5CV5A

Crystal structure of staphylococcal nuclease variant delta+phs k64g/v66k/e67g at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKGMKGNAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS K64G/V66K/E67G at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv5A00
1KAAA 2NUCA 1EQVA 5CR3A 2F0HA 2RDFA 1JOOA 3NK9A 4NDXA 5CV5A 5CV8A 4KTAA 1SNMA 3NXWA 2EYHA 3TP6A 2EY1A 3OSOA 4B9WA 1EY0A 3SK8A 1A3TA 2F0VA 2OF1A 2LKVA 3TMEA 3TP5A 4PMCA 4DU9A 1A3VA 4KD4A 5C6AA 1EYAA 2EXZA 5CC4A 3P1HA 3C1EA 4EQPA 4K2KA 2PZUA 2RBMA 2F0TA 2KHSA 2OXPA 3LX0A 4ZQ3A 1A3UA 1TQOA 2F0KA 5KRUA 4HMJA 1ENAA 4ME5A 5DEHA 4KJNA 4NKLA 2F0DA 2SOBA 2F0SA 4N9PA 3T16A 5K5PA 5ISRA 2PQEA 1F2MA 3RUZA 1SYFA 3MXPA 4NP5A 3V2TA 2EYMA 4EQOA 5HURA 3BDLA 5I9OA 1EYDA 1KDAA 1SNQA 5C4ZA 5JAVA 1EZ6A 3SR1A 2RKSA 1U9RA 3OMGA 2F0UA 4KD3A 3MZ5A 3BDCA 2F0QA 2F0MA 4YIJA 1RKNA 4KY7A 5C4HA 5KYLA 2PYKA 5E3FA 5CV4A 2F3VA 2SNSA 4ZUIA 2F3WA 3D4DA 2PZWA 1ENCA 1SNPA 2O4XA 2SNMA 3MVVA 4G57A 4KY6A 4OL7A 1AEXA 3D4WA 3D6CA 3R3OA 4DGZA 3DMUA 3NP8A 4K5XA 4EVOA 5IIFA 2EY6A 1STBA 1EYCA 3EROA 4K8IA 2F0WA 4IZ8A 1STNA 1II3A 4F7XA 5IGBA 1EZ8A 3TP7A 5KGUA 4IALA 1JORA 5KEEA 4EQNA 4J1MA 3H6MA 3S9WA 2F0OA 4R8NA 5EKKA 4K5WA 2F0LA 4DFAA 1NSNS 5IGFA 3TP8A 5J1ZA 5KYIA 2EY2A 3OMCA 3NQTA 2F0EA 4K8JA 4WORA 5EGTA 2EYLA 3SXHA 1SYEA 2F0NA 1F2YA 4QF4A 3E5SA 3D8GA 4KY5A 3MEHA 5IGCA 3SK6A 2EYFA 5KIXA 3NUCA 3QB3A 2EYJA 4RKLA 1SNCA 4ZUJA 1TR5A 5J22A 1EY4A 3EJIA 4MIUA 5DAUA 4F8MA 4HMIA 3VA5A 3C1FA 1SNDA 1EY6A 2WACA 5C3WA 3SK4A 5C3XA 5HGTA 2EYOA 3EVQA 3QOJA 4WRDA 5C5MA 3DHQA 4NMZA 1SYCA 1SNOA 1F2ZA 4QMGA 5IGGA 5NUCA 1EY8A 3ITPA 4LAAA 4K2LA 3NHHA 2F0IA 4IUNA 5EKLA 1A2TA 3PMFA 1STGA 4K6DA 5IOCA 1SYBA 4S3SA 5I6WA 2OEOA 4KHVA 5CV6A 2EY5A 1TT2A 2F0JA 2F0GA 2QDBA 3MHBA 1EY5A 4HTHA 5C5LA 5CGKA 3HZXA 5E1FA 5F2DA 4DF7A 4K14A 1NUCA 1STYA 4K5VA 4RKBA 1KABA 2KQ3A 4H7BA 4KV6A 1SYDA 2F0PA 4PNYA 5CV7A 4TRDA 1EY7A 4I65A 1STHA 2PW7A 2PW5A 1IHZA 1KDBA 3P75A 4B9XA 1STAA 4E6IA 5IGDA 5I9PA 5IGEA 4PMBA 3U9OA 3ERQA 1JOKA 5IODA 3T13A 2EYPA 3OWFA 4QB4A 3HEJA 5M9OA 1SYGA 2HQEA 1EY9A 4ID6A 4J6HA 1A2UA 5J39A 2M00A 5CV9A 4KJOA 1JOQA 2F0FA 5JOBA 3SK5A 3QOLA 1KDCA 3SHLA 4N9TA 4ODGA 2ENBA 2PZTA 5I6YA
chains in the Genus database with same CATH superfamily
1I4RA 5KNCA 1TS3A 4G4KA 2DY7A 4IJHA 1C4QA 5TSSA 5IYBG 4HN7A 3BVZA 2A6HD 4QIWE 3SDZA 2E2IB 4BY1H 2F1MA 1Y1VB 2O2LD 5D14A 4C2MB 1VQJA 2XRQD 2MQHA 3C1EA 4K2KA 4YCVA 3URYA 3K7AB 3GTOH 1DXMA 1V1QA 2F0KA 4X62Q 2JA6H 1X9NA 3I4MH 2F0DA 3JAML 2PQEA 1ML0D 4EQOA 4RH6A 3MAQA 1HQMC 3F8TA 1XPRA 1ET6A 1LTGD 4DV6L 1NTGA 3PF5A 1HR0Q 4L5RC 3IKJA 3GTKB 1S5DD 4BY1G 4NB3A 2A69D 2VS1A 4CDCC 1NJIC 5ELBA 2R7ZH 1SDFA 4BBRB 2LY7A 1LLRD 2JA6G 3RD4A 3I4MG 4IQZA 1E1OA 4K8IA 1PH8A 3J7AV 1PFBA 2G9DA 3L7ZC 3C46A 2ZM6L 1EU4A 2WKCA 2MGSA 3K0XA 4WORA 3RR5A 1XPOA 3DEPA 5KIXA 2A68D 1SR3A 1Z7TA 2R7ZG 1DM0B 4ZKCB 1SNDA 1SE3A 3QIAA 2MO1A 3KJOA 3PUXA 1LT5D 4WJ4A 3A7LA 3Q0AA 2AMCB 5C5MA 4QMGA 1SYCA 1YNJC 3DEOA 1CT1D 3UI2A 4L5SA 1SXTA 1PZKD 4CKBA 1J5EL 1GUNA 4CDEC 4LF5Q 1K3RA 2ICEC 3J81j 2R7DA 1PFMA 1RDPD 5C0XH 2Q2HA 5C5LA 2DN8A 5CGKA 4DF7A 3CHBD 2M9VA 3KJPA 4K5VA 1K8OA 1HFGA 3K81C 4OX9L 1O78A 3G48A 3A5ZB 3S1RH 3KOJA 1I94L 1TWHB 2ID0A 5IWAQ 5JPNC 3K5LA 1QNUA 2Q8RE 1Q81C 4A3FH 1N34L 3SK5A 2HUGA 3S1NB 1WD1A 4DK6C 1F9PA 2ENBA 3PCOB 4AYBG 3KBGA 5C0XG 3HOWB 1BKBA 5CR3A 1X55A 5M3FB 2B2UC 5EBCA 2BOSA 2JP1A 2EY1A 1SFOB 1FJGL 4GNXC 1BXTA 5IT9c 4U68A 1QOHA 1UE5A 3A55A 3DWAA 4V190 3CD6A 2I5HA 4XYOA 3TREA 3GV3A 5M5WH 4A3FG 1EQRA 1H9MA 3PIP3 5GQOA 3VDYA 3T16A 1KTKA 3DWPA 3PO3H 4IO9A 5EPKA 1WTVA 4PG3A 3NEMA 3T53B 4KMUC 4HEDA 3OPOA 4OONA 1Y1WH 4A3CH 2P5ZX 3RLNA 4A3GB 2E5LQ 2HCCA 3I4NH 3KUPA 4HCEA 2JA5H 2YU9H 4UP8A 3B6YA 3FMCA 3GO5A 3R3OA 2Z8LA 1Q8KA 3J80L 2CVRA 2G5DA 4DNIA 2F03A 3PO3G 4IALA 1ASYA 1EIHA 3CCRA 2LSSA 4R8NA 1SMYC 3VYTA 1GUTA 1V9PA 2KEDA 3VYSA 1Y1WG 3K0YA 4A3CG 4XDXA 1SYEA 1F2YA 4L5TA 2Q2TA 1SMXA 2UXDL 1CZGA 1RTOA 4ZUJA 2JA5G 3K5OA 3A56A 1TWGB 3OYYA 2SEBD 5CORA 5ELCA 5FLXE 1VQCA 3NBIA 4AQYQ 1I50H 4KLKA 2R7FA 2PQAB 4Q5VA 4MTNA 1GHKA 4O2DA 1J8IA 2WB1G 2L12A 1NCVA 3T1YQ 1PH5A 1GKHA 4IN3A 4L8JA 2BE5D 4RGOS 3GP7A 4FYDA 2KHJA 2KVMA 1CM9A 4IUUA 4FXGC 4B08A 1JICA 1QILA 1EUJA 4JI8L 1Z6HA 3MXGA 4JI0L 2OTLA 1SE4A 3VYRA 4JOIA 2FINB 3H3VI 4X65L 1H9SA 3KF6A 2L4NA 4RCOA 1CA6A 1S4ZA 2QEXA 1F9QA 2RCFA 3GTOB 1TWCH 3HRZC 1I4XA 1PTOB 1OXTA 3NWTA 4RGMA 1HNXQ 3U58A 3NBHB 3I4MB 1RTNA 4RHRA 2VB3X 1LTBD 1XMOL 3V05A 1Q3LA 1I4PA 2IPKD 5LMNW 1F9RA 1FL0A 1CI3M 1SE8A 2WV6D 1GUOA 4AH6A 2K32A 1CKOA 4DU9A 3CQZH 3HKSA 1QZHA 1JWSD 3NQIA 2JEAI 2CQAA 3HOVB 2RVLA 1KRTA 3U9SA 4PV1C 4GOPB 3HOXH 2HIXA 2R7ZB 1L1OB 1PXUA 3ND8A 1RCVD 3RUZA 1HA6A 1J9OA 3D3RA 4LFAL 4NXNL 2KOLA 3SR1A 4JG2A 3K5NA 4ALPA 4LF9Q 3S1QH 2VUMH 4DV0L 1IYVA 1GXDC 1JJGA 4UHVA 3NPPA 4MN3A 4L63B 4IJLA 3OTOL 1CK1A 3D4WA 3HOXG 4BA1I 4XTCS 2E2HH 3KK7A 3FPPA 1VQ8A 4A3BH 2RSNA 3AEVA 3S9WA 1JE4A 2J7ZA 1CHQD 2CH4W 3G7LA 1VS0A 2BCOA 3K59A 5J1ZA 2EY2A 3OMCA 4DR4L 4UDUC 3M7NA 2VUMG 3U50C 1XJVA 3D8GA 1ESRA 4DV5Q 4AYBB 2QILA 3VR3A 3KLSA 4KHPQ 4WFN3 2K01A 4TQUS 3J7AF 1V1PA 1E7ZA 1PYSB 2HDLA 2JSOA 3CCSA 4A3BG 4DAYB 4ILWA 3S1RB 5H1SE 2AUJD 3F2DA 5EKLA 3I8ZA 4P2CB 1UEAB 4A3EH 1HCZA 2DJFC 4JVZA 4HSPA 4A3FB 4X6AH 4DV1L 4X3KA 1A62A 4UP9A 1CTMA 1NMGA 4RKBA 4PNYA 2F0PA 1TU2B 2QEJC 2J0TD 1D7QA 4QCLA 4X64L 3ERQA 3JAMi 3HFZB 4LUOA 4GLXA 5D3IB 1YJWA 1TWAB 3RN2A 1YVCA 4JBMA 2YTXA 4N8X1 4KJOA 4A3EG 4JI3L 3QOLA 3SHLA 1QVGA 1L2FA 1YNJD 3S24A 2JEBI 3DUZA 5M5WB 5I6YA 1VQ5A 1RIPA 1CSQA 3PO3B 1AN8A 2EYHA 4LK1C 5IY0A 1AP0A 2GA4B 4DV6Q 5GAGC 3MC0B 2VQFQ 1G2TA 1Y1WB 1OXSC 3CPFA 1VQKA 2F0TA 1PH1A 5T1IA 1VMPA 1D1KA 2YU9B 4KJNA 1LABA 2IX0A 1XMQQ 2Z6BA 2KCNA 1D5MC 5HURA 2HQLA 4QY7A 1KDAA 3NE5B 5K36H 1KNEA 1GM5A 3T1HL 2ZM6Q 1AW7A 4HR7B 1NR4A 2WB1B 4JI5L 4ZUIA 3TZDA 2SNMA 2MUYA 5DLQE 5FK9C 1WTOA 1O7IA 4K5XA 3G71A 1Q12A 1STBA 1BCPF 2OTJA 3KYHC 3TP7A 4HIMA 2B63H 1I50B 1PA6A 3HKZG 1KNAA 5K36G 5KYIA 4V0BA 4JOIC 1J5EQ 1D8LA 2F0NA 4QL5A 3I7FA 4P73A 2JXMB 3N6RA 2K14A 4RKLA 1H95A 3D4RA 3MWYW 1EY6A 4B3RQ 2DJGC 2WINB 5JVG3 3EN2A 3CCEA 2HHHL 1N33L 4DV3L 2B63G 1I94Q 2I0QA 3CC2A 3NTIA 1SYBA 4S3SA 3GQBA 3CMEA 3GTPH 1BR9A 1B1ZA 4DAPA 4FF3A 2F0GA 3MHBA 2A5HA 3BYTB 3HZXA 1VMCA 1TWCB 1FVIA 1SMYD 4ZYSA 3MXNB 1PLFA 4BBRH 1RD9D 2VB2X 1IBLL 2EYPA 2TSSA 3OOCA 2HQEA 2CH4A 2L15A 1K0SA 3CCMA 3UDIA 1UEBA 3CQZB 2IW3A 1VQOA 5I2YA 2MPMA 4RAUC 2N3SA 2Z6KC 3ICEA 3HOXB 3CAMA 4CBVA 4R4IA 3TBIB 2NN6H 1SJHD 1FNWA 2F0HA 1YZ6A 3BG3A 4NW2A 1I3QH 1I4GA 2EJFC 4BBRG 3T51B 1NNXA 3SK8A 4FNFA 3J80i 2LKVA 2JQOA 4M8AA 4KN7C 3S1QB 3S2DH 1WFQA 4OO1I 2AUKA 1EOTA 5A2QL 3J7ZC 1TQOA 4XXEA 4CJ0B 3J81L 2L5TA 3QWNA 5LL6S 1BCPC 4MNOA 4IURA 4N9PA 5K5PA 2KA7A 4IFDI 2R92H 2PMZB 2E76C 5L37A 2E2HB 2NN6G 1AH9A 4A3BB 4DV4L 3JC66 2F0UA 4JI1L 4WJ3M 4C3HH 5C3EH 1LTRD 4B3SL 4BXXH 1E0BA 1NMFA 2UXDQ 3OHXC 4BWGB 5E4XA 2V1CC 2O5IC 2ZTDA 3CRLC 2F0WA 2R92G 4DV7L 4OWWB 1O7YA 1O7ZA 3MEFA 1E2WA 3BVGA 3SE0A 5IYCH 1MGSA 4YCUA 3PUYA 3M4QA 2F0EA 3MFGA 4M1UB 5EGTA 4POFA 4A3EB 4C3HG 5C3EG 1BDOA 4BXXG 2EYJA 5J22A 1KLGD 2GVAA 1EEFD 4Y52H 1VQDA 4H0LC 1JJCB 2IY5B 4EQ5A 2EYOA 4WRDA 2J4XA 1N9WA 2UUCL 5IGGA 1S40A 1TY0A 3D31A 3H3VC 3NHHA 4JI0Q 1BUVT 3DM3A 1KAWA 2ZJPA 5ELNA 4A4IA 5I6WA 5IYCG 4X65Q 4KHVA 5EQ0A 4FF2A 2G9HD 2F0JA 4DAMA 1S5ED 2JA8H 4OXPA 4JW0A 1O80A 1BF4A 1BNZA 1KIXA 5JEAJ 1D5XC 4IOAA 1EY7A 1TS4A 1I5FA 5I9PA 2RDGA 2X69A 1W3SA 1MBYA 3T13A 2MO0A 2UXBL 1FR3A 3HEJA 1EY9A 2AQ1B 2KUMA 2N55A 1TS2A 3X3MA 1HNWL 1D5ZC 1VQBA 3VR6A 1S72A 1PMRA 2MJ8A 4Y7NH 1BBXC 4DXGA 1KAAA 1X3GA 2JA8G 3M9BA 4YIJA 1K8MA 1SE2A 1TWGH 1XXGA 5CV8A 4XQQA 1CQFA 4RHSA 4JI2Q 4X66L 4B9WA 4NXNQ 3HKZB 1FGUA 3PF4A 2H4OA 1EIGA 1WTPA 4DNRB 3M85A 3P20A 4EQPA 4IUPA 1W6JA 1B50A 1JC7A 1KXLA 1IKLA 3FHWA 1WCMH 2D0OA 3GTLH 1MI2A 1QNKA 3AFQA 1ASZA 3STBC 3S16H 5DNFA 4XQNA 2B63B 2B2TC 1EWIA 3CXCA 1VQ4A 2F0MA 4DR4Q 2VY3A 1JQYD 3D4DA 1TS5A 1LYLA 3TDQA 1NAPA 2LMCB 4GKKL 4A93H 1PTOH 3K6OA 4LF6Q 1WCMG 4UY8C 1EZ8A 4EQNA 1C48A 5FLMH 1GOZA 4GNXB 3A74A 3PUWA 2DNCA 3MEHA 3SK6A 1BQQT 4BS9A 3F2UA 2E2JH 4B3TL 3GTPB 3M3YH 4DV1Q 3HOVH 2ZJQA 2K03A 1JMCA 1G6ZA 5LMNL 5E7NA 3L9AX 3L0OA 5EBDA 4A93G 3DHQA 2NVXH 1T5EA 4X64Q 4DR7L 4LAAA 4K2LA 1PFNA 1H9RA 5FLMG 2XWJB 1RODA 1KRSA 1N36L 1TIID 4ULLA 5CV6A 1KQSA 2F52A 1EWCA 1TVXA 4JI3Q 4OEMB 1WTWA 1JJ2A 4CJ1B 3BU2A 1NUCA 1STYA 3V2TA 3HOVG 4DUZL 4G7HC 4I65A 1OTCA 4C1NI 4FXDA 5IGEA 5BR8L 3MXUA 5IT9L 4JI6L 1I3QB 5COYA 1HTLD 3OWFA 2C5CA 1HQRD 