4DNIA

Structure of editosome protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
257
structure length
257
Chain Sequence
b'TILPQAPQYHLDVAPNAPEEGEVAAHWRCVNHCVMLGVVQNIQEGFVFEDKVLQFTLITDFEGPSPGDPDKDFHTVRVFDSDYSSRVKEQLRDGEWFLVTGRLRMVPQYDGSMRKYYHYPVIQVHPGCGSVLKVKLASGAGHMKSVNSVTLVGVVHDIQSGFVYEDAVTQFTLTTTSIDTTHPTQEVVVEKDHHTIRCFGELFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNKHFYFPYIQVQPPHGQVAVIHGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion protein of RNA-editing complex proteins MP42 and MP18
publication title Explorations of linked editosome domains leading to the discovery of motifs defining conserved pockets in editosome OB-folds.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Protein binding, rna binding protein
total genus 47
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dniA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dniA02
5LMUL 1NTGA 1MJEA 3BU2A 3K0XA 2E5LQ 3CCLA 2KHIA 3CQZH 3GTJH 3W1BA 4DR1L 3GTOH 3PUYA 4YWKA 4A76A 4DR5L 2UUCL 4UP8A 1FVIA 4JI3Q 3B6YA 1JJ2A 2QA4A 5IYDG 1PH3A 2R6GA 3S24A 5GADC 1I5FA 1OXUA 1LUZA 3ER0A 3WWVA 1SLJA 2K14A 5AJ3Q 4X6AH 3K81C 4XIGS 4JI4Q 4A3IH 3NELA 3S1QH 1VQLA 3CAMA 4ME3A 2RHQB 1K0RA 4DV6L 4BBSH 5ELNA 4DV7Q 3I4OA 1HR0Q 1EFWA 2R7FA 4AIMA 2HT1A 2R7ZG 1VQ4A 1WCMH 1PV4A 4P72A 1FL0A 3U4VA 3U50C 4LF4Q 2UUAL 4XTCS 4GOPC 3E9HA 4OO1G 4IPDA 1D7QA 3A5ZB 3G48A 1PH5A 3PO3H 3GTPH 4APVA 3PF5A 1E22A 2JA9A 2DGYA 2GVAA 4DV3L 2IHEA 1Y14B 1VS0A 2I0QA 4C3HH 3BJUA 4NXML 5M3MH 4A3FG 2VUMH 1R9TH 1WFQA 2K75A 4JI2L 2EIFA 4HJAA 2R7DA 2YU9H 4AH6A 1BBUA 2VZAA 1KAWA 4HIDA 2NVTH 3PUWA 2JK8A 4JYAL 1B70B 2F4VL 4IJLA 2B63G 1YJ9A 1FGUA 4GNXA 1XNRL 3OTOL 3ICEA 4DR7L 2MO0A 4IOAA 1OXTA 1J6QA 4RMFA 1HNXQ 3KFUA 1DGSA 3GTQH 2NN6G 4GLXA 3OW2A 3UDIA 4IFDG 5BR8L 2VQFQ 1QZGA 4LF9Q 3PUVA 2GN5A 3JC66 4DV2L 2YV5A 4DV0L 4R4TA 1NBWA 5EAYA 2IX1A 1KC8C 4A4IA 1XPUA 1CKOA 4L5TA 4B3SL 2UXBL 4Y7NH 2ASBA 1SE8A 4JI1L 3A5UA 3ULPA 1L0WA 3I4NG 2KENA 4IPGA 2Q2HA 1A0IA 4X64Q 1HH2P 4OX9Q 1VQNA 5JJIA 5HGQA 4KHPL 4BY1G 4IPHA 2HQLA 1IBLQ 2NZOA 3AFPA 4JG2A 3ZJYC 1ASYA 3PF4A 5GAGC 4A3KH 1TWAH 5IWAQ 3PCOB 1I3QH 2Q2TA 2KCMA 2UXCQ 3PGZA 5H1SE 1SROA 1X3EA 4PMWA 2F3IA 3K8AA 3TQYA 2YTXA 2CWPA 4X65Q 2WB1G 4P74A 5LMNW 1PH1A 2AWOA 1VQBA 4YCVA 1EYGA 3GTGH 4JOIC 1B7YB 1KRSA 3S16H 4BXXH 4JI5Q 4A3GG 2VL6A 1C0AA 1K83H 3J7ZC 4A3EG 5IP9H 2Q2UA 4KHPQ 2CWAA 3UDFA 3S15H 3GTKH 4C3IH 5LMNQ 2NVXH 1HZAA 2OQ0A 4HJ7A 2R93H 1HJPA 1N32L 1T9HA 3M4QA 2OTLA 2UU9Q 4A75A 1E1OA 1YJWA 4BY7H 2NZHA 1U0LA 2NVYH 1K3RA 3KF6A 4L5QA 4DK6C 2JEAI 1BKBA 4LUVA 1HNZL 1XMOQ 4DPGA 3HOUG 3A74A 4A93H 4JV5Q 4QQBX 2HIVA 4DR4Q 1A8VA 3CCSA 1EIYB 1PYSB 2L15A 1W2BA 3G71A 2V1CC 3AFQA 1UE7A 4JBJA 3KDFB 1VQIA 1GM5A 1VQEA 1SFOH 2ATWA 3TEHB 2HHHL 1AE2A 4GOPA 1SR3A 4LF8L 4BA2I 1VQ7A 3I2ZA 2ZM6Q 5J3BA 4B3TQ 1VCIA 5GQOA 4OO1I 4H02A 2EXDA 5C44G 3M7NA 2K52A 3CMAA 3TRZA 1VQ6A 3PO2G 4R4OA 3JAMi 2IT1A 3CD6A 2UXDL 4DUZL 1CUKA 1JJGA 1G51A 4GKJL 1XJVA 4MZ9A 4L5SA 2C35B 3H0GG 1IBMQ 1Q1BA 1VQCA 1E7ZA 1EQQA 4NB3A 4OWTB 5M5WH 4JI6Q 4A3FH 1YIJA 2ID0A 3BZKA 1X54A 1YNXA 3M4OH 4P75A 5C3EG 2JA5G 4Y52H 2OTJA 4QIWE 4JI3L 1VQKA 1PYBA 4PZ6A 4DK3C 2Z0SA 3I4MH 4P73A 4NXNQ 3NBHB 1KL9A 1KHIA 3PIPA 4X62Q 4R1JA 5C0XJ 2NN6I 4A3JH 3HKZG 3RN5A 4IFDI 1LTLA 1YHBA 1HR0W 5AJ3L 3S2DH 3STBC 3CCJA 3OYYA 2LXKA 4A3MH 1KD1C 1IL2A 1JT8A 3S1NH 4A3LG 1CSQA 1HNWQ 4K0KQ 2K5NA 4DR6Q 2HIXA 3DLLA 1TWGH 3TREA 4DV7L 1VQ5A 1PFSA 1IXRA 4OONA 3S14H 4YCUA 2R92H 4IJHA 1A63A 5FLMH 4X66Q 4BBRG 4DR1Q 4YHHL 5IE8A 4DR5Q 2UUCQ 2JA6G 1V43A 1UE1A 4B3RQ 4GS3A 4QY7A 4YY3Q 5FJ8G 2WP8J 2ZJPA 3L7ZC 4DR2L 1X56A 2GVBA 3HOXG 4MTNA 5M5YH 2WB1E 1L1OA 3S2HH 1H95A 1W3SA 1MKHA 2MFIA 1YHAA 2YTYA 1Y1WH 1GO3E 2N78A 4LWCA 1I94L 2ZJQA 3W5OA 3PUXA 1UE5A 2AHOB 1UEBA 1EWIA 1TWFH 2LSSA 2CQOA 4GKKQ 4DV6Q 1X65A 4DKAC 1SMXA 1YZ6A 1VQHA 1OXXK 2VY3A 1NMGA 3M4PA 4YCWA 5IP7H 1X9NA 4AYBG 4DV4Q 1N34L 2Z6KA 3CXCA 1XTDA 2BA0A 3RR5A 3MEFA 1PH8A 1AE3A 4LFCQ 2VQFL 4LF9L 1A62A 2JJQA 1J5EQ 3J81j 2OWOA 4JC0A 4EQ5A 1BVSA 5IY0A 4A3GH 3CC2A 3CCVA 4DR3L 3RN2A 2RF4A 4LFBQ 4JI2Q 3HOYH 2ZTDA 1VQMA 3Q8DA 2N49A 5IYBG 1VQAA 2FXQA 4JYAQ 1X3GA 3J81i 2WAQE 2A19A 4LFAQ 2K5VA 2F4VQ 2KHJA 1K9MC 1C7YA 4OX9L 2PQAA 3OTOQ 5C0XI 3HOWG 3HOUH 3F2DA 3PV0A 1RIPA 4LF5L 3S17H 5DLQE 3TS2A 4A3IG 4DAYB 3KJPA 1IBLL 1E24A 1KRTA 3A0JA 2PNHA 1X3FA 3H15A 4HJ5A 1JB7A 4YWMA 5IWAL 4A3CH 4GNXB 2UXCL 1U5KA 2JA7H 2MNAA 4LUOA 1VQGA 5M3FH 3T1YL 1QUQA 4DV5Q 4LF6Q 4TVAB 1X6OA 3J80i 1BBWA 4UPAA 3F2BA 3T1HQ 1PHJA 1M90C 3HOZH 2Y0SG 5C4XH 5C44H 5GROA 3M85A 4GN5A 4HJ9A 3HOVG 1VQPA 3PO2H 2D62A 2BH8A 3HKSA 4UY8C 5M3MG 3CC4A 5K36G 3L2PA 1KQSA 3RNUA 3HKZE 2ALYB 3KLWA 4KLKA 1FJGQ 2VUMG 2JEBI 1KIXA 4L5RC 3H0GH 4JI8Q 5LMNL 3RZDH 1IBKL 4A3DG 2RHSB 4P71A 4GLVB 1MIUA 4A3BG 3H3VI 1L2FA 3FKIG 3E0EA 1WI5A 4O2DA 2VQEQ 2CKZB 5C3EH 2JA5H 4WJ3M 1XMOL 2UXBQ 3CC7A 3PSIA 1Z47A 4DR4L 5IYDH 2OQKA 1HZBA 1Q86C 4UP7A 1CKNA 1WOCA 4FDBA 5C0XG 3EIVA 1N36Q 3K7UC 3RZOH 5JJLA 1C9OA 3UDGA 1ASZA 4JI7Q 1G6PA 3CF5A 3K80C 3LGJA 1SN8A 1TWCH 1M1KC 4YWLA 2JE6I 3HFZB 2ZM6L 4B3TL 3UE0A 2UUBQ 5JEAJ 1XNQL 2AMCB 2A1AA 4IOCA 2R7ZH 1EOVA 1GKHA 4DV1L 1PA6A 1WYDA 4C2MH 1CSPA 1G291 4BBRH 4AQYL 2VNUD 4JI0Q 2MO1A 3TS0A 1N33Q 4JBMA 5FJ8H 4AYBE 2JA8G 2N3SA 1WJJA 1LYLA 4DAMA 4EX5A 3HOXH 1NE3A 2B3GA 3D31A 1PVOA 4LF7Q 4JI6L 4OWXB 2E5LL 1Q8KA 2ZTEA 3MXNB 2NVQH 2AKWB 3RLOA 3S1MH 1B8AA 5E7NA 4DUYQ 3KF6B 1IYJB 3IRBA 4LF8Q 3GD7A 3JAMc 2VS1A 5ELOA 4QJFA 4NXNL 3CP0A 2VW9A 2QEXA 1Q12A 2YYZA 4IO9A 3NEMA 2B63H 1PH6A 3CPFA 1YEZA 4B3MQ 1X55A 2PI2A 1XMQQ 4DNIA 1GVPA 4JI4L 3UDXA 4GOPB 3F2CA 4UP9A 5IP9G 3J7A5 1YJNA 1I6HH 4DR6L 3ULLA 5LMUQ 1JMCA 1HR0L 2R93G 4PG3A 5IT9c 4HIKA 1P16A 2K4KA 5JJKA 4X66L 4LW1A 3W1GA 4LF4L 4BY7G 1Y1VG 1N8RC 4B3RL 1PH2A 3UE1A 4YY3L 3CCEA 3RLNA 5IYBH 4KI0A 3KJOA 2OCEA 4A93G 1K73C 1Q82C 5IYCG 4J15A 2Y0SE 3NENA 3I4NH 1KXLA 3KYHC 2I5LX 3HOWH 4MNOA 1V1QA 3CCMA 4R4CA 1YI2A 4BY1H 3E9IA 3CCQA 3KF8B 1O7IA 2N8NA 3D0FA 4GN3B 3U4ZA 4GKKL 4JCVE 2JQOA 2AWNA 1EUJA 4BA1I 1OTCA 2F52A 4JOIA 3FHWA 5HY6A 1XPRA 1RL2A 2BA1A 1UE6A 5C4JH 2K50A 3GO5A 2KBNA 1VQJA 1HZ9A 4R4IA 1Q1EA 4YHHQ 4LUZA 4DV4L 4POFA 3G4SA 1S40A 1Q46A 1JE5A 1HNXL 2A8VA 1TWHH 4DR2Q 4LFCL 3AEVA 3HOVH 1J5EL 4DV3Q 3S1RH 3CW2C 2DUDA 4NXMQ 2IY5B 4A3EH 1VQDA 2PI2E 2WFWA 1I94Q 4NPSA 1CKMA 2EQSA 1QVGA 2YTVA 3RLFA 4A3DH 4LFBL 3BZCA 1AH9A 3CMEA 3I4MG 2CFMA 4A3BH 4R4QA 3FKIH 1S3OA 1L1OB 4LFAL 3FP9A 4DR7Q 1MJCA 4X64L 4A3JG 1XNRQ 3VDYA 2MQHA 1N34Q 2E2HH 4A3MG 4POGA 1Q7YC 1HZCA 1LM0A 1Q81C 5BR8Q 3M3YH 2I5HA 2D0PA 4BBSG 4DV2Q 2XTIA 1S72A 2ZJRA 4IPCA 4DV0Q 4JBKA 1WCMG 2R92G 3J81c 5FLMG 4DR3Q 4QGUA 1E3PA 3SGIA 1YBYA 4LF6L 3ULJA 4DV5L 1PH7A 5JEAG 4X65L 1VQ8A 4B3SQ 3T1HL 3PO3G 4ALPA 3PIOA 2XGTA 4JI1Q 2D0OA 3L0OA 1EQRA 4JI5L 1VQOA 1Y1WG 3STBD 1FJGL 3GDEA 1V9PA 1P8LA 2E8GA 4LF5Q 4GLAC 2JA8H 4JI8L 1JJCB 4C3JH 3I56A 2UUAQ 1VQFA 2RCNA 2IX0A 1TXYA 1NMFA 3CCUA 2B29A 3U58A 2ES2A 3KDFA 1L1OC 3J80c 2UU9L 2VQEL 3PUZA 1OXVA 1VQ9A 5IP7G 2PQAB 2BH2A 2QGQA 1IZ6A 4TQUS 3H3VH 4RG1A 4JV5L 5M5XH 1XNQQ 3T1YQ 4GN4B 1Z9FA 3G6EA 1GD7A 4WJ4A 3EN2A 2ZTCA 1QVCA 4IFDJ 1N36L 4JI7L 4GNXC 2E2IH 3M9BA 3AYHB 4A3LH 3HOYG 1IBKQ 4OWWB 3AQQA 1QUQB 2Z6KC 3GTLH 2UUBL 1YITA 4KHZA 1N32Q 1YVCA 1OXSC 3CPWA 2KCTA 4QL5A 4JI0L 1Y1VH 3I7FA 1N33L 2JA6H 4O0AA 1K8AC 1HNZQ 3K7AH 4PZ8A 2IHFA 3DM3A 1IBML 2H5XA 5GAHC 5IYCH 1PH4A 1E1TA 4LF7L 4A3KG 3KOJA 1NY4A 1UWVA 4PZ7A 4DUYL 2K5HA 2HHHQ 2CCZA 4A3CG 2E2JH 4HIMA 2Q2IA 1PH9A 2JA7G 4HIOA 1QZHA 3F8TA 5M3FG 2WAQG 1NJIC 1QVFA 5GAEC 4LNQA 1I50H 3ERSX 3EBEA 1CKNB 4OXPA 4X62L 3HOZG 1EIFA 4DV1Q 5C4XG 2I5MX 1D8LA 1SRUA 3F1ZA 5FLXc 4AQYQ 4B3ML 3CCRA 4BXXG 4DUZQ 1XMQL 2UXDQ 2LXJA 3GTMH 4JBWA 1K8GA 4GKJQ 3I55A 4HJ8A 1YHQA 1HNWL 1N9WA 4K0KL 2PMZE 1XPOA
chains in the Genus database with same CATH superfamily
4CDCC 1NTGA 5LMUL 2ENBA 3IFTA 1SNDA 3K0XA 4UHVA 1GOZA 2L55A 3NQTA 1Z7TA 3S1RB 3NK9A 1PH3A 1BUVT 1PXUA 5GADC 2V4DA 3A8KE 1I5FA 2MPMA 3ER0A 3WWVA 1SLJA 2K14A 3NELA 1AFPA 3CAMA 4DV7Q 2R7FA 2FMCA 4JPBW 4AIMA 1GJXA 2IL8A 4CKBA 1FL0A 3ND9A 1A2UA 1UEAB 5DM63 4IPDA 1F9RA 1EYCA 1EY0A 1I4GA 2RA4A 2C9OA 1E22A 5ISRA 2DGYA 4C3HH 4NXML 3WOEA 4JI2L 2EIFA 4HJAA 2R7DA 4RWSC 2O4XA 3NTIA 1BBUA 3SK8A 1KAWA 4F88A 4HIDA 4OGQC 3T53B 4C3JB 5ELEA 4DR7L 1YJ9A 2TMPA 2MO0A 3U9OA 1LTSD 1J6QA 2A6EC 1RCVD 1XWEA 3A7AB 3GTQH 4DAVA 1AZPA 5BR8L 2VQFQ 4IFDG 1L0YB 2YV5A 4I7AA 2D5DA 2IX1A 2A6HD 4FO2A 1EQVA 1LO5D 1XXGA 4R8NA 4L5TA 2N88A 3FEWX 5A2QL 2ASBA 1CHPD 1L0WA 2B2UC 2SNMA 5JJIA 1PZJD 1VMPA 2SEBD 3LWEA 3ZJYC 3TP6A 1ASYA 5GAGC 1TWAH 1RTOA 2K03A 3PGZA 1X3EA 2K33A 1JQYD 3E5SA 3K8AA 4X65Q 2XWBB 3H3VC 1MHWC 2K1BA 1EYGA 4YCVA 1B7YB 4CDEC 4BXXH 4CKCA 3J7ZC 4A3EG 2Q2UA 5ELBA 1B3AA 1ENFA 5CV5A 1HZAA 4HJ7A 1HJPA 1N32L 1T9HA 2RDFA 4FXKC 5JPMC 5I6WA 4BY7H 1K3RA 2JEAI 5J39A 2AUJD 4LUVA 3HOUG 2A5HA 1S5FD 1KDAA 1NR4A 1ICFB 2V1CC 4JBJA 1GM5A 3TEHB 2HHHL 1AE2A 2DN8A 4LK1C 2DY7A 4BWGB 2K52A 4BBSB 1T5EA 3I4LA 3PO2G 4DUZL 1G51A 4IZ8A 1EY9A 1IBMQ 5E4WC 4HEDA 3MEHA 1HA5A 1MSGA 1DYQA 4KK7A 4OWTB 1YNXA 2TSSA 3KF8A 1VQKA 4PZ6A 1SBBB 5M3MB 2Z0SA 3I4MH 2VUMB 4P73A 4ZK9B 4NXNQ 3NBHB 1KL9A 3PIPA 3D3RA 4R1JA 1QNKA 2NVTB 4A3JH 4IFDI 1YHBA 2FINB 4RAUC 2F0KA 2X6GA 4A3MH 1IL2A 1CZGA 4A3LG 4XXEA 4K0KQ 2K5NA 4DR6Q 1TWGH 3FPPA 1VQ5A 1MBYA 4IJHA 3VA5A 4CBVA 5FLMH 4BBRG 4IUNA 2WP8J 2FJ2A 1STYA 2E76C 1FYCA 1YNJC 3L7ZC 3HOXG 5M5YH 2WB1E 4PV1C 5EGTA 2KJXA 3D8GA 1ZXTA 1Y1WH 4FF1A 2ZJQA 4RGNA 4QF4A 3PUXA 1UE5A 1EWIA 2F0QA 1O7ZA 1TWFH 2LSSA 1CA5A 5C5LA 2VY3A 3M4PA 3VR6A 3LWUA 1X9NA 4AYBG 1AN8A 1I3QB 3BYYB 4C56C 1EWHA 4LFCQ 1A62A 4ZKCB 3CC2A 3X3MA 1GXDC 3CCVA 1STEA 2JXMB 2RF4A 3D6WA 4JI2Q 4CKEA 4IALA 5HGTA 3HOYH 1K8MA 5CC4A 5HURA 2XNAC 4S3SA 1LTRD 1X3GA 3S15B 2A19A 4C3IB 4LFAQ 2KHJA 4OX9L 5CV6A 2R93B 5C0XI 1RIPA 4NW2A 5DLQE 3KJPA 1KLGD 2ZXRA 1BCPF 1E24A 1KRTA 1B4OA 3I72A 1C48A 2EYMA 1FR3A 4HJ5A 3QG1A 1CQVA 4ZCKA 1EYAA 4KN7C 3J80L 1VQGA 5M3FH 3NWTA 3HRZC 1X6OA 3J80i 1BBWA 1L0XB 4G7OC 1PHJA 1BDOA 5C44H 2J7ZA 3M85A 3HOVG 3ONAB 1LV9A 1VQPA 4C3HG 5K36G 1CZWA 1FJGQ 4X3SA 3HKZE 1BCPC 2ALYB 3SK5A 1B9MA 4KD3A 3H0GH 4JI8Q 4P71A 1LT4D 3JAME 1MIUA 1I4RA 3SR1A 2CKZB 1D5ZC 5M5WB 4WJ3M 1CFMA 2F0HA 5IYDH 4Q0FA 3NP8A 3M4YA 4BS9A 3K7UC 3RZOH 1SNPA 1ASZA 1G6PA 5IT9E 1SN8A 1TWCH 5G3LD 2JE6I 3SEBA 3HFZB 2ZM6L 2UUBQ 4KD4A 1XNQL 2A1AA 4IOCA 2R7ZH 3K6OA 4TRDA 3SXHA 1JOOA 2MO1A 3TS0A 1N33Q 4JBMA 4IUVA 3S14B 5KNCA 2MGSA 3QWNA 1MI2A 2N3SA 3NBHA 4RH6A 4B08A 3NUCA 2B3GA 2G5DA 4JI6L 4OWXB 2E5LL 1UNSA 2ZTEA 3RLOA 1WTPA 2O5IC 1B8AA 5DM73 3IRBA 4ABNA 1STBA 2Z8LA 1HUMA 1NSNS 3NEMA 2SDFA 3CPFA 2PI2A 1XMQQ 4DNIA 1GVPA 4GOPB 1T5XD 3J7A5 1YJNA 2NN6H 3N6RA 2A69D 2WB1B 2E75C 1P16A 2K4KA 2KCNA 4BY7G 5EJWA 1PH2A 1STNA 3UE1A 4A3GB 1WTOA 3Q0AA 5IGDA 2QF7A 3T51B 2Y0SE 3NENA 2I5LX 5IGGA 1V1QA 2VB3X 1YI2A 4BY1H 3E9IA 3D0FA 1ZYRC 3J81E 4GN3B 4GKKL 1JWMD 5A2QE 5CV9A 1EUJA 4H0LC 1S5ED 2EYPA 2F52A 3FHWA 4ZLTF 1DD2A 1XPRA 1UE6A 3QJYA 5C4JH 4R4IA 1HFGA 1Q1EA 1TT2A 4K5WA 4DV4L 1XPUA 1JE5A 2A8VA 2AQ1B 4ZUIA 1J5EL 4G4KA 4G57A 1S4ZA 1PTOB 3CW2C 2DUDA 3S1RH 4WORA 4KN4C 1MGSA 1VQDA 2WFWA 1ICWA 1CKMA 4LFBL 2YTVA 3RLFA 5IGFA 3AU7A 3I4MG 3S9WA 3SHLA 2F0WA 4DU9A 3FP9A 1XNRQ 2K28A 4A3JG 2OT2A 2B2YC 3BDCA 2E2HH 2MQHA 5D3DA 1QG7A 4A3MG 2KEEA 1PFMA 1Q81C 4DV2Q 2XTIA 2CH4W 2ZJRA 1WCMG 2XVSA 5FLMG 2BDNA 3NSWA 3PIO3 4LF6L 2B2VC 5ELCA 3ULJA 3MXGA 4DV5L 1SYCA 1PH7A 4B3SQ 1BQQT 2SOBA 5L37A 1Y1WG 3GDEA 4KY6A 1P8LA 3KK7A 4C2MB 4C3JH 2EJFC 1EQTA 3V96A 2RCNA 1C4QA 2ES2A 3J80c 2QDBA 2QGQA 4RHRA 5D3IB 2NVQB 4N9TA 4WJ4A 3EN2A 3NTKA 5IGEA 1PRTF 1QVCA 1D2BA 2KQ3A 1I50B 1JORA 1STGA 2B63B 3HOYG 2ZT9C 3K0YA 5E4XA 1F2MA 3SK4A 2Z6KC 1J8IA 1YVCA 1F77A 1OXSC 3CPWA 4QL5A 4RFBA 4JI0L 5KYIA 1K8AC 1HNZQ 4PZ8A 1PRTC 3DM3A 1ENAA 1CM9A 1Q8IA 5GAHC 4F87A 3BDLA 4KKUA 4TSSA 4PZ7A 3I4NB 3F8TA 2LY7A 5M3FG 1F9PA 2RQXA 1XNQQ 1QVFA 5GAEC 4LNQA 4OXPA 3ERSX 2KECA 2I5MX 1SRUA 2F0UA 3F1ZA 5FLXc 2UXDQ 2B2TA 2L12A 2LXJA 4HMJA 5KNDA 1UUPA 4HJ8A 2H4OA 3MXPA 1KDCA 2PMZE 2MUYA 1H9SB 3CCLA 2E5LQ 3H09A 3GTOH 3W1BA 1DXMA 3VR5A 3VYRA 2UUCL 4UP8A 4N8FA 1LT6D 2M9VA 3B6YA 2QA4A 5IYDG 2R6GA 2P5ZX 3L3OC 3S24A 1WD1A 1LUZA 3C1FA 3FKIB 5AJ3Q 3S1QH 1VQLA 2RHQB 5IGCA 1O7LA 4DV6L 4BBSH 1IKLA 5ELNA 2ZXOA 2R7ZG 2OF1A 4P72A 3U50C 4GOPC 1EL0A 1D7QA 1PH5A 3W3AA 3PF5A 1QJOA 4DV3L 1PFBA 5M3MH 4A3FG 2VUMH 2Z9HA 2WIIB 5FO7B 3J80E 1AZQA 1WFQA 4DAYA 4L63B 1F2YA 4RGMA 2NVTH 1STAA 3PUWA 4JYAL 3DMUA 3CU7A 1GHJA 4IJLA 4IOAA 1K0SA 3CKIB 4RMFA 1JWUD 2Q8RE 2NN6G 5IODA 3OW2A 3EROA 5C0XH 4QB4A 2GN5A 4DV0L 4HR7B 1EFID 5EAYA 4E6IA 1DONA 1CKOA 2E2IB 3RUZA 5CGKA 4JI1L 3A5UA 3ULPA 4IPGA 1F9SA 1ET9A 2I46A 4BY1G 2JA6B 4ODGA 2HQLA 4XQQA 2NZOA 4JG2A 4WJWA 3PF4A 4GZYC 5E3FA 5KNBA 2PZTA 1B3QA 1I3QH 1X3PA 3IAYA 2KCMA 2UXCQ 1FNUA 4PMWA 3TQYA 4P74A 5LMNW 3E0JA 3SK6A 1SXTA 2VL6A 1C0AA 4KHPQ 1TY0A 5IP9H 3S15H 4C3IH 4FNFA 4DF7A 2R93H 3TMEA 4A75A 1E1OA 1HQMC 1YJWA 1U0LA 5D65A 4F7XA 2DJGC 5I2YA 1XMOQ 4A93H 3GTJB 4DR4Q 1PYSB 1W2BA 3AFQA 3DWPA 1UE7A 5CBAE 4OIKA 3KDFB 1RDPD 2ATWA 3KLSX 2CW0C 3CRKC 2RCFA 4BA2I 1UAPA 1EWCA 1U4PA 4B3TQ 2E2DC 1I6VC 3ERQA 2PMZB 2EXDA 3M7NA 3LNNA 3CMAA 4R4OA 3JAMi 3CD6A 1JICA 5KRUA 4L5SA 4C3JG 5NUCA 4IUPA 1SNMA 5M5WH 2IW3A 2EJMA 3PO3B 2ID0A 3BZKA 1A3UA 1K28A 2EY1A 4JVZA 5IT9L 5C3EG 1GUNA 2JA5G 2A6HC 4JI3L 4DK3C 1SMYD 1R9TB 1GUGA 4G7ZC 5C0XJ 2NN6I 5FO9B 1GUSA 3NBIA 1VF5C 1LTLA 4I7ZC 3STBC 3CCJA 3S1NH 1CSQA 2HIXA 3DLLA 1D6EC 4QUCA 1PFSA 3S14H 2B2UA 3EFXD 1A63A 3EQLC 4X66Q 1B50A 3MFYA 4FVMA 3E6ZX 5IE8A 2UUCQ 4B3RQ 5FJ8G 3KBXA 4X3TA 1X56A 5EPKA 4MTNA 1L1OA 4LAAA 1LLRD 3MAQA 1H95A 1W3SA 1MKHA 1GO3E 2N78A 4LWCA 4Y7NB 3OPOA 1NR2A 1UEBA 2DJFC 3I91A 2CQOA 2F3WA 4DV6Q 2K7VA 1SMXA 1YZ6A 1NMGA 3X3NA 4YCWA 4A3KB 1N34L 1RKNA 1BO0A 1XTDA 4Z9CB 3RR5A 3MEFA 5IIFA 1AE3A 4LF9L 3FPUB 2K5WA 4A3GH 4LJZC 2LKVA 4MTKA 1BCPB 3RN2A 2F4IA 5C6AA 3R2IA 3S16B 1VQMA 3J81L 5IYBG 4JYAQ 3QOLA 2WAQE 3J81i 5DAUA 2NVXB 3DUZA 5I9PA 1K9MC 1C7YA 2PQAA 1DOKA 3HOWG 2F3VA 2NVYB 1IBLL 3O13A 3WDNA 3BVZA 4EQOA 1X3FA 1KTKA 5AFWA 4J1MA 3VYSA 4YWMA 5IWAL 4GNXB 1U5KA 2FHTA 4LUOA 1QUQA 2CHBD 1PTOH 4UPAA 3T1HQ 1SYFA 2F0SA 1RJTA 2D62A 3HKSA 5M3MG 2VUMG 1KQSA 3RNUA 2JEBI 4L5RC 3DM1A 4A3DG 4M8AA 5LMNL 1IBKL 4IUQA 3NWSA 4A3BG 1L2FA 2F0LA 3HG9A 3E0EA 2VQEQ 4XQJA 1LTGD 1JR0D 3BVGA 4RHSA 2OQKA 