5CV5A

Crystal structure of staphylococcal nuclease variant delta+phs k64g/v66k/e67g at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKGMKGNAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS K64G/V66K/E67G at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv5A00
3NUCA 3D8GA 1EQVA 1F2ZA 3P75A 3QOLA 3DHQA 4J6HA 4ODGA 5E3FA 5J1ZA 5I9PA 2ENBA 5K5PA 5JOBA 5C3XA 3SR1A 1A3VA 1KDCA 2OEOA 4K2KA 4K6DA 2F0NA 5F2DA 5KYIA 5KIXA 2EYLA 4HTHA 4KY6A 4NMZA 1II3A 2F0KA 2F3WA 4RKLA 3OSOA 3V2TA 5KYLA 5J39A 1SYDA 4PMBA 5C5LA 3LX0A 2NUCA 3SXHA 1JOOA 3P1HA 5IODA 4ZUJA 3TMEA 3TP5A 1STNA 2F0EA 4PMCA 5C3WA 1SNCA 4KJOA 1F2YA 5CR3A 3NXWA 2EYPA 3EROA 3MXPA 2SOBA 3R3OA 4KD3A 2EYHA 2F0FA 4EQNA 5EKKA 5IGFA 2SNMA 1STAA 5KRUA 1EY7A 4K14A 1EY0A 1KABA 4ZQ3A 4K5WA 5DAUA 4DFAA 2EYMA 1ENAA 4F7XA 2F0OA 1A2UA 4N9PA 5C4ZA 1JORA 2F0PA 3SK8A 4KY7A 2F0SA 3SHLA 4K8IA 3TP8A 4DGZA 3TP6A 5CGKA 3U9OA 5CV5A 3MHBA 2F0IA 3D6CA 5DEHA 3T16A 5IGCA 1KDBA 4IALA 3ERQA 3SK4A 3OMCA 3H6MA 4K8JA 1TR5A 1STHA 3C1EA 4K5XA 2PQEA 1SYEA 5EKLA 4EQPA 5HURA 3MVVA 4HMJA 1JOKA 4KJNA 4WORA 4QB4A 5M9OA 3MEHA 5ISRA 4EVOA 2SNSA 2F3VA 3QB3A 3D4DA 5E1FA 2EY1A 2F0TA 3HZXA 1U9RA 3TP7A 3EJIA 1EY6A 3SK6A 2EYJA 2EY2A 4G57A 4HMIA 3EVQA 2KHSA 4B9WA 4F8MA 1JOQA 2EXZA 2O4XA 5HGTA 1A3TA 3NP8A 1EYCA 2F0UA 1SNMA 2PW5A 4NKLA 5IGGA 4ZUIA 5I6WA 1TT2A 5IGBA 4KHVA 5IIFA 2RDFA 1EZ6A 2KQ3A 4NDXA 5KGUA 4KD4A 5CV4A 2QDBA 2LKVA 1EY8A 1SNQA 4QF4A 5C4HA 3C1FA 2F0LA 2WACA 1RKNA 1STYA 1STBA 2F0GA 1F2MA 1SNOA 4K5VA 4OL7A 4KTAA 1EY9A 5CV8A 1TQOA 3OWFA 2M00A 5NUCA 3HEJA 4H7BA 5CV7A 5I6YA 3PMFA 4N9TA 1SYGA 3BDLA 3E5SA 4PNYA 4B9XA 3S9WA 1EY4A 2EYOA 1SYFA 4IZ8A 2F0JA 2F0HA 1SYCA 4QMGA 5CV6A 4EQOA 4NP5A 4DF7A 1NSNS 4YIJA 1ENCA 4I65A 2OF1A 2OXPA 2EY5A 2EY6A 1IHZA 4TRDA 2F0MA 2PZUA 2HQEA 3BDCA 4J1MA 5CC4A 1KDAA 2PZTA 3D4WA 2F0WA 1SNDA 5KEEA 1A3UA 2F0VA 4ME5A 4KV6A 4LAAA 5IGEA 1A2TA 1EY5A 3NHHA 3DMUA 1KAAA 3OMGA 4ID6A 4R8NA 2F0DA 5EGTA 5I9OA 1EZ8A 5IGDA 1STGA 1EYAA 1NUCA 4IUNA 1SNPA 5J22A 2F0QA 3QOJA 1SYBA 4MIUA 3VA5A 3NK9A 1AEXA 5C5MA 2RBMA 5C6AA 3NQTA 3MZ5A 4WRDA 4DU9A 4RKBA 2RKSA 4K2LA 5IOCA 3SK5A 5JAVA 3T13A 4E6IA 1EYDA 5CV9A 2PYKA 3ITPA 4S3SA 4KY5A 2PW7A 2EYFA 2PZWA 3RUZA
chains in the Genus database with same CATH superfamily
1VQPA 3NWTA 1HNWL 1F2ZA 4RCOA 1HCZA 1PYSB 5JJIA 5C44H 2ZXRA 2JA6G 2B2UC 1GUGA 4KHZA 1N36L 2F3WA 1YHAA 1EIFA 3NTIA 1TWHB 2KJXA 4LF4L 2Z6BA 1FYCA 4CHTB 1GD7A 5CBEE 4GNXC 2L1BA 1RIPA 4PMCA 2ZTDA 5CR3A 4BY1B 2Z6KC 1VQ6A 2EYHA 4EQNA 2BE5C 2ES2A 5BR8Q 3H15A 4JI6Q 3ULLA 3CMAA 3IRBA 4ZQ3A 2DNCA 3CRKC 4JI1Q 1EFWA 4LFCL 3DWQA 3ND9A 2F0PA 4G7HC 3PIPA 2I46A 1B1ZA 3U9OA 3UDGA 1VQDA 4G7OC 4XYQA 4BXXH 1NJIC 5IWAL 2XRSD 3SK4A 3S2HB 2BDNA 2MUYA 4K8JA 3T56B 4RGNA 4AYBB 5IYBG 1D5XC 2CQAA 2PQEA 3RLFA 2H4OA 1I4HA 3I91A 4JBWA 2VQFL 2GVBA 2L4NA 1QCBD 1VQ8A 1WYDA 2F3VA 3QB3A 1PRTC 3S1RB 1ET6A 4A3IG 2E2IH 2VB3X 3JC66 5E4WC 2JA7G 1DD2A 4L6TB 3PF5A 4DK1A 2E2HH 2UXBL 2Z1CA 1A3TA 2AWOA 3RZOH 1V9PA 1EZ6A 5C0XH 1T9HA 1VQKA 1X3PA 4BY7G 4IO9A 3T53B 2UXCQ 1MSGA 1B50A 5I4DA 3S1NB 3CPFA 4QIWE 1RDPD 4UY8C 3S1MB 2JA8H 3HOVB 3K58A 4C3HG 4U673 3GTPH 5M5XB 4M1UB 3K0YA 4C3JB 4IZ8A 1G51A 4A3MB 1QOHA 2K04A 3EIVA 5EPKA 4UPAA 1I4XA 3I4LA 2RDHA 2EY6A 4LJZC 3D4WA 1E2VA 4N8FA 1A3UA 3TN2A 1A2TA 3OMGA 2XTIA 4NXNQ 1H95A 3GTMH 3DWPA 4KKTA 4XQJA 4IOAA 3URYA 4PMWA 5C6AA 2AMCB 4A3CG 4DNIA 1X3EA 1RODA 3MAQA 3HOYB 3ITPA 3K81C 1KC8C 2RDGA 1B9NA 1CHQD 4DV4Q 5I9PA 3K5OA 1G2TA 5EAYA 2AWNA 4DUZL 4I7ZC 4XYOA 1VQ7A 3CCLA 2A68D 2E5LQ 1HRJA 4A3GB 2LMCB 3GD7A 2K5QA 1C7YA 1JOOA 1Q1EA 4ZUJA 3KOJA 2I5HA 1EOTA 2UU9L 1RHPA 2B3GA 3W3AA 3M4YA 1GKHA 2D5DA 4GS3A 1DYQA 3FEWX 1TWAH 3QO2A 3I70A 2K6AA 4RFBA 1AZQA 1C48A 3CQZH 1RF2D 2R93B 4IPDA 2NVQH 3ERQA 2UUAL 1QUQB 1N34L 4L5RC 2A6EC 4DV7L 4K5XA 3CCJA 1QNKA 2PI2E 3J80E 1A8VA 4A4IA 1JT8A 4EX5A 3T1YL 1HNZQ 4QQBX 3D4DA 2NN6H 5M5WH 1I6HH 4ILWA 1B9MA 2B63B 2F4VL 4HMIA 4F8MA 4A3EG 3FPUB 2KCNA 2DY8A 1PH3A 2RQXA 1TWGB 2VUMG 4O1NA 5IIFA 4DV5L 2ASBA 4WJ3M 3TEHB 5C4HA 3VA7A 1BBUA 3C1FA 3P7JA 1KIXA 5DM73 3HEJA 5CV7A 4X66L 2FJ2A 4TSSA 2YYZA 1KQSA 3HOXH 1V43A 4RGTA 1SYFA 3LWUA 3AFQA 1SYCA 5CV6A 3F8TA 3S14H 1NSNS 3H0GB 3VYTA 4I65A 1XWEA 2K1BA 1S72A 2XWJB 1EOVA 2F0MA 1OXTA 3L2PA 5M3FB 4LAAA 2LFNA 3DMUA 5IGDA 2F0DA 1EIHA 1FGUA 1Y1VG 1HQMC 3DEPA 3BG3A 5M3MG 5J22A 3KF8B 1GO3E 1WI5A 1K83H 5C5MA 2UUCQ 3PSIA 4FO2A 1O78A 1PVOA 1ICFB 4X3SA 3UE1A 1R4PB 1SJHD 3GP7A 4DR6Q 4ODGA 2NTSA 3K7AB 4JV5L 5M5YH 4K6DA 2EYLA 1PH1A 2EJMA 3FDTA 1HR0W 1PH9A 2A8VA 4P75A 3LX0A 4RWSC 4LK1C 2RCFA 1EU3A 1F2YA 2B2VA 3CC4A 2EYPA 1BBXC 5KRUA 1XTCD 4R4TA 3QJYA 2PQAB 3GTGH 3PUXA 5JJZA 1JB7A 4O2DA 4X3TA 4DR1L 4LF4Q 4LWCA 1B8AA 2UUBL 5JPNC 3S15B 4R9WA 2XIWA 5EBCA 1N33L 1Y1WB 4X64L 2QDLA 2E2DC 1X32A 1ET9A 3OTOL 1FNWA 1GUOA 3HKZE 4RGMA 2EY1A 5G3LF 2JYOA 5LL6S 1BKBA 4DR7Q 4LUZA 3SDZA 1HR0L 1EIGA 1R9TH 5ELOA 5IWAQ 1K8OA 4DV0Q 2BDOA 1MGSA 1TWHH 2A74C 3KFUA 3M3YH 2YV5A 3L3OC 2YTXA 1LLRD 1UAPA 5IP9H 1F9PA 3OWEB 5IYDH 2N88A 3E5SA 1Q7YC 4GKJQ 4JI5L 1N8RC 4MNOA 1NCVA 4R4OA 1E2ZA 2JA7B 1G91A 1Q81C 2HHHQ 4IUUA 4QJFA 5CC4A 1MSHA 4YHHQ 1Y8OB 2PZTA 2RSOA 4JI3Q 5KEEA 4H02A 3S2HH 2O5JC 2PI2A 5KNBA 2Q2HA 5IP7H 2MGSA 3WWVA 3M4PA 1EWIA 2AUKA 3KDFA 4MTKA 4DR2Q 3HKSA 4R4CA 2RSNA 2A19A 4XQQA 3S1RH 2WAQE 2BOSA 3N52A 4CKBA 1PTOC 2RKSA 2ZT9C 4OWTB 1LV9A 4C3IH 1Y69U 3MXUA 5JJLA 3A7AB 4OO1H 2DJGC 5AFWA 4OX9L 1YHBA 4JI8Q 5CBAE 2CFMA 3CC2A 3TQYA 3LGJA 1DOKA 4UP7A 3HOVH 4A3FH 4KN7C 1VQCA 1QJOA 4C3JH 4A3MH 1K0SA 4IFDJ 1HA6A 2PNHA 5EKIA 4QL5A 4XQNA 4BA2I 2K05A 1GUNA 4HSVA 4L5SA 1YNXA 2NVYB 1XNQQ 1U4PA 1TWFB 4POFA 5BR8L 2R61A 4JI6L 2D0OA 4G7ZC 4P2CB 4JI1L 3VR3A 3CCEA 2E2HB 1E1OA 4BBRH 3ND8A 3S2DH 2UU9Q 1G2SA 1JJ2A 3C46A 1SYEA 1LT3D 2CKZB 1C4QA 4MTNA 3G71A 2JA8B 3BDOA 1JOQA 1SE3A 1SR3A 1L1OB 3PIO3 1TT2A 4DV7Q 2CHBD 2KQ3A 5K36G 4PV1C 4IFDG 4AH6A 2F52A 2IL8A 2KHJA 3K5LA 1X55A 1U4RA 3LNNA 1F2MA 5CV8A 1KL9A 3RMHA 2BA0A 3PMFA 1ILPA 1LT4D 4ZCKA 3CF5A 1IL2A 1PDQA 4K6LA 1EU4A 2A1AA 1TIID 2V4DA 2R7ZH 1HTPA 3S24A 3C2PA 3BVZA 4J1MA 4P74A 3I3CA 1AH9A 3V05A 5IT9E 5IGEA 1A6XA 2XN9C 5E7NA 1DGSA 4J15A 3WDNA 3J81E 4HJAA 1SNPA 3EBEA 1HTLD 2Q8RE 3VYRA 3I4NG 2RBMA 2K5HA 3E9IA 4UP8A 4NXNL 1GHJA 1H9JA 2F1MA 2X69A 3B6YA 3H3VH 3RN5A 2JP1A 2JXMB 3QOLA 2K14A 5E3FA 3RR5A 5K5PA 1VQMA 1NMFA 4POGA 4FF1A 2PMZB 4YWMA 4DV4L 3MXGA 1TWAB 3GTJH 2J4XA 4DAPA 3F1ZA 4FXKC 3CQZB 1J6QA 1S40A 3H09A 2NVQB 3G4SA 2B2VC 2E5LL 4DR5Q 1CKNA 3JAME 3NXWA 5FKAC 1DXMA 2N55A 3PCOB 5ELCA 3QWNA 5KGUA 1TY2A 3U58A 3NENA 5M3FH 3R2TA 2JE6I 4IUPA 5ELDA 2EXDA 4HJ7A 1DOLA 4QUCA 1IYUA 3UI2A 2A73B 3EN2A 3I4MG 1LTTD 1I6HB 5CV5A 2E76C 3KF6A 1X56A 2F0IA 5LMNQ 2PO4A 5AJ3L 2B2WA 1AE3A 4B3SL 4JCVE 2LS01 1L2FA 4C56C 2NB0A 1PYWD 4HMJA 3PQIA 2K5WA 1V1QA 1I6VC 2JEBI 1X54A 4A3LH 4CGYB 1GUWA 1YNJC 1C8CA 1HNZL 4JBMA 1N33Q 1H9RA 2IX0A 1LO5D 4KD4A 1CSPA 3IAYA 2LKVA 1EY8A 3A5UA 1YEZA 3TDQA 1Z47A 2LXKA 2WP8J 1UNSA 3J7ZC 1NR2A 4KN4C 3HOUG 1K9MC 1QWYA 4U68A 1HR0Q 3D4RA 1JICA 5COYA 4EQOA 1K83B 1YI2A 4YIJA 1E24A 1H9SB 5LL6X 2A6HC 3HP3A 4ZRZA 2JA6H 4KV6A 3AMUA 3EFXD 4ID6A 3M4QA 5EBDA 1SRUA 4A93G 1EYAA 4OWXB 2K75A 4OIKA 5BN4A 5I2XA 5M5YB 1JJGA 3VA5A 4IUQA 1W6JA 3HOWG 2YTYA 3GV3A 3NBHA 1VQ5A 2HIVA 2NVTB 2QW7A 1O80A 1EUJA 4H13C 4DNTB 2UUCL 1CQVA 4P72A 4M8AA 1WTRA 2VW9A 5C3XA 5EPLA 1HZCA 4A3BG 4PQXA 4NMZA 4RKLA 5IYBH 3GTGB 3V2TA 3M85A 1WOCA 3BZKA 3RNUA 3SXHA 1IZ6A 2Y0SE 1N32Q 4QCLA 3VDYA 3ER0A 4A3IH 2JA7H 3G48A 4DK0A 4K14A 1EL0A 5KNDA 2ZM6L 1CA5A 3P20A 4LF8L 2QGQA 3BU2A 4BY7H 3E0JA 1R9TB 1CSQA 2IY5B 1LTBD 1IBLQ 3FVQA 3M3YB 1BR9A 4C3HH 2EQSA 2SNSA 2A69C 4DR4Q 1E3PA 2EY2A 2IHEA 1LM0A 2OQKA 3T4AC 4B3MQ 3PUWA 2O4XA 4RGOS 1RL2A 1IXRA 1LTSD 2JN4A 4JG2A 5TSSA 3RZDH 2SDFA 1PYBA 4DR7L 1SNQA 1WCMG 1HJPA 1FD7D 3CC7A 4DV0L 4FF2A 1ENFA 4A76A 4WJ4A 4A3CH 3E3XA 2NVYH 2KBNA 1SE4A 1EY4A 1TWFH 3CW2C 3QG1A 3PO2G 4DV6Q 1HUMA 3TZDA 1XNRL 4RHRA 5KYIA 4FNFA 4GKJL 4C3IB 4XIGS 1BVSA 2JSOA 4B3TQ 1JWMD 2HHHL 4YHHL 2Z8LA 5HY6A 1V1PA 4JI3L 1SLJA 1M8AA 3I7FA 1J9OA 2ZTEA 3CCSA 3NK9A 5CORA 3ULJA 1T5EA 3MA2B 3T1HQ 4A3FB 1PFSA 3CXCA 2AHOB 2ICEC 2MHVA 4DR2L 1SE8A 3J7AV 2LY7A 4KY5A 1D6EC 1PZKD 3D31A 2ZTCA 1YJNA 4QGUA 5EJWA 3H91A 4BS9A 2KOLA 2J0TD 4K2KA 1MJEA 1F77A 1VQBA 4GN5A 3TS0A 1SYDA 4PMBA 3STBC 3J80c 4JI8L 1PFMA 3ICEA 5C3WA 4BBRB 4TQUS 3PF4A 2LXJA 3K5NA 3I4NB 3S2DB 1TS4A 1QE6A 3CD6A 4O42A 2GN5A 3TRZA 3KUPA 4KHPQ 2I5MX 2K50A 3G7LA 5DAUA 1AN8A 4A3EH 1G6PA 3J80L 3J81i 1J5EQ 4N9PA 2I07B 3OW2A 2VUMH 3SK8A 4JC0A 