2FMMA

Crystal structure of emsy-hp1 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
EKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein EMSY
publication title Crystal structure of the HP1-EMSY complex reveals an unusual mode of HP1 binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 13
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2fmmA00
2X69A 2HDMA 2MJ8A 1HUNA 2KOLA 2KEEA 2L4NA 1WTWA 2JP1A 2B2YC 2EE1A 2FMMA 1QNKA 4IUUA 4CJ0B 1WVLA 1WTRA 1ESRA 3MWYW 2CVRA 2HDLA 3GV6A 4X3SA 1VMCA 3SVMA 1NR2A 1C8CA 1WTOA 1LV9A 2VXWA 3HP3A 1AP0A 1A15A 3G7LA 1U4MA 2NYZD 1M8AA 4X3UA 5EQ0A 4QUCA 2HCCA 3N52A 5T1IA 1G6ZA 4ZAIA 1ML0D 1WTVA 2R3ZA 2IL8A 1HHVA 4ZKBB 1X3QA 3I91A 2NWGA 1DONA 2B2WA 1BBXC 1O80A 1KNEA 1U4PA 5CORA 5EPJA 2X6GA 5AFWA 3TZDA 5CMDA 1B2TA 3IFDA 2NZ1D 1MSGA 1VMPA 5EPLA 4CJ1B 1SAPA 1G2TA 1F9QA 4HSVA 5EKIA 1B53A 3KBXA 3DEPA 4UAIA 1QE6A 1NAPA 4U68A 1MGSA 4CJ2C 1G91A 1HFNA 1EQTA 2RA4A 4RWSC 1DOLA 2KEDA 4X3KA 4NW2A 4MN3A 1G2SA 4RAUC 4OIJA 3P7JA 2M2LA 5JJZA 4R8IA 2RSOA 2K01A 5E4XA 3UI2A 1RTOA 2JYOA 1DOMA 2B2YA 3IL8A 4MHEA 1ICWA 1F2LA 2KUMA 4IUPA 4XDXA 1PFBA 1IKLA 4ZKCB 1PDQA 2D9UA 3I90A 3Q6SA 5DNFA 1J8IA 1WD1A 2B2TC 1PFMA 5CBEE 1X32A 2N55A 1DZ1A 1MI2A 4O42A 1WTQA 3I3CA 2DY8A 1DOKA 1WTXA 4LMQD 2MP1A 4HCSA 2K03A 2MPMA 2K05A 3DEOA 4XT3B 2N88A 3F2UA 1IL8A 4HAEA 1HRJA 1U4LA 3MTSA 1AZQA 1BNZA 1GUWA 1HFGA 2BDNA 2SDFA 2Q8RE 4QUFA 2B2TA 1XYIA 1WD0A 1EIGA 1F9PA 1O7YA 1CM9A 1O7ZA 2FHTA 5EJWA 2L11A 1MSHA 4IURA 1NR4A 5CBAE 1S4ZA 3GV3A 1B50A 2L12A 1CA6A 2J7ZA 1U4RA 4X3TA 2K28A 1RJTA 4R9WA 1CA5A 1ILPA 2B2VC 3ONAB 1SDFA 5COYA 1X3PA 5T1GA 1HA6A 1PFNA 1EIHA 5D14A 2X6LA 2B2UC 1RODA 1KNAA 2HUGA 1ILQA 3TN2A 2MGSA 3D6WA 4OIKA 1RTNA 2H1EA 2B2VA 4IUQA 4DN4M 3DM1A 1B4OA 4ZLTF 1IKMA 1EOTA 2KECA 3FDTA 2FINB 3KUPA 2EOTA 5D65A 1EL0A 2B2UA 1TVXA 1JICA 1B3AA 1F9RA 4XT1B 3FPUB 1HUMA 1Q3LA 2B2WC 1AZPA 1BF4A 1WTPA 3LWEA 3R93A 2L1BA 4ZK9B 2XIWA 2KVMA 3QO2A 5EPKA 2DY7A 2EPBA 1J9OA 1QG7A 1RHPA 4IUVA 1NCVA 1SSOA 1PLFA 2FJ2A 4HEDA 2Q8TA 2FFKB 1F9SA 3I8ZA 2L9HA 2K1BA 3H91A 2RSNA 1ZXTA 4IUTA 2K04A 2RVLA 4RA8A 2HCIA 1E0BA 5E4WC 1JE4A 1XX8A 1BO0A
chains in the Genus database with same CATH superfamily
2A68C 5CV4A 2KCCA 4B3ML 1KLGD 3MVVA 5FLXE 5I9PA 3CD6A 3M85A 4NP5A 1J5EL 1TKWB 1WTOA 1TY2A 4DKAC 1K73C 3SK5A 4X6AH 4V0BA 3OIQA 1M90C 5C3XA 4A3LH 4A3KH 4KMUC 2AWOA 1JJCB 4BY7G 1I6HH 2E2JB 5K36G 4LW1A 1L0YB 2F0TA 1S5FD 4LUOA 4WJ3M 3H0GH 4P2CB 2UUCQ 4NW2A 4BBSH 4C3JH 4JI5L 2K14A 4FVMA 1H9JA 1PYBA 5M5YH 3F2DA 1V43A 4WJWA 5M5XB 4ZKCB 2D9UA 1F2MA 2N49A 3P1HA 3E0JA 1A2TA 1MD2D 5IT9L 2VQFL 3GTLH 5C4XG 3OSOA 1BDOA 1IYJB 4CDCC 4UDUC 3MFGA 5EKKA 2OQ0A 4LK1C 2I5LX 3S15B 4GLAC 5FJ8G 3OW2A 1U4LA 5IOCA 3OMCA 2ZJQA 1EZ6A 4DV5L 1VS0A 1UEBA 2F52A 3QG1A 4UP7A 4GZYC 1B50A 1SBBB 3RN2A 2R93G 5BN3A 3QOLA 4R9WA 1VQ9A 4DV6L 1G8ZD 4JI4L 2NVQB 1ILQA 4YWLA 2WB1B 1SXTA 2QEJC 4IUQA 3OWEB 1I5FA 3DM1A 3T4AC 3OTOL 2H4OA 4DU9A 4DXFA 1N36Q 1TWGB 1F9RA 1G291 3I70A 5G3LF 3U50C 3MC0B 1GOZA 3RD4A 1D2BA 3N6RA 3SK8A 3TBIB 2XN9C 4RH6A 1PH4A 1VQNA 4PZ6A 4DR4L 1STHA 1AFPA 3GTMH 2B29A 3DMUA 4YWMA 3C1EA 3A7AB 2F0JA 2HD3A 1JCKB 1V1OA 5JEAG 4UHVA 3GTJB 2WKCA 1MJEA 1S5ED 2EQSA 2SOBA 4A3FG 1N32L 5HGQA 2YV5A 1YHQA 3GTQH 1HNXL 2VXWA 5C0XJ 5JVH3 2F4VL 1VQBA 2VB3X 1AEXA 3CCLA 4HN7A 1K3BC 4DR5Q 3K7UC 1B70B 4JI6Q 2UUAQ 2B2WA 1PTOF 1FNVA 1UAPA 1SNOA 2CCZA 3G71A 3T51B 3E9HA 4FO2A 3CKIB 3U4ZA 3J81j 1XPRA 4FXGC 1Z6HA 4Y7NH 3KDFB 5KGUA 1Y1VH 1UE5A 2EDGA 3L3OC 4KLKA 2EXDA 5JJZA 2RSOA 2CFMA 1N33L 1YBYA 3S16B 3S1MB 2JYOA 3S9WA 2F0EA 4XDXA 5DNFA 3I90A 4L5TA 2YTXA 1HH2P 4O1NA 3HOYG 1F2YA 3E3XA 1NSNS 5D3IB 1L1OB 5J22A 3S1RB 1HFNA 3T1YL 3S17B 1BOSA 5GAHC 1J5EQ 4DUZL 2EYFA 4C3HG 1BVSA 4A75A 2E8GA 1HQRD 2DGYA 1U4RA 4KD3A 2PZUA 4K0KL 5C44B 3I7FA 3SDZA 4F8MA 1EIHA 1JWUD 3U4VA 2JJQA 3BVMA 3J7AF 1PZID 1RTNA 1SE2A 2N78A 2A6ED 5IYBH 3S2DB 2ASBA 4DAPA 2F0WA 2EOTA 1EYAA 5FKAC 5FLXL 2R92G 3R8BA 3S2HB 1VQ5A 4DAYB 3LWEA 2B63H 4EQOA 2JA8B 3PIOA 4OHJA 1ZKOA 1S3OA 3STBC 2R6GA 2A5HA 2KQ3A 3NELA 1JJGA 3CRLC 2D5DA 5KRUA 1IBLQ 1EQVA 1KLUD 2VUMG 1G51A 1LO5D 5IGDA 3M9BA 3NWTA 1M4VA 3S1QH 1JORA 2X69A 4NDXA 5EBCA 1QWYA 4CJ0B 3MAQA 1VQMA 1D5XC 1YNND 2GN5A 1I50B 4DUYQ 3PGZA 3SEBA 1J6QA 1LV9A 3EROA 1U4MA 1E1TA 1PTOB 4ZAIA 2E5LL 1OTCA 1JOKA 5LL6X 2ICEC 4LAAA 5CV6A 4OWTB 3J7YW 4JI4Q 1UE6A 2Q2UA 3WDNA 5ELOA 3URYA 4A3GG 4UP8A 3TP8A 2EXZA 3HFZB 4R4OA 1W6KA 1NY4A 2H5XA 1X3GA 3HOXH 1RKNA 1LABA 1YNNC 4J8QA 4DV1L 2K01A 2N8NA 4AYBG 2GVBA 4J1MA 4FYDA 5FLMG 4IFDG 5BR8L 3IL8A 4N8FA 4JI2L 3W1GA 2B8GA 2ZT9C 2QEXA 2UUBQ 4DR4Q 2JA7H 2SEBD 1EY8A 4LWCA 4A3DH 1WTXA 2F0PA 1HRJA 5C5MA 2NVTB 2BH8A 4C1NK 4KK7A 1OXVA 1N32Q 4B3SL 2ES2A 1S5DD 4K8JA 1X56A 1PH6A 4GN3B 4GKKL 1B7YB 1DCZA 2A73B 3ONAB 2Z6KC 4N8X1 2RCNA 2X6LA 1CQVA 5M9OA 1WCMG 2F0FA 3ND9A 3KBGA 3Q22A 1K83B 3KJOA 3BDCA 1II3A 3C46A 1NMGA 1L0XB 3E9IA 4NPSA 1HQMC 1ZYRD 2FINB 3GO5A 2F4IA 4AH6A 1F77A 4JYAQ 2WB1G 1N8RC 2EJFC 4P72A 1Q7YC 4DXGA 4LFBQ 3S24A 1NCVA 1PLFA 5M5XH 2O5IC 1PYSB 1Z47A 2E2HH 1DXMA 4GKJL 1K8MA 3IFTA 4IUTA 1XMOQ 4HIDA 2RVLA 4RA8A 4RGOS 3NSWA 3S15H 3LGJA 4BS9A 1B44D 3QJYA 3TEHB 1LT5D 3P75A 4LF8L 5GROA 2VZAA 1ESRA 1ZYRC 3T1YQ 4DK1A 1CSQA 4R4CA 3FPPA 4X3SA 2EY2A 5G3LD 1Q90A 1L1OC 3SVMA 4QMGA 4RHRA 3Q8DA 4RGTA 5FO9B 1OXUA 3L2PA 2ZJRA 2A69D 5ELFA 4K0KQ 3GTKB 1NTGA 3D0FA 1U5KA 2R3ZA 4GN4B 2LFNA 1QUQB 2RF4A 1K28A 1KNEA 3S14B 2K5HA 4CKCA 5L37A 2NN6G 4CJ1B 3H94A 5CC4A 1ESFA 2A6HD 3X3MA 1TWGH 1A62A 4HSVA 5EKIA 1XTDA 2ZXOA 2K6AA 2DNCA 3T56B 3BG3A 4MN3A 4IFDI 1G2SA 2IX1A 1UWVA 4G7ZC 4ULLA 1GJXA 2VQEQ 2IX0A 1RTOA 2HIVA 1SFOH 1PTOD 5JVG3 5HY6A 5NUCA 4B9WA 2AQ2B 2IHEA 3PV0A 4ILWA 2JA6B 1STBA 3I3CA 4S3SA 2EYJA 3NXWA 4OL7A 2K32A 3HOWG 3NWSA 1EY4A 5JJLA 4HAEA 1STAA 4OGQC 4XXEA 4Q5VA 4B3RL 3A74A 1XJVA 5EJWA 1O7ZA 1STEA 3OIPA 4KI0A 4LFCQ 1V1QA 3NTIA 1PH3A 1C48A 1TIID 3F1ZA 1KRSA 5COYA 2E5LQ 2Z6BA 4DR1Q 2B2UC 2LXJA 1VQEA 1PTOC 5FK9C 4L5RC 4IPHA 2NBFA 1JC7A 3D6WA 5M3FG 4ID6A 3I4NG 2KHSA 5C3WA 2KECA 5I6WA 2N3SA 2B39A 3K5MA 4JI1Q 2F1MA 2AMCB 5TSSA 2L1BA 4LF7L 4A3BB 4DV1Q 3GTQB 1Y69U 4JBKA 3HOVB 1RHPA 1WJJA 1NJIC 4QQBX 2I5MX 5KNCA 1IL2A 3CCEA 3I8ZA 4BBRB 1KHIA 4AQYQ 2JA8G 2EYOA 1S5BD 2QKIC 3I4OA 2NTTA 1QOHA 2B2YC 3S17H 4E6IA 3M7NA 2K7VA 2OXPA 2GVAA 3J81c 1SMYD 2UUCL 4B3SQ 5LMNW 1VMCA 1Y1VB 1AH9A 1EFID 5KYLA 2F0DA 2JE6I 3ERQA 1AP0A 1QZHA 3IKJA 1BCPF 5EQ0A 5C44H 2M9VA 4PNYA 4Q0FA 1HHVA 2NN6I 2PYKA 4K8IA 1Q8KA 4X65Q 3IFDA 4PMBA 1UE7A 3S2DH 2SNSA 4CGYB 5JJIA 5A2QL 3QB3A 4IPGA 4ZRZA 2F0LA 1E2ZA 1EY6A 3VYTA 5JEAJ 3S2HH 3KF8A 4RWSC 1SMYC 3HOZB 4BWGB 2Z9HA 1DOMA 5GAEC 4CDFC 3AFQA 1A63A 3A7LA 1L1OA 3KLRA 2IX3A 1MI2A 3DUZA 3A8KE 4JK1C 4A3IG 3HOUG 1SJED 4IPDA 3BU2A 5JOBA 5ISRA 1XPUA 3W3AA 2NZOA 2NZHA 2UXCQ 2LS01 4YHHQ 1N36L 1FGBD 2K5WA 5BN5A 1O7LA 2ID0A 1VQOA 1I50H 2J0TD 3K59A 4HIMA 3NE5B 3G48A 4DGZA 4X64L 3CPWA 1VQPA 2CHBD 1PTOH 2ATWA 2YTVA 5D14A 3TP5A 2AHOB 5ELBA 1SR3A 1A3VA 3VR4A 3JAME 4ZLTF 3PUZA 4DAYA 4QIWE 3KUPA 4ZYSA 1JOQA 1HUMA 1NNXA 4NXNQ 2AKWB 2JQOA 3BDOA 4HEDA 3I4MB 4DR5L 2FXQA 3V05A 4V190 2UUAL 1ZXTA 2JA9A 1SJHD 1X6OA 4LUVA 5CV7A 2MUYA 4BXXH 4Z9CB 1CFMA 2MJ8A 2NVTH 1KXLA 4A3LG 2XTIA 1WVLA 3MEHA 4A3KG 1R4PB 3NP8A 1BCPB 2I0QA 3M4YA 5JPNC 2UXDL 3G7LA 1YITA 1CKOA 1M8AA 2ALYB 3KF6B 2RDHA 2GA4B 1KL9A 1ML0D 1E1OA 1X3QA 2JEBI 3H0GG 5CV9A 1EWCA 1EU3A 3RNUA 1K83H 1LTSD 4BBSG 4WJ4A 4C3JG 1PH2A 1B2TA 4EX5A 1ET9A 2JA7B 1SYBA 4A3DB 2QCPX 2B8FA 2BH2A 4OELB 4JI7L 3DWQA 3GTOB 2C9OA 5C3EB 2BOSA 2BA1A 3HKZG 2OQKA 3PCOB 1E7ZA 1VQLA 4X3KA 2DN8A 4ZUJA 4OIJA 5IGBA 1FYCA 1SMXA 4LF7Q 1VQFA 3NTKA 5E4XA 2WAQE 2BE5D 2B2YA 3S1NB 3ZYYX 1OXSC 1CK1A 3BVZA 1IYVA 3V2TA 3G4SA 2E2IB 2CKZB 2PNHA 3PUYA 1JT8A 2MP1A 2K05A 3NK9A 5DM73 1RL2A 2OWOA 1EWHA 3D4WA 5ELEA 4FF1A 2PQEA 3H15A 4LFAL 2F03A 4WORA 3Q24A 3K5OA 1TS5A 3BS1A 3K6OA 1FNWA 4DNIA 1VQ7A 3GTKH 4TSSA 2KCNA 5CGKA 3MXUA 4A3CH 1LTBD 3OWFA 4HIKA 3E6ZX 2E2HB 1IBLL 3S14H 5IP9H 1SYEA 5DEHA 2VNUD 4AYBE 1B4OA 3BYYB 3T1HQ 1KDBA 4H7BA 2IY5B 5D65A 4KJOA 1VDZA 2E76C 1XMQQ 4XYOA 4XT1B 3TZUA 2E75C 5IY0A 4DUYL 2Z0SA 5EPKA 2WINB 1J9OA 1GKHA 3PUXA 3NUCA 4GOPB 1CKMA 1FVIA 4G4KA 5C4JB 2Q2HA 3K5LA 2EZVA 3G6EA 2JA6H 1JE4A 2DUDA 1K0SA 4AIMA 1LACA 1VQCA 5I9OA 5KNBA 4KKTA 3H3VH 1WTWA 3FRPB 2VL6A 3DWAA 4H44C 1Y8OB 1B1ZA 4XIGS 3FMCA 1PRTF 4HIOA 1TT2A 3NQIA 3VR2A 1QUQA 3CCSA 2D2CC 4F88A 2NYZD 4X64Q 2YYZA 3DLLA 5KEEA 1XXGA 4ZKBB 4YCVA 5M3MB 1SE3A 2F0IA 3GP7A 4ME3A 5I2YA 3DHQA 