2K7VA 1MHWC 2VZAA 3I4OA 1GUWA 2ZT9C 3S2DB 1B4OA 4OWXB 3CU7A 1JOQA 1B9MA 1SBBB 2HCIA 1LT4D 3FRPB 1G6PA 1NY4A 1HPCA 2A6ED 3NK9A 1GUSA 2R92B 5G3LF 3TP6A 1ICWA 4EX5A 4PMCA 4P75A 2FFKB 5C0XI 1EYAA 1DYQA 5CC4A 5FOBB 3UDGA 2YTYA 4C3HB 5C3EB 2K4KA 5AJ3L 2OXPA 4OIJA 4CDFC 1E22A 3I70A 3R2TA 3CMAA 1HA5A 1V8QA 2SOBA 2UUBQ 5ISRA 1ICFB 1N8RC 2C35B 3NTHA 3W1GA 4DR5Q 1CQVA 3EA6A 3A0JA 4KD3A 4ABNA 1PZID 1K8GA 1EU3A 1IBKQ 1JB3A 5E3FA 1CFMA 1TWAH 1ENCA 2MP1A 5I2XA 4FF1A 2VNUD 4DGZA 1HJPA 3AB9A 3OWEB 1PH2A 2NVTH 1STNA 1II3A 4JV5Q 1Q46A 1UE6A 2HHHQ 3HOUH 4KKSA 4DV3Q 1DJRD 3Q24A 4LNQA 1BCPD 3NQTA 1EIFA 1V1OA 4AYBE 2E8GA 2CFMA 3Q23A 1TKWB 2JA8B 3RN5A 1WTRA 1B70B 1C8CA 5C3XA 1LTAD 2FJ2A 3CCUA 1ET9A 1SNOA 2KECA 3PUZA 4FO2A 5NUCA 1IBLQ 1FNVA 4I7ZC 1Y14B 1CSPA 2F0IA 3PMFA 3HOUG 4IUQA 5IP9H 2OEOA 4NXML 2K75A 2WAQG 4K14A 1VQAA 1QVFA 4Y7NB 4H7BA 5C0XJ 3J81i 4IPHA 1STHA 2R3ZA 4CGYB 4GOPA 3U9OA 2NBFA 4QB4A 1BBWA 1X3PA 2WFWA 1B3AA 5IP9G 4G7OC 1BO0A 2Q8TA 5LHY1 4JYAL 1X6OA 2QDLA 1WCMB 2HD3A 2I46A 3ERSX 3GTLB 3I90A 4J15A 3S16B 1OXXK 2K5NA 2XTIA 4DV4Q 1ZYRC 2F0VA 3FPUB 4H13C 1S5BD 3TP5A 3S17H 1YIJA 1JE5A 5ELFA 4B3SQ 3ONAB 4LFBQ 4N8FA 4KN4C 1B53A 4YHHL 3LWEA 2KEEA 1HZBA 1B7YB 4XIGS 4APVA 4A93B 3BS1A 1SAPA 4DV7Q 2K5WA 2RKSA 4JBWA 2WB1E 3H3VH 3GTGH 3LGJA 1RHPA 3U4ZA 4LF7L 1HNZL 1XYIA 3KLWA 1IYJB 1YBYA 2E2JB 5EPJA 1CKNA 2Y0SG 3KDFA 3PSIA 3J80c 3M3YB 4A76A 2F4VL 2NTTA 1KHIA 3EROA 1XNRQ 2E2DC 3Q8DA 4J1MA 4RCNA 2UUCQ 2F0OA 2JYOA 2CWPA 2NVXB 4A3MH 5CYUA 4K8JA 3SXHA 1WTXA 2SDFA 3STBD 4A3IH 1VQEA 3QB3A 5EJWA 3UDFA 1SNCA 2Z4IA 4HJ5A 4BY7H 2IX1A 1PH9A 1QVCA 2Z6KA 3LNNA 3J7A5 3ULLA 4DR1L 4CDDC 1F2ZA 1CA5A 4DPGA 3ITPA 3RZOH 4JCVE 1R9TH 3CPWA 1SLJA 2CW0C 4R4QA 4A3MG 2HT1A 4QJFA 1DCZA 1HNWQ 4IPGA 4A3IG 1PFSA 5CV7A 2IWHA 4LF4Q 4BY7G 3T4AC 4DR2L 3FEWX 4DR3Q 3FDTA 1A8VA 4AIMA 4B9XA 5C4JH 1VDZA 1KL9A 1Z9FA 5IODA 2Z1CA 3OW2A 2HIVA 2LS01 1M90C 3MTSA 1NR2A 4RMFA 2EXDA 1MKHA 3X3NA 1H9SB 2CCZA 3KF6B 3J7YW 1GUGA 2IHFA 3GTMH 1I4HA 1C7YA 5ELEA 2KCTA 5CV5A 4R8IA 1T9HA 4YWKA 4KTAA 3NXWA 1A63A 1L0WA 1N32L 4BBSB 3JAME 4JI7L 2OCEA 3F2BA 1JR0D 4ZCKA 5C6AA 1IL8A 4MTKA 3VYUA 5ELOA 3K7UC 4HMJA 3CCLA 3A8JE 1OXUA 1VCIA 2PMZE 3DXJC 1HR0L 4NKLA 2CKZB 1VQ7A 2F0SA 3RNUA 4B3ML 4GKKQ 5EPLA 5I9OA 1EYGA 2NVTB 1SNQA 5C4ZA 1K0RA 3RMHA 2DY8A 3HOUB 1YNNC 1Q7YC 3FKIB 2K1BA 1HZ9A 2SNSA 3CKIB 3R2IA 5CV4A 4B3TQ 1F2LA 1XWEA 3G6JB 2NVQH 4G57A 4KY6A 3RLOA 2D9UA 3I73A 2PNHA 2WAQB 3VR5A 1YNXA 4EVOA 1JB7A 1WTQA 3A8KE 3H6MA 4GOPC 3NTKA 1JWUD 3WOEA 3TP8A 1B2TA 1B3QA 2Q8IB 2PNRC 3F1ZA 1HUMA 5C4XB 4LUZA 4QF4A 1Z47A 2KENA 4O1NA 1GD7A 4KY5A 3PIO3 1TR5A 4DR6L 1MD2D 3EJIA 1M4VA 4HMIA 4ZKBB 3C1FA 4DK1A 1BCPB 4DUZQ 4JBKA 2NB0A 1IXRA 2B8FA 4HIKA 1IZ6A 1IL2A 1V1PB 3I4LA 1FD7D 1YHAA 2I07B 2MHVA 1BOSA 1STGA 2EOTA 2ZXRA 2A69C 3H91A 4RGNA 2WIIB 4LMQD 2E74C 2NYZD 2CQOA 5IWAL 5IGBA 4H44C 3L3OC 1EL0A 1IHZA 3TSSA 4C3IH 2OT2A 1LT3D 3S14H 1FYCA 1L0XB 4PMWA 4OX9Q 3W2DA 3S17B 2AWOA 1MSHA 5T1GA 1OXVA 2B2TA 1QJOA 5AJ3Q 1PDQA 2D2CC 3E6ZX 2Y0SB 2A68C 1PYWD 5JVH3 1X3FA 2QA4A 5CBEE 3I91A 4OIKA 1GO3E 1YHBA 1N34Q 1QG7A 3HKZE 4F87A 4PZ7A 1CHPD 4C3IG 4KD4A 3DM1A 4PZ6A 3P7JA 4XT1B 5G3LD 1FJGQ 1E24A 1B9NA 3GTGB 3EFXD 3LX0A 2ZXOA 4A3DH 3PUVA 2RHSB 3H0GH 2LFNA 5FJ8H 4TKOB 4HAEA 2L1BA 4ZK9B 4QGUA 2K33A 1KC8C 2H5XA 2A19A 4K0KL 2EPBA 3KF8A 5JAVA 3J80E 1A15A 1RF2D 2TMPA 4A3MB 4OGQC 2F0QA 2PYKA 4RA8A 1C0AA 1VF7A 2NN6I 4A3IB 1E2ZA 4QQBX 1X3EA 4A3DG 3UE1A 4BY7B 3D6CA 1ZYRD 3DMUA 1RL2A 3H0GG 2A73B 5KGUA 5FJ8G 4LW1A 1LACA 2EQSA 3D0FA 3OIPA 4KHZA 2MNAA 2Z0SA 1EQQA 5JEAH 4TSSA 3S15H 3RZOB 1R9TB 4OO1H 3ND9A 1LTLA 4YWLA 5AFWA 2DGYA 3OIQA 1VQ6A 1BBUA 1QUQA 5JJZA 3MFYA 3IFDA 4IFDH 2VW9A 2NZ1D 1U4MA 5HGTA 5HGQA 3QOJA 3RZDH 5C4JB 4LF8L 3EBEA 4HSVA 2R61A 3T1YL 3AFPA 4K6DA 3S2HH 1K3BC 5JEAG 2PO4A 2UUAL 1X54A 2EY5A 3K5MA 4OO1G 3PGZA 5M5XH 1QB5D 1EY5A 5BN4A 1VQPA 5E1FA 1EQTA 5FLXL 2L9HA 3QR8A 3GTMB 3K57A 4IFDG 2PW5A 3P75A 4E6IA 3IRBA 1VF5C 1HR0W 5M9OA 1LTTD 3G6EA 1YEZA 4J6HA 1B44D 2A1AA 3C3LA 4JI8Q 1MJEA 1KDCA 4F88A 1SRUA 2EZVA 4YHHQ 1YJNA 2CW0D 1SNMA 2FHTA 4DV2L 5JPMC 4FXKC 1VQHA 2QF7A 1STEA 1A3TA 1XMOQ 2JA7H 1PYBA 4R4OA 2EXZA 3I55A 1P8LA 3C2PA 1K8AC 1HNZQ 2AQ3B 4ZQ3A 3J81c 2ZXPA 1YITA 5M3MH 1BVSA 1ENAA 2NVQB 1ZKOA 2IT1A 1Y8PB 2F4VQ 4LUVA 1F2MA 2VXWA 1LV9A 5LMUL 3M4OH 4CKCA 2UXCL 1VQIA 1H9JA 4LFAQ 2F3IA 2JA7G 4DA2A 3EQLC 1ESFA 1DOMA 1K9MC 4IUVA 4DV0Q 5CBAE 4ZAIA 1NBWA 1AEXA 2HDMA 4HCSA 5M3MG 4DNTB 2VQEL 2EY6A 3IAYA 4F7XA 2NVYH 5KEEA 3OTOQ 4OHJA 3V96A 4DFAA 5IGFA 1Y69U 2QCPX 4I7AA 2ALYB 4IUTA 1EY4A 2RQXA 4MIUA 4GKJL 1HFNA 1W2BA 3F2CA 5C3WA 3SK4A 1YNND 2ASBA 3A54A 3I3CA 4DR2Q 3E9IA 3TS2A 1PRTF 4C3IB 2ATWA 2XWBB 3S14B 2Q2UA 2XN9C 1VQNA 4JBJA 4RGTA 3ZYYX 1Q1EA 4HTHA 3HS0C 2OWOA 2AQ2B 3N52A 1EWHA 1K28A 2JN4A 3U4VA 1SEBD 3AQQA 5FO7B 3HOYB 3BYYB 4OWTB 4DK0A 1N32Q 4JI7Q 1HZCA 4UPAA 3WOFA 3W5OA 4G7ZC 1I6VC 5A35A 3CC7A 1XNQL 4A3DB 1EIYB 5HY6A 4O42A 3H0GB 2VQFL 1EQVA 4DN4M 5LL6X 1K83H 3RLFA 4B3MQ 3IFTA 4FDBA 5IP7H 4BA2I 3OSOA 2L11A 4JK1C 1EY0A 1EFWA 1F77A 2JA9A 2IJ0A 3ZJYC 5CMDA 4TVAB 1A3VA 2M2LA 4GN3B 3AU7A 2KHSA 2KHIA 1XMQL 1ZXTA 1IYUA 2KBNA 4Z9CB 3PO2H 2B8GA 4NPSA 1QCBD 4PQXA 1IW7C 1SYFA 2RSOA 2EYMA 4R1JA 1ONLA 5IP7G 3S15B 3E0JA 3H09A 1VQLA 3I2ZA 2KJXA 1LO5D 3T1HQ 4GLVB 1HZAA 2PZWA 4DR6Q 4A3JH 2D0PA 3NP8A 3PO2G 1X65A 3NWSA 4JI5Q 4A3KH 1PRTC 1JORA 3JAMc 2N8NA 3RZDB 3DWQA 1M1KC 1XX8A 2QW7A 4BBSH 3CW2C 2PI2E 3W3AA 2EYLA 1IKMA 3S2HB 1VQGA 4B3RL 2PPBC 5FO9B 4OELB 1PH6A 5M5XB 3GTQB 5KNDA 4PZ8A 2UU9L 4F8MA 1D1IA 2PQAA 2D5DA 3EVQA 1FNUA 2NZHA 4A3JG 4A3KG 3G4SA 1EY8A 1I6HB 1IBML 4C3JB 4BBSG 1N33Q 1ILPA 2QDBA 3FKIH 2BH8A 3HGBA 2R93H 3SVMA 1KABA 5DM63 4KV6A 1P16A 4O0AA 4LFCL 5IGDA 1F9SA 4DUYL 1HRJA 2I5MX 2Z4HA 3TN2A 4YY3L 4GS3A 2JA7B 1WJJA 2B2VC 5J3BA 3NBHA 3SEBA 3GTJH 2IL8A 3SGIA 5C4XH 3BZKA 4UAIA 3QG1A 5M3MB 5A2QE 2R6GA 2RHQB 2N78A 1S5FD 3FKIG 3J81E 1B8AA 2R93G 3PV0A 1Q90A 4K0KQ 4A3LH 2WP8J 1QE6A 1DGSA 3M4OB 4QIWB 3Q6SA 2K5VA 5IIFA 3VR4A 3GV6A 1U4LA 4CHTB 2PZUA 4P72A 1AFPA 5M5YH 1L1OA 4LWCA 1Q1BA 4U673 1AZPA 5C4XG 5IYDH 1X32A 4FVMA 2PI2A 1S5CD 3CCQA 5JJIA 1EYDA 2NVYB 3E3XA 1LM0A 1YI2A 3UE0A 3OMGA 2GN5A 4A3LG 3PIOA 3MZ5A 3BDCA 3I4NG 3BJUA 1LTSD 2WAQE 2CWAA 4JC0A 1RJTA 2I5LX 2O4XA 1G8ZD 4JI1Q 2IHEA 2B39A 2YTVA 4LJZC 1JT8A 4IZ8A 5IYDG 4JI4L 2FXQA 4LF8Q 5EKKA 5IE8A 4R9WA 5D65A 1WYDA 4C1NK 2UUAQ 3E5SA 3K8AA 5GAHC 4DAVA 1CUKA 4R4TA 1EEID 2L0CA 4DAYA 3S1MH 1PZJD 4BY1B 4KKUA 3VR2A 1WTHA 1WOCA 5EAYA 1E1TA 2XIWA 2JA6B 4J8QA 1J6QA 2D62A 4A75A 3BDOA 5BN5A 4XYQA 3ULPA 1G91A 1PTOF 4QUFA 1DOLA 3KLSX 1E2VA 2B29A 2IX3A 2KQ3A 3TS0A 1SYDA 2B2YA 4TRDA 5JJKA 4IOCA 2LXKA 1GVPA 1K83B 1NE3A 4DV2Q 3TEHB 1JOKA 2V4DA 2AWNA 3R93A 1EFID 2Y0SE 2UXBQ 1TXYA 2F0FA 4CJ2C 2F4IA 1CKMA 1DZ1A 2PZTA 4JI2L 1HHVA 3PO2B 1Y8NB 2BA1A 1Q82C 1UWVA 1SJED 5LMUQ 5GROA 2UXCQ 2OF1A 4WJWA 1FGBD 1A6XA 5C44H 4X66Q 2RBMA 1A3UA 5KRUA 2A8VA 1QZGA 2K6AA 3LWUA 1M8AA 2LXJA 4IPDA 2VQEQ 4NP5A 4A3JB 4A3KB 4RG1A 3KLRA 1U9RA 2ZJRA 2BDNA 3L2PA 4EGVA 2OQKA 5C4HA 4X62L 3A8IE 5C44G 4LF6L 3HOZH 1Y8OB 4OL7A 1SNPA 1U0LA 2NWGA 3MVVA 1X3QA 4GKJQ 2BH2A 3M7GA 2B2WA 2E75C 1EYCA 4XT3B 1CKNB 2BA0A 1AE2A 1ENFA 2WKDA 3KDFB 1MIUA 2AHOB 3W1BA 2K5QA 1R4QB 1PHJA 3BZDB 4HJ8A 3A7AB 1IW7D 2B3GA 1PTOC 1WI5A 3EIVA 1R4PB 1XTDA 3HOZG 1UE7A 2N88A 3VA5A 2WACA 2R93B 4H02A 2QGQA 4NMZA 3KFUA 2KCMA 4ZLTF 5LMNQ 5JJLA 5IT9E 4HIOA 2RCNA 5E4WC 2A6HC 4DR7Q 1XNQQ 1PRTD 2FMCA 2N49A 4XQJA 3A5UA 2RF4A 2DUDA 3MXNA 3GTJB 2EJGC 1L1OC 4DXFA 1G2SA 1N36Q 1SSOA 5KNBA 2EDGA 5GADC 3TZUA 1KDBA 1XPUA 4PMBA 2XGTA 3BVMA 4C56C 1A0IA 1T5XD 3I4NB 1AE3A 4LF5L 2JA5B 2YYZA 5BR8Q 1A2UA 3IL8A 2M00A 4FP5D 4JI6Q 3O13A 3QO2A 1W6KA 3T56B 2K50A 3BZCA 1TWFH 2NTSA 5JOBA 3CCJA 4ODGA 5M5YB 3E9HA 2QKIC 1UNSA 1H9KA 2Q2IA 1PVOA 4NDXA 1U5KA 1I4QA 3WWVA 2EVBA 1CZWA 1HH2P 4P71A 3MA2B 3WDNA 4HIDA 2Z9HA 3P1HA 1LTID 2UUBL 2EE1A 4KK7A 4ME5A 5DEHA 1G51A 4DR5L 3KBXA 1MJCA 4KI0A 1KD1C 4FF4A 1ZEQX 1JCKB 2XSCA 5I4DA 3GD7A 3BDLA 2E2IH 3QJYA 1UE1A 5BN3A 1IBKL 1EZ6A 1Y1VH 4GN5A 4C2MH 1L0YB 2X6LA 4HJ9A 1SROA 3K58A 3HOYH 4HJ7A 1G291 4IPCA 4ZRZA 3K7AH 1RKNA 2JJQA 4KY7A 5KYLA 5F2DA 4JV5L 2UU9Q 1D6EC 4MZ9A 3CP0A 4GN4B 4P74A 3S1MB 2B2YC 2A6EC 4X3SA 4DK3C 3I72A 2YV5A 1ILQA 3ER0A 4K5WA 5ELDA 1PV4A 3GTKH 1NSNS 2E5LL 3K80C 4HJAA 1Y1VG 1IBMQ 3TQYA 3ULJA 3HOYG 1UAPA 2EYFA 3NUCA 2K5DA 2DNEA 1YHQA 4R4CA 1DD2A 4Q0FA 3TRZA 2XNAC 4LFCQ 3AMUA 2MFIA 3CF5A 4DUYQ 1VQFA 4DKAC 1PH3A 4YY3Q 2RA4A 1MSGA 1TT2A 2C9OA 2PCFB 1AZQA 2VL6A 3AYHB 1KLUD 3HP3A 2K28A 4NXMQ 1XTCD 5EKIA 4RFBA 1TY2A 3D6WA 4AQYL 1U4PA 2VUMB 1STAA 3UDXA 2K05A 4UP7A 4K6LA 4ID6A 1E3PA 1Q86C 1HUNA 5J39A 4X3TA 1O7LA 5CV9A 5C44B 4N9TA 1OO9B 1PH4A 2NUCA 3GTQH 2RDFA 1JOOA 3H15A 1VQ9A 2B2WC 2X6GA 4RWSC 4JYAQ 2ZTEA 3NSWA 1TWHH 4LFBL 2XVSA 4KKTA 3TMEA 4YWMA 2ES2A 2JK8A 1WVLA 5DM73 1I6HH 1DONA 4ME3A 4YCWA 3S1NH 3HG9A 1LUZA 1HNXL 4C3JH 3HOWH 3HOZB 2L55A 5M3FH 2XRSD 2OQ0A 3MXPA 1SFOH 1Q8IA 4JI4Q 3FVQA 2A74C 1D2BA 3GDEA 3E0EA 1HXYD 1SN8A 3KF8B 3M4YA 2O5JC 3FP9A 5FO8B 2F3VA 1VQMA 1XNRL 2F3WA 3NELA 3CRKC 3R8BA 3I56A 4GZYC 1LT6D 1QWYA 4C3JG 2B2UA 3CC4A 3NENA 4LF7Q 3HOWG 2AKWB 2BDOA 2K52A 5M3FG 4QUCA 4GNXA 4A3GH 4LF9L 2F0LA 2BE5C 1UUPA 1PH7A 1EOVA 4JPBW 2FMMA 1JWMD 5IGCA 2GVBA 2B2VA 5DAUA 2H1EA 1GHJA 1DOKA 1GJXA 5FKAC 2RDHA 1QUQB 3VA7A 1K73C 3PIPA 4IFDJ 2EIFA 4GLAC 1V43A 3H94A 4IUNA 4A3GG 1A2TA 1X56A 5IOCA 1YJ9A 2NZOA 4DR1Q 1C9OA 5GAEC 4LF4L 4DV5L 2K5HA 5FLXc 1WD0A 1HTPA 4DR3L 3OW7A 4X3UA 1TWFB 4KHPL 5D3DA 2K04A 1S3OA 5IYBH 2JE6I 2CHBD 3DLLA 1U4RA 4MHEA 3PQIA 2PW7A 2ZTCA 1PTOD 1PRTB 4L6TB 3M4PA 1SYGA 4CKEA 2ICIA 3Q22A 2EJMA 3CCVA 4L5QA 2KCCA 4POGA
