2PQEA

Solution structure of proline-free mutant of staphylococcal nuclease
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
149
structure length
149
Chain Sequence
b'ATSTKKLHKEAATLIKAIDGDTVKLMYKGQAMTFRLLLVDTAETKHTKKGVEKYGAEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Restricted backbone conformational and motional flexibilities of loops containing peptidyl-proline bonds dominate the enzyme activity of staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 27
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pqeA00
5DAUA 5EGTA 5E3FA 4K14A 3LX0A 3NUCA 5I6YA 2OXPA 1JORA 1EY6A 4IZ8A 5CGKA 5IGDA 2EY2A 1EYAA 4ZUJA 3D6CA 3U9OA 1SYGA 4KY7A 5C3WA 5I9OA 5J39A 2F3VA 2PZTA 4F8MA 3TP8A 1KDCA 2F0DA 3P1HA 3P75A 1KDAA 3NHHA 1F2MA 3NXWA 4K2LA 3MVVA 1AEXA 3DHQA 3TMEA 5E1FA 5HGTA 2F0KA 1A2TA 1EYCA 1EQVA 1EY8A 4KV6A 4N9PA 3HEJA 5CV9A 2KHSA 4HMJA 3QOLA 1II3A 2F0LA 5IGCA 2EY6A 2PW5A 4DF7A 1TT2A 4NP5A 1KABA 2EYMA 2F0MA 3VA5A 4EQPA 2EYHA 4R8NA 5IGBA 4S3SA 4PNYA 5CV4A 5F2DA 5C6AA 3BDLA 4G57A 4B9XA 5J22A 1EY9A 3EJIA 3QOJA 3NK9A 4KD4A 4DGZA 5KYLA 3MZ5A 4MIUA 4K6DA 4HTHA 3SK5A 4B9WA 5J1ZA 2EY1A 2PZWA 1SYBA 2EYFA 5IGFA 3E5SA 4HMIA 3D8GA 5CV5A 1F2ZA 3S9WA 2RDFA 2EYJA 4PMCA 5NUCA 1JOQA 5K5PA 5EKLA 4F7XA 2RBMA 3TP6A 3ITPA 3MEHA 1EZ6A 2F0VA 3T13A 3TP5A 1STHA 1JOKA 1EY7A 4K8IA 1NUCA 4K5WA 5KYIA 3T16A 2PZUA 2PQEA 3R3OA 2SOBA 5KIXA 2OF1A 4YIJA 3PMFA 5CC4A 2F0WA 5DEHA 4DFAA 4KY5A 4WRDA 1SNDA 3C1FA 3OMGA 3SHLA 3OWFA 4LAAA 3SK8A 3C1EA 5IOCA 2F0NA 4QB4A 1NSNS 2RKSA 3MXPA 5M9OA 1RKNA 1STBA 4N9TA 4J6HA 4EQNA 4KD3A 5KEEA 5KRUA 1SYFA 4ZUIA 2EYOA 2F0HA 5HURA 1A2UA 1KAAA 2EY5A 2KQ3A 5C5LA 3ERQA 3H6MA 5C4ZA 3SK4A 1JOOA 2O4XA 3D4WA 3NQTA 4RKLA 5C5MA 4I65A 5C4HA 1A3TA 2F0OA 2F3WA 4E6IA 5I9PA 4ME5A 2QDBA 4QMGA 1STYA 4KJOA 4KHVA 3QB3A 5KGUA 2HQEA 2F0FA 1EY0A 4K2KA 1ENCA 2SNMA 4EVOA 5IGGA 4NMZA 1STAA 3MHBA 3OMCA 1ENAA 2ENBA 5CV6A 1SNMA 4K5VA 1U9RA 4RKBA 3HZXA 3D4DA 4DU9A 1SYCA 2PW7A 1SNQA 1SYDA 2PYKA 1EY5A 5JOBA 4ZQ3A 2LKVA 1TR5A 1STGA 2SNSA 3DMUA 2F0IA 2M00A 4ID6A 4IALA 4KTAA 4KY6A 2OEOA 4NDXA 3RUZA 4ODGA 5C3XA 5I6WA 2EYLA 5ISRA 5IGEA 1EY4A 3SR1A 3BDCA 3NP8A 4J1MA 4OL7A 2F0PA 4TRDA 1EZ8A 5JAVA 2EXZA 2F0QA 1F2YA 1A3UA 3EROA 1SNOA 4NKLA 2F0UA 5EKKA 1IHZA 1EYDA 1KDBA 2F0EA 1A3VA 4H7BA 4KJNA 3SK6A 1SYEA 1SNPA 4PMBA 4IUNA 4K8JA 4QF4A 5IODA 5IIFA 3TP7A 1STNA 2F0JA 3SXHA 1TQOA 2WACA 2F0SA 4WORA 2NUCA 5CV7A 4K5XA 4EQOA 3EVQA 2EYPA 5CR3A 5CV8A 2F0TA 3OSOA 3V2TA 1SNCA 2F0GA
chains in the Genus database with same CATH superfamily
4Q5VA 2WINB 2HIVA 4OO1H 2LFNA 1GUOA 1H9SB 1G6ZA 4ZLTF 5JJKA 3GTPB 2CWAA 1QVGA 4TSSA 4DV2Q 3MVVA 1AEXA 3PGZA 4LUOA 3TMEA 4GN3B 1O7YA 3FP9A 3LWUA 5ELDA 4RCOA 1KIXA 3ND8A 3DWAA 1DCZA 1VMCA 3S24A 4DXGA 1VQLA 1Y8OB 1Q3LA 1YEZA 4LF8L 4WJ4A 2LXJA 1IW7C 2R7ZH 1WOCA 1ET6A 3EJIA 1CI3M 1HZCA 4HTHA 1KLUD 5M3FG 2EOTA 2EJGC 3RD4A 4L5SA 3VYUA 3GTLB 3R2TA 3MFGA 1ENFA 4KKSA 1B53A 4LF8Q 5JVG3 1S5DD 2A6HC 1HNZL 4M1UB 1PTOC 4A76A 2GVAA 4A3DB 2O5JC 5IOCA 2PQAA 5C0XH 1LT3D 3I56A 1Y1WH 5IYDG 1B70B 2JA6H 5JEAG 2F0HA 4DV1L 1XPRA 2HT1A 4LFBL 2DY8A 4ULLA 1JB3A 5C4ZA 1AZQA 1HNZQ 4JW0A 4X64Q 4B3TL 3J7AF 3HKZB 1TS3A 1O80A 1N33L 1EY0A 4XT3B 4LNQA 5H1SE 4JVZA 3KLRA 3H15A 1GM5A 1SNMA 1XNRL 2CHBD 4JBKA 1H9SA 1ESFA 5KNDA 4DV1Q 4A3KH 3GTOB 1K9MC 3L9AX 3M9BA 5FLXE 1DOMA 1XWEA 4ZQ3A 1STGA 1BNZA 1UEAB 1BCPC 4GOPB 3KLWA 2B2TA 1N33Q 2NTSA 1EZ8A 4IJLA 4JOIC 1I94L 2EVBA 4DAMA 3K80C 1XNRQ 1IHZA 3FDTA 2RSNA 4DK3C 1HUMA 4A4IA 4KI0A 4A3JH 2V4DA 2F0JA 1KRTA 3JAME 4NXML 2NUCA 2VUMH 3R2IA 1Y8PB 4K14A 2NVYH 3NUCA 1I94Q 2XWJB 1VQ4A 4A75A 1Q81C 3R93A 1TS4A 2NZOA 4FDBA 1K3RA 2OT2A 1DOLA 2JEBI 4YCVA 3M7GA 1KNEA 3P75A 4NXMQ 1EFID 1EY8A 2OQ0A 4UAIA 5LL6X 1LLRD 1PFNA 2G5DA 3HOWH 2NN6G 1WTHA 4QQBX 3CCLA 4LFCL 4XDXA 3GDEA 2PI2E 3K5LA 3Q0AA 2QGQA 2PNRC 1PMRA 3H3VC 4MIUA 1SLJA 2K5WA 4B9WA 1IXRA 3UE1A 4HR7B 5IP7G 5IGFA 5FO9B 2A6ED 1NR2A 3P7JA 1A6XA 3ER0A 1YNND 1PTOF 4LFCQ 1UWVA 3GTMB 3WOEA 2WB1B 2WB1E 4YIJA 3PUVA 3H3VH 4IURA 1YNXA 1M90C 4A3LG 3X3MA 1ICFB 4KD3A 2ZM6L 4V190 5FKAC 4DNTB 3A7AB 1JE5A 2X69A 2B63G 3J80c 1NAPA 3FKIH 2UU9L 2R93G 4KHVA 3HOVG 1BF4A 1YJ9A 2Q2HA 3P20A 2KA7A 2ZM6Q 1K8GA 1SNQA 2B2WA 2KOLA 5M3MB 3DMUA 3CC7A 2GVBA 2UU9Q 3KFUA 2NVXH 2BE5D 1C8CA 2E8GA 3SR1A 2K50A 1EEID 4YCUA 4M8AA 3U4ZA 4C3HB 2EQSA 1T5EA 3F2BA 4DPGA 2WAQB 4DV6L 1MHWC 3PV0A 2E75C 3RMHA 2FJ2A 3GTGB 1EIYB 2XSCA 1G291 1K73C 2PI2A 2JA6B 2UXDL 2K33A 2F3IA 1MKHA 1SMYC 3E9HA 3PO3H 3V2TA 1PH8A 1HUNA 2F0TA 4LAAA 1QNKA 5DAUA 1PTOB 4DV3L 5I6YA 4DV6Q 1SYGA 2EE1A 2MHVA 3STBD 1H9MA 1IBML 2RCFA 2UXDQ 1HNWQ 3R8BA 4A3KB 3HOYH 4PZ7A 1CKNB 4JI5L 1FNUA 2JN4A 2CH4A 2F0KA 4DV3Q 1YIJA 4UDUC 1VQ9A 1M4VA 1B3QA 2OCEA 1NJIC 2FXQA 3O13A 1TT2A 2A5HA 1SN8A 1D7QA 2EYHA 4OIJA 2AUJD 5A2QL 3UDGA 2KHJA 1A8VA 1Q46A 5J22A 3T1HL 4JI5Q 2Y0SE 3H94A 2A8VA 3HOUH 1PVOA 2KCTA 3S14H 1BCPB 2PZWA 4OIKA 1G51A 3AQQA 1F9SA 1H9JA 3H0GB 3S9WA 2F4VL 1EWHA 2F0VA 3T13A 1SSOA 1E22A 3OHXC 1EY7A 1NUCA 1C9OA 1VQ5A 2HHHL 1IBKL 2IX3A 3T1HQ 2F0WA 1K28A 3C1FA 3SHLA 1EU4A 1DM0B 1PYSB 1TWAB 1UAPA 3OIQA 2RKSA 3DLLA 1X3GA 4MZ9A 1X9NA 2F4VQ 5M5XH 2KQ3A 2CFMA 4JI4L 4FVMA 4AQYQ 2HHHQ 1IBKQ 3K57A 1Q12A 2QDBA 5HY6A 4R4TA 1VQOA 3QB3A 1QJOA 3I4OA 3L2PA 1LTID 4K2KA 1ENCA 1U4RA 1XTDA 3G71A 1F77A 3PIPA 4GLXA 4A3EB 2ICEC 3AFPA 4DK1A 1P16A 1VS0A 2RA4A 1QVFA 2M00A 4ID6A 1SDFA 2JEAI 4KKUA 1CKNA 3T56B 4FXDA 4A3GB 1EU3A 4F87A 2WV6D 3Q24A 2NZ1D 2NN6I 2EXZA 3I70A 1SAPA 3AEVA 3MFYA 3QWNA 2F0UA 2CKZB 1SNPA 2Q2TA 2XRSD 2IHEA 3VYSA 1Y1VG 3DWPA 2XRQD 1PA6A 3J7A5 4BXXG 2WACA 4WORA 3KUPA 5T1IA 2OXPA 2JA8B 1O7IA 1TWGB 2RHQB 2RDHA 2K32A 5I9OA 3BZCA 3S2HH 3HOZH 4A93G 3K58A 3PF5A 1KDCA 4IOAA 4HSPA 3OOCA 4F88A 1I6VC 3RNUA 2VS1A 3M4YA 1TS5A 4TKOB 2Q2IA 2HIXA 3HEJA 5CV9A 2PPBC 3CAMA 4DXFA 2M9VA 3HOXB 2A69D 5C3EG 2B39A 4DV7L 1OXSC 2EYMA 1H9KA 4S3SA 3N52A 3KJOA 2KENA 3S17H 2AUKA 4APVA 4MN3A 1OXUA 4JPBW 5G3LF 3S16H 4OO1G 1NCVA 3JC66 3T53B 1B3AA 4QCLA 4DV0L 2WB1G 3D8GA 1ZEQX 1F2ZA 3QG1A 5CV5A 2RDFA 4ABNA 2AHOB 2E2HH 4V0BA 2ZXOA 3T51B 4DV7Q 4K8IA 4K5WA 3MAQA 1BR9A 3R3OA 1ZKOA 3M85A 2QA4A 2L15A 5CC4A 3J81E 3TDQA 2OWOA 1DYQA 2RCNA 3HOYB 3C1EA 1XTCD 4DV0Q 1R9TH 5M9OA 1S40A 1LTTD 5C4XH 4AH6A 1JE4A 2R93H 2R7ZG 5KNCA 1PZKD 5FK9C 2F3WA 4UHVA 3S1RH 1VQMA 4ME5A 3S1MH 3SGIA 3W1GA 4G4KA 4L6TB 5M3FB 3WWVA 1SXTA 1JICA 2SNMA 3FVQA 4XQQA 2E2IH 1HA6A 1ENAA 3UDIA 1DJRD 5FJ8H 3HOUB 1E2VA 3CKIB 3DEPA 3JAMi 1PLFA 3OTOL 1HJPA 2E74C 2F0IA 4O2DA 4IUQA 1IKLA 1V43A 1F9RA 4OL7A 3WOFA 5C0XG 2E2JB 3GV6A 2E2DC 4QL5A 1NR4A 1Y1WG 2JA6G 4JI3L 1Q1EA 2BH8A 1EYDA 2B2TC 4R4CA 3I91A 3RLOA 1SYEA 4R8IA 1SJHD 2MGSA 3RLFA 4XXEA 3J80L 3OTOQ 4HJAA 2D62A 3E9IA 4FO2A 5M5XB 1XMOL 2ATWA 3ULLA 2KHIA 5FLXc 3H09A 4R4OA 5EGTA 5E3FA 4JI3Q 1PRTF 2BA1A 5I2YA 3GTKH 1RF2D 4A3KG 2ZXPA 3D6CA 3EN2A 3SE0A 5C3WA 4JI7L 1XMOQ 1A63A 3NHHA 1B2TA 3DM3A 1U0LA 1HZAA 3MXNB 5CMDA 1D5ZC 2L9HA 3K6OA 4PV1C 4DF7A 2Y0SG 4FF4A 4TVAB 3CCMA 3UI2A 4JI7Q 4A3JG 3CCEA 4IFDI 4R8NA 4CJ0B 1LM0A 4LW1A 4ZAIA 3SEBA 2IW3A 5HGQA 5F2DA 2VUMG 1BQQT 3MXGA 2IL8A 3QOJA 1D1KA 3PIO3 1QZHA 3L7ZC 4IPCA 3GV3A 3CXCA 4BWGB 4FF1A 1PFSA 2VW9A 4BBRH 2XWBB 1PYBA 4RFBA 1JMCA 1STHA 2KUMA 4J15A 1X6OA 1EFWA 2Q8RE 3HOZB 5IT9L 4DR2L 5L37A 3FPPA 4UP7A 4IQZA 5ELEA 2EDGA 5COYA 1QG7A 3HOWG 3L0OA 1VQBA 2ZTEA 1HA5A 1VQIA 1PH3A 1KAAA 4PZ6A 2AQ1B 3H6MA 1WD0A 4DR7Q 1NMFA 5C5MA 4QGUA 2X6GA 4CBVA 4DR2Q 3U50C 4BS9A 2K03A 3VDYA 1Q1BA 2RQXA 3S17B 5K36G 2ENBA 1C0AA 4RKBA 3S16B 1BBXC 3NWSA 4C3JH 2F52A 4ZRZA 4C1NK 4C2MB 4H02A 3I90A 4NB3A 2E2HB 1R4PB 2EYLA 1Y69U 1GUSA 2F0PA 2PCFB 5JAVA 1TXYA 1U4MA 4L5QA 1F2YA 4P75A 1Y1VH 4H7BA 1MI2A 2B29A 3E3XA 1D6EC 3I7FA 3FKIG 1PH4A 2MO0A 2B63B 5M5YH 5C4XB 4MNOA 2NVTH 2VY3A 1ESRA 2R93B 5D65A 3TS0A 5CR3A 4HIMA 3LX0A 4BBSH 4IZ8A 3DWQA 4UY8C 4YY3Q 5J39A 1UNSA 2E2IB 3BG3A 2PNHA 3AB9A 4JYAL 4RGOS 2Q8TA 1BOSA 4R1JA 1VMPA 4IPGA 4HSVA 3HG9A 1U4PA 1XX8A 5ELOA 1Z47A 5IGCA 1DD2A 3BVMA 1PH2A 4JYAQ 3NWTA 2JYOA 2Z4IA 5JPMC 3PO3G 1LTSD 2TMPA 4DNIA 3C3LA 1VQCA 4KD4A 3CC2A 5FO8B 1GVPA 1YBYA 3OWEB 1SYBA 3IKJA 2NVQH 3S15B 2JA9A 1KXLA 1PV4A 5D14A 3GTKB 3HOYG 4JG2A 2PQEA 1QUQB 5C0XI 1XPOA 4Y52H 4DFAA 3K5MA 3K7AB 1FD7D 5J3BA 3NSWA 3M7NA 1TVXA 1LACA 2EY5A 3I8ZA 5C5LA 3ERQA 4I65A 5I9PA 3HOUG 1VQHA 1S72A 1JJGA 5IGGA 2NZHA 2DN8A 2NBFA 1MSHA 1EYGA 1U9RA 1QCBD 4IFDJ 1Q82C 4RGTA 4DU9A 2B8FA 4L63B 1MBYA 1VDZA 2BOSA 4IUUA 1GHJA 4BBRB 1EY4A 2VZAA 2ZTDA 1UUPA 2K5QA 5JJZA 4KK7A 4QIWE 1XYIA 4RGNA 4NKLA 4CDCC 5JVH3 4HIKA 1G91A 1WTXA 4GNXA 1GHKA 4BY1H 1J8IA 