1N34L

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n34L00
4X64Q 1WCMG 5IP7G 2R93G 1M90C 3CF5A 3PIOA 3BZCA 2BH2A 3JC66 1N8RC 1TWHH 2RHSB 1PH7A 4BY7H 5C4JH 3CCJA 3S14H 1QZGA 4A93H 2UU9L 1NTGA 1EUJA 2JA8H 2JEBI 2UXCQ 2OCEA 4DAYB 2R92G 3MEFA 3J80i 2UUAL 2KBNA 1FJGL 5ELNA 1Q86C 1N9WA 3EN2A 2ATWA 1GVPA 2XTIA 4LF7L 1EYGA 4JV5L 1E3PA 2NVYH 2YU9H 3I56A 2JK8A 1IXRA 2N3SA 3UDFA 3CCRA 1YZ6A 1IZ6A 1C0AA 2JA5H 1MKHA 1BVSA 2OQKA 4QGUA 3J80c 1JMCA 5C3EH 3CD6A 1OXXK 3PO3H 2WAQG 4JI8L 4X62Q 1VQ6A 1GKHA 2H5XA 1N36Q 5M3FG 4L5SA 3F1ZA 1IL2A 4JI6L 1TWCH 2PQAA 1V43A 1PH9A 1HR0L 1YNXA 2ID0A 4JI4Q 1X6OA 1PH2A 1PH4A 4BXXG 2CCZA 1CKNB 4P73A 2DGYA 4IO9A 4JI7Q 4QL5A 2Q2TA 4IJHA 2R7ZG 3A74A 3OTOL 3U58A 2HQLA 5FLMG 4LF9L 1RL2A 3PF4A 2DUDA 1PVOA 4DK3C 3F2CA 1K9MC 4DR7Q 5JJLA 5H1SE 3J7A5 1BBWA 1HZAA 3EBEA 4P71A 4PZ8A 4K0KL 4DAMA 4DR4Q 2JA6H 3GTKH 3M4PA 2N49A 3I4MG 4IPGA 1HZBA 5C0XG 3K8AA 3U50C 4A3BG 4QQBX 2V1CC 1VQCA 4IPCA 4GKKL 1FL0A 4GLAC 1E22A 3G48A 2ASBA 3CP0A 4JC0A 4NXNL 3DLLA 1J5EQ 4DUYQ 2B63G 4LF8L 1LYLA 3GTQH 3S17H 4DR1Q 1Y1WG 1NJIC 5GADC 1OTCA 3PF5A 4GNXB 2IX0A 4LUVA 5K36G 1VQGA 1K3RA 2RF4A 3HFZB 1S3OA 1R9TH 2GVAA 4GLVB 4A76A 4PZ7A 3HOYG 3H0GH 3PUXA 1TXYA 2E2IH 2NN6I 1SE8A 2K5NA 1U5KA 1IBKL 2NVTH 1X54A 2UXDQ 1PFSA 3TS2A 5IYDH 3TQYA 3HOUH 1I94Q 5C4XH 4MZ9A 4GOPC 4P74A 1XPOA 4OX9L 3PO2H 1X3FA 5HGQA 4JYAL 1ASYA 1YJ9A 4H02A 3NBHB 1EIFA 2KHIA 2VW9A 3BJUA 5IYBH 1M1KC 3GTLH 4O2DA 2CWPA 3FKIH 3NENA 4JI8Q 4IPHA 4A4IA 1U0LA 3J81i 1X3GA 4JCVE 5ELOA 1YJNA 1SLJA 4X6AH 2F3IA 3RZOH 2A19A 3CAMA 5M3MH 2NN6G 1PHJA 1HR0Q 3HOVH 4R4TA 4DV3Q 4R4IA 2HHHQ 1L1OB 2HIXA 4DV1L 4LFBQ 2YTXA 5FLXc 2VQFQ 4JI5Q 1N32Q 3M4QA 4LF6L 1KC8C 3MXNB 2MO1A 4DPGA 4JI1Q 5GROA 4A93G 3J81c 1WI5A 2CFMA 4LF5L 2JA8G 2VQEQ 1IYJB 4LF9Q 2QGQA 3CW2C 1CSPA 2PI2A 1GO3E 5IWAQ 4KHPQ 1D8LA 4A75A 2YTVA 3I4NH 4BBRH 1IBML 2WB1G 1TWAH 4KI0A 1NBWA 3RLNA 4DV6L 2K75A 4B3TL 3CPWA 2VZAA 1UE5A 1AE2A 3M9BA 3A0JA 3T1HL 4GKKQ 2JA5G 5JJIA 3I2ZA 3HKZG 4HIKA 3ERSX 2HT1A 1XNRQ 1B7YB 2ZM6Q 1G51A 5GQOA 3T1YQ 3S1QH 1YHQA 1XPRA 1EFWA 4X65L 2A8VA 1Q12A 2VS1A 1E24A 1NE3A 4QY7A 2F52A 1VQKA 4PZ6A 4A3LH 2BA0A 4YCWA 2JA7H 3AQQA 4UY8C 4JI3L 4HJ9A 4DR5Q 4A3MG 3BU2A 2I5HA 1JJCB 4UP7A 4XIGS 1VQ8A 5AJ3Q 4X66L 1IBLQ 1KXLA 1SMXA 1B70B 3CQZH 2R7DA 5C44H 2Q2IA 4FDBA 4ME3A 1P8LA 3ER0A 3FHWA 4A3DG 4GOPB 3E0EA 4QIWE 1SRUA 1E7ZA 4IOCA 2KCTA 4DR3L 3S1MH 4GNXA 4EX5A 1HNXL 2FXQA 2EXDA 2I0QA 4AYBE 5LMNL 1HNZL 3UE0A 4YHHL 1XMOQ 4B3SL 1QVCA 1W3SA 1I6HH 1PYSB 1Y1VG 1Z9FA 2IT1A 3NEMA 2A1AA 4DV1Q 1A63A 4LF6Q 1P16A 3CCEA 2Z0SA 4ALPA 4DUZL 3M4OH 1YI2A 4LFAQ 1Q7YC 4B3RQ 3H0GG 3KLWA 2Y0SE 3RLOA 1BKBA 1I3QH 2UXBL 4UPAA 3HOWG 3KFUA 2Z6KA 4A3JH 1OXTA 4JI2L 2F4VL 4YWKA 1HJPA 1PA6A 3LGJA 3SGIA 4UP8A 3PCOB 1KQSA 3HOUG 1JJGA 3PO2G 1JE5A 3ICEA 4PMWA 4Y7NH 3F2DA 2LSSA 2K5VA 4DR2L 4GKJQ 1HR0W 5M5YH 2YTYA 3UDGA 1KD1C 2BH8A 4DV7L 1N33L 3FKIG 1L1OA 1CUKA 1EWIA 1K83H 2HIVA 2MO0A 2IHFA 2C35B 3K0XA 4BA1I 2KHJA 3KOJA 4YY3Q 5LMUL 4AQYQ 1VQLA 1JJ2A 4JBKA 4IJLA 3CCUA 4X65Q 4JOIA 2E2JH 2D0OA 4LFCL 3HOVG 5M5WH 1O7IA 3F2BA 2JE6I 3HOXH 4HIDA 3CCVA 5IP9G 5IP9H 1EOVA 2CWAA 4PG3A 3RZDH 2R93H 1WCMH 5E7NA 5IP7H 2B29A 3H3VH 1NMGA 2VUMH 1HNWL 3S24A 1X56A 1PYBA 4HJ5A 2RHQB 2R6GA 4DV4L 3ULJA 1CSQA 3I55A 3TS0A 3GTPH 1VQMA 3WWVA 1LUZA 1N34L 2R92H 3KDFA 2ALYB 4BBRG 3ZJYC 1K8AC 1OXUA 2MQHA 2UUAQ 1QUQA 1FJGQ 2ZTEA 1QVFA 4LF7Q 1VQ9A 3A5UA 4LUZA 4LF4L 4JV5Q 4NXML 1V1QA 1X55A 3ULPA 2IX1A 4HIMA 2AWOA 4YCUA 1HNZQ 1A8VA 2PI2E 1WJJA 4XTCS 4YHHQ 1A62A 1VQEA 2N78A 4POGA 3PIPA 4L5TA 4OO1I 2GVBA 3J81j 3K81C 4A3CG 2XGTA 5M3FH 3U4ZA 3W5OA 4A3LG 2BA1A 4JI6Q 5GAGC 4X64L 3KJPA 2GN5A 1VQFA 1PH1A 1UWVA 2JJQA 2AMCB 1Y14B 4UP9A 4B3ML 2JEAI 3NELA 3G71A 3K7AH 4DK6C 3GTJH 4BXXH 1VQ7A 4A3FH 3W1BA 4IFDJ 4GLXA 3RR5A 4BY7G 3RLFA 1Q8KA 1VQAA 1HZ9A 2PQAB 3RN5A 3TRZA 4TVAB 1VQ5A 2R7ZH 4C3IH 2UXCL 3OTOQ 1J6QA 1PH8A 3BZKA 2OTLA 3OW2A 3F8TA 3KYHC 4OO1G 3A5ZB 1T9HA 1VQOA 2EQSA 3CCQA 1VQNA 5EAYA 4K0KQ 3OYYA 1ASZA 3I4MH 1X9NA 3D31A 2QEXA 4BY1H 2K52A 2E5LL 1XTDA 2JQOA 1Q1BA 3L0OA 4OONA 1GM5A 1KHIA 4O0AA 4YCVA 4DR6L 1LM0A 1JT8A 4X62L 5C3EG 3PO3G 4NXNQ 3Q8DA 4JI0L 1N36L 1NY4A 4YWLA 4BBSH 4LF8Q 1CKNA 3S2HH 1NMFA 2ZJPA 1W2BA 1SN8A 3UE1A 4DV5L 1KRSA 4JBMA 1L2FA 2IY5B 1KIXA 1MJCA 2VNUD 5JJKA 3CMEA 4LW1A 1OXVA 4GN5A 4LWCA 4A3JG 3HOYH 5J3BA 2JA9A 4IFDI 3DM3A 4AIMA 2OQ0A 5IYCH 2IHEA 3H3VI 2K4KA 2UUCL 2RCNA 5M5XH 1IBKQ 4DR7L 5IT9c 4IPDA 1AE3A 1CKOA 3PV0A 2NVQH 3PUWA 4LF4Q 3S15H 3EIVA 1VCIA 2OTJA 3AYHB 3J7ZC 2LXKA 3CCLA 4OX9Q 1I50H 1LTLA 3GTMH 4DR4L 3KF6B 4JBJA 2JA6G 1VQIA 4JYAQ 1WFQA 4A3KH 2Q2HA 1C7YA 5FJ8H 2D0PA 1RIPA 1S40A 3HOXG 5C0XJ 4C3JH 3G6EA 4DUYL 1VQ4A 4JG2A 4A3IH 3U4VA 4GNXC 1SR3A 1AH9A 3CCMA 4B3MQ 2VUMG 2WB1E 4MNOA 4DV2L 4P72A 2LXJA 1CKMA 3CMAA 1DGSA 1BBUA 3VDYA 1MJEA 5IY0A 3S1RH 3GO5A 4LF5Q 3HKZE 5JEAJ 5DLQE 1XNQL 5LMNW 2WFWA 2UXDL 1E1OA 1Q1EA 2KENA 3B6YA 3S1NH 4GN4B 3STBD 4A3GH 1IBMQ 3CXCA 5IYDG 3G4SA 1WOCA 2Z6KC 1VQPA 1I94L 2MFIA 3CCSA 4DV6Q 2OWOA 4B3TQ 5C4XG 1I5FA 3ULLA 2E5LQ 2ZJRA 1E1TA 3GD7A 4OXPA 2ZTDA 2VL6A 2N8NA 3UDIA 3T1HQ 4A3EH 3S16H 1KL9A 2CQOA 4RG1A 4DR6Q 2EIFA 1EQRA 5IYBG 2E2HH 4AH6A 4QJFA 2UUBL 4JI0Q 3HOZH 1YBYA 4Y52H 1YHAA 4L5QA 1VQHA 5C0XI 1QVGA 1PH5A 1L1OC 2K50A 3PGZA 4J15A 4DKAC 4NB3A 4R4CA 3HKSA 5M3MG 1TWGH 4DV3L 4DV5Q 5GAEC 2HHHL 4L5RC 4JOIC 2YYZA 1VQJA 2VQFL 4JI5L 4A3FG 4LFBL 1N32L 2ZTCA 3D0FA 4JI1L 2I5MX 4A3MH 3L2PA 1Q81C 4JI3Q 2VQEL 3S2DH 2R7FA 4HIOA 2Q2UA 2UUCQ 1XMQL 1Q46A 1JB7A 5IWAL 2D62A 4X66Q 4KHPL 1OXSC 2NZHA 3PUVA 3I4NG 3AFQA 2WAQE 1QZHA 4A3DH 4IOAA 2VY3A 4BY1G 2QA4A 1D7QA 4KLKA 4YWMA 4OWXB 1YVCA 1MIUA 3KJOA 3GTGH 1B8AA 3TREA 3E9HA 4DR3Q 4DV0L 1HNXQ 3KF8B 4RMFA 4APVA 1XNRL 1YITA 2ZM6L 1X65A 5LMNQ 2K5HA 3T1YL 1K0RA 1S72A 4POFA 4BBSG 4B3SQ 1X3EA 3M3YH 3H15A 1EIYB 1Y1VH 3M85A 3I7FA 4R4OA 4GN3B 3JAMi 3STBC 5BR8L 4DV2Q 5JEAG 2AKWB 4DUZQ 2NVXH 1KAWA 2JA7G 4OWTB 4DR5L 5IYCG 3HOWH 2UXBQ 1PV4A 1G6PA 2WP8J 3KF6A 3RN2A 5AJ3L 4GOPA 4JI2Q 1IBLL 3AFPA 2ZJQA 3I4OA 2F4VQ 4C2MH 1G291 2B3GA 1A0IA 2PNHA 4C3HH 1UE6A 3JAMc 1HH2P 4P75A 5FLMH 1UE7A 1YEZA 3PUYA 1V9PA 5C44G 1SFOH 2AWNA 3W1GA 1EQQA 1KRTA 4DR2Q 4A3KG 2YV5A 1YJWA 4HJ8A 5GAHC 3CC4A 5FJ8G 2UUBQ 4DV7Q 3PSIA 3CC7A 2E8GA 4LUOA 1FGUA 4R4QA 1N33Q 1HZCA 2UU9Q 4A3BH 1XNQQ 4BA2I 5LMUQ 1C9OA 4HJAA 4A3IG 3K7UC 1YIJA 2K14A 1XMOL 4JBWA 2NZOA 3UDXA 4LFCQ 4DNIA 1SROA 2B63H 2I5LX 3RNUA 3M7NA 1Y1WH 3GDEA 1FVIA 4LFAL 3K80C 4B3RL 1HNWQ 3CC2A 5IE8A 1VQBA 4JI4L 4AYBG 4DV4Q 1XMQQ 2AHOB 1H95A 3CPFA 2ES2A 4EQ5A 4GS3A 1WYDA 4JI7L 1N34Q 4A3GG 2KCMA 1GD7A 4TQUS 4KHZA 4WJ4A 3PUZA 1PH6A 1VQDA 4NPSA 3L7ZC 2MNAA 4OWWB 1UEBA 4GKJL 1Z47A 4A3EG 1Q82C 3KDFB 4DV0Q 2Y0SG 2L15A 4NXMQ 3E9IA 1VS0A 1K73C 3HOZG 1UE1A 1L0WA 1QUQB 4LNQA 1XPUA 4MTNA 4YY3L 4AQYL 1TWFH 3AEVA 3IRBA 5HY6A 1PH3A 1XJVA 3TEHB 2PMZE 3GTOH 4A3CH 4R1JA 3FP9A 1J5EL 4HJ7A 5BR8Q 1K8GA 1YHBA 2CKZB 4IFDG 4WJ3M 4DR1L
chains in the Genus database with same CATH superfamily
2R93G 2XSCA 4O42A 1Q3LA 5EKIA 4XQJA 3JC66 1N8RC 1TWHH 1PH7A 2DNEA 4BY7H 3S14H 5IOCA 1EUJA 1V1PA 1X3PA 3KF8A 2R92G 1Y8PB 2Z1CA 5M3FB 2A68D 1FJGL 4KY6A 1Q86C 1N9WA 3EN2A 2F0JA 3K7AB 2SOBA 3J81E 2JK8A 2O5JC 2F3WA 1YZ6A 3OWFA 1C0AA 2JA5H 1MKHA 4C2MB 4C3HB 4QGUA 3J80c 3CD6A 5CORA 2TMPA 1GKHA 1TWCH 1EY6A 1HR0L 4HN7A 4JI4Q 2LKVA 1HCZA 1PH2A 3DWQA 2F1MA 4P73A 2PPBC 2Q2TA 4IJHA 4QUFA 3I70A 3OTOL 1LTID 2HQLA 5L37A 5EBDA 3PF4A 1PVOA 4DR7Q 5JJLA 3Q6SA 4IUUA 3J7A5 1S5CD 1A3UA 1BR9A 4A3BG 4CHTB 1RKNA 2EPBA 4IPCA 2JYOA 1LV9A 5CV6A 1CA5A 1FL0A 3G48A 2ASBA 1J5EQ 2F0TA 3A7LA 3S17H 5CV4A 2K6AA 1VF7A 4FF2A 2IX0A 3GTMB 1GUTA 1K3RA 1IHZA 1VQGA 2RF4A 2Z9HA 4GLVB 1TWFB 2X6LA 3H0GH 3PUXA 2DJGC 1EWHA 1X54A 2LFNA 1JB3A 1PFSA 2PYKA 3MA2B 2RSNA 5DM63 1JC7A 3HOUH 1CQFA 4GOPC 1XPOA 2CH4W 3PO2H 1X3FA 5HGQA 1UEAB 1AEXA 1F2YA 1YJ9A 4KV6A 4ABNA 1EIFA 2VW9A 3BJUA 2JA8B 1U0LA 5ELEA 4ZAIA 1X3GA 2F3IA 2RDHA 1JCKB 5DAUA 3HOVH 1HR0Q 2WB1B 2F0WA 2YU9B 4KY5A 1T5XD 2HIXA 5IGBA 4LFBQ 2VQFQ 5FLXc 1D5MC 1ENAA 2CFMA 4LF5L 2VQEQ 3CW2C 3MC0B 1CSPA 1XX8A 1LTSD 2SDFA 2OT2A 4KI0A 1NBWA 3RLNA 2VZAA 5IGDA 1LT6D 5FOBB 1BDOA 3EJIA 1CK1A 4H44C 1YHQA 2F4IA 4FF1A 1Q12A 2VS1A 1IYVA 1E24A 4QY7A 2F52A 2LMCB 4A3LH 3WOFA 2F0PA 4YCWA 4JI3L 4DR5Q 3SXHA 4A3MG 3KBGA 4UP7A 1UUPA 1EU3A 5AJ3Q 1SMXA 1B70B 4FNFA 1Y1VB 2Q2IA 4K14A 4ME3A 1P8LA 3ER0A 3FHWA 4A3DG 4ZKCB 3E0EA 4QIWE 4IOCA 2BCOA 3V05A 4FF3A 4UHVA 4K2KA 5EPJA 2I0QA 4F8MA 3KLRA 4NMZA 4XDXA 2KJXA 3A8IE 3UE0A 4B3SL 1W3SA 1PYSB 2IT1A 1SE2A 3NEMA 1A63A 2Q8IB 1SFOB 1O7LA 3KLWA 2Y0SE 3RLOA 4HSPA 1X32A 4UPAA 5EPLA 2Z6KA 2NWGA 1OXTA 3X3MA 4R9WA 1HJPA 1PA6A 4C56C 1KQSA 3VYSA 4Y7NH 2LSSA 5M5YH 5ELBA 3UDGA 3TP6A 1E0BA 1N33L 5IODA 2IHFA 1PTOD 2C35B 1XNQL 5D65A 1HXYD 5FKAC 2E2JH 2WINB 2D0OA 4LFCL 4BBRB 2JE6I 4HIDA 4DXGA 1EOVA 3TBIB 3J80L 3H3VH 3S24A 1PYBA 4HJ5A 1QJOA 1SBBB 2R6GA 3ULJA 4HMIA 3HGBA 3TS0A 3GTPH 1BQQT 4J1MA 1EQVA 3NQIA 3VYTA 3GTOB 5KEEA 3H3VC 3DXJC 5JOBA 4LF4L 4HIMA 4M1UB 1BO0A 4POGA 4L5TA 2D2CC 3CQZB 4YIJA 4A3CG 2XGTA 1BF4A 2BA1A 3C1FA 1SEBD 1Y14B 3NBIA 4BXXH 1VQ7A 1EZ6A 2EDGA 2PZUA 4BY7G 1Q8KA 1DOKA 1HZ9A 2A73B 3TRZA 3A56A 2R7ZH 4C3IH 2KHSA 5C3EB 1J6QA 1SAPA 3GV3A 3HRZC 1PH8A 3KBXA 3KYHC 2L1BA 2F0EA 2MP1A 4QIWB 3E6ZX 3P7JA 5CGKA 3OYYA 4DGZA 3I4MH 2OXPA 1XTDA 4A3JB 