5E7NA

Crystal structure of rpa70n in complex with vu0085636
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Identification and Optimization of Anthranilic Acid Based Inhibitors of Replication Protein A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/inhibitor
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5e7nA00
4RMFA 4DR3L 5C4XG 1J5EL 4A3MG 3RZDH 5FLXc 2XTIA 2OQ0A 2RHQB 1W2BA 3JC66 1VQLA 5BR8L 2UUAL 3PIOA 3OTOQ 2UUCQ 4JI0Q 3AFPA 2JA8G 3HOVG 2VS1A 4DR7Q 5IP7H 2MQHA 4BA2I 4POGA 2JE6I 2MNAA 2OCEA 1WYDA 4IFDG 1L1OB 3AFQA 5IYBH 4A3CH 4HJ8A 1TWAH 4L5RC 3GTLH 1C9OA 1JE5A 1C7YA 5IY0A 1OXUA 2K14A 1KL9A 3K8AA 3NELA 1PVOA 3K7UC 2E2JH 2FXQA 3J81c 1EQRA 2YTYA 1YZ6A 2ID0A 2Q2HA 4JCVE 5IP7G 2Z6KC 1UWVA 1MKHA 3UDXA 3A5UA 4DR2Q 4LF4Q 1K9MC 3CCMA 4UY8C 5M5XH 4P74A 2OWOA 4A3CG 4X65Q 3BZCA 5C0XI 4DV3L 3RLOA 1YI2A 4JBKA 4H02A 1G51A 1N36L 3M4OH 2N49A 1YJNA 4X64Q 2EQSA 3Q8DA 1X54A 2BA0A 3I4MH 4DUYQ 4BBSH 2JA6H 1X3EA 1OXXK 4A3BH 4L5TA 1JT8A 3I7FA 3BZKA 5GAHC 1CUKA 2R92H 3S16H 4A76A 4DR1Q 3GTPH 3M4QA 4GKKQ 3KFUA 3H15A 3PIPA 2B29A 4GS3A 4KHPQ 3I4MG 2UXDL 3TREA 1D8LA 1HZ9A 3ICEA 4RG1A 1PH4A 3F8TA 2I0QA 2JA6G 4A3BG 3CXCA 1PV4A 3L2PA 2R92G 4KHZA 1Q46A 4LUVA 5AJ3Q 3W1GA 5IP9H 2C35B 5JEAJ 4DV7Q 4LF6Q 1VQOA 3HOZG 4GKJQ 2R7FA 2ZTDA 1YJWA 1CSQA 4B3RL 4GNXA 1VQ6A 1NMGA 4JI7L 4LF8Q 4R4CA 3KLWA 3KF6A 5C44H 4HJ5A 1N33Q 4B3MQ 4IJHA 4JI5Q 1QVCA 2LSSA 3HFZB 4GN3B 5ELNA 1YEZA 1QUQB 3HOYH 1QZGA 1E3PA 1VS0A 4POFA 3CCSA 3OTOL 2V1CC 4A4IA 4HIMA 1PH9A 2ZJQA 4JI0L 1Y1WH 1I50H 1YHBA 1VQHA 5HGQA 3U58A 2JA7G 4LF9L 4DNIA 5C44G 4LF7L 4LFBQ 3AQQA 3H0GG 5FLMH 3G71A 4QL5A 2UUBL 2DGYA 2VW9A 4JBMA 1CSPA 4DV2Q 1BBWA 1PH8A 4B3TQ 2R7DA 3HOYG 3PF4A 2Y0SG 5JJIA 3CCLA 3ERSX 1SFOH 3JAMc 4A3IH 4DV0Q 1FJGQ 1E24A 2VQEL 4L5QA 5H1SE 4DR2L 1Q7YC 2N3SA 2VZAA 3IRBA 4LF4L 3H3VI 4IOAA 2VUMH 1K3RA 1TXYA 2K50A 2OTLA 3TRZA 3A0JA 4X65L 5LMNW 4OWWB 4YHHQ 2KENA 2VL6A 1NTGA 1BBUA 4HIOA 3PGZA 3W5OA 1VQ8A 2Q2TA 1N32Q 4JI1Q 2XGTA 3ULJA 1S72A 3T1YL 4C3HH 1RL2A 1VQAA 1YNXA 1PYBA 3SGIA 4A3IG 2UU9Q 4B3SQ 4X64L 3A5ZB 4GNXC 1XPOA 2E2IH 1U0LA 2QA4A 1I94Q 4JG2A 4JV5Q 4IPGA 2MO0A 1L0WA 1VQ7A 5M5WH 3M85A 1A0IA 2BH8A 2IT1A 5M5YH 4J15A 4DUZQ 1B70B 1IBLQ 2ATWA 3F2DA 1UE6A 4PZ7A 4DR1L 4A3EG 1PH5A 4GKKL 3CC7A 3M7NA 3J80c 2UXCL 4KHPL 3EN2A 4DV5Q 3S1QH 1GD7A 2YTXA 2D0PA 1IXRA 5C4XH 4A3MH 3GDEA 5AJ3L 1YHQA 4NB3A 4DV7L 2E5LL 4GKJL 2NN6I 1AH9A 3LGJA 1PYSB 2KBNA 2A8VA 1YVCA 5IWAQ 1WI5A 4LF8L 1E22A 2YTVA 1N33L 1XNRL 3U50C 4WJ4A 3CC2A 3KF6B 4JI5L 4HIDA 4JI4Q 2LXJA 4QQBX 2UXDQ 3S14H 3ER0A 5JEAG 3FHWA 1JJCB 3PF5A 1K0RA 1KIXA 3KJOA 3GTMH 1HZAA 4O2DA 3DLLA 1VQ9A 3CQZH 2NVXH 2A19A 3GTQH 4A3GH 1XMOQ 3E0EA 5C0XG 1N34Q 3CCJA 4JI3Q 1X55A 4DR4Q 1VQCA 3J81j 4LFBL 1BKBA 4DV2L 4EQ5A 4IJLA 4B3TL 1X3GA 1X56A 2CFMA 2E8GA 5C3EH 2WAQG 4IPCA 1S40A 4IPHA 3J81i 1X9NA 4P73A 4DV0L 2NVQH 4AYBG 1AE2A 1UE7A 4JI2Q 4MNOA 3GTGH 2K5HA 4A3GG 1M1KC 4DV6Q 1HNWQ 4JYAL 4LWCA 4XIGS 3I4OA 1IZ6A 1X6OA 4YHHL 1AE3A 3PV0A 1VQEA 4K0KQ 1N32L 3NENA 4JI1L 1X65A 4QIWE 4C3JH 5C3EG 1X3FA 1VQGA 3S1NH 4B3SL 3CF5A 1B7YB 4R4IA 2DUDA 3GO5A 4DV1Q 4ME3A 4LUZA 3PUVA 4IO9A 2JK8A 1UE5A 1V43A 1I94L 2ES2A 3AEVA 2RCNA 1R9TH 1HH2P 4FDBA 1KC8C 2NVTH 4LNQA 3G4SA 3I2ZA 1IBLL 2KHIA 3HOZH 1TWCH 3HOXH 4X66Q 3ULLA 4X62Q 3HKZG 5EAYA 1VQMA 2AHOB 1YJ9A 2PI2E 2WAQE 4DV5L 4O0AA 1ASYA 4A3FH 1J6QA 4GN4B 3B6YA 1XTDA 2ZTEA 4P72A 4AYBE 2JA9A 3CMAA 2HIXA 3S2HH 1HNXQ 1A8VA 3H3VH 3WWVA 1NJIC 3HOXG 5K36G 3S17H 1VQNA 1LYLA 1QVGA 4R4QA 4DK6C 4LUOA 5IWAL 2RF4A 1YITA 1PH6A 2JA7H 4A3JH 1JJ2A 1H95A 5C0XJ 3H0GH 3STBC 4A3FG 4JI4L 1UE1A 2K75A 3CMEA 1Q86C 1GO3E 4PZ8A 4TQUS 4GLVB 3CPWA 1VQJA 2N78A 1DGSA 2N8NA 3D0FA 4GN5A 3I56A 4C3IH 2UUCL 2UXBL 3CCRA 4DR7L 4P75A 4DAMA 5HY6A 4DV4Q 1N34L 1FVIA 4YWKA 1WFQA 4JI3L 4A3JG 2WB1G 3UE1A 1HNZQ 4LFCQ 2PQAA 3PSIA 2AKWB 2A1AA 3HKZE 3CD6A 4BA1I 2EIFA 2HT1A 3I55A 1IBMQ 4OXPA 3PUZA 1V1QA 1IYJB 1Z47A 3JAMi 1V9PA 1I6HH 5E7NA 4WJ3M 3NBHB 4DR6Q 4JI2L 3S15H 4OWTB 4DKAC 4OO1I 5LMUQ 4DV6L 1HNWL 1TWGH 1Y1VG 1PH2A 1J5EQ 2VUMG 1G291 1W3SA 2ZM6Q 2UUAQ 5BR8Q 4R1JA 4K0KL 5JJLA 5LMNQ 5IE8A 1HJPA 4A3EH 3KYHC 1K8AC 2K5NA 2Q2IA 1KQSA 4UPAA 3CCUA 4DV1L 1WOCA 5IYCH 2JEAI 4KLKA 1EIYB 4DUYL 1Q12A 2H5XA 3UDIA 1XPRA 3EBEA 4YWMA 2IHEA 5GROA 4X6AH 3S2DH 2NN6G 2AWNA 4NXMQ 3J7A5 1GM5A 2KHJA 1I3QH 2HIVA 2WB1E 3J80i 4X66L 4X62L 3VDYA 4JOIA 1KHIA 1YBYA 3ZJYC 5IYCG 4DV3Q 2ASBA 4QGUA 4UP7A 1SR3A 4YCVA 1PH3A 2I5HA 2HQLA 1NBWA 2D62A 1I5FA 3K80C 3PCOB 1HNXL 4LF6L 2PMZE 5M3FH 1JB7A 4YCUA 2HHHQ 2BA1A 2PI2A 1SN8A 2OTJA 3RN5A 1KXLA 1XMQQ 1EQQA 4B3ML 4GNXB 1B8AA 3PUYA 4LFAQ 1C0AA 3F1ZA 4DAYB 4HJ7A 1EWIA 3AYHB 3STBD 4OONA 4A3LG 1KRSA 2R6GA 1A63A 3FKIH 1O7IA 5J3BA 1HR0W 3GTOH 2F3IA 3CAMA 5M3FG 5ELOA 2IX1A 1HR0Q 1PHJA 4GLXA 2E2HH 3K81C 2AMCB 2GVAA 3CP0A 1EFWA 4JI6Q 4DV4L 4BBRH 4LFCL 4PMWA 1QZHA 2R7ZH 2GN5A 2VY3A 3L0OA 3PUXA 2PQAB 1IBML 4MTNA 3FKIG 3W1BA 5GQOA 2NZOA 1K8GA 1JMCA 1WJJA 4JBWA 4Y52H 1HZCA 4GLAC 3D31A 4AQYQ 4DR6L 3PUWA 3RR5A 1FJGL 4EX5A 1QUQA 4JOIC 1Q81C 2VQFQ 1VQKA 5LMUL 1SMXA 3CPFA 4BBRG 1U5KA 4QJFA 3GD7A 4BY1H 2QEXA 2R7ZG 1VCIA 2EXDA 2ZM6L 3U4ZA 2K52A 5LMNL 1SROA 5GAGC 1TWHH 2I5LX 3TS2A 4GOPA 3E9IA 3F2CA 1IBKQ 2UU9L 4LF9Q 4PG3A 4LF7Q 1Q82C 2ZJPA 1Y14B 3KJPA 2UUBQ 5JJKA 2IHFA 1PH1A 1E7ZA 3S1MH 4BY1G 4JV5L 1OXTA 1HZBA 2B3GA 1PFSA 1P8LA 4DUZL 1UEBA 2RHSB 1K73C 2VQEQ 4NXML 2CWPA 2JQOA 2F52A 2R93H 3BJUA 4DR5Q 1VQFA 3KF8B 2YV5A 1A62A 4R4OA 5IYBG 3HOWH 3KDFA 1Q1EA 4IFDI 1CKMA 3OYYA 1BVSA 3T1YQ 4XTCS 1VQDA 4IPDA 4YY3Q 2CQOA 1TWFH 5FJ8H 4JC0A 1FL0A 1N9WA 3DM3A 4QY7A 3K0XA 5GADC 2R93G 1XPUA 3G6EA 3G48A 4IOCA 3T1HQ 3EIVA 2HHHL 4OX9Q 1M90C 1KAWA 2ZTCA 4L5SA 2KCMA 3HOWG 3OW2A 1PA6A 4JI8Q 1XMQL 4A93H 4LFAL 1NE3A 1Q8KA 1D7QA 3UE0A 1RIPA 1XNQQ 2UXCQ 3I4NH 5FJ8G 1CKNA 1GKHA 3CW2C 4OO1G 1EOVA 3L7ZC 2MFIA 4GOPC 1HR0L 4BBSG 1VQBA 4ALPA 4JI6L 2D0OA 4PZ6A 1XMOL 3TEHB 1SRUA 4KI0A 1Y1VH 4R4TA 5M3MH 1LTLA 2F4VQ 3K7AH 1MIUA 4NXNQ 4DR4L 2CKZB 4A93G 2CWAA 3UDFA 4C2MH 1T9HA 3MXNB 2E5LQ 1GVPA 2L15A 2KCTA 3PO3H 4LF5Q 3I4NG 3TS0A 2NZHA 1YIJA 2JA5H 4AQYL 2NVYH 3CC4A 1XNRQ 3GTKH 2IX0A 2VQFL 3HKSA 1VQPA 4YWLA 4IFDJ 2K5VA 5M3MG 4DR3Q 1NMFA 3HOUH 4UP8A 5IP9G 2I5MX 4Y7NH 1FGUA 3ULPA 4A3KH 4DPGA 2UXBQ 2VNUD 3FP9A 2ALYB 1QVFA 3PO3G 2BH2A 1P16A 4HIKA 2GVBA 1L1OA 3J7ZC 1IBKL 2JA5G 1E1OA 4APVA 3BU2A 1YHAA 4HJAA 4P71A 2LXKA 2AWOA 4GOPB 3PO2H 1Z9FA 4HJ9A 4AIMA 1PH7A 3HOUG 3UDGA 1L2FA 1LM0A 3S24A 4A3KG 2WFWA 1SE8A 3GTJH 1Y1WG 2YU9H 1KRTA 1EYGA 3M3YH 1VQIA 4DR5L 4JYAQ 1EIFA 4A75A 1K83H 1E1TA 1MJCA 4NPSA 5FLMG 3RNUA 2B63H 3PO2G 3RLNA 4UP9A 1JJGA 1ASZA 2YYZA 2K4KA 1N36Q 3KDFB 1IL2A 4A3LH 1EUJA 1CKOA 4YY3L 5GAEC 2Z0SA 4A3DH 4BXXH 1NY4A 2MO1A 1OXVA 3T1HL 4LW1A 4OX9L 3CCVA 2B63G 1Q1BA 3E9HA 1G6PA 4JI8L 3CCEA 2QGQA 1MJEA 5C4JH 3RLFA 4YCWA 5IYDH 3KOJA 2ZJRA 4DK3C 4TVAB 5DLQE 2JJQA 2Q2UA 3NEMA 1XNQL 3S1RH 4A3DG 2Z6KA 4BXXG 5IT9c 4MZ9A 1KD1C 2CCZA 3A74A 1L1OC 4AH6A 2Y0SE 1VQ5A 4BY7H 1VQ4A 4JBJA 1CKNB 3F2BA 1WCMH 1SLJA 2WP8J 1HNZL 2JEBI 3CCQA 2F4VL 4NXNL 3MEFA 1N8RC 3RN2A 3TQYA 1OTCA 1S3OA 5IYDG 2JA8H 2OQKA 1OXSC 3HOVH 3U4VA 4B3RQ 3M9BA 4OWXB 4LF5L 1LUZA 3RZOH 2IY5B 4JI7Q 3M4PA 1XJVA 2PNHA 4BY7G 1WCMG
chains in the Genus database with same CATH superfamily
1WTVA 3RZDH 2OQ0A 1JC7A 3JC66 2UUAL 2JA8G 3PIOA 3AFPA 3QOJA 3RUZA 1IL8A 3T56B 4FXDA 5KNCA 1X32A 2SNSA 2MNAA 3C2PA 3AFQA 1PFMA 2JXMB 4HSVA 5M5YB 3K5MA 1B3QA 1C9OA 1JE5A 3QIAA 3EQLC 5F2DA 3NELA 1PVOA 5KNBA 1D1KA 3K7UC 3J81c 1EQRA 5CC4A 2ID0A 2H4OA 1UWVA 5EJWA 3UDXA 3WOFA 3CCMA 4UY8C 1B50A 1VF5C 4EVOA 1A3VA 5C0XI 1SNMA 3M4OH 2N49A 4CDEC 3V2TA 1X54A 4BBSH 3J80E 1CHQD 2J7ZA 3NQIA 2K5WA 3VR5A 2R92H 5JVH3 2CQAA 3M4QA 3GTMB 1F9SA 3A54A 2NTTA 1I4GA 1BR9A 1PRTC 2IL8A 2MGSA 1V1PB 3ICEA 1E2ZA 1G2TA 3CXCA 3BYYB 2R92G 2WV6D 3K6OA 4LUVA 5IP9H 2BE5D 4KV6A 1X3QA 4DK1A 1JORA 1ILPA 1WTOA 1N33Q 1K3BC 4HJ5A 3QWNA 2WACA 4IJHA 4JI5Q 3HFZB 1QUQB 2FINB 1PTOB 1VS0A 3S1NB 3CCSA 2EY1A 4HIMA 1PH9A 2SDFA 1Y1WH 1AZQA 1D2BA 5C3XA 1I4PA 4RGMA 2JA7G 2B2WC 4LFBQ 5FLMH 2UUBL 2VW9A 4DV2Q 2R7DA 4KN7C 1R4PB 2Y0SG 3OMCA 1SFOH 4G57A 3H3VI 4L5QA 2Z6BA 2N3SA 2VZAA 3IRBA 1F2MA 2B2UC 1K3RA 2K50A 3K5LA 1JICA 3A0JA 1JOQA 1BBUA 1WTPA 3S2HB 2K7VA 4PV1C 1VQ8A 1N32Q 2XGTA 1RL2A 1K8MA 1VQAA 3EVQA 1PYBA 1XWEA 3TP7A 5E1FA 2E2IH 2QA4A 1A2UA 2XN9C 1PLFA 5FK9C 2MUYA 1ONLA 1A0IA 2BH8A 4J15A 3F2DA 1RTNA 1UE6A 4DR1L 1U4LA 4GKKL 3HZXA 1SNQA 3CRLC 3Q6SA 1DXMA 2PMZB 2F0MA 3KLSX 3T51B 4ZK9B 3E6ZX 3GDEA 4RKBA 1YHQA 4GKJL 4KKTA 3GTKB 2NN6I 1YVCA 1UUPA 4NW2A 2J0TD 1E22A 3QG1A 1STGA 1UEAB 2PCFB 1BOSA 2EYPA 4HIDA 3D8GA 1SYDA 1JJCB 1KIXA 4O1NA 2F0NA 4O2DA 3DLLA 3I73A 2AQ2B 1EIGA 1X55A 2NZ1D 3G7LA 1LABA 5M9OA 4IJLA 4B3TL 1X3GA 2V4DA 1B1ZA 2CFMA 2F0EA 5C3EH 2WAQG 4IPCA 1UAPA 4F88A 4JI2Q 1UE7A 3GTGH 2K5HA 1IHZA 4FXGC 4LWCA 4XIGS 1IZ6A 5AFWA 2XNAC 2C9OA 4JI1L 5C3EG 5CV8A 4RAUC 2XWBB 3KLSA 1I94L 2L55A 2F03A 2HDLA 4UDUC 1R9TH 1HH2P 2WIIB 2NVTH 1IBLL 3I2ZA 1FGBD 1TWCH 3HOXH 4S3SA 3ULLA 1JOOA 3HKZG 1VQMA 3DWAA 1ASYA 4A3FH 1DZ1A 3NBIA 5I6YA 4AYBE 1ML0D 2JA9A 3I70A 1A8VA 4OIKA 5DNFA 1EY9A 1NJIC 3HOXG 1ZXTA 2FMCA 5ELBA 1LYLA 3SR1A 4R4QA 5IWAL 3BYTB 4DAYA 1PH6A 4A3JH 4FP5D 4BY1B 5C0XJ 3RZDB 1H95A 4A3FG 4JI4L 1M8AA 1UE1A 2K75A 1HA6A 2IPKD 3KBXA 4GLVB 5D3IB 2N8NA 3I56A 2UUCL 1T5EA 2Z4IA 2LY7A 3CCRA 5CMDA 