2PQEA

Solution structure of proline-free mutant of staphylococcal nuclease
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
149
structure length
149
Chain Sequence
ATSTKKLHKEAATLIKAIDGDTVKLMYKGQAMTFRLLLVDTAETKHTKKGVEKYGAEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Restricted backbone conformational and motional flexibilities of loops containing peptidyl-proline bonds dominate the enzyme activity of staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 27
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pqeA00
5CC4A 1TR5A 4HMIA 2PZTA 4RKLA 2RKSA 5IGDA 2NUCA 4K8IA 4LAAA 3T13A 5I9OA 3PMFA 3NXWA 4ID6A 4G57A 1SNMA 4HTHA 5CV6A 3NHHA 2PQEA 1STHA 3SHLA 5KRUA 1ENCA 1SNOA 1A2TA 3P75A 4KJOA 2ENBA 1NUCA 1SNQA 5KYLA 2KHSA 3MHBA 5F2DA 1SNPA 2F0QA 3U9OA 4EQOA 5K5PA 2OEOA 1TT2A 2PZUA 4ODGA 1EY5A 4KY5A 2F0IA 3QB3A 1SYFA 2HQEA 4NKLA 4PMCA 5IGGA 4ZQ3A 1KDAA 1A2UA 2F0VA 2F0FA 5C5MA 3NK9A 5JAVA 2LKVA 4KV6A 4PNYA 4KHVA 5C4HA 3NP8A 4KY7A 2SOBA 3H6MA 3BDLA 5I6YA 4KY6A 3SK5A 2EYPA 3ITPA 1EZ8A 3TP7A 4DGZA 1EQVA 3DMUA 1EY0A 5C3XA 1STNA 1JOOA 2O4XA 3MEHA 1SYEA 3E5SA 4KD3A 5I9PA 3SK6A 4MIUA 2EYJA 2EY5A 3D4DA 3SK8A 2F0WA 5IOCA 1JOQA 4K8JA 4ME5A 1EY6A 1SYGA 1EZ6A 3HZXA 1EYDA 1F2YA 3QOLA 3C1EA 2F0MA 2F0GA 3RUZA 1EY8A 1ENAA 3C1FA 4RKBA 3BDCA 2EY2A 1RKNA 2F0TA 2WACA 4QMGA 5CV7A 1STYA 4ZUIA 4DFAA 4F8MA 4YIJA 5C3WA 3OMGA 4N9PA 4B9XA 3D4WA 1SYDA 3MZ5A 3TMEA 5KYIA 4J1MA 4NP5A 2EYOA 2KQ3A 1EY4A 3D8GA 3OMCA 3V2TA 2EY6A 5HGTA 5E1FA 5IGBA 2SNMA 2F0OA 2OXPA 1A3UA 1EYCA 2F0NA 4I65A 3SR1A 2F0JA 5EKKA 1F2ZA 1SNDA 2F0EA 2EY1A 4H7BA 4IZ8A 4PMBA 4TRDA 4IUNA 5DAUA 3MXPA 1EY9A 2F3VA 3R3OA 4IALA 2F0LA 5C6AA 3OSOA 4B9WA 5DEHA 1F2MA 1STAA 3NQTA 4KD4A 3SK4A 3VA5A 1KDCA 1EYAA 1A3VA 1A3TA 2PW5A 3EJIA 3QOJA 4K5VA 4QF4A 1SYBA 2EYFA 2EXZA 5C5LA 3TP5A 5JOBA 5KEEA 3TP6A 3D6CA 5CV8A 4EQNA 1SNCA 2F0DA 5EGTA 3EVQA 1SYCA 5J22A 3ERQA 2F0UA 3HEJA 2EYLA 2EYHA 4K5XA 5CV9A 4KTAA 5IODA 2F0KA 1TQOA 1EY7A 5IIFA 4K14A 5E3FA 5C4ZA 1JOKA 3SXHA 5NUCA 4DU9A 4E6IA 5ISRA 5CV5A 3S9WA 3DHQA 1JORA 2QDBA 4KJNA 4R8NA 5J1ZA 2RBMA 1AEXA 3MVVA 5IGFA 1KDBA 1STGA 2F0SA 1II3A 2F3WA 3LX0A 4WRDA 5HURA 5M9OA 4N9TA 2RDFA 3P1HA 4K2KA 5CGKA 3TP8A 1IHZA 4WORA 2F0PA 4K6DA 4ZUJA 2PZWA 4NMZA 5EKLA 2SNSA 5CV4A 4NDXA 5I6WA 4EVOA 3T16A 2PW7A 4F7XA 4K2LA 4OL7A 4QB4A 5J39A 2EYMA 2OF1A 4K5WA 3NUCA 4DF7A 1KABA 3EROA 4S3SA 4EQPA 5KGUA 1STBA 5KIXA 5CR3A 5IGEA 2F0HA 4HMJA 1U9RA 4J6HA 2PYKA 5IGCA 1KAAA 2M00A 3OWFA 1NSNS
chains in the Genus database with same CATH superfamily
1TR5A 5FKAC 2I5LX 4GN4B 2RKSA 2A68D 2A1AA 3J81i 2E2JB 3NXWA 3I70A 1FNWA 1A62A 4JBJA 4JI4Q 2XWJB 3SHLA 3E0JA 2ENBA 5D3DA 5EBCA 2WAQB 2EJMA 3KF8B 3TRZA 1WTOA 1BBWA 1U0LA 4CJ1B 4FF1A 4LF4Q 4KMUC 2NVYB 1PH8A 3HOUH 1A2UA 4ABNA 2N3SA 2NWGA 3J7ZC 3U4VA 3S1MB 1QNUA 2R7DA 4CDCC 1WD1A 2RSNA 3H91A 2JA6B 3TP7A 4GOPA 5FO9B 4DK6C 5I2YA 3BYYB 1HTLD 3DM3A 4FF2A 1L0WA 2PPBC 1JE5A 1V1PB 4DNRB 1EWHA 2OWOA 1EZ6A 2IHFA 3I4OA 2F0MA 4FO2A 2BE5C 2JJQA 4F8MA 3S17B 1BUVT 2UUAL 2NVQB 1KRTA 3LNNA 4CDFC 1HHVA 1TS5A 4IFDH 2HCIA 4A3KH 5JEAG 1Z6HA 2B2WC 2LS01 4R1JA 3SK4A 3J7AF 3STBC 2QEJC 4B3RQ 1YHAA 4A3BG 3WOEA 1K8OA 2Z4IA 1XNRQ 3T51B 4HEDA 2KECA 3TZDA 3CC2A 1W6JA 3T53B 4IUQA 3GTMH 2BOSA 4JG2A 2XN9C 4WJ4A 2VZAA 4A93H 4UDUC 3M9BA 1JCKB 1PTOB 4XIGS 2PZWA 1U4PA 1W2BA 5T1IA 2JE6I 4EVOA 2EQSA 4QB4A 1N8RC 5D14A 2VB2X 4LFBQ 3D4RA 4JV5L 2RF4A 2F0HA 2NN6G 3AFQA 1TWFH 2PYKA 1KAAA 3I8ZA 4CDEC 2Q2UA 3PO2B 4LF5L 2A8VA 1IBKL 3UDXA 5CC4A 4V190 3BDOA 1LTGD 4RKLA 4X3TA 1K9MC 1X3EA 3T13A 2MHVA 3HGBA 1YHBA 2CH4A 3HOVG 2JA8G 1STHA 2B2WA 1Q8IA 4DV5L 4A3GB 1JB3A 4CKEA 2R92G 1QCBD 3K81C 1FVIA 1SROA 1IKLA 1GD7A 2I5HA 4RCOA 3PIP3 2Z1CA 4UHVA 2OQKA 2L0CA 4ZQ3A 5M5YH 3FPPA 1IKMA 1O7IA 3KK7A 5LMUQ 2YTVA 4ILWA 2NB0A 2IPKD 3ND8A 2HHHL 1A8VA 2WV6D 5A35A 3H3VH 3MEHA 1JWSD 1MSGA 3SK8A 3G6EA 5KNCA 1YJ9A 1VQ6A 1A63A 3HOZG 2C5CA 3OW2A 1L0YB 1AN8A 1KAWA 1Q7YC 1ILQA 3NBHB 2HD3A 2UU9Q 4QIWE 4ZUIA 3H15A 1Q1BA 3ZYYX 2K01A 4NP5A 3D8GA 4R4TA 1AW7A 3O13A 4RFBA 5IGBA 5C0XG 4RAUC 2EY1A 1UEAB 4HJ5A 1HJPA 4IUNA 2HIXA 1A0IA 1GUSA 1QILA 4YCUA 1MD2D 3SVMA 3A54A 5IP7G 3D31A 2YYZA 3K5LA 2H5XA 4OO1G 1E2ZA 4X3UA 2IWHA 1PRTD 1SNCA 3FKIH 2F1MA 2RCNA 1R9TH 1GHKA 3BG3A 5FLMG 4KN4C 3S1QB 1M8AA 1VCIA 3EQLC 2VW9A 1VQDA 2AQ2B 3DEOA 4OONA 4DV6L 4P75A 1JORA 1S5CD 4LF9Q 2UXBQ 3MVVA 4LF6L 2YTXA 1II3A 3F8TA 3LX0A 1CKNA 2YU9H 4BXXH 2KCMA 3P1HA 1FNUA 4K2KA 4FDBA 1ZXTA 3OYYA 1E24A 3KFUA 4JCVE 4NXNL 4JOIC 2K4KA 1STBA 4A3DB 5M3FG 2CHBD 1BQQT 2Q8TA 4RA8A 4GNXB 1RTOA 3CU7A 1JQYD 2QW7A 4DR1Q 2WINB 3X3NA 1YJNA 4YY3Q 1PH5A 1ONLA 2I5MX 1NUCA 1FR3A 3VR6A 2KHSA 1SNPA 2JA7H 5FLXL 5DM73 3G48A 2DN8A 1VQ4A 4DNTB 2D62A 4ZLTF 3RLFA 5BR8L 1GUOA 3NK9A 5GAEC 4YCWA 1IL8A 4DV0L 2A6EC 1S5ED 1WCMB 1C7YA 1F9SA 3BDLA 2X69A 1IYJB 3I4MH 2J0TD 4GZYC 2KOLA 1ESRA 5I9PA 2EYJA 5E4XA 1HZBA 3NTIA 4K8JA 4ME5A 3D3RA 2K5QA 4JOIA 1AE2A 5LL6S 1NE3A 3TEHB 1RKNA 3M7NA 3QG1A 3AQQA 1VQGA 1SE8A 3TMEA 3NENA 1T9HA 1X3GA 3AFPA 4DV4L 5EKIA 1PYBA 2Y0SG 2N8NA 4IFDJ 5IT9L 5EKKA 4PMBA 2K5HA 1EYGA 2ZXRA 3GTKH 4R8IA 1GUGA 2X6GA 4X66L 1Z47A 4BY1G 4B9WA 1BCPD 4R4IA 1I50B 1NMFA 1U4LA 3EN2A 1HTPA 1A3TA 1B8AA 3EJIA 3W1GA 3S15B 4NXML 3HOXH 1HNXL 1IW7D 1ZYRC 3E0EA 4RHRA 4A75A 2OTJA 3CC7A 4U673 1EY7A 2Z8LA 2H4OA 3HOYG 1CA6A 1PRTB 4KJNA 2YV5A 4F88A 3BVMA 3CCRA 1AEXA 5IGFA 1PH7A 4WRDA 1I94Q 3PUVA 1JB7A 1TWCH 2DY7A 4C3IB 3GTQH 2PMZB 3ONAB 1F77A 3BYTB 4YWMA 3PIOA 5IWAQ 4UP9A 2WB1G 3HG9A 4DR6Q 1VQ8A 3DWQA 5C44B 1K83B 3JAME 1BNZA 3CCMA 4DR3L 3K5MA 2HCCA 3NQIA 3A5UA 2LFNA 4DR5L 4DV3L 4K8IA 3MEFA 2Q2HA 2R6GA 4HTHA 4CKBA 2KHJA 2WAQG 1SNOA 5BN3A 4KJOA 3I56A 1SN8A 1K0SA 1T5XD 3OIPA 3DM1A 4A3KG 3CQZB 2RHSB 1TKWB 1QUQB 4DUYL 1DZ1A 2Z9HA 2EIFA 2ALYB 3A7AB 3H94A 5LMNQ 1QJOA 3CCUA 5JEAH 3M3YB 1KNEA 3H6MA 1DXMA 1LT4D 4GN5A 1SRUA 5IYDG 4HCSA 4JC0A 1VQBA 3UE1A 4DGZA 1HFGA 4X62Q 4A3BH 2B8FA 1WFQA 2I0QA 3K8AA 1U5KA 4JI5Q 2QEXA 5IT9c 5G3LF 1EYDA 1ENAA 4GN3B 4DV2L 3H09A 4CKCA 3K59A 1DOMA 3J81c 1XMQQ 3VR3A 4H02A 3KJPA 4XT3B 3PUZA 3CPFA 4XQJA 1N36Q 1F2ZA 1TWAH 2OT2A 3F2BA 1HUMA 3SEBA 1I6VC 3OSOA 3OTOL 2R3ZA 1EYAA 4NW2A 1VF7A 2NN6H 2KCTA 3LGJA 3GTLB 1LO5D 5J22A 1BCPB 1PV4A 4DK0A 2JYOA 2OCEA 3H3VC 2E5LQ 4FVMA 4AYBG 4LUOA 3I3CA 1U4RA 3E9IA 1YIJA 2R92H 4ZAIA 1U4MA 2K52A 4N9TA 3I4NB 4LUVA 1KIXA 3AYHB 3J80L 2V1CC 4ZUJA 4A3LG 1P8LA 1PHJA 3K7UC 2E2IB 2NZOA 2OQ0A 2M9VA 4I7AA 4DK3C 4N8X1 4DF7A 1H95A 2R7ZB 1OO9B 2B3GA 2ZJQA 4DV1Q 3PO2G 5M5WB 3FRPB 2XTIA 1YITA 3BZCA 3A8KE 2A6HD 1HNWQ 1D1IA 4LFAL 3U9SA 1CKNB 4JI6L 3T1YQ 1R4PB 2IL8A 3HP3A 5CORA 4JYAQ 4ID6A 1K8AC 1UE6A 2O5JC 1Q86C 3HOZH 3KBGA 3PIO3 5M3MB 1S40A 3UI2A 1MBYA 1SJHD 2EPBA 4EQOA 4DV7Q 5C0XH 1PZJD 1AFPA 4ZKBB 1GOZA 1X6OA 1D5MC 4JPBW 2VQFL 5IP7H 5I6YA 1VQEA 4G7HC 2VY3A 3R2TA 4R4CA 3ITPA 4B3TL 1G2SA 4OO1H 1DGSA 2CH4W 4IFDI 4LF7Q 1E2VA 1I6HB 3GDEA 5IYBG 3UDGA 3A7LA 2BDOA 5FLMH 2NTSA 4K0KL 4JI0Q 4KLKA 4BXXG 3I91A 5ELNA 1G6ZA 3J7YW 1SMXA 4DUZL 1VS0A 3BDCA 4JBKA 1XMOQ 2JQOA 3R93A 1H9SB 3DLLA 3H0GB 5HGQA 1YJWA 2PI2E 1EY4A 1ET6A 1E0BA 3S1RB 1UWVA 1VMPA 2ID0A 2Q2TA 3BZKA 1SE4A 1NAPA 1NBWA 2IX0A 5DEHA 1HR0L 3UE0A 1SMYC 3K7AH 1A3VA 3FMCA 2K5WA 2PW5A 1O7LA 1N34Q 2VB3X 2LSSA 5C4JH 5M3FH 5EGTA 2E8GA 3S14H 3HEJA 1Y1WB 3J80c 2RVLA 1VQNA 2F4VL 2YTYA 1FJGQ 1LTTD 4YCVA 3Q23A 1JOKA 1HNZL 1FL0A 3S9WA 3CCLA 2B8GA 3VYSA 4KI0A 3OWEB 3Q22A 1PA6A 2UXDQ 4HN7A 3RMHA 2RDFA 2I07B 4J8QA 3TREA 1ML0D 2R93B 2Q8RE 4HR7B 4PG3A 1BF4A 1B7YB 2PNHA 4RH6A 1H9JA 2NVTH 3U58A 5C4XB 4A3DG 3A56A 3PF5A 1D5XC 1F9PA 1BO0A 4LJZC 4A3JB 1D7QA 1J5EL 4DAYA 3HS0C 1CZGA 1ICFB 4HMIA 1UAPA 1M90C 2QILA 5I9OA 1ENFA 4IQZA 4PZ6A 2E2HB 2AKWB 1NY4A 1MIUA 4A3CG 3Q0AA 2B29A 3F2UA 2WIIB 1DCZA 5K5PA 4FF3A 3JAMi 3QWNA 3L3OC 3A8JE 2QA4A 3HOXG 2CKZB 1S5DD 3SDZA 2EDGA 5JEAJ 1RCVD 4BY1H 1T5EA 1CI3M 4A3IB 4DR2Q 2N78A 2PQAA 3DUZA 3HOUB 4O42A 4I7ZC 4PV1C 1MGSA 4QY7A 2CCZA 2XWBB 2F0WA 2A69D 1PDQA 5C3EG 3AEVA 4DPGA 3GO5A 5CMDA 3HOYH 5EPLA 4DXFA 5M9OA 3GV6A 1B3QA 1JJGA 1YNJD 2KBNA 2JA5B 2LY7A 1R4QB 2MGSA 2MO1A 4LW1A 4BBRH 2K7VA 4JBMA 1SNDA 2MUYA 1JWMD 1D5ZC 4LF8L 4GKKQ 2AUJD 3M4QA 1KDCA 1SXTA 2EJFC 5AJ3Q 1RHPA 4YWLA 4QIWB 3AB9A 4C3HB 3D6CA 2K33A 3J81j 2F0DA 3EVQA 1SYCA 5E7NA 1JC7A 2E2JH 3RN5A 3IAYA 3S2DH 1B53A 4BA2I 2B2UC 4K14A 4QCLA 4DU9A 5NUCA 3T1HL 5FJ8G 5ISRA 3M4OH 2WFWA 1BBUA 1TS4A 5A2QE 2NZHA 1PFBA 4HSPA 3KLWA 4C3IG 3W1BA 5CGKA 2XGTA 4DK1A 2NVYH 1FNVA 2VXWA 4DR5Q 4YHHQ 3GTPB 1MI2A 1WOCA 2RQXA 3GTMB 2ATWA 1IBLQ 1X3FA 4IUPA 4A93B 2WKDA 1PMRA 5C44G 1Z7TA 2MQHA 