1N34L

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n34L00
1PH6A 4HJ8A 5FLMG 1E3PA 2FXQA 2MFIA 4JV5L 2A19A 2AHOB 1EOVA 2R93H 1QZGA 1KD1C 3BJUA 2HIXA 5ELNA 5GQOA 1VQDA 2JA6G 1X6OA 1JB7A 3RZOH 2H5XA 1QZHA 4BBSH 4LWCA 3ULLA 4WJ3M 1JJ2A 4JBJA 2VQEL 1N32L 1PV4A 3KYHC 1PH1A 3U58A 1Q1EA 4GS3A 2C35B 5M3MH 3CCUA 1Q12A 3CD6A 4DR6Q 4KHPQ 1WCMH 1KIXA 4JI3Q 2Z0SA 4GNXB 1JE5A 1OXTA 1CSQA 2N78A 5M5XH 3CCEA 3UDXA 4UP9A 4DV3Q 2UUBL 4B3MQ 3IRBA 2OTLA 1NJIC 1LM0A 4MZ9A 2N49A 3J81i 1X56A 4X62Q 1ASZA 3NELA 3TRZA 4AQYQ 3S16H 3H0GH 1Q7YC 3S24A 1HNXL 3S1NH 4A3GG 3STBD 3I7FA 3KDFB 1XMOQ 3M4QA 4DR5Q 1PH9A 2KCTA 3S1RH 1VQNA 4DV4Q 3H3VH 2ASBA 1X3GA 4A3JH 4LF9L 2ZTCA 1NY4A 1KQSA 4B3RL 4R4IA 4DR2L 3HOYG 2HHHQ 2XGTA 1YZ6A 3BU2A 1WJJA 1PYSB 4DUZQ 1V1QA 1YEZA 3F2DA 1IBLQ 4AIMA 4GLXA 1M1KC 1IBKQ 2NVXH 2HT1A 3UDGA 2B3GA 1EQQA 4JI8Q 5FLMH 1OTCA 3S1MH 2UU9Q 1N33Q 4DUYQ 1T9HA 3CCQA 3HOUG 4R4OA 3GTQH 3CCMA 3EN2A 3CCLA 4TQUS 2YU9H 5C3EG 4LF7Q 4NXNQ 4JI5Q 4R4CA 3HOXG 1VQLA 4IO9A 1N36L 4QQBX 3CP0A 4Y52H 5GROA 4AYBE 4POGA 3G4SA 2VZAA 4LF8L 4DV0L 3M7NA 1G51A 1E1TA 1SE8A 4JI7Q 1K83H 1EIYB 1PVOA 1WOCA 1HJPA 1C7YA 2JE6I 3RLOA 2QGQA 1CSPA 4R1JA 3UE0A 4JI4L 1VQHA 1FJGL 2K5NA 2RF4A 5IYDH 3AFPA 1ASYA 4UPAA 4JV5Q 1A62A 4IOCA 1X54A 4JI1Q 2MO1A 2BA1A 4GN4B 2RHQB 3PF4A 3PUVA 2R6GA 4A3BG 2F3IA 1TWFH 5IP7G 2VQEQ 1VQOA 1VQFA 1RIPA 3PUYA 3HOYH 1YHAA 1PH7A 1N34L 4C3JH 4MTNA 4AYBG 5FJ8G 1QUQA 2EIFA 1CUKA 4L5RC 4KHPL 2UUBQ 3E9IA 4JI3L 1L1OB 5IYBG 2E2IH 1K8AC 4ME3A 1M90C 2ZJQA 1XPUA 1HR0W 1H95A 4HJ5A 3RN2A 3OYYA 1GO3E 2NZHA 3HOXH 1U0LA 4A3FG 3UDFA 1Z9FA 1HNZQ 3W5OA 5GADC 2YYZA 2ZTDA 1NBWA 5EAYA 2GVBA 4DAMA 1UE6A 2IT1A 4GOPC 1X9NA 2OWOA 1HR0L 1FL0A 4OWWB 1XMOL 3S15H 4DR5L 2I5HA 1NTGA 1IZ6A 1BBWA 2EQSA 2XTIA 2YV5A 2VUMG 2K50A 2AKWB 3AYHB 4HIOA 3TEHB 2CFMA 1W3SA 1YNXA 4QJFA 4TVAB 3AFQA 4DR4L 3M85A 1VQCA 1CKNB 1YJNA 1PH4A 4HIKA 3PUXA 2HHHL 2JQOA 4DUZL 4IOAA 4JBWA 1RL2A 1IBLL 1VQ6A 1K8GA 1IBKL 4X6AH 4BXXH 4A3DH 4JI8L 3K81C 4GKJL 2UU9L 1N33L 2ES2A 5GAGC 5IP7H 1NE3A 3K8AA 2D62A 5IE8A 5FLXc 3BZKA 2I5LX 4PG3A 2ZM6L 4LF7L 4LFBL 4YWMA 4NXNL 2YTXA 3F8TA 1I94Q 5JJIA 3BZCA 5FJ8H 5AJ3Q 4LF8Q 4DV0Q 2L15A 4DK6C 1QVGA 3J7A5 2KHIA 4HJAA 4A3KH 2JA5H 3A0JA 2MQHA 3PSIA 1UWVA 5IYBH 4A75A 1GM5A 4JI7L 3FP9A 3WWVA 1NMGA 2K75A 4P71A 4JI4Q 4A3IG 4EQ5A 2OCEA 2ZJPA 4A3LG 3FKIG 4A3FH 1BVSA 1SLJA 3FHWA 5C0XJ 4DKAC 3J80c 2JA7G 4A3MG 4JI1L 2VUMH 1C9OA 3HKSA 4RMFA 5C44G 2NZOA 2PQAA 2LXKA 3B6YA 4A93G 3DM3A 3PUWA 4IPDA 4OXPA 1A0IA 4EX5A 1N34Q 4GKKQ 3TREA 2HIVA 4LFAQ 1EFWA 4AH6A 3HOVG 5IP9G 5J3BA 1S72A 4KLKA 3S1QH 2LSSA 2CQOA 2UUCL 1E7ZA 3I2ZA 3F2BA 2LXJA 4BBRH 1XNRQ 1VQBA 2VS1A 3JAMi 4JI6Q 1CKOA 1TWGH 1BBUA 1IXRA 5C4JH 1Q82C 3S17H 1YHQA 4IFDJ 2JA9A 1QVFA 1YI2A 1VQ8A 3ER0A 4YCWA 1Q81C 4JI2L 1L1OA 1UE7A 1P8LA 4FDBA 1HR0Q 1HNZL 1WYDA 1LTLA 3G48A 4C2MH 3OW2A 3ULJA 1VS0A 2OQKA 4QIWE 4DR4Q 1A63A 2RHSB 3EIVA 4DNIA 4DV6L 2JA8G 1HZCA 4A3EH 2R7FA 2B63H 1G6PA 4GLVB 1IBML 3NBHB 3RN5A 2CKZB 4JI0L 3PIPA 3CC7A 4HIMA 2VL6A 3W1BA 4DV2Q 3NENA 4GKJQ 1N9WA 4LW1A 4A3MH 4UP7A 4YHHQ 4IPCA 1CKNA 5C44H 3S2HH 3T1YQ 3D31A 2JA6H 2ZM6Q 4LFBQ 4HJ7A 3A5UA 1B7YB 1V43A 4JCVE 3F1ZA 3CAMA 1YBYA 1W2BA 2Y0SE 1Y14B 1I94L 5AJ3L 2E2JH 1Q86C 1U5KA 4NPSA 4L5QA 4JC0A 3KF6B 4NB3A 3KFUA 2F4VQ 4DV7L 4GN5A 4PMWA 3STBC 3SGIA 2AWNA 4OX9Q 3RR5A 3RZDH 3ULPA 4OO1I 1GD7A 1S3OA 2Z6KA 3CCVA 1KL9A 4A3GH 1V9PA 4DR3Q 1EUJA 4QY7A 1X3FA 4P73A 1XMQL 4R4QA 3GTPH 2UUAL 3K7UC 3LGJA 5IWAQ 2JEBI 2JA8H 1FVIA 2GVAA 3J81c 3W1GA 1AE2A 3PO2G 2BH2A 4GKKL 2IY5B 3PCOB 2ID0A 1HH2P 2Y0SG 4C3HH 4LF4L 2UUCQ 4B3SL 4LFAL 4L5SA 4NXML 1FGUA 2EXDA 3KOJA 1Z47A 1XNQQ 3GTKH 3GTOH 4GLAC 4P74A 4DR1L 3GTJH 3E0EA 1TWAH 2KHJA 1K0RA 1EIFA 1PH5A 1B70B 3HOUH 1XNRL 3GDEA 2MO0A 4MNOA 4JI6L 1KAWA 2UXCQ 5C3EH 2ZTEA 5C0XI 4JI2Q 4GNXA 1VQ7A 3PUZA 4P72A 1KRTA 5LMUL 3GTLH 3RNUA 3CCRA 4DAYB 2OTJA 1YJWA 1I5FA 3I55A 5JEAJ 2R7ZG 3CQZH 3CPFA 2E5LQ 2Q2UA 1D7QA 3K80C 2K5VA 2JK8A 1YVCA 4YWKA 4DV6Q 1GVPA 4DK3C 1LUZA 3TS0A 3CCSA 1K73C 4RG1A 4KHZA 1IBMQ 1OXUA 4LUVA 5DLQE 3KDFA 2VQFQ 4JI0Q 4LF5Q 2PMZE 3ERSX 3Q8DA 3PO3G 1Q1BA 4J15A 4IFDI 1LYLA 2IHEA 3S2DH 2CCZA 4DV2L 1P16A 4JBKA 1SR3A 3M4PA 4A3BH 1MJEA 4YHHL 3CW2C 3VDYA 1EYGA 3KF8B 2DUDA 4BA2I 3T1YL 5C4XG 4BA1I 4IJHA 3K0XA 2CWPA 3I4NG 3PO2H 3PIOA 4YCUA 3H15A 2R93G 1EWIA 3UDIA 3KJOA 4BBSG 1PYBA 1AE3A 4DV7Q 3HOZG 2UXDQ 4K0KL 4LFCQ 1VQGA 1UE5A 2F4VL 3CF5A 5IY0A 4B3TQ 1VCIA 2BA0A 4OX9L 1X65A 3M3YH 4OO1G 2PNHA 2R7ZH 3J81j 4JBMA 2GN5A 2IX1A 1XMQQ 4DR3L 5HY6A 2N3SA 2UUAQ 5K36G 1L1OC 4PZ7A 5JJLA 3L7ZC 2NVYH 3H0GG 4L5TA 2YTYA 4BY7G 3TQYA 1KHIA 5IWAL 1HNWL 4LF4Q 4BY1G 1VQAA 4B3SQ 3U4VA 4YY3L 4NXMQ 2NVTH 2VNUD 4JYAL 3PO3H 3PV0A 4JOIA 4DR1Q 4A3JG 1E1OA 1N8RC 4A3CG 1Q8KA 4PZ8A 3GO5A 1XNQL 1OXXK 1UEBA 4DR7L 1CKMA 1JJGA 2A8VA 1EQRA 1UE1A 2JJQA 5C4XH 5LMUQ 3A74A 2UXCL 1I6HH 3ZJYC 1J5EL 3I4NH 2WB1E 4GN3B 4Y7NH 1QUQB 5C0XG 1VQJA 2I0QA 4LNQA 4O0AA 1IYJB 1AH9A 1TWCH 4P75A 3CXCA 2E5LL 2ZJRA 3U50C 1J6QA 3HOZH 4WJ4A 1TXYA 2N8NA 1X55A 1GKHA 3I56A 4A3IH 1BKBA 3I4OA 4A3LH 3FKIH 2VQFL 4LF5L 3NEMA 4DV5Q 2KBNA 1X3EA 1Y1WG 3EBEA 2NN6I 1L0WA 2JA7H 1VQPA 2Z6KC 1SROA 4IFDG 4YWLA 2E8GA 3RLFA 4A93H 4APVA 5IYCG 5IYDG 2PI2A 1PH3A 2E2HH 4BY7H 4PZ6A 2WB1G 2WP8J 4BY1H 3HOVH 4O2DA 5IP9H 2K14A 1TWHH 2IX0A 1YIJA 1KC8C 2Q2TA 1Q46A 4X64L 3MEFA 4A3CH 2RCNA 1YJ9A 4X65L 4HJ9A 4K0KQ 2UXBL 2R92G 3KLWA 4OWXB 1OXSC 1L2FA 4LUOA 4GOPB 5HGQA 1SFOH 3OTOL 4LFCL 4JG2A 4DV1L 5IT9c 2UXDL 5JJKA 2KCMA 3CMEA 1VQKA 4LF6L 4B3TL 1MKHA 2AMCB 3GTMH 4R4TA 1WFQA 5M5YH 3G6EA 3JC66 4GNXC 3M4OH 5BR8Q 3PGZA 3JAMc 3GTGH 2VW9A 1HNWQ 5LMNQ 3H3VI 3K7AH 4X66L 4YY3Q 1HZ9A 1VQEA 1I3QH 1I50H 2HQLA 3T1HL 4JYAQ 1R9TH 2YTVA 4POFA 3CC4A 1Y1WH 3E9HA 1VQMA 1VQIA 1PA6A 2A1AA 2D0PA 1IL2A 4DR7Q 4A4IA 3MXNB 4H02A 1KRSA 1HZAA 1XPOA 2PQAB 2KENA 4C3IH 1K3RA 2JEAI 1Y1VG 5H1SE 5IYCH 1J5EQ 2K5HA 2F52A 1PFSA 1QVCA 1XPRA 1MJCA 3CMAA 3CPWA 5E7NA 2Q2HA 3UE1A 4BXXG 4A3DG 3D0FA 2WAQE 3HOWG 1YHBA 2MNAA 1N32Q 1XTDA 2PI2E 2D0OA 5ELOA 1JJCB 2Q2IA 1A8VA 5M5WH 1SRUA 2R92H 2CWAA 1WI5A 3GD7A 1PH2A 3PF5A 3CC2A 2BH8A 2ATWA 4DR6L 4A3KG 3J80i 2JA5G 1JMCA 1HZBA 3HFZB 1OXVA 3L2PA 4DV3L 2QA4A 4DV5L 4B3ML 3I4MG 4OONA 3DLLA 2NN6G 4QL5A 5M3FG 1XJVA 4UP8A 1PH8A 3HKZE 1SN8A 3KJPA 4YCVA 1HNXQ 3RLNA 4X62L 2B29A 1E24A 2WFWA 4AQYL 1MIUA 1G291 4KI0A 2WAQG 5JEAG 4LF9Q 4X64Q 3L0OA 2R7DA 4QGUA 4DV4L 4DR2Q 4B3RQ 4X65Q 2UXBQ 1VQ4A 3CCJA 1D8LA 1K9MC 4UY8C 4IPGA 4JOIC 4IJLA 2DGYA 5M3MG 3U4ZA 1Y1VH 3OTOQ 4DV1Q 1WCMG 3A5ZB 1NMFA 4XIGS 4XTCS 2K4KA 2QEXA 4ALPA 1PHJA 4LF6Q 2NVQH 3AEVA 1SMXA 4BBRG 1O7IA 4HIDA 1VQ9A 3ICEA 1YITA 5LMNW 1JT8A 3HOWH 4DUYL 3KF6A 4DPGA 4GOPA 3HKZG 1N36Q 1S40A 5BR8L 4X66Q 4LUZA 4JI5L 3M9BA 3J7ZC 3T1HQ 4OWTB 5LMNL 2I5MX 2V1CC 3F2CA 1KXLA 1B8AA 1E22A 4A76A 2IHFA 3TS2A 2AWOA 3G71A 3AQQA 3S14H 5GAHC 2K52A 1VQ5A 5GAEC 3I4MH 4A3EG 2B63G 2VY3A 1FJGQ 5M3FH 2OQ0A 1DGSA 1C0AA 2ALYB 4IPHA
chains in the Genus database with same CATH superfamily
1E3PA 4JV5L 1B4OA 4V0BA 1EOVA 3MFGA 3BJUA 2QKIC 2JA6G 3WOFA 1QZHA 1B50A 2PZUA 4LWCA 1JJ2A 1N32L 3CRLC 2VQEL 3KYHC 3GTMB 5M3MH 4GS3A 3CCUA 5M5YB 1FGBD 1KIXA 4GNXB 4G4KA 1CSQA 2G5DA 1STGA 1JWUD 1TU2B 3NHHA 3IRBA 3E5SA 2N49A 1K8OA 3H94A 2RQXA 1PTOD 5K36H 1BCPB 4X62Q 3Q23A 3S16H 3S1NH 3I7FA 3KDFB 4BS9A 4DR5Q 1XMOQ 2RSOA 2KCTA 2V4DA 1WTXA 1PH9A 4DV4Q 1VQNA 5T1IA 1NY4A 3HOYG 4JW0A 2HHHQ 1YZ6A 1WJJA 4AIMA 1M1KC 3UDGA 2B3GA 3D8GA 2UU9Q 4EQNA 3NWSA 3GTQH 1S5BD 3EN2A 4LF7Q 2JXMB 2E2IB 3J80E 4QQBX 5GROA 1EY0A 1JC7A 4AYBE 3G4SA 4LF8L 4DV0L 3M7NA 1WTOA 3HZXA 1E1TA 1K83H 2F0DA 1EIYB 2KECA 3VA5A 1LTBD 1CSPA 4R1JA 4IFDH 1SNDA 3UE0A 4JI4L 1VQHA 3I72A 2RF4A 4UPAA 1I4RA 2EY2A 1M8AA 2BA1A 4GN4B 1Y1VB 5EPLA 1E0BA 4IUTA 1B53A 3T16A 4CHTB 4A3DB 3HOYH 3TBIB 2WACA 3C1FA 2RDGA 2EIFA 2UUBQ 1K8AC 2SEBD 1H95A 5DM73 3RN2A 5I6WA 1STAA 1GO3E 3S14B 2F4IA 3I4MB 5GADC 2YYZA 2ZTDA 5EAYA 2IT1A 1SNPA 1FL0A 1XMOL 2QILA 4DR5L 1F2YA 2EQSA 1BBWA 2K5DA 3AYHB 2CFMA 4DR4L 1Y8PB 1CKNB 2D5DA 3BVMA 4RHRA 4HIKA 1NCVA 2HHHL 2JQOA 4XYQA 4IOAA 1EZ6A 3D4DA 4X6AH 5M3MB 1AZQA 3K81C 2UU9L 1EY4A 4KHVA 5DM63 1PZJD 1IHZA 1STNA 4B08A 4Z9CB 1EIHA 3DM1A 4PG3A 4XT1B 4LF7L 5C4JB 4YWMA 1KDCA 4IUQA 2MJ8A 1JORA 2NWGA 4RH6A 1QVGA 2JA5H 2MQHA 3PSIA 3S1NB 3MZ5A 4C2MB 2ZJPA 4A3LG 5C4ZA 3QJYA 1B3QA 1GUNA 1PDQA 2F3VA 3FHWA 2RDFA 2KQ3A 3MXNA 2A73B 4FF3A 5C44G 2P5ZX 4J1MA 4A93G 3DM3A 3PUWA 4OXPA 1R4QB 2HIVA 1K8MA 2JA6B 5IIFA 4XQNA 4BBRH 2VS1A 1TWGH 1BBUA 1Q82C 2R61A 1H9SA 1QVFA 4JI2L 3K59A 1ENFA 3QOJA 3OW2A 3RMHA 3ULJA 1VS0A 3TP6A 3FRPB 2EXZA 1EL0A 2WINB 2KUMA 2HD3A 5CMDA 1QB5D 3HOYB 2VL6A 4Q5VA 5JPMC 2IW3A 4LW1A 4IPCA 5C44H 1RODA 4HSPA 2NB0A 3GTOB 2B2YA 2ZM6Q 4LFBQ 2EY5A 5HGTA 1B7YB 4N9PA 3F1ZA 1XYIA 4HCSA 2GA4B 5E1FA 5FKAC 5EGTA 1TR5A 4JVZA 4L5QA 1Z7TA 3GTLB 1F2MA 3C46A 1PTOH 1ZKOA 3SGIA 1ZYRD 4OX9Q 4OO1I 5C6AA 2BDNA 5KEEA 5AFWA 4YIJA 2B2TA 1FVIA 2GVAA 2HDLA 2ID0A 2Y0SG 5FLXL 3K5MA 1FGUA 1Z47A 1TS5A 4GLAC 3HOUH 5C3EH 4DK1A 4WJWA 3PUZA 3CCRA 4CDEC 4DAYB 2ICIA 5L37A 2R7ZG 2K01A 2L11A 3K80C 2K5VA 1I4GA 2JK8A 3QO2A 1ML0D 1CK1A 1IYVA 1D6EC 1K73C 1DD2A 4RG1A 3DWAA 4LF5Q 2PMZE 1F9QA 1NNXA 1LYLA 4IUPA 2CCZA 5IT9E 3M4PA 4A3BH 4L8JA 1AFPA 3KUPA 1U4RA 1PRTC 4IJHA 4BA1I 1STHA 1DM0B 2R93G 1EWIA 3SK5A 3KJOA 4BBSG 3DWPA 1AE3A 3T51B 3CHBD 