4EQ5A 3KLWA 4MN3A 3HKZG 1XNQL 1WTHA 4UDUC 2TSSA 5A35A 3MVVA 2CCZA 1SE2A 4V0BA 3HG9A 1SROA 2L0CA 3BJUA 1Z7TA 2B29A 3CAMA 1ZXTA 4X3UA 5KNCA 5C0XI 3BS1A 2EOTA 3SK6A 1X65A 1XX8A 2HDLA 2KHSA 5LMUQ 1D5ZC 2EE1A 3VR4A 5AJ3Q 1HZAA 2K5DA 1BBWA 4B3SQ 1Y1VH 3JAMi 5JVH3 2R7ZB 5M3MH 1QILA 4WJWA 1S4ZA 3OIPA 2F0GA 1JJCB 4DA2A 4HIOA 3SE0A 1VF5C 4DXGA 1JR0D 2DGYA 1I50H 2FHTA 1ONLA 3F2BA 1Y8PB 1LUZA 1UE1A 2F0HA 4DF7A 1BCPD 3CCRA 4DV1Q 4O0AA 2PZUA 1Y8NB 4X6AH 4DV2Q 2WAQG 2NZ1D 3F2DA 4GN3B 4RCNA 1JE4A 5EGTA 1EWHA 1I5FA 2RCNA 3GDEA 4GOPB 4ZKCB 1BOSA 3IKJA 4A3DG 1FL0A 1SFOH 5T1IA 1AEXA 1Q1BA 3GTJB 2E74C 1VQJA 3A8JE 2OT2A 3I90A 4S3SA 3CCVA 1WTPA 2KCCA 2EYFA 2PZWA 5LMNW 2L9HA 2B2TA 3K6OA 5JEAJ 2KEDA 4OONA 1BCPB 1J8IA 5JJKA 1KDCA 2F0NA 4YCUA 1II3A 2F0KA 5C3EG 1VCIA 4A3JG 1PH6A 3MXPA 4LF5L 1E1TA 1SBBB 2A6HD 3HOWB 1KABA 1SMYC 4F7XA 4DR5L 1DZ1A 1VQGA 2MP1A 1OXSC 4K8IA 3TP8A 4DGZA 3MHBA 1I3QB 3RN2A 4IALA 1QUQA 4XT1B 2HT1A 2NN6I 2NVTH 1RCVD 1WTVA 5LMNL 2ZM6Q 2MO0A 1MD2D 4LF8Q 5JEAG 1OO9B 2FMMA 1KHIA 2WB1B 4YY3L 4B9WA 3EVQA 1YVCA 2A5HA 3I4OA 4BBSG 2MFIA 5C4XG 5IGGA 3NBIA 1S5BD 3MTSA 2C9OA 1KNAA 3RD4A 2B8FA 2BCOA 1QZHA 1I4PA 2JA6B 2X6GA 2RHQB 1RKNA 1O7YA 1SNOA 3W1GA 2K5VA 2NZHA 3IFTA 3OWFA 1Q8KA 1LABA 1ZEQX 3PO3G 1SYGA 1EIYB 2IX3A 3S17B 2XWBB 4C1NI 5BN3A 3KYHC 4ZLTF 2ID0A 3CPWA 4GLVB 1IHZA 3BDCA 3EA6A 3PIOA 3CP0A 1B53A 1CA6A 1FJGL 1VS0A 1WTWA 1KAAA 1B3QA 3X3MA 3CU7A 1STGA 1SMXA 1PH8A 3KF8A 4JBKA 2N49A 3A56A 4LW1A 1G8ZD 2DJFC 5EPJA 2A69D 2DN8A 2BE5D 1VF7A 1XNRQ 4K2LA 2YTVA 1BDOA 4IPGA 1K8AC 1F2LA 1GUSA 1B4OA 2MPMA 2C35B 1LTLA 1ESFA 3TSSA 3G6EA 1HQRD 3NUCA 4APVA 4A3IB 3DM3A 1SDFA 2ENBA 2EJFC 4V190 3E9HA 1HFGA 4B3RL 2EDGA 2R92G 1A62A 4LMQD 5DNFA 3OSOA 1IW7C 3GTKH 1ASYA 1PTOH 1U4MA 4MHEA 4BY7B 1P16A 2HD3A 4IPHA 2I0QA 3VYSA 1PRTD 4GNXB 3GTLB 3NWSA 4KD3A 4AQYL 3MXNB 4JVZA 2K03A 3J7AF 4C3HB 2PQAA 1PV4A 1N32L 4DAYB 1LTID 4GN4B 1HNXQ 1VDZA 5GROA 4FF3A 1Q46A 5K36H 4IFDH 5DEHA 3D6CA 1W2BA 5FJ8G 2HDMA 3H6MA 3HGBA 3RZDB 1YNNC 3QR8A 3Q24A 3HOZG 1O7LA 2JA5G 5ELBA 4OXPA 4EVOA 5E1FA 1QZGA 1FGBD 1PRTB 2Z4IA 1IBLL 2R3ZA 3MFYA 4LUVA 2BA1A 4LFBL 1L0XB 5IT9c 3OOCA 1MI2A 1TVXA 3SGIA 4DR4L 3L9AX 5FLXc 1NY4A 5A2QL 1CHPD 4UAIA 4B3ML 3L7ZC 2IPKD 3WOEA 3HFZB 4Q5VA 3GV6A 3I4NH 4BY1G 2PMZE 1UE7A 3MEFA 2R6GA 3PUVA 1LT6D 2H1EA 5IT9L 1EEID 3N6RA 1W6KA 4N9TA 1V1OA 5FLXL 4X62L 3S9WA 1PH2A 1HHVA 1KD1C 2JK8A 3KBGA 4EGVA 1XTDA 2DNEA 3D6WA 4P73A 5GQOA 1UEBA 4DV6L 3L0OA 4KKSA 3W2DA 5DLQE 1EY5A 2B2UA 4A3KG 4IUVA 2I5LX 1VQAA 4RAUC 1QNUA 1AP0A 4TKOB 4RG1A 1D5MC 4TVAB 4DU9A 4B3TL 1BF4A 4OO1I 1JQYD 2EVBA 2ZJRA 4OHJA 3KJOA 2KCTA 4HIMA 2NVXB 1LYLA 1KAWA 1MKHA 5FLMG 1UWVA 1JORA 3D0FA 4UHVA 1LTAD 3T1HL 3I4MH 4J6HA 2B2TC 2Y0SG 2QILA 4IURA 2DY7A 2N8NA 3KF6B 5FO9B 4A3EB 2A6ED 4C1NK 2VUMB 1JCKB 1AW7A 2L11A 2NUCA 2OQ0A 1JC7A 2WFWA 4KJOA 4A3DB 1CFMA 4OIJA 1IBKL 1NNXA 1ZYRC 3R3OA 1STAA 4CKEA 3K7UC 1MJCA 2PCFB 3AQQA 1PZID 1ENAA 4YWLA 1YJ9A 2N3SA 3CRLC 2AQ1B 3SHLA 4KHPL 2NYZD 3NPPA 1VQ9A 3GTQB 1J5EL 3KK7A 1E7ZA 1CZWA 4ULLA 2EJGC 4PZ7A 4BWGB 3OW7A 4IOCA 2A68C 4LF5Q 2Q8IB 1O7IA 2K4KA 4Q0FA 5C3EB 1Y1VB 3HOUH 4WORA 5M3MB 5FK9C 5M9OA 3HOYG 5GADC 4HJ8A 4FF4A 1RD9D 4GZYC 3VYUA 1K28A 3A8IE 2B39A 1I50B 1Q3LA 1LACA 4X65Q 2L55A 4A3GG 1L1OA 5IGBA 4KHVA 4A93H 1I4GA 5LMUL 4QF4A 4DPGA 3W5OA 2QCPX 1PH5A 5C4JH 1CI3M 3TBIB 1STYA 2D0PA 1BCPF 5FO7B 3HOWH 2KVMA 1SMYD 4CDDC 4YY3Q 4H44C 4DNRB 3IL8A 2QF7A 4IPCA 1YIJA 3S16B 1TY0A 1SFOB 4NP5A 2CH4A 4NPSA 4DUYL 3U50C 1PFBA 1I3QH 2EY5A 2R93G 2RF4A 3EQLC 4F88A 4A3BH 1NBWA 4KK7A 4JYAQ 1S5DD 2CW0C 2TMPA 3I8ZA 1CTMA 1S5CD 4KLKA 5C4XB 1TS3A 1E22A 5ELFA 4DV1L 1NUCA 3H3VI 4IUNA 4DV2L 3OYYA 1Q86C 1WTQA 2OTJA 2SEBD 3CCMA 4IUTA 2B2YA 2OWOA 1GVPA 2WINB 2B63G 1F9SA 1X3GA 4L63B 4QUFA 1FJGQ 1QVCA 1SEBD 4JI2Q 1NR4A 3P75A 3CMEA 1TKWB 4ZKBB 3X3NA 2QEJC 1XMQQ 1RJTA 2XRQD 2OTLA 3KJPA 3HS0C 1MHWC 1PFNA 3M7NA 3S1QH 5IODA 3KLRA 2NWGA 1KRSA 1STNA 1D1KA 2F0EA 3S17H 4CJ0B 1WD1A 2K32A 3H0GG 4AYBE 5EKKA 1OXXK 4DAMA 2M9VA 4DFAA 4B3RQ 2K7VA 2K33A 5C4ZA 5JVG3 4Y7NH 2ZJPA 3I73A 3ONAB 4FXDA 2V1CC 4YWKA 1L0WA 4GKKL 5G3LD 1GXDC 3QIAA 1WCMH 1KDBA 4IJHA 4XDXA 4DR3Q 2VNUD 3OMCA 2R92B 1MBYA 2IHFA 3GO5A 4AQYQ 4RH6A 3K8AA 1F9QA 1DCZA 3ZJYC 3MEHA 3A5ZB 4R1JA 3PO2H 3NQIA 2PNRC 4NB3A 4CDFC 2F0TA 3TP7A 1U9RA 2XVSA 4NW2A 3A0JA 2Q2UA 4GLXA 3AFPA 2F0UA 1SNMA 1JB3A 1AZPA 1IW7D 5I6WA 1XXGA 3NSWA 3J81j 2YU9H 3K57A 2JEAI 3GTOB 3PUYA 2G9DA 4LF6Q 3GTLH 5BN5A 1STBA 4K5VA 4OL7A 2VQEQ 1PTOD 4KTAA 4L8JA 5NUCA 1D2BA 5I6YA 2VL6A 3FKIG 2EYOA 3NE5B 4LFBQ 3VR6A 2ZXOA 3NEMA 1H9SA 2PPBC 1ESRA 3BZCA 1KDAA 1YNND 3NELA 1UE5A 1UE6A 3KLSX 1Y1WG 1EZ8A 3BYYB 4X62Q 2WKCA 4RMFA 3GTKB 3Q0AA 1PTOB 5IYCG 3K59A 2PYKA 5ELNA 2KHIA 3F2UA 2HUGA 3A55A 2K28A 2BH8A 2H5XA 3FHWA 5J1ZA 5JOBA 5J3BA 1A3VA 1PRTF 5KIXA 4R8IA 1JE5A 5KYLA 2AKWB 4A3KB 4G4KA 3U4ZA 3M4OH 1PZJD 1B3AA 2CQOA 1Q12A 3M9BA 1EY0A 1X3FA 4IQZA 1XYIA 1D1IA 2Y0SB 4P71A 3UDXA 2J7ZA 5C44G 4OWWB 1HNXL 5E4XA 1AFPA 1CT1D 1IBKQ 1TR5A 1STHA 1A63A 1DOMA 4K0KQ 4EQPA 1WD0A 2NVXH 4C2MH 1Q90A 1YZ6A 2K52A 5C0XJ 3PUZA 4H0LC 1B2TA 2X6LA 1M90C 4HR7B 4HEDA 1L1OC 1TXYA 3I2ZA 2L15A 1C9OA 2B2WC 4BXXG 4YCVA 2JJQA 4A3DH 4JI4L 1JWSD 1CZGA 1ZYRD 2XNAC 1EFID 1VQFA 1Q82C 1XMOQ 3BDLA 1XPRA 1P8LA 1ICWA 1YHQA 3CHBD 3IFDA 3AU7A 3GTQH 3OHXC 1CM9A 1WTOA 5C3EH 1GOZA 3I4MB 4A3JH 5FO8B 1Z9FA 5C0XG 3ZYYX 1VMPA 1ML0D 4HN7A 2E75C 4AIMA 2D9UA 4JI7Q 2B2YC 2R7FA 4ZYSA 4WRDA 4DUYQ 2JA8G 4RKBA 1HPCA 2FMCA 4DN4M 3SK5A 3ERSX 1LTGD 1U5KA 3MC0B 1XPOA 4ME3A 1B7YB 3RUZA 4LF9L 4CJ1B 1SSOA 4I7AA 1SAPA 1ZKOA 3PIP3 2HQLA 3VR5A 2WB1E 4QIWB 2AUJD 1GUTA 4IJLA 4OEMB 1SN8A 3Q22A 4CKCA 1HZBA 3OPOA 1AE2A 2CVRA 3TP5A 3S16H 1SNCA 1C0AA 5JEAH 1Y14B 3EROA 4YCWA 2SOBA 1IYJB 3R8BA 1YNJD 1EY7A 1QB5D 4XXEA 3HOUB 1KLUD 4BBSH 3H94A 4ZK9B 2CW0D 5C4XH 3PGZA 4LFAL 2OCEA 3G6JB 5CGKA 3LWEA 1BUVT 1NAPA 4JPBW 5IGCA 2AQ3B 5GAGC 4DAVA 1K3BC 2G5DA 1PHJA 1TS2A 3M7GA 2WV6D 3BZDB 2ZXPA 5EKLA 4A93B 4DK3C 1BO0A 1GHKA 3PO3H 4QB4A 3UDFA 5C4JB 1K0RA 4J8QA 2XGTA 1SXTA 3FPPA 3HZXA 3EJIA 4GKKQ 1K8GA 3DM1A 2MJ8A 4JOIA 5D3IB 2VS1A 4PZ8A 4ABNA 4ZUIA 4FYDA 1I4QA 2UXDQ 3ULPA 4DV3L 2KCMA 5CV4A 1MIUA 2QDBA 1M1KC 1I94L 5L37A 4A3BB 4X65L 1Q8IA 1TS5A 3W1BA 1EQRA 2WKDA 4N8X1 1IBMQ 3U9SA 4NXML 1TQOA 4FXGC 2M00A 4PG3A 4H7BA 1VQHA 5GAEC 2GVAA 1DM0B 2VB2X 1KRTA 3D3RA 1VQNA 2RHSB 5D65A 4A75A 1EYGA 2F0JA 1YJWA 1TU2B 4LF7Q 2NN6G 1ENCA 2VZAA 1H9KA 1XPUA 2CH4W 3DLLA 2Q2IA 4TRDA 2HQEA 3K80C 1HFNA 5IY0A 2R92H 1SNDA 2XSCA 1RTNA 1GM5A 2Q8TA 5I9OA 4PZ6A 2IX1A 3UE0A 2QKIC 4GOPA 4X3KA 4DK6C 5HGQA 1WJJA 4DXFA 3KDFB 2HCCA 1K3RA 2KECA 5D3DA 3VR2A 2F0QA 4JYAL 3QOJA 4MIUA 3SEBA 4BA1I 2L12A 3WOFA 1F9RA 5IOCA 5T1GA 1HNWQ 2E2JB 1A15A 1XJVA 3T13A 1EYDA 3MFGA 3S1QB 3AEVA 4GLAC 2NTTA 3FKIB 3HOXG 5LHY1 2EZVA 2MNAA 1ASZA 1TWCH 2PW7A 3TREA 2FINB 3D8GA 1EQVA 1YITA 1CKMA 1N36Q 5JPMC 1FR3A 3GTOH 5IE8A 5FJ8H 4JI2L 4HTHA 4Y7NB 2F4IA 2O2LD 3HOZH 2JA5H 3P1HA 2KENA 1WCMB 1JMCA 1XMQL 4LFCQ 3J7A5 5IGFA 2F0FA 4RHSA 1DJRD 1QVGA 1IYVA 2ATWA 1ILQA 1CQFA 4K5WA 4LUOA 5DM63 2F03A 3PO2B 3TS2A 4CJ2C 2Z4HA 2IW3A 1STEA 2NZOA 1QVFA 3TP6A 2VQFQ 3E6ZX 2B8GA 4BY1H 1NE3A 2L5TA 3DUZA 1RTOA 2YU9B 1HUNA 5HURA 4CDCC 2F3IA 5ISRA 2UXBQ 4DR3L 3BYTB 4WFN3 4UP9A 3E0EA 3SVMA 5CYUA 1WVLA 4F87A 4G57A 5HGTA 1G291 3NP8A 1PTOF 4A3KH 2R7DA 2RDFA 5GAHC 2FFKB 5C44B 4Y52H 1VQOA 2P5ZX 4DKAC 2WACA 3FRPB 4L5TA 3I55A 1X6OA 1VQLA 4B9XA 4LF6L 2D62A 5FLMH 2VQEL 1X9NA 2QEXA 1S5FD 1T5XD 1BNZA 4JI0L 1BXTA 4HJ5A 1IKLA 2EPBA 1PLFA 2F0WA 2F0VA 4JI4Q 3I72A 3S1NH 2CWPA 3NHHA 3S1MH 4RA8A 1Z6HA 3STBD 3J81c 2HCIA 1V8QA 3GQBA 3HKZB 5M5XH 1UUPA 3A7LA 3TZUA 3NQTA 2IT1A 3MZ5A 5IP9G 4LNQA 5D14A 5IYDG 4HSPA 5CV9A 3J81L 4DUZQ 1WTXA 4FVMA 3M4OB 2HIXA 4KJNA 2JA9A 2E2IB 1D7QA 1GJXA 3SR1A 2JQOA 2KUMA 3T51B 4AYBG 4KY6A 5IP7G 3CCUA 3FMCA 3RZOB 2EIFA 3FP9A 1KLGD 3HOYH 1EQTA 4GNXA 3JAMc 2K5NA 4LF9Q 1CKNB 2RA4A 4HCSA 3MXNA 2ZJQA 4IFDI 2SNMA 1I4RA 2Z6KA 4R4IA 1JWUD 4Z9CB 2EYMA 2WIIB 3A8KE 4DAYA 4C2MB 4C3IG 3GTPB 2VXWA 3K0XA 1S3OA 2F0OA 3KBXA 5I2YA 1K73C 2UUAQ 1S5ED 4A3GH 1LTRD 1L0YB 4ALPA 1WFQA 3NTHA 4KY7A 1CK1A 4HJ9A 1N34Q 3JAML 4OO1G 1B44D 2WAQB 3T1YQ 2IWHA 3U4VA 3BVGA 3DXJC 3HOVG 4B08A 1KXLA 1PA6A 4A3FG 1LT5D 4JBJA 1HH2P 1JOKA 1KTKA 3A74A 4OELB 2F4VQ 3GTMB 4C3JG 2UXCL 4A3MG 3CKIB 4LFAQ 5A2QE 1YBYA 5ELEA 4K0KL 1EY6A 4DV5Q 2R93H 2EYJA 4JOIC 1VQ4A 2EXZA 3AYHB 2VY3A 3J80i 2PW5A 2IJ0A 4HIDA 1EQQA 5FLXE 2D2CC 1FVIA 4X66Q 3R2IA 2ALYB 2F0LA 4BBRG 4FP5D 1U0LA 1EY9A 1X3QA 2N78A 2GA4B 4A3JB 4KKUA 1HZ9A 2B63H 3MWYW 1CKOA 4PNYA 3C3LA 3OIQA 2MO1A 1TWGH 5EQ0A 3Q6SA 1HXYD 2OF1A 2OXPA 4DV3Q 4XTCS 3H3VC 1XMOL 1I94Q 4ME5A 1R4QB 1B70B 4NXMQ 4GOPC 1IL8A 1M4VA 2KEEA 3H0GH 2FXQA 3NBHB 5JAVA 3RLNA 3K5MA 3R93A 4JV5Q 4HCEA 1O7ZA 4JI7L 1PH7A 1EWCA 3BVMA 1N9WA 3DHQA 4R4QA 1BCPC 5CMDA 5M5WB 2R7ZG 1FNUA 1W3SA 4BBSB 3I56A 2OEOA 5F2DA 1IKMA 2RVLA 2O5IC 5J39A 2Z0SA 5C5LA 1HA5A 2KA7A 1A0IA 2MQHA 2NBFA 3CCQA 3O13A 4CDEC 1PMRA 2AQ2B 3K7AH 1KNEA 1SJED 1U4LA 2DUDA 4DR1Q 3PO3B 4JK1C 4KI0A 2UUBQ 1A2UA 3HOXB 2F0SA 3S14B 4X64Q 3T16A 3OTOQ 2C5CA 3C1EA 3HRZC 2E8GA 5FOBB 3AB9A 2E2JH 4KMUC 3NTKA 3V96A 3FKIH 1H9MA 5M3FG 1OXVA 3Q8DA 1D8LA 4L5QA 2CWAA 3S15H 1EYCA 3PV0A 4NKLA 2M2LA 1DONA 1Y1WH 4NDXA 1PH4A 2G9HD 4CBVA 1QG7A 2K01A 2LSSA 1NTGA 3TMEA 1UEAB 4HAEA 5H1SE 4JI5Q 2UXDL 1BQQT 2ICIA 4FDBA 4JW0A 3DWAA 4XT3B 5IYCH 4IN3A 1NMGA 3Q23A 1IBML 4QMGA 3UDIA 3F2CA 2Z9HA 4ZAIA 2QA4A 4A3LG 3J7YW 3KLSA 1E0BA 4QY7A 1VQEA 1PXUA 1TWCB 1K8MA 1OTCA 4LF7L 4R8NA 4DR6L 2BH2A 1EEFD 1VMCA 3A54A 1V1PB 1SYBA 1VQIA 3RLOA 2Q2TA 4JI0Q 1OXUA 1G6ZA 2WB1G 4E6IA 3HOZB 3DEOA 2JA5B 1E2WA 4MZ9A 4OX9Q 4OGQC 1FNVA 1CUKA 4HIKA