4RA8A 5KEEA 1N34L 4LFCQ 4A3JG 1HNZQ 3UE1A 3DEOA 2ICIA 3N52A 2EIFA 2RCFA 5DAUA 2RKSA 3PUZA 4QUFA 3AMUA 2R93B 1Z47A 1HFGA 3K5NA 1I6HH 5EBDA 2LS01 3WDNA 3Q23A 1IYVA 2AUKA 2B8GA 5LMUQ 3K58A 1HNWL 3CHBD 5JJLA 2ZXRA 1KTKA 3KYHC 1K8AC 2Q2IA 4BBSB 4LAAA 1QG7A 3H09A 5T1GA 4DV1L 1WOCA 1H9RA 3GV6A 3DWPA 5I9OA 3C1FA 4XQQA 4K8JA 2IHEA 5GROA 4X6AH 3S2DH 2FFKB 2EDGA 4O42A 1DCZA 1LT3D 3J7A5 3P75A 4XQJA 1I4XA 4ID6A 5HURA 3I91A 3KLRA 2AQ3B 3ZJYC 5M3MB 1STNA 4EQPA 4KKUA 4UP7A 1SR3A 4QGUA 1PH3A 5KYIA 2Q8TA 1NBWA 1EQVA 3X3MA 1JCKB 1I5FA 5CGKA 1D5MC 1JB7A 2NVYB 1EOTA 2RSOA 4DN4M 5C0XH 4IUVA 3VR4A 1EQQA 4CDDC 3J7AV 3DXJC 3PUYA 2Y0SB 2M2LA 3HOUB 3F1ZA 3F2UA 5JPMC 3AYHB 2Z9HA 4HJ7A 4A3KB 1Y1WB 1A63A 2JP1A 2NBFA 3OHXC 3ITPA 2IX1A 2E2HH 2AMCB 4DV4L 1TKWB 3BVGA 1QZHA 3TZDA 3DUZA 2GN5A 4XXEA 2VY3A 1STAA 3L0OA 1IBML 1FNUA 5GQOA 2K5DA 3SEBA 4JBWA 1HZCA 1TS3A 4GLAC 1Y8PB 4KD3A 4DR6L 1K83B 3RR5A 2OF1A 4B9XA 1VMPA 1U5KA 2F0TA 1QOHA 2QEXA 2ZM6L 2WINB 3RMHA 1QE6A 4A3DB 3MEHA 2I5LX 5GAGC 3TS2A 2DJFC 1IBKQ 4CJ2C 4LF7Q 1PTOF 1Y14B 1A2TA 4DA2A 1PH1A 4J8QA 3S1MH 1HZBA 1PFSA 1P8LA 3S1RB 4RGOS 1EU3A 1K73C 2RHSB 4NXML 2VQEQ 1AFPA 2F52A 1BCPC 1HTPA 4E6IA 1SYCA 5C5LA 5CBAE 4MN3A 1BVSA 1WTWA 4J1MA 1VQDA 1KABA 4YY3Q 4XQNA 5G3LF 1TY2A 5FJ8H 2A68C 4QY7A 3DM3A 4TKOB 1I6VC 1KAWA 4KD4A 2F3WA 2F0HA 3A7AB 4NDXA 1D7QA 4LK1C 2UXCQ 5FJ8G 3T4AC 3L7ZC 3WOEA 1HA5A 4GOPC 1ESRA 5FOBB 2D0OA 1TWAB 3GTLB 1Y1VH 1LTLA 3K7AH 2FMMA 3UDFA 4C2MH 2L15A 3PO3H 3GTGB 3TS0A 1II3A 3W3AA 3UI2A 2VQFL 4YWLA 2K5VA 1HQRD 3CKIB 1HRJA 5FO8B 2I5MX 2UXBQ 3J81L 4ULLA 2NN6H 3PO3G 4CKBA 3I4MB 2GVBA 2F0UA 1FNVA 3N6RA 5A2QL 2A69D 2PW5A 4HJ9A 3S16B 2NVTB 5L37A 2XIWA 3HOXB 4N9PA 2WFWA 3GTJH 2YU9H 1KRTA 1EYGA 2KECA 1D1IA 4ZUIA 1TT2A 1PFNA 4L6TB 2K05A 3EFXD 2B63H 3RNUA 4XT3B 3NTKA 1LTSD 2BOSA 2K4KA 1N36Q 4RGTA 1O7LA 1A3UA 1NY4A 4DXFA 5C44B 3EJIA 4A3JB 5I2YA 4LW1A 4DXGA 3CCVA 2B63G 1G6PA 1ZKOA 2BDOA 1SE2A 4KY7A 5C4JH 4X3SA 3RLFA 5IYDH 3KOJA 2ZJRA 4CJ0B 4C3HG 1SYBA 5DLQE 3A56A 1BNZA 1V1PA 2G5DA 5IT9c 2UXDQ 4C1NI 3DMUA 5IGDA 1CKNB 3F2BA 5J22A 2WP8J 3CCQA 3MEFA 1TIID 2XSCA 4CKCA 5IYDG 2IY5B 4LF5L 2KVMA 2HDMA 3M4PA 2E2DC 1S5CD 4RMFA 4DR3L 5C4XG 1DOLA 4A3MG 3DWQA 2XTIA 2PZWA 2EXZA 2RQXA 4JI0Q 1ZYRD 1BQQT 4QF4A 3BVZA 3JAME 1IYUA 3SDZA 1WYDA 4Q0FA 5IYBH 2EVBA 3MHBA 2EYMA 4HJ8A 1SBBB 3S2DB 1GUTA 1SMYC 4J6HA 3NBHA 3K8AA 2K14A 2FXQA 2EYHA 1YZ6A 4JCVE 4LF4Q 3TZUA 5IGFA 5KNDA 4P74A 3BZCA 5ISRA 2RSNA 4OL7A 1I4RA 3OIPA 1EYAA 3AU7A 1S5DD 1JB3A 4X64Q 2EQSA 2BA0A 4FF1A 4DUYQ 1OXXK 4A3BH 3TP8A 3I7FA 4DAPA 3BZKA 3BVMA 1U4PA 4C3JG 2E2HB 1DJRD 3SK8A 2NVXB 3OSOA 4A3GB 4KHPQ 1AP0A 3HRZC 3TREA 3F8TA 4A3BG 2BDNA 4JW0A 5T1IA 1PV4A 2NB0A 1Q46A 5IGEA 1XYIA 5JEAJ 2D9UA 2ZTDA 4B3RL 4RH6A 4GNXA 1NMGA 4LF8Q 3I90A 4R4CA 4V190 5C4HA 3MFGA 2K03A 4GN3B 3HOYH 1YEZA 4F87A 1E3PA 2VB2X 4ODGA 2V1CC 4A4IA 1S5ED 1TS2A 5HGQA 3U58A 4LF9L 4DNIA 2KEEA 4IUNA 3S1MB 3AQQA 3H0GG 3G71A 4QL5A 4JBMA 1CSPA 1BBWA 1LV9A 3HOYG 5JVG3 5JJIA 4C3IG 1PXUA 1Q7YC 5JAVA 3TN2A 2QW7A 4H44C 2IW3A 3TRZA 2OTLA 2QCPX 5LMNW 4WRDA 2EY2A 4OWWB 3A8JE 5LL6S 3TMEA 1YNXA 4UAIA 1STBA 3A5ZB 1XPOA 3R2TA 4FF4A 1GXDC 4JV5Q 1L0WA 2MO0A 1V1OA 5M5WH 2IT1A 2ATWA 3KF8A 4DUZQ 4PZ7A 4A3EG 2IJ0A 3CC7A 3J80c 1Y1VB 4WJWA 4CHTB 1G91A 3K7AB 3S1QH 4K5XA 1GD7A 2D0PA 1MBYA 1L0XB 2Z8LA 5JEAH 2FJ2A 4ZQ3A 4G7OC 1HTLD 1AH9A 1PYSB 2KBNA 2A8VA 2Z4HA 3TBIB 3SK4A 1HFNA 3CRKC 1N33L 3QO2A 5G3LD 4JI5L 4QQBX 3SK5A 5IIFA 3S14H 3ER0A 5DEHA 5D14A 5JEAG 2DJGC 3PF5A 3CQZH 1E0BA 3SHLA 4G4KA 3GTQH 1XMOQ 2DY8A 1IW7D 4LJZC 4LFBL 1VQCA 3J81j 1BKBA 4DV2L 2L1BA 1KLGD 4HCSA 4HAEA 1I3QB 4KJNA 3MVVA 4IPHA 3J81i 4XT1B 4P73A 2NVQH 2KUMA 2B2VC 4MNOA 4DV6Q 4ME5A 2XWJB 2CW0C 3Q22A 3ZYYX 3I4OA 4K14A 2PPBC 1WD0A 1AE3A 1DOMA 3PV0A 1N32L 3NSWA 3NENA 4QIWE 1VQGA 3CU7A 1B7YB 2DUDA 3GO5A 3NPPA 3VA5A 2ENBA 1UE5A 1V43A 3R2IA 4B08A 4K5WA 3G4SA 5IGCA 4HR7B 3VR3A 5EAYA 2AHOB 1YJ9A 4BBRB 2WAQE 4V0BA 4RCOA 2ZTEA 4L8JA 2HIXA 4ZLTF 2EE1A 1ENCA 1ET9A 3S17H 1GUWA 1QVGA 4LUOA 1YITA 2JA7H 1SNPA 1MGSA 1GJXA 3CMEA 1U9RA 3ONAB 3CPWA 2N78A 4ZAIA 3NK9A 1DGSA 2NTSA 3LWUA 5EQ0A 4DR7L 4DAMA 5HY6A 2KA7A 4YWKA 2WB1G 4F8MA 3PSIA 2AKWB 3HKZE 2NYZD 4BA1I 1WD1A 3MA2B 3NBHB 2JN4A 4JI2L 3S15H 4OWTB 2QDBA 1TWGH 3PQIA 4MHEA 1PH2A 1GUGA 1JOKA 2UUAQ 1M4VA 5IE8A 1HJPA 4X3KA 5JJZA 1KQSA 1KDBA 2TMPA 3MXPA 4A3BB 3MXGA 3CCUA 3SVMA 1FR3A 1SJHD 2JEAI 2I07B 4FO2A 4KLKA 5KRUA 3EBEA 3R8BA 2O5IC 4CDFC 4B9WA 4IN3A 3GP7A 4K8IA 2D2CC 1TS4A 2QEJC 3KK7A 1VMCA 4JOIA 1EWHA 3FRPB 1EZ8A 5TSSA 3G6JB 2HQLA 4G7HC 2D62A 3K80C 3ERQA 4LF6L 5M3FH 3BG3A 3K57A 4KHVA 2E76C 5LL6X 1NR2A 3HOYB 4R8NA 1XMQQ 4B3ML 4GNXB 4LFAQ 1GUNA 4KKSA 1EWIA 4A3LG 4OONA 3FKIH 1EY4A 1HR0W 3GTOH 3CAMA 5M3FG 1HR0Q 4GLXA 3RD4A 4LFCL 3ND8A 2R7ZH 3PUXA 2PQAB 3W1BA 3FKIG 1S5FD 1PZJD 4AQYQ 3PUWA 1FJGL 1LTAD 1EY6A 4EX5A 2MPMA 2M9VA 3E5SA 5LMUL 5KGUA 4QJFA 4HN7A 2R7ZG 1VCIA 1T5XD 2WKDA 3FVQA 2G9HD 1CTMA 1TWHH 2UU9L 4PG3A 2A69C 3KJPA 2UUBQ 2LKVA 5M5WB 1HQMC 1E7ZA 2B3GA 1ILQA 2L0CA 4DR5Q 4TRDA 3KF8B 2YV5A 3IKJA 1YNND 4FVMA 4BY7B 4P2CB 4R4OA 3HOWH 5FO7B 1D5ZC 2JA8B 2N88A 3HS0C 4XTCS 4IPDA 4ZCKA 5IT9L 3K0XA 3G48A 3T1HQ 4OX9Q 3EIVA 2ZTCA 3HOWG 1PA6A 3S14B 4A93H 1F9PA 1IKMA 1RTOA 2JSOA 3I4NH 2PZUA 1CKNA 1WTQA 4OO1G 2MFIA 1BF4A 1VQBA 4I65A 3TEHB 2F4VQ 4DR4L 1LLRD 4A93G 2CWAA 2LFNA 2NVQB 1RF2D 5FLXE 3I4NG 1YIJA 2JA5H 1SAPA 1I4QA 2EYFA 2IX0A 3H3VC 1NMFA 1ZYRC 4H13C 3M4OB 4ZKBB 1FGUA 4DPGA 1QVFA 4HEDA 2F0QA 1K8OA 1IBKL 2JA5G 1FD7D 3BU2A 4HJAA 2AWOA 3PO2H 3GQBA 1Z9FA 2X6LA 2R92B 4G7ZC 4AIMA 1L2FA 2E75C 3OIQA 1MI2A 3M4YA 3J7YW 1B4OA 1HCZA 1WTRA 2F0OA 3I3CA 1EIFA 4A75A 1SE4A 2O5JC 4NPSA 3PO2G 2F0GA 4IUQA 5HGTA 3KDFB 4HMJA 3S17B 4HMIA 4YY3L 1RKNA 5GAEC 4BXXH 2JA7B 5BN3A 1OXVA 1D6EC 2XRQD 3A8KE 3E9HA 1MJEA 5ELCA 1HUMA 3S9WA 5EKIA 2F0VA 4TVAB 2JJQA 2Q2UA 4JPBW 2Z6KA 4BXXG 1XTCD 2CCZA 3A55A 4AH6A 1J8IA 1PRTD 3NTIA 3FEWX 3X3NA 1WCMH 1RJTA 1S3OA 5IODA 4OIJA 3U9SA 1SFOB 2OQKA 5A35A 3HOVH 5CV9A 1IKLA 5CR3A 4OWXB 1LT4D 1LUZA 3RZOH 4JI7Q 3T13A 1BXTA 1LTRD 1WCMG 3A5UA 4GZYC 4KY5A 1J5EL 2EJFC 1KNAA 1SYFA 1SE3A 2RHQB 1W2BA 1BDOA 1VQLA 5BR8L 2UXBL 3OTOQ 1NR4A 2UUCQ 3HOVG 2A6EC 4BWGB 5IP7H 2E2IB 3V96A 2F4IA 2F3VA 4POGA 2JE6I 2OCEA 1L1OB 4L5RC 2L5TA 4NKLA 1OXUA 1KL9A 2MP1A 2E2JH 2YTYA 2Q2HA 5IP7G 4DR2Q 4QIWB 1MKHA 5J1ZA 4OEMB 4X65Q 4N9TA 3K0YA 4DV3L 5I6WA 2EYJA 4H02A 1N36L 3J80L 1PYWD 1YJNA 4WORA 3H6MA 4XDXA 4RKLA 1CT1D 4DNRB 2LMCB 1Y8NB 1HPCA 2JA6H 1X3EA 2NWGA 1F2YA 1JT8A 1PTOC 2F0LA 2WAQB 4HTHA 5EPKA 3HGBA 4A76A 4EQOA 3GTPH 4HCEA 3H15A 4GS3A 2UXDL 1D8LA 2JA6G 1GUOA 2K1BA 1YNJD 5C3WA 3L2PA 2E74C 3OW7A 5C3EB 1PFBA 5AJ3Q 4DV7Q 3HOZG 1VQOA 2R7FA 5ELEA 1Q3LA 1B44D 4IURA 3FPPA 2AQ1B 4N8FA 2CVRA 1AN8A 4POFA 5EKLA 4JI0L 2ZJQA 3HKZB 2L4NA 2VB3X 1I50H 1YHBA 1B9MA 3H94A 1KDCA 5C5MA 1PRTB 4KY6A 2DGYA 1R9TB 1G2SA 1TWCB 1AEXA 2Q8RE 3JAMc 4A3IH 1DONA 4DV0Q 5H1SE 4RHRA 5CV4A 4LF4L 4A3FB 1TXYA 1I4HA 1EEID 2KEDA 4ZKCB 4YHHQ 2KENA 1NTGA 2Q2TA 1ET6A 3LX0A 3ULJA 3T1YL 4C3HH 5NUCA 4B3SQ 4A3IG 3SGIA 4RGNA 4X64L 2F0FA 2RDFA 4GNXC 2B2YA 4CJ1B 2F0PA 1H9KA 1LT5D 4JG2A 4IPGA 3MAQA 2NUCA 3M85A 5M5YH 2L12A 3VYRA 4KHPL 4DV5Q 1S5BD 4K6LA 1HHVA 1IXRA 5C4XH 4A3MH 2BE5C 1JR0D 1I6HB 2E5LL 4OHJA 1PDQA 3LGJA 1WI5A 3NUCA 1NNXA 4LF8L 2YTVA 1XNRL 3U50C 3CC2A 3KF6B 4IZ8A 3R93A 3FHWA 1QNUA 5I9PA 3GTMH 1VQ9A 2A19A 2HD3A 2X69A 3A8IE 3E0EA 4ILWA 1EY5A 4JI3Q 3TSSA 2B39A 1X56A 1RCVD 2E8GA 1S40A 2HUGA 4EGVA 1EY7A 3Q24A 1X9NA 4PMCA 3T16A 2DNCA 2EOTA 1O78A 3VYSA 4JYAL 1EZ6A 5CYUA 1VQEA 4K0KQ 1F2LA 4C3JH 1X3FA 3S1NH 3CF5A 4R4IA 4LUZA 3PUVA 1Z7TA 5EPJA 3E3XA 5E3FA 2ES2A 3AEVA 3H91A 4R8IA 1BO0A 1LO5D 2Q8IB 4X66Q 4X62Q 5BN5A 3MXUA 1J6QA 3B6YA 4P72A 3HOVB 3CMAA 3S2HH 3RZOB 1HNXQ 5JOBA 5BN4A 2F0WA 1G8ZD 3VYTA 3H0GH 4YIJA 4CKEA 1Q86C 3BDCA 1CI3M 1VQJA 4GN5A 3BZDB 4C3IH 3OPOA 4RWSC 1WFQA 1CZWA 2PQAA 3D6WA 3CD6A 2E2JB 2B2TA 4FF2A 5E7NA 2IX3A 3K59A 4ZYSA 4DKAC 4OO1I 1HUNA 4DV6L 1W3SA 2I46A 3NHHA 4DFAA 3HG9A 4R1JA 3TP5A 5LMNQ 4A3EH 4OGQC 2K5NA 3TP6A 1SSOA 4UPAA 4X3TA 3OMGA 1EIYB 4KTAA 1Q12A 3D4WA 1XPRA 3D4RA 5I2XA 3IFDA 4C56C 3GTPB 2K01A 1K0SA 3HEJA 1WVLA 2AWNA 2KHJA 2WB1E 2HIVA 3J80i 5E4XA 2RDGA 1BCPD 1YBYA 4CDCC 1W6KA 1LTTD 2ICEC 4C2MB 1Q8IA 2I5HA 2L9HA 3PO3B 3SE0A 5I4DA 5ELFA 3NXWA 2A68D 4YCUA 2HHHQ 1CFMA 2OTJA 2EYOA 1KXLA 3MWYW 1U4RA 2EPBA 3STBD 1KRSA 2R6GA 2EJGC 1O7IA 5J3BA 4RHSA 2KOLA 2D5DA 5FO9B 1LTBD 1PHJA 3K81C 4JI6Q 3CP0A 1EFWA 5CORA 4DNTB 4PMWA 1TS5A 3KBGA 1DOKA 2YU9B 3GTJB 4MTNA 1B2TA 1WJJA 1K28A 3NE5B 4UHVA 2B63B 4JOIC 1Q81C 3PMFA 4BY1H 5ELDA 2K28A 2EXDA 4C3HB 2H1EA 3U4ZA 2K52A 3D3RA 4QMGA 1SDFA 4LF9Q 2ZJPA 4DU9A 2SOBA 3MFYA 1SNDA 5C4JB 1EU4A 4BY1G 1OXTA 1O80A 2PYKA 1PRTF 2F0DA 2R93H 2JQOA 1VQFA 1A62A 5C4XB 3KDFA 4A3MB 5EBCA 1XX8A 1TWFH 2R61A 4JC0A 2R93G 5GADC 1XPUA 4IOCA 4H7BA 4L5SA 3IAYA 4JI8Q 1XMQL 4LFAL 1CHPD 1Q8KA 3UE0A 1QJOA 5E4WC 1RIPA 1XNQQ 3J7AF 4H0LC 4QB4A 1GKHA 3CW2C 1EOVA 1HR0L 4BBSG 2A74C 3BDLA 4ALPA 5LHY1 1BCPB 3O13A 2PNRC 1F77A 5M3MH 4NXNQ 1B9NA 1FYCA 1T9HA 3MXNB 4XYQA 3MC0B 2JYOA 4AQYL 2NVYH 3CC4A 2CH4A 3HKSA 4IFDJ 5M3MG 1QCBD 3HOUH 4C3JB 5IP9G 5KIXA 4Y7NH 3ULPA 4A3KH 3FP9A 2ALYB 2EY6A 4HIKA 1L1OA 3D4DA 1E1OA 2R3ZA 3FDTA 4U68A 1ESFA 1TQOA 1YHAA 2L11A 4P71A 3J81E 4GOPB 2TSSA 1PH7A 3HOUG 1STHA 3UDGA 1SMYD 3S24A 1BUVT 4A3KG 1KAAA 