2FMMA

Crystal structure of emsy-hp1 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
EKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the HP1-EMSY complex reveals an unusual mode of HP1 binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Protein EMSY
total genus 13
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2fmmA00
2Q8RE 4OIJA 1WTVA 2KEDA 2MP1A 2EOTA 1O80A 4RWSC 2DY7A 4RA8A 3F2UA 1M8AA 1RODA 1F9SA 5E4XA 2K03A 2X6GA 1J9OA 4NW2A 5COYA 2Q8TA 3G7LA 3LWEA 2K05A 1B3AA 1RTOA 1CA6A 2B2UA 4RAUC 3HP3A 4XT1B 1NR4A 2KVMA 2B2YA 3I91A 1U4PA 3DEOA 1F9QA 4R9WA 5EKIA 1WTRA 1WVLA 1X3QA 1WD0A 1HHVA 2K28A 4X3TA 1O7YA 2EE1A 2D9UA 1F9RA 3DEPA 1HUNA 1WTOA 2X6LA 2HDLA 2FFKB 2DY8A 2B2VA 3GV3A 3UI2A 3N52A 2N55A 5CBAE 2FHTA 1DOKA 2MGSA 3P7JA 2FINB 3H91A 5T1IA 1JICA 1CA5A 2L1BA 1QE6A 4X3KA 1U4RA 4IUPA 4XT3B 4ZKCB 1ILQA 2B2WC 1S4ZA 1ZXTA 1IKLA 4CJ2C 4LMQD 2NZ1D 1IKMA 1EQTA 3FDTA 5EPKA 1NCVA 2L11A 5T1GA 1JE4A 4HSVA 1RHPA 1XYIA 2HCIA 1G6ZA 3R93A 1ILPA 1BO0A 1EIGA 1DOMA 3MTSA 2RA4A 4MHEA 2KOLA 4XDXA 5AFWA 1HA6A 1U4LA 4UAIA 1VMPA 4HCSA 1EIHA 1ML0D 2HCCA 2B2TC 3MWYW 4O42A 1KNEA 2L4NA 1HUMA 1PFBA 2M2LA 1WTWA 1PFNA 1BBXC 1RTNA 2K1BA 3Q6SA 4ZK9B 3FPUB 5DNFA 2FMMA 2MPMA 2R3ZA 3TZDA 2RVLA 3GV6A 1ESRA 1X3PA 1J8IA 1GUWA 1PLFA 1PDQA 1BNZA 4ZKBB 1X32A 1WTXA 1WTPA 2J7ZA 2L12A 2HUGA 4MN3A 1MSHA 1EOTA 3D6WA 2KECA 1SAPA 2KEEA 5CBEE 2JP1A 4OIKA 2KUMA 4CJ0B 2VXWA 3SVMA 1HFNA 2X69A 1RJTA 1HRJA 2H1EA 4ZLTF 1Q3LA 1QNKA 1B4OA 1HFGA 1MSGA 3TN2A 5JJZA 5EQ0A 4R8IA 1PFMA 4ZAIA 1F9PA 2BDNA 1IL8A 3IFDA 3ONAB 1B2TA 1EL0A 4IUVA 1QG7A 1DZ1A 2B2WA 5EPLA 1WD1A 2L9HA 4QUFA 1WTQA 4CJ1B 1NAPA 1G91A 4DN4M 2RSNA 4IUQA 2EPBA 2SDFA 1ICWA 2K01A 5CMDA 1U4MA 1E0BA 1VMCA 4QUCA 1SDFA 4IUUA 2K04A 2FJ2A 2HDMA 2XIWA 3DM1A 3I8ZA 3IL8A 1XX8A 1BF4A 1G2SA 2N88A 5D65A 2NYZD 1KNAA 3KUPA 2B2VC 1AP0A 1AZQA 5EJWA 1B50A 1SSOA 5EPJA 5D14A 1F2LA 3QO2A 2JYOA 4HAEA 1A15A 4IURA 2RSOA 1C8CA 2B2TA 2MJ8A 1MGSA 1B53A 2B2YC 1DOLA 1O7ZA 1CM9A 4HEDA 1DONA 1NR2A 2B2UC 2CVRA 3I3CA 1AZPA 2NWGA 1MI2A 4IUTA 3I90A 1LV9A 4X3SA 4X3UA 5CORA 2IL8A 1G2TA 4U68A 1TVXA 3KBXA 5E4WC
chains in the Genus database with same CATH superfamily
4JK1C 4RWSC 2VL6A 3NTHA 4BY1H 1F9SA 3RN5A 4FXDA 4HIKA 3G7LA 3RLNA 3OWFA 3OW7A 2JA8B 2MQHA 3A0JA 1TY2A 2EIFA 1NR4A 3DEOA 1QUQB 5IWAL 1WD0A 2YTYA 5F2DA 3SEBA 4DK0A 5NUCA 1CZWA 2K6AA 3H3VC 4JI3Q 2N55A 2UXDL 3M4OB 2MFIA 1VQPA 5M3FH 4BY7B 3NK9A 5H1SE 1VQBA 2KHJA 2Z6KA 1YJ9A 3NTIA 3D6CA 4A3GH 2BDOA 2E2DC 3I55A 3R93A 4RH6A 2R7ZG 2K7VA 4DXFA 4XQJA 3QJYA 5AFWA 1RKNA 2UUAQ 1K28A 1XMQQ 4BBSG 4HCSA 3RZDB 3L3OC 4IFDI 3H6MA 3AFPA 1HR0Q 4IFDG 5C0XG 1KLGD 2AUJD 2K52A 4RG1A 1W6KA 1S5DD 4YWLA 3F8TA 4JOIA 4B9WA 2F4VL 5EBDA 1C4QA 2J7ZA 4JV5Q 1GO3E 1AE3A 2UUCQ 1V9PA 2JA5H 3EN2A 3MXGA 1QJOA 4DUZL 3W2DA 4A3GG 2D5DA 4FF4A 4FVMA 4CBVA 5AJ3L 2R93B 3A8KE 4KKUA 3WDNA 5IGBA 2VB2X 2UXDQ 1J5EL 3HOYB 4A3BH 4HJ5A 4LNQA 2NVQB 1NAPA 4A4IA 4DUYQ 1X55A 3OWEB 1PV4A 1CT1D 2F0IA 1QNUA 2PI2A 3BU2A 4QUCA 1SFOB 4DAMA 1JOQA 3MHBA 4BA2I 4WORA 4I7ZC 2A68D 4FF2A 1MIUA 3DWQA 2NYZD 5C44B 1AP0A 1CZGA 3S24A 1HXYD 1JOOA 3C3LA 3GTKH 2JA6B 1O7ZA 4PZ8A 2LS01 2IHEA 3D4DA 4NKLA 1OTCA 3S16H 3IAYA 2K14A 3CC2A 4YCUA 4K0KL 3S1NH 2RBMA 3HGBA 1CHPD 3K5NA 4KTAA 1YNND 2K03A 1J9OA 4ZUIA 4IFDJ 5GADC 2WB1E 4C3IB 1I3QB 4ZKBB 5FLXE 1HHVA 3PV0A 2JA8H 4FYDA 2BH8A 2D0PA 1JB7A 1JWSD 1STAA 2QW7A 5CV6A 2MGSA 3A7LA 4KD4A 5T1IA 1E22A 1IHZA 2Z0SA 1LTID 1PRTB 4NXMQ 5IYBH 4DF7A 1SNDA 4HIDA 1ZXTA 1IKLA 3MXPA 4LMQD 4IN3A 4JI4Q 1TIID 5EPKA 3QB3A 1L0WA 5FO8B 4L63B 5CGKA 1L0XB 3OMGA 4WJ4A 4LF9L 2JSOA 3RZOH 4RCOA 3CCMA 2Q2IA 4XQNA 2VW9A 2E2JB 2F0LA 3DXJC 2JA8G 5BN4A 4GKJL 4XDXA 4UAIA 3RN2A 4LUZA 1VMPA 1TWHH 2OQ0A 2XTIA 4JI5Q 1TXYA 3VDYA 1EIHA 4DAVA 3TSSA 3GTPH 1KQSA 3T13A 5M3FB 3Q23A 3NEMA 1K8GA 2NVXB 1BOSA 3FMCA 4DV5Q 1QZHA 4IALA 2HUGA 4DK1A 1CQVA 1SE2A 1NMGA 1HR0W 1VQMA 1Q3LA 1YHQA 4ZAIA 3V2TA 3I4MH 3IFDA 3S1RH 1D2BA 3T53B 4A3JB 1V8QA 2NZOA 3VA7A 1HNZQ 3NXWA 1TS2A 3CPFA 2PNHA 1PVOA 1PXUA 2IHFA 1JB3A 1HZ9A 4RGTA 5DM63 1VMCA 1IXRA 3L0OA 4Q5VA 1S5FD 4OHJA 4YY3Q 1R9TB 1PH1A 5D65A 3NENA 4GKJQ 3PO2H 5CV5A 1TQOA 1N36L 3PIP3 1VQ6A 2VB3X 5M5WB 5KRUA 1NR2A 4S3SA 4A3FB 4X3SA 4ABNA 1JOKA 1MKHA 2Z4IA 2F0QA 4JCVE 1E3PA 2MP1A 2OQKA 5IIFA 1LLRD 3BDCA 1CKNB 5IT9c 4KKSA 4NW2A 3HOUG 1TS3A 4RAUC 5CV9A 1K83H 3NBHA 3J80c 3SK6A 3TRZA 1OO9B 5C0XH 2E2HH 3P7JA 3H0GH 3ICEA 4RKBA 4TKOB 4ZKCB 1JMCA 1S4ZA 2LSSA 3FDTA 4L5QA 5C0XI 1I4QA 1MHWC 3S17H 4HIOA 1Q12A 1N34L 1EFWA 1V43A 5IP9H 1GUGA 4DV3L 1YJNA 4UDUC 5IGDA 3RZOB 4H13C 1STHA 1Q1BA 5KNBA 1WOCA 1NE3A 4MTNA 1Y8NB 3WOEA 5BR8Q 3PO3H 2F0NA 1Q81C 3FKIG 1YHAA 1SNQA 2F0MA 3D4RA 2LXJA 2PMZB 2PW7A 5C4JB 3BJUA 1FJGL 1GUWA 4Z9CB 4DV5L 1V1PA 1ENFA 1HNWQ 1SAPA 1KRTA 2CW0D 1VQNA 3HG9A 1ZYRC 2HD3A 4P2CB 1IYJB 4A93G 5IP9G 5FLXc 3M85A 2A6HD 1EOVA 2IWHA 1MJCA 3DLLA 1IYUA 3Q8DA 5JEAG 1B1ZA 5I9PA 2R93G 3CF5A 4R8NA 1VQ9A 2AQ3B 3S1NB 3ITPA 5J3BA 1WD1A 1WTQA 1Y14B 5I4DA 3A55A 5C4ZA 2EPBA 2SDFA 3HOZB 1I6VC 3GTGH 4CDFC 4NXML 1ENCA 4IUUA 3F2CA 3I8ZA 2AMCB 3HS0C 1O78A 5C4XH 5DAUA 4GOPB 2K4KA 2QCPX 2UUBL 1A15A 4HN7A 1PZJD 2MJ8A 1VQ8A 1PRTF 5KYLA 2E74C 2YYZA 1AZPA 1MI2A 1WTHA 3OYYA 5ELOA 2PNRC 4WJ3M 2E5LL 2DGYA 2SNSA 1FNUA 3TREA 1N32L 1IBLQ 2Q8TA 2NVTH 4XQQA 2YTXA 1GXDC 1RTOA 1N32Q 2YU9H 4AYBE 2F3VA 3WWVA 2K28A 2ZXOA 1NBWA 5FO7B 2JA5B 1HUNA 4J1MA 1K73C 3J7AF 3TP7A 4QMGA 5C0XJ 2E75C 5J22A 1EQRA 2OF1A 3S16B 2MO0A 3LNNA 3FRPB 1JR0D 2K5NA 2NN6H 2K75A 1AFPA 1ILQA 1C7YA 1Y8PB 4YY3L 3C2PA 3CC7A 5T1GA 2PMZE 1TS4A 3SK8A 1LT3D 3X3NA 2JK8A 1XYIA 3QR8A 1WI5A 1LT4D 4DV3Q 5KEEA 3T51B 2EXDA 4JBKA 1ML0D 5KGUA 2HIVA 3GTJH 4EQNA 4DV6L 2A68C 3I4NG 3P20A 1VQDA 1WTXA 1KL9A 3J7ZC 2ZJPA 1EYGA 3K7UC 4UHVA 4OIKA 3CQZB 1KDCA 2PW5A 4F87A 1PYWD 2IX3A 2RDFA 1T5XD 1EZ8A 2UUAL 2EYHA 2F3IA 3NP8A 4HJ8A 1SE3A 4GKKL 1HTPA 1EL0A 1C48A 1QG7A 1E2VA 1SRUA 2HQLA 2NVXH 3OPOA 4CJ1B 1UWVA 2RQXA 3AU7A 2WFWA 2PZWA 3A54A 3SGIA 3KLSA 1VQ5A 5I6YA 1EU3A 2R61A 3TEHB 4RHSA 3A56A 4JI7Q 4PQXA 4A93H 2RKSA 2B2VC 5M5YH 5JVH3 3JAMi 1D6EC 3MXUA 4DGZA 2JYOA 4OO1H 1PH6A 4XTCS 1Y1VG 2RHQB 5A2QL 3VR5A 1JT8A 2XN9C 1S5BD 4DFAA 2ICEC 1WTVA 1W3SA 1WYDA 1M4VA 1SNOA 1YITA 4DR7L 2OXPA 3D4WA 1GM5A 3KFUA 1F2MA 3H0GG 3E0JA 4C3IH 1X3EA 1WVLA 1CSQA 2F0OA 1EFID 3MXNB 4WJWA 3E9IA 4QGUA 1EQVA 1Z47A 4NXNL 1TWFH 1CA5A 4MNOA 1NMFA 4EQOA 1H9KA 4A3EB 3PF4A 4KY7A 1PZKD 1C9OA 1XNQL 1FNWA 3HRZC 4B3RL 4L6TB 3U4VA 1SMYD 4C3IG 3BDOA 4X66L 4LF6Q 3KJOA 2R92B 3MWYW 1EU4A 1BBXC 2JE6I 2UUBQ 4OL7A 4DNTB 2R3ZA 5C3EH 2PZUA 2JA7G 1X32A 3LWUA 2A6ED 1Z9FA 2K50A 2KEEA 3PF5A 1E1TA 5CBEE 3E6ZX 3J7YW 4BXXG 1U0LA 3CCSA 1I94L 3STBD 1JCKB 4EX5A 4IPGA 4C56C 4A3EH 1UEAB 2UU9L 1DD2A 1T5EA 5EPLA 2A69C 2IX1A 4A3FG 2Z4HA 5C5LA 1LYLA 2QEJC 5IODA 1GUTA 3PIPA 3CCRA 4GLXA 3KYHC 4IQZA 1BBUA 1LTAD 4JI7L 3VA5A 1XMOQ 2A6EC 1B50A 4IZ8A 5EJWA 2WV6D 1BBWA 3CQZH 4N8X1 1KRSA 1I6HH 1QZGA 4O2DA 3JAMc 4JOIC 1WCMH 3BYTB 3VYTA 2CCZA 1K3RA 1V1PB 2ZT9C 4HJ9A 1GJXA 3U4ZA 3CCEA 1SYEA 4K0KQ 4RKLA 4LK1C 4K14A 1M8AA 2ASBA 4CDDC 2R93H 1N33L 5LMNL 4DPGA 1PH8A 4LUOA 4DR7Q 1M1KC 4DV2L 1U4PA 1PH7A 4A3MG 4KMUC 1X54A 1B7YB 1QOHA 1YBYA 5IGEA 3OIPA 4DNIA 4DV1L 1RD9D 4ID6A 2EY6A 4JYAQ 4X6AH 1GUNA 4B3ML 3VR4A 4ZYSA 1J6QA 4JI2L 3HOWH 1CFMA 4XT3B 3TS2A 2KJXA 1YJWA 4X65L 1PTOD 1IBKQ 2K5HA 3HOXB 2LFNA 2WB1B 1EYDA 5C3EG 1F2ZA 2Y0SE 3EROA 2NVTB 1Q8KA 3MVVA 5FK9C 4G7HC 2EXZA 1BXTA 4O42A 3U9OA 4DV0Q 2M2LA 3KOJA 4YHHQ 1JJGA 1STEA 2MPMA 4DAYB 4L5RC 1VDZA 1X3PA 3KF6A 2KCNA 1ET6A 1XWEA 4MN3A 4AH6A 1MSHA 3CCQA 4UP7A 4J8QA 3IFTA 1Y8OB 2R7DA 5HY6A 1CKOA 3CU7A 4C2MH 3G6JB 3S2HB 3DWAA 1XJVA 1HZAA 1YVCA 1Y1WB 1A8VA 1A0IA 1I94Q 1DCZA 4LF8Q 1A3TA 4IPDA 3ONAB 2PO4A 3BVZA 2UU9Q 3ERQA 2B2WA 3ERSX 2KCMA 1SR3A 4H44C 4GN3B 5CV7A 1HPCA 3H15A 2ZXPA 1CQFA 2RDGA 3N6RA 3PUVA 5E3FA 3STBC 1SDFA 3L2PA 2K04A 1PH3A 4JI8L 4DR4L 4JBMA 2N88A 2NN6I 5CYUA 4A3IB 2XRSD 3T16A 1PYSB 1RCVD 3QO2A 2WAQG 1C8CA 4B3RQ 2C5CA 4DV0L 5FLMH 4K8IA 1L0YB 1DGSA 5BN5A 4A75A 4U68A 4TRDA 1X3FA 5K36G 3FHWA 4QL5A 1STBA 4KV6A 1SE8A 2LMCB 4APVA 1Y1WG 4CDEC 4OX9L 2L15A 4H02A 2I5MX 4GS3A 2AHOB 2BOSA 4JW0A 2ZXRA 2ZTDA 4JI0Q 3DEPA 2VUMH 2B2VA 4OXPA 3GTOB 2JA7B 1Z6HA 4A3BG 3KDFB 1LTBD 2C9OA 4JYAL 5JJKA 3J80i 2UUCL 1JICA 2HIXA 4F8MA 2OWOA 3I4NH 3GO5A 1MD2D 4QF4A 3M7GA 4R4CA 3T4AC 2D2CC 3CHBD 1B44D 4RHRA 2RF4A 3SR1A 3M4QA 4IOCA 1II3A 2EYMA 3TP5A 3V96A 1EIGA 4B3SL 4KN4C 2RA4A 3I4OA 2CH4A 2AQ1B 4BY1G 1XMOL 3JAME 2AKWB 