4NW2A 3L0OA 3QWNA 1KHIA 2HD3A 5FK9C 2NZ1D 4YWLA 5AFWA 1TT2A 2IY5B 1ILPA 1KIXA 1K83B 5JJKA 2VNUD 3CMEA 4LW1A 1IKMA 4GN5A 4HCSA 4IFDI 3DM3A 2RDGA 3HOXB 2K4KA 5FLXL 4RGMA 1DOLA 5JAVA 5IT9c 2B2VC 4LF4Q 3CCLA 2G9DA 4JYAQ 1KDAA 3ND9A 4I7AA 3G6EA 3FRPB 4A3IH 4GNXC 1J8IA 3K6OA 5C4XB 4KJOA 4MNOA 2EXZA 4DV2L 4P72A 3HP3A 1O7ZA 4HCEA 3R2TA 1BBUA 2B2TC 5IY0A 2BDNA 1WD0A 1I4GA 2WFWA 2UXDL 2A6HC 1Q1EA 2F0DA 1SNOA 4GN4B 2F0LA 1WOCA 4EQNA 1GHJA 4B3TQ 4A3FB 4OXPA 3BG3A 3UDIA 1Z7TA 4A3EH 3S16H 2CQOA 2E2HH 2EY1A 2F03A 3A7AB 1B9NA 2NYZD 1SYCA 1L1OC 2WV6D 5FO7B 3I4NB 4NB3A 1EWCA 4L5RC 2EY2A 1TWGH 4JOIC 4BY1B 4WRDA 4XYOA 2CW0D 2D9UA 1FGBD 2L11A 4FO2A 5IWAL 2D62A 4ILWA 2NBFA 5IIFA 4IOAA 3T53B 1D7QA 2K7VA 4YWMA 4OWXB 1YVCA 1MIUA 4IALA 5BN4A 4DR3Q 3GP7A 1HNXQ 4RMFA 2ZM6L 5LMNQ 5M5XB 4ID6A 3T1YL 1K0RA 5KYLA 1Y8OB 2A68C 3M3YH 3M85A 3S15B 3I7FA 4R4OA 4GN3B 3Q0AA 5C44B 4DV2Q 5IGGA 1PZID 4A3KB 4DUZQ 4N9TA 1KAWA 4OWTB 5IYCG 3HOWH 1G6PA 3ZYYX 4GOPA 2R3ZA 3I4OA 2B3GA 3JAMc 1UE6A 1HH2P 2EYOA 3EVQA 1V9PA 3NQTA 3W1GA 4ZUIA 1KRTA 1YJWA 5GAHC 2K03A 3OIPA 2VB3X 5C5LA 2E8GA 4LUOA 5D3DA 1ENFA 4A3BH 5G3LF 4HJAA 1C9OA 1YIJA 3K7UC 4DFAA 1PXUA 1SYFA 1S5FD 2I5LX 3MXUA 2L5TA 4EQPA 4X3KA 4FVMA 2F0FA 3CC2A 1STHA 1M4VA 4FP5D 2ES2A 1ICWA 4A3GG 1H9SB 2A74C 2D5DA 1PH6A 4OWWB 1WCMB 3M7GA 4GKJL 2EJMA 1PLFA 4PNYA 2L15A 2K28A 1STNA 1G6ZA 3HOZG 1STEA 1UE1A 4LNQA 5DNFA 1XPUA 1LTRD 4MTNA 4TRDA 3IRBA 5HY6A 1PRTD 3FP9A 4CGYB 1YHBA 1WTPA 4DR1L 2OF1A 3RMHA 3PIOA 3GTGB 3BZCA 2BH2A 3BVMA 1RDPD 2F0SA 2RDFA 4FXKC 1ICFB 2UXCQ 1NCVA 4X3UA 3D4DA 3BZDB 2UUAL 3H91A 4K5WA 1GVPA 2XTIA 5FLXE 4CJ0B 1SE4A 3T4AC 1E2VA 2EYHA 1IXRA 4XQNA 3K57A 3OOCA 2MUYA 3MXGA 2XN9C 2WAQG 4JI6L 2KUMA 1PH9A 1K8MA 4BXXG 4LMQD 4R8IA 2R7ZG 4LF9L 2B39A 4K2LA 1ENCA 1RL2A 2DUDA 4DK3C 3F2CA 2EY6A 4K0KL 3EBEA 4DR4Q 2JA6H 3GTKH 3I4MG 3K8AA 2IW3A 2R61A 1VQCA 1L0YB 3HOYB 1SJED 2WKCA 4L63B 3MXPA 4J6HA 4GLAC 1HFGA 3Q24A 3CP0A 3NE5B 4DUYQ 2B63G 4PMCA 1VF5C 4LF8L 3GTQH 5BN3A 4DR1Q 1Y1WG 1K8OA 1OTCA 2P5ZX 3T51B 3BYTB 2K33A 2X6GA 1I50B 1RHPA 4MHEA 1JICA 3TN2A 4F88A 1DXMA 2IJ0A 1TXYA 3MWYW 1SE8A 4QMGA 1MSHA 4C3JB 2NVTH 1YNND 4X3SA 4PMBA 3TS2A 1O80A 2ZXOA 1FYCA 5EQ0A 1TWHB 1B53A 3VR6A 3A55A 3GTLH 5IYBH 3TP5A 1PTOH 4JCVE 4JVZA 1YJNA 1SLJA 3CKIB 4X6AH 2NN6G 3NXWA 2EJFC 4DAYA 1E2WA 1F2LA 4DV3Q 4DV1L 1EY7A 4JI5Q 3M4QA 4A93G 4JI1Q 1PTOC 4CKBA 3C46A 2JA5B 3TP8A 4HAEA 4LF9Q 3R93A 3VR5A 1GO3E 2O5IC 4KHPQ 4A75A 5C5MA 3MZ5A 1TWAH 2JP1A 4RFBA 4RKLA 2K75A 1UE5A 3M4YA 3JAML 3GQBA 1Y8NB 2BE5D 1GJXA 3HKZG 2HT1A 1XNRQ 3MFGA 1LTBD 4XT3B 3S1QH 2MPMA 4H13C 1EFWA 1O7YA 5A2QL 1QE6A 3FPPA 4LJZC 4C1NK 5JJZA 2BA0A 1M8AA 1EYDA 1B4OA 3AQQA 1QB5D 2ICEC 2B2VA 3HS0C 1EY0A 4CDCC 4UAIA 4X66L 3S17B 3PMFA 2IPKD 3QG1A 2F3VA 4CDEC 4GOPB 3OIQA 3K5OA 1SRUA 2EOTA 3H0GB 3S1MH 4GNXA 2EXDA 1STYA 3VA7A 2HDLA 5CV8A 1CZGA 4YHHL 1XMOQ 1MI2A 3BDCA 3FEWX 3HOUB 2PCFB 3PO2B 2B2TA 4DV1Q 5J22A 4BS9A 1Z6HA 1MGSA 5C4HA 1YI2A 4LFAQ 1Q7YC 1I3QH 1BOSA 2I46A 3HZXA 4IN3A 3HOWG 3KFUA 5KNBA 1ZXTA 4JI2L 2F4VL 2EYMA 3HOVB 4N8X1 1JE5A 4KMUC 3ONAB 4NDXA 3F2DA 4DR2L 3BDOA 5E1FA 2BH8A 4DV7L 3FKIG 1L1OA 2MO0A 1EWIA 3KOJA 4AQYQ 2BOSA 1D1IA 4JOIA 1VDZA 5M5WH 1A6XA 5IT9E 1ZYRD 3HG9A 2CWAA 5E7NA 5IP7H 2L12A 3I72A 1HNWL 1X56A 3D6CA 1EZ8A 3I55A 4ULLA 4KY7A 5C4ZA 3URYA 4OIKA 2ALYB 1K8AC 2MQHA 1PYWD 1PZKD 5LL6X 1FJGQ 1G2TA 5KGUA 2F0IA 2AUJD 1EFID 2F0HA 4NXML 3ULPA 5F2DA 1A8VA 2V4DA 1CM9A 1W6KA 1WJJA 4YHHQ 3D3RA 1KNEA 1VQEA 3PIPA 4Q5VA 2L4NA 4DNRB 5M3FH 3U9SA 4L8JA 2K05A 4X64L 2GN5A 1KAAA 1PH1A 2JEAI 4PV1C 2AMCB 4I65A 3NELA 3G71A 3K7AH 3FMCA 3GTJH 3R2IA 4IFDJ 4GLXA 3OSOA 3RN5A 3DWPA 1VQ5A 4DAVA 4CKCA 1BCPD 3OTOQ 3PO3B 2OTLA 3F8TA 4OO1G 3A5ZB 2L55A 4UDUC 1VQNA 2CW0C 1X9NA 3D31A 2QEXA 4PQXA 2K52A 2K5DA 5C0XH 2E5LL 1Q1BA 4QCLA 1I4QA 1LM0A 3QIAA 4X62L 1N36L 1NY4A 5EKKA 1SNCA 1CKNA 2QDLA 3KLSX 1JQYD 2A5HA 5DEHA 4JBMA 1S5DD 1OXVA 4LWCA 1KNAA 3FVQA 3K0YA 5J3BA 5I6WA 5IYCH 3MAQA 2IHEA 3H3VI 2F0MA 3NPPA 1MD2D 5TSSA 1AE3A 1AW7A 1CKOA 1G8ZD 5D3IB 3EIVA 1VCIA 3GTMH 2DN8A 1LTLA 1QWYA 3KF6B 2JA6G 4KD4A 1R9TB 5EBCA 2Q2HA 3GTPB 2D0PA 1GUGA 5CV5A 2E2IB 2KOLA 1VQ4A 3JAME 3CCMA 2VUMG 3PIO3 1ZKOA 5JVG3 1CKMA 3FDTA 3CMAA 1DGSA 1TY2A 3S1RH 4LF5Q 3HKZE 5JEAJ 5DLQE 4CKEA 5LMNW 4XYQA 1HHVA 1TS2A 1E1OA 1F2ZA 2KENA 3B6YA 4TKOB 3RZOB 3STBD 4A3GH 4R8NA 4XQQA 5M3MB 1I94L 1SYBA 2E5LQ 2ZJRA 1E1TA 2N8NA 4C3IB 2EIFA 5IYBG 4Y52H 1JJGA 4AH6A 3HOZH 1YBYA 2FMCA 1YHAA 4L5QA 1QNUA 1QVGA 1F77A 2K50A 4DKAC 4R4CA 1B9MA 1SMYD 5GAEC 2HHHL 2YYZA 1N32L 1AN8A 4RCNA 2A6ED 2HQEA 4MN3A 5J1ZA 4JI3Q 3S2DH 1KABA 1GOZA 1PRTC 1Q46A 1JB7A 1DM0B 3LWEA 1JWSD 4QF4A 3EQLC 4G4KA 1D2BA 4KLKA 3TZUA 1QNKA 3KJOA 2JA7B 1V1PB 4DV0L 1A3VA 3KF8B 4APVA 1YITA 1X65A 2K5HA 1TU2B 1S72A 4BBSG 2KA7A 4B3SQ 1X3EA 1EIYB 1Y1VH 4FYDA 5A35A 1CTMA 3OMCA 1SNPA 2NVXH 1FD7D 1PTOF 5ELDA 4A3IB 1IBLL 2VXWA 1G291 2PNHA 1I6HB 4DU9A 4P75A 1UE7A 3PUYA 1SFOH 1EQQA 2F0GA 2VB2X 1QG7A 1TKWB 3CC4A 2DY7A 3M4OB 4RWSC 5FJ8G 1N33Q 3CC7A 4R4QA 1HZCA 4BA2I 1XNQQ 2KEEA 1SYEA 2H1EA 2NZOA 4LFCQ 4I7ZC 4DNIA 2XVSA 2Z4IA 2B63H 1JOOA 3M7NA 1Y1WH 2E75C 1FVIA 1I6VC 1U4PA 3K80C 4A3EB 3S16B 1RF2D 1JWUD 4B3RL 2Y0SB 3BDLA 4AYBG 1HRJA 1V1OA 3CPFA 1WYDA 1DJRD 4K8IA 4JI7L 5IGCA 4TQUS 1GD7A 4DA2A 1TWGB 4KHZA 1AFPA 1VQDA 4NPSA 2PO4A 3L7ZC 3RZDB 2R93B 2HCIA 5CV9A 1Z47A 1Q82C 1CA6A 4DV0Q 4HTHA 2IL8A 5ISRA 2K04A 1EY5A 4YY3L 2EE1A 3GTOH 1YNNC 2PMZE 4R1JA 1C8CA 2R92B 2NUCA 1K8GA 5I2XA 2CKZB 4WJ3M 2NN6H 5IP7G 3CF5A 4LK1C 1SNQA 3L3OC 2B2UC 4DAPA 1KLGD 3KLSA 5C4JH 4KHVA 4A93H 3DMUA 4RCOA 1NTGA 4U68A 5ELNA 1EY4A 2IX3A 4LF7L 1EYGA 1FR3A 4JV5L 2NVYH 2E74C 1LABA 5CR3A 1K3BC 2N3SA 3CCRA 1ET9A 1IZ6A 1R4QB 2ICIA 3H09A 5EGTA 4CJ2C 1BVSA 1C48A 4DNTB 3J7AV 5C3EH 1U9RA 2H5XA 5M3FG 4L5SA 5LHY1 3D8GA 3K5LA 1V43A 2ID0A 5KNDA 2BE5C 1D5XC 4FXDA 2CCZA 1CKNB 3NK9A 4A3BB 4JI7Q 3RD4A 4C3HG 1AP0A 1R4PB 3A74A 4OL7A 5J39A 5FLMG 4B9XA 2Q8TA 1DYQA 1K9MC 5EJWA 3ND8A 5H1SE 1EL0A 1BBWA 2RKSA 4PZ8A 2C5CA 4V190 2KCCA 4DAMA 5HURA 3M4PA 4RGNA 3BVGA 1H9MA 1ESRA 5C0XG 3U50C 3MVVA 3VYRA 1BBXC 2V1CC 4GKKL 4NXNL 5C3XA 4ME5A 1ONLA 1W6JA 5CV7A 2NVQB 3ERQA 3PF5A 5K36G 2QKIC 1S3OA 1EY8A 4E6IA 1PDQA 5G3LD 2KCNA 5M9OA 2K5NA 4K6LA 1U5KA 1IBKL 2HDMA 4XT1B 3J80E 2F0UA 2UXDQ 1PMRA 1SDFA 2J4XA 3KUPA 5C4XH 3CU7A 2MJ8A 4OX9L 1ASYA 1CI3M 4H02A 1G91A 1M1KC 4O2DA 2CWPA 3FKIH 4A4IA 4IPHA 3J81i 3PIP3 2C9OA 3OPOA 3QR8A 5ELOA 4L6TB 1ZEQX 3BS1A 2A19A 3W3AA 4R4IA 2YTXA 4LF6L 2MO1A 4OIJA 1Q90A 1WI5A 2JA8G 1IYJB 3MHBA 1MSGA 3E0JA 1ZYRC 2EVBA 5IWAQ 3I4NH 2NTSA 4OEMB 1IBML 2WB1G 2NTTA 2MGSA 2JXMB 4K5XA 5CC4A 4DV6L 3CPWA 1AE2A 1WTVA 3TP7A 3M9BA 4GKKQ 3T1HL 1IW7D 4A3MB 3V2TA 1WTOA 3ERSX 2ZM6Q 1G51A 3T1YQ 2NB0A 3SK8A 4H7BA 3QO2A 2A8VA 1NE3A 1F9QA 2I07B 1VQKA 4PZ6A 4A3DB 4HEDA 4RH6A 2K5WA 4UY8C 2I5HA 1JJCB 4XIGS 1XYIA 3J81L 3GTQB 1DZ1A 1LO5D 2R7DA 5C44H 4FDBA 4OO1H 1E7ZA 4IQZA 2KCTA 3GV6A 4EX5A 4HMJA 4AYBE 3J7AF 1BCPC 4KKSA 2PZTA 1QVCA 2ZXRA 4KKTA 1Y1VG 2A1AA 4LF6Q 1A2TA 5DM73 4J8QA 5HGTA 5CBAE 1BKBA 1PTOB 1F2MA 2UXBL 2PW7A 1LTAD 1PRTF 3H94A 1RJTA 3LGJA 1SXTA 2E2DC 3SGIA 2DJFC 1C4QA 2SEBD 3T56B 1TY0A 3ICEA 3EFXD 1HFNA 2K5VA 3DWAA 4GKJQ 1HR0W 2YTYA 1KD1C 1KDCA 2HIVA 1EIHA 2UU9L 3A8KE 5LMUL 4JBKA 2GA4B 2J0TD 1O7IA 4ZUJA 1XXGA 3QB3A 3CCVA 4ZLTF 5IP9H 4PG3A 3C1EA 1WCMH 2B29A 1WTRA 2VUMH 1NR2A 2RBMA 2RHQB 4DV4L 1CHQD 1DONA 1VQMA 4P2CB 1LUZA 3WWVA 1N34L 1ILQA 3KDFA 4K6DA 3OMGA 4BBRG 3ZJYC 5IGFA 1OXUA 1EU4A 4G7ZC 2UUAQ 1MBYA 2WKDA 1VQ9A 4ZYSA 3T16A 4LUZA 1X55A 2IX1A 2AWOA 4YCUA 1RCVD 4BY7B 4N9PA 3S14B 1WTHA 1EYCA 1STAA 1SE3A 3K81C 3Q23A 3W5OA 4QB4A 3I4LA 2BDOA 1STBA 4JI6Q 1UWVA 4B3ML 3S1MB 3W1BA 3MTSA 2K01A 2SNSA 3RR5A 4DN4M 1VQAA 5JPMC 2B2WA 1JWMD 3NP8A 1LTGD 4NP5A 1T9HA 2FINB 1TWCB 2EQSA 4IUTA 3CCQA 5EAYA 4K0KQ 2A6EC 1O78A 2DNCA 3VR3A 1I3QB 4FF4A 5I9OA 2F0KA 4KJNA 4DK0A 4OONA 1GM5A 3UI2A 2QDBA 3MEHA 4O0AA 2O4XA 3R3OA 4YCVA 5EPKA 5C3EG 4DR6L 3Q8DA 2M2LA 2KQ3A 4BBSH 4LF8Q 3S2HH 1NMFA 2M9VA 3DEOA 3IKJA 1SN8A 1IL8A 1KRSA 1L2FA 1RTOA 1MJCA 2CQAA 1HUMA 4A3JG 3EA6A 3HOYH 2JA9A 1B3QA 2OQ0A 1EYAA 3OW7A 1CQVA 4DR7L 1U4LA 1NR4A 4IPDA 1WTXA 3PV0A 1EEID 1LT3D 2LXKA 1I50H 4JBJA 1VQIA 1WFQA 1C7YA 2FFKB 5FJ8H 1AZQA 3HOXG 1SYDA 4C3JH 3IFDA 3U4VA 3QOJA 3SK5A 2B2UA 4B3MQ 2WB1E 1A3TA 5C6AA 1MJEA 1A2UA 4ZCKA 3A54A 3NBHA 5D14A 3S1NH 1NAPA 2OWOA 3CCSA 1BUVT 5C4XG 3GTJB 2TSSA 4DR6Q 1RD9D 4QJFA 2Z8LA 1I4XA 5BN5A 3WDNA 5C0XI 3MXNA 4IUPA 3E3XA 3HKSA 4KD3A 4OHJA 1S4ZA 5CMDA 1CT1D 1VQJA 2VQFL 4A3FG 4LFBL 1SNDA 2ZTCA 3D0FA 1HTPA 1GUWA 2I5MX 2LS01 2VQEL 4HIOA 2Q2UA 1II3A 1XMQL 3K5NA 4X66Q 4B08A 1QOHA 1V8QA 3PUVA 3I4NG 3AFQA 3C2PA 2WAQE 1TIID 4BY1G 2QA4A 1PZJD 2EJGC 2EYPA 3U9OA 1YNJD 3TREA 3E9HA 2G5DA 1LACA 1SNMA 2AQ2B 4G57A 1KDBA 4POFA 4FXGC 4C1NI 3QJYA 3LWUA 3IAYA 4ODGA 5JEAG 1SJHD 3CHBD 5KNCA 1HA5A 4DR5L 4G7HC 1PV4A 5AJ3L 3RUZA 4DXFA 4JI2Q 3AFPA 1NSNS 4ZRZA 2F4VQ 4C2MH 3O13A 1WTQA 4C3HH 1A0IA 5FLMH 1YEZA 3I73A 2K32A 5C44G 3NWSA 4A3KG 4DR2Q 2YV5A 2F0QA 2FJ2A 4U673 3S1RB 4DV7Q 3PSIA 2XRQD 2KEDA 1JT8A 3AMUA 2K14A 1B2TA 4A3GB 3BVZA 3RNUA 1STGA 3IL8A 3GDEA 4Y7NB 3WOEA 5JVH3 1E2ZA 3D4RA 1HNWQ 5K36H 1SYGA 5M5YB 5IE8A 2RSOA 3HOZB 1XMQQ 2AHOB 4GS3A 1PRTB 2H4OA 2E2JB 1LTTD 3A8JE 1H9JA 1T5EA 1UEBA 2RQXA 2O2LD 3KDFB 4NXMQ 3E9IA 3S2DB 3NHHA 