1ICFB 1NSNS 5A2QE 1Y1WG 2A5HA 1QB5D 3M3YH 4DR5L 1K83H 1E1TA 3T53B 5FLMG 3R3OA 1LTID 3FMCA 4LMQD 1JJGA 1ASZA 2YYZA 2XVSA 4ABNA 2KQ3A 1IL2A 4A3LH 1EUJA 4A3DH 1LT6D 2MO1A 4OX9L 3T1HL 3H0GB 2MHVA 2HCCA 4QUCA 3DEPA 4DK3C 4C3IB 5J39A 4HSPA 2B2VA 3S1RH 4A3DG 1KD1C 1F2ZA 4JBJA 2PO4A 1YNJC 4N8X1 1RD9D 1C8CA 1SLJA 1HNZL 2JEBI 2F4VL 1N8RC 2M00A 1OXSC 2RVLA 3U4VA 1JE4A 1XJVA 2J4XA 4DK0A 3PIP3 1J9OA 4IFDH 3Q8DA 3P20A 5EPLA 1XXGA 2C5CA 5FLXc 4A3EB 3JAML 4FXKC 1CQFA 2A73B 3FPUB 5DM63 2VS1A 4DR7Q 1A3TA 2MQHA 2QDLA 1E2WA 5DM73 4BA2I 4IFDG 4A3CH 1UNSA 1TWAH 2EJMA 4RCNA 3GTLH 1MD2D 4KMUC 1C7YA 4DGZA 1SNCA 3A7LA 5IY0A 4JVZA 2Z6KC 3S1QB 1K9MC 4JK1C 5M5XH 2OWOA 4A3CG 4JBKA 1YI2A 3RLOA 3I72A 3P7JA 4I7ZC 1G51A 1R4QB 4KJOA 2RBMA 4RFBA 3I4MH 4OO1H 2A6HD 2B2WA 2VXWA 1TU2B 4I7AA 4L5TA 5GAHC 2P5ZX 2QKIC 1CUKA 3QOLA 3S16H 3EA6A 4R9WA 3IL8A 4DR1Q 4Z9CB 4GKKQ 3CQZB 3KFUA 1G6ZA 3GTQB 1EEFD 3PIPA 2B29A 2G9DA 1W6JA 1DYQA 3AB9A 4PNYA 2B2UA 1HZ9A 3I4MG 4RG1A 2XRSD 1PH4A 2I0QA 2RA4A 5CBEE 2N55A 2AUJD 4KHZA 3W1GA 1O7YA 2C35B 4LF6Q 4GKJQ 2RDHA 1YJWA 1CSQA 4FYDA 1QILA 4JI7L 1VQ6A 3KLWA 3KF6A 5C44H 4B3MQ 4IUPA 1QVCA 2LSSA 5ELNA 1BBXC 1QNKA 1QZGA 2OT2A 3OTOL 2OXPA 2GA4B 3L9AX 4KK7A 1VQHA 5C44G 3OWEB 4LF7L 3BDOA 4IALA 2K5QA 1TY0A 3D6CA 5D65A 1PH8A 4B3TQ 3PF4A 3URYA 4MTKA 3CCLA 3ERSX 1JWSD 1SJED 1FJGQ 1E24A 2VQEL 4DR2L 4CGYB 4IOAA 4X65L 2CW0D 2VL6A 3BS1A 3DHQA 2O4XA 4HIOA 3PGZA 1TWFB 2QILA 3W5OA 4JI1Q 1X3PA 1S72A 2BCOA 2UU9Q 1EL0A 1RHPA 3OWFA 1CK1A 1MSGA 2WB1B 1U0LA 1I94Q 3HP3A 1H9SA 1AZPA 3DM1A 1VQ7A 1B70B 1E2VA 1IBLQ 1PH5A 1CQVA 3M7NA 2UXCL 1WTXA 3EN2A 3SK6A 2YTXA 2DY7A 2EYLA 1SYGA 5AJ3L 1TR5A 4NB3A 4DV7L 1B53A 2ZXOA 1KNEA 3S15B 2MJ8A 4ZUJA 3NQTA 5D3DA 5IWAQ 1TWGB 4U673 5JPNC 4WJ4A 4Y7NB 1GHJA 4F7XA 4JI4Q 2LXJA 2F1MA 1SYEA 2ZXPA 2HQEA 2Z1CA 1K0RA 3KJOA 1HZAA 2NVXH 1MSHA 1KDAA 4A3GH 5C0XG 2K04A 2B2YC 1SXTA 3CCJA 1N34Q 4DR4Q 4PQXA 4EQ5A 1WTHA 1BCPF 4Q5VA 3M3YB 2SEBD 2QF7A 1NCVA 3M7GA 4DV0L 4AYBG 1AE2A 4A3GG 1M1KC 1HNWQ 2ZT9C 4L63B 3C46A 5COYA 1X6OA 4YHHL 3NWSA 2HCIA 1X65A 5M3FB 3I4LA 3OOCA 4B3SL 4K5VA 4DV1Q 4ME3A 1ICWA 4IO9A 2JK8A 3C1EA 1A15A 2RCNA 4FDBA 3FKIB 1KC8C 4LNQA 1EFID 3GTOB 2KHIA 3HOZH 5K36H 1LTGD 1JWMD 2KCCA 2PI2E 5K5PA 4DV5L 3QJYA 4O0AA 2R7ZB 4GN4B 1XTDA 2IWHA 3H3VH 3WWVA 5K36G 1VQNA 4NMZA 2KCNA 3E0JA 4DK6C 2DNEA 2KHSA 2RF4A 1JJ2A 1S4ZA 3STBC 2CH4W 1GO3E 4PZ8A 3GV3A 2PZTA 4TQUS 1TWHB 1RDPD 3LWEA 3D0FA 1Y69U 5CV6A 3I8ZA 4P75A 1U4MA 1IW7C 3NWTA 4DV4Q 1FVIA 2VUMH 4JI3L 5FKAC 2A1AA 2O2LD 3VR6A 2HT1A 3I55A 4DAVA 1IBMQ 4OXPA 1V1QA 5EGTA 1IYJB 3JAMi 1V9PA 4WJ3M 4DR6Q 5M5XB 3HOWB 1VF7A 4WFN3 1Y1VG 2VUMG 1J5EQ 2FHTA 1G291 2ZM6Q 4C1NK 5BR8Q 3C3LA 1EQTA 4K0KL 3TDQA 1CA6A 1C4QA 1A6XA 4NP5A 5IYCH 1MHWC 4DUYL 2H5XA 4A93B 3UDIA 3W2DA 4YWMA 2NN6G 3I4NB 1GOZA 1NUCA 3QR8A 1GM5A 4NXMQ 1I3QH 1KLUD 4X66L 4X62L 3VDYA 3Q0AA 1F9QA 3VA7A 1KHIA 5IYCG 4DV3Q 4PMBA 2ASBA 4YCVA 3EROA 4DF7A 3PCOB 1HNXL 4TSSA 3U9OA 2PMZE 2JA5B 2B2TC 1EIHA 1B3AA 4IUUA 1PMRA 2BA1A 2PI2A 1SN8A 1Z6HA 1EY8A 1ZEQX 5CV5A 3RN5A 1B8AA 1C0AA 2PQEA 4DAYB 1CM9A 4FNFA 2PW7A 5C4ZA 1HXYD 2F3IA 5ELOA 4EQNA 1FNWA 2GVAA 1V8QA 1EY0A 3PO2B 4BBRH 3MXNA 1ENAA 1Y8OB 3MZ5A 2K32A 2NZOA 1K8GA 1JMCA 4Y52H 3D31A 4M1UB 1QUQA 1VQKA 2VQFQ 1SMXA 3CPFA 4BBRG 3GD7A 1GHKA 1SEBD 1DD2A 1F9RA 1SROA 5LMNL 1PTOH 2DN8A 4CBVA 4GOPA 3E9IA 3F2CA 1Q82C 3VYUA 1NAPA 5JJKA 2IHFA 1ENFA 4FF3A 4JV5L 3IFTA 4K6DA 4OELB 2K6AA 1H9SB 4DUZL 1PZID 1UEBA 4IUTA 1CA5A 2CWPA 5IGGA 3BJUA 1SNOA 2K33A 1WCMB 1L0YB 5IYBG 1C48A 5IOCA 1Q1EA 4IFDI 1CKMA 1LACA 3OYYA 2SNMA 4ZRZA 3T1YQ 1H9JA 1OO9B 2CQOA 1FL0A 1N9WA 1RODA 2KJXA 1D5XC 3G6EA 2HHHL 1M90C 2EY5A 2KCMA 1VDZA 5IT9E 3OW2A 3QB3A 3VR2A 1NE3A 3SXHA 2X6GA 4X3UA 1H9MA 4AYBB 4K2LA 4JI6L 4PZ6A 1XMOL 3L3OC 1SRUA 4KI0A 1QWYA 4R4TA 5FLXL 1MIUA 2CKZB 5EKKA 5KYLA 2E5LQ 1STYA 1GVPA 1PZKD 2KCTA 3LNNA 3P1HA 4LF5Q 2NZHA 2OEOA 4IQZA 1XNRQ 3GTKH 1VQPA 4DR3Q 4QCLA 4UP8A 2VNUD 1EWCA 3V05A 3MTSA 2BH2A 1P16A 2A6ED 3J7ZC 4APVA 2JA6B 5IGBA 1JWUD 2LXKA 3HOZB 3KUPA 1LM0A 4K2KA 5C6AA 1SE8A 3NTHA 2F0SA 3PIO3 1YNNC 1Q90A 1VQIA 4JYAQ 1MJCA 3RLNA 4UP9A 4BS9A 1STEA 1CKOA 1AW7A 2Z0SA 2A6HC 4M8AA 2WKCA 3K5OA 1JQYD 1Q1BA 4JI8L 3CCEA 2QGQA 1PTOD 4YCWA 2CHBD 3NEMA 1XNQL 1I50B 2F0JA 4MZ9A 2VUMB 3A74A 1L1OC 5CV7A 2Y0SE 1VQ5A 4BY7H 1VQ4A 1CZGA 1EYDA 2F0IA 1TVXA 1EYCA 4XYOA 3ND9A 4NXNL 3RN2A 3TQYA 2EZVA 1OTCA 1GUSA 2JA8H 4A3IB 4KN4C 4B3RQ 3M9BA 1O7ZA 4MIUA 2F0KA 1DM0B 2PNHA 4BY7G 3NP8A 2B8FA
chains in the Genus database with same CATH topology
4RMFA 4DR3L 5C4XG 1J5EL 4A3MG 3RZDH 5FLXc 2XTIA 2OQ0A 2RHQB 1W2BA 3JC66 1VQLA 5BR8L 2UUAL 3PIOA 3OTOQ 2UUCQ 4JI0Q 3AFPA 2JA8G 3HOVG 2VS1A 4DR7Q 5IP7H 2MQHA 4BA2I 4POGA 2JE6I 2MNAA 2OCEA 1WYDA 4IFDG 1L1OB 3AFQA 5IYBH 4A3CH 4HJ8A 1TWAH 4L5RC 3GTLH 1C9OA 1JE5A 1C7YA 5IY0A 1OXUA 2K14A 1KL9A 3K8AA 3NELA 1PVOA 3K7UC 2E2JH 2FXQA 3J81c 1EQRA 2YTYA 1YZ6A 2ID0A 2Q2HA 4JCVE 5IP7G 2Z6KC 1UWVA 1MKHA 3UDXA 3A5UA 4DR2Q 4LF4Q 1K9MC 3CCMA 4UY8C 5M5XH 4P74A 2OWOA 4A3CG 4X65Q 3BZCA 5C0XI 4DV3L 3RLOA 1YI2A 4JBKA 4H02A 1G51A 1N36L 3M4OH 2N49A 1YJNA 4X64Q 2EQSA 3Q8DA 1X54A 2BA0A 3I4MH 4DUYQ 4BBSH 2JA6H 1X3EA 1OXXK 4A3BH 4L5TA 1JT8A 3I7FA 3BZKA 5GAHC 1CUKA 2R92H 3S16H 4A76A 4DR1Q 3GTPH 3M4QA 4GKKQ 3KFUA 3H15A 3PIPA 2B29A 4GS3A 4KHPQ 3I4MG 2UXDL 3TREA 1D8LA 1HZ9A 3ICEA 4RG1A 1PH4A 3F8TA 2I0QA 2JA6G 4A3BG 3CXCA 1PV4A 3L2PA 2R92G 4KHZA 1Q46A 4LUVA 5AJ3Q 3W1GA 5IP9H 2C35B 5JEAJ 4DV7Q 4LF6Q 1VQOA 3HOZG 4GKJQ 2R7FA 2ZTDA 1YJWA 1CSQA 4B3RL 4GNXA 1VQ6A 1NMGA 4JI7L 4LF8Q 4R4CA 3KLWA 3KF6A 5C44H 4HJ5A 1N33Q 4B3MQ 4IJHA 4JI5Q 1QVCA 2LSSA 3HFZB 4GN3B 5ELNA 1YEZA 1QUQB 3HOYH 1QZGA 1E3PA 1VS0A 4POFA 3CCSA 3OTOL 2V1CC 4A4IA 4HIMA 1PH9A 2ZJQA 4JI0L 1Y1WH 1I50H 1YHBA 1VQHA 5HGQA 3U58A 2JA7G 4LF9L 4DNIA 5C44G 4LF7L 4LFBQ 3AQQA 3H0GG 5FLMH 3G71A 4QL5A 2UUBL 2DGYA 2VW9A 4JBMA 1CSPA 4DV2Q 1BBWA 1PH8A 4B3TQ 2R7DA 3HOYG 3PF4A 2Y0SG 5JJIA 3CCLA 3ERSX 1SFOH 3JAMc 4A3IH 4DV0Q 1FJGQ 1E24A 2VQEL 4L5QA 5H1SE 4DR2L 1Q7YC 2N3SA 2VZAA 3IRBA 4LF4L 3H3VI 4IOAA 2VUMH 1K3RA 1TXYA 2K50A 2OTLA 3TRZA 3A0JA 4X65L 5LMNW 4OWWB 4YHHQ 2KENA 2VL6A 1NTGA 1BBUA 4HIOA 3PGZA 3W5OA 1VQ8A 2Q2TA 1N32Q 4JI1Q 2XGTA 3ULJA 1S72A 3T1YL 4C3HH 1RL2A 1VQAA 1YNXA 1PYBA 3SGIA 4A3IG 2UU9Q 4B3SQ 4X64L 3A5ZB 4GNXC 1XPOA 2E2IH 1U0LA 2QA4A 1I94Q 4JG2A 4JV5Q 4IPGA 2MO0A 1L0WA 1VQ7A 5M5WH 3M85A 1A0IA 2BH8A 2IT1A 5M5YH 4J15A 4DUZQ 1B70B 1IBLQ 2ATWA 3F2DA 1UE6A 4PZ7A 4DR1L 4A3EG 1PH5A 4GKKL 3CC7A 3M7NA 3J80c 2UXCL 4KHPL 3EN2A 4DV5Q 3S1QH 1GD7A 2YTXA 2D0PA 1IXRA 5C4XH 4A3MH 3GDEA 5AJ3L 1YHQA 4NB3A 4DV7L 2E5LL 4GKJL 2NN6I 1AH9A 3LGJA 1PYSB 2KBNA 2A8VA 1YVCA 5IWAQ 1WI5A 4LF8L 1E22A 2YTVA 1N33L 1XNRL 3U50C 4WJ4A 3CC2A 3KF6B 4JI5L 4HIDA 4JI4Q 2LXJA 4QQBX 2UXDQ 3S14H 3ER0A 5JEAG 3FHWA 1JJCB 3PF5A 1K0RA 1KIXA 3KJOA 3GTMH 1HZAA 4O2DA 3DLLA 1VQ9A 3CQZH 2NVXH 2A19A 3GTQH 4A3GH 1XMOQ 3E0EA 5C0XG 1N34Q 3CCJA 4JI3Q 1X55A 4DR4Q 1VQCA 3J81j 4LFBL 1BKBA 4DV2L 4EQ5A 4IJLA 4B3TL 1X3GA 1X56A 2CFMA 2E8GA 5C3EH 2WAQG 4IPCA 1S40A 4IPHA 3J81i 1X9NA 4P73A 4DV0L 2NVQH 4AYBG 1AE2A 1UE7A 4JI2Q 4MNOA 3GTGH 2K5HA 4A3GG 1M1KC 4DV6Q 1HNWQ 4JYAL 4LWCA 4XIGS 3I4OA 1IZ6A 1X6OA 4YHHL 1AE3A 3PV0A 1VQEA 4K0KQ 1N32L 3NENA 4JI1L 1X65A 4QIWE 4C3JH 5C3EG 1X3FA 1VQGA 3S1NH 4B3SL 3CF5A 1B7YB 4R4IA 2DUDA 3GO5A 4DV1Q 4ME3A 4LUZA 3PUVA 4IO9A 2JK8A 1UE5A 1V43A 1I94L 2ES2A 3AEVA 2RCNA 1R9TH 1HH2P 4FDBA 1KC8C 2NVTH 4LNQA 3G4SA 3I2ZA 1IBLL 2KHIA 3HOZH 1TWCH 3HOXH 4X66Q 3ULLA 4X62Q 3HKZG 5EAYA 1VQMA 2AHOB 1YJ9A 2PI2E 2WAQE 4DV5L 4O0AA 1ASYA 4A3FH 1J6QA 4GN4B 3B6YA 1XTDA 2ZTEA 4P72A 4AYBE 2JA9A 3CMAA 2HIXA 3S2HH 1HNXQ 1A8VA 3H3VH 3WWVA 1NJIC 3HOXG 5K36G 3S17H 1VQNA 1LYLA 1QVGA 4R4QA 4DK6C 4LUOA 5IWAL 2RF4A 1YITA 1PH6A 2JA7H 4A3JH 1JJ2A 1H95A 5C0XJ 3H0GH 3STBC 4A3FG 4JI4L 1UE1A 2K75A 3CMEA 1Q86C 1GO3E 4PZ8A 4TQUS 4GLVB 3CPWA 1VQJA 2N78A 1DGSA 2N8NA 3D0FA 4GN5A 3I56A 4C3IH 2UUCL 2UXBL 3CCRA 4DR7L 4P75A 4DAMA 5HY6A 4DV4Q 1N34L 1FVIA 4YWKA 1WFQA 4JI3L 4A3JG 2WB1G 3UE1A 1HNZQ 4LFCQ 2PQAA 3PSIA 2AKWB 2A1AA 3HKZE 3CD6A 4BA1I 2EIFA 2HT1A 3I55A 1IBMQ 4OXPA 3PUZA 1V1QA 1IYJB 1Z47A 3JAMi 1V9PA 1I6HH 5E7NA 4WJ3M 3NBHB 4DR6Q 4JI2L 3S15H 4OWTB 4DKAC 4OO1I 5LMUQ 4DV6L 1HNWL 1TWGH 1Y1VG 1PH2A 1J5EQ 2VUMG 1G291 1W3SA 2ZM6Q 2UUAQ 5BR8Q 4R1JA 4K0KL 5JJLA 5LMNQ 5IE8A 1HJPA 4A3EH 3KYHC 1K8AC 2K5NA 2Q2IA 1KQSA 4UPAA 3CCUA 4DV1L 1WOCA 5IYCH 2JEAI 4KLKA 1EIYB 4DUYL 1Q12A 2H5XA 3UDIA 1XPRA 3EBEA 4YWMA 2IHEA 5GROA 4X6AH 3S2DH 2NN6G 2AWNA 4NXMQ 3J7A5 1GM5A 2KHJA 1I3QH 2HIVA 2WB1E 3J80i 4X66L 4X62L 3VDYA 4JOIA 1KHIA 1YBYA 3ZJYC 5IYCG 4DV3Q 2ASBA 4QGUA 4UP7A 1SR3A 4YCVA 1PH3A 2I5HA 2HQLA 1NBWA 2D62A 1I5FA 3K80C 3PCOB 1HNXL 4LF6L 2PMZE 5M3FH 1JB7A 4YCUA 2HHHQ 2BA1A 2PI2A 1SN8A 2OTJA 3RN5A 1KXLA 1XMQQ 1EQQA 4B3ML 4GNXB 1B8AA 3PUYA 4LFAQ 1C0AA 3F1ZA 4DAYB 4HJ7A 1EWIA 3AYHB 3STBD 4OONA 4A3LG 1KRSA 2R6GA 1A63A 3FKIH 1O7IA 5J3BA 1HR0W 3GTOH 2F3IA 3CAMA 5M3FG 5ELOA 2IX1A 1HR0Q 1PHJA 4GLXA 2E2HH 3K81C 2AMCB 2GVAA 3CP0A 1EFWA 4JI6Q 4DV4L 4BBRH 4LFCL 4PMWA 1QZHA 2R7ZH 2GN5A 2VY3A 3L0OA 3PUXA 2PQAB 1IBML 4MTNA 3FKIG 3W1BA 5GQOA 2NZOA 1K8GA 1JMCA 1WJJA 4JBWA 4Y52H 1HZCA 4GLAC 3D31A 4AQYQ 4DR6L 3PUWA 3RR5A 1FJGL 4EX5A 1QUQA 4JOIC 1Q81C 2VQFQ 1VQKA 5LMUL 1SMXA 3CPFA 4BBRG 1U5KA 4QJFA 3GD7A 4BY1H 2QEXA 2R7ZG 1VCIA 2EXDA 2ZM6L 