3CCQA 1SFOB 2UUBL 1Y1VG 3PO3B 5CMDA 5AFWA 4JW0A 4YIJA 3K58A 1SAPA 2Q2TA 1QE6A 3M4OH 4U68A 4H02A 5F2DA 3GTPH 2LXKA 2PW7A 4K2LA 4A3BH 1ENAA 1BCPD 3RUZA 3HOVH 4JBJA 1GUTA 3CCRA 1QCBD 1RCVD 1MKHA 3EN2A 1HZ9A 4BBRH 1QJOA 5J1ZA 1TWCB 3W1BA 4DR6L 1XWEA 2Z8LA 3JAML 4I7AA 4CHTB 3NENA 4LNQA 4C2MB 4JYAL 4JI0Q 3D4RA 2YTYA 1A2UA 3CCVA 5IYBG 2UXDQ 1RJTA 4MZ9A 4LFBL 1BCPC 1X3PA 1Q81C 5D3DA 2DJGC 4ZQ3A 3SE0A 3C3LA 1N34Q 3T13A 1XMOL 5IYCH 2B63G 2H1EA 3G6JB 1MBYA 1YI2A 3IAYA 2EYHA 4R4TA 4C3IB 4G7HC 1ET6A 4WRDA 1W6JA 2F3IA 2Q2IA 1KIXA 4JI7Q 3QIAA 4RFBA 1Q3LA 2RKSA 3HOZH 2XIWA 3CXCA 1GXDC 1QG7A 3PIO3 2HCIA 2PQAB 1EIYB 1EUJA 4BY1B 3RR5A 1IW7D 4DR7Q 2EE1A 4GLXA 1PRTB 1WTRA 2WFWA 2KJXA 4DV0Q 5DLQE 3U9SA 5IYDH 1QVGA 3TSSA 4LFAQ 3ULJA 1A15A 2VQEL 4X3UA 3RZDH 3NBIA 1YEZA 1ICFB 4HJ7A 1D5MC 4L5QA 4RCNA 1QZGA 3SGIA 4A3MB 1BQQT 3CMEA 3HOXG 3UDFA 4OWWB 1G2TA 1EYCA 1DD2A 1IYUA 1SNMA 2A6EC 2PI2A 1YHAA 3CC2A 3EVQA 3MXNB 1LTTD 3FVQA 2JA7G 2ICIA 4RKBA 4LFCL 4K6DA 4A3DG 1LTID 3MFYA 2OCEA 3M3YB 1FNUA 1GUNA 2IPKD 3I4MH 2R7ZB 2AUJD 1Q82C 1VQ4A 1IKLA 2EIFA 1D6EC 4DR1L 4XTCS 4CKEA 4GNXB 1PH5A 4BA2I 1VQGA 3P20A 4O2DA 3K81C 4JBWA 4LMQD 4HJ9A 3EFXD 2MPMA 2F3WA 2Y0SE 1BR9A 1B9MA 1QNUA 2Y0SB 3I2ZA 4POGA 4JI1L 3A55A 4HMIA 1I4QA 1MSHA 5EGTA 1M1KC 1Q46A 3D8GA 4POFA 4X3TA 1CA5A 1CHPD 4HCEA 4OO1H 4JPBW 3H6MA 2RHSB 3VR5A 1RODA 4NMZA 4FF4A 4AQYL 1HR0W 2MFIA 4CDEC 2BA0A 3HG9A 5LMUQ 4GS3A 5A2QE 4APVA 4B9XA 2I5HA 2F0GA 1EEID 2K33A 5C3EH 3GTOH 3HGBA 4A93B 1X3EA 1STGA 4KKUA 3VDYA 1KRTA 1EY7A 4ABNA 5FO7B 3CCJA 5IT9c 1FR3A 4RKLA 3NTHA 3S1NH 5I4DA 3ER0A 1F9SA 1Q86C 4N9PA 3D4DA 1BKBA 3CQZB 3HKSA 3BZKA 2EY5A 2E2IH 3UE0A 4X65L 4DR6Q 1UNSA 2K5DA 2QILA 2HDMA 2WACA 5DM63 2KEEA 1RD9D 1XTCD 4A3EB 3BVGA 3MWYW 3KF6A 3PF5A 1WTHA 1Y1WB 3I55A 1G6ZA 4QUCA 4M1UB 1XNQQ 5C6AA 2KCTA 3JC66 3OW7A 2X6GA 3BJUA 3PUVA 3BZCA 1MSGA 4DAMA 4A3JB 4DR2Q 2UXCL 4UAIA 4YHHL 2YU9B 1PRTD 1G91A 3EIVA 1D8LA 3PO2B 1A6XA 3CF5A 1LT3D 1NE3A 4B3TQ 1STYA 4RGNA 3V96A 3C1FA 1O7IA 1K8GA 3AU7A 2I46A 1EY5A 1CUKA 5C4JH 3K57A 5AJ3Q 5A35A 1BXTA 2JXMB 4LJZC 3GDEA 3I4LA 3F2UA 2JA5B 2BDNA 2DJFC 2B2TA 1XYIA 2AUKA 1F9PA 5I6YA 2L11A 2EYPA 3I56A 5CBAE 1KC8C 5CV8A 4NXNL 3ITPA 3CMAA 1YNXA 4DF7A 4ODGA 5T1GA 1A8VA 3HKZE 4KKSA 3LWUA 5M3MH 2A69C 3PO3H 2XSCA 2HUGA 3T53B 1GUGA 3KOJA 3TN2A 4RCOA 1CZGA 3CCUA 2IHFA 1GD7A 1IKMA 4CBVA 2IJ0A 4A76A 3F8TA 1G6PA 2HT1A 1TVXA 2R7FA 2QF7A 3PIPA 1AE3A 3TRZA 2A6HC 4GOPA 1AZPA 4PZ8A 4IALA 3W5OA 5IGGA 3J80c 1GO3E 2LSSA 2EJGC 2V1CC 1VCIA 4IUVA 2K75A 4YWKA 2L9HA 1HNWQ 2K04A 3AFPA 1TWCH 4HTHA 1I6VC 5C0XH 1RF2D 5E4WC 2CW0D 4GNXC 5C44G 1HUNA 1Y8PB 3RMHA 1LTAD 1QNKA 2LY7A 4IJLA 4PMCA 3K0XA 1FGUA 4C2MH 2HDLA 2D0PA 3M4OB 4KHVA 3D31A 1IBKQ 5C4XB 1A0IA 3GTPB 3HP3A 4DV7L 4FDBA 5C4ZA 2QDBA 1KAWA 2XNAC 1MIUA 2RDFA 3JAMi 4IUNA 4L5SA 1I94Q 5CORA 5ELCA 4H0LC 4IN3A 1SROA 4C3IH 5FLXc 5EPLA 1BBWA 4DK0A 3WOFA 4LF9Q 2KA7A 1F9QA 3OHXC 1XNRQ 2J4XA 2EY1A 1MGSA 4L63B 1IBMQ 2KEDA 1SEBD 3DM3A 4RAUC 2UU9L 2ZTEA 2RDGA 4P71A 1JR0D 1EU4A 2LMCB 3RLFA 3Q6SA 1ENFA 1CT1D 4FF2A 2DY8A 1DOKA 3KDFA 4BY1H 3SK4A 1PHJA 2JEAI 1HXYD 1AN8A 2PZTA 3T1HL 3M4QA 1WI5A 3EA6A 1BNZA 2XRQD 4ZUIA 2D0OA 4QUFA 1GUWA 2C35B 1EYDA 1XMQL 4JI3Q 1OO9B 1E24A 2F0OA 3AEVA 1C9OA 1SE8A 2SNMA 1IXRA 2K52A 4KN4C 1SNCA 1CA6A 1VF7A 2G9DA 4DV4Q 1CHQD 3QWNA 4A3MH 4A3FB 3D6CA 2NUCA 3MEFA 2MGSA 3L0OA 1EOTA 4P74A 1EL0A 1JICA 5E3FA 4I65A 4G57A 5GQOA 5CYUA 1WTPA 4MIUA 1HPCA 3ULPA 3Q0AA 1Y14B 2PQAA 1H9SB 3M3YH 4BXXG 2R7ZH 2ZXRA 3RZDB 4JVZA 4KD4A 3U58A 5CV5A 4QCLA 1BO0A 5IP7H 2RQXA 1L0WA 1UUPA 1V9PA 2P5ZX 4A4IA 1PVOA 2CWAA 4PG3A 3K8AA 3VYRA 4QIWB 1T9HA 1HR0Q 2ZTCA 4DPGA 1E2VA 3HOYB 1C8CA 4KHPQ 4QY7A 2CH4W 2HCCA 1A3UA 3I91A 2NWGA 1CI3M 1VQJA 4MTNA 5LMNL 1BBXC 1YJ9A 1X54A 1LTLA 4C3HB 3MXNA 4G7OC 2NTSA 1LUZA 3NBHB 4IOAA 1U0LA 3A5ZB 1LLRD 1K9MC 1B53A 5JPMC 4A93H 1OXXK 3H3VC 4JI0L 4QF4A 1SE4A 4GNXA 3CRKC 1SYFA 3E0EA 2KUMA 4FNFA 1PDQA 1PH8A 2R92B 3CQZH 5CBEE 5EAYA 1N34L 3SHLA 2N55A 1WTQA 3FKIH 1ENCA 1Q12A 1VQIA 2VS1A 3MTSA 3MXGA 1GM5A 1AZQA 4A3EH 1HFGA 2PZWA 2K5QA 4A3CG 3I73A 3NQTA 1HJPA 5IP9G 2EYMA 1S4ZA 3E5SA 1Y1WH 3TDQA 2VUMB 4RGMA 2K50A 1Y8NB 1YNJD 1ILPA 4DV7Q 5IE8A 4DR3Q 1EIFA 2WAQB 1S40A 2OTJA 3PQIA 3L9AX 3K7AH 4RHSA 2F0NA 4OIKA 2B2VA 1I4RA 2FMCA 4I7ZC 1I4XA 2B3GA 1QVFA 3SK6A 2VY3A 4A3JH 2F0UA 5FO8B 4DR7L 2YU9H 1PZJD 1V8QA 1YJWA 5HURA 1D5ZC 4MTKA 3PO2H 4IZ8A 4DV0L 3RZOB 2JA6G 2F0VA 3R93A 3J81E 4ZK9B 4A3GB 2OTLA 2UU9Q 1MHWC 3UDIA 3QOJA 4FF3A 1YNJC 1Q1BA 2XWJB 1TWHH 2BE5C 5KIXA 2ZJPA 2F3VA 4UP9A 4IFDJ 4K6LA 1FD7D 4QJFA 2DNEA 4HR7B 1FL0A 2L55A 2JA5H 4ME5A 4AYBB 3LNNA 2KOLA 1N9WA 4EVOA 4IUUA 1TS2A 4EQNA 1S5CD 5M5WB 1SRUA 1SNDA 3ERSX 4OX9Q 3MZ5A 3OMGA 2XVSA 1CTMA 2IW3A 3NPPA 2PO4A 1SN8A 1TR5A 2E2DC 4TVAB 4A3BG 3HOVG 2R61A 4KN7C 5FOBB 1I4GA 4ALPA 1CQFA 5IGCA 4BBRG 5BN4A 5JAVA 4N9TA 1DGSA 2HIXA 1WCMB 4BY7H 2QDLA 5K36H 5IWAQ 3RN5A 4DV2Q 2NVYB 1EFWA 2BCOA 1PXUA 3M4PA 2G5DA 1F2ZA 1IHZA 1NUCA 1AW7A 2WKDA 2R7DA 2WB1E 4TKOB 5DAUA 1WD1A 4XQJA 1LYLA 5LMUL 1NMFA 4XT3B 2UXBQ 1H9MA 4HJAA 1KDAA 1SYCA 2F0KA 1KABA 1WD0A 3CP0A 1EIGA 1HTLD 3J7AV 5C4XH 5IYCG 1VQ6A 4KJNA 2L12A 5JJKA 4J15A 2PMZE 3AMUA 3EQLC 1GHJA 2PMZB 5FJ8H 2KHIA 3RLNA 5KNDA 1HNZL 5LMNQ 2IWHA 1KD1C 1O78A 1SNQA 3HOZG 2R93H 1Q1EA 1CSPA 3VYUA 1D1KA 4C1NI 1E22A 3RLOA 4WFN3 1PMRA 4P75A 5CR3A 2I07B 2D62A 4X66L 1PH9A 4JCVE 1PA6A 3H3VI 4R4IA 1DYQA 2L15A 2K4KA 2KVMA 2EPBA 4HJ5A 1EOVA 2FJ2A 2XGTA 4JC0A 2Q8TA 2OEOA 2CH4A 1XNQL 5IYDG 4MNOA 2OF1A 2TSSA 4R8NA 2ZTDA 1E0BA 2PNRC 1XX8A 2PCFB 4JOIC 2K5VA 3IRBA 4FP5D 1WOCA 1GHKA 4DR2L 1R9TB 1TWAB 3PF4A 1I3QH 1FJGQ 1S72A 1HZCA 4NXMQ 3EJIA 3HS0C 4B3TL 4JV5Q 4IO9A 1TWFB 3KF8B 5T1IA 2ZM6Q 3HOWB 3J80L 5JEAH 4FXKC 4C56C 3KJPA 1EY0A 4LF6Q 2IL8A 3BDLA 4A3FH 1B9NA 1B3QA 1DONA 4TQUS 2F0SA 4DV3Q 1CKNB 4H13C 4HJ8A 5AJ3L 2L5TA 3I72A 1QILA 4J6HA 4B3MQ 1PH1A 3SR1A 3I4MG 3KBXA 3DEPA 3ND8A 1EQTA 3VA7A 5EKLA 4F87A 1VQDA 2A1AA 3STBD 2M2LA 3GTGB 1EZ8A 1I4HA 2OT2A 5M3FB 2K5NA 3I4NB 3UE1A 4XYQA 3CU7A 2VB2X 4K5VA 4DAVA 1YZ6A 4IUPA 2HHHL 1J8IA 1TY0A 5K5PA 2B2TC 1PFMA 2E74C 4YCWA 4DNTB 5C5LA 3C2PA 2KCMA 4NB3A 4HCSA 2K03A 5E1FA 1PH7A 4EGVA 1TQOA 2MHVA 4OO1G 1R4QB 1V1PB 1PV4A 1JQYD 1WYDA 4X62L 2Q8RE 4GLVB 1O7YA 1IW7C 5E7NA 1RIPA 3HOYH 4JI5Q 2NVXB 2WIIB 2J7ZA 4LF5L 3PUWA 3J81L 1LT6D 4HMJA 3AQQA 3GD7A 5C3EG 1LT4D 3BZDB 2VQFQ 3PMFA 4P73A 3PSIA 1E2WA 1HNWL 4C3HH 4LF4L 3KLSX 4GOPC 3KFUA 4EQ5A 3DXJC 4DN4M 2O4XA 1JOOA 2WAQG 4K5WA 3KLSA 3LX0A 1UEAB 3U9OA 1H9SA 4DV5Q 2IT1A 1IBKL 3ICEA 1EY9A 2WP8J 4DV6Q 1U9RA 4DNRB 2C5CA 2R92H 1X9NA 1EQRA 2RSNA 4R4QA 1QB5D 2KENA 3TS2A 1H95A 1I94L 3ULLA 4DA2A 3OTOQ 1LTRD 4JBMA 5GADC 1X55A 1H9KA 4LF9L 1XNRL 1X65A 2CVRA 1IBML 2VUMH 2MNAA 1NR2A 4M8AA 2QW7A 4OEMB 4A3IB 1L2FA 3HOUB 4FXDA 3WOEA 2HQEA 3TREA 1D1IA 3NBHA 5ELNA 4PQXA 1HNZQ 1O80A 5J3BA 1X3FA 3KYHC 1U4PA 5EPJA 3TZDA 1T5XD 3K80C 1VMPA 1HZBA 1UE1A 2CQOA 3AYHB 4RMFA 3FKIB 4IQZA 4QB4A 3L7ZC 3M7GA 4X66Q 4JI3L 3RZOH 2RA4A 2XWBB 1CZWA 4A3GH 1PZKD 2M00A 3VR3A 4R8IA 2VW9A 1HNXQ 1P8LA 4JOIA 2AQ1B 2EJMA 2F4VQ 3TS0A 5LHY1 4DV4L 1ICWA 1F2LA 5IIFA 1PFBA 4JI8L 1JWSD 4OO1I 1X32A 2E2JH 1DZ1A 3K7AB 2RCFA 2JSOA 5FLMH 3W2DA 4IFDH 1C0AA 5M3MG 2LKVA 5M5WH 5KYIA 3FP9A 3O13A 2XRSD 3PO3G 3H09A 3SXHA 1NR4A 4LUZA 4R1JA 4TRDA 1KAAA 1N33Q 3OOCA 2CWPA 2K28A 2Z4HA 3NEMA 3DWPA 3J7ZC 4DK6C 1PFNA 1ZEQX 2KBNA 1MJCA 1TWHB 4A3KB 2PPBC 1XPOA 1HZAA 2EYLA 2PW5A 2ENBA 1I6HB 4YY3L 3F2CA 2QA4A 3FDTA 1KDCA 1JB3A 1B3AA 1P16A 1QVCA 3H0GB 4NKLA 4BA1I 4DUZQ 1HR0L 3X3NA 1ONLA 1WCMH 1NBWA 3HEJA 3A0JA 5C0XG 4BBSB 1EWIA 1PRTC 2MO1A 3CPFA 4C3JB 2NVYH 4KY7A 1WFQA 5IGFA 4KHPL 3PIP3 5M5YB 3FEWX 2QGQA 4KV6A 3A54A 2F0MA 3TP7A 2NVQH 3VYSA 2HHHQ 3HKZB 3GTLB 3JAMc 4K2KA 1W3SA 3HRZC 4L8JA 3A5UA 1EEFD 4OWXB 2L4NA 2JP1A 4IOCA 1VQHA 4X62Q 4PZ7A 4Y52H 3NHHA 1E3PA 4BY7B 4C3IG 1EYGA 4QL5A 1VQ8A 1GVPA 1LTGD 1SNPA 4LF5Q 5EBDA 4KHZA 3KLWA 1B8AA 1KTKA 1PYWD 4LF4Q 1LM0A 4PV1C 2O2LD 1YVCA 3GTJH 1K3RA 2L0CA 3MHBA 4YCUA 2Q8IB 1NAPA 1JMCA 3TMEA 1A3TA 3MXPA 1DOLA 1I4PA 2NN6H 4BY1G 4IJHA 1RDPD 4KY5A 3UI2A 1Z9FA 2V4DA 4DR3L 4MHEA 1SYDA 4HSPA 3TQYA 3KK7A 1JJ2A 3VA5A 3GTMB 3CW2C 5IGEA 1DJRD 1YIJA 1TS3A 2R93B 5ELDA 2N88A 3A56A 1VQAA 4GN5A 2Z1CA 4UPAA 1STNA 1R9TH 2SDFA 2CW0C 1TWAH 5GAGC 4A3MG 1YJNA 2FHTA 1CM9A 5H1SE 3QR8A 3S16H 1GUSA 1DM0B 3UDGA 1TWFH 5LL6S 3MA2B 3S1MH 3HOWH 2B2VC 1SDFA 5BR8Q 1HA6A 1HA5A 2O5JC 4JI2Q 4O0AA 5IT9E 1W2BA 5HGTA 3OYYA 3OPOA 3R2IA 3D3RA 2Z6KA 3S1RH 1VF5C 2R7ZG 2RBMA 5C0XI 1KQSA 3WWVA 4Y7NB 3J80i 2HQLA 3A8IE 1BF4A 4F7XA 1I3QB 4JG2A 3GTGH 1TS4A 2ZXPA 5M3FH 4GKKQ 1AE2A 5IP7G 1IZ6A 3I4NH 3B6YA 4OX9L 2Y0SG 1SSOA 2AQ3B 3TP6A 2FFKB 1VQKA 2K1BA 3H91A 4DFAA 1ASYA 4JI8Q 2F0QA 3EBEA 2CQAA 2G9HD 2WV6D 3ZJYC 4L6TB 2A19A 1SLJA 2FMMA 3FHWA 1T5EA 3GV6A 3AB9A 2JA8H 2A74C 2PI2E 2NVXH 1CKNA 5IWAL 1JWMD 4DV2L 3CAMA 3N52A 2RHQB 1WTVA 2Z4IA 4GKJQ 4A93G 3CC7A 1HCZA 1D7QA 4EQPA 2BDOA 3K0YA 1Q8IA 2NZ1D 1EQQA 1C4QA 4PMWA 2JN4A 4XQQA 4YY3Q 2UXBL 4LF8Q 3CHBD 1HTPA 4RG1A 2TMPA 3J81i 4CJ2C 4OXPA 1YHBA 3P7JA 3HZXA 2B63B 1BBUA 3A8JE 3FKIG 2KHJA 3R2TA 4CDDC 1K0RA 3T16A 4A3EG 1PFSA 1V1PA 2MQHA 4DK3C 4O42A 1Y1WG 5I2XA 3DEOA 3BYTB 4ZCKA 3S1QB 1IL8A 2F0HA 1BUVT 3GQBA 4IURA 3F2BA 2EVBA 3GV3A 4OONA 1ASZA 4K5XA 4A3IH 3HOUH 4KY6A 4IPCA 4B08A 5J39A 4CKBA 3J80E 4A3JG 3R3OA 4JI6L 5C4HA 2MO0A 4UY8C 3PO2G 1KNAA 2JK8A 1OXTA 2NB0A 4XQNA 1JB7A 2A68D 3Q23A 4KTAA 3CC4A 3CCMA 2AWNA 1K8AC 1JE5A 4B3RQ 2B2UA 4U673 2EY6A 3FPUB 2B2WC 1FJGL 3VR6A 1GUOA 3J7A5 3K5NA 3HOXB 4NXML 1TXYA 1TU2B 2A8VA 5IODA 3QO2A 2DY7A 2JA5G 4JV5L 1H9RA 1K8OA 2ZM6L 1Z7TA 1C7YA 3UDXA 4K14A 4LF6L 4DV3L 4QGUA 1SYGA
