5E7NA

Crystal structure of rpa70n in complex with vu0085636
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Identification and Optimization of Anthranilic Acid Based Inhibitors of Replication Protein A.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5e7nA00
1U0LA 4JI4L 1EUJA 1U5KA 5IWAL 4A4IA 3KLWA 3I56A 4DR3L 4AQYQ 5E7NA 1IBLQ 4GKKQ 1NY4A 2YTYA 2F4VL 1CSPA 2K14A 1AH9A 4A3LG 1X3EA 3M85A 1X6OA 2WP8J 5GQOA 1L0WA 5JEAG 1Q86C 3TRZA 4A3CG 3S14H 2F3IA 4A93H 4LF9L 1VQCA 4LF7Q 1I6HH 3KFUA 4AIMA 5LMNQ 4ALPA 4LFAL 3I4MG 4JYAL 3H15A 2JEAI 3PO2G 2QGQA 1N9WA 2WB1E 3I4OA 3W1GA 2QA4A 4GNXC 4DR5L 4RG1A 4A3EG 2R92G 4BXXH 1Q1BA 4LWCA 4JI2L 3RNUA 3RN2A 1C9OA 1K0RA 3NEMA 4A3JH 1X55A 4HIMA 3CCQA 5BR8L 2WB1G 1P8LA 4APVA 4QQBX 4LFBL 2ALYB 3PUVA 5C4XH 2UXBQ 5LMUQ 3T1HQ 1JJ2A 1MKHA 2Z6KC 2F52A 1E7ZA 1VQBA 4X66Q 1UE5A 3K0XA 4JCVE 1HZAA 4JI8L 3GTGH 1BKBA 4GNXB 1PV4A 2UUAL 2PNHA 4X65L 4B3RQ 1HNWL 1GVPA 3J81i 1WCMH 2BA1A 3A5ZB 4L5QA 1HZCA 3PO3G 2B63H 3CCUA 1IXRA 3H0GH 1VQ4A 1VQLA 3GD7A 1XMOL 2XTIA 4FDBA 4A3DG 1SROA 5M3FG 3NBHB 2ES2A 1HR0Q 1XNRQ 3BJUA 1Q46A 3HOUH 4MZ9A 3CQZH 1N34Q 4HIDA 3S1NH 1N33L 4IOCA 1K9MC 4JBKA 1FJGL 3BZCA 4JI5Q 3HOXG 3VDYA 4JI7L 1SN8A 4PZ8A 4DV5L 4GKJL 3CCRA 4OWXB 2UUBL 3J81j 2NN6G 4DNIA 5M5XH 1HZBA 2YYZA 2YU9H 4DV3Q 3S2HH 4DV1L 1KIXA 4B3MQ 1MJCA 3E9HA 2YTXA 5IY0A 3D31A 3HKSA 3PIOA 1X65A 4GNXA 4BA2I 3WWVA 4GOPC 4A3LH 4DR7L 4UPAA 1I94Q 4LUOA 4P74A 4P72A 1PH3A 4PZ6A 2JK8A 2FXQA 2MFIA 3TEHB 4IOAA 5ELNA 3ZJYC 5IYBG 2VNUD 1KXLA 1IBMQ 3I4MH 2DGYA 4NXNL 1CSQA 2K5VA 2K5HA 3PO2H 4X62Q 3S17H 4YHHQ 2Z6KA 4A75A 1K3RA 3PSIA 1Z9FA 4A3KG 2R92H 2XGTA 4PG3A 1EFWA 1IBLL 3RZOH 4BXXG 3PGZA 4B3TQ 4GKKL 5C44H 1VS0A 4GS3A 4LF6Q 4DPGA 2ZTDA 4DV6Q 4QIWE 5IE8A 4TVAB 1PH6A 4R4TA 1CUKA 2BH2A 3GTQH 1Y1VG 3PCOB 1SE8A 1CKOA 4IPCA 2NZHA 3CP0A 4DV2Q 3U58A 2OWOA 1SMXA 1YHBA 2UXDQ 3CCEA 4ME3A 4YWKA 1CKMA 5LMNL 1Q12A 1A62A 1E22A 5M5WH 4LNQA 3GTOH 3M3YH 3TREA 1YBYA 3RLOA 5GAEC 3L7ZC 2PQAB 5HGQA 1Q1EA 1KAWA 1NE3A 2A8VA 2ZM6L 3RLFA 3UDXA 3KOJA 1NMGA 5K36G 2QEXA 3A0JA 3CCVA 4LFCL 3CPWA 2B63G 4HJAA 4UP7A 3H0GG 1BBWA 3KDFB 5M3FH 1VQAA 2OQKA 1PH2A 4Y52H 1Z47A 3ERSX 1N36Q 4OX9Q 4BY7H 4B3SL 4X66L 1JMCA 4GOPA 1RL2A 1XTDA 2YV5A 1S72A 2GVBA 4YCWA 2F4VQ 4YY3Q 3TS0A 3CPFA 2JA7H 4NXML 1KHIA 1PFSA 2VUMG 4GN4B 2VL6A 1IZ6A 4JI1L 1N32Q 1I5FA 1O7IA 1W3SA 2JA5G 1GO3E 2PMZE 5LMNW 2Z0SA 4LUVA 4H02A 1FGUA 3ER0A 5AJ3Q 2PQAA 1C7YA 4P71A 4L5SA 4JV5L 1XNRL 4P73A 4DK6C 5FLXc 2HHHQ 1G291 5IP9G 4DV0Q 1QVCA 2CQOA 3I2ZA 1N34L 2BH8A 4JI3Q 3AQQA 5IYBH 1MJEA 1JJGA 2JQOA 1NJIC 2AWNA 3KDFA 1L2FA 4LF5Q 4XTCS 3U4ZA 5FJ8G 2WFWA 2UUCQ 4A3KH 4DV7Q 4DR6Q 5JJIA 3CD6A 2K5NA 3GO5A 1AE3A 5GADC 3L2PA 3FHWA 2VW9A 2E2IH 2VQEQ 2VQFL 4BY1H 1VQJA 5C44G 3CF5A 1VQGA 2HIVA 2VS1A 2IHFA 1I94L 3KF6B 1SR3A 1Y1VH 1VQKA 1VQDA 4O0AA 4BBRG 1JB7A 1EIFA 3GTJH 4HIOA 3RLNA 3KYHC 1S3OA 4OXPA 3OTOQ 1LUZA 2H5XA 3T1YL 3FP9A 2ZJRA 1PHJA 1M90C 3PUWA 4X62L 3AEVA 1XPRA 3H3VH 4K0KQ 1HR0W 1J5EQ 1FL0A 4UY8C 3S16H 1OXUA 2NN6I 4A3FG 3S2DH 2KHJA 3W5OA 4GN5A 3G71A 2PI2A 4JI6Q 3RR5A 4LF6L 4DV6L 1WYDA 1QVFA 1YJNA 5C3EG 1X3FA 2IX0A 2KCTA 2IHEA 1VQOA 4JI0Q 1E24A 2YTVA 3J80c 3CMEA 4XIGS 3I4NH 4DV2L 2MO1A 2ZTEA 4IFDG 3EIVA 4IPHA 2UXCQ 5C0XG 1Q8KA 3UDFA 1BVSA 2VUMH 4BY7G 1EQRA 4A3BG 4DKAC 3M4PA 1T9HA 1HNXQ 1X56A 5GAGC 4YCVA 3KF6A 1K83H 4JC0A 4OONA 3K7UC 4DR2Q 2AHOB 5GROA 3CW2C 2JA7G 3L0OA 2B3GA 3F2CA 1GM5A 1HNZQ 2JA6H 4QGUA 2JA5H 3W1BA 2R7ZH 1KRSA 3HOVH 4DR4Q 1OXVA 4LF8L 3AFQA 1Q81C 1UWVA 4LF4L 3CXCA 1S40A 4PZ7A 1SFOH 4Y7NH 4JI4Q 4POFA 3HKZG 1E1TA 3G48A 1PYSB 5DLQE 4DR3Q 2ID0A 4A3IG 4OX9L 5IP9H 3CAMA 2GN5A 1IBKQ 2R93G 3M7NA 3JAMi 1VQIA 4J15A 3HOZH 2E8GA 4GN3B 1AE2A 1N32L 4GLAC 2HIXA 5FJ8H 4X64L 4PMWA 4LFAQ 4MTNA 4JYAQ 2LXJA 4HJ8A 4AQYL 2JA8H 3BU2A 1PH5A 1KL9A 4NB3A 1XPUA 1FVIA 3FKIG 1BBUA 1JE5A 4BY1G 3PIPA 3CCMA 4DR5Q 2DUDA 2HHHL 1A0IA 4JI2Q 4GOPB 4IPGA 3UDIA 4BBRH 1HZ9A 1EYGA 3F8TA 4TQUS 2NVQH 3D0FA 1YIJA 1YHAA 2CWAA 3PF5A 4LF7L 4DUZQ 3PO3H 4LFBQ 4GLVB 1PH8A 2EQSA 3KJOA 3RZDH 1VQ7A 1TXYA 5JJKA 4OWTB 1PA6A 5IYDG 1K8GA 1K73C 4DV7L 4KLKA 4DR6L 1X3GA 3J81c 4A3FH 4C3JH 2CWPA 4MNOA 2Q2TA 1SLJA 2Q2HA 2VQEL 4L5RC 4JI8Q 4JOIC 3S24A 1LYLA 1TWGH 5IP7G 5C3EH 1WJJA 1A63A 2UUAQ 1HNWQ 1VQEA 4X65Q 4YCUA 1Q7YC 1I50H 4JBMA 3I4NG 2K4KA 3ULJA 1VQMA 2R6GA 2UXBL 2Y0SE 3OTOL 5LMUL 3T1HL 1KQSA 1XMOQ 3K80C 5H1SE 4A3BH 4JG2A 1XPOA 1B70B 2NVYH 2A19A 3K8AA 4JI6L 4NPSA 4OO1G 2OTJA 1PH4A 4B3RL 1D7QA 1PH1A 2Y0SG 2Q2UA 1KRTA 2JA6G 1N33Q 3M4OH 2D0PA 4IJHA 1FJGQ 1B7YB 3AYHB 3HOVG 2K75A 4L5TA 2WAQG 2R7ZG 4JBWA 1H95A 1VQ8A 1E1OA 5JEAJ 4C3HH 4DV5Q 2AWOA 4A3MG 3E9IA 1IL2A 4GKJQ 2UUBQ 1UE1A 1XMQQ 2D62A 2CCZA 1HR0L 4A3IH 1VQFA 2VY3A 4KHZA 3HOWG 4RMFA 2VZAA 4DUYQ 2R93H 2MNAA 4R4QA 1W2BA 1Y14B 5FLMG 1RIPA 2RCNA 4JI5L 2JJQA 3HOZG 2E2HH 1WI5A 3EBEA 4P75A 2IX1A 4DR4L 1G51A 3TQYA 1QZHA 4UP9A 2HT1A 4HJ7A 1N8RC 1Y1WG 4NXNQ 3CC4A 2JA8G 2D0OA 4DR1Q 4YWMA 4DV3L 3IRBA 4B3ML 3OW2A 2N78A 4A3GG 3FKIH 2PI2E 4IFDI 3CCLA 2A1AA 4IO9A 1VQHA 1A8VA 5C0XI 1UEBA 4JOIA 5C4JH 1IBKL 4JBJA 2E2JH 5JJLA 3CC2A 1DGSA 4EX5A 1P16A 2LXKA 2KBNA 5M3MG 1IBML 1NBWA 4R4CA 2E5LQ 3B6YA 4AH6A 4QJFA 2AKWB 3A74A 3PV0A 5IYDH 2AMCB 4YHHL 4K0KL 3GDEA 3NELA 4A76A 1QUQB 2CFMA 2I5MX 3DLLA 2OCEA 4B3TL 2EIFA 4DK3C 3ULPA 3STBD 4GLXA 3S15H 4IFDJ 4QY7A 5IP7H 4AYBE 2C35B 2IT1A 5C0XJ 3RN5A 2UU9Q 2ZM6Q 4BBSH 1PH9A 1UE7A 1EOVA 3F1ZA 2JEBI 5IT9c 4EQ5A 1VQ6A 1UE6A 3LGJA 3E0EA 3G4SA 1VCIA 2UXDL 4POGA 4DUZL 4LFCQ 1XNQQ 1M1KC 3U50C 4AYBG 3PUYA 3S1QH 3F2DA 1OTCA 1SRUA 1YJ9A 4KHPQ 2LSSA 4OWWB 5HY6A 2MO0A 4B3SQ 2KENA 1YNXA 3SGIA 1GD7A 5GAHC 3CCSA 3HKZE 4DV4Q 4X6AH 1LM0A 3GTKH 1VQ9A 3TS2A 5ELOA 4NXMQ 2JA9A 3Q8DA 3K81C 1TWAH 4JI1Q 4A3MH 1TWHH 1JT8A 1LTLA 1E3PA 2B29A 1QUQA 3UDGA 3OYYA 4R1JA 2I0QA 2N3SA 5IWAQ 3HOWH 1N36L 4O2DA 4DAMA 4JV5Q 2I5LX 1V43A 1L1OC 2KCMA 3BZKA 3M4QA 3H3VI 5FLMH 3S1RH 5IYCG 4R4IA 2ZJQA 2ATWA 2I5HA 4YY3L 1Q82C 1TWFH 1X54A 1ASYA 2K52A 4QL5A 3HOYG 2RHSB 1YJWA 4LF9Q 3AFPA 4C3IH 1Y1WH 4HJ5A 1QZGA 1VQPA 3CMAA 1V1QA 3CC7A 1YI2A 5AJ3L 1YITA 3DM3A 2JE6I 3PF4A 5EAYA 3UE0A 1XMQL 4A3GH 1EIYB 2OQ0A 4HJ9A 4DV0L 1EWIA 2VQFQ 4DUYL 2NZOA 1YVCA 1L1OB 1XJVA 4JI3L 4C2MH 3CCJA 2R7DA 1CKNB 3J7ZC 1X9NA 1VQ5A 5M3MH 2K50A 5BR8Q 1WOCA 1R9TH 2ZJPA 1NMFA 4A3CH 3A5UA 4OO1I 2KHIA 2RHQB 1HJPA 2L15A 4A93G 4LF5L 1YZ6A 2UUCL 3T1YQ 1EQQA 3J7A5 2V1CC 3ULLA 4DR1L 1WFQA 4LW1A 2Q2IA 4A3EH 1YEZA 1IYJB 2RF4A 4IPDA 4BBSG 1OXTA 1OXXK 1OXSC 4BA1I 1KC8C 4IJLA 2ZTCA 3UE1A 4A3JG 2NVTH 3ICEA 3F2BA 5M5YH 1QVGA 3U4VA 2E5LL 3STBC 3S1MH 5C4XG 1JJCB 2WAQE 1J5EL 3M9BA 3I7FA 1NTGA 1MIUA 1G6PA 1B8AA 1L1OA 1ASZA 1VQNA 2R7FA 1CKNA 3K7AH 2ASBA 3NENA 1PYBA 2UU9L 4JI0L 3G6EA 2N8NA 2MQHA 4LUZA 4JI7Q 1PH7A 1C0AA 1YHQA 3PUXA 4WJ4A 4R4OA 1WCMG 4YWLA 3KJPA 2EXDA 2GVAA 4LF8Q 1XNQL 1KD1C 3KF8B 3PUZA 4LF4Q 1TWCH 3MXNB 2UXCL 1HH2P 4A3DH 3GTLH 3JAMc 3MEFA 2N49A 3J80i 4DV1Q 4KHPL 5J3BA 1HNXL 3GTPH 2CKZB 4WJ3M 4DAYB 2HQLA 1GKHA 5IYCH 4DR7Q 4HIKA 4DR2L 3I55A 3JC66 3HOUG 4DV4L 1HNZL 4KI0A 1PVOA 1J6QA 3HOYH 3EN2A 1V9PA 2OTLA 4UP8A 1K8AC 3HOXH 2IY5B 1D8LA 3HFZB 3GTMH 2NVXH 4X64Q 1I3QH 2BA0A
chains in the Genus database with same CATH superfamily
1U0LA 1STAA 1WD1A 3TP5A 2RSNA 1D1KA 5E7NA 1NY4A 2P5ZX 1QG7A 4QUFA 1ESFA 3M85A 2WP8J 5GQOA 1Q86C 2K01A 3TRZA 1NCVA 4A93H 1A3VA 1I6HH 5LMNQ 2F0MA 3I4MG 2QGQA 1EZ8A 5C5LA 5CC4A 5LL6S 5ELEA 3RNUA 1IYUA 4NW2A 1K0RA 4A3JH 4L8JA 3OPOA 5BR8L 2BOSA 4IALA 4QQBX 2ALYB 4FXGC 1TQOA 5HURA 1B50A 1G6ZA 1PTOH 3CHBD 1MKHA 2L1BA 2Z6KC 2EE1A 2BE5C 4X66Q 3HOXB 1PV4A 2UUAL 2QDLA 4B3RQ 3MFGA 1U4PA 2BA1A 2F0QA 3DMUA 1ZYRD 1KNAA 1A2TA 1RJTA 3GD7A 1XMOL 4FDBA 1BXTA 1HXYD 4LK1C 1NR2A 5D14A 1HR0Q 1Q46A 2FMMA 3CQZH 3S1NH 4HIDA 2MUYA 1JWMD 1PMRA 1N33L 1FJGL 4JBKA 2RDGA 1I6HB 4JI5Q 3HOXG 3VDYA 3J7AV 5T1GA 1SN8A 3RUZA 1CA5A 1LT5D 2WV6D 3CCRA 4OWXB 1AZQA 5M5XH 4JPBW 5DM63 3BVMA 1MJCA 3E9HA 2YTXA 5JJZA 3D4DA 2KOLA 5JAVA 1RDPD 3CKIB 4B9WA 5IYBG 5ISRA 4I7AA 4X62Q 1ILPA 2SDFA 4CHTB 4K0KQ 2MP1A 2Z6KA 3ONAB 4A75A 1EWCA 1EFWA 1QWYA 1SSOA 1JWSD 3PGZA 4IN3A 3R8BA 4F88A 3MWYW 4GS3A 4G7HC 4LF6Q 4DPGA 2ZTDA 4CDEC 4QIWE 5IE8A 1CUKA 3GTQH 1ZKOA 3PCOB 1SE8A 1I4RA 3E0JA 3CP0A 5KEEA 1SMXA 1YHBA 4CJ2C 5M5WH 1PDQA 4LNQA 4KKUA 3RLOA 1K83B 1EU3A 3Q23A 3DWAA 5KNDA 4DNRB 2ZM6L 2JA5B 3UDXA 5J22A 2NYZD 5T1IA 5FK9C 5K36G 5M5XB 3A0JA 3CCVA 4LFCL 1SFOB 2JN4A 1MSHA 3KDFB 3A54A 5M3FH 1LABA 1EQVA 3K6OA 3TP7A 1N36Q 4BY7H 4B3SL 4KKSA 4CDDC 5IGBA 1BCPD 2KCCA 1STYA 4J6HA 1RL2A 1KDAA 2YV5A 4YCWA 4YY3Q 2JA7H 4NXML 5CGKA 4GN4B 2VL6A 2O4XA 2JA5G 3IFDA 2EYPA 4FF3A 2PQAA 2K5DA 5EPLA 3TBIB 4ABNA 1XNRL 1VF7A 3GTQB 1G291 2PNRC 3PO3B 4MHEA 5M5WB 3E5SA 1NJIC 2AWNA 2PO4A 4DU9A 5FJ8G 1FD7D 1S5ED 5C3XA 2WFWA 5ELCA 4A3FB 4DV7Q 3HP3A 2UUCQ 2K5NA 1AE3A 3J81L 2KUMA 5C3EB 1CFMA 3DWPA 2IHFA 4KJOA 1JB7A 3PO3G 4BY7B 1LUZA 4ZAIA 4A3BB 1M90C 3E6ZX 4OHJA 4OIJA 3VA5A 3S16H 2JA7B 4A3FG 3S2DH 3W5OA 4GN5A 3D8GA 3MFYA 4M8AA 1YJNA 3VR3A 5C3EG 2IX0A 2F0KA 2MO1A 2L0CA 4IFDG 5BN3A 2UXCQ 4RCOA 5C0XG 3UDFA 4BY7G 4A3BG 4DKAC 1D2BA 1T9HA 1K3BC 2EYHA 2E2HB 1LT4D 2K05A 2K03A 4CDCC 3K5MA 2JA7G 2JSOA 2VUMH 4DFAA 1GUNA 2R7ZH 3W1BA 2RA4A 3K5LA 1SE2A 3NQIA 1OXVA 3L9AX 1GJXA 1Q81C 3CXCA 3VYUA 4KD3A 4JK1C 4DAVA 1RHPA 1SMYC 5C4JB 4KK7A 4N8FA 5IP9H 3M7NA 3HRZC 1VQIA 1BNZA 4H0LC 4ZQ3A 4GN3B 