1K0SA 4B3TQ 2F0EA 3P20A 1VCIA 2BA0A 1WD0A 4OX9L 2K5QA 4OO1G 2R7ZH 2PMZB 3J81j 2GN5A 1LTTD 1C4QA 2UUAQ 3LX0A 2NVYH 3H0GG 4L5TA 4CBVA 3NQIA 4IURA 2NVTH 5C44B 4B3SQ 4R8NA 4YY3L 1EIGA 4A93B 3PV0A 4H13C 1F9SA 4PZ8A 3GO5A 4DAVA 2KCNA 3URYA 5LMUQ 2N55A 1PTOB 4Y7NH 1C8CA 1VQJA 2B2YC 1TWCH 4WFN3 2ZJRA 2EYLA 1V8QA 1GKHA 4A3IH 4CKCA 1JCKB 4OIJA 2WKCA 4LF5L 3K7AB 1X3EA 2JA7H 1O80A 1BCPD 1VQPA 1R9TB 2E8GA 3RLFA 3QIAA 1JOQA 5IYDG 2PI2A 2DY7A 2NTSA 2B2TC 4PZ6A 2WB1G 4XQJA 2WP8J 4O2DA 2B2VA 4RGOS 4RKLA 4PMBA 2RCNA 1ILQA 1UNSA 3KLWA 1OXSC 2ENBA 4LUOA 3Q22A 1SFOH 2L0CA 2AQ2B 3CMEA 4LF6L 4B3TL 4ID6A 5CORA 2MUYA 5BR8Q 2EPBA 3GTGH 2VW9A 3MTSA 1HZ9A 1VQEA 1I3QH 1I50H 1QNUA 5DEHA 2YTVA 4R8IA 1PA6A 2D0PA 4DR7Q 4A4IA 5CGKA 2Y0SB 5C5MA 3E6ZX 2PQAB 1K3RA 4DF7A 3V05A 2ZXOA 2F52A 4ZYSA 3D0FA 2WAQE 3HOWG 1TQOA 3BVZA 3TZDA 1GUGA 2PI2E 2D0OA 2R7ZB 2XIWA 3GD7A 3CC2A 2ATWA 4DR6L 4RGTA 4A3KG 4QF4A 3HFZB 2NVTB 1YNND 5I9PA 5M3FG 4G7HC 1WTWA 2EVBA 4UP8A 1HNXQ 3KJPA 3NBHA 1E24A 3VR3A 4KI0A 2FHTA 5DNFA 3OPOA 3JAME 1X3QA 3A55A 3NXWA 2I07B 2BE5D 2UXBQ 1ICFB 4Y7NB 2R93B 4CJ1B 4IPGA 4LJZC 4BBSB 3A5ZB 4ALPA 2NVQH 1X3PA 1YITA 1WCMB 3HOWH 3NQTA 3KF6A 4F87A 1HCZA 5BR8L 1LT4D 5EPJA 1CA5A 4OWTB 2I5MX 3F2CA 4F8MA 3J7AV 1B8AA 5CV9A 1E22A 3H0GB 4CDDC 2LY7A 5GAEC 4FVMA 3S1RB 3P7JA 2B63G 1QNKA 2F0NA 4NKLA 2KHSA 2F0QA 1JQYD 5M3FH 1DGSA 5JOBA 2L5TA 3WDNA 2AUJD 4ZKBB 2AHOB 1QZGA 1KD1C 1LT6D 1HTPA 2HIXA 3MA2B 5GQOA 2EY1A 1SYGA 5NUCA 4WJ3M 2J7ZA 3U58A 1PH1A 2B2VC 3JAML 1PFMA 4KHPQ 3K6OA 5A2QL 5IGFA 1EQVA 2Z0SA 4OIKA 1JE5A 5M5XH 4DV3Q 4TSSA 1FNVA 2X6GA 1I50B 1SYBA 1B9NA 3J81i 2O5IC 2MP1A 4ZLTF 1X56A 1ASZA 3TRZA 1HNXL 2IJ0A 3KK7A 3ND8A 1V1OA 1E2VA 4A3JH 5EBCA 4NW2A 5G3LD 1SEBD 2JP1A 4C3JG 2XGTA 3BU2A 2KJXA 3FDTA 1YEZA 2SOBA 4GLXA 3I70A 1OTCA 4DUYQ 2DNEA 4MN3A 2LFNA 1DONA 1VQLA 1XX8A 4Y52H 3I8ZA 4RKBA 2A69C 1RHPA 4POGA 2VZAA 4IALA 5DAUA 1SNCA 1WOCA 1HJPA 4FYDA 2F0IA 4U68A 3ITPA 1NUCA 2HCIA 4JV5Q 4ODGA 4IOCA 1CA6A 1X54A 4JI1Q 1T5EA 3PF4A 3CU7A 2R6GA 3J7YW 2L1BA 1S5ED 2VQEQ 1VQFA 1PH7A 3SK6A 5IGGA 4C3JH 3HOWB 4MTNA 4AYBG 5FJ8G 1QUQA 2L4NA 2RCFA 4KHPL 1CUKA 1PRTD 4DAPA 5LL6S 1L1OB 2PW7A 2E2IH 2Q8TA 4ME3A 5JVG3 1RJTA 1HFNA 3TN2A 1XPUA 1EU3A 4HJ5A 4A3KB 4ME5A 2E74C 1KLGD 1DOLA 2CVRA 4IUNA 3UDFA 1JB3A 1HNZQ 1MGSA 1T5XD 1NBWA 3P1HA 2GVBA 2F0JA 2LKVA 1HR0L 4OWWB 3S15H 1NTGA 2XTIA 2K50A 4DGZA 1BDOA 4QJFA 4TVAB 3M85A 4HSVA 2RBMA 1YJNA 1PH4A 3PUXA 2QDLA 2HDMA 1VQ6A 1K8GA 4BXXH 4A3DH 2XWBB 3S1QB 2ES2A 3K8AA 5D3IB 1TS3A 2D62A 5IE8A 3H09A 5FLXc 3BZKA 3NTKA 1U4LA 3ONAB 1MD2D 3BZCA 4PMCA 5FJ8H 4LF8Q 4DV0Q 3CRKC 3J81E 1ENCA 4HMIA 4K5VA 4ZQ3A 3FP9A 1SE4A 3WWVA 2KA7A 4P71A 4JI4Q 4PV1C 1ILPA 2D9UA 4QUFA 3DMUA 2B63B 3SK8A 3AB9A 1V1PA 4JI1L 4RMFA 5D65A 2NZOA 1B44D 5EKIA 3TREA 1EFWA 3PIP3 2IL8A 5IP9G 5D14A 1B1ZA 3NK9A 1S72A 1CZWA 2LSSA 5BN3A 2UUCL 1E7ZA 1LT3D 4KN4C 2LXJA 1PZID 3SVMA 1AZPA 5C4JH 1IXRA 2SDFA 2E2JB 1YI2A 1CT1D 3ER0A 2SNMA 4ZUJA 3IAYA 1EY8A 1P8LA 1UE7A 1HNZL 3NBIA 3RZDB 2MHVA 4C2MH 1A63A 4QIWE 4DR4Q 1Y69U 4EQPA 2O4XA 1D5MC 3EIVA 2PZWA 3F2UA 4XYOA 3R8BA 3GTPB 3HEJA 1GHJA 2EJGC 1IBML 4JI0L 2CKZB 3PIPA 3C3LA 3R93A 4HIMA 4C3JB 4DV2Q 1SBBB 1BBXC 1CKNA 4ZKCB 3T1YQ 2JA6H 3LWEA 3SEBA 1V43A 1SMYC 1GUTA 3CAMA 1YBYA 1W2BA 3OHXC 1Y14B 4ILWA 1Q86C 1U5KA 1U4MA 1JOOA 1ZXTA 1HXYD 1SE3A 3CQZB 2TSSA 4FXGC 4IN3A 3KFUA 3V96A 4DV7L 3S15B 3RR5A 3ULPA 5EQ0A 1S3OA 1KL9A 4DR3Q 1EUJA 2F0GA 1BUVT 2A68D 4DFAA 5IWAQ 3S2DB 2J0TD 4O42A 1AE2A 3I91A 4TRDA 1QJOA 2PO4A 2F03A 4NXML 4FF1A 3KOJA 3GTKH 3GTOH 4P74A 4DR1L 4AYBB 4N9TA 4MNOA 2UXCQ 5KNBA 2ZTEA 5C0XI 4JI2Q 5ELCA 4P72A 3GTLH 3RNUA 2RKSA 5IODA 2DNCA 1I5FA 3I55A 2Q8RE 1D7QA 3TMEA 4K14A 4YWKA 3J80L 3W3AA 1GVPA 4LAAA 4DK3C 5IOCA 3CCSA 2L55A 4KHZA 5DLQE 2VQFQ 3HRZC 2Z1CA 1SYDA 4QUCA 5I2YA 1JOKA 4DV2L 1SR3A 1EYGA 3CW2C 2EDGA 2ICEC 1EEFD 4C1NI 4BA2I 3T1YL 1CFMA 3I4NG 3H15A 4YCUA 5ELDA 3EVQA 3I73A 4NP5A 4K0KL 1AW7A 1TVXA 1UE5A 3CF5A 5IY0A 3TP8A 3HOZB 2XSCA 3K5NA 2IX1A 2F0PA 2B2UA 2VXWA 5C3WA 5JVH3 4DR3L 1EEID 1S5FD 4PZ7A 3VR2A 4KD3A 2YTYA 4QB4A 3TQYA 5IWAL 1HNWL 2FINB 2OEOA 4I65A 2F0TA 4JYAL 1GUWA 4JOIA 1PFBA 4HR7B 2E2HB 1Q8KA 4M8AA 1CKMA 1JJGA 4DN4M 1EQRA 1IYUA 1BO0A 4KTAA 2UXCL 1J5EL 3I4NH 4IUUA 4MIUA 5C0XG 3MC0B 3K5OA 1AH9A 4F7XA 4FP5D 3FEWX 3U50C 1J6QA 4WJ4A 2N8NA 1CQFA 1BKBA 1DCZA 3I4OA 2VQFL 4A3LH 4K6LA 2KBNA 4UHVA 1JR0D 2D2CC 2A69D 2CH4W 1Y1WG 1J8IA 2K5WA 1EY5A 3BVGA 1TY0A 3VR6A 1BNZA 1SROA 2NUCA 1WTHA 4YWLA 1EZ8A 4C3IG 3GTKB 4A93H 5IYCG 1BXTA 4K8IA 3EROA 2HQEA 2EYJA 2EZVA 1CQVA 2Q2TA 5EJWA 2PQEA 1D1KA 3PMFA 4DK0A 4OHJA 4GOPB 5HGQA 3OTOL 4DV1L 4JG2A 5ELFA 1VQKA 5KYLA 1MKHA 2AMCB 4UAIA 2K6AA 3NSWA 3G6EA 1DOKA 3PGZA 3JAMc 3IL8A 1A6XA 3H3VI 3K7AH 4YY3Q 1DYQA 3Q6SA 3T1HL 1R9TH 1Y1WH 4OGQC 4XT3B 3E9HA 2A1AA 1IL2A 4DU9A 1EFID 1PRTB 3MXNB 1MI2A 1XPOA 4C3IH 2KENA 5IYCH 5ISRA 2K5HA 4FNFA 3CMAA 2DN8A 5E7NA 3UE1A 1YHBA 1F9RA 1Y8NB 2F0WA 5COYA 5ELOA 4KN7C 2NBFA 1TS4A 2CWAA 1PH2A 3I4LA 3PF5A 1H9SB 1CM9A 2BH8A 1LTRD 2DJGC 4KK7A 1JMCA 3SK4A 2F0MA 4B3ML 1NSNS 3DLLA 1XWEA 3BYYB 1SN8A 5CC4A 2X6LA 2B29A 1GOZA 4AQYL 2B2UC 1MIUA 2WAQG 5JEAG 4LF9Q 3L0OA 2F0UA 4MTKA 4DR2Q 1GXDC 2A6EC 3I4NB 1LTGD 5CV4A 5CR3A 2PW5A 1D8LA 3KBGA 3SHLA 3CCJA 4JOIC 3RZOB 2C5CA 1WCMG 2L12A 2FFKB 2RA4A 4LF6Q 2K4KA 4J8QA 2QEXA 2PNRC 3TDQA 3AEVA 1VQ9A 5JPNC 1JT8A 5LMNW 3G7LA 1E2WA 1N36Q 2F3WA 1S40A 1K3BC 1LT5D 4JI5L 1HUMA 3DHQA 4XDXA 2JYOA 2IX3A 4A76A 2AWOA 4EVOA 2K52A 1EY6A 4A3EG 1FJGQ 2OQ0A 5JAVA 2EYMA 1HHVA 2K04A 5J39A 2FXQA 2A19A 2NVXB 2R93H 5IT9L 2Z4IA 1VQDA 5FO7B 4BBSH 2H5XA 3ULLA 3VYTA 3GV3A 4IUVA 1B2TA 2F0KA 2C35B 4DR6Q 3CD6A 1B3AA 1WCMH 4JI3Q 3SXHA 1CTMA 1SMYD 4UP9A 2JN4A 4OO1H 2OTLA 1NJIC 2Z9HA 3T13A 1LM0A 3NE5B 4MZ9A 3MXGA 4KJOA 2Q8IB 2OXPA 1Y1WB 3NELA 3H0GH 1Q7YC 3S24A 2L9HA 4A3GG 1YNJC 3M4QA 4C3IB 3S1RH 3H3VH 3D6CA 5CV7A 1X3GA 1Q8IA 4LF9L 2ZTCA 4R4IA 1H9RA 3VYSA 4DR2L 3T56B 1L0XB 1G6ZA 1TWFB 2EYHA 4DUZQ 3F2DA 1IBLQ 1IBKQ 1II3A 1U4PA 3S1MH 1N33Q 1T9HA 5CYUA 3CCMA 3V2TA 3CKIB 2YU9H 1GUSA 4R4CA 3HOXG 5FK9C 1N36L 1WVLA 3EQLC 4CJ2C 1VMCA 1G51A 4JI7Q 1S5DD 1SE8A 3KLSA 3NPPA 3QR8A 1C7YA 1EU4A 3RLOA 3W2DA 1UUPA 2KVMA 1DXMA 1FJGL 5CBAE 5IYDH 3AFPA 1ASYA 1A62A 2BOSA 3EFXD 1PFNA 2RHQB 2F3IA 1RTNA 3PUYA 5IGCA 1WTVA 1YHAA 1N34L 1PLFA 2KCCA 3IFTA 1MHWC 1W6JA 5E4WC 4L5RC 4HEDA 3E9IA 4JI3L 4ZCKA 5IYBG 2CH4A 2ZJQA 5A35A 1WTPA 3OYYA 4KKSA 1QWYA 3HOXH 1U0LA 1Z9FA 4KD4A 3W5OA 1X9NA 3KLRA 3RUZA 1A3UA 4A3FB 2I5HA 2VUMG 4KKTA 4HIOA 2AKWB 1YNXA 2WAQB 1VQCA 5J1ZA 4HN7A 4DUZL 4JBWA 4L63B 1IBLL 4O1NA 1LABA 1IBKL 4GKJL 1N33L 5GAGC 1RD9D 4FXKC 4P2CB 3MXPA 2I5LX 4PQXA 1ESFA 3S17B 2YTXA 1I94Q 5JJIA 2PZTA 4DXGA 5AJ3Q 2L15A 4DK6C 4RAUC 2I46A 4HJAA 4A3KH 3A0JA 3DEOA 1UWVA 5IYBH 3IFDA 4JI7L 3S9WA 1LO5D 1NMGA 2K75A 1BQQT 4C56C 4EQ5A 3TZUA 3HGBA 3FKIG 1TIID 2AQ3B 1EY7A 5K5PA 4DNTB 4A3EB 1BVSA 5C0XJ 2TMPA 3J80c 2E75C 4KY6A 2E76C 4A3MG 2VUMH 2O5JC 1C9OA 3GP7A 2LXKA 4IPDA 3S1MB 1EWHA 4FF4A 1G2SA 4LFAQ 4QMGA 2K33A 3S2HB 3HOVG 5J3BA 2IWHA 2YU9B 1SSOA 4RCOA 3S1QH 2CQOA 1BR9A 3A8KE 3I2ZA 5E4XA 1XNRQ 5M9OA 1VQBA 4JI6Q 1GUOA 1YHQA 2RSNA 2NZ1D 4YCWA 1L1OA 2XRQD 4I7ZC 1NR4A 4FDBA 3QWNA 1HR0Q 1WYDA 1PTOF 3G48A 3HP3A 2O2LD 4A3GB 2JA8G 4DNIA 4DV6L 4Q0FA 1HZCA 2B63H 2RDHA 2PPBC 1G6PA 4GLVB 5KNCA 4C3HG 3NBHB 3RN5A 2PCFB 3BDLA 3CC7A 1HTLD 3NENA 1N9WA 3FMCA 4A3MH 4UP7A 1D5XC 3E0JA 3GTJB 1TWAB 4HTHA 2QCPX 4HJ7A 3DUZA 1I94L 5AJ3L 2E2JH 3HOXB 4NPSA 1IW7C 5EBDA 4IZ8A 1CZGA 3KF6B 1PYWD 4GN5A 3STBC 2AWNA 3RZDH 3OWFA 3CCVA 2HCCA 4QY7A 3MWYW 4QCLA 1XMQL 4R4QA 3GTPH 4G7OC 5IGEA 2JA8H 5KGUA 3W1GA 2BH2A 3PCOB 4LFAL 3T53B 4C3HH 2UUCQ 4LF4L 4L5SA 2EXDA 1SYEA 4WORA 3PO2B 5HURA 3E0EA 4K2LA 1EIFA 1XNRL 3LNNA 4JI6L 1KAWA 3PIO3 2K05A 4GNXA 2OTJA 2MGSA 4RA8A 1KTKA 5JEAJ 3CQZH 2E5LQ 2Q2UA 3GQBA 1Q3LA 3EA6A 3M3YB 1DJRD 5FOBB 1A2TA 1LUZA 3TS0A 1IBMQ 1OXUA 4JI0Q 2VUMB 3KDFA 5JJZA 4J15A 3VYUA 4IFDI 4G57A 3S2DH 1UAPA 3O13A 4V190 5EKKA 5FO9B 3KF8B 4K6DA 2DUDA 5C4XG 2NYZD 5CV6A 2F0VA 3K0XA 3PIOA 3QG1A 1KNAA 1I6HB 1PYBA 4K2KA 4NDXA 4DV7Q 1KABA 3HOZG 2UXDQ 4LFCQ 4I7AA 1I4HA 4K5XA 4JBMA 4IQZA 3FKIB 5HY6A 2N3SA 1G91A 5K36G 1L1OC 4JK1C 5JJLA 1RKNA 3L7ZC 4BY7G 3R2IA 1KHIA 4A3MB 4G7ZC 1A15A 4BY1G 1VQAA 3OIPA 4NXMQ 2VNUD 3RD4A 1RCVD 2EJMA 4DR1Q 5KNDA 1N8RC 3TP5A 1YNJD 3A56A 3HOVB 1HFGA 1UEBA 5D3DA 4HMJA 1UE1A 3HG9A 5C4XH 3ZJYC 4EGVA 4HCEA 4GN3B 1G2TA 1QUQB 4RCNA 2I0QA 1Z6HA 4CJ0B 2R3ZA 4O0AA 1I6VC 1NR2A 2E5LL 4ZK9B 2H4OA 1ENAA 3HOZH 1TXYA 1X55A 4OL7A 3I56A 3GV6A 3J81L 1SNMA 4X3KA 2JA8B 1PZKD 1Q90A 4UDUC 3EBEA 1VF5C 3HS0C 1L0WA 2F0LA 4C3HB 4IFDG 4DA2A 1ZEQX 2EJFC 5EPKA 1PH3A 2E2HH 4BY7H 4BY1H 5J22A 5IP9H 2K14A 1TWHH 2IX0A 1KC8C 4X64L 1F77A 4X3SA 2KEEA 3X3NA 4X65L 3T4AC 2Z6BA 4K0KQ 2R92G 1L2FA 4QIWB 2UXDL 4LFCL 5IT9c 2AQ1B 1H9KA 2KCMA 5M5WB 1KLUD 1C48A 4R4TA 4GNXC 3JC66 3M4OH 1HNWQ 4U673 4X66L 3WOEA 1JE4A 4H44C 2HQLA 4JYAQ 3K5LA 1BCPC 2NTTA 3CC4A 5EKLA 1EYCA 1VQIA 3A54A 4X3UA 1V1PB 2CQAA 2JEAI 1KRSA 2AUKA 1J5EQ 1QVCA 1FNUA 5CV8A 1XPRA 1MJCA 4CKEA 1AP0A 2MNAA 2E2DC 1JJCB 3K58A 2R92H 2QEJC 1WI5A 1JWSD 2M00A 5ELBA 3KLSX 2JA5G 2LMCB 2QA4A 2F0OA 4OONA 1FYCA 1LTAD 1A3VA 2KEDA 4QL5A 1GJXA 4EQOA 3HKZE 3RLNA 5CV5A 5I2XA 1I4PA 4X62L 3D3RA 1X32A 4L6TB 1RF2D 4B3RQ 4DV4L 5C4XB 1TKWB 2EYOA 1K9MC 1ICWA 