3U4ZA 2K52A 5LMNL 1SROA 5GAGC 1TWHH 2I5LX 3TS2A 4GOPA 3E9IA 3F2CA 1IBKQ 2UU9L 4LF9Q 4PG3A 4LF7Q 1Q82C 2ZJPA 1Y14B 3KJPA 2UUBQ 5JJKA 2IHFA 1PH1A 1E7ZA 3S1MH 4BY1G 4JV5L 1OXTA 1HZBA 2B3GA 1PFSA 1P8LA 4DUZL 1UEBA 2RHSB 1K73C 2VQEQ 4NXML 2CWPA 2JQOA 2F52A 2R93H 3BJUA 4DR5Q 1VQFA 3KF8B 2YV5A 1A62A 4R4OA 5IYBG 3HOWH 3KDFA 1Q1EA 4IFDI 1CKMA 3OYYA 1BVSA 3T1YQ 4XTCS 1VQDA 4IPDA 4YY3Q 2CQOA 1TWFH 5FJ8H 4JC0A 1FL0A 1N9WA 3DM3A 4QY7A 3K0XA 5GADC 2R93G 1XPUA 3G6EA 3G48A 4IOCA 3T1HQ 3EIVA 2HHHL 4OX9Q 1M90C 1KAWA 2ZTCA 4L5SA 2KCMA 3HOWG 3OW2A 1PA6A 4JI8Q 1XMQL 4A93H 4LFAL 1NE3A 1Q8KA 1D7QA 3UE0A 1RIPA 1XNQQ 2UXCQ 3I4NH 5FJ8G 1CKNA 1GKHA 3CW2C 4OO1G 1EOVA 3L7ZC 2MFIA 4GOPC 1HR0L 4BBSG 1VQBA 4ALPA 4JI6L 2D0OA 4PZ6A 1XMOL 3TEHB 1SRUA 4KI0A 1Y1VH 4R4TA 5M3MH 1LTLA 2F4VQ 3K7AH 1MIUA 4NXNQ 4DR4L 2CKZB 4A93G 2CWAA 3UDFA 4C2MH 1T9HA 3MXNB 2E5LQ 1GVPA 2L15A 2KCTA 3PO3H 4LF5Q 3I4NG 3TS0A 2NZHA 1YIJA 2JA5H 4AQYL 2NVYH 3CC4A 1XNRQ 3GTKH 2IX0A 2VQFL 3HKSA 1VQPA 4YWLA 4IFDJ 2K5VA 5M3MG 4DR3Q 1NMFA 3HOUH 4UP8A 5IP9G 2I5MX 4Y7NH 1FGUA 3ULPA 4A3KH 4DPGA 2UXBQ 2VNUD 3FP9A 2ALYB 1QVFA 3PO3G 2BH2A 1P16A 4HIKA 2GVBA 1L1OA 3J7ZC 1IBKL 2JA5G 1E1OA 4APVA 3BU2A 1YHAA 4HJAA 4P71A 2LXKA 2AWOA 4GOPB 3PO2H 1Z9FA 4HJ9A 4AIMA 1PH7A 3HOUG 3UDGA 1L2FA 1LM0A 3S24A 4A3KG 2WFWA 1SE8A 3GTJH 1Y1WG 2YU9H 1KRTA 1EYGA 3M3YH 1VQIA 4DR5L 4JYAQ 1EIFA 4A75A 1K83H 1E1TA 1MJCA 4NPSA 5FLMG 3RNUA 2B63H 3PO2G 3RLNA 4UP9A 1JJGA 1ASZA 2YYZA 2K4KA 1N36Q 3KDFB 1IL2A 4A3LH 1EUJA 1CKOA 4YY3L 5GAEC 2Z0SA 4A3DH 4BXXH 1NY4A 2MO1A 1OXVA 3T1HL 4LW1A 4OX9L 3CCVA 2B63G 1Q1BA 3E9HA 1G6PA 4JI8L 3CCEA 2QGQA 1MJEA 5C4JH 3RLFA 4YCWA 5IYDH 3KOJA 2ZJRA 4DK3C 4TVAB 5DLQE 2JJQA 2Q2UA 3NEMA 1XNQL 3S1RH 4A3DG 2Z6KA 4BXXG 5IT9c 4MZ9A 1KD1C 2CCZA 3A74A 1L1OC 4AH6A 2Y0SE 1VQ5A 4BY7H 1VQ4A 4JBJA 1CKNB 3F2BA 1WCMH 1SLJA 2WP8J 1HNZL 2JEBI 3CCQA 2F4VL 4NXNL 3MEFA 1N8RC 3RN2A 3TQYA 1OTCA 1S3OA 5IYDG 2JA8H 2OQKA 1OXSC 3HOVH 3U4VA 4B3RQ 3M9BA 4OWXB 4LF5L 1LUZA 3RZOH 2IY5B 4JI7Q 3M4PA 1XJVA 2PNHA 4BY7G 1WCMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RMF A;  4DR3 L;  5C4X G;  1J5E L;  4A3M G;  3RZD H;  5FLX c;  2XTI A;  2OQ0 A;  2RHQ B;  1W2B A;  3JC6 6;  1VQL A;  5BR8 L;  2UUA L;  3PIO A;  3OTO Q;  2UUC Q;  4JI0 Q;  3AFP A;  2JA8 G;  3HOV G;  2VS1 A;  4DR7 Q;  5IP7 H;  2MQH A;  4BA2 I;  4POG A;  2JE6 I;  2MNA A;  2OCE A;  1WYD A;  4IFD G;  1L1O B;  3AFQ A;  5IYB H;  4A3C H;  4HJ8 A;  1TWA H;  4L5R C;  3GTL H;  1C9O A;  1JE5 A;  1C7Y A;  5IY0 A;  1OXU A;  2K14 A;  1KL9 A;  3K8A A;  3NEL A;  1PVO A;  3K7U C;  2E2J H;  2FXQ A;  3J81 c;  1EQR A;  2YTY A;  1YZ6 A;  2ID0 A;  2Q2H A;  4JCV E;  5IP7 G;  2Z6K C;  1UWV A;  1MKH A;  3UDX A;  3A5U A;  4DR2 Q;  4LF4 Q;  1K9M C;  3CCM A;  4UY8 C;  5M5X H;  4P74 A;  2OWO A;  4A3C G;  4X65 Q;  3BZC A;  5C0X I;  4DV3 L;  3RLO A;  1YI2 A;  4JBK A;  4H02 A;  1G51 A;  1N36 L;  3M4O H;  2N49 A;  1YJN A;  4X64 Q;  2EQS A;  3Q8D A;  1X54 A;  2BA0 A;  3I4M H;  4DUY Q;  4BBS H;  2JA6 H;  1X3E A;  1OXX K;  4A3B H;  4L5T A;  1JT8 A;  3I7F A;  3BZK A;  5GAH C;  1CUK A;  2R92 H;  3S16 H;  4A76 A;  4DR1 Q;  3GTP H;  3M4Q A;  4GKK Q;  3KFU A;  3H15 A;  3PIP A;  2B29 A;  4GS3 A;  4KHP Q;  3I4M G;  2UXD L;  3TRE A;  1D8L A;  1HZ9 A;  3ICE A;  4RG1 A;  1PH4 A;  3F8T A;  2I0Q A;  2JA6 G;  4A3B G;  3CXC A;  1PV4 A;  3L2P A;  2R92 G;  4KHZ A;  1Q46 A;  4LUV A;  5AJ3 Q;  3W1G A;  5IP9 H;  2C35 B;  5JEA J;  4DV7 Q;  4LF6 Q;  1VQO A;  3HOZ G;  4GKJ Q;  2R7F A;  2ZTD A;  1YJW A;  1CSQ A;  4B3R L;  4GNX A;  1VQ6 A;  1NMG A;  4JI7 L;  4LF8 Q;  4R4C A;  3KLW A;  3KF6 A;  5C44 H;  4HJ5 A;  1N33 Q;  4B3M Q;  4IJH A;  4JI5 Q;  1QVC A;  2LSS A;  3HFZ B;  4GN3 B;  5ELN A;  1YEZ A;  1QUQ B;  3HOY H;  1QZG A;  1E3P A;  1VS0 A;  4POF A;  3CCS A;  3OTO L;  2V1C C;  4A4I A;  4HIM A;  1PH9 A;  2ZJQ A;  4JI0 L;  1Y1W H;  1I50 H;  1YHB A;  1VQH A;  5HGQ A;  3U58 A;  2JA7 G;  4LF9 L;  4DNI A;  5C44 G;  4LF7 L;  4LFB Q;  3AQQ A;  3H0G G;  5FLM H;  3G71 A;  4QL5 A;  2UUB L;  2DGY A;  2VW9 A;  4JBM A;  1CSP A;  4DV2 Q;  1BBW A;  1PH8 A;  4B3T Q;  2R7D A;  3HOY G;  3PF4 A;  2Y0S G;  5JJI A;  3CCL A;  3ERS X;  1SFO H;  3JAM c;  4A3I H;  4DV0 Q;  1FJG Q;  1E24 A;  2VQE L;  4L5Q A;  5H1S E;  4DR2 L;  1Q7Y C;  2N3S A;  2VZA A;  3IRB A;  4LF4 L;  3H3V I;  4IOA A;  2VUM H;  1K3R A;  1TXY A;  2K50 A;  2OTL A;  3TRZ A;  3A0J A;  4X65 L;  5LMN W;  4OWW B;  4YHH Q;  2KEN A;  2VL6 A;  1NTG A;  1BBU A;  4HIO A;  3PGZ A;  3W5O A;  1VQ8 A;  2Q2T A;  1N32 Q;  4JI1 Q;  2XGT A;  3ULJ A;  1S72 A;  3T1Y L;  4C3H H;  1RL2 A;  1VQA A;  1YNX A;  1PYB A;  3SGI A;  4A3I G;  2UU9 Q;  4B3S Q;  4X64 L;  3A5Z B;  4GNX C;  1XPO A;  2E2I H;  1U0L A;  2QA4 A;  1I94 Q;  4JG2 A;  4JV5 Q;  4IPG A;  2MO0 A;  1L0W A;  1VQ7 A;  5M5W H;  3M85 A;  1A0I A;  2BH8 A;  2IT1 A;  5M5Y H;  4J15 A;  4DUZ Q;  1B70 B;  1IBL Q;  2ATW A;  3F2D A;  1UE6 A;  4PZ7 A;  4DR1 L;  4A3E G;  1PH5 A;  4GKK L;  3CC7 A;  3M7N A;  3J80 c;  2UXC L;  4KHP L;  3EN2 A;  4DV5 Q;  3S1Q H;  1GD7 A;  2YTX A;  2D0P A;  1IXR A;  5C4X H;  4A3M H;  3GDE A;  5AJ3 L;  1YHQ A;  4NB3 A;  4DV7 L;  2E5L L;  4GKJ L;  2NN6 I;  1AH9 A;  3LGJ A;  1PYS B;  2KBN A;  2A8V A;  1YVC A;  5IWA Q;  1WI5 A;  4LF8 L;  1E22 A;  2YTV A;  1N33 L;  1XNR L;  3U50 C;  4WJ4 A;  3CC2 A;  3KF6 B;  4JI5 L;  4HID A;  4JI4 Q;  2LXJ A;  4QQB X;  2UXD Q;  3S14 H;  3ER0 A;  5JEA G;  3FHW A;  1JJC B;  3PF5 A;  1K0R A;  1KIX A;  3KJO A;  3GTM H;  1HZA A;  4O2D A;  3DLL A;  1VQ9 A;  3CQZ H;  2NVX H;  2A19 A;  3GTQ H;  4A3G H;  1XMO Q;  3E0E A;  5C0X G;  1N34 Q;  3CCJ A;  4JI3 Q;  1X55 A;  4DR4 Q;  1VQC A;  3J81 j;  4LFB L;  1BKB A;  4DV2 L;  4EQ5 A;  4IJL A;  4B3T L;  1X3G A;  1X56 A;  2CFM A;  2E8G A;  5C3E H;  2WAQ G;  4IPC A;  1S40 A;  4IPH A;  3J81 i;  1X9N A;  4P73 A;  4DV0 L;  2NVQ H;  4AYB G;  1AE2 A;  1UE7 A;  4JI2 Q;  4MNO A;  3GTG H;  2K5H A;  4A3G G;  1M1K C;  4DV6 Q;  1HNW Q;  4JYA L;  4LWC A;  4XIG S;  3I4O A;  1IZ6 A;  1X6O A;  4YHH L;  1AE3 A;  3PV0 A;  1VQE A;  4K0K Q;  1N32 L;  3NEN A;  4JI1 L;  1X65 A;  4QIW E;  4C3J H;  5C3E G;  1X3F A;  1VQG A;  3S1N H;  4B3S L;  3CF5 A;  1B7Y B;  4R4I A;  2DUD A;  3GO5 A;  4DV1 Q;  4ME3 A;  4LUZ A;  3PUV A;  4IO9 A;  2JK8 A;  1UE5 A;  1V43 A;  1I94 L;  2ES2 A;  3AEV A;  2RCN A;  1R9T H;  1HH2 P;  4FDB A;  1KC8 C;  2NVT H;  4LNQ A;  3G4S A;  3I2Z A;  1IBL L;  2KHI A;  3HOZ H;  1TWC H;  3HOX H;  4X66 Q;  3ULL A;  4X62 Q;  3HKZ G;  5EAY A;  1VQM A;  2AHO B;  1YJ9 A;  2PI2 E;  2WAQ E;  4DV5 L;  4O0A A;  1ASY A;  4A3F H;  1J6Q A;  4GN4 B;  3B6Y A;  1XTD A;  2ZTE A;  4P72 A;  4AYB E;  2JA9 A;  3CMA A;  2HIX A;  3S2H H;  1HNX Q;  1A8V A;  3H3V H;  3WWV A;  1NJI C;  3HOX G;  5K36 G;  3S17 H;  1VQN A;  1LYL A;  1QVG A;  4R4Q A;  4DK6 C;  4LUO A;  5IWA L;  2RF4 A;  1YIT A;  1PH6 A;  2JA7 H;  4A3J H;  1JJ2 A;  1H95 A;  5C0X J;  3H0G H;  3STB C;  4A3F G;  4JI4 L;  1UE1 A;  2K75 A;  3CME A;  1Q86 C;  1GO3 E;  4PZ8 A;  4TQU S;  4GLV B;  3CPW A;  1VQJ A;  2N78 A;  1DGS A;  2N8N A;  3D0F A;  4GN5 A;  3I56 A;  4C3I H;  2UUC L;  2UXB L;  3CCR A;  4DR7 L;  4P75 A;  4DAM A;  5HY6 A;  4DV4 Q;  1N34 L;  1FVI A;  4YWK A;  1WFQ A;  4JI3 L;  4A3J G;  2WB1 G;  3UE1 A;  1HNZ Q;  4LFC Q;  2PQA A;  3PSI A;  2AKW B;  2A1A A;  3HKZ E;  3CD6 A;  4BA1 I;  2EIF A;  2HT1 A;  3I55 A;  1IBM Q;  4OXP A;  3PUZ A;  1V1Q A;  1IYJ B;  1Z47 A;  3JAM i;  1V9P A;  1I6H H;  5E7N A;  4WJ3 M;  3NBH B;  4DR6 Q;  4JI2 L;  3S15 H;  4OWT B;  4DKA C;  4OO1 I;  5LMU Q;  4DV6 L;  1HNW L;  1TWG H;  1Y1V G;  1PH2 A;  1J5E Q;  2VUM G;  1G29 1;  1W3S A;  2ZM6 Q;  2UUA Q;  5BR8 Q;  4R1J A;  4K0K L;  5JJL A;  5LMN Q;  5IE8 A;  1HJP A;  4A3E H;  3KYH C;  1K8A C;  2K5N A;  2Q2I A;  1KQS A;  4UPA A;  3CCU A;  4DV1 L;  1WOC A;  5IYC H;  2JEA I;  4KLK A;  1EIY B;  4DUY L;  1Q12 A;  2H5X A;  3UDI A;  1XPR A;  3EBE A;  4YWM A;  2IHE A;  5GRO A;  4X6A H;  3S2D H;  2NN6 G;  2AWN A;  4NXM Q;  3J7A 5;  1GM5 A;  2KHJ A;  1I3Q H;  2HIV A;  2WB1 E;  3J80 i;  4X66 L;  4X62 L;  3VDY A;  4JOI A;  1KHI A;  1YBY A;  3ZJY C;  5IYC G;  4DV3 Q;  2ASB A;  4QGU A;  4UP7 A;  1SR3 A;  4YCV A;  1PH3 A;  2I5H A;  2HQL A;  1NBW A;  2D62 A;  1I5F A;  3K80 C;  3PCO B;  1HNX L;  4LF6 L;  2PMZ E;  5M3F H;  1JB7 A;  4YCU A;  2HHH Q;  2BA1 A;  2PI2 A;  1SN8 A;  2OTJ A;  3RN5 A;  1KXL A;  1XMQ Q;  1EQQ A;  4B3M L;  4GNX B;  1B8A A;  3PUY A;  4LFA Q;  1C0A A;  3F1Z A;  4DAY B;  4HJ7 A;  1EWI A;  3AYH B;  3STB D;  4OON A;  4A3L G;  1KRS A;  2R6G A;  1A63 A;  3FKI H;  1O7I A;  5J3B A;  1HR0 W;  3GTO H;  2F3I A;  3CAM A;  5M3F G;  5ELO A;  2IX1 A;  1HR0 Q;  1PHJ A;  4GLX A;  2E2H H;  3K81 C;  2AMC B;  2GVA A;  3CP0 A;  1EFW A;  4JI6 Q;  4DV4 L;  4BBR H;  4LFC L;  4PMW A;  1QZH A;  2R7Z H;  2GN5 A;  2VY3 A;  3L0O A;  3PUX A;  2PQA B;  1IBM L;  4MTN A;  3FKI G;  3W1B A;  5GQO A;  2NZO A;  1K8G A;  1JMC A;  1WJJ A;  4JBW A;  4Y52 H;  1HZC A;  4GLA C;  3D31 A;  4AQY Q;  4DR6 L;  3PUW A;  3RR5 A;  1FJG L;  4EX5 A;  1QUQ A;  4JOI C;  1Q81 C;  2VQF Q;  1VQK A;  5LMU L;  1SMX A;  3CPF A;  4BBR G;  1U5K A;  4QJF A;  3GD7 A;  4BY1 H;  2QEX A;  2R7Z G;  1VCI A;  2EXD A;  2ZM6 L;  3U4Z A;  2K52 A;  5LMN L;  1SRO A;  