chains in the Genus database with same CATH topology
3NWTA 1F2ZA 4RCOA 1HCZA 2ZXRA 2B2UC 1GUGA 4KHZA 2F3WA 3NTIA 1TWHB 2KJXA 4CHTB 1FYCA 5CBEE 2L1BA 4PMCA 5CR3A 4BY1B 2EYHA 4EQNA 2BE5C 4ZQ3A 2DNCA 3CRKC 3DWQA 3ND9A 2F0PA 4G7HC 2I46A 1B1ZA 3U9OA 4G7OC 4XYQA 2XRSD 3SK4A 3S2HB 2BDNA 2MUYA 4K8JA 3T56B 4AYBB 4RGNA 1D5XC 2CQAA 2PQEA 3RLFA 2H4OA 1I4HA 3I91A 4JBWA 2L4NA 1QCBD 2F3VA 3QB3A 1PRTC 3S1RB 1ET6A 2VB3X 5E4WC 1DD2A 4L6TB 4DK1A 2Z1CA 1A3TA 2AWOA 1EZ6A 5C0XH 1X3PA 3T53B 1MSGA 1B50A 5I4DA 3S1NB 1RDPD 3S1MB 3HOVB 3K58A 4C3HG 4U673 5M5XB 4M1UB 3K0YA 4C3JB 4IZ8A 4A3MB 1QOHA 2K04A 5EPKA 1I4XA 3I4LA 2RDHA 2EY6A 4LJZC 3D4WA 1E2VA 1A3UA 3TN2A 1A2TA 3OMGA 3DWPA 4KKTA 4XQJA 3URYA 4PMWA 5C6AA 1RODA 3MAQA 3HOYB 3ITPA 2RDGA 1B9NA 1CHQD 5I9PA 3K5OA 1G2TA 2AWNA 4I7ZC 4XYOA 2A68D 1HRJA 4A3GB 2LMCB 3GD7A 2K5QA 1JOOA 1Q1EA 4ZUJA 1EOTA 1RHPA 3W3AA 3M4YA 2D5DA 1DYQA 3FEWX 3I70A 3QO2A 2K6AA 4RFBA 1AZQA 1C48A 2R93B 1RF2D 3ERQA 2A6EC 4K5XA 1QNKA 3J80E 3D4DA 2NN6H 4ILWA 1B9MA 2B63B 4HMIA 4F8MA 3FPUB 2KCNA 2DY8A 2RQXA 1TWGB 4O1NA 5IIFA 5C4HA 3VA7A 3C1FA 3P7JA 5DM73 3HEJA 5CV7A 2FJ2A 4TSSA 2YYZA 1V43A 4RGTA 1SYFA 3LWUA 1SYCA 5CV6A 1NSNS 3H0GB 3VYTA 4I65A 1XWEA 2K1BA 2XWJB 2F0MA 5M3FB 1OXTA 4LAAA 2LFNA 3DMUA 5IGDA 2F0DA 1EIHA 1HQMC 3DEPA 3BG3A 5J22A 5C5MA 4FO2A 1O78A 4X3SA 1R4PB 1SJHD 3GP7A 4ODGA 2NTSA 3K7AB 4K6DA 2EYLA 2EJMA 3FDTA 3LX0A 4RWSC 4LK1C 1EU3A 1F2YA 2B2VA 2EYPA 1BBXC 5KRUA 1XTCD 3QJYA 3PUXA 5JJZA 4X3TA 5JPNC 3S15B 4R9WA 2XIWA 5EBCA 1Y1WB 2E2DC 1X32A 1ET9A 1FNWA 1GUOA 4RGMA 2EY1A 5G3LF 2JYOA 5LL6S 3SDZA 1EIGA 1K8OA 2BDOA 1MGSA 2A74C 3L3OC 1LLRD 1UAPA 1F9PA 3OWEB 2N88A 3E5SA 1NCVA 1E2ZA 2JA7B 1G91A 4IUUA 5CC4A 1MSHA 1Y8OB 2PZTA 2RSOA 5KEEA 2O5JC 5KNBA 2MGSA 2AUKA 4XQQA 2RSNA 2BOSA 3N52A 4CKBA 1PTOC 2RKSA 2ZT9C 1LV9A 1Y69U 3MXUA 3A7AB 4OO1H 5AFWA 5CBAE 1DOKA 4KN7C 1QJOA 4IFDJ 1HA6A 5EKIA 4XQNA 4BA2I 2K05A 1GUNA 4HSVA 2NVYB 1U4PA 1TWFB 2R61A 4G7ZC 4P2CB 3VR3A 2E2HB 3ND8A 1G2SA 3C46A 1SYEA 1LT3D 1C4QA 2JA8B 3BDOA 1JOQA 1SE3A 3PIO3 1TT2A 2CHBD 2KQ3A 5K36G 4PV1C 4IFDG 2IL8A 3K5LA 1U4RA 3LNNA 1F2MA 5CV8A 3RMHA 2BA0A 3PMFA 1ILPA 1LT4D 1PDQA 4K6LA 1EU4A 1TIID 2V4DA 1HTPA 3C2PA 3BVZA 4J1MA 3I3CA 3V05A 5IT9E 5IGEA 1A6XA 2XN9C 3WDNA 3J81E 1SNPA 1HTLD 2Q8RE 3VYRA 2RBMA 1GHJA 1H9JA 2F1MA 2X69A 2JP1A 2JXMB 3QOLA 5E3FA 5K5PA 4FF1A 2PMZB 3MXGA 1TWAB 2J4XA 4DAPA 4FXKC 3CQZB 3H09A 2NVQB 2B2VC 3JAME 3NXWA 5FKAC 1DXMA 2N55A 5ELCA 5KGUA 3QWNA 1TY2A 3R2TA 2JE6I 4IUPA 5ELDA 1DOLA 4QUCA 1IYUA 3UI2A 2A73B 1LTTD 1I6HB 5CV5A 2E76C 2F0IA 2PO4A 2B2WA 2LS01 4C56C 2NB0A 1PYWD 4HMJA 2K5WA 1I6VC 2JEBI 4CGYB 1GUWA 1YNJC 1C8CA 1H9RA 2IX0A 1LO5D 4KD4A 3IAYA 2LKVA 1EY8A 3TDQA 1Z47A 2WP8J 1UNSA 1NR2A 4KN4C 1QWYA 4U68A 3D4RA 1JICA 5COYA 4EQOA 1K83B 4YIJA 5LL6X 1H9SB 2A6HC 3HP3A 4ZRZA 4KV6A 3AMUA 3EFXD 4ID6A 5EBDA 1EYAA 4OIKA 5BN4A 5I2XA 5M5YB 3VA5A 4IUQA 1W6JA 3NBHA 3GV3A 2NVTB 1O80A 4H13C 4DNTB 1CQVA 4M8AA 1WTRA 5C3XA 5EPLA 4PQXA 4NMZA 4RKLA 3GTGB 3V2TA 3M85A 3SXHA 4QCLA 4DK0A 4K14A 1EL0A 5KNDA 1CA5A 3P20A 3E0JA 1R9TB 1LTBD 3FVQA 3M3YB 1BR9A 2SNSA 2A69C 2EY2A 3T4AC 3PUWA 2O4XA 4RGOS 1LTSD 5TSSA 2SDFA 1SNQA 1FD7D 4FF2A 1ENFA 1SE4A 1EY4A 3QG1A 1HUMA 3TZDA 4RHRA 5KYIA 4FNFA 4C3IB 4XIGS 2JSOA 1JWMD 2Z8LA 1V1PA 1M8AA 1J9OA 3NK9A 5CORA 1T5EA 3MA2B 4A3FB 2ICEC 2MHVA 3J7AV 2LY7A 4KY5A 1D6EC 1PZKD 3D31A 5EJWA 3H91A 4BS9A 2KOLA 2J0TD 4K2KA 1F77A 1SYDA 4PMBA 1PFMA 5C3WA 4BBRB 4TQUS 3I4NB 3K5NA 3S2DB 1TS4A 1QE6A 4O42A 3KUPA 3G7LA 5DAUA 1AN8A 3J80L 4N9PA 2I07B 3SK8A 4MN3A 4UDUC 2TSSA 5A35A 3MVVA 1SE2A 4V0BA 3HG9A 2L0CA 1Z7TA 4X3UA 1ZXTA 5KNCA 5C0XI 3BS1A 2EOTA 3SK6A 1XX8A 2HDLA 2KHSA 1D5ZC 2EE1A 3VR4A 2K5DA 5JVH3 2R7ZB 1QILA 4WJWA 1S4ZA 3OIPA 2F0GA 4DA2A 3SE0A 1VF5C 4DXGA 1JR0D 2FHTA 1ONLA 1Y8PB 2F0HA 4DF7A 1BCPD 2PZUA 1Y8NB 2NZ1D 4RCNA 1JE4A 5EGTA 1EWHA 4ZKCB 1BOSA 3IKJA 5T1IA 1AEXA 1Q1BA 3GTJB 2E74C 3A8JE 2OT2A 3I90A 4S3SA 1WTPA 2KCCA 2EYFA 2PZWA 2L9HA 2B2TA 3K6OA 5JEAJ 2KEDA 1BCPB 1J8IA 1KDCA 2F0NA 1II3A 2F0KA 1VCIA 3MXPA 1SBBB 3HOWB 2A6HD 1KABA 1SMYC 4F7XA 1DZ1A 2MP1A 1OXSC 4K8IA 3TP8A 4DGZA 3MHBA 1I3QB 4IALA 4XT1B 2NN6I 1RCVD 1WTVA 1MD2D 5JEAG 1OO9B 2FMMA 2WB1B 4B9WA 3EVQA 2A5HA 5IGGA 3NBIA 1S5BD 3MTSA 2C9OA 1KNAA 3RD4A 2B8FA 2BCOA 2JA6B 1I4PA 1RKNA 1O7YA 2X6GA 1SNOA 3IFTA 3OWFA 1LABA 1ZEQX 1SYGA 2IX3A 3S17B 2XWBB 4C1NI 5BN3A 4ZLTF 2ID0A 1IHZA 3BDCA 3EA6A 1B53A 1CA6A 1WTWA 1KAAA 3X3MA 3CU7A 1STGA 3KF8A 3A56A 1G8ZD 5EPJA 2A69D 2DN8A 2BE5D 1VF7A 4K2LA 1BDOA 1F2LA 1GUSA 1B4OA 2MPMA 1ESFA 3TSSA 1HQRD 3NUCA 4A3IB 1SDFA 2ENBA 2EJFC 4V190 1HFGA 2EDGA 4LMQD 5DNFA 3OSOA 1IW7C 1PTOH 1U4MA 4MHEA 4BY7B 3VYSA 1PRTD 3GTLB 3NWSA 4KD3A 2K03A 3J7AF 4C3HB 1LTID 1VDZA 4FF3A 5K36H 4IFDH 5DEHA 3D6CA 2HDMA 3H6MA 3HGBA 3RZDB 1YNNC 3Q24A 1O7LA 5ELBA 4EVOA 5E1FA 1FGBD 1PRTB 2Z4IA 2R3ZA 3MFYA 2BA1A 1L0XB 3OOCA 1MI2A 1TVXA 3L9AX 5A2QL 1CHPD 4UAIA 3L7ZC 2IPKD 3WOEA 4Q5VA 3GV6A 2R6GA 3PUVA 1LT6D 2H1EA 5IT9L 1EEID 3N6RA 1W6KA 4N9TA 1V1OA 5FLXL 3S9WA 1HHVA 3KBGA 4EGVA 2DNEA 3D6WA 4KKSA 3W2DA 1EY5A 2B2UA 4IUVA 4RAUC 1QNUA 1AP0A 4TKOB 1D5MC 4DU9A 4OO1I 1BF4A 1JQYD 2EVBA 4OHJA 2NVXB 1JORA 1LTAD 4J6HA 2B2TC 2QILA 4IURA 2DY7A 5FO9B 4A3EB 2A6ED 4C1NK 2VUMB 1JCKB 1AW7A 2L11A 2NUCA 1JC7A 4KJOA 4A3DB 1CFMA 4OIJA 3R3OA 1ZYRC 1STAA 4CKEA 2PCFB 1PZID 1ENAA 3CRLC 2AQ1B 3SHLA 2NYZD 3NPPA 3GTQB 3KK7A 1CZWA 4ULLA 2EJGC 4BWGB 3OW7A 2A68C 2Q8IB 5C3EB 4Q0FA 1Y1VB 4WORA 5M3MB 5FK9C 5M9OA 4FF4A 1RD9D 4GZYC 3VYUA 3A8IE 2B39A 1I50B 1Q3LA 1LACA 2L55A 5IGBA 4KHVA 1I4GA 4QF4A 2QCPX 1CI3M 3TBIB 1STYA 1BCPF 5FO7B 2KVMA 1SMYD 4H44C 4DNRB 3IL8A 2QF7A 3S16B 1TY0A 1SFOB 4NP5A 1PFBA 2EY5A 3EQLC 4F88A 4KK7A 1S5DD 2CW0C 2TMPA 3I8ZA 1CTMA 1S5CD 5C4XB 1TS3A 5ELFA 1NUCA 4IUNA 1WTQA 2SEBD 4IUTA 2B2YA 2WINB 1F9SA 4L63B 4QUFA 1SEBD 1NR4A 3P75A 1TKWB 4ZKBB 3X3NA 2QEJC 1RJTA 2XRQD 3HS0C 1PFNA 3M7NA 5IODA 3KLRA 2NWGA 1STNA 1D1KA 2F0EA 4CJ0B 1WD1A 2K32A 5EKKA 1OXXK 2M9VA 4DFAA 2K7VA 2K33A 5C4ZA 5JVG3 4FXDA 3I73A 3ONAB 5G3LD 1GXDC 3QIAA 1KDBA 4XDXA 2VNUD 3OMCA 2R92B 1MBYA 3GO5A 4RH6A 1F9QA 1DCZA 3MEHA 3NQIA 2PNRC 2F0TA 3TP7A 1U9RA 2XVSA 4NW2A 2F0UA 1SNMA 1JB3A 1AZPA 1IW7D 5I6WA 1XXGA 3NSWA 2JEAI 3K57A 3GTOB 3PUYA 2G9DA 5BN5A 1STBA 4K5VA 4OL7A 1PTOD 4KTAA 4L8JA 5NUCA 1D2BA 5I6YA 2EYOA 3NE5B 3VR6A 2ZXOA 1H9SA 2PPBC 1ESRA 1KDAA 1YNND 3KLSX 1EZ8A 3BYYB 2WKCA 3GTKB 3Q0AA 1PTOB 3K59A 2PYKA 3F2UA 2HUGA 3A55A 2K28A 5J1ZA 5JOBA 1A3VA 1PRTF 5KIXA 4R8IA 5KYLA 4A3KB 4G4KA 1PZJD 1B3AA 1Q12A 1EY0A 4IQZA 1XYIA 1D1IA 2Y0SB 2J7ZA 5E4XA 1AFPA 1CT1D 1TR5A 1STHA 1DOMA 4EQPA 1WD0A 1Q90A 5C0XJ 3PUZA 4H0LC 1B2TA 2X6LA 4HR7B 4HEDA 2B2WC 1JWSD 1CZGA 1ZYRD 2XNAC 1EFID 3BDLA 1ICWA 3CHBD 3IFDA 3AU7A 3OHXC 1CM9A 1WTOA 1GOZA 3I4MB 5FO8B 5C0XG 3ZYYX 1VMPA 1ML0D 4HN7A 2E75C 2D9UA 2B2YC 4ZYSA 4WRDA 4RKBA 1HPCA 2FMCA 4DN4M 3SK5A 1LTGD 3MC0B 3RUZA 4CJ1B 1SSOA 1SAPA 1ZKOA 3PIP3 3VR5A 4QIWB 2AUJD 1GUTA 3Q22A 4CKCA 3OPOA 2CVRA 3TP5A 1SNCA 5JEAH 3EROA 2SOBA 3R8BA 1YNJD 1EY7A 1QB5D 4XXEA 3HOUB 1KLUD 3H94A 4ZK9B 2CW0D 3G6JB 5CGKA 3LWEA 1BUVT 1NAPA 5IGCA 2AQ3B 4DAVA 1TS2A 3M7GA 2WV6D 3BZDB 2ZXPA 5EKLA 4A93B 1BO0A 1GHKA 4QB4A 5C4JB 4J8QA 3FPPA 1SXTA 3HZXA 3EJIA 3DM1A 2MJ8A 5D3IB 4ABNA 4ZUIA 4FYDA 1I4QA 5CV4A 2QDBA 4A3BB 1Q8IA 1TS5A 2WKDA 3U9SA 1TQOA 4FXGC 2M00A 4H7BA 1DM0B 2VB2X 3D3RA 5D65A 2F0JA 1TU2B 2NN6G 1ENCA 1H9KA 