1VS0A 2E76C 1K73C 1VMCA 4KN4C 1TWFH 1BCPF 1NUCA 3W2DA 4RKBA 1BXTA 4K8JA 4HJ7A 3J7YW 5IP9G 1CZWA 4X64Q 1WCMG 3I8ZA 1M90C 1JE4A 2CHBD 5E3FA 3SK4A 3P20A 2RHSB 2PZWA 3CCJA 2A69D 1QZGA 5A2QE 2JA8H 2JEBI 2WAQB 2OCEA 4DAYB 3MEFA 3J80i 4H0LC 2KBNA 5EKLA 2ENBA 2ATWA 2NVXB 1E3PA 2YU9H 3I56A 3PQIA 3UDFA 3L9AX 5E4WC 1FNVA 2OQKA 1JMCA 4KTAA 2R7ZB 3PO3H 1OXXK 4JI8L 4X62Q 1VQ6A 4ZKBB 1N36Q 1A15A 3F1ZA 1IL2A 2XRSD 2JSOA 2PQAA 3SEBA 4EGVA 1YNXA 1AZPA 1X6OA 1IW7C 3I4MB 1PH4A 1F9PA 2DGYA 4IO9A 2J7ZA 1BNZA 4QL5A 5FO9B 3U58A 4IUQA 3SK6A 3FPUB 4XXEA 1X3QA 2B63B 3TMEA 2N55A 1Y1WB 3P75A 1HZAA 1S5BD 4P71A 4RGTA 2L0CA 2N49A 2XWBB 4IPGA 1HZBA 4QQBX 3I91A 4EVOA 1E22A 4JC0A 3DLLA 2HUGA 5LL6S 1OO9B 1LYLA 1NJIC 5GADC 2IWHA 1B3AA 4GNXB 4LUVA 1HA6A 1H9SA 3HFZB 2F0NA 4GZYC 4HR7B 1R9TH 2GVAA 4A76A 4PZ7A 3HOYG 1QCBD 2E2IH 2NN6I 4M8AA 3E5SA 5IYDH 3TQYA 1K0SA 1I94Q 1B44D 4MZ9A 4P74A 5I9PA 4JYAL 1B50A 1GXDC 2B2WC 5C4JB 3NBHB 4A93B 2KHIA 4JI8Q 3NENA 3IFTA 4C3JG 4NKLA 3RZOH 1PHJA 3CAMA 5M3MH 4R4TA 2NVYB 2HHHQ 1L1OB 4MTKA 3LX0A 1N32Q 1KC8C 3MXNB 3AU7A 4DPGA 5GROA 3EROA 3J81c 1JORA 4CBVA 3HKZB 1NNXA 2E2HB 2QGQA 4TSSA 5C3WA 1VMPA 2PI2A 1D8LA 2YTVA 4BBRH 1JOQA 2XWJB 2JN4A 2EYJA 4B3TL 2PNRC 2B2YC 2F0VA 2ZXPA 1XWEA 3A0JA 2JA5G 3DM1A 5JJIA 3I2ZA 4HIKA 1B7YB 5GQOA 1XPRA 3SHLA 1S5ED 2CH4A 4X65L 2SNMA 1K28A 1J9OA 4RHSA 3QOLA 4Q0FA 1I4PA 3H6MA 2JA7H 3ITPA 4HJ9A 3BU2A 1VQ8A 1GUSA 1IBLQ 1KXLA 4ZQ3A 4IURA 3M3YB 3CQZH 3VR2A 1D6EC 2KECA 2EYFA 5JPNC 3SDZA 4G7OC 4DR3L 1KTKA 1TR5A 1HNXL 2FXQA 4JK1C 3HOWB 5LMNL 1HNZL 5KRUA 1TS3A 1I6HH 1Z9FA 1I4RA 5KYIA 1P16A 3CCEA 2Z0SA 4N8FA 4ALPA 4DUZL 3M4OH 4B3RQ 3H0GG 4RA8A 3FKIB 4V0BA 1TS4A 4A3JH 1EEFD 4YWKA 2DY8A 1LT4D 2X69A 5E4XA 4UP8A 3PCOB 3HOUG 3PO2G 4PMWA 4WJWA 2EY5A 3N6RA 4O1NA 3TSSA 4KKUA 1RODA 1CUKA 2RA4A 1K83H 1EY9A 3K0XA 2MHVA 4BA1I 4F87A 2KHJA 4YY3Q 1VQLA 1JJ2A 4IJLA 3CCUA 4X65Q 2Q8RE 5T1GA 1HUNA 3HOVG 3TDQA 3F2BA 3HOXH 4IFDH 1GHKA 3RZDH 2R93H 3NTHA 2OEOA 1NMGA 3CRLC 3N52A 2L9HA 3VA5A 3Q22A 1CSQA 3K5MA 1TQOA 2R92H 2Z4HA 4IZ8A 1QUQA 4JW0A 2ZTEA 1QVFA 4IUNA 5ELFA 4LF7Q 3NWTA 3D4WA 3A5UA 5NUCA 4JV5Q 3KK7A 1F9SA 1V1QA 3DHQA 4WORA 2FMMA 4OGQC 2FHTA 5I2YA 1HNZQ 2PI2E 4XTCS 4OO1I 1A62A 2N78A 4CDDC 1BCPB 2GVBA 2PMZB 3J81j 3U4ZA 5T1IA 2AQ3B 1DCZA 4A3LG 5KIXA 5GAGC 3KJPA 1JOKA 1VQFA 2JJQA 4UP9A 1WTWA 3K59A 2QW7A 4DK6C 1JR0D 2PW5A 4CDFC 4A3FH 3RLFA 2PQAB 3NSWA 4TVAB 2UXCL 1UNSA 3BZKA 4JPBW 4MIUA 3OW2A 3VYUA 1VQOA 3R8BA 3BYYB 3S9WA 1ASZA 4BY1H 1HPCA 1KLUD 2WIIB 2JQOA 4X3TA 1HQMC 4QUCA 2XNAC 1PFNA 2RCFA 3PO3G 4NXNQ 4JI0L 1IKLA 1LT5D 3AB9A 2ZJPA 3G7LA 1W2BA 3G6JB 3X3NA 3OHXC 3UE1A 5K5PA 4DV5L 1YNJC 1TVXA 5JEAH 2JA6B 3GTKB 2EYLA 4K5VA 4AIMA 2UUCL 2RCNA 5M5XH 1IBKQ 3CRKC 1H9KA 4S3SA 2NVQH 3PUWA 2VUMB 3S15H 2OTJA 2RVLA 3AYHB 3J7ZC 2K1BA 1SSOA 4OX9Q 4DR4L 2QEJC 2AQ1B 4A3KH 1DOMA 4RAUC 1EQTA 1D5ZC 1CHPD 4B9WA 1RIPA 1S40A 5C0XJ 1UAPA 4DUYL 3HEJA 4JG2A 1MHWC 3F2UA 2NVTB 1SR3A 1AH9A 2F0OA 1EIGA 2M00A 1D1KA 1TS5A 3DUZA 1GUNA 1FNWA 2LXJA 2Z6BA 1PFMA 4DF7A 3LNNA 4DK1A 5I6YA 3VDYA 1ML0D 3GTLB 2XIWA 3GO5A 1EOTA 2N88A 1Q8IA 4CJ1B 1WVLA 2PQEA 1WD1A 1H9RA 1IBMQ 3CXCA 5IYDG 3G4SA 2Z6KC 1VQPA 3C3LA 2MFIA 4DV6Q 2QCPX 1I5FA 3ULLA 5IT9L 4OELB 3GD7A 2ZTDA 2VL6A 3T1HQ 1U4RA 1KL9A 4RG1A 2QILA 1EQRA 3I3CA 2UUBL 4JI0Q 3SR1A 2ZT9C 1VQHA 1PH5A 3PGZA 4J15A 2WACA 3SE0A 4KK7A 5M3MG 4DV5Q 4DV3L 1TWAB 3VR4A 1XTCD 4JI5L 2G9HD 4JI1L 4A3MH 3L2PA 4C3IG 1Q81C 2R7FA 2UUCQ 1QILA 3S1QB 4BBSB 4KHPL 3S2HB 3MFYA 1OXSC 2NZHA 3OWEB 5I4DA 1QZHA 4Z9CB 4A3DH 4RHRA 2HCCA 2VY3A 3GTGH 1B8AA 2A69C 3DEPA 4F7XA 1XNRL 3I90A 1ESFA 1CFMA 3H15A 1Y69U 1DD2A 3JAMi 3STBC 5BR8L 2AKWB 2LY7A 3K58A 2JA7G 4ZK9B 5CYUA 2UXBQ 2WP8J 3KF6A 3RN2A 5IGEA 1B1ZA 2ZJQA 3P1HA 1IYUA 2KVMA 4RGOS 2EZVA 2AWNA 1SMYC 2CVRA 4HJ8A 4LAAA 4BWGB 1HTLD 2UUBQ 3T13A 4AYBB 1FGUA 2UU9Q 5LMUQ 1FNUA 4A3IG 2AUKA 1XMOL 4JBWA 1U4MA 3S1NB 1HQRD 3UDXA 2A6HD 1SROA 3NUCA 2QF7A 3NTKA 1L0XB 4LFAL 5CBEE 1GUOA 1VQBA 3SVMA 4JI4L 2K5QA 4DV4Q 1H95A 4KN7C 4EQ5A 1N34Q 4HSVA 1PFBA 3D6WA 2KCMA 2B2YA 2B8GA 5M5WB 1F9RA 4WJ4A 3PUZA 3TZDA 1RTNA 2MNAA 1LLRD 2B8FA 4WFN3 4A3EG 2Y0SG 4EQOA 1I4HA 1L0WA 1QUQB 5ELCA 3V96A 4AQYL 1ET6A 5FO8B 3AEVA 3NTIA 4IUVA 1PH3A 1XJVA 3TEHB 4A3CH 1J5EL 5BR8Q 4IFDG 5COYA 1G2SA
chains in the Genus database with same CATH topology
4X64Q 1WCMG 5IP7G 2R93G 1M90C 3CF5A 3PIOA 3BZCA 2BH2A 3JC66 1N8RC 1TWHH 2RHSB 1PH7A 4BY7H 5C4JH 3CCJA 3S14H 1QZGA 4A93H 2UU9L 1NTGA 1EUJA 2JA8H 2JEBI 2UXCQ 2OCEA 4DAYB 2R92G 3MEFA 3J80i 2UUAL 2KBNA 1FJGL 5ELNA 1Q86C 1N9WA 3EN2A 2ATWA 1GVPA 2XTIA 4LF7L 1EYGA 4JV5L 1E3PA 2NVYH 2YU9H 3I56A 2JK8A 1IXRA 2N3SA 3UDFA 3CCRA 1YZ6A 1IZ6A 1C0AA 2JA5H 1MKHA 1BVSA 2OQKA 4QGUA 3J80c 1JMCA 5C3EH 3CD6A 1OXXK 3PO3H 2WAQG 4JI8L 4X62Q 1VQ6A 1GKHA 2H5XA 1N36Q 5M3FG 4L5SA 3F1ZA 1IL2A 4JI6L 1TWCH 2PQAA 1V43A 1PH9A 1HR0L 1YNXA 2ID0A 4JI4Q 1X6OA 1PH2A 1PH4A 4BXXG 2CCZA 1CKNB 4P73A 2DGYA 4IO9A 4JI7Q 4QL5A 2Q2TA 4IJHA 2R7ZG 3A74A 3OTOL 3U58A 2HQLA 5FLMG 4LF9L 1RL2A 3PF4A 2DUDA 1PVOA 4DK3C 3F2CA 1K9MC 4DR7Q 5JJLA 5H1SE 3J7A5 1BBWA 1HZAA 3EBEA 4P71A 4PZ8A 4K0KL 4DAMA 4DR4Q 2JA6H 3GTKH 3M4PA 2N49A 3I4MG 4IPGA 1HZBA 5C0XG 3K8AA 3U50C 4A3BG 4QQBX 2V1CC 1VQCA 4IPCA 4GKKL 1FL0A 4GLAC 1E22A 3G48A 2ASBA 3CP0A 4JC0A 4NXNL 3DLLA 1J5EQ 4DUYQ 2B63G 4LF8L 1LYLA 3GTQH 3S17H 4DR1Q 1Y1WG 1NJIC 5GADC 1OTCA 3PF5A 4GNXB 2IX0A 4LUVA 5K36G 1VQGA 1K3RA 2RF4A 3HFZB 1S3OA 1R9TH 2GVAA 4GLVB 4A76A 4PZ7A 3HOYG 3H0GH 3PUXA 1TXYA 2E2IH 2NN6I 1SE8A 2K5NA 1U5KA 1IBKL 2NVTH 1X54A 2UXDQ 1PFSA 3TS2A 5IYDH 3TQYA 3HOUH 1I94Q 5C4XH 4MZ9A 4GOPC 4P74A 1XPOA 4OX9L 3PO2H 1X3FA 5HGQA 4JYAL 1ASYA 1YJ9A 4H02A 3NBHB 1EIFA 2KHIA 2VW9A 3BJUA 5IYBH 1M1KC 3GTLH 4O2DA 2CWPA 3FKIH 3NENA 4JI8Q 4IPHA 4A4IA 1U0LA 3J81i 1X3GA 4JCVE 5ELOA 1YJNA 1SLJA 4X6AH 2F3IA 3RZOH 2A19A 3CAMA 5M3MH 2NN6G 1PHJA 1HR0Q 3HOVH 4R4TA 4DV3Q 4R4IA 2HHHQ 1L1OB 2HIXA 4DV1L 4LFBQ 2YTXA 5FLXc 2VQFQ 4JI5Q 1N32Q 3M4QA 4LF6L 1KC8C 3MXNB 2MO1A 4DPGA 4JI1Q 5GROA 4A93G 3J81c 1WI5A 2CFMA 4LF5L 2JA8G 2VQEQ 1IYJB 4LF9Q 2QGQA 3CW2C 1CSPA 2PI2A 1GO3E 5IWAQ 4KHPQ 1D8LA 4A75A 2YTVA 3I4NH 4BBRH 1IBML 2WB1G 1TWAH 4KI0A 1NBWA 3RLNA 4DV6L 2K75A 4B3TL 3CPWA 2VZAA 1UE5A 1AE2A 3M9BA 3A0JA 3T1HL 4GKKQ 2JA5G 5JJIA 3I2ZA 3HKZG 4HIKA 3ERSX 2HT1A 1XNRQ 1B7YB 2ZM6Q 1G51A 5GQOA 3T1YQ 3S1QH 1YHQA 1XPRA 1EFWA 4X65L 2A8VA 1Q12A 2VS1A 1E24A 1NE3A 4QY7A 2F52A 1VQKA 4PZ6A 4A3LH 2BA0A 4YCWA 2JA7H 3AQQA 4UY8C 4JI3L 4HJ9A 4DR5Q 4A3MG 3BU2A 2I5HA 1JJCB 4UP7A 4XIGS 1VQ8A 5AJ3Q 4X66L 1IBLQ 1KXLA 1SMXA 1B70B 3CQZH 2R7DA 5C44H 2Q2IA 4FDBA 4ME3A 1P8LA 3ER0A 3FHWA 4A3DG 4GOPB 3E0EA 4QIWE 1SRUA 1E7ZA 4IOCA 2KCTA 4DR3L 3S1MH 4GNXA 4EX5A 1HNXL 2FXQA 2EXDA 2I0QA 4AYBE 5LMNL 1HNZL 3UE0A 4YHHL 1XMOQ 4B3SL 1QVCA 1W3SA 1I6HH 1PYSB 1Y1VG 1Z9FA 2IT1A 3NEMA 2A1AA 4DV1Q 1A63A 4LF6Q 1P16A 3CCEA 2Z0SA 4ALPA 4DUZL 3M4OH 1YI2A 4LFAQ 1Q7YC 4B3RQ 3H0GG 3KLWA 2Y0SE 3RLOA 1BKBA 1I3QH 2UXBL 4UPAA 3HOWG 3KFUA 2Z6KA 4A3JH 1OXTA 4JI2L 2F4VL 4YWKA 1HJPA 1PA6A 3LGJA 3SGIA 4UP8A 3PCOB 1KQSA 3HOUG 1JJGA 3PO2G 1JE5A 3ICEA 4PMWA 4Y7NH 3F2DA 2LSSA 2K5VA 4DR2L 4GKJQ 1HR0W 5M5YH 2YTYA 3UDGA 1KD1C 2BH8A 4DV7L 1N33L 3FKIG 1L1OA 1CUKA 1EWIA 1K83H 2HIVA 2MO0A 2IHFA 2C35B 3K0XA 4BA1I 2KHJA 3KOJA 4YY3Q 5LMUL 4AQYQ 1VQLA 1JJ2A 4JBKA 4IJLA 3CCUA 4X65Q 4JOIA 2E2JH 2D0OA 4LFCL 3HOVG 5M5WH 1O7IA 3F2BA 2JE6I 3HOXH 4HIDA 3CCVA 5IP9G 5IP9H 1EOVA 2CWAA 4PG3A 3RZDH 2R93H 1WCMH 5E7NA 5IP7H 2B29A 3H3VH 1NMGA 2VUMH 1HNWL 3S24A 1X56A 1PYBA 4HJ5A 2RHQB 2R6GA 4DV4L 3ULJA 1CSQA 3I55A 3TS0A 3GTPH 1VQMA 3WWVA 1LUZA 1N34L 2R92H 3KDFA 2ALYB 4BBRG 3ZJYC 1K8AC 1OXUA 2MQHA 2UUAQ 1QUQA 1FJGQ 2ZTEA 1QVFA 4LF7Q 1VQ9A 3A5UA 4LUZA 4LF4L 4JV5Q 4NXML 1V1QA 1X55A 3ULPA 2IX1A 4HIMA 2AWOA 4YCUA 1HNZQ 1A8VA 2PI2E 1WJJA 4XTCS 4YHHQ 1A62A 1VQEA 2N78A 4POGA 3PIPA 4L5TA 4OO1I 2GVBA 3J81j 3K81C 4A3CG 2XGTA 5M3FH 3U4ZA 3W5OA 4A3LG 2BA1A 4JI6Q 5GAGC 4X64L 3KJPA 2GN5A 1VQFA 1PH1A 1UWVA 2JJQA 2AMCB 1Y14B 4UP9A 4B3ML 2JEAI 3NELA 3G71A 3K7AH 4DK6C 3GTJH 4BXXH 1VQ7A 4A3FH 3W1BA 4IFDJ 4GLXA 3RR5A 4BY7G 3RLFA 1Q8KA 1VQAA 1HZ9A 2PQAB 3RN5A 3TRZA 4TVAB 1VQ5A 2R7ZH 4C3IH 2UXCL 3OTOQ 1J6QA 1PH8A 3BZKA 2OTLA 3OW2A 3F8TA 3KYHC 4OO1G 3A5ZB 1T9HA 1VQOA 2EQSA 3CCQA 1VQNA 5EAYA 4K0KQ 3OYYA 1ASZA 3I4MH 1X9NA 3D31A 2QEXA 4BY1H 2K52A 2E5LL 1XTDA 2JQOA 1Q1BA 3L0OA 4OONA 1GM5A 1KHIA 4O0AA 4YCVA 4DR6L 1LM0A 1JT8A 4X62L 5C3EG 3PO3G 4NXNQ 3Q8DA 4JI0L 1N36L 1NY4A 4YWLA 4BBSH 4LF8Q 1CKNA 3S2HH 1NMFA 2ZJPA 1W2BA 1SN8A 3UE1A 4DV5L 1KRSA 4JBMA 1L2FA 2IY5B 1KIXA 1MJCA 2VNUD 5JJKA 3CMEA 4LW1A 1OXVA 4GN5A 4LWCA 4A3JG 3HOYH 5J3BA 2JA9A 4IFDI 3DM3A 4AIMA 2OQ0A 5IYCH 2IHEA 3H3VI 2K4KA 2UUCL 2RCNA 5M5XH 1IBKQ 4DR7L 5IT9c 4IPDA 1AE3A 1CKOA 3PV0A 2NVQH 3PUWA 4LF4Q 3S15H 3EIVA 1VCIA 2OTJA 3AYHB 3J7ZC 2LXKA 3CCLA 4OX9Q 1I50H 1LTLA 3GTMH 4DR4L 3KF6B 4JBJA 2JA6G 1VQIA 4JYAQ 1WFQA 4A3KH 2Q2HA 1C7YA 5FJ8H 2D0PA 1RIPA 1S40A 3HOXG 5C0XJ 4C3JH 3G6EA 4DUYL 1VQ4A 4JG2A 4A3IH 3U4VA 4GNXC 1SR3A 1AH9A 3CCMA 4B3MQ 2VUMG 2WB1E 4MNOA 4DV2L 4P72A 2LXJA 1CKMA 3CMAA 1DGSA 1BBUA 3VDYA 1MJEA 5IY0A 3S1RH 3GO5A 4LF5Q 3HKZE 5JEAJ 5DLQE 1XNQL 5LMNW 2WFWA 2UXDL 1E1OA 1Q1EA 2KENA 3B6YA 3S1NH 4GN4B 3STBD 4A3GH 1IBMQ 3CXCA 5IYDG 3G4SA 1WOCA 2Z6KC 1VQPA 1I94L 2MFIA 3CCSA 4DV6Q 2OWOA 4B3TQ 5C4XG 1I5FA 