2RDFA

Crystal structure of staphyloccocal nuclease viagan/e75a variant at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
125
Chain Sequence
LHKEPATLIKAIDGNTVKLMYKGQPMVFRLLLVDIPKYGPEAAAFTKKMVENAKKIEVAFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQHLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Electrostatic effects in a network of polar and ionizable groups in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 125
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rdfA00
2EYOA 5EKLA 4N9PA 2ENBA 2F0DA 4H7BA 4TRDA 3T13A 5IGFA 3OSOA 4KJOA 4KY5A 5DAUA 5IGGA 3MHBA 1KDAA 4K8IA 1II3A 4QB4A 3DMUA 1STGA 5IIFA 4KD4A 4PNYA 4K5VA 3D8GA 2PW7A 2SNMA 5CV9A 5C3WA 5CGKA 3V2TA 1EYCA 2PZTA 1F2MA 2F0EA 2F3VA 1EY9A 2QDBA 5J22A 3ERQA 1ENAA 4IZ8A 2EY2A 3EJIA 4ME5A 3TP7A 2KQ3A 5HGTA 4PMBA 5IGBA 2SOBA 5E3FA 2HQEA 5C5MA 2EYPA 2M00A 3C1EA 1SNMA 1STBA 4K5WA 2PW5A 1SNPA 1STAA 2F0UA 4DU9A 4EQPA 5C6AA 1EYAA 5IODA 3TMEA 2F0PA 5CR3A 3MVVA 5CV5A 5JOBA 1TQOA 3H6MA 3NQTA 2EY5A 4ZUIA 3T16A 1JOOA 3TP6A 3TP5A 5IGEA 5KYIA 1F2YA 1JOKA 1STNA 1TT2A 5IGCA 3EVQA 5C4HA 3NP8A 5C4ZA 2F0FA 1A3VA 2NUCA 1SYEA 3P75A 4WRDA 3SK8A 5HURA 4S3SA 1EY6A 1EZ8A 1SNDA 4R8NA 5CV6A 1AEXA 4QMGA 4EQOA 4K14A 3SXHA 2O4XA 2RKSA 5CC4A 4E6IA 1EY5A 2OEOA 4K6DA 3SR1A 2F0NA 1KDBA 1RKNA 1SNOA 2F0VA 3EROA 4NP5A 1SYDA 2F0SA 4NDXA 4KTAA 5I9PA 3E5SA 1JOQA 5CV4A 5DEHA 1A2TA 1SNCA 3RUZA 2PYKA 4KY6A 5ISRA 3BDLA 4WORA 4MIUA 5EGTA 5JAVA 1ENCA 1EZ6A 3R3OA 3SHLA 5EKKA 4G57A 3OMCA 4ZUJA 5IGDA 1A3UA 5I9OA 2WACA 4QF4A 5KGUA 5NUCA 2F0QA 3NUCA 3S9WA 1A2UA 3P1HA 4RKBA 1STHA 1SNQA 2EY1A 5F2DA 4DGZA 2EY6A 1NSNS 2EYLA 3HEJA 4ZQ3A 4IUNA 4I65A 5E1FA 3TP8A 4KV6A 4DFAA 4J1MA 4ID6A 1JORA 1EQVA 3QOJA 3SK5A 3NXWA 3QOLA 2F0IA 3D6CA 1STYA 3MZ5A 1SYCA 3D4DA 5J1ZA 2EYFA 3PMFA 1KDCA 4IALA 4HTHA 4KD3A 3OWFA 5C5LA 4OL7A 4DF7A 5CV7A 5KRUA 2F0LA 2F0OA 1IHZA 2EYJA 3LX0A 3NK9A 4K2KA 2SNSA 2PQEA 4PMCA 1NUCA 3MEHA 3MXPA 1SYBA 2KHSA 4HMIA 4N9TA 4YIJA 1SYGA 2F0GA 3DHQA 3QB3A 4ODGA 4EQNA 4RKLA 3VA5A 5I6WA 5K5PA 1EY4A 3NHHA 4F7XA 1EYDA 2EYMA 2F0MA 1U9RA 4HMJA 1KAAA 1SYFA 2EXZA 2RBMA 1F2ZA 4K2LA 4KY7A 2F0JA 4K5XA 4KJNA 5J39A 2F3WA 3ITPA 1EY7A 3D4WA 5C3XA 1EY0A 5I6YA 4K8JA 5IOCA 2OXPA 2F0TA 3SK6A 3BDCA 2LKVA 4NKLA 1EY8A 1KABA 2OF1A 1A3TA 2F0HA 4B9WA 4EVOA 5KYLA 4F8MA 4KHVA 2RDFA 3OMGA 3SK4A 5KIXA 5M9OA 2F0WA 2EYHA 2PZWA 2PZUA 4J6HA 4LAAA 4B9XA 5CV8A 2F0KA 3C1FA 3U9OA 3HZXA 4NMZA 5KEEA 1TR5A
chains in the Genus database with same CATH superfamily
3HOXH 1BVSA 4DK0A 4C1NK 2KCMA 3I4NB 2NN6H 3ULPA 4KKTA 2HIVA 3T1YL 1DXMA 1QZGA 4KD4A 3D8GA 1L0YB 4PMWA 3S1QH 2F3VA 1Q7YC 2K5HA 4A3MG 1YJWA 2EOTA 3K81C 2R6GA 4OGQC 2KQ3A 1BDOA 3B6YA 5M3MG 1VQ8A 4LF9Q 4RGNA 4DV5Q 4DR6Q 4B3SL 4EQPA 5CV5A 5M5XH 1MSHA 3G48A 4YCUA 1M8AA 1TWGB 5IGCA 3U4VA 2F0FA 4WRDA 5M5YH 1UUPA 2K6AA 4IUVA 5LMNW 1EY6A 3CCJA 4K14A 4TSSA 2JEAI 2A68D 2YTXA 1SNOA 2A74C 3VR4A 1B9MA 3RZOH 1JOQA 2PO4A 4M1UB 4ZYSA 3HOXB 4DV4L 1G2TA 1EEFD 1PVOA 4O42A 3K80C 1I4QA 2EIFA 3C46A 4WJWA 1DZ1A 2IPKD 1NCVA 3S1QB 2O5JC 1PH3A 1R9TH 1BCPD 4ZQ3A 1CZWA 3BZCA 1YHAA 4C3HG 4H02A 2HHHL 2IX0A 2RVLA 3E9HA 2EPBA 2CW0D 1VQOA 3BDOA 4B3SQ 2A1AA 3VYUA 4JI4L 1D1KA 3NK9A 3WDNA 1VS0A 5M5XB 1G291 1K0RA 1AH9A 2HCIA 1EY4A 3CW2C 3J7A5 5C0XJ 3HOUG 1SE2A 1B2TA 5M5YB 2OTJA 3GTMH 3HGBA 4K2LA 1UWVA 1N8RC 2HT1A 2NVTH 3A55A 1Q3LA 4N8FA 2N3SA 4LNQA 1H9JA 4IPDA 3RZOB 4LFBQ 1YNXA 4F8MA 3SK4A 1ESRA 3A8KE 4J6HA 3WWVA 3W1GA 1CSQA 4GN4B 2HHHQ 2JA5H 3BZDB 2VNUD 3MHBA 1R9TB 1U4LA 3TQYA 3UE0A 1K0SA 5COYA 3TS2A 4OO1H 4PG3A 1CHPD 2A68C 1PH1A 4UP9A 1Y8NB 4L8JA 3L0OA 2EJFC 1GKHA 1S3OA 3CD6A 4JBMA 4LF5L 1SE4A 1Y1VG 2R93H 5C5MA 4WJ4A 2RDHA 1AZPA 3K5OA 3IKJA 4DU9A 4NPSA 1EU3A 1VQKA 2NVTB 2EVBA 1I4RA 2CW0C 1KNEA 3NP8A 1FGBD 3P75A 1LM0A 3W2DA 5IYCG 1AFPA 3H3VH 3NTIA 2LSSA 3D4RA 1Y8OB 2NVQH 4GLXA 3FRPB 5EBCA 4NDXA 3MAQA 3VYTA 2JA5B 4BY1G 2KVMA 3E0JA 2G9DA 3OMCA 1Y69U 1AW7A 2CWPA 2RDGA 2M2LA 4X3SA 1OXTA 1FJGQ 5GAGC 3Q24A 4I7ZC 4ZRZA 4DAVA 2F1MA 2E2IH 2E75C 4LF5Q 2IL8A 2I5LX 1SR3A 1JORA 4KN7C 4A3BB 4HEDA 2JEBI 2PI2E 1XNRL 4CKCA 5IYBG 1WCMG 3PMFA 3STBC 3RNUA 4GKKL 1I3QH 2XIWA 4AIMA 1FR3A 3CHBD 1ET9A 1SFOB 2E8GA 5M3FG 1WYDA 3VDYA 4PMCA 3LWEA 2KHSA 1OXUA 1SYGA 1NR4A 1WD0A 1JICA 1WTHA 3NTHA 1Q86C 4GZYC 1HUMA 1QILA 3A56A 3J80c 1XMQL 1LYLA 2NVQB 1H95A 4XT3B 1PYWD 4BXXG 2L5TA 1QVGA 1MKHA 2VY3A 3S2HH 4BBRG 1PH6A 1ASZA 1L0XB 2KCNA 4P73A 1HNWL 1U4PA 1HH2P 3T51B 5JJZA 5KEEA 1TR5A 1PHJA 2ENBA 4DPGA 4LF6L 3PO2H 2E2IB 1KDAA 4QB4A 1XNRQ 3FP9A 4DAYA 4GKKQ 1CI3M 3KDFA 4QUCA 1O78A 3H3VC 3OOCA 1PH2A 1XMOL 1GUWA 2K5QA 3A7AB 4LFAL 4DNRB 3RN2A 1I3QB 3PUWA 3J80E 1HNXL 3N6RA 1PLFA 5G3LD 3EJIA 1BNZA 1CKNA 1BR9A 2Q8IB 5CORA 2EYPA 1SJHD 1D6EC 1XMQQ 2P5ZX 1NMFA 1HJPA 3K58A 4U68A 1YNJD 2AKWB 3HOYH 1HFNA 3HOZG 5E4WC 2Z8LA 5D3IB 4B3ML 1JOOA 1JOKA 1HTPA 1S72A 2ZJRA 4RCOA 2K05A 2NUCA 1HNWQ 4P71A 2JN4A 3S2HB 2R7DA 4EQOA 1JWMD 3DUZA 3KF6B 1Y14B 2A6ED 4IN3A 1WD1A 3MXUA 4WFN3 4LF6Q 3TDQA 5KNBA 5C4JB 5DEHA 5A2QL 3S15H 3ERSX 3LNNA 4G4KA 4UP7A 3PO2B 3HKZB 2QF7A 4LFAQ 1PH8A 1HNZL 4YCWA 3S9WA 3K5LA 3S1MH 5C3EH 3V96A 4JBWA 2IWHA 2RA4A 3NXWA 4DNTB 2C9OA 1HZCA 3DM3A 1O7YA 2NVXH 3D4DA 4IFDI 1YVCA 3PUXA 3MFGA 4B3MQ 1B53A 1TWAH 1VQ4A 3LX0A 2CKZB 2EYJA 1K8MA 2PQEA 1D7QA 3A54A 3F1ZA 3MEHA 3HOYB 1SYBA 2ZTDA 4N9TA 3PIP3 2L11A 3D6WA 4DAPA 3GTQH 4MTKA 4FVMA 2MHVA 4KKSA 4B3RL 5JVG3 1TIID 3FKIH 3TRZA 3M9BA 2BA0A 3NEMA 3KYHC 1KABA 1HR0W 1LTRD 1K3RA 3GTJH 1HNZQ 4QUFA 1LO5D 3S15B 4FXGC 2JJQA 5GAHC 3HZXA 1YJ9A 2I5MX 5EBDA 2PCFB 4R1JA 2A19A 1K83H 5HGQA 5I2XA 4A3KH 1PRTD 4RHRA 2LMCB 5C3EB 4KJOA 3OYYA 5IGGA 5KNDA 1LT5D 2LXJA 1EIYB 4FF4A 5FOBB 5CV9A 1HQRD 2MQHA 2A6EC 3RMHA 1XYIA 1PH7A 5HY6A 2PZTA 1NY4A 2NVXB 4Y52H 1QZHA 3CPFA 4RFBA 1V1PA 5E7NA 1XX8A 4GLAC 2EQSA 4C3HH 3RD4A 1Z47A 2WKCA 4B3RQ 1SNMA 1SNPA 2F0UA 2OTLA 4JV5L 3TMEA 4A3GH 3RR5A 1EIFA 3H15A 3FKIB 2EZVA 3PO3G 1TS4A 4HCEA 2WV6D 1C0AA 1GD7A 1SJED 1EEID 3HG9A 5JPNC 1QOHA 2MGSA 2E2HH 3E0EA 5H1SE 3HOUH 3ZJYC 1SMXA 1U4MA 3GTJB 3GTOH 1LTBD 5K36H 3TSSA 3CMAA 3K0YA 4A3DB 4A3KB 2CWAA 2L55A 1GVPA 1HZAA 4HIDA 2K4KA 4G57A 1KIXA 3PGZA 2H5XA 3E6ZX 3G71A 3AB9A 5CBEE 1QWYA 5AFWA 1D8LA 4MZ9A 4ID6A 4X3TA 1QG7A 5C0XI 2J4XA 4C3HB 1C4QA 4JCVE 4JV5Q 1K8OA 2JA5G 3KBGA 1F9RA 3IL8A 5CV7A 2K50A 1IHZA 4HN7A 1ILPA 1YIJA 4A3GB 2A5HA 4A3LG 1CKMA 2MNAA 2VL6A 4ILWA 4AH6A 2KCTA 1Y1VH 2IX3A 2B2WC 4A3BG 1K8AC 1ASYA 1TXYA 4QGUA 3F2DA 3HOUB 3GTOB 1EOVA 1MI2A 1LT4D 4DV2L 2R7ZH 4GS3A 4CKEA 2F0HA 4FYDA 1GUGA 1Q81C 2F0WA 3MXNB 5IYCH 2F0KA 2RCNA 3FEWX 2PPBC 1JQYD 1VF7A 3CCUA 3IFTA 1SMYD 5DAUA 1MBYA 1E24A 3DLLA 4BY1H 1WTRA 4UY8C 3GTKH 5CGKA 2XTIA 2PW7A 5C4XG 4CDCC 2K14A 2F0EA 1ESFA 1V9PA 4RGTA 5L37A 1EL0A 2R3ZA 3GTPH 2MP1A 3MTSA 3VR5A 4IJHA 1STBA 3DM1A 3HKSA 1STAA 1Y1VB 1UE1A 5IYBH 1YI2A 4DV2Q 1V1QA 2N78A 2PQAB 3MXGA 1LACA 4IFDG 3PUVA 4FF3A 5C4HA 4GOPA 2R7ZB 1DOMA 5EKIA 3K5NA 4YWLA 2RSOA 2OWOA 3OW7A 5BN4A 4DV0L 1H9SA 1GO3E 4XYQA 2PYKA 2B2WA 4LMQD 4H44C 2HUGA 1IL8A 4C3IG 2O2LD 1I6HH 2BDNA 2E76C 3GTKB 1Q8KA 2NB0A 3LGJA 1TS5A 5LMUQ 1QUQA 2CQAA 4L63B 4HIKA 1R4QB 1WTPA 1RL2A 4A3JB 1VQAA 2A73B 1TVXA 4KMUC 1L1OB 1KDCA 2ZXPA 1BO0A 4DAMA 1SMYC 3A8IE 1CK1A 3RZDH 2MUYA 4NW2A 4QJFA 4JG2A 4C56C 3MXPA 1BUVT 3BVMA 1GXDC 2F0GA 2FFKB 5C44G 2JK8A 2ZJQA 2IY5B 1QB5D 2F0MA 3BS1A 4DV0Q 1KAAA 2EJMA 3HKZE 4LUVA 1NNXA 1H9RA 3AMUA 3PF5A 3D4WA 2DY8A 2JA6G 3MXNA 3HOZH 3NPPA 1EY8A 4JI5L 1L1OC 4U673 3HOYG 3MC0B 1VQDA 4LF8L 1I6HB 3AU7A 2EYOA 1T5XD 1BOSA 4BA2I 3NQIA 1EU4A 3KOJA 1PDQA 3BG3A 1JWUD 2FHTA 3PCOB 1IYUA 1SXTA 5ELDA 5IWAL 3D0FA 1RD9D 2HD3A 3JC66 2KA7A 2L4NA 5BR8L 3RZDB 2Q2TA 2HDMA 1IL2A 2E2DC 4P2CB 3CCVA 1CQFA 3P20A 1XNQL 3PIO3 3ONAB 1CT1D 2VUMH 4JI5Q 4UPAA 3GP7A 2L1BA 1VQPA 3HOZB 5JJKA 4MHEA 3H0GH 4R8NA 4LF8Q 5CV6A 1UNSA 2XRSD 1WTOA 1VQLA 1ICWA 4ZCKA 3BJUA 1LTSD 2OCEA 1GM5A 1ILQA 1WFQA 5CV4A 5IYDH 1A0IA 2AQ2B 1EQTA 2JSOA 5IWAQ 3FKIG 4OWWB 1JCKB 1FD7D 2WAQB 3HOVG 3DEOA 4IPGA 1XPUA 4R9WA 5BR8Q 1Z9FA 1CM9A 2EY1A 4DGZA 3ULJA 3R2IA 3F2CA 4UP8A 5DM63 1L1OA 2KOLA 2KENA 2MJ8A 1QVCA 1IBKL 4LFCQ 3IFDA 1SYCA 5KNCA 3SDZA 1X6OA 3KUPA 4FDBA 1XNQQ 4A3KG 4A3DG 1HUNA 4ALPA 4IURA 1X55A 4K2KA 4POFA 3T1YQ 2VS1A 4ZK9B 4HIOA 2Y0SG 1NE3A 2JA7G 3UE1A 2VUMB 3A5UA 4JVZA 4EQNA 4RKLA 4XTCS 1B9NA 1BCPF 4F7XA 1HPCA 1I50B 3RLOA 2B2VA 2H1EA 3CU7A 3H0GB 1EY7A 2D0OA 2OXPA 3SK6A 1BBWA 1PH5A 3QG1A 1IYVA 1B44D 1UAPA 3NSWA 3OMGA 2NZHA 3PO3H 4A3GG 1STEA 3J7AF 3PUYA 3QO2A 3U9OA 2L15A 3BYTB 1I4GA 4KN4C 1JJCB 1NAPA 3OPOA 1FGUA 3EIVA 2LS01 1RTOA 