5E7NA

Crystal structure of rpa70n in complex with vu0085636
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Optimization of Anthranilic Acid Based Inhibitors of Replication Protein A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5e7nA00
2KCTA 3D31A 1KQSA 1EIFA 2ZTDA 1JJ2A 3RLOA 3AQQA 4DKAC 1GO3E 2IY5B 4K0KL 3CC4A 1G291 2OQKA 4DAYB 5C4JH 4P74A 1PH8A 3UDGA 4DAMA 3K0XA 2ES2A 3GTOH 4GNXC 1W3SA 3TQYA 3UDIA 4A3FG 2UUAQ 1VS0A 5IE8A 1VQ6A 1NBWA 3I7FA 1LTLA 1PYSB 3T1YQ 2XTIA 2PQAB 4GN4B 3TS2A 3CQZH 1K8GA 4BY1H 3RN2A 3OYYA 4LUVA 5LMUL 4JI5L 4LF7L 5GADC 1YJWA 1UE6A 1C7YA 4NXNL 2UXDL 4IPDA 1VQAA 3J81j 1MIUA 1UWVA 3CAMA 3ULPA 1HR0L 2VQFQ 4A3BG 2I5HA 3JAMc 1WOCA 1Q8KA 2UXBQ 5IYCH 1E7ZA 4C3IH 2MNAA 1YJNA 2JA8G 2VUMH 4HJ7A 3F2CA 1EFWA 4A3GH 1HNWQ 3HOVG 4JV5L 3HOUG 5J3BA 3PUXA 3M7NA 1XNRL 3F2BA 1TWFH 5M5XH 4JI3Q 3JC66 3G71A 1SE8A 3KF6B 3GO5A 1OTCA 2Y0SE 1VQEA 4JI4Q 2F52A 1IBKQ 3T1YL 2R93H 4JOIC 4JI0Q 4DK6C 3A74A 3S1RH 1D8LA 1VCIA 2V1CC 3F8TA 4A3IH 1X6OA 2WAQG 3UE0A 1YHAA 1Z9FA 1I6HH 3STBD 5IP9G 2ASBA 4GNXA 1T9HA 3W5OA 3TREA 5HGQA 2JQOA 5FLMG 1HR0Q 4JI6L 3S1MH 3FHWA 3CCUA 1GVPA 1MJCA 1EUJA 3G48A 4YY3Q 5IYDH 3CCRA 4NXMQ 4UPAA 3STBC 4GOPA 4JI7L 2E8GA 4EQ5A 4A4IA 1QZHA 3CCVA 3RLNA 4DV3L 1YZ6A 5IWAQ 4LF7Q 3ERSX 4R4CA 5GAGC 4WJ3M 3L7ZC 1BBUA 1NJIC 2N78A 5GQOA 2YTYA 4TQUS 1VQNA 1IXRA 1IBMQ 2D0OA 4B3SQ 4BY1G 1IBKL 3DLLA 4BBSH 2R7DA 3CC7A 2K14A 3EBEA 2UUAL 3I4MH 2UXBL 1YIJA 4IOCA 1R9TH 4OXPA 2VZAA 4DR7L 5LMNL 1O7IA 3CMEA 5BR8Q 1JMCA 4A3GG 4IJHA 2CCZA 2JA6H 1SR3A 4IPGA 2R7ZH 3PF5A 4P71A 5C0XI 1CUKA 4A3CH 1E1TA 1N33L 4DV7Q 3PUYA 2IX1A 1WFQA 1VQLA 2ZJQA 4JI0L 1YEZA 2VY3A 1L1OB 3H0GH 4YHHL 1TWAH 1PH2A 4X6AH 1SLJA 3CC2A 4A3DH 3ULJA 4C3HH 4DR5L 1MKHA 4LF8L 1WJJA 4YWMA 4A3EH 2K4KA 4QIWE 1HNWL 1EWIA 1Y1VH 3H3VH 1YBYA 1WCMG 1X3GA 3FKIH 4A3FH 1QZGA 4A75A 3CCLA 5AJ3Q 3BZKA 4QJFA 1N36L 2OCEA 1PH3A 4JI2Q 3MXNB 3S16H 3U4ZA 2I0QA 3HKZE 1Q12A 3MEFA 3HOWG 1EOVA 2F3IA 3S17H 3EIVA 3GTPH 3NEMA 5JEAJ 1XPRA 3CP0A 1I94L 1VQFA 3GTJH 1X9NA 1V9PA 2Q2TA 4JI1L 1YI2A 3KDFB 4QY7A 3I56A 4GN5A 5BR8L 1X65A 3CPFA 4R4IA 5IP7H 2Q2IA 5IT9c 4JI6Q 2VUMG 3CCSA 4DV5Q 3E0EA 3F1ZA 3S2HH 3NENA 1OXSC 1NE3A 1M1KC 3AFPA 1BBWA 3S15H 4HIMA 2JA5H 2JA6G 5IYBG 3S14H 2N3SA 1C9OA 4H02A 1X55A 2MO1A 3E9HA 4MTNA 2YV5A 1N34Q 4A93H 1HR0W 1LUZA 4LF4L 1N9WA 1X54A 2BH8A 3ULLA 5IWAL 2UUBQ 4Y52H 1VQMA 2LSSA 4AYBG 5DLQE 3BJUA 2NN6I 3RN5A 3S2DH 2GVAA 2VS1A 4R1JA 4BBRG 1VQPA 4A3MH 2E2JH 2EQSA 3L0OA 1TWHH 4LF6Q 2HHHL 4B3MQ 3CCMA 3A5ZB 4R4OA 3CCJA 4J15A 4XIGS 2H5XA 4B3TL 5C3EG 3HOYG 1AH9A 1XNQL 1M90C 1XMQL 1GKHA 1CSQA 4IFDJ 1YVCA 1X3EA 1EYGA 4L5RC 5JJKA 5M3MH 2MQHA 4DV7L 4B3RL 4RG1A 4DV4L 3GTGH 3BZCA 1HZ9A 4OX9Q 2Q2HA 2R7FA 1A8VA 5C0XG 4DUYL 1XMOQ 4BBSG 4KHPQ 2GVBA 4LFCL 4AIMA 1S40A 4DR3Q 1G51A 3M4QA 4ME3A 2UUCL 2OWOA 4HIOA 4DR6Q 1VQKA 2IT1A 3KYHC 3M9BA 4MNOA 4JI8L 2E2IH 1I5FA 1A62A 1A0IA 1BKBA 5IY0A 1LYLA 4A3CG 1YJ9A 5LMUQ 1PH1A 2R92H 4L5QA 4HJ9A 3T1HQ 1KXLA 3HOZH 1H95A 1UE1A 2KBNA 4DUZQ 2C35B 4P75A 5M3FG 3CMAA 4DV2Q 4OWWB 4JOIA 5FJ8H 5HY6A 4JYAQ 1PVOA 3PUVA 1SROA 4LF6L 4X66Q 4QQBX 1Q82C 1N32Q 4JBKA 1KRTA 4JI7Q 4OWXB 2QGQA 1QVCA 2VL6A 1VQOA 4HIDA 1VQHA 4A3KG 1KHIA 3PO3G 4DR1L 3M3YH 2N8NA 4HIKA 1J6QA 2PNHA 1HZBA 4IPCA 1L2FA 3Q8DA 2IHEA 1KD1C 2YU9H 2I5LX 4DUYQ 1XMOL 1RL2A 3A0JA 2NVQH 1P8LA 4LF9L 3F2DA 1VQGA 2OQ0A 2NZHA 3RZDH 4POFA 1S72A 4OWTB 4DR4L 3PGZA 1KC8C 2DGYA 5ELNA 4GLVB 2RHSB 4X65Q 1HNZQ 2NN6G 1NY4A 4C3JH 3GTQH 1KL9A 4K0KQ 1FJGL 1YHBA 3KFUA 3OW2A 4JI5Q 4LNQA 1CKOA 1HNXL 1IBLQ 2UXCQ 3HFZB 1L1OC 4R4TA 3UDFA 1NTGA 2Y0SG 4B3SL 2A8VA 4LUZA 1E22A 4PG3A 2NZOA 2AHOB 2WFWA 5GAHC 4GOPB 1VQ7A 2PQAA 4DK3C 3EN2A 1N33Q 4OO1I 5LMNQ 1C0AA 4ALPA 2CWAA 4UP8A 3K7AH 2B29A 5M3FH 4IOAA 3M4OH 1L1OA 4DV5L 1XTDA 2CFMA 5M5YH 4YHHQ 2UXDQ 4X62L 5C3EH 2JE6I 2JA7G 4LFBQ 1K3RA 4DNIA 2E2HH 3LGJA 4DUZL 3HKSA 2AWOA 1OXVA 3I4OA 1AE3A 4JI3L 3CXCA 1ASZA 2FXQA 4A3BH 1A63A 4L5SA 1JT8A 5IYCG 2JA8H 1Q1BA 1Q7YC 4UP9A 5FLXc 3HOUH 3J81c 1QVFA 2WB1G 4GKKL 4BA2I 1FJGQ 3I4MG 4P73A 4LFAQ 1AE2A 1E1OA 3BU2A 1CKNA 3KDFA 3I4NH 3K81C 1PYBA 4LUOA 3GDEA 1HZAA 2F4VL 4JC0A 1PH9A 4JI4L 4JBMA 3ER0A 4DV6Q 1XJVA 2D62A 3J80c 1EQRA 2Z6KC 2NVXH 4NXML 4GOPC 4LWCA 4DV0Q 2UU9Q 2JEAI 4JV5Q 3A5UA 4DV3Q 5IP9H 1OXTA 2N49A 5C44H 1XNRQ 1HNXQ 2I5MX 1IBLL 3H0GG 3RR5A 2VNUD 4X62Q 2OTJA 1L0WA 4L5TA 2JA9A 4YCUA 4A3DG 4APVA 3NBHB 2VQFL 3H3VI 3RLFA 3J7ZC 4YWKA 3M4PA 3PIOA 4WJ4A 3RZOH 3U50C 3GTKH 1WCMH 1UE7A 1LM0A 3FKIG 2K5VA 3E9IA 4HJ8A 1TWGH 3S24A 4DR2L 1J5EL 1OXUA 3KF8B 1X56A 4X64Q 1EIYB 1V1QA 3CW2C 3PUWA 4JI8Q 2AKWB 2ID0A 2Z0SA 3HOVH 4QGUA 3PSIA 2RF4A 1WYDA 2ZTEA 4DR3L 4OONA 4JBWA 3G6EA 4DR1Q 4AQYL 1Y1WH 2BA1A 1BVSA 2MFIA 4IJLA 4YCVA 1Z47A 2YYZA 2R7ZG 4HJ5A 4GS3A 3J80i 4QL5A 2K52A 3HOXG 3GD7A 1IZ6A 3CF5A 4DV4Q 2UUCQ 4DR6L 4UP7A 5C4XH 2YTXA 2QA4A 1XPOA 4UY8C 4DV0L 4A3IG 1ASYA 2E5LQ 1V43A 3H15A 3PF4A 4LW1A 3T1HL 1S3OA 5FLMH 5AJ3L 5EAYA 1E24A 2LXJA 2WAQE 1OXXK 4X65L 1GM5A 2K5HA 3KF6A 1SN8A 3PUZA 2ZM6Q 1HNZL 5IYDG 1Y1VG 3AYHB 5ELOA 5JEAG 4X66L 4NPSA 5C44G 4LF5L 2A19A 2AWNA 4LF8Q 1K83H 1YHQA 1G6PA 2B3GA 4JYAL 3KJOA 2HIXA 2JA7H 3CPWA 2HT1A 3K80C 4O2DA 2KHJA 5C0XJ 1KRSA 1NMGA 2D0PA 1QVGA 1JJGA 1N8RC 4NXNQ 2ZJRA 4DV1Q 3TS0A 3HOWH 4LFCQ 4A3LG 4GNXB 3HOYH 3CCQA 2K50A 1Y14B 4GKJQ 1Q86C 1VQ5A 3KOJA 2DUDA 4JCVE 3W1GA 3GTMH 3TRZA 2BA0A 3U4VA 2Q2UA 5JJIA 1N34L 2EXDA 4P72A 5IP7G 3KJPA 1XMQQ 4AQYQ 1IYJB 3PCOB 4BY7H 4EX5A 2EIFA 2ZM6L 1WI5A 2CKZB 2Z6KA 4GLAC 1K73C 3L2PA 4YWLA 5IYBH 2L15A 4DPGA 4PZ6A 3PV0A 2VQEQ 2MO0A 4IFDI 1TXYA 2R6GA 4IO9A 4KHPL 4KLKA 4LF9Q 4DV1L 2CQOA 5C4XG 3I55A 1VQ8A 4A93G 3DM3A 1CKNB 1JJCB 3AFQA 1FGUA 1XNQQ 2UUBL 1XPUA 4HJAA 1UE5A 4A3MG 2HQLA 2IHFA 1QUQA 2ZJPA 4A3EG 2R92G 3KLWA 4IPHA 3ICEA 4YY3L 4LF5Q 2B63H 1SFOH 4KI0A 2HHHQ 3IRBA 1TWCH 4GLXA 1PH6A 2ZTCA 4JG2A 1CKMA 1SMXA 2PI2A 2KENA 2WB1E 4YCWA 1Q81C 1PH7A 1GD7A 4B3ML 1VQIA 4KHZA 1YNXA 2PMZE 5JJLA 1JB7A 2IX0A 4DR5Q 3PO3H 4DR4Q 4B3RQ 4A76A 4DV2L 3HKZG 2VW9A 1VQJA 3FP9A 5E7NA 2NVTH 4A3JH 4BXXH 2RHQB 4Y7NH 1PH5A 4C2MH 4MZ9A 4PZ8A 1IL2A 5M3MG 3W1BA 3TEHB 3UDXA 3OTOL 1DGSA 5K36G 3M85A 3K7UC 4JI2L 3SGIA 3GTLH 4PZ7A 1I50H 2ALYB 3ZJYC 3D0FA 1Y1WG 3NELA 2JA5G 1B8AA 4IFDG 2WP8J 4BY7G 1I94Q 3CD6A 3PO2H 4OX9L 1RIPA 1VQBA 5GROA 1MJEA 1N32L 3RNUA 3G4SA 1PA6A 2A1AA 4PMWA 2UU9L 1VQCA 1K0RA 2YTVA 3HOXH 2NVYH 1VQDA 1P16A 4DR7Q 3J81i 5GAEC 4GN3B 4XTCS 3JAMi 2JK8A 4BBRH 4DV6L 3VDYA 4O0AA 4GKJL 1NMFA 4AYBE 4OO1G 4RMFA 2F4VQ 1FVIA 3PIPA 3AEVA 4LFBL 2GN5A 1CSPA 4GKKQ 1U0LA 4FDBA 4POGA 2B63G 2JEBI 2KCMA 4A3KH 2CWPA 3S1NH 2KHIA 5M5WH 2AMCB 3K8AA 4BA1I 4X64L 1JE5A 1K8AC 1PV4A 1J5EQ 1HJPA 5LMNW 1EQQA 1E3PA 1FL0A 1PFSA 2RCNA 1B7YB 1B70B 2VQEL 1KAWA 4A3LH 1VQ9A 3B6YA 4JBJA 3S1QH 1X3FA 4B3TQ 4A3JG 1SRUA 3WWVA 1PH4A 1Q46A 4BXXG 2UXCL 4DR2Q 3U58A 1W2BA 4R4QA 4AH6A 1N36Q 4LFAL 4NB3A 1VQ4A 1YITA 1D7QA 4TVAB 2PI2E 3J7A5 1Q1EA 2JJQA 3UE1A 3CCEA 2HIVA 1I3QH 2XGTA 2ATWA 1HZCA 5H1SE 2QEXA 1U5KA 1HH2P 4LF4Q 2K5NA 1PHJA 2E5LL 2BH2A 4JI1Q 3PO2G 1UEBA 3OTOQ 3HOZG 1KIXA 3I2ZA 2OTLA 2LXKA 2R93G 2K75A 1K9MC 3I4NG 1QUQB 5FJ8G 1IBML
chains in the Genus database with same CATH superfamily
2KCTA 2KCCA 3FDTA 1GO3E 3CC4A 1G291 2R92B 4DAYB 3GTOH 2BDNA 2ES2A 3UDIA 5IE8A 2XWBB 3T1YQ 5HURA 1TS2A 4GN4B 3TS2A 3S1NB 2IX3A 3VYTA 1CZWA 1UE6A 2AQ3B 3HOUB 1EY7A 4UAIA 3ULPA 3CAMA 3BYYB 1HR0L 3K5OA 1RD9D 4RKBA 1HNWQ 4FYDA 1ENFA 2EY6A 2PNRC 5J3BA 1LTTD 3PUXA 3F2BA 3QG1A 5KEEA 3Q23A 1OTCA 1VQEA 1IBKQ 4TRDA 4JI0Q 1D8LA 1H9RA 4ZRZA 3F8TA 4XQNA 2WAQG 1JOOA 4N8FA 3FPPA 1YHAA 5IP9G 2ASBA 4DFAA 4NDXA 4GNXA 5M3FB 3KF8A 5HGQA 2JQOA 2EJMA 4IN3A 3PMFA 5E4WC 1GVPA 2CHBD 4KD3A 2K5QA 4UPAA 5I2XA 4EQ5A 1V1OA 4DV3L 5IWAQ 3ERSX 2Z4IA 3MFYA 4BBSH 4HSVA 3DMUA 3I4MH 1YIJA 3CMEA 1W6KA 3OOCA 4A3GG 1SEBD 4IJHA 1SR3A 3TP5A 2R7ZH 2K33A 3C1FA 3HZXA 2XIWA 1WFQA 1ENCA 2ZJQA 4ZYSA 4JI0L 1YEZA 1SYGA 2B8FA 1L1OB 3D6WA 1KAAA 2SOBA 1S5CD 3H0GH 4YHHL 4WORA 1PH2A 4X6AH 1RTNA 3CC2A 4C3HH 1D5MC 1EIGA 1SYFA 4K6DA 2XNAC 3BG3A 1PTOD 4DK1A 1LT5D 2ZXOA 3V05A 1PH3A 2JA7B 3G7LA 3W3AA 3MEFA 5CBEE 3S17H 1I94L 3CP0A 3FVQA 4IQZA 1V9PA 2KECA 1LT3D 3I73A 4JI6Q 5CV7A 3S2HH 3E0EA 1NE3A 1EY4A 3J7AF 2MP1A 2JA6G 5IYBG 2VUMB 2N3SA 1WTVA 4H02A 1C9OA 4MTNA 5A2QL 1N34Q 2G5DA 1XX8A 4LF4L 1X54A 2WIIB 2PQEA 4LJZC 2JA6B 2NN6I 3RN5A 2GVAA 4C1NK 2VS1A 5CC4A 3L0OA 2EVBA 3NBHA 1WD0A 2HHHL 4FF2A 3K5MA 4XIGS 4B3TL 1AH9A 4ILWA 2IJ0A 1XMQL 1GKHA 1PTOC 4L5RC 1F9SA 4LK1C 4DV7L 1I4RA 5JVG3 1W6JA 1VF7A 4OX9Q 3FKIB 3T13A 1XMOQ 4N8X1 1EY9A 4C2MB 4DXFA 4KHPQ 1JOKA 4LFCL 1LTID 1V8QA 2UUCL 1VQKA 2Z6BA 3PIP3 1BKBA 1ZYRC 5IY0A 3L3OC 4KY5A 1K3BC 1PFBA 3D6CA 2ZT9C 3HOZH 4I7ZC 1O7ZA 1HQRD 4DUZQ 4P75A 1PRTD 3BYTB 4DV2Q 4JOIA 4JYAQ 2DN8A 3PUVA 3TP7A 5CGKA 2SEBD 3WOEA 2VL6A 4HIDA 3HRZC 4DR1L 1TWGB 3CKIB 4QMGA 1KD1C 1TWCB 2I5LX 1B50A 1LABA 1MD2D 3NQTA 1RL2A 2PYKA 4XT3B 3V2TA 3PGZA 2DGYA 2FHTA 2KEEA 4GLVB 2RHSB 5TSSA 1OO9B 3P75A 1FJGL 5KIXA 1CKOA 1HNXL 1IBLQ 1L1OC 1JWUD 2A6ED 2L0CA 3TMEA 1E22A 5GAHC 3EN2A 5C44B 4OO1I 5LMNQ 4ZQ3A 2CWAA 2B29A 3RZOB 4DV5L 4XQQA 1XTDA 3I72A 2K28A 1BUVT 1PDQA 1WTPA 1PYWD 5ELEA 4LFBQ 4QB4A 2E2JB 2EY1A 2EYLA 3HKSA 3GTMB 2AWOA 1OXVA 1PZID 2K1BA 3GV3A 2Z4HA 3SDZA 5LHY1 4JI3L 5C0XH 2XSCA 4EQPA 2VB3X 1Q7YC 5EKIA 3J81c 4KK7A 4R9WA 2WB1G 2QEJC 4GKKL 1SAPA 5A35A 