5CV5A

Crystal structure of staphylococcal nuclease variant delta+phs k64g/v66k/e67g at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKGMKGNAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS K64G/V66K/E67G at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv5A00
5CC4A 4TRDA 4G57A 4K14A 3MHBA 4K2KA 2EYLA 5K5PA 1U9RA 4HMIA 1EQVA 1SNCA 4F8MA 4OL7A 3SHLA 4EQNA 5C3XA 1TT2A 3NHHA 4KHVA 1II3A 1EY7A 3MVVA 5KEEA 1STGA 3H6MA 4PNYA 2F0QA 4RKBA 3TP8A 1EY8A 3TP5A 3MZ5A 5EKKA 4NMZA 3BDCA 3NP8A 3E5SA 3OWFA 4DF7A 4RKLA 4EQOA 5I6YA 1EY9A 3OSOA 4K5XA 5NUCA 4K5VA 5E1FA 5J22A 4S3SA 5I6WA 2F0GA 3OMCA 4NDXA 5CV4A 2KQ3A 1KDCA 3QOJA 4KD3A 1JORA 1STAA 3BDLA 4KY7A 5KYIA 2F0WA 3C1FA 2PZWA 2RDFA 5F2DA 2F3WA 5M9OA 3EVQA 1JOOA 1EZ8A 2EXZA 4B9WA 3SR1A 1SNQA 2F0PA 2F0NA 2OXPA 4QF4A 4I65A 5C4HA 5HGTA 3ERQA 4K6DA 5KGUA 5IGEA 2PW7A 2EY1A 1A2TA 1SNOA 2F0JA 3TP7A 5I9OA 5IGCA 3S9WA 1SYDA 1SYBA 2F0KA 1KAAA 4ZQ3A 1EY4A 4ZUJA 3U9OA 5IGGA 2PYKA 4PMCA 5IGFA 4DFAA 4KJOA 2EYHA 3SXHA 4NP5A 2EYPA 4LAAA 5CV8A 1NSNS 4HMJA 3V2TA 4F7XA 5KYLA 5E3FA 4QMGA 4EVOA 2F0FA 1JOKA 5DAUA 4HTHA 5CV5A 3VA5A 4R8NA 4E6IA 5CV7A 3SK6A 1STNA 3SK4A 5IGBA 2QDBA 3MEHA 2RKSA 2F3VA 5C5LA 5CV6A 5C3WA 1F2YA 3OMGA 3P1HA 3RUZA 5IGDA 1A3TA 2F0EA 2F0TA 2OEOA 3QB3A 1EYAA 1EY5A 2KHSA 4IUNA 4WORA 3NQTA 3ITPA 2F0VA 1SYEA 1A2UA 4PMBA 3D4WA 3MXPA 5C6AA 4B9XA 2SNSA 3DMUA 5KIXA 3D6CA 5ISRA 1NUCA 5J39A 5CV9A 2F0UA 5IODA 4QB4A 1EY6A 4ODGA 2PQEA 3TMEA 1SYGA 5J1ZA 3NUCA 4KY5A 2OF1A 1SYCA 2PW5A 3D4DA 1F2ZA 1EYDA 2EY6A 1SYFA 5CR3A 4KTAA 5IIFA 5IOCA 3QOLA 1IHZA 2F0MA 2F0IA 5I9PA 4WRDA 1A3UA 2F0SA 2SNMA 3NK9A 5EGTA 2F0OA 1TQOA 5JOBA 1AEXA 3PMFA 3T16A 3TP6A 4KD4A 4N9TA 2F0DA 2EYFA 4ZUIA 1STYA 2EY5A 4H7BA 2SOBA 4KJNA 4ME5A 4EQPA 3EROA 3D8GA 3R3OA 2PZUA 3DHQA 1ENCA 1EY0A 5HURA 1A3VA 1KABA 3P75A 2EYJA 1EYCA 1ENAA 4DU9A 2WACA 4IZ8A 4DGZA 2ENBA 4K8JA 4K2LA 3EJIA 5C4ZA 3HZXA 4K8IA 2EYOA 1SNDA 2EYMA 4YIJA 2O4XA 4MIUA 2M00A 5EKLA 5C5MA 2F0HA 3NXWA 2LKVA 1EZ6A 2RBMA 1STBA 3C1EA 1STHA 4N9PA 4IALA 1SNMA 3SK5A 3SK8A 5KRUA 5DEHA 3T13A 1RKNA 1KDAA 3HEJA 4ID6A 4KY6A 4K5WA 1KDBA 2F0LA 3LX0A 4NKLA 5JAVA 1F2MA 5CGKA 1SNPA 2HQEA 1JOQA 1TR5A 2PZTA 4J1MA 2NUCA 2EY2A 4J6HA 4KV6A
chains in the Genus database with same CATH superfamily
4IUVA 1IW7D 3EN2A 5IYBH 3FKIB 4M1UB 3HGBA 3CKIB 1N34Q 2HIXA 2JXMB 1ZYRD 2A68D 4OO1G 5DLQE 3I2ZA 1TS3A 4KHPL 5I6YA 3FRPB 1TS5A 4LWCA 3GTGB 2Z6KC 2R61A 4A3JG 1B2TA 1PYWD 5FO9B 1VQKA 2Q8RE 4YHHQ 1Q12A 2K75A 4K0KQ 2D0OA 3EVQA 1ESRA 1HH2P 1EZ8A 1EWCA 2EXZA 2PMZE 4N8X1 3M7NA 4DAYB 2L12A 2EXDA 3JAME 1LTID 3BZCA 3PIP3 2UU9Q 2KJXA 1U4PA 1XMQQ 2EYHA 1EEID 2EYPA 2Y0SG 3HS0C 2WB1E 4YCUA 4DV3Q 4LAAA 1B53A 4FVMA 3GTMB 3GTKH 3T4AC 2B8FA 4DR5Q 1ZXTA 4BY7H 4OO1I 5BR8Q 1QWYA 5CV6A 4ABNA 5D3IB 3CC4A 4DR6Q 2GN5A 2ASBA 4XIGS 4DV0Q 4HSPA 2RSOA 4PMBA 3TN2A 1HRJA 4JYAQ 3ND8A 3NBHB 4UP8A 1KXLA 3D6CA 1XPOA 2E5LQ 4DK0A 4JI3L 4CDDC 3V96A 2LXKA 4DV7Q 1SYGA 1H95A 1GUOA 4DR4L 4QGUA 1O7ZA 3I72A 3AFPA 5ELDA 4GNXA 3BVMA 5M3FH 5M3FB 4A3IB 3TRZA 4KHPQ 2D2CC 3FP9A 5IIFA 1FYCA 3UDFA 4HCEA 1VQ7A 3OYYA 2K6AA 3GTLH 3GTLB 2D5DA 3GV6A 1DXMA 3KF6A 2R7DA 4QY7A 5AJ3Q 1X3FA 1A8VA 3MC0B 5K36G 3CCVA 4BA1I 4OIKA 3AYHB 4JG2A 4HJ9A 1QZHA 1V8QA 4QIWB 3J7ZC 4Q0FA 1MKHA 4LF9L 4LFCQ 2JA7B 1C48A 2J7ZA 2NVYB 1LT6D 2O5JC 4R4TA 2N49A 1I4QA 3MTSA 2H5XA 1F9RA 1LT5D 4GOPA 5LHY1 1UE5A 4GZYC 1U4MA 4I7ZC 1R4PB 1CI3M 2IHFA 4BXXG 3G48A 1JB7A 5FLXc 3UDGA 4EQOA 4A3EG 1EY9A 2K33A 2WAQB 3AFQA 5C3EG 3U4ZA 3Q24A 1MGSA 2F0GA 1UEAB 2NN6I 1PH2A 2AWOA 5CBEE 4RG1A 1X3EA 1PZKD 1Y8NB 1PZJD 5G3LD 3K7AB 2OXPA 5I4DA 4C3JG 2QDLA 2E2JB 2K5WA 5IGCA 5IP9H 2D62A 2L5TA 2E2HB 1GUSA 1HA6A 4RGMA 2EQSA 1XNQL 1G6PA 2Z8LA 4KHZA 1I6VC 2L4NA 2Q2UA 2F0FA 1UE6A 5C4XH 2H1EA 4A3GB 2BE5C 1YZ6A 3KLSX 3OMGA 4CDFC 2ZJQA 2JA5G 2EJGC 3LWUA 4YCWA 2JA8B 3PUZA 1KLGD 3ITPA 3HOUH 3HOUB 1SYEA 1AE3A 2F3IA 3LNNA 5LMNL 4L6TB 1KC8C 2SNSA 1E24A 1VQEA 5FO7B 4GKKQ 3B6YA 3GTPB 4C2MB 3JAMc 1EY6A 1YNJD 3FVQA 2PQEA 3I4NH 4Y52H 2V1CC 3OW2A 4OWXB 4GN3B 4DPGA 3RZDB 4BBRB 5I9PA 2WIIB 4P73A 2TSSA 3ONAB 2MO0A 1STYA 1JR0D 2IT1A 3GTQH 3GTQB 2SOBA 4B3SL 1EYGA 1E22A 1J8IA 1D7QA 4O0AA 4DUZQ 1CSQA 4L63B 4DGZA 3HOYG 3SE0A 4QIWE 1GOZA 4CGYB 3CQZH 1VQOA 1YNXA 1HZAA 5D65A 4YY3Q 2B8GA 1A6XA 3NELA 1CK1A 4O2DA 3SVMA 4A3CG 4CKBA 3PQIA 4A3BH 4K5WA 1FVIA 4IUUA 4Z9CB 4DV6Q 1SAPA 1CKOA 1W6JA 1PH6A 3K0YA 1A15A 1BCPF 2E76C 2IX3A 2I5HA 2ALYB 4UP9A 4B3TQ 4HMIA 4R1JA 4EQNA 4JI1L 2L1BA 3F2DA 2ZM6L 2WAQE 1Y8PB 2HUGA 1HR0Q 3HKZG 4A3KB 4JPBW 5IYDH 3DEOA 3TDQA 3NP8A 2IL8A 2R92G 3CC2A 2B3GA 1VQJA 4S3SA 2X69A 2KQ3A 5A35A 5LMUL 3TZDA 3I4MB 2PZWA 2VQEQ 1VQ6A 2NYZD 1RF2D 3SEBA 3T56B 2DJGC 1RTOA 5FJ8G 5IGEA 3PIPA 2K28A 3U9SA 4JI2Q 1PHJA 1SYBA 2OQ0A 1EY4A 3MEFA 1PH4A 1VF5C 1TIID 4YWLA 5IGGA 3R2TA 4OIJA 4KKTA 1D8LA 1NBWA 5KYLA 3DM1A 3V2TA 2N78A 5AFWA 2XIWA 1CFMA 1MI2A 3STBC 3MAQA 3J81i 3H3VI 4IPHA 1STNA 1TWAH 4U68A 5IP7H 4R4IA 4B3RQ 2C5CA 3QB3A 4HIMA 3WOFA 3AQQA 3EA6A 1VQDA 4N8FA 2NN6H 4JI1Q 3H0GG 2ZM6Q 1F9PA 5GROA 4QB4A 1W3SA 1JE5A 4JI6Q 3TMEA 4O1NA 1PH9A 1PYSB 3OHXC 1GUTA 1K8AC 1LTTD 3KLSA 4GNXB 1PRTF 1MD2D 1QJOA 1IYJB 4JV5Q 1I5FA 1R9TB 1BCPD 3S1QH 4LFBQ 5JEAJ 2D0PA 3D8GA 5HURA 2OWOA 3W1GA 4HSVA 4GKJQ 3N6RA 4IZ8A 3HOXH 3KF6B 1J5EL 1X54A 3S17H 3KUPA 2KVMA 2YYZA 2A69C 4DKAC 1K8GA 3HOVH 3HOVB 3RLFA 1SNMA 3K6OA 2RCFA 3HEJA 4ID6A 5DM63 4AQYQ 1SNPA 5HY6A 2HQEA 4UDUC 4A3FH 2WB1G 4IPCA 4J6HA 4C3JH 1Y1WB 4FF2A 3VYRA 1TT2A 2K05A 5KEEA 3W1BA 3JAMi 4LK1C 4GOPB 1HA5A 2PQAA 5GADC 1EY8A 5EKKA 1YJ9A 2KEDA 1BNZA 4MN3A 3OSOA 3ULJA 3OMCA 3PO3H 4QUCA 1PXUA 3PO3B 1X6OA 4LF7L 2NTSA 5M5XB 1AE2A 1YI2A 4IFDH 2CCZA 2ID0A 4B9WA 1SNQA 4KN7C 1F9SA 1W6KA 5ELNA 2E2IH 3J80E 4HAEA 4DV2Q 5IT9E 3K5NA 1MJCA 2V4DA 4JI0Q 5GAEC 3DUZA 1L1OC 1ML0D 3E6ZX 2G9HD 1NTGA 3CC7A 1KAAA 2B63H 4DK3C 1EIYB 1WFQA 4XT3B 2XVSA 3PO2G 3Q23A 1NSNS 2VNUD 2HDLA 2R7ZH 1PRTD 1LLRD 3A0JA 3X3NA 1LUZA 1C7YA 3ICEA 3KDFA 1PLFA 3RUZA 1FL0A 5ELOA 2BH2A 2OEOA 1D5XC 4IUNA 2HQLA 1L0YB 2DJFC 5IYBG 3TSSA 1B9MA 3DMUA 1ASYA 3G6JB 3CCJA 2MO1A 4YWMA 2VZAA 2ATWA 1ICWA 1AZQA 5HGQA 1CQVA 2MNAA 4A3DH 3WDNA 3RNUA 2A6EC 2EY5A 1YIJA 3H3VC 4HCSA 4XQJA 4CJ0B 3A7LA 5BN3A 3P75A 2AHOB 4TKOB 2F03A 3H3VH 3S2DB 5C0XJ 3KJPA 1SRUA 2A6HC 4HEDA 1DOMA 4YIJA 4FF3A 3QG1A 4JBMA 4O42A 1CUKA 3SK5A 1HZCA 1V9PA 5DEHA 2BA1A 2F0LA 5D14A 1HXYD 4EGVA 1JOQA 4BY7G 4DAVA 3TS2A 2EY2A 1Q3LA 1LYLA 1FNWA 1EQRA 1JWSD 3S1RH 1HQMC 1U9RA 3S1RB 1SNCA 1XMOQ 1BF4A 1WCMB 1DJRD 3UE0A 3W2DA 3BU2A 4XYOA 4HJ8A 3KLWA 4UAIA 4FXGC 1VQAA 4RKLA 1FJGQ 4K5XA 2CQAA 5LL6S 1Q7YC 1N8RC 3T1YL 1LTLA 3HP3A 3M3YB 1JORA 5KYIA 1U5KA 5M3FG 2NVXB 3M85A 1Q82C 2K5VA 4A3LH 1I50B 2VQFL 4PZ8A 1WVLA 5KGUA 5C4JH 4X65L 4OELB 1QILA 1KHIA 2PO4A 5FLMH 2CHBD 2KCTA 2YU9H 1ET6A 4NP5A 4FF1A 4C3HH 4C3HB 5CV8A 3DM3A 2WFWA 2HIVA 3ERSX 1EOVA 3SK6A 3K5LA 1N33Q 4CBVA 4OHJA 4G4KA 4KMUC 1WTOA 3S15B 2KCNA 4B3MQ 4DR3L 2XWBB 1DD2A 2P5ZX 5JVH3 5KIXA 3A54A 2L55A 2PNHA 1I6HB 3OW7A 2F0UA 4X3SA 4R9WA 1MIUA 4ZAIA 5IT9c 1K3BC 3Q0AA 1SMYD 1S5ED 3A55A 1B3QA 2EY6A 3M4PA 1VQHA 3E9IA 3T1YQ 1VQIA 2KOLA 2B2TC 2F0SA 4R4OA 1UEBA 1EFWA 4DXGA 4KD4A 2F0DA 1GUNA 2WV6D 3A74A 3AB9A 2VQFQ 4ZRZA 3F8TA 4X66L 4BY1H 2B2UA 2A19A 3S1NH 1F9QA 5IP9G 4UY8C 2NVQB 3NXWA 2KECA 5E4XA 2NVTH 3C1EA 3Q22A 4DK6C 2UUBQ 2C35B 1TY2A 4K0KL 1K28A 2I07B 1KDBA 3LX0A 1F2MA 1LTRD 4BBSB 4PQXA 5C4XG 2B29A 2G5DA 2O2LD 2UU9L 1H9JA 3K58A 3OPOA 4LF8L 3BVZA 2HHHL 1TWCH 1EIGA 4DR3Q 2K03A 1XMQL 1I3QH 2NWGA 3HOUG 3TP5A 5JJKA 5M3MH 5M3MB 4DV3L 1WOCA 4WJWA 1D5ZC 2NBFA 3I4NG 5BR8L 2JA6H 4FDBA 4IPDA 1LABA 4CKEA 1S72A 1W2BA 1XWEA 4ALPA 4DV0L 2TMPA 1C4QA 4BWGB 3FKIH 4JYAL 3HRZC 1M90C 1B3AA 2E5LL 3VYUA 3A8KE 3VR6A 4X66Q 1MBYA 4NPSA 2Z9HA 4DV7L 1UE7A 3F2UA 1F77A 4R4CA 3VDYA 1X32A 3PCOB 3D6WA 4V190 3GTGH 1QB5D 2ICEC 2QA4A 4L5SA 4A3MB 1VF7A 4CDCC 4A3BG 2MQHA 3BDOA 3D0FA 4OGQC 1JWMD 3P1HA 2NB0A 4JOIA 1IXRA 5AJ3L 3KDFB 1IBKQ 3IRBA 2QEXA 2MFIA 3D4WA 1NMFA 2VUMH 2VUMB 4LF8Q 2HHHQ 2AUJD 2RQXA 5IODA 1HTLD 3NEMA 4MTNA 5IYDG 1AW7A 1XYIA 1IYVA 1PMRA 4LFCL 4P74A 2UUCL 3D4DA 3GTMH 1HUNA 1EYDA 3JAML 3CPFA 1YBYA 4KTAA 5CR3A 1C8CA 1S3OA 4MTKA 2NZHA 4G7OC 1XXGA 1TQOA 4XXEA 5G3LF 3E0EA 1BCPB 1B1ZA 4OXPA 2JA9A 3QR8A 1N32Q 1ENAA 2IY5B 1VMPA 5KNBA 3OWEB 1ET9A 5EKIA 4MIUA 2M00A 1JB3A 2DNCA 2LKVA 2RBMA 1X3GA 4N9PA 1CA5A 3HOZB 3TBIB 1O7YA 2L0CA 5JAVA 4A3IH 1DONA 2QGQA 3PF4A 1SSOA 4NW2A 5IP7G 5K5PA 4ZLTF 1I4PA 2R93B 1IKMA 3J80i 1VQMA 1XTDA 4AYBB 1B7YB 4XQNA 2B2YA 4DF7A 2NN6G 4QJFA 1NJIC 1AP0A 