2RDFA

Crystal structure of staphyloccocal nuclease viagan/e75a variant at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
125
Chain Sequence
LHKEPATLIKAIDGNTVKLMYKGQPMVFRLLLVDIPKYGPEAAAFTKKMVENAKKIEVAFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQHLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Electrostatic effects in a network of polar and ionizable groups in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 36
structure length 125
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rdfA00
4KJNA 3RUZA 4HTHA 3OWFA 1KDBA 1KDAA 1EQVA 3OMGA 3NK9A 4NKLA 4PMCA 4R8NA 3SK5A 4F7XA 5CC4A 4LAAA 5IIFA 3EJIA 4ID6A 3P1HA 1ENCA 2F0MA 3QOJA 1EY4A 1F2YA 2EY1A 4KD3A 2F0NA 4KTAA 5EKKA 4ZUIA 5CV7A 5NUCA 3TP6A 4EVOA 3BDLA 4ODGA 4E6IA 1EY5A 3QOLA 4MIUA 2PQEA 2ENBA 5CV6A 5KEEA 5C6AA 1SYGA 2EY2A 2F3VA 2WACA 4KY7A 4EQOA 3VA5A 1STNA 3TMEA 1TR5A 1F2ZA 4OL7A 4PMBA 3T13A 3E5SA 4RKBA 1STAA 4K5VA 5M9OA 5KYLA 1AEXA 4H7BA 1EYDA 4ZUJA 1SYEA 3LX0A 3C1EA 3MXPA 3NP8A 3OMCA 4I65A 4IALA 5C3XA 2F0HA 4YIJA 2F3WA 5CV8A 5ISRA 2KHSA 2M00A 3NQTA 5KRUA 3NXWA 5KYIA 5HURA 2PZTA 4KY5A 5I9PA 4K8IA 3TP8A 3BDCA 2F0GA 5CV4A 3EROA 3EVQA 1NSNS 1KDCA 2F0WA 4K6DA 3T16A 1STYA 1KABA 1SYCA 4QB4A 2F0EA 1JOOA 2EYOA 2F0JA 2PW5A 4RKLA 4F8MA 5IODA 5KIXA 4KY6A 3V2TA 1EY0A 2KQ3A 1NUCA 4K5XA 1STGA 1A2UA 5CV9A 4ME5A 2F0TA 3HZXA 4NDXA 2F0FA 1JOQA 3SK8A 4J6HA 4EQNA 2F0VA 2SOBA 3D4DA 1JOKA 1EY6A 4KV6A 5C5LA 2F0OA 2SNMA 5K5PA 1STHA 2PZWA 5DEHA 2RDFA 2F0QA 2PW7A 3D4WA 2EYJA 3SK4A 5IGFA 3D6CA 3ITPA 5E3FA 5J1ZA 1SYDA 4QF4A 4K2KA 3P75A 1EYAA 3D8GA 5C4ZA 5IGGA 1TT2A 2EXZA 5I9OA 4J1MA 1SNQA 4HMJA 2QDBA 4K8JA 4ZQ3A 5CGKA 1A3UA 5I6YA 1EZ6A 4N9PA 4QMGA 3TP7A 1IHZA 3SHLA 4DF7A 5J22A 1SNPA 3SK6A 1EYCA 4NP5A 4WRDA 4IZ8A 2F0DA 1SNCA 5I6WA 1SNOA 1EY7A 1A3VA 1A3TA 4DGZA 5C5MA 4NMZA 4S3SA 2OXPA 4K5WA 2PZUA 2HQEA 4G57A 1EY9A 5CV5A 5IGCA 2OEOA 4IUNA 1TQOA 3SR1A 2PYKA 5IOCA 3MHBA 3DMUA 2EYHA 1SNDA 1SYFA 2RBMA 3TP5A 1JORA 1ENAA 1U9RA 4TRDA 4EQPA 5JAVA 3U9OA 5IGBA 1SNMA 1RKNA 2OF1A 3SXHA 4HMIA 2EY6A 2EYPA 5JOBA 4K14A 4WORA 3NUCA 4PNYA 3MVVA 3S9WA 3HEJA 5KGUA 2F0PA 5EGTA 2F0UA 5J39A 3R3OA 3MZ5A 4DU9A 2O4XA 3NHHA 2F0KA 1F2MA 1EZ8A 1II3A 3C1FA 5C4HA 5EKLA 5F2DA 5C3WA 3ERQA 5IGDA 2SNSA 3DHQA 1EY8A 2F0LA 2RKSA 5CR3A 2F0IA 4K2LA 4KD4A 4B9XA 4DFAA 2LKVA 2F0SA 2NUCA 3QB3A 4N9TA 2EYLA 4KJOA 3PMFA 1KAAA 1SYBA 1STBA 5IGEA 3MEHA 1A2TA 5HGTA 2EYMA 5E1FA 4KHVA 3OSOA 4B9WA 2EY5A 5DAUA 3H6MA 2EYFA
chains in the Genus database with same CATH superfamily
4GKJL 2HDLA 4JC0A 2FJ2A 1PH7A 4NB3A 1NBWA 3R93A 4R4OA 1NTGA 4DK0A 3I8ZA 2RVLA 3K7UC 1EWCA 3K81C 3CCEA 1K8AC 4HR7B 1H9RA 3S16B 1O7ZA 1PFNA 4A3GG 4MIUA 3MXNB 1PLFA 4A3MG 5EPJA 4IO9A 4JI1Q 3R2IA 3MTSA 4EQOA 4X66L 3AU7A 1Q81C 2E75C 4CKBA 2PMZE 3J7YW 1G8ZD 5TSSA 1AEXA 4ZUJA 1EYDA 2ZM6L 1VQGA 4ZKBB 2JA6H 1C9OA 1X54A 2M00A 2AQ1B 4X62Q 1T5EA 1TXYA 2JE6I 3NXWA 1K73C 5HURA 1SAPA 1EU3A 4BY7G 1K9MC 2E76C 2D2CC 3VYRA 1NNXA 2Q8TA 1PH5A 3K59A 4JI5Q 2SOBA 1FGBD 4DR6Q 1YEZA 1B44D 1EU4A 1GVPA 1EEID 2O5IC 2K7VA 5E3FA 4DV5Q 1RJTA 4I7ZC 3P75A 2N88A 3EN2A 5C4ZA 1YNXA 5I9OA 3G48A 2JK8A 1A63A 1Z9FA 4Z9CB 4A3JG 1I6VC 1K8MA 2MO1A 1OXSC 2A1AA 2WB1G 1LV9A 2B8FA 3FPUB 3QIAA 3A8JE 4FXDA 1ZKOA 2FINB 5I2YA 1QZGA 1DCZA 2KCTA 4NMZA 2OXPA 4K5WA 5DNFA 4R4QA 5HGQA 4OONA 3KF6B 1HUNA 3T53B 2DNEA 3VR3A 3I72A 4GLVB 4R4TA 3DLLA 4LFBL 1JE5A 3MA2B 4G7OC 4JK1C 3G4SA 2EY6A 2EYPA 5AJ3Q 4RH6A 3CP0A 4ULLA 1VQ9A 2DY8A 2B2YA 3RZOH 3IL8A 4QUFA 3RZDH 4A3LH 5M3FB 5J39A 4WFN3 1AZQA 5FLMG 3KLSA 4DR4L 2F4IA 3WOEA 1TVXA 2P5ZX 1U5KA 1K8GA 4FNFA 1EIYB 2IL8A 3VR4A 3HOWG 3I4MH 2B2WC 1VQPA 1GUOA 1W2BA 2A6HC 3TN2A 1N34L 4JW0A 3HOZB 3F2BA 3OIPA 4MHEA 1CT1D 1IZ6A 2K03A 2N78A 3ND8A 1PH4A 3T1HQ 1O7YA 4JVZA 1NE3A 5EKKA 4ZKCB 4JBWA 2PQEA 2ENBA 4A76A 4DAMA 2JEAI 4R4IA 4BBRG 4WJWA 4H7BA 4JBMA 1I50H 2JJQA 4OX9L 4KKSA 1B4OA 1JWSD 1ENFA 2PNRC 1MGSA 1ML0D 5C0XJ 1HRJA 2QDLA 5M5XB 1PXUA 3TP8A 1TWHH 1CHPD 1KDCA 2BE5C 5A35A 1XNRQ 2PW5A 3K6OA 3GTPB 2BOSA 2EE1A 2IX1A 1S5CD 4OELB 4BBSG 1GHJA 3A8IE 1JOKA 4DV7L 3ONAB 3CCRA 2G5DA 2QW7A 1HZ9A 4H44C 2NZHA 3Q23A 4QQBX 5C0XH 5J1ZA 1N33L 5BN5A 5M5YH 4JI2L 3RN5A 4MNOA 2QDBA 5JEAG 3CPWA 2E2HB 1LYLA 4Y7NH 1MIUA 3J81c 2L11A 4YHHL 1DD2A 5J22A 2Z6KA 4P75A 3ULLA 5D14A 1Y1WG 3S1NB 4ZAIA 1F2LA 1HTLD 1QILA 2PNHA 3J80c 3C2PA 4AYBE 3GTLB 4N8FA 3W1GA 4WJ3M 4LUZA 1WJJA 2DJFC 1GUNA 3I91A 2R92H 1HNWL 1RKNA 2RA4A 5BN3A 3PO2G 3TSSA 5C4XH 3S1QB 4TVAB 2FHTA 4JPBW 4RMFA 5KGUA 2KENA 1LLRD 1I3QB 1O7IA 2GN5A 3GV6A 5C3WA 2K32A 2PI2E 4QIWB 2R7DA 2UUCL 3CCLA 3GTQB 2ZXOA 1B3AA 4KJOA 2UU9L 4C1NI 5M3MB 3RNUA 1SYBA 4HIMA 3MEHA 5E4WC 2HHHL 2JA8G 1Q8KA 4POFA 4YWLA 5IP7G 1B70B 1KAWA 3RUZA 3VR2A 2VNUD 2A69D 2NTSA 2R61A 4O0AA 5IIFA 1IXRA 3P20A 3P1HA 2WV6D 4ID6A 3K5MA 1MJCA 4B3RL 1Q46A 5IYCH 1EOTA 1QVCA 1L2FA 5E4XA 3S17H 3H0GG 2NVYB 4AH6A 4UP9A 1TS5A 2EY2A 3M3YB 2ALYB 1YJ9A 1SFOH 4LF9Q 2JEBI 1M4VA 4HJAA 3A8KE 3DM3A 1HFGA 1ZYRD 2XSCA 2LFNA 1QNKA 3IKJA 4YIJA 4UP8A 2KECA 3JC66 3S2DH 3KK7A 1EUJA 3BDCA 2F0GA 2QILA 2F0EA 3CAMA 2F0JA 5IODA 1OXTA 2CVRA 4J15A 2EDGA 4JG2A 1E2ZA 3D4DA 4M1UB 4YWKA 4JI8L 2RDFA 2EJFC 2RSOA 1VQIA 1X3EA 3SK4A 3STBC 2KA7A 1ONLA 1BBUA 1ET6A 1S5FD 4M8AA 1HH2P 4CDFC 4DAYB 3BZDB 2EJGC 3N52A 2TSSA 1EQTA 2NYZD 1C7YA 1X3GA 1PRTB 4IPDA 3H3VI 5JPNC 4NPSA 2KBNA 3SK6A 3K7AH 3H91A 3W3AA 2IHFA 3O13A 4UHVA 1IBLL 2ASBA 1B3QA 1YNJD 5I6WA 1LO5D 2CH4A 1UE1A 4PZ6A 2LY7A 4S3SA 3HOXH 2KJXA 5CBAE 5C3EG 5IGCA 2B2TA 4MTNA 5K36H 4RG1A 1JORA 1CUKA 4TRDA 2NN6H 3SXHA 3A56A 4HMIA 1EIFA 1Z7TA 1QNUA 2H4OA 4QJFA 5CMDA 3PIP3 1JWUD 2QKIC 4FXGC 2K50A 2I5HA 4ZCKA 1J5EL 3CF5A 4IURA 1LT6D 2RCFA 2SEBD 1F9PA 1S5BD 5C4JB 2A6EC 4B3TQ 2XRSD 4ZRZA 4LF8Q 3J7ZC 1DGSA 2NUCA 1A15A 4LF7L 4HIDA 5EBDA 2YYZA 2AWNA 3J81j 2WIIB 5IT9E 3JAMc 2B63G 2PI2A 5ELCA 2F03A 2VUMG 1VQ5A 4L5QA 4R8NA 4A3FB 1VQMA 2B2VA 3TS0A 5FJ8G 1BQQT 4DR3L 2Y0SB 3GDEA 5KEEA 1X56A 4LFCQ 2K52A 1TY2A 1SYGA 1LTAD 1STNA 3HOYH 1M8AA 1Q1BA 2Z6BA 3FEWX 1SYEA 3GTJH 4OWXB 1X6OA 4K6LA 3KLWA 3SGIA 1QVFA 2BH2A 3I4NB 4DV1Q 1X32A 1SJED 3J7AV 4KKTA 4FF4A 4RGOS 4DXFA 1HXYD 1RDPD 1IW7D 5JEAJ 1D5MC 4F8MA 4DV6Q 2D0PA 1ASZA 4ME5A 1JJGA 3HZXA 2WAQG 4MTKA 1G51A 4DUYL 2DGYA 5LMNQ 1WTWA 2F52A 3RR5A 4YCWA 2AHOB 4U68A 1DOLA 3X3NA 3D4RA 2JA6G 2GVAA 3H94A 5H1SE 3RLOA 3S1MH 1TWCH 5D3DA 3K0XA 3Q22A 2Z0SA 3KDFB 4J1MA 3UE1A 2VZAA 3UI2A 4LF5L 4JI4Q 5I6YA 1XYIA 5L37A 1A8VA 1SDFA 4C3HB 3OWEB 3W5OA 2HT1A 1KRSA 4DGZA 1HNXL 1BXTA 1EY9A 5I2XA 3MAQA 3GTOB 5ELDA 3MHBA 4BY1H 1AE3A 4ABNA 1SYFA 2RBMA 5BR8Q 4IUVA 1HR0Q 3DEPA 3HKZB 1I94L 1SNMA 5J3BA 1YBYA 4B3ML 1LTSD 4G7ZC 5C4HA 1SEBD 5EKLA 5F2DA 4RGTA 1SMYD 5LMUL 3HS0C 3L0OA 2RKSA 1Y1VH 3OTOL 1XPUA 3L9AX 5IGEA 1N32Q 1G6PA 5E1FA 1VQLA 4UP7A 1SE2A 2EYFA 4JBJA 4DR1L 1DZ1A 1HNZQ 4A3LG 4LAAA 1VQHA 4KK7A 3M3YH 4AYBB 1TWGH 4A3BH 1WTQA 5CV7A 1I4PA 4LW1A 4XTCS 1GUGA 4A93H 3H15A 3CD6A 2WACA 3ER0A 3I4MG 1BCPD 4HSPA 1LTTD 1C0AA 1VQDA 5GAHC 3NP8A 3C1EA 3HOUB 2RF4A 4A3IB 1SE8A 3KJPA 5FOBB 1GXDC 3L2PA 2B2UC 5CV4A 1QCBD 1STYA 1KRTA 1LTRD 2HCCA 1XNQL 3AMUA 2O5JC 2D0OA 1AH9A 1FGUA 4A3EB 3PUWA 2DNCA 1V1PB 3WWVA 3SEBA 3SK8A 2X69A 1WI5A 3M4PA 4KV6A 1NJIC 1IYVA 1STHA 4HJ7A 4DK1A 4CHTB 4HN7A 3NBHB 3K57A 5ELBA 5IGFA 2VQEL 1PRTF 1V43A 3I90A 2F4VL 5C0XI 2UUAQ 2EXZA 4RHRA 1GOZA 2K01A 2FFKB 3SHLA 3VYSA 1SNPA 1Q3LA 3RLNA 4RHSA 2GVBA 2F0DA 1PH2A 2IT1A 1I4RA 1XTCD 2RQXA 4KKUA 3ULPA 3MXUA 3HOVH 3FKIH 1UAPA 5FLXc 4FO2A 1I4GA 4JI0Q 1U9RA 1YHBA 4RGNA 2XRQD 3E9HA 5C0XG 2ZJPA 2K28A 3G71A 2IY5B 1FYCA 4K14A 1PDQA 2ES2A 3TREA 5BN4A 2PCFB 4DR5L 2X6LA 5ELNA 3KOJA 4DN4M 4IOCA 2AUKA 4B9XA 3DWQA 1UUPA 4XT3B 1X55A 2F1MA 1E7ZA 2H5XA 2IWHA 3WOFA 3X3MA 4GNXB 2K6AA 2WFWA 4DV2Q 1AP0A 1TWFB 1TY0A 2R92G 5KNDA 1KHIA 1RD9D 3CRKC 5C4XG 3OMGA 3NK9A 4K0KL 4JI6L 4DAVA 1FJGL 3IFDA 1KD1C 3S15H 2ZXPA 2F0MA 3W1BA 3T1YQ 4IUUA 2VXWA 3J81L 4CBVA 3DM1A 3AQQA 4E6IA 1W6KA 2CCZA 1FD7D 1LTGD 3PSIA 1FNWA 2R93B 3I7FA 4RWSC 1RODA 3J80L 5IWAL 4BXXH 5KYLA 1DOKA 1J9OA 4JV5Q 2YTYA 2ICIA 1JC7A 2K5NA 2K5VA 3F2UA 5A2QL 3RD4A 4JI3Q 1CFMA 5KYIA 4X65L 2ZT9C 2G9HD 2KVMA 3NTHA 2IX3A 4K6DA 2XWJB 2E8GA 1MSGA 5IYCG 4LK1C 4IJLA 1NUCA 1Q82C 1ZXTA 2JA5B 1PFBA 1VCIA 1I6HB 2YTVA 1J8IA 2K5DA 4LF6L 3UDXA 4C3JB 4X66Q 2AUJD 1GUSA 2QF7A 1IL8A 1VQ7A 1QOHA 1LT5D 4IFDJ 2HQLA 2MHVA 1FR3A 3V96A 5C44H 4GNXC 4OO1H 2B3GA 4GN5A 3TZDA 2JN4A 3ZJYC 3BDOA 2JSOA 4BWGB 4GOPB 1R4PB 4IOAA 4WJ4A 2MPMA 2ZTEA 3SDZA 1CSPA 3CCSA 5FO8B 1N36Q 4IJHA 4A3GB 2HQEA 3FDTA 1CQVA 4A3MB 3GTMH 4X62L 4IFDH 1XMQL 5FO7B 2NVXB 