1IKLA 1ILQA 1FJGQ 3I4MG 4LFAQ 1IW7C 3I4NH 3K81C 1PYBA 4JI4L 4KTAA 2D62A 1EQRA 1S4ZA 2NVXH 2M2LA 1QNUA 4LWCA 1STGA 1NR2A 5M9OA 4DV0Q 3K5NA 3FEWX 3VYSA 5KNBA 1II3A 3LWUA 4C1NI 3NBIA 1ZXTA 4C3HG 3RLFA 4YWKA 3S16B 3U50C 2XVSA 2OXPA 3GTKH 1WCMH 3FKIG 2K5VA 3QO2A 4K8IA 1OXUA 1X56A 2J4XA 4X64Q 4PV1C 3K58A 1EY5A 1V1QA 3CW2C 4ZLTF 1EEFD 3PUWA 4G7HC 1SJED 5EKKA 4HTHA 1WYDA 4AQYL 4C3JG 1PFMA 3OMGA 2Z9HA 4HJ5A 1EY8A 4GS3A 4QL5A 4IURA 2ICEC 4A3IG 2A69C 4QCLA 2Y0SB 4XXEA 5ISRA 2MHVA 1E24A 5IT9L 4YIJA 1HNZL 2ZM6Q 3I3CA 4CBVA 4TKOB 4LF5L 2A19A 2AWNA 4HEDA 3AMUA 3SXHA 2KHJA 5C0XJ 1ET6A 1GUGA 3R8BA 3NXWA 1EFID 2ZJRA 3IFDA 4PMBA 4LFCQ 3HOWH 4A3LG 4I7AA 3GTGB 1MSGA 2F0HA 3SK5A 3ZYYX 4KN4C 3U4VA 1A3TA 5IGCA 1N34L 4P72A 4ZKCB 1DONA 4AQYQ 2E76C 2CKZB 1F2MA 1HRJA 4YWLA 5IYBH 5G3LF 3OIPA 4PZ6A 3DEPA 2R6GA 3IFTA 3AB9A 3I55A 5EJWA 3NWTA 3DM3A 1JJCB 4CJ1B 2V4DA 4U673 2R92G 1UE5A 3QOJA 4IPHA 5CORA 2PPBC 2B63H 1LT4D 1SFOH 4E6IA 1PH6A 1TWCH 4Z9CB 3EA6A 4YCWA 2KENA 5JEAH 3H0GB 3G6JB 3BDOA 1YNXA 4KHZA 4LMQD 4ZAIA 1JB7A 1STNA 5JJLA 3S1MB 5HGTA 4A76A 1PRTC 2VW9A 1VQJA 3J7AV 1SSOA 5M3MG 3W1BA 2FMCA 1BCPF 3OTOL 3KK7A 5K36G 2HCCA 3BVZA 4PZ7A 2ALYB 1JWMD 1Y1WG 4IFDG 3JAML 1RDPD 3S2HB 1RIPA 1VQBA 2D9UA 5GROA 3UI2A 2EY2A 1K0RA 3HOXH 2NVYH 1VQDA 1P16A 1Y1WB 1NSNS 4RH6A 5E3FA 2K05A 3HOXB 5JAVA 2JK8A 3DM1A 1ILPA 4AYBE 4OO1G 4RMFA 3TDQA 5I6WA 3AU7A 5IODA 4LFBL 1TVXA 2JEBI 4A3KH 4V0BA 3S1NH 5M5WH 3K0YA 5CBAE 1LACA 4X64L 1K8AC 1PV4A 4IZ8A 1EQQA 2VQEL 1F9PA 2I07B 2EPBA 2L9HA 5JJZA 3WWVA 2UXCL 3U58A 4B9WA 4R4QA 4AH6A 1Q3LA 4LFAL 4NB3A 1QCBD 1D7QA 4KV6A 4CJ2C 2JJQA 3CCEA 1AZPA 1XWEA 2B2VC 2C5CA 3GTJB 4LF4Q 2K5DA 1HH2P 2M9VA 1X3PA 5I2YA 1PRTF 2Q8RE 3D4DA 4JI1Q 4K8JA 1KIXA 3I2ZA 2R93G 4IUNA 2NWGA 4CJ0B 1KDCA 5FJ8G 3Q24A 1BDOA 1CA5A 2ZTDA 1JJ2A 2F0KA 4DKAC 4OO1H 2EYJA 4K0KL 3GTOB 5CYUA 1UUPA 4AYBB 1Y8PB 2OQKA 4P74A 3UDGA 4GNXC 1W3SA 3TQYA 3DEOA 2UUAQ 1NBWA 3I7FA 2IPKD 5T1IA 2XTIA 2F0GA 1EWHA 2MPMA 3RN2A 1NUCA 4LUVA 1C4QA 5GADC 1YJWA 2JA8B 3TN2A 5IGDA 3I4MB 1VQAA 4ZKBB 2VQFQ 2B2WC 1GUWA 4OL7A 2MNAA 1E7ZA 2JA8G 1DOKA 3F2CA 1HFNA 3NPPA 5EBDA 2A6HD 1XNRL 2AQ2B 2F3WA 5M5XH 3A8IE 2NZ1D 3DHQA 3KF6B 4ABNA 2Y0SE 3QR8A 2EDGA 4FVMA 1SXTA 1ESRA 2R93H 3T1YL 4J1MA 1EYDA 4DK6C 3A74A 2V1CC 4A3IH 1EY0A 1Z9FA 3RUZA 4C3HB 4JI6L 3R2IA 1HR0Q 3TZUA 4DA2A 3FHWA 5IYDH 1J8IA 3T51B 4JI7L 1D5ZC 3E3XA 4LF7Q 3C1EA 2PO4A 1VQNA 1NJIC 5GQOA 4TQUS 1IBMQ 4BY1G 1IBKL 4N9TA 3DLLA 2EXZA 3CC7A 2M00A 3KLSA 4RA8A 4BY7B 2CW0D 4DR7L 5BR8Q 5CV5A 4C3IG 4Q0FA 2NBFA 2H1EA 2VXWA 4IPGA 4P71A 4DV7Q 4C3IB 1VQLA 1RHPA 3C3LA 1SMYD 1U4PA 3I4NB 4IUUA 1TWAH 1A2TA 4F87A 4A3DH 3ULJA 2A73B 4YWMA 3VR6A 2K4KA 4QIWE 1Y1VH 2KHSA 1FGBD 4HMIA 3BZKA 4QJFA 5KNDA 1TS4A 2OCEA 4DAYA 3MXNB 2CQAA 3S16H 1KNAA 3HKZE 1X3QA 2F3IA 3EIVA 1XTCD 2HDMA 3NEMA 5JEAJ 3H6MA 1X9NA 2Q2TA 4JI1L 1YI2A 5C3XA 3KDFB 5C4HA 1QOHA 5BR8L 3E0JA 2Q2IA 1G91A 2IL8A 4DV5Q 4CDCC 2ENBA 1OXSC 1GUNA 3AFPA 1BBWA 3S15H 1STEA 3RMHA 2MJ8A 1TIID 1HR0W 3S15B 4Y52H 1X32A 3K7AB 3ULLA 2MUYA 1GHKA 1I4GA 2LSSA 1RJTA 1A3VA 5J39A 1K0SA 3MXUA 3VA7A 4R1JA 4BBRG 4PMCA 1ML0D 1VQPA 2RQXA 4LF6Q 1BNZA 4B3MQ 3CCMA 2G9HD 3CCJA 2H5XA 5C3EG 1I6HB 1EQVA 2PW5A 1CSQA 3OWEB 1CA6A 2FINB 5M3MH 4B3RL 4DV4L 3GTGH 2CH4A 1HZ9A 3VYUA 2Q2HA 2GVBA 2LY7A 4DR3Q 3M4QA 1UEAB 1C8CA 5CMDA 4BBSB 2IT1A 3M9BA 4JI8L 2E2IH 2E2DC 5EPLA 1A0IA 5E1FA 2D2CC 4A3CG 2KQ3A 3A7AB 4L5QA 4HJ9A 3T1HQ 1KXLA 4K6LA 2JN4A 1IKMA 1M8AA 2C35B 4OWWB 3CMAA 1PVOA 5FJ8H 1DD2A 4LF6L 1VMPA 1KRTA 1K8OA 1LT6D 1QVCA 3PO3G 2EYHA 3M3YH 1VQHA 1I6VC 2N8NA 3EROA 1J6QA 2PNHA 1HZBA 3E5SA 3MHBA 4FP5D 4HIKA 3Q8DA 4DUYQ 4OEMB 4FXKC 3A0JA 1XYIA 1DJRD 2A69D 4LF9L 3F2DA 2OQ0A 3RZDH 1S72A 4OWTB 4DR4L 2EYFA 1KC8C 4C3JB 1HNZQ 4M8AA 2NN6G 3QWNA 4C3JH 3A8KE 4HAEA 3OW2A 4HCSA 1CK1A 1HFGA 4G57A 1BCPC 4LUZA 2HD3A 1EYAA 1N33Q 4KJNA 5I9OA 4GOPB 5JJKA 4RGMA 1TS5A 1NR4A 4IOAA 2A6HC 2F0NA 2R61A 3M4OH 1L1OA 1TKWB 1QNKA 2CFMA 2L55A 2UXDQ 5DAUA 2L11A 4X62L 4DF7A 3P1HA 1K3RA 2E2HH 3LGJA 4DUZL 3GTKB 5AFWA 4KY6A 3I4OA 3T53B 2WINB 1U4MA 3NP8A 4A3BH 2VB2X 4L5SA 5IYCG 3GTQB 1A3UA 1AE2A 1E1OA 1U9RA 5ELCA 1GHJA 3VA5A 4JBMA 3ER0A 1XJVA 3J80c 3N52A 4NXML 5I9PA 2UU9Q 4JV5Q 4LAAA 1HNXQ 1IBLL 3D3RA 1O7YA 2B2TA 4X62Q 1L0WA 2JA9A 5G3LD 3OIQA 4L6TB 4QUFA 3OSOA 1SJHD 3MC0B 4APVA 2L5TA 3M4PA 3PIOA 1LM0A 1J5EL 3KF8B 2HCIA 3BVGA 1EU3A 1KTKA 2E2IB 3HOVH 3PSIA 1B53A 2RF4A 5EKLA 3CQZB 1STBA 4DR3L 2BA1A 4FNFA 2MFIA 1STAA 2EOTA 3T4AC 3S2DB 3CF5A 1RODA 3SK6A 2YTXA 5C4XH 3J81E 3PIO3 4UDUC 1V43A 3H15A 4LW1A 3T1HL 5FLMH 3SVMA 3Q6SA 1BF4A 2WAQE 5KYIA 1GM5A 2K5HA 1O78A 3KF6A 3PUZA 4R8IA 3MTSA 1Y1VG 3AYHB 4QUCA 5ELOA 1S5ED 5C44G 2X6LA 3QB3A 4L8JA 1YHQA 1G6PA 4G7ZC 1EYCA 2JA7H 1LTGD 4O2DA 1L0XB 1KRSA 4GZYC 2CH4W 4DV1Q 3SE0A 5JPNC 3TS0A 4GNXB 3CCQA 2B8GA 1Y14B 1VQ5A 1TS3A 3GTMH 2BA0A 1MSHA 5JJIA 3KJPA 2BDOA 1XMQQ 4BY7H 2EIFA 2ZM6L 1WI5A 2Z6KA 4GLAC 2L15A 4DPGA 1A15A 3PV0A 1NNXA 2VQEQ 4KKSA 4KHPL 1MI2A 5J22A 3TP8A 1VQ8A 3AFQA 2I46A 3HGBA 1XPUA 2F0FA 2HQLA 2ZJPA 3U9SA 3PQIA 3IRBA 1E0BA 2XN9C 4FXDA 1SMXA 2ZXPA 4CDDC 1TQOA 4DR4Q 4A3DB 1WTHA 4DV2L 3ND8A 3R93A 4Y7NH 5DEHA 1PH5A 4C2MH 1IL2A 5ELBA 4BS9A 4MTKA 1BQQT 3TEHB 3K7UC 1TU2B 4B08A 2JSOA 3ZJYC 3H94A 1PXUA 3NELA 4KKUA 1B8AA 4K2KA 1MJEA 1N32L 3G4SA 2A1AA 2B39A 1VQCA 2YTVA 2F0UA 4K5VA 3U9OA 3J81i 5GAEC 4BBRH 3NK9A 3BZDB 2K04A 3MXPA 4GKJL 2F4VQ 1QE6A 1FVIA 1EQTA 3SK4A 1LTSD 1CZGA 5FLXL 2PZUA 2GN5A 1T5XD 4GKKQ 3W2DA 4POGA 4KJOA 2B63G 5M5YB 2NTSA 1JQYD 3K8AA 2NUCA 1GOZA 1HJPA 1G2TA 1J9OA 1TWHB 1B70B 3S1QH 2A74C 2F0SA 2K5WA 3QJYA 1Q46A 1B44D 1Y8OB 4IUPA 4UHVA 5EBCA 1N36Q 1VQ4A 4TVAB 1SBBB 2LS01 2PZTA 3UE1A 4A3JB 2XGTA 3KBXA 1LV9A 1ENAA 1HZCA 1JCKB 1PHJA 2E5LL 1CTMA 3QOLA 3OTOQ 3HOZG 4J6HA 2LXKA 1K9MC 1IBML 1G2SA 1KQSA 1EIFA 3RLOA 3AQQA 1JR0D 2IY5B 3S9WA 2B2YC 1IW7D 3CHBD 1GUSA 5FO8B 5C4JH 2F0JA 3DWPA 1PH8A 4DAMA 3K0XA 1D5XC 2EJGC 4V190 4A3FG 5IIFA 1SFOB 3A54A 1F9QA 1LTLA 3D8GA 2PQAB 5CR3A 5ELDA 3CQZH 2A68C 1K8GA 2F4IA 3OYYA 5LMUL 4JI5L 1EWCA 1PTOH 1C7YA 5J1ZA 4I65A 4NXNL 2NN6H 1AP0A 4R8NA 1MIUA 4A3BG 3R2TA 1WOCA 2UXBQ 4K2LA 4C3IH 5IYCH 1YNJD 5IOCA 4JV5L 3HOUG 1I4HA 1I3QB 3ITPA 4JI3Q 3G71A 1SE8A 2WB1B 3GO5A 1RF2D 1SNMA 2BE5D 1FYCA 5F2DA 4JI4Q 4JOIC 4X3TA 1Y69U 3S1RH 3V96A 3A7LA 3UE0A 3K59A 3TP6A 3STBD 3W5OA 3TREA 5FLMG 3S1MH 3M4OB 2MGSA 5I4DA 3KLSX 3IKJA 1KDAA 1ICWA 4EQNA 3G48A 4WJWA 4YY3Q 3X3MA 4ZK9B 2E8GA 4WRDA 4A4IA 1QZHA 2SDFA 2F0DA 4R4CA 4WJ3M 2AUJD 1BBUA 1QG7A 2YTYA 2D0OA 3QIAA 1EY6A 1EZ6A 2R7DA 1I4QA 3EBEA 2UUAL 2UXBL 5EQ0A 1R9TH 1LTRD 1JMCA 1WTXA 4KD4A 2JA6H 5C0XI 1CUKA 1E1TA 1N33L 3OPOA 4A3GB 3PUYA 2ICIA 2K03A 1SNCA 2VY3A 4DAPA 4O42A 1D2BA 2F0EA 3N6RA 1MKHA 4LF8L 4P2CB 1IHZA 3I90A 4O1NA 1WJJA 5IT9E 1E2WA 4OELB 1WCMG 1X3GA 3FKIH 4A3FH 5EPJA 2X69A 3CCLA 5AJ3Q 5KGUA 4F8MA 1N36L 2L1BA 3K6OA 4KKTA 3U4ZA 1Q12A 1WCMB 5KYLA 3MZ5A 1PRTB 3J80L 1EOVA 2L4NA 3GTPH 1DCZA 1VQFA 4H44C 3GTJH 3GV6A 4QY7A 4GN5A 3CPFA 4R4IA 5IT9c 5T1GA 3K57A 2VUMG 3PO2B 1H9JA 3F1ZA 3RD4A 3NENA 3SEBA 1M1KC 1HTPA 1KNEA 1ZKOA 3T16A 2JA5H 1CM9A 1X55A 3BS1A 4A93H 1N9WA 1O7LA 2BH8A 2UUBQ 1VQMA 5DLQE 3BJUA 3S2DH 3C2PA 2E2JH 2EQSA 1TWHH 1B3QA 1SE4A 1LO5D 2F0OA 4A3MB 3A5ZB 3I4LA 4R4OA 4CKCA 4A3EB 4J15A 1XNQL 1M90C 4XDXA 2LMCB 1X3EA 2EYMA 2MQHA 1YNNC 4IUQA 2RDHA 2R7FA 1A8VA 1SYBA 1FNUA 4K14A 1BBXC 5CV8A 1TT2A 5DNFA 1KDBA 4AIMA 1A6XA 1A2UA 4G4KA 4ME3A 5C4ZA 2OWOA 4HIOA 3KYHC 4C56C 2O5JC 3WDNA 1I5FA 4IFDH 4J8QA 4H7BA 1YJ9A 2HDLA 4ZUJA 3IL8A 1GJXA 3OHXC 2TMPA 1H95A 1UE1A 1WTWA 5M3FG 3S14B 1EOTA 5HY6A 4A3KB 1SROA 1HUNA 4QQBX 1Q82C 3D4WA 4JBKA 3H3VC 4OWXB 2QGQA 1VQOA 1QILA 1TWAB 2KEDA 1Q90A 4A3KG 1PTOB 2SNMA 4KY7A 4IPCA 5FOBB 1E2VA 1EZ8A 2YU9H 1XMOL 5K36H 4RCOA 2PCFB 4Y7NB 5D3DA 4IUVA 1VQGA 4DNRB 4ID6A 3LWEA 5ELNA 5BN5A 1NY4A 2R3ZA 2A6EC 5I6YA 5LL6S 2AQ1B 3HFZB 4FXGC 2UXCQ 1NTGA 4FF4A 3H09A 1B2TA 4PG3A 1VQ7A 1Y1VB 2PQAA 5DM73 1C0AA 2DJFC 4UP8A 3K7AH 5M3FH 2A68D 5FO9B 3BVMA 2K01A 5CV6A 5M5YH 1DYQA 4IUTA 4EGVA 1EL0A 2JE6I 2JA7G 4DNIA 2XWJB 4XT1B 5C3EB 2F0QA 4PQXA 1AE3A 4X3KA 1WTQA 1SE3A 2NVQB 1HCZA 1CHPD 2JA8H 2QCPX 1Q1BA 3S1QB 4UP9A 1JB3A 5FLXc 3HOUH 3DXJC 1QVFA 4OIKA 4P73A 3BU2A 3KDFA 1WD1A 4LUOA 3GDEA 2F4VL 3P20A 4JC0A 5C4XB 3Q22A 4DV6Q 4GOPC 3JAME 3A5UA 4DV3Q 1OXTA 4FF3A 2N49A 5C44H 1XNRQ 5NUCA 2I5MX 3RR5A 2B2UA 1U4LA 4YCUA 2DY7A 4A3DG 3FPUB 3NBHB 4HCEA 3RZOH 4DAVA 1D6EC 3VR2A 5C4JB 3M3YB 3E9IA 1TWGH 4DR2L 2JYOA 1FR3A 1EIYB 1CQFA 3KLRA 2Z0SA 1AFPA 2F3VA 3LNNA 5IGEA 3EJIA 4U68A 2DY8A 5C6AA 4BY1B 2DNCA 3G6EA 1WTOA 1RCVD 4IJLA 4YCVA 2YYZA 2R7ZG 2K7VA 2KA7A 4H0LC 3L9AX 2K52A 3M4YA 1IZ6A 2RKSA 3GD7A 4DV4Q 4DR6L 4BWGB 2QA4A 4UY8C 4DV0L 1ASYA 2AUKA 3CRLC 3GP7A 4G7OC 1S3OA 5AJ3L 5EAYA 4RKLA 4X65L 2J0TD 1SN8A 1EU4A 5IGBA 4RFBA 1B4OA 5D65A 1EEID 2EYOA 3KJOA 2Z8LA 3K80C 2HT1A 3NWSA 1JJGA 1NMGA 4NXNQ 4B9XA 1FD7D 3HOYH 2J7ZA 2K50A 3MAQA 3SR1A 4DXGA 1BOSA 2B2UC 4ZCKA 4GKJQ 1Q86C 3KOJA 3A8JE 2DUDA 2QDLA 2B2WA 2Q2UA 4JW0A 1I4XA 4F88A 1SE2A 2EXDA 3E6ZX 1E2ZA 4XQJA 2QW7A 3PCOB 2KVMA 3NQIA 3DUZA 1BR9A 1XXGA 4JVZA 2NTTA 1K73C 1CQVA 3L2PA 1SNOA 2O4XA 1R9TB 4IFDI 4IO9A 3SK8A 5FLXE 4RWSC 4KLKA 5EPKA 4LF9Q 4DV1L 1KABA 1CKNB 2BOSA 2E74C 1XNQQ 4QIWB 4A3MG 2IHFA 1QUQA 4A3EG 3KLWA 5FKAC 1D1KA 4YY3L 4KN7C 3ICEA 4LF5Q 2HHHQ 4KI0A 3T56B 3MEHA 4GLXA 2ZTCA 1JE4A 