4GLAC 5AJ3Q 2CHBD 2L4NA 4LFBQ 4QCLA 1ESFA 3IRBA 2FMMA 3T1HL 3A74A 4BXXH 4A3FH 1JJ2A 1IW7D 1SNMA 3O13A 1VF5C 2L12A 1EWCA 3BVMA 2BE5D 2KECA 2EZVA 2DJGC 2QEXA 2F0JA 4ALPA 5M5YB 4H0LC 3FP9A 3BS1A 2F0SA 3VYRA 1I5FA 1D8LA 1XPUA 2Q2UA 1XMQL 1PFMA 2O5IC 3EFXD 1EYCA 1DM0B 4C3HB 3CKIB 2O4XA 2VQFL 1U9RA 4DXGA 4BY7H 2TSSA 3GD7A 4CKEA 1IBKL 2F4VQ 5IY0A 2F4IA 2F0PA 4XYOA 2R6GA 1E0BA 4J15A 4JI2Q 3GDEA 3AB9A 5BN3A 3I4MB 3DM1A 1HNXQ 1GD7A 1I4XA 1BF4A 4X65Q 1BCPC 3KUPA 1QWYA 3PUWA 2V1CC 2Z6BA 3CRKC 4ME3A 1FR3A 1SJHD 5IGGA 1VQHA 4DKAC 2B63B 1TWCH 1KABA 4AQYQ 5IE8A 4JBWA 4YCWA 3CPWA 4IO9A 1XPRA 2Z6KC 5C3WA 1ASYA 3SK4A 5KIXA 4N9TA 4A3EG 3LWEA 4CHTB 3CXCA 3E5SA 1XTCD 2KVMA 5M3MG 5K5PA 1K8OA 3MZ5A 2UXCL 3F2BA 3RLFA 4ZRZA 2HHHL 2NBFA 2D9UA 4DV4Q 5JEAJ 3CCUA 1QVFA 4KN7C 5JAVA 4HMIA 4DV4L 1CSPA 5M9OA 1QE6A 1A62A 4X3KA 3QWNA 4QIWB 5JPNC 2EJFC 3AYHB 4R1JA 3CP0A 3FKIH 1VQ7A 1EYAA 3QOLA 3E9HA 3HKZE 3AEVA 4X66Q 3S2HH 1SLJA 4C2MB 3M4YA 2R7ZH 3MTSA 2UXBL 2QDBA 4V0BA 4OELB 1VS0A 3J81j 5M5XB 1PFNA 1I4HA 3HOUH 4IOAA 4A3LH 1DJRD 1C0AA 2K5WA 2QKIC 3J7AV 2EY5A 2RVLA 3GV6A 2RDHA 1D5MC 1TWHB 4TQUS 5GAEC 1B8AA 3SE0A 2KENA 2XSCA 4H7BA 3D3RA 5C3XA 1KHIA 1MSGA 3RD4A 3NUCA 5DEHA 3TN2A 3HOXH 1DYQA 4LF6L 4BS9A 4JI5L 5IYCH 1F9PA 1IL8A 3LGJA 3CD6A 1LT5D 4CKCA 4K8JA 4FXKC 4IUVA 2F0VA 2XGTA 4OWXB 4DK3C 4OWTB 5I9OA 4GOPC 3VYSA 2PQEA 1RL2A 4WRDA 4A3DG 2DN8A 1PH4A 2VNUD 3HOYH 3PUXA 5LHY1 1FYCA 4C3HH 4QJFA 1VQIA 3BZCA 2FJ2A 2SOBA 4WFN3 1VQKA 5HGQA 3MEFA 1CI3M 2EJGC 1NJIC 3KLRA 1CKMA 5FJ8G 4NPSA 3CMAA 4N9PA 3EQLC 1F2LA 4OONA 4IURA 5TSSA 4BBSH 3K57A 1RF2D 3P75A 4LF7Q 3A5ZB 1D1KA 2CVRA 3KF6B 1WCMB 4PMCA 1HZBA 3KBXA 1IYVA 1NUCA 5E4WC 1KXLA 2K5DA 3T1HQ 1CKNA 2EQSA 4LW1A 1KAWA 1JE5A 4KK7A 4LAAA 1TWAH 5IOCA 2A19A 3TS0A 1F9QA 5FJ8H 3RNUA 2CQOA 2VZAA 2EYPA 5KNCA 2CKZB 1BKBA 2HDLA 4L8JA 2DY8A 1EIFA 4DAPA 2VQEL 4X64Q 3I4NB 3J81i 1DOKA 2CW0C 4JI1L 4UPAA 3FEWX 5EBCA 3R8BA 1IKMA 1NCVA 2B29A 1EWHA 1HJPA 3FPPA 1LO5D 4YIJA 1YHBA 3TBIB 1HNWL 1QVCA 5C4XG 4NP5A 3HKZG 4GZYC 4KLKA 5K36H 4LF7L 2B2TC 1VQGA 2CWAA 3EIVA 3GTLB 5DLQE 2L0CA 2E8GA 1EY4A 4HSPA 5GROA 2I46A 3NQTA 5JPMC 1JWUD 3UDFA 4O0AA 1J8IA 1MJEA 1PDQA 4DUYL 1WTPA 2K5QA 5FKAC 3PO3B 1VQAA 5CC4A 4A3IH 3CC4A 1UE7A 4DR1L 2VXWA 2HHHQ 1RJTA 1FD7D 4B08A 1HQRD 2KCTA 2NN6G 5ELBA 3MAQA 2EJMA 3V05A 4C3HG 4F7XA 1D5XC 2VQEQ 1DZ1A 2QA4A 4FNFA 4LF4L 1GHJA 5IYBG 1G291 1JORA 1PTOB 3ULJA 4DR6L 2XWBB 3H94A 3VR3A 1Q46A 1YEZA 5JJLA 2J4XA 1W6JA 2H4OA 2Q2HA 4FO2A 1B9MA 4LF5Q 4HAEA 2PZTA 2VUMG 1S5CD 2V4DA 1YNXA 3OIQA 1DONA 3S1QB 1OXUA 3RUZA 2JN4A 2NWGA 3VR2A 3A8IE 4BBRH 4TSSA 1G2TA 5ELCA 3H09A 3HOYG 1QCBD 4KHZA 4IPHA 3OTOQ 2K32A 2EOTA 4A3JG 5ELNA 4PNYA 2WP8J 1K8MA 2X6GA 4JI8Q 2L5TA 4A93B 2G9DA 1CA6A 1ZYRD 5ELEA 1H9JA 3HOVB 1TWAB 2A1AA 1O7YA 4IUNA 2XWJB 2L55A 1L1OA 3BYYB 3AQQA 2FFKB 4DV1Q 3K80C 1FNVA 2F0WA 1D1IA 2FHTA 3K0YA 4C3JG 4FDBA 1HR0L 2I07B 1Y69U 3QOJA 3U50C 4K5XA 1BDOA 3ZJYC 1KAAA 4A3JH 1Q7YC 3I72A 4LFCQ 4UY8C 1RHPA 4GOPA 1Q90A 3R2IA 2E2IB 4GKKQ 4FF3A 3TDQA 1KDBA 1HA6A 1HH2P 1YNJC 1HTLD 2WAQE 3PMFA 3A7AB 1H9SA 3HFZB 3Q6SA 4ULLA 3BZKA 3TZDA 4A3DH 4PMWA 4C1NI 2BH2A 3NHHA 2JA6H 1VQFA 1PA6A 3MFYA 4M8AA 5C44H 3KLWA 3URYA 2X69A 1Z7TA 4BWGB 4JI6L 4DNRB 1QNKA 3TP8A 2UXCQ 1O7IA 1EY8A 1TT2A 4A3CH 5JEAH 2BDNA 5C4HA 1K9MC 2LXKA 3NELA 4AYBB 4ZCKA 5BR8L 3T56B 4XYQA 3F1ZA 4A3BB 4LJZC 2ALYB 1G91A 2ZTEA 3NTKA 1ICWA 2K33A 1ZEQX 1SE4A 4LFCL 2RCFA 3RMHA 4DR6Q 3IKJA 4DR4Q 1HZCA 1I50B 1TR5A 4C3JB 1UE5A 2Y0SB 5J39A 1STNA 4A3KB 1QB5D 3EBEA 3S14H 1MGSA 3PIOA 3S1MB 2WB1G 3D31A 3RLOA 1A3UA 2NB0A 1SBBB 3I4LA 1AH9A 1KLUD 1E7ZA 2R92H 2KEDA 4GLVB 3OTOL 1O80A 4LF9Q 2EYJA 1BR9A 2DY7A 1ENAA 2ATWA 1RODA 2Y0SG 1HNXL 4IFDH 4F88A 1NSNS 1CHQD 2F1MA 4BA1I 5HGTA 3G71A 1WTRA 2B39A 2EDGA 2O2LD 4RGMA 1Q1EA 1IL2A 5LL6X 2QF7A 1F9RA 2K5VA 1PZID 4LF4Q 4KHPL 1SXTA 2NZHA 3OMCA 3MEHA 3Q22A 4YCVA 4A3LG 1V1QA 4E6IA 3PUYA 2H5XA 4CKBA 4YWKA 3E3XA 2B2WC 3M3YH 1R4PB 2E2HB 4CJ2C 4OO1G 2NZ1D 4RCNA 2F0DA 2KHIA 1CUKA 2VY3A 5CV4A 1JJCB 1IBLL 5JOBA 2A69D 4K6LA 2MHVA 2OTLA 3EJIA 2OTJA 1X6OA 2AWOA 1PH5A 5EAYA 1WTWA 4OWWB 1LTLA 1BNZA 1G6PA 1D7QA 5M5WH 2YV5A 4A3CG 4KI0A 3GTMB 5FOBB 3PO2B 1B9NA 2Q8IB 5JVG3 1ZKOA 1L2FA 1A2UA 1KD1C 1EEID 2N8NA 4J6HA 3K0XA 4DV7L 3HOWG 1I4GA 3NQIA 3K59A 2A8VA 3I4MG 3NSWA 1VF7A 2G9HD 1B2TA 3PQIA 1Q8IA 4DR5L 2HQEA 3W1GA 3GP7A 1VQOA 4DA2A 4QUFA 1NTGA 1N36Q 3I2ZA 4BBRB 4DR3L 1V1OA 3G6EA 1MBYA 1EY7A 2A74C 2CQAA 5E7NA 1UEBA 2EY1A 1SYBA 1TWGB 2I5LX 2HDMA 1BCPD 1SJED 5D3IB 1KNAA 4HIMA 1TWGH 1SSOA 2SEBD 4C1NK 3PO2G 5D14A 4JI0L 3UDGA 1UNSA 4ZQ3A 1S72A 4HEDA 3M3YB 3VYUA 1GUSA 2F0KA 2A73B 2EVBA 1IZ6A 2JJQA 3PCOB 4PV1C 2IT1A 1LV9A 3ZYYX 3DMUA 3KDFA 5KYIA 2PI2E 4B9XA 2Q8RE 1D5ZC 4POGA 1TU2B 1VQEA 2ICIA 1N34Q 2DUDA 2CH4W 2NVYB 1PHJA 4G4KA 1H95A 2CWPA 4R4QA 1DXMA 5EKLA 4DV7Q 4KY5A 3DUZA 2GN5A 2PQAB 1LABA 2IPKD 4Q0FA 5GQOA 2JQOA 3K5OA 4P75A 3UI2A 1YI2A 2Z9HA 3KF8B 1PYBA 1SYFA 4ME5A 4DR3Q 4I7AA 4K2KA 2Z8LA 4A76A 4KY6A 1EWIA 1N33Q 4K5WA 5CV8A 1K0SA 2YU9B 3NBHB 4HJAA 1LM0A 4MZ9A 3CW2C 4MHEA 3NPPA 2UXBQ 1SNPA 1YNNC 2CFMA 1XPOA 1CTMA 1G8ZD 5C5MA 2ZTCA 1N9WA 1YIJA 5FLMG 2K1BA 4Y7NB 2LY7A 2VS1A 2JA7H 3ER0A 3GTOH 3JAML 1E2WA 3WOFA 3ND8A 1FGBD 3GTKB 1EY5A 3S9WA 3HOZG 4XIGS 1AE2A 1VCIA 1PH2A 4I65A 4PMBA 1OXTA 2E2JH 4JBJA 2NTSA 3DWPA 3TMEA 1BCPF 1HFGA 2F3WA 4R8IA 1SFOH 4UP9A 3L9AX 1KDAA 1T9HA 3B6YA 5D3DA 2Z1CA 1SNCA 4QIWE 1EY6A 2WACA 3OSOA 1S3OA 1TKWB 1XNRQ 1U4MA 3P1HA 1S5ED 3J81L 3R2TA 3NWTA 5G3LD 5M3MB 1I3QH 2F03A 2YTVA 3MA2B 2E2IH 5C6AA 5EPJA 1Q82C 4QB4A 1EUJA 2PQAA 3CCJA 2DNEA 1WCMG 3HZXA 4DAYA 1J5EQ 3I3CA 2IJ0A 1K8AC 3NE5B 2PPBC 1KIXA 2FMCA 2I0QA 4GN5A 4RA8A 4GN4B 5COYA 2M9VA 3K5LA 4GNXC 4FF1A 3E0EA 2QILA 4XT1B 1EQQA 5I2XA 1OXXK 2NTTA 2NUCA 3UDXA 5ISRA 2EE1A 4LF5L 1U5KA 4XXEA 4DV6Q 1H9RA 3CAMA 3I70A 2F52A 3H91A 2L1BA 3GTJB 3J81E 1TS5A 1FJGQ 1QVGA 4JC0A 3TQYA 4GNXA 3CCVA 1LTRD 3CMEA 1I6HB 4ILWA 1JQYD 2QGQA 2HCIA 2MUYA 1G6ZA 5IYDG 3A5UA 5LL6S 1ILPA 5LMNQ 2KOLA 4MIUA 5EKKA 2ENBA 5EGTA 2WAQB 1BUVT 1P8LA 1HUMA 4P71A 4HMJA 4ZK9B 3MFGA 3FPUB 2B8GA 2BA0A 1ICFB 1SEBD 4RFBA 4JI6Q 3NWSA 1A6XA 4DUZQ 1XNQQ 1PRTC 2KUMA 2A5HA 5G3LF 1R9TH 1X3GA 3J7A5 1STGA 1CK1A 1B4OA 3TP6A 3S15H 3J81c 1BQQT 3X3MA 1LTSD 3PSIA 2SNMA 4LFBL 5KNDA 5C3EB 5FO9B 4NDXA 3SK5A 1SROA 4O1NA 2GVBA 4EQPA 2OT2A 4JG2A 3GTLH 2A6HC 2MO1A 4AQYL 2F0GA 1GOZA 4A3KG 2TMPA 2WINB 2RCNA 2XIWA 1IBML 4EGVA 3C1FA 1ONLA 1M90C 3OHXC 5M3FG 5J1ZA 1AZQA 3FKIB 4HJ7A 4BY1B 3BDLA 3CRLC 2RSOA 1SMXA 3GTQH 1F2YA 4DU9A 3UE1A 1Y1VH 3HOVG 2RHSB 4RMFA 3I90A 3G48A 4X3UA 4PG3A 2IL8A 4LWCA 5A35A 1PMRA 2ID0A 3HOXG 5IP7G 1SMYC 4FXGC 3ULPA 3A8JE 1O7LA 5IT9E 4A3KH 4N8FA 3K7AH 3HKZB 1B3AA 1B3QA 4C3JH 1XTDA 3I91A 1X3QA 4X3TA 2KCCA 3T1YQ 2Q2TA 1UUPA 2IX0A 4YHHL 1LUZA 3DHQA 3BZDB 1U4RA 2FXQA 3LX0A 4KD3A 3BVGA 1FVIA 1L1OC 1EQTA 3KJPA 2JEBI 2L11A 4BBSB 4DK6C 2QDLA 4HSVA 3F2DA 3U58A 1G51A 3KK7A 4X62L 4EVOA 4A3MB 2DNCA 1XNRL 1JWMD 3MXNA 2DJFC 1YNJD 3I56A 3R3OA 4DR2L 2JA6G 3GTGB 4KKTA 3QIAA 4IPCA 2HCCA 2NVYH 1ASZA 1PFBA 4P72A 4Y52H 1GKHA 1TWFB 1X56A 1E24A 4OEMB 5DNFA 1A3VA 3PGZA 1AEXA 3GTQB 4TVAB 3TZUA 3D6WA 2JP1A 1LT6D 1VQLA 3D8GA 4PZ7A 2ES2A 3SVMA 2ZJRA 4K2LA 1HRJA 3UE0A 1K83B 2H1EA 4UP8A 4ZLTF 1K0RA 5IWAQ 5EQ0A 4A3MH 3K8AA 4DR5Q 4YWMA 1QUQA 3D0FA 4B3SQ 2XRQD 1HNZL 3KF8A 1GUOA 4IJHA 2NVQH 1K3BC 5C4JH 2L9HA 4KHVA 2AUKA 3NBIA 1PRTD 2AWNA 2MNAA 3K6OA 2IW3A 4IUQA 3CCLA 2K01A 3Q24A 3SDZA 3I73A 5CR3A 4DV2Q 3H3VH 3MC0B 1PFSA 4R4OA 3Q0AA 3IL8A 2EYFA 2JA9A 4G7ZC 1LTGD 1YZ6A 1E2ZA 1GVPA 4POFA 4KJNA 4JI1Q 1LTTD 1NY4A 1B53A 1DOLA 1PTOC 1AW7A 2B2UC 1UE6A 2P5ZX 1A2TA 4AYBG 3KBGA 4HCEA 5GAHC 1EIYB 3S1QH 4OIJA 2VUMB 5IYCG 3RZDH 2N78A 2F0EA 4IJLA 2OEOA 3F2UA 4A3IG 2PCFB 2KQ3A 2K05A 4G57A 3HP3A 4R9WA 4FP5D 2B2YA 3L7ZC 5EKIA 4A3GB 4RGOS 2ZM6L 5JJIA 4LUVA 3K58A 1WTOA 1EZ6A 2X6LA 2O5JC 1W2BA 1TY0A 3W3AA 1VQ4A 5CBAE 2LKVA 3HOUB 4BY7G 1H9SB 5GAGC 1SYDA 2B63H 3K81C 3PUZA 2IY5B 2PYKA 5IGCA 3GTPB 1HA5A 1JE4A 2R7ZB 2B8FA 4X62Q 2C35B 2F0UA 2JXMB 5C4XB 2D62A 2N3SA 1BO0A 3OOCA 5DM73 1DOMA 4B3TQ 1X9NA 1Q86C 1RIPA 2WKDA 4LFAL 1JC7A 2VQFQ 4U673 3HOWB 4K5VA 4ODGA 1S40A 1PLFA 2B63G 1SYGA 5A2QE 4P73A 3S1RB 4NXNQ 5IGFA 3PO3G 3S14B 3FVQA 5LMNW 3ND9A 1Y1WH 3PIO3 2GA4B 4OO1I 4G7OC 4PZ6A 1I50H 4CDCC 5M3MH 1UE1A 2EY2A 3S2DB 2N49A 1OXSC 1WJJA 3M7NA 4NMZA 5LMUQ 3H3VI 1SN8A 1TWCB 4GNXB 5IYDH 5LMUL 4L5TA 2J0TD 3EA6A 4DN4M 2RSNA 4JI4L 3M9BA 4R4TA 4OX9Q 1HCZA 4RGNA 1XX8A 3U9SA 4EQ5A 3W5OA 1VQCA 1R4QB 2R92G 1LACA 1FL0A 3SXHA 3HOZH 4KJOA 1EY9A 2B2YC 3GQBA 2D0OA 1CM9A 2ZJQA 2JEAI 4A3DB 5CORA 3H0GB 3S1MH 1N8RC 5L37A 1KC8C 1RDPD 4V190 1EY0A 2BCOA 2G5DA 3W1BA 3AFQA 5E4XA 4M1UB 5C44G 2OCEA 2KA7A 2B2UA 2GVAA 1GHKA 1KTKA 2ZM6Q 1HQMC 3J80E 5ELFA 1NNXA 4JI3L 1I4RA 3GV3A 1AN8A 1PH9A 2BE5C 2HT1A 3N52A 3I7FA 3ULLA 2FINB 2XNAC 4JPBW 2XVSA 3C1EA 3RR5A 1E1OA 2F0FA 3HEJA 4IUPA 1EEFD 4OGQC 1A63A 3KLSX 2M00A 1FGUA 2JA5G 2WKCA 3M4PA 5FLXL 1XXGA 1IBMQ 1BCPB 1IW7C 4BBRG 4CGYB 3HOVH 3SHLA 2WIIB 3S17B 3K7AB 1U4LA 4LF8L 1QILA 5E1FA 4B3MQ 1KNEA 4QQBX 1RTNA 1ESRA 4Y7NH 1F77A 4ZUJA 5M5XH 4JV5L 1EOTA 5ELDA 5I6WA 3K5MA 4CJ0B 1HFNA 2F0TA 4JVZA 5IT9L 2KHSA 2BA1A 5JJZA 2KBNA 2F0HA 1X65A 1ET9A 1I4PA 1PTOH 3QG1A 2R7FA 1PTOF 3T1YL 4HR7B 3BG3A 1P16A 1UAPA 2EYOA 3JC66 1B70B 1WFQA 2EYLA 4P74A 1H9MA 4K6DA 2E76C 5IP7H 2E5LQ 3C46A 4DR1Q 1OXVA 5CMDA 3S2DH 1STYA 3J80L 4MTKA 1SYCA 5HURA 4AIMA 4L5SA 3DM3A 3HKSA 3OW2A 2AQ2B 1G2SA 3S15B 2I5HA 3EVQA 4QY7A 1VQJA 4KHPQ 3GTMH 3VR6A 4DR2Q 3UDIA 5I2YA 2B3GA 4B3TL 2B2TA 1L1OB 4NB3A 4X64L 4HTHA 4LFAQ 4R4IA 4IUTA 3M4OH 3G4SA 1Y1VB 1BVSA 1TVXA 3AMUA