1Q86C 5C0XG 3AMUA 1LTID 5JJLA 3F2UA 3N52A 1Z6HA 3UDGA 4JI7Q 4ULLA 2JYOA 4YWLA 3Q24A 2KVMA 2EYHA 1SJHD 2PPBC 1EU3A 1EOVA 1GKHA 2R61A 1G291 4C2MH 4AQYL 2VNUD 2M2LA 2EXZA 1YNND 4OO1H 4AYBE 3TP8A 3NE5B 2JA8G 2RSOA 1WJJA 4DAMA 2NTSA 3D31A 1PVOA 4LF7Q 3OMGA 2WKDA 3MXNB 2NVQH 2Z6BA 4DUYQ 3KF6B 1IYJB 2HQEA 5EBCA 3JAMc 2VS1A 2L9HA 5ELOA 3V05A 2VW9A 2QEXA 1Q12A 3NQIA 5K5PA 2O5JC 2B63H 2G9HD 3FVQA 1PH6A 1YEZA 4B3MQ 4JI4L 4XYQA 5IP9G 1DJRD 3R3OA 4XT3B 3GQBA 1QCBD 4UAIA 1JMCA 5LMUQ 3QOJA 2R93G 1TIID 5IT9c 4HIKA 1G2TA 4X3KA 5JJKA 1GUOA 3KLSA 4LW1A 4LF4L 1Y1VG 1N8RC 1M4VA 4YY3L 4KI0A 4A93G 2JN4A 4ZRZA 5CBEE 1Q82C 5IYCG 1EIHA 2B8FA 3I4NH 1HTPA 3KYHC 4R4CA 3DWAA 1U4LA 5A35A 3HOUB 3S17B 4EQNA 1XYIA 4BA1I 4JOIA 1RL2A 2BA1A 1VQJA 1EEID 2VXWA 4DA2A 4LUZA 4POFA 3G4SA 4DNTB 4HAEA 3KLRA 4FYDA 2JA7B 5F2DA 2WAQB 4NXMQ 4M1UB 2FMMA 5JVH3 5C4XB 3Q6SA 1Y8OB 2EQSA 3PO2B 1AH9A 2I07B 1O7YA 3BZCA 1Q90A 1MD2D 2CFMA 2F0DA 4XQNA 3FKIH 3QIAA 2F03A 3RZDB 4DR7Q 1MJCA 5C5MA 2MJ8A 3PQIA 1N34Q 5JPNC 1Q7YC 1HZCA 2PYKA 5BR8Q 2SNSA 2AQ2B 3DHQA 3J81c 3BVMA 3U9SA 4QGUA 3SGIA 2PW7A 1LTTD 1VQ8A 3PIOA 4RKLA 2XGTA 1WD0A 1E2VA 1NAPA 3NPPA 1CQFA 4KV6A 1VQOA 5T1IA 3J7AF 2E8GA 2WINB 5EPJA 2PCFB 5DNFA 4BBRB 1PRTB 1VQFA 2A69C 1NMFA 3QB3A 2UU9L 3HOXB 5KEEA 4OHJA 4F8MA 3H3VH 1VF7A 2QEJC 4GN4B 1Z9FA 4J8QA 5BN3A 4ME5A 1N36L 1TS5A 4GNXC 2E2IH 2K01A 3M9BA 1HA6A 1IBKQ 3AQQA 1ESFA 2NUCA 4U68A 1KLUD 4HSVA 1D5MC 4KHZA 5JVG3 2EYOA 3VR3A 1N32Q 4PMBA 2K32A 2JA6H 5EPLA 4HN7A 2EY5A 2C5CA 2IHFA 2H5XA 5JJZA 1PH4A 3MHBA 1RD9D 3K58A 2HHHQ 2CCZA 2Q2IA 3MXUA 4HIOA 1QZHA 2EZVA 2F0PA 1ZKOA 1NJIC 1CKNB 4X62L 1DM0B 4AQYQ 1QE6A 4FP5D 4DUZQ 4BXXG 4JBWA 5FK9C 3I55A 3OWEB 1ET6A 4K5VA 3BU2A 1MJEA 1EYDA 3HOVB 3GTJH 2B2YA 4DR1L 3PUYA 1A3VA 1TR5A 4ZQ3A 4A76A 4KHVA 5CORA 1TVXA 4RGTA 1V1PB 2XSCA 4RGOS 1F2ZA 4IUTA 4MHEA 3I70A 3J7AV 1OXUA 4DXFA 1B2TA 4XIGS 4JI4Q 2B2VA 4ME3A 1O80A 3G6JB 1K0RA 1B44D 1RF2D 1EFWA 2ZXPA 3URYA 1VQ4A 3GTQB 2L5TA 4LF4Q 4XT1B 2UUAL 1D5XC 1QILA 5BN4A 4XTCS 3E9HA 4OO1G 4HTHA 5DEHA 1FNVA 3PO3H 3MZ5A 4APVA 4J6HA 2F0OA 2GVAA 2KA7A 1E2WA 4KTAA 1R9TH 4KKSA 4C1NK 1Y8NB 3FDTA 1LTBD 2VZAA 3IKJA 2F0JA 3OWFA 2F4VL 2B63G 1FGUA 3ICEA 3OTOL 1OXTA 3H94A 1SYBA 1DGSA 4GLXA 3KBGA 1HRJA 4DNRB 3JC66 3MVVA 1K3BC 4FXDA 1CK1A 4RCOA 1NBWA 4K8JA 4ID6A 4A4IA 3HKZB 3GV3A 4O42A 2UXBL 4ILWA 4Y7NH 3AB9A 3ZYYX 3I4NG 2KENA 4OX9Q 4JW0A 2Z1CA 4C1NI 2F0VA 1A6XA 5HGQA 1JOKA 2LS01 2WACA 3K7AB 4A3KH 1SDFA 3BS1A 2F0FA 4K8IA 3PCOB 3V2TA 4LMQD 1IYVA 3M7GA 5H1SE 2F3IA 2YTXA 2CWPA 2E2JB 1PH1A 1JWSD 3S16H 3OHXC 3MTSA 3HEJA 2CWAA 1EY5A 2NVXH 3GTMB 2OQ0A 1II3A 2UU9Q 3I73A 2NVYH 4K6DA 4DK6C 1U4RA 4EQPA 4QQBX 3CQZB 1VDZA 3A74A 2KOLA 2HIVA 3DEOA 4RCNA 4ZKBB 1QNUA 1EIYB 2L15A 2B2WC 4V0BA 1NUCA 3HGBA 4GOPA 1SR3A 4OL7A 4LF8L 3I2ZA 2ZM6Q 5J3BA 1VCIA 4A3IB 4PQXA 4OO1I 4H02A 5C44G 1A3TA 4RKBA 3TRZA 1VQ6A 2IT1A 2CVRA 1TWGB 1CA6A 4DAPA 1EY8A 1BOSA 1WCMB 4GKJL 4MZ9A 2C35B 3H0GG 1ENCA 1GUWA 2F0MA 1Q1BA 1TS3A 1E7ZA 1VQCA 4HCSA 4NB3A 4FF3A 4JI6Q 2K5DA 1YIJA 3GTPB 1X54A 2Y0SB 3BZDB 4P75A 4QMGA 4Y52H 2OTJA 4QIWE 3DWQA 1PYBA 2F0IA 4UDUC 1Y1WB 1PLFA 4X62Q 1TWFB 2BE5D 3MWYW 2YU9B 3RN5A 2D2CC 1HR0W 3OYYA 1B1ZA 1V8QA 4YIJA 2D9UA 3TREA 4DV7L 4YCUA 4IQZA 4CGYB 4Q5VA 4DR1Q 2JA6G 1UE1A 2RDHA 4B9WA 4CJ0B 2ZJPA 2GVBA 3QR8A 1YHAA 3IL8A 3RD4A 2AHOB 2LFNA 4GKKQ 1X65A 4DKAC 3BG3A 4ZUJA 1HQRD 5J1ZA 1OXXK 1TS2A 2EY6A 2X6LA 4DV4Q 1SEBD 1PH8A 2VQFL 2JJQA 4H13C 1J5EQ 3J81j 2OWOA 4JC0A 4EQ5A 3T13A 2PNRC 5IY0A 1EY4A 1Q3LA 3GTGB 1PMRA 4LFBQ 5C4ZA 2ZTDA 4K5XA 2NZ1D 1IW7D 4DFAA 2N49A 3GV6A 1K83B 1BF4A 3GTKB 1KAAA 2K5VA 2F4VQ 1IKMA 3TDQA 1JCKB 3OTOQ 5I9OA 2K04A 3HOUH 1H9RA 1Y69U 4LF5L 3S17H 2GA4B 5LL6S 2QCPX 3H15A 1V1OA 2PO4A 5JAVA 1CT1D 2JA7H 1XX8A 1SFOB 4LF6Q 3T1YL 4DV5Q 1SMYC 2UXBQ 4DN4M 1TWCB 1M90C 5C4XH 5GROA 3FRPB 4CDDC 3PO2H 3Q22A 2J0TD 4KLKA 3KLWA 1KIXA 2EYLA 3RZDH 4GLVB 3H6MA 2RSNA 4K6LA 3VR4A 2HUGA 3H3VI 3FMCA 4WRDA 3MA2B 3P1HA 2BCOA 4FF4A 4A3FB 1F2LA 3CC7A 3PSIA 1Z47A 3M4OB 2ICEC 3K5MA 1HZBA 4UP7A 2JSOA 4FDBA 3OIQA 1C9OA 4PMCA 3CF5A 3LGJA 2EOTA 1HXYD 3S2DB 2AMCB 1H9SA 2QKIC 3R2TA 4DV1L 1PA6A 1WYDA 1CSPA 2NBFA 4BBRH 4JI0Q 4MN3A 1K8OA 4FF2A 1DOMA 4QIWB 2R92B 4EX5A 3HOXH 1LYLA 4O1NA 1W6KA 1ILPA 1ML0D 2BOSA 2AKWB 2EYJA 3S2HB 4LF8Q 1SNOA 4QJFA 4NXNL 3CP0A 4ZAIA 1TY2A 2YYZA 4P2CB 4IO9A 5M9OA 1PTOD 2XRQD 5IGBA 2M00A 1X55A 2G9DA 3BYTB 3UDXA 3F2CA 4UP9A 3TP7A 4K2LA 5EKKA 4DR6L 3A8IE 3ULLA 1HR0L 4PG3A 2JP1A 3A56A 2XIWA 5EQ0A 5I2XA 1H9JA 1QOHA 3CCEA 3RLNA 2QILA 4J15A 1BBXC 3MFGA 2RDGA 1WTXA 3CCMA 3C1EA 3KF8B 1O7IA 2N8NA 3U4ZA 2JQOA 2E2HB 3NTHA 2F0TA 2K50A 4R8IA 3GO5A 3UI2A 1G91A 1HNXL 2KCCA 1MSHA 4LFCL 3HOVH 4DV3Q 1RHPA 2IY5B 3HOZB 5K36H 2H1EA 1NCVA 2PI2E 1KNEA 2KHSA 2CW0D 1F9QA 5CYUA 2R3ZA 4R4QA 1S3OA 3CRLC 4LFAL 3G7LA 1GHKA 4L8JA 4X64L 1YNNC 5KGUA 3VDYA 2A68D 5C3EB 2JA5B 4POGA 1U9RA 3IFDA 4IN3A 4BBSG 2D0PA 1EY6A 1S72A 1AW7A 4IPCA 4DV0Q 3T16A 4JBKA 2HD3A 1SE3A 2WV6D 2HCIA 1E3PA 1R4QB 5C3XA 1JB3A 5CV4A 3HP3A 1IHZA 4K14A 5ELDA 2D0OA 4JI1Q 3RMHA 1EQRA 3J7YW 4JI5L 3TN2A 3STBD 1FJGL 4I65A 1V9PA 4HCEA 4LF5Q 2K6AA 4JI8L 4K2KA 3I56A 1ILQA 3KUPA 1TXYA 3U58A 3KDFA 1L1OC 3WOFA 4KKTA 1LT5D 3BDOA 1IZ6A 4TQUS 4JV5L 1EOTA 3T1YQ 3S1MB 2J4XA 3GP7A 2Q8IB 1GD7A 3G6EA 2ZTCA 3D4WA 1GUTA 1BR9A 1WTVA 2QW7A 3ITPA 5FKAC 3TBIB 4ZYSA 3CHBD 2UUBL 1G8ZD 1QWYA 1YITA 4HMIA 5LL6X 3DXJC 4V190 1I6HB 2F0NA 1ESRA 5C3WA 1N33L 3NHHA 2A6ED 3K7AH 3GTOB 3OSOA 1O78A 2KUMA 1S5BD 3PMFA 3ND8A 3C2PA 1E1TA 1B53A 2PZUA 2E74C 3KOJA 1NY4A 2CQAA 1UWVA 1RTNA 2K5HA 5KYLA 2E2JH 2L1BA 2JA7G 3HOWB 1PYWD 2NB0A 4R9WA 3S1QB 2WAQG 1HUNA 4HSPA 4NKLA 1I50H 2K05A 3EBEA 1SNCA 5C4XG 1EIFA 4DV1Q 2ICIA 1XMQL 2KEDA 3GTMH 1YHQA 1HNWL 2RKSA 3P20A 4C3IG 4QCLA 1PDQA 3SE0A 2AQ3B 1TWHB 5FOBB 2KHIA 3CQZH 2OXPA 2EVBA 2PZWA 4KJNA 4YWKA 4DR5L 3R8BA 2HDLA 1FVIA 4JI3Q 1LACA 4A3EB 1JJ2A 1KDBA 1WTWA 2Q8TA 1TKWB 4A3DB 1DCZA 3A7LA 4A3BB 1G6ZA 4X6AH 3K81C 4X3UA 4A3IH 1SYGA 5G3LF 2EYFA 1AEXA 4KY5A 3I4OA 1HR0Q 4L6TB 3EA6A 2HT1A 1WCMH 1PV4A 1D1KA 3M3YB 3U4VA 1XTCD 3A5ZB 3G48A 1WTRA 1H9KA 3GTPH 1VMCA 2JA9A 1HFNA 3LX0A 3K5LA 2IHEA 1Y14B 1VS0A 2I0QA 4TKOB 3BJUA 2F0GA 2K75A 3K57A 2YU9H 4AH6A 3W2DA 2JK8A 2JA8B 2WKCA 1B70B 1LABA 5CV8A 4GNXA 1XNRL 4DK0A 3T56B 1HNXQ 3KFUA 3UDIA 1QZGA 4LF9Q 3PUVA 4DV2L 5M5XB 1TS4A 4IURA 4R4TA 1RODA 1KC8C 1SE2A 4B3SL 4N8X1 4N9PA 1HTLD 1SE8A 2K5QA 3MC0B 3GTLB 1J9OA 2Q2HA 1A0IA 4X64Q 1HH2P 1VQNA 1EZ6A 1Y1VB 4IPHA 4CHTB 1IBLQ 3D4DA 3AFPA 1EIGA 4A93B 5COYA 2MHVA 5IWAQ 2Q2TA 4H7BA 1SROA 1STHA 2XN9C 1YNJD 2WB1G 1I4QA 1WVLA 3VYTA 3VR2A 2AWOA 1VQBA 3GTGH 1SJED 4JOIC 5LHY1 1C8CA 2NTTA 1KRSA 4JI5Q 4A3GG 1K83H 1CHQD 3DEPA 2XRSD 3UDFA 4AYBB 5CMDA 5LMNQ 3GTKH 2X69A 2HCCA 3EVQA 3M4QA 1ONLA 2OTLA 3MXNA 2NZHA 4L5QA 3KF6A 3L9AX 5JOBA 1BKBA 1PFNA 1HNZL 4JV5Q 4DPGA 2HDMA 1A8VA 3CCSA 3G71A 1BNZA 1VQIA 1VQEA 1SFOH 1EY7A 4QUFA 3HZXA 1VQ7A 3I8ZA 4DK1A 2EJGC 5GQOA 3S1NB 2N55A 2UXDL 1CUKA 4EGVA 1JJGA 5FLXL 1XJVA 1EQQA 3TZDA 5ELFA 3OIPA 4A3FH 2FFKB 3M4OH 1PZID 4C3HB 3PIP3 1S5DD 1KHIA 4PNYA 4EVOA 4G7HC 1LTAD 1I4XA 3HKZG 5AJ3L 3S2DH 1BCPD 2LXKA 1JOQA 1KD1C 1JT8A 1HNWQ 2RBMA 1E2ZA 1IXRA 4OONA 