chains in the Genus database with same CATH topology
2A68C 5CV4A 2KCCA 1KLGD 3MVVA 5FLXE 5I9PA 3M85A 4NP5A 1TKWB 1WTOA 1TY2A 3SK5A 4V0BA 3OIQA 5C3XA 4KMUC 2AWOA 2E2JB 5K36G 1L0YB 2F0TA 1S5FD 4P2CB 4NW2A 4FVMA 1H9JA 1V43A 4WJWA 5M5XB 4ZKCB 2D9UA 1F2MA 3P1HA 3E0JA 1A2TA 1MD2D 5IT9L 3OSOA 1BDOA 4UDUC 3MFGA 5EKKA 4LK1C 3S15B 1U4LA 5IOCA 3OMCA 1EZ6A 3QG1A 4GZYC 1B50A 1SBBB 5BN3A 3QOLA 4R9WA 1G8ZD 2NVQB 1ILQA 2WB1B 1SXTA 2QEJC 4IUQA 3OWEB 3T4AC 3DM1A 2H4OA 4DU9A 4DXFA 1TWGB 1F9RA 1G291 3I70A 5G3LF 3MC0B 1GOZA 3RD4A 1D2BA 3N6RA 3SK8A 3TBIB 2XN9C 4RH6A 1STHA 1AFPA 3DMUA 3C1EA 3A7AB 2F0JA 1JCKB 1V1OA 5JEAG 3GTJB 2WKCA 1S5ED 2SOBA 2VXWA 5C0XJ 5JVH3 2VB3X 1AEXA 4HN7A 2B2WA 1PTOF 1FNVA 1UAPA 1SNOA 3T51B 4FO2A 3CKIB 4FXGC 1Z6HA 5KGUA 2EDGA 3L3OC 5JJZA 2RSOA 3S16B 3S1MB 2JYOA 3S9WA 2F0EA 4XDXA 5DNFA 3I90A 4O1NA 1F2YA 1NSNS 5D3IB 5J22A 3S1RB 1HFNA 3S17B 1BOSA 2EYFA 4C3HG 1HQRD 1U4RA 4KD3A 2PZUA 5C44B 3SDZA 4F8MA 1EIHA 1JWUD 3BVMA 3J7AF 1PZID 1RTNA 1SE2A 2A6ED 3S2DB 4DAPA 2F0WA 2EOTA 1EYAA 5FKAC 5FLXL 3R8BA 3S2HB 3LWEA 4EQOA 2JA8B 4OHJA 1ZKOA 2R6GA 2A5HA 2KQ3A 3CRLC 2D5DA 5KRUA 1EQVA 1KLUD 1LO5D 5IGDA 3NWTA 1M4VA 1JORA 2X69A 4NDXA 5EBCA 1QWYA 4CJ0B 3MAQA 1D5XC 1YNND 1I50B 3SEBA 1LV9A 3EROA 1U4MA 1PTOB 4ZAIA 1JOKA 5LL6X 2ICEC 4LAAA 5CV6A 3J7YW 3WDNA 3URYA 3TP8A 2EXZA 1W6KA 1RKNA 1LABA 1YNNC 4J8QA 2K01A 4J1MA 4FYDA 4IFDG 3IL8A 2B8GA 2ZT9C 2SEBD 1EY8A 1WTXA 2F0PA 1HRJA 5C5MA 2NVTB 4C1NK 4KK7A 1OXVA 1S5DD 4K8JA 1DCZA 2A73B 3ONAB 2X6LA 1CQVA 5M9OA 2F0FA 3Q22A 3ND9A 3KBGA 1K83B 3BDCA 1II3A 3C46A 1L0XB 1HQMC 1ZYRD 2FINB 3GO5A 2F4IA 1F77A 2EJFC 4DXGA 1NCVA 1PLFA 2O5IC 1Z47A 1DXMA 1K8MA 3IFTA 4IUTA 2RVLA 4RA8A 4RGOS 3NSWA 4BS9A 1B44D 3QJYA 1LT5D 3P75A 1ESRA 1ZYRC 4DK1A 3FPPA 4X3SA 2EY2A 5G3LD 1Q90A 3SVMA 4QMGA 4RHRA 4RGTA 5FO9B 1OXUA 2A69D 5ELFA 3GTKB 2R3ZA 2LFNA 1KNEA 3S14B 4CKCA 2NN6G 4CJ1B 3H94A 5CC4A 1ESFA 2A6HD 3X3MA 4HSVA 5EKIA 2ZXOA 2K6AA 2DNCA 3T56B 3BG3A 4MN3A 4IFDI 1G2SA 2IX1A 4G7ZC 4ULLA 1GJXA 2IX0A 1RTOA 1PTOD 5JVG3 5NUCA 4B9WA 2AQ2B 3PV0A 4ILWA 2JA6B 1STBA 3I3CA 4S3SA 2EYJA 3NXWA 4OL7A 2K32A 3NWSA 1EY4A 4HAEA 1STAA 4OGQC 4XXEA 4Q5VA 5EJWA 1O7ZA 1STEA 3OIPA 4KI0A 3NTIA 1C48A 1TIID 5COYA 2B2UC 5FK9C 1PTOC 2NBFA 1JC7A 3D6WA 4ID6A 2KHSA 5C3WA 2KECA 5I6WA 2B39A 3K5MA 2F1MA 5TSSA 2L1BA 4A3BB 3GTQB 1Y69U 3HOVB 1RHPA 5KNCA 3I8ZA 4BBRB 2EYOA 1S5BD 2QKIC 2NTTA 1QOHA 2B2YC 4E6IA 3M7NA 2K7VA 2OXPA 1SMYD 1VMCA 1Y1VB 1EFID 5KYLA 2F0DA 2JE6I 3ERQA 1AP0A 3IKJA 1BCPF 5EQ0A 2M9VA 4PNYA 4Q0FA 1HHVA 2NN6I 2PYKA 4K8IA 3IFDA 4PMBA 2SNSA 4CGYB 5A2QL 3QB3A 4ZRZA 2F0LA 1E2ZA 1EY6A 3VYTA 5JEAJ 3KF8A 4RWSC 1SMYC 3HOZB 4BWGB 1DOMA 3A7LA 3KLRA 2IX3A 1MI2A 3DUZA 3A8KE 4JK1C 1SJED 5JOBA 5ISRA 3W3AA 2LS01 1FGBD 2K5WA 5BN5A 1O7LA 2ID0A 2J0TD 3K59A 3NE5B 4DGZA 2CHBD 1PTOH 5D14A 3TP5A 5ELBA 1A3VA 3VR4A 3JAME 4ZLTF 3PUZA 4DAYA 3KUPA 4ZYSA 1JOQA 1HUMA 3BDOA 4HEDA 3I4MB 3V05A 4V190 1ZXTA 1SJHD 5CV7A 2MUYA 4Z9CB 1CFMA 2MJ8A 1WVLA 3MEHA 1R4PB 3NP8A 1BCPB 3M4YA 5JPNC 3G7LA 1M8AA 2RDHA 2GA4B 1ML0D 1X3QA 2JEBI 5CV9A 1EWCA 1EU3A 1LTSD 4C3JG 1B2TA 1ET9A 2JA7B 1SYBA 4A3DB 2QCPX 2B8FA 3DWQA 3GTOB 2C9OA 5C3EB 2BOSA 2BA1A 4X3KA 2DN8A 4ZUJA 4OIJA 5IGBA 1FYCA 3NTKA 5E4XA 2BE5D 2B2YA 3S1NB 3ZYYX 1OXSC 1CK1A 3BVZA 1IYVA 3V2TA 2E2IB 3PUYA 2MP1A 2K05A 3NK9A 5DM73 1EWHA 3D4WA 5ELEA 4FF1A 2PQEA 2F03A 4WORA 3Q24A 3K5OA 1TS5A 3BS1A 3K6OA 1FNWA 4TSSA 2KCNA 5CGKA 3MXUA 1LTBD 3OWFA 3E6ZX 2E2HB 1SYEA 5DEHA 2VNUD 1B4OA 3BYYB 1KDBA 4H7BA 5D65A 4KJOA 1VDZA 2E76C 4XYOA 3TZUA 4XT1B 2E75C 5EPKA 2WINB 1J9OA 3PUXA 3NUCA 4G4KA 5C4JB 3K5LA 2EZVA 1JE4A 1LACA 5I9OA 5KNBA 4KKTA 1WTWA 3FRPB 3DWAA 4H44C 1Y8OB 1B1ZA 4XIGS 3FMCA 1PRTF 1TT2A 3NQIA 3VR2A 2D2CC 4F88A 2NYZD 2YYZA 5KEEA 1XXGA 4ZKBB 5M3MB 1SE3A 2F0IA 3GP7A 5I2YA 1SFOB 3DHQA 3PO3B 5CMDA 5AFWA 4YIJA 3K58A 1SAPA 1QE6A 4U68A 5F2DA 2PW7A 4K2LA 1ENAA 1BCPD 3RUZA 1GUTA 1QCBD 1RCVD 1QJOA 5J1ZA 1TWCB 1XWEA 2Z8LA 3JAML 4CHTB 4C2MB 3D4RA 1A2UA 1RJTA 1BCPC 1X3PA 5D3DA 4ZQ3A 3SE0A 3C3LA 3T13A 2H1EA 3G6JB 1MBYA 3IAYA 2EYHA 4C3IB 4G7HC 1ET6A 4WRDA 1W6JA 3QIAA 4RFBA 1Q3LA 2RKSA 2XIWA 1GXDC 1QG7A 3PIO3 2HCIA 4BY1B 1IW7D 2EE1A 1PRTB 1WTRA 2KJXA 3U9SA 3TSSA 1A15A 4X3UA 3NBIA 1D5MC 4RCNA 4A3MB 1BQQT 1G2TA 1EYCA 1DD2A 1IYUA 1SNMA 2A6EC 3EVQA 1LTTD 3FVQA 2ICIA 4RKBA 4K6DA 1LTID 3MFYA 3M3YB 1FNUA 1GUNA 2IPKD 2R7ZB 2AUJD 1IKLA 1D6EC 4XTCS 4CKEA 4BA2I 3P20A 4JBWA 4LMQD 3EFXD 2MPMA 2F3WA 1BR9A 1B9MA 1QNUA 2Y0SB 3A55A 4HMIA 1I4QA 1MSHA 5EGTA 3D8GA 4X3TA 1CA5A 1CHPD 4HCEA 4OO1H 3H6MA 3VR5A 1RODA 4NMZA 4FF4A 2BA0A 3HG9A 5A2QE 4B9XA 2F0GA 1EEID 2K33A 3HGBA 4A93B 1STGA 4KKUA 1EY7A 4ABNA 5FO7B 1FR3A 4RKLA 3NTHA 5I4DA 1F9SA 4N9PA 3D4DA 3CQZB 2EY5A 1UNSA 2K5DA 2QILA 2HDMA 2WACA 5DM63 2KEEA 1RD9D 1XTCD 4A3EB 3BVGA 3MWYW 1Y1WB 1G6ZA 4QUCA 4M1UB 5C6AA 3OW7A 2X6GA 3PUVA 1MSGA 4A3JB 4UAIA 2YU9B 1PRTD 1G91A 3PO2B 1A6XA 1LT3D 1STYA 4RGNA 3V96A 3C1FA 3AU7A 2I46A 1EY5A 3K57A 5A35A 1BXTA 2JXMB 4LJZC 3I4LA 3F2UA 2JA5B 2BDNA 2B2TA 1XYIA 2AUKA 1F9PA 5I6YA 2L11A 2EYPA 5CBAE 5CV8A 3ITPA 4DF7A 4ODGA 5T1GA 4KKSA 3LWUA 2A69C 2XSCA 2HUGA 3T53B 1GUGA 3TN2A 4RCOA 1CZGA 1IKMA 4CBVA 2IJ0A 1TVXA 2QF7A 2A6HC 1AZPA 4IALA 5IGGA 2EJGC 1VCIA 4IUVA 2L9HA 2K04A 4HTHA 1I6VC 5C0XH 1RF2D 5E4WC 2CW0D 1HUNA 1Y8PB 3RMHA 1LTAD 1QNKA 2LY7A 4PMCA 2HDLA 3M4OB 4KHVA 3D31A 5C4XB 3GTPB 3HP3A 5C4ZA 2QDBA 2XNAC 2RDFA 4IUNA 5CORA 5ELCA 4H0LC 4IN3A 5EPLA 4DK0A 3WOFA 2KA7A 1F9QA 3OHXC 2J4XA 2EY1A 1MGSA 4L63B 2KEDA 1SEBD 4RAUC 2RDGA 1JR0D 1EU4A 2LMCB 3RLFA 3Q6SA 1ENFA 1CT1D 4FF2A 2DY8A 1DOKA 3SK4A 2JEAI 1HXYD 1AN8A 2PZTA 3EA6A 1BNZA 2XRQD 4ZUIA 1GUWA 4QUFA 1EYDA 1OO9B 2F0OA 2SNMA 1CA6A 4KN4C 1SNCA 1VF7A 2G9DA 1CHQD 3QWNA 4A3FB 3D6CA 2NUCA 2MGSA 1EOTA 1EL0A 1JICA 5E3FA 4I65A 4G57A 5CYUA 1WTPA 4MIUA 1HPCA 3Q0AA 1H9SB 2ZXRA 3RZDB 4KD4A 5CV5A 4QCLA 1BO0A 2RQXA 1UUPA 3VYRA 4QIWB 1E2VA 3HOYB 1C8CA 2HCCA 1A3UA 3I91A 2NWGA 1CI3M 1BBXC 4C3HB 3MXNA 4G7OC 2NTSA 1LLRD 1B53A 5JPMC 1OXXK 3H3VC 4QF4A 1SE4A 3CRKC 1SYFA 2KUMA 4FNFA 1PDQA 2R92B 5CBEE 3SHLA 2N55A 1WTQA 1ENCA 1Q12A 3MTSA 3MXGA 1AZQA 1HFGA 2PZWA 2K5QA 3I73A 3NQTA 2EYMA 1S4ZA 3E5SA 3TDQA 2VUMB 4RGMA 1Y8NB 1YNJD 1ILPA 2WAQB 3L9AX 4RHSA 2F0NA 4OIKA 2B2VA 1I4RA 2FMCA 4I7ZC 1I4XA 3SK6A 2F0UA 5FO8B 1PZJD 1V8QA 5HURA 1D5ZC 4IZ8A 3RZOB 2F0VA 3R93A 3J81E 4ZK9B 4A3GB 3QOJA 4FF3A 1YNJC 1Q1BA 2XWJB 2BE5C 5KIXA 2F3VA 4IFDJ 4K6LA 1FD7D 2DNEA 4HR7B 2L55A 4ME5A 4AYBB 3LNNA 2KOLA 4EVOA 4IUUA 1TS2A 4EQNA 1S5CD 5M5WB 1SNDA 3MZ5A 2XVSA 3OMGA 1CTMA 2IW3A 3NPPA 2PO4A 1TR5A 2E2DC 2R61A 4KN7C 5FOBB 1I4GA 1CQFA 5IGCA 5BN4A 5JAVA 4N9TA 1WCMB 5K36H 2NVYB 2BCOA 1PXUA 5DAUA 1F2ZA 1IHZA 1NUCA 1AW7A 2WKDA 4TKOB 1WD1A 4XQJA 4XT3B 1H9MA 1KDAA 1SYCA 2F0KA 1KABA 1WD0A 1EIGA 1HTLD 3J7AV 4KJNA 2L12A 3AMUA 3EQLC 1GHJA 2PMZB 5KNDA 2IWHA 1O78A 1SNQA 1Q1EA 3VYUA 1D1KA 4C1NI 4WFN3 1PMRA 5CR3A 2I07B 2D62A 1DYQA 2KVMA 2EPBA 2FJ2A 2Q8TA 2OEOA 2OF1A 2TSSA 4R8NA 1E0BA 2PNRC 1XX8A 2PCFB 4FP5D 1GHKA 1R9TB 1TWAB 3EJIA 3HS0C 1TWFB 5T1IA 3HOWB 3J80L 5JEAH 4FXKC 4C56C 1EY0A 2IL8A 3BDLA 1B9NA 1DONA 4TQUS 2F0SA 4H13C 2L5TA 3I72A 1QILA 4J6HA 3SR1A 3KBXA 3DEPA 3ND8A 1EQTA 3VA7A 5EKLA 4F87A 2M2LA 3GTGB 1EZ8A 1I4HA 2OT2A 5M3FB 3I4NB 4XYQA 3CU7A 2VB2X 4K5VA 4DAVA 4IUPA 1J8IA 1TY0A 5K5PA 2B2TC 1PFMA 2E74C 4DNTB 5C5LA 