2PQEA

Solution structure of proline-free mutant of staphylococcal nuclease
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
149
structure length
149
Chain Sequence
ATSTKKLHKEAATLIKAIDGDTVKLMYKGQAMTFRLLLVDTAETKHTKKGVEKYGAEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Restricted backbone conformational and motional flexibilities of loops containing peptidyl-proline bonds dominate the enzyme activity of staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 27
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pqeA00
3OMGA 3QOLA 5IGFA 5J1ZA 3T16A 1EZ8A 4J1MA 4PMBA 4YIJA 1KDCA 1EZ6A 4EQOA 1EY6A 2EYOA 2EYLA 1EY9A 2F0GA 2RKSA 2PYKA 3BDCA 4G57A 4S3SA 2EY1A 5JOBA 3TP6A 4F7XA 3H6MA 3P75A 3R3OA 4KV6A 4N9TA 1RKNA 2M00A 1EY5A 1TQOA 1TT2A 4EQPA 3D4WA 3EVQA 4ME5A 4ID6A 1EYDA 1IHZA 2F0EA 2F0IA 2F0OA 1JOKA 3P1HA 4KY5A 4ZQ3A 4ZUIA 2EYJA 2PZWA 5IGCA 5KYIA 5I9PA 4DU9A 5IGGA 1SNCA 4QMGA 3OWFA 2F0UA 2F0MA 5DAUA 3DHQA 5DEHA 2LKVA 3NHHA 3T13A 2PZUA 2HQEA 2QDBA 4ZUJA 5EKKA 1SYFA 4NKLA 3HZXA 1SYEA 2SNMA 5IODA 4HMIA 4WORA 5CV8A 1ENCA 3BDLA 3EJIA 4B9XA 3S9WA 1JOOA 3NP8A 5I6WA 5KEEA 5E3FA 2EYHA 3SK4A 4KY6A 2ENBA 5IGBA 2F0KA 2OF1A 1A3UA 1SNMA 5K5PA 3QB3A 3TP8A 1F2ZA 1A3TA 3V2TA 4K2KA 4PNYA 2F0LA 4K14A 4NMZA 5CV4A 5CC4A 2F0FA 1KDBA 2EYMA 2F0WA 2F0QA 4QB4A 5E1FA 1F2YA 1SYCA 5EKLA 5F2DA 1JORA 4ODGA 3OSOA 5KRUA 1AEXA 1SNQA 1STBA 4K8JA 4F8MA 5M9OA 4K6DA 1STNA 1ENAA 4OL7A 3SR1A 4B9WA 4KHVA 5CR3A 5C5LA 4NDXA 5HGTA 3D4DA 5ISRA 3MVVA 4DGZA 3LX0A 3NXWA 5C4HA 2EYFA 5IOCA 5KYLA 2F0NA 3ITPA 4KJNA 2F0VA 3SK6A 1STHA 2EY5A 4KJOA 3U9OA 5CV7A 4EVOA 3ERQA 3E5SA 2F0DA 1EY7A 2PQEA 3NK9A 5C3XA 4DF7A 3TP7A 4KD4A 1JOQA 4IZ8A 3C1FA 4K2LA 3RUZA 5IIFA 3SHLA 4TRDA 2F0SA 2F3WA 2F3VA 4I65A 4MIUA 4K8IA 3TMEA 3C1EA 4K5VA 1STGA 1II3A 2WACA 2PW5A 3TP5A 4IALA 4RKBA 4PMCA 5KGUA 2PZTA 4WRDA 2F0HA 1KAAA 2RBMA 3NUCA 5I9OA 4K5XA 5C3WA 1TR5A 4IUNA 5C5MA 3SK8A 4KTAA 3NQTA 4KD3A 5NUCA 5C6AA 5JAVA 5J39A 2OXPA 5CV5A 1SNDA 5IGDA 5CGKA 1EY4A 4HMJA 5HURA 5KIXA 4NP5A 1EY8A 3MEHA 4KY7A 1SNOA 2EXZA 1SNPA 3DMUA 4QF4A 1EY0A 2O4XA 3D8GA 4K5WA 2EYPA 2OEOA 5CV9A 1STAA 4HTHA 1SYDA 3HEJA 4R8NA 1SYBA 3MZ5A 2KQ3A 4J6HA 2EY2A 4N9PA 4RKLA 5J22A 1EYAA 1SYGA 2F0TA 3EROA 3QOJA 4LAAA 2NUCA 4DFAA 1EQVA 2KHSA 5I6YA 3D6CA 2SOBA 1KDAA 3MHBA 4H7BA 3PMFA 3SXHA 5IGEA 2SNSA 4E6IA 4EQNA 5C4ZA 1STYA 2PW7A 2EY6A 1F2MA 2RDFA 3MXPA 3OMCA 2F0PA 3SK5A 3VA5A 1A3VA 5EGTA 1KABA 1NSNS 1A2UA 1NUCA 2F0JA 1U9RA 1EYCA 5CV6A 1A2TA
chains in the Genus database with same CATH superfamily
3I4LA 2C5CA 2F0GA 4KKTA 1J8IA 1HNXL 2RF4A 3R3OA 4IN3A 2L55A 5TSSA 4KN4C 1XMQQ 3S1QB 3PQIA 3UI2A 1F2LA 4AH6A 1WTRA 1Q86C 4GNXC 2B2VA 3NBHB 5FK9C 1M90C 4RGNA 2EYJA 4NXNL 1L2FA 4DV5L 2F0UA 4DV0Q 4N8X1 3NHHA 2QDBA 4HCEA 1IYVA 4KN7C 3LGJA 3PF4A 3AMUA 1PFMA 2K75A 5HGQA 1K8OA 1XNRL 1PH4A 3S9WA 3NP8A 3NENA 3H94A 3GTJH 3BZKA 1O80A 1Q46A 4DV5Q 2DJGC 1BDOA 4GKKQ 1E2ZA 4A3JG 1IBLL 2WIIB 5A35A 3A55A 1J6QA 1XNRQ 2XNAC 2CH4A 4JW0A 4K6LA 3G71A 3AFQA 3K80C 2E2IB 1Y1VH 4MTNA 2FMCA 1IBLQ 2XTIA 1SBBB 1GUSA 1FVIA 2WAQE 3E5SA 4GN3B 1FJGL 3MEFA 3TS2A 4IZ8A 5BR8L 3M7GA 2JJQA 3HOZG 5AFWA 1O7ZA 3D4RA 2C9OA 2L5TA 2K5VA 4JOIC 2UUAL 1EIFA 2PW5A 3J7ZC 1E22A 1FJGQ 1X3QA 4GN5A 5FOBB 1H9SB 1CM9A 5BR8Q 1CZGA 5M5WB 5C3EH 4JI8Q 1VQ8A 1K8AC 1QUQA 3RZOH 4C3HH 4R4TA 2FHTA 3BVMA 4LF7L 1ZYRC 1ESFA 4RH6A 2CQAA 4FNFA 4BBRG 1E24A 3HOYH 3Q0AA 3PO3H 1I6VC 4A3EH 1XXGA 2WB1E 1H9MA 1EIHA 1FNVA 1L0WA 1BKBA 3FKIG 3TZUA 5C44H 1DONA 1N36L 2Q2TA 4LF7Q 4LUZA 1T5XD 1HRJA 2C35B 3E9IA 1VF7A 5IYDG 3I4NH 3A0JA 2JA5G 5CYUA 2DJFC 2K32A 1X56A 1HPCA 2RKSA 4RCNA 3KK7A 4F7XA 1T9HA 4R8IA 1N36Q 1SE8A 3MFGA 4OIKA 3J81L 1H9JA 1BCPF 1PTOF 3H15A 2F0OA 4BS9A 2HQLA 4BWGB 2PMZB 5GROA 4DAPA 3M4QA 2KEDA 2NVXB 3GTKH 5DAUA 1X32A 2PZUA 2HQEA 2RCNA 3GTOH 3I70A 4IOAA 2SEBD 2R7DA 1PH1A 1KD1C 2NZOA 4A3GB 3GTMB 1SE4A 2LXJA 1VQEA 1I5FA 3SGIA 1H9KA 1A3TA 4LF6L 3OIQA 1X6OA 3S1NB 3RN5A 5EKLA 5IT9E 1Z9FA 2D9UA 4GOPC 5DNFA 2RVLA 5FKAC 4HIKA 4LF6Q 3J80c 1ML0D 3HG9A 1PYWD 1YNJD 3S17H 1VQ5A 4BBSH 3J81c 5G3LF 4JI6Q 4KD4A 2N78A 2E75C 4K2LA 4H02A 1F9SA 2I5HA 3CRLC 3F2CA 1BR9A 4H0LC 5D3IB 3D6WA 3H0GG 1NBWA 2K1BA 2RCFA 1SJED 1B3AA 1S5ED 4B3ML 2KUMA 3NQTA 5M3FG 2K52A 4XT1B 4CKCA 5JAVA 2JK8A 2M9VA 4LMQD 1G91A 1FL0A 2KOLA 1G2TA 5JPNC 1PRTF 4CGYB 1G8ZD 2R92G 5C0XG 1U5KA 1SYDA 5H1SE 2JN4A 2Z6KC 1VQIA 2AMCB 2WAQB 1BUVT 2B2UA 3PGZA 1TY2A 3KFUA 3K5MA 1D2BA 1N34L 2A68D 1YJ9A 1X3FA 1N9WA 4JK1C 3TREA 2DN8A 1CT1D 4IUVA 5IGFA 1EZ8A 4J1MA 4PMBA 3I73A 4G57A 3RLOA 3E0EA 1IBMQ 4IFDG 2CFMA 3QR8A 5IP9H 3D4WA 3NELA 2IHFA 1IHZA 3PF5A 2E2JB 2WFWA 2K5DA 2JA6H 3SDZA 4QMGA 4G7OC 4DA2A 1KLUD 2DNEA 4LF4Q 5IP7G 1X3PA 3F2DA 3SVMA 2WB1B 5C4XG 1B3QA 1ENCA 3NBIA 3VR3A 1SXTA 2VNUD 1YHQA 1IL8A 1HCZA 1LTAD 3V05A 2FFKB 5DM63 2PO4A 3DEOA 1G2SA 2K5NA 1SYCA 2KBNA 2IX3A 4ODGA 3OSOA 2XGTA 2AUJD 4A3FB 1STBA 1BVSA 4K8JA 1QB5D 4LF9Q 4QIWE 2JA7G 1O78A 4TKOB 1QZGA 4DXGA 2A6HC 4UAIA 2MHVA 3HKZB 1E2VA 2F0VA 3DWPA 1HHVA 1FNUA 4AYBG 1VQLA 3ERQA 4DF7A 4XIGS 2JA8H 4GLVB 4JI5L 5A2QE 2UUBQ 3KDFB 2KHIA 3M9BA 3M7NA 3S1MH 1JWMD 3Q23A 4QQBX 2NN6H 2F3IA 3ULLA 1FNWA 1KC8C 1C8CA 2OCEA 3PIPA 4JI5Q 4JBKA 3VYTA 4RGTA 5C6AA 4B3TL 4HJ9A 3GTJB 1QNUA 1SE2A 4L8JA 3FP9A 4QF4A 4KHZA 1LTTD 4C3IB 5CV9A 3S1QH 2N55A 4IFDJ 4N9PA 1QOHA 4RKLA 4KLKA 1SYGA 4JI0L 3S15B 4LWCA 4B3TQ 2B39A 3D6CA 3WOEA 5IGEA 3SXHA 2VUMG 3J7AF 1STYA 4A4IA 2F0PA 1FYCA 1SE3A 1Y1VB 1IKLA 4JI0Q 4GS3A 4R4CA 1GHKA 1X3GA 2OQKA 1KRSA 2F03A 4N9TA 4DK3C 1B2TA 4IPGA 1PMRA 2KJXA 2KA7A 2F0IA 2F0EA 2K5QA 1GXDC 2R93G 1K3BC 1RTOA 3FEWX 2Y0SG 3KLSA 3H91A 2ES2A 5EJWA 5IGGA 2N3SA 1YJNA 3ZJYC 3V96A 1XTDA 4CHTB 5JVG3 3PUWA 1R4PB 4X3SA 2VQEQ 2RDHA 2ZTCA 1SMYC 2ZXOA 3RZOB 1QVFA 2NTSA 5LMNQ 1F9PA 2EYHA 4HIMA 2OWOA 4X6AH 1SEBD 3HOUH 4KY6A 4EQ5A 4DR3L 1K83H 3IRBA 3VDYA 1SFOB 3BZCA 5CC4A 3CKIB 1RCVD 4A3EB 4CDCC 1AEXA 4A3CH 3OHXC 5C44B 1C7YA 5M9OA 4XQJA 3CCEA 2AQ1B 4DV4Q 1M8AA 3LX0A 3DM3A 3I4MH 2G9HD 4Q0FA 1YZ6A 4UP9A 5M3MG 1HQRD 4RMFA 2UXCL 3SK6A 2I5MX 1TWAB 5IT9c 1PH3A 4JI4Q 1XNQL 4A3DB 3K5LA 5ELNA 1CSQA 3PIP3 3I72A 1HR0L 3EN2A 4DR1L 1BCPC 4X62L 3JAMi 2EJMA 3HOVG 2UXCQ 4DNTB 1ASZA 4N8FA 4ZLTF 3GTKB 1HZAA 4FVMA 4APVA 1DOMA 2DY8A 3RZDH 3OTOL 3GTOB 2OTLA 4KTAA 4DR1Q 1N32L 1TVXA 4L5RC 1SNDA 1Q90A 2ZT9C 1SDFA 1WCMB 4QIWB 3ND9A 4K5WA 1L0XB 4HTHA 2K05A 3UE0A 1Y1WH 3EROA 1N32Q 2K6AA 2B3GA 2R7ZB 3CCSA 2SNSA 4CDDC 1F2MA 1Q8IA 4TSSA 4KHPQ 1VQNA 1A2UA 1LV9A 1I4HA 2WKCA 3PCOB 3QOLA 1A63A 4XYQA 4IJLA 3S17B 2K28A 3P7JA 3ER0A 4KKUA 4BBSB 1TS4A 3E6ZX 5GAHC 2VQFL 1VQJA 3KF8A 1YHBA 1QUQB 2BA1A 3D0FA 3A74A 1VQDA 1T5EA 3S24A 1K73C 2LKVA 3L7ZC 1PH9A 2VQFQ 2WV6D 4A3IG 1TXYA 1K0SA 2ZM6Q 2BA0A 2JEBI 2AWNA 1PH2A 4HMIA 1JMCA 1EUJA 2EPBA 1JOOA 4L5QA 5A2QL 1Q1BA 4OO1G 2F0KA 3M4OH 5K5PA 2D2CC 1PRTC 5KNDA 2ZXPA 3K7AB 4QUFA 1BOSA 4FO2A 1AE2A 4GNXA 2F0FA 4U673 2LSSA 1PH6A 4B3SL 3HOXG 5AJ3Q 1EQTA 2H4OA 4BXXG 1CUKA 1TWFH 1M4VA 3SR1A 5C5LA 1PFSA 2XWJB 3MVVA 2VZAA 3SEBA 3C3LA 2Q8RE 5IOCA 2YU9H 1NAPA 2KHJA 5ELDA 2B2WC 3KDFA 3NK9A 5T1IA 1CKMA 2EIFA 1UE1A 5IIFA 2ZJRA 1GUGA 3HOZH 2UXDL 4FF3A 2MQHA 1HA5A 1XPRA 1IBKQ 1OXSC 3GTQH 3H3VI 4DR4L 2WACA 4BY7H 4DV2L 3ULJA 2GVBA 4PQXA 2PZTA 4C56C 3J81E 3UDGA 4ULLA 4LFAL 2FINB 5EQ0A 2KCNA 4B3RQ 3R2TA 3DLLA 2UXDQ 2HT1A 2NB0A 3IFDA 4DR4Q 1DOKA 2H1EA 4L63B 5CGKA 5IGDA 4A3BG 2K04A 1WTHA 4DV2Q 3VR2A 1NMFA 2CW0C 3OYYA 3NPPA 1SRUA 3TBIB 4LFAQ 1SN8A 4X65L 1U4LA 1XMOL 4GZYC 1TS2A 5J22A 1YNNC 1HTPA 4LAAA 2E2JH 1DD2A 1QJOA 2RA4A 3MHBA 4DR2L 3O13A 4P73A 4DR5Q 4GLXA 3KF6B 4J15A 1SJHD 3VA5A 3CMAA 3M4PA 1WJJA 3ZYYX 2E8GA 2NN6I 4X65Q 2RDGA 1XMOQ 4A93G 4QGUA 4EQOA 1IL2A 1TWGH 3HRZC 5ELFA 2A69D 3H6MA 4Q5VA 4G7ZC 4EX5A 2Z4IA 1EFWA 3S1RH 4LF5L 1KNEA 1TQOA 2ID0A 3KOJA 4M8AA 2XRSD 5FJ8G 1JOKA 1N33L 3S1MB 1CI3M 3PUYA 1EQRA 3WDNA 1WI5A 3FMCA 2F0MA 5DEHA 1B70B 3CF5A 4XYOA 3S14B 1UUPA 1SYEA 3I2ZA 2EVBA 4JV5L 1FD7D 2MPMA 2TMPA 4YCWA 1N33Q 1JB3A 1CK1A 1SMXA 1A3UA 3MXGA 3K5NA 1O7IA 1WTWA 1S3OA 2ZTDA 3GO5A 2D62A 5I2XA 2XIWA 3SHLA 4C1NI 1QWYA 1MBYA 5KNBA 4OELB 2CWAA 5G3LD 5LL6S 1HNXQ 2IX1A 5ISRA 3AU7A 2F52A 4DGZA 5C4HA 3NE5B 2EYFA 1XJVA 2NTTA 2F0NA 4V0BA 5T1GA 2L1BA 4OGQC 1AP0A 3K59A 1SSOA 4NXNQ 1CSPA 4DAYA 2B2YC 4C3IH 4CJ0B 1X55A 1FR3A 2E74C 3P20A 3TP5A 3S15H 2A19A 3HOWH 4GOPA 4Y7NH 3CAMA 4LNQA 4KD3A 4C3JH 1XYIA 3GTPB 3A8JE 2E5LL 2KECA 1S5FD 2K4KA 3HOUB 1OTCA 5IYCH 1XPOA 5EPKA 1K0RA 1K83B 1D5MC 3CHBD 1HJPA 2O4XA 1VS0A 1OXXK 4DK6C 5EAYA 1H95A 1HA6A 1RJTA 3EIVA 2KEEA 4A3LG 3PMFA 4HAEA 4GKJL 3PSIA 2P5ZX 