3AU7A 1PTOF 2CW0C 1K83B 5E1FA 3MWYW 1H9SA 4KD3A 1JJ2A 2JA7H 1VQGA 2UUCQ 1SE2A 4JC0A 1HHVA 2HCCA 1VCIA 4C56C 1KAWA 2F1MA 2NVYH 5JJIA 3KFUA 3SR1A 5C4HA 2F0NA 3I7FA 3J81c 3CXCA 3ERQA 1R4QB 1H9KA 2ZJPA 3K8AA 4GKKL 2A6HD 5EPKA 3R8BA 4KJOA 3HOXG 1IYUA 1G51A 3CCLA 2ZT9C 4F7XA 4RMFA 1EU3A 1PH5A 2E75C 4QMGA 5IE8A 1D1KA 5IYCH 3HOVG 1Z7TA 4HTHA 1QCBD 5CV7A 3TQYA 5C5LA 5C3WA 2LY7A 1PRTB 3K7AH 4A3FG 1EY5A 4DUZL 3IL8A 1A2UA 2E2JH 4LUVA 4C3IB 1LTBD 1Y14B 2E2HH 5J39A 1YJWA 1KTKA 1S5DD 1P16A 4YY3L 4PG3A 2WKDA 1EQQA 2LFNA 2QW7A 5CMDA 4KY5A 1E1OA 2IHEA 1YNND 3VR3A 4DV6L 2WKCA 3DWPA 3PO3G 3U4VA 4A3GH 4IFDG 4B3TL 2CWAA 1CTMA 1S5BD 3URYA 1VQCA 2Z0SA 1EFID 2JA8H 3HOWB 1EYCA 1HR0L 2AQ3B 4K8IA 4ME3A 5C44B 3GTPH 4C2MH 1PTOD 2MUYA 2B63G 3U50C 1PV4A 1G91A 3V05A 4HJAA 1V43A 2YTXA 4NKLA 3AMUA 2VQEL 1WTVA 4H44C 1J6QA 4OWWB 3J7YW 3RZDH 1LV9A 4BBRH 2R7ZG 2AUKA 4HIDA 2JEAI 1XPUA 3MHBA 4X62L 1EQVA 1WD0A 4JI2L 1G6ZA 1E2WA 1PH1A 2K1BA 4AYBE 4CDEC 3H6MA 2AQ1B 4IFDI 2K4KA 4NMZA 1WTPA 1HFGA 3PGZA 3MFYA 4P75A 3UE1A 3CCQA 4FP5D 4JI4L 3HFZB 1VQ5A 3QJYA 1VQFA 3S24A 1VQ4A 5ELFA 2F0WA 4NXNQ 4RA8A 2BH8A 3RZOB 4B3RL 4PMWA 4A3DG 2CH4W 4TSSA 1J9OA 2A1AA 2R7FA 1VMCA 1Q8IA 1GHJA 2BA0A 3O13A 2PYKA 4A3KH 4X3TA 4JI6L 2QCPX 2VB2X 2CVRA 1IZ6A 1PFMA 4HMJA 3I56A 1WTWA 4Y7NH 4Y7NB 5DAUA 4JV5L 1CT1D 1I4XA 3SK4A 1CZGA 1LACA 3I4MH 4LFBL 5M5YB 2BDNA 3K5MA 2PNRC 2F0EA 3ER0A 2D9UA 1TWHB 2KHSA 4GKJL 5ELEA 1CM9A 4X62Q 2VY3A 4B9XA 2IX1A 1GM5A 1QUQA 2AWNA 4JW0A 1UWVA 2IJ0A 1HZ9A 5J1ZA 2IPKD 5LL6X 4AQYL 1KIXA 2I46A 4JI4Q 3TZUA 2NTTA 3SDZA 3NK9A 3PMFA 1KNEA 3BZDB 4KJNA 4EQPA 4A3LG 3R3OA 2K32A 4RHRA 1EY0A 1NMGA 2JYOA 1V1PA 2ZTCA 4V0BA 2OCEA 5EAYA 4ZYSA 1HCZA 5FLMG 4EX5A 5ELBA 5EKLA 1BR9A 3K59A 4GN5A 4GNXC 4LF4Q 3Q6SA 4C3HG 1ICFB 1Q1EA 2VL6A 3DLLA 1EL0A 4IJLA 5JEAH 1Z6HA 1BKBA 1R9TH 4TRDA 2A8VA 4G57A 4DV2L 1HNWL 3EFXD 3ULLA 4F8MA 1SLJA 4JI0L 3AEVA 3S2HB 1LT4D 4JI5L 4J15A 1STGA 2NZOA 4ZKCB 1OXUA 1NAPA 1WTHA 2E2DC 2HDMA 2E8GA 2B2YC 1HZBA 2VXWA 3L0OA 3OIPA 3WOEA 4HN7A 5J22A 4DR2Q 1K9MC 3BDLA 5KNCA 4OWTB 3M9BA 1I4GA 1KLUD 1DM0B 1H9SB 1BBWA 1JOOA 2GA4B 1CSPA 1ZEQX 4IUPA 1H9MA 1Y1WH 4K6LA 4GOPC 2K01A 2PW7A 3Q8DA 2EVBA 2SEBD 3MXGA 1SNOA 1ZYRC 2A68C 4FNFA 1SYDA 5C3EB 1YHQA 3U9OA 5A2QE 2DUDA 1T9HA 5KNDA 4BY1G 3VR4A 4DFAA 4FXDA 4LUZA 3BS1A 4B08A 1SN8A 4EVOA 4A93H 4A93B 3VA5A 5M5XH 1EEFD 3MEHA 4OONA 5EPJA 1A3TA 1O78A 3BYTB 2PPBC 1HNWQ 1B50A 4DN4M 5ISRA 3G7LA 4JI5Q 1A62A 1I4RA 5CV9A 3H91A 2AKWB 2EE1A 1OXSC 2JN4A 5M3MG 4IQZA 2CFMA 2KENA 5IT9L 1HNXQ 1K0SA 4LFAL 2JA6G 2JA5B 4H13C 1VQLA 1AEXA 1XMOL 1TVXA 2FJ2A 3TREA 2BDOA 3GP7A 4G7ZC 3FKIG 1FJGL 4DK1A 3SGIA 5FO8B 3DWQA 1STBA 1STHA 2K5HA 1NR4A 2GVBA 4UPAA 2EDGA 1XNRQ 4KY6A 1BXTA 2XSCA 3NTKA 3G4SA 2MPMA 3QO2A 1SR3A 1GKHA 4K14A 4RWSC 3H09A 3HOYB 1PZID 5C0XH 2CKZB 3L7ZC 2I0QA 1NY4A 3S2DH 2Z4HA 4ZCKA 4F87A 3BDCA 4DV5L 1KRTA 3G6EA 2VUMG 1H9RA 2AQ2B 1HR0W 4K5VA 2Q8IB 3G71A 2VS1A 3GQBA 4TVAB 4PZ6A 4KY7A 3R93A 1N33L 4XYQA 4EQ5A 3VYSA 1STEA 3CF5A 4ZKBB 2BE5D 4B3ML 4JBKA 3S14B 4LFAQ 3NPPA 1ILQA 4I65A 3T1HQ 2A74C 1WCMH 1BBXC 2R92B 1Y1VH 1Y1VB 1K8OA 3NE5B 3E0JA 1BBUA 5IGFA 1PFNA 1JWUD 3KK7A 4JBWA 4FYDA 3MXUA 3A5UA 4A76A 1V1QA 3TS0A 3E3XA 3M3YH 4E6IA 4DV1L 1E7ZA 1E0BA 4CKCA 2LSSA 3CCMA 4A3IG 2NVXH 1A63A 5BN5A 1DOLA 1I50H 5IGDA 4ULLA 4X64L 5CORA 3QWNA 4JI8Q 1CKMA 1N9WA 3VYTA 2UUBL 4AH6A 1VQNA 1QVGA 1QUQB 1CQFA 4DV5Q 4QQBX 3GTOB 1EWHA 5JJZA 3BYYB 3J7AF 1SXTA 2K5DA 2LS01 1DYQA 2JA7G 2EJFC 3M4QA 4ZUIA 4Q5VA 5FKAC 3OTOQ 3S15H 1SJHD 3OOCA 3OIQA 4LF6Q 4POFA 3FPUB 5C4ZA 3HZXA 2KUMA 4APVA 4IO9A 1V1PB 5CBAE 1YNJC 1I6HH 4DNIA 3J80c 3KF8A 4IALA 1PTOB 1WTRA 2WAQG 3PF5A 3ZJYC 5IYCG 3RLOA 4QL5A 2PZTA 2RHSB 4J1MA 1C0AA 4DV1Q 3K5OA 5CC4A 2PMZB 4WJ4A 3NHHA 1QVFA 4X64Q 4RKBA 3OWFA 4KK7A 2NVQH 2AMCB 4IPGA 3H15A 2JJQA 3STBD 2WB1B 1FNVA 2LXJA 2JK8A 3CCRA 1JJCB 2UXDL 1DGSA 2KHJA 4AIMA 1UUPA 4BBSH 4RCNA 1TY0A 1GVPA 1IBKL 4A3GG 1FD7D 2Q8TA 3NWSA 2DNEA 2KHIA 1TWFB 3J81L 2F0KA 1B4OA 2XTIA 2JA8G 4ZUJA 3CMAA 5JJLA 3CPWA 1U4LA 3CHBD 3D31A 1ESFA 3HG9A 1QZGA 2A5HA 5M5WB 2QDBA 3L9AX 1CKNB 1WJJA 5FLXE 4BBRG 1N32L 1BOSA 4L5RC 4OX9Q 1PH7A 4FF4A 3PO2B 1SJED 2K04A 2A69D 4X6AH 5JPNC 4ODGA 1SFOB 1U0LA 1IKLA 3BG3A 2EIFA 4LF5L 1SYFA 1MHWC 1JMCA 3NBIA 2F0IA 4A3MH 1CHPD 5JOBA 2F0OA 2UXDQ 1OXTA 3A7AB 4H02A 3S1MH 3S1MB 2K7VA 3RN5A 2OQKA 2B39A 2ENBA 4K8JA 3GV3A 1K8MA 3K80C 3S16H 3S16B 1SE3A 5DNFA 5IWAQ 4A3KG 4NXMQ 5KRUA 1TWGH 1TWGB 4JI7Q 1K73C 4UP7A 2ES2A 3FHWA 1X56A 1BCPC 2MP1A 3H94A 3RR5A 3I4MG 1SEBD 2PI2A 4K2KA 3D3RA 4ILWA 4XT1B 3SHLA 4R8IA 2K5QA 2WINB 4CHTB 1I94Q 4IURA 1RIPA 3PUVA 3VR2A 1X65A 1SDFA 3E5SA 4KKSA 3CW2C 3IFTA 3GTKB 2JQOA 3HOZH 4NDXA 4BY7B 3QOJA 3M7GA 1STAA 3DWAA 3L3OC 1IBLL 2XNAC 4LF5Q 1NE3A 4BS9A 5H1SE 1C9OA 4POGA 5GAGC 2F4IA 1UNSA 5DM73 3C3LA 1N36L 1EU4A 1A2TA 2R93H 1EOTA 1X3PA 2XWJB 2IWHA 3KJOA 1S5FD 3PV0A 2YTYA 4PMCA 4HIKA 3NTIA 4YCVA 1LTSD 4DAPA 3QIAA 1PVOA 1K83H 1CZWA 1JOKA 4RGOS 3FEWX 3UDXA 3M4YA 1HQRD 4GLAC 3HKSA 3CCEA 2A6ED 1MSHA 2F0TA 5JEAG 1Z47A 1ENFA 4WORA 2F0VA 1WYDA 1U4RA 2DY7A 4LW1A 2C9OA 1OTCA 1L0WA 2IX0A 2ZTEA 1Q86C 1VS0A 4ZK9B 2OF1A 2PW5A 1F2ZA 1TS4A 4M8AA 2GVAA 1PRTC 3U58A 1EWIA 1A3UA 2FHTA 5BN4A 1IBLQ 3CD6A 2ICIA 3F2BA 3BJUA 2Q2HA 1ENCA 3DHQA 3F2CA 1Y1WG 1Q46A 2WACA 3FMCA 2Q2TA 1N36Q 4C3IH 1S5CD 1MSGA 1UE1A 2EYMA 1EZ6A 4JI3Q 3RD4A 3SK8A 3KLRA 3T13A 4DR4Q 2RDGA 3KF8B 1WI5A 5I2XA 4DUYL 4NXNL 3EQLC 4A93G 1EUJA 2I5MX 1SE4A 2NUCA 4QUFA 3KBXA 2ZXPA 3MVVA 1L1OA 1QE6A 3HOWH 4DR1L 2B2UC 3TP8A 1KD1C 4C1NI 1CHQD 3W5OA 4X3KA 5C44H 4WFN3 3F1ZA 2F4VL 4RGNA 3CU7A 4RCOA 2N55A 1KDCA 1Y69U 1BDOA 2Z1CA 3K81C 5C4XB 4C1NK 3BVGA 4LF9Q 1AN8A 2RDFA 2KBNA 1MJEA 1RHPA 2XGTA 3IAYA 4FO2A 2F0PA 1SROA 1GXDC 2EY1A 1F2LA 1ZKOA 3JC66 2M2LA 1CA6A 3GD7A 1E2ZA 2Q2IA 4JBJA 4LNQA 1TU2B 3I4NB 4DR7L 1K3RA 4HJ7A 1A0IA 1V1OA 2OT2A 4LMQD 3PSIA 3TEHB 4R8NA 1ILPA 3A5ZB 5L37A 2RKSA 4DUYQ 1LT3D 1M1KC 3RZOH 3ULPA 2L15A 4KI0A 2F52A 4IOCA 3CRLC 3NQTA 4LJZC 1Q1BA 4OO1H 1TXYA 2CH4A 1WD1A 1OXXK 1KL9A 5C0XG 1JJGA 2L11A 1NUCA 1TKWB 3CQZB 4DR1Q 1G8ZD 1IL8A 3UI2A 3UDIA 4A3JH 3LWEA 4A3JB 4LF4L 2RF4A 3NTHA 3J7AV 1XNQQ 1ASZA 1M4VA 3NUCA 4A3BB 1G2TA 1D6EC 1NNXA 1UAPA 2F4VQ 1O80A 2HT1A 5EBDA 4WRDA 2BOSA 3T16A 5M5YH 4JOIC 1RODA 1L2FA 1TWHH 3FPPA 2LMCB 1A3VA 1TS2A 2N3SA 1E3PA 2QILA 4P2CB 4DU9A 1HTPA 5LMNQ 1WCMG 2Y0SB 1JE4A 2EYOA 2VW9A 1FGBD 4DR2L 1EIFA 1Y1VG 4HIOA 2L9HA 1XX8A 1SMYC 3C2PA 4DR7Q 1KDAA 5C0XI 5CGKA 2E74C 3PIO3 1G2SA 2FMCA 4LUOA 1GO3E 1OXVA 1RDPD 1GD7A 2EYLA 3I4LA 5C3XA 5GAHC 4OL7A 1RD9D 4KKUA 4B3SQ 1EY7A 1HNZL 2UXBL 2F0QA 1GUGA 2RA4A 2ZXRA 2QEJC 4P71A 4L5QA 4UHVA 1QOHA 3CMEA 4GLXA 2HCIA 1XPRA 1YVCA 3I73A 3CRKC 5CV4A 1Z9FA 4IJHA 1TWAB 5FK9C 3K7UC 1PFSA 3CCSA 1HJPA 2RSNA 1Q90A 1S40A 3PUWA 1GUWA 3RLNA 3I70A 3S2HH 5K36H 4DNRB 5I9OA 2G9DA 4ZQ3A 2K5NA 4RFBA 3EIVA 3P7JA 4CJ1B 2DGYA 1IL2A 4GN4B 2R3ZA 2EJMA 3L2PA 1HNXL 1HFNA 2FFKB 5CV5A 1SMXA 1FR3A 5LMUQ 2RVLA 2B2TA 2F3VA 3S1QB 1F2YA 4A75A 1PA6A 1IW7C 3I91A 1PH8A 3NENA 1I4HA 4BXXH 2EOTA 1FNUA 2A73B 3HOXB 1JCKB 1X9NA 3P20A 3J81j 3MXPA 3S17B 4A3EH 4A3EB 3W3AA 5C3EH 4X3UA 1HNZQ 2UXBQ 5J3BA 2FMMA 4MNOA 2HD3A 3D4RA 1XNRL 2YV5A 3WWVA 1SYCA 5IOCA 2X6GA 1CKNA 4DXFA 5JPMC 1B9NA 3I4OA 4A3FB 2SNMA 1T5XD 4TQUS 4C3JB 2B2WA 3TP6A 1DOKA 5A2QL 1RCVD 3LGJA 4H7BA 4BBSG 4IOAA 4L5TA 1QNUA 1JQYD 1EQTA 2Y0SE 2PZUA 4JK1C 5EBCA 4BA2I 3I55A 4IN3A 2EYJA 2I5LX 2JEBI 4K2LA 5EJWA 3I90A 1EIHA 1XJVA 1SNDA 3MXNA 2F0HA 1VDZA 4F88A 2CW0D 3CCUA 2B2VA 5CYUA 5EQ0A 1SE8A 1RKNA 2H4OA 4JCVE 3J80L 3I3CA 2K14A 3A8IE 2JA5H 4XQQA 1NR2A 4IFDJ 2FXQA 2PI2E 4KV6A 3T1HL 3RN2A 1P8LA 4MHEA 2E2IB 1OO9B 5I2YA 4CJ2C 1D1IA 2QKIC 1PDQA 4KHVA 1II3A 3A56A 2B63B 5FOBB 1J5EQ 1L1OB 2K52A 3KOJA 2KEEA 2EZVA 1LTGD 5NUCA 2RCNA 1HPCA 2N8NA 2M9VA 1YHAA 5I6WA 3DEPA 2Z6KA 2R7ZB 2Z6BA 4HR7B 3KYHC 5M9OA 2F3WA 4DAYA 1GHKA 2UXCL 2RDHA 4A3MG 5HGTA 4QF4A 4K6DA 4MZ9A 1YITA 1D5MC 1E1TA 4JI8L 1E2VA 3K57A 3HOYH 1JT8A 2F0JA 3TP7A 3GTJH 3GTJB 1BO0A 1LTAD 2MGSA 3PUYA 2Z4IA 3S9WA 4DV4L 1X55A 4WJ3M 1B8AA 3SXHA 5D3DA 4YWKA 4A3CH 2JE6I 5JVG3 4FXKC 4JVZA 1PFBA 4A4IA 3VA7A 1QVCA 4A3DB 4LF7Q 1QNKA 5EPLA 3OTOL 2NZ1D 3S14H 1EYAA 3N52A 3NBHA 3HKZB 4LF6L 3X3MA 3IFDA 1AFPA 1Q8KA 3E9HA 1Q81C 2R92H 1RTNA 2X6LA 2OTJA 2RHQB 5LMNW 4U673 4DAMA 1BUVT 3IKJA 1RL2A 1VQ9A 2J4XA 4KLKA 4J8QA 5T1IA 3HOZG 2JSOA 2MHVA 2ZJRA 2KCCA 2F0MA 4OEMB 5FJ8H 4N9TA 4RHSA 2UXCQ 4ME5A 1DZ1A 2K50A 3T51B 1KABA 4NB3A 1D2BA 3EJIA 1KRSA 2R93G 3GO5A 4G7HC 1Y8OB 4DV4Q 3NSWA 2MJ8A 1HUMA 3MFGA 2EPBA 4AYBG 3M4OH 3M4OB 3GTOH 1YNNC 2DN8A 4DA2A 3PIOA 3CP0A 3VR5A 1WTXA 1K0RA 2JP1A 4RH6A 2QF7A 1B44D 5T1GA 3DXJC 1S4ZA 3KBGA 5C4JB 3GDEA 2R6GA 2XRSD 4GS3A 2ZXOA 1T5EA 3J7A5 1G291 3H0GH 3H0GB 4PNYA 4QCLA 2O5IC 4L8JA 3MZ5A 2YU9B 2FINB 1PTOC 1O7LA 1M8AA 3EBEA 2PCFB 1LO5D 1PTOH 1WTQA 2BCOA 5COYA 3C1FA 3CAMA 3PUXA 3A8JE 5F2DA 2VB3X 4PV1C 4GLVB 4P72A 4RAUC 4KN4C 1PYBA 4H0LC 1PH3A 4OX9L 2OTLA 2J0TD 1IBML 2UUAL 3C46A 1X3QA 1ONLA 4C3IG 1NCVA 4IUTA 1SBBB 1QG7A 1RJTA 1DCZA 1YHBA 3R2IA 1VQBA 5IGBA 1B70B 5E7NA 3NWTA 3HKZE 5TSSA 5IY0A 1N34L 2KCMA 4XTCS 4X65Q 4BY1B 1O7IA 3FDTA 1LM0A 3S1NB 1VQPA 1TWFH 5C6AA 1KNAA 3ZYYX 5IWAL 1AZPA 3HOWG 4PZ7A 5GQOA 2NVTB 4NXML 4XDXA 3BZKA 2YTVA 5C44G 4YHHL 1BVSA 3J81E 4JI7L 2CQOA 4R4QA 2IW3A 5ELCA 1KQSA 2N88A 3QOLA 1IHZA 1BQQT 1GJXA 5EGTA 2B2WC 1XTCD 5M5WH 2CWPA 1FGUA 2EYFA 2WP8J 3MA2B 3EROA 4IUQA 1I94L 1TWCB 2KA7A 1I3QB 4DNTB 3I8ZA 3PO2H 4HJ5A 4I7AA 2PQAB 5E4WC 1IBMQ 2O4XA 3T53B 2DY8A 3K0XA 1VQ8A 5C5MA 2UUAQ 2B2VC 4DR5L 1L0XB 1YJNA 1SFOH 1AH9A 2XRQD 2ZTDA 3MXNB 1JICA 5FLXL 2JA6B 2XN9C 3ND9A 2SDFA 3NQIA 4RGTA 1TR5A 4DR6L 3RMHA 1JC7A 5E3FA 1YEZA