3C2PA 4HCSA 2K03A 5E1FA 4EGVA 1TQOA 2MHVA 4OO1G 1R4QB 1V1PB 1JQYD 2Q8RE 1O7YA 1IW7C 2NVXB 2WIIB 2J7ZA 3PUWA 3J81L 1LT6D 4HMJA 3GD7A 1LT4D 3BZDB 3PMFA 1E2WA 3KLSX 3DXJC 4DN4M 2O4XA 1JOOA 4K5WA 3KLSA 3LX0A 1UEAB 3U9OA 1H9SA 2IT1A 1EY9A 2WP8J 1U9RA 4DNRB 2C5CA 2RSNA 1QB5D 4DA2A 1LTRD 1H9KA 2CVRA 1NR2A 4M8AA 4A3IB 3HOUB 4FXDA 3WOEA 2HQEA 1D1IA 3NBHA 4PQXA 1O80A 5EPJA 1U4PA 3TZDA 1T5XD 1VMPA 3FKIB 4IQZA 4QB4A 3L7ZC 3M7GA 2RA4A 2XWBB 1CZWA 1PZKD 2M00A 3VR3A 4R8IA 2AQ1B 2EJMA 5LHY1 1ICWA 1F2LA 5IIFA 1PFBA 1JWSD 4OO1I 1X32A 1DZ1A 3K7AB 2JSOA 3W2DA 4IFDH 2LKVA 5KYIA 3O13A 2XRSD 3H09A 3SXHA 1NR4A 4TRDA 1KAAA 3OOCA 2K28A 2Z4HA 3DWPA 1PFNA 1ZEQX 4A3KB 2PPBC 1TWHB 2EYLA 2PW5A 2ENBA 1I6HB 3FDTA 1KDCA 1JB3A 1B3AA 3H0GB 4NKLA 4BA1I 3X3NA 1ONLA 3HEJA 5C0XG 4BBSB 1PRTC 4C3JB 4KY7A 5IGFA 3PIP3 5M5YB 3FEWX 4KV6A 3A54A 2F0MA 3TP7A 3VYSA 3HKZB 3GTLB 4K2KA 3HRZC 4L8JA 1EEFD 2L4NA 2JP1A 3NHHA 4BY7B 4C3IG 1LTGD 1SNPA 5EBDA 4KHZA 1KTKA 1PYWD 4PV1C 2O2LD 2L0CA 3MHBA 2Q8IB 1NAPA 3TMEA 1A3TA 3MXPA 1DOLA 1I4PA 2NN6H 1RDPD 4KY5A 3UI2A 2V4DA 4MHEA 1SYDA 4HSPA 3KK7A 3VA5A 3GTMB 5IGEA 1DJRD 1TS3A 2R93B 5ELDA 2N88A 3A56A 2Z1CA 1STNA 2SDFA 2CW0C 2FHTA 1CM9A 1GUSA 1DM0B 5LL6S 3MA2B 2B2VC 1SDFA 1HA6A 1HA5A 2O5JC 5IT9E 5HGTA 3OPOA 3R2IA 3D3RA 1VF5C 2RBMA 5C0XI 4Y7NB 3A8IE 1BF4A 4F7XA 1I3QB 1TS4A 2ZXPA 1SSOA 2AQ3B 3TP6A 2FFKB 2K1BA 3H91A 4DFAA 2F0QA 2CQAA 2G9HD 2WV6D 4L6TB 2FMMA 1T5EA 3GV6A 3AB9A 2A74C 1JWMD 3N52A 1WTVA 2Z4IA 1HCZA 4EQPA 2BDOA 3K0YA 1Q8IA 2NZ1D 1C4QA 4PMWA 4XQQA 3CHBD 1HTPA 2TMPA 4CJ2C 3P7JA 3HZXA 2B63B 3A8JE 3R2TA 3T16A 1V1PA 4O42A 5I2XA 3DEOA 3BYTB 3S1QB 1IL8A 2F0HA 1BUVT 3GQBA 4IURA 2EVBA 3GV3A 4K5XA 4KY6A 4B08A 5J39A 4CKBA 3J80E 3R3OA 5C4HA 1KNAA 1OXTA 2NB0A 4XQNA 2A68D 3Q23A 4KTAA 2AWNA 2B2UA 4U673 2EY6A 3FPUB 2B2WC 3VR6A 1GUOA 3K5NA 3HOXB 1TU2B 5IODA 3QO2A 2DY7A 1H9RA 1K8OA 1Z7TA 4K14A 1SYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X69 A;  2HDM A;  2MJ8 A;  1HUN A;  2KOL A;  2KEE A;  2L4N A;  1WTW A;  2JP1 A;  2B2Y C;  2EE1 A;  2FMM A;  1QNK A;  4IUU A;  4CJ0 B;  1WVL A;  1WTR A;  1ESR A;  3MWY W;  2CVR A;  2HDL A;  3GV6 A;  4X3S A;  1VMC A;  3SVM A;  1NR2 A;  1C8C A;  1WTO A;  1LV9 A;  2VXW A;  3HP3 A;  1AP0 A;  1A15 A;  3G7L A;  1U4M A;  2NYZ D;  1M8A A;  4X3U A;  5EQ0 A;  4QUC A;  2HCC A;  3N52 A;  5T1I A;  1G6Z A;  4ZAI A;  1ML0 D;  1WTV A;  2R3Z A;  2IL8 A;  1HHV A;  4ZKB B;  1X3Q A;  3I91 A;  2NWG A;  1DON A;  2B2W A;  1BBX C;  1O80 A;  1KNE A;  1U4P A;  5COR A;  5EPJ A;  2X6G A;  5AFW A;  3TZD A;  5CMD A;  1B2T A;  3IFD A;  2NZ1 D;  1MSG A;  1VMP A;  5EPL A;  4CJ1 B;  1SAP A;  1G2T A;  1F9Q A;  4HSV A;  5EKI A;  1B53 A;  3KBX A;  3DEP A;  4UAI A;  1QE6 A;  1NAP A;  4U68 A;  1MGS A;  4CJ2 C;  1G91 A;  1HFN A;  1EQT A;  2RA4 A;  4RWS C;  1DOL A;  2KED A;  4X3K A;  4NW2 A;  4MN3 A;  1G2S A;  4RAU C;  4OIJ A;  3P7J A;  2M2L A;  5JJZ A;  4R8I A;  2RSO A;  2K01 A;  5E4X A;  3UI2 A;  1RTO A;  2JYO A;  1DOM A;  2B2Y A;  3IL8 A;  4MHE A;  1ICW A;  1F2L A;  2KUM A;  4IUP A;  4XDX A;  1PFB A;  1IKL A;  4ZKC B;  1PDQ A;  2D9U A;  3I90 A;  3Q6S A;  5DNF A;  1J8I A;  1WD1 A;  2B2T C;  1PFM A;  5CBE E;  1X32 A;  2N55 A;  1DZ1 A;  1MI2 A;  4O42 A;  1WTQ A;  3I3C A;  2DY8 A;  1DOK A;  1WTX A;  4LMQ D;  2MP1 A;  4HCS A;  2K03 A;  2MPM A;  2K05 A;  3DEO A;  4XT3 B;  2N88 A;  3F2U A;  1IL8 A;  4HAE A;  1HRJ A;  1U4L A;  3MTS A;  1AZQ A;  1BNZ A;  1GUW A;  1HFG A;  2BDN A;  2SDF A;  2Q8R E;  4QUF A;  2B2T A;  1XYI A;  1WD0 A;  1EIG A;  1F9P A;  1O7Y A;  1CM9 A;  1O7Z A;  2FHT A;  5EJW A;  2L11 A;  1MSH A;  4IUR A;  1NR4 A;  5CBA E;  1S4Z A;  3GV3 A;  1B50 A;  2L12 A;  1CA6 A;  2J7Z A;  1U4R A;  4X3T A;  2K28 A;  1RJT A;  4R9W A;  1CA5 A;  1ILP A;  2B2V C;  3ONA B;  1SDF A;  5COY A;  1X3P A;  5T1G A;  1HA6 A;  1PFN A;  1EIH A;  5D14 A;  2X6L A;  2B2U C;  1ROD A;  1KNA A;  2HUG A;  1ILQ A;  3TN2 A;  2MGS A;  3D6W A;  4OIK A;  1RTN A;  2H1E A;  2B2V A;  4IUQ A;  4DN4 M;  3DM1 A;  1B4O A;  4ZLT F;  1IKM A;  1EOT A;  2KEC A;  3FDT A;  2FIN B;  3KUP A;  2EOT A;  5D65 A;  1EL0 A;  2B2U A;  1TVX A;  1JIC A;  1B3A A;  1F9R A;  4XT1 B;  3FPU B;  1HUM A;  1Q3L A;  2B2W C;  1AZP A;  1BF4 A;  1WTP A;  3LWE A;  3R93 A;  2L1B A;  4ZK9 B;  2XIW A;  2KVM A;  3QO2 A;  5EPK A;  2DY7 A;  2EPB A;  1J9O A;  1QG7 A;  1RHP A;  4IUV A;  1NCV A;  1SSO A;  1PLF A;  2FJ2 A;  4HED A;  2Q8T A;  2FFK B;  1F9S A;  3I8Z A;  2L9H A;  2K1B A;  3H91 A;  2RSN A;  1ZXT A;  4IUT A;  2K04 A;  2RVL A;  4RA8 A;  2HCI A;  1E0B A;  5E4W C;  1JE4 A;  1XX8 A;  1BO0 A; 
#chains in the Genus database with same CATH topology
 2A68 C;  5CV4 A;  2KCC A;  4B3M L;  1KLG D;  3MVV A;  5FLX E;  5I9P A;  3CD6 A;  3M85 A;  4NP5 A;  1J5E L;  1TKW B;  1WTO A;  1TY2 A;  4DKA C;  1K73 C;  3SK5 A;  4X6A H;  4V0B A;  3OIQ A;  1M90 C;  5C3X A;  4A3L H;  4A3K H;  4KMU C;  2AWO A;  1JJC B;  4BY7 G;  1I6H H;  2E2J B;  5K36 G;  4LW1 A;  1L0Y B;  2F0T A;  1S5F D;  4LUO A;  4WJ3 M;  3H0G H;  4P2C B;  2UUC Q;  4NW2 A;  4BBS H;  4C3J H;  4JI5 L;  2K14 A;  4FVM A;  1H9J A;  1PYB A;  5M5Y H;  3F2D A;  1V43 A;  4WJW A;  5M5X B;  4ZKC B;  2D9U A;  1F2M A;  2N49 A;  3P1H A;  3E0J A;  1A2T A;  1MD2 D;  5IT9 L;  2VQF L;  3GTL H;  5C4X G;  3OSO A;  1BDO A;  1IYJ B;  4CDC C;  4UDU C;  3MFG A;  5EKK A;  2OQ0 A;  4LK1 C;  2I5L X;  3S15 B;  4GLA C;  5FJ8 G;  3OW2 A;  1U4L A;  5IOC A;  3OMC A;  2ZJQ A;  1EZ6 A;  4DV5 L;  1VS0 A;  1UEB A;  2F52 A;  3QG1 A;  4UP7 A;  4GZY C;  1B50 A;  1SBB B;  3RN2 A;  2R93 G;  5BN3 A;  3QOL A;  4R9W A;  1VQ9 A;  4DV6 L;  1G8Z D;  4JI4 L;  2NVQ B;  1ILQ A;  4YWL A;  2WB1 B;  1SXT A;  2QEJ C;  4IUQ A;  3OWE B;  1I5F A;  3DM1 A;  3T4A C;  3OTO L;  2H4O A;  4DU9 A;  4DXF A;  1N36 Q;  1TWG B;  1F9R A;  1G29 1;  3I70 A;  5G3L F;  3U50 C;  3MC0 B;  1GOZ A;  3RD4 A;  1D2B A;  3N6R A;  3SK8 A;  3TBI B;  2XN9 C;  4RH6 A;  1PH4 A;  1VQN A;  4PZ6 A;  4DR4 L;  1STH A;  1AFP A;  3GTM H;  2B29 A;  3DMU A;  4YWM A;  3C1E A;  3A7A B;  2F0J A;  2HD3 A;  1JCK B;  1V1O A;  5JEA G;  4UHV A;  3GTJ B;  2WKC A;  1MJE A;  1S5E D;  2EQS A;  2SOB A;  4A3F G;  1N32 L;  5HGQ A;  2YV5 A;  1YHQ A;  3GTQ H;  1HNX L;  2VXW A;  5C0X J;  5JVH 3;  2F4V L;  1VQB A;  2VB3 X;  1AEX A;  3CCL A;  4HN7 A;  1K3B C;  4DR5 Q;  3K7U C;  1B70 B;  4JI6 Q;  2UUA Q;  2B2W A;  1PTO F;  1FNV A;  1UAP A;  1SNO A;  2CCZ A;  3G71 A;  3T51 B;  3E9H A;  4FO2 A;  3CKI B;  3U4Z A;  3J81 j;  1XPR A;  4FXG C;  1Z6H A;  4Y7N H;  3KDF B;  5KGU A;  1Y1V H;  1UE5 A;  2EDG A;  3L3O C;  4KLK A;  2EXD A;  5JJZ A;  2RSO A;  2CFM A;  1N33 L;  1YBY A;  3S16 B;  3S1M B;  2JYO A;  3S9W A;  2F0E A;  4XDX A;  5DNF A;  3I90 A;  4L5T A;  2YTX A;  1HH2 P;  4O1N A;  3HOY G;  1F2Y A;  3E3X A;  1NSN S;  5D3I B;  1L1O B;  5J22 A;  3S1R B;  1HFN A;  3T1Y L;  3S17 B;  1BOS A;  5GAH C;  1J5E Q;  4DUZ L;  2EYF A;  4C3H G;  1BVS A;  4A75 A;  2E8G A;  1HQR D;  2DGY A;  1U4R A;  4KD3 A;  2PZU A;  4K0K L;  5C44 B;  3I7F A;  3SDZ A;  4F8M A;  1EIH A;  1JWU D;  3U4V A;  2JJQ A;  3BVM A;  3J7A F;  1PZI D;  1RTN A;  1SE2 A;  2N78 A;  2A6E D;  5IYB H;  3S2D B;  2ASB A;  4DAP A;  2F0W A;  2EOT A;  1EYA A;  5FKA C;  5FLX L;  2R92 G;  3R8B A;  3S2H B;  1VQ5 A;  4DAY B;  3LWE A;  2B63 H;  4EQO A;  2JA8 B;  3PIO A;  4OHJ A;  1ZKO A;  1S3O A;  3STB C;  2R6G A;  2A5H A;  2KQ3 A;  3NEL A;  1JJG A;  3CRL C;  2D5D A;  5KRU A;  1IBL Q;  1EQV A;  1KLU D;  2VUM G;  1G51 A;  1LO5 D;  5IGD A;  3M9B A;  3NWT A;  1M4V A;  3S1Q H;  1JOR A;  2X69 A;  4NDX A;  5EBC A;  1QWY A;  4CJ0 B;  3MAQ A;  1VQM A;  1D5X C;  1YNN D;  2GN5 A;  1I50 B;  4DUY Q;  3PGZ A;  3SEB A;  1J6Q A;  1LV9 A;  3ERO A;  1U4M A;  1E1T A;  1PTO B;  4ZAI A;  2E5L L;  1OTC A;  1JOK A;  5LL6 X;  2ICE C;  4LAA A;  5CV6 A;  4OWT B;  3J7Y W;  4JI4 Q;  1UE6 A;  2Q2U A;  3WDN A;  5ELO A;  3URY A;  4A3G G;  4UP8 A;  3TP8 A;  2EXZ A;  3HFZ B;  4R4O A;  1W6K A;  1NY4 A;  2H5X A;  1X3G A;  3HOX H;  1RKN A;  1LAB A;  1YNN C;  4J8Q A;  4DV1 L;  2K01 A;  2N8N A;  4AYB G;  2GVB A;  4J1M A;  4FYD A;  5FLM G;  4IFD G;  5BR8 L;  3IL8 A;  4N8F A;  4JI2 L;  3W1G A;  2B8G A;  2ZT9 C;  2QEX A;  2UUB Q;  4DR4 Q;  2JA7 H;  2SEB D;  1EY8 A;  4LWC A;  4A3D H;  1WTX A;  2F0P A;  1HRJ A;  5C5M A;  2NVT B;  2BH8 A;  4C1N K;  4KK7 A;  1OXV A;  1N32 Q;  4B3S L;  2ES2 A;  1S5D D;  4K8J A;  1X56 A;  1PH6 A;  