5CV5A

Crystal structure of staphylococcal nuclease variant delta+phs k64g/v66k/e67g at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKGMKGNAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS K64G/V66K/E67G at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv5A00
1STGA 4ID6A 4WRDA 4OL7A 1EY0A 1SNOA 5IGDA 1F2ZA 4J6HA 4WORA 2F0DA 3V2TA 4PMCA 1STBA 5CV6A 4DU9A 4HMJA 4EQNA 3LX0A 4NKLA 5IOCA 3HZXA 3NP8A 4K2KA 5I6YA 4K5VA 4YIJA 3SXHA 1U9RA 2PQEA 1SYGA 4DF7A 1EY4A 2F0VA 4DGZA 5CC4A 4RKLA 2EYMA 3MHBA 4RKBA 1A3VA 2F3VA 1A2UA 2SNSA 4TRDA 2F0UA 4EVOA 4KTAA 5CV7A 5E3FA 5I6WA 4K5WA 5IGCA 5KYLA 4ODGA 3TP7A 2F0SA 4KD3A 3RUZA 4KY6A 4K8IA 3P1HA 4IZ8A 1STYA 4HTHA 4PNYA 2WACA 1STNA 5C3XA 2F0TA 1SNCA 3OMCA 2EY2A 5IGFA 2HQEA 4H7BA 5E1FA 3TP8A 5KGUA 1JOQA 3T13A 1SNPA 2PYKA 4QF4A 1A2TA 1EY7A 2F0KA 1STAA 1EYCA 3SK5A 5I9PA 5CV8A 3NUCA 4KY5A 3SK4A 2M00A 5HGTA 1ENCA 1SYCA 2QDBA 2EYOA 3NK9A 5EKKA 1SYBA 3SHLA 3SK8A 3DMUA 3QB3A 5IGEA 1A3TA 3C1FA 3R3OA 4K5XA 4N9TA 4KD4A 5F2DA 3MXPA 5EGTA 2EYFA 5I9OA 3VA5A 2F0OA 4MIUA 5IIFA 5C3WA 1IHZA 1EZ6A 2F0QA 3ERQA 3E5SA 5KIXA 2F0LA 4S3SA 5DAUA 2EY5A 3S9WA 4IALA 3QOJA 1ENAA 2PZTA 5J1ZA 1TQOA 1F2MA 4QB4A 5J22A 3BDLA 1SNDA 1SYDA 4NDXA 2F0HA 5IGGA 4IUNA 2NUCA 4K6DA 4LAAA 2O4XA 5JOBA 5JAVA 2F0EA 2RBMA 4EQOA 5IODA 1JORA 4KV6A 4F8MA 3PMFA 3TP5A 4N9PA 4NP5A 2F3WA 3D4WA 3MVVA 3U9OA 2EYJA 2PW7A 2F0GA 4K14A 4NMZA 1KABA 4F7XA 5IGBA 1JOOA 5J39A 3EROA 5C6AA 4HMIA 4KHVA 4B9XA 3EJIA 1SYFA 1EY8A 3DHQA 2EYLA 1F2YA 3MZ5A 5CV9A 2OXPA 1II3A 4ZUJA 5ISRA 5M9OA 2F0NA 1KDAA 2SNMA 1NUCA 1SNQA 2SOBA 3MEHA 5CV4A 2F0IA 2KQ3A 3C1EA 3EVQA 3OMGA 5K5PA 1EY6A 4J1MA 5CGKA 4B9WA 2OF1A 3H6MA 3QOLA 4DFAA 1EYDA 3OWFA 4ME5A 1EYAA 3NXWA 1STHA 1AEXA 2F0MA 3NHHA 3OSOA 3P75A 2OEOA 2PW5A 3ITPA 3BDCA 4I65A 3HEJA 5EKLA 4KY7A 3TP6A 5C4HA 5CR3A 1KDCA 4QMGA 5C5LA 2F0JA 1SNMA 3SK6A 1A3UA 2EYPA 4K8JA 1EQVA 3TMEA 4EQPA 5HURA 4R8NA 2LKVA 1TR5A 2F0FA 3D8GA 2RKSA 3D4DA 4ZQ3A 2RDFA 3NQTA 3T16A 3D6CA 5KEEA 5C5MA 4KJOA 5C4ZA 1RKNA 3SR1A 2EY6A 1NSNS 4G57A 4PMBA 5KRUA 4K2LA 2F0PA 4KJNA 2EYHA 1EY9A 5NUCA 5KYIA 1KDBA 2F0WA 1SYEA 2EY1A 2KHSA 2PZWA 4ZUIA 2EXZA 1EZ8A 1TT2A 4E6IA 5CV5A 5DEHA 2PZUA 1EY5A 1JOKA 1KAAA 2ENBA
chains in the Genus database with same CATH superfamily
3LNNA 4WRDA 1EY0A 3J81j 5HGQA 3UDIA 2UXBQ 4A3MB 5FJ8G 1LLRD 4A3KG 1CZWA 3CRKC 5C0XJ 3KF8B 1SE4A 2UUCQ 1O78A 1U9RA 1SYGA 4HIMA 3OW2A 4OIKA 1L1OB 4A3IG 3ONAB 1I3QB 4YCWA 2SNSA 3S2HB 2JA8B 2Z0SA 5D14A 1S40A 3K7AH 4DV5L 3KK7A 1IYJB 1KNEA 2VQFQ 4DAPA 3KLSA 5FKAC 2Q8TA 4M1UB 1YBYA 5IP9H 1Y1VH 4H7BA 2UXBL 3GTJH 1JOQA 2HCCA 4X62Q 3BJUA 2IX3A 3ULLA 4ZK9B 1ENCA 2A5HA 3UE1A 2XSCA 5KNBA 4HJ8A 3GTQB 1S5DD 1EUJA 1Q12A 4ABNA 1IBKL 2L4NA 1SFOH 1GUWA 1PRTB 1R9TH 5LMNW 1PYSB 4L8JA 5IT9c 1WTVA 5TSSA 2R7ZH 2AKWB 4DNTB 3E6ZX 4LF8Q 1LT4D 4G7ZC 2BCOA 1GD7A 4JCVE 1VQJA 2KBNA 4DNRB 3HKZE 1WI5A 2AUKA 4DAYB 3TP5A 1IL2A 1B50A 1NJIC 3HOYG 1UUPA 3PIPA 5KNCA 4YWMA 3FKIB 1EFWA 1SYFA 1PH8A 1IW7C 1I4HA 2JQOA 1FJGL 4BY1H 1IW7D 1CK1A 3U50C 1ESFA 2PPBC 3C1EA 4RGNA 3A54A 2Q2HA 4H44C 2DJGC 5E4WC 3S2DB 1Y1VB 1ILPA 1A3UA 1H9MA 2A69C 2DNEA 1X65A 2LKVA 4A3IB 3NQTA 1QWYA 5C4ZA 5FJ8H 1G51A 1LTLA 1C8CA 4BXXG 5M3FB 3RN2A 1WJJA 3MFGA 1KDBA 1SYEA 4DK1A 1LT5D 1GUSA 2CW0C 3M85A 1PVOA 1FL0A 4NXMQ 4JBJA 3M3YH 2VY3A 3CHBD 2E74C 2KJXA 4DUYL 4UPAA 1VF7A 4C3JG 3UE0A 5IOCA 5ELDA 4LF7L 3J7YW 2BDNA 4RWSC 3FP9A 3NTHA 4DXFA 2ES2A 4LWCA 1A3VA 1S5CD 1VS0A 2F3VA 1JE4A 2F0UA 4N8X1 3PO2G 4GOPA 3MWYW 5IGCA 3DUZA 4DUZL 4X62L 1VMCA 1TIID 4R4QA 1QJOA 1BCPB 3F8TA 3T1YQ 1SNCA 2EY2A 4LMQD 1PH7A 3I73A 5GADC 2VUMG 1A8VA 1YNJD 2CWAA 2IPKD 1M4VA 1STAA 4A3IH 3SK5A 1VQ4A 2DY8A 4A3BG 2O5JC 3W1BA 1E2VA 3GO5A 4HIKA 5I2YA 1N32Q 1AE2A 2QILA 3UDGA 4A3JH 1YNXA 1RCVD 1OXTA 1SE2A 1XXGA 1LUZA 4J8QA 1QVCA 5I9OA 4DV3L 1T5EA 2F0OA 4GN3B 4MIUA 3PO3G 1IHZA 2VZAA 4HSPA 2F0LA 4PMWA 2WV6D 2UUBL 1JWMD 4O42A 2NUCA 5ELEA 2F0EA 3K8AA 3D0FA 4PZ6A 2B2WA 4DUYQ 3U9OA 3GTMB 1PH5A 4R4IA 2K5NA 3NPPA 4F7XA 2BH8A 1GUTA 4CKCA 2EYLA 4DR6L 2C9OA 4QIWE 3MZ5A 4ZUJA 1II3A 3G71A 4DV7L 3S15B 4FVMA 1R9TB 1SNQA 4HJ9A 5GAHC 2RSOA 3VA7A 1Q81C 2AQ1B 3RN5A 1BCPC 4LFBL 4DR4Q 4BY7B 1G291 1JB7A 2A19A 2UXDQ 2JEBI 4OX9Q 2F4IA 5BN3A 2PW5A 2CQOA 3HKSA 1QZHA 1LTTD 1KDCA 3JC66 3ERSX 4A93H 5C5MA 1OXVA 3S1MH 1NSNS 5ELFA 3X3MA 5KRUA 1NTGA 1BBWA 1KLGD 1O7IA 1NR4A 4RCNA 1JR0D 1XMQL 2OQ0A 4HAEA 4GN4B 4UP8A 5CV5A 3X3NA 2RHSB 1PHJA 2JA5G 4DR2L 1PXUA 2KCMA 1TWGH 3STBC 1D7QA 4YCVA 2J7ZA 1EFID 4IUUA 3S2DH 4OO1I 2Q8RE 3K5OA 2K28A 3OIQA 3H15A 4PV1C 1B3AA 2CVRA 1I94L 3RLNA 1HH2P 4ODGA 4LFBQ 4JK1C 3P1HA 1JJGA 3NSWA 4DV7Q 5E4XA 3RLFA 2HQEA 1KAWA 3L3OC 4QIWB 1UNSA 2VB2X 3J80i 4X3SA 4GZYC 3NUCA 3TS2A 4LFAL 3GTKH 1RL2A 2XNAC 3SHLA 3I56A 4UP9A 4RGOS 4APVA 4DV2L 4A3KH 2K5HA 2F3IA 2N3SA 3C1FA 3I4MB 1FD7D 3C2PA 5EGTA 3U4VA 2I07B 4XYQA 2JA9A 1PTOF 3T53B 3IFTA 4A3BB 1GUNA 1U4MA 4HCSA 1VQBA 3E9IA 3I91A 2SEBD 3AYHB 2NBFA 1CQVA 1PFBA 1VQHA 1S4ZA 1FNWA 1EQQA 2GA4B 2F0GA 4A3EG 3BVMA 1B4OA 4XIGS 2UUCL 3EJIA 1A15A 2EPBA 2OXPA 5M9OA 4C56C 1H95A 1IKMA 1H9SB 4FXKC 1MHWC 4ME5A 2JA8H 3ITPA 4OHJA 4HCEA 1YVCA 2QKIC 4RA8A 2F0JA 4DA2A 1XJVA 3S24A 5HURA 3HOZB 3TMEA 2BA0A 4QL5A 3A5ZB 3M7GA 2WIIB 1WFQA 1U4PA 1K83H 5JPMC 1HZBA 3J7A5 3OHXC 4LF5L 4GKKQ 1Q8IA 4YCUA 5NUCA 4R9WA 2R92H 4A3CH 5C0XH 4ZUIA 1EZ8A 5M5XH 1EWCA 4A3EB 1TVXA 1TY2A 3PUVA 4V190 3UDFA 2VB3X 2EZVA 1SNOA 2R93H 3TDQA 2JA6G 1SJED 1LTSD 3HGBA 2PMZB 1CSPA 4R1JA 3PSIA 3SXHA 4DF7A 1EY4A 1VQDA 2JE6I 2BE5D 3VYRA 4B3RL 3RZDB 4ALPA 4K5WA 4A3MH 2FINB 4IZ8A 4HTHA 3HOWB 3HS0C 3E0EA 5BN4A 4HR7B 3I4NG 1DOMA 5JVG3 2B63B 3GTLB 5EQ0A 1EYCA 1QNKA 2UXDL 2M00A 2DJFC 1HR0W 1V9PA 1HNXQ 5HGTA 1SYBA 4I7AA 2NZOA 3ND8A 3BYYB 4HSVA 5M3MG 2ZM6L 4PZ7A 2GVBA 1Q1EA 2NWGA 5IGEA 1LTID 4N9TA 1BQQT 2Y0SG 4LF4L 3IL8A 3VA5A 2WAQG 4HEDA 1EZ6A 3PF5A 1WTXA 1YNND 4IALA 1YNNC 1ENAA 1RJTA 5C4XH 2KCCA 1WTPA 1AN8A 4U673 2DNCA 2CKZB 4XQQA 3GTOB 5JAVA 2IX1A 3BZKA 4X64Q 4JI2Q 2AQ3B 2N8NA 2V4DA 3DWPA 1WOCA 3D6WA 1HZCA 4DV1Q 4JVZA 3FKIH 2PNRC 1TWCB 3GTGB 3H0GH 2UXCL 2LXJA 4FDBA 4DV4Q 4DV5Q 1JWSD 3I4OA 3FDTA 4XYOA 4CGYB 1XPRA 2NVXH 1D8LA 3W1GA 3A55A 2K1BA 3AFPA 3ZYYX 4X66L 1NY4A 1QVFA 1X3QA 2PQAB 4KN4C 5JPNC 3GTGH 1K0SA 1QOHA 4EQPA 4X66Q 3KLWA 2F0FA 4CJ1B 1B9MA 4ZQ3A 1VQEA 1HNZQ 4P73A 3FPUB 2DUDA 4TSSA 1NE3A 1Q86C 4G57A 3OTOQ 4OWWB 4DN4M 2UXCQ 3MA2B 2M9VA 2R7DA 2WP8J 5DEHA 1TWHB 1I6HH 4B3SL 2R93B 1MD2D 4J6HA 2VXWA 1STBA 3GTJB 1HNWL 5A2QL 2KA7A 3WOEA 4NXML 2K75A 1BOSA 4Y7NB 3M4YA 3UDXA 1MSGA 1FGBD 3PUYA 1STEA 3HOVH 3AMUA 2Q8IB 3RUZA 4GS3A 2E75C 1C9OA 2KENA 3MXGA 2B3GA 1STNA 1WCMG 4LF4Q 2IWHA 1Y8OB 5IGFA 1XMOL 4NXNQ 4IUTA 3K57A 4JOIA 2AWOA 1EY7A 1S5ED 2MPMA 5DM63 2JYOA 4Z9CB 3JAMi 1VQIA 2Z4HA 4JBKA 2K05A 5M3MB 4C1NI 1KTKA 2JA7G 1U4LA 3S17B 5FLXL 1I4GA 4FYDA 3AQQA 3VR3A 5EBDA 1BO0A 1S72A 2I5HA 4QB4A 3V96A 3OIPA 4H02A 2NVTB 5IGGA 3MC0B 4EQOA 1IZ6A 3IAYA 4KV6A 1ET6A 5C44B 4A3BH 4OX9L 2L55A 3K7UC 4R4CA 1WYDA 4NMZA 4YHHQ 3I4MH 1TS3A 3L9AX 5CV9A 1M1KC 3BG3A 2AHOB 1KDAA 5JEAG 4QQBX 1VMPA 3OMGA 5K36G 3BDOA 2L1BA 3K5MA 1VQFA 1XYIA 1AEXA 2Z9HA 5DM73 2KCNA 4KY7A 3R2IA 2XTIA 4CKEA 2WKCA 1ILQA 3KF6A 2ID0A 5M3MH 2IHEA 1U0LA 1YEZA 4NB3A 1PRTF 4GN5A 5LMNQ 2KVMA 2D0PA 3I4NB 2N88A 3D6CA 5D65A 1AZQA 1H9RA 1HJPA 1I6HB 4PMBA 2EOTA 3I2ZA 1SAPA 4Q5VA 3VR5A 1HNZL 4RHRA 1C0AA 2LFNA 1STGA 2A6HC 2C5CA 1YJ9A 2FHTA 1V8QA 4YWKA 5C44G 4DV0Q 1UAPA 1KIXA 3F2BA 1N8RC 2JP1A 5CC4A 1VDZA 1HUMA 3O13A 3GDEA 1D2BA 4QY7A 3Q0AA 2D0OA 2AMCB 5E3FA 3J80c 1TKWB 1ZKOA 1SDFA 2E2IB 4DK6C 4WJWA 5I2XA 3H0GB 4HIDA 5C3XA 4BA2I 3DM1A 4IUQA 3G6EA 4JI7L 4A3CG 3FPPA 1Y69U 1L1OC 1EWIA 1EQTA 3F2UA 3HOYH 3CKIB 2RQXA 1WD0A 4X3TA 1LM0A 2LS01 4K5XA 4GOPB 1Q3LA 2K5DA 2JA5B 4QUFA 2JA8G 4LUVA 4YHHL 3VR6A 2FMCA 1BXTA 2IT1A 1VQ6A 1JT8A 5JJZA 3DEOA 1Q1BA 1FNVA 3H3VI 1C7YA 3BDLA 3HOUG 1PH1A 1L0YB 5FLXc 2CFMA 2JA7B 1X3EA 4Y52H 1D1IA 3BZDB 2PMZE 2BDOA 1CT1D 1BBUA 1PFNA 3GTLH 2RHQB 4RGMA 2B63H 3PGZA 2NVYB 4OGQC 2F0NA 1FR3A 2AWNA 3HOWH 5CV4A 1RIPA 2ZTCA 1MGSA 1PMRA 4J1MA 4XXEA 4B9WA 1GJXA 4IOAA 4JYAL 2UU9Q 1MI2A 5EKLA 3CU7A 3DXJC 2M2LA 5C5LA 5FO7B 1JWUD 3PCOB 4JI8L 4K8JA 1EEID 4DPGA 1QNUA 5LL6X 3HOXH 3CP0A 3KF8A 4K0KQ 4CDDC 3CD6A 3S1RB 1Y8NB 3CXCA 2F0PA 1Q46A 1MJCA 4LF6Q 1WCMH 1TS5A 1IBKQ 1G6ZA 2MFIA 2PW7A 2ENBA 2ICEC 4BA1I 1HR0L 2ATWA 3M4QA 1KD1C 1HNWQ 1K83B 4JI7Q 1HTLD 1O7ZA 3KBGA 4IO9A 4EQNA 4ZKBB 2KOLA 1NAPA 4OELB 1PDQA 3I90A 5FLMH 4L5SA 1VQCA 2WB1B 3FRPB 4RAUC 2ALYB 1LTBD 5M5WB 2LY7A 5IT9E 2ZTEA 1BUVT 