1TS3A 1KXLA 2F52A 1B7YB 5IIFA 3I55A 4MNOA 2ICIA 2VZAA 3DWQA 4APVA 3KFUA 5K36G 4R4CA 4H0LC 3NTKA 1WI5A 5JEAG 4DV4Q 4JW0A 3PSIA 4JI6L 4ME5A 5IE8A 3M85A 2UUBL 1B4OA 2X6LA 2LY7A 1VQ9A 1MSGA 1BF4A 1IBLL 1LT6D 1VDZA 3GV3A 3STBD 3I4MB 2LXKA 4OXPA 5D14A 3FVQA 3NQTA 1JJGA 3L2PA 1WOCA 3OIQA 1VQ5A 1TY0A 4A3LH 1CTMA 4BA1I 5IT9c 4MTNA 4YCVA 3D31A 4CJ0B 4DV7L 4JI4Q 4IOCA 2O4XA 2N88A 2JA8G 3PO3B 3NENA 4QY7A 1SN8A 4DAYB 3KDFB 1TKWB 4R4IA 4A3BH 1PFMA 5A2QE 4DN4M 3QWNA 2MO1A 4IPHA 3BDLA 3KBXA 1NBWA 4L5TA 4ULLA 2L12A 5EGTA 1IZ6A 1V43A 3SHLA 2K03A 5DLQE 1IW7C 1SFOH 1CKNB 2WFWA 4QF4A 2R7ZG 2K5WA 2YV5A 4JI6Q 2EYLA 1B3AA 2I46A 4I65A 3QOJA 1Z6HA 4HJ9A 3BVGA 4O1NA 3RLFA 1EOTA 1IBLQ 2R92H 1HA6A 2C35B 1X54A 1PXUA 1VQIA 2KUMA 4C3JH 5IT9E 3VYSA 4DR2L 2YTVA 2UUCL 5C4XH 4HIMA 3CC7A 3S1NH 1X9NA 2G9HD 4DV7Q 1VQBA 2X6GA 3W3AA 4JI7L 5EAYA 1PZID 1K73C 4R4QA 2F3WA 1B3QA 4A3JG 1A63A 3HOWB 2EE1A 3I8ZA 2ID0A 3BDCA 1KQSA 1B70B 4QIWB 2OQ0A 3X3MA 3CF5A 2QA4A 4IFDH 4FF1A 2PZUA 1BBXC 2XGTA 3I90A 3DXJC 4L6TB 1C9OA 2E74C 4RCNA 3MEFA 1UE5A 3AFQA 3S14B 4DKAC 2NZ1D 4DR2Q 2UUCQ 2R92B 2B2TA 2JP1A 5ELCA 1CA5A 4C3IH 1DD2A 3S1RH 4C3JB 1Q1EA 2G5DA 5T1IA 4IJLA 1VQJA 5C4XB 5GROA 2B63B 1JMCA 1BXTA 1OTCA 4JI7Q 3S1NB 4A3CH 3EBEA 2HQEA 4NXNL 2GN5A 4HJ8A 1I4PA 3QR8A 4K5WA 1CHQD 3MWYW 5C4JH 3CRLC 5C6AA 1Y8PB 5IODA 3H6MA 4BS9A 3EA6A 1AE2A 4R4TA 3R8BA 2ZJPA 2QCPX 5HURA 1S5CD 1IKMA 4N8X1 5G3LF 5C44H 2RKSA 4M8AA 1BQQT 3CCRA 1VQFA 4LF7L 2DGYA 2JA6H 4RGOS 1N33L 1E2VA 5CYUA 3UDIA 4PV1C 1LTAD 1V1PB 2TSSA 2JE6I 2VB3X 5IGDA 2XWBB 2YU9H 5KGUA 3KLSA 3URYA 2DUDA 4C3IB 3S1RB 1OXVA 2ZTCA 2B29A 3TP8A 1Q8IA 3QJYA 4NXNQ 4A3FH 1HZBA 3QOLA 1JB7A 1X56A 1RHPA 1D5MC 4KI0A 4DV6L 2K32A 1TY2A 1SSOA 2WP8J 4PZ6A 3GDEA 4X6AH 3BZKA 4OELB 2WAQG 1VQGA 2KECA 1DGSA 1XMOQ 1CFMA 2Z6BA 4R4OA 4JBJA 2ZTEA 2WAQE 3CCEA 2GVAA 2QEJC 2SEBD 5C44B 1HNXQ 4LF7Q 5I6YA 5IOCA 1N33Q 3S17H 1EFID 2AQ3B 2N8NA 5C0XH 4CHTB 2JA6B 4A75A 3OW2A 2FJ2A 5KIXA 3IRBA 5IT9L 2VUMG 2JQOA 1ONLA 3A8JE 3I3CA 3JAML 3G4SA 2YU9B 3K8AA 3GQBA 4N9PA 3KJOA 4RAUC 3NBIA 2BOSA 3R93A 3H0GG 1KNAA 1DM0B 5D65A 1F9SA 4CKBA 5E4XA 4DV6Q 3DMUA 4LK1C 5C3WA 4A3FB 5LMNL 1M4VA 1XTDA 4TQUS 4HSPA 1YHQA 1G8ZD 5IYDG 2ATWA 3HOVH 4DK6C 2WIIB 1RCVD 3I7FA 1Q82C 2GA4B 3J81i 2XSCA 4POGA 4QQBX 1F2LA 1PRTF 2SOBA 5FO8B 1ZEQX 4A3DH 5EPKA 1O7LA 3VR2A 3UDGA 4GN3B 3T56B 4B08A 3EVQA 3EN2A 2DJFC 3P7JA 3S17B 5FLMG 2BE5C 1J9OA 2JA7H 4MN3A 4S3SA 1K8GA 5CBAE 1C7YA 3C3LA 1LLRD 3EROA 4OEMB 5JPMC 3S2DH 4KTAA 3E5SA 3I4MG 4JOIA 4DUYL 3FPPA 4A93B 2HQLA 5LMNQ 1ENCA 1NR2A 3R3OA 5EKKA 1A3UA 5I9OA 1O7IA 4JI2L 2KBNA 2OQKA 4J8QA 3D3RA 1MJCA 1LV9A 1HHVA 4YHHL 3HOVB 4J1MA 4LF4L 3RN5A 4FXDA 3N52A 3G7LA 3TZDA 4KHZA 2Z4IA 4OIJA 2AUKA 4ME3A 4GOPB 4K6LA 5ELEA 1TWCB 2CVRA 2Q2UA 2F0LA 2GVBA 4C1NI 1M1KC 5JEAH 3L7ZC 4CDFC 1E0BA 2IT1A 4PZ7A 1H9SB 4B3TL 1EYDA 3BU2A 4G7ZC 2Y0SB 1W6JA 4YWMA 3CCQA 2JA7B 3CPWA 1ENFA 2D2CC 2B8FA 1N9WA 5C3XA 1X3EA 4DUYQ 2UXDL 5BN5A 1VQHA 2LKVA 3KLRA 4XIGS 2MO0A 1F9QA 3S2DB 2Q8TA 2OF1A 2L0CA 1T9HA 4EVOA 2AUJD 1QUQB 4JI2Q 1GUSA 2RDFA 4GOPC 4GKJL 1XPRA 2BH2A 5ELNA 4B9XA 1M90C 3BVZA 4XQNA 2QDLA 2JA8H 4AQYL 4YHHQ 4JYAL 2F0DA 4H7BA 4TRDA 4LF4Q 3OSOA 2WINB 3CKIB 4GNXA 4L5SA 1E1TA 4DK1A 2ES2A 3F8TA 3HOWG 2D9UA 1EYGA 1PTOH 2ZM6L 1EYCA 3J81E 1PTOD 2Z6KA 1YJNA 3PF4A 1GHKA 4TKOB 2RF4A 3K57A 3OHXC 3VA7A 1CZGA 2EY2A 4B3TQ 2R7FA 4EQ5A 2F4IA 4QIWE 1W6KA 1U5KA 2R61A 2K5VA 5LHY1 1BKBA 2F3IA 2UXDQ 3E9IA 3GTGH 2R92G 3GD7A 1DJRD 3MFYA 1PZJD 4GKJQ 4C3JG 5C4ZA 2MPMA 4ZKBB 3GTLH 1RIPA 1L0WA 1SNDA 2B63G 3G6EA 4AQYQ 4E6IA 1UEBA 4JYAQ 3K7UC 1KDBA 1KD1C 3RLNA 1H9MA 5ELOA 4A3JH 1E3PA 2JA8B 3L9AX 1TWHH 1SBBB 2ZM6Q 5JAVA 3PQIA 1EZ6A 1YEZA 2YTYA 1DOKA 1PTOB 1S40A 2Z4HA 1AZQA 2WB1G 4PQXA 1VMPA 1UEAB 4P75A 4TVAB 4A3IH 1EFWA 1KLUD 2AMCB 5FLXE 1VQ6A 1XPOA 3MZ5A 1NJIC 2D5DA 1RJTA 1X32A 2J0TD 1MGSA 3LWUA 3OWFA 3NWSA 4GN5A 2DNEA 4KHPL 3GTGB 4JK1C 4HMIA 1GHJA 4JI0L 4HSVA 1KTKA 3PUZA 2VQEL 2SDFA 4OWXB 1PTOC 3I2ZA 3ICEA 3GTLB 2EXZA 3TEHB 2RBMA 1I94L 5DNFA 3TBIB 4PZ8A 1EY0A 4XQJA 4X62L 5I4DA 2DN8A 4A3CG 4IQZA 1D1IA 3NBHA 3I72A 1K9MC 2B2YA 1HFGA 3CC2A 1TWHB 4KHVA 1C8CA 5AJ3L 4BBSB 4HCSA 1I5FA 2PZWA 4IOAA 1PZKD 1N36L 1E2ZA 2EDGA 1SRUA 1ZKOA 4A76A 3CQZB 4Y7NB 2DY7A 3M4YA 1Q12A 4DV1L 4A3IB 3KK7A 5IP9G 4PNYA 3M4OH 1GJXA 1CSPA 2CH4W 2KHIA 1F2MA 1VQ7A 2KCCA 1CKOA 4RGMA 4JI0Q 2AHOB 4AYBG 4JPBW 2VQEQ 4OWTB 5IGBA 5IP7G 2M00A 4NB3A 1FYCA 4X3UA 2KEEA 1JR0D 4ZUIA 2EY5A 4A3FG 4HAEA 5FJ8G 4X64L 5CMDA 5AJ3Q 2AWNA 3IAYA 3C2PA 1N36Q 3KF8A 3TREA 5I2YA 3J81L 1G51A 2OEOA 2B2VC 2F0VA 4NP5A 2VXWA 3U50C 2UXCL 3TZUA 4DV1Q 4L5QA 3RUZA 4KY6A 4F88A 2NBFA 2CFMA 1GUOA 1D5XC 2F0QA 3M4OB 4FNFA 1VF5C 1A2UA 1KHIA 5C0XG 1STHA 4IFDJ 1IBML 1I50H 4KK7A 4IPCA 4FXKC 1X3QA 2IW3A 3F2UA 1Q1BA 1HR0L 4IALA 4Q0FA 1JE4A 4HTHA 4A93G 1O7ZA 1A15A 2B39A 2Z0SA 4X64Q 3J81j 1W2BA 1FVIA 2IHEA 1HTLD 4BY7G 4I7AA 1U9RA 3TN2A 3VR3A 2F0JA 3CCLA 4DNIA 2A69D 2EXDA 2UXCQ 1SLJA 1H9KA 3KLWA 1LT3D 1B1ZA 4X65L 4O2DA 5FLXL 2E2JH 5FLMH 4LAAA 1I4XA 1IBMQ 5EKLA 5IGFA 2PI2A 3I4MH 1AP0A 3SGIA 3JAMi 1STGA 2NZOA 1HR0Q 1VQNA 5LL6X 4DR3L 1IW7D 2BDOA 2Y0SE 1Q46A 1SE8A 3Q8DA 2I07B 1EY9A 1XXGA 1WTWA 2B2UA 1ENAA 2AWOA 3UDFA 3KLSX 5M5WH 1PYSB 1TS2A 4PMBA 4YY3L 4RA8A 1XTCD 1EQQA 4IUUA 2QKIC 3OIPA 3K59A 3F2BA 4LFBL 1FNWA 1P16A 4X65Q 1TQOA 2ZT9C 1IBKQ 1HXYD 2MFIA 3W5OA 1PA6A 1FNUA 4EGVA 1EWHA 1QNKA 1DONA 2RHSB 2K04A 4CDEC 1V1OA 4V0BA 2E2JB 2JA9A 2F0NA 1JB3A 5EJWA 3CCSA 1B8AA 2L9HA 2A6HC 2PNHA 1EWIA 3K7AH 3PV0A 2JYOA 2D0PA 3I91A 5ISRA 4DR3Q 1HCZA 1PFNA 1ZXTA 2A69C 2QGQA 1X3GA 3HRZC 2H4OA 1JC7A 1SEBD 2VQFL 1X65A 3HFZB 2E5LL 3CXCA 1NSNS 4YY3Q 1XWEA 1C48A 1JJ2A 1EQVA 3SK5A 3BYYB 4Q5VA 4ZLTF 3JAMc 5M5WB 3HOWH 5EPLA 1U4RA 3Q22A 1SE3A 5DM73 4KD3A 5C5LA 2B2TC 4P72A 2F4VL 3Q23A 2F0OA 1BCPB 5LL6S 4JI3L 1BBUA 3VA5A 2OT2A 5TSSA 2NN6I 1PMRA 3SEBA 1WTQA 1VQEA 3EQLC 3W1BA 3S14H 3ITPA 2PMZB 4ZAIA 2ZXRA 2K52A 3ULLA 2F0TA 2UUBQ 3T53B 1F9PA 1DYQA 1FJGL 1ICFB 3I4LA 5T1GA 1OXXK 2FINB 3FDTA 3K7AB 2BCOA 3A74A 4B9WA 2K1BA 1VMCA 3FHWA 4DA2A 2I0QA 4RH6A 3JAME 2B63H 3PIPA 2VQFQ 3ND8A 2E5LQ 1UE7A 1GUNA 3J80i 4A3EH 4G7HC 1HQMC 1BCPC 3CAMA 3GTMB 4CJ2C 2BH8A 1T5EA 4H13C 1PYBA 1LUZA 2F4VQ 2ZXOA 2X69A 4KLKA 5A35A 5D3DA 1FNVA 4BBSG 3I56A 5J22A 4JI3Q 3U9SA 3FPUB 1W3SA 1SAPA 1A62A 1R4PB 3TP7A 4HR7B 5HGTA 4JI1L 1A8VA 1X3FA 4A3IG 2FMCA 3ND9A 1ET6A 5CR3A 3WOFA 2UUAL 1E7ZA 2Q8RE 5KYIA 1G6ZA 5ELBA 2FMMA 2C5CA 1TT2A 1WTVA 4IUQA 1AE3A 3VR6A 2IHFA 2VW9A 1PH9A 1G6PA 1EZ8A 5JEAJ 1LTID 1S5ED 4YWKA 4C2MH 3SE0A 1EY5A 4K6DA 4HJ5A 4R8IA 2R93B 1SYDA 2ALYB 4A3EB 1FL0A 1QE6A 4WORA 4DXFA 4ZUJA 3K5MA 4OIKA 5FO9B 3CC4A 1D2BA 4G7OC 1A6XA 1YZ6A 4JI1Q 2NVYH 2HCCA 2Q2HA 3FMCA 3K0XA 3HP3A 1KAWA 2WB1B 3Q6SA 2F0IA 1I4HA 1X3PA 2XNAC 2DNCA 3AFPA 5IP9H 3NELA 4RWSC 2UUAQ 4DF7A 4ABNA 1SROA 1EIHA 3DWAA 3CMEA 1PH4A 3GO5A 4YIJA 1IXRA 1GUTA 3M4PA 4CDDC 2IX1A 4OO1I 1F2ZA 5IP7H 3CCMA 1OXSC 4C2MB 2K5NA 1EQRA 3T1HL 3M7GA 4DV3L 5FJ8H 3A0JA 1AN8A 2BE5D 1TWFH 4V190 1HRJA 2EYHA 4K0KL 1O80A 1EUJA 1J5EL 3I4NG 5J39A 2V1CC 1KRSA 1Z7TA 1ZYRD 4HJ7A 4FF2A 3VYRA 3T13A 1Y1WH 1LABA 4KY5A 1WTXA 4O0AA 1Q90A 2NVYB 4JOIC 4K5VA 3I73A 1JWSD 2UXBL 1TU2B 3H3VI 4LUOA 2ICEC 2K75A 3H91A 2QDBA 3M3YH 4XDXA 1LTTD 1RTNA 2CQOA 4CGYB 5E3FA 5FKAC 5EPJA 4AYBB 2PW5A 3T1HQ 4NXML 1EYAA 3MVVA 4LW1A 4DXGA 3A5ZB 2K28A 4IO9A 4A93H 5JJLA 4DV3Q 1F2YA 1STNA 4WJ3M 1GOZA 3UDXA 3SK8A 4LUZA 1KL9A 4K0KQ 4GNXB 1J5EQ 3U58A 1AEXA 2B3GA 3J7ZC 2CCZA 4BY7H 1TWFB 3DEPA 1ML0D 1QCBD 1UE6A 3HOXG 2N49A 2NN6G 2HIXA 5I9PA 3ER0A 4A3MH 1Y1WB 4MIUA 2UXBQ 1TWCH 2DJGC 3Q0AA 4Z9CB 2EJGC 4F87A 3CRKC 3MA2B 1QNUA 5M3MH 4QL5A 4UAIA 3NUCA 3P1HA 4RKBA 4XT1B 1SNQA 3EFXD 1D5ZC 2K33A 2EY6A 3M3YB 3AYHB 4GNXC 3D6CA 1PFBA 1STYA 4NXMQ 1KC8C 1N32L 5J1ZA 2EYFA 1ZYRC 5GADC 4DUZL 1L2FA 1YNJC 1VQMA 3GV6A 3J7AV 1EWCA 2Z6KC 1CUKA 1EIGA 3CP0A 2SNSA 1DOLA 3S1MB 2Z9HA 2J7ZA 4ODGA 2V4DA 4XXEA 3NWTA 5K5PA 3X3NA 1SYFA 1NTGA 4RMFA 1CA6A 3V05A 4K5XA 4BY7B 2VB2X 2D62A 1LTGD 2ASBA 4K8JA 3SVMA 1TWAB 4DR4L 3HS0C 5KYLA 4A3MB 1N34L 5ELFA 4NMZA 3GTQB 5M3MB 2BA1A 2YYZA 4L5RC 1KLGD 1OO9B 1XJVA 4FP5D 3J81c 2IJ0A 2QW7A 1II3A 3K6OA 3KF6A 1N32Q 1VQCA 4DUZQ 2QILA 1K28A 4UHVA 3V2TA 2PMZE 4P74A 5FK9C 3G6JB 4DK3C 4LWCA 1PRTB 2NTTA 3J80L 2KHJA 1K83B 1JE5A 3NBHB 1DCZA 4X66L 1I6VC 1PTOF 3TP5A 3I4OA 4DR4Q 3WOEA 5BN3A 4DR1L 1N34Q 1SYEA 1U0LA 2K01A 3DWPA 4QMGA 3SXHA 2WKDA 5CC4A 1S5DD 4J15A 3QIAA 2LFNA 3H09A 1LTLA 2F0SA 4HJAA 1PRTC 1A2TA 1MD2D 1SNCA 2HDLA 5GQOA 2F03A 4OO1G 1RF2D 3UI2A 1F77A 4A4IA 3PIOA 2B2YC 1G2SA 