3OW2A 1F77A 3R93A 5C3XA 1GHJA 5JJZA 1CHPD 1DM0B 2VS1A 3I4MB 1KL9A 4LUVA 2DGYA 2EYOA 4S3SA 4ALPA 2UUAQ 3CPFA 1VMPA 3P75A 3EFXD 3CCJA 1HTLD 1SAPA 2Q2HA 1PYBA 2JA9A 3G7LA 1DZ1A 1L1OC 3K8AA 3VR5A 5JJKA 2QILA 1SFOH 2NVYB 1LABA 1L0YB 3U4ZA 3URYA 1EQQA 3S2HH 1BF4A 3RZDB 4R1JA 4DR6L 1PH5A 2FMMA 1QZHA 1ZKOA 1TWAH 3EBEA 4A3DH 4DV3L 3ULPA 4HJAA 3KBGA 1IW7C 4DAVA 4DR6Q 4K2KA 1PFNA 5CV4A 2EYMA 1Y1WB 5FLXL 1I50H 3BJUA 2QEJC 4DV3Q 2VW9A 4RA8A 2BE5C 1VQ9A 1DXMA 2WB1G 4CJ1B 4IUTA 4YY3L 2IHEA 1I4RA 4A75A 1MD2D 4QL5A 1WCMH 3TP7A 3C1FA 3RUZA 1ENFA 1AE3A 1JQYD 1BXTA 2CCZA 1KIXA 1G51A 2EOTA 3UDFA 4YY3Q 3BVGA 4A3MH 4A3KH 2ATWA 1HFNA 2R7ZH 3SE0A 5HY6A 1PVOA 2A6EC 2Z1CA 5ELCA 4IO9A 1D8LA 1ILQA 1LT4D 2I0QA 1K3RA 1GUTA 3HKZG 1Z47A 1JICA 4FXGC 4NP5A 3UE1A 1NR2A 1EY8A 4UP8A 3CCQA 3M4OB 1TS5A 3GTLB 2MNAA 1D5ZC 4FP5D 4A3JB 2MP1A 1AW7A 2Z8LA 1JE4A 3KF6A 5FLXc 1V8QA 1Y8OB 5CBAE 1RODA 4HJ5A 1B9MA 3M4YA 3WWVA 4JBMA 2B8FA 1EEID 4BA2I 2SOBA 4X3TA 2VUMH 4P2CB 1TWFB 3UDXA 2PW7A 1KRTA 3SK5A 5LMNW 3RLFA 1QVGA 1YBYA 3MTSA 2YU9B 3PO2H 1YVCA 4PZ7A 1WD1A 3IL8A 2UUCL 1ICFB 1W6KA 4OHJA 1UE5A 3RR5A 3IKJA 3HOZB 3K7AH 4KI0A 4B3MQ 1QILA 3GTQB 3P1HA 4KY5A 4JI2L 1VF5C 2R7FA 4BY7B 4PV1C 4X3KA 2KCCA 2XN9C 2UUCQ 3OWEB 4CKEA 3HFZB 1I4XA 4O0AA 3HZXA 1Y1VG 2IL8A 4ZAIA 2E2DC 1UEAB 2G5DA 4JI2Q 4C2MB 2PQAA 4IPCA 2N49A 4XQNA 3DXJC 2I5LX 4L6TB 1JWUD 2DNCA 5JVH3 1N34Q 3QB3A 3TP8A 4ABNA 2CQOA 1HZCA 4MNOA 4DV6L 2WKDA 5ELOA 3T4AC 2F0QA 5E1FA 1SLJA 2I07B 1GJXA 4WJ4A 2Z0SA 5EKIA 1KHIA 2QA4A 4K6DA 3KF8B 3T1YL 2AUKA 3CQZB 1KQSA 5KNCA 1RTNA 1ZYRD 5C3EG 2CVRA 1F9QA 1LTSD 3NTHA 5M3MH 4DV6Q 4JC0A 4C3HG 2L12A 1WTVA 2Q2IA 1TWGB 2F0DA 5M5YH 1AZPA 1WFQA 1TWCH 3H3VH 1C4QA 4B08A 3S1RB 2YTVA 3HOYG 1EL0A 4MIUA 3PO3G 4K8IA 1JJCB 2J4XA 4BY1G 3CC7A 1STGA 2AHOB 2HD3A 4XT3B 4YHHL 3HOVH 3A7AB 4AIMA 2QKIC 5LL6X 4AYBE 5C44G 1PLFA 1KAAA 5JEAH 1QE6A 1CA6A 3J7A5 5I9OA 4I7AA 4IUNA 5C5MA 3I4NG 1ET6A 4GNXB 1HZ9A 2OXPA 3Q24A 2VXWA 2ALYB 1W3SA 5D14A 4XTCS 3PUZA 1B8AA 4MTKA 5IYBG 4KY7A 1SNOA 1VQFA 2Q8IB 2OEOA 3I4OA 2HIXA 5DLQE 3M85A 3VA7A 2KQ3A 5EPJA 1EYAA 3GD7A 4JBWA 4K0KL 4GLAC 5C0XJ 1ZEQX 4H7BA 4QJFA 1EIYB 2RDFA 3OMCA 3STBC 2LFNA 3NTIA 2F0JA 2CH4W 4DXFA 3CW2C 1U9RA 1EYCA 1PH8A 3S14H 4G7HC 3A7LA 5I2YA 1EWHA 4K0KQ 2EY1A 2SDFA 3I91A 1RKNA 1A6XA 2BDNA 3DEPA 5L37A 1EWIA 1MSHA 5LMUL 3N52A 2E2HB 1JJ2A 2N8NA 3H0GB 1SNCA 4HN7A 3HOWB 4Y7NB 4RGMA 2K14A 1Y14B 1B9NA 1OXUA 5EPLA 3TS0A 5LMUQ 3B6YA 4C3JB 4O42A 3VYSA 4B9XA 5JJLA 4OXPA 3CCVA 4BBSG 2Y0SE 5K36H 2K03A 4DNRB 4DV7L 1F2ZA 2R92B 1QNKA 3A5ZB 1GD7A 3E9HA 2BDOA 2B2UC 2F1MA 2K5HA 4IFDI 5F2DA 4DAMA 2HHHL 1SNQA 3T1HL 1CFMA 4OX9L 2NVQH 1E1OA 1D6EC 2ICIA 4WJWA 3ERSX 1EOVA 1WD0A 2OQ0A 5BN4A 3BZDB 1U4MA 1F9RA 1CZWA 1CKNA 4ZCKA 4DV7Q 2GVAA 3ICEA 1NTGA 2F4IA 3L9AX 3W1BA 3GTPH 4X64L 5LHY1 2M2LA 2HHHQ 2MFIA 1TWHB 3S2DH 1JOQA 1TKWB 1MJCA 4IUUA 1MHWC 5I4DA 1II3A 5FO9B 1VQKA 4LW1A 4X64Q 1JWSD 2B63G 1VQ4A 3S2HB 1A62A 4DR3Q 4L5SA 3SK8A 2LY7A 2QCPX 4NXML 1PTOH 4WJ3M 3A56A 3CP0A 1BBXC 1EY4A 2B2WA 2XRQD 2R6GA 4OIJA 2NVTH 1EY0A 1PZKD 1V9PA 3A8IE 4DK1A 5IP9G 4LF8L 3C46A 1STEA 3W3AA 4NXMQ 2EY2A 2Z4HA 1K8MA 2F0TA 2NVYH 2EZVA 2JA6G 1I50B 1YHAA 2X69A 1KDAA 1E2WA 1ET9A 2A5HA 1XNQQ 2JA7B 3KBXA 2PCFB 4DAYB 4HJ7A 1RL2A 2OT2A 3AYHB 2WP8J 1HR0Q 3OMGA 4LF8Q 1BBWA 4X62Q 1WVLA 4P72A 3BDCA 4DUYL 4GOPB 3NTKA 4UDUC 2V1CC 3EVQA 4X66L 3OTOQ 4ME5A 3IFTA 1EYDA 5FJ8H 2A69C 3QWNA 2A6HD 4ZK9B 1ESRA 4A3MB 3X3NA 5ELEA 4A3KB 3L3OC 4FXKC 4YCVA 3OWFA 4XDXA 3BYYB 3DHQA 4O1NA 1E0BA 3H09A 4R4IA 4POFA 4PMWA 1JC7A 4QUCA 1UWVA 4WORA 1B4OA 3BDLA 4X66Q 2QEXA 2GN5A 3DM1A 1TU2B 4F87A 1VCIA 2XSCA 1RF2D 3VR6A 1CKOA 2JA8G 4HSVA 2HCIA 4LFCL 4RG1A 1HNZL 4RHSA 2BH2A 5M5XH 5DM73 4QB4A 1JORA 2O2LD 4UP7A 3S16H 2NN6G 3I8ZA 2VUMB 1GUOA 4PZ6A 5CR3A 1RD9D 4NDXA 3FPPA 3MXUA 4IJHA 2KCMA 3K57A 3PO2B 1DGSA 4RGOS 5CV7A 2RSOA 1VQHA 4XQQA 4JYAL 3T53B 3W5OA 1HH2P 1I3QH 3GTLH 4A3JH 2F3VA 3KLRA 2R93B 4IALA 2D5DA 3CPWA 4WRDA 4L5TA 4WFN3 1JCKB 2E76C 2Z9HA 2F4VL 1LTBD 4MZ9A 2DY7A 3TQYA 4JI1L 2ZTEA 4JBJA 1DCZA 1J5EL 2JE6I 5EBCA 2EDGA 2RHSB 2PI2E 4B3SQ 2O5JC 2F4VQ 3A54A 1VQOA 3MZ5A 2J7ZA 4M1UB 2B8GA 1QG7A 1EU3A 5C4ZA 1I6HB 3OOCA 3TN2A 5C3WA 1JR0D 1NMGA 5FLXE 3KLSX 5M3MB 4AQYL 1LTLA 3K7UC 4R4OA 1V43A 3HOUG 4C2MH 2EE1A 3RN2A 5M5YB 3KJOA 1VQ6A 1VMCA 4FF2A 1TWCB 1EY5A 4BBRH 1TT2A 4LFBL 5C4JH 4FDBA 1A15A 3HOVB 1NE3A 4A3CG 5KYIA 3FKIH 3OPOA 4JOIA 4MHEA 4P75A 3CQZH 3I3CA 3I4MG 3JAML 5IYDH 2JA5H 3CRKC 5CV8A 1BO0A 3ONAB 1BCPD 2XVSA 4FYDA 1PTOD 1HNWL 2ENBA 3GV3A 3D31A 1DYQA 1I4PA 4ZRZA 4DR2Q 2BCOA 2F0LA 5NUCA 4CDEC 1IYUA 2VB2X 2BH8A 4P71A 2OTJA 1Q1EA 4F8MA 4HR7B 4O2DA 3J80i 4HEDA 2IT1A 4LF5Q 3J81i 3IAYA 1ASYA 3FVQA 5E4XA 1MSGA 2PQEA 3HKSA 4FXDA 4DN4M 2F0SA 2F3WA 3LNNA 4I65A 4PG3A 5D65A 1GOZA 1A0IA 1VDZA 2PQAB 1YITA 2KCTA 1J9OA 3QO2A 4PMCA 4YWKA 4JV5Q 3JAMc 4HCSA 1XMQL 3NUCA 1LLRD 3FHWA 5J39A 5CV5A 4DV0L 1NCVA 4DUZL 4A3GG 3DMUA 2IW3A 2EYPA 4ME3A 1YNJC 1SYBA 4P74A 2B2TC 2E2HH 1PH7A 3PUXA 3HOXB 4FF4A 1P8LA 2NVQB 3H0GH 4DUZQ 3QIAA 1IYJB 4GKKL 3GV6A 4YWLA 1H9RA 3AFPA 1I4GA 3RD4A 3GTGB 1JE5A 5M3FH 2R3ZA 4NB3A 2LMCB 5J1ZA 1PRTD 2KENA 1GUNA 1EZ6A 5JOBA 3S2DB 4MN3A 4U68A 3CCRA 4CDFC 1V1PA 2R92H 5C0XH 1JJGA 2NBFA 1EU4A 4ZQ3A 5E7NA 1PDQA 4H13C 2E5LQ 3TRZA 1ILPA 1E3PA 2MJ8A 3U4VA 1BCPB 1PTOB 3F1ZA 3JC66 2A68C 4A3BB 2DUDA 5E3FA 3SK4A 3TZDA 1BNZA 1HQMC 1TWHH 3MXNA 2EJFC 3CXCA 2NVTB 3T56B 1I4QA 4GKJQ 4JI8L 1BBUA 4IFDH 4BA1I 5IE8A 1LYLA 3LWEA 1CHQD 5FLMG 3AQQA 4K14A 4KMUC 2F0WA 3A5UA 4BY7G 2WAQG 1GUWA 2Z6KA 1G291 1PFBA 1YJWA 2J0TD 2K01A 3PUVA 1K8GA 4KHVA 1WTXA 1D5XC 3D4DA 5IP7H 3EQLC 3NXWA 2CW0D 4DR7L 4HSPA 5C4XH 1W6JA 4A93B 1STHA 2ICEC 2JQOA 1PZJD 1W2BA 2RQXA 4FF1A 4EVOA 2IJ0A 1S4ZA 2LXKA 3KLWA 3OW7A 3AEVA 2AKWB 1YNND 1Q81C 2TSSA 1PXUA 4JVZA 4QY7A 4BY1H 4DR7Q 4X3UA 3ND8A 4ZKCB 1UNSA 2Q8TA 2F0HA 2JA7H 4UHVA 4IPHA 2VL6A 1LT6D 4YCUA 1TIID 4C1NK 3RLNA 3J80L 5IYBH 1PV4A 1HXYD 3D8GA 5BN3A 1CKNB 2B2VC 1GKHA 5M5XB 3HKZE 3BVZA 3F2UA 3M3YB 2CWPA 2ZJPA 2IY5B 3S16B 2I46A 4A3FG 1B1ZA 1WTOA 1QCBD 1PRTB 1U4RA 4J8QA 5D3DA 4NW2A 3U58A 1EY6A 4TQUS 1XWEA 2M00A 1I3QB 3KYHC 4HIOA 2K50A 1D1IA 1X54A 4R9WA 2PZWA 4JI6L 5CMDA 4QCLA 1CQVA 2FXQA 2WINB 3FRPB 2YTYA 3T13A 4GN4B 5IODA 4A76A 5I6WA 4RWSC 1B44D 3I90A 4OWWB 3A8KE 3GP7A 5EBDA 2X6GA 3FDTA 4C3IG 3MA2B 1P16A 5COYA 1YI2A 2R93H 2O5IC 3HOWG 1ENAA 1TY0A 4YWMA 3CCLA 1PZID 1MKHA 1LT3D 1KAWA 5GQOA 4C3JG 3I56A 3GQBA 2YV5A 2EY5A 2NYZD 1EY7A 1QVCA 5IYCG 2HCCA 2JEAI 1LACA 4BBRB 1S5CD 3NWTA 4IOCA 2UU9L 2EQSA 5C4JB 2JSOA 1CTMA 2VY3A 1HR0W 3FKIB 4POGA 2B63H 1E7ZA 1IBML 2A73B 2RBMA 4OWXB 2UXBL 1MI2A 2MGSA 1I6HH 4IURA 5IWAL 2A74C 2UU9Q 2JA5B 4ILWA 3NBHA 1WTQA 5HURA 4LF4L 5E4WC 2UXBQ 5JPMC 1N8RC 1EFID 1RHPA 3T1YQ 5IWAQ 1B53A 4A3EG 1LTGD 2MO0A 1R9TH 4CKBA 4DFAA 1EQVA 2KHSA 3K81C 1Q7YC 2RHQB 4EQNA 1Y8PB 5J3BA 1NY4A 1UE7A 3U9SA 5IY0A 1A2TA 3RNUA 1JT8A 5BN5A 1UEBA 1IW7D 3NQIA 3T16A 4DKAC 1KDCA 1EEFD 2Z6BA 2EYLA 2YYZA 3K58A 1PHJA 3TP6A 2QDLA 4YHHQ 4LF9L 4A3DG 2PI2A 1LTID 1ICWA 1V1QA 1KTKA 2A1AA 3EA6A 2G9DA 4JPBW 4ID6A 2BE5D 1D7QA 2NZ1D 4ZUIA 5IGCA 5I9PA 3DWQA 3H3VC 4H44C 5GADC 1AZQA 1O7LA 2UUBL 1NNXA 2PNHA 3VYUA 1ONLA 2L0CA 4KKSA 3CCMA 1WCMG 1RDPD 4LK1C 1VQPA 1LT5D 1H9SA 2HIVA 1EYGA 3HS0C 2A6ED 4NPSA 4IUQA 4XXEA 2VB3X 3Q8DA 3K6OA 1F2YA 1LUZA 4A3MG 5FO7B 4A3KG 1WOCA 5KRUA 1S5DD 2R7ZG 2L11A 3TSSA 5C0XI 1E1TA 1C9OA 1GO3E 3TDQA 2GA4B 4A3IH 2QF7A 5M3FB 4CJ2C 4IUPA 2A8VA 2ZJQA 4KJNA 4JI3L 2EJGC 4OO1H 1NR4A 2Q2UA 2B29A 4Y52H 3NWSA 1JB7A 5ELBA 4TRDA 5CBEE 5GAEC 3C1EA 3J7YW 3VR4A 1MGSA 4DV1L 4PZ8A 1VQGA 2IWHA 3R2IA 4RKBA 1HZBA 3HOXH 4JI3Q 4BXXH 1IZ6A 2FJ2A 1EWCA 4K5XA 3Q6SA 3Q22A 1WTPA 1L1OB 3GTGH 4IPDA 3PO2G 2PPBC 1S5BD 2BOSA 3GDEA 4HMJA 5KIXA 4DV1Q 2MO1A 3G4SA 1SR3A 5IT9L 3JAME 2EXZA 3T1HQ 1KXLA 2VQEL 4OX9Q 3BYTB 1PA6A 1DOLA 4DK0A 5LMNL 3QOJA 5CORA 2NUCA 1IXRA 2IX0A 2MUYA 1K9MC 1I94L 1AN8A 1A3VA 5C3EB 2E2IH 2AWOA 5CV6A 4JG2A 1X9NA 3J81j 5C4XB 4C3HB 4YIJA 1YNXA 2NWGA 1EY9A 2D0PA 4A3BH 2PYKA 3W2DA 3CD6A 1O7YA 3I7FA 4DV4L 3WOFA 2AQ2B 3C2PA 3HOYB 1I94Q 1MJEA 2YTXA 1HUNA 4EQPA 3PO3B 4JI4L 4BY1B 1VQ7A 2AQ3B 1OXTA 2JP1A 1HFGA 3I55A 3MC0B 4DU9A 2X6LA 3QG1A 3CMEA 3E3XA 1PYSB 1SYFA 5M5WH 3I4NB 3BS1A 2L9HA 2SNMA 3BU2A 3L0OA 2PNRC 3F8TA 3LWUA 1MIUA 2JXMB 1R4QB 4A93H 1IKMA 4AYBB 3TEHB 3K0XA 5IGBA 1SNMA 1EIGA 1PTOC 1AH9A 3V2TA 3PV0A 3N6RA 2H5XA 3CU7A 1OXVA 5JEAG 3BG3A 1STNA 3HP3A 4OL7A 5HGTA 1ZXTA 4DUYQ 4IQZA 1V1PB 3PIOA 1YIJA 3NEMA 1AFPA 1FGUA 1HUMA 3D3RA 4JI7L 3U50C 1OO9B 1UE6A 3KJPA 4KHPL 1B7YB 1A8VA 4OEMB 