1YNNC 2NVTB 3KLRA 5EGTA 3E0JA 1HA5A 1JJCB 2UXBL 3DHQA 4DR6L 1HJPA 5CR3A 4BY7B 1S5DD 4RFBA 4N9TA 4BS9A 3HOXG 4DV5L 1HA6A 1I4QA 2EPBA 5K36G 2I46A 1B1ZA 2NN6G 5ELFA 1PV4A 3C3LA 4LFBQ 2F3IA 1YITA 4C56C 3DUZA 3MXGA 3S2HH 2LXJA 1H9SA 4YY3L 4ODGA 4A3JB 1EY5A 3HOZG 1XJVA 5CBEE 2CWAA 2WB1B 4A3IH 4KY7A 1K83B 2K4KA 3S1RB 1F2ZA 3TQYA 1CKNB 1IBML 3PO3B 4GOPC 2K5HA 4UDUC 2KHJA 3NQTA 1X3QA 3GV3A 1B50A 2EOTA 2H1EA 4B3SQ 2A8VA 1Q86C 4IUTA 1OXXK 4CJ0B 4L5TA 3GTKB 1X65A 2F0VA 5EBCA 3M9BA 3HOYG 3KJOA 2NVQB 3M4YA 1F9QA 3HOWB 1KQSA 1V1OA 4NXNQ 3JAML 5CYUA 1F9SA 3IRBA 5GADC 3R8BA 4J8QA 2WAQE 4QCLA 3RN2A 1EYCA 4C3IB 2CKZB 4XDXA 1QVGA 2BA1A 3S14B 2QGQA 3DMUA 5EPKA 1R9TB 4DV7Q 2A68C 4RAUC 1N9WA 2CQAA 3A7LA 4BBRB 1K3RA 4PNYA 2XGTA 3R3OA 4Y52H 2EXDA 4JI2Q 5M5WH 3TDQA 4A4IA 4CJ2C 4YHHQ 3VDYA 3GTGB 2F0IA 5GAGC 1CQFA 3CHBD 3ND9A 1DXMA 4FF1A 3CXCA 4BBSB 2MJ8A 3RMHA 3OSOA 4BY1G 3K8AA 5COYA 2YU9H 3M4OH 2R7ZH 1KDBA 3SK5A 1HNWQ 4PMCA 4F7XA 3E0EA 2R93H 2DN8A 1HQRD 1CTMA 3CC4A 1V1QA 1SROA 1T9HA 5NUCA 4DNRB 4X64L 4YWMA 2VB2X 1Y1VG 1L1OA 2IW3A 1FNVA 3HFZB 2UUCQ 4CDEC 1TR5A 3KF8A 3HRZC 2Z8LA 2UU9Q 1Y1WB 4XYQA 4Q0FA 5C3XA 4LF4Q 3PIO3 1RIPA 2HHHQ 3S16H 4JBKA 3GO5A 4A3BG 3PO2B 1QUQA 2J0TD 4B3RQ 1EY0A 1LTBD 4ME3A 4K5XA 1STGA 3D0FA 4A93G 1EY6A 1CK1A 2TMPA 1CM9A 3U4VA 1F9RA 3ITPA 1PHJA 2E2IB 3IAYA 1JCKB 1PH1A 4FF3A 4X6AH 1TT2A 2JA8B 1TWAB 3CW2C 4LF9L 4DAPA 1VQBA 1A3VA 1A3TA 2KEEA 4ZK9B 3H0GB 2A6HD 1EFWA 2L12A 2EYHA 1WYDA 4JI8Q 4EQPA 1ESRA 3U9OA 2C9OA 2M9VA 3NUCA 4G4KA 2F0UA 4FXKC 3NHHA 4DA2A 1EQRA 2PMZB 2R7FA 4QL5A 5T1GA 3V05A 1D5XC 4KN4C 1JR0D 3I55A 2F0LA 2B2YC 2LKVA 1IBLQ 2B2UA 3OW2A 1UEAB 4F88A 1STBA 1RL2A 1A2TA 2I5LX 3PIOA 4JYAQ 5M3FH 4HCEA 2R3ZA 3FKIG 3PGZA 3I73A 3HOVG 2CW0C 1L0WA 1WTHA 1TS3A 2ZXRA 1HCZA 4L5SA 1IBKL 2BE5D 2B39A 2K04A 1JB7A 1EY4A 1F2YA 1UE5A 3D6WA 3TP6A 2VW9A 1M1KC 3QG1A 3PO3H 3CPFA 3HOZH 2N3SA 3CRLC 1MBYA 3I3CA 3TMEA 2VB3X 3J81E 4F87A 2V4DA 2MGSA 1T5XD 1YJWA 5FLXL 3CQZB 4DR7L 4I65A 3OMCA 4C2MB 3CCJA 2NTTA 3WDNA 2F3WA 3J80E 5C3EB 2Y0SG 4DV0Q 4OGQC 4B3TL 4QGUA 1I4HA 5A2QE 1SYCA 1S72A 1D7QA 4RKLA 1NAPA 1PTOB 5KIXA 4A75A 2KQ3A 2RHSB 1UEBA 4APVA 4DR3Q 1SXTA 1CHQD 5LMNW 2NZOA 3D31A 3A5ZB 4FP5D 1BKBA 2F0OA 4DK6C 1OO9B 4DV4Q 3AEVA 1PRTC 1PH3A 5M5XH 3PV0A 5IP9H 2EYJA 1SBBB 4BXXG 1G91A 3D6CA 5IE8A 1CZGA 3W2DA 4JI7Q 5IGGA 3D8GA 2OT2A 2B29A 1Q90A 4CGYB 1D1IA 3GTPH 1KNAA 4A3DB 5FKAC 1EIHA 2B63B 4LFCL 1ASYA 1NR4A 4OO1I 2VUMB 1KXLA 1W6JA 4IPCA 1K8OA 2HIVA 2WKCA 2JQOA 1YZ6A 1LABA 4NXML 3DWPA 5C5MA 2CHBD 2PQAA 4HJ8A 4G57A 4O1NA 5CV5A 2CH4W 4IUNA 2PYKA 4KHPL 2E2JB 1PYSB 2E2HH 2Z6KC 1HR0W 4IFDI 5I4DA 1ESFA 1MKHA 1HHVA 2D9UA 3PF4A 2J4XA 5C44G 3S1NH 3NSWA 4DV6L 1KLUD 4OO1G 1F2MA 2R6GA 3GTLH 4UPAA 3PUVA 3Q8DA 3OYYA 1B8AA 2DUDA 1Q1EA 3S1QH 1CSQA 1EEFD 2VQFQ 1X3FA 3CC2A 1HNXQ 1PTOC 5IYDH 2WAQB 3BJUA 4O42A 1GUTA 1I3QH 4IFDG 5DAUA 3J7A5 1C4QA 4KJNA 3H3VC 4AQYL 1I94Q 2LS01 1GKHA 2JA6B 1PFSA 3GTQH 1SR3A 1ILPA 1MI2A 1H9JA 5M3MH 4P2CB 3AFPA 4XQQA 5JJZA 1KIXA 3Q24A 1RTNA 5LMUQ 1DOMA 1YIJA 3KBXA 4P73A 2LXKA 3OTOQ 1ZEQX 3STBD 3KLSX 3CU7A 2F0HA 4FYDA 5ISRA 2XIWA 2A19A 2PZTA 4K8IA 2NVYH 4DR1Q 3BVGA 1A6XA 1M90C 3EVQA 2C35B 2UUBL 3MFYA 3OIQA 1XMOQ 2EQSA 4DKAC 3FHWA 1I5FA 3QJYA 1CA5A 1N32L 4DNTB 4EQNA 1QWYA 5C5LA 4A3IG 1QE6A 2E5LL 1D8LA 2PW7A 5LL6S 3OPOA 1U4MA 3B6YA 4KMUC 1X3PA 1SJHD 1SNQA 2L0CA 2MNAA 3D3RA 2NB0A 3JAME 1EZ6A 3PQIA 3FP9A 5G3LD 3RZOB 2I07B 3RZDB 2A6ED 3MXNA 1XNQQ 5HY6A 2V1CC 1WOCA 4X3SA 3ICEA 1U4PA 3NWSA 3IFTA 2PZUA 3PF5A 3CCQA 2OEOA 2K14A 5IOCA 2L4NA 5JJLA 1ICFB 1ENAA 5JVG3 2UXCL 3C46A 4RGMA 3F8TA 1EQQA 2K5QA 4WORA 2B2WA 1E2WA 2X6GA 4LFAL 1PZJD 2B2TC 4OWWB 1EZ8A 5IGDA 2UXDL 1Y69U 1EY8A 3UE0A 1FL0A 4XQNA 4DR2Q 1IYJB 4QY7A 2QCPX 3K58A 1B2TA 2EYMA 2UUAL 2OCEA 1RF2D 3H6MA 3QWNA 1KDAA 1EQVA 5CC4A 3EBEA 3EQLC 5C4JH 5FK9C 1I50B 5ELEA 1HZBA 2MUYA 3QOJA 4GN3B 4Q5VA 4EVOA 1BUVT 3DXJC 4DNIA 3P7JA 4DR5Q 1WTPA 3QOLA 2N55A 1PZKD 1TWHB 4C2MH 3TRZA 2ID0A 1H9KA 4FVMA 3T56B 1S40A 4GKKL 1XXGA 4JI0L 3E5SA 3KF6A 2A74C 4A3FH 2Q2TA 4QIWE 1E3PA 1E22A 2ZTCA 1PTOF 3BYYB 5KRUA 5FO9B 2R7ZG 1RTOA 5I9PA 1KLGD 4DUZL 2BH8A 2R93G 1WTOA 1PH6A 3ERSX 4K0KQ 1KNEA 3T16A 2GA4B 2A73B 1FJGQ 1JOOA 1EL0A 4RCNA 3NPPA 2Q2UA 4GS3A 4V190 5M5YB 3BVZA 3E3XA 2F0TA 4NDXA 3NEMA 2HUGA 4Y7NB 3UDGA 5IY0A 2XTIA 2AKWB 1WCMB 1AE2A 3PUXA 5KNBA 2BDNA 4A3KB 4P74A 3CMEA 3I4NH 3KBGA 1EFID 5IWAQ 1W3SA 3ZYYX 4QF4A 1X9NA 4LWCA 5E7NA 3M4QA 4DV3Q 1HUMA 3URYA 1B9MA 4GKJQ 2R92B 3HGBA 4CDDC 5C4XB 1Q12A 2EZVA 5AFWA 1JMCA 4NP5A 1LTLA 4X3TA 4GLAC 3A55A 5IT9L 1SNOA 1EY7A 1NR2A 2N8NA 4YCVA 3PCOB 1A62A 1CKOA 4CJ1B 4CKEA 1GD7A 2E74C 1J6QA 2SDFA 3NWTA 3TP5A 2KCCA 2K1BA 1SLJA 5IYBH 1XPRA 5DM63 2ZM6Q 1JWMD 4MZ9A 4C3HH 1TKWB 2JA7B 3L7ZC 1WD0A 2Q2IA 1SMXA 1KC8C 1JT8A 1JICA 4HIOA 4H02A 4JI1L 3GTOH 2Z4IA 4OHJA 3QB3A 1VQJA 1QZHA 5JPMC 2A5HA 3PMFA 3VR5A 3S17B 4HJ9A 1TU2B 3VYUA 1TIID 1O7LA 2ZTDA 1SFOB 3TBIB 1XMQQ 4POGA 2NN6I 1BNZA 3GD7A 2Z1CA 1GJXA 1K28A 2NBFA 4ZYSA 1JJ2A 2L55A 3SE0A 1BF4A 3M85A 2EY1A 4KD3A 2F0NA 4KTAA 4ZUIA 3S2DB 1PYBA 1VQEA 4JI5L 1N36L 1K0RA 5CV6A 4PV1C 2UXBQ 3CCVA 2D5DA 4LNQA 4YCUA 2C5CA 1LT3D 5M3FG 5LHY1 4KHZA 5D3IB 1L0XB 2A69C 2EJMA 1YJNA 1WTVA 5FLXE 3H09A 1LM0A 1VQAA 1XWEA 2RDGA 4OWTB 2E2DC 4DR4Q 1WVLA 2I0QA 2JYOA 3PO3G 1BR9A 1MSHA 4ILWA 4YY3Q 4JCVE 3HOUH 3LGJA 3NENA 3A74A 4R8IA 2XN9C 3K7AB 2Y0SE 1QJOA 1Q8IA 1ZYRC 4PZ7A 5AJ3L 2FXQA 3NELA 1PZID 4HCSA 1IBMQ 3HOXB 1EWIA 3CKIB 1N34Q 3BZCA 3FVQA 2EVBA 4A3EH 2RHQB 2OWOA 2AMCB 1L0YB 3MFGA 3CMAA 4KI0A 4XQJA 1G2TA 1IYUA 1VQCA 3K5LA 5JVH3 1SNCA 4CDCC 3EA6A 1WD1A 1C8CA 1AN8A 1O78A 2HIXA 1EIGA 3CCMA 5IP9G 2ZJQA 3K5OA 4RCOA 4EX5A 2OF1A 3BVMA 5JOBA 3T1HL 4C3IG 4B3SL 1F77A 3MVVA 1VQOA 1PMRA 4OX9Q 1G6ZA 2JP1A 3HEJA 2F0PA 1VF5C 2EIFA 1Y14B 1G2SA 2B8GA 3ERQA 1Y8OB 3N6RA 1P8LA 1Y8PB 4K2LA 1YNJC 3NTIA 3Q0AA 2F0SA 1GHKA 2BDOA 1D1KA 1MD2D 1PH9A 4NXNL 3ULJA 2K33A 1PYWD 3PUZA 3TS2A 1P16A 3HOYB 3AFQA 3FMCA 4DAYA 4KLKA 1BO0A 1XNRL 3GTJB 1ENCA 3LWUA 4FF2A 1N33Q 3HKZE 4JOIC 5T1IA 4P71A 3Q6SA 3EIVA 1YVCA 4CKCA 1TWFH 1Y8NB 3U50C 2VS1A 3DEOA 3MWYW 5IYDG 3F2DA 1WTXA 3MXPA 5DLQE 2FMMA 5CV8A 1U0LA 2KHSA 3A5UA 3M7GA 1AZPA 2CQOA 3EROA 1WCMH 4HIKA 2F0WA 3S1MB 1UWVA 4A3KH 1TWCB 2EYOA 1DJRD 4KY6A 2Q8RE 3V2TA 5M3MG 3NQIA 3OW7A 3RLFA 1NY4A 4X64Q 5IT9c 2SNMA 5DEHA 4H13C 4BA1I 1UE7A 4GN4B 1YI2A 4UY8C 1B7YB 1YNND 1CI3M 2RSNA 2IX0A 5KNCA 4IPGA 4BY1B 4IPHA 2JA5H 4G7HC 3VYTA 1HQMC 2D62A 1I6HH 3TP7A 4A3CG 5GAEC 4DF7A 1IW7C 3QR8A 1H9SB 4V0BA 4C3JH 1V9PA 3HKSA 4L63B 2BA0A 1K0SA 1JE4A 4LF4L 4R1JA 3SR1A 1SNDA 1Y1VB 2JA7H 2OQKA 5GQOA 5JAVA 2G9DA 1DONA 2K5WA 4PG3A 1E0BA 5EPLA 1UNSA 1BCPB 1D2BA 3PUYA 3I4OA 4HAEA 1II3A 4ZLTF 2ZJRA 4A3GH 3AYHB 3S24A 3KUPA 2SNSA 1E2VA 4A3MH 2J7ZA 2KHIA 4KD4A 4XXEA 1TWGB 2NVXH 4A3BB 3TZUA 2NVTH 1Z6HA 2HD3A 2Q8IB 3TEHB 4DK3C 3BYTB 3T4AC 4A93B 1YHQA 3J81i 1GM5A 1SSOA 3KDFA 4HTHA 1DM0B 1IKLA 5CORA 3J80i 4BY7H 1B53A 1UE6A 4LUOA 4NW2A 1MJEA 1SMYC 2RCNA 4EQ5A 3OHXC 5C6AA 2WKDA 1NMGA 3NTKA 1K3BC 4OL7A 3T13A 2BCOA 1E24A 2HCIA 3T51B 1STAA 3KFUA 4IALA 1SE3A 3MC0B 1STEA 1XPOA 3MEFA 4KY5A 4A3JH 1ICWA 3LNNA 3A0JA 1KABA 4OIJA 1K83H 3S1RH 4X3KA 1Z47A 4OXPA 1IBKQ 4L8JA 1O80A 1TS4A 5EKIA 1A2UA 2JA9A 1JOQA 3VR6A 2F0FA 1J5EQ 4IUPA 2M2LA 1D6EC 1NMFA 4JYAL 1BCPC 4LJZC 1LT4D 2I5MX 2PZWA 5K5PA 3F2CA 1D5ZC 2AWOA 4A3FG 4HEDA 2A68D 4IN3A 3E6ZX 4LF7Q 4LUVA 1E1TA 4DR7Q 4AIMA 3HOVB 2CFMA 3F1ZA 3FKIB 5D65A 5FLMH 3GTKH 5CGKA 4ZQ3A 4O2DA 1A3UA 4N9PA 1DYQA 1CZWA 1IHZA 4LF8L 2NVQH 1N8RC 4WRDA 1LACA 3HOWH 4IZ8A 2JXMB 1ILQA 1IL2A 1L1OB 2VL6A 4OEMB 3KF8B 2PPBC 3I4NG 4A3DG 1R4QB 1GO3E 1HZAA 2WINB 4DV0L 2PO4A 4H0LC 4X3UA 3OOCA 1IKMA 4C3IH 3KYHC 1QG7A 2AQ2B 1VQ8A 3I56A 3S14H 2Q2HA 4OIKA 1QUQB 3CCUA 1V1PA 4DV4L 1R9TH 3S15B 1SE4A 2KCMA 2YV5A 1AFPA 2EYLA 3HP3A 4BBRH 4DUYQ 4NXMQ 1BBXC 3NBHA 5DM73 4JI7L 4EGVA 1EOVA 4B9WA 5EQ0A 4DV1L 1WTRA 4KHPQ 3E9IA 3OWFA 5IYBG 4NKLA 4MN3A 3GTGH 3EJIA 1VMCA 1BDOA 4C3HG 3G7LA 1VQ6A 3I70A 1SN8A 4LF5Q 4HSVA 3K0YA 3BDLA 5LMNL 4BBSH 1V8QA 2IHEA 1U4RA 5JJIA 3HKZG 1RHPA 4B08A 2K75A 4PMBA 3UDIA 1PH8A 1BVSA 2YTXA 4RKBA 1VQ4A 3PIPA 3FPPA 3G6JB 1NCVA 2L15A 1HPCA 1L1OC 4JI4L 5JEAH 3U58A 1VDZA 1YHAA 2LMCB 4R9WA 4AQYQ 4PQXA 1NSNS 1VQFA 4B3MQ 2XWBB 1I4XA 4PZ8A 5CV9A 5C44B 3JAMi 3BZKA 2VQFL 1Y1WH 1VS0A 4J6HA 3M7NA 2LSSA 2RDHA 3HG9A 1CKMA 2OQ0A 4GNXA 5BR8L 1HR0L 1PVOA 2OTLA 2WP8J 3NE5B 1H95A 2WB1E 1A0IA 4AYBG 3PO2H 4K2KA 1G291 3DWAA 4XIGS 3GTMB 3BG3A 4HMJA 3CC7A 2QA4A 4P72A 1Q7YC 1QB5D 4A3CH 3NBIA 2KEDA 3QO2A 4XT1B 2UUBQ 5JJKA 2ICEC 3HOUG 