1N32L 2SEBD 4OIKA 1EYDA 4MTNA 1JOKA 2LXJA 2JA8H 1AN8A 1PH5A 1BCPB 1XPUA 2DUDA 4CDFC 4ZKBB 1QILA 1EYGA 1HZ9A 3F8TA 4TQUS 5IT9L 1JC7A 4KMUC 4LF7L 1H9SB 3S1QB 3IFTA 3DHQA 2CH4A 4GLVB 1TXYA 1K73C 3J81c 4ILWA 2VQEL 2K33A 2R7ZB 1G2TA 1A63A 2UUAQ 2JXMB 2SOBA 4A3MB 4YCUA 3HOWB 4R8NA 3T1HL 4H44C 1XMOQ 1LTGD 1RODA 3PQIA 3K80C 5H1SE 1HA6A 4JG2A 3J7AF 1JCKB 1E2WA 4NPSA 1LTRD 3BYYB 1N33Q 2D0PA 1Y1WB 1FJGQ 2R7ZG 1GHKA 3LWEA 2JA8B 2PW5A 3OSOA 1VQ8A 5JEAJ 4A3MG 4C3HH 3G6JB 1S5DD 1UE1A 1XMQQ 4A3IH 1VQFA 1STGA 3HOWG 1LO5D 4DUYQ 4IUPA 5M3MB 4PNYA 2RCNA 3KBXA 4PQXA 2JJQA 2ZT9C 3IKJA 4RGNA 1AW7A 4XT1B 4HJ7A 1Y1WG 5E4XA 3CC4A 2JA8G 4K2KA 4YWMA 3OW2A 1SYGA 2PI2E 4FVMA 2A1AA 2F4IA 1A8VA 1IBKL 4I7ZC 4JBJA 2E2JH 2A68D 3CC2A 4HMIA 1P16A 4C56C 1AZPA 5M3MG 1IBML 3OMGA 3MXNA 3A74A 2MGSA 3NSWA 3V2TA 3D6WA 2I5MX 2QW7A 3ULPA 3S15H 5COYA 2L12A 4AYBE 1LTBD 4BBSH 2ZM6Q 1EOVA 3F1ZA 2JEBI 4LMQD 5IT9c 2Z9HA 3E0EA 3KLSX 2UXDL 4POGA 4LFCQ 1DONA 1FGBD 3A8IE 3PUYA 3Q24A 3F2DA 4OWWB 5HY6A 1DYQA 2Z8LA 4K8JA 4B3SQ 1EIGA 2KENA 3SGIA 1GD7A 5CMDA 3HKZE 4X6AH 1LTID 1LM0A 3TS2A 1CK1A 2A74C 4NXMQ 2JA9A 1MGSA 1TWAH 1SNCA 2X6GA 4HTHA 2NTSA 5IWAQ 3AB9A 4RHRA 3HZXA 3MHBA 4NP5A 4DAMA 2EYOA 1EY6A 3BZKA 5EBCA 3M4QA 1WTXA 4L6TB 4LAAA 2HCIA 3H3VI 5FLMH 1CHQD 2ATWA 4R4IA 2F0TA 2EDGA 2XN9C 3K58A 4MTKA 2K52A 1PTOF 1U9RA 1YJWA 4C3IH 3CMAA 1V1QA 1CHPD 1V8QA 1YITA 3C2PA 3DM3A 2JE6I 1SNQA 1EIYB 1F2MA 4BBSB 4HJ9A 4X3KA 4DV0L 1XWEA 1BR9A 1II3A 1CKNB 1X9NA 4A3CH 1SAPA 1XTCD 2K50A 4RFBA 1R9TH 1NMFA 4OO1I 4IZ8A 1EFID 4RGMA 1F9RA 1TKWB 4DR1L 4LW1A 2CH4W 1E2VA 3C46A 2RF4A 3EA6A 1TWAB 1WCMB 3NE5B 2LMCB 4KHVA 5G3LF 4BBSG 3P1HA 1OXSC 4IJLA 2ZTCA 1D5XC 1QVGA 4RHSA 1JJCB 1O80A 3HS0C 5ELBA 3D4RA 1G6PA 1ASZA 2O5IC 1SYEA 2J7ZA 4C3IB 2X69A 4JI0L 5BN4A 5IGEA 4JI7Q 1PH7A 3PUXA 1WCMG 3KJPA 1ONLA 3I4LA 2R3ZA 1XNQL 1KD1C 3A7AB 3S2HB 1TWCH 1HH2P 1SE4A 3J80i 5J3BA 2G9DA 4DR2L 5NUCA 1HNZL 3EN2A 2OTLA 1SEBD 4C3IG 3GTMH 1E0BA 2NVXH 3M4YA 2R92B 2F0LA 2IX3A 3RZOB 4DXGA 3KLWA 3FVQA 4WORA 1IBLQ 2K14A 4IQZA 4A3LG 3G7LA 1L0WA 4A3CG 4X3SA 3S14H 1FNWA 4LF9L 4LF7Q 1CI3M 2IL8A 4AIMA 5C4HA 4ALPA 3FPPA 4JYAL 2F1MA 1IW7C 1ILQA 2WB1E 1GHJA 3RD4A 3I4OA 4GNXC 2KCNA 2R92G 1PXUA 3I3CA 4LWCA 1YNJD 3RN2A 2RSOA 1LT6D 1X55A 4HIMA 3J81E 1P8LA 4APVA 4LFBL 3QOJA 5C4XH 3T1HQ 1PZKD 5CR3A 5EKKA 3V96A 1HQMC 1BKBA 2LKVA 4PMBA 2PNHA 1HNWL 2NVXB 1GUGA 4KKTA 2B63H 3CCUA 3H0GH 1VQLA 2XTIA 3C1EA 4KY6A 3NBHB 5I4DA 3BJUA 3W2DA 2EPBA 1N34Q 1B53A 1K9MC 4NDXA 3P20A 4DV5L 4I65A 3DXJC 3ND8A 3J81j 5I9PA 1HZBA 2YYZA 1EY5A 5A2QE 1CM9A 4GNXA 2LY7A 1IKMA 4IUVA 3IL8A 1TR5A 1MBYA 2KVMA 4UPAA 4DR7L 1PH3A 4XDXA 4PZ6A 2VNUD 2FXQA 3TEHB 5ELNA 1IBMQ 3I4MH 1CSQA 2F0WA 2G5DA 2MHVA 4UAIA 2WIIB 4DV6Q 3X3NA 5CV4A 2B63B 1HUNA 2HUGA 3H0GB 2BH2A 1IHZA 1CKOA 2OWOA 1EWHA 2EY1A 2O5JC 4MIUA 2UXDQ 4RWSC 1CTMA 4YWKA 1GXDC 1A62A 1TS4A 5JVG3 1YBYA 3NP8A 2C5CA 1NE3A 2RBMA 1B4OA 3I8ZA 3RLFA 1F2ZA 1V1OA 3CPWA 2B63G 2A69D 4HJAA 4UP7A 2Z1CA 2B39A 3H0GG 1VQAA 2OQKA 3NWTA 1WD0A 1PH2A 2PMZB 1Z47A 4Y52H 3Q22A 5I6WA 2F0JA 5AFWA 4OX9Q 1XTDA 1TY0A 1EY0A 3CPFA 1DOMA 4RGOS 3NQTA 5D65A 1O7IA 1A15A 1W3SA 1CT1D 5JOBA 1GO3E 2Z0SA 1DM0B 4JV5L 2F0EA 2HHHQ 1HFNA 3WDNA 4DV0Q 3GQBA 3PIP3 1QVCA 2CQOA 2QEJC 3I2ZA 4M1UB 2BH8A 4ZUIA 3AQQA 5IYBH 1JJGA 2JQOA 3RZDB 1RTNA 2HD3A 4DR6Q 5JJIA 1FNUA 3GO5A 4BWGB 5GADC 5CV7A 3FHWA 1TWGB 1HQRD 4BY1H 1Q3LA 1I94L 2KQ3A 1VQDA 1LTTD 5ELDA 3NUCA 1EIFA 4ID6A 3GTJH 5IGFA 4HIOA 1NSNS 4OXPA 3OTOQ 1PHJA 2H5XA 3T1YL 2ZJRA 5CORA 3H3VH 3AEVA 4U673 3OWEB 5DM73 4K6DA 1OXUA 2NN6I 3SK4A 2KHJA 1W6JA 1QVFA 5K36H 1EYCA 1B44D 2IHEA 4JI0Q 1BO0A 3CMEA 1TT2A 4XIGS 2M9VA 3U9SA 4DV2L 3HKZB 4NMZA 4IPHA 1Q8KA 1BVSA 4O1NA 3HEJA 1EQRA 1QCBD 1UUPA 5GAGC 3KF6A 1K83H 4OO1H 1UNSA 4CKCA 3K7UC 4DR2Q 2AHOB 1HNZQ 1GM5A 2JA6H 5IODA 4QGUA 2JA5H 1KRSA 4RKBA 4DR4Q 1FNVA 4LF8L 4LF4L 4BY1B 5K5PA 1SFOH 4XYOA 3OMCA 1I4XA 3HKZG 4FXKC 1E1TA 2ID0A 2CHBD 2XVSA 4QMGA 4RCNA 3GTJB 2Q8IB 1B3AA 2E8GA 4IUUA 1AE2A 4DN4M 3K57A 4GLAC 2HIXA 5FJ8H 2ICEC 1WVLA 4JYAQ 3BU2A 4DF7A 4BY1G 1BBUA 3PIPA 4GOPB 3LX0A 4IPGA 2NVQH 1AP0A 1ENCA 3BG3A 1X3PA 3D0FA 1YIJA 1PYWD 4EQPA 2XIWA 2OF1A 4DUZQ 3PO3H 4LFBQ 2FMCA 2EQSA 3KK7A 3FDTA 1VQ7A 4OWTB 5JJKA 5IYDG 4KLKA 5A35A 4KY5A 2RDHA 4A3FH 4MNOA 2JA6B 2F0HA 3S24A 5IP7G 2KEDA 2PYKA 5C3EH 5J39A 1HNWQ 1VMPA 1Q7YC 2C9OA 1NAPA 2K4KA 4K2LA 3ULJA 4IFDH 2UXBL 1JQYD 2Y0SE 5LMUL 5C0XH 1WTPA 3R93A 4A3BH 4HSVA 2Z6BA 1B70B 2A19A 4ULLA 4JI6L 4OO1G 2OTJA 2DY8A 3O13A 1PH1A 2Q2UA 2JA6G 3M4OH 1NR4A 2EY6A 3AYHB 2K75A 4U68A 1E1OA 4DV5Q 1CA6A 2AWOA 3E9IA 2B2YC 3NTIA 1XXGA 2D62A 2VY3A 4KHZA 4RMFA 2NVQB 2PZUA 1HUMA 1Y14B 1RIPA 1PRTC 2E2HH 1WI5A 3EBEA 4P75A 1LV9A 5EJWA 1SE3A 3KLSA 1XX8A 3IRBA 4B3ML 2N78A 3DWQA 2A6HC 4IO9A 1VQHA 5C4JH 2NVTB 1GUWA 4CJ0B 5JJLA 4G7OC 4EX5A 3KLRA 1DCZA 3V05A 2E5LQ 1LACA 3K59A 3PV0A 3U9OA 3GDEA 4DXFA 4A76A 1KDCA 1KABA 4B3TL 4DK3C 3STBD 3M4OB 4IFDJ 4QY7A 1HHVA 2IT1A 4CJ1B 5C0XJ 3RN5A 2XSCA 4EQ5A 1VQ6A 4XQJA 2VXWA 2HDLA 3U50C 3S1QH 1OTCA 1SRUA 3JAML 1YJ9A 4KHPQ 2F0UA 3SR1A 1YNXA 1A2UA 2AQ3B 5GAHC 2KHSA 5ELOA 3BDOA 1ET6A 4V0BA 3TP6A 3K81C 4A3MH 2B29A 1E3PA 2WKDA 1QUQA 3UDGA 2N3SA 1TU2B 1DJRD 3HOWH 1RCVD 4JV5Q 4TRDA 2KCMA 5FLXL 2F4VL 2I5HA 3BDCA 1TWFH 2B2VC 4QL5A 1TIID 4K8IA 1Y1WH 4HJ5A 3VYTA 1JOOA 3CC7A 2HDMA 3T16A 3FRPB 3DM1A 3UE0A 1I4PA 4Q5VA 2OQ0A 2NUCA 2LS01 2EJFC 2E76C 2NZOA 1YVCA 1L1OB 3J7ZC 5M3MH 5BR8Q 1SJED 1WOCA 2ZJPA 5C4ZA 2XWJB 1MHWC 3LWUA 2L15A 1ICWA 1YZ6A 3T1YQ 1EQQA 3J7A5 1IYJB 4RAUC 1OXXK 2BE5D 4XQNA 1KC8C 1O7YA 1BUVT 3ICEA 2BDNA 1HFGA 3J80L 3T56B 1JICA 4ZCKA 2KJXA 2WAQE 1J5EL 3I7FA 4CKBA 3HOUB 1I4QA 1TWFB 5KNCA 2I07B 2ASBA 4CKEA 3NENA 2UU9L 2B2VA 1JWUD 1F2LA 2MQHA 1SXTA 2N8NA 1C0AA 4WJ4A 4YWLA 3F2UA 1WTHA 4LF8Q 1G2SA 1RKNA 3PUZA 4LF4Q 4A3DH 3JAMc 3MEFA 2N49A 5FO7B 3D6CA 4RA8A 2QILA 4DAYB 5C6AA 4TKOB 3HOUG 4DV4L 5IGDA 4KI0A 2DJFC 5FO8B 2MPMA 2NTTA 3PO2B 1MD2D 3HFZB 2E75C 2NN6H 1I3QH 4A4IA 1EY8A 2ENBA 1GOZA 3ERQA 4N8X1 1ML0D 1SNOA 4GKKQ 2F0NA 2B8GA 3OIQA 2IPKD 2YTYA 2PPBC 1CSPA 2KA7A 1STNA 5JEAG 3SK8A 3KF8A 3I72A 3KFUA 1LTSD 4K5VA 3H15A 2JEAI 3PO2G 1N9WA 4DR5L 3SEBA 1EOTA 4KJNA 3NEMA 3NPPA 4A3DB 3AMUA 5KRUA 2UXBQ 5LMUQ 3OHXC 1GUTA 1JJ2A 2IJ0A 1VQBA 1UE5A 1HZAA 4JI8L 2H4OA 1X3QA 4UHVA 2MJ8A 4X65L 1CQFA 3J81i 1I3QB 1WCMH 1JB3A 3A5ZB 1S5CD 3A55A 3RMHA 1HZCA 4B9XA 3MXPA 1HA5A 2B2UC 4A3DG 1Z6HA 1XNRQ 3MVVA 3P7JA 1C8CA 2H1EA 2A5HA 3I70A 3H3VC 1TVXA 5CBAE 2EY2A 3MTSA 4ZRZA 2PW7A 4GKJL 4A3KB 1C4QA 1KLGD 2NN6G 2E2IB 2YU9H 1F9SA 3S2HH 1EQTA 4DV1L 4B3MQ 2WACA 3D31A 3BS1A 1X65A 4BA2I 1Y1VB 3WWVA 4GOPC 4E6IA 4A3LH 4KTAA 4LUOA 4P74A 4F8MA 2EZVA 2M2LA 2JK8A 3EQLC 5CBEE 3ZJYC 4QIWB 2K5HA 3R2TA 2F3WA 2B2WC 3S17H 4BS9A 4A3KG 1KLUD 3PSIA 2R92H 2HQEA 2XGTA 3RZOH 4B3TQ 1VS0A 5KIXA 2EOTA 1R4QB 4TVAB 4R4TA 1Y1VG 4IPCA 2NZHA 1EY7A 3CCEA 4ME3A 3TMEA 5LMNL 1CKMA 1Q12A 1E22A 2B2UA 2JYOA 2PCFB 1K8MA 2PQAB 5HGQA 1DOLA 4IURA 3MA2B 3KOJA 1NMGA 4KD4A 2YU9B 4Y7NB 4J8QA 1SDFA 2K6AA 2A73B 4ZK9B 4X66L 1YNND 4GOPA 1ZYRC 2F4VQ 1SMYD 2AQ2B 2I46A 1S72A 1X32A 1KHIA 1PFSA 4FF4A 2NWGA 4JI1L 2F0OA 3S17B 1I5FA 1N32Q 2Z4IA 4LUVA 2WKCA 2F0GA 1PFMA 2ZXPA 1C7YA 4P71A 3CU7A 2OT2A 3KUPA 2R61A 4BBRB 4OEMB 3DEPA 1FR3A 1MJEA 2XWBB 2DNCA 3KDFA 1PZID 1ESRA 1EEFD 5CV9A 2AUKA 4DK1A 3L2PA 2VW9A 2VQEQ 2VQFL 1VQJA 3CF5A 1VQGA 2HIVA 1I4GA 1SR3A 4F7XA 4C1NI 2L5TA 1VQKA 1CZWA 4BBRG 1G91A 2NBFA 5J1ZA 4HSPA 1EY4A 3RLNA 3KYHC 1F9QA 2PZTA 3PUWA 2RDFA 4X62L 2NVYB 1J5EQ 4DA2A 4RH6A 4UY8C 4IUNA 4DNTB 1SBBB 3G71A 4LF6L 1X3FA 3I4NH 4R9WA 2ZTEA 1MI2A 4HN7A 1EYAA 3EIVA 1L0XB 3VA7A 1DD2A 1FYCA 4WFN3 2R93B 2J0TD 4L63B 5BN5A 3NTKA 1J9OA 1T5XD 1TS2A 3CW2C 3L0OA 2B3GA 3F2CA 5DAUA 3HOVH 2QF7A 2Q8TA 1LT3D 4XXEA 3FKIB 1BCPC 3TZDA 1PFBA 4PZ7A 4CGYB 4N9PA 4POFA 5E3FA 1EL0A 1PYSB 1KDBA 1STHA 3CAMA 2GN5A 1IBKQ 4WJWA 2R93G 5C5MA 2EXZA 3NWSA 3MC0B 2D2CC 1DXMA 3T4AC 4XQQA 4X64L 3N52A 4AQYL 1RF2D 2Q8RE 4NB3A 1A3UA 1FVIA 3FKIG 3HGBA 1JE5A 3OW7A 4IUTA 3SK5A 4DR5Q 1IKLA 1EU4A 3I4NB 1A0IA 3UDIA 4C1NK 3QIAA 4ODGA 4N9TA 3PF5A 1H9MA 1MSGA 1PH8A 3EFXD 3RZDH 1HPCA 5IT9E 4DV7L 1X3GA 4C3JH 2CWPA 3I73A 1SLJA 1JOQA 2L11A 1CZGA 2FJ2A 4JI8Q 3HOVB 1TWGH 2WAQB 2K32A 1WJJA 1VQEA 2IW3A 4X65Q 3SHLA 2KEEA 1I50H 4JBMA 4ZLTF 3I4NG 3K5NA 3VR4A 3OOCA 1VQMA 2R6GA 1M8AA 2X6LA 4H13C 1KQSA 5LHY1 3A56A 1UAPA 1XPOA 2RCFA 3K8AA 1GUSA 2V4DA 4K5WA 4HR7B 1D7QA 2F03A 4JVZA 1KRTA 1H9SA 3HOVG 1SJHD 1U4RA 2WAQG 4YIJA 4A3GB 4GKJQ 1PTOD 3P75A 2CCZA 3VR6A 1PLFA 4C2MB 3T13A 1W2BA 3NK9A 2DJGC 3Q0AA 2IX1A 1G51A 4UP9A 4C3JB 2HT1A 2D9UA 4TSSA 3I91A 4DR1Q 4DV3L 1KNEA 1C48A 4A3GG 1D1IA 4O42A 3CCLA 1I50B 1H9KA 1UEBA 4KV6A 3TN2A 4AYBB 5G3LD 3S1MB 1M4VA 1NBWA 1A3TA 1HTPA 2K5QA 5IYDH 2AMCB 4YHHL 4C3JG 4KN4C 3KBGA 3C1FA 2EIFA 4DAYA 4GLXA 5I9OA 5IP7H 5IIFA 2A6ED 1UE7A 3MXUA 1UEAB 4FF2A 2F0DA 2SNMA 4Q0FA 4PV1C 1XNQQ 3GTLB 1M1KC 1KTKA 4AYBG 3C3LA 4MN3A 1Y8NB 4DAPA 1PZJD 2RQXA 1JORA 3HOYB 3CCSA 1VQ9A 3TP8A 3GV3A 1G8ZD 4JI1Q 3GTOB 2I0QA 3OYYA 4R1JA 1TS3A 1U4LA 4O2DA 1RD9D 1Y8PB 4GZYC 1I6VC 5IYCG 2ZJQA 1ENAA 1Q82C 4EQNA 1X54A 1ASYA 4A93B 5CV8A 4QF4A 3HOYG 3HG9A 2PZWA 4LF9Q 3T51B 3ITPA 3EJIA 5CV6A 2D5DA 1HCZA 5AJ3L 3PF4A 5EAYA 1XMQL 2EYJA 2VQFQ 4DUYL 4A3JB 1IW7D 4H7BA 1XJVA 4JI3L 3CCJA 1VQ5A 3A5UA 1PTOB 2RHQB 4A93G 4LF5L 2RVLA 2V1CC 2F0FA 2HCCA 3ULLA 