1N34L

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n34L00
2K4KA 3BZKA 4DV1L 2RCNA 1W3SA 3CF5A 4GOPC 4JYAQ 4WJ3M 1E1OA 4LF6Q 3S24A 5M3MH 2LSSA 4K0KQ 3CCUA 1CKNB 3ULPA 2BA1A 1U5KA 3M85A 4EQ5A 1K73C 4EX5A 3GDEA 1PH9A 5FLMG 3GTGH 2JJQA 4LUZA 1SE8A 2KCMA 3A5UA 1KC8C 1K83H 1E3PA 3PUZA 1E22A 2AHOB 2ALYB 3PUVA 3A5ZB 3B6YA 2BA0A 5IP9G 1C7YA 4JI7Q 4IFDI 2YTYA 2E2JH 1EUJA 4DV7Q 1VQ7A 2GVAA 1YJWA 3GO5A 1P8LA 4LUVA 3CD6A 4GLVB 2ZJPA 3CMEA 1VQBA 2JQOA 3DM3A 4DR7L 4B3TL 3UDGA 4LF4L 2UXCQ 3EN2A 2WAQE 4ME3A 1Q82C 1HZ9A 2BH8A 4XTCS 1YI2A 1KAWA 3G48A 4JBKA 5H1SE 4X65Q 4QY7A 1PH2A 2KHIA 2I5HA 4IJLA 1A8VA 2Y0SG 2YU9H 1Z9FA 5M3MG 4A3DH 1PH7A 4GN4B 3PUWA 3HOUH 2Y0SE 4A3EG 1XMOQ 4DAYB 4JI4L 4GKJQ 4BA2I 4LF7L 3HKSA 4JG2A 4QGUA 1A62A 3GTJH 4OONA 5M5XH 4JBJA 5IP9H 5GAEC 5AJ3L 1WCMH 3CAMA 4A3IH 5C0XI 2HIXA 1QZGA 1HZCA 4A3GG 3S2HH 1WCMG 2N8NA 4BY1G 4A4IA 1MKHA 1YNXA 4AIMA 3HOXH 3F2BA 3RN5A 4APVA 4DV4Q 4JI5Q 3Q8DA 4AQYQ 3KJOA 1B8AA 2YTVA 4LFAL 1QVGA 4MNOA 4JOIA 5J3BA 4J15A 3H15A 4BXXG 1QUQA 4IO9A 4DV6L 1HJPA 2UUBL 3LGJA 4X64Q 4BY1H 1Q81C 1QVCA 2Z0SA 4A3FH 1GVPA 5LMUL 2UUCQ 4A3KH 2K5NA 3MEFA 2YTXA 4FDBA 4YWMA 1I94L 4QIWE 2IT1A 2R6GA 4L5RC 4X62L 4AQYL 3KLWA 1RL2A 3PSIA 2ZTCA 4HIKA 5C0XJ 4L5TA 2N78A 3RNUA 4A3CG 1IYJB 2UUAL 1QUQB 1CKOA 4DR3L 3ICEA 4BBSH 3M3YH 2NZOA 4JI8Q 1Q1BA 4OO1G 1KHIA 2ID0A 4P73A 4DK3C 3S1RH 4P75A 4DV0L 2Q2HA 5LMUQ 2CFMA 3KJPA 1VQPA 4NXNL 4DR1Q 1HNZL 3GTLH 1XMQL 2HHHQ 4LW1A 3AFPA 3F1ZA 3A74A 4DR6Q 4NB3A 1VCIA 4LF5Q 3ERSX 3I4MH 3PF5A 3PF4A 1PYSB 3GTKH 1IBKL 3TREA 1FGUA 3JC66 2JA6H 1PH3A 1XJVA 4YCVA 2R93H 3U58A 1EQQA 4PG3A 1CSQA 2KCTA 2OCEA 1YVCA 4IOCA 3PV0A 2KHJA 1HZBA 4GNXB 1I50H 2R7FA 2RHQB 5HY6A 1L0WA 3CPWA 1GO3E 1VQ4A 1LTLA 4R1JA 4HJ7A 4C3HH 3FKIH 4JI7L 2A8VA 2OWOA 1XMOL 2R7ZG 4POGA 4X62Q 2ASBA 4IPGA 3GD7A 3NELA 3JAMi 1VQ8A 5BR8L 1GKHA 1UE6A 1VQKA 4IPCA 4GNXC 4B3SL 2NVTH 1PFSA 1WOCA 2ZM6L 3W1BA 1J5EQ 4GKKL 1X3GA 2V1CC 2YYZA 5E7NA 3HOWG 1KD1C 4B3MQ 4JV5L 2JE6I 4YWLA 2R7ZH 4HIDA 1VQCA 3H0GG 1GD7A 2CWPA 1NTGA 4JYAL 1WYDA 1G6PA 2JEBI 1OXSC 1WI5A 2ZTEA 1K8GA 4HJ8A 4IFDG 2PI2A 1VS0A 1M1KC 2VUMG 1V9PA 1A63A 4P71A 1C0AA 2UU9L 2XTIA 2IHEA 2LXJA 1EQRA 3PO3G 2ZM6Q 1J5EL 1YBYA 3M4OH 4GKKQ 1H95A 1YHBA 4UP7A 3I2ZA 3UDFA 5GAHC 4OWWB 4LFBQ 4QQBX 1X54A 1L1OC 3L2PA 3W1GA 2I5MX 3K80C 2VQEQ 1AE2A 4Y7NH 2F4VQ 1HNWL 1PVOA 4L5SA 2PQAA 3CCMA 4UPAA 3CW2C 4HJ5A 4YWKA 5C44G 1PH4A 1HNXQ 2Z6KC 4C2MH 3K7UC 3M4PA 4TVAB 3M9BA 4YHHL 1L2FA 5AJ3Q 1I3QH 1JMCA 2MNAA 1OXVA 5C4JH 5K36G 1JT8A 2GN5A 4RMFA 4X65L 3S1QH 1VQNA 1YEZA 2K50A 2RF4A 3S1MH 2VNUD 2VQEL 4LF9L 4HJ9A 5C3EG 3OTOQ 2Q2UA 1VQAA 2CWAA 2N3SA 3UE0A 3PIPA 4JI0L 2GVBA 4DR6L 1CKMA 1B7YB 5M3FH 1Q8KA 3MXNB 1GM5A 2R92H 4A3DG 4DR1L 2QA4A 1P16A 3AFQA 4ALPA 3UE1A 4DV6Q 2WB1G 1E7ZA 2PQAB 1JJ2A 4AYBE 2ZJQA 3I4MG 3S15H 2EQSA 3ULJA 3W5OA 3KFUA 4PZ7A 5GROA 4GLXA 4H02A 1OXXK 5IYCH 1HR0Q 1YIJA 4HIMA 4DR3Q 2UU9Q 3K0XA 1T9HA 1UE7A 3PO2H 4A76A 4B3SQ 4A3JG 4DR4L 2BH2A 5C4XH 1V43A 3VDYA 2I5LX 4DV1Q 2B29A 2K14A 4GNXA 3H3VH 1Z47A 3K8AA 1ASYA 3ZJYC 2ATWA 3S1NH 1Y14B 2QEXA 5M5YH 1KIXA 5BR8Q 5C0XG 1EIYB 3HOVH 4WJ4A 4R4IA 1PH5A 2D0OA 2E2HH 1LUZA 1OTCA 2WAQG 4DR4Q 5FJ8G 4LFCL 3T1YQ 2XGTA 1X3FA 1IBKQ 3HOZH 3FHWA 1A0IA 2E5LQ 3RN2A 3TS2A 4X66L 5IYDG 1KQSA 3E0EA 4O2DA 3CCRA 3RLOA 4KHPQ 3I4OA 3M4QA 4GLAC 4DUZL 4XIGS 3TS0A 4Y52H 1KRTA 3G71A 1Y1WG 1OXTA 2DGYA 3U50C 2VQFL 4A3MG 4NXML 4X66Q 3FKIG 3DLLA 2AKWB 4IOAA 4LF8Q 1S3OA 2E5LL 3J7ZC 4JBWA 3RZDH 3J80i 4OWTB 4JV5Q 1VQEA 2K75A 4A3MH 3CC2A 2OTJA 4KHPL 3CCSA 3HKZE 4PMWA 3OW2A 1HNZQ 2JA8H 2MO0A 3J81c 3OTOL 1TXYA 3CCJA 5C44H 3PIOA 4UP8A 4IPHA 1NE3A 2K5HA 1FL0A 4OXPA 5JEAG 1G51A 3K81C 3S14H 5FLMH 4C3IH 2NVYH 4DR2L 3PGZA 4BY7G 3PO3H 1LM0A 4B3RL 5IE8A 1N36L 3NBHB 2I0QA 1YHQA 1EOVA 3I56A 3A0JA 2OQ0A 4P72A 5ELOA 4OO1I 4TQUS 5C4XG 1VQIA 2VZAA 4LFAQ 5IP7G 1VQJA 2CCZA 3J80c 1HR0L 1IBMQ 3M7NA 3IRBA 4JI1L 1PH6A 1V1QA 4OX9Q 2WP8J 3E9IA 4JI6L 3EBEA 1K9MC 3CCLA 2KBNA 4IJHA 5IY0A 4DR2Q 3J81i 1KXLA 1W2BA 5JJLA 3KDFB 1Q7YC 1AH9A 3BJUA 2AMCB 3G6EA 4LF9Q 1WJJA 4LF5L 2K5VA 1TWCH 5IWAL 4B3ML 4PZ8A 4LF7Q 1E1TA 1N34L 2B63G 2YV5A 2N49A 3ER0A 3CCEA 3L0OA 2Q2IA 2OTLA 4DR5L 3EIVA 2R92G 3RZOH 1Q46A 1FJGQ 1PH8A 2IX1A 1SN8A 3CXCA 2A1AA 2F3IA 1N9WA 1VQGA 3PCOB 4GN5A 5GADC 3HOXG 3L7ZC 2PNHA 1E24A 4YHHQ 2VQFQ 5LMNW 1PV4A 4A93G 4LFBL 2JA9A 1HR0W 5IYBG 2UXBL 1L1OA 1R9TH 1VQMA 4AYBG 5LMNQ 1LYLA 3CC4A 2VUMH 3HOYH 3PUXA 4A75A 4A3BG 2IY5B 2E8GA 3UDXA 3KOJA 3BZCA 4YCUA 2UXDL 4A3JH 4R4TA 1XPOA 4B3TQ 2Z6KA 4YY3Q 3F2DA 2JA5H 4BA1I 4DR7Q 1YJNA 1B70B 1JJCB 4QL5A 2A19A 3J7A5 2WFWA 1EYGA 1X6OA 1IBML 2JA8G 2B63H 1WFQA 4NPSA 4JI2Q 2VL6A 4AH6A 4BBRH 4JI0Q 1ASZA 3UDIA 1SRUA 2JA7G 1X3EA 4A3LH 2F52A 1N32L 4JI5L 3BU2A 4DNIA 3CC7A 3KF6B 5LMNL 3F8TA 1X65A 3RR5A 4BBRG 1VQ5A 4C3JH 4K0KL 3OYYA 1CSPA 2ZJRA 3STBC 3AQQA 3NENA 4JCVE 1HNXL 3TRZA 1JE5A 1AE3A 1TWGH 4DV5Q 2QGQA 2AWNA 2FXQA 4LF8L 4JC0A 2UUCL 4R4OA 1K0RA 1L1OB 1S40A 2B3GA 2PI2E 2NZHA 4NXMQ 4A3BH 3SGIA 1JB7A 1XTDA 5JJIA 1YHAA 4GOPA 2DUDA 4JI3L 5JEAJ 4DV2L 2MO1A 1EFWA 3CQZH 1TWAH 1X55A 2CQOA 3CCQA 1QZHA 1VQ6A 2UXDQ 1PYBA 5IP7H 2VY3A 4DV0Q 1SROA 1UEBA 1D7QA 4DUYQ 3H3VI 4HIOA 2JEAI 4DAMA 2HHHL 2HQLA 4DUZQ 1PA6A 4A3CH 1NY4A 2L15A 1XNQL 1KRSA 5FLXc 1NMFA 2D0PA 1N33Q 3HFZB 2NN6G 3TEHB 3TQYA 3GTQH 3F2CA 5GQOA 2LXKA 1VQOA 4JI4Q 1QVFA 2HT1A 3H0GH 4GKJL 1UE1A 4LWCA 1U0LA 1N36Q 2KENA 2K52A 1D8LA 1K3RA 1HH2P 1XNRQ 1G291 4BBSG 1N33L 5IYDH 3AEVA 2JA5G 3STBD 4KLKA 2Q2TA 2HIVA 1YJ9A 3ULLA 4LF4Q 1Y1VH 4POFA 5HGQA 1PHJA 1K8AC 4DK6C 3HOYG 2JA7H 1SMXA 2ES2A 4JI6Q 4OWXB 1CKNA 1MIUA 3I4NH 1BBUA 3G4SA 1I5FA 1X56A 4GS3A 4A3GH 2UUBQ 2JK8A 1XNRL 1RIPA 1KL9A 4DV2Q 4JI3Q 3I4NG 1Q1EA 1J6QA 3T1HL 3CMAA 4PZ6A 4YY3L 5FJ8H 4B3RQ 4UP9A 5IT9c 2VS1A 5M5WH 1PH1A 4MZ9A 5IYCG 2H5XA 1VQLA 1XNQQ 1IBLQ 2UUAQ 1NJIC 4GOPB 1NBWA 3RLFA 1N34Q 3T1YL 4LFCQ 1HNWQ 4LNQA 4DPGA 1Y1VG 4GN3B 1MJEA 1UE5A 3I7FA 3FP9A 1IBLL 4DR5Q 3D0FA 4DKAC 4IFDJ 4A3EH 3HOUG 2MFIA 2NVXH 1OXUA 3HKZG 1VQFA 5IWAQ 3E9HA 5C3EH 4X64L 1DGSA 2IX0A 1IZ6A 2CKZB 3PUYA 2D62A 1YITA 4DV7L 1HZAA 1X9NA 3KF6A 4JBMA 1IL2A 5JJKA 4UY8C 4A3IG 2NN6I 5GAGC 3CCVA 4JI8L 3WWVA 4QJFA 4JI1Q 4DV4L 3S17H 2ZTDA 1BKBA 1SLJA 4BY7H 2C35B 4R4CA 5M3FG 3HOVG 1M90C 1BBWA 1EIFA 4DV3Q 4BXXH 2UXBQ 1VQDA 3I55A 4LUOA 1BVSA 2R93G 1S72A 3D31A 2EIFA 1UWVA 1O7IA 4RG1A 2RHSB 4KHZA 2NVQH 3KF8B 3U4ZA 3KYHC 1I94Q 1JJGA 1VQ9A 4JI2L 5EAYA 3PO2G 1IXRA 4LF6L 4O0AA 4A93H 4X6AH 3AYHB 3J81j 3GTPH 2AWOA 2OQKA 3RLNA 4HJAA 2MQHA 1MJCA 1TWFH 4KI0A 4P74A 3JAMc 1Y1WH 1Q86C 4DV3L 3GTOH 2UXCL 1SFOH 1SR3A 1I6HH 3K7AH 3S16H 1YZ6A 4YCWA 4OX9L 1EWIA 2PMZE 1CUKA 4DUYL 1N8RC 2F4VL 3HOZG 3T1HQ 1NMGA 4IPDA 4A3LG 1TWHH 1XPRA 4DV5L 3U4VA 2IHFA 3CP0A 3S2DH 2EXDA 2WB1E 3KDFA 4MTNA 4R4QA 2E2IH 1Q12A 1FVIA 4JOIC 4L5QA 5IYBH 4A3KG 1XMQQ 1FJGL 3NEMA 3HOWH 2VW9A 4A3FG 5ELNA 3CPFA 4NXNQ 3GTMH 2JA6G 2R7DA 5DLQE 1N32Q 1VQHA 1XPUA 1C9OA
chains in the Genus database with same CATH superfamily
2K4KA 4OIJA 3G7LA 1W3SA 4GOPC 2LSSA 3CCUA 2OF1A 1CKNB 4G7HC 3M85A 1PH9A 1SYCA 3GDEA 1QJOA 2JJQA 1CT1D 1SE8A 2XRQD 5T1GA 5JEAH 4A3IG 1E22A 2AHOB 3A5ZB 1HCZA 1Q3LA 1SE3A 4DV7Q 2GVAA 2A6HC 2RQXA 4GLVB 2ZJPA 4ZYSA 3CMEA 1K3BC 2JQOA 3OWEB 2SNSA 3EN2A 1FNUA 2BH8A 2F0WA 3KLSA 3L3OC 2IX3A 1GOZA 4X65Q 3QOJA 2NUCA 1PH2A 2I5HA 1DZ1A 1A8VA 1PRTB 1Z9FA 2NWGA 5M3MG 1PH7A 4X3SA 4A3DH 4A3EG 1X3QA 2DY8A 1ENFA 4JG2A 3GTJH 1A62A 5GAEC 3IKJA 4G4KA 2NTTA 5K36H 2HQEA 1PFBA 4K5VA 5FO9B 4XT3B 2F0LA 3DXJC 4RHRA 3Q8DA 5IGFA 4BS9A 3KJOA 2YTVA 1BCPB 3FKIB 4AYBB 1HJPA 4X64Q 3D3RA 1Q8IA 2Z0SA 5LMUL 3I73A 4A3KH 4DU9A 1I94L 2R7ZB 1NNXA 2ZTCA 5EPLA 1GHKA 5E4XA 3OOCA 1TVXA 3S1QB 4DK3C 2DJFC 3S1RH 1UEAB 2K5QA 5ELBA 4DV0L 1PZID 1V1PB 2EOTA 5I6WA 1HNZL 1YNNC 1B2TA 3GTLH 2HHHQ 4LW1A 5G3LD 1C8CA 3ERSX 1D5ZC 3D4RA 1ZYRD 2HDLA 2OCEA 4IOCA 3DEOA 2KHJA 1D5MC 1IL8A 1I50H 5HY6A 1L0WA 5I2XA 3IFTA 2E76C 4R1JA 5EKIA 4HJ7A 4C3HH 1W6JA 2WAQB 4X62Q 5BR8L 4B3SL 1UE6A 1BCPC 1HRJA 5J1ZA 3W1BA 1S4ZA 2ZXOA 1LLRD 4YWLA 4HIDA 1VQCA 2F0NA 3H0GG 2B63B 4JYAL 2L4NA 3SDZA 2JA7B 2PI2A 1J9OA 1V9PA 2PCFB 2HUGA 1C0AA 4JPBW 4JW0A 2IHEA 2ZM6Q 1H95A 4UP7A 3UDFA 3I2ZA 4LFBQ 1L1OC 1F9QA 1KDBA 2I5MX 1CQVA 2EY6A 1AE2A 1R4QB 3I4LA 4Y7NH 4F87A 2KVMA 1SFOB 4KY6A 3AU7A 5C44G 1PH4A 5I9PA 1HNXQ 2K32A 1PFMA 3BVZA 3K7UC 1RJTA 5K36G 2GN5A 1AN8A 1YEZA 1V1PA 3W2DA 4HJ9A 3OTOQ 4DK1A 2CWAA 1STEA 2CQAA 4XQJA 3MXNB 3T51B 1GM5A 2R92H 4DR1L 3TZUA 1P16A 2EJGC 3AFQA 2KA7A 2WB1G 1E7ZA 5CV7A 3S15H 3MC0B 4C3IB 3N52A 3S17B 1OXXK 4HIMA 4DR3Q 3A7LA 3PO2H 5A35A 2JP1A 1TU2B 3D8GA 4DR4L 1V43A 3KBGA 2I5LX 2F0SA 1A2TA 1EY5A 3S1NH 5DM63 3J80E 1WTOA 3HOVH 4WJ4A 1CA5A 3OSOA 3HOZH 3TS2A 3FHWA 3HOZB 3I72A 2IW3A 4TKOB 4KHPQ 3RLOA 2E2IB 4GLAC 2FMCA 4XIGS 5EPJA 3C3LA 4Y52H 3U50C 4NXML 4A3MG 1ZXTA 1S3OA 3RZDH 2F4IA 3D6CA 3CC2A 2OTJA 2F3WA 1J8IA 3OW2A 2MO0A 3OTOL 1JR0D 3V96A 5C44H 4UP8A 1NE3A 2P5ZX 2MJ8A 4KD3A 1G51A 2R93B 2SNMA 1PTOB 1V8QA 5LL6X 1ZYRC 2Y0SB 4C3JB 3PO3H 4B3RL 3HS0C 3P7JA 5IE8A 3QG1A 4ZUIA 1EY8A 3A0JA 2OQ0A 4OO1I 2RKSA 4LFAQ 3X3NA 1IBMQ 4JI1L 1NR4A 4OX9Q 2WP8J 3E9IA 3EBEA 3CCLA 1RD9D 5IY0A 2H4OA 4LMQD 1Z7TA 1KXLA 2AQ3B 1W2BA 2CHBD 4LF5L 2K5VA 2B63G 4JV5Q 2E2DC 3ER0A 3A55A 1SNOA 3L0OA 3M4OB 1X3PA 5AFWA 1I4HA 2MHVA 5EJWA 1R4PB 1Q46A 1PH8A 1I3QB 5C3EB 