chains in the Genus database with same CATH topology
4JK1C 4RWSC 3NTHA 1F9SA 4FXDA 3G7LA 3OWFA 3OW7A 2JA8B 1TY2A 1NR4A 3DEOA 1WD0A 5F2DA 3SEBA 4DK0A 5NUCA 1CZWA 2K6AA 3H3VC 2N55A 3M4OB 4BY7B 3NK9A 3NTIA 3D6CA 2BDOA 2E2DC 3R93A 4RH6A 2K7VA 4DXFA 4XQJA 3QJYA 5AFWA 1RKNA 4HCSA 3RZDB 3L3OC 4IFDI 3H6MA 4IFDG 5C0XG 1KLGD 2AUJD 1W6KA 1S5DD 4B9WA 5EBDA 1C4QA 2J7ZA 3MXGA 1QJOA 3W2DA 2D5DA 4FF4A 4FVMA 4CBVA 2R93B 3A8KE 4KKUA 3WDNA 5IGBA 2VB2X 3HOYB 2NVQB 1NAPA 3OWEB 1CT1D 2F0IA 1QNUA 4QUCA 1SFOB 1JOQA 3MHBA 4BA2I 4WORA 4I7ZC 2A68D 4FF2A 3DWQA 2NYZD 5C44B 1AP0A 1CZGA 1HXYD 1JOOA 3C3LA 2JA6B 1O7ZA 2LS01 3D4DA 4NKLA 3IAYA 2RBMA 3HGBA 1CHPD 3K5NA 4KTAA 1YNND 2K03A 1J9OA 4ZUIA 4IFDJ 4C3IB 1I3QB 4ZKBB 5FLXE 1HHVA 3PV0A 4FYDA 1JWSD 1STAA 5CV6A 2MGSA 3A7LA 4KD4A 5T1IA 1IHZA 1LTID 1PRTB 4DF7A 1SNDA 1ZXTA 1IKLA 3MXPA 4IN3A 4LMQD 1TIID 5EPKA 3QB3A 5FO8B 4L63B 5CGKA 1L0XB 3OMGA 2JSOA 4RCOA 4XQNA 2E2JB 2F0LA 3DXJC 5BN4A 4XDXA 4UAIA 1VMPA 1EIHA 4DAVA 3TSSA 3T13A 5M3FB 3Q23A 2NVXB 1BOSA 3FMCA 4IALA 2HUGA 4DK1A 1CQVA 1SE2A 1Q3LA 4ZAIA 3V2TA 3IFDA 1D2BA 3T53B 4A3JB 1V8QA 3VA7A 3NXWA 1TS2A 1PXUA 1JB3A 4RGTA 5DM63 1VMCA 4Q5VA 1S5FD 4OHJA 1R9TB 5D65A 5CV5A 1TQOA 3PIP3 2VB3X 5M5WB 5KRUA 1NR2A 4S3SA 4A3FB 4X3SA 4ABNA 1JOKA 2Z4IA 2F0QA 2MP1A 5IIFA 1LLRD 3BDCA 4KKSA 4NW2A 1TS3A 4RAUC 5CV9A 3NBHA 3SK6A 1OO9B 5C0XH 3P7JA 4RKBA 4TKOB 4ZKCB 1S4ZA 3FDTA 5C0XI 1I4QA 1Q12A 1V43A 1GUGA 3RZOB 4UDUC 5IGDA 4H13C 1STHA 1Q1BA 5KNBA 1Y8NB 3WOEA 2F0NA 2F0MA 1SNQA 3D4RA 2PMZB 2PW7A 5C4JB 1GUWA 4Z9CB 1V1PA 1ENFA 1SAPA 2CW0D 3HG9A 1ZYRC 4P2CB 3M85A 2A6HD 2IWHA 1IYUA 5JEAG 1B1ZA 5I9PA 4R8NA 3S1NB 2AQ3B 3ITPA 1WD1A 1WTQA 5I4DA 3A55A 5C4ZA 2EPBA 2SDFA 3HOZB 1I6VC 1ENCA 4IUUA 3I8ZA 3HS0C 1O78A 5DAUA 2QCPX 1A15A 4HN7A 1PZJD 2MJ8A 1PRTF 5KYLA 2E74C 2YYZA 1AZPA 1MI2A 2PNRC 2SNSA 1FNUA 2Q8TA 4XQQA 1GXDC 1RTOA 2F3VA 2K28A 2ZXOA 5FO7B 2JA5B 1HUNA 4J1MA 3J7AF 3TP7A 4QMGA 5C0XJ 2E75C 5J22A 2OF1A 3S16B 3LNNA 3FRPB 1JR0D 2NN6H 1AFPA 1ILQA 1Y8PB 3C2PA 5T1GA 1TS4A 3SK8A 1LT3D 3X3NA 1XYIA 1LT4D 5KEEA 3T51B 1ML0D 5KGUA 4EQNA 2A68C 3P20A 1WTXA 4OIKA 3CQZB 1KDCA 2PW5A 4F87A 1PYWD 2IX3A 2RDFA 1T5XD 1EZ8A 2EYHA 3NP8A 1SE3A 1HTPA 1EL0A 1C48A 1QG7A 1E2VA 3OPOA 4CJ1B 2RQXA 3AU7A 3A54A 2PZWA 3KLSA 5I6YA 1EU3A 2R61A 4RHSA 3A56A 4PQXA 2RKSA 2B2VC 5JVH3 1D6EC 3MXUA 4DGZA 2JYOA 4OO1H 4XTCS 5A2QL 3VR5A 2XN9C 1S5BD 4DFAA 2ICEC 1WTVA 1M4VA 1SNOA 2OXPA 3D4WA 1F2MA 3E0JA 1WVLA 2F0OA 1EFID 4WJWA 1EQVA 1Z47A 1CA5A 4EQOA 1H9KA 4A3EB 4KY7A 1PZKD 1FNWA 3HRZC 4L6TB 1SMYD 4C3IG 3BDOA 2R92B 3MWYW 1EU4A 1BBXC 2JE6I 4OL7A 4DNTB 2R3ZA 2PZUA 1X32A 3LWUA 2A6ED 2KEEA 5CBEE 3E6ZX 3J7YW 1JCKB 4C56C 1DD2A 1UEAB 1T5EA 5EPLA 2A69C 2IX1A 2Z4HA 5C5LA 2QEJC 5IODA 1GUTA 4IQZA 1LTAD 3VA5A 2A6EC 1B50A 4IZ8A 5EJWA 2WV6D 3BYTB 3VYTA 1V1PB 2ZT9C 1GJXA 1SYEA 4RKLA 4LK1C 4K14A 1M8AA 1U4PA 4KMUC 1QOHA 5IGEA 3OIPA 1RD9D 4ID6A 2EY6A 1GUNA 3VR4A 4ZYSA 1CFMA 4XT3B 2KJXA 1PTOD 3HOXB 2LFNA 2WB1B 1EYDA 1F2ZA 3EROA 2NVTB 3MVVA 5FK9C 4G7HC 2EXZA 1BXTA 4O42A 3U9OA 2M2LA 1STEA 2MPMA 1VDZA 1X3PA 2KCNA 1ET6A 1XWEA 4MN3A 1MSHA 4J8QA 3IFTA 1Y8OB 3CU7A 3G6JB 3S2HB 3DWAA 1Y1WB 1DCZA 1A3TA 3ONAB 2PO4A 3BVZA 3ERQA 2B2WA 4H44C 5CV7A 1HPCA 2ZXPA 1CQFA 2RDGA 3N6RA 3PUVA 5E3FA 1SDFA 2K04A 2N88A 2NN6I 5CYUA 4A3IB 2XRSD 3T16A 1RCVD 3QO2A 1C8CA 2C5CA 4K8IA 1L0YB 5BN5A 4U68A 4TRDA 5K36G 1STBA 4KV6A 2LMCB 2BOSA 2ZXRA 3DEPA 2B2VA 3GTOB 2JA7B 1Z6HA 1LTBD 2C9OA 1JICA 4F8MA 3GO5A 1MD2D 4QF4A 3M7GA 3T4AC 2D2CC 3CHBD 1B44D 4RHRA 3SR1A 1II3A 2EYMA 3TP5A 3V96A 1EIGA 4KN4C 2RA4A 2AQ1B 3JAME 2CHBD 2L4NA 4QCLA 1ESFA 2FMMA 1IW7D 1SNMA 3O13A 1VF5C 2L12A 1EWCA 3BVMA 2BE5D 2KECA 2EZVA 2F0JA 5M5YB 4H0LC 3BS1A 2F0SA 3VYRA 2O5IC 1PFMA 3EFXD 1EYCA 1DM0B 4C3HB 3CKIB 2O4XA 1U9RA 4DXGA 2TSSA 3GD7A 4CKEA 2F4IA 2F0PA 4XYOA 2R6GA 1E0BA 3AB9A 5BN3A 3I4MB 3DM1A 1I4XA 1BF4A 1BCPC 3KUPA 1QWYA 3PUWA 3CRKC 1SJHD 5IGGA 1FR3A 2B63B 1KABA 4JBWA 5C3WA 3SK4A 5KIXA 4N9TA 3LWEA 4CHTB 3E5SA 1XTCD 2KVMA 5K5PA 1K8OA 3MZ5A 3RLFA 4ZRZA 2NBFA 2D9UA 5JEAJ 4KN7C 5JAVA 4HMIA 5M9OA 1QE6A 4X3KA 3QWNA 4QIWB 5JPNC 2EJFC 1EYAA 3QOLA 4C2MB 3M4YA 3MTSA 2QDBA 4V0BA 5M5XB 1PFNA 1I4HA 1DJRD 2K5WA 2QKIC 3J7AV 2EY5A 2RVLA 3GV6A 2RDHA 1D5MC 1TWHB 4TQUS 3SE0A 2XSCA 4H7BA 3D3RA 5C3XA 3RD4A 1MSGA 3NUCA 5DEHA 3TN2A 1DYQA 4BS9A 1F9PA 1IL8A 1LT5D 4CKCA 4K8JA 4FXKC 4IUVA 2F0VA 5I9OA 3VYSA 2PQEA 4WRDA 2DN8A 2VNUD 3PUXA 5LHY1 1FYCA 2FJ2A 2SOBA 4WFN3 1CI3M 2EJGC 3KLRA 4N9PA 3EQLC 1F2LA 4IURA 5TSSA 3K57A 1RF2D 3P75A 1D1KA 2CVRA 1WCMB 4PMCA 3KBXA 1IYVA 5E4WC 1NUCA 2K5DA 4KK7A 4LAAA 5IOCA 1F9QA 2EYPA 5KNCA 2HDLA 4L8JA 2DY8A 4DAPA 3I4NB 1DOKA 2CW0C 3FEWX 5EBCA 3R8BA 1IKMA 1NCVA 1EWHA 3FPPA 1LO5D 4YIJA 3TBIB 4NP5A 4GZYC 5K36H 2B2TC 3GTLB 2L0CA 4HSPA 1EY4A 2I46A 3NQTA 5JPMC 1JWUD 1J8IA 1PDQA 1WTPA 2K5QA 5FKAC 3PO3B 5CC4A 2VXWA 1RJTA 1FD7D 4B08A 1HQRD 2NN6G 5ELBA 3MAQA 2EJMA 3V05A 4C3HG 4F7XA 1D5XC 1DZ1A 4FNFA 1GHJA 1G291 1JORA 1PTOB 2XWBB 3H94A 3VR3A 2J4XA 1W6JA 2H4OA 4FO2A 1B9MA 4HAEA 2PZTA 1S5CD 2V4DA 3OIQA 1DONA 3S1QB 1OXUA 3RUZA 2NWGA 3VR2A 3A8IE 4TSSA 1G2TA 5ELCA 3H09A 1QCBD 4KHZA 2K32A 2EOTA 4PNYA 2WP8J 1K8MA 2X6GA 2L5TA 4A93B 2G9DA 1CA6A 1ZYRD 5ELEA 1H9JA 3HOVB 1TWAB 1O7YA 4IUNA 2XWJB 2L55A 3BYYB 2FFKB 1FNVA 2F0WA 1D1IA 2FHTA 3K0YA 4C3JG 2I07B 1Y69U 3QOJA 4K5XA 1BDOA 1KAAA 3I72A 1RHPA 1Q90A 3R2IA 2E2IB 4FF3A 3TDQA 1KDBA 1HA6A 1YNJC 1HTLD 3PMFA 3A7AB 1H9SA 3Q6SA 4ULLA 3TZDA 4PMWA 4C1NI 3NHHA 3MFYA 4M8AA 3URYA 2X69A 1Z7TA 4BWGB 4DNRB 1QNKA 3TP8A 1EY8A 1TT2A 5JEAH 2BDNA 5C4HA 4AYBB 3T56B 4XYQA 4A3BB 4LJZC 1G91A 3NTKA 1ICWA 2K33A 1ZEQX 1SE4A 3RMHA 3IKJA 1I50B 1TR5A 4C3JB 2Y0SB 5J39A 1STNA 4A3KB 1QB5D 1MGSA 3S1MB 3D31A 1A3UA 2NB0A 1SBBB 3I4LA 1KLUD 2KEDA 1O80A 2EYJA 1BR9A 2DY7A 1ENAA 1RODA 4IFDH 4F88A 1NSNS 1CHQD 2F1MA 4BA1I 5HGTA 1WTRA 2B39A 2EDGA 2O2LD 4RGMA 1Q1EA 5LL6X 2QF7A 1F9RA 1PZID 1SXTA 3OMCA 3MEHA 3Q22A 4E6IA 3PUYA 4CKBA 2E2HB 2B2WC 1R4PB 4CJ2C 4OO1G 2NZ1D 4RCNA 2F0DA 5CV4A 5JOBA 2A69D 4K6LA 2MHVA 3EJIA 2AWOA 1WTWA 1BNZA 4KI0A 3GTMB 5FOBB 3PO2B 1B9NA 2Q8IB 5JVG3 1ZKOA 1A2UA 1EEID 4J6HA 1I4GA 3NQIA 3K59A 3NSWA 1VF7A 2G9HD 1B2TA 1Q8IA 2HQEA 3GP7A 4DA2A 4QUFA 4BBRB 1V1OA 1MBYA 1EY7A 2A74C 2CQAA 2EY1A 1SYBA 1TWGB 2HDMA 1BCPD 1SJED 5D3IB 1KNAA 1SSOA 2SEBD 4C1NK 5D14A 1UNSA 4ZQ3A 4HEDA 3M3YB 3VYUA 1GUSA 2F0KA 2A73B 2EVBA 4PV1C 2IT1A 1LV9A 3ZYYX 3DMUA 5KYIA 4B9XA 2Q8RE 1D5ZC 1TU2B 2ICIA 2NVYB 4G4KA 1DXMA 5EKLA 4KY5A 3DUZA 1LABA 2IPKD 4Q0FA 3K5OA 3UI2A 1SYFA 4ME5A 4K2KA 2Z8LA 4KY6A 4K5WA 5CV8A 2YU9B 4MHEA 3NPPA 1SNPA 1YNNC 1CTMA 1G8ZD 5C5MA 2K1BA 4Y7NB 2LY7A 3JAML 1E2WA 3WOFA 3ND8A 1FGBD 3GTKB 1EY5A 3S9WA 4XIGS 1VCIA 4I65A 4PMBA 1OXTA 2NTSA 3DWPA 3TMEA 1BCPF 1HFGA 2F3WA 4R8IA 3L9AX 1KDAA 5D3DA 2Z1CA 1SNCA 1EY6A 2WACA 3OSOA 1TKWB 1U4MA 3P1HA 1S5ED 3J81L 3R2TA 3NWTA 5G3LD 5M3MB 2F03A 3MA2B 5C6AA 5EPJA 4QB4A 2DNEA 4DAYA 3HZXA 3I3CA 2IJ0A 3NE5B 2PPBC 2FMCA 4RA8A 5COYA 2M9VA 3K5LA 4FF1A 2QILA 4XT1B 5I2XA 1OXXK 2NTTA 2NUCA 5ISRA 2EE1A 4XXEA 1H9RA 3I70A 3H91A 2L1BA 3GTJB 3J81E 1TS5A 1LTRD 1I6HB 4ILWA 1JQYD 2HCIA 2MUYA 1G6ZA 5LL6S 1ILPA 2KOLA 4MIUA 5EKKA 2ENBA 5EGTA 2WAQB 1BUVT 1HUMA 4HMJA 4ZK9B 3MFGA 3FPUB 2B8GA 2BA0A 1SEBD 4RFBA 3NWSA 1A6XA 1PRTC 2KUMA 2A5HA 5G3LF 1STGA 1CK1A 1B4OA 3TP6A 1BQQT 3X3MA 1LTSD 2SNMA 5KNDA 5C3EB 5FO9B 