3ULLA 2E5LQ 2ZJRA 1E1TA 3GD7A 4OXPA 2ZTDA 2VL6A 2N8NA 3UDIA 3T1HQ 4A3EH 3S16H 1KL9A 2CQOA 4RG1A 4DR6Q 2EIFA 1EQRA 5IYBG 2E2HH 4AH6A 4QJFA 2UUBL 4JI0Q 3HOZH 1YBYA 4Y52H 1YHAA 4L5QA 1VQHA 5C0XI 1QVGA 1PH5A 1L1OC 2K50A 3PGZA 4J15A 4DKAC 4NB3A 4R4CA 3HKSA 5M3MG 1TWGH 4DV3L 4DV5Q 5GAEC 2HHHL 4L5RC 4JOIC 2YYZA 1VQJA 2VQFL 4JI5L 4A3FG 4LFBL 1N32L 2ZTCA 3D0FA 4JI1L 2I5MX 4A3MH 3L2PA 1Q81C 4JI3Q 2VQEL 3S2DH 2R7FA 4HIOA 2Q2UA 2UUCQ 1XMQL 1Q46A 1JB7A 5IWAL 2D62A 4X66Q 4KHPL 1OXSC 2NZHA 3PUVA 3I4NG 3AFQA 2WAQE 1QZHA 4A3DH 4IOAA 2VY3A 4BY1G 2QA4A 1D7QA 4KLKA 4YWMA 4OWXB 1YVCA 1MIUA 3KJOA 3GTGH 1B8AA 3TREA 3E9HA 4DR3Q 4DV0L 1HNXQ 3KF8B 4RMFA 4APVA 1XNRL 1YITA 2ZM6L 1X65A 5LMNQ 2K5HA 3T1YL 1K0RA 1S72A 4POFA 4BBSG 4B3SQ 1X3EA 3M3YH 3H15A 1EIYB 1Y1VH 3M85A 3I7FA 4R4OA 4GN3B 3JAMi 3STBC 5BR8L 4DV2Q 5JEAG 2AKWB 4DUZQ 2NVXH 1KAWA 2JA7G 4OWTB 4DR5L 5IYCG 3HOWH 2UXBQ 1PV4A 1G6PA 2WP8J 3KF6A 3RN2A 5AJ3L 4GOPA 4JI2Q 1IBLL 3AFPA 2ZJQA 3I4OA 2F4VQ 4C2MH 1G291 2B3GA 1A0IA 2PNHA 4C3HH 1UE6A 3JAMc 1HH2P 4P75A 5FLMH 1UE7A 1YEZA 3PUYA 1V9PA 5C44G 1SFOH 2AWNA 3W1GA 1EQQA 1KRTA 4DR2Q 4A3KG 2YV5A 1YJWA 4HJ8A 5GAHC 3CC4A 5FJ8G 2UUBQ 4DV7Q 3PSIA 3CC7A 2E8GA 4LUOA 1FGUA 4R4QA 1N33Q 1HZCA 2UU9Q 4A3BH 1XNQQ 4BA2I 5LMUQ 1C9OA 4HJAA 4A3IG 3K7UC 1YIJA 2K14A 1XMOL 4JBWA 2NZOA 3UDXA 4LFCQ 4DNIA 1SROA 2B63H 2I5LX 3RNUA 3M7NA 1Y1WH 3GDEA 1FVIA 4LFAL 3K80C 4B3RL 1HNWQ 3CC2A 5IE8A 1VQBA 4JI4L 4AYBG 4DV4Q 1XMQQ 2AHOB 1H95A 3CPFA 2ES2A 4EQ5A 4GS3A 1WYDA 4JI7L 1N34Q 4A3GG 2KCMA 1GD7A 4TQUS 4KHZA 4WJ4A 3PUZA 1PH6A 1VQDA 4NPSA 3L7ZC 2MNAA 4OWWB 1UEBA 4GKJL 1Z47A 4A3EG 1Q82C 3KDFB 4DV0Q 2Y0SG 2L15A 4NXMQ 3E9IA 1VS0A 1K73C 3HOZG 1UE1A 1L0WA 1QUQB 4LNQA 1XPUA 4MTNA 4YY3L 4AQYL 1TWFH 3AEVA 3IRBA 5HY6A 1PH3A 1XJVA 3TEHB 2PMZE 3GTOH 4A3CH 4R1JA 3FP9A 1J5EL 4HJ7A 5BR8Q 1K8GA 1YHBA 2CKZB 4IFDG 4WJ3M 4DR1L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 Q;  1WCM G;  5IP7 G;  2R93 G;  1M90 C;  3CF5 A;  3PIO A;  3BZC A;  2BH2 A;  3JC6 6;  1N8R C;  1TWH H;  2RHS B;  1PH7 A;  4BY7 H;  5C4J H;  3CCJ A;  3S14 H;  1QZG A;  4A93 H;  2UU9 L;  1NTG A;  1EUJ A;  2JA8 H;  2JEB I;  2UXC Q;  2OCE A;  4DAY B;  2R92 G;  3MEF A;  3J80 i;  2UUA L;  2KBN A;  1FJG L;  5ELN A;  1Q86 C;  1N9W A;  3EN2 A;  2ATW A;  1GVP A;  2XTI A;  4LF7 L;  1EYG A;  4JV5 L;  1E3P A;  2NVY H;  2YU9 H;  3I56 A;  2JK8 A;  1IXR A;  2N3S A;  3UDF A;  3CCR A;  1YZ6 A;  1IZ6 A;  1C0A A;  2JA5 H;  1MKH A;  1BVS A;  2OQK A;  4QGU A;  3J80 c;  1JMC A;  5C3E H;  3CD6 A;  1OXX K;  3PO3 H;  2WAQ G;  4JI8 L;  4X62 Q;  1VQ6 A;  1GKH A;  2H5X A;  1N36 Q;  5M3F G;  4L5S A;  3F1Z A;  1IL2 A;  4JI6 L;  1TWC H;  2PQA A;  1V43 A;  1PH9 A;  1HR0 L;  1YNX A;  2ID0 A;  4JI4 Q;  1X6O A;  1PH2 A;  1PH4 A;  4BXX G;  2CCZ A;  1CKN B;  4P73 A;  2DGY A;  4IO9 A;  4JI7 Q;  4QL5 A;  2Q2T A;  4IJH A;  2R7Z G;  3A74 A;  3OTO L;  3U58 A;  2HQL A;  5FLM G;  4LF9 L;  1RL2 A;  3PF4 A;  2DUD A;  1PVO A;  4DK3 C;  3F2C A;  1K9M C;  4DR7 Q;  5JJL A;  5H1S E;  3J7A 5;  1BBW A;  1HZA A;  3EBE A;  4P71 A;  4PZ8 A;  4K0K L;  4DAM A;  4DR4 Q;  2JA6 H;  3GTK H;  3M4P A;  2N49 A;  3I4M G;  4IPG A;  1HZB A;  5C0X G;  3K8A A;  3U50 C;  4A3B G;  4QQB X;  2V1C C;  1VQC A;  4IPC A;  4GKK L;  1FL0 A;  4GLA C;  1E22 A;  3G48 A;  2ASB A;  3CP0 A;  4JC0 A;  4NXN L;  3DLL A;  1J5E Q;  4DUY Q;  2B63 G;  4LF8 L;  1LYL A;  3GTQ H;  3S17 H;  4DR1 Q;  1Y1W G;  1NJI C;  5GAD C;  1OTC A;  3PF5 A;  4GNX B;  2IX0 A;  4LUV A;  5K36 G;  1VQG A;  1K3R A;  2RF4 A;  3HFZ B;  1S3O A;  1R9T H;  2GVA A;  4GLV B;  4A76 A;  4PZ7 A;  3HOY G;  3H0G H;  3PUX A;  1TXY A;  2E2I H;  2NN6 I;  1SE8 A;  2K5N A;  1U5K A;  1IBK L;  2NVT H;  1X54 A;  2UXD Q;  1PFS A;  3TS2 A;  5IYD H;  3TQY A;  3HOU H;  1I94 Q;  5C4X H;  4MZ9 A;  4GOP C;  4P74 A;  1XPO A;  4OX9 L;  3PO2 H;  1X3F A;  5HGQ A;  4JYA L;  1ASY A;  1YJ9 A;  4H02 A;  3NBH B;  1EIF A;  2KHI A;  2VW9 A;  3BJU A;  5IYB H;  1M1K C;  3GTL H;  4O2D A;  2CWP A;  3FKI H;  3NEN A;  4JI8 Q;  4IPH A;  4A4I A;  1U0L A;  3J81 i;  1X3G A;  4JCV E;  5ELO A;  1YJN A;  1SLJ A;  4X6A H;  2F3I A;  3RZO H;  2A19 A;  3CAM A;  5M3M H;  2NN6 G;  1PHJ A;  1HR0 Q;  3HOV H;  4R4T A;  4DV3 Q;  4R4I A;  2HHH Q;  1L1O B;  2HIX A;  4DV1 L;  4LFB Q;  2YTX A;  5FLX c;  2VQF Q;  4JI5 Q;  1N32 Q;  3M4Q A;  4LF6 L;  1KC8 C;  3MXN B;  2MO1 A;  4DPG A;  4JI1 Q;  5GRO A;  4A93 G;  3J81 c;  1WI5 A;  2CFM A;  4LF5 L;  2JA8 G;  2VQE Q;  1IYJ B;  4LF9 Q;  2QGQ A;  3CW2 C;  1CSP A;  2PI2 A;  1GO3 E;  5IWA Q;  4KHP Q;  1D8L A;  4A75 A;  2YTV A;  3I4N H;  4BBR H;  1IBM L;  2WB1 G;  1TWA H;  4KI0 A;  1NBW A;  3RLN A;  4DV6 L;  2K75 A;  4B3T L;  3CPW A;  2VZA A;  1UE5 A;  1AE2 A;  3M9B A;  3A0J A;  3T1H L;  4GKK Q;  2JA5 G;  5JJI A;  3I2Z A;  3HKZ G;  4HIK A;  3ERS X;  2HT1 A;  1XNR Q;  1B7Y B;  2ZM6 Q;  1G51 A;  5GQO A;  3T1Y Q;  3S1Q H;  1YHQ A;  1XPR A;  1EFW A;  4X65 L;  2A8V A;  1Q12 A;  2VS1 A;  1E24 A;  1NE3 A;  4QY7 A;  2F52 A;  1VQK A;  4PZ6 A;  4A3L H;  2BA0 A;  4YCW A;  2JA7 H;  3AQQ A;  4UY8 C;  4JI3 L;  4HJ9 A;  4DR5 Q;  4A3M G;  3BU2 A;  2I5H A;  1JJC B;  4UP7 A;  4XIG S;  1VQ8 A;  5AJ3 Q;  4X66 L;  1IBL Q;  1KXL A;  1SMX A;  1B70 B;  3CQZ H;  2R7D A;  5C44 H;  2Q2I A;  4FDB A;  4ME3 A;  1P8L A;  3ER0 A;  3FHW A;  4A3D G;  4GOP B;  3E0E A;  4QIW E;  1SRU A;  1E7Z A;  4IOC A;  2KCT A;  4DR3 L;  3S1M H;  4GNX A;  4EX5 A;  1HNX L;  2FXQ A;  2EXD A;  2I0Q A;  4AYB E;  5LMN L;  1HNZ L;  3UE0 A;  4YHH L;  1XMO Q;  4B3S L;  1QVC A;  1W3S A;  1I6H H;  1PYS B;  1Y1V G;  1Z9F A;  2IT1 A;  3NEM A;  2A1A A;  4DV1 Q;  1A63 A;  4LF6 Q;  1P16 A;  3CCE A;  2Z0S A;  4ALP A;  4DUZ L;  3M4O H;  1YI2 A;  4LFA Q;  1Q7Y C;  4B3R Q;  3H0G G;  3KLW A;  2Y0S E;  3RLO A;  1BKB A;  1I3Q H;  2UXB L;  4UPA A;  3HOW G;  3KFU A;  2Z6K A;  4A3J H;  1OXT A;  4JI2 L;  2F4V L;  4YWK A;  1HJP A;  1PA6 A;  3LGJ A;  3SGI A;  4UP8 A;  3PCO B;  1KQS A;  3HOU G;  1JJG A;  3PO2 G;  1JE5 A;  3ICE A;  4PMW A;  4Y7N H;  3F2D A;  2LSS A;  2K5V A;  4DR2 L;  4GKJ Q;  1HR0 W;  5M5Y H;  2YTY A;  3UDG A;  1KD1 C;  2BH8 A;  4DV7 L;  1N33 L;  3FKI G;  1L1O A;  1CUK A;  1EWI A;  1K83 H;  2HIV A;  2MO0 A;  2IHF A;  2C35 B;  3K0X A;  4BA1 I;  2KHJ A;  3KOJ A;  4YY3 Q;  5LMU L;  4AQY Q;  1VQL A;  1JJ2 A;  4JBK A;  4IJL A;  3CCU A;  4X65 Q;  4JOI A;  2E2J H;  2D0O A;  4LFC L;  3HOV G;  5M5W H;  1O7I A;  3F2B A;  2JE6 I;  3HOX H;  4HID A;  3CCV A;  5IP9 G;  5IP9 H;  1EOV A;  2CWA A;  4PG3 A;  3RZD H;  2R93 H;  1WCM H;  5E7N A;  5IP7 H;  2B29 A;  3H3V H;  1NMG A;  2VUM H;  1HNW L;  3S24 A;  1X56 A;  1PYB A;  4HJ5 A;  2RHQ B;  2R6G A;  4DV4 L;  3ULJ A;  1CSQ A;  3I55 A;  3TS0 A;  3GTP H;  1VQM A;  3WWV A;  1LUZ A;  1N34 L;  2R92 H;  3KDF A;  2ALY B;  4BBR G;  3ZJY C;  1K8A C;  1OXU A;  2MQH A;  2UUA Q;  1QUQ A;  1FJG Q;  2ZTE A;  1QVF A;  4LF7 Q;  1VQ9 A;  3A5U A;  4LUZ A;  4LF4 L;  4JV5 Q;  4NXM L;  1V1Q A;  1X55 A;  3ULP A;  2IX1 A;  4HIM A;  2AWO A;  4YCU A;  1HNZ Q;  1A8V A;  2PI2 E;  1WJJ A;  4XTC S;  4YHH Q;  1A62 A;  1VQE A;  2N78 A;  4POG A;  3PIP A;  4L5T A;  4OO1 I;  2GVB A;  3J81 j;  3K81 C;  4A3C G;  2XGT A;  5M3F H;  3U4Z A;  3W5O A;  4A3L G;  2BA1 A;  4JI6 Q;  5GAG C;  4X64 L;  3KJP A;  2GN5 A;  1VQF A;  1PH1 A;  1UWV A;  2JJQ A;  2AMC B;  1Y14 B;  4UP9 A;  4B3M L;  2JEA I;  3NEL A;  3G71 A;  3K7A H;  4DK6 C;  3GTJ H;  4BXX H;  1VQ7 A;  4A3F H;  3W1B A;  4IFD J;  4GLX A;  3RR5 A;  4BY7 G;  3RLF A;  1Q8K A;  1VQA A;  1HZ9 A;  2PQA B;  3RN5 A;  3TRZ A;  4TVA B;  1VQ5 A;  2R7Z H;  4C3I H;  2UXC L;  3OTO Q;  1J6Q A;  1PH8 A;  3BZK A;  2OTL A;  3OW2 A;  3F8T A;  3KYH C;  4OO1 G;  3A5Z B;  1T9H A;  1VQO A;  2EQS A;  3CCQ A;  1VQN A;  5EAY A;  4K0K Q;  3OYY A;  1ASZ A;  3I4M H;  1X9N A;  3D31 A;  2QEX A;  4BY1 H;  2K52 A;  2E5L L;  1XTD A;  2JQO A;  1Q1B A;  3L0O A;  4OON A;  1GM5 A;  1KHI A;  4O0A A;  4YCV A;  4DR6 L;  1LM0 A;  1JT8 A;  4X62 L;  5C3E G;  3PO3 G;  4NXN Q;  3Q8D A;  4JI0 L;  1N36 L;  1NY4 A;  4YWL A;  4BBS H;  4LF8 Q;  1CKN A;  3S2H H;  1NMF A;  2ZJP A;  1W2B A;  1SN8 A;  3UE1 A;  4DV5 L;  1KRS A;  4JBM A;  1L2F A;  2IY5 B;  1KIX A;  1MJC A;  2VNU D;  5JJK A;  3CME A;  4LW1 A;  1OXV A;  4GN5 A;  4LWC A;  4A3J G;  3HOY H;  5J3B A;  2JA9 A;  4IFD I;  3DM3 A;  4AIM A;  2OQ0 A;  5IYC H;  2IHE A;  3H3V I;  2K4K A;  2UUC L;  2RCN A;  5M5X H;  1IBK Q;  4DR7 L;  5IT9 c;  4IPD A;  1AE3 A;  1CKO A;  3PV0 A;  2NVQ H;  3PUW A;  4LF4 Q;  3S15 H;  3EIV A;  1VCI A;  2OTJ A;  3AYH B;  3J7Z C;  2LXK A;  3CCL A;  4OX9 Q;  1I50 H;  1LTL A;  3GTM H;  4DR4 L;  3KF6 B;  4JBJ A;  2JA6 G;  1VQI A;  4JYA Q;  1WFQ A;  4A3K H;  2Q2H A;  1C7Y A;  5FJ8 H;  2D0P A;  1RIP A;  1S40 A;  3HOX G;  5C0X J;  4C3J H;  3G6E A;  4DUY L;  1VQ4 A;  4JG2 A;  4A3I H;  3U4V A;  4GNX C;  1SR3 A;  1AH9 A;  3CCM A;  4B3M Q;  2VUM G;  2WB1 E;  4MNO A;  4DV2 L;  4P72 A;  2LXJ A;  1CKM A;  3CMA A;  1DGS A;  1BBU A;  3VDY A;  1MJE A;  5IY0 A;  3S1R H;  3GO5 A;  4LF5 Q;  3HKZ E;  5JEA J;  5DLQ E;  1XNQ L;  5LMN W;  2WFW A;  2UXD L;  1E1O A;  1Q1E A;  2KEN A;  3B6Y A;  3S1N H;  4GN4 B;  3STB D;  4A3G H;  1IBM Q;  3CXC A;  5IYD G;  3G4S A;  1WOC A;  2Z6K