2FMMA

Crystal structure of emsy-hp1 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
EKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein EMSY
publication title Crystal structure of the HP1-EMSY complex reveals an unusual mode of HP1 binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2fmmA00
2N55A 4LMQD 1A15A 2M2LA 1J8IA 2SDFA 4R8IA 2K1BA 1RJTA 2B2WC 2EE1A 2MJ8A 1WTPA 2L1BA 4RAUC 2KEEA 4X3UA 5CBEE 1WTWA 1CM9A 3UI2A 1G2SA 1PFBA 1ZXTA 5EPKA 2KVMA 5AFWA 2RSNA 1CA5A 3MWYW 1QE6A 3IFDA 2HDMA 3SVMA 1C8CA 2L12A 1G6ZA 3FDTA 3H91A 1GUWA 1ESRA 3KBXA 5EKIA 1VMPA 4MN3A 1PFMA 3IL8A 1QNKA 1MGSA 5JJZA 4IUPA 1BF4A 4HCSA 2KUMA 3KUPA 1B3AA 2IL8A 2L4NA 4XT3B 3I3CA 1HFNA 1PDQA 1WTQA 1X3QA 1EIHA 1ICWA 4CJ0B 1EL0A 1E0BA 2HCIA 2HUGA 3GV6A 3ONAB 3P7JA 2FINB 4MHEA 1XYIA 4ZKBB 3DEOA 4CJ1B 1IKMA 1NR2A 1B53A 1WTXA 1X3PA 4ZLTF 2Q8RE 1ML0D 4IUVA 1DOKA 1F2LA 2B2WA 1AZQA 4IUUA 4QUFA 5E4WC 1BBXC 1G91A 2B2UC 2NZ1D 2FFKB 4UAIA 5EQ0A 2B2UA 2FMMA 4IUQA 4XDXA 3I8ZA 1SDFA 5EPJA 1IKLA 5COYA 1MSHA 3N52A 3F2UA 4RWSC 1HUMA 1DOLA 4ZK9B 2HCCA 4RA8A 1B4OA 2D9UA 1MSGA 2K03A 2NWGA 1RTOA 1RODA 1WD1A 4CJ2C 1IL8A 4X3TA 2RA4A 3D6WA 1G2TA 2RSOA 1EOTA 2XIWA 2BDNA 2FJ2A 4IUTA 5E4XA 1F9SA 5CMDA 2B2TC 3Q6SA 1SSOA 4X3KA 5T1GA 2B2TA 3R93A 1BNZA 4NW2A 1F9RA 2K01A 1X32A 4OIJA 2H1EA 1F9PA 5D65A 3GV3A 1B2TA 1O80A 1VMCA 1O7YA 2N88A 1DOMA 2J7ZA 1NCVA 1S4ZA 1TVXA 1RHPA 5DNFA 2B2YC 1EIGA 1HUNA 1U4PA 1BO0A 1MI2A 2B2YA 1Q3LA 2B2VC 2DY8A 2Q8TA 1WTRA 2B2VA 1NR4A 1HRJA 1RTNA 2K05A 2MPMA 3MTSA 5EPLA 1DZ1A 1WD0A 2EPBA 1ILQA 4HAEA 2DY7A 3QO2A 4DN4M 2L9HA 3HP3A 4QUCA 4U68A 4ZKCB 3I91A 1PLFA 1WTOA 1U4MA 2FHTA 1F9QA 3G7LA 5D14A 1KNAA 1NAPA 1M8AA 2R3ZA 2RVLA 5CBAE 1EQTA 2JP1A 2JYOA 2X6GA 1QG7A 4HEDA 1SAPA 1JE4A 2KEDA 2HDLA 1U4RA 2MGSA 1WVLA 2MP1A 4OIKA 4ZAIA 1J9OA 3I90A 1XX8A 5T1IA 3DM1A 1HHVA 2KECA 1B50A 2X6LA 1ILPA 1AZPA 2CVRA 2VXWA 4X3SA 1WTVA 5CORA 1U4LA 1O7ZA 2K04A 1AP0A 1LV9A 3LWEA 1JICA 1CA6A 1KNEA 3TN2A 1HFGA 2KOLA 4IURA 1DONA 2NYZD 3FPUB 5EJWA 3TZDA 2K28A 2L11A 4HSVA 2EOTA 4O42A 2X69A 4R9WA 1HA6A 1PFNA 3DEPA 4XT1B
chains in the Genus database with same CATH superfamily
2OT2A 2SDFA 4GOPB 3J81c 4RAUC 3I4LA 3NPPA 3OTOL 2WAQB 3D4RA 3D6CA 1B1ZA 4EQNA 5C4HA 1K9MC 2LFNA 4RHRA 4JBKA 3MWYW 3I55A 2H5XA 2PZWA 3KBXA 1HNWL 3K5MA 2JQOA 3AEVA 1PFMA 3GQBA 1VQBA 4A3JH 4HCSA 5CV4A 1MJCA 2QW7A 4K5VA 2KJXA 2PNRC 1PDQA 3A8IE 5ELEA 1AW7A 3T1HQ 3VR5A 1Y8OB 1GUGA 2BE5C 1IKMA 3TMEA 3H09A 1B53A 5KYLA 4GKJQ 1GUSA 2DNEA 5IWAQ 1EFID 5KNBA 1CUKA 1BCPD 1T5XD 4BA1I 5IYCG 2AMCB 4C2MH 2Z4IA 4A3JB 3K7AH 1KABA 3PCOB 4FF3A 1N34Q 2EY5A 1B4OA 2CHBD 2A6HD 2DJGC 1L2FA 5IOCA 3CC7A 2EXZA 3K81C 1Q46A 1JE5A 3PUWA 5C4XB 4LF7L 2F0SA 2XIWA 2NZHA 1ESFA 3X3MA 3M4QA 4B3TQ 1EWHA 2B2TC 3GTMB 2XVSA 3RZDB 1W6KA 3K7AB 4HIOA 1F9PA 5D65A 4EQOA 2QKIC 4DV0Q 1HQMC 2NUCA 2Z9HA 5FO8B 1PVOA 1HNXL 2KCCA 5JEAG 4KI0A 3VYTA 4UY8C 3K57A 2K05A 1E2VA 4JPBW 2UUBQ 4X6AH 2EIFA 1IYUA 3ER0A 2AKWB 3N6RA 2JA6G 3G7LA 5D14A 4LFAQ 1DYQA 3E6ZX 1QG7A 1SAPA 1EEID 1I4RA 2I46A 4BY1G 1B44D 3SHLA 4X64L 2R7ZH 1STYA 1QOHA 3HS0C 2DNCA 2AQ2B 3I90A 3K7UC 2I0QA 3TP8A 1Y8NB 3Q0AA 4DR2Q 1TWFB 2QDBA 4IFDH 4M1UB 1U4LA 2BOSA 4KN4C 3CW2C 3A5UA 4R4CA 3LNNA 3FPUB 2R7ZB 1EQVA 4I7ZC 2UUCQ 3E5SA 4DR4Q 4YCWA 2CWPA 2EY1A 2K1BA 2K75A 2VQFQ 3G6JB 1S5FD 2PQEA 4OL7A 1G6ZA 5HY6A 2B3GA 5IGEA 4LNQA 5FLXL 1A63A 2ZXPA 1SMYD 3S17H 4LFCQ 3PGZA 1H9KA 1EZ8A 1WTQA 2E5LL 4JBWA 3H3VI 4JI7Q 1X65A 4RCOA 5JJKA 1CKMA 2GN5A 3HOZH 1EU3A 2B2WA 1IW7D 3C3LA 1I50B 4KLKA 2NN6G 1L0WA 4POFA 5COYA 2QF7A 3RLOA 1PMRA 3N52A 1XMQQ 3I4MH 1XNQL 2D9UA 1V43A 3S1RB 1RTOA 2EDGA 4YWMA 1P16A 3TP7A 4X3TA 4G7OC 1Q90A 4O1NA 4A3KG 2WB1G 4HJ9A 1VQJA 2QA4A 1D8LA 3E9HA 3QOLA 3R93A 3M3YH 2N3SA 1TXYA 1F9RA 5M5YH 1LT5D 2F0QA 3RN5A 3T1YQ 2B8FA 5LHY1 2H1EA 3UE0A 1B2TA 5K36G 2Z6KA 2PYKA 1SYBA 3S15H 4DV7Q 1S5BD 3L9AX 1WTRA 5BN5A 1PTOD 2YTYA 1NR4A 3W1BA 3ZJYC 4HIKA 4KKUA 2MPMA 4RGNA 1S5ED 1ILQA 2F0HA 1PYBA 4HR7B 2F4VL 3J7AF 4KMUC 4IFDI 5M5YB 3WOFA 2F0VA 3FMCA 4R4TA 3TS2A 3S2DH 3HOWH 4JYAQ 3F2CA 4KK7A 4H0LC 4R1JA 4DV3Q 3S15B 5I9OA 1IBMQ 2F0MA 4LJZC 5G3LD 4B9WA 1AEXA 4DV2Q 4DK3C 3Q22A 1ET9A 1E1OA 2OXPA 1XPRA 1SYGA 5I2YA 5CV5A 4KTAA 4OWWB 2RDGA 1WYDA 3S2DB 3HOWB 2KOLA 1GM5A 1Y14B 2AQ1B 3SK6A 1E24A 1SYEA 3DEPA 1EUJA 5C3XA 1YNJC 4A3FH 4UPAA 1CM9A 3UI2A 1E22A 1BKBA 2EXDA 3I70A 1MHWC 5LMNL 5TSSA 4JK1C 3S14H 1BDOA 1ESRA 1SBBB 4IUPA 1I94L 3NBHB 1CI3M 3TZUA 4HSPA 1M90C 4LFBL 3TP6A 4CKBA 1HNWQ 4IPHA 4A3FB 1BOSA 4JI6Q 1XYIA 2RDFA 2JA5B 3DEOA 3D4DA 1D1KA 1RF2D 3S14B 1CSQA 5KEEA 4GN5A 1KD1C 4QIWB 4QY7A 1IXRA 1UE5A 4IUQA 1KLGD 4XDXA 4QL5A 4IO9A 3F2UA 2N49A 3QB3A 3HOXH 3WOEA 4J1MA 4K5WA 4R4QA 1RODA 3V05A 5CC4A 5IGGA 2B63G 2G9DA 1WJJA 2PQAB 2RHSB 3SK8A 4JOIA 3J80i 3Q6SA 2HD3A 2DGYA 3TP5A 4IN3A 1B7YB 5IGBA 4OIJA 4PMCA 2Z6KC 3HOXB 2N88A 4GNXC 2KHIA 1EZ6A 1BO0A 1MI2A 5ELNA 5LL6X 1HRJA 4DUYL 3MTSA 1YHBA 2KHSA 5KGUA 1HNXQ 2A1AA 1GD7A 2IJ0A 4JCVE 1BUVT 3J81i 2IT1A 3HEJA 1HXYD 5ELCA 4DUZL 1TS3A 2LY7A 4JI4L 2K50A 4OIKA 1YBYA 4DV5L 4UP7A 3CC2A 1B3QA 1VQAA 3DM1A 5T1IA 1JB7A 4RMFA 1EWIA 3SGIA 4K8IA 1JOOA 1LM0A 5CV8A 2JE6I 4F87A 4LF5L 3EIVA 1CA6A 1KNEA 2KCTA 3AB9A 1VQHA 3KYHC 4DV6L 4HSVA 5F2DA 1PH5A 2GVBA 4C3HB 4A3LG 4DR7L 3AFQA 3MVVA 3Q23A 3I4NH 2PW5A 1YIJA 4YY3Q 2N78A 3BVMA 1HZCA 2PPBC 3FPPA 1XJVA 4CHTB 1V1PA 3TQYA 1C9OA 2ZXRA 3HRZC 1CSPA 4KJNA 4BBSH 4CJ0B 3I4NB 2HUGA 3SK5A 2XWBB 4CJ1B 1XTCD 3WDNA 2F52A 2Z4HA 4DAVA 1DOKA 3MHBA 1EU4A 1GO3E 1LT6D 4YHHL 5C3EH 4GKKL 1PH8A 3MXGA 1H9SA 2VQEL 4CJ2C 5IT9E 1YNND 2ZJPA 4LUOA 1PFSA 1XNQQ 2IW3A 4POGA 1EYDA 1DJRD 4JOIC 5FJ8H 4DXFA 1AE2A 4X65L 1AE3A 5IODA 2E2HH 4KJOA 2F0JA 1CK1A 3GTKH 4Y7NH 2VUMG 2C5CA 2EZVA 1G51A 3PIO3 1NCVA 1KLUD 1F2YA 2HQLA 2PQAA 2PMZB 2WIIB 5C0XG 1HUNA 2Y0SG 1Y1WH 2R92B 4YIJA 4WJ4A 4A3GG 4C56C 5IGFA 4YCUA 1NBWA 2Q8IB 1TWGH 1PLFA 3MFYA 4GLXA 1U4MA 4OXPA 1KNAA 1GKHA 1NAPA 5FLXE 4Y7NB 2F4VQ 2CQAA 1I6HB 1KTKA 4DR3Q 2RCFA 1PZJD 1WVLA 3STBC 2A74C 3E0JA 1Y1WB 4LWCA 2F0GA 3EFXD 1HR0L 1NJIC 1ENFA 5C44G 4LF8Q 3HOUH 1KHIA 1EIYB 4A3DG 4C3IG 1AP0A 4FXGC 3CCUA 2EVBA 3S1MH 2VY3A 4BXXH 1ZEQX 2L5TA 2QILA 2IWHA 4DV4L 1HNZL 4J6HA 4ALPA 2NVQH 1MKHA 4RHSA 3VR6A 1J8IA 1B9MA 1EY4A 3R2IA 1KDAA 2EE1A 1SJED 4KHPQ 1OXVA 1XNRL 2E2DC 1J5EQ 4R4OA 4JI3L 5CV6A 3T56B 1K8AC 1LUZA 1B70B 2WV6D 3BYTB 3D0FA 4ZUIA 1IYVA 1JR0D 1UAPA 1QVFA 2K5QA 3DWAA 3RMHA 1SNOA 2HIXA 1SJHD 5HURA 4ULLA 1KC8C 4CGYB 2K6AA 2L4NA 5M3MH 5FO9B 4CDCC 2FINB 1I94Q 2OTJA 4LFBQ 2CCZA 1X54A 3J7YW 4PZ6A 2DN8A 1EYGA 5M5XH 1D7QA 5EGTA 4IJHA 1RL2A 4GN4B 5IYCH 4UP9A 3LWUA 3C1FA 2B8GA 5M3MB 2CQOA 2XSCA 1SNMA 4TVAB 4KD4A 4S3SA 1TS5A 2F0OA 1IL8A 1SE2A 2KCNA 1L1OB 4IPDA 1HZ9A 3F8TA 4YWLA 1CQVA 1XWEA 3H0GB 4C3JG 2EYMA 4N8FA 1FNWA 3JAME 1SNDA 4OHJA 3ULJA 3GV3A 3ICEA 5C4JH 1GHJA 1BCPB 2PNHA 1DOMA 4EQPA 4NPSA 2PMZE 1BR9A 5JEAH 2NTTA 2UUAQ 2PZUA 1JQYD 1Q1EA 2AHOB 3HP3A 4ZKCB 1PA6A 2K4KA 2JA6H 1VQ4A 1VQLA 5CBAE 2D62A 1EQTA 2OQKA 3H6MA 2A69C 1I4XA 5C4JB 2OEOA 3W3AA 2EYPA 5IYBG 4BY1H 1K83H 2E76C 3J81j 1XX8A 1JOQA 4DUZQ 3FKIG 1ILPA 3E9IA 4HJ8A 2CVRA 4DR5Q 2JA6B 1O7ZA 3VYSA 4DR6L 1A3TA 4QJFA 1PH3A 1Y8PB 5A35A 2EY2A 2A68D 4P74A 2I5LX 4LF5Q 1GUWA 2EY6A 3KLSA 2F0KA 2JA7G 1G2SA 1H9RA 3J80c 3DWPA 2KVMA 2NVXH 3HOVG 5C4ZA 1IBLQ 2CWAA 5IP7G 2IPKD 3IFDA 3NTIA 1QUQA 4DAPA 2NTSA 5H1SE 1VMPA 3OHXC 2AUJD 3PUYA 4KY5A 2K5NA 4QMGA 1STGA 2V4DA 3QOJA 5GQOA 5K5PA 4TRDA 4B3SQ 4BWGB 4K14A 4PQXA 2E74C 1XXGA 3KF6B 1VQ9A 1SNCA 4IUNA 3P1HA 1Q82C 1HZBA 1BBXC 2CH4W 2ZTDA 2LSSA 5FLXc 2XWJB 1MD2D 5IIFA 3OW7A 1MSHA 3DHQA 1GHKA 2RQXA 1H95A 1SYFA 4JI5Q 3TS0A 1S5DD 4YHHQ 4GKKQ 5KIXA 1G2TA 4A3KH 2TMPA 4K6LA 4NXMQ 2D5DA 2VQEQ 1EOTA 3GTJH 1V1OA 1O78A 2QEJC 1LT3D 2M9VA 3QJYA 1W3SA 5KRUA 1HTPA 5C5LA 3IFTA 1Q81C 5DLQE 5K36H 4J8QA 4K2LA 4A3CG 1L1OA 2EYJA 4DV1Q 3BVZA 1SE3A 4L63B 1RDPD 4LW1A 2ZM6L 2WB1B 3GTJB 3P20A 4RH6A 2JEAI 4IOAA 1PTOH 4MZ9A 2JP1A 1EQRA 2BA1A 4GNXB 4LF4Q 1JE4A 1YZ6A 1YEZA 2F0WA 2IX0A 3L2PA 4HMIA 4L5SA 4C2MB 3GTPH 3G4SA 4L6TB 4MTKA 3CCJA 4PMBA 2KA7A 2FMCA 1PTOB 2MNAA 4X62L 2R61A 4JI7L 4I65A 4IFDJ 5JOBA 1SE8A 4O42A 2JJQA 1PFNA 1LTRD 1A15A 3A74A 2L1BA 4PV1C 2ZXOA 4DV4Q 3K59A 1LO5D 3NSWA 1HNZQ 1U5KA 3VR4A 2O5IC 1PYSB 1PRTC 2CW0D 1XNRQ 3EA6A 1C0AA 1TWCH 3K0YA 2MQHA 4RG1A 5IT9L 1SYDA 3HKZB 2WINB 4A3IG 1MIUA 4LF9L 1HJPA 1UNSA 2RKSA 1SNQA 1HPCA 1PRTF 2EQSA 3I2ZA 4AYBE 1FGBD 1UE6A 4ZLTF 4B3ML 5BR8Q 1QB5D 1TWCB 3DXJC 3LX0A 4IUUA 4OGQC 5EQ0A 1Q8KA 3VA7A 