5E7NA

Crystal structure of rpa70n in complex with vu0085636
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Optimization of Anthranilic Acid Based Inhibitors of Replication Protein A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5e7nA00
1YBYA 3OTOQ 3BZCA 1AE3A 1IYJB 4LWCA 4NXNL 3GO5A 3TS2A 5FLXc 4A3BH 5DLQE 2NZOA 2DUDA 1E24A 4JYAQ 2Q2HA 4DUZQ 3PUXA 2YYZA 3E9IA 1VQGA 4QL5A 1PH6A 4BY1H 5C0XG 3S16H 4X66L 1ASYA 2RF4A 4APVA 4C3IH 3JAMi 4BBSG 3I4NH 4A3LH 3HKZE 3S1QH 5M5WH 1TWCH 2CWPA 3HFZB 2ZJPA 4A3JG 1IXRA 2IHEA 3H0GG 2ALYB 4A4IA 2UU9L 2AMCB 1EOVA 2R93H 4JI6L 5BR8L 2JJQA 5GADC 1HZAA 1HR0Q 3FHWA 2MFIA 5E7NA 4JI5Q 3CCVA 4HJ8A 1G291 1B7YB 4EQ5A 4X65L 4HIMA 4JBMA 1CSPA 2PQAA 2HT1A 4B3SL 5JJIA 5EAYA 3KF6B 4JI6Q 3ER0A 4YHHL 1ASZA 3S1MH 1BVSA 1WCMG 3CMAA 1VQMA 2UU9Q 4DKAC 4BY1G 4KHZA 4MZ9A 1PH5A 1LM0A 2UXDQ 1VQ8A 3KOJA 4DK3C 2V1CC 1YIJA 1PH3A 4YWLA 1N9WA 3G6EA 4X66Q 3AFPA 1B8AA 1Q12A 2XGTA 1FJGQ 4JYAL 4DV7Q 2K14A 4GOPA 4K0KQ 2DGYA 4PZ8A 1S72A 2HIVA 3PUZA 3AQQA 1TWAH 1KIXA 2K5NA 2F4VL 2KHIA 1KRTA 3OTOL 3K80C 4DV3L 4LF5L 1UE5A 4X62Q 3RNUA 1Q82C 3T1YL 2JA5G 4LNQA 3T1HL 2D0OA 1KRSA 1Q8KA 2YTVA 3G48A 1S40A 1EIYB 4GKKL 2NZHA 3CC7A 4A3KH 1PV4A 3BU2A 1BBWA 5ELNA 4NXML 3IRBA 1HR0W 2Z6KA 1YVCA 3ZJYC 3CF5A 4P72A 1J5EL 1XPRA 2VZAA 1EWIA 5C0XI 2QA4A 1VQ6A 1AH9A 2A1AA 1QUQA 4GOPC 2UUBQ 2IT1A 4QJFA 1K0RA 4DV0L 3KF8B 2I0QA 3S14H 3CPFA 3HOXG 2NVYH 2K75A 2CFMA 3UDFA 1SRUA 4RMFA 4LFCL 2PI2E 3NBHB 1E22A 4GKJQ 4LF6L 1L2FA 1QVFA 4A3CG 2F52A 5M3FG 4HJ7A 2BH2A 4YCWA 4OWXB 4DR1L 3RZDH 4HJ9A 4BA2I 2HIXA 4DV6L 4DR1Q 4OWTB 4OO1I 1VQPA 2EIFA 2Q2IA 1AE2A 3U4ZA 4OXPA 3PSIA 5JEAG 1PHJA 1HNZQ 3PO3G 1HH2P 2KBNA 4LFBL 1TXYA 1L1OB 4DR3L 2GVBA 4POFA 3E0EA 2D0PA 1X9NA 4LUZA 4LW1A 3W1BA 2E8GA 2L15A 1JE5A 3L2PA 1Y1WH 1Q86C 1NBWA 3K7UC 3OYYA 1I3QH 3B6YA 2ZM6L 1VQ7A 3NENA 4IJLA 1UE6A 1PH7A 2ZJQA 1C9OA 1YJ9A 4NXMQ 2H5XA 4OONA 4R4TA 1VQDA 1RIPA 4DPGA 1V43A 4R4CA 2KCMA 4DUYQ 1JJ2A 3F2CA 3CCUA 2HHHQ 4A3CH 2IY5B 2R7DA 4FDBA 3T1HQ 2R92G 4JI8L 1SE8A 5C0XJ 3CQZH 4O2DA 1VQHA 4GS3A 3WWVA 3CW2C 2NN6G 2WAQG 4JI8Q 1W3SA 5M3MH 2ATWA 4JCVE 4GN5A 3H3VI 5J3BA 1U5KA 4LF8L 1WYDA 5GQOA 3TEHB 2JA7H 4MNOA 3EBEA 1YJNA 1SFOH 1N36Q 2VUMG 3CD6A 5C4XG 1KQSA 4LFAL 2BH8A 2WAQE 4B3TL 3ULJA 4JBJA 4IFDJ 4JI1L 2ZTCA 2YV5A 4DR6L 2Y0SE 2UXCL 3HOVG 2UUCQ 1MJCA 2GN5A 3S2HH 2E2IH 2UXDL 1XMQL 3UE0A 1G51A 1EUJA 2D62A 4LUOA 4A3MG 4BBRH 2E2HH 5IP7G 3GD7A 2VUMH 4IOAA 5AJ3L 4B3TQ 1HNZL 4B3SQ 4QQBX 3CCJA 5IP9H 2CKZB 3AYHB 3UDIA 2VQFL 1EFWA 1EIFA 3E9HA 3M4PA 4RG1A 3RR5A 1N36L 1XNQL 4X65Q 3RN5A 1D7QA 3A5UA 1JB7A 2VL6A 2RHQB 4LF6Q 3AEVA 1WOCA 4R4IA 3ULPA 3J80i 4PG3A 2MO1A 1HNWL 4HIKA 4JG2A 4B3RQ 4A93G 1Y1VG 1SR3A 4A75A 2UUBL 4JI2Q 1GO3E 1HZ9A 1VQLA 4BXXH 3MXNB 1VQIA 1K8GA 1J5EQ 1H95A 2I5HA 4UPAA 5LMNW 2JA5H 2KENA 2I5LX 2UUAL 5IY0A 4JI4L 4JI7L 3CCMA 4LF7Q 3KJOA 4BBSH 1WJJA 5IYBG 1UE1A 1MJEA 1PYBA 3HOWH 2JK8A 3KDFA 1HZCA 1KD1C 1K9MC 2Z6KC 4H02A 4OX9L 1R9TH 1VQ9A 4OWWB 2R93G 3CAMA 4DR3Q 4IFDI 1XNRL 1A8VA 1NMGA 1KXLA 2EQSA 3HOWG 2F4VQ 2MO0A 3PGZA 5FJ8G 3PF5A 2JA6G 2B3GA 4O0AA 3M85A 4K0KL 2R7FA 1N33L 3KJPA 4DR5Q 3PUYA 2UUAQ 5C4XH 4DK6C 4GLXA 2E5LL 2RHSB 1FJGL 3J81c 4GKJL 1WI5A 1Q7YC 4A3EH 1PH2A 2NVTH 4WJ4A 2IHFA 4PZ7A 2N3SA 4MTNA 4HIDA 4LF9Q 3HOZG 1HNWQ 4DV0Q 3STBD 3CCLA 1Q1EA 1X55A 4A3BG 2E5LQ 1FGUA 4DV1Q 2YU9H 4YCVA 4DR5L 2WB1E 1OXVA 2PMZE 1FL0A 4A3EG 4LF4L 4DR7Q 2JQOA 5IYCG 1V1QA 1LYLA 4JI5L 3UDGA 5AJ3Q 5H1SE 3T1YQ 4A3FH 4A3GG 2UXBQ 5JJKA 1XNRQ 1U0LA 2K52A 2AWNA 2N78A 4BY7H 1L0WA 1E1OA 1IBKL 1PH9A 4HIOA 4R1JA 2UXCQ 3GTPH 3S2DH 1JJGA 4DR6Q 2JA8H 3KFUA 3F2DA 1OTCA 1SLJA 3PF4A 3K7AH 3HOZH 2B63H 4A3DG 3D0FA 4P75A 1JJCB 1OXTA 1TWHH 1X65A 4DUZL 1O7IA 3DLLA 5C3EH 3M9BA 4UP7A 1QZHA 1Q46A 4LF8Q 2ZTEA 2PQAB 1IBKQ 3RLNA 4X6AH 1SMXA 1CKOA 4C2MH 3GTGH 1M90C 4YHHQ 4YWMA 3KDFB 4DNIA 1KL9A 4AIMA 1QVGA 4QY7A 2UXBL 1CSQA 1KC8C 1VQKA 3HOVH 3RLOA 1GD7A 2JA9A 4Y52H 1VQNA 4LF4Q 2Y0SG 3VDYA 5JJLA 1A63A 2VQFQ 1XNQQ 1MKHA 4L5TA 4JI0L 3I4MG 5IYDH 2OTLA 3GTMH 1PH1A 4L5SA 3H0GH 3F1ZA 1X54A 5FLMG 4EX5A 2ZM6Q 2R6GA 1N32L 3A0JA 2B63G 4IPHA 1J6QA 5C44G 1RL2A 4LF9L 4JV5L 4OO1G 4AQYL 1X6OA 3PO2H 2CCZA 4Y7NH 3HOUG 2ZTDA 2WB1G 2IX0A 5IWAL 1A0IA 4LFBQ 1LUZA 4A3JH 3HOXH 3F2BA 3TRZA 3M3YH 2I5MX 3S17H 1EQQA 3PCOB 1HZBA 1L1OA 2N49A 1X56A 2RCNA 1FVIA 2GVAA 3S1RH 1N34Q 2PI2A 4P74A 1NTGA 2AKWB 1PH4A 1CKNA 1VQAA 1VQ4A 1E1TA 3CPWA 3I56A 4DV5L 4AQYQ 1BKBA 1KHIA 2LXJA 1SN8A 1YHQA 1CUKA 4GN3B 2A8VA 4BY7G 2VW9A 1XTDA 1PFSA 1GVPA 3HKSA 4DUYL 3RLFA 2VQEQ 1XPOA 3S24A 4C3HH 5ELOA 2K5VA 2HHHL 4P73A 3J81j 4GNXA 1IBLQ 4LF7L 2NVQH 1JT8A 2XTIA 1I50H 5FJ8H 3I55A 1XMOL 2C35B 2JA6H 2N8NA 5JEAJ 2Q2UA 2YTYA 4DAMA 3FP9A 3GTKH 4B3RL 4YY3L 3G4SA 3CC2A 4BBRG 4WJ3M 1A62A 4JC0A 2AHOB 3A74A 3I4OA 1K8AC 1C0AA 1JMCA 5LMNL 5IP9G 4JBWA 1N8RC 1N34L 1HJPA 4DV6Q 2EXDA 1XJVA 1VQCA 3H15A 1VQBA 1D8LA 1WFQA 1PA6A 2ZJRA 4JBKA 1HNXL 1X3GA 3KYHC 5IWAQ 4UP9A 4GOPB 4PZ6A 4JI3Q 3PUWA 1XMQQ 5GAGC 3PV0A 3CCRA 3STBC 5IYCH 2QEXA 3TS0A 1VQOA 2UUCL 5LMUQ 3M4QA 1NMFA 3NELA 4YWKA 4JI1Q 3CMEA 3HOYH 3LGJA 3JC66 1VQFA 1EQRA 4J15A 4A76A 2MNAA 3CC4A 4JI0Q 3H3VH 2VS1A 3J7A5 4QGUA 3PO3H 4KHPQ 3PIPA 1I5FA 1YNXA 1K83H 4KHPL 1UWVA 1NY4A 1OXXK 4QIWE 1G6PA 4X62L 4IOCA 2QGQA 2MQHA 4DV3Q 4LF5Q 1YJWA 2BA1A 1YZ6A 2NN6I 1QUQB 4GN4B 4XTCS 3NEMA 1S3OA 1DGSA 2VY3A 4JI3L 1YITA 5IP7H 4L5RC 2B29A 3EN2A 4KLKA 4BA1I 4A3KG 3J81i 2JEBI 2LXKA 1P8LA 4NB3A 3L0OA 5K36G 4DV2L 2R92H 3UE1A 3TQYA 4IPCA 4L5QA 1V9PA 1Y1WG 2R7ZG 1W2BA 2OWOA 2YTXA 1YHBA 4HJ5A 3HOYG 4DR4L 3U50C 4A3IG 1K73C 3DM3A 4PMWA 5LMNQ 3S1NH 4NXNQ 4DR2Q 1K3RA 3W5OA 2JA7G 1KAWA 3KLWA 4YY3Q 5IT9c 1VCIA 2K4KA 1YHAA 4DR4Q 4TQUS 4BXXG 5C4JH 1SROA 4X64Q 3UDXA 4NPSA 3L7ZC 4DV2Q 4A3IH 1PH8A 2PNHA 4B3MQ 3GTQH 4IFDG 3BJUA 3F8TA 3EIVA 1Z47A 1OXUA 5IE8A 1Q81C 2ID0A 3K0XA 3SGIA 3I2ZA 1VQ5A 4LFCQ 3D31A 3KF6A 3JAMc 5M5XH 3RN2A 2F3IA 4JOIC 2A19A 4TVAB 2JA8G 1IL2A 1BBUA 2OTJA 4B3ML 1PYSB 1LTLA 2ES2A 4ME3A 1GM5A 4X64L 3ICEA 2K5HA 1N33Q 3I7FA 3U58A 4AH6A 1E7ZA 2E2JH 3RZOH 1VQEA 1Y1VH 1B70B 2BA0A 4YCUA 2HQLA 1X3FA 2WP8J 4DR2L 1NJIC 2Q2TA 4POGA 4OX9Q 4KI0A 5GROA 4JV5Q 2CQOA 3CCQA 4A3FG 4A3GH 1I94L 4IO9A 2KHJA 3GTJH 4DV7L 2NVXH 3Q8DA 4JI4Q 3ERSX 1HNXQ 4JI7Q 3G71A 4LFAQ 2AWOA 5M3FH 3K8AA 5FLMH 4JI2L 1CKMA 3BZKA 4DV4Q 1WCMH 1YI2A 1GKHA 5M5YH 4GNXB 1PVOA 2LSSA 1C7YA 5IYBH 1OXSC 5C3EG 4R4QA 4HJAA 4ALPA 2JEAI 4IPGA 3W1GA 1Z9FA 4GLVB 1I6HH 3U4VA 1EYGA 4R4OA 1IBML 4IPDA 4AYBE 1XMOQ 1M1KC 3M7NA 4AYBG 3ULLA 1HR0L 3OW2A 5BR8Q 4UY8C 3I4NG 3MEFA 5LMUL 3GDEA 3GTOH 1Q1BA 4GLAC 2WFWA 3CCSA 5IYDG 3I4MH 2FXQA 2VNUD 4A93H 1YEZA 3M4OH 4IJHA 2CWAA 1VS0A 2KCTA 5C44H 1NE3A 4P71A 5M3MG 2ASBA 1UE7A 3K81C 4DR7L 1X3EA 1P16A 1QVCA 1TWGH 1IBMQ 3GTLH 4XIGS 3HOUH 3FKIG 2OQ0A 3S15H 5HGQA 4UP8A 2OQKA 4DV1L 3J80c 1QZGA 3HKZG 4JOIA 5GAHC 1L1OC 1IZ6A 1MIUA 2R7ZH 3AFQA 4DAYB 1E3PA 4A3DH 3PO2G 1N32Q 4DV4L 2Z0SA 4A3MH 3A5ZB 2IX1A 2OCEA 3FKIH 4A3LG 3CXCA 1UEBA 5HY6A 2JE6I 3CCEA 1CKNB 1TWFH 1XPUA 3PIOA 1IBLL 1VQJA 1Y14B 1I94Q 3J7ZC 2VQEL 5GAEC 4C3JH 4GNXC 4GKKQ 3PUVA 1T9HA 3CP0A 2K50A 4LUVA 4DV5Q 3TREA
chains in the Genus database with same CATH superfamily
4M8AA 3MFYA 2PMZB 1SJED 1A2UA 4LWCA 4NXNL 2K5WA 3BDLA 1LTID 3ONAB 4QL5A 3K5NA 2EYJA 2O4XA 2KEDA 2QDBA 2AUKA 1BQQT 3PO2B 4ULLA 3BDCA 3CRKC 2JJQA 3A8KE 1ENCA 5GADC 1LTTD 1HR0Q 2MFIA 4N8FA 3L9AX 4QUFA 1G291 1U4LA 1K83B 4X65L 4HIMA 3KBXA 1CSPA 3D4WA 3HS0C 2DY8A 1M4VA 1ASZA 3S1MH 1BVSA 4ZAIA 2XVSA 1KNAA 4BY1G 2B2UC 4ZKBB 4R9WA 4DAVA 4X66Q 2F0PA 1BDOA 1B9MA 2A68D 1QOHA 1SMYC 4K0KQ 2DGYA 3K59A 3P75A 1VF7A 3PUZA 5C4JB 3BZDB 4PV1C 3K80C 1STYA 4X3UA 5JJZA 3GTKB 2JA5G 2D0OA 2YTVA 4H7BA 4GKKL 3G48A 3S1NB 3S2HB 3IRBA 1HR0W 4OO1H 3ZJYC 4P72A 2WACA 2QA4A 5CV6A 2IT1A 3HOXG 2WAQB 1D1IA 1E22A 1QG7A 5COYA 1QVFA 2F52A 4DV6L 4DR1Q 1VQPA 2OXPA 1AE2A 3R93A 1HNZQ 1PHJA 1HH2P 2B39A 2HCIA 1L1OB 3VA7A 4DR3L 1ENAA 3ND8A 4X3TA 2DN8A 4LW1A 1BO0A 5EPKA 2L15A 1JE5A 3TP8A 3L2PA 1NBWA 1LABA 1NR4A 5DNFA 3B6YA 1B53A 1VQ7A 2F0SA 4OONA 1RIPA 5CV8A 4DUYQ 5D65A 3F2CA 4A3CH 1K3BC 4JI8L 2MP1A 3CW2C 4JPBW 5I9PA 2RDGA 4JI8Q 1W3SA 1CHPD 4C3JB 2DNEA 3H3VI 4DNTB 1F77A 4OEMB 1SFOH 3OIPA 5ISRA 1KQSA 1DONA 3Q24A 3AU7A 4B3TL 2DJGC 2HDMA 2ZTCA 4DR6L 2Y0SE 1HQMC 3HOVG 2UXDL 2GN5A 3S2HH 2E2IH 5C5MA 1G51A 3UE0A 1EUJA 2D62A 4LUOA 3U9SA 3T51B 4BBRH 3EA6A 5AJ3L 4FNFA 1HNZL 1STAA 1UNSA 3CCJA 5IP9H 3MC0B 2CKZB 1A6XA 3UDIA 1EFWA 3RR5A 3DWAA 4RKLA 4FF3A 1EY7A 4X65Q 2VL6A 4KKTA 1K8OA 4LF6Q 3SK4A 3U9OA 2F0IA 2MO1A 1TS3A 1F2MA 3HOWB 2I46A 1Y1VG 5E1FA 1SR3A 2UUBL 4JI2Q 1GO3E 1VQLA 4BXXH 2XRSD 3MXNB 1M8AA 1K8GA 2NVXB 2I5LX 3AB9A 3G6JB 1EIHA 1YNNC 4NMZA 3VYSA 3HOWH 2JK8A 4CJ0B 1CI3M 2Z6KC 4H02A 2R93G 2NZ1D 3CAMA 4HCSA 4EQOA 4A3BB 3KK7A 3FDTA 3HKZB 5C5LA 5FJ8G 2JA6G 1DYQA 5FLXE 2E2DC 2EYLA 4K0KL 3LWEA 1FJGL 4DK6C 3J81c 1E2VA 3FRPB 5ELBA 3CHBD 2NVTH 2JN4A 1UUPA 4IUVA 4MTNA 1SYCA 3X3MA 3STBD 1D5XC 2B8FA 1H9KA 4A3BG 2YU9H 1CQVA 2WB1E 1OXVA 4DR7Q 4G4KA 2C5CA 1LYLA 1QNUA 2TSSA 5JJKA 3I70A 3S15B 2JSOA 1U0LA 2K52A 3W3AA 2N78A 1WTXA 1IW7C 3E3XA 1W6JA 1PH9A 1JJGA 1T5EA 3S2DH 2RDHA 3FKIB 3D0FA 4P75A 1JJCB 1F2LA 4DK1A 2IW3A 4LF8Q 4OGQC 4CDEC 1CKOA 1A3VA 4BS9A 2AQ1B 4L6TB 4YHHQ 4DNIA 4Q0FA 2J0TD 1NR2A 1GD7A 3E5SA 4X3SA 4LF4Q 2NWGA 4XQJA 5IYDH 2OTLA 1PH1A 1X54A 2I07B 2ZM6Q 