chains in the Genus database with same CATH topology
1I4RA 5KNCA 1TS3A 4G4KA 2DY7A 1C4QA 5TSSA 4HN7A 3BVZA 2A6HD 3SDZA 2E2IB 2F1MA 1Y1VB 2O2LD 5D14A 4C2MB 2XRQD 3C1EA 4K2KA 3URYA 3K7AB 1DXMA 2F0KA 2F0DA 3JAML 2PQEA 1ML0D 4EQOA 4RH6A 3MAQA 1HQMC 1ET6A 1LTGD 3IKJA 3GTKB 1S5DD 2A69D 5ELBA 1SDFA 4BBRB 2LY7A 1LLRD 3RD4A 4IQZA 4K8IA 3J7AV 1PFBA 2G9DA 3L7ZC 3C46A 1EU4A 2WKCA 2MGSA 4WORA 3DEPA 5KIXA 2A68D 1Z7TA 1DM0B 4ZKCB 1SNDA 1SE3A 3QIAA 3PUXA 1LT5D 3A7LA 3Q0AA 5C5MA 4QMGA 1SYCA 1YNJC 3DEOA 1CT1D 3UI2A 1SXTA 1PZKD 4CKBA 1GUNA 2ICEC 1PFMA 1RDPD 5C0XH 5C5LA 2DN8A 5CGKA 4DF7A 3CHBD 2M9VA 4K5VA 1K8OA 1HFGA 1O78A 1TWHB 2ID0A 5JPNC 3K5LA 1QNUA 2Q8RE 3SK5A 2HUGA 3S1NB 1WD1A 1F9PA 2ENBA 5C0XG 3KBGA 3HOWB 5CR3A 5M3FB 2B2UC 5EBCA 2BOSA 2JP1A 2EY1A 1SFOB 1BXTA 4U68A 1QOHA 3A55A 3DWAA 4V190 4XYOA 3GV3A 1H9MA 3PIP3 3T16A 1KTKA 3DWPA 1WTVA 5EPKA 3T53B 4KMUC 4HEDA 3OPOA 4A3GB 2HCCA 3KUPA 4HCEA 3FMCA 3GO5A 3R3OA 2Z8LA 3J80L 2CVRA 2F03A 4IALA 1EIHA 4R8NA 1SMYC 3VYTA 1GUTA 2KEDA 3VYSA 3K0YA 4XDXA 1SYEA 1F2YA 1CZGA 1RTOA 4ZUJA 3K5OA 3A56A 1TWGB 2SEBD 5CORA 5ELCA 5FLXE 3NBIA 4Q5VA 1GHKA 1J8IA 2L12A 1NCVA 4IN3A 4L8JA 2BE5D 4RGOS 3GP7A 4FYDA 2KVMA 1CM9A 4IUUA 4FXGC 4B08A 1JICA 1QILA 1Z6HA 3MXGA 1SE4A 3VYRA 2FINB 1H9SA 2L4NA 4RCOA 1CA6A 1S4ZA 1F9QA 3GTOB 3HRZC 1I4XA 1PTOB 1OXTA 3NWTA 4RGMA 3I4MB 1RTNA 4RHRA 2VB3X 1LTBD 3V05A 1Q3LA 1I4PA 2IPKD 1F9RA 1CI3M 2WV6D 1GUOA 2K32A 4DU9A 1JWSD 3NQIA 2JEAI 2CQAA 3HOVB 2RVLA 3U9SA 4PV1C 2R7ZB 1PXUA 3ND8A 1RCVD 3RUZA 1HA6A 1J9OA 3D3RA 2KOLA 3SR1A 3K5NA 1IYVA 1GXDC 3NPPA 4MN3A 4L63B 1CK1A 3D4WA 4BA1I 4XTCS 3KK7A 3FPPA 2RSNA 3S9WA 1JE4A 2J7ZA 1CHQD 3G7LA 2BCOA 3K59A 5J1ZA 2EY2A 3OMCA 4UDUC 3M7NA 3D8GA 1ESRA 4AYBB 2QILA 3VR3A 3KLSA 4WFN3 2K01A 4TQUS 3J7AF 1V1PA 2HDLA 2JSOA 4ILWA 3S1RB 2AUJD 5EKLA 3I8ZA 4P2CB 1UEAB 1HCZA 4HSPA 4A3FB 4X3KA 1CTMA 4RKBA 4PNYA 2F0PA 1TU2B 2QEJC 2J0TD 4QCLA 3ERQA 5D3IB 1TWAB 4KJOA 3QOLA 3SHLA 1YNJD 2JEBI 3DUZA 5M5WB 5I6YA 3PO3B 1AN8A 2EYHA 4LK1C 1AP0A 2GA4B 3MC0B 1G2TA 1Y1WB 1OXSC 2F0TA 5T1IA 1VMPA 1D1KA 2YU9B 4KJNA 1LABA 2IX0A 2KCNA 1D5MC 5HURA 1KDAA 3NE5B 5K36H 1KNEA 1AW7A 4HR7B 1NR4A 2WB1B 4ZUIA 3TZDA 2SNMA 2MUYA 5FK9C 1WTOA 4K5XA 1Q12A 1STBA 1BCPF 3TP7A 1I50B 1KNAA 5K36G 5KYIA 4V0BA 2F0NA 2JXMB 3N6RA 4RKLA 3D4RA 3MWYW 1EY6A 2WINB 5JVG3 3NTIA 1SYBA 4S3SA 3GQBA 1BR9A 1B1ZA 4DAPA 4FF3A 2F0GA 3MHBA 2A5HA 3BYTB 3HZXA 1VMCA 1TWCB 1SMYD 4ZYSA 1PLFA 1RD9D 2VB2X 2EYPA 2TSSA 3OOCA 2HQEA 3CQZB 2IW3A 5I2YA 2MPMA 4RAUC 3HOXB 4CBVA 3TBIB 2NN6H 1SJHD 1FNWA 2F0HA 3BG3A 4NW2A 1I4GA 2EJFC 3T51B 3SK8A 4FNFA 2LKVA 4M8AA 4KN7C 3S1QB 4OO1I 2AUKA 1EOTA 5A2QL 1TQOA 4XXEA 4CJ0B 3J81L 2L5TA 3QWNA 5LL6S 1BCPC 4IURA 4N9PA 5K5PA 2KA7A 4IFDI 2PMZB 2E76C 2E2HB 2NN6G 4A3BB 2F0UA 1LTRD 1E0BA 3OHXC 4BWGB 5E4XA 2O5IC 3CRLC 2F0WA 1O7YA 1O7ZA 1E2WA 3BVGA 3SE0A 1MGSA 3PUYA 2F0EA 3MFGA 4M1UB 5EGTA 4A3EB 4C3HG 1BDOA 2EYJA 5J22A 1KLGD 1EEFD 4H0LC 2EYOA 4WRDA 2J4XA 5IGGA 1TY0A 3D31A 3H3VC 3NHHA 1BUVT 5I6WA 4KHVA 5EQ0A 4FF2A 2G9HD 2F0JA 1S5ED 1O80A 1BF4A 1BNZA 5JEAJ 1D5XC 1EY7A 1TS4A 5I9PA 2RDGA 2X69A 1MBYA 3T13A 1FR3A 3HEJA 1EY9A 2AQ1B 2KUMA 2N55A 1TS2A 3X3MA 1D5ZC 3VR6A 1PMRA 2MJ8A 1BBXC 4DXGA 1KAAA 4YIJA 1K8MA 1SE2A 1XXGA 5CV8A 4XQQA 1CQFA 4RHSA 4B9WA 3HKZB 2H4OA 1EIGA 1WTPA 4DNRB 3M85A 3P20A 4EQPA 4IUPA 1W6JA 1B50A 1JC7A 1IKLA 1MI2A 1QNKA 5DNFA 4XQNA 2B63B 2B2TC 2F0MA 1JQYD 3D4DA 1TS5A 3TDQA 1NAPA 2LMCB 1PTOH 3K6OA 1EZ8A 4EQNA 1C48A 1GOZA 3PUWA 2DNCA 3MEHA 3SK6A 1BQQT 4BS9A 3F2UA 3GTPB 2K03A 1G6ZA 3L9AX 5EBDA 3DHQA 1T5EA 4LAAA 4K2LA 1PFNA 1H9RA 2XWJB 1RODA 1TIID 4ULLA 5CV6A 1EWCA 1TVXA 1WTWA 4CJ1B 1NUCA 1STYA 3V2TA 4G7HC 4I65A 4FXDA 4C1NI 5IGEA 3MXUA 5IT9L 1I3QB 5COYA 1HTLD 3OWFA 2C5CA 1HQRD 2K7VA 1GUWA 2ZT9C 3S2DB 1B4OA 3CU7A 1JOQA 1B9MA 1SBBB 2HCIA 1LT4D 3FRPB 1HPCA 2A6ED 3NK9A 1GUSA 2R92B 5G3LF 3TP6A 1ICWA 4PMCA 2FFKB 5C0XI 1EYAA 1DYQA 5CC4A 5FOBB 4C3HB 5C3EB 2OXPA 4OIJA 3I70A 3R2TA 1HA5A 1V8QA 2SOBA 5ISRA 3NTHA 1CQVA 3EA6A 4KD3A 4ABNA 1PZID 1EU3A 1JB3A 5E3FA 1CFMA 1ENCA 2MP1A 5I2XA 4FF1A 2VNUD 4DGZA 3AB9A 3OWEB 1STNA 1II3A 4KKSA 1DJRD 3Q24A 1BCPD 3NQTA 1V1OA 3Q23A 1TKWB 2JA8B 1WTRA 1C8CA 5C3XA 1LTAD 2FJ2A 1ET9A 1SNOA 2KECA 3PUZA 4FO2A 5NUCA 1FNVA 4I7ZC 2F0IA 3PMFA 4IUQA 2OEOA 4K14A 4Y7NB 4H7BA 5C0XJ 1STHA 2R3ZA 4CGYB 3U9OA 2NBFA 4QB4A 1X3PA 1B3AA 4G7OC 1BO0A 2Q8TA 5LHY1 1WCMB 2I46A 3GTLB 3I90A 3S16B 1OXXK 1ZYRC 2F0VA 3FPUB 4H13C 1S5BD 3TP5A 5ELFA 3ONAB 4KN4C 1B53A 3LWEA 2KEEA 4XIGS 4A93B 3BS1A 1SAPA 2K5WA 2RKSA 4JBWA 1RHPA 1XYIA 2E2JB 5EPJA 3M3YB 2NTTA 3EROA 2E2DC 4J1MA 4RCNA 2F0OA 2JYOA 2NVXB 5CYUA 4K8JA 3SXHA 1WTXA 2SDFA 3QB3A 5EJWA 1SNCA 2Z4IA 2IX1A 3LNNA 1F2ZA 1CA5A 3ITPA 2CW0C 1DCZA 5CV7A 2IWHA 3T4AC 3FEWX 3FDTA 4B9XA 1VDZA 5IODA 2Z1CA 2LS01 3MTSA 1NR2A 3X3NA 1H9SB 3J7YW 1GUGA 1I4HA 5ELEA 4R8IA 5CV5A 4KTAA 3NXWA 4BBSB 3JAME 1JR0D 5C6AA 1IL8A 3VYUA 4HMJA 3A8JE 1OXUA 1VCIA 3DXJC 4NKLA 2F0SA 5EPLA 5I9OA 2NVTB 1SNQA 5C4ZA 3RMHA 2DY8A 3HOUB 1YNNC 3FKIB 2K1BA 5CV4A 2SNSA 3CKIB 3R2IA 1F2LA 1XWEA 3G6JB 4G57A 4KY6A 2D9UA 3I73A 2WAQB 3VR5A 4EVOA 1WTQA 3A8KE 3H6MA 3NTKA 1JWUD 3WOEA 3TP8A 1B2TA 2Q8IB 2PNRC 1HUMA 5C4XB 4QF4A 1Z47A 4O1NA 4KY5A 3PIO3 1TR5A 1MD2D 3EJIA 1M4VA 4HMIA 4ZKBB 3C1FA 4DK1A 1BCPB 2NB0A 2B8FA 1V1PB 3I4LA 1FD7D 2I07B 2MHVA 1BOSA 1STGA 2EOTA 2ZXRA 2A69C 3H91A 4RGNA 2WIIB 4LMQD 2E74C 2NYZD 5IGBA 4H44C 3L3OC 1EL0A 1IHZA 3TSSA 2OT2A 1LT3D 1FYCA 1L0XB 4PMWA 3W2DA 3S17B 2AWOA 1MSHA 5T1GA 1OXVA 2B2TA 1QJOA 1PDQA 2D2CC 3E6ZX 2Y0SB 2A68C 1PYWD 5JVH3 5CBEE 3I91A 4OIKA 1QG7A 4F87A 1CHPD 4C3IG 4KD4A 3DM1A 3P7JA 4XT1B 5G3LD 1B9NA 3GTGB 3EFXD 3LX0A 2ZXOA 3PUVA 2LFNA 4TKOB 4HAEA 2L1BA 4ZK9B 2K33A 2EPBA 3KF8A 5JAVA 3J80E 1A15A 1RF2D 2TMPA 4A3MB 4OGQC 2F0QA 2PYKA 4RA8A 1VF7A 2NN6I 4A3IB 1E2ZA 4BY7B 3D6CA 1ZYRD 3DMUA 2A73B 5KGUA 1LACA 3OIPA 4KHZA 5JEAH 4TSSA 3RZOB 1R9TB 4OO1H 3ND9A 5AFWA 3OIQA 5JJZA 3MFYA 3IFDA 4IFDH 2NZ1D 1U4MA 5HGTA 3QOJA 5C4JB 4HSVA 2R61A 4K6DA 5JEAG 2PO4A 2EY5A 3K5MA 4OO1G 1QB5D 1EY5A 5BN4A 5E1FA 1EQTA 5FLXL 2L9HA 3GTMB 3K57A 4IFDG 2PW5A 3P75A 4E6IA 1VF5C 5M9OA 1LTTD 4J6HA 1B44D 3C3LA 1KDCA 4F88A 2EZVA 2CW0D 1SNMA 2FHTA 5JPMC 4FXKC 2QF7A 1STEA 1A3TA 2EXZA 3C2PA 2AQ3B 4ZQ3A 2ZXPA 1ENAA 2NVQB 1ZKOA 2IT1A 1Y8PB 1F2MA 2VXWA 1LV9A 4CKCA 1H9JA 4DA2A 3EQLC 1ESFA 1DOMA 4IUVA 5CBAE 4ZAIA 1AEXA 2HDMA 4HCSA 4DNTB 2EY6A 3IAYA 4F7XA 5KEEA 4OHJA 3V96A 4DFAA 5IGFA 1Y69U 2QCPX 4IUTA 1EY4A 2RQXA 4MIUA 1HFNA 5C3WA 3SK4A 1YNND 3A54A 3I3CA 1PRTF 4C3IB 2XWBB 3S14B 2XN9C 4RGTA 3ZYYX 1Q1EA 4HTHA 3HS0C 2AQ2B 3N52A 1EWHA 1SEBD 5FO7B 3HOYB 3BYYB 4DK0A 3WOFA 4G7ZC 1I6VC 5A35A 4A3DB 4O42A 3H0GB 1EQVA 4DN4M 5LL6X 3RLFA 3IFTA 4BA2I 3OSOA 2L11A 4JK1C 1EY0A 1F77A 2IJ0A 5CMDA 1A3VA 2M2LA 3AU7A 2KHSA 1ZXTA 1IYUA 4Z9CB 2B8GA 1QCBD 4PQXA 1IW7C 1SYFA 2RSOA 2EYMA 1ONLA 3S15B 3E0JA 3H09A 2KJXA 1LO5D 2PZWA 3NP8A 3NWSA 1PRTC 1JORA 3RZDB 3DWQA 1XX8A 3W3AA 2EYLA 1IKMA 3S2HB 2PPBC 5FO9B 5M5XB 3GTQB 5KNDA 4F8MA 1D1IA 2D5DA 3EVQA 1FNUA 1EY8A 1I6HB 4C3JB 1ILPA 2QDBA 3HGBA 3SVMA 1KABA 5DM63 4KV6A 5IGDA 1F9SA 1HRJA 2Z4HA 3TN2A 2JA7B 2B2VC 3NBHA 3SEBA 2IL8A 4UAIA 3QG1A 5M3MB 5A2QE 2R6GA 1S5FD 3J81E 3PV0A 1Q90A 2WP8J 1QE6A 3M4OB 4QIWB 3Q6SA 5IIFA 3VR4A 3GV6A 1U4LA 4CHTB 2PZUA 1AFPA 1Q1BA 4U673 1AZPA 1X32A 4FVMA 1S5CD 1EYDA 2NVYB 3OMGA 3MZ5A 3BDCA 1LTSD 1RJTA 2O4XA 1G8ZD 