2FMMA

Crystal structure of emsy-hp1 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
b'EKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein EMSY
publication title Crystal structure of the HP1-EMSY complex reveals an unusual mode of HP1 binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 13
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2fmmA00
1MGSA 2EE1A 1RTOA 2K03A 1EIHA 2L9HA 1F9SA 3LWEA 4HAEA 1HRJA 2KEDA 1O7YA 2B2UA 1J9OA 4RA8A 4ZLTF 1DZ1A 1QE6A 2B2YC 4QUCA 1QNKA 3N52A 2Q8RE 1PFMA 4ZAIA 1HUNA 2EPBA 1CM9A 1BF4A 5EQ0A 2K04A 5T1GA 1NCVA 1IL8A 1EL0A 2M2LA 3G7LA 1HA6A 1M8AA 4ZKBB 2N88A 1G2SA 1SSOA 5CMDA 1AP0A 4ZKCB 1NR2A 1DOMA 2IL8A 3QO2A 1HFGA 3FPUB 1G2TA 3GV6A 1X3QA 2HDLA 2KVMA 4IURA 2HCCA 5E4XA 4IUPA 2FHTA 3DEOA 1LV9A 4HCSA 4X3SA 3D6WA 4DN4M 1BO0A 3KBXA 4R8IA 1WD1A 1SDFA 4ZK9B 4HSVA 2B2TC 2JP1A 2L12A 3P7JA 2RSNA 3R93A 1ILPA 4LMQD 5D14A 4O42A 2H1EA 1ICWA 5JJZA 1O80A 1B4OA 1U4MA 5DNFA 1RODA 3GV3A 2MP1A 2K28A 4IUTA 1X32A 4X3TA 4CJ1B 1KNAA 1WTPA 1F9PA 2MJ8A 2B2WC 2MGSA 3I8ZA 4XT3B 1B50A 1CA6A 1S4ZA 1U4PA 4XT1B 1PLFA 1TVXA 1PFBA 2B2YA 2HDMA 1VMCA 2L11A 4IUQA 4NW2A 4U68A 5EJWA 1WTOA 1C8CA 1G6ZA 2X69A 1U4LA 1RTNA 1NAPA 1U4RA 2R3ZA 2K01A 1DONA 2CVRA 4MN3A 1J8IA 1XX8A 2RA4A 1DOLA 1QG7A 5EPKA 3SVMA 2HCIA 2DY7A 2KUMA 1WVLA 2FJ2A 1B2TA 3MWYW 1F2LA 2VXWA 3TZDA 1JE4A 2JYOA 3F2UA 2X6LA 3DM1A 2J7ZA 1O7ZA 1Q3LA 5D65A 1MSGA 2FINB 3H91A 1HHVA 2B2VC 3I91A 2L4NA 2RVLA 4R9WA 3UI2A 1WTRA 1E0BA 4XDXA 2MPMA 2KOLA 2L1BA 4UAIA 2D9UA 1HUMA 4IUVA 2B2TA 2B2UC 2Q8TA 5E4WC 4CJ0B 1ILQA 3TN2A 1HFNA 4HEDA 1XYIA 5AFWA 1PFNA 1RHPA 5EKIA 2KECA 1WTQA 1DOKA 1WTXA 2KEEA 2EOTA 2FMMA 2HUGA 2NZ1D 5CORA 1BNZA 5EPLA 1KNEA 4X3KA 3IL8A 2K05A 1WD0A 1MSHA 2NYZD 2X6GA 1GUWA 3IFDA 2B2WA 2FFKB 1F9RA 5CBAE 1MI2A 1AZPA 1VMPA 3HP3A 4CJ2C 4OIJA 4RWSC 3FDTA 4OIKA 4RAUC 3I90A 1IKLA 1JICA 1ML0D 2K1BA 4MHEA 1NR4A 1F9QA 1B53A 5COYA 4QUFA 1ESRA 1A15A 4IUUA 3ONAB 1SAPA 2NWGA 3I3CA 1EQTA 3DEPA 5EPJA 2RSOA 1BBXC 3MTSA 1X3PA 5CBEE 1B3AA 1EIGA 3Q6SA 1CA5A 2DY8A 1RJTA 5T1IA 1IKMA 2N55A 1EOTA 1ZXTA 4X3UA 1WTWA 1AZQA 1G91A 2SDFA 1PDQA 2B2VA 2BDNA 1WTVA 2XIWA 3KUPA
chains in the Genus database with same CATH superfamily
2K03A 1K83H 2RHQB 5C3EH 1XMOL 4LFCL 2JA5B 2C9OA 2WV6D 3R3OA 4H44C 1NTGA 3O13A 2JA8H 3FVQA 3H0GG 3NENA 2R92H 4A93B 4ZAIA 4XXEA 4L5QA 1HXYD 1P16A 4LF6L 2A1AA 1SYGA 2ENBA 2UXBQ 1DOMA 1LUZA 1FD7D 3FPUB 3QJYA 2K14A 2RCNA 1PRTF 1BO0A 1CZGA 1W2BA 1FGBD 2L12A 1ILPA 5LHY1 4LMQD 1XNRQ 2PQAB 5JJZA 4C3HG 1TWCH 2Z8LA 2E76C 5JOBA 1B44D 3I8ZA 5IP7H 1CQVA 5BR8Q 5C4JB 1G291 1NE3A 3MEFA 4IUNA 1PLFA 5ELFA 2B2YA 3W1GA 3EVQA 4DV5Q 3J7AF 3VR2A 2ZJQA 1ENFA 2LXJA 4U673 4IOCA 5IT9L 3EROA 3OWFA 1B2TA 4A3CG 4DV6Q 3FEWX 2QEJC 1AEXA 1Q3LA 3H91A 4BBSB 2B2VC 2L4NA 4WJ4A 2XRQD 4JOIA 4IUVA 4BXXH 3TN2A 3ER0A 2EXZA 3W3AA 3SK6A 1XNRL 3HOUH 1PRTD 1KLUD 2P5ZX 1A0IA 3DHQA 3D8GA 4NB3A 4DR6Q 1RIPA 4FXKC 2SNSA 1SXTA 2NZOA 2JXMB 4EVOA 3CW2C 1TWFH 2IPKD 4IUUA 3TRZA 5BR8L 4KHPQ 5CYUA 1SLJA 2HQEA 2K7VA 1TU2B 3ERSX 4DV5L 3K0YA 1EIGA 1H9RA 2KCMA 4LF9Q 3T1HQ 3NWSA 5C44B 3RMHA 2JA7H 1Q1EA 2E8GA 1QVGA 2XWBB 3VR5A 4DV6L 4QY7A 5FO9B 5C4XG 4JI7Q 1P8LA 1NY4A 2H5XA 3DWPA 4HSPA 4IQZA 2OEOA 3FMCA 3NXWA 5I4DA 5JVH3 1PFMA 4XQJA 3UE0A 2I07B 3K7AB 2F03A 2K04A 4UY8C 4G57A 1VQDA 3OSOA 3I4MB 2ATWA 1GOZA 2BA1A 3QWNA 1G2SA 5CMDA 4DR6L 5HY6A 4V0BA 3J7YW 3DEOA 3D31A 5FO8B 2K5WA 3F1ZA 3S1QB 4KHPL 2OQ0A 4JI2L 1B4OA 3K57A 3HZXA 3UDGA 3CP0A 5C4XH 4LF9L 5GAGC 3T1HL 3NELA 2BDOA 4KV6A 1C0AA 1PH7A 2ZT9C 4ZQ3A 1B50A 1F2ZA 1E7ZA 2JEAI 1I4RA 1Q8KA 2Q2IA 4JI7L 5C5LA 5IWAL 3JAMc 1RKNA 2R93B 4HJ8A 1Y14B 2KUMA 3QOJA 4MTNA 3P1HA 3WDNA 1O7LA 4PZ8A 1LTGD 4UDUC 4RFBA 1BBWA 1H95A 4H13C 3A74A 4ME5A 5ELCA 4I65A 2NZHA 4AQYQ 3H09A 2JK8A 3CD6A 2B2TA 1Y1VB 4KN7C 4FXGC 1EFWA 1S5FD 1EU3A 3EQLC 4WORA 1KL9A 1S40A 4C3IH 4A3DH 1WTQA 1YI2A 3V2TA 4Q5VA 2K5HA 4H0LC 3IFDA 1FJGQ 1TS5A 3I4NB 1ZKOA 3J7A5 4DV2Q 3T13A 3PO3B 4GKKQ 1IKLA 2LY7A 3DLLA 3S2DB 4PQXA 3C1EA 1K8OA 2K5QA 4DXGA 5K5PA 1BR9A 2KHSA 2EIFA 4HMJA 2NTSA 3R2TA 3M4QA 1JQYD 3J7ZC 3ND8A 1L0YB 1VQGA 3EFXD 5I6WA 3GTLH 2EJFC 2SDFA 3A7AB 2F3VA 1H9SA 1TS2A 2DGYA 2DN8A 2EE1A 4GOPA 1UEBA 2AWNA 1ZYRD 1J9OA 3HOZB 1I5FA 3FP9A 4MTKA 5M3MG 3P75A 1WTHA 2KCCA 1IZ6A 1CM9A 4DV3Q 1PH6A 2VB3X 1D6EC 4JC0A 3LNNA 3PUXA 3G7LA 1LLRD 3FKIG 4LF7Q 5JJLA 2EY6A 1FJGL 2ZXPA 4DV2L 1X9NA 4GKKL 4DN4M 3FHWA 1SDFA 5G3LD 4DR1Q 2E5LL 4DR5Q 4KK7A 2JA6B 4APVA 4HJ5A 4A93G 2VUMG 4X3TA 1UEAB 4IN3A 1L1OB 2B2WC 5M3MH 4XIGS 4QL5A 4KY5A 4RH6A 1TVXA 4IOAA 2ALYB 3T56B 2EJGC 1E2VA 2AWOA 1H9MA 1TY0A 1XX8A 2YV5A 3I56A 3KF8A 3QB3A 1LTLA 1F2LA 4YIJA 3PIO3 4RGMA 2ASBA 1QZHA 1HHVA 1PFSA 2WAQB 2RVLA 1L0WA 1GKHA 1CK1A 4CDFC 2JA5H 4A3BG 2YTXA 1NUCA 1CKMA 5C5MA 2DNCA 5EBCA 2EY5A 4A93H 3HS0C 4CJ0B 1FNWA 2JE6I 2O5JC 2VY3A 4DR1L 1PTOB 2OXPA 2KEEA 4JVZA 1UAPA 4DR5L 1VDZA 4A3IB 2X6GA 1SFOB 1KC8C 5C0XH 2CW0C 4RAUC 2PMZB 1ESRA 5IYBG 4BBSG 4Y7NB 3NQTA 4K0KQ 2CWPA 1G8ZD 1HTLD 4V190 1D8LA 3KF6A 4LK1C 3H15A 2KHIA 1CA5A 2DY8A 2JN4A 1IKMA 1CHPD 3K5MA 1LTSD 2XWJB 1EY4A 4DV0L 1L0XB 1BBUA 2B2VA 4MZ9A 4LF5L 4IPGA 1QUQA 5C4JH 2PMZE 1I4HA 1PMRA 3QOLA 1J5EQ 1UE5A 4KD3A 2CKZB 1QE6A 3KOJA 3ERQA 4C56C 3H0GB 3K0XA 3MAQA 1WYDA 5ISRA 1TWHB 1BF4A 5EQ0A 5T1GA 5DM63 1EWHA 1I94Q 1SYFA 5IYBH 4BBSH 1CI3M 1GXDC 1WFQA 1X65A 5EGTA 5C44G 1STYA 3MHBA 4FVMA 1NBWA 5CV7A 3CRLC 5C4ZA 4IUPA 2FHTA 3KBXA 3JAMi 4K0KL 2AQ3B 4O42A 3PF5A 3S1NB 2XGTA 4C3HB 5DNFA 1RODA 1WJJA 4L5TA 3RR5A 1QOHA 2NTTA 1RL2A 5DM73 4GS3A 3T51B 1LTBD 3E6ZX 3J80i 5C6AA 3PGZA 1LT6D 2LMCB 3UE1A 5CC4A 1JWSD 4FP5D 3I4OA 3NTIA 4LF8Q 3JAML 5IODA 1U4RA 1SYDA 4KHVA 1XNQL 5IOCA 2Z6BA 5C44H 2I5MX 5CV5A 4DR4L 5KNCA 3D6CA 4GLAC 4QGUA 1E1TA 2VW9A 2B63G 1LT5D 2X6LA 2DJGC 1I94L 3J80L 2A74C 4OGQC 4GLVB 4YWMA 1YHAA 3SK8A 1JWMD 2Q8TA 2IX3A 5IYCG 1KD1C 4RGTA 3K7AH 2FXQA 4ME3A 2PPBC 1A3TA 5IE8A 3I4MH 3E0EA 1KLGD 2K5DA 1N36Q 2R93G 1BCPB 5HURA 3CCRA 3I90A 2N78A 4OELB 1HTPA 1JR0D 3RLFA 1UNSA 3S1QH 2NUCA 2EVBA 1JT8A 2K4KA 5EPJA 3RUZA 2PYKA 2IHFA 3E3XA 3MTSA 4LF8L 1VQEA 5C0XJ 1RDPD 4ZCKA 5T1IA 2CH4W 1Z7TA 1CFMA 4X3UA 4DA2A 1AZQA 3MC0B 1WTVA 5JJKA 5IYCH 3NBIA 2XIWA 4R4CA 5AJ3Q 3LGJA 3C46A 1QZGA 4HAEA 1KIXA 1NJIC 4EQ5A 2EDGA 3SDZA 3KJPA 3CCLA 1PYWD 2WIIB 3BS1A 2EYFA 2R93H 2VZAA 3N52A 4B3SQ 4HR7B 1JMCA 4KMUC 4QB4A 3TS2A 1JE5A 2AQ1B 5IT9E 4JYAQ 2OF1A 3H6MA 4K2LA 3OOCA 3PUZA 4RCNA 1IBKQ 2A8VA 1A63A 1WCMB 1EYCA 3PV0A 4ZKCB 1N36L 1ENAA 1YNXA 4B3RQ 4JI0L 1X3QA 1Y1VH 2HCCA 1L2FA 3NTHA 1C48A 1X6OA 2XTIA 1LTID 3CMEA 4K14A 4JI5Q 2F0UA 3HOZG 1STBA 2NVYB 2PNRC 2N49A 3I4NH 1ONLA 1X32A 3S2DH 3PO3H 2LKVA 2KJXA 3BDLA 1E22A 1GHKA 5AJ3L 2LFNA 3NBHB 4C1NI 2JQOA 3OWEB 4OONA 1HZ9A 1IYJB 3RZDB 2V4DA 2CVRA 3HKSA 1QG7A 2HCIA 4B3SL 1YHBA 1L1OC 5E1FA 3K8AA 4OO1H 4BBRG 4JYAL 3MXGA 1LYLA 3PIOA 1IBKL 1NMGA 1EWCA 2FMCA 1E0BA 1T5XD 4B3RL 2L1BA 3HOZH 3J81c 1BUVT 1CSPA 1EZ8A 5LMNQ 4X62Q 3A8IE 2EZVA 1EIYB 3CRKC 4FYDA 2HUGA 1GUGA 3M4OB 1MSHA 2NYZD 2B2WA 2L0CA 1XJVA 1MJEA 3L7ZC 4MHEA 2F4VQ 2VS1A 1EY0A 1F9QA 1AW7A 1SMXA 2PW7A 1VQFA 1H9KA 3R2IA 4PZ6A 5LMUQ 1KAAA 3G71A 2GVAA 2XVSA 3A7LA 5J39A 1X3PA 1O78A 4A3LG 1JWUD 3U4VA 2JA6H 4DNRB 4PMWA 4IFDH 2ES2A 2GVBA 2BDNA 3ZYYX 1LTTD 3CPFA 4LF6Q 2ZJRA 2A6HD 5KEEA 5C0XI 2IJ0A 2K33A 1I4GA 3SEBA 2ID0A 3KDFA 4FF3A 1KAWA 1E2WA 1KDAA 3J7AV 1SE8A 3AU7A 4ABNA 1HUNA 1XWEA 3S15B 4X62L 1S3OA 1HJPA 3LX0A 2G9HD 2K5NA 3CC2A 1IL8A 3U50C 3MFGA 2XRSD 3SXHA 2IHEA 2QKIC 1AE2A 5KGUA 1EUJA 1M8AA 2Q2UA 3FKIB 2PNHA 3F2BA 1EY9A 3S24A 4DR2Q 4B9XA 5E4XA 2RDFA 2F4VL 3D6WA 5LMUL 4P74A 4WFN3 2JSOA 1PTOH 1PA6A 1SNPA 1CKNB 1PZJD 3NQIA 5NUCA 4A3IH 2UUAQ 3S14B 4CKBA 1SFOH 2KCNA 4L8JA 2KA7A 2VUMB 1KNAA 1STHA 2A6HC 1GO3E 4ODGA 5D3IB 4HIMA 4Y7NH 2E2JB 5JJIA 1PFBA 3LWUA 1T5EA 1VMCA 4J1MA 1JJCB 4LNQA 2D0PA 1WI5A 4BY1B 2NVXB 2L15A 5C3XA 3ND9A 1I4XA 4GN4B 4LAAA 5E7NA 2LS01 3I2ZA 4JCVE 4KD4A 1TXYA 4MNOA 2ZTCA 4K6LA 3TDQA 3CCMA 4A3BB 1SNOA 1B1ZA 5E3FA 1HUMA 2R7FA 4DR2L 3H0GH 3S1MB 4KKUA 4DAYA 4EQPA 1HFNA 1TWHH 1TWGB 2EYHA 3P20A 4K6DA 2PZUA 1XTDA 2JA9A 1PZKD 4Y52H 5CORA 2UUAL 1EY8A 1D1KA 3OHXC 3KLSX 1WOCA 1V1PA 3I72A 4QUFA 1PV4A 1SYEA 2RDHA 1NNXA 3WOEA 2UXCQ 3C1FA 4AIMA 1O7IA 1EQTA 2Z9HA 4L5SA 2IX0A 5FKAC 4ID6A 3S1NH 2Z6KA 4C3HH 3GD7A 5M5XB 1I6VC 3TQYA 1BCPC 3IKJA 4RG1A 4HJ9A 1HNXQ 3PF4A 1V43A 1EEID 4UHVA 4J8QA 5IGGA 3A54A 5LL6X 4XTCS 2XNAC 3VR6A 2K50A 4IPHA 2EXDA 1XMQQ 3HOXB 1K8MA 2NB0A 1F2YA 4IFDJ 1I4QA 2ZTEA 2QEXA 1EY5A 2R61A 1TS4A 