4TRDA 2HQEA 1HFNA 1SNDA 2XSCA 1RTNA 2Q8TA 5I9OA 2IX1A 2QKIC 4X3KA 4DXFA 2HCCA 2KECA 5D3DA 3VR2A 2F0QA 3QOJA 4MIUA 3SEBA 4BA1I 2L12A 3WOFA 1F9RA 5IOCA 5T1GA 2E2JB 1A15A 3T13A 1EYDA 3MFGA 3S1QB 2NTTA 3FKIB 5LHY1 2EZVA 2PW7A 2FINB 3D8GA 1EQVA 5JPMC 1FR3A 4HTHA 4Y7NB 2F4IA 2O2LD 3P1HA 1WCMB 5IGFA 2F0FA 4RHSA 1DJRD 1IYVA 1ILQA 1CQFA 4K5WA 5DM63 2F03A 3PO2B 4CJ2C 2Z4HA 2IW3A 1STEA 3TP6A 3E6ZX 2B8GA 3DUZA 2L5TA 1RTOA 2YU9B 1HUNA 5HURA 5ISRA 3BYTB 4WFN3 3SVMA 5CYUA 1WVLA 4F87A 4G57A 5HGTA 1G291 3NP8A 1PTOF 2RDFA 2FFKB 5C44B 2WACA 3FRPB 4B9XA 2D62A 1BNZA 1S5FD 1T5XD 1BXTA 1IKLA 2EPBA 1PLFA 2F0WA 2F0VA 3I72A 3NHHA 4RA8A 1Z6HA 2HCIA 1V8QA 3GQBA 3HKZB 1UUPA 3A7LA 3TZUA 3NQTA 2IT1A 3MZ5A 5D14A 4HSPA 5CV9A 3J81L 1WTXA 4FVMA 3M4OB 4KJNA 2E2IB 1GJXA 3SR1A 2KUMA 3T51B 4KY6A 3FMCA 3RZOB 1KLGD 1EQTA 2RA4A 4HCSA 3MXNA 4IFDI 2SNMA 1I4RA 1JWUD 4Z9CB 2EYMA 2WIIB 3A8KE 4DAYA 4C2MB 4C3IG 3GTPB 2VXWA 3KBXA 2F0OA 5I2YA 1S5ED 1LTRD 1L0YB 3NTHA 4KY7A 1CK1A 3JAML 4OO1G 1B44D 2WAQB 2IWHA 3BVGA 3DXJC 4B08A 1LT5D 1JOKA 1KTKA 3GTMB 4C3JG 3CKIB 5A2QE 5ELEA 1EY6A 2EYJA 2EXZA 2PW5A 2IJ0A 5FLXE 2D2CC 3R2IA 2F0LA 4FP5D 1EY9A 1X3QA 2GA4B 4A3JB 4KKUA 3MWYW 4PNYA 3C3LA 3OIQA 5EQ0A 3Q6SA 1HXYD 2OF1A 2OXPA 4XTCS 3H3VC 4ME5A 1R4QB 1IL8A 1M4VA 2KEEA 5JAVA 3K5MA 3R93A 4HCEA 1O7ZA 1EWCA 3BVMA 3DHQA 5CMDA 1BCPC 5M5WB 1FNUA 4BBSB 2OEOA 5F2DA 1IKMA 2RVLA 2O5IC 5J39A 5C5LA 1HA5A 2KA7A 2NBFA 3O13A 1PMRA 2AQ2B 1KNEA 1SJED 1U4LA 3PO3B 4JK1C 4KI0A 3HOXB 1A2UA 2F0SA 3S14B 3T16A 2C5CA 3C1EA 3HRZC 5FOBB 3AB9A 4KMUC 3NTKA 3V96A 1H9MA 1OXVA 1EYCA 3PV0A 4NKLA 2M2LA 1DONA 4NDXA 2G9HD 4CBVA 1QG7A 2K01A 3TMEA 4HAEA 1UEAB 1BQQT 2ICIA 3DWAA 4XT3B 4IN3A 3Q23A 4QMGA 4ZAIA 3J7YW 3KLSA 1E0BA 1PXUA 1TWCB 1K8MA 4R8NA 1EEFD 1VMCA 3A54A 1V1PB 1SYBA 1OXUA 1G6ZA 4E6IA 3HOZB 3DEOA 2JA5B 1E2WA 4OGQC 1FNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NUC A;  3D8G A;  1EQV A;  1F2Z A;  3P75 A;  3QOL A;  3DHQ A;  4J6H A;  4ODG A;  5E3F A;  5J1Z A;  5I9P A;  2ENB A;  5K5P A;  5JOB A;  5C3X A;  3SR1 A;  1A3V A;  1KDC A;  2OEO A;  4K2K A;  4K6D A;  2F0N A;  5F2D A;  5KYI A;  5KIX A;  2EYL A;  4HTH A;  4KY6 A;  4NMZ A;  1II3 A;  2F0K A;  2F3W A;  4RKL A;  3OSO A;  3V2T A;  5KYL A;  5J39 A;  1SYD A;  4PMB A;  5C5L A;  3LX0 A;  2NUC A;  3SXH A;  1JOO A;  3P1H A;  5IOD A;  4ZUJ A;  3TME A;  3TP5 A;  1STN A;  2F0E A;  4PMC A;  5C3W A;  1SNC A;  4KJO A;  1F2Y A;  5CR3 A;  3NXW A;  2EYP A;  3ERO A;  3MXP A;  2SOB A;  3R3O A;  4KD3 A;  2EYH A;  2F0F A;  4EQN A;  5EKK A;  5IGF A;  2SNM A;  1STA A;  5KRU A;  1EY7 A;  4K14 A;  1EY0 A;  1KAB A;  4ZQ3 A;  4K5W A;  5DAU A;  4DFA A;  2EYM A;  1ENA A;  4F7X A;  2F0O A;  1A2U A;  4N9P A;  5C4Z A;  1JOR A;  2F0P A;  3SK8 A;  4KY7 A;  2F0S A;  3SHL A;  4K8I A;  3TP8 A;  4DGZ A;  3TP6 A;  5CGK A;  3U9O A;  5CV5 A;  3MHB A;  2F0I A;  3D6C A;  5DEH A;  3T16 A;  5IGC A;  1KDB A;  4IAL A;  3ERQ A;  3SK4 A;  3OMC A;  3H6M A;  4K8J A;  1TR5 A;  1STH A;  3C1E A;  4K5X A;  2PQE A;  1SYE A;  5EKL A;  4EQP A;  5HUR A;  3MVV A;  4HMJ A;  1JOK A;  4KJN A;  4WOR A;  4QB4 A;  5M9O A;  3MEH A;  5ISR A;  4EVO A;  2SNS A;  2F3V A;  3QB3 A;  3D4D A;  5E1F A;  2EY1 A;  2F0T A;  3HZX A;  1U9R A;  3TP7 A;  3EJI A;  1EY6 A;  3SK6 A;  2EYJ A;  2EY2 A;  4G57 A;  4HMI A;  3EVQ A;  2KHS A;  4B9W A;  4F8M A;  1JOQ A;  2EXZ A;  2O4X A;  5HGT A;  1A3T A;  3NP8 A;  1EYC A;  2F0U A;  1SNM A;  2PW5 A;  4NKL A;  5IGG A;  4ZUI A;  5I6W A;  1TT2 A;  5IGB A;  4KHV A;  5IIF A;  2RDF A;  1EZ6 A;  2KQ3 A;  4NDX A;  5KGU A;  4KD4 A;  5CV4 A;  2QDB A;  2LKV A;  1EY8 A;  1SNQ A;  4QF4 A;  5C4H A;  3C1F A;  2F0L A;  2WAC A;  1RKN A;  1STY A;  1STB A;  2F0G A;  1F2M A;  1SNO A;  4K5V A;  4OL7 A;  4KTA A;  1EY9 A;  5CV8 A;  1TQO A;  3OWF A;  2M00 A;  5NUC A;  3HEJ A;  4H7B A;  5CV7 A;  5I6Y A;  3PMF A;  4N9T A;  1SYG A;  3BDL A;  3E5S A;  4PNY A;  4B9X A;  3S9W A;  1EY4 A;  2EYO A;  1SYF A;  4IZ8 A;  2F0J A;  2F0H A;  1SYC A;  4QMG A;  5CV6 A;  4EQO A;  4NP5 A;  4DF7 A;  1NSN S;  4YIJ A;  1ENC A;  4I65 A;  2OF1 A;  2OXP A;  2EY5 A;  2EY6 A;  1IHZ A;  4TRD A;  2F0M A;  2PZU A;  2HQE A;  3BDC A;  4J1M A;  5CC4 A;  1KDA A;  2PZT A;  3D4W A;  2F0W A;  1SND A;  5KEE A;  1A3U A;  2F0V A;  4ME5 A;  4KV6 A;  4LAA A;  5IGE A;  1A2T A;  1EY5 A;  3NHH A;  3DMU A;  1KAA A;  3OMG A;  4ID6 A;  4R8N A;  2F0D A;  5EGT A;  5I9O A;  1EZ8 A;  5IGD A;  1STG A;  1EYA A;  1NUC A;  4IUN A;  1SNP A;  5J22 A;  2F0Q A;  3QOJ A;  1SYB A;  4MIU A;  3VA5 A;  3NK9 A;  1AEX A;  5C5M A;  2RBM A;  5C6A A;  3NQT A;  3MZ5 A;  4WRD A;  4DU9 A;  4RKB A;  2RKS A;  4K2L A;  5IOC A;  3SK5 A;  5JAV A;  3T13 A;  4E6I A;  1EYD A;  5CV9 A;  2PYK A;  3ITP A;  4S3S A;  4KY5 A;  2PW7 A;  2EYF A;  2PZW A;  3RUZ A; 
#chains in the Genus database with same CATH topology
 1VQP A;  3NWT A;  1HNW L;  1F2Z A;  4RCO A;  1HCZ A;  1PYS B;  5JJI A;  5C44 H;  2ZXR A;  2JA6 G;  2B2U C;  1GUG A;  4KHZ A;  1N36 L;  2F3W A;  1YHA A;  1EIF A;  3NTI A;  1TWH B;  2KJX A;  4LF4 L;  2Z6B A;  1FYC A;  4CHT B;  1GD7 A;  5CBE E;  4GNX C;  2L1B A;  1RIP A;  4PMC A;  2ZTD A;  5CR3 A;  4BY1 B;  2Z6K C;  1VQ6 A;  2EYH A;  4EQN A;  2BE5 C;  2ES2 A;  5BR8 Q;  3H15 A;  4JI6 Q;  3ULL A;  3CMA A;  3IRB A;  4ZQ3 A;  2DNC A;  3CRK C;  4JI1 Q;  1EFW A;  4LFC L;  3DWQ A;  3ND9 A;  2F0P A;  4G7H C;  3PIP A;  2I46 A;  1B1Z A;  3U9O A;  3UDG A;  1VQD A;  4G7O C;  4XYQ A;  4BXX H;  1NJI C;  5IWA L;  2XRS D;  3SK4 A;  3S2H B;  2BDN A;  2MUY A;  4K8J A;  3T56 B;  4RGN A;  4AYB B;  5IYB G;  1D5X C;  2CQA A;  2PQE A;  3RLF A;  2H4O A;  1I4H A;  3I91 A;  4JBW A;  2VQF L;  2GVB A;  2L4N A;  1QCB D;  1VQ8 A;  1WYD A;  2F3V A;  3QB3 A;  1PRT C;  3S1R B;  1ET6 A;  4A3I G;  2E2I H;  2VB3 X;  3JC6 6;  5E4W C;  2JA7 G;  1DD2 A;  4L6T B;  3PF5 A;  4DK1 A;  2E2H H;  2UXB L;  2Z1C A;  1A3T A;  2AWO A;  3RZO H;  1V9P A;  1EZ6 A;  5C0X H;  1T9H A;  1VQK A;  1X3P A;  4BY7 G;  4IO9 A;  3T53 B;  2UXC Q;  1MSG A;  1B50 A;  5I4D A;  3S1N B;  3CPF A;  4QIW E;  1RDP D;  4UY8 C;  3S1M B;  2JA8 H;  3HOV B;  3K58 A;  4C3H G;  4U67 3;  3GTP H;  5M5X B;  4M1U B;  3K0Y A;  4C3J B;  4IZ8 A;  1G51 A;  4A3M B;  1QOH A;  2K04 A;  3EIV A;  5EPK A;  4UPA A;  1I4X A;  3I4L A;  2RDH A;  2EY6 A;  4LJZ C;  3D4W A;  1E2V A;  4N8F A;  1A3U A;  3TN2 A;  1A2T A;  3OMG A;  2XTI A;  4NXN Q;  1H95 A;  3GTM H;  3DWP A;  4KKT A;  4XQJ A;  4IOA A;  3URY A;  4PMW A;  5C6A A;  2AMC B;  4A3C G;  4DNI A;  1X3E A;  1ROD A;  3MAQ A;  3HOY B;  3ITP A;  3K81 C;  1KC8 C;  2RDG A;  1B9N A;  1CHQ D;  4DV4 Q;  5I9P A;  3K5O A;  1G2T A;  5EAY A;  2AWN A;  4DUZ L;  4I7Z C;  4XYO A;  1VQ7 A;  3CCL A;  2A68 D;  2E5L Q;  1HRJ A;  4A3G B;  2LMC B;  3GD7 A;  2K5Q A;  1C7Y A;  1JOO A;  1Q1E A;  4ZUJ A;  3KOJ A;  2I5H A;  1EOT A;  2UU9 L;  1RHP A;  2B3G A;  3W3A A;  3M4Y A;  1GKH A;  2D5D A;  4GS3 A;  1DYQ A;  3FEW X;  1TWA H;  3QO2 A;  3I70 A;  2K6A A;  4RFB A;  1AZQ A;  1C48 A;  3CQZ H;  1RF2 D;  2R93 B;  4IPD A;  2NVQ H;  3ERQ A;  2UUA L;  1QUQ B;  1N34 L;  4L5R C;  2A6E C;  4DV7 L;  4K5X A;  3CCJ A;  1QNK A;  2PI2 E;  3J80 E;  1A8V A;  4A4I A;  1JT8 A;  4EX5 A;  3T1Y L;  1HNZ Q;  4QQB X;  3D4D A;  2NN6 H;  5M5W H;  1I6H H;  4ILW A;  1B9M A;  2B63 B;  2F4V L;  4HMI A;  4F8M A;  4A3E G;  3FPU B;  2KCN A;  2DY8 A;  1PH3 A;  2RQX A;  1TWG B;  2VUM G;  4O1N A;  5IIF A;  4DV5 L;  2ASB A;  4WJ3 M;  3TEH B;  5C4H A;  3VA7 A;  1BBU A;  3C1F A;  3P7J A;  1KIX A;  5DM7 3;  3HEJ A;  5CV7 A;  4X66 L;  2FJ2 A;  4TSS A;  2YYZ A;  1KQS A;  3HOX H;  1V43 A;  4RGT A;  1SYF A;  3LWU A;  3AFQ A;  1SYC A;  5CV6 A;  3F8T A;  3S14 H;  1NSN S;  3H0G B;  3VYT A;  4I65 A;  1XWE A;  2K1B A;  1S72 A;  2XWJ B;  1EOV A;  2F0M A;  1OXT A;  3L2P A;  5M3F B;  4LAA A;  2LFN A;  3DMU A;  5IGD A;  2F0D A;  1EIH A;  1FGU A;  1Y1V G;  1HQM C;  3DEP A;  3BG3 A;  5M3M G;  5J22 A;  3KF8 B;  1GO3 E;  1WI5 A;  1K83 H;  5C5M A;  2UUC Q;  3PSI A;  4FO2 A;  1O78 A;  1PVO A;  1ICF B;  4X3S A;  3UE1 A;  1R4P B;  1SJH D;  3GP7 A;  4DR6 Q;  4ODG A;  2NTS A;  3K7A B;  4JV5 L;  5M5Y H;  4K6D A;  2EYL A;  1PH1 A;  2EJM A;  3FDT A;  1HR0 W;  1PH9 A;  2A8V A;  4P75 A;  3LX0 A;  4RWS C;  4LK1 C;  2RCF A;  1EU3 A;  1F2Y A;  2B2V A;  3CC4 A;  2EYP A;  1BBX C;  5KRU A;  1XTC D;  4R4T A;  3QJY A;  2PQA B;  3GTG H;  3PUX A;  5JJZ A;  1JB7 A;  4O2D A;  4X3T A;  4DR1 L;  4LF4 Q;  4LWC A;  1B8A A;  2UUB