U4VA 3S2HH 2ES2A 3CCJA 1NE3A 4DV5L 4JI6Q 1QVGA 2R6GA 4NB3A 3NENA 1A8VA 4LUZA 1M90C 3E9HA 3ERSX 5HY6A 4JI5Q 5C3EG 3AYHB 3CXCA 3M3YH 3RN2A 3T1YL 4OO1I 4DV4L 1MIUA 4DUYL 4LF7L 5C4XG 2ZM6L 1N8RC 3UDIA 1N34L 4GKJL 4IJHA 1K9MC 2GVAA 1AE2A 2R93G 5IP7H 1VQEA 2HIVA 4DNIA 4FDBA 2VW9A 1G291 3GDEA 5IYCH 4JI4Q 3UE0A 4PZ8A 4IFDI 4IPDA 3BU2A 3PUXA 5AJ3Q 2UXDL 4O0AA 1I5FA 2Z0SA 1IBLL 4BBSH 4XIGS 1KQSA 1VQCA 3S24A 4YCUA 3WWVA 1UWVA 2K14A 5M3FG 4UP9A 5C0XG 1GVPA 4QY7A 4JI6L 1TXYA 1GKHA 4YWKA 3W1BA 4A4IA 1YVCA 3I4MH 4JI5L 1Q1EA 4P72A 1B8AA 4PZ7A 2JA8G 4KI0A 4B3TQ 2B3GA 3H15A 3M7NA 4JG2A 1S40A 1L2FA 1X3EA 1X3FA 4BBRG 4AYBE 4POFA 3RLNA 4HJ5A 4GS3A 2AHOB 1P8LA 3M4PA 4IPCA 3STBC 3I2ZA 2YTXA 4GN5A 2K52A 4A3MH 4JI4L 1LM0A 4DR3Q 3PO3H 1Q86C 3ZJYC 5AJ3L 4KLKA 2Q2TA 2DUDA 2Y0SE 3GTOH 4LFAQ 1SMXA 1EUJA 4A76A 3TEHB 5IP9G 1QVCA 1P16A 5GQOA 3CMAA 4JCVE 1VS0A 1X65A 4IPHA 4QIWE 4QL5A 4PMWA 4AYBG 5M5XH 4UP7A 4JBWA 3D31A 1E1TA 2WAQE 4A75A 1CKMA 3JAMc 4HJ8A 1PYSB 2EXDA 4H02A 1JJ2A 3AFQA 4B3TL 2IY5B 4WJ4A 3I4OA 2Y0SG 1DGSA 1X6OA 5H1SE 4KHPQ 5C0XJ 1J5EQ 1PH5A 2EQSA 1Y1WG 3JAMi 3CAMA 3CCVA 4A3KH 1VQLA 1GO3E 2Z6KA 3CC2A 3CP0A 4LF6Q 1JJCB 3HFZB 1ASZA 4OXPA 3IRBA 1L1OC 3A0JA 4HIOA 2WAQG 5JEAG 4JI7Q 3K7UC 3PO2H 4B3RQ 1SRUA 3PUWA 4DV3L 2ZJPA 3KYHC 1EWIA 1K8AC 4LFAL 2VUMG 1VQ8A 5EAYA 2IX1A 1VQNA 4P74A 4UY8C 2LSSA 1XNRQ 4JI2Q 1U5KA 2E2JH 2I5MX 2VNUD 1TWCH 4XTCS 3I7FA 1Z47A 3S2DH 2AWOA 1R9TH 4A3BG 4JBKA 3PUZA 1VQPA 4LFBQ 1PYBA 1SLJA 4UPAA 3J80i 3W1GA 2UXBQ 1FL0A 4KHPL 1HNWQ 1IL2A 3UDXA 1J5EL 4RG1A 4DAMA 1E1OA 4LF6L 4JV5Q 1VQ9A 2PMZE 3BZCA 5ELOA 1K8GA 1K3RA 4C3IH 3HOVG 1VQKA 3BZKA 4JOIA 4OWTB 4JI7L 1Q12A 4B3RL 1VQHA 3G4SA 1Q46A 1VQJA 3HOXG 1YJWA 5C4JH 4TQUS 2WFWA 2R7DA 4X64Q 1IBMQ 1XNRL 4GLVB 3TRZA 4JI2L 4LUVA 3F2DA 2R92G 4P75A 2JA9A 1V9PA 1OXTA 1LYLA 4OWXB 1O7IA 1WCMG 3U4ZA 3J81c 4LFBL 3ULPA 1CKNB 4RMFA 2R7ZG 1M1KC 3HOYG 1HZ9A 2UXBL 3RN5A 1IYJB 4DPGA 1BKBA 1HZCA 4R4CA 1HNWL 2FXQA 3J7ZC 4JV5L 1PVOA 1LTLA 2NVYH 1OTCA 4X65Q 1XMOQ 4OONA 3TS0A 4DV1Q 2MO0A 1VQDA 4YHHQ 1GM5A 2V1CC 4DR6Q 2N8NA 5C44H 1XPUA 4APVA 1YITA 3CD6A 3F2BA 3NBHB 3RLFA 3TQYA 4GNXB 3PIOA 3PF4A 3CPFA 1BBUA 3Q8DA 3HOUG 2A1AA 2KCTA 3KF8B 1T9HA 4AH6A 3FKIG 4X66Q 5IYBH 3HKSA 4R4TA 4X64L 1IBML 3S1QH 1UE5A 1OXSC 3S16H 2UUBQ 2VQFQ 2ALYB 3EBEA 3AFPA 1TWHH 2D0OA 1S72A 3S17H 4YWMA 2B63G 1AE3A 3CW2C 1FJGQ 4C3JH 4OWWB 2NVQH 3ER0A 3H0GG 3ULLA 1PHJA 1EIYB 2OQKA 2I0QA 3BJUA 2MQHA 1Y1VG 1VQBA 3OYYA 4HIDA 5FLMG 3KDFB 4IO9A 1Q7YC 1HR0Q 3MEFA 1VQIA 1C0AA 3K80C 3HOZG 1OXUA 3U58A 4X65L 1JMCA 3DM3A 1XMOL 5C3EH 4DV1L 1E24A 4YHHL 2WP8J 4DR6L 1X56A 1NY4A 2JA6G 2BA0A 1PH8A 1MJCA 2YYZA 1MKHA 4DK3C 2KENA 1I94Q 2PQAB 5C4XH 2E8GA 4IFDJ 2JEBI 4IOAA 3K0XA 4GN3B 2UXCQ 2Z6KC 1QUQB 3KF6B 4JI1Q 1SFOH 3M4QA 1VQAA 2OTLA 2RF4A 3I55A 3K81C 2QEXA 4JBMA 3FP9A 4X66L 2R93H 4MNOA 5LMNW 2XGTA 1EQRA 2UUBL 4P73A 2KCMA 4BY1G 2VQFL 3UDGA 1IZ6A 1TWFH 1Z9FA 3F1ZA 2D62A 3CCRA 1PH6A 2JK8A 1FJGL 1A63A 4A93G 2I5LX 1UE7A 4YY3Q 5M3FH 3STBD 1YJNA 4J15A 1PH1A 2IT1A 1HR0L 1CUKA 4DV3Q 1EFWA 1QZGA 1YIJA 1TWAH 2NN6I 1SR3A 3B6YA 2JA8H 2CQOA 4R1JA 2ATWA 1XJVA 5IT9c 4BY1H 1KAWA 1I94L 1HH2P 1W3SA 4A3EG 4BBRH 2UXCL 4HJ9A 3GTQH 4B3MQ 3PCOB 5E7NA 4JI1L 1BVSA 2KBNA 4IJLA 3L7ZC 4JOIC 3M4OH 3RZOH 2CCZA 1UEBA 4DV6L 2GN5A 1YHAA 2EIFA 1BBWA 5IP9H 1KRTA 4YY3L 4IPGA 5DLQE 5K36G 1PH2A 1C9OA 3ICEA 4A3CG 2NVTH 3RNUA 3CC7A 1WI5A 4NXMQ 4POGA 2BH2A 2JA5G 1X3GA 2MFIA 4BY7G 1CSQA 2E2IH 5GAGC 2L15A 1KL9A 1Y14B 2GVBA 2I5HA 3KLWA 4QGUA 5C0XI 3G6EA 4A3DG 4NPSA 1RIPA 4A3IG 1U0LA 3SGIA 1WOCA 2JEAI 1Y1WH 4B3ML 4HJAA 2N49A 3LGJA 5J3BA 1YZ6A 4A3JG 4QJFA 4LF5Q 2JE6I 3A74A 2RHSB 2NZHA 1A62A 4YWLA 4A3LG 4BA1I 1IXRA 2IHEA 3RR5A 5LMNQ 4IOCA 1CKNA 4K0KQ 4DKAC 5IYDG 1EIFA 1HZBA 3KJPA 4X62Q 2VUMH 1SROA 1MJEA 4A3IH 4L5TA 1XNQQ 2BA1A 2Q2HA 4QQBX 1HNZQ 4DUZQ 3NEMA 4GOPA 4NXML 3PV0A 5ELNA 1Q82C 3MXNB 1VQ6A 1WYDA 4GNXA 2IX0A 5IWAQ 1C7YA 1GD7A 4TVAB 1I50H 4B3SQ 2OTJA 3RZDH 1B7YB 2NVXH 4A3FG 1K73C 3PSIA 2OQ0A 1NMGA 1KC8C 4LF9Q 2MO1A 2ASBA 4AQYQ 3HOVH 4DR7Q 2VY3A 4LF5L 1JT8A 1AH9A 3A5ZB 4A3GG 2KHIA 1VQFA 3I56A 4IFDG 2JA7G 3HOWG 1NBWA 3CC4A 1WFQA 2BH8A 2HQLA 3J81i 5LMNL 4GKKQ 1KRSA 2HIXA 3HOXH 1X9NA 4K0KL 4DV2Q 4X6AH 4X62L 3I4NG 2RCNA 3PUVA 2A8VA 4JBJA 1E22A 4C2MH 2UU9Q 2HT1A 1NMFA 1XNQL 2R92H 2PI2E 1HNZL 4DUZL 1YI2A 3H3VI 4R4OA 1WCMH 2XTIA 3CCMA 5GADC 1N9WA 2OWOA 2DGYA 2K4KA 4PG3A 3KFUA 2JJQA 2R7ZH 5M5WH 3HOYH 3S1RH 2PQAA 3D0FA 2YTVA 4AIMA 5IWAL 2MNAA 2Q2UA 4B3SL 3S14H 3GTPH 1EYGA 1QUQA 1SN8A 2VQEQ 2QA4A 3A5UA 4HIMA 4LF9L 1B70B 4DR7L 4AQYL 1S3OA 3CCSA 1PH3A 1K0RA 3CQZH 1YBYA 4BXXG 1H95A 4JI3Q 3FHWA 2F4VQ 3F8TA 4DV0Q 1ASYA 4HJ7A 3HOUH 2YTYA 5IP7G 2OCEA 1KHIA 4GKKL 1J6QA 3FKIH 5IYCG 3EIVA 4DV2L 1L1OB 1KD1C 4L5SA 3DLLA 2UU9L 2F52A 1N32Q 4BBSG 1VCIA 2B63H 4ALPA 3GD7A 3GTGH 3AEVA 2N78A 3H0GH 3W5OA 5LMUQ 3U50C 1VQ5A 1Q8KA 1Y1VH 3HKZE 4BXXH 1W2BA 1V43A 4YCVA 3TREA 5HGQA 4HIKA 5GAHC 4EX5A 5FLMH 1PH7A 3I4MG 3PO2G 3E9IA 2VQEL 1YHBA 1VQMA 4BA2I 4LW1A 4DV6Q 3HOZH 4L5RC 1OXVA 1XPOA 3KOJA 2VL6A 3J81j 1Q1BA 3E0EA 1I3QH 4MTNA 1IBKQ 2JA6H 1I6HH 1FGUA 2ZTCA 4A3BH 3PF5A 4JI3L 1K83H 2F3IA 1WJJA 4DV0L 2F4VL 3CMEA 4LF4Q 3AQQA 3HKZG 2E5LQ 4A3MG 4EQ5A 4YCWA 3PO3G 2K5NA 1L0WA 2ZJQA 1QVFA 2E2HH 2QGQA 4OX9Q 1X54A 1EQQA 5M5YH 2ZTEA 1VQ4A 1N32L 2LXKA 2CKZB 1VQOA 2NZOA 4Y7NH 4LF8Q 2HHHQ 3K8AA 1XMQQ 4A93H 3UE1A 1G51A 5LMUL 4LFCQ 4WJ3M 4ME3A 5JJIA 2YU9H 1PH9A 2WB1E 3GO5A 3L0OA 3CPWA 4GOPC 1VQ7A 2ZTDA 2CFMA 3OTOQ 3TS2A 2B29A 5IE8A 1N36Q 4GNXC 1CSPA 4LWCA 3JC66 1IBKL 4DAYB 1D7QA 2RHQB 4A3KG 4NXNQ 4A3EH 1E7ZA 4KHZA 3RLOA 1OXXK 2PI2A 5IY0A 3CCQA 4LF4L 2WB1G 2E5LL 3GTLH 2K5VA 1RL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0I A;  4OX9 L;  2ZJR A;  4LNQ A;  4DV7 Q;  3J7A 5;  2A19 A;  4JC0 A;  4JI0 Q;  5M3M G;  4P71 A;  3GTM H;  4LF8 L;  2HHH L;  1XMQ L;  3K7A H;  5JJL A;  3M9B A;  4LFC L;  1JE5 A;  1E3P A;  1NJI C;  1HNX Q;  3UDF A;  4GLX A;  1PH4 A;  4A3C H;  1YHQ A;  1FVI A;  4LUO A;  1HJP A;  1G6P A;  4GN4 B;  4GLA C;  5GRO A;  1XTD A;  5BR8 Q;  1YJ9 A;  2AWN A;  3OTO L;  2JA5 H;  3H3V H;  4DR3 L;  3S1N H;  1N36 L;  1VQG A;  4BY7 H;  1QZH A;  1PFS A;  4A3D H;  3T1H Q;  4NXN L;  2Q2I A;  1UE6 A;  4C3H H;  3NEL A;  5M3M H;  2IHF A;  4JYA Q;  3EN2 