chains in the Genus database with same CATH topology
4IUVA 1IW7D 3FKIB 4M1UB 3HGBA 3CKIB 2JXMB 1ZYRD 2A68D 4OO1G 1TS3A 5I6YA 3FRPB 1TS5A 3GTGB 2R61A 1B2TA 1PYWD 5FO9B 2Q8RE 1Q12A 3EVQA 1ESRA 1EZ8A 1EWCA 2EXZA 3M7NA 2L12A 3JAME 1LTID 3PIP3 2KJXA 1U4PA 2EYHA 1EEID 2EYPA 3HS0C 4LAAA 1B53A 4FVMA 3GTMB 3T4AC 2B8FA 1ZXTA 4OO1I 1QWYA 5CV6A 4ABNA 5D3IB 4XIGS 4HSPA 2RSOA 4PMBA 3TN2A 1HRJA 3ND8A 3D6CA 4DK0A 3V96A 1SYGA 1GUOA 1O7ZA 3I72A 5ELDA 3BVMA 5M3FB 4A3IB 2D2CC 5IIFA 1FYCA 4HCEA 2K6AA 3GTLB 2D5DA 3GV6A 1DXMA 3MC0B 5K36G 4BA1I 4OIKA 1V8QA 4QIWB 4Q0FA 2JA7B 1C48A 2J7ZA 2NVYB 1LT6D 2O5JC 1I4QA 3MTSA 1F9RA 1LT5D 5LHY1 4GZYC 1U4MA 4I7ZC 1R4PB 1CI3M 4EQOA 1EY9A 2K33A 2WAQB 3Q24A 1MGSA 2F0GA 1UEAB 2NN6I 2AWOA 5CBEE 1PZKD 1Y8NB 1PZJD 5G3LD 3K7AB 2OXPA 5I4DA 4C3JG 2E2JB 2K5WA 5IGCA 2D62A 2L5TA 2E2HB 1GUSA 1HA6A 4RGMA 2Z8LA 4KHZA 1I6VC 2L4NA 2F0FA 2H1EA 4A3GB 2BE5C 3KLSX 3OMGA 2EJGC 3LWUA 2JA8B 3PUZA 1KLGD 3ITPA 3HOUB 1SYEA 3LNNA 4L6TB 2SNSA 5FO7B 3GTPB 4C2MB 1EY6A 1YNJD 3FVQA 2PQEA 3RZDB 4BBRB 5I9PA 2WIIB 2TSSA 3ONAB 1STYA 1JR0D 2IT1A 3GTQB 2SOBA 1J8IA 4L63B 4DGZA 3SE0A 1GOZA 4CGYB 5D65A 2B8GA 1A6XA 3SVMA 1CK1A 4CKBA 4K5WA 4IUUA 4Z9CB 1SAPA 1W6JA 3K0YA 1A15A 1BCPF 2E76C 2IX3A 4HMIA 4EQNA 2L1BA 1Y8PB 2HUGA 4A3KB 3DEOA 3TDQA 3NP8A 2IL8A 4S3SA 2X69A 2KQ3A 5A35A 3TZDA 3I4MB 2PZWA 2NYZD 1RF2D 3SEBA 3T56B 1RTOA 5IGEA 2K28A 3U9SA 1SYBA 1EY4A 1VF5C 1TIID 5IGGA 3R2TA 4OIJA 4KKTA 5KYLA 3DM1A 3V2TA 5AFWA 2XIWA 1CFMA 1MI2A 3MAQA 1STNA 4U68A 2C5CA 3QB3A 3WOFA 3EA6A 2NN6H 1F9PA 4QB4A 3TMEA 4O1NA 3OHXC 1GUTA 1LTTD 3KLSA 1PRTF 1MD2D 1QJOA 1R9TB 1BCPD 5JEAJ 3D8GA 5HURA 4HSVA 3N6RA 4IZ8A 3KUPA 2KVMA 2YYZA 2A69C 3HOVB 3RLFA 1SNMA 3K6OA 3HEJA 4ID6A 5DM63 1SNPA 2HQEA 4UDUC 4J6HA 1Y1WB 4FF2A 3VYRA 1TT2A 2K05A 5KEEA 4LK1C 1HA5A 1EY8A 5EKKA 2KEDA 1BNZA 4MN3A 3OSOA 3OMCA 3PO3B 4QUCA 1PXUA 2NTSA 5M5XB 4IFDH 2ID0A 4B9WA 1SNQA 4KN7C 1F9SA 1W6KA 3J80E 4HAEA 5IT9E 3K5NA 2V4DA 3DUZA 1ML0D 3E6ZX 2G9HD 1KAAA 4XT3B 2XVSA 3Q23A 1NSNS 2VNUD 2HDLA 1PRTD 1LLRD 3X3NA 1PLFA 3RUZA 2OEOA 1D5XC 4IUNA 1L0YB 3TSSA 1B9MA 3DMUA 3G6JB 1ICWA 1AZQA 1CQVA 3WDNA 2A6EC 2EY5A 3H3VC 4HCSA 4XQJA 4CJ0B 3A7LA 5BN3A 3P75A 4TKOB 2F03A 3S2DB 5C0XJ 2A6HC 4HEDA 1DOMA 4YIJA 4FF3A 3QG1A 4O42A 3SK5A 5DEHA 2BA1A 2F0LA 5D14A 1HXYD 4EGVA 1JOQA 4DAVA 2EY2A 1Q3LA 1FNWA 1JWSD 3S1RB 1HQMC 1U9RA 1BF4A 1SNCA 1WCMB 1DJRD 3W2DA 4XYOA 4UAIA 4FXGC 4RKLA 4K5XA 2CQAA 5LL6S 3M3YB 3HP3A 1JORA 5KYIA 2NVXB 3M85A 1I50B 1WVLA 5KGUA 1QILA 2PO4A 2CHBD 1ET6A 4NP5A 4FF1A 4C3HB 5CV8A 3K5LA 3SK6A 4CBVA 4OHJA 4G4KA 4KMUC 1WTOA 3S15B 2KCNA 2XWBB 1DD2A 5JVH3 5KIXA 3A54A 2L55A 1I6HB 3OW7A 2F0UA 4X3SA 4R9WA 4ZAIA 3Q0AA 1SMYD 1S5ED 3A55A 2EY6A 2KOLA 2B2TC 2F0SA 4DXGA 4KD4A 2F0DA 1GUNA 2WV6D 3AB9A 4ZRZA 2B2UA 1F9QA 2NVQB 3NXWA 2KECA 5E4XA 3C1EA 3Q22A 1TY2A 2I07B 1KDBA 3LX0A 1F2MA 1LTRD 4BBSB 4PQXA 2O2LD 1H9JA 3K58A 3OPOA 3BVZA 1EIGA 2K03A 2NWGA 3TP5A 5M3MB 4WJWA 1D5ZC 2NBFA 1LABA 4CKEA 1XWEA 2TMPA 1C4QA 4BWGB 3HRZC 1B3AA 3VYUA 3A8KE 3VR6A 1MBYA 3F2UA 1F77A 1X32A 3D6WA 4V190 1QB5D 2ICEC 4A3MB 1VF7A 3BDOA 4OGQC 1JWMD 3P1HA 2NB0A 3D4WA 2VUMB 2AUJD 2RQXA 5IODA 1HTLD 1IYVA 1AW7A 1XYIA 1PMRA 3D4DA 1HUNA 1EYDA 3JAML 5CR3A 4KTAA 1C8CA 4G7OC 1XXGA 1TQOA 4XXEA 5G3LF 1BCPB 1B1ZA 1ENAA 1VMPA 5KNBA 3OWEB 1ET9A 5EKIA 4MIUA 2M00A 1JB3A 2DNCA 2LKVA 2RBMA 4N9PA 1CA5A 3HOZB 3TBIB 1O7YA 2L0CA 5JAVA 1DONA 1SSOA 4NW2A 5K5PA 4ZLTF 1I4PA 2R93B 1IKMA 4AYBB 4XQNA 2B2YA 4DF7A 2NN6G 1AP0A 3AU7A 1PTOF 2CW0C 1K83B 5E1FA 3MWYW 1H9SA 4KD3A 1SE2A 1HHVA 4C56C 2HCCA 1VCIA 2F1MA 3SR1A 5C4HA 2F0NA 3ERQA 1R4QB 1H9KA 2A6HD 5EPKA 3R8BA 4KJOA 1IYUA 2ZT9C 4F7XA 1EU3A 2E75C 4QMGA 1D1KA 1Z7TA 4HTHA 1QCBD 5CV7A 5C5LA 5C3WA 2LY7A 1PRTB 1EY5A 3IL8A 1A2UA 4C3IB 1LTBD 5J39A 1KTKA 1S5DD 2WKDA 2LFNA 5CMDA 4KY5A 1YNND 3VR3A 2WKCA 3DWPA 4IFDG 1CTMA 1S5BD 3URYA 1EFID 3HOWB 1EYCA 2AQ3B 4K8IA 5C44B 1PTOD 2MUYA 1G91A 3V05A 1V43A 4NKLA 3AMUA 1WTVA 4H44C 3J7YW 1LV9A 2AUKA 2JEAI 3MHBA 1EQVA 1WD0A 1G6ZA 1E2WA 2K1BA 3H6MA 2AQ1B 4IFDI 4NMZA 1WTPA 1HFGA 3MFYA 4FP5D 3QJYA 5ELFA 2F0WA 4RA8A 3RZOB 4PMWA 4TSSA 1J9OA 1VMCA 1Q8IA 1GHJA 2BA0A 3O13A 2PYKA 4X3TA 2QCPX 2VB2X 2CVRA 1PFMA 4HMJA 1WTWA 4Y7NB 5DAUA 1CT1D 1I4XA 3SK4A 1CZGA 1LACA 5M5YB 2BDNA 3K5MA 2PNRC 2F0EA 2D9UA 1TWHB 2KHSA 5ELEA 1CM9A 4B9XA 2IX1A 2AWNA 2IJ0A 5J1ZA 2IPKD 5LL6X 2I46A 3TZUA 2NTTA 3SDZA 3NK9A 3PMFA 1KNEA 3BZDB 4KJNA 4EQPA 3R3OA 2K32A 4RHRA 1EY0A 2JYOA 1V1PA 4V0BA 4ZYSA 1HCZA 5ELBA 5EKLA 1BR9A 3K59A 3Q6SA 4C3HG 1Q1EA 1EL0A 5JEAH 1Z6HA 4TRDA 4G57A 3EFXD 4F8MA 3S2HB 1LT4D 1STGA 4ZKCB 1OXUA 1NAPA 2E2DC 2HDMA 2B2YC 2VXWA 3OIPA 3WOEA 4HN7A 5J22A 3BDLA 5KNCA 1I4GA 1KLUD 1DM0B 1H9SB 1JOOA 2GA4B 1ZEQX 4IUPA 1H9MA 4K6LA 2K01A 2PW7A 2EVBA 2SEBD 3MXGA 1SNOA 1ZYRC 2A68C 4FNFA 1SYDA 5C3EB 3U9OA 5A2QE 5KNDA 3VR4A 4DFAA 4FXDA 3BS1A 4B08A 4EVOA 4A93B 3VA5A 1EEFD 3MEHA 5EPJA 1A3TA 1O78A 3BYTB 2PPBC 1B50A 4DN4M 5ISRA 3G7LA 1I4RA 5CV9A 3H91A 2EE1A 1OXSC 4IQZA 5IT9L 2JA5B 4H13C 1AEXA 1TVXA 2FJ2A 2BDOA 3GP7A 4G7ZC 4DK1A 5FO8B 3DWQA 1STBA 1STHA 1NR4A 2EDGA 4KY6A 1BXTA 2XSCA 3NTKA 2MPMA 3QO2A 4K14A 4RWSC 3H09A 3HOYB 1PZID 5C0XH 3L7ZC 2Z4HA 4F87A 3BDCA 1H9RA 2AQ2B 4K5VA 2Q8IB 3GQBA 4KY7A 3R93A 4XYQA 3VYSA 1STEA 4ZKBB 2BE5D 3S14B 3NPPA 1ILQA 4I65A 2A74C 1BBXC 2R92B 1Y1VB 1K8OA 3NE5B 3E0JA 5IGFA 1PFNA 1JWUD 3KK7A 4JBWA 4FYDA 3MXUA 4E6IA 1E0BA 4CKCA 5BN5A 1DOLA 5IGDA 4ULLA 5CORA 3QWNA 3VYTA 1CQFA 3GTOB 1EWHA 5JJZA 3BYYB 3J7AF 1SXTA 2K5DA 2LS01 1DYQA 2EJFC 4ZUIA 4Q5VA 5FKAC 1SJHD 3OOCA 3OIQA 3FPUB 5C4ZA 3HZXA 2KUMA 1V1PB 5CBAE 1YNJC 3KF8A 4IALA 1PTOB 1WTRA 2PZTA 4J1MA 3K5OA 5CC4A 2PMZB 3NHHA 4RKBA 3OWFA 4KK7A 2WB1B 1FNVA 1UUPA 4RCNA 1TY0A 1FD7D 2Q8TA 3NWSA 2DNEA 1TWFB 3J81L 2F0KA 1B4OA 4ZUJA 1U4LA 3CHBD 3D31A 1ESFA 3HG9A 2A5HA 5M5WB 2QDBA 3L9AX 5FLXE 1BOSA 4FF4A 3PO2B 1SJED 2K04A 2A69D 5JPNC 4ODGA 1SFOB 1IKLA 3BG3A 1SYFA 3NBIA 2F0IA 1CHPD 5JOBA 2F0OA 1OXTA 3A7AB 3S1MB 2K7VA 2B39A 2ENBA 4K8JA 3GV3A 1K8MA 3S16B 1SE3A 5DNFA 5KRUA 1TWGB 1BCPC 2MP1A 3H94A 1SEBD 4K2KA 3D3RA 4ILWA 4XT1B 3SHLA 4R8IA 2K5QA 2WINB 4CHTB 4IURA 3PUVA 3VR2A 1SDFA 3E5SA 4KKSA 3IFTA 3GTKB 4NDXA 4BY7B 3QOJA 3M7GA 1STAA 3DWAA 3L3OC 2XNAC 4BS9A 2F4IA 1UNSA 5DM73 3C3LA 1EU4A 1A2TA 1EOTA 1X3PA 2XWJB 2IWHA 1S5FD 3PV0A 4PMCA 3NTIA 1LTSD 4DAPA 3QIAA 1CZWA 1JOKA 4RGOS 3FEWX 3M4YA 1HQRD 2A6ED 1MSHA 2F0TA 5JEAG 1Z47A 1ENFA 4WORA 2F0VA 1U4RA 2DY7A 2C9OA 2IX0A 4ZK9B 2OF1A 2PW5A 1F2ZA 1TS4A 4M8AA 1PRTC 1A3UA 2FHTA 5BN4A 2ICIA 3DHQA 1ENCA 2WACA 3FMCA 1S5CD 1MSGA 2EYMA 1EZ6A 3RD4A 3SK8A 3KLRA 3T13A 2RDGA 5I2XA 3EQLC 1SE4A 2NUCA 4QUFA 3KBXA 2ZXPA 3MVVA 1QE6A 2B2UC 3TP8A 4C1NI 1CHQD 4X3KA 4WFN3 4RGNA 3CU7A 4RCOA 2N55A 1KDCA 1Y69U 1BDOA 2Z1CA 5C4XB 4C1NK 3BVGA 1AN8A 2RDFA 1RHPA 3IAYA 4FO2A 2F0PA 1GXDC 2EY1A 1F2LA 1ZKOA 2M2LA 1CA6A 3GD7A 1E2ZA 1TU2B 3I4NB 1V1OA 2OT2A 4LMQD 4R8NA 1ILPA 2RKSA 1LT3D 4KI0A 3CRLC 3NQTA 4LJZC 1Q1BA 4OO1H 1WD1A 1OXXK 5C0XG 2L11A 1NUCA 1TKWB 3CQZB 1G8ZD 1IL8A 3UI2A 4A3JB 3LWEA 3J7AV 3NTHA 1M4VA 3NUCA 4A3BB 1G2TA 1D6EC 1UAPA 1O80A 5EBDA 4WRDA 2BOSA 3T16A 1RODA 3FPPA 2LMCB 1A3VA 1TS2A 2QILA 4P2CB 4DU9A 1HTPA 2Y0SB 1JE4A 2EYOA 1FGBD 2L9HA 1XX8A 1SMYC 3C2PA 1KDAA 5C0XI 5CGKA 2E74C 3PIO3 1G2SA 2FMCA 1OXVA 1RDPD 2EYLA 3I4LA 5C3XA 4OL7A 1RD9D 4KKUA 1EY7A 2F0QA 1GUGA 2RA4A 2ZXRA 2QEJC 1QOHA 2HCIA 3I73A 3CRKC 