2YTXA

Solution structure of the second cold-shock domain of the human kiaa0885 protein (unr protein)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
97
structure length
97
Chain Sequence
b'GSSGSSGNIMLLKKKQARCQGVVCAMKEAFGFIERGDVVKEIFFHYSEFKGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold shock domain-containing protein E1
publication title The NMR solution structures of the five constituent cold-shock domains (CSD) of the human UNR (upstream of N-ras) protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 5
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ytxA01
5IYBH 4AQYL 3GTGH 1YNXA 1JJCB 3T1YQ 5JJLA 4Y7NH 2OTLA 4LF7Q 2K14A 1E22A 4POFA 3H0GG 2NVTH 1Y1VG 3JC66 1CKNA 3LGJA 1VQ4A 3S14H 1PH7A 1GM5A 3I56A 1QUQA 2K5NA 3CP0A 1X3GA 1OXUA 4DR1L 5AJ3Q 4JI7L 4LF5Q 1QVFA 3UDFA 4C3JH 1Q86C 5LMNL 1BBUA 4HJ8A 4B3TL 4BY7G 3ER0A 1P16A 2NVYH 1Z47A 3NELA 3UDIA 1E1OA 3TEHB 2PQAB 3ULJA 5IP9G 4A3LH 1FL0A 1TWFH 4GLXA 4JYAL 3KDFB 4YY3L 1AE3A 2YU9H 3I4MG 3H15A 2ZTDA 1Q7YC 5ELNA 2JEAI 2VQEQ 4KHPQ 2RF4A 3HFZB 4IFDJ 3F2DA 3CCJA 4A3BH 4A3GH 4JV5L 3UE1A 1RL2A 3F1ZA 3STBD 1P8LA 4X64Q 4YCUA 4JI1L 4DUYQ 4LF9Q 5JEAG 4IJLA 3MEFA 3KJOA 4B3RQ 2HT1A 1JMCA 4IPGA 3A5ZB 4DV5Q 4C2MH 5JJIA 4AIMA 4DK3C 1WCMG 2E8GA 2PNHA 4NXNL 4DV2L 3HOZH 4DV4Q 5GQOA 2QA4A 4NB3A 4L5TA 3CPFA 4LF6Q 3GTJH 4YCVA 4DUZQ 4TQUS 2VQFL 2MO0A 4A3JH 3PUXA 1EOVA 1GD7A 4JI3Q 4DPGA 3H3VH 1N9WA 3J80i 3KLWA 5FLMH 4IO9A 4PZ6A 1O7IA 2GVBA 4P73A 4AYBE 2PQAA 2EQSA 5C0XG 2E2JH 4DKAC 1HNZL 2CWPA 1EYGA 1IZ6A 3KDFA 3UE0A 4RG1A 2OWOA 3S1QH 2YTYA 1K83H 1C9OA 3F2BA 1XPOA 1VQ6A 5M3MG 4A75A 3D31A 4LW1A 4A3KH 1M1KC 2E5LQ 2WFWA 4JOIA 1J6QA 2WB1G 4KI0A 1N8RC 1OXVA 1J5EQ 1N33Q 1C0AA 1CUKA 1HZCA 5IYDH 5C4XG 1Q1BA 3JAMi 4A3EG 4DR2L 4PMWA 1PFSA 1YBYA 1Y1WG 2GN5A 4A3DG 1B7YB 4B3SQ 2GVAA 4LF4L 4NXMQ 3J81c 4HIDA 3HOUH 2B3GA 4OWXB 3GTOH 3UDXA 4A93H 1D7QA 1QVGA 4DR4Q 2JA8G 5IYCH 3U50C 3J7A5 2YTXA 3G71A 1UE1A 3U4ZA 4EX5A 4DV1Q 3B6YA 2E2IH 2JA5G 2PI2A 1XMQL 3CAMA 4BY1G 4R1JA 5H1SE 3M3YH 4GKJL 5C44G 3HOYG 4JBWA 1UE7A 2PMZE 4HIKA 2ALYB 2ASBA 2JJQA 4DR6Q 2HQLA 3J7ZC 3U4VA 4C3HH 5ELOA 1EQQA 1KRTA 2UUBQ 4A4IA 5BR8L 4DR3L 3T1HL 2UU9L 4IFDG 3RR5A 1VQPA 4GNXB 3E9HA 2BH8A 4YWKA 1YJNA 3HKZE 1A63A 4A3CG 4R4CA 1X65A 2R7FA 1XJVA 3HOWG 1VQ9A 5J3BA 3RNUA 1N36L 1VQEA 1X55A 1NJIC 1VQHA 4JOIC 5GAGC 1R9TH 2KBNA 3S24A 1LTLA 2UXCQ 4DV7Q 1D8LA 3D0FA 4POGA 5GROA 3OW2A 3AQQA 4HIMA 1VQJA 3BZCA 3TQYA 4B3ML 2R92H 5M5XH 1HR0Q 1B70B 2AKWB 1IBLL 3AFQA 1KRSA 3KF6A 4IPCA 1KIXA 1SR3A 3PF5A 1YIJA 3K8AA 4KLKA 5IWAL 1SE8A 1WOCA 3S17H 1VQ5A 3A74A 1JE5A 3M4QA 1KD1C 2B63H 1LUZA 2MO1A 4BA2I 1L1OB 1I94L 4R4IA 4L5RC 3KJPA 3HOXG 4HJ5A 3BZKA 2KHJA 2OQ0A 1S72A 1HNXL 1XNRL 1N32L 1TWGH 3CW2C 4GNXA 1E7ZA 2R93G 2BA1A 2E2HH 4Y52H 1OXXK 1MJCA 1X9NA 1Q46A 4R4TA 4B3TQ 5C4JH 1DGSA 2R7DA 4JCVE 1FVIA 4BBRG 2ID0A 3F8TA 1KC8C 3H0GH 1XNQQ 1VQFA 1Y1VH 3L2PA 4MNOA 3PO2G 5M5YH 1I6HH 4OWTB 4K0KL 2Y0SE 1VQ8A 1N34L 4YY3Q 1IBML 4OXPA 3GTPH 1HH2P 2K5HA 1VQGA 1PH9A 1PH8A 1HR0W 3RLOA 1L0WA 4LFAL 4BY7H 4OX9L 4JV5Q 1NE3A 1VS0A 1Q1EA 1X56A 2CWAA 1C7YA 3PO3G 3PUZA 3DLLA 4JI0L 1OXTA 4JI8Q 5IP9H 2VZAA 1TWHH 5FJ8G 1UEBA 4P72A 2UXDL 4L5SA 2WP8J 3AYHB 2ZJRA 1NTGA 1E1TA 3I4MH 2N49A 2KHIA 3EIVA 4LUVA 4A3FG 2IHEA 1GVPA 2N8NA 3CPWA 4JI5L 4DR5Q 1PYSB 4JI6Q 3I55A 1FJGL 1L1OA 4A3MG 4UPAA 1XPUA 2LXKA 1PH5A 1YJ9A 4GN5A 4DV2Q 4BXXG 2JK8A 3J80c 4P71A 4R4OA 5GADC 3HOVG 3T1YL 1KL9A 4DR7Q 3RN5A 1JB7A 2YYZA 2R7ZG 1I5FA 4LUOA 2VQFQ 1VQ7A 1SMXA 4QJFA 2Z6KA 4JI4Q 1S40A 4A3LG 1V43A 1WCMH 1U0LA 4X62Q 4GNXC 3RN2A 2VUMG 3ERSX 2RCNA 1GO3E 4XTCS 5AJ3L 4QY7A 3OTOQ 2ZM6Q 3Q8DA 1HNZQ 3S1RH 3M85A 1T9HA 2A8VA 3JAMc 4JC0A 2KCTA 4X66L 4DV0Q 1NMGA 2XTIA 1XMOQ 1PH1A 2CCZA 5K36G 4PZ7A 4BBSG 3KF8B 2EIFA 2VQEL 3PV0A 4DV6Q 3E9IA 5E7NA 1NMFA 4LF4Q 1K3RA 1E24A 5M3MH 1X6OA 2NVXH 1VQDA 4X64L 3ULPA 3AEVA 1KHIA 1EQRA 4DUYL 2I5LX 4ME3A 3I4NG 4B3RL 5C4XH 2ATWA 4LF8Q 2VL6A 3VDYA 3G4SA 4A3JG 4DV5L 4A3IG 2D0OA 1V9PA 3S1NH 1HNWL 4A3DH 2D0PA 1L1OC 2HHHL 1H95A 2F52A 1Q82C 2WAQE 2NVQH 4OONA 3PUVA 4DV4L 2ZTCA 4OO1I 1NBWA 3I2ZA 3I4OA 4DUZL 2UUCL 2JA8H 2C35B 1QVCA 4DAMA 1MIUA 1HZBA 4P74A 4YCWA 3BU2A 4IPHA 2Q2UA 2Z6KC 3KF6B 3CCVA 2L15A 2JA5H 4HIOA 5DLQE 2JA7H 4DR3Q 3T1HQ 4X6AH 2CKZB 4BY1H 1QZGA 1ASYA 3M4OH 1ASZA 5HY6A 5M5WH 5GAEC 1TWAH 3EN2A 1WYDA 2K75A 5C44H 4IOCA 3TREA 3G6EA 4O0AA 1YHQA 3HOYH 2AWNA 1N36Q 2E5LL 1IBKQ 1EUJA 4YHHQ 1X54A 1J5EL 3GTQH 3ZJYC 3TS2A 1RIPA 4X65L 5M3FG 1I3QH 1K9MC 3PIPA 2Q2TA 4RMFA 4JI2L 4UY8C 2MQHA 2Q2HA 4B3SL 4NXML 3HOWH 2JE6I 4UP9A 3NENA 3J81j 3A0JA 3HKSA 3M4PA 2ZJPA 5HGQA 2A19A 2BA0A 2HIXA 1TWCH 2B29A 1TXYA 1Z9FA 4O2DA 4HJ9A 1PA6A 5IWAQ 3ICEA 4BA1I 4LFBQ 1G51A 3GDEA 4NPSA 4DAYB 1Q81C 4DV1L 3K7UC 2DGYA 2RHQB 4QIWE 2UXBQ 1G6PA 4HJ7A 4DV3Q 2YTVA 1I94Q 5LMUQ 1PH3A 1A0IA 3SGIA 1YZ6A 4GLVB 3CCRA 3S15H 4QGUA 2JA6G 1VCIA 5C3EG 4P75A 1XNRQ 3L0OA 1VQKA 5JJKA 2NN6G 4AQYQ 3K0XA 2CFMA 4L5QA 4DR6L 2NN6I 4GOPC 4AYBG 1LM0A 4PZ8A 2IHFA 2UUBL 3GD7A 4A76A 3KOJA 3DM3A 3HOXH 3E0EA 3WWVA 1Q12A 1G291 1K8AC 4DR1Q 1VQBA 4JI7Q 4EQ5A 1K8GA 1IBMQ 2R93H 1UWVA 5LMNQ 1YI2A 4LFAQ 2V1CC 1Q8KA 3M9BA 4BBRH 2UUAL 2HIVA 1YEZA 3FKIG 1BBWA 5GAHC 3PO2H 2OQKA 4DV7L 1Y14B 5IP7G 2NZOA 2QGQA 4JYAQ 2UXDQ 1PYBA 2WB1E 4PG3A 4UP7A 5IT9c 3CC7A 1HR0L 5IY0A 2F4VL 3F2CA 2IT1A 1CKMA 3PO3H 4J15A 4GKKL 5IYBG 3L7ZC 4JI1Q 1B8AA 4YWMA 5FJ8H 4KHZA 1MKHA 1VQIA 2A1AA 3K7AH 1PHJA 1EWIA 2Z0SA 3G48A 4APVA 4A3FH 2EXDA 3W5OA 1CKOA 4LFCL 1K0RA 2YV5A 4A3MH 3A5UA 2VW9A 1S3OA 1VQCA 3IRBA 4NXNQ 4BXXH 4OWWB 3EBEA 1SN8A 3RLNA 3HOVH 1CSQA 1FGUA 2JA9A 4LF7L 4MZ9A 5LMNW 2R7ZH 1JJGA 3RZDH 3HKZG 1XNQL 4LNQA 2OTJA 2IX1A 3ULLA 4X66Q 3TRZA 1HZ9A 3FHWA 1SFOH 2VUMH 4LF5L 3CCEA 3CD6A 4IPDA 4GLAC 4JG2A 1VQMA 2RHSB 1UE6A 4GOPB 1MJEA 1A62A 4A3BG 4A3GG 2PI2E 4JBJA 3RZOH 1UE5A 1XPRA 3CCUA 4QL5A 2BH2A 4JI8L 1NY4A 4ALPA 4GN4B 1W2BA 3CCLA 1HZAA 1CSPA 3CC4A 4KHPL 4BBSH 4DK6C 4DR2Q 4DR5L 1HNWQ 3CC2A 4HJAA 4TVAB 4JI6L 4QQBX 4LUZA 1VQAA 2CQOA 2AWOA 4IJHA 1QZHA 2VS1A 2HHHQ 1E3PA 3I7FA 1K73C 3HOZG 4LF9L 4WJ3M 1OXSC 1VQNA 2FXQA 1PH2A 2F3IA 1VQOA 2KENA 4DR7L 4UP8A 3I4NH 3S16H 2UUCQ 4A3EH 1Y1WH 1EIFA 2ZJQA 4A3IH 4DNIA 2ES2A 1LYLA 1KQSA 3CMAA 5FLMG 4JI4L 3H3VI 2VY3A 3AFPA 4X62L 1SLJA 1XMQQ 4OO1G 2AHOB 3CF5A 3OTOL 1YHAA 4LF6L 1EFWA 4GKJQ 1KXLA 2D62A 2ZM6L 5C0XI 3GO5A 3TS0A 4JI3L 3NBHB 4GOPA 4A3KG 2Y0SG 2KCMA 4DV0L 4GS3A 1JJ2A 1VQLA 3M7NA 2OCEA 1A8VA 5BR8Q 1XMOL 3W1GA 5IYDG 3BJUA 2UU9Q 3KFUA 2VNUD 3NEMA 4X65Q 3W1BA 4JI2Q 3MXNB 2I5MX 4DV6L 3GTMH 3GTKH 2LXJA 2R6GA 1EIYB 3U58A 4AH6A 2DUDA 3HOUG 1YHBA 4A93G 4IOAA 1N33L 2IY5B 4YWLA 1SRUA 5IYCG 1YITA 4LF8L 5M3FH 3PGZA 3PUWA 1I50H 3UDGA 3S1MH 4A3CH 3K81C 1X3FA 3PUYA 1KAWA 4FDBA 1XTDA 4B3MQ 4H02A 2N78A 1PH4A 5IE8A 1PVOA 2JA7G 1IBLQ 3CQZH 2NZHA 3CCMA 5EAYA 4DR4L 1W3SA 2XGTA 2ZTEA 4JBMA 1IXRA 2AMCB 4WJ4A 2JQOA 3J81i 2QEXA 1BKBA 2IX0A 3PIOA 4MTNA 4R4QA 1M90C 1U5KA 1PV4A 3CXCA 5JEAJ 2I5HA 4GN3B 2K5VA 4JBKA 1IYJB 1HNXQ 3CCQA 3S2HH 2JA6H 5C3EH 1PH6A 4IFDI 1N32Q 1WFQA 3STBC 3PCOB 2MNAA 3CMEA 3FP9A 1WJJA 1CKNB 3OYYA 4YHHL 1YJWA 1IBKL 1QUQB 2H5XA 2UUAQ 1OTCA 1IL2A 5FLXc 3K80C 2N3SA 4XIGS 4K0KQ 2JEBI 1N34Q 3S2DH 3GTLH 2R92G 1WI5A 5C0XJ 1X3EA 1AE2A 3CCSA 1BVSA 2Q2IA 2F4VQ 4OX9Q 3RLFA 1L2FA 1GKHA 3FKIH 4JI0Q 2K52A 4GKKQ 2UXCL 4LFBL 1JT8A 5IP7H 3PF4A 2K4KA 2K50A 2UXBL 2WAQG 4C3IH 2B63G 2I0QA 2MFIA 1YVCA 1V1QA 4DV3L 3PSIA 5LMUL 2LSSA 4JI5Q 1HJPA 4LFCQ 1FJGQ 3KYHC 1AH9A 4LWCA 1SROA
chains in the Genus database with same CATH superfamily
4K5VA 3R93A 4RKLA 4Y7NH 2OTLA 5EKLA 5IGBA 1BDOA 2F0JA 2K14A 4POFA 5A35A 2NBFA 1Y1VG 3S14H 4DFAA 1SYDA 2E76C 2K5NA 5AJ3Q 2IX3A 3DWAA 4LF5Q 3ZYYX 4BY7G 1F2LA 3OMGA 5C4XB 3W2DA 4KK7A 4H0LC 2PQAB 1TWFH 1SNDA 2MPMA 1YNND 2NVQB 2VQEQ 2RF4A 3HFZB 4A3BH 1SBBB 1RL2A 4HN7A 2NWGA 3QR8A 3STBD 3D8GA 2F0VA 2JA5B 5FKAC 1O80A 4B3RQ 4BY1B 1EY6A 1JMCA 3A5ZB 4C2MH 1JWMD 1TWAB 2EJMA 1SXTA 4JVZA 2ENBA 1A3TA 2FMCA 3TP6A 2QA4A 5I2YA 2EZVA 4LF6Q 4L5TA 4YCVA 2K7VA 1GD7A 5JPNC 4DPGA 3KLWA 5FLMH 2PQAA 4F87A 2L12A 4KN7C 1HNZL 1ZXTA 2CWPA 1Q90A 1VQ6A 1C9OA 3D31A 4A3KH 2E5LQ 5FO8B 1M1KC 1II3A 2WB1G 3CRLC 2R92B 1J5EQ 1N33Q 3JAMi 4DR2L 4PMWA 4A3DG 1B7YB 2GVAA 4LF4L 4OHJA 1EFID 3LX0A 2B63B 2CH4A 1QVGA 5I9PA 1CQFA 1NNXA 2YTXA 5C5LA 3MEHA 1RTOA 2SDFA 1HA6A 3CAMA 4K8JA 3KLSX 1DM0B 1A2TA 3HOYG 4JBWA 4BBRB 3BDCA 3KF8A 5M5YB 4DR6Q 1STHA 3PIP3 4FXDA 3T1HL 1EWCA 4GNXB 3E9HA 4FF1A 1YJNA 1MHWC 3HKZE 1BF4A 2RSNA 1JWUD 3PO3B 1VQ9A 5J3BA 1SNCA 1YNJD 1N36L 1CA5A 5ELEA 3TN2A 1X55A 3K7AB 4JOIC 1R9TH 3S24A 1LT5D 2UXCQ 1D8LA 3TP5A 5GROA 4A3MB 3AQQA 1VQJA 5T1IA 4K2LA 4B3ML 2R92H 2PW5A 2AKWB 1PTOD 1SDFA 1DCZA 1I4XA 4TSSA 2LS01 1SR3A 4BS9A 4KLKA 3A54A 1VQ5A 3SE0A 2F3VA 1JE5A 2B63H 1LUZA 1SFOB 1I94L 4R4IA 4DK1A 1PRTF 5IGFA 1LTAD 1S5CD 1CZGA 1HNXL 5K5PA 5KIXA 1F9PA 1TWGH 4GNXA 4ULLA 4Y52H 4K6LA 1MJCA 1X9NA 4B3TQ 1FVIA 1XNQQ 3H0GH 3L2PA 3JAML 1PRTC 5M5YH 1IBML 4YY3Q 3GTPH 4FF3A 1PH8A 3PMFA 1HR0W 3RLOA 4JV5Q 1R4PB 3S16B 1Y1WB 2CWAA 3FPPA 1OXTA 1IYUA 1EU3A 1UEBA 1SNPA 2O2LD 2IHEA 2N8NA 3CPWA 2Q8TA 3I55A 4DAPA 1XPUA 1YJ9A 4DV2Q 3HOVG 3T1YL 1KL9A 1VF5C 3RN5A 2VQFQ 2OXPA 1VQ7A 3GTMB 2Z6KA 2G9HD 2HCIA 1S40A 1WCMH 1U0LA 5FO9B 1SE3A 2RCNA 5L37A 1ILPA 1AN8A 2ZM6Q 2VXWA 3OSOA 4QF4A 2PQEA 3S1MB 1FNUA 4X66L 2K5WA 3VR6A 4CDFC 1XMOQ 5C0XH 3D3RA 1S5ED 4HCEA 4PNYA 2HCCA 3E9IA 