1WFQA 2Q2IA 1VF5C 3M7GA 4RGTA 2A68C 4A3EH 1IL8A 1YEZA 4IPDA 1WTQA 2DNEA 1BBXC 2LFNA 1TS5A 3K5OA 4A3JG 2NVTH 1F2YA 3QR8A 1SNMA 5M5YH 4FF1A 3U4VA 1L0YB 2FFKB 3M9BA 4HAEA 5DEHA 3SDZA 5KGUA 3CQZB 2B2TC 3S1NB 1B8AA 4EQOA 1VQNA 3TDQA 1CKNA 3K7AH 1OO9B 3CRKC 4CBVA 2E2DC 4LUZA 5IOCA 4R4OA 2EXDA 2IWHA 1HNXL 3GTPH 1DOKA 2CVRA 2HQLA 2L55A 5EQ0A 3PIO3 4DR7Q 3EROA 1T5EA 3I55A 5M9OA 1PRTF 4ZYSA 1B9NA 4G7ZC 1Y8OB 4X64Q 4A3EB 4JI4L 1EUJA 1U5KA 5IWAL 3I56A 4DR3L 3OWFA 4AQYQ 5JVH3 4J1MA 4ME5A 2WB1B 1AH9A 5M5YB 1X3EA 1X6OA 1B1ZA 3QB3A 2F3IA 1VQCA 3QOLA 4LFAL 1ICFB 3SK6A 4B08A 3K7AB 4K14A 3W1GA 3VR5A 2QA4A 2B2TA 4RG1A 4A3EG 4BXXH 1Q1BA 3LNNA 4RKLA 4JI2L 3H6MA 1RTOA 5I2YA 1C9OA 3CCQA 2WB1G 5M3FB 3PUVA 1Y69U 2B2YA 3GTPB 1VDZA 2F52A 1E7ZA 4P2CB 3K0XA 4JCVE 3WOEA 3GTGH 2CW0D 4GNXB 3DEOA 1GVPA 1IYVA 4L5QA 3UI2A 2KECA 1IXRA 1VQ4A 2EYFA 2L9HA 1SROA 5M3FG 4JW0A 2ES2A 5EKIA 4QB4A 1V1PB 3HOUH 4MZ9A 3SVMA 4LJZC 4IOCA 4FXDA 5JPMC 3BZCA 4JI7L 2Z4HA 3I90A 5A2QL 4PZ8A 5LL6X 2UUBL 4OL7A 4DNIA 1GUOA 1YNNC 4DV3Q 1KIXA 5I6YA 5IY0A 4UDUC 3HKSA 3PIOA 2NZ1D 1ENFA 1ZXTA 1I94Q 5JEAH 2EVBA 4P72A 3NBIA 2MFIA 4IOAA 4IUQA 1KXLA 4NKLA 2DGYA 4NXNL 3URYA 2K1BA 2K5VA 3NBHA 3GTGB 2QDBA 3PO2H 3S16B 1I4HA 4YHHQ 3S2DB 1K3RA 1LTAD 1Z9FA 1K8OA 4PG3A 1IBLL 4BXXG 5C44H 1O7ZA 2F3VA 2ICIA 3SXHA 3AU7A 5CYUA 1PH6A 3BYTB 1BDOA 3H09A 3U58A 4DV2Q 2QKIC 3NHHA 4HMJA 1NUCA 1YNJC 3M3YH 3TREA 1WTRA 5GAEC 3L7ZC 1VMCA 3QO2A 1Q1EA 2VUMB 1KAWA 2A8VA 2F0IA 3QJYA 1CQVA 5EPJA 2QEXA 2VB3X 1AEXA 1BBWA 4XT3B 2AQ1B 5EGTA 3ERSX 1O78A 1JMCA 4OELB 2GVBA 1S5BD 3TS0A 2VUMG 3R3OA 1IZ6A 3FPUB 5L37A 4GKKL 5EPKA 1B9MA 2PMZE 2TSSA 5LMNW 4H02A 1D5MC 4QCLA 1HTLD 1FGUA 5C44B 3ER0A 5AJ3Q 4L5SA 3W3AA 4P73A 4DK6C 5FLXc 1QNKA 5C3WA 2O2LD 2OXPA 5IP9G 4EVOA 3PMFA 1N34L 2DY7A 3TSSA 4JI3Q 1D5ZC 3MAQA 2BCOA 1F9PA 3M3YB 1L2FA 4LF5Q 4XTCS 3U4ZA 4A3KH 2M00A 3CD6A 2EYLA 1NNXA 2CQAA 3D4WA 5ELFA 3FEWX 2E2IH 1QJOA 5C44G 2DN8A 2VS1A 3KF6B 1Y1VH 4O0AA 4R8IA 1SNPA 1S3OA 3FP9A 2NB0A 4PMCA 2L4NA 1XPRA 1HR0W 3ND9A 1FL0A 3BZDB 4KY7A 5D3IB 1W6KA 5D3DA 4JI6Q 2PI2A 3RR5A 4DV6L 3QG1A 3IAYA 1WYDA 2KCTA 1VQOA 1E24A 2YTVA 4XYQA 2F0VA 4C3HB 3J80c 4QUCA 4A3IB 2EJGC 4FNFA 3D3RA 4OGQC 3MEHA 2K5WA 3VYSA 1R4PB 3M4PA 1HNXQ 1X56A 4YCVA 1QE6A 4JC0A 2WINB 4OONA 1HRJA 5FKAC 2A69C 5GROA 3H91A 5EKLA 3AFQA 1K0SA 1UWVA 1S40A 4C3HG 1PRTD 1B2TA 4Y7NH 4JI4Q 3G48A 4DR3Q 4A3IG 5DLQE 2GA4B 4OX9L 2ZXRA 2E2JB 2G9HD 4DGZA 1TY2A 2A6HD 3JAMi 4J15A 1PTOC 3BVZA 3HOZH 2XRSD 5TSSA 4PMWA 4LFAQ 5CV5A 4HJ8A 1EEID 3S15B 5E4WC 3T53B 5KYLA 5F2DA 1KL9A 2BDOA 3DUZA 3CCMA 2HHHL 3TZUA 4JI2Q 3OIPA 4BBRH 2VB2X 1YHAA 5E1FA 2CWAA 3R2IA 1E2ZA 3KJOA 1PA6A 3QWNA 1K8GA 3E3XA 4DR6L 2Q2TA 1SYFA 2Y0SB 2J4XA 2Q2HA 5HGTA 4L5RC 4JOIC 1LYLA 2ZXOA 1STEA 1A6XA 1DZ1A 2XRQD 1LLRD 4WRDA 3OTOL 2TMPA 4G57A 4S3SA 4FO2A 2A6EC 2NVYH 1BOSA 3MZ5A 3HOZB 2F0PA 1PH4A 4B3RL 2EY5A 3VYRA 2Y0SG 4IJHA 1B7YB 1H95A 4L5TA 4JBWA 1PFNA 1Z7TA 1WTWA 1IL2A 2B8FA 2B2WA 2UUBQ 1HR0L 2VZAA 2R93H 2MNAA 4G4KA 1ZEQX 4R4QA 3H94A 1R9TB 5FLMG 4JI5L 3HOZG 2PQEA 3CRLC 2K7VA 1XYIA 4DR4L 3TQYA 1O7LA 1QZHA 1N8RC 4NXNQ 1AFPA 2FINB 2D0OA 1SYCA 3FKIH 1EY9A 4IFDI 3FMCA 5C0XI 3J7YW 4JOIA 3S9WA 1EIHA 1DGSA 3N6RA 2LXKA 2KBNA 3A8KE 4R4CA 1Q8IA 1PRTB 3B6YA 4AH6A 4QJFA 4K6LA 2AKWB 2FHTA 4K0KL 1D6EC 3NELA 4X3TA 1QUQB 2CFMA 1WTOA 1QNUA 3DLLA 2OCEA 2C35B 1U4MA 2UU9Q 1PH9A 5KYIA 3NXWA 1UE6A 3LGJA 4K5XA 3G4SA 4EGVA 1TWCB 1VCIA 4DUZL 3BVGA 2LSSA 2MO0A 4HEDA 2AUJD 2EYMA 2XNAC 2N55A 4KN7C 4DV4Q 3JAME 4ZUJA 3GTKH 3A7LA 1KAAA 3GTMB 1S5FD 3Q8DA 1JR0D 2EJMA 1TWHH 1JT8A 1BCPF 1LTLA 3SE0A 2QCPX 1QB5D 5IGGA 4ZKCB 5FO9B 1N36L 2E74C 4Z9CB 2I5LX 1V43A 1L1OC 1WTVA 3X3MA 3S1RH 5KNBA 1F77A 4YY3L 3S14B 1JE4A 5IGCA 5JPNC 2RHSB 4HCEA 5FLXE 5FOBB 3AFPA 1QZGA 3WOFA 1VQPA 1YI2A 3L3OC 4A3GH 1QOHA 1S4ZA 2SNSA 4FYDA 1EWIA 1EZ6A 1Q90A 4C2MH 2R7DA 3GV6A 1SNDA 5C4XB 2KHIA 1HJPA 2UUCL 1H9RA 3A8JE 1ET9A 1J8IA 3GTKB 1V1PA 2OEOA 4F87A 4DK0A 4FP5D 1OXTA 5I2XA 1TWHB 4BA1I 1SYDA 3Q6SA 1BF4A 3NTHA 3UE1A 2F0SA 2K28A 3F2BA 1K28A 2E5LL 3STBC 3S1MH 5C4XG 3EVQA 2JP1A 2K04A 3ZYYX 3S1RB 3MXGA 3J80E 1NTGA 1MIUA 1L1OA 2R7FA 1PYBA 1BQQT 2N88A 3G6EA 4V190 1YHQA 3VR2A 2GVAA 3KF8B 1B3QA 2UXCL 3MXNB 3GTLH 3BDLA 3K0YA 4DV1Q 2CW0C 4KHPL 5EBDA 2CKZB 2RKSA 4HCSA 5IYCH 1GKHA 4WJ3M 4X3UA 1STBA 4HIKA 5DNFA 3JC66 1SYBA 1PVOA 1J6QA 3HOYH 1H9JA 3I4MB 1V9PA 4UP8A 1K8AC 3HOXH 2IY5B 1D8LA 3GP7A 3GTOH 2BA0A
chains in the Genus database with same CATH topology
1U0LA 4JI4L 1EUJA 1U5KA 5IWAL 4A4IA 3KLWA 3I56A 4DR3L 4AQYQ 5E7NA 1IBLQ 4GKKQ 1NY4A 2YTYA 2F4VL 1CSPA 2K14A 1AH9A 4A3LG 1X3EA 3M85A 1X6OA 2WP8J 5GQOA 1L0WA 5JEAG 1Q86C 3TRZA 4A3CG 3S14H 2F3IA 4A93H 4LF9L 1VQCA 4LF7Q 1I6HH 3KFUA 4AIMA 5LMNQ 4ALPA 4LFAL 3I4MG 4JYAL 3H15A 2JEAI 3PO2G 2QGQA 1N9WA 2WB1E 3I4OA 3W1GA 2QA4A 4GNXC 4DR5L 4RG1A 4A3EG 2R92G 4BXXH 1Q1BA 4LWCA 4JI2L 3RNUA 3RN2A 1C9OA 1K0RA 3NEMA 4A3JH 1X55A 4HIMA 3CCQA 5BR8L 2WB1G 1P8LA 4APVA 4QQBX 4LFBL 2ALYB 3PUVA 5C4XH 2UXBQ 5LMUQ 3T1HQ 1JJ2A 1MKHA 2Z6KC 2F52A 1E7ZA 1VQBA 4X66Q 1UE5A 3K0XA 4JCVE 1HZAA 4JI8L 3GTGH 1BKBA 4GNXB 1PV4A 2UUAL 2PNHA 4X65L 4B3RQ 1HNWL 1GVPA 3J81i 1WCMH 2BA1A 3A5ZB 4L5QA 1HZCA 3PO3G 2B63H 3CCUA 1IXRA 3H0GH 1VQ4A 1VQLA 3GD7A 1XMOL 2XTIA 4FDBA 4A3DG 1SROA 5M3FG 3NBHB 2ES2A 1HR0Q 1XNRQ 3BJUA 1Q46A 3HOUH 4MZ9A 3CQZH 1N34Q 4HIDA 3S1NH 1N33L 4IOCA 1K9MC 4JBKA 1FJGL 3BZCA 4JI5Q 3HOXG 3VDYA 4JI7L 1SN8A 4PZ8A 4DV5L 4GKJL 3CCRA 4OWXB 2UUBL 3J81j 2NN6G 4DNIA 5M5XH 1HZBA 2YYZA 2YU9H 4DV3Q 3S2HH 4DV1L 1KIXA 4B3MQ 1MJCA 3E9HA 2YTXA 5IY0A 3D31A 3HKSA 3PIOA 1X65A 4GNXA 4BA2I 3WWVA 4GOPC 4A3LH 4DR7L 4UPAA 1I94Q 4LUOA 4P74A 4P72A 1PH3A 4PZ6A 2JK8A 2FXQA 2MFIA 3TEHB 4IOAA 5ELNA 3ZJYC 5IYBG 2VNUD 1KXLA 1IBMQ 3I4MH 2DGYA 4NXNL 1CSQA 2K5VA 2K5HA 3PO2H 4X62Q 3S17H 4YHHQ 2Z6KA 4A75A 1K3RA 3PSIA 1Z9FA 4A3KG 2R92H 2XGTA 4PG3A 1EFWA 1IBLL 3RZOH 4BXXG 3PGZA 4B3TQ 4GKKL 5C44H 1VS0A 4GS3A 4LF6Q 4DPGA 2ZTDA 4DV6Q 4QIWE 5IE8A 4TVAB 1PH6A 4R4TA 1CUKA 2BH2A 3GTQH 1Y1VG 3PCOB 1SE8A 1CKOA 4IPCA 2NZHA 3CP0A 4DV2Q 3U58A 2OWOA 1SMXA 1YHBA 2UXDQ 3CCEA 4ME3A 4YWKA 1CKMA 5LMNL 1Q12A 1A62A 1E22A 5M5WH 4LNQA 3GTOH 3M3YH 3TREA 1YBYA 3RLOA 5GAEC 3L7ZC 2PQAB 5HGQA 1Q1EA 1KAWA 1NE3A 2A8VA 2ZM6L 3RLFA 3UDXA 3KOJA 1NMGA 5K36G 2QEXA 3A0JA 3CCVA 4LFCL 3CPWA 2B63G 4HJAA 4UP7A 3H0GG 1BBWA 3KDFB 5M3FH 1VQAA 2OQKA 1PH2A 4Y52H 1Z47A 3ERSX 1N36Q 4OX9Q 4BY7H 4B3SL 4X66L 1JMCA 4GOPA 1RL2A 1XTDA 2YV5A 1S72A 2GVBA 4YCWA 2F4VQ 4YY3Q 3TS0A 3CPFA 2JA7H 4NXML 1KHIA 1PFSA 2VUMG 4GN4B 2VL6A 1IZ6A 4JI1L 1N32Q 1I5FA 1O7IA 1W3SA 2JA5G 1GO3E 2PMZE 5LMNW 2Z0SA 4LUVA 4H02A 1FGUA 3ER0A 5AJ3Q 2PQAA 1C7YA 4P71A 4L5SA 4JV5L 1XNRL 4P73A 4DK6C 5FLXc 2HHHQ 1G291 5IP9G 4DV0Q 1QVCA 2CQOA 3I2ZA 1N34L 2BH8A 4JI3Q 3AQQA 5IYBH 1MJEA 1JJGA 2JQOA 1NJIC 2AWNA 3KDFA 1L2FA 4LF5Q 4XTCS 3U4ZA 5FJ8G 2WFWA 2UUCQ 4A3KH 4DV7Q 4DR6Q 5JJIA 3CD6A 2K5NA 3GO5A 1AE3A 5GADC 3L2PA 3FHWA 2VW9A 2E2IH 2VQEQ 2VQFL 4BY1H 1VQJA 5C44G 3CF5A 1VQGA 2HIVA 2VS1A 2IHFA 1I94L 3KF6B 1SR3A 1Y1VH 1VQKA 1VQDA 4O0AA 4BBRG 1JB7A 1EIFA 3GTJH 4HIOA 3RLNA 3KYHC 1S3OA 4OXPA 3OTOQ 1LUZA 2H5XA 3T1YL 3FP9A 2ZJRA 1PHJA 1M90C 3PUWA 4X62L 3AEVA 1XPRA 3H3VH 4K0KQ 1HR0W 1J5EQ 1FL0A 4UY8C 3S16H 1OXUA 2NN6I 4A3FG 3S2DH 2KHJA 3W5OA 4GN5A 3G71A 2PI2A 4JI6Q 3RR5A 4LF6L 4DV6L 1WYDA 1QVFA 1YJNA 5C3EG 1X3FA 2IX0A 2KCTA 2IHEA 1VQOA 4JI0Q 1E24A 2YTVA 3J80c 3CMEA 4XIGS 3I4NH 4DV2L 2MO1A 2ZTEA 4IFDG 3EIVA 4IPHA 2UXCQ 5C0XG 1Q8KA 3UDFA 1BVSA 2VUMH 4BY7G 1EQRA 4A3BG 4DKAC 3M4PA 1T9HA 1HNXQ 1X56A 5GAGC 4YCVA 3KF6A 1K83H 4JC0A 4OONA 3K7UC 4DR2Q 2AHOB 5GROA 3CW2C 2JA7G 3L0OA 2B3GA 3F2CA 1GM5A 1HNZQ 2JA6H 4QGUA 2JA5H 3W1BA 2R7ZH 1KRSA 3HOVH 4DR4Q 1OXVA 4LF8L 3AFQA 1Q81C 1UWVA 4LF4L 3CXCA 1S40A 4PZ7A 1SFOH 4Y7NH 4JI4Q 4POFA 3HKZG 1E1TA 3G48A 1PYSB 5DLQE 4DR3Q 2ID0A 4A3IG 4OX9L 5IP9H 3CAMA 2GN5A 1IBKQ 2R93G 3M7NA 3JAMi 1VQIA 4J15A 3HOZH 2E8GA 4GN3B 1AE2A 1N32L 4GLAC 2HIXA 5FJ8H 4X64L 4PMWA 4LFAQ 4MTNA 4JYAQ 2LXJA 4HJ8A 4AQYL 2JA8H 3BU2A 1PH5A 1KL9A 4NB3A 1XPUA 1FVIA 3FKIG 1BBUA 1JE5A 4BY1G 3PIPA 3CCMA 4DR5Q 2DUDA 2HHHL 1A0IA 4JI2Q 4GOPB 4IPGA 3UDIA 4BBRH 1HZ9A 1EYGA 3F8TA 4TQUS 2NVQH 3D0FA 1YIJA 1YHAA 2CWAA 3PF5A 4LF7L 4DUZQ 3PO3H 4LFBQ 4GLVB 1PH8A 2EQSA 3KJOA 3RZDH 1VQ7A 1TXYA 5JJKA 4OWTB 1PA6A 5IYDG 1K8GA 1K73C 4DV7L 4KLKA 4DR6L 1X3GA 3J81c 4A3FH 4C3JH 2CWPA 4MNOA 2Q2TA 1SLJA 2Q2HA 2VQEL 4L5RC 4JI8Q 4JOIC 3S24A 1LYLA 1TWGH 5IP7G 5C3EH 1WJJA 1A63A 2UUAQ 1HNWQ 1VQEA 4X65Q 4YCUA 1Q7YC 1I50H 4JBMA 3I4NG 2K4KA 3ULJA 1VQMA 2R6GA 2UXBL 2Y0SE 3OTOL 5LMUL 3T1HL 1KQSA 1XMOQ 3K80C 5H1SE 4A3BH 4JG2A 1XPOA 1B70B 2NVYH 2A19A 3K8AA 4JI6L 4NPSA 4OO1G 2OTJA 1PH4A 4B3RL 1D7QA 1PH1A 2Y0SG 2Q2UA 1KRTA 2JA6G 1N33Q 3M4OH 2D0PA 4IJHA 1FJGQ 1B7YB 3AYHB 3HOVG 2K75A 4L5TA 2WAQG 2R7ZG 4JBWA 1H95A 1VQ8A 1E1OA 5JEAJ 4C3HH 4DV5Q 2AWOA 4A3MG 3E9IA 1IL2A 4GKJQ 2UUBQ 1UE1A 1XMQQ 2D62A 2CCZA 1HR0L 4A3IH 1VQFA 2VY3A 4KHZA 3HOWG 4RMFA 2VZAA 4DUYQ 2R93H 2MNAA 4R4QA 1W2BA 1Y14B 5FLMG 1RIPA 2RCNA 4JI5L 2JJQA 3HOZG 2E2HH 1WI5A 3EBEA 4P75A 2IX1A 4DR4L 1G51A 3TQYA 1QZHA 4UP9A 2HT1A 4HJ7A 1N8RC 1Y1WG 4NXNQ 3CC4A 2JA8G 2D0OA 4DR1Q 4YWMA 4DV3L 3IRBA 4B3ML 3OW2A 2N78A 4A3GG 3FKIH 2PI2E 4IFDI 3CCLA 2A1AA 4IO9A 1VQHA 1A8VA 5C0XI 1UEBA 4JOIA 5C4JH 1IBKL 4JBJA 2E2JH 5JJLA 3CC2A 1DGSA 4EX5A 1P16A 2LXKA 2KBNA 5M3MG 1IBML 1NBWA 4R4CA 2E5LQ 3B6YA 4AH6A 4QJFA 2AKWB 3A74A 3PV0A 5IYDH 2AMCB 4YHHL 4K0KL 3GDEA 3NELA 4A76A 1QUQB 2CFMA 2I5MX 3DLLA 2OCEA 4B3TL 2EIFA 4DK3C 3ULPA 3STBD 4GLXA 3S15H 4IFDJ 4QY7A 5IP7H 4AYBE 2C35B 2IT1A 5C0XJ 3RN5A 2UU9Q 2ZM6Q 4BBSH 1PH9A 1UE7A 1EOVA 3F1ZA 2JEBI 5IT9c 4EQ5A 1VQ6A 1UE6A 3LGJA 3E0EA 3G4SA 1VCIA 2UXDL 4POGA 4DUZL 4LFCQ 1XNQQ 1M1KC 3U50C 4AYBG 3PUYA 3S1QH 3F2DA 1OTCA 1SRUA 1YJ9A 4KHPQ 2LSSA 4OWWB 5HY6A 2MO0A 4B3SQ 2KENA 1YNXA 3SGIA 1GD7A 5GAHC 3CCSA 3HKZE 4DV4Q 4X6AH 1LM0A 3GTKH 1VQ9A 3TS2A 5ELOA 4NXMQ 2JA9A 3Q8DA 3K81C 1TWAH 4JI1Q 4A3MH 1TWHH 1JT8A 1LTLA 1E3PA 2B29A 1QUQA 3UDGA 3OYYA 4R1JA 2I0QA 2N3SA 5IWAQ 3HOWH 1N36L 4O2DA 4DAMA 4JV5Q 2I5LX 1V43A 1L1OC 2KCMA 3BZKA 3M4QA 3H3VI 5FLMH 3S1RH 5IYCG 4R4IA 2ZJQA 2ATWA 2I5HA 4YY3L 1Q82C 1TWFH 1X54A 1ASYA 2K52A 4QL5A 3HOYG 2RHSB 1YJWA 4LF9Q 3AFPA 4C3IH 1Y1WH 4HJ5A 1QZGA 1VQPA 3CMAA 1V1QA 3CC7A 1YI2A 5AJ3L 1YITA 3DM3A 2JE6I 3PF4A 5EAYA 3UE0A 1XMQL 4A3GH 1EIYB 2OQ0A 4HJ9A 4DV0L 1EWIA 2VQFQ 4DUYL 2NZOA 1YVCA 1L1OB 1XJVA 4JI3L 4C2MH 3CCJA 2R7DA 1CKNB 3J7ZC 1X9NA 1VQ5A 5M3MH 2K50A 5BR8Q 1WOCA 1R9TH 2ZJPA 1NMFA 4A3CH 3A5UA 4OO1I 2KHIA 2RHQB 1HJPA 2L15A 4A93G 4LF5L 1YZ6A 2UUCL 3T1YQ 1EQQA 3J7A5 2V1CC 3ULLA 4DR1L 1WFQA 4LW1A 2Q2IA 4A3EH 1YEZA 1IYJB 2RF4A 4IPDA 4BBSG 1OXTA 1OXXK 1OXSC 4BA1I 1KC8C 4IJLA 2ZTCA 3UE1A 4A3JG 2NVTH 3ICEA 3F2BA 5M5YH 1QVGA 3U4VA 2E5LL 3STBC 3S1MH 5C4XG 1JJCB 2WAQE 1J5EL 3M9BA 3I7FA 1NTGA 1MIUA 1G6PA 1B8AA 1L1OA 1ASZA 1VQNA 2R7FA 1CKNA 3K7AH 2ASBA 3NENA 1PYBA 2UU9L 4JI0L 3G6EA 2N8NA 2MQHA 4LUZA 4JI7Q 1PH7A 1C0AA 1YHQA 3PUXA 4WJ4A 4R4OA 1WCMG 4YWLA 3KJPA 2EXDA 2GVAA 4LF8Q 1XNQL 1KD1C 3KF8B 3PUZA 4LF4Q 1TWCH 3MXNB 2UXCL 1HH2P 4A3DH 3GTLH 3JAMc 3MEFA 2N49A 3J80i 4DV1Q 4KHPL 5J3BA 1HNXL 3GTPH 2CKZB 4WJ3M 4DAYB 2HQLA 1GKHA 5IYCH 4DR7Q 4HIKA 4DR2L 3I55A 3JC66 3HOUG 4DV4L 1HNZL 4KI0A 1PVOA 1J6QA 3HOYH 3EN2A 1V9PA 2OTLA 4UP8A 1K8AC 3HOXH 2IY5B 1D8LA 3HFZB 3GTMH 2NVXH 4X64Q 1I3QH 2BA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U0L A;  4JI4 L;  1EUJ A;  1U5K A;  5IWA L;  4A4I A;  3KLW A;  3I56 A;  4DR3 L;  4AQY Q;  5E7N A;  1IBL Q;  4GKK Q;  1NY4 A;  2YTY A;  2F4V L;  1CSP A;  2K14 A;  1AH9 A;  4A3L G;  1X3E A;  3M85 A;  1X6O A;  2WP8 J;  5GQO A;  1L0W A;  5JEA G;  1Q86 C;  3TRZ A;  4A3C G;  3S14 H;  2F3I A;  4A93 H;  4LF9 L;  1VQC A;  4LF7 Q;  1I6H H;  3KFU A;  4AIM A;  5LMN Q;  4ALP A;  4LFA L;  3I4M G;  4JYA L;  3H15 A;  2JEA I;  3PO2 G;  2QGQ A;  1N9W A;  2WB1 E;  3I4O A;  3W1G A;  2QA4 A;  4GNX C;  4DR5 L;  4RG1 A;  4A3E G;  2R92 G;  4BXX H;  1Q1B A;  4LWC A;  4JI2 L;  3RNU A;  3RN2 A;  1C9O A;  1K0R A;  3NEM A;  4A3J H;  1X55 A;  4HIM A;  3CCQ A;  5BR8 L;  2WB1 G;  1P8L A;  4APV A;  4QQB X;  4LFB L;  2ALY B;  3PUV A;  5C4X H;  2UXB Q;  5LMU Q;  3T1H Q;  1JJ2 A;  1MKH A;  2Z6K C;  2F52 A;  1E7Z A;  1VQB A;  4X66 Q;  1UE5 A;  3K0X A;  4JCV E;  1HZA A;  4JI8 L;  3GTG H;  1BKB A;  4GNX B;  1PV4 A;  2UUA L;  2PNH A;  4X65 L;  4B3R Q;  1HNW L;  1GVP A;  3J81 i;  1WCM H;  2BA1 A;  3A5Z B;  4L5Q A;  1HZC A;  3PO3 G;  2B63 H;  3CCU A;  1IXR A;  3H0G H;  1VQ4 A;  1VQL A;  3GD7 A;  1XMO L;  2XTI A;  4FDB A;  4A3D G;  1SRO A;  5M3F G;  3NBH B;  2ES2 A;  1HR0 Q;  1XNR Q;  3BJU A;  1Q46 A;  3HOU H;  4MZ9 A;  3CQZ H;  1N34 Q;  4HID A;  3S1N H;  1N33 L;  4IOC A;  1K9M C;  4JBK A;  1FJG L;  3BZC A;  4JI5 Q;  3HOX G;  3VDY A;  4JI7 L;  1SN8 A;  4PZ8 A;  4DV5 L;  4GKJ L;  3CCR A;  4OWX B;  2UUB L;  3J81 j;  2NN6 G;  4DNI A;  5M5X H;  1HZB A;  2YYZ A;  2YU9 H;  4DV3 Q;  3S2H H;  4DV1 L;  1KIX A;  4B3M Q;  1MJC A;  3E9H A;  2YTX A;  5IY0 A;  3D31 A;  3HKS A;  3PIO A;  1X65 A;  4GNX A;  4BA2 I;  3WWV A;  4GOP C;  4A3L H;  4DR7 L;  4UPA A;  1I94 Q;  4LUO A;  4P74 A;  4P72 A;  1PH3 A;  4PZ6 A;  2JK8 A;  2FXQ A;  2MFI A;  3TEH B;  4IOA A;  5ELN A;  3ZJY C;  5IYB G;  2VNU D;  1KXL A;  1IBM Q;  3I4M H;  2DGY A;  4NXN L;  1CSQ A;  2K5V A;  2K5H A;  3PO2 H;  4X62 Q;  3S17 H;  4YHH Q;  2Z6K A;  4A75 A;  1K3R A;  3PSI A;  1Z9F A;  4A3K G;  2R92 H;  2XGT A;  4PG3 A;  1EFW A;  1IBL L;  3RZO H;  4BXX G;  3PGZ A;  4B3T Q;  4GKK L;  5C44 H;  1VS0 A;  4GS3 A;  4LF6 Q;  4DPG A;  2ZTD A;  4DV6 Q;  4QIW E;  5IE8 A;  4TVA B;  1PH6 A;  4R4T A;  1CUK A;  2BH2 A;  3GTQ H;  1Y1V G;  3PCO B;  1SE8 A;  1CKO A;  4IPC A;  2NZH A;  3CP0 A;  4DV2 Q;  3U58 A;  2OWO A;  1SMX A;  1YHB A;  2UXD Q;  3CCE A;  4ME3 A;  4YWK A;  1CKM A;  5LMN L;  1Q12 A;  1A62 A;  1E22 A;  5M5W H;  4LNQ A;  3GTO H;  3M3Y H;  3TRE A;  1YBY A;  3RLO A;  5GAE C;  3L7Z C;  2PQA B;  5HGQ A;  1Q1E A;  1KAW A;  1NE3 A;  2A8V A;  2ZM6 L;  3RLF A;  3UDX A;  3KOJ A;  1NMG A;  5K36 G;  2QEX A;  3A0J A;  3CCV A;  4LFC L;  3CPW A;  2B63 G;  4HJA A;  4UP7 A;  3H0G G;  1BBW A;  3KDF B;  5M3F H;  1VQA A;  2OQK A;  1PH2 A;  4Y52 H;  1Z47 A;  3ERS X;  1N36 Q;  4OX9 Q;  4BY7 H;  4B3S L;  4X66 L;  1JMC A;  4GOP A;  1RL2 A;  1XTD A;  2YV5 A;  1S72 A;  2GVB A;  4YCW A;  2F4V Q;  4YY3 Q;  3TS0 A;  3CPF A;  2JA7 H;  4NXM L;  1KHI A;  1PFS A;  2VUM G;  4GN4 B;  2VL6 A;  1IZ6 A;  4JI1 L;  1N32 Q;  1I5F A;  1O7I A;  1W3S A;  2JA5 G;  1GO3 E;  2PMZ E;  5LMN W;  2Z0S A;  4LUV A;  4H02 A;  1FGU A;  3ER0 A;  5AJ3 Q;  2PQA A;  1C7Y A;  4P71 A;  4L5S A;  4JV5 L;  1XNR L;  4P73 A;  4DK6 C;  5FLX c;  2HHH Q;  1G29 1;  5IP9 G;  4DV0 Q;  1QVC A;  2CQO A;  3I2Z A;  1N34 L;  2BH8 A;  4JI3 Q;  3AQQ A;  5IYB H;  1MJE A;  1JJG A;  2JQO A;  1NJI C;  2AWN A;  3KDF A;  1L2F A;  4LF5 Q;  4XTC S;  3U4Z A;  5FJ8 G;  2WFW A;  2UUC Q;  4A3K H;  4DV7 Q;  4DR6 Q;  5JJI A;  3CD6 A;  2K5N A;  3GO5 A;  1AE3 A;  5GAD C;  3L2P A;  3FHW A;  2VW9 A;  2E2I H;  2VQE Q;  2VQF L;  4BY1 H;  1VQJ A;  5C44 G;  3CF5 A;  1VQG A;  2HIV A;  2VS1 A;  2IHF A;  1I94 L;  3KF6 B;  1SR3 A;  1Y1V H;  1VQK A;  1VQD A;  4O0A A;  4BBR G;  1JB7 A;  1EIF A;  3GTJ H;  4HIO A;  3RLN A;  3KYH C;  1S3O A;  4OXP A;  3OTO Q;  1LUZ A;  2H5X A;  3T1Y L;  3FP9 A;  2ZJR A;  1PHJ A;  1M90 C;  3PUW A;  4X62 L;  3AEV A;  1XPR A;  3H3V H;  4K0K Q;  1HR0 W;  1J5E Q;  1FL0 A;  4UY8 C;  3S16 H;  1OXU A;  2NN6 I;  4A3F G;  3S2D H;  2KHJ A;  3W5O A;  4GN5 A;  3G71 A;  2PI2 A;  4JI6 Q;  3RR5 A;  4LF6 L;  4DV6 L;  1WYD A;  1QVF A;  1YJN A;  5C3E G;  1X3F A;  2IX0 A;  2KCT A;  2IHE A;  1VQO A;  4JI0 Q;  1E24 A;  2YTV A;  3J80 c;  3CME A;  4XIG S;  3I4N H;  4DV2 L;  2MO1 A;  2ZTE A;  4IFD G;  3EIV A;  4IPH A;  2UXC Q;  5C0X G;  1Q8K A;  3UDF A;  1BVS A;  2VUM H;  4BY7 G;  1EQR A;  4A3B G;  4DKA C;  3M4P A;  1T9H A;  1HNX Q;  1X56 A;  5GAG C;  4YCV A;  3KF6 A;  1K83 H;  4JC0 A;  4OON A;  3K7U C;  4DR2 Q;  2AHO B;  5GRO A;  3CW2 C;  2JA7 G;  3L0O A;  2B3G A;  3F2C A;  1GM5 A;  1HNZ Q;  2JA6 H;  4QGU A;  2JA5 H;  3W1B A;  2R7Z H;  1KRS A;  3HOV H;  4DR4 Q;  1OXV A;  4LF8 L;  3AFQ A;  1Q81 C;  1UWV A;  4LF4 L;  3CXC A;  1S40 A;  4PZ7 A;  1SFO H;  4Y7N H;  4JI4 Q;  4POF A;  3HKZ G;  1E1T A;  3G48 A;  1PYS B;  5DLQ E;  4DR3 Q;  2ID0 A;  4A3I G;  4OX9 L;  5IP9 H;  3CAM A;  2GN5 A;  1IBK Q;  2R93 G;  3M7N A;  3JAM i;  1VQI A;  4J15 A;  3HOZ H;  2E8G A;  4GN3 B;  1AE2 A;  1N32 L;  4GLA C;  2HIX A;  5FJ8 H;  4X64 L;  4PMW A;  4LFA Q;  4MTN A;  4JYA Q;  2LXJ A;  4HJ8 A;  4AQY L;  2JA8 H;  3BU2 A;  1PH5 A;  1KL9 A;  4NB3 A;  1XPU A;  1FVI A;  3FKI G;  1BBU A;  1JE5 A;  4BY1 G;  3PIP A;  3CCM A;  4DR5 Q;  2DUD A;  2HHH L;  1A0I A;  4JI2 Q;  4GOP B;  4IPG A;  3UDI A;  4BBR H;  1HZ9 A;  1EYG A;  3F8T A;  4TQU S;  2NVQ H;  3D0F A;  1YIJ A;  1YHA A;  2CWA A;  3PF5 A;  4LF7 L;  4DUZ Q;  3PO3 H;  4LFB Q;  4GLV B;  1PH8 A;  2EQS A;  3KJO A;  3RZD H;  1VQ7 A;  1TXY A;  5JJK A;  4OWT B;  1PA6 A;  5IYD G;  1K8G A;  1K73 C;  4DV7 L;  4KLK A;  4DR6 L;  1X3G A;  3J81 c;  4A3F H;  4C3J H;  2CWP A;  4MNO A;  2Q2T A;  1SLJ A;  2Q2H A;  2VQE L;  4L5R C;  4JI8 Q;  4JOI C;  3S24 A;  1LYL A;  1TWG H;  5IP7 G;  5C3E H;  1WJJ A;  1A63 A;  2UUA Q;  1HNW Q;  1VQE A;  4X65 Q;  4YCU A;  1Q7Y C;  1I50 H;  4JBM A;  3I4N G;  2K4K A;  3ULJ A;  1VQM A;  2R6G A;  2UXB L;  2Y0S E;  3OTO L;  5LMU L;  3T1H L;  1KQS A;  1XMO Q;  3K80 C;  5H1S E;  4A3B H;  4JG2 A;  1XPO A;  1B70 B;  2NVY H;  2A19 A;  3K8A A;  4JI6 L;  4NPS A;  4OO1 G;  2OTJ A;  1PH4 A;  4B3R L;  1D7Q A;  1PH1 A;  2Y0S G;  2Q2U A;  1KRT A;  2JA6 G;  1N33 Q;  3M4O H;  2D0P A;  4IJH A;  1FJG Q;  1B7Y B;  3AYH B;  3HOV G;  2K75 A;  4L5T A;  2WAQ G;  2R7Z G;  4JBW A;  1H95 A;  1VQ8 A;  1E1O A;  5JEA J;  4C3H H;  4DV5 Q;  2AWO A;  4A3M G;  3E9I A;  1IL2 A;  4GKJ Q;  2UUB Q;  1UE1 A;  1XMQ Q;  2D62 A;  2CCZ A;  1HR0 L;  4A3I H;  1VQF A;  2VY3 A;  4KHZ A;  3HOW G;  4RMF A;  2VZA A;  4DUY Q;  2R93 H;  2MNA A;  4R4Q A;  1W2B A;  1Y14 B;  5FLM G;  1RIP A;  2RCN A;  4JI5 L;  2JJQ A;  3HOZ G;  2E2H H;  1WI5 A;  3EBE A;  4P75 A;  2IX1 A;  4DR4 L;  1G51 A;  3TQY A;  1QZH A;  4UP9 A;  2HT1 A;  4HJ7 A;  1N8R C;  1Y1W G;  4NXN Q;  3CC4 A;  2JA8 G;  2D0O A;  4DR1 Q;  4YWM A;  4DV3 L;  3IRB A;  4B3M L;  3OW2 A;  2N78 A;  4A3G G;  3FKI H;  2PI2 E;  4IFD I;  3CCL A;  2A1A A;  4IO9 A;  1VQH A;  1A8V A;  5C0X I;  1UEB A;  4JOI A;  5C4J H;  1IBK L;  4JBJ A;  2E2J H;  5JJL A;  3CC2 A;  1DGS A;  4EX5 A;  1P16 A;  2LXK A;  2KBN