5CV4A 1TWAB 5FK9C 2RSNA 1Q90A 3PUWA 1GUWA 3I70A 5K36H 4DNRB 5I9OA 2G9DA 4ZQ3A 4RFBA 3P7JA 4CJ1B 2R3ZA 2EJMA 1HFNA 2FFKB 5CV5A 1FR3A 2RVLA 2B2TA 2F3VA 3S1QB 1F2YA 1IW7C 3I91A 1I4HA 2EOTA 1FNUA 2A73B 3HOXB 1JCKB 3P20A 3MXPA 3S17B 4A3EB 3W3AA 4X3UA 2FMMA 3D4RA 1SYCA 5IOCA 2X6GA 4DXFA 5JPMC 1B9NA 4A3FB 2SNMA 1T5XD 4TQUS 4C3JB 2B2WA 3TP6A 1DOKA 5A2QL 1RCVD 4H7BA 4JK1C 1QNUA 1JQYD 1EQTA 4BA2I 2PZUA 5EBCA 4IN3A 2EYJA 2JEBI 4K2LA 5EJWA 3I90A 1EIHA 1SNDA 3MXNA 2F0HA 1VDZA 4F88A 2CW0D 2B2VA 5CYUA 5EQ0A 1RKNA 2H4OA 3J80L 3I3CA 3A8IE 4XQQA 1NR2A 4IFDJ 4KV6A 4MHEA 2E2IB 1OO9B 5I2YA 4CJ2C 1D1IA 2QKIC 1PDQA 4KHVA 1II3A 3A56A 2B63B 5FOBB 2KEEA 2EZVA 1LTGD 5NUCA 1HPCA 2M9VA 5I6WA 3DEPA 2R7ZB 4HR7B 5M9OA 2F3WA 4DAYA 1GHKA 2RDHA 5HGTA 4QF4A 4K6DA 1D5MC 1E2VA 3K57A 2F0JA 3TP7A 3GTJB 1BO0A 1LTAD 2MGSA 3PUYA 2Z4IA 3S9WA 3SXHA 5D3DA 2JE6I 5JVG3 4FXKC 1PFBA 3VA7A 4A3DB 1QNKA 5EPLA 2NZ1D 1EYAA 3N52A 3NBHA 3HKZB 3X3MA 3IFDA 1AFPA 1RTNA 2X6LA 4U673 1BUVT 3IKJA 2J4XA 4J8QA 5T1IA 2JSOA 2MHVA 2KCCA 2F0MA 4N9TA 4RHSA 4ME5A 1DZ1A 3T51B 1KABA 1D2BA 3EJIA 3GO5A 4G7HC 1Y8OB 3NSWA 2MJ8A 1HUMA 3MFGA 2EPBA 3M4OB 1YNNC 2DN8A 4DA2A 3VR5A 1WTXA 2JP1A 4RH6A 2QF7A 1B44D 5T1GA 3DXJC 1S4ZA 3KBGA 5C4JB 2R6GA 2XRSD 2ZXOA 1T5EA 1G291 3H0GB 4PNYA 4QCLA 2O5IC 4L8JA 3MZ5A 2YU9B 2FINB 1PTOC 1O7LA 1M8AA 2PCFB 1LO5D 1PTOH 1WTQA 2BCOA 5COYA 3C1FA 3PUXA 3A8JE 5F2DA 2VB3X 4PV1C 4RAUC 4KN4C 4H0LC 2J0TD 3C46A 1X3QA 1ONLA 4C3IG 1NCVA 4IUTA 1SBBB 1QG7A 1RJTA 1DCZA 3R2IA 5IGBA 3NWTA 5TSSA 4XTCS 4BY1B 3FDTA 3S1NB 5C6AA 1KNAA 3ZYYX 1AZPA 2NVTB 4XDXA 3J81E 2IW3A 5ELCA 2N88A 3QOLA 1IHZA 1BQQT 1GJXA 5EGTA 2B2WC 1XTCD 2EYFA 2WP8J 3MA2B 3EROA 4IUQA 1TWCB 2KA7A 1I3QB 4DNTB 3I8ZA 5E4WC 2O4XA 3T53B 2DY8A 5C5MA 2B2VC 1L0XB 2XRQD 5FLXL 2JA6B 1JICA 2XN9C 3ND9A 2SDFA 3NQIA 4RGTA 1TR5A 3RMHA 1JC7A 5E3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CC4 A;  4TRD A;  4G57 A;  4K14 A;  3MHB A;  4K2K A;  2EYL A;  5K5P A;  1U9R A;  4HMI A;  1EQV A;  1SNC A;  4F8M A;  4OL7 A;  3SHL A;  4EQN A;  5C3X A;  1TT2 A;  3NHH A;  4KHV A;  1II3 A;  1EY7 A;  3MVV A;  5KEE A;  1STG A;  3H6M A;  4PNY A;  2F0Q A;  4RKB A;  3TP8 A;  1EY8 A;  3TP5 A;  3MZ5 A;  5EKK A;  4NMZ A;  3BDC A;  3NP8 A;  3E5S A;  3OWF A;  4DF7 A;  4RKL A;  4EQO A;  5I6Y A;  1EY9 A;  3OSO A;  4K5X A;  5NUC A;  4K5V A;  5E1F A;  5J22 A;  4S3S A;  5I6W A;  2F0G A;  3OMC A;  4NDX A;  5CV4 A;  2KQ3 A;  1KDC A;  3QOJ A;  4KD3 A;  1JOR A;  1STA A;  3BDL A;  4KY7 A;  5KYI A;  2F0W A;  3C1F A;  2PZW A;  2RDF A;  5F2D A;  2F3W A;  5M9O A;  3EVQ A;  1JOO A;  1EZ8 A;  2EXZ A;  4B9W A;  3SR1 A;  1SNQ A;  2F0P A;  2F0N A;  2OXP A;  4QF4 A;  4I65 A;  5C4H A;  5HGT A;  3ERQ A;  4K6D A;  5KGU A;  5IGE A;  2PW7 A;  2EY1 A;  1A2T A;  1SNO A;  2F0J A;  3TP7 A;  5I9O A;  5IGC A;  3S9W A;  1SYD A;  1SYB A;  2F0K A;  1KAA A;  4ZQ3 A;  1EY4 A;  4ZUJ A;  3U9O A;  5IGG A;  2PYK A;  4PMC A;  5IGF A;  4DFA A;  4KJO A;  2EYH A;  3SXH A;  4NP5 A;  2EYP A;  4LAA A;  5CV8 A;  1NSN S;  4HMJ A;  3V2T A;  4F7X A;  5KYL A;  5E3F A;  4QMG A;  4EVO A;  2F0F A;  1JOK A;  5DAU A;  4HTH A;  5CV5 A;  3VA5 A;  4R8N A;  4E6I A;  5CV7 A;  3SK6 A;  1STN A;  3SK4 A;  5IGB A;  2QDB A;  3MEH A;  2RKS A;  2F3V A;  5C5L A;  5CV6 A;  5C3W A;  1F2Y A;  3OMG A;  3P1H A;  3RUZ A;  5IGD A;  1A3T A;  2F0E A;  2F0T A;  2OEO A;  3QB3 A;  1EYA A;  1EY5 A;  2KHS A;  4IUN A;  4WOR A;  3NQT A;  3ITP A;  2F0V A;  1SYE A;  1A2U A;  4PMB A;  3D4W A;  3MXP A;  5C6A A;  4B9X A;  2SNS A;  3DMU A;  5KIX A;  3D6C A;  5ISR A;  1NUC A;  5J39 A;  5CV9 A;  2F0U A;  5IOD A;  4QB4 A;  1EY6 A;  4ODG A;  2PQE A;  3TME A;  1SYG A;  5J1Z A;  3NUC A;  4KY5 A;  2OF1 A;  1SYC A;  2PW5 A;  3D4D A;  1F2Z A;  1EYD A;  2EY6 A;  1SYF A;  5CR3 A;  4KTA A;  5IIF A;  5IOC A;  3QOL A;  1IHZ A;  2F0M A;  2F0I A;  5I9P A;  4WRD A;  1A3U A;  2F0S A;  2SNM A;  3NK9 A;  5EGT A;  2F0O A;  1TQO A;  5JOB A;  1AEX A;  3PMF A;  3T16 A;  3TP6 A;  4KD4 A;  4N9T A;  2F0D A;  2EYF A;  4ZUI A;  1STY A;  2EY5 A;  4H7B A;  2SOB A;  4KJN A;  4ME5 A;  4EQP A;  3ERO A;  3D8G A;  3R3O A;  2PZU A;  3DHQ A;  1ENC A;  1EY0 A;  5HUR A;  1A3V A;  1KAB A;  3P75 A;  2EYJ A;  1EYC A;  1ENA A;  4DU9 A;  2WAC A;  4IZ8 A;  4DGZ A;  2ENB A;  4K8J A;  4K2L A;  3EJI A;  5C4Z A;  3HZX A;  4K8I A;  2EYO A;  1SND A;  2EYM A;  4YIJ A;  2O4X A;  4MIU A;  2M00 A;  5EKL A;  5C5M A;  2F0H A;  3NXW A;  2LKV A;  1EZ6 A;  2RBM A;  1STB A;  3C1E A;  1STH A;  4N9P A;  4IAL A;  1SNM A;  3SK5 A;  3SK8 A;  5KRU A;  5DEH A;  3T13 A;  1RKN A;  1KDA A;  3HEJ A;  4ID6 A;  4KY6 A;  4K5W A;  1KDB A;  2F0L A;  3LX0 A;  4NKL A;  5JAV A;  1F2M A;  5CGK A;  1SNP A;  2HQE A;  1JOQ A;  1TR5 A;  2PZT A;  4J1M A;  2NUC A;  2EY2 A;  4J6H A;  4KV6 A; 
#chains in the Genus database with same CATH topology
 4IUV A;  1IW7 D;  3EN2 A;  5IYB H;  3FKI B;  4M1U B;  3HGB A;  3CKI B;  1N34 Q;  2HIX A;  2JXM B;  1ZYR D;  2A68 D;  4OO1 G;  5DLQ E;  3I2Z A;  1TS3 A;  4KHP L;  5I6Y A;  3FRP B;  1TS5 A;  4LWC A;  3GTG B;  2Z6K C;  2R61 A;  4A3J G;  1B2T A;  1PYW D;  5FO9 B;  1VQK A;  2Q8R E;  4YHH Q;  1Q12 A;  2K75 A;  4K0K Q;  2D0O A;  3EVQ A;  1ESR A;  1HH2 P;  1EZ8 A;  1EWC A;  2EXZ A;  2PMZ E;  4N8X 1;  3M7N A;  4DAY B;  2L12 A;  2EXD A;  3JAM E;  1LTI D;  3BZC A;  3PIP 3;  2UU9 Q;  2KJX A;  1U4P A;  1XMQ Q;  2EYH A;  1EEI D;  2EYP A;  2Y0S G;  3HS0 C;  2WB1 E;  4YCU A;  4DV3 Q;  4LAA A;  1B53 A;  4FVM A;  3GTM B;  3GTK H;  3T4A C;  2B8F A;  4DR5 Q;  1ZXT A;  4BY7 H;  4OO1 I;  5BR8 Q;  1QWY A;  5CV6 A;  4ABN A;  5D3I B;  3CC4 A;  4DR6 Q;  2GN5 A;  2ASB A;  4XIG S;  4DV0 Q;  4HSP A;  2RSO A;  4PMB A;  3TN2 A;  1HRJ A;  4JYA Q;  3ND8 A;  3NBH B;  4UP8 A;  1KXL A;  3D6C A;  1XPO A;  2E5L Q;  4DK0 A;  4JI3 L;  4CDD C;  3V96 A;  2LXK A;  4DV7 Q;  1SYG A;  1H95 A;  1GUO A;  4DR4 L;  4QGU A;  1O7Z A;  3I72 A;  3AFP A;  5ELD A;  4GNX A;  3BVM A;  5M3F H;  5M3F B;  4A3I B;  3TRZ A;  4KHP Q;  2D2C C;  3FP9 A;  5IIF A;  1FYC A;  3UDF A;  4HCE A;  1VQ7 A;  3OYY A;  2K6A A;  3GTL H;  3GTL B;  2D5D A;  3GV6 A;  1DXM A;  3KF6 A;  2R7D A;  4QY7 A;  5AJ3 Q;  1X3F A;  1A8V A;  3MC0 B;  5K36 G;  3CCV A;  4BA1 I;  4OIK A;  3AYH B;  4JG2 A;  4HJ9 A;  1QZH A;  1V8Q A;  4QIW B;  3J7Z C;  4Q0F A;  1MKH A;  4LF9 L;  4LFC Q;  2JA7 B;  1C48 A;  2J7Z A;  2NVY B;  1LT6 D;  2O5J C;  4R4T A;  2N49 A;  1I4Q A;  3MTS A;  2H5X A;  1F9R A;  1LT5 D;  4GOP A;  5LHY 1;  1UE5 A;  4GZY C;  1U4M A;  4I7Z C;  1R4P B;  1CI3 M;  2IHF A;  4BXX G;  3G48 A;  1JB7 A;  5FLX c;  3UDG A;  4EQO A;  4A3E G;  1EY9 A;  2K33 A;  2WAQ B;  3AFQ A;  5C3E G;  3U4Z A;  3Q24 A;  1MGS A;  2F0G A;  1UEA B;  2NN6 I;  1PH2 A;  2AWO A;  5CBE E;  4RG1 A;  1X3E A;  1PZK D;  1Y8N B;  1PZJ D;  5G3L D;  3K7A B;  2OXP A;  5I4D A;  4C3J G;  2QDL A;  2E2J B;  2K5W A;  5IGC A;  5IP9 H;  2D62 A;  2L5T A;  2E2H B;  1GUS A;  1HA6 A;  4RGM A;  2EQS A;  1XNQ L;  1G6P A;  2Z8L A;  4KHZ A;  1I6V C;  2L4N A;  2Q2U A;  2F0F A;  1UE6 A;  5C4X H;  2H1E A;  4A3G B;  2BE5 C;  1YZ6 A;  3KLS X;  3OMG A;  4CDF C;  2ZJQ A;  2JA5 G;  2EJG C;  3LWU A;  4YCW A;  2JA8 B;  3PUZ A;  1KLG D;  3ITP A;  3HOU H;  3HOU B;  1SYE A;  1AE3 A;  2F3I A;  3LNN A;  5LMN L;  4L6T B;  1KC8 C;  2SNS A;  1E24 A;  1VQE A;  5FO7 B;  4GKK Q;  3B6Y A;  3GTP B;  4C2M B;  3JAM c;  1EY6 A;  1YNJ D;  3FVQ A;  2PQE A;  3I4N H;  4Y52 H;  2V1C C;  3OW2 A;  4OWX B;  4GN3 B;  4DPG A;  3RZD B;  4BBR B;  5I9P A;  2WII B;  4P73 A;  2TSS A;  3ONA B;  2MO0 A;  1STY A;  1JR0 D;  2IT1 A;  3GTQ H;  3GTQ B;  2SOB A;  4B3S L;  1EYG A;  1E22 A;  1J8I A;  1D7Q A;  4O0A A;  4DUZ Q;  1CSQ A;  4L63 B;  4DGZ A;  3HOY G;  3SE0 A;  4QIW E;  1GOZ A;  4CGY B;  3CQZ H;  1VQO A;  1YNX A;  1HZA A;  5D65 A;  4YY3 Q;  2B8G A;  1A6X A;  3NEL A;  1CK1 A;  4O2D A;  3SVM A;  4A3C G;  4CKB A;  3PQI A;  4A3B H;  4K5W A;  1FVI A;  4IUU A;  4Z9C B;  4DV6 Q;  1SAP A;  1CKO A;  1W6J A;  1PH6 A;  3K0Y A;  1A15 A;  1BCP F;  2E76 C;  2IX3 A;  2I5H A;  2ALY B;  4UP9 A;  4B3T Q;  4HMI A;  4R1J A;  4EQN A;  4JI1 L;  2L1B A;  3F2D A;  2ZM6 L;  2WAQ E;  1Y8P B;  2HUG A;  1HR0 Q;  3HKZ G;  4A3K B;  4JPB W;  5IYD H;  3DEO A;  3TDQ A;  3NP8 A;  2IL8 A;  2R92 G;  3CC2 A;  2B3G A;  1VQJ A;  4S3S A;  2X69 A;  2KQ3 A;  5A35 A;  5LMU L;  3TZD A;  3I4M B;  2PZW A;  2VQE Q;  1VQ6 A;  2NYZ D;  1RF2 D;  3SEB A;  3T56 B;  2DJG C;  1RTO A;  5FJ8 G;  5IGE A;  3PIP