1QB5D 5TSSA 2R92H 4YHHL 4DR5Q 1V43A 4NP5A 4GS3A 4QY7A 4YY3Q 5JEAH 4WFN3 1NNXA 4DR2L 1HPCA 4DXGA 3S2HH 2YTYA 2MFIA 1I94L 3W5OA 3QO2A 3Q23A 1HHVA 1VQHA 3K5OA 5IP7H 5EKIA 1TWAB 3A55A 2Z6KA 3CXCA 2BA0A 1FD7D 2A73B 1TU2B 1BVSA 2OEOA 4DR3L 1I4PA 2VB2X 2BDOA 3Q8DA 2DY8A 4KJOA 2EPBA 1VQAA 2FXQA 2B2WA 1SE4A 5I4DA 3OOCA 3TS2A 3F2DA 3PV0A 2IJ0A 4A3IG 4DAYB 4BY7B 2DNCA 3A0JA 1EEFD 2PNHA 4MIUA 4XDXA 1I4HA 1JB7A 2L11A 3HS0C 4A3CH 1JC7A 2UXCL 2L0CA 1IL8A 2MNAA 2IWHA 3K5NA 4TVAB 3F2BA 3HOZH 3D6CA 3NXWA 2Y0SG 4HJ9A 4GN5A 5CV7A 2Z4IA 2BE5C 3H91A 2BH8A 4UY8C 3CC4A 2DNEA 3L2PA 4KHPL 4CJ1B 5FO8B 5J22A 1ZYRD 3VA7A 2RHSB 1R4PB 1FGBD 3FKIG 1WI5A 4O2DA 5C3EH 2JA5H 2B8GA 1BXTA 2PQEA 1X3QA 1XMOL 1D1IA 3VYUA 4DR4L 3TSSA 1CKNA 1WOCA 5EBDA 3I4MB 2AUKA 3EIVA 1N36Q 3K80C 4NDXA 1M1KC 4A3JB 1Y8PB 4B3TL 3UE0A 5JEAJ 4A3MB 1G2SA 1TQOA 4JK1C 2MP1A 5FJ8H 4B9XA 4CDFC 2IPKD 1V1PA 1ZEQX 2CH4A 5C4HA 5BN5A 1NE3A 5T1GA 5CR3A 3K59A 1Q8KA 5IOCA 3S1MH 5M5YB 2PW5A 5E7NA 5I6YA 3GD7A 1IW7C 4NMZA 4U673 1KNAA 1I6HH 3SVMA 1WTHA 4IFDH 2EDGA 3E3XA 2O2LD 5D14A 4KMUC 4X66L 2L4NA 3W1GA 4B3RL 3C46A 1X32A 5IYBH 3KJOA 2OCEA 5KIXA 2IX3A 1S5CD 3HOYB 1K73C 1CI3M 3D4RA 2A74C 2NWGA 1KXLA 1WTQA 3HOWH 4MNOA 3T4AC 3CCQA 3R93A 4JCVE 2AWNA 1OTCA 5HY6A 1EU4A 2KBNA 1HZ9A 4YHHQ 1S40A 2UUAQ 1Q46A 4OIJA 1PRTD 1TWHH 4DR2Q 3AEVA 4IUUA 2LMCB 5M3FB 1AP0A 4A3EH 1KABA 3OW7A 5C44B 1I94Q 1PZKD 4NPSA 1B9NA 1FNWA 2B2TC 1QVGA 4A3DH 3TP5A 2NYZD 1DZ1A 1EZ8A 1JE4A 3CMEA 4A3BH 1W6JA 3H0GB 1LT3D 1L1OB 4FXGC 5EKLA 2F0EA 3TZUA 1PTOF 4OELB 1LM0A 3M3YH 2QDLA 2I5HA 5E1FA 3EJIA 2R92G 1SSOA 4DR3Q 1YBYA 3RZOB 1A15A 5JEAG 2EY2A 4XYOA 4X65L 3T1HL 3C3LA 3PO3G 4ALPA 1PTOC 3L0OA 3A8JE 2B39A 1A2TA 1OO9B 2R7ZB 1SNQA 4GLAC 2RVLA 3SDZA 2JA8H 1JJCB 1SYDA 2IX0A 4OEMB 4DGZA 2B29A 3CCUA 3P75A 3OMCA 2VQEL 3PUZA 1HCZA 1OXVA 5IP7G 2PQAB 1VQ9A 2BH2A 1M8AA 4RG1A 5FLXE 5M5XH 1SAPA 4IFDJ 3A54A 4JI7L 4RA8A 3AYHB 2EE1A 4A3LH 1U4MA 4OWWB 1QUQB 3GTLH 2KCTA 1H9MA 4H44C 1Y1VH 3I7FA 4O0AA 1IBML 5IYCH 4LF7L 2Z4HA 4A3KG 2F1MA 3I3CA 4DUYL 4A3CG 2XWJB 4HIMA 1PH9A 3I90A 4CJ2C 4BY1B 3JAML 3HOZG 4KY7A 1IYUA 1D8LA 4B3ML 1DOLA 3CCRA 1K8GA 4GKJQ 1SYEA 2A68C 1CTMA 5C4JB 1E0BA 1N9WA 3P7JA 4K0KL 1XPOA
chains in the Genus database with same CATH topology
5LMUL 1NTGA 1MJEA 3BU2A 3K0XA 2E5LQ 3CCLA 2KHIA 3CQZH 3GTJH 3W1BA 4DR1L 3GTOH 3PUYA 4YWKA 4A76A 4DR5L 2UUCL 4UP8A 1FVIA 4JI3Q 3B6YA 1JJ2A 2QA4A 5IYDG 1PH3A 2R6GA 3S24A 5GADC 1I5FA 1OXUA 1LUZA 3ER0A 3WWVA 1SLJA 2K14A 5AJ3Q 4X6AH 3K81C 4XIGS 4JI4Q 4A3IH 3NELA 3S1QH 1VQLA 3CAMA 4ME3A 2RHQB 1K0RA 4DV6L 4BBSH 5ELNA 4DV7Q 3I4OA 1HR0Q 1EFWA 2R7FA 4AIMA 2HT1A 2R7ZG 1VQ4A 1WCMH 1PV4A 4P72A 1FL0A 3U4VA 3U50C 4LF4Q 2UUAL 4XTCS 4GOPC 3E9HA 4OO1G 4IPDA 1D7QA 3A5ZB 3G48A 1PH5A 3PO3H 3GTPH 4APVA 3PF5A 1E22A 2JA9A 2DGYA 2GVAA 4DV3L 2IHEA 1Y14B 1VS0A 2I0QA 4C3HH 3BJUA 4NXML 5M3MH 4A3FG 2VUMH 1R9TH 1WFQA 2K75A 4JI2L 2EIFA 4HJAA 2R7DA 2YU9H 4AH6A 1BBUA 2VZAA 1KAWA 4HIDA 2NVTH 3PUWA 2JK8A 4JYAL 1B70B 2F4VL 4IJLA 2B63G 1YJ9A 1FGUA 4GNXA 1XNRL 3OTOL 3ICEA 4DR7L 2MO0A 4IOAA 1OXTA 1J6QA 4RMFA 1HNXQ 3KFUA 1DGSA 3GTQH 2NN6G 4GLXA 3OW2A 3UDIA 4IFDG 5BR8L 2VQFQ 1QZGA 4LF9Q 3PUVA 2GN5A 3JC66 4DV2L 2YV5A 4DV0L 4R4TA 1NBWA 5EAYA 2IX1A 1KC8C 4A4IA 1XPUA 1CKOA 4L5TA 4B3SL 2UXBL 4Y7NH 2ASBA 1SE8A 4JI1L 3A5UA 3ULPA 1L0WA 3I4NG 2KENA 4IPGA 2Q2HA 1A0IA 4X64Q 1HH2P 4OX9Q 1VQNA 5JJIA 5HGQA 4KHPL 4BY1G 4IPHA 2HQLA 1IBLQ 2NZOA 3AFPA 4JG2A 3ZJYC 1ASYA 3PF4A 5GAGC 4A3KH 1TWAH 5IWAQ 3PCOB 1I3QH 2Q2TA 2KCMA 2UXCQ 3PGZA 5H1SE 1SROA 1X3EA 4PMWA 2F3IA 3K8AA 3TQYA 2YTXA 2CWPA 4X65Q 2WB1G 4P74A 5LMNW 1PH1A 2AWOA 1VQBA 4YCVA 1EYGA 3GTGH 4JOIC 1B7YB 1KRSA 3S16H 4BXXH 4JI5Q 4A3GG 2VL6A 1C0AA 1K83H 3J7ZC 4A3EG 5IP9H 2Q2UA 4KHPQ 2CWAA 3UDFA 3S15H 3GTKH 4C3IH 5LMNQ 2NVXH 1HZAA 2OQ0A 4HJ7A 2R93H 1HJPA 1N32L 1T9HA 3M4QA 2OTLA 2UU9Q 4A75A 1E1OA 1YJWA 4BY7H 2NZHA 1U0LA 2NVYH 1K3RA 3KF6A 4L5QA 4DK6C 2JEAI 1BKBA 4LUVA 1HNZL 1XMOQ 4DPGA 3HOUG 3A74A 4A93H 4JV5Q 4QQBX 2HIVA 4DR4Q 1A8VA 3CCSA 1EIYB 1PYSB 2L15A 1W2BA 3G71A 2V1CC 3AFQA 1UE7A 4JBJA 3KDFB 1VQIA 1GM5A 1VQEA 1SFOH 2ATWA 3TEHB 2HHHL 1AE2A 4GOPA 1SR3A 4LF8L 4BA2I 1VQ7A 3I2ZA 2ZM6Q 5J3BA 4B3TQ 1VCIA 5GQOA 4OO1I 4H02A 2EXDA 5C44G 3M7NA 2K52A 3CMAA 3TRZA 1VQ6A 3PO2G 4R4OA 3JAMi 2IT1A 3CD6A 2UXDL 4DUZL 1CUKA 1JJGA 1G51A 4GKJL 1XJVA 4MZ9A 4L5SA 2C35B 3H0GG 1IBMQ 1Q1BA 1VQCA 1E7ZA 1EQQA 4NB3A 4OWTB 5M5WH 4JI6Q 4A3FH 1YIJA 2ID0A 3BZKA 1X54A 1YNXA 3M4OH 4P75A 5C3EG 2JA5G 4Y52H 2OTJA 4QIWE 4JI3L 1VQKA 1PYBA 4PZ6A 4DK3C 2Z0SA 3I4MH 4P73A 4NXNQ 3NBHB 1KL9A 1KHIA 3PIPA 4X62Q 4R1JA 5C0XJ 2NN6I 4A3JH 3HKZG 3RN5A 4IFDI 1LTLA 1YHBA 1HR0W 5AJ3L 3S2DH 3STBC 3CCJA 3OYYA 2LXKA 4A3MH 1KD1C 1IL2A 1JT8A 3S1NH 4A3LG 1CSQA 1HNWQ 4K0KQ 2K5NA 4DR6Q 2HIXA 3DLLA 1TWGH 3TREA 4DV7L 1VQ5A 1PFSA 1IXRA 4OONA 3S14H 4YCUA 2R92H 4IJHA 1A63A 5FLMH 4X66Q 4BBRG 4DR1Q 4YHHL 5IE8A 4DR5Q 2UUCQ 2JA6G 1V43A 1UE1A 4B3RQ 4GS3A 4QY7A 4YY3Q 5FJ8G 2WP8J 2ZJPA 3L7ZC 4DR2L 1X56A 2GVBA 3HOXG 4MTNA 5M5YH 2WB1E 1L1OA 3S2HH 1H95A 1W3SA 1MKHA 2MFIA 1YHAA 2YTYA 1Y1WH 1GO3E 2N78A 4LWCA 1I94L 2ZJQA 3W5OA 3PUXA 1UE5A 2AHOB 1UEBA 1EWIA 1TWFH 2LSSA 2CQOA 4GKKQ 4DV6Q 1X65A 4DKAC 1SMXA 1YZ6A 1VQHA 1OXXK 2VY3A 1NMGA 3M4PA 4YCWA 5IP7H 1X9NA 4AYBG 4DV4Q 1N34L 2Z6KA 3CXCA 1XTDA 2BA0A 3RR5A 3MEFA 1PH8A 1AE3A 4LFCQ 2VQFL 4LF9L 1A62A 2JJQA 1J5EQ 3J81j 2OWOA 4JC0A 4EQ5A 1BVSA 5IY0A 4A3GH 3CC2A 3CCVA 4DR3L 3RN2A 2RF4A 4LFBQ 4JI2Q 3HOYH 2ZTDA 1VQMA 3Q8DA 2N49A 5IYBG 1VQAA 2FXQA 4JYAQ 1X3GA 3J81i 2WAQE 2A19A 4LFAQ 2K5VA 2F4VQ 2KHJA 1K9MC 1C7YA 4OX9L 2PQAA 3OTOQ 5C0XI 3HOWG 3HOUH 3F2DA 3PV0A 1RIPA 4LF5L 3S17H 5DLQE 3TS2A 4A3IG 4DAYB 3KJPA 1IBLL 1E24A 1KRTA 3A0JA 2PNHA 1X3FA 3H15A 4HJ5A 1JB7A 4YWMA 5IWAL 4A3CH 4GNXB 2UXCL 1U5KA 2JA7H 2MNAA 4LUOA 1VQGA 5M3FH 3T1YL 1QUQA 4DV5Q 4LF6Q 4TVAB 1X6OA 3J80i 1BBWA 4UPAA 3F2BA 3T1HQ 1PHJA 1M90C 3HOZH 2Y0SG 5C4XH 5C44H 5GROA 3M85A 4GN5A 4HJ9A 3HOVG 1VQPA 3PO2H 2D62A 2BH8A 3HKSA 4UY8C 5M3MG 3CC4A 5K36G 3L2PA 1KQSA 3RNUA 3HKZE 2ALYB 3KLWA 4KLKA 1FJGQ 2VUMG 2JEBI 1KIXA 4L5RC 3H0GH 4JI8Q 5LMNL 3RZDH 1IBKL 4A3DG 2RHSB 4P71A 4GLVB 1MIUA 4A3BG 3H3VI 1L2FA 3FKIG 3E0EA 1WI5A 4O2DA 2VQEQ 2CKZB 5C3EH 2JA5H 4WJ3M 1XMOL 2UXBQ 3CC7A 3PSIA 1Z47A 4DR4L 5IYDH 2OQKA 1HZBA 1Q86C 4UP7A 1CKNA 1WOCA 4FDBA 5C0XG 3EIVA 1N36Q 3K7UC 3RZOH 5JJLA 1C9OA 3UDGA 1ASZA 4JI7Q 1G6PA 3CF5A 3K80C 3LGJA 1SN8A 1TWCH 1M1KC 4YWLA 2JE6I 3HFZB 2ZM6L 4B3TL 3UE0A 2UUBQ 5JEAJ 1XNQL 2AMCB 2A1AA 4IOCA 2R7ZH 1EOVA 1GKHA 4DV1L 1PA6A 1WYDA 4C2MH 1CSPA 1G291 4BBRH 4AQYL 2VNUD 4JI0Q 2MO1A 3TS0A 1N33Q 4JBMA 5FJ8H 4AYBE 2JA8G 2N3SA 1WJJA 1LYLA 4DAMA 4EX5A 3HOXH 1NE3A 2B3GA 3D31A 1PVOA 4LF7Q 4JI6L 4OWXB 2E5LL 1Q8KA 2ZTEA 3MXNB 2NVQH 2AKWB 3RLOA 3S1MH 1B8AA 5E7NA 4DUYQ 3KF6B 1IYJB 3IRBA 4LF8Q 3GD7A 3JAMc 2VS1A 5ELOA 4QJFA 4NXNL 3CP0A 2VW9A 2QEXA 1Q12A 2YYZA 4IO9A 3NEMA 2B63H 1PH6A 3CPFA 1YEZA 4B3MQ 1X55A 2PI2A 1XMQQ 4DNIA 1GVPA 4JI4L 3UDXA 4GOPB 3F2CA 4UP9A 5IP9G 3J7A5 1YJNA 1I6HH 4DR6L 3ULLA 5LMUQ 1JMCA 1HR0L 2R93G 4PG3A 5IT9c 4HIKA 1P16A 2K4KA 5JJKA 4X66L 4LW1A 3W1GA 4LF4L 4BY7G 1Y1VG 1N8RC 4B3RL 1PH2A 3UE1A 4YY3L 3CCEA 3RLNA 5IYBH 