4C3JG 4A3CH 4TKOB 4JI2Q 1NCVA 5A35A 4CDDC 1D5XC 2HQLA 4GNXB 4L63B 1QILA 1SN8A 2IW3A 1SSOA 2AQ2B 1VS0A 2F0QA 2HT1A 1S5ED 3K5OA 4HCSA 4ZUJA 3WOFA 1ET9A 2F0SA 4HSVA 2UXCL 2RSNA 3W2DA 2MNAA 5IWAQ 3TREA 3Q23A 2LSSA 1VQCA 3QR8A 4ZRZA 4H02A 3K5LA 4IZ8A 1HNXL 1CZWA 3H3VC 3GTKB 2K5VA 1JJGA 3MXUA 1OXTA 1WCMG 3VYTA 1XMQL 4J15A 2R3ZA 1DYQA 3J81j 1DONA 2WFWA 1LT4D 4X65Q 1VQPA 2B63B 4JV5Q 1EYGA 3U9OA 5GAHC 5D65A 3GDEA 3TBIB 1MSGA 2EQSA 1IBLQ 2F0LA 2KOLA 2B2UC 2KQ3A 4RGNA 1K0SA 3D0FA 1DOKA 1WCMH 3STBD 1X56A 3W5OA 4OO1I 3EIVA 4R8NA 3NP8A 4OHJA 4P2CB 3VR3A 3H3VH 3M7NA 3ONAB 3I3CA 1II3A 1BBXC 5KIXA 1PH2A 1STEA 2KHJA 2A73B 2K52A 2NVYH 2N55A 1WTWA 4X65L 4A3JB 4KTAA 3RLOA 4JV5L 5FLXL 4RKLA 1JC7A 1PH5A 1F9SA 2F4IA 1DJRD 3LWEA 3VR4A 3KBGA 4YY3Q 2CWAA 1IBLL 1NSNS 5G3LF 2CQOA 3CQZB 4RA8A 4ZLTF 3RZDH 1EEFD 1K9MC 1VQ9A 2Q8RE 3JAME 1GUTA 1SJHD 4OL7A 2F0OA 2E5LQ 2E75C 2QILA 2GA4B 3STBC 5KYLA 4LF4Q 4IFDI 3RLNA 1PYSB 3J80E 1YIJA 4CDCC 4PG3A 4IURA 1F77A 3M4YA 4KN4C 1HQMC 1A2UA 1LV9A 1EYDA 2QW7A 2JP1A 1ASYA 4KY7A 5D14A 3KLWA 4HIDA 3EN2A 1U4MA 3OIQA 3M4OH 1N32L 2EY2A 4OX9Q 4XQNA 2QDLA 2A69D 4DK0A 1LO5D 1X3EA 1Z47A 4NW2A 4YY3L 1A8VA 1U9RA 1OO9B 3SR1A 4DNTB 3C3LA 4TVAB 1WVLA 3ULJA 3EA6A 4DGZA 5BN3A 4A3FB 1Y1WG 1VCIA 2VXWA 1JE4A 4BBRB 1F2MA 1U0LA 2WB1E 4LF4L 1X3GA 2IY5B 2KBNA 1YNND 2D9UA 4K5XA 5I2YA 4HIOA 1TKWB 2NN6G 2CW0D 1MHWC 3S15H 1ILQA 1HR0W 1UE1A 1CT1D 4NXMQ 3MEHA 2NZ1D 4YWKA 3PO2B 1PXUA 1SMYC 4BY1G 3PUWA 3FKIH 4DV0Q 1BDOA 2A69C 2MHVA 1AZPA 4OX9L 4LFBL 4UPAA 3GTQB 4LF5Q 1ML0D 3L9AX 5COYA 4NXNQ 2NWGA 4A3MB 1EZ6A 4KI0A 3S14H 1IYUA 2AMCB 1K8GA 3T16A 3Q0AA 1VQHA 1EOTA 2VUMH 3A5ZB 5M5YB 1SBBB 3BYTB 4YHHL 4DPGA 5IY0A 2K75A 2B29A 1HZBA 1QJOA 2E2JH 2KEDA 3OIPA 4DAVA 1O7YA 2F0JA 1B70B 1YNNC 4TQUS 3CCUA 2BE5C 3BU2A 4BY1H 2NVXH 1SNMA 4IALA 3Q24A 3AMUA 3KLSA 1PZID 3KFUA 3A56A 3OW2A 1QNUA 1B7YB 4UP9A 3F2DA 4NXML 2R6GA 1PYBA 3FPPA 4ZKBB 1SROA 1STAA 2IT1A 4A3BH 3CAMA 1H9SB 4GOPB 2F0MA 1E3PA 5J22A 3S1MH 2C35B 1I6HB 5CR3A 1TWGH 1PH3A 4NXNL 1X54A 1YVCA 2B39A 1SNQA 3FRPB 3P7JA 3HOXG 1XNQQ 2I5HA 1XPUA 5F2DA 2CH4A 2IWHA 3SK4A 4DR4Q 1DGSA 4CJ1B 2WKCA 2HIXA 3PCOB 3K80C 1D2BA 3W1BA 2MJ8A 4OWWB 2MGSA 4QQBX 4LJZC 4DR3L 3BJUA 3GTPB 4BA1I 2X69A 5M5XH 2K32A 1J8IA 1S72A 5EPKA 3L3OC 4A4IA 2DY7A 3HOWG 4P71A 1FVIA 4P75A 3M4PA 4DK1A 2MFIA 4M1UB 4HIKA 2HHHL 1STGA 3HOXH 1D5ZC 1Q90A 4GKJQ 4PMCA 4HCEA 3A0JA 2I46A 4GN5A 5AFWA 1WTXA 4B08A 3KF8B 2QF7A 4X64Q 2FFKB 1F9RA 4EQNA 5CBAE 3CXCA 1MI2A 1VMPA 1EFID 5FJ8G 3G6JB 1B53A 3MXNA 5C3WA 3DEPA 2RQXA 3BDCA 2JEBI 1B3AA 2G5DA 3B6YA 1FGUA 1G91A 1Y8OB 4S3SA 4KJNA 1RF2D 1VQKA 3GTKH 3I73A 3U9SA 4WJ3M 1EIHA 2A6ED 3NUCA 4JBJA 3VA5A 4I7ZC 4A3GB 2G9DA 1A62A 1KTKA 4CDEC 2QDBA 2B2UA 1YHQA 4JI0Q 2BH2A 4GKJL 3H3VI 1YJNA 3ITPA 4DXFA 3GTMB 2BH8A 2UUBQ 3TEHB 3KF6B 4C3JB 2O5IC 2B63H 2F0TA 2KENA 4IPDA 2RKSA 5ELEA 3D4RA 4DAMA 1GUSA 4JK1C 3T4AC 5M5WB 3MA2B 3TMEA 4XYOA 1TQOA 1QUQB 1W3SA 2A5HA 3QO2A 4X64L 1G2TA 4A75A 1UE7A 4A3JG 4JBKA 1N33Q 4R8IA 1BKBA 4POFA 4K5VA 4DV4Q 4HJ7A 3I70A 1CQFA 2D0OA 4B9WA 1O80A 1W6JA 2F0VA 4QJFA 5J1ZA 2NVTB 4QF4A 2YTYA 1Y8PB 3M9BA 2K28A 3GO5A 4BWGB 1Q1BA 1HH2P 3A55A 2XN9C 2A6EC 1CA6A 2ICIA 2R7DA 3NTKA 4U68A 2B3GA 1YEZA 2J4XA 5DEHA 1G6ZA 5EBDA 1B8AA 4R4QA 5I9PA 2E2DC 3SVMA 4A3KB 2UUBL 4A3JH 3TP8A 3AYHB 1PH8A 1G51A 1O7ZA 2MO0A 2QA4A 4L6TB 1S5DD 4FF2A 4ZYSA 4NKLA 3CQZH 2WB1G 1AFPA 5DLQE 3C2PA 1DXMA 3M7GA 1MKHA 3PQIA 4LWCA 1N33L 2A68C 3AFQA 3F8TA 5H1SE 4DV4L 3E9HA 2ZM6Q 5IYDG 3EBEA 1PTOD 1PRTB 3JC66 1LT3D 1KNEA 5A2QL 3CU7A 1SNCA 2RCFA 4A3FG 2OTLA 3X3NA 3HEJA 2MUYA 4XQQA 3K59A 1UE6A 3CKIB 2RSOA 1FR3A 1IL2A 1M4VA 5CBEE 3BVMA 4PNYA 2F3WA 1K28A 2KCTA 1D7QA 3MVVA 4PV1C 5L37A 1KDCA 1EIFA 1XPOA 3SE0A 3KUPA 1GJXA 1RTOA 3PO2G 1N8RC 1TY2A 2RHSB 4F7XA 2Y0SB 2B8FA 3DWQA 2F52A 4QUCA 1QNKA 3F2CA 3RNUA 1E2ZA 3NEMA 1YITA 4A3FH 1T9HA 2A19A 3NPPA 3A5UA 4A3MG 4DK3C 1PTOC 4BBRH 2ZM6L 2YYZA 2C5CA 3NWTA 4N8X1 1CSQA 4K8IA 3Q22A 2N88A 1QWYA 1AP0A 1JB3A 1EQVA 1Y69U 2Y0SE 4NMZA 2F0FA 2HD3A 1WD1A 3GTJB 2L5TA 4ZK9B 3Q8DA 4IJHA 4JI4Q 1MD2D 3MXPA 3PO2H 1EOVA 3GV3A 3K5NA 3GTQH 2NVQB 3UDIA 3DWAA 4F88A 2CFMA 5C3EG 4A3MH 4XT1B 1DD2A 3S1RB 3ICEA 4DNIA 1C8CA 4A3LH 1KDBA 2WKDA 4NPSA 1K3RA 1U4LA 1RTNA 1VQ7A 3CC4A 1JCKB 2ZTDA 3S9WA 3GQBA 5M5YH 1Y1WB 4X6AH 1YZ6A 1BQQT 4DK6C 1W6KA 3F2UA 2J7ZA 4OXPA 1PVOA 3T1YQ 4LFAQ 4GZYC 1E1OA 3I55A 5FLXE 2F0IA 2E74C 3QG1A 3G48A 2V1CC 2IX1A 2AUKA 4NP5A 1XYIA 5IGFA 3IFTA 4FNFA 1TIID 1Q46A 2ZXRA 4JI8L 4JI4L 1SYBA 4DUZQ 4QIWE 2F0WA 1BCPD 1J6QA 1I6HH 1D5MC 1NR4A 5IP7G 2Z4HA 4K8JA 4X66Q 4G4KA 4PMBA 4KY6A 5JVG3 3DXJC 1C7YA 2ZXOA 4AYBG 3KYHC 2AHOB 1YNJD 1R9TB 3G4SA 4FF1A 4F8MA 3T1YL 4LFAL 3GTPH 1I3QB 1MJCA 3K6OA 5FO7B 4HTHA 4YWLA 3ULPA 1MIUA 4KJOA 4BXXG 3D4WA 4WRDA 4CKCA 1HZCA 4QMGA 3KK7A 5LL6S 2M2LA 3ZJYC 4RGOS 2D5DA 4RCOA 5TSSA 3HOUG 4BY7B 4YCUA 1IYVA 4Z9CB 2EJMA 2VL6A 5JPNC 4DUZL 4XYQA 2YU9B 1K3BC 4OEMB 3HOYB 3R8BA 2GN5A 3GTGB 3KDFB 3OPOA 3G6EA 2PZWA 3S16B 1HPCA 1TWAB 4X66L 4A3GG 3PUYA 1YNJC 1EWIA 1KABA 5IGBA 1KXLA 1TT2A 5FK9C 3TSSA 1OXXK 2UXBL 2JA7G 3VA7A 1I4PA 1LACA 4HMIA 2DJFC 3E5SA 3K81C 3SK5A 1S4ZA 4Q0FA 2HDMA 1WTOA 3URYA 1K0RA 1SE3A 5JAVA 5CV4A 4MN3A 4ZUIA 1HNZQ 3HOWB 3UDFA 1C9OA 3V05A 1R4QB 3DM1A 2XSCA 4PZ7A 1CTMA 2O2LD 4A3GH 3H94A 2K6AA 2I0QA 4GN3B 1Z6HA 4RMFA 4YCWA 3D4DA 1VF7A 4CHTB 3GTMH 3NK9A 5FOBB 4C3JH 4HEDA 2F0DA 1ET6A 1RHPA 1GUOA 2KECA 4KHZA 3J81i 1LABA 2FMMA 4X3KA 5M5WH 4DAPA 1GUNA 4A3KG 3S17B 3HP3A 2D62A 4WJWA 1VQLA 4OIKA 1JICA 1OXUA 4OWXB 4JPBW 1EQQA 2UU9Q 1Q12A 4POGA 2F0EA 1PRTC 4G7HC 5GROA 4DAYB 2QGQA 2NVTH 4DV1Q 3J81L 5CV6A 4O2DA 1HNZL 4R4IA 4G7OC 1D1IA 1Q86C 1I50B 5EKLA 1PDQA 3HGBA 1B9MA 1V1PB 1B9NA 2VNUD 1YJ9A 3E0JA 4A3KH 1NMFA 3GP7A 4KKTA 2EPBA 1GD7A 4R4TA 4P72A 4C3IG 4A3DG 4BA2I 2Q2TA 1L1OA 1N32Q 3QIAA 2IL8A 3BG3A 4C2MB 3CF5A 1XPRA 3CC7A 2UU9L 2EY1A 2Y0SG 4TRDA 3RZOB 1JORA 2H4OA 3J80c 4DV1L 4FF4A 3HOVB 5FLMG 3BYYB 2CQAA 2TMPA 1WTPA 4UP8A 3BZKA 4G7ZC 1BOSA 2B8GA 1SNDA 3AFPA 1NAPA 4O1NA 5CV9A 2K01A 1VQ4A 4UP7A 2RA4A 1R4PB 5KNDA 3TZDA 3CMAA 3A8JE 3N6RA 3PUVA 4HN7A 1KHIA 1GM5A 4F87A 4A76A 1WTRA 3OW7A 4XDXA 1SMYD 2MPMA 4LFBQ 2WB1B 1V8QA 2NBFA 5E4WC 5FLMH 2R7ZB 1VQOA 4LUVA 1JJ2A 1A6XA 1PFNA 4DF7A 1VQ8A 4H7BA 2ZJPA 1UUPA 2K05A 2VB2X 1VQNA 1FYCA 2OCEA 4YHHQ 3EJIA 1M90C 4AQYL 1X55A 4NDXA 5GADC 3GTJH 1A15A 1A3VA 5JPMC 2JJQA 2VQEQ 4EGVA 1VQIA 3ULLA 3Q6SA 2BE5D 2BCOA 4KKSA 1N9WA 2NVQH 2N3SA 3AEVA 3CPWA 2E2IB 3S2HB 2F1MA 1MGSA 4RHSA 3TS0A 3BVZA 5EAYA 3S1RH 3CHBD 4P73A 2MQHA 2JA5G 2LXKA 4EQOA 1DZ1A 3BVGA 2OQKA 1OXSC 3A8KE 3CCQA 3M3YB 2Z0SA 2PI2A 1PH4A 1Y1WH 4DR7Q 5KNBA 4TSSA 1B3QA 4K2KA 5I6YA 1C4QA 1H9JA 1V1OA 1ENCA 1ZYRC 4IJLA 1QVFA 3OMCA 2E2HB 5C0XG 3VYRA 1YBYA 2HDLA 3TP5A 2NN6H 2O4XA 3K58A 4MIUA 1JOKA 2Z4IA 5M9OA 3E9IA 4DR3Q 1FNVA 4DV3L 1LM0A 1K8AC 2H1EA 2VQEL 3K7UC 2Z1CA 4A3EB 3AQQA 5A2QE 4LF7L 1BXTA 1RD9D 3GTOB 1F9PA 4XT3B 1Q7YC 3PIP3 5M3FB 4FDBA 2HHHQ 1AH9A 2F0PA 1K83B 1CUKA 5C3EB 4BY7G 4JBWA 3BDOA 3HKZB 4LUZA 2EYMA 4IUQA 5EJWA 3CCVA 4QCLA 1R9TH 1N34Q 3HOYG 3CCEA 2JA8B 1VQMA 2WAQE 2R92B 1SJED 2FJ2A 3TP6A 3VYSA 1JOQA 1VQ6A 4DR7L 1VQBA 4GNXC 2F0KA 2Q8IB 1JB7A 2FINB 1SE2A 1EQRA 3I91A 2EYOA 1I3QH 1SEBD 2PZTA 1MBYA 5ELNA 3MZ5A 3HKZE 4UAIA 2AUJD 4RHRA 2DNEA 3IRBA 2EYJA 4C1NK 1V9PA 4BY7H 5IP9G 1BNZA 3VDYA 2HIVA 3T53B 1ESFA 2J0TD 3NHHA 1EYAA 1TWCB 2YU9H 4BS9A 3HOYH 3SHLA 4CJ2C 4RWSC 3GTGH 2UUCQ 4AH6A 3S16H 1TWAH 1RCVD 1OXVA 1XTCD 2D2CC 1SAPA 2OTJA 1V1QA 4JBMA 4AYBB 1OTCA 5LMNW 1DCZA 3X3MA 1N34L 3MFYA 4L5RC 1QB5D 3V96A 4B3MQ 4DUYQ 5ELBA 2I5LX 3I4LA 2L9HA 1DM0B 3DM3A 1AN8A 3L2PA 5IP9H 4N8FA 1JOOA 1KRSA 2B2YC 4JI6Q 4AYBE 2F0NA 2F0GA 3HOWH 3M85A 1U5KA 1X3FA 5JEAG 2UXDQ 4YCVA 3PMFA 5HGTA 4ILWA 4OWTB 4JI3Q 2PW5A 3KLRA 5BN5A 3HOUB 3I4MG 4ULLA 4LUOA 5GQOA 1Q8IA 5ELOA 1J5EL 2L55A 2WINB 3L0OA 3NBHA 4N9PA 3GV6A 2EYPA 2OWOA 2PI2E 2UUCL 1TWFB 2Z6KC 4JOIC 1QCBD 1GVPA 2BA0A 1BVSA 4FO2A 5I9OA 1PH1A 1ICWA 2QCPX 4R1JA 3DMUA 3IAYA 1KQSA 3OMGA 4DKAC 4KLKA 1FNUA 4JI1Q 3S17H 1Q82C 1EY6A 5FJ8H 2JA7B 4RKBA 1Z9FA 4B3ML 1A3UA 5IGDA 4DUYL 5IGCA 3TP7A 5JEAH 5BN4A 3RD4A 3WWVA 2L11A 1E24A 4DV7Q 5I2XA 3NSWA 1HR0Q 5CV8A 1CHQD 1PTOF 5EKKA 4JI6L 1DOLA 2Q2HA 5IT9c 2DUDA 1UWVA 4DFAA 1I50H 3D3RA 1EY7A 2JYOA 2UXDL 3HRZC 2A68D 4GLXA 3CCSA 2CCZA 4JI3L 4HJAA 3TZUA 5GAEC 3UI2A 2YTVA 1QVCA 1ASZA 2EYLA 3CCJA 3OTOQ 3HOVG 3OYYA 1Y1VG 1PHJA 1LTRD 4JW0A 4IPCA 5EKIA 1K73C 1VQJA 1SR3A 5D3DA 5J3BA 2F0HA 2CHBD 3IL8A 3PSIA 1WD0A 1IHZA 5C4XB 4JI1L 2M9VA 3I4NG 4OIJA 3FDTA 4B3TQ 3PO3G 2K1BA 4C2MH 3DUZA 1A2TA 2VQFQ 5ELDA 4DV7L 3RZOH 2M00A 1HR0L 3KJOA 3HOVH 2R7ZG 2ICEC 4FXDA 3HFZB 4OO1G 3UDXA 5K36G 2PQEA 2RDGA 1HRJA 3OTOL 3MXNB 1VQAA 2SOBA 1M1KC 1HQRD 3HG9A 1Y8NB 4M8AA 1CKNA 5KRUA 2RBMA 1AE3A 2SEBD 4C3IB 4A3DB 1FL0A 3BZDB 1XXGA 3VYUA 1EL0A 4CBVA 2OT2A 1HA6A 1TR5A 1KRTA 1NR2A 1HFGA 2KVMA 1HCZA 4B3TL 2R7ZH 4N9TA 5C4HA 4X3SA 2B2TC 3R93A 5IYDH 5K36H 5HGQA 4EX5A 2VQFL 1HA5A 2BOSA 2JA6G 2MP1A 2PQAA 1SE4A 4ALPA 4IUTA 4IFDG 4IO9A 3GTLB 1IBMQ 2MO1A 1CKOA 3I7FA 4LW1A 3PIPA 1U4PA 1Q81C 4CGYB 4CKEA 2WACA 2NN6I 4I7AA 3AB9A 4JI5L 1HNWQ 1GHJA 4J6HA 3U58A 2TSSA 1ZEQX 3U4ZA 3J81E 5IGEA 2AKWB 1VQ5A 3SGIA 5KYIA 3MWYW 3BZCA 5JEAJ 2E2IH 3S2HH 1BCPF 2SNMA 4JI8Q 1IW7D 2WAQG 4O0AA 4R9WA 1SYCA 2WP8J 1XMOQ 4JG2A 4GOPC 4LFCQ 4A3EG 4K5WA 1IXRA 3M3YH 5M3FG 4R4OA 1EU4A 3HKZG 2EOTA 5FLXc 5EPLA 2RF4A 1TS3A 1VF5C 5DAUA 4A3IG 1GUWA 2JA8G 2E2HH 2R92G 1LTAD 1ICFB 2F3IA 3NE5B 4DU9A 5M3MB 2PO4A 1IBML 5LMNL 4QIWB 5CGKA 1HZAA 2PCFB 1G6PA 3RN2A 1RJTA 1HNWL 4A3EH 4E6IA 1STNA 4GNXA 1ZXTA 2N8NA 3RN5A 3GTOH 1SRUA 1YJWA 1S5CD 1PH9A 1S5BD 5M3FH 1IW7C 5IIFA