L;  5JPN C;  3S15 B;  4R9W A;  2XIW A;  5EBC A;  1N33 L;  1Y1W B;  4X64 L;  2QDL A;  2E2D C;  1X32 A;  1ET9 A;  3OTO L;  1FNW A;  1GUO A;  3HKZ E;  4RGM A;  2EY1 A;  5G3L F;  2JYO A;  5LL6 S;  1BKB A;  4DR7 Q;  4LUZ A;  3SDZ A;  1HR0 L;  1EIG A;  1R9T H;  5ELO A;  5IWA Q;  1K8O A;  4DV0 Q;  2BDO A;  1MGS A;  1TWH H;  2A74 C;  3KFU A;  3M3Y H;  2YV5 A;  3L3O C;  2YTX A;  1LLR D;  1UAP A;  5IP9 H;  1F9P A;  3OWE B;  5IYD H;  2N88 A;  3E5S A;  1Q7Y C;  4GKJ Q;  4JI5 L;  1N8R C;  4MNO A;  1NCV A;  4R4O A;  1E2Z A;  2JA7 B;  1G91 A;  1Q81 C;  2HHH Q;  4IUU A;  4QJF A;  5CC4 A;  1MSH A;  4YHH Q;  1Y8O B;  2PZT A;  2RSO A;  4JI3 Q;  5KEE A;  4H02 A;  3S2H H;  2O5J C;  2PI2 A;  5KNB A;  2Q2H A;  5IP7 H;  2MGS A;  3WWV A;  3M4P A;  1EWI A;  2AUK A;  3KDF A;  4MTK A;  4DR2 Q;  3HKS A;  4R4C A;  2RSN A;  2A19 A;  4XQQ A;  3S1R H;  2WAQ E;  2BOS A;  3N52 A;  4CKB A;  1PTO C;  2RKS A;  2ZT9 C;  4OWT B;  1LV9 A;  4C3I H;  1Y69 U;  3MXU A;  5JJL A;  3A7A B;  4OO1 H;  2DJG C;  5AFW A;  4OX9 L;  1YHB A;  4JI8 Q;  5CBA E;  2CFM A;  3CC2 A;  3TQY A;  3LGJ A;  1DOK A;  4UP7 A;  3HOV H;  4A3F H;  4KN7 C;  1VQC A;  1QJO A;  4C3J H;  4A3M H;  1K0S A;  4IFD J;  1HA6 A;  2PNH A;  5EKI A;  4QL5 A;  4XQN A;  4BA2 I;  2K05 A;  1GUN A;  4HSV A;  4L5S A;  1YNX A;  2NVY B;  1XNQ Q;  1U4P A;  1TWF B;  4POF A;  5BR8 L;  2R61 A;  4JI6 L;  2D0O A;  4G7Z C;  4P2C B;  4JI1 L;  3VR3 A;  3CCE A;  2E2H B;  1E1O A;  4BBR H;  3ND8 A;  3S2D H;  2UU9 Q;  1G2S A;  1JJ2 A;  3C46 A;  1SYE A;  1LT3 D;  2CKZ B;  1C4Q A;  4MTN A;  3G71 A;  2JA8 B;  3BDO A;  1JOQ A;  1SE3 A;  1SR3 A;  1L1O B;  3PIO 3;  1TT2 A;  4DV7 Q;  2CHB D;  2KQ3 A;  5K36 G;  4PV1 C;  4IFD G;  4AH6 A;  2F52 A;  2IL8 A;  2KHJ A;  3K5L A;  1X55 A;  1U4R A;  3LNN A;  1F2M A;  5CV8 A;  1KL9 A;  3RMH A;  2BA0 A;  3PMF A;  1ILP A;  1LT4 D;  4ZCK A;  3CF5 A;  1IL2 A;  1PDQ A;  4K6L A;  1EU4 A;  2A1A A;  1TII D;  2V4D A;  2R7Z H;  1HTP A;  3S24 A;  3C2P A;  3BVZ A;  4J1M A;  4P74 A;  3I3C A;  1AH9 A;  3V05 A;  5IT9 E;  5IGE A;  1A6X A;  2XN9 C;  5E7N A;  1DGS A;  4J15 A;  3WDN A;  3J81 E;  4HJA A;  1SNP A;  3EBE A;  1HTL D;  2Q8R E;  3VYR A;  3I4N G;  2RBM A;  2K5H A;  3E9I A;  4UP8 A;  4NXN L;  1GHJ A;  1H9J A;  2F1M A;  2X69 A;  3B6Y A;  3H3V H;  3RN5 A;  2JP1 A;  2JXM B;  3QOL A;  2K14 A;  5E3F A;  3RR5 A;  5K5P A;  1VQM A;  1NMF A;  4POG A;  4FF1 A;  2PMZ B;  4YWM A;  4DV4 L;  3MXG A;  1TWA B;  3GTJ H;  2J4X A;  4DAP A;  3F1Z A;  4FXK C;  3CQZ B;  1J6Q A;  1S40 A;  3H09 A;  2NVQ B;  3G4S A;  2B2V C;  2E5L L;  4DR5 Q;  1CKN A;  3JAM E;  3NXW A;  5FKA C;  1DXM A;  2N55 A;  3PCO B;  5ELC A;  3QWN A;  5KGU A;  1TY2 A;  3U58 A;  3NEN A;  5M3F H;  3R2T A;  2JE6 I;  4IUP A;  5ELD A;  2EXD A;  4HJ7 A;  1DOL A;  4QUC A;  1IYU A;  3UI2 A;  2A73 B;  3EN2 A;  3I4M G;  1LTT D;  1I6H B;  5CV5 A;  2E76 C;  3KF6 A;  1X56 A;  2F0I A;  5LMN Q;  2PO4 A;  5AJ3 L;  2B2W A;  1AE3 A;  4B3S L;  4JCV E;  2LS0 1;  1L2F A;  4C56 C;  2NB0 A;  1PYW D;  4HMJ A;  3PQI A;  2K5W A;  1V1Q A;  1I6V C;  2JEB I;  1X54 A;  4A3L H;  4CGY B;  1GUW A;  1YNJ C;  1C8C A;  1HNZ L;  4JBM A;  1N33 Q;  1H9R A;  2IX0 A;  1LO5 D;  4KD4 A;  1CSP A;  3IAY A;  2LKV A;  1EY8 A;  3A5U A;  1YEZ A;  3TDQ A;  1Z47 A;  2LXK A;  2WP8 J;  1UNS A;  3J7Z C;  1NR2 A;  4KN4 C;  3HOU G;  1K9M C;  1QWY A;  4U68 A;  1HR0 Q;  3D4R A;  1JIC A;  5COY A;  4EQO A;  1K83 B;  1YI2 A;  4YIJ A;  1E24 A;  1H9S B;  5LL6 X;  2A6H C;  3HP3 A;  4ZRZ A;  2JA6 H;  4KV6 A;  3AMU A;  3EFX D;  4ID6 A;  3M4Q A;  5EBD A;  1SRU A;  4A93 G;  1EYA A;  4OWX B;  2K75 A;  4OIK A;  5BN4 A;  5I2X A;  5M5Y B;  1JJG A;  3VA5 A;  4IUQ A;  1W6J A;  3HOW G;  2YTY A;  3GV3 A;  3NBH A;  1VQ5 A;  2HIV A;  2NVT B;  2QW7 A;  1O80 A;  1EUJ A;  4H13 C;  4DNT B;  2UUC L;  1CQV A;  4P72 A;  4M8A A;  1WTR A;  2VW9 A;  5C3X A;  5EPL A;  1HZC A;  4A3B G;  4PQX A;  4NMZ A;  4RKL A;  5IYB H;  3GTG B;  3V2T A;  3M85 A;  1WOC A;  3BZK A;  3RNU A;  3SXH A;  1IZ6 A;  2Y0S E;  1N32 Q;  4QCL A;  3VDY A;  3ER0 A;  4A3I H;  2JA7 H;  3G48 A;  4DK0 A;  4K14 A;  1EL0 A;  5KND A;  2ZM6 L;  1CA5 A;  3P20 A;  4LF8 L;  2QGQ A;  3BU2 A;  4BY7 H;  3E0J A;  1R9T B;  1CSQ A;  2IY5 B;  1LTB D;  1IBL Q;  3FVQ A;  3M3Y B;  1BR9 A;  4C3H H;  2EQS A;  2SNS A;  2A69 C;  4DR4 Q;  1E3P A;  2EY2 A;  2IHE A;  1LM0 A;  2OQK A;  3T4A C;  4B3M Q;  3PUW A;  2O4X A;  4RGO S;  1RL2 A;  1IXR A;  1LTS D;  2JN4 A;  4JG2 A;  5TSS A;  3RZD H;  2SDF A;  1PYB A;  4DR7 L;  1SNQ A;  1WCM G;  1HJP A;  1FD7 D;  3CC7 A;  4DV0 L;  4FF2 A;  1ENF A;  4A76 A;  4WJ4 A;  4A3C H;  3E3X A;  2NVY H;  2KBN A;  1SE4 A;  1EY4 A;  1TWF H;  3CW2 C;  3QG1 A;  3PO2 G;  4DV6 Q;  1HUM A;  3TZD A;  1XNR L;  4RHR A;  5KYI A;  4FNF A;  4GKJ L;  4C3I B;  4XIG S;  1BVS A;  2JSO A;  4B3T Q;  1JWM D;  2HHH L;  4YHH L;  2Z8L A;  5HY6 A;  1V1P A;  4JI3 L;  1SLJ A;  1M8A A;  3I7F A;  1J9O A;  2ZTE A;  3CCS A;  3NK9 A;  5COR A;  3ULJ A;  1T5E A;  3MA2 B;  3T1H Q;  4A3F B;  1PFS A;  3CXC A;  2AHO B;  2ICE C;  2MHV A;  4DR2 L;  1SE8 A;  3J7A V;  2LY7 A;  4KY5 A;  1D6E C;  1PZK D;  3D31 A;  2ZTC A;  1YJN A;  4QGU A;  5EJW A;  3H91 A;  4BS9 A;  2KOL A;  2J0T D;  4K2K A;  1MJE A;  1F77 A;  1VQB A;  4GN5 A;  3TS0 A;  1SYD A;  4PMB A;  3STB C;  3J80 c;  4JI8 L;  1PFM A;  3ICE A;  5C3W A;  4BBR B;  4TQU S;  3PF4 A;  2LXJ A;  3K5N A;  3I4N B;  3S2D B;  1TS4 A;  1QE6 A;  3CD6 A;  4O42 A;  2GN5 A;  3TRZ A;  3KUP A;  4KHP Q;  2I5M X;  2K50 A;  3G7L A;  5DAU A;  1AN8 A;  4A3E H;  1G6P A;  3J80 L;  3J81 i;  1J5E Q;  4N9P A;  2I07 B;  3OW2 A;  2VUM H;  3SK8 A;  4JC0 A;  4EQ5 A;  3KLW A;  4MN3 A;  3HKZ G;  1XNQ L;  1WTH A;  4UDU C;  2TSS A;  5A35 A;  3MVV A;  2CCZ A;  1SE2 A;  4V0B A;  3HG9 A;  1SRO A;  2L0C A;  3BJU A;  1Z7T A;  2B29 A;  3CAM A;  1ZXT A;  4X3U A;  5KNC A;  5C0X I;  3BS1 A;  2EOT A;  3SK6 A;  1X65 A;  1XX8 A;  2HDL A;  2KHS A;  5LMU Q;  1D5Z C;  2EE1 A;  3VR4 A;  5AJ3 Q;  1HZA A;  2K5D A;  1BBW A;  4B3S Q;  1Y1V H;  3JAM i;  5JVH 3;  2R7Z B;  5M3M H;  1QIL A;  4WJW A;  1S4Z A;  3OIP A;  2F0G A;  1JJC B;  4DA2 A;  4HIO A;  3SE0 A;  1VF5 C;  4DXG A;  1JR0 D;  2DGY A;  1I50 H;  2FHT A;  1ONL A;  3F2B A;  1Y8P B;  1LUZ A;  1UE1 A;  2F0H A;  4DF7 A;  1BCP D;  3CCR A;  4DV1 Q;  4O0A A;  2PZU A;  1Y8N B;  4X6A H;  4DV2 Q;  2WAQ G;  2NZ1 D;  3F2D A;  4GN3 B;  4RCN A;  1JE4 A;  5EGT A;  1EWH A;  1I5F A;  2RCN A;  3GDE A;  4GOP B;  4ZKC B;  1BOS A;  3IKJ A;  4A3D G;  1FL0 A;  1SFO H;  5T1I A;  1AEX A;  1Q1B A;  3GTJ B;  2E74 C;  1VQJ A;  3A8J E;  2OT2 A;  3I90 A;  4S3S A;  3CCV A;  1WTP A;  2KCC A;  2EYF A;  2PZW A;  5LMN W;  2L9H A;  2B2T A;  3K6O A;  5JEA J;  2KED A;  4OON A;  1BCP B;  1J8I A;  5JJK A;  1KDC A;  2F0N A;  4YCU A;  1II3 A;  2F0K A;  5C3E G;  1VCI A;  4A3J G;  1PH6 A;  3MXP A;  4LF5 L;  1E1T A;  1SBB B;  2A6H D;  3HOW B;  1KAB A;  1SMY C;  4F7X A;  4DR5 L;  1DZ1 A;  1VQG A;  2MP1 A;  1OXS C;  4K8I A;  3TP8 A;  4DGZ A;  3MHB A;  1I3Q B;  3RN2 A;  4IAL A;  1QUQ A;  4XT1 B;  2HT1 A;  2NN6 I;  2NVT H;  1RCV D;  1WTV A;  5LMN L;  2ZM6 Q;  2MO0 A;  1MD2 D;  4LF8 Q;  5JEA G;  1OO9 B;  2FMM A;  1KHI A;  2WB1 B;  4YY3 L;  4B9W A;  3EVQ A;  1YVC A;  2A5H A;  3I4O A;  4BBS G;  2MFI A;  5C4X G;  5IGG A;  3NBI A;  1S5B D;  3MTS A;  2C9O A;  1KNA A;  3RD4 A;  2B8F A;  2BCO A;  1QZH A;  1I4P A;  2JA6 B;  2X6G A;  2RHQ B;  1RKN A;  1O7Y A;  1SNO A;  3W1G A;  2K5V A;  2NZH A;  3IFT A;  3OWF A;  1Q8K A;  1LAB A;  1ZEQ X;  3PO3 G;  1SYG A;  1EIY B;  2IX3 A;  3S17 B;  2XWB B;  4C1N I;  5BN3 A;  3KYH C;  4ZLT F;  2ID0 A;  3CPW A;  4GLV B;  1IHZ A;  3BDC A;  3EA6 A;  3PIO A;  3CP0 A;  1B53 A;  1CA6 A;  1FJG L;  1VS0 A;  1WTW A;  1KAA A;  1B3Q A;  3X3M A;  3CU7 A;  1STG A;  1SMX A;  1PH8 A;  3KF8 A;  4JBK A;  2N49 A;  3A56 A;  4LW1 A;  1G8Z D;  2DJF C;  5EPJ A;  2A69 D;  2DN8 A;  2BE5 D;  1VF7 A;  1XNR Q;  4K2L A;  2YTV A;  1BDO A;  4IPG A;  1K8A C;  1F2L A;  1GUS A;  1B4O A;  2MPM A;  2C35 B;  1LTL A;  1ESF A;  3TSS A;  3G6E A;  1HQR D;  3NUC A;  4APV A;  4A3I B;  3DM3 A;  1SDF A;  2ENB A;  2EJF C;  4V19 0;  3E9H A;  1HFG A;  4B3R L;  2EDG A;  2R92 G;  1A62 A;  4LMQ D;  5DNF A;  3OSO A;  1IW7 C;  3GTK H;  1ASY A;  1PTO H;  1U4M A;  4MHE A;  4BY7 B;  1P16 A;  2HD3 A;  4IPH A;  2I0Q A;  3VYS A;  1PRT D;  4GNX B;  3GTL B;  3NWS A;  4KD3 A;  4AQY L;  3MXN B;  4JVZ A;  2K03 A;  3J7A