1IKLA 2WACA 2N55A 5NUCA 1NMGA 1WJJA 5FLXc 1K3BC 5F2DA 2E2HB 3HEJA 4IUNA 4DR5L 1JT8A 1RDPD 2R93G 1WVLA 2O5IC 2UU9L 3OTOL 3OWEB 1YNND 3AQQA 4A3EG 1S5BD 1PFSA 4X66Q 3S16H 3KF8B 3I70A 4DR1Q 1MJEA 4JC0A 2I5HA 4BBSH 2RCFA 1QJOA 3QB3A 3KJPA 2K7VA 2EYMA 4EX5A 5JVH3 2KJXA 4OX9L 3CQZH 4KY7A 2KEDA 4Y7NH 3AEVA 4LJZC 1YHBA 2CHBD 5FO7B 1MHWC 2TMPA 2NWGA 1RODA 1A3TA 2WB1E 2QEXA 5LMUL 5M9OA 4XYOA 4CJ1B 4FO2A 5CV8A 1P8LA 2JXMB 3M7NA 3ZYYX 4DR5Q 1WCMH 2AQ1B 2UU9Q 3OTOQ 5GAEC 4K8IA 3L3OC 5M3FH 2NTSA 2SNMA 5JJIA 3S16B 3ERQA 1J8IA 4IZ8A 2XN9C 2CH4A 1G91A 2RQXA 4JI8L 4OX9Q 4X3KA 2Q2IA 1QVFA 1S4ZA 3C1EA 1KRTA 4BXXH 4BBRH 1PV4A 2F0PA 4BY1B 5JOBA 2XVSA 3TP6A 2Z1CA 2A6HD 3T16A 3U4ZA 5IGEA 3R2TA 1S5FD 1YNNC 4UDUC 1A3VA 4ZKCB 1IYJB 4KHPQ 4RHSA 4KKUA 2A8VA 4RG1A 3O13A 3GTPB 4BWGB 3T4AC 3SR1A 1RKNA 4DR7L 2M9VA 1SDFA 3E3XA 3PO2G 3HKZG 1YITA 1WCMB 4CBVA 3H94A 1I94Q 1MIUA 5J3BA 3M4QA 1E2WA 4OHJA 4OONA 3TS0A 4X62Q 5M3FB 4AYBE 3J7YW 1VCIA 3I4NH 2K5DA 1E1OA 1V8QA 5E1FA 4KV6A 4JI8Q 4DFAA 2NYZD 1CQVA 1J6QA 2XRQD 1HA5A 1HZ9A 1Y1WG 5KRUA 3S24A 4OL7A 3A7LA 4QCLA 2B8GA 4BBRB 2RSNA 1NUCA 2B2UC 3DHQA 5I6WA 5IY0A 2RHQB 2XWJB 3NHHA 4IUPA 2FXQA 1E22A 4HMJA 4IUTA 4DR7Q 4LF9L 4KJNA 4DV5L 4DR6L 1YBYA 1TWGH 3NE5B 4NKLA 5EQ0A 2PNRC 5C3EG 3C1FA 4JBKA 2PQAA 4LFCL 1B50A 4XQQA 4GLVB
chains in the Genus database with same CATH topology
4DK0A 4C1NK 3I4NB 2NN6H 4KKTA 1DXMA 4KD4A 3D8GA 1L0YB 4PMWA 2F3VA 2EOTA 2R6GA 4OGQC 2KQ3A 1BDOA 4RGNA 4EQPA 5CV5A 1MSHA 1M8AA 1TWGB 5IGCA 2F0FA 4WRDA 1UUPA 2K6AA 4IUVA 1EY6A 4K14A 4TSSA 2JEAI 2A68D 1SNOA 2A74C 3VR4A 1B9MA 1JOQA 2PO4A 4M1UB 4ZYSA 3HOXB 1G2TA 1EEFD 4O42A 1I4QA 3C46A 4WJWA 1DZ1A 2IPKD 1NCVA 3S1QB 2O5JC 1BCPD 4ZQ3A 1CZWA 4C3HG 2IX0A 2RVLA 2EPBA 2CW0D 3BDOA 3VYUA 1D1KA 3NK9A 3WDNA 5M5XB 1G291 2HCIA 1EY4A 5C0XJ 1SE2A 1B2TA 5M5YB 3HGBA 4K2LA 3A55A 1Q3LA 1H9JA 3RZOB 4F8MA 3SK4A 1ESRA 3A8KE 4J6HA 3BZDB 2VNUD 3MHBA 1R9TB 1U4LA 5COYA 4OO1H 1CHPD 2A68C 1Y8NB 4L8JA 2EJFC 1SE4A 5C5MA 2RDHA 1AZPA 3K5OA 3IKJA 4DU9A 1EU3A 2NVTB 2EVBA 1I4RA 2CW0C 1KNEA 3NP8A 1FGBD 3P75A 3W2DA 1AFPA 3NTIA 3D4RA 1Y8OB 3FRPB 5EBCA 4NDXA 3MAQA 3VYTA 2JA5B 2KVMA 3E0JA 2G9DA 3OMCA 1Y69U 1AW7A 2RDGA 2M2LA 4X3SA 1OXTA 3Q24A 4I7ZC 4ZRZA 4DAVA 2F1MA 2E75C 2IL8A 1JORA 4KN7C 4A3BB 4HEDA 2JEBI 4CKCA 3PMFA 2XIWA 1FR3A 3CHBD 1ET9A 1SFOB 4PMCA 3LWEA 2KHSA 1OXUA 1SYGA 1NR4A 1WD0A 1JICA 3NTHA 4GZYC 1HUMA 1QILA 3A56A 2NVQB 4XT3B 1PYWD 2L5TA 1L0XB 2KCNA 1U4PA 5JJZA 3T51B 5KEEA 1TR5A 2ENBA 2E2IB 1KDAA 4QB4A 4DAYA 1CI3M 4QUCA 1O78A 3H3VC 3OOCA 1GUWA 2K5QA 3A7AB 4DNRB 1I3QB 3PUWA 3J80E 3N6RA 1PLFA 5G3LD 3EJIA 1BNZA 1BR9A 2Q8IB 5CORA 2EYPA 1SJHD 1D6EC 3K58A 4U68A 1YNJD 1HFNA 5E4WC 2Z8LA 5D3IB 1JOOA 1JOKA 1HTPA 4RCOA 2K05A 2NUCA 3S2HB 4EQOA 1JWMD 3DUZA 2A6ED 4IN3A 1WD1A 3MXUA 4WFN3 3TDQA 5KNBA 5C4JB 5DEHA 5A2QL 3LNNA 4G4KA 3PO2B 3HKZB 2QF7A 3S9WA 3K5LA 3V96A 4JBWA 2IWHA 2RA4A 3NXWA 4DNTB 2C9OA 1O7YA 3D4DA 4IFDI 3PUXA 3MFGA 1B53A 3LX0A 2EYJA 1K8MA 2PQEA 3A54A 3MEHA 3HOYB 1SYBA 4N9TA 3PIP3 2L11A 3D6WA 4DAPA 4FVMA 2MHVA 4KKSA 5JVG3 1TIID 2BA0A 1KABA 1LTRD 4QUFA 1LO5D 3S15B 4FXGC 3HZXA 5EBDA 2PCFB 5I2XA 1PRTD 4RHRA 2LMCB 5C3EB 4KJOA 5IGGA 5KNDA 1LT5D 4FF4A 5FOBB 5CV9A 1HQRD 2A6EC 3RMHA 1XYIA 2PZTA 2NVXB 4RFBA 1V1PA 1XX8A 3RD4A 1Z47A 2WKCA 1SNMA 1SNPA 2F0UA 3TMEA 3FKIB 2EZVA 1TS4A 4HCEA 2WV6D 1SJED 1EEID 3HG9A 5JPNC 1QOHA 2MGSA 1U4MA 3GTJB 1LTBD 5K36H 3TSSA 3K0YA 4A3DB 4A3KB 2L55A 4G57A 3E6ZX 3AB9A 5CBEE 1QWYA 5AFWA 4ID6A 4X3TA 1QG7A 5C0XI 2J4XA 4C3HB 1C4QA 1K8OA 3KBGA 1F9RA 3IL8A 5CV7A 1IHZA 4HN7A 1ILPA 4A3GB 2A5HA 4ILWA 2IX3A 2B2WC 3HOUB 3GTOB 1MI2A 1LT4D 4CKEA 2F0HA 4FYDA 1GUGA 2F0WA 2F0KA 3FEWX 2PPBC 1JQYD 1VF7A 3IFTA 1SMYD 5DAUA 1MBYA 1WTRA 5CGKA 2PW7A 2F0EA 1ESFA 4RGTA 1EL0A 2R3ZA 2MP1A 3MTSA 3VR5A 1STBA 3DM1A 1STAA 1Y1VB 3MXGA 1LACA 4IFDG 3PUVA 4FF3A 5C4HA 2R7ZB 1DOMA 5EKIA 3K5NA 2RSOA 3OW7A 5BN4A 1H9SA 4XYQA 2PYKA 2B2WA 4LMQD 4H44C 2HUGA 1IL8A 4C3IG 2O2LD 2BDNA 2E76C 3GTKB 2NB0A 1TS5A 2CQAA 4L63B 1R4QB 1WTPA 4A3JB 2A73B 1TVXA 4KMUC 1KDCA 2ZXPA 1BO0A 1SMYC 3A8IE 1CK1A 2MUYA 4NW2A 4C56C 3MXPA 1BUVT 3BVMA 1GXDC 2F0GA 2FFKB 1QB5D 2F0MA 3BS1A 1KAAA 2EJMA 1H9RA 3AMUA 3D4WA 2DY8A 3MXNA 3NPPA 1EY8A 4U673 3MC0B 1I6HB 3AU7A 2EYOA 1T5XD 1BOSA 4BA2I 3NQIA 1EU4A 1PDQA 3BG3A 1JWUD 2FHTA 1IYUA 1SXTA 5ELDA 1RD9D 2KA7A 2L4NA 3RZDB 2HDMA 2E2DC 4P2CB 1CQFA 3P20A 3PIO3 3ONAB 1CT1D 3GP7A 2L1BA 3HOZB 4MHEA 4R8NA 5CV6A 1UNSA 2XRSD 1WTOA 1ICWA 1LTSD 1ILQA 5CV4A 2AQ2B 1EQTA 2JSOA 1JCKB 1FD7D 2WAQB 3DEOA 4R9WA 2EY1A 1CM9A 4DGZA 3R2IA 5DM63 2KOLA 2MJ8A 3IFDA 1SYCA 5KNCA 3SDZA 3KUPA 1HUNA 4IURA 4K2KA 4ZK9B 2VUMB 4EQNA 4RKLA 4XTCS 1B9NA 1BCPF 4F7XA 1HPCA 1I50B 2B2VA 2H1EA 3CU7A 3H0GB 1EY7A 2OXPA 3SK6A 3QG1A 1IYVA 1B44D 1UAPA 3NSWA 3OMGA 1STEA 3J7AF 3PUYA 3QO2A 3U9OA 3BYTB 1I4GA 4KN4C 1NAPA 3OPOA 2LS01 1RTOA 1TS3A 5IIFA 2ICIA 3DWQA 5K36G 4H0LC 3NTKA 5JEAG 4ME5A 3M85A 1B4OA 2X6LA 2LY7A 1MSGA 1BF4A 1LT6D 1VDZA 3GV3A 3I4MB 5D14A 3FVQA 3NQTA 3OIQA 1TY0A 1CTMA 4BA1I 3D31A 4CJ0B 2O4XA 2N88A 3PO3B 1TKWB 1PFMA 5A2QE 4DN4M 3QWNA 3BDLA 3KBXA 5EGTA 4ULLA 2L12A 1V43A 3SHLA 2K03A 1IW7C 4QF4A 2K5WA 2EYLA 1B3AA 2I46A 4I65A 3QOJA 1Z6HA 3BVGA 4O1NA 3RLFA 1EOTA 1HA6A 1PXUA 2KUMA 5IT9E 3VYSA 2G9HD 2X6GA 3W3AA 1PZID 2F3WA 3HOWB 2EE1A 3I8ZA 2ID0A 3BDCA 4QIWB 3X3MA 4IFDH 4FF1A 2PZUA 1BBXC 3I90A 3DXJC 4L6TB 2E74C 4RCNA 3S14B 2NZ1D 2R92B 2B2TA 2JP1A 5ELCA 1CA5A 1DD2A 4C3JB 1Q1EA 5T1IA 5C4XB 2B63B 1BXTA 3S1NB 2HQEA 1I4PA 4K5WA 1CHQD 3MWYW 3CRLC 5C6AA 1Y8PB 5IODA 3H6MA 4BS9A 3EA6A 3R8BA 5HURA 2QCPX 1S5CD 1IKMA 5G3LF 2RKSA 4M8AA 1BQQT 4RGOS 1E2VA 5CYUA 4PV1C 1LTAD 1V1PB 2TSSA 2JE6I 2VB3X 5IGDA 2XWBB 5KGUA 3KLSA 3URYA 4C3IB 3S1RB 1OXVA 3TP8A 1Q8IA 3QJYA 3QOLA 1RHPA 1D5MC 4KI0A 2K32A 1TY2A 1SSOA 2WP8J 2KECA 1CFMA 2SEBD 2QEJC 5C44B 5I6YA 5IOCA 1EFID 2AQ3B 5C0XH 4CHTB 2JA6B 2FJ2A 5KIXA 5IT9L 1ONLA 3A8JE 3I3CA 3JAML 2YU9B 3GQBA 4N9PA 4RAUC 3NBIA 2BOSA 3R93A 1KNAA 1DM0B 5D65A 1F9SA 4CKBA 5E4XA 3DMUA 4LK1C 5C3WA 4A3FB 1M4VA 4TQUS 4HSPA 1G8ZD 2WIIB 1RCVD 2GA4B 2XSCA 1F2LA 1PRTF 2SOBA 5FO8B 1ZEQX 5EPKA 1O7LA 3VR2A 3T56B 4B08A 3EVQA 3P7JA 3S17B 2BE5C 1J9OA 4MN3A 4S3SA 5CBAE 3C3LA 1LLRD 3EROA 5JPMC 4KTAA 3E5SA 3FPPA 4A93B 1ENCA 1NR2A 3R3OA 5EKKA 1A3UA 5I9OA 4J8QA 3D3RA 1LV9A 1HHVA 3HOVB 4J1MA 4FXDA 3N52A 3G7LA 3TZDA 4KHZA 2Z4IA 4OIJA 2AUKA 4K6LA 5ELEA 1TWCB 2CVRA 2F0LA 4C1NI 5JEAH 3L7ZC 1E0BA 2IT1A 1H9SB 1EYDA 4G7ZC 2Y0SB 1W6JA 2JA7B 1ENFA 2D2CC 2B8FA 5C3XA 5BN5A 3KLRA 2LKVA 4XIGS 3S2DB 1F9QA 2Q8TA 2OF1A 2L0CA 4EVOA 2AUJD 1GUSA 2RDFA 4B9XA 3BVZA 4XQNA 2F0DA 4H7BA 4TRDA 3OSOA 2WINB 3CKIB 4DK1A 2D9UA 1PTOH 1EYCA 3J81E 1PTOD 1GHKA 4TKOB 3K57A 3OHXC 3VA7A 1CZGA 2EY2A 2F4IA 1W6KA 2R61A 5LHY1 3GD7A 1DJRD 3MFYA 1PZJD 5C4ZA 4C3JG 2MPMA 4ZKBB 1SNDA 4E6IA 1KDBA 1H9MA 2JA8B 3L9AX 1SBBB 5JAVA 1EZ6A 1DOKA 1PTOB 2Z4HA 1AZQA 4PQXA 1VMPA 1UEAB 1KLUD 5FLXE 3MZ5A 2D5DA 1RJTA 1X32A 2J0TD 1MGSA 3LWUA 3OWFA 3NWSA 2DNEA 3GTGB 4JK1C 4HMIA 1GHJA 4HSVA 1KTKA 3PUZA 2SDFA 1PTOC 3GTLB 2EXZA 2RBMA 5DNFA 3TBIB 4XQJA 1EY0A 5I4DA 2DN8A 4IQZA 1D1IA 3NBHA 3I72A 2B2YA 1HFGA 1TWHB 4KHVA 1C8CA 4BBSB 4HCSA 2PZWA 1PZKD 1E2ZA 2EDGA 1ZKOA 3CQZB 4Y7NB 2DY7A 3M4YA 1Q12A 4A3IB 3KK7A 1GJXA 4PNYA 1F2MA 2KCCA 4RGMA 5IGBA 2M00A 1FYCA 4X3UA 2KEEA 1JR0D 4ZUIA 2EY5A 4HAEA 5CMDA 2AWNA 3IAYA 3C2PA 3KF8A 5I2YA 3J81L 2OEOA 2B2VC 2F0VA 4NP5A 2VXWA 3TZUA 3RUZA 4KY6A 4F88A 2NBFA 1GUOA 1D5XC 2F0QA 3M4OB 4FNFA 1VF5C 1A2UA 5C0XG 4IFDJ 1STHA 4KK7A 4FXKC 1X3QA 2IW3A 3F2UA 1Q1BA 4IALA 4Q0FA 1JE4A 4HTHA 1O7ZA 1A15A 2B39A 1HTLD 1U9RA 3TN2A 3VR3A 2F0JA 2A69D 1H9KA 1LT3D 1B1ZA 5FLXL 4LAAA 1I4XA 5EKLA 5IGFA 1AP0A 1STGA 5LL6X 1IW7D 2BDOA 2I07B 1EY9A 1XXGA 1WTWA 2B2UA 1ENAA 2AWOA 3KLSX 1TS2A 4PMBA 4RA8A 1XTCD 4IUUA 2QKIC 3OIPA 3K59A 1FNWA 1TQOA 2ZT9C 1HXYD 1FNUA 4EGVA 1EWHA 1QNKA 1DONA 2K04A 1V1OA 4V0BA 2E2JB 2F0NA 1JB3A 5EJWA 2L9HA 3PV0A 2JYOA 3I91A 5ISRA 1HCZA 1PFNA 1ZXTA 2A69C 3HRZC 2H4OA 1JC7A 1SEBD 1NSNS 1XWEA 1C48A 1EQVA 3SK5A 3BYYB 4Q5VA 4ZLTF 5M5WB 5EPLA 1U4RA 3Q22A 1SE3A 5DM73 4KD3A 5C5LA 2B2TC 3Q23A 2F0OA 1BCPB 5LL6S 3VA5A 2OT2A 5TSSA 2NN6I 1PMRA 3SEBA 1WTQA 3EQLC 3ITPA 2PMZB 4ZAIA 2ZXRA 2F0TA 3T53B 1F9PA 1DYQA 3I4LA 5T1GA 1OXXK 2FINB 3FDTA 3K7AB 2BCOA 4B9WA 2K1BA 1VMCA 4DA2A 4RH6A 3JAME 3ND8A 1GUNA 4G7HC 1HQMC 1BCPC 3GTMB 4CJ2C 1T5EA 4H13C 2ZXOA 2X69A 5A35A 5D3DA 1FNVA 5J22A 3U9SA 3FPUB 1SAPA 3TP7A 1R4PB 5HGTA 4HR7B 2FMCA 3ND9A 1ET6A 5CR3A 3WOFA 5KYIA 2Q8RE 1G6ZA 5ELBA 2FMMA 2C5CA 1TT2A 1WTVA 4IUQA 3VR6A 1EZ8A 5JEAJ 