2B39A 4LJZC 4IZ8A 5EKKA 4R9WA 5D65A 4C1NK 3E5SA 4DAVA 1EEID 2L0CA 4DAYA 1PZJD 4BY1B 4KKUA 3VR2A 2XIWA 2JA6B 4J8QA 2D62A 3BDOA 5BN5A 4XYQA 1G91A 1PTOF 4QUFA 1DOLA 3KLSX 1E2VA 2IX3A 2KQ3A 1SYDA 2B2YA 4TRDA 1K83B 1JOKA 2V4DA 2AWNA 3R93A 1EFID 2F0FA 4CJ2C 2F4IA 1DZ1A 2PZTA 1HHVA 3PO2B 1Y8NB 2BA1A 1SJED 2OF1A 4WJWA 1FGBD 1A6XA 2RBMA 1A3UA 5KRUA 2K6AA 3LWUA 1M8AA 4A3JB 4NP5A 4A3KB 3KLRA 1U9RA 2BDNA 4EGVA 5C4HA 3A8IE 1Y8OB 4OL7A 1SNPA 3MVVA 2NWGA 1X3QA 3M7GA 2B2WA 2E75C 1EYCA 4XT3B 2BA0A 1ENFA 2WKDA 2K5QA 1R4QB 3BZDB 3A7AB 1IW7D 1PTOC 1R4PB 2N88A 3VA5A 2WACA 2R93B 4NMZA 4ZLTF 5IT9E 5E4WC 2A6HC 1PRTD 2FMCA 4XQJA 3MXNA 3GTJB 2EJGC 4DXFA 1G2SA 1SSOA 5KNBA 2EDGA 3TZUA 1KDBA 4PMBA 3BVMA 4C56C 1T5XD 3I4NB 2JA5B 2YYZA 1A2UA 3IL8A 2M00A 4FP5D 3O13A 3QO2A 1W6KA 3T56B 2NTSA 5JOBA 4ODGA 5M5YB 2QKIC 1UNSA 1H9KA 4NDXA 1I4QA 2EVBA 1CZWA 3WDNA 3MA2B 3P1HA 1LTID 2EE1A 4KK7A 4ME5A 5DEHA 3KBXA 4KI0A 4FF4A 1ZEQX 1JCKB 2XSCA 5I4DA 3GD7A 3BDLA 3QJYA 5BN3A 1EZ6A 1L0YB 2X6LA 3K58A 1G291 4ZRZA 1RKNA 4KY7A 5KYLA 5F2DA 1D6EC 3S1MB 2B2YC 2A6EC 4X3SA 3I72A 1ILQA 4K5WA 5ELDA 1NSNS 1UAPA 2EYFA 3NUCA 2K5DA 2DNEA 1DD2A 4Q0FA 2XNAC 3AMUA 2RA4A 1MSGA 1TT2A 2C9OA 2PCFB 1AZQA 1KLUD 3HP3A 2K28A 1XTCD 5EKIA 4RFBA 1TY2A 3D6WA 1U4PA 2VUMB 1STAA 2K05A 4K6LA 4ID6A 1HUNA 5J39A 4X3TA 1O7LA 5CV9A 5C44B 4N9TA 1OO9B 2NUCA 2RDFA 1JOOA 2B2WC 2X6GA 4RWSC 3NSWA 2XVSA 4KKTA 3TMEA 1WVLA 5DM73 1DONA 3HG9A 3HOZB 2L55A 2XRSD 3MXPA 1Q8IA 3FVQA 2A74C 1D2BA 1HXYD 3M4YA 2O5JC 5FO8B 2F3VA 2F3WA 3CRKC 3R8BA 4GZYC 1LT6D 1QWYA 4C3JG 2B2UA 2BDOA 4QUCA 2F0LA 2BE5C 1UUPA 2FMMA 1JWMD 5IGCA 2B2VA 5DAUA 2H1EA 1GHJA 1DOKA 1GJXA 5FKAC 2RDHA 3VA7A 4IFDJ 1V43A 3H94A 4IUNA 1A2TA 5IOCA 1WD0A 1HTPA 3OW7A 4X3UA 1TWFB 5D3DA 2K04A 2JE6I 2CHBD 1U4RA 4MHEA 2PW7A 1PTOD 1PRTB 4L6TB 1SYGA 4CKEA 2ICIA 3Q22A 2EJMA 2KCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAA A;  2NUC A;  1EQV A;  5CR3 A;  2F0H A;  2RDF A;  1JOO A;  3NK9 A;  4NDX A;  5CV5 A;  5CV8 A;  4KTA A;  1SNM A;  3NXW A;  2EYH A;  3TP6 A;  2EY1 A;  3OSO A;  4B9W A;  1EY0 A;  3SK8 A;  1A3T A;  2F0V A;  2OF1 A;  2LKV A;  3TME A;  3TP5 A;  4PMC A;  4DU9 A;  1A3V A;  4KD4 A;  5C6A A;  1EYA A;  2EXZ A;  5CC4 A;  3P1H A;  3C1E A;  4EQP A;  4K2K A;  2PZU A;  2RBM A;  2F0T A;  2KHS A;  2OXP A;  3LX0 A;  4ZQ3 A;  1A3U A;  1TQO A;  2F0K A;  5KRU A;  4HMJ A;  1ENA A;  4ME5 A;  5DEH A;  4KJN A;  4NKL A;  2F0D A;  2SOB A;  2F0S A;  4N9P A;  3T16 A;  5K5P A;  5ISR A;  2PQE A;  1F2M A;  3RUZ A;  1SYF A;  3MXP A;  4NP5 A;  3V2T A;  2EYM A;  4EQO A;  5HUR A;  3BDL A;  5I9O A;  1EYD A;  1KDA A;  1SNQ A;  5C4Z A;  5JAV A;  1EZ6 A;  3SR1 A;  2RKS A;  1U9R A;  3OMG A;  2F0U A;  4KD3 A;  3MZ5 A;  3BDC A;  2F0Q A;  2F0M A;  4YIJ A;  1RKN A;  4KY7 A;  5C4H A;  5KYL A;  2PYK A;  5E3F A;  5CV4 A;  2F3V A;  2SNS A;  4ZUI A;  2F3W A;  3D4D A;  2PZW A;  1ENC A;  1SNP A;  2O4X A;  2SNM A;  3MVV A;  4G57 A;  4KY6 A;  4OL7 A;  1AEX A;  3D4W A;  3D6C A;  3R3O A;  4DGZ A;  3DMU A;  3NP8 A;  4K5X A;  4EVO A;  5IIF A;  2EY6 A;  1STB A;  1EYC A;  3ERO A;  4K8I A;  2F0W A;  4IZ8 A;  1STN A;  1II3 A;  4F7X A;  5IGB A;  1EZ8 A;  3TP7 A;  5KGU A;  4IAL A;  1JOR A;  5KEE A;  4EQN A;  4J1M A;  3H6M A;  3S9W A;  2F0O A;  4R8N A;  5EKK A;  4K5W A;  2F0L A;  4DFA A;  1NSN S;  5IGF A;  3TP8 A;  5J1Z A;  5KYI A;  2EY2 A;  3OMC A;  3NQT A;  2F0E A;  4K8J A;  4WOR A;  5EGT A;  2EYL A;  3SXH A;  1SYE A;  2F0N A;  1F2Y A;  4QF4 A;  3E5S A;  3D8G A;  4KY5 A;  3MEH A;  5IGC A;  3SK6 A;  2EYF A;  5KIX A;  3NUC A;  3QB3 A;  2EYJ A;  4RKL A;  1SNC A;  4ZUJ A;  1TR5 A;  5J22 A;  1EY4 A;  3EJI A;  4MIU A;  5DAU A;  4F8M A;  4HMI A;  3VA5 A;  3C1F A;  1SND A;  1EY6 A;  2WAC A;  5C3W A;  3SK4 A;  5C3X A;  5HGT A;  2EYO A;  3EVQ A;  3QOJ A;  4WRD A;  5C5M A;  3DHQ A;  4NMZ A;  1SYC A;  1SNO A;  1F2Z A;  4QMG A;  5IGG A;  5NUC A;  1EY8 A;  3ITP A;  4LAA A;  4K2L A;  3NHH A;  2F0I A;  4IUN A;  5EKL A;  1A2T A;  3PMF A;  1STG A;  4K6D A;  5IOC A;  1SYB A;  4S3S A;  5I6W A;  2OEO A;  4KHV A;  5CV6 A;  2EY5 A;  1TT2 A;  2F0J A;  2F0G A;  2QDB A;  3MHB A;  1EY5 A;  4HTH A;  5C5L A;  5CGK A;  3HZX A;  5E1F A;  5F2D A;  4DF7 A;  4K14 A;  1NUC A;  1STY A;  4K5V A;  4RKB A;  1KAB A;  2KQ3 A;  4H7B A;  4KV6 A;  1SYD A;  2F0P A;  4PNY A;  5CV7 A;  4TRD A;  1EY7 A;  4I65 A;  1STH A;  2PW7 A;  2PW5 A;  1IHZ A;  1KDB A;  3P75 A;  4B9X A;  1STA A;  4E6I A;  5IGD A;  5I9P A;  5IGE A;  4PMB A;  3U9O A;  3ERQ A;  1JOK A;  5IOD A;  3T13 A;  2EYP A;  3OWF A;  4QB4 A;  3HEJ A;  5M9O A;  1SYG A;  2HQE A;  1EY9 A;  4ID6 A;  4J6H A;  1A2U A;  5J39 A;  2M00 A;  5CV9 A;  4KJO A;  1JOQ A;  2F0F A;  5JOB A;  3SK5 A;  3QOL A;  1KDC A;  3SHL A;  4N9T A;  4ODG A;  2ENB A;  2PZT A;  5I6Y A; 
#chains in the Genus database with same CATH topology
 1I4R A;  5KNC A;  1TS3 A;  4G4K A;  2DY7 A;  4IJH A;  1C4Q A;  5TSS A;  5IYB G;  4HN7 A;  3BVZ A;  2A6H D;  4QIW E;  3SDZ A;  2E2I B;  4BY1 H;  2F1M A;  1Y1V B;  2O2L D;  5D14 A;  4C2M B;  1VQJ A;  2XRQ D;  2MQH A;  3C1E A;  4K2K A;  4YCV A;  3URY A;  3K7A B;  3GTO H;  1DXM A;  1V1Q A;  2F0K A;  4X62 Q;  2JA6 H;  1X9N A;  3I4M H;  2F0D A;  3JAM L;  2PQE A;  1ML0 D;  4EQO A;  4RH6 A;  3MAQ A;  1HQM C;  3F8T A;  1XPR A;  1ET6 A;  1LTG D;  4DV6 L;  1NTG A;  3PF5 A;  1HR0 Q;  4L5R C;  3IKJ A;  3GTK B;  1S5D D;  4BY1 G;  4NB3 A;  2A69 D;  2VS1 A;  4CDC C;  1NJI C;  5ELB A;  2R7Z H;  1SDF A;  4BBR B;  2LY7 A;  1LLR D;  2JA6 G;  3RD4 A;  3I4M G;  4IQZ A;  1E1O A;  4K8I A;  1PH8 A;  3J7A V;  1PFB A;  2G9D A;  3L7Z C;  3C46 A;  2ZM6 L;  1EU4 A;  2WKC A;  2MGS A;  3K0X A;  4WOR A;  3RR5 A;  1XPO A;  3DEP A;  5KIX A;  2A68 D;  1SR3 A;  1Z7T A;  2R7Z G;  1DM0 B;  4ZKC B;  1SND A;  1SE3 A;  3QIA A;  2MO1 A;  3KJO A;  3PUX A;  1LT5 D;  4WJ4 A;  3A7L A;  3Q0A A;  2AMC B;  5C5M A;  4QMG A;  1SYC A;  1YNJ C;  3DEO A;  1CT1 D;  3UI2 A;  4L5S A;  1SXT A;  1PZK D;  4CKB A;  1J5E L;  1GUN A;  4CDE C;  4LF5 Q;  1K3R A;  2ICE C;  3J81 j;  2R7D A;  1PFM A;  1RDP D;  5C0X H;  2Q2H A;  5C5L A;  2DN8 A;  5CGK A;  4DF7 A;  3CHB D;  2M9V A;  3KJP A;  4K5V A;  1K8O A;  1HFG A;  3K81 C;  4OX9 L;  1O78 A;  3G48 A;  3A5Z B;  3S1R H;  3KOJ A;  1I94 L;  1TWH B;  2ID0 A;  5IWA Q;  5JPN C;  3K5L A;  1QNU A;  2Q8R E;  1Q81 C;  4A3F H;  1N34 L;  3SK5 A;  2HUG A;  3S1N B;  1WD1 A;  4DK6 C;  1F9P A;  2ENB A;  3PCO B;  4AYB G;  3KBG A;  5C0X G;  3HOW B;  1BKB A;  5CR3 A;  1X55 A;  5M3F B;  2B2U C;  5EBC A;  2BOS A;  2JP1 A;  2EY1 A;  1SFO B;  1FJG L;  4GNX C;  1BXT A;  5IT9 c;  4U68 A;  1QOH A;  1UE5 A;  3A55 A;  3DWA A;  4V19 0;  3CD6 A;  2I5H A;  4XYO A;  3TRE A;  3GV3 A;  5M5W H;  4A3F G;  1EQR A;  1H9M A;  3PIP 3;  5GQO A;  3VDY A;  3T16 A;  1KTK A;  3DWP A;  3PO3 H;  4IO9 A;  5EPK A;  1WTV A;  4PG3 A;  3NEM A;  3T53 B;  4KMU C;  4HED A;  3OPO A;  4OON A;  1Y1W H;  4A3C H;  2P5Z X;  3RLN A;  4A3G B;  2E5L Q;  2HCC A;  3I4N H;  3KUP A;  4HCE A;  2JA5 H;  2YU9 H;  4UP8 A;  3B6Y A;  3FMC A;  3GO5 A;  3R3O A;  2Z8L A;  1Q8K A;  3J80 L;  2CVR A;  2G5D A;  4DNI A;  2F03 A;  3PO3 G;  4IAL A;  1ASY A;  1EIH A;  3CCR A;  2LSS A;  4R8N A;  1SMY C;  3VYT A;  1GUT A;  1V9P A;  2KED A;  3VYS A;  1Y1W G;  3K0Y A;  4A3C G;  4XDX A;  1SYE A;  1F2Y A;  4L5T A;  2Q2T A;  1SMX A;  2UXD L;  1CZG A;  1RTO A;  4ZUJ A;  2JA5 G;  3K5O A;  3A56 A;  1TWG B;  3OYY A;  2SEB D;  5COR A;  5ELC A;  5FLX E;  1VQC A;  3NBI A;  4AQY Q;  1I50 H;  4KLK A;  2R7F A;  2PQA B;  4Q5V A;  4MTN A;  1GHK A;  4O2D A;  1J8I A;  2WB1 G;  2L12 A;  1NCV A;  3T1Y Q;  1PH5 A;  1GKH A;  4IN3 A;  4L8J A;  2BE5 D;  4RGO S;  3GP7 A;  4FYD A;  2KHJ A;  2KVM A;  1CM9 A;  4IUU A;  4FXG C;  4B08 A;  1JIC A;  1QIL A;  1EUJ A;  4JI8 L;  1Z6H A;  3MXG A;  4JI0 L;  2OTL A;  1SE4 A;  3VYR A;  4JOI A;  2FIN B;  3H3V I;  4X65 L;  1H9S A;  3KF6 A;  2L4N A;  4RCO A;  1CA6 A;  1S4Z A;  2QEX A;  1F9Q A;  2RCF A;  3GTO B;  1TWC H;  3HRZ C;  1I4X A;  1PTO B;  1OXT A;  3NWT A;  4RGM A;  1HNX Q;  3U58 A;  3NBH B;  3I4M B;  1RTN A;  4RHR A;  2VB3 X;  1LTB D;  1XMO L;  3V05 A;  1Q3L A;  1I4P A;  2IPK D;  5LMN W;  1F9R A;  1FL0 A;  1CI3 M;  1SE8 A;  2WV6 D;  1GUO A;  4AH6 A;  2K32 A;  1CKO A;  4DU9 A;  3CQZ H;  3HKS A;  1QZH A;  1JWS D;  3NQI A;  2JEA I;  2CQA A;  3HOV B;  2RVL A;  1KRT A;  3U9S A;  4PV1 C;  4GOP B;  3HOX H;  2HIX A;  2R7Z B;  1L1O B;  1PXU A;  3ND8 A;  1RCV D;  3RUZ A;  1HA6 A;  1J9O A;  3D3R A;  4LFA L;  4NXN L;  2KOL A;  3SR1 A;  4JG2 A;  3K5N A;  4ALP A;  4LF9 Q;  3S1Q H;  2VUM H;  4DV0 L;  1IYV A;  1GXD C;  1JJG A;  4UHV A;  3NPP A;  4MN3 A;  4L63 B;  4IJL A;  3OTO L;  1CK1 A;  3D4W A;  3HOX G;  4BA1 I;  4XTC S;  2E2H H;  3KK7 A;  3FPP A;  1VQ8 A;  4A3B H;  2RSN A;  3AEV A;  3S9W A;  1JE4 A;  2J7Z A;  1CHQ D;  2CH4 W;  3G7L A;  1VS0 A;  2BCO A;  3K59 A;  5J1Z A;  2EY2 A;  3OMC A;  4DR4 L;  4UDU C;  3M7N A;  2VUM G;  3U50 C;  1XJV A;  3D8G A;  1ESR A;  4DV5 Q;  4AYB B;  2QIL A;  3VR3 A;  3KLS A;  4KHP Q;  4WFN 3;  2K01 A;  4TQU S;  3J7A F;  1V1P A;  1E7Z A;  1PYS B;  2HDL A;  2JSO A;  3CCS A;  4A3B G;  4DAY B;  4ILW A;  3S1R B;  5H1S E;  2AUJ D;  3F2D A;  5EKL A;  3I8Z A;  4P2C B;  1UEA B;  4A3E H;  1HCZ A;  2DJF C;  4JVZ A;  4HSP A;  4A3F B;  4X6A H;  4DV1 L;  4X3K A;  1A62 A;  4UP9 A;  1CTM A;  1NMG A;  4RKB A;  4PNY A;  2F0P A;  1TU2 B;  2QEJ C;  2J0T D;  1D7Q A;  4QCL A;  4X64 L;  3ERQ A;  3JAM i;  3HFZ B;  4LUO A;  4GLX A;  5D3I B;  1YJW A;  1TWA B;  3RN2 A;  1YVC A;  4JBM A;  2YTX A;  4N8X 1;  4KJO A;  4A3E G;  4JI3 L;  3QOL A;  3SHL A;  1QVG A;  1L2F A;  1YNJ D;  3S24 A;  2JEB I;  3DUZ A;  5M5W B;  5I6Y A;  1VQ5 A;  1RIP A;  1CSQ A;  3PO3 B;  1AN8 A;  2EYH A;  4LK1 C;  5IY0 A;  1AP0 A;  2GA4 B;  4DV6 Q;  5GAG C;  3MC0 B;  2VQF Q;  1G2T A;  1Y1W B;  1OXS C;  3CPF A;  1VQK A;  2F0T A;  1PH1 A;  5T1I A;  1VMP A;  1D1K A;  2YU9 B;  4KJN A;  1LAB A;  2IX0 A;  1XMQ Q;  2Z6B A;  2KCN A;  1D5M C;  5HUR A;  2HQL A;  4QY7 A;  1KDA A;  3NE5 B;  5K36 H;  1KNE A;  1GM5 A;  3T1H L;  2ZM6 Q;  1AW7 A;  4HR7 B;  1NR4 A;  2WB1 B;  4JI5 L;  4ZUI A;  3TZD A;  2SNM A;  2MUY A;  5DLQ E;  5FK9 C;  1WTO A;  1O7I A;  4K5X A;  3G71 A;  1Q12 A;  1STB A;  1BCP F;  2OTJ A;  3KYH C;  3TP7 A;  4HIM A;  2B63 H;  1I50 B;  1PA6 A;  3HKZ G;  1KNA A;  5K36 G;  5KYI A;  4V0B A;  4JOI C;  1J5E Q;  1D8L A;  2F0N A;  4QL5 A;  3I7F A;  4P73 A;  2JXM B;  3N6R A;  2K14 A;  4RKL A;  1H95 A;  3D4R A;  3MWY W;  1EY6 A;  4B3R Q;  2DJG C;  2WIN B;  5JVG 3;  3EN2 A;  3CCE A;  2HHH L;  1N33 L;  4DV3 L;  2B63 G;  1I94 Q;  2I0Q A;  3CC2 A;  3NTI A;  1SYB A;  4S3S A;  3GQB A;  3CME A;  3GTP H;  1BR9 A;  1B1Z A;  4DAP A;  4FF3 A;  2F0G A;  3MHB A;  2A5H A;  3BYT B;  3HZX A;  1VMC A;  1TWC B;  1FVI A;  1SMY D;  4ZYS A;  3MXN B;  1PLF A;  4BBR H;  1RD9 D;  2VB2 X;  1IBL L;  2EYP A;  2TSS A;  3OOC A;  2HQE A;  2CH4 A;  2L15 A;  1K0S A;  3CCM A;  3UDI A;  1UEB A;  3CQZ B;  2IW3 A;  1VQO A;  5I2Y A;  2MPM A;  4RAU C;  2N3S A;  2Z6K C;  3ICE A;  3HOX B;  3CAM A;  4CBV A;  4R4I A;  3TBI B;  2NN6 H;  1SJH D;  1FNW A;  2F0H A;  1YZ6 A;  3BG3 A;  4NW2 A;  1I3Q H;  1I4G A;  2EJF C;  4BBR G;  3T51 B;  1NNX A;  3SK8 A;  4FNF A;  3J80 i;  2LKV A;  2JQO A;  4M8A A;  4KN7 C;  3S1Q B;  3S2D H;  1WFQ A;  4OO1 I;  2AUK A;  1EOT A;  5A2Q L;  3J7Z C;  1TQO A;  4XXE A;  4CJ0 B;  3J81 L;  2L5T A;  3QWN A;  5LL6 S;  1BCP C;  4MNO A;  4IUR A;  4N9P A;  5K5P A;  2KA7 A;  4IFD I;  2R92 H;  2PMZ B;  2E76 C;  5L37 A;  2E2H B;  2NN6 G;  1AH9 A;  4A3B B;  4DV4 L;  3JC6 6;  2F0U A;  4JI1 L;  4WJ3 M;  4C3H H;  5C3E H;  1LTR D;  4B3S L;  4BXX H;  1E0B A;  1NMF A;  2UXD Q;  3OHX C;  4BWG B;  5E4X A;  2V1C C;  2O5I C;  2ZTD A;  3CRL C;  2F0W A;  2R92 G;  4DV7 L;  4OWW B;  1O7Y A;  1O7Z A;  3MEF A;  1E2W A;  3BVG A;  3SE0 A;  5IYC H;  1MGS A;  4YCU A;  3PUY A;  3M4Q A;  2F0E A;  3MFG A;  4M1U B;  5EGT A;  4POF A;  4A3E B;  4C3H G;  5C3E G;  1BDO A;  4BXX G;  2EYJ A;  5J22 A;  1KLG D;  2GVA A;  1EEF D;  4Y52 H;  1VQD A;  4H0L C;  1JJC B;  2IY5 B;  4EQ5 A;  2EYO A;  4WRD A;  2J4X A;  1N9W A;  2UUC L;  5IGG A;  1S40 A;  1TY0 A;  3D31 A;  3H3V C;  3NHH A;  4JI0 Q;  1BUV T;  3DM3 A;  1KAW A;  2ZJP A;  5ELN A;  4A4I A;  5I6W A;  5IYC G;  4X65 Q;  4KHV A;  5EQ0 A;  4FF2 A;  2G9H D;  2F0J A;  4DAM A;  1S5E D;  2JA8 H;  4OXP A;  4JW0 A;  1O80 A;  1BF4 A;  1BNZ A;  1KIX A;  5JEA J;  1D5X C;  4IOA A;  1EY7 A;  1TS4 A;  1I5F A;  5I9P A;  2RDG A;  2X69 A;  1W3S A;  1MBY A;  3T13 A;  2MO0 A;  2UXB L;  1FR3 A;  3HEJ A;  1EY9 A;  2AQ1 B;  2KUM A;  2N55 A;  1TS2 A;  3X3M A;  1HNW L;  1D5Z C;  1VQB A;  3VR6 A;  1S72 A;  1PMR A;  2MJ8 A;  4Y7N H;  1BBX C;  4DXG A;  1KAA A;  1X3G A;  2JA8 G;  3M9B A;  4YIJ A;  1K8M A;  1SE2 A;  1TWG H;  1XXG A;  5CV8 A;  4XQQ A;  1CQF A;  4RHS A;  4JI2 Q;  4X66 L;  4B9W A;  4NXN Q;  3HKZ B;  1FGU A;  3PF4 A;  2H4O A;  1EIG A;  1WTP A;  4DNR B;  3M85 A;  3P20 A;  4EQP A;  4IUP A;  1W6J A;  1B50 A;  1JC7 A;  1KXL A;  1IKL A;  3FHW A;  1WCM H;  2D0O A;  3GTL H;  1MI2 A;  1QNK A;  3AFQ A;  1ASZ A;  3STB C;  3S16 H;  5DNF A;  4XQN A;  2B63 B;  2B2T C;  1EWI A;  3CXC A;  1VQ4 A;  2F0M A;  4DR4 Q;  2VY3 A;  1JQY D;  3D4D A;  1TS5 A;  1LYL A;  3TDQ A;  1NAP A;  2LMC B;  4GKK L;  4A93 H;  1PTO H;  3K6O A;  4LF6 Q;  1WCM G;  4UY8 C;  1EZ8 A;  4EQN A;  1C48 A;  5FLM H;  1GOZ A;  4GNX B;  3A74 A;  3PUW A;  2DNC A;  3MEH A;  3SK6 A;  1BQQ T;  4BS9 A;  3F2U A;  2E2J H;  4B3T L;  3GTP B;  3M3Y H;  4DV1 Q;  3HOV H;  2ZJQ A;  2K03 A;  1JMC A;  1G6Z A;  5LMN L;  5E7N A;  3L9A X;  3L0O A;  5EBD A;  4A93 G;  3DHQ A;  2NVX H;  1T5E A;  4X64 Q;  4DR7 L;  4LAA A;  4K2L A;  1PFN A;  1H9R A;  5FLM G;  2XWJ B;  1ROD A;  1KRS A;  1N36 L;  1TII D;  4ULL A;  5CV6 A;  1KQS A;  2F52 A;  1EWC A;  1TVX A;  4JI3 Q;  4OEM B;  1WTW A;  1JJ2 A;  4CJ1 B;  3BU2 A;  1NUC A;  1STY A;  3V2T A;  3HOV G;  4DUZ L;  4G7H C;  4I65 A;  1OTC A;  4C1N I;  4FXD A;  5IGE A;  5BR8 L;  3MXU A;  5IT9 L;  4JI6 L;  1I3Q B;  5COY A;  1HTL D;  3OWF A;  2C5C A;  1HQR D;  2K7V A;  1MHW C;  2VZA A;  3I4O A;  1GUW A;  2ZT9 C;  3S2D B;  1B4O A;  4OWX B;  3CU7 A;  1JOQ A;  1B9M A;  1SBB B;  2HCI A;  1LT4 D;  3FRP B;  1G6P A;  1NY4 A;  1HPC A;  2A6E D;  3NK9 A;  1GUS A;  2R92 B;  5G3L F;  3TP6 A;  1ICW A;  4EX5 A;  4PMC A;  4P75 A;  2FFK B;  5C0X I;  1EYA A;  1DYQ A;  5CC4 A;  5FOB B;  3UDG A;  2YTY A;  4C3H B;  5C3E B;  2K4K A;  5AJ3 L;  2OXP A;  4OIJ A;  4CDF C;  1E22 A;  3I70 A;  3R2T A;  3CMA A;  1HA5 A;  1V8Q A;  2SOB A;  2UUB Q;  5ISR A;  1ICF B;  1N8R C;  2C35 B;  3NTH A;  3W1G A;  4DR5 Q;  1CQV A;  3EA6 A;  3A0J A;  4KD3 A;  4ABN A;  1PZI D;  1K8G A;  1EU3 A;  1IBK Q;  1JB3 A;  5E3F A;  1CFM A;  1TWA H;  1ENC A;  2MP1 A;  5I2X A;  4FF1 A;  2VNU D;  4DGZ A;  1HJP A;  3AB9 A;  3OWE B;  1PH2 A;  2NVT H;  1STN A;  1II3 A;  4JV5 Q;  1Q46 A;  1UE6 A;  2HHH Q;  3HOU H;  4KKS A;  4DV3 Q;  1DJR D;  3Q24 A;  4LNQ A;  1BCP D;  3NQT A;  1EIF A;  1V1O A;  4AYB E;  2E8G A;  2CFM A;  3Q23 A;  1TKW B;  2JA8 B;  3RN5 A;  1WTR A;  1B70 B;  1C8C A;  5C3X A;  1LTA D;  2FJ2 A;  3CCU A;  1ET9 A;  1SNO A;  2KEC A;  3PUZ A;  4FO2 A;  5NUC A;  1IBL Q;  1FNV A;  4I7Z C;  1Y14 B;  1CSP A;  2F0I A;  3PMF A;  3HOU G;  4IUQ A;  5IP9 H;  2OEO A;  4NXM L;  2K75 A;  2WAQ G;  4K14 A;  1VQA A;  1QVF A;  4Y7N B;  4H7B A;  5C0X J;  3J81 i;  4IPH A;  1STH A;  2R3Z A;  4CGY B;  4GOP A;  3U9O A;  2NBF A;  4QB4 A;  1BBW A;  1X3P A;  2WFW A;  1B3A A;  5IP9 G;  4G7O C;  1BO0 A;  2Q8T A;  5LHY 1;  4JYA L;  1X6O A;  2QDL A;  1WCM B;  2HD3 A;  2I46 A;  3ERS X;  3GTL B;  3I90 A;  4J15 A;  3S16 B;  1OXX K;  2K5N A;  2XTI A;  4DV4 Q;  1ZYR C;  2F0V A;  3FPU B;  4H13 C;  1S5B D;  3TP5 A;  3S17 H;  1YIJ A;  1JE5 A;  5ELF A;  4B3S Q;  3ONA B;  4LFB Q;  4N8F A;  4KN4 C;  1B53 A;  4YHH L;  3LWE A;  2KEE A;  1HZB A;  1B7Y B;  4XIG S;  4APV A;  4A93 B;  3BS1 A;  1SAP A;  4DV7 Q;  2K5W A;  2RKS A;  4JBW A;  2WB1 E;  3H3V H;  3GTG H;  3LGJ A;  1RHP A;  3U4Z A;  4LF7 L;  1HNZ L;  1XYI A;  3KLW A;  1IYJ B;  1YBY A;  2E2J B;  5EPJ A;  1CKN A;  2Y0S G;  3KDF A;  3PSI A;  3J80 c;  3M3Y B;  4A76 A;  2F4V L;  2NTT A;  1KHI A;  3ERO A;  1XNR Q;  2E2D C;  3Q8D A;  4J1M A;  4RCN A;  2UUC Q;  2F0O A;  2JYO A;  2CWP A;  2NVX B;  4A3M H;  5CYU A;  4K8J A;  3SXH A;  1WTX A;  2SDF A;  3STB D;  4A3I H;  1VQE A;  3QB3 A;  5EJW A;  3UDF A;  1SNC A;  2Z4I A;  4HJ5 A;  4BY7 H;  2IX1 A;  1PH9 A;  1QVC A;  2Z6K A;  3LNN A;  3J7A 5;  3ULL A;  4DR1 L;  4CDD C;  1F2Z A;  1CA5 A;  4DPG A;  3ITP A;  3RZO H;  4JCV E;  1R9T H;  3CPW A;  1SLJ A;  2CW0 C;  4R4Q A;  4A3M G;  2HT1 A;  4QJF A;  1DCZ A;  1HNW Q;  4IPG A;  4A3I G;  1PFS A;  5CV7 A;  2IWH A;  4LF4 Q;  4BY7 G;  3T4A C;  4DR2 L;  3FEW X;  4DR3 Q;  3FDT A;  1A8V A;  4AIM A;  4B9X A;  5C4J H;  1VDZ A;  1KL9 