4KI0A 3KJOA 2OCEA 4A93G 1K73C 1Q82C 5IYCG 4J15A 2Y0SE 3NENA 3I4NH 1KXLA 3KYHC 2I5LX 3HOWH 4MNOA 1V1QA 3CCMA 4R4CA 1YI2A 4BY1H 3E9IA 3CCQA 3KF8B 1O7IA 2N8NA 3D0FA 4GN3B 3U4ZA 4GKKL 4JCVE 2JQOA 2AWNA 1EUJA 4BA1I 1OTCA 2F52A 4JOIA 3FHWA 5HY6A 1XPRA 1RL2A 2BA1A 1UE6A 5C4JH 2K50A 3GO5A 2KBNA 1VQJA 1HZ9A 4R4IA 1Q1EA 4YHHQ 4LUZA 4DV4L 4POFA 3G4SA 1S40A 1Q46A 1JE5A 1HNXL 2A8VA 1TWHH 4DR2Q 4LFCL 3AEVA 3HOVH 1J5EL 4DV3Q 3S1RH 3CW2C 2DUDA 4NXMQ 2IY5B 4A3EH 1VQDA 2PI2E 2WFWA 1I94Q 4NPSA 1CKMA 2EQSA 1QVGA 2YTVA 3RLFA 4A3DH 4LFBL 3BZCA 1AH9A 3CMEA 3I4MG 2CFMA 4A3BH 4R4QA 3FKIH 1S3OA 1L1OB 4LFAL 3FP9A 4DR7Q 1MJCA 4X64L 4A3JG 1XNRQ 3VDYA 2MQHA 1N34Q 2E2HH 4A3MG 4POGA 1Q7YC 1HZCA 1LM0A 1Q81C 5BR8Q 3M3YH 2I5HA 2D0PA 4BBSG 4DV2Q 2XTIA 1S72A 2ZJRA 4IPCA 4DV0Q 4JBKA 1WCMG 2R92G 3J81c 5FLMG 4DR3Q 4QGUA 1E3PA 3SGIA 1YBYA 4LF6L 3ULJA 4DV5L 1PH7A 5JEAG 4X65L 1VQ8A 4B3SQ 3T1HL 3PO3G 4ALPA 3PIOA 2XGTA 4JI1Q 2D0OA 3L0OA 1EQRA 4JI5L 1VQOA 1Y1WG 3STBD 1FJGL 3GDEA 1V9PA 1P8LA 2E8GA 4LF5Q 4GLAC 2JA8H 4JI8L 1JJCB 4C3JH 3I56A 2UUAQ 1VQFA 2RCNA 2IX0A 1TXYA 1NMFA 3CCUA 2B29A 3U58A 2ES2A 3KDFA 1L1OC 3J80c 2UU9L 2VQEL 3PUZA 1OXVA 1VQ9A 5IP7G 2PQAB 2BH2A 2QGQA 1IZ6A 4TQUS 3H3VH 4RG1A 4JV5L 5M5XH 1XNQQ 3T1YQ 4GN4B 1Z9FA 3G6EA 1GD7A 4WJ4A 3EN2A 2ZTCA 1QVCA 4IFDJ 1N36L 4JI7L 4GNXC 2E2IH 3M9BA 3AYHB 4A3LH 3HOYG 1IBKQ 4OWWB 3AQQA 1QUQB 2Z6KC 3GTLH 2UUBL 1YITA 4KHZA 1N32Q 1YVCA 1OXSC 3CPWA 2KCTA 4QL5A 4JI0L 1Y1VH 3I7FA 1N33L 2JA6H 4O0AA 1K8AC 1HNZQ 3K7AH 4PZ8A 2IHFA 3DM3A 1IBML 2H5XA 5GAHC 5IYCH 1PH4A 1E1TA 4LF7L 4A3KG 3KOJA 1NY4A 1UWVA 4PZ7A 4DUYL 2K5HA 2HHHQ 2CCZA 4A3CG 2E2JH 4HIMA 2Q2IA 1PH9A 2JA7G 4HIOA 1QZHA 3F8TA 5M3FG 2WAQG 1NJIC 1QVFA 5GAEC 4LNQA 1I50H 3ERSX 3EBEA 1CKNB 4OXPA 4X62L 3HOZG 1EIFA 4DV1Q 5C4XG 2I5MX 1D8LA 1SRUA 3F1ZA 5FLXc 4AQYQ 4B3ML 3CCRA 4BXXG 4DUZQ 1XMQL 2UXDQ 2LXJA 3GTMH 4JBWA 1K8GA 4GKJQ 3I55A 4HJ8A 1YHQA 1HNWL 1N9WA 4K0KL 2PMZE 1XPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU L;  1NTG A;  1MJE A;  3BU2 A;  3K0X A;  2E5L Q;  3CCL A;  2KHI A;  3CQZ H;  3GTJ H;  3W1B A;  4DR1 L;  3GTO H;  3PUY A;  4YWK A;  4A76 A;  4DR5 L;  2UUC L;  4UP8 A;  1FVI A;  4JI3 Q;  3B6Y A;  1JJ2 A;  2QA4 A;  5IYD G;  1PH3 A;  2R6G A;  3S24 A;  5GAD C;  1I5F A;  1OXU A;  1LUZ A;  3ER0 A;  3WWV A;  1SLJ A;  2K14 A;  5AJ3 Q;  4X6A H;  3K81 C;  4XIG S;  4JI4 Q;  4A3I H;  3NEL A;  3S1Q H;  1VQL A;  3CAM A;  4ME3 A;  2RHQ B;  1K0R A;  4DV6 L;  4BBS H;  5ELN A;  4DV7 Q;  3I4O A;  1HR0 Q;  1EFW A;  2R7F A;  4AIM A;  2HT1 A;  2R7Z G;  1VQ4 A;  1WCM H;  1PV4 A;  4P72 A;  1FL0 A;  3U4V A;  3U50 C;  4LF4 Q;  2UUA L;  4XTC S;  4GOP C;  3E9H A;  4OO1 G;  4IPD A;  1D7Q A;  3A5Z B;  3G48 A;  1PH5 A;  3PO3 H;  3GTP H;  4APV A;  3PF5 A;  1E22 A;  2JA9 A;  2DGY A;  2GVA A;  4DV3 L;  2IHE A;  1Y14 B;  1VS0 A;  2I0Q A;  4C3H H;  3BJU A;  4NXM L;  5M3M H;  4A3F G;  2VUM H;  1R9T H;  1WFQ A;  2K75 A;  4JI2 L;  2EIF A;  4HJA A;  2R7D A;  2YU9 H;  4AH6 A;  1BBU A;  2VZA A;  1KAW A;  4HID A;  2NVT H;  3PUW A;  2JK8 A;  4JYA L;  1B70 B;  2F4V L;  4IJL A;  2B63 G;  1YJ9 A;  1FGU A;  4GNX A;  1XNR L;  3OTO L;  3ICE A;  4DR7 L;  2MO0 A;  4IOA A;  1OXT A;  1J6Q A;  4RMF A;  1HNX Q;  3KFU A;  1DGS A;  3GTQ H;  2NN6 G;  4GLX A;  3OW2 A;  3UDI A;  4IFD G;  5BR8 L;  2VQF Q;  1QZG A;  4LF9 Q;  3PUV A;  2GN5 A;  3JC6 6;  4DV2 L;  2YV5 A;  4DV0 L;  4R4T A;  1NBW A;  5EAY A;  2IX1 A;  1KC8 C;  4A4I A;  1XPU A;  1CKO A;  4L5T A;  4B3S L;  2UXB L;  4Y7N H;  2ASB A;  1SE8 A;  4JI1 L;  3A5U A;  3ULP A;  1L0W A;  3I4N G;  2KEN A;  4IPG A;  2Q2H A;  1A0I A;  4X64 Q;  1HH2 P;  4OX9 Q;  1VQN A;  5JJI A;  5HGQ A;  4KHP L;  4BY1 G;  4IPH A;  2HQL A;  1IBL Q;  2NZO A;  3AFP A;  4JG2 A;  3ZJY C;  1ASY A;  3PF4 A;  5GAG C;  4A3K H;  1TWA H;  5IWA Q;  3PCO B;  1I3Q H;  2Q2T A;  2KCM A;  2UXC Q;  3PGZ A;  5H1S E;  1SRO A;  1X3E A;  4PMW A;  2F3I A;  3K8A A;  3TQY A;  2YTX A;  2CWP A;  4X65 Q;  2WB1 G;  4P74 A;  5LMN W;  1PH1 A;  2AWO A;  1VQB A;  4YCV A;  1EYG A;  3GTG H;  4JOI C;  1B7Y B;  1KRS A;  3S16 H;  4BXX H;  4JI5 Q;  4A3G G;  2VL6 A;  1C0A A;  1K83 H;  3J7Z C;  4A3E G;  5IP9 H;  2Q2U A;  4KHP Q;  2CWA A;  3UDF A;  3S15 H;  3GTK H;  4C3I H;  5LMN Q;  2NVX H;  1HZA A;  2OQ0 A;  4HJ7 A;  2R93 H;  1HJP A;  1N32 L;  1T9H A;  3M4Q A;  2OTL A;  2UU9 Q;  4A75 A;  1E1O A;  1YJW A;  4BY7 H;  2NZH A;  1U0L A;  2NVY H;  1K3R A;  3KF6 A;  4L5Q A;  4DK6 C;  2JEA I;  1BKB A;  4LUV A;  1HNZ L;  1XMO Q;  4DPG A;  3HOU G;  3A74 A;  4A93 H;  4JV5 Q;  4QQB X;  2HIV A;  4DR4 Q;  1A8V A;  3CCS A;  1EIY B;  1PYS B;  2L15 A;  1W2B A;  3G71 A;  2V1C C;  3AFQ A;  1UE7 A;  4JBJ A;  3KDF B;  1VQI A;  1GM5 A;  1VQE A;  1SFO H;  2ATW A;  3TEH B;  2HHH L;  1AE2 A;  4GOP A;  1SR3 A;  4LF8 L;  4BA2 I;  1VQ7 A;  3I2Z A;  2ZM6 Q;  5J3B A;  4B3T Q;  1VCI A;  5GQO A;  4OO1 I;  4H02 A;  2EXD A;  5C44 G;  3M7N A;  2K52 A;  3CMA A;  3TRZ A;  1VQ6 A;  3PO2 G;  4R4O A;  3JAM i;  2IT1 A;  3CD6 A;  2UXD L;  4DUZ L;  1CUK A;  1JJG A;  1G51 A;  4GKJ L;  1XJV A;  4MZ9 A;  4L5S A;  2C35 B;  3H0G G;  1IBM Q;  1Q1B A;  1VQC A;  1E7Z A;  1EQQ A;  4NB3 A;  4OWT B;  5M5W H;  4JI6 Q;  4A3F H;  1YIJ A;  2ID0 A;  3BZK A;  1X54 A;  1YNX A;  3M4O H;  4P75 A;  5C3E G;  2JA5 G;  4Y52 H;  2OTJ A;  4QIW E;  4JI3 L;  1VQK A;  1PYB A;  4PZ6 A;  4DK3 C;  2Z0S A;  3I4M H;  4P73 A;  4NXN Q;  3NBH B;  1KL9 A;  1KHI A;  3PIP A;  4X62 Q;  4R1J A;  5C0X J;  2NN6 I;  4A3J H;  3HKZ G;  3RN5 A;  4IFD I;  1LTL A;  1YHB A;  1HR0 W;  5AJ3 L;  3S2D H;  3STB C;  3CCJ A;  3OYY A;  2LXK A;  4A3M H;  1KD1 C;  1IL2 A;  1JT8 A;  3S1N H;  4A3L G;  1CSQ A;  1HNW Q;  4K0K Q;  2K5N A;  4DR6 Q;  2HIX A;  3DLL A;  1TWG H;  3TRE A;  4DV7 L;  1VQ5 A;  1PFS A;  1IXR A;  4OON A;  3S14 H;  4YCU A;  2R92 H;  4IJH A;  1A63 A;  5FLM H;  4X66 Q;  4BBR G;  4DR1 Q;  4YHH L;  5IE8 A;  4DR5 Q;  2UUC Q;  2JA6 G;  1V43 A;  1UE1 A;  4B3R Q;  4GS3 A;  4QY7 A;  4YY3 Q;  5FJ8 G;  2WP8 J;  2ZJP A;  3L7Z C;  4DR2 L;  1X56 A;  2GVB A;  3HOX G;  4MTN A;  5M5Y H;  2WB1 E;  1L1O A;  3S2H H;  1H95 A;  1W3S A;  1MKH A;  2MFI A;  1YHA A;  2YTY A;  1Y1W H;  1GO3 E;  2N78 A;  4LWC A;  1I94 L;  2ZJQ A;  3W5O A;  3PUX A;  1UE5 A;  2AHO B;  1UEB A;  1EWI A;  1TWF H;  2LSS A;  2CQO A;  4GKK Q;  4DV6 Q;  1X65 A;  4DKA C;  1SMX A;  1YZ6 A;  1VQH A;  1OXX K;  2VY3 A;  1NMG A;  3M4P A;  4YCW A;  5IP7 H;  1X9N A;  4AYB G;  4DV4 Q;  1N34 L;  2Z6K A;  3CXC A;  1XTD A;  2BA0 A;  3RR5 A;  3MEF A;  1PH8 A;  1AE3 A;  4LFC Q;  2VQF L;  4LF9 L;  1A62 A;  2JJQ A;  1J5E Q;  3J81 j;  2OWO A;  4JC0 A;  4EQ5 A;  1BVS A;  5IY0 A;  4A3G H;  3CC2 A;  3CCV A;  4DR3 L;  3RN2 A;  2RF4 A;  4LFB Q;  4JI2 Q;  3HOY H;  2ZTD A;  1VQM A;  3Q8D A;  2N49 A;  5IYB G;  1VQA A;  2FXQ A;  4JYA Q;  1X3G A;  3J81 i;  2WAQ E;  2A19 A;  4LFA Q;  2K5V A;  2F4V Q;  2KHJ A;  1K9M C;  1C7Y A;  4OX9 L;  2PQA A;  3OTO Q;  5C0X I;  3HOW G;  3HOU H;  3F2D A;  3PV0 A;  1RIP A;  4LF5 L;  3S17 H;  5DLQ E;  3TS2 A;  4A3I G;  4DAY B;  3KJP A;  1IBL L;  1E24 A;  1KRT A;  3A0J A;  2PNH A;  1X3F