1IHZA 2WAQE 1PH4A 3AMUA 3MEFA 1STBA 3NQIA 1D6EC 2KQ3A 4H13C 1A2TA 2R7FA 3J7A5 4A3BH 3KF6A 2NWGA 2B63H 3KOJA 3U50C 2F1MA 4KHVA 1OXUA 1VS0A 4RKLA 4LF6Q 3BJUA 3QG1A 1VQDA 2PW7A 3CD6A 1QJOA 1SSOA 1Q8IA 3DMUA 1X32A 2K5DA 2R93G 4B3RL 2Z8LA 1TWAH 1L1OC 4A3BB 2K5WA 1F2MA 2JEBI 2B63B 1CFMA 3S17B 3KFUA 1DCZA 2OQ0A 4H7BA 1QVCA 2DY7A 4A93G 3FP9A 3I91A 1FNUA 4B08A 4Y52H 1BCPC 4CBVA 4BBRG 2JYOA 1ET6A 3HOZB 1CTMA 1TWAB 4FDBA 3LGJA 1VQFA 3G71A 2XNAC 1WCMH 2A6HC 4EVOA 3Q8DA 4NXNL 1EY6A 3I4MB 2D0OA 1CQFA 4KHZA 1LABA 1PHJA 1VQKA 1AH9A 1BCPF 4GNXA 1WOCA 5CORA 1IBKL 3R3OA 4X66L 5FKAC 3TN2A 4A3JG 2M00A 4FF1A 3M3YB 4IALA 4DR6Q 2Q2IA 1WCMB 2BA0A 4XT1B 5C4XG 2A73B 1TQOA 4X3UA 2PI2A 2I07B 2YYZA 1A3VA 5EPKA 2C35B 3IKJA 4A4IA 4B9XA 1I3QH 3R2TA 1E3PA 1Q86C 2O5JC 5EKIA 1V9PA 1II3A 1QNKA 2K14A 3HKZE 3BDLA 4G7HC 2KUMA 4AQYL 5E1FA 4JG2A 5C0XJ 2QCPX 3AU7A 5JVH3 3ERQA 4KY7A 2JA9A 1JJCB 3JAML 1V1PB 3CHBD 4YCVA 4OX9L 1X56A 2LS01 3WWVA 3VR2A 2NZ1D 4UAIA 1A0IA 2FFKB 1EWCA 5M9OA 3OTOQ 1VQCA 1VQPA 3CMEA 3VA5A 5IYDG 3D8GA 4PMWA 4C1NK 3K5NA 5E4XA 3MFGA 4MNOA 3UDIA 1D5MC 1R9TH 2UU9L 1H9SB 1SMYC 3PO2G 5CV7A 2VUMH 1B9NA 3F2BA 4IFDG 4DR1L 1FYCA 1SR3A 3KK7A 4V0BA 1RTNA 1XMOL 4JI2L 4A3GH 3CC4A 1PH7A 1F2ZA 2L9HA 1IW7C 5LMUL 4DAYB 1FL0A 1R9TB 1O7LA 3PF4A 4GLVB 5CR3A 4ODGA 2EYHA 1E2WA 1EYCA 4LF7Q 3PIOA 2YV5A 4A3GB 5D3IB 2IX1A 1QZHA 1ENCA 3B6YA 1ASYA 3KJPA 4JBMA 3ND8A 2K04A 4HMJA 4C3IH 3F2DA 1TR5A 1CZGA 1CZWA 4O0AA 1GUTA 3QR8A 1MBYA 3NWTA 1C48A 2MO0A 1PTOC 4CDEC 4CKEA 4R8IA 2WFWA 1RJTA 3OOCA 2K52A 3H94A 1KRSA 1WTWA 4WORA 2ICIA 3GTLH 2XGTA 3FEWX 5J3BA 2DJFC 4DNTB 1JCKB 4ZUJA 4X64Q 1C8CA 4CKCA 3TRZA 1EY7A 1YJNA 1WFQA 1PTOF 1RIPA 3ITPA 1G291 1DD2A 3KUPA 1B3AA 2Z6BA 3K0XA 3RLFA 4MHEA 1TS2A 3I56A 2A19A 3E0EA 5G3LF 1YI2A 2FMMA 4Q0FA 3QWNA 1VF5C 1EOVA 1EYAA 4GN3B 2HCCA 2K03A 4LUZA 3OIQA 4DAMA 3EQLC 1STHA 3HOYH 4A3MH 1DM0B 1QZGA 3HOWG 3PSIA 4ZQ3A 3UDGA 1BNZA 3IAYA 1FJGL 4DF7A 1VQOA 1OTCA 1VQ7A 3OSOA 2E5LQ 4P72A 3P75A 1N32L 2E8GA 1BBWA 4MIUA 1PV4A 4Z9CB 4QIWE 4EX5A 5FLMG 3RR5A 5I9PA 3HOYB 4B3RQ 4A3MB 2UXCL 4HTHA 4BBSB 5JVG3 2MO1A 4OWXB 4DN4M 1VQ5A 1X55A 3KLRA 4A3EG 2O2LD 3L7ZC 1K8OA 3TSSA 3BDOA 3I72A 3T4AC 5IYBH 3CCEA 1FD7D 4ZAIA 2JA5G 3IRBA 3KF8B 3PMFA 5C3EB 2EYFA 4DAYA 4WJWA 2ASBA 4P75A 3FKIH 4NXNQ 1CKOA 1RD9D 1JORA 1VDZA 1KDBA 1NNXA 2RDHA 1HFGA 2HHHL 3S1NH 1SNPA 2K28A 5ELOA 4G7ZC 2E2HB 5IWAL 3GTKB 2JSOA 1LTGD 1ASZA 2JA7H 4JC0A 1JJGA 1Y1VH 3RUZA 3F1ZA 1N34L 4CDFC 3HOVH 1UWVA 5IP7H 2F03A 4XYQA 3S1NB 5IP9G 1TWGB 4RFBA 3T51B 4UHVA 3J81E 1IL2A 3PV0A 2J0TD 5EBCA 4L5RC 3I3CA 1Y1VB 1NY4A 3BZCA 1A3UA 1PRTB 3RZOH 1EY8A 5ELBA 3CF5A 1QUQB 1SE4A 2Q8RE 3OIPA 3A8JE 4LK1C 3T16A 1I4HA 4NDXA 3HOUB 2CFMA 3VDYA 2UUBL 1TU2B 4XYOA 4WFN3 1WTHA 2SNMA 4XTCS 3S1MB 4LFAL 1HUMA 1PXUA 3CRKC 2NVQB 4ZYSA 3RZOB 5LMNQ 3MZ5A 1TWHH 3CU7A 1SRUA 3H15A 2RCNA 3SK4A 1QNUA 4FYDA 4IUTA 4X3KA 5EKKA 3A8KE 4C3HG 4XQJA 1Z7TA 1O80A 4A3CH 2UU9Q 5DEHA 2DY8A 2F3IA 1TWHB 3MXNB 1Z47A 1XPOA 5EPLA 2YTXA 2F3VA 3RD4A 4DR4L 1CKNA 3MXPA 3OMGA 4DR1Q 1GXDC 1HR0W 2VQFL 3NQTA 3SR1A 4FNFA 5M5XB 5LMUQ 2ZJRA 2MFIA 3ULLA 4ME3A 3CXCA 3CCMA 4ZRZA 1OO9B 1STNA 1Z6HA 4ME5A 1YNNC 1RKNA 5GADC 3HKSA 4ILWA 3BZDB 2VXWA 4LFCL 3X3NA 2BE5D 4A75A 1J6QA 3LWEA 1JICA 3D31A 2PZTA 4G57A 3V96A 2C9OA 3A0JA 2QDLA 2WP8J 1K8MA 1EFWA 3TZDA 3KF8A 4FXDA 2E2IH 1HCZA 4AH6A 4DUYQ 3KDFA 4R9WA 3PUZA 2VNUD 4XQQA 1XMQL 1QILA 1I5FA 1UE7A 1GOZA 3NE5B 1QE6A 3SVMA 4JI4Q 2L12A 1NUCA 1X3GA 5M3FG 2E2IB 1IYJB 4DV5Q 1PH1A 4JI0L 1LTTD 4RGOS 3KJOA 3OMCA 5KNCA 2DUDA 3A7AB 1HFNA 2R92G 4HJAA 4BY1B 1EIHA 3J7ZC 2HCIA 1K83B 3GV6A 1VQ6A 3EBEA 4XXEA 4OONA 3W2DA 4DV6Q 4KKSA 3A5ZB 2LKVA 5E4WC 4NB3A 4TSSA 3NTKA 5IT9c 4DR7Q 1LT4D 1LTBD 2ID0A 1Y1WG 4PNYA 3PO3G 1LTSD 1Q7YC 4OWTB 2A8VA 3M7NA 1VCIA 3I7FA 1IBML 4ID6A 3TDQA 4DV2L 5CV9A 2JA8G 1HA5A 5C5MA 5T1GA 4HJ7A 2JK8A 1LYLA 2B39A 2NVXB 3KLSX 4PG3A 2R93H 4IJLA 2VW9A 3CCQA 2PCFB 4APVA 1X6OA 1VQ8A 4PZ8A 2P5ZX 2NN6H 1TVXA 5DNFA 1EIGA 1X9NA 1LTID 3KLWA 1N32Q 1G8ZD 2ICEC 4BY7G 4DK1A 3FRPB 3NTHA 4A93H 4BXXG 2J4XA 1R4QB 4OO1G 4BBRH 1K28A 1TY2A 3MXNA 5I2XA 1U4RA 4IQZA 1S3OA 1KAWA 4E6IA 3DWQA 4X65Q 5BN4A 4FXKC 4A93B 1I4GA 1AZPA 5EKLA 4L5TA 4JI6L 5NUCA 2WKDA 3G48A 1NTGA 4BBRB 4A3KB 2AWNA 4U673 4IURA 3NENA 3VYUA 5M3MG 1W6JA 2L11A 4P73A 4DKAC 3S1QH 4QQBX 2FXQA 2HHHQ 2M2LA 5C4XH 3BG3A 3U9OA 5GAHC 4G4KA 4L8JA 3GTMH 2ZT9C 1I4PA 2L0CA 2VZAA 3H0GG 3OYYA 2D2CC 4NP5A 5AFWA 3W5OA 3RZDH 2HDMA 5C6AA 5M5WH 1LTLA 5EAYA 3H3VH 3CQZH 3S1QB 2RHQB 2R7DA 5JJZA 1HR0Q 5ELDA 3C1EA 3CP0A 4DK0A 3NP8A 1X3QA 2OCEA 2ATWA 3J7AV 3GTPB 3PIP3 1S40A 2KENA 3A56A 2Z1CA 3OPOA 2SEBD 4OEMB 1KXLA 5M5WB 1MJEA 3CQZB 2YU9H 3SE0A 2KHJA 2A68C 2F0DA 3UDXA 1L0XB 2K5VA 5J22A 4K2KA 5CGKA 1LLRD 1TWFH 2TSSA 4RA8A 3UE1A 5IYDH 4JI3Q 3JAMc 2NN6I 1ONLA 1EY9A 1K73C 1SFOH 4R8NA 4H02A 4XQNA 2FJ2A 4FF2A 2YU9B 3K8AA 1G6PA 4O2DA 1FR3A 3PUXA 2OF1A 1SROA 1FGUA 2F0FA 1EY0A 4LUVA 2NZOA 3BYYB 2QGQA 5IGCA 1K0RA 3PO2H 1KAAA 3A55A 2Q8TA 3J80L 2B2YA 2B2VA 1YNJD 2R6GA 2QEXA 4XIGS 1SFOB 1N33L 4U68A 2F0PA 2VB2X 1WTOA 2PO4A 4F7XA 3CCLA 1F9QA 4DNRB 1M8AA 1BQQT 4HEDA 3MEHA 1IZ6A 3PO2B 3M4OH 5E7NA 4YY3L 5A2QE 2MP1A 5DAUA 5D3DA 2K5HA 4AYBG 5AJ3L 4QGUA 5KNDA 1HHVA 2KECA 2F0EA 3J81L 4N8X1 1UEAB 2WAQG 1I50H 3CCSA 1ENAA 4GOPA 2UXBL 4RGMA 4GS3A 1GUNA 2BH8A 4OELB 4ABNA 3M4OB 4DXGA 2WB1E 3MAQA 2N8NA 4HCEA 2ENBA 3S1RH 4IZ8A 1FNVA 1F2LA 1A62A 2N55A 3EROA 2MJ8A 2HT1A 1WTPA 5C3WA 3U58A 3AYHB 1ZXTA 4KV6A 2B29A 5I4DA 3S9WA 1PH9A 1TS4A 1U9RA 3K58A 1PH2A 1LTAD 3M7GA 4FO2A 4DK6C 1SMXA 5GAEC 3URYA 4V190 2PI2E 2NVTH 2EJMA 5FOBB 4JI0Q 1ICWA 2BH2A 5HGQA 4R4IA 3NBIA 3ONAB 3UDFA 2A5HA 2K32A 3C2PA 1KQSA 4ZKBB 1I6VC 4A3LH 1NR2A 1WTXA 3DM3A 1X3FA 4QUFA 1A2UA 1G91A 3HZXA 1QWYA 2B2UA 1V8QA 4KD3A 1HZAA 3I8ZA 4ZCKA 5EPJA 1Y69U 1D5XC 2NVTB 1A6XA 3VYRA 4JI8L 3S2HH 1CHPD 3NEMA 2KBNA 2XRQD 3AQQA 4DR3L 2UXDL 3D6WA 1K0SA 3ULPA 4DU9A 2CW0C 4I7AA 3JC66 1T5EA 2G5DA 2GA4B 4NW2A 4LF8L 2K01A 1KDCA 1K8GA 2JN4A 1I3QB 1STAA 1M4VA 1A8VA 3S2HB 5GROA 4K0KL 5FLMH 3BDCA 1LACA 2B2YC 2V1CC 1HA6A 5FK9C 2B2VC 1Q3LA 2VL6A 4K8JA 3HG9A 2SOBA 5DM73 4HIDA 3SXHA 2ZTCA 1N9WA 4N9TA 1N36L 4M8AA 5JJIA 4A3EH 1EQQA 4KHPL 3FVQA 3HKZG 1KRTA 2X6GA 1J5EL 1QCBD 3GTOH 3HGBA 2HDLA 1AN8A 2R7ZG 2JA5H 2WKCA 1J9OA 1NMGA 4IPCA 3NHHA 1ICFB 4TKOB 4A3EB 5C0XH 4CDDC 3L3OC 1WTVA 4GOPC 1HQRD 2CH4A 3GTOB 4N9PA 3K80C 5EJWA 2SNSA 2YTVA 2EOTA 3MC0B 4F88A 3PQIA 1YHQA 2ZM6Q 5IE8A 2VUMB 4P71A 2B2WC 3TREA 1VQNA 3FHWA 2Y0SB 1PFBA 5CYUA 1SEBD 2KCMA 3TBIB 3PF5A 3A7LA 5IP9H 5C44H 3EJIA 4HIMA 1Q12A 5IY0A 3S16H 1D5ZC 2ZTEA 4A3DH 2I5HA 4A3BG 4NKLA 2LMCB 2IL8A 4WRDA 4XT3B 5LMNW 1JJ2A 1TIID 1GVPA 1VQIA 3T53B 4X62Q 1EY5A 3GD7A 5L37A 1NMFA 4JV5L 4KN7C 1PZID 1VQEA 3M4PA 4A76A 3BZKA 5C44B 2UUAL 3HOZG 3CPFA 1AZQA 4RCNA 3U9SA 2EJFC 1VQMA 3GP7A 3S16B 4A3DB 4C3IB 2B2UC 3NWSA 4TQUS 4C1NI 3RLNA 3I4MG 4ZK9B 2AWOA 5J39A 3STBD 3L0OA 3H3VC 2HQEA 4P2CB 4MTNA 2BDNA 2F0LA 3D3RA 5CMDA 1KIXA 3GTLB 1W2BA 1XTDA 4LF9Q 1WCMG 2LXJA 2F0IA 3EVQA 4C3HH 4DR5L 1QVGA 1Z9FA 1PZKD 1JT8A 1VMCA 1O7YA 2IX3A 1T9HA 2E2JH 1TY0A 4QB4A 4FF4A 3TEHB 1C4QA 4B3MQ 1U4PA 1H9JA 2AUKA 2F0TA 5I6YA 1DZ1A 1WD0A 3MA2B 3R8BA 3QO2A 4BA2I 5C0XI 3I73A 2R3ZA 1N33Q 3KBGA 2IHFA 1PH6A 3K6OA 1IBLL 2E2JB 1HTLD 1UEBA 4AIMA 4C3JH 1XPUA 1BVSA 4JW0A 2CKZB 3W1GA 1CKNB 3OWFA 4JVZA 1B50A 3CPWA 1UE1A 1P8LA 1STEA 5AJ3Q 4JI1L 3M85A 3OWEB 1HH2P 3O13A 1X3EA 3BU2A 5E3FA 4B3SL 2NYZD 4C3JB 2UXBQ 2NBFA 3GDEA 1PYWD 1NE3A 1F77A 3GTGH 2EYLA 4LMQD 5ELFA 4YWKA 5CBEE 2KEEA 4A3FG 2VB3X 3NBHA 1VQGA 3AFPA 1K3BC 1S5CD 2Y0SE 1SLJA 2RSNA 4JI5L 1E7ZA 1CA5A 1JWSD 3KDFB 3FDTA 5M3FH 3JAMi 4Q5VA 2BDOA 1U0LA 4NXML 3CKIB 4MN3A 3T1HL 1JC7A 2XTIA 3IL8A 1VF7A 5LL6S 3J80E 3GTGB 3E3XA 2ALYB 2R92H 4UDUC 4GLAC 1IBKQ 4GKJL 4X66Q 1GUOA 2VS1A 1D1IA 2XN9C 2OTLA 2HIVA 1ML0D 3FKIB 4IUVA 4DV1L 5M3FB 1BBUA 1YJWA 1I6HH 5JPNC 5IGDA 2A69D 3NELA 4RWSC 1DOLA 3HOXG 4LF4L 3PO3H 1H9MA 4B3TL 3HFZB 5ISRA 5BN3A 2ZJQA 2I5MX 3I4OA 4WJ3M 4JI8Q 3V2TA 2JA7B 1ZYRD 5A2QL 2JA8H 2BCOA 3GTQH 4QF4A 2UXDQ 1TKWB 4DV0L 2Z0SA 2A6ED 4AQYQ 3HOVB 1E1TA 2L15A 4NMZA 1JWMD 4EQ5A 3ZYYX 3PO3B 2WACA 2J7ZA 4DNIA 3VR3A 1YNXA 4OX9Q 1E2ZA 1DXMA 4DA2A 3NUCA 1KL9A 2XRSD 4BY7H 4K0KQ 2EPBA 2JA8B 2MHVA 1SXTA 3GTQB 1I4QA 4QUCA 4JBJA 4OO1H 2K7VA 1CHQD 4LAAA 3GO5A 2RVLA 3RN2A 2G9HD 1OXTA 1OXSC 1N36Q 2IY5B 3C46A 4F8MA 1NSNS 2KEDA 4DR2L 2F3WA 2E75C 5HGTA 1B8AA 2F0NA 3D4WA 2EJGC 4BY7B 3BVGA 3MXUA 5I6WA 4J15A 4DFAA 2X6LA 4X3SA 2Q2TA 5EBDA 3QIAA 2UUCL 3SDZA 1YVCA 1DONA 1Q1BA 4PZ7A 3CCVA 1L0YB 5BR8L 2ES2A 3SEBA 4JI2Q 1XMOQ 5JEAJ 4K5XA 3EN2A 4K6DA 3G6EA 3DLLA 1SN8A 3U4VA 2O4XA 3M4YA 4KKTA 3I4NG 1EIFA 3NXWA 4GZYC 3H0GH 3CMAA 1ZKOA 3H91A 2D0PA 4L5QA 4FVMA 4LF6L 2NVYH 3CRLC 3RNUA 1UUPA 3ND9A 1MGSA 1BF4A 1DGSA 3HOYG 1K3RA 4A3MG 2NB0A 2F4IA 4BBSG 3M9BA 1D2BA 3T13A 1EL0A 1E0BA 3P7JA 2LXKA 5JPMC 1X3PA 3DUZA 1YITA 1C7YA 4EGVA 2L55A 5FO7B 2NVYB 1N8RC 4JV5Q 1SDFA 1IKLA 4DGZA 3A54A 5JJLA 5C3EG 1WI5A 4QCLA 1M1KC 4RGTA 2IHEA 1MSGA 1WD1A 4A3IH 2MUYA 2Q2HA 2RA4A 1OXXK 4FP5D 1RCVD 2EYOA 3PIPA 3CCRA 2RSOA 3T1YL 4KY6A 2AQ3B 1O7IA 5FJ8G 5GAGC 1F9SA 2B2TA 5DM63 1JMCA 2Q2UA 1SYCA 4OO1I 1JB3A 3ERSX 4DV7L 1EEFD 2JXMB 1GJXA 1V1QA 1BXTA 1S4ZA 1ZYRC 4A3IB 1RHPA 1S72A 1CT1D 4UP8A 2RF4A 4RKBA 2OWOA 2A6EC 5JAVA 3BS1A 3Q24A 3S24A 3K5LA 4HAEA 4H44C 1JOKA 4JYAL 2FHTA 1YHAA 4DV3L 1PRTD 3K5OA 4DPGA 3OW2A 3NK9A 1YJ9A 1TT2A 1Y1VG 2MGSA 4BS9A 3PUVA 2F0UA 5J1ZA 2H4OA 3U4ZA 2RBMA 5KYIA 1FJGQ 3HOUG 1AFPA 1R4PB 1FVIA 1LV9A 4HJ5A 1JWUD 3CAMA 4IOCA 4IPGA 4JI1Q 2UXCQ 2X69A 4HN7A 2R93B 4AYBB 2K33A 2GVAA