A;  2K28 A;  3U9S A;  4JI2 Q;  1PHJ A;  1SYB A;  2OQ0 A;  1EY4 A;  3MEF A;  1PH4 A;  1VF5 C;  1TII D;  4YWL A;  5IGG A;  3R2T A;  4OIJ A;  4KKT A;  1D8L A;  1NBW A;  5KYL A;  3DM1 A;  3V2T A;  2N78 A;  5AFW A;  2XIW A;  1CFM A;  1MI2 A;  3STB C;  3MAQ A;  3J81 i;  3H3V I;  4IPH A;  1STN A;  1TWA H;  4U68 A;  5IP7 H;  4R4I A;  4B3R Q;  2C5C A;  3QB3 A;  4HIM A;  3WOF A;  3AQQ A;  3EA6 A;  1VQD A;  4N8F A;  2NN6 H;  4JI1 Q;  3H0G G;  2ZM6 Q;  1F9P A;  5GRO A;  4QB4 A;  1W3S A;  1JE5 A;  4JI6 Q;  3TME A;  4O1N A;  1PH9 A;  1PYS B;  3OHX C;  1GUT A;  1K8A C;  1LTT D;  3KLS A;  4GNX B;  1PRT F;  1MD2 D;  1QJO A;  1IYJ B;  4JV5 Q;  1I5F A;  1R9T B;  1BCP D;  3S1Q H;  4LFB Q;  5JEA J;  2D0P A;  3D8G A;  5HUR A;  2OWO A;  3W1G A;  4HSV A;  4GKJ Q;  3N6R A;  4IZ8 A;  3HOX H;  3KF6 B;  1J5E L;  1X54 A;  3S17 H;  3KUP A;  2KVM A;  2YYZ A;  2A69 C;  4DKA C;  1K8G A;  3HOV H;  3HOV B;  3RLF A;  1SNM A;  3K6O A;  2RCF A;  3HEJ A;  4ID6 A;  5DM6 3;  4AQY Q;  1SNP A;  5HY6 A;  2HQE A;  4UDU C;  4A3F H;  2WB1 G;  4IPC A;  4J6H A;  4C3J H;  1Y1W B;  4FF2 A;  3VYR A;  1TT2 A;  2K05 A;  5KEE A;  3W1B A;  3JAM i;  4LK1 C;  4GOP B;  1HA5 A;  2PQA A;  5GAD C;  1EY8 A;  5EKK A;  1YJ9 A;  2KED A;  1BNZ A;  4MN3 A;  3OSO A;  3ULJ A;  3OMC A;  3PO3 H;  4QUC A;  1PXU A;  3PO3 B;  1X6O A;  4LF7 L;  2NTS A;  5M5X B;  1AE2 A;  1YI2 A;  4IFD H;  2CCZ A;  2ID0 A;  4B9W A;  1SNQ A;  4KN7 C;  1F9S A;  1W6K A;  5ELN A;  2E2I H;  3J80 E;  4HAE A;  4DV2 Q;  5IT9 E;  3K5N A;  1MJC A;  2V4D A;  4JI0 Q;  5GAE C;  3DUZ A;  1L1O C;  1ML0 D;  3E6Z X;  2G9H D;  1NTG A;  3CC7 A;  1KAA A;  2B63 H;  4DK3 C;  1EIY B;  1WFQ A;  4XT3 B;  2XVS A;  3PO2 G;  3Q23 A;  1NSN S;  2VNU D;  2HDL A;  2R7Z H;  1PRT D;  1LLR D;  3A0J A;  3X3N A;  1LUZ A;  1C7Y A;  3ICE A;  3KDF A;  1PLF A;  3RUZ A;  1FL0 A;  5ELO A;  2BH2 A;  2OEO A;  1D5X C;  4IUN A;  2HQL A;  1L0Y B;  2DJF C;  5IYB G;  3TSS A;  1B9M A;  3DMU A;  1ASY A;  3G6J B;  3CCJ A;  2MO1 A;  4YWM A;  2VZA A;  2ATW A;  1ICW A;  1AZQ A;  5HGQ A;  1CQV A;  2MNA A;  4A3D H;  3WDN A;  3RNU A;  2A6E C;  2EY5 A;  1YIJ A;  3H3V C;  4HCS A;  4XQJ A;  4CJ0 B;  3A7L A;  5BN3 A;  3P75 A;  2AHO B;  4TKO B;  2F03 A;  3H3V H;  3S2D B;  5C0X J;  3KJP A;  1SRU A;  2A6H C;  4HED A;  1DOM A;  4YIJ A;  4FF3 A;  3QG1 A;  4JBM A;  4O42 A;  1CUK A;  3SK5 A;  1HZC A;  1V9P A;  5DEH A;  2BA1 A;  2F0L A;  5D14 A;  1HXY D;  4EGV A;  1JOQ A;  4BY7 G;  4DAV A;  3TS2 A;  2EY2 A;  1Q3L A;  1LYL A;  1FNW A;  1EQR A;  1JWS D;  3S1R H;  1HQM C;  1U9R A;  3S1R B;  1SNC A;  1XMO Q;  1BF4 A;  1WCM B;  1DJR D;  3UE0 A;  3W2D A;  3BU2 A;  4XYO A;  4HJ8 A;  3KLW A;  4UAI A;  4FXG C;  1VQA A;  4RKL A;  1FJG Q;  4K5X A;  2CQA A;  5LL6 S;  1Q7Y C;  1N8R C;  3T1Y L;  1LTL A;  3HP3 A;  3M3Y B;  1JOR A;  5KYI A;  1U5K A;  5M3F G;  2NVX B;  3M85 A;  1Q82 C;  2K5V A;  4A3L H;  1I50 B;  2VQF L;  4PZ8 A;  1WVL A;  5KGU A;  5C4J H;  4X65 L;  4OEL B;  1QIL A;  1KHI A;  2PO4 A;  5FLM H;  2CHB D;  2KCT A;  2YU9 H;  1ET6 A;  4NP5 A;  4FF1 A;  4C3H H;  4C3H B;  5CV8 A;  3DM3 A;  2WFW A;  2HIV A;  3ERS X;  1EOV A;  3SK6 A;  3K5L A;  1N33 Q;  4CBV A;  4OHJ A;  4G4K A;  4KMU C;  1WTO A;  3S15 B;  2KCN A;  4B3M Q;  4DR3 L;  2XWB B;  1DD2 A;  2P5Z X;  5JVH 3;  5KIX A;  3A54 A;  2L55 A;  2PNH A;  1I6H B;  3OW7 A;  2F0U A;  4X3S A;  4R9W A;  1MIU A;  4ZAI A;  5IT9 c;  1K3B C;  3Q0A A;  1SMY D;  1S5E D;  3A55 A;  1B3Q A;  2EY6 A;  3M4P A;  1VQH A;  3E9I A;  3T1Y Q;  1VQI A;  2KOL A;  2B2T C;  2F0S A;  4R4O A;  1UEB A;  1EFW A;  4DXG A;  4KD4 A;  2F0D A;  1GUN A;  2WV6 D;  3A74 A;  3AB9 A;  2VQF Q;  4ZRZ A;  3F8T A;  4X66 L;  4BY1 H;  2B2U A;  2A19 A;  3S1N H;  1F9Q A;  5IP9 G;  4UY8 C;  2NVQ B;  3NXW A;  2KEC A;  5E4X A;  2NVT H;  3C1E A;  3Q22 A;  4DK6 C;  2UUB Q;  2C35 B;  1TY2 A;  4K0K L;  1K28 A;  2I07 B;  1KDB A;  3LX0 A;  1F2M A;  1LTR D;  4BBS B;  4PQX A;  5C4X G;  2B29 A;  2G5D A;  2O2L D;  2UU9 L;  1H9J A;  3K58 A;  3OPO A;  4LF8 L;  3BVZ A;  2HHH L;  1TWC H;  1EIG A;  4DR3 Q;  2K03 A;  1XMQ L;  1I3Q H;  2NWG A;  3HOU G;  3TP5 A;  5JJK A;  5M3M H;  5M3M B;  4DV3 L;  1WOC A;  4WJW A;  1D5Z C;  2NBF A;  3I4N G;  5BR8 L;  2JA6 H;  4FDB A;  4IPD A;  1LAB A;  4CKE A;  1S72 A;  1W2B A;  1XWE A;  4ALP A;  4DV0 L;  2TMP A;  1C4Q A;  4BWG B;  3FKI H;  4JYA L;  3HRZ C;  1M90 C;  1B3A A;  2E5L L;  3VYU A;  3A8K E;  3VR6 A;  4X66 Q;  1MBY A;  4NPS A;  2Z9H A;  4DV7 L;  1UE7 A;  3F2U A;  1F77 A;  4R4C A;  3VDY A;  1X32 A;  3PCO B;  3D6W A;  4V19 0;  3GTG H;  1QB5 D;  2ICE C;  2QA4 A;  4L5S A;  4A3M B;  1VF7 A;  4CDC C;  4A3B G;  2MQH A;  3BDO A;  3D0F A;  4OGQ C;  1JWM D;  3P1H A;  2NB0 A;  4JOI A;  1IXR A;  5AJ3 L;  3KDF B;  1IBK Q;  3IRB A;  2QEX A;  2MFI A;  3D4W A;  1NMF A;  2VUM H;  2VUM B;  4LF8 Q;  2HHH Q;  2AUJ D;  2RQX A;  5IOD A;  1HTL D;  3NEM A;  4MTN A;  5IYD G;  1AW7 A;  1XYI A;  1IYV A;  1PMR A;  4LFC L;  4P74 A;  2UUC L;  3D4D A;  3GTM H;  1HUN A;  1EYD A;  3JAM L;  3CPF A;  1YBY A;  4KTA A;  5CR3 A;  1C8C A;  1S3O A;  4MTK A;  2NZH A;  4G7O C;  1XXG A;  1TQO A;  4XXE A;  5G3L F;  3E0E A;  1BCP B;  1B1Z A;  4OXP A;  2JA9 A;  3QR8 A;  1N32 Q;  1ENA A;  2IY5 B;  1VMP A;  5KNB A;  3OWE B;  1ET9 A;  5EKI A;  4MIU A;  2M00 A;  1JB3 A;  2DNC A;  2LKV A;  2RBM A;  1X3G A;  4N9P A;  1CA5 A;  3HOZ B;  3TBI B;  1O7Y A;  2L0C A;  5JAV A;  4A3I H;  1DON A;  2QGQ A;  3PF4 A;  1SSO A;  4NW2 A;  5IP7 G;  5K5P A;  4ZLT F;  1I4P A;  2R93 B;  1IKM A;  3J80 i;  1VQM A;  1XTD A;  4AYB B;  1B7Y B;  4XQN A;  2B2Y A;  4DF7 A;  2NN6 G;  4QJF A;  1NJI C;  1AP0 A;  3AU7 A;  1PTO F;  2CW0 C;  1K83 B;  5E1F A;  3MWY W;  1H9S A;  4KD3 A;  1JJ2 A;  2JA7 H;  1VQG A;  2UUC Q;  1SE2 A;  4JC0 A;  1HHV A;  2HCC A;  1VCI A;  4C56 C;  1KAW A;  2F1M A;  2NVY H;  5JJI A;  3KFU A;  3SR1 A;  5C4H A;  2F0N A;  3I7F A;  3J81 c;  3CXC A;  3ERQ A;  1R4Q B;  1H9K A;  2ZJP A;  3K8A A;  4GKK L;  2A6H D;  5EPK A;  3R8B A;  4KJO A;  3HOX G;  1IYU A;  1G51 A;  3CCL A;  2ZT9 C;  4F7X A;  4RMF A;  1EU3 A;  1PH5 A;  2E75 C;  4QMG A;  5IE8 A;  1D1K A;  5IYC H;  3HOV G;  1Z7T A;  4HTH A;  1QCB D;  5CV7 A;  3TQY A;  5C5L A;  5C3W A;  2LY7 A;  1PRT B;  3K7A H;  4A3F G;  1EY5 A;  4DUZ L;  3IL8 A;  1A2U A;  2E2J H;  4LUV A;  4C3I B;  1LTB D;  1Y14 B;  2E2H H;  5J39 A;  1YJW A;  1KTK A;  1S5D D;  1P16 A;  4YY3 L;  4PG3 A;  2WKD A;  1EQQ A;  2LFN A;  2QW7 A;  5CMD A;  4KY5 A;  1E1O A;  2IHE A;  1YNN D;  3VR3 A;  4DV6 L;  2WKC A;  3DWP A;  3PO3 G;  3U4V A;  4A3G H;  4IFD G;  4B3T L;  2CWA A;  1CTM A;  1S5B D;  3URY A;  1VQC A;  2Z0S A;  1EFI D;  2JA8 H;  3HOW B;  1EYC A;  1HR0 L;  2AQ3 B;  4K8I A;  4ME3 A;  5C44 B;  3GTP H;  4C2M H;  1PTO D;  2MUY A;  2B63 G;  3U50 C;  1PV4 A;  1G91 A;  3V05 A;  4HJA A;  1V43 A;  2YTX A;  4NKL A;  3AMU A;  2VQE L;  1WTV A;  4H44 C;  1J6Q A;  4OWW B;  3J7Y W;  3RZD H;  1LV9 A;  4BBR H;  2R7Z G;  2AUK A;  4HID A;  2JEA I;  1XPU A;  3MHB A;  4X62 L;  1EQV A;  1WD0 A;  4JI2 L;  1G6Z A;  1E2W A;  1PH1 A;  2K1B A;  4AYB E;  4CDE C;  3H6M A;  2AQ1 B;  4IFD I;  2K4K A;  4NMZ A;  1WTP A;  1HFG A;  3PGZ A;  3MFY A;  4P75 A;  3UE1 A;  3CCQ A;  4FP5 D;  4JI4 L;  3HFZ B;  1VQ5 A;  3QJY A;  1VQF A;  3S24 A;  1VQ4 A;  5ELF A;  2F0W A;  4NXN Q;  4RA8 A;  2BH8 A;  3RZO B;  4B3R L;  4PMW A;  4A3D G;  2CH4 W;  4TSS A;  1J9O A;  2A1A A;  2R7F A;  1VMC A;  1Q8I A;  1GHJ A;  2BA0 A;  3O13 A;  2PYK A;  4A3K H;  4X3T A;  4JI6 L;  2QCP X;  2VB2 X;  2CVR A;  1IZ6 A;  1PFM A;  4HMJ A;  3I56 A;  1WTW A;  4Y7N H;  4Y7N B;  5DAU A;  4JV5 L;  1CT1 D;  1I4X A;  3SK4 A;  1CZG A;  1LAC A;  3I4M H;  4LFB L;  5M5Y B;  2BDN A;  3K5M A;  2PNR C;  2F0E A;  3ER0 A;  2D9U A;  1TWH B;  2KHS A;  4GKJ L;  5ELE A;  1CM9 A;  4X62 Q;  2VY3 A;  4B9X A;  2IX1 A;  1GM5 A;  1QUQ A;  2AWN A;  4JW0 A;  1UWV A;  2IJ0 A;  1HZ9 A;  5J1Z A;  2IPK D;  5LL6 X;  4AQY L;  1KIX A;  2I46 A;  4JI4 Q;  3TZU A;  2NTT A;  3SDZ A;  3NK9 A;  3PMF A;  1KNE A;  3BZD B;  4KJN A;  4EQP A;  4A3L G;  3R3O A;  2K32 A;  4RHR A;  1EY0 A;  1NMG A;  2JYO A;  1V1P A;  2ZTC A;  4V0B A;  2OCE A;  5EAY A;  4ZYS A;  1HCZ A;  5FLM G;  4EX5 A;  5ELB A;  5EKL A;  1BR9 A;  3K59 A;  4GN5 A;  4GNX C;  4LF4 Q;  3Q6S A;  4C3H G;  1ICF B;  1Q1E A;  2VL6 A;  3DLL A;  1EL0 A;  4IJL A;  5JEA H;  1Z6H A;  1BKB A;  1R9T H;  4TRD A;  2A8V A;  4G57 A;  4DV2 L;  1HNW L;  3EFX