2R6GA 3T56B 3J81E 4JV5L 1RL2A 4LF9L 3PO2H 3D4DA 4Y7NH 3HOUG 2WB1G 4IZ8A 4A3JH 3M3YH 2I5MX 1EQQA 2XRQD 2KECA 5KNDA 3BS1A 4K14A 4CJ2C 1N34Q 1H9SB 1PH4A 4CDCC 2F3WA 1VQAA 5AFWA 1XXGA 2RDFA 1JOQA 1XTDA 1PFSA 1F9RA 2IL8A 3HKSA 2HHHL 2KQ3A 5JEAH 4J8QA 1C4QA 1IBLQ 4DAYA 1EY4A 4FO2A 2Q2UA 1EEFD 1CZWA 3OMCA 3GTKH 2QKIC 3G4SA 4AYBB 3CC2A 5EKKA 1A62A 3NE5B 1W6KA 1SFOB 5LMNL 5IP9G 4JBWA 3NTHA 1D5MC 3H15A 2A6HC 1SXTA 1PA6A 1IKLA 1VDZA 4ZRZA 3NHHA 3KUPA 1PMRA 3NWSA 4JI3Q 3QIAA 1XMQQ 2J4XA 3PV0A 2QEXA 3Q6SA 5K36H 2F0OA 4A3IB 3GTOB 5LMUQ 1NMFA 2E76C 3NELA 1GUOA 4JI1Q 2KCNA 1EQRA 4A76A 1JOKA 2VS1A 3PO3H 1I5FA 1YNXA 1K83H 3I90A 1NY4A 1G6PA 2MPMA 1SDFA 5M9OA 2BA1A 4F8MA 1YZ6A 1BCPD 2BE5D 2E75C 1DGSA 4IALA 5CMDA 3DXJC 1YITA 5IP7H 5LHY1 4KLKA 3HG9A 2F0LA 2EDGA 2R92H 4KY5A 5LL6S 4DU9A 3GTPB 2OWOA 1YHBA 4HJ5A 4DR4L 1JE4A 1MSGA 4DR2Q 3W5OA 1I6VC 5IGCA 2JA7G 1F9SA 4CDFC 2K5DA 2A74C 1TWGB 1WTOA 1SYBA 4X64Q 3DUZA 2JA5B 1PH8A 3EIVA 5IE8A 1VQ5A 4LFCQ 3D31A 3RD4A 1Y8NB 3SHLA 2JA8G 1RJTA 3VYRA 1EY6A 1HXYD 2PW7A 2K1BA 4X64L 2K5HA 1N33Q 3S1MB 1SAPA 5CBEE 3N6RA 1VQEA 2SNMA 1BF4A 4TRDA 3S1RB 3M3YB 4DR2L 1PTOD 3VR4A 3NWTA 2G5DA 4A3GH 4JI7Q 1HNXQ 3G71A 3C1EA 2AWOA 5CGKA 4C3IB 1YI2A 5M5YH 2K28A 5JOBA 4IUTA 5IYBH 3W1GA 5CR3A 3MA2B 1EYGA 1XMOQ 3I3CA 3M7NA 5M5XB 4UY8C 3S16B 4RGTA 1Q1BA 1TVXA 4A93H 2E74C 3SK6A 1A2TA 2PZUA 2KCTA 4ZYSA 1NSNS 1UE7A 3S15H 1IBMQ 4XIGS 2K04A 2Z4IA 5E3FA 2N88A 4DV1L 1AP0A 1E3PA 2Q8TA 3K7AB 2OCEA 4KK7A 5HY6A 2F1MA 1CKNB 1XPUA 1PLFA 2NVTB 1VQJA 2Z1CA 5GAEC 2L1BA 2L12A 1XX8A 3PUVA 5C3WA 2H1EA 3CQZB 1AE3A 1G2TA 1TS4A 4IURA 3GO5A 3R8BA 5FLXc 2F0DA 4U673 2M9VA 4A3BH 2C9OA 3KLSA 2NZOA 1E24A 4DUZQ 1SNDA 1Y8OB 3E9IA 4BY1H 1I50B 4HSVA 4APVA 4BBSG 3I4NH 4RGMA 1CHQD 1TWCH 1CA6A 2EY5A 1IXRA 5IGBA 2R93H 1EOVA 2KHSA 5BR8L 3F2UA 4JI5Q 2L9HA 2HCCA 3IFTA 4JBMA 3V96A 2HT1A 1MI2A 3TZDA 1FNVA 4YHHL 4BBSB 2UXDQ 1LM0A 3K58A 3KOJA 4TSSA 4BBRB 3I91A 4YWLA 1N9WA 3RUZA 3BVZA 1B8AA 1Q12A 1TWFB 1JWUD 1PRTF 1EEID 1EOTA 3A56A 4GOPA 4PZ8A 4R8IA 1B44D 1S72A 3OWEB 4QIWB 1B3QA 4QB4A 1Q82C 3H91A 1JCKB 5BN4A 1G2SA 4A3KH 3S9WA 1STGA 3R2TA 3HOXB 1BBWA 4KD4A 1YVCA 2WKCA 1XPRA 1AH9A 2A1AA 5EPJA 4DV0L 4U68A 5CV5A 4XYQA 5C3XA 4IQZA 1DXMA 4HAEA 3NQTA 4A3CG 1HUMA 5IT9E 2G9DA 5EKLA 2L0CA 3GQBA 4DR1L 4OWXB 2BH2A 5I9OA 4HJ9A 4H13C 4QF4A 4RAUC 3WDNA 4K5XA 1H9SA 5JEAG 4V190 4RH6A 5D3DA 1TXYA 4POFA 1B2TA 3E0EA 4IJLA 4NXMQ 1ET6A 1VQDA 4DPGA 5IOCA 2IY5B 2HHHQ 4A3DB 2A6ED 2R61A 1CT1D 3CQZH 3G7LA 4O2DA 1VQHA 4C2MB 4FF2A 3EQLC 1KTKA 5IGFA 2FJ2A 2WAQG 3VR5A 1SNPA 4FVMA 4LF8L 1XWEA 5M5YB 1YJNA 3EBEA 1N36Q 5KNCA 4LFAL 1C48A 2WAQE 3QO2A 1GUGA 2EY1A 3KBGA 3I4MB 1MJCA 1XMQL 5G3LD 1B1ZA 5J39A 5FOBB 4IOAA 2XIWA 3E9HA 3M4PA 1IL8A 5JAVA 5I2YA 2B2WA 1QE6A 1D7QA 2RHQB 3ULPA 1HNWL 3MHBA 4JG2A 1K28A 4KJNA 4N9TA 4A75A 2KJXA 1HZ9A 1J5EQ 1ICFB 2JA5H 2KENA 3GTJB 1L0XB 3E0JA 3OHXC 5IY0A 3CCMA 2UUAL 2K03A 4JI7L 4LF7Q 4BBSH 1WJJA 1UE1A 4K2LA 1KD1C 1K9MC 4I7AA 4B9WA 4OX9L 4OWWB 4DR3Q 2EQSA 3NXWA 1NUCA 4G7ZC 2BE5C 2MO0A 2Z9HA 1ZKOA 4O0AA 3PIO3 3M85A 1N33L 1EYDA 2UUAQ 5C4XH 2E5LL 2RHSB 4K2KA 3W2DA 1AZPA 3RMHA 4I7ZC 2F3VA 4HTHA 4HIDA 4LF9Q 5K5PA 2F0WA 3NQIA 1HNWQ 4DV0Q 2B2WC 1X55A 1EYCA 4OIJA 2E5LQ 4A3EG 1D2BA 1DJRD 1AZQA 5IYCG 2A6HD 5H1SE 4A3GG 1TQOA 1XNRQ 1TWHB 4BY7H 2EOTA 2KA7A 1E1OA 3T53B 2MHVA 1EQVA 2B63B 5T1IA 2UXCQ 3N52A 4FXKC 4CHTB 2JA8H 4DR6Q 1HCZA 5HURA 1BBXC 3OSOA 3K7AH 4F87A 1TWHH 3EROA 1I3QB 4B08A 1Y1WB 1FNUA 2KEEA 2F0JA 1VMCA 2ZTEA 2PQAB 2A5HA 2F0NA 3RLNA 1SMXA 3GTGH 1EWCA 2J7ZA 1KL9A 4LK1C 1KC8C 3HOVH 4K8JA 3VDYA 2OF1A 2O2LD 5KIXA 4I65A 4JI0L 2D5DA 3H0GH 4G7OC 1S5DD 3DWPA 1H9RA 4IPHA 5C44G 2B2TA 2D2CC 5C4XB 3QOLA 4M1UB 4AQYL 1X6OA 2CCZA 1GOZA 5IWAL 1I4HA 4LFBQ 1LUZA 1X32A 3TRZA 1O7ZA 2XSCA 5IT9L 1WTVA 5CV4A 3S1RH 1HZBA 2N49A 4DK0A 1WTQA 4P74A 1NTGA 2AKWB 1QCBD 1CKNA 2K6AA 1EWHA 1E1TA 4ZKCB 2EXZA 4Y7NB 4AQYQ 2LXJA 2A8VA 2K7VA 2VW9A 3C2PA 1DOMA 2M00A 4C3HH 3J81j 4QCLA 3JAME 5FJ8H 3I55A 1PDQA 2JA6H 4DGZA 4KV6A 4DA2A 2P5ZX 4YY3L 4HSPA 4ME5A 1IW7D 3A74A 3URYA 4PMBA 5JPNC 2PQEA 2EZVA 1N8RC 1N34L 1A3UA 1VQBA 5JPMC 1WFQA 1ESFA 2WV6D 1JR0D 1NCVA 1HNXL 1X3GA 5IWAQ 3GTQB 4GOPB 4PZ6A 3PUWA 3TS0A 3CCRA 3STBC 2WINB 3M4QA 1V1PB 1GUSA 3HOYH 3H09A 2MNAA 4JI0Q 1EY5A 3TSSA 4KHPL 1UWVA 2EY2A 2LY7A 3DHQA 4X62L 2EY6A 2QGQA 4IOCA 2SEBD 4E6IA 4KJOA 3OMGA 5DM73 2NN6I 4GN4B 3NTIA 3PO3B 2VY3A 4L5RC 2B29A 3EN2A 4NB3A 5M3FB 2L4NA 1Y1WG 4L5QA 1V9PA 4R8NA 1W2BA 3HOYG 4PQXA 1QB5D 2AQ3B 3QWNA 4O42A 5KYLA 4A3IG 1SYDA 4PMWA 3DMUA 4KKSA 5LMNQ 1KAWA 2EPBA 1AFPA 2F0GA 5IT9c 3K0YA 3SK5A 2HUGA 1YHAA 2EYMA 2SOBA 1H9MA 3NBIA 5I4DA 3UDXA 3VYTA 4NPSA 4DV2Q 4A3IH 3BVMA 4B3MQ 4MN3A 4IFDG 1TR5A 3F8TA 4WRDA 2ID0A 3SGIA 5FO8B 1B3AA 4P2CB 1XYIA 3RN2A 2A19A 1HQRD 4EQNA 2OTJA 3RZOB 1PZID 3I7FA 1SJHD 3SE0A 1E7ZA 2NTTA 5KEEA 2E2JH 2CQAA 3D6WA 1Y1VH 2RA4A 2BA0A 3S17B 2F4IA 2HQLA 4YCUA 4POGA 2WP8J 1NJIC 2Q2TA 4ABNA 4KI0A 3IAYA 5GROA 1AN8A 2MGSA 1GUWA 1ZXTA 2LS01 4IO9A 3GTJH 4JI4Q 1RF2D 4KMUC 4LFAQ 5FLMH 1IYUA 1CKMA 3BZKA 4DV4Q 1WCMH 3MXPA 4KY6A 4IUUA 3V2TA 5C3EG 4ALPA 1SNQA 2JEAI 1SE4A 2B2YA 1EIGA 3BYTB 5ELCA 4G7HC 1CA5A 4R4OA 1RHPA 4RKBA 1CK1A 4JVZA 1HR0L 3I4NG 2Y0SB 3NSWA 3MEFA 2MJ8A 2R3ZA 5LMUL 1MBYA 1I4RA 2WFWA 4YIJA 3I4MH 1LACA 3EJIA 1YEZA 3M4OH 1QWYA 4QMGA 1HPCA 1JT8A 1NE3A 4P71A 3TBIB 1RTNA 5KYIA 1QVCA 4RCOA 3DM1A 5HGTA 3P1HA 3FKIG 2OQ0A 3GTLH 5HGQA 4UP8A 1GXDC 5LL6X 3HKZG 4JOIA 4ZUIA 2Q8IB 1JICA 1MIUA 2IX3A 2F0MA 1DOKA 4A3DH 4DFAA 4DV4L 2Z0SA 4A3MH 3FKIH 4A3LG 1I4QA 3C3LA 1RODA 1TWFH 1EU3A 2A68C 1IBLL 3K5OA 2VQEL 2F0QA 4C3JH 4GNXC 5I6YA 4GKKQ 1B50A 3J80E 1T9HA 2K50A 4LUVA 2IPKD 4L63B 5CV7A 2A6EC 1RCVD 1ML0D 4KN7C 3C46A 1H9JA 2YU9B 5DLQE 2F0FA 2VB2X 2DUDA 1R9TB 4JYAQ 5CC4A 3K5LA 2YYZA 2D9UA 2PYKA 5C0XG 5DAUA 3S16H 2FMMA 4C3IH 2EYOA 4A3LH 3S1QH 2ZJPA 2CWPA 3HFZB 4A3JG 4LJZC 4A4IA 2ALYB 2AMCB 4JI6L 1II3A 2TMPA 3CCVA 4KKUA 2L11A 4C3IG 1QJOA 2PQAA 5JJIA 1EY9A 3KF6B 3SK8A 4JI6Q 3CMAA 1VQMA 4K8IA 4DKAC 4MZ9A 1VQ8A 1YIJA 1U4RA 3AFPA 4IUQA 3NK9A 3GTMB 1FJGQ 4JYAL 3HOZB 3AMUA 2K14A 1I4XA 2HIVA 2KHIA 1XTCD 4HR7B 1KRTA 3OTOL 3T1YL 3T4AC 3T1HL 1KRSA 1Q8KA 1EIYB 3TP6A 3CC7A 3P7JA 3BU2A 5C3EB 4NXML 2Z6KA 3CF5A 5DEHA 1VQ6A 2VZAA 1EWIA 5D3IB 1QUQA 4GOPC 1K0RA 3PMFA 2O5IC 3S14H 1I4PA 3IFDA 4RMFA 4OELB 1EZ6A 2PI2E 4LFCL 3NBHB 3PQIA 4GKJQ 3MTSA 4LF6L 1L2FA 1TU2B 5M3FG 4HJ7A 4YCWA 3RZDH 1SNOA 5DM63 5TSSA 2N55A 4OWTB 3O13A 4OO1I 1CZGA 4LFBL 4N8X1 3PSIA 4OXPA 2KBNA 1STEA 5C4HA 3VA5A 2GVBA 2D0PA 1X9NA 1Q86C 1YNJC 1BOSA 5C6AA 3OYYA 4RFBA 1RKNA 4Z9CB 3NENA 1UE6A 1C9OA 1YJ9A 4R4TA 1VMPA 1X3QA 3A8JE 1V43A 4R4CA 2F0UA 2KCMA 1JJ2A 4HCEA 3CCUA 2B2VC 3T1HQ 2R92G 1A15A 1JB3A 1TIID 4GS3A 3WWVA 2RBMA 2NN6G 2ATWA 5J3BA 1U5KA 3SVMA 1WYDA 2JA7H 3CD6A 3HOYB 4C3HG 4N9PA 2BH8A 3ULJA 4IFDJ 4JI1L 3PIP3 2YV5A 2UXCL 1E2ZA 1PRTB 2K33A 4KHVA 4A3MG 1WTHA 2E2HH 5IP7G 1FGBD 4B3TQ 4LAAA 3FEWX 2VQFL 1N36L 4RG1A 5F2DA 2NN6H 1HRJA 3A5UA 3TMEA 4R4IA 1KDCA 1T5XD 4UAIA 3P20A 3J80i 5IIFA 4PMCA 4HIKA 4EGVA 4B3RQ 1KABA 1WVLA 2EYHA 4CKBA 2PPBC 1FR3A 4RCNA 5T1GA 4C3HB 1VQIA 3GV6A 2IX1A 4JI4L 5FLXL 4A3GB 1PFBA 5IYBG 2OT2A 1I4GA 3KDFA 1HZCA 1IYVA 3GV3A 4B9XA 4IFDI 1R4QB 1XNRL 3I72A 1A8VA 5A2QL 1NMGA 1KXLA 5J1ZA 4A3JB 4HMJA 2K01A 2B3GA 1DD2A 2R7FA 3HEJA 2BDOA 1V8QA 4GLXA 1WI5A 2E2HB 1VF5C 4A3EH 1PTOC 3TZUA 5I2XA 2N3SA 1B4OA 1EFID 3S14B 3CCLA 4ZK9B 4DV1Q 2XN9C 1FL0A 4X3KA 4LF4L 1S5ED 1D5ZC 1WTRA 4PNYA 3UDGA 5AJ3Q 5EJWA 2AWNA 1GHKA 5IODA 4OL7A 2QW7A 3GTPH 4IUPA 1SLJA 3BDOA 3HOZH 4FF4A 2B63H 1OXTA 4DUZL 1O7IA 1ILQA 2RKSA 2A73B 5C3EH 3M9BA 4UP7A 1Q46A 3A55A 3K6OA 1LT5D 1TY2A 1M90C 4AIMA 4QY7A 2UXBL 1CSQA 2JXMB 3HGBA 4TKOB 3M4OB 1VQNA 2Z4HA 4Y52H 2Y0SG 5JJLA 1A63A 2VQFQ 1EZ8A 3MWYW 4L5TA 1BR9A 1F2YA 3GTMH 4L5SA 3QR8A 3F1ZA 2ZXRA 5BN3A 5FLMG 3OPOA 1N32L 1BCPC 4O1NA 2H4OA 2B63G 4OO1G 5CYUA 2EYPA 2CW0C 5IGEA 3S1QB 3CKIB 2ZTDA 1TS2A 2IX0A 1A0IA 3F2BA 1KDAA 2X69A 3PCOB 2RCNA 1L1OA 1O78A 2CH4W 1TKWB 3OOCA 3UI2A 2JP1A 3QOJA 1VQ4A 3ND9A 4DV5L 1QVGA 3HOWG 1KHIA 5E4XA 4GN3B 2EYFA 5L37A 1XPOA 3S24A 4XQQA 5CV9A 1R4PB 4LF7L 3TDQA 2XTIA 1XMOL 4DN4M 4G57A 2N8NA 5C0XH 3KF8A 4A3MB 3SEBA 4B3RL 3HP3A 3ERQA 4JC0A 1DCZA 1C0AA 1JMCA 3LNNA 4RA8A 2EXDA 1VQCA 1D8LA 4JW0A 4XT3B 2FINB 2ZJRA 3D4RA 2PO4A 5KRUA 4J1MA 1NAPA 3TN2A 2Z6BA 5GAGC 3HRZC 4YWKA 4LMQD 3CMEA 1WTWA 3LGJA 3MAQA 3JC66 1EYAA 1VQFA 4J15A 2VB3X 3CC4A 1O7YA 3H3VH 3J7A5 4KHPQ 1EL0A 4QGUA 1LT4D 3PIPA 1WD1A 1U4PA 4QIWE 4ZLTF 1PYWD 4DNRB 3MXGA 1QUQB 4RGOS 4XTCS 3NEMA 1S3OA 1EY0A 4OIKA 4A3KG 2LXKA 1P8LA 3L0OA 3UE1A 4IPCA 4ID6A 3QJYA 2XWBB 1F9QA 2R7ZG 3S2DB 1HA6A 2K5QA 4HMIA 1K73C 1S5FD 3DM3A 3S1NH 2PZWA 4HEDA 3J80L 5FKAC 3H94A 1JWSD 3LWUA 4YY3Q 4K6DA 4GZYC 2WIIB 4DR4Q 4BXXG 5C4JH 1KNEA 2CHBD 3VR3A 1TS5A 1A3TA 3L7ZC 1S5BD 2PNHA 3GTQH 3BJUA 3NTKA 1Z47A 1OXUA 4C1NK 1PXUA 3KF6A 1HFGA 3SR1A 3JAMc 4F7XA 1IKMA 2F3IA 4JOIC 4TVAB 4A3KB 4DXFA 2B8GA 1LTLA 4J6HA 2ES2A 2E2JB 2RQXA 1G91A 1GM5A 2ZT9C 3ICEA 1DM0B 2LFNA 4V0BA 4AH6A 1LV9A 2X6LA 3RZOH 1RTOA 1B70B 1WD0A 5ELDA 3T16A 1WCMB 3GP7A 4A3FG 5EPLA 4QUCA 1I94L 1SYFA 2EJGC 2KHJA 1GUNA 4DV7L 3Q8DA 2NVXH 3ERSX 4FXDA 2L55A 2CVRA 4HN7A 5M3FH 3IKJA 4JI2L 3EVQA 4CKCA 2F0EA 1AW7A 5NUCA 1CFMA 2EJMA 3KLRA 1PVOA 2FFKB 1C7YA 2AUJD 1Y1VB 1RD9D 4R4QA 4IUNA 1YNND 1PRTC 4MHEA 