4GN3 B;  4GKK L;  1B7Y B;  1DCZ A;  2A73 B;  3ONA B;  2Z6K C;  4N8X 1;  2RCN A;  2X6L A;  1CQV A;  5M9O A;  1WCM G;  2F0F A;  3ND9 A;  3KBG A;  3Q22 A;  1K83 B;  3KJO A;  3BDC A;  1II3 A;  3C46 A;  1NMG A;  1L0X B;  3E9I A;  4NPS A;  1HQM C;  1ZYR D;  2FIN B;  3GO5 A;  2F4I A;  4AH6 A;  1F77 A;  4JYA Q;  2WB1 G;  1N8R C;  2EJF C;  4P72 A;  1Q7Y C;  4DXG A;  4LFB Q;  3S24 A;  1NCV A;  1PLF A;  5M5X H;  2O5I C;  1PYS B;  1Z47 A;  2E2H H;  1DXM A;  4GKJ L;  1K8M A;  3IFT A;  4IUT A;  1XMO Q;  4HID A;  2RVL A;  4RA8 A;  4RGO S;  3NSW A;  3S15 H;  3LGJ A;  4BS9 A;  1B44 D;  3QJY A;  3TEH B;  1LT5 D;  3P75 A;  4LF8 L;  5GRO A;  2VZA A;  1ESR A;  1ZYR C;  3T1Y Q;  4DK1 A;  1CSQ A;  4R4C A;  3FPP A;  4X3S A;  2EY2 A;  5G3L D;  1Q90 A;  1L1O C;  3SVM A;  4QMG A;  4RHR A;  3Q8D A;  4RGT A;  5FO9 B;  1OXU A;  3L2P A;  2ZJR A;  2A69 D;  5ELF A;  4K0K Q;  3GTK B;  1NTG A;  3D0F A;  1U5K A;  2R3Z A;  4GN4 B;  2LFN A;  1QUQ B;  2RF4 A;  1K28 A;  1KNE A;  3S14 B;  2K5H A;  4CKC A;  5L37 A;  2NN6 G;  4CJ1 B;  3H94 A;  5CC4 A;  1ESF A;  2A6H D;  3X3M A;  1TWG H;  1A62 A;  4HSV A;  5EKI A;  1XTD A;  2ZXO A;  2K6A A;  2DNC A;  3T56 B;  3BG3 A;  4MN3 A;  4IFD I;  1G2S A;  2IX1 A;  1UWV A;  4G7Z C;  4ULL A;  1GJX A;  2VQE Q;  2IX0 A;  1RTO A;  2HIV A;  1SFO H;  1PTO D;  5JVG 3;  5HY6 A;  5NUC A;  4B9W A;  2AQ2 B;  2IHE A;  3PV0 A;  4ILW A;  2JA6 B;  1STB A;  3I3C A;  4S3S A;  2EYJ A;  3NXW A;  4OL7 A;  2K32 A;  3HOW G;  3NWS A;  1EY4 A;  5JJL A;  4HAE A;  1STA A;  4OGQ C;  4XXE A;  4Q5V A;  4B3R L;  3A74 A;  1XJV A;  5EJW A;  1O7Z A;  1STE A;  3OIP A;  4KI0 A;  4LFC Q;  1V1Q A;  3NTI A;  1PH3 A;  1C48 A;  1TII D;  3F1Z A;  1KRS A;  5COY A;  2E5L Q;  2Z6B A;  4DR1 Q;  2B2U C;  2LXJ A;  1VQE A;  1PTO C;  5FK9 C;  4L5R C;  4IPH A;  2NBF A;  1JC7 A;  3D6W A;  5M3F G;  4ID6 A;  3I4N G;  2KHS A;  5C3W A;  2KEC A;  5I6W A;  2N3S A;  2B39 A;  3K5M A;  4JI1 Q;  2F1M A;  2AMC B;  5TSS A;  2L1B A;  4LF7 L;  4A3B B;  4DV1 Q;  3GTQ B;  1Y69 U;  4JBK A;  3HOV B;  1RHP A;  1WJJ A;  1NJI C;  4QQB X;  2I5M X;  5KNC A;  1IL2 A;  3CCE A;  3I8Z A;  4BBR B;  1KHI A;  4AQY Q;  2JA8 G;  2EYO A;  1S5B D;  2QKI C;  3I4O A;  2NTT A;  1QOH A;  2B2Y C;  3S17 H;  4E6I A;  3M7N A;  2K7V A;  2OXP A;  2GVA A;  3J81 c;  1SMY D;  2UUC L;  4B3S Q;  5LMN W;  1VMC A;  1Y1V B;  1AH9 A;  1EFI D;  5KYL A;  2F0D A;  2JE6 I;  3ERQ A;  1AP0 A;  1QZH A;  3IKJ A;  1BCP F;  5EQ0 A;  5C44 H;  2M9V A;  4PNY A;  4Q0F A;  1HHV A;  2NN6 I;  2PYK A;  4K8I A;  1Q8K A;  4X65 Q;  3IFD A;  4PMB A;  1UE7 A;  3S2D H;  2SNS A;  4CGY B;  5JJI A;  5A2Q L;  3QB3 A;  4IPG A;  4ZRZ A;  2F0L A;  1E2Z A;  1EY6 A;  3VYT A;  5JEA J;  3S2H H;  3KF8 A;  4RWS C;  1SMY C;  3HOZ B;  4BWG B;  2Z9H A;  1DOM A;  5GAE C;  4CDF C;  3AFQ A;  1A63 A;  3A7L A;  1L1O A;  3KLR A;  2IX3 A;  1MI2 A;  3DUZ A;  3A8K E;  4JK1 C;  4A3I G;  3HOU G;  1SJE D;  4IPD A;  3BU2 A;  5JOB A;  5ISR A;  1XPU A;  3W3A A;  2NZO A;  2NZH A;  2UXC Q;  2LS0 1;  4YHH Q;  1N36 L;  1FGB D;  2K5W A;  5BN5 A;  1O7L A;  2ID0 A;  1VQO A;  1I50 H;  2J0T D;  3K59 A;  4HIM A;  3NE5 B;  3G48 A;  4DGZ A;  4X64 L;  3CPW A;  1VQP A;  2CHB D;  1PTO H;  2ATW A;  2YTV A;  5D14 A;  3TP5 A;  2AHO B;  5ELB A;  1SR3 A;  1A3V A;  3VR4 A;  3JAM E;  4ZLT F;  3PUZ A;  4DAY A;  4QIW E;  3KUP A;  4ZYS A;  1JOQ A;  1HUM A;  1NNX A;  4NXN Q;  2AKW B;  2JQO A;  3BDO A;  4HED A;  3I4M B;  4DR5 L;  2FXQ A;  3V05 A;  4V19 0;  2UUA L;  1ZXT A;  2JA9 A;  1SJH D;  1X6O A;  4LUV A;  5CV7 A;  2MUY A;  4BXX H;  4Z9C B;  1CFM A;  2MJ8 A;  2NVT H;  1KXL A;  4A3L G;  2XTI A;  1WVL A;  3MEH A;  4A3K G;  1R4P B;  3NP8 A;  1BCP B;  2I0Q A;  3M4Y A;  5JPN C;  2UXD L;  3G7L A;  1YIT A;  1CKO A;  1M8A A;  2ALY B;  3KF6 B;  2RDH A;  2GA4 B;  1KL9 A;  1ML0 D;  1E1O A;  1X3Q A;  2JEB I;  3H0G G;  5CV9 A;  1EWC A;  1EU3 A;  3RNU A;  1K83 H;  1LTS D;  4BBS G;  4WJ4 A;  4C3J G;  1PH2 A;  1B2T A;  4EX5 A;  1ET9 A;  2JA7 B;  1SYB A;  4A3D B;  2QCP X;  2B8F A;  2BH2 A;  4OEL B;  4JI7 L;  3DWQ A;  3GTO B;  2C9O A;  5C3E B;  2BOS A;  2BA1 A;  3HKZ G;  2OQK A;  3PCO B;  1E7Z A;  1VQL A;  4X3K A;  2DN8 A;  4ZUJ A;  4OIJ A;  5IGB A;  1FYC A;  1SMX A;  4LF7 Q;  1VQF A;  3NTK A;  5E4X A;  2WAQ E;  2BE5 D;  2B2Y A;  3S1N B;  3ZYY X;  1OXS C;  1CK1 A;  3BVZ A;  1IYV A;  3V2T A;  3G4S A;  2E2I B;  2CKZ B;  2PNH A;  3PUY A;  1JT8 A;  2MP1 A;  2K05 A;  3NK9 A;  5DM7 3;  1RL2 A;  2OWO A;  1EWH A;  3D4W A;  5ELE A;  4FF1 A;  2PQE A;  3H15 A;  4LFA L;  2F03 A;  4WOR A;  3Q24 A;  3K5O A;  1TS5 A;  3BS1 A;  3K6O A;  1FNW A;  4DNI A;  1VQ7 A;  3GTK H;  4TSS A;  2KCN A;  5CGK A;  3MXU A;  4A3C H;  1LTB D;  3OWF A;  4HIK A;  3E6Z X;  2E2H B;  1IBL L;  3S14 H;  5IP9 H;  1SYE A;  5DEH A;  2VNU D;  4AYB E;  1B4O A;  3BYY B;  3T1H Q;  1KDB A;  4H7B A;  2IY5 B;  5D65 A;  4KJO A;  1VDZ A;  2E76 C;  1XMQ Q;  4XYO A;  4XT1 B;  3TZU A;  2E75 C;  5IY0 A;  4DUY L;  2Z0S A;  5EPK A;  2WIN B;  1J9O A;  1GKH A;  3PUX A;  3NUC A;  4GOP B;  1CKM A;  1FVI A;  4G4K A;  5C4J B;  2Q2H A;  3K5L A;  2EZV A;  3G6E A;  2JA6 H;  1JE4 A;  2DUD A;  1K0S A;  4AIM A;  1LAC A;  1VQC A;  5I9O A;  5KNB A;  4KKT A;  3H3V H;  1WTW A;  3FRP B;  2VL6 A;  3DWA A;  4H44 C;  1Y8O B;  1B1Z A;  4XIG S;  3FMC A;  1PRT F;  4HIO A;  1TT2 A;  3NQI A;  3VR2 A;  1QUQ A;  3CCS A;  2D2C C;  4F88 A;  2NYZ D;  4X64 Q;  2YYZ A;  3DLL A;  5KEE A;  1XXG A;  4ZKB B;  4YCV A;  5M3M B;  1SE3 A;  2F0I A;  3GP7 A;  4ME3 A;  5I2Y A;  3DHQ A;  3CCQ A;  1SFO B;  2UUB L;  1Y1V G;  3PO3 B;  5CMD A;  5AFW A;  4JW0 A;  4YIJ A;  3K58 A;  1SAP A;  2Q2T A;  1QE6 A;  3M4O H;  4U68 A;  4H02 A;  5F2D A;  3GTP H;  2LXK A;  2PW7 A;  4K2L A;  4A3B H;  1ENA A;  1BCP D;  3RUZ A;  3HOV H;  4JBJ A;  1GUT A;  3CCR A;  1QCB D;  1RCV D;  1MKH A;  3EN2 A;  1HZ9 A;  4BBR H;  1QJO A;  5J1Z A;  1TWC B;  3W1B A;  4DR6 L;  1XWE A;  2Z8L A;  3JAM L;  4I7A A;  4CHT B;  3NEN A;  4LNQ A;  4C2M B;  4JYA L;  4JI0 Q;  3D4R A;  2YTY A;  1A2U A;  3CCV A;  5IYB G;  2UXD Q;  1RJT A;  4MZ9 A;  4LFB L;  1BCP C;  1X3P A;  1Q81 C;  5D3D A;  2DJG C;  4ZQ3 A;  3SE0 A;  3C3L A;  1N34 Q;  3T13 A;  1XMO L;  5IYC H;  2B63 G;  2H1E A;  3G6J B;  1MBY A;  1YI2 A;  3IAY A;  2EYH A;  4R4T A;  4C3I B;  4G7H C;  1ET6 A;  4WRD A;  1W6J A;  2F3I A;  2Q2I A;  1KIX A;  4JI7 Q;  3QIA A;  4RFB A;  1Q3L A;  2RKS A;  3HOZ H;  2XIW A;  3CXC A;  1GXD C;  1QG7 A;  3PIO 3;  2HCI A;  2PQA B;  1EIY B;  1EUJ A;  4BY1 B;  3RR5 A;  1IW7 D;  4DR7 Q;  2EE1 A;  4GLX A;  1PRT B;  1WTR A;  2WFW A;  2KJX A;  4DV0 Q;  5DLQ E;  3U9S A;  5IYD H;  1QVG A;  3TSS A;  4LFA Q;  3ULJ A;  1A15 A;  2VQE L;  4X3U A;  3RZD H;  3NBI A;  1YEZ A;  1ICF B;  4HJ7 A;  1D5M C;  4L5Q A;  4RCN A;  1QZG A;  3SGI A;  4A3M B;  1BQQ T;  3CME A;  3HOX G;  3UDF A;  4OWW B;  1G2T A;  1EYC A;  1DD2 A;  1IYU A;  1SNM A;  2A6E C;  2PI2 A;  1YHA A;  3CC2 A;  3EVQ A;  3MXN B;  1LTT D;  3FVQ A;  2JA7 G;  2ICI A;  4RKB A;  4LFC L;  4K6D A;  4A3D G;  1LTI D;  3MFY A;  2OCE A;  3M3Y B;  1FNU A;  1GUN A;  2IPK D;  3I4M H;  2R7Z B;  2AUJ D;  1Q82 C;  1VQ4 A;  1IKL A;  2EIF A;  1D6E C;  4DR1 L;  4XTC S;  4CKE A;  4GNX B;  1PH5 A;  4BA2 I;  1VQG A;  3P20 A;  4O2D A;  3K81 C;  4JBW A;  4LMQ D;  4HJ9 A;  3EFX D;  2MPM A;  2F3W A;  2Y0S E;  1BR9 A;  1B9M A;  1QNU A;  2Y0S B;  3I2Z A;  4POG A;  4JI1 L;  3A55 A;  4HMI A;  1I4Q A;  1MSH A;  5EGT A;  1M1K C;  1Q46 A;  3D8G A;  4POF A;  4X3T A;  1CA5 A;  1CHP D;  4HCE A;  4OO1 H;  4JPB W;  3H6M A;  2RHS B;  3VR5 A;  1ROD A;  4NMZ A;  4FF4 A;  4AQY L;  1HR0 W;  2MFI A;  4CDE C;  2BA0 A;  3HG9 A;  5LMU Q;  4GS3 A;  5A2Q E;  4APV A;  4B9X A;  2I5H A;  2F0G A;  1EEI D;  2K33 A;  5C3E H;  3GTO H;  3HGB A;  4A93 B;  1X3E A;  1STG A;  4KKU A;  3VDY A;  1KRT A;  1EY7 A;  4ABN A;  5FO7 B;  3CCJ A;  5IT9 c;  1FR3 A;  4RKL A;  3NTH A;  3S1N H;  5I4D A;  3ER0 A;  1F9S A;  1Q86 C;  4N9P A;  3D4D A;  1BKB A;  3CQZ B;  3HKS A;  3BZK A;  2EY5 A;  2E2I H;  3UE0 A;  4X65 L;  4DR6 Q;  1UNS A;  2K5D A;  2QIL A;  2HDM A;  2WAC A;  5DM6 3;  2KEE A;  1RD9 D;  1XTC D;  4A3E B;  3BVG A;  3MWY W;  3KF6 A;  3PF5 A;  1WTH A;  1Y1W B;  3I55 A;  1G6Z A;  4QUC A;  4M1U B;  1XNQ Q;  5C6A A;  2KCT A;  3JC6 6;  3OW7 A;  2X6G A;  3BJU A;  3PUV A;  3BZC A;  1MSG A;  4DAM A;  4A3J B;  4DR2 Q;  2UXC L;  4UAI A;  4YHH L;  2YU9 B;  1PRT