2HD3A 1XX8A 1HUMA 1VQDA 3MZ5A 4FP5D 4X64L 3AEVA 2AQ3B 2I5LX 4JPBW 4ME3A 4DNRB 2VL6A 5JAVA 4A3JG 2QCPX 3S15B 1L1OC 2HHHL 1H95A 2F52A 1SYEA 4OONA 2ZTCA 1NBWA 4DUZL 3I4OA 2C35B 2CH4W 3SVMA 1VDZA 4IPHA 1O78A 3KF6B 3S2DB 1TS4A 1KNAA 2JA7H 1V8QA 5M5WH 5C44H 3TREA 4O0AA 3TP7A 4RHRA 5FOBB 3I3CA 4OIKA 1IBKQ 2XN9C 4HCSA 1I6VC 3NHHA 4IFDH 5EQ0A 4JI2L 4RMFA 4UP9A 3HKSA 1O7YA 1ZYRD 1I4HA 1ILQA 3ICEA 4LFBQ 1G51A 1STEA 1VMPA 3GDEA 4NPSA 3TSSA 1Q81C 2DGYA 4J1MA 3NBHA 4C56C 4DV3Q 5LMUQ 3SGIA 1YZ6A 2QILA 3S15H 4QGUA 1VCIA 1GOZA 2NVYB 3VYUA 5C6AA 5C3EG 3K5LA 1XNRQ 4AQYQ 1D5MC 2E2DC 2TMPA 3GV6A 2IHFA 3GD7A 4A76A 3KOJA 2NYZD 5KNBA 3HOXH 1WTPA 3E0EA 2F0IA 1K8AC 4PMCA 4DXFA 5CR3A 1VQBA 4JI7Q 2R93H 3A8JE 5LMNQ 2B2VC 4LFAQ 1QWYA 4RHSA 4BBSB 2NTSA 1PFBA 1BBWA 5GAHC 1MBYA 2JP1A 2L4NA 2NZOA 4JYAQ 4C3IG 2K32A 1PYBA 2WB1E 1RD9D 3HOZB 1HR0L 1CFMA 5IY0A 2MJ8A 2IT1A 1S4ZA 3T51B 4KTAA 4ZKCB 3E0JA 4JI1Q 4YWMA 5ELCA 2ICIA 1DZ1A 1R4QB 4DAVA 4APVA 4A3FH 2K5QA 3NQTA 1K0RA 2EOTA 1PXUA 3A5UA 1S3OA 1VQCA 3IRBA 2VW9A 4OWWB 1CA6A 3VR3A 2JA9A 3DUZA 3T53B 5KYLA 3RZDH 2KA7A 2F0KA 1SE2A 1SNOA 4H7BA 4E6IA 3NP8A 5LL6S 3NTHA 1JORA 3HOUB 3M4YA 3BYYB 1JB3A 4A3BG 4GOPB 1MJEA 1A62A 3RZOH 1XPRA 3URYA 2BH2A 2XSCA 1U4LA 5FLXE 3CCLA 1JOKA 1CSPA 4BBSH 4DK6C 2F03A 1C8CA 4DR5L 1HNWQ 3CC2A 1LTID 4TVAB 4JI6L 4QQBX 2CQOA 3NTIA 3MVVA 4DF7A 5JVH3 3I7FA 1K73C 3Q0AA 1VQNA 2FXQA 1PH2A 1X32A 2F3IA 4DR7L 1DYQA 3WOEA 2UUCQ 1B1ZA 2ZJQA 2JA6B 1LYLA 1KQSA 5FLMG 3SK6A 2VY3A 4X62L 1XMQQ 3I90A 3OTOL 4DA2A 4CKCA 1C48A 1F2ZA 2F1MA 4PQXA 1CHPD 5FK9C 1Y8OB 4GOPA 4A3KG 3ONAB 1VQLA 2OCEA 1SAPA 5BR8Q 4Z9CB 1Y8PB 3BJUA 3NEMA 5JOBA 4DV6L 2LXJA 2EDGA 3U9OA 1YHBA 3K57A 4KKSA 1D6EC 1IW7D 4YWLA 1SRUA 1A6XA 1YITA 2L1BA 3PGZA 4R8NA 1I50H 5IGGA 5KNDA 1X3FA 5DNFA 1PH4A 2E2HB 4DR4L 2DNEA 4JBMA 2X69A 2PZWA 4O42A 4WJ4A 3J81i 4LJZC 1BKBA 1M90C 3C1FA 4C3JB 5JEAJ 4GN3B 4JBKA 1BQQT 3SEBA 3E6ZX 3CCQA 2JA6H 4XXEA 4N8X1 3CMEA 4FF4A 1I4GA 2KVMA 1DOKA 3OPOA 2K1BA 4UAIA 1WD0A 2H5XA 3OOCA 1DJRD 1SJED 1IL2A 1L0YB 2HDLA 2N3SA 1N34Q 3QIAA 3GTLH 2R92G 5G3LD 1WI5A 2JYOA 1OO9B 5EBDA 2K52A 4GKKQ 2KEEA 2UXBL 2B63G 1I4RA 2MFIA 1YVCA 2BE5C 4JI5Q 1HJPA 4LFCQ 3KYHC 3J7YW 5HY6A 1B2TA 5BN3A 1E22A 3QOJA 3H0GG 1TY0A 1TR5A 1VQ4A 1EU4A 4RFBA 3I56A 4DR1L 3CP0A 1X3GA 2QDBA 4C3JH 3A7LA 4HJ8A 4XQQA 1TU2B 1SYBA 3ER0A 1IHZA 3VR2A 1Z47A 3NELA 4ZYSA 3VYRA 4HSVA 4GLXA 1AFPA 2IWHA 3T16A 4XQNA 4KHPQ 1Z7TA 3QOLA 3UE1A 2M9VA 2JA8B 2D2CC 3F1ZA 2BDNA 4DXGA 1JR0D 3Q24A 1P8LA 3J81L 4YCUA 4DUYQ 5CC4A 2EY1A 4IJLA 5EPLA 3OMCA 4DK3C 1WCMG 1TS3A 1EZ8A 1K8MA 4DV4Q 1VMCA 5GQOA 3CPFA 3DWQA 1I3QB 4A3JH 4UDUC 3HRZC 3J80i 5I4DA 2E2JH 1RCVD 2KJXA 5C0XG 2F0PA 4DKAC 2OEOA 1TWCB 1EYGA 1LT3D 3NE5B 3AU7A 4RG1A 3F2BA 1K83H 3KUPA 1XPOA 4JOIA 1J6QA 1N8RC 1OXVA 5M5XB 3IKJA 5IYDH 1HUNA 1EOTA 1Y1WG 1A2UA 1PFSA 1YBYA 5TSSA 4NXMQ 4B3SQ 4X3UA 1XWEA 1RHPA 4HIDA 2WAQB 2B3GA 1QILA 1LABA 1D7QA 1LTSD 5IYCH 4HSPA 1K3BC 4RGOS 3J7A5 2CHBD 1UE1A 4DV1Q 5D3IB 5HURA 1KNEA 4CBVA 2QW7A 3M3YH 4NW2A 4WORA 2BCOA 5C44G 1UE7A 2A68D 2PMZE 4ZAIA 1ET6A 3PO2B 1SYGA 2HQLA 4C3HH 1EQQA 4A4IA 4DGZA 4IFDG 1A63A 2BH8A 4R4CA 3R8BA 1X65A 3RD4A 3Q23A 5KNCA 1PZJD 1VQHA 1BXTA 3QB3A 1I4PA 2Q8IB 2A5HA 2PO4A 4JK1C 4DK0A 1LLRD 1H9SA 3BZCA 3TQYA 5M5XH 3LWUA 1KRSA 2R7ZB 1WOCA 4GZYC 3A74A 1KD1C 1DONA 1U4MA 3J80L 2G5DA 4BA2I 2VUMB 1V1PB 1L1OB 1U4PA 3HOXG 4PV1C 1IYVA 2OQ0A 1S72A 1CZWA 1N32L 3ERQA 1BBXC 2R93G 4R4TA 5C4JH 4JCVE 1LT4D 2R7DA 4V0BA 1KABA 1HTLD 3CRKC 1I6HH 4K0KL 1VQ8A 1ML0D 4OXPA 2F4IA 1PH9A 5E3FA 1L0WA 3I4NB 4OX9L 1B3QA 1Q1EA 4A3EB 1C7YA 1EY8A 3PUZA 4A3IB 3MC0B 4JI0L 4JI8Q 1K8OA 5IP9H 2VZAA 1TWHH 5J39A 1BCPD 2QDLA 2UXDL 1LO5D 1RDPD 4ZUJA 4A3FG 4LUVA 1PTOH 3TBIB 3QG1A 1V1PA 1L1OA 1H9KA 2LXKA 4GN5A 5GADC 1I5FA 2FINB 1F2MA 1SMXA 3QWNA 3R2IA 3GTKB 1V43A 2XVSA 3RN2A 1G6ZA 1GUGA 5AJ3L 4QY7A 1PMRA 1HNZQ 2EPBA 3A56A 2D5DA 2A8VA 3JAMc 5M3FB 1QJOA 5CGKA 4DV0Q 1NMGA 1PH1A 1PDQA 5EKKA 4MHEA 3K59A 4PZ7A 4BBSG 3KF8B 2VQEL 3EQLC 1NMFA 2SNSA 4LF4Q 1X6OA 2RDGA 2RQXA 3CU7A 2RBMA 4B3RL 5C4XH 2A6HD 2F0OA 1EEID 1KAAA 1V9PA 3S2HB 2CQAA 1Q82C 2NVQH 2Z1CA 4K6DA 4OO1I 3I2ZA 4P74A 3BU2A 4X3KA 2Q2UA 2JA5H 3CCVA 2L15A 4CKBA 4BWGB 3T1HQ 4BY1H 2AUKA 1JQYD 1ASZA 5GAEC 1TWAH 3G6EA 3FKIB 4Q5VA 4IUUA 4HMJA 1N36Q 2E5LL 1E0BA 1GHJA 5FO7B 1J5EL 2N55A 1Z6HA 4I7ZC 4UY8C 1ENFA 1BCPF 2Z4IA 5JJZA 2B2TA 2JE6I 1D1IA 4I7AA 3GTGB 3VYTA 2A19A 4QUCA 4XYOA 2Z8LA 1TXYA 4DN4M 1Z9FA 1NR4A 1PA6A 1SYCA 3BG3A 1MGSA 1SJHD 2CW0D 4FVMA 1YNNC 5C5MA 2YTVA 1B44D 1I94Q 1A0IA 1FGBD 2JA6G 3HKZB 3L0OA 1DOLA 3TZDA 1EYCA 4I65A 2PNRC 4DR6L 4AYBG 1EZ6A 5CORA 2OF1A 2YU9B 4ZKBB 3DMUA 4FYDA 2HUGA 4A3GB 1TIID 1G291 5CBAE 4EQNA 3OHXC 1IBMQ 1NSNS 2QKIC 1O7ZA 3M9BA 4BBRH 5JVG3 2HIVA 2J4XA 1E2WA 1Y14B 3U9SA 4XT3B 3CC7A 4RCOA 3BZDB 3J81E 3N52A 5E4WC 4M8AA 3F2CA 4C1NK 4KHVA 2V4DA 2MGSA 4RKBA 3PO3H 4J15A 1C4QA 2GA4B 3L7ZC 2CVRA 5FJ8H 3K7AH 3K5MA 1PHJA 3G48A 2EYOA 2YV5A 2RDHA 4A3MH 4G7OC 2VB3X 3E5SA 4NXNQ 4BXXH 4C3JG 2KCCA 4F8MA 3D4WA 3VR5A 1SYFA 4LF7L 4MZ9A 5LMNW 2NB0A 3W3AA 1XNQL 2OTJA 2IX1A 3FDTA 4X66Q 4L63B 1JE4A 3FHWA 5D65A 1SFOH 3CD6A 4FXKC 4GLAC 3GTOB 2EE1A 4A93B 1UE6A 2RHSB 2EYJA 5EGTA 2PI2E 3BDLA 3NWSA 4F88A 1O7LA 2E2IB 4CGYB 1G2SA 4HEDA 3OW7A 1W2BA 3CC4A 3IFTA 2L5TA 5A2QE 4LUZA 4IJHA 1YNJC 2HHHQ 1PTOF 1E3PA 4LF9L 2L0CA 3T4AC 1VQOA 3TZUA 2XNAC 4F7XA 3S16H 1Y1WH 2B2WC 1HFNA 1EIFA 1J8IA 3BVZA 4DNIA 2O4XA 3CMAA 4IUTA 4XT1B 4U673 1SLJA 2AHOB 4XYQA 1PTOC 1YHAA 4GKJQ 2D62A 2ZM6L 2IL8A 3GO5A 4JI3L 3NBHB 2ICEC 2EYLA 2Y0SG 3R2TA 4KJNA 1A8VA 1XMOL 1L0XB 3W1GA 2K01A 1LT6D 5IYDG 2UU9Q 1WTVA 4JI2Q 3GTMH 4IN3A 3S17B 4AH6A 1A15A 2IY5B 4B9WA 5IYCG 1STNA 1WTOA 3S1MH 2K6AA 4FDBA 1FR3A 2N78A 4H02A 1G2TA 5BN5A 1IBLQ 5DM73 3CCMA 4RWSC 3J80E 1QNUA 2NVTB 3BVMA 1Y1VB 3O13A 2JQOA 2QEXA 4K14A 3PIOA 4C3HG 4R4QA 1STBA 2F0WA 4H44C 1PV4A 2B2UA 3TDQA 4BY7B 2A74C 4MIUA 1LTRD 1XXGA 1WFQA 1BO0A 1IL8A 3WDNA 3PCOB 1IBKL 2AQ1B 3OYYA 3HGBA 4CJ2C 4EQPA 1OTCA 4HR7B 5I6WA 3S2DH 1BNZA 1LACA 5T1GA 1BVSA 3D6CA 2A69D 1QE6A 2I07B 1GKHA 3T56B 4LFBL 1JT8A 5IP7H 2NZ1D 2K50A 1KDCA 2WAQG 2I0QA 3GQBA 3A55A 4DV3L 3GTJB 5LMUL 3S1RB 3D4RA 3OWEB 1FJGQ 3H09A 1EY7A 1B9NA 5IYBH 2P5ZX 4AQYL 1YNXA 2PCFB 1TKWB 1AP0A 2ZXRA 3OIQA 2NVTH 4M1UB 3JC66 3LGJA 2JXMB 2RVLA 4G7HC 1PH7A 1GM5A 3SDZA 4B08A 1OXUA 4JI7L 5C3WA 1CK1A 1SNQA 2B39A 3MFGA 4ZQ3A 1QVFA 1STGA 2WB1B 5LMNL 1BBUA 4NKLA 3D6WA 4DNTB 1P16A 2NVYH 1EY5A 1H9MA 3E3XA 3I72A 3UDIA 2A6ED 2F0MA 1E1OA 3ULJA 2K28A 4A3DB 5IP9G 4JYAL 3LWEA 1AE3A 3H15A 2JEAI 3CCJA 1JOQA 4RCNA 1BUVT 2L9HA 4JI1L 1F9RA 3MXPA 3MEFA 4DV5Q 2LKVA 3M4OB 3HOYB 1D5XC 1GUOA 5KYIA 3HOZH 1QG7A 2XWJB 3GTJH 2PW7A 3GTQB 1ZYRC 4TQUS 1EWHA 1LTBD 2F0HA 5HGTA 1NUCA 4P73A 4AYBE 1PYWD 1IZ6A 1NR2A 3MXUA 3IL8A 4HAEA 2WACA 4A75A 4LW1A 2WFWA 5CV4A 5C4XG 4WFN3 1Q1BA 5CV7A 4A3EG 1FNVA 3J81c 1S5FD 3HOUH 4OWXB 3UDXA 4DR4Q 5EKIA 3V96A 2O5JC 1NCVA 1UNSA 1BR9A 3U50C 3G71A 3DHQA 4EX5A 5C4ZA 1KDBA 2JA5G 1XMQL 4BY1G 1EEFD 5H1SE 4HIKA 2ASBA 4QCLA 3U4VA 1KRTA 2UUBQ 5BR8L 2H1EA 4DR3L 2C9OA 3RR5A 4L6TB 3NBIA 1XJVA 3G7LA 3OIPA 5EBCA 3JAME 3DM1A 4K2KA 1K28A 1NJIC 2ZXPA 2WKDA 3I4MB 1LTLA 4MN3A 4X3SA 4DV7Q 2F0EA 3D0FA 3OW2A 4HIMA 3HEJA 3AFQA 1KIXA 1YIJA 3K8AA 5IWAL 3V2TA 4FO2A 2QEJC 1EYDA 1EIHA 1RJTA 1S5DD 4HJ5A 4RGMA 3CW2C 2IW3A 1E7ZA 2E2HH 1OXXK 1DGSA 2EY5A 4BBRG 2ID0A 3F8TA 1HQMC 1VQFA 3SK4A 5E4XA 4XQJA 4MNOA 4OWTB 2Y0SE 5M3MB 2EYFA 1N34L 2K5HA 1VQGA 4DAYA 1PFNA 1ICFB 1NE3A 1X56A 3FEWX 3PO3G 3S1NB 2N88A 2PZTA 2X6LA 5FJ8G 4P72A 1SMYD 3EA6A 2WP8J 3AYHB 4L5SA 3C46A 1NTGA 3I4MH 2KHIA 1STYA 4IQZA 4JI5L 3QJYA 1CTMA 3MA2B 2RA4A 4A3MG 4BXXG 1TS2A 3J80c 3R3OA 2B8FA 5JEAH 2YYZA 1JB7A 1IW7C 1E2ZA 5KGUA 4JI4Q 4A3LG 5DM63 3ERSX 4OL7A 1T9HA 1Y8NB 2F0FA 1QB5D 2KCTA 3HOWB 4RA8A 2CCZA 1B3AA 2LMCB 4KY7A 3CQZB 1JC7A 1LTGD 2EIFA 3VR4A 5G3LF 1K3RA 1WTQA 1E24A 5M3MH 2SOBA 3MHBA 1PRTB 1KHIA 4DUYL 1B4OA 5NUCA 2ATWA 4KY6A 4LF8Q 3VDYA 3D4DA 3S1NH 3T13A 5C3EB 2WAQE 2DNCA 3PUVA 4DV4L 2EYPA 3EFXD 1H9SB 2JA8H 1V1OA 1TQOA 5DEHA 1MIUA 4YCWA 4HIOA 1JWSD 5DLQE 2MUYA 2CKZB 2F3WA 5C3XA 3EN2A 1YHQA 1WYDA 2K75A 2NUCA 2AUJD 2AWNA 4YHHQ 1X54A 3TS2A 4X65L 5CV9A 1I3QH 3VA5A 3PIPA 2K33A 2DY8A 2Q2HA 4J8QA 3K58A 4B3SL 4NXML 3HOWH 1I4QA 3J81j 2ZJPA 5IT9L 2BA0A 4NDXA 1TWCH 2B29A 4Y7NB 4HJ9A 3S14B 4DV1L 4QIWE 1B50A 4OEMB 4WRDA 5EJWA 2H4OA 1TY2A 1FNWA 2Z4HA 1TS5A 4P75A 5JJKA 3K0XA 3NXWA 2NN6I 4GOPC 1TWFB 4L8JA 1LM0A 4JW0A 3OWFA 4PZ8A 4R8IA 5CMDA 1EYAA 2PYKA 3WWVA 1Q12A 3J7AV 2K5DA 4EVOA 4FXGC 1K8GA 1GUWA 3I91A 2C5CA 1EIGA 1T5EA 1HXYD 2UUAL 4NMZA 4C2MB 3PO2H 2D9UA 2OQKA 5IP7G 2QGQA 3VYSA 2UXDQ 4QB4A 4PG3A 2AQ2B 5ISRA 1A3VA 2F4VL 3I4LA 1DOMA 1CKMA 1PZID 5IYBG 4RH6A 5D14A 3KBXA 1MKHA 4KHZA 5F2DA 4N8FA 3P7JA 2Z0SA 3TMEA 2B2WA 3DEOA 2EXDA 5I2XA 1EY9A 1F9QA 1AZPA 3MWYW 1T5XD 5CV8A 3K6OA 4A3KB 4KKUA 4U68A 2R7ZH 1KDAA 3EJIA 1D5ZC 4LNQA 3VA7A 4YIJA 2XIWA 3V05A 3TRZA 1SNMA 1HZ9A 1PZKD 2VUMH 3C2PA 4LF5L 3L3OC 1UE5A 2A68C 3NUCA 3Q6SA 3CCUA 4K8IA 5J1ZA 4V190 4JI8L 4DU9A 1NY4A 1IKMA 4GN4B 1HZAA 5K36H 2B8GA 4DR2Q 3P20A 4ZUIA 3AB9A 2FMMA 5CYUA 2AWOA 2VS1A 4K5WA 4Q0FA 3HOZG 2HQEA 1OXSC 3I4NH 1RF2D 4A3EH 4A3IH 1H9JA 1PRTD 2ES2A 5EPJA 5CV6A 3H3VI 3KBGA 2SEBD 4FNFA 4LF6L 1R9TB 5C0XI 3TS0A 1LTTD 3NK9A 5ELDA 5BN4A 2LY7A 4IUVA 3IAYA 2DJFC 2KCMA 4DV0L 2B2YC 5LL6X 2VNUD 4RAUC 2EY2A 3W1BA 3NWTA 