2JYOA 2V4DA 1KLGD 3CC2A 3STBD 1VQCA 4R4QA 4JI7Q 4UY8C 2NVXH 3M3YH 3MXNB 2K33A 2QGQA 2IPKD 3HGBA 4LFCQ 4HIDA 1HNZQ 1UAPA 1U0LA 1VQBA 5JJIA 2RSNA 3R8BA 3G48A 4A3GH 4OONA 5FO8B 3GTMH 3MEHA 3X3MA 3MAQA 2ASBA 1C48A 1SNPA 2ZM6L 2KVMA 1M1KC 4V190 2CHBD 1BQQT 1SROA 3DUZA 3HEJA 1Q3LA 3UDIA 1Y69U 4J6HA 4HJ8A 3KUPA 4DNIA 3S1NH 1WYDA 2Y0SB 1XTCD 3FPUB 4I7ZC 4E6IA 1X3EA 2K5WA 4TVAB 4JYAQ 1Q8KA 1NSNS 1NUCA 1KABA 2K7VA 2CKZB 3DWAA 3OIPA 1LM0A 5AJ3L 1XX8A 5K36G 1NJIC 3QJYA 1LO5D 4KV6A 2XWBB 1S40A 3L2PA 2EXDA 2B2YA 3NSWA 1Z7TA 2B2TA 4JCVE 4JI1Q 2B63B 1SMYD 1J5EQ 4A3LH 4CBVA 1Q12A 4EGVA 4ZUJA 2HDLA 5EKKA 3AB9A 4NKLA 2HUGA 5JEAJ 1D1KA 2HDMA 3T51B 1IBKL 3K5OA 4UPAA 3EJIA 5KEEA 2L4NA 3J7AV 4ZYSA 1G6PA 3PIO3 2OF1A 4ZKBB 4B3RL 1GM5A 3K0YA 3RMHA 5FLMH 3VYRA 3W1GA 4PNYA 4LUOA 4NMZA 1Q82C 3J80E 1KDBA 1XPUA 3MFYA 4AQYQ 2JA6B 1R9TB 1Z6HA 4RFBA 3MWYW 1K28A 2LS01 1CA5A 1B50A 1FGBD 4RHRA 4B9WA 4DPGA 1G6ZA 4RAUC 5KYLA 3ITPA 4LFBQ 4KJOA 3U9OA 3G6EA 2QW7A 3F2BA 4DR5L 1GVPA 1V1OA 3BDOA 4OWTB 1U4PA 3TMEA 4K5VA 1L1OA 4RCOA 3CC4A 4KK7A 1EOTA 1YEZA 1Y8NB 5KGUA 4G4KA 1HNWQ 2NZHA 1TR5A 1KNAA 3G6JB 2N88A 1DJRD 1X65A 2PMZE 1S72A 1RIPA 2R61A 2JA8B 4F88A 1LTRD 1STAA 2L15A 4OO1I 4R8NA 3CCUA 2D0OA 1Y1WG 5I6YA 3E0JA 4A3FH 1TS3A 1C0AA 2ZXRA 5GAGC 1CQFA 2EY6A 3MXPA 4Z9CB 1VQAA 4A3IB 5EGTA 4LJZC 1VQMA
chains in the Genus database with same CATH topology
3I4LA 2C5CA 2F0GA 4KKTA 1J8IA 3R3OA 4IN3A 2L55A 5TSSA 4KN4C 3S1QB 3UI2A 1F2LA 1WTRA 2B2VA 5FK9C 4RGNA 2EYJA 2F0UA 3NHHA 2QDBA 4HCEA 1IYVA 4KN7C 3AMUA 1PFMA 1K8OA 3S9WA 3NP8A 3H94A 1O80A 1BDOA 1E2ZA 2WIIB 5A35A 3A55A 2XNAC 4K6LA 2E2IB 2FMCA 1SBBB 1GUSA 3E5SA 4IZ8A 3M7GA 5AFWA 1O7ZA 3D4RA 2C9OA 2L5TA 2PW5A 1X3QA 5FOBB 1H9SB 1CM9A 1CZGA 5M5WB 2FHTA 3BVMA 1ZYRC 1ESFA 4RH6A 2CQAA 4FNFA 3Q0AA 1I6VC 1XXGA 1H9MA 1EIHA 1FNVA 3TZUA 1DONA 1T5XD 1HRJA 1VF7A 5CYUA 2K32A 1HPCA 2RKSA 4RCNA 3KK7A 4F7XA 4R8IA 3MFGA 4OIKA 3J81L 1H9JA 1BCPF 1PTOF 2F0OA 4BS9A 4BWGB 2PMZB 4DAPA 2NVXB 2KEDA 5DAUA 1X32A 2PZUA 2HQEA 3I70A 2SEBD 4A3GB 3GTMB 1SE4A 1H9KA 1A3TA 3OIQA 3S1NB 5EKLA 5IT9E 2D9UA 5DNFA 2RVLA 5FKAC 1ML0D 3HG9A 1PYWD 1YNJD 5G3LF 4KD4A 2E75C 4K2LA 1F9SA 3CRLC 1BR9A 4H0LC 5D3IB 3D6WA 2K1BA 1SJED 1B3AA 1S5ED 2KUMA 3NQTA 4XT1B 4CKCA 5JAVA 2M9VA 4LMQD 1G91A 2KOLA 1G2TA 5JPNC 1PRTF 4CGYB 1G8ZD 5C0XG 1SYDA 2WAQB 1BUVT 2B2UA 1TY2A 3K5MA 1D2BA 2A68D 4JK1C 2DN8A 1CT1D 4IUVA 5IGFA 1EZ8A 4J1MA 4PMBA 3I73A 4G57A 4IFDG 3D4WA 1IHZA 2E2JB 2K5DA 3SDZA 4QMGA 4G7OC 4DA2A 1KLUD 2DNEA 1X3PA 3SVMA 2WB1B 1ENCA 3NBIA 3VR3A 1SXTA 2VNUD 1IL8A 1HCZA 1LTAD 3V05A 2FFKB 5DM63 2PO4A 3DEOA 1G2SA 1SYCA 2IX3A 4ODGA 3OSOA 2AUJD 4A3FB 1STBA 4K8JA 1QB5D 1O78A 4TKOB 4DXGA 2A6HC 4UAIA 2MHVA 3HKZB 1E2VA 2F0VA 3DWPA 1HHVA 1FNUA 3ERQA 4DF7A 4XIGS 5A2QE 3M7NA 1JWMD 3Q23A 2NN6H 1FNWA 1C8CA 3VYTA 4RGTA 5C6AA 3GTJB 1QNUA 1SE2A 4L8JA 4QF4A 4KHZA 1LTTD 4C3IB 5CV9A 2N55A 4IFDJ 4N9PA 1QOHA 4RKLA 1SYGA 3S15B 2B39A 3D6CA 3WOEA 5IGEA 3SXHA 3J7AF 1STYA 2F0PA 1FYCA 1SE3A 1Y1VB 1IKLA 1GHKA 2F03A 4N9TA 1B2TA 1PMRA 2KJXA 2KA7A 2F0IA 2F0EA 2K5QA 1GXDC 1RTOA 3FEWX 3KLSA 3H91A 5EJWA 5IGGA 3V96A 4CHTB 5JVG3 3PUWA 1R4PB 4X3SA 2RDHA 1SMYC 2ZXOA 3RZOB 2NTSA 1F9PA 2EYHA 1SEBD 4KY6A 1SFOB 4A3EB 5CC4A 3CKIB 1RCVD 1AEXA 3OHXC 5C44B 5M9OA 4XQJA 2AQ1B 1M8AA 3LX0A 2G9HD 4Q0FA 1HQRD 3SK6A 1TWAB 4A3DB 3K5LA 3PIP3 3I72A 1BCPC 2EJMA 4DNTB 4ZLTF 3GTKB 4FVMA 1DOMA 2DY8A 3GTOB 4KTAA 1TVXA 1SNDA 1Q90A 2ZT9C 1SDFA 1WCMB 4QIWB 3ND9A 4K5WA 1L0XB 4HTHA 2K05A 3EROA 2K6AA 2R7ZB 2SNSA 1F2MA 1Q8IA 4TSSA 1A2UA 1LV9A 1I4HA 2WKCA 3QOLA 4XYQA 3S17B 2K28A 3P7JA 4KKUA 4BBSB 1TS4A 3E6ZX 3KF8A 2BA1A 1T5EA 2LKVA 3L7ZC 2WV6D 2BA0A 2JEBI 2AWNA 4HMIA 2EPBA 1JOOA 5A2QL 1Q1BA 4OO1G 2F0KA 5K5PA 2D2CC 1PRTC 5KNDA 2ZXPA 3K7AB 4QUFA 1BOSA 4FO2A 2F0FA 4U673 1EQTA 2H4OA 1M4VA 3SR1A 5C5LA 2XWJB 3MVVA 3SEBA 3C3LA 2Q8RE 5IOCA 1NAPA 5ELDA 2B2WC 3NK9A 5T1IA 5IIFA 1GUGA 4FF3A 1HA5A 1OXSC 2WACA 4PQXA 2PZTA 4C56C 3J81E 4ULLA 2FINB 5EQ0A 2KCNA 3R2TA 2NB0A 3IFDA 1DOKA 2H1EA 4L63B 5CGKA 5IGDA 2K04A 3VR2A 2CW0C 3NPPA 3TBIB 1U4LA 4GZYC 1TS2A 5J22A 1YNNC 1HTPA 4LAAA 1DD2A 1QJOA 2RA4A 3MHBA 3O13A 1SJHD 3VA5A 3ZYYX 2NN6I 2RDGA 4EQOA 3HRZC 5ELFA 2A69D 3H6MA 4Q5VA 4G7ZC 2Z4IA 1KNEA 1TQOA 2ID0A 4M8AA 2XRSD 1JOKA 3S1MB 1CI3M 3PUYA 3WDNA 3FMCA 2F0MA 5DEHA 4XYOA 3S14B 1UUPA 1SYEA 2EVBA 1FD7D 2MPMA 2TMPA 1JB3A 1CK1A 1A3UA 3MXGA 3K5NA 1WTWA 3GO5A 2D62A 5I2XA 2XIWA 3SHLA 4C1NI 1QWYA 1MBYA 5KNBA 5G3LD 5LL6S 2IX1A 5ISRA 3AU7A 4DGZA 5C4HA 3NE5B 2EYFA 2NTTA 2F0NA 4V0BA 5T1GA 2L1BA 4OGQC 1AP0A 3K59A 1SSOA 4DAYA 2B2YC 4CJ0B 1FR3A 2E74C 3P20A 3TP5A 4KD3A 1XYIA 3GTPB 3A8JE 2KECA 1S5FD 3HOUB 5EPKA 1K83B 1D5MC 3CHBD 2O4XA 1OXXK 1HA6A 1RJTA 2KEEA 3PMFA 4HAEA 1F77A 3R93A 5C3XA 1GHJA 5JJZA 1CHPD 1DM0B 3I4MB 2EYOA 4S3SA 3P75A 1VMPA 3EFXD 1HTLD 1SAPA 3G7LA 1DZ1A 3VR5A 2QILA 2NVYB 1LABA 1L0YB 3URYA 1BF4A 3RZDB 2FMMA 1ZKOA 3KBGA 1IW7C 4DAVA 4K2KA 1PFNA 5CV4A 2EYMA 1Y1WB 5FLXL 2QEJC 4RA8A 2BE5C 1DXMA 4CJ1B 4IUTA 1I4RA 1MD2D 3TP7A 3C1FA 3RUZA 1ENFA 1JQYD 1BXTA 2EOTA 3BVGA 1HFNA 3SE0A 2A6EC 2Z1CA 5ELCA 1ILQA 1LT4D 1GUTA 1Z47A 1JICA 4FXGC 4NP5A 1NR2A 1EY8A 3M4OB 1TS5A 3GTLB 1D5ZC 4FP5D 4A3JB 2MP1A 1AW7A 2Z8LA 1JE4A 1V8QA 1Y8OB 5CBAE 1RODA 1B9MA 3M4YA 2B8FA 1EEID 4BA2I 2SOBA 4X3TA 4P2CB 1TWFB 2PW7A 3SK5A 3RLFA 3MTSA 2YU9B 1WD1A 3IL8A 1W6KA 4OHJA 3IKJA 3HOZB 4KI0A 1QILA 3GTQB 3P1HA 4KY5A 1VF5C 4BY7B 4PV1C 4X3KA 2KCCA 2XN9C 3OWEB 4CKEA 1I4XA 3HZXA 2IL8A 4ZAIA 2E2DC 1UEAB 4C2MB 4XQNA 3DXJC 4L6TB 1JWUD 2DNCA 5JVH3 3QB3A 3TP8A 4ABNA 2WKDA 3T4AC 2F0QA 5E1FA 2I07B 1GJXA 5EKIA 4K6DA 2AUKA 3CQZB 5KNCA 1RTNA 1ZYRD 2CVRA 1F9QA 1LTSD 3NTHA 4C3HG 2L12A 1WTVA 1TWGB 2F0DA 1AZPA 1C4QA 4B08A 3S1RB 1EL0A 4MIUA 4K8IA 2J4XA 1STGA 4XT3B 3A7AB 2QKIC 5LL6X 1PLFA 1KAAA 5JEAH 1QE6A 1CA6A 5I9OA 4IUNA 5C5MA 1ET6A 3Q24A 2OXPA 2VXWA 5D14A 4XTCS 3PUZA 4KY7A 1SNOA 2Q8IB 2OEOA 3M85A 3VA7A 2KQ3A 5EPJA 1EYAA 3GD7A 4JBWA 5C0XJ 1ZEQX 4H7BA 2RDFA 3OMCA 2LFNA 3NTIA 2F0JA 4DXFA 1U9RA 1EYCA 4G7HC 3A7LA 5I2YA 1EWHA 2EY1A 2SDFA 3I91A 1RKNA 1A6XA 2BDNA 3DEPA 1MSHA 3N52A 2E2HB 3H0GB 1SNCA 4HN7A 3HOWB 4Y7NB 4RGMA 1B9NA 1OXUA 5EPLA 4C3JB 4O42A 3VYSA 4B9XA 5K36H 2K03A 4DNRB 1F2ZA 2R92B 1QNKA 2BDOA 2B2UC 2F1MA 4IFDI 5F2DA 1SNQA 1CFMA 1D6EC 2ICIA 4WJWA 1WD0A 5BN4A 3BZDB 1U4MA 1F9RA 1CZWA 2F4IA 3L9AX 5LHY1 2M2LA 1TWHB 1JOQA 1TKWB 4IUUA 5I4DA 1II3A 5FO9B 1JWSD 3S2HB 3SK8A 2LY7A 2QCPX 1PTOH 3A56A 1BBXC 1EY4A 2B2WA 2XRQD 2R6GA 4OIJA 1EY0A 1PZKD 3A8IE 4DK1A 3C46A 1STEA 3W3AA 2EY2A 2Z4HA 1K8MA 2F0TA 2EZVA 1I50B 2X69A 1KDAA 1E2WA 1ET9A 2A5HA 2JA7B 3KBXA 2PCFB 2OT2A 2WP8J 3OMGA 1WVLA 3BDCA 3NTKA 4UDUC 3EVQA 4ME5A 3IFTA 1EYDA 2A69C 3QWNA 2A6HD 4ZK9B 1ESRA 4A3MB 3X3NA 5ELEA 4A3KB 3L3OC 4FXKC 3OWFA 4XDXA 3BYYB 3DHQA 4O1NA 1E0BA 3H09A 4PMWA 1JC7A 4QUCA 4WORA 1B4OA 3BDLA 3DM1A 1TU2B 4F87A 1VCIA 2XSCA 1RF2D 3VR6A 4HSVA 2HCIA 4RHSA 5DM73 4QB4A 1JORA 2O2LD 2NN6G 3I8ZA 2VUMB 1GUOA 5CR3A 1RD9D 4NDXA 3FPPA 3MXUA 3K57A 3PO2B 4RGOS 5CV7A 2RSOA 4XQQA 3T53B 2F3VA 3KLRA 2R93B 4IALA 2D5DA 4WRDA 4WFN3 1JCKB 2E76C 1LTBD 2DY7A 1DCZA 2JE6I 5EBCA 2EDGA 2O5JC 3A54A 3MZ5A 2J7ZA 4M1UB 2B8GA 1QG7A 1EU3A 5C4ZA 1I6HB 3OOCA 3TN2A 5C3WA 1JR0D 5FLXE 3KLSX 5M3MB 1V43A 2EE1A 5M5YB 1VMCA 4FF2A 1TWCB 1EY5A 1TT2A 1A15A 3HOVB 5KYIA 3OPOA 4MHEA 3I3CA 3JAML 3CRKC 5CV8A 1BO0A 3ONAB 1BCPD 2XVSA 4FYDA 1PTOD 2ENBA 3GV3A 3D31A 1DYQA 1I4PA 4ZRZA 2BCOA 2F0LA 5NUCA 1IYUA 2VB2X 1Q1EA 4F8MA 4HR7B 4HEDA 2IT1A 3IAYA 3FVQA 5E4XA 1MSGA 2PQEA 4FXDA 4DN4M 2F0SA 2F3WA 3LNNA 4I65A 5D65A 1GOZA 1VDZA 1J9OA 3QO2A 4PMCA 4HCSA 3NUCA 1LLRD 5J39A 5CV5A 1NCVA 3DMUA 2IW3A 2EYPA 1YNJC 1SYBA 2B2TC 3HOXB 3PUXA 4FF4A 2NVQB 3QIAA 3GV6A 1H9RA 1I4GA 3RD4A 3GTGB 2R3ZA 2LMCB 5J1ZA 1PRTD 1GUNA 1EZ6A 5JOBA 3S2DB 4MN3A 4U68A 1V1PA 5C0XH 2NBFA 1EU4A 4ZQ3A 1PDQA 4H13C 1ILPA 2MJ8A 1BCPB 1PTOB 2A68C 4A3BB 5E3FA 3SK4A 3TZDA 1BNZA 1HQMC 3MXNA 2EJFC 2NVTB 3T56B 1I4QA 4IFDH 4BA1I 3LWEA 1CHQD 4K14A 4KMUC 2F0WA 1GUWA 1G291 1PFBA 2J0TD 2K01A 3PUVA 4KHVA 1WTXA 1D5XC 3D4DA 3EQLC 3NXWA 2CW0D 4HSPA 1W6JA 4A93B 1STHA 2ICEC 4FF1A 1PZJD 2RQXA 4EVOA 2IJ0A 1S4ZA 3OW7A 1YNND 2TSSA 1PXUA 4X3UA 3ND8A 4ZKCB 1UNSA 2Q8TA 2F0HA 1LT6D 1TIID 4C1NK 3J80L 1HXYD 3D8GA 5BN3A 2B2VC 5M5XB 3BVZA 3F2UA 3M3YB 3S16B 2I46A 1B1ZA 1WTOA 1QCBD 1PRTB 1U4RA 4J8QA 5D3DA 4NW2A 1EY6A 4TQUS 1XWEA 2M00A 1I3QB 1D1IA 4R9WA 2PZWA 5CMDA 4QCLA 1CQVA 2WINB 3FRPB 3T13A 5IODA 5I6WA 4RWSC 1B44D 3I90A 3A8KE 3GP7A 5EBDA 2X6GA 3FDTA 4C3IG 3MA2B 5COYA 2O5IC 1ENAA 1TY0A 1PZID 1LT3D 4C3JG 3GQBA 