chains in the Genus database with same CATH topology
2OT2A 2SDFA 4RAUC 3I4LA 3NPPA 2WAQB 3D4RA 3D6CA 1B1ZA 4EQNA 5C4HA 2LFNA 4RHRA 3MWYW 2PZWA 3KBXA 3K5MA 1PFMA 3GQBA 4HCSA 5CV4A 4K5VA 2KJXA 2PNRC 1PDQA 3A8IE 5ELEA 1AW7A 3VR5A 1Y8OB 1GUGA 2BE5C 1IKMA 3TMEA 3H09A 1B53A 5KYLA 1GUSA 2DNEA 1EFID 5KNBA 1BCPD 1T5XD 4BA1I 2Z4IA 4A3JB 1KABA 4FF3A 2EY5A 1B4OA 2CHBD 2A6HD 5IOCA 2EXZA 3PUWA 5C4XB 2F0SA 2XIWA 1ESFA 3X3MA 3GTMB 1EWHA 2B2TC 2XVSA 3RZDB 1W6KA 3K7AB 1F9PA 5D65A 4EQOA 2QKIC 1HQMC 2NUCA 5FO8B 2KCCA 5JEAG 4KI0A 3VYTA 3K57A 2K05A 1E2VA 1IYUA 3N6RA 3G7LA 5D14A 1DYQA 3E6ZX 1QG7A 1SAPA 1EEID 1I4RA 2I46A 1B44D 3SHLA 1STYA 1QOHA 3HS0C 2DNCA 2AQ2B 3I90A 3TP8A 1Y8NB 3Q0AA 1TWFB 2QDBA 4IFDH 4M1UB 1U4LA 2BOSA 4KN4C 3LNNA 3FPUB 2R7ZB 1EQVA 4I7ZC 3E5SA 2EY1A 2K1BA 3G6JB 1S5FD 2PQEA 4OL7A 1G6ZA 5IGEA 5FLXL 2ZXPA 1SMYD 1H9KA 1EZ8A 1WTQA 4JBWA 4RCOA 1EU3A 2B2WA 1IW7D 3C3LA 1I50B 2NN6G 5COYA 2QF7A 1PMRA 3N52A 2D9UA 1V43A 3S1RB 1RTOA 2EDGA 3TP7A 4X3TA 4G7OC 1Q90A 4O1NA 3R93A 3QOLA 1F9RA 1LT5D 2F0QA 2B8FA 5LHY1 2H1EA 1B2TA 5K36G 2PYKA 1SYBA 1S5BD 3L9AX 1WTRA 5BN5A 1PTOD 1NR4A 4KKUA 2MPMA 4RGNA 1S5ED 1ILQA 2F0HA 4HR7B 3J7AF 4KMUC 4IFDI 5M5YB 3WOFA 2F0VA 3FMCA 4KK7A 4H0LC 3S15B 5I9OA 2F0MA 4LJZC 5G3LD 4B9WA 1AEXA 3Q22A 1ET9A 2OXPA 1SYGA 5I2YA 5CV5A 4KTAA 2RDGA 3S2DB 3HOWB 2KOLA 2AQ1B 3SK6A 1SYEA 3DEPA 5C3XA 1YNJC 1CM9A 3UI2A 3I70A 5TSSA 4JK1C 1BDOA 1ESRA 1SBBB 4IUPA 1CI3M 3TZUA 4HSPA 3TP6A 4CKBA 4A3FB 1BOSA 1XYIA 2RDFA 2JA5B 3DEOA 3D4DA 1D1KA 1RF2D 3S14B 5KEEA 4QIWB 4IUQA 1KLGD 4XDXA 3F2UA 3QB3A 3WOEA 4J1MA 4K5WA 3V05A 1RODA 5CC4A 5IGGA 2G9DA 3SK8A 3Q6SA 3TP5A 4IN3A 5IGBA 4OIJA 4PMCA 3HOXB 2N88A 1EZ6A 1BO0A 1MI2A 5LL6X 1HRJA 3MTSA 2KHSA 5KGUA 2IJ0A 1BUVT 2IT1A 3HEJA 1HXYD 5ELCA 1TS3A 2LY7A 4OIKA 5T1IA 3DM1A 4K8IA 1JOOA 5CV8A 2JE6I 4F87A 1CA6A 1KNEA 3AB9A 4HSVA 5F2DA 4C3HB 3MVVA 3Q23A 2PW5A 3BVMA 2PPBC 3FPPA 4CHTB 1V1PA 2ZXRA 3HRZC 4KJNA 4CJ0B 3I4NB 2HUGA 3SK5A 2XWBB 4CJ1B 1XTCD 3WDNA 2Z4HA 4DAVA 1DOKA 3MHBA 1EU4A 1LT6D 3MXGA 1H9SA 4CJ2C 5IT9E 1YNND 2IW3A 1EYDA 1DJRD 4DXFA 5IODA 4KJOA 2F0JA 1CK1A 2C5CA 2EZVA 3PIO3 1NCVA 1KLUD 1F2YA 2WIIB 2PMZB 5C0XG 1HUNA 2R92B 4YIJA 4C56C 5IGFA 2Q8IB 1PLFA 3MFYA 1U4MA 1KNAA 1NAPA 5FLXE 4Y7NB 2CQAA 1I6HB 1KTKA 1PZJD 1WVLA 2A74C 3E0JA 1Y1WB 2F0GA 3EFXD 1ENFA 4C3IG 1AP0A 4FXGC 2EVBA 1ZEQX 2L5TA 2QILA 2IWHA 4J6HA 4RHSA 3VR6A 1J8IA 1B9MA 1EY4A 3R2IA 1KDAA 2EE1A 1SJED 1OXVA 2E2DC 5CV6A 3T56B 4ZUIA 2WV6D 3BYTB 1IYVA 1JR0D 1UAPA 2K5QA 3DWAA 3RMHA 1SNOA 1SJHD 5HURA 4ULLA 4CGYB 2K6AA 2L4NA 5FO9B 2FINB 3J7YW 2DN8A 5EGTA 3LWUA 3C1FA 2B8GA 5M3MB 2XSCA 1SNMA 4KD4A 4S3SA 1TS5A 2F0OA 1IL8A 1SE2A 2KCNA 1CQVA 1XWEA 3H0GB 4C3JG 2EYMA 1FNWA 3JAME 1SNDA 4OHJA 3GV3A 1GHJA 1BCPB 1DOMA 4EQPA 1BR9A 5JEAH 2NTTA 2PZUA 1JQYD 1Q1EA 3HP3A 4ZKCB 5CBAE 2D62A 1EQTA 3H6MA 2A69C 1I4XA 5C4JB 2OEOA 3W3AA 2EYPA 2E76C 1XX8A 1JOQA 1ILPA 2CVRA 2JA6B 1O7ZA 3VYSA 1A3TA 1Y8PB 5A35A 2EY2A 2A68D 1GUWA 2EY6A 3KLSA 2F0KA 1G2SA 1H9RA 3DWPA 2KVMA 5C4ZA 2IPKD 3IFDA 3NTIA 4DAPA 2NTSA 1VMPA 3OHXC 2AUJD 3PUYA 4KY5A 4QMGA 1STGA 2V4DA 3QOJA 5K5PA 4TRDA 4BWGB 4K14A 4PQXA 2E74C 1XXGA 1SNCA 4IUNA 3P1HA 1BBXC 2XWJB 1MD2D 5IIFA 3OW7A 1MSHA 3DHQA 1GHKA 2RQXA 1SYFA 1S5DD 5KIXA 1G2TA 2TMPA 4K6LA 2D5DA 1EOTA 1V1OA 1O78A 2QEJC 1LT3D 2M9VA 3QJYA 5KRUA 1HTPA 5C5LA 3IFTA 5K36H 4J8QA 4K2LA 2EYJA 3BVZA 1SE3A 4L63B 1RDPD 2WB1B 3GTJB 3P20A 4RH6A 2JEAI 1PTOH 2JP1A 2BA1A 1JE4A 2F0WA 2IX0A 4HMIA 4C2MB 4L6TB 4PMBA 2KA7A 2FMCA 1PTOB 2R61A 4I65A 4IFDJ 5JOBA 4O42A 1PFNA 1LTRD 1A15A 2L1BA 4PV1C 2ZXOA 3K59A 1LO5D 3NSWA 3VR4A 2O5IC 1PRTC 2CW0D 3EA6A 3K0YA 5IT9L 1SYDA 3HKZB 2WINB 1UNSA 2RKSA 1SNQA 1HPCA 1PRTF 1FGBD 4ZLTF 1QB5D 1TWCB 3DXJC 3LX0A 4IUUA 4OGQC 5EQ0A 3VA7A 1IHZA 3AMUA 1STBA 3NQIA 1D6EC 2KQ3A 4H13C 1A2TA 2NWGA 2F1MA 4KHVA 1OXUA 4RKLA 3QG1A 2PW7A 1QJOA 1SSOA 1Q8IA 3DMUA 1X32A 2K5DA 2Z8LA 4A3BB 2K5WA 1F2MA 2JEBI 2B63B 1CFMA 3S17B 1DCZA 4H7BA 2DY7A 3I91A 1FNUA 4B08A 1BCPC 4CBVA 2JYOA 1ET6A 3HOZB 1CTMA 1TWAB 2XNAC 2A6HC 4EVOA 1EY6A 3I4MB 1CQFA 4KHZA 1LABA 1BCPF 5CORA 3R3OA 5FKAC 3TN2A 2M00A 4FF1A 3M3YB 4IALA 1WCMB 2BA0A 4XT1B 2A73B 1TQOA 4X3UA 2I07B 2YYZA 1A3VA 5EPKA 3IKJA 4B9XA 3R2TA 2O5JC 5EKIA 1II3A 1QNKA 3BDLA 4G7HC 2KUMA 5E1FA 5C0XJ 2QCPX 3AU7A 5JVH3 3ERQA 4KY7A 3JAML 1V1PB 3CHBD 2LS01 3VR2A 2NZ1D 4UAIA 2FFKB 1EWCA 5M9OA 3VA5A 3D8GA 4PMWA 4C1NK 3K5NA 5E4XA 3MFGA 1D5MC 1H9SB 1SMYC 5CV7A 1B9NA 4IFDG 1FYCA 3KK7A 4V0BA 1RTNA 1F2ZA 2L9HA 1IW7C 1R9TB 1O7LA 5CR3A 4ODGA 2EYHA 1E2WA 1EYCA 4A3GB 5D3IB 2IX1A 1ENCA 3ND8A 2K04A 4HMJA 1TR5A 1CZGA 1CZWA 1GUTA 1MBYA 3NWTA 1C48A 1PTOC 4CKEA 4R8IA 1RJTA 3OOCA 3H94A 1WTWA 4WORA 2ICIA 3FEWX 4DNTB 1JCKB 4ZUJA 1C8CA 4CKCA 1EY7A 1PTOF 3ITPA 1G291 1DD2A 3KUPA 1B3AA 3RLFA 4MHEA 1TS2A 5G3LF 2FMMA 4Q0FA 3QWNA 1VF5C 1EYAA 2HCCA 2K03A 3OIQA 3EQLC 1STHA 1DM0B 4ZQ3A 1BNZA 3IAYA 4DF7A 3OSOA 3P75A 4MIUA 4Z9CB 3HOYB 5I9PA 4A3MB 4HTHA 4BBSB 5JVG3 4DN4M 3KLRA 2O2LD 3L7ZC 1K8OA 3TSSA 3BDOA 3I72A 3T4AC 1FD7D 4ZAIA 3PMFA 5C3EB 2EYFA 4DAYA 4WJWA 1RD9D 1JORA 1VDZA 1KDBA 2RDHA 1HFGA 1SNPA 2K28A 4G7ZC 2E2HB 3GTKB 2JSOA 1LTGD 3RUZA 2F03A 4XYQA 3S1NB 1TWGB 4RFBA 3T51B 3J81E 3PV0A 2J0TD 5EBCA 3I3CA 1Y1VB 1A3UA 1PRTB 1EY8A 5ELBA 1SE4A 2Q8RE 3OIPA 3T16A 3A8JE 4LK1C 1I4HA 4NDXA 3HOUB 1TU2B 4XYOA 4WFN3 2SNMA 4XTCS 3S1MB 1HUMA 1PXUA 3CRKC 2NVQB 4ZYSA 3RZOB 3MZ5A 3CU7A 4FYDA 3SK4A 1QNUA 4IUTA 4X3KA 5EKKA 3A8KE 4C3HG 4XQJA 1Z7TA 1O80A 5DEHA 2DY8A 1TWHB 1Z47A 5EPLA 3RD4A 2F3VA 3MXPA 3OMGA 1GXDC 3NQTA 3SR1A 4FNFA 5M5XB 4ZRZA 1OO9B 1STNA 1Z6HA 4ME5A 1YNNC 1RKNA 4ILWA 3BZDB 2VXWA 3X3NA 2BE5D 3LWEA 1JICA 3D31A 2PZTA 4G57A 3V96A 2C9OA 2WP8J 1K8MA 3TZDA 3KF8A 4FXDA 1HCZA 4R9WA 3PUZA 2VNUD 4XQQA 1QILA 1GOZA 3NE5B 1QE6A 3SVMA 2L12A 1NUCA 2E2IB 1LTTD 4RGOS 3OMCA 5KNCA 3A7AB 1HFNA 4BY1B 1EIHA 2HCIA 1K83B 3GV6A 4XXEA 3W2DA 4KKSA 2LKVA 5E4WC 4TSSA 3NTKA 1LT4D 1LTBD 2ID0A 4PNYA 1LTSD 3M7NA 1VCIA 4ID6A 3TDQA 5CV9A 1HA5A 5C5MA 5T1GA 2B39A 2NVXB 3KLSX 2PCFB 2NN6H 1TVXA 5DNFA 1EIGA 1LTID 1G8ZD 2ICEC 4DK1A 3FRPB 3NTHA 2J4XA 1R4QB 4OO1G 1TY2A 3MXNA 5I2XA 1U4RA 4IQZA 4E6IA 3DWQA 5BN4A 4FXKC 4A93B 1I4GA 1AZPA 5EKLA 5NUCA 2WKDA 4BBRB 4A3KB 2AWNA 4U673 4IURA 3VYUA 1W6JA 2L11A 2M2LA 3BG3A 3U9OA 4G4KA 4L8JA 2ZT9C 1I4PA 2L0CA 2D2CC 4NP5A 5AFWA 2HDMA 5C6AA 3S1QB 5JJZA 5ELDA 3C1EA 4DK0A 3NP8A 1X3QA 3J7AV 3GTPB 3PIP3 3A56A 2Z1CA 3OPOA 2SEBD 5M5WB 3CQZB 3SE0A 2A68C 2F0DA 5J22A 1L0XB 4K2KA 5CGKA 1LLRD 2TSSA 4RA8A 2NN6I 1ONLA 1EY9A 4R8NA 4XQNA 4FF2A 2FJ2A 2YU9B 1FR3A 3PUXA 2OF1A 2F0FA 5IGCA 1EY0A 3BYYB 1KAAA 3A55A 2Q8TA 3J80L 2B2YA 2B2VA 1YNJD 2R6GA 4XIGS 1SFOB 4U68A 2F0PA 2VB2X 1WTOA 2PO4A 4F7XA 1F9QA 4DNRB 1M8AA 1BQQT 4HEDA 3MEHA 3PO2B 5A2QE 2MP1A 5DAUA 5D3DA 5KNDA 1HHVA 2KECA 2F0EA 3J81L 1UEAB 1ENAA 4RGMA 1GUNA 4ABNA 3M4OB 4DXGA 3MAQA 4HCEA 2ENBA 4IZ8A 1FNVA 1F2LA 2N55A 3EROA 2MJ8A 1WTPA 5C3WA 1ZXTA 4KV6A 5I4DA 3S9WA 1TS4A 1U9RA 3K58A 1LTAD 3M7GA 4FO2A 3URYA 4V190 2EJMA 5FOBB 1ICWA 3NBIA 3ONAB 2A5HA 2K32A 3C2PA 4ZKBB 1I6VC 1NR2A 1WTXA 4QUFA 1A2UA 1G91A 3HZXA 1QWYA 2B2UA 1V8QA 4KD3A 3I8ZA 5EPJA 1Y69U 1D5XC 2NVTB 1A6XA 3VYRA 1CHPD 2XRQD 3D6WA 4DU9A 2CW0C 1T5EA 2GA4B 4NW2A 2K01A 1KDCA 1I3QB 1STAA 1M4VA 3S2HB 3BDCA 1LACA 2B2YC 1HA6A 5FK9C 2B2VC 1Q3LA 4K8JA 3HG9A 2SOBA 5DM73 3SXHA 4N9TA 4M8AA 3FVQA 2X6GA 1QCBD 3HGBA 2HDLA 