4L5RC 4EQOA 4CDFC 3MXUA 1EIFA 2K5VA 3TEHB 3TZDA 4LFBQ 1E2ZA 5IWAL 2FHTA 3HFZB 4GN4B 2JA5H 2DY7A 3D31A 4B3TQ 4GKKL 3NENA 4LF5L 1JR0D 1RHPA 1PTOD 4ME3A 5ELBA 1RTNA 4DUZL 1QUQA 2F0DA 5IY0A 3GTJH 2CQOA 2C9OA 4KHZA 5IWAQ 1XNQL 4B3RL 5IP9H 2AWOA 4GKKQ 2BDNA 1L0YB 4LF5Q 1A0IA 1PXUA 3G6EA 1Y1VB 3PUXA 3J81i 2LSSA 2PO4A 5FLXL 1CSQA 4XTCS 3DUZA 3MZ5A 3I2ZA 1XNQQ 4B3RQ 2NVTB 2A68D 1I4GA 5NUCA 3HOZG 3H3VI 3MEFA 3AYHB 1E1TA 4A93B 1X54A 3T16A 2QILA 2SOBA 2UUAL 3EBEA 1JC7A 4CDDC 2A6EC 5DEHA 4LK1C 1ASZA 4C56C 4POGA 3NBHB 2OTJA 1NE3A 4OONA 5ELNA 1IYJB 1STBA 5EPKA 5KEEA 2OQKA 3S1QB 4X3KA 5C3EB 1HTPA 3BZDB 2GA4B 3V96A 3KF6A 1HTLD 4E6IA 2UUAQ 3ULPA 1G6PA 1V9PA 5K36H 2MQHA 1JT8A 2NB0A 2I07B 2B8GA 2AKWB 2KCCA 1V1PB 4CKCA 1DZ1A 1WTQA 3KBGA 1VQ7A 4HEDA 4FF3A 1KQSA 2NVQB 3CF5A 3GTQH 4EX5A 1G2SA 1TY0A 2OEOA 2VB3X 3PCOB 1CA6A 2YV5A 4X65L 1W2BA 1X55A 5C4XG 4GS3A 3SK6A 1Q90A 3E6ZX 2BE5C 1JQYD 5C0XJ 1V1QA 3ICEA 3RZDH 1PZID 2R7ZB 2LMCB 3A74A 3TBIB 3NTHA 1FR3A 2LY7A 4JV5L 5CV8A 3E0EA 3VA7A 1L0WA 2Q8IB 4X65Q 3QIAA 1J9OA 1HRJA 5FJ8G 1JORA 1BCPF 1B4OA 2JA7H 1DOKA 2G9DA 2Z1CA 4JV5Q 4JK1C 4X6AH 5E1FA 3NBHA 1I50H 4WFN3 1Y1WB 4ZKBB 1HFGA 1QNUA 1JWMD 3IRBA 1QE6A 4XQNA 3VR2A 1H95A 3W5OA 1IZ6A 4HJ7A 4EQPA 5IGBA 4Q0FA 4PNYA 2CVRA 1EY9A 3VYRA 2K5DA 1ONLA 4FNFA 5FLMH 2R6GA 2DJGC 3I4MH 2UXCL 1HQRD 2YU9H 1V1PA 3CU7A 4IPHA 1ZYRC 5IT9c 3PUZA 2JA5B 2HUGA 4LF7L 3LGJA 1K8AC 1LTAD 2XTIA 5A2QE 1S3OA 2JQOA 2B2YA 1HXYD 3KK7A 1IBMQ 3CC4A 2B2VC 4LMQD 2UXCQ 5KRUA 1LABA 4J6HA 4P2CB 3KDFA 2Y0SB 5GQOA 4DA2A 4A3JB 4LF7Q 2O4XA 4GKJL 1VQ8A 5C4HA 1HZ9A 5ELCA 2VUMB 1X56A 4QMGA 4KJOA 3HKSA 2K5HA 4KN7C 2HQEA 2NVYB 4DK6C 2L12A 2EIFA 3URYA 1STAA 4BBRG 4L5TA 3DM1A 2WKDA 3CD6A 4DK0A 2IT1A 1HQMC 3NTIA 3BS1A 3WDNA 2K75A 3HP3A 4NDXA 3RUZA 4DV4L 1I4XA 1QWYA 1ML0D 4J1MA 2K5NA 1BBUA 3J7YW 1B1ZA 4XT1B 4JC0A 3HOWB 2MPMA 3LWEA 1PFMA 2R61A 1WD1A 1IL8A 3CCUA 1E7ZA 1F9PA 1CZWA 1Z6HA 1PFBA 2Z6KC 4OEMB 1D5MC 4DV4Q 4ZK9B 2KBNA 2EYPA 1TWHH 1SNCA 2F0GA 5G3LD 2XIWA 1FNVA 3MA2B 4JI4Q 1NBWA 3MWYW 1XPUA 4C3JG 2EY2A 1H9RA 3CPFA 1UE6A 2ZJQA 2QDLA 1SEBD 4YHHL 1VQ6A 4F8MA 4G7OC 1JJCB 1QZGA 2UXBL 2K01A 2AQ2B 2Z4HA 2ASBA 2ZJPA 3SDZA 5HGTA 1OXVA 3GTQB 1CFMA 5C4JH 4RCNA 2H5XA 2KHSA 1II3A 2XGTA 1BKBA 1KAWA 2HDMA 4YHHQ 4NXNL 1VQPA 3VA5A 2XVSA 4B3SL 4A3BG 3FKIB 2UXBQ 1WCMH 1W3SA 1L0XB 1YNJC 4P74A 4DAYB 3RZDB 2A69C 2D5DA 4BY7H 4BBSG 2QEXA 1YI2A 4IO9A 1EUJA 1S5FD 3D4RA 2JXMB 4P72A 4PMCA 3IFDA 4POFA 5IYCH 4NXNQ 1DXMA 4B3SQ 2B2UA 3I73A 1TWFH 1S5BD 1CHQD 1XXGA 3CQZH 2NVXB 3K8AA 4QJFA 3U4VA 4B08A 4KY5A 1CKMA 5E7NA 2BDOA 3GP7A 4RHRA 2L11A 4U673 3M3YH 3S1NH 2AWNA 3F2CA 4N9TA 1I50B 2JSOA 3K5OA 1PH9A 1X3QA 5JJLA 1AE3A 5CBAE 1X3PA 3PO3B 3QJYA 1CKOA 4TQUS 1C4QA 2SEBD 4OELB 3KBXA 1PRTD 2J0TD 2HQLA 1CQVA 3A8IE 1SRUA 3I4MB 1DGSA 4A3MH 2ALYB 1VQNA 1RDPD 3BJUA 1B50A 1WYDA 1GD7A 1K3BC 4DKAC 5C44H 1GOZA 3LNNA 4H44C 2UUCL 1CQFA 2KEEA 3D6WA 5JEAJ 4CHTB 1PH7A 4HN7A 3HS0C 4Z9CB 3DEOA 1TIID 1LT6D 5CV7A 4DAYA 1GO3E 2K14A 4GNXC 1HNXL 3S14B 5AFWA 1GUNA 3ERSX 1ASYA 1YJNA 2UUCQ 4HCEA 1FL0A 2IPKD 4KLKA 3A5ZB 4IUPA 3I4NH 1LUZA 4K0KL 3TP8A 3P1HA 1T9HA 2N3SA 3J80E 1B9MA 1TU2B 1KD1C 3NXWA 1HNXQ 2ZXRA 3CP0A 4DR3L 2KJXA 2F1MA 4HMJA 3HRZC 2RDGA 4BY1G 5DNFA 4K0KQ 2F0MA 2R7FA 5JJIA 1B9NA 4FF2A 2AMCB 3Q23A 1LTBD 2K28A 4A3FH 5LMNL 3BDLA 4HJ9A 4B9XA 4X3UA 3NK9A 5KYLA 2R92H 5BN5A 4DR3Q 4FYDA 1KL9A 3TZUA 4RAUC 1JWUD 2N49A 2JA5G 2I5MX 2RHSB 1FNWA 2O2LD 1HZBA 3HGBA 4F7XA 5IGEA 3TP6A 3ITPA 3PQIA 1EZ6A 3V05A 1EWIA 1EOVA 5KYIA 3GTPH 3JAMc 3A56A 3G4SA 5LMNQ 1M8AA 4KHPL 1BBWA 1SNDA 4OXPA 5IP9G 2JJQA 1IYUA 1N34L 3MXPA 3CCSA 4CJ1B 3PO2H 1K0SA 2WFWA 4HIOA 2EYOA 4B3ML 3K7UC 1KNAA 1WJJA 5D3DA 2F0OA 1VQDA 4KHPQ 5KGUA 1PHJA 1UE5A 4EQ5A 2F0FA 3GD7A 4O0AA 3NE5B 1N34Q 5CV6A 4UPAA 3K0YA 4BY7B 3D4DA 1Q8IA 2B2VA 4C3IG 4B3MQ 3S2HB 1Q7YC 1SBBB 2QF7A 1IYVA 3PIP3 4ODGA 5C3XA 4DR6L 4DV5L 4A3DH 1IL2A 1MJEA 4XIGS 5EKKA 2F0EA 1KDBA 3MC0B 2ID0A 4PMBA 1VCIA 3SVMA 1RJTA 3S1NB 5IIFA 4JBMA 2F0SA 2HCIA 1GUWA 2HD3A 1SE2A 3BYTB 4X66L 3KOJA 2BH2A 5CORA 3Q22A 4RG1A 1ZXTA 4PG3A 2VQEL 5CGKA 4MTKA 5IGDA 4ZUJA 1EYAA 1HHVA 1VQAA 4IFDH 4CGYB 1N8RC 3GTOH 3G6JB 1HR0L 4A3MB 1U5KA 2Z6KA 4X66Q 2KECA 1A2TA 4KV6A 3A54A 1R9TB 1CA5A 4N9PA 2VQEQ 1FGUA 4OO1I 4KN4C 1AE2A 4A3BH 2A73B 1X3FA 4OX9L 1KABA 1VF5C 4IN3A 4BA1I 2MO1A 1F9QA 2CW0D 1HR0Q 1IKMA 3S1RB 3S1MB 5C6AA 3FHWA 4RH6A 1SFOH 4EGVA 3VR5A 1CK1A 4R4IA 5IYBH 2ES2A 2EY1A 2EJFC 2QKIC 5A35A 3I72A 2FINB 1MIUA 2JA7G 4PQXA 1WTWA 1D2BA 5EKLA 1WI5A 2RBMA 1JOKA 2K05A 2I5LX 3I4NB 1C48A 3BVZA 1D1IA 2IX1A 3D0FA 3SK8A 4YCWA 3GQBA 3QR8A 4GNXB 1EL0A 2B2YC 1K8MA 1A2UA 3NPPA 1WTOA 3S2DH 4IUTA 4LFAL 5E4WC 4A3IH 5FLMG 4WJ3M 3A8JE 1A62A 1VQKA 3I4MG 1I3QH 2YTYA 4DAPA 5BN3A 2K6AA 5LMNW 2FMCA 2G9HD 3HZXA 3VYTA 1SE8A 2ZTCA 4LWCA 1SYDA 4U68A 5JOBA 1MJCA 4LFAQ 2BCOA 1JWSD 3GTMH 3FRPB 1HFNA 2DNCA 2OTLA 2X6LA 3CRKC 3T1YL 1O78A 5GROA 2MFIA 3RN2A 3BYYB 1N9WA 3TSSA 3CMAA 3DXJC 3I4LA 1TKWB 3PO2B 2ZT9C 1STNA 1OXTA 1F2LA 4EVOA 2WIIB 3EA6A 1Y8NB 4XQJA 3KLSA 3T1YQ 4YWKA 1PH6A 3KLSX 4QUFA 4OWTB 4KKTA 4QY7A 4XYOA 3BDOA 4CKEA 1W6KA 2MNAA 2PZTA 2YTVA 5M3MH 4QIWB 2A1AA 5KNBA 1KDAA 5FO7B 5LMUL 3DHQA 5BR8L 2L5TA 1TY2A 3BU2A 4C3HH 3CCQA 1IW7D 4X64L 3KF6B 4UP8A 3QOLA 2YYZA 2CCZA 1X65A 3GTGH 2JE6I 3BZKA 1SE4A 1PZJD 1YZ6A 3B6YA 4ZCKA 1YJWA 4DUYL 1G2TA 5LMUQ 1J5EL 5BR8Q 3SK5A 3KF8A 4YWLA 1V1OA 2A6HD 4RMFA 5J1ZA 1OXXK 1PTOH 3K81C 1LTRD 3HKZE 4DN4M 4C3JB 5LL6S 2GN5A 3K5NA 2IY5B 2N78A 4JI8L 2DNEA 1I4QA 1NY4A 1E1OA 1E3PA 4DUYQ 3PMFA 5E4XA 5FOBB 2B2UC 2A68C 1VF7A 1J5EQ 4LUZA 1NMGA 3MTSA 3U58A 4QB4A 1HR0W 4DUZQ 5CBEE 1D5XC 1NNXA 4RHSA 1SYFA 1PYWD 2VXWA 4JI8Q 1WCMG 5M5YB 3SK4A 1JOOA 3VR6A 4RKLA 4AYBG 4A3BB 1BO0A 2A19A 4BY7G 4ZYSA 2VNUD 2IX0A 3FMCA 4JI1L 5BN4A 4BBSB 4C3IH 3J81j 1JJ2A 1SFOB 3A8KE 1BCPD 5IYCG 3H0GH 1I4RA 2R7DA 2RF4A 1TWCH 4HCSA 3U9SA 3JAML 1AW7A 1YNNC 2HDLA 4X62L 5I6WA 1EIGA 3IAYA 3RLNA 4JI1Q 1YITA 3NP8A 3G7LA 5EKIA 4NPSA 1VQEA 2TSSA 1TWAH 5GAEC 2L55A 1KC8C 4I7ZC 2ZJRA 3T4AC 2VQFL 1S5CD 1PDQA 4N8FA 3J80i 4RWSC 5IODA 4OWWB 3TP7A 4LF9L 1QOHA 2F03A 3SXHA 3J81c 1DONA 4X62Q 3S2DB 1HH2P 3EVQA 2DGYA 4A3IB 2KEDA 4XYQA 3ZJYC 1T5XD 3OIPA 1LO5D 1RODA 4FP5D 5M5WH 3A55A 4A3EH 1I3QB 2VQFQ 4A3MG 1SJED 3RN5A 3FPUB 4LF9Q 2K4KA 1O7ZA 2BA0A 4MHEA 1KRSA 3CCJA 4O1NA 2AQ3B 5C44G 4A3GH 1OTCA 3TN2A 3KDFB 2IWHA 3AMUA 1KTKA 3D3RA 1SR3A 4GOPA 1I6HH 4GLAC 3F2UA 4HJ8A 4A3CH 3J7ZC 2V1CC 4UP9A 3AU7A 5EBCA 2L4NA 4FXGC 3NEMA 2JA8H 2K7VA 4LUVA 3CMEA 1TWGH 3E5SA 3I4NG 3GO5A 1E24A 1L1OC 3STBC 3TQYA 1Y14B 5GAGC 2KCMA 3UE0A 2I0QA 2FMMA 4ILWA 4GN5A 2ICIA 5EAYA 4DR1L 1NSNS 4ALPA 4OHJA 2QW7A 5HURA 4DAVA 3CHBD 3HOXH 4IPDA 4BY1B 2EPBA 4A3FG 1B8AA 4CDEC 3NQTA 4X3SA 2LS01 2RVLA 4RA8A 2EZVA 2R92G 2WAQE 2XN9C 1STYA 1N32L 5I4DA 4JI6L 4CKBA 4DR1Q 1HNWL 3M4QA 4DR4L 4P73A 1I5FA 1FGBD 2PYKA 1RTOA 2H1EA 3ULJA 2A74C 2D0OA 1L2FA 2N88A 3GTJB 3EIVA 4JI0L 3QO2A 3AFQA 1N32Q 4OGQC 1WFQA 5ELFA 4JI6Q 4WJWA 3PO2G 4DR4Q 2F0QA 1A3UA 3TRZA 1V8QA 1SMYD 3PSIA 4JBJA 4KJNA 5TSSA 2EJMA 2PMZB 1LT4D 3OW2A 2PMZE 4K8JA 2D9UA 2K1BA 2L1BA 4JI0Q 1TQOA 2VB2X 5JPNC 1E2WA 4X3TA 5M3FH 5I2XA 1EY6A 4GKJQ 1LYLA 1AH9A 1EEFD 1U4LA 1ZYRD 3KYHC 2F3VA 4C3IB 1BDOA 4Y7NH 1CTMA 3NBIA 2N8NA 4IJHA 1G8ZD 3N6RA 4NW2A 1TWCB 1F2MA 4A3DG 5DM73 3VR3A 1BVSA 2DJFC 4AQYL 3Q8DA 1EQVA 1VQJA 2E2JH 2JP1A 4ZKCB 1RL2A 3PIOA 2YTXA 5IYDH 5JEAH 1I4HA 1WTPA 2N55A 3HKZG 4OWXB 4K6DA 2F4IA 2MP1A 5DM63 1STEA 2EYFA 4HMIA 1BXTA 1LTGD 2QCPX 4KMUC 4HJ5A 1CSPA 3M4OH 4IFDG 3UDXA 1JCKB 4G7ZC 1B7YB 2WKCA 1JOQA 3TP5A 2M2LA 1P8LA 5M5WB 5KIXA 1D8LA 4WRDA 1XMQL 1LV9A 3OWFA 2F0NA 3BVGA 4O42A 1I6HB 1R4QB 2UUBL 1NTGA 1BUVT 3NELA 5IYBG 1XMQQ 5AJ3L 4NMZA 3MHBA 2RSOA 1QVCA 2JA7B 1ILQA 1YVCA 1SYCA 2CH4W 1WVLA 1EY5A 1SMXA 2UUBQ 4KTAA 1K8OA 2IHFA 2SNSA 4JOIA 1PRTC 2B3GA 1FVIA 5AJ3Q 2VL6A 3W2DA 1SNOA 1ET9A 2K52A 1LTLA 3PUWA 1Z9FA 2E76C 3I55A 2NN6H 4JI2L 4A3IG 1M1KC 1YNJD 2R3ZA 5DLQE 3F2DA 4G7HC 1CHPD 3EFXD 1L1OB 3CW2C 4DR5L 2YU9B 5IP7H 3U9OA 1PH5A 2NTTA 4C2MH 1E0BA 4JI2Q 1J6QA 1IBLL 1GXDC 2SDFA 4K2LA 4FXKC 3C46A 4PZ8A 2MJ8A 4DR5Q 1WTRA 3RZOH 3CRLC 4K6LA 2EY6A 4A3LH 1TS2A 4NP5A 1GJXA 1EWCA 1O7LA 4GLVB 1IBLQ 1N36L 3J81L 5CV4A 2B63H 1C7YA 5D3IB 4LF4L 1FYCA 4YWMA 1Q8KA 3HOVH 3KJPA 3TS2A 4GZYC 3C2PA 2EYJA 5GADC 2J4XA 4R4QA 5M3MG 3VR4A 1WTVA 1N36Q 1K83H 1VQGA 1LT5D 3A0JA 2OF1A 2E5LL 4LF4Q 4JBWA 4Y7NB 4C3HG 1YHQA 1EOTA 1SE3A 2WAQG 3PF4A 1AFPA 4ZUIA 1EQRA 3X3NA 1X3EA 1VQFA 3D4WA 2C5CA 1A3TA 1YHAA 2DUDA 1TWHB 3PUYA 2E5LQ 1L1OA 2P5ZX 2CWPA 4H13C 3Q6SA 2IJ0A 3OMCA 