5GAG C;  1TWH H;  2I5L X;  3TS2 A;  4GOP A;  3E9I A;  3F2C A;  1IBK Q;  2UU9 L;  4LF9 Q;  4PG3 A;  4LF7 Q;  1Q82 C;  2ZJP A;  1Y14 B;  3KJP A;  2UUB Q;  5JJK A;  2IHF A;  1PH1 A;  1E7Z A;  3S1M H;  4BY1 G;  4JV5 L;  1OXT A;  1HZB A;  2B3G A;  1PFS A;  1P8L A;  4DUZ L;  1UEB A;  2RHS B;  1K73 C;  2VQE Q;  4NXM L;  2CWP A;  2JQO A;  2F52 A;  2R93 H;  3BJU A;  4DR5 Q;  1VQF A;  3KF8 B;  2YV5 A;  1A62 A;  4R4O A;  5IYB G;  3HOW H;  3KDF A;  1Q1E A;  4IFD I;  1CKM A;  3OYY A;  1BVS A;  3T1Y Q;  4XTC S;  1VQD A;  4IPD A;  4YY3 Q;  2CQO A;  1TWF H;  5FJ8 H;  4JC0 A;  1FL0 A;  1N9W A;  3DM3 A;  4QY7 A;  3K0X A;  5GAD C;  2R93 G;  1XPU A;  3G6E A;  3G48 A;  4IOC A;  3T1H Q;  3EIV A;  2HHH L;  4OX9 Q;  1M90 C;  1KAW A;  2ZTC A;  4L5S A;  2KCM A;  3HOW G;  3OW2 A;  1PA6 A;  4JI8 Q;  1XMQ L;  4A93 H;  4LFA L;  1NE3 A;  1Q8K A;  1D7Q A;  3UE0 A;  1RIP A;  1XNQ Q;  2UXC Q;  3I4N H;  5FJ8 G;  1CKN A;  1GKH A;  3CW2 C;  4OO1 G;  1EOV A;  3L7Z C;  2MFI A;  4GOP C;  1HR0 L;  4BBS G;  1VQB A;  4ALP A;  4JI6 L;  2D0O A;  4PZ6 A;  1XMO L;  3TEH B;  1SRU A;  4KI0 A;  1Y1V H;  4R4T A;  5M3M H;  1LTL A;  2F4V Q;  3K7A H;  1MIU A;  4NXN Q;  4DR4 L;  2CKZ B;  4A93 G;  2CWA A;  3UDF A;  4C2M H;  1T9H A;  3MXN B;  2E5L Q;  1GVP A;  2L15 A;  2KCT A;  3PO3 H;  4LF5 Q;  3I4N G;  3TS0 A;  2NZH A;  1YIJ A;  2JA5 H;  4AQY L;  2NVY H;  3CC4 A;  1XNR Q;  3GTK H;  2IX0 A;  2VQF L;  3HKS A;  1VQP A;  4YWL A;  4IFD J;  2K5V A;  5M3M G;  4DR3 Q;  1NMF A;  3HOU H;  4UP8 A;  5IP9 G;  2I5M X;  4Y7N H;  1FGU A;  3ULP A;  4A3K H;  4DPG A;  2UXB Q;  2VNU D;  3FP9 A;  2ALY B;  1QVF A;  3PO3 G;  2BH2 A;  1P16 A;  4HIK A;  2GVB A;  1L1O A;  3J7Z C;  1IBK L;  2JA5 G;  1E1O A;  4APV A;  3BU2 A;  1YHA A;  4HJA A;  4P71 A;  2LXK A;  2AWO A;  4GOP B;  3PO2 H;  1Z9F A;  4HJ9 A;  4AIM A;  1PH7 A;  3HOU G;  3UDG A;  1L2F A;  1LM0 A;  3S24 A;  4A3K G;  2WFW A;  1SE8 A;  3GTJ H;  1Y1W G;  2YU9 H;  1KRT A;  1EYG A;  3M3Y H;  1VQI A;  4DR5 L;  4JYA Q;  1EIF A;  4A75 A;  1K83 H;  1E1T A;  1MJC A;  4NPS A;  5FLM G;  3RNU A;  2B63 H;  3PO2 G;  3RLN A;  4UP9 A;  1JJG A;  1ASZ A;  2YYZ A;  2K4K A;  1N36 Q;  3KDF B;  1IL2 A;  4A3L H;  1EUJ A;  1CKO A;  4YY3 L;  5GAE C;  2Z0S A;  4A3D H;  4BXX H;  1NY4 A;  2MO1 A;  1OXV A;  3T1H L;  4LW1 A;  4OX9 L;  3CCV A;  2B63 G;  1Q1B A;  3E9H A;  1G6P A;  4JI8 L;  3CCE A;  2QGQ A;  1MJE A;  5C4J H;  3RLF A;  4YCW A;  5IYD H;  3KOJ A;  2ZJR A;  4DK3 C;  4TVA B;  5DLQ E;  2JJQ A;  2Q2U A;  3NEM A;  1XNQ L;  3S1R H;  4A3D G;  2Z6K A;  4BXX G;  5IT9 c;  4MZ9 A;  1KD1 C;  2CCZ A;  3A74 A;  1L1O C;  4AH6 A;  2Y0S E;  1VQ5 A;  4BY7 H;  1VQ4 A;  4JBJ A;  1CKN B;  3F2B A;  1WCM H;  1SLJ A;  2WP8 J;  1HNZ L;  2JEB I;  3CCQ A;  2F4V L;  4NXN L;  3MEF A;  1N8R C;  3RN2 A;  3TQY A;  1OTC A;  1S3O A;  5IYD G;  2JA8 H;  2OQK A;  1OXS C;  3HOV H;  3U4V A;  4B3R Q;  3M9B A;  4OWX B;  4LF5 L;  1LUZ A;  3RZO H;  2IY5 B;  4JI7 Q;  3M4P A;  1XJV A;  2PNH A;  4BY7 G;  1WCM G; 
#chains in the Genus database with same CATH topology
 1WTV A;  3RZD H;  2OQ0 A;  1JC7 A;  3JC6 6;  2UUA L;  2JA8 G;  3PIO A;  3AFP A;  3QOJ A;  3RUZ A;  1IL8 A;  3T56 B;  4FXD A;  5KNC A;  1X32 A;  2SNS A;  2MNA A;  3C2P A;  3AFQ A;  1PFM A;  2JXM B;  4HSV A;  5M5Y B;  3K5M A;  1B3Q A;  1C9O A;  1JE5 A;  3QIA A;  3EQL C;  5F2D A;  3NEL A;  1PVO A;  5KNB A;  1D1K A;  3K7U C;  3J81 c;  1EQR A;  5CC4 A;  2ID0 A;  2H4O A;  1UWV A;  5EJW A;  3UDX A;  3WOF A;  3CCM A;  4UY8 C;  1B50 A;  1VF5 C;  4EVO A;  1A3V A;  5C0X I;  1SNM A;  3M4O H;  2N49 A;  4CDE C;  3V2T A;  1X54 A;  4BBS H;  3J80 E;  1CHQ D;  2J7Z A;  3NQI A;  2K5W A;  3VR5 A;  2R92 H;  5JVH 3;  2CQA A;  3M4Q A;  3GTM B;  1F9S A;  3A54 A;  2NTT A;  1I4G A;  1BR9 A;  1PRT C;  2IL8 A;  2MGS A;  1V1P B;  3ICE A;  1E2Z A;  1G2T A;  3CXC A;  3BYY B;  2R92 G;  2WV6 D;  3K6O A;  4LUV A;  5IP9 H;  2BE5 D;  4KV6 A;  1X3Q A;  4DK1 A;  1JOR A;  1ILP A;  1WTO A;  1N33 Q;  1K3B C;  4HJ5 A;  3QWN A;  2WAC A;  4IJH A;  4JI5 Q;  3HFZ B;  1QUQ B;  2FIN B;  1PTO B;  1VS0 A;  3S1N B;  3CCS A;  2EY1 A;  4HIM A;  1PH9 A;  2SDF A;  1Y1W H;  1AZQ A;  1D2B A;  5C3X A;  1I4P A;  4RGM A;  2JA7 G;  2B2W C;  4LFB Q;  5FLM H;  2UUB L;  2VW9 A;  4DV2 Q;  2R7D A;  4KN7 C;  1R4P B;  2Y0S G;  3OMC A;  1SFO H;  4G57 A;  3H3V I;  4L5Q A;  2Z6B A;  2N3S A;  2VZA A;  3IRB A;  1F2M A;  2B2U C;  1K3R A;  2K50 A;  3K5L A;  1JIC A;  3A0J A;  1JOQ A;  1BBU A;  1WTP A;  3S2H B;  2K7V A;  4PV1 C;  1VQ8 A;  1N32 Q;  2XGT A;  1RL2 A;  1K8M A;  1VQA A;  3EVQ A;  1PYB A;  1XWE A;  3TP7 A;  5E1F A;  2E2I H;  2QA4 A;  1A2U A;  2XN9 C;  1PLF A;  5FK9 C;  2MUY A;  1ONL A;  1A0I A;  2BH8 A;  4J15 A;  3F2D A;  1RTN A;  1UE6 A;  4DR1 L;  1U4L A;  4GKK L;  3HZX A;  1SNQ A;  3CRL C;  3Q6S A;  1DXM A;  2PMZ B;  2F0M A;  3KLS X;  3T51 B;  4ZK9 B;  3E6Z X;  3GDE A;  4RKB A;  1YHQ A;  4GKJ L;  4KKT A;  3GTK B;  2NN6 I;  1YVC A;  1UUP A;  4NW2 A;  2J0T D;  1E22 A;  3QG1 A;  1STG A;  1UEA B;  2PCF B;  1BOS A;  2EYP A;  4HID A;  3D8G A;  1SYD A;  1JJC B;  1KIX A;  4O1N A;  2F0N A;  4O2D A;  3DLL A;  3I73 A;  2AQ2 B;  1EIG A;  1X55 A;  2NZ1 D;  3G7L A;  1LAB A;  5M9O A;  4IJL A;  4B3T L;  1X3G A;  2V4D A;  1B1Z A;  2CFM A;  2F0E A;  5C3E H;  2WAQ G;  4IPC A;  1UAP A;  4F88 A;  4JI2 Q;  1UE7 A;  3GTG H;  2K5H A;  1IHZ A;  4FXG C;  4LWC A;  4XIG S;  1IZ6 A;  5AFW A;  2XNA C;  2C9O A;  4JI1 L;  5C3E G;  5CV8 A;  4RAU C;  2XWB B;  3KLS A;  1I94 L;  2L55 A;  2F03 A;  2HDL A;  4UDU C;  1R9T H;  1HH2 P;  2WII B;  2NVT H;  1IBL L;  3I2Z A;  1FGB D;  1TWC H;  3HOX H;  4S3S A;  3ULL A;  1JOO A;  3HKZ G;  1VQM A;  3DWA A;  1ASY A;  4A3F H;  1DZ1 A;  3NBI A;  5I6Y A;  4AYB E;  1ML0 D;  2JA9 A;  3I70 A;  1A8V A;  4OIK A;  5DNF A;  1EY9 A;  1NJI C;  3HOX G;  1ZXT A;  2FMC A;  5ELB A;  1LYL A;  3SR1 A;  4R4Q A;  5IWA L;  3BYT B;  4DAY A;  1PH6 A;  4A3J H;  4FP5 D;  4BY1 B;  5C0X J;  3RZD B;  1H95 A;  4A3F G;  4JI4 L;  1M8A A;  1UE1 A;  2K75 A;  1HA6 A;  2IPK D;  3KBX A;  4GLV B;  5D3I B;  2N8N A;  3I56 A;  2UUC L;  1T5E A;  2Z4I A;  2LY7 A;  3CCR A;  5CMD A;  4RA8 A;  5KEE A;  1N34 L;  4LFC Q;  4A3J G;  1HNZ Q;  3UE1 A;  3DEO A;  2ICI A;  3N52 A;  2EIF A;  2RCF A;  5DAU A;  2RKS A;  3PUZ A;  4QUF A;  3AMU A;  2R93 B;  1Z47 A;  1HFG A;  3K5N A;  1I6H H;  5EBD A;  2LS0 1;  3WDN A;  3Q23 A;  1IYV A;  2AUK A;  2B8G A;  5LMU Q;  3K58 A;  1HNW L;  3CHB D;  5JJL A;  2ZXR A;  1KTK A;  3KYH C;  1K8A C;  2Q2I A;  4BBS B;  4LAA A;  1QG7 A;  3H09 A;  5T1G A;  4DV1 L;  1WOC A;  1H9R A;  3GV6 A;  3DWP A;  5I9O A;  3C1F A;  4XQQ A;  4K8J A;  2IHE A;  5GRO A;  4X6A H;  3S2D H;  2FFK B;  2EDG A;  4O42 A;  1DCZ A;  1LT3 D;  3J7A 5;  3P75 A;  4XQJ A;  1I4X A;  4ID6 A;  5HUR A;  3I91 A;  3KLR A;  2AQ3 B;  3ZJY C;  5M3M B;  1STN A;  4EQP A;  4KKU A;  4UP7 A;  1SR3 A;  4QGU A;  1PH3 A;  5KYI A;  2Q8T A;  1NBW A;  1EQV A;  3X3M A;  1JCK B;  1I5F A;  5CGK A;  1D5M C;  1JB7 A;  2NVY B;  1EOT A;  2RSO A;  4DN4 M;  5C0X H;  4IUV A;  3VR4 A;  1EQQ A;  4CDD C;  3J7A V;  3DXJ C;  3PUY A;  2Y0S B;  2M2L A;  3HOU B;  3F1Z A;  3F2U A;  5JPM C;  3AYH B;  2Z9H A;  4HJ7 A;  4A3K B;  1Y1W B;  1A63 A;  2JP1 A;  2NBF A;  3OHX C;  3ITP A;  2IX1 A;  2E2H H;  2AMC B;  4DV4 L;  1TKW B;  3BVG A;  1QZH A;  3TZD A;  3DUZ A;  2GN5 A;  4XXE A;  2VY3 A;  1STA A;  3L0O A;  1IBM L;  1FNU A;  5GQO A;  2K5D A;  3SEB A;  4JBW A;  1HZC A;  1TS3 A;  4GLA C;  1Y8P B;  4KD3 A;  4DR6 L;  1K83 B;  3RR5 A;  2OF1 A;  4B9X A;  1VMP A;  1U5K A;  2F0T A;  1QOH A;  2QEX A;  2ZM6 L;  2WIN B;  3RMH A;  1QE6 A;  4A3D B;  3MEH A;  2I5L X;  5GAG C;  3TS2 A;  2DJF C;  1IBK Q;  4CJ2 C;  4LF7 Q;  1PTO F;  1Y14 B;  1A2T A;  4DA2 A;  1PH1 A;  4J8Q A;  3S1M H;  1HZB A;  1PFS A;  1P8L A;  3S1R B;  4RGO S;  1EU3 A;  1K73 C;  2RHS B;  4NXM L;  2VQE Q;  1AFP A;  2F52 A;  1BCP C;  1HTP A;  4E6I A;  1SYC A;  5C5L A;  5CBA E;  4MN3 A;  1BVS A;  1WTW A;  4J1M A;  1VQD A;  1KAB A;  4YY3 Q;  4XQN A;  5G3L F;  1TY2 A;  5FJ8 H;  2A68 C;  4QY7 A;  3DM3 A;  4TKO B;  1I6V C;  1KAW A;  4KD4 A;  2F3W A;  2F0H A;  3A7A B;  4NDX A;  1D7Q A;  4LK1 C;  2UXC Q;  5FJ8 G;  3T4A C;  3L7Z C;  3WOE A;  1HA5 A;  4GOP C;  1ESR A;  5FOB B;  2D0O A;  1TWA B;  3GTL B;  1Y1V H;  1LTL A;  3K7A H;  2FMM A;  3UDF A;  4C2M H;  2L15 A;  3PO3 H;  3GTG B;  3TS0 A;  1II3 A;  3W3A A;  3UI2 A;  2VQF L;  4YWL A;  2K5V A;  1HQR D;  3CKI B;  1HRJ A;  5FO8 B;  2I5M X;  2UXB Q;  3J81 L;  4ULL A;  2NN6 H;  3PO3 G;  4CKB A;  3I4M B;  2GVB A;  2F0U A;  1FNV A;  3N6R A;  5A2Q L;  2A69 D;  2PW5 A;  4HJ9 A;  3S16 B;  2NVT B;  5L37 A;  2XIW A;  3HOX B;  4N9P A;  2WFW A;  3GTJ H;  2YU9 H;  1KRT A;  1EYG A;  2KEC A;  1D1I A;  4ZUI A;  1TT2 A;  1PFN A;  4L6T B;  2K05 A;  3EFX D;  2B63 H;  3RNU A;  4XT3 B;  3NTK A;  1LTS D;  2BOS A;  2K4K A;  1N36 Q;  4RGT A;  1O7L A;  1A3U A;  1NY4 A;  4DXF A;  5C44 B;  3EJI A;  4A3J B;  5I2Y A;  4LW1 A;  4DXG A;  3CCV A;  2B63 G;  1G6P A;  1ZKO A;  2BDO A;  1SE2 A;  4KY7 A;  5C4J H;  4X3S A;  3RLF A;  5IYD H;  3KOJ A;  2ZJR A;  4CJ0 B;  4C3H G;  1SYB A;  5DLQ E;  3A56 A;  1BNZ A;  1V1P A;  2G5D A;  5IT9 c;  2UXD Q;  4C1N I;  3DMU A;  5IGD A;  