chains in the Genus database with same CATH topology
2K03A 2JA5B 2C9OA 2WV6D 3R3OA 4H44C 3O13A 3FVQA 4A93B 4ZAIA 4XXEA 1HXYD 1SYGA 2ENBA 1DOMA 1FD7D 3FPUB 3QJYA 1PRTF 1BO0A 1CZGA 1FGBD 2L12A 1ILPA 5LHY1 4LMQD 5JJZA 4C3HG 2Z8LA 2E76C 5JOBA 1B44D 3I8ZA 1CQVA 5C4JB 1G291 4IUNA 5ELFA 1PLFA 2B2YA 3EVQA 3J7AF 3VR2A 1ENFA 4U673 5IT9L 3EROA 3OWFA 1B2TA 3FEWX 2QEJC 1AEXA 1Q3LA 3H91A 4BBSB 2B2VC 2L4NA 2XRQD 4IUVA 3TN2A 2EXZA 3W3AA 3SK6A 1PRTD 1KLUD 3DHQA 3D8GA 4FXKC 2SNSA 1SXTA 2JXMB 4EVOA 2IPKD 4IUUA 5CYUA 2HQEA 2K7VA 1TU2B 3K0YA 1EIGA 1H9RA 3NWSA 5C44B 3RMHA 1Q1EA 2XWBB 3VR5A 5FO9B 3DWPA 4HSPA 4IQZA 2OEOA 3FMCA 3NXWA 5I4DA 5JVH3 1PFMA 4XQJA 2I07B 3K7AB 2F03A 2K04A 4G57A 3OSOA 3I4MB 1GOZA 2BA1A 3QWNA 1G2SA 5CMDA 4V0BA 3J7YW 3DEOA 3D31A 5FO8B 2K5WA 3S1QB 1B4OA 3K57A 3HZXA 2BDOA 4KV6A 2ZT9C 4ZQ3A 1B50A 1F2ZA 2JEAI 1I4RA 5C5LA 1RKNA 2R93B 2KUMA 3QOJA 3P1HA 3WDNA 1O7LA 1LTGD 4UDUC 4RFBA 4H13C 4ME5A 5ELCA 4I65A 3H09A 2B2TA 1Y1VB 4KN7C 4FXGC 1S5FD 1EU3A 3EQLC 4WORA 1WTQA 3V2TA 4Q5VA 4H0LC 3IFDA 1TS5A 3I4NB 1ZKOA 3T13A 3PO3B 3S2DB 1IKLA 2LY7A 4PQXA 3C1EA 1K8OA 2K5QA 4DXGA 5K5PA 1BR9A 2KHSA 4HMJA 2NTSA 3R2TA 1JQYD 3ND8A 1L0YB 3EFXD 5I6WA 2EJFC 2SDFA 3A7AB 2F3VA 1H9SA 1TS2A 2EE1A 2DN8A 2AWNA 1ZYRD 1J9OA 3HOZB 3P75A 2KCCA 1CM9A 2VB3X 1D6EC 3LNNA 3PUXA 3G7LA 1LLRD 2EY6A 2ZXPA 4DN4M 1SDFA 5G3LD 4KK7A 2JA6B 4X3TA 1UEAB 4IN3A 2B2WC 4XIGS 4KY5A 4RH6A 1TVXA 3T56B 2EJGC 1E2VA 2AWOA 1H9MA 1TY0A 1XX8A 3KF8A 3QB3A 1F2LA 4YIJA 3PIO3 4RGMA 1HHVA 2WAQB 2RVLA 1CK1A 1NUCA 5C5MA 2DNCA 5EBCA 2EY5A 3HS0C 4CJ0B 1FNWA 2JE6I 2O5JC 1PTOB 2OXPA 2KEEA 1UAPA 1VDZA 4A3IB 2X6GA 1SFOB 5C0XH 2CW0C 4RAUC 2PMZB 1ESRA 4Y7NB 3NQTA 1G8ZD 1HTLD 4V190 4LK1C 1CA5A 2DY8A 1IKMA 1CHPD 3K5MA 1LTSD 2XWJB 1EY4A 1L0XB 2B2VA 1I4HA 1PMRA 3QOLA 4KD3A 1QE6A 3ERQA 4C56C 3H0GB 3MAQA 5ISRA 1TWHB 1BF4A 5EQ0A 5T1GA 5DM63 1EWHA 1SYFA 1CI3M 1GXDC 5EGTA 1STYA 3MHBA 4FVMA 5CV7A 3CRLC 5C4ZA 4IUPA 2FHTA 3KBXA 2AQ3B 4O42A 3S1NB 4C3HB 5DNFA 1RODA 1QOHA 2NTTA 5DM73 3T51B 1LTBD 3E6ZX 5C6AA 1LT6D 2LMCB 5CC4A 1JWSD 4FP5D 3NTIA 3JAML 5IODA 1U4RA 1SYDA 4KHVA 5IOCA 5CV5A 5KNCA 3D6CA 1LT5D 2X6LA 3J80L 2A74C 4OGQC 3SK8A 1JWMD 2Q8TA 2IX3A 4RGTA 2PPBC 1A3TA 1KLGD 2K5DA 1BCPB 5HURA 3I90A 1HTPA 1JR0D 3RLFA 1UNSA 2NUCA 2EVBA 5EPJA 3RUZA 2PYKA 3MTSA 5C0XJ 1RDPD 5T1IA 1Z7TA 1CFMA 4X3UA 4DA2A 1AZQA 3MC0B 1WTVA 3NBIA 2XIWA 3C46A 4HAEA 2EDGA 3SDZA 1PYWD 2WIIB 3BS1A 2EYFA 3N52A 4HR7B 4KMUC 4QB4A 2AQ1B 5IT9E 2OF1A 3H6MA 4K2LA 3OOCA 3PUZA 4RCNA 1WCMB 1EYCA 3PV0A 4ZKCB 1ENAA 1X3QA 2HCCA 3NTHA 1C48A 1LTID 4K14A 2F0UA 1STBA 2NVYB 2PNRC 1ONLA 1X32A 2LKVA 2KJXA 3BDLA 1GHKA 2LFNA 4C1NI 3OWEB 3RZDB 2V4DA 2CVRA 1QG7A 2HCIA 5E1FA 4OO1H 3MXGA 1EWCA 2FMCA 1E0BA 1T5XD 2L1BA 1BUVT 1EZ8A 3A8IE 2EZVA 3CRKC 4FYDA 2HUGA 1GUGA 3M4OB 1MSHA 2NYZD 2B2WA 2L0CA 3L7ZC 4MHEA 1EY0A 1F9QA 1AW7A 2PW7A 3R2IA 1H9KA 1KAAA 2XVSA 3A7LA 5J39A 1X3PA 1O78A 1JWUD 4DNRB 4PMWA 4IFDH 2BDNA 3ZYYX 1LTTD 2A6HD 5KEEA 5C0XI 2IJ0A 2K33A 1I4GA 3SEBA 2ID0A 4FF3A 1E2WA 1KDAA 3J7AV 3AU7A 4ABNA 1HUNA 1XWEA 3S15B 3LX0A 2G9HD 1IL8A 3MFGA 2XRSD 3SXHA 2QKIC 5KGUA 1M8AA 3FKIB 1EY9A 4B9XA 5E4XA 2RDFA 3D6WA 4WFN3 2JSOA 1PTOH 1SNPA 1PZJD 5NUCA 3NQIA 3S14B 4CKBA 2KCNA 4L8JA 2KA7A 2VUMB 1KNAA 1STHA 2A6HC 4ODGA 5D3IB 2E2JB 1PFBA 3LWUA 1T5EA 1VMCA 4J1MA 4BY1B 2NVXB 5C3XA 3ND9A 1I4XA 4LAAA 2LS01 4KD4A 4K6LA 3TDQA 4A3BB 1SNOA 1B1ZA 5E3FA 1HUMA 3S1MB 4KKUA 4DAYA 4EQPA 1HFNA 1TWGB 2EYHA 3P20A 4K6DA 2PZUA 1PZKD 5CORA 1EY8A 1D1KA 3OHXC 3KLSX 1V1PA 3I72A 4QUFA 1SYEA 2RDHA 3WOEA 3C1FA 1EQTA 2IX0A 5FKAC 4ID6A 3GD7A 5M5XB 1I6VC 1BCPC 3IKJA 1V43A 1EEID 4J8QA 5IGGA 3A54A 5LL6X 4XTCS 2XNAC 3VR6A 3HOXB 1K8MA 2NB0A 1F2YA 4IFDJ 1I4QA 1EY5A 2R61A 1TS4A 4C3JG 4TKOB 1NCVA 5A35A 1D5XC 4L63B 1QILA 2IW3A 1SSOA 2AQ2B 2F0QA 1S5ED 3K5OA 4HCSA 4ZUJA 3WOFA 1ET9A 2F0SA 4HSVA 2RSNA 3W2DA 3Q23A 4ZRZA 3K5LA 4IZ8A 1CZWA 3H3VC 3GTKB 3MXUA 1OXTA 3VYTA 2R3ZA 1DYQA 1DONA 1LT4D 2B63B 3U9OA 5D65A 3TBIB 1MSGA 2F0LA 2KOLA 2B2UC 2KQ3A 4RGNA 1DOKA 4OO1I 4R8NA 3NP8A 4OHJA 4P2CB 3VR3A 3M7NA 3ONAB 3I3CA 1II3A 1BBXC 5KIXA 1STEA 2A73B 2N55A 1WTWA 4A3JB 4KTAA 5FLXL 4RKLA 1JC7A 1F9SA 2F4IA 1DJRD 3LWEA 3VR4A 3KBGA 1NSNS 5G3LF 3CQZB 4RA8A 4ZLTF 1EEFD 2Q8RE 3JAME 1GUTA 1SJHD 4OL7A 2F0OA 2E75C 2QILA 2GA4B 5KYLA 4IFDI 3J80E 4IURA 1F77A 4KN4C 3M4YA 1HQMC 1A2UA 1LV9A 1EYDA 2JP1A 4KY7A 5D14A 1U4MA 3OIQA 2EY2A 4XQNA 2A69D 4DK0A 1LO5D 1Z47A 4NW2A 1U9RA 1OO9B 3SR1A 4DNTB 3C3LA 1WVLA 3EA6A 4DGZA 5BN3A 4A3FB 1VCIA 2VXWA 1JE4A 4BBRB 1F2MA 1YNND 2D9UA 4K5XA 5I2YA 1TKWB 2NN6G 2CW0D 1ILQA 1CT1D 3MEHA 2NZ1D 3PO2B 1PXUA 1SMYC 3PUWA 1BDOA 2A69C 2MHVA 1AZPA 3GTQB 1ML0D 3L9AX 5COYA 2NWGA 4A3MB 1EZ6A 4KI0A 1IYUA 3T16A 3Q0AA 1EOTA 5M5YB 1SBBB 3BYTB 1QJOA 2KEDA 3OIPA 4DAVA 1O7YA 2F0JA 4TQUS 1YNNC 2BE5C 1SNMA 4IALA 3Q24A 3AMUA 3KLSA 1PZID 3A56A 1QNUA 2R6GA 3FPPA 4ZKBB 1STAA 2IT1A 1H9SB 2F0MA 5J22A 1I6HB 5CR3A 2B39A 1SNQA 3FRPB 3P7JA 5F2DA 2IWHA 3SK4A 4CJ1B 2WKCA 1D2BA 2MJ8A 2MGSA 4LJZC 3GTPB 4BA1I 2X69A 2K32A 1J8IA 5EPKA 3L3OC 2DY7A 4DK1A 4M1UB 1STGA 1D5ZC 1Q90A 4PMCA 4HCEA 2I46A 5AFWA 1WTXA 4B08A 2QF7A 2FFKB 1F9RA 4EQNA 5CBAE 1MI2A 1VMPA 1EFID 3G6JB 1B53A 3MXNA 5C3WA 3DEPA 2RQXA 3BDCA 2JEBI 1B3AA 1G91A 1Y8OB 4S3SA 4KJNA 1RF2D 3I73A 3U9SA 1EIHA 2A6ED 3NUCA 3VA5A 4A3GB 4I7ZC 2G9DA 1KTKA 2QDBA 2B2UA 3ITPA 4DXFA 3GTMB 4C3JB 2O5IC 2F0TA 2RKSA 5ELEA 3D4RA 1GUSA 4JK1C 3T4AC 5M5WB 3MA2B 3TMEA 4XYOA 1TQOA 2A5HA 3QO2A 1G2TA 4R8IA 4K5VA 3I70A 1CQFA 4B9WA 1O80A 1W6JA 2F0VA 5J1ZA 2NVTB 4QF4A 1Y8PB 2K28A 3GO5A 4BWGB 1Q1BA 3A55A 2XN9C 2A6EC 1CA6A 2ICIA 3NTKA 4U68A 2J4XA 5DEHA 1G6ZA 5EBDA 5I9PA 2E2DC 3SVMA 4A3KB 3TP8A 1O7ZA 4L6TB 1S5DD 4FF2A 4ZYSA 4NKLA 1AFPA 3C2PA 1DXMA 3M7GA 2A68C 1PTOD 1PRTB 1LT3D 1KNEA 5A2QL 3CU7A 1SNCA 3X3NA 3HEJA 2MUYA 4XQQA 3K59A 3CKIB 2RSOA 1FR3A 1M4VA 5CBEE 3BVMA 4PNYA 2F3WA 3MVVA 4PV1C 1KDCA 3SE0A 3KUPA 1GJXA 1RTOA 1TY2A 4F7XA 2Y0SB 2B8FA 3DWQA 4QUCA 1QNKA 1E2ZA 3NPPA 1PTOC 2YYZA 2C5CA 3NWTA 4K8IA 3Q22A 2N88A 1QWYA 1AP0A 1JB3A 1EQVA 1Y69U 4NMZA 2F0FA 3GTJB 1WD1A 2L5TA 4ZK9B 1MD2D 3MXPA 3GV3A 3K5NA 2NVQB 3DWAA 4F88A 1DD2A 4XT1B 3S1RB 1C8CA 1KDBA 2WKDA 1U4LA 1RTNA 1JCKB 3S9WA 3GQBA 1Y1WB 1BQQT 1W6KA 3F2UA 2J7ZA 4GZYC 5FLXE 2F0IA 2E74C 3QG1A 2IX1A 2AUKA 4NP5A 1XYIA 5IGFA 3IFTA 4FNFA 1TIID 2ZXRA 1SYBA 2F0WA 1BCPD 1D5MC 1NR4A 2Z4HA 4K8JA 4G4KA 4PMBA 4KY6A 5JVG3 3DXJC 2ZXOA 1YNJD 1R9TB 4FF1A 4F8MA 1I3QB 3K6OA 5FO7B 4HTHA 4KJOA 3D4WA 4WRDA 4CKCA 4QMGA 3KK7A 5LL6S 2M2LA 4RGOS 2D5DA 4RCOA 5TSSA 4BY7B 1IYVA 4Z9CB 2EJMA 5JPNC 2YU9B 4XYQA 3HOYB 3R8BA 3GTGB 3OPOA 2PZWA 3S16B 1HPCA 1TWAB 3PUYA 1YNJC 1KABA 5IGBA 1TT2A 5FK9C 3TSSA 1OXXK 3VA7A 1I4PA 1LACA 4HMIA 3E5SA 3SK5A 1S4ZA 4Q0FA 2HDMA 1WTOA 3URYA 5JAVA 1SE3A 5CV4A 4MN3A 4ZUIA 3HOWB 3V05A 1R4QB 3DM1A 2XSCA 1CTMA 2O2LD 3H94A 2K6AA 1Z6HA 3D4DA 1VF7A 4CHTB 3NK9A 5FOBB 4HEDA 2F0DA 1ET6A 1RHPA 1GUOA 2KECA 4KHZA 1LABA 2FMMA 4X3KA 4DAPA 1GUNA 3S17B 3HP3A 2D62A 4WJWA 4OIKA 1JICA 1OXUA 1Q12A 2F0EA 1PRTC 4G7HC 3J81L 5CV6A 4G7OC 1D1IA 1I50B 5EKLA 1PDQA 3HGBA 1B9MA 1V1PB 1B9NA 2VNUD 3E0JA 3GP7A 4KKTA 2EPBA 4C3IG 4BA2I 3QIAA 2IL8A 3BG3A 4C2MB 2EY1A 4TRDA 3RZOB 1JORA 2H4OA 4FF4A 3HOVB 3BYYB 2CQAA 2TMPA 1WTPA 4G7ZC 1BOSA 2B8GA 1SNDA 1NAPA 4O1NA 5CV9A 2K01A 2RA4A 1R4PB 5KNDA 3TZDA 3A8JE 3N6RA 