C;  1VQP A;  1I94 L;  2MFI A;  3CCS A;  4DV6 Q;  2OWO A;  4B3T Q;  5C4X G;  1I5F A;  3ULL A;  2E5L Q;  2ZJR A;  1E1T A;  3GD7 A;  4OXP A;  2ZTD A;  2VL6 A;  2N8N A;  3UDI A;  3T1H Q;  4A3E H;  3S16 H;  1KL9 A;  2CQO A;  4RG1 A;  4DR6 Q;  2EIF A;  1EQR A;  5IYB G;  2E2H H;  4AH6 A;  4QJF A;  2UUB L;  4JI0 Q;  3HOZ H;  1YBY A;  4Y52 H;  1YHA A;  4L5Q A;  1VQH A;  5C0X I;  1QVG A;  1PH5 A;  1L1O C;  2K50 A;  3PGZ A;  4J15 A;  4DKA C;  4NB3 A;  4R4C A;  3HKS A;  5M3M G;  1TWG H;  4DV3 L;  4DV5 Q;  5GAE C;  2HHH L;  4L5R C;  4JOI C;  2YYZ A;  1VQJ A;  2VQF L;  4JI5 L;  4A3F G;  4LFB L;  1N32 L;  2ZTC A;  3D0F A;  4JI1 L;  2I5M X;  4A3M H;  3L2P A;  1Q81 C;  4JI3 Q;  2VQE L;  3S2D H;  2R7F A;  4HIO A;  2Q2U A;  2UUC Q;  1XMQ L;  1Q46 A;  1JB7 A;  5IWA L;  2D62 A;  4X66 Q;  4KHP L;  1OXS C;  2NZH A;  3PUV A;  3I4N G;  3AFQ A;  2WAQ E;  1QZH A;  4A3D H;  4IOA A;  2VY3 A;  4BY1 G;  2QA4 A;  1D7Q A;  4KLK A;  4YWM A;  4OWX B;  1YVC A;  1MIU A;  3KJO A;  3GTG H;  1B8A A;  3TRE A;  3E9H A;  4DR3 Q;  4DV0 L;  1HNX Q;  3KF8 B;  4RMF A;  4APV A;  1XNR L;  1YIT A;  2ZM6 L;  1X65 A;  5LMN Q;  2K5H A;  3T1Y L;  1K0R A;  1S72 A;  4POF A;  4BBS G;  4B3S Q;  1X3E A;  3M3Y H;  3H15 A;  1EIY B;  1Y1V H;  3M85 A;  3I7F A;  4R4O A;  4GN3 B;  3JAM i;  3STB C;  5BR8 L;  4DV2 Q;  5JEA G;  2AKW B;  4DUZ Q;  2NVX H;  1KAW A;  2JA7 G;  4OWT B;  4DR5 L;  5IYC G;  3HOW H;  2UXB Q;  1PV4 A;  1G6P A;  2WP8 J;  3KF6 A;  3RN2 A;  5AJ3 L;  4GOP A;  4JI2 Q;  1IBL L;  3AFP A;  2ZJQ A;  3I4O A;  2F4V Q;  4C2M H;  1G29 1;  2B3G A;  1A0I A;  2PNH A;  4C3H H;  1UE6 A;  3JAM c;  1HH2 P;  4P75 A;  5FLM H;  1UE7 A;  1YEZ A;  3PUY A;  1V9P A;  5C44 G;  1SFO H;  2AWN A;  3W1G A;  1EQQ A;  1KRT A;  4DR2 Q;  4A3K G;  2YV5 A;  1YJW A;  4HJ8 A;  5GAH C;  3CC4 A;  5FJ8 G;  2UUB Q;  4DV7 Q;  3PSI A;  3CC7 A;  2E8G A;  4LUO A;  1FGU A;  4R4Q A;  1N33 Q;  1HZC A;  2UU9 Q;  4A3B H;  1XNQ Q;  4BA2 I;  5LMU Q;  1C9O A;  4HJA A;  4A3I G;  3K7U C;  1YIJ A;  2K14 A;  1XMO L;  4JBW A;  2NZO A;  3UDX A;  4LFC Q;  4DNI A;  1SRO A;  2B63 H;  2I5L X;  3RNU A;  3M7N A;  1Y1W H;  3GDE A;  1FVI A;  4LFA L;  3K80 C;  4B3R L;  1HNW Q;  3CC2 A;  5IE8 A;  1VQB A;  4JI4 L;  4AYB G;  4DV4 Q;  1XMQ Q;  2AHO B;  1H95 A;  3CPF A;  2ES2 A;  4EQ5 A;  4GS3 A;  1WYD A;  4JI7 L;  1N34 Q;  4A3G G;  2KCM A;  1GD7 A;  4TQU S;  4KHZ A;  4WJ4 A;  3PUZ A;  1PH6 A;  1VQD A;  4NPS A;  3L7Z C;  2MNA A;  4OWW B;  1UEB A;  4GKJ L;  1Z47 A;  4A3E G;  1Q82 C;  3KDF B;  4DV0 Q;  2Y0S G;  2L15 A;  4NXM Q;  3E9I A;  1VS0 A;  1K73 C;  3HOZ G;  1UE1 A;  1L0W A;  1QUQ B;  4LNQ A;  1XPU A;  4MTN A;  4YY3 L;  4AQY L;  1TWF H;  3AEV A;  3IRB A;  5HY6 A;  1PH3 A;  1XJV A;  3TEH B;  2PMZ E;  3GTO H;  4A3C H;  4R1J A;  3FP9 A;  1J5E L;  4HJ7 A;  5BR8 Q;  1K8G A;  1YHB A;  2CKZ B;  4IFD G;  4WJ3 M;  4DR1 L; 
#chains in the Genus database with same CATH topology
 2R93 G;  2XSC A;  4O42 A;  1Q3L A;  5EKI A;  4XQJ A;  3JC6 6;  1N8R C;  1TWH H;  1PH7 A;  2DNE A;  4BY7 H;  3S14 H;  5IOC A;  1EUJ A;  1V1P A;  1X3P A;  3KF8 A;  2R92 G;  1Y8P B;  2Z1C A;  5M3F B;  2A68 D;  1FJG L;  4KY6 A;  1Q86 C;  1N9W A;  3EN2 A;  2F0J A;  3K7A B;  2SOB A;  3J81 E;  2JK8 A;  2O5J C;  2F3W A;  1YZ6 A;  3OWF A;  1C0A A;  2JA5 H;  1MKH A;  4C2M B;  4C3H B;  4QGU A;  3J80 c;  3CD6 A;  5COR A;  2TMP A;  1GKH A;  1TWC H;  1EY6 A;  1HR0 L;  4HN7 A;  4JI4 Q;  2LKV A;  1HCZ A;  1PH2 A;  3DWQ A;  2F1M A;  4P73 A;  2PPB C;  2Q2T A;  4IJH A;  4QUF A;  3I70 A;  3OTO L;  1LTI D;  2HQL A;  5L37 A;  5EBD A;  3PF4 A;  1PVO A;  4DR7 Q;  5JJL A;  3Q6S A;  4IUU A;  3J7A 5;  1S5C D;  1A3U A;  1BR9 A;  4A3B G;  4CHT B;  1RKN A;  2EPB A;  4IPC A;  2JYO A;  1LV9 A;  5CV6 A;  1CA5 A;  1FL0 A;  3G48 A;  2ASB A;  1J5E Q;  2F0T A;  3A7L A;  3S17 H;  5CV4 A;  2K6A A;  1VF7 A;  4FF2 A;  2IX0 A;  3GTM B;  1GUT A;  1K3R A;  1IHZ A;  1VQG A;  2RF4 A;  2Z9H A;  4GLV B;  1TWF B;  2X6L A;  3H0G H;  3PUX A;  2DJG C;  1EWH A;  1X54 A;  2LFN A;  1JB3 A;  1PFS A;  2PYK A;  3MA2 B;  2RSN A;  5DM6 3;  1JC7 A;  3HOU H;  1CQF A;  4GOP C;  1XPO A;  2CH4 W;  3PO2 H;  1X3F A;  5HGQ A;  1UEA B;  1AEX A;  1F2Y A;  1YJ9 A;  4KV6 A;  4ABN A;  1EIF A;  2VW9 A;  3BJU A;  2JA8 B;  1U0L A;  5ELE A;  4ZAI A;  1X3G A;  2F3I A;  2RDH A;  1JCK B;  5DAU A;  3HOV H;  1HR0 Q;  2WB1 B;  2F0W A;  2YU9 B;  4KY5 A;  1T5X D;  2HIX A;  5IGB A;  4LFB Q;  2VQF Q;  5FLX c;  1D5M C;  1ENA A;  2CFM A;  4LF5 L;  2VQE Q;  3CW2 C;  3MC0 B;  1CSP A;  1XX8 A;  1LTS D;  2SDF A;  2OT2 A;  4KI0 A;  1NBW A;  3RLN A;  2VZA A;  5IGD A;  1LT6 D;  5FOB B;  1BDO A;  3EJI A;  1CK1 A;  4H44 C;  1YHQ A;  2F4I A;  4FF1 A;  1Q12 A;  2VS1 A;  1IYV A;  1E24 A;  4QY7 A;  2F52 A;  2LMC B;  4A3L H;  3WOF A;  2F0P A;  4YCW A;  4JI3 L;  4DR5 Q;  3SXH A;  4A3M G;  3KBG A;  4UP7 A;  1UUP A;  1EU3 A;  5AJ3 Q;  1SMX A;  1B70 B;  4FNF A;  1Y1V B;  2Q2I A;  4K14 A;  4ME3 A;  1P8L A;  3ER0 A;  3FHW A;  4A3D G;  4ZKC B;  3E0E A;  4QIW E;  4IOC A;  2BCO A;  3V05 A;  4FF3 A;  4UHV A;  4K2K A;  5EPJ A;  2I0Q A;  4F8M A;  3KLR A;  4NMZ A;  4XDX A;  2KJX A;  3A8I E;  3UE0 A;  4B3S L;  1W3S A;  1PYS B;  2IT1 A;  1SE2 A;  3NEM A;  1A63 A;  2Q8I B;  1SFO B;  1O7L A;  3KLW A;  2Y0S E;  3RLO A;  4HSP A;  1X32 A;  4UPA A;  5EPL A;  2Z6K A;  2NWG A;  1OXT A;  3X3M A;  4R9W A;  1HJP A;  1PA6 A;  4C56 C;  1KQS A;  3VYS A;  4Y7N H;  2LSS A;  5M5Y H;  5ELB A;  3UDG A;  3TP6 A;  1E0B A;  1N33 L;  5IOD A;  2IHF A;  1PTO D;  2C35 B;  1XNQ L;  5D65 A;  1HXY D;  5FKA C;  2E2J H;  2WIN B;  2D0O A;  4LFC L;  4BBR B;  2JE6 I;  4HID A;  4DXG A;  1EOV A;  3TBI B;  3J80 L;  3H3V H;  3S24 A;  1PYB A;  4HJ5 A;  1QJO A;  1SBB B;  2R6G A;  3ULJ A;  4HMI A;  3HGB A;  3TS0 A;  3GTP H;  1BQQ T;  4J1M A;  1EQV A;  3NQI A;  3VYT A;  3GTO B;  5KEE A;  3H3V C;  3DXJ C;  5JOB A;  4LF4 L;  4HIM A;  4M1U B;  1BO0 A;  4POG A;  4L5T A;  2D2C C;  3CQZ B;  4YIJ A;  4A3C G;  2XGT A;  1BF4 A;  2BA1 A;  3C1F A;  1SEB D;  1Y14 B;  3NBI A;  4BXX H;  1VQ7 A;  1EZ6 A;  2EDG A;  2PZU A;  4BY7 G;  1Q8K A;  1DOK A;  1HZ9 A;  2A73 B;  3TRZ A;  3A56 A;  2R7Z H;  4C3I H;  2KHS A;  5C3E B;  1J6Q A;  1SAP A;  3GV3 A;  3HRZ C;  1PH8 A;  3KBX A;  3KYH C;  2L1B A;  2F0E A;  2MP1 A;  4QIW B;  3E6Z X;  3P7J A;  5CGK A;  3OYY A;  4DGZ A;  3I4M H;  2OXP A;  1XTD A;  4A3J B;  4NW2 A;  3L0O A;  3QWN A;  1KHI A;  2HD3 A;  5FK9 C;  2NZ1 D;  4YWL A;  5AFW A;  1TT2 A;  2IY5 B;  1ILP A;  1KIX A;  1K83 B;  5JJK A;  2VNU D;  3CME A;  4LW1 A;  1IKM A;  4GN5 A;  4HCS A;  4IFD I;  3DM3 A;  2RDG A;  3HOX B;  2K4K A;  5FLX L;  4RGM A;  1DOL A;  5JAV A;  5IT9 c;  2B2V C;  4LF4 Q;  3CCL A;  2G9D A;  4JYA Q;  1KDA A;  3ND9 A;  4I7A A;  3G6E A;  3FRP B;  4A3I H;  4GNX C;  1J8I A;  3K6O A;  5C4X B;  4KJO A;  4MNO A;  2EXZ A;  4DV2 L;  4P72 A;  3HP3 A;  1O7Z A;  4HCE A;  3R2T A;  1BBU A;  2B2T C;  5IY0 A;  2BDN A;  1WD0 A;  1I4G A;  2WFW A;  2UXD L;  2A6H C;  1Q1E A;  2F0D A;  1SNO A;  4GN4 B;  2F0L A;  1WOC A;  4EQN A;  1GHJ A;  4B3T Q;  4A3F B;  4OXP A;  3BG3 A;  3UDI A;  1Z7T A;  4A3E H;  3S16 H;  2CQO A;  2E2H H;  2EY1 A;  2F03 A;  3A7A B;  1B9N A;  2NYZ D;  1SYC A;  1L1O C;  2WV6 D;  5FO7 B;  3I4N B;  4NB3 A;  1EWC A;  4L5R C;  2EY2 A;  1TWG H;  4JOI C;  4BY1 B;  4WRD A;  4XYO A;  2CW0 D;  2D9U A;  1FGB D;  2L11 A;  4FO2 A;  5IWA L;  2D62 A;  4ILW A;  2NBF A;  5IIF A;  4IOA A;  3T53 B;  1D7Q A;  2K7V A;  4YWM A;  4OWX B;  1YVC A;  1MIU A;  4IAL A;  5BN4 A;  4DR3 Q;  3GP7 A;  1HNX Q;  4RMF A;  2ZM6 L;  5LMN Q;  5M5X B;  4ID6 A;  3T1Y L;  1K0R A;  5KYL A;  1Y8O B;  2A68 C;  3M3Y H;  3M85 A;  3S15 B;  3I7F A;  4R4O A;  4GN3 B;  3Q0A A;  5C44 B;  4DV2 Q;  5IGG A;  1PZI D;  4A3K B;  4DUZ Q;  4N9T A;  1KAW A;  4OWT B;  5IYC G;  3HOW H;  1G6P A;  3ZYY X;  4GOP A;  2R3Z A;  3I4O A;  2B3G A;  3JAM c;  1UE6 A;  1HH2 P;  2EYO A;  3EVQ A;  1V9P A;  3NQT A;  3W1G A;  4ZUI A;  1KRT A;  1YJW A;  5GAH C;  2K03 A;  3OIP A;  2VB3 X;  5C5L A;  2E8G A;  4LUO A;  5D3D A;  1ENF A;  4A3B H;  5G3L F;  4HJA A;  1C9O A;  1YIJ A;  3K7U C;  4DFA A;  1PXU A;  1SYF A;  1S5F D;  2I5L X;  3MXU A;  2L5T A;  4EQP A;  4X3K A;  4FVM A;  2F0F A;  3CC2 A;  1STH A;  1M4V A;  4FP5 D;  2ES2 A;  1ICW A;  4A3G G;  1H9S B;  2A74 C;  2D5D A;  1PH6 A;  4OWW B;  1WCM B;  3M7G A;  4GKJ L;  2EJM A;  1PLF A;  4PNY A;  2L15 A;  2K28 A;  1STN A;  1G6Z A;  3HOZ G;  1STE A;  1UE1 A;  4LNQ A;  5DNF A;  1XPU A;  1LTR D;  4MTN A;  4TRD A;  3IRB A;  5HY6 A;  1PRT D;  3FP9 A;  4CGY B;  1YHB A;  1WTP A;  4DR1 L;  2OF1 A;  3RMH A;  3PIO A;  3GTG B;  3BZC A;  2BH2 A;  3BVM A;  1RDP D;  2F0S A;  2RDF A;  4FXK C;  1ICF B;  2UXC Q;  1NCV A;  4X3U A;  3D4D A;  3BZD B;  2UUA L;  3H91 A;  4K5W A;  1GVP A;  2XTI A;  5FLX E;  4CJ0 B;  1SE4 A;  3T4A C;  1E2V A;  2EYH A;  1IXR A;  4XQN A;  3K57 A;  3OOC A;  2MUY A;  3MXG A;  2XN9 C;  2WAQ G;  4JI6 L;  2KUM A;  1PH9 A;  1K8M A;  4BXX G;  4LMQ D;  4R8I A;  2R7Z G;  4LF9 L;  2B39 A;  4K2L A;  1ENC A;  1RL2 A;  2DUD A;  4DK3 C;  3F2C A;  2EY6 A;  4K0K L;  3EBE A;  4DR4 Q;  2JA6 H;  3GTK H;  3I4M G;  3K8A A;  2IW3 A;  2R61 A;  1VQC A;  1L0Y B;  3HOY B;  