A;  5M3M G;  1IBM L;  1NBW A;  4R4C A;  2E5L Q;  3B6Y A;  4AH6 A;  4QJF A;  2AKW B;  3A74 A;  3PV0 A;  5IYD H;  2AMC B;  4YHH L;  4K0K L;  3GDE A;  3NEL A;  4A76 A;  1QUQ B;  2CFM A;  2I5M X;  3DLL A;  2OCE A;  4B3T L;  2EIF A;  4DK3 C;  3ULP A;  3STB D;  4GLX A;  3S15 H;  4IFD J;  4QY7 A;  5IP7 H;  4AYB E;  2C35 B;  2IT1 A;  5C0X J;  3RN5 A;  2UU9 Q;  2ZM6 Q;  4BBS H;  1PH9 A;  1UE7 A;  1EOV A;  3F1Z A;  2JEB I;  5IT9 c;  4EQ5 A;  1VQ6 A;  1UE6 A;  3LGJ A;  3E0E A;  3G4S A;  1VCI A;  2UXD L;  4POG A;  4DUZ L;  4LFC Q;  1XNQ Q;  1M1K C;  3U50 C;  4AYB G;  3PUY A;  3S1Q H;  3F2D A;  1OTC A;  1SRU A;  1YJ9 A;  4KHP Q;  2LSS A;  4OWW B;  5HY6 A;  2MO0 A;  4B3S Q;  2KEN A;  1YNX A;  3SGI A;  1GD7 A;  5GAH C;  3CCS A;  3HKZ E;  4DV4 Q;  4X6A H;  1LM0 A;  3GTK H;  1VQ9 A;  3TS2 A;  5ELO A;  4NXM Q;  2JA9 A;  3Q8D A;  3K81 C;  1TWA H;  4JI1 Q;  4A3M H;  1TWH H;  1JT8 A;  1LTL A;  1E3P A;  2B29 A;  1QUQ A;  3UDG A;  3OYY A;  4R1J A;  2I0Q A;  2N3S A;  5IWA Q;  3HOW H;  1N36 L;  4O2D A;  4DAM A;  4JV5 Q;  2I5L X;  1V43 A;  1L1O C;  2KCM A;  3BZK A;  3M4Q A;  3H3V I;  5FLM H;  3S1R H;  5IYC G;  4R4I A;  2ZJQ A;  2ATW A;  2I5H A;  4YY3 L;  1Q82 C;  1TWF H;  1X54 A;  1ASY A;  2K52 A;  4QL5 A;  3HOY G;  2RHS B;  1YJW A;  4LF9 Q;  3AFP A;  4C3I H;  1Y1W H;  4HJ5 A;  1QZG A;  1VQP A;  3CMA A;  1V1Q A;  3CC7 A;  1YI2 A;  5AJ3 L;  1YIT A;  3DM3 A;  2JE6 I;  3PF4 A;  5EAY A;  3UE0 A;  1XMQ L;  4A3G H;  1EIY B;  2OQ0 A;  4HJ9 A;  4DV0 L;  1EWI A;  2VQF Q;  4DUY L;  2NZO A;  1YVC A;  1L1O B;  1XJV A;  4JI3 L;  4C2M H;  3CCJ A;  2R7D A;  1CKN B;  3J7Z C;  1X9N A;  1VQ5 A;  5M3M H;  2K50 A;  5BR8 Q;  1WOC A;  1R9T H;  2ZJP A;  1NMF A;  4A3C H;  3A5U A;  4OO1 I;  2KHI A;  2RHQ B;  1HJP A;  2L15 A;  4A93 G;  4LF5 L;  1YZ6 A;  2UUC L;  3T1Y Q;  1EQQ A;  3J7A 5;  2V1C C;  3ULL A;  4DR1 L;  1WFQ A;  4LW1 A;  2Q2I A;  4A3E H;  1YEZ A;  1IYJ B;  2RF4 A;  4IPD A;  4BBS G;  1OXT A;  1OXX K;  1OXS C;  4BA1 I;  1KC8 C;  4IJL A;  2ZTC A;  3UE1 A;  4A3J G;  2NVT H;  3ICE A;  3F2B A;  5M5Y H;  1QVG A;  3U4V A;  2E5L L;  3STB C;  3S1M H;  5C4X G;  1JJC B;  2WAQ E;  1J5E L;  3M9B A;  3I7F A;  1NTG A;  1MIU A;  1G6P A;  1B8A A;  1L1O A;  1ASZ A;  1VQN A;  2R7F A;  1CKN A;  3K7A H;  2ASB A;  3NEN A;  1PYB A;  2UU9 L;  4JI0 L;  3G6E A;  2N8N A;  2MQH A;  4LUZ A;  4JI7 Q;  1PH7 A;  1C0A A;  1YHQ A;  3PUX A;  4WJ4 A;  4R4O A;  1WCM G;  4YWL A;  3KJP A;  2EXD A;  2GVA A;  4LF8 Q;  1XNQ L;  1KD1 C;  3KF8 B;  3PUZ A;  4LF4 Q;  1TWC H;  3MXN B;  2UXC L;  1HH2 P;  4A3D H;  3GTL H;  3JAM c;  3MEF A;  2N49 A;  3J80 i;  4DV1 Q;  4KHP L;  5J3B A;  1HNX L;  3GTP H;  2CKZ B;  4WJ3 M;  4DAY B;  2HQL A;  1GKH A;  5IYC H;  4DR7 Q;  4HIK A;  4DR2 L;  3I55 A;  3JC6 6;  3HOU G;  4DV4 L;  1HNZ L;  4KI0 A;  1PVO A;  1J6Q A;  3HOY H;  3EN2 A;  1V9P A;  2OTL A;  4UP8 A;  1K8A C;  3HOX H;  2IY5 B;  1D8L A;  3HFZ B;  3GTM H;  2NVX H;  4X64 Q;  1I3Q H;  2BA0 A; 
#chains in the Genus database with same CATH topology
 1U0L A;  1STA A;  1WD1 A;  3TP5 A;  2RSN A;  1D1K A;  5E7N A;  1NY4 A;  2P5Z X;  1QG7 A;  4QUF A;  1ESF A;  3M85 A;  2WP8 J;  5GQO A;  1Q86 C;  2K01 A;  3TRZ A;  1NCV A;  4A93 H;  1A3V A;  1I6H H;  5LMN Q;  2F0M A;  3I4M G;  2QGQ A;  1EZ8 A;  5C5L A;  5CC4 A;  5LL6 S;  5ELE A;  3RNU A;  1IYU A;  4NW2 A;  1K0R A;  4A3J H;  4L8J A;  3OPO A;  5BR8 L;  2BOS A;  4IAL A;  4QQB X;  2ALY B;  4FXG C;  1TQO A;  5HUR A;  1B50 A;  1G6Z A;  1PTO H;  3CHB D;  1MKH A;  2L1B A;  2Z6K C;  2EE1 A;  2BE5 C;  4X66 Q;  3HOX B;  1PV4 A;  2UUA L;  2QDL A;  4B3R Q;  3MFG A;  1U4P A;  2BA1 A;  2F0Q A;  3DMU A;  1ZYR D;  1KNA A;  1A2T A;  1RJT A;  3GD7 A;  1XMO L;  4FDB A;  1BXT A;  1HXY D;  4LK1 C;  1NR2 A;  5D14 A;  1HR0 Q;  1Q46 A;  2FMM A;  3CQZ H;  3S1N H;  4HID A;  2MUY A;  1JWM D;  1PMR A;  1N33 L;  1FJG L;  4JBK A;  2RDG A;  1I6H B;  4JI5 Q;  3HOX G;  3VDY A;  3J7A V;  5T1G A;  1SN8 A;  3RUZ A;  1CA5 A;  1LT5 D;  2WV6 D;  3CCR A;  4OWX B;  1AZQ A;  5M5X H;  4JPB W;  5DM6 3;  3BVM A;  1MJC A;  3E9H A;  2YTX A;  5JJZ A;  3D4D A;  2KOL A;  5JAV A;  1RDP D;  3CKI B;  4B9W A;  5IYB G;  5ISR A;  4I7A A;  4X62 Q;  1ILP A;  2SDF A;  4CHT B;  4K0K Q;  2MP1 A;  2Z6K A;  3ONA B;  4A75 A;  1EWC A;  1EFW A;  1QWY A;  1SSO A;  1JWS D;  3PGZ A;  4IN3 A;  3R8B A;  4F88 A;  3MWY W;  4GS3 A;  4G7H C;  4LF6 Q;  4DPG A;  2ZTD A;  4CDE C;  4QIW E;  5IE8 A;  1CUK A;  3GTQ H;  1ZKO A;  3PCO B;  1SE8 A;  1I4R A;  3E0J A;  3CP0 A;  5KEE A;  1SMX A;  1YHB A;  4CJ2 C;  5M5W H;  1PDQ A;  4LNQ A;  4KKU A;  3RLO A;  1K83 B;  1EU3 A;  3Q23 A;  3DWA A;  5KND A;  4DNR B;  2ZM6 L;  2JA5 B;  3UDX A;  5J22 A;  2NYZ D;  5T1I A;  5FK9 C;  5K36 G;  5M5X B;  3A0J A;  3CCV A;  4LFC L;  1SFO B;  2JN4 A;  1MSH A;  3KDF B;  3A54 A;  5M3F H;  1LAB A;  1EQV A;  3K6O A;  3TP7 A;  1N36 Q;  4BY7 H;  4B3S L;  4KKS A;  4CDD C;  5IGB A;  1BCP D;  2KCC A;  1STY A;  4J6H A;  1RL2 A;  1KDA A;  2YV5 A;  4YCW A;  4YY3 Q;  2JA7 H;  4NXM L;  5CGK A;  4GN4 B;  2VL6 A;  2O4X A;  2JA5 G;  3IFD A;  2EYP A;  4FF3 A;  2PQA A;  2K5D A;  5EPL A;  3TBI B;  4ABN A;  1XNR L;  1VF7 A;  3GTQ B;  1G29 1;  2PNR C;  3PO3 B;  4MHE A;  5M5W B;  3E5S A;  1NJI C;  2AWN A;  2PO4 A;  4DU9 A;  5FJ8 G;  1FD7 D;  1S5E D;  5C3X A;  2WFW A;  5ELC A;  4A3F B;  4DV7 Q;  3HP3 A;  2UUC Q;  2K5N A;  1AE3 A;  3J81 L;  2KUM A;  5C3E B;  1CFM A;  3DWP A;  2IHF A;  4KJO A;  1JB7 A;  3PO3 G;  4BY7 B;  1LUZ A;  4ZAI A;  4A3B B;  1M90 C;  3E6Z X;  4OHJ A;  4OIJ A;  3VA5 A;  3S16 H;  2JA7 B;  4A3F G;  3S2D H;  3W5O A;  4GN5 A;  3D8G A;  3MFY A;  4M8A A;  1YJN A;  3VR3 A;  5C3E G;  2IX0 A;  2F0K A;  2MO1 A;  2L0C A;  4IFD G;  5BN3 A;  2UXC Q;  4RCO A;  5C0X G;  3UDF A;  4BY7 G;  4A3B G;  4DKA C;  1D2B A;  1T9H A;  1K3B C;  2EYH A;  2E2H B;  1LT4 D;  2K05 A;  2K03 A;  4CDC C;  3K5M A;  2JA7 G;  2JSO A;  2VUM H;  4DFA A;  1GUN A;  2R7Z H;  3W1B A;  2RA4 A;  3K5L A;  1SE2 A;  3NQI A;  1OXV A;  3L9A X;  1GJX A;  1Q81 C;  3CXC A;  3VYU A;  4KD3 A;  4JK1 C;  4DAV A;  1RHP A;  1SMY C;  5C4J B;  4KK7 A;  4N8F A;  5IP9 H;  3M7N A;  3HRZ C;  1VQI A;  1BNZ A;  4H0L C;  4ZQ3 A;  4GN3 B;  1N32 L;  2SEB D;  4OIK A;  1EYD A;  4MTN A;  1JOK A;  2LXJ A;  2JA8 H;  1AN8 A;  1PH5 A;  1BCP B;  1XPU A;  2DUD A;  4CDF C;  4ZKB B;  1QIL A;  1EYG A;  1HZ9 A;  3F8T A;  4TQU S;  5IT9 L;  1JC7 A;  4KMU C;  4LF7 L;  1H9S B;  3S1Q B;  3IFT A;  3DHQ A;  2CH4 A;  4GLV B;  1TXY A;  1K73 C;  3J81 c;  4ILW A;  2VQE L;  2K33 A;  2R7Z B;  1G2T A;  1A63 A;  2UUA Q;  2JXM B;  2SOB A;  4A3M B;  4YCU A;  3HOW B;  4R8N A;  3T1H L;  4H44 C;  1XMO Q;  1LTG D;  1ROD A;  3PQI A;  3K80 C;  5H1S E;  1HA6 A;  4JG2 A;  3J7A F;  1JCK B;  1E2W A;  4NPS A;  1LTR D;  3BYY B;  1N33 Q;  2D0P A;  1Y1W B;  1FJG Q;  2R7Z G;  1GHK A;  3LWE A;  2JA8 B;  2PW5 A;  3OSO A;  1VQ8 A;  5JEA J;  4A3M G;  4C3H H;  3G6J B;  1S5D D;  1UE1 A;  1XMQ Q;  4A3I H;  1VQF A;  1STG A;  3HOW G;  1LO5 D;  4DUY Q;  4IUP A;  5M3M B;  4PNY A;  2RCN A;  3KBX A;  4PQX A;  2JJQ A;  2ZT9 C;  3IKJ A;  4RGN A;  1AW7 A;  4XT1 B;  4HJ7 A;  1Y1W G;  5E4X A;  3CC4 A;  2JA8 G;  4K2K A;  4YWM A;  3OW2 A;  1SYG A;  2PI2 E;  4FVM A;  2A1A A;  2F4I A;  1A8V A;  1IBK L;  4I7Z C;  4JBJ A;  2E2J H;  2A68 D;  3CC2 A;  4HMI A;  1P16 A;  4C56 C;  1AZP A;  5M3M G;  1IBM L;  3OMG A;  3MXN A;  3A74 A;  2MGS A;  3NSW A;  3V2T A;  3D6W A;  2I5M X;  2QW7 A;  3ULP A;  3S15 H;  5COY A;  2L12 A;  4AYB E;  1LTB D;  4BBS H;  2ZM6 Q;  1EOV A;  3F1Z A;  2JEB I;  4LMQ D;  5IT9 c;  2Z9H A;  3E0E A;  3KLS X;  2UXD L;  4POG A;  4LFC Q;  1DON A;  1FGB D;  3A8I E;  3PUY A;  3Q24 A;  3F2D A;  4OWW B;  5HY6 A;  1DYQ A;  2Z8L A;  4K8J A;  4B3S Q;  1EIG A;  2KEN A;  3SGI A;  1GD7 A;  5CMD A;  3HKZ E;  4X6A H;  1LTI D;  1LM0 A;  3TS2 A;  1CK1 A;  2A74 C;  4NXM Q;  2JA9 A;  1MGS A;  1TWA H;  1SNC A;  2X6G A;  4HTH A;  2NTS A;  5IWA Q;  3AB9 A;  4RHR A;  3HZX A;  3MHB A;  4NP5 A;  4DAM A;  2EYO A;  1EY6 A;  3BZK A;  5EBC A;  3M4Q A;  1WTX A;  4L6T B;  4LAA A;  2HCI A;  3H3V I;  5FLM H;  1CHQ D;  2ATW A;  4R4I A;  2F0T A;  2EDG A;  2XN9 C;  3K58 A;  4MTK A;  2K52 A;  1PTO F;  1U9R A;  1YJW A;  4C3I H;  3CMA A;  1V1Q A;  1CHP D;  1V8Q A;  1YIT A;  3C2P A;  3DM3 A;  2JE6 I;  1SNQ A;  1EIY B;  1F2M A;  4BBS B;  4HJ9 A;  4X3K A;  4DV0 L;  1XWE A;  1BR9 A;  1II3 A;  1CKN B;  1X9N A;  4A3C H;  1SAP A;  1XTC D;  2K50 A;  4RFB A;  1R9T H;  1NMF A;  4OO1 I;  4IZ8 A;  1EFI D;  4RGM A;  1F9R A;  1TKW B;  4DR1 L;  4LW1 A;  2CH4 W;  1E2V A;  3C46 A;  2RF4 A;  3EA6 A;  1TWA B;  1WCM B;  3NE5 B;  2LMC B;  4KHV A;  5G3L F;  4BBS G;  3P1H A;  1OXS C;  4IJL A;  2ZTC A;  1D5X C;  1QVG A;  4RHS A;  1JJC B;  1O80 A;  3HS0 C;  5ELB A;  3D4R A;  1G6P A;  1ASZ A;  2O5I C;  1SYE A;  2J7Z A;  4C3I B;  2X69 A;  4JI0 L;  5BN4 A;  5IGE A;  4JI7 Q;  1PH7 A;  3PUX A;  1WCM G;  3KJP A;  1ONL A;  3I4L A;  2R3Z A;  1XNQ L;  1KD1 C;  3A7A B;  3S2H B;  1TWC H;  1HH2 P;  1SE4 A;  3J80 i;  5J3B A;  2G9D A;  4DR2 L;  5NUC A;  1HNZ L;  3EN2 A;  2OTL A;  1SEB D;  4C3I G;  3GTM H;  1E0B A;  2NVX H;  3M4Y A;  2R92 B;  2F0L A;  2IX3 A;  3RZO B;  4DXG A;  3KLW A;  3FVQ A;  4WOR