3P7JA 2PI2A 3BDCA 4B3ML 1PH7A 1GD7A 4DGZA 5C5MA 4HMJA 3VYRA 5M3MB 4DR5Q 3PO3H 4IALA 3HKZG 5E7NA 2NVTH 2EJFC 2QDBA 2RHQB 4MZ9A 3WOFA 3UDXA 4DNTB 1WTRA 3M85A 4JI2L 3SGIA 1I50H 1VDZA 3VR3A 3MA2B 2JA5G 5L37A 4BY7G 3PO2H 3RNUA 4PMWA 4DR7Q 2KJXA 3FMCA 4NW2A 1MHWC 4GN3B 1DXMA 3JAMi 4DV6L 2SNSA 3VDYA 2FMMA 2RA4A 1NAPA 2ZXRA 1V1PB 2WKCA 3PIPA 4ME5A 1U0LA 1WVLA 2KCMA 2CWPA 5JPMC 2B2YA 1B1ZA 3OW7A 1MBYA 4JPBW 4BA1I 1JE5A 1BCPD 5LMNW 1JOQA 2RCNA 1KAWA 4RGOS 1EIHA 1FNWA 1X3FA 4JK1C 1PH4A 1SNQA 4DR2Q 1R4QB 2H4OA 1O80A 2PI2E 2F0WA 3J7A5 1ONLA 3FRPB 2R7ZB 1S5DD 2PMZB 2HIVA 4CGYB 2R93B 1I3QH 4H13C 1GUTA 2O5IC 2BH2A 2K5NA 1STHA 4A3IB 3MVVA 1VMCA 1MGSA 2OTLA 2K75A 2CVRA 2NVYB 5CV9A 3D31A 4OIJA 3J81L 4EQOA 1CT1D 1SDFA 1TR5A 1HHVA 1HA6A 1LTAD 2XRQD 2Q8IB 3M7GA 2F0IA 4RHSA 1VF5C 1VS0A 1VQ6A 1PYSB 3DWQA 1B3AA 4BY1H 4LF7L 1F2ZA 1PMRA 3RZDB 2UXDL 4IPDA 3VR4A 3J81j 1UWVA 3BDLA 2DNEA 2B2TC 2I5HA 3JAMc 1Q8KA 1UNSA 4A3GH 2JXMB 1YJNA 2VUMH 4HJ7A 1EFWA 3HOVG 4HR7B 3M7NA 1I4PA 1TWFH 3JC66 1S5FD 1QB5D 2F52A 3KUPA 5BN3A 2KOLA 2JP1A 1VCIA 3VR5A 1Z6HA 1X6OA 1I6HH 1SNPA 1FNVA 2BE5C 1AZQA 3MWYW 1T9HA 3O13A 1K83B 1F2LA 3CCUA 1MJCA 1EUJA 1AW7A 3CCRA 1H9SB 4NXMQ 3NUCA 2EZVA 1ESFA 3STBC 5KRUA 4GOPA 3ERQA 3CCVA 3RLNA 5M5WB 1HUMA 1YZ6A 1PLFA 5GAGC 1IYVA 3L7ZC 1RTOA 2N78A 1IXRA 4B3SQ 4XYOA 3GTPB 4MIUA 2K14A 2JA5B 4IOCA 4OXPA 2VZAA 1U4RA 1O7IA 5LMNL 2EY5A 5EGTA 2CCZA 5A2QE 3PF5A 4A3CH 1DZ1A 5DM63 3I70A 2IX1A 2OEOA 2EYPA 1ET9A 1SLJA 2HQEA 4DR5L 4A3EH 1HNWL 1EWIA 3H3VH 4EVOA 1YBYA 1DOLA 1QZGA 3HOWB 4A75A 2OF1A 4JI2Q 2I0QA 1TY0A 2F0MA 3HOWG 3Q0AA 5FO7B 3TBIB 1BO0A 1DM0B 1XPRA 1CFMA 2DJGC 2RCFA 3S17B 4FO2A 3I56A 4F7XA 1ZYRD 1X65A 5IP7H 3CCSA 5JOBA 4ODGA 4X3SA 2B2VA 2WV6D 3S14H 4HIMA 5JVH3 1SYDA 2QILA 2MO1A 3E9HA 4N9PA 2YV5A 2XRSD 5KNCA 1LUZA 5IWAL 4NKLA 1SNDA 4AYBG 4L63B 2NVXB 4A3MH 1IL8A 3HS0C 2WAQB 3MXGA 4K5XA 3TSSA 2BCOA 3HKZB 3HOYG 1PZJD 2Q8TA 3X3NA 4IFDJ 2NYZD 1YVCA 1EYGA 4RG1A 1M4VA 5D3IB 3BZCA 3HOYB 1HPCA 1H9SA 4DUYL 5C0XG 4BBSG 2RVLA 1S40A 1G51A 3F2UA 4S3SA 4DR6Q 4CDEC 4MNOA 4MN3A 4DU9A 1HQMC 5LL6X 1A62A 4XYQA 1F2YA 3I8ZA 1LYLA 4CDFC 2F0LA 1SYCA 2RDGA 3HEJA 4NP5A 4ZUIA 5LMUQ 1PH1A 2R92H 2KBNA 4RHRA 4NMZA 1F77A 1YNJC 4X66Q 1N32Q 2GA4B 4JI7Q 5IGGA 2C9OA 1KHIA 3CRKC 5FK9C 2E2HB 4M1UB 1JICA 5IGFA 1L2FA 3SHLA 2IHEA 3PO3B 4KMUC 1F9RA 1AEXA 1SYEA 2NVQH 1P8LA 2NZHA 4POFA 4K5WA 2F1MA 5CV4A 1PFNA 4X65Q 2CW0C 3GTQH 1KL9A 4K0KQ 5M5XB 1HA5A 1YHBA 3KFUA 1JORA 4JI5Q 3NTIA 4LNQA 4DK0A 3H91A 4R4TA 1GUOA 3NTKA 4PNYA 3UDFA 2Y0SG 2A8VA 4CKEA 2X6GA 2K32A 3NE5B 3HOZB 1SMYC 2NZOA 2AHOB 2WFWA 4DK3C 4A93B 2KCNA 4ALPA 2L12A 1STYA 4RGNA 2N88A 1B9NA 4YHHQ 1QJOA 4HSPA 5C3EH 4FF1A 1Y8NB 3A55A 3HP3A 3D4RA 2OT2A 1G6ZA 4ULLA 1CHQD 1ASZA 3CXCA 2D5DA 2RBMA 4MHEA 4WFN3 2FJ2A 2FXQA 5COYA 3HOVB 1A63A 1JT8A 2F03A 1G8ZD 2KUMA 4Q5VA 2N55A 1QWYA 4BA2I 1D1IA 1CKNA 1Q8IA 1HZAA 4HN7A 1PH9A 1BCPB 3NHHA 4DN4M 2Z6KC 2K6AA 2JEAI 2RSNA 3J80E 5IP9H 1R4PB 3S1RB 1ICFB 3H0GG 2VNUD 2OTJA 1V1PA 4L5TA 4OGQC 3TZDA 2VQFL 3H3VI 3J7ZC 2G9DA 4WJ4A 1UE7A 3KBGA 4OHJA 4HJ8A 2HUGA 3S24A 4CKBA 2LKVA 2NB0A 4JI8Q 2AKWB 2ID0A 4QGUA 1RKNA 3URYA 1BXTA 2IW3A 1KLGD 2ZTEA 4OONA 4JBWA 1Y1WH 4DR1Q 2QKIC 1BVSA 2F0PA 1Z47A 3I91A 3J80i 1TWFB 1GXDC 3HOXG 2UUCQ 4UP7A 1XPOA 1K28A 1PTOF 2E5LQ 3PF4A 3OWFA 2LXJA 1OXXK 2LFNA 1C48A 5IYDG 3EFXD 1TY2A 3DWAA 5JEAG 4X66L 1DOMA 4NPSA 2NVTB 4LF8Q 1K83H 2B3GA 4JYAL 2HIXA 1H9KA 3CPWA 1QVGA 2D0PA 1LTBD 2F0TA 4KHVA 1N8RC 4A3FB 1LLRD 3EVQA 1HXYD 1HTLD 4JCVE 3W1GA 2E75C 3TRZA 2A5HA 1Z7TA 1I50B 2FFKB 5IP7G 1CI3M 3NSWA 1IYJB 4EX5A 3GQBA 4A3BB 1AN8A 1YNND 1UAPA 2RSOA 5D14A 2MO0A 1TXYA 1IYUA 4BBRB 3MFGA 2CQOA 5C4XG 2WACA 3R3OA 4A93G 1FGUA 3EQLC 2UUBL 4HJAA 1ZEQX 5K5PA 2PZWA 1B9MA 4JG2A 1CKMA 2WB1E 1Q81C 1VQIA 1JWSD 2PMZE 2IX0A 4B3RQ 3C46A 3FP9A 4A3JH 4BXXH 4PZ8A 3J7YW 3HG9A 2F0VA 2WKDA 4RCNA 3IAYA 1DGSA 3NTHA 3GTLH 4RGTA 3MXNA 3OMCA 3D0FA 3GTLB 2WP8J 1I94Q 3CD6A 4OX9L 2TSSA 1PA6A 2UU9L 3LX0A 4XTCS 2O2LD 1L0YB 4O0AA 5C5LA 1NMFA 2P5ZX 4QF4A 3AEVA 1CSPA 4FDBA 1KLUD 2Z1CA 5BN4A 4TSSA 2KHIA 4X3UA 2AMCB 1J5EQ 2B63B 1E3PA 1FL0A 1PFSA 3A56A 1B7YB 4A3LH 1VQ9A 3B6YA 4JBJA 5C3WA 4B3TQ 1JC7A 4RAUC 1NCVA 4A3JG 1SRUA 2YU9B 4BXXG 1W2BA 1T5EA 1YITA 2EE1A 1Q1EA 5E4XA 5ELFA 4CHTB 3ONAB 3CU7A 2ATWA 2IWHA 5H1SE 2QEXA 1U5KA 1PZKD 1K8MA 2QF7A 3PO2G 1H9MA 1UEBA 2PW7A 3K5LA 1S5BD 3I4NG 2RDFA 1QUQB 4B3SL 3ND9A
chains in the Genus database with same CATH topology
2KCTA 3D31A 1KQSA 1EIFA 2ZTDA 1JJ2A 3RLOA 3AQQA 4DKAC 1GO3E 2IY5B 4K0KL 3CC4A 1G291 2OQKA 4DAYB 5C4JH 4P74A 1PH8A 3UDGA 4DAMA 3K0XA 2ES2A 3GTOH 4GNXC 1W3SA 3TQYA 3UDIA 4A3FG 2UUAQ 1VS0A 5IE8A 1VQ6A 1NBWA 3I7FA 1LTLA 1PYSB 3T1YQ 2XTIA 2PQAB 4GN4B 3TS2A 3CQZH 1K8GA 4BY1H 3RN2A 3OYYA 4LUVA 5LMUL 4JI5L 4LF7L 5GADC 1YJWA 1UE6A 1C7YA 4NXNL 2UXDL 4IPDA 1VQAA 3J81j 1MIUA 1UWVA 3CAMA 3ULPA 1HR0L 2VQFQ 4A3BG 2I5HA 3JAMc 1WOCA 1Q8KA 2UXBQ 5IYCH 1E7ZA 4C3IH 2MNAA 1YJNA 2JA8G 2VUMH 4HJ7A 3F2CA 1EFWA 4A3GH 1HNWQ 3HOVG 4JV5L 3HOUG 5J3BA 3PUXA 3M7NA 1XNRL 3F2BA 1TWFH 5M5XH 4JI3Q 3JC66 3G71A 1SE8A 3KF6B 3GO5A 1OTCA 2Y0SE 1VQEA 4JI4Q 2F52A 1IBKQ 3T1YL 2R93H 4JOIC 4JI0Q 4DK6C 3A74A 3S1RH 1D8LA 1VCIA 2V1CC 3F8TA 4A3IH 1X6OA 2WAQG 3UE0A 1YHAA 1Z9FA 1I6HH 3STBD 5IP9G 2ASBA 4GNXA 1T9HA 3W5OA 3TREA 5HGQA 2JQOA 5FLMG 1HR0Q 4JI6L 3S1MH 3FHWA 3CCUA 1GVPA 1MJCA 1EUJA 3G48A 4YY3Q 5IYDH 3CCRA 4NXMQ 4UPAA 3STBC 4GOPA 4JI7L 2E8GA 4EQ5A 4A4IA 1QZHA 3CCVA 3RLNA 4DV3L 1YZ6A 5IWAQ 4LF7Q 3ERSX 4R4CA 5GAGC 4WJ3M 3L7ZC 1BBUA 1NJIC 2N78A 5GQOA 2YTYA 4TQUS 1VQNA 1IXRA 1IBMQ 2D0OA 4B3SQ 4BY1G 1IBKL 3DLLA 4BBSH 2R7DA 3CC7A 2K14A 3EBEA 2UUAL 3I4MH 2UXBL 1YIJA 4IOCA 1R9TH 4OXPA 2VZAA 4DR7L 5LMNL 1O7IA 3CMEA 5BR8Q 1JMCA 4A3GG 4IJHA 2CCZA 2JA6H 1SR3A 4IPGA 2R7ZH 3PF5A 4P71A 5C0XI 1CUKA 4A3CH 1E1TA 1N33L 4DV7Q 3PUYA 2IX1A 1WFQA 1VQLA 2ZJQA 4JI0L 1YEZA 2VY3A 1L1OB 3H0GH 4YHHL 1TWAH 1PH2A 4X6AH 1SLJA 3CC2A 4A3DH 3ULJA 4C3HH 4DR5L 1MKHA 4LF8L 1WJJA 4YWMA 4A3EH 2K4KA 4QIWE 1HNWL 1EWIA 1Y1VH 3H3VH 1YBYA 1WCMG 1X3GA 3FKIH 4A3FH 1QZGA 4A75A 3CCLA 5AJ3Q 3BZKA 4QJFA 1N36L 2OCEA 1PH3A 4JI2Q 3MXNB 3S16H 3U4ZA 2I0QA 3HKZE 1Q12A 3MEFA 3HOWG 1EOVA 2F3IA 3S17H 3EIVA 3GTPH 3NEMA 5JEAJ 1XPRA 3CP0A 1I94L 1VQFA 3GTJH 1X9NA 1V9PA 2Q2TA 4JI1L 1YI2A 3KDFB 4QY7A 3I56A 4GN5A 5BR8L 1X65A 3CPFA 4R4IA 5IP7H 2Q2IA 5IT9c 4JI6Q 2VUMG 3CCSA 4DV5Q 3E0EA 3F1ZA 3S2HH 3NENA 1OXSC 1NE3A 1M1KC 3AFPA 1BBWA 3S15H 4HIMA 2JA5H 2JA6G 5IYBG 3S14H 2N3SA 1C9OA 4H02A 1X55A 2MO1A 3E9HA 4MTNA 2YV5A 1N34Q 4A93H 1HR0W 1LUZA 4LF4L 1N9WA 1X54A 2BH8A 3ULLA 5IWAL 2UUBQ 4Y52H 1VQMA 2LSSA 4AYBG 5DLQE 3BJUA 2NN6I 3RN5A 3S2DH 2GVAA 2VS1A 4R1JA 4BBRG 1VQPA 4A3MH 2E2JH 2EQSA 3L0OA 1TWHH 4LF6Q 2HHHL 4B3MQ 3CCMA 3A5ZB 4R4OA 3CCJA 4J15A 4XIGS 2H5XA 4B3TL 5C3EG 3HOYG 1AH9A 1XNQL 1M90C 1XMQL 1GKHA 1CSQA 4IFDJ 1YVCA 1X3EA 1EYGA 4L5RC 5JJKA 5M3MH 2MQHA 4DV7L 4B3RL 4RG1A 4DV4L 3GTGH 3BZCA 1HZ9A 4OX9Q 2Q2HA 2R7FA 1A8VA 5C0XG 4DUYL 1XMOQ 4BBSG 4KHPQ 2GVBA 4LFCL 4AIMA 1S40A 4DR3Q 1G51A 3M4QA 4ME3A 2UUCL 2OWOA 4HIOA 4DR6Q 1VQKA 2IT1A 3KYHC 3M9BA 4MNOA 4JI8L 2E2IH 1I5FA 1A62A 1A0IA 1BKBA 5IY0A 1LYLA 4A3CG 1YJ9A 5LMUQ 1PH1A 2R92H 4L5QA 4HJ9A 3T1HQ 1KXLA 3HOZH 1H95A 1UE1A 2KBNA 4DUZQ 2C35B 4P75A 5M3FG 3CMAA 4DV2Q 4OWWB 4JOIA 5FJ8H 5HY6A 4JYAQ 1PVOA 3PUVA 1SROA 4LF6L 4X66Q 4QQBX 1Q82C 1N32Q 4JBKA 1KRTA 4JI7Q 4OWXB 2QGQA 1QVCA 2VL6A 1VQOA 4HIDA 1VQHA 4A3KG 1KHIA 3PO3G 4DR1L 3M3YH 2N8NA 4HIKA 1J6QA 2PNHA 1HZBA 4IPCA 1L2FA 3Q8DA 2IHEA 1KD1C 2YU9H 2I5LX 4DUYQ 1XMOL 1RL2A 3A0JA 2NVQH 1P8LA 4LF9L 3F2DA 1VQGA 2OQ0A 2NZHA 3RZDH 4POFA 1S72A 4OWTB 4DR4L 3PGZA 1KC8C 2DGYA 5ELNA 4GLVB 2RHSB 4X65Q 1HNZQ 2NN6G 1NY4A 4C3JH 3GTQH 1KL9A 4K0KQ 1FJGL 1YHBA 3KFUA 3OW2A 4JI5Q 4LNQA 1CKOA 1HNXL 1IBLQ 2UXCQ 3HFZB 1L1OC 4R4TA 3UDFA 1NTGA 2Y0SG 4B3SL 2A8VA 4LUZA 1E22A 4PG3A 2NZOA 2AHOB 2WFWA 5GAHC 4GOPB 1VQ7A 2PQAA 4DK3C 3EN2A 1N33Q 4OO1I 5LMNQ 1C0AA 4ALPA 2CWAA 4UP8A 3K7AH 2B29A 5M3FH 4IOAA 3M4OH 1L1OA 4DV5L 1XTDA 2CFMA 5M5YH 4YHHQ 2UXDQ 4X62L 5C3EH 2JE6I 2JA7G 4LFBQ 1K3RA 4DNIA 2E2HH 3LGJA 4DUZL 3HKSA 2AWOA 1OXVA 3I4OA 1AE3A 4JI3L 3CXCA 1ASZA 2FXQA 4A3BH 1A63A 4L5SA 1JT8A 5IYCG 2JA8H 1Q1BA 1Q7YC 4UP9A 5FLXc 3HOUH 3J81c 1QVFA 2WB1G 4GKKL 4BA2I 1FJGQ 3I4MG 4P73A 4LFAQ 1AE2A 1E1OA 3BU2A 1CKNA 3KDFA 3I4NH 3K81C 1PYBA 4LUOA 3GDEA 1HZAA 2F4VL 4JC0A 1PH9A 4JI4L 4JBMA 3ER0A 4DV6Q 1XJVA 2D62A 3J80c 1EQRA 2Z6KC 2NVXH 4NXML 4GOPC 4LWCA 4DV0Q 2UU9Q 2JEAI 4JV5Q 3A5UA 4DV3Q 5IP9H 1OXTA 2N49A 5C44H 1XNRQ 1HNXQ 2I5MX 1IBLL 3H0GG 3RR5A 2VNUD 4X62Q 2OTJA 1L0WA 4L5TA 2JA9A 4YCUA 4A3DG 4APVA 3NBHB 2VQFL 3H3VI 3RLFA 3J7ZC 4YWKA 3M4PA 3PIOA 4WJ4A 3RZOH 3U50C 3GTKH 1WCMH 1UE7A 1LM0A 3FKIG 2K5VA 3E9IA 4HJ8A 1TWGH 3S24A 4DR2L 1J5EL 1OXUA 3KF8B 1X56A 4X64Q 1EIYB 1V1QA 3CW2C 3PUWA 4JI8Q 2AKWB 2ID0A 2Z0SA 3HOVH 4QGUA 3PSIA 2RF4A 1WYDA 2ZTEA 4DR3L 4OONA 4JBWA 3G6EA 4DR1Q 4AQYL 1Y1WH 2BA1A 1BVSA 2MFIA 4IJLA 4YCVA 1Z47A 2YYZA 2R7ZG 4HJ5A 4GS3A 3J80i 4QL5A 2K52A 3HOXG 3GD7A 1IZ6A 3CF5A 4DV4Q 2UUCQ 4DR6L 4UP7A 5C4XH 2YTXA 2QA4A 1XPOA 4UY8C 4DV0L 4A3IG 1ASYA 2E5LQ 1V43A 3H15A 3PF4A 4LW1A 3T1HL 1S3OA 5FLMH 5AJ3L 5EAYA 1E24A 2LXJA 2WAQE 1OXXK 4X65L 1GM5A 2K5HA 3KF6A 1SN8A 3PUZA 2ZM6Q 1HNZL 5IYDG 1Y1VG 3AYHB 5ELOA 5JEAG 4X66L 4NPSA 5C44G 4LF5L 2A19A 2AWNA 4LF8Q 1K83H 1YHQA 