1GUTA 1KLUD 2VXWA 1IBML 4IPDA 4AYBE 1E2WA 3ULLA 3X3NA 1STHA 3GDEA 1LTGD 4BY1B 5IYDG 2FXQA 3MFGA 2VNUD 4FP5D 1STBA 2ENBA 4IJHA 1OO9B 1HFNA 3HOVB 1VS0A 3ITPA 5M3MG 1I6HH 2ASBA 4EVOA 1X3EA 1P16A 3HOUH 1JQYD 1HUNA 1Z7TA 2OQKA 3J80c 2OEOA 1O7LA 2VUMB 5GAHC 4DXGA 3FMCA 4C3JG 3GTLB 4DAYB 2QF7A 3PO2G 1V1OA 1PFNA 2KVMA 3A5ZB 2B2UA 2R7ZB 5J22A 4A3EB 1JOOA 3JAML 5M3MB 3I4LA 1CQFA 2K05A 3TREA 1K8MA 3A8IE 1YBYA 3OTOQ 5D14A 3BZCA 1IYJB 3K5MA 2ICEC 1QILA 3TS2A 4L8JA 2FMCA 3CRLC 5G3LF 2Q2HA 3PUXA 1PTOH 1PH6A 1VQGA 2JA6B 4X66L 1ASYA 2RF4A 3JAMi 3SXHA 2WKDA 3HKZE 5M5WH 2IHEA 3H0GG 2UU9L 2K32A 1RDPD 1UEAB 1HZAA 3FHWA 4CDDC 2DY7A 5E7NA 4HJ8A 5FK9C 1B7YB 4EQ5A 1Q8IA 4S3SA 4B3SL 5EAYA 5ELEA 1FNWA 3ER0A 3E6ZX 1WCMG 2UU9Q 4FF1A 4KHZA 1PH5A 1Q90A 4DK3C 2V1CC 1PH3A 2G9HD 3G6EA 2F03A 3BYYB 2XGTA 1BXTA 1ESRA 1TY0A 4DV7Q 4FYDA 2JA8B 3H6MA 3AQQA 1TWAH 1KIXA 2K5NA 2F4VL 3LX0A 4DV3L 4LF5L 1UE5A 4X62Q 3RNUA 1SMYD 4LNQA 1HTPA 1L0YB 3C1FA 1S40A 2BOSA 2NZHA 4UDUC 1PV4A 3MVVA 5ELNA 2PCFB 1J5EL 1IHZA 3R3OA 5C0XI 4ZUJA 2UUBQ 4K5WA 4QJFA 2I0QA 3KF8B 4ODGA 3CPFA 2NVYH 2K75A 1DOLA 2CFMA 3UDFA 1SRUA 3H0GB 1MSHA 3FPUB 4BA2I 2HIXA 3K57A 1V1PA 1F2ZA 1D6EC 2KOLA 2XNAC 2EIFA 3FVQA 2Q2IA 1LTRD 5EKIA 4K6LA 3U4ZA 3PO3G 3VYUA 5EGTA 1PRTD 3RZDB 1Z6HA 3MXNA 4LUZA 3W1BA 2E8GA 5FO7B 1SE2A 1Y1WH 3WOEA 1KLGD 3K7UC 1I3QH 2ZM6L 3TP5A 1PH7A 2ZJQA 2H5XA 4MTKA 2R7DA 4FDBA 4BY7B 4KTAA 1SE8A 2F0HA 5C0XJ 2A69D 3GTGB 2Q8RE 2IWHA 5M3MH 4JCVE 4GN5A 5GQOA 3TEHB 1SE3A 4IFDH 4MNOA 2VUMG 5C44B 5C4XG 4NW2A 2B2TC 2NVYB 4JBJA 5KNBA 2UUCQ 5CORA 4BWGB 2RSNA 3GD7A 2VUMH 2QDLA 4B3SQ 4QQBX 4RHSA 5JVG3 3R2IA 3AYHB 1XNQL 1EIFA 2KUMA 1SYGA 3RN5A 1ZYRD 2NB0A 1JB7A 4CBVA 4F88A 3AEVA 1WOCA 1NNXA 4PG3A 3D3RA 1HTLD 4A93G 5C4ZA 1O80A 3MXUA 2V4DA 3OW7A 1H95A 2I5HA 4UPAA 5LMNW 2NBFA 3KJOA 1SNMA 1MJEA 1PYBA 4CJ1B 1R9TH 1VQ9A 4DAPA 4CKEA 2F4VQ 3PF5A 3PGZA 5I6WA 1SBBB 3KJPA 1JC7A 4DR5Q 3PUYA 1LT6D 3I4NB 2L5TA 1ILPA 1Q7YC 1PH2A 4WJ4A 4XYOA 2IHFA 4PZ7A 3QB3A 3HOZG 1Q3LA 2ZXOA 1DZ1A 2NTSA 3Q0AA 1Q1EA 2MUYA 1FGUA 1ONLA 1JWMD 4YCVA 4DR5L 1D1KA 2RCFA 2PMZE 1E0BA 2JQOA 1PFMA 1V1QA 4JI5L 3T1YQ 3J7AF 3D8GA 4WORA 4A3FH 2UXBQ 3J81L 2WB1B 3D6CA 3HOUB 1LO5D 4UHVA 1L0WA 1LTSD 1IBKL 4HIOA 3NPPA 4R1JA 3KFUA 3F2DA 1OTCA 2XWJB 3PF4A 3BG3A 4A3DG 2HD3A 1X65A 3DWQA 4H0LC 3DLLA 2QCPX 4A3FB 1QZHA 1PZKD 4WFN3 1IBKQ 2Z8LA 4X6AH 4C2MH 4MIUA 5IGGA 4RGNA 4YWMA 3KDFB 3OWFA 2JYOA 2GA4B 1VQKA 3ZYYX 3RLOA 2LMCB 2JA9A 3IL8A 3A7AB 3Q23A 1XNQQ 1MKHA 4H44C 3CU7A 3I4MG 4EQPA 1MGSA 4KY7A 4EX5A 1G6ZA 1PZJD 1X3PA 3A0JA 3HZXA 1J6QA 2R93B 1TWCB 2CW0D 2LKVA 2M2LA 1PTOF 3VR2A 2HQEA 3FPPA 3HOXH 4RHRA 3S17H 3A7LA 1X56A 1FVIA 2GVAA 4XDXA 1GHJA 2PI2A 2ZXPA 4FXGC 3CPWA 4XT1B 3I56A 1YHQA 1BKBA 4BY7G 1SN8A 1CUKA 4WJWA 1STNA 1GVPA 4DUYL 3RLFA 2VQEQ 5ELOA 2K5VA 2NVQH 4P73A 1HA5A 4GNXA 1G8ZD 3NBHA 2RSOA 3QG1A 5EBCA 1I50H 5EQ0A 2DJFC 2C35B 5JEAJ 2NVQB 1HHVA 4KD3A 2YTYA 4DAMA 5A2QE 3FP9A 1EQTA 1LTAD 4RWSC 4BBRG 4WJ3M 2AHOB 1K8AC 3I4OA 1EU4A 3NUCA 1HJPA 5E4WC 4DV6Q 1XJVA 1Y8PB 4JBKA 5KGUA 2E2IB 2F0TA 3KYHC 3NP8A 4XQNA 4UP9A 4A93B 1S5CD 4XXEA 4IN3A 5IYCH 1VQOA 2UUCL 4OHJA 4JK1C 3BVGA 2AQ2B 1ZEQX 1UAPA 2EJFC 1CTMA 2PW5A 1WTPA 1JORA 1OXXK 2SDFA 2MQHA 4DV3Q 4LF5Q 1YJWA 1F9PA 2X6GA 1SNCA 1SEBD 4JI3L 1ENFA 1TT2A 4BA1I 1ICWA 3J81i 5CBAE 2JEBI 5K36G 3J7YW 4DV2L 3TQYA 1KAAA 5A35A 2YTXA 1LTBD 3U50C 5FO9B 3VR6A 1SYEA 4NXNQ 1K3RA 2SNSA 1J8IA 3KLSX 3I8ZA 3KLWA 1BNZA 1VCIA 2K4KA 4TQUS 1BUVT 1SROA 1TWAB 4C56C 1B9NA 5ELFA 2CH4A 1Q81C 4GKJL 2ICIA 3K0XA 3DEPA 3I2ZA 3OIQA 1KDBA 2EVBA 5M5XH 2BCOA 1J9OA 1IL2A 1CM9A 1BBUA 4B3ML 1PYSB 2NYZD 3A54A 4ME3A 5EBDA 3WOFA 4DF7A 3L3OC 1AEXA 2IJ0A 4NDXA 3U58A 3MZ5A 5JVH3 3SDZA 2FHTA 1Y69U 3Q22A 1X3FA 4ZQ3A 4OX9Q 2RVLA 4JV5Q 2CQOA 3CCQA 2BDNA 1U4MA 2DNCA 4ZCKA 1MHWC 1LT3D 3K8AA 1U9RA 3T13A 1GKHA 4NKLA 2JA7B 2KCCA 3EFXD 4GNXB 5BN5A 1YNJD 2LSSA 2QEJC 4Q5VA 1EY8A 1OXSC 4C1NI 4HJAA 2F0VA 4IPGA 1Z9FA 4GLVB 2PNRC 3U4VA 3V05A 1GJXA 5M5WB 1M1KC 1QNKA 2NUCA 4AYBG 2O5JC 3OW2A 5BR8Q 2PZTA 1PTOB 3H3VC 3GTOH 4GLAC 3CCSA 4CGYB 4K5VA 1LLRD 3TP7A 1ZYRC 2HDLA 2B2YC 2CWAA 3M7GA 5C44H 3K81C 4DR7L 1BCPB 1TWGH 3J7AV 3I73A 1FYCA 1ET9A 1QZGA 2B2VA 1L1OC 4KN4C 1IZ6A 4ILWA 2R7ZH 1I6HB 3AFQA 1K0SA 3DEOA 4NP5A 5IGDA 1N32Q 2F0KA 2R92B 1SSOA 3CXCA 1UEBA 2JE6I 3MEHA 3CCEA 1FD7D 3PIOA 1S4ZA 1I94Q 1Y14B 2QILA 3M4YA 3J7ZC 1C8CA 2A69C 1MD2D 3CP0A 1BCPF 2EE1A 4DV5Q
chains in the Genus database with same CATH topology
1YBYA 3OTOQ 3BZCA 1AE3A 1IYJB 4LWCA 4NXNL 3GO5A 3TS2A 5FLXc 4A3BH 5DLQE 2NZOA 2DUDA 1E24A 4JYAQ 2Q2HA 4DUZQ 3PUXA 2YYZA 3E9IA 1VQGA 4QL5A 1PH6A 4BY1H 5C0XG 3S16H 4X66L 1ASYA 2RF4A 4APVA 4C3IH 3JAMi 4BBSG 3I4NH 4A3LH 3HKZE 3S1QH 5M5WH 1TWCH 2CWPA 3HFZB 2ZJPA 4A3JG 1IXRA 2IHEA 3H0GG 2ALYB 4A4IA 2UU9L 2AMCB 1EOVA 2R93H 4JI6L 5BR8L 2JJQA 5GADC 1HZAA 1HR0Q 3FHWA 2MFIA 5E7NA 4JI5Q 3CCVA 4HJ8A 1G291 1B7YB 4EQ5A 4X65L 4HIMA 4JBMA 1CSPA 2PQAA 2HT1A 4B3SL 5JJIA 5EAYA 3KF6B 4JI6Q 3ER0A 4YHHL 1ASZA 3S1MH 1BVSA 1WCMG 3CMAA 1VQMA 2UU9Q 4DKAC 4BY1G 4KHZA 4MZ9A 1PH5A 1LM0A 2UXDQ 1VQ8A 3KOJA 4DK3C 2V1CC 1YIJA 1PH3A 4YWLA 1N9WA 3G6EA 4X66Q 3AFPA 1B8AA 1Q12A 2XGTA 1FJGQ 4JYAL 4DV7Q 2K14A 4GOPA 4K0KQ 2DGYA 4PZ8A 1S72A 2HIVA 3PUZA 3AQQA 1TWAH 1KIXA 2K5NA 2F4VL 2KHIA 1KRTA 3OTOL 3K80C 4DV3L 4LF5L 1UE5A 4X62Q 3RNUA 1Q82C 3T1YL 2JA5G 4LNQA 3T1HL 2D0OA 1KRSA 1Q8KA 2YTVA 3G48A 1S40A 1EIYB 4GKKL 2NZHA 3CC7A 4A3KH 1PV4A 3BU2A 1BBWA 5ELNA 4NXML 3IRBA 1HR0W 2Z6KA 1YVCA 3ZJYC 3CF5A 4P72A 1J5EL 1XPRA 2VZAA 1EWIA 5C0XI 2QA4A 1VQ6A 1AH9A 2A1AA 1QUQA 4GOPC 2UUBQ 2IT1A 4QJFA 1K0RA 4DV0L 3KF8B 2I0QA 3S14H 3CPFA 3HOXG 2NVYH 2K75A 2CFMA 3UDFA 1SRUA 4RMFA 4LFCL 2PI2E 3NBHB 1E22A 4GKJQ 4LF6L 1L2FA 1QVFA 4A3CG 2F52A 5M3FG 4HJ7A 2BH2A 4YCWA 4OWXB 4DR1L 3RZDH 4HJ9A 4BA2I 2HIXA 4DV6L 4DR1Q 4OWTB 4OO1I 1VQPA 2EIFA 2Q2IA 1AE2A 3U4ZA 4OXPA 3PSIA 5JEAG 1PHJA 1HNZQ 3PO3G 1HH2P 2KBNA 4LFBL 1TXYA 1L1OB 4DR3L 2GVBA 4POFA 3E0EA 2D0PA 1X9NA 4LUZA 4LW1A 3W1BA 2E8GA 2L15A 1JE5A 3L2PA 1Y1WH 1Q86C 1NBWA 3K7UC 3OYYA 1I3QH 3B6YA 2ZM6L 1VQ7A 3NENA 4IJLA 1UE6A 1PH7A 2ZJQA 1C9OA 1YJ9A 4NXMQ 2H5XA 4OONA 4R4TA 1VQDA 1RIPA 4DPGA 1V43A 4R4CA 2KCMA 4DUYQ 1JJ2A 3F2CA 3CCUA 2HHHQ 4A3CH 2IY5B 2R7DA 4FDBA 3T1HQ 2R92G 4JI8L 1SE8A 5C0XJ 3CQZH 4O2DA 1VQHA 4GS3A 3WWVA 3CW2C 2NN6G 2WAQG 4JI8Q 1W3SA 5M3MH 2ATWA 4JCVE 4GN5A 3H3VI 5J3BA 1U5KA 4LF8L 1WYDA 5GQOA 3TEHB 2JA7H 4MNOA 3EBEA 1YJNA 1SFOH 1N36Q 2VUMG 3CD6A 5C4XG 1KQSA 4LFAL 2BH8A 2WAQE 4B3TL 3ULJA 4JBJA 4IFDJ 4JI1L 2ZTCA 2YV5A 4DR6L 2Y0SE 2UXCL 3HOVG 2UUCQ 1MJCA 2GN5A 3S2HH 2E2IH 2UXDL 1XMQL 3UE0A 1G51A 1EUJA 2D62A 4LUOA 4A3MG 4BBRH 2E2HH 5IP7G 3GD7A 2VUMH 4IOAA 5AJ3L 4B3TQ 1HNZL 4B3SQ 4QQBX 3CCJA 5IP9H 2CKZB 3AYHB 3UDIA 2VQFL 1EFWA 1EIFA 3E9HA 3M4PA 4RG1A 3RR5A 1N36L 1XNQL 4X65Q 3RN5A 1D7QA 3A5UA 1JB7A 2VL6A 2RHQB 4LF6Q 3AEVA 1WOCA 4R4IA 3ULPA 3J80i 4PG3A 2MO1A 1HNWL 4HIKA 4JG2A 4B3RQ 4A93G 1Y1VG 1SR3A 4A75A 2UUBL 4JI2Q 1GO3E 1HZ9A 1VQLA 4BXXH 3MXNB 1VQIA 1K8GA 1J5EQ 1H95A 2I5HA 4UPAA 5LMNW 2JA5H 2KENA 2I5LX 2UUAL 5IY0A 4JI4L 4JI7L 3CCMA 4LF7Q 3KJOA 4BBSH 1WJJA 5IYBG 1UE1A 1MJEA 1PYBA 3HOWH 2JK8A 3KDFA 1HZCA 1KD1C 1K9MC 2Z6KC 4H02A 4OX9L 1R9TH 1VQ9A 4OWWB 2R93G 3CAMA 4DR3Q 4IFDI 1XNRL 1A8VA 1NMGA 1KXLA 2EQSA 3HOWG 2F4VQ 2MO0A 3PGZA 5FJ8G 3PF5A 2JA6G 2B3GA 4O0AA 3M85A 4K0KL 2R7FA 1N33L 3KJPA 4DR5Q 3PUYA 2UUAQ 5C4XH 4DK6C 4GLXA 2E5LL 2RHSB 1FJGL 3J81c 4GKJL 1WI5A 1Q7YC 4A3EH 1PH2A 2NVTH 4WJ4A 2IHFA 4PZ7A 2N3SA 4MTNA 4HIDA 4LF9Q 3HOZG 1HNWQ 4DV0Q 3STBD 3CCLA 1Q1EA 1X55A 4A3BG 2E5LQ 1FGUA 4DV1Q 2YU9H 4YCVA 4DR5L 2WB1E 1OXVA 2PMZE 1FL0A 4A3EG 4LF4L 4DR7Q 2JQOA 5IYCG 1V1QA 1LYLA 4JI5L 3UDGA 5AJ3Q 5H1SE 3T1YQ 4A3FH 4A3GG 2UXBQ 5JJKA 1XNRQ 1U0LA 2K52A 2AWNA 2N78A 4BY7H 1L0WA 1E1OA 1IBKL 1PH9A 4HIOA 4R1JA 2UXCQ 3GTPH 3S2DH 1JJGA 4DR6Q 2JA8H 3KFUA 3F2DA 1OTCA 1SLJA 3PF4A 3K7AH 3HOZH 2B63H 4A3DG 3D0FA 4P75A 1JJCB 1OXTA 1TWHH 1X65A 4DUZL 1O7IA 3DLLA 5C3EH 3M9BA 4UP7A 1QZHA 1Q46A 4LF8Q 2ZTEA 2PQAB 1IBKQ 3RLNA 4X6AH 1SMXA 1CKOA 4C2MH 3GTGH 1M90C 4YHHQ 4YWMA 3KDFB 4DNIA 1KL9A 4AIMA 1QVGA 4QY7A 2UXBL 1CSQA 1KC8C 1VQKA 3HOVH 3RLOA 1GD7A 2JA9A 4Y52H 1VQNA 4LF4Q 2Y0SG 3VDYA 5JJLA 1A63A 2VQFQ 1XNQQ 1MKHA 4L5TA 4JI0L 3I4MG 5IYDH 2OTLA 3GTMH 1PH1A 4L5SA 3H0GH 3F1ZA 1X54A 5FLMG 4EX5A 2ZM6Q 2R6GA 1N32L 3A0JA 2B63G 4IPHA 1J6QA 5C44G 1RL2A 4LF9L 4JV5L 4OO1G 4AQYL 1X6OA 3PO2H 2CCZA 4Y7NH 3HOUG 2ZTDA 2WB1G 2IX0A 5IWAL 1A0IA 4LFBQ 1LUZA 4A3JH 3HOXH 3F2BA 3TRZA 3M3YH 2I5MX 3S17H 1EQQA 3PCOB 1HZBA 1L1OA 2N49A 1X56A 2RCNA 1FVIA 2GVAA 3S1RH 1N34Q 2PI2A 4P74A 1NTGA 2AKWB 1PH4A 1CKNA 1VQAA 1VQ4A 1E1TA 3CPWA 3I56A 4DV5L 4AQYQ 1BKBA 1KHIA 2LXJA 1SN8A 1YHQA 1CUKA 4GN3B 2A8VA 4BY7G 2VW9A 1XTDA 1PFSA 1GVPA 3HKSA 4DUYL 3RLFA 2VQEQ 1XPOA 3S24A 4C3HH 5ELOA 2K5VA 2HHHL 4P73A 3J81j 4GNXA 1IBLQ 4LF7L 2NVQH 1JT8A 2XTIA 1I50H 5FJ8H 3I55A 1XMOL 2C35B 2JA6H 2N8NA 5JEAJ 2Q2UA 2YTYA 4DAMA 3FP9A 3GTKH 4B3RL 4YY3L 3G4SA 3CC2A 4BBRG 4WJ3M 1A62A 4JC0A 2AHOB 3A74A 3I4OA 1K8AC 1C0AA 1JMCA 5LMNL 5IP9G 4JBWA 1N8RC 1N34L 1HJPA 4DV6Q 2EXDA 1XJVA 1VQCA 3H15A 1VQBA 1D8LA 1WFQA 1PA6A 2ZJRA 4JBKA 1HNXL 1X3GA 3KYHC 5IWAQ 4UP9A 4GOPB 4PZ6A 4JI3Q 3PUWA 1XMQQ 5GAGC 3PV0A 3CCRA 3STBC 5IYCH 2QEXA 3TS0A 1VQOA 2UUCL 5LMUQ 3M4QA 1NMFA 3NELA 4YWKA 4JI1Q 3CMEA 3HOYH 3LGJA 3JC66 1VQFA 1EQRA 