A;  1IBL Q;  2K14 A;  4IQZ A;  4A3L G;  3G7L A;  1L0W A;  4A3C G;  4X3S A;  3S14 H;  1FNW A;  4LF9 L;  4LF7 Q;  1CI3 M;  2IL8 A;  4AIM A;  5C4H A;  4ALP A;  3FPP A;  4JYA L;  2F1M A;  1IW7 C;  1ILQ A;  2WB1 E;  1GHJ A;  3RD4 A;  3I4O A;  4GNX C;  2KCN A;  2R92 G;  1PXU A;  3I3C A;  4LWC A;  1YNJ D;  3RN2 A;  2RSO A;  1LT6 D;  1X55 A;  4HIM A;  3J81 E;  1P8L A;  4APV A;  4LFB L;  3QOJ A;  5C4X H;  3T1H Q;  1PZK D;  5CR3 A;  5EKK A;  3V96 A;  1HQM C;  1BKB A;  2LKV A;  4PMB A;  2PNH A;  1HNW L;  2NVX B;  1GUG A;  4KKT A;  2B63 H;  3CCU A;  3H0G H;  1VQL A;  2XTI A;  3C1E A;  4KY6 A;  3NBH B;  5I4D A;  3BJU A;  3W2D A;  2EPB A;  1N34 Q;  1B53 A;  1K9M C;  4NDX A;  3P20 A;  4DV5 L;  4I65 A;  3DXJ C;  3ND8 A;  3J81 j;  5I9P A;  1HZB A;  2YYZ A;  1EY5 A;  5A2Q E;  1CM9 A;  4GNX A;  2LY7 A;  1IKM A;  4IUV A;  3IL8 A;  1TR5 A;  1MBY A;  2KVM A;  4UPA A;  4DR7 L;  1PH3 A;  4XDX A;  4PZ6 A;  2VNU D;  2FXQ A;  3TEH B;  5ELN A;  1IBM Q;  3I4M H;  1CSQ A;  2F0W A;  2G5D A;  2MHV A;  4UAI A;  2WII B;  4DV6 Q;  3X3N A;  5CV4 A;  2B63 B;  1HUN A;  2HUG A;  3H0G B;  2BH2 A;  1IHZ A;  1CKO A;  2OWO A;  1EWH A;  2EY1 A;  2O5J C;  4MIU A;  2UXD Q;  4RWS C;  1CTM A;  4YWK A;  1GXD C;  1A62 A;  1TS4 A;  5JVG 3;  1YBY A;  3NP8 A;  2C5C A;  1NE3 A;  2RBM A;  1B4O A;  3I8Z A;  3RLF A;  1F2Z A;  1V1O A;  3CPW A;  2B63 G;  2A69 D;  4HJA A;  4UP7 A;  2Z1C A;  2B39 A;  3H0G G;  1VQA A;  2OQK A;  3NWT A;  1WD0 A;  1PH2 A;  2PMZ B;  1Z47 A;  4Y52 H;  3Q22 A;  5I6W A;  2F0J A;  5AFW A;  4OX9 Q;  1XTD A;  1TY0 A;  1EY0 A;  3CPF A;  1DOM A;  4RGO S;  3NQT A;  5D65 A;  1O7I A;  1A15 A;  1W3S A;  1CT1 D;  5JOB A;  1GO3 E;  2Z0S A;  1DM0 B;  4JV5 L;  2F0E A;  2HHH Q;  1HFN A;  3WDN A;  4DV0 Q;  3GQB A;  3PIP 3;  1QVC A;  2CQO A;  2QEJ C;  3I2Z A;  4M1U B;  2BH8 A;  4ZUI A;  3AQQ A;  5IYB H;  1JJG A;  2JQO A;  3RZD B;  1RTN A;  2HD3 A;  4DR6 Q;  5JJI A;  1FNU A;  3GO5 A;  4BWG B;  5GAD C;  5CV7 A;  3FHW A;  1TWG B;  1HQR D;  4BY1 H;  1Q3L A;  1I94 L;  2KQ3 A;  1VQD A;  1LTT D;  5ELD A;  3NUC A;  1EIF A;  4ID6 A;  3GTJ H;  5IGF A;  4HIO A;  1NSN S;  4OXP A;  3OTO Q;  1PHJ A;  2H5X A;  3T1Y L;  2ZJR A;  5COR A;  3H3V H;  3AEV A;  4U67 3;  3OWE B;  5DM7 3;  4K6D A;  1OXU A;  2NN6 I;  3SK4 A;  2KHJ A;  1W6J A;  1QVF A;  5K36 H;  1EYC A;  1B44 D;  2IHE A;  4JI0 Q;  1BO0 A;  3CME A;  1TT2 A;  4XIG S;  2M9V A;  3U9S A;  4DV2 L;  3HKZ B;  4NMZ A;  4IPH A;  1Q8K A;  1BVS A;  4O1N A;  3HEJ A;  1EQR A;  1QCB D;  1UUP A;  5GAG C;  3KF6 A;  1K83 H;  4OO1 H;  1UNS A;  4CKC A;  3K7U C;  4DR2 Q;  2AHO B;  1HNZ Q;  1GM5 A;  2JA6 H;  5IOD A;  4QGU A;  2JA5 H;  1KRS A;  4RKB A;  4DR4 Q;  1FNV A;  4LF8 L;  4LF4 L;  4BY1 B;  5K5P A;  1SFO H;  4XYO A;  3OMC A;  1I4X A;  3HKZ G;  4FXK C;  1E1T A;  2ID0 A;  2CHB D;  2XVS A;  4QMG A;  4RCN A;  3GTJ B;  2Q8I B;  1B3A A;  2E8G A;  4IUU A;  1AE2 A;  4DN4 M;  3K57 A;  4GLA C;  2HIX A;  5FJ8 H;  2ICE C;  1WVL A;  4JYA Q;  3BU2 A;  4DF7 A;  4BY1 G;  1BBU A;  3PIP A;  4GOP B;  3LX0 A;  4IPG A;  2NVQ H;  1AP0 A;  1ENC A;  3BG3 A;  1X3P A;  3D0F A;  1YIJ A;  1PYW D;  4EQP A;  2XIW A;  2OF1 A;  4DUZ Q;  3PO3 H;  4LFB Q;  2FMC A;  2EQS A;  3KK7 A;  3FDT A;  1VQ7 A;  4OWT B;  5JJK A;  5IYD G;  4KLK A;  5A35 A;  4KY5 A;  2RDH A;  4A3F H;  4MNO A;  2JA6 B;  2F0H A;  3S24 A;  5IP7 G;  2KED A;  2PYK A;  5C3E H;  5J39 A;  1HNW Q;  1VMP A;  1Q7Y C;  2C9O A;  1NAP A;  2K4K A;  4K2L A;  3ULJ A;  4IFD H;  2UXB L;  1JQY D;  2Y0S E;  5LMU L;  5C0X H;  1WTP A;  3R93 A;  4A3B H;  4HSV A;  2Z6B A;  1B70 B;  2A19 A;  4ULL A;  4JI6 L;  4OO1 G;  2OTJ A;  2DY8 A;  3O13 A;  1PH1 A;  2Q2U A;  2JA6 G;  3M4O H;  1NR4 A;  2EY6 A;  3AYH B;  2K75 A;  4U68 A;  1E1O A;  4DV5 Q;  1CA6 A;  2AWO A;  3E9I A;  2B2Y C;  3NTI A;  1XXG A;  2D62 A;  2VY3 A;  4KHZ A;  4RMF A;  2NVQ B;  2PZU A;  1HUM A;  1Y14 B;  1RIP A;  1PRT C;  2E2H H;  1WI5 A;  3EBE A;  4P75 A;  1LV9 A;  5EJW A;  1SE3 A;  3KLS A;  1XX8 A;  3IRB A;  4B3M L;  2N78 A;  3DWQ A;  2A6H C;  4IO9 A;  1VQH A;  5C4J H;  2NVT B;  1GUW A;  4CJ0 B;  5JJL A;  4G7O C;  4EX5 A;  3KLR A;  1DCZ A;  3V05 A;  2E5L Q;  1LAC A;  3K59 A;  3PV0 A;  3U9O A;  3GDE A;  4DXF A;  4A76 A;  1KDC A;  1KAB A;  4B3T L;  4DK3 C;  3STB D;  3M4O B;  4IFD J;  4QY7 A;  1HHV A;  2IT1 A;  4CJ1 B;  5C0X J;  3RN5 A;  2XSC A;  4EQ5 A;  1VQ6 A;  4XQJ A;  2VXW A;  2HDL A;  3U50 C;  3S1Q H;  1OTC A;  1SRU A;  3JAM L;  1YJ9 A;  4KHP Q;  2F0U A;  3SR1 A;  1YNX A;  1A2U A;  2AQ3 B;  5GAH C;  2KHS A;  5ELO A;  3BDO A;  1ET6 A;  4V0B A;  3TP6 A;  3K81 C;  4A3M H;  2B29 A;  1E3P A;  2WKD A;  1QUQ A;  3UDG A;  2N3S A;  1TU2 B;  1DJR D;  3HOW H;  1RCV D;  4JV5 Q;  4TRD A;  2KCM A;  5FLX L;  2F4V L;  2I5H A;  3BDC A;  1TWF H;  2B2V C;  4QL5 A;  1TII D;  4K8I A;  1Y1W H;  4HJ5 A;  3VYT A;  1JOO A;  3CC7 A;  2HDM A;  3T16 A;  3FRP B;  3DM1 A;  3UE0 A;  1I4P A;  4Q5V A;  2OQ0 A;  2NUC A;  2LS0 1;  2EJF C;  2E76 C;  2NZO A;  1YVC A;  1L1O B;  3J7Z C;  5M3M H;  5BR8 Q;  1SJE D;  1WOC A;  2ZJP A;  5C4Z A;  2XWJ B;  1MHW C;  3LWU A;  2L15 A;  1ICW A;  1YZ6 A;  3T1Y Q;  1EQQ A;  3J7A 5;  1IYJ B;  4RAU C;  1OXX K;  2BE5 D;  4XQN A;  1KC8 C;  1O7Y A;  1BUV T;  3ICE A;  2BDN A;  1HFG A;  3J80 L;  3T56 B;  1JIC A;  4ZCK A;  2KJX A;  2WAQ E;  1J5E L;  3I7F A;  4CKB A;  3HOU B;  1I4Q A;  1TWF B;  5KNC A;  2I07 B;  2ASB A;  4CKE A;  3NEN A;  2UU9 L;  2B2V A;  1JWU D;  1F2L A;  2MQH A;  1SXT A;  2N8N A;  1C0A A;  4WJ4 A;  4YWL A;  3F2U A;  1WTH A;  4LF8 Q;  1G2S A;  1RKN A;  3PUZ A;  4LF4 Q;  4A3D H;  3JAM c;  3MEF A;  2N49 A;  5FO7 B;  3D6C A;  4RA8 A;  2QIL A;  4DAY B;  5C6A A;  4TKO B;  3HOU G;  4DV4 L;  5IGD A;  4KI0 A;  2DJF C;  5FO8 B;  2MPM A;  2NTT A;  3PO2 B;  1MD2 D;  3HFZ B;  2E75 C;  2NN6 H;  1I3Q H;  4A4I A;  1EY8 A;  2ENB A;  1GOZ A;  3ERQ A;  4N8X 1;  1ML0 D;  1SNO A;  4GKK Q;  2F0N A;  2B8G A;  3OIQ A;  2IPK D;  2YTY A;  2PPB C;  1CSP A;  2KA7 A;  1STN A;  5JEA G;  3SK8 A;  3KF8 A;  3I72 A;  3KFU A;  1LTS D;  4K5V A;  3H15 A;  2JEA I;  3PO2 G;  1N9W A;  4DR5 L;  3SEB A;  1EOT A;  4KJN A;  3NEM A;  3NPP A;  4A3D B;  3AMU A;  5KRU A;  2UXB Q;  5LMU Q;  3OHX C;  1GUT A;  1JJ2 A;  2IJ0 A;  1VQB A;  1UE5 A;  1HZA A;  4JI8 L;  2H4O A;  1X3Q A;  4UHV A;  2MJ8 A;  4X65 L;  1CQF A;  3J81 i;  1I3Q B;  1WCM H;  1JB3 A;  3A5Z B;  1S5C D;  3A55 A;  3RMH A;  1HZC A;  4B9X A;  3MXP A;  1HA5 A;  2B2U C;  4A3D G;  1Z6H A;  1XNR Q;  3MVV A;  3P7J A;  1C8C A;  2H1E A;  2A5H A;  3I70 A;  3H3V C;  1TVX A;  5CBA E;  2EY2 A;  3MTS A;  4ZRZ A;  2PW7 A;  4GKJ L;  4A3K B;  1C4Q A;  1KLG D;  2NN6 G;  2E2I B;  2YU9 H;  1F9S A;  3S2H H;  1EQT A;  4DV1 L;  4B3M Q;  2WAC A;  3D31 A;  3BS1 A;  1X65 A;  4BA2 I;  1Y1V B;  3WWV A;  4GOP C;  4E6I A;  4A3L H;  4KTA A;  4LUO A;  4P74 A;  4F8M A;  2EZV A;  2M2L A;  2JK8 A;  3EQL C;  5CBE E;  3ZJY C;  4QIW B;  2K5H A;  3R2T A;  2F3W A;  2B2W C;  3S17 H;  4BS9 A;  4A3K G;  1KLU D;  3PSI A;  2R92 H;  2HQE A;  2XGT A;  3RZO H;  4B3T Q;  1VS0 A;  5KIX A;  2EOT A;  1R4Q B;  4TVA B;  4R4T A;  1Y1V G;  4IPC A;  2NZH A;  1EY7 A;  3CCE A;  4ME3 A;  3TME A;  5LMN L;  1CKM A;  1Q12 A;  1E22 A;  2B2U A;  2JYO A;  2PCF B;  1K8M A;  2PQA B;  5HGQ A;  1DOL A;  4IUR A;  3MA2 B;  3KOJ A;  1NMG A;  4KD4 A;  2YU9 B;  4Y7N B;  4J8Q A;  1SDF A;  2K6A A;  2A73 B;  4ZK9 B;  4X66 L;  1YNN D;  4GOP A;  1ZYR C;  2F4V Q;  1SMY D;  2AQ2 B;  2I46 A;  1S72 A;  1X32 A;  1KHI A;  1PFS A;  4FF4 A;  2NWG A;  4JI1 L;  2F0O A;  3S17 B;  1I5F A;  1N32 Q;  2Z4I A;  4LUV A;  2WKC A;  2F0G A;  1PFM A;  2ZXP A;  1C7Y A;  4P71 A;  3CU7 A;  2OT2 A;  3KUP A;  2R61 A;  4BBR B;  4OEM B;  3DEP A;  1FR3 A;  1MJE A;  2XWB B;  2DNC A;  3KDF A;  1PZI D;  1ESR A;  1EEF D;  5CV9 A;  2AUK A;  4DK1 A;  3L2P A;  2VW9 A;  2VQE Q;  2VQF L;  1VQJ A;  3CF5 A;  1VQG A;  2HIV A;  1I4G A;  1SR3 A;  4F7X A;  4C1N I;  2L5T A;  1VQK A;  1CZW A;  4BBR G;  1G91 A;  2NBF A;  5J1Z A;  4HSP A;  1EY4 A;  3RLN A;  3KYH C;  1F9Q A;  2PZT A;  3PUW A;  2RDF A;  4X62 L;  2NVY B;  1J5E Q;  4DA2 A;  4RH6 A;  4UY8 C;  4IUN A;  4DNT B;  1SBB B;  3G71 A;  4LF6 L;  1X3F A;  3I4N H;  4R9W A;  2ZTE A;  1MI2 A;  4HN7 A;  1EYA A;  3EIV A;  1L0X B;  3VA7 A;  1DD2 A;  1FYC A;  4WFN 3;  2R93 B;  2J0T D;  4L63 B;  5BN5 A;  3NTK A;  1J9O A;  1T5X D;  1TS2 A;  3CW2 C;  3L0O A;  2B3G A;  3F2C A;  5DAU A;  3HOV H;  2QF7 A;  2Q8T A;  1LT3 D;  4XXE A;  3FKI B;  1BCP C;  3TZD A;  1PFB A;  4PZ7 A;  4CGY B;  4N9P A;  4POF A;  5E3F A;  1EL0 A;  1PYS B;  1KDB A;  1STH A;  3CAM A;  2GN5 A;  1IBK Q;  4WJW A;  2R93 G;  5C5M A;  2EXZ A;  3NWS A;  3MC0 B;  2D2C C;  1DXM A;  3T4A C;  4XQQ A;  4X64 L;  3N52 A;  4AQY L;  1RF2 D;  2Q8R E;  4NB3 A;  1A3U A;  1FVI A;  3FKI G;  3HGB A;  1JE5 A;  3OW7 A;  4IUT A;  3SK5 A;  4DR5 Q;  1IKL A;  1EU4 A;  3I4N B;  1A0I A;  3UDI A;  4C1N K;  3QIA A;  4ODG A;  4N9T A;  3PF5 A;  1H9M A;  1MSG A;  1PH8 A;  3EFX D;  3RZD H;  1HPC A;  5IT9 E;  4DV7 L;  1X3G A;  4C3J H;  2CWP A;  3I73 A;  1SLJ A;  1JOQ A;  2L11 A;  1CZG A;  2FJ2 A;  4JI8 Q;  3HOV B;  1TWG H;  2WAQ B;  2K32 A;  1WJJ A;  1VQE A;  2IW3 A;  4X65 Q;  3SHL A;  2KEE A;  1I50 H;  4JBM A;  