2KHSA 1VF7A 2I5MX 3ITPA 3GTKH 5FLXL 4HTHA 3U58A 2B2VA 2DUDA 3HOUG 3AMUA 1N33L 2EYMA 4OELB 1EY0A 1CM9A 1WD1A 5M3FH 3UDGA 3K5OA 3K81C 1TWGB 1XTDA 4B3MQ 2RDFA 2E74C 4S3SA 1EQTA 3PQIA 5EAYA 2ZTEA 1SE4A 3H0GB 1IXRA 2AMCB 4KD3A 1BCPC 5I6YA 1MD2D 4RGNA 3GTPB 1GXDC 2I5HA 2K5VA 2BOSA 1HNXQ 3S2HH 4KMUC 4IFDI 1PH6A 3BS1A 5COYA 2NN6H 3STBC 3K5NA 3LNNA 2MNAA 4IUPA 3FP9A 1YJWA 1CKNB 4TRDA 1QUQB 1HCZA 3X3MA 1HQRD 3A8KE 1ICWA 3P1HA 1B53A 3CKIB 5C0XJ 3CCSA 4HMIA 3RLFA 2MP1A 2QF7A 3FKIH 4OGQC 2UXCL 1CT1D 3PF4A 2K4KA 1WCMB 1V1QA 2LSSA 4ID6A 1Q3LA 5E1FA 3P75A 3SXHA 4G57A 4N9TA 3GTGH 2HDMA 1JJCB 3TP8A 3T1YQ 5JJLA 1HFGA 4LF7Q 2A6HC 1CKNA 1TT2A 1QUQA 1UAPA 2KUMA 2FFKB 2K03A 1AEXA 2KQ3A 5J22A 3UDFA 5LHY1 1Q86C 4B3TL 1G91A 2XRSD 3TEHB 3RUZA 4A3LH 1FL0A 3KDFB 4YY3L 2KCNA 2YU9H 2EXZA 3I4MG 3M7GA 2ZTDA 1Q7YC 5ELNA 3KK7A 2WKCA 4IFDJ 3F2DA 1WTXA 4A3GH 4JV5L 3N6RA 3RMHA 1MI2A 3UI2A 4X64Q 2L11A 4LF9Q 4QUFA 5JEAG 2JA7B 1EL0A 5I9OA 3KJOA 1KTKA 2HT1A 4IPGA 2M00A 1U4RA 5M5WB 5C44B 1WTHA 3X3NA 5JJIA 4AIMA 2E8GA 2PNHA 1FD7D 4NXNL 1F2YA 1EY4A 4DV2L 1FYCA 4NB3A 4DUZQ 2VQFL 1ESRA 2MO0A 3PUXA 1EOVA 4JI3Q 3H3VH 1N9WA 2CW0C 4IO9A 4PZ6A 1O7IA 2GVBA 4OO1H 1S5BD 2EQSA 4H13C 4CHTB 3KDFA 4ABNA 3GP7A 3UE0A 2FHTA 3FPUB 2OWOA 4KKTA 2YTYA 1XTCD 3K0YA 5M3MG 5ELBA 4KI0A 1C0AA 1CUKA 1HZCA 4IUNA 5IT9E 3BVGA 2GN5A 4CDCC 3DWPA 3J7AF 4PMBA 3GTOH 4A93H 3F2UA 2JA8G 1ESFA 1PFMA 3HOXB 3U4ZA 3MAQA 3B6YA 2E2IH 2PI2A 2R93B 2MHVA 4R1JA 2I46A 4GKJL 3KLSA 5D3DA 3ND8A 2K04A 2ALYB 2JJQA 4ZLTF 1X3PA 3J7ZC 1CHQD 5ELOA 1M8AA 2UU9L 5IGEA 1VQPA 4YWKA 3GV3A 4A3CG 2EJGC 2R7FA 2L55A 3HOWG 3RNUA 5IOCA 3I73A 1VQEA 4G7ZC 2J7ZA 5GAGC 2KBNA 2Q8RE 1B9MA 4ZK9B 3MXGA 3I8ZA 4A3FB 4POGA 1HHVA 2G9DA 4B9XA 1HR0Q 1B70B 4WJWA 1IBLL 4ILWA 2EYHA 3KF6A 4IPCA 1HPCA 3RZDB 1ONLA 3PF5A 3ND9A 4CKEA 1SE8A 1ENAA 2R61A 1CQVA 2F0LA 3S17H 3M4QA 2MO1A 4CJ0B 3HZXA 4ME5A 2VB2X 2PZUA 4L5RC 3KJPA 3BZKA 2KHJA 3RZOB 1XNRL 2BA1A 1Q46A 3QO2A 1KC8C 1Y69U 1Y1VH 2DY7A 1K0SA 3PO2G 1F9SA 2NVXB 3BYTB 1HH2P 2B2TC 3FMCA 2BDOA 2F0UA 4LFAL 4BY7H 1U9RA 4KD4A 1VS0A 3DLLA 1WVLA 1H9RA 2ZJRA 1Q8IA 1E1TA 2N49A 3EIVA 4DR5Q 1GVPA 4NP5A 4MTKA 1PYSB 2JSOA 4JI6Q 1FJGL 4UPAA 3WOFA 5KEEA 4O1NA 1PH5A 1EQVA 2JK8A 3G6JB 4P71A 1W6KA 4R4OA 4X3TA 4DR7Q 5EPKA 2R7ZG 1QNKA 4LUOA 4TKOB 5ELFA 3S1QB 4QJFA 4QMGA 4X62Q 2X6GA 4GNXC 2VUMG 4XTCS 1GO3E 2F0TA 4KY5A 3OTOQ 3C1EA 3Q8DA 2RCFA 3M85A 3S1RH 2J0TD 1I50B 4JC0A 4KV6A 2PPBC 4FF2A 2EY6A 2XTIA 1PLFA 5K36G 2BE5D 2SNMA 3PV0A 4DV6Q 1SEBD 5E7NA 1XYIA 3HP3A 2NVXH 3MFYA 3ULPA 2EJFC 1EQRA 1G8ZD 1DXMA 4OIJA 3I4NG 2OT2A 2F0NA 3G4SA 2LFNA 2M2LA 2D0OA 5IIFA 4DV5L 4A3IG 1HNWL 4A3DH 2D0PA 2WV6D 2JN4A 4ZRZA 3H91A 4AYBB 2IPKD 1F77A 2DJGC 2A69C 2UUCL 1QVCA 4DAMA 1HZBA 5CBEE 2Z6KC 1MSGA 3GTLB 4DR3Q 4X6AH 2KOLA 1QZGA 1ASYA 3M4OH 4IOCA 3HOYH 3S1QH 2WINB 1ENCA 3SK5A 1EUJA 3GTQH 1AW7A 3ZJYC 1RIPA 4KN4C 3SR1A 2Q2TA 5M3FG 1K9MC 3H3VC 2MQHA 3I70A 1GHKA 3NENA 4R9WA 4CDDC 3A0JA 3M4PA 2ZT9C 5HGQA 2DN8A 2HIXA 3PIO3 2TSSA 4O2DA 1JICA 2A6EC 5IWAQ 4BA1I 4DAYB 2O5IC 3K7UC 2RHQB 2UXBQ 1G6PA 4HJ7A 3HOVB 1HA5A 1PH3A 4GLVB 3CCRA 2IJ0A 5DAUA 1VQKA 2NN6G 4CJ1B 2CFMA 4L5QA 4CDEC 2UUBL 3FVQA 1X3QA 1NAPA 3DM3A 4XDXA 3NPPA 1HTPA 4DR1Q 4EQ5A 2F0DA 1GUSA 1UWVA 3Q22A 1CI3M 1WTWA 1HRJA 1YI2A 2V1CC 1Q8KA 3CHBD 3DXJC 1YEZA 3FKIG 5IGDA 4DV7L 3KLRA 3A7AB 2KEDA 4IZ8A 4UP7A 5IT9c 1W6JA 1DD2A 4A3JB 4GKKL 1GUTA 3EVQA 1B8AA 1UUPA 1JOOA 2A73B 1QOHA 2A1AA 1VQIA 2E2JB 1EWIA 3W5OA 1CKOA 2B2UC 4LFCL 4IUQA 3A8IE 1ET9A 1K83B 4ODGA 1RTNA 3EBEA 2Y0SB 4IALA 1SN8A 3EROA 3RLNA 3HOVH 1CSQA 1FGUA 1JJGA 3DEPA 1BCPB 3HKZG 2ZXOA 4J6HA 2F0SA 3ULLA 2B2YA 4EGVA 1TVXA 3CCEA 4IPDA 4JG2A 1D2BA 1VQMA 5C4HA 4A3GG 4JBJA 4P2CB 1D1KA 4QL5A 2RSOA 1LV9A 1AZQA 4ALPA 4N9PA 5IGCA 4KHPL 3M3YB 1RODA 4HJAA 1VQAA 2K05A 1QZHA 2FJ2A 2NTTA 1MSHA 4LAAA 4LK1C 3MTSA 4C3HB 4WJ3M 1ZKOA 3SK8A 5CV5A 2KENA 1WTRA 4UP8A 4KJOA 2F0GA 3SHLA 4RGTA 2Z6BA 4G4KA 1M4VA 4JI4L 2XWBB 3AFPA 4UHVA 4OO1G 5JPMC 3CF5A 2KECA 1KXLA 1EFWA 3H6MA 4IURA 2R3ZA 1RKNA 3NQIA 4GS3A 1JJ2A 3M7NA 3NTKA 3KFUA 1KLGD 4ZCKA 3H94A 4EQOA 4X65Q 3MXNB 5AFWA 1SSOA 4K5XA 2R6GA 4LMQD 2F0QA 1EIYB 1A3UA 4C3IB 4A93G 4IOAA 5A2QL 2XRQD 5KRUA 2Z9HA 4LF8L 3PUWA 5M9OA 4A3CH 1GJXA 3PUYA 1KAWA 5IODA 5IE8A 1PVOA 2JA7G 3CQZH 2NZHA 5C4JB 1E2VA 1W3SA 2XGTA 2PMZB 1I6HB 2IX0A 1GUNA 4MTNA 1SMYC 3HG9A 1U5KA 3CXCA 1IYJB 1BOSA 5C3EH 1N32Q 3HS0C 1IKLA 3MXNA 1TWHB 2RKSA 1J9OA 1WJJA 4YHHL 2UUAQ 4A3BB 1PTOB 1UEAB 2WIIB 3K80C 3L9AX 4XIGS 5FLXc 4K0KQ 2JEBI 2E75C 4QIWB 1X3EA 1AE2A 3BDOA 1ZEQX 2Q2IA 2F4VQ 4OX9Q 3FRPB 4C1NI 3C3LA 1L2FA 4JI0Q 2EVBA 3NSWA 4C3IH 1JCKB 1QCBD 3IFDA 3PSIA 1KLUD 3S9WA 1AH9A 1STAA 4LWCA 1SROA
chains in the Genus database with same CATH topology
5IYBH 4AQYL 3GTGH 1YNXA 1JJCB 3T1YQ 5JJLA 4Y7NH 2OTLA 4LF7Q 2K14A 1E22A 4POFA 3H0GG 2NVTH 1Y1VG 3JC66 1CKNA 3LGJA 1VQ4A 3S14H 1PH7A 1GM5A 3I56A 1QUQA 2K5NA 3CP0A 1X3GA 1OXUA 4DR1L 5AJ3Q 4JI7L 4LF5Q 1QVFA 3UDFA 4C3JH 1Q86C 5LMNL 1BBUA 4HJ8A 4B3TL 4BY7G 3ER0A 1P16A 2NVYH 1Z47A 3NELA 3UDIA 1E1OA 3TEHB 2PQAB 3ULJA 5IP9G 4A3LH 1FL0A 1TWFH 4GLXA 4JYAL 3KDFB 4YY3L 1AE3A 2YU9H 3I4MG 3H15A 2ZTDA 1Q7YC 5ELNA 2JEAI 2VQEQ 4KHPQ 2RF4A 3HFZB 4IFDJ 3F2DA 3CCJA 4A3BH 4A3GH 4JV5L 3UE1A 1RL2A 3F1ZA 3STBD 1P8LA 4X64Q 4YCUA 4JI1L 4DUYQ 4LF9Q 5JEAG 4IJLA 3MEFA 3KJOA 4B3RQ 2HT1A 1JMCA 4IPGA 3A5ZB 4DV5Q 4C2MH 5JJIA 4AIMA 4DK3C 1WCMG 2E8GA 2PNHA 4NXNL 4DV2L 3HOZH 4DV4Q 5GQOA 2QA4A 4NB3A 4L5TA 3CPFA 4LF6Q 3GTJH 4YCVA 4DUZQ 4TQUS 2VQFL 2MO0A 4A3JH 3PUXA 1EOVA 1GD7A 4JI3Q 4DPGA 3H3VH 1N9WA 3J80i 3KLWA 5FLMH 4IO9A 4PZ6A 1O7IA 2GVBA 4P73A 4AYBE 2PQAA 2EQSA 5C0XG 2E2JH 4DKAC 1HNZL 2CWPA 1EYGA 1IZ6A 3KDFA 3UE0A 4RG1A 2OWOA 3S1QH 2YTYA 1K83H 1C9OA 3F2BA 1XPOA 1VQ6A 5M3MG 4A75A 3D31A 4LW1A 4A3KH 1M1KC 2E5LQ 2WFWA 4JOIA 1J6QA 2WB1G 4KI0A 1N8RC 1OXVA 1J5EQ 1N33Q 1C0AA 1CUKA 1HZCA 5IYDH 5C4XG 1Q1BA 3JAMi 4A3EG 4DR2L 4PMWA 1PFSA 1YBYA 1Y1WG 2GN5A 4A3DG 1B7YB 4B3SQ 2GVAA 4LF4L 4NXMQ 3J81c 4HIDA 3HOUH 2B3GA 4OWXB 3GTOH 3UDXA 4A93H 1D7QA 1QVGA 4DR4Q 2JA8G 5IYCH 3U50C 3J7A5 2YTXA 3G71A 1UE1A 3U4ZA 4EX5A 4DV1Q 3B6YA 2E2IH 2JA5G 2PI2A 1XMQL 3CAMA 4BY1G 4R1JA 5H1SE 3M3YH 4GKJL 5C44G 3HOYG 4JBWA 1UE7A 2PMZE 4HIKA 2ALYB 2ASBA 2JJQA 4DR6Q 2HQLA 3J7ZC 3U4VA 4C3HH 5ELOA 1EQQA 1KRTA 2UUBQ 4A4IA 5BR8L 4DR3L 3T1HL 2UU9L 4IFDG 3RR5A 1VQPA 4GNXB 3E9HA 2BH8A 4YWKA 1YJNA 3HKZE 1A63A 4A3CG 4R4CA 1X65A 2R7FA 1XJVA 3HOWG 1VQ9A 5J3BA 3RNUA 1N36L 1VQEA 1X55A 1NJIC 1VQHA 4JOIC 5GAGC 1R9TH 2KBNA 3S24A 1LTLA 2UXCQ 4DV7Q 1D8LA 3D0FA 4POGA 5GROA 3OW2A 3AQQA 4HIMA 1VQJA 3BZCA 3TQYA 4B3ML 2R92H 5M5XH 1HR0Q 1B70B 2AKWB 1IBLL 3AFQA 1KRSA 3KF6A 4IPCA 1KIXA 1SR3A 3PF5A 1YIJA 3K8AA 4KLKA 5IWAL 1SE8A 1WOCA 3S17H 1VQ5A 3A74A 1JE5A 3M4QA 1KD1C 2B63H 1LUZA 2MO1A 4BA2I 1L1OB 1I94L 4R4IA 4L5RC 3KJPA 3HOXG 4HJ5A 3BZKA 2KHJA 2OQ0A 1S72A 1HNXL 1XNRL 1N32L 1TWGH 3CW2C 4GNXA 1E7ZA 2R93G 2BA1A 2E2HH 4Y52H 1OXXK 1MJCA 1X9NA 1Q46A 4R4TA 4B3TQ 5C4JH 1DGSA 2R7DA 4JCVE 1FVIA 4BBRG 2ID0A 3F8TA 1KC8C 3H0GH 1XNQQ 1VQFA 1Y1VH 3L2PA 4MNOA 3PO2G 5M5YH 1I6HH 4OWTB 4K0KL 2Y0SE 1VQ8A 1N34L 4YY3Q 1IBML 4OXPA 3GTPH 1HH2P 2K5HA 1VQGA 1PH9A 1PH8A 1HR0W 3RLOA 1L0WA 4LFAL 4BY7H 4OX9L 4JV5Q 1NE3A 1VS0A 1Q1EA 1X56A 2CWAA 1C7YA 3PO3G 3PUZA 3DLLA 4JI0L 1OXTA 4JI8Q 5IP9H 2VZAA 1TWHH 5FJ8G 1UEBA 4P72A 2UXDL 4L5SA 2WP8J 3AYHB 2ZJRA 1NTGA 1E1TA 3I4MH 2N49A 2KHIA 3EIVA 4LUVA 4A3FG 2IHEA 1GVPA 2N8NA 3CPWA 4JI5L 4DR5Q 1PYSB 4JI6Q 3I55A 1FJGL 1L1OA 4A3MG 4UPAA 1XPUA 2LXKA 1PH5A 1YJ9A 4GN5A 4DV2Q 4BXXG 2JK8A 3J80c 4P71A 4R4OA 5GADC 3HOVG 3T1YL 1KL9A 4DR7Q 3RN5A 1JB7A 2YYZA 2R7ZG 1I5FA 4LUOA 2VQFQ 1VQ7A 1SMXA 4QJFA 2Z6KA 4JI4Q 1S40A 4A3LG 1V43A 1WCMH 1U0LA 4X62Q 4GNXC 3RN2A 2VUMG 3ERSX 2RCNA 1GO3E 4XTCS 5AJ3L 4QY7A 3OTOQ 2ZM6Q 3Q8DA 1HNZQ 3S1RH 3M85A 1T9HA 2A8VA 3JAMc 4JC0A 2KCTA 4X66L 4DV0Q 1NMGA 2XTIA 1XMOQ 1PH1A 2CCZA 5K36G 4PZ7A 4BBSG 3KF8B 2EIFA 2VQEL 3PV0A 4DV6Q 3E9IA 5E7NA 1NMFA 4LF4Q 1K3RA 1E24A 5M3MH 1X6OA 2NVXH 1VQDA 4X64L 3ULPA 3AEVA 1KHIA 1EQRA 4DUYL 2I5LX 4ME3A 3I4NG 4B3RL 5C4XH 2ATWA 4LF8Q 2VL6A 3VDYA 3G4SA 4A3JG 4DV5L 4A3IG 2D0OA 1V9PA 3S1NH 1HNWL 4A3DH 2D0PA 1L1OC 2HHHL 1H95A 2F52A 1Q82C 2WAQE 2NVQH 4OONA 3PUVA 4DV4L 2ZTCA 4OO1I 1NBWA 3I2ZA 3I4OA 4DUZL 2UUCL 2JA8H 2C35B 1QVCA 4DAMA 1MIUA 1HZBA 4P74A 4YCWA 3BU2A 4IPHA 2Q2UA 2Z6KC 3KF6B 3CCVA 2L15A 2JA5H 4HIOA 5DLQE 2JA7H 4DR3Q 3T1HQ 4X6AH 2CKZB 4BY1H 1QZGA 1ASYA 3M4OH 1ASZA 5HY6A 5M5WH 5GAEC 1TWAH 3EN2A 1WYDA 2K75A 5C44H 4IOCA 3TREA 3G6EA 4O0AA 1YHQA 3HOYH 2AWNA 1N36Q 2E5LL 1IBKQ 1EUJA 4YHHQ 1X54A 1J5EL 3GTQH 3ZJYC 3TS2A 1RIPA 4X65L 5M3FG 1I3QH 1K9MC 3PIPA 2Q2TA 4RMFA 4JI2L 4UY8C 2MQHA 2Q2HA 4B3SL 4NXML 3HOWH 2JE6I 4UP9A 3NENA 3J81j 3A0JA 3HKSA 3M4PA 2ZJPA 5HGQA 2A19A 2BA0A 2HIXA 1TWCH 2B29A 1TXYA 1Z9FA 4O2DA 4HJ9A 1PA6A 5IWAQ 3ICEA 4BA1I 4LFBQ 1G51A 3GDEA 4NPSA 4DAYB 1Q81C 4DV1L 3K7UC 2DGYA 2RHQB 4QIWE 2UXBQ 1G6PA 4HJ7A 4DV3Q 2YTVA 1I94Q 5LMUQ 1PH3A 1A0IA 3SGIA 1YZ6A 4GLVB 3CCRA 3S15H 4QGUA 2JA6G 1VCIA 5C3EG 4P75A 1XNRQ 3L0OA 1VQKA 5JJKA 2NN6G 4AQYQ 3K0XA 2CFMA 4L5QA 4DR6L 2NN6I 4GOPC 4AYBG 1LM0A 4PZ8A 2IHFA 2UUBL 3GD7A 4A76A 3KOJA 3DM3A 3HOXH 3E0EA 3WWVA 1Q12A 1G291 1K8AC 4DR1Q 1VQBA 4JI7Q 4EQ5A 1K8GA 1IBMQ 2R93H 1UWVA 5LMNQ 1YI2A 4LFAQ 2V1CC 1Q8KA 3M9BA 4BBRH 2UUAL 2HIVA 1YEZA 3FKIG 1BBWA 5GAHC 3PO2H 2OQKA 4DV7L 1Y14B 5IP7G 2NZOA 