3PUVA 4HN7A 4F87A 1WTRA 3OW7A 4XDXA 1SMYD 2MPMA 2WB1B 1V8QA 2NBFA 5E4WC 2R7ZB 1A6XA 1PFNA 4DF7A 4H7BA 1UUPA 2K05A 2VB2X 1FYCA 3EJIA 4NDXA 1A15A 1A3VA 5JPMC 4EGVA 3Q6SA 2BE5D 2BCOA 4KKSA 2E2IB 3S2HB 2F1MA 1MGSA 4RHSA 3BVZA 3CHBD 4EQOA 1DZ1A 3BVGA 1OXSC 3A8KE 3M3YB 5KNBA 4TSSA 4K2KA 5I6YA 1C4QA 1H9JA 1V1OA 1ENCA 1ZYRC 3OMCA 2E2HB 5C0XG 3VYRA 2HDLA 3TP5A 2NN6H 2O4XA 3K58A 4MIUA 1JOKA 2Z4IA 5M9OA 1FNVA 2H1EA 2Z1CA 4A3EB 5A2QE 1BXTA 1RD9D 3GTOB 1F9PA 4XT3B 3PIP3 5M3FB 2F0PA 1K83B 5C3EB 4JBWA 3BDOA 3HKZB 2EYMA 4IUQA 5EJWA 4QCLA 2JA8B 2R92B 1SJED 2FJ2A 3TP6A 3VYSA 1JOQA 2F0KA 2Q8IB 2FINB 1SE2A 3I91A 2EYOA 2PZTA 1SEBD 1MBYA 3MZ5A 4UAIA 2AUJD 4RHRA 2DNEA 2EYJA 4C1NK 1BNZA 3T53B 1ESFA 2J0TD 3NHHA 1EYAA 1TWCB 4BS9A 3SHLA 4CJ2C 4RWSC 1RCVD 1OXVA 1XTCD 2D2CC 1SAPA 4AYBB 1DCZA 3X3MA 3MFYA 1QB5D 3V96A 5ELBA 3I4LA 2L9HA 1DM0B 1AN8A 1JOOA 2B2YC 2F0NA 2F0GA 3M85A 5JEAG 3PMFA 5HGTA 4ILWA 2PW5A 3KLRA 5BN5A 3HOUB 4ULLA 1Q8IA 2L55A 2WINB 4N9PA 3NBHA 3GV6A 2EYPA 1TWFB 1QCBD 2BA0A 4FO2A 5I9OA 1ICWA 2QCPX 3DMUA 3IAYA 3OMGA 1FNUA 1EY6A 2JA7B 4RKBA 1A3UA 5IGDA 5IGCA 3TP7A 5JEAH 5BN4A 3RD4A 2L11A 5I2XA 3NSWA 5CV8A 1CHQD 1PTOF 5EKKA 1DOLA 4DFAA 3D3RA 1EY7A 2JYOA 3HRZC 2A68D 3TZUA 3UI2A 2EYLA 1LTRD 5EKIA 5D3DA 2F0HA 2CHBD 3IL8A 1WD0A 1IHZA 5C4XB 2M9VA 4OIJA 3FDTA 2K1BA 3DUZA 1A2TA 5ELDA 2M00A 2ICEC 4FXDA 4OO1G 5K36G 2PQEA 2RDGA 1HRJA 2SOBA 1HQRD 3HG9A 1Y8NB 4M8AA 5KRUA 2RBMA 2SEBD 4C3IB 4A3DB 1EL0A 3BZDB 3VYUA 1XXGA 4CBVA 2OT2A 1HA6A 1TR5A 1NR2A 1HFGA 2KVMA 1HCZA 4N9TA 5C4HA 4X3SA 2B2TC 3R93A 5K36H 1HA5A 2BOSA 2MP1A 1SE4A 4IUTA 4IFDG 3GTLB 1U4PA 4CGYB 4CKEA 2WACA 2NN6I 3AB9A 1GHJA 4J6HA 2TSSA 1ZEQX 3J81E 5IGEA 5KYIA 3MWYW 5JEAJ 1BCPF 2SNMA 1IW7D 4R9WA 1SYCA 2WP8J 4K5WA 1EU4A 2EOTA 5EPLA 1TS3A 1VF5C 5DAUA 1GUWA 1LTAD 3NE5B 4DU9A 5M3MB 2PO4A 4QIWB 5CGKA 2PCFB 1RJTA 4E6IA 1STNA 1ZXTA 1S5CD 1S5BD 1IW7C 5IIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MGS A;  2EE1 A;  1RTO A;  2K03 A;  1EIH A;  2L9H A;  1F9S A;  3LWE A;  4HAE A;  1HRJ A;  2KED A;  1O7Y A;  2B2U A;  1J9O A;  4RA8 A;  4ZLT F;  1DZ1 A;  1QE6 A;  2B2Y C;  4QUC A;  1QNK A;  3N52 A;  2Q8R E;  1PFM A;  4ZAI A;  1HUN A;  2EPB A;  1CM9 A;  1BF4 A;  5EQ0 A;  2K04 A;  5T1G A;  1NCV A;  1IL8 A;  1EL0 A;  2M2L A;  3G7L A;  1HA6 A;  1M8A A;  4ZKB B;  2N88 A;  1G2S A;  1SSO A;  5CMD A;  1AP0 A;  4ZKC B;  1NR2 A;  1DOM A;  2IL8 A;  3QO2 A;  1HFG A;  3FPU B;  1G2T A;  3GV6 A;  1X3Q A;  2HDL A;  2KVM A;  4IUR A;  2HCC A;  5E4X A;  4IUP A;  2FHT A;  3DEO A;  1LV9 A;  4HCS A;  4X3S A;  3D6W A;  4DN4 M;  1BO0 A;  3KBX A;  4R8I A;  1WD1 A;  1SDF A;  4ZK9 B;  4HSV A;  2B2T C;  2JP1 A;  2L12 A;  3P7J A;  2RSN A;  3R93 A;  1ILP A;  4LMQ D;  5D14 A;  4O42 A;  2H1E A;  1ICW A;  5JJZ A;  1O80 A;  1B4O A;  1U4M A;  5DNF A;  1ROD A;  3GV3 A;  2MP1 A;  2K28 A;  4IUT A;  1X32 A;  4X3T A;  4CJ1 B;  1KNA A;  1WTP A;  1F9P A;  2MJ8 A;  2B2W C;  2MGS A;  3I8Z A;  4XT3 B;  1B50 A;  1CA6 A;  1S4Z A;  1U4P A;  4XT1 B;  1PLF A;  1TVX A;  1PFB A;  2B2Y A;  2HDM A;  1VMC A;  2L11 A;  4IUQ A;  4NW2 A;  4U68 A;  5EJW A;  1WTO A;  1C8C A;  1G6Z A;  2X69 A;  1U4L A;  1RTN A;  1NAP A;  1U4R A;  2R3Z A;  2K01 A;  1DON A;  2CVR A;  4MN3 A;  1J8I A;  1XX8 A;  2RA4 A;  1DOL A;  1QG7 A;  5EPK A;  3SVM A;  2HCI A;  2DY7 A;  2KUM A;  1WVL A;  2FJ2 A;  1B2T A;  3MWY W;  1F2L A;  2VXW A;  3TZD A;  1JE4 A;  2JYO A;  3F2U A;  2X6L A;  3DM1 A;  2J7Z A;  1O7Z A;  1Q3L A;  5D65 A;  1MSG A;  2FIN B;  3H91 A;  1HHV A;  2B2V C;  3I91 A;  2L4N A;  2RVL A;  4R9W A;  3UI2 A;  1WTR A;  1E0B A;  4XDX A;  2MPM A;  2KOL A;  2L1B A;  4UAI A;  2D9U A;  1HUM A;  4IUV A;  2B2T A;  2B2U C;  2Q8T A;  5E4W C;  4CJ0 B;  1ILQ A;  3TN2 A;  1HFN A;  4HED A;  1XYI A;  5AFW A;  1PFN A;  1RHP A;  5EKI A;  2KEC A;  1WTQ A;  1DOK A;  1WTX A;  2KEE A;  2EOT A;  2FMM A;  2HUG A;  2NZ1 D;  5COR A;  1BNZ A;  5EPL A;  1KNE A;  4X3K A;  3IL8 A;  2K05 A;  1WD0 A;  1MSH A;  2NYZ D;  2X6G A;  1GUW A;  3IFD A;  2B2W A;  2FFK B;  1F9R A;  5CBA E;  1MI2 A;  1AZP A;  1VMP A;  3HP3 A;  4CJ2 C;  4OIJ A;  4RWS C;  3FDT A;  4OIK A;  4RAU C;  3I90 A;  1IKL A;  1JIC A;  1ML0 D;  2K1B A;  4MHE A;  1NR4 A;  1F9Q A;  1B53 A;  5COY A;  4QUF A;  1ESR A;  1A15 A;  4IUU A;  3ONA B;  1SAP A;  2NWG A;  3I3C A;  1EQT A;  3DEP A;  5EPJ A;  2RSO A;  1BBX C;  3MTS A;  1X3P A;  5CBE E;  1B3A A;  1EIG A;  3Q6S A;  1CA5 A;  2DY8 A;  1RJT A;  5T1I A;  1IKM A;  2N55 A;  1EOT A;  1ZXT A;  4X3U A;  1WTW A;  1AZQ A;  1G91 A;  2SDF A;  1PDQ A;  2B2V A;  2BDN A;  1WTV A;  2XIW A;  3KUP A; 
#chains in the Genus database with same CATH topology
 2K03 A;  1K83 H;  2RHQ B;  5C3E H;  1XMO L;  4LFC L;  2JA5 B;  2C9O A;  2WV6 D;  3R3O A;  4H44 C;  1NTG A;  3O13 A;  2JA8 H;  3FVQ A;  3H0G G;  3NEN A;  2R92 H;  4A93 B;  4ZAI A;  4XXE A;  4L5Q A;  1HXY D;  1P16 A;  4LF6 L;  2A1A A;  1SYG A;  2ENB A;  2UXB Q;  1DOM A;  1LUZ A;  1FD7 D;  3FPU B;  3QJY A;  2K14 A;  2RCN A;  1PRT F;  1BO0 A;  1CZG A;  1W2B A;  1FGB D;  2L12 A;  1ILP A;  5LHY 1;  4LMQ D;  1XNR Q;  2PQA B;  5JJZ A;  4C3H G;  1TWC H;  2Z8L A;  2E76 C;  5JOB A;  1B44 D;  3I8Z A;  5IP7 H;  1CQV A;  5BR8 Q;  5C4J B;  1G29 1;  1NE3 A;  3MEF A;  4IUN A;  1PLF A;  5ELF A;  2B2Y A;  3W1G A;  3EVQ A;  4DV5 Q;  3J7A F;  3VR2 A;  2ZJQ A;  1ENF A;  2LXJ A;  4U67 3;  4IOC A;  5IT9 L;  3ERO A;  3OWF A;  1B2T A;  4A3C G;  4DV6 Q;  3FEW X;  2QEJ C;  1AEX A;  1Q3L A;  3H91 A;  4BBS B;  2B2V C;  2L4N A;  4WJ4 A;  2XRQ D;  4JOI A;  4IUV A;  4BXX H;  3TN2 A;  3ER0 A;  2EXZ A;  3W3A A;  3SK6 A;  1XNR L;  3HOU H;  1PRT D;  1KLU D;  2P5Z X;  1A0I A;  3DHQ A;  3D8G A;  4NB3 A;  4DR6 Q;  1RIP A;  4FXK C;  2SNS A;  1SXT A;  2NZO A;  2JXM B;  4EVO A;  3CW2 C;  1TWF H;  2IPK D;  4IUU A;  3TRZ A;  5BR8 L;  4KHP Q;  5CYU A;  1SLJ A;  2HQE A;  2K7V A;  1TU2 B;  3ERS X;  4DV5 L;  3K0Y A;  1EIG A;  1H9R A;  2KCM A;  4LF9 Q;  3T1H Q;  3NWS A;  5C44 B;  3RMH A;  2JA7 H;  1Q1E A;  2E8G A;  1QVG A;  2XWB B;  3VR5 A;  4DV6 L;  4QY7 A;  5FO9 B;  5C4X G;  4JI7 Q;  1P8L A;  1NY4 A;  2H5X A;  3DWP A;  4HSP A;  4IQZ A;  2OEO A;  3FMC A;  3NXW A;  5I4D A;  5JVH 3;  1PFM A;  4XQJ A;  3UE0 A;  2I07 B;  3K7A B;  2F03 A;  2K04 A;  4UY8 C;  4G57 A;  1VQD A;  3OSO A;  3I4M B;  2ATW A;  1GOZ A;  2BA1 A;  3QWN A;  1G2S A;  5CMD A;  4DR6 L;  5HY6 A;  4V0B A;  3J7Y W;  3DEO A;  3D31 A;  5FO8 B;  2K5W A;  3F1Z A;  3S1Q B;  4KHP L;  2OQ0 A;  4JI2 L;  1B4O A;  3K57 A;  3HZX A;  3UDG A;  3CP0 A;  5C4X H;  4LF9 L;  5GAG C;  3T1H L;  3NEL A;  2BDO A;  4KV6 A;  1C0A A;  1PH7 A;  2ZT9 C;  4ZQ3 A;  1B50 A;  1F2Z A;  1E7Z A;  2JEA I;  1I4R A;  1Q8K A;  2Q2I A;  4JI7 L;  5C5L A;  5IWA L;  3JAM c;  1RKN A;  2R93 B;  4HJ8 A;  1Y14 B;  2KUM A;  3QOJ A;  4MTN A;  3P1H A;  3WDN A;  1O7L A;  4PZ8 A;  1LTG D;  4UDU C;  4RFB A;  1BBW A;  1H95 A;  4H13 C;  3A74 A;  4ME5 A;  5ELC A;  4I65 A;  2NZH A;  4AQY Q;  3H09 A;  2JK8 A;  3CD6 A;  2B2T A;  1Y1V B;  4KN7 C;  4FXG C;  1EFW A;  1S5F D;  1EU3 A;  3EQL C;  4WOR A;  1KL9 A;  1S40 A;  4C3I H;  4A3D H;  1WTQ A;  1YI2 A;  3V2T A;  4Q5V A;  2K5H A;  4H0L C;  3IFD A;  1FJG Q;  1TS5 A;  3I4N B;  1ZKO A;  3J7A 5;  4DV2 Q;  3T13 A;  3PO3 B;  4GKK Q;  1IKL A;  2LY7 A;  3DLL A;  3S2D B;  4PQX A;  3C1E A;  1K8O A;  2K5Q A;  4DXG A;  5K5P A;  1BR9 A;  2KHS A;  2EIF A;  4HMJ A;  2NTS A;  3R2T A;  3M4Q A;  1JQY D;  3J7Z C;  3ND8 A;  1L0Y B;  1VQG A;  3EFX D;  5I6W A;  3GTL H;  2EJF C;  2SDF A;  3A7A B;  2F3V A;  1H9S A;  1TS2 A;  2DGY A;  2DN8 A;  2EE1 A;  4GOP A;  1UEB A;  2AWN A;  1ZYR D;  1J9O A;  3HOZ B;  1I5F A;  3FP9 A;  4MTK A;  5M3M G;  3P75 A;  1WTH A;  2KCC A;  1IZ6 A;  1CM9 A;  4DV3 Q;  1PH6 A;  2VB3 X;  1D6E C;  4JC0 A;  3LNN A;  3PUX A;  3G7L A;  1LLR D;  3FKI G;  4LF7 Q;  5JJL A;  2EY6 A;  1FJG L;  2ZXP A;  4DV2 L;  1X9N A;  4GKK L;  4DN4 M;  3FHW A;  1SDF A;  5G3L D;  4DR1 Q;  2E5L L;  4DR5 Q;  4KK7 A;  2JA6 B;  4APV A;  4HJ5 A;  4A93 G;  2VUM G;  4X3T A;  1UEA B;  4IN3 A;  1L1O B;  2B2W C;  5M3M H;  4XIG S;  4QL5 A;  4KY5 A;  4RH6 A;  1TVX A;  4IOA A;  2ALY B;  3T56 B;  2EJG C;  1E2V A;  2AWO A;  1H9M A;  1TY0 A;  1XX8 A;  2YV5 A;  3I56 A;  3KF8 A;  3QB3 A;  1LTL A;  1F2L A;  4YIJ A;  3PIO 3;  4RGM A;  2ASB A;  1QZH A;  1HHV A;  1PFS A;  2WAQ B;  2RVL A;  1L0W A;  1GKH A;  1CK1 A;  4CDF C;  2JA5 H;  4A3B G;  2YTX A;  