4J15A 4A76A 2MNAA 3CC4A 4JI0Q 3H3VH 2VS1A 3J7A5 4QGUA 3PO3H 4KHPQ 3PIPA 1I5FA 1YNXA 1K83H 4KHPL 1UWVA 1NY4A 1OXXK 4QIWE 1G6PA 4X62L 4IOCA 2QGQA 2MQHA 4DV3Q 4LF5Q 1YJWA 2BA1A 1YZ6A 2NN6I 1QUQB 4GN4B 4XTCS 3NEMA 1S3OA 1DGSA 2VY3A 4JI3L 1YITA 5IP7H 4L5RC 2B29A 3EN2A 4KLKA 4BA1I 4A3KG 3J81i 2JEBI 2LXKA 1P8LA 4NB3A 3L0OA 5K36G 4DV2L 2R92H 3UE1A 3TQYA 4IPCA 4L5QA 1V9PA 1Y1WG 2R7ZG 1W2BA 2OWOA 2YTXA 1YHBA 4HJ5A 3HOYG 4DR4L 3U50C 4A3IG 1K73C 3DM3A 4PMWA 5LMNQ 3S1NH 4NXNQ 4DR2Q 1K3RA 3W5OA 2JA7G 1KAWA 3KLWA 4YY3Q 5IT9c 1VCIA 2K4KA 1YHAA 4DR4Q 4TQUS 4BXXG 5C4JH 1SROA 4X64Q 3UDXA 4NPSA 3L7ZC 4DV2Q 4A3IH 1PH8A 2PNHA 4B3MQ 3GTQH 4IFDG 3BJUA 3F8TA 3EIVA 1Z47A 1OXUA 5IE8A 1Q81C 2ID0A 3K0XA 3SGIA 3I2ZA 1VQ5A 4LFCQ 3D31A 3KF6A 3JAMc 5M5XH 3RN2A 2F3IA 4JOIC 2A19A 4TVAB 2JA8G 1IL2A 1BBUA 2OTJA 4B3ML 1PYSB 1LTLA 2ES2A 4ME3A 1GM5A 4X64L 3ICEA 2K5HA 1N33Q 3I7FA 3U58A 4AH6A 1E7ZA 2E2JH 3RZOH 1VQEA 1Y1VH 1B70B 2BA0A 4YCUA 2HQLA 1X3FA 2WP8J 4DR2L 1NJIC 2Q2TA 4POGA 4OX9Q 4KI0A 5GROA 4JV5Q 2CQOA 3CCQA 4A3FG 4A3GH 1I94L 4IO9A 2KHJA 3GTJH 4DV7L 2NVXH 3Q8DA 4JI4Q 3ERSX 1HNXQ 4JI7Q 3G71A 4LFAQ 2AWOA 5M3FH 3K8AA 5FLMH 4JI2L 1CKMA 3BZKA 4DV4Q 1WCMH 1YI2A 1GKHA 5M5YH 4GNXB 1PVOA 2LSSA 1C7YA 5IYBH 1OXSC 5C3EG 4R4QA 4HJAA 4ALPA 2JEAI 4IPGA 3W1GA 1Z9FA 4GLVB 1I6HH 3U4VA 1EYGA 4R4OA 1IBML 4IPDA 4AYBE 1XMOQ 1M1KC 3M7NA 4AYBG 3ULLA 1HR0L 3OW2A 5BR8Q 4UY8C 3I4NG 3MEFA 5LMUL 3GDEA 3GTOH 1Q1BA 4GLAC 2WFWA 3CCSA 5IYDG 3I4MH 2FXQA 2VNUD 4A93H 1YEZA 3M4OH 4IJHA 2CWAA 1VS0A 2KCTA 5C44H 1NE3A 4P71A 5M3MG 2ASBA 1UE7A 3K81C 4DR7L 1X3EA 1P16A 1QVCA 1TWGH 1IBMQ 3GTLH 4XIGS 3HOUH 3FKIG 2OQ0A 3S15H 5HGQA 4UP8A 2OQKA 4DV1L 3J80c 1QZGA 3HKZG 4JOIA 5GAHC 1L1OC 1IZ6A 1MIUA 2R7ZH 3AFQA 4DAYB 1E3PA 4A3DH 3PO2G 1N32Q 4DV4L 2Z0SA 4A3MH 3A5ZB 2IX1A 2OCEA 3FKIH 4A3LG 3CXCA 1UEBA 5HY6A 2JE6I 3CCEA 1CKNB 1TWFH 1XPUA 3PIOA 1IBLL 1VQJA 1Y14B 1I94Q 3J7ZC 2VQEL 5GAEC 4C3JH 4GNXC 4GKKQ 3PUVA 1T9HA 3CP0A 2K50A 4LUVA 4DV5Q 3TREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YBY A;  3OTO Q;  3BZC A;  1AE3 A;  1IYJ B;  4LWC A;  4NXN L;  3GO5 A;  3TS2 A;  5FLX c;  4A3B H;  5DLQ E;  2NZO A;  2DUD A;  1E24 A;  4JYA Q;  2Q2H A;  4DUZ Q;  3PUX A;  2YYZ A;  3E9I A;  1VQG A;  4QL5 A;  1PH6 A;  4BY1 H;  5C0X G;  3S16 H;  4X66 L;  1ASY A;  2RF4 A;  4APV A;  4C3I H;  3JAM i;  4BBS G;  3I4N H;  4A3L H;  3HKZ E;  3S1Q H;  5M5W H;  1TWC H;  2CWP A;  3HFZ B;  2ZJP A;  4A3J G;  1IXR A;  2IHE A;  3H0G G;  2ALY B;  4A4I A;  2UU9 L;  2AMC B;  1EOV A;  2R93 H;  4JI6 L;  5BR8 L;  2JJQ A;  5GAD C;  1HZA A;  1HR0 Q;  3FHW A;  2MFI A;  5E7N A;  4JI5 Q;  3CCV A;  4HJ8 A;  1G29 1;  1B7Y B;  4EQ5 A;  4X65 L;  4HIM A;  4JBM A;  1CSP A;  2PQA A;  2HT1 A;  4B3S L;  5JJI A;  5EAY A;  3KF6 B;  4JI6 Q;  3ER0 A;  4YHH L;  1ASZ A;  3S1M H;  1BVS A;  1WCM G;  3CMA A;  1VQM A;  2UU9 Q;  4DKA C;  4BY1 G;  4KHZ A;  4MZ9 A;  1PH5 A;  1LM0 A;  2UXD Q;  1VQ8 A;  3KOJ A;  4DK3 C;  2V1C C;  1YIJ A;  1PH3 A;  4YWL A;  1N9W A;  3G6E A;  4X66 Q;  3AFP A;  1B8A A;  1Q12 A;  2XGT A;  1FJG Q;  4JYA L;  4DV7 Q;  2K14 A;  4GOP A;  4K0K Q;  2DGY A;  4PZ8 A;  1S72 A;  2HIV A;  3PUZ A;  3AQQ A;  1TWA H;  1KIX A;  2K5N A;  2F4V L;  2KHI A;  1KRT A;  3OTO L;  3K80 C;  4DV3 L;  4LF5 L;  1UE5 A;  4X62 Q;  3RNU A;  1Q82 C;  3T1Y L;  2JA5 G;  4LNQ A;  3T1H L;  2D0O A;  1KRS A;  1Q8K A;  2YTV A;  3G48 A;  1S40 A;  1EIY B;  4GKK L;  2NZH A;  3CC7 A;  4A3K H;  1PV4 A;  3BU2 A;  1BBW A;  5ELN A;  4NXM L;  3IRB A;  1HR0 W;  2Z6K A;  1YVC A;  3ZJY C;  3CF5 A;  4P72 A;  1J5E L;  1XPR A;  2VZA A;  1EWI A;  5C0X I;  2QA4 A;  1VQ6 A;  1AH9 A;  2A1A A;  1QUQ A;  4GOP C;  2UUB Q;  2IT1 A;  4QJF A;  1K0R A;  4DV0 L;  3KF8 B;  2I0Q A;  3S14 H;  3CPF A;  3HOX G;  2NVY H;  2K75 A;  2CFM A;  3UDF A;  1SRU A;  4RMF A;  4LFC L;  2PI2 E;  3NBH B;  1E22 A;  4GKJ Q;  4LF6 L;  1L2F A;  1QVF A;  4A3C G;  2F52 A;  5M3F G;  4HJ7 A;  2BH2 A;  4YCW A;  4OWX B;  4DR1 L;  3RZD H;  4HJ9 A;  4BA2 I;  2HIX A;  4DV6 L;  4DR1 Q;  4OWT B;  4OO1 I;  1VQP A;  2EIF A;  2Q2I A;  1AE2 A;  3U4Z A;  4OXP A;  3PSI A;  5JEA G;  1PHJ A;  1HNZ Q;  3PO3 G;  1HH2 P;  2KBN A;  4LFB L;  1TXY A;  1L1O B;  4DR3 L;  2GVB A;  4POF A;  3E0E A;  2D0P A;  1X9N A;  4LUZ A;  4LW1 A;  3W1B A;  2E8G A;  2L15 A;  1JE5 A;  3L2P A;  1Y1W H;  1Q86 C;  1NBW A;  3K7U C;  3OYY A;  1I3Q H;  3B6Y A;  2ZM6 L;  1VQ7 A;  3NEN A;  4IJL A;  1UE6 A;  1PH7 A;  2ZJQ A;  1C9O A;  1YJ9 A;  4NXM Q;  2H5X A;  4OON A;  4R4T A;  1VQD A;  1RIP A;  4DPG A;  1V43 A;  4R4C A;  2KCM A;  4DUY Q;  1JJ2 A;  3F2C A;  3CCU A;  2HHH Q;  4A3C H;  2IY5 B;  2R7D A;  4FDB A;  3T1H Q;  2R92 G;  4JI8 L;  1SE8 A;  5C0X J;  3CQZ H;  4O2D A;  1VQH A;  4GS3 A;  3WWV A;  3CW2 C;  2NN6 G;  2WAQ G;  4JI8 Q;  1W3S A;  5M3M H;  2ATW A;  4JCV E;  4GN5 A;  3H3V I;  5J3B A;  1U5K A;  4LF8 L;  1WYD A;  5GQO A;  3TEH B;  2JA7 H;  4MNO A;  3EBE A;  1YJN A;  1SFO H;  1N36 Q;  2VUM G;  3CD6 A;  5C4X G;  1KQS A;  4LFA L;  2BH8 A;  2WAQ E;  4B3T L;  3ULJ A;  4JBJ A;  4IFD J;  4JI1 L;  2ZTC A;  2YV5 A;  4DR6 L;  2Y0S E;  2UXC L;  3HOV G;  2UUC Q;  1MJC A;  2GN5 A;  3S2H H;  2E2I H;  2UXD L;  1XMQ L;  3UE0 A;  1G51 A;  1EUJ A;  2D62 A;  4LUO A;  4A3M G;  4BBR H;  2E2H H;  5IP7 G;  3GD7 A;  2VUM H;  4IOA A;  5AJ3 L;  4B3T Q;  1HNZ L;  4B3S Q;  4QQB X;  3CCJ A;  5IP9 H;  2CKZ B;  3AYH B;  3UDI A;  2VQF L;  1EFW A;  1EIF A;  3E9H A;  3M4P A;  4RG1 A;  3RR5 A;  1N36 L;  1XNQ L;  4X65 Q;  3RN5 A;  1D7Q A;  3A5U A;  1JB7 A;  2VL6 A;  2RHQ B;  4LF6 Q;  3AEV A;  1WOC A;  4R4I A;  3ULP A;  3J80 i;  4PG3 A;  2MO1 A;  1HNW L;  4HIK A;  4JG2 A;  4B3R Q;  4A93 G;  1Y1V G;  1SR3 A;  4A75 A;  2UUB L;  4JI2 Q;  1GO3 E;  1HZ9 A;  1VQL A;  4BXX H;  3MXN B;  1VQI A;  1K8G A;  1J5E Q;  1H95 A;  2I5H A;  4UPA A;  5LMN W;  2JA5 H;  2KEN A;  2I5L X;  2UUA L;  5IY0 A;  4JI4 L;  4JI7 L;  3CCM A;  4LF7 Q;  3KJO A;  4BBS H;  1WJJ A;  5IYB G;  1UE1 A;  1MJE A;  1PYB A;  3HOW H;  2JK8 A;  3KDF A;  1HZC A;  1KD1 C;  1K9M C;  2Z6K C;  4H02 A;  4OX9 L;  1R9T H;  1VQ9 A;  4OWW B;  2R93 G;  3CAM A;  4DR3 Q;  4IFD I;  1XNR L;  1A8V A;  1NMG A;  1KXL A;  2EQS A;  3HOW G;  2F4V Q;  2MO0 A;  3PGZ A;  5FJ8 G;  3PF5 A;  2JA6 G;  2B3G A;  4O0A A;  3M85 A;  4K0K L;  2R7F A;  1N33 L;  3KJP A;  4DR5 Q;  3PUY A;  2UUA Q;  5C4X H;  4DK6 C;  4GLX A;  2E5L L;  2RHS B;  1FJG L;  3J81 c;  4GKJ L;  1WI5 A;  1Q7Y C;  4A3E H;  1PH2 A;  2NVT H;  4WJ4 A;  2IHF A;  4PZ7 A;  2N3S A;  4MTN A;  4HID A;  4LF9 Q;  3HOZ G;  1HNW Q;  4DV0 Q;  3STB D;  3CCL A;  1Q1E A;  1X55 A;  4A3B G;  2E5L Q;  1FGU A;  4DV1 Q;  2YU9 H;  4YCV A;  4DR5 L;  2WB1 E;  1OXV A;  2PMZ E;  1FL0 A;  4A3E G;  4LF4 L;  4DR7 Q;  2JQO A;  5IYC G;  1V1Q A;  1LYL A;  4JI5 L;  3UDG A;  5AJ3 Q;  5H1S E;  3T1Y Q;  4A3F H;  4A3G G;  2UXB Q;  5JJK A;  1XNR Q;  1U0L A;  2K52 A;  2AWN A;  2N78 A;  4BY7 H;  1L0W A;  1E1O A;  1IBK L;  1PH9 A;  4HIO A;  4R1J A;  2UXC Q;  3GTP H;  3S2D H;  1JJG A;  4DR6 Q;  2JA8 H;  3KFU A;  3F2D A;  1OTC A;  1SLJ A;  3PF4 A;  3K7A H;  3HOZ H;  2B63 H;  4A3D G;  3D0F A;  4P75 A;  1JJC B;  1OXT A;  1TWH H;  1X65 A;  4DUZ L;  1O7I A;  3DLL A;  5C3E H;  3M9B A;  4UP7 A;  1QZH A;  1Q46 A;  4LF8 Q;  2ZTE A;  2PQA B;  1IBK Q;  3RLN A;  4X6A H;  1SMX A;  1CKO A;  4C2M H;  3GTG H;  1M90 C;  4YHH Q;  4YWM A;  3KDF B;  4DNI A;  1KL9 A;  4AIM A;  1QVG A;  4QY7 A;  2UXB L;  1CSQ A;  1KC8 C;  1VQK A;  3HOV H;  3RLO A;  1GD7 A;  2JA9 A;  4Y52 H;  1VQN A;  4LF4 Q;  2Y0S G;  3VDY A;  5JJL A;  1A63 A;  2VQF Q;  1XNQ Q;  1MKH A;  4L5T A;  4JI0 L;  3I4M G;  5IYD H;  2OTL A;  3GTM H;  1PH1 A;  4L5S A;  3H0G H;  3F1Z A;  1X54 A;  5FLM G;  4EX5 A;  2ZM6 Q;  2R6G A;  1N32 L;  3A0J A;  2B63 G;  4IPH A;  1J6Q A;  5C44 G;  1RL2 A;  4LF9 L;  4JV5 L;  4OO1 G;  4AQY L;  1X6O A;  3PO2 H;  2CCZ A;  4Y7N H;  3HOU G;  2ZTD A;  2WB1 G;  2IX0 A;  5IWA L;  1A0I A;  4LFB Q;  1LUZ A;  4A3J H;  3HOX H;  3F2B A;  3TRZ A;  3M3Y H;  2I5M X;  3S17 H;  1EQQ A;  3PCO B;  1HZB A;  1L1O A;  2N49 A;  1X56 A;  2RCN A;  1FVI A;  2GVA A;  3S1R H;  1N34 Q;  2PI2 A;  4P74 A;  1NTG A;  2AKW B;  1PH4 A;  1CKN A;  1VQA A;  1VQ4 A;  1E1T A;  3CPW A;  3I56 A;  4DV5 L;  4AQY Q;  1BKB A;  1KHI A;  2LXJ A;  1SN8 A;  1YHQ A;  1CUK A;  4GN3 B;  2A8V A;  4BY7 G;  2VW9 A;  1XTD A;  1PFS A;  1GVP A;  3HKS A;  4DUY L;  3RLF A;  2VQE Q;  1XPO A;  3S24 A;  4C3H H;  5ELO A;  2K5V A;  2HHH L;  4P73 A;  3J81 j;  4GNX A;  1IBL Q;  4LF7 L;  2NVQ H;  1JT8 A;  2XTI A;  1I50 H;  5FJ8 H;  3I55 A;  1XMO L;  2C35 B;  2JA6 H;  2N8N A;  5JEA J;  2Q2U A;  2YTY A;  4DAM A;  3FP9 A;  3GTK H;  4B3R L;  4YY3 L;  3G4S A;  3CC2 A;  4BBR G;  4WJ3 M;  1A62 A;  4JC0 A;  2AHO B;  3A74 A;  3I4O A;  1K8A C;  1C0A A;  1JMC A;  5LMN L;  5IP9 G;  4JBW A;  1N8R C;  1N34 L;  1HJP A;  4DV6 Q;  2EXD A;  1XJV A;  1VQC A;  3H15 A;  1VQB A;  1D8L A;  1WFQ A;  1PA6 A;  2ZJR A;  4JBK A;  1HNX L;  1X3G A;  3KYH C;  5IWA Q;  4UP9 A;  4GOP B;  4PZ6 A;  4JI3 Q;  3PUW A;  1XMQ Q;  5GAG C;  3PV0 A;  3CCR A;  3STB C;  5IYC H;  2QEX A;  3TS0 A;  1VQO A;  2UUC L;  5LMU Q;  3M4Q A;  1NMF A;  3NEL A;  4YWK A;  4JI1 Q;  3CME A;  3HOY H;  3LGJ A;  3JC6 6;  1VQF A;  1EQR