4GNXC 1VQAA 1JQYD 3GTMH 1CTMA 1ENFA 3J81i 4JG2A 3PIO3 2R92B 2L12A 2N55A 5FO9B 3CCMA 3CCLA 3VR2A 3KYHC 3VYTA 4JPBW 2QEXA 4L6TB 4HJ7A 1X54A 4V0BA 3T51B 5F2DA 5CBEE 3T1YL 4UY8C 1YJWA 2F4VQ 3ERQA 1XX8A 4DV1L 1PYWD 2B2TA 3HKZG 1A63A 1SROA 2D5DA 1B2TA 3M3YB 4L63B 2YTXA 3P7JA 2N49A 1EEFD 4K6DA 1N33Q 5JJLA 5JOBA 5GQOA 3M4OH 4HIOA 3WWVA 3L0OA 1L0XB 3S1QB 3MVVA 4R8IA 1SEBD 1EYGA 2PO4A 5M5YB 1VQ5A 2YV5A 2YU9H 1S3OA 2JA6H 3I8ZA 5D3IB 4P2CB 2K01A 2OF1A 1EYDA 3OOCA 3OSOA 1WTRA 1GVPA 4NPSA 1IBML 1KXLA 3SK6A 3N52A 3HOYB 4DR7Q 2R3ZA 2MJ8A 2I5LX 1WVLA 3K7AB 1G2TA 1G6PA 2VS1A 1KRSA 3GTKB 1K0RA 2XRQD 1U5KA 2OQKA 4OXPA 2VUMH 1FYCA 2K14A 3CC7A 1CKNB 1VQ9A 1IYUA 3HOWG 1KAAA 4A3DB 4ID6A 3ER0A 4OL7A 4PQXA 1JB3A 4DU9A 1VQKA 4NKLA 1VF5C 4RCOA 3M7NA 5I6YA 4YIJA 1EIHA 1V1PB 2F0VA 3J81L 2E5LL 1RTNA 4FXGC 4TRDA 2R93G 2JN4A 2JA6B 2K32A 4K8IA 4C3IG 3TZUA 3CCSA 5C0XG 1YHBA 3J81c 1GHJA 2E2HH 1E1OA 4KLKA 1E7ZA 3NBHB 1SNPA 5IYBH 4WJ3M 4A3JG 5GROA 5I9PA 1LTGD 4IN3A 1F9QA 1EOVA 1X56A 3DMUA 3RMHA 4DV3Q 3I3CA 5ELBA 4B3TL 2EYFA 1CZGA 3TQYA 2BA1A 2F0QA 3NTIA 4IURA 4UDUC 4AQYQ 3A7AB 3DWAA 1V1QA 4GLAC 4UHVA 1TQOA 4C3HG 1AH9A 2XRSD 1B44D 2F0HA 1XTDA 3T1HL 4LAAA 4DV4L 3S1NH 4TVAB 4MTKA 2MUYA 1WCMB 2B2WC 2F3WA 3Q8DA 2WKDA 4C3JH 2B2UA 1JOOA 1UE6A 2E8GA 4KHVA 4B9XA 3C46A 3MFYA 2D9UA 1BBXC 4A3LG 1YNJC 3S2HH 1EL0A 1SE3A 2K50A 1RD9D 1PTOC 1EY6A 1DZ1A 4DNIA 3M4OB 1B9NA 2QEJC 2F0MA 2D2CC 4K2KA 4LFAQ 4A3DG 3Q24A 2O2LD 3PF4A 1AFPA 1SSOA 2QF7A 2MP1A 4AYBG 2EQSA 1Q82C 4K0KL 2NB0A 5IP7G 2PNHA 3T16A 1AP0A 2HCIA 3I70A 1X9NA 1KLUD 3GQBA 1HCZA 4BS9A 1CFMA 2R6GA 4QUCA 1EIFA 4LNQA 3HRZC 3PO3B 1DONA 4POFA 2E2DC 2Z6BA 2A6ED 2EY1A 2UU9L 4OO1G 2ZJQA 1YHQA 1TT2A 5K36H 3HOVB 4JI6Q 1K28A 1L2FA 2G5DA 4JI5Q 1OTCA 1JCKB 1F2ZA 3B6YA 2HT1A 3HZXA 2CCZA 3HKZB 2P5ZX 5M5WH 2K52A 2JA5H 3NBHA 4LJZC 4B3RQ 1LO5D 5IYBG 2UUAL 2G9HD 1V43A 1STYA 1BCPF 4LUZA 3PV0A 4C3IB 4XT1B 1PTOB 3OMCA 3TEHB 2Q2IA 1JE5A 5IT9L 4KHPL 2F0KA 2JA7H 1XMOQ 4ME3A 1IKLA 1XTCD 5IYCH 1TY0A 2B8GA 1PH2A 2E2JH 3AB9A 4LF5Q 3KOJA 1U4RA 4BBSB 3D31A 4A4IA 1PH4A 3HP3A 1Y1WB 4MN3A 2Z1CA 4KD4A 3FHWA 4KKUA 4IUVA 4Q0FA 1Y1VG 3FEWX 3URYA 2CH4W 4RG1A 3MXNB 1CA6A 1K8MA 3GV6A 1QILA 1ZXTA 1LACA 2LSSA 1EOTA 4DAMA 2VQFL 4JI4Q 4DXGA 2L9HA 3CAMA 5FK9C 1KL9A 2NTSA 3I4LA 3IKJA 4LFCL 3MEHA 4FF2A 1TWAB 2Z4IA 4DV6Q 4MHEA 5CGKA 3T1HQ 1XPOA 1W2BA 1KHIA 1RODA 3P75A 1PH6A 2XIWA 2YTYA 4C1NK 5C4HA 3GP7A 5CR3A 2A68C 2WFWA 3MXNA 4B08A 1HHVA 2EYPA 3CCEA 3GTQH 2Z8LA 2K04A 2DN8A 3OWEB 1TR5A 3D8GA 2RKSA 4B3TQ 1QUQB 1F9SA 4YWLA 4B3MQ 2MGSA 4DV2Q 4JW0A 3NENA 2DY7A 5J3BA 4FF4A 5T1IA 4E6IA 3A0JA 4C2MB 2WAQE 3H0GG 3H6MA 3HOVG 2CW0D 3JAML 2NVTH 4LF7Q 3PO2H 1NMGA 3RLOA 4H0LC 2E76C 4FF1A 2K6AA 2NZ1D 1DM0B 5IYCG 3QR8A 1I50B 1E3PA 2PQEA 5EPKA 1I94Q 5FLXE 2EYMA 3A7LA 1UWVA 4YY3Q 1A0IA 4C2MH 5KYLA 1CA5A 5JJIA 4DAYA 5G3LF 5C4XG 2L5TA 1WTQA 2A73B 2PYKA 4O1NA 3NTKA 5EBCA 1F2LA 1TWFB 5I4DA 3J7AV 5CV8A 4KY5A 3RNUA 5FLMG 1N36Q 1TS2A 3D4RA 4A3GG 1B3QA 4IFDG 3BU2A 1IBMQ 4CBVA 4O0AA 1CHPD 3EA6A 4LF9Q 3S16B 2K5VA 5IIFA 5C3WA 3I4NH 3BZCA 3M4PA 4YY3L 1F2MA 5J22A 5BR8L 1PTOD 4A3MG 3NE5B 5EPLA 1QUQA 4JV5Q 1VQ7A 1Q90A 2KHJA 2RBMA 1GUGA 1H9KA 3HOXG 2K33A 4L5RC 4IPCA 3HOZH 1NBWA 5IGBA 5EAYA 3TS0A 4EGVA 5J39A 3VYSA 4HMIA 1EY8A 3DHQA 1K73C 1LT3D 3IFDA 4RFBA 3CF5A 3DEPA 4ULLA 4NW2A 1OXXK 2KECA 4ZAIA 2EJGC 4MTNA 4GNXB 2R92G 4MNOA 3K0YA 5IWAQ 2BOSA 4A3LH 3NHHA 2RCNA 2L0CA 1PLFA 3SVMA 1GO3E 4QMGA 3R93A 5AFWA 4A3FB 2CQAA 3V05A 2MQHA 3T4AC 4FO2A 1L1OA 2WAQB 1TWFH 3IRBA 3E9HA 2OT2A 2CWPA 5IP9G 4IFDI 2PZWA 5ELOA 3H3VC 1YIJA 3CW2C 2RCFA 3ULPA 4LFCQ 2YYZA 3BVGA 2IHFA 2TSSA 5CV6A 4JI3L 3A5UA 2JEAI 1IXRA 2ZXOA 5BN5A 1PYBA 4KKTA 4K5VA 1OXUA 2E2JB 4JI4L 2NVXB 1X32A 2A1AA 4IOCA 5T1GA 4N8FA 4RKBA 1A2UA 1F9PA 2QW7A 4KTAA 5CV7A 4JBMA 4PG3A 1VQ8A 1HR0Q 3QO2A 1CKMA 3Q23A 4PNYA 4C3IH 1O7YA 4JI0L 4GKJQ 3PO3H 5E1FA 2X6GA 3T13A 1SRUA 1EIGA 3QIAA 1QE6A 1XNRQ 4BXXH 4XT3B 3BYTB 2ZTDA 1XPUA 4XQJA 1MBYA 2HIVA 1HTPA 1LTRD 2TMPA 1BDOA 5EJWA 4HJ5A 2K7VA 3NK9A 1B7YB 5C3EB 3CCQA 3NWSA 2VQEQ 1A3TA 2LMCB 2A68D 4P75A 5M5YH 1LYLA 1D5ZC 5IY0A 5LMUL 2R61A 1S5BD 3ND9A 3EN2A 3E5SA 4S3SA 4A3GB 4LF9L 1BF4A 1H9SA 3QOJA 1X6OA 4OO1H 4OWTB 1BKBA 4DR2Q 3LWUA 4ZYSA 3K80C 4NDXA 2FJ2A 1NNXA 4A3EH 3K58A 2QA4A 2PQAA 4L5TA 3TBIB 1IYVA 1C48A 1EU3A 3CMAA 3D4WA 4X3UA 4BBRB 1HQMC 2EYJA 1SMYD 3ZJYC 2LXKA 3TZDA 2IJ0A 5LMUQ 4CKBA 1MSHA 1WD1A 1DCZA 5ISRA 2HHHL 3GTPH 2VQEL 3RD4A 5E7NA 5AJ3L 2N78A 3QOLA 2O5IC 1QCBD 4I65A 3BDCA 1D5XC 5C4XB 1SMYC 2PCFB 5M5XB 2RDFA 1QB5D 3TSSA 3FVQA 3HOUB 2C35B 2QDLA 2HDMA 1TS4A 4KJNA 4DAVA 3GD7A 1DGSA 3Q22A 2FMMA 4LUOA 2F0WA 4G4KA 1UE5A 4DR1Q 2EXZA 4B3SQ 1PTOH 1EY5A 1X55A 4AIMA 4JI3Q 4DK3C 3I55A 1EU4A 4PMCA 3KJPA 5IYDH 4DR3Q 3HFZB 4IFDH 2BE5C 3OTOL 1J9OA 2R7FA 4DGZA 1CHQD 1J6QA 4DV0L 1BVSA 3MHBA 3PUWA 2XWBB 4A3DH 5DLQE 2Y0SB 4AQYL 2ZXPA 1N32L 4M8AA 1YITA 2GN5A 3AU7A 4DV6L 1HRJA 4KD3A 4AH6A 2R7ZG 1UE1A 4GLVB 4QGUA 1FVIA 3KDFA 3SE0A 4F87A 1IBLL 1BNZA 1ICWA 1XWEA 2H1EA 2AQ2B 5IWAL 4G7OC 1N34L 1SYCA 2EYOA 1NR2A 1YHAA 4X65Q 1W6JA 2B2VA 3MXPA 1GHKA 2RVLA 4LK1C 1CSQA 1OO9B 1YJNA 2I0QA 2IY5B 2HIXA 1PA6A 2YU9B 2KUMA 3JAME 3CQZB 3H91A 1JORA 5IODA 4RHSA 4CHTB 1WTOA 2NTTA 4XTCS 4WFN3 3AEVA 2NN6I 3PIP3 3H3VH 1Q7YC 5DNFA 3EROA 3I72A 3I7FA 3QJYA 2SOBA 4A3FG 3EVQA 2UUAQ 1XNQQ 2MO1A 3U58A 1HQRD 1XMQQ 3L7ZC 3K81C 1GUOA 1JJ2A 4BY7H 3J81E 2HDLA 3Q6SA 3S1QH 5JEAJ 1FNUA 1SXTA 3K5NA 3RZOH 4X6AH 3MXUA 5G3LD 4PZ8A 2Z6KC 1RKNA 4DR7L 3VDYA 1PRTD 3KBXA 1XNQL 1A6XA 4KHZA 4A3KB 3S1MB 4KN7C 1TU2B 5C4JB 2R7ZB 4AYBB 2JJQA 4CDFC 4A93B 1UEAB 2NZHA 2NN6H 2A8VA 4ZCKA 4KKSA 1HZAA 1M90C 1K8AC 1SJHD 4IJLA 2BH2A 2B2UC 5M3FG 4HMJA 2Q2UA 1LT6D 2B39A 3NP8A 5C0XI 3F1ZA 1N33L 4GKKL 1SMXA 4OONA 5CMDA 4RKLA 2OTJA 2XGTA 3LGJA 1VQPA 4A3JB 4OIJA 2EDGA 2NYZD 3KF6B 3FMCA 4TQUS 1Z47A 2HD3A 3S14H 3K6OA 1X3GA 4I7ZC 3CCUA 3TP8A 5GAGC 4A76A 1A2TA 1SN8A 5FOBB 4X65L 2VUMB 2H4OA 1DOLA 2WB1E 3RR5A 3HOZG 3P20A 2QDBA 1RF2D 2ZXRA 3CCJA 1IBLQ 3D3RA 3U9SA 3KLRA 1UE7A 1I4XA 3F2CA 1UEBA 3HG9A 3A8JE 1M8AA 3NQIA 1WTWA 5KIXA 4GLXA 2EY5A 2NVYH 5J1ZA 3DM3A 1HA5A 1K9MC 2K5WA 3A8IE 1SNDA 3LWEA 4CDEC 1VQOA 2A6EC 3K59A 2O4XA 5IP7H 2ZJPA 4FF3A 4JI1L 4A3GH 4P71A 4X64L 3E0JA 3CMEA 5M3FH 1KABA 1N9WA 2WB1G 3QG1A 1RDPD 4RH6A 1J8IA 3CCRA 3T56B 4AYBE 5C3EH 3H09A 1K3RA 4ZKCB 2Q2TA 2F0IA 3CPFA 4FNFA 3S1NB 1B1ZA 3NXWA 3I4MG 3AFQA 1KRTA 3HEJA 2B2VC 1R4PB 1VCIA 1HFNA 2ZM6Q 2F03A 2KHIA 3C3LA 1NCVA 1ASZA 4L5QA 1JICA 3G4SA 2CH4A 5CYUA 4UP7A 4J15A 4JOIC 4JI8Q 4EX5A 4QCLA 5AJ3Q 1Y14B 4FXDA 1E2WA 3VYUA 4BBRH 1JC7A 2EYHA 2I46A 3HOUH 5C4JH 4IUPA 4XDXA 2HHHQ 4JYAQ 3R2TA 1H9JA 4RMFA 4BBSG 3R8BA 1JOKA 3D4DA 3GV3A 4RGTA 3KUPA 1PFMA 4GOPC 3S1RH 1N36L 1I6VC 4WORA 2K4KA 3RZOB 1P16A 4JI5L 1PH9A 2MHVA 3K0XA 1G2SA 1HFGA 4EVOA 5IYDG 1PZKD 1BCPD 1ZYRD 3TP7A 3SGIA 1MJEA 1ZYRC 1AZPA 4KY6A 4NXNL 1IL8A 4U68A 4HJAA 2F0TA 2OTLA 3EQLC 1KNAA 5KGUA 1MIUA 4QF4A 3E3XA 2Z6KA 3FKIG 1V1PA 1VQMA 2XWJB 2OCEA 4ZRZA 3J7ZC 1YZ6A 1Z7TA 5EKKA 3CC2A 5HY6A 1TWCH 2K5QA 1PV4A 5A2QE 2EJMA 3R3OA 2F1MA 1SFOB 4JI0Q 4GKJL 1WTHA 2A69D 1B70B 3W3AA 2X69A 4GNXA 3VR4A 2VL6A 2QGQA 1Q8KA 2VNUD 1CM9A 4JI1Q 3G6JB 1E24A 4IUNA 1FGUA 1KQSA 1VQLA 4F8MA 2XVSA 4N9PA 4A93G 4NP5A 2G9DA 4K14A 4BY1B 1X3FA 1G91A 3CQZH 1F2YA 3KFUA 5D3DA 2RA4A 3TRZA 2B29A 4P74A 4C3HB 1SE8A 4X3KA 3EBEA 4DR3L 1ZEQX 1STHA 1QVGA 5LMNL 1DXMA 1I4PA 3W2DA 1HUNA 1A62A 1VQGA 4POGA 5I6WA 3CC4A 1TXYA 2HUGA 2I5MX 3J80E 5C44H 4OEMB 4O2DA 4R4TA 4JI2L 1PFSA 2CHBD 3KLSX 1K8GA 1K8OA 2KHSA 1I50H 2V1CC 4A3FH 2EVBA 1AW7A 1LV9A 3PO2B 1W3SA 5IGDA 2E2IH 1ML0D 4Y7NH 2FFKB 3M9BA 2E5LQ 1R4QB 1J5EL 4KHPQ 1T5XD 1PZJD 3PUXA 1DOKA 3DLLA 2RF4A 1E0BA 4JV5L 1RHPA 1HNXL 2H5XA 4HN7A 2IW3A 2A74C 2PI2E 1W6KA 2MNAA 1I3QH 4OWXB 1ESRA 4DKAC 4BWGB 3K5LA 2WACA 4F88A 2EXDA 2AUJD 3GTPB 3PIOA 1QZGA 1LTAD 3CPWA 1GOZA 2EE1A 2B63G 4FP5D 3PUZA 3TN2A 5JVH3 3SK4A 2SDFA 1QG7A 2K03A 3SK8A 3PQIA 3G48A 2NVQH 3QB3A 1PZID 1KC8C 3A8KE 4IPDA 1ONLA 3OPOA 2OWOA 4QJFA 4C3HH 2FXQA 1JMCA 4DR4L 3HOXB 1CKOA 3S9WA 3JAMc 2EIFA 4A75A 4MZ9A 1O80A 2EJFC 2MO0A 2ICIA 3EIVA 3MAQA 1EIYB 1LABA 2IL8A 2VW9A 3TREA 3PMFA 1DJRD 5LHY1 4IPGA 1ET9A 3GTOH 4DR6Q 3MEFA 5L37A 4EQ5A 3QWNA 4JC0A 1I5FA 2KEEA 1HXYD 3STBD 1HA6A 4BBSH 5EKIA 3H94A 1HZ9A 3A56A 1DD2A 1I4QA 2JXMB 2XN9C 4BBRG 1T9HA 4CDCC 3OWFA 1EYAA 4BY1G 1N34Q 2OEOA 2L15A 3TP6A 4KI0A 2J4XA 3S17H 1F77A 1PH3A 5IE8A 4TKOB 1SNMA 2ZJRA 2RSNA 1F9RA 5KEEA 1GXDC 4KJOA 1D5MC 1VQNA 2B2YC 2B2YA 4IJHA 3WOFA 4KK7A 1EY9A 5KYIA 5COYA 1TWGB 5C3EG 1B8AA 2PZUA 1AE3A 3EFXD 4DUZQ 2Y0SE 1O7LA 1E22A 4LW1A 1Z6HA 3V2TA 2F0DA 2D62A 3OW7A 3KJOA 4R4OA 3LX0A 4ILWA 5FO8B 1RTOA 1EWHA 1TWAH 3J7AF 2B8FA 1ASYA 4DR1L 3A74A 4K6LA 1SLJA 1CUKA 1X3PA 1S5FD 2F0SA 3W5OA 1TWHH 4IFDJ 5ELCA 4DR5Q 4LF6L 3ICEA 2QCPX 4IQZA 2JSOA 1BR9A 1P8LA 3BVZA 2WINB 4KMUC 1Y8PB 2F52A 4G7HC 1CI3M 3RZDH 5BR8Q 5CORA 1K3BC 5H1SE 3L2PA 2RDGA 3SEBA 4WJ4A 3S15H 2X6LA 1NMFA 4H13C 2HQLA 1D1KA 5GAEC 4DK0A 2JK8A 5A35A 1Y1WH 1L0WA 1CQFA 1EQRA 2KEDA 5DAUA 1YI2A 3S16H 2PZTA 1FJGQ 4XQNA 1B53A 5KNDA 1PRTC 1SYDA 3SDZA 5CBAE 2ZT9C 1GM5A 1HPCA 3NEMA 2A6HD 1OXSC 1CKNA 2KCTA 4JBWA 2IX0A 3CRLC 5ELNA 1J5EQ 5C6AA 1SBBB 4JI6L 3DWQA 1E2ZA 2J0TD 4LF8L 3ULJA 2NN6G 3WDNA 2B2TC 2SNMA 1NUCA 2RDHA 2GVAA 4CJ2C 2KQ3A 5JEAH 3CCVA 5LL6S 1ICFB 2DGYA 3BS1A 4DR5L 1E1TA 2YTVA 4P72A 3F2DA 3G7LA 1C4QA 4CJ0B 2E2HB 1XNRL 1SR3A 3OYYA 1EQVA 2PI2A 1I4RA 2L11A 4IPHA 4R8NA 4DFAA 1MKHA 5K5PA 1JJCB 4BY7G 5EPJA 1D6EC 3SR1A 2EY6A 2F4VL 1GKHA 1Z9FA 3KDFB 3NELA 4K2LA 1DYQA 3NWTA 4C3JB 4B3ML 2ASBA 4UAIA 2NVQB 1G8ZD 1V1OA 3S14B 3J80L 2UUBQ 3UI2A 3NBIA 4ZLTF 3MTSA 3N6RA 5JJKA 3U4ZA 1Y1WG