1SJE D;  2WKC A;  4L63 B;  3MXP A;  4J6H A;  4GLA C;  1HFG A;  3Q24 A;  3CP0 A;  3NE5 B;  4DUY Q;  2B63 G;  4PMC A;  1VF5 C;  4LF8 L;  3GTQ H;  5BN3 A;  4DR1 Q;  1Y1W G;  1K8O A;  1OTC A;  2P5Z X;  3T51 B;  3BYT B;  2K33 A;  2X6G A;  1I50 B;  1RHP A;  4MHE A;  1JIC A;  3TN2 A;  4F88 A;  1DXM A;  2IJ0 A;  1TXY A;  3MWY W;  1SE8 A;  4QMG A;  1MSH A;  4C3J B;  2NVT H;  1YNN D;  4X3S A;  4PMB A;  3TS2 A;  1O80 A;  2ZXO A;  1FYC A;  5EQ0 A;  1TWH B;  1B53 A;  3VR6 A;  3A55 A;  3GTL H;  5IYB H;  3TP5 A;  1PTO H;  4JCV E;  4JVZ A;  1YJN A;  1SLJ A;  3CKI B;  4X6A H;  2NN6 G;  3NXW A;  2EJF C;  4DAY A;  1E2W A;  1F2L A;  4DV3 Q;  4DV1 L;  1EY7 A;  4JI5 Q;  3M4Q A;  4A93 G;  4JI1 Q;  1PTO C;  4CKB A;  3C46 A;  2JA5 B;  3TP8 A;  4HAE A;  4LF9 Q;  3R93 A;  3VR5 A;  1GO3 E;  2O5I C;  4KHP Q;  4A75 A;  5C5M A;  3MZ5 A;  1TWA H;  2JP1 A;  4RFB A;  4RKL A;  2K75 A;  1UE5 A;  3M4Y A;  3JAM L;  3GQB A;  1Y8N B;  2BE5 D;  1GJX A;  3HKZ G;  2HT1 A;  1XNR Q;  3MFG A;  1LTB D;  4XT3 B;  3S1Q H;  2MPM A;  4H13 C;  1EFW A;  1O7Y A;  5A2Q L;  1QE6 A;  3FPP A;  4LJZ C;  4C1N K;  5JJZ A;  2BA0 A;  1M8A A;  1EYD A;  1B4O A;  3AQQ A;  1QB5 D;  2ICE C;  2B2V A;  3HS0 C;  1EY0 A;  4CDC C;  4UAI A;  4X66 L;  3S17 B;  3PMF A;  2IPK D;  3QG1 A;  2F3V A;  4CDE C;  4GOP B;  3OIQ A;  3K5O A;  1SRU A;  2EOT A;  3H0G B;  3S1M H;  4GNX A;  2EXD A;  1STY A;  3VA7 A;  2HDL A;  5CV8 A;  1CZG A;  4YHH L;  1XMO Q;  1MI2 A;  3BDC A;  3FEW X;  3HOU B;  2PCF B;  3PO2 B;  2B2T A;  4DV1 Q;  5J22 A;  4BS9 A;  1Z6H A;  1MGS A;  5C4H A;  1YI2 A;  4LFA Q;  1Q7Y C;  1I3Q H;  1BOS A;  2I46 A;  3HZX A;  4IN3 A;  3HOW G;  3KFU A;  5KNB A;  1ZXT A;  4JI2 L;  2F4V L;  2EYM A;  3HOV B;  4N8X 1;  1JE5 A;  4KMU C;  3ONA B;  4NDX A;  3F2D A;  4DR2 L;  3BDO A;  5E1F A;  2BH8 A;  4DV7 L;  3FKI G;  1L1O A;  2MO0 A;  1EWI A;  3KOJ A;  4AQY Q;  2BOS A;  1D1I A;  4JOI A;  1VDZ A;  5M5W H;  1A6X A;  5IT9 E;  1ZYR D;  3HG9 A;  2CWA A;  5E7N A;  5IP7 H;  2L12 A;  3I72 A;  1HNW L;  1X56 A;  3D6C A;  1EZ8 A;  3I55 A;  4ULL A;  4KY7 A;  5C4Z A;  3URY A;  4OIK A;  2ALY B;  1K8A C;  2MQH A;  1PYW D;  1PZK D;  5LL6 X;  1FJG Q;  1G2T A;  5KGU A;  2F0I A;  2AUJ D;  1EFI D;  2F0H A;  4NXM L;  3ULP A;  5F2D A;  1A8V A;  2V4D A;  1CM9 A;  1W6K A;  1WJJ A;  4YHH Q;  3D3R A;  1KNE A;  1VQE A;  3PIP A;  4Q5V A;  2L4N A;  4DNR B;  5M3F H;  3U9S A;  4L8J A;  2K05 A;  4X64 L;  2GN5 A;  1KAA A;  1PH1 A;  2JEA I;  4PV1 C;  2AMC B;  4I65 A;  3NEL A;  3G71 A;  3K7A H;  3FMC A;  3GTJ H;  3R2I A;  4IFD J;  4GLX A;  3OSO A;  3RN5 A;  3DWP A;  1VQ5 A;  4DAV A;  4CKC A;  1BCP D;  3OTO Q;  3PO3 B;  2OTL A;  3F8T A;  4OO1 G;  3A5Z B;  2L55 A;  4UDU C;  1VQN A;  2CW0 C;  1X9N A;  3D31 A;  2QEX A;  4PQX A;  2K52 A;  2K5D A;  5C0X H;  2E5L L;  1Q1B A;  4QCL A;  1I4Q A;  1LM0 A;  3QIA A;  4X62 L;  1N36 L;  1NY4 A;  5EKK A;  1SNC A;  1CKN A;  2QDL A;  3KLS X;  1JQY D;  2A5H A;  5DEH A;  4JBM A;  1S5D D;  1OXV A;  4LWC A;  1KNA A;  3FVQ A;  3K0Y A;  5J3B A;  5I6W A;  5IYC H;  3MAQ A;  2IHE A;  3H3V I;  2F0M A;  3NPP A;  1MD2 D;  5TSS A;  1AE3 A;  1AW7 A;  1CKO A;  1G8Z D;  5D3I B;  3EIV A;  1VCI A;  3GTM H;  2DN8 A;  1LTL A;  1QWY A;  3KF6 B;  2JA6 G;  4KD4 A;  1R9T B;  5EBC A;  2Q2H A;  3GTP B;  2D0P A;  1GUG A;  5CV5 A;  2E2I B;  2KOL A;  1VQ4 A;  3JAM E;  3CCM A;  2VUM G;  3PIO 3;  1ZKO A;  5JVG 3;  1CKM A;  3FDT A;  3CMA A;  1DGS A;  1TY2 A;  3S1R H;  4LF5 Q;  3HKZ E;  5JEA J;  5DLQ E;  4CKE A;  5LMN W;  4XYQ A;  1HHV A;  1TS2 A;  1E1O A;  1F2Z A;  2KEN A;  3B6Y A;  4TKO B;  3RZO B;  3STB D;  4A3G H;  4R8N A;  4XQQ A;  5M3M B;  1I94 L;  1SYB A;  2E5L Q;  2ZJR A;  1E1T A;  2N8N A;  4C3I B;  2EIF A;  5IYB G;  4Y52 H;  1JJG A;  4AH6 A;  3HOZ H;  1YBY A;  2FMC A;  1YHA A;  4L5Q A;  1QNU A;  1QVG A;  1F77 A;  2K50 A;  4DKA C;  4R4C A;  1B9M A;  1SMY D;  5GAE C;  2HHH L;  2YYZ A;  1N32 L;  1AN8 A;  4RCN A;  2A6E D;  2HQE A;  4MN3 A;  5J1Z A;  4JI3 Q;  3S2D H;  1KAB A;  1GOZ A;  1PRT C;  1Q46 A;  1JB7 A;  1DM0 B;  3LWE A;  1JWS D;  4QF4 A;  3EQL C;  4G4K A;  1D2B A;  4KLK A;  3TZU A;  1QNK A;  3KJO A;  2JA7 B;  1V1P B;  4DV0 L;  1A3V A;  3KF8 B;  4APV A;  1YIT A;  1X65 A;  2K5H A;  1TU2 B;  1S72 A;  4BBS G;  2KA7 A;  4B3S Q;  1X3E A;  1EIY B;  1Y1V H;  4FYD A;  5A35 A;  1CTM A;  3OMC A;  1SNP A;  2NVX H;  1FD7 D;  1PTO F;  5ELD A;  4A3I B;  1IBL L;  2VXW A;  1G29 1;  2PNH A;  1I6H B;  4DU9 A;  4P75 A;  1UE7 A;  3PUY A;  1SFO H;  1EQQ A;  2F0G A;  2VB2 X;  1QG7 A;  1TKW B;  3CC4 A;  2DY7 A;  3M4O B;  4RWS C;  5FJ8 G;  1N33 Q;  3CC7 A;  4R4Q A;  1HZC A;  4BA2 I;  1XNQ Q;  2KEE A;  1SYE A;  2H1E A;  2NZO A;  4LFC Q;  4I7Z C;  4DNI A;  2XVS A;  2Z4I A;  2B63 H;  1JOO A;  3M7N A;  1Y1W H;  2E75 C;  1FVI A;  1I6V C;  1U4P A;  3K80 C;  4A3E B;  3S16 B;  1RF2 D;  1JWU D;  4B3R L;  2Y0S B;  3BDL A;  4AYB G;  1HRJ A;  1V1O A;  3CPF A;  1WYD A;  1DJR D;  4K8I A;  4JI7 L;  5IGC A;  4TQU S;  1GD7 A;  4DA2 A;  1TWG B;  4KHZ A;  1AFP A;  1VQD A;  4NPS A;  2PO4 A;  3L7Z C;  3RZD B;  2R93 B;  2HCI A;  5CV9 A;  1Z47 A;  1Q82 C;  1CA6 A;  4DV0 Q;  4HTH A;  2IL8 A;  5ISR A;  2K04 A;  1EY5 A;  4YY3 L;  2EE1 A;  3GTO H;  1YNN C;  2PMZ E;  4R1J A;  1C8C A;  2R92 B;  2NUC A;  1K8G A;  5I2X A;  2CKZ B;  4WJ3 M;  2NN6 H;  5IP7 G;  3CF5 A;  4LK1 C;  1SNQ A;  3L3O C;  2B2U C;  4DAP A;  1KLG D;  3KLS A;  5C4J H;  4KHV A;  4A93 H;  3DMU A;  4RCO A;  1NTG A;  4U68 A;  5ELN A;  1EY4 A;  2IX3 A;  4LF7 L;  1EYG A;  1FR3 A;  4JV5 L;  2NVY H;  2E74 C;  1LAB A;  5CR3 A;  1K3B C;  2N3S A;  3CCR A;  1ET9 A;  1IZ6 A;  1R4Q B;  2ICI A;  3H09 A;  5EGT A;  4CJ2 C;  1BVS A;  1C48 A;  4DNT B;  3J7A V;  5C3E H;  1U9R A;  2H5X A;  5M3F G;  4L5S A;  5LHY 1;  3D8G A;  3K5L A;  1V43 A;  2ID0 A;  5KND A;  2BE5 C;  1D5X C;  4FXD A;  2CCZ A;  1CKN B;  3NK9 A;  4A3B B;  4JI7 Q;  3RD4 A;  4C3H G;  1AP0 A;  1R4P B;  3A74 A;  4OL7 A;  5J39 A;  5FLM G;  4B9X A;  2Q8T A;  1DYQ A;  1K9M C;  5EJW A;  3ND8 A;  5H1S E;  1EL0 A;  1BBW A;  2RKS A;  4PZ8 A;  2C5C A;  4V19 0;  2KCC A;  4DAM A;  5HUR A;  3M4P A;  4RGN A;  3BVG A;  1H9M A;  1ESR A;  5C0X G;  3U50 C;  3MVV A;  3VYR A;  1BBX C;  2V1C C;  4GKK L;  4NXN L;  5C3X A;  4ME5 A;  1ONL A;  1W6J A;  5CV7 A;  2NVQ B;  3ERQ A;  3PF5 A;  5K36 G;  2QKI C;  1S3O A;  1EY8 A;  4E6I A;  1PDQ A;  5G3L D;  2KCN A;  5M9O A;  2K5N A;  4K6L A;  1U5K A;  1IBK L;  2HDM A;  4XT1 B;  3J80 E;  2F0U A;  2UXD Q;  1PMR A;  1SDF A;  2J4X A;  3KUP A;  5C4X H;  3CU7 A;  2MJ8 A;  4OX9 L;  1ASY A;  1CI3 M;  4H02 A;  1G91 A;  1M1K C;  4O2D A;  2CWP A;  3FKI H;  4A4I A;  4IPH A;  3J81 i;  3PIP 3;  2C9O A;  3OPO A;  3QR8 A;  5ELO A;  4L6T B;  1ZEQ X;  3BS1 A;  2A19 A;  3W3A A;  4R4I A;  2YTX A;  4LF6 L;  2MO1 A;  4OIJ A;  1Q90 A;  1WI5 A;  2JA8 G;  1IYJ B;  3MHB A;  1MSG A;  3E0J A;  1ZYR C;  2EVB A;  5IWA Q;  3I4N H;  2NTS A;  4OEM B;  1IBM L;  2WB1 G;  2NTT A;  2MGS A;  2JXM B;  4K5X A;  5CC4 A;  4DV6 L;  3CPW A;  1AE2 A;  1WTV A;  3TP7 A;  3M9B A;  4GKK Q;  3T1H L;  1IW7 D;  4A3M B;  3V2T A;  1WTO A;  3ERS X;  2ZM6 Q;  1G51 A;  3T1Y Q;  2NB0 A;  3SK8 A;  4H7B A;  3QO2 A;  2A8V A;  1NE3 A;  1F9Q A;  2I07 B;  1VQK A;  4PZ6 A;  4A3D B;  4HED A;  4RH6 A;  2K5W A;  4UY8 C;  2I5H A;  1JJC B;  4XIG S;  1XYI A;  3J81 L;  3GTQ B;  1DZ1 A;  1LO5 D;  2R7D A;  5C44 H;  4FDB A;  4OO1 H;  1E7Z A;  4IQZ A;  2KCT A;  3GV6 A;  4EX5 A;  4HMJ A;  4AYB E;  3J7A F;  1BCP C;  4KKS A;  2PZT A;  1QVC A;  2ZXR A;  4KKT A;  1Y1V G;  2A1A A;  4LF6 Q;  1A2T A;  5DM7 3;  4J8Q A;  5HGT A;  5CBA E;  1BKB A;  1PTO B;  1F2M A;  2UXB L;  2PW7 A;  1LTA D;  1PRT F;  3H94 A;  1RJT A;  3LGJ A;  1SXT A;  2E2D C;  3SGI A;  2DJF C;  1C4Q A;  2SEB D;  3T56 B;  1TY0 A;  3ICE A;  3EFX D;  1HFN A;  2K5V A;  3DWA A;  4GKJ Q;  1HR0 W;  2YTY A;  1KD1 C;  1KDC A;  2HIV A;  1EIH A;  2UU9 L;  3A8K E;  5LMU L;  4JBK A;  2GA4 B;  2J0T D;  1O7I A;  4ZUJ A;  1XXG A;  3QB3 A;  3CCV A;  4ZLT F;  5IP9 H;  4PG3 A;  3C1E A;  1WCM H;  2B29 A;  1WTR A;  2VUM H;  1NR2 A;  2RBM A;  2RHQ B;  4DV4 L;  1CHQ D;  1DON A;  1VQM A;  4P2C B;  1LUZ A;  3WWV A;  1N34 L;  1ILQ A;  3KDF A;  4K6D A;  3OMG A;  4BBR G;  3ZJY C;  5IGF A;  1OXU A;  1EU4 A;  4G7Z C;  2UUA Q;  1MBY A;  2WKD A;  1VQ9 A;  4ZYS A;  3T16 A;  4LUZ A;  1X55 A;  2IX1 A;  2AWO A;  4YCU A;  1RCV D;  4BY7 B;  4N9P A;  3S14 B;  1WTH A;  1EYC A;  1STA A;  1SE3 A;  3K81 C;  3Q23 A;  3W5O A;  4QB4 A;  3I4L A;  2BDO A;  1STB A;  4JI6 Q;  1UWV A;  4B3M L;  3S1M B;  3W1B A;  3MTS A;  2K01 A;  2SNS A;  3RR5 A;  4DN4 M;  1VQA A;  5JPM C;  2B2W A;  1JWM D;  3NP8 A;  1LTG D;  4NP5 A;  1T9H A;  2FIN B;  1TWC B;  2EQS A;  4IUT A;  3CCQ A;  5EAY A;  4K0K Q;  2A6E C;  1O78 A;  2DNC A;  3VR3 A;  1I3Q B;  4FF4 A;  5I9O A;  2F0K A;  4KJN A;  4DK0 A;  4OON A;  1GM5 A;  3UI2 A;  2QDB A;  3MEH A;  4O0A A;  2O4X A;  3R3O A;  4YCV A;  5EPK A;  5C3E G;  4DR6 L;  3Q8D A;  2M2L A;  2KQ3 A;  4BBS H;  4LF8 Q;  3S2H H;  1NMF A;  2M9V A;  3DEO A;  3IKJ A;  1SN8 A;  1IL8 A;  1KRS A;  1L2F A;  1RTO A;  1MJC A;  2CQA A;  1HUM A;  4A3J G;  3EA6 A;  3HOY H;  2JA9 A;  1B3Q A;  2OQ0 A;  1EYA A;  3OW7 