D;  3ULL A;  4F8M A;  1SLJ A;  4JI0 L;  3AEV A;  3S2H B;  1LT4 D;  4JI5 L;  4J15 A;  1STG A;  2NZO A;  4ZKC B;  1OXU A;  1NAP A;  1WTH A;  2E2D C;  2HDM A;  2E8G A;  2B2Y C;  1HZB A;  2VXW A;  3L0O A;  3OIP A;  3WOE A;  4HN7 A;  5J22 A;  4DR2 Q;  1K9M C;  3BDL A;  5KNC A;  4OWT B;  3M9B A;  1I4G A;  1KLU D;  1DM0 B;  1H9S B;  1BBW A;  1JOO A;  2GA4 B;  1CSP A;  1ZEQ X;  4IUP A;  1H9M A;  1Y1W H;  4K6L A;  4GOP C;  2K01 A;  2PW7 A;  3Q8D A;  2EVB A;  2SEB D;  3MXG A;  1SNO A;  1ZYR C;  2A68 C;  4FNF A;  1SYD A;  5C3E B;  1YHQ A;  3U9O A;  5A2Q E;  2DUD A;  1T9H A;  5KND A;  4BY1 G;  3VR4 A;  4DFA A;  4FXD A;  4LUZ A;  3BS1 A;  4B08 A;  1SN8 A;  4EVO A;  4A93 H;  4A93 B;  3VA5 A;  5M5X H;  1EEF D;  3MEH A;  4OON A;  5EPJ A;  1A3T A;  1O78 A;  3BYT B;  2PPB C;  1HNW Q;  1B50 A;  4DN4 M;  5ISR A;  3G7L A;  4JI5 Q;  1A62 A;  1I4R A;  5CV9 A;  3H91 A;  2AKW B;  2EE1 A;  1OXS C;  2JN4 A;  5M3M G;  4IQZ A;  2CFM A;  2KEN A;  5IT9 L;  1HNX Q;  1K0S A;  4LFA L;  2JA6 G;  2JA5 B;  4H13 C;  1VQL A;  1AEX A;  1XMO L;  1TVX A;  2FJ2 A;  3TRE A;  2BDO A;  3GP7 A;  4G7Z C;  3FKI G;  1FJG L;  4DK1 A;  3SGI A;  5FO8 B;  3DWQ A;  1STB A;  1STH A;  2K5H A;  1NR4 A;  2GVB A;  4UPA A;  2EDG A;  1XNR Q;  4KY6 A;  1BXT A;  2XSC A;  3NTK A;  3G4S A;  2MPM A;  3QO2 A;  1SR3 A;  1GKH A;  4K14 A;  4RWS C;  3H09 A;  3HOY B;  1PZI D;  5C0X H;  2CKZ B;  3L7Z C;  2I0Q A;  1NY4 A;  3S2D H;  2Z4H A;  4ZCK A;  4F87 A;  3BDC A;  4DV5 L;  1KRT A;  3G6E A;  2VUM G;  1H9R A;  2AQ2 B;  1HR0 W;  4K5V A;  2Q8I B;  3G71 A;  2VS1 A;  3GQB A;  4TVA B;  4PZ6 A;  4KY7 A;  3R93 A;  1N33 L;  4XYQ A;  4EQ5 A;  3VYS A;  1STE A;  3CF5 A;  4ZKB B;  2BE5 D;  4B3M L;  4JBK A;  3S14 B;  4LFA Q;  3NPP A;  1ILQ A;  4I65 A;  3T1H Q;  2A74 C;  1WCM H;  1BBX C;  2R92 B;  1Y1V H;  1Y1V B;  1K8O A;  3NE5 B;  3E0J A;  1BBU A;  5IGF A;  1PFN A;  1JWU D;  3KK7 A;  4JBW A;  4FYD A;  3MXU A;  3A5U A;  4A76 A;  1V1Q A;  3TS0 A;  3E3X A;  3M3Y H;  4E6I A;  4DV1 L;  1E7Z A;  1E0B A;  4CKC A;  2LSS A;  3CCM A;  4A3I G;  2NVX H;  1A63 A;  5BN5 A;  1DOL A;  1I50 H;  5IGD A;  4ULL A;  4X64 L;  5COR A;  3QWN A;  4JI8 Q;  1CKM A;  1N9W A;  3VYT A;  2UUB L;  4AH6 A;  1VQN A;  1QVG A;  1QUQ B;  1CQF A;  4DV5 Q;  4QQB X;  3GTO B;  1EWH A;  5JJZ A;  3BYY B;  3J7A F;  1SXT A;  2K5D A;  2LS0 1;  1DYQ A;  2JA7 G;  2EJF C;  3M4Q A;  4ZUI A;  4Q5V A;  5FKA C;  3OTO Q;  3S15 H;  1SJH D;  3OOC A;  3OIQ A;  4LF6 Q;  4POF A;  3FPU B;  5C4Z A;  3HZX A;  2KUM A;  4APV A;  4IO9 A;  1V1P B;  5CBA E;  1YNJ C;  1I6H H;  4DNI A;  3J80 c;  3KF8 A;  4IAL A;  1PTO B;  1WTR A;  2WAQ G;  3PF5 A;  3ZJY C;  5IYC G;  3RLO A;  4QL5 A;  2PZT A;  2RHS B;  4J1M A;  1C0A A;  4DV1 Q;  3K5O A;  5CC4 A;  2PMZ B;  4WJ4 A;  3NHH A;  1QVF A;  4X64 Q;  4RKB A;  3OWF A;  4KK7 A;  2NVQ H;  2AMC B;  4IPG A;  3H15 A;  2JJQ A;  3STB D;  2WB1 B;  1FNV A;  2LXJ A;  2JK8 A;  3CCR A;  1JJC B;  2UXD L;  1DGS A;  2KHJ A;  4AIM A;  1UUP A;  4BBS H;  4RCN A;  1TY0 A;  1GVP A;  1IBK L;  4A3G G;  1FD7 D;  2Q8T A;  3NWS A;  2DNE A;  2KHI A;  1TWF B;  3J81 L;  2F0K A;  1B4O A;  2XTI A;  2JA8 G;  4ZUJ A;  3CMA A;  5JJL A;  3CPW A;  1U4L A;  3CHB D;  3D31 A;  1ESF A;  3HG9 A;  1QZG A;  2A5H A;  5M5W B;  2QDB A;  3L9A X;  1CKN B;  1WJJ A;  5FLX E;  4BBR G;  1N32 L;  1BOS A;  4L5R C;  4OX9 Q;  1PH7 A;  4FF4 A;  3PO2 B;  1SJE D;  2K04 A;  2A69 D;  4X6A H;  5JPN C;  4ODG A;  1SFO B;  1U0L A;  1IKL A;  3BG3 A;  2EIF A;  4LF5 L;  1SYF A;  1MHW C;  1JMC A;  3NBI A;  2F0I A;  4A3M H;  1CHP D;  5JOB A;  2F0O A;  2UXD Q;  1OXT A;  3A7A B;  4H02 A;  3S1M H;  3S1M B;  2K7V A;  3RN5 A;  2OQK A;  2B39 A;  2ENB A;  4K8J A;  3GV3 A;  1K8M A;  3K80 C;  3S16 H;  3S16 B;  1SE3 A;  5DNF A;  5IWA Q;  4A3K G;  4NXM Q;  5KRU A;  1TWG H;  1TWG B;  4JI7 Q;  1K73 C;  4UP7 A;  2ES2 A;  3FHW A;  1X56 A;  1BCP C;  2MP1 A;  3H94 A;  3RR5 A;  3I4M G;  1SEB D;  2PI2 A;  4K2K A;  3D3R A;  4ILW A;  4XT1 B;  3SHL A;  4R8I A;  2K5Q A;  2WIN B;  4CHT B;  1I94 Q;  4IUR A;  1RIP A;  3PUV A;  3VR2 A;  1X65 A;  1SDF A;  3E5S A;  4KKS A;  3CW2 C;  3IFT A;  3GTK B;  2JQO A;  3HOZ H;  4NDX A;  4BY7 B;  3QOJ A;  3M7G A;  1STA A;  3DWA A;  3L3O C;  1IBL L;  2XNA C;  4LF5 Q;  1NE3 A;  4BS9 A;  5H1S E;  1C9O A;  4POG A;  5GAG C;  2F4I A;  1UNS A;  5DM7 3;  3C3L A;  1N36 L;  1EU4 A;  1A2T A;  2R93 H;  1EOT A;  1X3P A;  2XWJ B;  2IWH A;  3KJO A;  1S5F D;  3PV0 A;  2YTY A;  4PMC A;  4HIK A;  3NTI A;  4YCV A;  1LTS D;  4DAP A;  3QIA A;  1PVO A;  1K83 H;  1CZW A;  1JOK A;  4RGO S;  3FEW X;  3UDX A;  3M4Y A;  1HQR D;  4GLA C;  3HKS A;  3CCE A;  2A6E D;  1MSH A;  2F0T A;  5JEA G;  1Z47 A;  1ENF A;  4WOR A;  2F0V A;  1WYD A;  1U4R A;  2DY7 A;  4LW1 A;  2C9O A;  1OTC A;  1L0W A;  2IX0 A;  2ZTE A;  1Q86 C;  1VS0 A;  4ZK9 B;  2OF1 A;  2PW5 A;  1F2Z A;  1TS4 A;  4M8A A;  2GVA A;  1PRT C;  3U58 A;  1EWI A;  1A3U A;  2FHT A;  5BN4 A;  1IBL Q;  3CD6 A;  2ICI A;  3F2B A;  3BJU A;  2Q2H A;  1ENC A;  3DHQ A;  3F2C A;  1Y1W G;  1Q46 A;  2WAC A;  3FMC A;  2Q2T A;  1N36 Q;  4C3I H;  1S5C D;  1MSG A;  1UE1 A;  2EYM A;  1EZ6 A;  4JI3 Q;  3RD4 A;  3SK8 A;  3KLR A;  3T13 A;  4DR4 Q;  2RDG A;  3KF8 B;  1WI5 A;  5I2X A;  4DUY L;  4NXN L;  3EQL C;  4A93 G;  1EUJ A;  2I5M X;  1SE4 A;  2NUC A;  4QUF A;  3KBX A;  2ZXP A;  3MVV A;  1L1O A;  1QE6 A;  3HOW H;  4DR1 L;  2B2U C;  3TP8 A;  1KD1 C;  4C1N I;  1CHQ D;  3W5O A;  4X3K A;  5C44 H;  4WFN 3;  3F1Z A;  2F4V L;  4RGN A;  3CU7 A;  4RCO A;  2N55 A;  1KDC A;  1Y69 U;  1BDO A;  2Z1C A;  3K81 C;  5C4X B;  4C1N K;  3BVG A;  4LF9 Q;  1AN8 A;  2RDF A;  2KBN A;  1MJE A;  1RHP A;  2XGT A;  3IAY A;  4FO2 A;  2F0P A;  1SRO A;  1GXD C;  2EY1 A;  1F2L A;  1ZKO A;  3JC6 6;  2M2L A;  1CA6 A;  3GD7 A;  1E2Z A;  2Q2I A;  4JBJ A;  4LNQ A;  1TU2 B;  3I4N B;  4DR7 L;  1K3R A;  4HJ7 A;  1A0I A;  1V1O A;  2OT2 A;  4LMQ D;  3PSI A;  3TEH B;  4R8N A;  1ILP A;  3A5Z B;  5L37 A;  2RKS A;  4DUY Q;  1LT3 D;  1M1K C;  3RZO H;  3ULP A;  2L15 A;  4KI0 A;  2F52 A;  4IOC A;  3CRL C;  3NQT A;  4LJZ C;  1Q1B A;  4OO1 H;  1TXY A;  2CH4 A;  1WD1 A;  1OXX K;  1KL9 A;  5C0X G;  1JJG A;  2L11 A;  1NUC A;  1TKW B;  3CQZ B;  4DR1 Q;  1G8Z D;  1IL8 A;  3UI2 A;  3UDI A;  4A3J H;  3LWE A;  4A3J B;  4LF4 L;  2RF4 A;  3NTH A;  3J7A V;  1XNQ Q;  1ASZ A;  1M4V A;  3NUC A;  4A3B B;  1G2T A;  1D6E C;  1NNX A;  1UAP A;  2F4V Q;  1O80 A;  2HT1 A;  5EBD A;  4WRD A;  2BOS A;  3T16 A;  5M5Y H;  4JOI C;  1ROD A;  1L2F A;  1TWH H;  3FPP A;  2LMC B;  1A3V A;  1TS2 A;  2N3S A;  1E3P A;  2QIL A;  4P2C B;  4DU9 A;  1HTP A;  5LMN Q;  1WCM G;  2Y0S B;  1JE4 A;  2EYO A;  2VW9 A;  1FGB D;  4DR2 L;  1EIF A;  1Y1V G;  4HIO A;  2L9H A;  1XX8 A;  1SMY C;  3C2P A;  4DR7 Q;  1KDA A;  5C0X I;  5CGK A;  2E74 C;  3PIO 3;  1G2S A;  2FMC A;  4LUO A;  1GO3 E;  1OXV A;  1RDP D;  1GD7 A;  2EYL A;  3I4L A;  5C3X A;  5GAH C;  4OL7 A;  1RD9 D;  4KKU A;  4B3S Q;  1EY7 A;  1HNZ L;  2UXB L;  2F0Q A;  1GUG A;  2RA4 A;  2ZXR A;  2QEJ C;  4P71 A;  4L5Q A;  4UHV A;  1QOH A;  3CME A;  4GLX A;  2HCI A;  1XPR A;  1YVC A;  3I73 A;  3CRK C;  5CV4 A;  1Z9F A;  4IJH A;  1TWA B;  5FK9 C;  3K7U C;  1PFS A;  3CCS A;  1HJP A;  2RSN A;  1Q90 A;  1S40 A;  3PUW A;  1GUW A;  3RLN A;  3I70 A;  3S2H H;  5K36 H;  4DNR B;  5I9O A;  2G9D A;  4ZQ3 A;  2K5N A;  4RFB A;  3EIV A;  3P7J A;  4CJ1 B;  2DGY A;  1IL2 A;  4GN4 B;  2R3Z A;  2EJM A;  3L2P A;  1HNX L;  1HFN A;  2FFK B;  5CV5 A;  1SMX A;  1FR3 A;  5LMU Q;  2RVL A;  2B2T A;  2F3V A;  3S1Q B;  1F2Y A;  4A75 A;  1PA6 A;  1IW7 C;  3I91 A;  1PH8 A;  3NEN A;  1I4H A;  4BXX H;  2EOT A;  1FNU A;  2A73 B;  3HOX B;  1JCK B;  1X9N A;  3P20 A;  3J81 j;  3MXP A;  3S17 B;  4A3E H;  4A3E B;  3W3A A;  5C3E H;  4X3U A;  1HNZ Q;  2UXB Q;  5J3B A;  2FMM A;  4MNO A;  2HD3 A;  3D4R A;  1XNR L;  2YV5 A;  3WWV A;  1SYC A;  5IOC A;  2X6G A;  1CKN A;  4DXF A;  5JPM C;  1B9N A;  3I4O A;  4A3F B;  2SNM A;  1T5X D;  4TQU S;  4C3J B;  2B2W A;  3TP6 A;  1DOK A;  5A2Q L;  1RCV D;  3LGJ A;  4H7B A;  4BBS G;  4IOA A;  4L5T A;  1QNU A;  1JQY D;  1EQT A;  2Y0S E;  2PZU A;  4JK1 C;  5EBC A;  4BA2 I;  3I55 A;  4IN3 A;  2EYJ A;  2I5L X;  2JEB I;  4K2L A;  5EJW A;  3I90 A;  1EIH A;  1XJV A;  1SND A;  3MXN A;  2F0H A;  1VDZ A;  4F88 A;  2CW0 D;  3CCU A;  2B2V A;  5CYU A;  5EQ0 A;  1SE8 A;  1RKN A;  2H4O A;  4JCV E;  3J80 L;  3I3C A;  2K14 A;  3A8I E;  