1NUC A;  1CKM A;  5C5M A;  2DNC A;  5EBC A;  2EY5 A;  4A93 H;  3HS0 C;  4CJ0 B;  1FNW A;  2JE6 I;  2O5J C;  2VY3 A;  4DR1 L;  1PTO B;  2OXP A;  2KEE A;  4JVZ A;  1UAP A;  4DR5 L;  1VDZ A;  4A3I B;  2X6G A;  1SFO B;  1KC8 C;  5C0X H;  2CW0 C;  4RAU C;  2PMZ B;  1ESR A;  5IYB G;  4BBS G;  4Y7N B;  3NQT A;  4K0K Q;  2CWP A;  1G8Z D;  1HTL D;  4V19 0;  1D8L A;  3KF6 A;  4LK1 C;  3H15 A;  2KHI A;  1CA5 A;  2DY8 A;  2JN4 A;  1IKM A;  1CHP D;  3K5M A;  1LTS D;  2XWJ B;  1EY4 A;  4DV0 L;  1L0X B;  1BBU A;  2B2V A;  4MZ9 A;  4LF5 L;  4IPG A;  1QUQ A;  5C4J H;  2PMZ E;  1I4H A;  1PMR A;  3QOL A;  1J5E Q;  1UE5 A;  4KD3 A;  2CKZ B;  1QE6 A;  3KOJ A;  3ERQ A;  4C56 C;  3H0G B;  3K0X A;  3MAQ A;  1WYD A;  5ISR A;  1TWH B;  1BF4 A;  5EQ0 A;  5T1G A;  5DM6 3;  1EWH A;  1I94 Q;  1SYF A;  5IYB H;  4BBS H;  1CI3 M;  1GXD C;  1WFQ A;  1X65 A;  5EGT A;  5C44 G;  1STY A;  3MHB A;  4FVM A;  1NBW A;  5CV7 A;  3CRL C;  5C4Z A;  4IUP A;  2FHT A;  3KBX A;  3JAM i;  4K0K L;  2AQ3 B;  4O42 A;  3PF5 A;  3S1N B;  2XGT A;  4C3H B;  5DNF A;  1ROD A;  1WJJ A;  4L5T A;  3RR5 A;  1QOH A;  2NTT A;  1RL2 A;  5DM7 3;  4GS3 A;  3T51 B;  1LTB D;  3E6Z X;  3J80 i;  5C6A A;  3PGZ A;  1LT6 D;  2LMC B;  3UE1 A;  5CC4 A;  1JWS D;  4FP5 D;  3I4O A;  3NTI A;  4LF8 Q;  3JAM L;  5IOD A;  1U4R A;  1SYD A;  4KHV A;  1XNQ L;  5IOC A;  2Z6B A;  5C44 H;  2I5M X;  5CV5 A;  4DR4 L;  5KNC A;  3D6C A;  4GLA C;  4QGU A;  1E1T A;  2VW9 A;  2B63 G;  1LT5 D;  2X6L A;  2DJG C;  1I94 L;  3J80 L;  2A74 C;  4OGQ C;  4GLV B;  4YWM A;  1YHA A;  3SK8 A;  1JWM D;  2Q8T A;  2IX3 A;  5IYC G;  1KD1 C;  4RGT A;  3K7A H;  2FXQ A;  4ME3 A;  2PPB C;  1A3T A;  5IE8 A;  3I4M H;  3E0E A;  1KLG D;  2K5D A;  1N36 Q;  2R93 G;  1BCP B;  5HUR A;  3CCR A;  3I90 A;  2N78 A;  4OEL B;  1HTP A;  1JR0 D;  3RLF A;  1UNS A;  3S1Q H;  2NUC A;  2EVB A;  1JT8 A;  2K4K A;  5EPJ A;  3RUZ A;  2PYK A;  2IHF A;  3E3X A;  3MTS A;  4LF8 L;  1VQE A;  5C0X J;  1RDP D;  4ZCK A;  5T1I A;  2CH4 W;  1Z7T A;  1CFM A;  4X3U A;  4DA2 A;  1AZQ A;  3MC0 B;  1WTV A;  5JJK A;  5IYC H;  3NBI A;  2XIW A;  4R4C A;  5AJ3 Q;  3LGJ A;  3C46 A;  1QZG A;  4HAE A;  1KIX A;  1NJI C;  4EQ5 A;  2EDG A;  3SDZ A;  3KJP A;  3CCL A;  1PYW D;  2WII B;  3BS1 A;  2EYF A;  2R93 H;  2VZA A;  3N52 A;  4B3S Q;  4HR7 B;  1JMC A;  4KMU C;  4QB4 A;  3TS2 A;  1JE5 A;  2AQ1 B;  5IT9 E;  4JYA Q;  2OF1 A;  3H6M A;  4K2L A;  3OOC A;  3PUZ A;  4RCN A;  1IBK Q;  2A8V A;  1A63 A;  1WCM B;  1EYC A;  3PV0 A;  4ZKC B;  1N36 L;  1ENA A;  1YNX A;  4B3R Q;  4JI0 L;  1X3Q A;  1Y1V H;  2HCC A;  1L2F A;  3NTH A;  1C48 A;  1X6O A;  2XTI A;  1LTI D;  3CME A;  4K14 A;  4JI5 Q;  2F0U A;  3HOZ G;  1STB A;  2NVY B;  2PNR C;  2N49 A;  3I4N H;  1ONL A;  1X32 A;  3S2D H;  3PO3 H;  2LKV A;  2KJX A;  3BDL A;  1E22 A;  1GHK A;  5AJ3 L;  2LFN A;  3NBH B;  4C1N I;  2JQO A;  3OWE B;  4OON A;  1HZ9 A;  1IYJ B;  3RZD B;  2V4D A;  2CVR A;  3HKS A;  1QG7 A;  2HCI A;  4B3S L;  1YHB A;  1L1O C;  5E1F A;  3K8A A;  4OO1 H;  4BBR G;  4JYA L;  3MXG A;  1LYL A;  3PIO A;  1IBK L;  1NMG A;  1EWC A;  2FMC A;  1E0B A;  1T5X D;  4B3R L;  2L1B A;  3HOZ H;  3J81 c;  1BUV T;  1CSP A;  1EZ8 A;  5LMN Q;  4X62 Q;  3A8I E;  2EZV A;  1EIY B;  3CRK C;  4FYD A;  2HUG A;  1GUG A;  3M4O B;  1MSH A;  2NYZ D;  2B2W A;  2L0C A;  1XJV A;  1MJE A;  3L7Z C;  4MHE A;  2F4V Q;  2VS1 A;  1EY0 A;  1F9Q A;  1AW7 A;  1SMX A;  2PW7 A;  1VQF A;  1H9K A;  3R2I A;  4PZ6 A;  5LMU Q;  1KAA A;  3G71 A;  2GVA A;  2XVS A;  3A7L A;  5J39 A;  1X3P A;  1O78 A;  4A3L G;  1JWU D;  3U4V A;  2JA6 H;  4DNR B;  4PMW A;  4IFD H;  2ES2 A;  2GVB A;  2BDN A;  3ZYY X;  1LTT D;  3CPF A;  4LF6 Q;  2ZJR A;  2A6H D;  5KEE A;  5C0X I;  2IJ0 A;  2K33 A;  1I4G A;  3SEB A;  2ID0 A;  3KDF A;  4FF3 A;  1KAW A;  1E2W A;  1KDA A;  3J7A V;  1SE8 A;  3AU7 A;  4ABN A;  1HUN A;  1XWE A;  3S15 B;  4X62 L;  1S3O A;  1HJP A;  3LX0 A;  2G9H D;  2K5N A;  3CC2 A;  1IL8 A;  3U50 C;  3MFG A;  2XRS D;  3SXH A;  2IHE A;  2QKI C;  1AE2 A;  5KGU A;  1EUJ A;  1M8A A;  2Q2U A;  3FKI B;  2PNH A;  3F2B A;  1EY9 A;  3S24 A;  4DR2 Q;  4B9X A;  5E4X A;  2RDF A;  2F4V L;  3D6W A;  5LMU L;  4P74 A;  4WFN 3;  2JSO A;  1PTO H;  1PA6 A;  1SNP A;  1CKN B;  1PZJ D;  3NQI A;  5NUC A;  4A3I H;  2UUA Q;  3S14 B;  4CKB A;  1SFO H;  2KCN A;  4L8J A;  2KA7 A;  2VUM B;  1KNA A;  1STH A;  2A6H C;  1GO3 E;  4ODG A;  5D3I B;  4HIM A;  4Y7N H;  2E2J B;  5JJI A;  1PFB A;  3LWU A;  1T5E A;  1VMC A;  4J1M A;  1JJC B;  4LNQ A;  2D0P A;  1WI5 A;  4BY1 B;  2NVX B;  2L15 A;  5C3X A;  3ND9 A;  1I4X A;  4GN4 B;  4LAA A;  5E7N A;  2LS0 1;  3I2Z A;  4JCV E;  4KD4 A;  1TXY A;  4MNO A;  2ZTC A;  4K6L A;  3TDQ A;  3CCM A;  4A3B B;  1SNO A;  1B1Z A;  5E3F A;  1HUM A;  2R7F A;  4DR2 L;  3H0G H;  3S1M B;  4KKU A;  4DAY A;  4EQP A;  1HFN A;  1TWH H;  1TWG B;  2EYH A;  3P20 A;  4K6D A;  2PZU A;  1XTD A;  2JA9 A;  1PZK D;  4Y52 H;  5COR A;  2UUA L;  1EY8 A;  1D1K A;  3OHX C;  3KLS X;  1WOC A;  1V1P A;  3I72 A;  4QUF A;  1PV4 A;  1SYE A;  2RDH A;  1NNX A;  3WOE A;  2UXC Q;  3C1F A;  4AIM A;  1O7I A;  1EQT A;  2Z9H A;  4L5S A;  2IX0 A;  5FKA C;  4ID6 A;  3S1N H;  2Z6K A;  4C3H H;  3GD7 A;  5M5X B;  1I6V C;  3TQY A;  1BCP C;  3IKJ A;  4RG1 A;  4HJ9 A;  1HNX Q;  3PF4 A;  1V43 A;  1EEI D;  4UHV A;  4J8Q A;  5IGG A;  3A54 A;  5LL6 X;  4XTC S;  2XNA C;  3VR6 A;  2K50 A;  4IPH A;  2EXD A;  1XMQ Q;  3HOX B;  1K8M A;  2NB0 A;  1F2Y A;  4IFD J;  1I4Q A;  2ZTE A;  2QEX A;  1EY5 A;  2R61 A;  1TS4 A;  4C3J G;  4A3C H;  4TKO B;  4JI2 Q;  1NCV A;  5A35 A;  4CDD C;  1D5X C;  2HQL A;  4GNX B;  4L63 B;  1QIL A;  1SN8 A;  2IW3 A;  1SSO A;  2AQ2 B;  1VS0 A;  2F0Q A;  2HT1 A;  1S5E D;  3K5O A;  4HCS A;  4ZUJ A;  3WOF A;  1ET9 A;  2F0S A;  4HSV A;  2UXC L;  2RSN A;  3W2D A;  2MNA A;  5IWA Q;  3TRE A;  3Q23 A;  2LSS A;  1VQC A;  3QR8 A;  4ZRZ A;  4H02 A;  3K5L A;  4IZ8 A;  1HNX L;  1CZW A;  3H3V C;  3GTK B;  2K5V A;  1JJG A;  3MXU A;  1OXT A;  1WCM G;  3VYT A;  1XMQ L;  4J15 A;  2R3Z A;  1DYQ A;  3J81 j;  1DON A;  2WFW A;  1LT4 D;  4X65 Q;  1VQP A;  2B63 B;  4JV5 Q;  1EYG A;  3U9O A;  5GAH C;  5D65 A;  3GDE A;  3TBI B;  1MSG A;  2EQS A;  1IBL Q;  2F0L A;  2KOL A;  2B2U C;  2KQ3 A;  4RGN A;  1K0S A;  3D0F A;  1DOK A;  1WCM H;  3STB D;  1X56 A;  3W5O A;  4OO1 I;  3EIV A;  4R8N A;  3NP8 A;  4OHJ A;  4P2C B;  3VR3 A;  3H3V H;  3M7N A;  3ONA B;  3I3C A;  1II3 A;  1BBX C;  5KIX A;  1PH2 A;  1STE A;  2KHJ A;  2A73 B;  2K52 A;  2NVY H;  2N55 A;  1WTW A;  4X65 L;  4A3J B;  4KTA A;  3RLO A;  4JV5 L;  5FLX L;  4RKL A;  1JC7 A;  1PH5 A;  1F9S A;  2F4I A;  1DJR D;  3LWE A;  3VR4 A;  3KBG A;  4YY3 Q;  2CWA A;  1IBL L;  1NSN S;  5G3L F;  2CQO A;  3CQZ B;  4RA8 A;  4ZLT F;  3RZD H;  1EEF D;  1K9M C;  1VQ9 A;  2Q8R E;  3JAM E;  1GUT A;  1SJH D;  4OL7 A;  2F0O A;  2E5L Q;  2E75 C;  2QIL A;  2GA4 B;  3STB C;  5KYL A;  4LF4 Q;  4IFD I;  3RLN A;  1PYS B;  3J80 E;  1YIJ A;  4CDC C;  4PG3 A;  4IUR A;  1F77 A;  3M4Y A;  4KN4 C;  1HQM C;  1A2U A;  1LV9 A;  1EYD A;  2QW7 A;  2JP1 A;  1ASY A;  4KY7 A;  5D14 A;  3KLW A;  4HID A;  3EN2 A;  1U4M A;  3OIQ A;  3M4O H;  1N32 L;  2EY2 A;  4OX9 Q;  4XQN A;  2QDL A;  2A69 D;  4DK0 A;  1LO5 D;  1X3E A;  1Z47 A;  4NW2 A;  4YY3 L;  1A8V A;  1U9R A;  1OO9 B;  3SR1 A;  4DNT B;  3C3L A;  4TVA B;  1WVL A;  3ULJ A;  3EA6 A;  4DGZ A;  5BN3 A;  4A3F B;  1Y1W G;  1VCI A;  2VXW A;  1JE4 A;  4BBR B;  1F2M A;  1U0L A;  2WB1 E;  4LF4 L;  1X3G A;  2IY5 B;  2KBN A;  1YNN D;  2D9U A;  4K5X A;  5I2Y A;  4HIO A;  1TKW B;  2NN6 G;  2CW0 D;  1MHW C;  3S15 H;  1ILQ A;  1HR0 W;  1UE1 A;  1CT1 D;  4NXM Q;  3MEH A;  2NZ1 D;  4YWK A;  3PO2 B;  1PXU A;  1SMY C;  4BY1 G;  3PUW A;  3FKI H;  4DV0 Q;  1BDO A;  2A69 C;  2MHV A;  1AZP A;  4OX9 L;  4LFB L;  4UPA A;  3GTQ B;  4LF5 Q;  1ML0 D;  3L9A X;  5COY A;  4NXN Q;  2NWG A;  4A3M B;  1EZ6 A;  4KI0 A;  3S14 H;  1IYU A;  2AMC B;  1K8G A;  3T16 A;  3Q0A A;  1VQH A;  1EOT A;  2VUM H;  3A5Z B;  5M5Y B;  1SBB B;  3BYT B;  4YHH L;  4DPG A;  5IY0 A;  2K75 A;  2B29 A;  1HZB A;  1QJO A;  2E2J H;  2KED A;  3OIP A;  4DAV A;  1O7Y A;  2F0J A;  1B70 B;  1YNN C;  4TQU S;  3CCU A;  2BE5 C;  3BU2 A;  4BY1 H;  2NVX H;  1SNM A;  4IAL A;  3Q24 A;  3AMU A;  3KLS A;  1PZI D;  3KFU A;  3A56 A;  3OW2 A;  1QNU A;  1B7Y B;  4UP9 A;  3F2D A;  4NXM L;  2R6G A;  1PYB A;  3FPP A;  4ZKB