2E2IH 1BOSA 1U4LA 1VQNA 1BCPF 1XX8A 2JA8H 4XYOA 2E5LQ 2QEXA 5IP7H 2CW0D 1HNZL 5IGBA 1TWAH 3GQBA 4GZYC 2NWGA 2VY3A 2IJ0A 3S9WA 4A3EG 3L3OC 2QEJC 3MZ5A 1FNUA 4DU9A 1XMOL 2O4XA 2F0KA 3C1FA 1EWHA 3H0GH 1CA6A 1WFQA 1S3OA 4KN7C 5G3LF 4DFAA 3SVMA 3BU2A 4ALPA 3S2HB 1ET9A 2KOLA 2K05A 4C1NK 1B9NA 2ATWA 1S5ED 1TS2A 3I4LA 5HGTA 3FRPB 3VA7A 2EY5A 3I4MB 4PMWA 5ELOA 1H9MA 2UXCQ 1GUWA 2VQEQ 5GROA 2F4VQ 1LTID 5EAYA 4LFAQ 2HDMA 1HFNA 4GOPA 1PFMA 2UXDQ 2F3VA 4GLXA 2Z9HA 3VA5A 1XTDA 2DJGC 5EJWA 1AW7A 2PQAB 1PRTD 4TSSA 4K5VA 5M9OA 3GP7A 3LX0A 4QUCA 1MHWC 1OTCA 2CWPA 1S4ZA 4IUQA 4N8X1 3UDFA 2XNAC 2OTJA 2MP1A 1RCVD 4QB4A 2MQHA 4BA2I 4DR2L 3CQZH 3U4ZA 1JB3A 4RA8A 3K80C 5C3EH 1VF7A 2FMCA 2B2VC 1OXVA 4GKKQ 2F0QA 4DPGA 3D4WA 3R2TA 2KCNA 2O2LD 3J7AF 1KL9A 2L5TA 1SYDA 1HZCA 5LL6X 1EYAA 1PTOH 1SRUA 1BBWA 3K5NA 4R4CA 1KTKA 4K8JA 4HJ5A 3H3VH 4QMGA 1WCMG 4DUZQ 4JI6Q 3A54A 4A3KG 1OXUA 2NZ1D 2XVSA 4I7AA 4IQZA 4L6TB 1EYGA 2DY7A 2KUMA 4TKOB 3EFXD 2AQ3B 2MFIA 4DV2L 5M5WB 1CKNA 4DXGA 1HTPA 4JOIA 1TQOA 1JQYD 1PTOD 1VQKA 4A3DH 3I2ZA 3LWEA 2B63H 2L1BA 4L5RC 2VUMH 4TQUS 2Z4HA 3BS1A 2MO0A 2L9HA 3T1YL 1PA6A 5FJ8H 2JA5G 4X65Q 3AB9A 2YU9B 3M4OB 2R7ZB 2E2JH 1C48A 2IPKD 4C3JG 1LUZA 3U9SA 2N49A 4U673 4LMQD 1KAAA 3G6EA 4JV5L 1E1OA 1VMPA 1FVIA 4UAIA 4KHVA 3A7AB 4FDBA 2JA7G 4JI3L 4DV3L 4LF6Q
chains in the Genus database with same CATH topology
2HDLA 2FJ2A 3R93A 4DK0A 3I8ZA 2RVLA 1EWCA 4HR7B 1H9RA 3S16B 1O7ZA 1PFNA 4MIUA 1PLFA 5EPJA 3R2IA 3MTSA 4EQOA 3AU7A 2E75C 4CKBA 3J7YW 1G8ZD 5TSSA 1AEXA 4ZUJA 1EYDA 4ZKBB 2M00A 2AQ1B 1T5EA 2JE6I 3NXWA 5HURA 1SAPA 1EU3A 2E76C 2D2CC 3VYRA 2Q8TA 3K59A 2SOBA 1FGBD 1B44D 1EU4A 1EEID 2O5IC 2K7VA 5E3FA 1RJTA 4I7ZC 3P75A 2N88A 5C4ZA 5I9OA 4Z9CB 1I6VC 1K8MA 1OXSC 1LV9A 2B8FA 3FPUB 3QIAA 3A8JE 4FXDA 1ZKOA 2FINB 5I2YA 1DCZA 4NMZA 2OXPA 4K5WA 5DNFA 1HUNA 3T53B 2DNEA 3VR3A 3I72A 3MA2B 4G7OC 4JK1C 2EY6A 2EYPA 4RH6A 4ULLA 2DY8A 2B2YA 3IL8A 4QUFA 5M3FB 5J39A 4WFN3 1AZQA 3KLSA 2F4IA 3WOEA 1TVXA 4FNFA 2IL8A 3VR4A 2B2WC 1GUOA 2A6HC 3TN2A 3HOZB 3OIPA 4MHEA 1CT1D 2K03A 3ND8A 1O7YA 5EKKA 4ZKCB 4JBWA 2PQEA 2ENBA 2JEAI 4WJWA 4H7BA 4KKSA 1B4OA 1JWSD 1ENFA 2PNRC 1MGSA 1ML0D 5C0XJ 1HRJA 5M5XB 1PXUA 3TP8A 1CHPD 1KDCA 2BE5C 5A35A 2PW5A 3K6OA 3GTPB 2BOSA 2EE1A 2IX1A 1S5CD 1GHJA 3A8IE 1JOKA 3ONAB 4H44C 3Q23A 5C0XH 5J1ZA 5BN5A 2QDBA 5JEAG 2E2HB 2L11A 1DD2A 5J22A 5D14A 3S1NB 4ZAIA 1F2LA 1HTLD 1QILA 3C2PA 3GTLB 1GUNA 3I91A 1RKNA 2RA4A 5BN3A 3S1QB 3TSSA 2FHTA 5KGUA 1LLRD 1I3QB 3GV6A 5C3WA 2K32A 4QIWB 3GTQB 2ZXOA 1B3AA 4KJOA 4C1NI 5M3MB 1SYBA 3MEHA 5E4WC 3RUZA 3VR2A 2VNUD 2A69D 2NTSA 2R61A 5IIFA 3P20A 3P1HA 2WV6D 4ID6A 3K5MA 1EOTA 5E4XA 2NVYB 1TS5A 2EY2A 3M3YB 2JEBI 1M4VA 3A8KE 1HFGA 1ZYRD 2XSCA 2LFNA 1QNKA 3IKJA 4YIJA 2KECA 3KK7A 3BDCA 2F0GA 2QILA 2F0EA 2F0JA 5IODA 1OXTA 2CVRA 2EDGA 1E2ZA 3D4DA 4M1UB 2RDFA 2EJFC 2RSOA 3SK4A 2KA7A 1ONLA 1ET6A 1S5FD 4M8AA 3BZDB 2EJGC 3N52A 2TSSA 1EQTA 2NYZD 1PRTB 5JPNC 3SK6A 3H91A 3W3AA 3O13A 1YNJD 5I6WA 1LO5D 2LY7A 4S3SA 2KJXA 5CBAE 5IGCA 2B2TA 5K36H 1JORA 4TRDA 2NN6H 3SXHA 3A56A 4HMIA 1Z7TA 1QNUA 2H4OA 5CMDA 3PIP3 1JWUD 2QKIC 4FXGC 4IURA 1LT6D 2SEBD 1F9PA 1S5BD 5C4JB 2A6EC 2XRSD 4ZRZA 2NUCA 1A15A 5EBDA 2YYZA 2AWNA 2WIIB 5IT9E 5ELCA 2F03A 4R8NA 4A3FB 2B2VA 1BQQT 2Y0SB 5KEEA 1TY2A 1SYGA 1LTAD 1STNA 1M8AA 1Q1BA 3FEWX 1SYEA 4K6LA 3I4NB 1X32A 1SJED 3J7AV 4KKTA 4FF4A 4RGOS 4DXFA 1HXYD 1RDPD 1IW7D 5JEAJ 1D5MC 4F8MA 4ME5A 3HZXA 1WTWA 4U68A 1DOLA 3X3NA 3D4RA 3H94A 5D3DA 3Q22A 4J1MA 3UI2A 5I6YA 1XYIA 1SDFA 4C3HB 3OWEB 4DGZA 1BXTA 1EY9A 5I2XA 3MAQA 3GTOB 5ELDA 3MHBA 4ABNA 1SYFA 2RBMA 4IUVA 3DEPA 3HKZB 1SNMA 1LTSD 4G7ZC 5C4HA 1SEBD 5EKLA 5F2DA 4RGTA 1SMYD 3HS0C 2RKSA 3L9AX 5IGEA 5E1FA 1SE2A 2EYFA 1DZ1A 4LAAA 4KK7A 4AYBB 1WTQA 5CV7A 1I4PA 4XTCS 1GUGA 2WACA 1BCPD 4HSPA 1LTTD 3NP8A 3C1EA 3HOUB 4A3IB 5FOBB 1GXDC 2B2UC 5CV4A 1QCBD 1STYA 1LTRD 2HCCA 3AMUA 2O5JC 4A3EB 3PUWA 2DNCA 1V1PB 3SEBA 3SK8A 2X69A 4KV6A 1IYVA 1STHA 4DK1A 4CHTB 4HN7A 3K57A 5ELBA 5IGFA 1PRTF 1V43A 3I90A 5C0XI 2EXZA 4RHRA 1GOZA 2K01A 2FFKB 3SHLA 3VYSA 1SNPA 1Q3LA 4RHSA 2F0DA 2IT1A 1I4RA 1XTCD 2RQXA 4KKUA 3MXUA 1UAPA 4FO2A 1I4GA 1U9RA 4RGNA 2XRQD 5C0XG 2K28A 1FYCA 4K14A 1PDQA 5BN4A 2PCFB 2X6LA 4DN4M 2AUKA 4B9XA 3DWQA 1UUPA 4XT3B 2F1MA 2IWHA 3WOFA 3X3MA 2K6AA 1AP0A 1TWFB 1TY0A 5KNDA 1RD9D 3CRKC 3OMGA 3NK9A 4DAVA 3IFDA 2ZXPA 2F0MA 4IUUA 2VXWA 3J81L 4CBVA 3DM1A 4E6IA 1W6KA 1FD7D 1LTGD 1FNWA 2R93B 4RWSC 1RODA 3J80L 5KYLA 1DOKA 1J9OA 2ICIA 1JC7A 5A2QL 3F2UA 3RD4A 1CFMA 5KYIA 2ZT9C 2G9HD 2KVMA 3NTHA 2IX3A 4K6DA 2XWJB 1MSGA 4LK1C 1NUCA 1ZXTA 2JA5B 1PFBA 1VCIA 1I6HB 1J8IA 2K5DA 4C3JB 2AUJD 1GUSA 2QF7A 1IL8A 1QOHA 1LT5D 4IFDJ 2MHVA 1FR3A 3V96A 4OO1H 3TZDA 3BDOA 2JSOA 4BWGB 1R4PB 2MPMA 3SDZA 5FO8B 4A3GB 2HQEA 3FDTA 1CQVA 4A3MB 4IFDH 5FO7B 2NVXB 1YNNC 2NVTB 3KLRA 5EGTA 3E0JA 1HA5A 3DHQA 5CR3A 4BY7B 1S5DD 4RFBA 4N9TA 4BS9A 1HA6A 1I4QA 2EPBA 5K36G 2I46A 1B1ZA 2NN6G 5ELFA 3C3LA 4C56C 3DUZA 3MXGA 1H9SA 4ODGA 4A3JB 1EY5A 5CBEE 2WB1B 4KY7A 1K83B 3S1RB 1F2ZA 3PO3B 4UDUC 3NQTA 1X3QA 3GV3A 1B50A 2EOTA 2H1EA 4IUTA 1OXXK 4CJ0B 3GTKB 2F0VA 5EBCA 2NVQB 3M4YA 1F9QA 3HOWB 1V1OA 3JAML 5CYUA 1F9SA 3R8BA 4J8QA 4QCLA 1EYCA 4C3IB 4XDXA 3S14B 2BA1A 3DMUA 5EPKA 1R9TB 2A68C 4RAUC 2CQAA 3A7LA 4BBRB 4PNYA 3R3OA 3TDQA 4CJ2C 3GTGB 2F0IA 1CQFA 3CHBD 3ND9A 1DXMA 4FF1A 4BBSB 2MJ8A 3RMHA 3OSOA 5COYA 1KDBA 3SK5A 4PMCA 4F7XA 2DN8A 1HQRD 1CTMA 5NUCA 4DNRB 2VB2X 2IW3A 1FNVA 1TR5A 3KF8A 3HRZC 2Z8LA 1Y1WB 4XYQA 4Q0FA 5C3XA 3PIO3 3GO5A 3PO2B 2J0TD 1EY0A 1LTBD 4K5XA 1STGA 1EY6A 1CK1A 2TMPA 1CM9A 1F9RA 3ITPA 2E2IB 3IAYA 1JCKB 4FF3A 1TT2A 2JA8B 1TWAB 4DAPA 1A3VA 1A3TA 2KEEA 4ZK9B 3H0GB 2A6HD 2L12A 2EYHA 4EQPA 1ESRA 3U9OA 2C9OA 2M9VA 3NUCA 4G4KA 2F0UA 4FXKC 3NHHA 4DA2A 2PMZB 5T1GA 3V05A 1D5XC 4KN4C 1JR0D 2F0LA 2B2YC 2LKVA 2B2UA 1UEAB 4F88A 1STBA 1A2TA 4HCEA 2R3ZA 3I73A 2CW0C 1TS3A 2ZXRA 1HCZA 2BE5D 2B39A 2K04A 1EY4A 1F2YA 3D6WA 3TP6A 3QG1A 3CRLC 1MBYA 3I3CA 3TMEA 2VB3X 3J81E 4F87A 2V4DA 2MGSA 1T5XD 5FLXL 3CQZB 4I65A 3OMCA 4C2MB 2NTTA 3WDNA 2F3WA 3J80E 5C3EB 4OGQC 1I4HA 5A2QE 1SYCA 4RKLA 1NAPA 1PTOB 5KIXA 2KQ3A 1SXTA 1CHQD 3D31A 4FP5D 2F0OA 1OO9B 1PRTC 3PV0A 2EYJA 1SBBB 1G91A 3D6CA 1CZGA 3W2DA 5IGGA 3D8GA 2OT2A 4CGYB 1Q90A 1D1IA 1KNAA 4A3DB 5FKAC 1EIHA 2B63B 4OO1I 1NR4A 2VUMB 1W6JA 1K8OA 2WKCA 1LABA 3DWPA 5C5MA 2CHBD 4G57A 4O1NA 5CV5A 4IUNA 2PYKA 2E2JB 4IFDI 5I4DA 1ESFA 1HHVA 2D9UA 2J4XA 3NSWA 1KLUD 4OO1G 1F2MA 2R6GA 3PUVA 1Q1EA 1EEFD 1PTOC 2WAQB 4O42A 1GUTA 4IFDG 5DAUA 1C4QA 4KJNA 3H3VC 2LS01 2JA6B 1ILPA 1MI2A 1H9JA 4P2CB 4XQQA 5JJZA 3Q24A 1RTNA 1DOMA 3KBXA 1ZEQX 3KLSX 3CU7A 2F0HA 4FYDA 5ISRA 2XIWA 2PZTA 4K8IA 3BVGA 1A6XA 3EVQA 3MFYA 3OIQA 3QJYA 1CA5A 4DNTB 4EQNA 1QWYA 5C5LA 1QE6A 2PW7A 5LL6S 3OPOA 1U4MA 4KMUC 1X3PA 1SJHD 1SNQA 2L0CA 3D3RA 2NB0A 3JAME 1EZ6A 5G3LD 3RZOB 2I07B 3RZDB 2A6ED 3MXNA 4X3SA 1U4PA 3NWSA 3IFTA 2PZUA 2OEOA 5IOCA 2L4NA 1ENAA 5JVG3 3C46A 4RGMA 2K5QA 4WORA 2B2WA 1E2WA 2X6GA 1PZJD 2B2TC 1EZ8A 5IGDA 1Y69U 1EY8A 4XQNA 2QCPX 3K58A 1B2TA 2EYMA 1RF2D 3H6MA 3QWNA 1KDAA 1EQVA 5CC4A 3EQLC 5FK9C 1I50B 5ELEA 2MUYA 3QOJA 4Q5VA 4EVOA 1BUVT 3DXJC 3P7JA 1WTPA 3QOLA 2N55A 1PZKD 1TWHB 2ID0A 1H9KA 4FVMA 3T56B 1XXGA 3E5SA 2A74C 1PTOF 3BYYB 5KRUA 5FO9B 1RTOA 5I9PA 1KLGD 1WTOA 1KNEA 3T16A 2GA4B 2A73B 1EL0A 1JOOA 4RCNA 3NPPA 4V190 5M5YB 3BVZA 2F0TA 4NDXA 2HUGA 4Y7NB 1WCMB 3PUXA 5KNBA 2BDNA 4A3KB 3KBGA 1EFID 3ZYYX 4QF4A 1HUMA 3URYA 1B9MA 2R92B 3HGBA 5C4XB 1Q12A 2EZVA 5AFWA 4NP5A 4X3TA 3A55A 5IT9L 1SNOA 1EY7A 1NR2A 4CJ1B 4CKEA 2E74C 2SDFA 3NWTA 3TP5A 2KCCA 2K1BA 5DM63 1JWMD 1TKWB 2JA7B 3L7ZC 1WD0A 1JICA 2Z4IA 4OHJA 3QB3A 5JPMC 2A5HA 3PMFA 3VR5A 3S17B 1TU2B 3VYUA 1TIID 1O7LA 1SFOB 3TBIB 2NN6I 1BNZA 3GD7A 2Z1CA 1GJXA 2NBFA 4ZYSA 2L55A 3SE0A 1BF4A 3M85A 2EY1A 4KD3A 2F0NA 4KTAA 4ZUIA 3S2DB 5CV6A 4PV1C 2D5DA 2C5CA 1LT3D 5LHY1 4KHZA 5D3IB 1L0XB 2A69C 2EJMA 1WTVA 5FLXE 3H09A 1XWEA 2RDGA 2E2DC 1WVLA 2JYOA 1BR9A 1MSHA 4ILWA 4R8IA 2XN9C 3K7AB 1QJOA 1Q8IA 1ZYRC 4HCSA 1PZID 3HOXB 3CKIB 3FVQA 2EVBA 1L0YB 3MFGA 4KI0A 4XQJA 1G2TA 1IYUA 3K5LA 5JVH3 1SNCA 3EA6A 1WD1A 1C8CA 1AN8A 1O78A 1EIGA 3K5OA 4RCOA 2OF1A 3BVMA 5JOBA 4C3IG 1F77A 3MVVA 1PMRA 1G6ZA 2JP1A 3HEJA 2F0PA 1VF5C 1G2SA 2B8GA 3ERQA 1Y8OB 3N6RA 1Y8PB 4K2LA 1YNJC 3NTIA 3Q0AA 2F0SA 1GHKA 2BDOA 1D1KA 1MD2D 2K33A 1PYWD 3PUZA 3HOYB 3FMCA 4DAYA 1BO0A 3GTJB 1ENCA 3LWUA 4FF2A 5T1IA 3Q6SA 4CKCA 1Y8NB 3DEOA 3MWYW 1WTXA 3MXPA 2FMMA 5CV8A 2KHSA 3M7GA 1AZPA 3EROA 2F0WA 3S1MB 1TWCB 2EYOA 1DJRD 4KY6A 2Q8RE 3V2TA 3NQIA 3OW7A 