4NDXA 3SK5A 4O1NA 4EQPA 2OT2A 2A6HC 2F0GA 1GOZA 2TMPA 2WINB 2XIWA 4EGVA 3C1FA 1ONLA 3OHXC 5J1ZA 1AZQA 3FKIB 4BY1B 3BDLA 3CRLC 2RSOA 1F2YA 4DU9A 3I90A 4X3UA 2IL8A 5A35A 1PMRA 2ID0A 1SMYC 4FXGC 3A8JE 1O7LA 5IT9E 3HKZB 1B3AA 3I91A 1X3QA 4X3TA 2KCCA 1UUPA 2IX0A 3DHQA 3BZDB 1U4RA 3LX0A 4KD3A 3BVGA 1EQTA 2JEBI 2L11A 4BBSB 4HSVA 3KK7A 4EVOA 4A3MB 2DNCA 1JWMD 3MXNA 1YNJD 3R3OA 3GTGB 4KKTA 3QIAA 2HCCA 1PFBA 1TWFB 5DNFA 1A3VA 1AEXA 3GTQB 3TZUA 3D6WA 2JP1A 1LT6D 3D8GA 3SVMA 1HRJA 4K2LA 1K83B 2H1EA 4ZLTF 5EQ0A 2XRQD 3KF8A 1GUOA 2L9HA 4KHVA 2AUKA 3NBIA 1PRTD 2AWNA 3K6OA 2IW3A 4IUQA 2K01A 3Q24A 3SDZA 3I73A 5CR3A 3MC0B 3Q0AA 3IL8A 2EYFA 4G7ZC 1LTGD 1E2ZA 4KJNA 1LTTD 1B53A 1DOLA 1PTOC 1AW7A 2B2UC 1A2TA 3KBGA 4HCEA 4OIJA 2VUMB 2F0EA 2OEOA 3F2UA 2PCFB 2KQ3A 2K05A 4G57A 3HP3A 4R9WA 4FP5D 2B2YA 3L7ZC 5EKIA 4A3GB 4RGOS 3K58A 1WTOA 1EZ6A 2X6LA 2O5JC 1TY0A 3W3AA 5CBAE 2LKVA 3HOUB 1H9SB 1SYDA 3PUZA 2PYKA 5IGCA 3GTPB 1HA5A 1JE4A 2R7ZB 2B8FA 2F0UA 2JXMB 5C4XB 5DM73 2D62A 3OOCA 1BO0A 1DOMA 2WKDA 1JC7A 4U673 3HOWB 4K5VA 4ODGA 1PLFA 1SYGA 5A2QE 3S1RB 5IGFA 3S14B 3FVQA 3ND9A 3PIO3 2GA4B 4OO1I 4G7OC 2EY2A 3S2DB 1OXSC 3M7NA 4NMZA 1TWCB 2J0TD 3EA6A 4DN4M 2RSNA 1HCZA 4RGNA 1XX8A 3U9SA 1R4QB 1LACA 3SXHA 4KJOA 1EY9A 2B2YC 3GQBA 1CM9A 2JEAI 4A3DB 5CORA 3H0GB 4V190 1RDPD 1EY0A 2BCOA 5E4XA 4M1UB 2KA7A 2B2UA 1GHKA 1KTKA 1HQMC 3J80E 5ELFA 1I4RA 3GV3A 1AN8A 2BE5C 3N52A 2FINB 2XNAC 2XVSA 3C1EA 2F0FA 3HEJA 4IUPA 1EEFD 4OGQC 3KLSX 2M00A 2WKCA 5FLXL 1XXGA 1BCPB 1IW7C 4CGYB 3SHLA 2WIIB 3S17B 3K7AB 1U4LA 1QILA 5E1FA 1KNEA 1RTNA 1ESRA 1F77A 4ZUJA 1EOTA 5ELDA 5I6WA 3K5MA 4CJ0B 1HFNA 2F0TA 5IT9L 2KHSA 2BA1A 5JJZA 2F0HA 1ET9A 1I4PA 1PTOH 3QG1A 1PTOF 4HR7B 3BG3A 1UAPA 2EYOA 2EYLA 1H9MA 4K6DA 2E76C 3C46A 1OXVA 5CMDA 1STYA 3J80L 1SYCA 5HURA 2AQ2B 1G2SA 3S15B 3EVQA 3VR6A 5I2YA 2B2TA 4HTHA 4IUTA 1Y1VB 1TVXA 3AMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8R E;  4OIJ A;  1WTV A;  2KED A;  2MP1 A;  2EOT A;  1O80 A;  4RWS C;  2DY7 A;  4RA8 A;  3F2U A;  1M8A A;  1ROD A;  1F9S A;  5E4X A;  2K03 A;  2X6G A;  1J9O A;  4NW2 A;  5COY A;  2Q8T A;  3G7L A;  3LWE A;  2K05 A;  1B3A A;  1RTO A;  1CA6 A;  2B2U A;  4RAU C;  3HP3 A;  4XT1 B;  1NR4 A;  2KVM A;  2B2Y A;  3I91 A;  1U4P A;  3DEO A;  1F9Q A;  4R9W A;  5EKI A;  1WTR A;  1WVL A;  1X3Q A;  1WD0 A;  1HHV A;  2K28 A;  4X3T A;  1O7Y A;  2EE1 A;  2D9U A;  1F9R A;  3DEP A;  1HUN A;  1WTO A;  2X6L A;  2HDL A;  2FFK B;  2DY8 A;  2B2V A;  3GV3 A;  3UI2 A;  3N52 A;  2N55 A;  5CBA E;  2FHT A;  1DOK A;  2MGS A;  3P7J A;  2FIN B;  3H91 A;  5T1I A;  1JIC A;  1CA5 A;  2L1B A;  1QE6 A;  4X3K A;  1U4R A;  4IUP A;  4XT3 B;  4ZKC B;  1ILQ A;  2B2W C;  1S4Z A;  1ZXT A;  1IKL A;  4CJ2 C;  4LMQ D;  2NZ1 D;  1IKM A;  1EQT A;  3FDT A;  5EPK A;  1NCV A;  2L11 A;  5T1G A;  1JE4 A;  4HSV A;  1RHP A;  1XYI A;  2HCI A;  1G6Z A;  3R93 A;  1ILP A;  1BO0 A;  1EIG A;  1DOM A;  3MTS A;  2RA4 A;  4MHE A;  2KOL A;  4XDX A;  5AFW A;  1HA6 A;  1U4L A;  4UAI A;  1VMP A;  4HCS A;  1EIH A;  1ML0 D;  2HCC A;  2B2T C;  3MWY W;  4O42 A;  1KNE A;  2L4N A;  1HUM A;  1PFB A;  2M2L A;  1WTW A;  1PFN A;  1BBX C;  1RTN A;  2K1B A;  3Q6S A;  4ZK9 B;  3FPU B;  5DNF A;  2FMM A;  2MPM A;  2R3Z A;  3TZD A;  2RVL A;  3GV6 A;  1ESR A;  1X3P A;  1J8I A;  1GUW A;  1PLF A;  1PDQ A;  1BNZ A;  4ZKB B;  1X32 A;  1WTX A;  1WTP A;  2J7Z A;  2L12 A;  2HUG A;  4MN3 A;  1MSH A;  1EOT A;  3D6W A;  2KEC A;  1SAP A;  2KEE A;  5CBE E;  2JP1 A;  4OIK A;  2KUM A;  4CJ0 B;  2VXW A;  3SVM A;  1HFN A;  2X69 A;  1RJT A;  1HRJ A;  2H1E A;  4ZLT F;  1Q3L A;  1QNK A;  1B4O A;  1HFG A;  1MSG A;  3TN2 A;  5JJZ A;  5EQ0 A;  4R8I A;  1PFM A;  4ZAI A;  1F9P A;  2BDN A;  1IL8 A;  3IFD A;  3ONA B;  1B2T A;  1EL0 A;  4IUV A;  1QG7 A;  1DZ1 A;  2B2W A;  5EPL A;  1WD1 A;  2L9H A;  4QUF A;  1WTQ A;  4CJ1 B;  1NAP A;  1G91 A;  4DN4 M;  2RSN A;  4IUQ A;  2EPB A;  2SDF A;  1ICW A;  2K01 A;  5CMD A;  1U4M A;  1E0B A;  1VMC A;  4QUC A;  1SDF A;  4IUU A;  2K04 A;  2FJ2 A;  2HDM A;  2XIW A;  3DM1 A;  3I8Z A;  3IL8 A;  1XX8 A;  1BF4 A;  1G2S A;  2N88 A;  5D65 A;  2NYZ D;  1KNA A;  3KUP A;  2B2V C;  1AP0 A;  1AZQ A;  5EJW A;  1B50 A;  1SSO A;  5EPJ A;  5D14 A;  1F2L A;  3QO2 A;  2JYO A;  4HAE A;  1A15 A;  4IUR A;  2RSO A;  1C8C A;  2B2T A;  2MJ8 A;  1MGS A;  1B53 A;  2B2Y C;  1DOL A;  1O7Z A;  1CM9 A;  4HED A;  1DON A;  1NR2 A;  2B2U C;  2CVR A;  3I3C A;  1AZP A;  2NWG A;  1MI2 A;  4IUT A;  3I90 A;  1LV9 A;  4X3S A;  4X3U A;  5COR A;  2IL8 A;  1G2T A;  4U68 A;  1TVX A;  3KBX A;  5E4W C; 
#chains in the Genus database with same CATH topology
 4JK1 C;  4RWS C;  2VL6 A;  3NTH A;  4BY1 H;  1F9S A;  3RN5 A;  4FXD A;  4HIK A;  3G7L A;  3RLN A;  3OWF A;  3OW7 A;  2JA8 B;  2MQH A;  3A0J A;  1TY2 A;  2EIF A;  1NR4 A;  3DEO A;  1QUQ B;  5IWA L;  1WD0 A;  2YTY A;  5F2D A;  3SEB A;  4DK0 A;  5NUC A;  1CZW A;  2K6A A;  3H3V C;  4JI3 Q;  2N55 A;  2UXD L;  3M4O B;  2MFI A;  1VQP A;  5M3F H;  4BY7 B;  3NK9 A;  5H1S E;  1VQB A;  2KHJ A;  2Z6K A;  1YJ9 A;  3NTI A;  3D6C A;  4A3G H;  2BDO A;  2E2D C;  3I55 A;  3R93 A;  4RH6 A;  2R7Z G;  2K7V A;  4DXF A;  4XQJ A;  3QJY A;  5AFW A;  1RKN A;  2UUA Q;  1K28 A;  1XMQ Q;  4BBS G;  4HCS A;  3RZD B;  3L3O C;  4IFD I;  3H6M A;  3AFP A;  1HR0 Q;  4IFD G;  5C0X G;  1KLG D;  2AUJ D;  2K52 A;  4RG1 A;  1W6K A;  1S5D D;  4YWL A;  3F8T A;  4JOI A;  4B9W A;  2F4V L;  5EBD A;  1C4Q A;  2J7Z A;  4JV5 Q;  1GO3 E;  1AE3 A;  2UUC Q;  1V9P A;  2JA5 H;  3EN2 A;  3MXG A;  1QJO A;  4DUZ L;  3W2D A;  4A3G G;  2D5D A;  4FF4 A;  4FVM A;  4CBV A;  5AJ3 L;  2R93 B;  3A8K E;  4KKU A;  3WDN A;  5IGB A;  2VB2 X;  2UXD Q;  1J5E L;  3HOY B;  4A3B H;  4HJ5 A;  4LNQ A;  2NVQ B;  1NAP A;  4A4I A;  4DUY Q;  1X55 A;  3OWE B;  1PV4 A;  1CT1 D;  2F0I A;  1QNU A;  2PI2 A;  3BU2 A;  4QUC A;  1SFO B;  4DAM A;  1JOQ A;  3MHB A;  4BA2 I;  4WOR A;  4I7Z C;  2A68 D;  4FF2 A;  1MIU A;  3DWQ A;  2NYZ D;  5C44 B;  1AP0 A;  1CZG A;  3S24 A;  1HXY D;  1JOO A;  3C3L A;  3GTK H;  2JA6 B;  1O7Z A;  4PZ8 A;  2LS0 1;  2IHE A;  3D4D A;  4NKL A;  1OTC A;  3S16 H;  3IAY A;  2K14 A;  3CC2 A;  4YCU A;  4K0K L;  3S1N H;  2RBM A;  3HGB A;  1CHP D;  3K5N A;  4KTA A;  1YNN D;  2K03 A;  1J9O A;  4ZUI A;  4IFD J;  5GAD C;  2WB1 E;  4C3I B;  1I3Q B;  4ZKB B;  5FLX E;  1HHV A;  3PV0 A;  2JA8 H;  4FYD A;  2BH8 A;  2D0P A;  1JB7 A;  1JWS D;  1STA A;  2QW7 A;  5CV6 A;  2MGS A;  3A7L A;  4KD4 A;  5T1I A;  1E22 A;  1IHZ A;  2Z0S A;  1LTI D;  1PRT B;  4NXM Q;  5IYB H;  4DF7 A;  1SND A;  4HID A;  1ZXT A;  1IKL A;  3MXP A;  4LMQ D;  4IN3 A;  4JI4 Q;  1TII D;  5EPK A;  3QB3 A;  1L0W A;  5FO8 B;  4L63 B;  5CGK A;  1L0X B;  3OMG A;  4WJ4 A;  4LF9 L;  2JSO A;  3RZO H;  4RCO A;  3CCM A;  2Q2I A;  4XQN A;  2VW9 A;  2E2J B;  2F0L A;  3DXJ C;  2JA8 G;  5BN4 A;  4GKJ L;  4XDX A;  4UAI A;  3RN2 A;  4LUZ A;  1VMP A;  1TWH H;  2OQ0 A;  2XTI A;  4JI5 Q;  1TXY A;  3VDY A;  1EIH A;  4DAV A;  3TSS A;  3GTP H;  1KQS A;  3T13 A;  5M3F B;  3Q23 A;  3NEM A;  1K8G A;  2NVX B;  1BOS A;  3FMC A;  4DV5 Q;  1QZH A;  4IAL A;  2HUG A;  4DK1 A;  1CQV A;  1SE2 A;  1NMG A;  1HR0 W;  1VQM A;  1Q3L A;  1YHQ A;  4ZAI A;  3V2T A;  3I4M H;  3IFD A;  3S1R H;  1D2B A;  3T53 B;  4A3J B;  1V8Q A;  2NZO A;  3VA7 A;  1HNZ Q;  3NXW A;  1TS2 A;  3CPF A;  2PNH A;  1PVO A;  1PXU A;  2IHF A;  1JB3 A;  1HZ9 A;  4RGT A;  5DM6 3;  1VMC A;  1IXR A;  3L0O A;  4Q5V A;  1S5F D;  4OHJ A;  4YY3 Q;  1R9T B;  1PH1 A;  5D65 A;  3NEN A;  4GKJ Q;  3PO2 H;  5CV5 A;  1TQO A;  1N36 L;  3PIP 3;  1VQ6 A;  2VB3 X;  5M5W B;  5KRU A;  1NR2 A;  4S3S A;  4A3F B;  4X3S A;  4ABN A;  1JOK A;  1MKH A;  2Z4I A;  2F0Q A;  4JCV E;  1E3P A;  2MP1 A;  2OQK A;  5IIF A;  1LLR D;  3BDC A;  1CKN B;  5IT9 c;  4KKS A;  4NW2 A;  3HOU G;  1TS3 A;  4RAU C;  5CV9 A;  1K83 H;  3NBH A;  3J80 c;  3SK6 A;  3TRZ A;  1OO9 B;  5C0X H;  2E2H H;  3P7J A;  3H0G H;  3ICE A;  4RKB A;  4TKO B;  4ZKC B;  1JMC A;  1S4Z A;  2LSS A;  3FDT A;  4L5Q A;  5C0X I;  1I4Q A;  1MHW C;  3S17 H;  4HIO A;  1Q12 A;  1N34 L;  1EFW A;  1V43 A;  5IP9 H;  1GUG A;  4DV3 L;  1YJN A;  4UDU C;  5IGD A;  3RZO B;  4H13 C;  1STH A;  1Q1B A;  5KNB A;  1WOC A;  1NE3 A;  4MTN A;  1Y8N B;  3WOE A;  5BR8 Q;  3PO3 H;  2F0N A;  1Q81 C;  3FKI G;  1YHA A;  1SNQ A;  2F0M A;  3D4R A;  2LXJ A;  2PMZ B;  2PW7 A;  5C4J B;  3BJU A;  1FJG L;  1GUW