1CKN B;  3F2B A;  5J22 A;  2WP8 J;  3CCQ A;  3MEF A;  1TII D;  2XSC A;  4CKC A;  5IYD G;  2IY5 B;  4LF5 L;  2KVM A;  2HDM A;  3M4P A;  2E2D C;  1S5C D;  4RMF A;  4DR3 L;  5C4X G;  1DOL A;  4A3M G;  3DWQ A;  2XTI A;  2PZW A;  2EXZ A;  2RQX A;  4JI0 Q;  1ZYR D;  1BQQ T;  4QF4 A;  3BVZ A;  3JAM E;  1IYU A;  3SDZ A;  1WYD A;  4Q0F A;  5IYB H;  2EVB A;  3MHB A;  2EYM A;  4HJ8 A;  1SBB B;  3S2D B;  1GUT A;  1SMY C;  4J6H A;  3NBH A;  3K8A A;  2K14 A;  2FXQ A;  2EYH A;  1YZ6 A;  4JCV E;  4LF4 Q;  3TZU A;  5IGF A;  5KND A;  4P74 A;  3BZC A;  5ISR A;  2RSN A;  4OL7 A;  1I4R A;  3OIP A;  1EYA A;  3AU7 A;  1S5D D;  1JB3 A;  4X64 Q;  2EQS A;  2BA0 A;  4FF1 A;  4DUY Q;  1OXX K;  4A3B H;  3TP8 A;  3I7F A;  4DAP A;  3BZK A;  3BVM A;  1U4P A;  4C3J G;  2E2H B;  1DJR D;  3SK8 A;  2NVX B;  3OSO A;  4A3G B;  4KHP Q;  1AP0 A;  3HRZ C;  3TRE A;  3F8T A;  4A3B G;  2BDN A;  4JW0 A;  5T1I A;  1PV4 A;  2NB0 A;  1Q46 A;  5IGE A;  1XYI A;  5JEA J;  2D9U A;  2ZTD A;  4B3R L;  4RH6 A;  4GNX A;  1NMG A;  4LF8 Q;  3I90 A;  4R4C A;  4V19 0;  5C4H A;  3MFG A;  2K03 A;  4GN3 B;  3HOY H;  1YEZ A;  4F87 A;  1E3P A;  2VB2 X;  4ODG A;  2V1C C;  4A4I A;  1S5E D;  1TS2 A;  5HGQ A;  3U58 A;  4LF9 L;  4DNI A;  2KEE A;  4IUN A;  3S1M B;  3AQQ A;  3H0G G;  3G71 A;  4QL5 A;  4JBM A;  1CSP A;  1BBW A;  1LV9 A;  3HOY G;  5JVG 3;  5JJI A;  4C3I G;  1PXU A;  1Q7Y C;  5JAV A;  3TN2 A;  2QW7 A;  4H44 C;  2IW3 A;  3TRZ A;  2OTL A;  2QCP X;  5LMN W;  4WRD A;  2EY2 A;  4OWW B;  3A8J E;  5LL6 S;  3TME A;  1YNX A;  4UAI A;  1STB A;  3A5Z B;  1XPO A;  3R2T A;  4FF4 A;  1GXD C;  4JV5 Q;  1L0W A;  2MO0 A;  1V1O A;  5M5W H;  2IT1 A;  2ATW A;  3KF8 A;  4DUZ Q;  4PZ7 A;  4A3E G;  2IJ0 A;  3CC7 A;  3J80 c;  1Y1V B;  4WJW A;  4CHT B;  1G91 A;  3K7A B;  3S1Q H;  4K5X A;  1GD7 A;  2D0P A;  1MBY A;  1L0X B;  2Z8L A;  5JEA H;  2FJ2 A;  4ZQ3 A;  4G7O C;  1HTL D;  1AH9 A;  1PYS B;  2KBN A;  2A8V A;  2Z4H A;  3TBI B;  3SK4 A;  1HFN A;  3CRK C;  1N33 L;  3QO2 A;  5G3L D;  4JI5 L;  4QQB X;  3SK5 A;  5IIF A;  3S14 H;  3ER0 A;  5DEH A;  5D14 A;  5JEA G;  2DJG C;  3PF5 A;  3CQZ H;  1E0B A;  3SHL A;  4G4K A;  3GTQ H;  1XMO Q;  2DY8 A;  1IW7 D;  4LJZ C;  4LFB L;  1VQC A;  3J81 j;  1BKB A;  4DV2 L;  2L1B A;  1KLG D;  4HCS A;  4HAE A;  1I3Q B;  4KJN A;  3MVV A;  4IPH A;  3J81 i;  4XT1 B;  4P73 A;  2NVQ H;  2KUM A;  2B2V C;  4MNO A;  4DV6 Q;  4ME5 A;  2XWJ B;  2CW0 C;  3Q22 A;  3ZYY X;  3I4O A;  4K14 A;  2PPB C;  1WD0 A;  1AE3 A;  1DOM A;  3PV0 A;  1N32 L;  3NSW A;  3NEN A;  4QIW E;  1VQG A;  3CU7 A;  1B7Y B;  2DUD A;  3GO5 A;  3NPP A;  3VA5 A;  2ENB A;  1UE5 A;  1V43 A;  3R2I A;  4B08 A;  4K5W A;  3G4S A;  5IGC A;  4HR7 B;  3VR3 A;  5EAY A;  2AHO B;  1YJ9 A;  4BBR B;  2WAQ E;  4V0B A;  4RCO A;  2ZTE A;  4L8J A;  2HIX A;  4ZLT F;  2EE1 A;  1ENC A;  1ET9 A;  3S17 H;  1GUW A;  1QVG A;  4LUO A;  1YIT A;  2JA7 H;  1SNP A;  1MGS A;  1GJX A;  3CME A;  1U9R A;  3ONA B;  3CPW A;  2N78 A;  4ZAI A;  3NK9 A;  1DGS A;  2NTS A;  3LWU A;  5EQ0 A;  4DR7 L;  4DAM A;  5HY6 A;  2KA7 A;  4YWK A;  2WB1 G;  4F8M A;  3PSI A;  2AKW B;  3HKZ E;  2NYZ D;  4BA1 I;  1WD1 A;  3MA2 B;  3NBH B;  2JN4 A;  4JI2 L;  3S15 H;  4OWT B;  2QDB A;  1TWG H;  3PQI A;  4MHE A;  1PH2 A;  1GUG A;  1JOK A;  2UUA Q;  1M4V A;  5IE8 A;  1HJP A;  4X3K A;  5JJZ A;  1KQS A;  1KDB A;  2TMP A;  3MXP A;  4A3B B;  3MXG A;  3CCU A;  3SVM A;  1FR3 A;  1SJH D;  2JEA I;  2I07 B;  4FO2 A;  4KLK A;  5KRU A;  3EBE A;  3R8B A;  2O5I C;  4CDF C;  4B9W A;  4IN3 A;  3GP7 A;  4K8I A;  2D2C C;  1TS4 A;  2QEJ C;  3KK7 A;  1VMC A;  4JOI A;  1EWH A;  3FRP B;  1EZ8 A;  5TSS A;  3G6J B;  2HQL A;  4G7H C;  2D62 A;  3K80 C;  3ERQ A;  4LF6 L;  5M3F H;  3BG3 A;  3K57 A;  4KHV A;  2E76 C;  5LL6 X;  1NR2 A;  3HOY B;  4R8N A;  1XMQ Q;  4B3M L;  4GNX B;  4LFA Q;  1GUN A;  4KKS A;  1EWI A;  4A3L G;  4OON A;  3FKI H;  1EY4 A;  1HR0 W;  3GTO H;  3CAM A;  5M3F G;  1HR0 Q;  4GLX A;  3RD4 A;  4LFC L;  3ND8 A;  2R7Z H;  3PUX A;  2PQA B;  3W1B A;  3FKI G;  1S5F D;  1PZJ D;  4AQY Q;  3PUW A;  1FJG L;  1LTA D;  1EY6 A;  4EX5 A;  2MPM A;  2M9V A;  3E5S A;  5LMU L;  5KGU A;  4QJF A;  4HN7 A;  2R7Z G;  1VCI A;  1T5X D;  2WKD A;  3FVQ A;  2G9H D;  1CTM A;  1TWH H;  2UU9 L;  4PG3 A;  2A69 C;  3KJP A;  2UUB Q;  2LKV A;  5M5W B;  1HQM C;  1E7Z A;  2B3G A;  1ILQ A;  2L0C A;  4DR5 Q;  4TRD A;  3KF8 B;  2YV5 A;  3IKJ A;  1YNN D;  4FVM A;  4BY7 B;  4P2C B;  4R4O A;  3HOW H;  5FO7 B;  1D5Z C;  2JA8 B;  2N88 A;  3HS0 C;  4XTC S;  4IPD A;  4ZCK A;  5IT9 L;  3K0X A;  3G48 A;  3T1H Q;  4OX9 Q;  3EIV A;  2ZTC A;  3HOW G;  1PA6 A;  3S14 B;  4A93 H;  1F9P A;  1IKM A;  1RTO A;  2JSO A;  3I4N H;  2PZU A;  1CKN A;  1WTQ A;  4OO1 G;  2MFI A;  1BF4 A;  1VQB A;  4I65 A;  3TEH B;  2F4V Q;  4DR4 L;  1LLR D;  4A93 G;  2CWA A;  2LFN A;  2NVQ B;  1RF2 D;  5FLX E;  3I4N G;  1YIJ A;  2JA5 H;  1SAP A;  1I4Q A;  2EYF A;  2IX0 A;  3H3V C;  1NMF A;  1ZYR C;  4H13 C;  3M4O B;  4ZKB B;  1FGU A;  4DPG A;  1QVF A;  4HED A;  2F0Q A;  1K8O A;  1IBK L;  2JA5 G;  1FD7 D;  3BU2 A;  4HJA A;  2AWO A;  3PO2 H;  3GQB A;  1Z9F A;  2X6L A;  2R92 B;  4G7Z C;  4AIM A;  1L2F A;  2E75 C;  3OIQ A;  1MI2 A;  3M4Y A;  3J7Y W;  1B4O A;  1HCZ A;  1WTR A;  2F0O A;  3I3C A;  1EIF A;  4A75 A;  1SE4 A;  2O5J C;  4NPS A;  3PO2 G;  2F0G A;  4IUQ A;  5HGT A;  3KDF B;  4HMJ A;  3S17 B;  4HMI A;  4YY3 L;  1RKN A;  5GAE C;  4BXX H;  2JA7 B;  5BN3 A;  1OXV A;  1D6E C;  2XRQ D;  3A8K E;  3E9H A;  1MJE A;  5ELC A;  1HUM A;  3S9W A;  5EKI A;  2F0V A;  4TVA B;  2JJQ A;  2Q2U A;  4JPB W;  2Z6K A;  4BXX G;  1XTC D;  2CCZ A;  3A55 A;  4AH6 A;  1J8I A;  1PRT D;  3NTI A;  3FEW X;  3X3N A;  1WCM H;  1RJT A;  1S3O A;  5IOD A;  4OIJ A;  3U9S A;  1SFO B;  2OQK A;  5A35 A;  3HOV H;  5CV9 A;  1IKL A;  5CR3 A;  4OWX B;  1LT4 D;  1LUZ A;  3RZO H;  4JI7 Q;  3T13 A;  1BXT A;  1LTR D;  1WCM G;  3A5U A;  4GZY C;  4KY5 A;  1J5E L;  2EJF C;  1KNA A;  1SYF A;  1SE3 A;  2RHQ B;  1W2B A;  1BDO A;  1VQL A;  5BR8 L;  2UXB L;  3OTO Q;  1NR4 A;  2UUC Q;  3HOV G;  2A6E C;  4BWG B;  5IP7 H;  2E2I B;  3V96 A;  2F4I A;  2F3V A;  4POG A;  2JE6 I;  2OCE A;  1L1O B;  4L5R C;  2L5T A;  4NKL A;  1OXU A;  1KL9 A;  2MP1 A;  2E2J H;  2YTY A;  2Q2H A;  5IP7 G;  4DR2 Q;  4QIW B;  1MKH A;  5J1Z A;  4OEM B;  4X65 Q;  4N9T A;  3K0Y A;  4DV3 L;  5I6W A;  2EYJ A;  4H02 A;  1N36 L;  3J80 L;  1PYW D;  1YJN A;  4WOR A;  3H6M A;  4XDX A;  4RKL A;  1CT1 D;  4DNR B;  2LMC B;  1Y8N B;  1HPC A;  2JA6 H;  1X3E A;  2NWG A;  1F2Y A;  1JT8 A;  1PTO C;  2F0L A;  2WAQ B;  4HTH A;  5EPK A;  3HGB A;  4A76 A;  4EQO A;  3GTP H;  4HCE A;  3H15 A;  4GS3 A;  2UXD L;  1D8L A;  2JA6 G;  1GUO A;  2K1B A;  1YNJ D;  5C3W A;  3L2P A;  2E74 C;  3OW7 A;  5C3E B;  1PFB A;  5AJ3 Q;  4DV7 Q;  3HOZ G;  1VQO A;  2R7F A;  5ELE A;  1Q3L A;  1B44 D;  4IUR A;  3FPP A;  2AQ1 B;  4N8F A;  2CVR A;  1AN8 A;  4POF A;  5EKL A;  4JI0 L;  2ZJQ A;  3HKZ B;  2L4N A;  2VB3 X;  1I50 H;  1YHB A;  1B9M A;  3H94 A;  1KDC A;  5C5M A;  1PRT B;  4KY6 A;  2DGY A;  1R9T B;  1G2S A;  1TWC B;  1AEX A;  2Q8R E;  3JAM c;  4A3I H;  1DON A;  4DV0 Q;  5H1S E;  4RHR A;  5CV4 A;  4LF4 L;  4A3F B;  1TXY A;  1I4H A;  1EEI D;  2KED A;  4ZKC B;  4YHH Q;  2KEN A;  1NTG A;  2Q2T A;  1ET6 A;  3LX0 A;  3ULJ A;  3T1Y L;  4C3H H;  5NUC A;  4B3S Q;  4A3I G;  3SGI A;  4RGN A;  4X64 L;  2F0F A;  2RDF A;  4GNX C;  2B2Y A;  4CJ1 B;  2F0P A;  1H9K A;  1LT5 D;  4JG2 A;  4IPG A;  3MAQ A;  2NUC A;  3M85 A;  5M5Y H;  2L12 A;  3VYR A;  4KHP L;  4DV5 Q;  1S5B D;  4K6L A;  1HHV A;  1IXR A;  5C4X H;  4A3M H;  2BE5 C;  1JR0 D;  1I6H B;  2E5L L;  4OHJ A;  1PDQ A;  3LGJ A;  1WI5 A;  3NUC A;  1NNX A;  4LF8 L;  2YTV A;  1XNR L;  3U50 C;  3CC2 A;  3KF6 B;  4IZ8 A;  3R93 A;  3FHW A;  1QNU A;  5I9P A;  3GTM H;  1VQ9 A;  2A19 A;  2HD3 A;  2X69 A;  3A8I E;  3E0E A;  4ILW A;  1EY5 A;  4JI3 Q;  3TSS A;  2B39 A;  1X56 A;  1RCV D;  2E8G A;  1S40 A;  2HUG A;  4EGV A;  1EY7 A;  3Q24 A;  1X9N A;  4PMC A;  3T16 A;  2DNC A;  2EOT A;  1O78 A;  3VYS A;  4JYA L;  1EZ6 A;  5CYU A;  1VQE A;  4K0K Q;  1F2L A;  4C3J H;  1X3F A;  3S1N H;  3CF5 A;  4R4I A;  4LUZ A;  3PUV A;  1Z7T A;  5EPJ A;  3E3X A;  5E3F A;  2ES2 A;  3AEV A;  3H91 A;  4R8I A;  1BO0 A;  1LO5 D;  2Q8I B;  4X66 Q;  4X62 Q;  5BN5 A;  3MXU A;  1J6Q A;  3B6Y A;  4P72 A;  3HOV B;  3CMA A;  3S2H H;  3RZO B;  1HNX Q;  5JOB A;  5BN4 A;  2F0W A;  1G8Z D;  3VYT A;  3H0G H;  4YIJ A;  4CKE A;  1Q86 C;  3BDC A;  1CI3 M;  1VQJ A;  4GN5 A;  3BZD B;  4C3I H;  3OPO A;  4RWS C;  1WFQ A;  1CZW A;  2PQA A;  3D6W A;  3CD6 A;  2E2J B;  2B2T A;  4FF2 A;  5E7N A;  2IX3 A;  3K59 A;  4ZYS A;  4DKA C;  4OO1 I;  1HUN A;  4DV6 L;  1W3S A;  2I46 A;  3NHH A;  4DFA A;  3HG9 A;  4R1J A;  3TP5 A;  5LMN Q;  4A3E H;  4OGQ C;  2K5N A;  3TP6 A;  1SSO A;  4UPA A;  4X3T A;  3OMG A;  1EIY B;  4KTA A;  1Q12 A;  3D4W A;  1XPR A;  3D4R A;  5I2X A;  3IFD A;  4C56 C;  3GTP B;  2K01 A;  1K0S A;  3HEJ A;  1WVL A;  2AWN A;  2KHJ A;  2WB1 E;  2HIV A;  3J80 i;  5E4X A;  2RDG A;  1BCP D;  1YBY A;  4CDC C;  1W6K A;  1LTT D;  2ICE C;  4C2M B;  1Q8I A;  2I5H A;  2L9H A;  3PO3 B;  3SE0 A;  5I4D A;  5ELF A;  3NXW A;  2A68 D;  4YCU A;  