2SEBD 1KABA 3HKZE 2L12A 4UP8A 1KD1C 5IYDH 1HQMC 1QNKA 3PUXA 3PUWA 4DR7L 4X64L 3C3LA 5ELOA 1N33Q 4KKUA 1PFMA 1E22A 1H9MA 1CQVA 3FEWX 2AWNA 2Y0SE 3P75A 3S17H 2ES2A 1SAPA 1OXUA 2CW0D 1BXTA 1H9KA 3M4PA 2DUDA 5C0XJ 2B2UA 4GLXA 1VQ9A 3VR4A 4PNYA 5GAHC 4B3SQ 3PO3G 5LMNW 1HZAA 5M5YB 1QZGA 2F03A 1X55A 4JI8Q 1JMCA 2J7ZA 3MFYA 4HJAA 1QG7A 2GVAA 4MNOA 5LHY1 4A3MB 1PZKD 1VDZA 3S2HH 2QDLA 4ME3A 4ZKCB 2RCFA 1EY6A 2CQAA 3VDYA 1L1OB 3C1EA 4G7ZC 4DFAA 3BJUA 1C0AA 2AHOB 1PTOH 2PI2A 5GROA 3BZDB 4A3LH 3K5OA 2F0JA 2VQEQ 1IBMQ 5DAUA 4KHZA 4OX9L 3R3OA 3ULPA 1I4QA 1MHWC 2DGYA 1BVSA 2HIVA 5KEEA 1WTRA 2VS1A 3CCEA 3PO2H 2VNUD 5CV8A 2XVSA 2ZM6Q 4POGA 1F2LA 4HIMA 2AMCB 4RWSC 3F2CA 3KF6B 1QE6A 2F0KA 5GAGC 1XNQQ 4B08A 1X56A 5C4ZA 3KLSA 1VQHA 4R8NA 1HZ9A 1YNND 2QGQA 5IYCH 3MA2B 1EOVA 1R9TB 3I4NG 3I55A 1PH1A 2F0PA 5JPMC 3U50C 3CCSA 2ZXPA 1M1KC 3CC4A 2YU9B 3J7AV 1LT5D 4B3MQ 2R7ZG 4DR4L 3OHXC 4IPHA 3PUYA 4K5WA 2ZTCA 3MFGA 4LFCQ 3K0YA 4RGMA 4JI7Q 1E1TA 2M00A 2HDLA 1DONA 1K73C 5IYBH 1I4XA 3X3MA 4RHSA 5M3MG 4RCNA 1VQPA 3TS0A 3S16H 3P7JA 2K5NA 3MHBA 1TWHH 3U9OA 1X9NA 4UAIA 3MXNA 2LMCB 3C46A 1SBBB 5BN5A 2BH2A 3GTJH 4G7OC 1G291 4ODGA 1A15A 4L5QA 2LXJA 1LTLA 2HQEA 4PMCA 5IGGA 1EFWA 3ULJA 1XPUA 1N32Q 4TQUS 2FFKB 4AH6A 4GKJL 4JW0A 4JI1Q 3K0XA 2BE5D 2KEDA 4AQYL 1EQVA 1EEID 2KENA 1W6KA 4AYBE 1HRJA 3S1QH 4KD3A 3SK6A 1XYIA 4MIUA 2G5DA 2N88A 4OWWB 1Y1VG 1F2YA 2VUMB 3P20A 3DXJC 2UUCL 1WTQA 1CKMA 1K0RA 3VYTA 4B9XA 3STBD 4XXEA 3FHWA 2XNAC 4X3SA 3KDFA 1TVXA 1RTNA 2SNMA 2K75A 2Z6KC 1WTWA 2UUBQ 2DJGC 4ZCKA 1D6EC 2KUMA 1YBYA 2C35B 3JC66 4IJHA 3RZOB 1PTOF 1V1QA 3BU2A 3GTGB 4A3DH 1SE2A 4Q5VA 1SYBA 4IOAA 2B2YC 1TXYA 3PV0A 4JI3L 4C56C 4X65L 2HDMA 1SJED 4HIKA 2FJ2A 4KHPL 3KUPA 3D6WA 5IODA 2TSSA 1KL9A 2L9HA 1PH3A 2UXCL 1V1OA 3QJYA 5K36G 4QUFA 2XIWA 1J9OA 4GOPB 1MSHA 1K3BC 1PH9A 3KBXA 4HAEA 3CD6A 1C9OA 4A3CH 2F52A 3F1ZA 3W3AA 1E1OA 1Q82C 1YI2A 1I4PA 5E4WC 4JI2Q 4LWCA 2IT1A 3J81L 3TSSA 2MO0A 5C4XG 3D0FA 3NE5B 1CHPD 1JJCB 4IN3A 5D65A 1O7ZA 2OF1A 3RZDB 1EQRA 3G4SA 1JWUD 1V8QA 2K03A 4A3JG 1BDOA 5JJZA 4JI4L 1Y8PB 1G6PA 3PSIA 5C0XI 4IJLA 4EGVA 2Z6KA 3I2ZA 1N9WA 4LAAA 3A8IE 4BBSB 4C3JG 1YVCA 1RD9D 5FLXE 5C3EH 1TY0A 4LF4L 2PQEA 4OO1I 1B1ZA 2KVMA 1LABA 4BBRG 1BR9A 3S24A 2B2YA 4C2MB 2OTLA 1B2TA 3V05A 2B39A 1SSOA 4PZ8A 1EY5A 2KJXA 1PH2A 2F0IA 1SYFA 1SFOB 1KDAA 2F0VA 5C5MA 4IPCA 1S5BD 4POFA 4A3IG 1I50H 4RGOS 4FXGC 4OWTB 5CBEE 2R61A 2A74C 1C48A 1LM0A 3G71A 3TBIB 1CSPA 1EZ8A 1B44D 1YEZA 1ICWA 1UE1A 1WTHA 3I4LA 5C3XA 1STNA 3S1NB 2GA4B 1B4OA 2EY5A 1CKOA 3FDTA 1YHQA 4BY7B 2P5ZX 4XYQA 4HIDA 5FJ8H 4ZK9B 4RKBA 2JA5G 5C3WA 5M5XB 5IT9E 1HQRD 3EFXD 3NSWA 3D4WA 3IKJA 5KYIA 4C3IH 1NJIC 3G7LA 5E1FA 2JA6G 3CAMA 1TWGB 1VQCA 3ICEA 4B3RL 4A3EB 4FF4A 4DKAC 2CQOA 1EY9A 2UUAQ 2KHIA 3T4AC 1XNRL 2CFMA 5C44H 1K83H 4KD4A 3VA5A 4C3HG 2FMCA 4UPAA 4K5VA 3TP5A 4R4OA 2B63B 3ZJYC 1S3OA 4K5XA 1AP0A 5E3FA 4OEMB 3VYUA 2K28A 1Z9FA 5T1GA 3MTSA 1EWCA 3CQZH 2DNCA 2E76C 3CHBD 4WORA 3TP8A 4LFBL 5EQ0A 3HOVB 2JA8B 4ULLA 3AMUA 4NDXA 1PTOC 2PW7A 1WYDA 3M3YH 2L4NA 3A74A 1V1PA 1OXVA 3PO3H 2VL6A 1AZQA 5KIXA 1XTDA 1LLRD 1HH2P 5ELDA 1UEBA 1F9RA 2TMPA 3MC0B 1YNXA 5IGDA 2IX1A 2ASBA 2Z0SA 4JV5Q 1Y8OB 3NHHA 3M7GA 4UP7A 2A6ED 4LF5Q 1IBKQ 4LUZA 1GUWA 4ZYSA 1NTGA 5KYLA 1DOLA 3Q8DA 5LMUL 1WTXA 3HOZB 2A68C 2JK8A 1PYSB 4DV5Q 1B3AA 1NR4A 1GJXA 3K57A 1LUZA 3R8BA 5CYUA 3PF4A 4A3GG 1Q1EA 1VQFA 3DMUA 4A3MG 2UU9L 1EU3A 5IYCG 1PVOA 2MJ8A 1G51A 4K6LA 2HHHQ 1ASYA 2L15A 4CBVA 2PMZE 5IP9G 2WACA 1STYA 5ELEA 3I4NH 3OMGA 1Q90A 3NTKA 2EYOA 3V2TA 3HFZB 3GP7A 3KYHC 4IO9A 4I65A 1A3UA 5JVH3 2E2IH 1ZYRD 4UY8C 4A3FB 1XXGA 2F0EA 5H1SE 1PH4A 2XRQD 1EL0A 5JJLA 2R7ZH 1Q46A 2BCOA 2EJGC 2L1BA 1XTCD 3BVZA 5M5WH 4LK1C 4MN3A 4EQNA 2GN5A 1IL2A 2NVXB 4LF9L 2UXBL 2F0UA 4RGNA 3C2PA 3CMAA 2I46A 5M3MH 3J80E 1RL2A 1XPRA 4XTCS 3CF5A 3RLOA 1DM0B 1IYVA 2F3WA 5CBAE 4MTNA 5AFWA 4R9WA 1I3QH 4K6DA 1K8MA 4C1NI 1TS3A 4DV6Q 2EVBA 3RN2A 4LF6Q 4O0AA 2EZVA 2WKCA 4HCEA 4Z9CB 5HY6A 1JT8A 1QZHA 2K6AA 4KN7C 3NBHA 5ELCA 5CR3A 3EA6A 4DR1L 2NYZD 2ZTDA 4J6HA 4NXNQ 1I6HH 4L5TA 3VYRA 1GUTA 3SXHA 4YY3L 1CA5A 3B6YA 3L7ZC 4R4QA 4H13C 1J8IA 2NUCA 4CDDC 3QO2A 3PMFA 1JE4A 3GQBA 1UNSA 4GNXC 1STEA 2O5IC 3NWTA 1Y1VH 1L0XB 4QGUA 4GS3A 3DEPA 3HKZB 2NBFA 2F0QA 1LTRD 1QVCA 1EU4A 3S1RH 1RF2D 4QJFA 2RDHA 1E7ZA 2IY5B 2L55A 3I72A 4V0BA 3HOWB 2AQ3B 2FINB 2PO4A 1O80A 1GKHA 4GLVB 2Y0SB 3WDNA 3ER0A 3GTOH 1I4RA 5BR8Q 1LTBD 1SE3A 4DNIA 2AWOA 3F2DA 3K6OA 4DV0Q 1GVPA 1KNAA 3H3VI 5K36H 4HSVA 5FO8B 2VUMG 1SEBD 3C1FA 3TS2A 1VQAA 2F0TA 1BCPF 2KCNA 2NZ1D 4TSSA 3MZ5A 1HR0W 1WCMG 4NPSA 3EBEA 5JVG3 1QVGA 4H7BA 3EIVA 1PFNA 1WI5A 1IZ6A 3E3XA 3BVGA 4XQQA 5C4XH 4GNXA 4FP5D 1LT3D 4L5SA 4RMFA 4DV4Q 4A3JH 1EQQA 5FO7B 4X66Q 4Y7NH 2L11A 1I94L 1K28A 1TQOA 2E2HH 4P72A 4PZ7A 4C3JH 4NXMQ 2ICEC 2QDBA 3CXCA 1HNXQ 1F9QA 5IWAL 3S2DB 4IUVA 1Y69U 1ASZA 1PRTC 1RODA 1LV9A 1IYUA 3M4OB 4DR6L 4NMZA 1W3SA 2E75C 4DA2A 1B9MA 4OL7A 3NBIA 4A3KB 2ZJRA 1S5FD 4A3IH 4CGYB 2BDNA 5IGEA 3OWFA 4BBSG 1EUJA 1KTKA 1OXSC 2EOTA 1CUKA 1KHIA 1Q8KA 2K32A 3E9HA 4DR3Q 3KLRA 5KRUA 1ENCA 1QWYA 2DY8A 2D0PA 1NCVA 2JA5H 1SNQA 3BS1A 4DV3Q 5LMNL 1HPCA 3UDIA 2JA9A 4WJ3M 1GHJA 1UUPA 3S1MH 1TIID 2PZUA 1V43A 2IW3A 3QB3A 3UDFA 1X32A 2ZTEA 1TY2A 2JA6H 2G9DA 2JSOA 4X62L 4AIMA 5BN4A 1M4VA 1EOTA 3NP8A 1CFMA 3KOJA 4DUYQ 1SDFA 4KY6A 4JI5L 4C3HH 1LTID 4QL5A 1KLGD 1MKHA 2FXQA 4OHJA 1TWFB 4DAVA 3J7A5 4JVZA 4BY7G 2PCFB 1XMQL 2NVQH 2N49A 4OELB 3IL8A 1OTCA 1N36L 3S2HB 4YIJA 1SMYD 4JK1C 3KLSX 1HUNA 4P74A 2KQ3A 3GTPH 4A3EG 2MFIA 4AYBB 1GXDC 4DV2Q 5G3LD 2DJFC 4KKTA 4IALA 3WOFA 1Q81C 1F2MA 3NQTA 5JJKA 4DAPA 1VQJA 4QF4A 1JJ2A 5KNBA 2E5LL 2B63G 2C9OA 4OGQC 2A19A 2K50A 4L6TB 3TQYA 3DWPA 2K1BA 3ERQA 2EYHA 2A5HA 1QUQA 3OTOQ 5EJWA 5GQOA 4L63B 5IIFA 1C4QA 2DNEA 2J4XA 5EBDA 5ELBA 1BCPC 2WB1E 3QIAA 2X6LA 5J1ZA 4BA1I 3NWSA 3MXGA 5JJIA 3MWYW 2BA1A 1IW7C 1DOKA 4DV1L 5EKLA 5CV4A 1VQKA 3CCJA 4F7XA 1NR2A 1HNWL 1DYQA 3G6JB 3T1YL 5LL6X 4FXKC 4YWKA 4JYAL 2WAQE 4EQPA 2ZT9C 1X65A 1LTAD 3SGIA 4HMJA 1RDPD 2F4IA 4A3GH 2Q2IA 3J80i 1X3QA 4FYDA 1D8LA 2K14A 4A3MH 3FKIB 4PMWA 1PFSA 3ULLA 2ZXOA 3KJOA 4MZ9A 1BOSA 5CV6A 4A76A 4J15A 4LFAQ 1A2TA 3FP9A 2JEAI 4JI6Q 5IP9H 4DV7L 3NTHA 5COYA 1ZKOA 1IXRA 1BBXC 3S16B 2RHQB 4L8JA 4QQBX 1CHQD 4TVAB 2GVBA 4XQNA 1TWHB 4LF7L 1PLFA 3I7FA 4KHVA 3GTJB 2WP8J 4Q0FA 3SK5A 4JI0L 3K58A 1VMCA 1LT6D 1GO3E 1CM9A 2HT1A 2E2DC 3E5SA 1XMOL 2VQFQ 5IOCA 3A5ZB 4B3TQ 4XYOA 3W5OA 1SR3A 4QMGA 1XPOA 5J3BA 4DAYB 1H9RA 1SYDA 4K0KQ 2JA7B 4L5RC 4A3FG 4DUZQ 2F0NA 1N34L 2JN4A 2XRSD 5EAYA 3SR1A 1TU2B 4APVA 4IZ8A 3MXPA 4LNQA 3QR8A 5C6AA 1Q12A 2KCCA 3TN2A 1Q3LA 2G9HD 1FJGL 5JOBA 4BWGB 1MJEA 3I4MB 2NN6I 1HR0Q 2UXDL 3H0GG 1PH6A 1PYWD 4C1NK 4F87A 1WTVA 5DNFA 2PQAB 2V4DA 2RBMA 1CSQA 4OWXB 2QCPX 1B70B 4CJ0B 2F4VQ 3RLNA 1HNZQ 1C8CA 5KNDA 3L0OA 1FD7D 1KLUD 1UE7A 3T16A 3VR5A 3GTKB 1Y1WG 1XX8A 4IPGA 5KGUA 1EQTA 3FVQA 1U9RA 5IGCA 3HOXB 3NEMA 1H9SA 3N52A 4RGTA 1HCZA 4U68A 3JAML 4G4KA 5IE8A 4Y52H 1VQ7A 4ZRZA 2MP1A 2R93G 2VUMH 1EIGA 1PXUA 3HKZG 1J5EQ 4MTKA 3LWUA 3IFTA 3CMEA 4HIOA 3SE0A 2A6HC 2OEOA 1SLJA 1AE3A 1YZ6A 5C3EB 1WCMH 1LTSD 3RD4A 4LMQD 4DR2L 1TWCB 1BKBA 1O7YA 3GTQB 3HOWG 3U4ZA 3WWVA 3RZOH 3GTGH 2LKVA 1X54A 1XJVA 3VR2A 2R7FA 1EIHA 2QF7A 3CKIB 1UE5A 1MJCA 3RNUA 1ILPA 3V96A 1JOOA 4H44C 1HZCA 1VQLA 1VQIA 1LACA 2K04A 2RA4A 3QOLA 3TDQA 2ICIA 1G91A 1JICA 3Q24A 4GKKL 4DXGA 4P71A 3HOUG 5AJ3L 2F0OA 3S15H 1NNXA 2BA0A 2B2TC 3VA7A 1KQSA 1TS2A 3RZDH 4CHTB 1D2BA 5FOBB 1I4HA 1OXXK 1S4ZA 2RSOA 2EXZA 4DN4M 4WFN3 5DM63 3TP6A 1AH9A 2CVRA 4BBSH 4LF8Q 4MHEA 2K5VA 3CCVA 2EYLA 3CW2C 4A3BB 3K5NA 4OIJA 4E6IA 3I90A 5CV5A 5FLXc 4YHHL 3DHQA 1WD0A 4BS9A 4C2MH 2D5DA 1IBLL 3M85A 3J81E 3CRKC 4O1NA 3OIQA 5L37A 1IHZA 5ELFA 3T1HQ 3HRZC 1SFOH 3RR5A 1G8ZD 4IFDG 2K5DA 3MXUA 2SNSA 5I6WA 1VF5C 2AQ1B 2CWAA 4H0LC 3JAMc 2L5TA 1TWAB 1N33L 1PZID 3EROA 3KF8A 1FGUA 2KA7A 3S1NH 1NSNS 4X3KA 5D3IB 1EIYB 1CZWA 3PO3B 2B2TA 1QB5D 4BY7H 3IFDA 4G57A 3CPWA 2IX3A 1QOHA 1B9NA 5EPKA 1I5FA 3TZUA 4TKOB 5M5XH 4DR7Q 4X64Q 2EE1A 3CRLC 3E6ZX 4IUUA 4ALPA 4FXDA 2JXMB 2QKIC 3LWEA 1VQOA 3R2IA 4A93G 2R92B 3ERSX 3DWAA 2IJ0A 4B3SL 2SDFA 4X6AH 1HA6A 1TWGH 4KY5A 4NKLA 4A3EH 5JPNC 2F0FA 4JI8L 3MAQA 2JP1A 4EQ5A 1A6XA 4M8AA 1I4GA 2IHEA 4KY7A 5I2XA 1OXTA 2MNAA 4P2CB 2EYPA 4HJ7A 1V9PA 3L2PA 1D1KA 2B63H 3FPUB 2O4XA 1JR0D 2EXDA 3Q6SA 3AU7A 4KKSA 1LYLA 3D4DA 1CK1A 2M2LA 1JOQA 4HJ9A 4M1UB 1P16A 3HZXA 2E74C 2KEEA 1XWEA 1EY8A 2VQEL 2PNRC 5CV7A 2A73B 1IBML 1L1OC 2N55A 1EFID 1WJJA 1CQFA 1EIFA 3HOVH 2JA8H 3IRBA 2HQLA 2K05A 3A55A 2A69C 3N6RA 