A;  4Z9C B;  4DV5 L;  1V1P A;  1ENF A;  1HNW Q;  1SAP A;  1KRT A;  2CW0 D;  1VQN A;  3HG9 A;  1ZYR C;  2HD3 A;  4P2C B;  1IYJ B;  4A93 G;  5IP9 G;  5FLX c;  3M85 A;  2A6H D;  1EOV A;  2IWH A;  1MJC A;  3DLL A;  1IYU A;  3Q8D A;  5JEA G;  1B1Z A;  5I9P A;  2R93 G;  3CF5 A;  4R8N A;  1VQ9 A;  2AQ3 B;  3S1N B;  3ITP A;  5J3B A;  1WD1 A;  1WTQ A;  1Y14 B;  5I4D A;  3A55 A;  5C4Z A;  2EPB A;  2SDF A;  3HOZ B;  1I6V C;  3GTG H;  4CDF C;  4NXM L;  1ENC A;  4IUU A;  3F2C A;  3I8Z A;  2AMC B;  3HS0 C;  1O78 A;  5C4X H;  5DAU A;  4GOP B;  2K4K A;  2QCP X;  2UUB L;  1A15 A;  4HN7 A;  1PZJ D;  2MJ8 A;  1VQ8 A;  1PRT F;  5KYL A;  2E74 C;  2YYZ A;  1AZP A;  1MI2 A;  1WTH A;  3OYY A;  5ELO A;  2PNR C;  4WJ3 M;  2E5L L;  2DGY A;  2SNS A;  1FNU A;  3TRE A;  1N32 L;  1IBL Q;  2Q8T A;  2NVT H;  4XQQ A;  2YTX A;  1GXD C;  1RTO A;  1N32 Q;  2YU9 H;  4AYB E;  2F3V A;  3WWV A;  2K28 A;  2ZXO A;  1NBW A;  5FO7 B;  2JA5 B;  1HUN A;  4J1M A;  1K73 C;  3J7A F;  3TP7 A;  4QMG A;  5C0X J;  2E75 C;  5J22 A;  1EQR A;  2OF1 A;  3S16 B;  2MO0 A;  3LNN A;  3FRP B;  1JR0 D;  2K5N A;  2NN6 H;  2K75 A;  1AFP A;  1ILQ A;  1C7Y A;  1Y8P B;  4YY3 L;  3C2P A;  3CC7 A;  5T1G A;  2PMZ E;  1TS4 A;  3SK8 A;  1LT3 D;  3X3N A;  2JK8 A;  1XYI A;  3QR8 A;  1WI5 A;  1LT4 D;  4DV3 Q;  5KEE A;  3T51 B;  2EXD A;  4JBK A;  1ML0 D;  5KGU A;  2HIV A;  3GTJ H;  4EQN A;  4DV6 L;  2A68 C;  3I4N G;  3P20 A;  1VQD A;  1WTX A;  1KL9 A;  3J7Z C;  2ZJP A;  1EYG A;  3K7U C;  4UHV A;  4OIK A;  3CQZ B;  1KDC A;  2PW5 A;  4F87 A;  1PYW D;  2IX3 A;  2RDF A;  1T5X D;  1EZ8 A;  2UUA L;  2EYH A;  2F3I A;  3NP8 A;  4HJ8 A;  1SE3 A;  4GKK L;  1HTP A;  1EL0 A;  1C48 A;  1QG7 A;  1E2V A;  1SRU A;  2HQL A;  2NVX H;  3OPO A;  4CJ1 B;  1UWV A;  2RQX A;  3AU7 A;  2WFW A;  2PZW A;  3A54 A;  3SGI A;  3KLS A;  1VQ5 A;  5I6Y A;  1EU3 A;  2R61 A;  3TEH B;  4RHS A;  3A56 A;  4JI7 Q;  4PQX A;  4A93 H;  2RKS A;  2B2V C;  5M5Y H;  5JVH 3;  3JAM i;  1D6E C;  3MXU A;  4DGZ A;  2JYO A;  4OO1 H;  1PH6 A;  4XTC S;  1Y1V G;  2RHQ B;  5A2Q L;  3VR5 A;  1JT8 A;  2XN9 C;  1S5B D;  4DFA A;  2ICE C;  1WTV A;  1W3S A;  1WYD A;  1M4V A;  1SNO A;  1YIT A;  4DR7 L;  2OXP A;  3D4W A;  1GM5 A;  3KFU A;  1F2M A;  3H0G G;  3E0J A;  4C3I H;  1X3E A;  1WVL A;  1CSQ A;  2F0O A;  1EFI D;  3MXN B;  4WJW A;  3E9I A;  4QGU A;  1EQV A;  1Z47 A;  4NXN L;  1TWF H;  1CA5 A;  4MNO A;  1NMF A;  4EQO A;  1H9K A;  4A3E B;  3PF4 A;  4KY7 A;  1PZK D;  1C9O A;  1XNQ L;  1FNW A;  3HRZ C;  4B3R L;  4L6T B;  3U4V A;  1SMY D;  4C3I G;  3BDO A;  4X66 L;  4LF6 Q;  3KJO A;  2R92 B;  3MWY W;  1EU4 A;  1BBX C;  2JE6 I;  2UUB Q;  4OL7 A;  4DNT B;  2R3Z A;  5C3E H;  2PZU A;  2JA7 G;  1X32 A;  3LWU A;  2A6E D;  1Z9F A;  2K50 A;  2KEE A;  3PF5 A;  1E1T A;  5CBE E;  3E6Z X;  3J7Y W;  4BXX G;  1U0L A;  3CCS A;  1I94 L;  3STB D;  1JCK B;  4EX5 A;  4IPG A;  4C56 C;  4A3E H;  1UEA B;  2UU9 L;  1DD2 A;  1T5E A;  5EPL A;  2A69 C;  2IX1 A;  4A3F G;  2Z4H A;  5C5L A;  1LYL A;  2QEJ C;  5IOD A;  1GUT A;  3PIP A;  3CCR A;  4GLX A;  3KYH C;  4IQZ A;  1BBU A;  1LTA D;  4JI7 L;  3VA5 A;  1XMO Q;  2A6E C;  1B50 A;  4IZ8 A;  5EJW A;  2WV6 D;  1BBW A;  3CQZ H;  4N8X 1;  1KRS A;  1I6H H;  1QZG A;  4O2D A;  3JAM c;  4JOI C;  1WCM H;  3BYT B;  3VYT A;  2CCZ A;  1K3R A;  1V1P B;  2ZT9 C;  4HJ9 A;  1GJX A;  3U4Z A;  3CCE A;  1SYE A;  4K0K Q;  4RKL A;  4LK1 C;  4K14 A;  1M8A A;  2ASB A;  4CDD C;  2R93 H;  1N33 L;  5LMN L;  4DPG A;  1PH8 A;  4LUO A;  4DR7 Q;  1M1K C;  4DV2 L;  1U4P A;  1PH7 A;  4A3M G;  4KMU C;  1X54 A;  1B7Y B;  1QOH A;  1YBY A;  5IGE A;  3OIP A;  4DNI A;  4DV1 L;  1RD9 D;  4ID6 A;  2EY6 A;  4JYA Q;  4X6A H;  1GUN A;  4B3M L;  3VR4 A;  4ZYS A;  1J6Q A;  4JI2 L;  3HOW H;  1CFM A;  4XT3 B;  3TS2 A;  2KJX A;  1YJW A;  4X65 L;  1PTO D;  1IBK Q;  2K5H A;  3HOX B;  2LFN A;  2WB1 B;  1EYD A;  5C3E G;  1F2Z A;  2Y0S E;  3ERO A;  2NVT B;  1Q8K A;  3MVV A;  5FK9 C;  4G7H C;  2EXZ A;  1BXT A;  4O42 A;  3U9O A;  4DV0 Q;  2M2L A;  3KOJ A;  4YHH Q;  1JJG A;  1STE A;  2MPM A;  4DAY B;  4L5R C;  1VDZ A;  1X3P A;  3KF6 A;  2KCN A;  1ET6 A;  1XWE A;  4MN3 A;  4AH6 A;  1MSH A;  3CCQ A;  4UP7 A;  4J8Q A;  3IFT A;  1Y8O B;  2R7D A;  5HY6 A;  1CKO A;  3CU7 A;  4C2M H;  3G6J B;  3S2H B;  3DWA A;  1XJV A;  1HZA A;  1YVC A;  1Y1W B;  1A8V A;  1A0I A;  1I94 Q;  1DCZ A;  4LF8 Q;  1A3T A;  4IPD A;  3ONA B;  2PO4 A;  3BVZ A;  2UU9 Q;  3ERQ A;  2B2W A;  3ERS X;  2KCM A;  1SR3 A;  4H44 C;  4GN3 B;  5CV7 A;  1HPC A;  3H15 A;  2ZXP A;  1CQF A;  2RDG A;  3N6R A;  3PUV A;  5E3F A;  3STB C;  1SDF A;  3L2P A;  2K04 A;  1PH3 A;  4JI8 L;  4DR4 L;  4JBM A;  2N88 A;  2NN6 I;  5CYU A;  4A3I B;  2XRS D;  3T16 A;  1PYS B;  1RCV D;  3QO2 A;  2WAQ G;  1C8C A;  4B3R Q;  2C5C A;  4DV0 L;  5FLM H;  4K8I A;  1L0Y B;  1DGS A;  5BN5 A;  4A75 A;  4U68 A;  4TRD A;  1X3F A;  5K36 G;  3FHW A;  4QL5 A;  1STB A;  4KV6 A;  1SE8 A;  2LMC B;  4APV A;  1Y1W G;  4CDE C;  4OX9 L;  2L15 A;  4H02 A;  2I5M X;  4GS3 A;  2AHO B;  2BOS A;  4JW0 A;  2ZXR A;  2ZTD A;  4JI0 Q;  3DEP A;  2VUM H;  2B2V A;  4OXP A;  3GTO B;  2JA7 B;  1Z6H A;  4A3B G;  3KDF B;  1LTB D;  2C9O A;  4JYA L;  5JJK A;  3J80 i;  2UUC L;  1JIC A;  2HIX A;  4F8M A;  2OWO A;  3I4N H;  3GO5 A;  1MD2 D;  4QF4 A;  3M7G A;  4R4C A;  3T4A C;  2D2C C;  3CHB D;  1B44 D;  4RHR A;  2RF4 A;  3SR1 A;  3M4Q A;  4IOC A;  1II3 A;  2EYM A;  3TP5 A;  3V96 A;  1EIG A;  4B3S L;  4KN4 C;  2RA4 A;  3I4O A;  2CH4 A;  2AQ1 B;  4BY1 G;  1XMO L;  3JAM E;  2AKW B;  4GLA C;  5AJ3 Q;  2CHB D;  2L4N A;  4LFB Q;  4QCL A;  1ESF A;  3IRB A;  2FMM A;  3T1H L;  3A74 A;  4BXX H;  4A3F H;  1JJ2 A;  1IW7 D;  1SNM A;  3O13 A;  1VF5 C;  2L12 A;  1EWC A;  3BVM A;  2BE5 D;  2KEC A;  2EZV A;  2DJG C;  2QEX A;  2F0J A;  4ALP A;  5M5Y B;  4H0L C;  3FP9 A;  3BS1 A;  2F0S A;  3VYR A;  1I5F A;  1D8L A;  1XPU A;  2Q2U A;  1XMQ L;  1PFM A;  2O5I C;  3EFX D;  1EYC A;  1DM0 B;  4C3H B;  3CKI B;  2O4X A;  2VQF L;  1U9R A;  4DXG A;  4BY7 H;  2TSS A;  3GD7 A;  4CKE A;  1IBK L;  2F4V Q;  5IY0 A;  2F4I A;  2F0P A;  4XYO A;  2R6G A;  1E0B A;  4J15 A;  4JI2 Q;  3GDE A;  3AB9 A;  5BN3 A;  3I4M B;  3DM1 A;  1HNX Q;  1GD7 A;  1I4X A;  1BF4 A;  4X65 Q;  1BCP C;  3KUP A;  1QWY A;  3PUW A;  2V1C C;  2Z6B A;  3CRK C;  4ME3 A;  1FR3 A;  1SJH D;  5IGG A;  1VQH A;  4DKA C;  2B63 B;  1TWC H;  1KAB A;  4AQY Q;  5IE8 A;  4JBW A;  4YCW A;  3CPW A;  4IO9 A;  1XPR A;  2Z6K C;  5C3W A;  1ASY A;  3SK4 A;  5KIX A;  4N9T A;  4A3E G;  3LWE A;  4CHT B;  3CXC A;  3E5S A;  1XTC D;  2KVM A;  5M3M G;  5K5P A;  1K8O A;  3MZ5 A;  2UXC L;  3F2B A;  3RLF A;  4ZRZ A;  2HHH L;  2NBF A;  2D9U A;  4DV4 Q;  5JEA J;  3CCU A;  1QVF A;  4KN7 C;  5JAV A;  4HMI A;  4DV4 L;  1CSP A;  5M9O A;  1QE6 A;  1A62 A;  4X3K A;  3QWN A;  4QIW B;  5JPN C;  2EJF C;  3AYH B;  4R1J A;  3CP0 A;  3FKI H;  1VQ7 A;  1EYA A;  3QOL A;  3E9H A;  3HKZ E;  3AEV A;  4X66 Q;  3S2H H;  1SLJ A;  4C2M B;  3M4Y A;  2R7Z H;  3MTS A;  2UXB L;  2QDB A;  4V0B A;  4OEL B;  1VS0 A;  3J81 j;  5M5X B;  1PFN A;  1I4H A;  3HOU H;  4IOA A;  4A3L H;  1DJR D;  1C0A A;  2K5W A;  2QKI C;  3J7A V;  2EY5 A;  2RVL A;  3GV6 A;  2RDH A;  1D5M C;  1TWH B;  4TQU S;  5GAE C;  1B8A A;  3SE0 A;  2KEN A;  2XSC A;  4H7B A;  3D3R A;  5C3X A;  1KHI A;  1MSG A;  3RD4 A;  3NUC A;  5DEH A;  3TN2 A;  3HOX H;  1DYQ A;  4LF6 L;  4BS9 A;  4JI5 L;  5IYC H;  1F9P A;  1IL8 A;  3LGJ A;  3CD6 A;  1LT5 D;  4CKC A;  4K8J A;  4FXK C;  4IUV A;  2F0V A;  2XGT A;  4OWX B;  4DK3 C;  4OWT B;  5I9O A;  4GOP C;  3VYS A;  2PQE A;  1RL2 A;  4WRD A;  4A3D G;  2DN8 A;  1PH4 A;  2VNU D;  3HOY H;  3PUX A;  5LHY 1;  1FYC A;  4C3H H;  4QJF A;  1VQI A;  3BZC A;  2FJ2 A;  2SOB A;  4WFN 3;  1VQK A;  5HGQ A;  3MEF A;  1CI3 M;  2EJG C;  1NJI C;  3KLR A;  1CKM A;  5FJ8 G;  4NPS A;  3CMA A;  4N9P A;  3EQL C;  1F2L A;  4OON A;  4IUR A;  5TSS A;  4BBS H;  3K57 A;  1RF2 D;  3P75 A;  4LF7 Q;  3A5Z B;  1D1K A;  2CVR A;  3KF6 B;  1WCM B;  4PMC A;  1HZB A;  3KBX A;  1IYV A;  1NUC A;  5E4W C;  1KXL A;  2K5D A;  3T1H Q;  1CKN A;  2EQS A;  4LW1 A;  1KAW A;  1JE5 A;  4KK7 A;  4LAA A;  1TWA H;  5IOC A;  2A19 A;  3TS0 A;  1F9Q A;  5FJ8 H;  3RNU A;  2CQO A;  2VZA A;  2EYP A;  5KNC A;  2CKZ B;  1BKB A;  2HDL A;  4L8J A;  2DY8 A;  1EIF A;  4DAP A;  2VQE L;  4X64 Q;  3I4N B;  3J81 i;  1DOK A;  2CW0 C;  4JI1 