A;  1Z9F A;  5IOD A;  2Z1C A;  3OW2 A;  2HIV A;  2LS0 1;  1M90 C;  3MTS A;  1NR2 A;  4RMF A;  2EXD A;  1MKH A;  3X3N A;  1H9S B;  2CCZ A;  3KF6 B;  3J7Y W;  1GUG A;  2IHF A;  3GTM H;  1I4H A;  1C7Y A;  5ELE A;  2KCT A;  5CV5 A;  4R8I A;  1T9H A;  4YWK A;  4KTA A;  3NXW A;  1A63 A;  1L0W A;  1N32 L;  4BBS B;  3JAM E;  4JI7 L;  2OCE A;  3F2B A;  1JR0 D;  4ZCK A;  5C6A A;  1IL8 A;  4MTK A;  3VYU A;  5ELO A;  3K7U C;  4HMJ A;  3CCL A;  3A8J E;  1OXU A;  1VCI A;  2PMZ E;  3DXJ C;  1HR0 L;  4NKL A;  2CKZ B;  1VQ7 A;  2F0S A;  3RNU A;  4B3M L;  4GKK Q;  5EPL A;  5I9O A;  1EYG A;  2NVT B;  1SNQ A;  5C4Z A;  1K0R A;  3RMH A;  2DY8 A;  3HOU B;  1YNN C;  1Q7Y C;  3FKI B;  2K1B A;  1HZ9 A;  2SNS A;  3CKI B;  3R2I A;  5CV4 A;  4B3T Q;  1F2L A;  1XWE A;  3G6J B;  2NVQ H;  4G57 A;  4KY6 A;  3RLO A;  2D9U A;  3I73 A;  2PNH A;  2WAQ B;  3VR5 A;  1YNX A;  4EVO A;  1JB7 A;  1WTQ A;  3A8K E;  3H6M A;  4GOP C;  3NTK A;  1JWU D;  3WOE A;  3TP8 A;  1B2T A;  1B3Q A;  2Q8I B;  2PNR C;  3F1Z A;  1HUM A;  5C4X B;  4LUZ A;  4QF4 A;  1Z47 A;  2KEN A;  4O1N A;  1GD7 A;  4KY5 A;  3PIO 3;  1TR5 A;  4DR6 L;  1MD2 D;  3EJI A;  1M4V A;  4HMI A;  4ZKB B;  3C1F A;  4DK1 A;  1BCP B;  4DUZ Q;  4JBK A;  2NB0 A;  1IXR A;  2B8F A;  4HIK A;  1IZ6 A;  1IL2 A;  1V1P B;  3I4L A;  1FD7 D;  1YHA A;  2I07 B;  2MHV A;  1BOS A;  1STG A;  2EOT A;  2ZXR A;  2A69 C;  3H91 A;  4RGN A;  2WII B;  4LMQ D;  2E74 C;  2NYZ D;  2CQO A;  5IWA L;  5IGB A;  4H44 C;  3L3O C;  1EL0 A;  1IHZ A;  3TSS A;  4C3I H;  2OT2 A;  1LT3 D;  3S14 H;  1FYC A;  1L0X B;  4PMW A;  4OX9 Q;  3W2D A;  3S17 B;  2AWO A;  1MSH A;  5T1G A;  1OXV A;  2B2T A;  1QJO A;  5AJ3 Q;  1PDQ A;  2D2C C;  3E6Z X;  2Y0S B;  2A68 C;  1PYW D;  5JVH 3;  1X3F A;  2QA4 A;  5CBE E;  3I91 A;  4OIK A;  1GO3 E;  1YHB A;  1N34 Q;  1QG7 A;  3HKZ E;  4F87 A;  4PZ7 A;  1CHP D;  4C3I G;  4KD4 A;  3DM1 A;  4PZ6 A;  3P7J A;  4XT1 B;  5G3L D;  1FJG Q;  1E24 A;  1B9N A;  3GTG B;  3EFX D;  3LX0 A;  2ZXO A;  4A3D H;  3PUV A;  2RHS B;  3H0G H;  2LFN A;  5FJ8 H;  4TKO B;  4HAE A;  2L1B A;  4ZK9 B;  4QGU A;  2K33 A;  1KC8 C;  2H5X A;  2A19 A;  4K0K L;  2EPB A;  3KF8 A;  5JAV A;  3J80 E;  1A15 A;  1RF2 D;  2TMP A;  4A3M B;  4OGQ C;  2F0Q A;  2PYK A;  4RA8 A;  1C0A A;  1VF7 A;  2NN6 I;  4A3I B;  1E2Z A;  4QQB X;  1X3E A;  4A3D G;  3UE1 A;  4BY7 B;  3D6C A;  1ZYR D;  3DMU A;  1RL2 A;  3H0G G;  2A73 B;  5KGU A;  5FJ8 G;  4LW1 A;  1LAC A;  2EQS A;  3D0F A;  3OIP A;  4KHZ A;  2MNA A;  2Z0S A;  1EQQ A;  5JEA H;  4TSS A;  3S15 H;  3RZO B;  1R9T B;  4OO1 H;  3ND9 A;  1LTL A;  4YWL A;  5AFW A;  2DGY A;  3OIQ A;  1VQ6 A;  1BBU A;  1QUQ A;  5JJZ A;  3MFY A;  3IFD A;  4IFD H;  2VW9 A;  2NZ1 D;  1U4M A;  5HGT A;  5HGQ A;  3QOJ A;  3RZD H;  5C4J B;  4LF8 L;  3EBE A;  4HSV A;  2R61 A;  3T1Y L;  3AFP A;  4K6D A;  3S2H H;  1K3B C;  5JEA G;  2PO4 A;  2UUA L;  1X54 A;  2EY5 A;  3K5M A;  4OO1 G;  3PGZ A;  5M5X H;  1QB5 D;  1EY5 A;  5BN4 A;  1VQP A;  5E1F A;  1EQT A;  5FLX L;  2L9H A;  3QR8 A;  3GTM B;  3K57 A;  4IFD G;  2PW5 A;  3P75 A;  4E6I A;  3IRB A;  1VF5 C;  1HR0 W;  5M9O A;  1LTT D;  3G6E A;  1YEZ A;  4J6H A;  1B44 D;  2A1A A;  3C3L A;  4JI8 Q;  1MJE A;  1KDC A;  4F88 A;  1SRU A;  2EZV A;  4YHH Q;  1YJN A;  2CW0 D;  1SNM A;  2FHT A;  4DV2 L;  5JPM C;  4FXK C;  1VQH A;  2QF7 A;  1STE A;  1A3T A;  1XMO Q;  2JA7 H;  1PYB A;  4R4O A;  2EXZ A;  3I55 A;  1P8L A;  3C2P A;  1K8A C;  1HNZ Q;  2AQ3 B;  4ZQ3 A;  3J81 c;  2ZXP A;  1YIT A;  5M3M H;  1BVS A;  1ENA A;  2NVQ B;  1ZKO A;  2IT1 A;  1Y8P B;  2F4V Q;  4LUV A;  1F2M A;  2VXW A;  1LV9 A;  5LMU L;  3M4O H;  4CKC A;  2UXC L;  1VQI A;  1H9J A;  4LFA Q;  2F3I A;  2JA7 G;  4DA2 A;  3EQL C;  1ESF A;  1DOM A;  1K9M C;  4IUV A;  4DV0 Q;  5CBA E;  4ZAI A;  1NBW A;  1AEX A;  2HDM A;  4HCS A;  5M3M G;  4DNT B;  2VQE L;  2EY6 A;  3IAY A;  4F7X A;  2NVY H;  5KEE A;  3OTO Q;  4OHJ A;  3V96 A;  4DFA A;  5IGF A;  1Y69 U;  2QCP X;  4I7A A;  2ALY B;  4IUT A;  1EY4 A;  2RQX A;  4MIU A;  4GKJ L;  1HFN A;  1W2B A;  3F2C A;  5C3W A;  3SK4 A;  1YNN D;  2ASB A;  3A54 A;  3I3C A;  4DR2 Q;  3E9I A;  3TS2 A;  1PRT F;  4C3I B;  2ATW A;  2XWB B;  3S14 B;  2Q2U A;  2XN9 C;  1VQN A;  4JBJ A;  4RGT A;  3ZYY X;  1Q1E A;  4HTH A;  3HS0 C;  2OWO A;  2AQ2 B;  3N52 A;  1EWH A;  1K28 A;  2JN4 A;  3U4V A;  1SEB D;  3AQQ A;  5FO7 B;  3HOY B;  3BYY B;  4OWT B;  4DK0 A;  1N32 Q;  4JI7 Q;  1HZC A;  4UPA A;  3WOF A;  3W5O A;  4G7Z C;  1I6V C;  5A35 A;  3CC7 A;  1XNQ L;  4A3D B;  1EIY B;  5HY6 A;  4O42 A;  3H0G B;  2VQF L;  1EQV A;  4DN4 M;  5LL6 X;  1K83 H;  3RLF A;  4B3M Q;  3IFT A;  4FDB A;  5IP7 H;  4BA2 I;  3OSO A;  2L11 A;  4JK1 C;  1EY0 A;  1EFW A;  1F77 A;  2JA9 A;  2IJ0 A;  3ZJY C;  5CMD A;  4TVA B;  1A3V A;  2M2L A;  4GN3 B;  3AU7 A;  2KHS A;  2KHI A;  1XMQ L;  1ZXT A;  1IYU A;  2KBN A;  4Z9C B;  3PO2 H;  2B8G A;  4NPS A;  1QCB D;  4PQX A;  1IW7 C;  1SYF A;  2RSO A;  2EYM A;  4R1J A;  1ONL A;  5IP7 G;  3S15 B;  3E0J A;  3H09 A;  1VQL A;  3I2Z A;  2KJX A;  1LO5 D;  3T1H Q;  4GLV B;  1HZA A;  2PZW A;  4DR6 Q;  4A3J H;  2D0P A;  3NP8 A;  3PO2 G;  1X65 A;  3NWS A;  4JI5 Q;  4A3K H;  1PRT C;  1JOR A;  3JAM c;  2N8N A;  3RZD B;  3DWQ A;  1M1K C;  1XX8 A;  2QW7 A;  4BBS H;  3CW2 C;  2PI2 E;  3W3A A;  2EYL A;  1IKM A;  3S2H B;  1VQG A;  4B3R L;  2PPB C;  5FO9 B;  4OEL B;  1PH6 A;  5M5X B;  3GTQ B;  5KND A;  4PZ8 A;  2UU9 L;  4F8M A;  1D1I A;  2PQA A;  2D5D A;  3EVQ A;  1FNU A;  2NZH A;  4A3J G;  4A3K G;  3G4S A;  1EY8 A;  1I6H B;  1IBM L;  4C3J B;  4BBS G;  1N33 Q;  1ILP A;  2QDB A;  3FKI H;  2BH8 A;  3HGB A;  2R93 H;  3SVM A;  1KAB A;  5DM6 3;  4KV6 A;  1P16 A;  4O0A A;  4LFC L;  5IGD A;  1F9S A;  4DUY L;  1HRJ A;  2I5M X;  2Z4H A;  3TN2 A;  4YY3 L;  4GS3 A;  2JA7 B;  1WJJ A;  2B2V C;  5J3B A;  3NBH A;  3SEB A;  3GTJ H;  2IL8 A;  3SGI A;  5C4X H;  3BZK A;  4UAI A;  3QG1 A;  5M3M B;  5A2Q E;  2R6G A;  2RHQ B;  2N78 A;  1S5F D;  3FKI G;  3J81 E;  1B8A A;  2R93 G;  3PV0 A;  1Q90 A;  4K0K Q;  4A3L H;  2WP8 J;  1QE6 A;  1DGS A;  3M4O B;  4QIW B;  3Q6S A;  2K5V A;  5IIF A;  3VR4 A;  3GV6 A;  1U4L A;  4CHT B;  2PZU A;  4P72 A;  1AFP A;  5M5Y H;  1L1O A;  4LWC A;  1Q1B A;  4U67 3;  1AZP A;  5C4X G;  5IYD H;  1X32 A;  4FVM A;  2PI2 A;  1S5C D;  3CCQ A;  5JJI A;  1EYD A;  2NVY B;  3E3X A;  1LM0 A;  1YI2 A;  3UE0 A;  3OMG A;  2GN5 A;  4A3L G;  3PIO A;  3MZ5 A;  3BDC A;  3I4N G;  3BJU A;  1LTS D;  2WAQ E;  2CWA A;  4JC0 A;  1RJT A;  2I5L X;  2O4X A;  1G8Z D;  4JI1 Q;  2IHE A;  2B39 A;  2YTV A;  4LJZ C;  1JT8 A;  4IZ8 A;  5IYD G;  4JI4 L;  2FXQ A;  4LF8 Q;  5EKK A;  5IE8 A;  4R9W A;  5D65 A;  1WYD A;  4C1N K;  2UUA Q;  3E5S A;  3K8A A;  5GAH C;  4DAV A;  1CUK A;  4R4T A;  1EEI D;  2L0C A;  4DAY A;  3S1M H;  1PZJ D;  4BY1 B;  4KKU A;  3VR2 A;  1WTH A;  1WOC A;  5EAY A;  1E1T A;  2XIW A;  2JA6 B;  4J8Q A;  1J6Q A;  2D62 A;  4A75 A;  3BDO A;  5BN5 A;  4XYQ A;  3ULP A;  1G91 A;  1PTO F;  4QUF A;  1DOL A;  3KLS X;  1E2V A;  2B29 A;  2IX3 A;  2KQ3 A;  3TS0 A;  1SYD A;  2B2Y A;  4TRD A;  5JJK A;  4IOC A;  2LXK A;  1GVP A;  1K83 B;  1NE3 A;  4DV2 Q;  3TEH B;  1JOK A;  2V4D A;  2AWN A;  3R93 A;  1EFI D;  2Y0S E;  2UXB Q;  1TXY A;  2F0F A;  4CJ2 C;  2F4I A;  1CKM A;  1DZ1 A;  2PZT A;  4JI2 L;  1HHV A;  3PO2 B;  1Y8N B;  2BA1 A;  1Q82 C;  1UWV A;  1SJE D;  5LMU Q;  5GRO A;  2UXC Q;  2OF1 A;  4WJW A;  1FGB D;  1A6X A;  5C44 H;  4X66 Q;  2RBM A;  1A3U A;  5KRU A;  2A8V A;  1QZG A;  2K6A A;  3LWU A;  1M8A A;  2LXJ A;  4IPD A;  2VQE Q;  4NP5 A;  4A3J B;  4A3K B;  4RG1 A;  3KLR A;  1U9R A;  2ZJR A;  2BDN A;  3L2P A;  4EGV A;  2OQK A;  5C4H A;  4X62 L;  3A8I E;  5C44 G;  4LF6 L;  3HOZ H;  1Y8O B;  4OL7 A;  1SNP A;  1U0L A;  2NWG A;  3MVV A;  1X3Q A;  4GKJ Q;  2BH2 A;  3M7G A;  2B2W A;  2E75 C;  1EYC A;  4XT3 B;  1CKN B;  2BA0 A;  1AE2 A;  1ENF A;  2WKD A;  3KDF B;  1MIU A;  2AHO B;  3W1B A;  2K5Q A;  1R4Q B;  1PHJ A;  3BZD B;  4HJ8 A;  3A7A B;  1IW7 D;  2B3G A;  1PTO C;  1WI5 A;  3EIV A;  1R4P B;  1XTD A;  3HOZ G;  1UE7 A;  2N88 A;  3VA5 A;  2WAC A;  2R93 B;  4H02 A;  2QGQ A;  4NMZ A;  3KFU A;  2KCM A;  4ZLT F;  5LMN Q;  5JJL A;  5IT9 E;  4HIO A;  2RCN A;  5E4W C;  2A6H C;  4DR7 Q;  1XNQ Q;  1PRT D;  2FMC A;  2N49 A;  4XQJ A;  3A5U A;  2RF4 A;  2DUD A;  3MXN A;  3GTJ B;  2EJG C;  1L1O C;  4DXF A;  1G2S A;  1N36 Q;  1SSO A;  5KNB A;  2EDG A;  5GAD C;  3TZU A;  