1G6PA 2B3GA 4JYAL 3KJOA 2HIXA 2JA7H 3CPWA 2HT1A 3K80C 4O2DA 2KHJA 5C0XJ 1KRSA 1NMGA 2D0PA 1QVGA 1JJGA 1N8RC 4NXNQ 2ZJRA 4DV1Q 3TS0A 3HOWH 4LFCQ 4A3LG 4GNXB 3HOYH 3CCQA 2K50A 1Y14B 4GKJQ 1Q86C 1VQ5A 3KOJA 2DUDA 4JCVE 3W1GA 3GTMH 3TRZA 2BA0A 3U4VA 2Q2UA 5JJIA 1N34L 2EXDA 4P72A 5IP7G 3KJPA 1XMQQ 4AQYQ 1IYJB 3PCOB 4BY7H 4EX5A 2EIFA 2ZM6L 1WI5A 2CKZB 2Z6KA 4GLAC 1K73C 3L2PA 4YWLA 5IYBH 2L15A 4DPGA 4PZ6A 3PV0A 2VQEQ 2MO0A 4IFDI 1TXYA 2R6GA 4IO9A 4KHPL 4KLKA 4LF9Q 4DV1L 2CQOA 5C4XG 3I55A 1VQ8A 4A93G 3DM3A 1CKNB 1JJCB 3AFQA 1FGUA 1XNQQ 2UUBL 1XPUA 4HJAA 1UE5A 4A3MG 2HQLA 2IHFA 1QUQA 2ZJPA 4A3EG 2R92G 3KLWA 4IPHA 3ICEA 4YY3L 4LF5Q 2B63H 1SFOH 4KI0A 2HHHQ 3IRBA 1TWCH 4GLXA 1PH6A 2ZTCA 4JG2A 1CKMA 1SMXA 2PI2A 2KENA 2WB1E 4YCWA 1Q81C 1PH7A 1GD7A 4B3ML 1VQIA 4KHZA 1YNXA 2PMZE 5JJLA 1JB7A 2IX0A 4DR5Q 3PO3H 4DR4Q 4B3RQ 4A76A 4DV2L 3HKZG 2VW9A 1VQJA 3FP9A 5E7NA 2NVTH 4A3JH 4BXXH 2RHQB 4Y7NH 1PH5A 4C2MH 4MZ9A 4PZ8A 1IL2A 5M3MG 3W1BA 3TEHB 3UDXA 3OTOL 1DGSA 5K36G 3M85A 3K7UC 4JI2L 3SGIA 3GTLH 4PZ7A 1I50H 2ALYB 3ZJYC 3D0FA 1Y1WG 3NELA 2JA5G 1B8AA 4IFDG 2WP8J 4BY7G 1I94Q 3CD6A 3PO2H 4OX9L 1RIPA 1VQBA 5GROA 1MJEA 1N32L 3RNUA 3G4SA 1PA6A 2A1AA 4PMWA 2UU9L 1VQCA 1K0RA 2YTVA 3HOXH 2NVYH 1VQDA 1P16A 4DR7Q 3J81i 5GAEC 4GN3B 4XTCS 3JAMi 2JK8A 4BBRH 4DV6L 3VDYA 4O0AA 4GKJL 1NMFA 4AYBE 4OO1G 4RMFA 2F4VQ 1FVIA 3PIPA 3AEVA 4LFBL 2GN5A 1CSPA 4GKKQ 1U0LA 4FDBA 4POGA 2B63G 2JEBI 2KCMA 4A3KH 2CWPA 3S1NH 2KHIA 5M5WH 2AMCB 3K8AA 4BA1I 4X64L 1JE5A 1K8AC 1PV4A 1J5EQ 1HJPA 5LMNW 1EQQA 1E3PA 1FL0A 1PFSA 2RCNA 1B7YB 1B70B 2VQEL 1KAWA 4A3LH 1VQ9A 3B6YA 4JBJA 3S1QH 1X3FA 4B3TQ 4A3JG 1SRUA 3WWVA 1PH4A 1Q46A 4BXXG 2UXCL 4DR2Q 3U58A 1W2BA 4R4QA 4AH6A 1N36Q 4LFAL 4NB3A 1VQ4A 1YITA 1D7QA 4TVAB 2PI2E 3J7A5 1Q1EA 2JJQA 3UE1A 3CCEA 2HIVA 1I3QH 2XGTA 2ATWA 1HZCA 5H1SE 2QEXA 1U5KA 1HH2P 4LF4Q 2K5NA 1PHJA 2E5LL 2BH2A 4JI1Q 3PO2G 1UEBA 3OTOQ 3HOZG 1KIXA 3I2ZA 2OTLA 2LXKA 2R93G 2K75A 1K9MC 3I4NG 1QUQB 5FJ8G 1IBML
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCT A;  3D31 A;  1KQS A;  1EIF A;  2ZTD A;  1JJ2 A;  3RLO A;  3AQQ A;  4DKA C;  1GO3 E;  2IY5 B;  4K0K L;  3CC4 A;  1G29 1;  2OQK A;  4DAY B;  5C4J H;  4P74 A;  1PH8 A;  3UDG A;  4DAM A;  3K0X A;  2ES2 A;  3GTO H;  4GNX C;  1W3S A;  3TQY A;  3UDI A;  4A3F G;  2UUA Q;  1VS0 A;  5IE8 A;  1VQ6 A;  1NBW A;  3I7F A;  1LTL A;  1PYS B;  3T1Y Q;  2XTI A;  2PQA B;  4GN4 B;  3TS2 A;  3CQZ H;  1K8G A;  4BY1 H;  3RN2 A;  3OYY A;  4LUV A;  5LMU L;  4JI5 L;  4LF7 L;  5GAD C;  1YJW A;  1UE6 A;  1C7Y A;  4NXN L;  2UXD L;  4IPD A;  1VQA A;  3J81 j;  1MIU A;  1UWV A;  3CAM A;  3ULP A;  1HR0 L;  2VQF Q;  4A3B G;  2I5H A;  3JAM c;  1WOC A;  1Q8K A;  2UXB Q;  5IYC H;  1E7Z A;  4C3I H;  2MNA A;  1YJN A;  2JA8 G;  2VUM H;  4HJ7 A;  3F2C A;  1EFW A;  4A3G H;  1HNW Q;  3HOV G;  4JV5 L;  3HOU G;  5J3B A;  3PUX A;  3M7N A;  1XNR L;  3F2B A;  1TWF H;  5M5X H;  4JI3 Q;  3JC6 6;  3G71 A;  1SE8 A;  3KF6 B;  3GO5 A;  1OTC A;  2Y0S E;  1VQE A;  4JI4 Q;  2F52 A;  1IBK Q;  3T1Y L;  2R93 H;  4JOI C;  4JI0 Q;  4DK6 C;  3A74 A;  3S1R H;  1D8L A;  1VCI A;  2V1C C;  3F8T A;  4A3I H;  1X6O A;  2WAQ G;  3UE0 A;  1YHA A;  1Z9F A;  1I6H H;  3STB D;  5IP9 G;  2ASB A;  4GNX A;  1T9H A;  3W5O A;  3TRE A;  5HGQ A;  2JQO A;  5FLM G;  1HR0 Q;  4JI6 L;  3S1M H;  3FHW A;  3CCU A;  1GVP A;  1MJC A;  1EUJ A;  3G48 A;  4YY3 Q;  5IYD H;  3CCR A;  4NXM Q;  4UPA A;  3STB C;  4GOP A;  4JI7 L;  2E8G A;  4EQ5 A;  4A4I A;  1QZH A;  3CCV A;  3RLN A;  4DV3 L;  1YZ6 A;  5IWA Q;  4LF7 Q;  3ERS X;  4R4C A;  5GAG C;  4WJ3 M;  3L7Z C;  1BBU A;  1NJI C;  2N78 A;  5GQO A;  2YTY A;  4TQU S;  1VQN A;  1IXR A;  1IBM Q;  2D0O A;  4B3S Q;  4BY1 G;  1IBK L;  3DLL A;  4BBS H;  2R7D A;  3CC7 A;  2K14 A;  3EBE A;  2UUA L;  3I4M H;  2UXB L;  1YIJ A;  4IOC A;  1R9T H;  4OXP A;  2VZA A;  4DR7 L;  5LMN L;  1O7I A;  3CME A;  5BR8 Q;  1JMC A;  4A3G G;  4IJH A;  2CCZ A;  2JA6 H;  1SR3 A;  4IPG A;  2R7Z H;  3PF5 A;  4P71 A;  5C0X I;  1CUK A;  4A3C H;  1E1T A;  1N33 L;  4DV7 Q;  3PUY A;  2IX1 A;  1WFQ A;  1VQL A;  2ZJQ A;  4JI0 L;  1YEZ A;  2VY3 A;  1L1O B;  3H0G H;  4YHH L;  1TWA H;  1PH2 A;  4X6A H;  1SLJ A;  3CC2 A;  4A3D H;  3ULJ A;  4C3H H;  4DR5 L;  1MKH A;  4LF8 L;  1WJJ A;  4YWM A;  4A3E H;  2K4K A;  4QIW E;  1HNW L;  1EWI A;  1Y1V H;  3H3V H;  1YBY A;  1WCM G;  1X3G A;  3FKI H;  4A3F H;  1QZG A;  4A75 A;  3CCL A;  5AJ3 Q;  3BZK A;  4QJF A;  1N36 L;  2OCE A;  1PH3 A;  4JI2 Q;  3MXN B;  3S16 H;  3U4Z A;  2I0Q A;  3HKZ E;  1Q12 A;  3MEF A;  3HOW G;  1EOV A;  2F3I A;  3S17 H;  3EIV A;  3GTP H;  3NEM A;  5JEA J;  1XPR A;  3CP0 A;  1I94 L;  1VQF A;  3GTJ H;  1X9N A;  1V9P A;  2Q2T A;  4JI1 L;  1YI2 A;  3KDF B;  4QY7 A;  3I56 A;  4GN5 A;  5BR8 L;  1X65 A;  3CPF A;  4R4I A;  5IP7 H;  2Q2I A;  5IT9 c;  4JI6 Q;  2VUM G;  3CCS A;  4DV5 Q;  3E0E A;  3F1Z A;  3S2H H;  3NEN A;  1OXS C;  1NE3 A;  1M1K C;  3AFP A;  1BBW A;  3S15 H;  4HIM A;  2JA5 H;  2JA6 G;  5IYB G;  3S14 H;  2N3S A;  1C9O A;  4H02 A;  1X55 A;  2MO1 A;  3E9H A;  4MTN A;  2YV5 A;  1N34 Q;  4A93 H;  1HR0 W;  1LUZ A;  4LF4 L;  1N9W A;  1X54 A;  2BH8 A;  3ULL A;  5IWA L;  2UUB Q;  4Y52 H;  1VQM A;  2LSS A;  4AYB G;  5DLQ E;  3BJU A;  2NN6 I;  3RN5 A;  3S2D H;  2GVA A;  2VS1 A;  4R1J A;  4BBR G;  1VQP A;  4A3M H;  2E2J H;  2EQS A;  3L0O A;  1TWH H;  4LF6 Q;  2HHH L;  4B3M Q;  3CCM A;  3A5Z B;  4R4O A;  3CCJ A;  4J15 A;  4XIG S;  2H5X A;  4B3T L;  5C3E G;  3HOY G;  1AH9 A;  1XNQ L;  1M90 C;  1XMQ L;  1GKH A;  1CSQ A;  4IFD J;  1YVC A;  1X3E A;  1EYG A;  4L5R C;  5JJK A;  5M3M H;  2MQH A;  4DV7 L;  4B3R L;  4RG1 A;  4DV4 L;  3GTG H;  3BZC A;  1HZ9 A;  4OX9 Q;  2Q2H A;  2R7F A;  1A8V A;  5C0X G;  4DUY L;  1XMO Q;  4BBS G;  4KHP Q;  2GVB A;  4LFC L;  4AIM A;  1S40 A;  4DR3 Q;  1G51 A;  3M4Q A;  4ME3 A;  2UUC L;  2OWO A;  4HIO A;  4DR6 Q;  1VQK A;  2IT1 A;  3KYH C;  3M9B A;  4MNO A;  4JI8 L;  2E2I H;  1I5F A;  1A62 A;  1A0I A;  1BKB A;  5IY0 A;  1LYL A;  4A3C G;  1YJ9 A;  5LMU Q;  1PH1 A;  2R92 H;  4L5Q A;  4HJ9 A;  3T1H Q;  1KXL A;  3HOZ H;  1H95 A;  1UE1 A;  2KBN A;  4DUZ Q;  2C35 B;  4P75 A;  5M3F G;  3CMA A;  4DV2 Q;  4OWW B;  4JOI A;  5FJ8 H;  5HY6 A;  4JYA Q;  1PVO A;  3PUV A;  1SRO A;  4LF6 L;  4X66 Q;  4QQB X;  1Q82 C;  1N32 Q;  4JBK A;  1KRT A;  4JI7 Q;  4OWX B;  2QGQ A;  1QVC A;  2VL6 A;  1VQO A;  4HID A;  1VQH A;  4A3K G;  1KHI A;  3PO3 G;  4DR1 L;  3M3Y H;  2N8N A;  4HIK A;  1J6Q A;  2PNH A;  1HZB A;  4IPC A;  1L2F A;  3Q8D A;  2IHE A;  1KD1 C;  2YU9 H;  2I5L X;  4DUY Q;  1XMO L;  1RL2 A;  3A0J A;  2NVQ H;  1P8L A;  4LF9 L;  3F2D A;  1VQG A;  2OQ0 A;  2NZH A;  3RZD H;  4POF A;  1S72 A;  4OWT B;  4DR4 L;  3PGZ A;  1KC8 C;  2DGY A;  5ELN A;  4GLV B;  2RHS B;  4X65 Q;  1HNZ Q;  2NN6 G;  1NY4 A;  4C3J H;  3GTQ H;  1KL9 A;  4K0K Q;  1FJG L;  1YHB A;  3KFU A;  3OW2 A;  4JI5 Q;  4LNQ A;  1CKO A;  1HNX L;  1IBL Q;  2UXC Q;  3HFZ B;  1L1O C;  4R4T A;  3UDF A;  1NTG A;  2Y0S G;  4B3S L;  2A8V A;  4LUZ A;  1E22 A;  4PG3 A;  2NZO A;  2AHO B;  2WFW A;  5GAH C;  4GOP B;  1VQ7 A;  2PQA A;  4DK3 C;  3EN2 A;  1N33 Q;  4OO1 I;  5LMN Q;  1C0A A;  4ALP A;  2CWA A;  4UP8 A;  3K7A H;  2B29 A;  5M3F H;  4IOA A;  3M4O H;  1L1O A;  4DV5 L;  1XTD A;  2CFM A;  5M5Y H;  4YHH Q;  2UXD Q;  4X62 L;  5C3E H;  2JE6 I;  2JA7 G;  4LFB Q;  1K3R A;  4DNI A;  2E2H H;  3LGJ A;  4DUZ L;  3HKS A;  2AWO A;  1OXV A;  3I4O A;  1AE3 A;  4JI3 L;  3CXC A;  1ASZ A;  2FXQ A;  4A3B H;  1A63 A;  4L5S A;  1JT8 A;  5IYC G;  2JA8 H;  1Q1B A;  1Q7Y C;  4UP9 A;  5FLX c;  3HOU H;  3J81 c;  1QVF A;  2WB1 G;  4GKK L;  4BA2 I;  1FJG Q;  3I4M G;  4P73 A;  4LFA Q;  1AE2 A;  1E1O A;  3BU2 A;  1CKN A;  3KDF A;  3I4N H;  3K81 C;  1PYB A;  4LUO A;  3GDE A;  1HZA A;  2F4V L;  4JC0 A;  1PH9 A;  4JI4 L;  4JBM A;  3ER0 A;  4DV6 Q;  1XJV A;  2D62 A;  3J80 c;  1EQR A;  2Z6K C;  2NVX H;  4NXM L;  4GOP C;  4LWC A;  4DV0 Q;  2UU9 Q;  2JEA I;  4JV5 Q;  3A5U A;  4DV3 Q;  5IP9 H;  1OXT A;  2N49 A;  5C44 H;  1XNR Q;  1HNX Q;  2I5M X;  1IBL L;  3H0G G;  3RR5 A;  2VNU D;  4X62 Q;  2OTJ A;  1L0W A;  4L5T A;  2JA9 A;  4YCU A;  4A3D G;  4APV A;  3NBH B;  2VQF L;  3H3V I;  3RLF A;  3J7Z C;  4YWK A;  3M4P A;  3PIO A;  4WJ4 A;  3RZO H;  3U50 C;  3GTK H;  1WCM H;  1UE7 A;  1LM0 A;  3FKI G;  2K5V A;  3E9I A;  4HJ8 A;  1TWG H;  3S24 A;  4DR2 L;  1J5E L;  1OXU A;  3KF8 B;  1X56 A;  4X64 Q;  1EIY B;  1V1Q A;  3CW2 C;  3PUW A;  4JI8 Q;  2AKW B;  2ID0 A;  2Z0S A;  3HOV H;  4QGU A;  3PSI A;  2RF4 A;  1WYD A;  2ZTE A;  4DR3 L;  4OON A;  4JBW A;  3G6E A;  4DR1 Q;  4AQY L;  1Y1W H;  2BA1 A;  1BVS A;  2MFI A;  4IJL A;  4YCV A;  1Z47 A;  2YYZ A;  2R7Z G;  4HJ5 A;  4GS3 A;  3J80 i;  4QL5 A;  2K52 A;  3HOX G;  3GD7 A;  1IZ6 A;  3CF5 A;  4DV4 Q;  2UUC Q;  4DR6 L;  4UP7 A;  5C4X H;  2YTX A;  2QA4 A;  1XPO A;  4UY8 C;  4DV0 L;  4A3I G;  1ASY A;  2E5L Q;  1V43 A;  3H15 A;  3PF4 A;  4LW1 A;  3T1H L;  1S3O A;  5FLM H;  5AJ3 L;  5EAY A;  1E24 A;  2LXJ A;  2WAQ E;  1OXX K;  4X65 L;  1GM5 A;  2K5H A;  3KF6 A;  1SN8 A;  3PUZ A;  2ZM6 Q;  1HNZ L;  5IYD G;  1Y1V G;  3AYH B;  5ELO A;  5JEA G;  4X66 L;  4NPS A;  5C44 G;  4LF5 L;  2A19 A;  2AWN A;  4LF8 Q;  1K83 H;  1YHQ A;  1G6P A;  2B3G A;  4JYA L;  3KJO A;  2HIX A;  2JA7 H;  3CPW A;  2HT1 A;  3K80 C;  4O2D A;  2KHJ A;  5C0X J;  1KRS A;  1NMG A;  2D0P A;  1QVG A;  1JJG A;  1N8R C;  4NXN Q;  2ZJR A;  4DV1 Q;  3TS0 A;  3HOW H;  4LFC Q;  4A3L G;  4GNX B;  3HOY H;  3CCQ A;  2K50 A;  1Y14 B;  4GKJ Q;  1Q86 C;  1VQ5 A;  3KOJ A;  2DUD A;  4JCV E;  3W1G A;  3GTM H;  3TRZ A;  2BA0 A;  3U4V A;  2Q2U A;  5JJI A;  1N34 L;  2EXD A;  4P72 A;  5IP7 G;  3KJP A;  1XMQ Q;  4AQY Q;  1IYJ B;  3PCO B;  4BY7 H;  4EX5 A;  2EIF A;  2ZM6 L;  1WI5 A;  2CKZ B;  2Z6K A;  4GLA C;  1K73 C;  3L2P A;  4YWL A;  5IYB H;  2L15 A;  4DPG A;  4PZ6 A;  3PV0 A;  2VQE Q;  2MO0 A;  4IFD I;  1TXY A;  2R6G A;  4IO9 A;  4KHP L;  4KLK A;  4LF9 Q;  4DV1 L;  2CQO A;  5C4X G;  3I55 A;  1VQ8 A;  4A93 G;  3DM3 A;  1CKN B;  1JJC B;  3AFQ A;  1FGU A;  1XNQ Q;  2UUB L;  1XPU A;  4HJA A;  1UE5 A;  4A3M G;  2HQL A;  2IHF A;  1QUQ A;  2ZJP A;  4A3E G;  2R92 G;  3KLW A;  4IPH A;  3ICE A;  4YY3 L;  4LF5 Q;  2B63 H;  1SFO H;  4KI0 A;  2HHH Q;  3IRB A;  1TWC H;  4GLX A;  1PH6 A;  2ZTC A;  4JG2 A;  1CKM A;  1SMX A;  2PI2 A;  2KEN A;  2WB1 E;  4YCW A;  1Q81 C;  1PH7 A;  1GD7 A;  4B3M L;  1VQI A;  4KHZ A;  1YNX A;  2PMZ E;  5JJL A;  1JB7 A;  2IX0 A;  4DR5 Q;  3PO3 H;  4DR4 Q;  4B3R Q;  4A76 A;  4DV2 L;  3HKZ G;  2VW9 A;  1VQJ A;  3FP9 A;  5E7N A;  2NVT H;  4A3J H;  4BXX H;  2RHQ B;  4Y7N H;  1PH5 A;  4C2M H;  4MZ9 A;  4PZ8 A;  1IL2 A;  5M3M G;  3W1B A;  3TEH B;  3UDX A;  3OTO L;  1DGS A;  5K36 G;  3M85 A;  3K7U C;  4JI2 L;  3SGI A;  3GTL H;  4PZ7 A;  1I50 H;  2ALY B;  3ZJY C;  3D0F A;  1Y1W G;  3NEL A;  2JA5 G;  1B8A A;  4IFD G;  2WP8 J;  4BY7 G;  1I94 Q;  3CD6 A;  3PO2 H;  4OX9 L;  1RIP A;  1VQB A;  5GRO A;  1MJE A;  1N32 L;  3RNU A;  3G4S A;  1PA6 A;  2A1A A;  4PMW A;  2UU9 L;  1VQC A;  1K0R A;  2YTV A;  3HOX H;  2NVY H;  1VQD A;  1P16 A;  4DR7 Q;  3J81 i;  5GAE C;  4GN3 B;  4XTC S;  3JAM i;  2JK8 A;  4BBR H;  4DV6 L;  3VDY A;  4O0A A;  4GKJ L;  1NMF A;  4AYB E;  4OO1 G;  4RMF A;  2F4V Q;  1FVI A;  3PIP A;  3AEV A;  4LFB L;  2GN5 A;  1CSP A;  4GKK Q;  1U0L A;  4FDB A;  4POG A;  2B63 G;  2JEB I;  2KCM A;  4A3K H;  2CWP A;  3S1N H;  2KHI A;  5M5W H;  2AMC B;  3K8A A;  4BA1 I;  4X64 L;  1JE5 A;  1K8A C;  1PV4 A;  1J5E Q;  1HJP A;  5LMN W;  1EQQ A;  1E3P A;  1FL0 A;  1PFS A;  2RCN A;  1B7Y B;  1B70 B;  2VQE L;  1KAW A;  4A3L H;  1VQ9 A;  3B6Y A;  4JBJ A;  3S1Q H;  1X3F A;  4B3T Q;  4A3J G;  1SRU A;  3WWV A;  1PH4 A;  1Q46 A;  4BXX G;  2UXC L;  4DR2 Q;  3U58 A;  1W2B A;  4R4Q A;  4AH6 A;  1N36 Q;  4LFA L;  4NB3 A;  1VQ4 A;  1YIT A;  1D7Q A;  4TVA B;  2PI2 E;  3J7A 5;  1Q1E A;  2JJQ A;  3UE1 A;  3CCE A;  2HIV A;  1I3Q H;  2XGT A;  2ATW A;  1HZC A;  5H1S E;  2QEX A;  1U5K A;  1HH2 P;  4LF4 Q;  2K5N A;  1PHJ A;  2E5L L;  2BH2 A;  4JI1 Q;  3PO2 G;  1UEB A;  3OTO Q;  3HOZ G;  1KIX A;  3I2Z A;  2OTL A;  2LXK A;  2R93 G;  2K75 A;  1K9M C;  3I4N G;  1QUQ B;  5FJ8 G;  1IBM L; 
#chains in the Genus database with same CATH topology
 2KCT A;  2KCC A;  3FDT A;  1GO3 E;  3CC4 A;  1G29 1;  2R92 B;  4DAY B;  3GTO H;  2BDN A;  2ES2 A;  3UDI A;  5IE8 A;  2XWB B;  3T1Y Q;  5HUR A;  1TS2 A;  4GN4 B;  3TS2 A;  3S1N B;  2IX3 A;  3VYT A;  1CZW A;  1UE6 A;  2AQ3 B;  3HOU B;  1EY7 A;  4UAI A;  3ULP A;  3CAM A;  3BYY B;  1HR0 L;  3K5O A;  1RD9 D;  4RKB A;  1HNW Q;  4FYD A;  1ENF A;  2EY6 A;  2PNR C;  5J3B A;  1LTT D;  3PUX A;  3F2B A;  3QG1 A;  5KEE A;  3Q23 A;  1OTC A;  1VQE A;  1IBK Q;  4TRD A;  4JI0 Q;  1D8L A;  1H9R A;  4ZRZ A;  3F8T A;  4XQN A;  2WAQ G;  1JOO A;  4N8F A;  3FPP A;  1YHA A;  5IP9 G;  2ASB A;  4DFA A;  4NDX A;  4GNX A;  5M3F B;  3KF8 A;  5HGQ A;  2JQO A;  2EJM A;  4IN3 A;  3PMF A;  5E4W C;  1GVP A;  2CHB D;  4KD3 A;  2K5Q A;  4UPA A;  5I2X A;  4EQ5 A;  1V1O A;  4DV3 L;  5IWA Q;  3ERS X;  2Z4I A;  3MFY A;  4BBS H;  4HSV A;  3DMU A;  3I4M H;  1YIJ A;  3CME A;  1W6K A;  3OOC A;  4A3G G;  1SEB D;  4IJH A;  1SR3 A;  3TP5 A;  2R7Z H;  2K33 A;  3C1F A;  3HZX A;  2XIW A;  1WFQ A;  1ENC A;  2ZJQ A;  4ZYS A;  4JI0 L;  1YEZ A;  1SYG A;  2B8F A;  1L1O B;  3D6W A;  1KAA A;  2SOB A;  1S5C D;  3H0G H;  4YHH L;  4WOR A;  1PH2 A;  4X6A H;  1RTN A;  3CC2 A;  4C3H H;  1D5M C;  1EIG A;  1SYF A;  4K6D A;  2XNA C;  3BG3 A;  1PTO D;  4DK1 A;  1LT5 D;  2ZXO A;  3V05 A;  1PH3 A;  2JA7 B;  3G7L A;  3W3A A;  3MEF A;  5CBE E;  3S17 H;  1I94 L;  3CP0 A;  3FVQ A;  4IQZ A;  1V9P A;  2KEC A;  1LT3 D;  3I73 A;  4JI6 Q;  5CV7 A;  3S2H H;  3E0E A;  1NE3 A;  1EY4 A;  3J7A F;  2MP1 A;  2JA6 G;  5IYB G;  2VUM B;  2N3S A;  1WTV A;  4H02 A;  1C9O A;  4MTN A;  5A2Q L;  1N34 Q;  2G5D A;  1XX8 A;  4LF4 L;  1X54 A;  2WII B;  2PQE A;  4LJZ C;  2JA6 B;  2NN6 I;  3RN5 A;  2GVA A;  4C1N K;  2VS1 A;  5CC4 A;  3L0O A;  2EVB A;  3NBH A;  1WD0 A;  2HHH L;  4FF2 A;  3K5M A;  4XIG S;  4B3T L;  1AH9 A;  4ILW A;  2IJ0 A;  1XMQ L;  1GKH A;  1PTO C;  4L5R C;  1F9S A;  4LK1 C;  4DV7 L;  1I4R A;  5JVG 3;  1W6J A;  1VF7 A;  4OX9 Q;  3FKI B;  3T13 A;  1XMO Q;  4N8X 1;  1EY9 A;  4C2M B;  4DXF A;  4KHP Q;  1JOK A;  4LFC L;  1LTI D;  1V8Q A;  2UUC L;  1VQK A;  2Z6B A;  3PIP 3;  1BKB A;  1ZYR C;  5IY0 A;  3L3O C;  4KY5 A;  1K3B C;  1PFB A;  3D6C A;  2ZT9 C;  3HOZ H;  4I7Z C;  1O7Z A;  1HQR D;  4DUZ Q;  4P75 A;  1PRT D;  3BYT B;  4DV2 Q;  4JOI A;  4JYA Q;  2DN8 A;  3PUV A;  3TP7 A;  5CGK A;  2SEB D;  3WOE A;  2VL6 A;  4HID A;  3HRZ C;  4DR1 L;  1TWG B;  3CKI B;  4QMG A;  1KD1 C;  1TWC B;  2I5L X;  1B50 A;  1LAB A;  1MD2 D;  3NQT A;  1RL2 A;  2PYK A;  4XT3 B;  3V2T A;  3PGZ A;  2DGY A;  2FHT A;  2KEE A;  4GLV B;  2RHS B;  5TSS A;  1OO9 B;  3P75 A;  1FJG L;  5KIX A;  1CKO A;  1HNX L;  1IBL Q;  1L1O C;  1JWU D;  2A6E D;  2L0C A;  3TME A;  1E22 A;  5GAH C;  3EN2 A;  5C44 B;  4OO1 I;  5LMN Q;  4ZQ3 A;  2CWA A;  2B29 A;  3RZO B;  4DV5 L;  4XQQ A;  1XTD A;  3I72 A;  2K28 A;  1BUV T;  1PDQ A;  1WTP A;  1PYW D;  5ELE A;  4LFB Q;  4QB4 A;  2E2J B;  2EY1 A;  2EYL A;  3HKS A;  3GTM B;  2AWO A;  1OXV A;  1PZI D;  2K1B A;  3GV3 A;  2Z4H A;  3SDZ A;  5LHY 1;  4JI3 L;  5C0X H;  2XSC A;  4EQP A;  2VB3 X;  1Q7Y C;  5EKI A;  3J81 c;  4KK7 A;  4R9W A;  2WB1 G;  2QEJ C;  4GKK L;  1SAP A;  5A35 A;  1IKL A;  1ILQ A;  1FJG Q;  3I4M G;  4LFA Q;  1IW7 C;  3I4N H;  3K81 C;  1PYB A;  4JI4 L;  4KTA A;  2D62 A;  1EQR A;  1S4Z A;  2NVX H;  2M2L A;  1QNU A;  4LWC A;  1STG A;  1NR2 A;  5M9O A;  4DV0 Q;  3K5N A;  3FEW X;  3VYS A;  5KNB A;  1II3 A;  3LWU A;  4C1N I;  3NBI A;  1ZXT A;  4C3H G;  3RLF A;  4YWK A;  3S16 B;  3U50 C;  2XVS A;  2OXP A;  3GTK H;  1WCM H;  3FKI G;  2K5V A;  3QO2 A;  4K8I A;  1OXU A;  1X56 A;  2J4X A;  4X64 Q;  4PV1 C;  3K58 A;  1EY5 A;  1V1Q A;  3CW2 C;  4ZLT F;  1EEF D;  3PUW A;  4G7H C;  1SJE D;  5EKK A;  4HTH A;  1WYD A;  4AQY L;  4C3J G;  1PFM A;  3OMG A;  2Z9H A;  4HJ5 A;  1EY8 A;  4GS3 A;  4QL5 A;  4IUR A;  2ICE C;  4A3I G;  2A69 C;  4QCL A;  2Y0S B;  4XXE A;  5ISR A;  2MHV A;  1E24 A;  5IT9 L;  4YIJ A;  1HNZ L;  2ZM6 Q;  3I3C A;  4CBV A;  4TKO B;  4LF5 L;  2A19 A;  2AWN A;  4HED A;  3AMU A;  3SXH A;  2KHJ A;  5C0X J;  1ET6 A;  1GUG A;  3R8B A;  3NXW A;  1EFI D;  2ZJR A;  3IFD A;  4PMB A;  4LFC Q;  3HOW H;  4A3L G;  4I7A A;  3GTG B;  1MSG A;  2F0H A;  3SK5 A;  3ZYY X;  4KN4 C;  3U4V A;  1A3T A;  5IGC A;  1N34 L;  4P72 A;  4ZKC B;  1DON A;  4AQY Q;  2E76 C;  2CKZ B;  1F2M A;  1HRJ A;  4YWL A;  5IYB H;  5G3L F;  3OIP A;  4PZ6 A;  3DEP A;  2R6G A;  3IFT A;  3AB9 A;  3I55 A;  5EJW A;  3NWT A;  3DM3 A;  1JJC B;  4CJ1 B;  2V4D A;  4U67 3;  2R92 G;  1UE5 A;  3QOJ A;  4IPH A;  5COR A;  2PPB C;  2B63 H;  1LT4 D;  1SFO H;  4E6I A;  1PH6 A;  1TWC H;  4Z9C B;  3EA6 A;  4YCW A;  2KEN A;  5JEA H;  3H0G B;  3G6J B;  3BDO A;  1YNX A;  4KHZ A;  4LMQ D;  4ZAI A;  1JB7 A;  1STN A;  5JJL A;  3S1M B;  5HGT A;  4A76 A;  1PRT C;  2VW9 A;  1VQJ A;  3J7A V;  1SSO A;  5M3M G;  3W1B A;  2FMC A;  1BCP F;  3OTO L;  3KK7 A;  5K36 G;  2HCC A;  3BVZ A;  4PZ7 A;  2ALY B;  1JWM D;  1Y1W G;  4IFD G;  3JAM L;  1RDP D;  3S2H B;  1RIP A;  1VQB A;  2D9U A;  5GRO A;  3UI2 A;  2EY2 A;  1K0R A;  3HOX H;  2NVY H;  1VQD A;  1P16 A;  1Y1W B;  1NSN S;  4RH6 A;  5E3F A;  2K05 A;  3HOX B;  5JAV A;  2JK8 A;  3DM1 A;  1ILP A;  4AYB E;  4OO1 G;  4RMF A;  3TDQ A;  5I6W A;  3AU7 A;  5IOD A;  4LFB L;  1TVX A;  2JEB I;  4A3K H;  4V0B A;  3S1N H;  5M5W H;  3K0Y A;  5CBA E;  1LAC A;  4X64 L;  1K8A C;  1PV4 A;  4IZ8 A;  1EQQ A;  2VQE L;  1F9P A;  2I07 B;  2EPB A;  2L9H A;  5JJZ A;  3WWV A;  2UXC L;  3U58 A;  4B9W A;  4R4Q A;  4AH6 A;  1Q3L A;  4LFA L;  4NB3 A;  1QCB D;  1D7Q A;  4KV6 A;  4CJ2 C;  2JJQ A;  3CCE A;  1AZP A;  1XWE A;  2B2V C;  2C5C A;  3GTJ B;  4LF4 Q;  2K5D A;  1HH2 P;  2M9V A;  1X3P A;  5I2Y A;  1PRT F;  2Q8R E;  3D4D A;  4JI1 Q;  4K8J A;  1KIX A;  3I2Z A;  2R93 G;  4IUN A;  2NWG A;  4CJ0 B;  1KDC A;  5FJ8 G;  3Q24 A;  1BDO A;  1CA5 A;  2ZTD A;  1JJ2 A;  2F0K A;  4DKA C;  4OO1 H;  2EYJ A;  4K0K L;  3GTO B;  5CYU A;  1UUP A;  4AYB B;  1Y8P B;  2OQK A;  4P74 A;  3UDG A;  4GNX C;  1W3S A;  3TQY A;  3DEO A;  2UUA Q;  1NBW A;  3I7F A;  2IPK D;  5T1I A;  2XTI A;  2F0G A;  1EWH A;  2MPM A;  3RN2 A;  1NUC A;  4LUV A;  1C4Q A;  5GAD C;  1YJW