chains in the Genus database with same CATH topology
3LNNA 4WRDA 1EY0A 4A3MB 1LLRD 1CZWA 3CRKC 5C0XJ 1SE4A 1O78A 1U9RA 1SYGA 4OIKA 3ONAB 1I3QB 2SNSA 3S2HB 2JA8B 5D14A 3KK7A 1KNEA 4DAPA 3KLSA 5FKAC 2Q8TA 4M1UB 4H7BA 1JOQA 2HCCA 2IX3A 4ZK9B 1ENCA 2A5HA 2XSCA 5KNBA 3GTQB 1S5DD 1Q12A 4ABNA 2L4NA 1GUWA 1PRTB 4L8JA 1WTVA 5TSSA 4DNTB 3E6ZX 1LT4D 4G7ZC 2BCOA 4DNRB 2AUKA 3TP5A 1B50A 1UUPA 5KNCA 3FKIB 1SYFA 1IW7C 1I4HA 1IW7D 1CK1A 1ESFA 2PPBC 3C1EA 4RGNA 3A54A 4H44C 5E4WC 3S2DB 1Y1VB 1ILPA 1A3UA 1H9MA 2A69C 2DNEA 2LKVA 4A3IB 3NQTA 1QWYA 5C4ZA 1C8CA 5M3FB 3MFGA 1KDBA 1SYEA 4DK1A 1LT5D 1GUSA 2CW0C 3M85A 3CHBD 2E74C 2KJXA 1VF7A 4C3JG 5IOCA 5ELDA 3J7YW 2BDNA 4RWSC 4DXFA 3NTHA 1A3VA 1S5CD 2F3VA 1JE4A 2F0UA 3MWYW 5IGCA 3DUZA 1VMCA 1TIID 1QJOA 1BCPB 1SNCA 2EY2A 4LMQD 3I73A 1YNJD 2IPKD 1M4VA 1STAA 3SK5A 2DY8A 2O5JC 1E2VA 3GO5A 5I2YA 2QILA 1RCVD 1OXTA 1SE2A 1XXGA 4J8QA 5I9OA 1T5EA 2F0OA 4MIUA 1IHZA 4HSPA 2F0LA 4PMWA 2WV6D 1JWMD 4O42A 2NUCA 5ELEA 2F0EA 2B2WA 3U9OA 3GTMB 3NPPA 4F7XA 1GUTA 4CKCA 2EYLA 2C9OA 3MZ5A 4ZUJA 1II3A 3S15B 4FVMA 1R9TB 1SNQA 3VA7A 2RSOA 2AQ1B 4BY7B 1BCPC 1G291 2JEBI 2F4IA 5BN3A 2PW5A 1LTTD 1KDCA 5C5MA 1OXVA 1NSNS 5ELFA 3X3MA 5KRUA 1KLGD 1NR4A 4RCNA 1JR0D 4HAEA 5CV5A 3X3NA 1PXUA 2J7ZA 1EFID 4IUUA 4OO1I 2Q8RE 3K5OA 2K28A 3OIQA 4PV1C 1B3AA 2CVRA 4ODGA 4JK1C 3P1HA 3NSWA 5E4XA 3RLFA 2HQEA 3L3OC 4QIWB 1UNSA 2VB2X 4X3SA 4GZYC 3NUCA 2XNAC 3SHLA 4RGOS 3C1FA 3I4MB 1FD7D 3C2PA 5EGTA 2I07B 4XYQA 1PTOF 3T53B 3IFTA 4A3BB 1GUNA 1U4MA 4HCSA 3I91A 2SEBD 2NBFA 1CQVA 1PFBA 1S4ZA 1FNWA 2GA4B 2F0GA 3BVMA 1B4OA 4XIGS 3EJIA 1A15A 2EPBA 2OXPA 5M9OA 4C56C 1IKMA 1H9SB 4FXKC 4ME5A 3ITPA 4OHJA 4HCEA 2QKIC 4RA8A 2F0JA 4DA2A 5HURA 3HOZB 3TMEA 2BA0A 3M7GA 2WIIB 1U4PA 5JPMC 3OHXC 1Q8IA 5NUCA 4R9WA 5C0XH 4ZUIA 1EZ8A 1EWCA 4A3EB 1TVXA 1TY2A 3PUVA 4V190 2VB3X 2EZVA 1SNOA 3TDQA 1SJED 1LTSD 3HGBA 2PMZB 3SXHA 4DF7A 1EY4A 3VYRA 2JE6I 2BE5D 3RZDB 4K5WA 2FINB 4IZ8A 4HTHA 3HOWB 3HS0C 5BN4A 4HR7B 1DOMA 5JVG3 2B63B 3GTLB 5EQ0A 1EYCA 1QNKA 2M00A 5HGTA 1SYBA 3ND8A 3BYYB 4HSVA 1Q1EA 2NWGA 5IGEA 1LTID 4N9TA 1BQQT 3IL8A 3VA5A 4HEDA 1EZ6A 1WTXA 1YNND 4IALA 1YNNC 1ENAA 1RJTA 2KCCA 1WTPA 1AN8A 4U673 2DNCA 4XQQA 3GTOB 5JAVA 2IX1A 2AQ3B 2V4DA 3DWPA 3D6WA 2PNRC 1TWCB 3GTGB 1JWSD 4XYOA 3FDTA 4CGYB 3A55A 2K1BA 3ZYYX 1X3QA 4KN4C 5JPNC 1QOHA 4EQPA 4CJ1B 2F0FA 1B9MA 4ZQ3A 3FPUB 4TSSA 4G57A 4DN4M 3MA2B 2M9VA 2WP8J 5DEHA 1TWHB 2R93B 1MD2D 4J6HA 2VXWA 1STBA 3GTJB 5A2QL 2KA7A 3WOEA 1BOSA 4Y7NB 3M4YA 1MSGA 1FGBD 3PUYA 1STEA 3AMUA 2Q8IB 3RUZA 2E75C 3MXGA 1STNA 2IWHA 1Y8OB 5IGFA 4IUTA 3K57A 2AWOA 1EY7A 1S5ED 2MPMA 5DM63 2JYOA 4Z9CB 2Z4HA 2K05A 5M3MB 4C1NI 1KTKA 1U4LA 3S17B 5FLXL 1I4GA 4FYDA 3VR3A 5EBDA 1BO0A 4QB4A 3V96A 3OIPA 2NVTB 5IGGA 3MC0B 4EQOA 3IAYA 4KV6A 1ET6A 5C44B 2L55A 4NMZA 1TS3A 3L9AX 5CV9A 3BG3A 1KDAA 5JEAG 1VMPA 3OMGA 5K36G 3BDOA 2L1BA 3K5MA 1XYIA 1AEXA 5DM73 2KCNA 4KY7A 3R2IA 4CKEA 2WKCA 1ILQA 2ID0A 1PRTF 2KVMA 3I4NB 2N88A 3D6CA 5D65A 1AZQA 1H9RA 1I6HB 4PMBA 2EOTA 1SAPA 4Q5VA 3VR5A 4RHRA 2LFNA 1STGA 2A6HC 2C5CA 2FHTA 1V8QA 1UAPA 2JP1A 5CC4A 1VDZA 1HUMA 3O13A 1D2BA 3Q0AA 5E3FA 1TKWB 1ZKOA 1SDFA 2E2IB 4WJWA 5I2XA 3H0GB 5C3XA 4BA2I 3DM1A 4IUQA 3FPPA 1Y69U 1EQTA 3F2UA 3CKIB 2RQXA 1WD0A 4X3TA 2LS01 4K5XA 1Q3LA 2K5DA 2JA5B 4QUFA 3VR6A 2FMCA 1BXTA 2IT1A 5JJZA 3DEOA 1Q1BA 1FNVA 3BDLA 1L0YB 2JA7B 1D1IA 3BZDB 2BDOA 1CT1D 1PFNA 4RGMA 2NVYB 4OGQC 2F0NA 1FR3A 2AWNA 5CV4A 1MGSA 1PMRA 4J1MA 4XXEA 4B9WA 1GJXA 1MI2A 5EKLA 3CU7A 3DXJC 2M2LA 5C5LA 5FO7B 1JWUD 4K8JA 1EEID 1QNUA 5LL6X 3KF8A 3S1RB 1Y8NB 2F0PA 1TS5A 1G6ZA 2PW7A 2ENBA 2ICEC 4BA1I 1K83B 1HTLD 1O7ZA 3KBGA 4EQNA 4ZKBB 2KOLA 1NAPA 1PDQA 3I90A 2WB1B 3FRPB 4RAUC 1LTBD 5M5WB 2LY7A 5IT9E 1BUVT 1JQYD 1CTMA 1ENFA 3PIO3 2R92B 2L12A 2N55A 5FO9B 3VR2A 3VYTA 4L6TB 4V0BA 3T51B 5F2DA 5CBEE 3ERQA 1XX8A 1PYWD 2B2TA 2D5DA 1B2TA 3M3YB 4L63B 3P7JA 4K6DA 1EEFD 5JOBA 1L0XB 3S1QB 3MVVA 4R8IA 1SEBD 2PO4A 5M5YB 3I8ZA 5D3IB 4P2CB 2K01A 2OF1A 1EYDA 3OOCA 3OSOA 1WTRA 3SK6A 3N52A 3HOYB 2R3ZA 2MJ8A 1WVLA 3K7AB 1G2TA 3GTKB 2XRQD 1FYCA 1IYUA 1KAAA 4A3DB 4ID6A 4OL7A 4PQXA 1JB3A 4DU9A 4NKLA 1VF5C 4RCOA 3M7NA 5I6YA 4YIJA 1EIHA 1V1PB 2F0VA 3J81L 1RTNA 4FXGC 4TRDA 2JA6B 2K32A 4K8IA 4C3IG 3TZUA 5C0XG 1GHJA 1SNPA 5I9PA 1LTGD 4IN3A 1F9QA 3DMUA 3RMHA 3I3CA 5ELBA 2EYFA 1CZGA 2BA1A 2F0QA 3NTIA 4IURA 4UDUC 3A7AB 3DWAA 1TQOA 4C3HG 2XRSD 1B44D 2F0HA 4LAAA 2MUYA 1WCMB 2B2WC 2F3WA 2WKDA 2B2UA 1JOOA 4KHVA 4B9XA 3C46A 3MFYA 2D9UA 1BBXC 1YNJC 1EL0A 1SE3A 1RD9D 1PTOC 1EY6A 1DZ1A 3M4OB 1B9NA 2QEJC 2F0MA 2D2CC 4K2KA 3Q24A 2O2LD 1AFPA 1SSOA 2QF7A 2MP1A 2NB0A 3T16A 1AP0A 2HCIA 3I70A 1KLUD 1HCZA 4BS9A 3GQBA 1CFMA 2R6GA 4QUCA 3HRZC 3PO3B 1DONA 2E2DC 2A6ED 2EY1A 4OO1G 1TT2A 5K36H 3HOVB 1JCKB 1F2ZA 3HZXA 3HKZB 3NBHA 4LJZC 1LO5D 2G9HD 1V43A 1STYA 1BCPF 3PV0A 4C3IB 4XT1B 1PTOB 3OMCA 5IT9L 2F0KA 1IKLA 1XTCD 1TY0A 2B8GA 3AB9A 1U4RA 4BBSB 3D31A 3HP3A 1Y1WB 4MN3A 2Z1CA 4KD4A 4KKUA 4IUVA 4Q0FA 3FEWX 3URYA 1CA6A 1K8MA 3GV6A 1QILA 1ZXTA 1LACA 1EOTA 4DXGA 2L9HA 5FK9C 2NTSA 3I4LA 3IKJA 3MEHA 4FF2A 1TWAB 2Z4IA 4MHEA 5CGKA 1RODA 3P75A 2XIWA 4C1NK 5C4HA 3GP7A 5CR3A 2A68C 3MXNA 4B08A 1HHVA 2EYPA 2Z8LA 2K04A 2DN8A 3OWEB 1TR5A 3D8GA 2RKSA 1F9SA 2MGSA 2DY7A 4FF4A 5T1IA 4E6IA 4C2MB 3H6MA 2CW0D 3JAML 4H0LC 2E76C 4FF1A 2K6AA 2NZ1D 1DM0B 1I50B 2PQEA 5EPKA 5FLXE 2EYMA 3A7LA 5KYLA 1CA5A 4DAYA 5G3LF 2L5TA 1WTQA 2A73B 2PYKA 4O1NA 3NTKA 5EBCA 1TWFB 1F2LA 5I4DA 3J7AV 5CV8A 4KY5A 1TS2A 3D4RA 4IFDG 4CBVA 1CHPD 3EA6A 3S16B 5IIFA 5C3WA 1F2MA 5J22A 1PTOD 3NE5B 5EPLA 1Q90A 2RBMA 1GUGA 1H9KA 2K33A 5IGBA 4EGVA 5J39A 3VYSA 4HMIA 1EY8A 3DHQA 1LT3D 3IFDA 4RFBA 3DEPA 4ULLA 4NW2A 1OXXK 2KECA 4ZAIA 2EJGC 3K0YA 2BOSA 3NHHA 2L0CA 1PLFA 3SVMA 4QMGA 3R93A 5AFWA 4A3FB 2CQAA 3V05A 3T4AC 4FO2A 2WAQB 2OT2A 4IFDI 2PZWA 3H3VC 2YYZA 3BVGA 2TSSA 5CV6A 2JEAI 2ZXOA 5BN5A 4KKTA 4K5VA 1OXUA 2E2JB 2NVXB 1X32A 5T1GA 4RKBA 1A2UA 1F9PA 4KTAA 5CV7A 3QO2A 3Q23A 4PNYA 1O7YA 5E1FA 2X6GA 3T13A 1EIGA 3QIAA 1QE6A 4XT3B 3BYTB 4XQJA 1MBYA 1HTPA 1LTRD 2TMPA 1BDOA 5EJWA 2K7VA 3NK9A 5C3EB 3NWSA 1A3TA 2LMCB 2A68D 1D5ZC 2R61A 1S5BD 3ND9A 3E5SA 4S3SA 4A3GB 1BF4A 1H9SA 3QOJA 4OO1H 3LWUA 4ZYSA 4NDXA 2FJ2A 3K58A 3TBIB 1IYVA 1C48A 1EU3A 3D4WA 4X3UA 4BBRB 1HQMC 2EYJA 1SMYD 3TZDA 2IJ0A 4CKBA 1MSHA 1WD1A 1DCZA 5ISRA 3RD4A 3QOLA 2O5IC 1QCBD 4I65A 3BDCA 1D5XC 5C4XB 1SMYC 2PCFB 5M5XB 2RDFA 1QB5D 3TSSA 3FVQA 3HOUB 2HDMA 1TS4A 4KJNA 4DAVA 3GD7A 3Q22A 2FMMA 2F0WA 4G4KA 2EXZA 1PTOH 1EY5A 1EU4A 4PMCA 4IFDH 2BE5C 1J9OA 4DGZA 1CHQD 3MHBA 3PUWA 2XWBB 2Y0SB 2ZXPA 4M8AA 3AU7A 1HRJA 4KD3A 3SE0A 4F87A 1BNZA 1ICWA 1XWEA 2H1EA 2AQ2B 4G7OC 1SYCA 2EYOA 1NR2A 1W6JA 2B2VA 3MXPA 1GHKA 2RVLA 4LK1C 1OO9B 2YU9B 2KUMA 3JAME 3CQZB 3H91A 1JORA 5IODA 4RHSA 4CHTB 1WTOA 2NTTA 4XTCS 4WFN3 2NN6I 3PIP3 5DNFA 3EROA 3I72A 3QJYA 2SOBA 3EVQA 1HQRD 3L7ZC 1GUOA 3J81E 2HDLA 3Q6SA 5JEAJ 1FNUA 1SXTA 3K5NA 3MXUA 5G3LD 1RKNA 1PRTD 3KBXA 1A6XA 4KHZA 4A3KB 3S1MB 4KN7C 1TU2B 5C4JB 2R7ZB 4AYBB 4A93B 1UEAB 2NN6H 4KKSA 1SJHD 2B2UC 4HMJA 1LT6D 2B39A 3NP8A 5C0XI 5CMDA 4RKLA 4A3JB 4OIJA 2EDGA 2NYZD 3FMCA 4TQUS 1Z47A 3K6OA 4I7ZC 3TP8A 1A2TA 5FOBB 2VUMB 2H4OA 1DOLA 3P20A 2QDBA 1RF2D 2ZXRA 3D3RA 3U9SA 3KLRA 1I4XA 3HG9A 3A8JE 1M8AA 3NQIA 1WTWA 5KIXA 2EY5A 5J1ZA 1HA5A 2K5WA 3A8IE 1SNDA 3LWEA 2A6EC 3K59A 2O4XA 4FF3A 3E0JA 1KABA 3QG1A 1RDPD 4RH6A 