2JA5 H;  4XQQ A;  1NR2 A;  4IFD J;  2FXQ A;  2PI2 E;  4KV6 A;  3T1H L;  3RN2 A;  1P8L A;  4MHE A;  2E2I B;  1OO9 B;  5I2Y A;  4CJ2 C;  1D1I A;  2QKI C;  1PDQ A;  4KHV A;  1II3 A;  3A56 A;  2B63 B;  5FOB B;  1J5E Q;  1L1O B;  2K52 A;  3KOJ A;  2KEE A;  2EZV A;  1LTG D;  5NUC A;  2RCN A;  1HPC A;  2N8N A;  2M9V A;  1YHA A;  5I6W A;  3DEP A;  2Z6K A;  2R7Z B;  2Z6B A;  4HR7 B;  3KYH C;  5M9O A;  2F3W A;  4DAY A;  1GHK A;  2UXC L;  2RDH A;  4A3M G;  5HGT A;  4QF4 A;  4K6D A;  4MZ9 A;  1YIT A;  1D5M C;  1E1T A;  4JI8 L;  1E2V A;  3K57 A;  3HOY H;  1JT8 A;  2F0J A;  3TP7 A;  3GTJ H;  3GTJ B;  1BO0 A;  1LTA D;  2MGS A;  3PUY A;  2Z4I A;  3S9W A;  4DV4 L;  1X55 A;  4WJ3 M;  1B8A A;  3SXH A;  5D3D A;  4YWK A;  4A3C H;  2JE6 I;  5JVG 3;  4FXK C;  4JVZ A;  1PFB A;  4A4I A;  3VA7 A;  1QVC A;  4A3D B;  4LF7 Q;  1QNK A;  5EPL A;  3OTO L;  2NZ1 D;  3S14 H;  1EYA A;  3N52 A;  3NBH A;  3HKZ B;  4LF6 L;  3X3M A;  3IFD A;  1AFP A;  1Q8K A;  3E9H A;  1Q81 C;  2R92 H;  1RTN A;  2X6L A;  2OTJ A;  2RHQ B;  5LMN W;  4U67 3;  4DAM A;  1BUV T;  3IKJ A;  1RL2 A;  1VQ9 A;  2J4X A;  4KLK A;  4J8Q A;  5T1I A;  3HOZ G;  2JSO A;  2MHV A;  2ZJR A;  2KCC A;  2F0M A;  4OEM B;  5FJ8 H;  4N9T A;  4RHS A;  2UXC Q;  4ME5 A;  1DZ1 A;  2K50 A;  3T51 B;  1KAB A;  4NB3 A;  1D2B A;  3EJI A;  1KRS A;  2R93 G;  3GO5 A;  4G7H C;  1Y8O B;  4DV4 Q;  3NSW A;  2MJ8 A;  1HUM A;  3MFG A;  2EPB A;  4AYB G;  3M4O H;  3M4O B;  3GTO H;  1YNN C;  2DN8 A;  4DA2 A;  3PIO A;  3CP0 A;  3VR5 A;  1WTX A;  1K0R A;  2JP1 A;  4RH6 A;  2QF7 A;  1B44 D;  5T1G A;  3DXJ C;  1S4Z A;  3KBG A;  5C4J B;  3GDE A;  2R6G A;  2XRS D;  4GS3 A;  2ZXO A;  1T5E A;  3J7A 5;  1G29 1;  3H0G H;  3H0G B;  4PNY A;  4QCL A;  2O5I C;  4L8J A;  3MZ5 A;  2YU9 B;  2FIN B;  1PTO C;  1O7L A;  1M8A A;  3EBE A;  2PCF B;  1LO5 D;  1PTO H;  1WTQ A;  2BCO A;  5COY A;  3C1F A;  3CAM A;  3PUX A;  3A8J E;  5F2D A;  2VB3 X;  4PV1 C;  4GLV B;  4P72 A;  4RAU C;  4KN4 C;  1PYB A;  4H0L C;  1PH3 A;  4OX9 L;  2OTL A;  2J0T D;  1IBM L;  2UUA L;  3C46 A;  1X3Q A;  1ONL A;  4C3I G;  1NCV A;  4IUT A;  1SBB B;  1QG7 A;  1RJT A;  1DCZ A;  1YHB A;  3R2I A;  1VQB A;  5IGB A;  1B70 B;  5E7N A;  3NWT A;  3HKZ E;  5TSS A;  5IY0 A;  1N34 L;  2KCM A;  4XTC S;  4X65 Q;  4BY1 B;  1O7I A;  3FDT A;  1LM0 A;  3S1N B;  1VQP A;  1TWF H;  5C6A A;  1KNA A;  3ZYY X;  5IWA L;  1AZP A;  3HOW G;  4PZ7 A;  5GQO A;  2NVT B;  4NXM L;  4XDX A;  3BZK A;  2YTV A;  5C44 G;  4YHH L;  1BVS A;  3J81 E;  4JI7 L;  2CQO A;  4R4Q A;  2IW3 A;  5ELC A;  1KQS A;  2N88 A;  3QOL A;  1IHZ A;  1BQQ T;  1GJX A;  5EGT A;  2B2W C;  1XTC D;  5M5W H;  2CWP A;  1FGU A;  2EYF A;  2WP8 J;  3MA2 B;  3ERO A;  4IUQ A;  1I94 L;  1TWC B;  2KA7 A;  1I3Q B;  4DNT B;  3I8Z A;  3PO2 H;  4HJ5 A;  4I7A A;  2PQA B;  5E4W C;  1IBM Q;  2O4X A;  3T53 B;  2DY8 A;  3K0X A;  1VQ8 A;  5C5M A;  2UUA Q;  2B2V C;  4DR5 L;  1L0X B;  1YJN A;  1SFO H;  1AH9 A;  2XRQ D;  2ZTD A;  3MXN B;  1JIC A;  5FLX L;  2JA6 B;  2XN9 C;  3ND9 A;  2SDF A;  3NQI A;  4RGT A;  1TR5 A;  4DR6 L;  3RMH A;  1JC7 A;  5E3F A;  1YEZ A; 
#chains in the Genus database with same CATH homology
 4IUV A;  1IW7 D;  3FKI B;  4M1U B;  3HGB A;  3CKI B;  2JXM B;  1ZYR D;  2A68 D;  4OO1 G;  1TS3 A;  5I6Y A;  3FRP B;  1TS5 A;  3GTG B;  2R61 A;  1B2T A;  1PYW D;  5FO9 B;  2Q8R E;  1Q12 A;  3EVQ A;  1ESR A;  1EZ8 A;  1EWC A;  2EXZ A;  3M7N A;  2L12 A;  3JAM E;  1LTI D;  3PIP 3;  2KJX A;  1U4P A;  2EYH A;  1EEI D;  2EYP A;  3HS0 C;  4LAA A;  1B53 A;  4FVM A;  3GTM B;  3T4A C;  2B8F A;  1ZXT A;  4OO1 I;  1QWY A;  5CV6 A;  4ABN A;  5D3I B;  4XIG S;  4HSP A;  2RSO A;  4PMB A;  3TN2 A;  1HRJ A;  3ND8 A;  3D6C A;  4DK0 A;  3V96 A;  1SYG A;  1GUO A;  1O7Z A;  3I72 A;  5ELD A;  3BVM A;  5M3F B;  4A3I B;  2D2C C;  5IIF A;  1FYC A;  4HCE A;  2K6A A;  3GTL B;  2D5D A;  3GV6 A;  1DXM A;  3MC0 B;  5K36 G;  4BA1 I;  4OIK A;  1V8Q A;  4QIW B;  4Q0F A;  2JA7 B;  1C48 A;  2J7Z A;  2NVY B;  1LT6 D;  2O5J C;  1I4Q A;  3MTS A;  1F9R A;  1LT5 D;  5LHY 1;  4GZY C;  1U4M A;  4I7Z C;  1R4P B;  1CI3 M;  4EQO A;  1EY9 A;  2K33 A;  2WAQ B;  3Q24 A;  1MGS A;  2F0G A;  1UEA B;  2NN6 I;  2AWO A;  5CBE E;  1PZK D;  1Y8N B;  1PZJ D;  5G3L D;  3K7A B;  2OXP A;  5I4D A;  4C3J G;  2E2J B;  2K5W A;  5IGC A;  2D62 A;  2L5T A;  2E2H B;  1GUS A;  1HA6 A;  4RGM A;  2Z8L A;  4KHZ A;  1I6V C;  2L4N A;  2F0F A;  2H1E A;  4A3G B;  2BE5 C;  3KLS X;  3OMG A;  2EJG C;  3LWU A;  2JA8 B;  3PUZ A;  1KLG D;  3ITP A;  3HOU B;  1SYE A;  3LNN A;  4L6T B;  2SNS A;  5FO7 B;  3GTP B;  4C2M B;  1EY6 A;  1YNJ D;  3FVQ A;  2PQE A;  3RZD B;  4BBR B;  5I9P A;  2WII B;  2TSS A;  3ONA B;  1STY A;  1JR0 D;  2IT1 A;  3GTQ B;  2SOB A;  1J8I A;  4L63 B;  4DGZ A;  3SE0 A;  1GOZ A;  4CGY B;  5D65 A;  2B8G A;  1A6X A;  3SVM A;  1CK1 A;  4CKB A;  4K5W A;  4IUU A;  4Z9C B;  1SAP A;  1W6J A;  3K0Y A;  1A15 A;  1BCP F;  2E76 C;  2IX3 A;  4HMI A;  4EQN A;  2L1B A;  1Y8P B;  2HUG A;  4A3K B;  3DEO A;  3TDQ A;  3NP8 A;  2IL8 A;  4S3S A;  2X69 A;  2KQ3 A;  5A35 A;  3TZD A;  3I4M B;  2PZW A;  2NYZ D;  1RF2 D;  3SEB A;  3T56 B;  1RTO A;  5IGE A;  2K28 A;  3U9S A;  1SYB A;  1EY4 A;  1VF5 C;  1TII D;  5IGG A;  3R2T A;  4OIJ A;  4KKT A;  5KYL A;  3DM1 A;  3V2T A;  5AFW A;  2XIW A;  1CFM A;  1MI2 A;  3MAQ A;  1STN A;  4U68 A;  2C5C A;  3QB3 A;  3WOF A;  3EA6 A;  2NN6 H;  1F9P A;  4QB4 A;  3TME A;  4O1N A;  3OHX C;  1GUT A;  1LTT D;  3KLS A;  1PRT F;  1MD2 D;  1QJO A;  1R9T B;  1BCP D;  5JEA J;  3D8G A;  5HUR A;  4HSV A;  3N6R A;  4IZ8 A;  3KUP A;  2KVM A;  2YYZ A;  2A69 C;  3HOV B;  3RLF A;  1SNM A;  3K6O A;  3HEJ A;  4ID6 A;  5DM6 3;  1SNP A;  2HQE A;  4UDU C;  4J6H A;  1Y1W B;  4FF2 A;  3VYR A;  1TT2 A;  2K05 A;  5KEE A;  4LK1 C;  1HA5 A;  1EY8 A;  5EKK A;  2KED A;  1BNZ A;  4MN3 A;  3OSO A;  3OMC A;  3PO3 B;  4QUC A;  1PXU A;  2NTS A;  5M5X B;  4IFD H;  2ID0 A;  4B9W A;  1SNQ A;  4KN7 C;  1F9S A;  1W6K A;  3J80 E;  4HAE A;  5IT9 E;  3K5N A;  2V4D A;  3DUZ A;  1ML0 D;  3E6Z X;  2G9H D;  1KAA A;  4XT3 B;  2XVS A;  3Q23 A;  1NSN S;  2VNU D;  2HDL A;  1PRT D;  1LLR D;  3X3N A;  1PLF A;  3RUZ A;  2OEO A;  1D5X C;  4IUN A;  1L0Y B;  3TSS A;  1B9M A;  3DMU A;  3G6J B;  1ICW A;  1AZQ A;  1CQV A;  3WDN A;  2A6E C;  2EY5 A;  3H3V C;  4HCS A;  4XQJ A;  4CJ0 B;  3A7L A;  5BN3 A;  3P75 A;  4TKO B;  2F03 A;  3S2D B;  5C0X J;  2A6H C;  4HED A;  1DOM A;  4YIJ A;  4FF3 A;  3QG1 A;  4O42 A;  3SK5 A;  5DEH A;  2BA1 A;  2F0L A;  5D14 A;  1HXY D;  4EGV A;  1JOQ A;  4DAV A;  2EY2 A;  1Q3L A;  1FNW A;  1JWS D;  3S1R B;  1HQM C;  1U9R A;  1BF4 A;  1SNC A;  1WCM B;  1DJR D;  3W2D A;  4XYO A;  4UAI A;  4FXG C;  4RKL A;  4K5X A;  2CQA A;  5LL6 S;  3M3Y B;  3HP3 A;  1JOR A;  5KYI A;  2NVX B;  3M85 A;  1I50 B;  1WVL A;  5KGU A;  1QIL A;  2PO4 A;  2CHB D;  1ET6 A;  4NP5 A;  4FF1 A;  4C3H B;  5CV8 A;  3K5L A;  3SK6 A;  4CBV A;  4OHJ A;  4G4K A;  4KMU C;  1WTO A;  3S15 B;  2KCN A;  2XWB B;  1DD2 A;  5JVH 3;  5KIX A;  3A54 A;  2L55 A;  1I6H B;  3OW7 A;  2F0U A;  4X3S A;  4R9W A;  4ZAI A;  3Q0A A;  1SMY D;  1S5E D;  3A55 A;  2EY6 A;  2KOL A;  2B2T C;  2F0S A;  4DXG A;  4KD4 A;  2F0D A;  1GUN A;  2WV6 D;  3AB9 A;  4ZRZ A;  2B2U A;  1F9Q A;  2NVQ B;  3NXW A;  2KEC A;  5E4X A;  3C1E A;  3Q22 A;  1TY2 A;  2I07 B;  1KDB A;  3LX0 A;  1F2M A;  1LTR D;  4BBS B;  4PQX A;  2O2L D;  1H9J A;  3K58 A;  3OPO A;  3BVZ A;  1EIG A;  2K03 A;  2NWG A;  3TP5 A;  5M3M B;  4WJW A;  1D5Z C;  2NBF A;  1LAB A;  4CKE A;  1XWE A;  2TMP A;  1C4Q A;  4BWG B;  3HRZ C;  1B3A A;  3VYU A;  3A8K E;  3VR6 A;  1MBY A;  3F2U A;  1F77 A;  1X32 A;  3D6W A;  4V19 0;  1QB5 D;  2ICE C;  4A3M B;  1VF7 A;  3BDO A;  4OGQ C;  1JWM D;  3P1H A;  2NB0 A;  3D4W A;  2VUM B;  2AUJ D;  2RQX A;  5IOD A;  1HTL D;  1IYV A;  1AW7 A;  1XYI A;  1PMR A;  3D4D A;  1HUN A;  1EYD A;  3JAM L;  5CR3 A;  4KTA A;  1C8C A;  4G7O C;  1XXG A;  1TQO A;  4XXE A;  5G3L F;  1BCP B;  1B1Z A;  1ENA A;  1VMP A;  5KNB A;  3OWE B;  1ET9 A;  5EKI A;  4MIU A;  2M00 A;  1JB3 A;  2DNC A;  2LKV A;  2RBM A;  4N9P A;  1CA5 A;  3HOZ B;  3TBI B;  1O7Y A;  2L0C A;  5JAV A;  1DON A;  1SSO A;  4NW2 A;  5K5P A;  4ZLT F;  1I4P A;  2R93 B;  1IKM A;  4AYB B;  4XQN A;  2B2Y A;  4DF7 A;  2NN6 G;  1AP0 A;  3AU7 A;  1PTO F;  2CW0 C;  1K83 B;  5E1F A;  3MWY W;  1H9S A;  4KD3 A;  1SE2 A;  1HHV A;  4C56 C;  2HCC A;  1VCI A;  2F1M A;  