A;  1JB7 A;  1LUZ A;  4DR2 Q;  2UUC Q;  1N33 Q;  2CWA A;  2D0P A;  3J80 c;  4A3J H;  2N3S A;  4DR4 Q;  3L2P A;  3PIP A;  4OO1 G;  2KHJ A;  3G48 A;  5FLX c;  2AMC B;  4A3L H;  2H5X A;  2VS1 A;  4DV7 L;  1HR0 W;  1KXL A;  2YV5 A;  4JI0 L;  3CCU A;  5FJ8 G;  2C35 B;  1PA6 A;  3G71 A;  4DR1 Q;  4DR5 Q;  2UUA Q;  5IYD H;  2LXJ A;  1V1Q A;  2VZA A;  1HNX L;  1YEZ A;  4JI8 Q;  4DK6 C;  3GTJ H;  5GAE C;  3OW2 A;  5BR8 L;  4O2D A;  2CWP A;  4DV5 Q;  2K50 A;  1EOV A;  4R4Q A;  1CKO A;  1D8L A;  3CCE A;  3S1M H;  3T1H L;  1SE8 A;  3KDF A;  2AKW B;  3PUY A;  1XPR A;  1JJG A;  4A3F H;  1HZA A;  1UE1 A;  4L5Q A;  4PZ6 A;  5FJ8 H;  4JYA L;  5C44 G;  4DR2 L;  3T1Y Q;  2UUC L;  1L1O A;  2K5H A;  1N33 L;  4DV4 Q;  4DR4 L;  4MZ9 A;  3M85 A;  4DUY Q;  1KIX A;  4LF7 Q;  4Y52 H;  5JEA J;  3S15 H;  3KJO A;  1TWG H;  1NTG A;  2ZM6 Q;  1N34 Q;  4A3G H;  1Q81 C;  3CCL A;  2JA7 H;  3HOW H;  4GKJ Q;  1X55 A;  5JJK A;  2JQO A;  2K75 A;  4R4I A;  3ULJ A;  3KF6 A;  2PNH A;  5IYB G;  3GTK H;  2R7F A;  4DR5 L;  3PGZ A;  4DR1 L;  2UUA L;  3F2C A;  3I4N H;  2UXD Q;  4UP8 A;  2ID0 A;  4GOP B;  1YNX A;  1IBL Q;  2NN6 G;  1PV4 A;  4JI8 L;  3CF5 A;  3VDY A;  3U4V A;  3S2H H;  2ES2 A;  3CCJ A;  1NE3 A;  4DV5 L;  4JI6 Q;  1QVG A;  2R6G A;  4NB3 A;  3NEN A;  1A8V A;  4LUZ A;  1M90 C;  3E9H A;  3ERS X;  5HY6 A;  4JI5 Q;  5C3E G;  3AYH B;  3CXC A;  3M3Y H;  3RN2 A;  3T1Y L;  4OO1 I;  4DV4 L;  1MIU A;  4DUY L;  4LF7 L;  5C4X G;  2ZM6 L;  1N8R C;  3UDI A;  1N34 L;  4GKJ L;  4IJH A;  1K9M C;  2GVA A;  1AE2 A;  2R93 G;  5IP7 H;  1VQE A;  2HIV A;  4DNI A;  4FDB A;  2VW9 A;  1G29 1;  3GDE A;  5IYC H;  4JI4 Q;  3UE0 A;  4PZ8 A;  4IFD I;  4IPD A;  3BU2 A;  3PUX A;  5AJ3 Q;  2UXD L;  4O0A A;  1I5F A;  2Z0S A;  1IBL L;  4BBS H;  4XIG S;  1KQS A;  1VQC A;  3S24 A;  4YCU A;  3WWV A;  1UWV A;  2K14 A;  5M3F G;  4UP9 A;  5C0X G;  1GVP A;  4QY7 A;  4JI6 L;  1TXY A;  1GKH A;  4YWK A;  3W1B A;  4A4I A;  1YVC A;  3I4M H;  4JI5 L;  1Q1E A;  4P72 A;  1B8A A;  4PZ7 A;  2JA8 G;  4KI0 A;  4B3T Q;  2B3G A;  3H15 A;  3M7N A;  4JG2 A;  1S40 A;  1L2F A;  1X3E A;  1X3F A;  4BBR G;  4AYB E;  4POF A;  3RLN A;  4HJ5 A;  4GS3 A;  2AHO B;  1P8L A;  3M4P A;  4IPC A;  3STB C;  3I2Z A;  2YTX A;  4GN5 A;  2K52 A;  4A3M H;  4JI4 L;  1LM0 A;  4DR3 Q;  3PO3 H;  1Q86 C;  3ZJY C;  5AJ3 L;  4KLK A;  2Q2T A;  2DUD A;  2Y0S E;  3GTO H;  4LFA Q;  1SMX A;  1EUJ A;  4A76 A;  3TEH B;  5IP9 G;  1QVC A;  1P16 A;  5GQO A;  3CMA A;  4JCV E;  1VS0 A;  1X65 A;  4IPH A;  4QIW E;  4QL5 A;  4PMW A;  4AYB G;  5M5X H;  4UP7 A;  4JBW A;  3D31 A;  1E1T A;  2WAQ E;  4A75 A;  1CKM A;  3JAM c;  4HJ8 A;  1PYS B;  2EXD A;  4H02 A;  1JJ2 A;  3AFQ A;  4B3T L;  2IY5 B;  4WJ4 A;  3I4O A;  2Y0S G;  1DGS A;  1X6O A;  5H1S E;  4KHP Q;  5C0X J;  1J5E Q;  1PH5 A;  2EQS A;  1Y1W G;  3JAM i;  3CAM A;  3CCV A;  4A3K H;  1VQL A;  1GO3 E;  2Z6K A;  3CC2 A;  3CP0 A;  4LF6 Q;  1JJC B;  3HFZ B;  1ASZ A;  4OXP A;  3IRB A;  1L1O C;  3A0J A;  4HIO A;  2WAQ G;  5JEA G;  4JI7 Q;  3K7U C;  3PO2 H;  4B3R Q;  1SRU A;  3PUW A;  4DV3 L;  2ZJP A;  3KYH C;  1EWI A;  1K8A C;  4LFA L;  2VUM G;  1VQ8 A;  5EAY A;  2IX1 A;  1VQN A;  4P74 A;  4UY8 C;  2LSS A;  1XNR Q;  4JI2 Q;  1U5K A;  2E2J H;  2I5M X;  2VNU D;  1TWC H;  4XTC S;  3I7F A;  1Z47 A;  3S2D H;  2AWO A;  1R9T H;  4A3B G;  4JBK A;  3PUZ A;  1VQP A;  4LFB Q;  1PYB A;  1SLJ A;  4UPA A;  3J80 i;  3W1G A;  2UXB Q;  1FL0 A;  4KHP L;  1HNW Q;  1IL2 A;  3UDX A;  1J5E L;  4RG1 A;  4DAM A;  1E1O A;  4LF6 L;  4JV5 Q;  1VQ9 A;  2PMZ E;  3BZC A;  5ELO A;  1K8G A;  1K3R A;  4C3I H;  3HOV G;  1VQK A;  3BZK A;  4JOI A;  4OWT B;  4JI7 L;  1Q12 A;  4B3R L;  1VQH A;  3G4S A;  1Q46 A;  1VQJ A;  3HOX G;  1YJW A;  5C4J H;  4TQU S;  2WFW A;  2R7D A;  4X64 Q;  1IBM Q;  1XNR L;  4GLV B;  3TRZ A;  4JI2 L;  4LUV A;  3F2D A;  2R92 G;  4P75 A;  2JA9 A;  1V9P A;  1OXT A;  1LYL A;  4OWX B;  1O7I A;  1WCM G;  3U4Z A;  3J81 c;  4LFB L;  3ULP A;  1CKN B;  4RMF A;  2R7Z G;  1M1K C;  3HOY G;  1HZ9 A;  2UXB L;  3RN5 A;  1IYJ B;  4DPG A;  1BKB A;  1HZC A;  4R4C A;  1HNW L;  2FXQ A;  3J7Z C;  4JV5 L;  1PVO A;  1LTL A;  2NVY H;  1OTC A;  4X65 Q;  1XMO Q;  4OON A;  3TS0 A;  4DV1 Q;  2MO0 A;  1VQD A;  4YHH Q;  1GM5 A;  2V1C C;  4DR6 Q;  2N8N A;  5C44 H;  1XPU A;  4APV A;  1YIT A;  3CD6 A;  3F2B A;  3NBH B;  3RLF A;  3TQY A;  4GNX B;  3PIO A;  3PF4 A;  3CPF A;  1BBU A;  3Q8D A;  3HOU G;  2A1A A;  2KCT A;  3KF8 B;  1T9H A;  4AH6 A;  3FKI G;  4X66 Q;  5IYB H;  3HKS A;  4R4T A;  4X64 L;  1IBM L;  3S1Q H;  1UE5 A;  1OXS C;  3S16 H;  2UUB Q;  2VQF Q;  2ALY B;  3EBE A;  3AFP A;  1TWH H;  2D0O A;  1S72 A;  3S17 H;  4YWM A;  2B63 G;  1AE3 A;  3CW2 C;  1FJG Q;  4C3J H;  4OWW B;  2NVQ H;  3ER0 A;  3H0G G;  3ULL A;  1PHJ A;  1EIY B;  2OQK A;  2I0Q A;  3BJU A;  2MQH A;  1Y1V G;  1VQB A;  3OYY A;  4HID A;  5FLM G;  3KDF B;  4IO9 A;  1Q7Y C;  1HR0 Q;  3MEF A;  1VQI A;  1C0A A;  3K80 C;  3HOZ G;  1OXU A;  3U58 A;  4X65 L;  1JMC A;  3DM3 A;  1XMO L;  5C3E H;  4DV1 L;  1E24 A;  4YHH L;  2WP8 J;  4DR6 L;  1X56 A;  1NY4 A;  2JA6 G;  2BA0 A;  1PH8 A;  1MJC A;  2YYZ A;  1MKH A;  4DK3 C;  2KEN A;  1I94 Q;  2PQA B;  5C4X H;  2E8G A;  4IFD J;  2JEB I;  4IOA A;  3K0X A;  4GN3 B;  2UXC Q;  2Z6K C;  1QUQ B;  3KF6 B;  4JI1 Q;  1SFO H;  3M4Q A;  1VQA A;  2OTL A;  2RF4 A;  3I55 A;  3K81 C;  2QEX A;  4JBM A;  3FP9 A;  4X66 L;  2R93 H;  4MNO A;  5LMN W;  2XGT A;  1EQR A;  2UUB L;  4P73 A;  2KCM A;  4BY1 G;  2VQF L;  3UDG A;  1IZ6 A;  1TWF H;  1Z9F A;  3F1Z A;  2D62 A;  3CCR A;  1PH6 A;  2JK8 A;  1FJG L;  1A63 A;  4A93 G;  2I5L X;  1UE7 A;  4YY3 Q;  5M3F H;  3STB D;  1YJN A;  4J15 A;  1PH1 A;  2IT1 A;  1HR0 L;  1CUK A;  4DV3 Q;  1EFW A;  1QZG A;  1YIJ A;  1TWA H;  2NN6 I;  1SR3 A;  3B6Y A;  2JA8 H;  2CQO A;  4R1J A;  2ATW A;  1XJV A;  5IT9 c;  4BY1 H;  1KAW A;  1I94 L;  1HH2 P;  1W3S A;  4A3E G;  4BBR H;  2UXC L;  4HJ9 A;  3GTQ H;  4B3M Q;  3PCO B;  5E7N A;  4JI1 L;  1BVS A;  2KBN A;  4IJL A;  3L7Z C;  4JOI C;  3M4O H;  3RZO H;  2CCZ A;  1UEB A;  4DV6 L;  2GN5 A;  1YHA A;  2EIF A;  1BBW A;  5IP9 H;  1KRT A;  4YY3 L;  4IPG A;  5DLQ E;  5K36 G;  1PH2 A;  1C9O A;  3ICE A;  4A3C