L;  4UPA A;  3FEW X;  5EBC A;  3R8B A;  1IKM A;  1NCV A;  2B29 A;  1EWH A;  1HJP A;  3FPP A;  1LO5 D;  4YIJ A;  1YHB A;  3TBI B;  1HNW L;  1QVC A;  5C4X G;  4NP5 A;  3HKZ G;  4GZY C;  4KLK A;  5K36 H;  4LF7 L;  2B2T C;  1VQG A;  2CWA A;  3EIV A;  3GTL B;  5DLQ E;  2L0C A;  2E8G A;  1EY4 A;  4HSP A;  5GRO A;  2I46 A;  3NQT A;  5JPM C;  1JWU D;  3UDF A;  4O0A A;  1J8I A;  1MJE A;  1PDQ A;  4DUY L;  1WTP A;  2K5Q A;  5FKA C;  3PO3 B;  1VQA A;  5CC4 A;  4A3I H;  3CC4 A;  1UE7 A;  4DR1 L;  2VXW A;  2HHH Q;  1RJT A;  1FD7 D;  4B08 A;  1HQR D;  2KCT A;  2NN6 G;  5ELB A;  3MAQ A;  2EJM A;  3V05 A;  4C3H G;  4F7X A;  1D5X C;  2VQE Q;  1DZ1 A;  2QA4 A;  4FNF A;  4LF4 L;  1GHJ A;  5IYB G;  1G29 1;  1JOR A;  1PTO B;  3ULJ A;  4DR6 L;  2XWB B;  3H94 A;  3VR3 A;  1Q46 A;  1YEZ A;  5JJL A;  2J4X A;  1W6J A;  2H4O A;  2Q2H A;  4FO2 A;  1B9M A;  4LF5 Q;  4HAE A;  2PZT A;  2VUM G;  1S5C D;  2V4D A;  1YNX A;  3OIQ A;  1DON A;  3S1Q B;  1OXU A;  3RUZ A;  2JN4 A;  2NWG A;  3VR2 A;  3A8I E;  4BBR H;  4TSS A;  1G2T A;  5ELC A;  3H09 A;  3HOY G;  1QCB D;  4KHZ A;  4IPH A;  3OTO Q;  2K32 A;  2EOT A;  4A3J G;  5ELN A;  4PNY A;  2WP8 J;  1K8M A;  2X6G A;  4JI8 Q;  2L5T A;  4A93 B;  2G9D A;  1CA6 A;  1ZYR D;  5ELE A;  1H9J A;  3HOV B;  1TWA B;  2A1A A;  1O7Y A;  4IUN A;  2XWJ B;  2L55 A;  1L1O A;  3BYY B;  3AQQ A;  2FFK B;  4DV1 Q;  3K80 C;  1FNV A;  2F0W A;  1D1I A;  2FHT A;  3K0Y A;  4C3J G;  4FDB A;  1HR0 L;  2I07 B;  1Y69 U;  3QOJ A;  3U50 C;  4K5X A;  1BDO A;  3ZJY C;  1KAA A;  4A3J H;  1Q7Y C;  3I72 A;  4LFC Q;  4UY8 C;  1RHP A;  4GOP A;  1Q90 A;  3R2I A;  2E2I B;  4GKK Q;  4FF3 A;  3TDQ A;  1KDB A;  1HA6 A;  1HH2 P;  1YNJ C;  1HTL D;  2WAQ E;  3PMF A;  3A7A B;  1H9S A;  3HFZ B;  3Q6S A;  4ULL A;  3BZK A;  3TZD A;  4A3D H;  4PMW A;  4C1N I;  2BH2 A;  3NHH A;  2JA6 H;  1VQF A;  1PA6 A;  3MFY A;  4M8A A;  5C44 H;  3KLW A;  3URY A;  2X69 A;  1Z7T A;  4BWG B;  4JI6 L;  4DNR B;  1QNK A;  3TP8 A;  2UXC Q;  1O7I A;  1EY8 A;  1TT2 A;  4A3C H;  5JEA H;  2BDN A;  5C4H A;  1K9M C;  2LXK A;  3NEL A;  4AYB B;  4ZCK A;  5BR8 L;  3T56 B;  4XYQ A;  3F1Z A;  4A3B B;  4LJZ C;  2ALY B;  1G91 A;  2ZTE A;  3NTK A;  1ICW A;  2K33 A;  1ZEQ X;  1SE4 A;  4LFC L;  2RCF A;  3RMH A;  4DR6 Q;  3IKJ A;  4DR4 Q;  1HZC A;  1I50 B;  1TR5 A;  4C3J B;  1UE5 A;  2Y0S B;  5J39 A;  1STN A;  4A3K B;  1QB5 D;  3EBE A;  3S14 H;  1MGS A;  3PIO A;  3S1M B;  2WB1 G;  3D31 A;  3RLO A;  1A3U A;  2NB0 A;  1SBB B;  3I4L A;  1AH9 A;  1KLU D;  1E7Z A;  2R92 H;  2KED A;  4GLV B;  3OTO L;  1O80 A;  4LF9 Q;  2EYJ A;  1BR9 A;  2DY7 A;  1ENA A;  2ATW A;  1ROD A;  2Y0S G;  1HNX L;  4IFD H;  4F88 A;  1NSN S;  1CHQ D;  2F1M A;  4BA1 I;  5HGT A;  3G71 A;  1WTR A;  2B39 A;  2EDG A;  2O2L D;  4RGM A;  1Q1E A;  1IL2 A;  5LL6 X;  2QF7 A;  1F9R A;  2K5V A;  1PZI D;  4LF4 Q;  4KHP L;  1SXT A;  2NZH A;  3OMC A;  3MEH A;  3Q22 A;  4YCV A;  4A3L G;  1V1Q A;  4E6I A;  3PUY A;  2H5X A;  4CKB A;  4YWK A;  3E3X A;  2B2W C;  3M3Y H;  1R4P B;  2E2H B;  4CJ2 C;  4OO1 G;  2NZ1 D;  4RCN A;  2F0D A;  2KHI A;  1CUK A;  2VY3 A;  5CV4 A;  1JJC B;  1IBL L;  5JOB A;  2A69 D;  4K6L A;  2MHV A;  2OTL A;  3EJI A;  2OTJ A;  1X6O A;  2AWO A;  1PH5 A;  5EAY A;  1WTW A;  4OWW B;  1LTL A;  1BNZ A;  1G6P A;  1D7Q A;  5M5W H;  2YV5 A;  4A3C G;  4KI0 A;  3GTM B;  5FOB B;  3PO2 B;  1B9N A;  2Q8I B;  5JVG 3;  1ZKO A;  1L2F A;  1A2U A;  1KD1 C;  1EEI D;  2N8N A;  4J6H A;  3K0X A;  4DV7 L;  3HOW G;  1I4G A;  3NQI A;  3K59 A;  2A8V A;  3I4M G;  3NSW A;  1VF7 A;  2G9H D;  1B2T A;  3PQI A;  1Q8I A;  4DR5 L;  2HQE A;  3W1G A;  3GP7 A;  1VQO A;  4DA2 A;  4QUF A;  1NTG A;  1N36 Q;  3I2Z A;  4BBR B;  4DR3 L;  1V1O A;  3G6E A;  1MBY A;  1EY7 A;  2A74 C;  2CQA A;  5E7N A;  1UEB A;  2EY1 A;  1SYB A;  1TWG B;  2I5L X;  2HDM A;  1BCP D;  1SJE D;  5D3I B;  1KNA A;  4HIM A;  1TWG H;  1SSO A;  2SEB D;  4C1N K;  3PO2 G;  5D14 A;  4JI0 L;  3UDG A;  1UNS A;  4ZQ3 A;  1S72 A;  4HED A;  3M3Y B;  3VYU A;  1GUS A;  2F0K A;  2A73 B;  2EVB A;  1IZ6 A;  2JJQ A;  3PCO B;  4PV1 C;  2IT1 A;  1LV9 A;  3ZYY X;  3DMU A;  3KDF A;  5KYI A;  2PI2 E;  4B9X A;  2Q8R E;  1D5Z C;  4POG A;  1TU2 B;  1VQE A;  2ICI A;  1N34 Q;  2DUD A;  2CH4 W;  2NVY B;  1PHJ A;  4G4K A;  1H95 A;  2CWP A;  4R4Q A;  1DXM A;  5EKL A;  4DV7 Q;  4KY5 A;  3DUZ A;  2GN5 A;  2PQA B;  1LAB A;  2IPK D;  4Q0F A;  5GQO A;  2JQO A;  3K5O A;  4P75 A;  3UI2 A;  1YI2 A;  2Z9H A;  3KF8 B;  1PYB A;  1SYF A;  4ME5 A;  4DR3 Q;  4I7A A;  4K2K A;  2Z8L A;  4A76 A;  4KY6 A;  1EWI A;  1N33 Q;  4K5W A;  5CV8 A;  1K0S A;  2YU9 B;  3NBH B;  4HJA A;  1LM0 A;  4MZ9 A;  3CW2 C;  4MHE A;  3NPP A;  2UXB Q;  1SNP A;  1YNN C;  2CFM A;  1XPO A;  1CTM A;  1G8Z D;  5C5M A;  2ZTC A;  1N9W A;  1YIJ A;  5FLM G;  2K1B A;  4Y7N B;  2LY7 A;  2VS1 A;  2JA7 H;  3ER0 A;  3GTO H;  3JAM L;  1E2W A;  3WOF A;  3ND8 A;  1FGB D;  3GTK B;  1EY5 A;  3S9W A;  3HOZ G;  4XIG S;  1AE2 A;  1VCI A;  1PH2 A;  4I65 A;  4PMB A;  1OXT A;  2E2J H;  4JBJ A;  2NTS A;  3DWP A;  3TME A;  1BCP F;  1HFG A;  2F3W A;  4R8I A;  1SFO H;  4UP9 A;  3L9A X;  1KDA A;  1T9H A;  3B6Y A;  5D3D A;  2Z1C A;  1SNC A;  4QIW E;  1EY6 A;  2WAC A;  3OSO A;  1S3O A;  1TKW B;  1XNR Q;  1U4M A;  3P1H A;  1S5E D;  3J81 L;  3R2T A;  3NWT A;  5G3L D;  5M3M B;  1I3Q H;  2F03 A;  2YTV A;  3MA2 B;  2E2I H;  5C6A A;  5EPJ A;  1Q82 C;  4QB4 A;  1EUJ A;  2PQA A;  3CCJ A;  2DNE A;  1WCM G;  3HZX A;  4DAY A;  1J5E Q;  3I3C A;  2IJ0 A;  1K8A C;  3NE5 B;  2PPB C;  1KIX A;  2FMC A;  2I0Q A;  4GN5 A;  4RA8 A;  4GN4 B;  5COY A;  2M9V A;  3K5L A;  4GNX C;  4FF1 A;  3E0E A;  2QIL A;  4XT1 B;  1EQQ A;  5I2X A;  1OXX K;  2NTT A;  2NUC A;  3UDX A;  5ISR A;  2EE1 A;  4LF5 L;  1U5K A;  4XXE A;  4DV6 Q;  1H9R A;  3CAM A;  3I70 A;  2F52 A;  3H91 A;  2L1B A;  3GTJ B;  3J81 E;  1TS5 A;  1FJG Q;  1QVG A;  4JC0 A;  3TQY A;  4GNX A;  3CCV A;  1LTR D;  3CME A;  1I6H B;  4ILW A;  1JQY D;  2QGQ A;  2HCI A;  2MUY A;  1G6Z A;  5IYD G;  3A5U A;  5LL6 S;  1ILP A;  5LMN Q;  2KOL A;  4MIU A;  5EKK A;  2ENB A;  5EGT A;  2WAQ B;  1BUV T;  1P8L A;  1HUM A;  4P71 A;  4HMJ A;  4ZK9 B;  3MFG A;  3FPU B;  2B8G A;  2BA0 A;  1ICF B;  1SEB D;  4RFB A;  4JI6 Q;  3NWS A;  1A6X A;  4DUZ Q;  1XNQ Q;  1PRT C;  2KUM A;  2A5H A;  5G3L F;  1R9T H;  1X3G A;  3J7A 5;  1STG A;  1CK1 A;  1B4O A;  3TP6 A;  3S15 H;  3J81 c;  1BQQ T;  3X3M A;  1LTS D;  3PSI A;  2SNM A;  4LFB L;  5KND A;  5C3E B;  5FO9 B;  4NDX A;  3SK5 A;  1SRO A;  4O1N A;  2GVB A;  4EQP A;  2OT2 A;  4JG2 A;  3GTL H;  2A6H C;  2MO1 A;  4AQY L;  2F0G A;  1GOZ A;  4A3K G;  2TMP A;  2WIN B;  2RCN A;  2XIW A;  1IBM L;  4EGV A;  3C1F A;  1ONL A;  1M90 C;  3OHX C;  5M3F G;  5J1Z A;  1AZQ A;  3FKI B;  4HJ7 A;  4BY1 B;  3BDL A;  3CRL C;  2RSO A;  1SMX A;  3GTQ H;  1F2Y A;  4DU9 A;  3UE1 A;  1Y1V H;  3HOV G;  2RHS B;  4RMF A;  3I90 A;  3G48 A;  4X3U A;  4PG3 A;  2IL8 A;  4LWC A;  5A35 A;  1PMR A;  2ID0 A;  3HOX G;  5IP7 G;  1SMY C;  4FXG C;  3ULP A;  3A8J E;  1O7L A;  5IT9 E;  4A3K H;  4N8F A;  3K7A H;  3HKZ B;  1B3A A;  1B3Q A;  4C3J H;  1XTD A;  3I91 A;  1X3Q A;  4X3T A;  2KCC A;  3T1Y Q;  2Q2T A;  1UUP A;  2IX0 A;  4YHH L;  1LUZ A;  3DHQ A;  3BZD B;  1U4R A;  2FXQ A;  3LX0 A;  4KD3 A;  3BVG A;  1FVI A;  1L1O C;  1EQT A;  3KJP A;  2JEB I;  2L11 A;  4BBS B;  4DK6 C;  2QDL A;  4HSV A;  3F2D A;  3U58 A;  1G51 A;  3KK7 A;  4X62 L;  4EVO A;  4A3M B;  2DNC A;  1XNR L;  1JWM D;  3MXN A;  2DJF C;  1YNJ D;  3I56 A;  3R3O A;  4DR2 L;  2JA6 G;  3GTG B;  4KKT A;  3QIA A;  4IPC A;  2HCC A;  2NVY H;  1ASZ A;  1PFB A;  4P72 A;  4Y52 H;  1GKH A;  1TWF B;  1X56 A;  1E24 A;  4OEM B;  5DNF A;  1A3V A;  3PGZ A;  1AEX A;  3GTQ B;  4TVA B;  3TZU A;  3D6W A;  2JP1 A;  1LT6 D;  1VQL A;  3D8G A;  4PZ7 A;  2ES2 A;  3SVM A;  2ZJR A;  4K2L A;  1HRJ A;  3UE0 A;  1K83 B;  2H1E A;  4UP8 A;  4ZLT F;  1K0R A;  5IWA Q;  5EQ0 A;  4A3M H;  3K8A A;  4DR5 Q;  4YWM A;  1QUQ A;  3D0F A;  4B3S Q;  2XRQ D;  1HNZ L;  3KF8 A;  1GUO A;  4IJH A;  2NVQ H;  1K3B C;  5C4J H;  2L9H A;  4KHV A;  2AUK A;  3NBI A;  1PRT D;  2AWN A;  2MNA A;  3K6O A;  2IW3 A;  4IUQ A;  3CCL A;  2K01 A;  3Q24 A;  3SDZ A;  3I73 A;  5CR3 A;  4DV2 Q;  3H3V H;  3MC0 B;  1PFS A;  4R4O A;  3Q0A A;  3IL8 A;  2EYF A;  2JA9 A;  4G7Z C;  1LTG D;  1YZ6 A;  1E2Z A;  1GVP A;  4POF A;  4KJN A;  4JI1 Q;  1LTT