2B8GA 4IJLA 3OTOQ 4DV1Q 4XIGS 1NMFA 1PHJA 2FJ2A 4BBRG 1F9PA 1HUNA 3ICEA 1A2UA 1IKLA 5C5LA 1KAAA 2PYKA 3NUCA 4E6IA 4ZRZA 1VMPA 3QOLA 4GOPA 2K32A 3C1EA 3A7AB 1R4PB 4LUZA 3J7ZC 3M9BA 3T1HQ 3HKZB 2V1CC 1YNNC 2EE1A 3S16B 2A6HC 3TS2A 4RGNA 4ULLA 2F1MA 3AQQA 3G71A 3D6WA 4BY7B 2ZXRA 2Z4HA 4BY1B 3MXUA 4X3TA 2CW0C 1TWHB 4RWSC 3BYTB 1C0AA 2ALYB 3K57A 1ESRA 4IPHA 4NMZA 3AU7A 1PH6A 4HJ8A 1EY9A 2BE5C 5FLMG 2MFIA 3BZDB 4CGYB 1LACA 5IGDA 5ELNA 3R2TA 3OWEB 1F2ZA 1X6OA 1JB7A 3RZOH 4B9XA 4KY7A 3MFYA 2XWJB 4JBJA 1PV4A 3GTQB 1Q1EA 4KY5A 1Q12A 4DAYA 3M4OB 1STEA 3I90A 1OXTA 2N78A 3CCEA 3UDXA 4B3MQ 2UUBL 2K1BA 1QOHA 1IW7D 3OIQA 1K83B 3D4RA 4AQYQ 3MEHA 1S4ZA 1KDBA 3STBD 1GHKA 1BCPF 5FLXE 4F88A 4LK1C 2ASBA 2WV6D 4B3RL 1KQSA 3MVVA 3VYRA 4XQQA 1CI3M 3X3MA 1S5CD 1PYSB 3OW7A 1V1QA 2NVXH 2HT1A 2M2LA 2LS01 4RFBA 1EQQA 4JI8Q 5KRUA 5FLMH 2R92B 5C0XH 2F0FA 3E3XA 3CCQA 3HOUG 4R4OA 3NP8A 1IL8A 3CCLA 4TQUS 5C3EG 3N52A 4NXNQ 4JI5Q 4IO9A 2C9OA 3CP0A 1K28A 4KKUA 3LWUA 1MSGA 3G6JB 2EYFA 1PVOA 2JE6I 3BDOA 3M7GA 3C2PA 2QGQA 3U9OA 2K5NA 3H6MA 3K0YA 2MO1A 1FNWA 1O78A 3PUVA 1PXUA 2XN9C 3A8IE 1TWFH 4A3BG 5IP7G 1VQOA 1SYCA 1RIPA 1FD7D 2QDBA 3IKJA 2K03A 5F2DA 1M90C 1HR0W 2JA5B 2M9VA 2OT2A 1RTOA 2K28A 2NZHA 3A8JE 4A3FG 1NAPA 4DAMA 2OWOA 4GOPC 1STBA 1UE6A 3FVQA 4R9WA 5E3FA 1IZ6A 4S3SA 2YV5A 3TEHB 1W3SA 1QCBD 3AFQA 2N88A 4CDCC 4GZYC 5T1GA 1RL2A 1BOSA 2XVSA 4JI8L 4ZUIA 1CHQD 1XTCD 3A7LA 5IP7H 1NE3A 4BBRB 2ZM6L 4LFBL 1TWGB 4NXNL 3F8TA 5ELEA 2F0HA 3J7A5 4CDFC 2KHIA 4HAEA 4A75A 2WKDA 1GM5A 1I4XA 4B9WA 3H91A 3EJIA 1VF7A 1M4VA 4A3IG 3M4YA 1HA6A 2OCEA 3Q24A 1TS2A 2DY8A 1TT2A 4A3FH 5LHY1 1SLJA 4DKAC 2JA7G 1LTSD 5JEAH 1H9JA 3HKSA 5C3XA 2PQAA 3B6YA 4CKBA 4EX5A 1N34Q 1A3TA 1A0IA 4M1UB 4GKKQ 5I6YA 3ZYYX 3MAQA 4AH6A 1PMRA 4KLKA 1W6KA 2FMMA 3F2BA 3JAMi 1CKOA 3S17H 3J7AF 4IFDJ 3SDZA 2QF7A 2A5HA 2JA9A 1Y8OB 4XXEA 2EOTA 1VQ8A 1HRJA 5BN4A 1Q81C 4DXFA 2JSOA 1LTLA 2J4XA 3L9AX 2Z8LA 2OQKA 1WD1A 1LLRD 2RHSB 4A3EH 2R7FA 4LMQD 1EOTA 5G3LF 3W1BA 4GKJQ 2HUGA 4YHHQ 1SJED 3S2HH 3D31A 3D4WA 3A5UA 1D2BA 3HOUB 1JICA 4JCVE 5LL6X 2Y0SE 4DNRB 5C3EB 1HA5A 2ZXPA 4H0LC 3Q0AA 5KIXA 1PTOC 4JC0A 3P75A 4NB3A 1SYFA 2F4VQ 4PMWA 1GD7A 2Z6KA 3BG3A 4A3GH 1V9PA 1X3FA 4P73A 2UUAL 3K7UC 3LGJA 2JEBI 3J81c 1U9RA 3PO2G 4GKKL 2IY5B 3AMUA 4A3BB 1HH2P 4B3SL 1SNQA 1DZ1A 1XNQQ 1EYDA 3GTJH 1TWAH 2KHJA 1K0RA 1PH5A 5TSSA 4OELB 1B70B 3GDEA 2MO0A 2B2WA 1PRTF 1VQ7A 5LMUL 1KRTA 1YJWA 3CPFA 4KV6A 1YVCA 4DV6Q 3UI2A 3OMGA 3SR1A 3OMCA 4OEMB 4LUVA 4K5WA 4J6HA 1STYA 2IPKD 2NVYB 3ERSX 3FPUB 3Q8DA 1Q1BA 3PO3G 2A68C 2IHEA 2QW7A 1SAPA 1P16A 4JBKA 2A6HD 1MJEA 4YHHL 3VDYA 2CW0D 3PO2H 2CWPA 1SJHD 3PQIA 5A2QE 1MBYA 4N8X1 3UDIA 2G9HD 1SDFA 1TWCB 1VQGA 2F4VL 1B9MA 1QG7A 2DJFC 1X65A 2XNAC 4FF2A 3M3YH 2PNHA 4A3IB 3ND9A 3NTHA 1XMQQ 3R3OA 1J9OA 1L0YB 5I9OA 2FMCA 1ET6A 2JA7B 2XRSD 4LF4Q 2VB3X 3U4VA 4RGMA 3PO3H 1O7YA 3ERQA 4A3JG 1E1OA 2B39A 4A3CG 1UEAB 1XNQL 1OXXK 4DR7L 1EQTA 2B8FA 2A8VA 1HQRD 2JJQA 1QE6A 3A74A 3DEPA 1I6HH 1EYAA 3NWTA 2WB1E 1SFOB 4LNQA 1H9MA 1IYJB 1HPCA 4P75A 3SE0A 3CXCA 4PNYA 3GTGB 4KJNA 1SE2A 3FKIH 3NEMA 4DV5Q 2KOLA 4N8FA 2NN6I 1I3QB 3I3CA 2Z6KC 5I4DA 4RHSA 1MSHA 3L3OC 1FR3A 1WTRA 1LTID 4APVA 3OOCA 4KMUC 1HQMC 3H3VC 4C1NK 3HOVH 3VA7A 1YIJA 2MPMA 1Q46A 2WB1B 3MEFA 4A3CH 3KF8A 3BS1A 1YJ9A 1SXTA 4HJ9A 2UXBL 4OWXB 2X69A 1OO9B 4FXDA 5JJKA 2B2WC 1VDZA 1O7LA 3NTIA 3GTMH 1BF4A 3TSSA 1WFQA 5M5YH 1AN8A 1DOMA 5BN5A 5LMNQ 2VB2X 3KBXA 2BDOA 4POFA 2RVLA 1KNEA 1XXGA 1VQMA 4ABNA 2EY6A 1F2LA 1LV9A 4H02A 1HZAA 2WIIB 2A6ED 1Y1VG 5IGBA 5H1SE 1D1IA 1KDAA 4ZAIA 2BCOA 2CHBD 1PFSA 4JPBW 3CPWA 4BXXG 3DXJC 4A3DG 2Q2HA 2F0SA 5FO8B 2NVQB 3BDCA 1ET9A 1N32Q 1XTDA 1ZYRC 4MHEA 3VR4A 2ZT9C 4K8JA 2Q2IA 1A8VA 1CHPD 1SRUA 3N6RA 1ONLA 5M5WH 4H7BA 1TY2A 1WTQA 3J80i 3U9SA 3OSOA 1HZBA 3FPPA 1OXVA 3L2PA 4DV3L 4DV5L 3I4MG 1E2ZA 2H1EA 2A74C 3PO3B 2NN6G 1JWMD 1XJVA 1PH8A 4YCVA 5KYIA 2EYPA 2WFWA 1SNOA 4TKOB 1G291 4WRDA 2G9DA 5M3FB 1AEXA 3VR5A 4X64Q 2R7DA 4QGUA 5CBEE 4X65Q 3TP7A 1VQ4A 4UY8C 1G8ZD 2OF1A 1RDPD 2DGYA 5M3MG 3U4ZA 1Y1VH 3MHBA 1I4QA 1QILA 2SNSA 4XTCS 3DWQA 1SMXA 1O7IA 4HIDA 5C4HA 1IKMA 3QB3A 4DUYL 1EWCA 4FO2A 5M5XB 4DPGA 3HKZG 4X66Q 5LMNL 1KXLA 2K7VA 1D5ZC 2IHFA 4BWGB 3S14H 5GAHC 3I4MH 1O7ZA 1VQ5A 2VY3A 2NN6H 4A3JB
chains in the Genus database with same CATH topology
1PH6A 4HJ8A 5FLMG 1E3PA 2FXQA 2MFIA 4JV5L 2A19A 2AHOB 1EOVA 2R93H 1QZGA 1KD1C 3BJUA 2HIXA 5ELNA 5GQOA 1VQDA 2JA6G 1X6OA 1JB7A 3RZOH 2H5XA 1QZHA 4BBSH 4LWCA 3ULLA 4WJ3M 1JJ2A 4JBJA 2VQEL 1N32L 1PV4A 3KYHC 1PH1A 3U58A 1Q1EA 4GS3A 2C35B 5M3MH 3CCUA 1Q12A 3CD6A 4DR6Q 4KHPQ 1WCMH 1KIXA 4JI3Q 2Z0SA 4GNXB 1JE5A 1OXTA 1CSQA 2N78A 5M5XH 3CCEA 3UDXA 4UP9A 4DV3Q 2UUBL 4B3MQ 3IRBA 2OTLA 1NJIC 1LM0A 4MZ9A 2N49A 3J81i 1X56A 4X62Q 1ASZA 3NELA 3TRZA 4AQYQ 3S16H 3H0GH 1Q7YC 3S24A 1HNXL 3S1NH 4A3GG 3STBD 3I7FA 3KDFB 1XMOQ 3M4QA 4DR5Q 1PH9A 2KCTA 3S1RH 1VQNA 4DV4Q 3H3VH 2ASBA 1X3GA 4A3JH 4LF9L 2ZTCA 1NY4A 1KQSA 4B3RL 4R4IA 4DR2L 3HOYG 2HHHQ 2XGTA 1YZ6A 3BU2A 1WJJA 1PYSB 4DUZQ 1V1QA 1YEZA 3F2DA 1IBLQ 4AIMA 4GLXA 1M1KC 1IBKQ 2NVXH 2HT1A 3UDGA 2B3GA 1EQQA 4JI8Q 5FLMH 1OTCA 3S1MH 2UU9Q 1N33Q 4DUYQ 1T9HA 3CCQA 3HOUG 4R4OA 3GTQH 3CCMA 3EN2A 3CCLA 4TQUS 2YU9H 5C3EG 4LF7Q 4NXNQ 4JI5Q 4R4CA 3HOXG 1VQLA 4IO9A 1N36L 4QQBX 3CP0A 4Y52H 5GROA 4AYBE 4POGA 3G4SA 2VZAA 4LF8L 4DV0L 3M7NA 1G51A 1E1TA 1SE8A 4JI7Q 1K83H 1EIYB 1PVOA 1WOCA 1HJPA 1C7YA 2JE6I 3RLOA 2QGQA 1CSPA 4R1JA 3UE0A 4JI4L 1VQHA 1FJGL 2K5NA 2RF4A 5IYDH 3AFPA 1ASYA 4UPAA 4JV5Q 1A62A 4IOCA 1X54A 4JI1Q 2MO1A 2BA1A 4GN4B 2RHQB 3PF4A 3PUVA 2R6GA 4A3BG 2F3IA 1TWFH 5IP7G 2VQEQ 1VQOA 1VQFA 1RIPA 3PUYA 3HOYH 1YHAA 1PH7A 1N34L 4C3JH 4MTNA 4AYBG 5FJ8G 1QUQA 2EIFA 1CUKA 4L5RC 4KHPL 2UUBQ 3E9IA 4JI3L 1L1OB 5IYBG 2E2IH 1K8AC 4ME3A 1M90C 2ZJQA 1XPUA 1HR0W 1H95A 4HJ5A 3RN2A 3OYYA 1GO3E 2NZHA 3HOXH 1U0LA 4A3FG 3UDFA 1Z9FA 1HNZQ 3W5OA 5GADC 2YYZA 2ZTDA 1NBWA 5EAYA 2GVBA 4DAMA 1UE6A 2IT1A 4GOPC 1X9NA 2OWOA 1HR0L 1FL0A 4OWWB 1XMOL 3S15H 4DR5L 2I5HA 1NTGA 1IZ6A 1BBWA 2EQSA 2XTIA 2YV5A 2VUMG 2K50A 2AKWB 3AYHB 4HIOA 3TEHB 2CFMA 1W3SA 1YNXA 4QJFA 4TVAB 3AFQA 4DR4L 3M85A 1VQCA 1CKNB 1YJNA 1PH4A 4HIKA 3PUXA 2HHHL 2JQOA 4DUZL 4IOAA 4JBWA 1RL2A 1IBLL 1VQ6A 1K8GA 1IBKL 4X6AH 4BXXH 4A3DH 4JI8L 3K81C 4GKJL 2UU9L 1N33L 2ES2A 5GAGC 5IP7H 1NE3A 3K8AA 2D62A 5IE8A 5FLXc 3BZKA 2I5LX 4PG3A 2ZM6L 4LF7L 4LFBL 4YWMA 4NXNL 2YTXA 3F8TA 1I94Q 5JJIA 3BZCA 5FJ8H 5AJ3Q 4LF8Q 4DV0Q 2L15A 4DK6C 1QVGA 3J7A5 2KHIA 4HJAA 4A3KH 2JA5H 3A0JA 2MQHA 3PSIA 1UWVA 5IYBH 4A75A 1GM5A 4JI7L 3FP9A 3WWVA 1NMGA 2K75A 4P71A 4JI4Q 4A3IG 4EQ5A 2OCEA 2ZJPA 4A3LG 3FKIG 4A3FH 1BVSA 1SLJA 3FHWA 5C0XJ 4DKAC 3J80c 2JA7G 4A3MG 4JI1L 2VUMH 1C9OA 3HKSA 4RMFA 5C44G 2NZOA 2PQAA 2LXKA 3B6YA 4A93G 3DM3A 3PUWA 4IPDA 4OXPA 1A0IA 4EX5A 1N34Q 4GKKQ 3TREA 2HIVA 4LFAQ 1EFWA 4AH6A 3HOVG 5IP9G 5J3BA 1S72A 4KLKA 3S1QH 2LSSA 2CQOA 2UUCL 1E7ZA 3I2ZA 3F2BA 2LXJA 4BBRH 1XNRQ 1VQBA 2VS1A 3JAMi 4JI6Q 1CKOA 1TWGH 1BBUA 1IXRA 5C4JH 1Q82C 3S17H 1YHQA 4IFDJ 2JA9A 1QVFA 1YI2A 1VQ8A 3ER0A 4YCWA 1Q81C 4JI2L 1L1OA 1UE7A 1P8LA 4FDBA 1HR0Q 1HNZL 1WYDA 1LTLA 3G48A 4C2MH 3OW2A 3ULJA 1VS0A 2OQKA 4QIWE 4DR4Q 1A63A 2RHSB 3EIVA 4DNIA 4DV6L 2JA8G 1HZCA 4A3EH 2R7FA 2B63H 1G6PA 4GLVB 1IBML 3NBHB 3RN5A 2CKZB 4JI0L 3PIPA 3CC7A 4HIMA 2VL6A 3W1BA 4DV2Q 3NENA 4GKJQ 1N9WA 4LW1A 4A3MH 4UP7A 4YHHQ 4IPCA 1CKNA 5C44H 3S2HH 3T1YQ 3D31A 2JA6H 2ZM6Q 4LFBQ 4HJ7A 3A5UA 1B7YB 1V43A 4JCVE 3F1ZA 3CAMA 1YBYA 1W2BA 2Y0SE 1Y14B 1I94L 5AJ3L 2E2JH 1Q86C 1U5KA 4NPSA 4L5QA 4JC0A 3KF6B 4NB3A 3KFUA 2F4VQ 4DV7L 4GN5A 4PMWA 3STBC 3SGIA 2AWNA 4OX9Q 3RR5A 3RZDH 3ULPA 4OO1I 1GD7A 1S3OA 2Z6KA 3CCVA 1KL9A 4A3GH 1V9PA 4DR3Q 1EUJA 4QY7A 1X3FA 4P73A 1XMQL 4R4QA 3GTPH 2UUAL 3K7UC 3LGJA 5IWAQ 2JEBI 2JA8H 1FVIA 2GVAA 3J81c 3W1GA 1AE2A 3PO2G 2BH2A 4GKKL 2IY5B 3PCOB 2ID0A 1HH2P 2Y0SG 4C3HH 4LF4L 2UUCQ 4B3SL 4LFAL 4L5SA 4NXML 1FGUA 2EXDA 3KOJA 1Z47A 1XNQQ 3GTKH 3GTOH 4GLAC 4P74A 4DR1L 3GTJH 3E0EA 1TWAH 2KHJA 1K0RA 1EIFA 1PH5A 1B70B 3HOUH 1XNRL 3GDEA 2MO0A 4MNOA 4JI6L 1KAWA 2UXCQ 5C3EH 2ZTEA 5C0XI 4JI2Q 4GNXA 1VQ7A 3PUZA 4P72A 1KRTA 5LMUL 3GTLH 3RNUA 3CCRA 4DAYB 2OTJA 1YJWA 1I5FA 3I55A 5JEAJ 2R7ZG 3CQZH 3CPFA 2E5LQ 2Q2UA 1D7QA 3K80C 2K5VA 2JK8A 1YVCA 4YWKA 4DV6Q 1GVPA 4DK3C 1LUZA 3TS0A 3CCSA 1K73C 4RG1A 4KHZA 1IBMQ 1OXUA 4LUVA 5DLQE 3KDFA 2VQFQ 4JI0Q 4LF5Q 2PMZE 3ERSX 3Q8DA 3PO3G 1Q1BA 4J15A 4IFDI 1LYLA 2IHEA 3S2DH 2CCZA 4DV2L 1P16A 4JBKA 1SR3A 3M4PA 4A3BH 1MJEA 4YHHL 3CW2C 3VDYA 1EYGA 3KF8B 2DUDA 4BA2I 3T1YL 5C4XG 4BA1I 4IJHA 3K0XA 2CWPA 3I4NG 3PO2H 3PIOA 4YCUA 3H15A 2R93G 1EWIA 3UDIA 3KJOA 4BBSG 1PYBA 1AE3A 4DV7Q 3HOZG 2UXDQ 4K0KL 4LFCQ 1VQGA 1UE5A 2F4VL 3CF5A 5IY0A 4B3TQ 1VCIA 2BA0A 4OX9L 1X65A 3M3YH 4OO1G 2PNHA 2R7ZH 3J81j 4JBMA 2GN5A 2IX1A 1XMQQ 4DR3L 5HY6A 2N3SA 2UUAQ 5K36G 1L1OC 4PZ7A 5JJLA 3L7ZC 2NVYH 3H0GG 4L5TA 2YTYA 4BY7G 3TQYA 1KHIA 5IWAL 1HNWL 4LF4Q 4BY1G 1VQAA 4B3SQ 3U4VA 4YY3L 4NXMQ 2NVTH 2VNUD 4JYAL 3PO3H 3PV0A 4JOIA 4DR1Q 4A3JG 1E1OA 1N8RC 4A3CG 1Q8KA 4PZ8A 3GO5A 1XNQL 1OXXK 1UEBA 4DR7L 1CKMA 1JJGA 2A8VA 1EQRA 1UE1A 2JJQA 5C4XH 5LMUQ 3A74A 2UXCL 1I6HH 3ZJYC 1J5EL 3I4NH 2WB1E 4GN3B 4Y7NH 1QUQB 5C0XG 1VQJA 2I0QA 4LNQA 4O0AA 1IYJB 1AH9A 1TWCH 4P75A 3CXCA 2E5LL 2ZJRA 3U50C 1J6QA 3HOZH 4WJ4A 1TXYA 2N8NA 1X55A 1GKHA 3I56A 