G;  2NVT H;  3RNU A;  3CC7 A;  1WI5 A;  4NXM Q;  4POG A;  2BH2 A;  2JA5 G;  1X3G A;  2MFI A;  4BY7 G;  1CSQ A;  2E2I H;  5GAG C;  2L15 A;  1KL9 A;  1Y14 B;  2GVB A;  2I5H A;  3KLW A;  4QGU A;  5C0X I;  3G6E A;  4A3D G;  4NPS A;  1RIP A;  4A3I G;  1U0L A;  3SGI A;  1WOC A;  2JEA I;  1Y1W H;  4B3M L;  4HJA A;  2N49 A;  3LGJ A;  5J3B A;  1YZ6 A;  4A3J G;  4QJF A;  4LF5 Q;  2JE6 I;  3A74 A;  2RHS B;  2NZH A;  1A62 A;  4YWL A;  4A3L G;  4BA1 I;  1IXR A;  2IHE A;  3RR5 A;  5LMN Q;  4IOC A;  1CKN A;  4K0K Q;  4DKA C;  5IYD G;  1EIF A;  1HZB A;  3KJP A;  4X62 Q;  2VUM H;  1SRO A;  1MJE A;  4A3I H;  4L5T A;  1XNQ Q;  2BA1 A;  2Q2H A;  4QQB X;  1HNZ Q;  4DUZ Q;  3NEM A;  4GOP A;  4NXM L;  3PV0 A;  5ELN A;  1Q82 C;  3MXN B;  1VQ6 A;  1WYD A;  4GNX A;  2IX0 A;  5IWA Q;  1C7Y A;  1GD7 A;  4TVA B;  1I50 H;  4B3S Q;  2OTJ A;  3RZD H;  1B7Y B;  2NVX H;  4A3F G;  1K73 C;  3PSI A;  2OQ0 A;  1NMG A;  1KC8 C;  4LF9 Q;  2MO1 A;  2ASB A;  4AQY Q;  3HOV H;  4DR7 Q;  2VY3 A;  4LF5 L;  1JT8 A;  1AH9 A;  3A5Z B;  4A3G G;  2KHI A;  1VQF A;  3I56 A;  4IFD G;  2JA7 G;  3HOW G;  1NBW A;  3CC4 A;  1WFQ A;  2BH8 A;  2HQL A;  3J81 i;  5LMN L;  4GKK Q;  1KRS A;  2HIX A;  3HOX H;  1X9N A;  4K0K L;  4DV2 Q;  4X6A H;  4X62 L;  3I4N G;  2RCN A;  3PUV A;  2A8V A;  4JBJ A;  1E22 A;  4C2M H;  2UU9 Q;  2HT1 A;  1NMF A;  1XNQ L;  2R92 H;  2PI2 E;  1HNZ L;  4DUZ L;  1YI2 A;  3H3V I;  4R4O A;  1WCM H;  2XTI A;  3CCM A;  5GAD C;  1N9W A;  2OWO A;  2DGY A;  2K4K A;  4PG3 A;  3KFU A;  2JJQ A;  2R7Z H;  5M5W H;  3HOY H;  3S1R H;  2PQA A;  3D0F A;  2YTV A;  4AIM A;  5IWA L;  2MNA A;  2Q2U A;  4B3S L;  3S14 H;  3GTP H;  1EYG A;  1QUQ A;  1SN8 A;  2VQE Q;  2QA4 A;  3A5U A;  4HIM A;  4LF9 L;  1B70 B;  4DR7 L;  4AQY L;  1S3O A;  3CCS A;  1PH3 A;  1K0R A;  3CQZ H;  1YBY A;  4BXX G;  1H95 A;  4JI3 Q;  3FHW A;  2F4V Q;  3F8T A;  4DV0 Q;  1ASY A;  4HJ7 A;  3HOU H;  2YTY A;  5IP7 G;  2OCE A;  1KHI A;  4GKK L;  1J6Q A;  3FKI H;  5IYC G;  3EIV A;  4DV2 L;  1L1O B;  1KD1 C;  4L5S A;  3DLL A;  2UU9 L;  2F52 A;  1N32 Q;  4BBS G;  1VCI A;  2B63 H;  4ALP A;  3GD7 A;  3GTG H;  3AEV A;  2N78 A;  3H0G H;  3W5O A;  5LMU Q;  3U50 C;  1VQ5 A;  1Q8K A;  1Y1V H;  3HKZ E;  4BXX H;  1W2B A;  1V43 A;  4YCV A;  3TRE A;  5HGQ A;  4HIK A;  5GAH C;  4EX5 A;  5FLM H;  1PH7 A;  3I4M G;  3PO2 G;  3E9I A;  2VQE L;  1YHB A;  1VQM A;  4BA2 I;  4LW1 A;  4DV6 Q;  3HOZ H;  4L5R C;  1OXV A;  1XPO A;  3KOJ A;  2VL6 A;  3J81 j;  1Q1B A;  3E0E A;  1I3Q H;  4MTN A;  1IBK Q;  2JA6 H;  1I6H H;  1FGU A;  2ZTC A;  4A3B H;  3PF5 A;  4JI3 L;  1K83 H;  2F3I A;  1WJJ A;  4DV0 L;  2F4V L;  3CME A;  4LF4 Q;  3AQQ A;  3HKZ G;  2E5L Q;  4A3M G;  4EQ5 A;  4YCW A;  3PO3 G;  2K5N A;  1L0W A;  2ZJQ A;  1QVF A;  2E2H H;  2QGQ A;  4OX9 Q;  1X54 A;  1EQQ A;  5M5Y H;  2ZTE A;  1VQ4 A;  1N32 L;  2LXK A;  2CKZ B;  1VQO A;  2NZO A;  4Y7N H;  4LF8 Q;  2HHH Q;  3K8A A;  1XMQ Q;  4A93 H;  3UE1 A;  1G51 A;  5LMU L;  4LFC Q;  4WJ3 M;  4ME3 A;  5JJI A;  2YU9 H;  1PH9 A;  2WB1 E;  3GO5 A;  3L0O A;  3CPW A;  4GOP C;  1VQ7 A;  2ZTD A;  2CFM A;  3OTO Q;  3TS2 A;  2B29 A;  5IE8 A;  1N36 Q;  4GNX C;  1CSP A;  4LWC A;  3JC6 6;  1IBK L;  4DAY B;  1D7Q A;  2RHQ B;  4A3K G;  4NXN Q;  4A3E H;  1E7Z A;  4KHZ A;  3RLO A;  1OXX K;  2PI2 A;  5IY0 A;  3CCQ A;  4LF4 L;  2WB1 G;  2E5L L;  3GTL H;  2K5V A;  1RL2 A; 
#chains in the Genus database with same CATH topology
 1LTI D;  1CQF A;  3G6J B;  2ZJR A;  4DV7 Q;  2A19 A;  4LF8 L;  2HHH L;  3TP5 A;  5L37 A;  1WD0 A;  1BQQ T;  1JE5 A;  2HCC A;  3FDT A;  1HNX Q;  1NJI C;  1PH4 A;  2A6E D;  3S1R B;  1EIG A;  1YHQ A;  1Z7T A;  2HDL A;  3GTP B;  1YJ9 A;  1SYD A;  4DR3 L;  3S1N H;  2FIN B;  1N36 L;  2F0G A;  2NVQ B;  4A3D H;  3CKI B;  4C3H H;  2F0I A;  3CU7 A;  2IHF A;  2WIN B;  3S2H H;  4DR2 Q;  4DAV A;  1C8C A;  4OO1 G;  4K5W A;  2KHJ A;  2PW5 A;  4DNT B;  5FLX c;  2EVB A;  5JVG 3;  4A3L H;  2VS1 A;  4ABN A;  4JI0 L;  5FJ8 G;  1WD1 A;  1EQT A;  4QMG A;  2VZA A;  1EEI D;  3L3O C;  1Y1V B;  2A68 D;  3DEP A;  3S9W A;  3J80 E;  2K33 A;  1EOV A;  4R4Q A;  5C4H A;  5KIX A;  3CCE A;  1AFP A;  3S1M H;  1J8I A;  1SE8 A;  3KDF A;  1I3Q B;  1I6H B;  1H9M A;  1HZA A;  2VB3 X;  5FJ8 H;  3QJY A;  3I90 A;  1K83 B;  4DK1 A;  2FMC A;  4DR4 L;  4XQN A;  2ZM6 Q;  1TWG H;  1NTG A;  4ODG A;  4IFD H;  1PRT C;  3HOW H;  3DMU A;  1X55 A;  2PNH A;  4OIJ A;  3GTK H;  4DR5 L;  1BUV T;  1RDP D;  3PGZ A;  4Y7N B;  3F2C A;  3I4N H;  2UXD Q;  1X32 A;  4C3J G;  4KY5 A;  1YNX A;  1IBL Q;  1PV4 A;  2B2Y A;  3CF5 A;  1KNA A;  2ES2 A;  3CCJ A;  1NE3 A;  4DV5 L;  2K7V A;  3ERS X;  1EY6 A;  5C3E G;  3T1Y L;  1IKM A;  2N88 A;  1G8Z D;  4LF7 L;  2KHS A;  4IJH A;  2E2I B;  5E1F A;  2Q8I B;  4M1U B;  5IP7 H;  1VQE A;  1F9S A;  2HIV A;  4DNI A;  3UE0 A;  3Q24 A;  4PZ8 A;  3D4R A;  4O0A A;  1UEA B;  4BBS H;  2RSO A;  4RGN A;  5ELC A;  4U68 A;  5M3F G;  2IPK D;  5C0X G;  1B2T A;  1WTR A;  2JA5 B;  1JOR A;  4RKL A;  2DNC A;  4BY7 B;  1YVC A;  4HCS A;  4JI5 L;  1I4R A;  3DEO A;  1CA6 A;  1B8A A;  1XXG A;  2JA8 G;  1JB3 A;  3H15 A;  1S40 A;  1ILQ A;  1JR0 D;  1L2F A;  1X3F A;  4AYB E;  1NUC A;  3RLN A;  3MHB A;  4GS3 A;  3STB C;  4JI4 L;  3PO3 H;  1RTO A;  2Y0S E;  3KBX A;  1GUW A;  1EUJ A;  5I9P A;  2N55 A;  4LMQ D;  5ELF A;  3TEH B;  5EPL A;  2KEC A;  1QVC A;  4QL5 A;  4PMW A;  5D65 A;  3GTJ B;  1PZK D;  2R61 A;  3D31 A;  2L5T A;  2WAQ E;  4A75 A;  4HJ8 A;  2SNM A;  1JJ2 A;  3VR2 A;  4B3T L;  1ESF A;  4HTH A;  3I4O A;  3N52 A;  4KHP Q;  5C0X J;  1VQL A;  3CAM A;  4TKO B;  1GO3 E;  4NKL A;  2MUY A;  1ASZ A;  2JA7 B;  3A0J A;  3S14 B;  3U9S A;  2L9H A;  4ID6 A;  5JEA G;  4CKE A;  4H44 C;  1SRU A;  3WDN A;  2VUM G;  1VQ8 A;  1HCZ A;  2P5Z X;  4UY8 C;  1WTH A;  2RDG A;  1TWC H;  2JN4 A;  4JW0 A;  1Z47 A;  3R2I A;  2B2Y C;  5KYL A;  3PUZ A;  4KK7 A;  4Q5V A;  1VQP A;  4JBK A;  3RD4 A;  4N9T A;  1FL0 A;  1HNW Q;  3UDX A;  4JV5 Q;  1ICF B;  5CMD A;  1VQ9 A;  4C3I H;  1R4P B;  1F9R A;  1S5E D;  1IL8 A;  1D1K A;  4JOI A;  4HMJ A;  4JI7 L;  1LTS D;  4BWG B;  3EQL C;  1TT2 A;  2NBF A;  1YJW A;  4QB4 A;  4A3B B;  3TRZ A;  1XNR L;  1HPC A;  4K2K A;  4JI2 L;  4LUV A;  1HRJ A;  