A;  4J15 A;  4A76 A;  2MNA A;  3CC4 A;  4JI0 Q;  3H3V H;  2VS1 A;  3J7A 5;  4QGU A;  3PO3 H;  4KHP Q;  3PIP A;  1I5F A;  1YNX A;  1K83 H;  4KHP L;  1UWV A;  1NY4 A;  1OXX K;  4QIW E;  1G6P A;  4X62 L;  4IOC A;  2QGQ A;  2MQH A;  4DV3 Q;  4LF5 Q;  1YJW A;  2BA1 A;  1YZ6 A;  2NN6 I;  1QUQ B;  4GN4 B;  4XTC S;  3NEM A;  1S3O A;  1DGS A;  2VY3 A;  4JI3 L;  1YIT A;  5IP7 H;  4L5R C;  2B29 A;  3EN2 A;  4KLK A;  4BA1 I;  4A3K G;  3J81 i;  2JEB I;  2LXK A;  1P8L A;  4NB3 A;  3L0O A;  5K36 G;  4DV2 L;  2R92 H;  3UE1 A;  3TQY A;  4IPC A;  4L5Q A;  1V9P A;  1Y1W G;  2R7Z G;  1W2B A;  2OWO A;  2YTX A;  1YHB A;  4HJ5 A;  3HOY G;  4DR4 L;  3U50 C;  4A3I G;  1K73 C;  3DM3 A;  4PMW A;  5LMN Q;  3S1N H;  4NXN Q;  4DR2 Q;  1K3R A;  3W5O A;  2JA7 G;  1KAW A;  3KLW A;  4YY3 Q;  5IT9 c;  1VCI A;  2K4K A;  1YHA A;  4DR4 Q;  4TQU S;  4BXX G;  5C4J H;  1SRO A;  4X64 Q;  3UDX A;  4NPS A;  3L7Z C;  4DV2 Q;  4A3I H;  1PH8 A;  2PNH A;  4B3M Q;  3GTQ H;  4IFD G;  3BJU A;  3F8T A;  3EIV A;  1Z47 A;  1OXU A;  5IE8 A;  1Q81 C;  2ID0 A;  3K0X A;  3SGI A;  3I2Z A;  1VQ5 A;  4LFC Q;  3D31 A;  3KF6 A;  3JAM c;  5M5X H;  3RN2 A;  2F3I A;  4JOI C;  2A19 A;  4TVA B;  2JA8 G;  1IL2 A;  1BBU A;  2OTJ A;  4B3M L;  1PYS B;  1LTL A;  2ES2 A;  4ME3 A;  1GM5 A;  4X64 L;  3ICE A;  2K5H A;  1N33 Q;  3I7F A;  3U58 A;  4AH6 A;  1E7Z A;  2E2J H;  3RZO H;  1VQE A;  1Y1V H;  1B70 B;  2BA0 A;  4YCU A;  2HQL A;  1X3F A;  2WP8 J;  4DR2 L;  1NJI C;  2Q2T A;  4POG A;  4OX9 Q;  4KI0 A;  5GRO A;  4JV5 Q;  2CQO A;  3CCQ A;  4A3F G;  4A3G H;  1I94 L;  4IO9 A;  2KHJ A;  3GTJ H;  4DV7 L;  2NVX H;  3Q8D A;  4JI4 Q;  3ERS X;  1HNX Q;  4JI7 Q;  3G71 A;  4LFA Q;  2AWO A;  5M3F H;  3K8A A;  5FLM H;  4JI2 L;  1CKM A;  3BZK A;  4DV4 Q;  1WCM H;  1YI2 A;  1GKH A;  5M5Y H;  4GNX B;  1PVO A;  2LSS A;  1C7Y A;  5IYB H;  1OXS C;  5C3E G;  4R4Q A;  4HJA A;  4ALP A;  2JEA I;  4IPG A;  3W1G A;  1Z9F A;  4GLV B;  1I6H H;  3U4V A;  1EYG A;  4R4O A;  1IBM L;  4IPD A;  4AYB E;  1XMO Q;  1M1K C;  3M7N A;  4AYB G;  3ULL A;  1HR0 L;  3OW2 A;  5BR8 Q;  4UY8 C;  3I4N G;  3MEF A;  5LMU L;  3GDE A;  3GTO H;  1Q1B A;  4GLA C;  2WFW A;  3CCS A;  5IYD G;  3I4M H;  2FXQ A;  2VNU D;  4A93 H;  1YEZ A;  3M4O H;  4IJH A;  2CWA A;  1VS0 A;  2KCT A;  5C44 H;  1NE3 A;  4P71 A;  5M3M G;  2ASB A;  1UE7 A;  3K81 C;  4DR7 L;  1X3E A;  1P16 A;  1QVC A;  1TWG H;  1IBM Q;  3GTL H;  4XIG S;  3HOU H;  3FKI G;  2OQ0 A;  3S15 H;  5HGQ A;  4UP8 A;  2OQK A;  4DV1 L;  3J80 c;  1QZG A;  3HKZ G;  4JOI A;  5GAH C;  1L1O C;  1IZ6 A;  1MIU A;  2R7Z H;  3AFQ A;  4DAY B;  1E3P A;  4A3D H;  3PO2 G;  1N32 Q;  4DV4 L;  2Z0S A;  4A3M H;  3A5Z B;  2IX1 A;  2OCE A;  3FKI H;  4A3L G;  3CXC A;  1UEB A;  5HY6 A;  2JE6 I;  3CCE A;  1CKN B;  1TWF H;  1XPU A;  3PIO A;  1IBL L;  1VQJ A;  1Y14 B;  1I94 Q;  3J7Z C;  2VQE L;  5GAE C;  4C3J H;  4GNX C;  4GKK Q;  3PUV A;  1T9H A;  3CP0 A;  2K50 A;  4LUV A;  4DV5 Q;  3TRE A; 
#chains in the Genus database with same CATH topology
 4M8A A;  3MFY A;  2PMZ B;  1SJE D;  1A2U A;  4LWC A;  4NXN L;  2K5W A;  3BDL A;  1LTI D;  3ONA B;  4QL5 A;  3K5N A;  2EYJ A;  2O4X A;  2KED A;  2QDB A;  2AUK A;  1BQQ T;  3PO2 B;  4ULL A;  3BDC A;  3CRK C;  2JJQ A;  3A8K E;  1ENC A;  5GAD C;  1LTT D;  1HR0 Q;  2MFI A;  4N8F A;  3L9A X;  4QUF A;  1G29 1;  1U4L A;  1K83 B;  4X65 L;  4HIM A;  3KBX A;  1CSP A;  3D4W A;  3HS0 C;  2DY8 A;  1M4V A;  1ASZ A;  3S1M H;  1BVS A;  4ZAI A;  2XVS A;  1KNA A;  4BY1 G;  2B2U C;  4ZKB B;  4R9W A;  4DAV A;  4X66 Q;  2F0P A;  1BDO A;  1B9M A;  2A68 D;  1QOH A;  1SMY C;  4K0K Q;  2DGY A;  3K59 A;  3P75 A;  1VF7 A;  3PUZ A;  5C4J B;  3BZD B;  4PV1 C;  3K80 C;  1STY A;  4X3U A;  5JJZ A;  3GTK B;  2JA5 G;  2D0O A;  2YTV A;  4H7B A;  4GKK L;  3G48 A;  3S1N B;  3S2H B;  3IRB A;  1HR0 W;  4OO1 H;  3ZJY C;  4P72 A;  2WAC A;  2QA4 A;  5CV6 A;  2IT1 A;  3HOX G;  2WAQ B;  1D1I A;  1E22 A;  1QG7 A;  5COY A;  1QVF A;  2F52 A;  4DV6 L;  4DR1 Q;  1VQP A;  2OXP A;  1AE2 A;  3R93 A;  1HNZ Q;  1PHJ A;  1HH2 P;  2B39 A;  2HCI A;  1L1O B;  3VA7 A;  4DR3 L;  1ENA A;  3ND8 A;  4X3T A;  2DN8 A;  4LW1 A;  1BO0 A;  5EPK A;  2L15 A;  1JE5 A;  3TP8 A;  3L2P A;  1NBW A;  1LAB A;  1NR4 A;  5DNF A;  3B6Y A;  1B53 A;  1VQ7 A;  2F0S A;  4OON A;  1RIP A;  5CV8 A;  4DUY Q;  5D65 A;  3F2C A;  4A3C H;  1K3B C;  4JI8 L;  2MP1 A;  3CW2 C;  4JPB W;  5I9P A;  2RDG A;  4JI8 Q;  1W3S A;  1CHP D;  4C3J B;  2DNE A;  3H3V I;  4DNT B;  1F77 A;  4OEM B;  1SFO H;  3OIP A;  5ISR A;  1KQS A;  1DON A;  3Q24 A;  3AU7 A;  4B3T L;  2DJG C;  2HDM A;  2ZTC A;  4DR6 L;  2Y0S E;  1HQM C;  3HOV G;  2UXD L;  2GN5 A;  3S2H H;  2E2I H;  5C5M A;  1G51 A;  3UE0 A;  1EUJ A;  2D62 A;  4LUO A;  3U9S A;  3T51 B;  4BBR H;  3EA6 A;  5AJ3 L;  4FNF A;  1HNZ L;  1STA A;  1UNS A;  3CCJ A;  5IP9 H;  3MC0 B;  2CKZ B;  1A6X A;  3UDI A;  1EFW A;  3RR5 A;  3DWA A;  4RKL A;  4FF3 A;  1EY7 A;  4X65 Q;  2VL6 A;  4KKT A;  1K8O A;  4LF6 Q;  3SK4 A;  3U9O A;  2F0I A;  2MO1 A;  1TS3 A;  1F2M A;  3HOW B;  2I46 A;  1Y1V G;  5E1F A;  1SR3 A;  2UUB L;  4JI2 Q;  1GO3 E;  1VQL A;  4BXX H;  2XRS D;  3MXN B;  1M8A A;  1K8G A;  2NVX B;  2I5L X;  3AB9 A;  3G6J B;  1EIH A;  1YNN C;  4NMZ A;  3VYS A;  3HOW H;  2JK8 A;  4CJ0 B;  1CI3 M;  2Z6K C;  4H02 A;  2R93 G;  2NZ1 D;  3CAM A;  4HCS A;  4EQO A;  4A3B B;  3KK7 A;  3FDT A;  3HKZ B;  5C5L A;  5FJ8 G;  2JA6 G;  1DYQ A;  5FLX E;  2E2D C;  2EYL A;  4K0K L;  3LWE A;  1FJG L;  4DK6 C;  3J81 c;  1E2V A;  3FRP B;  5ELB A;  3CHB D;  2NVT H;  2JN4 A;  1UUP A;  4IUV A;  4MTN A;  1SYC A;  3X3M A;  3STB D;  1D5X C;  2B8F A;  1H9K A;  4A3B G;  2YU9 H;  1CQV A;  2WB1 E;  1OXV A;  4DR7 Q;  4G4K A;  2C5C A;  1LYL A;  1QNU A;  2TSS A;  5JJK A;  3I70 A;  3S15 B;  2JSO A;  1U0L A;  2K52 A;  3W3A A;  2N78 A;  1WTX A;  1IW7 C;  3E3X A;  1W6J A;  1PH9 A;  1JJG A;  1T5E A;  3S2D H;  2RDH A;  3FKI B;  3D0F A;  4P75 A;  1JJC B;  1F2L A;  4DK1 A;  2IW3 A;  4LF8 Q;  4OGQ C;  4CDE C;  1CKO A;  1A3V A;  4BS9 A;  2AQ1 B;  4L6T B;  4YHH Q;  4DNI A;  4Q0F A;  2J0T D;  1NR2 A;  1GD7 A;  3E5S A;  4X3S A;  4LF4 Q;  2NWG A;  4XQJ A;  5IYD H;  2OTL A;  1PH1 A;  1X54 A;  2I07 B;  2ZM6 Q;  2R6G A;  3T56 B;  3J81 E;  4JV5 L;  1RL2 A;  4LF9 L;  3PO2 H;  3D4D A;  4Y7N H;  3HOU G;  2WB1 G;  4IZ8 A;  4A3J H;  3M3Y H;  2I5M X;  1EQQ A;  2XRQ D;  2KEC A;  5KND A;  3BS1 A;  4K14 A;  4CJ2 C;  1N34 Q;  1H9S B;  1PH4 A;  4CDC C;  2F3W A;  1VQA A;  5AFW A;  1XXG A;  2RDF A;  1JOQ A;  1XTD A;  1PFS A;  1F9R A;  2IL8 A;  3HKS A;  2HHH L;  2KQ3 A;  5JEA H;  4J8Q A;  1C4Q A;  1IBL Q;  4DAY A;  1EY4 A;  4FO2 A;  2Q2U A;  1EEF D;  1CZW A;  3OMC A;  3GTK H;  2QKI C;  3G4S A;  4AYB B;  3CC2 A;  5EKK A;  1A62 A;  3NE5 B;  1W6K A;  1SFO B;  5LMN L;  5IP9 G;  4JBW A;  3NTH A;  1D5M C;  3H15 A;  2A6H C;  1SXT A;  1PA6 A;  1IKL A;  1VDZ A;  4ZRZ A;  3NHH A;  3KUP A;  1PMR A;  3NWS A;  4JI3 Q;  3QIA A;  1XMQ Q;  2J4X A;  3PV0 A;  2QEX A;  3Q6S A;  5K36 H;  2F0O A;  4A3I B;  3GTO B;  5LMU Q;  1NMF A;  2E76 C;  3NEL A;  1GUO A;  4JI1 Q;  2KCN A;  1EQR A;  4A76 A;  1JOK A;  2VS1 A;  3PO3 H;  1I5F A;  1YNX A;  1K83 H;  3I90 A;  1NY4 A;  1G6P A;  2MPM A;  1SDF A;  5M9O A;  2BA1 A;  4F8M A;  1YZ6 A;  1BCP D;  2BE5 D;  2E75 C;  1DGS A;  4IAL A;  5CMD A;  3DXJ C;  1YIT A;  5IP7 H;  5LHY 1;  4KLK A;  3HG9 A;  2F0L A;  2EDG A;  2R92 H;  4KY5 A;  5LL6 S;  4DU9 A;  3GTP B;  2OWO A;  1YHB A;  4HJ5 A;  4DR4 L;  1JE4 A;  1MSG A;  4DR2 Q;  3W5O A;  1I6V C;  5IGC A;  2JA7 G;  1F9S A;  4CDF C;  2K5D A;  2A74 C;  1TWG B;  1WTO A;  1SYB A;  4X64 Q;  3DUZ A;  2JA5 B;  1PH8 A;  3EIV A;  5IE8 A;  1VQ5 A;  4LFC Q;  3D31 A;  3RD4 A;  1Y8N B;  3SHL A;  2JA8 G;  1RJT A;  3VYR A;  1EY6 A;  1HXY D;  2PW7 A;  2K1B A;  4X64 L;  2K5H A;  1N33 Q;  3S1M B;  1SAP A;  5CBE E;  3N6R A;  1VQE A;  2SNM A;  1BF4 A;  4TRD A;  3S1R B;  3M3Y B;  4DR2 L;  1PTO D;  3VR4 A;  3NWT A;  2G5D A;  4A3G H;  4JI7 Q;  1HNX Q;  3G71 A;  3C1E A;  2AWO A;  5CGK A;  4C3I B;  1YI2 A;  5M5Y H;  2K28 A;  5JOB A;  4IUT A;  5IYB H;  3W1G A;  5CR3 A;  3MA2 B;  1EYG A;  1XMO Q;  3I3C A;  3M7N A;  5M5X B;  4UY8 C;  3S16 B;  4RGT A;  1Q1B A;  1TVX A;  4A93 H;  2E74 C;  3SK6 A;  1A2T A;  2PZU A;  2KCT A;  4ZYS A;  1NSN S;  1UE7 A;  3S15 H;  1IBM Q;  4XIG S;  2K04 A;  2Z4I A;  5E3F A;  2N88 A;  4DV1 L;  1AP0 A;  1E3P A;  2Q8T A;  3K7A B;  2OCE A;  4KK7 A;  5HY6 A;  2F1M A;  1CKN B;  1XPU A;  1PLF A;  2NVT B;  1VQJ A;  2Z1C A;  5GAE C;  2L1B A;  2L12 A;  1XX8 A;  3PUV A;  5C3W A;  2H1E A;  3CQZ B;  1AE3 A;  1G2T A;  1TS4 A;  4IUR A;  3GO5 A;  3R8B A;  5FLX c;  2F0D A;  4U67 3;  2M9V A;  4A3B H;  2C9O A;  3KLS A;  2NZO A;  1E24 A;  4DUZ Q;  1SND A;  1Y8O B;  3E9I A;  4BY1 H;  1I50 B;  4HSV A;  4APV A;  4BBS G;  3I4N H;  4RGM A;  1CHQ D;  1TWC H;  1CA6 A;  2EY5 A;  1IXR A;  5IGB A;  2R93 H;  1EOV A;  2KHS A;  5BR8 L;  3F2U A;  4JI5 Q;  2L9H A;  2HCC A;  3IFT A;  4JBM A;  3V96 A;  2HT1 A;  1MI2 A;  3TZD A;  1FNV A;  4YHH L;  4BBS B;  2UXD Q;  1LM0 A;  3K58 A;  3KOJ A;  4TSS A;  4BBR B;  3I91 A;  4YWL A;  1N9W A;  3RUZ A;  3BVZ A;  1B8A A;  1Q12 A;  1TWF B;  1JWU D;  1PRT F;  1EEI D;  1EOT A;  3A56 