4A3IH 1BKBA 3I4OA 4A3LH 3FKIH 2VQFL 4LF5L 3NEMA 4DV5Q 2KBNA 1X3EA 1Y1WG 3EBEA 2NN6I 1L0WA 2JA7H 1VQPA 2Z6KC 1SROA 4IFDG 4YWLA 2E8GA 3RLFA 4A93H 4APVA 5IYCG 5IYDG 2PI2A 1PH3A 2E2HH 4BY7H 4PZ6A 2WB1G 2WP8J 4BY1H 3HOVH 4O2DA 5IP9H 2K14A 1TWHH 2IX0A 1YIJA 1KC8C 2Q2TA 1Q46A 4X64L 3MEFA 4A3CH 2RCNA 1YJ9A 4X65L 4HJ9A 4K0KQ 2UXBL 2R92G 3KLWA 4OWXB 1OXSC 1L2FA 4LUOA 4GOPB 5HGQA 1SFOH 3OTOL 4LFCL 4JG2A 4DV1L 5IT9c 2UXDL 5JJKA 2KCMA 3CMEA 1VQKA 4LF6L 4B3TL 1MKHA 2AMCB 3GTMH 4R4TA 1WFQA 5M5YH 3G6EA 3JC66 4GNXC 3M4OH 5BR8Q 3PGZA 3JAMc 3GTGH 2VW9A 1HNWQ 5LMNQ 3H3VI 3K7AH 4X66L 4YY3Q 1HZ9A 1VQEA 1I3QH 1I50H 2HQLA 3T1HL 4JYAQ 1R9TH 2YTVA 4POFA 3CC4A 1Y1WH 3E9HA 1VQMA 1VQIA 1PA6A 2A1AA 2D0PA 1IL2A 4DR7Q 4A4IA 3MXNB 4H02A 1KRSA 1HZAA 1XPOA 2PQAB 2KENA 4C3IH 1K3RA 2JEAI 1Y1VG 5H1SE 5IYCH 1J5EQ 2K5HA 2F52A 1PFSA 1QVCA 1XPRA 1MJCA 3CMAA 3CPWA 5E7NA 2Q2HA 3UE1A 4BXXG 4A3DG 3D0FA 2WAQE 3HOWG 1YHBA 2MNAA 1N32Q 1XTDA 2PI2E 2D0OA 5ELOA 1JJCB 2Q2IA 1A8VA 5M5WH 1SRUA 2R92H 2CWAA 1WI5A 3GD7A 1PH2A 3PF5A 3CC2A 2BH8A 2ATWA 4DR6L 4A3KG 3J80i 2JA5G 1JMCA 1HZBA 3HFZB 1OXVA 3L2PA 4DV3L 2QA4A 4DV5L 4B3ML 3I4MG 4OONA 3DLLA 2NN6G 4QL5A 5M3FG 1XJVA 4UP8A 1PH8A 3HKZE 1SN8A 3KJPA 4YCVA 1HNXQ 3RLNA 4X62L 2B29A 1E24A 2WFWA 4AQYL 1MIUA 1G291 4KI0A 2WAQG 5JEAG 4LF9Q 4X64Q 3L0OA 2R7DA 4QGUA 4DV4L 4DR2Q 4B3RQ 4X65Q 2UXBQ 1VQ4A 3CCJA 1D8LA 1K9MC 4UY8C 4IPGA 4JOIC 4IJLA 2DGYA 5M3MG 3U4ZA 1Y1VH 3OTOQ 4DV1Q 1WCMG 3A5ZB 1NMFA 4XIGS 4XTCS 2K4KA 2QEXA 4ALPA 1PHJA 4LF6Q 2NVQH 3AEVA 1SMXA 4BBRG 1O7IA 4HIDA 1VQ9A 3ICEA 1YITA 5LMNW 1JT8A 3HOWH 4DUYL 3KF6A 4DPGA 4GOPA 3HKZG 1N36Q 1S40A 5BR8L 4X66Q 4LUZA 4JI5L 3M9BA 3J7ZC 3T1HQ 4OWTB 5LMNL 2I5MX 2V1CC 3F2CA 1KXLA 1B8AA 1E22A 4A76A 2IHFA 3TS2A 2AWOA 3G71A 3AQQA 3S14H 5GAHC 2K52A 1VQ5A 5GAEC 3I4MH 4A3EG 2B63G 2VY3A 1FJGQ 5M3FH 2OQ0A 1DGSA 1C0AA 2ALYB 4IPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH6 A;  4HJ8 A;  5FLM G;  1E3P A;  2FXQ A;  2MFI A;  4JV5 L;  2A19 A;  2AHO B;  1EOV A;  2R93 H;  1QZG A;  1KD1 C;  3BJU A;  2HIX A;  5ELN A;  5GQO A;  1VQD A;  2JA6 G;  1X6O A;  1JB7 A;  3RZO H;  2H5X A;  1QZH A;  4BBS H;  4LWC A;  3ULL A;  4WJ3 M;  1JJ2 A;  4JBJ A;  2VQE L;  1N32 L;  1PV4 A;  3KYH C;  1PH1 A;  3U58 A;  1Q1E A;  4GS3 A;  2C35 B;  5M3M H;  3CCU A;  1Q12 A;  3CD6 A;  4DR6 Q;  4KHP Q;  1WCM H;  1KIX A;  4JI3 Q;  2Z0S A;  4GNX B;  1JE5 A;  1OXT A;  1CSQ A;  2N78 A;  5M5X H;  3CCE A;  3UDX A;  4UP9 A;  4DV3 Q;  2UUB L;  4B3M Q;  3IRB A;  2OTL A;  1NJI C;  1LM0 A;  4MZ9 A;  2N49 A;  3J81 i;  1X56 A;  4X62 Q;  1ASZ A;  3NEL A;  3TRZ A;  4AQY Q;  3S16 H;  3H0G H;  1Q7Y C;  3S24 A;  1HNX L;  3S1N H;  4A3G G;  3STB D;  3I7F A;  3KDF B;  1XMO Q;  3M4Q A;  4DR5 Q;  1PH9 A;  2KCT A;  3S1R H;  1VQN A;  4DV4 Q;  3H3V H;  2ASB A;  1X3G A;  4A3J H;  4LF9 L;  2ZTC A;  1NY4 A;  1KQS A;  4B3R L;  4R4I A;  4DR2 L;  3HOY G;  2HHH Q;  2XGT A;  1YZ6 A;  3BU2 A;  1WJJ A;  1PYS B;  4DUZ Q;  1V1Q A;  1YEZ A;  3F2D A;  1IBL Q;  4AIM A;  4GLX A;  1M1K C;  1IBK Q;  2NVX H;  2HT1 A;  3UDG A;  2B3G A;  1EQQ A;  4JI8 Q;  5FLM H;  1OTC A;  3S1M H;  2UU9 Q;  1N33 Q;  4DUY Q;  1T9H A;  3CCQ A;  3HOU G;  4R4O A;  3GTQ H;  3CCM A;  3EN2 A;  3CCL A;  4TQU S;  2YU9 H;  5C3E G;  4LF7 Q;  4NXN Q;  4JI5 Q;  4R4C A;  3HOX G;  1VQL A;  4IO9 A;  1N36 L;  4QQB X;  3CP0 A;  4Y52 H;  5GRO A;  4AYB E;  4POG A;  3G4S A;  2VZA A;  4LF8 L;  4DV0 L;  3M7N A;  1G51 A;  1E1T A;  1SE8 A;  4JI7 Q;  1K83 H;  1EIY B;  1PVO A;  1WOC A;  1HJP A;  1C7Y A;  2JE6 I;  3RLO A;  2QGQ A;  1CSP A;  4R1J A;  3UE0 A;  4JI4 L;  1VQH A;  1FJG L;  2K5N A;  2RF4 A;  5IYD H;  3AFP A;  1ASY A;  4UPA A;  4JV5 Q;  1A62 A;  4IOC A;  1X54 A;  4JI1 Q;  2MO1 A;  2BA1 A;  4GN4 B;  2RHQ B;  3PF4 A;  3PUV A;  2R6G A;  4A3B G;  2F3I A;  1TWF H;  5IP7 G;  2VQE Q;  1VQO A;  1VQF A;  1RIP A;  3PUY A;  3HOY H;  1YHA A;  1PH7 A;  1N34 L;  4C3J H;  4MTN A;  4AYB G;  5FJ8 G;  1QUQ A;  2EIF A;  1CUK A;  4L5R C;  4KHP L;  2UUB Q;  3E9I A;  4JI3 L;  1L1O B;  5IYB G;  2E2I H;  1K8A C;  4ME3 A;  1M90 C;  2ZJQ A;  1XPU A;  1HR0 W;  1H95 A;  4HJ5 A;  3RN2 A;  3OYY A;  1GO3 E;  2NZH A;  3HOX H;  1U0L A;  4A3F G;  3UDF A;  1Z9F A;  1HNZ Q;  3W5O A;  5GAD C;  2YYZ A;  2ZTD A;  1NBW A;  5EAY A;  2GVB A;  4DAM A;  1UE6 A;  2IT1 A;  4GOP C;  1X9N A;  2OWO A;  1HR0 L;  1FL0 A;  4OWW B;  1XMO L;  3S15 H;  4DR5 L;  2I5H A;  1NTG A;  1IZ6 A;  1BBW A;  2EQS A;  2XTI A;  2YV5 A;  2VUM G;  2K50 A;  2AKW B;  3AYH B;  4HIO A;  3TEH B;  2CFM A;  1W3S A;  1YNX A;  4QJF A;  4TVA B;  3AFQ A;  4DR4 L;  3M85 A;  1VQC A;  1CKN B;  1YJN A;  1PH4 A;  4HIK A;  3PUX A;  2HHH L;  2JQO A;  4DUZ L;  4IOA A;  4JBW A;  1RL2 A;  1IBL L;  1VQ6 A;  1K8G A;  1IBK L;  4X6A H;  4BXX H;  4A3D H;  4JI8 L;  3K81 C;  4GKJ L;  2UU9 L;  1N33 L;  2ES2 A;  5GAG C;  5IP7 H;  1NE3 A;  3K8A A;  2D62 A;  5IE8 A;  5FLX c;  3BZK A;  2I5L X;  4PG3 A;  2ZM6 L;  4LF7 L;  4LFB L;  4YWM A;  4NXN L;  2YTX A;  3F8T A;  1I94 Q;  5JJI A;  3BZC A;  5FJ8 H;  5AJ3 Q;  4LF8 Q;  4DV0 Q;  2L15 A;  4DK6 C;  1QVG A;  3J7A 5;  2KHI A;  4HJA A;  4A3K H;  2JA5 H;  3A0J A;  2MQH A;  3PSI A;  1UWV A;  5IYB H;  4A75 A;  1GM5 A;  4JI7 L;  3FP9 A;  3WWV A;  1NMG A;  2K75 A;  4P71 A;  4JI4 Q;  4A3I G;  4EQ5 A;  2OCE A;  2ZJP A;  4A3L G;  3FKI G;  4A3F H;  1BVS A;  1SLJ A;  3FHW A;  5C0X J;  4DKA C;  3J80 c;  2JA7 G;  4A3M G;  4JI1 L;  2VUM H;  1C9O A;  3HKS A;  4RMF A;  5C44 G;  2NZO A;  2PQA A;  2LXK A;  3B6Y A;  4A93 G;  3DM3 A;  3PUW A;  4IPD A;  4OXP A;  1A0I A;  4EX5 A;  1N34 Q;  4GKK Q;  3TRE A;  2HIV A;  4LFA Q;  1EFW A;  4AH6 A;  3HOV G;  5IP9 G;  5J3B A;  1S72 A;  4KLK A;  3S1Q H;  2LSS A;  2CQO A;  2UUC L;  1E7Z A;  3I2Z A;  3F2B A;  2LXJ A;  4BBR H;  1XNR Q;  1VQB A;  2VS1 A;  3JAM i;  4JI6 Q;  1CKO A;  1TWG H;  1BBU A;  1IXR A;  5C4J H;  1Q82 C;  3S17 H;  1YHQ A;  4IFD J;  2JA9 A;  1QVF A;  1YI2 A;  1VQ8 A;  3ER0 A;  4YCW A;  1Q81 C;  4JI2 L;  1L1O A;  1UE7 A;  1P8L A;  4FDB A;  1HR0 Q;  1HNZ L;  1WYD A;  1LTL A;  3G48 A;  4C2M H;  3OW2 A;  3ULJ A;  1VS0 A;  2OQK A;  4QIW E;  4DR4 Q;  1A63 A;  2RHS B;  3EIV A;  4DNI A;  4DV6 L;  2JA8 G;  1HZC A;  4A3E H;  2R7F A;  2B63 H;  1G6P A;  4GLV B;  1IBM L;  3NBH B;  3RN5 A;  2CKZ B;  4JI0 L;  3PIP A;  3CC7 A;  4HIM A;  2VL6 A;  3W1B A;  4DV2 Q;  3NEN A;  4GKJ Q;  1N9W A;  4LW1 A;  4A3M H;  4UP7 A;  4YHH Q;  4IPC A;  1CKN A;  5C44 H;  3S2H H;  3T1Y Q;  3D31 A;  2JA6 H;  2ZM6 Q;  4LFB Q;  4HJ7 A;  3A5U A;  1B7Y B;  1V43 A;  4JCV E;  3F1Z A;  3CAM A;  1YBY A;  1W2B A;  2Y0S E;  1Y14 B;  1I94 L;  5AJ3 L;  2E2J H;  1Q86 C;  1U5K A;  4NPS A;  4L5Q A;  4JC0 A;  3KF6 B;  4NB3 A;  3KFU A;  2F4V Q;  4DV7 L;  4GN5 A;  4PMW A;  3STB C;  3SGI A;  2AWN A;  4OX9 Q;  3RR5 A;  3RZD H;  3ULP A;  4OO1 I;  1GD7 A;  1S3O A;  2Z6K A;  3CCV A;  1KL9 A;  4A3G H;  1V9P A;  4DR3 Q;  1EUJ A;  4QY7 A;  1X3F A;  4P73 A;  1XMQ L;  4R4Q A;  3GTP H;  2UUA L;  3K7U C;  3LGJ A;  5IWA Q;  2JEB I;  2JA8 H;  1FVI A;  2GVA A;  3J81 c;  3W1G A;  1AE2 A;  3PO2 G;  2BH2 A;  4GKK L;  2IY5 B;  3PCO B;  2ID0 A;  1HH2 P;  2Y0S G;  4C3H H;  4LF4 L;  2UUC Q;  4B3S L;  4LFA L;  4L5S A;  4NXM L;  1FGU A;  2EXD A;  3KOJ A;  1Z47 A;  1XNQ Q;  3GTK H;  3GTO H;  4GLA C;  4P74 A;  4DR1 L;  3GTJ H;  3E0E A;  1TWA H;  2KHJ A;  1K0R A;  1EIF A;  1PH5 A;  1B70 B;  3HOU H;  1XNR L;  3GDE A;  2MO0 A;  4MNO A;  4JI6 L;  1KAW A;  2UXC Q;  5C3E H;  2ZTE A;  5C0X I;  4JI2 Q;  4GNX A;  1VQ7 A;  3PUZ A;  4P72 A;  1KRT A;  5LMU L;  3GTL H;  3RNU A;  3CCR A;  4DAY B;  2OTJ A;  1YJW A;  1I5F A;  3I55 A;  5JEA J;  2R7Z G;  3CQZ H;  3CPF A;  2E5L Q;  2Q2U A;  1D7Q A;  3K80 C;  2K5V A;  2JK8 A;  1YVC A;  4YWK A;  4DV6 Q;  1GVP A;  4DK3 C;  1LUZ A;  3TS0 A;  3CCS A;  1K73 C;  4RG1 A;  4KHZ A;  1IBM Q;  1OXU A;  4LUV A;  5DLQ E;  3KDF A;  2VQF Q;  4JI0 Q;  4LF5 Q;  2PMZ E;  3ERS X;  3Q8D A;  3PO3 G;  1Q1B A;  4J15 A;  4IFD I;  1LYL A;  2IHE A;  3S2D H;  2CCZ A;  4DV2 L;  1P16 A;  4JBK A;  1SR3 A;  3M4P A;  4A3B H;  1MJE A;  4YHH L;  3CW2 C;  3VDY A;  1EYG A;  3KF8 B;  2DUD A;  4BA2 I;  3T1Y L;  5C4X G;  4BA1 I;  4IJH A;  3K0X A;  2CWP A;  3I4N G;  3PO2 H;  3PIO A;  4YCU A;  3H15 A;  2R93 G;  1EWI A;  3UDI A;  3KJO A;  4BBS G;  1PYB A;  1AE3 A;  4DV7 Q;  3HOZ G;  2UXD Q;  4K0K L;  4LFC Q;  1VQG A;  1UE5 A;  2F4V L;  3CF5 A;  5IY0 A;  4B3T Q;  1VCI A;  2BA0 A;  4OX9 L;  1X65 A;  3M3Y H;  4OO1 G;  2PNH A;  2R7Z H;  3J81 j;  4JBM A;  2GN5 A;  2IX1 A;  1XMQ Q;  4DR3 L;  5HY6 A;  2N3S A;  2UUA Q;  5K36 G;  1L1O C;  4PZ7 A;  5JJL A;  3L7Z C;  2NVY H;  3H0G G;  4L5T A;  2YTY A;  4BY7 G;  3TQY A;  1KHI A;  5IWA L;  1HNW L;  4LF4 Q;  4BY1 G;  1VQA A;  4B3S Q;  3U4V A;  4YY3 L;  4NXM Q;  2NVT H;  2VNU D;  4JYA L;  3PO3 H;  3PV0 A;  4JOI A;  4DR1 Q;  4A3J G;  1E1O A;  1N8R C;  4A3C G;  1Q8K A;  4PZ8 A;  3GO5 A;  1XNQ L;  1OXX K;  1UEB A;  4DR7 L;  1CKM A;  1JJG A;  2A8V A;  1EQR A;  1UE1 A;  2JJQ A;  5C4X H;  5LMU Q;  3A74 A;  2UXC L;  1I6H H;  3ZJY C;  1J5E L;  3I4N H;  2WB1 E;  4GN3 B;  4Y7N H;  1QUQ B;  5C0X G;  1VQJ A;  2I0Q A;  4LNQ A;  4O0A A;  1IYJ B;  1AH9 A;  1TWC H;  4P75 A;  3CXC A;  2E5L L;  2ZJR