2RDGA 2ZM6L 1ET9A 1HA5A 3GTLH 2F3VA 1E3PA 1STAA 3MXNB 1YNJC 1XNQL 2O2LD 3QOJA 4FNFA 2Z4HA 4O2DA 4OX9Q 1WVLA 2XSCA 5CV9A 4KTAA 2FHTA 2D2CC 3PQIA 1DD2A 2HUGA 5FK9C 1CT1D 1PRTF 1S72A 1KDBA 1STGA 5HURA 1FYCA 4B3ML 4A4IA 4LFCL 1GM5A 1Y8NB 4JI7L 2ZJPA 4K2LA 2Z6BA 1ESFA 4QUCA 5DLQE 1I3QB 5J39A 1L1OA 3T56B 3CCQA 1Y14B 3K7AB 3KDFB 4KK7A 3FKIG 1L2FA 5C4JB 5M3FB 1VQ5A 4EX5A 3A0JA 3PCOB 4DR4Q 2PZTA 1KXLA 4PQXA 3OW7A 3ND9A 3S14B 1B50A 1GUNA 1AZPA 2D9UA 2F3IA 1SNMA 1KC8C 3OOCA 1CTMA 1N32L 1K8GA 5TSSA 2BH8A 5F2DA 3PGZA 1HFNA 4JI1L 1TT2A 1Y1VB 4A3FH 4IOCA 3KF6A 5JAVA 4KV6A 1G2TA 2H1EA 5C4HA 2NVTB 2SOBA 3OPOA 4IPDA 4DAMA 2FMMA 1RJTA 2NVXH 3M4YA 1EY0A 3CP0A 4P73A 2CW0C 1HXYD 3W2DA 4GKJQ 4IURA 1SYEA 2LXKA 3GTOB 3H0GH 1SYGA 1DJRD 4AQYQ 3RUZA 2B2VC 1X3PA 2F0GA 3K80C 4JBWA 5C5LA 2UUBL 2EY2A 2Q8IB 2JA7G 4CJ2C 4N9PA 1FGBD 1E2WA 4J1MA 5HGTA 3OMCA 2EY6A 2JEBI 1K3RA 1EYCA 2OXPA 5IY0A 2UUCQ 4XT1B 4TRDA 1VQMA 2AUKA 3GV3A 2F0LA 1Y1WH 5EPJA 2MPMA 4BY1B 3I4MG 2EYFA 4OXPA 3NPPA 5I4DA 1KRSA 4IUTA 3HKSA 1PTOD 2CWPA 2NTTA 4JI3Q 2R93H 3I73A 5GADC 3GD7A 4X65Q 4JI2L 1J6QA 1QVFA 3HOYB 4OIKA 4Y7NB 4HJ8A 2F0SA 1ZEQX 4KHPQ 2UXCQ 4GOPC 4C3JB 1EWIA 1NMGA 1WTPA 4NB3A 4N8FA 3NELA 5A2QL 3URYA 1O78A 4WJWA 4BBRB 3HOWH 2B2VA 2EYMA 1YNNC 4XDXA 2WB1B 4S3SA 3PIPA 3L9AX 4GLAC 4RG1A 1EEFD 1RIPA 3NUCA 2D0OA
chains in the Genus database with same CATH topology
1TR5A 5FKAC 2RKSA 2A68D 2E2JB 3NXWA 3I70A 1FNWA 2XWJB 3SHLA 3E0JA 2ENBA 5D3DA 5EBCA 2WAQB 2EJMA 1WTOA 4CJ1B 4FF1A 4KMUC 2NVYB 1A2UA 4ABNA 2NWGA 3S1MB 1QNUA 1WD1A 2RSNA 3H91A 2JA6B 3TP7A 5FO9B 5I2YA 3BYYB 1HTLD 4FF2A 2PPBC 4DNRB 1V1PB 1EWHA 1EZ6A 2F0MA 4FO2A 2BE5C 4F8MA 3S17B 1BUVT 2NVQB 3LNNA 1HHVA 1TS5A 4IFDH 2HCIA 5JEAG 1Z6HA 2B2WC 2LS01 3SK4A 3J7AF 2QEJC 3WOEA 1K8OA 2Z4IA 3T51B 4HEDA 2KECA 3TZDA 1W6JA 3T53B 4IUQA 2BOSA 2XN9C 4UDUC 1JCKB 1PTOB 4XIGS 2PZWA 1U4PA 5T1IA 2JE6I 4EVOA 4QB4A 5D14A 2VB2X 3D4RA 2F0HA 2NN6G 2PYKA 1KAAA 3I8ZA 3PO2B 4V190 5CC4A 4X3TA 3BDOA 1LTGD 4RKLA 3T13A 2MHVA 3HGBA 4A3GB 1STHA 2B2WA 1Q8IA 1JB3A 4CKEA 1QCBD 1IKLA 4RCOA 3PIP3 2Z1CA 2L0CA 4ZQ3A 3FPPA 1IKMA 3KK7A 4ILWA 2NB0A 2IPKD 3ND8A 2WV6D 5A35A 3MEHA 1JWSD 1MSGA 3SK8A 5KNCA 2C5CA 1L0YB 1AN8A 1ILQA 4ZUIA 1Q1BA 3ZYYX 2K01A 4NP5A 3D8GA 1AW7A 3O13A 4RFBA 5IGBA 5C0XG 4RAUC 2EY1A 1UEAB 4IUNA 1GUSA 1QILA 1MD2D 3SVMA 3A54A 3D31A 2YYZA 3K5LA 4OO1G 1E2ZA 4X3UA 2IWHA 1PRTD 1SNCA 2F1MA 1GHKA 3BG3A 4KN4C 3S1QB 1M8AA 1VCIA 3EQLC 2AQ2B 3DEOA 1JORA 1S5CD 3MVVA 1II3A 3LX0A 3P1HA 1FNUA 4K2KA 1ZXTA 1STBA 4A3DB 2CHBD 1BQQT 2Q8TA 4RA8A 1RTOA 3CU7A 1JQYD 2WINB 3X3NA 1ONLA 1NUCA 1FR3A 3VR6A 2KHSA 1SNPA 5FLXL 5DM73 2DN8A 4DNTB 2D62A 4ZLTF 3RLFA 1GUOA 3NK9A 1IL8A 2A6EC 1S5ED 1WCMB 1F9SA 3BDLA 2X69A 2J0TD 4GZYC 2KOLA 1ESRA 5I9PA 2EYJA 5E4XA 3NTIA 4K8JA 4ME5A 3D3RA 2K5QA 5LL6S 1RKNA 3M7NA 3QG1A 3TMEA 5EKIA 4IFDJ 5IT9L 5EKKA 4PMBA 2ZXRA 4R8IA 1GUGA 2X6GA 1Z47A 4B9WA 1BCPD 1I50B 1U4LA 3S15B 1HTPA 1A3TA 3EJIA 1IW7D 1ZYRC 4RHRA 4U673 1EY7A 2Z8LA 2H4OA 1CA6A 1PRTB 4KJNA 4F88A 3BVMA 1AEXA 5IGFA 4WRDA 3PUVA 2DY7A 4C3IB 2PMZB 3ONAB 1F77A 3BYTB 3HG9A 3DWQA 5C44B 1K83B 3JAME 1BNZA 3K5MA 2HCCA 3NQIA 2LFNA 4K8IA 2R6GA 4HTHA 4CKBA 1SNOA 5BN3A 4KJOA 1T5XD 3OIPA 3DM1A 3CQZB 1TKWB 1DZ1A 3A7AB 3H94A 1QJOA 5JEAH 3M3YB 1KNEA 3H6MA 1DXMA 1LT4D 4HCSA 4DGZA 1HFGA 2B8FA 5G3LF 1EYDA 1ENAA 3H09A 4CKCA 3K59A 1DOMA 3VR3A 4XT3B 3PUZA 4XQJA 1F2ZA 2OT2A 1HUMA 3SEBA 1I6VC 3OSOA 2R3ZA 1EYAA 4NW2A 1VF7A 2NN6H 3GTLB 1LO5D 5J22A 1BCPB 4DK0A 2JYOA 3H3VC 4FVMA 3I3CA 1U4RA 4ZAIA 1U4MA 4N9TA 3I4NB 3J80L 4ZUJA 2E2IB 2M9VA 4DF7A 2R7ZB 1OO9B 5M5WB 3FRPB 3A8KE 2A6HD 1D1IA 3U9SA 1R4PB 2IL8A 3HP3A 5CORA 4ID6A 2O5JC 3KBGA 3PIO3 5M3MB 3UI2A 1MBYA 1SJHD 2EPBA 4EQOA 5C0XH 1PZJD 1AFPA 4ZKBB 1GOZA 1D5MC 5I6YA 4G7HC 3R2TA 3ITPA 1G2SA 4OO1H 4IFDI 1E2VA 1I6HB 3A7LA 2BDOA 2NTSA 3I91A 1G6ZA 3J7YW 3BDCA 3R93A 1H9SB 3H0GB 1EY4A 1ET6A 1E0BA 3S1RB 1VMPA 2ID0A 1SE4A 1NAPA 2IX0A 5DEHA 1SMYC 1A3VA 3FMCA 2K5WA 2PW5A 1O7LA 2VB3X 5EGTA 3HEJA 1Y1WB 2RVLA 1LTTD 3Q23A 1JOKA 3S9WA 2B8GA 3VYSA 4KI0A 3OWEB 3Q22A 4HN7A 3RMHA 2RDFA 2I07B 4J8QA 1ML0D 2R93B 2Q8RE 4HR7B 1BF4A 4RH6A 1H9JA 5C4XB 3A56A 1D5XC 1F9PA 1BO0A 4LJZC 4A3JB 4DAYA 3HS0C 1CZGA 4HMIA 1UAPA 2QILA 5I9OA 1ENFA 4IQZA 2E2HB 3Q0AA 3F2UA 2WIIB 1DCZA 5K5PA 4FF3A 3QWNA 3L3OC 3A8JE 1S5DD 3SDZA 2EDGA 5JEAJ 1RCVD 1T5EA 1CI3M 4A3IB 3DUZA 3HOUB 4O42A 4I7ZC 4PV1C 1MGSA 2XWBB 2F0WA 2A69D 1PDQA 3GO5A 5CMDA 5EPLA 4DXFA 5M9OA 3GV6A 1YNJD 2JA5B 2LY7A 1R4QB 2MGSA 2K7VA 1SNDA 2MUYA 1JWMD 1D5ZC 2AUJD 1KDCA 1SXTA 2EJFC 1RHPA 4QIWB 3AB9A 4C3HB 3D6CA 2K33A 2F0DA 3EVQA 1SYCA 3IAYA 1JC7A 1B53A 4BA2I 2B2UC 4K14A 4QCLA 4DU9A 5NUCA 5ISRA 1TS4A 5A2QE 1PFBA 4HSPA 4C3IG 5CGKA 4DK1A 1FNVA 2VXWA 3GTPB 1MI2A 2RQXA 3GTMB 4IUPA 4A93B 2WKDA 1PMRA 1Z7TA 2SEBD 1KABA 2L12A 1HQMC 1QNKA 3PUXA 3PUWA 3C3LA 4KKUA 1PFMA 1H9MA 1CQVA 3FEWX 2AWNA 3P75A 1SAPA 1OXUA 2CW0D 1BXTA 1H9KA 5C0XJ 2B2UA 3VR4A 4PNYA 5M5YB 2F03A 2J7ZA 3MFYA 1QG7A 5LHY1 4A3MB 1PZKD 1VDZA 4ZKCB 1EY6A 2CQAA 3C1EA 4G7ZC 4DFAA 1PTOH 3BZDB 3K5OA 2F0JA 5DAUA 4KHZA 3R3OA 1I4QA 5KEEA 1WTRA 2VNUD 5CV8A 2XVSA 1F2LA 4RWSC 1QE6A 2F0KA 4B08A 5C4ZA 3KLSA 4R8NA 1YNND 3MA2B 1R9TB 2F0PA 5JPMC 2ZXPA 2YU9B 3J7AV 1LT5D 3OHXC 3PUYA 4K5WA 3MFGA 3K0YA 4RGMA 2M00A 2HDLA 1DONA 1I4XA 3X3MA 4RHSA 4RCNA 3P7JA 3MHBA 3U9OA 4UAIA 3MXNA 2LMCB 3C46A 1SBBB 5BN5A 4G7OC 1G291 4ODGA 1A15A 2HQEA 4PMCA 5IGGA 4TQUS 2FFKB 2BE5D 2KEDA 1EQVA 1EEID 1W6KA 1HRJA 4KD3A 3SK6A 1XYIA 4MIUA 2N88A 1F2YA 2VUMB 3P20A 3DXJC 1WTQA 3VYTA 4B9XA 4XXEA 2XNAC 4X3SA 1TVXA 1RTNA 2SNMA 1WTWA 1D6EC 2KUMA 3RZOB 1PTOF 3GTGB 1SE2A 4Q5VA 1SYBA 2B2YC 3PV0A 4C56C 2HDMA 1SJED 2FJ2A 3KUPA 3D6WA 5IODA 2TSSA 2L9HA 5K36G 1V1OA 3QJYA 4QUFA 2XIWA 1J9OA 1MSHA 3KBXA 4HAEA 3W3AA 1I4PA 5E4WC 2IT1A 3J81L 3TSSA 3NE5B 1CHPD 4IN3A 5D65A 1O7ZA 2OF1A 3RZDB 1JWUD 1V8QA 2K03A 1BDOA 5JJZA 1Y8PB 5C0XI 4EGVA 4BBSB 4LAAA 3A8IE 4C3JG 1RD9D 5FLXE 1TY0A 2PQEA 4OO1I 1B1ZA 2KVMA 1LABA 1BR9A 2B2YA 4C2MB 1B2TA 3V05A 2B39A 1SSOA 1EY5A 2KJXA 2F0IA 1SYFA 1SFOB 1KDAA 2F0VA 5C5MA 1S5BD 4RGOS 4FXGC 5CBEE 2R61A 2A74C 1C48A 3TBIB 1EZ8A 1B44D 1ICWA 3I4LA 5C3XA 1STNA 3S1NB 2GA4B 1B4OA 2EY5A 3FDTA 4BY7B 4XYQA 4ZK9B 4RKBA 5C3WA 5M5XB 5IT9E 1HQRD 3EFXD 3NSWA 3D4WA 3IKJA 5KYIA 3G7LA 5E1FA 1TWGB 4A3EB 4FF4A 1EY9A 3T4AC 4KD4A 3VA5A 4C3HG 2FMCA 3TP5A 4K5VA 2B63B 4K5XA 1AP0A 5E3FA 3VYUA 2K28A 5T1GA 3MTSA 1EWCA 2DNCA 2E76C 3CHBD 4WORA 3TP8A 5EQ0A 3HOVB 2JA8B 4ULLA 3AMUA 4NDXA 1PTOC 2PW7A 2L4NA 1V1PA 1OXVA 1AZQA 5KIXA 1LLRD 5ELDA 1F9RA 2TMPA 3MC0B 5IGDA 2IX1A 1Y8OB 3NHHA 3M7GA 2A6ED 1GUWA 4ZYSA 5KYLA 1DOLA 1WTXA 3HOZB 2A68C 1B3AA 1NR4A 1GJXA 3K57A 3R8BA 5CYUA 1Q1EA 3DMUA 1EU3A 2MJ8A 4K6LA 4CBVA 2WACA 1STYA 5ELEA 3OMGA 1Q90A 3NTKA 2EYOA 3V2TA 3GP7A 4I65A 1A3UA 5JVH3 1ZYRD 4A3FB 1XXGA 2F0EA 2XRQD 1EL0A 2BCOA 2EJGC 2L1BA 1XTCD 3BVZA 4LK1C 4MN3A 4EQNA 2NVXB 2F0UA 4RGNA 3C2PA 2I46A 3J80E 4XTCS 1DM0B 1IYVA 2F3WA 5CBAE 5AFWA 4R9WA 4K6DA 1K8MA 4C1NI 1TS3A 2EVBA 2EZVA 2WKCA 4HCEA 4Z9CB 2K6AA 4KN7C 3NBHA 5ELCA 5CR3A 3EA6A 2NYZD 4J6HA 3VYRA 1GUTA 3SXHA 1CA5A 3L7ZC 4H13C 1J8IA 2NUCA 3QO2A 3PMFA 1JE4A 3GQBA 1UNSA 1STEA 2O5IC 3NWTA 1L0XB 3DEPA 3HKZB 2NBFA 2F0QA 1LTRD 1EU4A 1RF2D 2RDHA 2L55A 3I72A 4V0BA 3HOWB 2AQ3B 2FINB 2PO4A 1O80A 2Y0SB 3WDNA 1I4RA 1LTBD 1SE3A 2AWOA 3K6OA 1KNAA 5K36H 4HSVA 5FO8B 1SEBD 3C1FA 2F0TA 1BCPF 2KCNA 2NZ1D 4TSSA 3MZ5A 5JVG3 4H7BA 4XQQA 1PFNA 3BVGA 4FP5D 1LT3D 5FO7B 2L11A 1TQOA 2ICEC 2QDBA 1F9QA 3S2DB 4IUVA 1Y69U 1PRTC 1RODA 1LV9A 1IYUA 3M4OB 4NMZA 2E75C 4DA2A 1B9MA 4OL7A 3NBIA 4A3KB 1S5FD 4CGYB 2BDNA 5IGEA 3OWFA 1KTKA 1OXSC 2EOTA 2K32A 3KLRA 5KRUA 1ENCA 1QWYA 2DY8A 1NCVA 1SNQA 3BS1A 1HPCA 1GHJA 1UUPA 1TIID 2PZUA 1V43A 2IW3A 3QB3A 1X32A 1TY2A 2G9DA 2JSOA 5BN4A 1M4VA 1EOTA 3NP8A 1CFMA 1SDFA 4KY6A 1LTID 1KLGD 4OHJA 1TWFB 4DAVA 2PCFB 3IL8A 3S2HB 4YIJA 1SMYD 4JK1C 3KLSX 1HUNA 2KQ3A 4AYBB 1GXDC 5G3LD 4KKTA 4IALA 3WOFA 1F2MA 3NQTA 4DAPA 4QF4A 5KNBA 2C9OA 4OGQC 4L6TB 3DWPA 2K1BA 3ERQA 2EYHA 2A5HA 5EJWA 4L63B 5IIFA 1C4QA 2DNEA 2J4XA 5EBDA 5ELBA 1BCPC 3QIAA 2X6LA 5J1ZA 4BA1I 3NWSA 3MXGA 3MWYW 2BA1A 1IW7C 1DOKA 5EKLA 5CV4A 4F7XA 1NR2A 1DYQA 3G6JB 5LL6X 4FXKC 4EQPA 2ZT9C 1LTAD 4HMJA 1RDPD 2F4IA 4FYDA 1X3QA 3FKIB 4PMWA 2ZXOA 1BOSA 5CV6A 1A2TA 2JEAI 3NTHA 5COYA 1ZKOA 1BBXC 3S16B 4L8JA 1CHQD 4XQNA 1TWHB 1PLFA 4KHVA 3GTJB 2WP8J 4Q0FA 3SK5A 3K58A 1VMCA 1LT6D 1CM9A 2E2DC 3E5SA 5IOCA 4XYOA 4QMGA 1H9RA 1SYDA 2JA7B 2F0NA 2XRSD 3SR1A 1TU2B 4IZ8A 3MXPA 5C6AA 1Q12A 2KCCA 3TN2A 1Q3LA 2G9HD 5JOBA 