3RLFA 2SNMA 5DEHA 4H13C 4BA1I 1YNND 1CI3M 2RSNA 2IX0A 5KNCA 4BY1B 4G7HC 3VYTA 1HQMC 2D62A 3TP7A 4DF7A 1IW7C 1H9SB 4V0BA 4L63B 2BA0A 1JE4A 3SR1A 1SNDA 1Y1VB 5JAVA 2G9DA 1DONA 2K5WA 1E0BA 5EPLA 1UNSA 1BCPB 1D2BA 3PUYA 4HAEA 1II3A 4ZLTF 3KUPA 2SNSA 1E2VA 2J7ZA 4KD4A 4XXEA 1TWGB 4A3BB 3TZUA 1Z6HA 2Q8IB 3BYTB 3T4AC 4A93B 1SSOA 4HTHA 1DM0B 1IKLA 5CORA 1B53A 4NW2A 1SMYC 3OHXC 5C6AA 2WKDA 3NTKA 4OL7A 3T13A 2BCOA 3T51B 2HCIA 1STAA 4IALA 1SE3A 3MC0B 1STEA 4KY5A 1ICWA 3LNNA 1KABA 4OIJA 4X3KA 1Z47A 4L8JA 1O80A 1TS4A 5EKIA 1A2UA 1JOQA 3VR6A 2F0FA 4IUPA 2M2LA 1D6EC 1BCPC 4LJZC 1LT4D 5K5PA 2PZWA 1D5ZC 2AWOA 4HEDA 2A68D 4IN3A 3E6ZX 3HOVB 3FKIB 5D65A 5CGKA 4ZQ3A 1A3UA 4N9PA 1DYQA 1CZWA 1IHZA 4WRDA 1LACA 4IZ8A 2JXMB 1ILQA 2PPBC 1R4QB 2WINB 2PO4A 4H0LC 4X3UA 3OOCA 1IKMA 1QG7A 2AQ2B 4OIKA 1V1PA 3S15B 1SE4A 1AFPA 2EYLA 3HP3A 1BBXC 3NBHA 5DM73 4EGVA 4B9WA 5EQ0A 1WTRA 3OWFA 4NKLA 4MN3A 3EJIA 1VMCA 1BDOA 4C3HG 3G7LA 3I70A 4HSVA 3K0YA 3BDLA 1V8QA 1U4RA 1RHPA 4B08A 4PMBA 4RKBA 3FPPA 3G6JB 1NCVA 1HPCA 5JEAH 1VDZA 2LMCB 4R9WA 4PQXA 1NSNS 2XWBB 1I4XA 5CV9A 5C44B 4J6HA 3M7NA 3HG9A 2RDHA 2WP8J 3NE5B 4K2KA 1G291 3DWAA 4XIGS 3GTMB 3BG3A 4HMJA 1QB5D 3NBIA 2KEDA 3QO2A 4XT1B 2ICEC 1BOSA 1U4LA 1BCPF 1XX8A 4XYOA 2CW0D 5IGBA 3GQBA 4GZYC 2NWGA 2IJ0A 3S9WA 3L3OC 2QEJC 3MZ5A 1FNUA 4DU9A 2O4XA 2F0KA 3C1FA 1EWHA 1CA6A 4DFAA 4KN7C 5G3LF 3SVMA 3S2HB 1ET9A 2KOLA 2K05A 4C1NK 1B9NA 1S5ED 1TS2A 3I4LA 5HGTA 3FRPB 3VA7A 2EY5A 3I4MB 4PMWA 1H9MA 1GUWA 1LTID 2HDMA 1HFNA 1PFMA 2F3VA 3VA5A 5EJWA 1AW7A 1PRTD 4TSSA 4K5VA 5M9OA 3GP7A 3LX0A 4QUCA 1S4ZA 4IUQA 2XNAC 2MP1A 1RCVD 4QB4A 4BA2I 1JB3A 4RA8A 1VF7A 2FMCA 2B2VC 1OXVA 2F0QA 3D4WA 3R2TA 2KCNA 2O2LD 3J7AF 2L5TA 1SYDA 5LL6X 1EYAA 1PTOH 3K5NA 1KTKA 4K8JA 4QMGA 3A54A 1OXUA 2NZ1D 2XVSA 4IQZA 4L6TB 2DY7A 2KUMA 4TKOB 3EFXD 2AQ3B 5M5WB 4DXGA 1HTPA 1TQOA 1JQYD 1PTOD 3LWEA 2L1BA 4TQUS 2Z4HA 3BS1A 2L9HA 3AB9A 2YU9B 3M4OB 2R7ZB 1C48A 2IPKD 4C3JG 3U9SA 4U673 4LMQD 1KAAA 1VMPA 4UAIA 4KHVA 3A7AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KJN A;  3RUZ A;  4HTH A;  3OWF A;  1KDB A;  1KDA A;  1EQV A;  3OMG A;  3NK9 A;  4NKL A;  4PMC A;  4R8N A;  3SK5 A;  4F7X A;  5CC4 A;  4LAA A;  5IIF A;  3EJI A;  4ID6 A;  3P1H A;  1ENC A;  2F0M A;  3QOJ A;  1EY4 A;  1F2Y A;  2EY1 A;  4KD3 A;  2F0N A;  4KTA A;  5EKK A;  4ZUI A;  5CV7 A;  5NUC A;  3TP6 A;  4EVO A;  3BDL A;  4ODG A;  4E6I A;  1EY5 A;  3QOL A;  4MIU A;  2PQE A;  2ENB A;  5CV6 A;  5KEE A;  5C6A A;  1SYG A;  2EY2 A;  2F3V A;  2WAC A;  4KY7 A;  4EQO A;  3VA5 A;  1STN A;  3TME A;  1TR5 A;  1F2Z A;  4OL7 A;  4PMB A;  3T13 A;  3E5S A;  4RKB A;  1STA A;  4K5V A;  5M9O A;  5KYL A;  1AEX A;  4H7B A;  1EYD A;  4ZUJ A;  1SYE A;  3LX0 A;  3C1E A;  3MXP A;  3NP8 A;  3OMC A;  4I65 A;  4IAL A;  5C3X A;  2F0H A;  4YIJ A;  2F3W A;  5CV8 A;  5ISR A;  2KHS A;  2M00 A;  3NQT A;  5KRU A;  3NXW A;  5KYI A;  5HUR A;  2PZT A;  4KY5 A;  5I9P A;  4K8I A;  3TP8 A;  3BDC A;  2F0G A;  5CV4 A;  3ERO A;  3EVQ A;  1NSN S;  1KDC A;  2F0W A;  4K6D A;  3T16 A;  1STY A;  1KAB A;  1SYC A;  4QB4 A;  2F0E A;  1JOO A;  2EYO A;  2F0J A;  2PW5 A;  4RKL A;  4F8M A;  5IOD A;  5KIX A;  4KY6 A;  3V2T A;  1EY0 A;  2KQ3 A;  1NUC A;  4K5X A;  1STG A;  1A2U A;  5CV9 A;  4ME5 A;  2F0T A;  3HZX A;  4NDX A;  2F0F A;  1JOQ A;  3SK8 A;  4J6H A;  4EQN A;  2F0V A;  2SOB A;  3D4D A;  1JOK A;  1EY6 A;  4KV6 A;  5C5L A;  2F0O A;  2SNM A;  5K5P A;  1STH A;  2PZW A;  5DEH A;  2RDF A;  2F0Q A;  2PW7 A;  3D4W A;  2EYJ A;  3SK4 A;  5IGF A;  3D6C A;  3ITP A;  5E3F A;  5J1Z A;  1SYD A;  4QF4 A;  4K2K A;  3P75 A;  1EYA A;  3D8G A;  5C4Z A;  5IGG A;  1TT2 A;  2EXZ A;  5I9O A;  4J1M A;  1SNQ A;  4HMJ A;  2QDB A;  4K8J A;  4ZQ3 A;  5CGK A;  1A3U A;  5I6Y A;  1EZ6 A;  4N9P A;  4QMG A;  3TP7 A;  1IHZ A;  3SHL A;  4DF7 A;  5J22 A;  1SNP A;  3SK6 A;  1EYC A;  4NP5 A;  4WRD A;  4IZ8 A;  2F0D A;  1SNC A;  5I6W A;  1SNO A;  1EY7 A;  1A3V A;  1A3T A;  4DGZ A;  5C5M A;  4NMZ A;  4S3S A;  2OXP A;  4K5W A;  2PZU A;  2HQE A;  4G57 A;  1EY9 A;  5CV5 A;  5IGC A;  2OEO A;  4IUN A;  1TQO A;  3SR1 A;  2PYK A;  5IOC A;  3MHB A;  3DMU A;  2EYH A;  1SND A;  1SYF A;  2RBM A;  3TP5 A;  1JOR A;  1ENA A;  1U9R A;  4TRD A;  4EQP A;  5JAV A;  3U9O A;  5IGB A;  1SNM A;  1RKN A;  2OF1 A;  3SXH A;  4HMI A;  2EY6 A;  2EYP A;  5JOB A;  4K14 A;  4WOR A;  3NUC A;  4PNY A;  3MVV A;  3S9W A;  3HEJ A;  5KGU A;  2F0P A;  5EGT A;  2F0U A;  5J39 A;  3R3O A;  3MZ5 A;  4DU9 A;  2O4X A;  3NHH A;  2F0K A;  1F2M A;  1EZ8 A;  1II3 A;  3C1F A;  5C4H A;  5EKL A;  5F2D A;  5C3W A;  3ERQ A;  5IGD A;  2SNS A;  3DHQ A;  1EY8 A;  2F0L A;  2RKS A;  5CR3 A;  2F0I A;  4K2L A;  4KD4 A;  4B9X A;  4DFA A;  2LKV A;  2F0S A;  2NUC A;  3QB3 A;  4N9T A;  2EYL A;  4KJO A;  3PMF A;  1KAA A;  1SYB A;  1STB A;  5IGE A;  3MEH A;  1A2T A;  5HGT A;  2EYM A;  5E1F A;  4KHV A;  3OSO A;  4B9W A;  2EY5 A;  5DAU A;  3H6M A;  2EYF A; 
#chains in the Genus database with same CATH topology
 4GKJ L;  2HDL A;  4JC0 A;  2FJ2 A;  1PH7 A;  4NB3 A;  1NBW A;  3R93 A;  4R4O A;  1NTG A;  4DK0 A;  3I8Z A;  2RVL A;  3K7U C;  1EWC A;  3K81 C;  3CCE A;  1K8A C;  4HR7 B;  1H9R A;  3S16 B;  1O7Z A;  1PFN A;  4A3G G;  4MIU A;  3MXN B;  1PLF A;  4A3M G;  5EPJ A;  4IO9 A;  4JI1 Q;  3R2I A;  3MTS A;  4EQO A;  4X66 L;  3AU7 A;  1Q81 C;  2E75 C;  4CKB A;  2PMZ E;  3J7Y W;  1G8Z D;  5TSS A;  1AEX A;  4ZUJ A;  1EYD A;  2ZM6 L;  1VQG A;  4ZKB B;  2JA6 H;  1C9O A;  1X54 A;  2M00 A;  2AQ1 B;  4X62 Q;  1T5E A;  1TXY A;  2JE6 I;  3NXW A;  1K73 C;  5HUR A;  1SAP A;  1EU3 A;  4BY7 G;  1K9M C;  2E76 C;  2D2C C;  3VYR A;  1NNX A;  2Q8T A;  1PH5 A;  3K59 A;  4JI5 Q;  2SOB A;  1FGB D;  4DR6 Q;  1YEZ A;  1B44 D;  1EU4 A;  1GVP A;  1EEI D;  2O5I C;  2K7V A;  5E3F A;  4DV5 Q;  1RJT A;  4I7Z C;  3P75 A;  2N88 A;  3EN2 A;  5C4Z A;  1YNX A;  5I9O A;  3G48 A;  2JK8 A;  1A63 A;  1Z9F A;  4Z9C B;  4A3J G;  1I6V C;  1K8M A;  2MO1 A;  1OXS C;  2A1A A;  2WB1 G;  1LV9 A;  2B8F A;  3FPU B;  3QIA A;  3A8J E;  4FXD A;  1ZKO A;  2FIN B;  5I2Y A;  1QZG A;  1DCZ A;  2KCT A;  4NMZ A;  2OXP A;  4K5W A;  5DNF A;  4R4Q A;  5HGQ A;  4OON A;  3KF6 B;  1HUN A;  3T53 B;  2DNE A;  3VR3 A;  3I72 A;  4GLV B;  4R4T A;  3DLL A;  4LFB L;  1JE5 A;  3MA2 B;  4G7O C;  4JK1 C;  3G4S A;  2EY6 A;  2EYP A;  5AJ3 Q;  4RH6 A;  3CP0 A;  4ULL A;  1VQ9 A;  2DY8 A;  2B2Y A;  3RZO H;  3IL8 A;  4QUF A;  3RZD H;  4A3L H;  5M3F B;  5J39 A;  4WFN 3;  1AZQ A;  5FLM G;  3KLS A;  4DR4 L;  2F4I A;  3WOE A;  1TVX A;  2P5Z X;  1U5K A;  1K8G A;  4FNF A;  1EIY B;  2IL8 A;  3VR4 A;  3HOW G;  3I4M H;  2B2W C;  1VQP A;  1GUO A;  1W2B A;  2A6H C;  3TN2 A;  1N34 L;  4JW0 A;  3HOZ B;  3F2B A;  3OIP A;  4MHE A;  1CT1 D;  1IZ6 A;  2K03 A;  2N78 A;  3ND8 A;  1PH4 A;  3T1H Q;  1O7Y A;  4JVZ A;  1NE3 A;  5EKK A;  4ZKC B;  4JBW A;  2PQE A;  2ENB A;  4A76 A;  4DAM A;  2JEA I;  4R4I A;  4BBR G;  4WJW A;  4H7B A;  4JBM A;  1I50 H;  2JJQ A;  4OX9 L;  4KKS A;  1B4O A;  1JWS D;  1ENF A;  2PNR C;  1MGS A;  1ML0 D;  5C0X J;  1HRJ A;  2QDL A;  5M5X B;  1PXU A;  3TP8 A;  1TWH H;  1CHP D;  1KDC A;  2BE5 C;  5A35 A;  1XNR Q;  2PW5 A;  3K6O A;  3GTP B;  2BOS A;  2EE1 A;  2IX1 A;  1S5C D;  4OEL B;  4BBS G;  1GHJ A;  3A8I E;  1JOK A;  4DV7 L;  3ONA B;  3CCR A;  2G5D A;  2QW7 A;  1HZ9 A;  4H44 C;  2NZH A;  3Q23 A;  4QQB X;  5C0X H;  5J1Z A;  1N33 L;  5BN5 A;  5M5Y H;  4JI2 L;  3RN5 A;  4MNO A;  2QDB A;  5JEA G;  3CPW A;  2E2H B;  1LYL A;  4Y7N H;  1MIU A;  3J81 c;  2L11 A;  4YHH L;  1DD2 A;  5J22 A;  2Z6K A;  4P75 A;  3ULL A;  5D14 A;  1Y1W G;  3S1N B;  4ZAI A;  1F2L A;  1HTL D;  1QIL A;  2PNH A;  3J80 c;  3C2P A;  4AYB E;  3GTL B;  4N8F A;  3W1G A;  4WJ3 M;  4LUZ A;  1WJJ A;  2DJF C;  1GUN A;  3I91 A;  2R92 H;  1HNW L;  1RKN A;  2RA4 A;  5BN3 A;  3PO2 G;  3TSS A;  5C4X H;  3S1Q B;  4TVA B;  2FHT A;  4JPB W;  4RMF A;  5KGU A;  2KEN A;  1LLR D;  1I3Q B;  1O7I A;  2GN5 A;  3GV6 A;  5C3W A;  2K32 A;  2PI2 E;  4QIW B;  2R7D A;  2UUC L;  3CCL A;  3GTQ B;  2ZXO A;  1B3A A;  4KJO A;  2UU9 L;  4C1N I;  5M3M B;  3RNU A;  1SYB A;  4HIM A;  3MEH A;  5E4W C;  2HHH L;  2JA8 G;  1Q8K A;  4POF A;  4YWL A;  5IP7 G;  1B70 B;  1KAW A;  3RUZ A;  3VR2 A;  2VNU D;  2A69 D;  2NTS A;  2R61 A;  4O0A A;  5IIF A;  1IXR A;  3P20 A;  3P1H A;  2WV6 D;  4ID6 A;  3K5M A;  1MJC A;  4B3R L;  1Q46 A;  5IYC H;  1EOT A;  1QVC A;  1L2F A;  5E4X A;  3S17 H;  3H0G G;  2NVY B;  4AH6 A;  4UP9 A;  