2HHH Q;  1CFM A;  2OTJ A;  2EYO A;  1KXL A;  3MWY W;  1U4R A;  2EPB A;  3STB D;  1KRS A;  2R6G A;  2EJG C;  1O7I A;  5J3B A;  4RHS A;  2KOL A;  2D5D A;  5FO9 B;  1LTB D;  1PHJ A;  3K81 C;  4JI6 Q;  3CP0 A;  1EFW A;  5COR A;  4DNT B;  4PMW A;  1TS5 A;  3KBG A;  1DOK A;  2YU9 B;  3GTJ B;  4MTN A;  1B2T A;  1WJJ A;  1K28 A;  3NE5 B;  4UHV A;  2B63 B;  4JOI C;  1Q81 C;  3PMF A;  4BY1 H;  5ELD A;  2K28 A;  2EXD A;  4C3H B;  2H1E A;  3U4Z A;  2K52 A;  3D3R A;  4QMG A;  1SDF A;  4LF9 Q;  2ZJP A;  4DU9 A;  2SOB A;  3MFY A;  1SND A;  5C4J B;  1EU4 A;  4BY1 G;  1OXT A;  1O80 A;  2PYK A;  1PRT F;  2F0D A;  2R93 H;  2JQO A;  1VQF A;  1A62 A;  5C4X B;  3KDF A;  4A3M B;  5EBC A;  1XX8 A;  1TWF H;  2R61 A;  4JC0 A;  2R93 G;  5GAD C;  1XPU A;  4IOC A;  4H7B A;  4L5S A;  3IAY A;  4JI8 Q;  1XMQ L;  4LFA L;  1CHP D;  1Q8K A;  3UE0 A;  1QJO A;  5E4W C;  1RIP A;  1XNQ Q;  3J7A F;  4H0L C;  4QB4 A;  1GKH A;  3CW2 C;  1EOV A;  1HR0 L;  4BBS G;  2A74 C;  3BDL A;  4ALP A;  5LHY 1;  1BCP B;  3O13 A;  2PNR C;  1F77 A;  5M3M H;  4NXN Q;  1B9N A;  1FYC A;  1T9H A;  3MXN B;  4XYQ A;  3MC0 B;  2JYO A;  4AQY L;  2NVY H;  3CC4 A;  2CH4 A;  3HKS A;  4IFD J;  5M3M G;  1QCB D;  3HOU H;  4C3J B;  5IP9 G;  5KIX A;  4Y7N H;  3ULP A;  4A3K H;  3FP9 A;  2ALY B;  2EY6 A;  4HIK A;  1L1O A;  3D4D A;  1E1O A;  2R3Z A;  3FDT A;  4U68 A;  1ESF A;  1TQO A;  1YHA A;  2L11 A;  4P71 A;  3J81 E;  4GOP B;  2TSS A;  1PH7 A;  3HOU G;  1STH A;  3UDG A;  1SMY D;  3S24 A;  1BUV T;  4A3K G;  1KAA A;  1ICF B;  1NSN S;  5A2Q E;  1Y1W G;  2A5H A;  1QB5 D;  3M3Y H;  4DR5 L;  1K83 H;  1E1T A;  3T53 B;  5FLM G;  3R3O A;  1LTI D;  3FMC A;  4LMQ D;  1JJG A;  1ASZ A;  2YYZ A;  2XVS A;  4ABN A;  2KQ3 A;  1IL2 A;  4A3L H;  1EUJ A;  4A3D H;  1LT6 D;  2MO1 A;  4OX9 L;  3T1H L;  3H0G B;  2MHV A;  2HCC A;  4QUC A;  3DEP A;  4DK3 C;  4C3I B;  5J39 A;  4HSP A;  2B2V A;  3S1R H;  4A3D G;  1KD1 C;  1F2Z A;  4JBJ A;  2PO4 A;  1YNJ C;  4N8X 1;  1RD9 D;  1C8C A;  1SLJ A;  1HNZ L;  2JEB I;  2F4V L;  1N8R C;  2M00 A;  1OXS C;  2RVL A;  3U4V A;  1JE4 A;  1XJV A;  2J4X A;  4DK0 A;  3PIP 3;  1J9O A;  4IFD H;  3Q8D A;  3P20 A;  5EPL A;  1XXG A;  2C5C A;  5FLX c;  4A3E B;  3JAM L;  4FXK C;  1CQF A;  2A73 B;  3FPU B;  5DM6 3;  2VS1 A;  4DR7 Q;  1A3T A;  2MQH A;  2QDL A;  1E2W A;  5DM7 3;  4BA2 I;  4IFD G;  4A3C H;  1UNS A;  1TWA H;  2EJM A;  4RCN A;  3GTL H;  1MD2 D;  4KMU C;  1C7Y A;  4DGZ A;  1SNC A;  3A7L A;  5IY0 A;  4JVZ A;  2Z6K C;  3S1Q B;  1K9M C;  4JK1 C;  5M5X H;  2OWO A;  4A3C G;  4JBK A;  1YI2 A;  3RLO A;  3I72 A;  3P7J A;  4I7Z C;  1G51 A;  1R4Q B;  4KJO A;  2RBM A;  4RFB A;  3I4M H;  4OO1 H;  2A6H D;  2B2W A;  2VXW A;  1TU2 B;  4I7A A;  4L5T A;  5GAH C;  2P5Z X;  2QKI C;  1CUK A;  3QOL A;  3S16 H;  3EA6 A;  4R9W A;  3IL8 A;  4DR1 Q;  4Z9C B;  4GKK Q;  3CQZ B;  3KFU A;  1G6Z A;  3GTQ B;  1EEF D;  3PIP A;  2B29 A;  2G9D A;  1W6J A;  1DYQ A;  3AB9 A;  4PNY A;  2B2U A;  1HZ9 A;  3I4M G;  4RG1 A;  2XRS D;  1PH4 A;  2I0Q A;  2RA4 A;  5CBE E;  2N55 A;  2AUJ D;  4KHZ A;  3W1G A;  1O7Y A;  2C35 B;  4LF6 Q;  4GKJ Q;  2RDH A;  1YJW A;  1CSQ A;  4FYD A;  1QIL A;  4JI7 L;  1VQ6 A;  3KLW A;  3KF6 A;  5C44 H;  4B3M Q;  4IUP A;  1QVC A;  2LSS A;  5ELN A;  1BBX C;  1QNK A;  1QZG A;  2OT2 A;  3OTO L;  2OXP A;  2GA4 B;  3L9A X;  4KK7 A;  1VQH A;  5C44 G;  3OWE B;  4LF7 L;  3BDO A;  4IAL A;  2K5Q A;  1TY0 A;  3D6C A;  5D65 A;  1PH8 A;  4B3T Q;  3PF4 A;  3URY A;  4MTK A;  3CCL A;  3ERS X;  1JWS D;  1SJE D;  1FJG Q;  1E24 A;  2VQE L;  4DR2 L;  4CGY B;  4IOA A;  4X65 L;  2CW0 D;  2VL6 A;  3BS1 A;  3DHQ A;  2O4X A;  4HIO A;  3PGZ A;  1TWF B;  2QIL A;  3W5O A;  4JI1 Q;  1X3P A;  1S72 A;  2BCO A;  2UU9 Q;  1EL0 A;  1RHP A;  3OWF A;  1CK1 A;  1MSG A;  2WB1 B;  1U0L A;  1I94 Q;  3HP3 A;  1H9S A;  1AZP A;  3DM1 A;  1VQ7 A;  1B70 B;  1E2V A;  1IBL Q;  1PH5 A;  1CQV A;  3M7N A;  2UXC L;  1WTX A;  3EN2 A;  3SK6 A;  2YTX A;  2DY7 A;  2EYL A;  1SYG A;  5AJ3 L;  1TR5 A;  4NB3 A;  4DV7 L;  1B53 A;  2ZXO A;  1KNE A;  3S15 B;  2MJ8 A;  4ZUJ A;  3NQT A;  5D3D A;  5IWA Q;  1TWG B;  4U67 3;  5JPN C;  4WJ4 A;  4Y7N B;  1GHJ A;  4F7X A;  4JI4 Q;  2LXJ A;  2F1M A;  1SYE A;  2ZXP A;  2HQE A;  2Z1C A;  1K0R A;  3KJO A;  1HZA A;  2NVX H;  1MSH A;  1KDA A;  4A3G H;  5C0X G;  2K04 A;  2B2Y C;  1SXT A;  3CCJ A;  1N34 Q;  4DR4 Q;  4PQX A;  4EQ5 A;  1WTH A;  1BCP F;  4Q5V A;  3M3Y B;  2SEB D;  2QF7 A;  1NCV A;  3M7G A;  4DV0 L;  4AYB G;  1AE2 A;  4A3G G;  1M1K C;  1HNW Q;  2ZT9 C;  4L63 B;  3C46 A;  5COY A;  1X6O A;  4YHH L;  3NWS A;  2HCI A;  1X65 A;  5M3F B;  3I4L A;  3OOC A;  4B3S L;  4K5V A;  4DV1 Q;  4ME3 A;  1ICW A;  4IO9 A;  2JK8 A;  3C1E A;  1A15 A;  2RCN A;  4FDB A;  3FKI B;  1KC8 C;  4LNQ A;  1EFI D;  3GTO B;  2KHI A;  3HOZ H;  5K36 H;  1LTG D;  1JWM D;  2KCC A;  2PI2 E;  5K5P A;  4DV5 L;  3QJY A;  4O0A A;  2R7Z B;  4GN4 B;  1XTD A;  2IWH A;  3H3V H;  3WWV A;  5K36 G;  1VQN A;  4NMZ A;  2KCN A;  3E0J A;  4DK6 C;  2DNE A;  2KHS A;  2RF4 A;  1JJ2 A;  1S4Z A;  3STB C;  2CH4 W;  1GO3 E;  4PZ8 A;  3GV3 A;  2PZT A;  4TQU S;  1TWH B;  1RDP D;  3LWE A;  3D0F A;  1Y69 U;  5CV6 A;  3I8Z A;  4P75 A;  1U4M A;  1IW7 C;  3NWT A;  4DV4 Q;  1FVI A;  2VUM H;  4JI3 L;  5FKA C;  2A1A A;  2O2L D;  3VR6 A;  2HT1 A;  3I55 A;  4DAV A;  1IBM Q;  4OXP A;  1V1Q A;  5EGT A;  1IYJ B;  3JAM i;  1V9P A;  4WJ3 M;  4DR6 Q;  5M5X B;  3HOW B;  1VF7 A;  4WFN 3;  1Y1V G;  2VUM G;  1J5E Q;  2FHT A;  1G29 1;  2ZM6 Q;  4C1N K;  5BR8 Q;  3C3L A;  1EQT A;  4K0K L;  3TDQ A;  1CA6 A;  1C4Q A;  1A6X A;  4NP5 A;  5IYC H;  1MHW C;  4DUY L;  2H5X A;  4A93 B;  3UDI A;  3W2D A;  4YWM A;  2NN6 G;  3I4N B;  1GOZ A;  1NUC A;  3QR8 A;  1GM5 A;  4NXM Q;  1I3Q H;  1KLU D;  4X66 L;  4X62 L;  3VDY A;  3Q0A A;  1F9Q A;  3VA7 A;  1KHI A;  5IYC G;  4DV3 Q;  4PMB A;  2ASB A;  4YCV A;  3ERO A;  4DF7 A;  3PCO B;  1HNX L;  4TSS A;  3U9O A;  2PMZ E;  2JA5 B;  2B2T C;  1EIH A;  1B3A A;  4IUU A;  1PMR A;  2BA1 A;  2PI2 A;  1SN8 A;  1Z6H A;  1EY8 A;  1ZEQ X;  5CV5 A;  3RN5 A;  1B8A A;  1C0A A;  2PQE A;  4DAY B;  1CM9 A;  4FNF A;  2PW7 A;  5C4Z A;  1HXY D;  2F3I A;  5ELO A;  4EQN A;  1FNW A;  2GVA A;  1V8Q A;  1EY0 A;  3PO2 B;  4BBR H;  3MXN A;  1ENA A;  1Y8O B;  3MZ5 A;  2K32 A;  2NZO A;  1K8G A;  1JMC A;  4Y52 H;  3D31 A;  4M1U B;  1QUQ A;  1VQK A;  2VQF Q;  1SMX A;  3CPF A;  4BBR G;  3GD7 A;  1GHK A;  1SEB D;  1DD2 A;  1F9R A;  1SRO A;  5LMN L;  1PTO H;  2DN8 A;  4CBV A;  4GOP A;  3E9I A;  3F2C A;  1Q82 C;  3VYU A;  1NAP A;  5JJK A;  2IHF A;  1ENF A;  4FF3 A;  4JV5 L;  3IFT A;  4K6D A;  4OEL B;  2K6A A;  1H9S B;  4DUZ L;  1PZI D;  1UEB A;  4IUT A;  1CA5 A;  2CWP A;  5IGG A;  3BJU A;  1SNO A;  2K33 A;  1WCM B;  1L0Y B;  5IYB G;  1C48 A;  5IOC A;  1Q1E A;  4IFD I;  1CKM A;  1LAC A;  3OYY A;  2SNM A;  4ZRZ A;  3T1Y Q;  1H9J A;  1OO9 B;  2CQO A;  1FL0 A;  1N9W A;  1ROD A;  2KJX A;  1D5X C;  3G6E A;  2HHH L;  1M90 C;  2EY5 A;  2KCM A;  1VDZ A;  5IT9 E;  3OW2 A;  3QB3 A;  3VR2 A;  1NE3 A;  3SXH A;  2X6G A;  4X3U A;  1H9M A;  4AYB B;  4K2L A;  4JI6 L;  4PZ6 A;  1XMO L;  3L3O C;  1SRU A;  4KI0 A;  1QWY A;  4R4T A;  5FLX L;  1MIU A;  2CKZ B;  5EKK A;  5KYL A;  2E5L Q;  1STY A;  1GVP A;  1PZK D;  2KCT A;  3LNN A;  3P1H A;  4LF5 Q;  2NZH A;  2OEO A;  4IQZ A;  1XNR Q;  3GTK H;  1VQP A;  4DR3 Q;  4QCL A;  4UP8 A;  2VNU D;  1EWC A;  3V05 A;  3MTS A;  2BH2 A;  1P16 A;  2A6E D;  3J7Z C;  4APV A;  2JA6 B;  5IGB A;  1JWU D;  2LXK A;  3HOZ B;  3KUP A;  1LM0 A;  4K2K A;  5C6A A;  1SE8 A;  3NTH A;  2F0S A;  3PIO 3;  1YNN C;  1Q90 A;  1VQI A;  4JYA Q;  1MJC A;  3RLN A;  4UP9 A;  4BS9 A;  1STE A;  1CKO A;  1AW7 A;  2Z0S A;  2A6H C;  4M8A A;  2WKC A;  3K5O A;  1JQY D;  1Q1B A;  4JI8 L;  3CCE A;  2QGQ A;  1PTO D;  4YCW A;  2CHB D;  3NEM A;  1XNQ L;  1I50 B;  2F0J A;  4MZ9 A;  2VUM B;  3A74 A;  1L1O C;  5CV7 A;  2Y0S E;  1VQ5 A;  4BY7 H;  1VQ4 A;  1CZG A;  1EYD A;  2F0I A;  1TVX A;  1EYC A;  4XYO A;  3ND9 A;  4NXN L;  3RN2 A;  3TQY A;  2EZV A;  1OTC A;  1GUS A;  2JA8 H;  4A3I B;  4KN4 C;  4B3R Q;  3M9B A;  1O7Z A;  4MIU A;  2F0K A;  1DM0 B;  2PNH A;  4BY7 G;  3NP8 A;  2B8F A; 
#chains in the Genus database with same CATH homology