2EY5A 2NYZD 1EY7A 2HCCA 2JEAI 1LACA 4BBRB 1S5CD 3NWTA 5C4JB 2JSOA 1CTMA 3FKIB 2A73B 2RBMA 1MI2A 2MGSA 4IURA 2A74C 2JA5B 4ILWA 3NBHA 1WTQA 5HURA 5E4WC 5JPMC 1EFID 1RHPA 1B53A 1LTGD 4CKBA 4DFAA 1EQVA 2KHSA 4EQNA 1Y8PB 3U9SA 1A2TA 5BN5A 3NQIA 1IW7D 3T16A 1KDCA 1EEFD 2EYLA 2YYZA 3K58A 3TP6A 1LTID 1ICWA 1KTKA 3EA6A 2G9DA 4ID6A 2BE5D 2NZ1D 4ZUIA 5IGCA 5I9PA 3DWQA 3H3VC 4H44C 1AZQA 1O7LA 3VYUA 1ONLA 2L0CA 4KKSA 1RDPD 4LK1C 1H9SA 1LT5D 3HS0C 2A6ED 4XXEA 4IUQA 2VB3X 3K6OA 1F2YA 5FO7B 5KRUA 1S5DD 2L11A 3TSSA 5C0XI 3TDQA 2GA4B 2QF7A 5M3FB 4CJ2C 4IUPA 4KJNA 2EJGC 4OO1H 1NR4A 3NWSA 5ELBA 4TRDA 5CBEE 3C1EA 3J7YW 3VR4A 1MGSA 2IWHA 3R2IA 4RKBA 2FJ2A 1EWCA 4K5XA 3Q6SA 3Q22A 1WTPA 2PPBC 1S5BD 2BOSA 4HMJA 5KIXA 5IT9L 3JAME 2EXZA 3BYTB 1DOLA 4DK0A 3QOJA 5CORA 2NUCA 2IX0A 2MUYA 1AN8A 1A3VA 5C3EB 2AWOA 5CV6A 5C4XB 4C3HB 4YIJA 2NWGA 1EY9A 2PYKA 3W2DA 1O7YA 3WOFA 2AQ2B 3C2PA 3HOYB 1HUNA 4EQPA 3PO3B 4BY1B 2AQ3B 1OXTA 2JP1A 1HFGA 3MC0B 4DU9A 2X6LA 3QG1A 1SYFA 3I4NB 3BS1A 2L9HA 2SNMA 2PNRC 3LWUA 2JXMB 1R4QB 1IKMA 4AYBB 5IGBA 1SNMA 1EIGA 1PTOC 3V2TA 3PV0A 3N6RA 3CU7A 1OXVA 5JEAG 3BG3A 1STNA 3HP3A 4OL7A 5HGTA 1ZXTA 4IQZA 1V1PB 1AFPA 1HUMA 3D3RA 1OO9B 2JYOA 2V4DA 1KLGD 2K33A 2IPKD 3HGBA 1UAPA 2RSNA 3R8BA 5FO8B 3MEHA 3X3MA 3MAQA 1C48A 1SNPA 2KVMA 4V190 2CHBD 1BQQT 3DUZA 3HEJA 1Q3LA 1Y69U 4J6HA 3KUPA 2Y0SB 1XTCD 3FPUB 4I7ZC 4E6IA 2K5WA 1NUCA 1KABA 1NSNS 2K7VA 3DWAA 3OIPA 1XX8A 5K36G 3QJYA 1LO5D 4KV6A 2XWBB 2B2YA 3NSWA 1Z7TA 2B2TA 2B63B 1SMYD 4CBVA 4EGVA 1Q12A 4ZUJA 2HDLA 5EKKA 3AB9A 4NKLA 5JEAJ 2HUGA 1D1KA 2HDMA 3T51B 3K5OA 3EJIA 5KEEA 2L4NA 3J7AV 4ZYSA 3PIO3 2OF1A 4ZKBB 3K0YA 3RMHA 3VYRA 4PNYA 4NMZA 3J80E 1KDBA 3MFYA 2JA6B 1R9TB 1Z6HA 4RFBA 3MWYW 2LS01 1CA5A 1B50A 1FGBD 4RHRA 4B9WA 1G6ZA 4RAUC 5KYLA 3ITPA 4KJOA 3U9OA 1V1OA 3BDOA 1U4PA 3TMEA 4K5VA 4RCOA 4KK7A 1EOTA 1Y8NB 5KGUA 4G4KA 1TR5A 1KNAA 3G6JB 2N88A 1DJRD 2R61A 2JA8B 4F88A 1LTRD 1STAA 4OO1I 4R8NA 5I6YA 3E0JA 1TS3A 2ZXRA 1CQFA 2EY6A 3MXPA 4Z9CB 4A3IB 5EGTA 4LJZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMG A;  3QOL A;  5IGF A;  5J1Z A;  3T16 A;  1EZ8 A;  4J1M A;  4PMB A;  4YIJ A;  1KDC A;  1EZ6 A;  4EQO A;  1EY6 A;  2EYO A;  2EYL A;  1EY9 A;  2F0G A;  2RKS A;  2PYK A;  3BDC A;  4G57 A;  4S3S A;  2EY1 A;  5JOB A;  3TP6 A;  4F7X A;  3H6M A;  3P75 A;  3R3O A;  4KV6 A;  4N9T A;  1RKN A;  2M00 A;  1EY5 A;  1TQO A;  1TT2 A;  4EQP A;  3D4W A;  3EVQ A;  4ME5 A;  4ID6 A;  1EYD A;  1IHZ A;  2F0E A;  2F0I A;  2F0O A;  1JOK A;  3P1H A;  4KY5 A;  4ZQ3 A;  4ZUI A;  2EYJ A;  2PZW A;  5IGC A;  5KYI A;  5I9P A;  4DU9 A;  5IGG A;  1SNC A;  4QMG A;  3OWF A;  2F0U A;  2F0M A;  5DAU A;  3DHQ A;  5DEH A;  2LKV A;  3NHH A;  3T13 A;  2PZU A;  2HQE A;  2QDB A;  4ZUJ A;  5EKK A;  1SYF A;  4NKL A;  3HZX A;  1SYE A;  2SNM A;  5IOD A;  4HMI A;  4WOR A;  5CV8 A;  1ENC A;  3BDL A;  3EJI A;  4B9X A;  3S9W A;  1JOO A;  3NP8 A;  5I6W A;  5KEE A;  5E3F A;  2EYH A;  3SK4 A;  4KY6 A;  2ENB A;  5IGB A;  2F0K A;  2OF1 A;  1A3U A;  1SNM A;  5K5P A;  3QB3 A;  3TP8 A;  1F2Z A;  1A3T A;  3V2T A;  4K2K A;  4PNY A;  2F0L A;  4K14 A;  4NMZ A;  5CV4 A;  5CC4 A;  2F0F A;  1KDB A;  2EYM A;  2F0W A;  2F0Q A;  4QB4 A;  5E1F A;  1F2Y A;  1SYC A;  5EKL A;  5F2D A;  1JOR A;  4ODG A;  3OSO A;  5KRU A;  1AEX A;  1SNQ A;  1STB A;  4K8J A;  4F8M A;  5M9O A;  4K6D A;  1STN A;  1ENA A;  4OL7 A;  3SR1 A;  4B9W A;  4KHV A;  5CR3 A;  5C5L A;  4NDX A;  5HGT A;  3D4D A;  5ISR A;  3MVV A;  4DGZ A;  3LX0 A;  3NXW A;  5C4H A;  2EYF A;  5IOC A;  5KYL A;  2F0N A;  3ITP A;  4KJN A;  2F0V A;  3SK6 A;  1STH A;  2EY5 A;  4KJO A;  3U9O A;  5CV7 A;  4EVO A;  3ERQ A;  3E5S A;  2F0D A;  1EY7 A;  2PQE A;  3NK9 A;  5C3X A;  4DF7 A;  3TP7 A;  4KD4 A;  1JOQ A;  4IZ8 A;  3C1F A;  4K2L A;  3RUZ A;  5IIF A;  3SHL A;  4TRD A;  2F0S A;  2F3W A;  2F3V A;  4I65 A;  4MIU A;  4K8I A;  3TME A;  3C1E A;  4K5V A;  1STG A;  1II3 A;  2WAC A;  2PW5 A;  3TP5 A;  4IAL A;  4RKB A;  4PMC A;  5KGU A;  2PZT A;  4WRD A;  2F0H A;  1KAA A;  2RBM A;  3NUC A;  5I9O A;  4K5X A;  5C3W A;  1TR5 A;  4IUN A;  5C5M A;  3SK8 A;  4KTA A;  3NQT A;  4KD3 A;  5NUC A;  5C6A A;  5JAV A;  5J39 A;  2OXP A;  5CV5 A;  1SND A;  5IGD A;  5CGK A;  1EY4 A;  4HMJ A;  5HUR A;  5KIX A;  4NP5 A;  1EY8 A;  3MEH A;  4KY7 A;  1SNO A;  2EXZ A;  1SNP A;  3DMU A;  4QF4 A;  1EY0 A;  2O4X A;  3D8G A;  4K5W A;  2EYP A;  2OEO A;  5CV9 A;  1STA A;  4HTH A;  1SYD A;  3HEJ A;  4R8N A;  1SYB A;  3MZ5 A;  2KQ3 A;  4J6H A;  2EY2 A;  4N9P A;  4RKL A;  5J22 A;  1EYA A;  1SYG A;  2F0T A;  3ERO A;  3QOJ A;  4LAA A;  2NUC A;  4DFA A;  1EQV A;  2KHS A;  5I6Y A;  3D6C A;  2SOB A;  1KDA A;  3MHB A;  4H7B A;  3PMF A;  3SXH A;  5IGE A;  2SNS A;  4E6I A;  4EQN A;  5C4Z A;  1STY A;  2PW7 A;  2EY6 A;  1F2M A;  2RDF A;  3MXP A;  3OMC A;  2F0P A;  3SK5 A;  3VA5 A;  1A3V A;  5EGT A;  1KAB A;  1NSN S;  1A2U A;  1NUC A;  2F0J A;  1U9R A;  1EYC A;  5CV6 A;  1A2T A; 
#chains in the Genus database with same CATH topology
 3I4L A;  2C5C A;  2F0G A;  4KKT A;  1J8I A;  1HNX L;  2RF4 A;  3R3O A;  4IN3 A;  2L55 A;  5TSS A;  4KN4 C;  1XMQ Q;  3S1Q B;  3PQI A;  3UI2 A;  1F2L A;  4AH6 A;  1WTR A;  1Q86 C;  4GNX C;  2B2V A;  3NBH B;  5FK9 C;  1M90 C;  4RGN A;  2EYJ A;  4NXN L;  1L2F A;  4DV5 L;  2F0U A;  4DV0 Q;  4N8X 1;  3NHH A;  2QDB A;  4HCE A;  1IYV A;  4KN7 C;  3LGJ A;  3PF4 A;  3AMU A;  1PFM A;  2K75 A;  5HGQ A;  1K8O A;  1XNR L;  1PH4 A;  3S9W A;  3NP8 A;  3NEN A;  3H94 A;  3GTJ H;  3BZK A;  1O80 A;  1Q46 A;  4DV5 Q;  2DJG C;  1BDO A;  4GKK Q;  1E2Z A;  4A3J G;  1IBL L;  2WII B;  5A35 A;  3A55 A;  1J6Q A;  1XNR Q;  2XNA C;  2CH4 A;  4JW0 A;  4K6L A;  3G71 A;  3AFQ A;  3K80 C;  2E2I B;  1Y1V H;  4MTN A;  2FMC A;  1IBL Q;  2XTI A;  1SBB B;  1GUS A;  1FVI A;  2WAQ E;  3E5S A;  4GN3 B;  1FJG L;  3MEF A;  3TS2 A;  4IZ8 A;  5BR8 L;  3M7G A;  2JJQ A;  3HOZ G;  5AFW A;  1O7Z A;  3D4R A;  2C9O A;  2L5T A;  2K5V A;  4JOI C;  2UUA L;  1EIF A;  2PW5 A;  3J7Z C;  1E22 A;  1FJG Q;  1X3Q A;  4GN5 A;  5FOB B;  1H9S B;  1CM9 A;  5BR8 Q;  1CZG A;  5M5W B;  5C3E H;  4JI8 Q;  1VQ8 A;  1K8A C;  1QUQ A;  3RZO H;  4C3H H;  4R4T A;  2FHT A;  3BVM A;  4LF7 L;  1ZYR C;  1ESF A;  4RH6 A;  2CQA A;  4FNF A;  4BBR G;  1E24 A;  3HOY H;  3Q0A A;  3PO3 H;  1I6V C;  4A3E H;  1XXG A;  2WB1 E;  1H9M A;  1EIH A;  1FNV A;  1L0W A;  1BKB A;  3FKI G;  3TZU A;  5C44 H;  1DON A;  1N36 L;  2Q2T A;  4LF7 Q;  4LUZ A;  1T5X D;  1HRJ A;  2C35 B;  3E9I A;  1VF7 A;  5IYD G;  3I4N H;  3A0J A;  2JA5 G;  5CYU A;  2DJF C;  2K32 A;  1X56 A;  1HPC A;  2RKS A;  4RCN A;  3KK7 A;  4F7X A;  1T9H A;  4R8I A;  1N36 Q;  1SE8 A;  3MFG A;  4OIK A;  3J81 L;  1H9J A;  1BCP F;  1PTO F;  3H15 A;  2F0O A;  4BS9 A;  2HQL A;  4BWG B;  2PMZ B;  5GRO A;  4DAP A;  3M4Q A;  2KED A;  2NVX B;  3GTK H;  5DAU A;  1X32 A;  2PZU A;  2HQE A;  2RCN A;  3GTO H;  3I70 A;  4IOA A;  2SEB D;  2R7D A;  1PH1 A;  1KD1 C;  2NZO A;  4A3G B;  3GTM B;  1SE4 A;  2LXJ A;  1VQE A;  1I5F A;  3SGI A;  1H9K A;  1A3T A;  4LF6 L;  3OIQ A;  1X6O A;  3S1N B;  3RN5 A;  5EKL A;  5IT9 E;  1Z9F A;  2D9U A;  4GOP C;  5DNF A;  2RVL A;  5FKA C;  4HIK A;  4LF6 Q;  3J80 c;  1ML0 D;  3HG9 A;  1PYW D;  1YNJ D;  3S17 H;  1VQ5 A;  4BBS H;  3J81 c;  5G3L F;  4JI6 Q;  4KD4 A;  2N78 A;  2E75 C;  4K2L A;  4H02 A;  1F9S A;  2I5H A;  3CRL C;  3F2C A;  1BR9 A;  4H0L C;  5D3I B;  3D6W A;  3H0G G;  1NBW A;  2K1B A;  2RCF A;  1SJE D;  1B3A A;  1S5E D;  4B3M L;  2KUM A;  3NQT A;  5M3F G;  2K52 A;  4XT1 B;  4CKC A;  5JAV A;  2JK8 A;  2M9V A;  4LMQ D;  1G91 A;  1FL0 A;  2KOL A;  1G2T A;  5JPN C;  1PRT F;  4CGY B;  1G8Z D;  2R92 G;  5C0X G;  1U5K A;  1SYD A;  5H1S E;  2JN4 A;  2Z6K C;  1VQI A;  2AMC B;  2WAQ B;  1BUV T;  2B2U A;  3PGZ A;  1TY2 A;  3KFU A;  3K5M A;  1D2B A;  1N34 L;  2A68 D;  1YJ9 A;  1X3F A;  1N9W A;  4JK1 C;  3TRE A;  2DN8 A;  1CT1 D;  4IUV A;  5IGF A;  1EZ8 A;  4J1M A;  4PMB A;  3I73 A;  4G57 A;  3RLO A;  3E0E A;  1IBM Q;  4IFD G;  2CFM A;  3QR8 A;  5IP9 H;  3D4W A;  3NEL A;  2IHF A;  1IHZ A;  3PF5 A;  2E2J B;  2WFW A;  2K5D A;  2JA6 H;  3SDZ A;  4QMG A;  4G7O C;  4DA2 A;  1KLU D;  2DNE A;  4LF4 Q;  5IP7 G;  1X3P A;  3F2D A;  3SVM A;  2WB1 B;  5C4X G;  1B3Q A;  1ENC A;  3NBI A;  3VR3 A;  1SXT A;  2VNU D;  1YHQ A;  1IL8 A;  1HCZ A;  1LTA D;  3V05 A;  2FFK B;  5DM6 3;  2PO4 A;  3DEO A;  1G2S A;  2K5N A;  1SYC A;  2KBN A;  2IX3 A;  4ODG A;  3OSO A;  2XGT A;  2AUJ D;  4A3F B;  