1J8IA 3T56B 3H09A 4ZKCB 2F0IA 4FNFA 3S1NB 1B1ZA 3NXWA 3HEJA 2B2VC 1R4PB 1VCIA 1HFNA 2F03A 3C3LA 1NCVA 1JICA 5CYUA 4QCLA 4FXDA 1E2WA 3VYUA 1JC7A 2EYHA 2I46A 4IUPA 4XDXA 3R2TA 1H9JA 3R8BA 1JOKA 3D4DA 3GV3A 4RGTA 3KUPA 1PFMA 1I6VC 4WORA 3RZOB 2MHVA 1G2SA 1HFGA 4EVOA 1PZKD 1BCPD 1ZYRD 3TP7A 1ZYRC 1AZPA 4KY6A 1IL8A 4U68A 2F0TA 3EQLC 1KNAA 5KGUA 4QF4A 1V1PA 2XWJB 4ZRZA 1Z7TA 5EKKA 2K5QA 5A2QE 2EJMA 3R3OA 2F1MA 1SFOB 2A69D 3W3AA 2X69A 3VR4A 2VNUD 1CM9A 3G6JB 4IUNA 4F8MA 2XVSA 4N9PA 4NP5A 2G9DA 4K14A 4BY1B 1G91A 1F2YA 5D3DA 2RA4A 4C3HB 4X3KA 1ZEQX 1STHA 1DXMA 1I4PA 3W2DA 1HUNA 5I6WA 2HUGA 3J80E 2CHBD 3KLSX 1K8OA 2KHSA 2EVBA 1AW7A 1LV9A 3PO2B 5IGDA 1ML0D 2FFKB 1R4QB 1T5XD 1PZJD 3PUXA 1DOKA 1E0BA 1RHPA 4HN7A 2IW3A 2A74C 1W6KA 1ESRA 4BWGB 3K5LA 2WACA 4F88A 2AUJD 3GTPB 1LTAD 1GOZA 2EE1A 4FP5D 3PUZA 3TN2A 5JVH3 3SK4A 2SDFA 1QG7A 2K03A 3SK8A 3QB3A 1PZID 3A8KE 1ONLA 3OPOA 3HOXB 3S9WA 1O80A 2EJFC 2ICIA 3MAQA 1LABA 2IL8A 3PMFA 1DJRD 5LHY1 1ET9A 3QWNA 2KEEA 1HXYD 1HA6A 5EKIA 3H94A 3A56A 1DD2A 1I4QA 2JXMB 2XN9C 3OWFA 1EYAA 2OEOA 3TP6A 4KI0A 2J4XA 1F77A 4TKOB 1SNMA 2RSNA 1F9RA 5KEEA 1GXDC 1D5MC 4KJOA 2B2YC 2B2YA 3WOFA 4KK7A 1EY9A 5KYIA 5COYA 1TWGB 2PZUA 3EFXD 1O7LA 1Z6HA 3V2TA 2F0DA 2D62A 3OW7A 3LX0A 4ILWA 5FO8B 1RTOA 1EWHA 3J7AF 2B8FA 4K6LA 1X3PA 1S5FD 2F0SA 4IFDJ 5ELCA 2QCPX 4IQZA 2JSOA 1BR9A 3BVZA 2WINB 4KMUC 1Y8PB 4G7HC 1CI3M 5CORA 2RDGA 3SEBA 2X6LA 4H13C 1D1KA 4DK0A 5A35A 1CQFA 2KEDA 5DAUA 2PZTA 4XQNA 1B53A 5KNDA 1PRTC 1SYDA 3SDZA 5CBAE 2ZT9C 1HPCA 2A6HD 1OXSC 4JBWA 2IX0A 3CRLC 5C6AA 1SBBB 3DWQA 1E2ZA 2J0TD 2NN6G 3WDNA 2B2TC 2SNMA 1NUCA 2RDHA 4CJ2C 5JEAH 2KQ3A 5LL6S 3BS1A 3G7LA 1C4QA 4CJ0B 2E2HB 1EQVA 5K5PA 1I4RA 2L11A 4R8NA 4DFAA 5EPJA 1D6EC 3SR1A 2EY6A 4K2LA 1DYQA 3NWTA 4C3JB 4UAIA 2NVQB 1G8ZD 1V1OA 3S14B 3J80L 3UI2A 3NBIA 4ZLTF 3MTSA 3N6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STG A;  4ID6 A;  4WRD A;  4OL7 A;  1EY0 A;  1SNO A;  5IGD A;  1F2Z A;  4J6H A;  4WOR A;  2F0D A;  3V2T A;  4PMC A;  1STB A;  5CV6 A;  4DU9 A;  4HMJ A;  4EQN A;  3LX0 A;  4NKL A;  5IOC A;  3HZX A;  3NP8 A;  4K2K A;  5I6Y A;  4K5V A;  4YIJ A;  3SXH A;  1U9R A;  2PQE A;  1SYG A;  4DF7 A;  1EY4 A;  2F0V A;  4DGZ A;  5CC4 A;  4RKL A;  2EYM A;  3MHB A;  4RKB A;  1A3V A;  2F3V A;  1A2U A;  2SNS A;  4TRD A;  2F0U A;  4EVO A;  4KTA A;  5CV7 A;  5E3F A;  5I6W A;  4K5W A;  5IGC A;  5KYL A;  4ODG A;  3TP7 A;  2F0S A;  4KD3 A;  3RUZ A;  4KY6 A;  4K8I A;  3P1H A;  4IZ8 A;  1STY A;  4HTH A;  4PNY A;  2WAC A;  1STN A;  5C3X A;  2F0T A;  1SNC A;  3OMC A;  2EY2 A;  5IGF A;  2HQE A;  4H7B A;  5E1F A;  3TP8 A;  5KGU A;  1JOQ A;  3T13 A;  1SNP A;  2PYK A;  4QF4 A;  1A2T A;  1EY7 A;  2F0K A;  1STA A;  1EYC A;  3SK5 A;  5I9P A;  5CV8 A;  3NUC A;  4KY5 A;  3SK4 A;  2M00 A;  5HGT A;  1ENC A;  1SYC A;  2QDB A;  2EYO A;  3NK9 A;  5EKK A;  1SYB A;  3SHL A;  3SK8 A;  3DMU A;  3QB3 A;  5IGE A;  1A3T A;  3C1F A;  3R3O A;  4K5X A;  4N9T A;  4KD4 A;  5F2D A;  3MXP A;  5EGT A;  2EYF A;  5I9O A;  3VA5 A;  2F0O A;  4MIU A;  5IIF A;  5C3W A;  1IHZ A;  1EZ6 A;  2F0Q A;  3ERQ A;  3E5S A;  5KIX A;  2F0L A;  4S3S A;  5DAU A;  2EY5 A;  3S9W A;  4IAL A;  3QOJ A;  1ENA A;  2PZT A;  5J1Z A;  1TQO A;  1F2M A;  4QB4 A;  5J22 A;  3BDL A;  1SND A;  1SYD A;  4NDX A;  2F0H A;  5IGG A;  4IUN A;  2NUC A;  4K6D A;  4LAA A;  2O4X A;  5JOB A;  5JAV A;  2F0E A;  2RBM A;  4EQO A;  5IOD A;  1JOR A;  4KV6 A;  4F8M A;  3PMF A;  3TP5 A;  4N9P A;  4NP5 A;  2F3W A;  3D4W A;  3MVV A;  3U9O A;  2EYJ A;  2PW7 A;  2F0G A;  4K14 A;  4NMZ A;  1KAB A;  4F7X A;  5IGB A;  1JOO A;  5J39 A;  3ERO A;  5C6A A;  4HMI A;  4KHV A;  4B9X A;  3EJI A;  1SYF A;  1EY8 A;  3DHQ A;  2EYL A;  1F2Y A;  3MZ5 A;  5CV9 A;  2OXP A;  1II3 A;  4ZUJ A;  5ISR A;  5M9O A;  2F0N A;  1KDA A;  2SNM A;  1NUC A;  1SNQ A;  2SOB A;  3MEH A;  5CV4 A;  2F0I A;  2KQ3 A;  3C1E A;  3EVQ A;  3OMG A;  5K5P A;  1EY6 A;  4J1M A;  5CGK A;  4B9W A;  2OF1 A;  3H6M A;  3QOL A;  4DFA A;  1EYD A;  3OWF A;  4ME5 A;  1EYA A;  3NXW A;  1STH A;  1AEX A;  2F0M A;  3NHH A;  3OSO A;  3P75 A;  2OEO A;  2PW5 A;  3ITP A;  3BDC A;  4I65 A;  3HEJ A;  5EKL A;  4KY7 A;  3TP6 A;  5C4H A;  5CR3 A;  1KDC A;  4QMG A;  5C5L A;  2F0J A;  1SNM A;  3SK6 A;  1A3U A;  2EYP A;  4K8J A;  1EQV A;  3TME A;  4EQP A;  5HUR A;  4R8N A;  2LKV A;  1TR5 A;  2F0F A;  3D8G A;  2RKS A;  3D4D A;  4ZQ3 A;  2RDF A;  3NQT A;  3T16 A;  3D6C A;  5KEE A;  5C5M A;  4KJO A;  5C4Z A;  1RKN A;  3SR1 A;  2EY6 A;  1NSN S;  4G57 A;  4PMB A;  5KRU A;  4K2L A;  2F0P A;  4KJN A;  2EYH A;  1EY9 A;  5NUC A;  5KYI A;  1KDB A;  2F0W A;  1SYE A;  2EY1 A;  2KHS A;  2PZW A;  4ZUI A;  2EXZ A;  1EZ8 A;  1TT2 A;  4E6I A;  5CV5 A;  5DEH A;  2PZU A;  1EY5 A;  1JOK A;  1KAA A;  2ENB A; 
#chains in the Genus database with same CATH topology
 3LNN A;  4WRD A;  1EY0 A;  3J81 j;  5HGQ A;  3UDI A;  2UXB Q;  4A3M B;  5FJ8 G;  1LLR D;  4A3K G;  1CZW A;  3CRK C;  5C0X J;  3KF8 B;  1SE4 A;  2UUC Q;  1O78 A;  1U9R A;  1SYG A;  4HIM A;  3OW2 A;  4OIK A;  1L1O B;  4A3I G;  3ONA B;  1I3Q B;  4YCW A;  2SNS A;  3S2H B;  2JA8 B;  2Z0S A;  5D14 A;  1S40 A;  3K7A H;  4DV5 L;  3KK7 A;  1IYJ B;  1KNE A;  2VQF Q;  4DAP A;  3KLS A;  5FKA C;  2Q8T A;  4M1U B;  1YBY A;  5IP9 H;  1Y1V H;  4H7B A;  2UXB L;  3GTJ H;  1JOQ A;  2HCC A;  4X62 Q;  3BJU A;  2IX3 A;  3ULL A;  4ZK9 B;  1ENC A;  2A5H A;  3UE1 A;  2XSC A;  5KNB A;  4HJ8 A;  3GTQ B;  1S5D D;  1EUJ A;  1Q12 A;  4ABN A;  1IBK L;  2L4N A;  1SFO H;  1GUW A;  1PRT B;  1R9T H;  5LMN W;  1PYS B;  4L8J A;  5IT9 c;  1WTV A;  5TSS A;  2R7Z H;  2AKW B;  4DNT B;  3E6Z X;  4LF8 Q;  1LT4 D;  4G7Z C;  2BCO A;  1GD7 A;  4JCV E;  1VQJ A;  2KBN A;  4DNR B;  3HKZ E;  1WI5 A;  2AUK A;  4DAY B;  3TP5 A;  1IL2 A;  1B50 A;  1NJI C;  3HOY G;  1UUP A;  3PIP A;  5KNC A;  4YWM A;  3FKI B;  1EFW A;  1SYF A;  1PH8 A;  1IW7 C;  1I4H A;  2JQO A;  1FJG L;  4BY1 H;  1IW7 D;  1CK1 A;  3U50 C;  1ESF A;  2PPB C;  3C1E A;  4RGN A;  3A54 A;  2Q2H A;  4H44 C;  2DJG C;  5E4W C;  3S2D B;  1Y1V B;  1ILP A;  1A3U A;  1H9M A;  2A69 C;  2DNE A;  1X65 A;  2LKV A;  4A3I B;  3NQT A;  1QWY A;  5C4Z A;  5FJ8 H;  1G51 A;  1LTL A;  1C8C A;  4BXX G;  5M3F B;  3RN2 A;  1WJJ A;  3MFG A;  1KDB A;  1SYE A;  4DK1 A;  1LT5 D;  1GUS A;  2CW0 C;  3M85 A;  1PVO A;  1FL0 A;  4NXM Q;  4JBJ A;  3M3Y H;  2VY3 A;  3CHB D;  2E74 C;  2KJX A;  4DUY L;  4UPA A;  1VF7 A;  4C3J G;  3UE0 A;  5IOC A;  5ELD A;  4LF7 L;  3J7Y W;  2BDN A;  4RWS C;  3FP9 A;  3NTH A;  4DXF A;  2ES2 A;  4LWC A;  1A3V A;  1S5C D;  1VS0 A;  2F3V A;  1JE4 A;  2F0U A;  4N8X 1;  3PO2 G;  4GOP A;  3MWY W;  5IGC A;  3DUZ A;  4DUZ L;  4X62 L;  1VMC A;  1TII D;  4R4Q A;  1QJO A;  1BCP B;  3F8T A;  3T1Y Q;  1SNC A;  2EY2 A;  4LMQ D;  1PH7 A;  3I73 A;  5GAD C;  2VUM G;  1A8V A;  1YNJ D;  2CWA A;  2IPK D;  1M4V A;  1STA A;  4A3I H;  3SK5 A;  1VQ4 A;  2DY8 A;  4A3B G;  2O5J C;  3W1B A;  1E2V A;  3GO5 A;  4HIK A;  5I2Y A;  1N32 Q;  1AE2 A;  2QIL A;  3UDG A;  4A3J H;  1YNX A;  1RCV D;  1OXT A;  1SE2 A;  1XXG A;  1LUZ A;  4J8Q A;  1QVC A;  5I9O A;  4DV3 L;  1T5E A;  2F0O A;  4GN3 B;  4MIU A;  3PO3 G;  1IHZ A;  2VZA A;  4HSP A;  2F0L A;  4PMW A;  2WV6 D;  2UUB L;  1JWM D;  4O42 A;  2NUC A;  5ELE A;  2F0E A;  3K8A A;  3D0F A;  4PZ6 A;  2B2W A;  4DUY Q;  3U9O A;  3GTM B;  1PH5 A;  4R4I A;  2K5N A;  3NPP A;  4F7X A;  2BH8 A;  1GUT A;  4CKC A;  2EYL A;  4DR6 L;  2C9O A;  4QIW E;  3MZ5 A;  4ZUJ A;  1II3 A;  3G71 A;  4DV7 L;  3S15 B;  4FVM A;  1R9T B;  1SNQ A;  4HJ9 A;  5GAH C;  2RSO A;  3VA7 A;  1Q81 C;  2AQ1 B;  3RN5 A;  1BCP C;  4LFB L;  4DR4 Q;  4BY7 B;  1G29 1;  1JB7 A;  2A19 A;  2UXD Q;  2JEB I;  4OX9 Q;  2F4I A;  5BN3 A;  2PW5 A;  2CQO A;  3HKS A;  1QZH A;  1LTT D;  1KDC A;  3JC6 6;  3ERS X;  4A93 H;  5C5M A;  1OXV A;  3S1M H;  1NSN S;  5ELF A;  3X3M A;  5KRU A;  1NTG A;  1BBW A;  1KLG D;  1O7I A;  1NR4 A;  4RCN A;  1JR0 D;  1XMQ L;  2OQ0 A;  4HAE A;  4GN4 B;  4UP8 A;  5CV5 A;  3X3N A;  2RHS B;  1PHJ A;  2JA5 G;  4DR2 L;  1PXU A;  2KCM A;  1TWG H;  3STB C;  1D7Q A;  4YCV A;  2J7Z A;  1EFI D;  4IUU A;  3S2D H;  4OO1 I;  2Q8R E;  3K5O A;  2K28 A;  3OIQ A;  3H15 A;  4PV1 C;  1B3A A;  2CVR A;  1I94 L;  3RLN A;  1HH2 P;  4ODG A;  4LFB Q;  4JK1 C;  3P1H A;  1JJG A;  3NSW A;  4DV7 Q;  5E4X A;  3RLF A;  2HQE A;  1KAW A;  3L3O C;  4QIW B;  1UNS A;  2VB2 X;  3J80 i;  4X3S A;  4GZY C;  3NUC A;  3TS2 