4ZLT F;  3I4N G;  3K5N A;  3VR4 A;  3OOC A;  1VQM A;  2R6G A;  1M8A A;  2X6L A;  4H13 C;  1KQS A;  5LHY 1;  3A56 A;  1UAP A;  1XPO A;  2RCF A;  3K8A A;  1GUS A;  2V4D A;  4K5W A;  4HR7 B;  1D7Q A;  2F03 A;  4JVZ A;  1KRT A;  1H9S A;  3HOV G;  1SJH D;  1U4R A;  2WAQ G;  4YIJ A;  4A3G B;  4GKJ Q;  1PTO D;  3P75 A;  2CCZ A;  3VR6 A;  1PLF A;  4C2M B;  3T13 A;  1W2B A;  3NK9 A;  2DJG C;  3Q0A A;  2IX1 A;  1G51 A;  4UP9 A;  4C3J B;  2HT1 A;  2D9U A;  4TSS A;  3I91 A;  4DR1 Q;  4DV3 L;  1KNE A;  1C48 A;  4A3G G;  1D1I A;  4O42 A;  3CCL A;  1I50 B;  1H9K A;  1UEB A;  4KV6 A;  3TN2 A;  4AYB B;  5G3L D;  3S1M B;  1M4V A;  1NBW A;  1A3T A;  1HTP A;  2K5Q A;  5IYD H;  2AMC B;  4YHH L;  4C3J G;  4KN4 C;  3KBG A;  3C1F A;  2EIF A;  4DAY A;  4GLX A;  5I9O A;  5IP7 H;  5IIF A;  2A6E D;  1UE7 A;  3MXU A;  1UEA B;  4FF2 A;  2F0D A;  2SNM A;  4Q0F A;  4PV1 C;  1XNQ Q;  3GTL B;  1M1K C;  1KTK A;  4AYB G;  3C3L A;  4MN3 A;  1Y8N B;  4DAP A;  1PZJ D;  2RQX A;  1JOR A;  3HOY B;  3CCS A;  1VQ9 A;  3TP8 A;  3GV3 A;  1G8Z D;  4JI1 Q;  3GTO B;  2I0Q A;  3OYY A;  4R1J A;  1TS3 A;  1U4L A;  4O2D A;  1RD9 D;  1Y8P B;  4GZY C;  1I6V C;  5IYC G;  2ZJQ A;  1ENA A;  1Q82 C;  4EQN A;  1X54 A;  1ASY A;  4A93 B;  5CV8 A;  4QF4 A;  3HOY G;  3HG9 A;  2PZW A;  4LF9 Q;  3T51 B;  3ITP A;  3EJI A;  5CV6 A;  2D5D A;  1HCZ A;  5AJ3 L;  3PF4 A;  5EAY A;  1XMQ L;  2EYJ A;  2VQF Q;  4DUY L;  4A3J B;  1IW7 D;  4H7B A;  1XJV A;  4JI3 L;  3CCJ A;  1VQ5 A;  3A5U A;  1PTO B;  2RHQ B;  4A93 G;  4LF5 L;  2RVL A;  2V1C C;  2F0F A;  2HCC A;  3ULL A;  1WFQ A;  2Q2I A;  1VF5 C;  3M7G A;  4RGT A;  2A68 C;  4A3E H;  1IL8 A;  1YEZ A;  4IPD A;  1WTQ A;  2DNE A;  1BBX C;  2LFN A;  1TS5 A;  3K5O A;  4A3J G;  2NVT H;  1F2Y A;  3QR8 A;  1SNM A;  5M5Y H;  4FF1 A;  3U4V A;  1L0Y B;  2FFK B;  3M9B A;  4HAE A;  5DEH A;  3SDZ A;  5KGU A;  3CQZ B;  2B2T C;  3S1N B;  1B8A A;  4EQO A;  1VQN A;  3TDQ A;  1CKN A;  3K7A H;  1OO9 B;  3CRK C;  4CBV A;  2E2D C;  4LUZ A;  5IOC A;  4R4O A;  2EXD A;  2IWH A;  1HNX L;  3GTP H;  1DOK A;  2CVR A;  2HQL A;  2L55 A;  5EQ0 A;  3PIO 3;  4DR7 Q;  3ERO A;  1T5E A;  3I55 A;  5M9O A;  1PRT F;  4ZYS A;  1B9N A;  4G7Z C;  1Y8O B;  4X64 Q;  4A3E B;  4JI4 L;  1EUJ A;  1U5K A;  5IWA L;  3I56 A;  4DR3 L;  3OWF A;  4AQY Q;  5JVH 3;  4J1M A;  4ME5 A;  2WB1 B;  1AH9 A;  5M5Y B;  1X3E A;  1X6O A;  1B1Z A;  3QB3 A;  2F3I A;  1VQC A;  3QOL A;  4LFA L;  1ICF B;  3SK6 A;  4B08 A;  3K7A B;  4K14 A;  3W1G A;  3VR5 A;  2QA4 A;  2B2T A;  4RG1 A;  4A3E G;  4BXX H;  1Q1B A;  3LNN A;  4RKL A;  4JI2 L;  3H6M A;  1RTO A;  5I2Y A;  1C9O A;  3CCQ A;  2WB1 G;  5M3F B;  3PUV A;  1Y69 U;  2B2Y A;  3GTP B;  1VDZ A;  2F52 A;  1E7Z A;  4P2C B;  3K0X A;  4JCV E;  3WOE A;  3GTG H;  2CW0 D;  4GNX B;  3DEO A;  1GVP A;  1IYV A;  4L5Q A;  3UI2 A;  2KEC A;  1IXR A;  1VQ4 A;  2EYF A;  2L9H A;  1SRO A;  5M3F G;  4JW0 A;  2ES2 A;  5EKI A;  4QB4 A;  1V1P B;  3HOU H;  4MZ9 A;  3SVM A;  4LJZ C;  4IOC A;  4FXD A;  5JPM C;  3BZC A;  4JI7 L;  2Z4H A;  3I90 A;  5A2Q L;  4PZ8 A;  5LL6 X;  2UUB L;  4OL7 A;  4DNI A;  1GUO A;  1YNN C;  4DV3 Q;  1KIX A;  5I6Y A;  5IY0 A;  4UDU C;  3HKS A;  3PIO A;  2NZ1 D;  1ENF A;  1ZXT A;  1I94 Q;  5JEA H;  2EVB A;  4P72 A;  3NBI A;  2MFI A;  4IOA A;  4IUQ A;  1KXL A;  4NKL A;  2DGY A;  4NXN L;  3URY A;  2K1B A;  2K5V A;  3NBH A;  3GTG B;  2QDB A;  3PO2 H;  3S16 B;  1I4H A;  4YHH Q;  3S2D B;  1K3R A;  1LTA D;  1Z9F A;  1K8O A;  4PG3 A;  1IBL L;  4BXX G;  5C44 H;  1O7Z A;  2F3V A;  2ICI A;  3SXH A;  3AU7 A;  5CYU A;  1PH6 A;  3BYT B;  1BDO A;  3H09 A;  3U58 A;  4DV2 Q;  2QKI C;  3NHH A;  4HMJ A;  1NUC A;  1YNJ C;  3M3Y H;  3TRE A;  1WTR A;  5GAE C;  3L7Z C;  1VMC A;  3QO2 A;  1Q1E A;  2VUM B;  1KAW A;  2A8V A;  2F0I A;  3QJY A;  1CQV A;  5EPJ A;  2QEX A;  2VB3 X;  1AEX A;  1BBW A;  4XT3 B;  2AQ1 B;  5EGT A;  3ERS X;  1O78 A;  1JMC A;  4OEL B;  2GVB A;  1S5B D;  3TS0 A;  2VUM G;  3R3O A;  1IZ6 A;  3FPU B;  5L37 A;  4GKK L;  5EPK A;  1B9M A;  2PMZ E;  2TSS A;  5LMN W;  4H02 A;  1D5M C;  4QCL A;  1HTL D;  1FGU A;  5C44 B;  3ER0 A;  5AJ3 Q;  4L5S A;  3W3A A;  4P73 A;  4DK6 C;  5FLX c;  1QNK A;  5C3W A;  2O2L D;  2OXP A;  5IP9 G;  4EVO A;  3PMF A;  1N34 L;  2DY7 A;  3TSS A;  4JI3 Q;  1D5Z C;  3MAQ A;  2BCO A;  1F9P A;  3M3Y B;  1L2F A;  4LF5 Q;  4XTC S;  3U4Z A;  4A3K H;  2M00 A;  3CD6 A;  2EYL A;  1NNX A;  2CQA A;  3D4W A;  5ELF A;  3FEW X;  2E2I H;  1QJO A;  5C44 G;  2DN8 A;  2VS1 A;  3KF6 B;  1Y1V H;  4O0A A;  4R8I A;  1SNP A;  1S3O A;  3FP9 A;  2NB0 A;  4PMC A;  2L4N A;  1XPR A;  1HR0 W;  3ND9 A;  1FL0 A;  3BZD B;  4KY7 A;  5D3I B;  1W6K A;  5D3D A;  4JI6 Q;  2PI2 A;  3RR5 A;  4DV6 L;  3QG1 A;  3IAY A;  1WYD A;  2KCT A;  1VQO A;  1E24 A;  2YTV A;  4XYQ A;  2F0V A;  4C3H B;  3J80 c;  4QUC A;  4A3I B;  2EJG C;  4FNF A;  3D3R A;  4OGQ C;  3MEH A;  2K5W A;  3VYS A;  1R4P B;  3M4P A;  1HNX Q;  1X56 A;  4YCV A;  1QE6 A;  4JC0 A;  2WIN B;  4OON A;  1HRJ A;  5FKA C;  2A69 C;  5GRO A;  3H91 A;  5EKL A;  3AFQ A;  1K0S A;  1UWV A;  1S40 A;  4C3H G;  1PRT D;  1B2T A;  4Y7N H;  4JI4 Q;  3G48 A;  4DR3 Q;  4A3I G;  5DLQ E;  2GA4 B;  4OX9 L;  2ZXR A;  2E2J B;  2G9H D;  4DGZ A;  1TY2 A;  2A6H D;  3JAM i;  4J15 A;  1PTO C;  3BVZ A;  3HOZ H;  2XRS D;  5TSS A;  4PMW A;  4LFA Q;  5CV5 A;  4HJ8 A;  1EEI D;  3S15 B;  5E4W C;  3T53 B;  5KYL A;  5F2D A;  1KL9 A;  2BDO A;  3DUZ A;  3CCM A;  2HHH L;  3TZU A;  4JI2 Q;  3OIP A;  4BBR H;  2VB2 X;  1YHA A;  5E1F A;  2CWA A;  3R2I A;  1E2Z A;  3KJO A;  1PA6 A;  3QWN A;  1K8G A;  3E3X A;  4DR6 L;  2Q2T A;  1SYF A;  2Y0S B;  2J4X A;  2Q2H A;  5HGT A;  4L5R C;  4JOI C;  1LYL A;  2ZXO A;  1STE A;  1A6X A;  1DZ1 A;  2XRQ D;  1LLR D;  4WRD A;  3OTO L;  2TMP A;  4G57 A;  4S3S A;  4FO2 A;  2A6E C;  2NVY H;  1BOS A;  3MZ5 A;  3HOZ B;  2F0P A;  1PH4 A;  4B3R L;  2EY5 A;  3VYR A;  2Y0S G;  4IJH A;  1B7Y B;  1H95 A;  4L5T A;  4JBW A;  1PFN A;  1Z7T A;  1WTW A;  1IL2 A;  2B8F A;  2B2W A;  2UUB Q;  1HR0 L;  2VZA A;  2R93 H;  2MNA A;  4G4K A;  1ZEQ X;  4R4Q A;  3H94 A;  1R9T B;  5FLM G;  4JI5 L;  3HOZ G;  2PQE A;  3CRL C;  2K7V A;  1XYI A;  4DR4 L;  3TQY A;  1O7L A;  1QZH A;  1N8R C;  4NXN Q;  1AFP A;  2FIN B;  2D0O A;  1SYC A;  3FKI H;  1EY9 A;  4IFD I;  3FMC A;  5C0X I;  3J7Y W;  4JOI A;  3S9W A;  1EIH A;  1DGS A;  3N6R A;  2LXK A;  2KBN A;  3A8K E;  4R4C A;  1Q8I A;  1PRT B;  3B6Y A;  4AH6 A;  4QJF A;  4K6L A;  2AKW B;  2FHT A;  4K0K L;  1D6E C;  3NEL A;  4X3T A;  1QUQ B;  2CFM A;  1WTO A;  1QNU A;  3DLL A;  2OCE A;  2C35 B;  1U4M A;  2UU9 Q;  1PH9 A;  5KYI A;  3NXW A;  1UE6 A;  3LGJ A;  4K5X A;  3G4S A;  4EGV A;  1TWC B;  1VCI A;  4DUZ L;  3BVG A;  2LSS A;  2MO0 A;  4HED A;  2AUJ D;  2EYM A;  2XNA C;  2N55 A;  4KN7 C;  4DV4 Q;  3JAM E;  4ZUJ A;  3GTK H;  3A7L A;  1KAA A;  3GTM B;  1S5F D;  3Q8D A;  1JR0 D;  2EJM A;  1TWH H;  1JT8 A;  1BCP F;  1LTL A;  3SE0 A;  2QCP X;  1QB5 D;  5IGG A;  4ZKC B;  5FO9 B;  1N36 L;  2E74 C;  4Z9C B;  2I5L X;  1V43 A;  1L1O C;  1WTV A;  3X3M A;  3S1R H;  5KNB A;  1F77 A;  4YY3 L;  3S14 B;  1JE4 A;  5IGC A;  5JPN C;  2RHS B;  4HCE A;  5FLX E;  5FOB B;  3AFP A;  1QZG A;  3WOF A;  1VQP A;  1YI2 A;  3L3O C;  4A3G H;  1QOH A;  1S4Z A;  2SNS A;  4FYD A;  1EWI A;  1EZ6 A;  1Q90 A;  4C2M H;  2R7D A;  3GV6 A;  1SND A;  5C4X B;  2KHI A;  1HJP A;  2UUC L;  1H9R A;  3A8J E;  1ET9 A;  1J8I A;  3GTK B;  1V1P A;  2OEO A;  4F87 A;  4DK0 A;  4FP5 D;  1OXT A;  5I2X A;  1TWH B;  4BA1 I;  1SYD A;  3Q6S A;  1BF4 A;  3NTH A;  3UE1 A;  2F0S A;  2K28 A;  3F2B A;  1K28 A;  2E5L L;  3STB C;  3S1M H;  5C4X G;  3EVQ A;  2JP1 A;  2K04 A;  3ZYY X;  3S1R B;  3MXG A;  3J80 E;  1NTG A;  1MIU A;  1L1O A;  2R7F A;  1PYB A;  1BQQ T;  2N88 A;  3G6E A;  4V19 0;  1YHQ A;  3VR2 A;  2GVA A;  3KF8 B;  1B3Q A;  2UXC L;  3MXN B;  3GTL H;  3BDL A;  3K0Y A;  4DV1 Q;  2CW0 C;  4KHP L;  5EBD A;  2CKZ B;  2RKS A;  4HCS A;  5IYC H;  1GKH A;  4WJ3 M;  4X3U A;  1STB A;  4HIK A;  5DNF A;  3JC6 6;  1SYB A;  1PVO A;  1J6Q A;  3HOY H;  1H9J A;  3I4M B;  1V9P A;  4UP8 A;  1K8A C;  3HOX H;  2IY5 B;  1D8L A;  3GP7 A;  3GTO H;  2BA0 A; 
#chains in the Genus database with same CATH homology