1AN8A 2WKCA 1J9OA 3NHHA 4TKOB 4A3EB 5C0XH 3L3OC 1WTVA 1HQRD 3GTOB 4N9PA 5EJWA 2SNSA 2EOTA 3MC0B 4F88A 2VUMB 2B2WC 2Y0SB 1PFBA 5CYUA 1SEBD 3TBIB 3A7LA 3EJIA 1Q12A 1D5ZC 4NKLA 2LMCB 2IL8A 4WRDA 4XT3B 1TIID 3T53B 1EY5A 3GD7A 4KN7C 1PZID 5C44B 1AZQA 4RCNA 3U9SA 2EJFC 3S16B 3GP7A 4A3DB 4C3IB 2B2UC 3NWSA 4TQUS 4C1NI 4ZK9B 2AWOA 5J39A 3H3VC 2HQEA 4P2CB 2BDNA 2F0LA 3D3RA 5CMDA 3GTLB 2F0IA 3EVQA 1PZKD 1VMCA 1O7YA 2IX3A 1TY0A 4QB4A 4FF4A 1C4QA 1U4PA 1H9JA 2AUKA 2F0TA 5I6YA 1DZ1A 1WD0A 3MA2B 3R8BA 3QO2A 4BA2I 5C0XI 3I73A 2R3ZA 3KBGA 3K6OA 2E2JB 1HTLD 3OWFA 1B50A 1STEA 3M85A 3OWEB 3O13A 5E3FA 2NYZD 4C3JB 2NBFA 1PYWD 1F77A 2EYLA 4LMQD 5ELFA 5CBEE 2KEEA 2VB3X 3NBHA 1S5CD 2RSNA 1CA5A 1JWSD 3FDTA 4Q5VA 2BDOA 3CKIB 4MN3A 1JC7A 3IL8A 1VF7A 5LL6S 3J80E 3GTGB 4UDUC 1GUOA 1D1IA 2XN9C 3FKIB 1ML0D 4IUVA 5M3FB 5JPNC 5IGDA 2A69D 4RWSC 1DOLA 1H9MA 5ISRA 5BN3A 3V2TA 2JA7B 1ZYRD 5A2QL 2BCOA 4QF4A 1TKWB 2A6ED 3HOVB 4NMZA 1JWMD 3ZYYX 3PO3B 2WACA 2J7ZA 3VR3A 1E2ZA 1DXMA 4DA2A 3NUCA 2XRSD 2EPBA 2JA8B 2MHVA 1SXTA 3GTQB 1I4QA 4QUCA 4OO1H 2K7VA 1CHQD 4LAAA 3GO5A 2RVLA 2G9HD 1OXTA 1OXSC 3C46A 4F8MA 1NSNS 2KEDA 2F3WA 2E75C 5HGTA 2F0NA 3D4WA 2EJGC 4BY7B 3BVGA 3MXUA 5I6WA 4DFAA 2X6LA 4X3SA 5EBDA 3QIAA 3SDZA 1DONA 1Q1BA 1L0YB 3SEBA 5JEAJ 4K5XA 4K6DA 2O4XA 3M4YA 4KKTA 3NXWA 4GZYC 1ZKOA 3H91A 4FVMA 3CRLC 1UUPA 3ND9A 1MGSA 1BF4A 2NB0A 2F4IA 1D2BA 3T13A 1EL0A 1E0BA 3P7JA 5JPMC 1X3PA 3DUZA 4EGVA 2L55A 5FO7B 2NVYB 1SDFA 1IKLA 4DGZA 3A54A 4QCLA 4RGTA 1MSGA 1WD1A 2MUYA 2RA4A 1OXXK 4FP5D 1RCVD 2EYOA 2RSOA 4KY6A 2AQ3B 1F9SA 2B2TA 5DM63 4OO1I 1SYCA 1JB3A 1EEFD 2JXMB 1GJXA 1S4ZA 1BXTA 1ZYRC 4A3IB 1RHPA 1CT1D 4RKBA 2A6EC 5JAVA 3BS1A 3Q24A 3K5LA 4HAEA 4H44C 1JOKA 2FHTA 1PRTD 3K5OA 3NK9A 1TT2A 2MGSA 4BS9A 3PUVA 2F0UA 5J1ZA 2H4OA 2RBMA 5KYIA 1AFPA 1R4PB 1LV9A 1JWUD 2X69A 4HN7A 2R93B 4AYBB 2K33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N55 A;  4LMQ D;  1A15 A;  2M2L A;  1J8I A;  2SDF A;  4R8I A;  2K1B A;  1RJT A;  2B2W C;  2EE1 A;  2MJ8 A;  1WTP A;  2L1B A;  4RAU C;  2KEE A;  4X3U A;  5CBE E;  1WTW A;  1CM9 A;  3UI2 A;  1G2S A;  1PFB A;  1ZXT A;  5EPK A;  2KVM A;  5AFW A;  2RSN A;  1CA5 A;  3MWY W;  1QE6 A;  3IFD A;  2HDM A;  3SVM A;  1C8C A;  2L12 A;  1G6Z A;  3FDT A;  3H91 A;  1GUW A;  1ESR A;  3KBX A;  5EKI A;  1VMP A;  4MN3 A;  1PFM A;  3IL8 A;  1QNK A;  1MGS A;  5JJZ A;  4IUP A;  1BF4 A;  4HCS A;  2KUM A;  3KUP A;  1B3A A;  2IL8 A;  2L4N A;  4XT3 B;  3I3C A;  1HFN A;  1PDQ A;  1WTQ A;  1X3Q A;  1EIH A;  1ICW A;  4CJ0 B;  1EL0 A;  1E0B A;  2HCI A;  2HUG A;  3GV6 A;  3ONA B;  3P7J A;  2FIN B;  4MHE A;  1XYI A;  4ZKB B;  3DEO A;  4CJ1 B;  1IKM A;  1NR2 A;  1B53 A;  1WTX A;  1X3P A;  4ZLT F;  2Q8R E;  1ML0 D;  4IUV A;  1DOK A;  1F2L A;  2B2W A;  1AZQ A;  4IUU A;  4QUF A;  5E4W C;  1BBX C;  1G91 A;  2B2U C;  2NZ1 D;  2FFK B;  4UAI A;  5EQ0 A;  2B2U A;  2FMM A;  4IUQ A;  4XDX A;  3I8Z A;  1SDF A;  5EPJ A;  1IKL A;  5COY A;  1MSH A;  3N52 A;  3F2U A;  4RWS C;  1HUM A;  1DOL A;  4ZK9 B;  2HCC A;  4RA8 A;  1B4O A;  2D9U A;  1MSG A;  2K03 A;  2NWG A;  1RTO A;  1ROD A;  1WD1 A;  4CJ2 C;  1IL8 A;  4X3T A;  2RA4 A;  3D6W A;  1G2T A;  2RSO A;  1EOT A;  2XIW A;  2BDN A;  2FJ2 A;  4IUT A;  5E4X A;  1F9S A;  5CMD A;  2B2T C;  3Q6S A;  1SSO A;  4X3K A;  5T1G A;  2B2T A;  3R93 A;  1BNZ A;  4NW2 A;  1F9R A;  2K01 A;  1X32 A;  4OIJ A;  2H1E A;  1F9P A;  5D65 A;  3GV3 A;  1B2T A;  1O80 A;  1VMC A;  1O7Y A;  2N88 A;  1DOM A;  2J7Z A;  1NCV A;  1S4Z A;  1TVX A;  1RHP A;  5DNF A;  2B2Y C;  1EIG A;  1HUN A;  1U4P A;  1BO0 A;  1MI2 A;  2B2Y A;  1Q3L A;  2B2V C;  2DY8 A;  2Q8T A;  1WTR A;  2B2V A;  1NR4 A;  1HRJ A;  1RTN A;  2K05 A;  2MPM A;  3MTS A;  5EPL A;  1DZ1 A;  1WD0 A;  2EPB A;  1ILQ A;  4HAE A;  2DY7 A;  3QO2 A;  4DN4 M;  2L9H A;  3HP3 A;  4QUC A;  4U68 A;  4ZKC B;  3I91 A;  1PLF A;  1WTO A;  1U4M A;  2FHT A;  1F9Q A;  3G7L A;  5D14 A;  1KNA A;  1NAP A;  1M8A A;  2R3Z A;  2RVL A;  5CBA E;  1EQT A;  2JP1 A;  2JYO A;  2X6G A;  1QG7 A;  4HED A;  1SAP A;  1JE4 A;  2KED A;  2HDL A;  1U4R A;  2MGS A;  1WVL A;  2MP1 A;  4OIK A;  4ZAI A;  1J9O A;  3I90 A;  1XX8 A;  5T1I A;  3DM1 A;  1HHV A;  2KEC A;  1B50 A;  2X6L A;  1ILP A;  1AZP A;  2CVR A;  2VXW A;  4X3S A;  1WTV A;  5COR A;  1U4L A;  1O7Z A;  2K04 A;  1AP0 A;  1LV9 A;  3LWE A;  1JIC A;  1CA6 A;  1KNE A;  3TN2 A;  1HFG A;  2KOL A;  4IUR A;  1DON A;  2NYZ D;  3FPU B;  5EJW A;  3TZD A;  2K28 A;  2L11 A;  4HSV A;  2EOT A;  4O42 A;  2X69 A;  4R9W A;  1HA6 A;  1PFN A;  3DEP A;  4XT1 B; 
#chains in the Genus database with same CATH topology
 2OT2 A;  2SDF A;  4GOP B;  3J81 c;  4RAU C;  3I4L A;  3NPP A;  3OTO L;  2WAQ B;  3D4R A;  3D6C A;  1B1Z A;  4EQN A;  5C4H A;  1K9M C;  2LFN A;  4RHR A;  4JBK A;  3MWY W;  3I55 A;  2H5X A;  2PZW A;  3KBX A;  1HNW L;  3K5M A;  2JQO A;  3AEV A;  1PFM A;  3GQB A;  1VQB A;  4A3J H;  4HCS A;  5CV4 A;  1MJC A;  2QW7 A;  4K5V A;  2KJX A;  2PNR C;  1PDQ A;  3A8I E;  5ELE A;  1AW7 A;  3T1H Q;  3VR5 A;  1Y8O B;  1GUG A;  2BE5 C;  1IKM A;  3TME A;  3H09 A;  1B53 A;  5KYL A;  4GKJ Q;  1GUS A;  2DNE A;  5IWA Q;  1EFI D;  5KNB A;  1CUK A;  1BCP D;  1T5X D;  4BA1 I;  5IYC G;  2AMC B;  4C2M H;  2Z4I A;  4A3J B;  3K7A H;  1KAB A;  3PCO B;  4FF3 A;  1N34 Q;  2EY5 A;  1B4O A;  2CHB D;  2A6H D;  2DJG C;  1L2F A;  5IOC A;  3CC7 A;  2EXZ A;  3K81 C;  1Q46 A;  1JE5 A;  3PUW A;  5C4X B;  4LF7 L;  2F0S A;  2XIW A;  2NZH A;  1ESF A;  3X3M A;  3M4Q A;  4B3T Q;  1EWH A;  2B2T C;  3GTM B;  2XVS A;  3RZD B;  1W6K A;  3K7A B;  4HIO A;  1F9P A;  5D65 A;  4EQO A;  2QKI C;  4DV0 Q;  1HQM C;  2NUC A;  2Z9H A;  5FO8 B;  1PVO A;  1HNX L;  2KCC A;  5JEA G;  4KI0 A;  3VYT A;  4UY8 C;  3K57 A;  2K05 A;  1E2V A;  4JPB W;  2UUB Q;  4X6A H;  2EIF A;  1IYU A;  3ER0 A;  2AKW B;  3N6R A;  2JA6 G;  3G7L A;  5D14 A;  4LFA Q;  1DYQ A;  3E6Z X;  1QG7 A;  1SAP A;  1EEI D;  1I4R A;  2I46 A;  4BY1 G;  1B44 D;  3SHL A;  4X64 L;  2R7Z H;  1STY A;  1QOH A;  3HS0 C;  2DNC A;  2AQ2 B;  3I90 A;  3K7U C;  2I0Q A;  3TP8 A;  1Y8N B;  3Q0A A;  4DR2 Q;  1TWF B;  2QDB A;  4IFD H;  4M1U B;  1U4L A;  2BOS A;  4KN4 C;  3CW2 C;  3A5U A;  4R4C A;  3LNN A;  3FPU B;  2R7Z B;  1EQV A;  4I7Z C;  2UUC Q;  3E5S A;  4DR4 Q;  4YCW A;  2CWP A;  2EY1 A;  2K1B A;  2K75 A;  2VQF Q;  3G6J B;  1S5F D;  2PQE A;  4OL7 A;  1G6Z A;  5HY6 A;  2B3G A;  5IGE A;  4LNQ A;  5FLX L;  1A63 A;  2ZXP A;  1SMY D;  3S17 H;  4LFC Q;  3PGZ A;  1H9K A;  1EZ8 A;  1WTQ A;  2E5L L;  4JBW A;  3H3V I;  4JI7 Q;  1X65 A;  4RCO A;  5JJK A;  1CKM A;  2GN5 A;  3HOZ H;  1EU3 A;  2B2W A;  1IW7 D;  3C3L A;  1I50 B;  4KLK A;  2NN6 G;  1L0W A;  4POF A;  5COY A;  2QF7 A;  3RLO A;  1PMR A;  3N52 A;  1XMQ Q;  3I4M H;  1XNQ L;  2D9U A;  1V43 A;  3S1R B;  1RTO A;  2EDG A;  4YWM A;  1P16 A;  3TP7 A;  4X3T A;  4G7O C;  1Q90 A;  4O1N A;  4A3K G;  2WB1 G;  4HJ9 A;  1VQJ A;  2QA4 A;  1D8L A;  3E9H A;  3QOL A;  3R93 A;  3M3Y H;  2N3S A;  1TXY A;  1F9R A;  5M5Y H;  1LT5 D;  2F0Q A;  3RN5 A;  3T1Y Q;  2B8F A;  5LHY 1;  2H1E A;  3UE0 A;  1B2T A;  5K36 G;  2Z6K A;  2PYK A;  1SYB A;  3S15 H;  4DV7 Q;  1S5B D;  3L9A X;  1WTR A;  5BN5 A;  1PTO D;  2YTY A;  1NR4 A;  3W1B A;  3ZJY C;  4HIK A;  4KKU A;  2MPM A;  4RGN A;  1S5E D;  1ILQ A;  2F0H A;  1PYB A;  4HR7 B;  2F4V L;  3J7A F;  4KMU C;  4IFD I;  5M5Y B;  3WOF A;  2F0V A;  3FMC A;  4R4T A;  3TS2 A;  3S2D H;  3HOW H;  4JYA Q;  3F2C A;  4KK7 A;  4H0L C;  4R1J A;  4DV3 Q;  3S15 B;  5I9O A;  1IBM Q;  2F0M A;  4LJZ C;  5G3L D;  4B9W A;  1AEX A;  4DV2 Q;  4DK3 C;  3Q22 A;  1ET9 A;  1E1O A;  2OXP A;  1XPR A;  1SYG A;  5I2Y A;  5CV5 A;  4KTA A;  4OWW B;  2RDG A;  1WYD A;  3S2D B;  3HOW B;  2KOL A;  1GM5 A;  1Y14 B;  2AQ1 B;  3SK6 A;  1E24 A;  1SYE A;  3DEP A;  1EUJ A;  5C3X A;  1YNJ C;  4A3F H;  4UPA A;  1CM9 A;  3UI2 A;  1E22 A;  1BKB A;  2EXD A;  3I70 A;  1MHW C;  5LMN L;  5TSS A;  4JK1 C;  3S14 H;  1BDO A;  1ESR A;  1SBB B;  4IUP A;  1I94 L;  3NBH B;  1CI3 M;  3TZU A;  4HSP A;  1M90 C;  4LFB L;  3TP6 A;  4CKB A;  1HNW Q;  4IPH A;  4A3F B;  1BOS A;  4JI6 Q;  1XYI A;  2RDF A;  2JA5 B;  3DEO A;  3D4D A;  1D1K A;  1RF2 D;  3S14 B;  1CSQ A;  5KEE A;  4GN5 A;  1KD1 C;  4QIW B;  4QY7 A;  1IXR A;  1UE5 A;  4IUQ A;  1KLG D;  4XDX A;  4QL5 A;  4IO9 A;  3F2U A;  2N49 A;  3QB3 A;  3HOX H;  3WOE A;  4J1M A;  4K5W A;  4R4Q A;  1ROD A;  3V05 