4BWGB 3I4MB 2NN6I 1PYWD 4C1NK 4F87A 1WTVA 5DNFA 2V4DA 2RBMA 2QCPX 4CJ0B 1C8CA 5KNDA 1FD7D 1KLUD 3T16A 3VR5A 3GTKB 1XX8A 5KGUA 1EQTA 3FVQA 1U9RA 5IGCA 3HOXB 1H9SA 3N52A 4RGTA 1HCZA 4U68A 3JAML 4G4KA 4ZRZA 2MP1A 1EIGA 1PXUA 3LWUA 3IFTA 3SE0A 2A6HC 2OEOA 5C3EB 1LTSD 3RD4A 4LMQD 1TWCB 1O7YA 3GTQB 2LKVA 3VR2A 1EIHA 2QF7A 3CKIB 1ILPA 3V96A 1JOOA 4H44C 1LACA 2K04A 2RA4A 3QOLA 3TDQA 2ICIA 1G91A 1JICA 3Q24A 4DXGA 2F0OA 2BA0A 2B2TC 3VA7A 1TS2A 4CHTB 1D2BA 5FOBB 1I4HA 1OXXK 1S4ZA 4DN4M 2RSOA 2EXZA 4WFN3 5DM63 3TP6A 2CVRA 4MHEA 2EYLA 4A3BB 3K5NA 4OIJA 4E6IA 3I90A 5CV5A 3DHQA 1WD0A 4BS9A 2D5DA 3M85A 3J81E 3CRKC 4O1NA 3OIQA 1IHZA 5ELFA 3HRZC 4IFDG 1G8ZD 2K5DA 3MXUA 2SNSA 5I6WA 1VF5C 2AQ1B 4H0LC 2L5TA 1TWAB 1PZID 3EROA 3KF8A 2KA7A 1NSNS 4X3KA 5D3IB 1CZWA 3PO3B 2B2TA 1QB5D 3IFDA 4G57A 2IX3A 1QOHA 1B9NA 5EPKA 3TZUA 4TKOB 2EE1A 3CRLC 3E6ZX 4IUUA 4FXDA 2JXMB 2QKIC 3LWEA 3R2IA 2R92B 3DWAA 2IJ0A 2SDFA 1HA6A 4KY5A 4NKLA 5JPNC 2F0FA 3MAQA 2JP1A 1A6XA 4M8AA 1I4GA 4KY7A 5I2XA 1OXTA 4P2CB 2EYPA 1D1KA 3FPUB 2O4XA 1JR0D 3Q6SA 3AU7A 4KKSA 3D4DA 1CK1A 2M2LA 1JOQA 4M1UB 3HZXA 2E74C 2KEEA 1XWEA 1EY8A 2PNRC 5CV7A 2A73B 2N55A 1EFID 1CQFA 2K05A 3A55A 2A69C 3N6RA 2RDGA 1ET9A 1HA5A 2F3VA 1STAA 1YNJC 2O2LD 3QOJA 4FNFA 2Z4HA 1WVLA 2XSCA 5CV9A 4KTAA 2FHTA 2D2CC 1DD2A 2HUGA 5FK9C 1CT1D 1PRTF 1KDBA 1STGA 5HURA 1FYCA 1Y8NB 4K2LA 4QUCA 1ESFA 1I3QB 5J39A 3T56B 3K7AB 4KK7A 5C4JB 5M3FB 2PZTA 4PQXA 3OW7A 3ND9A 3S14B 1B50A 1GUNA 1AZPA 2D9UA 1SNMA 3OOCA 1CTMA 5TSSA 5F2DA 1HFNA 1TT2A 1Y1VB 5JAVA 4KV6A 1G2TA 2H1EA 5C4HA 2NVTB 2SOBA 3OPOA 2FMMA 1RJTA 3M4YA 1EY0A 2CW0C 1HXYD 3W2DA 4IURA 1SYEA 3GTOB 1SYGA 1DJRD 3RUZA 2B2VC 1X3PA 2F0GA 4JBWA 5C5LA 2EY2A 2Q8IB 4CJ2C 4N9PA 1FGBD 1E2WA 4J1MA 5HGTA 3OMCA 2EY6A 2JEBI 2OXPA 1EYCA 4XT1B 4TRDA 2AUKA 3GV3A 2F0LA 5EPJA 2MPMA 4BY1B 2EYFA 3NPPA 5I4DA 4IUTA 1PTOD 2NTTA 3I73A 3GD7A 3HOYB 4OIKA 4Y7NB 2F0SA 1ZEQX 4C3JB 1WTPA 5A2QL 3URYA 1O78A 4WJWA 4BBRB 2B2VA 2EYMA 1YNNC 4XDXA 2WB1B 4S3SA 3L9AX 1EEFD 3NUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CC4 A;  1TR5 A;  4HMI A;  2PZT A;  4RKL A;  2RKS A;  5IGD A;  2NUC A;  4K8I A;  4LAA A;  3T13 A;  5I9O A;  3PMF A;  3NXW A;  4ID6 A;  4G57 A;  1SNM A;  4HTH A;  5CV6 A;  3NHH A;  2PQE A;  1STH A;  3SHL A;  5KRU A;  1ENC A;  1SNO A;  1A2T A;  3P75 A;  4KJO A;  2ENB A;  1NUC A;  1SNQ A;  5KYL A;  2KHS A;  3MHB A;  5F2D A;  1SNP A;  2F0Q A;  3U9O A;  4EQO A;  5K5P A;  2OEO A;  1TT2 A;  2PZU A;  4ODG A;  1EY5 A;  4KY5 A;  2F0I A;  3QB3 A;  1SYF A;  2HQE A;  4NKL A;  4PMC A;  5IGG A;  4ZQ3 A;  1KDA A;  1A2U A;  2F0V A;  2F0F A;  5C5M A;  3NK9 A;  5JAV A;  2LKV A;  4KV6 A;  4PNY A;  4KHV A;  5C4H A;  3NP8 A;  4KY7 A;  2SOB A;  3H6M A;  3BDL A;  5I6Y A;  4KY6 A;  3SK5 A;  2EYP A;  3ITP A;  1EZ8 A;  3TP7 A;  4DGZ A;  1EQV A;  3DMU A;  1EY0 A;  5C3X A;  1STN A;  1JOO A;  2O4X A;  3MEH A;  1SYE A;  3E5S A;  4KD3 A;  5I9P A;  3SK6 A;  4MIU A;  2EYJ A;  2EY5 A;  3D4D A;  3SK8 A;  2F0W A;  5IOC A;  1JOQ A;  4K8J A;  4ME5 A;  1EY6 A;  1SYG A;  1EZ6 A;  3HZX A;  1EYD A;  1F2Y A;  3QOL A;  3C1E A;  2F0M A;  2F0G A;  3RUZ A;  1EY8 A;  1ENA A;  3C1F A;  4RKB A;  3BDC A;  2EY2 A;  1RKN A;  2F0T A;  2WAC A;  4QMG A;  5CV7 A;  1STY A;  4ZUI A;  4DFA A;  4F8M A;  4YIJ A;  5C3W A;  3OMG A;  4N9P A;  4B9X A;  3D4W A;  1SYD A;  3MZ5 A;  3TME A;  5KYI A;  4J1M A;  4NP5 A;  2EYO A;  2KQ3 A;  1EY4 A;  3D8G A;  3OMC A;  3V2T A;  2EY6 A;  5HGT A;  5E1F A;  5IGB A;  2SNM A;  2F0O A;  2OXP A;  1A3U A;  1EYC A;  2F0N A;  4I65 A;  3SR1 A;  2F0J A;  5EKK A;  1F2Z A;  1SND A;  2F0E A;  2EY1 A;  4H7B A;  4IZ8 A;  4PMB A;  4TRD A;  4IUN A;  5DAU A;  3MXP A;  1EY9 A;  2F3V A;  3R3O A;  4IAL A;  2F0L A;  5C6A A;  3OSO A;  4B9W A;  5DEH A;  1F2M A;  1STA A;  3NQT A;  4KD4 A;  3SK4 A;  3VA5 A;  1KDC A;  1EYA A;  1A3V A;  1A3T A;  2PW5 A;  3EJI A;  3QOJ A;  4K5V A;  4QF4 A;  1SYB A;  2EYF A;  2EXZ A;  5C5L A;  3TP5 A;  5JOB A;  5KEE A;  3TP6 A;  3D6C A;  5CV8 A;  4EQN A;  1SNC A;  2F0D A;  5EGT A;  3EVQ A;  1SYC A;  5J22 A;  3ERQ A;  2F0U A;  3HEJ A;  2EYL A;  2EYH A;  4K5X A;  5CV9 A;  4KTA A;  5IOD A;  2F0K A;  1TQO A;  1EY7 A;  5IIF A;  4K14 A;  5E3F A;  5C4Z A;  1JOK A;  3SXH A;  5NUC A;  4DU9 A;  4E6I A;  5ISR A;  5CV5 A;  3S9W A;  3DHQ A;  1JOR A;  2QDB A;  4KJN A;  4R8N A;  5J1Z A;  2RBM A;  1AEX A;  3MVV A;  5IGF A;  1KDB A;  1STG A;  2F0S A;  1II3 A;  2F3W A;  3LX0 A;  4WRD A;  5HUR A;  5M9O A;  4N9T A;  2RDF A;  3P1H A;  4K2K A;  5CGK A;  3TP8 A;  1IHZ A;  4WOR A;  2F0P A;  4K6D A;  4ZUJ A;  2PZW A;  4NMZ A;  5EKL A;  2SNS A;  5CV4 A;  4NDX A;  5I6W A;  4EVO A;  3T16 A;  2PW7 A;  4F7X A;  4K2L A;  4OL7 A;  4QB4 A;  5J39 A;  2EYM A;  2OF1 A;  4K5W A;  3NUC A;  4DF7 A;  1KAB A;  3ERO A;  4S3S A;  4EQP A;  5KGU A;  1STB A;  5KIX A;  5CR3 A;  5IGE A;  2F0H A;  4HMJ A;  1U9R A;  4J6H A;  2PYK A;  5IGC A;  1KAA A;  2M00 A;  3OWF A;  1NSN S; 
#chains in the Genus database with same CATH topology
 1TR5 A;  5FKA C;  2I5L X;  4GN4 B;  2RKS A;  2A68 D;  2A1A A;  3J81 i;  2E2J B;  3NXW A;  3I70 A;  1FNW A;  1A62 A;  4JBJ A;  4JI4 Q;  2XWJ B;  3SHL A;  3E0J A;  2ENB A;  5D3D A;  5EBC A;  2WAQ B;  2EJM A;  3KF8 B;  3TRZ A;  1WTO A;  1BBW A;  1U0L A;  4CJ1 B;  4FF1 A;  4LF4 Q;  4KMU C;  2NVY B;  1PH8 A;  3HOU H;  1A2U A;  4ABN A;  2N3S A;  2NWG A;  3J7Z C;  3U4V A;  3S1M B;  1QNU A;  2R7D A;  4CDC C;  1WD1 A;  2RSN A;  3H91 A;  2JA6 B;  3TP7 A;  4GOP A;  5FO9 B;  4DK6 C;  5I2Y A;  3BYY B;  1HTL D;  3DM3 A;  4FF2 A;  1L0W A;  2PPB C;  1JE5 A;  1V1P B;  4DNR B;  1EWH A;  2OWO A;  1EZ6 A;  2IHF A;  3I4O A;  2F0M A;  4FO2 A;  2BE5 C;  2JJQ A;  4F8M A;  3S17 B;  1BUV T;  2UUA L;  2NVQ B;  1KRT A;  3LNN A;  4CDF C;  1HHV A;  1TS5 A;  4IFD H;  2HCI A;  4A3K H;  5JEA G;  1Z6H A;  2B2W C;  2LS0 1;  4R1J A;  3SK4 A;  3J7A F;  3STB C;  2QEJ C;  4B3R Q;  1YHA A;  4A3B G;  3WOE A;  1K8O A;  2Z4I A;  1XNR Q;  3T51 B;  4HED A;  2KEC A;  3TZD A;  3CC2 A;  1W6J A;  3T53 B;  4IUQ A;  3GTM H;  2BOS A;  4JG2 A;  2XN9 C;  4WJ4 A;  2VZA A;  4A93 H;  4UDU C;  3M9B A;  1JCK B;  1PTO B;  4XIG S;  2PZW A;  1U4P A;  1W2B A;  5T1I A;  2JE6 I;  4EVO A;  2EQS A;  4QB4 A;  1N8R C;  5D14 A;  2VB2 X;  4LFB Q;  3D4R A;  4JV5 L;  2RF4 A;  2F0H A;  2NN6 G;  3AFQ A;  1TWF H;  2PYK A;  1KAA A;  3I8Z A;  4CDE C;  2Q2U A;  3PO2 B;  4LF5 L;  2A8V A;  1IBK L;  3UDX A;  5CC4 A;  4V19 0;  3BDO A;  1LTG D;  4RKL A;  4X3T A;  1K9M C;  1X3E A;  3T13 A;  2MHV A;  3HGB A;  1YHB A;  2CH4 A;  3HOV G;  2JA8 G;  1STH A;  2B2W A;  1Q8I A;  4DV5 L;  4A3G B;  1JB3 A;  4CKE A;  2R92 G;  1QCB D;  3K81 C;  1FVI A;  1SRO A;  1IKL A;  1GD7 A;  2I5H A;  4RCO A;  3PIP 3;  2Z1C A;  4UHV A;  2OQK A;  2L0C A;  4ZQ3 A;  5M5Y H;  3FPP A;  1IKM A;  1O7I A;  3KK7 A;  5LMU Q;  2YTV A;  4ILW A;  2NB0 A;  2IPK D;  3ND8 A;  2HHH L;  1A8V A;  2WV6 D;  5A35 A;  3H3V H;  3MEH A;  1JWS D;  1MSG A;  3SK8 A;  3G6E A;  5KNC A;  1YJ9 A;  1VQ6 A;  1A63 A;  3HOZ G;  2C5C A;  3OW2 A;  1L0Y B;  1AN8 A;  1KAW A;  1Q7Y C;  1ILQ A;  3NBH B;  2HD3 A;  2UU9 Q;  4QIW E;  4ZUI A;  3H15 A;  1Q1B A;  3ZYY X;  2K01 A;  4NP5 A;  3D8G A;  4R4T A;  1AW7 A;  3O13 A;  4RFB A;  5IGB A;  5C0X G;  4RAU C;  2EY1 A;  1UEA B;  4HJ5 A;  1HJP A;  4IUN A;  2HIX A;  1A0I A;  1GUS A;  1QIL A;  4YCU A;  1MD2 D;  3SVM A;  3A54 A;  5IP7 G;  3D31 A;  2YYZ A;  3K5L A;  2H5X A;  4OO1 G;  1E2Z A;  4X3U A;  2IWH A;  1PRT D;  1SNC A;  3FKI H;  2F1M A;  2RCN A;  1R9T H;  1GHK A;  3BG3 A;  5FLM G;  4KN4 C;  3S1Q B;  1M8A A;  1VCI A;  3EQL C;  2VW9 A;  1VQD A;  2AQ2 B;  3DEO A;  4OON A;  4DV6 L;  4P75 A;  1JOR A;  1S5C D;  4LF9 Q;  2UXB Q;  3MVV A;  4LF6 L;  2YTX A;  1II3 A;  3F8T A;  3LX0 A;  1CKN A;  2YU9 H;  4BXX H;  2KCM A;  3P1H A;  1FNU A;  4K2K A;  4FDB A;  1ZXT A;  3OYY A;  1E24 A;  3KFU A;  4JCV E;  4NXN L;  4JOI C;  2K4K A;  1STB A;  4A3D B;  5M3F G;  2CHB D;  1BQQ T;  2Q8T A;  4RA8 A;  4GNX B;  1RTO A;  3CU7 A;  1JQY D;  2QW7 A;  4DR1 Q;  2WIN B;  3X3N A;  1YJN A;  4YY3 Q;  1PH5 A;  1ONL A;  2I5M X;  1NUC A;  1FR3 A;  3VR6 A;  2KHS A;  1SNP A;  2JA7 H;  5FLX L;  5DM7 3;  3G48 A;  2DN8 A;  1VQ4 A;  4DNT B;  2D62 A;  4ZLT F;  3RLF A;  5BR8 L;  1GUO A;  3NK9 A;  5GAE C;  4YCW A;  1IL8 A;  4DV0 L;  2A6E C;  1S5E D;  1WCM B;  1C7Y A;  1F9S A;  3BDL A;  2X69 A;  1IYJ B;  3I4M H;  2J0T D;  4GZY C;  2KOL A;  1ESR A;  5I9P A;  2EYJ A;  5E4X A;  1HZB A;  3NTI A;  