2QGQA 4JYAQ 2UXDQ 1PYBA 2WB1E 4PG3A 4UP7A 5IT9c 3CC7A 1HR0L 5IY0A 2F4VL 3F2CA 2IT1A 1CKMA 3PO3H 4J15A 4GKKL 5IYBG 3L7ZC 4JI1Q 1B8AA 4YWMA 5FJ8H 4KHZA 1MKHA 1VQIA 2A1AA 3K7AH 1PHJA 1EWIA 2Z0SA 3G48A 4APVA 4A3FH 2EXDA 3W5OA 1CKOA 4LFCL 1K0RA 2YV5A 4A3MH 3A5UA 2VW9A 1S3OA 1VQCA 3IRBA 4NXNQ 4BXXH 4OWWB 3EBEA 1SN8A 3RLNA 3HOVH 1CSQA 1FGUA 2JA9A 4LF7L 4MZ9A 5LMNW 2R7ZH 1JJGA 3RZDH 3HKZG 1XNQL 4LNQA 2OTJA 2IX1A 3ULLA 4X66Q 3TRZA 1HZ9A 3FHWA 1SFOH 2VUMH 4LF5L 3CCEA 3CD6A 4IPDA 4GLAC 4JG2A 1VQMA 2RHSB 1UE6A 4GOPB 1MJEA 1A62A 4A3BG 4A3GG 2PI2E 4JBJA 3RZOH 1UE5A 1XPRA 3CCUA 4QL5A 2BH2A 4JI8L 1NY4A 4ALPA 4GN4B 1W2BA 3CCLA 1HZAA 1CSPA 3CC4A 4KHPL 4BBSH 4DK6C 4DR2Q 4DR5L 1HNWQ 3CC2A 4HJAA 4TVAB 4JI6L 4QQBX 4LUZA 1VQAA 2CQOA 2AWOA 4IJHA 1QZHA 2VS1A 2HHHQ 1E3PA 3I7FA 1K73C 3HOZG 4LF9L 4WJ3M 1OXSC 1VQNA 2FXQA 1PH2A 2F3IA 1VQOA 2KENA 4DR7L 4UP8A 3I4NH 3S16H 2UUCQ 4A3EH 1Y1WH 1EIFA 2ZJQA 4A3IH 4DNIA 2ES2A 1LYLA 1KQSA 3CMAA 5FLMG 4JI4L 3H3VI 2VY3A 3AFPA 4X62L 1SLJA 1XMQQ 4OO1G 2AHOB 3CF5A 3OTOL 1YHAA 4LF6L 1EFWA 4GKJQ 1KXLA 2D62A 2ZM6L 5C0XI 3GO5A 3TS0A 4JI3L 3NBHB 4GOPA 4A3KG 2Y0SG 2KCMA 4DV0L 4GS3A 1JJ2A 1VQLA 3M7NA 2OCEA 1A8VA 5BR8Q 1XMOL 3W1GA 5IYDG 3BJUA 2UU9Q 3KFUA 2VNUD 3NEMA 4X65Q 3W1BA 4JI2Q 3MXNB 2I5MX 4DV6L 3GTMH 3GTKH 2LXJA 2R6GA 1EIYB 3U58A 4AH6A 2DUDA 3HOUG 1YHBA 4A93G 4IOAA 1N33L 2IY5B 4YWLA 1SRUA 5IYCG 1YITA 4LF8L 5M3FH 3PGZA 3PUWA 1I50H 3UDGA 3S1MH 4A3CH 3K81C 1X3FA 3PUYA 1KAWA 4FDBA 1XTDA 4B3MQ 4H02A 2N78A 1PH4A 5IE8A 1PVOA 2JA7G 1IBLQ 3CQZH 2NZHA 3CCMA 5EAYA 4DR4L 1W3SA 2XGTA 2ZTEA 4JBMA 1IXRA 2AMCB 4WJ4A 2JQOA 3J81i 2QEXA 1BKBA 2IX0A 3PIOA 4MTNA 4R4QA 1M90C 1U5KA 1PV4A 3CXCA 5JEAJ 2I5HA 4GN3B 2K5VA 4JBKA 1IYJB 1HNXQ 3CCQA 3S2HH 2JA6H 5C3EH 1PH6A 4IFDI 1N32Q 1WFQA 3STBC 3PCOB 2MNAA 3CMEA 3FP9A 1WJJA 1CKNB 3OYYA 4YHHL 1YJWA 1IBKL 1QUQB 2H5XA 2UUAQ 1OTCA 1IL2A 5FLXc 3K80C 2N3SA 4XIGS 4K0KQ 2JEBI 1N34Q 3S2DH 3GTLH 2R92G 1WI5A 5C0XJ 1X3EA 1AE2A 3CCSA 1BVSA 2Q2IA 2F4VQ 4OX9Q 3RLFA 1L2FA 1GKHA 3FKIH 4JI0Q 2K52A 4GKKQ 2UXCL 4LFBL 1JT8A 5IP7H 3PF4A 2K4KA 2K50A 2UXBL 2WAQG 4C3IH 2B63G 2I0QA 2MFIA 1YVCA 1V1QA 4DV3L 3PSIA 5LMUL 2LSSA 4JI5Q 1HJPA 4LFCQ 1FJGQ 3KYHC 1AH9A 4LWCA 1SROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYB H;  4AQY L;  3GTG H;  1YNX A;  1JJC B;  3T1Y Q;  5JJL A;  4Y7N H;  2OTL A;  4LF7 Q;  2K14 A;  1E22 A;  4POF A;  3H0G G;  2NVT H;  1Y1V G;  3JC6 6;  1CKN A;  3LGJ A;  1VQ4 A;  3S14 H;  1PH7 A;  1GM5 A;  3I56 A;  1QUQ A;  2K5N A;  3CP0 A;  1X3G A;  1OXU A;  4DR1 L;  5AJ3 Q;  4JI7 L;  4LF5 Q;  1QVF A;  3UDF A;  4C3J H;  1Q86 C;  5LMN L;  1BBU A;  4HJ8 A;  4B3T L;  4BY7 G;  3ER0 A;  1P16 A;  2NVY H;  1Z47 A;  3NEL A;  3UDI A;  1E1O A;  3TEH B;  2PQA B;  3ULJ A;  5IP9 G;  4A3L H;  1FL0 A;  1TWF H;  4GLX A;  4JYA L;  3KDF B;  4YY3 L;  1AE3 A;  2YU9 H;  3I4M G;  3H15 A;  2ZTD A;  1Q7Y C;  5ELN A;  2JEA I;  2VQE Q;  4KHP Q;  2RF4 A;  3HFZ B;  4IFD J;  3F2D A;  3CCJ A;  4A3B H;  4A3G H;  4JV5 L;  3UE1 A;  1RL2 A;  3F1Z A;  3STB D;  1P8L A;  4X64 Q;  4YCU A;  4JI1 L;  4DUY Q;  4LF9 Q;  5JEA G;  4IJL A;  3MEF A;  3KJO A;  4B3R Q;  2HT1 A;  1JMC A;  4IPG A;  3A5Z B;  4DV5 Q;  4C2M H;  5JJI A;  4AIM A;  4DK3 C;  1WCM G;  2E8G A;  2PNH A;  4NXN L;  4DV2 L;  3HOZ H;  4DV4 Q;  5GQO A;  2QA4 A;  4NB3 A;  4L5T A;  3CPF A;  4LF6 Q;  3GTJ H;  4YCV A;  4DUZ Q;  4TQU S;  2VQF L;  2MO0 A;  4A3J H;  3PUX A;  1EOV A;  1GD7 A;  4JI3 Q;  4DPG A;  3H3V H;  1N9W A;  3J80 i;  3KLW A;  5FLM H;  4IO9 A;  4PZ6 A;  1O7I A;  2GVB A;  4P73 A;  4AYB E;  2PQA A;  2EQS A;  5C0X G;  2E2J H;  4DKA C;  1HNZ L;  2CWP A;  1EYG A;  1IZ6 A;  3KDF A;  3UE0 A;  4RG1 A;  2OWO A;  3S1Q H;  2YTY A;  1K83 H;  1C9O A;  3F2B A;  1XPO A;  1VQ6 A;  5M3M G;  4A75 A;  3D31 A;  4LW1 A;  4A3K H;  1M1K C;  2E5L Q;  2WFW A;  4JOI A;  1J6Q A;  2WB1 G;  4KI0 A;  1N8R C;  1OXV A;  1J5E Q;  1N33 Q;  1C0A A;  1CUK A;  1HZC A;  5IYD H;  5C4X G;  1Q1B A;  3JAM i;  4A3E G;  4DR2 L;  4PMW A;  1PFS A;  1YBY A;  1Y1W G;  2GN5 A;  4A3D G;  1B7Y B;  4B3S Q;  2GVA A;  4LF4 L;  4NXM Q;  3J81 c;  4HID A;  3HOU H;  2B3G A;  4OWX B;  3GTO H;  3UDX A;  4A93 H;  1D7Q A;  1QVG A;  4DR4 Q;  2JA8 G;  5IYC H;  3U50 C;  3J7A 5;  2YTX A;  3G71 A;  1UE1 A;  3U4Z A;  4EX5 A;  4DV1 Q;  3B6Y A;  2E2I H;  2JA5 G;  2PI2 A;  1XMQ L;  3CAM A;  4BY1 G;  4R1J A;  5H1S E;  3M3Y H;  4GKJ L;  5C44 G;  3HOY G;  4JBW A;  1UE7 A;  2PMZ E;  4HIK A;  2ALY B;  2ASB A;  2JJQ A;  4DR6 Q;  2HQL A;  3J7Z C;  3U4V A;  4C3H H;  5ELO A;  1EQQ A;  1KRT A;  2UUB Q;  4A4I A;  5BR8 L;  4DR3 L;  3T1H L;  2UU9 L;  4IFD G;  3RR5 A;  1VQP A;  4GNX B;  3E9H A;  2BH8 A;  4YWK A;  1YJN A;  3HKZ E;  1A63 A;  4A3C G;  4R4C A;  1X65 A;  2R7F A;  1XJV A;  3HOW G;  1VQ9 A;  5J3B A;  3RNU A;  1N36 L;  1VQE A;  1X55 A;  1NJI C;  1VQH A;  4JOI C;  5GAG C;  1R9T H;  2KBN A;  3S24 A;  1LTL A;  2UXC Q;  4DV7 Q;  1D8L A;  3D0F A;  4POG A;  5GRO A;  3OW2 A;  3AQQ A;  4HIM A;  1VQJ A;  3BZC A;  3TQY A;  4B3M L;  2R92 H;  5M5X H;  1HR0 Q;  1B70 B;  2AKW B;  1IBL L;  3AFQ A;  1KRS A;  3KF6 A;  4IPC A;  1KIX A;  1SR3 A;  3PF5 A;  1YIJ A;  3K8A A;  4KLK A;  5IWA L;  1SE8 A;  1WOC A;  3S17 H;  1VQ5 A;  3A74 A;  1JE5 A;  3M4Q A;  1KD1 C;  2B63 H;  1LUZ A;  2MO1 A;  4BA2 I;  1L1O B;  1I94 L;  4R4I A;  4L5R C;  3KJP A;  3HOX G;  4HJ5 A;  3BZK A;  2KHJ A;  2OQ0 A;  1S72 A;  1HNX L;  1XNR L;  1N32 L;  1TWG H;  3CW2 C;  4GNX A;  1E7Z A;  2R93 G;  2BA1 A;  2E2H H;  4Y52 H;  1OXX K;  1MJC A;  1X9N A;  1Q46 A;  4R4T A;  4B3T Q;  5C4J H;  1DGS A;  2R7D A;  4JCV E;  1FVI A;  4BBR G;  2ID0 A;  3F8T A;  1KC8 C;  3H0G H;  1XNQ Q;  1VQF A;  1Y1V H;  3L2P A;  4MNO A;  3PO2 G;  5M5Y H;  1I6H H;  4OWT B;  4K0K L;  2Y0S E;  1VQ8 A;  1N34 L;  4YY3 Q;  1IBM L;  4OXP A;  3GTP H;  1HH2 P;  2K5H A;  1VQG A;  1PH9 A;  1PH8 A;  1HR0 W;  3RLO A;  1L0W A;  4LFA L;  4BY7 H;  4OX9 L;  4JV5 Q;  1NE3 A;  1VS0 A;  1Q1E A;  1X56 A;  2CWA A;  1C7Y A;  3PO3 G;  3PUZ A;  3DLL A;  4JI0 L;  1OXT A;  4JI8 Q;  5IP9 H;  2VZA A;  1TWH H;  5FJ8 G;  1UEB A;  4P72 A;  2UXD L;  4L5S A;  2WP8 J;  3AYH B;  2ZJR A;  1NTG A;  1E1T A;  3I4M H;  2N49 A;  2KHI A;  3EIV A;  4LUV A;  4A3F G;  2IHE A;  1GVP A;  2N8N A;  3CPW A;  4JI5 L;  4DR5 Q;  1PYS B;  4JI6 Q;  3I55 A;  1FJG L;  1L1O A;  4A3M G;  4UPA A;  1XPU A;  2LXK A;  1PH5 A;  1YJ9 A;  4GN5 A;  4DV2 Q;  4BXX G;  2JK8 A;  3J80 c;  4P71 A;  4R4O A;  5GAD C;  3HOV G;  3T1Y L;  1KL9 A;  4DR7 Q;  3RN5 A;  1JB7 A;  2YYZ A;  2R7Z G;  1I5F A;  4LUO A;  2VQF Q;  1VQ7 A;  1SMX A;  4QJF A;  2Z6K A;  4JI4 Q;  1S40 A;  4A3L G;  1V43 A;  1WCM H;  1U0L A;  4X62 Q;  4GNX C;  3RN2 A;  2VUM G;  3ERS X;  2RCN A;  1GO3 E;  4XTC S;  5AJ3 L;  4QY7 A;  3OTO Q;  2ZM6 Q;  3Q8D A;  1HNZ Q;  3S1R H;  3M85 A;  1T9H A;  2A8V A;  3JAM c;  4JC0 A;  2KCT A;  4X66 L;  4DV0 Q;  1NMG A;  2XTI A;  1XMO Q;  1PH1 A;  2CCZ A;  5K36 G;  4PZ7 A;  4BBS G;  3KF8 B;  2EIF A;  2VQE L;  3PV0 A;  4DV6 Q;  3E9I A;  5E7N A;  1NMF A;  4LF4 Q;  1K3R A;  1E24 A;  5M3M H;  1X6O A;  2NVX H;  1VQD A;  4X64 L;  3ULP A;  3AEV A;  1KHI A;  1EQR A;  4DUY L;  2I5L X;  4ME3 A;  3I4N G;  4B3R L;  5C4X H;  2ATW A;  4LF8 Q;  2VL6 A;  3VDY A;  3G4S A;  4A3J G;  4DV5 L;  4A3I G;  2D0O A;  1V9P A;  3S1N H;  1HNW L;  4A3D H;  2D0P A;  1L1O C;  2HHH L;  1H95 A;  2F52 A;  1Q82 C;  2WAQ E;  2NVQ H;  4OON A;  3PUV A;  4DV4 L;  2ZTC A;  4OO1 I;  1NBW A;  3I2Z A;  3I4O A;  4DUZ L;  2UUC L;  2JA8 H;  2C35 B;  1QVC A;  4DAM A;  1MIU A;  1HZB A;  4P74 A;  4YCW A;  3BU2 A;  4IPH A;  2Q2U A;  2Z6K C;  3KF6 B;  3CCV A;  2L15 A;  2JA5 H;  4HIO A;  5DLQ E;  2JA7 H;  4DR3 Q;  3T1H Q;  4X6A H;  2CKZ B;  4BY1 H;  1QZG A;  1ASY A;  3M4O H;  1ASZ A;  5HY6 A;  5M5W H;  5GAE C;  1TWA H;  3EN2 A;  1WYD A;  2K75 A;  5C44 H;  4IOC A;  3TRE A;  3G6E A;  4O0A A;  1YHQ A;  3HOY H;  2AWN A;  1N36 Q;  2E5L L;  1IBK Q;  1EUJ A;  4YHH Q;  1X54 A;  1J5E L;  3GTQ H;  3ZJY C;  3TS2 A;  1RIP A;  4X65 L;  5M3F G;  1I3Q H;  1K9M C;  3PIP A;  2Q2T A;  4RMF A;  4JI2 L;  4UY8 C;  2MQH A;  2Q2H A;  4B3S L;  4NXM L;  3HOW H;  2JE6 I;  4UP9 A;  3NEN A;  3J81 j;  3A0J A;  3HKS A;  3M4P A;  2ZJP A;  5HGQ A;  2A19 A;  2BA0 A;  2HIX A;  1TWC H;  2B29 A;  1TXY A;  1Z9F A;  4O2D A;  4HJ9 A;  1PA6 A;  5IWA Q;  3ICE A;  4BA1 I;  4LFB Q;  1G51 A;  3GDE A;  4NPS A;  4DAY B;  1Q81 C;  4DV1 L;  3K7U C;  2DGY A;  2RHQ B;  4QIW E;  2UXB Q;  1G6P A;  4HJ7 A;  4DV3 Q;  2YTV A;  1I94 Q;  5LMU Q;  1PH3 A;  1A0I A;  3SGI A;  1YZ6 A;  4GLV B;  3CCR A;  3S15 H;  4QGU A;  2JA6 G;  1VCI A;  5C3E G;  4P75 A;  1XNR Q;  3L0O A;  1VQK A;  5JJK A;  2NN6 G;  4AQY Q;  3K0X A;  2CFM A;  4L5Q A;  4DR6 L;  2NN6 I;  4GOP C;  4AYB G;  1LM0 A;  4PZ8 A;  2IHF A;  2UUB L;  3GD7 A;  4A76 A;  3KOJ A;  3DM3 A;  3HOX H;  3E0E A;  3WWV A;  1Q12 A;  1G29 1;  1K8A C;  4DR1 Q;  1VQB A;  4JI7 Q;  4EQ5 A;  1K8G A;  1IBM Q;  2R93 H;  1UWV A;  5LMN Q;  1YI2 A;  4LFA Q;  2V1C C;  1Q8K A;  3M9B A;  4BBR H;  2UUA L;  2HIV A;  1YEZ A;  3FKI G;  1BBW A;  5GAH C;  3PO2 H;  2OQK A;  4DV7 L;  1Y14 B;  5IP7 G;  2NZO A;  2QGQ A;  4JYA Q;  2UXD Q;  1PYB A;  2WB1 E;  4PG3 A;  4UP7 A;  5IT9 c;  3CC7 A;  1HR0 L;  5IY0 A;  2F4V L;  3F2C A;  2IT1 A;  1CKM A;  3PO3 H;  4J15 