A;  3U50 C;  1J6Q A;  3HOZ H;  4WJ4 A;  1TXY A;  2N8N A;  1X55 A;  1GKH A;  3I56 A;  4A3I H;  1BKB A;  3I4O A;  4A3L H;  3FKI H;  2VQF L;  4LF5 L;  3NEM A;  4DV5 Q;  2KBN A;  1X3E A;  1Y1W G;  3EBE A;  2NN6 I;  1L0W A;  2JA7 H;  1VQP A;  2Z6K C;  1SRO A;  4IFD G;  4YWL A;  2E8G A;  3RLF A;  4A93 H;  4APV A;  5IYC G;  5IYD G;  2PI2 A;  1PH3 A;  2E2H H;  4BY7 H;  4PZ6 A;  2WB1 G;  2WP8 J;  4BY1 H;  3HOV H;  4O2D A;  5IP9 H;  2K14 A;  1TWH H;  2IX0 A;  1YIJ A;  1KC8 C;  2Q2T A;  1Q46 A;  4X64 L;  3MEF A;  4A3C H;  2RCN A;  1YJ9 A;  4X65 L;  4HJ9 A;  4K0K Q;  2UXB L;  2R92 G;  3KLW A;  4OWX B;  1OXS C;  1L2F A;  4LUO A;  4GOP B;  5HGQ A;  1SFO H;  3OTO L;  4LFC L;  4JG2 A;  4DV1 L;  5IT9 c;  2UXD L;  5JJK A;  2KCM A;  3CME A;  1VQK A;  4LF6 L;  4B3T L;  1MKH A;  2AMC B;  3GTM H;  4R4T A;  1WFQ A;  5M5Y H;  3G6E A;  3JC6 6;  4GNX C;  3M4O H;  5BR8 Q;  3PGZ A;  3JAM c;  3GTG H;  2VW9 A;  1HNW Q;  5LMN Q;  3H3V I;  3K7A H;  4X66 L;  4YY3 Q;  1HZ9 A;  1VQE A;  1I3Q H;  1I50 H;  2HQL A;  3T1H L;  4JYA Q;  1R9T H;  2YTV A;  4POF A;  3CC4 A;  1Y1W H;  3E9H A;  1VQM A;  1VQI A;  1PA6 A;  2A1A A;  2D0P A;  1IL2 A;  4DR7 Q;  4A4I A;  3MXN B;  4H02 A;  1KRS A;  1HZA A;  1XPO A;  2PQA B;  2KEN A;  4C3I H;  1K3R A;  2JEA I;  1Y1V G;  5H1S E;  5IYC H;  1J5E Q;  2K5H A;  2F52 A;  1PFS A;  1QVC A;  1XPR A;  1MJC A;  3CMA A;  3CPW A;  5E7N A;  2Q2H A;  3UE1 A;  4BXX G;  4A3D G;  3D0F A;  2WAQ E;  3HOW G;  1YHB A;  2MNA A;  1N32 Q;  1XTD A;  2PI2 E;  2D0O A;  5ELO A;  1JJC B;  2Q2I A;  1A8V A;  5M5W H;  1SRU A;  2R92 H;  2CWA A;  1WI5 A;  3GD7 A;  1PH2 A;  3PF5 A;  3CC2 A;  2BH8 A;  2ATW A;  4DR6 L;  4A3K G;  3J80 i;  2JA5 G;  1JMC A;  1HZB A;  3HFZ B;  1OXV A;  3L2P A;  4DV3 L;  2QA4 A;  4DV5 L;  4B3M L;  3I4M G;  4OON A;  3DLL A;  2NN6 G;  4QL5 A;  5M3F G;  1XJV A;  4UP8 A;  1PH8 A;  3HKZ E;  1SN8 A;  3KJP A;  4YCV A;  1HNX Q;  3RLN A;  4X62 L;  2B29 A;  1E24 A;  2WFW A;  4AQY L;  1MIU A;  1G29 1;  4KI0 A;  2WAQ G;  5JEA G;  4LF9 Q;  4X64 Q;  3L0O A;  2R7D A;  4QGU A;  4DV4 L;  4DR2 Q;  4B3R Q;  4X65 Q;  2UXB Q;  1VQ4 A;  3CCJ A;  1D8L A;  1K9M C;  4UY8 C;  4IPG A;  4JOI C;  4IJL A;  2DGY A;  5M3M G;  3U4Z A;  1Y1V H;  3OTO Q;  4DV1 Q;  1WCM G;  3A5Z B;  1NMF A;  4XIG S;  4XTC S;  2K4K A;  2QEX A;  4ALP A;  1PHJ A;  4LF6 Q;  2NVQ H;  3AEV A;  1SMX A;  4BBR G;  1O7I A;  4HID A;  1VQ9 A;  3ICE A;  1YIT A;  5LMN W;  1JT8 A;  3HOW H;  4DUY L;  3KF6 A;  4DPG A;  4GOP A;  3HKZ G;  1N36 Q;  1S40 A;  5BR8 L;  4X66 Q;  4LUZ A;  4JI5 L;  3M9B A;  3J7Z C;  3T1H Q;  4OWT B;  5LMN L;  2I5M X;  2V1C C;  3F2C A;  1KXL A;  1B8A A;  1E22 A;  4A76 A;  2IHF A;  3TS2 A;  2AWO A;  3G71 A;  3AQQ A;  3S14 H;  5GAH C;  2K52 A;  1VQ5 A;  5GAE C;  3I4M H;  4A3E G;  2B63 G;  2VY3 A;  1FJG Q;  5M3F H;  2OQ0 A;  1DGS A;  1C0A A;  2ALY B;  4IPH A; 
#chains in the Genus database with same CATH topology
 1E3P A;  4JV5 L;  1B4O A;  4V0B A;  1EOV A;  3MFG A;  3BJU A;  2QKI C;  2JA6 G;  3WOF A;  1QZH A;  1B50 A;  2PZU A;  4LWC A;  1JJ2 A;  1N32 L;  3CRL C;  2VQE L;  3KYH C;  3GTM B;  5M3M H;  4GS3 A;  3CCU A;  5M5Y B;  1FGB D;  1KIX A;  4GNX B;  4G4K A;  1CSQ A;  2G5D A;  1STG A;  1JWU D;  1TU2 B;  3NHH A;  3IRB A;  3E5S A;  2N49 A;  1K8O A;  3H94 A;  2RQX A;  1PTO D;  5K36 H;  1BCP B;  4X62 Q;  3Q23 A;  3S16 H;  3S1N H;  3I7F A;  3KDF B;  4BS9 A;  4DR5 Q;  1XMO Q;  2RSO A;  2KCT A;  2V4D A;  1WTX A;  1PH9 A;  4DV4 Q;  1VQN A;  5T1I A;  1NY4 A;  3HOY G;  4JW0 A;  2HHH Q;  1YZ6 A;  1WJJ A;  4AIM A;  1M1K C;  3UDG A;  2B3G A;  3D8G A;  2UU9 Q;  4EQN A;  3NWS A;  3GTQ H;  1S5B D;  3EN2 A;  4LF7 Q;  2JXM B;  2E2I B;  3J80 E;  4QQB X;  5GRO A;  1EY0 A;  1JC7 A;  4AYB E;  3G4S A;  4LF8 L;  4DV0 L;  3M7N A;  1WTO A;  3HZX A;  1E1T A;  1K83 H;  2F0D A;  1EIY B;  2KEC A;  3VA5 A;  1LTB D;  1CSP A;  4R1J A;  4IFD H;  1SND A;  3UE0 A;  4JI4 L;  1VQH A;  3I72 A;  2RF4 A;  4UPA A;  1I4R A;  2EY2 A;  1M8A A;  2BA1 A;  4GN4 B;  1Y1V B;  5EPL A;  1E0B A;  4IUT A;  1B53 A;  3T16 A;  4CHT B;  4A3D B;  3HOY H;  3TBI B;  2WAC A;  3C1F A;  2RDG A;  2EIF A;  2UUB Q;  1K8A C;  2SEB D;  1H95 A;  5DM7 3;  3RN2 A;  5I6W A;  1STA A;  1GO3 E;  3S14 B;  2F4I A;  3I4M B;  5GAD C;  2YYZ A;  2ZTD A;  5EAY A;  2IT1 A;  1SNP A;  1FL0 A;  1XMO L;  2QIL A;  4DR5 L;  1F2Y A;  2EQS A;  1BBW A;  2K5D A;  3AYH B;  2CFM A;  4DR4 L;  1Y8P B;  1CKN B;  2D5D A;  3BVM A;  4RHR A;  4HIK A;  1NCV A;  2HHH L;  2JQO A;  4XYQ A;  4IOA A;  1EZ6 A;  3D4D A;  4X6A H;  5M3M B;  1AZQ A;  3K81 C;  2UU9 L;  1EY4 A;  4KHV A;  5DM6 3;  1PZJ D;  1IHZ A;  1STN A;  4B08 A;  4Z9C B;  1EIH A;  3DM1 A;  4PG3 A;  4XT1 B;  4LF7 L;  5C4J B;  4YWM A;  1KDC A;  4IUQ A;  2MJ8 A;  1JOR A;  2NWG A;  4RH6 A;  1QVG A;  2JA5 H;  2MQH A;  3PSI A;  3S1N B;  3MZ5 A;  4C2M B;  2ZJP A;  4A3L G;  5C4Z A;  3QJY A;  1B3Q A;  1GUN A;  1PDQ A;  2F3V A;  3FHW A;  2RDF A;  2KQ3 A;  3MXN A;  2A73 B;  4FF3 A;  5C44 G;  2P5Z X;  4J1M A;  4A93 G;  3DM3 A;  3PUW A;  4OXP A;  1R4Q B;  2HIV A;  1K8M A;  2JA6 B;  5IIF A;  4XQN A;  4BBR H;  2VS1 A;  1TWG H;  1BBU A;  1Q82 C;  2R61 A;  1H9S A;  1QVF A;  4JI2 L;  3K59 A;  1ENF A;  3QOJ A;  3OW2 A;  3RMH A;  3ULJ A;  1VS0 A;  3TP6 A;  3FRP B;  2EXZ A;  1EL0 A;  2WIN B;  2KUM A;  2HD3 A;  5CMD A;  1QB5 D;  3HOY B;  2VL6 A;  4Q5V A;  5JPM C;  2IW3 A;  4LW1 A;  4IPC A;  5C44 H;  1ROD A;  4HSP A;  2NB0 A;  3GTO B;  2B2Y A;  2ZM6 Q;  4LFB Q;  2EY5 A;  5HGT A;  1B7Y B;  4N9P A;  3F1Z A;  1XYI A;  4HCS A;  2GA4 B;  5E1F A;  5FKA C;  5EGT A;  1TR5 A;  4JVZ A;  4L5Q A;  1Z7T A;  3GTL B;  1F2M A;  3C46 A;  1PTO H;  1ZKO A;  3SGI A;  1ZYR D;  4OX9 Q;  4OO1 I;  5C6A A;  2BDN A;  5KEE A;  5AFW A;  4YIJ A;  2B2T A;  1FVI A;  2GVA A;  2HDL A;  2ID0 A;  2Y0S G;  5FLX L;  3K5M A;  1FGU A;  1Z47 A;  1TS5 A;  4GLA C;  3HOU H;  5C3E H;  4DK1 A;  4WJW A;  3PUZ A;  3CCR A;  4CDE C;  4DAY B;  2ICI A;  5L37 A;  2R7Z G;  2K01 A;  2L11 A;  3K80 C;  2K5V A;  1I4G A;  2JK8 A;  3QO2 A;  1ML0 D;  1CK1 A;  1IYV A;  1D6E C;  1K73 C;  1DD2 A;  4RG1 A;  3DWA A;  4LF5 Q;  2PMZ E;  1F9Q A;  1NNX A;  1LYL A;  4IUP A;  2CCZ A;  5IT9 E;  3M4P A;  4A3B H;  4L8J A;  1AFP A;  3KUP A;  1U4R A;  1PRT C;  4IJH A;  4BA1 I;  1STH A;  1DM0 B;  2R93 G;  1EWI A;  3SK5 A;  3KJO A;  4BBS G;  3DWP A;  1AE3 A;  3T51 B;  3CHB D;  1K0S A;  4B3T Q;  2F0E A;  3P20 A;  1VCI A;  2BA0 A;  1WD0 A;  4OX9 L;  2K5Q A;  4OO1 G;  2R7Z H;  2PMZ B;  3J81 j;  2GN5 A;  1LTT D;  1C4Q A;  2UUA Q;  3LX0 A;  2NVY H;  3H0G G;  4L5T A;  4CBV A;  3NQI A;  4IUR A;  2NVT H;  5C44 B;  4B3S Q;  4R8N A;  4YY3 L;  1EIG A;  4A93 B;  3PV0 A;  4H13 C;  1F9S A;  4PZ8 A;  3GO5 A;  4DAV A;  2KCN A;  3URY A;  5LMU Q;  2N55 A;  1PTO B;  4Y7N H;  1C8C A;  1VQJ A;  2B2Y C;  1TWC H;  4WFN 3;  2ZJR A;  2EYL A;  1V8Q A;  1GKH A;  4A3I H;  4CKC A;  1JCK B;  4OIJ A;  2WKC A;  4LF5 L;  3K7A B;  1X3E A;  2JA7 H;  1O80 A;  1BCP D;  1VQP A;  1R9T B;  2E8G A;  3RLF A;  3QIA A;  1JOQ A;  5IYD G;  2PI2 A;  2DY7 A;  2NTS A;  2B2T C;  4PZ6 A;  2WB1 G;  4XQJ A;  2WP8 J;  4O2D A;  2B2V A;  4RGO S;  4RKL A;  4PMB A;  2RCN A;  1ILQ A;  1UNS A;  3KLW A;  1OXS C;  2ENB A;  4LUO A;  3Q22 A;  1SFO H;  2L0C A;  2AQ2 B;  3CME A;  4LF6 L;  4B3T L;  4ID6 A;  5COR A;  2MUY A;  5BR8 Q;  2EPB A;  3GTG H;  2VW9 A;  3MTS A;  1HZ9 A;  1VQE A;  1I3Q H;  1I50 H;  1QNU A;  5DEH A;  2YTV A;  4R8I A;  1PA6 A;  2D0P A;  4DR7 Q;  4A4I A;  5CGK A;  2Y0S B;  5C5M A;  3E6Z X;  2PQA B;  1K3R A;  4DF7 A;  3V05 A;  2ZXO A;  2F52 A;  4ZYS A;  3D0F A;  2WAQ E;  3HOW G;  1TQO A;  3BVZ A;  3TZD A;  1GUG A;  2PI2 E;  2D0O A;  2R7Z B;  2XIW A;  3GD7 A;  3CC2 A;  2ATW A;  4DR6 L;  4RGT A;  4A3K G;  4QF4 A;  3HFZ B;  2NVT B;  1YNN D;  5I9P A;  5M3F G;  4G7H C;  1WTW A;  2EVB A;  4UP8 A;  1HNX Q;  3KJP A;  3NBH A;  1E24 A;  3VR3 A;  4KI0 A;  2FHT A;  5DNF A;  3OPO A;  3JAM E;  1X3Q A;  3A55 A;  3NXW A;  2I07 B;  2BE5 D;  2UXB Q;  1ICF B;  4Y7N B;  2R93 B;  4CJ1 B;  4IPG A;  4LJZ C;  4BBS B;  3A5Z B;  4ALP A;  2NVQ H;  1X3P A;  1YIT A;  1WCM B;  3HOW H;  3NQT A;  3KF6 A;  4F87 A;  1HCZ A;  5BR8 L;  1LT4 D;  5EPJ A;  1CA5 A;  4OWT B;  2I5M X;  3F2C A;  4F8M A;  3J7A V;  1B8A A;  5CV9 A;  1E22 A;  3H0G B;  4CDD C;  2LY7 A;  5GAE C;  4FVM A;  3S1R B;  3P7J A;  2B63 G;  1QNK A;  2F0N A;  4NKL A;  2KHS A;  2F0Q A;  1JQY D;  5M3F H;  1DGS A;  5JOB A;  2L5T A;  3WDN A;  2AUJ D;  4ZKB B;  2AHO B;  1QZG A;  1KD1 C;  1LT6 D;  1HTP A;  2HIX A;  3MA2 B;  5GQO A;  2EY1 A;  1SYG A;  5NUC A;  4WJ3 M;  2J7Z A;  3U58 A;  1PH1 A;  2B2V C;  3JAM L;  1PFM A;  4KHP Q;  3K6O A;  5A2Q L;  5IGF A;  1EQV A;  2Z0S A;  4OIK A;  1JE5 A;  5M5X H;  4DV3 Q;  4TSS A;  1FNV A;  2X6G A;  1I50 B;  1SYB A;  1B9N A;  3J81 i;  2O5I C;  2MP1 A;  4ZLT F;  1X56 A;  1ASZ A;  3TRZ A;  1HNX L;  2IJ0 A;  3KK7 A;  3ND8 A;  1V1O A;  1E2V A;  4A3J H;  5EBC A;  4NW2 A;  5G3L D;  1SEB D;  2JP1 A;  4C3J G;  2XGT A;  3BU2 A;  2KJX A;  3FDT A;  1YEZ A;  2SOB A;  4GLX A;  3I70 A;  1OTC A;  4DUY Q;  2DNE A;  4MN3 A;  2LFN A;  1DON A;  1VQL A;  1XX8 A;  4Y52 H;  3I8Z A;  4RKB A;  2A69 C;  1RHP A;  4POG A;  2VZA A;  