1TS5 A;  2EY2 A;  3M3Y B;  2ALY B;  1YJ9 A;  1SFO H;  4LF9 Q;  2JEB I;  1M4V A;  4HJA A;  3A8K E;  3DM3 A;  1HFG A;  1ZYR D;  2XSC A;  2LFN A;  1QNK A;  3IKJ A;  4YIJ A;  4UP8 A;  2KEC A;  3JC6 6;  3S2D H;  3KK7 A;  1EUJ A;  3BDC A;  2F0G A;  2QIL A;  2F0E A;  3CAM A;  2F0J A;  5IOD A;  1OXT A;  2CVR A;  4J15 A;  2EDG A;  4JG2 A;  1E2Z A;  3D4D A;  4M1U B;  4YWK A;  4JI8 L;  2RDF A;  2EJF C;  2RSO A;  1VQI A;  1X3E A;  3SK4 A;  3STB C;  2KA7 A;  1ONL A;  1BBU A;  1ET6 A;  1S5F D;  4M8A A;  1HH2 P;  4CDF C;  4DAY B;  3BZD B;  2EJG C;  3N52 A;  2TSS A;  1EQT A;  2NYZ D;  1C7Y A;  1X3G A;  1PRT B;  4IPD A;  3H3V I;  5JPN C;  4NPS A;  2KBN A;  3SK6 A;  3K7A H;  3H91 A;  3W3A A;  2IHF A;  3O13 A;  4UHV A;  1IBL L;  2ASB A;  1B3Q A;  1YNJ D;  5I6W A;  1LO5 D;  2CH4 A;  1UE1 A;  4PZ6 A;  2LY7 A;  4S3S A;  3HOX H;  2KJX A;  5CBA E;  5C3E G;  5IGC A;  2B2T A;  4MTN A;  5K36 H;  4RG1 A;  1JOR A;  1CUK A;  4TRD A;  2NN6 H;  3SXH A;  3A56 A;  4HMI A;  1EIF A;  1Z7T A;  1QNU A;  2H4O A;  4QJF A;  5CMD A;  3PIP 3;  1JWU D;  2QKI C;  4FXG C;  2K50 A;  2I5H A;  4ZCK A;  1J5E L;  3CF5 A;  4IUR A;  1LT6 D;  2RCF A;  2SEB D;  1F9P A;  1S5B D;  5C4J B;  2A6E C;  4B3T Q;  2XRS D;  4ZRZ A;  4LF8 Q;  3J7Z C;  1DGS A;  2NUC A;  1A15 A;  4LF7 L;  4HID A;  5EBD A;  2YYZ A;  2AWN A;  3J81 j;  2WII B;  5IT9 E;  3JAM c;  2B63 G;  2PI2 A;  5ELC A;  2F03 A;  2VUM G;  1VQ5 A;  4L5Q A;  4R8N A;  4A3F B;  1VQM A;  2B2V A;  3TS0 A;  5FJ8 G;  1BQQ T;  4DR3 L;  2Y0S B;  3GDE A;  5KEE A;  1X56 A;  4LFC Q;  2K52 A;  1TY2 A;  1SYG A;  1LTA D;  1STN A;  3HOY H;  1M8A A;  1Q1B A;  2Z6B A;  3FEW X;  1SYE A;  3GTJ H;  4OWX B;  1X6O A;  4K6L A;  3KLW A;  3SGI A;  1QVF A;  2BH2 A;  3I4N B;  4DV1 Q;  1X32 A;  1SJE D;  3J7A V;  4KKT A;  4FF4 A;  4RGO S;  4DXF A;  1HXY D;  1RDP D;  1IW7 D;  5JEA J;  1D5M C;  4F8M A;  4DV6 Q;  2D0P A;  1ASZ A;  4ME5 A;  1JJG A;  3HZX A;  2WAQ G;  4MTK A;  1G51 A;  4DUY L;  2DGY A;  5LMN Q;  1WTW A;  2F52 A;  3RR5 A;  4YCW A;  2AHO B;  4U68 A;  1DOL A;  3X3N A;  3D4R A;  2JA6 G;  2GVA A;  3H94 A;  5H1S E;  3RLO A;  3S1M H;  1TWC H;  5D3D A;  3K0X A;  3Q22 A;  2Z0S A;  3KDF B;  4J1M A;  3UE1 A;  2VZA A;  3UI2 A;  4LF5 L;  4JI4 Q;  5I6Y A;  1XYI A;  5L37 A;  1A8V A;  1SDF A;  4C3H B;  3OWE B;  3W5O A;  2HT1 A;  1KRS A;  4DGZ A;  1HNX L;  1BXT A;  1EY9 A;  5I2X A;  3MAQ A;  3GTO B;  5ELD A;  3MHB A;  4BY1 H;  1AE3 A;  4ABN A;  1SYF A;  2RBM A;  5BR8 Q;  4IUV A;  1HR0 Q;  3DEP A;  3HKZ B;  1I94 L;  1SNM A;  5J3B A;  1YBY A;  4B3M L;  1LTS D;  4G7Z C;  5C4H A;  1SEB D;  5EKL A;  5F2D A;  4RGT A;  1SMY D;  5LMU L;  3HS0 C;  3L0O A;  2RKS A;  1Y1V H;  3OTO L;  1XPU A;  3L9A X;  5IGE A;  1N32 Q;  1G6P A;  5E1F A;  1VQL A;  4UP7 A;  1SE2 A;  2EYF A;  4JBJ A;  4DR1 L;  1DZ1 A;  1HNZ Q;  4A3L G;  4LAA A;  1VQH A;  4KK7 A;  3M3Y H;  4AYB B;  1TWG H;  4A3B H;  1WTQ A;  5CV7 A;  1I4P A;  4LW1 A;  4XTC S;  1GUG A;  4A93 H;  3H15 A;  3CD6 A;  2WAC A;  3ER0 A;  3I4M G;  1BCP D;  4HSP A;  1LTT D;  1C0A A;  1VQD A;  5GAH C;  3NP8 A;  3C1E A;  3HOU B;  2RF4 A;  4A3I B;  1SE8 A;  3KJP A;  5FOB B;  1GXD C;  3L2P A;  2B2U C;  5CV4 A;  1QCB D;  1STY A;  1KRT A;  1LTR D;  2HCC A;  1XNQ L;  3AMU A;  2O5J C;  2D0O A;  1AH9 A;  1FGU A;  4A3E B;  3PUW A;  2DNC A;  1V1P B;  3WWV A;  3SEB A;  3SK8 A;  2X69 A;  1WI5 A;  3M4P A;  4KV6 A;  1NJI C;  1IYV A;  1STH A;  4HJ7 A;  4DK1 A;  4CHT B;  4HN7 A;  3NBH B;  3K57 A;  5ELB A;  5IGF A;  2VQE L;  1PRT F;  1V43 A;  3I90 A;  2F4V L;  5C0X I;  2UUA Q;  2EXZ A;  4RHR A;  1GOZ A;  2K01 A;  2FFK B;  3SHL A;  3VYS A;  1SNP A;  1Q3L A;  3RLN A;  4RHS A;  2GVB A;  2F0D A;  1PH2 A;  2IT1 A;  1I4R A;  1XTC D;  2RQX A;  4KKU A;  3ULP A;  3MXU A;  3HOV H;  3FKI H;  1UAP A;  5FLX c;  4FO2 A;  1I4G A;  4JI0 Q;  1U9R A;  1YHB A;  4RGN A;  2XRQ D;  3E9H A;  5C0X G;  2ZJP A;  2K28 A;  3G71 A;  2IY5 B;  1FYC A;  4K14 A;  1PDQ A;  2ES2 A;  3TRE A;  5BN4 A;  2PCF B;  4DR5 L;  2X6L A;  5ELN A;  3KOJ A;  4DN4 M;  4IOC A;  2AUK A;  4B9X A;  3DWQ A;  1UUP A;  4XT3 B;  1X55 A;  2F1M A;  1E7Z A;  2H5X A;  2IWH A;  3WOF A;  3X3M A;  4GNX B;  2K6A A;  2WFW A;  4DV2 Q;  1AP0 A;  1TWF B;  1TY0 A;  2R92 G;  5KND A;  1KHI A;  1RD9 D;  3CRK C;  5C4X G;  3OMG A;  3NK9 A;  4K0K L;  4JI6 L;  4DAV A;  1FJG L;  3IFD A;  1KD1 C;  3S15 H;  2ZXP A;  2F0M A;  3W1B A;  3T1Y Q;  4IUU A;  2VXW A;  3J81 L;  4CBV A;  3DM1 A;  3AQQ A;  4E6I A;  1W6K A;  2CCZ A;  1FD7 D;  1LTG D;  3PSI A;  1FNW A;  2R93 B;  3I7F A;  4RWS C;  1ROD A;  3J80 L;  5IWA L;  4BXX H;  5KYL A;  1DOK A;  1J9O A;  4JV5 Q;  2YTY A;  2ICI A;  1JC7 A;  2K5N A;  2K5V A;  3F2U A;  5A2Q L;  3RD4 A;  4JI3 Q;  1CFM A;  5KYI A;  4X65 L;  2ZT9 C;  2G9H D;  2KVM A;  3NTH A;  2IX3 A;  4K6D A;  2XWJ B;  2E8G A;  1MSG A;  5IYC G;  4LK1 C;  4IJL A;  1NUC A;  1Q82 C;  1ZXT A;  2JA5 B;  1PFB A;  1VCI A;  1I6H B;  2YTV A;  1J8I A;  2K5D A;  4LF6 L;  3UDX A;  4C3J B;  4X66 Q;  2AUJ D;  1GUS A;  2QF7 A;  1IL8 A;  1VQ7 A;  1QOH A;  1LT5 D;  4IFD J;  2HQL A;  2MHV A;  1FR3 A;  3V96 A;  5C44 H;  4GNX C;  4OO1 H;  2B3G A;  4GN5 A;  3TZD A;  2JN4 A;  3ZJY C;  3BDO A;  2JSO A;  4BWG B;  4GOP B;  1R4P B;  4IOA A;  4WJ4 A;  2MPM A;  2ZTE A;  3SDZ A;  1CSP A;  3CCS A;  5FO8 B;  1N36 Q;  4IJH A;  4A3G B;  2HQE A;  3FDT A;  1CQV A;  4A3M B;  3GTM H;  4X62 L;  4IFD H;  1XMQ L;  5FO7 B;  2NVX B;  1YNN C;  2NVT B;  3KLR A;  5EGT A;  3E0J A;  1HA5 A;  1JJC B;  2UXB L;  3DHQ A;  4DR6 L;  1HJP A;  5CR3 A;  4BY7 B;  1S5D D;  4RFB A;  4N9T A;  4BS9 A;  3HOX G;  4DV5 L;  1HA6 A;  1I4Q A;  2EPB A;  5K36 G;  2I46 A;  1B1Z A;  2NN6 G;  5ELF A;  1PV4 A;  3C3L A;  4LFB Q;  2F3I A;  1YIT A;  4C56 C;  3DUZ A;  3MXG A;  3S2H H;  2LXJ A;  1H9S A;  4YY3 L;  4ODG A;  4A3J B;  1EY5 A;  3HOZ G;  1XJV A;  5CBE E;  2CWA A;  2WB1 B;  4A3I H;  4KY7 A;  1K83 B;  2K4K A;  3S1R B;  1F2Z A;  3TQY A;  1CKN B;  1IBM L;  3PO3 B;  4GOP C;  2K5H A;  4UDU C;  2KHJ A;  3NQT A;  1X3Q A;  3GV3 A;  1B50 A;  2EOT A;  2H1E A;  4B3S Q;  2A8V A;  1Q86 C;  4IUT A;  1OXX K;  4CJ0 B;  4L5T A;  3GTK B;  1X65 A;  2F0V A;  5EBC A;  3M9B A;  3HOY G;  3KJO A;  2NVQ B;  3M4Y A;  1F9Q A;  3HOW B;  1KQS A;  1V1O A;  4NXN Q;  3JAM L;  5CYU A;  1F9S A;  3IRB A;  5GAD C;  3R8B A;  4J8Q A;  2WAQ E;  4QCL A;  3RN2 A;  1EYC A;  4C3I B;  2CKZ B;  4XDX A;  1QVG A;  2BA1 A;  3S14 B;  2QGQ A;  3DMU A;  5EPK A;  1R9T B;  4DV7 Q;  2A68 C;  4RAU C;  1N9W A;  2CQA A;  3A7L A;  4BBR B;  1K3R A;  4PNY A;  2XGT A;  3R3O A;  4Y52 H;  2EXD A;  4JI2 Q;  5M5W H;  3TDQ A;  4A4I A;  4CJ2 C;  4YHH Q;  3VDY A;  3GTG B;  2F0I A;  5GAG C;  1CQF A;  3CHB D;  3ND9 A;  1DXM A;  4FF1 A;  3CXC A;  4BBS B;  2MJ8 A;  3RMH A;  3OSO A;  4BY1 G;  3K8A A;  5COY A;  2YU9 H;  3M4O H;  2R7Z H;  1KDB A;  3SK5 A;  1HNW Q;  4PMC A;  4F7X A;  3E0E A;  2R93 H;  2DN8 A;  1HQR D;  1CTM A;  3CC4 A;  1V1Q A;  1SRO A;  1T9H A;  5NUC A;  4DNR B;  4X64 L;  4YWM A;  2VB2 X;  1Y1V G;  1L1O A;  2IW3 A;  1FNV A;  3HFZ B;  2UUC Q;  4CDE C;  1TR5 A;  3KF8 A;  3HRZ C;  2Z8L A;  2UU9 Q;  1Y1W B;  4XYQ A;  4Q0F A;  5C3X A;  4LF4 Q;  3PIO 3;  1RIP A;  2HHH Q;  3S16 H;  4JBK A;  3GO5 A;  4A3B G;  3PO2 B;  1QUQ A;  2J0T D;  4B3R Q;  1EY0 A;  1LTB D;  4ME3 A;  4K5X A;  1STG A;  3D0F A;  4A93 G;  1EY6 A;  1CK1 A;  2TMP A;  1CM9 A;  3U4V A;  1F9R A;  3ITP A;  1PHJ A;  2E2I B;  3IAY A;  1JCK B;  1PH1 A;  4FF3 A;  4X6A H;  1TT2 A;  2JA8 B;  1TWA B;  3CW2 C;  4LF9 L;  4DAP A;  1VQB A;  1A3V A;  1A3T A;  2KEE A;  4ZK9 B;  3H0G B;  2A6H D;  1EFW A;  2L12 A;  2EYH A;  1WYD A;  4JI8 Q;  4EQP A;  1ESR A;  3U9O A;  2C9O A;  2M9V A;  3NUC A;  4G4K A;  2F0U A;  4FXK C;  3NHH A;  4DA2 A;  1EQR A;  2PMZ B;  2R7F A;  4QL5 A;  5T1G A;  3V05 A;  1D5X C;  4KN4 C;  1JR0 D;  3I55 A;  2F0L A;  2B2Y C;  2LKV A;  1IBL Q;  2B2U A;  3OW2 A;  1UEA B;  4F88 A;  1STB A;  1RL2 A;  1A2T A;  2I5L X;  3PIO A;  4JYA Q;  5M3F H;  4HCE A;  2R3Z A;  3FKI G;  3PGZ A;  3I73 A;  3HOV G;  2CW0 C;  1L0W A;  1WTH A;  1TS3 A;  2ZXR A;  1HCZ A;  4L5S A;  1IBK L;  2BE5 D;  2B39 A;  2K04 A;  1JB7 A;  1EY4 A;  1F2Y A;  1UE5 A;  3D6W A;  3TP6 A;  2VW9 A;  1M1K C;  3QG1 A;  3PO3 H;  3CPF A;  3HOZ H;  2N3S A;  3CRL C;  1MBY A;  3I3C A;  3TME A;  2VB3 X;  3J81 E;  4F87 A;  2V4D A;  2MGS A;  1T5X D;  1YJW A;  5FLX L;  3CQZ B;  4DR7 L;  4I65 A;  3OMC A;  4C2M B;  3CCJ A;  2NTT A;  3WDN A;  2F3W A;  3J80 