A;  4GKK L;  5IYB G;  3L7Z C;  4JI1 Q;  1B8A A;  4YWM A;  5FJ8 H;  4KHZ A;  1MKH A;  1VQI A;  2A1A A;  3K7A H;  1PHJ A;  1EWI A;  2Z0S A;  3G48 A;  4APV A;  4A3F H;  2EXD A;  3W5O A;  1CKO A;  4LFC L;  1K0R A;  2YV5 A;  4A3M H;  3A5U A;  2VW9 A;  1S3O A;  1VQC A;  3IRB A;  4NXN Q;  4BXX H;  4OWW B;  3EBE A;  1SN8 A;  3RLN A;  3HOV H;  1CSQ A;  1FGU A;  2JA9 A;  4LF7 L;  4MZ9 A;  5LMN W;  2R7Z H;  1JJG A;  3RZD H;  3HKZ G;  1XNQ L;  4LNQ A;  2OTJ A;  2IX1 A;  3ULL A;  4X66 Q;  3TRZ A;  1HZ9 A;  3FHW A;  1SFO H;  2VUM H;  4LF5 L;  3CCE A;  3CD6 A;  4IPD A;  4GLA C;  4JG2 A;  1VQM A;  2RHS B;  1UE6 A;  4GOP B;  1MJE A;  1A62 A;  4A3B G;  4A3G G;  2PI2 E;  4JBJ A;  3RZO H;  1UE5 A;  1XPR A;  3CCU A;  4QL5 A;  2BH2 A;  4JI8 L;  1NY4 A;  4ALP A;  4GN4 B;  1W2B A;  3CCL A;  1HZA A;  1CSP A;  3CC4 A;  4KHP L;  4BBS H;  4DK6 C;  4DR2 Q;  4DR5 L;  1HNW Q;  3CC2 A;  4HJA A;  4TVA B;  4JI6 L;  4QQB X;  4LUZ A;  1VQA A;  2CQO A;  2AWO A;  4IJH A;  1QZH A;  2VS1 A;  2HHH Q;  1E3P A;  3I7F A;  1K73 C;  3HOZ G;  4LF9 L;  4WJ3 M;  1OXS C;  1VQN A;  2FXQ A;  1PH2 A;  2F3I A;  1VQO A;  2KEN A;  4DR7 L;  4UP8 A;  3I4N H;  3S16 H;  2UUC Q;  4A3E H;  1Y1W H;  1EIF A;  2ZJQ A;  4A3I H;  4DNI A;  2ES2 A;  1LYL A;  1KQS A;  3CMA A;  5FLM G;  4JI4 L;  3H3V I;  2VY3 A;  3AFP A;  4X62 L;  1SLJ A;  1XMQ Q;  4OO1 G;  2AHO B;  3CF5 A;  3OTO L;  1YHA A;  4LF6 L;  1EFW A;  4GKJ Q;  1KXL A;  2D62 A;  2ZM6 L;  5C0X I;  3GO5 A;  3TS0 A;  4JI3 L;  3NBH B;  4GOP A;  4A3K G;  2Y0S G;  2KCM A;  4DV0 L;  4GS3 A;  1JJ2 A;  1VQL A;  3M7N A;  2OCE A;  1A8V A;  5BR8 Q;  1XMO L;  3W1G A;  5IYD G;  3BJU A;  2UU9 Q;  3KFU A;  2VNU D;  3NEM A;  4X65 Q;  3W1B A;  4JI2 Q;  3MXN B;  2I5M X;  4DV6 L;  3GTM H;  3GTK H;  2LXJ A;  2R6G A;  1EIY B;  3U58 A;  4AH6 A;  2DUD A;  3HOU G;  1YHB A;  4A93 G;  4IOA A;  1N33 L;  2IY5 B;  4YWL A;  1SRU A;  5IYC G;  1YIT A;  4LF8 L;  5M3F H;  3PGZ A;  3PUW A;  1I50 H;  3UDG A;  3S1M H;  4A3C H;  3K81 C;  1X3F A;  3PUY A;  1KAW A;  4FDB A;  1XTD A;  4B3M Q;  4H02 A;  2N78 A;  1PH4 A;  5IE8 A;  1PVO A;  2JA7 G;  1IBL Q;  3CQZ H;  2NZH A;  3CCM A;  5EAY A;  4DR4 L;  1W3S A;  2XGT A;  2ZTE A;  4JBM A;  1IXR A;  2AMC B;  4WJ4 A;  2JQO A;  3J81 i;  2QEX A;  1BKB A;  2IX0 A;  3PIO A;  4MTN A;  4R4Q A;  1M90 C;  1U5K A;  1PV4 A;  3CXC A;  5JEA J;  2I5H A;  4GN3 B;  2K5V A;  4JBK A;  1IYJ B;  1HNX Q;  3CCQ A;  3S2H H;  2JA6 H;  5C3E H;  1PH6 A;  4IFD I;  1N32 Q;  1WFQ A;  3STB C;  3PCO B;  2MNA A;  3CME A;  3FP9 A;  1WJJ A;  1CKN B;  3OYY A;  4YHH L;  1YJW A;  1IBK L;  1QUQ B;  2H5X A;  2UUA Q;  1OTC A;  1IL2 A;  5FLX c;  3K80 C;  2N3S A;  4XIG S;  4K0K Q;  2JEB I;  1N34 Q;  3S2D H;  3GTL H;  2R92 G;  1WI5 A;  5C0X J;  1X3E A;  1AE2 A;  3CCS A;  1BVS A;  2Q2I A;  2F4V Q;  4OX9 Q;  3RLF A;  1L2F A;  1GKH A;  3FKI H;  4JI0 Q;  2K52 A;  4GKK Q;  2UXC L;  4LFB L;  1JT8 A;  5IP7 H;  3PF4 A;  2K4K A;  2K50 A;  2UXB L;  2WAQ G;  4C3I H;  2B63 G;  2I0Q A;  2MFI A;  1YVC A;  1V1Q A;  4DV3 L;  3PSI A;  5LMU L;  2LSS A;  4JI5 Q;  1HJP A;  4LFC Q;  1FJG Q;  3KYH C;  1AH9 A;  4LWC A;  1SRO A; 
#chains in the Genus database with same CATH topology
 4K5V A;  3R93 A;  4RKL A;  4Y7N H;  2OTL A;  5EKL A;  5IGB A;  1BDO A;  2F0J A;  2K14 A;  4POF A;  5A35 A;  2NBF A;  1Y1V G;  3S14 H;  4DFA A;  1SYD A;  2E76 C;  2K5N A;  5AJ3 Q;  2IX3 A;  3DWA A;  4LF5 Q;  3ZYY X;  4BY7 G;  1F2L A;  3OMG A;  5C4X B;  3W2D A;  4KK7 A;  4H0L C;  2PQA B;  1TWF H;  1SND A;  2MPM A;  1YNN D;  2NVQ B;  2VQE Q;  2RF4 A;  3HFZ B;  4A3B H;  1SBB B;  1RL2 A;  4HN7 A;  2NWG A;  3QR8 A;  3STB D;  3D8G A;  2F0V A;  2JA5 B;  5FKA C;  1O80 A;  4B3R Q;  4BY1 B;  1EY6 A;  1JMC A;  3A5Z B;  4C2M H;  1JWM D;  1TWA B;  2EJM A;  1SXT A;  4JVZ A;  2ENB A;  1A3T A;  2FMC A;  3TP6 A;  2QA4 A;  5I2Y A;  2EZV A;  4LF6 Q;  4L5T A;  4YCV A;  2K7V A;  1GD7 A;  5JPN C;  4DPG A;  3KLW A;  5FLM H;  2PQA A;  4F87 A;  2L12 A;  4KN7 C;  1HNZ L;  1ZXT A;  2CWP A;  1Q90 A;  1VQ6 A;  1C9O A;  3D31 A;  4A3K H;  2E5L Q;  5FO8 B;  1M1K C;  1II3 A;  2WB1 G;  3CRL C;  2R92 B;  1J5E Q;  1N33 Q;  3JAM i;  4DR2 L;  4PMW A;  4A3D G;  1B7Y B;  2GVA A;  4LF4 L;  4OHJ A;  1EFI D;  3LX0 A;  2B63 B;  2CH4 A;  1QVG A;  5I9P A;  1CQF A;  1NNX A;  2YTX A;  5C5L A;  3MEH A;  1RTO A;  2SDF A;  1HA6 A;  3CAM A;  4K8J A;  3KLS X;  1DM0 B;  1A2T A;  3HOY G;  4JBW A;  4BBR B;  3BDC A;  3KF8 A;  5M5Y B;  4DR6 Q;  1STH A;  3PIP 3;  4FXD A;  3T1H L;  1EWC A;  4GNX B;  3E9H A;  4FF1 A;  1YJN A;  1MHW C;  3HKZ E;  1BF4 A;  2RSN A;  1JWU D;  3PO3 B;  1VQ9 A;  5J3B A;  1SNC A;  1YNJ D;  1N36 L;  1CA5 A;  5ELE A;  3TN2 A;  1X55 A;  3K7A B;  4JOI C;  1R9T H;  3S24 A;  1LT5 D;  2UXC Q;  1D8L A;  3TP5 A;  5GRO A;  4A3M B;  3AQQ A;  1VQJ A;  5T1I A;  4K2L A;  4B3M L;  2R92 H;  2PW5 A;  2AKW B;  1PTO D;  1SDF A;  1DCZ A;  1I4X A;  4TSS A;  2LS0 1;  1SR3 A;  4BS9 A;  4KLK A;  3A54 A;  1VQ5 A;  3SE0 A;  2F3V A;  1JE5 A;  2B63 H;  1LUZ A;  1SFO B;  1I94 L;  4R4I A;  4DK1 A;  1PRT F;  5IGF A;  1LTA D;  1S5C D;  1CZG A;  1HNX L;  5K5P A;  5KIX A;  1F9P A;  1TWG H;  4GNX A;  4ULL A;  4Y52 H;  4K6L A;  1MJC A;  1X9N A;  4B3T Q;  1FVI A;  1XNQ Q;  3H0G H;  3L2P A;  3JAM L;  1PRT C;  5M5Y H;  1IBM L;  4YY3 Q;  3GTP H;  4FF3 A;  1PH8 A;  3PMF A;  1HR0 W;  3RLO A;  4JV5 Q;  1R4P B;  3S16 B;  1Y1W B;  2CWA A;  3FPP A;  1OXT A;  1IYU A;  1EU3 A;  1UEB A;  1SNP A;  2O2L D;  2IHE A;  2N8N A;  3CPW A;  2Q8T A;  3I55 A;  4DAP A;  1XPU A;  1YJ9 A;  4DV2 Q;  3HOV G;  3T1Y L;  1KL9 A;  1VF5 C;  3RN5 A;  2VQF Q;  2OXP A;  1VQ7 A;  3GTM B;  2Z6K A;  2G9H D;  2HCI A;  1S40 A;  1WCM H;  1U0L A;  5FO9 B;  1SE3 A;  2RCN A;  5L37 A;  1ILP A;  1AN8 A;  2ZM6 Q;  2VXW A;  3OSO A;  4QF4 A;  2PQE A;  3S1M B;  1FNU A;  4X66 L;  2K5W A;  3VR6 A;  4CDF C;  1XMO Q;  5C0X H;  3D3R A;  1S5E D;  4HCE A;  4PNY A;  2HCC A;  3E9I A;  2HD3 A;  1XX8 A;  1HUM A;  1VQD A;  3MZ5 A;  4FP5 D;  4X64 L;  3AEV A;  2AQ3 B;  2I5L X;  4JPB W;  4ME3 A;  4DNR B;  2VL6 A;  5JAV A;  4A3J G;  2QCP X;  3S15 B;  1L1O C;  2HHH L;  1H95 A;  2F52 A;  1SYE A;  4OON A;  2ZTC A;  1NBW A;  4DUZ L;  3I4O A;  2C35 B;  2CH4 W;  3SVM A;  1VDZ A;  4IPH A;  1O78 A;  3KF6 B;  3S2D B;  1TS4 A;  1KNA A;  2JA7 H;  1V8Q A;  5M5W H;  5C44 H;  3TRE A;  4O0A A;  3TP7 A;  4RHR A;  5FOB B;  3I3C A;  4OIK A;  1IBK Q;  2XN9 C;  4HCS A;  1I6V C;  3NHH A;  4IFD H;  5EQ0 A;  4JI2 L;  4RMF A;  4UP9 A;  3HKS A;  1O7Y A;  1ZYR D;  1I4H A;  1ILQ A;  3ICE A;  4LFB Q;  1G51 A;  1STE A;  1VMP A;  3GDE A;  4NPS A;  3TSS A;  1Q81 C;  2DGY A;  4J1M A;  3NBH A;  4C56 C;  4DV3 Q;  5LMU Q;  3SGI A;  1YZ6 A;  2QIL A;  3S15 H;  4QGU A;  1VCI A;  1GOZ A;  2NVY B;  3VYU A;  5C6A A;  5C3E G;  3K5L A;  1XNR Q;  4AQY Q;  1D5M C;  2E2D C;  2TMP A;  3GV6 A;  2IHF A;  3GD7 A;  4A76 A;  3KOJ A;  2NYZ D;  5KNB A;  3HOX H;  1WTP A;  3E0E A;  2F0I A;  1K8A C;  4PMC A;  4DXF A;  5CR3 A;  1VQB A;  4JI7 Q;  2R93 H;  3A8J E;  5LMN Q;  2B2V C;  4LFA Q;  1QWY A;  4RHS A;  4BBS B;  2NTS A;  1PFB A;  1BBW A;  5GAH C;  1MBY A;  2JP1 A;  2L4N A;  2NZO A;  4JYA Q;  4C3I G;  2K32 A;  1PYB A;  2WB1 E;  1RD9 D;  3HOZ B;  1HR0 L;  1CFM A;  5IY0 A;  2MJ8 A;  2IT1 A;  1S4Z A;  3T51 B;  4KTA A;  4ZKC B;  3E0J A;  4JI1 Q;  4YWM A;  5ELC A;  2ICI A;  1DZ1 A;  1R4Q B;  4DAV A;  4APV A;  4A3F H;  2K5Q A;  3NQT A;  1K0R A;  2EOT A;  1PXU A;  3A5U A;  1S3O A;  1VQC A;  3IRB A;  2VW9 A;  4OWW B;  1CA6 A;  3VR3 A;  2JA9 A;  3DUZ A;  3T53 B;  5KYL A;  3RZD H;  2KA7 A;  2F0K A;  1SE2 A;  1SNO A;  4H7B A;  4E6I A;  3NP8 A;  5LL6 S;  3NTH A;  1JOR A;  3HOU B;  3M4Y A;  3BYY B;  1JB3 A;  4A3B G;  4GOP B;  1MJE A;  1A62 A;  3RZO H;  1XPR A;  3URY A;  2BH2 A;  2XSC A;  1U4L A;  5FLX E;  3CCL A;  1JOK A;  1CSP A;  4BBS H;  4DK6 C;  2F03 A;  1C8C A;  4DR5 L;  1HNW Q;  3CC2 A;  1LTI D;  4TVA B;  4JI6 L;  4QQB X;  2CQO A;  3NTI A;  3MVV A;  4DF7 A;  5JVH 3;  3I7F A;  1K73 C;  3Q0A A;  1VQN A;  2FXQ A;  1PH2 A;  1X32 A;  2F3I A;  4DR7 L;  1DYQ A;  3WOE A;  2UUC Q;  1B1Z A;  2ZJQ A;  2JA6 B;  1LYL A;  1KQS A;  5FLM G;  3SK6 A;  2VY3 A;  4X62 L;  1XMQ Q;  3I90 A;  3OTO L;  4DA2 A;  4CKC A;  1C48 A;  1F2Z A;  2F1M A;  4PQX A;  1CHP D;  5FK9 C;  1Y8O B;  4GOP A;  4A3K G;  3ONA B;  1VQL A;  2OCE A;  1SAP A;  5BR8 Q;  4Z9C B;  1Y8P B;  3BJU A;  3NEM A;  5JOB A;  4DV6 L;  2LXJ A;  2EDG A;  3U9O A;  1YHB A;  3K57 A;  4KKS A;  1D6E C;  1IW7 D;  4YWL A;  1SRU A;  1A6X A;  1YIT A;  2L1B A;  3PGZ A;  4R8N A;  1I50 H;  5IGG A;  5KND A;  1X3F A;  5DNF A;  1PH4 A;  2E2H B;  4DR4 L;  2DNE A;  4JBM A;  2X69 A;  2PZW A;  4O42 A;  4WJ4 A;  3J81 i;  4LJZ C;  1BKB A;  1M90 C;  3C1F A;  4C3J B;  5JEA J;  4GN3 B;  4JBK A;  1BQQ T;  3SEB A;  3E6Z X;  3CCQ A;  2JA6 H;  4XXE A;  4N8X 1;  3CME A;  4FF4 A;  1I4G A;  2KVM A;  1DOK A;  3OPO A;  2K1B A;  4UAI A;  1WD0 A;  2H5X A;  3OOC A;  1DJR D;  1SJE D;  1IL2 A;  1L0Y B;  2HDL A;  2N3S A;  1N34 Q;  3QIA A;  3GTL H;  2R92 G;  5G3L D;  1WI5 A;  2JYO A;  1OO9 B;  5EBD A;  2K52 A;  4GKK Q;  2KEE A;  2UXB L;  2B63 G;  1I4R A;  2MFI A;  1YVC A;  2BE5 C;  4JI5 Q;  1HJP A;  4LFC Q;  3KYH C;  3J7Y W;  5HY6 A;  1B2T A;  5BN3 A;  1E22 A;  3QOJ A;  