4IAL A;  5DAU A;  1SNC A;  1WOC A;  1HJP A;  4FYD A;  2F0I A;  4U68 A;  3ITP A;  1NUC A;  2HCI A;  4JV5 Q;  4ODG A;  4IOC A;  1CA6 A;  1X54 A;  4JI1 Q;  1T5E A;  3PF4 A;  3CU7 A;  2R6G A;  3J7Y W;  2L1B A;  1S5E D;  2VQE Q;  1VQF A;  1PH7 A;  3SK6 A;  5IGG A;  4C3J H;  3HOW B;  4MTN A;  4AYB G;  5FJ8 G;  1QUQ A;  2L4N A;  2RCF A;  4KHP L;  1CUK A;  1PRT D;  4DAP A;  5LL6 S;  1L1O B;  2PW7 A;  2E2I H;  2Q8T A;  4ME3 A;  5JVG 3;  1RJT A;  1HFN A;  3TN2 A;  1XPU A;  1EU3 A;  4HJ5 A;  4A3K B;  4ME5 A;  2E74 C;  1KLG D;  1DOL A;  2CVR A;  4IUN A;  3UDF A;  1JB3 A;  1HNZ Q;  1MGS A;  1T5X D;  1NBW A;  3P1H A;  2GVB A;  2F0J A;  2LKV A;  1HR0 L;  4OWW B;  3S15 H;  1NTG A;  2XTI A;  2K50 A;  4DGZ A;  1BDO A;  4QJF A;  4TVA B;  3M85 A;  4HSV A;  2RBM A;  1YJN A;  1PH4 A;  3PUX A;  2QDL A;  2HDM A;  1VQ6 A;  1K8G A;  4BXX H;  4A3D H;  2XWB B;  3S1Q B;  2ES2 A;  3K8A A;  5D3I B;  1TS3 A;  2D62 A;  5IE8 A;  3H09 A;  5FLX c;  3BZK A;  3NTK A;  1U4L A;  3ONA B;  1MD2 D;  3BZC A;  4PMC A;  5FJ8 H;  4LF8 Q;  4DV0 Q;  3CRK C;  3J81 E;  1ENC A;  4HMI A;  4K5V A;  4ZQ3 A;  3FP9 A;  1SE4 A;  3WWV A;  2KA7 A;  4P71 A;  4JI4 Q;  4PV1 C;  1ILP A;  2D9U A;  4QUF A;  3DMU A;  2B63 B;  3SK8 A;  3AB9 A;  1V1P A;  4JI1 L;  4RMF A;  5D65 A;  2NZO A;  1B44 D;  5EKI A;  3TRE A;  1EFW A;  3PIP 3;  2IL8 A;  5IP9 G;  5D14 A;  1B1Z A;  3NK9 A;  1S72 A;  1CZW A;  2LSS A;  5BN3 A;  2UUC L;  1E7Z A;  1LT3 D;  4KN4 C;  2LXJ A;  1PZI D;  3SVM A;  1AZP A;  5C4J H;  1IXR A;  2SDF A;  2E2J B;  1YI2 A;  1CT1 D;  3ER0 A;  2SNM A;  4ZUJ A;  3IAY A;  1EY8 A;  1P8L A;  1UE7 A;  1HNZ L;  3NBI A;  3RZD B;  2MHV A;  4C2M H;  1A63 A;  4QIW E;  4DR4 Q;  1Y69 U;  4EQP A;  2O4X A;  1D5M C;  3EIV A;  2PZW A;  3F2U A;  4XYO A;  3R8B A;  3GTP B;  3HEJ A;  1GHJ A;  2EJG C;  1IBM L;  4JI0 L;  2CKZ B;  3PIP A;  3C3L A;  3R93 A;  4HIM A;  4C3J B;  4DV2 Q;  1SBB B;  1BBX C;  1CKN A;  4ZKC B;  3T1Y Q;  2JA6 H;  3LWE A;  3SEB A;  1V43 A;  1SMY C;  1GUT A;  3CAM A;  1YBY A;  1W2B A;  3OHX C;  1Y14 B;  4ILW A;  1Q86 C;  1U5K A;  1U4M A;  1JOO A;  1ZXT A;  1HXY D;  1SE3 A;  3CQZ B;  2TSS A;  4FXG C;  4IN3 A;  3KFU A;  3V96 A;  4DV7 L;  3S15 B;  3RR5 A;  3ULP A;  5EQ0 A;  1S3O A;  1KL9 A;  4DR3 Q;  1EUJ A;  2F0G A;  1BUV T;  2A68 D;  4DFA A;  5IWA Q;  3S2D B;  2J0T D;  4O42 A;  1AE2 A;  3I91 A;  4TRD A;  1QJO A;  2PO4 A;  2F03 A;  4NXM L;  4FF1 A;  3KOJ A;  3GTK H;  3GTO H;  4P74 A;  4DR1 L;  4AYB B;  4N9T A;  4MNO A;  2UXC Q;  5KNB A;  2ZTE A;  5C0X I;  4JI2 Q;  5ELC A;  4P72 A;  3GTL H;  3RNU A;  2RKS A;  5IOD A;  2DNC A;  1I5F A;  3I55 A;  2Q8R E;  1D7Q A;  3TME A;  4K14 A;  4YWK A;  3J80 L;  3W3A A;  1GVP A;  4LAA A;  4DK3 C;  5IOC A;  3CCS A;  2L55 A;  4KHZ A;  5DLQ E;  2VQF Q;  3HRZ C;  2Z1C A;  1SYD A;  4QUC A;  5I2Y A;  1JOK A;  4DV2 L;  1SR3 A;  1EYG A;  3CW2 C;  2EDG A;  2ICE C;  1EEF D;  4C1N I;  4BA2 I;  3T1Y L;  1CFM A;  3I4N G;  3H15 A;  4YCU A;  5ELD A;  3EVQ A;  3I73 A;  4NP5 A;  4K0K L;  1AW7 A;  1TVX A;  1UE5 A;  3CF5 A;  5IY0 A;  3TP8 A;  3HOZ B;  2XSC A;  3K5N A;  2IX1 A;  2F0P A;  2B2U A;  2VXW A;  5C3W A;  5JVH 3;  4DR3 L;  1EEI D;  1S5F D;  4PZ7 A;  3VR2 A;  4KD3 A;  2YTY A;  4QB4 A;  3TQY A;  5IWA L;  1HNW L;  2FIN B;  2OEO A;  4I65 A;  2F0T A;  4JYA L;  1GUW A;  4JOI A;  1PFB A;  4HR7 B;  2E2H B;  1Q8K A;  4M8A A;  1CKM A;  1JJG A;  4DN4 M;  1EQR A;  1IYU A;  1BO0 A;  4KTA A;  2UXC L;  1J5E L;  3I4N H;  4IUU A;  4MIU A;  5C0X G;  3MC0 B;  3K5O A;  1AH9 A;  4F7X A;  4FP5 D;  3FEW X;  3U50 C;  1J6Q A;  4WJ4 A;  2N8N A;  1CQF A;  1BKB A;  1DCZ A;  3I4O A;  2VQF L;  4A3L H;  4K6L A;  2KBN A;  4UHV A;  1JR0 D;  2D2C C;  2A69 D;  2CH4 W;  1Y1W G;  1J8I A;  2K5W A;  1EY5 A;  3BVG A;  1TY0 A;  3VR6 A;  1BNZ A;  1SRO A;  2NUC A;  1WTH A;  4YWL A;  1EZ8 A;  4C3I G;  3GTK B;  4A93 H;  5IYC G;  1BXT A;  4K8I A;  3ERO A;  2HQE A;  2EYJ A;  2EZV A;  1CQV A;  2Q2T A;  5EJW A;  2PQE A;  1D1K A;  3PMF A;  4DK0 A;  4OHJ A;  4GOP B;  5HGQ A;  3OTO L;  4DV1 L;  4JG2 A;  5ELF A;  1VQK A;  5KYL A;  1MKH A;  2AMC B;  4UAI A;  2K6A A;  3NSW A;  3G6E A;  1DOK A;  3PGZ A;  3JAM c;  3IL8 A;  1A6X A;  3H3V I;  3K7A H;  4YY3 Q;  1DYQ A;  3Q6S A;  3T1H L;  1R9T H;  1Y1W H;  4OGQ C;  4XT3 B;  3E9H A;  2A1A A;  1IL2 A;  4DU9 A;  1EFI D;  1PRT B;  3MXN B;  1MI2 A;  1XPO A;  4C3I H;  2KEN A;  5IYC H;  5ISR A;  2K5H A;  4FNF A;  3CMA A;  2DN8 A;  5E7N A;  3UE1 A;  1YHB A;  1F9R A;  1Y8N B;  2F0W A;  5COY A;  5ELO A;  4KN7 C;  2NBF A;  1TS4 A;  2CWA A;  1PH2 A;  3I4L A;  3PF5 A;  1H9S B;  1CM9 A;  2BH8 A;  1LTR D;  2DJG C;  4KK7 A;  1JMC A;  3SK4 A;  2F0M A;  4B3M L;  1NSN S;  3DLL A;  1XWE A;  3BYY B;  1SN8 A;  5CC4 A;  2X6L A;  2B29 A;  1GOZ A;  4AQY L;  2B2U C;  1MIU A;  2WAQ G;  5JEA G;  4LF9 Q;  3L0O A;  2F0U A;  4MTK A;  4DR2 Q;  1GXD C;  2A6E C;  3I4N B;  1LTG D;  5CV4 A;  5CR3 A;  2PW5 A;  1D8L A;  3KBG A;  3SHL A;  3CCJ A;  4JOI C;  3RZO B;  2C5C A;  1WCM G;  2L12 A;  2FFK B;  2RA4 A;  4LF6 Q;  2K4K A;  4J8Q A;  2QEX A;  2PNR C;  3TDQ A;  3AEV A;  1VQ9 A;  5JPN C;  1JT8 A;  5LMN W;  3G7L A;  1E2W A;  1N36 Q;  2F3W A;  1S40 A;  1K3B C;  1LT5 D;  4JI5 L;  1HUM A;  3DHQ A;  4XDX A;  2JYO A;  2IX3 A;  4A76 A;  2AWO A;  4EVO A;  2K52 A;  1EY6 A;  4A3E G;  1FJG Q;  2OQ0 A;  5JAV A;  2EYM A;  1HHV A;  2K04 A;  5J39 A;  2FXQ A;  2A19 A;  2NVX B;  2R93 H;  5IT9 L;  2Z4I A;  1VQD A;  5FO7 B;  4BBS H;  2H5X A;  3ULL A;  3VYT A;  3GV3 A;  4IUV A;  1B2T A;  2F0K A;  2C35 B;  4DR6 Q;  3CD6 A;  1B3A A;  1WCM H;  4JI3 Q;  3SXH A;  1CTM A;  1SMY D;  4UP9 A;  2JN4 A;  4OO1 H;  2OTL A;  1NJI C;  2Z9H A;  3T13 A;  1LM0 A;  3NE5 B;  4MZ9 A;  3MXG A;  4KJO A;  2Q8I B;  2OXP A;  1Y1W B;  3NEL A;  3H0G H;  1Q7Y C;  3S24 A;  2L9H A;  4A3G G;  1YNJ C;  3M4Q A;  4C3I B;  3S1R H;  3H3V H;  3D6C A;  5CV7 A;  1X3G A;  1Q8I A;  4LF9 L;  2ZTC A;  4R4I A;  1H9R A;  3VYS A;  4DR2 L;  3T56 B;  1L0X B;  1G6Z A;  1TWF B;  2EYH A;  4DUZ Q;  3F2D A;  1IBL Q;  1IBK Q;  1II3 A;  1U4P A;  3S1M H;  1N33 Q;  1T9H A;  5CYU A;  3CCM A;  3V2T A;  3CKI B;  2YU9 H;  1GUS A;  4R4C A;  3HOX G;  5FK9 C;  1N36 L;  1WVL A;  3EQL C;  4CJ2 C;  1VMC A;  1G51 A;  4JI7 Q;  1S5D D;  1SE8 A;  3KLS A;  3NPP A;  3QR8 A;  1C7Y A;  1EU4 A;  3RLO A;  3W2D A;  1UUP A;  2KVM A;  1DXM A;  1FJG L;  5CBA E;  5IYD H;  3AFP A;  1ASY A;  1A62 A;  2BOS A;  3EFX D;  1PFN A;  2RHQ B;  2F3I A;  1RTN A;  3PUY A;  5IGC A;  1WTV A;  1YHA A;  1N34 L;  1PLF A;  2KCC A;  3IFT A;  1MHW C;  1W6J A;  5E4W C;  4L5R C;  4HED A;  3E9I A;  4JI3 L;  4ZCK A;  5IYB G;  2CH4 A;  2ZJQ A;  5A35 A;  1WTP A;  3OYY A;  4KKS A;  1QWY A;  3HOX H;  1U0L A;  1Z9F A;  4KD4 A;  3W5O A;  1X9N A;  3KLR A;  3RUZ A;  1A3U A;  4A3F B;  2I5H A;  2VUM G;  4KKT A;  4HIO A;  2AKW B;  1YNX A;  2WAQ B;  1VQC A;  5J1Z A;  4HN7 A;  4DUZ L;  4JBW A;  4L63 B;  1IBL L;  4O1N A;  1LAB A;  1IBK L;  4GKJ L;  1N33 L;  5GAG C;  1RD9 D;  4FXK C;  4P2C B;  3MXP A;  2I5L X;  4PQX A;  1ESF A;  3S17 B;  2YTX A;  1I94 Q;  5JJI A;  2PZT A;  4DXG A;  5AJ3 Q;  2L15 A;  4DK6 C;  4RAU C;  2I46 A;  4HJA A;  4A3K H;  3A0J A;  3DEO A;  1UWV A;  5IYB H;  3IFD A;  4JI7 L;  3S9W A;  1LO5 D;  1NMG A;  2K75 A;  1BQQ T;  4C56 C;  4EQ5 A;  3TZU A;  3HGB A;  3FKI G;  1TII D;  2AQ3 B;  1EY7 A;  5K5P A;  4DNT B;  4A3E B;  1BVS A;  5C0X J;  2TMP A;  3J80 c;  2E75 C;  4KY6 A;  2E76 C;  4A3M G;  2VUM H;  2O5J C;  1C9O A;  3GP7 A;  2LXK A;  4IPD A;  3S1M B;  1EWH A;  4FF4 A;  1G2S A;  4LFA Q;  4QMG A;  2K33 A;  3S2H B;  3HOV G;  5J3B A;  2IWH A;  2YU9 B;  1SSO A;  4RCO A;  3S1Q H;  2CQO A;  1BR9 A;  3A8K E;  3I2Z A;  5E4X A;  1XNR Q;  5M9O A;  1VQB A;  4JI6 Q;  1GUO A;  1YHQ A;  2RSN A;  2NZ1 D;  4YCW A;  1L1O A;  2XRQ D;  4I7Z C;  1NR4 A;  4FDB A;  3QWN A;  1HR0 Q;  1WYD A;  1PTO F;  3G48 A;  3HP3 A;  2O2L D;  4A3G B;  2JA8 G;  4DNI A;  4DV6 L;  4Q0F A;  1HZC A;  2B63 H;  2RDH A;  2PPB C;  1G6P A;  4GLV B;  5KNC A;  4C3H G;  3NBH B;  3RN5 A;  2PCF B;  3BDL A;  3CC7 A;  1HTL D;  3NEN A;  1N9W A;  3FMC A;  4A3M H;  4UP7 A;  1D5X C;  3E0J A;  3GTJ B;  1TWA B;  4HTH A;  2QCP X;  4HJ7 A;  3DUZ A;  1I94 L;  5AJ3 L;  2E2J H;  3HOX B;  4NPS A;  1IW7 C;  5EBD A;  4IZ8 A;  1CZG A;  3KF6 B;  1PYW D;  4GN5 A;  3STB C;  2AWN A;  3RZD H;  3OWF A;  3CCV A;  2HCC A;  4QY7 A;  3MWY W;  4QCL A;  1XMQ L;  4R4Q A;  3GTP H;  4G7O C;  5IGE A;  2JA8 H;  5KGU A;  3W1G A;  2BH2 A;  3PCO B;  4LFA L;  3T53 B;  4C3H H;  2UUC Q;  4LF4 L;  4L5S A;  2EXD A;  1SYE A;  4WOR A;  3PO2 B;  5HUR A;  3E0E A;  4K2L A;  1EIF A;  1XNR L;  3LNN A;  4JI6 L;  1KAW A;  3PIO 3;  2K05 A;  4GNX A;  2OTJ A;  2MGS A;  4RA8 A;  1KTK A;  5JEA J;  3CQZ H;  2E5L Q;  2Q2U A;  3GQB A;  1Q3L A;  3EA6 A;  3M3Y B;  1DJR D;  5FOB B;  1A2T A;  1LUZ A;  3TS0 A;  1IBM Q;  1OXU A;  4JI0 Q;  2VUM B;  3KDF A;  5JJZ A;  4J15 A;  3VYU A;  4IFD I;  4G57 A;  3S2D H;  1UAP A;  3O13 A;  4V19 0;  5EKK A;  5FO9 B;  3KF8 B;  4K6D A;  2DUD A;  5C4X G;  2NYZ D;  5CV6 A;  2F0V A;  3K0X A;  3PIO A;  3QG1 A;  1KNA A;  1I6H B;  1PYB A;  4K2K A;  4NDX A;  4DV7 Q;  1KAB A;  3HOZ G;  2UXD Q;  4LFC Q;  4I7A A;  1I4H