A;  3H15 A;  4HJ5 A;  1JB7 A;  4YWM A;  5IWA L;  4A3C H;  4GNX B;  2UXC L;  1U5K A;  2JA7 H;  2MNA A;  4LUO A;  1VQG A;  5M3F H;  3T1Y L;  1QUQ A;  4DV5 Q;  4LF6 Q;  4TVA B;  1X6O A;  3J80 i;  1BBW A;  4UPA A;  3F2B A;  3T1H Q;  1PHJ A;  1M90 C;  3HOZ H;  2Y0S G;  5C4X H;  5C44 H;  5GRO A;  3M85 A;  4GN5 A;  4HJ9 A;  3HOV G;  1VQP A;  3PO2 H;  2D62 A;  2BH8 A;  3HKS A;  4UY8 C;  5M3M G;  3CC4 A;  5K36 G;  3L2P A;  1KQS A;  3RNU A;  3HKZ E;  2ALY B;  3KLW A;  4KLK A;  1FJG Q;  2VUM G;  2JEB I;  1KIX A;  4L5R C;  3H0G H;  4JI8 Q;  5LMN L;  3RZD H;  1IBK L;  4A3D G;  2RHS B;  4P71 A;  4GLV B;  1MIU A;  4A3B G;  3H3V I;  1L2F A;  3FKI G;  3E0E A;  1WI5 A;  4O2D A;  2VQE Q;  2CKZ B;  5C3E H;  2JA5 H;  4WJ3 M;  1XMO L;  2UXB Q;  3CC7 A;  3PSI A;  1Z47 A;  4DR4 L;  5IYD H;  2OQK A;  1HZB A;  1Q86 C;  4UP7 A;  1CKN A;  1WOC A;  4FDB A;  5C0X G;  3EIV A;  1N36 Q;  3K7U C;  3RZO H;  5JJL A;  1C9O A;  3UDG A;  1ASZ A;  4JI7 Q;  1G6P A;  3CF5 A;  3K80 C;  3LGJ A;  1SN8 A;  1TWC H;  1M1K C;  4YWL A;  2JE6 I;  3HFZ B;  2ZM6 L;  4B3T L;  3UE0 A;  2UUB Q;  5JEA J;  1XNQ L;  2AMC B;  2A1A A;  4IOC A;  2R7Z H;  1EOV A;  1GKH A;  4DV1 L;  1PA6 A;  1WYD A;  4C2M H;  1CSP A;  1G29 1;  4BBR H;  4AQY L;  2VNU D;  4JI0 Q;  2MO1 A;  3TS0 A;  1N33 Q;  4JBM A;  5FJ8 H;  4AYB E;  2JA8 G;  2N3S A;  1WJJ A;  1LYL A;  4DAM A;  4EX5 A;  3HOX H;  1NE3 A;  2B3G A;  3D31 A;  1PVO A;  4LF7 Q;  4JI6 L;  4OWX B;  2E5L L;  1Q8K A;  2ZTE A;  3MXN B;  2NVQ H;  2AKW B;  3RLO A;  3S1M H;  1B8A A;  5E7N A;  4DUY Q;  3KF6 B;  1IYJ B;  3IRB A;  4LF8 Q;  3GD7 A;  3JAM c;  2VS1 A;  5ELO A;  4QJF A;  4NXN L;  3CP0 A;  2VW9 A;  2QEX A;  1Q12 A;  2YYZ A;  4IO9 A;  3NEM A;  2B63 H;  1PH6 A;  3CPF A;  1YEZ A;  4B3M Q;  1X55 A;  2PI2 A;  1XMQ Q;  4DNI A;  1GVP A;  4JI4 L;  3UDX A;  4GOP B;  3F2C A;  4UP9 A;  5IP9 G;  3J7A 5;  1YJN A;  1I6H H;  4DR6 L;  3ULL A;  5LMU Q;  1JMC A;  1HR0 L;  2R93 G;  4PG3 A;  5IT9 c;  4HIK A;  1P16 A;  2K4K A;  5JJK A;  4X66 L;  4LW1 A;  3W1G A;  4LF4 L;  4BY7 G;  1Y1V G;  1N8R C;  4B3R L;  1PH2 A;  3UE1 A;  4YY3 L;  3CCE A;  3RLN A;  5IYB H;  4KI0 A;  3KJO A;  2OCE A;  4A93 G;  1K73 C;  1Q82 C;  5IYC G;  4J15 A;  2Y0S E;  3NEN A;  3I4N H;  1KXL A;  3KYH C;  2I5L X;  3HOW H;  4MNO A;  1V1Q A;  3CCM A;  4R4C A;  1YI2 A;  4BY1 H;  3E9I A;  3CCQ A;  3KF8 B;  1O7I A;  2N8N A;  3D0F A;  4GN3 B;  3U4Z A;  4GKK L;  4JCV E;  2JQO A;  2AWN A;  1EUJ A;  4BA1 I;  1OTC A;  2F52 A;  4JOI A;  3FHW A;  5HY6 A;  1XPR A;  1RL2 A;  2BA1 A;  1UE6 A;  5C4J H;  2K50 A;  3GO5 A;  2KBN A;  1VQJ A;  1HZ9 A;  4R4I A;  1Q1E A;  4YHH Q;  4LUZ A;  4DV4 L;  4POF A;  3G4S A;  1S40 A;  1Q46 A;  1JE5 A;  1HNX L;  2A8V A;  1TWH H;  4DR2 Q;  4LFC L;  3AEV A;  3HOV H;  1J5E L;  4DV3 Q;  3S1R H;  3CW2 C;  2DUD A;  4NXM Q;  2IY5 B;  4A3E H;  1VQD A;  2PI2 E;  2WFW A;  1I94 Q;  4NPS A;  1CKM A;  2EQS A;  1QVG A;  2YTV A;  3RLF A;  4A3D H;  4LFB L;  3BZC A;  1AH9 A;  3CME A;  3I4M G;  2CFM A;  4A3B H;  4R4Q A;  3FKI H;  1S3O A;  1L1O B;  4LFA L;  3FP9 A;  4DR7 Q;  1MJC A;  4X64 L;  4A3J G;  1XNR Q;  3VDY A;  2MQH A;  1N34 Q;  2E2H H;  4A3M G;  4POG A;  1Q7Y C;  1HZC A;  1LM0 A;  1Q81 C;  5BR8 Q;  3M3Y H;  2I5H A;  2D0P A;  4BBS G;  4DV2 Q;  2XTI A;  1S72 A;  2ZJR A;  4IPC A;  4DV0 Q;  4JBK A;  1WCM G;  2R92 G;  3J81 c;  5FLM G;  4DR3 Q;  4QGU A;  1E3P A;  3SGI A;  1YBY A;  4LF6 L;  3ULJ A;  4DV5 L;  1PH7 A;  5JEA G;  4X65 L;  1VQ8 A;  4B3S Q;  3T1H L;  3PO3 G;  4ALP A;  3PIO A;  2XGT A;  4JI1 Q;  2D0O A;  3L0O A;  1EQR A;  4JI5 L;  1VQO A;  1Y1W G;  3STB D;  1FJG L;  3GDE A;  1V9P A;  1P8L A;  2E8G A;  4LF5 Q;  4GLA C;  2JA8 H;  4JI8 L;  1JJC B;  4C3J H;  3I56 A;  2UUA Q;  1VQF A;  2RCN A;  2IX0 A;  1TXY A;  1NMF A;  3CCU A;  2B29 A;  3U58 A;  2ES2 A;  3KDF A;  1L1O C;  3J80 c;  2UU9 L;  2VQE L;  3PUZ A;  1OXV A;  1VQ9 A;  5IP7 G;  2PQA B;  2BH2 A;  2QGQ A;  1IZ6 A;  4TQU S;  3H3V H;  4RG1 A;  4JV5 L;  5M5X H;  1XNQ Q;  3T1Y Q;  4GN4 B;  1Z9F A;  3G6E A;  1GD7 A;  4WJ4 A;  3EN2 A;  2ZTC A;  1QVC A;  4IFD J;  1N36 L;  4JI7 L;  4GNX C;  2E2I H;  3M9B A;  3AYH B;  4A3L H;  3HOY G;  1IBK Q;  4OWW B;  3AQQ A;  1QUQ B;  2Z6K C;  3GTL H;  2UUB L;  1YIT A;  4KHZ A;  1N32 Q;  1YVC A;  1OXS C;  3CPW A;  2KCT A;  4QL5 A;  4JI0 L;  1Y1V H;  3I7F A;  1N33 L;  2JA6 H;  4O0A A;  1K8A C;  1HNZ Q;  3K7A H;  4PZ8 A;  2IHF A;  3DM3 A;  1IBM L;  2H5X A;  5GAH C;  5IYC H;  1PH4 A;  1E1T A;  4LF7 L;  4A3K G;  3KOJ A;  1NY4 A;  1UWV A;  4PZ7 A;  4DUY L;  2K5H A;  2HHH Q;  2CCZ A;  4A3C G;  2E2J H;  4HIM A;  2Q2I A;  1PH9 A;  2JA7 G;  4HIO A;  1QZH A;  3F8T A;  5M3F G;  2WAQ G;  1NJI C;  1QVF A;  5GAE C;  4LNQ A;  1I50 H;  3ERS X;  3EBE A;  1CKN B;  4OXP A;  4X62 L;  3HOZ G;  1EIF A;  4DV1 Q;  5C4X G;  2I5M X;  1D8L A;  1SRU A;  3F1Z A;  5FLX c;  4AQY Q;  4B3M L;  3CCR A;  4BXX G;  4DUZ Q;  1XMQ L;  2UXD Q;  2LXJ A;  3GTM H;  4JBW A;  1K8G A;  4GKJ Q;  3I55 A;  4HJ8 A;  1YHQ A;  1HNW L;  1N9W A;  4K0K L;  2PMZ E;  1XPO A; 
#chains in the Genus database with same CATH topology
 4CDC C;  1NTG A;  5LMU L;  2ENB A;  3IFT A;  1SND A;  3K0X A;  4UHV A;  1GOZ A;  2L55 A;  3NQT A;  1Z7T A;  3S1R B;  3NK9 A;  1PH3 A;  1BUV T;  1PXU A;  5GAD C;  2V4D A;  3A8K E;  1I5F A;  2MPM A;  3ER0 A;  3WWV A;  1SLJ A;  2K14 A;  3NEL A;  1AFP A;  3CAM A;  4DV7 Q;  2R7F A;  2FMC A;  4JPB W;  4AIM A;  1GJX A;  2IL8 A;  4CKB A;  1FL0 A;  3ND9 A;  1A2U A;  1UEA B;  5DM6 3;  4IPD A;  1F9R A;  1EYC A;  1EY0 A;  1I4G A;  2RA4 A;  2C9O A;  1E22 A;  5ISR A;  2DGY A;  4C3H H;  4NXM L;  3WOE A;  4JI2 L;  2EIF A;  4HJA A;  2R7D A;  4RWS C;  2O4X A;  3NTI A;  1BBU A;  3SK8 A;  1KAW A;  4F88 A;  4HID A;  4OGQ C;  3T53 B;  4C3J B;  5ELE A;  4DR7 L;  1YJ9 A;  2TMP A;  2MO0 A;  3U9O A;  1LTS D;  1J6Q A;  2A6E C;  1RCV D;  1XWE A;  3A7A B;  3GTQ H;  4DAV A;  1AZP A;  5BR8 L;  2VQF Q;  4IFD G;  1L0Y B;  2YV5 A;  4I7A A;  2D5D A;  2IX1 A;  2A6H D;  4FO2 A;  1EQV A;  1LO5 D;  1XXG A;  4R8N A;  4L5T A;  2N88 A;  3FEW X;  5A2Q L;  2ASB A;  1CHP D;  1L0W A;  2B2U C;  2SNM A;  5JJI A;  1PZJ D;  1VMP A;  2SEB D;  3LWE A;  3ZJY C;  3TP6 A;  1ASY A;  5GAG C;  1TWA H;  1RTO A;  2K03 A;  3PGZ A;  1X3E A;  2K33 A;  1JQY D;  3E5S A;  3K8A A;  4X65 Q;  2XWB B;  3H3V C;  1MHW C;  2K1B A;  1EYG A;  4YCV A;  1B7Y B;  4CDE C;  4BXX H;  4CKC A;  3J7Z C;  4A3E G;  2Q2U A;  5ELB A;  1B3A A;  1ENF A;  5CV5 A;  1HZA A;  4HJ7 A;  1HJP A;  1N32 L;  1T9H A;  2RDF A;  4FXK C;  5JPM C;  5I6W A;  4BY7 H;  1K3R A;  2JEA I;  5J39 A;  2AUJ D;  4LUV A;  3HOU G;  2A5H A;  1S5F D;  1KDA A;  1NR4 A;  1ICF B;  2V1C C;  4JBJ A;  1GM5 A;  3TEH B;  2HHH L;  1AE2 A;  2DN8 A;  4LK1 C;  2DY7 A;  4BWG B;  2K52 A;  4BBS B;  1T5E A;  3I4L A;  3PO2 G;  4DUZ L;  1G51 A;  4IZ8 A;  1EY9 A;  1IBM Q;  5E4W C;  4HED A;  3MEH A;  1HA5 A;  1MSG A;  1DYQ A;  4KK7 A;  4OWT B;  1YNX A;  2TSS A;  3KF8 A;  1VQK A;  4PZ6 A;  1SBB B;  5M3M B;  2Z0S A;  3I4M H;  2VUM B;  4P73 A;  4ZK9 B;  4NXN Q;  3NBH B;  1KL9 A;  3PIP A;  3D3R A;  