3SR1 A;  5C4H A;  2F0N A;  3ERQ A;  1R4Q B;  1H9K A;  2A6H D;  5EPK A;  3R8B A;  4KJO A;  1IYU A;  2ZT9 C;  4F7X A;  1EU3 A;  2E75 C;  4QMG A;  1D1K A;  1Z7T A;  4HTH A;  1QCB D;  5CV7 A;  5C5L A;  5C3W A;  2LY7 A;  1PRT B;  1EY5 A;  3IL8 A;  1A2U A;  4C3I B;  1LTB D;  5J39 A;  1KTK A;  1S5D D;  2WKD A;  2LFN A;  5CMD A;  4KY5 A;  1YNN D;  3VR3 A;  2WKC A;  3DWP A;  4IFD G;  1CTM A;  1S5B D;  3URY A;  1EFI D;  3HOW B;  1EYC A;  2AQ3 B;  4K8I A;  5C44 B;  1PTO D;  2MUY A;  1G91 A;  3V05 A;  1V43 A;  4NKL A;  3AMU A;  1WTV A;  4H44 C;  3J7Y W;  1LV9 A;  2AUK A;  2JEA I;  3MHB A;  1EQV A;  1WD0 A;  1G6Z A;  1E2W A;  2K1B A;  3H6M A;  2AQ1 B;  4IFD I;  4NMZ A;  1WTP A;  1HFG A;  3MFY A;  4FP5 D;  3QJY A;  5ELF A;  2F0W A;  4RA8 A;  3RZO B;  4PMW A;  4TSS A;  1J9O A;  1VMC A;  1Q8I A;  1GHJ A;  2BA0 A;  3O13 A;  2PYK A;  4X3T A;  2QCP X;  2VB2 X;  2CVR A;  1PFM A;  4HMJ A;  1WTW A;  4Y7N B;  5DAU A;  1CT1 D;  1I4X A;  3SK4 A;  1CZG A;  1LAC A;  5M5Y B;  2BDN A;  3K5M A;  2PNR C;  2F0E A;  2D9U A;  1TWH B;  2KHS A;  5ELE A;  1CM9 A;  4B9X A;  2IX1 A;  2AWN A;  2IJ0 A;  5J1Z A;  2IPK D;  5LL6 X;  2I46 A;  3TZU A;  2NTT A;  3SDZ A;  3NK9 A;  3PMF A;  1KNE A;  3BZD B;  4KJN A;  4EQP A;  3R3O A;  2K32 A;  4RHR A;  1EY0 A;  2JYO A;  1V1P A;  4V0B A;  4ZYS A;  1HCZ A;  5ELB A;  5EKL A;  1BR9 A;  3K59 A;  3Q6S A;  4C3H G;  1Q1E A;  1EL0 A;  5JEA H;  1Z6H A;  4TRD A;  4G57 A;  3EFX D;  4F8M A;  3S2H B;  1LT4 D;  1STG A;  4ZKC B;  1OXU A;  1NAP A;  2E2D C;  2HDM A;  2B2Y C;  2VXW A;  3OIP A;  3WOE A;  4HN7 A;  5J22 A;  3BDL A;  5KNC A;  1I4G A;  1KLU D;  1DM0 B;  1H9S B;  1JOO A;  2GA4 B;  1ZEQ X;  4IUP A;  1H9M A;  4K6L A;  2K01 A;  2PW7 A;  2EVB A;  2SEB D;  3MXG A;  1SNO A;  1ZYR C;  2A68 C;  4FNF A;  1SYD A;  5C3E B;  3U9O A;  5A2Q E;  5KND A;  3VR4 A;  4DFA A;  4FXD A;  3BS1 A;  4B08 A;  4EVO A;  4A93 B;  3VA5 A;  1EEF D;  3MEH A;  5EPJ A;  1A3T A;  1O78 A;  3BYT B;  2PPB C;  1B50 A;  4DN4 M;  5ISR A;  3G7L A;  1I4R A;  5CV9 A;  3H91 A;  2EE1 A;  1OXS C;  4IQZ A;  5IT9 L;  2JA5 B;  4H13 C;  1AEX A;  1TVX A;  2FJ2 A;  2BDO A;  3GP7 A;  4G7Z C;  4DK1 A;  5FO8 B;  3DWQ A;  1STB A;  1STH A;  1NR4 A;  2EDG A;  4KY6 A;  1BXT A;  2XSC A;  3NTK A;  2MPM A;  3QO2 A;  4K14 A;  4RWS C;  3H09 A;  3HOY B;  1PZI D;  5C0X H;  3L7Z C;  2Z4H A;  4F87 A;  3BDC A;  1H9R A;  2AQ2 B;  4K5V A;  2Q8I B;  3GQB A;  4KY7 A;  3R93 A;  4XYQ A;  3VYS A;  1STE A;  4ZKB B;  2BE5 D;  3S14 B;  3NPP A;  1ILQ A;  4I65 A;  2A74 C;  1BBX C;  2R92 B;  1Y1V B;  1K8O A;  3NE5 B;  3E0J A;  5IGF A;  1PFN A;  1JWU D;  3KK7 A;  4JBW A;  4FYD A;  3MXU A;  4E6I A;  1E0B A;  4CKC A;  5BN5 A;  1DOL A;  5IGD A;  4ULL A;  5COR A;  3QWN A;  3VYT A;  1CQF A;  3GTO B;  1EWH A;  5JJZ A;  3BYY B;  3J7A F;  1SXT A;  2K5D A;  2LS0 1;  1DYQ A;  2EJF C;  4ZUI A;  4Q5V A;  5FKA C;  1SJH D;  3OOC A;  3OIQ A;  3FPU B;  5C4Z A;  3HZX A;  2KUM A;  1V1P B;  5CBA E;  1YNJ C;  3KF8 A;  4IAL A;  1PTO B;  1WTR A;  2PZT A;  4J1M A;  3K5O A;  5CC4 A;  2PMZ B;  3NHH A;  4RKB A;  3OWF A;  4KK7 A;  2WB1 B;  1FNV A;  1UUP A;  4RCN A;  1TY0 A;  1FD7 D;  2Q8T A;  3NWS A;  2DNE A;  1TWF B;  3J81 L;  2F0K A;  1B4O A;  4ZUJ A;  1U4L A;  3CHB D;  3D31 A;  1ESF A;  3HG9 A;  2A5H A;  5M5W B;  2QDB A;  3L9A X;  5FLX E;  1BOS A;  4FF4 A;  3PO2 B;  1SJE D;  2K04 A;  2A69 D;  5JPN C;  4ODG A;  1SFO B;  1IKL A;  3BG3 A;  1SYF A;  3NBI A;  2F0I A;  1CHP D;  5JOB A;  2F0O A;  1OXT A;  3A7A B;  3S1M B;  2K7V A;  2B39 A;  2ENB A;  4K8J A;  3GV3 A;  1K8M A;  3S16 B;  1SE3 A;  5DNF A;  5KRU A;  1TWG B;  1BCP C;  2MP1 A;  3H94 A;  1SEB D;  4K2K A;  3D3R A;  4ILW A;  4XT1 B;  3SHL A;  4R8I A;  2K5Q A;  2WIN B;  4CHT B;  4IUR A;  3PUV A;  3VR2 A;  1SDF A;  3E5S A;  4KKS A;  3IFT A;  3GTK B;  4NDX A;  4BY7 B;  3QOJ A;  3M7G A;  1STA A;  3DWA A;  3L3O C;  2XNA C;  4BS9 A;  2F4I A;  1UNS A;  5DM7 3;  3C3L A;  1EU4 A;  1A2T A;  1EOT A;  1X3P A;  2XWJ B;  2IWH A;  1S5F D;  3PV0 A;  4PMC A;  3NTI A;  1LTS D;  4DAP A;  3QIA A;  1CZW A;  1JOK A;  4RGO S;  3FEW X;  3M4Y A;  1HQR D;  2A6E D;  1MSH A;  2F0T A;  5JEA G;  1Z47 A;  1ENF A;  4WOR A;  2F0V A;  1U4R A;  2DY7 A;  2C9O A;  2IX0 A;  4ZK9 B;  2OF1 A;  2PW5 A;  1F2Z A;  1TS4 A;  4M8A A;  1PRT C;  1A3U A;  2FHT A;  5BN4 A;  2ICI A;  3DHQ A;  1ENC A;  2WAC A;  3FMC A;  1S5C D;  1MSG A;  2EYM A;  1EZ6 A;  3RD4 A;  3SK8 A;  3KLR A;  3T13 A;  2RDG A;  5I2X A;  3EQL C;  1SE4 A;  2NUC A;  4QUF A;  3KBX A;  2ZXP A;  3MVV A;  1QE6 A;  2B2U C;  3TP8 A;  4C1N I;  1CHQ D;  4X3K A;  4WFN 3;  4RGN A;  3CU7 A;  4RCO A;  2N55 A;  1KDC A;  1Y69 U;  1BDO A;  2Z1C A;  5C4X B;  4C1N K;  3BVG A;  1AN8 A;  2RDF A;  1RHP A;  3IAY A;  4FO2 A;  2F0P A;  1GXD C;  2EY1 A;  1F2L A;  1ZKO A;  2M2L A;  1CA6 A;  3GD7 A;  1E2Z A;  1TU2 B;  3I4N B;  1V1O A;  2OT2 A;  4LMQ D;  4R8N A;  1ILP A;  2RKS A;  1LT3 D;  4KI0 A;  3CRL C;  3NQT A;  4LJZ C;  1Q1B A;  4OO1 H;  1WD1 A;  1OXX K;  5C0X G;  2L11 A;  1NUC A;  1TKW B;  3CQZ B;  1G8Z D;  1IL8 A;  3UI2 A;  4A3J B;  3LWE A;  3J7A V;  3NTH A;  1M4V A;  3NUC A;  4A3B B;  1G2T A;  1D6E C;  1UAP A;  1O80 A;  5EBD A;  4WRD A;  2BOS A;  3T16 A;  1ROD A;  3FPP A;  2LMC B;  1A3V A;  1TS2 A;  2QIL A;  4P2C B;  4DU9 A;  1HTP A;  2Y0S B;  1JE4 A;  2EYO A;  1FGB D;  2L9H A;  1XX8 A;  1SMY C;  3C2P A;  1KDA A;  5C0X I;  5CGK A;  2E74 C;  3PIO 3;  1G2S A;  2FMC A;  1OXV A;  1RDP D;  2EYL A;  3I4L A;  5C3X A;  4OL7 A;  1RD9 D;  4KKU A;  1EY7 A;  2F0Q A;  1GUG A;  2RA4 A;  2ZXR A;  2QEJ C;  1QOH A;  2HCI A;  3I73 A;  3CRK C;  5CV4 A;  1TWA B;  5FK9 C;  2RSN A;  1Q90 A;  3PUW A;  1GUW A;  3I70 A;  5K36 H;  4DNR B;  5I9O A;  2G9D A;  4ZQ3 A;  4RFB A;  3P7J A;  4CJ1 B;  2R3Z A;  2EJM A;  1HFN A;  2FFK B;  5CV5 A;  1FR3 A;  2RVL A;  2B2T A;  2F3V A;  3S1Q B;  1F2Y A;  1IW7 C;  3I91 A;  1I4H A;  2EOT A;  1FNU A;  2A73 B;  3HOX B;  1JCK B;  3P20 A;  3MXP A;  3S17 B;  4A3E B;  3W3A A;  4X3U A;  2FMM A;  3D4R A;  1SYC A;  5IOC A;  2X6G A;  4DXF A;  5JPM C;  1B9N A;  4A3F B;  2SNM A;  1T5X D;  4TQU S;  4C3J B;  2B2W A;  3TP6 A;  1DOK A;  5A2Q L;  1RCV D;  4H7B A;  4JK1 C;  1QNU A;  1JQY D;  1EQT A;  4BA2 I;  2PZU A;  5EBC A;  4IN3 A;  2EYJ A;  2JEB I;  4K2L A;  5EJW A;  3I90 A;  1EIH A;  1SND A;  3MXN A;  2F0H A;  1VDZ A;  4F88 A;  2CW0 D;  2B2V A;  5CYU A;  5EQ0 A;  1RKN A;  2H4O A;  3J80 L;  3I3C A;  3A8I E;  4XQQ A;  1NR2 A;  4IFD J;  4KV6 A;  4MHE A;  2E2I B;  1OO9 B;  5I2Y A;  4CJ2 C;  1D1I A;  2QKI C;  1PDQ A;  4KHV A;  1II3 A;  3A56 A;  2B63 B;  5FOB B;  2KEE A;  2EZV A;  1LTG D;  5NUC A;  1HPC A;  2M9V A;  5I6W A;  3DEP A;  2R7Z B;  4HR7 B;  5M9O A;  2F3W A;  4DAY A;  1GHK A;  2RDH A;  5HGT A;  4QF4 A;  4K6D A;  1D5M C;  1E2V A;  3K57 A;  2F0J A;  3TP7 A;  3GTJ B;  1BO0 A;  1LTA D;  2MGS A;  3PUY A;  2Z4I A;  3S9W A;  3SXH A;  5D3D A;  2JE6 I;  5JVG 3;  4FXK C;  1PFB A;  3VA7 A;  4A3D B;  1QNK A;  5EPL A;  2NZ1 D;  1EYA A;  3N52 A;  3NBH A;  3HKZ B;  3X3M A;  3IFD A;  1AFP A;  1RTN A;  2X6L A;  4U67 3;  1BUV T;  3IKJ A;  2J4X A;  4J8Q A;  5T1I A;  2JSO A;  2MHV A;  2KCC A;  2F0M A;  4N9T A;  4RHS A;  4ME5 A;  1DZ1 A;  3T51 B;  1KAB A;  1D2B A;  3EJI A;  3GO5 A;  4G7H C;  1Y8O B;  3NSW A;  2MJ8 A;  1HUM A;  3MFG A;  2EPB A;  3M4O B;  1YNN C;  2DN8 A;  4DA2 A;  3VR5 A;  1WTX A;  2JP1 A;  4RH6 A;  2QF7 A;  1B44 D;  5T1G A;  3DXJ C;  1S4Z A;  3KBG A;  5C4J B;  2R6G A;  2XRS D;  2ZXO A;  1T5E A;  1G29 1;  3H0G B;  4PNY A;  4QCL A;  2O5I C;  4L8J A;  3MZ5 A;  2YU9 B;  2FIN B;  1PTO C;  1O7L A;  1M8A A;  2PCF B;  1LO5 D;  1PTO H;  1WTQ A;  2BCO A;  5COY A;  3C1F A;  3PUX A;  3A8J E;  5F2D A;  2VB3 X;  4PV1 C;  4RAU C;  4KN4 C;  4H0L C;  2J0T D;  3C46 A;  1X3Q A;  1ONL A;  4C3I G;  1NCV A;  4IUT A;  1SBB B;  1QG7 A;  1RJT A;  1DCZ A;  3R2I A;  5IGB A;  3NWT A;  5TSS A;  4XTC S;  4BY1 B;  3FDT A;  3S1N B;  5C6A A;  1KNA A;  3ZYY X;  1AZP A;  2NVT B;  4XDX A;  3J81 E;  2IW3 A;  5ELC A;  2N88 A;  3QOL A;  1IHZ A;  1BQQ T;  1GJX A;  5EGT A;  2B2W C;  1XTC D;  2EYF A;  2WP8 J;  3MA2 B;  3ERO A;  4IUQ A;  1TWC B;  2KA7 A;  1I3Q B;  4DNT B;  3I8Z A;  5E4W C;  2O4X A;  3T53 B;  2DY8 A;  5C5M A;  2B2V C;  1L0X B;  2XRQ D;  5FLX L;  2JA6 B;  1JIC A;  2XN9 C;  3ND9 A;  2SDF A;  3NQI A;  4RGT A;  1TR5 A;  3RMH A;  1JC7 A;  5E3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...