A;  4GOP A;  4PZ8 A;  4R8I A;  1B44 D;  1S72 A;  3OWE B;  4QIW B;  1B3Q A;  4QB4 A;  1Q82 C;  3H91 A;  1JCK B;  5BN4 A;  1G2S A;  4A3K H;  3S9W A;  1STG A;  3R2T A;  3HOX B;  1BBW A;  4KD4 A;  1YVC A;  2WKC A;  1XPR A;  1AH9 A;  2A1A A;  5EPJ A;  4DV0 L;  4U68 A;  5CV5 A;  4XYQ A;  5C3X A;  4IQZ A;  1DXM A;  4HAE A;  3NQT A;  4A3C G;  1HUM A;  5IT9 E;  2G9D A;  5EKL A;  2L0C A;  3GQB A;  4DR1 L;  4OWX B;  2BH2 A;  5I9O A;  4HJ9 A;  4H13 C;  4QF4 A;  4RAU C;  3WDN A;  4K5X A;  1H9S A;  5JEA G;  4V19 0;  4RH6 A;  5D3D A;  1TXY A;  4POF A;  1B2T A;  3E0E A;  4IJL A;  4NXM Q;  1ET6 A;  1VQD A;  4DPG A;  5IOC A;  2IY5 B;  2HHH Q;  4A3D B;  2A6E D;  2R61 A;  1CT1 D;  3CQZ H;  3G7L A;  4O2D A;  1VQH A;  4C2M B;  4FF2 A;  3EQL C;  1KTK A;  5IGF A;  2FJ2 A;  2WAQ G;  3VR5 A;  1SNP A;  4FVM A;  4LF8 L;  1XWE A;  5M5Y B;  1YJN A;  3EBE A;  1N36 Q;  5KNC A;  4LFA L;  1C48 A;  2WAQ E;  3QO2 A;  1GUG A;  2EY1 A;  3KBG A;  3I4M B;  1MJC A;  1XMQ L;  5G3L D;  1B1Z A;  5J39 A;  5FOB B;  4IOA A;  2XIW A;  3E9H A;  3M4P A;  1IL8 A;  5JAV A;  5I2Y A;  2B2W A;  1QE6 A;  1D7Q A;  2RHQ B;  3ULP A;  1HNW L;  3MHB A;  4JG2 A;  1K28 A;  4KJN A;  4N9T A;  4A75 A;  2KJX A;  1HZ9 A;  1J5E Q;  1ICF B;  2JA5 H;  2KEN A;  3GTJ B;  1L0X B;  3E0J A;  3OHX C;  5IY0 A;  3CCM A;  2UUA L;  2K03 A;  4JI7 L;  4LF7 Q;  4BBS H;  1WJJ A;  1UE1 A;  4K2L A;  1KD1 C;  1K9M C;  4I7A A;  4B9W A;  4OX9 L;  4OWW B;  4DR3 Q;  2EQS A;  3NXW A;  1NUC A;  4G7Z C;  2BE5 C;  2MO0 A;  2Z9H A;  1ZKO A;  4O0A A;  3PIO 3;  3M85 A;  1N33 L;  1EYD A;  2UUA Q;  5C4X H;  2E5L L;  2RHS B;  4K2K A;  3W2D A;  1AZP A;  3RMH A;  4I7Z C;  2F3V A;  4HTH A;  4HID A;  4LF9 Q;  5K5P A;  2F0W A;  3NQI A;  1HNW Q;  4DV0 Q;  2B2W C;  1X55 A;  1EYC A;  4OIJ A;  2E5L Q;  4A3E G;  1D2B A;  1DJR D;  1AZQ A;  5IYC G;  2A6H D;  5H1S E;  4A3G G;  1TQO A;  1XNR Q;  1TWH B;  4BY7 H;  2EOT A;  2KA7 A;  1E1O A;  3T53 B;  2MHV A;  1EQV A;  2B63 B;  5T1I A;  2UXC Q;  3N52 A;  4FXK C;  4CHT B;  2JA8 H;  4DR6 Q;  1HCZ A;  5HUR A;  1BBX C;  3OSO A;  3K7A H;  4F87 A;  1TWH H;  3ERO A;  1I3Q B;  4B08 A;  1Y1W B;  1FNU A;  2KEE A;  2F0J A;  1VMC A;  2ZTE A;  2PQA B;  2A5H A;  2F0N A;  3RLN A;  1SMX A;  3GTG H;  1EWC A;  2J7Z A;  1KL9 A;  4LK1 C;  1KC8 C;  3HOV H;  4K8J A;  3VDY A;  2OF1 A;  2O2L D;  5KIX A;  4I65 A;  4JI0 L;  2D5D A;  3H0G H;  4G7O C;  1S5D D;  3DWP A;  1H9R A;  4IPH A;  5C44 G;  2B2T A;  2D2C C;  5C4X B;  3QOL A;  4M1U B;  4AQY L;  1X6O A;  2CCZ A;  1GOZ A;  5IWA L;  1I4H A;  4LFB Q;  1LUZ A;  1X32 A;  3TRZ A;  1O7Z A;  2XSC A;  5IT9 L;  1WTV A;  5CV4 A;  3S1R H;  1HZB A;  2N49 A;  4DK0 A;  1WTQ A;  4P74 A;  1NTG A;  2AKW B;  1QCB D;  1CKN A;  2K6A A;  1EWH A;  1E1T A;  4ZKC B;  2EXZ A;  4Y7N B;  4AQY Q;  2LXJ A;  2A8V A;  2K7V A;  2VW9 A;  3C2P A;  1DOM A;  2M00 A;  4C3H H;  3J81 j;  4QCL A;  3JAM E;  5FJ8 H;  3I55 A;  1PDQ A;  2JA6 H;  4DGZ A;  4KV6 A;  4DA2 A;  2P5Z X;  4YY3 L;  4HSP A;  4ME5 A;  1IW7 D;  3A74 A;  3URY A;  4PMB A;  5JPN C;  2PQE A;  2EZV A;  1N8R C;  1N34 L;  1A3U A;  1VQB A;  5JPM C;  1WFQ A;  1ESF A;  2WV6 D;  1JR0 D;  1NCV A;  1HNX L;  1X3G A;  5IWA Q;  3GTQ B;  4GOP B;  4PZ6 A;  3PUW A;  3TS0 A;  3CCR A;  3STB C;  2WIN B;  3M4Q A;  1V1P B;  1GUS A;  3HOY H;  3H09 A;  2MNA A;  4JI0 Q;  1EY5 A;  3TSS A;  4KHP L;  1UWV A;  2EY2 A;  2LY7 A;  3DHQ A;  4X62 L;  2EY6 A;  2QGQ A;  4IOC A;  2SEB D;  4E6I A;  4KJO A;  3OMG A;  5DM7 3;  2NN6 I;  4GN4 B;  3NTI A;  3PO3 B;  2VY3 A;  4L5R C;  2B29 A;  3EN2 A;  4NB3 A;  5M3F B;  2L4N A;  1Y1W G;  4L5Q A;  1V9P A;  4R8N A;  1W2B A;  3HOY G;  4PQX A;  1QB5 D;  2AQ3 B;  3QWN A;  4O42 A;  5KYL A;  4A3I G;  1SYD A;  4PMW A;  3DMU A;  4KKS A;  5LMN Q;  1KAW A;  2EPB A;  1AFP A;  2F0G A;  5IT9 c;  3K0Y A;  3SK5 A;  2HUG A;  1YHA A;  2EYM A;  2SOB A;  1H9M A;  3NBI A;  5I4D A;  3UDX A;  3VYT A;  4NPS A;  4DV2 Q;  4A3I H;  3BVM A;  4B3M Q;  4MN3 A;  4IFD G;  1TR5 A;  3F8T A;  4WRD A;  2ID0 A;  3SGI A;  5FO8 B;  1B3A A;  4P2C B;  1XYI A;  3RN2 A;  2A19 A;  1HQR D;  4EQN A;  2OTJ A;  3RZO B;  1PZI D;  3I7F A;  1SJH D;  3SE0 A;  1E7Z A;  2NTT A;  5KEE A;  2E2J H;  2CQA A;  3D6W A;  1Y1V H;  2RA4 A;  2BA0 A;  3S17 B;  2F4I A;  2HQL A;  4YCU A;  4POG A;  2WP8 J;  1NJI C;  2Q2T A;  4ABN A;  4KI0 A;  3IAY A;  5GRO A;  1AN8 A;  2MGS A;  1GUW A;  1ZXT A;  2LS0 1;  4IO9 A;  3GTJ H;  4JI4 Q;  1RF2 D;  4KMU C;  4LFA Q;  5FLM H;  1IYU A;  1CKM A;  3BZK A;  4DV4 Q;  1WCM H;  3MXP A;  4KY6 A;  4IUU A;  3V2T A;  5C3E G;  4ALP A;  1SNQ A;  2JEA I;  1SE4 A;  2B2Y A;  1EIG A;  3BYT B;  5ELC A;  4G7H C;  1CA5 A;  4R4O A;  1RHP A;  4RKB A;  1CK1 A;  4JVZ A;  1HR0 L;  3I4N G;  2Y0S B;  3NSW A;  3MEF A;  2MJ8 A;  2R3Z A;  5LMU L;  1MBY A;  1I4R A;  2WFW A;  4YIJ A;  3I4M H;  1LAC A;  3EJI A;  1YEZ A;  3M4O H;  1QWY A;  4QMG A;  1HPC A;  1JT8 A;  1NE3 A;  4P71 A;  3TBI B;  1RTN A;  5KYI A;  1QVC A;  4RCO A;  3DM1 A;  5HGT A;  3P1H A;  3FKI G;  2OQ0 A;  3GTL H;  5HGQ A;  4UP8 A;  1GXD C;  5LL6 X;  3HKZ G;  4JOI A;  4ZUI A;  2Q8I B;  1JIC A;  1MIU A;  2IX3 A;  2F0M A;  1DOK A;  4A3D H;  4DFA A;  4DV4 L;  2Z0S A;  4A3M H;  3FKI H;  4A3L G;  1I4Q A;  3C3L A;  1ROD A;  1TWF H;  1EU3 A;  2A68 C;  1IBL L;  3K5O A;  2VQE L;  2F0Q A;  4C3J H;  4GNX C;  5I6Y A;  4GKK Q;  1B50 A;  3J80 E;  1T9H A;  2K50 A;  4LUV A;  2IPK D;  4L63 B;  5CV7 A;  2A6E C;  1RCV D;  1ML0 D;  4KN7 C;  3C46 A;  1H9J A;  2YU9 B;  5DLQ E;  2F0F A;  2VB2 X;  2DUD A;  1R9T B;  4JYA Q;  5CC4 A;  3K5L A;  2YYZ A;  2D9U A;  2PYK A;  5C0X G;  5DAU A;  3S16 H;  2FMM A;  4C3I H;  2EYO A;  4A3L H;  3S1Q H;  2ZJP A;  2CWP A;  3HFZ B;  4A3J G;  4LJZ C;  4A4I A;  2ALY B;  2AMC B;  4JI6 L;  1II3 A;  2TMP A;  3CCV A;  4KKU A;  2L11 A;  4C3I G;  1QJO A;  2PQA A;  5JJI A;  1EY9 A;  3KF6 B;  3SK8 A;  4JI6 Q;  3CMA A;  1VQM A;  4K8I A;  4DKA C;  4MZ9 A;  1VQ8 A;  1YIJ A;  1U4R A;  3AFP A;  4IUQ A;  3NK9 A;  3GTM B;  1FJG Q;  4JYA L;  3HOZ B;  3AMU A;  2K14 A;  1I4X A;  2HIV A;  2KHI A;  1XTC D;  4HR7 B;  1KRT A;  3OTO L;  3T1Y L;  3T4A C;  3T1H L;  1KRS A;  1Q8K A;  1EIY B;  3TP6 A;  3CC7 A;  3P7J A;  3BU2 A;  5C3E B;  4NXM L;  2Z6K A;  3CF5 A;  5DEH A;  1VQ6 A;  2VZA A;  1EWI A;  5D3I B;  1QUQ A;  4GOP C;  1K0R A;  3PMF A;  2O5I C;  3S14 H;  1I4P A;  3IFD A;  4RMF A;  4OEL B;  1EZ6 A;  2PI2 E;  4LFC L;  3NBH B;  3PQI A;  4GKJ Q;  3MTS A;  4LF6 L;  1L2F A;  1TU2 B;  5M3F G;  4HJ7 A;  4YCW A;  3RZD H;  1SNO A;  5DM6 3;  5TSS A;  2N55 A;  4OWT B;  3O13 A;  4OO1 I;  1CZG A;  4LFB L;  4N8X 1;  3PSI A;  4OXP A;  2KBN A;  1STE A;  5C4H A;  3VA5 A;  2GVB A;  2D0P A;  1X9N A;  1Q86 C;  1YNJ C;  1BOS A;  5C6A A;  3OYY A;  4RFB A;  1RKN A;  4Z9C B;  3NEN A;  1UE6 A;  1C9O A;  1YJ9 A;  4R4T A;  1VMP A;  1X3Q A;  3A8J E;  1V43 A;  4R4C A;  2F0U A;  2KCM A;  1JJ2 A;  4HCE A;  3CCU A;  2B2V C;  3T1H Q;  2R92 G;  1A15 A;  1JB3 A;  1TII D;  4GS3 A;  3WWV A;  2RBM A;  2NN6 G;  2ATW A;  5J3B A;  1U5K A;  3SVM A;  1WYD A;  2JA7 H;  3CD6 A;  3HOY B;  4C3H G;  4N9P A;  2BH8 A;  3ULJ A;  4IFD J;  4JI1 L;  3PIP 3;  2YV5 A;  2UXC L;  1E2Z A;  1PRT B;  2K33 A;  4KHV A;  4A3M G;  1WTH A;  2E2H H;  5IP7 G;  1FGB D;  4B3T Q;  4LAA A;  3FEW X;  2VQF L;  1N36 L;  4RG1 A;  5F2D A;  2NN6 H;  1HRJ A;  3A5U A;  3TME A;  4R4I A;  1KDC A;  1T5X D;  4UAI A;  3P20 A;  3J80 i;  5IIF A;  4PMC A;  4HIK A;  4EGV A;  4B3R Q;  1KAB A;  1WVL A;  2EYH A;  4CKB A;  2PPB C;  1FR3 A;  4RCN A;  5T1G A;  4C3H B;  1VQI A;  3GV6 A;  2IX1 A;  4JI4 L;  5FLX L;  4A3G B;  1PFB A;  5IYB G;  2OT2 A;  1I4G A;  3KDF A;  1HZC A;  1IYV A;  3GV3 A;  4B9X A;  4IFD I;  1R4Q B;  1XNR L;  3I72 A;  1A8V A;  5A2Q L;  1NMG A;  1KXL A;  5J1Z A;  4A3J B;  4HMJ A;  2K01 A;  2B3G A;  1DD2 A;  2R7F A;  3HEJ A;  2BDO A;  1V8Q A;  4GLX A;  1WI5 A;  2E2H B;  1VF5 C;  4A3E H;  1PTO C;  3TZU A;  5I2X A;  2N3S A;  1B4O A;  1EFI D;  3S14 B;  3CCL A;  4ZK9 B;  4DV1 Q;  2XN9 C;  1FL0 A;  4X3K A;  4LF4 L;  1S5E D;  1D5Z C;  1WTR A;  4PNY A;  3UDG A;  5AJ3 Q;  5EJW A;  2AWN A;  1GHK A;  5IOD A;  4OL7 A;  2QW7 A;  3GTP H;  4IUP A;  1SLJ A;  3BDO A;  3HOZ H;  4FF4 A;  2B63 H;  1OXT A;  4DUZ L;  1O7I A;  1ILQ A;  2RKS A;  2A73 B;  5C3E H;  3M9B A;  4UP7 A;  1Q46 A;  3A55 A;  3K6O A;  1LT5 D;  1TY2 A;  1M90 C;  4AIM A;  4QY7 A;  2UXB L;  1CSQ A;  2JXM B;  3HGB A;  4TKO B;  3M4O B;  1VQN A;  2Z4H A;  4Y52 H;  2Y0S G;  5JJL A;  1A63 A;  2VQF Q;  1EZ8 A;  3MWY W;  4L5T A;  1BR9 A;  1F2Y A;  3GTM H;  4L5S A;  3QR8 A;  3F1Z A;  2ZXR A;  5BN3 A;  5FLM G;  3OPO A;  1N32 L;  1BCP C;  4O1N A;  2H4O A;  2B63 G;  4OO1 G;  5CYU A;  2EYP A;  2CW0 C;  5IGE A;  3S1Q B;  3CKI B;  2ZTD A;  1TS2 A;  2IX0 A;  1A0I A;  3F2B A;  1KDA A;  2X69 A;  3PCO B;  2RCN A;  1L1O A;  1O78 A;  2CH4 W;  1TKW B;  3OOC A;  3UI2 A;  2JP1 A;  3QOJ A;  1VQ4 A;  3ND9 A;  4DV5 L;  1QVG A;  3HOW G;  1KHI A;  5E4X A;  4GN3 B;  2EYF A;  5L37 A;  1XPO A;  3S24 A;  4XQQ A;  5CV9 A;  1R4P B;  4LF7 L;  3TDQ A;  2XTI A;  1XMO L;  4DN4 M;  4G57 A;  2N8N A;  5C0X H;  3KF8 A;  4A3M B;  3SEB A;  4B3R L;  3HP3 A;  3ERQ A;  4JC0 A;  1DCZ A;  1C0A A;  1JMC A;  3LNN A;  4RA8 A;  2EXD