5KNBA 5GADC 1N9WA 1WVLA 4FF4A 5C0XH 5K5PA 1HR0W 1O78A 5I9OA 5IYBG 2UXBL 2VUMH 1LYLA 5A2QE 4C1NK 2O5JC 3KOJA 3R2IA 4QMGA 1AW7A 4R4TA 3VYUA 3NXWA 2M2LA 2Z6KA 3T4AC 1DOLA 4DR7Q 4QL5A 2A19A 1DYQA 1X6OA 1IBML 1GUTA 2B63H 4NPSA 4Q0FA 4AH6A 1AZPA 2D9UA 3LNNA 2B2WA 2EYLA 4N9PA 4JI5L 2NN6H 1TKWB 5IGEA 4BBRG 2IJ0A 3CHBD 4CGYB 1XTCD 3TP8A 3D4WA 3STBC 3NENA 4JCVE 3TRZA 1TWGH 2AWNA 1ZKOA 2EVBA 4H0LC 3DUZA 1L1OB 2NZ1D 2B3GA 4NXMQ 4CDFC 5JJIA 1YHAA 2DUDA 3H6MA 4JI3L 4DV2L 3BZDB 2MO1A 2C5CA 1TWAH 3CCQA 1TWAB 2PNRC 4RAUC 4C1NI 3DHQA 1B9MA 4DUYQ 3H3VI 4HIOA 2JEAI 4DAMA 1HUMA 2D2CC 2HQLA 4OIKA 2L15A 3FDTA 1CZWA 1KRSA 1NMFA 2NN6G 3F2CA 3GTGB 2HCIA 1SAPA 2JN4A 3JAML 1VQOA 4H7BA 4LWCA 1U0LA 1RTNA 4WFN3 3HEJA 1UNSA 4BBSG 1G291 1F2MA 5IYDH 5CV9A 1YJ9A 4LF4Q 1Y1VH 2L0CA 1K8AC 3I4NH 1CKNA 4A3GH 2UUBQ 3H3VC 1KL9A 1HQMC 5CBEE 2A68D 4DV2Q 4JI3Q 3I4NG 3SE0A 3BYTB 4K5XA 4PMCA 1PH1A 4MZ9A 5IYCG 4R8NA 1IBLQ 3GTQB 2OXPA 2WKCA 3DEPA 2RBMA 3T1YL 1HNWQ 1UE5A 3FP9A 4L6TB 3LWUA 2E75C 1MBYA 4HSPA 4EQOA 3QIAA 3HOUG 5CYUA 5IWAQ 2IX0A 4K2LA 2EPBA 2K1BA 2M9VA 3DWPA 4BWGB 2ZXRA 1CK1A 5EPKA 4QJFA 2C35B 4RGOS 3BVGA 5C3WA 2UXBQ 3L9AX 2RDHA 3I55A 1BF4A 4K2KA 4LUOA 2K01A 4OO1H 2R93G 1VMCA 2Z4HA 2EIFA 1S72A 4RG1A 2RHSB 4K6LA 2R61A 1CFMA 3U4ZA 3V2TA 3P1HA 5NUCA 1IXRA 3OWFA 4O0AA 2RVLA 1Y8PB 3AYHB 2QKIC 3GTPH 2OQKA 4KI0A 1Q86C 3GTJB 1TWHB 2QW7A 3GTOH 2K05A 3HOVB 3K7AH 5KNDA 4YCWA 5IT9E 1EWIA 2X6LA 1WD1A 2F4VL 1SEBD 3HOZG 3HOYB 3T1HQ 4ZKBB 5C4HA 4TSSA 5CV8A 1RODA 3CP0A 3S2DH 4MTNA 3KDFA 2E2IH 1FVIA 4JOIC 5IYBH 1FJGL 3URYA 4G57A 2VW9A 4A3FG 3CPFA 3GTMH 2RCFA 3BDCA 2A74C 3H94A 1Y8OB 5DLQE 1XPUA 1GUNA 5HGTA 1E1OA 2MP1A 1HTPA 5E1FA 3S24A 4LF6Q 3NBHA 1PTOD 1K73C 4EQ5A 4S3SA 4RA8A 4LUZA 1KC8C 2KCMA 1K83H 3PUVA 4JI7Q 2BA0A 2E2JH 1EUJA 1VQ7A 1STNA 3GO5A 3CD6A 2DNEA 2YU9B 1VQBA 1I6HB 1S5CD 4DAVA 3NWTA 3DM1A 2UXCQ 1RKNA 4I7ZC 1KAWA 1BO0A 3K5OA 2C9OA 3QJYA 1QB5D 2EXZA 2KHIA 4FYDA 1U4RA 2Y0SG 4FXKC 4GN4B 1MSGA 3PUWA 2XSCA 3HOUH 1XMOQ 1ET9A 4DAYB 5KNCA 2A68C 1Z6HA 3TP7A 5C4JB 5M5XH 3EJIA 4JBJA 5IP9H 1EY0A 3I8ZA 2EE1A 5C0XI 1EWCA 5FLXL 1TT2A 1QZGA 1HZCA 3Q24A 1E0BA 1YNXA 3F2BA 1EY9A 4DV4Q 4LFAL 1B8AA 1EYDA 1QVGA 4MNOA 2FINB 2Q8IB 3NQIA 1STAA 1T5XD 4JOIA 1FNVA 4J15A 3H15A 4A3MB 1G2TA 4IO9A 4DV6L 3LGJA 4J8QA 1EEFD 3Q23A 4A3FH 4BY7B 1ESRA 3SHLA 2K5NA 4FDBA 2HDMA 4QIWE 2IT1A 3E0JA 1NUCA 4RCNA 3PSIA 4AQYL 4DK0A 2NVQB 5KRUA 5C0XJ 4L5TA 2N78A 3RNUA 1PDQA 4A3CG 3U9OA 1NCVA 2KQ3A 4BBSH 2EJFC 1TY2A 2NZOA 4JI8Q 4CKEA 1KHIA 4EVOA 1NAPA 4P75A 1VQPA 4C2MB 3OHXC 3AFPA 1VMPA 3F1ZA 3H09A 3A74A 2NVXB 4NB3A 5BN3A 3K59A 3C1EA 3PF5A 1PYSB 3GTKH 3MXPA 1PH3A 1QNKA 2TMPA 4C3JG 2KCTA 1YVCA 3PV0A 1MHWC 2FMMA 2Z9HA 3MWYW 4GNXB 2RHQB 1GO3E 2WIIB 4IUVA 2HD3A 3FKIH 5LL6S 3K0YA 4OEMB 1XMOL 2R7ZG 2ASBA 4IPGA 3GD7A 1VQ8A 1E2WA 1GKHA 4GNXC 1J5EQ 4IALA 1KDAA 2RDFA 3HOWG 4B3MQ 1CZGA 4IUUA 2JE6I 1G6ZA 1KNAA 2R7ZH 2CWPA 3I3CA 1WYDA 1WI5A 3WDNA 1K8GA 4IFDG 1A63A 1V1OA 3SK6A 2UU9L 4LJZC 3VR5A 1M4VA 1H9SA 4GKKQ 4XYQA 5E3FA 1X54A 3L2PA 2B2UA 3I4MB 1PVOA 3CCMA 1JOKA 4X3TA 3CW2C 3CU7A 2KJXA 1D6EC 3MTSA 3M4PA 4TVAB 2XWBB 5AJ3Q 1I3QH 3TDQA 1I4RA 1HXYD 2L12A 1JT8A 4X65L 1VQNA 2RF4A 3S1MH 2WV6D 4XXEA 2EZVA 1JOQA 1K8OA 5C3EG 1KABA 2Q2UA 2ICIA 3ONAB 1YNJD 1TR5A 4DR6L 5M3FH 3A54A 4K8JA 4WJWA 3C2PA 2CVRA 4V0BA 5DAUA 2ZJQA 1LT3D 1PFNA 2ZT9C 4HMJA 4AYBE 5IGGA 2EQSA 3SEBA 3ULJA 2EYPA 3KFUA 2NVYB 4KJOA 1ONLA 3AMUA 2I46A 4GLXA 2A73B 3TP6A 1YIJA 1M8AA 2UU9Q 1GJXA 3A7AB 4A3JG 1T5EA 4IURA 5C4XH 2K14A 1PTOH 4L63B 1Z47A 3K8AA 1ASYA 5CMDA 4LAAA 1Y14B 1EIYB 4A3KB 1PH5A 2E2HH 3A8KE 1OTCA 1A0IA 5EGTA 3E0EA 3I4OA 3TS0A 1L0YB 2KHSA 1AP0A 2DGYA 4KKUA 2VQFL 3S9WA 3DLLA 2PZWA 1WTQA 4K8IA 2E5LL 4JBWA 3J80i 3JAME 3SK8A 4H44C 3HKZE 1JE4A 2HCCA 3J81c 1PYWD 1PXUA 5C5MA 3PIOA 1FL0A 4DR2L 1XX8A 1C48A 3PGZA 4BY7G 5M3MB 5CGKA 1N36L 1A15A 1B44D 1DM0B 2I0QA 1GUWA 3I56A 1JORA 4P72A 1AFPA 2GA4B 5COYA 1FR3A 2CCZA 3J80c 1HR0L 1U9RA 3H91A 3IRBA 3M7NA 1V1QA 1LTRD 1S5BD 1CHPD 3KLRA 4JI6L 2KOLA 1K83B 1TS2A 4IJHA 3J81i 5C4ZA 1Q7YC 2FFKB 3G6EA 3FPUB 5EBDA 4LF9Q 1TWCH 1QOHA 4DAPA 2B2VA 1SXTA 2RSOA 2Q2IA 3LWEA 2OTLA 3RZOB 5M5YB 4DR5L 3EIVA 1MI2A 3RZOH 3J7AF 4FO2A 2JSOA 3KLSX 4DNRB 3T16A 1D1IA 4YHHQ 1LACA 3R93A 4KN4C 5LHY1 1L1OA 1R9TH 4IUTA 4AYBG 5LMNQ 3S2HB 2IY5B 3C1FA 4A75A 3VYSA 3J81E 2F03A 1STGA 4B3TQ 3F2DA 2JA5H 1DD2A 1YJNA 2JA5B 3PO3B 4OELB 3VA5A 1EYGA 1G2SA 3K5LA 3NE5B 1GXDC 1A3TA 4JI0Q 1SRUA 2JA7G 1HTLD 3QO2A 4A3LH 1EFID 1QWYA 3CRLC 4DNIA 2NVTB 3KF6B 5LMNL 2J4XA 3RR5A 5KYLA 1DONA 2DN8A 4A3FB 3OYYA 3PO2B 2Q8RE 2LY7A 2ZJRA 1PRTD 3GTPB 1GHJA 1S5FD 4LF8L 4JC0A 4R4OA 1K0RA 1S40A 2PI2E 2B2TA 2IPKD 1XTDA 4GOPA 5JEAJ 3HGBA 2FJ2A 1E2ZA 4OL7A 2UXDQ 1PYBA 2G9DA 3D4DA 1SYFA 1QG7A 1UEBA 2B2VC 5IGBA 4DUZQ 4A3CH 4E6IA 1H9SB 3GTQH 3TQYA 3TEHB 2B8GA 1JWUD 1B9NA 2XRSD 3RZDB 4JI4Q 3WOEA 3EFXD 3VR3A 3I91A 1UE1A 1N36Q 5KEEA 1ENAA 3STBD 2HIVA 3ULLA 4MN3A 1SSOA 4DK6C 4OWXB 4DN4M 1I5FA 2QF7A 2MPMA 2L55A 3CMAA 3T1HL 3BYYB 5FJ8H 4B3RQ 2VS1A 4Z9CB 1WCMB 4RH6A 1ZEQX 5FLXE 4RHSA 2VB2X 1KLGD 1NBWA 3S1RB 1EU3A 1Y1VG 3OIPA 1MJEA 4V190 3X3MA 3I7FA 1RF2D 3D0FA 4A3EH 1ILQA 1OXUA 5FK9C 5CR3A 3E9HA 5C3EH 4CKCA 1ICWA 3NHHA 2G9HD 4I65A 5JJKA 4UY8C 4KTAA 2NN6I 5GAGC 3PIO3 3CCVA 3EA6A 2E2JB 4EQPA 1BKBA 4BY7H 2F0GA 3HOVG 1M90C 4MTKA 4DV3Q 5CBAE 1KLUD 1QCBD 2NB0A 1F2ZA 4ABNA 1LABA 4KKTA 1K28A 3KF8B 5JJZA 3K5MA 1I94Q 1VQ9A 1K8MA 3PO2G 2N55A 2F0IA 4K5WA 2B39A 3K6OA 2KCCA 4PMBA 2DNCA 2MQHA 1TWFH 2A6ED 4DV3L 1HUNA 1SBBB 3EVQA 2UXCL 1FD7D 1SR3A 2SEBD 1I6HH 1WTPA 1YZ6A 1JQYD 2PMZE 1CUKA 4C56C 4DV5L 2EXDA 2WB1E 1LTGD 5ELEA 1EY6A 3HOUB 2Z6BA 4NXNQ 2VXWA 1SYDA 1SNMA 5DM73 2X69A 4NMZA 1JICA 3BZKA 3GV3A 1PZJD 2RCNA 3CF5A 5I2YA 2F0FA 2R92B 2BA1A 5EKLA 1U5KA 1ET6A 3GTGH 3U9SA 3A5UA 3PUZA 1E3PA 4YY3L 2ALYB 3B6YA 1C7YA 4ZQ3A 5JAVA 2F0JA 1YJWA 1SJED 1P8LA 4DR7L 4R9WA 2A5HA 3UDGA 1GUGA 4B3TL 3VR4A 4RFBA 2WAQE 4XTCS 2OEOA 5H1SE 3OMCA 1LTBD 4IJLA 1LTTD 3NTKA 3S16B 2Z4IA 4GKJQ 5FOBB 3K57A 4GZYC 2FHTA 3CAMA 4A3IH 3TMEA 5CV6A 3CQZB 3MFYA 4A3GG 4UAIA 1HFNA 1O7ZA 1WCMG 2N8NA 4AIMA 4A4IA 3HOXH 3RN5A 4JI5Q 4APVA 4AQYQ 2K6AA 4C3IG 4ME5A 2F3VA 4BXXG 1TQOA 2UUBL 3HOWB 1Q81C 2Q8TA 1GVPA 3J80L 2UUCQ 3MEFA 4YWMA 2LMCB 2YTXA 4OHJA 2R6GA 3E5SA 4X62L 2CW0D 1SYBA 4HIKA 3TBIB 5EBCA 4UDUC 3RD4A 4IUNA 3TZDA 1CKOA 3GTLB 3LX0A 3KUPA 1U4PA 2L11A 4OO1G 1EIGA 2ID0A 5LMUQ 3KJPA 4NXNL 4DR1Q 1XMQL 1DJRD 4DR6Q 4KHVA 2EY2A 1VCIA 4LF5Q 2Z1CA 3I4MH 1NR2A 1FGUA 4O42A 4QIWB 1XJVA 3S14B 1IYUA 2VB3X 1EQQA 4PG3A 1CSQA 1EEID 2R7FA 1VQ4A 4ZKCB 2L5TA 2M00A 2AUKA 3A8JE 3JAMi 1VQKA 2F0MA 3ND8A 1WOCA 4GKKL 4KD4A 2V1CC 2YYZA 4HCSA 1IHZA 1KD1C 2XVSA 1SDFA 5D14A 4FXDA 1G6PA 1BDOA 1GD7A 1NTGA 1UUPA 4WORA 3M3YB 2JEBI 2ZTEA 4WRDA 2WB1B 1VS0A 1M1KC 2VUMG 2KEEA 4NW2A 4P71A 4BY1B 4N8FA 3MFGA 1WTVA 2XTIA 2LXJA 3KBXA 3PO3G 1J5EL 1YBYA 2WACA 4FF1A 5GAHC 4OWWB 1W6KA 1BBXC 3W1GA 3K80C 1TWCB 2VQEQ 4B08A 4L5SA 2PQAA 4G7ZC 4UPAA 3BVMA 4YWKA 4KY7A 2PYKA 4YHHL 1L2FA 2F0VA 2MNAA 3CKIB 4H13C 5IGCA 5A2QL 4LF9L 3GQBA 4DGZA 3UE0A 4JI0L 1JWMD 1KAAA 1UAPA 2GVBA 4PV1C 1B7YB 1Q8KA 4A3DG 2CH4W 2Z8LA 3TP5A 4ALPA 3UE1A 1KDCA 3W5OA 3MAQA 4PZ7A 2G5DA 5IYCH 1HR0Q 5FO8B 3AB9A 2LS01 2XWJB 5FKAC 1UE7A 1TY0A 3P20A 4A76A 4B3SQ 1YNND 3KK7A 4MHEA 1MD2D 2A6HD 1AEXA 4DV1Q 4XYOA 4GNXA 3H3VH 2ATWA 5M5YH 1S5DD 5BR8Q 5C0XG 1D1KA 4B9WA 5BN4A 2WAQG 1Y8NB 5FJ8G 3T1YQ 1IBKQ 3RN2A 1CHQD 4X66L 4Y7NB 5IYDG 1QILA 1KQSA 1G8ZD 3CCRA 3M4YA 3M4QA 2B2UC 5C5LA 5I4DA 1I4GA 1R9TB 1VF7A 4X66Q 4LF8Q 1EY4A 3J7ZC 4A3IB 1I4PA 1XWEA 4OWTB 1VQEA 2JA8H 2F0TA 1F9RA 2PW7A 1I50B 4PMWA 1HNZQ 4IZ8A 1TXYA 2NTSA 3CCJA 3D6WA 3MZ5A 5JEAG 2O5IC 1E2VA 4C3IH 4CHTB 2AQ2B 1I4QA 2KECA 4EQNA 3NPPA 5CV5A 1YHQA 5C4XG 1TS4A 1VQIA 2VZAA 5IP7G 1VQJA 3HKZB 1F9SA 4X3UA 2DY7A 4A3GB 1BQQT 2OT2A 2B2YA 2F0KA 3UI2A 1ESFA 2KBNA 4QUFA 2KUMA 2BE5C 1CI3M 1AH9A 4CBVA 3BJUA 2AMCB 1D2BA 1FNWA 1WJJA 2BDNA 4XT1B 4B3ML 4PZ8A 3RUZA 2N49A 3CCEA 5D65A 5T1IA 1FJGQ 1VDZA 2IX1A 4CKBA 2F0OA 1KNEA 1JWSD 4RKBA 4CJ0B 3HOXG 5J22A 2PNHA 5LMNW 1PV4A 1HHVA 5JVH3 4A93G 2F0DA 2JA9A 1BOSA 4JVZA 3G6JB 3CC4A 3HOYH 3PUXA 3TSSA 1LT5D 2E8GA 4ZK9B 2K04A 3BDLA 3VYTA 3BZCA 5D3IB 1EIHA 2EYMA 1XPOA 4FF3A 1B70B 1JJCB 1VF5C 4MIUA 4KMUC 1WFQA 4JI2Q 2VL6A 4PQXA 1JC7A 1X3EA 3BU2A 3HP3A 1X65A 3QR8A 1CSPA 1HFGA 4RGNA 3AQQA 3Q22A 1HNXL 5IT9L 2QGQA 3SK4A 2FXQA 2UUCL 2JA6B 2E74C 2NZHA 1EYCA 4A3BH 4J6HA 1JB7A 3FVQA 1U4MA 5E4WC 1EFWA 4QUCA 2CQOA 1X55A 5IOCA 1VQ6A 2IL8A 4DXGA 4L8JA 1HA6A 4QB4A 1TS3A 5C3XA 2AUJD 2A69C 1AZQA 2KEDA 2CW0C 5ISRA 1EWHA 1N33Q 2D0PA 5GQOA 1SNQA 3GTMB 2LXKA 5FO7B 4GKJL 4ZAIA 2ZXPA 1PTOF 3H0GH 2J7ZA 1WTHA 2CH4A 4A3EB 4RGMA 4RWSC 1K3RA 1HA5A 1HH2P 3FMCA 1N33L 3AEVA 4KLKA 2Q2TA 4C3HG 2QEJC 5HGQA 1PHJA 3HOYG 1EYAA 2JA7H 2ES2A 1PMRA 1MIUA 4CJ1B 1X56A 3NK9A 4P2CB 4CDCC 3MEHA 1XNRL 1O7LA 3HG9A 4A93B 1J6QA 2RDGA 5IT9c 5M5WH 1SNCA 3I90A 5CC4A 4BBSB 1SYGA 4R8IA 1NJIC 4GOPB 4K14A 1N34Q 1FGBD 4QF4A 4NKLA 2B2TC 3MVVA 2O2LD 4GN3B 3V05A 2K03A 4DPGA 1SE4A 4IUQA 1EOTA 1I4XA 5BN5A 1IBLL 1F9PA 2F0HA 4DKAC 2JA8B 4KK7A 4B9XA 2MFIA 2NVXH 3HKZG 1VQFA 2MUYA 3ZYYX 4X64L 1A3UA 5F2DA 3PUYA 1H9RA 2K5WA 3OPOA 1HZAA 3KF6A 4X3KA 4KY5A 1JB3A 4DA2A 4XQNA 4DV4L 3S17H 4O1NA 5M3FG 1BBWA 1EIFA 2H1EA 4BXXH 2EYHA 3NWSA 3GP7A 