1KDB A;  1XPU A;  4PMB A;  2XGT A;  3BVM A;  4C56 C;  1A0I A;  1T5X D;  3I4N B;  1AE3 A;  4LF5 L;  2JA5 B;  2YYZ A;  5BR8 Q;  1A2U A;  3IL8 A;  2M00 A;  4FP5 D;  4JI6 Q;  3O13 A;  3QO2 A;  1W6K A;  3T56 B;  2K50 A;  3BZC A;  1TWF H;  2NTS A;  5JOB A;  3CCJ A;  4ODG A;  5M5Y B;  3E9H A;  2QKI C;  1UNS A;  1H9K A;  2Q2I A;  1PVO A;  4NDX A;  1U5K A;  1I4Q A;  3WWV A;  2EVB A;  1CZW A;  1HH2 P;  4P71 A;  3MA2 B;  3WDN A;  4HID A;  2Z9H A;  3P1H A;  1LTI D;  2UUB L;  2EE1 A;  4KK7 A;  4ME5 A;  5DEH A;  1G51 A;  4DR5 L;  3KBX A;  1MJC A;  4KI0 A;  1KD1 C;  4FF4 A;  1ZEQ X;  1JCK B;  2XSC A;  5I4D A;  3GD7 A;  3BDL A;  2E2I H;  3QJY A;  1UE1 A;  5BN3 A;  1IBK L;  1EZ6 A;  1Y1V H;  4GN5 A;  4C2M H;  1L0Y B;  2X6L A;  4HJ9 A;  1SRO A;  3K58 A;  3HOY H;  4HJ7 A;  1G29 1;  4IPC A;  4ZRZ A;  3K7A H;  1RKN A;  2JJQ A;  4KY7 A;  5KYL A;  5F2D A;  4JV5 L;  2UU9 Q;  1D6E C;  4MZ9 A;  3CP0 A;  4GN4 B;  4P74 A;  3S1M B;  2B2Y C;  2A6E C;  4X3S A;  4DK3 C;  3I72 A;  2YV5 A;  1ILQ A;  3ER0 A;  4K5W A;  5ELD A;  1PV4 A;  3GTK H;  1NSN S;  2E5L L;  3K80 C;  4HJA A;  1Y1V G;  1IBM Q;  3TQY A;  3ULJ A;  3HOY G;  1UAP A;  2EYF A;  3NUC A;  2K5D A;  2DNE A;  1YHQ A;  4R4C A;  1DD2 A;  4Q0F A;  3TRZ A;  2XNA C;  4LFC Q;  3AMU A;  2MFI A;  3CF5 A;  4DUY Q;  1VQF A;  4DKA C;  1PH3 A;  4YY3 Q;  2RA4 A;  1MSG A;  1TT2 A;  2C9O A;  2PCF B;  1AZQ A;  2VL6 A;  3AYH B;  1KLU D;  3HP3 A;  2K28 A;  4NXM Q;  1XTC D;  5EKI A;  4RFB A;  1TY2 A;  3D6W A;  4AQY L;  1U4P A;  2VUM B;  1STA A;  3UDX A;  2K05 A;  4UP7 A;  4K6L A;  4ID6 A;  1E3P A;  1Q86 C;  1HUN A;  5J39 A;  4X3T A;  1O7L A;  5CV9 A;  5C44 B;  4N9T A;  1OO9 B;  1PH4 A;  2NUC A;  3GTQ H;  2RDF A;  1JOO A;  3H15 A;  1VQ9 A;  2B2W C;  2X6G A;  4RWS C;  4JYA Q;  2ZTE A;  3NSW A;  1TWH H;  4LFB L;  2XVS A;  4KKT A;  3TME A;  4YWM A;  2ES2 A;  2JK8 A;  1WVL A;  5DM7 3;  1I6H H;  1DON A;  4ME3 A;  4YCW A;  3S1N H;  3HG9 A;  1LUZ A;  1HNX L;  4C3J H;  3HOW H;  3HOZ B;  2L55 A;  5M3F H;  2XRS D;  2OQ0 A;  3MXP A;  1SFO H;  1Q8I A;  4JI4 Q;  3FVQ A;  2A74 C;  1D2B A;  3GDE A;  3E0E A;  1HXY D;  1SN8 A;  3KF8 B;  3M4Y A;  2O5J C;  3FP9 A;  5FO8 B;  2F3V A;  1VQM A;  1XNR L;  2F3W A;  3NEL A;  3CRK C;  3R8B A;  3I56 A;  4GZY C;  1LT6 D;  1QWY A;  4C3J G;  2B2U A;  3CC4 A;  3NEN A;  4LF7 Q;  3HOW G;  2AKW B;  2BDO A;  2K52 A;  5M3F G;  4QUC A;  4GNX A;  4A3G H;  4LF9 L;  2F0L A;  2BE5 C;  1UUP A;  1PH7 A;  1EOV A;  4JPB W;  2FMM A;  1JWM D;  5IGC A;  2GVB A;  2B2V A;  5DAU A;  2H1E A;  1GHJ A;  1DOK A;  1GJX A;  5FKA C;  2RDH A;  1QUQ B;  3VA7 A;  1K73 C;  3PIP A;  4IFD J;  2EIF A;  4GLA C;  1V43 A;  3H94 A;  4IUN A;  4A3G G;  1A2T A;  1X56 A;  5IOC A;  1YJ9 A;  2NZO A;  4DR1 Q;  1C9O A;  5GAE C;  4LF4 L;  4DV5 L;  2K5H A;  5FLX c;  1WD0 A;  1HTP A;  4DR3 L;  3OW7 A;  4X3U A;  1TWF B;  4KHP L;  5D3D A;  2K04 A;  1S3O A;  5IYB H;  2JE6 I;  2CHB D;  3DLL A;  1U4R A;  4MHE A;  3PQI A;  2PW7 A;  2ZTC A;  1PTO D;  1PRT B;  4L6T B;  3M4P A;  1SYG A;  4CKE A;  2ICI A;  3Q22 A;  2EJM A;  3CCV A;  4L5Q A;  2KCC A;  4POG A; 
#chains in the Genus database with same CATH homology
 1I4R A;  5KNC A;  1TS3 A;  4G4K A;  2DY7 A;  1C4Q A;  5TSS A;  4HN7 A;  3BVZ A;  2A6H D;  3SDZ A;  2E2I B;  2F1M A;  1Y1V B;  2O2L D;  5D14 A;  4C2M B;  2XRQ D;  3C1E A;  4K2K A;  3URY A;  3K7A B;  1DXM A;  2F0K A;  2F0D A;  3JAM L;  2PQE A;  1ML0 D;  4EQO A;  4RH6 A;  3MAQ A;  1HQM C;  1ET6 A;  1LTG D;  3IKJ A;  3GTK B;  1S5D D;  2A69 D;  5ELB A;  1SDF A;  4BBR B;  2LY7 A;  1LLR D;  3RD4 A;  4IQZ A;  4K8I A;  3J7A V;  1PFB A;  2G9D A;  3L7Z C;  3C46 A;  1EU4 A;  2WKC A;  2MGS A;  4WOR A;  3DEP A;  5KIX A;  2A68 D;  1Z7T A;  1DM0 B;  4ZKC B;  1SND A;  1SE3 A;  3QIA A;  3PUX A;  1LT5 D;  3A7L A;  3Q0A A;  5C5M A;  4QMG A;  1SYC A;  1YNJ C;  3DEO A;  1CT1 D;  3UI2 A;  1SXT A;  1PZK D;  4CKB A;  1GUN A;  2ICE C;  1PFM A;  1RDP D;  5C0X H;  5C5L A;  2DN8 A;  5CGK A;  4DF7 A;  3CHB D;  2M9V A;  4K5V A;  1K8O A;  1HFG A;  1O78 A;  1TWH B;  2ID0 A;  5JPN C;  3K5L A;  1QNU A;  2Q8R E;  3SK5 A;  2HUG A;  3S1N B;  1WD1 A;  1F9P A;  2ENB A;  5C0X G;  3KBG A;  3HOW B;  5CR3 A;  5M3F B;  2B2U C;  5EBC A;  2BOS A;  2JP1 A;  2EY1 A;  1SFO B;  1BXT A;  4U68 A;  1QOH A;  3A55 A;  3DWA A;  4V19 0;  4XYO A;  3GV3 A;  1H9M A;  3PIP 3;  3T16 A;  1KTK A;  3DWP A;  1WTV A;  5EPK A;  3T53 B;  4KMU C;  4HED A;  3OPO A;  4A3G B;  2HCC A;  3KUP A;  4HCE A;  3FMC A;  3GO5 A;  3R3O A;  2Z8L A;  3J80 L;  2CVR A;  2F03 A;  4IAL A;  1EIH A;  4R8N A;  1SMY C;  3VYT A;  1GUT A;  2KED A;  3VYS A;  3K0Y A;  4XDX A;  1SYE A;  1F2Y A;  1CZG A;  1RTO A;  4ZUJ A;  3K5O A;  3A56 A;  1TWG B;  2SEB D;  5COR A;  5ELC A;  5FLX E;  3NBI A;  4Q5V A;  1GHK A;  1J8I A;  2L12 A;  1NCV A;  4IN3 A;  4L8J A;  2BE5 D;  4RGO S;  3GP7 A;  4FYD A;  2KVM A;  1CM9 A;  4IUU A;  4FXG C;  4B08 A;  1JIC A;  1QIL A;  1Z6H A;  3MXG A;  1SE4 A;  3VYR A;  2FIN B;  1H9S A;  2L4N A;  4RCO A;  1CA6 A;  1S4Z A;  1F9Q A;  3GTO B;  3HRZ C;  1I4X A;  1PTO B;  1OXT A;  3NWT A;  4RGM A;  3I4M B;  1RTN A;  4RHR A;  2VB3 X;  1LTB D;  3V05 A;  1Q3L A;  1I4P A;  2IPK D;  1F9R A;  1CI3 M;  2WV6 D;  1GUO A;  2K32 A;  4DU9 A;  1JWS D;  3NQI A;  2JEA I;  2CQA A;  3HOV B;  2RVL A;  3U9S A;  4PV1 C;  2R7Z B;  1PXU A;  3ND8 A;  1RCV D;  3RUZ A;  1HA6 A;  1J9O A;  3D3R A;  2KOL A;  3SR1 A;  3K5N A;  1IYV A;  1GXD C;  3NPP A;  4MN3 A;  4L63 B;  1CK1 A;  3D4W A;  4BA1 I;  4XTC S;  3KK7 A;  3FPP A;  2RSN A;  3S9W A;  1JE4 A;  2J7Z A;  1CHQ D;  3G7L A;  2BCO A;  3K59 A;  5J1Z A;  2EY2 A;  3OMC A;  4UDU C;  3M7N A;  3D8G A;  1ESR A;  4AYB B;  2QIL A;  3VR3 A;  3KLS A;  4WFN 3;  2K01 A;  4TQU S;  3J7A F;  1V1P A;  2HDL A;  2JSO A;  4ILW A;  3S1R B;  2AUJ D;  5EKL A;  3I8Z A;  4P2C B;  1UEA B;  1HCZ A;  4HSP A;  4A3F B;  4X3K A;  1CTM A;  4RKB A;  4PNY A;  2F0P A;  1TU2 B;  2QEJ C;  2J0T D;  4QCL A;  3ERQ A;  5D3I B;  1TWA B;  4KJO A;  3QOL A;  3SHL A;  1YNJ D;  2JEB I;  3DUZ A;  5M5W B;  5I6Y A;  3PO3 B;  1AN8 A;  2EYH A;  4LK1 C;  1AP0 A;  2GA4 B;  3MC0 B;  1G2T A;  1Y1W B;  1OXS C;  2F0T A;  5T1I A;  1VMP A;  1D1K A;  2YU9 B;  4KJN A;  1LAB A;  2IX0 A;  2KCN A;  1D5M C;  5HUR A;  1KDA A;  3NE5 B;  5K36 H;  1KNE A;  1AW7 A;  4HR7 B;  1NR4 A;  2WB1 B;  4ZUI A;  3TZD A;  2SNM A;  2MUY A;  5FK9 C;  1WTO A;  4K5X A;  1Q12 A;  1STB A;  1BCP F;  3TP7 A;  1I50 B;  1KNA A;  5K36 G;  5KYI A;  4V0B A;  2F0N A;  2JXM B;  3N6R A;  4RKL A;  3D4R A;  3MWY W;  1EY6 A;  2WIN B;  5JVG 3;  3NTI A;  1SYB A;  4S3S A;  3GQB A;  1BR9 A;  1B1Z A;  4DAP A;  4FF3 A;  2F0G A;  3MHB A;  2A5H A;  3BYT B;  3HZX A;  1VMC A;  1TWC B;  1SMY D;  4ZYS A;  1PLF A;  1RD9 D;  2VB2 X;  2EYP A;  2TSS A;  3OOC A;  2HQE A;  3CQZ B;  2IW3 A;  5I2Y A;  2MPM A;  4RAU C;  3HOX B;  4CBV A;  3TBI B;  2NN6 H;  1SJH D;  1FNW A;  2F0H A;  3BG3 A;  4NW2 A;  1I4G A;  2EJF C;  3T51 B;  3SK8 A;  4FNF A;  2LKV A;  4M8A A;  4KN7 C;  3S1Q B;  4OO1 I;  2AUK A;  1EOT A;  5A2Q L;  1TQO A;  4XXE A;  4CJ0 B;  3J81 L;  2L5T A;  3QWN A;  5LL6 S;  1BCP C;  4IUR A;  4N9P A;  5K5P A;  2KA7 A;  4IFD I;  2PMZ B;  2E76 C;  2E2H B;  2NN6 G;  4A3B B;  2F0U A;  1LTR D;  1E0B A;  3OHX C;  4BWG B;  5E4X A;  2O5I C;  3CRL C;  2F0W A;  1O7Y A;  1O7Z A;  1E2W A;  3BVG A;  3SE0 A;  1MGS A;  3PUY A;  2F0E A;  3MFG A;  4M1U B;  5EGT A;  4A3E B;  4C3H G;  1BDO A;  2EYJ A;  5J22 A;  1KLG D;  1EEF D;  4H0L C;  2EYO A;  4WRD A;  2J4X A;  5IGG A;  1TY0 A;  3D31 A;  3H3V C;  3NHH A;  1BUV T;  5I6W A;  4KHV A;  5EQ0 A;  4FF2 A;  2G9H D;  2F0J A;  1S5E D;  1O80 A;  1BF4 A;  1BNZ A;  5JEA J;  1D5X C;  1EY7 A;  1TS4 A;  5I9P A;  2RDG A;  2X69 A;  1MBY A;  3T13 A;  1FR3 A;  3HEJ A;  1EY9 A;  2AQ1 B;  2KUM A;  2N55 A;  1TS2 A;  3X3M A;  1D5Z C;  3VR6 A;  1PMR A;  2MJ8 A;  1BBX C;  4DXG A;  1KAA A;  4YIJ A;  1K8M A;  1SE2 A;  1XXG A;  5CV8 A;  4XQQ A;  1CQF A;  4RHS A;  4B9W A;  3HKZ B;  2H4O A;  1EIG A;  1WTP A;  4DNR B;  3M85 A;  3P20 A;  4EQP A;  4IUP A;  1W6J A;  1B50 A;  1JC7 A;  1IKL A;  1MI2 A;  1QNK A;  5DNF A;  4XQN A;  2B63 B;  2B2T C;  2F0M A;  1JQY D;  3D4D A;  1TS5 A;  3TDQ A;  1NAP A;  2LMC B;  1PTO H;  3K6O A;  1EZ8 A;  4EQN A;  1C48 A;  1GOZ A;  3PUW A;  2DNC A;  3MEH A;  3SK6 A;  1BQQ T;  4BS9 A;  3F2U A;  3GTP B;  2K03 A;  1G6Z A;  3L9A X;  5EBD A;  3DHQ A;  1T5E A;  4LAA A;  4K2L A;  