4K8J A;  4ME5 A;  3D3R A;  2K5Q A;  4JOI A;  1AE2 A;  5LL6 S;  1NE3 A;  3TEH B;  1RKN A;  3M7N A;  3QG1 A;  3AQQ A;  1VQG A;  1SE8 A;  3TME A;  3NEN A;  1T9H A;  1X3G A;  3AFP A;  4DV4 L;  5EKI A;  1PYB A;  2Y0S G;  2N8N A;  4IFD J;  5IT9 L;  5EKK A;  4PMB A;  2K5H A;  1EYG A;  2ZXR A;  3GTK H;  4R8I A;  1GUG A;  2X6G A;  4X66 L;  1Z47 A;  4BY1 G;  4B9W A;  1BCP D;  4R4I A;  1I50 B;  1NMF A;  1U4L A;  3EN2 A;  1HTP A;  1A3T A;  1B8A A;  3EJI A;  3W1G A;  3S15 B;  4NXM L;  3HOX H;  1HNX L;  1IW7 D;  1ZYR C;  3E0E A;  4RHR A;  4A75 A;  2OTJ A;  3CC7 A;  4U67 3;  1EY7 A;  2Z8L A;  2H4O A;  3HOY G;  1CA6 A;  1PRT B;  4KJN A;  2YV5 A;  4F88 A;  3BVM A;  3CCR A;  1AEX A;  5IGF A;  1PH7 A;  4WRD A;  1I94 Q;  3PUV A;  1JB7 A;  1TWC H;  2DY7 A;  4C3I B;  3GTQ H;  2PMZ B;  3ONA B;  1F77 A;  3BYT B;  4YWM A;  3PIO A;  5IWA Q;  4UP9 A;  2WB1 G;  3HG9 A;  4DR6 Q;  1VQ8 A;  3DWQ A;  5C44 B;  1K83 B;  3JAM E;  1BNZ A;  3CCM A;  4DR3 L;  3K5M A;  2HCC A;  3NQI A;  3A5U A;  2LFN A;  4DR5 L;  4DV3 L;  4K8I A;  3MEF A;  2Q2H A;  2R6G A;  4HTH A;  4CKB A;  2KHJ A;  2WAQ G;  1SNO A;  5BN3 A;  4KJO A;  3I56 A;  1SN8 A;  1K0S A;  1T5X D;  3OIP A;  3DM1 A;  4A3K G;  3CQZ B;  2RHS B;  1TKW B;  1QUQ B;  4DUY L;  1DZ1 A;  2Z9H A;  2EIF A;  2ALY B;  3A7A B;  3H94 A;  5LMN Q;  1QJO A;  3CCU A;  5JEA H;  3M3Y B;  1KNE A;  3H6M A;  1DXM A;  1LT4 D;  4GN5 A;  1SRU A;  5IYD G;  4HCS A;  4JC0 A;  1VQB A;  3UE1 A;  4DGZ A;  1HFG A;  4X62 Q;  4A3B H;  2B8F A;  1WFQ A;  2I0Q A;  3K8A A;  1U5K A;  4JI5 Q;  2QEX A;  5IT9 c;  5G3L F;  1EYD A;  1ENA A;  4GN3 B;  4DV2 L;  3H09 A;  4CKC A;  3K59 A;  1DOM A;  3J81 c;  1XMQ Q;  3VR3 A;  4H02 A;  3KJP A;  4XT3 B;  3PUZ A;  3CPF A;  4XQJ A;  1N36 Q;  1F2Z A;  1TWA H;  2OT2 A;  3F2B A;  1HUM A;  3SEB A;  1I6V C;  3OSO A;  3OTO L;  2R3Z A;  1EYA A;  4NW2 A;  1VF7 A;  2NN6 H;  2KCT A;  3LGJ A;  3GTL B;  1LO5 D;  5J22 A;  1BCP B;  1PV4 A;  4DK0 A;  2JYO A;  2OCE A;  3H3V C;  2E5L Q;  4FVM A;  4AYB G;  4LUO A;  3I3C A;  1U4R A;  3E9I A;  1YIJ A;  2R92 H;  4ZAI A;  1U4M A;  2K52 A;  4N9T A;  3I4N B;  4LUV A;  1KIX A;  3AYH B;  3J80 L;  2V1C C;  4ZUJ A;  4A3L G;  1P8L A;  1PHJ A;  3K7U C;  2E2I B;  2NZO A;  2OQ0 A;  2M9V A;  4I7A A;  4DK3 C;  4N8X 1;  4DF7 A;  1H95 A;  2R7Z B;  1OO9 B;  2B3G A;  2ZJQ A;  4DV1 Q;  3PO2 G;  5M5W B;  3FRP B;  2XTI A;  1YIT A;  3BZC A;  3A8K E;  2A6H D;  1HNW Q;  1D1I A;  4LFA L;  3U9S A;  1CKN B;  4JI6 L;  3T1Y Q;  1R4P B;  2IL8 A;  3HP3 A;  5COR A;  4JYA Q;  4ID6 A;  1K8A C;  1UE6 A;  2O5J C;  1Q86 C;  3HOZ H;  3KBG A;  3PIO 3;  5M3M B;  1S40 A;  3UI2 A;  1MBY A;  1SJH D;  2EPB A;  4EQO A;  4DV7 Q;  5C0X H;  1PZJ D;  1AFP A;  4ZKB B;  1GOZ A;  1X6O A;  1D5M C;  4JPB W;  2VQF L;  5IP7 H;  5I6Y A;  1VQE A;  4G7H C;  2VY3 A;  3R2T A;  4R4C A;  3ITP A;  4B3T L;  1G2S A;  4OO1 H;  1DGS A;  2CH4 W;  4IFD I;  4LF7 Q;  1E2V A;  1I6H B;  3GDE A;  5IYB G;  3UDG A;  3A7L A;  2BDO A;  5FLM H;  2NTS A;  4K0K L;  4JI0 Q;  4KLK A;  4BXX G;  3I91 A;  5ELN A;  1G6Z A;  3J7Y W;  1SMX A;  4DUZ L;  1VS0 A;  3BDC A;  4JBK A;  1XMO Q;  2JQO A;  3R93 A;  1H9S B;  3DLL A;  3H0G B;  5HGQ A;  1YJW A;  2PI2 E;  1EY4 A;  1ET6 A;  1E0B A;  3S1R B;  1UWV A;  1VMP A;  2ID0 A;  2Q2T A;  3BZK A;  1SE4 A;  1NAP A;  1NBW A;  2IX0 A;  5DEH A;  1HR0 L;  3UE0 A;  1SMY C;  3K7A H;  1A3V A;  3FMC A;  2K5W A;  2PW5 A;  1O7L A;  1N34 Q;  2VB3 X;  2LSS A;  5C4J H;  5M3F H;  5EGT A;  2E8G A;  3S14 H;  3HEJ A;  1Y1W B;  3J80 c;  2RVL A;  1VQN A;  2F4V L;  2YTY A;  1FJG Q;  1LTT D;  4YCV A;  3Q23 A;  1JOK A;  1HNZ L;  1FL0 A;  3S9W A;  3CCL A;  2B8G A;  3VYS A;  4KI0 A;  3OWE B;  3Q22 A;  1PA6 A;  2UXD Q;  4HN7 A;  3RMH A;  2RDF A;  2I07 B;  4J8Q A;  3TRE A;  1ML0 D;  2R93 B;  2Q8R E;  4HR7 B;  4PG3 A;  1BF4 A;  1B7Y B;  2PNH A;  4RH6 A;  1H9J A;  2NVT H;  3U58 A;  5C4X B;  4A3D G;  3A56 A;  3PF5 A;  1D5X C;  1F9P A;  1BO0 A;  4LJZ C;  4A3J B;  1D7Q A;  1J5E L;  4DAY A;  3HS0 C;  1CZG A;  1ICF B;  4HMI A;  1UAP A;  1M90 C;  2QIL A;  5I9O A;  1ENF A;  4IQZ A;  4PZ6 A;  2E2H B;  2AKW B;  1NY4 A;  1MIU A;  4A3C G;  3Q0A A;  2B29 A;  3F2U A;  2WII B;  1DCZ A;  5K5P A;  4FF3 A;  3JAM i;  3QWN A;  3L3O C;  3A8J E;  2QA4 A;  3HOX G;  2CKZ B;  1S5D D;  3SDZ A;  2EDG A;  5JEA J;  1RCV D;  4BY1 H;  1T5E A;  1CI3 M;  4A3I B;  4DR2 Q;  2N78 A;  2PQA A;  3DUZ A;  3HOU B;  4O42 A;  4I7Z C;  4PV1 C;  1MGS A;  4QY7 A;  2CCZ A;  2XWB B;  2F0W A;  2A69 D;  1PDQ A;  5C3E G;  3AEV A;  4DPG A;  3GO5 A;  5CMD A;  3HOY H;  5EPL A;  4DXF A;  5M9O A;  3GV6 A;  1B3Q A;  1JJG A;  1YNJ D;  2KBN A;  2JA5 B;  2LY7 A;  1R4Q B;  2MGS A;  2MO1 A;  4LW1 A;  4BBR H;  2K7V A;  4JBM A;  1SND A;  2MUY A;  1JWM D;  1D5Z C;  4LF8 L;  4GKK Q;  2AUJ D;  3M4Q A;  1KDC A;  1SXT A;  2EJF C;  5AJ3 Q;  1RHP A;  4YWL A;  4QIW B;  3AB9 A;  4C3H B;  3D6C A;  2K33 A;  3J81 j;  2F0D A;  3EVQ A;  1SYC A;  5E7N A;  1JC7 A;  2E2J H;  3RN5 A;  3IAY A;  3S2D H;  1B53 A;  4BA2 I;  2B2U C;  4K14 A;  4QCL A;  4DU9 A;  5NUC A;  3T1H L;  5FJ8 G;  5ISR A;  3M4O H;  2WFW A;  1BBU A;  1TS4 A;  5A2Q E;  2NZH A;  1PFB A;  4HSP A;  3KLW A;  4C3I G;  3W1B A;  5CGK A;  2XGT A;  4DK1 A;  2NVY H;  1FNV A;  2VXW A;  4DR5 Q;  4YHH Q;  3GTP B;  1MI2 A;  1WOC A;  2RQX A;  3GTM B;  2ATW A;  1IBL Q;  1X3F A;  4IUP A;  4A93 B;  2WKD A;  1PMR A;  5C44 G;  1Z7T A;  2MQH A;  2SEB D;  1KAB A;  3HKZ E;  2L12 A;  4UP8 A;  1KD1 C;  5IYD H;  1HQM C;  1QNK A;  3PUX A;  3PUW A;  4DR7 L;  4X64 L;  3C3L A;  5ELO A;  1N33 Q;  4KKU A;  1PFM A;  1E22 A;  1H9M A;  1CQV A;  3FEW X;  2AWN A;  2Y0S E;  3P75 A;  3S17 H;  2ES2 A;  1SAP A;  1OXU A;  2CW0 D;  1BXT A;  1H9K A;  3M4P A;  2DUD A;  5C0X J;  2B2U A;  4GLX A;  1VQ9 A;  3VR4 A;  4PNY A;  5GAH C;  4B3S Q;  3PO3 G;  5LMN W;  1HZA A;  5M5Y B;  1QZG A;  2F03 A;  1X55 A;  4JI8 Q;  1JMC A;  2J7Z A;  3MFY A;  4HJA A;  1QG7 A;  2GVA A;  4MNO A;  5LHY 1;  4A3M B;  1PZK D;  1VDZ A;  3S2H H;  2QDL A;  4ME3 A;  4ZKC B;  2RCF A;  1EY6 A;  2CQA A;  3VDY A;  1L1O B;  3C1E A;  4G7Z C;  4DFA A;  3BJU A;  1C0A A;  2AHO B;  1PTO H;  2PI2 A;  5GRO A;  3BZD B;  4A3L H;  3K5O A;  2F0J A;  2VQE Q;  1IBM Q;  5DAU A;  4KHZ A;  4OX9 L;  3R3O A;  3ULP A;  1I4Q A;  1MHW C;  2DGY A;  1BVS A;  2HIV A;  5KEE A;  1WTR A;  2VS1 A;  3CCE A;  3PO2 H;  2VNU D;  5CV8 A;  2XVS A;  2ZM6 Q;  4POG A;  1F2L A;  4HIM A;  2AMC B;  4RWS C;  3F2C A;  3KF6 B;  1QE6 A;  2F0K A;  5GAG C;  1XNQ Q;  4B08 A;  1X56 A;  5C4Z A;  3KLS A;  1VQH A;  4R8N A;  1HZ9 A;  1YNN D;  2QGQ A;  5IYC H;  3MA2 B;  1EOV A;  1R9T B;  3I4N G;  3I55 A;  1PH1 A;  2F0P A;  5JPM C;  3U50 C;  3CCS A;  2ZXP A;  1M1K C;  3CC4 A;  2YU9 B;  3J7A V;  1LT5 D;  4B3M Q;  2R7Z G;  4DR4 L;  3OHX C;  4IPH A;  3PUY A;  4K5W A;  2ZTC A;  3MFG A;  4LFC Q;  3K0Y A;  4RGM A;  4JI7 Q;  1E1T A;  2M00 A;  2HDL A;  1DON A;  1K73 C;  5IYB H;  1I4X A;  3X3M A;  4RHS A;  5M3M G;  4RCN A;  1VQP A;  3TS0 A;  3S16 H;  3P7J A;  2K5N A;  3MHB A;  1TWH H;  3U9O A;  1X9N A;  4UAI A;  3MXN A;  2LMC B;  3C46 A;  1SBB B;  5BN5 A;  2BH2 A;  3GTJ H;  4G7O C;  1G29 1;  4ODG A;  1A15 A;  4L5Q A;  2LXJ A;  1LTL A;  2HQE A;  4PMC A;  5IGG A;  1EFW A;  3ULJ A;  1XPU A;  1N32 Q;  4TQU S;  2FFK B;  4AH6 A;  4GKJ L;  4JW0 A;  4JI1 Q;  3K0X A;  2BE5 D;  2KED A;  4AQY L;  1EQV A;  1EEI D;  2KEN A;  1W6K A;  4AYB E;  1HRJ A;  3S1Q H;  4KD3 A;  3SK6 A;  1XYI A;  4MIU A;  2G5D A;  2N88 A;  4OWW B;  1Y1V G;  1F2Y A;  2VUM B;  3P20 A;  3DXJ C;  2UUC L;  1WTQ A;  1CKM A;  1K0R A;  3VYT A;  4B9X A;  3STB D;  4XXE A;  3FHW A;  2XNA C;  4X3S A;  3KDF A;  1TVX A;  1RTN A;  2SNM A;  2K75 A;  2Z6K C;  1WTW A;  2UUB Q;  2DJG C;  4ZCK A;  1D6E C;  2KUM A;  1YBY A;  2C35 B;  3JC6 6;  4IJH A;  3RZO B;  1PTO F;  1V1Q A;  3BU2 A;  3GTG B;  4A3D H;  1SE2 A;  4Q5V A;  1SYB A;  4IOA A;  2B2Y C;  1TXY A;  3PV0 A;  4JI3 L;  4C56 C;  4X65 L;  2HDM A;  1SJE D;  4HIK A;  2FJ2 A;  4KHP L;  3KUP A;  3D6W A;  5IOD A;  2TSS A;  1KL9 A;  2L9H A;  1PH3 A;  2UXC L;  1V1O A;  3QJY A;  5K36 G;  4QUF A;  2XIW A;  1J9O A;  4GOP B;  1MSH A;  1K3B C;  1PH9 A;  3KBX A;  4HAE A;  3CD6 A;  1C9O A;  4A3C H;  2F52 A;  3F1Z A;  3W3A A;  1E1O A;  1Q82 C;  1YI2 A;  1I4P A;  5E4W C;  4JI2 Q;  4LWC A;  2IT1 A;  3J81 L;  3TSS A;  2MO0 A;  5C4X G;  3D0F A;  3NE5 B;  1CHP D;  1JJC B;  4IN3 A;  5D65 A;  1O7Z A;  2OF1 A;  3RZD B;  1EQR A;  3G4S A;  1JWU D;  