1EZ6A 3ERQA 1VQDA 4NDXA 2BDOA 3D31A 4HMIA 2EY5A 4KHZA 2NVQH 1JJGA 5EAYA 4LF6L 3S1NB 1U4LA 2F1MA 4X6AH 1TWGB 1MJCA 3JAMc 4P74A 2BE5D 5KIXA 3J7YW 2F0EA 3T56B 2L9HA 2JXMB 4DUYL 1N8RC 1STBA 5ELDA 5ELCA 4KN7C 4A3LG 4IFDH 1B53A 1TWHH 1XPRA 1WD0A 4LK1C 3GTOB 3O13A 4R4QA 1XMQQ 3NEMA 3HOWH 1DXMA 2DJGC 4KKSA 2K28A 3E3XA 4ID6A 1VQHA 1N32Q 1C9OA 3OW7A 4DV1L 3F2UA 4JYAQ 4WJ3M 2N88A 4I7AA 3DMUA 4U673 1HPCA 1PLFA 1ILPA 5M3MH 4K0KQ 3ULPA 4EX5A 5I6YA 3Q6SA 5IIFA 5FLMG 4XDXA 5IP9G 4IFDI 2YTYA 4J1MA 4LUVA 2MGSA 1RHPA 3DM3A 2SDFA 4NP5A 5ELFA 4LF4L 5C4XB 4F7XA 1Q82C 4ME3A 1HZ9A 1YI2A 3G48A 4FNFA 3BDOA 4JBKA 4OGQC 4QY7A 2O4XA 1WTXA 1IKMA 2YU9H 4JK1C 2EY1A 4HAEA 3K7AB 2Y0SE 2XIWA 4JI4L 3GTKB 4BA2I 4LF7L 3HKSA 4QGUA 3T13A 4OONA 5AJ3L 1WCMH 4A3JB 4DAYA 1TIID 1XXGA 3WOFA 2HIXA 1ENCA 3FPPA 3S2HH 2QCPX 4BY1G 1MKHA 5IODA 5KGUA 2VUMB 2BCOA 1L0XB 2RA4A 1DOMA 1K0SA 3H0GB 5J3BA 1QUQA 1B3AA 1BCPF 3OIQA 3I4NB 1CTMA 4BY1H 1QVCA 4F8MA 4HEDA 5IGDA 3P75A 2WINB 3I70A 4L5RC 1GUSA 3BG3A 2PZUA 2QDLA 3KLWA 1RL2A 1F77A 1B4OA 1BNZA 1IYJB 2UUAL 1QUQB 4DR3L 2A69D 3ICEA 1I6VC 4HR7B 3M3YH 3QOLA 1Q1BA 2E2HB 3K58A 3A56A 5HURA 3N6RA 4P73A 4ZCKA 2Q2HA 2CFMA 2PMZB 1EQTA 4G7OC 1SYEA 2EYOA 1F2LA 3PF4A 1IBKL 3TREA 3JC66 2JA6H 4CDDC 2BOSA 3NQTA 4YCVA 4A3BB 2R93H 3U58A 4A3DB 5EQ0A 1PRTF 1LTSD 1HZBA 3CPWA 1EY7A 1LTLA 4JI7L 2A8VA 3M7GA 2OWOA 1OO9B 4POGA 3T53B 3NELA 1LTID 4U68A 1D5XC 4IPCA 1F2YA 2NVTH 1PFSA 3ND9A 2ZM6L 5C6AA 1X3GA 5E7NA 4BBRB 1EU4A 5C44B 4JV5L 1OXSC 1SJHD 2F0QA 1BUVT 4HJ8A 4IUPA 4FF2A 5CV4A 1H9MA 1LT4D 1EQRA 4HSVA 3M4OH 2QDBA 1YHBA 3IL8A 4QQBX 5JPNC 1PRTC 1EZ8A 1SNPA 1HNWL 2F4VQ 4HJ5A 1A2UA 3E6ZX 2Z6KC 3A8IE 3NTIA 4C2MH 2L1BA 3M9BA 4N9TA 1JMCA 1OXVA 5C4JH 3HOXB 4RMFA 1RTOA 3S1QH 2K50A 2VNUD 2VQEL 1IYVA 2V4DA 2PO4A 5JOBA 5JVG3 1VQAA 1HQRD 2N3SA 2B2WC 3J81L 3PIPA 1NSNS 3VR2A 1CKMA 3R8BA 2QA4A 5G3LF 4DV6Q 1JJ2A 2PQAB 3I4MG 4IN3A 1JOOA 5GROA 2LKVA 4H02A 1A6XA 4IQZA 3K0XA 1T9HA 3J7AV 3EQLC 1O7YA 4ULLA 2PPBC 1II3A 2WKDA 2BH2A 3VYRA 3VDYA 2B29A 3QWNA 2A6EC 4EGVA 3ZJYC 2AQ1B 2QEXA 1KIXA 1D7QA 2B8FA 3MA2B 4R4IA 4RGTA 2D0OA 3SR1A 3VA7A 1LUZA 2F0UA 4DR4Q 1TWFB 5M9OA 4LFCL 1X3FA 2XGTA 2E5LQ 4DFAA 1DOKA 4O2DA 3NUCA 4DUZL 1KRTA 1JCKB 3G71A 1Y1WG 1OXTA 4HCEA 1MSHA 3FKIG 2AKWB 4IOAA 3S1MB 5KYIA 1Y69U 4Q5VA 2ICEC 2K75A 3NBIA 1BCPD 4A3MH 4KHPL 3SK5A 3CCSA 3TN2A 1A3VA 1PTOC 1S5ED 4ZRZA 3QB3A 1LO5D 4IPHA 1KTKA 2K5HA 4OXPA 3S14H 3K81C 5FLMH 2NVYH 1SNDA 1LV9A 5CORA 1LM0A 3HZXA 2PW5A 3NBHB 4M8AA 1C4QA 4PNYA 1B1ZA 3K5NA 4K6DA 1EOVA 5J39A 5ELOA 4TQUS 1IW7C 3R2TA 1GUOA 1BR9A 1PH6A 1ICFB 1K9MC 4ZUJA 2EYFA 4DR2Q 2PZTA 1Y1VB 1XYIA 3KDFB 4LF7Q 5JJLA 5IWAL 1E1TA 1N34L 2YV5A 2EYJA 2R92G 2K5DA 1SMYC 1SN8A 2K7VA 3MXGA 3CXCA 2A1AA 2F3IA 1VQGA 3PCOB 4GN5A 1PZKD 1WTWA 3L7ZC 1E24A 2VQFQ 1CA6A 3SXHA 4LFBL 5M3FB 3R3OA 3NP8A 3BS1A 1VQMA 3PQIA 4A3BG 1EL0A 3UDXA 2UXDL 4YCUA 4A3JH 3S15B 4YY3Q 4BA1I 2SOBA 3GV6A 1TS5A 3J7A5 2WFWA 4HN7A 2JYOA 2JA8G 1G91A 4BBRH 4FXGC 1ASZA 3UDIA 1SE2A 2F52A 1N32L 2K33A 3CC7A 1H9JA 3F8TA 4FVMA 1VQ5A 4C3JH 4K0KL 4ODGA 1Q90A 3MXUA 3OMGA 2I07B 2TSSA 1JE5A 4RKLA 1AE3A 3VR6A 4DV5Q 4HTHA 3SGIA 3NTHA 5TSSA 4N8X1 3CQZH 1FYCA 4M1UB 1QZHA 4ILWA 3FRPB 5IP7H 4DF7A 1DCZA 2VY3A 4DV0Q 1SROA 4C3HB 3W3AA 4UHVA 2EJMA 2HHHL 1PA6A 3ITPA 1NY4A 1XNQL 1BXTA 4CJ2C 5FLXc 1O80A 3HFZB 3PIP3 1STHA 4TRDA 2D5DA 2HT1A 1QVFA 3S2DB 2KENA 3SVMA 2K52A 1B50A 1D8LA 1XNRQ 2EDGA 2JA5G 1RCVD 1QE6A 3KF8A 1LTAD 4POFA 1SMXA 4JI6Q 4FP5D 1BBUA 3G4SA 4GS3A 1CQFA 2LFNA 2JK8A 4KV6A 1RIPA 1IKLA 1Q1EA 2ENBA 4PZ6A 1IW7D 4UP9A 3FEWX 3DWQA 2NBFA 1QNUA 3MXNA 2H5XA 1VQLA 1XNQQ 2UUAQ 5EKKA 3RLFA 4LFCQ 1X32A 4LNQA 2NYZD 2B2YC 4DR5Q 3IAYA 4IFDJ 2R3ZA 2F0PA 3CRKC 1SMYD 1DGSA 1IZ6A 2CKZB 1WTRA 1MGSA 2D62A 1YITA 4DV7L 5M5XB 1X9NA 4QCLA 3EROA 1STYA 4RCOA 4JBMA 1IL2A 4JI8L 3WWVA 5DEHA 4JI1Q 2ZTDA 1SLJA 3RMHA 1ML0D 3HRZC 4R4CA 1B3QA 2QILA 1BVSA 1UWVA 1O7IA 4DNTB 1EQVA 3KYHC 3MHBA 4JI2L 2RSNA 5D3DA 2X6GA 3Q0AA 4A93H 3J81j 2AWOA 5DNFA 3RLNA 4HJAA 2PQEA 3IFDA 4YIJA 4KJNA 5M5WB 4XQQA 1Y1WH 3NSWA 5JPMC 4DXFA 1Y1WB 1SFOH 1LT6D 3S16H 4ZLTF 4OX9L 4F88A 3DWAA 1H9KA 1NMGA 4IPDA 3U4VA 2IHFA 2XN9C 2IWHA 1Q12A 3PMFA 4A3KG 2KCNA 4L5QA 2XNAC 4CDEC 5ELNA 2J0TD 2JA6G 1CM9A 2R7DA 1RDPD 5L37A 1YNJC 3C46A
chains in the Genus database with same CATH topology
2K4KA 3BZKA 4DV1L 2RCNA 1W3SA 3CF5A 4GOPC 4JYAQ 4WJ3M 1E1OA 4LF6Q 3S24A 5M3MH 2LSSA 4K0KQ 3CCUA 1CKNB 3ULPA 2BA1A 1U5KA 3M85A 4EQ5A 1K73C 4EX5A 3GDEA 1PH9A 5FLMG 3GTGH 2JJQA 4LUZA 1SE8A 2KCMA 3A5UA 1KC8C 1K83H 1E3PA 3PUZA 1E22A 2AHOB 2ALYB 3PUVA 3A5ZB 3B6YA 2BA0A 5IP9G 1C7YA 4JI7Q 4IFDI 2YTYA 2E2JH 1EUJA 4DV7Q 1VQ7A 2GVAA 1YJWA 3GO5A 1P8LA 4LUVA 3CD6A 4GLVB 2ZJPA 3CMEA 1VQBA 2JQOA 3DM3A 4DR7L 4B3TL 3UDGA 4LF4L 2UXCQ 3EN2A 2WAQE 4ME3A 1Q82C 1HZ9A 2BH8A 4XTCS 1YI2A 1KAWA 3G48A 4JBKA 5H1SE 4X65Q 4QY7A 1PH2A 2KHIA 2I5HA 4IJLA 1A8VA 2Y0SG 2YU9H 1Z9FA 5M3MG 4A3DH 1PH7A 4GN4B 3PUWA 3HOUH 2Y0SE 4A3EG 1XMOQ 4DAYB 4JI4L 4GKJQ 4BA2I 4LF7L 3HKSA 4JG2A 4QGUA 1A62A 3GTJH 4OONA 5M5XH 4JBJA 5IP9H 5GAEC 5AJ3L 1WCMH 3CAMA 4A3IH 5C0XI 2HIXA 1QZGA 1HZCA 4A3GG 3S2HH 1WCMG 2N8NA 4BY1G 4A4IA 1MKHA 1YNXA 4AIMA 3HOXH 3F2BA 3RN5A 4APVA 4DV4Q 4JI5Q 3Q8DA 4AQYQ 3KJOA 1B8AA 2YTVA 4LFAL 1QVGA 4MNOA 4JOIA 5J3BA 4J15A 3H15A 4BXXG 1QUQA 4IO9A 4DV6L 1HJPA 2UUBL 3LGJA 4X64Q 4BY1H 1Q81C 1QVCA 2Z0SA 4A3FH 1GVPA 5LMUL 2UUCQ 4A3KH 2K5NA 3MEFA 2YTXA 4FDBA 4YWMA 1I94L 4QIWE 2IT1A 2R6GA 4L5RC 4X62L 4AQYL 3KLWA 1RL2A 3PSIA 2ZTCA 4HIKA 5C0XJ 4L5TA 2N78A 3RNUA 4A3CG 1IYJB 2UUAL 1QUQB 1CKOA 4DR3L 3ICEA 4BBSH 3M3YH 2NZOA 4JI8Q 1Q1BA 4OO1G 1KHIA 2ID0A 4P73A 4DK3C 3S1RH 4P75A 4DV0L 2Q2HA 5LMUQ 2CFMA 3KJPA 1VQPA 4NXNL 4DR1Q 1HNZL 3GTLH 1XMQL 2HHHQ 4LW1A 3AFPA 3F1ZA 3A74A 4DR6Q 4NB3A 1VCIA 4LF5Q 3ERSX 3I4MH 3PF5A 3PF4A 1PYSB 3GTKH 1IBKL 3TREA 1FGUA 3JC66 2JA6H 1PH3A 1XJVA 4YCVA 2R93H 3U58A 1EQQA 4PG3A 1CSQA 2KCTA 2OCEA 1YVCA 4IOCA 3PV0A 2KHJA 1HZBA 4GNXB 1I50H 2R7FA 2RHQB 5HY6A 1L0WA 3CPWA 1GO3E 1VQ4A 1LTLA 4R1JA 4HJ7A 4C3HH 3FKIH 4JI7L 2A8VA 2OWOA 1XMOL 2R7ZG 4POGA 4X62Q 2ASBA 4IPGA 3GD7A 3NELA 3JAMi 1VQ8A 5BR8L 1GKHA 1UE6A 1VQKA 4IPCA 4GNXC 4B3SL 2NVTH 1PFSA 1WOCA 2ZM6L 3W1BA 1J5EQ 4GKKL 1X3GA 2V1CC 2YYZA 5E7NA 3HOWG 1KD1C 4B3MQ 4JV5L 2JE6I 4YWLA 2R7ZH 4HIDA 1VQCA 3H0GG 1GD7A 2CWPA 1NTGA 4JYAL 1WYDA 1G6PA 2JEBI 1OXSC 1WI5A 2ZTEA 1K8GA 4HJ8A 4IFDG 2PI2A 1VS0A 1M1KC 2VUMG 1V9PA 1A63A 4P71A 1C0AA 2UU9L 2XTIA 2IHEA 2LXJA 1EQRA 3PO3G 2ZM6Q 1J5EL 1YBYA 3M4OH 4GKKQ 1H95A 1YHBA 4UP7A 3I2ZA 3UDFA 5GAHC 4OWWB 4LFBQ 4QQBX 1X54A 1L1OC 3L2PA 3W1GA 2I5MX 3K80C 2VQEQ 1AE2A 4Y7NH 2F4VQ 1HNWL 1PVOA 4L5SA 2PQAA 3CCMA 4UPAA 3CW2C 4HJ5A 4YWKA 5C44G 1PH4A 1HNXQ 2Z6KC 4C2MH 3K7UC 3M4PA 4TVAB 3M9BA 4YHHL 1L2FA 5AJ3Q 1I3QH 1JMCA 2MNAA 1OXVA 5C4JH 5K36G 1JT8A 2GN5A 4RMFA 4X65L 3S1QH 1VQNA 1YEZA 2K50A 2RF4A 3S1MH 2VNUD 2VQEL 4LF9L 4HJ9A 5C3EG 3OTOQ 2Q2UA 1VQAA 2CWAA 2N3SA 3UE0A 3PIPA 4JI0L 2GVBA 4DR6L 1CKMA 1B7YB 5M3FH 1Q8KA 3MXNB 1GM5A 2R92H 4A3DG 4DR1L 2QA4A 1P16A 3AFQA 4ALPA 3UE1A 4DV6Q 2WB1G 1E7ZA 2PQAB 1JJ2A 4AYBE 2ZJQA 3I4MG 3S15H 2EQSA 3ULJA 3W5OA 3KFUA 4PZ7A 5GROA 4GLXA 4H02A 1OXXK 5IYCH 1HR0Q 1YIJA 4HIMA 4DR3Q 2UU9Q 3K0XA 1T9HA 1UE7A 3PO2H 4A76A 4B3SQ 4A3JG 4DR4L 2BH2A 5C4XH 1V43A 3VDYA 2I5LX 4DV1Q 2B29A 2K14A 4GNXA 3H3VH 1Z47A 3K8AA 1ASYA 3ZJYC 2ATWA 3S1NH 1Y14B 2QEXA 5M5YH 1KIXA 5BR8Q 5C0XG 1EIYB 3HOVH 4WJ4A 4R4IA 1PH5A 2D0OA 2E2HH 1LUZA 1OTCA 2WAQG 4DR4Q 5FJ8G 4LFCL 3T1YQ 2XGTA 1X3FA 1IBKQ 3HOZH 3FHWA 1A0IA 2E5LQ 3RN2A 3TS2A 4X66L 5IYDG 1KQSA 3E0EA 4O2DA 3CCRA 3RLOA 4KHPQ 3I4OA 3M4QA 4GLAC 4DUZL 4XIGS 3TS0A 4Y52H 1KRTA 3G71A 1Y1WG 1OXTA 2DGYA 3U50C 2VQFL 4A3MG 4NXML 4X66Q 3FKIG 3DLLA 2AKWB 4IOAA 4LF8Q 1S3OA 2E5LL 3J7ZC 4JBWA 3RZDH 3J80i 4OWTB 4JV5Q 1VQEA 2K75A 4A3MH 3CC2A 2OTJA 4KHPL 3CCSA 3HKZE 4PMWA 3OW2A 1HNZQ 2JA8H 2MO0A 3J81c 3OTOL 1TXYA 3CCJA 5C44H 3PIOA 4UP8A 4IPHA 1NE3A 2K5HA 1FL0A 4OXPA 5JEAG 1G51A 3K81C 3S14H 5FLMH 4C3IH 2NVYH 4DR2L 3PGZA 4BY7G 3PO3H 1LM0A 4B3RL 5IE8A 1N36L 3NBHB 2I0QA 1YHQA 1EOVA 3I56A 3A0JA 2OQ0A 4P72A 5ELOA 4OO1I 4TQUS 5C4XG 1VQIA 2VZAA 4LFAQ 5IP7G 1VQJA 2CCZA 3J80c 1HR0L 1IBMQ 3M7NA 3IRBA 4JI1L 1PH6A 1V1QA 4OX9Q 2WP8J 3E9IA 4JI6L 3EBEA 1K9MC 3CCLA 2KBNA 4IJHA 5IY0A 4DR2Q 3J81i 1KXLA 1W2BA 5JJLA 3KDFB 1Q7YC 1AH9A 3BJUA 2AMCB 3G6EA 4LF9Q 1WJJA 4LF5L 2K5VA 1TWCH 5IWAL 4B3ML 4PZ8A 4LF7Q 1E1TA 1N34L 2B63G 2YV5A 2N49A 3ER0A 3CCEA 3L0OA 2Q2IA 2OTLA 4DR5L 3EIVA 2R92G 3RZOH 1Q46A 1FJGQ 1PH8A 2IX1A 1SN8A 3CXCA 2A1AA 2F3IA 1N9WA 1VQGA 3PCOB 4GN5A 5GADC 3HOXG 3L7ZC 2PNHA 1E24A 4YHHQ 2VQFQ 5LMNW 1PV4A 4A93G 4LFBL 2JA9A 1HR0W 5IYBG 2UXBL 1L1OA 1R9TH 1VQMA 4AYBG 5LMNQ 1LYLA 3CC4A 2VUMH 3HOYH 3PUXA 4A75A 4A3BG 2IY5B 2E8GA 3UDXA 3KOJA 3BZCA 4YCUA 2UXDL 4A3JH 4R4TA 1XPOA 4B3TQ 2Z6KA 4YY3Q 3F2DA 2JA5H 4BA1I 4DR7Q 1YJNA 1B70B 1JJCB 4QL5A 2A19A 3J7A5 2WFWA 1EYGA 1X6OA 1IBML 2JA8G 2B63H 1WFQA 4NPSA 4JI2Q 2VL6A 4AH6A 4BBRH 4JI0Q 1ASZA 3UDIA 1SRUA 2JA7G 1X3EA 4A3LH 2F52A 1N32L 4JI5L 3BU2A 4DNIA 3CC7A 3KF6B 5LMNL 3F8TA 1X65A 3RR5A 4BBRG 1VQ5A 4C3JH 4K0KL 3OYYA 1CSPA 2ZJRA 3STBC 3AQQA 3NENA 4JCVE 1HNXL 3TRZA 1JE5A 1AE3A 1TWGH 4DV5Q 2QGQA 2AWNA 2FXQA 4LF8L 4JC0A 2UUCL 4R4OA 1K0RA 1L1OB 1S40A 2B3GA 2PI2E 2NZHA 4NXMQ 4A3BH 3SGIA 1JB7A 1XTDA 5JJIA 1YHAA 4GOPA 2DUDA 