1PFN A;  1H9R A;  2XWJ B;  1ROD A;  1TII D;  4ULL A;  5CV6 A;  1EWC A;  1TVX A;  1WTW A;  4CJ1 B;  1NUC A;  1STY A;  3V2T A;  4G7H C;  4I65 A;  4FXD A;  4C1N I;  5IGE A;  3MXU A;  5IT9 L;  1I3Q B;  5COY A;  1HTL D;  3OWF A;  2C5C A;  1HQR D;  2K7V A;  1GUW A;  2ZT9 C;  3S2D B;  1B4O A;  3CU7 A;  1JOQ A;  1B9M A;  1SBB B;  2HCI A;  1LT4 D;  3FRP B;  1HPC A;  2A6E D;  3NK9 A;  1GUS A;  2R92 B;  5G3L F;  3TP6 A;  1ICW A;  4PMC A;  2FFK B;  5C0X I;  1EYA A;  1DYQ A;  5CC4 A;  5FOB B;  4C3H B;  5C3E B;  2OXP A;  4OIJ A;  3I70 A;  3R2T A;  1HA5 A;  1V8Q A;  2SOB A;  5ISR A;  3NTH A;  1CQV A;  3EA6 A;  4KD3 A;  4ABN A;  1PZI D;  1EU3 A;  1JB3 A;  5E3F A;  1CFM A;  1ENC A;  2MP1 A;  5I2X A;  4FF1 A;  2VNU D;  4DGZ A;  3AB9 A;  3OWE B;  1STN A;  1II3 A;  4KKS A;  1DJR D;  3Q24 A;  1BCP D;  3NQT A;  1V1O A;  3Q23 A;  1TKW B;  2JA8 B;  1WTR A;  1C8C A;  5C3X A;  1LTA D;  2FJ2 A;  1ET9 A;  1SNO A;  2KEC A;  3PUZ A;  4FO2 A;  5NUC A;  1FNV A;  4I7Z C;  2F0I A;  3PMF A;  4IUQ A;  2OEO A;  4K14 A;  4Y7N B;  4H7B A;  5C0X J;  1STH A;  2R3Z A;  4CGY B;  3U9O A;  2NBF A;  4QB4 A;  1X3P A;  1B3A A;  4G7O C;  1BO0 A;  2Q8T A;  5LHY 1;  1WCM B;  2I46 A;  3GTL B;  3I90 A;  3S16 B;  1OXX K;  1ZYR C;  2F0V A;  3FPU B;  4H13 C;  1S5B D;  3TP5 A;  5ELF A;  3ONA B;  4KN4 C;  1B53 A;  3LWE A;  2KEE A;  4XIG S;  4A93 B;  3BS1 A;  1SAP A;  2K5W A;  2RKS A;  4JBW A;  1RHP A;  1XYI A;  2E2J B;  5EPJ A;  3M3Y B;  2NTT A;  3ERO A;  2E2D C;  4J1M A;  4RCN A;  2F0O A;  2JYO A;  2NVX B;  5CYU A;  4K8J A;  3SXH A;  1WTX A;  2SDF A;  3QB3 A;  5EJW A;  1SNC A;  2Z4I A;  2IX1 A;  3LNN A;  1F2Z A;  1CA5 A;  3ITP A;  2CW0 C;  1DCZ A;  5CV7 A;  2IWH A;  3T4A C;  3FEW X;  3FDT A;  4B9X A;  1VDZ A;  5IOD A;  2Z1C A;  2LS0 1;  3MTS A;  1NR2 A;  3X3N A;  1H9S B;  3J7Y W;  1GUG A;  1I4H A;  5ELE A;  4R8I A;  5CV5 A;  4KTA A;  3NXW A;  4BBS B;  3JAM E;  1JR0 D;  5C6A A;  1IL8 A;  3VYU A;  4HMJ A;  3A8J E;  1OXU A;  1VCI A;  3DXJ C;  4NKL A;  2F0S A;  5EPL A;  5I9O A;  2NVT B;  1SNQ A;  5C4Z A;  3RMH A;  2DY8 A;  3HOU B;  1YNN C;  3FKI B;  2K1B A;  5CV4 A;  2SNS A;  3CKI B;  3R2I A;  1F2L A;  1XWE A;  3G6J B;  4G57 A;  4KY6 A;  2D9U A;  3I73 A;  2WAQ B;  3VR5 A;  4EVO A;  1WTQ A;  3A8K E;  3H6M A;  3NTK A;  1JWU D;  3WOE A;  3TP8 A;  1B2T A;  2Q8I B;  2PNR C;  1HUM A;  5C4X B;  4QF4 A;  1Z47 A;  4O1N A;  4KY5 A;  3PIO 3;  1TR5 A;  1MD2 D;  3EJI A;  1M4V A;  4HMI A;  4ZKB B;  3C1F A;  4DK1 A;  1BCP B;  2NB0 A;  2B8F A;  1V1P B;  3I4L A;  1FD7 D;  2I07 B;  2MHV A;  1BOS A;  1STG A;  2EOT A;  2ZXR A;  2A69 C;  3H91 A;  4RGN A;  2WII B;  4LMQ D;  2E74 C;  2NYZ D;  5IGB A;  4H44 C;  3L3O C;  1EL0 A;  1IHZ A;  3TSS A;  2OT2 A;  1LT3 D;  1FYC A;  1L0X B;  4PMW A;  3W2D A;  3S17 B;  2AWO A;  1MSH A;  5T1G A;  1OXV A;  2B2T A;  1QJO A;  1PDQ A;  2D2C C;  3E6Z X;  2Y0S B;  2A68 C;  1PYW D;  5JVH 3;  5CBE E;  3I91 A;  4OIK A;  1QG7 A;  4F87 A;  1CHP D;  4C3I G;  4KD4 A;  3DM1 A;  3P7J A;  4XT1 B;  5G3L D;  1B9N A;  3GTG B;  3EFX D;  3LX0 A;  2ZXO A;  3PUV A;  2LFN A;  4TKO B;  4HAE A;  2L1B A;  4ZK9 B;  2K33 A;  2EPB A;  3KF8 A;  5JAV A;  3J80 E;  1A15 A;  1RF2 D;  2TMP A;  4A3M B;  4OGQ C;  2F0Q A;  2PYK A;  4RA8 A;  1VF7 A;  2NN6 I;  4A3I B;  1E2Z A;  4BY7 B;  3D6C A;  1ZYR D;  3DMU A;  2A73 B;  5KGU A;  1LAC A;  3OIP A;  4KHZ A;  5JEA H;  4TSS A;  3RZO B;  1R9T B;  4OO1 H;  3ND9 A;  5AFW A;  3OIQ A;  5JJZ A;  3MFY A;  3IFD A;  4IFD H;  2NZ1 D;  1U4M A;  5HGT A;  3QOJ A;  5C4J B;  4HSV A;  2R61 A;  4K6D A;  5JEA G;  2PO4 A;  2EY5 A;  3K5M A;  4OO1 G;  1QB5 D;  1EY5 A;  5BN4 A;  5E1F A;  1EQT A;  5FLX L;  2L9H A;  3GTM B;  3K57 A;  4IFD G;  2PW5 A;  3P75 A;  4E6I A;  1VF5 C;  5M9O A;  1LTT D;  4J6H A;  1B44 D;  3C3L A;  1KDC A;  4F88 A;  2EZV A;  2CW0 D;  1SNM A;  2FHT A;  5JPM C;  4FXK C;  2QF7 A;  1STE A;  1A3T A;  2EXZ A;  3C2P A;  2AQ3 B;  4ZQ3 A;  2ZXP A;  1ENA A;  2NVQ B;  1ZKO A;  2IT1 A;  1Y8P B;  1F2M A;  2VXW A;  1LV9 A;  4CKC A;  1H9J A;  4DA2 A;  3EQL C;  1ESF A;  1DOM A;  4IUV A;  5CBA E;  4ZAI A;  1AEX A;  2HDM A;  4HCS A;  4DNT B;  2EY6 A;  3IAY A;  4F7X A;  5KEE A;  4OHJ A;  3V96 A;  4DFA A;  5IGF A;  1Y69 U;  2QCP X;  4IUT A;  1EY4 A;  2RQX A;  4MIU A;  1HFN A;  5C3W A;  3SK4 A;  1YNN D;  3A54 A;  3I3C A;  1PRT F;  4C3I B;  2XWB B;  3S14 B;  2XN9 C;  4RGT A;  3ZYY X;  1Q1E A;  4HTH A;  3HS0 C;  2AQ2 B;  3N52 A;  1EWH A;  1SEB D;  5FO7 B;  3HOY B;  3BYY B;  4DK0 A;  3WOF A;  4G7Z C;  1I6V C;  5A35 A;  4A3D B;  4O42 A;  3H0G B;  1EQV A;  4DN4 M;  5LL6 X;  3RLF A;  3IFT A;  4BA2 I;  3OSO A;  2L11 A;  4JK1 C;  1EY0 A;  1F77 A;  2IJ0 A;  5CMD A;  1A3V A;  2M2L A;  3AU7 A;  2KHS A;  1ZXT A;  1IYU A;  4Z9C B;  2B8G A;  1QCB D;  4PQX A;  1IW7 C;  1SYF A;  2RSO A;  2EYM A;  1ONL A;  3S15 B;  3E0J A;  3H09 A;  2KJX A;  1LO5 D;  2PZW A;  3NP8 A;  3NWS A;  1PRT C;  1JOR A;  3RZD B;  3DWQ A;  1XX8 A;  3W3A A;  2EYL A;  1IKM A;  3S2H B;  2PPB C;  5FO9 B;  5M5X B;  3GTQ B;  5KND A;  4F8M A;  1D1I A;  2D5D A;  3EVQ A;  1FNU A;  1EY8 A;  1I6H B;  4C3J B;  1ILP A;  2QDB A;  3HGB A;  3SVM A;  1KAB A;  5DM6 3;  4KV6 A;  5IGD A;  1F9S A;  1HRJ A;  2Z4H A;  3TN2 A;  2JA7 B;  2B2V C;  3NBH A;  3SEB A;  2IL8 A;  4UAI A;  3QG1 A;  5M3M B;  5A2Q E;  2R6G A;  1S5F D;  3J81 E;  3PV0 A;  1Q90 A;  2WP8 J;  1QE6 A;  3M4O B;  4QIW B;  3Q6S A;  5IIF A;  3VR4 A;  3GV6 A;  1U4L A;  4CHT B;  2PZU A;  1AFP A;  1Q1B A;  4U67 3;  1AZP A;  1X32 A;  4FVM A;  1S5C D;  1EYD A;  2NVY B;  3OMG A;  3MZ5 A;  3BDC A;  1LTS D;  1RJT A;  2O4X A;  1G8Z D;  2B39 A;  4LJZ C;  4IZ8 A;  5EKK A;  4R9W A;  5D65 A;  4C1N K;  3E5S A;  4DAV A;  1EEI D;  2L0C A;  4DAY A;  1PZJ D;  4BY1 B;  4KKU A;  3VR2 A;  2XIW A;  2JA6 B;  4J8Q A;  2D62 A;  3BDO A;  5BN5 A;  4XYQ A;  1G91 A;  1PTO F;  4QUF A;  1DOL A;  3KLS X;  1E2V A;  2IX3 A;  2KQ3 A;  1SYD A;  2B2Y A;  4TRD A;  1K83 B;  1JOK A;  2V4D A;  2AWN A;  3R93 A;  1EFI D;  2F0F A;  4CJ2 C;  2F4I A;  1DZ1 A;  2PZT A;  1HHV A;  3PO2 B;  1Y8N B;  2BA1 A;  1SJE D;  2OF1 A;  4WJW A;  1FGB D;  1A6X A;  2RBM A;  1A3U A;  5KRU A;  2K6A A;  3LWU A;  1M8A A;  4A3J B;  4NP5 A;  4A3K B;  3KLR A;  1U9R A;  2BDN A;  4EGV A;  5C4H A;  3A8I E;  1Y8O B;  4OL7 A;  1SNP A;  3MVV A;  2NWG A;  1X3Q A;  3M7G A;  2B2W A;  2E75 C;  1EYC A;  4XT3 B;  2BA0 A;  1ENF A;  2WKD A;  2K5Q A;  1R4Q B;  3BZD B;  3A7A B;  1IW7 D;  1PTO C;  1R4P B;  2N88 A;  3VA5 A;  2WAC A;  2R93 B;  4NMZ A;  4ZLT F;  5IT9 E;  5E4W C;  2A6H C;  1PRT D;  2FMC A;  4XQJ A;  3MXN A;  3GTJ B;  2EJG C;  4DXF A;  1G2S A;  1SSO A;  5KNB A;  2EDG A;  3TZU A;  1KDB A;  4PMB A;  3BVM A;  4C56 C;  1T5X D;  3I4N B;  2JA5 B;  2YYZ A;  1A2U A;  3IL8 A;  2M00 A;  4FP5 D;  3O13 A;  3QO2 A;  1W6K A;  3T56 B;  2NTS A;  5JOB A;  4ODG A;  5M5Y B;  2QKI C;  1UNS A;  1H9K A;  4NDX A;  1I4Q A;  2EVB A;  1CZW A;  3WDN A;  3MA2 B;  3P1H A;  1LTI D;  2EE1 A;  4KK7 A;  4ME5 A;  5DEH A;  3KBX A;  4KI0 A;  4FF4 A;  1ZEQ X;  1JCK B;  2XSC A;  5I4D A;  3GD7 A;  3BDL A;  3QJY A;  5BN3 A;  1EZ6 A;  1L0Y B;  2X6L A;  3K58 A;  1G29 1;  4ZRZ A;  1RKN A;  4KY7 A;  5KYL A;  5F2D A;  1D6E C;  3S1M B;  2B2Y C;  2A6E C;  4X3S A;  3I72 A;  1ILQ A;  4K5W A;  5ELD A;  1NSN S;  1UAP A;  2EYF A;  3NUC A;  2K5D A;  2DNE A;  1DD2 A;  4Q0F A;  2XNA C;  3AMU A;  2RA4 A;  1MSG A;  1TT2 A;  2C9O A;  2PCF B;  1AZQ A;  1KLU D;  3HP3 A;  2K28 A;  1XTC D;  5EKI A;  4RFB A;  1TY2 A;  3D6W A;  1U4P A;  2VUM B;  1STA A;  2K05 A;  4K6L A;  4ID6 A;  1HUN A;  5J39 A;  4X3T A;  1O7L A;  5CV9 A;  5C44 B;  4N9T A;  1OO9 B;  2NUC A;  2RDF A;  1JOO A;  2B2W C;  2X6G A;  4RWS C;  3NSW A;  2XVS A;  4KKT A;  3TME A;  1WVL A;  5DM7 3;  1DON A;  3HG9 A;  3HOZ B;  2L55 A;  2XRS D;  3MXP A;  1Q8I A;  3FVQ A;  2A74 C;  1D2B A;  1HXY D;  3M4Y A;  2O5J C;  5FO8 B;  2F3V A;  2F3W A;  3CRK C;  3R8B A;  4GZY C;  1LT6 D;  1QWY A;  4C3J G;  2B2U A;  2BDO A;  4QUC A;  2F0L A;  2BE5 C;  1UUP A;  2FMM A;  1JWM D;  5IGC A;  2B2V A;  5DAU A;  2H1E A;  1GHJ A;  1DOK A;  1GJX A;  5FKA C;  2RDH A;  3VA7 A;  4IFD J;  1V43 A;  3H94 A;  4IUN A;  1A2T A;  5IOC A;  1WD0 A;  1HTP A;  3OW7 A;  4X3U A;  1TWF B;  5D3D A;  2K04 A;  2JE6 I;  2CHB D;  1U4R A;  4MHE A;  2PW7 A;  1PTO D;  1PRT B;  4L6T B;  1SYG A;  4CKE A;  2ICI A;  3Q22 A;  2EJM A;  2KCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...