A;  1CQV A;  4DR7 L;  1U4L A;  1NR4 A;  4IPD A;  1WTX A;  3PV0 A;  1EEI D;  1LT3 D;  2LXK A;  1I50 H;  4JBJ A;  1VQI A;  1WFQ A;  1C7Y A;  2FFK B;  5FJ8 H;  1AZQ A;  3HOX G;  1SYD A;  4C3J H;  3IFD A;  3U4V A;  3QOJ A;  3SK5 A;  2B2U A;  4B3M Q;  2WB1 E;  1A3T A;  5C6A A;  1MJE A;  1A2U A;  4ZCK A;  3A54 A;  3NBH A;  5D14 A;  3S1N H;  1NAP A;  2OWO A;  3CCS A;  1BUV T;  5C4X G;  3GTJ B;  2TSS A;  4DR6 Q;  1RD9 D;  4QJF A;  2Z8L A;  1I4X A;  5BN5 A;  3WDN A;  5C0X I;  3MXN A;  4IUP A;  3E3X A;  3HKS A;  4KD3 A;  4OHJ A;  1S4Z A;  5CMD A;  1CT1 D;  1VQJ A;  2VQF L;  4A3F G;  4LFB L;  1SND A;  2ZTC A;  3D0F A;  1HTP A;  1GUW A;  2I5M X;  2LS0 1;  2VQE L;  4HIO A;  2Q2U A;  1II3 A;  1XMQ L;  3K5N A;  4X66 Q;  4B08 A;  1QOH A;  1V8Q A;  3PUV A;  3I4N G;  3AFQ A;  3C2P A;  2WAQ E;  1TII D;  4BY1 G;  2QA4 A;  1PZJ D;  2EJG C;  2EYP A;  3U9O A;  1YNJ D;  3TRE A;  3E9H A;  2G5D A;  1LAC A;  1SNM A;  2AQ2 B;  4G57 A;  1KDB A;  4POF A;  4FXG C;  4C1N I;  3QJY A;  3LWU A;  3IAY A;  4ODG A;  5JEA G;  1SJH D;  3CHB D;  5KNC A;  1HA5 A;  4DR5 L;  4G7H C;  1PV4 A;  5AJ3 L;  3RUZ A;  4DXF A;  4JI2 Q;  3AFP A;  1NSN S;  4ZRZ A;  2F4V Q;  4C2M H;  3O13 A;  1WTQ A;  4C3H H;  1A0I A;  5FLM H;  1YEZ A;  3I73 A;  2K32 A;  5C44 G;  3NWS A;  4A3K G;  4DR2 Q;  2YV5 A;  2F0Q A;  2FJ2 A;  4U67 3;  3S1R B;  4DV7 Q;  3PSI A;  2XRQ D;  2KED A;  1JT8 A;  3AMU A;  2K14 A;  1B2T A;  4A3G B;  3BVZ A;  3RNU A;  1STG A;  3IL8 A;  3GDE A;  4Y7N B;  3WOE A;  5JVH 3;  1E2Z A;  3D4R A;  1HNW Q;  5K36 H;  1SYG A;  5M5Y B;  5IE8 A;  2RSO A;  3HOZ B;  1XMQ Q;  2AHO B;  4GS3 A;  1PRT B;  2H4O A;  2E2J B;  1LTT D;  3A8J E;  1H9J A;  1T5E A;  1UEB A;  2RQX A;  2O2L D;  3KDF B;  4NXM Q;  3E9I A;  3S2D B;  3NHH A;  1VS0 A;  2E76 C;  1K73 C;  1VMC A;  4KN4 C;  1TWF H;  1BCP F;  1NUC A;  3W2D A;  4RKB A;  1BXT A;  4K8J A;  4HJ7 A;  3J7Y W;  5IP9 G;  1CZW A;  4X64 Q;  1WCM G;  3I8Z A;  1M90 C;  1JE4 A;  2CHB D;  5E3F A;  3SK4 A;  3P20 A;  2RHS B;  2PZW A;  3CCJ A;  2A69 D;  1QZG A;  5A2Q E;  2JA8 H;  2JEB I;  2WAQ B;  2OCE A;  4DAY B;  3MEF A;  3J80 i;  4H0L C;  2KBN A;  5EKL A;  2ENB A;  2ATW A;  2NVX B;  1E3P A;  2YU9 H;  3I56 A;  3PQI A;  3UDF A;  3L9A X;  5E4W C;  1FNV A;  2OQK A;  1JMC A;  4KTA A;  2R7Z B;  3PO3 H;  1OXX K;  4JI8 L;  4X62 Q;  1VQ6 A;  4ZKB B;  1N36 Q;  1A15 A;  3F1Z A;  1IL2 A;  2XRS D;  2JSO A;  2PQA A;  3SEB A;  4EGV A;  1YNX A;  1AZP A;  1X6O A;  1IW7 C;  3I4M B;  1PH4 A;  1F9P A;  2DGY A;  4IO9 A;  2J7Z A;  1BNZ A;  4QL5 A;  5FO9 B;  3U58 A;  4IUQ A;  3SK6 A;  3FPU B;  4XXE A;  1X3Q A;  2B63 B;  3TME A;  2N55 A;  1Y1W B;  3P75 A;  1HZA A;  1S5B D;  4P71 A;  4RGT A;  2L0C A;  2N49 A;  2XWB B;  4IPG A;  1HZB A;  4QQB X;  3I91 A;  4EVO A;  1E22 A;  4JC0 A;  3DLL A;  2HUG A;  5LL6 S;  1OO9 B;  1LYL A;  1NJI C;  5GAD C;  2IWH A;  1B3A A;  4GNX B;  4LUV A;  1HA6 A;  1H9S A;  3HFZ B;  2F0N A;  4GZY C;  4HR7 B;  1R9T H;  2GVA A;  4A76 A;  4PZ7 A;  3HOY G;  1QCB D;  2E2I H;  2NN6 I;  4M8A A;  3E5S A;  5IYD H;  3TQY A;  1K0S A;  1I94 Q;  1B44 D;  4MZ9 A;  4P74 A;  5I9P A;  4JYA L;  1B50 A;  1GXD C;  2B2W C;  5C4J B;  3NBH B;  4A93 B;  2KHI A;  4JI8 Q;  3NEN A;  3IFT A;  4C3J G;  4NKL A;  3RZO H;  1PHJ A;  3CAM A;  5M3M H;  4R4T A;  2NVY B;  2HHH Q;  1L1O B;  4MTK A;  3LX0 A;  1N32 Q;  1KC8 C;  3MXN B;  3AU7 A;  4DPG A;  5GRO A;  3ERO A;  3J81 c;  1JOR A;  4CBV A;  3HKZ B;  1NNX A;  2E2H B;  2QGQ A;  4TSS A;  5C3W A;  1VMP A;  2PI2 A;  1D8L A;  2YTV A;  4BBR H;  1JOQ A;  2XWJ B;  2JN4 A;  2EYJ A;  4B3T L;  2PNR C;  2B2Y C;  2F0V A;  2ZXP A;  1XWE A;  3A0J A;  2JA5 G;  3DM1 A;  5JJI A;  3I2Z A;  4HIK A;  1B7Y B;  5GQO A;  1XPR A;  3SHL A;  1S5E D;  2CH4 A;  4X65 L;  2SNM A;  1K28 A;  1J9O A;  4RHS A;  3QOL A;  4Q0F A;  1I4P A;  3H6M A;  2JA7 H;  3ITP A;  4HJ9 A;  3BU2 A;  1VQ8 A;  1GUS A;  1IBL Q;  1KXL A;  4ZQ3 A;  4IUR A;  3M3Y B;  3CQZ H;  3VR2 A;  1D6E C;  2KEC A;  2EYF A;  5JPN C;  3SDZ A;  4G7O C;  4DR3 L;  1KTK A;  1TR5 A;  1HNX L;  2FXQ A;  4JK1 C;  3HOW B;  5LMN L;  1HNZ L;  5KRU A;  1TS3 A;  1I6H H;  1Z9F A;  1I4R A;  5KYI A;  1P16 A;  3CCE A;  2Z0S A;  4N8F A;  4ALP A;  4DUZ L;  3M4O H;  4B3R Q;  3H0G G;  4RA8 A;  3FKI B;  4V0B A;  1TS4 A;  4A3J H;  1EEF D;  4YWK A;  2DY8 A;  1LT4 D;  2X69 A;  5E4X A;  4UP8 A;  3PCO B;  3HOU G;  3PO2 G;  4PMW A;  4WJW A;  2EY5 A;  3N6R A;  4O1N A;  3TSS A;  4KKU A;  1ROD A;  1CUK A;  2RA4 A;  1K83 H;  1EY9 A;  3K0X A;  2MHV A;  4BA1 I;  4F87 A;  2KHJ A;  4YY3 Q;  1VQL A;  1JJ2 A;  4IJL A;  3CCU A;  4X65 Q;  2Q8R E;  5T1G A;  1HUN A;  3HOV G;  3TDQ A;  3F2B A;  3HOX H;  4IFD H;  1GHK A;  3RZD H;  2R93 H;  3NTH A;  2OEO A;  1NMG A;  3CRL C;  3N52 A;  2L9H A;  3VA5 A;  3Q22 A;  1CSQ A;  3K5M A;  1TQO A;  2R92 H;  2Z4H A;  4IZ8 A;  1QUQ A;  4JW0 A;  2ZTE A;  1QVF A;  4IUN A;  5ELF A;  4LF7 Q;  3NWT A;  3D4W A;  3A5U A;  5NUC A;  4JV5 Q;  3KK7 A;  1F9S A;  1V1Q A;  3DHQ A;  4WOR A;  2FMM A;  4OGQ C;  2FHT A;  5I2Y A;  1HNZ Q;  2PI2 E;  4XTC S;  4OO1 I;  1A62 A;  2N78 A;  4CDD C;  1BCP B;  2GVB A;  2PMZ B;  3J81 j;  3U4Z A;  5T1I A;  2AQ3 B;  1DCZ A;  4A3L G;  5KIX A;  5GAG C;  3KJP A;  1JOK A;  1VQF A;  2JJQ A;  4UP9 A;  1WTW A;  3K59 A;  2QW7 A;  4DK6 C;  1JR0 D;  2PW5 A;  4CDF C;  4A3F H;  3RLF A;  2PQA B;  3NSW A;  4TVA B;  2UXC L;  1UNS A;  3BZK A;  4JPB W;  4MIU A;  3OW2 A;  3VYU A;  1VQO A;  3R8B A;  3BYY B;  3S9W A;  1ASZ A;  4BY1 H;  1HPC A;  1KLU D;  2WII B;  2JQO A;  4X3T A;  1HQM C;  4QUC A;  2XNA C;  1PFN A;  2RCF A;  3PO3 G;  4NXN Q;  4JI0 L;  1IKL A;  1LT5 D;  3AB9 A;  2ZJP A;  3G7L A;  1W2B A;  3G6J B;  3X3N A;  3OHX C;  3UE1 A;  5K5P A;  4DV5 L;  1YNJ C;  1TVX A;  5JEA H;  2JA6 B;  3GTK B;  2EYL A;  4K5V A;  4AIM A;  2UUC L;  2RCN A;  5M5X H;  1IBK Q;  3CRK C;  1H9K A;  4S3S A;  2NVQ H;  3PUW A;  2VUM B;  3S15 H;  2OTJ A;  2RVL A;  3AYH B;  3J7Z C;  2K1B A;  1SSO A;  4OX9 Q;  4DR4 L;  2QEJ C;  2AQ1 B;  4A3K H;  1DOM A;  4RAU C;  1EQT A;  1D5Z C;  1CHP D;  4B9W A;  1RIP A;  1S40 A;  5C0X J;  1UAP A;  4DUY L;  3HEJ A;  4JG2 A;  1MHW C;  3F2U A;  2NVT B;  1SR3 A;  1AH9 A;  2F0O A;  1EIG A;  2M00 A;  1D1K A;  1TS5 A;  3DUZ A;  1GUN A;  1FNW A;  2LXJ A;  2Z6B A;  1PFM A;  4DF7 A;  3LNN A;  4DK1 A;  5I6Y A;  3VDY A;  1ML0 D;  3GTL B;  2XIW A;  3GO5 A;  1EOT A;  2N88 A;  1Q8I A;  4CJ1 B;  1WVL A;  2PQE A;  1WD1 A;  1H9R A;  1IBM Q;  3CXC A;  5IYD G;  3G4S A;  2Z6K C;  1VQP A;  3C3L A;  2MFI A;  4DV6 Q;  2QCP X;  1I5F A;  3ULL A;  5IT9 L;  4OEL B;  3GD7 A;  2ZTD A;  2VL6 A;  3T1H Q;  1U4R A;  1KL9 A;  4RG1 A;  2QIL A;  1EQR A;  3I3C A;  2UUB L;  4JI0 Q;  3SR1 A;  2ZT9 C;  1VQH A;  1PH5 A;  3PGZ A;  4J15 A;  2WAC A;  3SE0 A;  4KK7 A;  5M3M G;  4DV5 Q;  4DV3 L;  1TWA B;  3VR4 A;  1XTC D;  4JI5 L;  2G9H D;  4JI1 L;  4A3M H;  3L2P A;  4C3I G;  1Q81 C;  2R7F A;  2UUC Q;  1QIL A;  3S1Q B;  4BBS B;  4KHP L;  3S2H B;  3MFY A;  1OXS C;  2NZH A;  3OWE B;  5I4D A;  1QZH A;  4Z9C B;  4A3D H;  4RHR A;  2HCC A;  2VY3 A;  3GTG H;  1B8A A;  2A69 C;  3DEP A;  4F7X A;  1XNR L;  3I90 A;  1ESF A;  1CFM A;  3H15 A;  1Y69 U;  1DD2 A;  3JAM i;  3STB C;  5BR8 L;  2AKW B;  2LY7 A;  3K58 A;  2JA7 G;  4ZK9 B;  5CYU A;  2UXB Q;  2WP8 J;  3KF6 A;  3RN2 A;  5IGE A;  1B1Z A;  2ZJQ A;  3P1H A;  1IYU A;  2KVM A;  4RGO S;  2EZV A;  2AWN A;  1SMY C;  2CVR A;  4HJ8 A;  4LAA A;  4BWG B;  1HTL D;  2UUB Q;  3T13 A;  4AYB B;  1FGU A;  2UU9 Q;  5LMU Q;  1FNU A;  4A3I G;  2AUK A;  1XMO L;  4JBW A;  1U4M A;  3S1N B;  1HQR D;  3UDX A;  2A6H D;  1SRO A;  3NUC A;  2QF7 A;  3NTK A;  1L0X B;  4LFA L;  5CBE E;  1GUO A;  1VQB A;  3SVM A;  4JI4 L;  2K5Q A;  4DV4 Q;  1H95 A;  4KN7 C;  4EQ5 A;  1N34 Q;  4HSV A;  1PFB A;  3D6W A;  2KCM A;  2B2Y A;  2B8G A;  5M5W B;  1F9R A;  4WJ4 A;  3PUZ A;  3TZD A;  1RTN A;  2MNA A;  1LLR D;  2B8F A;  4WFN 3;  4A3E G;  2Y0S G;  4EQO A;  1I4H A;  1L0W A;  1QUQ B;  5ELC A;  3V96 A;  4AQY L;  1ET6 A;  5FO8 B;  3AEV A;  3NTI A;  4IUV A;  1PH3 A;  1XJV A;  3TEH B;  4A3C H;  1J5E L;  5BR8 Q;  4IFD G;  5COY A;  1G2S A; 
#chains in the Genus database with same CATH homology