1V9P A;  5C4Z A;  2BDN A;  3U4Z A;  1NR4 A;  5FLX L;  1K8O A;  4RMF A;  1JIC A;  2RDF A;  1BKB A;  5BN3 A;  1OTC A;  1TS2 A;  1XMO Q;  5C3X A;  4DV1 Q;  2MO0 A;  1VQD A;  4FF2 A;  5C44 H;  5LL6 X;  1XPU A;  3SK8 A;  3RLF A;  1DCZ A;  3A8J E;  3TQY A;  3CPF A;  1HQM C;  3HKZ B;  4A3M B;  1SEB D;  3J81 E;  2KCT A;  5EKL A;  1T9H A;  5IYB H;  4FXK C;  1EWC A;  4X64 L;  1IBM L;  2D5D A;  4IUP A;  4TSS A;  5BN5 A;  1ML0 D;  1PTO H;  2LFN A;  1XX8 A;  4KMU C;  5M5X B;  3CW2 C;  2NVQ H;  4V0B A;  1STE A;  3BJU A;  2MQH A;  1Y1V G;  3DWQ A;  1Q7Y C;  3MFG A;  2R3Z A;  4XYO A;  4X3U A;  1OXU A;  1JMC A;  4X65 L;  2M2L A;  4YHH L;  4FP5 D;  4HSV A;  2JA6 G;  2EY6 A;  2YYZ A;  2KEN A;  5C4X H;  3SK4 A;  1O7Z A;  2JEB I;  2XNA C;  2A69 D;  1ONL A;  2WB1 B;  4X3K A;  4IOA A;  1QUQ B;  3KF6 B;  2RF4 A;  3I55 A;  4N8X 1;  4X66 L;  3BYY B;  2UUB L;  1TWF H;  1A2T A;  2D62 A;  4A3J B;  2JK8 A;  5EBC A;  5FO9 B;  4O1N A;  1K0S A;  3G7L A;  1SYC A;  4IN3 A;  4X3T A;  3STB D;  1YJN A;  4J15 A;  1TY2 A;  1CUK A;  4DV3 Q;  1EFW A;  3E5S A;  1YIJ A;  1G6Z A;  1SR3 A;  1S4Z A;  4FXD A;  1EY0 A;  5IT9 c;  2X6G A;  4B3M Q;  3HZX A;  4JI1 L;  3A7A B;  2EYO A;  4JOI C;  4IJL A;  5C4J B;  1ROD A;  3NTK A;  4KY6 A;  2SDF A;  5KNC A;  4A3F B;  1UEB A;  2GN5 A;  4IUQ A;  4KKT A;  1VMP A;  1QIL A;  1FR3 A;  5K36 G;  3AU7 A;  4A3C G;  3URY A;  2JA5 G;  4BY7 G;  1SYG A;  2E2I H;  2NVY B;  2I5H A;  3G6E A;  4NPS A;  1SE4 A;  1NNX A;  1WOC A;  2JEA I;  5J3B A;  3DHQ A;  3M4Y A;  4LF5 Q;  3FVQ A;  1TS5 A;  3OHX C;  1A62 A;  3NWS A;  4DNR B;  4BA1 I;  2KCC A;  3RR5 A;  1CKN A;  1HZB A;  1SRO A;  2CQA A;  3BDL A;  5NUC A;  5CC4 A;  2BA1 A;  4I7A A;  2NTT A;  4NXM L;  5ELN A;  1JWS D;  3C1E A;  2BCO A;  3NBH A;  1VQ6 A;  1JWU D;  1C7Y A;  1GD7 A;  4TVA B;  2PCF B;  1G2T A;  1QNK A;  2MHV A;  2OTJ A;  1B7Y B;  2NVX H;  1K8M A;  1LV9 A;  3I72 A;  3VA5 A;  2E74 C;  1NMG A;  2VY3 A;  1SFO B;  3A5Z B;  4MIU A;  3I56 A;  2JA7 G;  2R93 B;  2AUK A;  5COR A;  1WFQ A;  4I65 A;  3BZD B;  5LMN L;  1CA5 A;  3SK5 A;  4K0K L;  2AQ2 B;  2CVR A;  4X62 L;  3E0J A;  1SNC A;  2OT2 A;  4JBJ A;  2A8V A;  2UU9 Q;  1XNQ L;  1HNZ L;  4DUZ L;  1Y8N B;  5IGD A;  5DEH A;  3I3C A;  1JQY D;  4NDX A;  1QJO A;  2RBM A;  1TWA B;  1TR5 A;  3OWE B;  4QF4 A;  3HOY H;  3D0F A;  2Q2U A;  3S14 H;  3DM1 A;  1SN8 A;  4HIM A;  4BBR B;  4LF9 L;  3X3M A;  1RF2 D;  3CCS A;  3CQZ H;  4FNF A;  1IW7 D;  3F8T A;  4DV0 Q;  3HOU H;  4HJ7 A;  2PQE A;  5IYC G;  4U67 3;  1KD1 C;  5CBA E;  3T16 A;  1SBB B;  3QWN A;  4ZRZ A;  5KEE A;  1R4Q B;  2LS0 1;  5DM6 3;  2NVT B;  4WFN 3;  4WJW A;  5ISR A;  3TRE A;  2XSC A;  4HIK A;  5GAH C;  4EX5 A;  3BDO A;  3PIO 3;  1MD2 D;  3KOJ A;  1Y1W B;  2CHB D;  1FGU A;  2ZTC A;  4A3B H;  1L0X B;  4JI3 L;  2MGS A;  3LWE A;  4OEL B;  4ZLT F;  3SVM A;  2KCN A;  1KDA A;  4JK1 C;  3HKZ G;  4A3M G;  2K5N A;  2E2H H;  1T5E A;  3NTH A;  1B53 A;  2ZTE A;  4B9W A;  1N32 L;  1LO5 D;  2CKZ B;  1PXU A;  1SND A;  1XMQ Q;  5F2D A;  4LFC Q;  4ME3 A;  2YU9 H;  3HEJ A;  4FYD A;  2DJG C;  1XWE A;  2F03 A;  2CFM A;  1EU4 A;  3OTO Q;  1LT5 D;  2CW0 C;  2Z6B A;  4LWC A;  1D7Q A;  1IBK L;  4DAY B;  1L0Y B;  2X69 A;  1EZ8 A;  1SNO A;  2WAC A;  1STB A;  2WB1 G;  2E5L L;  2DNE A;  4I7Z C;  3PO2 G;  1A0I A;  2JP1 A;  3Q0A A;  4OX9 L;  4LNQ A;  1EQV A;  2L11 A;  3J7A 5;  4JC0 A;  5IT9 L;  4P71 A;  4K8I A;  2R92 B;  2F0Q A;  3NP8 A;  5JJL A;  3M9B A;  1WCM B;  2EY2 A;  4F87 A;  1QE6 A;  2A6E C;  4OL7 A;  5DNF A;  1HJP A;  5GRO A;  5BR8 Q;  1XTD A;  4V19 0;  2XRS D;  4OHJ A;  3K58 A;  1QZH A;  2PO4 A;  3MXP A;  1SE3 A;  5IGF A;  3NEL A;  4H0L C;  3EN2 A;  1JB7 A;  2UUC Q;  2CWA A;  4A3J H;  4PMC A;  1IKL A;  1CK1 A;  4C56 C;  3PIP A;  1ICW A;  2H1E A;  1EOT A;  3QO2 A;  1KXL A;  1O7L A;  3ZYY X;  4XDX A;  2C35 B;  1UNS A;  2EY1 A;  2G9D A;  2KOL A;  3G71 A;  4DR1 Q;  2UUA Q;  5IYD H;  2LXJ A;  1KAB A;  1X3Q A;  3H0G B;  1A15 A;  3CHB D;  1KDB A;  4O2D A;  3HOZ B;  3T1H L;  3PUY A;  4CJ0 B;  3BVZ A;  1XPR A;  3VR3 A;  4G57 A;  4A3F H;  4L5Q A;  4JVZ A;  4JYA L;  1N33 L;  4DV4 Q;  4MZ9 A;  4DUY Q;  1KIX A;  3S15 H;  3KJO A;  1N34 Q;  4GKJ Q;  3CCL A;  2JA8 B;  2JQO A;  3ULJ A;  4GZY C;  3KF6 A;  2HCI A;  5M5Y B;  3GTQ B;  1BR9 A;  3T56 B;  3V96 A;  2PZW A;  1AEX A;  2NN6 G;  2SOB A;  4JI8 L;  2EDG A;  3U4V A;  5A2Q L;  3VDY A;  1QOH A;  3M4O B;  2Z9H A;  3RZO B;  1F9Q A;  5T1I A;  4JI6 Q;  3J7Y W;  3EFX D;  1QVG A;  2K5D A;  1A8V A;  4LUZ A;  1H9S A;  4LAA A;  3AYH B;  3KBG A;  1CZG A;  4OO1 I;  2B2V C;  1CHP D;  1B50 A;  1JOQ A;  3GTL B;  3K5O A;  4CDD C;  5CBE E;  3V2T A;  2R93 G;  4FDB A;  1G29 1;  3GDE A;  3GTM B;  5I2Y A;  4IFD I;  4IPD A;  3PUX A;  3K7A B;  2PNR C;  1STH A;  1KQS A;  5LL6 S;  4YCU A;  2K14 A;  2F0S A;  3K0Y A;  4UP9 A;  4QY7 A;  1XYI A;  1TXY A;  1GKH A;  4YWK A;  2VUM B;  4A4I A;  1JC7 A;  1GUN A;  3A55 A;  5CGK A;  1WVL A;  4BBR G;  5FO7 B;  1PYW D;  4M8A A;  4HJ5 A;  1MHW C;  4KKU A;  1HHV A;  2KEE A;  4GN5 A;  4KHV A;  2V4D A;  2K52 A;  3RZD B;  3FMC A;  5AJ3 L;  4KLK A;  2DUD A;  4LFA Q;  1SMX A;  4A76 A;  2WV6 D;  5IP9 G;  2B2U A;  1Y69 U;  3CMA A;  1P16 A;  5GQO A;  1X65 A;  4IPH A;  4QIW E;  3VA7 A;  1E1T A;  3QOJ A;  1DOK A;  1CKM A;  3JAM c;  2A74 C;  1PYS B;  3FPU B;  2KVM A;  2OF1 A;  1V8Q A;  1Y1W G;  4LF6 Q;  3UI2 A;  2Z6K A;  3HFZ B;  4Z9C B;  4A3G B;  1Q8I A;  1WTO A;  2B39 A;  3PUW A;  1DD2 A;  4DV3 L;  2ZJP A;  1EWI A;  5AFW A;  1CTM A;  5EJW A;  3DWP A;  4R9W A;  2XWB B;  3D6C A;  2I5M X;  4CDE C;  1WTP A;  3I7F A;  2EJF C;  2AWO A;  1TS4 A;  4LFB Q;  5I6Y A;  2F0O A;  4UPA A;  3J80 i;  1SMY D;  2UXB Q;  3M3Y B;  3P7J A;  3L9A X;  4L6T B;  3K5N A;  3HP3 A;  4RG1 A;  1J5E L;  2QEJ C;  1EFI D;  1KAA A;  3BZC A;  4OEM B;  4G7O C;  1K3R A;  4JPB W;  3A8I E;  1OO9 B;  1YNN D;  1CQV A;  4NMZ A;  4OWT B;  2EY5 A;  1Q12 A;  4B3R L;  1VQH A;  4OO1 H;  4PQX A;  2Z4I A;  3G4S A;  1A2U A;  2JA6 B;  4TQU S;  1JCK B;  3F2D A;  4EQN A;  2R92 G;  4P75 A;  2JA9 A;  1WCM G;  1ENF A;  3ULP A;  1CKN B;  4RWS C;  3I4M B;  3P75 A;  3RN5 A;  4DPG A;  4R4C A;  4F7X A;  1PZJ D;  2FXQ A;  1PVO A;  4OON