1LTID 1S5ED 3SE0A 1EY5A 4K6DA 4R8IA 2R93B 1SYDA 4A3EB 1QE6A 4WORA 4DXFA 4ZUJA 3K5MA 4OIKA 5FO9B 1D2BA 4G7OC 1A6XA 2HCCA 3FMCA 3HP3A 2WB1B 3Q6SA 2F0IA 1I4HA 1X3PA 2XNAC 2DNCA 4RWSC 4DF7A 4ABNA 1EIHA 3DWAA 3GO5A 4YIJA 1GUTA 2IX1A 4OO1I 1F2ZA 1OXSC 4C2MB 3M7GA 1AN8A 2BE5D 4V190 1HRJA 2EYHA 1O80A 5J39A 1Z7TA 1ZYRD 4FF2A 3VYRA 3T13A 1LABA 4KY5A 1WTXA 1Q90A 2NVYB 4K5VA 3I73A 1JWSD 1TU2B 2ICEC 3H91A 2QDBA 4XDXA 1LTTD 1RTNA 4CGYB 5E3FA 5FKAC 5EPJA 4AYBB 2PW5A 1EYAA 3MVVA 4DXGA 2K28A 1F2YA 1STNA 1GOZA 3SK8A 1AEXA 1TWFB 3DEPA 1ML0D 1QCBD 2NN6G 5I9PA 1Y1WB 4MIUA 3Q0AA 4Z9CB 2EJGC 4F87A 3CRKC 3MA2B 1QNUA 4UAIA 3NUCA 3P1HA 4RKBA 4XT1B 1SNQA 3EFXD 1D5ZC 2K33A 2EY6A 3M3YB 3D6CA 1PFBA 1STYA 5J1ZA 2EYFA 1ZYRC 1YNJC 3GV6A 3J7AV 1EWCA 1EIGA 2SNSA 1DOLA 3S1MB 2J7ZA 4ODGA 2V4DA 4XXEA 3NWTA 5K5PA 3X3NA 1SYFA 1CA6A 3V05A 4K5XA 4BY7B 2VB2X 2D62A 1LTGD 4K8JA 3SVMA 1TWAB 3HS0C 5KYLA 4A3MB 5ELFA 4NMZA 3GTQB 5M3MB 2BA1A 2YYZA 1KLGD 1OO9B 4FP5D 2IJ0A 1II3A 3K6OA 2QILA 3V2TA 5FK9C 3G6JB 3J80L 1PRTB 2NTTA 1K83B 1DCZA 1I6VC 1PTOF 3TP5A 3WOEA 5BN3A 1SYEA 2K01A 3DWPA 4QMGA 3SXHA 2WKDA 5CC4A 1S5DD 3QIAA 2LFNA 3H09A 2F0SA 1PRTC 1A2TA 1MD2D 1SNCA 2HDLA 2F03A 4OO1G 3UI2A 1RF2D 1F77A 2B2YC 1G2SA 1IKLA 2WACA 2N55A 5NUCA 2E2HB 5F2DA 3HEJA 4IUNA 1RDPD 1WVLA 2O5IC 3OWEB 1YNND 1S5BD 3I70A 1QJOA 3QB3A 2K7VA 2EYMA 5JVH3 2KJXA 4KY7A 2KEDA 4LJZC 2CHBD 5FO7B 2TMPA 2NWGA 1RODA 1A3TA 5M9OA 4XYOA 4CJ1B 4FO2A 5CV8A 2JXMB 3M7NA 3ZYYX 2AQ1B 4K8IA 3L3OC 2NTSA 2SNMA 3S16B 3ERQA 1J8IA 4IZ8A 2XN9C 1G91A 2RQXA 4X3KA 1S4ZA 3C1EA 4BY1B 2F0PA 5JOBA 2XVSA 3TP6A 2Z1CA 2A6HD 3T16A 5IGEA 3R2TA 1S5FD 1YNNC 4UDUC 1A3VA 4ZKCB 4RHSA 4KKUA 3O13A 3GTPB 4BWGB 3T4AC 3SR1A 1RKNA 2M9VA 1SDFA 1WCMB 4CBVA 3H94A 1E2WA 4OHJA 5M3FB 3J7YW 1VCIA 2K5DA 1V8QA 5E1FA 4KV6A 4DFAA 2NYZD 1CQVA 2XRQD 1HA5A 5KRUA 4OL7A 3A7LA 4QCLA 2B8GA 4BBRB 2RSNA 1NUCA 2B2UC 3DHQA 5I6WA 2XWJB 3NHHA 4IUPA 4HMJA 4IUTA 4KJNA 3NE5B 4NKLA 5EQ0A 2PNRC 3C1FA 1B50A 4XQQA 2A6HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYO A;  5EKL A;  4N9P A;  2ENB A;  2F0D A;  4H7B A;  4TRD A;  3T13 A;  5IGF A;  3OSO A;  4KJO A;  4KY5 A;  5DAU A;  5IGG A;  3MHB A;  1KDA A;  4K8I A;  1II3 A;  4QB4 A;  3DMU A;  1STG A;  5IIF A;  4KD4 A;  4PNY A;  4K5V A;  3D8G A;  2PW7 A;  2SNM A;  5CV9 A;  5C3W A;  5CGK A;  3V2T A;  1EYC A;  2PZT A;  1F2M A;  2F0E A;  2F3V A;  1EY9 A;  2QDB A;  5J22 A;  3ERQ A;  1ENA A;  4IZ8 A;  2EY2 A;  3EJI A;  4ME5 A;  3TP7 A;  2KQ3 A;  5HGT A;  4PMB A;  5IGB A;  2SOB A;  5E3F A;  2HQE A;  5C5M A;  2EYP A;  2M00 A;  3C1E A;  1SNM A;  1STB A;  4K5W A;  2PW5 A;  1SNP A;  1STA A;  2F0U A;  4DU9 A;  4EQP A;  5C6A A;  1EYA A;  5IOD A;  3TME A;  2F0P A;  5CR3 A;  3MVV A;  5CV5 A;  5JOB A;  1TQO A;  3H6M A;  3NQT A;  2EY5 A;  4ZUI A;  3T16 A;  1JOO A;  3TP6 A;  3TP5 A;  5IGE A;  5KYI A;  1F2Y A;  1JOK A;  1STN A;  1TT2 A;  5IGC A;  3EVQ A;  5C4H A;  3NP8 A;  5C4Z A;  2F0F A;  1A3V A;  2NUC A;  1SYE A;  3P75 A;  4WRD A;  3SK8 A;  5HUR A;  4S3S A;  1EY6 A;  1EZ8 A;  1SND A;  4R8N A;  5CV6 A;  1AEX A;  4QMG A;  4EQO A;  4K14 A;  3SXH A;  2O4X A;  2RKS A;  5CC4 A;  4E6I A;  1EY5 A;  2OEO A;  4K6D A;  3SR1 A;  2F0N A;  1KDB A;  1RKN A;  1SNO A;  2F0V A;  3ERO A;  4NP5 A;  1SYD A;  2F0S A;  4NDX A;  4KTA A;  5I9P A;  3E5S A;  1JOQ A;  5CV4 A;  5DEH A;  1A2T A;  1SNC A;  3RUZ A;  2PYK A;  4KY6 A;  5ISR A;  3BDL A;  4WOR A;  4MIU A;  5EGT A;  5JAV A;  1ENC A;  1EZ6 A;  3R3O A;  3SHL A;  5EKK A;  4G57 A;  3OMC A;  4ZUJ A;  5IGD A;  1A3U A;  5I9O A;  2WAC A;  4QF4 A;  5KGU A;  5NUC A;  2F0Q A;  3NUC A;  3S9W A;  1A2U A;  3P1H A;  4RKB A;  1STH A;  1SNQ A;  2EY1 A;  5F2D A;  4DGZ A;  2EY6 A;  1NSN S;  2EYL A;  3HEJ A;  4ZQ3 A;  4IUN A;  4I65 A;  5E1F A;  3TP8 A;  4KV6 A;  4DFA A;  4J1M A;  4ID6 A;  1JOR A;  1EQV A;  3QOJ A;  3SK5 A;  3NXW A;  3QOL A;  2F0I A;  3D6C A;  1STY A;  3MZ5 A;  1SYC A;  3D4D A;  5J1Z A;  2EYF A;  3PMF A;  1KDC A;  4IAL A;  4HTH A;  4KD3 A;  3OWF A;  5C5L A;  4OL7 A;  4DF7 A;  5CV7 A;  5KRU A;  2F0L A;  2F0O A;  1IHZ A;  2EYJ A;  3LX0 A;  3NK9 A;  4K2K A;  2SNS A;  2PQE A;  4PMC A;  1NUC A;  3MEH A;  3MXP A;  1SYB A;  2KHS A;  4HMI A;  4N9T A;  4YIJ A;  1SYG A;  2F0G A;  3DHQ A;  3QB3 A;  4ODG A;  4EQN A;  4RKL A;  3VA5 A;  5I6W A;  5K5P A;  1EY4 A;  3NHH A;  4F7X A;  1EYD A;  2EYM A;  2F0M A;  1U9R A;  4HMJ A;  1KAA A;  1SYF A;  2EXZ A;  2RBM A;  1F2Z A;  4K2L A;  4KY7 A;  2F0J A;  4K5X A;  4KJN A;  5J39 A;  2F3W A;  3ITP A;  1EY7 A;  3D4W A;  5C3X A;  1EY0 A;  5I6Y A;  4K8J A;  5IOC A;  2OXP A;  2F0T A;  3SK6 A;  3BDC A;  2LKV A;  4NKL A;  1EY8 A;  1KAB A;  2OF1 A;  1A3T A;  2F0H A;  4B9W A;  4EVO A;  5KYL A;  4F8M A;  4KHV A;  2RDF A;  3OMG A;  3SK4 A;  5KIX A;  5M9O A;  2F0W A;  2EYH A;  2PZW A;  2PZU A;  4J6H A;  4LAA A;  4B9X A;  5CV8 A;  2F0K A;  3C1F A;  3U9O A;  3HZX A;  4NMZ A;  5KEE A;  1TR5 A; 
#chains in the Genus database with same CATH topology
 3HOX H;  1BVS A;  4DK0 A;  4C1N K;  2KCM A;  3I4N B;  2NN6 H;  3ULP A;  4KKT A;  2HIV A;  3T1Y L;  1DXM A;  1QZG A;  4KD4 A;  3D8G A;  1L0Y B;  4PMW A;  3S1Q H;  2F3V A;  1Q7Y C;  2K5H A;  4A3M G;  1YJW A;  2EOT A;  3K81 C;  2R6G A;  4OGQ C;  2KQ3 A;  1BDO A;  3B6Y A;  5M3M G;  1VQ8 A;  4LF9 Q;  4RGN A;  4DV5 Q;  4DR6 Q;  4B3S L;  4EQP A;  5CV5 A;  5M5X H;  1MSH A;  3G48 A;  4YCU A;  1M8A A;  1TWG B;  5IGC A;  3U4V A;  2F0F A;  4WRD A;  5M5Y H;  1UUP A;  2K6A A;  4IUV A;  5LMN W;  1EY6 A;  3CCJ A;  4K14 A;  4TSS A;  2JEA I;  2A68 D;  2YTX A;  1SNO A;  2A74 C;  3VR4 A;  1B9M A;  3RZO H;  1JOQ A;  2PO4 A;  4M1U B;  4ZYS A;  3HOX B;  4DV4 L;  1G2T A;  1EEF D;  1PVO A;  4O42 A;  3K80 C;  1I4Q A;  2EIF A;  3C46 A;  4WJW A;  1DZ1 A;  2IPK D;  1NCV A;  3S1Q B;  2O5J C;  1PH3 A;  1R9T H;  1BCP D;  4ZQ3 A;  1CZW A;  3BZC A;  1YHA A;  4C3H G;  4H02 A;  2HHH L;  2IX0 A;  2RVL A;  3E9H A;  2EPB A;  2CW0 D;  1VQO A;  3BDO A;  4B3S Q;  2A1A A;  3VYU A;  4JI4 L;  1D1K A;  3NK9 A;  3WDN A;  1VS0 A;  5M5X B;  1G29 1;  1K0R A;  1AH9 A;  2HCI A;  1EY4 A;  3CW2 C;  3J7A 5;  5C0X J;  3HOU G;  1SE2 A;  1B2T A;  5M5Y B;  2OTJ A;  3GTM H;  3HGB A;  4K2L A;  1UWV A;  1N8R C;  2HT1 A;  2NVT H;  3A55 A;  1Q3L A;  4N8F A;  2N3S A;  4LNQ A;  1H9J A;  4IPD A;  3RZO B;  4LFB Q;  1YNX A;  4F8M A;  3SK4 A;  1ESR A;  3A8K E;  4J6H A;  3WWV A;  3W1G A;  1CSQ A;  4GN4 B;  2HHH Q;  2JA5 H;  3BZD B;  2VNU D;  3MHB A;  1R9T B;  1U4L A;  3TQY A;  3UE0 A;  1K0S A;  5COY A;  3TS2 A;  4OO1 H;  4PG3 A;  1CHP D;  2A68 C;  1PH1 A;  4UP9 A;  1Y8N B;  4L8J A;  3L0O A;  2EJF C;  1GKH A;  1S3O A;  3CD6 A;  4JBM A;  4LF5 L;  1SE4 A;  1Y1V G;  2R93 H;  5C5M A;  4WJ4 A;  2RDH A;  1AZP A;  3K5O A;  3IKJ A;  4DU9 A;  4NPS A;  1EU3 A;  1VQK A;  2NVT B;  2EVB A;  1I4R A;  2CW0 C;  1KNE A;  3NP8 A;  1FGB D;  3P75 A;  1LM0 A;  3W2D A;  5IYC G;  1AFP A;  3H3V H;  3NTI A;  2LSS A;  3D4R A;  1Y8O B;  2NVQ H;  4GLX A;  3FRP B;  5EBC A;  4NDX A;  3MAQ A;  3VYT A;  2JA5 B;  4BY1 G;  2KVM A;  3E0J A;  2G9D A;  3OMC A;  1Y69 U;  1AW7 A;  2CWP A;  2RDG A;  2M2L A;  4X3S A;  1OXT A;  1FJG Q;  5GAG C;  3Q24 A;  4I7Z C;  4ZRZ A;  4DAV A;  2F1M A;  2E2I H;  2E75 C;  4LF5 Q;  2IL8 A;  2I5L X;  1SR3 A;  1JOR A;  4KN7 C;  4A3B B;  4HED A;  2JEB I;  2PI2 E;  1XNR L;  4CKC A;  5IYB G;  1WCM G;  3PMF A;  3STB C;  3RNU A;  4GKK L;  1I3Q H;  2XIW A;  4AIM A;  1FR3 A;  3CHB D;  1ET9 A;  1SFO B;  2E8G A;  5M3F G;  1WYD A;  3VDY A;  4PMC A;  3LWE A;  2KHS A;  1OXU A;  1SYG A;  1NR4 A;  1WD0 A;  1JIC A;  1WTH A;  3NTH A;  1Q86 C;  4GZY C;  1HUM A;  1QIL A;  3A56 A;  3J80 c;  1XMQ L;  1LYL A;  2NVQ B;  1H95 A;  4XT3 B;  1PYW D;  4BXX G;  2L5T A;  1QVG A;  1MKH A;  2VY3 A;  3S2H H;  4BBR G;  1PH6 A;  1ASZ A;  1L0X B;  2KCN A;  4P73 A;  1HNW L;  1U4P A;  1HH2 P;  3T51 B;  5JJZ A;  5KEE A;  1TR5 A;  1PHJ A;  2ENB A;  4DPG A;  4LF6 L;  3PO2 H;  2E2I B;  1KDA A;  4QB4 A;  1XNR Q;  3FP9 A;  4DAY A;  4GKK Q;  1CI3 M;  3KDF A;  4QUC A;  1O78 A;  3H3V C;  3OOC A;  1PH2 A;  1XMO L;  1GUW A;  2K5Q A;  3A7A B;  4LFA L;  4DNR B;  3RN2 A;  1I3Q B;  3PUW A;  3J80 E;  1HNX L;  3N6R A;  1PLF A;  5G3L D;  3EJI A;  1BNZ A;  1CKN A;  1BR9 A;  2Q8I B;  5COR A;  2EYP A;  1SJH D;  1D6E C;  1XMQ Q;  2P5Z X;  1NMF A;  1HJP A;  3K58 A;  4U68 A;  1YNJ D;  2AKW B;  3HOY H;  1HFN A;  3HOZ G;  5E4W C;  2Z8L A;  5D3I B;  4B3M L;  1JOO A;  1JOK A;  1HTP A;  1S72 A;  2ZJR A;  