4R1J A;  1QNK A;  2NVT B;  4A3J H;  4IFD I;  1YHB A;  2FIN B;  4RAU C;  2F0K A;  2X6G A;  4A3M H;  1IL2 A;  1CZG A;  4A3L G;  4XXE A;  4K0K Q;  2K5N A;  4DR6 Q;  1TWG H;  3FPP A;  1VQ5 A;  1MBY A;  4IJH A;  3VA5 A;  4CBV A;  5FLM H;  4BBR G;  4IUN A;  2WP8 J;  2FJ2 A;  1STY A;  2E76 C;  1FYC A;  1YNJ C;  3L7Z C;  3HOX G;  5M5Y H;  2WB1 E;  4PV1 C;  5EGT A;  2KJX A;  3D8G A;  1ZXT A;  1Y1W H;  4FF1 A;  2ZJQ A;  4RGN A;  4QF4 A;  3PUX A;  1UE5 A;  1EWI A;  2F0Q A;  1O7Z A;  1TWF H;  2LSS A;  1CA5 A;  5C5L A;  2VY3 A;  3M4P A;  3VR6 A;  3LWU A;  1X9N A;  4AYB G;  1AN8 A;  1I3Q B;  3BYY B;  4C56 C;  1EWH A;  4LFC Q;  1A62 A;  4ZKC B;  3CC2 A;  3X3M A;  1GXD C;  3CCV A;  1STE A;  2JXM B;  2RF4 A;  3D6W A;  4JI2 Q;  4CKE A;  4IAL A;  5HGT A;  3HOY H;  1K8M A;  5CC4 A;  5HUR A;  2XNA C;  4S3S A;  1LTR D;  1X3G A;  3S15 B;  2A19 A;  4C3I B;  4LFA Q;  2KHJ A;  4OX9 L;  5CV6 A;  2R93 B;  5C0X I;  1RIP A;  4NW2 A;  5DLQ E;  3KJP A;  1KLG D;  2ZXR A;  1BCP F;  1E24 A;  1KRT A;  1B4O A;  3I72 A;  1C48 A;  2EYM A;  1FR3 A;  4HJ5 A;  3QG1 A;  1CQV A;  4ZCK A;  1EYA A;  4KN7 C;  3J80 L;  1VQG A;  5M3F H;  3NWT A;  3HRZ C;  1X6O A;  3J80 i;  1BBW A;  1L0X B;  4G7O C;  1PHJ A;  1BDO A;  5C44 H;  2J7Z A;  3M85 A;  3HOV G;  3ONA B;  1LV9 A;  1VQP A;  4C3H G;  5K36 G;  1CZW A;  1FJG Q;  4X3S A;  3HKZ E;  1BCP C;  2ALY B;  3SK5 A;  1B9M A;  4KD3 A;  3H0G H;  4JI8 Q;  4P71 A;  1LT4 D;  3JAM E;  1MIU A;  1I4R A;  3SR1 A;  2CKZ B;  1D5Z C;  5M5W B;  4WJ3 M;  1CFM A;  2F0H A;  5IYD H;  4Q0F A;  3NP8 A;  3M4Y A;  4BS9 A;  3K7U C;  3RZO H;  1SNP A;  1ASZ A;  1G6P A;  5IT9 E;  1SN8 A;  1TWC H;  5G3L D;  2JE6 I;  3SEB A;  3HFZ B;  2ZM6 L;  2UUB Q;  4KD4 A;  1XNQ L;  2A1A A;  4IOC A;  2R7Z H;  3K6O A;  4TRD A;  3SXH A;  1JOO A;  2MO1 A;  3TS0 A;  1N33 Q;  4JBM A;  4IUV A;  3S14 B;  5KNC A;  2MGS A;  3QWN A;  1MI2 A;  2N3S A;  3NBH A;  4RH6 A;  4B08 A;  3NUC A;  2B3G A;  2G5D A;  4JI6 L;  4OWX B;  2E5L L;  1UNS A;  2ZTE A;  3RLO A;  1WTP A;  2O5I C;  1B8A A;  5DM7 3;  3IRB A;  4ABN A;  1STB A;  2Z8L A;  1HUM A;  1NSN S;  3NEM A;  2SDF A;  3CPF A;  2PI2 A;  1XMQ Q;  4DNI A;  1GVP A;  4GOP B;  1T5X D;  3J7A 5;  1YJN A;  2NN6 H;  3N6R A;  2A69 D;  2WB1 B;  2E75 C;  1P16 A;  2K4K A;  2KCN A;  4BY7 G;  5EJW A;  1PH2 A;  1STN A;  3UE1 A;  4A3G B;  1WTO A;  3Q0A A;  5IGD A;  2QF7 A;  3T51 B;  2Y0S E;  3NEN A;  2I5L X;  5IGG A;  1V1Q A;  2VB3 X;  1YI2 A;  4BY1 H;  3E9I A;  3D0F A;  1ZYR C;  3J81 E;  4GN3 B;  4GKK L;  1JWM D;  5A2Q E;  5CV9 A;  1EUJ A;  4H0L C;  1S5E D;  2EYP A;  2F52 A;  3FHW A;  4ZLT F;  1DD2 A;  1XPR A;  1UE6 A;  3QJY A;  5C4J H;  4R4I A;  1HFG A;  1Q1E A;  1TT2 A;  4K5W A;  4DV4 L;  1XPU A;  1JE5 A;  2A8V A;  2AQ1 B;  4ZUI A;  1J5E L;  4G4K A;  4G57 A;  1S4Z A;  1PTO B;  3CW2 C;  2DUD A;  3S1R H;  4WOR A;  4KN4 C;  1MGS A;  1VQD A;  2WFW A;  1ICW A;  1CKM A;  4LFB L;  2YTV A;  3RLF A;  5IGF A;  3AU7 A;  3I4M G;  3S9W A;  3SHL A;  2F0W A;  4DU9 A;  3FP9 A;  1XNR Q;  2K28 A;  4A3J G;  2OT2 A;  2B2Y C;  3BDC A;  2E2H H;  2MQH A;  5D3D A;  1QG7 A;  4A3M G;  2KEE A;  1PFM A;  1Q81 C;  4DV2 Q;  2XTI A;  2CH4 W;  2ZJR A;  1WCM G;  2XVS A;  5FLM G;  2BDN A;  3NSW A;  3PIO 3;  4LF6 L;  2B2V C;  5ELC A;  3ULJ A;  3MXG A;  4DV5 L;  1SYC A;  1PH7 A;  4B3S Q;  1BQQ T;  2SOB A;  5L37 A;  1Y1W G;  3GDE A;  4KY6 A;  1P8L A;  3KK7 A;  4C2M B;  4C3J H;  2EJF C;  1EQT A;  3V96 A;  2RCN A;  1C4Q A;  2ES2 A;  3J80 c;  2QDB A;  2QGQ A;  4RHR A;  5D3I B;  2NVQ B;  4N9T A;  4WJ4 A;  3EN2 A;  3NTK A;  5IGE A;  1PRT F;  1QVC A;  1D2B A;  2KQ3 A;  1I50 B;  1JOR A;  1STG A;  2B63 B;  3HOY G;  2ZT9 C;  3K0Y A;  5E4X A;  1F2M A;  3SK4 A;  2Z6K C;  1J8I A;  1YVC A;  1F77 A;  1OXS C;  3CPW A;  4QL5 A;  4RFB A;  4JI0 L;  5KYI A;  1K8A C;  1HNZ Q;  4PZ8 A;  1PRT C;  3DM3 A;  1ENA A;  1CM9 A;  1Q8I A;  5GAH C;  4F87 A;  3BDL A;  4KKU A;  4TSS A;  4PZ7 A;  3I4N B;  3F8T A;  2LY7 A;  5M3F G;  1F9P A;  2RQX A;  1XNQ Q;  1QVF A;  5GAE C;  4LNQ A;  4OXP A;  3ERS X;  2KEC A;  2I5M X;  1SRU A;  2F0U A;  3F1Z A;  5FLX c;  2UXD Q;  2B2T A;  2L12 A;  2LXJ A;  4HMJ A;  5KND A;  1UUP A;  4HJ8 A;  2H4O A;  3MXP A;  1KDC A;  2PMZ E;  2MUY A;  1H9S B;  3CCL A;  2E5L Q;  3H09 A;  3GTO H;  3W1B A;  1DXM A;  3VR5 A;  3VYR A;  2UUC L;  4UP8 A;  4N8F A;  1LT6 D;  2M9V A;  3B6Y A;  2QA4 A;  5IYD G;  2R6G A;  2P5Z X;  3L3O C;  3S24 A;  1WD1 A;  1LUZ A;  3C1F A;  3FKI B;  5AJ3 Q;  3S1Q H;  1VQL A;  2RHQ B;  5IGC A;  1O7L A;  4DV6 L;  4BBS H;  1IKL A;  5ELN A;  2ZXO A;  2R7Z G;  2OF1 A;  4P72 A;  3U50 C;  4GOP C;  1EL0 A;  1D7Q A;  1PH5 A;  3W3A A;  3PF5 A;  1QJO A;  4DV3 L;  1PFB A;  5M3M H;  4A3F G;  2VUM H;  2Z9H A;  2WII B;  5FO7 B;  3J80 E;  1AZQ A;  1WFQ A;  4DAY A;  4L63 B;  1F2Y A;  4RGM A;  2NVT H;  1STA A;  3PUW A;  4JYA L;  3DMU A;  3CU7 A;  1GHJ A;  4IJL A;  4IOA A;  1K0S A;  3CKI B;  4RMF A;  1JWU D;  2Q8R E;  2NN6 G;  5IOD A;  3OW2 A;  3ERO A;  5C0X H;  4QB4 A;  2GN5 A;  4DV0 L;  4HR7 B;  1EFI D;  5EAY A;  4E6I A;  1DON A;  1CKO A;  2E2I B;  3RUZ A;  5CGK A;  4JI1 L;  3A5U A;  3ULP A;  4IPG A;  1F9S A;  1ET9 A;  2I46 A;  4BY1 G;  2JA6 B;  4ODG A;  2HQL A;  4XQQ A;  2NZO A;  4JG2 A;  4WJW A;  3PF4 A;  4GZY C;  5E3F A;  5KNB A;  2PZT A;  1B3Q A;  1I3Q H;  1X3P A;  3IAY A;  2KCM A;  2UXC Q;  1FNU A;  4PMW A;  3TQY A;  4P74 A;  5LMN W;  3E0J A;  3SK6 A;  1SXT A;  2VL6 A;  1C0A A;  4KHP Q;  1TY0 A;  5IP9 H;  3S15 H;  4C3I H;  4FNF A;  4DF7 A;  2R93 H;  3TME A;  4A75 A;  1E1O A;  1HQM C;  1YJW A;  1U0L A;  5D65 A;  4F7X A;  2DJG C;  5I2Y A;  1XMO Q;  4A93 H;  3GTJ B;  4DR4 Q;  1PYS B;  1W2B A;  3AFQ A;  3DWP A;  1UE7 A;  5CBA E;  4OIK A;  3KDF B;  1RDP D;  2ATW A;  3KLS X;  2CW0 C;  3CRK C;  2RCF A;  4BA2 I;  1UAP A;  1EWC A;  1U4P A;  4B3T Q;  2E2D C;  1I6V C;  3ERQ A;  2PMZ B;  2EXD A;  3M7N A;  3LNN A;  3CMA A;  4R4O A;  3JAM i;  3CD6 A;  1JIC A;  5KRU A;  4L5S A;  4C3J G;  5NUC A;  4IUP A;  1SNM A;  5M5W H;  2IW3 A;  2EJM A;  3PO3 B;  2ID0 A;  3BZK A;  1A3U A;  1K28 A;  2EY1 A;  4JVZ A;  5IT9 L;  5C3E G;  1GUN A;  2JA5 G;  2A6H C;  4JI3 L;  4DK3 C;  1SMY D;  1R9T B;  1GUG A;  4G7Z C;  5C0X J;  2NN6 I;  5FO9 B;  1GUS A;  3NBI A;  1VF5 C;  1LTL A;  4I7Z C;  3STB C;  3CCJ A;  3S1N H;  1CSQ A;  2HIX A;  3DLL A;  1D6E C;  4QUC A;  1PFS A;  3S14 H;  2B2U A;  3EFX D;  1A63 A;  3EQL C;  4X66 Q;  1B50 A;  3MFY A;  4FVM A;  3E6Z X;  5IE8 A;  2UUC Q;  4B3R Q;  5FJ8 G;  3KBX A;  4X3T A;  1X56 A;  5EPK A;  4MTN A;  1L1O A;  4LAA A;  1LLR D;  3MAQ A;  1H95 A;  1W3S A;  1MKH A;  1GO3 E;  2N78 A;  4LWC A;  4Y7N B;  3OPO A;  1NR2 A;  1UEB A;  2DJF C;  3I91 A;  2CQO A;  2F3W A;  4DV6 Q;  2K7V A;  1SMX A;  1YZ6 A;  1NMG A;  3X3N A;  4YCW A;  4A3K B;  1N34 L;  1RKN A;  1BO0 A;  1XTD A;  4Z9C B;  3RR5 A;  3MEF A;  5IIF A;  1AE3 A;  4LF9 L;  3FPU B;  2K5W A;  4A3G H;  4LJZ C;  2LKV A;  4MTK A;  1BCP B;  3RN2 A;  2F4I A;  5C6A A;  3R2I A;  3S16 B;  1VQM A;  3J81 L;  5IYB G;  4JYA Q;  3QOL A;  2WAQ E;  3J81 i;  5DAU A;  2NVX B;  