1STB A;  1BVS A;  4K8J A;  1QB5 D;  4LF9 Q;  4QIW E;  2JA7 G;  1O78 A;  4TKO B;  1QZG A;  4DXG A;  2A6H C;  4UAI A;  2MHV A;  3HKZ B;  1E2V A;  2F0V A;  3DWP A;  1HHV A;  1FNU A;  4AYB G;  1VQL A;  3ERQ A;  4DF7 A;  4XIG S;  2JA8 H;  4GLV B;  4JI5 L;  5A2Q E;  2UUB Q;  3KDF B;  2KHI A;  3M9B A;  3M7N A;  3S1M H;  1JWM D;  3Q23 A;  4QQB X;  2NN6 H;  2F3I A;  3ULL A;  1FNW A;  1KC8 C;  1C8C A;  2OCE A;  3PIP A;  4JI5 Q;  4JBK A;  3VYT A;  4RGT A;  5C6A A;  4B3T L;  4HJ9 A;  3GTJ B;  1QNU A;  1SE2 A;  4L8J A;  3FP9 A;  4QF4 A;  4KHZ A;  1LTT D;  4C3I B;  5CV9 A;  3S1Q H;  2N55 A;  4IFD J;  4N9P A;  1QOH A;  4RKL A;  4KLK A;  1SYG A;  4JI0 L;  3S15 B;  4LWC A;  4B3T Q;  2B39 A;  3D6C A;  3WOE A;  5IGE A;  3SXH A;  2VUM G;  3J7A F;  1STY A;  4A4I A;  2F0P A;  1FYC A;  1SE3 A;  1Y1V B;  1IKL A;  4JI0 Q;  4GS3 A;  4R4C A;  1GHK A;  1X3G A;  2OQK A;  1KRS A;  2F03 A;  4N9T A;  4DK3 C;  1B2T A;  4IPG A;  1PMR A;  2KJX A;  2KA7 A;  2F0I A;  2F0E A;  2K5Q A;  1GXD C;  2R93 G;  1K3B C;  1RTO A;  3FEW X;  2Y0S G;  3KLS A;  3H91 A;  2ES2 A;  5EJW A;  5IGG A;  2N3S A;  1YJN A;  3ZJY C;  3V96 A;  1XTD A;  4CHT B;  5JVG 3;  3PUW A;  1R4P B;  4X3S A;  2VQE Q;  2RDH A;  2ZTC A;  1SMY C;  2ZXO A;  3RZO B;  1QVF A;  2NTS A;  5LMN Q;  1F9P A;  2EYH A;  4HIM A;  2OWO A;  4X6A H;  1SEB D;  3HOU H;  4KY6 A;  4EQ5 A;  4DR3 L;  1K83 H;  3IRB A;  3VDY A;  1SFO B;  3BZC A;  5CC4 A;  3CKI B;  1RCV D;  4A3E B;  4CDC C;  1AEX A;  4A3C H;  3OHX C;  5C44 B;  1C7Y A;  5M9O A;  4XQJ A;  3CCE A;  2AQ1 B;  4DV4 Q;  1M8A A;  3LX0 A;  3DM3 A;  3I4M H;  2G9H D;  4Q0F A;  1YZ6 A;  4UP9 A;  5M3M G;  1HQR D;  4RMF A;  2UXC L;  3SK6 A;  2I5M X;  1TWA B;  5IT9 c;  1PH3 A;  4JI4 Q;  1XNQ L;  4A3D B;  3K5L A;  5ELN A;  1CSQ A;  3PIP 3;  3I72 A;  1HR0 L;  3EN2 A;  4DR1 L;  1BCP C;  4X62 L;  3JAM i;  2EJM A;  3HOV G;  2UXC Q;  4DNT B;  1ASZ A;  4N8F A;  4ZLT F;  3GTK B;  1HZA A;  4FVM A;  4APV A;  1DOM A;  2DY8 A;  3RZD H;  3OTO L;  3GTO B;  2OTL A;  4KTA A;  4DR1 Q;  1N32 L;  1TVX A;  4L5R C;  1SND A;  1Q90 A;  2ZT9 C;  1SDF A;  1WCM B;  4QIW B;  3ND9 A;  4K5W A;  1L0X B;  4HTH A;  2K05 A;  3UE0 A;  1Y1W H;  3ERO A;  1N32 Q;  2K6A A;  2B3G A;  2R7Z B;  3CCS A;  2SNS A;  4CDD C;  1F2M A;  1Q8I A;  4TSS A;  4KHP Q;  1VQN A;  1A2U A;  1LV9 A;  1I4H A;  2WKC A;  3PCO B;  3QOL A;  1A63 A;  4XYQ A;  4IJL A;  3S17 B;  2K28 A;  3P7J A;  3ER0 A;  4KKU A;  4BBS B;  1TS4 A;  3E6Z X;  5GAH C;  2VQF L;  1VQJ A;  3KF8 A;  1YHB A;  1QUQ B;  2BA1 A;  3D0F A;  3A74 A;  1VQD A;  1T5E A;  3S24 A;  1K73 C;  2LKV A;  3L7Z C;  1PH9 A;  2VQF Q;  2WV6 D;  4A3I G;  1TXY A;  1K0S A;  2ZM6 Q;  2BA0 A;  2JEB I;  2AWN A;  1PH2 A;  4HMI A;  1JMC A;  1EUJ A;  2EPB A;  1JOO A;  4L5Q A;  5A2Q L;  1Q1B A;  4OO1 G;  2F0K A;  3M4O H;  5K5P A;  2D2C C;  1PRT C;  5KND A;  2ZXP A;  3K7A B;  4QUF A;  1BOS A;  4FO2 A;  1AE2 A;  4GNX A;  2F0F A;  4U67 3;  2LSS A;  1PH6 A;  4B3S L;  3HOX G;  5AJ3 Q;  1EQT A;  2H4O A;  4BXX G;  1CUK A;  1TWF H;  1M4V A;  3SR1 A;  5C5L A;  1PFS A;  2XWJ B;  3MVV A;  2VZA A;  3SEB A;  3C3L A;  2Q8R E;  5IOC A;  2YU9 H;  1NAP A;  2KHJ A;  5ELD A;  2B2W C;  3KDF A;  3NK9 A;  5T1I A;  1CKM A;  2EIF A;  1UE1 A;  5IIF A;  2ZJR A;  1GUG A;  3HOZ H;  2UXD L;  4FF3 A;  2MQH A;  1HA5 A;  1XPR A;  1IBK Q;  1OXS C;  3GTQ H;  3H3V I;  4DR4 L;  2WAC A;  4BY7 H;  4DV2 L;  3ULJ A;  2GVB A;  4PQX A;  2PZT A;  4C56 C;  3J81 E;  3UDG A;  4ULL A;  4LFA L;  2FIN B;  5EQ0 A;  2KCN A;  4B3R Q;  3R2T A;  3DLL A;  2UXD Q;  2HT1 A;  2NB0 A;  3IFD A;  4DR4 Q;  1DOK A;  2H1E A;  4L63 B;  5CGK A;  5IGD A;  4A3B G;  2K04 A;  1WTH A;  4DV2 Q;  3VR2 A;  1NMF A;  2CW0 C;  3OYY A;  3NPP A;  1SRU A;  3TBI B;  4LFA Q;  1SN8 A;  4X65 L;  1U4L A;  1XMO L;  4GZY C;  1TS2 A;  5J22 A;  1YNN C;  1HTP A;  4LAA A;  2E2J H;  1DD2 A;  1QJO A;  2RA4 A;  3MHB A;  4DR2 L;  3O13 A;  4P73 A;  4DR5 Q;  4GLX A;  3KF6 B;  4J15 A;  1SJH D;  3VA5 A;  3CMA A;  3M4P A;  1WJJ A;  3ZYY X;  2E8G A;  2NN6 I;  4X65 Q;  2RDG A;  1XMO Q;  4A93 G;  4QGU A;  4EQO A;  1IL2 A;  1TWG H;  3HRZ C;  5ELF A;  2A69 D;  3H6M A;  4Q5V A;  4G7Z C;  4EX5 A;  2Z4I A;  1EFW A;  3S1R H;  4LF5 L;  1KNE A;  1TQO A;  2ID0 A;  3KOJ A;  4M8A A;  2XRS D;  5FJ8 G;  1JOK A;  1N33 L;  3S1M B;  1CI3 M;  3PUY A;  1EQR A;  3WDN A;  1WI5 A;  3FMC A;  2F0M A;  5DEH A;  1B70 B;  3CF5 A;  4XYO A;  3S14 B;  1UUP A;  1SYE A;  3I2Z A;  2EVB A;  4JV5 L;  1FD7 D;  2MPM A;  2TMP A;  4YCW A;  1N33 Q;  1JB3 A;  1CK1 A;  1SMX A;  1A3U A;  3MXG A;  3K5N A;  1O7I A;  1WTW A;  1S3O A;  2ZTD A;  3GO5 A;  2D62 A;  5I2X A;  2XIW A;  3SHL A;  4C1N I;  1QWY A;  1MBY A;  5KNB A;  4OEL B;  2CWA A;  5G3L D;  5LL6 S;  1HNX Q;  2IX1 A;  5ISR A;  3AU7 A;  2F52 A;  4DGZ A;  5C4H A;  3NE5 B;  2EYF A;  1XJV A;  2NTT A;  2F0N A;  4V0B A;  5T1G A;  2L1B A;  4OGQ C;  1AP0 A;  3K59 A;  1SSO A;  4NXN Q;  1CSP A;  4DAY A;  2B2Y C;  4C3I H;  4CJ0 B;  1X55 A;  1FR3 A;  2E74 C;  3P20 A;  3TP5 A;  3S15 H;  2A19 A;  3HOW H;  4GOP A;  4Y7N H;  3CAM A;  4LNQ A;  4KD3 A;  4C3J H;  1XYI A;  3GTP B;  3A8J E;  2E5L L;  2KEC A;  1S5F D;  2K4K A;  3HOU B;  1OTC A;  5IYC H;  1XPO A;  5EPK A;  1K0R A;  1K83 B;  1D5M C;  3CHB D;  1HJP A;  2O4X A;  1VS0 A;  1OXX K;  4DK6 C;  5EAY A;  1H95 A;  1HA6 A;  1RJT A;  3EIV A;  2KEE A;  4A3L G;  3PMF A;  4HAE A;  4GKJ L;  3PSI A;  2P5Z X;  3OW2 A;  1F77 A;  3R93 A;  5C3X A;  1GHJ A;  5JJZ A;  1CHP D;  1DM0 B;  2VS1 A;  3I4M B;  1KL9 A;  4LUV A;  2DGY A;  2EYO A;  4S3S A;  4ALP A;  2UUA Q;  3CPF A;  1VMP A;  3P75 A;  3EFX D;  3CCJ A;  1HTL D;  1SAP A;  2Q2H A;  1PYB A;  2JA9 A;  3G7L A;  1DZ1 A;  1L1O C;  3K8A A;  3VR5 A;  5JJK A;  2QIL A;  1SFO H;  2NVY B;  1LAB A;  1L0Y B;  3U4Z A;  3URY A;  1EQQ A;  3S2H H;  1BF4 A;  3RZD B;  4R1J A;  4DR6 L;  1PH5 A;  2FMM A;  1QZH A;  1ZKO A;  1TWA H;  3EBE A;  4A3D H;  4DV3 L;  3ULP A;  4HJA A;  3KBG A;  1IW7 C;  4DAV A;  4DR6 Q;  4K2K A;  1PFN A;  5CV4 A;  2EYM A;  1Y1W B;  5FLX L;  1I50 H;  3BJU A;  2QEJ C;  4DV3 Q;  2VW9 A;  4RA8 A;  2BE5 C;  1VQ9 A;  1DXM A;  2WB1 G;  4CJ1 B;  4IUT A;  4YY3 L;  2IHE A;  1I4R A;  4A75 A;  1MD2 D;  4QL5 A;  1WCM H;  3TP7 A;  3C1F A;  3RUZ A;  1ENF A;  1AE3 A;  1JQY D;  1BXT A;  2CCZ A;  1KIX A;  1G51 A;  2EOT A;  3UDF A;  4YY3 Q;  3BVG A;  4A3M H;  4A3K H;  2ATW A;  1HFN A;  2R7Z H;  3SE0 A;  5HY6 A;  1PVO A;  2A6E C;  2Z1C A;  5ELC A;  4IO9 A;  1D8L A;  1ILQ A;  1LT4 D;  2I0Q A;  1K3R A;  1GUT A;  3HKZ G;  1Z47 A;  1JIC A;  4FXG C;  4NP5 A;  3UE1 A;  1NR2 A;  1EY8 A;  4UP8 A;  3CCQ A;  3M4O B;  1TS5 A;  3GTL B;  2MNA A;  1D5Z C;  4FP5 D;  4A3J B;  2MP1 A;  1AW7 A;  2Z8L A;  1JE4 A;  3KF6 A;  5FLX c;  1V8Q A;  1Y8O B;  5CBA E;  1ROD A;  4HJ5 A;  1B9M A;  3M4Y A;  3WWV A;  4JBM A;  2B8F A;  1EEI D;  4BA2 I;  2SOB A;  4X3T A;  2VUM H;  4P2C B;  1TWF B;  3UDX A;  2PW7 A;  1KRT A;  3SK5 A;  5LMN W;  3RLF A;  1QVG A;  1YBY A;  3MTS A;  2YU9 B;  3PO2 H;  1YVC A;  4PZ7 A;  1WD1 A;  3IL8 A;  2UUC L;  1ICF B;  1W6K A;  4OHJ A;  1UE5 A;  3RR5 A;  3IKJ A;  3HOZ B;  3K7A H;  4KI0 A;  4B3M Q;  1QIL A;  3GTQ B;  3P1H A;  4KY5 A;  4JI2 L;  1VF5 C;  2R7F A;  4BY7 B;  4PV1 C;  4X3K A;  2KCC A;  2XN9 C;  2UUC Q;  3OWE B;  4CKE A;  3HFZ B;  1I4X A;  4O0A A;  3HZX A;  1Y1V G;  2IL8 A;  4ZAI A;  2E2D C;  1UEA B;  2G5D A;  4JI2 Q;  4C2M B;  2PQA A;  4IPC A;  2N49 A;  4XQN A;  3DXJ C;  2I5L X;  4L6T B;  1JWU D;  2DNC A;  5JVH 3;  1N34 Q;  3QB3 A;  3TP8 A;  4ABN A;  2CQO A;  1HZC A;  4MNO A;  4DV6 L;  2WKD A;  5ELO A;  3T4A C;  2F0Q A;  5E1F A;  1SLJ A;  2I07 B;  1GJX A;  4WJ4 A;  2Z0S A;  5EKI A;  1KHI A;  2QA4 A;  4K6D A;  3KF8 B;  3T1Y L;  2AUK A;  3CQZ B;  1KQS A;  5KNC A;  1RTN A;  1ZYR D;  5C3E G;  2CVR A;  1F9Q A;  1LTS D;  3NTH A;  5M3M H;  4DV6 Q;  4JC0 A;  4C3H G;  2L12 A;  1WTV A;  2Q2I A;  1TWG B;  2F0D A;  5M5Y H;  1AZP A;  1WFQ A;  1TWC H;  3H3V H;  1C4Q A;  4B08 A;  3S1R B;  2YTV A;  3HOY G;  1EL0 A;  4MIU A;  3PO3 G;  4K8I A;  1JJC B;  2J4X A;  4BY1 G;  3CC7 A;  1STG A;  2AHO B;  2HD3 A;  4XT3 B;  4YHH L;  3HOV H;  3A7A B;  4AIM A;  2QKI C;  5LL6 X;  4AYB E;  5C44 G;  1PLF A;  1KAA A;  5JEA H;  1QE6 A;  1CA6 A;  3J7A 5;  5I9O A;  4I7A A;  4IUN A;  5C5M A;  3I4N G;  1ET6 A;  4GNX B;  1HZ9 A;  2OXP A;  3Q24 A;  2VXW A;  2ALY B;  1W3S A;  5D14 A;  4XTC S;  3PUZ A;  1B8A A;  4MTK A;  5IYB G;  4KY7 A;  1SNO A;  1VQF A;  2Q8I B;  