B;  1SRO A;  1STA A;  2IT1 A;  4A3B H;  3CAM A;  1H9S B;  4GOP B;  2F0M A;  1E3P A;  5J22 A;  3S1M H;  2C35 B;  1I6H B;  5CR3 A;  1TWG H;  1PH3 A;  4NXN L;  1X54 A;  1YVC A;  2B39 A;  1SNQ A;  3FRP B;  3P7J A;  3HOX G;  1XNQ Q;  2I5H A;  1XPU A;  5F2D A;  2CH4 A;  2IWH A;  3SK4 A;  4DR4 Q;  1DGS A;  4CJ1 B;  2WKC A;  2HIX A;  3PCO B;  3K80 C;  1D2B A;  3W1B A;  2MJ8 A;  4OWW B;  2MGS A;  4QQB X;  4LJZ C;  4DR3 L;  3BJU A;  3GTP B;  4BA1 I;  2X69 A;  5M5X H;  2K32 A;  1J8I A;  1S72 A;  5EPK A;  3L3O C;  4A4I A;  2DY7 A;  3HOW G;  4P71 A;  1FVI A;  4P75 A;  3M4P A;  4DK1 A;  2MFI A;  4M1U B;  4HIK A;  2HHH L;  1STG A;  3HOX H;  1D5Z C;  1Q90 A;  4GKJ Q;  4PMC A;  4HCE A;  3A0J A;  2I46 A;  4GN5 A;  5AFW A;  1WTX A;  4B08 A;  3KF8 B;  2QF7 A;  4X64 Q;  2FFK B;  1F9R A;  4EQN A;  5CBA E;  3CXC A;  1MI2 A;  1VMP A;  1EFI D;  5FJ8 G;  3G6J B;  1B53 A;  3MXN A;  5C3W A;  3DEP A;  2RQX A;  3BDC A;  2JEB I;  1B3A A;  2G5D A;  3B6Y A;  1FGU A;  1G91 A;  1Y8O B;  4S3S A;  4KJN A;  1RF2 D;  1VQK A;  3GTK H;  3I73 A;  3U9S A;  4WJ3 M;  1EIH A;  2A6E D;  3NUC A;  4JBJ A;  3VA5 A;  4I7Z C;  4A3G B;  2G9D A;  1A62 A;  1KTK A;  4CDE C;  2QDB A;  2B2U A;  1YHQ A;  4JI0 Q;  2BH2 A;  4GKJ L;  3H3V I;  1YJN A;  3ITP A;  4DXF A;  3GTM B;  2BH8 A;  2UUB Q;  3TEH B;  3KF6 B;  4C3J B;  2O5I C;  2B63 H;  2F0T A;  2KEN A;  4IPD A;  2RKS A;  5ELE A;  3D4R A;  4DAM A;  1GUS A;  4JK1 C;  3T4A C;  5M5W B;  3MA2 B;  3TME A;  4XYO A;  1TQO A;  1QUQ B;  1W3S A;  2A5H A;  3QO2 A;  4X64 L;  1G2T A;  4A75 A;  1UE7 A;  4A3J G;  4JBK A;  1N33 Q;  4R8I A;  1BKB A;  4POF A;  4K5V A;  4DV4 Q;  4HJ7 A;  3I70 A;  1CQF A;  2D0O A;  4B9W A;  1O80 A;  1W6J A;  2F0V A;  4QJF A;  5J1Z A;  2NVT B;  4QF4 A;  2YTY A;  1Y8P B;  3M9B A;  2K28 A;  3GO5 A;  4BWG B;  1Q1B A;  1HH2 P;  3A55 A;  2XN9 C;  2A6E C;  1CA6 A;  2ICI A;  2R7D A;  3NTK A;  4U68 A;  2B3G A;  1YEZ A;  2J4X A;  5DEH A;  1G6Z A;  5EBD A;  1B8A A;  4R4Q A;  5I9P A;  2E2D C;  3SVM A;  4A3K B;  2UUB L;  4A3J H;  3TP8 A;  3AYH B;  1PH8 A;  1G51 A;  1O7Z A;  2MO0 A;  2QA4 A;  4L6T B;  1S5D D;  4FF2 A;  4ZYS A;  4NKL A;  3CQZ H;  2WB1 G;  1AFP A;  5DLQ E;  3C2P A;  1DXM A;  3M7G A;  1MKH A;  3PQI A;  4LWC A;  1N33 L;  2A68 C;  3AFQ A;  3F8T A;  5H1S E;  4DV4 L;  3E9H A;  2ZM6 Q;  5IYD G;  3EBE A;  1PTO D;  1PRT B;  3JC6 6;  1LT3 D;  1KNE A;  5A2Q L;  3CU7 A;  1SNC A;  2RCF A;  4A3F G;  2OTL A;  3X3N A;  3HEJ A;  2MUY A;  4XQQ A;  3K59 A;  1UE6 A;  3CKI B;  2RSO A;  1FR3 A;  1IL2 A;  1M4V A;  5CBE E;  3BVM A;  4PNY A;  2F3W A;  1K28 A;  2KCT A;  1D7Q A;  3MVV A;  4PV1 C;  5L37 A;  1KDC A;  1EIF A;  1XPO A;  3SE0 A;  3KUP A;  1GJX A;  1RTO A;  3PO2 G;  1N8R C;  1TY2 A;  2RHS B;  4F7X A;  2Y0S B;  2B8F A;  3DWQ A;  2F52 A;  4QUC A;  1QNK A;  3F2C A;  3RNU A;  1E2Z A;  3NEM A;  1YIT A;  4A3F H;  1T9H A;  2A19 A;  3NPP A;  3A5U A;  4A3M G;  4DK3 C;  1PTO C;  4BBR H;  2ZM6 L;  2YYZ A;  2C5C A;  3NWT A;  4N8X 1;  1CSQ A;  4K8I A;  3Q22 A;  2N88 A;  1QWY A;  1AP0 A;  1JB3 A;  1EQV A;  1Y69 U;  2Y0S E;  4NMZ A;  2F0F A;  2HD3 A;  1WD1 A;  3GTJ B;  2L5T A;  4ZK9 B;  3Q8D A;  4IJH A;  4JI4 Q;  1MD2 D;  3MXP A;  3PO2 H;  1EOV A;  3GV3 A;  3K5N A;  3GTQ H;  2NVQ B;  3UDI A;  3DWA A;  4F88 A;  2CFM A;  5C3E G;  4A3M H;  4XT1 B;  1DD2 A;  3S1R B;  3ICE A;  4DNI A;  1C8C A;  4A3L H;  1KDB A;  2WKD A;  4NPS A;  1K3R A;  1U4L A;  1RTN A;  1VQ7 A;  3CC4 A;  1JCK B;  2ZTD A;  3S9W A;  3GQB A;  5M5Y H;  1Y1W B;  4X6A H;  1YZ6 A;  1BQQ T;  4DK6 C;  1W6K A;  3F2U A;  2J7Z A;  4OXP A;  1PVO A;  3T1Y Q;  4LFA Q;  4GZY C;  1E1O A;  3I55 A;  5FLX E;  2F0I A;  2E74 C;  3QG1 A;  3G48 A;  2V1C C;  2IX1 A;  2AUK A;  4NP5 A;  1XYI A;  5IGF A;  3IFT A;  4FNF A;  1TII D;  1Q46 A;  2ZXR A;  4JI8 L;  4JI4 L;  1SYB A;  4DUZ Q;  4QIW E;  2F0W A;  1BCP D;  1J6Q A;  1I6H H;  1D5M C;  1NR4 A;  5IP7 G;  2Z4H A;  4K8J A;  4X66 Q;  4G4K A;  4PMB A;  4KY6 A;  5JVG 3;  3DXJ C;  1C7Y A;  2ZXO A;  4AYB G;  3KYH C;  2AHO B;  1YNJ D;  1R9T B;  3G4S A;  4FF1 A;  4F8M A;  3T1Y L;  4LFA L;  3GTP H;  1I3Q B;  1MJC A;  3K6O A;  5FO7 B;  4HTH A;  4YWL A;  3ULP A;  1MIU A;  4KJO A;  4BXX G;  3D4W A;  4WRD A;  4CKC A;  1HZC A;  4QMG A;  3KK7 A;  5LL6 S;  2M2L A;  3ZJY C;  4RGO S;  2D5D A;  4RCO A;  5TSS A;  3HOU G;  4BY7 B;  4YCU A;  1IYV A;  4Z9C B;  2EJM A;  2VL6 A;  5JPN C;  4DUZ L;  4XYQ A;  2YU9 B;  1K3B C;  4OEM B;  3HOY B;  3R8B A;  2GN5 A;  3GTG B;  3KDF B;  3OPO A;  3G6E A;  2PZW A;  3S16 B;  1HPC A;  1TWA B;  4X66 L;  4A3G G;  3PUY A;  1YNJ C;  1EWI A;  1KAB A;  5IGB A;  1KXL A;  1TT2 A;  5FK9 C;  3TSS A;  1OXX K;  2UXB L;  2JA7 G;  3VA7 A;  1I4P A;  1LAC A;  4HMI A;  2DJF C;  3E5S A;  3K81 C;  3SK5 A;  1S4Z A;  4Q0F A;  2HDM A;  1WTO A;  3URY A;  1K0R A;  1SE3 A;  5JAV A;  5CV4 A;  4MN3 A;  4ZUI A;  1HNZ Q;  3HOW B;  3UDF A;  1C9O A;  3V05 A;  1R4Q B;  3DM1 A;  2XSC A;  4PZ7 A;  1CTM A;  2O2L D;  4A3G H;  3H94 A;  2K6A A;  2I0Q A;  4GN3 B;  1Z6H A;  4RMF A;  4YCW A;  3D4D A;  1VF7 A;  4CHT B;  3GTM H;  3NK9 A;  5FOB B;  4C3J H;  4HED A;  2F0D A;  1ET6 A;  1RHP A;  1GUO A;  2KEC A;  4KHZ A;  3J81 i;  1LAB A;  2FMM A;  4X3K A;  5M5W H;  4DAP A;  1GUN A;  4A3K G;  3S17 B;  3HP3 A;  2D62 A;  4WJW A;  1VQL A;  4OIK A;  1JIC A;  1OXU A;  4OWX B;  4JPB W;  1EQQ A;  2UU9 Q;  1Q12 A;  4POG A;  2F0E A;  1PRT C;  4G7H C;  5GRO A;  4DAY B;  2QGQ A;  2NVT H;  4DV1 Q;  3J81 L;  5CV6 A;  4O2D A;  1HNZ L;  4R4I A;  4G7O C;  1D1I A;  1Q86 C;  1I50 B;  5EKL A;  1PDQ A;  3HGB A;  1B9M A;  1V1P B;  1B9N A;  2VNU D;  1YJ9 A;  3E0J A;  4A3K H;  1NMF A;  3GP7 A;  4KKT A;  2EPB A;  1GD7 A;  4R4T A;  4P72 A;  4C3I G;  4A3D G;  4BA2 I;  2Q2T A;  1L1O A;  1N32 Q;  3QIA A;  2IL8 A;  3BG3 A;  4C2M B;  3CF5 A;  1XPR A;  3CC7 A;  2UU9 L;  2EY1 A;  2Y0S G;  4TRD A;  3RZO B;  1JOR A;  2H4O A;  3J80 c;  4DV1 L;  4FF4 A;  3HOV B;  5FLM G;  3BYY B;  2CQA A;  2TMP A;  1WTP A;  4UP8 A;  3BZK A;  4G7Z C;  1BOS A;  2B8G A;  1SND A;  3AFP A;  1NAP A;  4O1N A;  5CV9 A;  2K01 A;  1VQ4 A;  4UP7 A;  2RA4 A;  1R4P B;  5KND A;  3TZD A;  3CMA A;  3A8J E;  3N6R A;  3PUV A;  4HN7 A;  1KHI A;  1GM5 A;  4F87 A;  4A76 A;  1WTR A;  3OW7 A;  4XDX A;  1SMY D;  2MPM A;  4LFB Q;  2WB1 B;  1V8Q A;  2NBF A;  5E4W C;  5FLM H;  2R7Z B;  1VQO A;  4LUV A;  1JJ2 A;  1A6X A;  1PFN A;  4DF7 A;  1VQ8 A;  4H7B A;  2ZJP A;  1UUP A;  2K05 A;  2VB2 X;  1VQN A;  1FYC A;  2OCE A;  4YHH Q;  3EJI A;  1M90 C;  4AQY L;  1X55 A;  4NDX A;  5GAD C;  3GTJ H;  1A15 A;  1A3V A;  5JPM C;  2JJQ A;  2VQE Q;  4EGV A;  1VQI A;  3ULL A;  3Q6S A;  2BE5 D;  2BCO A;  4KKS A;  1N9W A;  2NVQ H;  2N3S A;  3AEV A;  3CPW A;  2E2I B;  3S2H B;  2F1M A;  1MGS A;  4RHS A;  3TS0 A;  3BVZ A;  5EAY A;  3S1R H;  3CHB D;  4P73 A;  2MQH A;  2JA5 G;  2LXK A;  4EQO A;  1DZ1 A;  3BVG A;  2OQK A;  1OXS C;  3A8K E;  3CCQ A;  3M3Y B;  2Z0S A;  2PI2 A;  1PH4 A;  1Y1W H;  4DR7 Q;  5KNB A;  4TSS A;  1B3Q A;  4K2K A;  5I6Y A;  1C4Q A;  1H9J A;  1V1O A;  1ENC A;  1ZYR C;  4IJL A;  1QVF A;  3OMC A;  2E2H B;  5C0X G;  3VYR A;  1YBY A;  2HDL A;  3TP5 A;  2NN6 H;  2O4X A;  3K58 A;  4MIU A;  1JOK A;  2Z4I A;  5M9O A;  3E9I A;  4DR3 Q;  1FNV A;  4DV3 L;  1LM0 A;  1K8A C;  2H1E A;  2VQE L;  3K7U C;  2Z1C A;  4A3E B;  3AQQ A;  5A2Q E;  4LF7 L;  1BXT A;  1RD9 D;  3GTO B;  1F9P A;  4XT3 B;  1Q7Y C;  3PIP 3;  5M3F B;  4FDB A;  2HHH Q;  1AH9 A;  2F0P A;  1K83 B;  1CUK A;  5C3E B;  4BY7 G;  4JBW A;  3BDO A;  3HKZ B;  4LUZ A;  2EYM A;  4IUQ A;  5EJW A;  3CCV A;  4QCL A;  1R9T H;  1N34 Q;  3HOY G;  3CCE A;  2JA8 B;  1VQM A;  2WAQ E;  2R92 B;  1SJE D;  2FJ2 A;  3TP6 A;  3VYS A;  1JOQ A;  1VQ6 A;  4DR7 L;  1VQB A;  4GNX C;  2F0K A;  2Q8I B;  1JB7 A;  2FIN B;  1SE2 A;  1EQR A;  3I91 A;  2EYO A;  1I3Q H;  1SEB D;  2PZT A;  1MBY A;  5ELN A;  3MZ5 A;  3HKZ E;  4UAI A;  2AUJ D;  4RHR A;  2DNE A;  3IRB A;  2EYJ A;  4C1N K;  1V9P A;  4BY7 H;  5IP9 G;  1BNZ A;  3VDY A;  2HIV A;  3T53 B;  1ESF A;  2J0T D;  3NHH A;  1EYA A;  1TWC B;  2YU9 H;  4BS9 A;  3HOY H;  3SHL A;  4CJ2 C;  4RWS C;  3GTG H;  2UUC Q;  4AH6 A;  3S16 H;  1TWA H;  1RCV D;  1OXV A;  1XTC D;  2D2C C;  1SAP A;  2OTJ A;  1V1Q A;  4JBM A;  4AYB B;  1OTC A;  5LMN W;  1DCZ A;  3X3M A;  1N34 L;  3MFY A;  4L5R C;  1QB5 D;  3V96 A;  4B3M Q;  4DUY Q;  5ELB A;  2I5L X;  3I4L A;  2L9H A;  