4RCO A;  2K05 A;  2NUC A;  1HNW Q;  4P71 A;  2JN4 A;  3S2H B;  2R7D A;  4EQO A;  1JWM D;  3DUZ A;  3KF6 B;  1Y14 B;  2A6E D;  4IN3 A;  1WD1 A;  3MXU A;  4WFN 3;  4LF6 Q;  3TDQ A;  5KNB A;  5C4J B;  5DEH A;  5A2Q L;  3S15 H;  3ERS X;  3LNN A;  4G4K A;  4UP7 A;  3PO2 B;  3HKZ B;  2QF7 A;  4LFA Q;  1PH8 A;  1HNZ L;  4YCW A;  3S9W A;  3K5L A;  3S1M H;  5C3E H;  3V96 A;  4JBW A;  2IWH A;  2RA4 A;  3NXW A;  4DNT B;  2C9O A;  1HZC A;  3DM3 A;  1O7Y A;  2NVX H;  3D4D A;  4IFD I;  1YVC A;  3PUX A;  3MFG A;  4B3M Q;  1B53 A;  1TWA H;  1VQ4 A;  3LX0 A;  2CKZ B;  2EYJ A;  1K8M A;  2PQE A;  1D7Q A;  3A54 A;  3F1Z A;  3MEH A;  3HOY B;  1SYB A;  2ZTD A;  4N9T A;  3PIP 3;  2L11 A;  3D6W A;  4DAP A;  3GTQ H;  4MTK A;  4FVM A;  2MHV A;  4KKS A;  4B3R L;  5JVG 3;  1TII D;  3FKI H;  3TRZ A;  3M9B A;  2BA0 A;  3NEM A;  3KYH C;  1KAB A;  1HR0 W;  1LTR D;  1K3R A;  3GTJ H;  1HNZ Q;  4QUF A;  1LO5 D;  3S15 B;  4FXG C;  2JJQ A;  5GAH C;  3HZX A;  1YJ9 A;  2I5M X;  5EBD A;  2PCF B;  4R1J A;  2A19 A;  1K83 H;  5HGQ A;  5I2X A;  4A3K H;  1PRT D;  4RHR A;  2LMC B;  5C3E B;  4KJO A;  3OYY A;  5IGG A;  5KND A;  1LT5 D;  2LXJ A;  1EIY B;  4FF4 A;  5FOB B;  5CV9 A;  1HQR D;  2MQH A;  2A6E C;  3RMH A;  1XYI A;  1PH7 A;  5HY6 A;  2PZT A;  1NY4 A;  2NVX B;  4Y52 H;  1QZH A;  3CPF A;  4RFB A;  1V1P A;  5E7N A;  1XX8 A;  4GLA C;  2EQS A;  4C3H H;  3RD4 A;  1Z47 A;  2WKC A;  4B3R Q;  1SNM A;  1SNP A;  2F0U A;  2OTL A;  4JV5 L;  3TME A;  4A3G H;  3RR5 A;  1EIF A;  3H15 A;  3FKI B;  2EZV A;  3PO3 G;  1TS4 A;  4HCE A;  2WV6 D;  1C0A A;  1GD7 A;  1SJE D;  1EEI D;  3HG9 A;  5JPN C;  1QOH A;  2MGS A;  2E2H H;  3E0E A;  5H1S E;  3HOU H;  3ZJY C;  1SMX A;  1U4M A;  3GTJ B;  3GTO H;  1LTB D;  5K36 H;  3TSS A;  3CMA A;  3K0Y A;  4A3D B;  4A3K B;  2CWA A;  2L55 A;  1GVP A;  1HZA A;  4HID A;  2K4K A;  4G57 A;  1KIX A;  3PGZ A;  2H5X A;  3E6Z X;  3G71 A;  3AB9 A;  5CBE E;  1QWY A;  5AFW A;  1D8L A;  4MZ9 A;  4ID6 A;  4X3T A;  1QG7 A;  5C0X I;  2J4X A;  4C3H B;  1C4Q A;  4JCV E;  4JV5 Q;  1K8O A;  2JA5 G;  3KBG A;  1F9R A;  3IL8 A;  5CV7 A;  2K50 A;  1IHZ A;  4HN7 A;  1ILP A;  1YIJ A;  4A3G B;  2A5H A;  4A3L G;  1CKM A;  2MNA A;  2VL6 A;  4ILW A;  4AH6 A;  2KCT A;  1Y1V H;  2IX3 A;  2B2W C;  4A3B G;  1K8A C;  1ASY A;  1TXY A;  4QGU A;  3F2D A;  3HOU B;  3GTO B;  1EOV A;  1MI2 A;  1LT4 D;  4DV2 L;  2R7Z H;  4GS3 A;  4CKE A;  2F0H A;  4FYD A;  1GUG A;  1Q81 C;  2F0W A;  3MXN B;  5IYC H;  2F0K A;  2RCN A;  3FEW X;  2PPB C;  1JQY D;  1VF7 A;  3CCU A;  3IFT A;  1SMY D;  5DAU A;  1MBY A;  1E24 A;  3DLL A;  4BY1 H;  1WTR A;  4UY8 C;  3GTK H;  5CGK A;  2XTI A;  2PW7 A;  5C4X G;  4CDC C;  2K14 A;  2F0E A;  1ESF A;  1V9P A;  4RGT A;  5L37 A;  1EL0 A;  2R3Z A;  3GTP H;  2MP1 A;  3MTS A;  3VR5 A;  4IJH A;  1STB A;  3DM1 A;  3HKS A;  1STA A;  1Y1V B;  1UE1 A;  5IYB H;  1YI2 A;  4DV2 Q;  1V1Q A;  2N78 A;  2PQA B;  3MXG A;  1LAC A;  4IFD G;  3PUV A;  4FF3 A;  5C4H A;  4GOP A;  2R7Z B;  1DOM A;  5EKI A;  3K5N A;  4YWL A;  2RSO A;  2OWO A;  3OW7 A;  5BN4 A;  4DV0 L;  1H9S A;  1GO3 E;  4XYQ A;  2PYK A;  2B2W A;  4LMQ D;  4H44 C;  2HUG A;  1IL8 A;  4C3I G;  2O2L D;  1I6H H;  2BDN A;  2E76 C;  3GTK B;  1Q8K A;  2NB0 A;  3LGJ A;  1TS5 A;  5LMU Q;  1QUQ A;  2CQA A;  4L63 B;  4HIK A;  1R4Q B;  1WTP A;  1RL2 A;  4A3J B;  1VQA A;  2A73 B;  1TVX A;  4KMU C;  1L1O B;  1KDC A;  2ZXP A;  1BO0 A;  4DAM A;  1SMY C;  3A8I E;  1CK1 A;  3RZD H;  2MUY A;  4NW2 A;  4QJF A;  4JG2 A;  4C56 C;  3MXP A;  1BUV T;  3BVM A;  1GXD C;  2F0G A;  2FFK B;  5C44 G;  2JK8 A;  2ZJQ A;  2IY5 B;  1QB5 D;  2F0M A;  3BS1 A;  4DV0 Q;  1KAA A;  2EJM A;  3HKZ E;  4LUV A;  1NNX A;  1H9R A;  3AMU A;  3PF5 A;  3D4W A;  2DY8 A;  2JA6 G;  3MXN A;  3HOZ H;  3NPP A;  1EY8 A;  4JI5 L;  1L1O C;  4U67 3;  3HOY G;  3MC0 B;  1VQD A;  4LF8 L;  1I6H B;  3AU7 A;  2EYO A;  1T5X D;  1BOS A;  4BA2 I;  3NQI A;  1EU4 A;  3KOJ A;  1PDQ A;  3BG3 A;  1JWU D;  2FHT A;  3PCO B;  1IYU A;  1SXT A;  5ELD A;  5IWA L;  3D0F A;  1RD9 D;  2HD3 A;  3JC6 6;  2KA7 A;  2L4N A;  5BR8 L;  3RZD B;  2Q2T A;  2HDM A;  1IL2 A;  2E2D C;  4P2C B;  3CCV A;  1CQF A;  3P20 A;  1XNQ L;  3PIO 3;  3ONA B;  1CT1 D;  2VUM H;  4JI5 Q;  4UPA A;  3GP7 A;  2L1B A;  1VQP A;  3HOZ B;  5JJK A;  4MHE A;  3H0G H;  4R8N A;  4LF8 Q;  5CV6 A;  1UNS A;  2XRS D;  1WTO A;  1VQL A;  1ICW A;  4ZCK A;  3BJU A;  1LTS D;  2OCE A;  1GM5 A;  1ILQ A;  1WFQ A;  5CV4 A;  5IYD H;  1A0I A;  2AQ2 B;  1EQT A;  2JSO A;  5IWA Q;  3FKI G;  4OWW B;  1JCK B;  1FD7 D;  2WAQ B;  3HOV G;  3DEO A;  4IPG A;  1XPU A;  4R9W A;  5BR8 Q;  1Z9F A;  1CM9 A;  2EY1 A;  4DGZ A;  3ULJ A;  3R2I A;  3F2C A;  4UP8 A;  5DM6 3;  1L1O A;  2KOL A;  2KEN A;  2MJ8 A;  1QVC A;  1IBK L;  4LFC Q;  3IFD A;  1SYC A;  5KNC A;  3SDZ A;  1X6O A;  3KUP A;  4FDB A;  1XNQ Q;  4A3K G;  4A3D G;  1HUN A;  4ALP A;  4IUR A;  1X55 A;  4K2K A;  4POF A;  3T1Y Q;  2VS1 A;  4ZK9 B;  4HIO A;  2Y0S G;  1NE3 A;  2JA7 G;  3UE1 A;  2VUM B;  3A5U A;  4JVZ A;  4EQN A;  4RKL A;  4XTC S;  1B9N A;  1BCP F;  4F7X A;  1HPC A;  1I50 B;  3RLO A;  2B2V A;  2H1E A;  3CU7 A;  3H0G B;  1EY7 A;  2D0O A;  2OXP A;  3SK6 A;  1BBW A;  1PH5 A;  3QG1 A;  1IYV A;  1B44 D;  1UAP A;  3NSW A;  3OMG A;  2NZH A;  3PO3 H;  4A3G G;  1STE A;  3J7A F;  3PUY A;  3QO2 A;  3U9O A;  2L15 A;  3BYT B;  1I4G A;  4KN4 C;  1JJC B;  1NAP A;  3OPO A;  1FGU A;  3EIV A;  2LS0 1;  1RTO A;  1TS3 A;  1KXL A;  2F52 A;  1B7Y B;  5IIF A;  3I55 A;  4MNO A;  2ICI A;  2VZA A;  3DWQ A;  4APV A;  3KFU A;  5K36 G;  4R4C A;  4H0L C;  3NTK A;  1WI5 A;  5JEA G;  4DV4 Q;  4JW0 A;  3PSI A;  4JI6 L;  4ME5 A;  5IE8 A;  3M85 A;  2UUB L;  1B4O A;  2X6L A;  2LY7 A;  1VQ9 A;  1MSG A;  1BF4 A;  1IBL L;  1LT6 D;  1VDZ A;  3GV3 A;  3STB D;  3I4M B;  2LXK A;  4OXP A;  5D14 A;  3FVQ A;  3NQT A;  1JJG A;  3L2P A;  1WOC A;  3OIQ A;  1VQ5 A;  1TY0 A;  4A3L H;  1CTM A;  4BA1 I;  5IT9 c;  4MTN A;  4YCV A;  3D31 A;  4CJ0 B;  4DV7 L;  4JI4 Q;  4IOC A;  2O4X A;  2N88 A;  2JA8 G;  3PO3 B;  3NEN A;  4QY7 A;  1SN8 A;  4DAY B;  3KDF B;  1TKW B;  4R4I A;  4A3B H;  1PFM A;  5A2Q E;  4DN4 M;  3QWN A;  2MO1 A;  4IPH A;  3BDL A;  3KBX A;  1NBW A;  4L5T A;  4ULL A;  2L12 A;  5EGT A;  1IZ6 A;  1V43 A;  3SHL A;  2K03 A;  5DLQ E;  1IW7 C;  1SFO H;  1CKN B;  2WFW A;  4QF4 A;  2R7Z G;  2K5W A;  2YV5 A;  4JI6 Q;  2EYL A;  1B3A A;  2I46 A;  4I65 A;  3QOJ A;  1Z6H A;  4HJ9 A;  3BVG A;  4O1N A;  3RLF A;  1EOT A;  1IBL Q;  2R92 H;  1HA6 A;  2C35 B;  1X54 A;  1PXU A;  1VQI A;  2KUM A;  4C3J H;  5IT9 E;  3VYS A;  4DR2 L;  2YTV A;  2UUC L;  5C4X H;  4HIM A;  3CC7 A;  3S1N H;  1X9N A;  2G9H D;  4DV7 Q;  1VQB A;  2X6G A;  3W3A A;  4JI7 L;  5EAY A;  1PZI D;  1K73 C;  4R4Q A;  2F3W A;  1B3Q A;  4A3J G;  1A63 A;  3HOW B;  2EE1 A;  3I8Z A;  2ID0 A;  3BDC A;  1KQS A;  1B70 B;  4QIW B;  2OQ0 A;  3X3M A;  3CF5 A;  2QA4 A;  4IFD H;  4FF1 A;  2PZU A;  1BBX C;  2XGT A;  3I90 A;  3DXJ C;  4L6T B;  1C9O A;  2E74 C;  4RCN A;  3MEF A;  1UE5 A;  3AFQ A;  3S14 B;  4DKA C;  2NZ1 D;  4DR2 Q;  2UUC Q;  2R92 B;  2B2T A;  2JP1 A;  5ELC A;  1CA5 A;  4C3I H;  1DD2 A;  3S1R H;  4C3J B;  1Q1E A;  2G5D A;  5T1I A;  4IJL A;  1VQJ A;  5C4X B;  5GRO A;  2B63 B;  1JMC A;  1BXT A;  1OTC A;  4JI7 Q;  3S1N B;  4A3C H;  3EBE A;  2HQE A;  4NXN L;  2GN5 A;  4HJ8 A;  1I4P A;  3QR8 A;  4K5W A;  1CHQ D;  3MWY W;  5C4J H;  3CRL C;  5C6A A;  1Y8P B;  5IOD A;  3H6M A;  4BS9 A;  3EA6 A;  1AE2 A;  4R4T A;  3R8B A;  2ZJP A;  2QCP X;  5HUR A;  1S5C D;  1IKM A;  4N8X 1;  5G3L F;  5C44 H;  2RKS A;  4M8A A;  1BQQ T;  3CCR A;  1VQF A;  4LF7 L;  2DGY A;  2JA6 H;  4RGO S;  1N33 L;  1E2V A;  5CYU A;  3UDI A;  4PV1 C;  1LTA D;  1V1P B;  2TSS A;  2JE6 I;  2VB3 X;  5IGD A;  2XWB B;  2YU9 H;  5KGU A;  3KLS A;  3URY A;  2DUD A;  4C3I B;  3S1R B;  1OXV A;  2ZTC A;  2B29 A;  3TP8 A;  1Q8I A;  3QJY A;  4NXN Q;  4A3F H;  1HZB A;  3QOL A;  1JB7 A;  1X56 A;  1RHP A;  1D5M C;  4KI0 A;  4DV6 L;  2K32 A;  1TY2 A;  1SSO A;  2WP8 J;  4PZ6 A;  3GDE A;  4X6A H;  3BZK A;  4OEL B;  2WAQ G;  1VQG A;  2KEC A;  1DGS A;  1XMO Q;  1CFM A;  2Z6B A;  4R4O A;  4JBJ A;  2ZTE A;  2WAQ E;  3CCE A;  2GVA A;  2QEJ C;  2SEB D;  5C44 B;  1HNX Q;  4LF7 Q;  5I6Y A;  5IOC A;  1N33 Q;  3S17 H;  1EFI D;  2AQ3 B;  2N8N A;  5C0X H;  4CHT B;  2JA6 B;  4A75 A;  3OW2 A;  2FJ2 A;  5KIX A;  3IRB A;  5IT9 L;  2VUM G;  2JQO A;  1ONL A;  3A8J E;  3I3C A;  3JAM L;  3G4S