4BA2I 2D0PA 1MGSA 3S15H 2PW7A 1PH1A 3NQIA 1YHBA 2Z0SA 2LKVA 1TR5A 3M4OB 3K59A 3RR5A 2EXDA 5CYUA 3BDCA 4DNRB 3K7AH 1FJGL 5C4JB 2FFKB 3EROA 4DGZA 2K04A 1A3VA 4MTNA 2Z9HA 2O5IC 1SROA 2KCNA 4IUNA 2J7ZA 1WCMB 1UE7A 5IT9E 4AYBB 2Z8LA 4AYBE 1MSGA 3OW7A 3GTLH 4C1NI 1FJGQ 4AIMA 3H0GG 3W3AA 2NYZD 4HAEA 4KY7A 1EQQA 1X32A 5IE8A 1TWFB 3CQZB 1GKHA 4N8X1 5EBDA 3FEWX 4RGMA 1EQTA 1UEBA 2KVMA 1GUGA 4H0LC 4DR7L 1EYCA 3M3YB 2HCCA 1KLGD 1QB5D 5LHY1 2F0LA 3OYYA 2LXKA 2PW5A 4DR6Q 3ND9A 1S4ZA 3IFTA 4DV5Q 4GOPC 3J7AV 1ICWA 1Z7TA 3F1ZA 5EQ0A 2D2CC 2WP8J 3CCVA 4G57A 3F8TA 5GAHC 2CQAA 4JCVE 3G48A 1HPCA 1PRTB 2CW0C 4A3EG 1CUKA 4L8JA 5K5PA 3MEHA 3H91A 3M4PA 3A5UA 3W1BA 1ILPA 2PZUA 1K0RA 4LF6L 4A3GG 3OMGA 4QUCA 5C44B 1W6JA 3IL8A 3ONAB 2B2WC 1RKNA 4EQNA 1CM9A 2I5HA 2H4OA 1QILA 3MXNA 3NTKA 4A3CG 3RZOB 1A15A 2C35B 3OPOA 1HCZA 2MUYA 1CZGA 1I4PA 1B44D 4LF6Q 1AN8A 4YY3L 1CT1D 4BXXH 1RD9D 1S5ED 2JA8G 5EPJA 4I7AA 2L0CA 4OX9Q 2JK8A 1RCVD 1MD2D 1AZPA 4P71A 3A7LA 4K5VA 1JB7A 3HOVB 1OO9B 2Q2UA 3EQLC 4LJZC 5EJWA 3I3CA 1KHIA 5EPLA 4A93H 2I46A 4CJ2C 4IALA 3CCRA 4IOCA 3E0JA 4KY6A 2Z6BA 4HIDA 5ISRA 1K83B 4J8QA 3K0XA 4TRDA 1EIHA 2PQAB 4IUVA 1RIPA 3HOXG 3UDFA 2XNAC 2NWGA 3L3OC 2QEJC 3S1QH 1GUTA 4PMWA 5C3EH 4QF4A 3TREA 3CPWA 1AP0A 4A3FB 1Q86C 3KF8B 5T1GA 2R92B 4DV2L 1UE1A 4K5XA 3ZYYX 4R9WA 3OSOA 1XJVA
chains in the Genus database with same CATH topology
4Q5VA 2WINB 4OO1H 2LFNA 1GUOA 1H9SB 1G6ZA 4ZLTF 3GTPB 4TSSA 3MVVA 1AEXA 3TMEA 1O7YA 3LWUA 5ELDA 4RCOA 3ND8A 3DWAA 1DCZA 1VMCA 4DXGA 1Y8OB 1Q3LA 1IW7C 1ET6A 3EJIA 1CI3M 4HTHA 1KLUD 2EOTA 2EJGC 3RD4A 3VYUA 3GTLB 3R2TA 3MFGA 1ENFA 4KKSA 1B53A 5JVG3 1S5DD 2A6HC 4M1UB 1PTOC 4A3DB 2O5JC 5IOCA 5C0XH 1LT3D 5JEAG 2F0HA 2DY8A 4ULLA 1JB3A 5C4ZA 1AZQA 3J7AF 3HKZB 1TS3A 1O80A 1EY0A 4XT3B 3KLRA 1SNMA 2CHBD 1H9SA 1ESFA 5KNDA 3GTOB 3L9AX 5FLXE 1DOMA 1XWEA 4ZQ3A 1STGA 1BNZA 1UEAB 1BCPC 2B2TA 2NTSA 1EZ8A 2EVBA 1IHZA 3FDTA 2RSNA 1HUMA 4KI0A 2V4DA 2F0JA 3JAME 2NUCA 3R2IA 1Y8PB 4K14A 3NUCA 2XWJB 3R93A 1TS4A 2OT2A 1DOLA 2JEBI 3M7GA 1KNEA 3P75A 1EFID 1EY8A 5LL6X 4UAIA 1LLRD 1PFNA 2NN6G 4XDXA 3K5LA 3Q0AA 2PNRC 1PMRA 3H3VC 4MIUA 2K5WA 4B9WA 4HR7B 5IGFA 5FO9B 2A6ED 1NR2A 3P7JA 1A6XA 1YNND 1PTOF 3GTMB 3WOEA 2WB1B 4YIJA 3PUVA 4IURA 3X3MA 4KD3A 4V190 5FKAC 4DNTB 3A7AB 2X69A 1NAPA 4KHVA 1BF4A 3P20A 2KA7A 1SNQA 2B2WA 2KOLA 5M3MB 3DMUA 2BE5D 1C8CA 3SR1A 1EEID 4M8AA 4C3HB 1T5EA 2WAQB 3PV0A 2E75C 3RMHA 2FJ2A 3GTGB 2XSCA 1G291 2JA6B 2K33A 1SMYC 3V2TA 1HUNA 2F0TA 4LAAA 1QNKA 5DAUA 1PTOB 5I6YA 1SYGA 2EE1A 2MHVA 1H9MA 3R8BA 4A3KB 1FNUA 2F0KA 4UDUC 1M4VA 3O13A 1TT2A 2A5HA 2EYHA 4OIJA 2AUJD 5A2QL 5J22A 3H94A 1BCPB 2PZWA 4OIKA 1F9SA 1H9JA 3H0GB 3S9WA 1EWHA 2F0VA 3T13A 1SSOA 3OHXC 1EY7A 1NUCA 2IX3A 2F0WA 3C1FA 3SHLA 1EU4A 1DM0B 1TWAB 3OIQA 1UAPA 2RKSA 2KQ3A 4FVMA 3K57A 1Q12A 2QDBA 3QB3A 1QJOA 1LTID 4K2KA 1ENCA 1U4RA 1F77A 4A3EB 2ICEC 4DK1A 2RA4A 2M00A 4ID6A 1SDFA 2JEAI 4KKUA 3T56B 4FXDA 4A3GB 1EU3A 4F87A 2WV6D 3Q24A 2NZ1D 2NN6I 2EXZA 3I70A 1SAPA 3MFYA 3QWNA 2F0UA 1SNPA 2XRSD 3VYSA 3DWPA 2XRQD 2WACA 4WORA 3KUPA 5T1IA 2OXPA 2JA8B 1TWGB 2RDHA 2K32A 5I9OA 3K58A 1KDCA 4HSPA 3OOCA 4F88A 1I6VC 3M4YA 1TS5A 4TKOB 3HEJA 5CV9A 2PPBC 4DXFA 2M9VA 3HOXB 2A69D 2B39A 1OXSC 2EYMA 1H9KA 4S3SA 3N52A 2AUKA 4MN3A 1OXUA 4OO1G 5G3LF 1NCVA 3T53B 4QCLA 1B3AA 3D8GA 1ZEQX 1F2ZA 3QG1A 5CV5A 2RDFA 4ABNA 4V0BA 2ZXOA 3T51B 4K8IA 4K5WA 3MAQA 1BR9A 3R3OA 1ZKOA 3M85A 5CC4A 3J81E 3TDQA 1DYQA 3HOYB 3C1EA 1XTCD 5M9OA 1LTTD 1JE4A 5KNCA 1PZKD 5FK9C 2F3WA 4ME5A 4G4KA 4L6TB 5M3FB 1SXTA 1JICA 2SNMA 3FVQA 4XQQA 1HA6A 1ENAA 1DJRD 3HOUB 1E2VA 3CKIB 3DEPA 1PLFA 2E74C 2F0IA 4IUQA 1IKLA 1V43A 1F9RA 4OL7A 3WOFA 5C0XG 2E2JB 3GV6A 2E2DC 1NR4A 1Q1EA 1EYDA 2B2TC 3I91A 1SYEA 4R8IA 1SJHD 2MGSA 3RLFA 4XXEA 3J80L 2D62A 4FO2A 5M5XB 3H09A 5EGTA 5E3FA 1PRTF 2BA1A 5I2YA 1RF2D 2ZXPA 3D6CA 3SE0A 5C3WA 3NHHA 1B2TA 5CMDA 1D5ZC 2L9HA 3K6OA 4PV1C 4DF7A 4FF4A 3UI2A 4IFDI 4R8NA 4CJ0B 4ZAIA 3SEBA 2IW3A 5F2DA 1BQQT 3MXGA 2IL8A 3QOJA 1D1KA 3PIO3 3L7ZC 3GV3A 4FF1A 4BWGB 2XWBB 4RFBA 1STHA 2KUMA 2Q8RE 3HOZB 5IT9L 3FPPA 4IQZA 5ELEA 2EDGA 5COYA 1QG7A 1HA5A 1KAAA 2AQ1B 3H6MA 1WD0A 5C5MA 2X6GA 4CBVA 4BS9A 2K03A 1Q1BA 2RQXA 3S17B 5K36G 2ENBA 4RKBA 3S16B 1BBXC 3NWSA 4ZRZA 4C2MB 4C1NK 3I90A 2E2HB 1R4PB 2EYLA 1Y69U 1GUSA 2F0PA 2PCFB 5JAVA 1U4MA 1F2YA 4H7BA 1MI2A 1D6EC 2B63B 5C4XB 1ESRA 2R93B 5D65A 5CR3A 3LX0A 4IZ8A 3DWQA 5J39A 1UNSA 2E2IB 3BG3A 3AB9A 4RGOS 2Q8TA 1BOSA 1VMPA 4HSVA 3HG9A 1U4PA 1XX8A 1Z47A 5IGCA 1DD2A 3BVMA 3NWTA 2JYOA 2Z4IA 5JPMC 1LTSD 2TMPA 3C3LA 4KD4A 5FO8B 3OWEB 1SYBA 3IKJA 3S15B 5D14A 3GTKB 2PQEA 5C0XI 4DFAA 3K5MA 3K7AB 1FD7D 3NSWA 3M7NA 1TVXA 1LACA 2EY5A 3I8ZA 5C5LA 3ERQA 4I65A 5I9PA 5IGGA 2DN8A 2NBFA 1MSHA 1U9RA 1QCBD 4IFDJ 4DU9A 4RGTA 2B8FA 4L63B 1MBYA 1VDZA 2BOSA 4IUUA 1GHJA 4BBRB 1EY4A 1UUPA 2K5QA 5JJZA 4KK7A 1XYIA 4RGNA 4NKLA 5JVH3 1G91A 1WTXA 1GHKA 1J8IA 4EQOA 3MXUA 3TZDA 1E2ZA 2FHTA 2DY7A 3D31A 1JR0D 1RHPA 1PTOD 5ELBA 1RTNA 2F0DA 2C9OA 4KHZA 2AWOA 2BDNA 1L0YB 1PXUA 1Y1VB 3PUXA 2PO4A 5FLXL 4XTCS 3DUZA 3MZ5A 2NVTB 2A68D 1I4GA 5NUCA 4A93B 3T16A 2QILA 2SOBA 1JC7A 2A6EC 5DEHA 4LK1C 4C56C 1STBA 5EPKA 5KEEA 3S1QB 4X3KA 5C3EB 1HTPA 3BZDB 2GA4B 3V96A 1HTLD 4E6IA 5K36H 2NB0A 2I07B 2B8GA 2KCCA 1V1PB 4CKCA 1DZ1A 1WTQA 3KBGA 4FF3A 4HEDA 2NVQB 1G2SA 1TY0A 2OEOA 2VB3X 1CA6A 3SK6A 1Q90A 3E6ZX 2BE5C 1JQYD 5C0XJ 1PZID 2R7ZB 2LMCB 3TBIB 3NTHA 1FR3A 2LY7A 5CV8A 3VA7A 2Q8IB 3QIAA 1J9OA 1HRJA 1JORA 1BCPF 1B4OA 1DOKA 2G9DA 2Z1CA 4JK1C 5E1FA 3NBHA 4WFN3 1Y1WB 4ZKBB 1HFGA 1QNUA 1JWMD 1QE6A 4XQNA 3VR2A 4EQPA 5IGBA 4Q0FA 4PNYA 2CVRA 1EY9A 3VYRA 2K5DA 1ONLA 4FNFA 2R6GA 1HQRD 1V1PA 3CU7A 1ZYRC 3PUZA 2JA5B 2HUGA 1LTAD 5A2QE 2B2YA 1HXYD 3KK7A 2B2VC 4LMQD 5KRUA 1LABA 4J6HA 4P2CB 2Y0SB 4DA2A 4A3JB 2O4XA 5C4HA 5ELCA 2VUMB 4QMGA 4KJOA 4KN7C 2HQEA 2NVYB 2L12A 3URYA 1STAA 3DM1A 2WKDA 4DK0A 2IT1A 1HQMC 3NTIA 3BS1A 3WDNA 3HP3A 4NDXA 3RUZA 1I4XA 1QWYA 1ML0D 4J1MA 3J7YW 1B1ZA 4XT1B 3HOWB 2MPMA 3LWEA 1PFMA 2R61A 1WD1A 1IL8A 1F9PA 1CZWA 1Z6HA 1PFBA 1D5MC 4ZK9B 2EYPA 1SNCA 2F0GA 5G3LD 2XIWA 1FNVA 3MA2B 3MWYW 4C3JG 2EY2A 1H9RA 1SEBD 4F8MA 4G7OC 2K01A 2AQ2B 2Z4HA 3SDZA 5HGTA 1OXVA 3GTQB 1CFMA 4RCNA 2KHSA 1II3A 2HDMA 3VA5A 2XVSA 3FKIB 1L0XB 1YNJC 3RZDB 2A69C 2D5DA 1S5FD 3D4RA 2JXMB 4PMCA 3IFDA 1DXMA 2B2UA 3I73A 1S5BD 1CHQD 1XXGA 2NVXB 4B08A 4KY5A 2BDOA 3GP7A 4RHRA 2L11A 4U673 2AWNA 4N9TA 1I50B 2JSOA 3K5OA 1X3QA 5CBAE 1X3PA 3PO3B 3QJYA 4TQUS 1C4QA 2SEBD 3KBXA 1PRTD 2J0TD 1CQVA 3A8IE 3I4MB 1RDPD 1B50A 1GOZA 3LNNA 4H44C 1CQFA 2KEEA 3D6WA 5JEAJ 4CHTB 4HN7A 3HS0C 4Z9CB 3DEOA 1TIID 1LT6D 5CV7A 4DAYA 3S14B 5AFWA 1GUNA 4HCEA 2IPKD 4IUPA 3TP8A 3P1HA 3J80E 1B9MA 1TU2B 3NXWA 2ZXRA 2KJXA 2F1MA 4HMJA 3HRZC 2RDGA 5DNFA 2F0MA 1B9NA 4FF2A 3Q23A 1LTBD 2K28A 3BDLA 4B9XA 4X3UA 3NK9A 5KYLA 5BN5A 4FYDA 3TZUA 4RAUC 1JWUD 1FNWA 2O2LD 3HGBA 4F7XA 5IGEA 3TP6A 3ITPA 1EZ6A 3V05A 5KYIA 3A56A 1M8AA 1SNDA 1IYUA 3MXPA 4CJ1B 2EYOA 1KNAA 5D3DA 2F0OA 5KGUA 2F0FA 3GD7A 3NE5B 5CV6A 3K0YA 4BY7B 3D4DA 1Q8IA 2B2VA 4C3IG 3S2HB 1SBBB 2QF7A 1IYVA 3PIP3 4ODGA 5C3XA 4XIGS 5EKKA 2F0EA 1KDBA 3MC0B 2ID0A 4PMBA 1VCIA 3SVMA 1RJTA 3S1NB 5IIFA 2F0SA 2HCIA 1GUWA 1SE2A 3BYTB 5CORA 3Q22A 1ZXTA 5CGKA 5IGDA 4ZUJA 1EYAA 1HHVA 4IFDH 4CGYB 3G6JB 4A3MB 1CA5A 2KECA 1A2TA 4KV6A 3A54A 1R9TB 4N9PA 4OO1I 4KN4C 2A73B 1KABA 1VF5C 4IN3A 4BA1I 1F9QA 2CW0D 1IKMA 3S1RB 3S1MB 5C6AA 4RH6A 4EGVA 3VR5A 1CK1A 2EY1A 2EJFC 2QKIC 5A35A 3I72A 2FINB 4PQXA 1WTWA 1D2BA 5EKLA 2RBMA 1JOKA 2K05A 3I4NB 1C48A 3BVZA 1D1IA 2IX1A 3SK8A 3GQBA 1EL0A 2B2YC 1K8MA 1A2UA 3NPPA 1WTOA 4IUTA 5E4WC 3A8JE 4DAPA 5BN3A 2K6AA 2FMCA 2G9HD 3HZXA 3VYTA 1SYDA 4U68A 5JOBA 2BCOA 1JWSD 3FRPB 1HFNA 2DNCA 2X6LA 3CRKC 1O78A 3BYYB 3TSSA 3DXJC 3I4LA 1TKWB 3PO2B 2ZT9C 1STNA 1OXTA 1F2LA 4EVOA 2WIIB 3EA6A 1Y8NB 4XQJA 3KLSA 3KLSX 4QUFA 4KKTA 4XYOA 3BDOA 4CKEA 1W6KA 2PZTA 4QIWB 5KNBA 1KDAA 5FO7B 3DHQA 2L5TA 1TY2A 1IW7D 3QOLA 2YYZA 2JE6I 1SE4A 1PZJD 1G2TA 3SK5A 3KF8A 1V1OA 2A6HD 5J1ZA 1OXXK 1PTOH 1LTRD 4DN4M 4C3JB 5LL6S 3K5NA 2DNEA 1I4QA 3PMFA 5E4XA 5FOBB 2B2UC 2A68C 1VF7A 3MTSA 4QB4A 5CBEE 1D5XC 4RHSA 1SYFA 1PYWD 2VXWA 5M5YB 3SK4A 1JOOA 3VR6A 4RKLA 4A3BB 1BO0A 4ZYSA 2VNUD 2IX0A 3FMCA 5BN4A 4BBSB 1SFOB 3A8KE 1BCPD 1I4RA 4HCSA 3U9SA 3JAML 1AW7A 1YNNC 2HDLA 5I6WA 1EIGA 3IAYA 3NP8A 3G7LA 5EKIA 2TSSA 2L55A 4I7ZC 3T4AC 1S5CD 1PDQA 4RWSC 5IODA 3TP7A 1QOHA 2F03A 3SXHA 1DONA 3S2DB 3EVQA 4A3IB 2KEDA 4XYQA 1T5XD 3OIPA 1LO5D 1RODA 4FP5D 3A55A 1I3QB 1SJED 3FPUB 1O7ZA 2BA0A 4MHEA 4O1NA 2AQ3B 3TN2A 2IWHA 