F;  4C3H B;  2PQA A;  1PV4 A;  1N32 L;  4DAY B;  1LTI D;  4GN4 B;  1HNX Q;  1VDZ A;  5GRO A;  4FF3 A;  1Q46 A;  5K36 H;  4IFD H;  5DEH A;  3D6C A;  1W2B A;  5FJ8 G;  2HDM A;  3H6M A;  3HGB A;  3RZD B;  1YNN C;  3QR8 A;  3Q24 A;  3HOZ G;  1O7L A;  2JA5 G;  5ELB A;  4OXP A;  4EVO A;  5E1F A;  1QZG A;  1FGB D;  1PRT B;  2Z4I A;  1IBL L;  2R3Z A;  3MFY A;  4LUV A;  2BA1 A;  4LFB L;  1L0X B;  5IT9 c;  3OOC A;  1MI2 A;  1TVX A;  3SGI A;  4DR4 L;  3L9A X;  5FLX c;  1NY4 A;  5A2Q L;  1CHP D;  4UAI A;  4B3M L;  3L7Z C;  2IPK D;  3WOE A;  3HFZ B;  4Q5V A;  3GV6 A;  3I4N H;  4BY1 G;  2PMZ E;  1UE7 A;  3MEF A;  2R6G A;  3PUV A;  1LT6 D;  2H1E A;  5IT9 L;  1EEI D;  3N6R A;  1W6K A;  4N9T A;  1V1O A;  5FLX L;  4X62 L;  3S9W A;  1PH2 A;  1HHV A;  1KD1 C;  2JK8 A;  3KBG A;  4EGV A;  1XTD A;  2DNE A;  3D6W A;  4P73 A;  5GQO A;  1UEB A;  4DV6 L;  3L0O A;  4KKS A;  3W2D A;  5DLQ E;  1EY5 A;  2B2U A;  4A3K G;  4IUV A;  2I5L X;  1VQA A;  4RAU C;  1QNU A;  1AP0 A;  4TKO B;  4RG1 A;  1D5M C;  4TVA B;  4DU9 A;  4B3T L;  1BF4 A;  4OO1 I;  1JQY D;  2EVB A;  2ZJR A;  4OHJ A;  3KJO A;  2KCT A;  4HIM A;  2NVX B;  1LYL A;  1KAW A;  1MKH A;  5FLM G;  1UWV A;  1JOR A;  3D0F A;  4UHV A;  1LTA D;  3T1H L;  3I4M H;  4J6H A;  2B2T C;  2Y0S G;  2QIL A;  4IUR A;  2DY7 A;  2N8N A;  3KF6 B;  5FO9 B;  4A3E B;  2A6E D;  4C1N K;  2VUM B;  1JCK B;  1AW7 A;  2L11 A;  2NUC A;  2OQ0 A;  1JC7 A;  2WFW A;  4KJO A;  4A3D B;  1CFM A;  4OIJ A;  1IBK L;  1NNX A;  1ZYR C;  3R3O A;  1STA A;  4CKE A;  3K7U C;  1MJC A;  2PCF B;  3AQQ A;  1PZI D;  1ENA A;  4YWL A;  1YJ9 A;  2N3S A;  3CRL C;  2AQ1 B;  3SHL A;  4KHP L;  2NYZ D;  3NPP A;  1VQ9 A;  3GTQ B;  1J5E L;  3KK7 A;  1E7Z A;  1CZW A;  4ULL A;  2EJG C;  4PZ7 A;  4BWG B;  3OW7 A;  4IOC A;  2A68 C;  4LF5 Q;  2Q8I B;  1O7I A;  2K4K A;  4Q0F A;  5C3E B;  1Y1V B;  3HOU H;  4WOR A;  5M3M B;  5FK9 C;  5M9O A;  3HOY G;  5GAD C;  4HJ8 A;  4FF4 A;  1RD9 D;  4GZY C;  3VYU A;  1K28 A;  3A8I E;  2B39 A;  1I50 B;  1Q3L A;  1LAC A;  4X65 Q;  2L55 A;  4A3G G;  1L1O A;  5IGB A;  4KHV A;  4A93 H;  1I4G A;  5LMU L;  4QF4 A;  4DPG A;  3W5O A;  2QCP X;  1PH5 A;  5C4J H;  1CI3 M;  3TBI B;  1STY A;  2D0P A;  1BCP F;  5FO7 B;  3HOW H;  2KVM A;  1SMY D;  4CDD C;  4YY3 Q;  4H44 C;  4DNR B;  3IL8 A;  2QF7 A;  4IPC A;  1YIJ A;  3S16 B;  1TY0 A;  1SFO B;  4NP5 A;  2CH4 A;  4NPS A;  4DUY L;  3U50 C;  1PFB A;  1I3Q H;  2EY5 A;  2R93 G;  2RF4 A;  3EQL C;  4F88 A;  4A3B H;  1NBW A;  4KK7 A;  4JYA Q;  1S5D D;  2CW0 C;  2TMP A;  3I8Z A;  1CTM A;  1S5C D;  4KLK A;  5C4X B;  1TS3 A;  1E22 A;  5ELF A;  4DV1 L;  1NUC A;  3H3V I;  4IUN A;  4DV2 L;  3OYY A;  1Q86 C;  1WTQ A;  2OTJ A;  2SEB D;  3CCM A;  4IUT A;  2B2Y A;  2OWO A;  1GVP A;  2WIN B;  2B63 G;  1F9S A;  1X3G A;  4L63 B;  4QUF A;  1FJG Q;  1QVC A;  1SEB D;  4JI2 Q;  1NR4 A;  3P75 A;  3CME A;  1TKW B;  4ZKB B;  3X3N A;  2QEJ C;  1XMQ Q;  1RJT A;  2XRQ D;  2OTL A;  3KJP A;  3HS0 C;  1MHW C;  1PFN A;  3M7N A;  3S1Q H;  5IOD A;  3KLR A;  2NWG A;  1KRS A;  1STN A;  1D1K A;  2F0E A;  3S17 H;  4CJ0 B;  1WD1 A;  2K32 A;  3H0G G;  4AYB E;  5EKK A;  1OXX K;  4DAM A;  2M9V A;  4DFA A;  4B3R Q;  2K7V A;  2K33 A;  5C4Z A;  5JVG 3;  4Y7N H;  2ZJP A;  3I73 A;  3ONA B;  4FXD A;  2V1C C;  4YWK A;  1L0W A;  4GKK L;  5G3L D;  1GXD C;  3QIA A;  1WCM H;  1KDB A;  4IJH A;  4XDX A;  4DR3 Q;  2VNU D;  3OMC A;  2R92 B;  1MBY A;  2IHF A;  3GO5 A;  4AQY Q;  4RH6 A;  3K8A A;  1F9Q A;  1DCZ A;  3ZJY C;  3MEH A;  3A5Z B;  4R1J A;  3PO2 H;  3NQI A;  2PNR C;  4NB3 A;  4CDF C;  2F0T A;  3TP7 A;  1U9R A;  2XVS A;  4NW2 A;  3A0J A;  2Q2U A;  4GLX A;  3AFP A;  2F0U A;  1SNM A;  1JB3 A;  1AZP A;  1IW7 D;  5I6W A;  1XXG A;  3NSW A;  3J81 j;  2YU9 H;  3K57 A;  2JEA I;  3GTO B;  3PUY A;  2G9D A;  4LF6 Q;  3GTL H;  5BN5 A;  1STB A;  4K5V A;  4OL7 A;  2VQE Q;  1PTO D;  4KTA A;  4L8J A;  5NUC A;  1D2B A;  5I6Y A;  2VL6 A;  3FKI G;  2EYO A;  3NE5 B;  4LFB Q;  3VR6 A;  2ZXO A;  3NEM A;  1H9S A;  2PPB C;  1ESR A;  3BZC A;  1KDA A;  1YNN D;  3NEL A;  1UE5 A;  1UE6 A;  3KLS X;  1Y1W G;  1EZ8 A;  3BYY B;  4X62 Q;  2WKC A;  4RMF A;  3GTK B;  3Q0A A;  1PTO B;  5IYC G;  3K59 A;  2PYK A;  5ELN A;  2KHI A;  3F2U A;  2HUG A;  3A55 A;  2K28 A;  2BH8 A;  2H5X A;  3FHW A;  5J1Z A;  5JOB A;  5J3B A;  1A3V A;  1PRT F;  5KIX A;  4R8I A;  1JE5 A;  5KYL A;  2AKW B;  4A3K B;  4G4K A;  3U4Z A;  3M4O H;  1PZJ D;  1B3A A;  2CQO A;  1Q12 A;  3M9B A;  1EY0 A;  1X3F A;  4IQZ A;  1XYI A;  1D1I A;  2Y0S B;  4P71 A;  3UDX A;  2J7Z A;  5C44 G;  4OWW B;  1HNX L;  5E4X A;  1AFP A;  1CT1 D;  1IBK Q;  1TR5 A;  1STH A;  1A63 A;  1DOM A;  4K0K Q;  4EQP A;  1WD0 A;  2NVX H;  4C2M H;  1Q90 A;  1YZ6 A;  2K52 A;  5C0X J;  3PUZ A;  4H0L C;  1B2T A;  2X6L A;  1M90 C;  4HR7 B;  4HED A;  1L1O C;  1TXY A;  3I2Z A;  2L15 A;  1C9O A;  2B2W C;  4BXX G;  4YCV A;  2JJQ A;  4A3D H;  4JI4 L;  1JWS D;  1CZG A;  1ZYR D;  2XNA C;  1EFI D;  1VQF A;  1Q82 C;  1XMO Q;  3BDL A;  1XPR A;  1P8L A;  1ICW A;  1YHQ A;  3CHB D;  3IFD A;  3AU7 A;  3GTQ H;  3OHX C;  1CM9 A;  1WTO A;  5C3E H;  1GOZ A;  3I4M B;  4A3J H;  5FO8 B;  1Z9F A;  5C0X G;  3ZYY X;  1VMP A;  1ML0 D;  4HN7 A;  2E75 C;  4AIM A;  2D9U A;  4JI7 Q;  2B2Y C;  2R7F A;  4ZYS A;  4WRD A;  4DUY Q;  2JA8 G;  4RKB A;  1HPC A;  2FMC A;  4DN4 M;  3SK5 A;  3ERS X;  1LTG D;  1U5K A;  3MC0 B;  1XPO A;  4ME3 A;  1B7Y B;  3RUZ A;  4LF9 L;  4CJ1 B;  1SSO A;  4I7A A;  1SAP A;  1ZKO A;  3PIP 3;  2HQL A;  3VR5 A;  2WB1 E;  4QIW B;  2AUJ D;  1GUT A;  4IJL A;  4OEM B;  1SN8 A;  3Q22 A;  4CKC A;  1HZB A;  3OPO A;  1AE2 A;  2CVR A;  3TP5 A;  3S16 H;  1SNC A;  1C0A A;  5JEA H;  1Y14 B;  3ERO A;  4YCW A;  2SOB A;  1IYJ B;  3R8B A;  1YNJ D;  1EY7 A;  1QB5 D;  4XXE A;  3HOU B;  1KLU D;  4BBS H;  3H94 A;  4ZK9 B;  2CW0 D;  5C4X H;  3PGZ A;  4LFA L;  2OCE A;  3G6J B;  5CGK A;  3LWE A;  1BUV T;  1NAP A;  4JPB W;  5IGC A;  2AQ3 B;  5GAG C;  4DAV A;  1K3B C;  2G5D A;  1PHJ A;  1TS2 A;  3M7G A;  2WV6 D;  3BZD B;  2ZXP A;  5EKL A;  4A93 B;  4DK3 C;  1BO0 A;  1GHK A;  3PO3 H;  4QB4 A;  3UDF A;  5C4J B;  1K0R A;  4J8Q A;  2XGT A;  1SXT A;  3FPP A;  3HZX A;  3EJI A;  4GKK Q;  1K8G A;  3DM1 A;  2MJ8 A;  4JOI A;  5D3I B;  2VS1 A;  4PZ8 A;  4ABN A;  4ZUI A;  4FYD A;  1I4Q A;  2UXD Q;  3ULP A;  4DV3 L;  2KCM A;  5CV4 A;  1MIU A;  2QDB A;  1M1K C;  1I94 L;  5L37 A;  4A3B B;  4X65 L;  1Q8I A;  1TS5 A;  3W1B A;  1EQR A;  2WKD A;  4N8X 1;  1IBM Q;  3U9S A;  4NXM L;  1TQO A;  4FXG C;  2M00 A;  4PG3 A;  4H7B A;  1VQH A;  5GAE C;  2GVA A;  1DM0 B;  2VB2 X;  1KRT A;  3D3R A;  1VQN A;  2RHS B;  5D65 A;  4A75 A;  1EYG A;  2F0J A;  1YJW A;  1TU2 B;  4LF7 Q;  2NN6 G;  1ENC A;  2VZA A;  1H9K A;  1XPU A;  2CH4 W;  3DLL A;  2Q2I A;  4TRD A;  2HQE A;  3K80 C;  1HFN A;  5IY0 A;  2R92 H;  1SND A;  2XSC A;  1RTN A;  1GM5 A;  2Q8T A;  5I9O A;  4PZ6 A;  2IX1 A;  3UE0 A;  2QKI C;  4GOP A;  4X3K A;  4DK6 C;  5HGQ A;  1WJJ A;  4DXF A;  3KDF B;  2HCC A;  1K3R A;  2KEC A;  5D3D A;  3VR2 A;  2F0Q A;  4JYA L;  3QOJ A;  4MIU A;  3SEB A;  4BA1 I;  2L12 A;  3WOF A;  1F9R A;  5IOC A;  5T1G A;  1HNW Q;  2E2J B;  1A15 A;  1XJV A;  3T13 A;  1EYD A;  3MFG A;  3S1Q B;  3AEV A;  4GLA C;  2NTT A;  3FKI B;  3HOX G;  5LHY 1;  2EZV A;  2MNA A;  1ASZ A;  1TWC H;  2PW7 A;  3TRE A;  2FIN B;  3D8G A;  1EQV A;  1YIT A;  1CKM A;  1N36 Q;  5JPM C;  1FR3 A;  3GTO H;  5IE8 A;  5FJ8 H;  4JI2 L;  4HTH A;  4Y7N B;  2F4I A;  2O2L D;  3HOZ H;  2JA5 H;  3P1H A;  2KEN A;  1WCM B;  1JMC A;  1XMQ L;  4LFC Q;  3J7A 5;  5IGF A;  2F0F A;  4RHS A;  1DJR D;  1QVG A;  1IYV A;  2ATW A;  1ILQ A;  1CQF A;  4K5W A;  4LUO A;  5DM6 3;  2F03 A;  3PO2 B;  3TS2 A;  4CJ2 C;  2Z4H A;  2IW3 A;  1STE A;  2NZO A;  1QVF A;  3TP6 A;  2VQF Q;  3E6Z X;  2B8G A;  4BY1 H;  1NE3 A;  2L5T A;  3DUZ A;  1RTO A;  2YU9 B;  1HUN A;  5HUR A;  4CDC C;  2F3I A;  5ISR A;  2UXB Q;  4DR3 L;  3BYT B;  4WFN 3;  4UP9 A;  3E0E A;  3SVM A;  5CYU A;  1WVL A;  4F87 A;  4G57 A;  5HGT A;  1G29 1;  3NP8 A;  1PTO F;  4A3K H;  2R7D A;  2RDF A;  5GAH C;  2FFK B;  5C44 B;  4Y52 H;  1VQO A;  2P5Z X;  4DKA C;  2WAC A;  3FRP B;  4L5T A;  3I55 A;  1X6O A;  1VQL A;  4B9X A;  4LF6 L;  2D62 A;  5FLM H;  2VQE L;  1X9N A;  2QEX A;  1S5F D;  1T5X D;  1BNZ A;  4JI0 L;  1BXT A;  4HJ5 A;  1IKL A;  2EPB A;  1PLF A;  2F0W A;  2F0V A;  4JI4 Q;  3I72 A;  3S1N H;  2CWP A;  3NHH A;  3S1M H;  