D;  1G91 A;  3EIV A;  1D8L A;  3PO2 B;  1A6X A;  3CF5 A;  1LT3 D;  1NE3 A;  4B3T Q;  1STY A;  4RGN A;  3V96 A;  3C1F A;  1O7I A;  1K8G A;  3AU7 A;  2I46 A;  1EY5 A;  1CUK A;  5C4J H;  3K57 A;  5AJ3 Q;  5A35 A;  1BXT A;  2JXM B;  4LJZ C;  3GDE A;  3I4L A;  3F2U A;  2JA5 B;  2BDN A;  2DJF C;  2B2T A;  1XYI A;  2AUK A;  1F9P A;  5I6Y A;  2L11 A;  2EYP A;  3I56 A;  5CBA E;  1KC8 C;  5CV8 A;  4NXN L;  3ITP A;  3CMA A;  1YNX A;  4DF7 A;  4ODG A;  5T1G A;  1A8V A;  3HKZ E;  4KKS A;  3LWU A;  5M3M H;  2A69 C;  3PO3 H;  2XSC A;  2HUG A;  3T53 B;  1GUG A;  3KOJ A;  3TN2 A;  4RCO A;  1CZG A;  3CCU A;  2IHF A;  1GD7 A;  1IKM A;  4CBV A;  2IJ0 A;  4A76 A;  3F8T A;  1G6P A;  2HT1 A;  1TVX A;  2R7F A;  2QF7 A;  3PIP A;  1AE3 A;  3TRZ A;  2A6H C;  4GOP A;  1AZP A;  4PZ8 A;  4IAL A;  3W5O A;  5IGG A;  3J80 c;  1GO3 E;  2LSS A;  2EJG C;  2V1C C;  1VCI A;  4IUV A;  2K75 A;  4YWK A;  2L9H A;  1HNW Q;  2K04 A;  3AFP A;  1TWC H;  4HTH A;  1I6V C;  5C0X H;  1RF2 D;  5E4W C;  2CW0 D;  4GNX C;  5C44 G;  1HUN A;  1Y8P B;  3RMH A;  1LTA D;  1QNK A;  2LY7 A;  4IJL A;  4PMC A;  3K0X A;  1FGU A;  4C2M H;  2HDL A;  2D0P A;  3M4O B;  4KHV A;  3D31 A;  1IBK Q;  5C4X B;  1A0I A;  3GTP B;  3HP3 A;  4DV7 L;  4FDB A;  5C4Z A;  2QDB A;  1KAW A;  2XNA C;  1MIU A;  2RDF A;  3JAM i;  4IUN A;  4L5S A;  1I94 Q;  5COR A;  5ELC A;  4H0L C;  4IN3 A;  1SRO A;  4C3I H;  5FLX c;  5EPL A;  1BBW A;  4DK0 A;  3WOF A;  4LF9 Q;  2KA7 A;  1F9Q A;  3OHX C;  1XNR Q;  2J4X A;  2EY1 A;  1MGS A;  4L63 B;  1IBM Q;  2KED A;  1SEB D;  3DM3 A;  4RAU C;  2UU9 L;  2ZTE A;  2RDG A;  4P71 A;  1JR0 D;  1EU4 A;  2LMC B;  3RLF A;  3Q6S A;  1ENF A;  1CT1 D;  4FF2 A;  2DY8 A;  1DOK A;  3KDF A;  4BY1 H;  3SK4 A;  1PHJ A;  2JEA I;  1HXY D;  1AN8 A;  2PZT A;  3T1H L;  3M4Q A;  1WI5 A;  3EA6 A;  1BNZ A;  2XRQ D;  4ZUI A;  2D0O A;  4QUF A;  1GUW A;  2C35 B;  1EYD A;  1XMQ L;  4JI3 Q;  1OO9 B;  1E24 A;  2F0O A;  3AEV A;  1C9O A;  1SE8 A;  2SNM A;  1IXR A;  2K52 A;  4KN4 C;  1SNC A;  1CA6 A;  1VF7 A;  2G9D A;  4DV4 Q;  1CHQ D;  3QWN A;  4A3M H;  4A3F B;  3D6C A;  2NUC A;  3MEF A;  2MGS A;  3L0O A;  1EOT A;  4P74 A;  1EL0 A;  1JIC A;  5E3F A;  4I65 A;  4G57 A;  5GQO A;  5CYU A;  1WTP A;  4MIU A;  1HPC A;  3ULP A;  3Q0A A;  1Y14 B;  2PQA A;  1H9S B;  3M3Y H;  4BXX G;  2R7Z H;  2ZXR A;  3RZD B;  4JVZ A;  4KD4 A;  3U58 A;  5CV5 A;  4QCL A;  1BO0 A;  5IP7 H;  2RQX A;  1L0W A;  1UUP A;  1V9P A;  2P5Z X;  4A4I A;  1PVO A;  2CWA A;  4PG3 A;  3K8A A;  3VYR A;  4QIW B;  1T9H A;  1HR0 Q;  2ZTC A;  4DPG A;  1E2V A;  3HOY B;  1C8C A;  4KHP Q;  4QY7 A;  2CH4 W;  2HCC A;  1A3U A;  3I91 A;  2NWG A;  1CI3 M;  1VQJ A;  4MTN A;  5LMN L;  1BBX C;  1YJ9 A;  1X54 A;  1LTL A;  4C3H B;  3MXN A;  4G7O C;  2NTS A;  1LUZ A;  3NBH B;  4IOA A;  1U0L A;  3A5Z B;  1LLR D;  1K9M C;  1B53 A;  5JPM C;  4A93 H;  1OXX K;  3H3V C;  4JI0 L;  4QF4 A;  1SE4 A;  4GNX A;  3CRK C;  1SYF A;  3E0E A;  2KUM A;  4FNF A;  1PDQ A;  1PH8 A;  2R92 B;  3CQZ H;  5CBE E;  5EAY A;  1N34 L;  3SHL A;  2N55 A;  1WTQ A;  3FKI H;  1ENC A;  1Q12 A;  1VQI A;  2VS1 A;  3MTS A;  3MXG A;  1GM5 A;  1AZQ A;  4A3E H;  1HFG A;  2PZW A;  2K5Q A;  4A3C G;  3I73 A;  3NQT A;  1HJP A;  5IP9 G;  2EYM A;  1S4Z A;  3E5S A;  1Y1W H;  3TDQ A;  2VUM B;  4RGM A;  2K50 A;  1Y8N B;  1YNJ D;  1ILP A;  4DV7 Q;  5IE8 A;  4DR3 Q;  1EIF A;  2WAQ B;  1S40 A;  2OTJ A;  3PQI A;  3L9A X;  3K7A H;  4RHS A;  2F0N A;  4OIK A;  2B2V A;  1I4R A;  2FMC A;  4I7Z C;  1I4X A;  2B3G A;  1QVF A;  3SK6 A;  2VY3 A;  4A3J H;  2F0U A;  5FO8 B;  4DR7 L;  2YU9 H;  1PZJ D;  1V8Q A;  1YJW A;  5HUR A;  1D5Z C;  4MTK A;  3PO2 H;  4IZ8 A;  4DV0 L;  3RZO B;  2JA6 G;  2F0V A;  3R93 A;  3J81 E;  4ZK9 B;  4A3G B;  2OTL A;  2UU9 Q;  1MHW C;  3UDI A;  3QOJ A;  4FF3 A;  1YNJ C;  1Q1B A;  2XWJ B;  1TWH H;  2BE5 C;  5KIX A;  2ZJP A;  2F3V A;  4UP9 A;  4IFD J;  4K6L A;  1FD7 D;  4QJF A;  2DNE A;  4HR7 B;  1FL0 A;  2L55 A;  2JA5 H;  4ME5 A;  4AYB B;  3LNN A;  2KOL A;  1N9W A;  4EVO A;  4IUU A;  1TS2 A;  4EQN A;  1S5C D;  5M5W B;  1SRU A;  1SND A;  3ERS X;  4OX9 Q;  3MZ5 A;  3OMG A;  2XVS A;  1CTM A;  2IW3 A;  3NPP A;  2PO4 A;  1SN8 A;  1TR5 A;  2E2D C;  4TVA B;  4A3B G;  3HOV G;  2R61 A;  4KN7 C;  5FOB B;  1I4G A;  4ALP A;  1CQF A;  5IGC A;  4BBR G;  5BN4 A;  5JAV A;  4N9T A;  1DGS A;  2HIX A;  1WCM B;  4BY7 H;  2QDL A;  5K36 H;  5IWA Q;  3RN5 A;  4DV2 Q;  2NVY B;  1EFW A;  2BCO A;  1PXU A;  3M4P A;  2G5D A;  1F2Z A;  1IHZ A;  1NUC A;  1AW7 A;  2WKD A;  2R7D A;  2WB1 E;  4TKO B;  5DAU A;  1WD1 A;  4XQJ A;  1LYL A;  5LMU L;  1NMF A;  4XT3 B;  2UXB Q;  1H9M A;  4HJA A;  1KDA A;  1SYC A;  2F0K A;  1KAB A;  1WD0 A;  3CP0 A;  1EIG A;  1HTL D;  3J7A V;  5C4X H;  5IYC G;  1VQ6 A;  4KJN A;  2L12 A;  5JJK A;  4J15 A;  2PMZ E;  3AMU A;  3EQL C;  1GHJ A;  2PMZ B;  5FJ8 H;  2KHI A;  3RLN A;  5KND A;  1HNZ L;  5LMN Q;  2IWH A;  1KD1 C;  1O78 A;  1SNQ A;  3HOZ G;  2R93 H;  1Q1E A;  1CSP A;  3VYU A;  1D1K A;  4C1N I;  1E22 A;  3RLO A;  4WFN 3;  1PMR A;  4P75 A;  5CR3 A;  2I07 B;  2D62 A;  4X66 L;  1PH9 A;  4JCV E;  1PA6 A;  3H3V I;  4R4I A;  1DYQ A;  2L15 A;  2K4K A;  2KVM A;  2EPB A;  4HJ5 A;  1EOV A;  2FJ2 A;  2XGT A;  4JC0 A;  2Q8T A;  2OEO A;  2CH4 A;  1XNQ L;  5IYD G;  4MNO A;  2OF1 A;  2TSS A;  4R8N A;  2ZTD A;  1E0B A;  2PNR C;  1XX8 A;  2PCF B;  4JOI C;  2K5V A;  3IRB A;  4FP5 D;  1WOC A;  1GHK A;  4DR2 L;  1R9T B;  1TWA B;  3PF4 A;  1I3Q H;  1FJG Q;  1S72 A;  1HZC A;  4NXM Q;  3EJI A;  3HS0 C;  4B3T L;  4JV5 Q;  4IO9 A;  1TWF B;  3KF8 B;  5T1I A;  2ZM6 Q;  3HOW B;  3J80 L;  5JEA H;  4FXK C;  4C56 C;  3KJP A;  1EY0 A;  4LF6 Q;  2IL8 A;  3BDL A;  4A3F H;  1B9N A;  1B3Q A;  1DON A;  4TQU S;  2F0S A;  4DV3 Q;  1CKN B;  4H13 C;  4HJ8 A;  5AJ3 L;  2L5T A;  3I72 A;  1QIL A;  4J6H A;  4B3M Q;  1PH1 A;  3SR1 A;  3I4M G;  3KBX A;  3DEP A;  3ND8 A;  1EQT A;  3VA7 A;  5EKL A;  4F87 A;  1VQD A;  2A1A A;  3STB D;  2M2L A;  3GTG B;  1EZ8 A;  1I4H A;  2OT2 A;  5M3F B;  2K5N A;  3I4N B;  3UE1 A;  4XYQ A;  3CU7 A;  2VB2 X;  4K5V A;  4DAV A;  1YZ6 A;  4IUP A;  2HHH L;  1J8I A;  1TY0 A;  5K5P A;  2B2T C;  1PFM A;  2E74 C;  4YCW A;  4DNT B;  5C5L A;  3C2P A;  2KCM A;  4NB3 A;  4HCS A;  2K03 A;  5E1F A;  1PH7 A;  4EGV A;  1TQO A;  2MHV A;  4OO1 G;  1R4Q B;  1V1P B;  1PV4 A;  1JQY D;  1WYD A;  4X62 L;  2Q8R E;  4GLV B;  1O7Y A;  1IW7 C;  5E7N A;  1RIP A;  3HOY H;  4JI5 Q;  2NVX B;  2WII B;  2J7Z A;  4LF5 L;  3PUW A;  3J81 L;  1LT6 D;  4HMJ A;  3AQQ A;  3GD7 A;  5C3E G;  1LT4 D;  3BZD B;  2VQF Q;  3PMF A;  4P73 A;  3PSI A;  1E2W A;  1HNW L;  4C3H H;  4LF4 L;  3KLS X;  4GOP C;  3KFU A;  4EQ5 A;  3DXJ C;  4DN4 M;  2O4X A;  1JOO A;  2WAQ G;  4K5W A;  3KLS A;  3LX0 A;  1UEA B;  3U9O A;  1H9S A;  4DV5 Q;  2IT1 A;  1IBK L;  3ICE A;  1EY9 A;  2WP8 J;  4DV6 Q;  1U9R A;  4DNR B;  2C5C A;  2R92 H;  1X9N A;  1EQR A;  2RSN A;  4R4Q A;  1QB5 D;  2KEN A;  3TS2 A;  1H95 A;  1I94 L;  3ULL A;  4DA2 A;  3OTO Q;  1LTR D;  4JBM A;  5GAD C;  1X55 A;  1H9K A;  4LF9 L;  1XNR L;  1X65 A;  2CVR A;  1IBM L;  2VUM H;  2MNA A;  1NR2 A;  4M8A A;  2QW7 A;  4OEM B;  4A3I B;  1L2F A;  3HOU B;  4FXD A;  3WOE A;  2HQE A;  3TRE A;  1D1I A;  3NBH A;  5ELN A;  4PQX A;  1HNZ Q;  1O80 A;  5J3B A;  1X3F A;  3KYH C;  1U4P A;  5EPJ A;  3TZD A;  1T5X D;  3K80 C;  1VMP A;  1HZB A;  1UE1 A;  2CQO A;  3AYH B;  4RMF A;  3FKI B;  4IQZ A;  4QB4 A;  3L7Z C;  3M7G A;  4X66 Q;  4JI3 L;  3RZO H;  2RA4 A;  2XWB B;  1CZW A;  4A3G H;  1PZK D;  2M00 A;  3VR3 A;  4R8I A;  2VW9 A;  1HNX Q;  1P8L A;  4JOI A;  2AQ1 B;  2EJM A;  2F4V Q;  3TS0 A;  5LHY 1;  4DV4 L;  1ICW A;  1F2L A;  5IIF A;  1PFB A;  4JI8 L;  1JWS D;  4OO1 I;  1X32 A;  2E2J H;  1DZ1 A;  3K7A B;  2RCF A;  2JSO A;  5FLM H;  3W2D A;  4IFD H;  1C0A A;  5M3M G;  2LKV A;  5M5W H;  5KYI A;  3FP9 A;  3O13 A;  2XRS D;  3PO3 G;  3H09 A;  3SXH A;  1NR4 A;  4LUZ A;  4R1J A;  4TRD A;  1KAA A;  1N33 Q;  3OOC A;  2CWP A;  2K28 A;  2Z4H A;  3NEM A;  3DWP A;  3J7Z C;  4DK6 C;  1PFN A;  1ZEQ X;  2KBN A;  1MJC A;  1TWH B;  4A3K B;  2PPB C;  1XPO A;  1HZA A;  2EYL A;  2PW5 A;  2ENB A;  1I6H B;  4YY3 L;  3F2C A;  2QA4 A;  3FDT A;  1KDC A;  1JB3 A;  1B3A A;  1P16 A;  1QVC A;  3H0G B;  4NKL A;  4BA1 I;  4DUZ Q;  1HR0 L;  3X3N A;  1ONL A;  1WCM H;  1NBW A;  3HEJ A;  3A0J A;  5C0X G;  4BBS B;  1EWI A;  1PRT C;  