D;  1NY4 A;  1B53 A;  1DOL A;  1PTO C;  1AW7 A;  2B2U C;  1UE6 A;  2P5Z X;  1A2T A;  4AYB G;  3KBG A;  4HCE A;  5GAH C;  1EIY B;  3S1Q H;  4OIJ A;  2VUM B;  5IYC G;  3RZD H;  2N78 A;  2F0E A;  4IJL A;  2OEO A;  3F2U A;  4A3I G;  2PCF B;  2KQ3 A;  2K05 A;  4G57 A;  3HP3 A;  4R9W A;  4FP5 D;  2B2Y A;  3L7Z C;  5EKI A;  4A3G B;  4RGO S;  2ZM6 L;  5JJI A;  4LUV A;  3K58 A;  1WTO A;  1EZ6 A;  2X6L A;  2O5J C;  1W2B A;  1TY0 A;  3W3A A;  1VQ4 A;  5CBA E;  2LKV A;  3HOU B;  4BY7 G;  1H9S B;  5GAG C;  1SYD A;  2B63 H;  3K81 C;  3PUZ A;  2IY5 B;  2PYK A;  5IGC A;  3GTP B;  1HA5 A;  1JE4 A;  2R7Z B;  2B8F A;  4X62 Q;  2C35 B;  2F0U A;  2JXM B;  5C4X B;  2D62 A;  2N3S A;  1BO0 A;  3OOC A;  5DM7 3;  1DOM A;  4B3T Q;  1X9N A;  1Q86 C;  1RIP A;  2WKD A;  4LFA L;  1JC7 A;  2VQF Q;  4U67 3;  3HOW B;  4K5V A;  4ODG A;  1S40 A;  1PLF A;  2B63 G;  1SYG A;  5A2Q E;  4P73 A;  3S1R B;  4NXN Q;  5IGF A;  3PO3 G;  3S14 B;  3FVQ A;  5LMN W;  3ND9 A;  1Y1W H;  3PIO 3;  2GA4 B;  4OO1 I;  4G7O C;  4PZ6 A;  1I50 H;  4CDC C;  5M3M H;  1UE1 A;  2EY2 A;  3S2D B;  2N49 A;  1OXS C;  1WJJ A;  3M7N A;  4NMZ A;  5LMU Q;  3H3V I;  1SN8 A;  1TWC B;  4GNX B;  5IYD H;  5LMU L;  4L5T A;  2J0T D;  3EA6 A;  4DN4 M;  2RSN A;  4JI4 L;  3M9B A;  4R4T A;  4OX9 Q;  1HCZ A;  4RGN A;  1XX8 A;  3U9S A;  4EQ5 A;  3W5O A;  1VQC A;  1R4Q B;  2R92 G;  1LAC A;  1FL0 A;  3SXH A;  3HOZ H;  4KJO A;  1EY9 A;  2B2Y C;  3GQB A;  2D0O A;  1CM9 A;  2ZJQ A;  2JEA I;  4A3D B;  5COR A;  3H0G B;  3S1M H;  1N8R C;  5L37 A;  1KC8 C;  1RDP D;  4V19 0;  1EY0 A;  2BCO A;  2G5D A;  3W1B A;  3AFQ A;  5E4X A;  4M1U B;  5C44 G;  2OCE A;  2KA7 A;  2B2U A;  2GVA A;  1GHK A;  1KTK A;  2ZM6 Q;  1HQM C;  3J80 E;  5ELF A;  1NNX A;  4JI3 L;  1I4R A;  3GV3 A;  1AN8 A;  1PH9 A;  2BE5 C;  2HT1 A;  3N52 A;  3I7F A;  3ULL A;  2FIN B;  2XNA C;  4JPB W;  2XVS A;  3C1E A;  3RR5 A;  1E1O A;  2F0F A;  3HEJ A;  4IUP A;  1EEF D;  4OGQ C;  1A63 A;  3KLS X;  2M00 A;  1FGU A;  2JA5 G;  2WKC A;  3M4P A;  5FLX L;  1XXG A;  1IBM Q;  1BCP B;  1IW7 C;  4BBR G;  4CGY B;  3HOV H;  3SHL A;  2WII B;  3S17 B;  3K7A B;  1U4L A;  4LF8 L;  1QIL A;  5E1F A;  4B3M Q;  1KNE A;  4QQB X;  1RTN A;  1ESR A;  4Y7N H;  1F77 A;  4ZUJ A;  5M5X H;  4JV5 L;  1EOT A;  5ELD A;  5I6W A;  3K5M A;  4CJ0 B;  1HFN A;  2F0T A;  4JVZ A;  5IT9 L;  2KHS A;  2BA1 A;  5JJZ A;  2KBN A;  2F0H A;  1X65 A;  1ET9 A;  1I4P A;  1PTO H;  3QG1 A;  2R7F A;  1PTO F;  3T1Y L;  4HR7 B;  3BG3 A;  1P16 A;  1UAP A;  2EYO A;  3JC6 6;  1B70 B;  1WFQ A;  2EYL A;  4P74 A;  1H9M A;  4K6D A;  2E76 C;  5IP7 H;  2E5L Q;  3C46 A;  4DR1 Q;  1OXV A;  5CMD A;  3S2D H;  1STY A;  3J80 L;  4MTK A;  1SYC A;  5HUR A;  4AIM A;  4L5S A;  3DM3 A;  3HKS A;  3OW2 A;  2AQ2 B;  1G2S A;  3S15 B;  2I5H A;  3EVQ A;  4QY7 A;  1VQJ A;  4KHP Q;  3GTM H;  3VR6 A;  4DR2 Q;  3UDI A;  5I2Y A;  2B3G A;  4B3T L;  2B2T A;  1L1O B;  4NB3 A;  4X64 L;  4HTH A;  4LFA Q;  4R4I A;  4IUT A;  3M4O H;  3G4S A;  1Y1V B;  1BVS A;  1TVX A;  3AMU A; 
#chains in the Genus database with same CATH homology
 4JK1 C;  4RWS C;  3NTH A;  1F9S A;  4FXD A;  3G7L A;  3OWF A;  3OW7 A;  2JA8 B;  1TY2 A;  1NR4 A;  3DEO A;  1WD0 A;  5F2D A;  3SEB A;  4DK0 A;  5NUC A;  1CZW A;  2K6A A;  3H3V C;  2N55 A;  3M4O B;  4BY7 B;  3NK9 A;  3NTI A;  3D6C A;  2BDO A;  2E2D C;  3R93 A;  4RH6 A;  2K7V A;  4DXF A;  4XQJ A;  3QJY A;  5AFW A;  1RKN A;  4HCS A;  3RZD B;  3L3O C;  4IFD I;  3H6M A;  4IFD G;  5C0X G;  1KLG D;  2AUJ D;  1W6K A;  1S5D D;  4B9W A;  5EBD A;  1C4Q A;  2J7Z A;  3MXG A;  1QJO A;  3W2D A;  2D5D A;  4FF4 A;  4FVM A;  4CBV A;  2R93 B;  3A8K E;  4KKU A;  3WDN A;  5IGB A;  2VB2 X;  3HOY B;  2NVQ B;  1NAP A;  3OWE B;  1CT1 D;  2F0I A;  1QNU A;  4QUC A;  1SFO B;  1JOQ A;  3MHB A;  4BA2 I;  4WOR A;  4I7Z C;  2A68 D;  4FF2 A;  3DWQ A;  2NYZ D;  5C44 B;  1AP0 A;  1CZG A;  1HXY D;  1JOO A;  3C3L A;  2JA6 B;  1O7Z A;  2LS0 1;  3D4D A;  4NKL A;  3IAY A;  2RBM A;  3HGB A;  1CHP D;  3K5N A;  4KTA A;  1YNN D;  2K03 A;  1J9O A;  4ZUI A;  4IFD J;  4C3I B;  1I3Q B;  4ZKB B;  5FLX E;  1HHV A;  3PV0 A;  4FYD A;  1JWS D;  1STA A;  5CV6 A;  2MGS A;  3A7L A;  4KD4 A;  5T1I A;  1IHZ A;  1LTI D;  1PRT B;  4DF7 A;  1SND A;  1ZXT A;  1IKL A;  3MXP A;  4IN3 A;  4LMQ D;  1TII D;  5EPK A;  3QB3 A;  5FO8 B;  4L63 B;  5CGK A;  1L0X B;  3OMG A;  2JSO A;  4RCO A;  4XQN A;  2E2J B;  2F0L A;  3DXJ C;  5BN4 A;  4XDX A;  4UAI A;  1VMP A;  1EIH A;  4DAV A;  3TSS A;  3T13 A;  5M3F B;  3Q23 A;  2NVX B;  1BOS A;  3FMC A;  4IAL A;  2HUG A;  4DK1 A;  1CQV A;  1SE2 A;  1Q3L A;  4ZAI A;  3V2T A;  3IFD A;  1D2B A;  3T53 B;  4A3J B;  1V8Q A;  3VA7 A;  3NXW A;  1TS2 A;  1PXU A;  1JB3 A;  4RGT A;  5DM6 3;  1VMC A;  4Q5V A;  1S5F D;  4OHJ A;  1R9T B;  5D65 A;  5CV5 A;  1TQO A;  3PIP 3;  2VB3 X;  5M5W B;  5KRU A;  1NR2 A;  4S3S A;  4A3F B;  4X3S A;  4ABN A;  1JOK A;  2Z4I A;  2F0Q A;  2MP1 A;  5IIF A;  1LLR D;  3BDC A;  4KKS A;  4NW2 A;  1TS3 A;  4RAU C;  5CV9 A;  3NBH A;  3SK6 A;  1OO9 B;  5C0X H;  3P7J A;  4RKB A;  4TKO B;  4ZKC B;  1S4Z A;  3FDT A;  5C0X I;  1I4Q A;  1Q12 A;  1V43 A;  1GUG A;  3RZO B;  4UDU C;  5IGD A;  4H13 C;  1STH A;  1Q1B A;  5KNB A;  1Y8N B;  3WOE A;  2F0N A;  2F0M A;  1SNQ A;  3D4R A;  2PMZ B;  2PW7 A;  5C4J B;  1GUW A;  4Z9C B;  1V1P A;  1ENF A;  1SAP A;  2CW0 D;  3HG9 A;  1ZYR C;  4P2C B;  3M85 A;  2A6H D;  2IWH A;  1IYU A;  5JEA G;  1B1Z A;  5I9P A;  4R8N A;  3S1N B;  2AQ3 B;  3ITP A;  1WD1 A;  1WTQ A;  5I4D A;  3A55 A;  5C4Z A;  2EPB A;  2SDF A;  3HOZ B;  1I6V C;  1ENC A;  4IUU A;  3I8Z A;  3HS0 C;  1O78 A;  5DAU A;  2QCP X;  1A15 A;  4HN7 A;  1PZJ D;  2MJ8 A;  1PRT F;  5KYL A;  2E74 C;  2YYZ A;  1AZP A;  1MI2 A;  2PNR C;  2SNS A;  1FNU A;  2Q8T A;  4XQQ A;  1GXD C;  1RTO A;  2F3V A;  2K28 A;  2ZXO A;  5FO7 B;  2JA5 B;  1HUN A;  4J1M A;  3J7A F;  3TP7 A;  4QMG A;  5C0X J;  2E75 C;  5J22 A;  2OF1 A;  3S16 B;  3LNN A;  3FRP B;  1JR0 D;  2NN6 H;  1AFP A;  1ILQ A;  1Y8P B;  3C2P A;  5T1G A;  1TS4 A;  3SK8 A;  1LT3 D;  3X3N A;  1XYI A;  1LT4 D;  5KEE A;  3T51 B;  1ML0 D;  5KGU A;  4EQN A;  2A68 C;  3P20 A;  1WTX A;  4OIK A;  3CQZ B;  1KDC A;  2PW5 A;  4F87 A;  1PYW D;  2IX3 A;  2RDF A;  1T5X D;  1EZ8 A;  2EYH A;  3NP8 A;  1SE3 A;  1HTP A;  1EL0 A;  1C48 A;  1QG7 A;  1E2V A;  3OPO A;  4CJ1 B;  2RQX A;  3AU7 A;  3A54 A;  2PZW A;  3KLS A;  5I6Y A;  1EU3 A;  2R61 A;  4RHS A;  3A56 A;  4PQX A;  2RKS A;  2B2V C;  5JVH 3;  1D6E C;  3MXU A;  4DGZ A;  2JYO A;  4OO1 H;  4XTC S;  5A2Q L;  3VR5 A;  2XN9 C;  1S5B D;  4DFA A;  2ICE C;  1WTV A;  1M4V A;  1SNO A;  2OXP A;  3D4W A;  1F2M A;  3E0J A;  1WVL A;  2F0O A;  1EFI D;  4WJW A;  1EQV A;  1Z47 A;  1CA5 A;  4EQO A;  1H9K A;  4A3E B;  4KY7 A;  1PZK D;  1FNW A;  3HRZ C;  4L6T B;  1SMY D;  4C3I G;  3BDO A;  2R92 B;  3MWY W;  1EU4 A;  1BBX C;  2JE6 I;  4OL7 A;  4DNT B;  2R3Z A;  2PZU A;  1X32 A;  3LWU A;  2A6E D;  2KEE A;  5CBE E;  3E6Z X;  3J7Y W;  1JCK B;  4C56 C;  1DD2 A;  1UEA B;  1T5E A;  5EPL A;  2A69 C;  2IX1 A;  2Z4H A;  5C5L A;  2QEJ C;  5IOD A;  1GUT A;  4IQZ A;  1LTA D;  3VA5 A;  2A6E C;  1B50 A;  4IZ8 A;  5EJW A;  2WV6 D;  3BYT B;  3VYT A;  1V1P B;  2ZT9 C;  1GJX A;  1SYE A;  4RKL A;  4LK1 C;  4K14 A;  1M8A A;  1U4P A;  4KMU C;  1QOH A;  5IGE A;  3OIP A;  1RD9 D;  4ID6 A;  2EY6 A;  1GUN A;  3VR4 A;  4ZYS A;  1CFM A;  4XT3 B;  2KJX A;  1PTO D;  3HOX B;  2LFN A;  2WB1 B;  1EYD A;  1F2Z A;  3ERO A;  2NVT B;  3MVV A;  5FK9 C;  4G7H C;  2EXZ A;  1BXT A;  4O42 A;  3U9O A;  2M2L A;  1STE A;  2MPM A;  1VDZ A;  1X3P A;  2KCN A;  1ET6 A;  1XWE A;  4MN3 A;  1MSH A;  4J8Q A;  3IFT A;  1Y8O B;  3CU7 A;  3G6J B;  3S2H B;  3DWA A;  1Y1W B;  1DCZ A;  1A3T A;  3ONA B;  2PO4 A;  3BVZ A;  3ERQ A;  2B2W A;  4H44 C;  5CV7 A;  1HPC A;  2ZXP A;  1CQF A;  2RDG A;  3N6R A;  3PUV A;  5E3F A;  1SDF A;  2K04 A;  2N88 A;  2NN6 I;  5CYU A;  4A3I B;  2XRS D;  3T16 A;  1RCV D;  3QO2 A;  1C8C A;  2C5C A;  4K8I A;  1L0Y B;  5BN5 A;  4U68 A;  4TRD A;  5K36 G;  1STB A;  4KV6 A;  2LMC B;  2BOS A;  2ZXR A;  3DEP A;  2B2V A;  3GTO B;  2JA7 B;  1Z6H A;  1LTB D;  2C9O A;  1JIC A;  4F8M A;  3GO5 A;  1MD2 D;  4QF4 A;  3M7G A;  3T4A C;  2D2C C;  3CHB D;  1B44 D;  4RHR A;  3SR1 A;  1II3 A;  2EYM A;  3TP5 A;  3V96 A;  1EIG A;  4KN4 C;  2RA4 A;  2AQ1 B;  3JAM E;  2CHB D;  2L4N A;  4QCL A;  1ESF