4JI3L 5JEAJ 4DV2L 2MO1A 1EFWA 3CQZH 1TWAH 1X55A 2CQOA 3CCQA 1QZHA 1VQ6A 2UXDQ 1PYBA 5IP7H 2VY3A 4DV0Q 1SROA 1UEBA 1D7QA 4DUYQ 3H3VI 4HIOA 2JEAI 4DAMA 2HHHL 2HQLA 4DUZQ 1PA6A 4A3CH 1NY4A 2L15A 1XNQL 1KRSA 5FLXc 1NMFA 2D0PA 1N33Q 3HFZB 2NN6G 3TEHB 3TQYA 3GTQH 3F2CA 5GQOA 2LXKA 1VQOA 4JI4Q 1QVFA 2HT1A 3H0GH 4GKJL 1UE1A 4LWCA 1U0LA 1N36Q 2KENA 2K52A 1D8LA 1K3RA 1HH2P 1XNRQ 1G291 4BBSG 1N33L 5IYDH 3AEVA 2JA5G 3STBD 4KLKA 2Q2TA 2HIVA 1YJ9A 3ULLA 4LF4Q 1Y1VH 4POFA 5HGQA 1PHJA 1K8AC 4DK6C 3HOYG 2JA7H 1SMXA 2ES2A 4JI6Q 4OWXB 1CKNA 1MIUA 3I4NH 1BBUA 3G4SA 1I5FA 1X56A 4GS3A 4A3GH 2UUBQ 2JK8A 1XNRL 1RIPA 1KL9A 4DV2Q 4JI3Q 3I4NG 1Q1EA 1J6QA 3T1HL 3CMAA 4PZ6A 4YY3L 5FJ8H 4B3RQ 4UP9A 5IT9c 2VS1A 5M5WH 1PH1A 4MZ9A 5IYCG 2H5XA 1VQLA 1XNQQ 1IBLQ 2UUAQ 1NJIC 4GOPB 1NBWA 3RLFA 1N34Q 3T1YL 4LFCQ 1HNWQ 4LNQA 4DPGA 1Y1VG 4GN3B 1MJEA 1UE5A 3I7FA 3FP9A 1IBLL 4DR5Q 3D0FA 4DKAC 4IFDJ 4A3EH 3HOUG 2MFIA 2NVXH 1OXUA 3HKZG 1VQFA 5IWAQ 3E9HA 5C3EH 4X64L 1DGSA 2IX0A 1IZ6A 2CKZB 3PUYA 2D62A 1YITA 4DV7L 1HZAA 1X9NA 3KF6A 4JBMA 1IL2A 5JJKA 4UY8C 4A3IG 2NN6I 5GAGC 3CCVA 4JI8L 3WWVA 4QJFA 4JI1Q 4DV4L 3S17H 2ZTDA 1BKBA 1SLJA 4BY7H 2C35B 4R4CA 5M3FG 3HOVG 1M90C 1BBWA 1EIFA 4DV3Q 4BXXH 2UXBQ 1VQDA 3I55A 4LUOA 1BVSA 2R93G 1S72A 3D31A 2EIFA 1UWVA 1O7IA 4RG1A 2RHSB 4KHZA 2NVQH 3KF8B 3U4ZA 3KYHC 1I94Q 1JJGA 1VQ9A 4JI2L 5EAYA 3PO2G 1IXRA 4LF6L 4O0AA 4A93H 4X6AH 3AYHB 3J81j 3GTPH 2AWOA 2OQKA 3RLNA 4HJAA 2MQHA 1MJCA 1TWFH 4KI0A 4P74A 3JAMc 1Y1WH 1Q86C 4DV3L 3GTOH 2UXCL 1SFOH 1SR3A 1I6HH 3K7AH 3S16H 1YZ6A 4YCWA 4OX9L 1EWIA 2PMZE 1CUKA 4DUYL 1N8RC 2F4VL 3HOZG 3T1HQ 1NMGA 4IPDA 4A3LG 1TWHH 1XPRA 4DV5L 3U4VA 2IHFA 3CP0A 3S2DH 2EXDA 2WB1E 3KDFA 4MTNA 4R4QA 2E2IH 1Q12A 1FVIA 4JOIC 4L5QA 5IYBH 4A3KG 1XMQQ 1FJGL 3NEMA 3HOWH 2VW9A 4A3FG 5ELNA 3CPFA 4NXNQ 3GTMH 2JA6G 2R7DA 5DLQE 1N32Q 1VQHA 1XPUA 1C9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4K A;  3BZK A;  4DV1 L;  2RCN A;  1W3S A;  3CF5 A;  4GOP C;  4JYA Q;  4WJ3 M;  1E1O A;  4LF6 Q;  3S24 A;  5M3M H;  2LSS A;  4K0K Q;  3CCU A;  1CKN B;  3ULP A;  2BA1 A;  1U5K A;  3M85 A;  4EQ5 A;  1K73 C;  4EX5 A;  3GDE A;  1PH9 A;  5FLM G;  3GTG H;  2JJQ A;  4LUZ A;  1SE8 A;  2KCM A;  3A5U A;  1KC8 C;  1K83 H;  1E3P A;  3PUZ A;  1E22 A;  2AHO B;  2ALY B;  3PUV A;  3A5Z B;  3B6Y A;  2BA0 A;  5IP9 G;  1C7Y A;  4JI7 Q;  4IFD I;  2YTY A;  2E2J H;  1EUJ A;  4DV7 Q;  1VQ7 A;  2GVA A;  1YJW A;  3GO5 A;  1P8L A;  4LUV A;  3CD6 A;  4GLV B;  2ZJP A;  3CME A;  1VQB A;  2JQO A;  3DM3 A;  4DR7 L;  4B3T L;  3UDG A;  4LF4 L;  2UXC Q;  3EN2 A;  2WAQ E;  4ME3 A;  1Q82 C;  1HZ9 A;  2BH8 A;  4XTC S;  1YI2 A;  1KAW A;  3G48 A;  4JBK A;  5H1S E;  4X65 Q;  4QY7 A;  1PH2 A;  2KHI A;  2I5H A;  4IJL A;  1A8V A;  2Y0S G;  2YU9 H;  1Z9F A;  5M3M G;  4A3D H;  1PH7 A;  4GN4 B;  3PUW A;  3HOU H;  2Y0S E;  4A3E G;  1XMO Q;  4DAY B;  4JI4 L;  4GKJ Q;  4BA2 I;  4LF7 L;  3HKS A;  4JG2 A;  4QGU A;  1A62 A;  3GTJ H;  4OON A;  5M5X H;  4JBJ A;  5IP9 H;  5GAE C;  5AJ3 L;  1WCM H;  3CAM A;  4A3I H;  5C0X I;  2HIX A;  1QZG A;  1HZC A;  4A3G G;  3S2H H;  1WCM G;  2N8N A;  4BY1 G;  4A4I A;  1MKH A;  1YNX A;  4AIM A;  3HOX H;  3F2B A;  3RN5 A;  4APV A;  4DV4 Q;  4JI5 Q;  3Q8D A;  4AQY Q;  3KJO A;  1B8A A;  2YTV A;  4LFA L;  1QVG A;  4MNO A;  4JOI A;  5J3B A;  4J15 A;  3H15 A;  4BXX G;  1QUQ A;  4IO9 A;  4DV6 L;  1HJP A;  2UUB L;  3LGJ A;  4X64 Q;  4BY1 H;  1Q81 C;  1QVC A;  2Z0S A;  4A3F H;  1GVP A;  5LMU L;  2UUC Q;  4A3K H;  2K5N A;  3MEF A;  2YTX A;  4FDB A;  4YWM A;  1I94 L;  4QIW E;  2IT1 A;  2R6G A;  4L5R C;  4X62 L;  4AQY L;  3KLW A;  1RL2 A;  3PSI A;  2ZTC A;  4HIK A;  5C0X J;  4L5T A;  2N78 A;  3RNU A;  4A3C G;  1IYJ B;  2UUA L;  1QUQ B;  1CKO A;  4DR3 L;  3ICE A;  4BBS H;  3M3Y H;  2NZO A;  4JI8 Q;  1Q1B A;  4OO1 G;  1KHI A;  2ID0 A;  4P73 A;  4DK3 C;  3S1R H;  4P75 A;  4DV0 L;  2Q2H A;  5LMU Q;  2CFM A;  3KJP A;  1VQP A;  4NXN L;  4DR1 Q;  1HNZ L;  3GTL H;  1XMQ L;  2HHH Q;  4LW1 A;  3AFP A;  3F1Z A;  3A74 A;  4DR6 Q;  4NB3 A;  1VCI A;  4LF5 Q;  3ERS X;  3I4M H;  3PF5 A;  3PF4 A;  1PYS B;  3GTK H;  1IBK L;  3TRE A;  1FGU A;  3JC6 6;  2JA6 H;  1PH3 A;  1XJV A;  4YCV A;  2R93 H;  3U58 A;  1EQQ A;  4PG3 A;  1CSQ A;  2KCT A;  2OCE A;  1YVC A;  4IOC A;  3PV0 A;  2KHJ A;  1HZB A;  4GNX B;  1I50 H;  2R7F A;  2RHQ B;  5HY6 A;  1L0W A;  3CPW A;  1GO3 E;  1VQ4 A;  1LTL A;  4R1J A;  4HJ7 A;  4C3H H;  3FKI H;  4JI7 L;  2A8V A;  2OWO A;  1XMO L;  2R7Z G;  4POG A;  4X62 Q;  2ASB A;  4IPG A;  3GD7 A;  3NEL A;  3JAM i;  1VQ8 A;  5BR8 L;  1GKH A;  1UE6 A;  1VQK A;  4IPC A;  4GNX C;  4B3S L;  2NVT H;  1PFS A;  1WOC A;  2ZM6 L;  3W1B A;  1J5E Q;  4GKK L;  1X3G A;  2V1C C;  2YYZ A;  5E7N A;  3HOW G;  1KD1 C;  4B3M Q;  4JV5 L;  2JE6 I;  4YWL A;  2R7Z H;  4HID A;  1VQC A;  3H0G G;  1GD7 A;  2CWP A;  1NTG A;  4JYA L;  1WYD A;  1G6P A;  2JEB I;  1OXS C;  1WI5 A;  2ZTE A;  1K8G A;  4HJ8 A;  4IFD G;  2PI2 A;  1VS0 A;  1M1K C;  2VUM G;  1V9P A;  1A63 A;  4P71 A;  1C0A A;  2UU9 L;  2XTI A;  2IHE A;  2LXJ A;  1EQR A;  3PO3 G;  2ZM6 Q;  1J5E L;  1YBY A;  3M4O H;  4GKK Q;  1H95 A;  1YHB A;  4UP7 A;  3I2Z A;  3UDF A;  5GAH C;  4OWW B;  4LFB Q;  4QQB X;  1X54 A;  1L1O C;  3L2P A;  3W1G A;  2I5M X;  3K80 C;  2VQE Q;  1AE2 A;  4Y7N H;  2F4V Q;  1HNW L;  1PVO A;  4L5S A;  2PQA A;  3CCM A;  4UPA A;  3CW2 C;  4HJ5 A;  4YWK A;  5C44 G;  1PH4 A;  1HNX Q;  2Z6K C;  4C2M H;  3K7U C;  3M4P A;  4TVA B;  3M9B A;  4YHH L;  1L2F A;  5AJ3 Q;  1I3Q H;  1JMC A;  2MNA A;  1OXV A;  5C4J H;  5K36 G;  1JT8 A;  2GN5 A;  4RMF A;  4X65 L;  3S1Q H;  1VQN A;  1YEZ A;  2K50 A;  2RF4 A;  3S1M H;  2VNU D;  2VQE L;  4LF9 L;  4HJ9 A;  5C3E G;  3OTO Q;  2Q2U A;  1VQA A;  2CWA A;  2N3S A;  3UE0 A;  3PIP A;  4JI0 L;  2GVB A;  4DR6 L;  1CKM A;  1B7Y B;  5M3F H;  1Q8K A;  3MXN B;  1GM5 A;  2R92 H;  4A3D G;  4DR1 L;  2QA4 A;  1P16 A;  3AFQ A;  4ALP A;  3UE1 A;  4DV6 Q;  2WB1 G;  1E7Z A;  2PQA B;  1JJ2 A;  4AYB E;  2ZJQ A;  3I4M G;  3S15 H;  2EQS A;  3ULJ A;  3W5O A;  3KFU A;  4PZ7 A;  5GRO A;  4GLX A;  4H02 A;  1OXX K;  5IYC H;  1HR0 Q;  1YIJ A;  4HIM A;  4DR3 Q;  2UU9 Q;  3K0X A;  1T9H A;  1UE7 A;  3PO2 H;  4A76 A;  4B3S Q;  4A3J G;  4DR4 L;  2BH2 A;  5C4X H;  1V43 A;  3VDY A;  2I5L X;  4DV1 Q;  2B29 A;  2K14 A;  4GNX A;  3H3V H;  1Z47 A;  3K8A A;  1ASY A;  3ZJY C;  2ATW A;  3S1N H;  1Y14 B;  2QEX A;  5M5Y H;  1KIX A;  5BR8 Q;  5C0X G;  1EIY B;  3HOV H;  4WJ4 A;  4R4I A;  1PH5 A;  2D0O A;  2E2H H;  1LUZ A;  1OTC A;  2WAQ G;  4DR4 Q;  5FJ8 G;  4LFC L;  3T1Y Q;  2XGT A;  1X3F A;  1IBK Q;  3HOZ H;  3FHW A;  1A0I A;  2E5L Q;  3RN2 A;  3TS2 A;  4X66 L;  5IYD G;  1KQS A;  3E0E A;  4O2D A;  3CCR A;  3RLO A;  4KHP Q;  3I4O A;  3M4Q A;  4GLA C;  4DUZ L;  4XIG S;  3TS0 A;  4Y52 H;  1KRT A;  3G71 A;  1Y1W G;  1OXT A;  2DGY A;  3U50 C;  2VQF L;  4A3M G;  4NXM L;  4X66 Q;  3FKI G;  3DLL A;  2AKW B;  4IOA A;  4LF8 Q;  1S3O A;  2E5L L;  3J7Z C;  4JBW A;  3RZD H;  3J80 i;  4OWT B;  4JV5 Q;  1VQE A;  2K75 A;  4A3M H;  3CC2 A;  2OTJ A;  4KHP L;  3CCS A;  3HKZ E;  4PMW A;  3OW2 A;  1HNZ Q;  2JA8 H;  2MO0 A;  3J81 c;  3OTO L;  1TXY A;  3CCJ A;  5C44 H;  3PIO A;  4UP8 A;  4IPH A;  1NE3 A;  2K5H A;  1FL0 A;  4OXP A;  5JEA G;  1G51 A;  3K81 C;  3S14 H;  5FLM H;  4C3I H;  2NVY H;  4DR2 L;  3PGZ A;  4BY7 G;  3PO3 H;  1LM0 A;  4B3R L;  5IE8 A;  1N36 L;  3NBH B;  2I0Q A;  1YHQ A;  1EOV A;  3I56 A;  3A0J A;  2OQ0 A;  4P72 A;  5ELO A;  4OO1 I;  4TQU S;  5C4X G;  1VQI A;  2VZA A;  4LFA Q;  5IP7 G;  1VQJ A;  2CCZ A;  3J80 c;  1HR0 L;  1IBM Q;  3M7N A;  3IRB A;  4JI1 L;  1PH6 A;  1V1Q A;  4OX9 Q;  2WP8 J;  3E9I A;  4JI6 L;  3EBE A;  1K9M C;  3CCL A;  2KBN A;  4IJH A;  5IY0 A;  4DR2 Q;  3J81 i;  1KXL A;  1W2B A;  5JJL A;  3KDF B;  1Q7Y C;  1AH9 A;  3BJU A;  2AMC B;  3G6E A;  4LF9 Q;  1WJJ A;  4LF5 L;  2K5V A;  1TWC H;  5IWA L;  4B3M L;  4PZ8 A;  4LF7 Q;  1E1T A;  1N34 L;  2B63 G;  2YV5 A;  2N49 A;  3ER0 A;  3CCE A;  3L0O A;  2Q2I A;  2OTL A;  4DR5 L;  3EIV A;  2R92 G;  3RZO H;  1Q46 A;  1FJG Q;  1PH8 A;  2IX1 A;  1SN8 A;  3CXC A;  2A1A A;  2F3I A;  1N9W A;  1VQG A;  3PCO B;  4GN5 A;  5GAD C;  3HOX G;  3L7Z C;  2PNH A;  1E24 A;  4YHH Q;  2VQF Q;  5LMN W;  1PV4 A;  4A93 G;  4LFB L;  2JA9 A;  1HR0 W;  5IYB G;  2UXB L;  1L1O A;  1R9T H;  1VQM A;  4AYB G;  5LMN Q;  1LYL A;  3CC4 A;  2VUM H;  3HOY H;  3PUX A;  4A75 A;  4A3B G;  2IY5 B;  2E8G A;  3UDX A;  3KOJ A;  3BZC A;  4YCU A;  2UXD L;  4A3J H;  4R4T A;  1XPO A;  4B3T Q;  2Z6K A;  4YY3 Q;  3F2D A;  2JA5 H;  4BA1 I;  4DR7 Q;  1YJN A;  1B70 B;  1JJC B;  4QL5 A;  2A19 A;  3J7A 5;  2WFW A;  1EYG A;  1X6O A;  1IBM L;  2JA8 G;  2B63 H;  1WFQ A;  4NPS A;  4JI2 Q;  2VL6 A;  4AH6 A;  4BBR H;  4JI0 Q;  1ASZ A;  3UDI A;  1SRU A;  2JA7 G;  1X3E A;  4A3L H;  2F52 A;  1N32 L;  4JI5 L;  3BU2 A;  4DNI A;  3CC7 A;  3KF6 B;  5LMN L;  3F8T A;  1X65 A;  3RR5 A;  4BBR G;  1VQ5 A;  4C3J H;  4K0K L;  3OYY A;  1CSP A;  2ZJR A;  3STB C;  3AQQ A;  3NEN A;  4JCV E;  1HNX L;  3TRZ A;  1JE5 A;  1AE3 A;  1TWG H;  4DV5 Q;  2QGQ A;  2AWN A;  2FXQ A;  4LF8 L;  4JC0 A;  2UUC L;  4R4O A;  1K0R A;  1L1O B;  1S40 A;  2B3G A;  2PI2 E;  2NZH