2OEO A;  3I4O A;  2HIX A;  5DLQ E;  3M85 A;  3VA7 A;  2KQ3 A;  5EPJ A;  1EYA A;  3GD7 A;  4JBW A;  4K0K L;  4GLA C;  5C0X J;  1ZEQ X;  4H7B A;  4QJF A;  1EIY B;  2RDF A;  3OMC A;  3STB C;  2LFN A;  3NTI A;  2F0J A;  2CH4 W;  4DXF A;  3CW2 C;  1U9R A;  1EYC A;  1PH8 A;  3S14 H;  4G7H C;  3A7L A;  5I2Y A;  1EWH A;  4K0K Q;  2EY1 A;  2SDF A;  3I91 A;  1RKN A;  1A6X A;  2BDN A;  3DEP A;  5L37 A;  1EWI A;  1MSH A;  5LMU L;  3N52 A;  2E2H B;  1JJ2 A;  2N8N A;  3H0G B;  1SNC A;  4HN7 A;  3HOW B;  4Y7N B;  4RGM A;  2K14 A;  1Y14 B;  1B9N A;  1OXU A;  5EPL A;  3TS0 A;  5LMU Q;  3B6Y A;  4C3J B;  4O42 A;  3VYS A;  4B9X A;  5JJL A;  4OXP A;  3CCV A;  4BBS G;  2Y0S E;  5K36 H;  2K03 A;  4DNR B;  4DV7 L;  1F2Z A;  2R92 B;  1QNK A;  3A5Z B;  1GD7 A;  3E9H A;  2BDO A;  2B2U C;  2F1M A;  2K5H A;  4IFD I;  5F2D A;  4DAM A;  2HHH L;  1SNQ A;  3T1H L;  1CFM A;  4OX9 L;  2NVQ H;  1E1O A;  1D6E C;  2ICI A;  4WJW A;  3ERS X;  1EOV A;  1WD0 A;  2OQ0 A;  5BN4 A;  3BZD B;  1U4M A;  1F9R A;  1CZW A;  1CKN A;  4ZCK A;  4DV7 Q;  2GVA A;  3ICE A;  1NTG A;  2F4I A;  3L9A X;  3W1B A;  3GTP H;  4X64 L;  5LHY 1;  2M2L A;  2HHH Q;  2MFI A;  1TWH B;  3S2D H;  1JOQ A;  1TKW B;  1MJC A;  4IUU A;  1MHW C;  5I4D A;  1II3 A;  5FO9 B;  1VQK A;  4LW1 A;  4X64 Q;  1JWS D;  2B63 G;  1VQ4 A;  3S2H B;  1A62 A;  4DR3 Q;  4L5S A;  3SK8 A;  2LY7 A;  2QCP X;  4NXM L;  1PTO H;  4WJ3 M;  3A56 A;  3CP0 A;  1BBX C;  1EY4 A;  2B2W A;  2XRQ D;  2R6G A;  4OIJ A;  2NVT H;  1EY0 A;  1PZK D;  1V9P A;  3A8I E;  4DK1 A;  5IP9 G;  4LF8 L;  3C46 A;  1STE A;  3W3A A;  4NXM Q;  2EY2 A;  2Z4H A;  1K8M A;  2F0T A;  2NVY H;  2EZV A;  2JA6 G;  1I50 B;  1YHA A;  2X69 A;  1KDA A;  1E2W A;  1ET9 A;  2A5H A;  1XNQ Q;  2JA7 B;  3KBX A;  2PCF B;  4DAY B;  4HJ7 A;  1RL2 A;  2OT2 A;  3AYH B;  2WP8 J;  1HR0 Q;  3OMG A;  4LF8 Q;  1BBW A;  4X62 Q;  1WVL A;  4P72 A;  3BDC A;  4DUY L;  4GOP B;  3NTK A;  4UDU C;  2V1C C;  3EVQ A;  4X66 L;  3OTO Q;  4ME5 A;  3IFT A;  1EYD A;  5FJ8 H;  2A69 C;  3QWN A;  2A6H D;  4ZK9 B;  1ESR A;  4A3M B;  3X3N A;  5ELE A;  4A3K B;  3L3O C;  4FXK C;  4YCV A;  3OWF A;  4XDX A;  3BYY B;  3DHQ A;  4O1N A;  1E0B A;  3H09 A;  4R4I A;  4POF A;  4PMW A;  1JC7 A;  4QUC A;  1UWV A;  4WOR A;  1B4O A;  3BDL A;  4X66 Q;  2QEX A;  2GN5 A;  3DM1 A;  1TU2 B;  4F87 A;  1VCI A;  2XSC A;  1RF2 D;  3VR6 A;  1CKO A;  2JA8 G;  4HSV A;  2HCI A;  4LFC L;  4RG1 A;  1HNZ L;  4RHS A;  2BH2 A;  5M5X H;  5DM7 3;  4QB4 A;  1JOR A;  2O2L D;  4UP7 A;  3S16 H;  2NN6 G;  3I8Z A;  2VUM B;  1GUO A;  4PZ6 A;  5CR3 A;  1RD9 D;  4NDX A;  3FPP A;  3MXU A;  4IJH A;  2KCM A;  3K57 A;  3PO2 B;  1DGS A;  4RGO S;  5CV7 A;  2RSO A;  1VQH A;  4XQQ A;  4JYA L;  3T53 B;  3W5O A;  1HH2 P;  1I3Q H;  3GTL H;  4A3J H;  2F3V A;  3KLR A;  2R93 B;  4IAL A;  2D5D A;  3CPW A;  4WRD A;  4L5T A;  4WFN 3;  1JCK B;  2E76 C;  2Z9H A;  2F4V L;  1LTB D;  4MZ9 A;  2DY7 A;  3TQY A;  4JI1 L;  2ZTE A;  4JBJ A;  1DCZ A;  1J5E L;  2JE6 I;  5EBC A;  2EDG A;  2RHS B;  2PI2 E;  4B3S Q;  2O5J C;  2F4V Q;  3A54 A;  1VQO A;  3MZ5 A;  2J7Z A;  4M1U B;  2B8G A;  1QG7 A;  1EU3 A;  5C4Z A;  1I6H B;  3OOC A;  3TN2 A;  5C3W A;  1JR0 D;  1NMG A;  5FLX E;  3KLS X;  5M3M B;  4AQY L;  1LTL A;  3K7U C;  4R4O A;  1V43 A;  3HOU G;  4C2M H;  2EE1 A;  3RN2 A;  5M5Y B;  3KJO A;  1VQ6 A;  1VMC A;  4FF2 A;  1TWC B;  1EY5 A;  4BBR H;  1TT2 A;  4LFB L;  5C4J H;  4FDB A;  1A15 A;  3HOV B;  1NE3 A;  4A3C G;  5KYI A;  3FKI H;  3OPO A;  4JOI A;  4MHE A;  4P75 A;  3CQZ H;  3I3C A;  3I4M G;  3JAM L;  5IYD H;  2JA5 H;  3CRK C;  5CV8 A;  1BO0 A;  3ONA B;  1BCP D;  2XVS A;  4FYD A;  1PTO D;  1HNW L;  2ENB A;  3GV3 A;  3D31 A;  1DYQ A;  1I4P A;  4ZRZ A;  4DR2 Q;  2BCO A;  2F0L A;  5NUC A;  4CDE C;  1IYU A;  2VB2 X;  2BH8 A;  4P71 A;  2OTJ A;  1Q1E A;  4F8M A;  4HR7 B;  4O2D A;  3J80 i;  4HED A;  2IT1 A;  4LF5 Q;  3J81 i;  3IAY A;  1ASY A;  3FVQ A;  5E4X A;  1MSG A;  2PQE A;  3HKS A;  4FXD A;  4DN4 M;  2F0S A;  2F3W A;  3LNN A;  4I65 A;  4PG3 A;  5D65 A;  1GOZ A;  1A0I A;  1VDZ A;  2PQA B;  1YIT A;  2KCT A;  1J9O A;  3QO2 A;  4PMC A;  4YWK A;  4JV5 Q;  3JAM c;  4HCS A;  1XMQ L;  3NUC A;  1LLR D;  3FHW A;  5J39 A;  5CV5 A;  4DV0 L;  1NCV A;  4DUZ L;  4A3G G;  3DMU A;  2IW3 A;  2EYP A;  4ME3 A;  1YNJ C;  1SYB A;  4P74 A;  2B2T C;  2E2H H;  1PH7 A;  3PUX A;  3HOX B;  4FF4 A;  1P8L A;  2NVQ B;  3H0G H;  4DUZ Q;  3QIA A;  1IYJ B;  4GKK L;  3GV6 A;  4YWL A;  1H9R A;  3AFP A;  1I4G A;  3RD4 A;  3GTG B;  1JE5 A;  5M3F H;  2R3Z A;  4NB3 A;  2LMC B;  5J1Z A;  1PRT D;  2KEN A;  1GUN A;  1EZ6 A;  5JOB A;  3S2D B;  4MN3 A;  4U68 A;  3CCR A;  4CDF C;  1V1P A;  2R92 H;  5C0X H;  1JJG A;  2NBF A;  1EU4 A;  4ZQ3 A;  5E7N A;  1PDQ A;  4H13 C;  2E5L Q;  3TRZ A;  1ILP A;  1E3P A;  2MJ8 A;  3U4V A;  1BCP B;  1PTO B;  3F1Z A;  3JC6 6;  2A68 C;  4A3B B;  2DUD A;  5E3F A;  3SK4 A;  3TZD A;  1BNZ A;  1HQM C;  1TWH H;  3MXN A;  2EJF C;  3CXC A;  2NVT B;  3T56 B;  1I4Q A;  4GKJ Q;  4JI8 L;  1BBU A;  4IFD H;  4BA1 I;  5IE8 A;  1LYL A;  3LWE A;  1CHQ D;  5FLM G;  3AQQ A;  4K14 A;  4KMU C;  2F0W A;  3A5U A;  4BY7 G;  2WAQ G;  1GUW A;  2Z6K A;  1G29 1;  1PFB A;  1YJW A;  2J0T D;  2K01 A;  3PUV A;  1K8G A;  4KHV A;  1WTX A;  1D5X C;  3D4D A;  5IP7 H;  3EQL C;  3NXW A;  2CW0 D;  4DR7 L;  4HSP A;  5C4X H;  1W6J A;  4A93 B;  1STH A;  2ICE C;  2JQO A;  1PZJ D;  1W2B A;  2RQX A;  4FF1 A;  4EVO A;  2IJ0 A;  1S4Z A;  2LXK A;  3KLW A;  3OW7 A;  3AEV A;  2AKW B;  1YNN D;  1Q81 C;  2TSS A;  1PXU A;  4JVZ A;  4QY7 A;  4BY1 H;  4DR7 Q;  4X3U A;  3ND8 A;  4ZKC B;  1UNS A;  2Q8T A;  2F0H A;  2JA7 H;  4UHV A;  4IPH A;  2VL6 A;  1LT6 D;  4YCU A;  1TII D;  4C1N K;  3RLN A;  3J80 L;  5IYB H;  1PV4 A;  1HXY D;  3D8G A;  5BN3 A;  1CKN B;  2B2V C;  1GKH A;  5M5X B;  3HKZ E;  3BVZ A;  3F2U A;  3M3Y B;  2CWP A;  2ZJP A;  2IY5 B;  3S16 B;  2I46 A;  4A3F G;  1B1Z A;  1WTO A;  1QCB D;  1PRT B;  1U4R A;  4J8Q A;  5D3D A;  4NW2 A;  3U58 A;  1EY6 A;  4TQU S;  1XWE A;  2M00 A;  1I3Q B;  3KYH C;  4HIO A;  2K50 A;  1D1I A;  1X54 A;  4R9W A;  2PZW A;  4JI6 L;  5CMD A;  4QCL A;  1CQV A;  2FXQ A;  2WIN B;  3FRP B;  2YTY A;  3T13 A;  4GN4 B;  5IOD A;  4A76 A;  5I6W A;  4RWS C;  1B44 D;  3I90 A;  4OWW B;  3A8K E;  3GP7 A;  5EBD A;  2X6G A;  3FDT A;  4C3I G;  3MA2 B;  1P16 A;  5COY A;  1YI2 A;  2R93 H;  2O5I C;  3HOW G;  1ENA A;  1TY0 A;  4YWM A;  3CCL A;  1PZI D;  1MKH A;  1LT3 D;  1KAW A;  5GQO A;  4C3J G;  3I56 A;  3GQB A;  2YV5 A;  2EY5 A;  2NYZ D;  1EY7 A;  1QVC A;  5IYC G;  2HCC A;  2JEA I;  1LAC A;  4BBR B;  1S5C D;  3NWT A;  4IOC A;  2UU9 L;  2EQS A;  5C4J B;  2JSO A;  1CTM A;  2VY3 A;  1HR0 W;  3FKI B;  4POG A;  2B63 H;  1E7Z A;  1IBM L;  2A73 B;  2RBM A;  4OWX B;  2UXB L;  1MI2 A;  2MGS A;  1I6H H;  4IUR A;  5IWA L;  2A74 C;  2UU9 Q;  2JA5 B;  4ILW A;  3NBH A;  1WTQ A;  5HUR A;  4LF4 L;  5E4W C;  2UXB Q;  5JPM C;  1N8R C;  1EFI D;  1RHP A;  3T1Y Q;  5IWA Q;  1B53 A;  4A3E G;  1LTG D;  2MO0 A;  1R9T H;  4CKB A;  4DFA A;  1EQV A;  2KHS A;  3K81 C;  1Q7Y C;  2RHQ B;  4EQN A;  1Y8P B;  5J3B A;  1NY4 A;  1UE7 A;  3U9S A;  5IY0 A;  1A2T A;  3RNU A;  1JT8 A;  5BN5 A;  1UEB A;  1IW7 D;  3NQI A;  3T16 A;  4DKA C;  1KDC A;  1EEF D;  2Z6B A;  2EYL A;  2YYZ A;  3K58 A;  1PHJ A;  3TP6 A;  2QDL A;  4YHH Q;  4LF9 L;  4A3D G;  2PI2 A;  1LTI D;  1ICW A;  1V1Q A;  1KTK A;  2A1A A;  3EA6 A;  2G9D A;  4JPB W;  4ID6 A;  2BE5 D;  1D7Q A;  2NZ1 D;  4ZUI A;  5IGC A;  5I9P A;  3DWQ A;  3H3V C;  4H44 C;  5GAD C;  1AZQ A;  1O7L A;  2UUB L;  1NNX A;  2PNH A;  3VYU A;  1ONL A;  2L0C A;  4KKS A;  3CCM A;  1WCM G;  1RDP D;  4LK1 C;  1VQP A;  1LT5 D;  1H9S A;  2HIV A;  1EYG A;  3HS0 C;  2A6E D;  4NPS A;  4IUQ A;  4XXE A;  2VB3 X;  3Q8D A;  3K6O A;  1F2Y A;  1LUZ A;  4A3M G;  5FO7 B;  4A3K G;  1WOC A;  5KRU A;  1S5D D;  2R7Z G;  2L11 A;  3TSS A;  5C0X I;  1E1T A;  1C9O A;  1GO3 E;  3TDQ A;  2GA4 B;  4A3I H;  2QF7 A;  5M3F B;  4CJ2 C;  4IUP A;  2A8V A;  2ZJQ A;  4KJN A;  4JI3 L;  2EJG C;  4OO1 H;  1NR4 A;  2Q2U A;  2B29 A;  4Y52 H;  3NWS A;  1JB7 A;  5ELB A;  4TRD A;  5CBE E;  5GAE C;  3C1E A;  3J7Y W;  3VR4 A;  1MGS A;  4DV1 L;  4PZ8 A;  1VQG A;  2IWH A;  3R2I A;  4RKB A;  1HZB A;  3HOX H;  4JI3 Q;  4BXX H;  1IZ6 A;  2FJ2 A;  1EWC A;  4K5X A;  3Q6S A;  3Q22 A;  1WTP A;  1L1O B;  3GTG H;  4IPD A;  3PO2 G;  2PPB C;  1S5B D;  2BOS A;  3GDE A;  4HMJ A;  5KIX A;  4DV1 Q;  2MO1 A;  