3H0G G;  1TY0 A;  1TR5 A;  1VQ4 A;  1EU4 A;  4RFB A;  3I56 A;  4DR1 L;  3CP0 A;  1X3G A;  2QDB A;  4C3J H;  3A7L A;  4HJ8 A;  4XQQ A;  1TU2 B;  1SYB A;  3ER0 A;  1IHZ A;  3VR2 A;  1Z47 A;  3NEL A;  4ZYS A;  3VYR A;  4HSV A;  4GLX A;  1AFP A;  2IWH A;  3T16 A;  4XQN A;  4KHP Q;  1Z7T A;  3QOL A;  3UE1 A;  2M9V A;  2JA8 B;  2D2C C;  3F1Z A;  2BDN A;  4DXG A;  1JR0 D;  3Q24 A;  1P8L A;  3J81 L;  4YCU A;  4DUY Q;  5CC4 A;  2EY1 A;  4IJL A;  5EPL A;  3OMC A;  4DK3 C;  1WCM G;  1TS3 A;  1EZ8 A;  1K8M A;  4DV4 Q;  1VMC A;  5GQO A;  3CPF A;  3DWQ A;  1I3Q B;  4A3J H;  4UDU C;  3HRZ C;  3J80 i;  5I4D A;  2E2J H;  1RCV D;  2KJX A;  5C0X G;  2F0P A;  4DKA C;  2OEO A;  1TWC B;  1EYG A;  1LT3 D;  3NE5 B;  3AU7 A;  4RG1 A;  3F2B A;  1K83 H;  3KUP A;  1XPO A;  4JOI A;  1J6Q A;  1N8R C;  1OXV A;  5M5X B;  3IKJ A;  5IYD H;  1HUN A;  1EOT A;  1Y1W G;  1A2U A;  1PFS A;  1YBY A;  5TSS A;  4NXM Q;  4B3S Q;  4X3U A;  1XWE A;  1RHP A;  4HID A;  2WAQ B;  2B3G A;  1QIL A;  1LAB A;  1D7Q A;  1LTS D;  5IYC H;  4HSP A;  1K3B C;  4RGO S;  3J7A 5;  2CHB D;  1UE1 A;  4DV1 Q;  5D3I B;  5HUR A;  1KNE A;  4CBV A;  2QW7 A;  3M3Y H;  4NW2 A;  4WOR A;  2BCO A;  5C44 G;  1UE7 A;  2A68 D;  2PMZ E;  4ZAI A;  1ET6 A;  3PO2 B;  1SYG A;  2HQL A;  4C3H H;  1EQQ A;  4A4I A;  4DGZ A;  4IFD G;  1A63 A;  2BH8 A;  4R4C A;  3R8B A;  1X65 A;  3RD4 A;  3Q23 A;  5KNC A;  1PZJ D;  1VQH A;  1BXT A;  3QB3 A;  1I4P A;  2Q8I B;  2A5H A;  2PO4 A;  4JK1 C;  4DK0 A;  1LLR D;  1H9S A;  3BZC A;  3TQY A;  5M5X H;  3LWU A;  1KRS A;  2R7Z B;  1WOC A;  4GZY C;  3A74 A;  1KD1 C;  1DON A;  1U4M A;  3J80 L;  2G5D A;  4BA2 I;  2VUM B;  1V1P B;  1L1O B;  1U4P A;  3HOX G;  4PV1 C;  1IYV A;  2OQ0 A;  1S72 A;  1CZW A;  1N32 L;  3ERQ A;  1BBX C;  2R93 G;  4R4T A;  5C4J H;  4JCV E;  1LT4 D;  2R7D A;  4V0B A;  1KAB A;  1HTL D;  3CRK C;  1I6H H;  4K0K L;  1VQ8 A;  1ML0 D;  4OXP A;  2F4I A;  1PH9 A;  5E3F A;  1L0W A;  3I4N B;  4OX9 L;  1B3Q A;  1Q1E A;  4A3E B;  1C7Y A;  1EY8 A;  3PUZ A;  4A3I B;  3MC0 B;  4JI0 L;  4JI8 Q;  1K8O A;  5IP9 H;  2VZA A;  1TWH H;  5J39 A;  1BCP D;  2QDL A;  2UXD L;  1LO5 D;  1RDP D;  4ZUJ A;  4A3F G;  4LUV A;  1PTO H;  3TBI B;  3QG1 A;  1V1P A;  1L1O A;  1H9K A;  2LXK A;  4GN5 A;  5GAD C;  1I5F A;  2FIN B;  1F2M A;  1SMX A;  3QWN A;  3R2I A;  3GTK B;  1V43 A;  2XVS A;  3RN2 A;  1G6Z A;  1GUG A;  5AJ3 L;  4QY7 A;  1PMR A;  1HNZ Q;  2EPB A;  3A56 A;  2D5D A;  2A8V A;  3JAM c;  5M3F B;  1QJO A;  5CGK A;  4DV0 Q;  1NMG A;  1PH1 A;  1PDQ A;  5EKK A;  4MHE A;  3K59 A;  4PZ7 A;  4BBS G;  3KF8 B;  2VQE L;  3EQL C;  1NMF A;  2SNS A;  4LF4 Q;  1X6O A;  2RDG A;  2RQX A;  3CU7 A;  2RBM A;  4B3R L;  5C4X H;  2A6H D;  2F0O A;  1EEI D;  1KAA A;  1V9P A;  3S2H B;  2CQA A;  1Q82 C;  2NVQ H;  2Z1C A;  4K6D A;  4OO1 I;  3I2Z A;  4P74 A;  3BU2 A;  4X3K A;  2Q2U A;  2JA5 H;  3CCV A;  2L15 A;  4CKB A;  4BWG B;  3T1H Q;  4BY1 H;  2AUK A;  1JQY D;  1ASZ A;  5GAE C;  1TWA H;  3G6E A;  3FKI B;  4Q5V A;  4IUU A;  4HMJ A;  1N36 Q;  2E5L L;  1E0B A;  1GHJ A;  5FO7 B;  1J5E L;  2N55 A;  1Z6H A;  4I7Z C;  4UY8 C;  1ENF A;  1BCP F;  2Z4I A;  5JJZ A;  2B2T A;  2JE6 I;  1D1I A;  4I7A A;  3GTG B;  3VYT A;  2A19 A;  4QUC A;  4XYO A;  2Z8L A;  1TXY A;  4DN4 M;  1Z9F A;  1NR4 A;  1PA6 A;  1SYC A;  3BG3 A;  1MGS A;  1SJH D;  2CW0 D;  4FVM A;  1YNN C;  5C5M A;  2YTV A;  1B44 D;  1I94 Q;  1A0I A;  1FGB D;  2JA6 G;  3HKZ B;  3L0O A;  1DOL A;  3TZD A;  1EYC A;  4I65 A;  2PNR C;  4DR6 L;  4AYB G;  1EZ6 A;  5COR A;  2OF1 A;  2YU9 B;  4ZKB B;  3DMU A;  4FYD A;  2HUG A;  4A3G B;  1TII D;  1G29 1;  5CBA E;  4EQN A;  3OHX C;  1IBM Q;  1NSN S;  2QKI C;  1O7Z A;  3M9B A;  4BBR H;  5JVG 3;  2HIV A;  2J4X A;  1E2W A;  1Y14 B;  3U9S A;  4XT3 B;  3CC7 A;  4RCO A;  3BZD B;  3J81 E;  3N52 A;  5E4W C;  4M8A A;  3F2C A;  4C1N K;  4KHV A;  2V4D A;  2MGS A;  4RKB A;  3PO3 H;  4J15 A;  1C4Q A;  2GA4 B;  3L7Z C;  2CVR A;  5FJ8 H;  3K7A H;  3K5M A;  1PHJ A;  3G48 A;  2EYO A;  2YV5 A;  2RDH A;  4A3M H;  4G7O C;  2VB3 X;  3E5S A;  4NXN Q;  4BXX H;  4C3J G;  2KCC A;  4F8M A;  3D4W A;  3VR5 A;  1SYF A;  4LF7 L;  4MZ9 A;  5LMN W;  2NB0 A;  3W3A A;  1XNQ L;  2OTJ A;  2IX1 A;  3FDT A;  4X66 Q;  4L63 B;  1JE4 A;  3FHW A;  5D65 A;  1SFO H;  3CD6 A;  4FXK C;  4GLA C;  3GTO B;  2EE1 A;  4A93 B;  1UE6 A;  2RHS B;  2EYJ A;  5EGT A;  2PI2 E;  3BDL A;  3NWS A;  4F88 A;  1O7L A;  2E2I B;  4CGY B;  1G2S A;  4HED A;  3OW7 A;  1W2B A;  3CC4 A;  3IFT A;  2L5T A;  5A2Q E;  4LUZ A;  4IJH A;  1YNJ C;  2HHH Q;  1PTO F;  1E3P A;  4LF9 L;  2L0C A;  3T4A C;  1VQO A;  3TZU A;  2XNA C;  4F7X A;  3S16 H;  1Y1W H;  2B2W C;  1HFN A;  1EIF A;  1J8I A;  3BVZ A;  4DNI A;  2O4X A;  3CMA A;  4IUT A;  4XT1 B;  4U67 3;  1SLJ A;  2AHO B;  4XYQ A;  1PTO C;  1YHA A;  4GKJ Q;  2D62 A;  2ZM6 L;  2IL8 A;  3GO5 A;  4JI3 L;  3NBH B;  2ICE C;  2EYL A;  2Y0S G;  3R2T A;  4KJN A;  1A8V A;  1XMO L;  1L0X B;  3W1G A;  2K01 A;  1LT6 D;  5IYD G;  2UU9 Q;  1WTV A;  4JI2 Q;  3GTM H;  4IN3 A;  3S17 B;  4AH6 A;  1A15 A;  2IY5 B;  4B9W A;  5IYC G;  1STN A;  1WTO A;  3S1M H;  2K6A A;  4FDB A;  1FR3 A;  2N78 A;  4H02 A;  1G2T A;  5BN5 A;  1IBL Q;  5DM7 3;  3CCM A;  4RWS C;  3J80 E;  1QNU A;  2NVT B;  3BVM A;  1Y1V B;  3O13 A;  2JQO A;  2QEX A;  4K14 A;  3PIO A;  4C3H G;  4R4Q A;  1STB A;  2F0W A;  4H44 C;  1PV4 A;  2B2U A;  3TDQ A;  4BY7 B;  2A74 C;  4MIU A;  1LTR D;  1XXG A;  1WFQ A;  1BO0 A;  1IL8 A;  3WDN A;  3PCO B;  1IBK L;  2AQ1 B;  3OYY A;  3HGB A;  4CJ2 C;  4EQP A;  1OTC A;  4HR7 B;  5I6W A;  3S2D H;  1BNZ A;  1LAC A;  5T1G A;  1BVS A;  3D6C A;  2A69 D;  1QE6 A;  2I07 B;  1GKH A;  3T56 B;  4LFB L;  1JT8 A;  5IP7 H;  2NZ1 D;  2K50 A;  1KDC A;  2WAQ G;  2I0Q A;  3GQB A;  3A55 A;  4DV3 L;  3GTJ B;  5LMU L;  3S1R B;  3D4R A;  3OWE B;  1FJG Q;  3H09 A;  1EY7 A;  1B9N A;  5IYB H;  2P5Z X;  4AQY L;  1YNX A;  2PCF B;  1TKW B;  1AP0 A;  2ZXR A;  3OIQ A;  2NVT H;  4M1U B;  3JC6 6;  3LGJ A;  2JXM B;  2RVL A;  4G7H C;  1PH7 A;  1GM5 A;  3SDZ A;  4B08 A;  1OXU A;  4JI7 L;  5C3W A;  1CK1 A;  1SNQ A;  2B39 A;  3MFG A;  4ZQ3 A;  1QVF A;  1STG A;  2WB1 B;  5LMN L;  1BBU A;  4NKL A;  3D6W A;  4DNT B;  1P16 A;  2NVY H;  1EY5 A;  1H9M A;  3E3X A;  3I72 A;  3UDI A;  2A6E D;  2F0M A;  1E1O A;  3ULJ A;  2K28 A;  4A3D B;  5IP9 G;  4JYA L;  3LWE A;  1AE3 A;  3H15 A;  2JEA I;  3CCJ A;  1JOQ A;  4RCN A;  1BUV T;  2L9H A;  4JI1 L;  1F9R A;  3MXP A;  3MEF A;  4DV5 Q;  2LKV A;  3M4O B;  3HOY B;  1D5X C;  1GUO A;  5KYI A;  3HOZ H;  1QG7 A;  2XWJ B;  3GTJ H;  2PW7 A;  3GTQ B;  1ZYR C;  4TQU S;  1EWH A;  1LTB D;  2F0H A;  5HGT A;  1NUC A;  4P73 A;  4AYB E;  1PYW D;  1IZ6 A;  1NR2 A;  3MXU A;  3IL8 A;  4HAE A;  2WAC A;  4A75 A;  4LW1 A;  2WFW A;  5CV4 A;  5C4X G;  4WFN 3;  1Q1B A;  5CV7 A;  4A3E G;  1FNV A;  3J81 c;  1S5F D;  3HOU H;  4OWX B;  3UDX A;  4DR4 Q;  5EKI A;  3V96 A;  2O5J C;  1NCV A;  1UNS A;  1BR9 A;  3U50 C;  3G71 A;  3DHQ A;  4EX5 A;  5C4Z A;  1KDB A;  2JA5 G;  1XMQ L;  4BY1 G;  1EEF D;  5H1S E;  4HIK A;  2ASB A;  4QCL A;  3U4V A;  1KRT A;  2UUB Q;  5BR8 L;  2H1E A;  4DR3 L;  2C9O A;  3RR5 A;  4L6T B;  3NBI A;  1XJV A;  3G7L A;  3OIP A;  5EBC A;  3JAM E;  3DM1 A;  4K2K A;  1K28 A;  1NJI C;  2ZXP A;  2WKD A;  3I4M B;  1LTL A;  4MN3 A;  4X3S A;  4DV7 Q;  2F0E A;  3D0F A;  3OW2 A;  4HIM A;  3HEJ A;  3AFQ A;  1KIX A;  1YIJ A;  3K8A A;  5IWA L;  3V2T A;  4FO2 A;  2QEJ C;  1EYD A;  1EIH A;  1RJT A;  1S5D D;  4HJ5 A;  4RGM A;  3CW2 C;  2IW3 A;  1E7Z A;  2E2H H;  1OXX K;  1DGS A;  2EY5 A;  4BBR G;  2ID0 A;  3F8T A;  1HQM C;  1VQF A;  3SK4 A;  5E4X A;  4XQJ A;  4MNO A;  4OWT B;  2Y0S E;  5M3M B;  2EYF A;  1N34 L;  2K5H A;  1VQG A;  4DAY A;  1PFN A;  1ICF B;  1NE3 A;  1X56 A;  3FEW X;  3PO3 G;  3S1N B;  2N88 A;  2PZT A;  2X6L A;  5FJ8 G;  4P72 A;  1SMY D;  3EA6 A;  2WP8 J;  3AYH B;  4L5S A;  3C46 A;  1NTG A;  3I4M H;  2KHI A;  1STY A;  4IQZ A;  4JI5 L;  3QJY A;  1CTM A;  3MA2 B;  2RA4 A;  4A3M G;  4BXX G;  1TS2 A;  3J80 c;  3R3O A;  2B8F A;  5JEA H;  2YYZ A;  1JB7 A;  1IW7 C;  1E2Z A;  5KGU A;  4JI4 Q;  4A3L G;  5DM6 3;  3ERS X;  4OL7 A;  1T9H A;  1Y8N B;  2F0F A;  1QB5 D;  2KCT A;  3HOW B;  4RA8 A;  2CCZ A;  1B3A A;  2LMC B;  4KY7 A;  3CQZ B;  1JC7 A;  1LTG D;  2EIF A;  3VR4 A;  5G3L F;  1K3R A;  1WTQ A;  1E24 A;  5M3M H;  2SOB A;  3MHB A;  1PRT B;  1KHI A;  4DUY L;  1B4O A;  5NUC A;  2ATW A;  4KY6 A;  4LF8 Q;  3VDY A;  3D4D A;  3S1N H;  3T13 A;  5C3E B;  2WAQ E;  2DNC A;  3PUV A;  4DV4 L;  2EYP A;  3EFX D;  1H9S B;  2JA8 H;  1V1O A;  1TQO A;  5DEH A;  1MIU A;  4YCW A;  4HIO A;  1JWS D;  5DLQ E;  2MUY A;  2CKZ B;  2F3W A;  5C3X A;  3EN2 A;  1YHQ A;  1WYD A;  2K75 A;  2NUC A;  2AUJ D;  2AWN A;  4YHH Q;  1X54 A;  3TS2 A;  4X65 L;  5CV9 A;  1I3Q H;  3VA5 A;  3PIP A;  2K33 A;  2DY8 A;  2Q2H A;  4J8Q A;  3K58 A;  4B3S L;  4NXM L;  3HOW H;  1I4Q A;  3J81 j;  2ZJP A;  5IT9 L;  2BA0 A;  4NDX A;  1TWC H;  2B29 A;  4Y7N B;  4HJ9 A;  3S14 B;  4DV1 L;  4QIW E;  1B50 A;  4OEM B;  4WRD A;  5EJW A;  2H4O A;  1TY2 A;  1FNW A;  2Z4H A;  1TS5 A;  4P75 A;  5JJK A;  3K0X A;  3NXW A;  2NN6 I;  4GOP C;  1TWF B;  4L8J A;  1LM0 A;  4JW0 A;  3OWF A;  4PZ8 A;  4R8I A;  5CMD A;  1EYA A;  2PYK A;  