A;  3TS0 A;  1GM5 A;  4DR6 Q;  4APV A;  2EYP A;  1YIT A;  3CD6 A;  3NBH B;  1O80 A;  3PF4 A;  2F0L A;  2HUG A;  1RHP A;  3FKI G;  3GTO B;  1PLF A;  2FFK B;  5J22 A;  2VQF Q;  2ALY B;  3AFP A;  1V1P B;  3S17 H;  5I6W A;  2B63 G;  1AE3 A;  5EKK A;  2B2U C;  4C3J H;  4K6L A;  3ER0 A;  3H0G G;  2I0Q A;  1F2M A;  3I73 A;  3OYY A;  2ICI A;  5FLM G;  1C0A A;  3K80 C;  3HOZ G;  3U58 A;  4ZAI A;  5C3E H;  3DUZ A;  1DYQ A;  3VR4 A;  2QKI C;  1PH8 A;  1MJC A;  1MKH A;  2A69 C;  4IFD J;  4DAY A;  2PPB C;  4HSP A;  2UXC Q;  2Z6K C;  2IW3 A;  4K5V A;  3FP9 A;  5G3L D;  1JE4 A;  3OW7 A;  4P73 A;  1IZ6 A;  1STA A;  4ZK9 B;  1FJG L;  2E2J B;  1A63 A;  2F0N A;  1PFB A;  1UE7 A;  5M3F H;  2EYH A;  1AP0 A;  5C0X H;  1I4P A;  3SEB A;  1PH1 A;  2IT1 A;  1E2V A;  4CJ2 C;  1HR0 L;  4NP5 A;  1STN A;  1ENA A;  3WOE A;  1WTW A;  2JA8 H;  2K01 A;  2L4N A;  4R1J A;  1XJV A;  2EXZ A;  1I94 L;  1HH2 P;  4KV6 A;  1H9K A;  2B2T C;  4CGY B;  3GTQ H;  3PCO B;  5E7N A;  4IUT A;  2XWJ B;  1BVS A;  4C1N I;  3M4O H;  5JPM C;  3RZO H;  3MWY W;  2EIF A;  4MTK A;  2A5H A;  2SEB D;  4J6H A;  4YIJ A;  1JOK A;  4FF3 A;  4ZYS A;  4YY3 L;  5M9O A;  3ICE A;  2KED A;  3VYT A;  4POG A;  2BH2 A;  2MFI A;  5GAG C;  4IAL A;  4QGU A;  1KL9 A;  1Y14 B;  1BCP F;  3KLW A;  3WOF A;  2ZXO A;  2F0U A;  3LGJ A;  1YZ6 A;  1UAP A;  3TP6 A;  3JAM L;  3A74 A;  5JEA H;  4IUV A;  1U4M A;  4RHS A;  3S1Q B;  1UUP A;  2IHE A;  1AZP A;  3NE5 B;  1TWH B;  2QCP X;  2VUM H;  1EIF A;  4DXF A;  2BE5 D;  2K5Q A;  2ZT9 C;  1PTO F;  3Q6S A;  3H09 A;  3PQI A;  2ZXP A;  2IX0 A;  1HTL D;  4B3S Q;  1VF5 C;  3RZD H;  1QG7 A;  3OSO A;  2ASB A;  2MO1 A;  4AQY Q;  3K57 A;  1TS3 A;  4A3G G;  3U9O A;  4X3S A;  2XIW A;  1NBW A;  2RVL A;  2BH8 A;  5D3D A;  3J81 i;  4DV2 Q;  5I9O A;  2HT1 A;  5FK9 C;  4PMB A;  2PI2 E;  5CV8 A;  3H3V I;  2XTI A;  5J1Z A;  4OIK A;  2EE1 A;  3RMH A;  2X6L A;  3S1R H;  2PQA A;  4AIM A;  5IWA L;  2F0H A;  1GXD C;  3GTP H;  4FF1 A;  3A5U A;  4C1N K;  4DR7 L;  1F2Y A;  1WTX A;  1CHQ D;  5LHY 1;  1PH3 A;  1K0R A;  1KTK A;  1IW7 C;  3NPP A;  4BXX G;  4IUR A;  2K05 A;  2EJG C;  3X3N A;  2LY7 A;  2OCE A;  3Q22 A;  4GKK L;  2LMC B;  1TY0 A;  1J6Q A;  1IYU A;  3EIV A;  2BDO A;  4RHR A;  1I6V C;  4AYB B;  4KJN A;  5C5M A;  1ZXT A;  5COY A;  1NCV A;  4J8Q A;  3PO2 B;  3AEV A;  5CV9 A;  1VQ5 A;  1Q90 A;  1Y1V H;  4BXX H;  1RCV D;  1LT6 D;  1EWH A;  3I4M G;  2J7Z A;  1W6J A;  2VQE L;  2Y0S B;  3NK9 A;  3T4A C;  4L5R C;  2VL6 A;  3J81 j;  1Q1B A;  1I3Q H;  4MTN A;  3S2D B;  2JA6 H;  1I6H H;  1K83 H;  2F4V L;  2WAQ B;  1H9S B;  2OEO A;  3AQQ A;  2RSN A;  1SYE A;  2TSS A;  1L0W A;  3A54 A;  3A56 A;  1I4H A;  1X54 A;  2IJ0 A;  2XVS A;  4H13 C;  2LXK A;  4K6D A;  5CV5 A;  4Y7N H;  4LF8 Q;  2HHH Q;  2F0E A;  5LMU L;  4Q0F A;  5CV6 A;  2EPB A;  5E4W C;  2CH4 W;  2F0F A;  4WRD A;  3OIQ A;  1I50 B;  3R3O A;  3A7L A;  3MAQ A;  2B29 A;  1N36 Q;  2NWG A;  2E76 C;  3KLS X;  3JC6 6;  3HOV B;  4A3K G;  1OXX K;  4HMI A;  4LF4 L;  1NY4 A;  1MSH A;  3HOX B;  3BVM A;  4HR7 B;  2NTS A;  1HFG A;  4G7Z C;  4C2M B;  4JI0 Q;  2QW7 A;  5ELD A;  2FJ2 A;  5FO8 B;  5K36 H;  1D5M C;  3UDF A;  4GLX A;  2R7Z B;  4A3C H;  4XQJ A;  4GN4 B;  2F4I A;  2JA5 H;  3H3V H;  2A6H D;  4BY7 H;  1LT3 D;  3VYU A;  1PFS A;  1QB5 D;  4NXN L;  2Q2I A;  1NR2 A;  2K28 A;  2K6A A;  5ELB A;  1LUZ A;  3TZU A;  2D0P A;  4HCE A;  3TZD A;  3J80 c;  4DR4 Q;  3G48 A;  1DXM A;  2TMP A;  2AMC B;  1H9J A;  2I07 B;  1A3T A;  2H5X A;  4R8N A;  1EU3 A;  4DV7 L;  2MPM A;  2YV5 A;  1HXY D;  3CCU A;  4DR5 Q;  1V1Q A;  3GTG B;  1MGS A;  5IGC A;  1QNU A;  1HNX L;  3RUZ A;  1V1P A;  3GTJ H;  3OW2 A;  5BN4 A;  2BOS A;  3CRK C;  3K59 A;  5G3L F;  4DV5 Q;  4MHE A;  5FLX E;  1CKO A;  5JJZ A;  2AKW B;  1BBX C;  4PZ6 A;  3FRP B;  3T1Y Q;  4DR2 L;  1L1O A;  1Y8O B;  1HTP A;  4LF7 Q;  4Y52 H;  4OGQ C;  3F2U A;  2JA7 H;  1SXT A;  5JJK A;  4NW2 A;  2K75 A;  4R4I A;  3W2D A;  4A93 B;  3QB3 A;  2ID0 A;  1S5F D;  2F0T A;  4GOP B;  1WTV A;  2R6G A;  1BO0 A;  3NEN A;  2WKD A;  1M90 C;  4JI5 Q;  1SDF A;  1BDO A;  3CXC A;  4A3E B;  1ZKO A;  2MP1 A;  1FYC A;  1MIU A;  3K5M A;  3FEW X;  2ZM6 L;  3UDI A;  3E6Z X;  3H6M A;  2GVA A;  1IYV A;  1AE2 A;  2VW9 A;  3BDC A;  4JI4 Q;  5IYC H;  1ZEQ X;  2UXD L;  1I5F A;  2Z0S A;  1GUG A;  1IBL L;  1VDZ A;  4XIG S;  1YNJ D;  3S24 A;  1UWV A;  5EPK A;  1GVP A;  3GV3 A;  2JXM B;  1EYD A;  1EY7 A;  3W1B A;  3S1N B;  4PZ7 A;  4A3D B;  4A3I B;  4B3T Q;  2B3G A;  2Z8L A;  1PMR A;  1SSO A;  3M7N A;  4JG2 A;  1SNQ A;  1K28 A;  1BOS A;  2O4X A;  1ZYR D;  2AHO B;  2VB2 X;  4IPC A;  1A3U A;  4A3M H;  1FNV A;  3MTS A;  2B2V A;  3ZJY C;  2Q2T A;  3NXW A;  3LX0 A;  4PV1 C;  5C6A A;  1ET9 A;  3A8K E;  4JCV E;  1EY8 A;  2O5I C;  4AYB G;  5M5X H;  3DWA A;  4UP7 A;  4RFB A;  5KND A;  5EQ0 A;  1EYA A;  3S1M B;  4WJ4 A;  2Y0S G;  1DGS A;  1X6O A;  5H1S E;  3K6O A;  3BYT B;  4FO2 A;  3CC2 A;  3D3R A;  2M9V A;  3CP0 A;  1JJC B;  1TWG B;  2B2W A;  5M5W B;  1H9R A;  4OXP A;  3IRB A;  2FMM A;  3HOW B;  1L1O C;  1F2L A;  2WAQ G;  4JI7 Q;  3K7U C;  3VR5 A;  3PO2 H;  1PRT F;  3OIP A;  3GTK B;  3KYH C;  1K8A C;  1GJX A;  1HUN A;  2IX1 A;  3SK6 A;  4P74 A;  1VQN A;  2LSS A;  1XNR Q;  4JI2 Q;  2MJ8 A;  1U5K A;  2VNU D;  1CFM A;  3S2D H;  3FKI B;  2NUC A;  1SMY C;  1SLJ A;  1T5X D;  1DJR D;  5JVH 3;  2B63 B;  3BVG A;  5E3F A;  4KHP L;  4DGZ A;  4ZUI A;  1E1O A;  1K8G A;  5ELO A;  4EQP A;  3HOV G;  2IX3 A;  1YNN C;  1VQK A;  1HFN A;  1KLU D;  1EEF D;  1W6K A;  3BZK A;  4KN7 C;  4ZKC B;  3FPP A;  5CV7 A;  1Q46 A;  3HOX G;  5CV4 A;  1LTT D;  5C4J H;  2WFW A;  4X64 Q;  2F0P A;  1IBM Q;  3GQB A;  1M4V A;  3J80 L;  1OXT A;  1LYL A;  4OWX B;  2H4O A;  3J81 c;  1EL0 A;  1C4Q A;  1HQR D;  2R7Z G;  3I8Z A;  1HZ9 A;  1IYJ B;  1HZC A;  1HNW L;  1JWM D;  3SE0 A;  1BCP D;  1E0B A;  3J7Z C;  4JV5 L;  1GUO A;  2NVY H;  2G5D A;  4X65 Q;  3NTI A;  4YHH Q;  2V1C C;  2JYO A;  3PIO A;  1TQO A;  2E2D C;  4CJ1 B;  3PO3 B;  4AH6 A;  4X66 Q;  3HKS A;  4R4T A;  2O2L D;  4RAU C;  1UE5 A;  1OXS C;  2UUB Q;  3EBE A;  2D0O A;  1S72 A;  3MEH A;  2NN6 H;  1EIY B;  1PTO D;  2RKS A;  2NYZ D;  4PNY A;  2B8F