A;  4LFA L;  3GTK H;  1RL2 A;  2XNA C;  3SHL A;  3I56 A;  4UP9 A;  4RGO S;  4APV A;  4DV2 L;  4A3K H;  2K5H A;  2F3I A;  2N3S A;  3C1F A;  3I4M B;  1FD7 D;  3C2P A;  5EGT A;  3U4V A;  2I07 B;  4XYQ A;  2JA9 A;  1PTO F;  3T53 B;  3IFT A;  4A3B B;  1GUN A;  1U4M A;  4HCS A;  1VQB A;  3E9I A;  3I91 A;  2SEB D;  3AYH B;  2NBF A;  1CQV A;  1PFB A;  1VQH A;  1S4Z A;  1FNW A;  1EQQ A;  2GA4 B;  2F0G A;  4A3E G;  3BVM A;  1B4O A;  4XIG S;  2UUC L;  3EJI A;  1A15 A;  2EPB A;  2OXP A;  5M9O A;  4C56 C;  1H95 A;  1IKM A;  1H9S B;  4FXK C;  1MHW C;  4ME5 A;  2JA8 H;  3ITP A;  4OHJ A;  4HCE A;  1YVC A;  2QKI C;  4RA8 A;  2F0J A;  4DA2 A;  1XJV A;  3S24 A;  5HUR A;  3HOZ B;  3TME A;  2BA0 A;  4QL5 A;  3A5Z B;  3M7G A;  2WII B;  1WFQ A;  1U4P A;  1K83 H;  5JPM C;  1HZB A;  3J7A 5;  3OHX C;  4LF5 L;  4GKK Q;  1Q8I A;  4YCU A;  5NUC A;  4R9W A;  2R92 H;  4A3C H;  5C0X H;  4ZUI A;  1EZ8 A;  5M5X H;  1EWC A;  4A3E B;  1TVX A;  1TY2 A;  3PUV A;  4V19 0;  3UDF A;  2VB3 X;  2EZV A;  1SNO A;  2R93 H;  3TDQ A;  2JA6 G;  1SJE D;  1LTS D;  3HGB A;  2PMZ B;  1CSP A;  4R1J A;  3PSI A;  3SXH A;  4DF7 A;  1EY4 A;  1VQD A;  2JE6 I;  2BE5 D;  3VYR A;  4B3R L;  3RZD B;  4ALP A;  4K5W A;  4A3M H;  2FIN B;  4IZ8 A;  4HTH A;  3HOW B;  3HS0 C;  3E0E A;  5BN4 A;  4HR7 B;  3I4N G;  1DOM A;  5JVG 3;  2B63 B;  3GTL B;  5EQ0 A;  1EYC A;  1QNK A;  2UXD L;  2M00 A;  2DJF C;  1HR0 W;  1V9P A;  1HNX Q;  5HGT A;  1SYB A;  4I7A A;  2NZO A;  3ND8 A;  3BYY B;  4HSV A;  5M3M G;  2ZM6 L;  4PZ7 A;  2GVB A;  1Q1E A;  2NWG A;  5IGE A;  1LTI D;  4N9T A;  1BQQ T;  2Y0S G;  4LF4 L;  3IL8 A;  3VA5 A;  2WAQ G;  4HED A;  1EZ6 A;  3PF5 A;  1WTX A;  1YNN D;  4IAL A;  1YNN C;  1ENA A;  1RJT A;  5C4X H;  2KCC A;  1WTP A;  1AN8 A;  4U67 3;  2DNC A;  2CKZ B;  4XQQ A;  3GTO B;  5JAV A;  2IX1 A;  3BZK A;  4X64 Q;  4JI2 Q;  2AQ3 B;  2N8N A;  2V4D A;  3DWP A;  1WOC A;  3D6W A;  1HZC A;  4DV1 Q;  4JVZ A;  3FKI H;  2PNR C;  1TWC B;  3GTG B;  3H0G H;  2UXC L;  2LXJ A;  4FDB A;  4DV4 Q;  4DV5 Q;  1JWS D;  3I4O A;  3FDT A;  4XYO A;  4CGY B;  1XPR A;  2NVX H;  1D8L A;  3W1G A;  3A55 A;  2K1B A;  3AFP A;  3ZYY X;  4X66 L;  1NY4 A;  1QVF A;  1X3Q A;  2PQA B;  4KN4 C;  5JPN C;  3GTG H;  1K0S A;  1QOH A;  4EQP A;  4X66 Q;  3KLW A;  2F0F A;  4CJ1 B;  1B9M A;  4ZQ3 A;  1VQE A;  1HNZ Q;  4P73 A;  3FPU B;  2DUD A;  4TSS A;  1NE3 A;  1Q86 C;  4G57 A;  3OTO Q;  4OWW B;  4DN4 M;  2UXC Q;  3MA2 B;  2M9V A;  2R7D A;  2WP8 J;  5DEH A;  1TWH B;  1I6H H;  4B3S L;  2R93 B;  1MD2 D;  4J6H A;  2VXW A;  1STB A;  3GTJ B;  1HNW L;  5A2Q L;  2KA7 A;  3WOE A;  4NXM L;  2K75 A;  1BOS A;  4Y7N B;  3M4Y A;  3UDX A;  1MSG A;  1FGB D;  3PUY A;  1STE A;  3HOV H;  3AMU A;  2Q8I B;  3RUZ A;  4GS3 A;  2E75 C;  1C9O A;  2KEN A;  3MXG A;  2B3G A;  1STN A;  1WCM G;  4LF4 Q;  2IWH A;  1Y8O B;  5IGF A;  1XMO L;  4NXN Q;  4IUT A;  3K57 A;  4JOI A;  2AWO A;  1EY7 A;  1S5E D;  2MPM A;  5DM6 3;  2JYO A;  4Z9C B;  3JAM i;  1VQI A;  2Z4H A;  4JBK A;  2K05 A;  5M3M B;  4C1N I;  1KTK A;  2JA7 G;  1U4L A;  3S17 B;  5FLX L;  1I4G A;  4FYD A;  3AQQ A;  3VR3 A;  5EBD A;  1BO0 A;  1S72 A;  2I5H A;  4QB4 A;  3V96 A;  3OIP A;  4H02 A;  2NVT B;  5IGG A;  3MC0 B;  4EQO A;  1IZ6 A;  3IAY A;  4KV6 A;  1ET6 A;  5C44 B;  4A3B H;  4OX9 L;  2L55 A;  3K7U C;  4R4C A;  1WYD A;  4NMZ A;  4YHH Q;  3I4M H;  1TS3 A;  3L9A X;  5CV9 A;  1M1K C;  3BG3 A;  2AHO B;  1KDA A;  5JEA G;  4QQB X;  1VMP A;  3OMG A;  5K36 G;  3BDO A;  2L1B A;  3K5M A;  1VQF A;  1XYI A;  1AEX A;  2Z9H A;  5DM7 3;  2KCN A;  4KY7 A;  3R2I A;  2XTI A;  4CKE A;  2WKC A;  1ILQ A;  3KF6 A;  2ID0 A;  5M3M H;  2IHE A;  1U0L A;  1YEZ A;  4NB3 A;  1PRT F;  4GN5 A;  5LMN Q;  2KVM A;  2D0P A;  3I4N B;  2N88 A;  3D6C A;  5D65 A;  1AZQ A;  1H9R A;  1HJP A;  1I6H B;  4PMB A;  2EOT A;  3I2Z A;  1SAP A;  4Q5V A;  3VR5 A;  1HNZ L;  4RHR A;  1C0A A;  2LFN A;  1STG A;  2A6H C;  2C5C A;  1YJ9 A;  2FHT A;  1V8Q A;  4YWK A;  5C44 G;  4DV0 Q;  1UAP A;  1KIX A;  3F2B A;  1N8R C;  2JP1 A;  5CC4 A;  1VDZ A;  1HUM A;  3O13 A;  3GDE A;  1D2B A;  4QY7 A;  3Q0A A;  2D0O A;  2AMC B;  5E3F A;  3J80 c;  1TKW B;  1ZKO A;  1SDF A;  2E2I B;  4DK6 C;  4WJW A;  5I2X A;  3H0G B;  4HID A;  5C3X A;  4BA2 I;  3DM1 A;  4IUQ A;  3G6E A;  4JI7 L;  4A3C G;  3FPP A;  1Y69 U;  1L1O C;  1EWI A;  1EQT A;  3F2U A;  3HOY H;  3CKI B;  2RQX A;  1WD0 A;  4X3T A;  1LM0 A;  2LS0 1;  4K5X A;  4GOP B;  1Q3L A;  2K5D A;  2JA5 B;  4QUF A;  2JA8 G;  4LUV A;  4YHH L;  3VR6 A;  2FMC A;  1BXT A;  2IT1 A;  1VQ6 A;  1JT8 A;  5JJZ A;  3DEO A;  1Q1B A;  1FNV A;  3H3V I;  1C7Y A;  3BDL A;  3HOU G;  1PH1 A;  1L0Y B;  5FLX c;  2CFM A;  2JA7 B;  1X3E A;  4Y52 H;  1D1I A;  3BZD B;  2PMZ E;  2BDO A;  1CT1 D;  1BBU A;  1PFN A;  3GTL H;  2RHQ B;  4RGM A;  2B63 H;  3PGZ A;  2NVY B;  4OGQ C;  2F0N A;  1FR3 A;  2AWN A;  3HOW H;  5CV4 A;  1RIP A;  2ZTC A;  1MGS A;  1PMR A;  4J1M A;  4XXE A;  4B9W A;  1GJX A;  4IOA A;  4JYA L;  2UU9 Q;  1MI2 A;  5EKL A;  3CU7 A;  3DXJ C;  2M2L A;  5C5L A;  5FO7 B;  1JWU D;  3PCO B;  4JI8 L;  4K8J A;  1EEI D;  4DPG A;  1QNU A;  5LL6 X;  3HOX H;  3CP0 A;  3KF8 A;  4K0K Q;  4CDD C;  3CD6 A;  3S1R B;  1Y8N B;  3CXC A;  2F0P A;  1Q46 A;  1MJC A;  4LF6 Q;  1WCM H;  1TS5 A;  1IBK Q;  1G6Z A;  2MFI A;  2PW7 A;  2ENB A;  2ICE C;  4BA1 I;  1HR0 L;  2ATW A;  3M4Q A;  1KD1 C;  1HNW Q;  1K83 B;  4JI7 Q;  1HTL D;  1O7Z A;  3KBG A;  4IO9 A;  4EQN A;  4ZKB B;  2KOL A;  1NAP A;  4OEL B;  1PDQ A;  3I90 A;  5FLM H;  4L5S A;  1VQC A;  2WB1 B;  3FRP B;  4RAU C;  2ALY B;  1LTB D;  5M5W B;  2LY7 A;  5IT9 E;  2ZTE A;  1BUV T;  4GNX C;  1VQA A;  1JQY D;  3GTM H;  1CTM A;  1ENF A;  3J81 i;  4JG2 A;  3PIO 3;  2R92 B;  2L12 A;  2N55 A;  5FO9 B;  3CCM A;  3CCL A;  3VR2 A;  3KYH C;  3VYT A;  4JPB W;  2QEX A;  4L6T B;  4HJ7 A;  1X54 A;  4V0B A;  3T51 B;  5F2D A;  5CBE E;  3T1Y L;  4UY8 C;  1YJW A;  2F4V Q;  3ERQ A;  1XX8 A;  4DV1 L;  1PYW D;  2B2T A;  3HKZ G;  1A63 A;  1SRO A;  2D5D A;  1B2T A;  3M3Y B;  4L63 B;  2YTX A;  3P7J A;  2N49 A;  1EEF D;  4K6D A;  1N33 Q;  5JJL A;  5JOB A;  5GQO A;  3M4O H;  4HIO A;  3WWV A;  3L0O A;  1L0X B;  3S1Q B;  3MVV A;  4R8I A;  1SEB D;  1EYG A;  2PO4 A;  5M5Y B;  1VQ5 A;  2YV5 A;  2YU9 H;  1S3O A;  2JA6 H;  3I8Z A;  5D3I B;  4P2C B;  2K01 A;  2OF1 A;  1EYD A;  3OOC A;  3OSO A;  1WTR A;  1GVP A;  4NPS A;  1IBM L;  1KXL A;  3SK6 A;  3N52 A;  3HOY B;  4DR7 Q;  2R3Z A;  2MJ8 A;  2I5L X;  1WVL A;  3K7A B;  1G2T A;  1G6P A;  2VS1 A;  1KRS A;  3GTK B;  1K0R A;  2XRQ D;  1U5K A;  2OQK A;  4OXP A;  2VUM H;  1FYC A;  2K14 A;  3CC7 A;  1CKN B;  1VQ9 A;  1IYU A;  3HOW G;  1KAA A;  4A3D B;  4ID6 A;  3ER0 A;  4OL7 A;  4PQX A;  1JB3 A;  4DU9 A;  1VQK A;  4NKL A;  1VF5 C;  4RCO A;  3M7N A;  5I6Y A;  4YIJ A;  1EIH A;  1V1P B;  2F0V A;  3J81 L;  2E5L L;  1RTN A;  4FXG C;  4TRD A;  2R93 G;  2JN4 A;  2JA6 B;  2K32 A;  4K8I A;  4C3I G;  3TZU A;  3CCS A;  5C0X G;  1YHB A;  3J81 c;  1GHJ A;  2E2H H;  1E1O A;  4KLK A;  1E7Z A;  3NBH B;  1SNP A;  5IYB H;  4WJ3 M;  4A3J G;  5GRO A;  5I9P A;  1LTG D;  4IN3 A;  1F9Q A;  1EOV A;  1X56 A;  3DMU A;  3RMH A;  4DV3 Q;  3I3C A;  5ELB A;  4B3T L;  2EYF A;  1CZG A;  3TQY A;  2BA1 A;  2F0Q A;  3NTI A;  4IUR A;  4UDU C;  4AQY Q;  3A7A B;  3DWA A;  1V1Q A;  4GLA C;  4UHV A;  1TQO A;  4C3H G;  1AH9 A;  2XRS D;  1B44 D;  2F0H A;  1XTD A;  3T1H L;  4LAA A;  4DV4 L;  3S1N H;  4TVA B;  4MTK A;  2MUY A;  1WCM B;  2B2W C;  2F3W A;  3Q8D A;  2WKD A;  4C3J H;  2B2U A;  1JOO A;  1UE6 A;  2E8G A;  4KHV A;  4B9X A;  3C46 A;  3MFY A;  2D9U A;  1BBX C;  4A3L G;  1YNJ C;  3S2H H;  1EL0 A;  1SE3 A;  2K50 A;  1RD9 D;  1PTO C;  1EY6 A;  1DZ1 A;  4DNI A;  3M4O B;  1B9N A;  2QEJ C;  2F0M A;  2D2C C;  4K2K A;  4LFA Q;  4A3D G;  3Q24 A;  2O2L D;  3PF4 A;  1AFP A;  1SSO A;  2QF7 A;  2MP1 A;  4AYB G;  2EQS A;  1Q82 C;  4K0K L;  2NB0 A;  5IP7 G;  2PNH A;  3T16 A;  1AP0 A;  2HCI A;  3I70 A;  1X9N A;  1KLU D;  3GQB A;  1HCZ A;  4BS9 A;  1CFM A;  2R6G A;  4QUC A;  1EIF A;  4LNQ A;  3HRZ C;  3PO3 B;  1DON A;  4POF A;  2E2D C;  2Z6B A;  2A6E D;  2EY1 A;  2UU9 L;  4OO1 G;  2ZJQ A;  1YHQ A;  1TT2 A;  5K36 H;  3HOV B;  4JI6 Q;  1K28 A;  1L2F A;  2G5D A;  4JI5 Q;  1OTC A;  1JCK B;  1F2Z A;  3B6Y A;  2HT1 A;  3HZX A;  2CCZ A;  3HKZ B;  2P5Z X;  5M5W H;  2K52 A;  2JA5 H;  3NBH A;  4LJZ C;  4B3R Q;  1LO5 D;  5IYB G;  2UUA L;  2G9H