A;  5CC4 A;  5IGG A;  2B63 G;  2G9D A;  1WJJ A;  2PQA B;  2RHS B;  3SK8 A;  4JOI A;  3J80 i;  3Q6S A;  2HD3 A;  2DGY A;  3TP5 A;  4IN3 A;  1B7Y B;  5IGB A;  4OIJ A;  4PMC A;  2Z6K C;  3HOX B;  2N88 A;  4GNX C;  2KHI A;  1EZ6 A;  1BO0 A;  1MI2 A;  5ELN A;  5LL6 X;  1HRJ A;  4DUY L;  3MTS A;  1YHB A;  2KHS A;  5KGU A;  1HNX Q;  2A1A A;  1GD7 A;  2IJ0 A;  4JCV E;  1BUV T;  3J81 i;  2IT1 A;  3HEJ A;  1HXY D;  5ELC A;  4DUZ L;  1TS3 A;  2LY7 A;  4JI4 L;  2K50 A;  4OIK A;  1YBY A;  4DV5 L;  4UP7 A;  3CC2 A;  1B3Q A;  1VQA A;  3DM1 A;  5T1I A;  1JB7 A;  4RMF A;  1EWI A;  3SGI A;  4K8I A;  1JOO A;  1LM0 A;  5CV8 A;  2JE6 I;  4F87 A;  4LF5 L;  3EIV A;  1CA6 A;  1KNE A;  2KCT A;  3AB9 A;  1VQH A;  3KYH C;  4DV6 L;  4HSV A;  5F2D A;  1PH5 A;  2GVB A;  4C3H B;  4A3L G;  4DR7 L;  3AFQ A;  3MVV A;  3Q23 A;  3I4N H;  2PW5 A;  1YIJ A;  4YY3 Q;  2N78 A;  3BVM A;  1HZC A;  2PPB C;  3FPP A;  1XJV A;  4CHT B;  1V1P A;  3TQY A;  1C9O A;  2ZXR A;  3HRZ C;  1CSP A;  4KJN A;  4BBS H;  4CJ0 B;  3I4N B;  2HUG A;  3SK5 A;  2XWB B;  4CJ1 B;  1XTC D;  3WDN A;  2F52 A;  2Z4H A;  4DAV A;  1DOK A;  3MHB A;  1EU4 A;  1GO3 E;  1LT6 D;  4YHH L;  5C3E H;  4GKK L;  1PH8 A;  3MXG A;  1H9S A;  2VQE L;  4CJ2 C;  5IT9 E;  1YNN D;  2ZJP A;  4LUO A;  1PFS A;  1XNQ Q;  2IW3 A;  4POG A;  1EYD A;  1DJR D;  4JOI C;  5FJ8 H;  4DXF A;  1AE2 A;  4X65 L;  1AE3 A;  5IOD A;  2E2H H;  4KJO A;  2F0J A;  1CK1 A;  3GTK H;  4Y7N H;  2VUM G;  2C5C A;  2EZV A;  1G51 A;  3PIO 3;  1NCV A;  1KLU D;  1F2Y A;  2HQL A;  2PQA A;  2PMZ B;  2WII B;  5C0X G;  1HUN A;  2Y0S G;  1Y1W H;  2R92 B;  4YIJ A;  4WJ4 A;  4A3G G;  4C56 C;  5IGF A;  4YCU A;  1NBW A;  2Q8I B;  1TWG H;  1PLF A;  3MFY A;  4GLX A;  1U4M A;  4OXP A;  1KNA A;  1GKH A;  1NAP A;  5FLX E;  4Y7N B;  2F4V Q;  2CQA A;  1I6H B;  1KTK A;  4DR3 Q;  2RCF A;  1PZJ D;  1WVL A;  3STB C;  2A74 C;  3E0J A;  1Y1W B;  4LWC A;  2F0G A;  3EFX D;  1HR0 L;  1NJI C;  1ENF A;  5C44 G;  4LF8 Q;  3HOU H;  1KHI A;  1EIY B;  4A3D G;  4C3I G;  1AP0 A;  4FXG C;  3CCU A;  2EVB A;  3S1M H;  2VY3 A;  4BXX H;  1ZEQ X;  2L5T A;  2QIL A;  2IWH A;  4DV4 L;  1HNZ L;  4J6H A;  4ALP A;  2NVQ H;  1MKH A;  4RHS A;  3VR6 A;  1J8I A;  1B9M A;  1EY4 A;  3R2I A;  1KDA A;  2EE1 A;  1SJE D;  4KHP Q;  1OXV A;  1XNR L;  2E2D C;  1J5E Q;  4R4O A;  4JI3 L;  5CV6 A;  3T56 B;  1K8A C;  1LUZ A;  1B70 B;  2WV6 D;  3BYT B;  3D0F A;  4ZUI A;  1IYV A;  1JR0 D;  1UAP A;  1QVF A;  2K5Q A;  3DWA A;  3RMH A;  1SNO A;  2HIX A;  1SJH D;  5HUR A;  4ULL A;  1KC8 C;  4CGY B;  2K6A A;  2L4N A;  5M3M H;  5FO9 B;  4CDC C;  2FIN B;  1I94 Q;  2OTJ A;  4LFB Q;  2CCZ A;  1X54 A;  3J7Y W;  4PZ6 A;  2DN8 A;  1EYG A;  5M5X H;  1D7Q A;  5EGT A;  4IJH A;  1RL2 A;  4GN4 B;  5IYC H;  4UP9 A;  3LWU A;  3C1F A;  2B8G A;  5M3M B;  2CQO A;  2XSC A;  1SNM A;  4TVA B;  4KD4 A;  4S3S A;  1TS5 A;  2F0O A;  1IL8 A;  1SE2 A;  2KCN A;  1L1O B;  4IPD A;  1HZ9 A;  3F8T A;  4YWL A;  1CQV A;  1XWE A;  3H0G B;  4C3J G;  2EYM A;  4N8F A;  1FNW A;  3JAM E;  1SND A;  4OHJ A;  3ULJ A;  3GV3 A;  3ICE A;  5C4J H;  1GHJ A;  1BCP B;  2PNH A;  1DOM A;  4EQP A;  4NPS A;  2PMZ E;  1BR9 A;  5JEA H;  2NTT A;  2UUA Q;  2PZU A;  1JQY D;  1Q1E A;  2AHO B;  3HP3 A;  4ZKC B;  1PA6 A;  2K4K A;  2JA6 H;  1VQ4 A;  1VQL A;  5CBA E;  2D62 A;  1EQT A;  2OQK A;  3H6M A;  2A69 C;  1I4X A;  5C4J B;  2OEO A;  3W3A A;  2EYP A;  5IYB G;  4BY1 H;  1K83 H;  2E76 C;  3J81 j;  1XX8 A;  1JOQ A;  4DUZ Q;  3FKI G;  1ILP A;  3E9I A;  4HJ8 A;  2CVR A;  4DR5 Q;  2JA6 B;  1O7Z A;  3VYS A;  4DR6 L;  1A3T A;  4QJF A;  1PH3 A;  1Y8P B;  5A35 A;  2EY2 A;  2A68 D;  4P74 A;  2I5L X;  4LF5 Q;  1GUW A;  2EY6 A;  3KLS A;  2F0K A;  2JA7 G;  1G2S A;  1H9R A;  3J80 c;  3DWP A;  2KVM A;  2NVX H;  3HOV G;  5C4Z A;  1IBL Q;  2CWA A;  5IP7 G;  2IPK D;  3IFD A;  3NTI A;  1QUQ A;  4DAP A;  2NTS A;  5H1S E;  1VMP A;  3OHX C;  2AUJ D;  3PUY A;  4KY5 A;  2K5N A;  4QMG A;  1STG A;  2V4D A;  3QOJ A;  5GQO A;  5K5P A;  4TRD A;  4B3S Q;  4BWG B;  4K14 A;  4PQX A;  2E74 C;  1XXG A;  3KF6 B;  1VQ9 A;  1SNC A;  4IUN A;  3P1H A;  1Q82 C;  1HZB A;  1BBX C;  2CH4 W;  2ZTD A;  2LSS A;  5FLX c;  2XWJ B;  1MD2 D;  5IIF A;  3OW7 A;  1MSH A;  3DHQ A;  1GHK A;  2RQX A;  1H95 A;  1SYF A;  4JI5 Q;  3TS0 A;  1S5D D;  4YHH Q;  4GKK Q;  5KIX A;  1G2T A;  4A3K H;  2TMP A;  4K6L A;  4NXM Q;  2D5D A;  2VQE Q;  1EOT A;  3GTJ H;  1V1O A;  1O78 A;  2QEJ C;  1LT3 D;  2M9V A;  3QJY A;  1W3S A;  5KRU A;  1HTP A;  5C5L A;  3IFT A;  1Q81 C;  5DLQ E;  5K36 H;  4J8Q A;  4K2L A;  4A3C G;  1L1O A;  2EYJ A;  4DV1 Q;  3BVZ A;  1SE3 A;  4L63 B;  1RDP D;  4LW1 A;  2ZM6 L;  2WB1 B;  3GTJ B;  3P20 A;  4RH6 A;  2JEA I;  4IOA A;  1PTO H;  4MZ9 A;  2JP1 A;  1EQR A;  2BA1 A;  4GNX B;  4LF4 Q;  1JE4 A;  1YZ6 A;  1YEZ A;  2F0W A;  2IX0 A;  3L2P A;  4HMI A;  4L5S A;  4C2M B;  3GTP H;  3G4S A;  4L6T B;  4MTK A;  3CCJ A;  4PMB A;  2KA7 A;  2FMC A;  1PTO B;  2MNA A;  4X62 L;  2R61 A;  4JI7 L;  4I65 A;  4IFD J;  5JOB A;  1SE8 A;  4O42 A;  2JJQ A;  1PFN A;  1LTR D;  1A15 A;  3A74 A;  2L1B A;  4PV1 C;  2ZXO A;  4DV4 Q;  3K59 A;  1LO5 D;  3NSW A;  1HNZ Q;  1U5K A;  3VR4 A;  2O5I C;  1PYS B;  1PRT C;  2CW0 D;  1XNR Q;  3EA6 A;  1C0A A;  1TWC H;  3K0Y A;  2MQH A;  4RG1 A;  5IT9 L;  1SYD A;  3HKZ B;  2WIN B;  4A3I G;  1MIU A;  4LF9 L;  1HJP A;  1UNS A;  2RKS A;  1SNQ A;  1HPC A;  1PRT F;  2EQS A;  3I2Z A;  4AYB E;  1FGB D;  1UE6 A;  4ZLT F;  4B3M L;  5BR8 Q;  1QB5 D;  1TWC B;  3DXJ C;  3LX0 A;  4IUU A;  4OGQ C;  5EQ0 A;  1Q8K A;  3VA7 A;  1IHZ A;  2WAQ E;  1PH4 A;  3AMU A;  3MEF A;  1STB A;  3NQI A;  1D6E C;  2KQ3 A;  4H13 C;  1A2T A;  2R7F A;  3J7A 5;  4A3B H;  3KF6 A;  2NWG A;  2B63 H;  3KOJ A;  3U50 C;  2F1M A;  4KHV A;  1OXU A;  1VS0 A;  4RKL A;  4LF6 Q;  3BJU A;  3QG1 A;  1VQD A;  2PW7 A;  3CD6 A;  1QJO A;  1SSO A;  1Q8I A;  3DMU A;  1X32 A;  2K5D A;  2R93 G;  4B3R L;  2Z8L A;  1TWA H;  1L1O C;  4A3B B;  2K5W A;  1F2M A;  2JEB I;  2B63 B;  1CFM A;  3S17 B;  3KFU A;  1DCZ A;  2OQ0 A;  4H7B A;  1QVC A;  2DY7 A;  4A93 G;  3FP9 A;  3I91 A;  1FNU A;  4B08 A;  4Y52 H;  1BCP C;  4CBV A;  4BBR G;  2JYO A;  1ET6 A;  3HOZ B;  1CTM A;  1TWA B;  4FDB A;  3LGJ A;  1VQF A;  3G71 A;  2XNA C;  1WCM H;  2A6H C;  4EVO A;  3Q8D A;  4NXN L;  1EY6 A;  3I4M B;  2D0O A;  1CQF A;  4KHZ A;  1LAB A;  1PHJ A;  1VQK A;  1AH9 A;  1BCP F;  4GNX A;  1WOC A;  5COR A;  1IBK L;  3R3O A;  4X66 L;  5FKA C;  3TN2 A;  4A3J G;  2M00 A;  4FF1 A;  3M3Y B;  4IAL A;  4DR6 Q;  2Q2I A;  1WCM B;  2BA0 A;  4XT1 B;  5C4X G;  2A73 B;  1TQO A;  4X3U A;  2PI2 A;  2I07 B;  2YYZ A;  1A3V A;  5EPK A;  2C35 B;  3IKJ A;  4A4I A;  4B9X A;  1I3Q H;  3R2T A;  1E3P A;  1Q86 C;  2O5J C;  5EKI A;  1V9P A;  1II3 A;  1QNK A;  2K14 A;  3HKZ E;  3BDL A;  4G7H C;  2KUM A;  4AQY L;  5E1F A;  4JG2 A;  5C0X J;  2QCP X;  3AU7 A;  5JVH 3;  3ERQ A;  4KY7 A;  2JA9 A;  1JJC B;  3JAM L;  1V1P B;  3CHB D;  4YCV A;  4OX9 L;  1X56 A;  2LS0 1;  3WWV A;  3VR2 A;  2NZ1 D;  4UAI A;  1A0I A;  2FFK B;  1EWC A;  5M9O A;  3OTO Q;  1VQC A;  1VQP A;  3CME A;  3VA5 A;  5IYD G;  3D8G A;  4PMW A;  4C1N K;  3K5N A;  5E4X A;  3MFG A;  4MNO A;  3UDI A;  1D5M C;  1R9T H;  2UU9 L;  1H9S B;  1SMY C;  3PO2 G;  5CV7 A;  2VUM H;  1B9N A;  3F2B A;  4IFD G;  4DR1 L;  1FYC A;  1SR3 A;  3KK7 A;  4V0B A;  1RTN A;  1XMO L;  4JI2 L;  4A3G H;  3CC4 A;  1PH7 A;  1F2Z A;  2L9H A;  1IW7 C;  5LMU L;  4DAY B;  1FL0 A;  1R9T B;  1O7L A;  3PF4 A;  4GLV B;  5CR3 A;  4ODG A;  2EYH A;  1E2W A;  1EYC A;  4LF7 Q;  3PIO A;  2YV5 A;  4A3G B;  5D3I B;  2IX1 A;  1QZH A;  1ENC A;  3B6Y A;  1ASY A;  3KJP A;  4JBM A;  3ND8 A;  2K04 A;  4HMJ A;  4C3I H;  3F2D A;  1TR5 A;  1CZG A;  1CZW A;  4O0A A;  1GUT A;  3QR8 A;  1MBY A;  3NWT A;  1C48 A;  2MO0 A;  1PTO C;  4CDE C;  4CKE A;  4R8I A;  2WFW A;  1RJT A;  3OOC A;  2K52 A;  3H94 A;  1KRS A;  1WTW A;  4WOR A;  2ICI A;  3GTL H;  2XGT A;  3FEW X;  5J3B A;  2DJF C;  4DNT B;  1JCK B;  4ZUJ A;  4X64 Q;  1C8C A;  4CKC A;  3TRZ A;  1EY7 A;  1YJN A;  1WFQ A;  1PTO F;  1RIP A;  3ITP A;  1G29 1;  1DD2 A;  3KUP A;  1B3A A;  2Z6B A;  3K0X A;  3RLF A;  4MHE A;  1TS2 A;  3I56 A;  2A19 A;  3E0E A;  5G3L F;  1YI2 A;  2FMM A;  4Q0F A;  3QWN A;  1VF5 C;  1EOV A;  1EYA A;  4GN3 B;  2HCC A;  2K03 A;  4LUZ A;  3OIQ A;  4DAM A;  3EQL C;  1STH A;  3HOY H;  4A3M H;  