A;  2YU9 B;  3K8A A;  3GQB A;  4N9P A;  3KJO A;  4RAU C;  3NBI A;  2BOS A;  3R93 A;  3H0G G;  1KNA A;  1DM0 B;  5D65 A;  1F9S A;  4CKB A;  5E4X A;  4DV6 Q;  3DMU A;  4LK1 C;  5C3W A;  4A3F B;  5LMN L;  1M4V A;  1XTD A;  4TQU S;  4HSP A;  1YHQ A;  1G8Z D;  5IYD G;  2ATW A;  3HOV H;  4DK6 C;  2WII B;  1RCV D;  3I7F A;  1Q82 C;  2GA4 B;  3J81 i;  2XSC A;  4POG A;  4QQB X;  1F2L A;  1PRT F;  2SOB A;  5FO8 B;  1ZEQ X;  4A3D H;  5EPK A;  1O7L A;  3VR2 A;  3UDG A;  4GN3 B;  3T56 B;  4B08 A;  3EVQ A;  3EN2 A;  2DJF C;  3P7J A;  3S17 B;  5FLM G;  2BE5 C;  1J9O A;  2JA7 H;  4MN3 A;  4S3S A;  1K8G A;  5CBA E;  1C7Y A;  3C3L A;  1LLR D;  3ERO A;  4OEM B;  5JPM C;  3S2D H;  4KTA A;  3E5S A;  3I4M G;  4JOI A;  4DUY L;  3FPP A;  4A93 B;  2HQL A;  5LMN Q;  1ENC A;  1NR2 A;  3R3O A;  5EKK A;  1A3U A;  5I9O A;  1O7I A;  4JI2 L;  2KBN A;  2OQK A;  4J8Q A;  3D3R A;  1MJC A;  1LV9 A;  1HHV A;  4YHH L;  3HOV B;  4J1M A;  4LF4 L;  3RN5 A;  4FXD A;  3N52 A;  3G7L A;  3TZD A;  4KHZ A;  2Z4I A;  4OIJ A;  2AUK A;  4ME3 A;  4GOP B;  4K6L A;  5ELE A;  1TWC B;  2CVR A;  2Q2U A;  2F0L A;  2GVB A;  4C1N I;  1M1K C;  5JEA H;  3L7Z C;  4CDF C;  1E0B A;  2IT1 A;  4PZ7 A;  1H9S B;  4B3T L;  1EYD A;  3BU2 A;  4G7Z C;  2Y0S B;  1W6J A;  4YWM A;  3CCQ A;  2JA7 B;  3CPW A;  1ENF A;  2D2C C;  2B8F A;  1N9W A;  5C3X A;  1X3E A;  4DUY Q;  2UXD L;  5BN5 A;  1VQH A;  2LKV A;  3KLR A;  4XIG S;  2MO0 A;  1F9Q A;  3S2D B;  2Q8T A;  2OF1 A;  2L0C A;  1T9H A;  4EVO A;  2AUJ D;  1QUQ B;  4JI2 Q;  1GUS A;  2RDF A;  4GOP C;  4GKJ L;  1XPR A;  2BH2 A;  5ELN A;  4B9X A;  1M90 C;  3BVZ A;  4XQN A;  2QDL A;  2JA8 H;  4AQY L;  4YHH Q;  4JYA L;  2F0D A;  4H7B A;  4TRD A;  4LF4 Q;  3OSO A;  2WIN B;  3CKI B;  4GNX A;  4L5S A;  1E1T A;  4DK1 A;  2ES2 A;  3F8T A;  3HOW G;  2D9U A;  1EYG A;  1PTO H;  2ZM6 L;  1EYC A;  3J81 E;  1PTO D;  2Z6K A;  1YJN A;  3PF4 A;  1GHK A;  4TKO B;  2RF4 A;  3K57 A;  3OHX C;  3VA7 A;  1CZG A;  2EY2 A;  4B3T Q;  2R7F A;  4EQ5 A;  2F4I A;  4QIW E;  1W6K A;  1U5K A;  2R61 A;  2K5V A;  5LHY 1;  1BKB A;  2F3I A;  2UXD Q;  3E9I A;  3GTG H;  2R92 G;  3GD7 A;  1DJR D;  3MFY A;  1PZJ D;  4GKJ Q;  4C3J G;  5C4Z A;  2MPM A;  4ZKB B;  3GTL H;  1RIP A;  1L0W A;  1SND A;  2B63 G;  3G6E A;  4AQY Q;  4E6I A;  1UEB A;  4JYA Q;  3K7U C;  1KDB A;  1KD1 C;  3RLN A;  1H9M A;  5ELO A;  4A3J H;  1E3P A;  2JA8 B;  3L9A X;  1TWH H;  1SBB B;  2ZM6 Q;  5JAV A;  3PQI A;  1EZ6 A;  1YEZ A;  2YTY A;  1DOK A;  1PTO B;  1S40 A;  2Z4H A;  1AZQ A;  2WB1 G;  4PQX A;  1VMP A;  1UEA B;  4P75 A;  4TVA B;  4A3I H;  1EFW A;  1KLU D;  2AMC B;  5FLX E;  1VQ6 A;  1XPO A;  3MZ5 A;  1NJI C;  2D5D A;  1RJT A;  1X32 A;  2J0T D;  1MGS A;  3LWU A;  3OWF A;  3NWS A;  4GN5 A;  2DNE A;  4KHP L;  3GTG B;  4JK1 C;  4HMI A;  1GHJ A;  4JI0 L;  4HSV A;  1KTK A;  3PUZ A;  2VQE L;  2SDF A;  4OWX B;  1PTO C;  3I2Z A;  3ICE A;  3GTL B;  2EXZ A;  3TEH B;  2RBM A;  1I94 L;  5DNF A;  3TBI B;  4PZ8 A;  1EY0 A;  4XQJ A;  4X62 L;  5I4D A;  2DN8 A;  4A3C G;  4IQZ A;  1D1I A;  3NBH A;  3I72 A;  1K9M C;  2B2Y A;  1HFG A;  3CC2 A;  1TWH B;  4KHV A;  1C8C A;  5AJ3 L;  4BBS B;  4HCS A;  1I5F A;  2PZW A;  4IOA A;  1PZK D;  1N36 L;  1E2Z A;  2EDG A;  1SRU A;  1ZKO A;  4A76 A;  3CQZ B;  4Y7N B;  2DY7 A;  3M4Y A;  1Q12 A;  4DV1 L;  4A3I B;  3KK7 A;  5IP9 G;  4PNY A;  3M4O H;  1GJX A;  1CSP A;  2CH4 W;  2KHI A;  1F2M A;  1VQ7 A;  2KCC A;  1CKO A;  4RGM A;  4JI0 Q;  2AHO B;  4AYB G;  4JPB W;  2VQE Q;  4OWT B;  5IGB A;  5IP7 G;  2M00 A;  4NB3 A;  1FYC A;  4X3U A;  2KEE A;  1JR0 D;  4ZUI A;  2EY5 A;  4A3F G;  4HAE A;  5FJ8 G;  4X64 L;  5CMD A;  5AJ3 Q;  2AWN A;  3IAY A;  3C2P A;  1N36 Q;  3KF8 A;  3TRE A;  5I2Y A;  3J81 L;  1G51 A;  2OEO A;  2B2V C;  2F0V A;  4NP5 A;  2VXW A;  3U50 C;  2UXC L;  3TZU A;  4DV1 Q;  4L5Q A;  3RUZ A;  4KY6 A;  4F88 A;  2NBF A;  2CFM A;  1GUO A;  1D5X C;  2F0Q A;  3M4O B;  4FNF A;  1VF5 C;  1A2U A;  1KHI A;  5C0X G;  1STH A;  4IFD J;  1IBM L;  1I50 H;  4KK7 A;  4IPC A;  4FXK C;  1X3Q A;  2IW3 A;  3F2U A;  1Q1B A;  1HR0 L;  4IAL A;  4Q0F A;  1JE4 A;  4HTH A;  4A93 G;  1O7Z A;  1A15 A;  2B39 A;  2Z0S A;  4X64 Q;  3J81 j;  1W2B A;  1FVI A;  2IHE A;  1HTL D;  4BY7 G;  4I7A A;  1U9R A;  3TN2 A;  3VR3 A;  2F0J A;  3CCL A;  4DNI A;  2A69 D;  2EXD A;  2UXC Q;  1SLJ A;  1H9K A;  3KLW A;  1LT3 D;  1B1Z A;  4X65 L;  4O2D A;  5FLX L;  2E2J H;  5FLM H;  4LAA A;  1I4X A;  1IBM Q;  5EKL A;  5IGF A;  2PI2 A;  3I4M H;  1AP0 A;  3SGI A;  3JAM i;  1STG A;  2NZO A;  1HR0 Q;  1VQN A;  5LL6 X;  4DR3 L;  1IW7 D;  2BDO A;  2Y0S E;  1Q46 A;  1SE8 A;  3Q8D A;  2I07 B;  1EY9 A;  1XXG A;  1WTW A;  2B2U A;  1ENA A;  2AWO A;  3UDF A;  3KLS X;  5M5W H;  1PYS B;  1TS2 A;  4PMB A;  4YY3 L;  4RA8 A;  1XTC D;  1EQQ A;  4IUU A;  2QKI C;  3OIP A;  3K59 A;  3F2B A;  4LFB L;  1FNW A;  1P16 A;  4X65 Q;  1TQO A;  2ZT9 C;  1IBK Q;  1HXY D;  2MFI A;  3W5O A;  1PA6 A;  1FNU A;  4EGV A;  1EWH A;  1QNK A;  1DON A;  2RHS B;  2K04 A;  4CDE C;  1V1O A;  4V0B A;  2E2J B;  2JA9 A;  2F0N A;  1JB3 A;  5EJW A;  3CCS A;  1B8A A;  2L9H A;  2A6H C;  2PNH A;  1EWI A;  3K7A H;  3PV0 A;  2JYO A;  2D0P A;  3I91 A;  5ISR A;  4DR3 Q;  1HCZ A;  1PFN A;  1ZXT A;  2A69 C;  2QGQ A;  1X3G A;  3HRZ C;  2H4O A;  1JC7 A;  1SEB D;  2VQF L;  1X65 A;  3HFZ B;  2E5L L;  3CXC A;  1NSN S;  4YY3 Q;  1XWE A;  1C48 A;  1JJ2 A;  1EQV A;  3SK5 A;  3BYY B;  4Q5V A;  4ZLT F;  3JAM c;  5M5W B;  3HOW H;  5EPL A;  1U4R A;  3Q22 A;  1SE3 A;  5DM7 3;  4KD3 A;  5C5L A;  2B2T C;  4P72 A;  2F4V L;  3Q23 A;  2F0O A;  1BCP B;  5LL6 S;  4JI3 L;  1BBU A;  3VA5 A;  2OT2 A;  5TSS A;  2NN6 I;  1PMR A;  3SEB A;  1WTQ A;  1VQE A;  3EQL C;  3W1B A;  3S14 H;  3ITP A;  2PMZ B;  4ZAI A;  2ZXR A;  2K52 A;  3ULL A;  2F0T A;  2UUB Q;  3T53 B;  1F9P A;  1DYQ A;  1FJG L;  1ICF B;  3I4L A;  5T1G A;  1OXX K;  2FIN B;  3FDT A;  3K7A B;  2BCO A;  3A74 A;  4B9W A;  2K1B A;  1VMC A;  3FHW A;  4DA2 A;  2I0Q A;  4RH6 A;  3JAM E;  2B63 H;  3PIP A;  2VQF Q;  3ND8 A;  2E5L Q;  1UE7 A;  1GUN A;  3J80 i;  4A3E H;  4G7H C;  1HQM C;  1BCP C;  3CAM A;  3GTM B;  4CJ2 C;  2BH8 A;  1T5E A;  4H13 C;  1PYB A;  1LUZ A;  2F4V Q;  2ZXO A;  2X69 A;  4KLK A;  5A35 A;  5D3D A;  1FNV A;  4BBS G;  3I56 A;  5J22 A;  4JI3 Q;  3U9S A;  3FPU B;  1W3S A;  1SAP A;  1A62 A;  1R4P B;  3TP7 A;  4HR7 B;  5HGT A;  4JI1 L;  1A8V A;  1X3F A;  4A3I G;  2FMC A;  3ND9 A;  1ET6 A;  5CR3 A;  3WOF A;  2UUA L;  1E7Z A;  2Q8R E;  5KYI A;  1G6Z A;  5ELB A;  2FMM A;  2C5C A;  1TT2 A;  1WTV A;  4IUQ A;  1AE3 A;  3VR6 A;  2IHF A;  2VW9 A;  1PH9 A;  1G6P A;  1EZ8 A;  5JEA J;  1LTI D;  1S5E D;  4YWK A;  4C2M H;  3SE0 A;  1EY5 A;  4K6D A;  4HJ5 A;  4R8I A;  2R93 B;  1SYD A;  2ALY B;  4A3E B;  1FL0 A;  1QE6 A;  4WOR A;  4DXF A;  4ZUJ A;  3K5M A;  4OIK A;  5FO9 B;  3CC4 A;  1D2B A;  4G7O C;  1A6X A;  1YZ6 A;  4JI1 Q;  2NVY H;  2HCC A;  2Q2H A;  3FMC A;  3K0X A;  3HP3 A;  1KAW A;  2WB1 B;  3Q6S A;  2F0I A;  1I4H A;  1X3P A;  2XNA C;  2DNC A;  3AFP A;  5IP9 H;  3NEL A;  4RWS C;  2UUA Q;  4DF7 A;  4ABN A;  1SRO A;  1EIH A;  3DWA A;  3CME A;  1PH4 A;  3GO5 A;  4YIJ A;  1IXR A;  1GUT A;  3M4P A;  4CDD C;  2IX1 A;  4OO1 I;  1F2Z A;  5IP7 H;  3CCM A;  1OXS C;  4C2M B;  2K5N A;  1EQR A;  3T1H L;  3M7G A;  4DV3 L;  5FJ8 H;  3A0J A;  1AN8 A;  2BE5 D;  1TWF H;  4V19 0;  1HRJ A;  2EYH A;  4K0K L;  1O80 A;  1EUJ A;  1J5E L;  3I4N G;  5J39 A;  2V1C C;  1KRS A;  1Z7T A;  1ZYR D;  4HJ7 A;  4FF2 A;  3VYR A;  3T13 A;  1Y1W H;  1LAB A;  4KY5 A;  1WTX A;  4O0A A;  1Q90 A;  2NVY B;  4JOI C;  4K5V A;  3I73 A;  1JWS D;  2UXB L;  1TU2 B;  3H3V I;  4LUO A;  2ICE C;  2K75 A;  3H91 A;  2QDB A;  3M3Y H;  4XDX A;  1LTT D;  1RTN A;  2CQO A;  4CGY B;  5E3F A;  5FKA C;  5EPJ A;  4AYB B;  2PW5 A;  3T1H Q;  4NXM L;  1EYA A;  3MVV A;  4LW1 A;  4DXG A;  3A5Z B;  2K28 A;  4IO9 A;  4A93 H;  5JJL A;  4DV3 Q;  1F2Y A;  1STN A;  4WJ3 M;  1GOZ A;  3UDX A;  3SK8 A;  4LUZ A;  1KL9 A;  4K0K Q;  4GNX B;  1J5E Q;  3U58 A;  1AEX A;  2B3G A;  3J7Z C;  2CCZ A;  4BY7 H;  1TWF B;  3DEP A;  1ML0 D;  1QCB D;  1UE6 A;  3HOX G;  2N49 A;  2NN6 G;  2HIX A;  5I9P A;  3ER0 A;  4A3M H;  1Y1W B;  4MIU A;  2UXB Q;  1TWC H;  2DJG C;  3Q0A A;  4Z9C B;  2EJG C;  4F87 A;  3CRK C;  3MA2 B;  1QNU A;  5M3M H;  4QL5 A;  4UAI A;  3NUC A;  3P1H A;  4RKB A;  4XT1 B;  1SNQ A;  3EFX D;  1D5Z C;  2K33 A;  2EY6 A;  3M3Y B;  3AYH B;  4GNX C;  3D6C A;  