3G4S A;  1SR3 A;  5IT9 L;  3JAM E;  2EXZ A;  3T1H Q;  1KXL A;  2VQE L;  4OX9 Q;  3BYT B;  1PA6 A;  1DOL A;  4DK0 A;  5LMN L;  3QOJ A;  5COR A;  2NUC A;  1IXR A;  2IX0 A;  2MUY A;  1K9M C;  1I94 L;  1AN8 A;  1A3V A;  5C3E B;  2E2I H;  2AWO A;  5CV6 A;  4JG2 A;  1X9N A;  3J81 j;  5C4X B;  4C3H B;  4YIJ A;  1YNX A;  2NWG A;  1EY9 A;  2D0P A;  4A3B H;  2PYK A;  3W2D A;  3CD6 A;  1O7Y A;  3I7F A;  4DV4 L;  3WOF A;  2AQ2 B;  3C2P A;  3HOY B;  1I94 Q;  1MJE A;  2YTX A;  1HUN A;  4EQP A;  3PO3 B;  4JI4 L;  4BY1 B;  1VQ7 A;  2AQ3 B;  1OXT A;  2JP1 A;  1HFG A;  3I55 A;  3MC0 B;  4DU9 A;  2X6L A;  3QG1 A;  3CME A;  3E3X A;  1PYS B;  1SYF A;  5M5W H;  3I4N B;  3BS1 A;  2L9H A;  2SNM A;  3BU2 A;  3L0O A;  2PNR C;  3F8T A;  3LWU A;  1MIU A;  2JXM B;  1R4Q B;  4A93 H;  1IKM A;  4AYB B;  3TEH B;  3K0X A;  5IGB A;  1SNM A;  1EIG A;  1PTO C;  1AH9 A;  3V2T A;  3PV0 A;  3N6R A;  2H5X A;  3CU7 A;  1OXV A;  5JEA G;  3BG3 A;  1STN A;  3HP3 A;  4OL7 A;  5HGT A;  1ZXT A;  4DUY Q;  4IQZ A;  1V1P B;  3PIO A;  1YIJ A;  3NEM A;  1AFP A;  1FGU A;  1HUM A;  3D3R A;  4JI7 L;  3U50 C;  1OO9 B;  1UE6 A;  3KJP A;  4KHP L;  1B7Y B;  1A8V A;  4OEM B;  2JYO A;  2V4D A;  1KLG D;  3CC2 A;  3STB D;  1VQC A;  4R4Q A;  4JI7 Q;  4UY8 C;  2NVX H;  3M3Y H;  3MXN B;  2K33 A;  2QGQ A;  2IPK D;  3HGB A;  4LFC Q;  4HID A;  1HNZ Q;  1UAP A;  1U0L A;  1VQB A;  5JJI A;  2RSN A;  3R8B A;  3G48 A;  4A3G H;  4OON A;  5FO8 B;  3GTM H;  3MEH A;  3X3M A;  3MAQ A;  2ASB A;  1C48 A;  1SNP A;  2ZM6 L;  2KVM A;  1M1K C;  4V19 0;  2CHB D;  1BQQ T;  1SRO A;  3DUZ A;  3HEJ A;  1Q3L A;  3UDI A;  1Y69 U;  4J6H A;  4HJ8 A;  3KUP A;  4DNI A;  3S1N H;  1WYD A;  2Y0S B;  1XTC D;  3FPU B;  4I7Z C;  4E6I A;  1X3E A;  2K5W A;  4TVA B;  4JYA Q;  1Q8K A;  1NSN S;  1NUC A;  1KAB A;  2K7V A;  2CKZ B;  3DWA A;  3OIP A;  1LM0 A;  5AJ3 L;  1XX8 A;  5K36 G;  1NJI C;  3QJY A;  1LO5 D;  4KV6 A;  2XWB B;  1S40 A;  3L2P A;  2EXD A;  2B2Y A;  3NSW A;  1Z7T A;  2B2T A;  4JCV E;  4JI1 Q;  2B63 B;  1SMY D;  1J5E Q;  4A3L H;  4CBV A;  1Q12 A;  4EGV A;  4ZUJ A;  2HDL A;  5EKK A;  3AB9 A;  4NKL A;  2HUG A;  5JEA J;  1D1K A;  2HDM A;  3T51 B;  1IBK L;  3K5O A;  4UPA A;  3EJI A;  5KEE A;  2L4N A;  3J7A V;  4ZYS A;  1G6P A;  3PIO 3;  2OF1 A;  4ZKB B;  4B3R L;  1GM5 A;  3K0Y A;  3RMH A;  5FLM H;  3VYR A;  3W1G A;  4PNY A;  4LUO A;  4NMZ A;  1Q82 C;  3J80 E;  1KDB A;  1XPU A;  3MFY A;  4AQY Q;  2JA6 B;  1R9T B;  1Z6H A;  4RFB A;  3MWY W;  1K28 A;  2LS0 1;  1CA5 A;  1B50 A;  1FGB D;  4RHR A;  4B9W A;  4DPG A;  1G6Z A;  4RAU C;  5KYL A;  3ITP A;  4LFB Q;  4KJO A;  3U9O A;  3G6E A;  2QW7 A;  3F2B A;  4DR5 L;  1GVP A;  1V1O A;  3BDO A;  4OWT B;  1U4P A;  3TME A;  4K5V A;  1L1O A;  4RCO A;  3CC4 A;  4KK7 A;  1EOT A;  1YEZ A;  1Y8N B;  5KGU A;  4G4K A;  1HNW Q;  2NZH A;  1TR5 A;  1KNA A;  3G6J B;  2N88 A;  1DJR D;  1X65 A;  2PMZ E;  1S72 A;  1RIP A;  2R61 A;  2JA8 B;  4F88 A;  1LTR D;  1STA A;  2L15 A;  4OO1 I;  4R8N A;  3CCU A;  2D0O A;  1Y1W G;  5I6Y A;  3E0J A;  4A3F H;  1TS3 A;  1C0A A;  2ZXR A;  5GAG C;  1CQF A;  2EY6 A;  3MXP A;  4Z9C B;  1VQA A;  4A3I B;  5EGT A;  4LJZ C;  1VQM A; 
#chains in the Genus database with same CATH homology
 3I4L A;  2C5C A;  2F0G A;  4KKT A;  1J8I A;  3R3O A;  4IN3 A;  2L55 A;  5TSS A;  4KN4 C;  3S1Q B;  3UI2 A;  1F2L A;  1WTR A;  2B2V A;  5FK9 C;  4RGN A;  2EYJ A;  2F0U A;  3NHH A;  2QDB A;  4HCE A;  1IYV A;  4KN7 C;  3AMU A;  1PFM A;  1K8O A;  3S9W A;  3NP8 A;  3H94 A;  1O80 A;  1BDO A;  1E2Z A;  2WII B;  5A35 A;  3A55 A;  2XNA C;  4K6L A;  2E2I B;  2FMC A;  1SBB B;  1GUS A;  3E5S A;  4IZ8 A;  3M7G A;  5AFW A;  1O7Z A;  3D4R A;  2C9O A;  2L5T A;  2PW5 A;  1X3Q A;  5FOB B;  1H9S B;  1CM9 A;  1CZG A;  5M5W B;  2FHT A;  3BVM A;  1ZYR C;  1ESF A;  4RH6 A;  2CQA A;  4FNF A;  3Q0A A;  1I6V C;  1XXG A;  1H9M A;  1EIH A;  1FNV A;  3TZU A;  1DON A;  1T5X D;  1HRJ A;  1VF7 A;  5CYU A;  2K32 A;  1HPC A;  2RKS A;  4RCN A;  3KK7 A;  4F7X A;  4R8I A;  3MFG A;  4OIK A;  3J81 L;  1H9J A;  1BCP F;  1PTO F;  2F0O A;  4BS9 A;  4BWG B;  2PMZ B;  4DAP A;  2NVX B;  2KED A;  5DAU A;  1X32 A;  2PZU A;  2HQE A;  3I70 A;  2SEB D;  4A3G B;  3GTM B;  1SE4 A;  1H9K A;  1A3T A;  3OIQ A;  3S1N B;  5EKL A;  5IT9 E;  2D9U A;  5DNF A;  2RVL A;  5FKA C;  1ML0 D;  3HG9 A;  1PYW D;  1YNJ D;  5G3L F;  4KD4 A;  2E75 C;  4K2L A;  1F9S A;  3CRL C;  1BR9 A;  4H0L C;  5D3I B;  3D6W A;  2K1B A;  1SJE D;  1B3A A;  1S5E D;  2KUM A;  3NQT A;  4XT1 B;  4CKC A;  5JAV A;  2M9V A;  4LMQ D;  1G91 A;  2KOL A;  1G2T A;  5JPN C;  1PRT F;  4CGY B;  1G8Z D;  5C0X G;  1SYD A;  2WAQ B;  1BUV T;  2B2U A;  1TY2 A;  3K5M A;  1D2B A;  2A68 D;  4JK1 C;  2DN8 A;  1CT1 D;  4IUV A;  5IGF A;  1EZ8 A;  4J1M A;  4PMB A;  3I73 A;  4G57 A;  4IFD G;  3D4W A;  1IHZ A;  2E2J B;  2K5D A;  3SDZ A;  4QMG A;  4G7O C;  4DA2 A;  1KLU D;  2DNE A;  1X3P A;  3SVM A;  2WB1 B;  1ENC A;  3NBI A;  3VR3 A;  1SXT A;  2VNU D;  1IL8 A;  1HCZ A;  1LTA D;  3V05 A;  2FFK B;  5DM6 3;  2PO4 A;  3DEO A;  1G2S A;  1SYC A;  2IX3 A;  4ODG A;  3OSO A;  2AUJ D;  4A3F B;  1STB A;  4K8J A;  1QB5 D;  1O78 A;  4TKO B;  4DXG A;  2A6H C;  4UAI A;  2MHV A;  3HKZ B;  1E2V A;  2F0V A;  3DWP A;  1HHV A;  1FNU A;  3ERQ A;  4DF7 A;  4XIG S;  5A2Q E;  3M7N A;  1JWM D;  3Q23 A;  2NN6 H;  1FNW A;  1C8C A;  3VYT A;  4RGT A;  5C6A A;  3GTJ B;  1QNU A;  1SE2 A;  4L8J A;  4QF4 A;  4KHZ A;  1LTT D;  4C3I B;  5CV9 A;  2N55 A;  4IFD J;  4N9P A;  1QOH A;  4RKL A;  1SYG A;  3S15 B;  2B39 A;  3D6C A;  3WOE A;  5IGE A;  3SXH A;  3J7A F;  1STY A;  2F0P A;  1FYC A;  1SE3 A;  1Y1V B;  1IKL A;  1GHK A;  2F03 A;  4N9T A;  1B2T A;  1PMR A;  2KJX A;  2KA7 A;  2F0I A;  2F0E A;  2K5Q A;  1GXD C;  1RTO A;  3FEW X;  3KLS A;  3H91 A;  5EJW A;  5IGG A;  3V96 A;  4CHT B;  5JVG 3;  3PUW A;  1R4P B;  4X3S A;  2RDH A;  1SMY C;  2ZXO A;  3RZO B;  2NTS A;  1F9P A;  2EYH A;  1SEB D;  4KY6 A;  1SFO B;  4A3E B;  5CC4 A;  3CKI B;  1RCV D;  1AEX A;  3OHX C;  5C44 B;  5M9O A;  4XQJ A;  2AQ1 B;  1M8A A;  3LX0 A;  2G9H D;  4Q0F A;  1HQR D;  3SK6 A;  1TWA B;  4A3D B;  3K5L A;  3PIP 3;  3I72 A;  1BCP C;  2EJM A;  4DNT B;  4ZLT F;  3GTK B;  4FVM A;  1DOM A;  2DY8 A;  3GTO B;  4KTA A;  1TVX A;  1SND A;  1Q90 A;  2ZT9 C;  1SDF A;  1WCM B;  4QIW B;  3ND9 A;  4K5W A;  1L0X B;  4HTH A;  2K05 A;  3ERO A;  2K6A A;  2R7Z B;  2SNS A;  1F2M A;  1Q8I A;  4TSS A;  1A2U A;  1LV9 A;  1I4H A;  2WKC A;  3QOL A;  4XYQ A;  3S17 B;  2K28 A;  3P7J A;  4KKU A;  4BBS B;  1TS4 A;  3E6Z X;  3KF8 A;  2BA1 A;  1T5E A;  2LKV A;  3L7Z C;  2WV6 D;  2BA0 A;  2JEB I;  2AWN A;  4HMI A;  2EPB A;  1JOO A;  5A2Q L;  1Q1B A;  4OO1 G;  2F0K A;  5K5P A;  2D2C C;  1PRT C;  5KND A;  2ZXP A;  3K7A B;  4QUF A;  1BOS A;  4FO2 A;  2F0F A;  4U67 3;  1EQT A;  2H4O A;  1M4V A;  3SR1 A;  5C5L A;  2XWJ B;  3MVV A;  3SEB A;  3C3L A;  2Q8R E;  5IOC A;  1NAP A;  5ELD A;  2B2W C;  3NK9 A;  5T1I A;  5IIF A;  1GUG A;  4FF3 A;  1HA5 A;  1OXS C;  2WAC A;  4PQX A;  2PZT A;  4C56 C;  3J81 E;  4ULL A;  2FIN B;  5EQ0 A;  2KCN A;  3R2T A;  2NB0 A;  3IFD A;  1DOK A;  2H1E A;  4L63 B;  5CGK A;  5IGD A;  2K04 A;  3VR2 A;  2CW0 C;  3NPP A;  3TBI B;  1U4L A;  4GZY C;  1TS2 A;  5J22 A;  1YNN C;  1HTP A;  4LAA A;  1DD2 A;  1QJO A;  2RA4 A;  3MHB A;  3O13 A;  1SJH D;  3VA5 A;  3ZYY X;  2NN6 I;  2RDG A;  4EQO A;  3HRZ C;  5ELF A;  2A69 D;  3H6M A;  4Q5V A;  4G7Z C;  2Z4I A;  1KNE A;  1TQO A;  2ID0 A;  4M8A A;  2XRS D;  1JOK A;  3S1M B;  1CI3 M;  3PUY A;  3WDN A;  3FMC A;  2F0M A;  5DEH A;  4XYO A;  3S14 B;  1UUP A;  1SYE A;  2EVB A;  1FD7 D;  2MPM A;  2TMP A;  1JB3 A;  1CK1 A;  1A3U A;  3MXG A;  3K5N A;  1WTW A;  3GO5 A;  2D62 A;  5I2X A;  2XIW A;  3SHL A;  4C1N I;  1QWY A;  1MBY A;  5KNB A;  5G3L D;  5LL6 S;  2IX1 A;  5ISR A;  3AU7 A;  4DGZ A;  5C4H A;  3NE5 B;  2EYF A;  2NTT A;  2F0N A;  4V0B A;  5T1G A;  2L1B A;  4OGQ C;  1AP0 A;  3K59 A;  1SSO A;  4DAY A;  2B2Y C;  4CJ0 B;  1FR3 A;  2E74 C;  3P20 A;  3TP5 A;  4KD3 A;  1XYI A;  3GTP B;  3A8J E;  2KEC A;  1S5F D;  3HOU B;  5EPK A;  1K83 B;  1D5M C;  3CHB D;  2O4X A;  1OXX K;  1HA6 A;  1RJT A;  2KEE A;  3PMF A;  4HAE A;  1F77 A;  3R93 A;  5C3X A;  1GHJ A;  5JJZ A;  1CHP D;  1DM0 B;  3I4M B;  2EYO A;  4S3S A;  3P75 A;  1VMP A;  3EFX D;  1HTL D;  1SAP A;  3G7L A;  1DZ1 A;  3VR5 A;  2QIL A;  2NVY B;  1LAB A;  1L0Y B;  3URY A;  1BF4 A;  3RZD B;  2FMM A;  1ZKO A;  3KBG