 4RMF A;  4DR3 L;  5C4X G;  1J5E L;  4A3M G;  3RZD H;  5FLX c;  2XTI A;  2OQ0 A;  2RHQ B;  1W2B A;  3JC6 6;  1VQL A;  5BR8 L;  2UUA L;  3PIO A;  3OTO Q;  2UUC Q;  4JI0 Q;  3AFP A;  2JA8 G;  3HOV G;  2VS1 A;  4DR7 Q;  5IP7 H;  2MQH A;  4BA2 I;  4POG A;  2JE6 I;  2MNA A;  2OCE A;  1WYD A;  4IFD G;  1L1O B;  3AFQ A;  5IYB H;  4A3C H;  4HJ8 A;  1TWA H;  4L5R C;  3GTL H;  1C9O A;  1JE5 A;  1C7Y A;  5IY0 A;  1OXU A;  2K14 A;  1KL9 A;  3K8A A;  3NEL A;  1PVO A;  3K7U C;  2E2J H;  2FXQ A;  3J81 c;  1EQR A;  2YTY A;  1YZ6 A;  2ID0 A;  2Q2H A;  4JCV E;  5IP7 G;  2Z6K C;  1UWV A;  1MKH A;  3UDX A;  3A5U A;  4DR2 Q;  4LF4 Q;  1K9M C;  3CCM A;  4UY8 C;  5M5X H;  4P74 A;  2OWO A;  4A3C G;  4X65 Q;  3BZC A;  5C0X I;  4DV3 L;  3RLO A;  1YI2 A;  4JBK A;  4H02 A;  1G51 A;  1N36 L;  3M4O H;  2N49 A;  1YJN A;  4X64 Q;  2EQS A;  3Q8D A;  1X54 A;  2BA0 A;  3I4M H;  4DUY Q;  4BBS H;  2JA6 H;  1X3E A;  1OXX K;  4A3B H;  4L5T A;  1JT8 A;  3I7F A;  3BZK A;  5GAH C;  1CUK A;  2R92 H;  3S16 H;  4A76 A;  4DR1 Q;  3GTP H;  3M4Q A;  4GKK Q;  3KFU A;  3H15 A;  3PIP A;  2B29 A;  4GS3 A;  4KHP Q;  3I4M G;  2UXD L;  3TRE A;  1D8L A;  1HZ9 A;  3ICE A;  4RG1 A;  1PH4 A;  3F8T A;  2I0Q A;  2JA6 G;  4A3B G;  3CXC A;  1PV4 A;  3L2P A;  2R92 G;  4KHZ A;  1Q46 A;  4LUV A;  5AJ3 Q;  3W1G A;  5IP9 H;  2C35 B;  5JEA J;  4DV7 Q;  4LF6 Q;  1VQO A;  3HOZ G;  4GKJ Q;  2R7F A;  2ZTD A;  1YJW A;  1CSQ A;  4B3R L;  4GNX A;  1VQ6 A;  1NMG A;  4JI7 L;  4LF8 Q;  4R4C A;  3KLW A;  3KF6 A;  5C44 H;  4HJ5 A;  1N33 Q;  4B3M Q;  4IJH A;  4JI5 Q;  1QVC A;  2LSS A;  3HFZ B;  4GN3 B;  5ELN A;  1YEZ A;  1QUQ B;  3HOY H;  1QZG A;  1E3P A;  1VS0 A;  4POF A;  3CCS A;  3OTO L;  2V1C C;  4A4I A;  4HIM A;  1PH9 A;  2ZJQ A;  4JI0 L;  1Y1W H;  1I50 H;  1YHB A;  1VQH A;  5HGQ A;  3U58 A;  2JA7 G;  4LF9 L;  4DNI A;  5C44 G;  4LF7 L;  4LFB Q;  3AQQ A;  3H0G G;  5FLM H;  3G71 A;  4QL5 A;  2UUB L;  2DGY A;  2VW9 A;  4JBM A;  1CSP A;  4DV2 Q;  1BBW A;  1PH8 A;  4B3T Q;  2R7D A;  3HOY G;  3PF4 A;  2Y0S G;  5JJI A;  3CCL A;  3ERS X;  1SFO H;  3JAM c;  4A3I H;  4DV0 Q;  1FJG Q;  1E24 A;  2VQE L;  4L5Q A;  5H1S E;  4DR2 L;  1Q7Y C;  2N3S A;  2VZA A;  3IRB A;  4LF4 L;  3H3V I;  4IOA A;  2VUM H;  1K3R A;  1TXY A;  2K50 A;  2OTL A;  3TRZ A;  3A0J A;  4X65 L;  5LMN W;  4OWW B;  4YHH Q;  2KEN A;  2VL6 A;  1NTG A;  1BBU A;  4HIO A;  3PGZ A;  3W5O A;  1VQ8 A;  2Q2T A;  1N32 Q;  4JI1 Q;  2XGT A;  3ULJ A;  1S72 A;  3T1Y L;  4C3H H;  1RL2 A;  1VQA A;  1YNX A;  1PYB A;  3SGI A;  4A3I G;  2UU9 Q;  4B3S Q;  4X64 L;  3A5Z B;  4GNX C;  1XPO A;  2E2I H;  1U0L A;  2QA4 A;  1I94 Q;  4JG2 A;  4JV5 Q;  4IPG A;  2MO0 A;  1L0W A;  1VQ7 A;  5M5W H;  3M85 A;  1A0I A;  2BH8 A;  2IT1 A;  5M5Y H;  4J15 A;  4DUZ Q;  1B70 B;  1IBL Q;  2ATW A;  3F2D A;  1UE6 A;  4PZ7 A;  4DR1 L;  4A3E G;  1PH5 A;  4GKK L;  3CC7 A;  3M7N A;  3J80 c;  2UXC L;  4KHP L;  3EN2 A;  4DV5 Q;  3S1Q H;  1GD7 A;  2YTX A;  2D0P A;  1IXR A;  5C4X H;  4A3M H;  3GDE A;  5AJ3 L;  1YHQ A;  4NB3 A;  4DV7 L;  2E5L L;  4GKJ L;  2NN6 I;  1AH9 A;  3LGJ A;  1PYS B;  2KBN A;  2A8V A;  1YVC A;  5IWA Q;  1WI5 A;  4LF8 L;  1E22 A;  2YTV A;  1N33 L;  1XNR L;  3U50 C;  4WJ4 A;  3CC2 A;  3KF6 B;  4JI5 L;  4HID A;  4JI4 Q;  2LXJ A;  4QQB X;  2UXD Q;  3S14 H;  3ER0 A;  5JEA G;  3FHW A;  1JJC B;  3PF5 A;  1K0R A;  1KIX A;  3KJO A;  3GTM H;  1HZA A;  4O2D A;  3DLL A;  1VQ9 A;  3CQZ H;  2NVX H;  2A19 A;  3GTQ H;  4A3G H;  1XMO Q;  3E0E A;  5C0X G;  1N34 Q;  3CCJ A;  4JI3 Q;  1X55 A;  4DR4 Q;  1VQC A;  3J81 j;  4LFB L;  1BKB A;  4DV2 L;  4EQ5 A;  4IJL A;  4B3T L;  1X3G A;  1X56 A;  2CFM A;  2E8G A;  5C3E H;  2WAQ G;  4IPC A;  1S40 A;  4IPH A;  3J81 i;  1X9N A;  4P73 A;  4DV0 L;  2NVQ H;  4AYB G;  1AE2 A;  1UE7 A;  4JI2 Q;  4MNO A;  3GTG H;  2K5H A;  4A3G G;  1M1K C;  4DV6 Q;  1HNW Q;  4JYA L;  4LWC A;  4XIG S;  3I4O A;  1IZ6 A;  1X6O A;  4YHH L;  1AE3 A;  3PV0 A;  1VQE A;  4K0K Q;  1N32 L;  3NEN A;  4JI1 L;  1X65 A;  4QIW E;  4C3J H;  5C3E G;  1X3F A;  1VQG A;  3S1N H;  4B3S L;  3CF5 A;  1B7Y B;  4R4I A;  2DUD A;  3GO5 A;  4DV1 Q;  4ME3 A;  4LUZ A;  3PUV A;  4IO9 A;  2JK8 A;  1UE5 A;  1V43 A;  1I94 L;  2ES2 A;  3AEV A;  2RCN A;  1R9T H;  1HH2 P;  4FDB A;  1KC8 C;  2NVT H;  4LNQ A;  3G4S A;  3I2Z A;  1IBL L;  2KHI A;  3HOZ H;  1TWC H;  3HOX H;  4X66 Q;  3ULL A;  4X62 Q;  3HKZ G;  5EAY A;  1VQM A;  2AHO B;  1YJ9 A;  2PI2 E;  2WAQ E;  4DV5 L;  4O0A A;  1ASY A;  4A3F H;  1J6Q A;  4GN4 B;  3B6Y A;  1XTD A;  2ZTE A;  4P72 A;  4AYB E;  2JA9 A;  3CMA A;  2HIX A;  3S2H H;  1HNX Q;  1A8V A;  3H3V H;  3WWV A;  1NJI C;  3HOX G;  5K36 G;  3S17 H;  1VQN A;  1LYL A;  1QVG A;  4R4Q A;  4DK6 C;  4LUO A;  5IWA L;  2RF4 A;  1YIT A;  1PH6 A;  2JA7 H;  4A3J H;  1JJ2 A;  1H95 A;  5C0X J;  3H0G H;  3STB C;  4A3F G;  4JI4 L;  1UE1 A;  2K75 A;  3CME A;  1Q86 C;  1GO3 E;  4PZ8 A;  4TQU S;  4GLV B;  3CPW A;  1VQJ A;  2N78 A;  1DGS A;  2N8N A;  3D0F A;  4GN5 A;  3I56 A;  4C3I H;  2UUC L;  2UXB L;  3CCR A;  4DR7 L;  4P75 A;  4DAM A;  5HY6 A;  4DV4 Q;  1N34 L;  1FVI A;  4YWK A;  1WFQ A;  4JI3 L;  4A3J G;  2WB1 G;  3UE1 A;  1HNZ Q;  4LFC Q;  2PQA A;  3PSI A;  2AKW B;  2A1A A;  3HKZ E;  3CD6 A;  4BA1 I;  2EIF A;  2HT1 A;  3I55 A;  1IBM Q;  4OXP A;  3PUZ A;  1V1Q A;  1IYJ B;  1Z47 A;  3JAM i;  1V9P A;  1I6H H;  5E7N A;  4WJ3 M;  3NBH B;  4DR6 Q;  4JI2 L;  3S15 H;  4OWT B;  4DKA C;  4OO1 I;  5LMU Q;  4DV6 L;  1HNW L;  1TWG H;  1Y1V G;  1PH2 A;  1J5E Q;  2VUM G;  1G29 1;  1W3S A;  2ZM6 Q;  2UUA Q;  5BR8 Q;  4R1J A;  4K0K L;  5JJL A;  5LMN Q;  5IE8 A;  1HJP A;  4A3E H;  3KYH C;  1K8A C;  2K5N A;  2Q2I A;  1KQS A;  4UPA A;  3CCU A;  4DV1 L;  1WOC A;  5IYC H;  2JEA I;  4KLK A;  1EIY B;  4DUY L;  1Q12 A;  2H5X A;  3UDI A;  1XPR A;  3EBE A;  4YWM A;  2IHE A;  5GRO A;  4X6A H;  3S2D H;  2NN6 G;  2AWN A;  4NXM Q;  3J7A 5;  1GM5 A;  2KHJ A;  1I3Q H;  2HIV A;  2WB1 E;  3J80 i;  4X66 L;  4X62 L;  3VDY A;  4JOI A;  1KHI A;  1YBY A;  3ZJY C;  5IYC G;  4DV3 Q;  2ASB A;  4QGU A;  4UP7 A;  1SR3 A;  4YCV A;  1PH3 A;  2I5H A;  2HQL A;  1NBW A;  2D62 A;  1I5F A;  3K80 C;  3PCO B;  1HNX L;  4LF6 L;  2PMZ E;  5M3F H;  1JB7 A;  4YCU A;  2HHH Q;  2BA1 A;  2PI2 A;  1SN8 A;  2OTJ A;  3RN5 A;  1KXL A;  1XMQ Q;  1EQQ A;  4B3M L;  4GNX B;  1B8A A;  3PUY A;  4LFA Q;  1C0A A;  3F1Z A;  4DAY B;  4HJ7 A;  1EWI A;  3AYH B;  3STB D;  4OON A;  4A3L G;  1KRS A;  2R6G A;  1A63 A;  3FKI H;  1O7I A;  5J3B A;  1HR0 W;  3GTO H;  2F3I A;  3CAM A;  5M3F G;  5ELO A;  2IX1 A;  1HR0 Q;  1PHJ A;  4GLX A;  2E2H H;  3K81 C;  2AMC B;  2GVA A;  3CP0 A;  1EFW A;  4JI6 Q;  4DV4 L;  4BBR H;  4LFC L;  4PMW A;  1QZH A;  2R7Z H;  2GN5 A;  2VY3 A;  3L0O A;  3PUX A;  2PQA B;  1IBM L;  4MTN A;  3FKI G;  3W1B A;  5GQO A;  2NZO A;  1K8G A;  1JMC A;  1WJJ A;  4JBW A;  4Y52 H;  1HZC A;  4GLA C;  3D31 A;  4AQY Q;  4DR6 L;  3PUW A;  3RR5 A;  1FJG L;  4EX5 A;  1QUQ A;  4JOI C;  1Q81 C;  2VQF Q;  1VQK A;  5LMU L;  1SMX A;  3CPF A;  4BBR G;  1U5K A;  4QJF A;  3GD7 A;  4BY1 H;  2QEX A;  2R7Z G;  1VCI A;  2EXD A;  2ZM6 L;  3U4Z A;  2K52 A;  5LMN L;  1SRO A;  5GAG C;  1TWH H;  2I5L X;  3TS2 A;  4GOP A;  3E9I A;  3F2C A;  1IBK Q;  2UU9 L;  4LF9 Q;  4PG3 A;  4LF7 Q;  1Q82 C;  2ZJP A;  1Y14 B;  3KJP A;  2UUB Q;  5JJK A;  2IHF A;  1PH1 A;  1E7Z A;  3S1M H;  4BY1 G;  4JV5 L;  1OXT A;  1HZB A;  2B3G A;  1PFS A;  1P8L A;  4DUZ L;  1UEB A;  2RHS B;  1K73 C;  2VQE Q;  4NXM L;  2CWP A;  2JQO A;  2F52 A;  2R93 H;  3BJU A;  4DR5 Q;  1VQF A;  3KF8 B;  2YV5 A;  1A62 A;  4R4O A;  5IYB G;  3HOW H;  3KDF A;  1Q1E A;  4IFD I;  1CKM A;  3OYY A;  1BVS A;  3T1Y Q;  4XTC S;  1VQD A;  4IPD A;  4YY3 Q;  2CQO A;  1TWF H;  5FJ8 H;  4JC0 A;  1FL0 A;  1N9W A;  3DM3 A;  4QY7 A;  3K0X A;  5GAD C;  2R93 G;  1XPU A;  3G6E A;  3G48 A;  4IOC A;  3T1H Q;  3EIV A;  2HHH L;  4OX9 Q;  1M90 C;  1KAW A;  2ZTC A;  4L5S A;  2KCM A;  3HOW G;  3OW2 A;  1PA6 A;  4JI8 Q;  1XMQ L;  4A93 H;  4LFA L;  1NE3 A;  1Q8K A;  1D7Q A;  3UE0 A;  1RIP A;  1XNQ Q;  2UXC Q;  3I4N H;  5FJ8 G;  1CKN A;  1GKH A;  3CW2 C;  4OO1 G;  1EOV A;  3L7Z C;  2MFI A;  4GOP C;  1HR0 L;  4BBS G;  1VQB A;  4ALP A;  4JI6 L;  2D0O A;  4PZ6 A;  1XMO L;  3TEH B;  1SRU A;  4KI0 A;  1Y1V H;  4R4T A;  5M3M H;  1LTL A;  2F4V Q;  3K7A H;  1MIU A;  4NXN Q;  4DR4 L;  2CKZ B;  4A93 G;  2CWA A;  3UDF A;  4C2M H;  1T9H A;  3MXN B;  2E5L Q;  1GVP A;  2L15 A;  2KCT A;  3PO3 H;  4LF5 Q;  3I4N G;  3TS0 A;  2NZH A;  1YIJ A;  2JA5 H;  4AQY L;  2NVY H;  3CC4 A;  1XNR Q;  3GTK H;  2IX0 A;  2VQF L;  3HKS A;  1VQP A;  4YWL A;  4IFD J;  2K5V A;  5M3M G;  4DR3 Q;  1NMF A;  3HOU H;  4UP8 A;  5IP9 G;  2I5M X;  4Y7N H;  1FGU A;  3ULP A;  4A3K H;  4DPG A;  2UXB Q;  2VNU D;  3FP9 A;  2ALY B;  1QVF A;  3PO3 G;  2BH2 A;  1P16 A;  4HIK A;  2GVB A;  1L1O A;  3J7Z C;  1IBK L;  2JA5 G;  1E1O A;  4APV A;  3BU2 A;  1YHA A;  4HJA A;  4P71 A;  2LXK A;  2AWO A;  4GOP B;  3PO2 H;  1Z9F A;  4HJ9 A;  4AIM A;  1PH7 A;  3HOU G;  3UDG A;  1L2F A;  1LM0 A;  3S24 A;  4A3K G;  2WFW A;  1SE8 A;  3GTJ H;  1Y1W G;  2YU9 H;  1KRT A;  1EYG A;  3M3Y H;  1VQI A;  4DR5 L;  4JYA Q;  1EIF A;  4A75 A;  1K83 H;  1E1T A;  1MJC A;  4NPS A;  5FLM G;  3RNU A;  2B63 H;  3PO2 G;  3RLN A;  4UP9 A;  1JJG A;  1ASZ A;  2YYZ A;  2K4K A;  1N36 Q;  3KDF B;  1IL2 A;  4A3L H;  1EUJ A;  1CKO A;  4YY3 L;  5GAE C;  2Z0S A;  4A3D H;  4BXX H;  1NY4 A;  2MO1 A;  1OXV A;  3T1H L;  4LW1 A;  4OX9 L;  3CCV A;  2B63 G;  1Q1B A;  3E9H A;  1G6P A;  4JI8 L;  3CCE A;  2QGQ A;  1MJE A;  5C4J H;  3RLF A;  4YCW A;  5IYD H;  3KOJ A;  2ZJR A;  4DK3 C;  4TVA B;  5DLQ E;  2JJQ A;  2Q2U A;  3NEM A;  1XNQ L;  3S1R H;  4A3D G;  2Z6K A;  4BXX G;  5IT9 c;  4MZ9 A;  1KD1 C;  2CCZ A;  3A74 A;  1L1O C;  4AH6 A;  2Y0S E;  1VQ5 A;  4BY7 H;  1VQ4 A;  4JBJ A;  1CKN B;  3F2B A;  1WCM H;  1SLJ A;  2WP8 J;  1HNZ L;  2JEB I;  3CCQ A;  2F4V L;  4NXN L;  3MEF A;  1N8R C;  3RN2 A;  3TQY A;  1OTC A;  1S3O A;  5IYD G;  2JA8 H;  2OQK A;  1OXS C;  3HOV H;  3U4V A;  4B3R Q;  3M9B A;  4OWX B;  4LF5 L;  1LUZ A;  3RZO H;  2IY5 B;  4JI7 Q;  3M4P A;  1XJV A;  2PNH A;  4BY7 G;  1WCM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...