3AMUA 1KTKA 3D3RA 3F2UA 3AU7A 5EBCA 2L4NA 4FXGC 2K7VA 3E5SA 3GO5A 2FMMA 4ILWA 2ICIA 1NSNS 4OHJA 5HURA 4DAVA 3CHBD 4BY1B 2EPBA 3NQTA 4X3SA 2LS01 2RVLA 4RA8A 2EZVA 2XN9C 1STYA 5I4DA 4CKBA 1FGBD 2PYKA 1RTOA 2H1EA 2A74C 2N88A 3GTJB 3QO2A 4OGQC 5ELFA 4WJWA 2F0QA 1A3UA 1V8QA 1SMYD 4KJNA 5TSSA 2EJMA 2PMZB 1LT4D 4K8JA 2D9UA 2K1BA 2L1BA 1TQOA 2VB2X 5JPNC 1E2WA 4X3TA 5I2XA 1EY6A 1EEFD 1U4LA 1ZYRD 2F3VA 4C3IB 1BDOA 1CTMA 3NBIA 1G8ZD 3N6RA 4NW2A 1TWCB 1F2MA 5DM73 3VR3A 1EQVA 2JP1A 4ZKCB 5JEAH 1I4HA 1WTPA 2N55A 4K6DA 2F4IA 2MP1A 5DM63 1STEA 2EYFA 4HMIA 1BXTA 1LTGD 2QCPX 4KMUC 4IFDG 1JCKB 4G7ZC 1JOQA 2WKCA 3TP5A 2M2LA 5M5WB 5KIXA 4WRDA 1LV9A 3OWFA 2F0NA 3BVGA 4O42A 1I6HB 1R4QB 1BUVT 4NMZA 3MHBA 2RSOA 2JA7B 1ILQA 1SYCA 1WVLA 1EY5A 4KTAA 1K8OA 2SNSA 1PRTC 3W2DA 1SNOA 1ET9A 3PUWA 2E76C 2NN6H 1YNJD 2R3ZA 4G7HC 1CHPD 3EFXD 2YU9B 3U9OA 2NTTA 1E0BA 1GXDC 2SDFA 4K2LA 4FXKC 3C46A 2MJ8A 1WTRA 3CRLC 4K6LA 2EY6A 1TS2A 4NP5A 1GJXA 1EWCA 1O7LA 3J81L 5CV4A 5D3IB 1FYCA 4GZYC 3C2PA 2EYJA 2J4XA 3VR4A 1WTVA 1LT5D 2OF1A 4JBWA 4Y7NB 4C3HG 1EOTA 1SE3A 1AFPA 4ZUIA 3X3NA 3D4WA 2C5CA 1A3TA 1TWHB 3PUYA 4H13C 3Q6SA 2IJ0A 3OMCA 4BA2I 1MGSA 2PW7A 3NQIA 2LKVA 1TR5A 3M4OB 3K59A 5CYUA 3BDCA 4DNRB 5C4JB 2FFKB 3EROA 4DGZA 2K04A 1A3VA 2O5IC 2KCNA 4IUNA 2J7ZA 1WCMB 5IT9E 4AYBB 2Z8LA 1MSGA 3OW7A 4C1NI 3W3AA 2NYZD 4HAEA 4KY7A 1X32A 1TWFB 3CQZB 5EBDA 3FEWX 4RGMA 1EQTA 2KVMA 1GUGA 4H0LC 1EYCA 3M3YB 2HCCA 1KLGD 1QB5D 5LHY1 2F0LA 2PW5A 3ND9A 1S4ZA 3IFTA 3J7AV 1ICWA 1Z7TA 5EQ0A 2D2CC 2WP8J 4G57A 2CQAA 1HPCA 1PRTB 2CW0C 4L8JA 5K5PA 3MEHA 3H91A 1ILPA 2PZUA 3OMGA 4QUCA 5C44B 1W6JA 3IL8A 3ONAB 2B2WC 1RKNA 4EQNA 1CM9A 2H4OA 1QILA 3MXNA 3NTKA 3RZOB 1A15A 3OPOA 1HCZA 2MUYA 1CZGA 1I4PA 1B44D 1AN8A 1CT1D 1RD9D 1S5ED 5EPJA 2L0CA 1RCVD 1MD2D 1AZPA 3A7LA 4K5VA 3HOVB 1OO9B 3EQLC 4LJZC 5EJWA 3I3CA 5EPLA 2I46A 4CJ2C 4IALA 3E0JA 4KY6A 5ISRA 1K83B 4J8QA 4TRDA 1EIHA 4IUVA 2XNAC 2NWGA 3L3OC 2QEJC 1GUTA 4PMWA 4QF4A 1AP0A 4A3FB 5T1GA 2R92B 4K5XA 3ZYYX 4R9WA 3OSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAU A;  5EGT A;  5E3F A;  4K14 A;  3LX0 A;  3NUC A;  5I6Y A;  2OXP A;  1JOR A;  1EY6 A;  4IZ8 A;  5CGK A;  5IGD A;  2EY2 A;  1EYA A;  4ZUJ A;  3D6C A;  3U9O A;  1SYG A;  4KY7 A;  5C3W A;  5I9O A;  5J39 A;  2F3V A;  2PZT A;  4F8M A;  3TP8 A;  1KDC A;  2F0D A;  3P1H A;  3P75 A;  1KDA A;  3NHH A;  1F2M A;  3NXW A;  4K2L A;  3MVV A;  1AEX A;  3DHQ A;  3TME A;  5E1F A;  5HGT A;  2F0K A;  1A2T A;  1EYC A;  1EQV A;  1EY8 A;  4KV6 A;  4N9P A;  3HEJ A;  5CV9 A;  2KHS A;  4HMJ A;  3QOL A;  1II3 A;  2F0L A;  5IGC A;  2EY6 A;  2PW5 A;  4DF7 A;  1TT2 A;  4NP5 A;  1KAB A;  2EYM A;  2F0M A;  3VA5 A;  4EQP A;  2EYH A;  4R8N A;  5IGB A;  4S3S A;  4PNY A;  5CV4 A;  5F2D A;  5C6A A;  3BDL A;  4G57 A;  4B9X A;  5J22 A;  1EY9 A;  3EJI A;  3QOJ A;  3NK9 A;  4KD4 A;  4DGZ A;  5KYL A;  3MZ5 A;  4MIU A;  4K6D A;  4HTH A;  3SK5 A;  4B9W A;  5J1Z A;  2EY1 A;  2PZW A;  1SYB A;  2EYF A;  5IGF A;  3E5S A;  4HMI A;  3D8G A;  5CV5 A;  1F2Z A;  3S9W A;  2RDF A;  2EYJ A;  4PMC A;  5NUC A;  1JOQ A;  5K5P A;  5EKL A;  4F7X A;  2RBM A;  3TP6 A;  3ITP A;  3MEH A;  1EZ6 A;  2F0V A;  3T13 A;  3TP5 A;  1STH A;  1JOK A;  1EY7 A;  4K8I A;  1NUC A;  4K5W A;  5KYI A;  3T16 A;  2PZU A;  2PQE A;  3R3O A;  2SOB A;  5KIX A;  2OF1 A;  4YIJ A;  3PMF A;  5CC4 A;  2F0W A;  5DEH A;  4DFA A;  4KY5 A;  4WRD A;  1SND A;  3C1F A;  3OMG A;  3SHL A;  3OWF A;  4LAA A;  3SK8 A;  3C1E A;  5IOC A;  2F0N A;  4QB4 A;  1NSN S;  2RKS A;  3MXP A;  5M9O A;  1RKN A;  1STB A;  4N9T A;  4J6H A;  4EQN A;  4KD3 A;  5KEE A;  5KRU A;  1SYF A;  4ZUI A;  2EYO A;  2F0H A;  5HUR A;  1A2U A;  1KAA A;  2EY5 A;  2KQ3 A;  5C5L A;  3ERQ A;  3H6M A;  5C4Z A;  3SK4 A;  1JOO A;  2O4X A;  3D4W A;  3NQT A;  4RKL A;  5C5M A;  4I65 A;  5C4H A;  1A3T A;  2F0O A;  2F3W A;  4E6I A;  5I9P A;  4ME5 A;  2QDB A;  4QMG A;  1STY A;  4KJO A;  4KHV A;  3QB3 A;  5KGU A;  2HQE A;  2F0F A;  1EY0 A;  4K2K A;  1ENC A;  2SNM A;  4EVO A;  5IGG A;  4NMZ A;  1STA A;  3MHB A;  3OMC A;  1ENA A;  2ENB A;  5CV6 A;  1SNM A;  4K5V A;  1U9R A;  4RKB A;  3HZX A;  3D4D A;  4DU9 A;  1SYC A;  2PW7 A;  1SNQ A;  1SYD A;  2PYK A;  1EY5 A;  5JOB A;  4ZQ3 A;  2LKV A;  1TR5 A;  1STG A;  2SNS A;  3DMU A;  2F0I A;  2M00 A;  4ID6 A;  4IAL A;  4KTA A;  4KY6 A;  2OEO A;  4NDX A;  3RUZ A;  4ODG A;  5C3X A;  5I6W A;  2EYL A;  5ISR A;  5IGE A;  1EY4 A;  3SR1 A;  3BDC A;  3NP8 A;  4J1M A;  4OL7 A;  2F0P A;  4TRD A;  1EZ8 A;  5JAV A;  2EXZ A;  2F0Q A;  1F2Y A;  1A3U A;  3ERO A;  1SNO A;  4NKL A;  2F0U A;  5EKK A;  1IHZ A;  1EYD A;  1KDB A;  2F0E A;  1A3V A;  4H7B A;  4KJN A;  3SK6 A;  1SYE A;  1SNP A;  4PMB A;  4IUN A;  4K8J A;  4QF4 A;  5IOD A;  5IIF A;  3TP7 A;  1STN A;  2F0J A;  3SXH A;  1TQO A;  2WAC A;  2F0S A;  4WOR A;  2NUC A;  5CV7 A;  4K5X A;  4EQO A;  3EVQ A;  2EYP A;  5CR3 A;  5CV8 A;  2F0T A;  3OSO A;  3V2T A;  1SNC A;  2F0G A; 
#chains in the Genus database with same CATH topology
 4Q5V A;  2WIN B;  2HIV A;  4OO1 H;  2LFN A;  1GUO A;  1H9S B;  1G6Z A;  4ZLT F;  5JJK A;  3GTP B;  2CWA A;  1QVG A;  4TSS A;  4DV2 Q;  3MVV A;  1AEX A;  3PGZ A;  4LUO A;  3TME A;  4GN3 B;  1O7Y A;  3FP9 A;  3LWU A;  5ELD A;  4RCO A;  1KIX A;  3ND8 A;  3DWA A;  1DCZ A;  1VMC A;  3S24 A;  4DXG A;  1VQL A;  1Y8O B;  1Q3L A;  1YEZ A;  4LF8 L;  4WJ4 A;  2LXJ A;  1IW7 C;  2R7Z H;  1WOC A;  1ET6 A;  3EJI A;  1CI3 M;  1HZC A;  4HTH A;  1KLU D;  5M3F G;  2EOT A;  2EJG C;  3RD4 A;  4L5S A;  3VYU A;  3GTL B;  3R2T A;  3MFG A;  1ENF A;  4KKS A;  1B53 A;  4LF8 Q;  5JVG 3;  1S5D D;  2A6H C;  1HNZ L;  4M1U B;  1PTO C;  4A76 A;  2GVA A;  4A3D B;  2O5J C;  5IOC A;  2PQA A;  5C0X H;  1LT3 D;  3I56 A;  1Y1W H;  5IYD G;  1B70 B;  2JA6 H;  5JEA G;  2F0H A;  4DV1 L;  1XPR A;  2HT1 A;  4LFB L;  2DY8 A;  4ULL A;  1JB3 A;  5C4Z A;  1AZQ A;  1HNZ Q;  4JW0 A;  4X64 Q;  4B3T L;  3J7A F;  3HKZ B;  1TS3 A;  1O80 A;  1N33 L;  1EY0 A;  4XT3 B;  4LNQ A;  5H1S E;  4JVZ A;  3KLR A;  3H15 A;  1GM5 A;  1SNM A;  1XNR L;  2CHB D;  4JBK A;  1H9S A;  1ESF A;  5KND A;  4DV1 Q;  4A3K H;  3GTO B;  1K9M C;  3L9A X;  3M9B A;  5FLX E;  1DOM A;  1XWE A;  4ZQ3 A;  1STG A;  1BNZ A;  1UEA B;  1BCP C;  4GOP B;  3KLW A;  2B2T A;  1N33 Q;  2NTS A;  1EZ8 A;  4IJL A;  4JOI C;  1I94 L;  2EVB A;  4DAM A;  3K80 C;  1XNR Q;  1IHZ A;  3FDT A;  2RSN A;  4DK3 C;  1HUM A;  4A4I A;  4KI0 A;  4A3J H;  2V4D A;  2F0J A;  1KRT A;  3JAM E;  4NXM L;  2NUC A;  2VUM H;  3R2I A;  1Y8P B;  4K14 A;  2NVY H;  3NUC A;  1I94 Q;  2XWJ B;  1VQ4 A;  4A75 A;  1Q81 C;  3R93 A;  1TS4 A;  2NZO A;  4FDB A;  1K3R A;  2OT2 A;  1DOL A;  2JEB I;  4YCV A;  3M7G A;  1KNE A;  3P75 A;  4NXM Q;  1EFI D;  1EY8 A;  2OQ0 A;  4UAI A;  5LL6 X;  1LLR D;  1PFN A;  2G5D A;  3HOW H;  2NN6 G;  1WTH A;  4QQB X;  3CCL A;  4LFC L;  4XDX A;  3GDE A;  2PI2 E;  3K5L A;  3Q0A A;  2QGQ A;  2PNR C;  1PMR A;  3H3V C;  4MIU A;  1SLJ A;  2K5W A;  4B9W A;  1IXR A;  3UE1 A;  4HR7 B;  5IP7 G;  5IGF A;  5FO9 B;  2A6E D;  1NR2 A;  3P7J A;  1A6X A;  3ER0 A;  1YNN D;  1PTO F;  4LFC Q;  1UWV A;  3GTM B;  3WOE A;  2WB1 B;  2WB1 E;  4YIJ A;  3PUV A;  3H3V H;  4IUR A;  1YNX A;  1M90 C;  4A3L G;  3X3M A;  1ICF B;  4KD3 A;  2ZM6 L;  4V19 0;  5FKA C;  4DNT B;  3A7A B;  1JE5 A;  2X69 A;  2B63 G;  3J80 c;  1NAP A;  3FKI H;  2UU9 L;  2R93 G;  4KHV A;  3HOV G;  1BF4 A;  1YJ9 A;  2Q2H A;  3P20 A;  2KA7 A;  2ZM6 Q;  1K8G A;  1SNQ A;  2B2W A;  2KOL A;  5M3M B;  3DMU A;  3CC7 A;  2GVB A;  2UU9 Q;  3KFU A;  2NVX H;  2BE5 D;  1C8C A;  2E8G A;  3SR1 A;  2K50 A;  1EEI D;  4YCU A;  4M8A A;  3U4Z A;  4C3H B;  2EQS A;  1T5E A;  3F2B A;  4DPG A;  2WAQ B;  4DV6 L;  1MHW C;  3PV0 A;  2E75 C;  3RMH A;  2FJ2 A;  3GTG B;  1EIY B;  2XSC A;  1G29 1;  1K73 C;  2PI2 A;  2JA6 B;  2UXD L;  2K33 A;  2F3I A;  1MKH A;  1SMY C;  3E9H A;  3PO3 H;  3V2T A;  1PH8 A;  1HUN A;  2F0T A;  4LAA A;  1QNK A;  5DAU A;  1PTO B;  4DV3 L;  5I6Y A;  4DV6 Q;  1SYG A;  2EE1 A;  2MHV A;  3STB D;  1H9M A;  1IBM L;  2RCF A;  2UXD Q;  1HNW Q;  3R8B A;  4A3K B;  3HOY H;  4PZ7 A;  1CKN B;  4JI5 L;  1FNU A;  2JN4 A;  2CH4 A;  2F0K A;  4DV3 Q;  1YIJ A;  4UDU C;  1VQ9 A;  1M4V A;  1B3Q A;  2OCE A;  1NJI C;  2FXQ A;  3O13 A;  1TT2 A;  2A5H A;  1SN8 A;  1D7Q A;  2EYH A;  4OIJ A;  2AUJ D;  5A2Q L;  3UDG A;  2KHJ A;  1A8V A;  1Q46 A;  5J22 A;  3T1H L;  4JI5 Q;  2Y0S E;  3H94 A;  2A8V A;  3HOU H;  1PVO A;  2KCT A;  3S14 H;  1BCP B;  