D;  1V43 A;  1STY A;  1BCP F;  4LUZ A;  3PV0 A;  4C3I B;  4XT1 B;  1PTO B;  3OMC A;  3TEH B;  2Q2I A;  1JE5 A;  5IT9 L;  4KHP L;  2F0K A;  2JA7 H;  1XMO Q;  4ME3 A;  1IKL A;  1XTC D;  5IYC H;  1TY0 A;  2B8G A;  1PH2 A;  2E2J H;  3AB9 A;  4LF5 Q;  3KOJ A;  1U4R A;  4BBS B;  3D31 A;  4A4I A;  1PH4 A;  3HP3 A;  1Y1W B;  4MN3 A;  2Z1C A;  4KD4 A;  3FHW A;  4KKU A;  4IUV A;  4Q0F A;  1Y1V G;  3FEW X;  3URY A;  2CH4 W;  4RG1 A;  3MXN B;  1CA6 A;  1K8M A;  3GV6 A;  1QIL A;  1ZXT A;  1LAC A;  2LSS A;  1EOT A;  4DAM A;  2VQF L;  4JI4 Q;  4DXG A;  2L9H A;  3CAM A;  5FK9 C;  1KL9 A;  2NTS A;  3I4L A;  3IKJ A;  4LFC L;  3MEH A;  4FF2 A;  1TWA B;  2Z4I A;  4DV6 Q;  4MHE A;  5CGK A;  3T1H Q;  1XPO A;  1W2B A;  1KHI A;  1ROD A;  3P75 A;  1PH6 A;  2XIW A;  2YTY A;  4C1N K;  5C4H A;  3GP7 A;  5CR3 A;  2A68 C;  2WFW A;  3MXN A;  4B08 A;  1HHV A;  2EYP A;  3CCE A;  3GTQ H;  2Z8L A;  2K04 A;  2DN8 A;  3OWE B;  1TR5 A;  3D8G A;  2RKS A;  4B3T Q;  1QUQ B;  1F9S A;  4YWL A;  4B3M Q;  2MGS A;  4DV2 Q;  4JW0 A;  3NEN A;  2DY7 A;  5J3B A;  4FF4 A;  5T1I A;  4E6I A;  3A0J A;  4C2M B;  2WAQ E;  3H0G G;  3H6M A;  3HOV G;  2CW0 D;  3JAM L;  2NVT H;  4LF7 Q;  3PO2 H;  1NMG A;  3RLO A;  4H0L C;  2E76 C;  4FF1 A;  2K6A A;  2NZ1 D;  1DM0 B;  5IYC G;  3QR8 A;  1I50 B;  1E3P A;  2PQE A;  5EPK A;  1I94 Q;  5FLX E;  2EYM A;  3A7L A;  1UWV A;  4YY3 Q;  1A0I A;  4C2M H;  5KYL A;  1CA5 A;  5JJI A;  4DAY A;  5G3L F;  5C4X G;  2L5T A;  1WTQ A;  2A73 B;  2PYK A;  4O1N A;  3NTK A;  5EBC A;  1F2L A;  1TWF B;  5I4D A;  3J7A V;  5CV8 A;  4KY5 A;  3RNU A;  5FLM G;  1N36 Q;  1TS2 A;  3D4R A;  4A3G G;  1B3Q A;  4IFD G;  3BU2 A;  1IBM Q;  4CBV A;  4O0A A;  1CHP D;  3EA6 A;  4LF9 Q;  3S16 B;  2K5V A;  5IIF A;  5C3W A;  3I4N H;  3BZC A;  3M4P A;  4YY3 L;  1F2M A;  5J22 A;  5BR8 L;  1PTO D;  4A3M G;  3NE5 B;  5EPL A;  1QUQ A;  4JV5 Q;  1VQ7 A;  1Q90 A;  2KHJ A;  2RBM A;  1GUG A;  1H9K A;  3HOX G;  2K33 A;  4L5R C;  4IPC A;  3HOZ H;  1NBW A;  5IGB A;  5EAY A;  3TS0 A;  4EGV A;  5J39 A;  3VYS A;  4HMI A;  1EY8 A;  3DHQ A;  1K73 C;  1LT3 D;  3IFD A;  4RFB A;  3CF5 A;  3DEP A;  4ULL A;  4NW2 A;  1OXX K;  2KEC A;  4ZAI A;  2EJG C;  4MTN A;  4GNX B;  2R92 G;  4MNO A;  3K0Y A;  5IWA Q;  2BOS A;  4A3L H;  3NHH A;  2RCN A;  2L0C A;  1PLF A;  3SVM A;  1GO3 E;  4QMG A;  3R93 A;  5AFW A;  4A3F B;  2CQA A;  3V05 A;  2MQH A;  3T4A C;  4FO2 A;  1L1O A;  2WAQ B;  1TWF H;  3IRB A;  3E9H A;  2OT2 A;  2CWP A;  5IP9 G;  4IFD I;  2PZW A;  5ELO A;  3H3V C;  1YIJ A;  3CW2 C;  2RCF A;  3ULP A;  4LFC Q;  2YYZ A;  3BVG A;  2IHF A;  2TSS A;  5CV6 A;  4JI3 L;  3A5U A;  2JEA I;  1IXR A;  2ZXO A;  5BN5 A;  1PYB A;  4KKT A;  4K5V A;  1OXU A;  2E2J B;  4JI4 L;  2NVX B;  1X32 A;  2A1A A;  4IOC A;  5T1G A;  4N8F A;  4RKB A;  1A2U A;  1F9P A;  2QW7 A;  4KTA A;  5CV7 A;  4JBM A;  4PG3 A;  1VQ8 A;  1HR0 Q;  3QO2 A;  1CKM A;  3Q23 A;  4PNY A;  4C3I H;  1O7Y A;  4JI0 L;  4GKJ Q;  3PO3 H;  5E1F A;  2X6G A;  3T13 A;  1SRU A;  1EIG A;  3QIA A;  1QE6 A;  1XNR Q;  4BXX H;  4XT3 B;  3BYT B;  2ZTD A;  1XPU A;  4XQJ A;  1MBY A;  2HIV A;  1HTP A;  1LTR D;  2TMP A;  1BDO A;  5EJW A;  4HJ5 A;  2K7V A;  3NK9 A;  1B7Y B;  5C3E B;  3CCQ A;  3NWS A;  2VQE Q;  1A3T A;  2LMC B;  2A68 D;  4P75 A;  5M5Y H;  1LYL A;  1D5Z C;  5IY0 A;  5LMU L;  2R61 A;  1S5B D;  3ND9 A;  3EN2 A;  3E5S A;  4S3S A;  4A3G B;  4LF9 L;  1BF4 A;  1H9S A;  3QOJ A;  1X6O A;  4OO1 H;  4OWT B;  1BKB A;  4DR2 Q;  3LWU A;  4ZYS A;  3K80 C;  4NDX A;  2FJ2 A;  1NNX A;  4A3E H;  3K58 A;  2QA4 A;  2PQA A;  4L5T A;  3TBI B;  1IYV A;  1C48 A;  1EU3 A;  3CMA A;  3D4W A;  4X3U A;  4BBR B;  1HQM C;  2EYJ A;  1SMY D;  3ZJY C;  2LXK A;  3TZD A;  2IJ0 A;  5LMU Q;  4CKB A;  1MSH A;  1WD1 A;  1DCZ A;  5ISR A;  2HHH L;  3GTP H;  2VQE L;  3RD4 A;  5E7N A;  5AJ3 L;  2N78 A;  3QOL A;  2O5I C;  1QCB D;  4I65 A;  3BDC A;  1D5X C;  5C4X B;  1SMY C;  2PCF B;  5M5X B;  2RDF A;  1QB5 D;  3TSS A;  3FVQ A;  3HOU B;  2C35 B;  2QDL A;  2HDM A;  1TS4 A;  4KJN A;  4DAV A;  3GD7 A;  1DGS A;  3Q22 A;  2FMM A;  4LUO A;  2F0W A;  4G4K A;  1UE5 A;  4DR1 Q;  2EXZ A;  4B3S Q;  1PTO H;  1EY5 A;  1X55 A;  4AIM A;  4JI3 Q;  4DK3 C;  3I55 A;  1EU4 A;  4PMC A;  3KJP A;  5IYD H;  4DR3 Q;  3HFZ B;  4IFD H;  2BE5 C;  3OTO L;  1J9O A;  2R7F A;  4DGZ A;  1CHQ D;  1J6Q A;  4DV0 L;  1BVS A;  3MHB A;  3PUW A;  2XWB B;  4A3D H;  5DLQ E;  2Y0S B;  4AQY L;  2ZXP A;  1N32 L;  4M8A A;  1YIT A;  2GN5 A;  3AU7 A;  4DV6 L;  1HRJ A;  4KD3 A;  4AH6 A;  2R7Z G;  1UE1 A;  4GLV B;  4QGU A;  1FVI A;  3KDF A;  3SE0 A;  4F87 A;  1IBL L;  1BNZ A;  1ICW A;  1XWE A;  2H1E A;  2AQ2 B;  5IWA L;  4G7O C;  1N34 L;  1SYC A;  2EYO A;  1NR2 A;  1YHA A;  4X65 Q;  1W6J A;  2B2V A;  3MXP A;  1GHK A;  2RVL A;  4LK1 C;  1CSQ A;  1OO9 B;  1YJN A;  2I0Q A;  2IY5 B;  2HIX A;  1PA6 A;  2YU9 B;  2KUM A;  3JAM E;  3CQZ B;  3H91 A;  1JOR A;  5IOD A;  4RHS A;  4CHT B;  1WTO A;  2NTT A;  4XTC S;  4WFN 3;  3AEV A;  2NN6 I;  3PIP 3;  3H3V H;  1Q7Y C;  5DNF A;  3ERO A;  3I72 A;  3I7F A;  3QJY A;  2SOB A;  4A3F G;  3EVQ A;  2UUA Q;  1XNQ Q;  2MO1 A;  3U58 A;  1HQR D;  1XMQ Q;  3L7Z C;  3K81 C;  1GUO A;  1JJ2 A;  4BY7 H;  3J81 E;  2HDL A;  3Q6S A;  3S1Q H;  5JEA J;  1FNU A;  1SXT A;  3K5N A;  3RZO H;  4X6A H;  3MXU A;  5G3L D;  4PZ8 A;  2Z6K C;  1RKN A;  4DR7 L;  3VDY A;  1PRT D;  3KBX A;  1XNQ L;  1A6X A;  4KHZ A;  4A3K B;  3S1M B;  4KN7 C;  1TU2 B;  5C4J B;  2R7Z B;  4AYB B;  2JJQ A;  4CDF C;  4A93 B;  1UEA B;  2NZH A;  2NN6 H;  2A8V A;  4ZCK A;  4KKS A;  1HZA A;  1M90 C;  1K8A C;  1SJH D;  4IJL A;  2BH2 A;  2B2U C;  5M3F G;  4HMJ A;  2Q2U A;  1LT6 D;  2B39 A;  3NP8 A;  5C0X I;  3F1Z A;  1N33 L;  4GKK L;  1SMX A;  4OON A;  5CMD A;  4RKL A;  2OTJ A;  2XGT A;  3LGJ A;  1VQP A;  4A3J B;  4OIJ A;  2EDG A;  2NYZ D;  3KF6 B;  3FMC A;  4TQU S;  1Z47 A;  2HD3 A;  3S14 H;  3K6O A;  1X3G A;  4I7Z C;  3CCU A;  3TP8 A;  5GAG C;  4A76 A;  1A2T A;  1SN8 A;  5FOB B;  4X65 L;  2VUM B;  2H4O A;  1DOL A;  2WB1 E;  3RR5 A;  3HOZ G;  3P20 A;  2QDB A;  1RF2 D;  2ZXR A;  3CCJ A;  1IBL Q;  3D3R A;  3U9S A;  3KLR A;  1UE7 A;  1I4X A;  3F2C A;  1UEB A;  3HG9 A;  3A8J E;  1M8A A;  3NQI A;  1WTW A;  5KIX A;  4GLX A;  2EY5 A;  2NVY H;  5J1Z A;  3DM3 A;  1HA5 A;  1K9M C;  2K5W A;  3A8I E;  1SND A;  3LWE A;  4CDE C;  1VQO A;  2A6E C;  3K59 A;  2O4X A;  5IP7 H;  2ZJP A;  4FF3 A;  4JI1 L;  4A3G H;  4P71 A;  4X64 L;  3E0J A;  3CME A;  5M3F H;  1KAB A;  1N9W A;  2WB1 G;  3QG1 A;  1RDP D;  4RH6 A;  1J8I A;  3CCR A;  3T56 B;  4AYB E;  5C3E H;  3H09 A;  1K3R A;  4ZKC B;  2Q2T A;  2F0I A;  3CPF A;  4FNF A;  3S1N B;  1B1Z A;  3NXW A;  3I4M G;  3AFQ A;  1KRT A;  3HEJ A;  2B2V C;  1R4P B;  1VCI A;  1HFN A;  2ZM6 Q;  2F03 A;  2KHI A;  3C3L A;  1NCV A;  1ASZ A;  4L5Q A;  1JIC A;  3G4S A;  2CH4 A;  5CYU A;  4UP7 A;  4J15 A;  4JOI C;  4JI8 Q;  4EX5 A;  4QCL A;  5AJ3 Q;  1Y14 B;  4FXD A;  1E2W A;  3VYU A;  4BBR H;  1JC7 A;  2EYH A;  2I46 A;  3HOU H;  5C4J H;  4IUP A;  4XDX A;  2HHH Q;  4JYA Q;  3R2T A;  1H9J A;  4RMF A;  4BBS G;  3R8B A;  1JOK A;  3D4D A;  3GV3 A;  4RGT A;  3KUP A;  1PFM A;  4GOP C;  3S1R H;  1N36 L;  1I6V C;  4WOR A;  2K4K A;  3RZO B;  1P16 A;  4JI5 L;  1PH9 A;  2MHV A;  3K0X A;  1G2S A;  1HFG A;  4EVO A;  5IYD G;  1PZK D;  1BCP D;  1ZYR D;  3TP7 A;  3SGI A;  1MJE A;  1ZYR C;  1AZP A;  4KY6 A;  4NXN L;  1IL8 A;  4U68 A;  4HJA A;  2F0T A;  2OTL A;  3EQL C;  1KNA A;  5KGU A;  1MIU A;  4QF4 A;  3E3X A;  2Z6K A;  3FKI G;  1V1P A;  1VQM A;  2XWJ B;  2OCE A;  4ZRZ A;  3J7Z C;  1YZ6 A;  1Z7T A;  5EKK A;  3CC2 A;  5HY6 A;  1TWC H;  2K5Q A;  1PV4 A;  5A2Q E;  2EJM A;  3R3O A;  2F1M A;  1SFO B;  4JI0 Q;  4GKJ L;  1WTH A;  2A69 D;  1B70 B;  3W3A A;  2X69 A;  4GNX A;  3VR4 A;  2VL6 A;  2QGQ A;  1Q8K A;  2VNU D;  1CM9 A;  4JI1 Q;  3G6J B;  1E24 A;  4IUN A;  1FGU A;  1KQS A;  1VQL A;  4F8M A;  2XVS A;  4N9P A;  4A93 G;  4NP5 A;  2G9D A;  4K14 A;  4BY1 B;  1X3F A;  1G91 A;  3CQZ H;  1F2Y A;  3KFU A;  5D3D A;  2RA4 A;  3TRZ A;  2B29 A;  4P74 A;  4C3H B;  1SE8 A;  4X3K A;  3EBE A;  4DR3 L;  1ZEQ X;  1STH A;  1QVG A;  5LMN L;  1DXM A;  1I4P A;  3W2D A;  1HUN A;  1A62 A;  1VQG A;  4POG A;  5I6W A;  3CC4 A;  1TXY A;  2HUG A;  2I5M X;  3J80 E;  5C44 H;  4OEM B;  4O2D A;  4R4T A;  4JI2 L;  1PFS A;  2CHB D;  3KLS X;  1K8G A;  1K8O A;  2KHS A;  1I50 H;  2V1C C;  4A3F H;  2EVB A;  