A;  4K5X A;  4JBM A;  4IQZ A;  3FKI B;  5HY6 A;  2N3S A;  1G91 A;  5K36 G;  1L1O C;  4JK1 C;  5JJL A;  1RKN A;  3L7Z C;  4BY7 G;  3R2I A;  1KHI A;  4A3M B;  4G7Z C;  1A15 A;  4BY1 G;  1VQA A;  3OIP A;  4NXM Q;  2VNU D;  3RD4 A;  1RCV D;  2EJM A;  4DR1 Q;  5KND A;  1N8R C;  3TP5 A;  1YNJ D;  3A56 A;  3HOV B;  1HFG A;  1UEB A;  5D3D A;  4HMJ A;  1UE1 A;  3HG9 A;  5C4X H;  3ZJY C;  4EGV A;  4HCE A;  4GN3 B;  1G2T A;  1QUQ B;  4RCN A;  2I0Q A;  1Z6H A;  4CJ0 B;  2R3Z A;  4O0A A;  1I6V C;  1NR2 A;  2E5L L;  4ZK9 B;  2H4O A;  1ENA A;  3HOZ H;  1TXY A;  1X55 A;  4OL7 A;  3I56 A;  3GV6 A;  3J81 L;  1SNM A;  4X3K A;  2JA8 B;  1PZK D;  1Q90 A;  4UDU C;  3EBE A;  1VF5 C;  3HS0 C;  1L0W A;  2F0L A;  4C3H B;  4IFD G;  4DA2 A;  1ZEQ X;  2EJF C;  5EPK A;  1PH3 A;  2E2H H;  4BY7 H;  4BY1 H;  5J22 A;  5IP9 H;  2K14 A;  1TWH H;  2IX0 A;  1KC8 C;  4X64 L;  1F77 A;  4X3S A;  2KEE A;  3X3N A;  4X65 L;  3T4A C;  2Z6B A;  4K0K Q;  2R92 G;  1L2F A;  4QIW B;  2UXD L;  4LFC L;  5IT9 c;  2AQ1 B;  1H9K A;  2KCM A;  5M5W B;  1KLU D;  1C48 A;  4R4T A;  4GNX C;  3JC6 6;  3M4O H;  1HNW Q;  4U67 3;  4X66 L;  3WOE A;  1JE4 A;  4H44 C;  2HQL A;  4JYA Q;  3K5L A;  1BCP C;  2NTT A;  3CC4 A;  5EKL A;  1EYC A;  1VQI A;  3A54 A;  4X3U A;  1V1P B;  2CQA A;  2JEA I;  1KRS A;  2AUK A;  1J5E Q;  1QVC A;  1FNU A;  5CV8 A;  1XPR A;  1MJC A;  4CKE A;  1AP0 A;  2MNA A;  2E2D C;  1JJC B;  3K58 A;  2R92 H;  2QEJ C;  1WI5 A;  1JWS D;  2M00 A;  5ELB A;  3KLS X;  2JA5 G;  2LMC B;  2QA4 A;  2F0O A;  4OON A;  1FYC A;  1LTA D;  1A3V A;  2KED A;  4QL5 A;  1GJX A;  4EQO A;  3HKZ E;  3RLN A;  5CV5 A;  5I2X A;  1I4P A;  4X62 L;  3D3R A;  1X32 A;  4L6T B;  1RF2 D;  4B3R Q;  4DV4 L;  5C4X B;  1TKW B;  2EYO A;  1K9M C;  1ICW A;  2B8G A;  4IJL A;  3OTO Q;  4DV1 Q;  4XIG S;  1NMF A;  1PHJ A;  2FJ2 A;  4BBR G;  1F9P A;  1HUN A;  3ICE A;  1A2U A;  1IKL A;  5C5L A;  1KAA A;  2PYK A;  3NUC A;  4E6I A;  4ZRZ A;  1VMP A;  3QOL A;  4GOP A;  2K32 A;  3C1E A;  3A7A B;  1R4P B;  4LUZ A;  3J7Z C;  3M9B A;  3T1H Q;  3HKZ B;  2V1C C;  1YNN C;  2EE1 A;  3S16 B;  2A6H C;  3TS2 A;  4RGN A;  4ULL A;  2F1M A;  3AQQ A;  3G71 A;  3D6W A;  4BY7 B;  2ZXR A;  2Z4H A;  4BY1 B;  3MXU A;  4X3T A;  2CW0 C;  1TWH B;  4RWS C;  3BYT B;  1C0A A;  2ALY B;  3K57 A;  1ESR A;  4IPH A;  4NMZ A;  3AU7 A;  1PH6 A;  4HJ8 A;  1EY9 A;  2BE5 C;  5FLM G;  2MFI A;  3BZD B;  4CGY B;  1LAC A;  5IGD A;  5ELN A;  3R2T A;  3OWE B;  1F2Z A;  1X6O A;  1JB7 A;  3RZO H;  4B9X A;  4KY7 A;  3MFY A;  2XWJ B;  4JBJ A;  1PV4 A;  3GTQ B;  1Q1E A;  4KY5 A;  1Q12 A;  4DAY A;  3M4O B;  1STE A;  3I90 A;  1OXT A;  2N78 A;  3CCE A;  3UDX A;  4B3M Q;  2UUB L;  2K1B A;  1QOH A;  1IW7 D;  3OIQ A;  1K83 B;  3D4R A;  4AQY Q;  3MEH A;  1S4Z A;  1KDB A;  3STB D;  1GHK A;  1BCP F;  5FLX E;  4F88 A;  4LK1 C;  2ASB A;  2WV6 D;  4B3R L;  1KQS A;  3MVV A;  3VYR A;  4XQQ A;  1CI3 M;  3X3M A;  1S5C D;  1PYS B;  3OW7 A;  1V1Q A;  2NVX H;  2HT1 A;  2M2L A;  2LS0 1;  4RFB A;  1EQQ A;  4JI8 Q;  5KRU A;  5FLM H;  2R92 B;  5C0X H;  2F0F A;  3E3X A;  3CCQ A;  3HOU G;  4R4O A;  3NP8 A;  1IL8 A;  3CCL A;  4TQU S;  5C3E G;  3N52 A;  4NXN Q;  4JI5 Q;  4IO9 A;  2C9O A;  3CP0 A;  1K28 A;  4KKU A;  3LWU A;  1MSG A;  3G6J B;  2EYF A;  1PVO A;  2JE6 I;  3BDO A;  3M7G A;  3C2P A;  2QGQ A;  3U9O A;  2K5N A;  3H6M A;  3K0Y A;  2MO1 A;  1FNW A;  1O78 A;  3PUV A;  1PXU A;  2XN9 C;  3A8I E;  1TWF H;  4A3B G;  5IP7 G;  1VQO A;  1SYC A;  1RIP A;  1FD7 D;  2QDB A;  3IKJ A;  2K03 A;  5F2D A;  1M90 C;  1HR0 W;  2JA5 B;  2M9V A;  2OT2 A;  1RTO A;  2K28 A;  2NZH A;  3A8J E;  4A3F G;  1NAP A;  4DAM A;  2OWO A;  4GOP C;  1STB A;  1UE6 A;  3FVQ A;  4R9W A;  5E3F A;  1IZ6 A;  4S3S A;  2YV5 A;  3TEH B;  1W3S A;  1QCB D;  3AFQ A;  2N88 A;  4CDC C;  4GZY C;  5T1G A;  1RL2 A;  1BOS A;  2XVS A;  4JI8 L;  4ZUI A;  1CHQ D;  1XTC D;  3A7L A;  5IP7 H;  1NE3 A;  4BBR B;  2ZM6 L;  4LFB L;  1TWG B;  4NXN L;  3F8T A;  5ELE A;  2F0H A;  3J7A 5;  4CDF C;  2KHI A;  4HAE A;  4A75 A;  2WKD A;  1GM5 A;  1I4X A;  4B9W A;  3H91 A;  3EJI A;  1VF7 A;  1M4V A;  4A3I G;  3M4Y A;  1HA6 A;  2OCE A;  3Q24 A;  1TS2 A;  2DY8 A;  1TT2 A;  4A3F H;  5LHY 1;  1SLJ A;  4DKA C;  2JA7 G;  1LTS D;  5JEA H;  1H9J A;  3HKS A;  5C3X A;  2PQA A;  3B6Y A;  4CKB A;  4EX5 A;  1N34 Q;  1A3T A;  1A0I A;  4M1U B;  4GKK Q;  5I6Y A;  3ZYY X;  3MAQ A;  4AH6 A;  1PMR A;  4KLK A;  1W6K A;  2FMM A;  3F2B A;  3JAM i;  1CKO A;  3S17 H;  3J7A F;  4IFD J;  3SDZ A;  2QF7 A;  2A5H A;  2JA9 A;  1Y8O B;  4XXE A;  2EOT A;  1VQ8 A;  1HRJ A;  5BN4 A;  1Q81 C;  4DXF A;  2JSO A;  1LTL A;  2J4X A;  3L9A X;  2Z8L A;  2OQK A;  1WD1 A;  1LLR D;  2RHS B;  4A3E H;  2R7F A;  4LMQ D;  1EOT A;  5G3L F;  3W1B A;  4GKJ Q;  2HUG A;  4YHH Q;  1SJE D;  3S2H H;  3D31 A;  3D4W A;  3A5U A;  1D2B A;  3HOU B;  1JIC A;  4JCV E;  5LL6 X;  2Y0S E;  4DNR B;  5C3E B;  1HA5 A;  2ZXP A;  4H0L C;  3Q0A A;  5KIX A;  1PTO C;  4JC0 A;  3P75 A;  4NB3 A;  1SYF A;  2F4V Q;  4PMW A;  1GD7 A;  2Z6K A;  3BG3 A;  4A3G H;  1V9P A;  1X3F A;  4P73 A;  2UUA L;  3K7U C;  3LGJ A;  2JEB I;  3J81 c;  1U9R A;  3PO2 G;  4GKK L;  2IY5 B;  3AMU A;  4A3B B;  1HH2 P;  4B3S L;  1SNQ A;  1DZ1 A;  1XNQ Q;  1EYD A;  3GTJ H;  1TWA H;  2KHJ A;  1K0R A;  1PH5 A;  5TSS A;  4OEL B;  1B70 B;  3GDE A;  2MO0 A;  2B2W A;  1PRT F;  1VQ7 A;  5LMU L;  1KRT A;  1YJW A;  3CPF A;  4KV6 A;  1YVC A;  4DV6 Q;  3UI2 A;  3OMG A;  3SR1 A;  3OMC A;  4OEM B;  4LUV A;  4K5W A;  4J6H A;  1STY A;  2IPK D;  2NVY B;  3ERS X;  3FPU B;  3Q8D A;  1Q1B A;  3PO3 G;  2A68 C;  2IHE A;  2QW7 A;  1SAP A;  1P16 A;  4JBK A;  2A6H D;  1MJE A;  4YHH L;  3VDY A;  2CW0 D;  3PO2 H;  2CWP A;  1SJH D;  3PQI A;  5A2Q E;  1MBY A;  4N8X 1;  3UDI A;  2G9H D;  1SDF A;  1TWC B;  1VQG A;  2F4V L;  1B9M A;  1QG7 A;  2DJF C;  1X65 A;  2XNA C;  4FF2 A;  3M3Y H;  2PNH A;  4A3I B;  3ND9 A;  3NTH A;  1XMQ Q;  3R3O A;  1J9O A;  1L0Y B;  5I9O A;  2FMC A;  1ET6 A;  2JA7 B;  2XRS D;  4LF4 Q;  2VB3 X;  3U4V A;  4RGM A;  3PO3 H;  1O7Y A;  3ERQ A;  4A3J G;  1E1O A;  2B39 A;  4A3C G;  1UEA B;  1XNQ L;  1OXX K;  4DR7 L;  1EQT A;  2B8F A;  2A8V A;  1HQR D;  2JJQ A;  1QE6 A;  3A74 A;  3DEP A;  1I6H H;  1EYA A;  3NWT A;  2WB1 E;  1SFO B;  4LNQ A;  1H9M A;  1IYJ B;  1HPC A;  4P75 A;  3SE0 A;  3CXC A;  4PNY A;  3GTG B;  4KJN A;  1SE2 A;  3FKI H;  3NEM A;  4DV5 Q;  2KOL A;  4N8F A;  2NN6 I;  1I3Q B;  3I3C A;  2Z6K C;  5I4D A;  4RHS A;  1MSH A;  3L3O C;  1FR3 A;  1WTR A;  1LTI D;  4APV A;  3OOC A;  4KMU C;  1HQM C;  3H3V C;  4C1N K;  3HOV H;  3VA7 A;  1YIJ A;  2MPM A;  1Q46 A;  2WB1 B;  3MEF A;  4A3C H;  3KF8 A;  3BS1 A;  1YJ9 A;  1SXT A;  4HJ9 A;  2UXB L;  4OWX B;  2X69 A;  1OO9 B;  4FXD A;  5JJK A;  2B2W C;  1VDZ A;  1O7L A;  3NTI A;  3GTM H;  1BF4 A;  3TSS A;  1WFQ A;  5M5Y H;  1AN8 A;  1DOM A;  5BN5 A;  5LMN Q;  2VB2 X;  3KBX A;  2BDO A;  4POF A;  2RVL A;  1KNE A;  1XXG A;  1VQM A;  4ABN A;  2EY6 A;  1F2L A;  1LV9 A;  4H02 A;  1HZA A;  2WII B;  2A6E D;  1Y1V G;  5IGB A;  5H1S E;  1D1I A;  1KDA A;  4ZAI A;  2BCO A;  2CHB D;  1PFS A;  4JPB W;  3CPW A;  4BXX G;  3DXJ C;  4A3D G;  2Q2H A;  2F0S A;  5FO8 B;  2NVQ B;  3BDC A;  1ET9 A;  1N32 Q;  1XTD A;  1ZYR C;  4MHE A;  3VR4 A;  2ZT9 C;  4K8J A;  2Q2I A;  1A8V A;  1CHP D;  1SRU A;  3N6R A;  1ONL A;  5M5W H;  4H7B A;  1TY2 A;  1WTQ A;  3J80 i;  3U9S A;  3OSO A;  1HZB A;  3FPP A;  1OXV A;  3L2P A;  4DV3 L;  4DV5 L;  3I4M G;  1E2Z A;  2H1E A;  2A74 C;  3PO3 B;  2NN6 G;  1JWM D;  1XJV A;  1PH8 A;  4YCV A;  5KYI A;  2EYP A;  2WFW A;  1SNO A;  4TKO B;  1G29 1;  4WRD A;  2G9D A;  5M3F B;  1AEX A;  3VR5 A;  4X64 Q;  2R7D A;  4QGU A;  5CBE E;  4X65 Q;  3TP7 A;  1VQ4 A;  4UY8 C;  1G8Z D;  2OF1 A;  1RDP D;  2DGY A;  5M3M G;  3U4Z A;  1Y1V H;  3MHB A;  1I4Q A;  1QIL A;  2SNS A;  4XTC S;  3DWQ A;  1SMX A;  1O7I A;  4HID A;  5C4H A;  1IKM A;  3QB3 A;  4DUY L;  1EWC A;  4FO2 A;  5M5X B;  4DPG A;  3HKZ G;  4X66 Q;  5LMN L;  1KXL A;  2K7V A;  1D5Z C;  2IHF A;  4BWG B;  3S14 H;  5GAH C;  3I4M H;  1O7Z A;  1VQ5 A;  2VY3 A;  2NN6 H;  4A3J B; 
#chains in the Genus database with same CATH homology