A;  2FMM A;  1IW7 D;  1SNM A;  3O13 A;  1VF5 C;  2L12 A;  1EWC A;  3BVM A;  2BE5 D;  2KEC A;  2EZV A;  2F0J A;  5M5Y B;  4H0L C;  3BS1 A;  2F0S A;  3VYR A;  2O5I C;  1PFM A;  3EFX D;  1EYC A;  1DM0 B;  4C3H B;  3CKI B;  2O4X A;  1U9R A;  4DXG A;  2TSS A;  3GD7 A;  4CKE A;  2F4I A;  2F0P A;  4XYO A;  2R6G A;  1E0B A;  3AB9 A;  5BN3 A;  3I4M B;  3DM1 A;  1I4X A;  1BF4 A;  1BCP C;  3KUP A;  1QWY A;  3PUW A;  3CRK C;  1SJH D;  5IGG A;  1FR3 A;  2B63 B;  1KAB A;  4JBW A;  5C3W A;  3SK4 A;  5KIX A;  4N9T A;  3LWE A;  4CHT B;  3E5S A;  1XTC D;  2KVM A;  5K5P A;  1K8O A;  3MZ5 A;  3RLF A;  4ZRZ A;  2NBF A;  2D9U A;  5JEA J;  4KN7 C;  5JAV A;  4HMI A;  5M9O A;  1QE6 A;  4X3K A;  3QWN A;  4QIW B;  5JPN C;  2EJF C;  1EYA A;  3QOL A;  4C2M B;  3M4Y A;  3MTS A;  2QDB A;  4V0B A;  5M5X B;  1PFN A;  1I4H A;  1DJR D;  2K5W A;  2QKI C;  3J7A V;  2EY5 A;  2RVL A;  3GV6 A;  2RDH A;  1D5M C;  1TWH B;  4TQU S;  3SE0 A;  2XSC A;  4H7B A;  3D3R A;  5C3X A;  3RD4 A;  1MSG A;  3NUC A;  5DEH A;  3TN2 A;  1DYQ A;  4BS9 A;  1F9P A;  1IL8 A;  1LT5 D;  4CKC A;  4K8J A;  4FXK C;  4IUV A;  2F0V A;  5I9O A;  3VYS A;  2PQE A;  4WRD A;  2DN8 A;  2VNU D;  3PUX A;  5LHY 1;  1FYC A;  2FJ2 A;  2SOB A;  4WFN 3;  1CI3 M;  2EJG C;  3KLR A;  4N9P A;  3EQL C;  1F2L A;  4IUR A;  5TSS A;  3K57 A;  1RF2 D;  3P75 A;  1D1K A;  2CVR A;  1WCM B;  4PMC A;  3KBX A;  1IYV A;  5E4W C;  1NUC A;  2K5D A;  4KK7 A;  4LAA A;  5IOC A;  1F9Q A;  2EYP A;  5KNC A;  2HDL A;  4L8J A;  2DY8 A;  4DAP A;  3I4N B;  1DOK A;  2CW0 C;  3FEW X;  5EBC A;  3R8B A;  1IKM A;  1NCV A;  1EWH A;  3FPP A;  1LO5 D;  4YIJ A;  3TBI B;  4NP5 A;  4GZY C;  5K36 H;  2B2T C;  3GTL B;  2L0C A;  4HSP A;  1EY4 A;  2I46 A;  3NQT A;  5JPM C;  1JWU D;  1J8I A;  1PDQ A;  1WTP A;  2K5Q A;  5FKA C;  3PO3 B;  5CC4 A;  2VXW A;  1RJT A;  1FD7 D;  4B08 A;  1HQR D;  2NN6 G;  5ELB A;  3MAQ A;  2EJM A;  3V05 A;  4C3H G;  4F7X A;  1D5X C;  1DZ1 A;  4FNF A;  1GHJ A;  1G29 1;  1JOR A;  1PTO B;  2XWB B;  3H94 A;  3VR3 A;  2J4X A;  1W6J A;  2H4O A;  4FO2 A;  1B9M A;  4HAE A;  2PZT A;  1S5C D;  2V4D A;  3OIQ A;  1DON A;  3S1Q B;  1OXU A;  3RUZ A;  2NWG A;  3VR2 A;  3A8I E;  4TSS A;  1G2T A;  5ELC A;  3H09 A;  1QCB D;  4KHZ A;  2K32 A;  2EOT A;  4PNY A;  2WP8 J;  1K8M A;  2X6G A;  2L5T A;  4A93 B;  2G9D A;  1CA6 A;  1ZYR D;  5ELE A;  1H9J A;  3HOV B;  1TWA B;  1O7Y A;  4IUN A;  2XWJ B;  2L55 A;  3BYY B;  2FFK B;  1FNV A;  2F0W A;  1D1I A;  2FHT A;  3K0Y A;  4C3J G;  2I07 B;  1Y69 U;  3QOJ A;  4K5X A;  1BDO A;  1KAA A;  3I72 A;  1RHP A;  1Q90 A;  3R2I A;  2E2I B;  4FF3 A;  3TDQ A;  1KDB A;  1HA6 A;  1YNJ C;  1HTL D;  3PMF A;  3A7A B;  1H9S A;  3Q6S A;  4ULL A;  3TZD A;  4PMW A;  4C1N I;  3NHH A;  3MFY A;  4M8A A;  3URY A;  2X69 A;  1Z7T A;  4BWG B;  4DNR B;  1QNK A;  3TP8 A;  1EY8 A;  1TT2 A;  5JEA H;  2BDN A;  5C4H A;  4AYB B;  3T56 B;  4XYQ A;  4A3B B;  4LJZ C;  1G91 A;  3NTK A;  1ICW A;  2K33 A;  1ZEQ X;  1SE4 A;  3RMH A;  3IKJ A;  1I50 B;  1TR5 A;  4C3J B;  2Y0S B;  5J39 A;  1STN A;  4A3K B;  1QB5 D;  1MGS A;  3S1M B;  3D31 A;  1A3U A;  2NB0 A;  1SBB B;  3I4L A;  1KLU D;  2KED A;  1O80 A;  2EYJ A;  1BR9 A;  2DY7 A;  1ENA A;  1ROD A;  4IFD H;  4F88 A;  1NSN S;  1CHQ D;  2F1M A;  4BA1 I;  5HGT A;  1WTR A;  2B39 A;  2EDG A;  2O2L D;  4RGM A;  1Q1E A;  5LL6 X;  2QF7 A;  1F9R A;  1PZI D;  1SXT A;  3OMC A;  3MEH A;  3Q22 A;  4E6I A;  3PUY A;  4CKB A;  2E2H B;  2B2W C;  1R4P B;  4CJ2 C;  4OO1 G;  2NZ1 D;  4RCN A;  2F0D A;  5CV4 A;  5JOB A;  2A69 D;  4K6L A;  2MHV A;  3EJI A;  2AWO A;  1WTW A;  1BNZ A;  4KI0 A;  3GTM B;  5FOB B;  3PO2 B;  1B9N A;  2Q8I B;  5JVG 3;  1ZKO A;  1A2U A;  1EEI D;  4J6H A;  1I4G A;  3NQI A;  3K59 A;  3NSW A;  1VF7 A;  2G9H D;  1B2T A;  1Q8I A;  2HQE A;  3GP7 A;  4DA2 A;  4QUF A;  4BBR B;  1V1O A;  1MBY A;  1EY7 A;  2A74 C;  2CQA A;  2EY1 A;  1SYB A;  1TWG B;  2HDM A;  1BCP D;  1SJE D;  5D3I B;  1KNA A;  1SSO A;  2SEB D;  4C1N K;  5D14 A;  1UNS A;  4ZQ3 A;  4HED A;  3M3Y B;  3VYU A;  1GUS A;  2F0K A;  2A73 B;  2EVB A;  4PV1 C;  2IT1 A;  1LV9 A;  3ZYY X;  3DMU A;  5KYI A;  4B9X A;  2Q8R E;  1D5Z C;  1TU2 B;  2ICI A;  2NVY B;  4G4K A;  1DXM A;  5EKL A;  4KY5 A;  3DUZ A;  1LAB A;  2IPK D;  4Q0F A;  3K5O A;  3UI2 A;  1SYF A;  4ME5 A;  4K2K A;  2Z8L A;  4KY6 A;  4K5W A;  5CV8 A;  2YU9 B;  4MHE A;  3NPP A;  1SNP A;  1YNN C;  1CTM A;  1G8Z D;  5C5M A;  2K1B A;  4Y7N B;  2LY7 A;  3JAM L;  1E2W A;  3WOF A;  3ND8 A;  1FGB D;  3GTK B;  1EY5 A;  3S9W A;  4XIG S;  1VCI A;  4I65 A;  4PMB A;  1OXT A;  2NTS A;  3DWP A;  3TME A;  1BCP F;  1HFG A;  2F3W A;  4R8I A;  3L9A X;  1KDA A;  5D3D A;  2Z1C A;  1SNC A;  1EY6 A;  2WAC A;  3OSO A;  1TKW B;  1U4M A;  3P1H A;  1S5E D;  3J81 L;  3R2T A;  3NWT A;  5G3L D;  5M3M B;  2F03 A;  3MA2 B;  5C6A A;  5EPJ A;  4QB4 A;  2DNE A;  4DAY A;  3HZX A;  3I3C A;  2IJ0 A;  3NE5 B;  2PPB C;  2FMC A;  4RA8 A;  5COY A;  2M9V A;  3K5L A;  4FF1 A;  2QIL A;  4XT1 B;  5I2X A;  1OXX K;  2NTT A;  2NUC A;  5ISR A;  2EE1 A;  4XXE A;  1H9R A;  3I70 A;  3H91 A;  2L1B A;  3GTJ B;  3J81 E;  1TS5 A;  1LTR D;  1I6H B;  4ILW A;  1JQY D;  2HCI A;  2MUY A;  1G6Z A;  5LL6 S;  1ILP A;  2KOL A;  4MIU A;  5EKK A;  2ENB A;  5EGT A;  2WAQ B;  1BUV T;  1HUM A;  4HMJ A;  4ZK9 B;  3MFG A;  3FPU B;  2B8G A;  2BA0 A;  1SEB D;  4RFB A;  3NWS A;  1A6X A;  1PRT C;  2KUM A;  2A5H A;  5G3L F;  1STG A;  1CK1 A;  1B4O A;  3TP6 A;  1BQQ T;  3X3M A;  1LTS D;  2SNM A;  5KND A;  5C3E B;  5FO9 B;  4NDX A;  3SK5 A;  4O1N A;  4EQP A;  2OT2 A;  2A6H C;  2F0G A;  1GOZ A;  2TMP A;  2WIN B;  2XIW A;  4EGV A;  3C1F A;  1ONL A;  3OHX C;  5J1Z A;  1AZQ A;  3FKI B;  4BY1 B;  3BDL A;  3CRL C;  2RSO A;  1F2Y A;  4DU9 A;  3I90 A;  4X3U A;  2IL8 A;  5A35 A;  1PMR A;  2ID0 A;  1SMY C;  4FXG C;  3A8J E;  1O7L A;  5IT9 E;  3HKZ B;  1B3A A;  3I91 A;  1X3Q A;  4X3T A;  2KCC A;  1UUP A;  2IX0 A;  3DHQ A;  3BZD B;  1U4R A;  3LX0 A;  4KD3 A;  3BVG A;  1EQT A;  2JEB I;  2L11 A;  4BBS B;  4HSV A;  3KK7 A;  4EVO A;  4A3M B;  2DNC A;  1JWM D;  3MXN A;  1YNJ D;  3R3O A;  3GTG B;  4KKT A;  3QIA A;  2HCC A;  1PFB A;  1TWF B;  5DNF A;  1A3V A;  1AEX A;  3GTQ B;  3TZU A;  3D6W A;  2JP1 A;  1LT6 D;  3D8G A;  3SVM A;  1HRJ A;  4K2L A;  1K83 B;  2H1E A;  4ZLT F;  5EQ0 A;  2XRQ D;  3KF8 A;  1GUO A;  2L9H A;  4KHV A;  2AUK A;  3NBI A;  1PRT D;  2AWN A;  3K6O A;  2IW3 A;  4IUQ A;  2K01 A;  3Q24 A;  3SDZ A;  3I73 A;  5CR3 A;  3MC0 B;  3Q0A A;  3IL8 A;  2EYF A;  4G7Z C;  1LTG D;  1E2Z A;  4KJN A;  1LTT D;  1B53 A;  1DOL A;  1PTO C;  1AW7 A;  2B2U C;  1A2T A;  3KBG A;  4HCE A;  4OIJ A;  2VUM B;  2F0E A;  2OEO A;  3F2U A;  2PCF B;  2KQ3 A;  2K05 A;  4G57 A;  3HP3 A;  4R9W A;  4FP5 D;  2B2Y A;  3L7Z C;  5EKI A;  4A3G B;  4RGO S;  3K58 A;  1WTO A;  1EZ6 A;  2X6L A;  2O5J C;  1TY0 A;  3W3A A;  5CBA E;  2LKV A;  3HOU B;  1H9S B;  1SYD A;  3PUZ A;  2PYK A;  5IGC A;  3GTP B;  1HA5 A;  1JE4 A;  2R7Z B;  2B8F A;  2F0U A;  2JXM B;  5C4X B;  5DM7 3;  2D62 A;  3OOC A;  1BO0 A;  1DOM A;  2WKD A;  1JC7 A;  4U67 3;  3HOW B;  4K5V A;  4ODG A;  1PLF A;  1SYG A;  5A2Q E;  3S1R B;  5IGF A;  3S14 B;  3FVQ A;  3ND9 A;  3PIO 3;  2GA4 B;  4OO1 I;  4G7O C;  2EY2 A;  3S2D B;  1OXS C;  3M7N A;  4NMZ A;  1TWC B;  2J0T D;  3EA6 A;  4DN4 M;  2RSN A;  1HCZ A;  4RGN A;  1XX8 A;  3U9S A;  1R4Q B;  1LAC A;  3SXH A;  4KJO A;  1EY9 A;  2B2Y C;  3GQB A;  1CM9 A;  2JEA I;  4A3D B;  5COR A;  3H0G B;  4V19 0;  1RDP D;  1EY0 A;  2BCO A;  5E4X A;  4M1U B;  2KA7 A;  2B2U A;  1GHK A;  1KTK A;  1HQM C;  3J80 E;  5ELF A;  1I4R A;  3GV3 A;  1AN8 A;  2BE5 C;  3N52 A;  2FIN B;  2XNA C;  2XVS A;  3C1E A;  2F0F A;  3HEJ A;  4IUP A;  1EEF D;  4OGQ C;  3KLS X;  2M00 A;  2WKC A;  5FLX L;  1XXG A;  1BCP B;  1IW7 C;  4CGY B;  3SHL A;  2WII B;  3S17 B;  3K7A B;  1U4L A;  1QIL A;  5E1F A;  1KNE A;  1RTN A;  1ESR A;  1F77 A;  4ZUJ A;  1EOT A;  5ELD A;  5I6W A;  3K5M A;  4CJ0 B;  1HFN A;  2F0T A;  5IT9 L;  2KHS A;  2BA1 A;  5JJZ A;  2F0H A;  1ET9 A;  1I4P A;  1PTO H;  3QG1 A;  1PTO F;  4HR7 B;  3BG3 A;  1UAP A;  2EYO A;  2EYL A;  1H9M A;  4K6D A;  2E76 C;  3C46 A;  1OXV A;  5CMD A;  1STY A;  3J80 L;  1SYC A;  5HUR A;  2AQ2 B;  1G2S A;  3S15 B;  3EVQ A;  3VR6 A;  5I2Y A;  2B2T A;  4HTH A;  4IUT A;  1Y1V B;  1TVX A;  3AMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...