1DM0 B;  3DM3 A;  1AN8 A;  3L2P A;  5IP9 H;  4N8F A;  1JOO A;  1KRS A;  2B2Y C;  4JI6 Q;  4AYB E;  2F0N A;  2F0G A;  3HOW H;  3M85 A;  1U5K A;  1X3F A;  5JEA G;  2UXD Q;  4YCV A;  3PMF A;  5HGT A;  4ILW A;  4OWT B;  4JI3 Q;  2PW5 A;  3KLR A;  5BN5 A;  3HOU B;  3I4M G;  4ULL A;  4LUO A;  5GQO A;  1Q8I A;  5ELO A;  1J5E L;  2L55 A;  2WIN B;  3L0O A;  3NBH A;  4N9P A;  3GV6 A;  2EYP A;  2OWO A;  2PI2 E;  2UUC L;  1TWF B;  2Z6K C;  4JOI C;  1QCB D;  1GVP A;  2BA0 A;  1BVS A;  4FO2 A;  5I9O A;  1PH1 A;  1ICW A;  2QCP X;  4R1J A;  3DMU A;  3IAY A;  1KQS A;  3OMG A;  4DKA C;  4KLK A;  1FNU A;  4JI1 Q;  3S17 H;  1Q82 C;  1EY6 A;  5FJ8 H;  2JA7 B;  4RKB A;  1Z9F A;  4B3M L;  1A3U A;  5IGD A;  4DUY L;  5IGC A;  3TP7 A;  5JEA H;  5BN4 A;  3RD4 A;  3WWV A;  2L11 A;  1E24 A;  4DV7 Q;  5I2X A;  3NSW A;  1HR0 Q;  5CV8 A;  1CHQ D;  1PTO F;  5EKK A;  4JI6 L;  1DOL A;  2Q2H A;  5IT9 c;  2DUD A;  1UWV A;  4DFA A;  1I50 H;  3D3R A;  1EY7 A;  2JYO A;  2UXD L;  3HRZ C;  2A68 D;  4GLX A;  3CCS A;  2CCZ A;  4JI3 L;  4HJA A;  3TZU A;  5GAE C;  3UI2 A;  2YTV A;  1QVC A;  1ASZ A;  2EYL A;  3CCJ A;  3OTO Q;  3HOV G;  3OYY A;  1Y1V G;  1PHJ A;  1LTR D;  4JW0 A;  4IPC A;  5EKI A;  1K73 C;  1VQJ A;  1SR3 A;  5D3D A;  5J3B A;  2F0H A;  2CHB D;  3IL8 A;  3PSI A;  1WD0 A;  1IHZ A;  5C4X B;  4JI1 L;  2M9V A;  3I4N G;  4OIJ A;  3FDT A;  4B3T Q;  3PO3 G;  2K1B A;  4C2M H;  3DUZ A;  1A2T A;  2VQF Q;  5ELD A;  4DV7 L;  3RZO H;  2M00 A;  1HR0 L;  3KJO A;  3HOV H;  2R7Z G;  2ICE C;  4FXD A;  3HFZ B;  4OO1 G;  3UDX A;  5K36 G;  2PQE A;  2RDG A;  1HRJ A;  3OTO L;  3MXN B;  1VQA A;  2SOB A;  1M1K C;  1HQR D;  3HG9 A;  1Y8N B;  4M8A A;  1CKN A;  5KRU A;  2RBM A;  1AE3 A;  2SEB D;  4C3I B;  4A3D B;  1FL0 A;  3BZD B;  1XXG A;  3VYU A;  1EL0 A;  4CBV A;  2OT2 A;  1HA6 A;  1TR5 A;  1KRT A;  1NR2 A;  1HFG A;  2KVM A;  1HCZ A;  4B3T L;  2R7Z H;  4N9T A;  5C4H A;  4X3S A;  2B2T C;  3R93 A;  5IYD H;  5K36 H;  5HGQ A;  4EX5 A;  2VQF L;  1HA5 A;  2BOS A;  2JA6 G;  2MP1 A;  2PQA A;  1SE4 A;  4ALP A;  4IUT A;  4IFD G;  4IO9 A;  3GTL B;  1IBM Q;  2MO1 A;  1CKO A;  3I7F A;  4LW1 A;  3PIP A;  1U4P A;  1Q81 C;  4CGY B;  4CKE A;  2WAC A;  2NN6 I;  4I7A A;  3AB9 A;  4JI5 L;  1HNW Q;  1GHJ A;  4J6H A;  3U58 A;  2TSS A;  1ZEQ X;  3U4Z A;  3J81 E;  5IGE A;  2AKW B;  1VQ5 A;  3SGI A;  5KYI A;  3MWY W;  3BZC A;  5JEA J;  2E2I H;  3S2H H;  1BCP F;  2SNM A;  4JI8 Q;  1IW7 D;  2WAQ G;  4O0A A;  4R9W A;  1SYC A;  2WP8 J;  1XMO Q;  4JG2 A;  4GOP C;  4LFC Q;  4A3E G;  4K5W A;  1IXR A;  3M3Y H;  5M3F G;  4R4O A;  1EU4 A;  3HKZ G;  2EOT A;  5FLX c;  5EPL A;  2RF4 A;  1TS3 A;  1VF5 C;  5DAU A;  4A3I G;  1GUW A;  2JA8 G;  2E2H H;  2R92 G;  1LTA D;  1ICF B;  2F3I A;  3NE5 B;  4DU9 A;  5M3M B;  2PO4 A;  1IBM L;  5LMN L;  4QIW B;  5CGK A;  1HZA A;  2PCF B;  1G6P A;  3RN2 A;  1RJT A;  1HNW L;  4A3E H;  4E6I A;  1STN A;  4GNX A;  1ZXT A;  2N8N A;  3RN5 A;  3GTO H;  1SRU A;  1YJW A;  1S5C D;  1PH9 A;  1S5B D;  5M3F H;  1IW7 C;  5IIF A; 
#chains in the Genus database with same CATH homology
 2K03 A;  2JA5 B;  2C9O A;  2WV6 D;  3R3O A;  4H44 C;  3O13 A;  3FVQ A;  4A93 B;  4ZAI A;  4XXE A;  1HXY D;  1SYG A;  2ENB A;  1DOM A;  1FD7 D;  3FPU B;  3QJY A;  1PRT F;  1BO0 A;  1CZG A;  1FGB D;  2L12 A;  1ILP A;  5LHY 1;  4LMQ D;  5JJZ A;  4C3H G;  2Z8L A;  2E76 C;  5JOB A;  1B44 D;  3I8Z A;  1CQV A;  5C4J B;  1G29 1;  4IUN A;  5ELF A;  1PLF A;  2B2Y A;  3EVQ A;  3J7A F;  3VR2 A;  1ENF A;  4U67 3;  5IT9 L;  3ERO A;  3OWF A;  1B2T A;  3FEW X;  2QEJ C;  1AEX A;  1Q3L A;  3H91 A;  4BBS B;  2B2V C;  2L4N A;  2XRQ D;  4IUV A;  3TN2 A;  2EXZ A;  3W3A A;  3SK6 A;  1PRT D;  1KLU D;  3DHQ A;  3D8G A;  4FXK C;  2SNS A;  1SXT A;  2JXM B;  4EVO A;  2IPK D;  4IUU A;  5CYU A;  2HQE A;  2K7V A;  1TU2 B;  3K0Y A;  1EIG A;  1H9R A;  3NWS A;  5C44 B;  3RMH A;  1Q1E A;  2XWB B;  3VR5 A;  5FO9 B;  3DWP A;  4HSP A;  4IQZ A;  2OEO A;  3FMC A;  3NXW A;  5I4D A;  5JVH 3;  1PFM A;  4XQJ A;  2I07 B;  3K7A B;  2F03 A;  2K04 A;  4G57 A;  3OSO A;  3I4M B;  1GOZ A;  2BA1 A;  3QWN A;  1G2S A;  5CMD A;  4V0B A;  3J7Y W;  3DEO A;  3D31 A;  5FO8 B;  2K5W A;  3S1Q B;  1B4O A;  3K57 A;  3HZX A;  2BDO A;  4KV6 A;  2ZT9 C;  4ZQ3 A;  1B50 A;  1F2Z A;  2JEA I;  1I4R A;  5C5L A;  1RKN A;  2R93 B;  2KUM A;  3QOJ A;  3P1H A;  3WDN A;  1O7L A;  1LTG D;  4UDU C;  4RFB A;  4H13 C;  4ME5 A;  5ELC A;  4I65 A;  3H09 A;  2B2T A;  1Y1V B;  4KN7 C;  4FXG C;  1S5F D;  1EU3 A;  3EQL C;  4WOR A;  1WTQ A;  3V2T A;  4Q5V A;  4H0L C;  3IFD A;  1TS5 A;  3I4N B;  1ZKO A;  3T13 A;  3PO3 B;  3S2D B;  1IKL A;  2LY7 A;  4PQX A;  3C1E A;  1K8O A;  2K5Q A;  4DXG A;  5K5P A;  1BR9 A;  2KHS A;  4HMJ A;  2NTS A;  3R2T A;  1JQY D;  3ND8 A;  1L0Y B;  3EFX D;  5I6W A;  2EJF C;  2SDF A;  3A7A B;  2F3V A;  1H9S A;  1TS2 A;  2EE1 A;  2DN8 A;  2AWN A;  1ZYR D;  1J9O A;  3HOZ B;  3P75 A;  2KCC A;  1CM9 A;  2VB3 X;  1D6E C;  3LNN A;  3PUX A;  3G7L A;  1LLR D;  2EY6 A;  2ZXP A;  4DN4 M;  1SDF A;  5G3L D;  4KK7 A;  2JA6 B;  4X3T A;  1UEA B;  4IN3 A;  2B2W C;  4XIG S;  4KY5 A;  4RH6 A;  1TVX A;  3T56 B;  2EJG C;  1E2V A;  2AWO A;  1H9M A;  1TY0 A;  1XX8 A;  3KF8 A;  3QB3 A;  1F2L A;  4YIJ A;  3PIO 3;  4RGM A;  1HHV A;  2WAQ B;  2RVL A;  1CK1 A;  1NUC A;  5C5M A;  2DNC A;  5EBC A;  2EY5 A;  3HS0 C;  4CJ0 B;  1FNW A;  2JE6 I;  2O5J C;  1PTO B;  2OXP A;  2KEE A;  1UAP A;  1VDZ A;  4A3I B;  2X6G A;  1SFO B;  5C0X H;  2CW0 C;  4RAU C;  2PMZ B;  1ESR A;  4Y7N B;  3NQT A;  1G8Z D;  1HTL D;  4V19 0;  4LK1 C;  1CA5 A;  2DY8 A;  1IKM A;  1CHP D;  3K5M A;  1LTS D;  2XWJ B;  1EY4 A;  1L0X B;  2B2V A;  1I4H A;  1PMR A;  3QOL A;  4KD3 A;  1QE6 A;  3ERQ A;  4C56 C;  3H0G B;  3MAQ A;  5ISR A;  1TWH B;  1BF4 A;  5EQ0 A;  5T1G A;  5DM6 3;  1EWH A;  1SYF A;  1CI3 M;  1GXD C;  5EGT A;  1STY A;  3MHB A;  4FVM A;  5CV7 A;  3CRL C;  5C4Z A;  4IUP A;  2FHT A;  3KBX A;  2AQ3 B;  4O42 A;  3S1N B;  4C3H B;  5DNF A;  1ROD A;  1QOH A;  2NTT A;  5DM7 3;  3T51 B;  1LTB D;  3E6Z X;  5C6A A;  1LT6 D;  2LMC B;  5CC4 A;  1JWS D;  4FP5 D;  3NTI A;  3JAM L;  5IOD A;  1U4R A;  1SYD A;  4KHV A;  5IOC A;  5CV5 A;  5KNC A;  3D6C A;  1LT5 D;  2X6L A;  3J80 L;  2A74 C;  4OGQ C;  3SK8 A;  1JWM D;  2Q8T A;  2IX3 A;  4RGT A;  2PPB C;  1A3T A;  1KLG D;  2K5D A;  1BCP B;  5HUR A;  3I90 A;  1HTP A;  1JR0 D;  3RLF A;  1UNS A;  2NUC A;  2EVB A;  5EPJ A;  3RUZ A;  2PYK A;  3MTS A;  5C0X J;  1RDP D;  5T1I A;  1Z7T A;  1CFM A;  4X3U A;  4DA2 A;  1AZQ A;  3MC0 B;  1WTV A;  3NBI A;  2XIW A;  3C46 A;  4HAE A;  2EDG A;  3SDZ A;  1PYW D;  2WII B;  3BS1 A;  2EYF A;  3N52 A;  4HR7 B;  4KMU C;  4QB4 A;  2AQ1 B;  5IT9 E;  2OF1 A;  3H6M A;  4K2L A;  3OOC A;  3PUZ A;  4RCN A;  1WCM B;  1EYC A;  3PV0 A;  4ZKC B;  1ENA A;  1X3Q A;  2HCC A;  3NTH A;  1C48 A;  1LTI D;  4K14 A;  2F0U A;  1STB A;  2NVY B;  2PNR C;  1ONL A;  1X32 A;  2LKV A;  2KJX A;  3BDL A;  1GHK A;  2LFN A;  4C1N I;  3OWE B;  3RZD B;  2V4D A;  2CVR A;  1QG7 A;  2HCI A;  5E1F A;  4OO1 H;  3MXG A;  1EWC A;  2FMC A;  1E0B A;  1T5X D;  2L1B A;  1BUV T;  1EZ8 A;  3A8I E;  2EZV A;  3CRK C;  4FYD A;  2HUG A;  1GUG A;  3M4O B;  1MSH A;  2NYZ D;  2B2W A;  2L0C A;  3L7Z C;  4MHE A;  1EY0 A;  1F9Q A;  1AW7 A;  2PW7 A;  3R2I A;  1H9K A;  1KAA A;  2XVS A;  3A7L A;  5J39 A;  1X3P A;  1O78 A;  1JWU D;  4DNR B;  4PMW A;  4IFD H;  2BDN A;  3ZYY X;  1LTT D;  2A6H D;  5KEE A;  5C0X I;  2IJ0 A;  2K33 A;  1I4G A;  3SEB A;  2ID0 A;  4FF3 A;  1E2W A;  1KDA A;  3J7A V;  3AU7 A;  4ABN A;  1HUN A;  1XWE A;  3S15 B;  3LX0 A;  2G9H D;  1IL8 A;  3MFG A;  2XRS D;  3SXH A;  2QKI C;  5KGU A;  1M8A A;  3FKI B;  1EY9 A;  4B9X A;  5E4X A;  2RDF A;  3D6W A;  4WFN 3;  2JSO A;  1PTO H;  1SNP A;  1PZJ D;  5NUC A;  3NQI A;  3S14 B;  4CKB A;  2KCN A;  4L8J A;  2KA7 A;  2VUM B;  1KNA A;  1STH A;  2A6H C;  4ODG A;  5D3I B;  2E2J B;  1PFB A;  3LWU A;  1T5E A;  1VMC A;  4J1M A;  4BY1 B;  2NVX B;  5C3X A;  3ND9 A;  1I4X A;  4LAA A;  2LS0 1;  4KD4 A;  4K6L A;  3TDQ A;  4A3B B;  1SNO A;  1B1Z A;  5E3F A;  1HUM A;  3S1M B;  4KKU A;  4DAY A;  4EQP A;  1HFN A;  1TWG B;  2EYH A;  3P20 A;  4K6D A;  2PZU A;  1PZK D;  5COR A;  1EY8 A;  1D1K A;  3OHX C;  3KLS X;  1V1P A;  3I72 A;  4QUF A;  1SYE A;  2RDH A;  3WOE A;  3C1F A;  1EQT A;  2IX0 A;  5FKA C;  4ID6 A;  3GD7 A;  5M5X B;  1I6V C;  