2PZW A;  4OIK A;  1G51 A;  3AQQ A;  1F9S A;  1H9J A;  3H0G B;  3S9W A;  2F4V L;  1EWH A;  2F0V A;  3T13 A;  1SSO A;  1E22 A;  3OHX C;  1EY7 A;  1NUC A;  1C9O A;  1VQ5 A;  2HHH L;  1IBK L;  2IX3 A;  3T1H Q;  2F0W A;  1K28 A;  3C1F A;  3SHL A;  1EU4 A;  1DM0 B;  1PYS B;  1TWA B;  1UAP A;  3OIQ A;  2RKS A;  3DLL A;  1X3G A;  4MZ9 A;  1X9N A;  2F4V Q;  5M5X H;  2KQ3 A;  2CFM A;  4JI4 L;  4FVM A;  4AQY Q;  2HHH Q;  1IBK Q;  3K57 A;  1Q12 A;  2QDB A;  5HY6 A;  4R4T A;  1VQO A;  3QB3 A;  1QJO A;  3I4O A;  3L2P A;  1LTI D;  4K2K A;  1ENC A;  1U4R A;  1XTD A;  3G71 A;  1F77 A;  3PIP A;  4GLX A;  4A3E B;  2ICE C;  3AFP A;  4DK1 A;  1P16 A;  1VS0 A;  2RA4 A;  1QVF A;  2M00 A;  4ID6 A;  1SDF A;  2JEA I;  4KKU A;  1CKN A;  3T56 B;  4FXD A;  4A3G B;  1EU3 A;  4F87 A;  2WV6 D;  3Q24 A;  2NZ1 D;  2NN6 I;  2EXZ A;  3I70 A;  1SAP A;  3AEV A;  3MFY A;  3QWN A;  2F0U A;  2CKZ B;  1SNP A;  2Q2T A;  2XRS D;  2IHE A;  3VYS A;  1Y1V G;  3DWP A;  2XRQ D;  1PA6 A;  3J7A 5;  4BXX G;  2WAC A;  4WOR A;  3KUP A;  5T1I A;  2OXP A;  2JA8 B;  1O7I A;  1TWG B;  2RHQ B;  2RDH A;  2K32 A;  5I9O A;  3BZC A;  3S2H H;  3HOZ H;  4A93 G;  3K58 A;  3PF5 A;  1KDC A;  4IOA A;  4HSP A;  3OOC A;  4F88 A;  1I6V C;  3RNU A;  2VS1 A;  3M4Y A;  1TS5 A;  4TKO B;  2Q2I A;  2HIX A;  3HEJ A;  5CV9 A;  2PPB C;  3CAM A;  4DXF A;  2M9V A;  3HOX B;  2A69 D;  5C3E G;  2B39 A;  4DV7 L;  1OXS C;  2EYM A;  1H9K A;  4S3S A;  3N52 A;  3KJO A;  2KEN A;  3S17 H;  2AUK A;  4APV A;  4MN3 A;  1OXU A;  4JPB W;  5G3L F;  3S16 H;  4OO1 G;  1NCV A;  3JC6 6;  3T53 B;  1B3A A;  4QCL A;  4DV0 L;  2WB1 G;  3D8G A;  1ZEQ X;  1F2Z A;  3QG1 A;  5CV5 A;  2RDF A;  4ABN A;  2AHO B;  2E2H H;  4V0B A;  2ZXO A;  3T51 B;  4DV7 Q;  4K8I A;  4K5W A;  3MAQ A;  1BR9 A;  3R3O A;  1ZKO A;  3M85 A;  2QA4 A;  2L15 A;  5CC4 A;  3J81 E;  3TDQ A;  2OWO A;  1DYQ A;  2RCN A;  3HOY B;  3C1E A;  1XTC D;  4DV0 Q;  1R9T H;  5M9O A;  1S40 A;  1LTT D;  5C4X H;  4AH6 A;  1JE4 A;  2R93 H;  2R7Z G;  5KNC A;  1PZK D;  5FK9 C;  2F3W A;  4UHV A;  3S1R H;  1VQM A;  4ME5 A;  3S1M H;  3SGI A;  3W1G A;  4G4K A;  4L6T B;  5M3F B;  3WWV A;  1SXT A;  1JIC A;  2SNM A;  3FVQ A;  4XQQ A;  2E2I H;  1HA6 A;  1ENA A;  3UDI A;  1DJR D;  5FJ8 H;  3HOU B;  1E2V A;  3CKI B;  3DEP A;  3JAM i;  1PLF A;  3OTO L;  1HJP A;  2E74 C;  2F0I A;  4O2D A;  4IUQ A;  1IKL A;  1V43 A;  1F9R A;  4OL7 A;  3WOF A;  5C0X G;  2E2J B;  3GV6 A;  2E2D C;  4QL5 A;  1NR4 A;  1Y1W G;  2JA6 G;  4JI3 L;  1Q1E A;  2BH8 A;  1EYD A;  2B2T C;  4R4C A;  3I91 A;  3RLO A;  1SYE A;  4R8I A;  1SJH D;  2MGS A;  3RLF A;  4XXE A;  3J80 L;  3OTO Q;  4HJA A;  2D62 A;  3E9I A;  4FO2 A;  5M5X B;  1XMO L;  2ATW A;  3ULL A;  2KHI A;  5FLX c;  3H09 A;  4R4O A;  5EGT A;  5E3F A;  4JI3 Q;  1PRT F;  2BA1 A;  5I2Y A;  3GTK H;  1RF2 D;  4A3K G;  2ZXP A;  3D6C A;  3EN2 A;  3SE0 A;  5C3W A;  4JI7 L;  1XMO Q;  1A63 A;  3NHH A;  1B2T A;  3DM3 A;  1U0L A;  1HZA A;  3MXN B;  5CMD A;  1D5Z C;  2L9H A;  3K6O A;  4PV1 C;  4DF7 A;  2Y0S G;  4FF4 A;  4TVA B;  3CCM A;  3UI2 A;  4JI7 Q;  4A3J G;  3CCE A;  4IFD I;  4R8N A;  4CJ0 B;  1LM0 A;  4LW1 A;  4ZAI A;  3SEB A;  2IW3 A;  5HGQ A;  5F2D A;  2VUM G;  1BQQ T;  3MXG A;  2IL8 A;  3QOJ A;  1D1K A;  3PIO 3;  1QZH A;  3L7Z C;  4IPC A;  3GV3 A;  3CXC A;  4BWG B;  4FF1 A;  1PFS A;  2VW9 A;  4BBR H;  2XWB B;  1PYB A;  4RFB A;  1JMC A;  1STH A;  2KUM A;  4J15 A;  1X6O A;  1EFW A;  2Q8R E;  3HOZ B;  5IT9 L;  4DR2 L;  5L37 A;  3FPP A;  4UP7 A;  4IQZ A;  5ELE A;  2EDG A;  5COY A;  1QG7 A;  3HOW G;  3L0O A;  1VQB A;  2ZTE A;  1HA5 A;  1VQI A;  1PH3 A;  1KAA A;  4PZ6 A;  2AQ1 B;  3H6M A;  1WD0 A;  4DR7 Q;  1NMF A;  5C5M A;  4QGU A;  2X6G A;  4CBV A;  4DR2 Q;  3U50 C;  4BS9 A;  2K03 A;  3VDY A;  1Q1B A;  2RQX A;  3S17 B;  5K36 G;  2ENB A;  1C0A A;  4RKB A;  3S16 B;  1BBX C;  3NWS A;  4C3J H;  2F52 A;  4ZRZ A;  4C1N K;  4C2M B;  4H02 A;  3I90 A;  4NB3 A;  2E2H B;  1R4P B;  2EYL A;  1Y69 U;  1GUS A;  2F0P A;  2PCF B;  5JAV A;  1TXY A;  1U4M A;  4L5Q A;  1F2Y A;  4P75 A;  1Y1V H;  4H7B A;  1MI2 A;  2B29 A;  3E3X A;  1D6E C;  3I7F A;  3FKI G;  1PH4 A;  2MO0 A;  2B63 B;  5M5Y H;  5C4X B;  4MNO A;  2NVT H;  2VY3 A;  1ESR A;  2R93 B;  5D65 A;  3TS0 A;  5CR3 A;  4HIM A;  3LX0 A;  4BBS H;  4IZ8 A;  3DWQ A;  4UY8 C;  4YY3 Q;  5J39 A;  1UNS A;  2E2I B;  3BG3 A;  2PNH A;  3AB9 A;  4JYA L;  4RGO S;  2Q8T A;  1BOS A;  4R1J A;  1VMP A;  4IPG A;  4HSV A;  3HG9 A;  1U4P A;  1XX8 A;  5ELO A;  1Z47 A;  5IGC A;  1DD2 A;  3BVM A;  1PH2 A;  4JYA Q;  3NWT A;  2JYO A;  2Z4I A;  5JPM C;  3PO3 G;  1LTS D;  2TMP A;  4DNI A;  3C3L A;  1VQC A;  4KD4 A;  3CC2 A;  5FO8 B;  1GVP A;  1YBY A;  3OWE B;  1SYB A;  3IKJ A;  2NVQ H;  3S15 B;  2JA9 A;  1KXL A;  1PV4 A;  5D14 A;  3GTK B;  3HOY G;  4JG2 A;  2PQE A;  1QUQ B;  5C0X I;  1XPO A;  4Y52 H;  4DFA A;  3K5M A;  3K7A B;  1FD7 D;  5J3B A;  3NSW A;  3M7N A;  1TVX A;  1LAC A;  2EY5 A;  3I8Z A;  5C5L A;  3ERQ A;  4I65 A;  5I9P A;  3HOU G;  1VQH A;  1S72 A;  1JJG A;  5IGG A;  2NZH A;  2DN8 A;  2NBF A;  1MSH A;  1EYG A;  1U9R A;  1QCB D;  4IFD J;  1Q82 C;  4RGT A;  4DU9 A;  2B8F A;  4L63 B;  1MBY A;  1VDZ A;  2BOS A;  4IUU A;  1GHJ A;  4BBR B;  1EY4 A;  2VZA A;  2ZTD A;  1UUP A;  2K5Q A;  5JJZ A;  4KK7 A;  4QIW E;  1XYI A;  4RGN A;  4NKL A;  4CDC C;  5JVH 3;  4HIK A;  1G91 A;  1WTX A;  4GNX A;  1GHK A;  4BY1 H;  1J8I A;  4L5R C;  4EQO A;  4CDF C;  3MXU A;  1EIF A;  2K5V A;  3TEH B;  3TZD A;  4LFB Q;  1E2Z A;  5IWA L;  2FHT A;  3HFZ B;  4GN4 B;  2JA5 H;  2DY7 A;  3D31 A;  4B3T Q;  4GKK L;  3NEN A;  4LF5 L;  1JR0 D;  1RHP A;  1PTO D;  4ME3 A;  5ELB A;  1RTN A;  4DUZ L;  1QUQ A;  2F0D A;  5IY0 A;  3GTJ H;  2CQO A;  2C9O A;  4KHZ A;  5IWA Q;  1XNQ L;  4B3R L;  5IP9 H;  2AWO A;  4GKK Q;  2BDN A;  1L0Y B;  4LF5 Q;  1A0I A;  1PXU A;  3G6E A;  1Y1V B;  3PUX A;  3J81 i;  2LSS A;  2PO4 A;  5FLX L;  1CSQ A;  4XTC S;  3DUZ A;  3MZ5 A;  3I2Z A;  1XNQ Q;  4B3R Q;  2NVT B;  2A68 D;  1I4G A;  5NUC A;  3HOZ G;  3H3V I;  3MEF A;  3AYH B;  1E1T A;  4A93 B;  1X54 A;  3T16 A;  2QIL A;  2SOB A;  2UUA L;  3EBE A;  1JC7 A;  4CDD C;  2A6E C;  5DEH A;  4LK1 C;  1ASZ A;  4C56 C;  4POG A;  3NBH B;  2OTJ A;  1NE3 A;  4OON A;  5ELN A;  1IYJ B;  1STB A;  5EPK A;  5KEE A;  2OQK A;  3S1Q B;  4X3K A;  5C3E B;  1HTP A;  3BZD B;  2GA4 B;  3V96 A;  3KF6 A;  1HTL D;  4E6I A;  2UUA Q;  3ULP A;  1G6P A;  1V9P A;  5K36 H;  2MQH A;  1JT8 A;  2NB0 A;  2I07 B;  2B8G A;  2AKW B;  2KCC A;  1V1P B;  4CKC A;  1DZ1 A;  1WTQ A;  3KBG A;  1VQ7 A;  4HED A;  4FF3 A;  1KQS A;  2NVQ B;  3CF5 A;  3GTQ H;  4EX5 A;  1G2S A;  1TY0 A;  2OEO A;  2VB3 X;  3PCO B;  1CA6 A;  2YV5 A;  4X65 L;  1W2B A;  1X55 A;  5C4X G;  4GS3 A;  3SK6 A;  1Q90 A;  3E6Z X;  2BE5 C;  1JQY D;  5C0X J;  1V1Q A;  3ICE A;  3RZD H;  1PZI D;  2R7Z B;  2LMC B;  3A74 A;  3TBI B;  3NTH A;  1FR3 A;  2LY7 A;  4JV5 L;  5CV8 A;  3E0E A;  3VA7 A;  1L0W A;  2Q8I B;  4X65 Q;  3QIA A;  1J9O A;  1HRJ A;  5FJ8 G;  1JOR A;  1BCP F;  1B4O A;  2JA7 H;  1DOK A;  2G9D A;  2Z1C A;  4JV5 Q;  4JK1 C;  4X6A H;  5E1F A;  3NBH A;  1I50 H;  4WFN 3;  1Y1W B;  4ZKB B;  1HFG A;  1QNU A;  1JWM D;  3IRB A;  1QE6 A;  4XQN A;  3VR2 A;  1H95 A;  3W5O A;  1IZ6 A;  4HJ7 A;  4EQP A;  5IGB A;  4Q0F A;  4PNY A;  2CVR A;  1EY9 A;  3VYR A;  2K5D A;  1ONL A;  4FNF A;  5FLM H;  2R6G A;  2DJG C;  3I4M H;  2UXC L;  1HQR D;  2YU9 H;  1V1P A;  3CU7 A;  4IPH A;  1ZYR C;  5IT9 c;  3PUZ A;  2JA5 B;  2HUG A;  4LF7 L;  3LGJ A;  1K8A C;  1LTA D;  2XTI A;  5A2Q E;  1S3O A;  2JQO A;  2B2Y A;  1HXY D;  3KK7 A;  1IBM Q;  3CC4 A;  2B2V C;  4LMQ D;  2UXC Q;  5KRU A;  1LAB A;  4J6H A;  4P2C B;  3KDF A;  2Y0S B;  5GQO A;  4DA2 A;  4A3J B;  4LF7 Q;  2O4X A;  4GKJ L;  1VQ8 A;  5C4H A;  1HZ9 A;  5ELC A;  2VUM B;  1X56 A;  4QMG A;  4KJO A;  3HKS A;  2K5H A;  4KN7 C;  2HQE A;  2NVY B;  4DK6 C;  2L12 A;  2EIF A;  3URY A;  1STA A;  4BBR G;  4L5T A;  3DM1 A;  2WKD A;  3CD6 A;  4DK0 A;  2IT1 A;  1HQM C;  3NTI A;  3BS1 A;  3WDN A;  2K75 A;  3HP3 A;  4NDX A;  3RUZ A;  4DV4 L;  1I4X A;  1QWY A;  1ML0 D;  4J1M A;  2K5N A;  1BBU A;  3J7Y W;  1B1Z A;  4XT1 B;  4JC0 A;  3HOW B;  2MPM A;  3LWE A;  1PFM A;  2R61 A;  1WD1 A;  1IL8 A;  3CCU A;  1E7Z A;  1F9P A;  1CZW A;  1Z6H A;  1PFB A;  2Z6K C;  4OEM B;  1D5M C;  4DV4 Q;  4ZK9 B;  2KBN A;  2EYP A;  1TWH H;  1SNC A;  2F0G A;  5G3L D;  2XIW A;  1FNV A;  3MA2 B;  4JI4 Q;  1NBW A;  3MWY W;  