E;  5C3E B;  2Y0S G;  4DV0 Q;  4OGQ C;  4B3T L;  4QGU A;  1I4H A;  5A2Q E;  1SYC A;  1S72 A;  1D7Q A;  4RKL A;  1NAP A;  1PTO B;  5KIX A;  4A75 A;  2KQ3 A;  2RHS B;  1UEB A;  4APV A;  4DR3 Q;  1SXT A;  1CHQ D;  5LMN W;  2NZO A;  3D31 A;  3A5Z B;  4FP5 D;  1BKB A;  2F0O A;  4DK6 C;  1OO9 B;  4DV4 Q;  3AEV A;  1PRT C;  1PH3 A;  5M5X H;  3PV0 A;  5IP9 H;  2EYJ A;  1SBB B;  4BXX G;  1G91 A;  3D6C A;  5IE8 A;  1CZG A;  3W2D A;  4JI7 Q;  5IGG A;  3D8G A;  2OT2 A;  2B29 A;  1Q90 A;  4CGY B;  1D1I A;  3GTP H;  1KNA A;  4A3D B;  5FKA C;  1EIH A;  2B63 B;  4LFC L;  1ASY A;  1NR4 A;  4OO1 I;  2VUM B;  1KXL A;  1W6J A;  4IPC A;  1K8O A;  2HIV A;  2WKC A;  2JQO A;  1YZ6 A;  1LAB A;  4NXM L;  3DWP A;  5C5M A;  2CHB D;  2PQA A;  4HJ8 A;  4G57 A;  4O1N A;  5CV5 A;  2CH4 W;  4IUN A;  2PYK A;  4KHP L;  2E2J B;  1PYS B;  2E2H H;  2Z6K C;  1HR0 W;  4IFD I;  5I4D A;  1ESF A;  1MKH A;  1HHV A;  2D9U A;  3PF4 A;  2J4X A;  5C44 G;  3S1N H;  3NSW A;  4DV6 L;  1KLU D;  4OO1 G;  1F2M A;  2R6G A;  3GTL H;  4UPA A;  3PUV A;  3Q8D A;  3OYY A;  1B8A A;  2DUD A;  1Q1E A;  3S1Q H;  1CSQ A;  1EEF D;  2VQF Q;  1X3F A;  3CC2 A;  1HNX Q;  1PTO C;  5IYD H;  2WAQ B;  3BJU A;  4O42 A;  1GUT A;  1I3Q H;  4IFD G;  5DAU A;  3J7A 5;  1C4Q A;  4KJN A;  3H3V C;  4AQY L;  1I94 Q;  2LS0 1;  1GKH A;  2JA6 B;  1PFS A;  3GTQ H;  1SR3 A;  1ILP A;  1MI2 A;  1H9J A;  5M3M H;  4P2C B;  3AFP A;  4XQQ A;  5JJZ A;  1KIX A;  3Q24 A;  1RTN A;  5LMU Q;  1DOM A;  1YIJ A;  3KBX A;  4P73 A;  2LXK A;  3OTO Q;  1ZEQ X;  3STB D;  3KLS X;  3CU7 A;  2F0H A;  4FYD A;  5ISR A;  2XIW A;  2A19 A;  2PZT A;  4K8I A;  2NVY H;  4DR1 Q;  3BVG A;  1A6X A;  1M90 C;  3EVQ A;  2C35 B;  2UUB L;  3MFY A;  3OIQ A;  1XMO Q;  2EQS A;  4DKA C;  3FHW A;  1I5F A;  3QJY A;  1CA5 A;  1N32 L;  4DNT B;  4EQN A;  1QWY A;  5C5L A;  4A3I G;  1QE6 A;  2E5L L;  1D8L A;  2PW7 A;  5LL6 S;  3OPO A;  1U4M A;  3B6Y A;  4KMU C;  1X3P A;  1SJH D;  1SNQ A;  2L0C A;  2MNA A;  3D3R A;  2NB0 A;  3JAM E;  1EZ6 A;  3PQI A;  3FP9 A;  5G3L D;  3RZO B;  2I07 B;  3RZD B;  2A6E D;  3MXN A;  1XNQ Q;  5HY6 A;  2V1C C;  1WOC A;  4X3S A;  3ICE A;  1U4P A;  3NWS A;  3IFT A;  2PZU A;  3PF5 A;  3CCQ A;  2OEO A;  2K14 A;  5IOC A;  2L4N A;  5JJL A;  1ICF B;  1ENA A;  5JVG 3;  2UXC L;  3C46 A;  4RGM A;  3F8T A;  1EQQ A;  2K5Q A;  4WOR A;  2B2W A;  1E2W A;  2X6G A;  4LFA L;  1PZJ D;  2B2T C;  4OWW B;  1EZ8 A;  5IGD A;  2UXD L;  1Y69 U;  1EY8 A;  3UE0 A;  1FL0 A;  4XQN A;  4DR2 Q;  1IYJ B;  4QY7 A;  2QCP X;  3K58 A;  1B2T A;  2EYM A;  2UUA L;  2OCE A;  1RF2 D;  3H6M A;  3QWN A;  1KDA A;  1EQV A;  5CC4 A;  3EBE A;  3EQL C;  5C4J H;  5FK9 C;  1I50 B;  5ELE A;  1HZB A;  2MUY A;  3QOJ A;  4GN3 B;  4Q5V A;  4EVO A;  1BUV T;  3DXJ C;  4DNI A;  3P7J A;  4DR5 Q;  1WTP A;  3QOL A;  2N55 A;  1PZK D;  1TWH B;  4C2M H;  3TRZ A;  2ID0 A;  1H9K A;  4FVM A;  3T56 B;  1S40 A;  4GKK L;  1XXG A;  4JI0 L;  3E5S A;  3KF6 A;  2A74 C;  4A3F H;  2Q2T A;  4QIW E;  1E3P A;  1E22 A;  2ZTC A;  1PTO F;  3BYY B;  5KRU A;  5FO9 B;  2R7Z G;  1RTO A;  5I9P A;  1KLG D;  4DUZ L;  2BH8 A;  2R93 G;  1WTO A;  1PH6 A;  3ERS X;  4K0K Q;  1KNE A;  3T16 A;  2GA4 B;  2A73 B;  1FJG Q;  1JOO A;  1EL0 A;  4RCN A;  3NPP A;  2Q2U A;  4GS3 A;  4V19 0;  5M5Y B;  3BVZ A;  3E3X A;  2F0T A;  4NDX A;  3NEM A;  2HUG A;  4Y7N B;  3UDG A;  5IY0 A;  2XTI A;  2AKW B;  1WCM B;  1AE2 A;  3PUX A;  5KNB A;  2BDN A;  4A3K B;  4P74 A;  3CME A;  3I4N H;  3KBG A;  1EFI D;  5IWA Q;  1W3S A;  3ZYY X;  4QF4 A;  1X9N A;  4LWC A;  5E7N A;  3M4Q A;  4DV3 Q;  1HUM A;  3URY A;  1B9M A;  4GKJ Q;  2R92 B;  3HGB A;  4CDD C;  5C4X B;  1Q12 A;  2EZV A;  5AFW A;  1JMC A;  4NP5 A;  1LTL A;  4X3T A;  4GLA C;  3A55 A;  5IT9 L;  1SNO A;  1EY7 A;  1NR2 A;  2N8N A;  4YCV A;  3PCO B;  1A62 A;  1CKO A;  4CJ1 B;  4CKE A;  1GD7 A;  2E74 C;  1J6Q A;  2SDF A;  3NWT A;  3TP5 A;  2KCC A;  2K1B A;  1SLJ A;  5IYB H;  1XPR A;  5DM6 3;  2ZM6 Q;  1JWM D;  4MZ9 A;  4C3H H;  1TKW B;  2JA7 B;  3L7Z C;  1WD0 A;  2Q2I A;  1SMX A;  1KC8 C;  1JT8 A;  1JIC A;  4HIO A;  4H02 A;  4JI1 L;  3GTO H;  2Z4I A;  4OHJ A;  3QB3 A;  1VQJ A;  1QZH A;  5JPM C;  2A5H A;  3PMF A;  3VR5 A;  3S17 B;  4HJ9 A;  1TU2 B;  3VYU A;  1TII D;  1O7L A;  2ZTD A;  1SFO B;  3TBI B;  1XMQ Q;  4POG A;  2NN6 I;  1BNZ A;  3GD7 A;  2Z1C A;  1GJX A;  1K28 A;  2NBF A;  4ZYS A;  1JJ2 A;  2L55 A;  3SE0 A;  1BF4 A;  3M85 A;  2EY1 A;  4KD3 A;  2F0N A;  4KTA A;  4ZUI A;  3S2D B;  1PYB A;  1VQE A;  4JI5 L;  1N36 L;  1K0R A;  5CV6 A;  4PV1 C;  2UXB Q;  3CCV A;  2D5D A;  4LNQ A;  4YCU A;  2C5C A;  1LT3 D;  5M3F G;  5LHY 1;  4KHZ A;  5D3I B;  1L0X B;  2A69 C;  2EJM A;  1YJN A;  1WTV A;  5FLX E;  3H09 A;  1LM0 A;  1VQA A;  1XWE A;  2RDG A;  4OWT B;  2E2D C;  4DR4 Q;  1WVL A;  2I0Q A;  2JYO A;  3PO3 G;  1BR9 A;  1MSH A;  4ILW A;  4YY3 Q;  4JCV E;  3HOU H;  3LGJ A;  3NEN A;  3A74 A;  4R8I A;  2XN9 C;  3K7A B;  2Y0S E;  1QJO A;  1Q8I A;  1ZYR C;  4PZ7 A;  5AJ3 L;  2FXQ A;  3NEL A;  1PZI D;  4HCS A;  1IBM Q;  3HOX B;  1EWI A;  3CKI B;  1N34 Q;  3BZC A;  3FVQ A;  2EVB A;  4A3E H;  2RHQ B;  2OWO A;  2AMC B;  1L0Y B;  3MFG A;  3CMA A;  4KI0 A;  4XQJ A;  1G2T A;  1IYU A;  1VQC A;  3K5L A;  5JVH 3;  1SNC A;  4CDC C;  3EA6 A;  1WD1 A;  1C8C A;  1AN8 A;  1O78 A;  2HIX A;  1EIG A;  3CCM A;  5IP9 G;  2ZJQ A;  3K5O A;  4RCO A;  4EX5 A;  2OF1 A;  3BVM A;  5JOB A;  3T1H L;  4C3I G;  4B3S L;  1F77 A;  3MVV A;  1VQO A;  1PMR A;  4OX9 Q;  1G6Z A;  2JP1 A;  3HEJ A;  2F0P A;  1VF5 C;  2EIF A;  1Y14 B;  1G2S A;  2B8G A;  3ERQ A;  1Y8O B;  3N6R A;  1P8L A;  1Y8P B;  4K2L A;  1YNJ C;  3NTI A;  3Q0A A;  2F0S A;  1GHK A;  2BDO A;  1D1K A;  1MD2 D;  1PH9 A;  4NXN L;  3ULJ A;  2K33 A;  1PYW D;  3PUZ A;  3TS2 A;  1P16 A;  3HOY B;  3AFQ A;  3FMC A;  4DAY A;  4KLK A;  1BO0 A;  1XNR L;  3GTJ B;  1ENC A;  3LWU A;  4FF2 A;  1N33 Q;  3HKZ E;  4JOI C;  5T1I A;  4P71 A;  3Q6S A;  3EIV A;  1YVC A;  4CKC A;  1TWF H;  1Y8N B;  3U50 C;  2VS1 A;  3DEO A;  3MWY W;  5IYD G;  3F2D A;  1WTX A;  3MXP A;  5DLQ E;  2FMM A;  5CV8 A;  1U0L A;  2KHS A;  3A5U A;  3M7G A;  1AZP A;  2CQO A;  3ERO A;  1WCM H;  4HIK A;  2F0W A;  3S1M B;  1UWV A;  4A3K H;  1TWC B;  2EYO A;  1DJR D;  4KY6 A;  2Q8R E;  3V2T A;  5M3M G;  3NQI A;  3OW7 A;  3RLF A;  1NY4 A;  4X64 Q;  5IT9 c;  2SNM A;  5DEH A;  4H13 C;  4BA1 I;  1UE7 A;  4GN4 B;  1YI2 A;  4UY8 C;  1B7Y B;  1YNN D;  1CI3 M;  2RSN A;  2IX0 A;  5KNC A;  4IPG A;  4BY1 B;  4IPH A;  2JA5 H;  4G7H C;  3VYT A;  1HQM C;  2D62 A;  1I6H H;  3TP7 A;  4A3C G;  5GAE C;  4DF7 A;  1IW7 C;  3QR8 A;  1H9S B;  4V0B A;  4C3J H;  1V9P A;  3HKS A;  4L63 B;  2BA0 A;  1K0S A;  1JE4 A;  4LF4 L;  4R1J A;  3SR1 A;  1SND A;  1Y1V B;  2JA7 H;  2OQK A;  5GQO A;  5JAV A;  2G9D A;  1DON A;  2K5W A;  4PG3 A;  1E0B A;  5EPL A;  1UNS A;  1BCP B;  1D2B A;  3PUY A;  3I4O A;  4HAE A;  1II3 A;  4ZLT F;  2ZJR A;  4A3G H;  3AYH B;  3S24 A;  3KUP A;  2SNS A;  1E2V A;  4A3M H;  2J7Z A;  2KHI A;  4KD4 A;  4XXE A;  1TWG B;  2NVX H;  4A3B B;  3TZU A;  2NVT H;  1Z6H A;  2HD3 A;  2Q8I B;  3TEH B;  4DK3 C;  3BYT B;  3T4A C;  4A93 B;  1YHQ A;  3J81 i;  1GM5 A;  1SSO A;  3KDF A;  4HTH A;  1DM0 B;  1IKL A;  5COR A;  3J80 i;  4BY7 H;  1B53 A;  1UE6 A;  4LUO A;  4NW2 A;  1MJE A;  1SMY C;  2RCN A;  4EQ5 A;  3OHX C;  5C6A A;  2WKD A;  1NMG A;  3NTK A;  1K3B C;  4OL7 A;  3T13 A;  2BCO A;  1E24 A;  2HCI A;  3T51 B;  1STA A;  3KFU A;  4IAL A;  1SE3 A;  3MC0 B;  1STE A;  1XPO A;  3MEF A;  4KY5 A;  4A3J H;  1ICW A;  3LNN A;  3A0J A;  1KAB A;  4OIJ A;  1K83 H;  3S1R H;  4X3K A;  1Z47 A;  4OXP A;  1IBK Q;  4L8J A;  1O80 A;  1TS4 A;  5EKI A;  1A2U A;  2JA9 A;  1JOQ A;  3VR6 A;  2F0F A;  1J5E Q;  4IUP A;  2M2L A;  1D6E C;  1NMF A;  4JYA L;  1BCP C;  4LJZ C;  1LT4 D;  2I5M X;  2PZW A;  5K5P A;  3F2C A;  1D5Z C;  2AWO A;  4A3F G;  4HED A;  2A68 D;  4IN3 A;  3E6Z X;  4LF7 Q;  4LUV A;  1E1T A;  4DR7 Q;  4AIM A;  3HOV B;  2CFM A;  3F1Z A;  3FKI B;  5D65 A;  5FLM H;  3GTK H;  5CGK A;  4ZQ3 A;  4O2D A;  1A3U A;  4N9P A;  1DYQ A;  1CZW A;  1IHZ A;  4LF8 L;  2NVQ H;  1N8R C;  4WRD A;  1LAC A;  3HOW H;  4IZ8 A;  2JXM B;  1ILQ A;  1IL2 A;  1L1O B;  2VL6 A;  4OEM B;  3KF8 B;  2PPB C;  3I4N G;  4A3D G;  1R4Q B;  1GO3 E;  1HZA A;  2WIN B;  4DV0 L;  2PO4 A;  4H0L C;  4X3U A;  3OOC A;  1IKM A;  4C3I H;  3KYH C;  1QG7 A;  2AQ2 B;  1VQ8 A;  3I56 A;  3S14 H;  2Q2H A;  4OIK A;  1QUQ B;  3CCU A;  1V1P