1DM0 B;  1QZG A;  3HOW G;  3PSI A;  4ZQ3 A;  3UDG A;  1BNZ A;  3IAY A;  1FJG L;  4DF7 A;  1VQO A;  1OTC A;  1VQ7 A;  3OSO A;  2E5L Q;  4P72 A;  3P75 A;  1N32 L;  2E8G A;  1BBW A;  4MIU A;  1PV4 A;  4Z9C B;  4QIW E;  4EX5 A;  5FLM G;  3RR5 A;  5I9P A;  3HOY B;  4B3R Q;  4A3M B;  2UXC L;  4HTH A;  4BBS B;  5JVG 3;  2MO1 A;  4OWX B;  4DN4 M;  1VQ5 A;  1X55 A;  3KLR A;  4A3E G;  2O2L D;  3L7Z C;  1K8O A;  3TSS A;  3BDO A;  3I72 A;  3T4A C;  5IYB H;  3CCE A;  1FD7 D;  4ZAI A;  2JA5 G;  3IRB A;  3KF8 B;  3PMF A;  5C3E B;  2EYF A;  4DAY A;  4WJW A;  2ASB A;  4P75 A;  3FKI H;  4NXN Q;  1CKO A;  1RD9 D;  1JOR A;  1VDZ A;  1KDB A;  1NNX A;  2RDH A;  1HFG A;  2HHH L;  3S1N H;  1SNP A;  2K28 A;  5ELO A;  4G7Z C;  2E2H B;  5IWA L;  3GTK B;  2JSO A;  1LTG D;  1ASZ A;  2JA7 H;  4JC0 A;  1JJG A;  1Y1V H;  3RUZ A;  3F1Z A;  1N34 L;  4CDF C;  3HOV H;  1UWV A;  5IP7 H;  2F03 A;  4XYQ A;  3S1N B;  5IP9 G;  1TWG B;  4RFB A;  3T51 B;  4UHV A;  3J81 E;  1IL2 A;  3PV0 A;  2J0T D;  5EBC A;  4L5R C;  3I3C A;  1Y1V B;  1NY4 A;  3BZC A;  1A3U A;  1PRT B;  3RZO H;  1EY8 A;  5ELB A;  3CF5 A;  1QUQ B;  1SE4 A;  2Q8R E;  3OIP A;  3A8J E;  4LK1 C;  3T16 A;  1I4H A;  4NDX A;  3HOU B;  2CFM A;  3VDY A;  2UUB L;  1TU2 B;  4XYO A;  4WFN 3;  1WTH A;  2SNM A;  4XTC S;  3S1M B;  4LFA L;  1HUM A;  1PXU A;  3CRK C;  2NVQ B;  4ZYS A;  3RZO B;  5LMN Q;  3MZ5 A;  1TWH H;  3CU7 A;  1SRU A;  3H15 A;  2RCN A;  3SK4 A;  1QNU A;  4FYD A;  4IUT A;  4X3K A;  5EKK A;  3A8K E;  4C3H G;  4XQJ A;  1Z7T A;  1O80 A;  4A3C H;  2UU9 Q;  5DEH A;  2DY8 A;  2F3I A;  1TWH B;  3MXN B;  1Z47 A;  1XPO A;  5EPL A;  2YTX A;  2F3V A;  3RD4 A;  4DR4 L;  1CKN A;  3MXP A;  3OMG A;  4DR1 Q;  1GXD C;  1HR0 W;  2VQF L;  3NQT A;  3SR1 A;  4FNF A;  5M5X B;  5LMU Q;  2ZJR A;  2MFI A;  3ULL A;  4ME3 A;  3CXC A;  3CCM A;  4ZRZ A;  1OO9 B;  1STN A;  1Z6H A;  4ME5 A;  1YNN C;  1RKN A;  5GAD C;  3HKS A;  4ILW A;  3BZD B;  2VXW A;  4LFC L;  3X3N A;  2BE5 D;  4A75 A;  1J6Q A;  3LWE A;  1JIC A;  3D31 A;  2PZT A;  4G57 A;  3V96 A;  2C9O A;  3A0J A;  2QDL A;  2WP8 J;  1K8M A;  1EFW A;  3TZD A;  3KF8 A;  4FXD A;  2E2I H;  1HCZ A;  4AH6 A;  4DUY Q;  3KDF A;  4R9W A;  3PUZ A;  2VNU D;  4XQQ A;  1XMQ L;  1QIL A;  1I5F A;  1UE7 A;  1GOZ A;  3NE5 B;  1QE6 A;  3SVM A;  4JI4 Q;  2L12 A;  1NUC A;  1X3G A;  5M3F G;  2E2I B;  1IYJ B;  4DV5 Q;  1PH1 A;  4JI0 L;  1LTT D;  4RGO S;  3KJO A;  3OMC A;  5KNC A;  2DUD A;  3A7A B;  1HFN A;  2R92 G;  4HJA A;  4BY1 B;  1EIH A;  3J7Z C;  2HCI A;  1K83 B;  3GV6 A;  1VQ6 A;  3EBE A;  4XXE A;  4OON A;  3W2D A;  4DV6 Q;  4KKS A;  3A5Z B;  2LKV A;  5E4W C;  4NB3 A;  4TSS A;  3NTK A;  5IT9 c;  4DR7 Q;  1LT4 D;  1LTB D;  2ID0 A;  1Y1W G;  4PNY A;  3PO3 G;  1LTS D;  1Q7Y C;  4OWT B;  2A8V A;  3M7N A;  1VCI A;  3I7F A;  1IBM L;  4ID6 A;  3TDQ A;  4DV2 L;  5CV9 A;  2JA8 G;  1HA5 A;  5C5M A;  5T1G A;  4HJ7 A;  2JK8 A;  1LYL A;  2B39 A;  2NVX B;  3KLS X;  4PG3 A;  2R93 H;  4IJL A;  2VW9 A;  3CCQ A;  2PCF B;  4APV A;  1X6O A;  1VQ8 A;  4PZ8 A;  2P5Z X;  2NN6 H;  1TVX A;  5DNF A;  1EIG A;  1X9N A;  1LTI D;  3KLW A;  1N32 Q;  1G8Z D;  2ICE C;  4BY7 G;  4DK1 A;  3FRP B;  3NTH A;  4A93 H;  4BXX G;  2J4X A;  1R4Q B;  4OO1 G;  4BBR H;  1K28 A;  1TY2 A;  3MXN A;  5I2X A;  1U4R A;  4IQZ A;  1S3O A;  1KAW A;  4E6I A;  3DWQ A;  4X65 Q;  5BN4 A;  4FXK C;  4A93 B;  1I4G A;  1AZP A;  5EKL A;  4L5T A;  4JI6 L;  5NUC A;  2WKD A;  3G48 A;  1NTG A;  4BBR B;  4A3K B;  2AWN A;  4U67 3;  4IUR A;  3NEN A;  3VYU A;  5M3M G;  1W6J A;  2L11 A;  4P73 A;  4DKA C;  3S1Q H;  4QQB X;  2FXQ A;  2HHH Q;  2M2L A;  5C4X H;  3BG3 A;  3U9O A;  5GAH C;  4G4K A;  4L8J A;  3GTM H;  2ZT9 C;  1I4P A;  2L0C A;  2VZA A;  3H0G G;  3OYY A;  2D2C C;  4NP5 A;  5AFW A;  3W5O A;  3RZD H;  2HDM A;  5C6A A;  5M5W H;  1LTL A;  5EAY A;  3H3V H;  3CQZ H;  3S1Q B;  2RHQ B;  2R7D A;  5JJZ A;  1HR0 Q;  5ELD A;  3C1E A;  3CP0 A;  4DK0 A;  3NP8 A;  1X3Q A;  2OCE A;  2ATW A;  3J7A V;  3GTP B;  3PIP 3;  1S40 A;  2KEN A;  3A56 A;  2Z1C A;  3OPO A;  2SEB D;  4OEM B;  1KXL A;  5M5W B;  1MJE A;  3CQZ B;  2YU9 H;  3SE0 A;  2KHJ A;  2A68 C;  2F0D A;  3UDX A;  1L0X B;  2K5V A;  5J22 A;  4K2K A;  5CGK A;  1LLR D;  1TWF H;  2TSS A;  4RA8 A;  3UE1 A;  5IYD H;  4JI3 Q;  3JAM c;  2NN6 I;  1ONL A;  1EY9 A;  1K73 C;  1SFO H;  4R8N A;  4H02 A;  4XQN A;  2FJ2 A;  4FF2 A;  2YU9 B;  3K8A A;  1G6P A;  4O2D A;  1FR3 A;  3PUX A;  2OF1 A;  1SRO A;  1FGU A;  2F0F A;  1EY0 A;  4LUV A;  2NZO A;  3BYY B;  2QGQ A;  5IGC A;  1K0R A;  3PO2 H;  1KAA A;  3A55 A;  2Q8T A;  3J80 L;  2B2Y A;  2B2V A;  1YNJ D;  2R6G A;  2QEX A;  4XIG S;  1SFO B;  1N33 L;  4U68 A;  2F0P A;  2VB2 X;  1WTO A;  2PO4 A;  4F7X A;  3CCL A;  1F9Q A;  4DNR B;  1M8A A;  1BQQ T;  4HED A;  3MEH A;  1IZ6 A;  3PO2 B;  3M4O H;  5E7N A;  4YY3 L;  5A2Q E;  2MP1 A;  5DAU A;  5D3D A;  2K5H A;  4AYB G;  5AJ3 L;  4QGU A;  5KND A;  1HHV A;  2KEC A;  2F0E A;  3J81 L;  4N8X 1;  1UEA B;  2WAQ G;  1I50 H;  3CCS A;  1ENA A;  4GOP A;  2UXB L;  4RGM A;  4GS3 A;  1GUN A;  2BH8 A;  4OEL B;  4ABN A;  3M4O B;  4DXG A;  2WB1 E;  3MAQ A;  2N8N A;  4HCE A;  2ENB A;  3S1R H;  4IZ8 A;  1FNV A;  1F2L A;  1A62 A;  2N55 A;  3ERO A;  2MJ8 A;  2HT1 A;  1WTP A;  5C3W A;  3U58 A;  3AYH B;  1ZXT A;  4KV6 A;  2B29 A;  5I4D A;  3S9W A;  1PH9 A;  1TS4 A;  1U9R A;  3K58 A;  1PH2 A;  1LTA D;  3M7G A;  4FO2 A;  4DK6 C;  1SMX A;  5GAE C;  3URY A;  4V19 0;  2PI2 E;  2NVT H;  2EJM A;  5FOB B;  4JI0 Q;  1ICW A;  2BH2 A;  5HGQ A;  4R4I A;  3NBI A;  3ONA B;  3UDF A;  2A5H A;  2K32 A;  3C2P A;  1KQS A;  4ZKB B;  1I6V C;  4A3L H;  1NR2 A;  1WTX A;  3DM3 A;  1X3F A;  4QUF A;  1A2U A;  1G91 A;  3HZX A;  1QWY A;  2B2U A;  1V8Q A;  4KD3 A;  1HZA A;  3I8Z A;  4ZCK A;  5EPJ A;  1Y69 U;  1D5X C;  2NVT B;  1A6X A;  3VYR A;  4JI8 L;  3S2H H;  1CHP D;  3NEM A;  2KBN A;  2XRQ D;  3AQQ A;  4DR3 L;  2UXD L;  3D6W A;  1K0S A;  3ULP A;  4DU9 A;  2CW0 C;  4I7A A;  3JC6 6;  1T5E A;  2G5D A;  2GA4 B;  4NW2 A;  4LF8 L;  2K01 A;  1KDC A;  1K8G A;  2JN4 A;  1I3Q B;  1STA A;  1M4V A;  1A8V A;  3S2H B;  5GRO A;  4K0K L;  5FLM H;  3BDC A;  1LAC A;  2B2Y C;  2V1C C;  1HA6 A;  5FK9 C;  2B2V C;  1Q3L A;  2VL6 A;  4K8J A;  3HG9 A;  2SOB A;  5DM7 3;  4HID A;  3SXH A;  2ZTC A;  1N9W A;  4N9T A;  1N36 L;  4M8A A;  5JJI A;  4A3E H;  1EQQ A;  4KHP L;  3FVQ A;  3HKZ G;  1KRT A;  2X6G A;  1J5E L;  1QCB D;  3GTO H;  3HGB A;  2HDL A;  1AN8 A;  2R7Z G;  2JA5 H;  2WKC A;  1J9O A;  1NMG A;  4IPC A;  3NHH A;  1ICF B;  4TKO B;  4A3E B;  5C0X H;  4CDD C;  3L3O C;  1WTV A;  4GOP C;  1HQR D;  2CH4 A;  3GTO B;  4N9P A;  3K80 C;  5EJW A;  2SNS A;  2YTV A;  2EOT A;  3MC0 B;  4F88 A;  3PQI A;  1YHQ A;  2ZM6 Q;  5IE8 A;  2VUM B;  4P71 A;  2B2W C;  3TRE A;  1VQN A;  3FHW A;  2Y0S B;  1PFB A;  5CYU A;  1SEB D;  2KCM A;  3TBI B;  3PF5 A;  3A7L A;  5IP9 H;  5C44 H;  3EJI A;  4HIM A;  1Q12 A;  5IY0 A;  3S16 H;  1D5Z C;  2ZTE A;  4A3D H;  2I5H A;  4A3B G;  4NKL A;  2LMC B;  2IL8 A;  4WRD A;  4XT3 B;  5LMN W;  1JJ2 A;  1TII D;  1GVP A;  1VQI A;  3T53 B;  4X62 Q;  1EY5 A;  3GD7 A;  5L37 A;  1NMF A;  4JV5 L;  4KN7 C;  1PZI D;  1VQE A;  3M4P A;  4A76 A;  3BZK A;  5C44 B;  2UUA L;  3HOZ G;  3CPF A;  1AZQ A;  4RCN A;  3U9S A;  2EJF C;  1VQM A;  3GP7 A;  3S16 B;  4A3D B;  4C3I B;  2B2U C;  3NWS A;  4TQU S;  4C1N I;  3RLN A;  3I4M G;  4ZK9 B;  2AWO A;  5J39 A;  3STB D;  3L0O A;  3H3V C;  2HQE A;  4P2C B;  4MTN A;  2BDN A;  2F0L A;  3D3R A;  5CMD A;  1KIX A;  3GTL B;  1W2B A;  1XTD A;  4LF9 Q;  1WCM G;  2LXJ A;  2F0I A;  3EVQ A;  4C3H H;  4DR5 L;  1QVG A;  1Z9F A;  1PZK D;  1JT8 A;  1VMC A;  1O7Y A;  2IX3 A;  1T9H A;  2E2J H;  1TY0 A;  4QB4 A;  4FF4 A;  3TEH B;  1C4Q A;  4B3M Q;  1U4P A;  1H9J A;  2AUK A;  2F0T A;  5I6Y A;  1DZ1 A;  1WD0 A;  3MA2 B;  3R8B A;  3QO2 A;  4BA2 I;  5C0X I;  3I73 A;  2R3Z A;  1N33 Q;  3KBG A;  2IHF A;  1PH6 A;  3K6O A;  1IBL L;  2E2J B;  1HTL D;  1UEB A;  4AIM A;  4C3J H;  1XPU A;  1BVS A;  4JW0 A;  2CKZ B;  3W1G A;  1CKN B;  3OWF A;  4JVZ A;  1B50 A;  3CPW A;  1UE1 A;  1P8L A;  1STE A;  5AJ3 Q;  4JI1 L;  3M85 A;  3OWE B;  1HH2 P;  3O13 A;  1X3E A;  3BU2 A;  5E3F A;  4B3S L;  2NYZ D;  4C3J B;  2UXB Q;  2NBF A;  3GDE A;  1PYW D;  1NE3 A;  1F77 A;  3GTG H;  2EYL A;  4LMQ D;  5ELF A;  4YWK A;  5CBE E;  2KEE A;  4A3F G;  2VB3 X;  3NBH