1XPU A;  4C3J G;  2EY2 A;  1H9R A;  3CPF A;  1UE6 A;  2ZJQ A;  2QDL A;  1SEB D;  4YHH L;  1VQ6 A;  4F8M A;  4G7O C;  1JJC B;  1QZG A;  2UXB L;  2K01 A;  2AQ2 B;  2Z4H A;  2ASB A;  2ZJP A;  3SDZ A;  5HGT A;  1OXV A;  3GTQ B;  1CFM A;  5C4J H;  4RCN A;  2H5X A;  2KHS A;  1II3 A;  2XGT A;  1BKB A;  1KAW A;  2HDM A;  4YHH Q;  4NXN L;  1VQP A;  3VA5 A;  2XVS A;  4B3S L;  4A3B G;  3FKI B;  2UXB Q;  1WCM H;  1W3S A;  1L0X B;  1YNJ C;  4P74 A;  4DAY B;  3RZD B;  2A69 C;  2D5D A;  4BY7 H;  4BBS G;  2QEX A;  1YI2 A;  4IO9 A;  1EUJ A;  1S5F D;  3D4R A;  2JXM B;  4P72 A;  4PMC A;  3IFD A;  4POF A;  5IYC H;  4NXN Q;  1DXM A;  4B3S Q;  2B2U A;  3I73 A;  1TWF H;  1S5B D;  1CHQ D;  1XXG A;  3CQZ H;  2NVX B;  3K8A A;  4QJF A;  3U4V A;  4B08 A;  4KY5 A;  1CKM A;  5E7N A;  2BDO A;  3GP7 A;  4RHR A;  2L11 A;  4U67 3;  3M3Y H;  3S1N H;  2AWN A;  3F2C A;  4N9T A;  1I50 B;  2JSO A;  3K5O A;  1PH9 A;  1X3Q A;  5JJL A;  1AE3 A;  5CBA E;  1X3P A;  3PO3 B;  3QJY A;  1CKO A;  4TQU S;  1C4Q A;  2SEB D;  4OEL B;  3KBX A;  1PRT D;  2J0T D;  2HQL A;  1CQV A;  3A8I E;  1SRU A;  3I4M B;  1DGS A;  4A3M H;  2ALY B;  1VQN A;  1RDP D;  3BJU A;  1B50 A;  1WYD A;  1GD7 A;  1K3B C;  4DKA C;  5C44 H;  1GOZ A;  3LNN A;  4H44 C;  2UUC L;  1CQF A;  2KEE A;  3D6W A;  5JEA J;  4CHT B;  1PH7 A;  4HN7 A;  3HS0 C;  4Z9C B;  3DEO A;  1TII D;  1LT6 D;  5CV7 A;  4DAY A;  1GO3 E;  2K14 A;  4GNX C;  1HNX L;  3S14 B;  5AFW A;  1GUN A;  3ERS X;  1ASY A;  1YJN A;  2UUC Q;  4HCE A;  1FL0 A;  2IPK D;  4KLK A;  3A5Z B;  4IUP A;  3I4N H;  1LUZ A;  4K0K L;  3TP8 A;  3P1H A;  1T9H A;  2N3S A;  3J80 E;  1B9M A;  1TU2 B;  1KD1 C;  3NXW A;  1HNX Q;  2ZXR A;  3CP0 A;  4DR3 L;  2KJX A;  2F1M A;  4HMJ A;  3HRZ C;  2RDG A;  4BY1 G;  5DNF A;  4K0K Q;  2F0M A;  2R7F A;  5JJI A;  1B9N A;  4FF2 A;  2AMC B;  3Q23 A;  1LTB D;  2K28 A;  4A3F H;  5LMN L;  3BDL A;  4HJ9 A;  4B9X A;  4X3U A;  3NK9 A;  5KYL A;  2R92 H;  5BN5 A;  4DR3 Q;  4FYD A;  1KL9 A;  3TZU A;  4RAU C;  1JWU D;  2N49 A;  2JA5 G;  2I5M X;  2RHS B;  1FNW A;  2O2L D;  1HZB A;  3HGB A;  4F7X A;  5IGE A;  3TP6 A;  3ITP A;  3PQI A;  1EZ6 A;  3V05 A;  1EWI A;  1EOV A;  5KYI A;  3GTP H;  3JAM c;  3A56 A;  3G4S A;  5LMN Q;  1M8A A;  4KHP L;  1BBW A;  1SND A;  4OXP A;  5IP9 G;  2JJQ A;  1IYU A;  1N34 L;  3MXP A;  3CCS A;  4CJ1 B;  3PO2 H;  1K0S A;  2WFW A;  4HIO A;  2EYO A;  4B3M L;  3K7U C;  1KNA A;  1WJJ A;  5D3D A;  2F0O A;  1VQD A;  4KHP Q;  5KGU A;  1PHJ A;  1UE5 A;  4EQ5 A;  2F0F A;  3GD7 A;  4O0A A;  3NE5 B;  1N34 Q;  5CV6 A;  4UPA A;  3K0Y A;  4BY7 B;  3D4D A;  1Q8I A;  2B2V A;  4C3I G;  4B3M Q;  3S2H B;  1Q7Y C;  1SBB B;  2QF7 A;  1IYV A;  3PIP 3;  4ODG A;  5C3X A;  4DR6 L;  4DV5 L;  4A3D H;  1IL2 A;  1MJE A;  4XIG S;  5EKK A;  2F0E A;  1KDB A;  3MC0 B;  2ID0 A;  4PMB A;  1VCI A;  3SVM A;  1RJT A;  3S1N B;  5IIF A;  4JBM A;  2F0S A;  2HCI A;  1GUW A;  2HD3 A;  1SE2 A;  3BYT B;  4X66 L;  3KOJ A;  2BH2 A;  5COR A;  3Q22 A;  4RG1 A;  1ZXT A;  4PG3 A;  2VQE L;  5CGK A;  4MTK A;  5IGD A;  4ZUJ A;  1EYA A;  1HHV A;  1VQA A;  4IFD H;  4CGY B;  1N8R C;  3GTO H;  3G6J B;  1HR0 L;  4A3M B;  1U5K A;  2Z6K A;  4X66 Q;  2KEC A;  1A2T A;  4KV6 A;  3A54 A;  1R9T B;  1CA5 A;  4N9P A;  2VQE Q;  1FGU A;  4OO1 I;  4KN4 C;  1AE2 A;  4A3B H;  2A73 B;  1X3F A;  4OX9 L;  1KAB A;  1VF5 C;  4IN3 A;  4BA1 I;  2MO1 A;  1F9Q A;  2CW0 D;  1HR0 Q;  1IKM A;  3S1R B;  3S1M B;  5C6A A;  3FHW A;  4RH6 A;  1SFO H;  4EGV A;  3VR5 A;  1CK1 A;  4R4I A;  5IYB H;  2ES2 A;  2EY1 A;  2EJF C;  2QKI C;  5A35 A;  3I72 A;  2FIN B;  1MIU A;  2JA7 G;  4PQX A;  1WTW A;  1D2B A;  5EKL A;  1WI5 A;  2RBM A;  1JOK A;  2K05 A;  2I5L X;  3I4N B;  1C48 A;  3BVZ A;  1D1I A;  2IX1 A;  3D0F A;  3SK8 A;  4YCW A;  3GQB A;  3QR8 A;  4GNX B;  1EL0 A;  2B2Y C;  1K8M A;  1A2U A;  3NPP A;  1WTO A;  3S2D H;  4IUT A;  4LFA L;  5E4W C;  4A3I H;  5FLM G;  4WJ3 M;  3A8J E;  1A62 A;  1VQK A;  3I4M G;  1I3Q H;  2YTY A;  4DAP A;  5BN3 A;  2K6A A;  5LMN W;  2FMC A;  2G9H D;  3HZX A;  3VYT A;  1SE8 A;  2ZTC A;  4LWC A;  1SYD A;  4U68 A;  5JOB A;  1MJC A;  4LFA Q;  2BCO A;  1JWS D;  3GTM H;  3FRP B;  1HFN A;  2DNC A;  2OTL A;  2X6L A;  3CRK C;  3T1Y L;  1O78 A;  5GRO A;  2MFI A;  3RN2 A;  3BYY B;  1N9W A;  3TSS A;  3CMA A;  3DXJ C;  3I4L A;  1TKW B;  3PO2 B;  2ZT9 C;  1STN A;  1OXT A;  1F2L A;  4EVO A;  2WII B;  3EA6 A;  1Y8N B;  4XQJ A;  3KLS A;  3T1Y Q;  4YWK A;  1PH6 A;  3KLS X;  4QUF A;  4OWT B;  4KKT A;  4QY7 A;  4XYO A;  3BDO A;  4CKE A;  1W6K A;  2MNA A;  2PZT A;  2YTV A;  5M3M H;  4QIW B;  2A1A A;  5KNB A;  1KDA A;  5FO7 B;  5LMU L;  3DHQ A;  5BR8 L;  2L5T A;  1TY2 A;  3BU2 A;  4C3H H;  3CCQ A;  1IW7 D;  4X64 L;  3KF6 B;  4UP8 A;  3QOL A;  2YYZ A;  2CCZ A;  1X65 A;  3GTG H;  2JE6 I;  3BZK A;  1SE4 A;  1PZJ D;  1YZ6 A;  3B6Y A;  4ZCK A;  1YJW A;  4DUY L;  1G2T A;  5LMU Q;  1J5E L;  5BR8 Q;  3SK5 A;  3KF8 A;  4YWL A;  1V1O A;  2A6H D;  4RMF A;  5J1Z A;  1OXX K;  1PTO H;  3K81 C;  1LTR D;  3HKZ E;  4DN4 M;  4C3J B;  5LL6 S;  2GN5 A;  3K5N A;  2IY5 B;  2N78 A;  4JI8 L;  2DNE A;  1I4Q A;  1NY4 A;  1E1O A;  1E3P A;  4DUY Q;  3PMF A;  5E4X A;  5FOB B;  2B2U C;  2A68 C;  1VF7 A;  1J5E Q;  4LUZ A;  1NMG A;  3MTS A;  3U58 A;  4QB4 A;  1HR0 W;  4DUZ Q;  5CBE E;  1D5X C;  1NNX A;  4RHS A;  1SYF A;  1PYW D;  2VXW A;  4JI8 Q;  1WCM G;  5M5Y B;  3SK4 A;  1JOO A;  3VR6 A;  4RKL A;  4AYB G;  4A3B B;  1BO0 A;  2A19 A;  4BY7 G;  4ZYS A;  2VNU D;  2IX0 A;  3FMC A;  4JI1 L;  5BN4 A;  4BBS B;  4C3I H;  3J81 j;  1JJ2 A;  1SFO B;  3A8K E;  1BCP D;  5IYC G;  3H0G H;  1I4R A;  2R7D A;  2RF4 A;  1TWC H;  4HCS A;  3U9S A;  3JAM L;  1AW7 A;  1YNN C;  2HDL A;  4X62 L;  5I6W A;  1EIG A;  3IAY A;  3RLN A;  4JI1 Q;  1YIT A;  3NP8 A;  3G7L A;  5EKI A;  4NPS A;  1VQE A;  2TSS A;  1TWA H;  5GAE C;  2L55 A;  1KC8 C;  4I7Z C;  2ZJR A;  3T4A C;  2VQF L;  1S5C D;  1PDQ A;  4N8F A;  3J80 i;  4RWS C;  5IOD A;  4OWW B;  3TP7 A;  4LF9 L;  1QOH A;  2F03 A;  3SXH A;  3J81 c;  1DON A;  4X62 Q;  3S2D B;  1HH2 P;  3EVQ A;  2DGY A;  4A3I B;  2KED A;  4XYQ A;  3ZJY C;  1T5X D;  3OIP A;  1LO5 D;  1ROD A;  4FP5 D;  5M5W H;  3A55 A;  4A3E H;  1I3Q B;  2VQF Q;  4A3M G;  1SJE D;  3RN5 A;  3FPU B;  4LF9 Q;  2K4K A;  1O7Z A;  2BA0 A;  4MHE A;  1KRS A;  3CCJ A;  4O1N A;  2AQ3 B;  5C44 G;  4A3G H;  1OTC A;  3TN2 A;  3KDF B;  2IWH A;  3AMU A;  1KTK A;  3D3R A;  1SR3 A;  4GOP A;  1I6H H;  4GLA C;  3F2U A;  4HJ8 A;  4A3C H;  3J7Z C;  2V1C C;  4UP9 A;  3AU7 A;  5EBC A;  2L4N A;  4FXG C;  3NEM A;  2JA8 H;  2K7V A;  4LUV A;  3CME A;  1TWG H;  3E5S A;  3I4N G;  3GO5 A;  1E24 A;  1L1O C;  3STB C;  3TQY A;  1Y14 B;  5GAG C;  2KCM A;  3UE0 A;  2I0Q A;  2FMM A;  4ILW A;  4GN5 A;  2ICI A;  5EAY A;  4DR1 L;  1NSN S;  4ALP A;  4OHJ A;  2QW7 A;  5HUR A;  4DAV A;  3CHB D;  3HOX H;  4IPD A;  4BY1 B;  2EPB A;  4A3F G;  1B8A A;  4CDE C;  3NQT A;  4X3S A;  2LS0 1;  2RVL A;  4RA8 A;  2EZV A;  2R92 G;  2WAQ E;  2XN9 C;  1STY A;  1N32 L;  5I4D A;  4JI6 L;  4CKB A;  4DR1 Q;  1HNW L;  3M4Q A;  4DR4 L;  4P73 A;  1I5F A;  1FGB D;  2PYK A;  1RTO A;  2H1E A;  3ULJ A;  2A74 C;  2D0O A;  1L2F A;  2N88 A;  3GTJ B;  3EIV A;  4JI0 L;  3QO2 A;  3AFQ A;  1N32 Q;  4OGQ C;  1WFQ A;  5ELF A;  4JI6 Q;  4WJW A;  3PO2 G;  4DR4 Q;  2F0Q A;  1A3U A;  3TRZ A;  1V8Q A;  1SMY D;  3PSI A;  4JBJ A;  4KJN A;  5TSS A;  2EJM A;  2PMZ B;  1LT4 D;  3OW2 A;  2PMZ E;  4K8J A;  2D9U A;  2K1B A;  2L1B A;  4JI0 Q;  1TQO A;  2VB2 X;  5JPN C;  1E2W A;  4X3T A;  5M3F H;  5I2X A;  1EY6 A;  4GKJ Q;  1LYL A;  1AH9 A;  1EEF D;  1U4L A;  1ZYR D;  3KYH C;  2F3V A;  4C3I B;  1BDO A;  4Y7N H;  1CTM A;  3NBI A;  2N8N A;  4IJH A;  1G8Z D;  3N6R A;  4NW2 A;  1TWC B;  1F2M A;  4A3D G;  5DM7 3;  3VR3 A;  1BVS A;  2DJF C;  4AQY L;  3Q8D A;  1EQV A;  1VQJ A;  2E2J H;  2JP1 A;  4ZKC B;  1RL2 A;  3PIO A;  2YTX A;  5IYD H;  5JEA H;  1I4H A;  1WTP A;  2N55 A;  3HKZ G;  4OWX B;  4K6D A;  2F4I A;  2MP1 A;  5DM6 3;  1STE A;  2EYF A;  4HMI A;  1BXT A;  1LTG D;  2QCP X;  4KMU C;  4HJ5 A;  1CSP A;  3M4O H;  4IFD G;  3UDX A;  1JCK B;  4G7Z C;  1B7Y B;  2WKC A;  1JOQ A;  3TP5 A;  2M2L A;  1P8L A;  5M5W B;  5KIX A;  1D8L A;  4WRD A;  1XMQ L;  1LV9 A;  3OWF A;  2F0N A;  3BVG A;  4O42 A;  1I6H B;  1R4Q B;  2UUB L;  1NTG A;  1BUV T;  3NEL A;  5IYB G;  1XMQ Q;  5AJ3 L;  4NMZ A;  3MHB A;  2RSO A;  1QVC A;  2JA7 B;  1ILQ A;  1YVC A;  1SYC A;  2CH4 W;  1WVL A;  