A;  4NXM Q;  4A3B H;  3SGI A;  1JB7 A;  1XTD A;  5JJI A;  1YHA A;  4GOP A;  2DUD A;  4JI3 L;  5JEA J;  4DV2 L;  2MO1 A;  1EFW A;  3CQZ H;  1TWA H;  1X55 A;  2CQO A;  3CCQ A;  1QZH A;  1VQ6 A;  2UXD Q;  1PYB A;  5IP7 H;  2VY3 A;  4DV0 Q;  1SRO A;  1UEB A;  1D7Q A;  4DUY Q;  3H3V I;  4HIO A;  2JEA I;  4DAM A;  2HHH L;  2HQL A;  4DUZ Q;  1PA6 A;  4A3C H;  1NY4 A;  2L15 A;  1XNQ L;  1KRS A;  5FLX c;  1NMF A;  2D0P A;  1N33 Q;  3HFZ B;  2NN6 G;  3TEH B;  3TQY A;  3GTQ H;  3F2C A;  5GQO A;  2LXK A;  1VQO A;  4JI4 Q;  1QVF A;  2HT1 A;  3H0G H;  4GKJ L;  1UE1 A;  4LWC A;  1U0L A;  1N36 Q;  2KEN A;  2K52 A;  1D8L A;  1K3R A;  1HH2 P;  1XNR Q;  1G29 1;  4BBS G;  1N33 L;  5IYD H;  3AEV A;  2JA5 G;  3STB D;  4KLK A;  2Q2T A;  2HIV A;  1YJ9 A;  3ULL A;  4LF4 Q;  1Y1V H;  4POF A;  5HGQ A;  1PHJ A;  1K8A C;  4DK6 C;  3HOY G;  2JA7 H;  1SMX A;  2ES2 A;  4JI6 Q;  4OWX B;  1CKN A;  1MIU A;  3I4N H;  1BBU A;  3G4S A;  1I5F A;  1X56 A;  4GS3 A;  4A3G H;  2UUB Q;  2JK8 A;  1XNR L;  1RIP A;  1KL9 A;  4DV2 Q;  4JI3 Q;  3I4N G;  1Q1E A;  1J6Q A;  3T1H L;  3CMA A;  4PZ6 A;  4YY3 L;  5FJ8 H;  4B3R Q;  4UP9 A;  5IT9 c;  2VS1 A;  5M5W H;  1PH1 A;  4MZ9 A;  5IYC G;  2H5X A;  1VQL A;  1XNQ Q;  1IBL Q;  2UUA Q;  1NJI C;  4GOP B;  1NBW A;  3RLF A;  1N34 Q;  3T1Y L;  4LFC Q;  1HNW Q;  4LNQ A;  4DPG A;  1Y1V G;  4GN3 B;  1MJE A;  1UE5 A;  3I7F A;  3FP9 A;  1IBL L;  4DR5 Q;  3D0F A;  4DKA C;  4IFD J;  4A3E H;  3HOU G;  2MFI A;  2NVX H;  1OXU A;  3HKZ G;  1VQF A;  5IWA Q;  3E9H A;  5C3E H;  4X64 L;  1DGS A;  2IX0 A;  1IZ6 A;  2CKZ B;  3PUY A;  2D62 A;  1YIT A;  4DV7 L;  1HZA A;  1X9N A;  3KF6 A;  4JBM A;  1IL2 A;  5JJK A;  4UY8 C;  4A3I G;  2NN6 I;  5GAG C;  3CCV A;  4JI8 L;  3WWV A;  4QJF A;  4JI1 Q;  4DV4 L;  3S17 H;  2ZTD A;  1BKB A;  1SLJ A;  4BY7 H;  2C35 B;  4R4C A;  5M3F G;  3HOV G;  1M90 C;  1BBW A;  1EIF A;  4DV3 Q;  4BXX H;  2UXB Q;  1VQD A;  3I55 A;  4LUO A;  1BVS A;  2R93 G;  1S72 A;  3D31 A;  2EIF A;  1UWV A;  1O7I A;  4RG1 A;  2RHS B;  4KHZ A;  2NVQ H;  3KF8 B;  3U4Z A;  3KYH C;  1I94 Q;  1JJG A;  1VQ9 A;  4JI2 L;  5EAY A;  3PO2 G;  1IXR A;  4LF6 L;  4O0A A;  4A93 H;  4X6A H;  3AYH B;  3J81 j;  3GTP H;  2AWO A;  2OQK A;  3RLN A;  4HJA A;  2MQH A;  1MJC A;  1TWF H;  4KI0 A;  4P74 A;  3JAM c;  1Y1W H;  1Q86 C;  4DV3 L;  3GTO H;  2UXC L;  1SFO H;  1SR3 A;  1I6H H;  3K7A H;  3S16 H;  1YZ6 A;  4YCW A;  4OX9 L;  1EWI A;  2PMZ E;  1CUK A;  4DUY L;  1N8R C;  2F4V L;  3HOZ G;  3T1H Q;  1NMG A;  4IPD A;  4A3L G;  1TWH H;  1XPR A;  4DV5 L;  3U4V A;  2IHF A;  3CP0 A;  3S2D H;  2EXD A;  2WB1 E;  3KDF A;  4MTN A;  4R4Q A;  2E2I H;  1Q12 A;  1FVI A;  4JOI C;  4L5Q A;  5IYB H;  4A3K G;  1XMQ Q;  1FJG L;  3NEM A;  3HOW H;  2VW9 A;  4A3F G;  5ELN A;  3CPF A;  4NXN Q;  3GTM H;  2JA6 G;  2R7D A;  5DLQ E;  1N32 Q;  1VQH A;  1XPU A;  1C9O A; 
#chains in the Genus database with same CATH topology
 2K4K A;  4OIJ A;  3G7L A;  1W3S A;  4GOP C;  2LSS A;  3CCU A;  2OF1 A;  1CKN B;  4G7H C;  3M85 A;  1PH9 A;  1SYC A;  3GDE A;  1QJO A;  2JJQ A;  1CT1 D;  1SE8 A;  2XRQ D;  5T1G A;  5JEA H;  4A3I G;  1E22 A;  2AHO B;  3A5Z B;  1HCZ A;  1Q3L A;  1SE3 A;  4DV7 Q;  2GVA A;  2A6H C;  2RQX A;  4GLV B;  2ZJP A;  4ZYS A;  3CME A;  1K3B C;  2JQO A;  3OWE B;  2SNS A;  3EN2 A;  1FNU A;  2BH8 A;  2F0W A;  3KLS A;  3L3O C;  2IX3 A;  1GOZ A;  4X65 Q;  3QOJ A;  2NUC A;  1PH2 A;  2I5H A;  1DZ1 A;  1A8V A;  1PRT B;  1Z9F A;  2NWG A;  5M3M G;  1PH7 A;  4X3S A;  4A3D H;  4A3E G;  1X3Q A;  2DY8 A;  1ENF A;  4JG2 A;  3GTJ H;  1A62 A;  5GAE C;  3IKJ A;  4G4K A;  2NTT A;  5K36 H;  2HQE A;  1PFB A;  4K5V A;  5FO9 B;  4XT3 B;  2F0L A;  3DXJ C;  4RHR A;  3Q8D A;  5IGF A;  4BS9 A;  3KJO A;  2YTV A;  1BCP B;  3FKI B;  4AYB B;  1HJP A;  4X64 Q;  3D3R A;  1Q8I A;  2Z0S A;  5LMU L;  3I73 A;  4A3K H;  4DU9 A;  1I94 L;  2R7Z B;  1NNX A;  2ZTC A;  5EPL A;  1GHK A;  5E4X A;  3OOC A;  1TVX A;  3S1Q B;  4DK3 C;  2DJF C;  3S1R H;  1UEA B;  2K5Q A;  5ELB A;  4DV0 L;  1PZI D;  1V1P B;  2EOT A;  5I6W A;  1HNZ L;  1YNN C;  1B2T A;  3GTL H;  2HHH Q;  4LW1 A;  5G3L D;  1C8C A;  3ERS X;  1D5Z C;  3D4R A;  1ZYR D;  2HDL A;  2OCE A;  4IOC A;  3DEO A;  2KHJ A;  1D5M C;  1IL8 A;  1I50 H;  5HY6 A;  1L0W A;  5I2X A;  3IFT A;  2E76 C;  4R1J A;  5EKI A;  4HJ7 A;  4C3H H;  1W6J A;  2WAQ B;  4X62 Q;  5BR8 L;  4B3S L;  1UE6 A;  1BCP C;  1HRJ A;  5J1Z A;  3W1B A;  1S4Z A;  2ZXO A;  1LLR D;  4YWL A;  4HID A;  1VQC A;  2F0N A;  3H0G G;  2B63 B;  4JYA L;  2L4N A;  3SDZ A;  2JA7 B;  2PI2 A;  1J9O A;  1V9P A;  2PCF B;  2HUG A;  1C0A A;  4JPB W;  4JW0 A;  2IHE A;  2ZM6 Q;  1H95 A;  4UP7 A;  3UDF A;  3I2Z A;  4LFB Q;  1L1O C;  1F9Q A;  1KDB A;  2I5M X;  1CQV A;  2EY6 A;  1AE2 A;  1R4Q B;  3I4L A;  4Y7N H;  4F87 A;  2KVM A;  1SFO B;  4KY6 A;  3AU7 A;  5C44 G;  1PH4 A;  5I9P A;  1HNX Q;  2K32 A;  1PFM A;  3BVZ A;  3K7U C;  1RJT A;  5K36 G;  2GN5 A;  1AN8 A;  1YEZ A;  1V1P A;  3W2D A;  4HJ9 A;  3OTO Q;  4DK1 A;  2CWA A;  1STE A;  2CQA A;  4XQJ A;  3MXN B;  3T51 B;  1GM5 A;  2R92 H;  4DR1 L;  3TZU A;  1P16 A;  2EJG C;  3AFQ A;  2KA7 A;  2WB1 G;  1E7Z A;  5CV7 A;  3S15 H;  3MC0 B;  4C3I B;  3N52 A;  3S17 B;  1OXX K;  4HIM A;  4DR3 Q;  3A7L A;  3PO2 H;  5A35 A;  2JP1 A;  1TU2 B;  3D8G A;  4DR4 L;  1V43 A;  3KBG A;  2I5L X;  2F0S A;  1A2T A;  1EY5 A;  3S1N H;  5DM6 3;  3J80 E;  1WTO A;  3HOV H;  4WJ4 A;  1CA5 A;  3OSO A;  3HOZ H;  3TS2 A;  3FHW A;  3HOZ B;  3I72 A;  2IW3 A;  4TKO B;  4KHP Q;  3RLO A;  2E2I B;  4GLA C;  2FMC A;  4XIG S;  5EPJ A;  3C3L A;  4Y52 H;  3U50 C;  4NXM L;  4A3M G;  1ZXT A;  1S3O A;  3RZD H;  2F4I A;  3D6C A;  3CC2 A;  2OTJ A;  2F3W A;  1J8I A;  3OW2 A;  2MO0 A;  3OTO L;  1JR0 D;  3V96 A;  5C44 H;  4UP8 A;  1NE3 A;  2P5Z X;  2MJ8 A;  4KD3 A;  1G51 A;  2R93 B;  2SNM A;  1PTO B;  1V8Q A;  5LL6 X;  1ZYR C;  2Y0S B;  4C3J B;  3PO3 H;  4B3R L;  3HS0 C;  3P7J A;  5IE8 A;  3QG1 A;  4ZUI A;  1EY8 A;  3A0J A;  2OQ0 A;  4OO1 I;  2RKS A;  4LFA Q;  3X3N A;  1IBM Q;  4JI1 L;  1NR4 A;  4OX9 Q;  2WP8 J;  3E9I A;  3EBE A;  3CCL A;  1RD9 D;  5IY0 A;  2H4O A;  4LMQ D;  1Z7T A;  1KXL A;  2AQ3 B;  1W2B A;  2CHB D;  4LF5 L;  2K5V A;  2B63 G;  4JV5 Q;  2E2D C;  3ER0 A;  3A55 A;  1SNO A;  3L0O A;  3M4O B;  1X3P A;  5AFW A;  1I4H A;  2MHV A;  5EJW A;  1R4P B;  1Q46 A;  1PH8 A;  1I3Q B;  5C3E B;  5KNB A;  5GAD C;  1N9W A;  1WVL A;  4FF4 A;  5C0X H;  5K5P A;  1HR0 W;  1O78 A;  5I9O A;  5IYB G;  2UXB L;  2VUM H;  1LYL A;  5A2Q E;  4C1N K;  2O5J C;  3KOJ A;  3R2I A;  4QMG A;  1AW7 A;  4R4T A;  3VYU A;  3NXW A;  2M2L A;  2Z6K A;  3T4A C;  1DOL A;  4DR7 Q;  4QL5 A;  2A19 A;  1DYQ A;  1X6O A;  1IBM L;  1GUT A;  2B63 H;  4NPS A;  4Q0F A;  4AH6 A;  1AZP A;  2D9U A;  3LNN A;  2B2W A;  2EYL A;  4N9P A;  4JI5 L;  2NN6 H;  1TKW B;  5IGE A;  4BBR G;  2IJ0 A;  3CHB D;  4CGY B;  1XTC D;  3TP8 A;  3D4W A;  3STB C;  3NEN A;  4JCV E;  3TRZ A;  1TWG H;  2AWN A;  1ZKO A;  2EVB A;  4H0L C;  3DUZ A;  1L1O B;  2NZ1 D;  2B3G A;  4NXM Q;  4CDF C;  5JJI A;  1YHA A;  2DUD A;  3H6M A;  4JI3 L;  4DV2 L;  3BZD B;  2MO1 A;  2C5C A;  1TWA H;  3CCQ A;  1TWA B;  2PNR C;  4RAU C;  4C1N I;  3DHQ A;  1B9M A;  4DUY Q;  3H3V I;  4HIO A;  2JEA I;  4DAM A;  1HUM A;  2D2C C;  2HQL A;  4OIK A;  2L15 A;  3FDT A;  1CZW A;  1KRS A;  1NMF A;  2NN6 G;  3F2C A;  3GTG B;  2HCI A;  1SAP A;  2JN4 A;  3JAM L;  1VQO A;  4H7B A;  4LWC A;  1U0L A;  1RTN A;  4WFN 3;  3HEJ A;  1UNS A;  4BBS G;  1G29 1;  1F2M A;  5IYD H;  5CV9 A;  1YJ9 A;  4LF4 Q;  1Y1V H;  2L0C A;  1K8A C;  3I4N H;  1CKN A;  4A3G H;  2UUB Q;  3H3V C;  1KL9 A;  1HQM C;  5CBE E;  2A68 D;  4DV2 Q;  4JI3 Q;  3I4N G;  3SE0 A;  3BYT B;  4K5X A;  4PMC A;  1PH1 A;  4MZ9 A;  5IYC G;  4R8N A;  1IBL Q;  3GTQ B;  2OXP A;  2WKC A;  3DEP A;  2RBM A;  3T1Y L;  1HNW Q;  1UE5 A;  3FP9 A;  4L6T B;  3LWU A;  2E75 C;  1MBY A;  4HSP A;  4EQO A;  3QIA A;  3HOU G;  5CYU A;  5IWA Q;  2IX0 A;  4K2L A;  2EPB A;  2K1B A;  2M9V A;  3DWP A;  4BWG B;  2ZXR A;  1CK1 A;  5EPK A;  4QJF A;  2C35 B;  4RGO S;  3BVG A;  5C3W A;  2UXB Q;  3L9A X;  2RDH A;  3I55 A;  1BF4 A;  4K2K A;  4LUO A;  2K01 A;  4OO1 H;  2R93 G;  1VMC A;  2Z4H A;  2EIF A;  1S72 A;  4RG1 A;  2RHS B;  4K6L A;  2R61 A;  1CFM A;  3U4Z A;  3V2T A;  3P1H A;  5NUC A;  1IXR A;  3OWF A;  4O0A A;  2RVL A;  1Y8P B;  3AYH B;  2QKI C;  3GTP H;  2OQK A;  4KI0 A;  1Q86 C;  3GTJ B;  1TWH B;  2QW7 A;  3GTO H;  2K05 A;  3HOV B;  3K7A H;  5KND A;  4YCW A;  5IT9 E;  1EWI A;  2X6L A;  1WD1 A;  2F4V L;  1SEB D;  3HOZ G;  3HOY B;  3T1H Q;  4ZKB B;  5C4H A;  4TSS A;  5CV8 A;  1ROD A;  3CP0 A;  3S2D H;  4MTN A;  3KDF A;  2E2I H;  1FVI A;  4JOI C;  5IYB H;  1FJG L;  3URY A;  4G57 A;  2VW9 A;  4A3F G;  3CPF A;  3GTM H;  2RCF A;  3BDC A;  2A74 C;  3H94 A;  1Y8O B;  5DLQ E;  1XPU A;  1GUN A;  5HGT A;  1E1O A;  2MP1 A;  1HTP A;  5E1F A;  3S24 A;  4LF6 Q;  3NBH A;  1PTO D;  1K73 C;  4EQ5 A;  4S3S A;  4RA8 A;  4LUZ A;  1KC8 C;  2KCM A;  1K83 H;  3PUV A;  4JI7 Q;  2BA0 A;  2E2J H;  1EUJ A;  1VQ7 A;  1STN A;  3GO5 A;  3CD6 A;  2DNE A;  2YU9 B;  1VQB A;  1I6H B;  1S5C D;  4DAV A;  3NWT A;  3DM1 A;  2UXC Q;  1RKN A;  4I7Z C;  