1V8Q A;  2K03 A;  4A3J G;  1BDO A;  5JJZ A;  4JI4 L;  1Y8P B;  1G6P A;  3PSI A;  5C0X I;  4IJL A;  4EGV A;  2Z6K A;  3I2Z A;  1N9W A;  4LAA A;  3A8I E;  4BBS B;  4C3J G;  1YVC A;  1RD9 D;  5FLX E;  5C3E H;  1TY0 A;  4LF4 L;  2PQE A;  4OO1 I;  1B1Z A;  2KVM A;  1LAB A;  4BBR G;  1BR9 A;  3S24 A;  2B2Y A;  4C2M B;  2OTL A;  1B2T A;  3V05 A;  2B39 A;  1SSO A;  4PZ8 A;  1EY5 A;  2KJX A;  1PH2 A;  2F0I A;  1SYF A;  1SFO B;  1KDA A;  2F0V A;  5C5M A;  4IPC A;  1S5B D;  4POF A;  4A3I G;  1I50 H;  4RGO S;  4FXG C;  4OWT B;  5CBE E;  2R61 A;  2A74 C;  1C48 A;  1LM0 A;  3G71 A;  3TBI B;  1CSP A;  1EZ8 A;  1B44 D;  1YEZ A;  1ICW A;  1UE1 A;  1WTH A;  3I4L A;  5C3X A;  1STN A;  3S1N B;  2GA4 B;  1B4O A;  2EY5 A;  1CKO A;  3FDT A;  1YHQ A;  4BY7 B;  2P5Z X;  4XYQ A;  4HID A;  5FJ8 H;  4ZK9 B;  4RKB A;  2JA5 G;  5C3W A;  5M5X B;  5IT9 E;  1HQR D;  3EFX D;  3NSW A;  3D4W A;  3IKJ A;  5KYI A;  4C3I H;  1NJI C;  3G7L A;  5E1F A;  2JA6 G;  3CAM A;  1TWG B;  1VQC A;  3ICE A;  4B3R L;  4A3E B;  4FF4 A;  4DKA C;  2CQO A;  1EY9 A;  2UUA Q;  2KHI A;  3T4A C;  1XNR L;  2CFM A;  5C44 H;  1K83 H;  4KD4 A;  3VA5 A;  4C3H G;  2FMC A;  4UPA A;  4K5V A;  3TP5 A;  4R4O A;  2B63 B;  3ZJY C;  1S3O A;  4K5X A;  1AP0 A;  5E3F A;  4OEM B;  3VYU A;  2K28 A;  1Z9F A;  5T1G A;  3MTS A;  1EWC A;  3CQZ H;  2DNC A;  2E76 C;  3CHB D;  4WOR A;  3TP8 A;  4LFB L;  5EQ0 A;  3HOV B;  2JA8 B;  4ULL A;  3AMU A;  4NDX A;  1PTO C;  2PW7 A;  1WYD A;  3M3Y H;  2L4N A;  3A74 A;  1V1P A;  1OXV A;  3PO3 H;  2VL6 A;  1AZQ A;  5KIX A;  1XTD A;  1LLR D;  1HH2 P;  5ELD A;  1UEB A;  1F9R A;  2TMP A;  3MC0 B;  1YNX A;  5IGD A;  2IX1 A;  2ASB A;  2Z0S A;  4JV5 Q;  1Y8O B;  3NHH A;  3M7G A;  4UP7 A;  2A6E D;  4LF5 Q;  1IBK Q;  4LUZ A;  1GUW A;  4ZYS A;  1NTG A;  5KYL A;  1DOL A;  3Q8D A;  5LMU L;  1WTX A;  3HOZ B;  2A68 C;  2JK8 A;  1PYS B;  4DV5 Q;  1B3A A;  1NR4 A;  1GJX A;  3K57 A;  1LUZ A;  3R8B A;  5CYU A;  3PF4 A;  4A3G G;  1Q1E A;  1VQF A;  3DMU A;  4A3M G;  2UU9 L;  1EU3 A;  5IYC G;  1PVO A;  2MJ8 A;  1G51 A;  4K6L A;  2HHH Q;  1ASY A;  2L15 A;  4CBV A;  2PMZ E;  5IP9 G;  2WAC A;  1STY A;  5ELE A;  3I4N H;  3OMG A;  1Q90 A;  3NTK A;  2EYO A;  3V2T A;  3HFZ B;  3GP7 A;  3KYH C;  4IO9 A;  4I65 A;  1A3U A;  5JVH 3;  2E2I H;  1ZYR D;  4UY8 C;  4A3F B;  1XXG A;  2F0E A;  5H1S E;  1PH4 A;  2XRQ D;  1EL0 A;  5JJL A;  2R7Z H;  1Q46 A;  2BCO A;  2EJG C;  2L1B A;  1XTC D;  3BVZ A;  5M5W H;  4LK1 C;  4MN3 A;  4EQN A;  2GN5 A;  1IL2 A;  2NVX B;  4LF9 L;  2UXB L;  2F0U A;  4RGN A;  3C2P A;  3CMA A;  2I46 A;  5M3M H;  3J80 E;  1RL2 A;  1XPR A;  4XTC S;  3CF5 A;  3RLO A;  1DM0 B;  1IYV A;  2F3W A;  5CBA E;  4MTN A;  5AFW A;  4R9W A;  1I3Q H;  4K6D A;  1K8M A;  4C1N I;  1TS3 A;  4DV6 Q;  2EVB A;  3RN2 A;  4LF6 Q;  4O0A A;  2EZV A;  2WKC A;  4HCE A;  4Z9C B;  5HY6 A;  1JT8 A;  1QZH A;  2K6A A;  4KN7 C;  3NBH A;  5ELC A;  5CR3 A;  3EA6 A;  4DR1 L;  2NYZ D;  2ZTD A;  4J6H A;  4NXN Q;  1I6H H;  4L5T A;  3VYR A;  1GUT A;  3SXH A;  4YY3 L;  1CA5 A;  3B6Y A;  3L7Z C;  4R4Q A;  4H13 C;  1J8I A;  2NUC A;  4CDD C;  3QO2 A;  3PMF A;  1JE4 A;  3GQB A;  1UNS A;  4GNX C;  1STE A;  2O5I C;  3NWT A;  1Y1V H;  1L0X B;  4QGU A;  4GS3 A;  3DEP A;  3HKZ B;  2NBF A;  2F0Q A;  1LTR D;  1QVC A;  1EU4 A;  3S1R H;  1RF2 D;  4QJF A;  2RDH A;  1E7Z A;  2IY5 B;  2L55 A;  3I72 A;  4V0B A;  3HOW B;  2AQ3 B;  2FIN B;  2PO4 A;  1O80 A;  1GKH A;  4GLV B;  2Y0S B;  3WDN A;  3ER0 A;  3GTO H;  1I4R A;  5BR8 Q;  1LTB D;  1SE3 A;  4DNI A;  2AWO A;  3F2D A;  3K6O A;  4DV0 Q;  1GVP A;  1KNA A;  3H3V I;  5K36 H;  4HSV A;  5FO8 B;  2VUM G;  1SEB D;  3C1F A;  3TS2 A;  1VQA A;  2F0T A;  1BCP F;  2KCN A;  2NZ1 D;  4TSS A;  3MZ5 A;  1HR0 W;  1WCM G;  4NPS A;  3EBE A;  5JVG 3;  1QVG A;  4H7B A;  3EIV A;  1PFN A;  1WI5 A;  1IZ6 A;  3E3X A;  3BVG A;  4XQQ A;  5C4X H;  4GNX A;  4FP5 D;  1LT3 D;  4L5S A;  4RMF A;  4DV4 Q;  4A3J H;  1EQQ A;  5FO7 B;  4X66 Q;  4Y7N H;  2L11 A;  1I94 L;  1K28 A;  1TQO A;  2E2H H;  4P72 A;  4PZ7 A;  4C3J H;  4NXM Q;  2ICE C;  2QDB A;  3CXC A;  1HNX Q;  1F9Q A;  5IWA L;  3S2D B;  4IUV A;  1Y69 U;  1ASZ A;  1PRT C;  1ROD A;  1LV9 A;  1IYU A;  3M4O B;  4DR6 L;  4NMZ A;  1W3S A;  2E75 C;  4DA2 A;  1B9M A;  4OL7 A;  3NBI A;  4A3K B;  2ZJR A;  1S5F D;  4A3I H;  4CGY B;  2BDN A;  5IGE A;  3OWF A;  4BBS G;  1EUJ A;  1KTK A;  1OXS C;  2EOT A;  1CUK A;  1KHI A;  1Q8K A;  2K32 A;  3E9H A;  4DR3 Q;  3KLR A;  5KRU A;  1ENC A;  1QWY A;  2DY8 A;  2D0P A;  1NCV A;  2JA5 H;  1SNQ A;  3BS1 A;  4DV3 Q;  5LMN L;  1HPC A;  3UDI A;  2JA9 A;  4WJ3 M;  1GHJ A;  1UUP A;  3S1M H;  1TII D;  2PZU A;  1V43 A;  2IW3 A;  3QB3 A;  3UDF A;  1X32 A;  2ZTE A;  1TY2 A;  2JA6 H;  2G9D A;  2JSO A;  4X62 L;  4AIM A;  5BN4 A;  1M4V A;  1EOT A;  3NP8 A;  1CFM A;  3KOJ A;  4DUY Q;  1SDF A;  4KY6 A;  4JI5 L;  4C3H H;  1LTI D;  4QL5 A;  1KLG D;  1MKH A;  2FXQ A;  4OHJ A;  1TWF B;  4DAV A;  3J7A 5;  4JVZ A;  4BY7 G;  2PCF B;  1XMQ L;  2NVQ H;  2N49 A;  4OEL B;  3IL8 A;  1OTC A;  1N36 L;  3S2H B;  4YIJ A;  1SMY D;  4JK1 C;  3KLS X;  1HUN A;  4P74 A;  2KQ3 A;  3GTP H;  4A3E G;  2MFI A;  4AYB B;  1GXD C;  4DV2 Q;  5G3L D;  2DJF C;  4KKT A;  4IAL A;  3WOF A;  1Q81 C;  1F2M A;  3NQT A;  5JJK A;  4DAP A;  1VQJ A;  4QF4 A;  1JJ2 A;  5KNB A;  2E5L L;  2B63 G;  2C9O A;  4OGQ C;  2A19 A;  2K50 A;  4L6T B;  3TQY A;  3DWP A;  2K1B A;  3ERQ A;  2EYH A;  2A5H A;  1QUQ A;  3OTO Q;  5EJW A;  5GQO A;  4L63 B;  5IIF A;  1C4Q A;  2DNE A;  2J4X A;  5EBD A;  5ELB A;  1BCP C;  2WB1 E;  3QIA A;  2X6L A;  5J1Z A;  4BA1 I;  3NWS A;  3MXG A;  5JJI A;  3MWY W;  2BA1 A;  1IW7 C;  1DOK A;  4DV1 L;  5EKL A;  5CV4 A;  1VQK A;  3CCJ A;  4F7X A;  1NR2 A;  1HNW L;  1DYQ A;  3G6J B;  3T1Y L;  5LL6 X;  4FXK C;  4YWK A;  4JYA L;  2WAQ E;  4EQP A;  2ZT9 C;  1X65 A;  1LTA D;  3SGI A;  4HMJ A;  1RDP D;  2F4I A;  4A3G H;  2Q2I A;  3J80 i;  1X3Q A;  4FYD A;  1D8L A;  2K14 A;  4A3M H;  3FKI B;  4PMW A;  1PFS A;  3ULL A;  2ZXO A;  3KJO A;  4MZ9 A;  1BOS A;  5CV6 A;  4A76 A;  4J15 A;  4LFA Q;  1A2T A;  3FP9 A;  2JEA I;  4JI6 Q;  5IP9 H;  4DV7 L;  3NTH A;  5COY A;  1ZKO A;  1IXR A;  1BBX C;  3S16 B;  2RHQ B;  4L8J A;  4QQB X;  1CHQ D;  4TVA B;  2GVB A;  4XQN A;  1TWH B;  4LF7 L;  1PLF A;  3I7F A;  4KHV A;  3GTJ B;  2WP8 J;  4Q0F A;  3SK5 A;  4JI0 L;  3K58 A;  1VMC A;  1LT6 D;  1GO3 E;  1CM9 A;  2HT1 A;  2E2D C;  3E5S A;  1XMO L;  2VQF Q;  5IOC A;  3A5Z B;  4B3T Q;  4XYO A;  3W5O A;  1SR3 A;  4QMG A;  1XPO A;  5J3B A;  4DAY B;  1H9R A;  1SYD A;  4K0K Q;  2JA7 B;  4L5R C;  4A3F G;  4DUZ Q;  2F0N A;  1N34 L;  2JN4 A;  2XRS D;  5EAY A;  3SR1 A;  1TU2 B;  4APV A;  4IZ8 A;  3MXP A;  4LNQ A;  3QR8 A;  5C6A A;  1Q12 A;  2KCC A;  3TN2 A;  1Q3L A;  2G9H D;  1FJG L;  5JOB A;  4BWG B;  1MJE A;  3I4M B;  2NN6 I;  1HR0 Q;  2UXD L;  3H0G G;  1PH6 A;  1PYW D;  4C1N K;  4F87 A;  1WTV A;  5DNF A;  2PQA B;  2V4D A;  2RBM A;  1CSQ A;  4OWX B;  2QCP X;  1B70 B;  4CJ0 B;  2F4V Q;  3RLN A;  1HNZ Q;  1C8C A;  5KND A;  3L0O A;  1FD7 D;  1KLU D;  1UE7 A;  3T16 A;  3VR5 A;  3GTK B;  1Y1W G;  1XX8 A;  4IPG A;  5KGU A;  1EQT A;  3FVQ A;  1U9R A;  5IGC A;  3HOX B;  3NEM A;  1H9S A;  3N52 A;  4RGT A;  1HCZ A;  4U68 A;  3JAM L;  4G4K A;  5IE8 A;  4Y52 H;  1VQ7 A;  4ZRZ A;  2MP1 A;  2R93 G;  2VUM H;  1EIG A;  1PXU A;  3HKZ G;  1J5E Q;  4MTK A;  3LWU A;  3IFT A;  3CME A;  4HIO A;  3SE0 A;  2A6H C;  2OEO A;  1SLJ A;  1AE3 A;  1YZ6 A;  5C3E B;  1WCM H;  1LTS D;  3RD4 A;  4LMQ D;  4DR2 L;  1TWC B;  1BKB A;  1O7Y A;  3GTQ B;  3HOW G;  3U4Z A;  3WWV A;  3RZO H;  3GTG H;  2LKV A;  1X54 A;  1XJV A;  3VR2 A;  2R7F A;  1EIH A;  2QF7 A;  3CKI B;  1UE5 A;  1MJC A;  3RNU A;  1ILP A;  3V96 A;  1JOO A;  4H44 C;  1HZC A;  1VQL A;  1VQI A;  1LAC A;  2K04 A;  2RA4 A;  3QOL A;  3TDQ A;  2ICI A;  1G91 A;  1JIC A;  3Q24 A;  4GKK L;  4DXG A;  4P71 A;  3HOU G;  5AJ3 L;  2F0O A;  3S15 H;  1NNX A;  2BA0 A;  2B2T C;  3VA7 A;  1KQS A;  1TS2 A;  3RZD H;  4CHT B;  1D2B A;  5FOB B;  1I4H A;  1OXX K;  1S4Z A;  2RSO A;  2EXZ A;  4DN4 M;  4WFN 3;  5DM6 3;  3TP6 A;  1AH9 A;  2CVR A;  4BBS H;  4LF8 Q;  4MHE A;  2K5V A;  3CCV A;  2EYL A;  3CW2 C;  4A3B B;  3K5N A;  4OIJ A;  4E6I A;  3I90 A;  5CV5 A;  5FLX c;  4YHH L;  3DHQ A;  1WD0 A;  4BS9 A;  4C2M H;  2D5D A;  1IBL L;  3M85 A;  3J81 E;  3CRK C;  4O1N A;  3OIQ A;  5L37 A;  1IHZ A;  5ELF A;  3T1H Q;  3HRZ C;  1SFO H;  3RR5 A;  