A;  2JA8 B;  3TN2 A;  5IGD A;  3I4M B;  1VQA A;  4ZKB B;  2VQF Q;  2B2W C;  1GUW A;  4OL7 A;  2MNA A;  1E7Z A;  2JA8 G;  1DOK A;  3F2C A;  1HFN A;  3NPP A;  5EBD A;  2A6H D;  1XNR L;  2AQ2 B;  2F3W A;  5M5X H;  3A8I E;  2NZ1 D;  3DHQ A;  3KF6 B;  4ABN A;  2Y0S E;  3QR8 A;  2EDG A;  4FVM A;  1SXT A;  1ESR A;  2R93 H;  3T1Y L;  4J1M A;  1EYD A;  4DK6 C;  3A74 A;  2V1C C;  4A3I H;  1EY0 A;  1Z9F A;  3RUZ A;  4C3H B;  4JI6 L;  3R2I A;  1HR0 Q;  3TZU A;  4DA2 A;  3FHW A;  5IYD H;  1J8I A;  3T51 B;  4JI7 L;  1D5Z C;  3E3X A;  4LF7 Q;  3C1E A;  2PO4 A;  1VQN A;  1NJI C;  5GQO A;  4TQU S;  1IBM Q;  4BY1 G;  1IBK L;  4N9T A;  3DLL A;  2EXZ A;  3CC7 A;  2M00 A;  3KLS A;  4RA8 A;  4BY7 B;  2CW0 D;  4DR7 L;  5BR8 Q;  5CV5 A;  4C3I G;  4Q0F A;  2NBF A;  2H1E A;  2VXW A;  4IPG A;  4P71 A;  4DV7 Q;  4C3I B;  1VQL A;  1RHP A;  3C3L A;  1SMY D;  1U4P A;  3I4N B;  4IUU A;  1TWA H;  1A2T A;  4F87 A;  4A3D H;  3ULJ A;  2A73 B;  4YWM A;  3VR6 A;  2K4K A;  4QIW E;  1Y1V H;  2KHS A;  1FGB D;  4HMI A;  3BZK A;  4QJF A;  5KND A;  1TS4 A;  2OCE A;  4DAY A;  3MXN B;  2CQA A;  3S16 H;  1KNA A;  3HKZ E;  1X3Q A;  2F3I A;  3EIV A;  1XTC D;  2HDM A;  3NEM A;  5JEA J;  3H6M A;  1X9N A;  2Q2T A;  4JI1 L;  1YI2 A;  5C3X A;  3KDF B;  5C4H A;  1QOH A;  5BR8 L;  3E0J A;  2Q2I A;  1G91 A;  2IL8 A;  4DV5 Q;  4CDC C;  2ENB A;  1OXS C;  1GUN A;  3AFP A;  1BBW A;  3S15 H;  1STE A;  3RMH A;  2MJ8 A;  1TII D;  1HR0 W;  3S15 B;  4Y52 H;  1X32 A;  3K7A B;  3ULL A;  2MUY A;  1GHK A;  1I4G A;  2LSS A;  1RJT A;  1A3V A;  5J39 A;  1K0S A;  3MXU A;  3VA7 A;  4R1J A;  4BBR G;  4PMC A;  1ML0 D;  1VQP A;  2RQX A;  4LF6 Q;  1BNZ A;  4B3M Q;  3CCM A;  2G9H D;  3CCJ A;  2H5X A;  5C3E G;  1I6H B;  1EQV A;  2PW5 A;  1CSQ A;  3OWE B;  1CA6 A;  2FIN B;  5M3M H;  4B3R L;  4DV4 L;  3GTG H;  2CH4 A;  1HZ9 A;  3VYU A;  2Q2H A;  2GVB A;  2LY7 A;  4DR3 Q;  3M4Q A;  1UEA B;  1C8C A;  5CMD A;  4BBS B;  2IT1 A;  3M9B A;  4JI8 L;  2E2I H;  2E2D C;  5EPL A;  1A0I A;  5E1F A;  2D2C C;  4A3C G;  2KQ3 A;  3A7A B;  4L5Q A;  4HJ9 A;  3T1H Q;  1KXL A;  4K6L A;  2JN4 A;  1IKM A;  1M8A A;  2C35 B;  4OWW B;  3CMA A;  1PVO A;  5FJ8 H;  1DD2 A;  4LF6 L;  1VMP A;  1KRT A;  1K8O A;  1LT6 D;  1QVC A;  3PO3 G;  2EYH A;  3M3Y H;  1VQH A;  1I6V C;  2N8N A;  3ERO A;  1J6Q A;  2PNH A;  1HZB A;  3E5S A;  3MHB A;  4FP5 D;  4HIK A;  3Q8D A;  4DUY Q;  4OEM B;  4FXK C;  3A0J A;  1XYI A;  1DJR D;  2A69 D;  4LF9 L;  3F2D A;  2OQ0 A;  3RZD H;  1S72 A;  4OWT B;  4DR4 L;  2EYF A;  1KC8 C;  4C3J B;  1HNZ Q;  4M8A A;  2NN6 G;  3QWN A;  4C3J H;  3A8K E;  4HAE A;  3OW2 A;  4HCS A;  1CK1 A;  1HFG A;  4G57 A;  1BCP C;  4LUZ A;  2HD3 A;  1EYA A;  1N33 Q;  4KJN A;  5I9O A;  4GOP B;  5JJK A;  4RGM A;  1TS5 A;  1NR4 A;  4IOA A;  2A6H C;  2F0N A;  2R61 A;  3M4O H;  1L1O A;  1TKW B;  1QNK A;  2CFM A;  2L55 A;  2UXD Q;  5DAU A;  2L11 A;  4X62 L;  4DF7 A;  3P1H A;  1K3R A;  2E2H H;  3LGJ A;  4DUZ L;  3GTK B;  5AFW A;  4KY6 A;  3I4O A;  3T53 B;  2WIN B;  1U4M A;  3NP8 A;  4A3B H;  2VB2 X;  4L5S A;  5IYC G;  3GTQ B;  1A3U A;  1AE2 A;  1E1O A;  1U9R A;  5ELC A;  1GHJ A;  3VA5 A;  4JBM A;  3ER0 A;  1XJV A;  3J80 c;  3N52 A;  4NXM L;  5I9P A;  2UU9 Q;  4JV5 Q;  4LAA A;  1HNX Q;  1IBL L;  3D3R A;  1O7Y A;  2B2T A;  4X62 Q;  1L0W A;  2JA9 A;  5G3L D;  3OIQ A;  4L6T B;  4QUF A;  3OSO A;  1SJH D;  3MC0 B;  4APV A;  2L5T A;  3M4P A;  3PIO A;  1LM0 A;  1J5E L;  3KF8 B;  2HCI A;  3BVG A;  1EU3 A;  1KTK A;  2E2I B;  3HOV H;  3PSI A;  1B53 A;  2RF4 A;  5EKL A;  3CQZ B;  1STB A;  4DR3 L;  2BA1 A;  4FNF A;  2MFI A;  1STA A;  2EOT A;  3T4A C;  3S2D B;  3CF5 A;  1ROD A;  3SK6 A;  2YTX A;  5C4X H;  3J81 E;  3PIO 3;  4UDU C;  1V43 A;  3H15 A;  4LW1 A;  3T1H L;  5FLM H;  3SVM A;  3Q6S A;  1BF4 A;  2WAQ E;  5KYI A;  1GM5 A;  2K5H A;  1O78 A;  3KF6 A;  3PUZ A;  4R8I A;  3MTS A;  1Y1V G;  3AYH B;  4QUC A;  5ELO A;  1S5E D;  5C44 G;  2X6L A;  3QB3 A;  4L8J A;  1YHQ A;  1G6P A;  4G7Z C;  1EYC A;  2JA7 H;  1LTG D;  4O2D A;  1L0X B;  1KRS A;  4GZY C;  2CH4 W;  4DV1 Q;  3SE0 A;  5JPN C;  3TS0 A;  4GNX B;  3CCQ A;  2B8G A;  1Y14 B;  1VQ5 A;  1TS3 A;  3GTM H;  2BA0 A;  1MSH A;  5JJI A;  3KJP A;  2BDO A;  1XMQ Q;  4BY7 H;  2EIF A;  2ZM6 L;  1WI5 A;  2Z6K A;  4GLA C;  2L15 A;  4DPG A;  1A15 A;  3PV0 A;  1NNX A;  2VQE Q;  4KKS A;  4KHP L;  1MI2 A;  5J22 A;  3TP8 A;  1VQ8 A;  3AFQ A;  2I46 A;  3HGB A;  1XPU A;  2F0F A;  2HQL A;  2ZJP A;  3U9S A;  3PQI A;  3IRB A;  1E0B A;  2XN9 C;  4FXD A;  1SMX A;  2ZXP A;  4CDD C;  1TQO A;  4DR4 Q;  4A3D B;  1WTH A;  4DV2 L;  3ND8 A;  3R93 A;  4Y7N H;  5DEH A;  1PH5 A;  4C2M H;  1IL2 A;  5ELB A;  4BS9 A;  4MTK A;  1BQQ T;  3TEH B;  3K7U C;  1TU2 B;  4B08 A;  2JSO A;  3ZJY C;  3H94 A;  1PXU A;  3NEL A;  4KKU A;  1B8A A;  4K2K A;  1MJE A;  1N32 L;  3G4S A;  2A1A A;  2B39 A;  1VQC A;  2YTV A;  2F0U A;  4K5V A;  3U9O A;  3J81 i;  5GAE C;  4BBR H;  3NK9 A;  3BZD B;  2K04 A;  3MXP A;  4GKJ L;  2F4V Q;  1QE6 A;  1FVI A;  1EQT A;  3SK4 A;  1LTS D;  1CZG A;  5FLX L;  2PZU A;  2GN5 A;  1T5X D;  4GKK Q;  3W2D A;  4POG A;  4KJO A;  2B63 G;  5M5Y B;  2NTS A;  1JQY D;  3K8A A;  2NUC A;  1GOZ A;  1HJP A;  1G2T A;  1J9O A;  1TWH B;  1B70 B;  3S1Q H;  2A74 C;  2F0S A;  2K5W A;  3QJY A;  1Q46 A;  1B44 D;  1Y8O B;  4IUP A;  4UHV A;  5EBC A;  1N36 Q;  1VQ4 A;  4TVA B;  1SBB B;  2LS0 1;  2PZT A;  3UE1 A;  4A3J B;  2XGT A;  3KBX A;  1LV9 A;  1ENA A;  1HZC A;  1JCK B;  1PHJ A;  2E5L L;  1CTM A;  3QOL A;  3OTO Q;  3HOZ G;  4J6H A;  2LXK A;  1K9M C;  1IBM L;  1G2S A;  1KQS A;  1EIF A;  3RLO A;  3AQQ A;  1JR0 D;  2IY5 B;  3S9W A;  2B2Y C;  1IW7 D;  3CHB D;  1GUS A;  5FO8 B;  5C4J H;  2F0J A;  3DWP A;  1PH8 A;  4DAM A;  3K0X A;  1D5X C;  2EJG C;  4V19 0;  4A3F G;  5IIF A;  1SFO B;  3A54 A;  1F9Q A;  1LTL A;  3D8G A;  2PQA B;  5CR3 A;  5ELD A;  3CQZ H;  2A68 C;  1K8G A;  2F4I A;  3OYY A;  5LMU L;  4JI5 L;  1EWC A;  1PTO H;  1C7Y A;  5J1Z A;  4I65 A;  4NXN L;  2NN6 H;  1AP0 A;  4R8N A;  1MIU A;  4A3B G;  3R2T A;  1WOC A;  2UXB Q;  4K2L A;  4C3I H;  5IYC H;  1YNJ D;  5IOC A;  4JV5 L;  3HOU G;  1I4H A;  1I3Q B;  3ITP A;  4JI3 Q;  3G71 A;  1SE8 A;  2WB1 B;  3GO5 A;  1RF2 D;  1SNM A;  2BE5 D;  1FYC A;  5F2D A;  4JI4 Q;  4JOI C;  4X3T A;  1Y69 U;  3S1R H;  3V96 A;  3A7L A;  3UE0 A;  3K59 A;  3TP6 A;  3STB D;  3W5O A;  3TRE A;  5FLM G;  3S1M H;  3M4O B;  2MGS A;  5I4D A;  3KLS X;  3IKJ A;  1KDA A;  1ICW A;  4EQN A;  3G48 A;  4WJW A;  4YY3 Q;  3X3M A;  4ZK9 B;  2E8G A;  4WRD A;  4A4I A;  1QZH A;  2SDF A;  2F0D A;  4R4C A;  4WJ3 M;  2AUJ D;  1BBU A;  1QG7 A;  2YTY A;  2D0O A;  3QIA A;  1EY6 A;  1EZ6 A;  2R7D A;  1I4Q A;  3EBE A;  2UUA L;  2UXB L;  5EQ0 A;  1R9T H;  1LTR D;  1JMC A;  1WTX A;  4KD4 A;  2JA6 H;  5C0X I;  1CUK A;  1E1T A;  1N33 L;  3OPO A;  4A3G B;  3PUY A;  2ICI A;  2K03 A;  1SNC A;  2VY3 A;  4DAP A;  4O42 A;  1D2B A;  2F0E A;  3N6R A;  1MKH A;  4LF8 L;  4P2C B;  1IHZ A;  3I90 A;  4O1N A;  1WJJ A;  5IT9 E;  1E2W A;  4OEL B;  1WCM G;  1X3G A;  3FKI H;  4A3F H;  5EPJ A;  2X69 A;  3CCL A;  5AJ3 Q;  5KGU A;  4F8M A;  1N36 L;  2L1B A;  3K6O A;  4KKT A;  3U4Z A;  1Q12 A;  1WCM B;  5KYL A;  3MZ5 A;  1PRT B;  3J80 L;  1EOV A;  2L4N A;  3GTP H;  1DCZ A;  1VQF A;  4H44 C;  3GTJ H;  3GV6 A;  4QY7 A;  4GN5 A;  3CPF A;  4R4I A;  5IT9 c;  5T1G A;  3K57 A;  2VUM G;  3PO2 B;  1H9J A;  3F1Z A;  3RD4 A;  3NEN A;  3SEB A;  1M1K C;  1HTP A;  1KNE A;  1ZKO A;  3T16 A;  2JA5 H;  1CM9 A;  1X55 A;  3BS1 A;  4A93 H;  1N9W A;  1O7L A;  2BH8 A;  2UUB Q;  1VQM A;  5DLQ E;  3BJU A;  3S2D H;  3C2P A;  2E2J H;  2EQS A;  1TWH H;  1B3Q A;  1SE4 A;  1LO5 D;  2F0O A;  4A3M B;  3A5Z B;  3I4L A;  4R4O A;  4CKC A;  4A3E B;  4J15 A;  1XNQ L;  1M90 C;  4XDX A;  2LMC B;  1X3E A;  2EYM A;  2MQH A;  1YNN C;  4IUQ A;  2RDH A;  2R7F A;  1A8V A;  1SYB A;  1FNU A;  4K14 A;  1BBX C;  5CV8 A;  1TT2 A;  5DNF A;  1KDB A;  4AIM A;  1A6X A;  1A2U A;  4G4K A;  4ME3 A;  5C4Z A;  2OWO A;  4HIO A;  3KYH C;  4C56 C;  2O5J C;  3WDN A;  1I5F A;  4IFD H;  4J8Q A;  4H7B A;  1YJ9 A;  2HDL A;  4ZUJ A;  3IL8 A;  1GJX A;  3OHX C;  2TMP A;  1H95 A;  1UE1 A;  1WTW A;  5M3F G;  3S14 B;  1EOT A;  5HY6 A;  4A3K B;  1SRO A;  1HUN A;  4QQB X;  1Q82 C;  3D4W A;  4JBK A;  3H3V C;  4OWX B;  2QGQ A;  1VQO A;  1QIL A;  1TWA B;  2KED A;  1Q90 A;  4A3K G;  1PTO B;  2SNM A;  4KY7 A;  4IPC A;  5FOB B;  1E2V A;  1EZ8 A;  2YU9 H;  1XMO L;  5K36 H;  4RCO A;  2PCF B;  4Y7N B;  5D3D A;  4IUV A;  1VQG A;  4DNR B;  4ID6 A;  3LWE A;  5ELN A;  5BN5 A;  1NY4 A;  2R3Z A;  2A6E C;  5I6Y A;  5LL6 S;  2AQ1 B;  3HFZ B;  4FXG C;  2UXC Q;  1NTG A;  4FF4 A;  3H09 A;  1B2T A;  4PG3 A;  1VQ7 A;  1Y1V B;  2PQA A;  5DM7 3;  1C0A A;  2DJF C;  4UP8 A;  3K7A H;  5M3F H;  2A68 D;  5FO9 B;  3BVM A;  2K01 A;  5CV6 A;  5M5Y H;  1DYQ A;  4IUT A;  4EGV A;  1EL0 A;  2JE6 I;  2JA7 G;  4DNI A;  2XWJ B;  4XT1 B;  5C3E B;  2F0Q A;  4PQX A;  1AE3 A;  4X3K A;  1WTQ A;  1SE3 A;  2NVQ B;  1HCZ A;  1CHP D;  2JA8 H;  2QCP X;  1Q1B A;  3S1Q B;  4UP9 A;  1JB3 A;  5FLX c;  3HOU H;  3DXJ C;  1QVF A;  4OIK A;  4P73 A;  3BU2 A;  3KDF A;  1WD1 A;  4LUO A;  3GDE A;  2F4V L;  3P20 A;  4JC0 A;  5C4X