A;  1VQG A;  3AFP A;  1K3B C;  1S5C D;  2Y0S E;  1SLJ A;  2RSN A;  4JI5 L;  1E7Z A;  1CA5 A;  1JWS D;  3KDF B;  3FDT A;  5M3F H;  3JAM i;  4Q5V A;  2BDO A;  1U0L A;  4NXM L;  3CKI B;  4MN3 A;  3T1H L;  1JC7 A;  2XTI A;  3IL8 A;  1VF7 A;  5LL6 S;  3J80 E;  3GTG B;  3E3X A;  2ALY B;  2R92 H;  4UDU C;  4GLA C;  1IBK Q;  4GKJ L;  4X66 Q;  1GUO A;  2VS1 A;  1D1I A;  2XN9 C;  2OTL A;  2HIV A;  1ML0 D;  3FKI B;  4IUV A;  4DV1 L;  5M3F B;  1BBU A;  1YJW A;  1I6H H;  5JPN C;  5IGD A;  2A69 D;  3NEL A;  4RWS C;  1DOL A;  3HOX G;  4LF4 L;  3PO3 H;  1H9M A;  4B3T L;  3HFZ B;  5ISR A;  5BN3 A;  2ZJQ A;  2I5M X;  3I4O A;  4WJ3 M;  4JI8 Q;  3V2T A;  2JA7 B;  1ZYR D;  5A2Q L;  2JA8 H;  2BCO A;  3GTQ H;  4QF4 A;  2UXD Q;  1TKW B;  4DV0 L;  2Z0S A;  2A6E D;  4AQY Q;  3HOV B;  1E1T A;  2L15 A;  4NMZ A;  1JWM D;  4EQ5 A;  3ZYY X;  3PO3 B;  2WAC A;  2J7Z A;  4DNI A;  3VR3 A;  1YNX A;  4OX9 Q;  1E2Z A;  1DXM A;  4DA2 A;  3NUC A;  1KL9 A;  2XRS D;  4BY7 H;  4K0K Q;  2EPB A;  2JA8 B;  2MHV A;  1SXT A;  3GTQ B;  1I4Q A;  4QUC A;  4JBJ A;  4OO1 H;  2K7V A;  1CHQ D;  4LAA A;  3GO5 A;  2RVL A;  3RN2 A;  2G9H D;  1OXT A;  1OXS C;  1N36 Q;  2IY5 B;  3C46 A;  4F8M A;  1NSN S;  2KED A;  4DR2 L;  2F3W A;  2E75 C;  5HGT A;  1B8A A;  2F0N A;  3D4W A;  2EJG C;  4BY7 B;  3BVG A;  3MXU A;  5I6W A;  4J15 A;  4DFA A;  2X6L A;  4X3S A;  2Q2T A;  5EBD A;  3QIA A;  2UUC L;  3SDZ A;  1YVC A;  1DON A;  1Q1B A;  4PZ7 A;  3CCV A;  1L0Y B;  5BR8 L;  2ES2 A;  3SEB A;  4JI2 Q;  1XMO Q;  5JEA J;  4K5X A;  3EN2 A;  4K6D A;  3G6E A;  3DLL A;  1SN8 A;  3U4V A;  2O4X A;  3M4Y A;  4KKT A;  3I4N G;  1EIF A;  3NXW A;  4GZY C;  3H0G H;  3CMA A;  1ZKO A;  3H91 A;  2D0P A;  4L5Q A;  4FVM A;  4LF6 L;  2NVY H;  3CRL C;  3RNU A;  1UUP A;  3ND9 A;  1MGS A;  1BF4 A;  1DGS A;  3HOY G;  1K3R A;  4A3M G;  2NB0 A;  2F4I A;  4BBS G;  3M9B A;  1D2B A;  3T13 A;  1EL0 A;  1E0B A;  3P7J A;  2LXK A;  5JPM C;  1X3P A;  3DUZ A;  1YIT A;  1C7Y A;  4EGV A;  2L55 A;  5FO7 B;  2NVY B;  1N8R C;  4JV5 Q;  1SDF A;  1IKL A;  4DGZ A;  3A54 A;  5JJL A;  5C3E G;  1WI5 A;  4QCL A;  1M1K C;  4RGT A;  2IHE A;  1MSG A;  1WD1 A;  4A3I H;  2MUY A;  2Q2H A;  2RA4 A;  1OXX K;  4FP5 D;  1RCV D;  2EYO A;  3PIP A;  3CCR A;  2RSO A;  3T1Y L;  4KY6 A;  2AQ3 B;  1O7I A;  5FJ8 G;  5GAG C;  1F9S A;  2B2T A;  5DM6 3;  1JMC A;  2Q2U A;  1SYC A;  4OO1 I;  1JB3 A;  3ERS X;  4DV7 L;  1EEF D;  2JXM B;  1GJX A;  1V1Q A;  1BXT A;  1S4Z A;  1ZYR C;  4A3I B;  1RHP A;  1S72 A;  1CT1 D;  4UP8 A;  2RF4 A;  4RKB A;  2OWO A;  2A6E C;  5JAV A;  3BS1 A;  3Q24 A;  3S24 A;  3K5L A;  4HAE A;  4H44 C;  1JOK A;  4JYA L;  2FHT A;  1YHA A;  4DV3 L;  1PRT D;  3K5O A;  4DPG A;  3OW2 A;  3NK9 A;  1YJ9 A;  1TT2 A;  1Y1V G;  2MGS A;  4BS9 A;  3PUV A;  2F0U A;  5J1Z A;  2H4O A;  3U4Z A;  2RBM A;  5KYI A;  1FJG Q;  3HOU G;  1AFP A;  1R4P B;  1FVI A;  1LV9 A;  4HJ5 A;  1JWU D;  3CAM A;  4IOC A;  4IPG A;  4JI1 Q;  2UXC Q;  2X69 A;  4HN7 A;  2R93 B;  4AYB B;  2K33 A;  2GVA A; 
#chains in the Genus database with same CATH homology
 2OT2 A;  2SDF A;  4RAU C;  3I4L A;  3NPP A;  2WAQ B;  3D4R A;  3D6C A;  1B1Z A;  4EQN A;  5C4H A;  2LFN A;  4RHR A;  3MWY W;  2PZW A;  3KBX A;  3K5M A;  1PFM A;  3GQB A;  4HCS A;  5CV4 A;  4K5V A;  2KJX A;  2PNR C;  1PDQ A;  3A8I E;  5ELE A;  1AW7 A;  3VR5 A;  1Y8O B;  1GUG A;  2BE5 C;  1IKM A;  3TME A;  3H09 A;  1B53 A;  5KYL A;  1GUS A;  2DNE A;  1EFI D;  5KNB A;  1BCP D;  1T5X D;  4BA1 I;  2Z4I A;  4A3J B;  1KAB A;  4FF3 A;  2EY5 A;  1B4O A;  2CHB D;  2A6H D;  5IOC A;  2EXZ A;  3PUW A;  5C4X B;  2F0S A;  2XIW A;  1ESF A;  3X3M A;  3GTM B;  1EWH A;  2B2T C;  2XVS A;  3RZD B;  1W6K A;  3K7A B;  1F9P A;  5D65 A;  4EQO A;  2QKI C;  1HQM C;  2NUC A;  5FO8 B;  2KCC A;  5JEA G;  4KI0 A;  3VYT A;  3K57 A;  2K05 A;  1E2V A;  1IYU A;  3N6R A;  3G7L A;  5D14 A;  1DYQ A;  3E6Z X;  1QG7 A;  1SAP A;  1EEI D;  1I4R A;  2I46 A;  1B44 D;  3SHL A;  1STY A;  1QOH A;  3HS0 C;  2DNC A;  2AQ2 B;  3I90 A;  3TP8 A;  1Y8N B;  3Q0A A;  1TWF B;  2QDB A;  4IFD H;  4M1U B;  1U4L A;  2BOS A;  4KN4 C;  3LNN A;  3FPU B;  2R7Z B;  1EQV A;  4I7Z C;  3E5S A;  2EY1 A;  2K1B A;  3G6J B;  1S5F D;  2PQE A;  4OL7 A;  1G6Z A;  5IGE A;  5FLX L;  2ZXP A;  1SMY D;  1H9K A;  1EZ8 A;  1WTQ A;  4JBW A;  4RCO A;  1EU3 A;  2B2W A;  1IW7 D;  3C3L A;  1I50 B;  2NN6 G;  5COY A;  2QF7 A;  1PMR A;  3N52 A;  2D9U A;  1V43 A;  3S1R B;  1RTO A;  2EDG A;  3TP7 A;  4X3T A;  4G7O C;  1Q90 A;  4O1N A;  3R93 A;  3QOL A;  1F9R A;  1LT5 D;  2F0Q A;  2B8F A;  5LHY 1;  2H1E A;  1B2T A;  5K36 G;  2PYK A;  1SYB A;  1S5B D;  3L9A X;  1WTR A;  5BN5 A;  1PTO D;  1NR4 A;  4KKU A;  2MPM A;  4RGN A;  1S5E D;  1ILQ A;  2F0H A;  4HR7 B;  3J7A F;  4KMU C;  4IFD I;  5M5Y B;  3WOF A;  2F0V A;  3FMC A;  4KK7 A;  4H0L C;  3S15 B;  5I9O A;  2F0M A;  4LJZ C;  5G3L D;  4B9W A;  1AEX A;  3Q22 A;  1ET9 A;  2OXP A;  1SYG A;  5I2Y A;  5CV5 A;  4KTA A;  2RDG A;  3S2D B;  3HOW B;  2KOL A;  2AQ1 B;  3SK6 A;  1SYE A;  3DEP A;  5C3X A;  1YNJ C;  1CM9 A;  3UI2 A;  3I70 A;  5TSS A;  4JK1 C;  1BDO A;  1ESR A;  1SBB B;  4IUP A;  1CI3 M;  3TZU A;  4HSP A;  3TP6 A;  4CKB A;  4A3F B;  1BOS A;  1XYI A;  2RDF A;  2JA5 B;  3DEO A;  3D4D A;  1D1K A;  1RF2 D;  3S14 B;  5KEE A;  4QIW B;  4IUQ A;  1KLG D;  4XDX A;  3F2U A;  3QB3 A;  3WOE A;  4J1M A;  4K5W A;  3V05 A;  1ROD A;  5CC4 A;  5IGG A;  2G9D A;  3SK8 A;  3Q6S A;  3TP5 A;  4IN3 A;  5IGB A;  4OIJ A;  4PMC A;  3HOX B;  2N88 A;  1EZ6 A;  1BO0 A;  1MI2 A;  5LL6 X;  1HRJ A;  3MTS A;  2KHS A;  5KGU A;  2IJ0 A;  1BUV T;  2IT1 A;  3HEJ A;  1HXY D;  5ELC A;  1TS3 A;  2LY7 A;  4OIK A;  5T1I A;  3DM1 A;  4K8I A;  1JOO A;  5CV8 A;  2JE6 I;  4F87 A;  1CA6 A;  1KNE A;  3AB9 A;  4HSV A;  5F2D A;  4C3H B;  3MVV A;  3Q23 A;  2PW5 A;  3BVM A;  2PPB C;  3FPP A;  4CHT B;  1V1P A;  2ZXR A;  3HRZ C;  4KJN A;  4CJ0 B;  3I4N B;  2HUG A;  3SK5 A;  2XWB B;  4CJ1 B;  1XTC D;  3WDN A;  2Z4H A;  4DAV A;  1DOK A;  3MHB A;  1EU4 A;  1LT6 D;  3MXG A;  1H9S A;  4CJ2 C;  5IT9 E;  1YNN D;  2IW3 A;  1EYD A;  1DJR D;  4DXF A;  5IOD A;  4KJO A;  2F0J A;  1CK1 A;  2C5C A;  2EZV A;  3PIO 3;  1NCV A;  1KLU D;  1F2Y A;  2WII B;  2PMZ B;  5C0X G;  1HUN A;  2R92 B;  4YIJ A;  4C56 C;  5IGF A;  2Q8I B;  1PLF A;  3MFY A;  1U4M A;  1KNA A;  1NAP A;  5FLX E;  4Y7N B;  2CQA A;  1I6H B;  1KTK A;  1PZJ D;  1WVL A;  2A74 C;  3E0J A;  1Y1W B;  2F0G A;  3EFX D;  1ENF A;  4C3I G;  1AP0 A;  4FXG C;  2EVB A;  1ZEQ X;  2L5T A;  2QIL A;  2IWH A;  4J6H A;  4RHS A;  3VR6 A;  1J8I A;  1B9M A;  1EY4 A;  3R2I A;  1KDA A;  2EE1 A;  1SJE D;  1OXV A;  2E2D C;  5CV6 A;  3T56 B;  4ZUI A;  2WV6 D;  3BYT B;  1IYV A;  1JR0 D;  1UAP A;  2K5Q A;  3DWA A;  3RMH A;  1SNO A;  1SJH D;  5HUR A;  4ULL A;  4CGY B;  2K6A A;  2L4N A;  5FO9 B;  2FIN B;  3J7Y W;  2DN8 A;  5EGT A;  3LWU A;  3C1F A;  2B8G A;  5M3M B;  2XSC A;  1SNM A;  4KD4 A;  4S3S A;  1TS5 A;  2F0O A;  1IL8 A;  1SE2 A;  2KCN A;  1CQV A;  1XWE A;  3H0G B;  4C3J G;  2EYM A;  1FNW A;  3JAM E;  1SND A;  4OHJ A;  3GV3 A;  1GHJ A;  1BCP B;  1DOM A;  4EQP A;  1BR9 A;  5JEA H;  2NTT A;  2PZU A;  1JQY D;  1Q1E A;  3HP3 A;  4ZKC B;  5CBA E;  2D62 A;  1EQT A;  3H6M A;  2A69 C;  1I4X A;  5C4J B;  2OEO A;  3W3A A;  2EYP A;  2E76 C;  1XX8 A;  1JOQ A;  1ILP A;  2CVR A;  2JA6 B;  1O7Z A;  3VYS A;  1A3T A;  1Y8P B;  5A35 A;  2EY2 A;  2A68 D;  1GUW A;  2EY6 A;  3KLS A;  2F0K A;  1G2S A;  1H9R A;  3DWP A;  2KVM A;  5C4Z A;  2IPK D;  3IFD A;  3NTI A;  4DAP A;  2NTS A;  1VMP A;  3OHX C;  2AUJ D;  3PUY A;  4KY5 A;  4QMG A;  1STG A;  2V4D A;  3QOJ A;  5K5P A;  4TRD A;  4BWG B;  4K14 A;  4PQX A;  2E74 C;  1XXG A;  1SNC A;  4IUN A;  3P1H A;  1BBX C;  2XWJ B;  1MD2 D;  5IIF A;  3OW7 A;  1MSH A;  3DHQ A;  1GHK A;  2RQX A;  1SYF A;  1S5D D;  5KIX A;  1G2T A;  2TMP A;  4K6L A;  2D5D A;  1EOT A;  1V1O A;  1O78 A;  2QEJ C;  1LT3 D;  2M9V A;  3QJY A;  5KRU A;  1HTP A;  5C5L A;  3IFT A;  5K36 H;  4J8Q A;  4K2L A;  2EYJ A;  3BVZ A;  1SE3 A;  4L63 B;  1RDP D;  2WB1 B;  3GTJ B;  3P20 A;  4RH6 A;  2JEA I;  1PTO H;  2JP1 A;  2BA1 A;  1JE4 A;  2F0W A;  2IX0 A;  4HMI A;  4C2M B;  4L6T B;  4PMB A;  2KA7 A;  2FMC A;  1PTO B;  2R61 A;  4I65 A;  4IFD J;  5JOB A;  4O42 A;  1PFN A;  1LTR D;  1A15 A;  2L1B A;  4PV1 C;  2ZXO A;  3K59 A;  1LO5 D;  3NSW A;  3VR4 A;  2O5I C;  