A;  1VQC A;  1D8L A;  4JW0 A;  4XT3 B;  2FIN B;  2ZJR A;  3D4R A;  2PO4 A;  5KRU A;  4J1M A;  1NAP A;  3TN2 A;  2Z6B A;  5GAG C;  3HRZ C;  4YWK A;  4LMQ D;  3CME A;  1WTW A;  3LGJ A;  3MAQ A;  3JC6 6;  1EYA A;  1VQF A;  4J15 A;  2VB3 X;  3CC4 A;  1O7Y A;  3H3V H;  3J7A 5;  4KHP Q;  1EL0 A;  4QGU A;  1LT4 D;  3PIP A;  1WD1 A;  1U4P A;  4QIW E;  4ZLT F;  1PYW D;  4DNR B;  3MXG A;  1QUQ B;  4RGO S;  4XTC S;  3NEM A;  1S3O A;  1EY0 A;  4OIK A;  4A3K G;  2LXK A;  1P8L A;  3L0O A;  3UE1 A;  4IPC A;  4ID6 A;  3QJY A;  2XWB B;  1F9Q A;  2R7Z G;  3S2D B;  1HA6 A;  2K5Q A;  4HMI A;  1K73 C;  1S5F D;  3DM3 A;  3S1N H;  2PZW A;  4HED A;  3J80 L;  5FKA C;  3H94 A;  1JWS D;  3LWU A;  4YY3 Q;  4K6D A;  4GZY C;  2WII B;  4DR4 Q;  4BXX G;  5C4J H;  1KNE A;  2CHB D;  3VR3 A;  1TS5 A;  1A3T A;  3L7Z C;  1S5B D;  2PNH A;  3GTQ H;  3BJU A;  3NTK A;  1Z47 A;  1OXU A;  4C1N K;  1PXU A;  3KF6 A;  1HFG A;  3SR1 A;  3JAM c;  4F7X A;  1IKM A;  2F3I A;  4JOI C;  4TVA B;  4A3K B;  4DXF A;  2B8G A;  1LTL A;  4J6H A;  2ES2 A;  2E2J B;  2RQX A;  1G91 A;  1GM5 A;  2ZT9 C;  3ICE A;  1DM0 B;  2LFN A;  4V0B A;  4AH6 A;  1LV9 A;  2X6L A;  3RZO H;  1RTO A;  1B70 B;  1WD0 A;  5ELD A;  3T16 A;  1WCM B;  3GP7 A;  4A3F G;  5EPL A;  4QUC A;  1I94 L;  1SYF A;  2EJG C;  2KHJ A;  1GUN A;  4DV7 L;  3Q8D A;  2NVX H;  3ERS X;  4FXD A;  2L55 A;  2CVR A;  4HN7 A;  5M3F H;  3IKJ A;  4JI2 L;  3EVQ A;  4CKC A;  2F0E A;  1AW7 A;  5NUC A;  1CFM A;  2EJM A;  3KLR A;  1PVO A;  2FFK B;  1C7Y A;  2AUJ D;  1Y1V B;  1RD9 D;  4R4Q A;  4IUN A;  1YNN D;  1PRT C;  4MHE A;  1GUT A;  1KLU D;  2VXW A;  1IBM L;  4IPD A;  4AYB E;  1E2W A;  3ULL A;  3X3N A;  1STH A;  3GDE A;  1LTG D;  4BY1 B;  5IYD G;  2FXQ A;  3MFG A;  2VNU D;  4FP5 D;  1STB A;  2ENB A;  4IJH A;  1OO9 B;  1HFN A;  3HOV B;  1VS0 A;  3ITP A;  5M3M G;  1I6H H;  2ASB A;  4EVO A;  1X3E A;  1P16 A;  3HOU H;  1JQY D;  1HUN A;  1Z7T A;  2OQK A;  3J80 c;  2OEO A;  1O7L A;  2VUM B;  5GAH C;  4DXG A;  3FMC A;  4C3J G;  3GTL B;  4DAY B;  2QF7 A;  3PO2 G;  1V1O A;  1PFN A;  2KVM A;  3A5Z B;  2B2U A;  2R7Z B;  5J22 A;  4A3E B;  1JOO A;  3JAM L;  5M3M B;  3I4L A;  1CQF A;  2K05 A;  3TRE A;  1K8M A;  3A8I E;  1YBY A;  3OTO Q;  5D14 A;  3BZC A;  1IYJ B;  3K5M A;  2ICE C;  1QIL A;  3TS2 A;  4L8J A;  2FMC A;  3CRL C;  5G3L F;  2Q2H A;  3PUX A;  1PTO H;  1PH6 A;  1VQG A;  2JA6 B;  4X66 L;  1ASY A;  2RF4 A;  3JAM i;  3SXH A;  2WKD A;  3HKZ E;  5M5W H;  2IHE A;  3H0G G;  2UU9 L;  2K32 A;  1RDP D;  1UEA B;  1HZA A;  3FHW A;  4CDD C;  2DY7 A;  5E7N A;  4HJ8 A;  5FK9 C;  1B7Y B;  4EQ5 A;  1Q8I A;  4S3S A;  4B3S L;  5EAY A;  5ELE A;  1FNW A;  3ER0 A;  3E6Z X;  1WCM G;  2UU9 Q;  4FF1 A;  4KHZ A;  1PH5 A;  1Q90 A;  4DK3 C;  2V1C C;  1PH3 A;  2G9H D;  3G6E A;  2F03 A;  3BYY B;  2XGT A;  1BXT A;  1ESR A;  1TY0 A;  4DV7 Q;  4FYD A;  2JA8 B;  3H6M A;  3AQQ A;  1TWA H;  1KIX A;  2K5N A;  2F4V L;  3LX0 A;  4DV3 L;  4LF5 L;  1UE5 A;  4X62 Q;  3RNU A;  1SMY D;  4LNQ A;  1HTP A;  1L0Y B;  3C1F A;  1S40 A;  2BOS A;  2NZH A;  4UDU C;  1PV4 A;  3MVV A;  5ELN A;  2PCF B;  1J5E L;  1IHZ A;  3R3O A;  5C0X I;  4ZUJ A;  2UUB Q;  4K5W A;  4QJF A;  2I0Q A;  3KF8 B;  4ODG A;  3CPF A;  2NVY H;  2K75 A;  1DOL A;  2CFM A;  3UDF A;  1SRU A;  3H0G B;  1MSH A;  3FPU B;  4BA2 I;  2HIX A;  3K57 A;  1V1P A;  1F2Z A;  1D6E C;  2KOL A;  2XNA C;  2EIF A;  3FVQ A;  2Q2I A;  1LTR D;  5EKI A;  4K6L A;  3U4Z A;  3PO3 G;  3VYU A;  5EGT A;  1PRT D;  3RZD B;  1Z6H A;  3MXN A;  4LUZ A;  3W1B A;  2E8G A;  5FO7 B;  1SE2 A;  1Y1W H;  3WOE A;  1KLG D;  3K7U C;  1I3Q H;  2ZM6 L;  3TP5 A;  1PH7 A;  2ZJQ A;  2H5X A;  4MTK A;  2R7D A;  4FDB A;  4BY7 B;  4KTA A;  1SE8 A;  2F0H A;  5C0X J;  2A69 D;  3GTG B;  2Q8R E;  2IWH A;  5M3M H;  4JCV E;  4GN5 A;  5GQO A;  3TEH B;  1SE3 A;  4IFD H;  4MNO A;  2VUM G;  5C44 B;  5C4X G;  4NW2 A;  2B2T C;  2NVY B;  4JBJ A;  5KNB A;  2UUC Q;  5COR A;  4BWG B;  2RSN A;  3GD7 A;  2VUM H;  2QDL A;  4B3S Q;  4QQB X;  4RHS A;  5JVG 3;  3R2I A;  3AYH B;  1XNQ L;  1EIF A;  2KUM A;  1SYG A;  3RN5 A;  1ZYR D;  2NB0 A;  1JB7 A;  4CBV A;  4F88 A;  3AEV A;  1WOC A;  1NNX A;  4PG3 A;  3D3R A;  1HTL D;  4A93 G;  5C4Z A;  1O80 A;  3MXU A;  2V4D A;  3OW7 A;  1H95 A;  2I5H A;  4UPA A;  5LMN W;  2NBF A;  3KJO A;  1SNM A;  1MJE A;  1PYB A;  4CJ1 B;  1R9T H;  1VQ9 A;  4DAP A;  4CKE A;  2F4V Q;  3PF5 A;  3PGZ A;  5I6W A;  1SBB B;  3KJP A;  1JC7 A;  4DR5 Q;  3PUY A;  1LT6 D;  3I4N B;  2L5T A;  1ILP A;  1Q7Y C;  1PH2 A;  4WJ4 A;  4XYO A;  2IHF A;  4PZ7 A;  3QB3 A;  3HOZ G;  1Q3L A;  2ZXO A;  1DZ1 A;  2NTS A;  3Q0A A;  1Q1E A;  2MUY A;  1FGU A;  1ONL A;  1JWM D;  4YCV A;  4DR5 L;  1D1K A;  2RCF A;  2PMZ E;  1E0B A;  2JQO A;  1PFM A;  1V1Q A;  4JI5 L;  3T1Y Q;  3J7A F;  3D8G A;  4WOR A;  4A3F H;  2UXB Q;  3J81 L;  2WB1 B;  3D6C A;  3HOU B;  1LO5 D;  4UHV A;  1L0W A;  1LTS D;  1IBK L;  4HIO A;  3NPP A;  4R1J A;  3KFU A;  3F2D A;  1OTC A;  2XWJ B;  3PF4 A;  3BG3 A;  4A3D G;  2HD3 A;  1X65 A;  3DWQ A;  4H0L C;  3DLL A;  2QCP X;  4A3F B;  1QZH A;  1PZK D;  4WFN 3;  1IBK Q;  2Z8L A;  4X6A H;  4C2M H;  4MIU A;  5IGG A;  4RGN A;  4YWM A;  3KDF B;  3OWF A;  2JYO A;  2GA4 B;  1VQK A;  3ZYY X;  3RLO A;  2LMC B;  2JA9 A;  3IL8 A;  3A7A B;  3Q23 A;  1XNQ Q;  1MKH A;  4H44 C;  3CU7 A;  3I4M G;  4EQP A;  1MGS A;  4KY7 A;  4EX5 A;  1G6Z A;  1PZJ D;  1X3P A;  3A0J A;  3HZX A;  1J6Q A;  2R93 B;  1TWC B;  2CW0 D;  2LKV A;  2M2L A;  1PTO F;  3VR2 A;  2HQE A;  3FPP A;  3HOX H;  4RHR A;  3S17 H;  3A7L A;  1X56 A;  1FVI A;  2GVA A;  4XDX A;  1GHJ A;  2PI2 A;  2ZXP A;  4FXG C;  3CPW A;  4XT1 B;  3I56 A;  1YHQ A;  1BKB A;  4BY7 G;  1SN8 A;  1CUK A;  4WJW A;  1STN A;  1GVP A;  4DUY L;  3RLF A;  2VQE Q;  5ELO A;  2K5V A;  2NVQ H;  4P73 A;  1HA5 A;  4GNX A;  1G8Z D;  3NBH A;  2RSO A;  3QG1 A;  5EBC A;  1I50 H;  5EQ0 A;  2DJF C;  2C35 B;  5JEA J;  2NVQ B;  1HHV A;  4KD3 A;  2YTY A;  4DAM A;  5A2Q E;  3FP9 A;  1EQT A;  1LTA D;  4RWS C;  4BBR G;  4WJ3 M;  2AHO B;  1K8A C;  3I4O A;  1EU4 A;  3NUC A;  1HJP A;  5E4W C;  4DV6 Q;  1XJV A;  1Y8P B;  4JBK A;  5KGU A;  2E2I B;  2F0T A;  3KYH C;  3NP8 A;  4XQN A;  4UP9 A;  4A93 B;  1S5C D;  4XXE A;  4IN3 A;  5IYC H;  1VQO A;  2UUC L;  4OHJ A;  4JK1 C;  3BVG A;  2AQ2 B;  1ZEQ X;  1UAP A;  2EJF C;  1CTM A;  2PW5 A;  1WTP A;  1JOR A;  1OXX K;  2SDF A;  2MQH A;  4DV3 Q;  4LF5 Q;  1YJW A;  1F9P A;  2X6G A;  1SNC A;  1SEB D;  4JI3 L;  1ENF A;  1TT2 A;  4BA1 I;  1ICW A;  3J81 i;  5CBA E;  2JEB I;  5K36 G;  3J7Y W;  4DV2 L;  3TQY A;  1KAA A;  5A35 A;  2YTX A;  1LTB D;  3U50 C;  5FO9 B;  3VR6 A;  1SYE A;  4NXN Q;  1K3R A;  2SNS A;  1J8I A;  3KLS X;  3I8Z A;  3KLW A;  1BNZ A;  1VCI A;  2K4K A;  4TQU S;  1BUV T;  1SRO A;  1TWA B;  4C56 C;  1B9N A;  5ELF A;  2CH4 A;  1Q81 C;  4GKJ L;  2ICI A;  3K0X A;  3DEP A;  3I2Z A;  3OIQ A;  1KDB A;  2EVB A;  5M5X H;  2BCO A;  1J9O A;  1IL2 A;  1CM9 A;  1BBU A;  4B3M L;  1PYS B;  2NYZ D;  3A54 A;  4ME3 A;  5EBD A;  3WOF A;  4DF7 A;  3L3O C;  1AEX A;  2IJ0 A;  4NDX A;  3U58 A;  3MZ5 A;  5JVH 3;  3SDZ A;  2FHT A;  1Y69 U;  3Q22 A;  1X3F A;  4ZQ3 A;  4OX9 Q;  2RVL A;  4JV5 Q;  2CQO A;  3CCQ A;  2BDN A;  1U4M A;  2DNC A;  4ZCK A;  1MHW C;  1LT3 D;  3K8A A;  1U9R A;  3T13 A;  1GKH A;  4NKL A;  2JA7 B;  2KCC A;  3EFX D;  4GNX B;  5BN5 A;  1YNJ D;  2LSS A;  2QEJ C;  4Q5V A;  1EY8 A;  1OXS C;  4C1N I;  4HJA A;  2F0V A;  4IPG A;  1Z9F A;  4GLV B;  2PNR C;  3U4V A;  3V05 A;  1GJX A;  5M5W B;  1M1K C;  1QNK A;  2NUC A;  4AYB G;  2O5J C;  3OW2 A;  5BR8 Q;  2PZT A;  1PTO B;  3H3V C;  3GTO H;  4GLA C;  3CCS A;  4CGY B;  4K5V A;  1LLR D;  3TP7 A;  1ZYR C;  2HDL A;  2B2Y C;  2CWA A;  3M7G A;  5C44 H;  3K81 C;  4DR7 L;  1BCP B;  1TWG H;  3J7A V;  3I73 A;  1FYC A;  1ET9 A;  1QZG A;  2B2V A;  1L1O C;  4KN4 C;  1IZ6 A;  4ILW A;  2R7Z H;  1I6H B;  3AFQ A;  1K0S A;  3DEO A;  4NP5 A;  5IGD A;  1N32 Q;  2F0K A;  2R92 B;  1SSO A;  3CXC A;  1UEB A;  2JE6 I;  3MEH A;  3CCE A;  1FD7 D;  3PIO A;  1S4Z A;  1I94 Q;  1Y14 B;  2QIL A;  3M4Y A;  3J7Z C;  1C8C A;  2A69 C;  1MD2 D;  3CP0 A;  1BCP F;  2EE1 A;  4DV5 Q; 
#chains in the Genus database with same CATH homology