1AW7 A;  1LV9 A;  3PO2 B;  1W3S A;  5IGD A;  2E2I H;  1ML0 D;  4Y7N H;  2FFK B;  3M9B A;  2E5L Q;  1R4Q B;  1J5E L;  4KHP Q;  1T5X D;  1PZJ D;  3PUX A;  1DOK A;  3DLL A;  2RF4 A;  1E0B A;  4JV5 L;  1RHP A;  1HNX L;  2H5X A;  4HN7 A;  2IW3 A;  2A74 C;  2PI2 E;  1W6K A;  2MNA A;  1I3Q H;  4OWX B;  1ESR A;  4DKA C;  4BWG B;  3K5L A;  2WAC A;  4F88 A;  2EXD A;  2AUJ D;  3GTP B;  3PIO A;  1QZG A;  1LTA D;  3CPW A;  1GOZ A;  2EE1 A;  2B63 G;  4FP5 D;  3PUZ A;  3TN2 A;  5JVH 3;  3SK4 A;  2SDF A;  1QG7 A;  2K03 A;  3SK8 A;  3PQI A;  3G48 A;  2NVQ H;  3QB3 A;  1PZI D;  1KC8 C;  3A8K E;  4IPD A;  1ONL A;  3OPO A;  2OWO A;  4QJF A;  4C3H H;  2FXQ A;  1JMC A;  4DR4 L;  3HOX B;  1CKO A;  3S9W A;  3JAM c;  2EIF A;  4A75 A;  4MZ9 A;  1O80 A;  2EJF C;  2MO0 A;  2ICI A;  3EIV A;  3MAQ A;  1EIY B;  1LAB A;  2IL8 A;  2VW9 A;  3TRE A;  3PMF A;  1DJR D;  5LHY 1;  4IPG A;  1ET9 A;  3GTO H;  4DR6 Q;  3MEF A;  5L37 A;  4EQ5 A;  3QWN A;  4JC0 A;  1I5F A;  2KEE A;  1HXY D;  3STB D;  1HA6 A;  4BBS H;  5EKI A;  3H94 A;  1HZ9 A;  3A56 A;  1DD2 A;  1I4Q A;  2JXM B;  2XN9 C;  4BBR G;  1T9H A;  4CDC C;  3OWF A;  1EYA A;  4BY1 G;  1N34 Q;  2OEO A;  2L15 A;  3TP6 A;  4KI0 A;  2J4X A;  3S17 H;  1F77 A;  1PH3 A;  5IE8 A;  4TKO B;  1SNM A;  2ZJR A;  2RSN A;  1F9R A;  5KEE A;  1GXD C;  4KJO A;  1D5M C;  1VQN A;  2B2Y C;  2B2Y A;  4IJH A;  3WOF A;  4KK7 A;  1EY9 A;  5KYI A;  5COY A;  1TWG B;  5C3E G;  1B8A A;  2PZU A;  1AE3 A;  3EFX D;  4DUZ Q;  2Y0S E;  1O7L A;  1E22 A;  4LW1 A;  1Z6H A;  3V2T A;  2F0D A;  2D62 A;  3OW7 A;  3KJO A;  4R4O A;  3LX0 A;  4ILW A;  5FO8 B;  1RTO A;  1EWH A;  1TWA H;  3J7A F;  2B8F A;  1ASY A;  4DR1 L;  3A74 A;  4K6L A;  1SLJ A;  1CUK A;  1X3P A;  1S5F D;  2F0S A;  3W5O A;  1TWH H;  4IFD J;  5ELC A;  4DR5 Q;  4LF6 L;  3ICE A;  2QCP X;  4IQZ A;  2JSO A;  1BR9 A;  1P8L A;  3BVZ A;  2WIN B;  4KMU C;  1Y8P B;  2F52 A;  4G7H C;  1CI3 M;  3RZD H;  5BR8 Q;  5COR A;  1K3B C;  5H1S E;  3L2P A;  2RDG A;  3SEB A;  4WJ4 A;  3S15 H;  2X6L A;  1NMF A;  4H13 C;  2HQL A;  1D1K A;  5GAE C;  4DK0 A;  2JK8 A;  5A35 A;  1Y1W H;  1L0W A;  1CQF A;  1EQR A;  2KED A;  5DAU A;  1YI2 A;  3S16 H;  2PZT A;  1FJG Q;  4XQN A;  1B53 A;  5KND A;  1PRT C;  1SYD A;  3SDZ A;  5CBA E;  2ZT9 C;  1GM5 A;  1HPC A;  3NEM A;  2A6H D;  1OXS C;  1CKN A;  2KCT A;  4JBW A;  2IX0 A;  3CRL C;  5ELN A;  1J5E Q;  5C6A A;  1SBB B;  4JI6 L;  3DWQ A;  1E2Z A;  2J0T D;  4LF8 L;  3ULJ A;  2NN6 G;  3WDN A;  2B2T C;  2SNM A;  1NUC A;  2RDH A;  2GVA A;  4CJ2 C;  2KQ3 A;  5JEA H;  3CCV A;  5LL6 S;  1ICF B;  2DGY A;  3BS1 A;  4DR5 L;  1E1T A;  2YTV A;  4P72 A;  3F2D A;  3G7L A;  1C4Q A;  4CJ0 B;  2E2H B;  1XNR L;  1SR3 A;  3OYY A;  1EQV A;  2PI2 A;  1I4R A;  2L11 A;  4IPH A;  4R8N A;  4DFA A;  1MKH A;  5K5P A;  1JJC B;  4BY7 G;  5EPJ A;  1D6E C;  3SR1 A;  2EY6 A;  2F4V L;  1GKH A;  1Z9F A;  3KDF B;  3NEL A;  4K2L A;  1DYQ A;  3NWT A;  4C3J B;  4B3M L;  2ASB A;  4UAI A;  2NVQ B;  1G8Z D;  1V1O A;  3S14 B;  3J80 L;  2UUB Q;  3UI2 A;  3NBI A;  4ZLT F;  3MTS A;  3N6R A;  5JJK A;  3U4Z A;  1Y1W G; 
#chains in the Genus database with same CATH homology
 3LNN A;  4WRD A;  1EY0 A;  4A3M B;  1LLR D;  1CZW A;  3CRK C;  5C0X J;  1SE4 A;  1O78 A;  1U9R A;  1SYG A;  4OIK A;  3ONA B;  1I3Q B;  2SNS A;  3S2H B;  2JA8 B;  5D14 A;  3KK7 A;  1KNE A;  4DAP A;  3KLS A;  5FKA C;  2Q8T A;  4M1U B;  4H7B A;  1JOQ A;  2HCC A;  2IX3 A;  4ZK9 B;  1ENC A;  2A5H A;  2XSC A;  5KNB A;  3GTQ B;  1S5D D;  1Q12 A;  4ABN A;  2L4N A;  1GUW A;  1PRT B;  4L8J A;  1WTV A;  5TSS A;  4DNT B;  3E6Z X;  1LT4 D;  4G7Z C;  2BCO A;  4DNR B;  2AUK A;  3TP5 A;  1B50 A;  1UUP A;  5KNC A;  3FKI B;  1SYF A;  1IW7 C;  1I4H A;  1IW7 D;  1CK1 A;  1ESF A;  2PPB C;  3C1E A;  4RGN A;  3A54 A;  4H44 C;  5E4W C;  3S2D B;  1Y1V B;  1ILP A;  1A3U A;  1H9M A;  2A69 C;  2DNE A;  2LKV A;  4A3I B;  3NQT A;  1QWY A;  5C4Z A;  1C8C A;  5M3F B;  3MFG A;  1KDB A;  1SYE A;  4DK1 A;  1LT5 D;  1GUS A;  2CW0 C;  3M85 A;  3CHB D;  2E74 C;  2KJX A;  1VF7 A;  4C3J G;  5IOC A;  5ELD A;  3J7Y W;  2BDN A;  4RWS C;  4DXF A;  3NTH A;  1A3V A;  1S5C D;  2F3V A;  1JE4 A;  2F0U A;  3MWY W;  5IGC A;  3DUZ A;  1VMC A;  1TII D;  1QJO A;  1BCP B;  1SNC A;  2EY2 A;  4LMQ D;  3I73 A;  1YNJ D;  2IPK D;  1M4V A;  1STA A;  3SK5 A;  2DY8 A;  2O5J C;  1E2V A;  3GO5 A;  5I2Y A;  2QIL A;  1RCV D;  1OXT A;  1SE2 A;  1XXG A;  4J8Q A;  5I9O A;  1T5E A;  2F0O A;  4MIU A;  1IHZ A;  4HSP A;  2F0L A;  4PMW A;  2WV6 D;  1JWM D;  4O42 A;  2NUC A;  5ELE A;  2F0E A;  2B2W A;  3U9O A;  3GTM B;  3NPP A;  4F7X A;  1GUT A;  4CKC A;  2EYL A;  2C9O A;  3MZ5 A;  4ZUJ A;  1II3 A;  3S15 B;  4FVM A;  1R9T B;  1SNQ A;  3VA7 A;  2RSO A;  2AQ1 B;  4BY7 B;  1BCP C;  1G29 1;  2JEB I;  2F4I A;  5BN3 A;  2PW5 A;  1LTT D;  1KDC A;  5C5M A;  1OXV A;  1NSN S;  5ELF A;  3X3M A;  5KRU A;  1KLG D;  1NR4 A;  4RCN A;  1JR0 D;  4HAE A;  5CV5 A;  3X3N A;  1PXU A;  2J7Z A;  1EFI D;  4IUU A;  4OO1 I;  2Q8R E;  3K5O A;  2K28 A;  3OIQ A;  4PV1 C;  1B3A A;  2CVR A;  4ODG A;  4JK1 C;  3P1H A;  3NSW A;  5E4X A;  3RLF A;  2HQE A;  3L3O C;  4QIW B;  1UNS A;  2VB2 X;  4X3S A;  4GZY C;  3NUC A;  2XNA C;  3SHL A;  4RGO S;  3C1F A;  3I4M B;  1FD7 D;  3C2P A;  5EGT A;  2I07 B;  4XYQ A;  1PTO F;  3T53 B;  3IFT A;  4A3B B;  1GUN A;  1U4M A;  4HCS A;  3I91 A;  2SEB D;  2NBF A;  1CQV A;  1PFB A;  1S4Z A;  1FNW A;  2GA4 B;  2F0G A;  3BVM A;  1B4O A;  4XIG S;  3EJI A;  1A15 A;  2EPB A;  2OXP A;  5M9O A;  4C56 C;  1IKM A;  1H9S B;  4FXK C;  4ME5 A;  3ITP A;  4OHJ A;  4HCE A;  2QKI C;  4RA8 A;  2F0J A;  4DA2 A;  5HUR A;  3HOZ B;  3TME A;  2BA0 A;  3M7G A;  2WII B;  1U4P A;  5JPM C;  3OHX C;  1Q8I A;  5NUC A;  4R9W A;  5C0X H;  4ZUI A;  1EZ8 A;  1EWC A;  4A3E B;  1TVX A;  1TY2 A;  3PUV A;  4V19 0;  2VB3 X;  2EZV A;  1SNO A;  3TDQ A;  1SJE D;  1LTS D;  3HGB A;  2PMZ B;  3SXH A;  4DF7 A;  1EY4 A;  3VYR A;  2JE6 I;  2BE5 D;  3RZD B;  4K5W A;  2FIN B;  4IZ8 A;  4HTH A;  3HOW B;  3HS0 C;  5BN4 A;  4HR7 B;  1DOM A;  5JVG 3;  2B63 B;  3GTL B;  5EQ0 A;  1EYC A;  1QNK A;  2M00 A;  5HGT A;  1SYB A;  3ND8 A;  3BYY B;  4HSV A;  1Q1E A;  2NWG A;  5IGE A;  1LTI D;  4N9T A;  1BQQ T;  3IL8 A;  3VA5 A;  4HED A;  1EZ6 A;  1WTX A;  1YNN D;  4IAL A;  1YNN C;  1ENA A;  1RJT A;  2KCC A;  1WTP A;  1AN8 A;  4U67 3;  2DNC A;  4XQQ A;  3GTO B;  5JAV A;  2IX1 A;  2AQ3 B;  2V4D A;  3DWP A;  3D6W A;  2PNR C;  1TWC B;  3GTG B;  1JWS D;  4XYO A;  3FDT A;  4CGY B;  3A55 A;  2K1B A;  3ZYY X;  1X3Q A;  4KN4 C;  5JPN C;  1QOH A;  4EQP A;  4CJ1 B;  2F0F A;  1B9M A;  4ZQ3 A;  3FPU B;  4TSS A;  4G57 A;  4DN4 M;  3MA2 B;  2M9V A;  2WP8 J;  5DEH A;  1TWH B;  2R93 B;  1MD2 D;  4J6H A;  2VXW A;  1STB A;  3GTJ B;  5A2Q L;  2KA7 A;  3WOE A;  1BOS A;  4Y7N B;  3M4Y A;  1MSG A;  1FGB D;  3PUY A;  1STE A;  3AMU A;  2Q8I B;  3RUZ A;  2E75 C;  3MXG A;  1STN A;  2IWH A;  1Y8O B;  5IGF A;  4IUT A;  3K57 A;  2AWO A;  1EY7 A;  1S5E D;  2MPM A;  5DM6 3;  2JYO A;  4Z9C B;  2Z4H A;  2K05 A;  5M3M B;  4C1N I;  1KTK A;  1U4L A;  3S17 B;  5FLX L;  1I4G A;  4FYD A;  3VR3 A;  5EBD A;  1BO0 A;  4QB4 A;  3V96 A;  3OIP A;  2NVT B;  5IGG A;  3MC0 B;  4EQO A;  3IAY A;  4KV6 A;  1ET6 A;  5C44 B;  2L55 A;  4NMZ A;  1TS3 A;  3L9A X;  5CV9 A;  3BG3 A;  1KDA A;  5JEA G;  1VMP A;  3OMG A;  5K36 G;  3BDO A;  2L1B A;  3K5M A;  1XYI A;  1AEX A;  5DM7 3;  2KCN A;  4KY7 A;  3R2I A;  4CKE A;  2WKC A;  1ILQ A;  2ID0 A;  1PRT F;  2KVM A;  3I4N B;  2N88 A;  3D6C A;  5D65 A;  1AZQ A;  1H9R A;  1I6H B;  4PMB A;  2EOT A;  1SAP A;  4Q5V A;  3VR5 A;  4RHR A;  2LFN A;  1STG A;  2A6H C;  2C5C A;  2FHT A;  1V8Q A;  1UAP A;  2JP1 A;  5CC4 A;  1VDZ A;  1HUM A;  3O13 A;  1D2B A;  3Q0A A;  5E3F A;  1TKW B;  1ZKO A;  1SDF A;  2E2I B;  4WJW A;  5I2X A;  3H0G B;  5C3X A;  4BA2 I;  3DM1 A;  4IUQ A;  3FPP A;  1Y69 U;  1EQT A;  3F2U A;  3CKI B;  2RQX A;  1WD0 A;  4X3T A;  2LS0 1;  4K5X A;  1Q3L A;  2K5D A;  2JA5 B;  4QUF A;  3VR6 A;  2FMC A;  1BXT A;  2IT1 A;  5JJZ A;  3DEO A;  1Q1B A;  1FNV A;  3BDL A;  1L0Y B;  2JA7 B;  1D1I A;  3BZD B;  2BDO A;  1CT1 D;  1PFN A;  4RGM A;  2NVY B;  4OGQ C;  2F0N A;  1FR3 A;  2AWN A;  5CV4 A;  1MGS A;  1PMR A;  4J1M A;  4XXE A;  4B9W A;  1GJX A;  1MI2 A;  5EKL A;  3CU7 A;  3DXJ C;  2M2L A;  5C5L A;  5FO7 B;  1JWU D;  4K8J A;  1EEI D;  1QNU A;  5LL6 X;  3KF8 A;  3S1R B;  1Y8N B;  