1G8Z D;  4IFD G;  2K5D A;  3MXU A;  2SNS A;  5I6W A;  1VF5 C;  2AQ1 B;  2CWA A;  4H0L C;  3JAM c;  2L5T A;  1TWA B;  1N33 L;  1PZI D;  3ERO A;  3KF8 A;  1FGU A;  2KA7 A;  3S1N H;  1NSN S;  4X3K A;  5D3I B;  1EIY B;  1CZW A;  3PO3 B;  2B2T A;  1QB5 D;  4BY7 H;  3IFD A;  4G57 A;  3CPW A;  2IX3 A;  1QOH A;  1B9N A;  5EPK A;  1I5F A;  3TZU A;  4TKO B;  5M5X H;  4DR7 Q;  4X64 Q;  2EE1 A;  3CRL C;  3E6Z X;  4IUU A;  4ALP A;  4FXD A;  2JXM B;  2QKI C;  3LWE A;  1VQO A;  3R2I A;  4A93 G;  2R92 B;  3ERS X;  3DWA A;  2IJ0 A;  4B3S L;  2SDF A;  4X6A H;  1HA6 A;  1TWG H;  4KY5 A;  4NKL A;  4A3E H;  5JPN C;  2F0F A;  4JI8 L;  3MAQ A;  2JP1 A;  4EQ5 A;  1A6X A;  4M8A A;  1I4G A;  2IHE A;  4KY7 A;  5I2X A;  1OXT A;  2MNA A;  4P2C B;  2EYP A;  4HJ7 A;  1V9P A;  3L2P A;  1D1K A;  2B63 H;  3FPU B;  2O4X A;  1JR0 D;  2EXD A;  3Q6S A;  3AU7 A;  4KKS A;  1LYL A;  3D4D A;  1CK1 A;  2M2L A;  1JOQ A;  4HJ9 A;  4M1U B;  1P16 A;  3HZX A;  2E74 C;  2KEE A;  1XWE A;  1EY8 A;  2VQE L;  2PNR C;  5CV7 A;  2A73 B;  1IBM L;  1L1O C;  2N55 A;  1EFI D;  1WJJ A;  1CQF A;  1EIF A;  3HOV H;  2JA8 H;  3IRB A;  2HQL A;  2K05 A;  3A55 A;  2A69 C;  3N6R A;  2RDG A;  2ZM6 L;  1ET9 A;  1HA5 A;  3GTL H;  2F3V A;  1E3P A;  1STA A;  3MXN B;  1YNJ C;  1XNQ L;  2O2L D;  3QOJ A;  4FNF A;  2Z4H A;  4O2D A;  4OX9 Q;  1WVL A;  2XSC A;  5CV9 A;  4KTA A;  2FHT A;  2D2C C;  3PQI A;  1DD2 A;  2HUG A;  5FK9 C;  1CT1 D;  1PRT F;  1S72 A;  1KDB A;  1STG A;  5HUR A;  1FYC A;  4B3M L;  4A4I A;  4LFC L;  1GM5 A;  1Y8N B;  4JI7 L;  2ZJP A;  4K2L A;  2Z6B A;  1ESF A;  4QUC A;  5DLQ E;  1I3Q B;  5J39 A;  1L1O A;  3T56 B;  3CCQ A;  1Y14 B;  3K7A B;  3KDF B;  4KK7 A;  3FKI G;  1L2F A;  5C4J B;  5M3F B;  1VQ5 A;  4EX5 A;  3A0J A;  3PCO B;  4DR4 Q;  2PZT A;  1KXL A;  4PQX A;  3OW7 A;  3ND9 A;  3S14 B;  1B50 A;  1GUN A;  1AZP A;  2D9U A;  2F3I A;  1SNM A;  1KC8 C;  3OOC A;  1CTM A;  1N32 L;  1K8G A;  5TSS A;  2BH8 A;  5F2D A;  3PGZ A;  1HFN A;  4JI1 L;  1TT2 A;  1Y1V B;  4A3F H;  4IOC A;  3KF6 A;  5JAV A;  4KV6 A;  1G2T A;  2H1E A;  5C4H A;  2NVT B;  2SOB A;  3OPO A;  4IPD A;  4DAM A;  2FMM A;  1RJT A;  2NVX H;  3M4Y A;  1EY0 A;  3CP0 A;  4P73 A;  2CW0 C;  1HXY D;  3W2D A;  4GKJ Q;  4IUR A;  1SYE A;  2LXK A;  3GTO B;  3H0G H;  1SYG A;  1DJR D;  4AQY Q;  3RUZ A;  2B2V C;  1X3P A;  2F0G A;  3K80 C;  4JBW A;  5C5L A;  2UUB L;  2EY2 A;  2Q8I B;  2JA7 G;  4CJ2 C;  4N9P A;  1FGB D;  1E2W A;  4J1M A;  5HGT A;  3OMC A;  2EY6 A;  2JEB I;  1K3R A;  1EYC A;  2OXP A;  5IY0 A;  2UUC Q;  4XT1 B;  4TRD A;  1VQM A;  2AUK A;  3GV3 A;  2F0L A;  1Y1W H;  5EPJ A;  2MPM A;  4BY1 B;  3I4M G;  2EYF A;  4OXP A;  3NPP A;  5I4D A;  1KRS A;  4IUT A;  3HKS A;  1PTO D;  2CWP A;  2NTT A;  4JI3 Q;  2R93 H;  3I73 A;  5GAD C;  3GD7 A;  4X65 Q;  4JI2 L;  1J6Q A;  1QVF A;  3HOY B;  4OIK A;  4Y7N B;  4HJ8 A;  2F0S A;  1ZEQ X;  4KHP Q;  2UXC Q;  4GOP C;  4C3J B;  1EWI A;  1NMG A;  1WTP A;  4NB3 A;  4N8F A;  3NEL A;  5A2Q L;  3URY A;  1O78 A;  4WJW A;  4BBR B;  3HOW H;  2B2V A;  2EYM A;  1YNN C;  4XDX A;  2WB1 B;  4S3S A;  3PIP A;  3L9A X;  4GLA C;  4RG1 A;  1EEF D;  1RIP A;  3NUC A;  2D0O A; 
#chains in the Genus database with same CATH homology
 1TR5 A;  5FKA C;  2RKS A;  2A68 D;  2E2J B;  3NXW A;  3I70 A;  1FNW A;  2XWJ B;  3SHL A;  3E0J A;  2ENB A;  5D3D A;  5EBC A;  2WAQ B;  2EJM A;  1WTO A;  4CJ1 B;  4FF1 A;  4KMU C;  2NVY B;  1A2U A;  4ABN A;  2NWG A;  3S1M B;  1QNU A;  1WD1 A;  2RSN A;  3H91 A;  2JA6 B;  3TP7 A;  5FO9 B;  5I2Y A;  3BYY B;  1HTL D;  4FF2 A;  2PPB C;  4DNR B;  1V1P B;  1EWH A;  1EZ6 A;  2F0M A;  4FO2 A;  2BE5 C;  4F8M A;  3S17 B;  1BUV T;  2NVQ B;  3LNN A;  1HHV A;  1TS5 A;  4IFD H;  2HCI A;  5JEA G;  1Z6H A;  2B2W C;  2LS0 1;  3SK4 A;  3J7A F;  2QEJ C;  3WOE A;  1K8O A;  2Z4I A;  3T51 B;  4HED A;  2KEC A;  3TZD A;  1W6J A;  3T53 B;  4IUQ A;  2BOS A;  2XN9 C;  4UDU C;  1JCK B;  1PTO B;  4XIG S;  2PZW A;  1U4P A;  5T1I A;  2JE6 I;  4EVO A;  4QB4 A;  5D14 A;  2VB2 X;  3D4R A;  2F0H A;  2NN6 G;  2PYK A;  1KAA A;  3I8Z A;  3PO2 B;  4V19 0;  5CC4 A;  4X3T A;  3BDO A;  1LTG D;  4RKL A;  3T13 A;  2MHV A;  3HGB A;  4A3G B;  1STH A;  2B2W A;  1Q8I A;  1JB3 A;  4CKE A;  1QCB D;  1IKL A;  4RCO A;  3PIP 3;  2Z1C A;  2L0C A;  4ZQ3 A;  3FPP A;  1IKM A;  3KK7 A;  4ILW A;  2NB0 A;  2IPK D;  3ND8 A;  2WV6 D;  5A35 A;  3MEH A;  1JWS D;  1MSG A;  3SK8 A;  5KNC A;  2C5C A;  1L0Y B;  1AN8 A;  1ILQ A;  4ZUI A;  1Q1B A;  3ZYY X;  2K01 A;  4NP5 A;  3D8G A;  1AW7 A;  3O13 A;  4RFB A;  5IGB A;  5C0X G;  4RAU C;  2EY1 A;  1UEA B;  4IUN A;  1GUS A;  1QIL A;  1MD2 D;  3SVM A;  3A54 A;  3D31 A;  2YYZ A;  3K5L A;  4OO1 G;  1E2Z A;  4X3U A;  2IWH A;  1PRT D;  1SNC A;  2F1M A;  1GHK A;  3BG3 A;  4KN4 C;  3S1Q B;  1M8A A;  1VCI A;  3EQL C;  2AQ2 B;  3DEO A;  1JOR A;  1S5C D;  3MVV A;  1II3 A;  3LX0 A;  3P1H A;  1FNU A;  4K2K A;  1ZXT A;  1STB A;  4A3D B;  2CHB D;  1BQQ T;  2Q8T A;  4RA8 A;  1RTO A;  3CU7 A;  1JQY D;  2WIN B;  3X3N A;  1ONL A;  1NUC A;  1FR3 A;  3VR6 A;  2KHS A;  1SNP A;  5FLX L;  5DM7 3;  2DN8 A;  4DNT B;  2D62 A;  4ZLT F;  3RLF A;  1GUO A;  3NK9 A;  1IL8 A;  2A6E C;  1S5E D;  1WCM B;  1F9S A;  3BDL A;  2X69 A;  2J0T D;  4GZY C;  2KOL A;  1ESR A;  5I9P A;  2EYJ A;  5E4X A;  3NTI A;  4K8J A;  4ME5 A;  3D3R A;  2K5Q A;  5LL6 S;  1RKN A;  3M7N A;  3QG1 A;  3TME A;  5EKI A;  4IFD J;  5IT9 L;  5EKK A;  4PMB A;  2ZXR A;  4R8I A;  1GUG A;  2X6G A;  1Z47 A;  4B9W A;  1BCP D;  1I50 B;  1U4L A;  3S15 B;  1HTP A;  1A3T A;  3EJI A;  1IW7 D;  1ZYR C;  4RHR A;  4U67 3;  1EY7 A;  2Z8L A;  2H4O A;  1CA6 A;  1PRT B;  4KJN A;  4F88 A;  3BVM A;  1AEX A;  5IGF A;  4WRD A;  3PUV A;  2DY7 A;  4C3I B;  2PMZ B;  3ONA B;  1F77 A;  3BYT B;  3HG9 A;  3DWQ A;  5C44 B;  1K83 B;  3JAM E;  1BNZ A;  3K5M A;  2HCC A;  3NQI A;  2LFN A;  4K8I A;  2R6G A;  4HTH A;  4CKB A;  1SNO A;  5BN3 A;  4KJO A;  1T5X D;  3OIP A;  3DM1 A;  3CQZ B;  1TKW B;  1DZ1 A;  3A7A B;  3H94 A;  1QJO A;  5JEA H;  3M3Y B;  1KNE A;  3H6M A;  1DXM A;  1LT4 D;  4HCS A;  4DGZ A;  1HFG A;  2B8F A;  5G3L F;  1EYD A;  1ENA A;  3H09 A;  4CKC A;  3K59 A;  1DOM A;  3VR3 A;  4XT3 B;  3PUZ A;  4XQJ A;  1F2Z A;  2OT2 A;  1HUM A;  3SEB A;  1I6V C;  3OSO A;  2R3Z A;  1EYA A;  4NW2 A;  1VF7 A;  2NN6 H;  3GTL B;  1LO5 D;  5J22 A;  1BCP B;  4DK0 A;  2JYO A;  3H3V C;  4FVM A;  3I3C A;  1U4R A;  4ZAI A;  1U4M A;  4N9T A;  3I4N B;  3J80 L;  4ZUJ A;  2E2I B;  2M9V A;  4DF7 A;  2R7Z B;  1OO9 B;  5M5W B;  3FRP B;  3A8K E;  2A6H D;  1D1I A;  3U9S A;  1R4P B;  2IL8 A;  3HP3 A;  5COR A;  4ID6 A;  2O5J C;  3KBG A;  3PIO 3;  5M3M B;  3UI2 A;  1MBY A;  1SJH D;  2EPB A;  4EQO A;  5C0X H;  1PZJ D;  1AFP A;  4ZKB B;  1GOZ A;  1D5M C;  5I6Y A;  4G7H C;  3R2T A;  3ITP A;  1G2S A;  4OO1 H;  4IFD I;  1E2V A;  1I6H B;  3A7L A;  2BDO A;  2NTS A;  3I91 A;  1G6Z A;  3J7Y W;  3BDC A;  3R93 A;  1H9S B;  3H0G B;  1EY4 A;  1ET6 A;  1E0B A;  3S1R B;  1VMP A;  2ID0 A;  1SE4 A;  1NAP A;  2IX0 A;  5DEH A;  1SMY C;  1A3V A;  3FMC A;  2K5W A;  2PW5 A;  1O7L A;  2VB3 X;  5EGT A;  3HEJ A;  1Y1W B;  2RVL A;  1LTT D;  3Q23 A;  1JOK A;  3S9W A;  2B8G A;  3VYS A;  4KI0 A;  3OWE B;  3Q22 A;  4HN7 A;  3RMH A;  2RDF A;  2I07 B;  4J8Q A;  1ML0 D;  2R93 B;  2Q8R E;  4HR7 B;  1BF4 A;  4RH6 A;  1H9J A;  5C4X B;  3A56 A;  1D5X C;  1F9P A;  1BO0 A;  4LJZ C;  4A3J B;  4DAY A;  3HS0 C;  1CZG A;  4HMI A;  1UAP A;  2QIL A;  5I9O A;  1ENF A;  4IQZ A;  2E2H B;  3Q0A A;  3F2U A;  2WII B;  1DCZ A;  5K5P A;  4FF3 A;  3QWN A;  3L3O C;  3A8J E;  1S5D D;  3SDZ A;  2EDG A;  5JEA J;  1RCV D;  1T5E A;  1CI3 M;  4A3I B;  3DUZ A;  3HOU B;  4O42 A;  4I7Z C;  4PV1 C;  1MGS A;  2XWB B;  2F0W A;  2A69 D;  1PDQ A;  3GO5 A;  5CMD A;  5EPL A;  4DXF A;  5M9O A;  3GV6 A;  1YNJ D;  2JA5 B;  2LY7 A;  1R4Q B;  2MGS A;  2K7V A;  1SND A;  2MUY A;  1JWM D;  1D5Z C;  2AUJ D;  1KDC A;  1SXT A;  2EJF C;  1RHP A;  4QIW B;  3AB9 A;  4C3H B;  3D6C A;  2K33 A;  2F0D A;  3EVQ A;  1SYC A;  3IAY A;  1JC7 A;  1B53 A;  4BA2 I;  2B2U C;  4K14 A;  4QCL A;  4DU9 A;  5NUC A;  5ISR A;  1TS4 A;  5A2Q E;  1PFB A;  4HSP A;  4C3I G;  5CGK A;  4DK1 A;  1FNV A;  2VXW A;  3GTP B;  1MI2 A;  2RQX A;  3GTM B;  4IUP A;  4A93 B;  2WKD A;  1PMR A;  1Z7T A;  2SEB D;  1KAB A;  2L12 A;  1HQM C;  1QNK A;  3PUX A;  3PUW A;  3C3L A;  4KKU A;  1PFM A;  1H9M A;  1CQV A;  3FEW X;  2AWN A;  3P75 A;  1SAP A;  1OXU A;  2CW0 