4RA8 A;  1Z6H A;  3STB D;  3J81 c;  2HCI A;  1V8Q A;  3GQB A;  3HKZ B;  5M5X H;  1UUP A;  3A7L A;  3TZU A;  3NQT A;  2IT1 A;  3MZ5 A;  5IP9 G;  4LNQ A;  5D14 A;  5IYD G;  4HSP A;  5CV9 A;  3J81 L;  4DUZ Q;  1WTX A;  4FVM A;  3M4O B;  2HIX A;  4KJN A;  2JA9 A;  2E2I B;  1D7Q A;  1GJX A;  3SR1 A;  2JQO A;  2KUM A;  3T51 B;  4AYB G;  4KY6 A;  5IP7 G;  3CCU A;  3FMC A;  3RZO B;  2EIF A;  3FP9 A;  1KLG D;  3HOY H;  1EQT A;  4GNX A;  3JAM c;  2K5N A;  4LF9 Q;  1CKN B;  2RA4 A;  4HCS A;  3MXN A;  2ZJQ A;  4IFD I;  2SNM A;  1I4R A;  2Z6K A;  4R4I A;  1JWU D;  4Z9C B;  2EYM A;  2WII B;  3A8K E;  4DAY A;  4C2M B;  4C3I G;  3GTP B;  2VXW A;  3K0X A;  1S3O A;  2F0O A;  3KBX A;  5I2Y A;  1K73 C;  2UUA Q;  1S5E D;  4A3G H;  1LTR D;  1L0Y B;  4ALP A;  1WFQ A;  3NTH A;  4KY7 A;  1CK1 A;  4HJ9 A;  1N34 Q;  3JAM L;  4OO1 G;  1B44 D;  2WAQ B;  3T1Y Q;  2IWH A;  3U4V A;  3BVG A;  3DXJ C;  3HOV G;  4B08 A;  1KXL A;  1PA6 A;  4A3F G;  1LT5 D;  4JBJ A;  1HH2 P;  1JOK A;  1KTK A;  3A74 A;  4OEL B;  2F4V Q;  3GTM B;  4C3J G;  2UXC L;  4A3M G;  3CKI B;  4LFA Q;  5A2Q E;  1YBY A;  5ELE A;  4K0K L;  1EY6 A;  4DV5 Q;  2R93 H;  2EYJ A;  4JOI C;  1VQ4 A;  2EXZ A;  3AYH B;  2VY3 A;  3J80 i;  2PW5 A;  2IJ0 A;  4HID A;  1EQQ A;  5FLX E;  2D2C C;  1FVI A;  4X66 Q;  3R2I A;  2ALY B;  2F0L A;  4BBR G;  4FP5 D;  1U0L A;  1EY9 A;  1X3Q A;  2N78 A;  2GA4 B;  4A3J B;  4KKU A;  1HZ9 A;  2B63 H;  3MWY W;  1CKO A;  4PNY A;  3C3L A;  3OIQ A;  2MO1 A;  1TWG H;  5EQ0 A;  3Q6S A;  1HXY D;  2OF1 A;  2OXP A;  4DV3 Q;  4XTC S;  3H3V C;  1XMO L;  1I94 Q;  4ME5 A;  1R4Q B;  1B70 B;  4NXM Q;  4GOP C;  1IL8 A;  1M4V A;  2KEE A;  3H0G H;  2FXQ A;  3NBH B;  5JAV A;  3RLN A;  3K5M A;  3R93 A;  4JV5 Q;  4HCE A;  1O7Z A;  4JI7 L;  1PH7 A;  1EWC A;  3BVM A;  1N9W A;  3DHQ A;  4R4Q A;  1BCP C;  5CMD A;  5M5W B;  2R7Z G;  1FNU A;  1W3S A;  4BBS B;  3I56 A;  2OEO A;  5F2D A;  1IKM A;  2RVL A;  2O5I C;  5J39 A;  2Z0S A;  5C5L A;  1HA5 A;  2KA7 A;  1A0I A;  2MQH A;  2NBF A;  3CCQ A;  3O13 A;  4CDE C;  1PMR A;  2AQ2 B;  3K7A H;  1KNE A;  1SJE D;  1U4L A;  2DUD A;  4DR1 Q;  3PO3 B;  4JK1 C;  4KI0 A;  2UUB Q;  1A2U A;  3HOX B;  2F0S A;  3S14 B;  4X64 Q;  3T16 A;  3OTO Q;  2C5C A;  3C1E A;  3HRZ C;  2E8G A;  5FOB B;  3AB9 A;  2E2J H;  4KMU C;  3NTK A;  3V96 A;  3FKI H;  1H9M A;  5M3F G;  1OXV A;  3Q8D A;  1D8L A;  4L5Q A;  2CWA A;  3S15 H;  1EYC A;  3PV0 A;  4NKL A;  2M2L A;  1DON A;  1Y1W H;  4NDX A;  1PH4 A;  2G9H D;  4CBV A;  1QG7 A;  2K01 A;  2LSS A;  1NTG A;  3TME A;  1UEA B;  4HAE A;  5H1S E;  4JI5 Q;  2UXD L;  1BQQ T;  2ICI A;  4FDB A;  4JW0 A;  3DWA A;  4XT3 B;  5IYC H;  4IN3 A;  1NMG A;  3Q23 A;  1IBM L;  4QMG A;  3UDI A;  3F2C A;  2Z9H A;  4ZAI A;  2QA4 A;  4A3L G;  3J7Y W;  3KLS A;  1E0B A;  4QY7 A;  1VQE A;  1PXU A;  1TWC B;  1K8M A;  1OTC A;  4LF7 L;  4R8N A;  4DR6 L;  2BH2 A;  1EEF D;  1VMC A;  3A54 A;  1V1P B;  1SYB A;  1VQI A;  3RLO A;  2Q2T A;  4JI0 Q;  1OXU A;  1G6Z A;  2WB1 G;  4E6I A;  3HOZ B;  3DEO A;  2JA5 B;  1E2W A;  4MZ9 A;  4OX9 Q;  4OGQ C;  1FNV A;  1CUK A;  4HIK A; 
#chains in the Genus database with same CATH homology
 3NWT A;  1F2Z A;  4RCO A;  1HCZ A;  2ZXR A;  2B2U C;  1GUG A;  4KHZ A;  2F3W A;  3NTI A;  1TWH B;  2KJX A;  4CHT B;  1FYC A;  5CBE E;  2L1B A;  4PMC A;  5CR3 A;  4BY1 B;  2EYH A;  4EQN A;  2BE5 C;  4ZQ3 A;  2DNC A;  3CRK C;  3DWQ A;  3ND9 A;  2F0P A;  4G7H C;  2I46 A;  1B1Z A;  3U9O A;  4G7O C;  4XYQ A;  2XRS D;  3SK4 A;  3S2H B;  2BDN A;  2MUY A;  4K8J A;  3T56 B;  4AYB B;  4RGN A;  1D5X C;  2CQA A;  2PQE A;  3RLF A;  2H4O A;  1I4H A;  3I91 A;  4JBW A;  2L4N A;  1QCB D;  2F3V A;  3QB3 A;  1PRT C;  3S1R B;  1ET6 A;  2VB3 X;  5E4W C;  1DD2 A;  4L6T B;  4DK1 A;  2Z1C A;  1A3T A;  2AWO A;  1EZ6 A;  5C0X H;  1X3P A;  3T53 B;  1MSG A;  1B50 A;  5I4D A;  3S1N B;  1RDP D;  3S1M B;  3HOV B;  3K58 A;  4C3H G;  4U67 3;  5M5X B;  4M1U B;  3K0Y A;  4C3J B;  4IZ8 A;  4A3M B;  1QOH A;  2K04 A;  5EPK A;  1I4X A;  3I4L A;  2RDH A;  2EY6 A;  4LJZ C;  3D4W A;  1E2V A;  1A3U A;  3TN2 A;  1A2T A;  3OMG A;  3DWP A;  4KKT A;  4XQJ A;  3URY A;  4PMW A;  5C6A A;  1ROD A;  3MAQ A;  3HOY B;  3ITP A;  2RDG A;  1B9N A;  1CHQ D;  5I9P A;  3K5O A;  1G2T A;  2AWN A;  4I7Z C;  4XYO A;  2A68 D;  1HRJ A;  4A3G B;  2LMC B;  3GD7 A;  2K5Q A;  1JOO A;  1Q1E A;  4ZUJ A;  1EOT A;  1RHP A;  3W3A A;  3M4Y A;  2D5D A;  1DYQ A;  3FEW X;  3I70 A;  3QO2 A;  2K6A A;  4RFB A;  1AZQ A;  1C48 A;  2R93 B;  1RF2 D;  3ERQ A;  2A6E C;  4K5X A;  1QNK A;  3J80 E;  3D4D A;  2NN6 H;  4ILW A;  1B9M A;  2B63 B;  4HMI A;  4F8M A;  3FPU B;  2KCN A;  2DY8 A;  2RQX A;  1TWG B;  4O1N A;  5IIF A;  5C4H A;  3VA7 A;  3C1F A;  3P7J A;  5DM7 3;  3HEJ A;  5CV7 A;  2FJ2 A;  4TSS A;  2YYZ A;  1V43 A;  4RGT A;  1SYF A;  3LWU A;  1SYC A;  5CV6 A;  1NSN S;  3H0G B;  3VYT A;  4I65 A;  1XWE A;  2K1B A;  2XWJ B;  2F0M A;  5M3F B;  1OXT A;  4LAA A;  2LFN A;  3DMU A;  5IGD A;  2F0D A;  1EIH A;  1HQM C;  3DEP A;  3BG3 A;  5J22 A;  5C5M A;  4FO2 A;  1O78 A;  4X3S A;  1R4P B;  1SJH D;  3GP7 A;  4ODG A;  2NTS A;  3K7A B;  4K6D A;  2EYL A;  2EJM A;  3FDT A;  3LX0 A;  4RWS C;  4LK1 C;  1EU3 A;  1F2Y A;  2B2V A;  2EYP A;  1BBX C;  5KRU A;  1XTC D;  3QJY A;  3PUX A;  5JJZ A;  4X3T A;  5JPN C;  3S15 B;  4R9W A;  2XIW A;  5EBC A;  1Y1W B;  2E2D C;  1X32 A;  1ET9 A;  1FNW A;  1GUO A;  4RGM A;  2EY1 A;  5G3L F;  2JYO A;  5LL6 S;  3SDZ A;  1EIG A;  1K8O A;  2BDO A;  1MGS A;  2A74 C;  3L3O C;  1LLR D;  1UAP A;  1F9P A;  3OWE B;  2N88 A;  3E5S A;  1NCV A;  1E2Z A;  2JA7 B;  1G91 A;  4IUU A;  5CC4 A;  1MSH A;  1Y8O B;  2PZT A;  2RSO A;  5KEE A;  2O5J C;  5KNB A;  2MGS A;  2AUK A;  4XQQ A;  2RSN A;  2BOS A;  3N52 A;  4CKB A;  1PTO C;  2RKS A;  2ZT9 C;  1LV9 A;  1Y69 U;  3MXU A;  3A7A B;  4OO1 H;  5AFW A;  5CBA E;  1DOK A;  4KN7 C;  1QJO A;  4IFD J;  1HA6 A;  5EKI A;  4XQN A;  4BA2 I;  2K05 A;  1GUN A;  4HSV A;  2NVY B;  1U4P A;  1TWF B;  2R61 A;  4G7Z C;  4P2C B;  3VR3 A;  2E2H B;  3ND8 A;  1G2S A;  3C46 A;  1SYE A;  1LT3 D;  1C4Q A;  2JA8 B;  3BDO A;  1JOQ A;  1SE3 A;  3PIO 3;  1TT2 A;  2CHB D;  2KQ3 A;  5K36 G;  4PV1 C;  4IFD G;  2IL8 A;  3K5L A;  1U4R A;  3LNN A;  1F2M A;  5CV8 A;  3RMH A;  2BA0 A;  3PMF A;  1ILP A;  1LT4 D;  1PDQ A;  4K6L A;  1EU4 A;  1TII D;  2V4D A;  1HTP A;  3C2P A;  3BVZ A;  4J1M A;  3I3C A;  3V05 A;  5IT9 E;  5IGE A;  1A6X A;  2XN9 C;  3WDN A;  3J81 E;  1SNP A;  1HTL D;  2Q8R E;  3VYR A;  2RBM A;  1GHJ A;  1H9J A;  2F1M A;  2X69 A;  2JP1 A;  2JXM B;  3QOL A;  5E3F A;  5K5P A;  4FF1 A;  2PMZ B;  3MXG A;  1TWA B;  2J4X A;  4DAP A;  4FXK C;  3CQZ B;  3H09 A;  2NVQ B;  2B2V C;  3JAM E;  3NXW A;  5FKA C;  1DXM A;  2N55 A;  5ELC A;  5KGU A;  3QWN A;  1TY2 A;  3R2T A;  2JE6 I;  4IUP A;  5ELD A;  1DOL A;  4QUC A;  1IYU A;  3UI2 A;  2A73 B;  1LTT D;  1I6H B;  5CV5 A;  2E76 C;  2F0I A;  2PO4 A;  2B2W A;  2LS0 1;  4C56 C;  2NB0 A;  1PYW D;  4HMJ A;  2K5W A;  1I6V C;  2JEB I;  4CGY B;  1GUW A;  1YNJ C;  1C8C A;  1H9R A;  2IX0 A;  1LO5 D;  4KD4 A;  3IAY A;  2LKV A;  1EY8 A;  3TDQ A;  1Z47 A;  2WP8 J;  1UNS A;  1NR2 A;  4KN4 C;  1QWY A;  4U68 A;  3D4R A;  1JIC A;  5COY A;  4EQO A;  1K83 B;  4YIJ A;  5LL6 X;  1H9S B;  2A6H C;  3HP3 A;  4ZRZ A;  4KV6 A;  3AMU A;  3EFX D;  4ID6 A;  5EBD A;  1EYA A;  4OIK A;  5BN4 A;  5I2X A;  5M5Y B;  3VA5 A;  4IUQ A;  1W6J A;  3NBH A;  3GV3 A;  2NVT B;  1O80 A;  4H13 C;  4DNT B;  1CQV A;  4M8A A;  1WTR A;  5C3X A;  5EPL A;  4PQX A;  4NMZ A;  4RKL A;  3GTG B;  3V2T A;  3M85 A;  3SXH A;  4QCL A;  4DK0 A;  4K14 A;  1EL0 A;  5KND A;  1CA5 A;  3P20 A;  3E0J A;  1R9T B;  1LTB D;  3FVQ A;  3M3Y B;  1BR9 A;  2SNS A;  2A69 C;  2EY2 A;  3T4A C;  3PUW A;  2O4X A;  4RGO S;  1LTS D;  5TSS A;  2SDF A;  1SNQ A;  1FD7 D;  4FF2 A;  1ENF A;  1SE4 A;  1EY4 A;  3QG1 A;  1HUM A;  3TZD A;  4RHR A;  5KYI A;  4FNF A;  4C3I B;  4XIG S;  2JSO A;  1JWM D;  2Z8L A;  1V1P A;  1M8A A;  1J9O A;  3NK9 A;  5COR A;  1T5E A;  3MA2 B;  4A3F B;  2ICE C;  2MHV A;  3J7A V;  2LY7 A;  4KY5 A;  1D6E C;  1PZK D;  3D31 A;  5EJW A;  3H91 A;  4BS9 A;  2KOL A;  2J0T D;  4K2K A;  1F77 A;  1SYD A;  4PMB A;  1PFM A;  5C3W A;  4BBR B;  4TQU S;  3I4N B;  3K5N A;  3S2D B;  1TS4 A;  1QE6 A;  4O42 A;  3KUP A;  3G7L A;  5DAU A;  1AN8 A;  3J80 L;  4N9P A;  2I07 B;  3SK8 A;  4MN3 A;  4UDU C;  2TSS A;  5A35 A;  3MVV A;  1SE2 A;  