3WWV A;  1Q12 A;  3J7A V;  2K5D A;  4EVO A;  4FXG C;  1K8G A;  1GUW A;  3I91 A;  2C5C A;  1EIG A;  1T5E A;  1HXY D;  2UUA L;  4NMZ A;  4C2M B;  3PO2 H;  2D9U A;  2OQK A;  5IP7 G;  2QGQ A;  3VYS A;  2UXD Q;  4QB4 A;  4PG3 A;  2AQ2 B;  5ISR A;  1A3V A;  2F4V L;  3I4L A;  1DOM A;  1CKM A;  1PZI D;  5IYB G;  4RH6 A;  5D14 A;  3KBX A;  1MKH A;  4KHZ A;  5F2D A;  4N8F A;  3P7J A;  2Z0S A;  3TME A;  2B2W A;  3DEO A;  2EXD A;  5I2X A;  1EY9 A;  1F9Q A;  1AZP A;  3MWY W;  1T5X D;  5CV8 A;  3K6O A;  4A3K B;  4KKU A;  4U68 A;  2R7Z H;  1KDA A;  3EJI A;  1D5Z C;  4LNQ A;  3VA7 A;  4YIJ A;  2XIW A;  3V05 A;  3TRZ A;  1SNM A;  1HZ9 A;  1PZK D;  2VUM H;  3C2P A;  4LF5 L;  3L3O C;  1UE5 A;  2A68 C;  3NUC A;  3Q6S A;  3CCU A;  4K8I A;  5J1Z A;  4V19 0;  4JI8 L;  4DU9 A;  1NY4 A;  1IKM A;  4GN4 B;  1HZA A;  5K36 H;  2B8G A;  4DR2 Q;  3P20 A;  4ZUI A;  3AB9 A;  2FMM A;  5CYU A;  2AWO A;  2VS1 A;  4K5W A;  4Q0F A;  3HOZ G;  2HQE A;  1OXS C;  3I4N H;  1RF2 D;  4A3E H;  4A3I H;  1H9J A;  1PRT D;  2ES2 A;  5EPJ A;  5CV6 A;  3H3V I;  3KBG A;  2SEB D;  4FNF A;  4LF6 L;  1R9T B;  5C0X I;  3TS0 A;  1LTT D;  3NK9 A;  5ELD A;  5BN4 A;  2LY7 A;  4IUV A;  3IAY A;  2DJF C;  2KCM A;  4DV0 L;  2B2Y C;  5LL6 X;  2VNU D;  4RAU C;  2EY2 A;  3W1B A;  3NWT A;  2KHS A;  1VF7 A;  2I5M X;  3ITP A;  3GTK H;  5FLX L;  4HTH A;  3U58 A;  2B2V A;  2DUD A;  3HOU G;  3AMU A;  1N33 L;  2EYM A;  4OEL B;  1EY0 A;  1CM9 A;  1WD1 A;  5M3F H;  3UDG A;  3K5O A;  3K81 C;  1TWG B;  1XTD A;  4B3M Q;  2RDF A;  2E74 C;  4S3S A;  1EQT A;  3PQI A;  5EAY A;  2ZTE A;  1SE4 A;  3H0G B;  1IXR A;  2AMC B;  4KD3 A;  1BCP C;  5I6Y A;  1MD2 D;  4RGN A;  3GTP B;  1GXD C;  2I5H A;  2K5V A;  2BOS A;  1HNX Q;  3S2H H;  4KMU C;  4IFD I;  1PH6 A;  3BS1 A;  5COY A;  2NN6 H;  3STB C;  3K5N A;  3LNN A;  2MNA A;  4IUP A;  3FP9 A;  1YJW A;  1CKN B;  4TRD A;  1QUQ B;  1HCZ A;  3X3M A;  1HQR D;  3A8K E;  1ICW A;  3P1H A;  1B53 A;  3CKI B;  5C0X J;  3CCS A;  4HMI A;  3RLF A;  2MP1 A;  2QF7 A;  3FKI H;  4OGQ C;  2UXC L;  1CT1 D;  3PF4 A;  2K4K A;  1WCM B;  1V1Q A;  2LSS A;  4ID6 A;  1Q3L A;  5E1F A;  3P75 A;  3SXH A;  4G57 A;  4N9T A;  3GTG H;  2HDM A;  1JJC B;  3TP8 A;  3T1Y Q;  5JJL A;  1HFG A;  4LF7 Q;  2A6H C;  1CKN A;  1TT2 A;  1QUQ A;  1UAP A;  2KUM A;  2FFK B;  2K03 A;  1AEX A;  2KQ3 A;  5J22 A;  3UDF A;  5LHY 1;  1Q86 C;  4B3T L;  1G91 A;  2XRS D;  3TEH B;  3RUZ A;  4A3L H;  1FL0 A;  3KDF B;  4YY3 L;  2KCN A;  2YU9 H;  2EXZ A;  3I4M G;  3M7G A;  2ZTD A;  1Q7Y C;  5ELN A;  3KK7 A;  2WKC A;  4IFD J;  3F2D A;  1WTX A;  4A3G H;  4JV5 L;  3N6R A;  3RMH A;  1MI2 A;  3UI2 A;  4X64 Q;  2L11 A;  4LF9 Q;  4QUF A;  5JEA G;  2JA7 B;  1EL0 A;  5I9O A;  3KJO A;  1KTK A;  2HT1 A;  4IPG A;  2M00 A;  1U4R A;  5M5W B;  5C44 B;  1WTH A;  3X3N A;  5JJI A;  4AIM A;  2E8G A;  2PNH A;  1FD7 D;  4NXN L;  1F2Y A;  1EY4 A;  4DV2 L;  1FYC A;  4NB3 A;  4DUZ Q;  2VQF L;  1ESR A;  2MO0 A;  3PUX A;  1EOV A;  4JI3 Q;  3H3V H;  1N9W A;  2CW0 C;  4IO9 A;  4PZ6 A;  1O7I A;  2GVB A;  4OO1 H;  1S5B D;  2EQS A;  4H13 C;  4CHT B;  3KDF A;  4ABN A;  3GP7 A;  3UE0 A;  2FHT A;  3FPU B;  2OWO A;  4KKT A;  2YTY A;  1XTC D;  3K0Y A;  5M3M G;  5ELB A;  4KI0 A;  1C0A A;  1CUK A;  1HZC A;  4IUN A;  5IT9 E;  3BVG A;  2GN5 A;  4CDC C;  3DWP A;  3J7A F;  4PMB A;  3GTO H;  4A93 H;  3F2U A;  2JA8 G;  1ESF A;  1PFM A;  3HOX B;  3U4Z A;  3MAQ A;  3B6Y A;  2E2I H;  2PI2 A;  2R93 B;  2MHV A;  4R1J A;  2I46 A;  4GKJ L;  3KLS A;  5D3D A;  3ND8 A;  2K04 A;  2ALY B;  2JJQ A;  4ZLT F;  1X3P A;  3J7Z C;  1CHQ D;  5ELO A;  1M8A A;  2UU9 L;  5IGE A;  1VQP A;  4YWK A;  3GV3 A;  4A3C G;  2EJG C;  2R7F A;  2L55 A;  3HOW G;  3RNU A;  5IOC A;  3I73 A;  1VQE A;  4G7Z C;  2J7Z A;  5GAG C;  2KBN A;  2Q8R E;  1B9M A;  4ZK9 B;  3MXG A;  3I8Z A;  4A3F B;  4POG A;  1HHV A;  2G9D A;  4B9X A;  1HR0 Q;  1B70 B;  4WJW A;  1IBL L;  4ILW A;  2EYH A;  3KF6 A;  4IPC A;  1HPC A;  3RZD B;  1ONL A;  3PF5 A;  3ND9 A;  4CKE A;  1SE8 A;  1ENA A;  2R61 A;  1CQV A;  2F0L A;  3S17 H;  3M4Q A;  2MO1 A;  4CJ0 B;  3HZX A;  4ME5 A;  2VB2 X;  2PZU A;  4L5R C;  3KJP A;  3BZK A;  2KHJ A;  3RZO B;  1XNR L;  2BA1 A;  1Q46 A;  3QO2 A;  1KC8 C;  1Y69 U;  1Y1V H;  2DY7 A;  1K0S A;  3PO2 G;  1F9S A;  2NVX B;  3BYT B;  1HH2 P;  2B2T C;  3FMC A;  2BDO A;  2F0U A;  4LFA L;  4BY7 H;  1U9R A;  4KD4 A;  1VS0 A;  3DLL A;  1WVL A;  1H9R A;  2ZJR A;  1Q8I A;  1E1T A;  2N49 A;  3EIV A;  4DR5 Q;  1GVP A;  4NP5 A;  4MTK A;  1PYS B;  2JSO A;  4JI6 Q;  1FJG L;  4UPA A;  3WOF A;  5KEE A;  4O1N A;  1PH5 A;  1EQV A;  2JK8 A;  3G6J B;  4P71 A;  1W6K A;  4R4O A;  4X3T A;  4DR7 Q;  5EPK A;  2R7Z G;  1QNK A;  4LUO A;  4TKO B;  5ELF A;  3S1Q B;  4QJF A;  4QMG A;  4X62 Q;  2X6G A;  4GNX C;  2VUM G;  4XTC S;  1GO3 E;  2F0T A;  4KY5 A;  3OTO Q;  3C1E A;  3Q8D A;  2RCF A;  3M85 A;  3S1R H;  2J0T D;  1I50 B;  4JC0 A;  4KV6 A;  2PPB C;  4FF2 A;  2EY6 A;  2XTI A;  1PLF A;  5K36 G;  2BE5 D;  2SNM A;  3PV0 A;  4DV6 Q;  1SEB D;  5E7N A;  1XYI A;  3HP3 A;  2NVX H;  3MFY A;  3ULP A;  2EJF C;  1EQR A;  1G8Z D;  1DXM A;  4OIJ A;  3I4N G;  2OT2 A;  2F0N A;  3G4S A;  2LFN A;  2M2L A;  2D0O A;  5IIF A;  4DV5 L;  4A3I G;  1HNW L;  4A3D H;  2D0P A;  2WV6 D;  2JN4 A;  4ZRZ A;  3H91 A;  4AYB B;  2IPK D;  1F77 A;  2DJG C;  2A69 C;  2UUC L;  1QVC A;  4DAM A;  1HZB A;  5CBE E;  2Z6K C;  1MSG A;  3GTL B;  4DR3 Q;  4X6A H;  2KOL A;  1QZG A;  1ASY A;  3M4O H;  4IOC A;  3HOY H;  3S1Q H;  2WIN B;  1ENC A;  3SK5 A;  1EUJ A;  3GTQ H;  1AW7 A;  3ZJY C;  1RIP A;  4KN4 C;  3SR1 A;  2Q2T A;  5M3F G;  1K9M C;  3H3V C;  2MQH A;  3I70 A;  1GHK A;  3NEN A;  4R9W A;  4CDD C;  3A0J A;  3M4P A;  2ZT9 C;  5HGQ A;  2DN8 A;  2HIX A;  3PIO 3;  2TSS A;  4O2D A;  1JIC A;  2A6E C;  5IWA Q;  4BA1 I;  4DAY B;  2O5I C;  3K7U C;  2RHQ B;  2UXB Q;  1G6P A;  4HJ7 A;  3HOV B;  1HA5 A;  1PH3 A;  4GLV B;  3CCR A;  2IJ0 A;  5DAU A;  1VQK A;  2NN6 G;  4CJ1 B;  2CFM A;  4L5Q A;  4CDE C;  2UUB L;  3FVQ A;  1X3Q A;  1NAP A;  3DM3 A;  4XDX A;  3NPP A;  1HTP A;  4DR1 Q;  4EQ5 A;  2F0D A;  1GUS A;  1UWV A;  3Q22 A;  1CI3 M;  1WTW A;  1HRJ A;  1YI2 A;  2V1C C;  1Q8K A;  3CHB D;  3DXJ C;  1YEZ A;  3FKI G;  5IGD A;  4DV7 L;  3KLR A;  3A7A B;  2KED A;  4IZ8 A;  4UP7 A;  5IT9 c;  1W6J A;  1DD2 A;  4A3J B;  4GKK L;  1GUT A;  3EVQ A;  1B8A A;  1UUP A;  1JOO A;  2A73 B;  1QOH A;  2A1A A;  1VQI A;  2E2J B;  1EWI A;  3W5O A;  1CKO A;  2B2U C;  4LFC L;  4IUQ A;  3A8I E;  1ET9 A;  1K83 B;  4ODG A;  1RTN A;  3EBE A;  2Y0S B;  4IAL A;  1SN8 A;  3ERO A;  3RLN A;  3HOV H;  1CSQ A;  1FGU A;  1JJG A;  3DEP A;  1BCP B;  3HKZ G;  2ZXO A;  4J6H A;  2F0S A;  3ULL A;  2B2Y A;  4EGV A;  1TVX A;  3CCE A;  4IPD A;  4JG2 A;  1D2B A;  1VQM A;  5C4H A;  4A3G G;  4JBJ A;  4P2C B;  1D1K A;  4QL5 A;  2RSO A;  1LV9 A;  1AZQ A;  4ALP A;  4N9P A;  5IGC A;  4KHP L;  3M3Y B;  1ROD A;  4HJA A;  1VQA A;  2K05 A;  1QZH A;  2FJ2 A;  2NTT A;  1MSH A;  4LAA A;  4LK1 C;  3MTS A;  4C3H B;  4WJ3 M;  1ZKO A;  3SK8 A;  5CV5 A;  2KEN A;  1WTR A;  4UP8 A;  4KJO A;  2F0G A;  3SHL A;  4RGT A;  2Z6B A;  4G4K A;  1M4V A;  4JI4 L;  2XWB B;  3AFP A;  4UHV A;  4OO1 G;  5JPM C;  3CF5 A;  2KEC A;  1KXL A;  1EFW A;  3H6M A;  4IUR A;  2R3Z A;  1RKN A;  3NQI A;  4GS3 A;  1JJ2 A;  3M7N A;  3NTK A;  3KFU A;  1KLG D;  4ZCK A;  3H94 A;  4EQO A;  4X65 Q;  3MXN B;  5AFW A;  1SSO A;  4K5X A;  2R6G A;  4LMQ D;  2F0Q A;  1EIY B;  1A3U A;  4C3I B;  4A93 G;  4IOA A;  5A2Q L;  2XRQ D;  5KRU A;  2Z9H A;  4LF8 L;  3PUW A;  5M9O A;  4A3C H;  1GJX A;  3PUY A;  1KAW A;  5IOD A;  5IE8 A;  1PVO A;  2JA7 G;  3CQZ H;  2NZH A;  5C4J B;  1E2V A;  1W3S A;  2XGT A;  2PMZ B;  1I6H B;  2IX0 A;  1GUN A;  4MTN A;  1SMY C;  3HG9 A;  1U5K A;  3CXC A;  1IYJ B;  1BOS A;  5C3E H;  1N32 Q;  3HS0 C;  1IKL A;  3MXN A;  1TWH B;  2RKS A;  1J9O A;  1WJJ A;  4YHH L;  2UUA Q;  4A3B B;  1PTO B;  1UEA B;  2WII B;  3K80 C;  3L9A X;  4XIG S;  5FLX c;  4K0K Q;  2JEB I;  2E75 C;  4QIW B;  1X3E A;  1AE2 A;  3BDO A;  1ZEQ X;  2Q2I A;  2F4V Q;  4OX9 Q;  3FRP B;  4C1N I;  3C3L A;  1L2F A;  4JI0 Q;  2EVB A;  3NSW A;  4C3I H;  1JCK B;  1QCB D;  3IFD A;  3PSI A;  1KLU D;  3S9W A;  1AH9 A;  1STA A;  4LWC A;  1SRO A; 
#chains in the Genus database with same CATH homology