2MO1 A;  3CPF A;  4C3J B;  2NVY H;  4KY7 A;  1WFQ A;  5IGF A;  4KHP L;  3PIP 3;  5M5Y B;  3FEW X;  2QGQ A;  4KV6 A;  3A54 A;  2F0M A;  3TP7 A;  2NVQ H;  3VYS A;  2HHH Q;  3HKZ B;  3GTL B;  3JAM c;  4K2K A;  1W3S A;  3HRZ C;  4L8J A;  3A5U A;  1EEF D;  4OWX B;  2L4N A;  2JP1 A;  4IOC A;  1VQH A;  4X62 Q;  4PZ7 A;  4Y52 H;  3NHH A;  1E3P A;  4BY7 B;  4C3I G;  1EYG A;  4QL5 A;  1VQ8 A;  1GVP A;  1LTG D;  1SNP A;  4LF5 Q;  5EBD A;  4KHZ A;  3KLW A;  1B8A A;  1KTK A;  1PYW D;  4LF4 Q;  1LM0 A;  4PV1 C;  2O2L D;  1YVC A;  3GTJ H;  1K3R A;  2L0C A;  3MHB A;  4YCU A;  2Q8I B;  1NAP A;  1JMC A;  3TME A;  1A3T A;  3MXP A;  1DOL A;  1I4P A;  2NN6 H;  4BY1 G;  4IJH A;  1RDP D;  4KY5 A;  3UI2 A;  1Z9F A;  2V4D A;  4DR3 L;  4MHE A;  1SYD A;  4HSP A;  3TQY A;  3KK7 A;  1JJ2 A;  3VA5 A;  3GTM B;  3CW2 C;  5IGE A;  1DJR D;  1YIJ A;  1TS3 A;  2R93 B;  5ELD A;  2N88 A;  3A56 A;  1VQA A;  4GN5 A;  2Z1C A;  4UPA A;  1STN A;  1R9T H;  2SDF A;  2CW0 C;  1TWA H;  5GAG C;  4A3M G;  1YJN A;  2FHT A;  1CM9 A;  5H1S E;  3QR8 A;  3S16 H;  1GUS A;  1DM0 B;  3UDG A;  1TWF H;  5LL6 S;  3MA2 B;  3S1M H;  3HOW H;  2B2V C;  1SDF A;  5BR8 Q;  1HA6 A;  1HA5 A;  2O5J C;  4JI2 Q;  4O0A A;  5IT9 E;  1W2B A;  5HGT A;  3OYY A;  3OPO A;  3R2I A;  3D3R A;  2Z6K A;  3S1R H;  1VF5 C;  2R7Z G;  2RBM A;  5C0X I;  1KQS A;  3WWV A;  4Y7N B;  3J80 i;  2HQL A;  3A8I E;  1BF4 A;  4F7X A;  1I3Q B;  4JG2 A;  3GTG H;  1TS4 A;  2ZXP A;  5M3F H;  4GKK Q;  1AE2 A;  5IP7 G;  1IZ6 A;  3I4N H;  3B6Y A;  4OX9 L;  2Y0S G;  1SSO A;  2AQ3 B;  3TP6 A;  2FFK B;  1VQK A;  2K1B A;  3H91 A;  4DFA A;  1ASY A;  4JI8 Q;  2F0Q A;  3EBE A;  2CQA A;  2G9H D;  2WV6 D;  3ZJY C;  4L6T B;  2A19 A;  1SLJ A;  2FMM A;  3FHW A;  1T5E A;  3GV6 A;  3AB9 A;  2JA8 H;  2A74 C;  2PI2 E;  2NVX H;  1CKN A;  5IWA L;  1JWM D;  4DV2 L;  3CAM A;  3N52 A;  2RHQ B;  1WTV A;  2Z4I A;  4GKJ Q;  4A93 G;  3CC7 A;  1HCZ A;  1D7Q A;  4EQP A;  2BDO A;  3K0Y A;  1Q8I A;  2NZ1 D;  1EQQ A;  1C4Q A;  4PMW A;  2JN4 A;  4XQQ A;  4YY3 Q;  2UXB L;  4LF8 Q;  3CHB D;  1HTP A;  4RG1 A;  2TMP A;  3J81 i;  4CJ2 C;  4OXP A;  1YHB A;  3P7J A;  3HZX A;  2B63 B;  1BBU A;  3A8J E;  3FKI G;  2KHJ A;  3R2T A;  4CDD C;  1K0R A;  3T16 A;  4A3E G;  1PFS A;  1V1P A;  2MQH A;  4DK3 C;  4O42 A;  1Y1W G;  5I2X A;  3DEO A;  3BYT B;  4ZCK A;  3S1Q B;  1IL8 A;  2F0H A;  1BUV T;  3GQB A;  4IUR A;  3F2B A;  2EVB A;  3GV3 A;  4OON A;  1ASZ A;  4K5X A;  4A3I H;  3HOU H;  4KY6 A;  4IPC A;  4B08 A;  5J39 A;  4CKB A;  3J80 E;  4A3J G;  3R3O A;  4JI6 L;  5C4H A;  2MO0 A;  4UY8 C;  3PO2 G;  1KNA A;  2JK8 A;  1OXT A;  2NB0 A;  4XQN A;  1JB7 A;  2A68 D;  3Q23 A;  4KTA A;  3CC4 A;  3CCM A;  2AWN A;  1K8A C;  1JE5 A;  4B3R Q;  2B2U A;  4U67 3;  2EY6 A;  3FPU B;  2B2W C;  1FJG L;  3VR6 A;  1GUO A;  3J7A 5;  3K5N A;  3HOX B;  4NXM L;  1TXY A;  1TU2 B;  2A8V A;  5IOD A;  3QO2 A;  2DY7 A;  2JA5 G;  4JV5 L;  1H9R A;  1K8O A;  2ZM6 L;  1Z7T A;  1C7Y A;  3UDX A;  4K14 A;  4LF6 L;  4DV3 L;  4QGU A;  1SYG A; 
#chains in the Genus database with same CATH homology
 2A68 C;  5CV4 A;  2KCC A;  1KLG D;  3MVV A;  5FLX E;  5I9P A;  3M85 A;  4NP5 A;  1TKW B;  1WTO A;  1TY2 A;  3SK5 A;  4V0B A;  3OIQ A;  5C3X A;  4KMU C;  2AWO A;  2E2J B;  5K36 G;  1L0Y B;  2F0T A;  1S5F D;  4P2C B;  4NW2 A;  4FVM A;  1H9J A;  1V43 A;  4WJW A;  5M5X B;  4ZKC B;  2D9U A;  1F2M A;  3P1H A;  3E0J A;  1A2T A;  1MD2 D;  5IT9 L;  3OSO A;  1BDO A;  4UDU C;  3MFG A;  5EKK A;  4LK1 C;  3S15 B;  1U4L A;  5IOC A;  3OMC A;  1EZ6 A;  3QG1 A;  4GZY C;  1B50 A;  1SBB B;  5BN3 A;  3QOL A;  4R9W A;  1G8Z D;  2NVQ B;  1ILQ A;  2WB1 B;  1SXT A;  2QEJ C;  4IUQ A;  3OWE B;  3T4A C;  3DM1 A;  2H4O A;  4DU9 A;  4DXF A;  1TWG B;  1F9R A;  1G29 1;  3I70 A;  5G3L F;  3MC0 B;  1GOZ A;  3RD4 A;  1D2B A;  3N6R A;  3SK8 A;  3TBI B;  2XN9 C;  4RH6 A;  1STH A;  1AFP A;  3DMU A;  3C1E A;  3A7A B;  2F0J A;  1JCK B;  1V1O A;  5JEA G;  3GTJ B;  2WKC A;  1S5E D;  2SOB A;  2VXW A;  5C0X J;  5JVH 3;  2VB3 X;  1AEX A;  4HN7 A;  2B2W A;  1PTO F;  1FNV A;  1UAP A;  1SNO A;  3T51 B;  4FO2 A;  3CKI B;  4FXG C;  1Z6H A;  5KGU A;  2EDG A;  3L3O C;  5JJZ A;  2RSO A;  3S16 B;  3S1M B;  2JYO A;  3S9W A;  2F0E A;  4XDX A;  5DNF A;  3I90 A;  4O1N A;  1F2Y A;  1NSN S;  5D3I B;  5J22 A;  3S1R B;  1HFN A;  3S17 B;  1BOS A;  2EYF A;  4C3H G;  1HQR D;  1U4R A;  4KD3 A;  2PZU A;  5C44 B;  3SDZ A;  4F8M A;  1EIH A;  1JWU D;  3BVM A;  3J7A F;  1PZI D;  1RTN A;  1SE2 A;  2A6E D;  3S2D B;  4DAP A;  2F0W A;  2EOT A;  1EYA A;  5FKA C;  5FLX L;  3R8B A;  3S2H B;  3LWE A;  4EQO A;  2JA8 B;  4OHJ A;  1ZKO A;  2R6G A;  2A5H A;  2KQ3 A;  3CRL C;  2D5D A;  5KRU A;  1EQV A;  1KLU D;  1LO5 D;  5IGD A;  3NWT A;  1M4V A;  1JOR A;  2X69 A;  4NDX A;  5EBC A;  1QWY A;  4CJ0 B;  3MAQ A;  1D5X C;  1YNN D;  1I50 B;  3SEB A;  1LV9 A;  3ERO A;  1U4M A;  1PTO B;  4ZAI A;  1JOK A;  5LL6 X;  2ICE C;  4LAA A;  5CV6 A;  3J7Y W;  3WDN A;  3URY A;  3TP8 A;  2EXZ A;  1W6K A;  1RKN A;  1LAB A;  1YNN C;  4J8Q A;  2K01 A;  4J1M A;  4FYD A;  4IFD G;  3IL8 A;  2B8G A;  2ZT9 C;  2SEB D;  1EY8 A;  1WTX A;  2F0P A;  1HRJ A;  5C5M A;  2NVT B;  4C1N K;  4KK7 A;  1OXV A;  1S5D D;  4K8J A;  1DCZ A;  2A73 B;  3ONA B;  2X6L A;  1CQV A;  5M9O A;  2F0F A;  3Q22 A;  3ND9 A;  3KBG A;  1K83 B;  3BDC A;  1II3 A;  3C46 A;  1L0X B;  1HQM C;  1ZYR D;  2FIN B;  3GO5 A;  2F4I A;  1F77 A;  2EJF C;  4DXG A;  1NCV A;  1PLF A;  2O5I C;  1Z47 A;  1DXM A;  1K8M A;  3IFT A;  4IUT A;  2RVL A;  4RA8 A;  4RGO S;  3NSW A;  4BS9 A;  1B44 D;  3QJY A;  1LT5 D;  3P75 A;  1ESR A;  1ZYR C;  4DK1 A;  3FPP A;  4X3S A;  2EY2 A;  5G3L D;  1Q90 A;  3SVM A;  4QMG A;  4RHR A;  4RGT A;  5FO9 B;  1OXU A;  2A69 D;  5ELF A;  3GTK B;  2R3Z A;  2LFN A;  1KNE A;  3S14 B;  4CKC A;  2NN6 G;  4CJ1 B;  3H94 A;  5CC4 A;  1ESF A;  2A6H D;  3X3M A;  4HSV A;  5EKI A;  2ZXO A;  2K6A A;  2DNC A;  3T56 B;  3BG3 A;  4MN3 A;  4IFD I;  1G2S A;  2IX1 A;  4G7Z C;  4ULL A;  1GJX A;  2IX0 A;  1RTO A;  1PTO D;  5JVG 3;  5NUC A;  4B9W A;  2AQ2 B;  3PV0 A;  4ILW A;  2JA6 B;  1STB A;  3I3C A;  4S3S A;  2EYJ A;  3NXW A;  4OL7 A;  2K32 A;  3NWS A;  1EY4 A;  4HAE A;  1STA A;  4OGQ C;  4XXE A;  4Q5V A;  5EJW A;  1O7Z A;  1STE A;  3OIP A;  4KI0 A;  3NTI A;  1C48 A;  1TII D;  5COY A;  2B2U C;  5FK9 C;  1PTO C;  2NBF A;  1JC7 A;  3D6W A;  4ID6 A;  2KHS A;  5C3W A;  2KEC A;  5I6W A;  2B39 A;  3K5M A;  2F1M A;  5TSS A;  2L1B A;  4A3B B;  3GTQ B;  1Y69 U;  3HOV B;  1RHP A;  5KNC A;  3I8Z A;  4BBR B;  2EYO A;  1S5B D;  2QKI C;  2NTT A;  1QOH A;  2B2Y C;  4E6I A;  3M7N A;  2K7V A;  2OXP A;  1SMY D;  1VMC A;  1Y1V B;  1EFI D;  5KYL A;  2F0D A;  2JE6 I;  3ERQ A;  1AP0 A;  3IKJ A;  1BCP F;  5EQ0 A;  2M9V A;  4PNY A;  4Q0F A;  1HHV A;  2NN6 I;  2PYK A;  4K8I A;  3IFD A;  4PMB A;  2SNS A;  4CGY B;  5A2Q L;  3QB3 A;  4ZRZ A;  2F0L A;  1E2Z A;  1EY6 A;  3VYT A;  5JEA J;  3KF8 A;  4RWS C;  1SMY C;  3HOZ B;  4BWG B;  1DOM A;  3A7L A;  3KLR A;  2IX3 A;  1MI2 A;  3DUZ A;  3A8K E;  4JK1 C;  1SJE D;  5JOB A;  5ISR A;  3W3A A;  2LS0 1;  1FGB D;  2K5W A;  5BN5 A;  1O7L A;  2ID0 A;  2J0T D;  3K59 A;  3NE5 B;  4DGZ A;  2CHB D;  1PTO H;  5D14 A;  3TP5 A;  5ELB A;  1A3V A;  3VR4 A;  3JAM E;  4ZLT F;  3PUZ A;  4DAY A;  3KUP A;  4ZYS A;  1JOQ A;  1HUM A;  3BDO A;  4HED A;  3I4M B;  3V05 A;  4V19 0;  1ZXT A;  1SJH D;  5CV7 A;  2MUY A;  4Z9C B;  1CFM A;  2MJ8 A;  1WVL A;  3MEH A;  1R4P B;  3NP8 A;  1BCP B;  3M4Y A;  5JPN C;  3G7L A;  1M8A A;  2RDH A;  2GA4 B;  1ML0 D;  1X3Q A;  2JEB I;  5CV9 A;  1EWC A;  1EU3 A;  1LTS D;  4C3J G;  1B2T A;  1ET9 A;  2JA7 B;  1SYB A;  4A3D B;  2QCP X;  2B8F A;  3DWQ A;  3GTO B;  2C9O A;  5C3E B;  2BOS A;  2BA1 A;  4X3K A;  2DN8 A;  4ZUJ A;  4OIJ A;  5IGB A;  1FYC A;  3NTK A;  5E4X A;  2BE5 D;  2B2Y A;  3S1N B;  3ZYY X;  1OXS C;  1CK1 A;  3BVZ A;  1IYV A;  3V2T A;  2E2I B;  3PUY A;  2MP1 A;  2K05 A;  3NK9 A;  5DM7 3;  1EWH A;  3D4W A;  5ELE A;  4FF1 A;  2PQE A;  2F03 A;  4WOR A;  3Q24 A;  3K5O A;  1TS5 A;  3BS1 A;  3K6O A;  1FNW A;  4TSS A;  2KCN A;  5CGK A;  3MXU A;  1LTB D;  3OWF A;  3E6Z X;  2E2H B;  1SYE A;  5DEH A;  2VNU D;  1B4O A;  3BYY B;  1KDB A;  4H7B A;  5D65 A;  4KJO A;  1VDZ A;  2E76 C;  4XYO A;  3TZU A;  4XT1 B;  2E75 C;  5EPK A;  2WIN B;  1J9O A;  3PUX A;  3NUC A;  4G4K A;  5C4J B;  3K5L A;  