1KAW A;  1BO0 A;  3K5O A;  2C9O A;  3QJY A;  1QB5 D;  2EXZ A;  2KHI A;  4FYD A;  1U4R A;  2Y0S G;  4FXK C;  4GN4 B;  1MSG A;  3PUW A;  2XSC A;  3HOU H;  1XMO Q;  1ET9 A;  4DAY B;  5KNC A;  2A68 C;  1Z6H A;  3TP7 A;  5C4J B;  5M5X H;  3EJI A;  4JBJ A;  5IP9 H;  1EY0 A;  3I8Z A;  2EE1 A;  5C0X I;  1EWC A;  5FLX L;  1TT2 A;  1QZG A;  1HZC A;  3Q24 A;  1E0B A;  1YNX A;  3F2B A;  1EY9 A;  4DV4 Q;  4LFA L;  1B8A A;  1EYD A;  1QVG A;  4MNO A;  2FIN B;  2Q8I B;  3NQI A;  1STA A;  1T5X D;  4JOI A;  1FNV A;  4J15 A;  3H15 A;  4A3M B;  1G2T A;  4IO9 A;  4DV6 L;  3LGJ A;  4J8Q A;  1EEF D;  3Q23 A;  4A3F H;  4BY7 B;  1ESR A;  3SHL A;  2K5N A;  4FDB A;  2HDM A;  4QIW E;  2IT1 A;  3E0J A;  1NUC A;  4RCN A;  3PSI A;  4AQY L;  4DK0 A;  2NVQ B;  5KRU A;  5C0X J;  4L5T A;  2N78 A;  3RNU A;  1PDQ A;  4A3C G;  3U9O A;  1NCV A;  2KQ3 A;  4BBS H;  2EJF C;  1TY2 A;  2NZO A;  4JI8 Q;  4CKE A;  1KHI A;  4EVO A;  1NAP A;  4P75 A;  1VQP A;  4C2M B;  3OHX C;  3AFP A;  1VMP A;  3F1Z A;  3H09 A;  3A74 A;  2NVX B;  4NB3 A;  5BN3 A;  3K59 A;  3C1E A;  3PF5 A;  1PYS B;  3GTK H;  3MXP A;  1PH3 A;  1QNK A;  2TMP A;  4C3J G;  2KCT A;  1YVC A;  3PV0 A;  1MHW C;  2FMM A;  2Z9H A;  3MWY W;  4GNX B;  2RHQ B;  1GO3 E;  2WII B;  4IUV A;  2HD3 A;  3FKI H;  5LL6 S;  3K0Y A;  4OEM B;  1XMO L;  2R7Z G;  2ASB A;  4IPG A;  3GD7 A;  1VQ8 A;  1E2W A;  1GKH A;  4GNX C;  1J5E Q;  4IAL A;  1KDA A;  2RDF A;  3HOW G;  4B3M Q;  1CZG A;  4IUU A;  2JE6 I;  1G6Z A;  1KNA A;  2R7Z H;  2CWP A;  3I3C A;  1WYD A;  1WI5 A;  3WDN A;  1K8G A;  4IFD G;  1A63 A;  1V1O A;  3SK6 A;  2UU9 L;  4LJZ C;  3VR5 A;  1M4V A;  1H9S A;  4GKK Q;  4XYQ A;  5E3F A;  1X54 A;  3L2P A;  2B2U A;  3I4M B;  1PVO A;  3CCM A;  1JOK A;  4X3T A;  3CW2 C;  3CU7 A;  2KJX A;  1D6E C;  3MTS A;  3M4P A;  4TVA B;  2XWB B;  5AJ3 Q;  1I3Q H;  3TDQ A;  1I4R A;  1HXY D;  2L12 A;  1JT8 A;  4X65 L;  1VQN A;  2RF4 A;  3S1M H;  2WV6 D;  4XXE A;  2EZV A;  1JOQ A;  1K8O A;  5C3E G;  1KAB A;  2Q2U A;  2ICI A;  3ONA B;  1YNJ D;  1TR5 A;  4DR6 L;  5M3F H;  3A54 A;  4K8J A;  4WJW A;  3C2P A;  2CVR A;  4V0B A;  5DAU A;  2ZJQ A;  1LT3 D;  1PFN A;  2ZT9 C;  4HMJ A;  4AYB E;  5IGG A;  2EQS A;  3SEB A;  3ULJ A;  2EYP A;  3KFU A;  2NVY B;  4KJO A;  1ONL A;  3AMU A;  2I46 A;  4GLX A;  2A73 B;  3TP6 A;  1YIJ A;  1M8A A;  2UU9 Q;  1GJX A;  3A7A B;  4A3J G;  1T5E A;  4IUR A;  5C4X H;  2K14 A;  1PTO H;  4L63 B;  1Z47 A;  3K8A A;  1ASY A;  5CMD A;  4LAA A;  1Y14 B;  1EIY B;  4A3K B;  1PH5 A;  2E2H H;  3A8K E;  1OTC A;  1A0I A;  5EGT A;  3E0E A;  3I4O A;  3TS0 A;  1L0Y B;  2KHS A;  1AP0 A;  2DGY A;  4KKU A;  2VQF L;  3S9W A;  3DLL A;  2PZW A;  1WTQ A;  4K8I A;  2E5L L;  4JBW A;  3J80 i;  3JAM E;  3SK8 A;  4H44 C;  3HKZ E;  1JE4 A;  2HCC A;  3J81 c;  1PYW D;  1PXU A;  5C5M A;  3PIO A;  1FL0 A;  4DR2 L;  1XX8 A;  1C48 A;  3PGZ A;  4BY7 G;  5M3M B;  5CGK A;  1N36 L;  1A15 A;  1B44 D;  1DM0 B;  2I0Q A;  1GUW A;  3I56 A;  1JOR A;  4P72 A;  1AFP A;  2GA4 B;  5COY A;  1FR3 A;  2CCZ A;  3J80 c;  1HR0 L;  1U9R A;  3H91 A;  3IRB A;  3M7N A;  1V1Q A;  1LTR D;  1S5B D;  1CHP D;  3KLR A;  4JI6 L;  2KOL A;  1K83 B;  1TS2 A;  4IJH A;  3J81 i;  5C4Z A;  1Q7Y C;  2FFK B;  3G6E A;  3FPU B;  5EBD A;  4LF9 Q;  1TWC H;  1QOH A;  4DAP A;  2B2V A;  1SXT A;  2RSO A;  2Q2I A;  3LWE A;  2OTL A;  3RZO B;  5M5Y B;  4DR5 L;  3EIV A;  1MI2 A;  3RZO H;  3J7A F;  4FO2 A;  2JSO A;  3KLS X;  4DNR B;  3T16 A;  1D1I A;  4YHH Q;  1LAC A;  3R93 A;  4KN4 C;  5LHY 1;  1L1O A;  1R9T H;  4IUT A;  4AYB G;  5LMN Q;  3S2H B;  2IY5 B;  3C1F A;  4A75 A;  3VYS A;  3J81 E;  2F03 A;  1STG A;  4B3T Q;  3F2D A;  2JA5 H;  1DD2 A;  1YJN A;  2JA5 B;  3PO3 B;  4OEL B;  3VA5 A;  1EYG A;  1G2S A;  3K5L A;  3NE5 B;  1GXD C;  1A3T A;  4JI0 Q;  1SRU A;  2JA7 G;  1HTL D;  3QO2 A;  4A3L H;  1EFI D;  1QWY A;  3CRL C;  4DNI A;  2NVT B;  3KF6 B;  5LMN L;  2J4X A;  3RR5 A;  5KYL A;  1DON A;  2DN8 A;  4A3F B;  3OYY A;  3PO2 B;  2Q8R E;  2LY7 A;  2ZJR A;  1PRT D;  3GTP B;  1GHJ A;  1S5F D;  4LF8 L;  4JC0 A;  4R4O A;  1K0R A;  1S40 A;  2PI2 E;  2B2T A;  2IPK D;  1XTD A;  4GOP A;  5JEA J;  3HGB A;  2FJ2 A;  1E2Z A;  4OL7 A;  2UXD Q;  1PYB A;  2G9D A;  3D4D A;  1SYF A;  1QG7 A;  1UEB A;  2B2V C;  5IGB A;  4DUZ Q;  4A3C H;  4E6I A;  1H9S B;  3GTQ H;  3TQY A;  3TEH B;  2B8G A;  1JWU D;  1B9N A;  2XRS D;  3RZD B;  4JI4 Q;  3WOE A;  3EFX D;  3VR3 A;  3I91 A;  1UE1 A;  1N36 Q;  5KEE A;  1ENA A;  3STB D;  2HIV A;  3ULL A;  4MN3 A;  1SSO A;  4DK6 C;  4OWX B;  4DN4 M;  1I5F A;  2QF7 A;  2MPM A;  2L55 A;  3CMA A;  3T1H L;  3BYY B;  5FJ8 H;  4B3R Q;  2VS1 A;  4Z9C B;  1WCM B;  4RH6 A;  1ZEQ X;  5FLX E;  4RHS A;  2VB2 X;  1KLG D;  1NBW A;  3S1R B;  1EU3 A;  1Y1V G;  3OIP A;  1MJE A;  4V19 0;  3X3M A;  3I7F A;  1RF2 D;  3D0F A;  4A3E H;  1ILQ A;  1OXU A;  5FK9 C;  5CR3 A;  3E9H A;  5C3E H;  4CKC A;  1ICW A;  3NHH A;  2G9H D;  4I65 A;  5JJK A;  4UY8 C;  4KTA A;  2NN6 I;  5GAG C;  3PIO 3;  3CCV A;  3EA6 A;  2E2J B;  4EQP A;  1BKB A;  4BY7 H;  2F0G A;  3HOV G;  1M90 C;  4MTK A;  4DV3 Q;  5CBA E;  1KLU D;  1QCB D;  2NB0 A;  1F2Z A;  4ABN A;  1LAB A;  4KKT A;  1K28 A;  3KF8 B;  5JJZ A;  3K5M A;  1I94 Q;  1VQ9 A;  1K8M A;  3PO2 G;  2N55 A;  2F0I A;  4K5W A;  2B39 A;  3K6O A;  2KCC A;  4PMB A;  2DNC A;  2MQH A;  1TWF H;  2A6E D;  4DV3 L;  1HUN A;  1SBB B;  3EVQ A;  2UXC L;  1FD7 D;  1SR3 A;  2SEB D;  1I6H H;  1WTP A;  1YZ6 A;  1JQY D;  2PMZ E;  1CUK A;  4C56 C;  4DV5 L;  2EXD A;  2WB1 E;  1LTG D;  5ELE A;  1EY6 A;  3HOU B;  2Z6B A;  4NXN Q;  2VXW A;  1SYD A;  1SNM A;  5DM7 3;  2X69 A;  4NMZ A;  1JIC A;  3BZK A;  3GV3 A;  1PZJ D;  2RCN A;  3CF5 A;  5I2Y A;  2F0F A;  2R92 B;  2BA1 A;  5EKL A;  1U5K A;  1ET6 A;  3GTG H;  3U9S A;  3A5U A;  3PUZ A;  1E3P A;  4YY3 L;  2ALY B;  3B6Y A;  1C7Y A;  4ZQ3 A;  5JAV A;  2F0J A;  1YJW A;  1SJE D;  1P8L A;  4DR7 L;  4R9W A;  2A5H A;  3UDG A;  1GUG A;  4B3T L;  3VR4 A;  4RFB A;  2WAQ E;  4XTC S;  2OEO A;  5H1S E;  3OMC A;  1LTB D;  4IJL A;  1LTT D;  3NTK A;  3S16 B;  2Z4I A;  4GKJ Q;  5FOB B;  3K57 A;  4GZY C;  2FHT A;  3CAM A;  4A3I H;  3TME A;  5CV6 A;  3CQZ B;  3MFY A;  4A3G G;  4UAI A;  1HFN A;  1O7Z A;  1WCM G;  2N8N A;  4AIM A;  4A4I A;  3HOX H;  3RN5 A;  4JI5 Q;  4APV A;  4AQY Q;  2K6A A;  4C3I G;  4ME5 A;  2F3V A;  4BXX G;  1TQO A;  2UUB L;  3HOW B;  1Q81 C;  2Q8T A;  1GVP A;  3J80 L;  2UUC Q;  3MEF A;  4YWM A;  2LMC B;  2YTX A;  4OHJ A;  2R6G A;  3E5S A;  4X62 L;  2CW0 D;  1SYB A;  4HIK A;  3TBI B;  5EBC A;  4UDU C;  3RD4 A;  4IUN A;  3TZD A;  1CKO A;  3GTL B;  3LX0 A;  3KUP A;  1U4P A;  2L11 A;  4OO1 G;  1EIG A;  2ID0 A;  5LMU Q;  3KJP A;  4NXN L;  4DR1 Q;  1XMQ L;  1DJR D;  4DR6 Q;  4KHV A;  2EY2 A;  1VCI A;  4LF5 Q;  2Z1C A;  3I4M H;  1NR2 A;  1FGU A;  4O42 A;  4QIW B;  1XJV A;  3S14 B;  1IYU A;  2VB3 X;  1EQQ A;  4PG3 A;  1CSQ A;  1EEI D;  2R7F A;  1VQ4 A;  4ZKC B;  2L5T A;  2M00 A;  2AUK A;  3A8J E;  3JAM i;  1VQK A;  2F0M A;  3ND8 A;  1WOC A;  4GKK L;  4KD4 A;  2V1C C;  2YYZ A;  4HCS A;  1IHZ A;  1KD1 C;  2XVS A;  1SDF A;  5D14 A;  4FXD A;  1G6P A;  1BDO A;  1GD7 A;  1NTG A;  1UUP A;  4WOR A;  3M3Y B;  2JEB I;  2ZTE A;  4WRD A;  2WB1 B;  1VS0 A;  1M1K C;  2VUM G;  2KEE A;  4NW2 A;  4P71 A;  4BY1 B;  4N8F A;  3MFG A;  1WTV A;  2XTI A;  2LXJ A;  3KBX A;  3PO3 G;  1J5E L;  1YBY A;  2WAC A;  4FF1 A;  5GAH C;  4OWW B;  1W6K A;  1BBX C;  3W1G A;  3K80 C;  1TWC B;  2VQE Q;  4B08 A;  4L5S A;  2PQA A;  4G7Z C;  4UPA A;  3BVM A;  4YWK A;  4KY7 A;  2PYK A;  4YHH L;  1L2F A;  2F0V A;  2MNA A;  3CKI B;  4H13 C;  5IGC A;  5A2Q L;  4LF9 L;  3GQB A;  4DGZ A;  3UE0 A;  4JI0 L;  1JWM D;  1KAA A;  1UAP A;  2GVB A;  4PV1 C;  1B7Y B;  1Q8K A;  4A3D G;  2CH4 W;  2Z8L A;  3TP5 A;  4ALP A;  3UE1 A;  1KDC A;  3W5O A;  3MAQ A;  4PZ7 A;  2G5D A;  5IYC H;  1HR0 Q;  5FO8 B;  3AB9 A;  2LS0 1;  2XWJ B;  5FKA C;  1UE7 A;  1TY0 A;  3P20 A;  4A76 A;  4B3S Q;  1YNN D;  3KK7 A;  4MHE A;  1MD2 D;  2A6H D;  1AEX A;  4DV1 Q;  4XYO A;  4GNX A;  3H3V H;  2ATW A;  5M5Y H;  1S5D D;  5BR8 Q;  5C0X G;  1D1K A;  4B9W A;  5BN4 A;  2WAQ G;  1Y8N B;  5FJ8 G;  3T1Y Q;  1IBK Q;  3RN2 A;  1CHQ D;  4X66 L;  4Y7N B;  5IYD G;  1QIL A;  1KQS A;  1G8Z D;  3CCR A;  3M4Y A;  3M4Q A;  2B2U C;  5C5L A;  5I4D A;  1I4G A;  1R9T B;  1VF7 A;  4X66 Q;  4LF8 Q;  1EY4 A;  3J7Z C;  4A3I B;  1I4P A;  1XWE A;  4OWT B;  1VQE A;  2JA8 H;  2F0T A;  1F9R A;  2PW7 A;  1I50 B;  4PMW A;  1HNZ Q;  4IZ8 A;  1TXY A;  2NTS A;  3CCJ A;  3D6W A;  3MZ5 A;  5JEA G;  2O5I C;  1E2V A;  4C3I H;  4CHT B;  2AQ2 B;  1I4Q A;  2KEC A;  4EQN A;  3NPP A;  5CV5 A;  1YHQ A;  5C4X G;  1TS4 A;  1VQI A;  2VZA A;  5IP7 G;  1VQJ A;  3HKZ B;  1F9S A;  4X3U A;  2DY7 A;  4A3G B;  1BQQ T;  2OT2 A;  2B2Y A;  2F0K A;  3UI2 A;  1ESF A;  2KBN A;  4QUF A;  2KUM A;  2BE5 C;  1CI3 M;  1AH9 A;  4CBV A;  3BJU A;  2AMC B;  1D2B A;  1FNW A;  1WJJ A;  2BDN A;  4XT1 B;  4B3M L;  4PZ8 A;  3RUZ A;  2N49 A;  3CCE A;  5D65 A;  5T1I A;  1FJG Q;  1VDZ A;  2IX1 A;  4CKB A;  2F0O A;  1KNE A;  1JWS D;  4RKB A;  4CJ0 B;  3HOX G;  5J22 A;  2PNH A;  5LMN W;  1PV4 A;  1HHV A;  5JVH 3;  4A93 G;  2F0D A;  2JA9 