A;  1IW7 C;  4DAV A;  4K2K A;  1PFN A;  5CV4 A;  2EYM A;  1Y1W B;  5FLX L;  2QEJ C;  4RA8 A;  2BE5 C;  1DXM A;  4CJ1 B;  4IUT A;  1I4R A;  1MD2 D;  3TP7 A;  3C1F A;  3RUZ A;  1ENF A;  1JQY D;  1BXT A;  2EOT A;  3BVG A;  1HFN A;  3SE0 A;  2A6E C;  2Z1C A;  5ELC A;  1ILQ A;  1LT4 D;  1GUT A;  1Z47 A;  1JIC A;  4FXG C;  4NP5 A;  1NR2 A;  1EY8 A;  3M4O B;  1TS5 A;  3GTL B;  1D5Z C;  4FP5 D;  4A3J B;  2MP1 A;  1AW7 A;  2Z8L A;  1JE4 A;  1V8Q A;  1Y8O B;  5CBA E;  1ROD A;  1B9M A;  3M4Y A;  2B8F A;  1EEI D;  4BA2 I;  2SOB A;  4X3T A;  4P2C B;  1TWF B;  2PW7 A;  3SK5 A;  3RLF A;  3MTS A;  2YU9 B;  1WD1 A;  3IL8 A;  1W6K A;  4OHJ A;  3IKJ A;  3HOZ B;  4KI0 A;  1QIL A;  3GTQ B;  3P1H A;  4KY5 A;  1VF5 C;  4BY7 B;  4PV1 C;  4X3K A;  2KCC A;  2XN9 C;  3OWE B;  4CKE A;  1I4X A;  3HZX A;  2IL8 A;  4ZAI A;  2E2D C;  1UEA B;  4C2M B;  4XQN A;  3DXJ C;  4L6T B;  1JWU D;  2DNC A;  5JVH 3;  3QB3 A;  3TP8 A;  4ABN A;  2WKD A;  3T4A C;  2F0Q A;  5E1F A;  2I07 B;  1GJX A;  5EKI A;  4K6D A;  2AUK A;  3CQZ B;  5KNC A;  1RTN A;  1ZYR D;  2CVR A;  1F9Q A;  1LTS D;  3NTH A;  4C3H G;  2L12 A;  1WTV A;  1TWG B;  2F0D A;  1AZP A;  1C4Q A;  4B08 A;  3S1R B;  1EL0 A;  4MIU A;  4K8I A;  2J4X A;  1STG A;  4XT3 B;  3A7A B;  2QKI C;  5LL6 X;  1PLF A;  1KAA A;  5JEA H;  1QE6 A;  1CA6 A;  5I9O A;  4IUN A;  5C5M A;  1ET6 A;  3Q24 A;  2OXP A;  2VXW A;  5D14 A;  4XTC S;  3PUZ A;  4KY7 A;  1SNO A;  2Q8I B;  2OEO A;  3M85 A;  3VA7 A;  2KQ3 A;  5EPJ A;  1EYA A;  3GD7 A;  4JBW A;  5C0X J;  1ZEQ X;  4H7B A;  2RDF A;  3OMC A;  2LFN A;  3NTI A;  2F0J A;  4DXF A;  1U9R A;  1EYC A;  4G7H C;  3A7L A;  5I2Y A;  1EWH A;  2EY1 A;  2SDF A;  3I91 A;  1RKN A;  1A6X A;  2BDN A;  3DEP A;  1MSH A;  3N52 A;  2E2H B;  3H0G B;  1SNC A;  4HN7 A;  3HOW B;  4Y7N B;  4RGM A;  1B9N A;  1OXU A;  5EPL A;  4C3J B;  4O42 A;  3VYS A;  4B9X A;  5K36 H;  2K03 A;  4DNR B;  1F2Z A;  2R92 B;  1QNK A;  2BDO A;  2B2U C;  2F1M A;  4IFD I;  5F2D A;  1SNQ A;  1CFM A;  1D6E C;  2ICI A;  4WJW A;  1WD0 A;  5BN4 A;  3BZD B;  1U4M A;  1F9R A;  1CZW A;  2F4I A;  3L9A X;  5LHY 1;  2M2L A;  1TWH B;  1JOQ A;  1TKW B;  4IUU A;  5I4D A;  1II3 A;  5FO9 B;  1JWS D;  3S2H B;  3SK8 A;  2LY7 A;  2QCP X;  1PTO H;  3A56 A;  1BBX C;  1EY4 A;  2B2W A;  2XRQ D;  2R6G A;  4OIJ A;  1EY0 A;  1PZK D;  3A8I E;  4DK1 A;  3C46 A;  1STE A;  3W3A A;  2EY2 A;  2Z4H A;  1K8M A;  2F0T A;  2EZV A;  1I50 B;  2X69 A;  1KDA A;  1E2W A;  1ET9 A;  2A5H A;  2JA7 B;  3KBX A;  2PCF B;  2OT2 A;  2WP8 J;  3OMG A;  1WVL A;  3BDC A;  3NTK A;  4UDU C;  3EVQ A;  4ME5 A;  3IFT A;  1EYD A;  2A69 C;  3QWN A;  2A6H D;  4ZK9 B;  1ESR A;  4A3M B;  3X3N A;  5ELE A;  4A3K B;  3L3O C;  4FXK C;  3OWF A;  4XDX A;  3BYY B;  3DHQ A;  4O1N A;  1E0B A;  3H09 A;  4PMW A;  1JC7 A;  4QUC A;  4WOR A;  1B4O A;  3BDL A;  3DM1 A;  1TU2 B;  4F87 A;  1VCI A;  2XSC A;  1RF2 D;  3VR6 A;  4HSV A;  2HCI A;  4RHS A;  5DM7 3;  4QB4 A;  1JOR A;  2O2L D;  2NN6 G;  3I8Z A;  2VUM B;  1GUO A;  5CR3 A;  1RD9 D;  4NDX A;  3FPP A;  3MXU A;  3K57 A;  3PO2 B;  4RGO S;  5CV7 A;  2RSO A;  4XQQ A;  3T53 B;  2F3V A;  3KLR A;  2R93 B;  4IAL A;  2D5D A;  4WRD A;  4WFN 3;  1JCK B;  2E76 C;  1LTB D;  2DY7 A;  1DCZ A;  2JE6 I;  5EBC A;  2EDG A;  2O5J C;  3A54 A;  3MZ5 A;  2J7Z A;  4M1U B;  2B8G A;  1QG7 A;  1EU3 A;  5C4Z A;  1I6H B;  3OOC A;  3TN2 A;  5C3W A;  1JR0 D;  5FLX E;  3KLS X;  5M3M B;  1V43 A;  2EE1 A;  5M5Y B;  1VMC A;  4FF2 A;  1TWC B;  1EY5 A;  1TT2 A;  1A15 A;  3HOV B;  5KYI A;  3OPO A;  4MHE A;  3I3C A;  3JAM L;  3CRK C;  5CV8 A;  1BO0 A;  3ONA B;  1BCP D;  2XVS A;  4FYD A;  1PTO D;  2ENB A;  3GV3 A;  3D31 A;  1DYQ A;  1I4P A;  4ZRZ A;  2BCO A;  2F0L A;  5NUC A;  1IYU A;  2VB2 X;  1Q1E A;  4F8M A;  4HR7 B;  4HED A;  2IT1 A;  3IAY A;  3FVQ A;  5E4X A;  1MSG A;  2PQE A;  4FXD A;  4DN4 M;  2F0S A;  2F3W A;  3LNN A;  4I65 A;  5D65 A;  1GOZ A;  1VDZ A;  1J9O A;  3QO2 A;  4PMC A;  4HCS A;  3NUC A;  1LLR D;  5J39 A;  5CV5 A;  1NCV A;  3DMU A;  2IW3 A;  2EYP A;  1YNJ C;  1SYB A;  2B2T C;  3HOX B;  3PUX A;  4FF4 A;  2NVQ B;  3QIA A;  3GV6 A;  1H9R A;  1I4G A;  3RD4 A;  3GTG B;  2R3Z A;  2LMC B;  5J1Z A;  1PRT D;  1GUN A;  1EZ6 A;  5JOB A;  3S2D B;  4MN3 A;  4U68 A;  1V1P A;  5C0X H;  2NBF A;  1EU4 A;  4ZQ3 A;  1PDQ A;  4H13 C;  1ILP A;  2MJ8 A;  1BCP B;  1PTO B;  2A68 C;  4A3B B;  5E3F A;  3SK4 A;  3TZD A;  1BNZ A;  1HQM C;  3MXN A;  2EJF C;  2NVT B;  3T56 B;  1I4Q A;  4IFD H;  4BA1 I;  3LWE A;  1CHQ D;  4K14 A;  4KMU C;  2F0W A;  1GUW A;  1G29 1;  1PFB A;  2J0T D;  2K01 A;  3PUV A;  4KHV A;  1WTX A;  1D5X C;  3D4D A;  3EQL C;  3NXW A;  2CW0 D;  4HSP A;  1W6J A;  4A93 B;  1STH A;  2ICE C;  4FF1 A;  1PZJ D;  2RQX A;  4EVO A;  2IJ0 A;  1S4Z A;  3OW7 A;  1YNN D;  2TSS A;  1PXU A;  4X3U A;  3ND8 A;  4ZKC B;  1UNS A;  2Q8T A;  2F0H A;  1LT6 D;  1TII D;  4C1N K;  3J80 L;  1HXY D;  3D8G A;  5BN3 A;  2B2V C;  5M5X B;  3BVZ A;  3F2U A;  3M3Y B;  3S16 B;  2I46 A;  1B1Z A;  1WTO A;  1QCB D;  1PRT B;  1U4R A;  4J8Q A;  5D3D A;  4NW2 A;  1EY6 A;  4TQU S;  1XWE A;  2M00 A;  1I3Q B;  1D1I A;  4R9W A;  2PZW A;  5CMD A;  4QCL A;  1CQV A;  2WIN B;  3FRP B;  3T13 A;  5IOD A;  5I6W A;  4RWS C;  1B44 D;  3I90 A;  3A8K E;  3GP7 A;  5EBD A;  2X6G A;  3FDT A;  4C3I G;  3MA2 B;  5COY A;  2O5I C;  1ENA A;  1TY0 A;  1PZI D;  1LT3 D;  4C3J G;  3GQB A;  2EY5 A;  2NYZ D;  1EY7 A;  2HCC A;  2JEA I;  1LAC A;  4BBR B;  1S5C D;  3NWT A;  5C4J B;  2JSO A;  1CTM A;  3FKI B;  2A73 B;  2RBM A;  1MI2 A;  2MGS A;  4IUR A;  2A74 C;  2JA5 B;  4ILW A;  3NBH A;  1WTQ A;  5HUR A;  5E4W C;  5JPM C;  1EFI D;  1RHP A;  1B53 A;  1LTG D;  4CKB A;  4DFA A;  1EQV A;  2KHS A;  4EQN A;  1Y8P B;  3U9S A;  1A2T A;  5BN5 A;  3NQI A;  1IW7 D;  3T16 A;  1KDC A;  1EEF D;  2EYL A;  2YYZ A;  3K58 A;  3TP6 A;  1LTI D;  1ICW A;  1KTK A;  3EA6 A;  2G9D A;  4ID6 A;  2BE5 D;  2NZ1 D;  4ZUI A;  5IGC A;  5I9P A;  3DWQ A;  3H3V C;  4H44 C;  1AZQ A;  1O7L A;  3VYU A;  1ONL A;  2L0C A;  4KKS A;  1RDP D;  4LK1 C;  1H9S A;  1LT5 D;  3HS0 C;  2A6E D;  4XXE A;  4IUQ A;  2VB3 X;  3K6O A;  1F2Y A;  5FO7 B;  5KRU A;  1S5D D;  2L11 A;  3TSS A;  5C0X I;  3TDQ A;  2GA4 B;  2QF7 A;  5M3F B;  4CJ2 C;  4IUP A;  4KJN A;  2EJG C;  4OO1 H;  1NR4 A;  3NWS A;  5ELB A;  4TRD A;  5CBE E;  3C1E A;  3J7Y W;  3VR4 A;  1MGS A;  2IWH A;  3R2I A;  4RKB A;  2FJ2 A;  1EWC A;  4K5X A;  3Q6S A;  3Q22 A;  1WTP A;  2PPB C;  1S5B D;  2BOS A;  4HMJ A;  5KIX A;  5IT9 L;  3JAM E;  2EXZ A;  3BYT B;  1DOL A;  4DK0 A;  3QOJ A;  5COR A;  2NUC A;  2IX0 A;  2MUY A;  1AN8 A;  1A3V A;  5C3E B;  2AWO A;  5CV6 A;  5C4X B;  4C3H B;  4YIJ A;  2NWG A;  1EY9 A;  2PYK A;  3W2D A;  1O7Y A;  3WOF A;  2AQ2 B;  3C2P A;  3HOY B;  1HUN A;  4EQP A;  3PO3 B;  4BY1 B;  2AQ3 B;  1OXT A;  2JP1 A;  1HFG A;  3MC0 B;  4DU9 A;  2X6L A;  3QG1 A;  1SYF A;  3I4N B;  3BS1 A;  2L9H A;  2SNM A;  2PNR C;  3LWU A;  2JXM B;  1R4Q B;  1IKM A;  4AYB B;  5IGB A;  1SNM A;  1EIG A;  1PTO C;  3V2T A;  3PV0 A;  3N6R A;  3CU7 A;  1OXV A;  5JEA G;  3BG3 A;  1STN A;  3HP3 A;  4OL7 A;  5HGT A;  1ZXT A;  4IQZ A;  1V1P B;  1AFP A;  1HUM A;  3D3R A;  1OO9 B;  2JYO A;  2V4D A;  1KLG D;  2K33 A;  2IPK D;  3HGB A;  1UAP A;  2RSN A;  3R8B A;  5FO8 B;  3MEH A;  3X3M A;  3MAQ A;  1C48 A;  1SNP A;  2KVM A;  4V19 0;  2CHB D;  1BQQ T;  3DUZ A;  3HEJ A;  1Q3L A;  1Y69 U;  4J6H A;  3KUP A;  2Y0S B;  1XTC D;  3FPU B;  4I7Z C;  4E6I A;  2K5W A;  1NUC A;  1KAB A;  1NSN S;  2K7V A;  3DWA A;  3OIP A;  1XX8 A;  5K36 G;  3QJY A;  1LO5 D;  4KV6 A;  2XWB B;  2B2Y A;  3NSW A;  1Z7T A;  2B2T A;  2B63 B;  1SMY D;  4CBV A;  4EGV A;  1Q12 A;  4ZUJ A;  2HDL A;  5EKK A;  3AB9 A;  4NKL A;  5JEA J;  2HUG A;  1D1K A;  2HDM A;  3T51 B;  3K5O A;  3EJI A;  5KEE A;  2L4N A;  3J7A V;  4ZYS A;  3PIO 3;  2OF1 A;  4ZKB B;  3K0Y A;  3RMH A;  3VYR A;  4PNY A;  4NMZ A;  3J80 E;  1KDB A;  3MFY A;  2JA6 B;  1R9T B;  1Z6H A;  4RFB A;  3MWY W;  2LS0 1;  1CA5 A;  1B50 A;  1FGB D;  4RHR A;  4B9W A;  1G6Z A;  4RAU C;  5KYL A;  3ITP A;  4KJO A;  3U9O A;  1V1O A;  3BDO A;  1U4P A;  3TME A;  4K5V A;  4RCO A;  4KK7 A;  1EOT A;  1Y8N B;  5KGU A;  4G4K A;  1TR5 A;  1KNA A;  3G6J B;  2N88 A;  1DJR D;  2R61 A;  2JA8 B;  4F88 A;  1LTR D;  1STA A;  4OO1 I;  4R8N A;  5I6Y A;  3E0J A;  1TS3 A;  2ZXR A;  1CQF A;  2EY6 A;  3MXP A;  4Z9C B;  4A3I B;  5EGT A;  4LJZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...