B;  3Q22 A;  4DV6 Q;  4GOP C;  3JAM E;  3A5U A;  4DV3 Q;  1OXT A;  4FF3 A;  2N49 A;  5C44 H;  1XNR Q;  5NUC A;  2I5M X;  3RR5 A;  2B2U A;  1U4L A;  4YCU A;  2DY7 A;  4A3D G;  3FPU B;  3NBH B;  4HCE A;  3RZO H;  4DAV A;  1D6E C;  3VR2 A;  5C4J B;  3M3Y B;  3E9I A;  1TWG H;  4DR2 L;  2JYO A;  1FR3 A;  1EIY B;  1CQF A;  3KLR A;  2Z0S A;  1AFP A;  2F3V A;  3LNN A;  5IGE A;  3EJI A;  4U68 A;  2DY8 A;  5C6A A;  4BY1 B;  2DNC A;  3G6E A;  1WTO A;  1RCV D;  4IJL A;  4YCV A;  2YYZ A;  2R7Z G;  2K7V A;  2KA7 A;  4H0L C;  3L9A X;  2K52 A;  3M4Y A;  1IZ6 A;  2RKS A;  3GD7 A;  4DV4 Q;  4DR6 L;  4BWG B;  2QA4 A;  4UY8 C;  4DV0 L;  1ASY A;  2AUK A;  3CRL C;  3GP7 A;  4G7O C;  1S3O A;  5AJ3 L;  5EAY A;  4RKL A;  4X65 L;  2J0T D;  1SN8 A;  1EU4 A;  5IGB A;  4RFB A;  1B4O A;  5D65 A;  1EEI D;  2EYO A;  3KJO A;  2Z8L A;  3K80 C;  2HT1 A;  3NWS A;  1JJG A;  1NMG A;  4NXN Q;  4B9X A;  1FD7 D;  3HOY H;  2J7Z A;  2K50 A;  3MAQ A;  3SR1 A;  4DXG A;  1BOS A;  2B2U C;  4ZCK A;  4GKJ Q;  1Q86 C;  3KOJ A;  3A8J E;  2DUD A;  2QDL A;  2B2W A;  2Q2U A;  4JW0 A;  1I4X A;  4F88 A;  1SE2 A;  2EXD A;  3E6Z X;  1E2Z A;  4XQJ A;  2QW7 A;  3PCO B;  2KVM A;  3NQI A;  3DUZ A;  1BR9 A;  1XXG A;  4JVZ A;  2NTT A;  1K73 C;  1CQV A;  3L2P A;  1SNO A;  2O4X A;  1R9T B;  4IFD I;  4IO9 A;  3SK8 A;  5FLX E;  4RWS C;  4KLK A;  5EPK A;  4LF9 Q;  4DV1 L;  1KAB A;  1CKN B;  2BOS A;  2E74 C;  1XNQ Q;  4QIW B;  4A3M G;  2IHF A;  1QUQ A;  4A3E G;  3KLW A;  5FKA C;  1D1K A;  4YY3 L;  4KN7 C;  3ICE A;  4LF5 Q;  2HHH Q;  4KI0 A;  3T56 B;  3MEH A;  4GLX A;  2ZTC A;  1JE4 A;  3P7J A;  2PI2 A;  3BDC A;  4B3M L;  1PH7 A;  1GD7 A;  4DGZ A;  5C5M A;  4HMJ A;  3VYR A;  5M3M B;  4DR5 Q;  3PO3 H;  4IAL A;  3HKZ G;  5E7N A;  2NVT H;  2EJF C;  2QDB A;  2RHQ B;  4MZ9 A;  3WOF A;  3UDX A;  4DNT B;  1WTR A;  3M85 A;  4JI2 L;  3SGI A;  1I50 H;  1VDZ A;  3VR3 A;  3MA2 B;  2JA5 G;  5L37 A;  4BY7 G;  3PO2 H;  3RNU A;  4PMW A;  4DR7 Q;  2KJX A;  3FMC A;  4NW2 A;  1MHW C;  4GN3 B;  1DXM A;  3JAM i;  4DV6 L;  2SNS A;  3VDY A;  2FMM A;  2RA4 A;  1NAP A;  2ZXR A;  1V1P B;  2WKC A;  3PIP A;  4ME5 A;  1U0L A;  1WVL A;  2KCM A;  2CWP A;  5JPM C;  2B2Y A;  1B1Z A;  3OW7 A;  1MBY A;  4JPB W;  4BA1 I;  1JE5 A;  1BCP D;  5LMN W;  1JOQ A;  2RCN A;  1KAW A;  4RGO S;  1EIH A;  1FNW A;  1X3F A;  4JK1 C;  1PH4 A;  1SNQ A;  4DR2 Q;  1R4Q B;  2H4O A;  1O80 A;  2PI2 E;  2F0W A;  3J7A 5;  1ONL A;  3FRP B;  2R7Z B;  1S5D D;  2PMZ B;  2HIV A;  4CGY B;  2R93 B;  1I3Q H;  4H13 C;  1GUT A;  2O5I C;  2BH2 A;  2K5N A;  1STH A;  4A3I B;  3MVV A;  1VMC A;  1MGS A;  2OTL A;  2K75 A;  2CVR A;  2NVY B;  5CV9 A;  3D31 A;  4OIJ A;  3J81 L;  4EQO A;  1CT1 D;  1SDF A;  1TR5 A;  1HHV A;  1HA6 A;  1LTA D;  2XRQ D;  2Q8I B;  3M7G A;  2F0I A;  4RHS A;  1VF5 C;  1VS0 A;  1VQ6 A;  1PYS B;  3DWQ A;  1B3A A;  4BY1 H;  4LF7 L;  1F2Z A;  1PMR A;  3RZD B;  2UXD L;  4IPD A;  3VR4 A;  3J81 j;  1UWV A;  3BDL A;  2DNE A;  2B2T C;  2I5H A;  3JAM c;  1Q8K A;  1UNS A;  4A3G H;  2JXM B;  1YJN A;  2VUM H;  4HJ7 A;  1EFW A;  3HOV G;  4HR7 B;  3M7N A;  1I4P A;  1TWF H;  3JC6 6;  1S5F D;  1QB5 D;  2F52 A;  3KUP A;  5BN3 A;  2KOL A;  2JP1 A;  1VCI A;  3VR5 A;  1Z6H A;  1X6O A;  1I6H H;  1SNP A;  1FNV A;  2BE5 C;  1AZQ A;  3MWY W;  1T9H A;  3O13 A;  1K83 B;  1F2L A;  3CCU A;  1MJC A;  1EUJ A;  1AW7 A;  3CCR A;  1H9S B;  4NXM Q;  3NUC A;  2EZV A;  1ESF A;  3STB C;  5KRU A;  4GOP A;  3ERQ A;  3CCV A;  3RLN A;  5M5W B;  1HUM A;  1YZ6 A;  1PLF A;  5GAG C;  1IYV A;  3L7Z C;  1RTO A;  2N78 A;  1IXR A;  4B3S Q;  4XYO A;  3GTP B;  4MIU A;  2K14 A;  2JA5 B;  4IOC A;  4OXP A;  2VZA A;  1U4R A;  1O7I A;  5LMN L;  2EY5 A;  5EGT A;  2CCZ A;  5A2Q E;  3PF5 A;  4A3C H;  1DZ1 A;  5DM6 3;  3I70 A;  2IX1 A;  2OEO A;  2EYP A;  1ET9 A;  1SLJ A;  2HQE A;  4DR5 L;  4A3E H;  1HNW L;  1EWI A;  3H3V H;  4EVO A;  1YBY A;  1DOL A;  1QZG A;  3HOW B;  4A75 A;  2OF1 A;  4JI2 Q;  2I0Q A;  1TY0 A;  2F0M A;  3HOW G;  3Q0A A;  5FO7 B;  3TBI B;  1BO0 A;  1DM0 B;  1XPR A;  1CFM A;  2DJG C;  2RCF A;  3S17 B;  4FO2 A;  3I56 A;  4F7X A;  1ZYR D;  1X65 A;  5IP7 H;  3CCS A;  5JOB A;  4ODG A;  4X3S A;  2B2V A;  2WV6 D;  3S14 H;  4HIM A;  5JVH 3;  1SYD A;  2QIL A;  2MO1 A;  3E9H A;  4N9P A;  2YV5 A;  2XRS D;  5KNC A;  1LUZ A;  5IWA L;  4NKL A;  1SND A;  4AYB G;  4L63 B;  2NVX B;  4A3M H;  1IL8 A;  3HS0 C;  2WAQ B;  3MXG A;  4K5X A;  3TSS A;  2BCO A;  3HKZ B;  3HOY G;  1PZJ D;  2Q8T A;  3X3N A;  4IFD J;  2NYZ D;  1YVC A;  1EYG A;  4RG1 A;  1M4V A;  5D3I B;  3BZC A;  3HOY B;  1HPC A;  1H9S A;  4DUY L;  5C0X G;  4BBS G;  2RVL A;  1S40 A;  1G51 A;  3F2U A;  4S3S A;  4DR6 Q;  4CDE C;  4MNO A;  4MN3 A;  4DU9 A;  1HQM C;  5LL6 X;  1A62 A;  4XYQ A;  1F2Y A;  3I8Z A;  1LYL A;  4CDF C;  2F0L A;  1SYC A;  2RDG A;  3HEJ A;  4NP5 A;  4ZUI A;  5LMU Q;  1PH1 A;  2R92 H;  2KBN A;  4RHR A;  4NMZ A;  1F77 A;  1YNJ C;  4X66 Q;  1N32 Q;  2GA4 B;  4JI7 Q;  5IGG A;  2C9O A;  1KHI A;  3CRK C;  5FK9 C;  2E2H B;  4M1U B;  1JIC A;  5IGF A;  1L2F A;  3SHL A;  2IHE A;  3PO3 B;  4KMU C;  1F9R A;  1AEX A;  1SYE A;  2NVQ H;  1P8L A;  2NZH A;  4POF A;  4K5W A;  2F1M A;  5CV4 A;  1PFN A;  4X65 Q;  2CW0 C;  3GTQ H;  1KL9 A;  4K0K Q;  5M5X B;  1HA5 A;  1YHB A;  3KFU A;  1JOR A;  4JI5 Q;  3NTI A;  4LNQ A;  4DK0 A;  3H91 A;  4R4T A;  1GUO A;  3NTK A;  4PNY A;  3UDF A;  2Y0S G;  2A8V A;  4CKE A;  2X6G A;  2K32 A;  3NE5 B;  3HOZ B;  1SMY C;  2NZO A;  2AHO B;  2WFW A;  4DK3 C;  4A93 B;  2KCN A;  4ALP A;  2L12 A;  1STY A;  4RGN A;  2N88 A;  1B9N A;  4YHH Q;  1QJO A;  4HSP A;  5C3E H;  4FF1 A;  1Y8N B;  3A55 A;  3HP3 A;  3D4R A;  2OT2 A;  1G6Z A;  4ULL A;  1CHQ D;  1ASZ A;  3CXC A;  2D5D A;  2RBM A;  4MHE A;  4WFN 3;  2FJ2 A;  2FXQ A;  5COY A;  3HOV B;  1A63 A;  1JT8 A;  2F03 A;  1G8Z D;  2KUM A;  4Q5V A;  2N55 A;  1QWY A;  4BA2 I;  1D1I A;  1CKN A;  1Q8I A;  1HZA A;  4HN7 A;  1PH9 A;  1BCP B;  3NHH A;  4DN4 M;  2Z6K C;  2K6A A;  2JEA I;  2RSN A;  3J80 E;  5IP9 H;  1R4P B;  3S1R B;  1ICF B;  3H0G G;  2VNU D;  2OTJ A;  1V1P A;  4L5T A;  4OGQ C;  3TZD A;  2VQF L;  3H3V I;  3J7Z C;  2G9D A;  4WJ4 A;  1UE7 A;  3KBG A;  4OHJ A;  4HJ8 A;  2HUG A;  3S24 A;  4CKB A;  2LKV A;  2NB0 A;  4JI8 Q;  2AKW B;  2ID0 A;  4QGU A;  1RKN A;  3URY A;  1BXT A;  2IW3 A;  1KLG D;  2ZTE A;  4OON A;  4JBW A;  1Y1W H;  4DR1 Q;  2QKI C;  1BVS A;  2F0P A;  1Z47 A;  3I91 A;  3J80 i;  1TWF B;  1GXD C;  3HOX G;  2UUC Q;  4UP7 A;  1XPO A;  1K28 A;  1PTO F;  2E5L Q;  3PF4 A;  3OWF A;  2LXJ A;  1OXX K;  2LFN A;  1C48 A;  5IYD G;  3EFX D;  1TY2 A;  3DWA A;  5JEA G;  4X66 L;  1DOM A;  4NPS A;  2NVT B;  4LF8 Q;  1K83 H;  2B3G A;  4JYA L;  2HIX A;  1H9K A;  3CPW A;  1QVG A;  2D0P A;  1LTB D;  2F0T A;  4KHV A;  1N8R C;  4A3F B;  1LLR D;  3EVQ A;  1HXY D;  1HTL D;  4JCV E;  3W1G A;  2E75 C;  3TRZ A;  2A5H A;  1Z7T A;  1I50 B;  2FFK B;  5IP7 G;  1CI3 M;  3NSW A;  1IYJ B;  4EX5 A;  3GQB A;  4A3B B;  1AN8 A;  1YNN D;  1UAP A;  2RSO A;  5D14 A;  2MO0 A;  1TXY A;  1IYU A;  4BBR B;  3MFG A;  2CQO A;  5C4X G;  2WAC A;  3R3O A;  4A93 G;  1FGU A;  3EQL C;  2UUB L;  4HJA A;  1ZEQ X;  5K5P A;  2PZW A;  1B9M A;  4JG2 A;  1CKM A;  2WB1 E;  1Q81 C;  1VQI A;  1JWS D;  2PMZ E;  2IX0 A;  4B3R Q;  3C46 A;  3FP9 A;  4A3J H;  4BXX H;  4PZ8 A;  3J7Y W;  3HG9 A;  2F0V A;  2WKD A;  4RCN A;  3IAY A;  1DGS A;  3NTH A;  3GTL H;  4RGT A;  3MXN A;  3OMC A;  3D0F A;  3GTL B;  2WP8 J;  1I94 Q;  3CD6 A;  4OX9 L;  2TSS A;  1PA6 A;  2UU9 L;  3LX0 A;  4XTC S;  2O2L D;  1L0Y B;  4O0A A;  5C5L A;  1NMF A;  2P5Z X;  4QF4 A;  3AEV A;  1CSP A;  4FDB A;  1KLU D;  2Z1C A;  5BN4 A;  4TSS A;  2KHI A;  4X3U A;  2AMC B;  1J5E Q;  2B63 B;  1E3P A;  1FL0 A;  1PFS A;  3A56 A;  1B7Y B;  4A3L H;  1VQ9 A;  3B6Y A;  4JBJ A;  5C3W A;  4B3T Q;  1JC7 A;  4RAU C;  1NCV A;  4A3J G;  1SRU A;  2YU9 B;  4BXX G;  1W2B A;  1T5E A;  1YIT A;  2EE1 A;  1Q1E A;  5E4X A;  5ELF A;  4CHT B;  3ONA B;  3CU7 A;  2ATW A;  2IWH A;  5H1S E;  2QEX A;  1U5K A;  1PZK D;  1K8M A;  2QF7 A;  3PO2 G;  1H9M A;  1UEB A;  2PW7 A;  3K5L A;  1S5B D;  3I4N G;  2RDF A;  1QUQ B;  4B3S L;  3ND9 A; 
#chains in the Genus database with same CATH homology