A;  3OOC A;  5C5L A;  3D8G A;  3MEF A;  1VQI A;  1GHK A;  3DM3 A;  1XMO L;  4DV1 L;  2WP8 J;  1X56 A;  1FGB D;  2XRQ D;  4DK3 C;  2PQA B;  4XT1 B;  4GN3 B;  3K0X A;  3VYS A;  3ERO A;  4JI1 Q;  1SFO H;  2B2W C;  3M4Q A;  1VQA A;  1DOM A;  2R93 H;  2XGT A;  3H94 A;  1EQR A;  5M3M B;  3UDG A;  2KCM A;  4K14 A;  1Z9F A;  3CCR A;  3SR1 A;  4A93 G;  4K2L A;  1V1O A;  2I5L X;  5E4X A;  2RDH A;  1QZG A;  3VR6 A;  1TWA H;  1E2W A;  1G2S A;  1FNW A;  2B8G A;  5IOC A;  2KA7 A;  2WKC A;  1EY9 A;  4C3I B;  2ATW A;  1KAW A;  3GP7 A;  4A3E G;  4BBR H;  1DZ1 A;  4HJ9 A;  1PFM A;  4J1M A;  2KBN A;  3L7Z C;  4EQO A;  1ET6 A;  5IP9 H;  3HGB A;  1KRT A;  3QG1 A;  4KJO A;  4IPG A;  1BCP B;  3M7G A;  1PH2 A;  3KK7 A;  2NVT H;  3CC7 A;  3MVV A;  4NXM Q;  1X3G A;  1CSQ A;  2L15 A;  4F88 A;  2GVB A;  5C0X I;  2KQ3 A;  1B44 D;  4A3D G;  1RIP A;  4A3I G;  1U0L A;  5C44 B;  1DM0 B;  4C3H G;  2F0D A;  4ZKB B;  1Y1W H;  5A35 A;  4HJA A;  4B3M L;  4HN7 A;  4QJF A;  1LT4 D;  2EJM A;  2RHS B;  2NZH A;  4N8F A;  4A3L G;  4RCN A;  4EVO A;  1IXR A;  5LMN Q;  1PTO B;  2B2T A;  4K0K Q;  4DKA C;  3KJP A;  2BE5 C;  4X62 Q;  5EBD A;  1MJE A;  4A3I H;  4QUC A;  1XNQ Q;  2Q2H A;  4CDF C;  1HNZ Q;  4DUZ Q;  3LWU A;  3NEM A;  1TII D;  4GOP A;  2F3W A;  2EYM A;  4HAE A;  1WYD A;  4GNX A;  4UDU C;  5I4D A;  2QDL A;  1K73 C;  1IHZ A;  3KF8 A;  1CT1 D;  3PSI A;  2OQ0 A;  5C4X B;  4LF9 Q;  3D4D A;  4LF5 L;  5DAU A;  1VQF A;  4IFD G;  3MC0 B;  3HOW G;  3D6W A;  2DY7 A;  4CKB A;  4DA2 A;  5K5P A;  1TWF B;  2F0J A;  1X9N A;  5CR3 A;  3I4N G;  2RCN A;  1E22 A;  4EGV A;  5CYU A;  2G9H D;  2R92 H;  3KLS A;  1SYF A;  2ENB A;  3C46 A;  2K1B A;  4R4O A;  1WCM H;  3NQT A;  5GAD C;  3TP8 A;  3MA2 B;  4PG3 A;  3KFU A;  2JJQ A;  4MN3 A;  5DM7 3;  5M5W H;  5A2Q E;  5KRU A;  3R2T A;  1EYG A;  2K32 A;  2K03 A;  3J7A V;  3ITP A;  3J81 L;  5IIF A;  4JI3 Q;  1PDQ A;  5HGT A;  1F9P A;  2YTY A;  5IP7 G;  1KHI A;  1ESR A;  5D14 A;  3FKI H;  4K5X A;  1L1O B;  4O42 A;  3BS1 A;  4A3K B;  4L5S A;  3DLL A;  2UU9 L;  3TN2 A;  3I70 A;  1N32 Q;  4BBS G;  1LAB A;  3GV6 A;  2B63 H;  3ND9 A;  3P1H A;  4TRD A;  2N78 A;  3H0G H;  3U50 C;  1Q8K A;  3HKZ E;  1V43 A;  5FLM H;  1PH7 A;  1YHB A;  1J9O A;  4BA2 I;  4DV6 Q;  3HOZ H;  1OXV A;  1XPO A;  4L63 B;  1HUM A;  4QIW B;  1R9T B;  1IBK Q;  3PF5 A;  4RGT A;  4RH6 A;  3HS0 C;  2F3I A;  1WJJ A;  4DV0 L;  2E5L Q;  4EQ5 A;  3PO3 G;  2KUM A;  4OX9 Q;  5M5Y H;  3IL8 A;  4B08 A;  2PZT A;  3K5L A;  3UE1 A;  2RA4 A;  4WJ3 M;  1PH9 A;  2EYJ A;  2WB1 E;  1VF7 A;  4GOP C;  2ZTD A;  4G4K A;  4XT3 B;  2NVX B;  4GNX C;  1BNZ A;  1CSP A;  5EGT A;  1B1Z A;  2RHQ B;  2EYL A;  4XQQ A;  3RLO A;  3GTL H;  1HA5 A;  1KLG D;  1ENC A;  1SE2 A;  2OXP A;  5M3M G;  3GTM H;  2CH4 A;  5J39 A;  4KKS A;  2NB0 A;  3MXN A;  3E3X A;  3K7A H;  1XMQ L;  4LFC L;  3W3A A;  1E3P A;  1O7Y A;  3HOY B;  1FVI A;  4LUO A;  2L12 A;  2A6H C;  1F2Z A;  3S16 B;  4GLA C;  1G6P A;  1MSG A;  2AWN A;  3OTO L;  1VQG A;  3KLR A;  3KUP A;  4G7H C;  3QOL A;  3T1H Q;  5I2X A;  3CQZ B;  1UE6 A;  3MFY A;  4C3I G;  2F1M A;  5M3M H;  4JYA Q;  4WOR A;  1N33 Q;  2QF7 A;  1LLR D;  2N3S A;  2J0T D;  3L2P A;  3HOU B;  1LTA D;  4RKB A;  4CKC A;  2AQ3 B;  1HR0 W;  2FHT A;  2JSO A;  1PA6 A;  3IFT A;  1FD7 D;  3CRL C;  3MXG A;  1O78 A;  4RA8 A;  4RCO A;  1YEZ A;  1CM9 A;  3IKJ A;  4DAP A;  2LKV A;  4JI8 Q;  3HRZ C;  4DK6 C;  5GAE C;  3EA6 A;  4QUF A;  5BR8 L;  2CWP A;  4RGM A;  4FXG C;  2K50 A;  2M00 A;  1D8L A;  1B3A A;  1D2B A;  3SDZ A;  1JJG A;  2DN8 A;  1UE1 A;  2PW7 A;  5C44 G;  2UUC L;  1STY A;  2K5H A;  3M85 A;  2D9U A;  5JEA J;  1PFN A;  4A3G H;  2F0K A;  1Q81 C;  5C3W A;  1PZI D;  1PRT D;  2E2H B;  1U4L A;  5IYB G;  4BY1 B;  3NHH A;  2R7F A;  4DR1 L;  2UUA L;  1DOL A;  4UP8 A;  2YU9 B;  3HG9 A;  2L0C A;  4DN4 M;  3MZ5 A;  2AUJ D;  4NB3 A;  3DXJ C;  1XTC D;  3E9H A;  5HY6 A;  3M3Y H;  3OWF A;  3NUC A;  5IGG A;  3RN2 A;  4B9X A;  4DV4 L;  4DUY L;  1B4O A;  5C4X G;  2C5C A;  1N8R C;  1N34 L;  3C2P A;  4GKJ L;  1K9M C;  5IGE A;  2ICE C;  3NWT A;  1TVX A;  5AJ3 Q;  3BU2 A;  1CZW A;  1BXT A;  3EJI A;  1YNJ C;  1BF4 A;  2EOT A;  1VQC A;  3WWV A;  5KYI A;  4JI6 L;  1SYB A;  3I4M H;  1SNM A;  4FVM A;  1Q1E A;  4P72 A;  3T51 B;  3QIA A;  4KI0 A;  2NZ1 D;  4CHT B;  4XXE A;  1X3E A;  1U4P A;  4POF A;  4KN4 C;  1ZYR C;  2J4X A;  2Q8T A;  3D4W A;  1EYC A;  1P8L A;  3M4P A;  3I2Z A;  1M8A A;  2YTX A;  5JOB A;  1LM0 A;  3ERQ A;  4DR3 Q;  1Q86 C;  2GA4 B;  3GTO H;  4KD3 A;  3N6R A;  1EIH A;  1D1I A;  2PZU A;  1VS0 A;  4JBW A;  3R93 A;  2A73 B;  1B9N A;  4LK1 C;  4H02 A;  2EXD A;  3AFQ A;  2IY5 B;  1WTQ A;  1Q3L A;  3TSS A;  1F77 A;  1PRT B;  1J5E Q;  1PH5 A;  2EQS A;  5T1G A;  3JAM i;  4A3K H;  3CCV A;  1DON A;  3S15 B;  3AB9 A;  5KNB A;  2I46 A;  4DK0 A;  4HIO A;  4ULL A;  4B3R Q;  3ONA B;  2D2C C;  2L1B A;  3TDQ A;  3JAM E;  4LFA L;  5EAY A;  1B3Q A;  1VMC A;  5JAV A;  2K04 A;  2E2J H;  4CDC C;  4XTC S;  3IAY A;  2F0W A;  1LTB D;  3C3L A;  1R9T H;  4ME5 A;  1PYB A;  3QR8 A;  3W1G A;  2Z4H A;  4IUN A;  4HED A;  1IL2 A;  1S5B D;  4DAM A;  4LF6 L;  2PMZ E;  2RQX A;  4DXG A;  3J7A F;  4QCL A;  3I4L A;  1VQJ A;  4KY7 A;  1I4Q A;  1MI2 A;  2E75 C;  3H91 A;  2R7D A;  4GLV B;  2Q8R E;  4P2C B;  5D3I B;  1LTG D;  1Z6H A;  1O7I A;  2HQE A;  2IL8 A;  4LFB L;  1M1K C;  3HOY G;  2UXB L;  1BCP C;  3V05 A;  3PIP 3;  1LTL A;  2HD3 A;  4RGO S;  2N8N A;  4ZQ3 A;  3F2B A;  4GNX B;  1BBU A;  1KNE A;  3Q8D A;  3HOU G;  3TME A;  2QIL A;  4ZCK A;  2A1A A;  2AQ1 B;  3KF8 B;  1U9R A;  3S1Q H;  3S16 H;  1TWH H;  4YWM A;  2O5J C;  1FJG Q;  1TU2 B;  4OWW B;  1I4G A;  1PTO C;  3ULL A;  1PHJ A;  2OQK A;  5KGU A;  4KD4 A;  5IGB A;  1EY4 A;  1VQB A;  4HID A;  1HR0 Q;  3KDF B;  4IO9 A;  1II3 A;  4DR6 L;  1E24 A;  1GOZ A;  2BA0 A;  1EZ6 A;  4A3B G;  1I94 Q;  2E8G A;  1ILP A;  3OMG A;  2OTL A;  2QDB A;  3K81 C;  2QEX A;  4JBM A;  4MNO A;  3I91 A;  2IWH A;  4C3H B;  5LMN W;  4BY1 G;  1X3P A;  2VQF L;  1PH6 A;  3S2H B;  3F1Z A;  1LTR D;  1RD9 D;  1AN8 A;  5IOD A;  4YY3 Q;  4F8M A;  3P20 A;  4L8J A;  4E6I A;  1CI3 M;  2NN6 I;  3B6Y A;  1A3V A;  2CQO A;  2EYF A;  4BY1 H;  