A;  1BOS A;  4JVZ A;  3G6J B;  3CC4 A;  3HOY H;  3PUX A;  3TSS A;  1LT5 D;  2E8G A;  4ZK9 B;  2K04 A;  3BDL A;  3VYT A;  3BZC A;  5D3I B;  1EIH A;  2EYM A;  1XPO A;  4FF3 A;  1B70 B;  1JJC B;  1VF5 C;  4MIU A;  4KMU C;  1WFQ A;  4JI2 Q;  2VL6 A;  4PQX A;  1JC7 A;  1X3E A;  3BU2 A;  3HP3 A;  1X65 A;  3QR8 A;  1CSP A;  1HFG A;  4RGN A;  3AQQ A;  3Q22 A;  1HNX L;  5IT9 L;  2QGQ A;  3SK4 A;  2FXQ A;  2UUC L;  2JA6 B;  2E74 C;  2NZH A;  1EYC A;  4A3B H;  4J6H A;  1JB7 A;  3FVQ A;  1U4M A;  5E4W C;  1EFW A;  4QUC A;  2CQO A;  1X55 A;  5IOC A;  1VQ6 A;  2IL8 A;  4DXG A;  4L8J A;  1HA6 A;  4QB4 A;  1TS3 A;  5C3X A;  2AUJ D;  2A69 C;  1AZQ A;  2KED A;  2CW0 C;  5ISR A;  1EWH A;  1N33 Q;  2D0P A;  5GQO A;  1SNQ A;  3GTM B;  2LXK A;  5FO7 B;  4GKJ L;  4ZAI A;  2ZXP A;  1PTO F;  3H0G H;  2J7Z A;  1WTH A;  2CH4 A;  4A3E B;  4RGM A;  4RWS C;  1K3R A;  1HA5 A;  1HH2 P;  3FMC A;  1N33 L;  3AEV A;  4KLK A;  2Q2T A;  4C3H G;  2QEJ C;  5HGQ A;  1PHJ A;  3HOY G;  1EYA A;  2JA7 H;  2ES2 A;  1PMR A;  1MIU A;  4CJ1 B;  1X56 A;  3NK9 A;  4P2C B;  4CDC C;  3MEH A;  1XNR L;  1O7L A;  3HG9 A;  4A93 B;  1J6Q A;  2RDG A;  5IT9 c;  5M5W H;  1SNC A;  3I90 A;  5CC4 A;  4BBS B;  1SYG A;  4R8I A;  1NJI C;  4GOP B;  4K14 A;  1N34 Q;  1FGB D;  4QF4 A;  4NKL A;  2B2T C;  3MVV A;  2O2L D;  4GN3 B;  3V05 A;  2K03 A;  4DPG A;  1SE4 A;  4IUQ A;  1EOT A;  1I4X A;  5BN5 A;  1IBL L;  1F9P A;  2F0H A;  4DKA C;  2JA8 B;  4KK7 A;  4B9X A;  2MFI A;  2NVX H;  3HKZ G;  1VQF A;  2MUY A;  3ZYY X;  4X64 L;  1A3U A;  5F2D A;  3PUY A;  1H9R A;  2K5W A;  3OPO A;  1HZA A;  3KF6 A;  4X3K A;  4KY5 A;  1JB3 A;  4DA2 A;  4XQN A;  4DV4 L;  3S17 H;  4O1N A;  5M3F G;  1BBW A;  1EIF A;  2H1E A;  4BXX H;  2EYH A;  3NWS A;  3GP7 A;  1EZ6 A;  3ERQ A;  1VQD A;  4NDX A;  2BDO A;  3D31 A;  4HMI A;  2EY5 A;  4KHZ A;  2NVQ H;  1JJG A;  5EAY A;  4LF6 L;  3S1N B;  1U4L A;  2F1M A;  4X6A H;  1TWG B;  1MJC A;  3JAM c;  4P74 A;  2BE5 D;  5KIX A;  3J7Y W;  2F0E A;  3T56 B;  2L9H A;  2JXM B;  4DUY L;  1N8R C;  1STB A;  5ELD A;  5ELC A;  4KN7 C;  4A3L G;  4IFD H;  1B53 A;  1TWH H;  1XPR A;  1WD0 A;  4LK1 C;  3GTO B;  3O13 A;  4R4Q A;  1XMQ Q;  3NEM A;  3HOW H;  1DXM A;  2DJG C;  4KKS A;  2K28 A;  3E3X A;  4ID6 A;  1VQH A;  1N32 Q;  1C9O A;  3OW7 A;  4DV1 L;  3F2U A;  4JYA Q;  4WJ3 M;  2N88 A;  4I7A A;  3DMU A;  4U67 3;  1HPC A;  1PLF A;  1ILP A;  5M3M H;  4K0K Q;  3ULP A;  4EX5 A;  5I6Y A;  3Q6S A;  5IIF A;  5FLM G;  4XDX A;  5IP9 G;  4IFD I;  2YTY A;  4J1M A;  4LUV A;  2MGS A;  1RHP A;  3DM3 A;  2SDF A;  4NP5 A;  5ELF A;  4LF4 L;  5C4X B;  4F7X A;  1Q82 C;  4ME3 A;  1HZ9 A;  1YI2 A;  3G48 A;  4FNF A;  3BDO A;  4JBK A;  4OGQ C;  4QY7 A;  2O4X A;  1WTX A;  1IKM A;  2YU9 H;  4JK1 C;  2EY1 A;  4HAE A;  3K7A B;  2Y0S E;  2XIW A;  4JI4 L;  3GTK B;  4BA2 I;  4LF7 L;  3HKS A;  4QGU A;  3T13 A;  4OON A;  5AJ3 L;  1WCM H;  4A3J B;  4DAY A;  1TII D;  1XXG A;  3WOF A;  2HIX A;  1ENC A;  3FPP A;  3S2H H;  2QCP X;  4BY1 G;  1MKH A;  5IOD A;  5KGU A;  2VUM B;  2BCO A;  1L0X B;  2RA4 A;  1DOM A;  1K0S A;  3H0G B;  5J3B A;  1QUQ A;  1B3A A;  1BCP F;  3OIQ A;  3I4N B;  1CTM A;  4BY1 H;  1QVC A;  4F8M A;  4HED A;  5IGD A;  3P75 A;  2WIN B;  3I70 A;  4L5R C;  1GUS A;  3BG3 A;  2PZU A;  2QDL A;  3KLW A;  1RL2 A;  1F77 A;  1B4O A;  1BNZ A;  1IYJ B;  2UUA L;  1QUQ B;  4DR3 L;  2A69 D;  3ICE A;  1I6V C;  4HR7 B;  3M3Y H;  3QOL A;  1Q1B A;  2E2H B;  3K58 A;  3A56 A;  5HUR A;  3N6R A;  4P73 A;  4ZCK A;  2Q2H A;  2CFM A;  2PMZ B;  1EQT A;  4G7O C;  1SYE A;  2EYO A;  1F2L A;  3PF4 A;  1IBK L;  3TRE A;  3JC6 6;  2JA6 H;  4CDD C;  2BOS A;  3NQT A;  4YCV A;  4A3B B;  2R93 H;  3U58 A;  4A3D B;  5EQ0 A;  1PRT F;  1LTS D;  1HZB A;  3CPW A;  1EY7 A;  1LTL A;  4JI7 L;  2A8V A;  3M7G A;  2OWO A;  1OO9 B;  4POG A;  3T53 B;  3NEL A;  1LTI D;  4U68 A;  1D5X C;  4IPC A;  1F2Y A;  2NVT H;  1PFS A;  3ND9 A;  2ZM6 L;  5C6A A;  1X3G A;  5E7N A;  4BBR B;  1EU4 A;  5C44 B;  4JV5 L;  1OXS C;  1SJH D;  2F0Q A;  1BUV T;  4HJ8 A;  4IUP A;  4FF2 A;  5CV4 A;  1H9M A;  1LT4 D;  1EQR A;  4HSV A;  3M4O H;  2QDB A;  1YHB A;  3IL8 A;  4QQB X;  5JPN C;  1PRT C;  1EZ8 A;  1SNP A;  1HNW L;  2F4V Q;  4HJ5 A;  1A2U A;  3E6Z X;  2Z6K C;  3A8I E;  3NTI A;  4C2M H;  2L1B A;  3M9B A;  4N9T A;  1JMC A;  1OXV A;  5C4J H;  3HOX B;  4RMF A;  1RTO A;  3S1Q H;  2K50 A;  2VNU D;  2VQE L;  1IYV A;  2V4D A;  2PO4 A;  5JOB A;  5JVG 3;  1VQA A;  1HQR D;  2N3S A;  2B2W C;  3J81 L;  3PIP A;  1NSN S;  3VR2 A;  1CKM A;  3R8B A;  2QA4 A;  5G3L F;  4DV6 Q;  1JJ2 A;  2PQA B;  3I4M G;  4IN3 A;  1JOO A;  5GRO A;  2LKV A;  4H02 A;  1A6X A;  4IQZ A;  3K0X A;  1T9H A;  3J7A V;  3EQL C;  1O7Y A;  4ULL A;  2PPB C;  1II3 A;  2WKD A;  2BH2 A;  3VYR A;  3VDY A;  2B29 A;  3QWN A;  2A6E C;  4EGV A;  3ZJY C;  2AQ1 B;  2QEX A;  1KIX A;  1D7Q A;  2B8F A;  3MA2 B;  4R4I A;  4RGT A;  2D0O A;  3SR1 A;  3VA7 A;  1LUZ A;  2F0U A;  4DR4 Q;  1TWF B;  5M9O A;  4LFC L;  1X3F A;  2XGT A;  2E5L Q;  4DFA A;  1DOK A;  4O2D A;  3NUC A;  4DUZ L;  1KRT A;  1JCK B;  3G71 A;  1Y1W G;  1OXT A;  4HCE A;  1MSH A;  3FKI G;  2AKW B;  4IOA A;  3S1M B;  5KYI A;  1Y69 U;  4Q5V A;  2ICE C;  2K75 A;  3NBI A;  1BCP D;  4A3M H;  4KHP L;  3SK5 A;  3CCS A;  3TN2 A;  1A3V A;  1PTO C;  1S5E D;  4ZRZ A;  3QB3 A;  1LO5 D;  4IPH A;  1KTK A;  2K5H A;  4OXP A;  3S14 H;  3K81 C;  5FLM H;  2NVY H;  1SND A;  1LV9 A;  5COR A;  1LM0 A;  3HZX A;  2PW5 A;  3NBH B;  4M8A A;  1C4Q A;  4PNY A;  1B1Z A;  3K5N A;  4K6D A;  1EOV A;  5J39 A;  5ELO A;  4TQU S;  1IW7 C;  3R2T A;  1GUO A;  1BR9 A;  1PH6 A;  1ICF B;  1K9M C;  4ZUJ A;  2EYF A;  4DR2 Q;  2PZT A;  1Y1V B;  1XYI A;  3KDF B;  4LF7 Q;  5JJL A;  5IWA L;  1E1T A;  1N34 L;  2YV5 A;  2EYJ A;  2R92 G;  2K5D A;  1SMY C;  1SN8 A;  2K7V A;  3MXG A;  3CXC A;  2A1A A;  2F3I A;  1VQG A;  3PCO B;  4GN5 A;  1PZK D;  1WTW A;  3L7Z C;  1E24 A;  2VQF Q;  1CA6 A;  3SXH A;  4LFB L;  5M3F B;  3R3O A;  3NP8 A;  3BS1 A;  1VQM A;  3PQI A;  4A3B G;  1EL0 A;  3UDX A;  2UXD L;  4YCU A;  4A3J H;  3S15 B;  4YY3 Q;  4BA1 I;  2SOB A;  3GV6 A;  1TS5 A;  3J7A 5;  2WFW A;  4HN7 A;  2JYO A;  2JA8 G;  1G91 A;  4BBR H;  4FXG C;  1ASZ A;  3UDI A;  1SE2 A;  2F52 A;  1N32 L;  2K33 A;  3CC7 A;  1H9J A;  3F8T A;  4FVM A;  1VQ5 A;  4C3J H;  4K0K L;  4ODG A;  1Q90 A;  3MXU A;  3OMG A;  2I07 B;  2TSS A;  1JE5 A;  4RKL A;  1AE3 A;  3VR6 A;  4DV5 Q;  4HTH A;  3SGI A;  3NTH A;  5TSS A;  4N8X 1;  3CQZ H;  1FYC A;  4M1U B;  1QZH A;  4ILW A;  3FRP B;  5IP7 H;  4DF7 A;  1DCZ A;  2VY3 A;  4DV0 Q;  1SRO A;  4C3H B;  3W3A A;  4UHV A;  2EJM A;  2HHH L;  1PA6 A;  3ITP A;  1NY4 A;  1XNQ L;  1BXT A;  4CJ2 C;  5FLX c;  1O80 A;  3HFZ B;  3PIP 3;  1STH A;  4TRD A;  2D5D A;  2HT1 A;  1QVF A;  3S2D B;  2KEN A;  3SVM A;  2K52 A;  1B50 A;  1D8L A;  1XNR Q;  2EDG A;  2JA5 G;  1RCV D;  1QE6 A;  3KF8 A;  1LTA D;  4POF A;  1SMX A;  4JI6 Q;  4FP5 D;  1BBU A;  3G4S A;  4GS3 A;  1CQF A;  2LFN A;  2JK8 A;  4KV6 A;  1RIP A;  1IKL A;  1Q1E A;  2ENB A;  4PZ6 A;  1IW7 D;  4UP9 A;  3FEW X;  3DWQ A;  2NBF A;  1QNU A;  3MXN A;  2H5X A;  1VQL A;  1XNQ Q;  2UUA Q;  5EKK A;  3RLF A;  4LFC Q;  1X32 A;  4LNQ A;  2NYZ D;  2B2Y C;  4DR5 Q;  3IAY A;  4IFD J;  2R3Z A;  2F0P A;  3CRK C;  1SMY D;  1DGS A;  1IZ6 A;  2CKZ B;  1WTR A;  1MGS A;  2D62 A;  1YIT A;  4DV7 L;  5M5X B;  1X9N A;  4QCL A;  3ERO A;  1STY A;  4RCO A;  4JBM A;  1IL2 A;  4JI8 L;  3WWV A;  5DEH A;  4JI1 Q;  2ZTD A;  1SLJ A;  3RMH A;  1ML0 D;  3HRZ C;  4R4C A;  1B3Q A;  2QIL A;  1BVS A;  1UWV A;  1O7I A;  4DNT B;  1EQV A;  3KYH C;  3MHB A;  4JI2 L;  2RSN A;  5D3D A;  2X6G A;  3Q0A A;  4A93 H;  3J81 j;  2AWO A;  5DNF A;  3RLN A;  4HJA A;  2PQE A;  3IFD A;  4YIJ A;  4KJN A;  5M5W B;  4XQQ A;  1Y1W H;  3NSW A;  5JPM C;  4DXF A;  1Y1W B;  1SFO H;  1LT6 D;  3S16 H;  4ZLT F;  4OX9 L;  4F88 A;  3DWA A;  1H9K A;  1NMG A;  4IPD A;  3U4V A;  2IHF A;  2XN9 C;  2IWH A;  1Q12 A;  3PMF A;  4A3K G;  2KCN A;  4L5Q A;  2XNA C;  4CDE C;  5ELN A;  2J0T D;  2JA6 G;  1CM9 A;  2R7D A;  1RDP D;  5L37 A;  1YNJ C;  3C46 A; 
#chains in the Genus database with same CATH homology