 4X64 Q;  1WCM G;  5IP7 G;  2R93 G;  1M90 C;  3CF5 A;  3PIO A;  3BZC A;  2BH2 A;  3JC6 6;  1N8R C;  1TWH H;  2RHS B;  1PH7 A;  4BY7 H;  5C4J H;  3CCJ A;  3S14 H;  1QZG A;  4A93 H;  2UU9 L;  1NTG A;  1EUJ A;  2JA8 H;  2JEB I;  2UXC Q;  2OCE A;  4DAY B;  2R92 G;  3MEF A;  3J80 i;  2UUA L;  2KBN A;  1FJG L;  5ELN A;  1Q86 C;  1N9W A;  3EN2 A;  2ATW A;  1GVP A;  2XTI A;  4LF7 L;  1EYG A;  4JV5 L;  1E3P A;  2NVY H;  2YU9 H;  3I56 A;  2JK8 A;  1IXR A;  2N3S A;  3UDF A;  3CCR A;  1YZ6 A;  1IZ6 A;  1C0A A;  2JA5 H;  1MKH A;  1BVS A;  2OQK A;  4QGU A;  3J80 c;  1JMC A;  5C3E H;  3CD6 A;  1OXX K;  3PO3 H;  2WAQ G;  4JI8 L;  4X62 Q;  1VQ6 A;  1GKH A;  2H5X A;  1N36 Q;  5M3F G;  4L5S A;  3F1Z A;  1IL2 A;  4JI6 L;  1TWC H;  2PQA A;  1V43 A;  1PH9 A;  1HR0 L;  1YNX A;  2ID0 A;  4JI4 Q;  1X6O A;  1PH2 A;  1PH4 A;  4BXX G;  2CCZ A;  1CKN B;  4P73 A;  2DGY A;  4IO9 A;  4JI7 Q;  4QL5 A;  2Q2T A;  4IJH A;  2R7Z G;  3A74 A;  3OTO L;  3U58 A;  2HQL A;  5FLM G;  4LF9 L;  1RL2 A;  3PF4 A;  2DUD A;  1PVO A;  4DK3 C;  3F2C A;  1K9M C;  4DR7 Q;  5JJL A;  5H1S E;  3J7A 5;  1BBW A;  1HZA A;  3EBE A;  4P71 A;  4PZ8 A;  4K0K L;  4DAM A;  4DR4 Q;  2JA6 H;  3GTK H;  3M4P A;  2N49 A;  3I4M G;  4IPG A;  1HZB A;  5C0X G;  3K8A A;  3U50 C;  4A3B G;  4QQB X;  2V1C C;  1VQC A;  4IPC A;  4GKK L;  1FL0 A;  4GLA C;  1E22 A;  3G48 A;  2ASB A;  3CP0 A;  4JC0 A;  4NXN L;  3DLL A;  1J5E Q;  4DUY Q;  2B63 G;  4LF8 L;  1LYL A;  3GTQ H;  3S17 H;  4DR1 Q;  1Y1W G;  1NJI C;  5GAD C;  1OTC A;  3PF5 A;  4GNX B;  2IX0 A;  4LUV A;  5K36 G;  1VQG A;  1K3R A;  2RF4 A;  3HFZ B;  1S3O A;  1R9T H;  2GVA A;  4GLV B;  4A76 A;  4PZ7 A;  3HOY G;  3H0G H;  3PUX A;  1TXY A;  2E2I H;  2NN6 I;  1SE8 A;  2K5N A;  1U5K A;  1IBK L;  2NVT H;  1X54 A;  2UXD Q;  1PFS A;  3TS2 A;  5IYD H;  3TQY A;  3HOU H;  1I94 Q;  5C4X H;  4MZ9 A;  4GOP C;  4P74 A;  1XPO A;  4OX9 L;  3PO2 H;  1X3F A;  5HGQ A;  4JYA L;  1ASY A;  1YJ9 A;  4H02 A;  3NBH B;  1EIF A;  2KHI A;  2VW9 A;  3BJU A;  5IYB H;  1M1K C;  3GTL H;  4O2D A;  2CWP A;  3FKI H;  3NEN A;  4JI8 Q;  4IPH A;  4A4I A;  1U0L A;  3J81 i;  1X3G A;  4JCV E;  5ELO A;  1YJN A;  1SLJ A;  4X6A H;  2F3I A;  3RZO H;  2A19 A;  3CAM A;  5M3M H;  2NN6 G;  1PHJ A;  1HR0 Q;  3HOV H;  4R4T A;  4DV3 Q;  4R4I A;  2HHH Q;  1L1O B;  2HIX A;  4DV1 L;  4LFB Q;  2YTX A;  5FLX c;  2VQF Q;  4JI5 Q;  1N32 Q;  3M4Q A;  4LF6 L;  1KC8 C;  3MXN B;  2MO1 A;  4DPG A;  4JI1 Q;  5GRO A;  4A93 G;  3J81 c;  1WI5 A;  2CFM A;  4LF5 L;  2JA8 G;  2VQE Q;  1IYJ B;  4LF9 Q;  2QGQ A;  3CW2 C;  1CSP A;  2PI2 A;  1GO3 E;  5IWA Q;  4KHP Q;  1D8L A;  4A75 A;  2YTV A;  3I4N H;  4BBR H;  1IBM L;  2WB1 G;  1TWA H;  4KI0 A;  1NBW A;  3RLN A;  4DV6 L;  2K75 A;  4B3T L;  3CPW A;  2VZA A;  1UE5 A;  1AE2 A;  3M9B A;  3A0J A;  3T1H L;  4GKK Q;  2JA5 G;  5JJI A;  3I2Z A;  3HKZ G;  4HIK A;  3ERS X;  2HT1 A;  1XNR Q;  1B7Y B;  2ZM6 Q;  1G51 A;  5GQO A;  3T1Y Q;  3S1Q H;  1YHQ A;  1XPR A;  1EFW A;  4X65 L;  2A8V A;  1Q12 A;  2VS1 A;  1E24 A;  1NE3 A;  4QY7 A;  2F52 A;  1VQK A;  4PZ6 A;  4A3L H;  2BA0 A;  4YCW A;  2JA7 H;  3AQQ A;  4UY8 C;  4JI3 L;  4HJ9 A;  4DR5 Q;  4A3M G;  3BU2 A;  2I5H A;  1JJC B;  4UP7 A;  4XIG S;  1VQ8 A;  5AJ3 Q;  4X66 L;  1IBL Q;  1KXL A;  1SMX A;  1B70 B;  3CQZ H;  2R7D A;  5C44 H;  2Q2I A;  4FDB A;  4ME3 A;  1P8L A;  3ER0 A;  3FHW A;  4A3D G;  4GOP B;  3E0E A;  4QIW E;  1SRU A;  1E7Z A;  4IOC A;  2KCT A;  4DR3 L;  3S1M H;  4GNX A;  4EX5 A;  1HNX L;  2FXQ A;  2EXD A;  2I0Q A;  4AYB E;  5LMN L;  1HNZ L;  3UE0 A;  4YHH L;  1XMO Q;  4B3S L;  1QVC A;  1W3S A;  1I6H H;  1PYS B;  1Y1V G;  1Z9F A;  2IT1 A;  3NEM A;  2A1A A;  4DV1 Q;  1A63 A;  4LF6 Q;  1P16 A;  3CCE A;  2Z0S A;  4ALP A;  4DUZ L;  3M4O H;  1YI2 A;  4LFA Q;  1Q7Y C;  4B3R Q;  3H0G G;  3KLW A;  2Y0S E;  3RLO A;  1BKB A;  1I3Q H;  2UXB L;  4UPA A;  3HOW G;  3KFU A;  2Z6K A;  4A3J H;  1OXT A;  4JI2 L;  2F4V L;  4YWK A;  1HJP A;  1PA6 A;  3LGJ A;  3SGI A;  4UP8 A;  3PCO B;  1KQS A;  3HOU G;  1JJG A;  3PO2 G;  1JE5 A;  3ICE A;  4PMW A;  4Y7N H;  3F2D A;  2LSS A;  2K5V A;  4DR2 L;  4GKJ Q;  1HR0 W;  5M5Y H;  2YTY A;  3UDG A;  1KD1 C;  2BH8 A;  4DV7 L;  1N33 L;  3FKI G;  1L1O A;  1CUK A;  1EWI A;  1K83 H;  2HIV A;  2MO0 A;  2IHF A;  2C35 B;  3K0X A;  4BA1 I;  2KHJ A;  3KOJ A;  4YY3 Q;  5LMU L;  4AQY Q;  1VQL A;  1JJ2 A;  4JBK A;  4IJL A;  3CCU A;  4X65 Q;  4JOI A;  2E2J H;  2D0O A;  4LFC L;  3HOV G;  5M5W H;  1O7I A;  3F2B A;  2JE6 I;  3HOX H;  4HID A;  3CCV A;  5IP9 G;  5IP9 H;  1EOV A;  2CWA A;  4PG3 A;  3RZD H;  2R93 H;  1WCM H;  5E7N A;  5IP7 H;  2B29 A;  3H3V H;  1NMG A;  2VUM H;  1HNW L;  3S24 A;  1X56 A;  1PYB A;  4HJ5 A;  2RHQ B;  2R6G A;  4DV4 L;  3ULJ A;  1CSQ A;  3I55 A;  3TS0 A;  3GTP H;  1VQM A;  3WWV A;  1LUZ A;  1N34 L;  2R92 H;  3KDF A;  2ALY B;  4BBR G;  3ZJY C;  1K8A C;  1OXU A;  2MQH A;  2UUA Q;  1QUQ A;  1FJG Q;  2ZTE A;  1QVF A;  4LF7 Q;  1VQ9 A;  3A5U A;  4LUZ A;  4LF4 L;  4JV5 Q;  4NXM L;  1V1Q A;  1X55 A;  3ULP A;  2IX1 A;  4HIM A;  2AWO A;  4YCU A;  1HNZ Q;  1A8V A;  2PI2 E;  1WJJ A;  4XTC S;  4YHH Q;  1A62 A;  1VQE A;  2N78 A;  4POG A;  3PIP A;  4L5T A;  4OO1 I;  2GVB A;  3J81 j;  3K81 C;  4A3C G;  2XGT A;  5M3F H;  3U4Z A;  3W5O A;  4A3L G;  2BA1 A;  4JI6 Q;  5GAG C;  4X64 L;  3KJP A;  2GN5 A;  1VQF A;  1PH1 A;  1UWV A;  2JJQ A;  2AMC B;  1Y14 B;  4UP9 A;  4B3M L;  2JEA I;  3NEL A;  3G71 A;  3K7A H;  4DK6 C;  3GTJ H;  4BXX H;  1VQ7 A;  4A3F H;  3W1B A;  4IFD J;  4GLX A;  3RR5 A;  4BY7 G;  3RLF A;  1Q8K A;  1VQA A;  1HZ9 A;  2PQA B;  3RN5 A;  3TRZ A;  4TVA B;  1VQ5 A;  2R7Z H;  4C3I H;  2UXC L;  3OTO Q;  1J6Q A;  1PH8 A;  3BZK A;  2OTL A;  3OW2 A;  3F8T A;  3KYH C;  4OO1 G;  3A5Z B;  1T9H A;  1VQO A;  2EQS A;  3CCQ A;  1VQN A;  5EAY A;  4K0K Q;  3OYY A;  1ASZ A;  3I4M H;  1X9N A;  3D31 A;  2QEX A;  4BY1 H;  2K52 A;  2E5L L;  1XTD A;  2JQO A;  1Q1B A;  3L0O A;  4OON A;  1GM5 A;  1KHI A;  4O0A A;  4YCV A;  4DR6 L;  1LM0 A;  1JT8 A;  4X62 L;  5C3E G;  3PO3 G;  4NXN Q;  3Q8D A;  4JI0 L;  1N36 L;  1NY4 A;  4YWL A;  4BBS H;  4LF8 Q;  1CKN A;  3S2H H;  1NMF A;  2ZJP A;  1W2B A;  1SN8 A;  3UE1 A;  4DV5 L;  1KRS A;  4JBM A;  1L2F A;  2IY5 B;  1KIX A;  1MJC A;  2VNU D;  5JJK A;  3CME A;  4LW1 A;  1OXV A;  4GN5 A;  4LWC A;  4A3J G;  3HOY H;  5J3B A;  2JA9 A;  4IFD I;  3DM3 A;  4AIM A;  2OQ0 A;  5IYC H;  2IHE A;  3H3V I;  2K4K A;  2UUC L;  2RCN A;  5M5X H;  1IBK Q;  4DR7 L;  5IT9 c;  4IPD A;  1AE3 A;  1CKO A;  3PV0 A;  2NVQ H;  3PUW A;  4LF4 Q;  3S15 H;  3EIV A;  1VCI A;  2OTJ A;  3AYH B;  3J7Z C;  2LXK A;  3CCL A;  4OX9 Q;  1I50 H;  1LTL A;  3GTM H;  4DR4 L;  3KF6 B;  4JBJ A;  2JA6 G;  1VQI A;  4JYA Q;  1WFQ A;  4A3K H;  2Q2H A;  1C7Y A;  5FJ8 H;  2D0P A;  1RIP A;  1S40 A;  3HOX G;  5C0X J;  4C3J H;  3G6E A;  4DUY L;  1VQ4 A;  4JG2 A;  4A3I H;  3U4V A;  4GNX C;  1SR3 A;  1AH9 A;  3CCM A;  4B3M Q;  2VUM G;  2WB1 E;  4MNO A;  4DV2 L;  4P72 A;  2LXJ A;  1CKM A;  3CMA A;  1DGS A;  1BBU A;  3VDY A;  1MJE A;  5IY0 A;  3S1R H;  3GO5 A;  4LF5 Q;  3HKZ E;  5JEA J;  5DLQ E;  1XNQ L;  5LMN W;  2WFW A;  2UXD L;  1E1O A;  1Q1E A;  2KEN A;  3B6Y A;  3S1N H;  4GN4 B;  3STB D;  4A3G H;  1IBM Q;  3CXC A;  5IYD G;  3G4S A;  1WOC A;  2Z6K C;  1VQP A;  1I94 L;  2MFI A;  3CCS A;  4DV6 Q;  2OWO A;  4B3T Q;  5C4X G;  1I5F A;  3ULL A;  2E5L Q;  2ZJR A;  1E1T A;  3GD7 A;  4OXP A;  2ZTD A;  2VL6 A;  2N8N A;  3UDI A;  3T1H Q;  4A3E H;  3S16 H;  1KL9 A;  2CQO A;  4RG1 A;  4DR6 Q;  2EIF A;  1EQR A;  5IYB G;  2E2H H;  4AH6 A;  4QJF A;  2UUB L;  4JI0 Q;  3HOZ H;  1YBY A;  4Y52 H;  1YHA A;  4L5Q A;  1VQH A;  5C0X I;  1QVG A;  1PH5 A;  1L1O C;  2K50 A;  3PGZ A;  4J15 A;  4DKA C;  4NB3 A;  4R4C A;  3HKS A;  5M3M G;  1TWG H;  4DV3 L;  4DV5 Q;  5GAE C;  2HHH L;  4L5R C;  4JOI C;  2YYZ A;  1VQJ A;  2VQF L;  4JI5 L;  4A3F G;  4LFB L;  1N32 L;  2ZTC A;  3D0F A;  4JI1 L;  2I5M X;  4A3M H;  3L2P A;  1Q81 C;  4JI3 Q;  2VQE L;  3S2D H;  2R7F A;  4HIO A;  2Q2U A;  2UUC Q;  1XMQ L;  1Q46 A;  1JB7 A;  5IWA L;  2D62 A;  4X66 Q;  4KHP L;  1OXS C;  2NZH A;  3PUV A;  3I4N G;  3AFQ A;  2WAQ E;  1QZH A;  4A3D H;  4IOA A;  2VY3 A;  4BY1 G;  2QA4 A;  1D7Q A;  4KLK A;  4YWM A;  4OWX B;  1YVC A;  1MIU A;  3KJO A;  3GTG H;  1B8A A;  3TRE A;  3E9H A;  4DR3 Q;  4DV0 L;  1HNX Q;  3KF8 B;  4RMF A;  4APV A;  1XNR L;  1YIT A;  2ZM6 L;  1X65 A;  5LMN Q;  2K5H A;  3T1Y L;  1K0R A;  1S72 A;  4POF A;  4BBS G;  4B3S Q;  1X3E A;  3M3Y H;  3H15 A;  1EIY B;  1Y1V H;  3M85 A;  3I7F A;  4R4O A;  4GN3 B;  3JAM i;  3STB C;  5BR8 L;  4DV2 Q;  5JEA G;  2AKW B;  4DUZ Q;  2NVX H;  1KAW A;  2JA7 G;  4OWT B;  4DR5 L;  5IYC G;  3HOW H;  2UXB Q;  1PV4 A;  1G6P A;  2WP8 J;  3KF6 A;  3RN2 A;  5AJ3 L;  4GOP A;  4JI2 Q;  1IBL L;  3AFP A;  2ZJQ A;  3I4O A;  2F4V Q;  4C2M H;  1G29 1;  2B3G A;  1A0I A;  2PNH A;  4C3H H;  1UE6 A;  3JAM c;  1HH2 P;  4P75 A;  5FLM H;  1UE7 A;  1YEZ A;  3PUY A;  1V9P A;  5C44 G;  1SFO H;  2AWN A;  3W1G A;  1EQQ A;  1KRT A;  4DR2 Q;  4A3K G;  2YV5 A;  1YJW A;  4HJ8 A;  5GAH C;  3CC4 A;  5FJ8 G;  2UUB Q;  4DV7 Q;  3PSI A;  3CC7 A;  2E8G A;  4LUO A;  1FGU A;  4R4Q A;  1N33 Q;  1HZC A;  2UU9 Q;  4A3B H;  1XNQ Q;  4BA2 I;  5LMU Q;  1C9O A;  4HJA A;  4A3I G;  3K7U C;  1YIJ A;  2K14 A;  1XMO L;  4JBW A;  2NZO A;  3UDX A;  4LFC Q;  4DNI A;  1SRO A;  2B63 H;  2I5L X;  3RNU A;  3M7N A;  1Y1W H;  3GDE A;  1FVI A;  4LFA L;  3K80 C;  4B3R L;  1HNW Q;  3CC2 A;  5IE8 A;  1VQB A;  4JI4 L;  4AYB G;  4DV4 Q;  1XMQ Q;  2AHO B;  1H95 A;  3CPF A;  2ES2 A;  4EQ5 A;  4GS3 A;  1WYD A;  4JI7 L;  1N34 Q;  4A3G G;  2KCM A;  1GD7 A;  4TQU S;  4KHZ A;  4WJ4 A;  3PUZ A;  1PH6 A;  1VQD A;  4NPS A;  3L7Z C;  2MNA A;  4OWW B;  1UEB A;  4GKJ L;  1Z47 A;  4A3E G;  1Q82 C;  3KDF B;  4DV0 Q;  2Y0S G;  2L15 A;  4NXM Q;  3E9I A;  1VS0 A;  1K73 C;  3HOZ G;  1UE1 A;  1L0W A;  1QUQ B;  4LNQ A;  1XPU A;  4MTN A;  4YY3 L;  4AQY L;  1TWF H;  3AEV A;  3IRB A;  5HY6 A;  1PH3 A;  1XJV A;  3TEH B;  2PMZ E;  3GTO H;  4A3C H;  4R1J A;  3FP9 A;  1J5E L;  4HJ7 A;  5BR8 Q;  1K8G A;  1YHB A;  2CKZ B;  4IFD G;  4WJ3 M;  4DR1 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...