1PFB A;  1STY A;  4NXM Q;  1KC8 C;  1N32 L;  5J1Z A;  2EYF A;  1ZYR C;  5GAD C;  4DUZ L;  1L2F A;  1YNJ C;  1VQM A;  3GV6 A;  3J7A V;  1EWC A;  2Z6K C;  1CUK A;  1EIG A;  3CP0 A;  2SNS A;  1DOL A;  3S1M B;  2Z9H A;  2J7Z A;  4ODG A;  2V4D A;  4XXE A;  3NWT A;  5K5P A;  3X3N A;  1SYF A;  1NTG A;  4RMF A;  1CA6 A;  3V05 A;  4K5X A;  4BY7 B;  2VB2 X;  2D62 A;  1LTG D;  2ASB A;  4K8J A;  3SVM A;  1TWA B;  4DR4 L;  3HS0 C;  5KYL A;  4A3M B;  1N34 L;  5ELF A;  4NMZ A;  3GTQ B;  5M3M B;  2BA1 A;  2YYZ A;  4L5R C;  1KLG D;  1OO9 B;  1XJV A;  4FP5 D;  3J81 c;  2IJ0 A;  2QW7 A;  1II3 A;  3K6O A;  3KF6 A;  1N32 Q;  1VQC A;  4DUZ Q;  2QIL A;  1K28 A;  4UHV A;  3V2T A;  2PMZ E;  4P74 A;  5FK9 C;  3G6J B;  4DK3 C;  4LWC A;  1PRT B;  2NTT A;  3J80 L;  2KHJ A;  1K83 B;  1JE5 A;  3NBH B;  1DCZ A;  4X66 L;  1I6V C;  1PTO F;  3TP5 A;  3I4O A;  4DR4 Q;  3WOE A;  5BN3 A;  4DR1 L;  1N34 Q;  1SYE A;  1U0L A;  2K01 A;  3DWP A;  4QMG A;  3SXH A;  2WKD A;  5CC4 A;  1S5D D;  4J15 A;  3QIA A;  2LFN A;  3H09 A;  1LTL A;  2F0S A;  4HJA A;  1PRT C;  1A2T A;  1MD2 D;  1SNC A;  2HDL A;  5GQO A;  2F03 A;  4OO1 G;  1RF2 D;  3UI2 A;  1F77 A;  4A4I A;  3PIO A;  2B2Y C;  1G2S A;  1IKL A;  2WAC A;  2N55 A;  5NUC A;  1NMG A;  1WJJ A;  5FLX c;  1K3B C;  5F2D A;  2E2H B;  3HEJ A;  4IUN A;  4DR5 L;  1JT8 A;  1RDP D;  2R93 G;  1WVL A;  2O5I C;  2UU9 L;  3OTO L;  3OWE B;  1YNN D;  3AQQ A;  4A3E G;  1S5B D;  1PFS A;  4X66 Q;  3S16 H;  3KF8 B;  3I70 A;  4DR1 Q;  1MJE A;  4JC0 A;  2I5H A;  4BBS H;  2RCF A;  1QJO A;  3QB3 A;  3KJP A;  2K7V A;  2EYM A;  4EX5 A;  5JVH 3;  2KJX A;  4OX9 L;  3CQZ H;  4KY7 A;  2KED A;  4Y7N H;  3AEV A;  4LJZ C;  1YHB A;  2CHB D;  5FO7 B;  1MHW C;  2TMP A;  2NWG A;  1ROD A;  1A3T A;  2WB1 E;  2QEX A;  5LMU L;  5M9O A;  4XYO A;  4CJ1 B;  4FO2 A;  5CV8 A;  1P8L A;  2JXM B;  3M7N A;  3ZYY X;  4DR5 Q;  1WCM H;  2AQ1 B;  2UU9 Q;  3OTO Q;  5GAE C;  4K8I A;  3L3O C;  5M3F H;  2NTS A;  2SNM A;  5JJI A;  3S16 B;  3ERQ A;  1J8I A;  4IZ8 A;  2XN9 C;  2CH4 A;  1G91 A;  2RQX A;  4JI8 L;  4OX9 Q;  4X3K A;  2Q2I A;  1QVF A;  1S4Z A;  3C1E A;  1KRT A;  4BXX H;  4BBR H;  1PV4 A;  2F0P A;  4BY1 B;  5JOB A;  2XVS A;  3TP6 A;  2Z1C A;  2A6H D;  3T16 A;  3U4Z A;  5IGE A;  3R2T A;  1S5F D;  1YNN C;  4UDU C;  1A3V A;  4ZKC B;  1IYJ B;  4KHP Q;  4RHS A;  4KKU A;  2A8V A;  4RG1 A;  3O13 A;  3GTP B;  4BWG B;  3T4A C;  3SR1 A;  1RKN A;  4DR7 L;  2M9V A;  1SDF A;  3E3X A;  3PO2 G;  3HKZ G;  1YIT A;  1WCM B;  4CBV A;  3H94 A;  1I94 Q;  1MIU A;  5J3B A;  3M4Q A;  1E2W A;  4OHJ A;  4OON A;  3TS0 A;  4X62 Q;  5M3F B;  4AYB E;  3J7Y W;  1VCI A;  3I4N H;  2K5D A;  1E1O A;  1V8Q A;  5E1F A;  4KV6 A;  4JI8 Q;  4DFA A;  2NYZ D;  1CQV A;  1J6Q A;  2XRQ D;  1HA5 A;  1HZ9 A;  1Y1W G;  5KRU A;  3S24 A;  4OL7 A;  3A7L A;  4QCL A;  2B8G A;  4BBR B;  2RSN A;  1NUC A;  2B2U C;  3DHQ A;  5I6W A;  5IY0 A;  2RHQ B;  2XWJ B;  3NHH A;  4IUP A;  2FXQ A;  1E22 A;  4HMJ A;  4IUT A;  4DR7 Q;  4LF9 L;  4KJN A;  4DV5 L;  4DR6 L;  1YBY A;  1TWG H;  3NE5 B;  4NKL A;  5EQ0 A;  2PNR C;  5C3E G;  3C1F A;  4JBK A;  2PQA A;  4LFC L;  1B50 A;  4XQQ A;  4GLV B; 
#chains in the Genus database with same CATH homology
 4DK0 A;  4C1N K;  3I4N B;  2NN6 H;  4KKT A;  1DXM A;  4KD4 A;  3D8G A;  1L0Y B;  4PMW A;  2F3V A;  2EOT A;  2R6G A;  4OGQ C;  2KQ3 A;  1BDO A;  4RGN A;  4EQP A;  5CV5 A;  1MSH A;  1M8A A;  1TWG B;  5IGC A;  2F0F A;  4WRD A;  1UUP A;  2K6A A;  4IUV A;  1EY6 A;  4K14 A;  4TSS A;  2JEA I;  2A68 D;  1SNO A;  2A74 C;  3VR4 A;  1B9M A;  1JOQ A;  2PO4 A;  4M1U B;  4ZYS A;  3HOX B;  1G2T A;  1EEF D;  4O42 A;  1I4Q A;  3C46 A;  4WJW A;  1DZ1 A;  2IPK D;  1NCV A;  3S1Q B;  2O5J C;  1BCP D;  4ZQ3 A;  1CZW A;  4C3H G;  2IX0 A;  2RVL A;  2EPB A;  2CW0 D;  3BDO A;  3VYU A;  1D1K A;  3NK9 A;  3WDN A;  5M5X B;  1G29 1;  2HCI A;  1EY4 A;  5C0X J;  1SE2 A;  1B2T A;  5M5Y B;  3HGB A;  4K2L A;  3A55 A;  1Q3L A;  1H9J A;  3RZO B;  4F8M A;  3SK4 A;  1ESR A;  3A8K E;  4J6H A;  3BZD B;  2VNU D;  3MHB A;  1R9T B;  1U4L A;  5COY A;  4OO1 H;  1CHP D;  2A68 C;  1Y8N B;  4L8J A;  2EJF C;  1SE4 A;  5C5M A;  2RDH A;  1AZP A;  3K5O A;  3IKJ A;  4DU9 A;  1EU3 A;  2NVT B;  2EVB A;  1I4R A;  2CW0 C;  1KNE A;  3NP8 A;  1FGB D;  3P75 A;  3W2D A;  1AFP A;  3NTI A;  3D4R A;  1Y8O B;  3FRP B;  5EBC A;  4NDX A;  3MAQ A;  3VYT A;  2JA5 B;  2KVM A;  3E0J A;  2G9D A;  3OMC A;  1Y69 U;  1AW7 A;  2RDG A;  2M2L A;  4X3S A;  1OXT A;  3Q24 A;  4I7Z C;  4ZRZ A;  4DAV A;  2F1M A;  2E75 C;  2IL8 A;  1JOR A;  4KN7 C;  4A3B B;  4HED A;  2JEB I;  4CKC A;  3PMF A;  2XIW A;  1FR3 A;  3CHB D;  1ET9 A;  1SFO B;  4PMC A;  3LWE A;  2KHS A;  1OXU A;  1SYG A;  1NR4 A;  1WD0 A;  1JIC A;  3NTH A;  4GZY C;  1HUM A;  1QIL A;  3A56 A;  2NVQ B;  4XT3 B;  1PYW D;  2L5T A;  1L0X B;  2KCN A;  1U4P A;  5JJZ A;  3T51 B;  5KEE A;  1TR5 A;  2ENB A;  2E2I B;  1KDA A;  4QB4 A;  4DAY A;  1CI3 M;  4QUC A;  1O78 A;  3H3V C;  3OOC A;  1GUW A;  2K5Q A;  3A7A B;  4DNR B;  1I3Q B;  3PUW A;  3J80 E;  3N6R A;  1PLF A;  5G3L D;  3EJI A;  1BNZ A;  1BR9 A;  2Q8I B;  5COR A;  2EYP A;  1SJH D;  1D6E C;  3K58 A;  4U68 A;  1YNJ D;  1HFN A;  5E4W C;  2Z8L A;  5D3I B;  1JOO A;  1JOK A;  1HTP A;  4RCO A;  2K05 A;  2NUC A;  3S2H B;  4EQO A;  1JWM D;  3DUZ A;  2A6E D;  4IN3 A;  1WD1 A;  3MXU A;  4WFN 3;  3TDQ A;  5KNB A;  5C4J B;  5DEH A;  5A2Q L;  3LNN A;  4G4K A;  3PO2 B;  3HKZ B;  2QF7 A;  3S9W A;  3K5L A;  3V96 A;  4JBW A;  2IWH A;  2RA4 A;  3NXW A;  4DNT B;  2C9O A;  1O7Y A;  3D4D A;  4IFD I;  3PUX A;  3MFG A;  1B53 A;  3LX0 A;  2EYJ A;  1K8M A;  2PQE A;  3A54 A;  3MEH A;  3HOY B;  1SYB A;  4N9T A;  3PIP 3;  2L11 A;  3D6W A;  4DAP A;  4FVM A;  2MHV A;  4KKS A;  5JVG 3;  1TII D;  2BA0 A;  1KAB A;  1LTR D;  4QUF A;  1LO5 D;  3S15 B;  4FXG C;  3HZX A;  5EBD A;  2PCF B;  5I2X A;  1PRT D;  4RHR A;  2LMC B;  5C3E B;  4KJO A;  5IGG A;  5KND A;  1LT5 D;  4FF4 A;  5FOB B;  5CV9 A;  1HQR D;  2A6E C;  3RMH A;  1XYI A;  2PZT A;  2NVX B;  4RFB A;  1V1P A;  1XX8 A;  3RD4 A;  1Z47 A;  2WKC A;  1SNM A;  1SNP A;  2F0U A;  3TME A;  3FKI B;  2EZV A;  1TS4 A;  4HCE A;  2WV6 D;  1SJE D;  1EEI D;  3HG9 A;  5JPN C;  1QOH A;  2MGS A;  1U4M A;  3GTJ B;  1LTB D;  5K36 H;  3TSS A;  3K0Y A;  4A3D B;  4A3K B;  2L55 A;  4G57 A;  3E6Z X;  3AB9 A;  5CBE E;  1QWY A;  5AFW A;  4ID6 A;  4X3T A;  1QG7 A;  5C0X I;  2J4X A;  4C3H B;  1C4Q A;  1K8O A;  3KBG A;  1F9R A;  3IL8 A;  5CV7 A;  1IHZ A;  4HN7 A;  1ILP A;  4A3G B;  2A5H A;  4ILW A;  2IX3 A;  2B2W C;  3HOU B;  3GTO B;  1MI2 A;  1LT4 D;  4CKE A;  2F0H A;  4FYD A;  1GUG A;  2F0W A;  2F0K A;  3FEW X;  2PPB C;  1JQY D;  1VF7 A;  3IFT A;  1SMY D;  5DAU A;  1MBY A;  1WTR A;  5CGK A;  2PW7 A;  2F0E A;  1ESF A;  4RGT A;  1EL0 A;  2R3Z A;  2MP1 A;  3MTS A;  3VR5 A;  1STB A;  3DM1 A;  1STA A;  1Y1V B;  3MXG A;  1LAC A;  4IFD G;  3PUV A;  4FF3 A;  5C4H A;  2R7Z B;  1DOM A;  5EKI A;  3K5N A;  2RSO A;  3OW7 A;  5BN4 A;  1H9S A;  4XYQ A;  2PYK A;  2B2W A;  4LMQ D;  4H44 C;  2HUG A;  1IL8 A;  4C3I G;  2O2L D;  2BDN A;  2E76 C;  3GTK B;  2NB0 A;  1TS5 A;  2CQA A;  4L63 B;  1R4Q B;  1WTP A;  4A3J B;  2A73 B;  1TVX A;  4KMU C;  1KDC A;  2ZXP A;  1BO0 A;  1SMY C;  3A8I E;  1CK1 A;  2MUY A;  4NW2 A;  4C56 C;  3MXP A;  1BUV T;  3BVM A;  1GXD C;  2F0G A;  2FFK B;  1QB5 D;  2F0M A;  3BS1 A;  1KAA A;  2EJM A;  1H9R A;  3AMU A;  3D4W A;  2DY8 A;  3MXN A;  3NPP A;  1EY8 A;  4U67 3;  3MC0 B;  1I6H B;  3AU7 A;  2EYO A;  1T5X D;  1BOS A;  4BA2 I;  3NQI A;  1EU4 A;  1PDQ A;  3BG3 A;  1JWU D;  2FHT A;  1IYU A;  1SXT A;  5ELD A;  1RD9 D;  2KA7 A;  2L4N A;  3RZD B;  2HDM A;  2E2D C;  4P2C B;  1CQF A;  3P20 A;  3PIO 3;  3ONA B;  1CT1 D;  3GP7 A;  2L1B A;  3HOZ B;  4MHE A;  4R8N A;  5CV6 A;  1UNS A;  2XRS D;  1WTO A;  1ICW A;  1LTS D;  1ILQ A;  5CV4 A;  2AQ2 B;  1EQT A;  2JSO A;  1JCK B;  1FD7 D;  2WAQ B;  3DEO A;  4R9W A;  2EY1 A;  1CM9 A;  4DGZ A;  3R2I A;  5DM6 3;  2KOL A;  2MJ8 A;  3IFD A;  1SYC A;  5KNC A;  3SDZ A;  3KUP A;  1HUN A;  4IUR A;  4K2K A;  4ZK9 B;  2VUM B;  4EQN A;  4RKL A;  4XTC S;  1B9N A;  1BCP F;  4F7X A;  1HPC A;  1I50 B;  2B2V A;  2H1E A;  3CU7 A;  3H0G B;  1EY7 A;  2OXP A;  3SK6 A;  3QG1 A;  1IYV A;  1B44 D;  1UAP A;  3NSW A;  3OMG A;  1STE A;  3J7A F;  3PUY A;  3QO2 A;  3U9O A;  3BYT B;  1I4G A;  4KN4 C;  1NAP A;  3OPO A;  2LS0 1;  1RTO A;  1TS3 A;  5IIF A;  2ICI A;  3DWQ A;  