 2K4K A;  3BZK A;  4DV1 L;  2RCN A;  1W3S A;  3CF5 A;  4GOP C;  4JYA Q;  4WJ3 M;  1E1O A;  4LF6 Q;  3S24 A;  5M3M H;  2LSS A;  4K0K Q;  3CCU A;  1CKN B;  3ULP A;  2BA1 A;  1U5K A;  3M85 A;  4EQ5 A;  1K73 C;  4EX5 A;  3GDE A;  1PH9 A;  5FLM G;  3GTG H;  2JJQ A;  4LUZ A;  1SE8 A;  2KCM A;  3A5U A;  1KC8 C;  1K83 H;  1E3P A;  3PUZ A;  1E22 A;  2AHO B;  2ALY B;  3PUV A;  3A5Z B;  3B6Y A;  2BA0 A;  5IP9 G;  1C7Y A;  4JI7 Q;  4IFD I;  2YTY A;  2E2J H;  1EUJ A;  4DV7 Q;  1VQ7 A;  2GVA A;  1YJW A;  3GO5 A;  1P8L A;  4LUV A;  3CD6 A;  4GLV B;  2ZJP A;  3CME A;  1VQB A;  2JQO A;  3DM3 A;  4DR7 L;  4B3T L;  3UDG A;  4LF4 L;  2UXC Q;  3EN2 A;  2WAQ E;  4ME3 A;  1Q82 C;  1HZ9 A;  2BH8 A;  4XTC S;  1YI2 A;  1KAW A;  3G48 A;  4JBK A;  5H1S E;  4X65 Q;  4QY7 A;  1PH2 A;  2KHI A;  2I5H A;  4IJL A;  1A8V A;  2Y0S G;  2YU9 H;  1Z9F A;  5M3M G;  4A3D H;  1PH7 A;  4GN4 B;  3PUW A;  3HOU H;  2Y0S E;  4A3E G;  1XMO Q;  4DAY B;  4JI4 L;  4GKJ Q;  4BA2 I;  4LF7 L;  3HKS A;  4JG2 A;  4QGU A;  1A62 A;  3GTJ H;  4OON A;  5M5X H;  4JBJ A;  5IP9 H;  5GAE C;  5AJ3 L;  1WCM H;  3CAM A;  4A3I H;  5C0X I;  2HIX A;  1QZG A;  1HZC A;  4A3G G;  3S2H H;  1WCM G;  2N8N A;  4BY1 G;  4A4I A;  1MKH A;  1YNX A;  4AIM A;  3HOX H;  3F2B A;  3RN5 A;  4APV A;  4DV4 Q;  4JI5 Q;  3Q8D A;  4AQY Q;  3KJO A;  1B8A A;  2YTV A;  4LFA L;  1QVG A;  4MNO A;  4JOI A;  5J3B A;  4J15 A;  3H15 A;  4BXX G;  1QUQ A;  4IO9 A;  4DV6 L;  1HJP A;  2UUB L;  3LGJ A;  4X64 Q;  4BY1 H;  1Q81 C;  1QVC A;  2Z0S A;  4A3F H;  1GVP A;  5LMU L;  2UUC Q;  4A3K H;  2K5N A;  3MEF A;  2YTX A;  4FDB A;  4YWM A;  1I94 L;  4QIW E;  2IT1 A;  2R6G A;  4L5R C;  4X62 L;  4AQY L;  3KLW A;  1RL2 A;  3PSI A;  2ZTC A;  4HIK A;  5C0X J;  4L5T A;  2N78 A;  3RNU A;  4A3C G;  1IYJ B;  2UUA L;  1QUQ B;  1CKO A;  4DR3 L;  3ICE A;  4BBS H;  3M3Y H;  2NZO A;  4JI8 Q;  1Q1B A;  4OO1 G;  1KHI A;  2ID0 A;  4P73 A;  4DK3 C;  3S1R H;  4P75 A;  4DV0 L;  2Q2H A;  5LMU Q;  2CFM A;  3KJP A;  1VQP A;  4NXN L;  4DR1 Q;  1HNZ L;  3GTL H;  1XMQ L;  2HHH Q;  4LW1 A;  3AFP A;  3F1Z A;  3A74 A;  4DR6 Q;  4NB3 A;  1VCI A;  4LF5 Q;  3ERS X;  3I4M H;  3PF5 A;  3PF4 A;  1PYS B;  3GTK H;  1IBK L;  3TRE A;  1FGU A;  3JC6 6;  2JA6 H;  1PH3 A;  1XJV A;  4YCV A;  2R93 H;  3U58 A;  1EQQ A;  4PG3 A;  1CSQ A;  2KCT A;  2OCE A;  1YVC A;  4IOC A;  3PV0 A;  2KHJ A;  1HZB A;  4GNX B;  1I50 H;  2R7F A;  2RHQ B;  5HY6 A;  1L0W A;  3CPW A;  1GO3 E;  1VQ4 A;  1LTL A;  4R1J A;  4HJ7 A;  4C3H H;  3FKI H;  4JI7 L;  2A8V A;  2OWO A;  1XMO L;  2R7Z G;  4POG A;  4X62 Q;  2ASB A;  4IPG A;  3GD7 A;  3NEL A;  3JAM i;  1VQ8 A;  5BR8 L;  1GKH A;  1UE6 A;  1VQK A;  4IPC A;  4GNX C;  4B3S L;  2NVT H;  1PFS A;  1WOC A;  2ZM6 L;  3W1B A;  1J5E Q;  4GKK L;  1X3G A;  2V1C C;  2YYZ A;  5E7N A;  3HOW G;  1KD1 C;  4B3M Q;  4JV5 L;  2JE6 I;  4YWL A;  2R7Z H;  4HID A;  1VQC A;  3H0G G;  1GD7 A;  2CWP A;  1NTG A;  4JYA L;  1WYD A;  1G6P A;  2JEB I;  1OXS C;  1WI5 A;  2ZTE A;  1K8G A;  4HJ8 A;  4IFD G;  2PI2 A;  1VS0 A;  1M1K C;  2VUM G;  1V9P A;  1A63 A;  4P71 A;  1C0A A;  2UU9 L;  2XTI A;  2IHE A;  2LXJ A;  1EQR A;  3PO3 G;  2ZM6 Q;  1J5E L;  1YBY A;  3M4O H;  4GKK Q;  1H95 A;  1YHB A;  4UP7 A;  3I2Z A;  3UDF A;  5GAH C;  4OWW B;  4LFB Q;  4QQB X;  1X54 A;  1L1O C;  3L2P A;  3W1G A;  2I5M X;  3K80 C;  2VQE Q;  1AE2 A;  4Y7N H;  2F4V Q;  1HNW L;  1PVO A;  4L5S A;  2PQA A;  3CCM A;  4UPA A;  3CW2 C;  4HJ5 A;  4YWK A;  5C44 G;  1PH4 A;  1HNX Q;  2Z6K C;  4C2M H;  3K7U C;  3M4P A;  4TVA B;  3M9B A;  4YHH L;  1L2F A;  5AJ3 Q;  1I3Q H;  1JMC A;  2MNA A;  1OXV A;  5C4J H;  5K36 G;  1JT8 A;  2GN5 A;  4RMF A;  4X65 L;  3S1Q H;  1VQN A;  1YEZ A;  2K50 A;  2RF4 A;  3S1M H;  2VNU D;  2VQE L;  4LF9 L;  4HJ9 A;  5C3E G;  3OTO Q;  2Q2U A;  1VQA A;  2CWA A;  2N3S A;  3UE0 A;  3PIP A;  4JI0 L;  2GVB A;  4DR6 L;  1CKM A;  1B7Y B;  5M3F H;  1Q8K A;  3MXN B;  1GM5 A;  2R92 H;  4A3D G;  4DR1 L;  2QA4 A;  1P16 A;  3AFQ A;  4ALP A;  3UE1 A;  4DV6 Q;  2WB1 G;  1E7Z A;  2PQA B;  1JJ2 A;  4AYB E;  2ZJQ A;  3I4M G;  3S15 H;  2EQS A;  3ULJ A;  3W5O A;  3KFU A;  4PZ7 A;  5GRO A;  4GLX A;  4H02 A;  1OXX K;  5IYC H;  1HR0 Q;  1YIJ A;  4HIM A;  4DR3 Q;  2UU9 Q;  3K0X A;  1T9H A;  1UE7 A;  3PO2 H;  4A76 A;  4B3S Q;  4A3J G;  4DR4 L;  2BH2 A;  5C4X H;  1V43 A;  3VDY A;  2I5L X;  4DV1 Q;  2B29 A;  2K14 A;  4GNX A;  3H3V H;  1Z47 A;  3K8A A;  1ASY A;  3ZJY C;  2ATW A;  3S1N H;  1Y14 B;  2QEX A;  5M5Y H;  1KIX A;  5BR8 Q;  5C0X G;  1EIY B;  3HOV H;  4WJ4 A;  4R4I A;  1PH5 A;  2D0O A;  2E2H H;  1LUZ A;  1OTC A;  2WAQ G;  4DR4 Q;  5FJ8 G;  4LFC L;  3T1Y Q;  2XGT A;  1X3F A;  1IBK Q;  3HOZ H;  3FHW A;  1A0I A;  2E5L Q;  3RN2 A;  3TS2 A;  4X66 L;  5IYD G;  1KQS A;  3E0E A;  4O2D A;  3CCR A;  3RLO A;  4KHP Q;  3I4O A;  3M4Q A;  4GLA C;  4DUZ L;  4XIG S;  3TS0 A;  4Y52 H;  1KRT A;  3G71 A;  1Y1W G;  1OXT A;  2DGY A;  3U50 C;  2VQF L;  4A3M G;  4NXM L;  4X66 Q;  3FKI G;  3DLL A;  2AKW B;  4IOA A;  4LF8 Q;  1S3O A;  2E5L L;  3J7Z C;  4JBW A;  3RZD H;  3J80 i;  4OWT B;  4JV5 Q;  1VQE A;  2K75 A;  4A3M H;  3CC2 A;  2OTJ A;  4KHP L;  3CCS A;  3HKZ E;  4PMW A;  3OW2 A;  1HNZ Q;  2JA8 H;  2MO0 A;  3J81 c;  3OTO L;  1TXY A;  3CCJ A;  5C44 H;  3PIO A;  4UP8 A;  4IPH A;  1NE3 A;  2K5H A;  1FL0 A;  4OXP A;  5JEA G;  1G51 A;  3K81 C;  3S14 H;  5FLM H;  4C3I H;  2NVY H;  4DR2 L;  3PGZ A;  4BY7 G;  3PO3 H;  1LM0 A;  4B3R L;  5IE8 A;  1N36 L;  3NBH B;  2I0Q A;  1YHQ A;  1EOV A;  3I56 A;  3A0J A;  2OQ0 A;  4P72 A;  5ELO A;  4OO1 I;  4TQU S;  5C4X G;  1VQI A;  2VZA A;  4LFA Q;  5IP7 G;  1VQJ A;  2CCZ A;  3J80 c;  1HR0 L;  1IBM Q;  3M7N A;  3IRB A;  4JI1 L;  1PH6 A;  1V1Q A;  4OX9 Q;  2WP8 J;  3E9I A;  4JI6 L;  3EBE A;  1K9M C;  3CCL A;  2KBN A;  4IJH A;  5IY0 A;  4DR2 Q;  3J81 i;  1KXL A;  1W2B A;  5JJL A;  3KDF B;  1Q7Y C;  1AH9 A;  3BJU A;  2AMC B;  3G6E A;  4LF9 Q;  1WJJ A;  4LF5 L;  2K5V A;  1TWC H;  5IWA L;  4B3M L;  4PZ8 A;  4LF7 Q;  1E1T A;  1N34 L;  2B63 G;  2YV5 A;  2N49 A;  3ER0 A;  3CCE A;  3L0O A;  2Q2I A;  2OTL A;  4DR5 L;  3EIV A;  2R92 G;  3RZO H;  1Q46 A;  1FJG Q;  1PH8 A;  2IX1 A;  1SN8 A;  3CXC A;  2A1A A;  2F3I A;  1N9W A;  1VQG A;  3PCO B;  4GN5 A;  5GAD C;  3HOX G;  3L7Z C;  2PNH A;  1E24 A;  4YHH Q;  2VQF Q;  5LMN W;  1PV4 A;  4A93 G;  4LFB L;  2JA9 A;  1HR0 W;  5IYB G;  2UXB L;  1L1O A;  1R9T H;  1VQM A;  4AYB G;  5LMN Q;  1LYL A;  3CC4 A;  2VUM H;  3HOY H;  3PUX A;  4A75 A;  4A3B G;  2IY5 B;  2E8G A;  3UDX A;  3KOJ A;  3BZC A;  4YCU A;  2UXD L;  4A3J H;  4R4T A;  1XPO A;  4B3T Q;  2Z6K A;  4YY3 Q;  3F2D A;  2JA5 H;  4BA1 I;  4DR7 Q;  1YJN A;  1B70 B;  1JJC B;  4QL5 A;  2A19 A;  3J7A 5;  2WFW A;  1EYG A;  1X6O A;  1IBM L;  2JA8 G;  2B63 H;  1WFQ A;  4NPS A;  4JI2 Q;  2VL6 A;  4AH6 A;  4BBR H;  4JI0 Q;  1ASZ A;  3UDI A;  1SRU A;  2JA7 G;  1X3E A;  4A3L H;  2F52 A;  1N32 L;  4JI5 L;  3BU2 A;  4DNI A;  3CC7 A;  3KF6 B;  5LMN L;  3F8T A;  1X65 A;  3RR5 A;  4BBR G;  1VQ5 A;  4C3J H;  4K0K L;  3OYY A;  1CSP A;  2ZJR A;  3STB C;  3AQQ A;  3NEN A;  4JCV E;  1HNX L;  3TRZ A;  1JE5 A;  1AE3 A;  1TWG H;  4DV5 Q;  2QGQ A;  2AWN A;  2FXQ A;  4LF8 L;  4JC0 A;  2UUC L;  4R4O A;  1K0R A;  1L1O B;  1S40 A;  2B3G A;  2PI2 E;  2NZH A;  4NXM Q;  4A3B H;  3SGI A;  1JB7 A;  1XTD A;  5JJI A;  1YHA A;  4GOP A;  2DUD A;  4JI3 L;  5JEA J;  4DV2 L;  2MO1 A;  1EFW A;  3CQZ H;  1TWA H;  1X55 A;  2CQO A;  3CCQ A;  1QZH A;  1VQ6 A;  2UXD Q;  1PYB A;  5IP7 H;  2VY3 A;  4DV0 Q;  1SRO A;  1UEB A;  1D7Q A;  4DUY Q;  3H3V I;  4HIO A;  2JEA I;  4DAM A;  2HHH L;  2HQL A;  4DUZ Q;  1PA6 A;  4A3C H;  1NY4 A;  2L15 A;  1XNQ L;  1KRS A;  5FLX c;  1NMF A;  2D0P A;  1N33 Q;  3HFZ B;  2NN6 G;  3TEH B;  3TQY A;  3GTQ H;  3F2C A;  5GQO A;  2LXK A;  1VQO A;  4JI4 Q;  1QVF A;  2HT1 A;  3H0G H;  4GKJ L;  1UE1 A;  4LWC A;  1U0L A;  1N36 Q;  2KEN A;  2K52 A;  1D8L A;  1K3R A;  1HH2 P;  1XNR Q;  1G29 1;  4BBS G;  1N33 L;  5IYD H;  3AEV A;  2JA5 G;  3STB D;  4KLK A;  2Q2T A;  2HIV A;  1YJ9 A;  3ULL A;  4LF4 Q;  1Y1V H;  4POF A;  5HGQ A;  1PHJ A;  1K8A C;  4DK6 C;  3HOY G;  2JA7 H;  1SMX A;  2ES2 A;  4JI6 Q;  4OWX B;  1CKN A;  1MIU A;  3I4N H;  1BBU A;  3G4S A;  1I5F A;  1X56 A;  4GS3 A;  4A3G H;  2UUB Q;  2JK8 A;  1XNR L;  1RIP A;  1KL9 A;  4DV2 Q;  4JI3 Q;  3I4N G;  1Q1E A;  1J6Q A;  3T1H L;  3CMA A;  4PZ6 A;  4YY3 L;  5FJ8 H;  4B3R Q;  4UP9 A;  5IT9 c;  2VS1 A;  5M5W H;  1PH1 A;  4MZ9 A;  5IYC G;  2H5X A;  1VQL A;  1XNQ Q;  1IBL Q;  2UUA Q;  1NJI C;  4GOP B;  1NBW A;  3RLF A;  1N34 Q;  3T1Y L;  4LFC Q;  1HNW Q;  4LNQ A;  4DPG A;  1Y1V G;  4GN3 B;  1MJE A;  1UE5 A;  3I7F A;  3FP9 A;  1IBL L;  4DR5 Q;  3D0F A;  4DKA C;  4IFD J;  4A3E H;  3HOU G;  2MFI A;  2NVX H;  1OXU A;  3HKZ G;  1VQF A;  5IWA Q;  3E9H A;  5C3E H;  4X64 L;  1DGS A;  2IX0 A;  1IZ6 A;  2CKZ B;  3PUY A;  2D62 A;  1YIT A;  4DV7 L;  1HZA A;  1X9N A;  3KF6 A;  4JBM A;  1IL2 A;  5JJK A;  4UY8 C;  4A3I G;  2NN6 I;  5GAG C;  3CCV A;  4JI8 L;  3WWV A;  4QJF A;  4JI1 Q;  4DV4 L;  3S17 H;  2ZTD A;  1BKB A;  1SLJ A;  4BY7 H;  2C35 B;  4R4C A;  5M3F G;  3HOV G;  1M90 C;  1BBW A;  1EIF A;  4DV3 Q;  4BXX H;  2UXB Q;  1VQD A;  3I55 A;  4LUO A;  1BVS A;  2R93 G;  1S72 A;  3D31 A;  2EIF A;  1UWV A;  1O7I A;  4RG1 A;  2RHS B;  4KHZ A;  2NVQ H;  3KF8 B;  3U4Z A;  3KYH C;  1I94 Q;  1JJG A;  1VQ9 A;  4JI2 L;  5EAY A;  3PO2 G;  1IXR A;  4LF6 L;  4O0A A;  4A93 H;  4X6A H;  3AYH B;  3J81 j;  3GTP H;  2AWO A;  2OQK A;  3RLN A;  4HJA A;  2MQH A;  1MJC A;  1TWF H;  4KI0 A;  4P74 A;  3JAM c;  1Y1W H;  1Q86 C;  4DV3 L;  3GTO H;  2UXC L;  1SFO H;  1SR3 A;  1I6H H;  3K7A H;  3S16 H;  1YZ6 A;  4YCW A;  4OX9 L;  1EWI A;  2PMZ E;  1CUK A;  4DUY L;  1N8R C;  2F4V L;  3HOZ G;  3T1H Q;  1NMG A;  4IPD A;  4A3L G;  1TWH H;  1XPR A;  4DV5 L;  3U4V A;  2IHF A;  3CP0 A;  3S2D H;  2EXD A;  2WB1 E;  3KDF A;  4MTN A;  4R4Q A;  2E2I H;  1Q12 A;  1FVI A;  4JOI C;  4L5Q A;  5IYB H;  4A3K G;  1XMQ Q;  1FJG L;  3NEM A;  3HOW H;  2VW9 A;  4A3F G;  5ELN A;  3CPF A;  4NXN Q;  3GTM H;  2JA6 G;  2R7D A;  5DLQ E;  1N32 Q;  1VQH A;  1XPU A;  1C9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...