1W3S A;  2UXC L;  1RJT A;  1QWY A;  5JPN C;  4CBV A;  3PMF A;  2CCZ A;  3IFD A;  4DV6 L;  1YHA A;  1BBW A;  2K5W A;  5EPJ A;  5DLQ E;  3O13 A;  5FKA C;  1NSN S;  1C9O A;  1D5X C;  3RNU A;  4H7B A;  1WI5 A;  1SNP A;  1KDC A;  3I4N B;  4S3S A;  2SNS A;  1K3B C;  1Y8P B;  1QCB D;  1NAP A;  3SGI A;  4FF4 A;  2PMZ B;  1RTN A;  2N49 A;  4A3J G;  2JE6 I;  1U4R A;  4YWL A;  1STG A;  3OPO A;  2F3V A;  2KJX A;  4IOC A;  2RCF A;  5IYD G;  3S17 B;  4C3J B;  1LAC A;  3T53 B;  4ILW A;  3H3V C;  4L5T A;  4IQZ A;  1MBY A;  3OMC A;  4QQB X;  5ELE A;  2VXW A;  3PV0 A;  1Q82 C;  3MXN B;  4K8J A;  3NSW A;  5IWA Q;  4BS9 A;  5C3E B;  1I50 H;  4BBS B;  1SJH D;  2DJF C;  4A3F G;  3SHL A;  1KC8 C;  4LJZ C;  1E2Z A;  4DR7 Q;  3HOV H;  2EZV A;  1JT8 A;  1AH9 A;  1S5D D;  2A68 C;  2KHI A;  3ND8 A;  3CC4 A;  3Q23 A;  2HQL A;  4GKK Q;  1KRS A;  2HIX A;  3HOX H;  4X6A H;  4DU9 A;  3PUV A;  4R8I A;  4C2M H;  1NMF A;  5M3F B;  1YI2 A;  1C48 A;  3CCM A;  2OWO A;  1N9W A;  2DGY A;  3R8B A;  2C9O A;  2K4K A;  5HUR A;  2R7Z H;  3EVQ A;  2YTV A;  2MNA A;  4B3S L;  2F0M A;  1QUQ A;  2VQE Q;  2QA4 A;  4KTA A;  1G91 A;  1B70 B;  3NQI A;  4AQY L;  4IZ8 A;  4UAI A;  1S3O A;  3BG3 A;  5FOB B;  3MXU A;  1I4X A;  1YBY A;  2L55 A;  3VYR A;  1H95 A;  5TSS A;  3FHW A;  1RKN A;  2HDM A;  2F4V Q;  1ASY A;  1FNU A;  4DV2 L;  1AZQ A;  4N9P A;  2F52 A;  1VCI A;  3AMU A;  1JOO A;  3TP7 A;  4ALP A;  3GD7 A;  3GTG H;  3W5O A;  5LMU Q;  4ZUJ A;  1W2B A;  4YCV A;  5HGQ A;  1SJE D;  3E9I A;  1VQM A;  3T13 A;  4LW1 A;  3LNN A;  1TWC B;  1A6X A;  3TBI B;  3E0E A;  2Z1C A;  4IUU A;  4XYQ A;  2DY8 A;  5EKI A;  1GUS A;  4UHV A;  3CME A;  4LF4 Q;  1AW7 A;  1EY5 A;  2F0V A;  4YCW A;  3C1F A;  2ZJQ A;  1QVF A;  2PYK A;  2QGQ A;  1EQQ A;  1VQ4 A;  1VQO A;  2NZO A;  2XN9 C;  3K8A A;  2WII B;  1TKW B;  1D5Z C;  4A93 H;  1GHJ A;  1G51 A;  5JJI A;  1SAP A;  3SXH A;  4DF7 A;  4DFA A;  1HA6 A;  3L0O A;  3GO5 A;  1GUT A;  3CPW A;  1VQ7 A;  1D6E C;  3TS2 A;  5IE8 A;  2ZXR A;  2CW0 D;  5IT9 E;  4NXN Q;  3NBI A;  4A3E H;  1E7Z A;  4KHZ A;  2PI2 A;  3CCQ A;  5IY0 A;  1B9M A;  2K5V A;  1RL2 A;  1S5C D; 
#chains in the Genus database with same CATH homology
 1A0I A;  4OX9 L;  2ZJR A;  4LNQ A;  4DV7 Q;  3J7A 5;  2A19 A;  4JC0 A;  4JI0 Q;  5M3M G;  4P71 A;  3GTM H;  4LF8 L;  2HHH L;  1XMQ L;  3K7A H;  5JJL A;  3M9B A;  4LFC L;  1JE5 A;  1E3P A;  1NJI C;  1HNX Q;  3UDF A;  4GLX A;  1PH4 A;  4A3C H;  1YHQ A;  1FVI A;  4LUO A;  1HJP A;  1G6P A;  4GN4 B;  4GLA C;  5GRO A;  1XTD A;  5BR8 Q;  1YJ9 A;  2AWN A;  3OTO L;  2JA5 H;  3H3V H;  4DR3 L;  3S1N H;  1N36 L;  1VQG A;  4BY7 H;  1QZH A;  1PFS A;  4A3D H;  3T1H Q;  4NXN L;  2Q2I A;  1UE6 A;  4C3H H;  3NEL A;  5M3M H;  2IHF A;  4JYA Q;  3EN2 A;  1JB7 A;  1LUZ A;  4DR2 Q;  2UUC Q;  1N33 Q;  2CWA A;  2D0P A;  3J80 c;  4A3J H;  2N3S A;  4DR4 Q;  3L2P A;  3PIP A;  4OO1 G;  2KHJ A;  3G48 A;  5FLX c;  2AMC B;  4A3L H;  2H5X A;  2VS1 A;  4DV7 L;  1HR0 W;  1KXL A;  2YV5 A;  4JI0 L;  3CCU A;  5FJ8 G;  2C35 B;  1PA6 A;  3G71 A;  4DR1 Q;  4DR5 Q;  2UUA Q;  5IYD H;  2LXJ A;  1V1Q A;  2VZA A;  1HNX L;  1YEZ A;  4JI8 Q;  4DK6 C;  3GTJ H;  5GAE C;  3OW2 A;  5BR8 L;  4O2D A;  2CWP A;  4DV5 Q;  2K50 A;  1EOV A;  4R4Q A;  1CKO A;  1D8L A;  3CCE A;  3S1M H;  3T1H L;  1SE8 A;  3KDF A;  2AKW B;  3PUY A;  1XPR A;  1JJG A;  4A3F H;  1HZA A;  1UE1 A;  4L5Q A;  4PZ6 A;  5FJ8 H;  4JYA L;  5C44 G;  4DR2 L;  3T1Y Q;  2UUC L;  1L1O A;  2K5H A;  1N33 L;  4DV4 Q;  4DR4 L;  4MZ9 A;  3M85 A;  4DUY Q;  1KIX A;  4LF7 Q;  4Y52 H;  5JEA J;  3S15 H;  3KJO A;  1TWG H;  1NTG A;  2ZM6 Q;  1N34 Q;  4A3G H;  1Q81 C;  3CCL A;  2JA7 H;  3HOW H;  4GKJ Q;  1X55 A;  5JJK A;  2JQO A;  2K75 A;  4R4I A;  3ULJ A;  3KF6 A;  2PNH A;  5IYB G;  3GTK H;  2R7F A;  4DR5 L;  3PGZ A;  4DR1 L;  2UUA L;  3F2C A;  3I4N H;  2UXD Q;  4UP8 A;  2ID0 A;  4GOP B;  1YNX A;  1IBL Q;  2NN6 G;  1PV4 A;  4JI8 L;  3CF5 A;  3VDY A;  3U4V A;  3S2H H;  2ES2 A;  3CCJ A;  1NE3 A;  4DV5 L;  4JI6 Q;  1QVG A;  2R6G A;  4NB3 A;  3NEN A;  1A8V A;  4LUZ A;  1M90 C;  3E9H A;  3ERS X;  5HY6 A;  4JI5 Q;  5C3E G;  3AYH B;  3CXC A;  3M3Y H;  3RN2 A;  3T1Y L;  4OO1 I;  4DV4 L;  1MIU A;  4DUY L;  4LF7 L;  5C4X G;  2ZM6 L;  1N8R C;  3UDI A;  1N34 L;  4GKJ L;  4IJH A;  1K9M C;  2GVA A;  1AE2 A;  2R93 G;  5IP7 H;  1VQE A;  2HIV A;  4DNI A;  4FDB A;  2VW9 A;  1G29 1;  3GDE A;  5IYC H;  4JI4 Q;  3UE0 A;  4PZ8 A;  4IFD I;  4IPD A;  3BU2 A;  3PUX A;  5AJ3 Q;  2UXD L;  4O0A A;  1I5F A;  2Z0S A;  1IBL L;  4BBS H;  4XIG S;  1KQS A;  1VQC A;  3S24 A;  4YCU A;  3WWV A;  1UWV A;  2K14 A;  5M3F G;  4UP9 A;  5C0X G;  1GVP A;  4QY7 A;  4JI6 L;  1TXY A;  1GKH A;  4YWK A;  3W1B A;  4A4I A;  1YVC A;  3I4M H;  4JI5 L;  1Q1E A;  4P72 A;  1B8A A;  4PZ7 A;  2JA8 G;  4KI0 A;  4B3T Q;  2B3G A;  3H15 A;  3M7N A;  4JG2 A;  1S40 A;  1L2F A;  1X3E A;  1X3F A;  4BBR G;  4AYB E;  4POF A;  3RLN A;  4HJ5 A;  4GS3 A;  2AHO B;  1P8L A;  3M4P A;  4IPC A;  3STB C;  3I2Z A;  2YTX A;  4GN5 A;  2K52 A;  4A3M H;  4JI4 L;  1LM0 A;  4DR3 Q;  3PO3 H;  1Q86 C;  3ZJY C;  5AJ3 L;  4KLK A;  2Q2T A;  2DUD A;  2Y0S E;  3GTO H;  4LFA Q;  1SMX A;  1EUJ A;  4A76 A;  3TEH B;  5IP9 G;  1QVC A;  1P16 A;  5GQO A;  3CMA A;  4JCV E;  1VS0 A;  1X65 A;  4IPH A;  4QIW E;  4QL5 A;  4PMW A;  4AYB G;  5M5X H;  4UP7 A;  4JBW A;  3D31 A;  1E1T A;  2WAQ E;  4A75 A;  1CKM A;  3JAM c;  4HJ8 A;  1PYS B;  2EXD A;  4H02 A;  1JJ2 A;  3AFQ A;  4B3T L;  2IY5 B;  4WJ4 A;  3I4O A;  2Y0S G;  1DGS A;  1X6O A;  5H1S E;  4KHP Q;  5C0X J;  1J5E Q;  1PH5 A;  2EQS A;  1Y1W G;  3JAM i;  3CAM A;  3CCV A;  4A3K H;  1VQL A;  1GO3 E;  2Z6K A;  3CC2 A;  3CP0 A;  4LF6 Q;  1JJC B;  3HFZ B;  1ASZ A;  4OXP A;  3IRB A;  1L1O C;  3A0J A;  4HIO A;  2WAQ G;  5JEA G;  4JI7 Q;  3K7U C;  3PO2 H;  4B3R Q;  1SRU A;  3PUW A;  4DV3 L;  2ZJP A;  3KYH C;  1EWI A;  1K8A C;  4LFA L;  2VUM G;  1VQ8 A;  5EAY A;  2IX1 A;  1VQN A;  4P74 A;  4UY8 C;  2LSS A;  1XNR Q;  4JI2 Q;  1U5K A;  2E2J H;  2I5M X;  2VNU D;  1TWC H;  4XTC S;  3I7F A;  1Z47 A;  3S2D H;  2AWO A;  1R9T H;  4A3B G;  4JBK A;  3PUZ A;  1VQP A;  4LFB Q;  1PYB A;  1SLJ A;  4UPA A;  3J80 i;  3W1G A;  