1BCP C;  3IKJ A;  1V43 A;  1EEI D;  4J8Q A;  5IGG A;  3A54 A;  5LL6 X;  4XTC S;  2XNA C;  3VR6 A;  3HOX B;  1K8M A;  2NB0 A;  1F2Y A;  4IFD J;  1I4Q A;  1EY5 A;  2R61 A;  1TS4 A;  4C3J G;  4TKO B;  1NCV A;  5A35 A;  1D5X C;  4L63 B;  1QIL A;  2IW3 A;  1SSO A;  2AQ2 B;  2F0Q A;  1S5E D;  3K5O A;  4HCS A;  4ZUJ A;  3WOF A;  1ET9 A;  2F0S A;  4HSV A;  2RSN A;  3W2D A;  3Q23 A;  4ZRZ A;  3K5L A;  4IZ8 A;  1CZW A;  3H3V C;  3GTK B;  3MXU A;  1OXT A;  3VYT A;  2R3Z A;  1DYQ A;  1DON A;  1LT4 D;  2B63 B;  3U9O A;  5D65 A;  3TBI B;  1MSG A;  2F0L A;  2KOL A;  2B2U C;  2KQ3 A;  4RGN A;  1DOK A;  4OO1 I;  4R8N A;  3NP8 A;  4OHJ A;  4P2C B;  3VR3 A;  3M7N A;  3ONA B;  3I3C A;  1II3 A;  1BBX C;  5KIX A;  1STE A;  2A73 B;  2N55 A;  1WTW A;  4A3J B;  4KTA A;  5FLX L;  4RKL A;  1JC7 A;  1F9S A;  2F4I A;  1DJR D;  3LWE A;  3VR4 A;  3KBG A;  1NSN S;  5G3L F;  3CQZ B;  4RA8 A;  4ZLT F;  1EEF D;  2Q8R E;  3JAM E;  1GUT A;  1SJH D;  4OL7 A;  2F0O A;  2E75 C;  2QIL A;  2GA4 B;  5KYL A;  4IFD I;  3J80 E;  4IUR A;  1F77 A;  4KN4 C;  3M4Y A;  1HQM C;  1A2U A;  1LV9 A;  1EYD A;  2JP1 A;  4KY7 A;  5D14 A;  1U4M A;  3OIQ A;  2EY2 A;  4XQN A;  2A69 D;  4DK0 A;  1LO5 D;  1Z47 A;  4NW2 A;  1U9R A;  1OO9 B;  3SR1 A;  4DNT B;  3C3L A;  1WVL A;  3EA6 A;  4DGZ A;  5BN3 A;  4A3F B;  1VCI A;  2VXW A;  1JE4 A;  4BBR B;  1F2M A;  1YNN D;  2D9U A;  4K5X A;  5I2Y A;  1TKW B;  2NN6 G;  2CW0 D;  1ILQ A;  1CT1 D;  3MEH A;  2NZ1 D;  3PO2 B;  1PXU A;  1SMY C;  3PUW A;  1BDO A;  2A69 C;  2MHV A;  1AZP A;  3GTQ B;  1ML0 D;  3L9A X;  5COY A;  2NWG A;  4A3M B;  1EZ6 A;  4KI0 A;  1IYU A;  3T16 A;  3Q0A A;  1EOT A;  5M5Y B;  1SBB B;  3BYT B;  1QJO A;  2KED A;  3OIP A;  4DAV A;  1O7Y A;  2F0J A;  4TQU S;  1YNN C;  2BE5 C;  1SNM A;  4IAL A;  3Q24 A;  3AMU A;  3KLS A;  1PZI D;  3A56 A;  1QNU A;  2R6G A;  3FPP A;  4ZKB B;  1STA A;  2IT1 A;  1H9S B;  2F0M A;  5J22 A;  1I6H B;  5CR3 A;  2B39 A;  1SNQ A;  3FRP B;  3P7J A;  5F2D A;  2IWH A;  3SK4 A;  4CJ1 B;  2WKC A;  1D2B A;  2MJ8 A;  2MGS A;  4LJZ C;  3GTP B;  4BA1 I;  2X69 A;  2K32 A;  1J8I A;  5EPK A;  3L3O C;  2DY7 A;  4DK1 A;  4M1U B;  1STG A;  1D5Z C;  1Q90 A;  4PMC A;  4HCE A;  2I46 A;  5AFW A;  1WTX A;  4B08 A;  2QF7 A;  2FFK B;  1F9R A;  4EQN A;  5CBA E;  1MI2 A;  1VMP A;  1EFI D;  3G6J B;  1B53 A;  3MXN A;  5C3W A;  3DEP A;  2RQX A;  3BDC A;  2JEB I;  1B3A A;  1G91 A;  1Y8O B;  4S3S A;  4KJN A;  1RF2 D;  3I73 A;  3U9S A;  1EIH A;  2A6E D;  3NUC A;  3VA5 A;  4A3G B;  4I7Z C;  2G9D A;  1KTK A;  2QDB A;  2B2U A;  3ITP A;  4DXF A;  3GTM B;  4C3J B;  2O5I C;  2F0T A;  2RKS A;  5ELE A;  3D4R A;  1GUS A;  4JK1 C;  3T4A C;  5M5W B;  3MA2 B;  3TME A;  4XYO A;  1TQO A;  2A5H A;  3QO2 A;  1G2T A;  4R8I A;  4K5V A;  3I70 A;  1CQF A;  4B9W A;  1O80 A;  1W6J A;  2F0V A;  5J1Z A;  2NVT B;  4QF4 A;  1Y8P B;  2K28 A;  3GO5 A;  4BWG B;  1Q1B A;  3A55 A;  2XN9 C;  2A6E C;  1CA6 A;  2ICI A;  3NTK A;  4U68 A;  2J4X A;  5DEH A;  1G6Z A;  5EBD A;  5I9P A;  2E2D C;  3SVM A;  4A3K B;  3TP8 A;  1O7Z A;  4L6T B;  1S5D D;  4FF2 A;  4ZYS A;  4NKL A;  1AFP A;  3C2P A;  1DXM A;  3M7G A;  2A68 C;  1PTO D;  1PRT B;  1LT3 D;  1KNE A;  5A2Q L;  3CU7 A;  1SNC A;  3X3N A;  3HEJ A;  2MUY A;  4XQQ A;  3K59 A;  3CKI B;  2RSO A;  1FR3 A;  1M4V A;  5CBE E;  3BVM A;  4PNY A;  2F3W A;  3MVV A;  4PV1 C;  1KDC A;  3SE0 A;  3KUP A;  1GJX A;  1RTO A;  1TY2 A;  4F7X A;  2Y0S B;  2B8F A;  3DWQ A;  4QUC A;  1QNK A;  1E2Z A;  3NPP A;  1PTO C;  2YYZ A;  2C5C A;  3NWT A;  4K8I A;  3Q22 A;  2N88 A;  1QWY A;  1AP0 A;  1JB3 A;  1EQV A;  1Y69 U;  4NMZ A;  2F0F A;  3GTJ B;  1WD1 A;  2L5T A;  4ZK9 B;  1MD2 D;  3MXP A;  3GV3 A;  3K5N A;  2NVQ B;  3DWA A;  4F88 A;  1DD2 A;  4XT1 B;  3S1R B;  1C8C A;  1KDB A;  2WKD A;  1U4L A;  1RTN A;  1JCK B;  3S9W A;  3GQB A;  1Y1W B;  1BQQ T;  1W6K A;  3F2U A;  2J7Z A;  4GZY C;  5FLX E;  2F0I A;  2E74 C;  3QG1 A;  2IX1 A;  2AUK A;  4NP5 A;  1XYI A;  5IGF A;  3IFT A;  4FNF A;  1TII D;  2ZXR A;  1SYB A;  2F0W A;  1BCP D;  1D5M C;  1NR4 A;  2Z4H A;  4K8J A;  4G4K A;  4PMB A;  4KY6 A;  5JVG 3;  3DXJ C;  2ZXO A;  1YNJ D;  1R9T B;  4FF1 A;  4F8M A;  1I3Q B;  3K6O A;  5FO7 B;  4HTH A;  4KJO A;  3D4W A;  4WRD A;  4CKC A;  4QMG A;  3KK7 A;  5LL6 S;  2M2L A;  4RGO S;  2D5D A;  4RCO A;  5TSS A;  4BY7 B;  1IYV A;  4Z9C B;  2EJM A;  5JPN C;  2YU9 B;  4XYQ A;  3HOY B;  3R8B A;  3GTG B;  3OPO A;  2PZW A;  3S16 B;  1HPC A;  1TWA B;  3PUY A;  1YNJ C;  1KAB A;  5IGB A;  1TT2 A;  5FK9 C;  3TSS A;  1OXX K;  3VA7 A;  1I4P A;  1LAC A;  4HMI A;  3E5S A;  3SK5 A;  1S4Z A;  4Q0F A;  2HDM A;  1WTO A;  3URY A;  5JAV A;  1SE3 A;  5CV4 A;  4MN3 A;  4ZUI A;  3HOW B;  3V05 A;  1R4Q B;  3DM1 A;  2XSC A;  1CTM A;  2O2L D;  3H94 A;  2K6A A;  1Z6H A;  3D4D A;  1VF7 A;  4CHT B;  3NK9 A;  5FOB B;  4HED A;  2F0D A;  1ET6 A;  1RHP A;  1GUO A;  2KEC A;  4KHZ A;  1LAB A;  2FMM A;  4X3K A;  4DAP A;  1GUN A;  3S17 B;  3HP3 A;  2D62 A;  4WJW A;  4OIK A;  1JIC A;  1OXU A;  1Q12 A;  2F0E A;  1PRT C;  4G7H C;  3J81 L;  5CV6 A;  4G7O C;  1D1I A;  1I50 B;  5EKL A;  1PDQ A;  3HGB A;  1B9M A;  1V1P B;  1B9N A;  2VNU D;  3E0J A;  3GP7 A;  4KKT A;  2EPB A;  4C3I G;  4BA2 I;  3QIA A;  2IL8 A;  3BG3 A;  4C2M B;  2EY1 A;  4TRD A;  3RZO B;  1JOR A;  2H4O A;  4FF4 A;  3HOV B;  3BYY B;  2CQA A;  2TMP A;  1WTP A;  4G7Z C;  1BOS A;  2B8G A;  1SND A;  1NAP A;  4O1N A;  5CV9 A;  2K01 A;  2RA4 A;  1R4P B;  5KND A;  3TZD A;  3A8J E;  3N6R A;  3PUV A;  4HN7 A;  4F87 A;  1WTR A;  3OW7 A;  4XDX A;  1SMY D;  2MPM A;  2WB1 B;  1V8Q A;  2NBF A;  5E4W C;  2R7Z B;  1A6X A;  1PFN A;  4DF7 A;  4H7B A;  1UUP A;  2K05 A;  2VB2 X;  1FYC A;  3EJI A;  4NDX A;  1A15 A;  1A3V A;  5JPM C;  4EGV A;  3Q6S A;  2BE5 D;  2BCO A;  4KKS A;  2E2I B;  3S2H B;  2F1M A;  1MGS A;  4RHS A;  3BVZ A;  3CHB D;  4EQO A;  1DZ1 A;  3BVG A;  1OXS C;  3A8K E;  3M3Y B;  5KNB A;  4TSS A;  4K2K A;  5I6Y A;  1C4Q A;  1H9J A;  1V1O A;  1ENC A;  1ZYR C;  3OMC A;  2E2H B;  5C0X G;  3VYR A;  2HDL A;  3TP5 A;  2NN6 H;  2O4X A;  3K58 A;  4MIU A;  1JOK A;  2Z4I A;  5M9O A;  1FNV A;  2H1E A;  2Z1C A;  4A3E B;  5A2Q E;  1BXT A;  1RD9 D;  3GTO B;  1F9P A;  4XT3 B;  3PIP 3;  5M3F B;  2F0P A;  1K83 B;  5C3E B;  4JBW A;  3BDO A;  3HKZ B;  2EYM A;  4IUQ A;  5EJW A;  4QCL A;  2JA8 B;  2R92 B;  1SJE D;  2FJ2 A;  3TP6 A;  3VYS A;  1JOQ A;  2F0K A;  2Q8I B;  2FIN B;  1SE2 A;  3I91 A;  2EYO A;  2PZT A;  1SEB D;  1MBY A;  3MZ5 A;  4UAI A;  2AUJ D;  4RHR A;  2DNE A;  2EYJ A;  4C1N K;  1BNZ A;  3T53 B;  1ESF A;  2J0T D;  3NHH A;  1EYA A;  1TWC B;  4BS9 A;  3SHL A;  4CJ2 C;  4RWS C;  1RCV D;  1OXV A;  1XTC D;  2D2C C;  1SAP A;  4AYB B;  1DCZ A;  3X3M A;  3MFY A;  1QB5 D;  3V96 A;  5ELB A;  3I4L A;  2L9H A;  1DM0 B;  1AN8 A;  1JOO A;  2B2Y C;  2F0N A;  2F0G A;  3M85 A;  5JEA G;  3PMF A;  5HGT A;  4ILW A;  2PW5 A;  3KLR A;  5BN5 A;  3HOU B;  4ULL A;  1Q8I A;  2L55 A;  2WIN B;  4N9P A;  3NBH A;  3GV6 A;  2EYP A;  1TWF B;  1QCB D;  2BA0 A;  4FO2 A;  5I9O A;  1ICW A;  2QCP X;  3DMU A;  3IAY A;  3OMG A;  1FNU A;  1EY6 A;  2JA7 B;  4RKB A;  1A3U A;  5IGD A;  5IGC A;  3TP7 A;  5JEA H;  5BN4 A;  3RD4 A;  2L11 A;  5I2X A;  3NSW A;  5CV8 A;  1CHQ D;  1PTO F;  5EKK A;  1DOL A;  4DFA A;  3D3R A;  1EY7 A;  2JYO A;  3HRZ C;  2A68 D;  3TZU A;  3UI2 A;  2EYL A;  1LTR D;  5EKI A;  5D3D A;  2F0H A;  2CHB D;  3IL8 A;  1WD0 A;  1IHZ A;  5C4X B;  2M9V A;  4OIJ A;  3FDT A;  2K1B A;  3DUZ A;  1A2T A;  5ELD A;  2M00 A;  2ICE C;  4FXD A;  4OO1 G;  5K36 G;  2PQE A;  2RDG A;  1HRJ A;  2SOB A;  1HQR D;  3HG9 A;  1Y8N B;  4M8A A;  5KRU A;  2RBM A;  2SEB D;  4C3I B;  4A3D B;  1EL0 A;  3BZD B;  3VYU A;  1XXG A;  4CBV A;  2OT2 A;  1HA6 A;  1TR5 A;  1NR2 A;  1HFG A;  2KVM A;  1HCZ A;  4N9T A;  5C4H A;  4X3S A;  2B2T C;  3R93 A;  5K36 H;  1HA5 A;  2BOS A;  2MP1 A;  1SE4 A;  4IUT A;  4IFD G;  3GTL B;  1U4P A;  4CGY B;  4CKE A;  2WAC A;  2NN6 I;  3AB9 A;  1GHJ A;  4J6H A;  2TSS A;  1ZEQ X;  3J81 E;  5IGE A;  5KYI A;  3MWY W;  5JEA J;  1BCP F;  2SNM A;  1IW7 D;  4R9W A;  1SYC A;  2WP8 J;  4K5W A;  1EU4 A;  2EOT A;  5EPL A;  1TS3 A;  1VF5 C;  5DAU A;  1GUW A;  1LTA D;  3NE5 B;  4DU9 A;  5M3M B;  2PO4 A;  4QIW B;  5CGK A;  2PCF B;  1RJT A;  4E6I A;  1STN A;  1ZXT A;  1S5C D;  1S5B D;  1IW7 C;  5IIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...