 5IYB H;  4AQY L;  3GTG H;  1YNX A;  1JJC B;  3T1Y Q;  5JJL A;  4Y7N H;  2OTL A;  4LF7 Q;  2K14 A;  1E22 A;  4POF A;  3H0G G;  2NVT H;  1Y1V G;  3JC6 6;  1CKN A;  3LGJ A;  1VQ4 A;  3S14 H;  1PH7 A;  1GM5 A;  3I56 A;  1QUQ A;  2K5N A;  3CP0 A;  1X3G A;  1OXU A;  4DR1 L;  5AJ3 Q;  4JI7 L;  4LF5 Q;  1QVF A;  3UDF A;  4C3J H;  1Q86 C;  5LMN L;  1BBU A;  4HJ8 A;  4B3T L;  4BY7 G;  3ER0 A;  1P16 A;  2NVY H;  1Z47 A;  3NEL A;  3UDI A;  1E1O A;  3TEH B;  2PQA B;  3ULJ A;  5IP9 G;  4A3L H;  1FL0 A;  1TWF H;  4GLX A;  4JYA L;  3KDF B;  4YY3 L;  1AE3 A;  2YU9 H;  3I4M G;  3H15 A;  2ZTD A;  1Q7Y C;  5ELN A;  2JEA I;  2VQE Q;  4KHP Q;  2RF4 A;  3HFZ B;  4IFD J;  3F2D A;  3CCJ A;  4A3B H;  4A3G H;  4JV5 L;  3UE1 A;  1RL2 A;  3F1Z A;  3STB D;  1P8L A;  4X64 Q;  4YCU A;  4JI1 L;  4DUY Q;  4LF9 Q;  5JEA G;  4IJL A;  3MEF A;  3KJO A;  4B3R Q;  2HT1 A;  1JMC A;  4IPG A;  3A5Z B;  4DV5 Q;  4C2M H;  5JJI A;  4AIM A;  4DK3 C;  1WCM G;  2E8G A;  2PNH A;  4NXN L;  4DV2 L;  3HOZ H;  4DV4 Q;  5GQO A;  2QA4 A;  4NB3 A;  4L5T A;  3CPF A;  4LF6 Q;  3GTJ H;  4YCV A;  4DUZ Q;  4TQU S;  2VQF L;  2MO0 A;  4A3J H;  3PUX A;  1EOV A;  1GD7 A;  4JI3 Q;  4DPG A;  3H3V H;  1N9W A;  3J80 i;  3KLW A;  5FLM H;  4IO9 A;  4PZ6 A;  1O7I A;  2GVB A;  4P73 A;  4AYB E;  2PQA A;  2EQS A;  5C0X G;  2E2J H;  4DKA C;  1HNZ L;  2CWP A;  1EYG A;  1IZ6 A;  3KDF A;  3UE0 A;  4RG1 A;  2OWO A;  3S1Q H;  2YTY A;  1K83 H;  1C9O A;  3F2B A;  1XPO A;  1VQ6 A;  5M3M G;  4A75 A;  3D31 A;  4LW1 A;  4A3K H;  1M1K C;  2E5L Q;  2WFW A;  4JOI A;  1J6Q A;  2WB1 G;  4KI0 A;  1N8R C;  1OXV A;  1J5E Q;  1N33 Q;  1C0A A;  1CUK A;  1HZC A;  5IYD H;  5C4X G;  1Q1B A;  3JAM i;  4A3E G;  4DR2 L;  4PMW A;  1PFS A;  1YBY A;  1Y1W G;  2GN5 A;  4A3D G;  1B7Y B;  4B3S Q;  2GVA A;  4LF4 L;  4NXM Q;  3J81 c;  4HID A;  3HOU H;  2B3G A;  4OWX B;  3GTO H;  3UDX A;  4A93 H;  1D7Q A;  1QVG A;  4DR4 Q;  2JA8 G;  5IYC H;  3U50 C;  3J7A 5;  2YTX A;  3G71 A;  1UE1 A;  3U4Z A;  4EX5 A;  4DV1 Q;  3B6Y A;  2E2I H;  2JA5 G;  2PI2 A;  1XMQ L;  3CAM A;  4BY1 G;  4R1J A;  5H1S E;  3M3Y H;  4GKJ L;  5C44 G;  3HOY G;  4JBW A;  1UE7 A;  2PMZ E;  4HIK A;  2ALY B;  2ASB A;  2JJQ A;  4DR6 Q;  2HQL A;  3J7Z C;  3U4V A;  4C3H H;  5ELO A;  1EQQ A;  1KRT A;  2UUB Q;  4A4I A;  5BR8 L;  4DR3 L;  3T1H L;  2UU9 L;  4IFD G;  3RR5 A;  1VQP A;  4GNX B;  3E9H A;  2BH8 A;  4YWK A;  1YJN A;  3HKZ E;  1A63 A;  4A3C G;  4R4C A;  1X65 A;  2R7F A;  1XJV A;  3HOW G;  1VQ9 A;  5J3B A;  3RNU A;  1N36 L;  1VQE A;  1X55 A;  1NJI C;  1VQH A;  4JOI C;  5GAG C;  1R9T H;  2KBN A;  3S24 A;  1LTL A;  2UXC Q;  4DV7 Q;  1D8L A;  3D0F A;  4POG A;  5GRO A;  3OW2 A;  3AQQ A;  4HIM A;  1VQJ A;  3BZC A;  3TQY A;  4B3M L;  2R92 H;  5M5X H;  1HR0 Q;  1B70 B;  2AKW B;  1IBL L;  3AFQ A;  1KRS A;  3KF6 A;  4IPC A;  1KIX A;  1SR3 A;  3PF5 A;  1YIJ A;  3K8A A;  4KLK A;  5IWA L;  1SE8 A;  1WOC A;  3S17 H;  1VQ5 A;  3A74 A;  1JE5 A;  3M4Q A;  1KD1 C;  2B63 H;  1LUZ A;  2MO1 A;  4BA2 I;  1L1O B;  1I94 L;  4R4I A;  4L5R C;  3KJP A;  3HOX G;  4HJ5 A;  3BZK A;  2KHJ A;  2OQ0 A;  1S72 A;  1HNX L;  1XNR L;  1N32 L;  1TWG H;  3CW2 C;  4GNX A;  1E7Z A;  2R93 G;  2BA1 A;  2E2H H;  4Y52 H;  1OXX K;  1MJC A;  1X9N A;  1Q46 A;  4R4T A;  4B3T Q;  5C4J H;  1DGS A;  2R7D A;  4JCV E;  1FVI A;  4BBR G;  2ID0 A;  3F8T A;  1KC8 C;  3H0G H;  1XNQ Q;  1VQF A;  1Y1V H;  3L2P A;  4MNO A;  3PO2 G;  5M5Y H;  1I6H H;  4OWT B;  4K0K L;  2Y0S E;  1VQ8 A;  1N34 L;  4YY3 Q;  1IBM L;  4OXP A;  3GTP H;  1HH2 P;  2K5H A;  1VQG A;  1PH9 A;  1PH8 A;  1HR0 W;  3RLO A;  1L0W A;  4LFA L;  4BY7 H;  4OX9 L;  4JV5 Q;  1NE3 A;  1VS0 A;  1Q1E A;  1X56 A;  2CWA A;  1C7Y A;  3PO3 G;  3PUZ A;  3DLL A;  4JI0 L;  1OXT A;  4JI8 Q;  5IP9 H;  2VZA A;  1TWH H;  5FJ8 G;  1UEB A;  4P72 A;  2UXD L;  4L5S A;  2WP8 J;  3AYH B;  2ZJR A;  1NTG A;  1E1T A;  3I4M H;  2N49 A;  2KHI A;  3EIV A;  4LUV A;  4A3F G;  2IHE A;  1GVP A;  2N8N A;  3CPW A;  4JI5 L;  4DR5 Q;  1PYS B;  4JI6 Q;  3I55 A;  1FJG L;  1L1O A;  4A3M G;  4UPA A;  1XPU A;  2LXK A;  1PH5 A;  1YJ9 A;  4GN5 A;  4DV2 Q;  4BXX G;  2JK8 A;  3J80 c;  4P71 A;  4R4O A;  5GAD C;  3HOV G;  3T1Y L;  1KL9 A;  4DR7 Q;  3RN5 A;  1JB7 A;  2YYZ A;  2R7Z G;  1I5F A;  4LUO A;  2VQF Q;  1VQ7 A;  1SMX A;  4QJF A;  2Z6K A;  4JI4 Q;  1S40 A;  4A3L G;  1V43 A;  1WCM H;  1U0L A;  4X62 Q;  4GNX C;  3RN2 A;  2VUM G;  3ERS X;  2RCN A;  1GO3 E;  4XTC S;  5AJ3 L;  4QY7 A;  3OTO Q;  2ZM6 Q;  3Q8D A;  1HNZ Q;  3S1R H;  3M85 A;  1T9H A;  2A8V A;  3JAM c;  4JC0 A;  2KCT A;  4X66 L;  4DV0 Q;  1NMG A;  2XTI A;  1XMO Q;  1PH1 A;  2CCZ A;  5K36 G;  4PZ7 A;  4BBS G;  3KF8 B;  2EIF A;  2VQE L;  3PV0 A;  4DV6 Q;  3E9I A;  5E7N A;  1NMF A;  4LF4 Q;  1K3R A;  1E24 A;  5M3M H;  1X6O A;  2NVX H;  1VQD A;  4X64 L;  3ULP A;  3AEV A;  1KHI A;  1EQR A;  4DUY L;  2I5L X;  4ME3 A;  3I4N G;  4B3R L;  5C4X H;  2ATW A;  4LF8 Q;  2VL6 A;  3VDY A;  3G4S A;  4A3J G;  4DV5 L;  4A3I G;  2D0O A;  1V9P A;  3S1N H;  1HNW L;  4A3D H;  2D0P A;  1L1O C;  2HHH L;  1H95 A;  2F52 A;  1Q82 C;  2WAQ E;  2NVQ H;  4OON A;  3PUV A;  4DV4 L;  2ZTC A;  4OO1 I;  1NBW A;  3I2Z A;  3I4O A;  4DUZ L;  2UUC L;  2JA8 H;  2C35 B;  1QVC A;  4DAM A;  1MIU A;  1HZB A;  4P74 A;  4YCW A;  3BU2 A;  4IPH A;  2Q2U A;  2Z6K C;  3KF6 B;  3CCV A;  2L15 A;  2JA5 H;  4HIO A;  5DLQ E;  2JA7 H;  4DR3 Q;  3T1H Q;  4X6A H;  2CKZ B;  4BY1 H;  1QZG A;  1ASY A;  3M4O H;  1ASZ A;  5HY6 A;  5M5W H;  5GAE C;  1TWA H;  3EN2 A;  1WYD A;  2K75 A;  5C44 H;  4IOC A;  3TRE A;  3G6E A;  4O0A A;  1YHQ A;  3HOY H;  2AWN A;  1N36 Q;  2E5L L;  1IBK Q;  1EUJ A;  4YHH Q;  1X54 A;  1J5E L;  3GTQ H;  3ZJY C;  3TS2 A;  1RIP A;  4X65 L;  5M3F G;  1I3Q H;  1K9M C;  3PIP A;  2Q2T A;  4RMF A;  4JI2 L;  4UY8 C;  2MQH A;  2Q2H A;  4B3S L;  4NXM L;  3HOW H;  2JE6 I;  4UP9 A;  3NEN A;  3J81 j;  3A0J A;  3HKS A;  3M4P A;  2ZJP A;  5HGQ A;  2A19 A;  2BA0 A;  2HIX A;  1TWC H;  2B29 A;  1TXY A;  1Z9F A;  4O2D A;  4HJ9 A;  1PA6 A;  5IWA Q;  3ICE A;  4BA1 I;  4LFB Q;  1G51 A;  3GDE A;  4NPS A;  4DAY B;  1Q81 C;  4DV1 L;  3K7U C;  2DGY A;  2RHQ B;  4QIW E;  2UXB Q;  1G6P A;  4HJ7 A;  4DV3 Q;  2YTV A;  1I94 Q;  5LMU Q;  1PH3 A;  1A0I A;  3SGI A;  1YZ6 A;  4GLV B;  3CCR A;  3S15 H;  4QGU A;  2JA6 G;  1VCI A;  5C3E G;  4P75 A;  1XNR Q;  3L0O A;  1VQK A;  5JJK A;  2NN6 G;  4AQY Q;  3K0X A;  2CFM A;  4L5Q A;  4DR6 L;  2NN6 I;  4GOP C;  4AYB G;  1LM0 A;  4PZ8 A;  2IHF A;  2UUB L;  3GD7 A;  4A76 A;  3KOJ A;  3DM3 A;  3HOX H;  3E0E A;  3WWV A;  1Q12 A;  1G29 1;  1K8A C;  4DR1 Q;  1VQB A;  4JI7 Q;  4EQ5 A;  1K8G A;  1IBM Q;  2R93 H;  1UWV A;  5LMN Q;  1YI2 A;  4LFA Q;  2V1C C;  1Q8K A;  3M9B A;  4BBR H;  2UUA L;  2HIV A;  1YEZ A;  3FKI G;  1BBW A;  5GAH C;  3PO2 H;  2OQK A;  4DV7 L;  1Y14 B;  5IP7 G;  2NZO A;  2QGQ A;  4JYA Q;  2UXD Q;  1PYB A;  2WB1 E;  4PG3 A;  4UP7 A;  5IT9 c;  3CC7 A;  1HR0 L;  5IY0 A;  2F4V L;  3F2C A;  2IT1 A;  1CKM A;  3PO3 H;  4J15 A;  4GKK L;  5IYB G;  3L7Z C;  4JI1 Q;  1B8A A;  4YWM A;  5FJ8 H;  4KHZ A;  1MKH A;  1VQI A;  2A1A A;  3K7A H;  1PHJ A;  1EWI A;  2Z0S A;  3G48 A;  4APV A;  4A3F H;  2EXD A;  3W5O A;  1CKO A;  4LFC L;  1K0R A;  2YV5 A;  4A3M H;  3A5U A;  2VW9 A;  1S3O A;  1VQC A;  3IRB A;  4NXN Q;  4BXX H;  4OWW B;  3EBE A;  1SN8 A;  3RLN A;  3HOV H;  1CSQ A;  1FGU A;  2JA9 A;  4LF7 L;  4MZ9 A;  5LMN W;  2R7Z H;  1JJG A;  3RZD H;  3HKZ G;  1XNQ L;  4LNQ A;  2OTJ A;  2IX1 A;  3ULL A;  4X66 Q;  3TRZ A;  1HZ9 A;  3FHW A;  1SFO H;  2VUM H;  4LF5 L;  3CCE A;  3CD6 A;  4IPD A;  4GLA C;  4JG2 A;  1VQM A;  2RHS B;  1UE6 A;  4GOP B;  1MJE A;  1A62 A;  4A3B G;  4A3G G;  2PI2 E;  4JBJ A;  3RZO H;  1UE5 A;  1XPR A;  3CCU A;  4QL5 A;  2BH2 A;  4JI8 L;  1NY4 A;  4ALP A;  4GN4 B;  1W2B A;  3CCL A;  1HZA A;  1CSP A;  3CC4 A;  4KHP L;  4BBS H;  4DK6 C;  4DR2 Q;  4DR5 L;  1HNW Q;  3CC2 A;  4HJA A;  4TVA B;  4JI6 L;  4QQB X;  4LUZ A;  1VQA A;  2CQO A;  2AWO A;  4IJH A;  1QZH A;  2VS1 A;  2HHH Q;  1E3P A;  3I7F A;  1K73 C;  3HOZ G;  4LF9 L;  4WJ3 M;  1OXS C;  1VQN A;  2FXQ A;  1PH2 A;  2F3I A;  1VQO A;  2KEN A;  4DR7 L;  4UP8 A;  3I4N H;  3S16 H;  2UUC Q;  4A3E H;  1Y1W H;  1EIF A;  2ZJQ A;  4A3I H;  4DNI A;  2ES2 A;  1LYL A;  1KQS A;  3CMA A;  5FLM G;  4JI4 L;  3H3V I;  2VY3 A;  3AFP A;  4X62 L;  1SLJ A;  1XMQ Q;  4OO1 G;  2AHO B;  3CF5 A;  3OTO L;  1YHA A;  4LF6 L;  1EFW A;  4GKJ Q;  1KXL A;  2D62 A;  2ZM6 L;  5C0X I;  3GO5 A;  3TS0 A;  4JI3 L;  3NBH B;  4GOP A;  4A3K G;  2Y0S G;  2KCM A;  4DV0 L;  4GS3 A;  1JJ2 A;  1VQL A;  3M7N A;  2OCE A;  1A8V A;  5BR8 Q;  1XMO L;  3W1G A;  5IYD G;  3BJU A;  2UU9 Q;  3KFU A;  2VNU D;  3NEM A;  4X65 Q;  3W1B A;  4JI2 Q;  3MXN B;  2I5M X;  4DV6 L;  3GTM H;  3GTK H;  2LXJ A;  2R6G A;  1EIY B;  3U58 A;  4AH6 A;  2DUD A;  3HOU G;  1YHB A;  4A93 G;  4IOA A;  1N33 L;  2IY5 B;  4YWL A;  1SRU A;  5IYC G;  1YIT A;  4LF8 L;  5M3F H;  3PGZ A;  3PUW A;  1I50 H;  3UDG A;  3S1M H;  4A3C H;  3K81 C;  1X3F A;  3PUY A;  1KAW A;  4FDB A;  1XTD A;  4B3M Q;  4H02 A;  2N78 A;  1PH4 A;  5IE8 A;  1PVO A;  2JA7 G;  1IBL Q;  3CQZ H;  2NZH A;  3CCM A;  5EAY A;  4DR4 L;  1W3S A;  2XGT A;  2ZTE A;  4JBM A;  1IXR A;  2AMC B;  4WJ4 A;  2JQO A;  3J81 i;  2QEX A;  1BKB A;  2IX0 A;  3PIO A;  4MTN A;  4R4Q A;  1M90 C;  1U5K A;  1PV4 A;  3CXC A;  5JEA J;  2I5H A;  4GN3 B;  2K5V A;  4JBK A;  1IYJ B;  1HNX Q;  3CCQ A;  3S2H H;  2JA6 H;  5C3E H;  1PH6 A;  4IFD I;  1N32 Q;  1WFQ A;  3STB C;  3PCO B;  2MNA A;  3CME A;  3FP9 A;  1WJJ A;  1CKN B;  3OYY A;  4YHH L;  1YJW A;  1IBK L;  1QUQ B;  2H5X A;  2UUA Q;  1OTC A;  1IL2 A;  5FLX c;  3K80 C;  2N3S A;  4XIG S;  4K0K Q;  2JEB I;  1N34 Q;  3S2D H;  3GTL H;  2R92 G;  1WI5 A;  5C0X J;  1X3E A;  1AE2 A;  3CCS A;  1BVS A;  2Q2I A;  2F4V Q;  4OX9 Q;  3RLF A;  1L2F A;  1GKH A;  3FKI H;  4JI0 Q;  2K52 A;  4GKK Q;  2UXC L;  4LFB L;  1JT8 A;  5IP7 H;  3PF4 A;  2K4K A;  2K50 A;  2UXB L;  2WAQ G;  4C3I H;  2B63 G;  2I0Q A;  2MFI A;  1YVC A;  1V1Q A;  4DV3 L;  3PSI A;  5LMU L;  2LSS A;  4JI5 Q;  1HJP A;  4LFC Q;  1FJG Q;  3KYH C;  1AH9 A;  4LWC A;  1SRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...