 1U0L A;  4JI4 L;  1EUJ A;  1U5K A;  5IWA L;  4A4I A;  3KLW A;  3I56 A;  4DR3 L;  4AQY Q;  5E7N A;  1IBL Q;  4GKK Q;  1NY4 A;  2YTY A;  2F4V L;  1CSP A;  2K14 A;  1AH9 A;  4A3L G;  1X3E A;  3M85 A;  1X6O A;  2WP8 J;  5GQO A;  1L0W A;  5JEA G;  1Q86 C;  3TRZ A;  4A3C G;  3S14 H;  2F3I A;  4A93 H;  4LF9 L;  1VQC A;  4LF7 Q;  1I6H H;  3KFU A;  4AIM A;  5LMN Q;  4ALP A;  4LFA L;  3I4M G;  4JYA L;  3H15 A;  2JEA I;  3PO2 G;  2QGQ A;  1N9W A;  2WB1 E;  3I4O A;  3W1G A;  2QA4 A;  4GNX C;  4DR5 L;  4RG1 A;  4A3E G;  2R92 G;  4BXX H;  1Q1B A;  4LWC A;  4JI2 L;  3RNU A;  3RN2 A;  1C9O A;  1K0R A;  3NEM A;  4A3J H;  1X55 A;  4HIM A;  3CCQ A;  5BR8 L;  2WB1 G;  1P8L A;  4APV A;  4QQB X;  4LFB L;  2ALY B;  3PUV A;  5C4X H;  2UXB Q;  5LMU Q;  3T1H Q;  1JJ2 A;  1MKH A;  2Z6K C;  2F52 A;  1E7Z A;  1VQB A;  4X66 Q;  1UE5 A;  3K0X A;  4JCV E;  1HZA A;  4JI8 L;  3GTG H;  1BKB A;  4GNX B;  1PV4 A;  2UUA L;  2PNH A;  4X65 L;  4B3R Q;  1HNW L;  1GVP A;  3J81 i;  1WCM H;  2BA1 A;  3A5Z B;  4L5Q A;  1HZC A;  3PO3 G;  2B63 H;  3CCU A;  1IXR A;  3H0G H;  1VQ4 A;  1VQL A;  3GD7 A;  1XMO L;  2XTI A;  4FDB A;  4A3D G;  1SRO A;  5M3F G;  3NBH B;  2ES2 A;  1HR0 Q;  1XNR Q;  3BJU A;  1Q46 A;  3HOU H;  4MZ9 A;  3CQZ H;  1N34 Q;  4HID A;  3S1N H;  1N33 L;  4IOC A;  1K9M C;  4JBK A;  1FJG L;  3BZC A;  4JI5 Q;  3HOX G;  3VDY A;  4JI7 L;  1SN8 A;  4PZ8 A;  4DV5 L;  4GKJ L;  3CCR A;  4OWX B;  2UUB L;  3J81 j;  2NN6 G;  4DNI A;  5M5X H;  1HZB A;  2YYZ A;  2YU9 H;  4DV3 Q;  3S2H H;  4DV1 L;  1KIX A;  4B3M Q;  1MJC A;  3E9H A;  2YTX A;  5IY0 A;  3D31 A;  3HKS A;  3PIO A;  1X65 A;  4GNX A;  4BA2 I;  3WWV A;  4GOP C;  4A3L H;  4DR7 L;  4UPA A;  1I94 Q;  4LUO A;  4P74 A;  4P72 A;  1PH3 A;  4PZ6 A;  2JK8 A;  2FXQ A;  2MFI A;  3TEH B;  4IOA A;  5ELN A;  3ZJY C;  5IYB G;  2VNU D;  1KXL A;  1IBM Q;  3I4M H;  2DGY A;  4NXN L;  1CSQ A;  2K5V A;  2K5H A;  3PO2 H;  4X62 Q;  3S17 H;  4YHH Q;  2Z6K A;  4A75 A;  1K3R A;  3PSI A;  1Z9F A;  4A3K G;  2R92 H;  2XGT A;  4PG3 A;  1EFW A;  1IBL L;  3RZO H;  4BXX G;  3PGZ A;  4B3T Q;  4GKK L;  5C44 H;  1VS0 A;  4GS3 A;  4LF6 Q;  4DPG A;  2ZTD A;  4DV6 Q;  4QIW E;  5IE8 A;  4TVA B;  1PH6 A;  4R4T A;  1CUK A;  2BH2 A;  3GTQ H;  1Y1V G;  3PCO B;  1SE8 A;  1CKO A;  4IPC A;  2NZH A;  3CP0 A;  4DV2 Q;  3U58 A;  2OWO A;  1SMX A;  1YHB A;  2UXD Q;  3CCE A;  4ME3 A;  4YWK A;  1CKM A;  5LMN L;  1Q12 A;  1A62 A;  1E22 A;  5M5W H;  4LNQ A;  3GTO H;  3M3Y H;  3TRE A;  1YBY A;  3RLO A;  5GAE C;  3L7Z C;  2PQA B;  5HGQ A;  1Q1E A;  1KAW A;  1NE3 A;  2A8V A;  2ZM6 L;  3RLF A;  3UDX A;  3KOJ A;  1NMG A;  5K36 G;  2QEX A;  3A0J A;  3CCV A;  4LFC L;  3CPW A;  2B63 G;  4HJA A;  4UP7 A;  3H0G G;  1BBW A;  3KDF B;  5M3F H;  1VQA A;  2OQK A;  1PH2 A;  4Y52 H;  1Z47 A;  3ERS X;  1N36 Q;  4OX9 Q;  4BY7 H;  4B3S L;  4X66 L;  1JMC A;  4GOP A;  1RL2 A;  1XTD A;  2YV5 A;  1S72 A;  2GVB A;  4YCW A;  2F4V Q;  4YY3 Q;  3TS0 A;  3CPF A;  2JA7 H;  4NXM L;  1KHI A;  1PFS A;  2VUM G;  4GN4 B;  2VL6 A;  1IZ6 A;  4JI1 L;  1N32 Q;  1I5F A;  1O7I A;  1W3S A;  2JA5 G;  1GO3 E;  2PMZ E;  5LMN W;  2Z0S A;  4LUV A;  4H02 A;  1FGU A;  3ER0 A;  5AJ3 Q;  2PQA A;  1C7Y A;  4P71 A;  4L5S A;  4JV5 L;  1XNR L;  4P73 A;  4DK6 C;  5FLX c;  2HHH Q;  1G29 1;  5IP9 G;  4DV0 Q;  1QVC A;  2CQO A;  3I2Z A;  1N34 L;  2BH8 A;  4JI3 Q;  3AQQ A;  5IYB H;  1MJE A;  1JJG A;  2JQO A;  1NJI C;  2AWN A;  3KDF A;  1L2F A;  4LF5 Q;  4XTC S;  3U4Z A;  5FJ8 G;  2WFW A;  2UUC Q;  4A3K H;  4DV7 Q;  4DR6 Q;  5JJI A;  3CD6 A;  2K5N A;  3GO5 A;  1AE3 A;  5GAD C;  3L2P A;  3FHW A;  2VW9 A;  2E2I H;  2VQE Q;  2VQF L;  4BY1 H;  1VQJ A;  5C44 G;  3CF5 A;  1VQG A;  2HIV A;  2VS1 A;  2IHF A;  1I94 L;  3KF6 B;  1SR3 A;  1Y1V H;  1VQK A;  1VQD A;  4O0A A;  4BBR G;  1JB7 A;  1EIF A;  3GTJ H;  4HIO A;  3RLN A;  3KYH C;  1S3O A;  4OXP A;  3OTO Q;  1LUZ A;  2H5X A;  3T1Y L;  3FP9 A;  2ZJR A;  1PHJ A;  1M90 C;  3PUW A;  4X62 L;  3AEV A;  1XPR A;  3H3V H;  4K0K Q;  1HR0 W;  1J5E Q;  1FL0 A;  4UY8 C;  3S16 H;  1OXU A;  2NN6 I;  4A3F G;  3S2D H;  2KHJ A;  3W5O A;  4GN5 A;  3G71 A;  2PI2 A;  4JI6 Q;  3RR5 A;  4LF6 L;  4DV6 L;  1WYD A;  1QVF A;  1YJN A;  5C3E G;  1X3F A;  2IX0 A;  2KCT A;  2IHE A;  1VQO A;  4JI0 Q;  1E24 A;  2YTV A;  3J80 c;  3CME A;  4XIG S;  3I4N H;  4DV2 L;  2MO1 A;  2ZTE A;  4IFD G;  3EIV A;  4IPH A;  2UXC Q;  5C0X G;  1Q8K A;  3UDF A;  1BVS A;  2VUM H;  4BY7 G;  1EQR A;  4A3B G;  4DKA C;  3M4P A;  1T9H A;  1HNX Q;  1X56 A;  5GAG C;  4YCV A;  3KF6 A;  1K83 H;  4JC0 A;  4OON A;  3K7U C;  4DR2 Q;  2AHO B;  5GRO A;  3CW2 C;  2JA7 G;  3L0O A;  2B3G A;  3F2C A;  1GM5 A;  1HNZ Q;  2JA6 H;  4QGU A;  2JA5 H;  3W1B A;  2R7Z H;  1KRS A;  3HOV H;  4DR4 Q;  1OXV A;  4LF8 L;  3AFQ A;  1Q81 C;  1UWV A;  4LF4 L;  3CXC A;  1S40 A;  4PZ7 A;  1SFO H;  4Y7N H;  4JI4 Q;  4POF A;  3HKZ G;  1E1T A;  3G48 A;  1PYS B;  5DLQ E;  4DR3 Q;  2ID0 A;  4A3I G;  4OX9 L;  5IP9 H;  3CAM A;  2GN5 A;  1IBK Q;  2R93 G;  3M7N A;  3JAM i;  1VQI A;  4J15 A;  3HOZ H;  2E8G A;  4GN3 B;  1AE2 A;  1N32 L;  4GLA C;  2HIX A;  5FJ8 H;  4X64 L;  4PMW A;  4LFA Q;  4MTN A;  4JYA Q;  2LXJ A;  4HJ8 A;  4AQY L;  2JA8 H;  3BU2 A;  1PH5 A;  1KL9 A;  4NB3 A;  1XPU A;  1FVI A;  3FKI G;  1BBU A;  1JE5 A;  4BY1 G;  3PIP A;  3CCM A;  4DR5 Q;  2DUD A;  2HHH L;  1A0I A;  4JI2 Q;  4GOP B;  4IPG A;  3UDI A;  4BBR H;  1HZ9 A;  1EYG A;  3F8T A;  4TQU S;  2NVQ H;  3D0F A;  1YIJ A;  1YHA A;  2CWA A;  3PF5 A;  4LF7 L;  4DUZ Q;  3PO3 H;  4LFB Q;  4GLV B;  1PH8 A;  2EQS A;  3KJO A;  3RZD H;  1VQ7 A;  1TXY A;  5JJK A;  4OWT B;  1PA6 A;  5IYD G;  1K8G A;  1K73 C;  4DV7 L;  4KLK A;  4DR6 L;  1X3G A;  3J81 c;  4A3F H;  4C3J H;  2CWP A;  4MNO A;  2Q2T A;  1SLJ A;  2Q2H A;  2VQE L;  4L5R C;  4JI8 Q;  4JOI C;  3S24 A;  1LYL A;  1TWG H;  5IP7 G;  5C3E H;  1WJJ A;  1A63 A;  2UUA Q;  1HNW Q;  1VQE A;  4X65 Q;  4YCU A;  1Q7Y C;  1I50 H;  4JBM A;  3I4N G;  2K4K A;  3ULJ A;  1VQM A;  2R6G A;  2UXB L;  2Y0S E;  3OTO L;  5LMU L;  3T1H L;  1KQS A;  1XMO Q;  3K80 C;  5H1S E;  4A3B H;  4JG2 A;  1XPO A;  1B70 B;  2NVY H;  2A19 A;  3K8A A;  4JI6 L;  4NPS A;  4OO1 G;  2OTJ A;  1PH4 A;  4B3R L;  1D7Q A;  1PH1 A;  2Y0S G;  2Q2U A;  1KRT A;  2JA6 G;  1N33 Q;  3M4O H;  2D0P A;  4IJH A;  1FJG Q;  1B7Y B;  3AYH B;  3HOV G;  2K75 A;  4L5T A;  2WAQ G;  2R7Z G;  4JBW A;  1H95 A;  1VQ8 A;  1E1O A;  5JEA J;  4C3H H;  4DV5 Q;  2AWO A;  4A3M G;  3E9I A;  1IL2 A;  4GKJ Q;  2UUB Q;  1UE1 A;  1XMQ Q;  2D62 A;  2CCZ A;  1HR0 L;  4A3I H;  1VQF A;  2VY3 A;  4KHZ A;  3HOW G;  4RMF A;  2VZA A;  4DUY Q;  2R93 H;  2MNA A;  4R4Q A;  1W2B A;  1Y14 B;  5FLM G;  1RIP A;  2RCN A;  4JI5 L;  2JJQ A;  3HOZ G;  2E2H H;  1WI5 A;  3EBE A;  4P75 A;  2IX1 A;  4DR4 L;  1G51 A;  3TQY A;  1QZH A;  4UP9 A;  2HT1 A;  4HJ7 A;  1N8R C;  1Y1W G;  4NXN Q;  3CC4 A;  2JA8 G;  2D0O A;  4DR1 Q;  4YWM A;  4DV3 L;  3IRB A;  4B3M L;  3OW2 A;  2N78 A;  4A3G G;  3FKI H;  2PI2 E;  4IFD I;  3CCL A;  2A1A A;  4IO9 A;  1VQH A;  1A8V A;  5C0X I;  1UEB A;  4JOI A;  5C4J H;  1IBK L;  4JBJ A;  2E2J H;  5JJL A;  3CC2 A;  1DGS A;  4EX5 A;  1P16 A;  2LXK A;  2KBN A;  5M3M G;  1IBM L;  1NBW A;  4R4C A;  2E5L Q;  3B6Y A;  4AH6 A;  4QJF A;  2AKW B;  3A74 A;  3PV0 A;  5IYD H;  2AMC B;  4YHH L;  4K0K L;  3GDE A;  3NEL A;  4A76 A;  1QUQ B;  2CFM A;  2I5M X;  3DLL A;  2OCE A;  4B3T L;  2EIF A;  4DK3 C;  3ULP A;  3STB D;  4GLX A;  3S15 H;  4IFD J;  4QY7 A;  5IP7 H;  4AYB E;  2C35 B;  2IT1 A;  5C0X J;  3RN5 A;  2UU9 Q;  2ZM6 Q;  4BBS H;  1PH9 A;  1UE7 A;  1EOV A;  3F1Z A;  2JEB I;  5IT9 c;  4EQ5 A;  1VQ6 A;  1UE6 A;  3LGJ A;  3E0E A;  3G4S A;  1VCI A;  2UXD L;  4POG A;  4DUZ L;  4LFC Q;  1XNQ Q;  1M1K C;  3U50 C;  4AYB G;  3PUY A;  3S1Q H;  3F2D A;  1OTC A;  1SRU A;  1YJ9 A;  4KHP Q;  2LSS A;  4OWW B;  5HY6 A;  2MO0 A;  4B3S Q;  2KEN A;  1YNX A;  3SGI A;  1GD7 A;  5GAH C;  3CCS A;  3HKZ E;  4DV4 Q;  4X6A H;  1LM0 A;  3GTK H;  1VQ9 A;  3TS2 A;  5ELO A;  4NXM Q;  2JA9 A;  3Q8D A;  3K81 C;  1TWA H;  4JI1 Q;  4A3M H;  1TWH H;  1JT8 A;  1LTL A;  1E3P A;  2B29 A;  1QUQ A;  3UDG A;  3OYY A;  4R1J A;  2I0Q A;  2N3S A;  5IWA Q;  3HOW H;  1N36 L;  4O2D A;  4DAM A;  4JV5 Q;  2I5L X;  1V43 A;  1L1O C;  2KCM A;  3BZK A;  3M4Q A;  3H3V I;  5FLM H;  3S1R H;  5IYC G;  4R4I A;  2ZJQ A;  2ATW A;  2I5H A;  4YY3 L;  1Q82 C;  1TWF H;  1X54 A;  1ASY A;  2K52 A;  4QL5 A;  3HOY G;  2RHS B;  1YJW A;  4LF9 Q;  3AFP A;  4C3I H;  1Y1W H;  4HJ5 A;  1QZG A;  1VQP A;  3CMA A;  1V1Q A;  3CC7 A;  1YI2 A;  5AJ3 L;  1YIT A;  3DM3 A;  2JE6 I;  3PF4 A;  5EAY A;  3UE0 A;  1XMQ L;  4A3G H;  1EIY B;  2OQ0 A;  4HJ9 A;  4DV0 L;  1EWI A;  2VQF Q;  4DUY L;  2NZO A;  1YVC A;  1L1O B;  1XJV A;  4JI3 L;  4C2M H;  3CCJ A;  2R7D A;  1CKN B;  3J7Z C;  1X9N A;  1VQ5 A;  5M3M H;  2K50 A;  5BR8 Q;  1WOC A;  1R9T H;  2ZJP A;  1NMF A;  4A3C H;  3A5U A;  4OO1 I;  2KHI A;  2RHQ B;  1HJP A;  2L15 A;  4A93 G;  4LF5 L;  1YZ6 A;  2UUC L;  3T1Y Q;  1EQQ A;  3J7A 5;  2V1C C;  3ULL A;  4DR1 L;  1WFQ A;  4LW1 A;  2Q2I A;  4A3E H;  1YEZ A;  1IYJ B;  2RF4 A;  4IPD A;  4BBS G;  1OXT A;  1OXX K;  1OXS C;  4BA1 I;  1KC8 C;  4IJL A;  2ZTC A;  3UE1 A;  4A3J G;  2NVT H;  3ICE A;  3F2B A;  5M5Y H;  1QVG A;  3U4V A;  2E5L L;  3STB C;  3S1M H;  5C4X G;  1JJC B;  2WAQ E;  1J5E L;  3M9B A;  3I7F A;  1NTG A;  1MIU A;  1G6P A;  1B8A A;  1L1O A;  1ASZ A;  1VQN A;  2R7F A;  1CKN A;  3K7A H;  2ASB A;  3NEN A;  1PYB A;  2UU9 L;  4JI0 L;  3G6E A;  2N8N A;  2MQH A;  4LUZ A;  4JI7 Q;  1PH7 A;  1C0A A;  1YHQ A;  3PUX A;  4WJ4 A;  4R4O A;  1WCM G;  4YWL A;  3KJP A;  2EXD A;  2GVA A;  4LF8 Q;  1XNQ L;  1KD1 C;  3KF8 B;  3PUZ A;  4LF4 Q;  1TWC H;  3MXN B;  2UXC L;  1HH2 P;  4A3D H;  3GTL H;  3JAM c;  3MEF A;  2N49 A;  3J80 i;  4DV1 Q;  4KHP L;  5J3B A;  1HNX L;  3GTP H;  2CKZ B;  4WJ3 M;  4DAY B;  2HQL A;  1GKH A;  5IYC H;  4DR7 Q;  4HIK A;  4DR2 L;  3I55 A;  3JC6 6;  3HOU G;  4DV4 L;  1HNZ L;  4KI0 A;  1PVO A;  1J6Q A;  3HOY H;  3EN2 A;  1V9P A;  2OTL A;  4UP8 A;  1K8A C;  3HOX H;  2IY5 B;  1D8L A;  3HFZ B;  3GTM H;  2NVX H;  4X64 Q;  1I3Q H;  2BA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...