2UXB Q;  1FL0 A;  4KHP L;  1HNW Q;  1IL2 A;  3UDX A;  1J5E L;  4RG1 A;  4DAM A;  1E1O A;  4LF6 L;  4JV5 Q;  1VQ9 A;  2PMZ E;  3BZC A;  5ELO A;  1K8G A;  1K3R A;  4C3I H;  3HOV G;  1VQK A;  3BZK A;  4JOI A;  4OWT B;  4JI7 L;  1Q12 A;  4B3R L;  1VQH A;  3G4S A;  1Q46 A;  1VQJ A;  3HOX G;  1YJW A;  5C4J H;  4TQU S;  2WFW A;  2R7D A;  4X64 Q;  1IBM Q;  1XNR L;  4GLV B;  3TRZ A;  4JI2 L;  4LUV A;  3F2D A;  2R92 G;  4P75 A;  2JA9 A;  1V9P A;  1OXT A;  1LYL A;  4OWX B;  1O7I A;  1WCM G;  3U4Z A;  3J81 c;  4LFB L;  3ULP A;  1CKN B;  4RMF A;  2R7Z G;  1M1K C;  3HOY G;  1HZ9 A;  2UXB L;  3RN5 A;  1IYJ B;  4DPG A;  1BKB A;  1HZC A;  4R4C A;  1HNW L;  2FXQ A;  3J7Z C;  4JV5 L;  1PVO A;  1LTL A;  2NVY H;  1OTC A;  4X65 Q;  1XMO Q;  4OON A;  3TS0 A;  4DV1 Q;  2MO0 A;  1VQD A;  4YHH Q;  1GM5 A;  2V1C C;  4DR6 Q;  2N8N A;  5C44 H;  1XPU A;  4APV A;  1YIT A;  3CD6 A;  3F2B A;  3NBH B;  3RLF A;  3TQY A;  4GNX B;  3PIO A;  3PF4 A;  3CPF A;  1BBU A;  3Q8D A;  3HOU G;  2A1A A;  2KCT A;  3KF8 B;  1T9H A;  4AH6 A;  3FKI G;  4X66 Q;  5IYB H;  3HKS A;  4R4T A;  4X64 L;  1IBM L;  3S1Q H;  1UE5 A;  1OXS C;  3S16 H;  2UUB Q;  2VQF Q;  2ALY B;  3EBE A;  3AFP A;  1TWH H;  2D0O A;  1S72 A;  3S17 H;  4YWM A;  2B63 G;  1AE3 A;  3CW2 C;  1FJG Q;  4C3J H;  4OWW B;  2NVQ H;  3ER0 A;  3H0G G;  3ULL A;  1PHJ A;  1EIY B;  2OQK A;  2I0Q A;  3BJU A;  2MQH A;  1Y1V G;  1VQB A;  3OYY A;  4HID A;  5FLM G;  3KDF B;  4IO9 A;  1Q7Y C;  1HR0 Q;  3MEF A;  1VQI A;  1C0A A;  3K80 C;  3HOZ G;  1OXU A;  3U58 A;  4X65 L;  1JMC A;  3DM3 A;  1XMO L;  5C3E H;  4DV1 L;  1E24 A;  4YHH L;  2WP8 J;  4DR6 L;  1X56 A;  1NY4 A;  2JA6 G;  2BA0 A;  1PH8 A;  1MJC A;  2YYZ A;  1MKH A;  4DK3 C;  2KEN A;  1I94 Q;  2PQA B;  5C4X H;  2E8G A;  4IFD J;  2JEB I;  4IOA A;  3K0X A;  4GN3 B;  2UXC Q;  2Z6K C;  1QUQ B;  3KF6 B;  4JI1 Q;  1SFO H;  3M4Q A;  1VQA A;  2OTL A;  2RF4 A;  3I55 A;  3K81 C;  2QEX A;  4JBM A;  3FP9 A;  4X66 L;  2R93 H;  4MNO A;  5LMN W;  2XGT A;  1EQR A;  2UUB L;  4P73 A;  2KCM A;  4BY1 G;  2VQF L;  3UDG A;  1IZ6 A;  1TWF H;  1Z9F A;  3F1Z A;  2D62 A;  3CCR A;  1PH6 A;  2JK8 A;  1FJG L;  1A63 A;  4A93 G;  2I5L X;  1UE7 A;  4YY3 Q;  5M3F H;  3STB D;  1YJN A;  4J15 A;  1PH1 A;  2IT1 A;  1HR0 L;  1CUK A;  4DV3 Q;  1EFW A;  1QZG A;  1YIJ A;  1TWA H;  2NN6 I;  1SR3 A;  3B6Y A;  2JA8 H;  2CQO A;  4R1J A;  2ATW A;  1XJV A;  5IT9 c;  4BY1 H;  1KAW A;  1I94 L;  1HH2 P;  1W3S A;  4A3E G;  4BBR H;  2UXC L;  4HJ9 A;  3GTQ H;  4B3M Q;  3PCO B;  5E7N A;  4JI1 L;  1BVS A;  2KBN A;  4IJL A;  3L7Z C;  4JOI C;  3M4O H;  3RZO H;  2CCZ A;  1UEB A;  4DV6 L;  2GN5 A;  1YHA A;  2EIF A;  1BBW A;  5IP9 H;  1KRT A;  4YY3 L;  4IPG A;  5DLQ E;  5K36 G;  1PH2 A;  1C9O A;  3ICE A;  4A3C G;  2NVT H;  3RNU A;  3CC7 A;  1WI5 A;  4NXM Q;  4POG A;  2BH2 A;  2JA5 G;  1X3G A;  2MFI A;  4BY7 G;  1CSQ A;  2E2I H;  5GAG C;  2L15 A;  1KL9 A;  1Y14 B;  2GVB A;  2I5H A;  3KLW A;  4QGU A;  5C0X I;  3G6E A;  4A3D G;  4NPS A;  1RIP A;  4A3I G;  1U0L A;  3SGI A;  1WOC A;  2JEA I;  1Y1W H;  4B3M L;  4HJA A;  2N49 A;  3LGJ A;  5J3B A;  1YZ6 A;  4A3J G;  4QJF A;  4LF5 Q;  2JE6 I;  3A74 A;  2RHS B;  2NZH A;  1A62 A;  4YWL A;  4A3L G;  4BA1 I;  1IXR A;  2IHE A;  3RR5 A;  5LMN Q;  4IOC A;  1CKN A;  4K0K Q;  4DKA C;  5IYD G;  1EIF A;  1HZB A;  3KJP A;  4X62 Q;  2VUM H;  1SRO A;  1MJE A;  4A3I H;  4L5T A;  1XNQ Q;  2BA1 A;  2Q2H A;  4QQB X;  1HNZ Q;  4DUZ Q;  3NEM A;  4GOP A;  4NXM L;  3PV0 A;  5ELN A;  1Q82 C;  3MXN B;  1VQ6 A;  1WYD A;  4GNX A;  2IX0 A;  5IWA Q;  1C7Y A;  1GD7 A;  4TVA B;  1I50 H;  4B3S Q;  2OTJ A;  3RZD H;  1B7Y B;  2NVX H;  4A3F G;  1K73 C;  3PSI A;  2OQ0 A;  1NMG A;  1KC8 C;  4LF9 Q;  2MO1 A;  2ASB A;  4AQY Q;  3HOV H;  4DR7 Q;  2VY3 A;  4LF5 L;  1JT8 A;  1AH9 A;  3A5Z B;  4A3G G;  2KHI A;  1VQF A;  3I56 A;  4IFD G;  2JA7 G;  3HOW G;  1NBW A;  3CC4 A;  1WFQ A;  2BH8 A;  2HQL A;  3J81 i;  5LMN L;  4GKK Q;  1KRS A;  2HIX A;  3HOX H;  1X9N A;  4K0K L;  4DV2 Q;  4X6A H;  4X62 L;  3I4N G;  2RCN A;  3PUV A;  2A8V A;  4JBJ A;  1E22 A;  4C2M H;  2UU9 Q;  2HT1 A;  1NMF A;  1XNQ L;  2R92 H;  2PI2 E;  1HNZ L;  4DUZ L;  1YI2 A;  3H3V I;  4R4O A;  1WCM H;  2XTI A;  3CCM A;  5GAD C;  1N9W A;  2OWO A;  2DGY A;  2K4K A;  4PG3 A;  3KFU A;  2JJQ A;  2R7Z H;  5M5W H;  3HOY H;  3S1R H;  2PQA A;  3D0F A;  2YTV A;  4AIM A;  5IWA L;  2MNA A;  2Q2U A;  4B3S L;  3S14 H;  3GTP H;  1EYG A;  1QUQ A;  1SN8 A;  2VQE Q;  2QA4 A;  3A5U A;  4HIM A;  4LF9 L;  1B70 B;  4DR7 L;  4AQY L;  1S3O A;  3CCS A;  1PH3 A;  1K0R A;  3CQZ H;  1YBY A;  4BXX G;  1H95 A;  4JI3 Q;  3FHW A;  2F4V Q;  3F8T A;  4DV0 Q;  1ASY A;  4HJ7 A;  3HOU H;  2YTY A;  5IP7 G;  2OCE A;  1KHI A;  4GKK L;  1J6Q A;  3FKI H;  5IYC G;  3EIV A;  4DV2 L;  1L1O B;  1KD1 C;  4L5S A;  3DLL A;  2UU9 L;  2F52 A;  1N32 Q;  4BBS G;  1VCI A;  2B63 H;  4ALP A;  3GD7 A;  3GTG H;  3AEV A;  2N78 A;  3H0G H;  3W5O A;  5LMU Q;  3U50 C;  1VQ5 A;  1Q8K A;  1Y1V H;  3HKZ E;  4BXX H;  1W2B A;  1V43 A;  4YCV A;  3TRE A;  5HGQ A;  4HIK A;  5GAH C;  4EX5 A;  5FLM H;  1PH7 A;  3I4M G;  3PO2 G;  3E9I A;  2VQE L;  1YHB A;  1VQM A;  4BA2 I;  4LW1 A;  4DV6 Q;  3HOZ H;  4L5R C;  1OXV A;  1XPO A;  3KOJ A;  2VL6 A;  3J81 j;  1Q1B A;  3E0E A;  1I3Q H;  4MTN A;  1IBK Q;  2JA6 H;  1I6H H;  1FGU A;  2ZTC A;  4A3B H;  3PF5 A;  4JI3 L;  1K83 H;  2F3I A;  1WJJ A;  4DV0 L;  2F4V L;  3CME A;  4LF4 Q;  3AQQ A;  3HKZ G;  2E5L Q;  4A3M G;  4EQ5 A;  4YCW A;  3PO3 G;  2K5N A;  1L0W A;  2ZJQ A;  1QVF A;  2E2H H;  2QGQ A;  4OX9 Q;  1X54 A;  1EQQ A;  5M5Y H;  2ZTE A;  1VQ4 A;  1N32 L;  2LXK A;  2CKZ B;  1VQO A;  2NZO A;  4Y7N H;  4LF8 Q;  2HHH Q;  3K8A A;  1XMQ Q;  4A93 H;  3UE1 A;  1G51 A;  5LMU L;  4LFC Q;  4WJ3 M;  4ME3 A;  5JJI A;  2YU9 H;  1PH9 A;  2WB1 E;  3GO5 A;  3L0O A;  3CPW A;  4GOP C;  1VQ7 A;  2ZTD A;  2CFM A;  3OTO Q;  3TS2 A;  2B29 A;  5IE8 A;  1N36 Q;  4GNX C;  1CSP A;  4LWC A;  3JC6 6;  1IBK L;  4DAY B;  1D7Q A;  2RHQ B;  4A3K G;  4NXN Q;  4A3E H;  1E7Z A;  4KHZ A;  3RLO A;  1OXX K;  2PI2 A;  5IY0 A;  3CCQ A;  4LF4 L;  2WB1 G;  2E5L L;  3GTL H;  2K5V A;  1RL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...