 1YBY A;  3OTO Q;  3BZC A;  1AE3 A;  1IYJ B;  4LWC A;  4NXN L;  3GO5 A;  3TS2 A;  5FLX c;  4A3B H;  5DLQ E;  2NZO A;  2DUD A;  1E24 A;  4JYA Q;  2Q2H A;  4DUZ Q;  3PUX A;  2YYZ A;  3E9I A;  1VQG A;  4QL5 A;  1PH6 A;  4BY1 H;  5C0X G;  3S16 H;  4X66 L;  1ASY A;  2RF4 A;  4APV A;  4C3I H;  3JAM i;  4BBS G;  3I4N H;  4A3L H;  3HKZ E;  3S1Q H;  5M5W H;  1TWC H;  2CWP A;  3HFZ B;  2ZJP A;  4A3J G;  1IXR A;  2IHE A;  3H0G G;  2ALY B;  4A4I A;  2UU9 L;  2AMC B;  1EOV A;  2R93 H;  4JI6 L;  5BR8 L;  2JJQ A;  5GAD C;  1HZA A;  1HR0 Q;  3FHW A;  2MFI A;  5E7N A;  4JI5 Q;  3CCV A;  4HJ8 A;  1G29 1;  1B7Y B;  4EQ5 A;  4X65 L;  4HIM A;  4JBM A;  1CSP A;  2PQA A;  2HT1 A;  4B3S L;  5JJI A;  5EAY A;  3KF6 B;  4JI6 Q;  3ER0 A;  4YHH L;  1ASZ A;  3S1M H;  1BVS A;  1WCM G;  3CMA A;  1VQM A;  2UU9 Q;  4DKA C;  4BY1 G;  4KHZ A;  4MZ9 A;  1PH5 A;  1LM0 A;  2UXD Q;  1VQ8 A;  3KOJ A;  4DK3 C;  2V1C C;  1YIJ A;  1PH3 A;  4YWL A;  1N9W A;  3G6E A;  4X66 Q;  3AFP A;  1B8A A;  1Q12 A;  2XGT A;  1FJG Q;  4JYA L;  4DV7 Q;  2K14 A;  4GOP A;  4K0K Q;  2DGY A;  4PZ8 A;  1S72 A;  2HIV A;  3PUZ A;  3AQQ A;  1TWA H;  1KIX A;  2K5N A;  2F4V L;  2KHI A;  1KRT A;  3OTO L;  3K80 C;  4DV3 L;  4LF5 L;  1UE5 A;  4X62 Q;  3RNU A;  1Q82 C;  3T1Y L;  2JA5 G;  4LNQ A;  3T1H L;  2D0O A;  1KRS A;  1Q8K A;  2YTV A;  3G48 A;  1S40 A;  1EIY B;  4GKK L;  2NZH A;  3CC7 A;  4A3K H;  1PV4 A;  3BU2 A;  1BBW A;  5ELN A;  4NXM L;  3IRB A;  1HR0 W;  2Z6K A;  1YVC A;  3ZJY C;  3CF5 A;  4P72 A;  1J5E L;  1XPR A;  2VZA A;  1EWI A;  5C0X I;  2QA4 A;  1VQ6 A;  1AH9 A;  2A1A A;  1QUQ A;  4GOP C;  2UUB Q;  2IT1 A;  4QJF A;  1K0R A;  4DV0 L;  3KF8 B;  2I0Q A;  3S14 H;  3CPF A;  3HOX G;  2NVY H;  2K75 A;  2CFM A;  3UDF A;  1SRU A;  4RMF A;  4LFC L;  2PI2 E;  3NBH B;  1E22 A;  4GKJ Q;  4LF6 L;  1L2F A;  1QVF A;  4A3C G;  2F52 A;  5M3F G;  4HJ7 A;  2BH2 A;  4YCW A;  4OWX B;  4DR1 L;  3RZD H;  4HJ9 A;  4BA2 I;  2HIX A;  4DV6 L;  4DR1 Q;  4OWT B;  4OO1 I;  1VQP A;  2EIF A;  2Q2I A;  1AE2 A;  3U4Z A;  4OXP A;  3PSI A;  5JEA G;  1PHJ A;  1HNZ Q;  3PO3 G;  1HH2 P;  2KBN A;  4LFB L;  1TXY A;  1L1O B;  4DR3 L;  2GVB A;  4POF A;  3E0E A;  2D0P A;  1X9N A;  4LUZ A;  4LW1 A;  3W1B A;  2E8G A;  2L15 A;  1JE5 A;  3L2P A;  1Y1W H;  1Q86 C;  1NBW A;  3K7U C;  3OYY A;  1I3Q H;  3B6Y A;  2ZM6 L;  1VQ7 A;  3NEN A;  4IJL A;  1UE6 A;  1PH7 A;  2ZJQ A;  1C9O A;  1YJ9 A;  4NXM Q;  2H5X A;  4OON A;  4R4T A;  1VQD A;  1RIP A;  4DPG A;  1V43 A;  4R4C A;  2KCM A;  4DUY Q;  1JJ2 A;  3F2C A;  3CCU A;  2HHH Q;  4A3C H;  2IY5 B;  2R7D A;  4FDB A;  3T1H Q;  2R92 G;  4JI8 L;  1SE8 A;  5C0X J;  3CQZ H;  4O2D A;  1VQH A;  4GS3 A;  3WWV A;  3CW2 C;  2NN6 G;  2WAQ G;  4JI8 Q;  1W3S A;  5M3M H;  2ATW A;  4JCV E;  4GN5 A;  3H3V I;  5J3B A;  1U5K A;  4LF8 L;  1WYD A;  5GQO A;  3TEH B;  2JA7 H;  4MNO A;  3EBE A;  1YJN A;  1SFO H;  1N36 Q;  2VUM G;  3CD6 A;  5C4X G;  1KQS A;  4LFA L;  2BH8 A;  2WAQ E;  4B3T L;  3ULJ A;  4JBJ A;  4IFD J;  4JI1 L;  2ZTC A;  2YV5 A;  4DR6 L;  2Y0S E;  2UXC L;  3HOV G;  2UUC Q;  1MJC A;  2GN5 A;  3S2H H;  2E2I H;  2UXD L;  1XMQ L;  3UE0 A;  1G51 A;  1EUJ A;  2D62 A;  4LUO A;  4A3M G;  4BBR H;  2E2H H;  5IP7 G;  3GD7 A;  2VUM H;  4IOA A;  5AJ3 L;  4B3T Q;  1HNZ L;  4B3S Q;  4QQB X;  3CCJ A;  5IP9 H;  2CKZ B;  3AYH B;  3UDI A;  2VQF L;  1EFW A;  1EIF A;  3E9H A;  3M4P A;  4RG1 A;  3RR5 A;  1N36 L;  1XNQ L;  4X65 Q;  3RN5 A;  1D7Q A;  3A5U A;  1JB7 A;  2VL6 A;  2RHQ B;  4LF6 Q;  3AEV A;  1WOC A;  4R4I A;  3ULP A;  3J80 i;  4PG3 A;  2MO1 A;  1HNW L;  4HIK A;  4JG2 A;  4B3R Q;  4A93 G;  1Y1V G;  1SR3 A;  4A75 A;  2UUB L;  4JI2 Q;  1GO3 E;  1HZ9 A;  1VQL A;  4BXX H;  3MXN B;  1VQI A;  1K8G A;  1J5E Q;  1H95 A;  2I5H A;  4UPA A;  5LMN W;  2JA5 H;  2KEN A;  2I5L X;  2UUA L;  5IY0 A;  4JI4 L;  4JI7 L;  3CCM A;  4LF7 Q;  3KJO A;  4BBS H;  1WJJ A;  5IYB G;  1UE1 A;  1MJE A;  1PYB A;  3HOW H;  2JK8 A;  3KDF A;  1HZC A;  1KD1 C;  1K9M C;  2Z6K C;  4H02 A;  4OX9 L;  1R9T H;  1VQ9 A;  4OWW B;  2R93 G;  3CAM A;  4DR3 Q;  4IFD I;  1XNR L;  1A8V A;  1NMG A;  1KXL A;  2EQS A;  3HOW G;  2F4V Q;  2MO0 A;  3PGZ A;  5FJ8 G;  3PF5 A;  2JA6 G;  2B3G A;  4O0A A;  3M85 A;  4K0K L;  2R7F A;  1N33 L;  3KJP A;  4DR5 Q;  3PUY A;  2UUA Q;  5C4X H;  4DK6 C;  4GLX A;  2E5L L;  2RHS B;  1FJG L;  3J81 c;  4GKJ L;  1WI5 A;  1Q7Y C;  4A3E H;  1PH2 A;  2NVT H;  4WJ4 A;  2IHF A;  4PZ7 A;  2N3S A;  4MTN A;  4HID A;  4LF9 Q;  3HOZ G;  1HNW Q;  4DV0 Q;  3STB D;  3CCL A;  1Q1E A;  1X55 A;  4A3B G;  2E5L Q;  1FGU A;  4DV1 Q;  2YU9 H;  4YCV A;  4DR5 L;  2WB1 E;  1OXV A;  2PMZ E;  1FL0 A;  4A3E G;  4LF4 L;  4DR7 Q;  2JQO A;  5IYC G;  1V1Q A;  1LYL A;  4JI5 L;  3UDG A;  5AJ3 Q;  5H1S E;  3T1Y Q;  4A3F H;  4A3G G;  2UXB Q;  5JJK A;  1XNR Q;  1U0L A;  2K52 A;  2AWN A;  2N78 A;  4BY7 H;  1L0W A;  1E1O A;  1IBK L;  1PH9 A;  4HIO A;  4R1J A;  2UXC Q;  3GTP H;  3S2D H;  1JJG A;  4DR6 Q;  2JA8 H;  3KFU A;  3F2D A;  1OTC A;  1SLJ A;  3PF4 A;  3K7A H;  3HOZ H;  2B63 H;  4A3D G;  3D0F A;  4P75 A;  1JJC B;  1OXT A;  1TWH H;  1X65 A;  4DUZ L;  1O7I A;  3DLL A;  5C3E H;  3M9B A;  4UP7 A;  1QZH A;  1Q46 A;  4LF8 Q;  2ZTE A;  2PQA B;  1IBK Q;  3RLN A;  4X6A H;  1SMX A;  1CKO A;  4C2M H;  3GTG H;  1M90 C;  4YHH Q;  4YWM A;  3KDF B;  4DNI A;  1KL9 A;  4AIM A;  1QVG A;  4QY7 A;  2UXB L;  1CSQ A;  1KC8 C;  1VQK A;  3HOV H;  3RLO A;  1GD7 A;  2JA9 A;  4Y52 H;  1VQN A;  4LF4 Q;  2Y0S G;  3VDY A;  5JJL A;  1A63 A;  2VQF Q;  1XNQ Q;  1MKH A;  4L5T A;  4JI0 L;  3I4M G;  5IYD H;  2OTL A;  3GTM H;  1PH1 A;  4L5S A;  3H0G H;  3F1Z A;  1X54 A;  5FLM G;  4EX5 A;  2ZM6 Q;  2R6G A;  1N32 L;  3A0J A;  2B63 G;  4IPH A;  1J6Q A;  5C44 G;  1RL2 A;  4LF9 L;  4JV5 L;  4OO1 G;  4AQY L;  1X6O A;  3PO2 H;  2CCZ A;  4Y7N H;  3HOU G;  2ZTD A;  2WB1 G;  2IX0 A;  5IWA L;  1A0I A;  4LFB Q;  1LUZ A;  4A3J H;  3HOX H;  3F2B A;  3TRZ A;  3M3Y H;  2I5M X;  3S17 H;  1EQQ A;  3PCO B;  1HZB A;  1L1O A;  2N49 A;  1X56 A;  2RCN A;  1FVI A;  2GVA A;  3S1R H;  1N34 Q;  2PI2 A;  4P74 A;  1NTG A;  2AKW B;  1PH4 A;  1CKN A;  1VQA A;  1VQ4 A;  1E1T A;  3CPW A;  3I56 A;  4DV5 L;  4AQY Q;  1BKB A;  1KHI A;  2LXJ A;  1SN8 A;  1YHQ A;  1CUK A;  4GN3 B;  2A8V A;  4BY7 G;  2VW9 A;  1XTD A;  1PFS A;  1GVP A;  3HKS A;  4DUY L;  3RLF A;  2VQE Q;  1XPO A;  3S24 A;  4C3H H;  5ELO A;  2K5V A;  2HHH L;  4P73 A;  3J81 j;  4GNX A;  1IBL Q;  4LF7 L;  2NVQ H;  1JT8 A;  2XTI A;  1I50 H;  5FJ8 H;  3I55 A;  1XMO L;  2C35 B;  2JA6 H;  2N8N A;  5JEA J;  2Q2U A;  2YTY A;  4DAM A;  3FP9 A;  3GTK H;  4B3R L;  4YY3 L;  3G4S A;  3CC2 A;  4BBR G;  4WJ3 M;  1A62 A;  4JC0 A;  2AHO B;  3A74 A;  3I4O A;  1K8A C;  1C0A A;  1JMC A;  5LMN L;  5IP9 G;  4JBW A;  1N8R C;  1N34 L;  1HJP A;  4DV6 Q;  2EXD A;  1XJV A;  1VQC A;  3H15 A;  1VQB A;  1D8L A;  1WFQ A;  1PA6 A;  2ZJR A;  4JBK A;  1HNX L;  1X3G A;  3KYH C;  5IWA Q;  4UP9 A;  4GOP B;  4PZ6 A;  4JI3 Q;  3PUW A;  1XMQ Q;  5GAG C;  3PV0 A;  3CCR A;  3STB C;  5IYC H;  2QEX A;  3TS0 A;  1VQO A;  2UUC L;  5LMU Q;  3M4Q A;  1NMF A;  3NEL A;  4YWK A;  4JI1 Q;  3CME A;  3HOY H;  3LGJ A;  3JC6 6;  1VQF A;  1EQR A;  4J15 A;  4A76 A;  2MNA A;  3CC4 A;  4JI0 Q;  3H3V H;  2VS1 A;  3J7A 5;  4QGU A;  3PO3 H;  4KHP Q;  3PIP A;  1I5F A;  1YNX A;  1K83 H;  4KHP L;  1UWV A;  1NY4 A;  1OXX K;  4QIW E;  1G6P A;  4X62 L;  4IOC A;  2QGQ A;  2MQH A;  4DV3 Q;  4LF5 Q;  1YJW A;  2BA1 A;  1YZ6 A;  2NN6 I;  1QUQ B;  4GN4 B;  4XTC S;  3NEM A;  1S3O A;  1DGS A;  2VY3 A;  4JI3 L;  1YIT A;  5IP7 H;  4L5R C;  2B29 A;  3EN2 A;  4KLK A;  4BA1 I;  4A3K G;  3J81 i;  2JEB I;  2LXK A;  1P8L A;  4NB3 A;  3L0O A;  5K36 G;  4DV2 L;  2R92 H;  3UE1 A;  3TQY A;  4IPC A;  4L5Q A;  1V9P A;  1Y1W G;  2R7Z G;  1W2B A;  2OWO A;  2YTX A;  1YHB A;  4HJ5 A;  3HOY G;  4DR4 L;  3U50 C;  4A3I G;  1K73 C;  3DM3 A;  4PMW A;  5LMN Q;  3S1N H;  4NXN Q;  4DR2 Q;  1K3R A;  3W5O A;  2JA7 G;  1KAW A;  3KLW A;  4YY3 Q;  5IT9 c;  1VCI A;  2K4K A;  1YHA A;  4DR4 Q;  4TQU S;  4BXX G;  5C4J H;  1SRO A;  4X64 Q;  3UDX A;  4NPS A;  3L7Z C;  4DV2 Q;  4A3I H;  1PH8 A;  2PNH A;  4B3M Q;  3GTQ H;  4IFD G;  3BJU A;  3F8T A;  3EIV A;  1Z47 A;  1OXU A;  5IE8 A;  1Q81 C;  2ID0 A;  3K0X A;  3SGI A;  3I2Z A;  1VQ5 A;  4LFC Q;  3D31 A;  3KF6 A;  3JAM c;  5M5X H;  3RN2 A;  2F3I A;  4JOI C;  2A19 A;  4TVA B;  2JA8 G;  1IL2 A;  1BBU A;  2OTJ A;  4B3M L;  1PYS B;  1LTL A;  2ES2 A;  4ME3 A;  1GM5 A;  4X64 L;  3ICE A;  2K5H A;  1N33 Q;  3I7F A;  3U58 A;  4AH6 A;  1E7Z A;  2E2J H;  3RZO H;  1VQE A;  1Y1V H;  1B70 B;  2BA0 A;  4YCU A;  2HQL A;  1X3F A;  2WP8 J;  4DR2 L;  1NJI C;  2Q2T A;  4POG A;  4OX9 Q;  4KI0 A;  5GRO A;  4JV5 Q;  2CQO A;  3CCQ A;  4A3F G;  4A3G H;  1I94 L;  4IO9 A;  2KHJ A;  3GTJ H;  4DV7 L;  2NVX H;  3Q8D A;  4JI4 Q;  3ERS X;  1HNX Q;  4JI7 Q;  3G71 A;  4LFA Q;  2AWO A;  5M3F H;  3K8A A;  5FLM H;  4JI2 L;  1CKM A;  3BZK A;  4DV4 Q;  1WCM H;  1YI2 A;  1GKH A;  5M5Y H;  4GNX B;  1PVO A;  2LSS A;  1C7Y A;  5IYB H;  1OXS C;  5C3E G;  4R4Q A;  4HJA A;  4ALP A;  2JEA I;  4IPG A;  3W1G A;  1Z9F A;  4GLV B;  1I6H H;  3U4V A;  1EYG A;  4R4O A;  1IBM L;  4IPD A;  4AYB E;  1XMO Q;  1M1K C;  3M7N A;  4AYB G;  3ULL A;  1HR0 L;  3OW2 A;  5BR8 Q;  4UY8 C;  3I4N G;  3MEF A;  5LMU L;  3GDE A;  3GTO H;  1Q1B A;  4GLA C;  2WFW A;  3CCS A;  5IYD G;  3I4M H;  2FXQ A;  2VNU D;  4A93 H;  1YEZ A;  3M4O H;  4IJH A;  2CWA A;  1VS0 A;  2KCT A;  5C44 H;  1NE3 A;  4P71 A;  5M3M G;  2ASB A;  1UE7 A;  3K81 C;  4DR7 L;  1X3E A;  1P16 A;  1QVC A;  1TWG H;  1IBM Q;  3GTL H;  4XIG S;  3HOU H;  3FKI G;  2OQ0 A;  3S15 H;  5HGQ A;  4UP8 A;  2OQK A;  4DV1 L;  3J80 c;  1QZG A;  3HKZ G;  4JOI A;  5GAH C;  1L1O C;  1IZ6 A;  1MIU A;  2R7Z H;  3AFQ A;  4DAY B;  1E3P A;  4A3D H;  3PO2 G;  1N32 Q;  4DV4 L;  2Z0S A;  4A3M H;  3A5Z B;  2IX1 A;  2OCE A;  3FKI H;  4A3L G;  3CXC A;  1UEB A;  5HY6 A;  2JE6 I;  3CCE A;  1CKN B;  1TWF H;  1XPU A;  3PIO A;  1IBL L;  1VQJ A;  1Y14 B;  1I94 Q;  3J7Z C;  2VQE L;  5GAE C;  4C3J H;  4GNX C;  4GKK Q;  3PUV A;  1T9H A;  3CP0 A;  2K50 A;  4LUV A;  4DV5 Q;  3TRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...