2EZV A;  1JE4 A;  1LAC A;  5I9O A;  5KNB A;  4KKT A;  1WTW A;  3FRP B;  3DWA A;  4H44 C;  1Y8O B;  1B1Z A;  4XIG S;  3FMC A;  1PRT F;  1TT2 A;  3NQI A;  3VR2 A;  2D2C C;  4F88 A;  2NYZ D;  2YYZ A;  5KEE A;  1XXG A;  4ZKB B;  5M3M B;  1SE3 A;  2F0I A;  3GP7 A;  5I2Y A;  1SFO B;  3DHQ A;  3PO3 B;  5CMD A;  5AFW A;  4YIJ A;  3K58 A;  1SAP A;  1QE6 A;  4U68 A;  5F2D A;  2PW7 A;  4K2L A;  1ENA A;  1BCP D;  3RUZ A;  1GUT A;  1QCB D;  1RCV D;  1QJO A;  5J1Z A;  1TWC B;  1XWE A;  2Z8L A;  3JAM L;  4CHT B;  4C2M B;  3D4R A;  1A2U A;  1RJT A;  1BCP C;  1X3P A;  5D3D A;  4ZQ3 A;  3SE0 A;  3C3L A;  3T13 A;  2H1E A;  3G6J B;  1MBY A;  3IAY A;  2EYH A;  4C3I B;  4G7H C;  1ET6 A;  4WRD A;  1W6J A;  3QIA A;  4RFB A;  1Q3L A;  2RKS A;  2XIW A;  1GXD C;  1QG7 A;  3PIO 3;  2HCI A;  4BY1 B;  1IW7 D;  2EE1 A;  1PRT B;  1WTR A;  2KJX A;  3U9S A;  3TSS A;  1A15 A;  4X3U A;  3NBI A;  1D5M C;  4RCN A;  4A3M B;  1BQQ T;  1G2T A;  1EYC A;  1DD2 A;  1IYU A;  1SNM A;  2A6E C;  3EVQ A;  1LTT D;  3FVQ A;  2ICI A;  4RKB A;  4K6D A;  1LTI D;  3MFY A;  3M3Y B;  1FNU A;  1GUN A;  2IPK D;  2R7Z B;  2AUJ D;  1IKL A;  1D6E C;  4XTC S;  4CKE A;  4BA2 I;  3P20 A;  4JBW A;  4LMQ D;  3EFX D;  2MPM A;  2F3W A;  1BR9 A;  1B9M A;  1QNU A;  2Y0S B;  3A55 A;  4HMI A;  1I4Q A;  1MSH A;  5EGT A;  3D8G A;  4X3T A;  1CA5 A;  1CHP D;  4HCE A;  4OO1 H;  3H6M A;  3VR5 A;  1ROD A;  4NMZ A;  4FF4 A;  2BA0 A;  3HG9 A;  5A2Q E;  4B9X A;  2F0G A;  1EEI D;  2K33 A;  3HGB A;  4A93 B;  1STG A;  4KKU A;  1EY7 A;  4ABN A;  5FO7 B;  1FR3 A;  4RKL A;  3NTH A;  5I4D A;  1F9S A;  4N9P A;  3D4D A;  3CQZ B;  2EY5 A;  1UNS A;  2K5D A;  2QIL A;  2HDM A;  2WAC A;  5DM6 3;  2KEE A;  1RD9 D;  1XTC D;  4A3E B;  3BVG A;  3MWY W;  1Y1W B;  1G6Z A;  4QUC A;  4M1U B;  5C6A A;  3OW7 A;  2X6G A;  3PUV A;  1MSG A;  4A3J B;  4UAI A;  2YU9 B;  1PRT D;  1G91 A;  3PO2 B;  1A6X A;  1LT3 D;  1STY A;  4RGN A;  3V96 A;  3C1F A;  3AU7 A;  2I46 A;  1EY5 A;  3K57 A;  5A35 A;  1BXT A;  2JXM B;  4LJZ C;  3I4L A;  3F2U A;  2JA5 B;  2BDN A;  2B2T A;  1XYI A;  2AUK A;  1F9P A;  5I6Y A;  2L11 A;  2EYP A;  5CBA E;  5CV8 A;  3ITP A;  4DF7 A;  4ODG A;  5T1G A;  4KKS A;  3LWU A;  2A69 C;  2XSC A;  2HUG A;  3T53 B;  1GUG A;  3TN2 A;  4RCO A;  1CZG A;  1IKM A;  4CBV A;  2IJ0 A;  1TVX A;  2QF7 A;  2A6H C;  1AZP A;  4IAL A;  5IGG A;  2EJG C;  1VCI A;  4IUV A;  2L9H A;  2K04 A;  4HTH A;  1I6V C;  5C0X H;  1RF2 D;  5E4W C;  2CW0 D;  1HUN A;  1Y8P B;  3RMH A;  1LTA D;  1QNK A;  2LY7 A;  4PMC A;  2HDL A;  3M4O B;  4KHV A;  3D31 A;  5C4X B;  3GTP B;  3HP3 A;  5C4Z A;  2QDB A;  2XNA C;  2RDF A;  4IUN A;  5COR A;  5ELC A;  4H0L C;  4IN3 A;  5EPL A;  4DK0 A;  3WOF A;  2KA7 A;  1F9Q A;  3OHX C;  2J4X A;  2EY1 A;  1MGS A;  4L63 B;  2KED A;  1SEB D;  4RAU C;  2RDG A;  1JR0 D;  1EU4 A;  2LMC B;  3RLF A;  3Q6S A;  1ENF A;  1CT1 D;  4FF2 A;  2DY8 A;  1DOK A;  3SK4 A;  2JEA I;  1HXY D;  1AN8 A;  2PZT A;  3EA6 A;  1BNZ A;  2XRQ D;  4ZUI A;  1GUW A;  4QUF A;  1EYD A;  1OO9 B;  2F0O A;  2SNM A;  1CA6 A;  4KN4 C;  1SNC A;  1VF7 A;  2G9D A;  1CHQ D;  3QWN A;  4A3F B;  3D6C A;  2NUC A;  2MGS A;  1EOT A;  1EL0 A;  1JIC A;  5E3F A;  4I65 A;  4G57 A;  5CYU A;  1WTP A;  4MIU A;  1HPC A;  3Q0A A;  1H9S B;  2ZXR A;  3RZD B;  4KD4 A;  5CV5 A;  4QCL A;  1BO0 A;  2RQX A;  1UUP A;  3VYR A;  4QIW B;  1E2V A;  3HOY B;  1C8C A;  2HCC A;  1A3U A;  3I91 A;  2NWG A;  1CI3 M;  1BBX C;  4C3H B;  3MXN A;  4G7O C;  2NTS A;  1LLR D;  1B53 A;  5JPM C;  1OXX K;  3H3V C;  4QF4 A;  1SE4 A;  3CRK C;  1SYF A;  2KUM A;  4FNF A;  1PDQ A;  2R92 B;  5CBE E;  3SHL A;  2N55 A;  1WTQ A;  1ENC A;  1Q12 A;  3MTS A;  3MXG A;  1AZQ A;  1HFG A;  2PZW A;  2K5Q A;  3I73 A;  3NQT A;  2EYM A;  1S4Z A;  3E5S A;  3TDQ A;  2VUM B;  4RGM A;  1Y8N B;  1YNJ D;  1ILP A;  2WAQ B;  3L9A X;  4RHS A;  2F0N A;  4OIK A;  2B2V A;  1I4R A;  2FMC A;  4I7Z C;  1I4X A;  3SK6 A;  2F0U A;  5FO8 B;  1PZJ D;  1V8Q A;  5HUR A;  1D5Z C;  4IZ8 A;  3RZO B;  2F0V A;  3R93 A;  3J81 E;  4ZK9 B;  4A3G B;  3QOJ A;  4FF3 A;  1YNJ C;  1Q1B A;  2XWJ B;  2BE5 C;  5KIX A;  2F3V A;  4IFD J;  4K6L A;  1FD7 D;  2DNE A;  4HR7 B;  2L55 A;  4ME5 A;  4AYB B;  3LNN A;  2KOL A;  4EVO A;  4IUU A;  1TS2 A;  4EQN A;  1S5C D;  5M5W B;  1SND A;  3MZ5 A;  2XVS A;  3OMG A;  1CTM A;  2IW3 A;  3NPP A;  2PO4 A;  1TR5 A;  2E2D C;  2R61 A;  4KN7 C;  5FOB B;  1I4G A;  1CQF A;  5IGC A;  5BN4 A;  5JAV A;  4N9T A;  1WCM B;  5K36 H;  2NVY B;  2BCO A;  1PXU A;  5DAU A;  1F2Z A;  1IHZ A;  1NUC A;  1AW7 A;  2WKD A;  4TKO B;  1WD1 A;  4XQJ A;  4XT3 B;  1H9M A;  1KDA A;  1SYC A;  2F0K A;  1KAB A;  1WD0 A;  1EIG A;  1HTL D;  3J7A V;  4KJN A;  2L12 A;  3AMU A;  3EQL C;  1GHJ A;  2PMZ B;  5KND A;  2IWH A;  1O78 A;  1SNQ A;  1Q1E A;  3VYU A;  1D1K A;  4C1N I;  4WFN 3;  1PMR A;  5CR3 A;  2I07 B;  2D62 A;  1DYQ A;  2KVM A;  2EPB A;  2FJ2 A;  2Q8T A;  2OEO A;  2OF1 A;  2TSS A;  4R8N A;  1E0B A;  2PNR C;  1XX8 A;  2PCF B;  4FP5 D;  1GHK A;  1R9T B;  1TWA B;  3EJI A;  3HS0 C;  1TWF B;  5T1I A;  3HOW B;  3J80 L;  5JEA H;  4FXK C;  4C56 C;  1EY0 A;  2IL8 A;  3BDL A;  1B9N A;  1DON A;  4TQU S;  2F0S A;  4H13 C;  2L5T A;  3I72 A;  1QIL A;  4J6H A;  3SR1 A;  3KBX A;  3DEP A;  3ND8 A;  1EQT A;  3VA7 A;  5EKL A;  4F87 A;  2M2L A;  3GTG B;  1EZ8 A;  1I4H A;  2OT2 A;  5M3F B;  3I4N B;  4XYQ A;  3CU7 A;  2VB2 X;  4K5V A;  4DAV A;  4IUP A;  1J8I A;  1TY0 A;  5K5P A;  2B2T C;  1PFM A;  2E74 C;  4DNT B;  5C5L A;  3C2P A;  4HCS A;  2K03 A;  5E1F A;  4EGV A;  1TQO A;  2MHV A;  4OO1 G;  1R4Q B;  1V1P B;  1JQY D;  2Q8R E;  1O7Y A;  1IW7 C;  2NVX B;  2WII B;  2J7Z A;  3PUW A;  3J81 L;  1LT6 D;  4HMJ A;  3GD7 A;  1LT4 D;  3BZD B;  3PMF A;  1E2W A;  3KLS X;  3DXJ C;  4DN4 M;  2O4X A;  1JOO A;  4K5W A;  3KLS A;  3LX0 A;  1UEA B;  3U9O A;  1H9S A;  2IT1 A;  1EY9 A;  2WP8 J;  1U9R A;  4DNR B;  2C5C A;  2RSN A;  1QB5 D;  4DA2 A;  1LTR D;  1H9K A;  2CVR A;  1NR2 A;  4M8A A;  4A3I B;  3HOU B;  4FXD A;  3WOE A;  2HQE A;  1D1I A;  3NBH A;  4PQX A;  1O80 A;  5EPJ A;  1U4P A;  3TZD A;  1T5X D;  1VMP A;  3FKI B;  4IQZ A;  4QB4 A;  3L7Z C;  3M7G A;  2RA4 A;  2XWB B;  1CZW A;  1PZK D;  2M00 A;  3VR3 A;  4R8I A;  2AQ1 B;  2EJM A;  5LHY 1;  1ICW A;  1F2L A;  5IIF A;  1PFB A;  1JWS D;  4OO1 I;  1X32 A;  1DZ1 A;  3K7A B;  2JSO A;  3W2D A;  4IFD H;  2LKV A;  5KYI A;  3O13 A;  2XRS D;  3H09 A;  3SXH A;  1NR4 A;  4TRD A;  1KAA A;  3OOC A;  2K28 A;  2Z4H A;  3DWP A;  1PFN A;  1ZEQ X;  4A3K B;  2PPB C;  1TWH B;  2EYL A;  2PW5 A;  2ENB A;  1I6H B;  3FDT A;  1KDC A;  1JB3 A;  1B3A A;  3H0G B;  4NKL A;  4BA1 I;  3X3N A;  1ONL A;  3HEJ A;  5C0X G;  4BBS B;  1PRT C;  4C3J B;  4KY7 A;  5IGF A;  3PIP 3;  5M5Y B;  3FEW X;  4KV6 A;  3A54 A;  2F0M A;  3TP7 A;  3VYS A;  3HKZ B;  3GTL B;  4K2K A;  3HRZ C;  4L8J A;  1EEF D;  2L4N A;  2JP1 A;  3NHH A;  4BY7 B;  4C3I G;  1LTG D;  1SNP A;  5EBD A;  4KHZ A;  1KTK A;  1PYW D;  4PV1 C;  2O2L D;  2L0C A;  3MHB A;  2Q8I B;  1NAP A;  3TME A;  1A3T A;  3MXP A;  1DOL A;  1I4P A;  2NN6 H;  1RDP D;  4KY5 A;  3UI2 A;  2V4D A;  4MHE A;  1SYD A;  4HSP A;  3KK7 A;  3VA5 A;  3GTM B;  5IGE A;  1DJR D;  1TS3 A;  2R93 B;  5ELD A;  2N88 A;  3A56 A;  2Z1C A;  1STN A;  2SDF A;  2CW0 C;  2FHT A;  1CM9 A;  1GUS A;  1DM0 B;  5LL6 S;  3MA2 B;  2B2V C;  1SDF A;  1HA6 A;  1HA5 A;  2O5J C;  5IT9 E;  5HGT A;  3OPO A;  3R2I A;  3D3R A;  1VF5 C;  2RBM A;  5C0X I;  4Y7N B;  3A8I E;  1BF4 A;  4F7X A;  1I3Q B;  1TS4 A;  2ZXP A;  1SSO A;  2AQ3 B;  3TP6 A;  2FFK B;  2K1B A;  3H91 A;  4DFA A;  2F0Q A;  2CQA A;  2G9H D;  2WV6 D;  4L6T B;  2FMM A;  1T5E A;  3GV6 A;  3AB9 A;  2A74 C;  1JWM D;  3N52 A;  1WTV A;  2Z4I A;  1HCZ A;  4EQP A;  2BDO A;  3K0Y A;  1Q8I A;  2NZ1 D;  1C4Q A;  4PMW A;  4XQQ A;  3CHB D;  1HTP A;  2TMP A;  4CJ2 C;  3P7J A;  3HZX A;  2B63 B;  3A8J E;  3R2T A;  3T16 A;  1V1P A;  4O42 A;  5I2X A;  3DEO A;  3BYT B;  3S1Q B;  1IL8 A;  2F0H A;  1BUV T;  3GQB A;  4IUR A;  2EVB A;  3GV3 A;  4K5X A;  4KY6 A;  4B08 A;  5J39 A;  4CKB A;  3J80 E;  3R3O A;  5C4H A;  1KNA A;  1OXT A;  2NB0 A;  4XQN A;  2A68 D;  3Q23 A;  4KTA A;  2AWN A;  2B2U A;  4U67 3;  2EY6 A;  3FPU B;  2B2W C;  3VR6 A;  1GUO A;  3K5N A;  3HOX B;  1TU2 B;  5IOD A;  3QO2 A;  2DY7 A;  1H9R A;  1K8O A;  1Z7T A;  4K14 A;  1SYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...