1EY5 A;  1SMX A;  2UUB Q;  4KTA A;  1K8O A;  2IHF A;  2SNS A;  4JOI A;  1PRT C;  2B3G A;  1FVI A;  5AJ3 Q;  2VL6 A;  3W2D A;  1SNO A;  1ET9 A;  2K52 A;  1LTL A;  3PUW A;  1Z9F A;  2E76 C;  3I55 A;  2NN6 H;  4JI2 L;  4A3I G;  1M1K C;  1YNJ D;  2R3Z A;  5DLQ E;  3F2D A;  4G7H C;  1CHP D;  3EFX D;  1L1O B;  3CW2 C;  4DR5 L;  2YU9 B;  5IP7 H;  3U9O A;  1PH5 A;  2NTT A;  4C2M H;  1E0B A;  4JI2 Q;  1J6Q A;  1IBL L;  1GXD C;  2SDF A;  4K2L A;  4FXK C;  3C46 A;  4PZ8 A;  2MJ8 A;  4DR5 Q;  1WTR A;  3RZO H;  3CRL C;  4K6L A;  2EY6 A;  4A3L H;  1TS2 A;  4NP5 A;  1GJX A;  1EWC A;  1O7L A;  4GLV B;  1IBL Q;  1N36 L;  3J81 L;  5CV4 A;  2B63 H;  1C7Y A;  5D3I B;  4LF4 L;  1FYC A;  4YWM A;  1Q8K A;  3HOV H;  3KJP A;  3TS2 A;  4GZY C;  3C2P A;  2EYJ A;  5GAD C;  2J4X A;  4R4Q A;  5M3M G;  3VR4 A;  1WTV A;  1N36 Q;  1K83 H;  1VQG A;  1LT5 D;  3A0J A;  2OF1 A;  2E5L L;  4LF4 Q;  4JBW A;  4Y7N B;  4C3H G;  1YHQ A;  1EOT A;  1SE3 A;  2WAQ G;  3PF4 A;  1AFP A;  4ZUI A;  1EQR A;  3X3N A;  1X3E A;  1VQF A;  3D4W A;  2C5C A;  1A3T A;  1YHA A;  2DUD A;  1TWH B;  3PUY A;  2E5L Q;  1L1O A;  2P5Z X;  2CWP A;  4H13 C;  3Q6S A;  2IJ0 A;  3OMC A;  4BA2 I;  2D0P A;  1MGS A;  3S15 H;  2PW7 A;  1PH1 A;  3NQI A;  1YHB A;  2Z0S A;  2LKV A;  1TR5 A;  3M4O B;  3K59 A;  3RR5 A;  2EXD A;  5CYU A;  3BDC A;  4DNR B;  3K7A H;  1FJG L;  5C4J B;  2FFK B;  3ERO A;  4DGZ A;  2K04 A;  1A3V A;  4MTN A;  2Z9H A;  2O5I C;  1SRO A;  2KCN A;  4IUN A;  2J7Z A;  1WCM B;  1UE7 A;  5IT9 E;  4AYB B;  2Z8L A;  4AYB E;  1MSG A;  3OW7 A;  3GTL H;  4C1N I;  1FJG Q;  4AIM A;  3H0G G;  3W3A A;  2NYZ D;  4HAE A;  4KY7 A;  1EQQ A;  1X32 A;  5IE8 A;  1TWF B;  3CQZ B;  1GKH A;  4N8X 1;  5EBD A;  3FEW X;  4RGM A;  1EQT A;  1UEB A;  2KVM A;  1GUG A;  4H0L C;  4DR7 L;  1EYC A;  3M3Y B;  2HCC A;  1KLG D;  1QB5 D;  5LHY 1;  2F0L A;  3OYY A;  2LXK A;  2PW5 A;  4DR6 Q;  3ND9 A;  1S4Z A;  3IFT A;  4DV5 Q;  4GOP C;  3J7A V;  1ICW A;  1Z7T A;  3F1Z A;  5EQ0 A;  2D2C C;  2WP8 J;  3CCV A;  4G57 A;  3F8T A;  5GAH C;  2CQA A;  4JCV E;  3G48 A;  1HPC A;  1PRT B;  2CW0 C;  4A3E G;  1CUK A;  4L8J A;  5K5P A;  3MEH A;  3H91 A;  3M4P A;  3A5U A;  3W1B A;  1ILP A;  2PZU A;  1K0R A;  4LF6 L;  4A3G G;  3OMG A;  4QUC A;  5C44 B;  1W6J A;  3IL8 A;  3ONA B;  2B2W C;  1RKN A;  4EQN A;  1CM9 A;  2I5H A;  2H4O A;  1QIL A;  3MXN A;  3NTK A;  4A3C G;  3RZO B;  1A15 A;  2C35 B;  3OPO A;  1HCZ A;  2MUY A;  1CZG A;  1I4P A;  1B44 D;  4LF6 Q;  1AN8 A;  4YY3 L;  1CT1 D;  4BXX H;  1RD9 D;  1S5E D;  2JA8 G;  5EPJ A;  4I7A A;  2L0C A;  4OX9 Q;  2JK8 A;  1RCV D;  1MD2 D;  1AZP A;  4P71 A;  3A7L A;  4K5V A;  1JB7 A;  3HOV B;  1OO9 B;  2Q2U A;  3EQL C;  4LJZ C;  5EJW A;  3I3C A;  1KHI A;  5EPL A;  4A93 H;  2I46 A;  4CJ2 C;  4IAL A;  3CCR A;  4IOC A;  3E0J A;  4KY6 A;  2Z6B A;  4HID A;  5ISR A;  1K83 B;  4J8Q A;  3K0X A;  4TRD A;  1EIH A;  2PQA B;  4IUV A;  1RIP A;  3HOX G;  3UDF A;  2XNA C;  2NWG A;  3L3O C;  2QEJ C;  3S1Q H;  1GUT A;  4PMW A;  5C3E H;  4QF4 A;  3TRE A;  3CPW A;  1AP0 A;  4A3F B;  1Q86 C;  3KF8 B;  5T1G A;  2R92 B;  4DV2 L;  1UE1 A;  4K5X A;  3ZYY X;  4R9W A;  3OSO A;  1XJV A; 
#chains in the Genus database with same CATH homology
 4Q5V A;  2WIN B;  4OO1 H;  2LFN A;  1GUO A;  1H9S B;  1G6Z A;  4ZLT F;  3GTP B;  4TSS A;  3MVV A;  1AEX A;  3TME A;  1O7Y A;  3LWU A;  5ELD A;  4RCO A;  3ND8 A;  3DWA A;  1DCZ A;  1VMC A;  4DXG A;  1Y8O B;  1Q3L A;  1IW7 C;  1ET6 A;  3EJI A;  1CI3 M;  4HTH A;  1KLU D;  2EOT A;  2EJG C;  3RD4 A;  3VYU A;  3GTL B;  3R2T A;  3MFG A;  1ENF A;  4KKS A;  1B53 A;  5JVG 3;  1S5D D;  2A6H C;  4M1U B;  1PTO C;  4A3D B;  2O5J C;  5IOC A;  5C0X H;  1LT3 D;  5JEA G;  2F0H A;  2DY8 A;  4ULL A;  1JB3 A;  5C4Z A;  1AZQ A;  3J7A F;  3HKZ B;  1TS3 A;  1O80 A;  1EY0 A;  4XT3 B;  3KLR A;  1SNM A;  2CHB D;  1H9S A;  1ESF A;  5KND A;  3GTO B;  3L9A X;  5FLX E;  1DOM A;  1XWE A;  4ZQ3 A;  1STG A;  1BNZ A;  1UEA B;  1BCP C;  2B2T A;  2NTS A;  1EZ8 A;  2EVB A;  1IHZ A;  3FDT A;  2RSN A;  1HUM A;  4KI0 A;  2V4D A;  2F0J A;  3JAM E;  2NUC A;  3R2I A;  1Y8P B;  4K14 A;  3NUC A;  2XWJ B;  3R93 A;  1TS4 A;  2OT2 A;  1DOL A;  2JEB I;  3M7G A;  1KNE A;  3P75 A;  1EFI D;  1EY8 A;  5LL6 X;  4UAI A;  1LLR D;  1PFN A;  2NN6 G;  4XDX A;  3K5L A;  3Q0A A;  2PNR C;  1PMR A;  3H3V C;  4MIU A;  2K5W A;  4B9W A;  4HR7 B;  5IGF A;  5FO9 B;  2A6E D;  1NR2 A;  3P7J A;  1A6X A;  1YNN D;  1PTO F;  3GTM B;  3WOE A;  2WB1 B;  4YIJ A;  3PUV A;  4IUR A;  3X3M A;  4KD3 A;  4V19 0;  5FKA C;  4DNT B;  3A7A B;  2X69 A;  1NAP A;  4KHV A;  1BF4 A;  3P20 A;  2KA7 A;  1SNQ A;  2B2W A;  2KOL A;  5M3M B;  3DMU A;  2BE5 D;  1C8C A;  3SR1 A;  1EEI D;  4M8A A;  4C3H B;  1T5E A;  2WAQ B;  3PV0 A;  2E75 C;  3RMH A;  2FJ2 A;  3GTG B;  2XSC A;  1G29 1;  2JA6 B;  2K33 A;  1SMY C;  3V2T A;  1HUN A;  2F0T A;  4LAA A;  1QNK A;  5DAU A;  1PTO B;  5I6Y A;  1SYG A;  2EE1 A;  2MHV A;  1H9M A;  3R8B A;  4A3K B;  1FNU A;  2F0K A;  4UDU C;  1M4V A;  3O13 A;  1TT2 A;  2A5H A;  2EYH A;  4OIJ A;  2AUJ D;  5A2Q L;  5J22 A;  3H94 A;  1BCP B;  2PZW A;  4OIK A;  1F9S A;  1H9J A;  3H0G B;  3S9W A;  1EWH A;  2F0V A;  3T13 A;  1SSO A;  3OHX C;  1EY7 A;  1NUC A;  2IX3 A;  2F0W A;  3C1F A;  3SHL A;  1EU4 A;  1DM0 B;  1TWA B;  3OIQ A;  1UAP A;  2RKS A;  2KQ3 A;  4FVM A;  3K57 A;  1Q12 A;  2QDB A;  3QB3 A;  1QJO A;  1LTI D;  4K2K A;  1ENC A;  1U4R A;  1F77 A;  4A3E B;  2ICE C;  4DK1 A;  2RA4 A;  2M00 A;  4ID6 A;  1SDF A;  2JEA I;  4KKU A;  3T56 B;  4FXD A;  4A3G B;  1EU3 A;  4F87 A;  2WV6 D;  3Q24 A;  2NZ1 D;  2NN6 I;  2EXZ A;  3I70 A;  1SAP A;  3MFY A;  3QWN A;  2F0U A;  1SNP A;  2XRS D;  3VYS A;  3DWP A;  2XRQ D;  2WAC A;  4WOR A;  3KUP A;  5T1I A;  2OXP A;  2JA8 B;  1TWG B;  2RDH A;  2K32 A;  5I9O A;  3K58 A;  1KDC A;  4HSP A;  3OOC A;  4F88 A;  1I6V C;  3M4Y A;  1TS5 A;  4TKO B;  3HEJ A;  5CV9 A;  2PPB C;  4DXF A;  2M9V A;  3HOX B;  2A69 D;  2B39 A;  1OXS C;  2EYM A;  1H9K A;  4S3S A;  3N52 A;  2AUK A;  4MN3 A;  1OXU A;  4OO1 G;  5G3L F;  1NCV A;  3T53 B;  4QCL A;  1B3A A;  3D8G A;  1ZEQ X;  1F2Z A;  3QG1 A;  5CV5 A;  2RDF A;  4ABN A;  4V0B A;  2ZXO A;  3T51 B;  4K8I A;  4K5W A;  3MAQ A;  1BR9 A;  3R3O A;  1ZKO A;  3M85 A;  5CC4 A;  3J81 E;  3TDQ A;  1DYQ A;  3HOY B;  3C1E A;  1XTC D;  5M9O A;  1LTT D;  1JE4 A;  5KNC A;  1PZK D;  5FK9 C;  2F3W A;  4ME5 A;  4G4K A;  4L6T B;  5M3F B;  1SXT A;  1JIC A;  2SNM A;  3FVQ A;  4XQQ A;  1HA6 A;  1ENA A;  1DJR D;  3HOU B;  1E2V A;  3CKI B;  3DEP A;  1PLF A;  2E74 C;  2F0I A;  4IUQ A;  1IKL A;  1V43 A;  1F9R A;  4OL7 A;  3WOF A;  5C0X G;  2E2J B;  3GV6 A;  2E2D C;  1NR4 A;  1Q1E A;  1EYD A;  2B2T C;  3I91 A;  1SYE A;  4R8I A;  1SJH D;  2MGS A;  3RLF A;  4XXE A;  3J80 L;  2D62 A;  4FO2 A;  5M5X B;  3H09 A;  5EGT A;  5E3F A;  1PRT F;  2BA1 A;  5I2Y A;  1RF2 D;  2ZXP A;  3D6C A;  3SE0 A;  5C3W A;  3NHH A;  1B2T A;  5CMD A;  1D5Z C;  2L9H A;  3K6O A;  4PV1 C;  4DF7 A;  4FF4 A;  3UI2 A;  4IFD I;  4R8N A;  4CJ0 B;  4ZAI A;  3SEB A;  2IW3 A;  5F2D A;  1BQQ T;  3MXG A;  2IL8 A;  3QOJ A;  1D1K A;  3PIO 3;  3L7Z C;  3GV3 A;  4FF1 A;  4BWG B;  2XWB B;  4RFB A;  1STH A;  2KUM A;  2Q8R E;  3HOZ B;  5IT9 L;  3FPP A;  4IQZ A;  5ELE A;  2EDG A;  5COY A;  1QG7 A;  1HA5 A;  1KAA A;  2AQ1 B;  3H6M A;  1WD0 A;  5C5M A;  2X6G A;  4CBV A;  4BS9 A;  2K03 A;  1Q1B A;  2RQX A;  3S17 B;  5K36 G;  2ENB A;  4RKB A;  3S16 B;  1BBX C;  3NWS A;  4ZRZ A;  4C2M B;  4C1N K;  3I90 A;  2E2H B;  1R4P B;  2EYL A;  1Y69 U;  1GUS A;  2F0P A;  2PCF B;  5JAV A;  1U4M A;  1F2Y A;  4H7B A;  1MI2 A;  1D6E C;  2B63 B;  5C4X B;  1ESR A;  2R93 B;  5D65 A;  5CR3 A;  3LX0 A;  4IZ8 A;  3DWQ A;  5J39 A;  1UNS A;  2E2I B;  3BG3 A;  3AB9 A;  4RGO S;  2Q8T A;  1BOS A;  1VMP A;  4HSV A;  3HG9 A;  1U4P A;  1XX8 A;  1Z47 A;  5IGC A;  1DD2 A;  3BVM A;  3NWT A;  2JYO A;  2Z4I A;  5JPM C;  1LTS D;  2TMP A;  3C3L A;  4KD4 A;  5FO8 B;  3OWE B;  1SYB A;  3IKJ A;  3S15 B;  5D14 A;  3GTK B;  2PQE A;  5C0X I;  4DFA A;  3K5M A;  3K7A B;  1FD7 D;  3NSW A;  3M7N A;  1TVX A;  1LAC A;  2EY5 A;  3I8Z A;  5C5L A;  3ERQ A;  4I65 A;  5I9P A;  5IGG A;  2DN8 A;  2NBF A;  1MSH A;  1U9R A;  1QCB D;  4IFD J;  4DU9 A;  4RGT A;  2B8F A;  4L63 B;  1MBY A;  1VDZ A;  2BOS A;  4IUU A;  1GHJ A;  4BBR B;  1EY4 A;  1UUP A;  2K5Q A;  5JJZ A;  4KK7 A;  1XYI A;  4RGN A;  4NKL A;  5JVH 3;  1G91 A;  1WTX A;  1GHK A;  1J8I A;  4EQO