4V0B A;  3HG9 A;  2L0C A;  1Z7T A;  4X3U A;  1ZXT A;  5KNC A;  5C0X I;  3BS1 A;  2EOT A;  3SK6 A;  1XX8 A;  2HDL A;  2KHS A;  1D5Z C;  2EE1 A;  3VR4 A;  2K5D A;  5JVH 3;  2R7Z B;  1QIL A;  4WJW A;  1S4Z A;  3OIP A;  2F0G A;  4DA2 A;  3SE0 A;  1VF5 C;  4DXG A;  1JR0 D;  2FHT A;  1ONL A;  1Y8P B;  2F0H A;  4DF7 A;  1BCP D;  2PZU A;  1Y8N B;  2NZ1 D;  4RCN A;  1JE4 A;  5EGT A;  1EWH A;  4ZKC B;  1BOS A;  3IKJ A;  5T1I A;  1AEX A;  1Q1B A;  3GTJ B;  2E74 C;  3A8J E;  2OT2 A;  3I90 A;  4S3S A;  1WTP A;  2KCC A;  2EYF A;  2PZW A;  2L9H A;  2B2T A;  3K6O A;  5JEA J;  2KED A;  1BCP B;  1J8I A;  1KDC A;  2F0N A;  1II3 A;  2F0K A;  1VCI A;  3MXP A;  1SBB B;  3HOW B;  2A6H D;  1KAB A;  1SMY C;  4F7X A;  1DZ1 A;  2MP1 A;  1OXS C;  4K8I A;  3TP8 A;  4DGZ A;  3MHB A;  1I3Q B;  4IAL A;  4XT1 B;  2NN6 I;  1RCV D;  1WTV A;  1MD2 D;  5JEA G;  1OO9 B;  2FMM A;  2WB1 B;  4B9W A;  3EVQ A;  2A5H A;  5IGG A;  3NBI A;  1S5B D;  3MTS A;  2C9O A;  1KNA A;  3RD4 A;  2B8F A;  2BCO A;  2JA6 B;  1I4P A;  1RKN A;  1O7Y A;  2X6G A;  1SNO A;  3IFT A;  3OWF A;  1LAB A;  1ZEQ X;  1SYG A;  2IX3 A;  3S17 B;  2XWB B;  4C1N I;  5BN3 A;  4ZLT F;  2ID0 A;  1IHZ A;  3BDC A;  3EA6 A;  1B53 A;  1CA6 A;  1WTW A;  1KAA A;  3X3M A;  3CU7 A;  1STG A;  3KF8 A;  3A56 A;  1G8Z D;  5EPJ A;  2A69 D;  2DN8 A;  2BE5 D;  1VF7 A;  4K2L A;  1BDO A;  1F2L A;  1GUS A;  1B4O A;  2MPM A;  1ESF A;  3TSS A;  1HQR D;  3NUC A;  4A3I B;  1SDF A;  2ENB A;  2EJF C;  4V19 0;  1HFG A;  2EDG A;  4LMQ D;  5DNF A;  3OSO A;  1IW7 C;  1PTO H;  1U4M A;  4MHE A;  4BY7 B;  3VYS A;  1PRT D;  3GTL B;  3NWS A;  4KD3 A;  2K03 A;  3J7A F;  4C3H B;  1LTI D;  1VDZ A;  4FF3 A;  5K36 H;  4IFD H;  5DEH A;  3D6C A;  2HDM A;  3H6M A;  3HGB A;  3RZD B;  1YNN C;  3Q24 A;  1O7L A;  5ELB A;  4EVO A;  5E1F A;  1FGB D;  1PRT B;  2Z4I A;  2R3Z A;  3MFY A;  2BA1 A;  1L0X B;  3OOC A;  1MI2 A;  1TVX A;  3L9A X;  5A2Q L;  1CHP D;  4UAI A;  3L7Z C;  2IPK D;  3WOE A;  4Q5V A;  3GV6 A;  2R6G A;  3PUV A;  1LT6 D;  2H1E A;  5IT9 L;  1EEI D;  3N6R A;  1W6K A;  4N9T A;  1V1O A;  5FLX L;  3S9W A;  1HHV A;  3KBG A;  4EGV A;  2DNE A;  3D6W A;  4KKS A;  3W2D A;  1EY5 A;  2B2U A;  4IUV A;  4RAU C;  1QNU A;  1AP0 A;  4TKO B;  1D5M C;  4DU9 A;  4OO1 I;  1BF4 A;  1JQY D;  2EVB A;  4OHJ A;  2NVX B;  1JOR A;  1LTA D;  4J6H A;  2B2T C;  2QIL A;  4IUR A;  2DY7 A;  5FO9 B;  4A3E B;  2A6E D;  4C1N K;  2VUM B;  1JCK B;  1AW7 A;  2L11 A;  2NUC A;  1JC7 A;  4KJO A;  4A3D B;  1CFM A;  4OIJ A;  3R3O A;  1ZYR C;  1STA A;  4CKE A;  2PCF B;  1PZI D;  1ENA A;  3CRL C;  2AQ1 B;  3SHL A;  2NYZ D;  3NPP A;  3GTQ B;  3KK7 A;  1CZW A;  4ULL A;  2EJG C;  4BWG B;  3OW7 A;  2A68 C;  2Q8I B;  5C3E B;  4Q0F A;  1Y1V B;  4WOR A;  5M3M B;  5FK9 C;  5M9O A;  4FF4 A;  1RD9 D;  4GZY C;  3VYU A;  3A8I E;  2B39 A;  1I50 B;  1Q3L A;  1LAC A;  2L55 A;  5IGB A;  4KHV A;  1I4G A;  4QF4 A;  2QCP X;  1CI3 M;  3TBI B;  1STY A;  1BCP F;  5FO7 B;  2KVM A;  1SMY D;  4H44 C;  4DNR B;  3IL8 A;  2QF7 A;  3S16 B;  1TY0 A;  1SFO B;  4NP5 A;  1PFB A;  2EY5 A;  3EQL C;  4F88 A;  4KK7 A;  1S5D D;  2CW0 C;  2TMP A;  3I8Z A;  1CTM A;  1S5C D;  5C4X B;  1TS3 A;  5ELF A;  1NUC A;  4IUN A;  1WTQ A;  2SEB D;  4IUT A;  2B2Y A;  2WIN B;  1F9S A;  4L63 B;  4QUF A;  1SEB D;  1NR4 A;  3P75 A;  1TKW B;  4ZKB B;  3X3N A;  2QEJ C;  1RJT A;  2XRQ D;  3HS0 C;  1PFN A;  3M7N A;  5IOD A;  3KLR A;  2NWG A;  1STN A;  1D1K A;  2F0E A;  4CJ0 B;  1WD1 A;  2K32 A;  5EKK A;  1OXX K;  2M9V A;  4DFA A;  2K7V A;  2K33 A;  5C4Z A;  5JVG 3;  4FXD A;  3I73 A;  3ONA B;  5G3L D;  1GXD C;  3QIA A;  1KDB A;  4XDX A;  2VNU D;  3OMC A;  2R92 B;  1MBY A;  3GO5 A;  4RH6 A;  1F9Q A;  1DCZ A;  3MEH A;  3NQI A;  2PNR C;  2F0T A;  3TP7 A;  1U9R A;  2XVS A;  4NW2 A;  2F0U A;  1SNM A;  1JB3 A;  1AZP A;  1IW7 D;  5I6W A;  1XXG A;  3NSW A;  2JEA I;  3K57 A;  3GTO B;  3PUY A;  2G9D A;  5BN5 A;  1STB A;  4K5V A;  4OL7 A;  1PTO D;  4KTA A;  4L8J A;  5NUC A;  1D2B A;  5I6Y A;  2EYO A;  3NE5 B;  3VR6 A;  2ZXO A;  1H9S A;  2PPB C;  1ESR A;  1KDA A;  1YNN D;  3KLS X;  1EZ8 A;  3BYY B;  2WKC A;  3GTK B;  3Q0A A;  1PTO B;  3K59 A;  2PYK A;  3F2U A;  2HUG A;  3A55 A;  2K28 A;  5J1Z A;  5JOB A;  1A3V A;  1PRT F;  5KIX A;  4R8I A;  5KYL A;  4A3K B;  4G4K A;  1PZJ D;  1B3A A;  1Q12 A;  1EY0 A;  4IQZ A;  1XYI A;  1D1I A;  2Y0S B;  2J7Z A;  5E4X A;  1AFP A;  1CT1 D;  1TR5 A;  1STH A;  1DOM A;  4EQP A;  1WD0 A;  1Q90 A;  5C0X J;  3PUZ A;  4H0L C;  1B2T A;  2X6L A;  4HR7 B;  4HED A;  2B2W C;  1JWS D;  1CZG A;  1ZYR D;  2XNA C;  1EFI D;  3BDL A;  1ICW A;  3CHB D;  3IFD A;  3AU7 A;  3OHX C;  1CM9 A;  1WTO A;  1GOZ A;  3I4M B;  5FO8 B;  5C0X G;  3ZYY X;  1VMP A;  1ML0 D;  4HN7 A;  2E75 C;  2D9U A;  2B2Y C;  4ZYS A;  4WRD A;  4RKB A;  1HPC A;  2FMC A;  4DN4 M;  3SK5 A;  1LTG D;  3MC0 B;  3RUZ A;  4CJ1 B;  1SSO A;  1SAP A;  1ZKO A;  3PIP 3;  3VR5 A;  4QIW B;  2AUJ D;  1GUT A;  3Q22 A;  4CKC A;  3OPO A;  2CVR A;  3TP5 A;  1SNC A;  5JEA H;  3ERO A;  2SOB A;  3R8B A;  1YNJ D;  1EY7 A;  1QB5 D;  4XXE A;  3HOU B;  1KLU D;  3H94 A;  4ZK9 B;  2CW0 D;  3G6J B;  5CGK A;  3LWE A;  1BUV T;  1NAP A;  5IGC A;  2AQ3 B;  4DAV A;  1TS2 A;  3M7G A;  2WV6 D;  3BZD B;  2ZXP A;  5EKL A;  4A93 B;  1BO0 A;  1GHK A;  4QB4 A;  5C4J B;  4J8Q A;  3FPP A;  1SXT A;  3HZX A;  3EJI A;  3DM1 A;  2MJ8 A;  5D3I B;  4ABN A;  4ZUI A;  4FYD A;  1I4Q A;  5CV4 A;  2QDB A;  4A3B B;  1Q8I A;  1TS5 A;  2WKD A;  3U9S A;  1TQO A;  4FXG C;  2M00 A;  4H7B A;  1DM0 B;  2VB2 X;  3D3R A;  5D65 A;  2F0J A;  1TU2 B;  2NN6 G;  1ENC A;  1H9K A;  4TRD A;  2HQE A;  1HFN A;  1SND A;  2XSC A;  1RTN A;  2Q8T A;  5I9O A;  2IX1 A;  2QKI C;  4X3K A;  4DXF A;  2HCC A;  2KEC A;  5D3D A;  3VR2 A;  2F0Q A;  3QOJ A;  4MIU A;  3SEB A;  4BA1 I;  2L12 A;  3WOF A;  1F9R A;  5IOC A;  5T1G A;  2E2J B;  1A15 A;  3T13 A;  1EYD A;  3MFG A;  3S1Q B;  2NTT A;  3FKI B;  5LHY 1;  2EZV A;  2PW7 A;  2FIN B;  3D8G A;  1EQV A;  5JPM C;  1FR3 A;  4HTH A;  4Y7N B;  2F4I A;  2O2L D;  3P1H A;  1WCM B;  5IGF A;  2F0F A;  4RHS A;  1DJR D;  1IYV A;  1ILQ A;  1CQF A;  4K5W A;  5DM6 3;  2F03 A;  3PO2 B;  4CJ2 C;  2Z4H A;  2IW3 A;  1STE A;  3TP6 A;  3E6Z X;  2B8G A;  3DUZ A;  2L5T A;  1RTO A;  2YU9 B;  1HUN A;  5HUR A;  5ISR A;  3BYT B;  4WFN 3;  3SVM A;  5CYU A;  1WVL A;  4F87 A;  4G57 A;  5HGT A;  1G29 1;  3NP8 A;  1PTO F;  2RDF A;  2FFK B;  5C44 B;  2WAC A;  3FRP B;  4B9X A;  2D62 A;  1BNZ A;  1S5F D;  1T5X D;  1BXT A;  1IKL A;  2EPB A;  1PLF A;  2F0W A;  2F0V A;  3I72 A;  3NHH A;  4RA8 A;  1Z6H A;  2HCI A;  1V8Q A;  3GQB A;  3HKZ B;  1UUP A;  3A7L A;  3TZU A;  3NQT A;  2IT1 A;  3MZ5 A;  5D14 A;  4HSP A;  5CV9 A;  3J81 L;  1WTX A;  4FVM A;  3M4O B;  4KJN A;  2E2I B;  1GJX A;  3SR1 A;  2KUM A;  3T51 B;  4KY6 A;  3FMC A;  3RZO B;  1KLG D;  1EQT A;  2RA4 A;  4HCS A;  3MXN A;  4IFD I;  2SNM A;  1I4R A;  1JWU D;  4Z9C B;  2EYM A;  2WII B;  3A8K E;  4DAY A;  4C2M B;  4C3I G;  3GTP B;  2VXW A;  3KBX A;  2F0O A;  5I2Y A;  1S5E D;  1LTR D;  1L0Y B;  3NTH A;  4KY7 A;  1CK1 A;  3JAM L;  4OO1 G;  1B44 D;  2WAQ B;  2IWH A;  3BVG A;  3DXJ C;  4B08 A;  1LT5 D;  1JOK A;  1KTK A;  3GTM B;  4C3J G;  3CKI B;  5A2Q E;  5ELE A;  1EY6 A;  2EYJ A;  2EXZ A;  2PW5 A;  2IJ0 A;  5FLX E;  2D2C C;  3R2I A;  2F0L A;  4FP5 D;  1EY9 A;  1X3Q A;  2GA4 B;  4A3J B;  4KKU A;  3MWY W;  4PNY A;  3C3L A;  3OIQ A;  5EQ0 A;  3Q6S A;  1HXY D;  2OF1 A;  2OXP A;  4XTC S;  3H3V C;  4ME5 A;  1R4Q B;  1IL8 A;  1M4V A;  2KEE A;  5JAV A;  3K5M A;  3R93 A;  4HCE A;  1O7Z A;  1EWC A;  3BVM A;  3DHQ A;  5CMD A;  1BCP C;  5M5W B;  1FNU A;  4BBS B;  2OEO A;  5F2D A;  1IKM A;  2RVL A;  2O5I C;  5J39 A;  5C5L A;  1HA5 A;  2KA7 A;  2NBF A;  3O13 A;  1PMR A;  2AQ2 B;  1KNE A;  1SJE D;  1U4L A;  3PO3 B;  4JK1 C;  4KI0 A;  3HOX B;  1A2U A;  2F0S A;  3S14 B;  3T16 A;  2C5C A;  3C1E A;  3HRZ C;  5FOB B;  3AB9 A;  4KMU C;  3NTK A;  3V96 A;  1H9M A;  1OXV A;  1EYC A;  3PV0 A;  4NKL A;  2M2L A;  1DON A;  4NDX A;  2G9H D;  4CBV A;  1QG7 A;  2K01 A;  3TME A;  4HAE A;  1UEA B;  1BQQ T;  2ICI A;  3DWA A;  4XT3 B;  4IN3 A;  3Q23 A;  4QMG A;  4ZAI A;  3J7Y W;  3KLS A;  1E0B A;  1PXU A;  1TWC B;  1K8M A;  4R8N A;  1EEF D;  1VMC A;  3A54 A;  1V1P B;  1SYB A;  1OXU A;  1G6Z A;  4E6I A;  3HOZ B;  3DEO A;  2JA5 B;  1E2W A;  4OGQ C;  1FNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...