A;  4DV4 L;  1R9T H;  3S15 B;  1SE4 A;  2KCM A;  2YV5 A;  1AFP A;  2EYL A;  3HP3 A;  4BBR H;  4DUY Q;  4NXM Q;  1BBX C;  3NBH A;  5DM7 3;  4JI7 L;  4EGV A;  1EOV A;  4B9W A;  5EQ0 A;  4DV1 L;  1WTR A;  4KHP Q;  3E9I A;  3OWF A;  5IYB G;  4NKL A;  4MN3 A;  3GTG H;  3EJI A;  1VMC A;  1BDO A;  4C3H G;  3G7L A;  1VQ6 A;  3I70 A;  1SN8 A;  4LF5 Q;  4HSV A;  3K0Y A;  3BDL A;  5LMN L;  4BBS H;  1V8Q A;  2IHE A;  1U4R A;  5JJI A;  3HKZ G;  1RHP A;  4B08 A;  2K75 A;  4PMB A;  3UDI A;  1PH8 A;  1BVS A;  2YTX A;  4RKB A;  1VQ4 A;  3PIP A;  3FPP A;  3G6J B;  1NCV A;  2L15 A;  1HPC A;  1L1O C;  4JI4 L;  5JEA H;  3U58 A;  1VDZ A;  1YHA A;  2LMC B;  4R9W A;  4AQY Q;  4PQX A;  1NSN S;  1VQF A;  4B3M Q;  2XWB B;  1I4X A;  4PZ8 A;  5CV9 A;  5C44 B;  3JAM i;  3BZK A;  2VQF L;  1Y1W H;  1VS0 A;  4J6H A;  3M7N A;  2LSS A;  2RDH A;  3HG9 A;  1CKM A;  2OQ0 A;  4GNX A;  5BR8 L;  1HR0 L;  1PVO A;  2OTL A;  2WP8 J;  3NE5 B;  1H95 A;  2WB1 E;  1A0I A;  4AYB G;  3PO2 H;  4K2K A;  1G29 1;  3DWA A;  4XIG S;  3GTM B;  3BG3 A;  4HMJ A;  3CC7 A;  2QA4 A;  4P72 A;  1Q7Y C;  1QB5 D;  4A3C H;  3NBI A;  2KED A;  3QO2 A;  4XT1 B;  2UUB Q;  5JJK A;  2ICE C;  3HOU G;  2E2I H;  1BOS A;  1U4L A;  1VQN A;  1BCP F;  1XX8 A;  2JA8 H;  4XYO A;  2E5L Q;  2QEX A;  5IP7 H;  2CW0 D;  1HNZ L;  5IGB A;  1TWA H;  3GQB A;  4GZY C;  2NWG A;  2VY3 A;  2IJ0 A;  3S9W A;  4A3E G;  3L3O C;  2QEJ C;  3MZ5 A;  1FNU A;  4DU9 A;  1XMO L;  2O4X A;  2F0K A;  3C1F A;  1EWH A;  3H0G H;  1CA6 A;  1WFQ A;  1S3O A;  4KN7 C;  5G3L F;  4DFA A;  3SVM A;  3BU2 A;  4ALP A;  3S2H B;  1ET9 A;  2KOL A;  2K05 A;  4C1N K;  1B9N A;  2ATW A;  1S5E D;  1TS2 A;  3I4L A;  5HGT A;  3FRP B;  3VA7 A;  2EY5 A;  3I4M B;  4PMW A;  5ELO A;  1H9M A;  2UXC Q;  1GUW A;  2VQE Q;  5GRO A;  2F4V Q;  1LTI D;  5EAY A;  4LFA Q;  2HDM A;  1HFN A;  4GOP A;  1PFM A;  2UXD Q;  2F3V A;  4GLX A;  2Z9H A;  3VA5 A;  1XTD A;  2DJG C;  5EJW A;  1AW7 A;  2PQA B;  1PRT D;  4TSS A;  4K5V A;  5M9O A;  3GP7 A;  3LX0 A;  4QUC A;  1MHW C;  1OTC A;  2CWP A;  1S4Z A;  4IUQ A;  4N8X 1;  3UDF A;  2XNA C;  2OTJ A;  2MP1 A;  1RCV D;  4QB4 A;  2MQH A;  4BA2 I;  4DR2 L;  3CQZ H;  3U4Z A;  1JB3 A;  4RA8 A;  3K80 C;  5C3E H;  1VF7 A;  2FMC A;  2B2V C;  1OXV A;  4GKK Q;  2F0Q A;  4DPG A;  3D4W A;  3R2T A;  2KCN A;  2O2L D;  3J7A F;  1KL9 A;  2L5T A;  1SYD A;  1HZC A;  5LL6 X;  1EYA A;  1PTO H;  1SRU A;  1BBW A;  3K5N A;  4R4C A;  1KTK A;  4K8J A;  4HJ5 A;  3H3V H;  4QMG A;  1WCM G;  4DUZ Q;  4JI6 Q;  3A54 A;  4A3K G;  1OXU A;  2NZ1 D;  2XVS A;  4I7A A;  4IQZ A;  4L6T B;  1EYG A;  2DY7 A;  2KUM A;  4TKO B;  3EFX D;  2AQ3 B;  2MFI A;  4DV2 L;  5M5W B;  1CKN A;  4DXG A;  1HTP A;  4JOI A;  1TQO A;  1JQY D;  1PTO D;  1VQK A;  4A3D H;  3I2Z A;  3LWE A;  2B63 H;  2L1B A;  4L5R C;  2VUM H;  4TQU S;  2Z4H A;  3BS1 A;  2MO0 A;  2L9H A;  3T1Y L;  1PA6 A;  5FJ8 H;  2JA5 G;  4X65 Q;  3AB9 A;  2YU9 B;  3M4O B;  2R7Z B;  2E2J H;  1C48 A;  2IPK D;  4C3J G;  1LUZ A;  3U9S A;  2N49 A;  4U67 3;  4LMQ D;  1KAA A;  3G6E A;  4JV5 L;  1E1O A;  1VMP A;  1FVI A;  4UAI A;  4KHV A;  3A7A B;  4FDB A;  2JA7 G;  4JI3 L;  4DV3 L;  4LF6 Q; 
#chains in the Genus database with same CATH homology
 2HDL A;  2FJ2 A;  3R93 A;  4DK0 A;  3I8Z A;  2RVL A;  1EWC A;  4HR7 B;  1H9R A;  3S16 B;  1O7Z A;  1PFN A;  4MIU A;  1PLF A;  5EPJ A;  3R2I A;  3MTS A;  4EQO A;  3AU7 A;  2E75 C;  4CKB A;  3J7Y W;  1G8Z D;  5TSS A;  1AEX A;  4ZUJ A;  1EYD A;  4ZKB B;  2M00 A;  2AQ1 B;  1T5E A;  2JE6 I;  3NXW A;  5HUR A;  1SAP A;  1EU3 A;  2E76 C;  2D2C C;  3VYR A;  2Q8T A;  3K59 A;  2SOB A;  1FGB D;  1B44 D;  1EU4 A;  1EEI D;  2O5I C;  2K7V A;  5E3F A;  1RJT A;  4I7Z C;  3P75 A;  2N88 A;  5C4Z A;  5I9O A;  4Z9C B;  1I6V C;  1K8M A;  1OXS C;  1LV9 A;  2B8F A;  3FPU B;  3QIA A;  3A8J E;  4FXD A;  1ZKO A;  2FIN B;  5I2Y A;  1DCZ A;  4NMZ A;  2OXP A;  4K5W A;  5DNF A;  1HUN A;  3T53 B;  2DNE A;  3VR3 A;  3I72 A;  3MA2 B;  4G7O C;  4JK1 C;  2EY6 A;  2EYP A;  4RH6 A;  4ULL A;  2DY8 A;  2B2Y A;  3IL8 A;  4QUF A;  5M3F B;  5J39 A;  4WFN 3;  1AZQ A;  3KLS A;  2F4I A;  3WOE A;  1TVX A;  4FNF A;  2IL8 A;  3VR4 A;  2B2W C;  1GUO A;  2A6H C;  3TN2 A;  3HOZ B;  3OIP A;  4MHE A;  1CT1 D;  2K03 A;  3ND8 A;  1O7Y A;  5EKK A;  4ZKC B;  4JBW A;  2PQE A;  2ENB A;  2JEA I;  4WJW A;  4H7B A;  4KKS A;  1B4O A;  1JWS D;  1ENF A;  2PNR C;  1MGS A;  1ML0 D;  5C0X J;  1HRJ A;  5M5X B;  1PXU A;  3TP8 A;  1CHP D;  1KDC A;  2BE5 C;  5A35 A;  2PW5 A;  3K6O A;  3GTP B;  2BOS A;  2EE1 A;  2IX1 A;  1S5C D;  1GHJ A;  3A8I E;  1JOK A;  3ONA B;  4H44 C;  3Q23 A;  5C0X H;  5J1Z A;  5BN5 A;  2QDB A;  5JEA G;  2E2H B;  2L11 A;  1DD2 A;  5J22 A;  5D14 A;  3S1N B;  4ZAI A;  1F2L A;  1HTL D;  1QIL A;  3C2P A;  3GTL B;  1GUN A;  3I91 A;  1RKN A;  2RA4 A;  5BN3 A;  3S1Q B;  3TSS A;  2FHT A;  5KGU A;  1LLR D;  1I3Q B;  3GV6 A;  5C3W A;  2K32 A;  4QIW B;  3GTQ B;  2ZXO A;  1B3A A;  4KJO A;  4C1N I;  5M3M B;  1SYB A;  3MEH A;  5E4W C;  3RUZ A;  3VR2 A;  2VNU D;  2A69 D;  2NTS A;  2R61 A;  5IIF A;  3P20 A;  3P1H A;  2WV6 D;  4ID6 A;  3K5M A;  1EOT A;  5E4X A;  2NVY B;  1TS5 A;  2EY2 A;  3M3Y B;  2JEB I;  1M4V A;  3A8K E;  1HFG A;  1ZYR D;  2XSC A;  2LFN A;  1QNK A;  3IKJ A;  4YIJ A;  2KEC A;  3KK7 A;  3BDC A;  2F0G A;  2QIL A;  2F0E A;  2F0J A;  5IOD A;  1OXT A;  2CVR A;  2EDG A;  1E2Z A;  3D4D A;  4M1U B;  2RDF A;  2EJF C;  2RSO A;  3SK4 A;  2KA7 A;  1ONL A;  1ET6 A;  1S5F D;  4M8A A;  3BZD B;  2EJG C;  3N52 A;  2TSS A;  1EQT A;  2NYZ D;  1PRT B;  5JPN C;  3SK6 A;  3H91 A;  3W3A A;  3O13 A;  1YNJ D;  5I6W A;  1LO5 D;  2LY7 A;  4S3S A;  2KJX A;  5CBA E;  5IGC A;  2B2T A;  5K36 H;  1JOR A;  4TRD A;  2NN6 H;  3SXH A;  3A56 A;  4HMI A;  1Z7T A;  1QNU A;  2H4O A;  5CMD A;  3PIP 3;  1JWU D;  2QKI C;  4FXG C;  4IUR A;  1LT6 D;  2SEB D;  1F9P A;  1S5B D;  5C4J B;  2A6E C;  2XRS D;  4ZRZ A;  2NUC A;  1A15 A;  5EBD A;  2YYZ A;  2AWN A;  2WII B;  5IT9 E;  5ELC A;  2F03 A;  4R8N A;  4A3F B;  2B2V A;  1BQQ T;  2Y0S B;  5KEE A;  1TY2 A;  1SYG A;  1LTA D;  1STN A;  1M8A A;  1Q1B A;  3FEW X;  1SYE A;  4K6L A;  3I4N B;  1X32 A;  1SJE D;  3J7A V;  4KKT A;  4FF4 A;  4RGO S;  4DXF A;  1HXY D;  1RDP D;  1IW7 D;  5JEA J;  1D5M C;  4F8M A;  4ME5 A;  3HZX A;  1WTW A;  4U68 A;  1DOL A;  3X3N A;  3D4R A;  3H94 A;  5D3D A;  3Q22 A;  4J1M A;  3UI2 A;  5I6Y A;  1XYI A;  1SDF A;  4C3H B;  3OWE B;  4DGZ A;  1BXT A;  1EY9 A;  5I2X A;  3MAQ A;  3GTO B;  5ELD A;  3MHB A;  4ABN A;  1SYF A;  2RBM A;  4IUV A;  3DEP A;  3HKZ B;  1SNM A;  1LTS D;  4G7Z C;  5C4H A;  1SEB D;  5EKL A;  5F2D A;  4RGT A;  1SMY D;  3HS0 C;  2RKS A;  3L9A X;  5IGE A;  5E1F A;  1SE2 A;  2EYF A;  1DZ1 A;  4LAA A;  4KK7 A;  4AYB B;  1WTQ A;  5CV7 A;  1I4P A;  4XTC S;  1GUG A;  2WAC A;  1BCP D;  4HSP A;  1LTT D;  3NP8 A;  3C1E A;  3HOU B;  4A3I B;  5FOB B;  1GXD C;  2B2U C;  5CV4 A;  1QCB D;  1STY A;  1LTR D;  2HCC A;  3AMU A;  2O5J C;  4A3E B;  3PUW A;  2DNC A;  1V1P B;  3SEB A;  3SK8 A;  2X69 A;  4KV6 A;  1IYV A;  1STH A;  4DK1 A;  4CHT B;  4HN7 A;  3K57 A;  5ELB A;  5IGF A;  1PRT F;  1V43 A;  3I90 A;  5C0X I;  2EXZ A;  4RHR A;  1GOZ A;  2K01 A;  2FFK B;  3SHL A;  3VYS A;  1SNP A;  1Q3L A;  4RHS A;  2F0D A;  2IT1 A;  1I4R A;  1XTC D;  2RQX A;  4KKU A;  3MXU A;  1UAP A;  4FO2 A;  1I4G A;  1U9R A;  4RGN A;  2XRQ D;  5C0X G;  2K28 A;  1FYC A;  4K14 A;  1PDQ A;  5BN4 A;  2PCF B;  2X6L A;  4DN4 M;  2AUK A;  4B9X A;  3DWQ A;  1UUP A;  4XT3 B;  2F1M A;  2IWH A;  3WOF A;  3X3M A;  2K6A A;  1AP0 A;  1TWF B;  1TY0 A;  5KND A;  1RD9 D;  3CRK C;  3OMG A;  3NK9 A;  4DAV A;  3IFD A;  2ZXP A;  2F0M A;  4IUU A;  2VXW A;  3J81 L;  4CBV A;  3DM1 A;  4E6I A;  1W6K A;  1FD7 D;  1LTG D;  1FNW A;  2R93 B;  4RWS C;  1ROD A;  3J80 L;  5KYL A;  1DOK A;  1J9O A;  2ICI A;  1JC7 A;  5A2Q L;  3F2U A;  3RD4 A;  1CFM A;  5KYI A;  2ZT9 C;  2G9H D;  2KVM A;  3NTH A;  2IX3 A;  4K6D A;  2XWJ B;  1MSG A;  4LK1 C;  1NUC A;  1ZXT A;  2JA5 B;  1PFB A;  1VCI A;  1I6H B;  1J8I A;  2K5D A;  4C3J B;  2AUJ D;  1GUS A;  2QF7 A;  1IL8 A;  1QOH A;  1LT5 D;  4IFD J;  2MHV A;  1FR3 A;  3V96 A;  4OO1 H;  3TZD A;  3BDO A;  2JSO A;  4BWG B;  1R4P B;  2MPM A;  3SDZ A;  5FO8 B;  4A3G B;  2HQE A;  3FDT A;  1CQV A;  4A3M B;  4IFD H;  5FO7 B;  2NVX B;  1YNN C;  2NVT B;  3KLR A;  5EGT A;  3E0J A;  1HA5 A;  3DHQ A;  5CR3 A;  4BY7 B;  1S5D D;  4RFB A;  4N9T A;  4BS9 A;  1HA6 A;  