5K36 G;  4H0L C;  3NTK A;  5JEA G;  4ME5 A;  3M85 A;  1B4O A;  2X6L A;  2LY7 A;  1MSG A;  1BF4 A;  1LT6 D;  1VDZ A;  3GV3 A;  3I4M B;  5D14 A;  3FVQ A;  3NQT A;  3OIQ A;  1TY0 A;  1CTM A;  4BA1 I;  3D31 A;  4CJ0 B;  2O4X A;  2N88 A;  3PO3 B;  1TKW B;  1PFM A;  5A2Q E;  4DN4 M;  3QWN A;  3BDL A;  3KBX A;  5EGT A;  4ULL A;  2L12 A;  1V43 A;  3SHL A;  2K03 A;  1IW7 C;  4QF4 A;  2K5W A;  2EYL A;  1B3A A;  2I46 A;  4I65 A;  3QOJ A;  1Z6H A;  3BVG A;  4O1N A;  3RLF A;  1EOT A;  1HA6 A;  1PXU A;  2KUM A;  5IT9 E;  3VYS A;  2G9H D;  2X6G A;  3W3A A;  1PZI D;  2F3W A;  3HOW B;  2EE1 A;  3I8Z A;  2ID0 A;  3BDC A;  4QIW B;  3X3M A;  4IFD H;  4FF1 A;  2PZU A;  1BBX C;  3I90 A;  3DXJ C;  4L6T B;  2E74 C;  4RCN A;  3S14 B;  2NZ1 D;  2R92 B;  2B2T A;  2JP1 A;  5ELC A;  1CA5 A;  1DD2 A;  4C3J B;  1Q1E A;  5T1I A;  5C4X B;  2B63 B;  1BXT A;  3S1N B;  2HQE A;  1I4P A;  4K5W A;  1CHQ D;  3MWY W;  3CRL C;  5C6A A;  1Y8P B;  5IOD A;  3H6M A;  4BS9 A;  3EA6 A;  3R8B A;  5HUR A;  2QCP X;  1S5C D;  1IKM A;  5G3L F;  2RKS A;  4M8A A;  1BQQ T;  4RGO S;  1E2V A;  5CYU A;  4PV1 C;  1LTA D;  1V1P B;  2TSS A;  2JE6 I;  2VB3 X;  5IGD A;  2XWB B;  5KGU A;  3KLS A;  3URY A;  4C3I B;  3S1R B;  1OXV A;  3TP8 A;  1Q8I A;  3QJY A;  3QOL A;  1RHP A;  1D5M C;  4KI0 A;  2K32 A;  1TY2 A;  1SSO A;  2WP8 J;  2KEC A;  1CFM A;  2SEB D;  2QEJ C;  5C44 B;  5I6Y A;  5IOC A;  1EFI D;  2AQ3 B;  5C0X H;  4CHT B;  2JA6 B;  2FJ2 A;  5KIX A;  5IT9 L;  1ONL A;  3A8J E;  3I3C A;  3JAM L;  2YU9 B;  3GQB A;  4N9P A;  4RAU C;  3NBI A;  2BOS A;  3R93 A;  1KNA A;  1DM0 B;  5D65 A;  1F9S A;  4CKB A;  5E4X A;  3DMU A;  4LK1 C;  5C3W A;  4A3F B;  1M4V A;  4TQU S;  4HSP A;  1G8Z D;  2WII B;  1RCV D;  2GA4 B;  2XSC A;  1F2L A;  1PRT F;  2SOB A;  5FO8 B;  1ZEQ X;  5EPK A;  1O7L A;  3VR2 A;  3T56 B;  4B08 A;  3EVQ A;  3P7J A;  3S17 B;  2BE5 C;  1J9O A;  4MN3 A;  4S3S A;  5CBA E;  3C3L A;  1LLR D;  3ERO A;  5JPM C;  4KTA A;  3E5S A;  3FPP A;  4A93 B;  1ENC A;  1NR2 A;  3R3O A;  5EKK A;  1A3U A;  5I9O A;  4J8Q A;  3D3R A;  1LV9 A;  1HHV A;  3HOV B;  4J1M A;  4FXD A;  3N52 A;  3G7L A;  3TZD A;  4KHZ A;  2Z4I A;  4OIJ A;  2AUK A;  4K6L A;  5ELE A;  1TWC B;  2CVR A;  2F0L A;  4C1N I;  5JEA H;  3L7Z C;  1E0B A;  2IT1 A;  1H9S B;  1EYD A;  4G7Z C;  2Y0S B;  1W6J A;  2JA7 B;  1ENF A;  2D2C C;  2B8F A;  5C3X A;  5BN5 A;  3KLR A;  2LKV A;  4XIG S;  3S2D B;  1F9Q A;  2Q8T A;  2OF1 A;  2L0C A;  4EVO A;  2AUJ D;  1GUS A;  2RDF A;  4B9X A;  3BVZ A;  4XQN A;  2F0D A;  4H7B A;  4TRD A;  3OSO A;  2WIN B;  3CKI B;  4DK1 A;  2D9U A;  1PTO H;  1EYC A;  3J81 E;  1PTO D;  1GHK A;  4TKO B;  3K57 A;  3OHX C;  3VA7 A;  1CZG A;  2EY2 A;  2F4I A;  1W6K A;  2R61 A;  5LHY 1;  3GD7 A;  1DJR D;  3MFY A;  1PZJ D;  5C4Z A;  4C3J G;  2MPM A;  4ZKB B;  1SND A;  4E6I A;  1KDB A;  1H9M A;  2JA8 B;  3L9A X;  1SBB B;  5JAV A;  1EZ6 A;  1DOK A;  1PTO B;  2Z4H A;  1AZQ A;  4PQX A;  1VMP A;  1UEA B;  1KLU D;  5FLX E;  3MZ5 A;  2D5D A;  1RJT A;  1X32 A;  2J0T D;  1MGS A;  3LWU A;  3OWF A;  3NWS A;  2DNE A;  3GTG B;  4JK1 C;  4HMI A;  1GHJ A;  4HSV A;  1KTK A;  3PUZ A;  2SDF A;  1PTO C;  3GTL B;  2EXZ A;  2RBM A;  5DNF A;  3TBI B;  4XQJ A;  1EY0 A;  5I4D A;  2DN8 A;  4IQZ A;  1D1I A;  3NBH A;  3I72 A;  2B2Y A;  1HFG A;  1TWH B;  4KHV A;  1C8C A;  4BBS B;  4HCS A;  2PZW A;  1PZK D;  1E2Z A;  2EDG A;  1ZKO A;  3CQZ B;  4Y7N B;  2DY7 A;  3M4Y A;  1Q12 A;  4A3I B;  3KK7 A;  1GJX A;  4PNY A;  1F2M A;  2KCC A;  4RGM A;  5IGB A;  2M00 A;  1FYC A;  4X3U A;  2KEE A;  1JR0 D;  4ZUI A;  2EY5 A;  4HAE A;  5CMD A;  2AWN A;  3IAY A;  3C2P A;  3KF8 A;  5I2Y A;  3J81 L;  2OEO A;  2B2V C;  2F0V A;  4NP5 A;  2VXW A;  3TZU A;  3RUZ A;  4KY6 A;  4F88 A;  2NBF A;  1GUO A;  1D5X C;  2F0Q A;  3M4O B;  4FNF A;  1VF5 C;  1A2U A;  5C0X G;  4IFD J;  1STH A;  4KK7 A;  4FXK C;  1X3Q A;  2IW3 A;  3F2U A;  1Q1B A;  4IAL A;  4Q0F A;  1JE4 A;  4HTH A;  1O7Z A;  1A15 A;  2B39 A;  1HTL D;  1U9R A;  3TN2 A;  3VR3 A;  2F0J A;  2A69 D;  1H9K A;  1LT3 D;  1B1Z A;  5FLX L;  4LAA A;  1I4X A;  5EKL A;  5IGF A;  1AP0 A;  1STG A;  5LL6 X;  1IW7 D;  2BDO A;  2I07 B;  1EY9 A;  1XXG A;  1WTW A;  2B2U A;  1ENA A;  2AWO A;  3KLS X;  1TS2 A;  4PMB A;  4RA8 A;  1XTC D;  4IUU A;  2QKI C;  3OIP A;  3K59 A;  1FNW A;  1TQO A;  2ZT9 C;  1HXY D;  1FNU A;  4EGV A;  1EWH A;  1QNK A;  1DON A;  2K04 A;  1V1O A;  4V0B A;  2E2J B;  2F0N A;  1JB3 A;  5EJW A;  2L9H A;  3PV0 A;  2JYO A;  3I91 A;  5ISR A;  1HCZ A;  1PFN A;  1ZXT A;  2A69 C;  3HRZ C;  2H4O A;  1JC7 A;  1SEB D;  1NSN S;  1XWE A;  1C48 A;  1EQV A;  3SK5 A;  3BYY B;  4Q5V A;  4ZLT F;  5M5W B;  5EPL A;  1U4R A;  3Q22 A;  1SE3 A;  5DM7 3;  4KD3 A;  5C5L A;  2B2T C;  3Q23 A;  2F0O A;  1BCP B;  5LL6 S;  3VA5 A;  2OT2 A;  5TSS A;  2NN6 I;  1PMR A;  3SEB A;  1WTQ A;  3EQL C;  3ITP A;  2PMZ B;  4ZAI A;  2ZXR A;  2F0T A;  3T53 B;  1F9P A;  1DYQ A;  3I4L A;  5T1G A;  1OXX K;  2FIN B;  3FDT A;  3K7A B;  2BCO A;  4B9W A;  2K1B A;  1VMC A;  4DA2 A;  4RH6 A;  3JAM E;  3ND8 A;  1GUN A;  4G7H C;  1HQM C;  1BCP C;  3GTM B;  4CJ2 C;  1T5E A;  4H13 C;  2ZXO A;  2X69 A;  5A35 A;  5D3D A;  1FNV A;  5J22 A;  3U9S A;  3FPU B;  1SAP A;  3TP7 A;  1R4P B;  5HGT A;  4HR7 B;  2FMC A;  3ND9 A;  1ET6 A;  5CR3 A;  3WOF A;  5KYI A;  2Q8R E;  1G6Z A;  5ELB A;  2FMM A;  2C5C A;  1TT2 A;  1WTV A;  4IUQ A;  3VR6 A;  1EZ8 A;  5JEA J;  1LTI D;  1S5E D;  3SE0 A;  1EY5 A;  4K6D A;  4R8I A;  2R93 B;  1SYD A;  4A3E B;  1QE6 A;  4WOR A;  4DXF A;  4ZUJ A;  3K5M A;  4OIK A;  5FO9 B;  1D2B A;  4G7O C;  1A6X A;  2HCC A;  3FMC A;  3HP3 A;  2WB1 B;  3Q6S A;  2F0I A;  1I4H A;  1X3P A;  2XNA C;  2DNC A;  4RWS C;  4DF7 A;  4ABN A;  1EIH A;  3DWA A;  3GO5 A;  4YIJ A;  1GUT A;  2IX1 A;  4OO1 I;  1F2Z A;  1OXS C;  4C2M B;  3M7G A;  1AN8 A;  2BE5 D;  4V19 0;  1HRJ A;  2EYH A;  1O80 A;  5J39 A;  1Z7T A;  1ZYR D;  4FF2 A;  3VYR A;  3T13 A;  1LAB A;  4KY5 A;  1WTX A;  1Q90 A;  2NVY B;  4K5V A;  3I73 A;  1JWS D;  1TU2 B;  2ICE C;  3H91 A;  2QDB A;  4XDX A;  1LTT D;  1RTN A;  4CGY B;  5E3F A;  5FKA C;  5EPJ A;  4AYB B;  2PW5 A;  1EYA A;  3MVV A;  4DXG A;  2K28 A;  1F2Y A;  1STN A;  1GOZ A;  3SK8 A;  1AEX A;  1TWF B;  3DEP A;  1ML0 D;  1QCB D;  2NN6 G;  5I9P A;  1Y1W B;  4MIU A;  3Q0A A;  4Z9C B;  2EJG C;  4F87 A;  3CRK C;  3MA2 B;  1QNU A;  4UAI A;  3NUC A;  3P1H A;  4RKB A;  4XT1 B;  1SNQ A;  3EFX D;  1D5Z C;  2K33 A;  2EY6 A;  3M3Y B;  3D6C A;  1PFB A;  1STY A;  5J1Z A;  2EYF A;  1ZYR C;  1YNJ C;  3GV6 A;  3J7A V;  1EWC A;  1EIG A;  2SNS A;  1DOL A;  3S1M B;  2J7Z A;  4ODG A;  2V4D A;  4XXE A;  3NWT A;  5K5P A;  3X3N A;  1SYF A;  1CA6 A;  3V05 A;  4K5X A;  4BY7 B;  2VB2 X;  2D62 A;  1LTG D;  4K8J A;  3SVM A;  1TWA B;  3HS0 C;  5KYL A;  4A3M B;  5ELF A;  4NMZ A;  3GTQ B;  5M3M B;  2BA1 A;  2YYZ A;  1KLG D;  1OO9 B;  4FP5 D;  2IJ0 A;  1II3 A;  3K6O A;  2QIL A;  3V2T A;  5FK9 C;  3G6J B;  3J80 L;  1PRT B;  2NTT A;  1K83 B;  1DCZ A;  1I6V C;  1PTO F;  3TP5 A;  3WOE A;  5BN3 A;  1SYE A;  2K01 A;  3DWP A;  4QMG A;  3SXH A;  2WKD A;  5CC4 A;  1S5D D;  3QIA A;  2LFN A;  3H09 A;  2F0S A;  1PRT C;  1A2T A;  1MD2 D;  1SNC A;  2HDL A;  2F03 A;  4OO1 G;  3UI2 A;  1RF2 D;  1F77 A;  2B2Y C;  1G2S A;  1IKL A;  2WAC A;  2N55 A;  5NUC A;  2E2H B;  5F2D A;  3HEJ A;  4IUN A;  1RDP D;  1WVL A;  2O5I C;  3OWE B;  1YNN D;  1S5B D;  3I70 A;  1QJO A;  3QB3 A;  2K7V A;  2EYM A;  5JVH 3;  2KJX A;  4KY7 A;  2KED A;  4LJZ C;  2CHB D;  5FO7 B;  2TMP A;  2NWG A;  1ROD A;  1A3T A;  5M9O A;  4XYO A;  4CJ1 B;  4FO2 A;  5CV8 A;  2JXM B;  3M7N A;  3ZYY X;  2AQ1 B;  4K8I A;  3L3O C;  2NTS A;  2SNM A;  3S16 B;  3ERQ A;  1J8I A;  4IZ8 A;  2XN9 C;  1G91 A;  2RQX A;  4X3K A;  1S4Z A;  3C1E A;  4BY1 B;  2F0P A;  5JOB A;  2XVS A;  3TP6 A;  2Z1C A;  2A6H D;  3T16 A;  5IGE A;  3R2T A;  1S5F D;  1YNN C;  4UDU C;  1A3V A;  4ZKC B;  4RHS A;  4KKU A;  3O13 A;  3GTP B;  4BWG B;  3T4A C;  3SR1 A;  1RKN A;  2M9V A;  1SDF A;  1WCM B;  4CBV A;  3H94 A;  1E2W A;  4OHJ A;  5M3F B;  3J7Y W;  1VCI A;  2K5D A;  1V8Q A;  5E1F A;  4KV6 A;  4DFA A;  2NYZ D;  1CQV A;  2XRQ D;  1HA5 A;  5KRU A;  4OL7 A;  3A7L A;  4QCL A;  2B8G A;  4BBR B;  2RSN A;  1NUC A;  2B2U C;  3DHQ A;  5I6W A;  2XWJ B;  3NHH A;  4IUP A;  4HMJ A;  4IUT A;  4KJN A;  3NE5 B;  4NKL A;  5EQ0 A;  2PNR C;  3C1F A;  1B50 A;  4XQQ A;  2A6H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...