A;  3MXU A;  3TZD A;  1E2Z A;  2FHT A;  2DY7 A;  3D31 A;  1JR0 D;  1RHP A;  1PTO D;  5ELB A;  1RTN A;  2F0D A;  2C9O A;  4KHZ A;  2AWO A;  2BDN A;  1L0Y B;  1PXU A;  1Y1V B;  3PUX A;  2PO4 A;  5FLX L;  4XTC S;  3DUZ A;  3MZ5 A;  2NVT B;  2A68 D;  1I4G A;  5NUC A;  4A93 B;  3T16 A;  2QIL A;  2SOB A;  1JC7 A;  2A6E C;  5DEH A;  4LK1 C;  4C56 C;  1STB A;  5EPK A;  5KEE A;  3S1Q B;  4X3K A;  5C3E B;  1HTP A;  3BZD B;  2GA4 B;  3V96 A;  1HTL D;  4E6I A;  5K36 H;  2NB0 A;  2I07 B;  2B8G A;  2KCC A;  1V1P B;  4CKC A;  1DZ1 A;  1WTQ A;  3KBG A;  4FF3 A;  4HED A;  2NVQ B;  1G2S A;  1TY0 A;  2OEO A;  2VB3 X;  1CA6 A;  3SK6 A;  1Q90 A;  3E6Z X;  2BE5 C;  1JQY D;  5C0X J;  1PZI D;  2R7Z B;  2LMC B;  3TBI B;  3NTH A;  1FR3 A;  2LY7 A;  5CV8 A;  3VA7 A;  2Q8I B;  3QIA A;  1J9O A;  1HRJ A;  1JOR A;  1BCP F;  1B4O A;  1DOK A;  2G9D A;  2Z1C A;  4JK1 C;  5E1F A;  3NBH A;  4WFN 3;  1Y1W B;  4ZKB B;  1HFG A;  1QNU A;  1JWM D;  1QE6 A;  4XQN A;  3VR2 A;  4EQP A;  5IGB A;  4Q0F A;  4PNY A;  2CVR A;  1EY9 A;  3VYR A;  2K5D A;  1ONL A;  4FNF A;  2R6G A;  1HQR D;  1V1P A;  3CU7 A;  1ZYR C;  3PUZ A;  2JA5 B;  2HUG A;  1LTA D;  5A2Q E;  2B2Y A;  1HXY D;  3KK7 A;  2B2V C;  4LMQ D;  5KRU A;  1LAB A;  4J6H A;  4P2C B;  2Y0S B;  4DA2 A;  4A3J B;  2O4X A;  5C4H A;  5ELC A;  2VUM B;  4QMG A;  4KJO A;  4KN7 C;  2HQE A;  2NVY B;  2L12 A;  3URY A;  1STA A;  3DM1 A;  2WKD A;  4DK0 A;  2IT1 A;  1HQM C;  3NTI A;  3BS1 A;  3WDN A;  3HP3 A;  4NDX A;  3RUZ A;  1I4X A;  1QWY A;  1ML0 D;  4J1M A;  3J7Y W;  1B1Z A;  4XT1 B;  3HOW B;  2MPM A;  3LWE A;  1PFM A;  2R61 A;  1WD1 A;  1IL8 A;  1F9P A;  1CZW A;  1Z6H A;  1PFB A;  1D5M C;  4ZK9 B;  2EYP A;  1SNC A;  2F0G A;  5G3L D;  2XIW A;  1FNV A;  3MA2 B;  3MWY W;  4C3J G;  2EY2 A;  1H9R A;  1SEB D;  4F8M A;  4G7O C;  2K01 A;  2AQ2 B;  2Z4H A;  3SDZ A;  5HGT A;  1OXV A;  3GTQ B;  1CFM A;  4RCN A;  2KHS A;  1II3 A;  2HDM A;  3VA5 A;  2XVS A;  3FKI B;  1L0X B;  1YNJ C;  3RZD B;  2A69 C;  2D5D A;  1S5F D;  3D4R A;  2JXM B;  4PMC A;  3IFD A;  1DXM A;  2B2U A;  3I73 A;  1S5B D;  1CHQ D;  1XXG A;  2NVX B;  4B08 A;  4KY5 A;  2BDO A;  3GP7 A;  4RHR A;  2L11 A;  4U67 3;  2AWN A;  4N9T A;  1I50 B;  2JSO A;  3K5O A;  1X3Q A;  5CBA E;  1X3P A;  3PO3 B;  3QJY A;  4TQU S;  1C4Q A;  2SEB D;  3KBX A;  1PRT D;  2J0T D;  1CQV A;  3A8I E;  3I4M B;  1RDP D;  1B50 A;  1GOZ A;  3LNN A;  4H44 C;  1CQF A;  2KEE A;  3D6W A;  5JEA J;  4CHT B;  4HN7 A;  3HS0 C;  4Z9C B;  3DEO A;  1TII D;  1LT6 D;  5CV7 A;  4DAY A;  3S14 B;  5AFW A;  1GUN A;  4HCE A;  2IPK D;  4IUP A;  3TP8 A;  3P1H A;  3J80 E;  1B9M A;  1TU2 B;  3NXW A;  2ZXR A;  2KJX A;  2F1M A;  4HMJ A;  3HRZ C;  2RDG A;  5DNF A;  2F0M A;  1B9N A;  4FF2 A;  3Q23 A;  1LTB D;  2K28 A;  3BDL A;  4B9X A;  4X3U A;  3NK9 A;  5KYL A;  5BN5 A;  4FYD A;  3TZU A;  4RAU C;  1JWU D;  1FNW A;  2O2L D;  3HGB A;  4F7X A;  5IGE A;  3TP6 A;  3ITP A;  1EZ6 A;  3V05 A;  5KYI A;  3A56 A;  1M8A A;  1SND A;  1IYU A;  3MXP A;  4CJ1 B;  2EYO A;  1KNA A;  5D3D A;  2F0O A;  5KGU A;  2F0F A;  3GD7 A;  3NE5 B;  5CV6 A;  3K0Y A;  4BY7 B;  3D4D A;  1Q8I A;  2B2V A;  4C3I G;  3S2H B;  1SBB B;  2QF7 A;  1IYV A;  3PIP 3;  4ODG A;  5C3X A;  4XIG S;  5EKK A;  2F0E A;  1KDB A;  3MC0 B;  2ID0 A;  4PMB A;  1VCI A;  3SVM A;  1RJT A;  3S1N B;  5IIF A;  2F0S A;  2HCI A;  1GUW A;  1SE2 A;  3BYT B;  5COR A;  3Q22 A;  1ZXT A;  5CGK A;  5IGD A;  4ZUJ A;  1EYA A;  1HHV A;  4IFD H;  4CGY B;  3G6J B;  4A3M B;  1CA5 A;  2KEC A;  1A2T A;  4KV6 A;  3A54 A;  1R9T B;  4N9P A;  4OO1 I;  4KN4 C;  2A73 B;  1KAB A;  1VF5 C;  4IN3 A;  4BA1 I;  1F9Q A;  2CW0 D;  1IKM A;  3S1R B;  3S1M B;  5C6A A;  4RH6 A;  4EGV A;  3VR5 A;  1CK1 A;  2EY1 A;  2EJF C;  2QKI C;  5A35 A;  3I72 A;  2FIN B;  4PQX A;  1WTW A;  1D2B A;  5EKL A;  2RBM A;  1JOK A;  2K05 A;  3I4N B;  1C48 A;  3BVZ A;  1D1I A;  2IX1 A;  3SK8 A;  3GQB A;  1EL0 A;  2B2Y C;  1K8M A;  1A2U A;  3NPP A;  1WTO A;  4IUT A;  5E4W C;  3A8J E;  4DAP A;  5BN3 A;  2K6A A;  2FMC A;  2G9H D;  3HZX A;  3VYT A;  1SYD A;  4U68 A;  5JOB A;  2BCO A;  1JWS D;  3FRP B;  1HFN A;  2DNC A;  2X6L A;  3CRK C;  1O78 A;  3BYY B;  3TSS A;  3DXJ C;  3I4L A;  1TKW B;  3PO2 B;  2ZT9 C;  1STN A;  1OXT A;  1F2L A;  4EVO A;  2WII B;  3EA6 A;  1Y8N B;  4XQJ A;  3KLS A;  3KLS X;  4QUF A;  4KKT A;  4XYO A;  3BDO A;  4CKE A;  1W6K A;  2PZT A;  4QIW B;  5KNB A;  1KDA A;  5FO7 B;  3DHQ A;  2L5T A;  1TY2 A;  1IW7 D;  3QOL A;  2YYZ A;  2JE6 I;  1SE4 A;  1PZJ D;  1G2T A;  3SK5 A;  3KF8 A;  1V1O A;  2A6H D;  5J1Z A;  1OXX K;  1PTO H;  1LTR D;  4DN4 M;  4C3J B;  5LL6 S;  3K5N A;  2DNE A;  1I4Q A;  3PMF A;  5E4X A;  5FOB B;  2B2U C;  2A68 C;  1VF7 A;  3MTS A;  4QB4 A;  5CBE E;  1D5X C;  4RHS A;  1SYF A;  1PYW D;  2VXW A;  5M5Y B;  3SK4 A;  1JOO A;  3VR6 A;  4RKL A;  4A3B B;  1BO0 A;  4ZYS A;  2VNU D;  2IX0 A;  3FMC A;  5BN4 A;  4BBS B;  1SFO B;  3A8K E;  1BCP D;  1I4R A;  4HCS A;  3U9S A;  3JAM L;  1AW7 A;  1YNN C;  2HDL A;  5I6W A;  1EIG A;  3IAY A;  3NP8 A;  3G7L A;  5EKI A;  2TSS A;  2L55 A;  4I7Z C;  3T4A C;  1S5C D;  1PDQ A;  4RWS C;  5IOD A;  3TP7 A;  1QOH A;  2F03 A;  3SXH A;  1DON A;  3S2D B;  3EVQ A;  4A3I B;  2KED A;  4XYQ A;  1T5X D;  3OIP A;  1LO5 D;  1ROD A;  4FP5 D;  3A55 A;  1I3Q B;  1SJE D;  3FPU B;  1O7Z A;  2BA0 A;  4MHE A;  4O1N A;  2AQ3 B;  3TN2 A;  2IWH A;  3AMU A;  1KTK A;  3D3R A;  3F2U A;  3AU7 A;  5EBC A;  2L4N A;  4FXG C;  2K7V A;  3E5S A;  3GO5 A;  2FMM A;  4ILW A;  2ICI A;  1NSN S;  4OHJ A;  5HUR A;  4DAV A;  3CHB D;  4BY1 B;  2EPB A;  3NQT A;  4X3S A;  2LS0 1;  2RVL A;  4RA8 A;  2EZV A;  2XN9 C;  1STY A;  5I4D A;  4CKB A;  1FGB D;  2PYK A;  1RTO A;  2H1E A;  2A74 C;  2N88 A;  3GTJ B;  3QO2 A;  4OGQ C;  5ELF A;  4WJW A;  2F0Q A;  1A3U A;  1V8Q A;  1SMY D;  4KJN A;  5TSS A;  2EJM A;  2PMZ B;  1LT4 D;  4K8J A;  2D9U A;  2K1B A;  2L1B A;  1TQO A;  2VB2 X;  5JPN C;  1E2W A;  4X3T A;  5I2X A;  1EY6 A;  1EEF D;  1U4L A;  1ZYR D;  2F3V A;  4C3I B;  1BDO A;  1CTM A;  3NBI A;  1G8Z D;  3N6R A;  4NW2 A;  1TWC B;  1F2M A;  5DM7 3;  3VR3 A;  1EQV A;  2JP1 A;  4ZKC B;  5JEA H;  1I4H A;  1WTP A;  2N55 A;  4K6D A;  2F4I A;  2MP1 A;  5DM6 3;  1STE A;  2EYF A;  4HMI A;  1BXT A;  1LTG D;  2QCP X;  4KMU C;  4IFD G;  1JCK B;  4G7Z C;  1JOQ A;  2WKC A;  3TP5 A;  2M2L A;  5M5W B;  5KIX A;  4WRD A;  1LV9 A;  3OWF A;  2F0N A;  3BVG A;  4O42 A;  1I6H B;  1R4Q B;  1BUV T;  4NMZ A;  3MHB A;  2RSO A;  2JA7 B;  1ILQ A;  1SYC A;  1WVL A;  1EY5 A;  4KTA A;  1K8O A;  2SNS A;  1PRT C;  3W2D A;  1SNO A;  1ET9 A;  3PUW A;  2E76 C;  2NN6 H;  1YNJ D;  2R3Z A;  4G7H C;  1CHP D;  3EFX D;  2YU9 B;  3U9O A;  2NTT A;  1E0B A;  1GXD C;  2SDF A;  4K2L A;  4FXK C;  3C46 A;  2MJ8 A;  1WTR A;  3CRL C;  4K6L A;  2EY6 A;  1TS2 A;  4NP5 A;  1GJX A;  1EWC A;  1O7L A;  3J81 L;  5CV4 A;  5D3I B;  1FYC A;  4GZY C;  3C2P A;  2EYJ A;  2J4X A;  3VR4 A;  1WTV A;  1LT5 D;  2OF1 A;  4JBW A;  4Y7N B;  4C3H G;  1EOT A;  1SE3 A;  1AFP A;  4ZUI A;  3X3N A;  3D4W A;  2C5C A;  1A3T A;  1TWH B;  3PUY A;  4H13 C;  3Q6S A;  2IJ0 A;  3OMC A;  4BA2 I;  1MGS A;  2PW7 A;  3NQI A;  2LKV A;  1TR5 A;  3M4O B;  3K59 A;  5CYU A;  3BDC A;  4DNR B;  5C4J B;  2FFK B;  3ERO A;  4DGZ A;  2K04 A;  1A3V A;  2O5I C;  2KCN A;  4IUN A;  2J7Z A;  1WCM B;  5IT9 E;  4AYB B;  2Z8L A;  1MSG A;  3OW7 A;  4C1N I;  3W3A A;  2NYZ D;  4HAE A;  4KY7 A;  1X32 A;  1TWF B;  3CQZ B;  5EBD A;  3FEW X;  4RGM A;  1EQT A;  2KVM A;  1GUG A;  4H0L C;  1EYC A;  3M3Y B;  2HCC A;  1KLG D;  1QB5 D;  5LHY 1;  2F0L A;  2PW5 A;  3ND9 A;  1S4Z A;  3IFT A;  3J7A V;  1ICW A;  1Z7T A;  5EQ0 A;  2D2C C;  2WP8 J;  4G57 A;  2CQA A;  1HPC A;  1PRT B;  2CW0 C;  4L8J A;  5K5P A;  3MEH A;  3H91 A;  1ILP A;  2PZU A;  3OMG A;  4QUC A;  5C44 B;  1W6J A;  3IL8 A;  3ONA B;  2B2W C;  1RKN A;  4EQN A;  1CM9 A;  2H4O A;  1QIL A;  3MXN A;  3NTK A;  3RZO B;  1A15 A;  3OPO A;  1HCZ A;  2MUY A;  1CZG A;  1I4P A;  1B44 D;  1AN8 A;  1CT1 D;  1RD9 D;  1S5E D;  5EPJ A;  2L0C A;  1RCV D;  1MD2 D;  1AZP A;  3A7L A;  4K5V A;  3HOV B;  1OO9 B;  3EQL C;  4LJZ C;  5EJW A;  3I3C A;  5EPL A;  2I46 A;  4CJ2 C;  4IAL A;  3E0J A;  4KY6 A;  5ISR A;  1K83 B;  4J8Q A;  4TRD A;  1EIH A;  4IUV A;  2XNA C;  2NWG A;  3L3O C;  2QEJ C;  1GUT A;  4PMW A;  4QF4 A;  1AP0 A;  4A3F B;  5T1G A;  2R92 B;  4K5X A;  3ZYY X;  4R9W A;  3OSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...