1I4Q A;  2EPB A;  5K36 G;  2I46 A;  1B1Z A;  2NN6 G;  5ELF A;  3C3L A;  4C56 C;  3DUZ A;  3MXG A;  1H9S A;  4ODG A;  4A3J B;  1EY5 A;  5CBE E;  2WB1 B;  4KY7 A;  1K83 B;  3S1R B;  1F2Z A;  3PO3 B;  4UDU C;  3NQT A;  1X3Q A;  3GV3 A;  1B50 A;  2EOT A;  2H1E A;  4IUT A;  1OXX K;  4CJ0 B;  3GTK B;  2F0V A;  5EBC A;  2NVQ B;  3M4Y A;  1F9Q A;  3HOW B;  1V1O A;  3JAM L;  5CYU A;  1F9S A;  3R8B A;  4J8Q A;  4QCL A;  1EYC A;  4C3I B;  4XDX A;  3S14 B;  2BA1 A;  3DMU A;  5EPK A;  1R9T B;  2A68 C;  4RAU C;  2CQA A;  3A7L A;  4BBR B;  4PNY A;  3R3O A;  3TDQ A;  4CJ2 C;  3GTG B;  2F0I A;  1CQF A;  3CHB D;  3ND9 A;  1DXM A;  4FF1 A;  4BBS B;  2MJ8 A;  3RMH A;  3OSO A;  5COY A;  1KDB A;  3SK5 A;  4PMC A;  4F7X A;  2DN8 A;  1HQR D;  1CTM A;  5NUC A;  4DNR B;  2VB2 X;  2IW3 A;  1FNV A;  1TR5 A;  3KF8 A;  3HRZ C;  2Z8L A;  1Y1W B;  4XYQ A;  4Q0F A;  5C3X A;  3PIO 3;  3GO5 A;  3PO2 B;  2J0T D;  1EY0 A;  1LTB D;  4K5X A;  1STG A;  1EY6 A;  1CK1 A;  2TMP A;  1CM9 A;  1F9R A;  3ITP A;  2E2I B;  3IAY A;  1JCK B;  4FF3 A;  1TT2 A;  2JA8 B;  1TWA B;  4DAP A;  1A3V A;  1A3T A;  2KEE A;  4ZK9 B;  3H0G B;  2A6H D;  2L12 A;  2EYH A;  4EQP A;  1ESR A;  3U9O A;  2C9O A;  2M9V A;  3NUC A;  4G4K A;  2F0U A;  4FXK C;  3NHH A;  4DA2 A;  2PMZ B;  5T1G A;  3V05 A;  1D5X C;  4KN4 C;  1JR0 D;  2F0L A;  2B2Y C;  2LKV A;  2B2U A;  1UEA B;  4F88 A;  1STB A;  1A2T A;  4HCE A;  2R3Z A;  3I73 A;  2CW0 C;  1TS3 A;  2ZXR A;  1HCZ A;  2BE5 D;  2B39 A;  2K04 A;  1EY4 A;  1F2Y A;  3D6W A;  3TP6 A;  3QG1 A;  3CRL C;  1MBY A;  3I3C A;  3TME A;  2VB3 X;  3J81 E;  4F87 A;  2V4D A;  2MGS A;  1T5X D;  5FLX L;  3CQZ B;  4I65 A;  3OMC A;  4C2M B;  2NTT A;  3WDN A;  2F3W A;  3J80 E;  5C3E B;  4OGQ C;  1I4H A;  5A2Q E;  1SYC A;  4RKL A;  1NAP A;  1PTO B;  5KIX A;  2KQ3 A;  1SXT A;  1CHQ D;  3D31 A;  4FP5 D;  2F0O A;  1OO9 B;  1PRT C;  3PV0 A;  2EYJ A;  1SBB B;  1G91 A;  3D6C A;  1CZG A;  3W2D A;  5IGG A;  3D8G A;  2OT2 A;  4CGY B;  1Q90 A;  1D1I A;  1KNA A;  4A3D B;  5FKA C;  1EIH A;  2B63 B;  4OO1 I;  1NR4 A;  2VUM B;  1W6J A;  1K8O A;  2WKC A;  1LAB A;  3DWP A;  5C5M A;  2CHB D;  4G57 A;  4O1N A;  5CV5 A;  4IUN A;  2PYK A;  2E2J B;  4IFD I;  5I4D A;  1ESF A;  1HHV A;  2D9U A;  2J4X A;  3NSW A;  1KLU D;  4OO1 G;  1F2M A;  2R6G A;  3PUV A;  1Q1E A;  1EEF D;  1PTO C;  2WAQ B;  4O42 A;  1GUT A;  4IFD G;  5DAU A;  1C4Q A;  4KJN A;  3H3V C;  2LS0 1;  2JA6 B;  1ILP A;  1MI2 A;  1H9J A;  4P2C B;  4XQQ A;  5JJZ A;  3Q24 A;  1RTN A;  1DOM A;  3KBX A;  1ZEQ X;  3KLS X;  3CU7 A;  2F0H A;  4FYD A;  5ISR A;  2XIW A;  2PZT A;  4K8I A;  3BVG A;  1A6X A;  3EVQ A;  3MFY A;  3OIQ A;  3QJY A;  1CA5 A;  4DNT B;  4EQN A;  1QWY A;  5C5L A;  1QE6 A;  2PW7 A;  5LL6 S;  3OPO A;  1U4M A;  4KMU C;  1X3P A;  1SJH D;  1SNQ A;  2L0C A;  3D3R A;  2NB0 A;  3JAM E;  1EZ6 A;  5G3L D;  3RZO B;  2I07 B;  3RZD B;  2A6E D;  3MXN A;  4X3S A;  1U4P A;  3NWS A;  3IFT A;  2PZU A;  2OEO A;  5IOC A;  2L4N A;  1ENA A;  5JVG 3;  3C46 A;  4RGM A;  2K5Q A;  4WOR A;  2B2W A;  1E2W A;  2X6G A;  1PZJ D;  2B2T C;  1EZ8 A;  5IGD A;  1Y69 U;  1EY8 A;  4XQN A;  2QCP X;  3K58 A;  1B2T A;  2EYM A;  1RF2 D;  3H6M A;  3QWN A;  1KDA A;  1EQV A;  5CC4 A;  3EQL C;  5FK9 C;  1I50 B;  5ELE A;  2MUY A;  3QOJ A;  4Q5V A;  4EVO A;  1BUV T;  3DXJ C;  3P7J A;  1WTP A;  3QOL A;  2N55 A;  1PZK D;  1TWH B;  2ID0 A;  1H9K A;  4FVM A;  3T56 B;  1XXG A;  3E5S A;  2A74 C;  1PTO F;  3BYY B;  5KRU A;  5FO9 B;  1RTO A;  5I9P A;  1KLG D;  1WTO A;  1KNE A;  3T16 A;  2GA4 B;  2A73 B;  1EL0 A;  1JOO A;  4RCN A;  3NPP A;  4V19 0;  5M5Y B;  3BVZ A;  2F0T A;  4NDX A;  2HUG A;  4Y7N B;  1WCM B;  3PUX A;  5KNB A;  2BDN A;  4A3K B;  3KBG A;  1EFI D;  3ZYY X;  4QF4 A;  1HUM A;  3URY A;  1B9M A;  2R92 B;  3HGB A;  5C4X B;  1Q12 A;  2EZV A;  5AFW A;  4NP5 A;  4X3T A;  3A55 A;  5IT9 L;  1SNO A;  1EY7 A;  1NR2 A;  4CJ1 B;  4CKE A;  2E74 C;  2SDF A;  3NWT A;  3TP5 A;  2KCC A;  2K1B A;  5DM6 3;  1JWM D;  1TKW B;  2JA7 B;  3L7Z C;  1WD0 A;  1JIC A;  2Z4I A;  4OHJ A;  3QB3 A;  5JPM C;  2A5H A;  3PMF A;  3VR5 A;  3S17 B;  1TU2 B;  3VYU A;  1TII D;  1O7L A;  1SFO B;  3TBI B;  2NN6 I;  1BNZ A;  3GD7 A;  2Z1C A;  1GJX A;  2NBF A;  4ZYS A;  2L55 A;  3SE0 A;  1BF4 A;  3M85 A;  2EY1 A;  4KD3 A;  2F0N A;  4KTA A;  4ZUI A;  3S2D B;  5CV6 A;  4PV1 C;  2D5D A;  2C5C A;  1LT3 D;  5LHY 1;  4KHZ A;  5D3I B;  1L0X B;  2A69 C;  2EJM A;  1WTV A;  5FLX E;  3H09 A;  1XWE A;  2RDG A;  2E2D C;  1WVL A;  2JYO A;  1BR9 A;  1MSH A;  4ILW A;  4R8I A;  2XN9 C;  3K7A B;  1QJO A;  1Q8I A;  1ZYR C;  4HCS A;  1PZI D;  3HOX B;  3CKI B;  3FVQ A;  2EVB A;  1L0Y B;  3MFG A;  4KI0 A;  4XQJ A;  1G2T A;  1IYU A;  3K5L A;  5JVH 3;  1SNC A;  3EA6 A;  1WD1 A;  1C8C A;  1AN8 A;  1O78 A;  1EIG A;  3K5O A;  4RCO A;  2OF1 A;  3BVM A;  5JOB A;  4C3I G;  1F77 A;  3MVV A;  1PMR A;  1G6Z A;  2JP1 A;  3HEJ A;  2F0P A;  1VF5 C;  1G2S A;  2B8G A;  3ERQ A;  1Y8O B;  3N6R A;  1Y8P B;  4K2L A;  1YNJ C;  3NTI A;  3Q0A A;  2F0S A;  1GHK A;  2BDO A;  1D1K A;  1MD2 D;  2K33 A;  1PYW D;  3PUZ A;  3HOY B;  3FMC A;  4DAY A;  1BO0 A;  3GTJ B;  1ENC A;  3LWU A;  4FF2 A;  5T1I A;  3Q6S A;  4CKC A;  1Y8N B;  3DEO A;  3MWY W;  1WTX A;  3MXP A;  2FMM A;  5CV8 A;  2KHS A;  3M7G A;  1AZP A;  3ERO A;  2F0W A;  3S1M B;  1TWC B;  2EYO A;  1DJR D;  4KY6 A;  2Q8R E;  3V2T A;  3NQI A;  3OW7 A;  3RLF A;  2SNM A;  5DEH A;  4H13 C;  4BA1 I;  1YNN D;  1CI3 M;  2RSN A;  2IX0 A;  5KNC A;  4BY1 B;  4G7H C;  3VYT A;  1HQM C;  2D62 A;  3TP7 A;  4DF7 A;  1IW7 C;  1H9S B;  4V0B A;  4L63 B;  2BA0 A;  1JE4 A;  3SR1 A;  1SND A;  1Y1V B;  5JAV A;  2G9D A;  1DON A;  2K5W A;  1E0B A;  5EPL A;  1UNS A;  1BCP B;  1D2B A;  3PUY A;  4HAE A;  1II3 A;  4ZLT F;  3KUP A;  2SNS A;  1E2V A;  2J7Z A;  4KD4 A;  4XXE A;  1TWG B;  4A3B B;  3TZU A;  1Z6H A;  2Q8I B;  3BYT B;  3T4A C;  4A93 B;  1SSO A;  4HTH A;  1DM0 B;  1IKL A;  5COR A;  1B53 A;  4NW2 A;  1SMY C;  3OHX C;  5C6A A;  2WKD A;  3NTK A;  4OL7 A;  3T13 A;  2BCO A;  3T51 B;  2HCI A;  1STA A;  4IAL A;  1SE3 A;  3MC0 B;  1STE A;  4KY5 A;  1ICW A;  3LNN A;  1KAB A;  4OIJ A;  4X3K A;  1Z47 A;  4L8J A;  1O80 A;  1TS4 A;  5EKI A;  1A2U A;  1JOQ A;  3VR6 A;  2F0F A;  4IUP A;  2M2L A;  1D6E C;  1BCP C;  4LJZ C;  1LT4 D;  5K5P A;  2PZW A;  1D5Z C;  2AWO A;  4HED A;  2A68 D;  4IN3 A;  3E6Z X;  3HOV B;  3FKI B;  5D65 A;  5CGK A;  4ZQ3 A;  1A3U A;  4N9P A;  1DYQ A;  1CZW A;  1IHZ A;  4WRD A;  1LAC A;  4IZ8 A;  2JXM B;  1ILQ A;  2PPB C;  1R4Q B;  2WIN B;  2PO4 A;  4H0L C;  4X3U A;  3OOC A;  1IKM A;  1QG7 A;  2AQ2 B;  4OIK A;  1V1P A;  3S15 B;  1SE4 A;  1AFP A;  2EYL A;  3HP3 A;  1BBX C;  3NBH A;  5DM7 3;  4EGV A;  4B9W A;  5EQ0 A;  1WTR A;  3OWF A;  4NKL A;  4MN3 A;  3EJI A;  1VMC A;  1BDO A;  4C3H G;  3G7L A;  3I70 A;  4HSV A;  3K0Y A;  3BDL A;  1V8Q A;  1U4R A;  1RHP A;  4B08 A;  4PMB A;  4RKB A;  3FPP A;  3G6J B;  1NCV A;  1HPC A;  5JEA H;  1VDZ A;  2LMC B;  4R9W A;  4PQX A;  1NSN S;  2XWB B;  1I4X A;  5CV9 A;  5C44 B;  4J6H A;  3M7N A;  3HG9 A;  2RDH A;  2WP8 J;  3NE5 B;  4K2K A;  1G29 1;  3DWA A;  4XIG S;  3GTM B;  3BG3 A;  4HMJ A;  1QB5 D;  3NBI A;  2KED A;  3QO2 A;  4XT1 B;  2ICE C;  1BOS A;  1U4L A;  1BCP F;  1XX8 A;  4XYO A;  2CW0 D;  5IGB A;  3GQB A;  4GZY C;  2NWG A;  2IJ0 A;  3S9W A;  3L3O C;  2QEJ C;  3MZ5 A;  1FNU A;  4DU9 A;  2O4X A;  2F0K A;  3C1F A;  1EWH A;  1CA6 A;  4DFA A;  4KN7 C;  5G3L F;  3SVM A;  3S2H B;  1ET9 A;  2KOL A;  2K05 A;  4C1N K;  1B9N A;  1S5E D;  1TS2 A;  3I4L A;  5HGT A;  3FRP B;  3VA7 A;  2EY5 A;  3I4M B;  4PMW A;  1H9M A;  1GUW A;  1LTI D;  2HDM A;  1HFN A;  1PFM A;  2F3V A;  3VA5 A;  5EJW A;  1AW7 A;  1PRT D;  4TSS A;  4K5V A;  5M9O A;  3GP7 A;  3LX0 A;  4QUC A;  1S4Z A;  4IUQ A;  2XNA C;  2MP1 A;  1RCV D;  4QB4 A;  4BA2 I;  1JB3 A;  4RA8 A;  1VF7 A;  2FMC A;  2B2V C;  1OXV A;  2F0Q A;  3D4W A;  3R2T A;  2KCN A;  2O2L D;  3J7A F;  2L5T A;  1SYD A;  5LL6 X;  1EYA A;  1PTO H;  3K5N A;  1KTK A;  4K8J A;  4QMG A;  3A54 A;  1OXU A;  2NZ1 D;  2XVS A;  4IQZ A;  4L6T B;  2DY7 A;  2KUM A;  4TKO B;  3EFX D;  2AQ3 B;  5M5W B;  4DXG A;  1HTP A;  1TQO A;  1JQY D;  1PTO D;  3LWE A;  2L1B A;  4TQU S;  2Z4H A;  3BS1 A;  2L9H A;  3AB9 A;  2YU9 B;  3M4O B;  2R7Z B;  1C48 A;  2IPK D;  4C3J G;  3U9S A;  4U67 3;  4LMQ D;  1KAA A;  1VMP A;  4UAI A;  4KHV A;  3A7A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...