 2KCT A;  3D31 A;  1KQS A;  1EIF A;  2ZTD A;  1JJ2 A;  3RLO A;  3AQQ A;  4DKA C;  1GO3 E;  2IY5 B;  4K0K L;  3CC4 A;  1G29 1;  2OQK A;  4DAY B;  5C4J H;  4P74 A;  1PH8 A;  3UDG A;  4DAM A;  3K0X A;  2ES2 A;  3GTO H;  4GNX C;  1W3S A;  3TQY A;  3UDI A;  4A3F G;  2UUA Q;  1VS0 A;  5IE8 A;  1VQ6 A;  1NBW A;  3I7F A;  1LTL A;  1PYS B;  3T1Y Q;  2XTI A;  2PQA B;  4GN4 B;  3TS2 A;  3CQZ H;  1K8G A;  4BY1 H;  3RN2 A;  3OYY A;  4LUV A;  5LMU L;  4JI5 L;  4LF7 L;  5GAD C;  1YJW A;  1UE6 A;  1C7Y A;  4NXN L;  2UXD L;  4IPD A;  1VQA A;  3J81 j;  1MIU A;  1UWV A;  3CAM A;  3ULP A;  1HR0 L;  2VQF Q;  4A3B G;  2I5H A;  3JAM c;  1WOC A;  1Q8K A;  2UXB Q;  5IYC H;  1E7Z A;  4C3I H;  2MNA A;  1YJN A;  2JA8 G;  2VUM H;  4HJ7 A;  3F2C A;  1EFW A;  4A3G H;  1HNW Q;  3HOV G;  4JV5 L;  3HOU G;  5J3B A;  3PUX A;  3M7N A;  1XNR L;  3F2B A;  1TWF H;  5M5X H;  4JI3 Q;  3JC6 6;  3G71 A;  1SE8 A;  3KF6 B;  3GO5 A;  1OTC A;  2Y0S E;  1VQE A;  4JI4 Q;  2F52 A;  1IBK Q;  3T1Y L;  2R93 H;  4JOI C;  4JI0 Q;  4DK6 C;  3A74 A;  3S1R H;  1D8L A;  1VCI A;  2V1C C;  3F8T A;  4A3I H;  1X6O A;  2WAQ G;  3UE0 A;  1YHA A;  1Z9F A;  1I6H H;  3STB D;  5IP9 G;  2ASB A;  4GNX A;  1T9H A;  3W5O A;  3TRE A;  5HGQ A;  2JQO A;  5FLM G;  1HR0 Q;  4JI6 L;  3S1M H;  3FHW A;  3CCU A;  1GVP A;  1MJC A;  1EUJ A;  3G48 A;  4YY3 Q;  5IYD H;  3CCR A;  4NXM Q;  4UPA A;  3STB C;  4GOP A;  4JI7 L;  2E8G A;  4EQ5 A;  4A4I A;  1QZH A;  3CCV A;  3RLN A;  4DV3 L;  1YZ6 A;  5IWA Q;  4LF7 Q;  3ERS X;  4R4C A;  5GAG C;  4WJ3 M;  3L7Z C;  1BBU A;  1NJI C;  2N78 A;  5GQO A;  2YTY A;  4TQU S;  1VQN A;  1IXR A;  1IBM Q;  2D0O A;  4B3S Q;  4BY1 G;  1IBK L;  3DLL A;  4BBS H;  2R7D A;  3CC7 A;  2K14 A;  3EBE A;  2UUA L;  3I4M H;  2UXB L;  1YIJ A;  4IOC A;  1R9T H;  4OXP A;  2VZA A;  4DR7 L;  5LMN L;  1O7I A;  3CME A;  5BR8 Q;  1JMC A;  4A3G G;  4IJH A;  2CCZ A;  2JA6 H;  1SR3 A;  4IPG A;  2R7Z H;  3PF5 A;  4P71 A;  5C0X I;  1CUK A;  4A3C H;  1E1T A;  1N33 L;  4DV7 Q;  3PUY A;  2IX1 A;  1WFQ A;  1VQL A;  2ZJQ A;  4JI0 L;  1YEZ A;  2VY3 A;  1L1O B;  3H0G H;  4YHH L;  1TWA H;  1PH2 A;  4X6A H;  1SLJ A;  3CC2 A;  4A3D H;  3ULJ A;  4C3H H;  4DR5 L;  1MKH A;  4LF8 L;  1WJJ A;  4YWM A;  4A3E H;  2K4K A;  4QIW E;  1HNW L;  1EWI A;  1Y1V H;  3H3V H;  1YBY A;  1WCM G;  1X3G A;  3FKI H;  4A3F H;  1QZG A;  4A75 A;  3CCL A;  5AJ3 Q;  3BZK A;  4QJF A;  1N36 L;  2OCE A;  1PH3 A;  4JI2 Q;  3MXN B;  3S16 H;  3U4Z A;  2I0Q A;  3HKZ E;  1Q12 A;  3MEF A;  3HOW G;  1EOV A;  2F3I A;  3S17 H;  3EIV A;  3GTP H;  3NEM A;  5JEA J;  1XPR A;  3CP0 A;  1I94 L;  1VQF A;  3GTJ H;  1X9N A;  1V9P A;  2Q2T A;  4JI1 L;  1YI2 A;  3KDF B;  4QY7 A;  3I56 A;  4GN5 A;  5BR8 L;  1X65 A;  3CPF A;  4R4I A;  5IP7 H;  2Q2I A;  5IT9 c;  4JI6 Q;  2VUM G;  3CCS A;  4DV5 Q;  3E0E A;  3F1Z A;  3S2H H;  3NEN A;  1OXS C;  1NE3 A;  1M1K C;  3AFP A;  1BBW A;  3S15 H;  4HIM A;  2JA5 H;  2JA6 G;  5IYB G;  3S14 H;  2N3S A;  1C9O A;  4H02 A;  1X55 A;  2MO1 A;  3E9H A;  4MTN A;  2YV5 A;  1N34 Q;  4A93 H;  1HR0 W;  1LUZ A;  4LF4 L;  1N9W A;  1X54 A;  2BH8 A;  3ULL A;  5IWA L;  2UUB Q;  4Y52 H;  1VQM A;  2LSS A;  4AYB G;  5DLQ E;  3BJU A;  2NN6 I;  3RN5 A;  3S2D H;  2GVA A;  2VS1 A;  4R1J A;  4BBR G;  1VQP A;  4A3M H;  2E2J H;  2EQS A;  3L0O A;  1TWH H;  4LF6 Q;  2HHH L;  4B3M Q;  3CCM A;  3A5Z B;  4R4O A;  3CCJ A;  4J15 A;  4XIG S;  2H5X A;  4B3T L;  5C3E G;  3HOY G;  1AH9 A;  1XNQ L;  1M90 C;  1XMQ L;  1GKH A;  1CSQ A;  4IFD J;  1YVC A;  1X3E A;  1EYG A;  4L5R C;  5JJK A;  5M3M H;  2MQH A;  4DV7 L;  4B3R L;  4RG1 A;  4DV4 L;  3GTG H;  3BZC A;  1HZ9 A;  4OX9 Q;  2Q2H A;  2R7F A;  1A8V A;  5C0X G;  4DUY L;  1XMO Q;  4BBS G;  4KHP Q;  2GVB A;  4LFC L;  4AIM A;  1S40 A;  4DR3 Q;  1G51 A;  3M4Q A;  4ME3 A;  2UUC L;  2OWO A;  4HIO A;  4DR6 Q;  1VQK A;  2IT1 A;  3KYH C;  3M9B A;  4MNO A;  4JI8 L;  2E2I H;  1I5F A;  1A62 A;  1A0I A;  1BKB A;  5IY0 A;  1LYL A;  4A3C G;  1YJ9 A;  5LMU Q;  1PH1 A;  2R92 H;  4L5Q A;  4HJ9 A;  3T1H Q;  1KXL A;  3HOZ H;  1H95 A;  1UE1 A;  2KBN A;  4DUZ Q;  2C35 B;  4P75 A;  5M3F G;  3CMA A;  4DV2 Q;  4OWW B;  4JOI A;  5FJ8 H;  5HY6 A;  4JYA Q;  1PVO A;  3PUV A;  1SRO A;  4LF6 L;  4X66 Q;  4QQB X;  1Q82 C;  1N32 Q;  4JBK A;  1KRT A;  4JI7 Q;  4OWX B;  2QGQ A;  1QVC A;  2VL6 A;  1VQO A;  4HID A;  1VQH A;  4A3K G;  1KHI A;  3PO3 G;  4DR1 L;  3M3Y H;  2N8N A;  4HIK A;  1J6Q A;  2PNH A;  1HZB A;  4IPC A;  1L2F A;  3Q8D A;  2IHE A;  1KD1 C;  2YU9 H;  2I5L X;  4DUY Q;  1XMO L;  1RL2 A;  3A0J A;  2NVQ H;  1P8L A;  4LF9 L;  3F2D A;  1VQG A;  2OQ0 A;  2NZH A;  3RZD H;  4POF A;  1S72 A;  4OWT B;  4DR4 L;  3PGZ A;  1KC8 C;  2DGY A;  5ELN A;  4GLV B;  2RHS B;  4X65 Q;  1HNZ Q;  2NN6 G;  1NY4 A;  4C3J H;  3GTQ H;  1KL9 A;  4K0K Q;  1FJG L;  1YHB A;  3KFU A;  3OW2 A;  4JI5 Q;  4LNQ A;  1CKO A;  1HNX L;  1IBL Q;  2UXC Q;  3HFZ B;  1L1O C;  4R4T A;  3UDF A;  1NTG A;  2Y0S G;  4B3S L;  2A8V A;  4LUZ A;  1E22 A;  4PG3 A;  2NZO A;  2AHO B;  2WFW A;  5GAH C;  4GOP B;  1VQ7 A;  2PQA A;  4DK3 C;  3EN2 A;  1N33 Q;  4OO1 I;  5LMN Q;  1C0A A;  4ALP A;  2CWA A;  4UP8 A;  3K7A H;  2B29 A;  5M3F H;  4IOA A;  3M4O H;  1L1O A;  4DV5 L;  1XTD A;  2CFM A;  5M5Y H;  4YHH Q;  2UXD Q;  4X62 L;  5C3E H;  2JE6 I;  2JA7 G;  4LFB Q;  1K3R A;  4DNI A;  2E2H H;  3LGJ A;  4DUZ L;  3HKS A;  2AWO A;  1OXV A;  3I4O A;  1AE3 A;  4JI3 L;  3CXC A;  1ASZ A;  2FXQ A;  4A3B H;  1A63 A;  4L5S A;  1JT8 A;  5IYC G;  2JA8 H;  1Q1B A;  1Q7Y C;  4UP9 A;  5FLX c;  3HOU H;  3J81 c;  1QVF A;  2WB1 G;  4GKK L;  4BA2 I;  1FJG Q;  3I4M G;  4P73 A;  4LFA Q;  1AE2 A;  1E1O A;  3BU2 A;  1CKN A;  3KDF A;  3I4N H;  3K81 C;  1PYB A;  4LUO A;  3GDE A;  1HZA A;  2F4V L;  4JC0 A;  1PH9 A;  4JI4 L;  4JBM A;  3ER0 A;  4DV6 Q;  1XJV A;  2D62 A;  3J80 c;  1EQR A;  2Z6K C;  2NVX H;  4NXM L;  4GOP C;  4LWC A;  4DV0 Q;  2UU9 Q;  2JEA I;  4JV5 Q;  3A5U A;  4DV3 Q;  5IP9 H;  1OXT A;  2N49 A;  5C44 H;  1XNR Q;  1HNX Q;  2I5M X;  1IBL L;  3H0G G;  3RR5 A;  2VNU D;  4X62 Q;  2OTJ A;  1L0W A;  4L5T A;  2JA9 A;  4YCU A;  4A3D G;  4APV A;  3NBH B;  2VQF L;  3H3V I;  3RLF A;  3J7Z C;  4YWK A;  3M4P A;  3PIO A;  4WJ4 A;  3RZO H;  3U50 C;  3GTK H;  1WCM H;  1UE7 A;  1LM0 A;  3FKI G;  2K5V A;  3E9I A;  4HJ8 A;  1TWG H;  3S24 A;  4DR2 L;  1J5E L;  1OXU A;  3KF8 B;  1X56 A;  4X64 Q;  1EIY B;  1V1Q A;  3CW2 C;  3PUW A;  4JI8 Q;  2AKW B;  2ID0 A;  2Z0S A;  3HOV H;  4QGU A;  3PSI A;  2RF4 A;  1WYD A;  2ZTE A;  4DR3 L;  4OON A;  4JBW A;  3G6E A;  4DR1 Q;  4AQY L;  1Y1W H;  2BA1 A;  1BVS A;  2MFI A;  4IJL A;  4YCV A;  1Z47 A;  2YYZ A;  2R7Z G;  4HJ5 A;  4GS3 A;  3J80 i;  4QL5 A;  2K52 A;  3HOX G;  3GD7 A;  1IZ6 A;  3CF5 A;  4DV4 Q;  2UUC Q;  4DR6 L;  4UP7 A;  5C4X H;  2YTX A;  2QA4 A;  1XPO A;  4UY8 C;  4DV0 L;  4A3I G;  1ASY A;  2E5L Q;  1V43 A;  3H15 A;  3PF4 A;  4LW1 A;  3T1H L;  1S3O A;  5FLM H;  5AJ3 L;  5EAY A;  1E24 A;  2LXJ A;  2WAQ E;  1OXX K;  4X65 L;  1GM5 A;  2K5H A;  3KF6 A;  1SN8 A;  3PUZ A;  2ZM6 Q;  1HNZ L;  5IYD G;  1Y1V G;  3AYH B;  5ELO A;  5JEA G;  4X66 L;  4NPS A;  5C44 G;  4LF5 L;  2A19 A;  2AWN A;  4LF8 Q;  1K83 H;  1YHQ A;  1G6P A;  2B3G A;  4JYA L;  3KJO A;  2HIX A;  2JA7 H;  3CPW A;  2HT1 A;  3K80 C;  4O2D A;  2KHJ A;  5C0X J;  1KRS A;  1NMG A;  2D0P A;  1QVG A;  1JJG A;  1N8R C;  4NXN Q;  2ZJR A;  4DV1 Q;  3TS0 A;  3HOW H;  4LFC Q;  4A3L G;  4GNX B;  3HOY H;  3CCQ A;  2K50 A;  1Y14 B;  4GKJ Q;  1Q86 C;  1VQ5 A;  3KOJ A;  2DUD A;  4JCV E;  3W1G A;  3GTM H;  3TRZ A;  2BA0 A;  3U4V A;  2Q2U A;  5JJI A;  1N34 L;  2EXD A;  4P72 A;  5IP7 G;  3KJP A;  1XMQ Q;  4AQY Q;  1IYJ B;  3PCO B;  4BY7 H;  4EX5 A;  2EIF A;  2ZM6 L;  1WI5 A;  2CKZ B;  2Z6K A;  4GLA C;  1K73 C;  3L2P A;  4YWL A;  5IYB H;  2L15 A;  4DPG A;  4PZ6 A;  3PV0 A;  2VQE Q;  2MO0 A;  4IFD I;  1TXY A;  2R6G A;  4IO9 A;  4KHP L;  4KLK A;  4LF9 Q;  4DV1 L;  2CQO A;  5C4X G;  3I55 A;  1VQ8 A;  4A93 G;  3DM3 A;  1CKN B;  1JJC B;  3AFQ A;  1FGU A;  1XNQ Q;  2UUB L;  1XPU A;  4HJA A;  1UE5 A;  4A3M G;  2HQL A;  2IHF A;  1QUQ A;  2ZJP A;  4A3E G;  2R92 G;  3KLW A;  4IPH A;  3ICE A;  4YY3 L;  4LF5 Q;  2B63 H;  1SFO H;  4KI0 A;  2HHH Q;  3IRB A;  1TWC H;  4GLX A;  1PH6 A;  2ZTC A;  4JG2 A;  1CKM A;  1SMX A;  2PI2 A;  2KEN A;  2WB1 E;  4YCW A;  1Q81 C;  1PH7 A;  1GD7 A;  4B3M L;  1VQI A;  4KHZ A;  1YNX A;  2PMZ E;  5JJL A;  1JB7 A;  2IX0 A;  4DR5 Q;  3PO3 H;  4DR4 Q;  4B3R Q;  4A76 A;  4DV2 L;  3HKZ G;  2VW9 A;  1VQJ A;  3FP9 A;  5E7N A;  2NVT H;  4A3J H;  4BXX H;  2RHQ B;  4Y7N H;  1PH5 A;  4C2M H;  4MZ9 A;  4PZ8 A;  1IL2 A;  5M3M G;  3W1B A;  3TEH B;  3UDX A;  3OTO L;  1DGS A;  5K36 G;  3M85 A;  3K7U C;  4JI2 L;  3SGI A;  3GTL H;  4PZ7 A;  1I50 H;  2ALY B;  3ZJY C;  3D0F A;  1Y1W G;  3NEL A;  2JA5 G;  1B8A A;  4IFD G;  2WP8 J;  4BY7 G;  1I94 Q;  3CD6 A;  3PO2 H;  4OX9 L;  1RIP A;  1VQB A;  5GRO A;  1MJE A;  1N32 L;  3RNU A;  3G4S A;  1PA6 A;  2A1A A;  4PMW A;  2UU9 L;  1VQC A;  1K0R A;  2YTV A;  3HOX H;  2NVY H;  1VQD A;  1P16 A;  4DR7 Q;  3J81 i;  5GAE C;  4GN3 B;  4XTC S;  3JAM i;  2JK8 A;  4BBR H;  4DV6 L;  3VDY A;  4O0A A;  4GKJ L;  1NMF A;  4AYB E;  4OO1 G;  4RMF A;  2F4V Q;  1FVI A;  3PIP A;  3AEV A;  4LFB L;  2GN5 A;  1CSP A;  4GKK Q;  1U0L A;  4FDB A;  4POG A;  2B63 G;  2JEB I;  2KCM A;  4A3K H;  2CWP A;  3S1N H;  2KHI A;  5M5W H;  2AMC B;  3K8A A;  4BA1 I;  4X64 L;  1JE5 A;  1K8A C;  1PV4 A;  1J5E Q;  1HJP A;  5LMN W;  1EQQ A;  1E3P A;  1FL0 A;  1PFS A;  2RCN A;  1B7Y B;  1B70 B;  2VQE L;  1KAW A;  4A3L H;  1VQ9 A;  3B6Y A;  4JBJ A;  3S1Q H;  1X3F A;  4B3T Q;  4A3J G;  1SRU A;  3WWV A;  1PH4 A;  1Q46 A;  4BXX G;  2UXC L;  4DR2 Q;  3U58 A;  1W2B A;  4R4Q A;  4AH6 A;  1N36 Q;  4LFA L;  4NB3 A;  1VQ4 A;  1YIT A;  1D7Q A;  4TVA B;  2PI2 E;  3J7A 5;  1Q1E A;  2JJQ A;  3UE1 A;  3CCE A;  2HIV A;  1I3Q H;  2XGT A;  2ATW A;  1HZC A;  5H1S E;  2QEX A;  1U5K A;  1HH2 P;  4LF4 Q;  2K5N A;  1PHJ A;  2E5L L;  2BH2 A;  4JI1 Q;  3PO2 G;  1UEB A;  3OTO Q;  3HOZ G;  1KIX A;  3I2Z A;  2OTL A;  2LXK A;  2R93 G;  2K75 A;  1K9M C;  3I4N G;  1QUQ B;  5FJ8 G;  1IBM L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...