1PRT C;  2CW0 D;  3EA6 A;  3K0Y A;  5IT9 L;  1SYD A;  3HKZ B;  2WIN B;  1UNS A;  2RKS A;  1SNQ A;  1HPC A;  1PRT F;  1FGB D;  4ZLT F;  1QB5 D;  1TWC B;  3DXJ C;  3LX0 A;  4IUU A;  4OGQ C;  5EQ0 A;  3VA7 A;  1IHZ A;  3AMU A;  1STB A;  3NQI A;  1D6E C;  2KQ3 A;  4H13 C;  1A2T A;  2NWG A;  2F1M A;  4KHV A;  1OXU A;  4RKL A;  3QG1 A;  2PW7 A;  1QJO A;  1SSO A;  1Q8I A;  3DMU A;  1X32 A;  2K5D A;  2Z8L A;  4A3B B;  2K5W A;  1F2M A;  2JEB I;  2B63 B;  1CFM A;  3S17 B;  1DCZ A;  4H7B A;  2DY7 A;  3I91 A;  1FNU A;  4B08 A;  1BCP C;  4CBV A;  2JYO A;  1ET6 A;  3HOZ B;  1CTM A;  1TWA B;  2XNA C;  2A6H C;  4EVO A;  1EY6 A;  3I4M B;  1CQF A;  4KHZ A;  1LAB A;  1BCP F;  5COR A;  3R3O A;  5FKA C;  3TN2 A;  2M00 A;  4FF1 A;  3M3Y B;  4IAL A;  1WCM B;  2BA0 A;  4XT1 B;  2A73 B;  1TQO A;  4X3U A;  2I07 B;  2YYZ A;  1A3V A;  5EPK A;  3IKJ A;  4B9X A;  3R2T A;  2O5J C;  5EKI A;  1II3 A;  1QNK A;  3BDL A;  4G7H C;  2KUM A;  5E1F A;  5C0X J;  2QCP X;  3AU7 A;  5JVH 3;  3ERQ A;  4KY7 A;  3JAM L;  1V1P B;  3CHB D;  2LS0 1;  3VR2 A;  2NZ1 D;  4UAI A;  2FFK B;  1EWC A;  5M9O A;  3VA5 A;  3D8G A;  4PMW A;  4C1N K;  3K5N A;  5E4X A;  3MFG A;  1D5M C;  1H9S B;  1SMY C;  5CV7 A;  1B9N A;  4IFD G;  1FYC A;  3KK7 A;  4V0B A;  1RTN A;  1F2Z A;  2L9H A;  1IW7 C;  1R9T B;  1O7L A;  5CR3 A;  4ODG A;  2EYH A;  1E2W A;  1EYC A;  4A3G B;  5D3I B;  2IX1 A;  1ENC A;  3ND8 A;  2K04 A;  4HMJ A;  1TR5 A;  1CZG A;  1CZW A;  1GUT A;  1MBY A;  3NWT A;  1C48 A;  1PTO C;  4CKE A;  4R8I A;  1RJT A;  3OOC A;  3H94 A;  1WTW A;  4WOR A;  2ICI A;  3FEW X;  4DNT B;  1JCK B;  4ZUJ A;  1C8C A;  4CKC A;  1EY7 A;  1PTO F;  3ITP A;  1G29 1;  1DD2 A;  3KUP A;  1B3A A;  3RLF A;  4MHE A;  1TS2 A;  5G3L F;  2FMM A;  4Q0F A;  3QWN A;  1VF5 C;  1EYA A;  2HCC A;  2K03 A;  3OIQ A;  3EQL C;  1STH A;  1DM0 B;  4ZQ3 A;  1BNZ A;  3IAY A;  4DF7 A;  3OSO A;  3P75 A;  4MIU A;  4Z9C B;  3HOY B;  5I9P A;  4A3M B;  4HTH A;  4BBS B;  5JVG 3;  4DN4 M;  3KLR A;  2O2L D;  3L7Z C;  1K8O A;  3TSS A;  3BDO A;  3I72 A;  3T4A C;  1FD7 D;  4ZAI A;  3PMF A;  5C3E B;  2EYF A;  4DAY A;  4WJW A;  1RD9 D;  1JOR A;  1VDZ A;  1KDB A;  2RDH A;  1HFG A;  1SNP A;  2K28 A;  4G7Z C;  2E2H B;  3GTK B;  2JSO A;  1LTG D;  3RUZ A;  2F03 A;  4XYQ A;  3S1N B;  1TWG B;  4RFB A;  3T51 B;  3J81 E;  3PV0 A;  2J0T D;  5EBC A;  3I3C A;  1Y1V B;  1A3U A;  1PRT B;  1EY8 A;  5ELB A;  1SE4 A;  2Q8R E;  3OIP A;  3T16 A;  3A8J E;  4LK1 C;  1I4H A;  4NDX A;  3HOU B;  1TU2 B;  4XYO A;  4WFN 3;  2SNM A;  4XTC S;  3S1M B;  1HUM A;  1PXU A;  3CRK C;  2NVQ B;  4ZYS A;  3RZO B;  3MZ5 A;  3CU7 A;  4FYD A;  3SK4 A;  1QNU A;  4IUT A;  4X3K A;  5EKK A;  3A8K E;  4C3H G;  4XQJ A;  1Z7T A;  1O80 A;  5DEH A;  2DY8 A;  1TWH B;  1Z47 A;  5EPL A;  3RD4 A;  2F3V A;  3MXP A;  3OMG A;  1GXD C;  3NQT A;  3SR1 A;  4FNF A;  5M5X B;  4ZRZ A;  1OO9 B;  1STN A;  1Z6H A;  4ME5 A;  1YNN C;  1RKN A;  4ILW A;  3BZD B;  2VXW A;  3X3N A;  2BE5 D;  3LWE A;  1JIC A;  3D31 A;  2PZT A;  4G57 A;  3V96 A;  2C9O A;  2WP8 J;  1K8M A;  3TZD A;  3KF8 A;  4FXD A;  1HCZ A;  4R9W A;  3PUZ A;  2VNU D;  4XQQ A;  1QIL A;  1GOZ A;  3NE5 B;  1QE6 A;  3SVM A;  2L12 A;  1NUC A;  2E2I B;  1LTT D;  4RGO S;  3OMC A;  5KNC A;  3A7A B;  1HFN A;  4BY1 B;  1EIH A;  2HCI A;  1K83 B;  3GV6 A;  4XXE A;  3W2D A;  4KKS A;  2LKV A;  5E4W C;  4TSS A;  3NTK A;  1LT4 D;  1LTB D;  2ID0 A;  4PNY A;  1LTS D;  3M7N A;  1VCI A;  4ID6 A;  3TDQ A;  5CV9 A;  1HA5 A;  5C5M A;  5T1G A;  2B39 A;  2NVX B;  3KLS X;  2PCF B;  2NN6 H;  1TVX A;  5DNF A;  1EIG A;  1LTI D;  1G8Z D;  2ICE C;  4DK1 A;  3FRP B;  3NTH A;  2J4X A;  1R4Q B;  4OO1 G;  1TY2 A;  3MXN A;  5I2X A;  1U4R A;  4IQZ A;  4E6I A;  3DWQ A;  5BN4 A;  4FXK C;  4A93 B;  1I4G A;  1AZP A;  5EKL A;  5NUC A;  2WKD A;  4BBR B;  4A3K B;  2AWN A;  4U67 3;  4IUR A;  3VYU A;  1W6J A;  2L11 A;  2M2L A;  3BG3 A;  3U9O A;  4G4K A;  4L8J A;  2ZT9 C;  1I4P A;  2L0C A;  2D2C C;  4NP5 A;  5AFW A;  2HDM A;  5C6A A;  3S1Q B;  5JJZ A;  5ELD A;  3C1E A;  4DK0 A;  3NP8 A;  1X3Q A;  3J7A V;  3GTP B;  3PIP 3;  3A56 A;  2Z1C A;  3OPO A;  2SEB D;  5M5W B;  3CQZ B;  3SE0 A;  2A68 C;  2F0D A;  5J22 A;  1L0X B;  4K2K A;  5CGK A;  1LLR D;  2TSS A;  4RA8 A;  2NN6 I;  1ONL A;  1EY9 A;  4R8N A;  4XQN A;  4FF2 A;  2FJ2 A;  2YU9 B;  1FR3 A;  3PUX A;  2OF1 A;  2F0F A;  5IGC A;  1EY0 A;  3BYY B;  1KAA A;  3A55 A;  2Q8T A;  3J80 L;  2B2Y A;  2B2V A;  1YNJ D;  2R6G A;  4XIG S;  1SFO B;  4U68 A;  2F0P A;  2VB2 X;  1WTO A;  2PO4 A;  4F7X A;  1F9Q A;  4DNR B;  1M8A A;  1BQQ T;  4HED A;  3MEH A;  3PO2 B;  5A2Q E;  2MP1 A;  5DAU A;  5D3D A;  5KND A;  1HHV A;  2KEC A;  2F0E A;  3J81 L;  1UEA B;  1ENA A;  4RGM A;  1GUN A;  4ABN A;  3M4O B;  4DXG A;  3MAQ A;  4HCE A;  2ENB A;  4IZ8 A;  1FNV A;  1F2L A;  2N55 A;  3ERO A;  2MJ8 A;  1WTP A;  5C3W A;  1ZXT A;  4KV6 A;  5I4D A;  3S9W A;  1TS4 A;  1U9R A;  3K58 A;  1LTA D;  3M7G A;  4FO2 A;  3URY A;  4V19 0;  2EJM A;  5FOB B;  1ICW A;  3NBI A;  3ONA B;  2A5H A;  2K32 A;  3C2P A;  4ZKB B;  1I6V C;  1NR2 A;  1WTX A;  4QUF A;  1A2U A;  1G91 A;  3HZX A;  1QWY A;  2B2U A;  1V8Q A;  4KD3 A;  3I8Z A;  5EPJ A;  1Y69 U;  1D5X C;  2NVT B;  1A6X A;  3VYR A;  1CHP D;  2XRQ D;  3D6W A;  4DU9 A;  2CW0 C;  1T5E A;  2GA4 B;  4NW2 A;  2K01 A;  1KDC A;  1I3Q B;  1STA A;  1M4V A;  3S2H B;  3BDC A;  1LAC A;  2B2Y C;  1HA6 A;  5FK9 C;  2B2V C;  1Q3L A;  4K8J A;  3HG9 A;  2SOB A;  5DM7 3;  3SXH A;  4N9T A;  4M8A A;  3FVQ A;  2X6G A;  1QCB D;  3HGB A;  2HDL A;  1AN8 A;  2WKC A;  1J9O A;  3NHH A;  4TKO B;  4A3E B;  5C0X H;  3L3O C;  1WTV A;  1HQR D;  3GTO B;  4N9P A;  5EJW A;  2SNS A;  2EOT A;  3MC0 B;  4F88 A;  2VUM B;  2B2W C;  2Y0S B;  1PFB A;  5CYU A;  1SEB D;  3TBI B;  3A7L A;  3EJI A;  1Q12 A;  1D5Z C;  4NKL A;  2LMC B;  2IL8 A;  4WRD A;  4XT3 B;  1TII D;  3T53 B;  1EY5 A;  3GD7 A;  4KN7 C;  1PZI D;  5C44 B;  1AZQ A;  4RCN A;  3U9S A;  2EJF C;  3S16 B;  3GP7 A;  4A3D B;  4C3I B;  2B2U C;  3NWS A;  4TQU S;  4C1N I;  4ZK9 B;  2AWO A;  5J39 A;  3H3V C;  2HQE A;  4P2C B;  2BDN A;  2F0L A;  3D3R A;  5CMD A;  3GTL B;  2F0I A;  3EVQ A;  1PZK D;  1VMC A;  1O7Y A;  2IX3 A;  1TY0 A;  4QB4 A;  4FF4 A;  1C4Q A;  1U4P A;  1H9J A;  2AUK A;  2F0T A;  5I6Y A;  1DZ1 A;  1WD0 A;  3MA2 B;  3R8B A;  3QO2 A;  4BA2 I;  5C0X I;  3I73 A;  2R3Z A;  3KBG A;  3K6O A;  2E2J B;  1HTL D;  3OWF A;  1B50 A;  1STE A;  3M85 A;  3OWE B;  3O13 A;  5E3F A;  2NYZ D;  4C3J B;  2NBF A;  1PYW D;  1F77 A;  2EYL A;  4LMQ D;  5ELF A;  5CBE E;  2KEE A;  2VB3 X;  3NBH A;  1S5C D;  2RSN A;  1CA5 A;  1JWS D;  3FDT A;  4Q5V A;  2BDO A;  3CKI B;  4MN3 A;  1JC7 A;  3IL8 A;  1VF7 A;  5LL6 S;  3J80 E;  3GTG B;  4UDU C;  1GUO A;  1D1I A;  2XN9 C;  3FKI B;  1ML0 D;  4IUV A;  5M3F B;  5JPN C;  5IGD A;  2A69 D;  4RWS C;  1DOL A;  1H9M A;  5ISR A;  5BN3 A;  3V2T A;  2JA7 B;  1ZYR D;  5A2Q L;  2BCO A;  4QF4 A;  1TKW B;  2A6E D;  3HOV B;  4NMZ A;  1JWM D;  3ZYY X;  3PO3 B;  2WAC A;  2J7Z A;  3VR3 A;  1E2Z A;  1DXM A;  4DA2 A;  3NUC A;  2XRS D;  2EPB A;  2JA8 B;  2MHV A;  1SXT A;  3GTQ B;  1I4Q A;  4QUC A;  4OO1 H;  2K7V A;  1CHQ D;  4LAA A;  3GO5 A;  2RVL A;  2G9H D;  1OXT A;  1OXS C;  3C46 A;  4F8M A;  1NSN S;  2KED A;  2F3W A;  2E75 C;  5HGT A;  2F0N A;  3D4W A;  2EJG C;  4BY7 B;  3BVG A;  3MXU A;  5I6W A;  4DFA A;  2X6L A;  4X3S A;  5EBD A;  3QIA A;  3SDZ A;  1DON A;  1Q1B A;  1L0Y B;  3SEB A;  5JEA J;  4K5X A;  4K6D A;  2O4X A;  3M4Y A;  4KKT A;  3NXW A;  4GZY C;  1ZKO A;  3H91 A;  4FVM A;  3CRL C;  1UUP A;  3ND9 A;  1MGS A;  1BF4 A;  2NB0 A;  2F4I A;  1D2B A;  3T13 A;  1EL0 A;  1E0B A;  3P7J A;  5JPM C;  1X3P A;  3DUZ A;  4EGV A;  2L55 A;  5FO7 B;  2NVY B;  1SDF A;  1IKL A;  4DGZ A;  3A54 A;  4QCL A;  4RGT A;  1MSG A;  1WD1 A;  2MUY A;  2RA4 A;  1OXX K;  4FP5 D;  1RCV D;  2EYO A;  2RSO A;  4KY6 A;  2AQ3 B;  1F9S A;  2B2T A;  5DM6 3;  4OO1 I;  1SYC A;  1JB3 A;  1EEF D;  2JXM B;  1GJX A;  1S4Z A;  1BXT A;  1ZYR C;  4A3I B;  1RHP A;  1CT1 D;  4RKB A;  2A6E C;  5JAV A;  3BS1 A;  3Q24 A;  3K5L A;  4HAE A;  4H44 C;  1JOK A;  2FHT A;  1PRT D;  3K5O A;  3NK9 A;  1TT2 A;  2MGS A;  4BS9 A;  3PUV A;  2F0U A;  5J1Z A;  2H4O A;  2RBM A;  5KYI A;  1AFP A;  1R4P B;  1LV9 A;  1JWU D;  2X69 A;  4HN7 A;  2R93 B;  4AYB B;  2K33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...