2F0P A;  1TS5 A;  1G6Z A;  2PW7 A;  2ENB A;  2ICE C;  4BA1 I;  1K83 B;  1HTL D;  1O7Z A;  3KBG A;  4EQN A;  4ZKB B;  2KOL A;  1NAP A;  1PDQ A;  3I90 A;  2WB1 B;  3FRP B;  4RAU C;  1LTB D;  5M5W B;  2LY7 A;  5IT9 E;  1BUV T;  1JQY D;  1CTM A;  1ENF A;  3PIO 3;  2R92 B;  2L12 A;  2N55 A;  5FO9 B;  3VR2 A;  3VYT A;  4L6T B;  4V0B A;  3T51 B;  5F2D A;  5CBE E;  3ERQ A;  1XX8 A;  1PYW D;  2B2T A;  2D5D A;  1B2T A;  3M3Y B;  4L63 B;  3P7J A;  4K6D A;  1EEF D;  5JOB A;  1L0X B;  3S1Q B;  3MVV A;  4R8I A;  1SEB D;  2PO4 A;  5M5Y B;  3I8Z A;  5D3I B;  4P2C B;  2K01 A;  2OF1 A;  1EYD A;  3OOC A;  3OSO A;  1WTR A;  3SK6 A;  3N52 A;  3HOY B;  2R3Z A;  2MJ8 A;  1WVL A;  3K7A B;  1G2T A;  3GTK B;  2XRQ D;  1FYC A;  1IYU A;  1KAA A;  4A3D B;  4ID6 A;  4OL7 A;  4PQX A;  1JB3 A;  4DU9 A;  4NKL A;  1VF5 C;  4RCO A;  3M7N A;  5I6Y A;  4YIJ A;  1EIH A;  1V1P B;  2F0V A;  3J81 L;  1RTN A;  4FXG C;  4TRD A;  2JA6 B;  2K32 A;  4K8I A;  4C3I G;  3TZU A;  5C0X G;  1GHJ A;  1SNP A;  5I9P A;  1LTG D;  4IN3 A;  1F9Q A;  3DMU A;  3RMH A;  3I3C A;  5ELB A;  2EYF A;  1CZG A;  2BA1 A;  2F0Q A;  3NTI A;  4IUR A;  4UDU C;  3A7A B;  3DWA A;  1TQO A;  4C3H G;  2XRS D;  1B44 D;  2F0H A;  4LAA A;  2MUY A;  1WCM B;  2B2W C;  2F3W A;  2WKD A;  2B2U A;  1JOO A;  4KHV A;  4B9X A;  3C46 A;  3MFY A;  2D9U A;  1BBX C;  1YNJ C;  1EL0 A;  1SE3 A;  1RD9 D;  1PTO C;  1EY6 A;  1DZ1 A;  3M4O B;  1B9N A;  2QEJ C;  2F0M A;  2D2C C;  4K2K A;  3Q24 A;  2O2L D;  1AFP A;  1SSO A;  2QF7 A;  2MP1 A;  2NB0 A;  3T16 A;  1AP0 A;  2HCI A;  3I70 A;  1KLU D;  1HCZ A;  4BS9 A;  3GQB A;  1CFM A;  2R6G A;  4QUC A;  3HRZ C;  3PO3 B;  1DON A;  2E2D C;  2A6E D;  2EY1 A;  4OO1 G;  1TT2 A;  5K36 H;  3HOV B;  1JCK B;  1F2Z A;  3HZX A;  3HKZ B;  3NBH A;  4LJZ C;  1LO5 D;  2G9H D;  1V43 A;  1STY A;  1BCP F;  3PV0 A;  4C3I B;  4XT1 B;  1PTO B;  3OMC A;  5IT9 L;  2F0K A;  1IKL A;  1XTC D;  1TY0 A;  2B8G A;  3AB9 A;  1U4R A;  4BBS B;  3D31 A;  3HP3 A;  1Y1W B;  4MN3 A;  2Z1C A;  4KD4 A;  4KKU A;  4IUV A;  4Q0F A;  3FEW X;  3URY A;  1CA6 A;  1K8M A;  3GV6 A;  1QIL A;  1ZXT A;  1LAC A;  1EOT A;  4DXG A;  2L9H A;  5FK9 C;  2NTS A;  3I4L A;  3IKJ A;  3MEH A;  4FF2 A;  1TWA B;  2Z4I A;  4MHE A;  5CGK A;  1ROD A;  3P75 A;  2XIW A;  4C1N K;  5C4H A;  3GP7 A;  5CR3 A;  2A68 C;  3MXN A;  4B08 A;  1HHV A;  2EYP A;  2Z8L A;  2K04 A;  2DN8 A;  3OWE B;  1TR5 A;  3D8G A;  2RKS A;  1F9S A;  2MGS A;  2DY7 A;  4FF4 A;  5T1I A;  4E6I A;  4C2M B;  3H6M A;  2CW0 D;  3JAM L;  4H0L C;  2E76 C;  4FF1 A;  2K6A A;  2NZ1 D;  1DM0 B;  1I50 B;  2PQE A;  5EPK A;  5FLX E;  2EYM A;  3A7L A;  5KYL A;  1CA5 A;  4DAY A;  5G3L F;  2L5T A;  1WTQ A;  2A73 B;  2PYK A;  4O1N A;  3NTK A;  5EBC A;  1TWF B;  1F2L A;  5I4D A;  3J7A V;  5CV8 A;  4KY5 A;  1TS2 A;  3D4R A;  4IFD G;  4CBV A;  1CHP D;  3EA6 A;  3S16 B;  5IIF A;  5C3W A;  1F2M A;  5J22 A;  1PTO D;  3NE5 B;  5EPL A;  1Q90 A;  2RBM A;  1GUG A;  1H9K A;  2K33 A;  5IGB A;  4EGV A;  5J39 A;  3VYS A;  4HMI A;  1EY8 A;  3DHQ A;  1LT3 D;  3IFD A;  4RFB A;  3DEP A;  4ULL A;  4NW2 A;  1OXX K;  2KEC A;  4ZAI A;  2EJG C;  3K0Y A;  2BOS A;  3NHH A;  2L0C A;  1PLF A;  3SVM A;  4QMG A;  3R93 A;  5AFW A;  4A3F B;  2CQA A;  3V05 A;  3T4A C;  4FO2 A;  2WAQ B;  2OT2 A;  4IFD I;  2PZW A;  3H3V C;  2YYZ A;  3BVG A;  2TSS A;  5CV6 A;  2JEA I;  2ZXO A;  5BN5 A;  4KKT A;  4K5V A;  1OXU A;  2E2J B;  2NVX B;  1X32 A;  5T1G A;  4RKB A;  1A2U A;  1F9P A;  4KTA A;  5CV7 A;  3QO2 A;  3Q23 A;  4PNY A;  1O7Y A;  5E1F A;  2X6G A;  3T13 A;  1EIG A;  3QIA A;  1QE6 A;  4XT3 B;  3BYT B;  4XQJ A;  1MBY A;  1HTP A;  1LTR D;  2TMP A;  1BDO A;  5EJW A;  2K7V A;  3NK9 A;  5C3E B;  3NWS A;  1A3T A;  2LMC B;  2A68 D;  1D5Z C;  2R61 A;  1S5B D;  3ND9 A;  3E5S A;  4S3S A;  4A3G B;  1BF4 A;  1H9S A;  3QOJ A;  4OO1 H;  3LWU A;  4ZYS A;  4NDX A;  2FJ2 A;  3K58 A;  3TBI B;  1IYV A;  1C48 A;  1EU3 A;  3D4W A;  4X3U A;  4BBR B;  1HQM C;  2EYJ A;  1SMY D;  3TZD A;  2IJ0 A;  4CKB A;  1MSH A;  1WD1 A;  1DCZ A;  5ISR A;  3RD4 A;  3QOL A;  2O5I C;  1QCB D;  4I65 A;  3BDC A;  1D5X C;  5C4X B;  1SMY C;  2PCF B;  5M5X B;  2RDF A;  1QB5 D;  3TSS A;  3FVQ A;  3HOU B;  2HDM A;  1TS4 A;  4KJN A;  4DAV A;  3GD7 A;  3Q22 A;  2FMM A;  2F0W A;  4G4K A;  2EXZ A;  1PTO H;  1EY5 A;  1EU4 A;  4PMC A;  4IFD H;  2BE5 C;  1J9O A;  4DGZ A;  1CHQ D;  3MHB A;  3PUW A;  2XWB B;  2Y0S B;  2ZXP A;  4M8A A;  3AU7 A;  1HRJ A;  4KD3 A;  3SE0 A;  4F87 A;  1BNZ A;  1ICW A;  1XWE A;  2H1E A;  2AQ2 B;  4G7O C;  1SYC A;  2EYO A;  1NR2 A;  1W6J A;  2B2V A;  3MXP A;  1GHK A;  2RVL A;  4LK1 C;  1OO9 B;  2YU9 B;  2KUM A;  3JAM E;  3CQZ B;  3H91 A;  1JOR A;  5IOD A;  4RHS A;  4CHT B;  1WTO A;  2NTT A;  4XTC S;  4WFN 3;  2NN6 I;  3PIP 3;  5DNF A;  3ERO A;  3I72 A;  3QJY A;  2SOB A;  3EVQ A;  1HQR D;  3L7Z C;  1GUO A;  3J81 E;  2HDL A;  3Q6S A;  5JEA J;  1FNU A;  1SXT A;  3K5N A;  3MXU A;  5G3L D;  1RKN A;  1PRT D;  3KBX A;  1A6X A;  4KHZ A;  4A3K B;  3S1M B;  4KN7 C;  1TU2 B;  5C4J B;  2R7Z B;  4AYB B;  4A93 B;  1UEA B;  2NN6 H;  4KKS A;  1SJH D;  2B2U C;  4HMJ A;  1LT6 D;  2B39 A;  3NP8 A;  5C0X I;  5CMD A;  4RKL A;  4A3J B;  4OIJ A;  2EDG A;  2NYZ D;  3FMC A;  4TQU S;  1Z47 A;  3K6O A;  4I7Z C;  3TP8 A;  1A2T A;  5FOB B;  2VUM B;  2H4O A;  1DOL A;  3P20 A;  2QDB A;  1RF2 D;  2ZXR A;  3D3R A;  3U9S A;  3KLR A;  1I4X A;  3HG9 A;  3A8J E;  1M8A A;  3NQI A;  1WTW A;  5KIX A;  2EY5 A;  5J1Z A;  1HA5 A;  2K5W A;  3A8I E;  1SND A;  3LWE A;  2A6E C;  3K59 A;  2O4X A;  4FF3 A;  3E0J A;  1KAB A;  3QG1 A;  1RDP D;  4RH6 A;  1J8I A;  3T56 B;  3H09 A;  4ZKC B;  2F0I A;  4FNF A;  3S1N B;  1B1Z A;  3NXW A;  3HEJ A;  2B2V C;  1R4P B;  1VCI A;  1HFN A;  2F03 A;  3C3L A;  1NCV A;  1JIC A;  5CYU A;  4QCL A;  4FXD A;  1E2W A;  3VYU A;  1JC7 A;  2EYH A;  2I46 A;  4IUP A;  4XDX A;  3R2T A;  1H9J A;  3R8B A;  1JOK A;  3D4D A;  3GV3 A;  4RGT A;  3KUP A;  1PFM A;  1I6V C;  4WOR A;  3RZO B;  2MHV A;  1G2S A;  1HFG A;  4EVO A;  1PZK D;  1BCP D;  1ZYR D;  3TP7 A;  1ZYR C;  1AZP A;  4KY6 A;  1IL8 A;  4U68 A;  2F0T A;  3EQL C;  1KNA A;  5KGU A;  4QF4 A;  1V1P A;  2XWJ B;  4ZRZ A;  1Z7T A;  5EKK A;  2K5Q A;  5A2Q E;  2EJM A;  3R3O A;  2F1M A;  1SFO B;  2A69 D;  3W3A A;  2X69 A;  3VR4 A;  2VNU D;  1CM9 A;  3G6J B;  4IUN A;  4F8M A;  2XVS A;  4N9P A;  4NP5 A;  2G9D A;  4K14 A;  4BY1 B;  1G91 A;  1F2Y A;  5D3D A;  2RA4 A;  4C3H B;  4X3K A;  1ZEQ X;  1STH A;  1DXM A;  1I4P A;  3W2D A;  1HUN A;  5I6W A;  2HUG A;  3J80 E;  2CHB D;  3KLS X;  1K8O A;  2KHS A;  2EVB A;  1AW7 A;  1LV9 A;  3PO2 B;  5IGD A;  1ML0 D;  2FFK B;  1R4Q B;  1T5X D;  1PZJ D;  3PUX A;  1DOK A;  1E0B A;  1RHP A;  4HN7 A;  2IW3 A;  2A74 C;  1W6K A;  1ESR A;  4BWG B;  3K5L A;  2WAC A;  4F88 A;  2AUJ D;  3GTP B;  1LTA D;  1GOZ A;  2EE1 A;  4FP5 D;  3PUZ A;  3TN2 A;  5JVH 3;  3SK4 A;  2SDF A;  1QG7 A;  2K03 A;  3SK8 A;  3QB3 A;  1PZI D;  3A8K E;  1ONL A;  3OPO A;  3HOX B;  3S9W A;  1O80 A;  2EJF C;  2ICI A;  3MAQ A;  1LAB A;  2IL8 A;  3PMF A;  1DJR D;  5LHY 1;  1ET9 A;  3QWN A;  2KEE A;  1HXY D;  1HA6 A;  5EKI A;  3H94 A;  3A56 A;  1DD2 A;  1I4Q A;  2JXM B;  2XN9 C;  3OWF A;  1EYA A;  2OEO A;  3TP6 A;  4KI0 A;  2J4X A;  1F77 A;  4TKO B;  1SNM A;  2RSN A;  1F9R A;  5KEE A;  1GXD C;  1D5M C;  4KJO A;  2B2Y C;  2B2Y A;  3WOF A;  4KK7 A;  1EY9 A;  5KYI A;  5COY A;  1TWG B;  2PZU A;  3EFX D;  1O7L A;  1Z6H A;  3V2T A;  2F0D A;  2D62 A;  3OW7 A;  3LX0 A;  4ILW A;  5FO8 B;  1RTO A;  1EWH A;  3J7A F;  2B8F A;  4K6L A;  1X3P A;  1S5F D;  2F0S A;  4IFD J;  5ELC A;  2QCP X;  4IQZ A;  2JSO A;  1BR9 A;  3BVZ A;  2WIN B;  4KMU C;  1Y8P B;  4G7H C;  1CI3 M;  5COR A;  2RDG A;  3SEB A;  2X6L A;  4H13 C;  1D1K A;  4DK0 A;  5A35 A;  1CQF A;  2KED A;  5DAU A;  2PZT A;  4XQN A;  1B53 A;  5KND A;  1PRT C;  1SYD A;  3SDZ A;  5CBA E;  2ZT9 C;  1HPC A;  2A6H D;  1OXS C;  4JBW A;  2IX0 A;  3CRL C;  5C6A A;  1SBB B;  3DWQ A;  1E2Z A;  2J0T D;  2NN6 G;  3WDN A;  2B2T C;  2SNM A;  1NUC A;  2RDH A;  4CJ2 C;  5JEA H;  2KQ3 A;  5LL6 S;  3BS1 A;  3G7L A;  1C4Q A;  4CJ0 B;  2E2H B;  1EQV A;  5K5P A;  1I4R A;  2L11 A;  4R8N A;  4DFA A;  5EPJ A;  1D6E C;  3SR1 A;  2EY6 A;  4K2L A;  1DYQ A;  3NWT A;  4C3J B;  4UAI A;  2NVQ B;  1G8Z D;  1V1O A;  3S14 B;  3J80 L;  3UI2 A;  3NBI A;  4ZLT F;  3MTS A;  3N6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...