D;  1BXT A;  1H9K A;  5C0X J;  2B2U A;  3VR4 A;  4PNY A;  5M5Y B;  2F03 A;  2J7Z A;  3MFY A;  1QG7 A;  5LHY 1;  4A3M B;  1PZK D;  1VDZ A;  4ZKC B;  1EY6 A;  2CQA A;  3C1E A;  4G7Z C;  4DFA A;  1PTO H;  3BZD B;  3K5O A;  2F0J A;  5DAU A;  4KHZ A;  3R3O A;  1I4Q A;  5KEE A;  1WTR A;  2VNU D;  5CV8 A;  2XVS A;  1F2L A;  4RWS C;  1QE6 A;  2F0K A;  4B08 A;  5C4Z A;  3KLS A;  4R8N A;  1YNN D;  3MA2 B;  1R9T B;  2F0P A;  5JPM C;  2ZXP A;  2YU9 B;  3J7A V;  1LT5 D;  3OHX C;  3PUY A;  4K5W A;  3MFG A;  3K0Y A;  4RGM A;  2M00 A;  2HDL A;  1DON A;  1I4X A;  3X3M A;  4RHS A;  4RCN A;  3P7J A;  3MHB A;  3U9O A;  4UAI A;  3MXN A;  2LMC B;  3C46 A;  1SBB B;  5BN5 A;  4G7O C;  1G29 1;  4ODG A;  1A15 A;  2HQE A;  4PMC A;  5IGG A;  4TQU S;  2FFK B;  2BE5 D;  2KED A;  1EQV A;  1EEI D;  1W6K A;  1HRJ A;  4KD3 A;  3SK6 A;  1XYI A;  4MIU A;  2N88 A;  1F2Y A;  2VUM B;  3P20 A;  3DXJ C;  1WTQ A;  3VYT A;  4B9X A;  4XXE A;  2XNA C;  4X3S A;  1TVX A;  1RTN A;  2SNM A;  1WTW A;  1D6E C;  2KUM A;  3RZO B;  1PTO F;  3GTG B;  1SE2 A;  4Q5V A;  1SYB A;  2B2Y C;  3PV0 A;  4C56 C;  2HDM A;  1SJE D;  2FJ2 A;  3KUP A;  3D6W A;  5IOD A;  2TSS A;  2L9H A;  5K36 G;  1V1O A;  3QJY A;  4QUF A;  2XIW A;  1J9O A;  1MSH A;  3KBX A;  4HAE A;  3W3A A;  1I4P A;  5E4W C;  2IT1 A;  3J81 L;  3TSS A;  3NE5 B;  1CHP D;  4IN3 A;  5D65 A;  1O7Z A;  2OF1 A;  3RZD B;  1JWU D;  1V8Q A;  2K03 A;  1BDO A;  5JJZ A;  1Y8P B;  5C0X I;  4EGV A;  4BBS B;  4LAA A;  3A8I E;  4C3J G;  1RD9 D;  5FLX E;  1TY0 A;  2PQE A;  4OO1 I;  1B1Z A;  2KVM A;  1LAB A;  1BR9 A;  2B2Y A;  4C2M B;  1B2T A;  3V05 A;  2B39 A;  1SSO A;  1EY5 A;  2KJX A;  2F0I A;  1SYF A;  1SFO B;  1KDA A;  2F0V A;  5C5M A;  1S5B D;  4RGO S;  4FXG C;  5CBE E;  2R61 A;  2A74 C;  1C48 A;  3TBI B;  1EZ8 A;  1B44 D;  1ICW A;  3I4L A;  5C3X A;  1STN A;  3S1N B;  2GA4 B;  1B4O A;  2EY5 A;  3FDT A;  4BY7 B;  4XYQ A;  4ZK9 B;  4RKB A;  5C3W A;  5M5X B;  5IT9 E;  1HQR D;  3EFX D;  3NSW A;  3D4W A;  3IKJ A;  5KYI A;  3G7L A;  5E1F A;  1TWG B;  4A3E B;  4FF4 A;  1EY9 A;  3T4A C;  4KD4 A;  3VA5 A;  4C3H G;  2FMC A;  3TP5 A;  4K5V A;  2B63 B;  4K5X A;  1AP0 A;  5E3F A;  3VYU A;  2K28 A;  5T1G A;  3MTS A;  1EWC A;  2DNC A;  2E76 C;  3CHB D;  4WOR A;  3TP8 A;  5EQ0 A;  3HOV B;  2JA8 B;  4ULL A;  3AMU A;  4NDX A;  1PTO C;  2PW7 A;  2L4N A;  1V1P A;  1OXV A;  1AZQ A;  5KIX A;  1LLR D;  5ELD A;  1F9R A;  2TMP A;  3MC0 B;  5IGD A;  2IX1 A;  1Y8O B;  3NHH A;  3M7G A;  2A6E D;  1GUW A;  4ZYS A;  5KYL A;  1DOL A;  1WTX A;  3HOZ B;  2A68 C;  1B3A A;  1NR4 A;  1GJX A;  3K57 A;  3R8B A;  5CYU A;  1Q1E A;  3DMU A;  1EU3 A;  2MJ8 A;  4K6L A;  4CBV A;  2WAC A;  1STY A;  5ELE A;  3OMG A;  1Q90 A;  3NTK A;  2EYO A;  3V2T A;  3GP7 A;  4I65 A;  1A3U A;  5JVH 3;  1ZYR D;  4A3F B;  1XXG A;  2F0E A;  2XRQ D;  1EL0 A;  2BCO A;  2EJG C;  2L1B A;  1XTC D;  3BVZ A;  4LK1 C;  4MN3 A;  4EQN A;  2NVX B;  2F0U A;  4RGN A;  3C2P A;  2I46 A;  3J80 E;  4XTC S;  1DM0 B;  1IYV A;  2F3W A;  5CBA E;  5AFW A;  4R9W A;  4K6D A;  1K8M A;  4C1N I;  1TS3 A;  2EVB A;  2EZV A;  2WKC A;  4HCE A;  4Z9C B;  2K6A A;  4KN7 C;  3NBH A;  5ELC A;  5CR3 A;  3EA6 A;  2NYZ D;  4J6H A;  3VYR A;  1GUT A;  3SXH A;  1CA5 A;  3L7Z C;  4H13 C;  1J8I A;  2NUC A;  3QO2 A;  3PMF A;  1JE4 A;  3GQB A;  1UNS A;  1STE A;  2O5I C;  3NWT A;  1L0X B;  3DEP A;  3HKZ B;  2NBF A;  2F0Q A;  1LTR D;  1EU4 A;  1RF2 D;  2RDH A;  2L55 A;  3I72 A;  4V0B A;  3HOW B;  2AQ3 B;  2FIN B;  2PO4 A;  1O80 A;  2Y0S B;  3WDN A;  1I4R A;  1LTB D;  1SE3 A;  2AWO A;  3K6O A;  1KNA A;  5K36 H;  4HSV A;  5FO8 B;  1SEB D;  3C1F A;  2F0T A;  1BCP F;  2KCN A;  2NZ1 D;  4TSS A;  3MZ5 A;  5JVG 3;  4H7B A;  4XQQ A;  1PFN A;  3BVG A;  4FP5 D;  1LT3 D;  5FO7 B;  2L11 A;  1TQO A;  2ICE C;  2QDB A;  1F9Q A;  3S2D B;  4IUV A;  1Y69 U;  1PRT C;  1ROD A;  1LV9 A;  1IYU A;  3M4O B;  4NMZ A;  2E75 C;  4DA2 A;  1B9M A;  4OL7 A;  3NBI A;  4A3K B;  1S5F D;  4CGY B;  2BDN A;  5IGE A;  3OWF A;  1KTK A;  1OXS C;  2EOT A;  2K32 A;  3KLR A;  5KRU A;  1ENC A;  1QWY A;  2DY8 A;  1NCV A;  1SNQ A;  3BS1 A;  1HPC A;  1GHJ A;  1UUP A;  1TII D;  2PZU A;  1V43 A;  2IW3 A;  3QB3 A;  1X32 A;  1TY2 A;  2G9D A;  2JSO A;  5BN4 A;  1M4V A;  1EOT A;  3NP8 A;  1CFM A;  1SDF A;  4KY6 A;  1LTI D;  1KLG D;  4OHJ A;  1TWF B;  4DAV A;  2PCF B;  3IL8 A;  3S2H B;  4YIJ A;  1SMY D;  4JK1 C;  3KLS X;  1HUN A;  2KQ3 A;  4AYB B;  1GXD C;  5G3L D;  4KKT A;  4IAL A;  3WOF A;  1F2M A;  3NQT A;  4DAP A;  4QF4 A;  5KNB A;  2C9O A;  4OGQ C;  4L6T B;  3DWP A;  2K1B A;  3ERQ A;  2EYH A;  2A5H A;  5EJW A;  4L63 B;  5IIF A;  1C4Q A;  2DNE A;  2J4X A;  5EBD A;  5ELB A;  1BCP C;  3QIA A;  2X6L A;  5J1Z A;  4BA1 I;  3NWS A;  3MXG A;  3MWY W;  2BA1 A;  1IW7 C;  1DOK A;  5EKL A;  5CV4 A;  4F7X A;  1NR2 A;  1DYQ A;  3G6J B;  5LL6 X;  4FXK C;  4EQP A;  2ZT9 C;  1LTA D;  4HMJ A;  1RDP D;  2F4I A;  4FYD A;  1X3Q A;  3FKI B;  4PMW A;  2ZXO A;  1BOS A;  5CV6 A;  1A2T A;  2JEA I;  3NTH A;  5COY A;  1ZKO A;  1BBX C;  3S16 B;  4L8J A;  1CHQ D;  4XQN A;  1TWH B;  1PLF A;  4KHV A;  3GTJ B;  2WP8 J;  4Q0F A;  3SK5 A;  3K58 A;  1VMC A;  1LT6 D;  1CM9 A;  2E2D C;  3E5S A;  5IOC A;  4XYO A;  4QMG A;  1H9R A;  1SYD A;  2JA7 B;  2F0N A;  2XRS D;  3SR1 A;  1TU2 B;  4IZ8 A;  3MXP A;  5C6A A;  1Q12 A;  2KCC A;  3TN2 A;  1Q3L A;  2G9H D;  5JOB A;  4BWG B;  3I4M B;  2NN6 I;  1PYW D;  4C1N K;  4F87 A;  1WTV A;  5DNF A;  2V4D A;  2RBM A;  2QCP X;  4CJ0 B;  1C8C A;  5KND A;  1FD7 D;  1KLU D;  3T16 A;  3VR5 A;  3GTK B;  1XX8 A;  5KGU A;  1EQT A;  3FVQ A;  1U9R A;  5IGC A;  3HOX B;  1H9S A;  3N52 A;  4RGT A;  1HCZ A;  4U68 A;  3JAM L;  4G4K A;  4ZRZ A;  2MP1 A;  1EIG A;  1PXU A;  3LWU A;  3IFT A;  3SE0 A;  2A6H C;  2OEO A;  5C3E B;  1LTS D;  3RD4 A;  4LMQ D;  1TWC B;  1O7Y A;  3GTQ B;  2LKV A;  3VR2 A;  1EIH A;  2QF7 A;  3CKI B;  1ILP A;  3V96 A;  1JOO A;  4H44 C;  1LAC A;  2K04 A;  2RA4 A;  3QOL A;  3TDQ A;  2ICI A;  1G91 A;  1JIC A;  3Q24 A;  4DXG A;  2F0O A;  2BA0 A;  2B2T C;  3VA7 A;  1TS2 A;  4CHT B;  1D2B A;  5FOB B;  1I4H A;  1OXX K;  1S4Z A;  4DN4 M;  2RSO A;  2EXZ A;  4WFN 3;  5DM6 3;  3TP6 A;  2CVR A;  4MHE A;  2EYL A;  4A3B B;  3K5N A;  4OIJ A;  4E6I A;  3I90 A;  5CV5 A;  3DHQ A;  1WD0 A;  4BS9 A;  2D5D A;  3M85 A;  3J81 E;  3CRK C;  4O1N A;  3OIQ A;  1IHZ A;  5ELF A;  3HRZ C;  4IFD G;  1G8Z D;  2K5D A;  3MXU A;  2SNS A;  5I6W A;  1VF5 C;  2AQ1 B;  4H0L C;  2L5T A;  1TWA B;  1PZI D;  3ERO A;  3KF8 A;  2KA7 A;  1NSN S;  4X3K A;  5D3I B;  1CZW A;  3PO3 B;  2B2T A;  1QB5 D;  3IFD A;  4G57 A;  2IX3 A;  1QOH A;  1B9N A;  5EPK A;  3TZU A;  4TKO B;  2EE1 A;  3CRL C;  3E6Z X;  4IUU A;  4FXD A;  2JXM B;  2QKI C;  3LWE A;  3R2I A;  2R92 B;  3DWA A;  2IJ0 A;  2SDF A;  1HA6 A;  4KY5 A;  4NKL A;  5JPN C;  2F0F A;  3MAQ A;  2JP1 A;  1A6X A;  4M8A A;  1I4G A;  4KY7 A;  5I2X A;  1OXT A;  4P2C B;  2EYP A;  1D1K A;  3FPU B;  2O4X A;  1JR0 D;  3Q6S A;  3AU7 A;  4KKS A;  3D4D A;  1CK1 A;  2M2L A;  1JOQ A;  4M1U B;  3HZX A;  2E74 C;  2KEE A;  1XWE A;  1EY8 A;  2PNR C;  5CV7 A;  2A73 B;  2N55 A;  1EFI D;  1CQF A;  2K05 A;  3A55 A;  2A69 C;  3N6R A;  2RDG A;  1ET9 A;  1HA5 A;  2F3V A;  1STA A;  1YNJ C;  2O2L D;  3QOJ A;  4FNF A;  2Z4H A;  1WVL A;  2XSC A;  5CV9 A;  4KTA A;  2FHT A;  2D2C C;  1DD2 A;  2HUG A;  5FK9 C;  1CT1 D;  1PRT F;  1KDB A;  1STG A;  5HUR A;  1FYC A;  1Y8N B;  4K2L A;  4QUC A;  1ESF A;  1I3Q B;  5J39 A;  3T56 B;  3K7A B;  4KK7 A;  5C4J B;  5M3F B;  2PZT A;  4PQX A;  3OW7 A;  3ND9 A;  3S14 B;  1B50 A;  1GUN A;  1AZP A;  2D9U A;  1SNM A;  3OOC A;  1CTM A;  5TSS A;  5F2D A;  1HFN A;  1TT2 A;  1Y1V B;  5JAV A;  4KV6 A;  1G2T A;  2H1E A;  5C4H A;  2NVT B;  2SOB A;  3OPO A;  2FMM A;  1RJT A;  3M4Y A;  1EY0 A;  2CW0 C;  1HXY D;  3W2D A;  4IUR A;  1SYE A;  3GTO B;  1SYG A;  1DJR D;  3RUZ A;  2B2V C;  1X3P A;  2F0G A;  4JBW A;  5C5L A;  2EY2 A;  2Q8I B;  4CJ2 C;  4N9P A;  1FGB D;  1E2W A;  4J1M A;  5HGT A;  3OMC A;  2EY6 A;  2JEB I;  2OXP A;  1EYC A;  4XT1 B;  4TRD A;  2AUK A;  3GV3 A;  2F0L A;  5EPJ A;  2MPM A;  4BY1 B;  2EYF A;  3NPP A;  5I4D A;  4IUT A;  1PTO D;  2NTT A;  3I73 A;  3GD7 A;  3HOY B;  4OIK A;  4Y7N B;  2F0S A;  1ZEQ X;  4C3J B;  1WTP A;  5A2Q L;  3URY A;  1O78 A;  4WJW A;  4BBR B;  2B2V A;  2EYM A;  1YNN C;  4XDX A;  2WB1 B;  4S3S A;  3L9A X;  1EEF D;  3NUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...