 1PH6 A;  4HJ8 A;  5FLM G;  1E3P A;  2FXQ A;  2MFI A;  4JV5 L;  2A19 A;  2AHO B;  1EOV A;  2R93 H;  1QZG A;  1KD1 C;  3BJU A;  2HIX A;  5ELN A;  5GQO A;  1VQD A;  2JA6 G;  1X6O A;  1JB7 A;  3RZO H;  2H5X A;  1QZH A;  4BBS H;  4LWC A;  3ULL A;  4WJ3 M;  1JJ2 A;  4JBJ A;  2VQE L;  1N32 L;  1PV4 A;  3KYH C;  1PH1 A;  3U58 A;  1Q1E A;  4GS3 A;  2C35 B;  5M3M H;  3CCU A;  1Q12 A;  3CD6 A;  4DR6 Q;  4KHP Q;  1WCM H;  1KIX A;  4JI3 Q;  2Z0S A;  4GNX B;  1JE5 A;  1OXT A;  1CSQ A;  2N78 A;  5M5X H;  3CCE A;  3UDX A;  4UP9 A;  4DV3 Q;  2UUB L;  4B3M Q;  3IRB A;  2OTL A;  1NJI C;  1LM0 A;  4MZ9 A;  2N49 A;  3J81 i;  1X56 A;  4X62 Q;  1ASZ A;  3NEL A;  3TRZ A;  4AQY Q;  3S16 H;  3H0G H;  1Q7Y C;  3S24 A;  1HNX L;  3S1N H;  4A3G G;  3STB D;  3I7F A;  3KDF B;  1XMO Q;  3M4Q A;  4DR5 Q;  1PH9 A;  2KCT A;  3S1R H;  1VQN A;  4DV4 Q;  3H3V H;  2ASB A;  1X3G A;  4A3J H;  4LF9 L;  2ZTC A;  1NY4 A;  1KQS A;  4B3R L;  4R4I A;  4DR2 L;  3HOY G;  2HHH Q;  2XGT A;  1YZ6 A;  3BU2 A;  1WJJ A;  1PYS B;  4DUZ Q;  1V1Q A;  1YEZ A;  3F2D A;  1IBL Q;  4AIM A;  4GLX A;  1M1K C;  1IBK Q;  2NVX H;  2HT1 A;  3UDG A;  2B3G A;  1EQQ A;  4JI8 Q;  5FLM H;  1OTC A;  3S1M H;  2UU9 Q;  1N33 Q;  4DUY Q;  1T9H A;  3CCQ A;  3HOU G;  4R4O A;  3GTQ H;  3CCM A;  3EN2 A;  3CCL A;  4TQU S;  2YU9 H;  5C3E G;  4LF7 Q;  4NXN Q;  4JI5 Q;  4R4C A;  3HOX G;  1VQL A;  4IO9 A;  1N36 L;  4QQB X;  3CP0 A;  4Y52 H;  5GRO A;  4AYB E;  4POG A;  3G4S A;  2VZA A;  4LF8 L;  4DV0 L;  3M7N A;  1G51 A;  1E1T A;  1SE8 A;  4JI7 Q;  1K83 H;  1EIY B;  1PVO A;  1WOC A;  1HJP A;  1C7Y A;  2JE6 I;  3RLO A;  2QGQ A;  1CSP A;  4R1J A;  3UE0 A;  4JI4 L;  1VQH A;  1FJG L;  2K5N A;  2RF4 A;  5IYD H;  3AFP A;  1ASY A;  4UPA A;  4JV5 Q;  1A62 A;  4IOC A;  1X54 A;  4JI1 Q;  2MO1 A;  2BA1 A;  4GN4 B;  2RHQ B;  3PF4 A;  3PUV A;  2R6G A;  4A3B G;  2F3I A;  1TWF H;  5IP7 G;  2VQE Q;  1VQO A;  1VQF A;  1RIP A;  3PUY A;  3HOY H;  1YHA A;  1PH7 A;  1N34 L;  4C3J H;  4MTN A;  4AYB G;  5FJ8 G;  1QUQ A;  2EIF A;  1CUK A;  4L5R C;  4KHP L;  2UUB Q;  3E9I A;  4JI3 L;  1L1O B;  5IYB G;  2E2I H;  1K8A C;  4ME3 A;  1M90 C;  2ZJQ A;  1XPU A;  1HR0 W;  1H95 A;  4HJ5 A;  3RN2 A;  3OYY A;  1GO3 E;  2NZH A;  3HOX H;  1U0L A;  4A3F G;  3UDF A;  1Z9F A;  1HNZ Q;  3W5O A;  5GAD C;  2YYZ A;  2ZTD A;  1NBW A;  5EAY A;  2GVB A;  4DAM A;  1UE6 A;  2IT1 A;  4GOP C;  1X9N A;  2OWO A;  1HR0 L;  1FL0 A;  4OWW B;  1XMO L;  3S15 H;  4DR5 L;  2I5H A;  1NTG A;  1IZ6 A;  1BBW A;  2EQS A;  2XTI A;  2YV5 A;  2VUM G;  2K50 A;  2AKW B;  3AYH B;  4HIO A;  3TEH B;  2CFM A;  1W3S A;  1YNX A;  4QJF A;  4TVA B;  3AFQ A;  4DR4 L;  3M85 A;  1VQC A;  1CKN B;  1YJN A;  1PH4 A;  4HIK A;  3PUX A;  2HHH L;  2JQO A;  4DUZ L;  4IOA A;  4JBW A;  1RL2 A;  1IBL L;  1VQ6 A;  1K8G A;  1IBK L;  4X6A H;  4BXX H;  4A3D H;  4JI8 L;  3K81 C;  4GKJ L;  2UU9 L;  1N33 L;  2ES2 A;  5GAG C;  5IP7 H;  1NE3 A;  3K8A A;  2D62 A;  5IE8 A;  5FLX c;  3BZK A;  2I5L X;  4PG3 A;  2ZM6 L;  4LF7 L;  4LFB L;  4YWM A;  4NXN L;  2YTX A;  3F8T A;  1I94 Q;  5JJI A;  3BZC A;  5FJ8 H;  5AJ3 Q;  4LF8 Q;  4DV0 Q;  2L15 A;  4DK6 C;  1QVG A;  3J7A 5;  2KHI A;  4HJA A;  4A3K H;  2JA5 H;  3A0J A;  2MQH A;  3PSI A;  1UWV A;  5IYB H;  4A75 A;  1GM5 A;  4JI7 L;  3FP9 A;  3WWV A;  1NMG A;  2K75 A;  4P71 A;  4JI4 Q;  4A3I G;  4EQ5 A;  2OCE A;  2ZJP A;  4A3L G;  3FKI G;  4A3F H;  1BVS A;  1SLJ A;  3FHW A;  5C0X J;  4DKA C;  3J80 c;  2JA7 G;  4A3M G;  4JI1 L;  2VUM H;  1C9O A;  3HKS A;  4RMF A;  5C44 G;  2NZO A;  2PQA A;  2LXK A;  3B6Y A;  4A93 G;  3DM3 A;  3PUW A;  4IPD A;  4OXP A;  1A0I A;  4EX5 A;  1N34 Q;  4GKK Q;  3TRE A;  2HIV A;  4LFA Q;  1EFW A;  4AH6 A;  3HOV G;  5IP9 G;  5J3B A;  1S72 A;  4KLK A;  3S1Q H;  2LSS A;  2CQO A;  2UUC L;  1E7Z A;  3I2Z A;  3F2B A;  2LXJ A;  4BBR H;  1XNR Q;  1VQB A;  2VS1 A;  3JAM i;  4JI6 Q;  1CKO A;  1TWG H;  1BBU A;  1IXR A;  5C4J H;  1Q82 C;  3S17 H;  1YHQ A;  4IFD J;  2JA9 A;  1QVF A;  1YI2 A;  1VQ8 A;  3ER0 A;  4YCW A;  1Q81 C;  4JI2 L;  1L1O A;  1UE7 A;  1P8L A;  4FDB A;  1HR0 Q;  1HNZ L;  1WYD A;  1LTL A;  3G48 A;  4C2M H;  3OW2 A;  3ULJ A;  1VS0 A;  2OQK A;  4QIW E;  4DR4 Q;  1A63 A;  2RHS B;  3EIV A;  4DNI A;  4DV6 L;  2JA8 G;  1HZC A;  4A3E H;  2R7F A;  2B63 H;  1G6P A;  4GLV B;  1IBM L;  3NBH B;  3RN5 A;  2CKZ B;  4JI0 L;  3PIP A;  3CC7 A;  4HIM A;  2VL6 A;  3W1B A;  4DV2 Q;  3NEN A;  4GKJ Q;  1N9W A;  4LW1 A;  4A3M H;  4UP7 A;  4YHH Q;  4IPC A;  1CKN A;  5C44 H;  3S2H H;  3T1Y Q;  3D31 A;  2JA6 H;  2ZM6 Q;  4LFB Q;  4HJ7 A;  3A5U A;  1B7Y B;  1V43 A;  4JCV E;  3F1Z A;  3CAM A;  1YBY A;  1W2B A;  2Y0S E;  1Y14 B;  1I94 L;  5AJ3 L;  2E2J H;  1Q86 C;  1U5K A;  4NPS A;  4L5Q A;  4JC0 A;  3KF6 B;  4NB3 A;  3KFU A;  2F4V Q;  4DV7 L;  4GN5 A;  4PMW A;  3STB C;  3SGI A;  2AWN A;  4OX9 Q;  3RR5 A;  3RZD H;  3ULP A;  4OO1 I;  1GD7 A;  1S3O A;  2Z6K A;  3CCV A;  1KL9 A;  4A3G H;  1V9P A;  4DR3 Q;  1EUJ A;  4QY7 A;  1X3F A;  4P73 A;  1XMQ L;  4R4Q A;  3GTP H;  2UUA L;  3K7U C;  3LGJ A;  5IWA Q;  2JEB I;  2JA8 H;  1FVI A;  2GVA A;  3J81 c;  3W1G A;  1AE2 A;  3PO2 G;  2BH2 A;  4GKK L;  2IY5 B;  3PCO B;  2ID0 A;  1HH2 P;  2Y0S G;  4C3H H;  4LF4 L;  2UUC Q;  4B3S L;  4LFA L;  4L5S A;  4NXM L;  1FGU A;  2EXD A;  3KOJ A;  1Z47 A;  1XNQ Q;  3GTK H;  3GTO H;  4GLA C;  4P74 A;  4DR1 L;  3GTJ H;  3E0E A;  1TWA H;  2KHJ A;  1K0R A;  1EIF A;  1PH5 A;  1B70 B;  3HOU H;  1XNR L;  3GDE A;  2MO0 A;  4MNO A;  4JI6 L;  1KAW A;  2UXC Q;  5C3E H;  2ZTE A;  5C0X I;  4JI2 Q;  4GNX A;  1VQ7 A;  3PUZ A;  4P72 A;  1KRT A;  5LMU L;  3GTL H;  3RNU A;  3CCR A;  4DAY B;  2OTJ A;  1YJW A;  1I5F A;  3I55 A;  5JEA J;  2R7Z G;  3CQZ H;  3CPF A;  2E5L Q;  2Q2U A;  1D7Q A;  3K80 C;  2K5V A;  2JK8 A;  1YVC A;  4YWK A;  4DV6 Q;  1GVP A;  4DK3 C;  1LUZ A;  3TS0 A;  3CCS A;  1K73 C;  4RG1 A;  4KHZ A;  1IBM Q;  1OXU A;  4LUV A;  5DLQ E;  3KDF A;  2VQF Q;  4JI0 Q;  4LF5 Q;  2PMZ E;  3ERS X;  3Q8D A;  3PO3 G;  1Q1B A;  4J15 A;  4IFD I;  1LYL A;  2IHE A;  3S2D H;  2CCZ A;  4DV2 L;  1P16 A;  4JBK A;  1SR3 A;  3M4P A;  4A3B H;  1MJE A;  4YHH L;  3CW2 C;  3VDY A;  1EYG A;  3KF8 B;  2DUD A;  4BA2 I;  3T1Y L;  5C4X G;  4BA1 I;  4IJH A;  3K0X A;  2CWP A;  3I4N G;  3PO2 H;  3PIO A;  4YCU A;  3H15 A;  2R93 G;  1EWI A;  3UDI A;  3KJO A;  4BBS G;  1PYB A;  1AE3 A;  4DV7 Q;  3HOZ G;  2UXD Q;  4K0K L;  4LFC Q;  1VQG A;  1UE5 A;  2F4V L;  3CF5 A;  5IY0 A;  4B3T Q;  1VCI A;  2BA0 A;  4OX9 L;  1X65 A;  3M3Y H;  4OO1 G;  2PNH A;  2R7Z H;  3J81 j;  4JBM A;  2GN5 A;  2IX1 A;  1XMQ Q;  4DR3 L;  5HY6 A;  2N3S A;  2UUA Q;  5K36 G;  1L1O C;  4PZ7 A;  5JJL A;  3L7Z C;  2NVY H;  3H0G G;  4L5T A;  2YTY A;  4BY7 G;  3TQY A;  1KHI A;  5IWA L;  1HNW L;  4LF4 Q;  4BY1 G;  1VQA A;  4B3S Q;  3U4V A;  4YY3 L;  4NXM Q;  2NVT H;  2VNU D;  4JYA L;  3PO3 H;  3PV0 A;  4JOI A;  4DR1 Q;  4A3J G;  1E1O A;  1N8R C;  4A3C G;  1Q8K A;  4PZ8 A;  3GO5 A;  1XNQ L;  1OXX K;  1UEB A;  4DR7 L;  1CKM A;  1JJG A;  2A8V A;  1EQR A;  1UE1 A;  2JJQ A;  5C4X H;  5LMU Q;  3A74 A;  2UXC L;  1I6H H;  3ZJY C;  1J5E L;  3I4N H;  2WB1 E;  4GN3 B;  4Y7N H;  1QUQ B;  5C0X G;  1VQJ A;  2I0Q A;  4LNQ A;  4O0A A;  1IYJ B;  1AH9 A;  1TWC H;  4P75 A;  3CXC A;  2E5L L;  2ZJR A;  3U50 C;  1J6Q A;  3HOZ H;  4WJ4 A;  1TXY A;  2N8N A;  1X55 A;  1GKH A;  3I56 A;  4A3I H;  1BKB A;  3I4O A;  4A3L H;  3FKI H;  2VQF L;  4LF5 L;  3NEM A;  4DV5 Q;  2KBN A;  1X3E A;  1Y1W G;  3EBE A;  2NN6 I;  1L0W A;  2JA7 H;  1VQP A;  2Z6K C;  1SRO A;  4IFD G;  4YWL A;  2E8G A;  3RLF A;  4A93 H;  4APV A;  5IYC G;  5IYD G;  2PI2 A;  1PH3 A;  2E2H H;  4BY7 H;  4PZ6 A;  2WB1 G;  2WP8 J;  4BY1 H;  3HOV H;  4O2D A;  5IP9 H;  2K14 A;  1TWH H;  2IX0 A;  1YIJ A;  1KC8 C;  2Q2T A;  1Q46 A;  4X64 L;  3MEF A;  4A3C H;  2RCN A;  1YJ9 A;  4X65 L;  4HJ9 A;  4K0K Q;  2UXB L;  2R92 G;  3KLW A;  4OWX B;  1OXS C;  1L2F A;  4LUO A;  4GOP B;  5HGQ A;  1SFO H;  3OTO L;  4LFC L;  4JG2 A;  4DV1 L;  5IT9 c;  2UXD L;  5JJK A;  2KCM A;  3CME A;  1VQK A;  4LF6 L;  4B3T L;  1MKH A;  2AMC B;  3GTM H;  4R4T A;  1WFQ A;  5M5Y H;  3G6E A;  3JC6 6;  4GNX C;  3M4O H;  5BR8 Q;  3PGZ A;  3JAM c;  3GTG H;  2VW9 A;  1HNW Q;  5LMN Q;  3H3V I;  3K7A H;  4X66 L;  4YY3 Q;  1HZ9 A;  1VQE A;  1I3Q H;  1I50 H;  2HQL A;  3T1H L;  4JYA Q;  1R9T H;  2YTV A;  4POF A;  3CC4 A;  1Y1W H;  3E9H A;  1VQM A;  1VQI A;  1PA6 A;  2A1A A;  2D0P A;  1IL2 A;  4DR7 Q;  4A4I A;  3MXN B;  4H02 A;  1KRS A;  1HZA A;  1XPO A;  2PQA B;  2KEN A;  4C3I H;  1K3R A;  2JEA I;  1Y1V G;  5H1S E;  5IYC H;  1J5E Q;  2K5H A;  2F52 A;  1PFS A;  1QVC A;  1XPR A;  1MJC A;  3CMA A;  3CPW A;  5E7N A;  2Q2H A;  3UE1 A;  4BXX G;  4A3D G;  3D0F A;  2WAQ E;  3HOW G;  1YHB A;  2MNA A;  1N32 Q;  1XTD A;  2PI2 E;  2D0O A;  5ELO A;  1JJC B;  2Q2I A;  1A8V A;  5M5W H;  1SRU A;  2R92 H;  2CWA A;  1WI5 A;  3GD7 A;  1PH2 A;  3PF5 A;  3CC2 A;  2BH8 A;  2ATW A;  4DR6 L;  4A3K G;  3J80 i;  2JA5 G;  1JMC A;  1HZB A;  3HFZ B;  1OXV A;  3L2P A;  4DV3 L;  2QA4 A;  4DV5 L;  4B3M L;  3I4M G;  4OON A;  3DLL A;  2NN6 G;  4QL5 A;  5M3F G;  1XJV A;  4UP8 A;  1PH8 A;  3HKZ E;  1SN8 A;  3KJP A;  4YCV A;  1HNX Q;  3RLN A;  4X62 L;  2B29 A;  1E24 A;  2WFW A;  4AQY L;  1MIU A;  1G29 1;  4KI0 A;  2WAQ G;  5JEA G;  4LF9 Q;  4X64 Q;  3L0O A;  2R7D A;  4QGU A;  4DV4 L;  4DR2 Q;  4B3R Q;  4X65 Q;  2UXB Q;  1VQ4 A;  3CCJ A;  1D8L A;  1K9M C;  4UY8 C;  4IPG A;  4JOI C;  4IJL A;  2DGY A;  5M3M G;  3U4Z A;  1Y1V H;  3OTO Q;  4DV1 Q;  1WCM G;  3A5Z B;  1NMF A;  4XIG S;  4XTC S;  2K4K A;  2QEX A;  4ALP A;  1PHJ A;  4LF6 Q;  2NVQ H;  3AEV A;  1SMX A;  4BBR G;  1O7I A;  4HID A;  1VQ9 A;  3ICE A;  1YIT A;  5LMN W;  1JT8 A;  3HOW H;  4DUY L;  3KF6 A;  4DPG A;  4GOP A;  3HKZ G;  1N36 Q;  1S40 A;  5BR8 L;  4X66 Q;  4LUZ A;  4JI5 L;  3M9B A;  3J7Z C;  3T1H Q;  4OWT B;  5LMN L;  2I5M X;  2V1C C;  3F2C A;  1KXL A;  1B8A A;  1E22 A;  4A76 A;  2IHF A;  3TS2 A;  2AWO A;  3G71 A;  3AQQ A;  3S14 H;  5GAH C;  2K52 A;  1VQ5 A;  5GAE C;  3I4M H;  4A3E G;  2B63 G;  2VY3 A;  1FJG Q;  5M3F H;  2OQ0 A;  1DGS A;  1C0A A;  2ALY B;  4IPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...