3DUZ A;  5I9P A;  1K9M C;  1C7Y A;  2PQA A;  1DOK A;  3HOW G;  2F3V A;  2NVY B;  1IBL L;  3O13 A;  3WDN A;  3BVZ A;  4EQO A;  1X3F A;  1KTK A;  5AFW A;  4J1M A;  3VYS A;  4YWM A;  5IWA L;  4GNX B;  1U5K A;  2FHT A;  4LUO A;  1QUQ A;  2CHB D;  1PTO H;  4UPA A;  3T1H Q;  1SYF A;  2F0S A;  1RJT A;  2D62 A;  3HKS A;  5M3M G;  2VUM G;  1KQS A;  3RNU A;  2JEB I;  4L5R C;  3DM1 A;  4A3D G;  4M8A A;  5LMN L;  1IBK L;  4IUQ A;  3NWS A;  4A3B G;  1L2F A;  2F0L A;  3HG9 A;  3E0E A;  2VQE Q;  4XQJ A;  1LTG D;  1JR0 D;  3BVG A;  4RHS A;  2OQK A;  1Q86 C;  5C0X G;  3AMU A;  1LTI D;  5JJL A;  3F2U A;  3N52 A;  1Z6H A;  3UDG A;  4JI7 Q;  4ULL A;  2JYO A;  4YWL A;  3Q24 A;  2KVM A;  2EYH A;  1SJH D;  2PPB C;  1EU3 A;  1EOV A;  1GKH A;  2R61 A;  1G29 1;  4C2M H;  4AQY L;  2VNU D;  2M2L A;  2EXZ A;  1YNN D;  4OO1 H;  4AYB E;  3TP8 A;  3NE5 B;  2JA8 G;  2RSO A;  1WJJ A;  4DAM A;  2NTS A;  3D31 A;  1PVO A;  4LF7 Q;  3OMG A;  2WKD A;  3MXN B;  2NVQ H;  2Z6B A;  4DUY Q;  3KF6 B;  1IYJ B;  2HQE A;  5EBC A;  3JAM c;  2VS1 A;  2L9H A;  5ELO A;  3V05 A;  2VW9 A;  2QEX A;  1Q12 A;  3NQI A;  5K5P A;  2O5J C;  2B63 H;  2G9H D;  3FVQ A;  1PH6 A;  1YEZ A;  4B3M Q;  4JI4 L;  4XYQ A;  5IP9 G;  1DJR D;  3R3O A;  4XT3 B;  3GQB A;  1QCB D;  4UAI A;  1JMC A;  5LMU Q;  3QOJ A;  2R93 G;  1TII D;  5IT9 c;  4HIK A;  1G2T A;  4X3K A;  5JJK A;  1GUO A;  3KLS A;  4LW1 A;  4LF4 L;  1Y1V G;  1N8R C;  1M4V A;  4YY3 L;  4KI0 A;  4A93 G;  2JN4 A;  4ZRZ A;  5CBE E;  1Q82 C;  5IYC G;  1EIH A;  2B8F A;  3I4N H;  1HTP A;  3KYH C;  4R4C A;  3DWA A;  1U4L A;  5A35 A;  3HOU B;  3S17 B;  4EQN A;  1XYI A;  4BA1 I;  4JOI A;  1RL2 A;  2BA1 A;  1VQJ A;  1EEI D;  2VXW A;  4DA2 A;  4LUZ A;  4POF A;  3G4S A;  4DNT B;  4HAE A;  3KLR A;  4FYD A;  2JA7 B;  5F2D A;  2WAQ B;  4NXM Q;  4M1U B;  2FMM A;  5JVH 3;  5C4X B;  3Q6S A;  1Y8O B;  2EQS A;  3PO2 B;  1AH9 A;  2I07 B;  1O7Y A;  3BZC A;  1Q90 A;  1MD2 D;  2CFM A;  2F0D A;  4XQN A;  3FKI H;  3QIA A;  2F03 A;  3RZD B;  4DR7 Q;  1MJC A;  5C5M A;  2MJ8 A;  3PQI A;  1N34 Q;  5JPN C;  1Q7Y C;  1HZC A;  2PYK A;  5BR8 Q;  2SNS A;  2AQ2 B;  3DHQ A;  3J81 c;  3BVM A;  3U9S A;  4QGU A;  3SGI A;  2PW7 A;  1LTT D;  1VQ8 A;  3PIO A;  4RKL A;  2XGT A;  1WD0 A;  1E2V A;  1NAP A;  3NPP A;  1CQF A;  4KV6 A;  1VQO A;  5T1I A;  3J7A F;  2E8G A;  2WIN B;  5EPJ A;  2PCF B;  5DNF A;  4BBR B;  1PRT B;  1VQF A;  2A69 C;  1NMF A;  3QB3 A;  2UU9 L;  3HOX B;  5KEE A;  4OHJ A;  4F8M A;  3H3V H;  1VF7 A;  2QEJ C;  4GN4 B;  1Z9F A;  4J8Q A;  5BN3 A;  4ME5 A;  1N36 L;  1TS5 A;  4GNX C;  2E2I H;  2K01 A;  3M9B A;  1HA6 A;  1IBK Q;  3AQQ A;  1ESF A;  2NUC A;  4U68 A;  1KLU D;  4HSV A;  1D5M C;  4KHZ A;  5JVG 3;  2EYO A;  3VR3 A;  1N32 Q;  4PMB A;  2K32 A;  2JA6 H;  5EPL A;  4HN7 A;  2EY5 A;  2C5C A;  2IHF A;  2H5X A;  5JJZ A;  1PH4 A;  3MHB A;  1RD9 D;  3K58 A;  2HHH Q;  2CCZ A;  2Q2I A;  3MXU A;  4HIO A;  1QZH A;  2EZV A;  2F0P A;  1ZKO A;  1NJI C;  1CKN B;  4X62 L;  1DM0 B;  4AQY Q;  1QE6 A;  4FP5 D;  4DUZ Q;  4BXX G;  4JBW A;  5FK9 C;  3I55 A;  3OWE B;  1ET6 A;  4K5V A;  3BU2 A;  1MJE A;  1EYD A;  3HOV B;  3GTJ H;  2B2Y A;  4DR1 L;  3PUY A;  1A3V A;  1TR5 A;  4ZQ3 A;  4A76 A;  4KHV A;  5COR A;  1TVX A;  4RGT A;  1V1P B;  2XSC A;  4RGO S;  1F2Z A;  4IUT A;  4MHE A;  3I70 A;  3J7A V;  1OXU A;  4DXF A;  1B2T A;  4XIG S;  4JI4 Q;  2B2V A;  4ME3 A;  1O80 A;  3G6J B;  1K0R A;  1B44 D;  1RF2 D;  1EFW A;  2ZXP A;  3URY A;  1VQ4 A;  3GTQ B;  2L5T A;  4LF4 Q;  4XT1 B;  2UUA L;  1D5X C;  1QIL A;  5BN4 A;  4XTC S;  3E9H A;  4OO1 G;  4HTH A;  5DEH A;  1FNV A;  3PO3 H;  3MZ5 A;  4APV A;  4J6H A;  2F0O A;  2GVA A;  2KA7 A;  1E2W A;  4KTA A;  1R9T H;  4KKS A;  4C1N K;  1Y8N B;  3FDT A;  1LTB D;  2VZA A;  3IKJ A;  2F0J A;  3OWF A;  2F4V L;  2B63 G;  1FGU A;  3ICE A;  3OTO L;  1OXT A;  3H94 A;  1SYB A;  1DGS A;  4GLX A;  3KBG A;  1HRJ A;  4DNR B;  3JC6 6;  3MVV A;  1K3B C;  4FXD A;  1CK1 A;  4RCO A;  1NBW A;  4K8J A;  4ID6 A;  4A4I A;  3HKZ B;  3GV3 A;  4O42 A;  2UXB L;  4ILW A;  4Y7N H;  3AB9 A;  3ZYY X;  3I4N G;  2KEN A;  4OX9 Q;  4JW0 A;  2Z1C A;  4C1N I;  2F0V A;  1A6X A;  5HGQ A;  1JOK A;  2LS0 1;  2WAC A;  3K7A B;  4A3K H;  1SDF A;  3BS1 A;  2F0F A;  4K8I A;  3PCO B;  3V2T A;  4LMQ D;  1IYV A;  3M7G A;  5H1S E;  2F3I A;  2YTX A;  2CWP A;  2E2J B;  1PH1 A;  1JWS D;  3S16 H;  3OHX C;  3MTS A;  3HEJ A;  2CWA A;  1EY5 A;  2NVX H;  3GTM B;  2OQ0 A;  1II3 A;  2UU9 Q;  3I73 A;  2NVY H;  4K6D A;  4DK6 C;  1U4R A;  4EQP A;  4QQB X;  3CQZ B;  1VDZ A;  3A74 A;  2KOL A;  2HIV A;  3DEO A;  4RCN A;  4ZKB B;  1QNU A;  1EIY B;  2L15 A;  2B2W C;  4V0B A;  1NUC A;  3HGB A;  4GOP A;  1SR3 A;  4OL7 A;  4LF8 L;  3I2Z A;  2ZM6 Q;  5J3B A;  1VCI A;  4A3I B;  4PQX A;  4OO1 I;  4H02 A;  5C44 G;  1A3T A;  4RKB A;  3TRZ A;  1VQ6 A;  2IT1 A;  2CVR A;  1TWG B;  1CA6 A;  4DAP A;  1EY8 A;  1BOS A;  1WCM B;  4GKJ L;  4MZ9 A;  2C35 B;  3H0G G;  1ENC A;  1GUW A;  2F0M A;  1Q1B A;  1TS3 A;  1E7Z A;  1VQC A;  4HCS A;  4NB3 A;  4FF3 A;  4JI6 Q;  2K5D A;  1YIJ A;  3GTP B;  1X54 A;  2Y0S B;  3BZD B;  4P75 A;  4QMG A;  4Y52 H;  2OTJ A;  4QIW E;  3DWQ A;  1PYB A;  2F0I A;  4UDU C;  1Y1W B;  1PLF A;  4X62 Q;  1TWF B;  2BE5 D;  3MWY W;  2YU9 B;  3RN5 A;  2D2C C;  1HR0 W;  3OYY A;  1B1Z A;  1V8Q A;  4YIJ A;  2D9U A;  3TRE A;  4DV7 L;  4YCU A;  4IQZ A;  4CGY B;  4Q5V A;  4DR1 Q;  2JA6 G;  1UE1 A;  2RDH A;  4B9W A;  4CJ0 B;  2ZJP A;  2GVB A;  3QR8 A;  1YHA A;  3IL8 A;  3RD4 A;  2AHO B;  2LFN A;  4GKK Q;  1X65 A;  4DKA C;  3BG3 A;  4ZUJ A;  1HQR D;  5J1Z A;  1OXX K;  1TS2 A;  2EY6 A;  2X6L A;  4DV4 Q;  1SEB D;  1PH8 A;  2VQF L;  2JJQ A;  4H13 C;  1J5E Q;  3J81 j;  2OWO A;  4JC0 A;  4EQ5 A;  3T13 A;  2PNR C;  5IY0 A;  1EY4 A;  1Q3L A;  3GTG B;  1PMR A;  4LFB Q;  5C4Z A;  2ZTD A;  4K5X A;  2NZ1 D;  1IW7 D;  4DFA A;  2N49 A;  3GV6 A;  1K83 B;  1BF4 A;  3GTK B;  1KAA A;  2K5V A;  2F4V Q;  1IKM A;  3TDQ A;  1JCK B;  3OTO Q;  5I9O A;  2K04 A;  3HOU H;  1H9R A;  1Y69 U;  4LF5 L;  3S17 H;  2GA4 B;  5LL6 S;  2QCP X;  3H15 A;  1V1O A;  2PO4 A;  5JAV A;  1CT1 D;  2JA7 H;  1XX8 A;  1SFO B;  4LF6 Q;  3T1Y L;  4DV5 Q;  1SMY C;  2UXB Q;  4DN4 M;  1TWC B;  1M90 C;  5C4X H;  5GRO A;  3FRP B;  4CDD C;  3PO2 H;  3Q22 A;  2J0T D;  4KLK A;  3KLW A;  1KIX A;  2EYL A;  3RZD H;  4GLV B;  3H6M A;  2RSN A;  4K6L A;  3VR4 A;  2HUG A;  3H3V I;  3FMC A;  4WRD A;  3MA2 B;  3P1H A;  2BCO A;  4FF4 A;  4A3F B;  1F2L A;  3CC7 A;  3PSI A;  1Z47 A;  3M4O B;  2ICE C;  3K5M A;  1HZB A;  4UP7 A;  2JSO A;  4FDB A;  3OIQ A;  1C9O A;  4PMC A;  3CF5 A;  3LGJ A;  2EOT A;  1HXY D;  3S2D B;  2AMC B;  1H9S A;  2QKI C;  3R2T A;  4DV1 L;  1PA6 A;  1WYD A;  1CSP A;  2NBF A;  4BBR H;  4JI0 Q;  4MN3 A;  1K8O A;  4FF2 A;  1DOM A;  4QIW B;  2R92 B;  4EX5 A;  3HOX H;  1LYL A;  4O1N A;  1W6K A;  1ILP A;  1ML0 D;  2BOS A;  2AKW B;  2EYJ A;  3S2H B;  4LF8 Q;  1SNO A;  4QJF A;  4NXN L;  3CP0 A;  4ZAI A;  1TY2 A;  2YYZ A;  4P2C B;  4IO9 A;  5M9O A;  1PTO D;  2XRQ D;  5IGB A;  2M00 A;  1X55 A;  2G9D A;  3BYT B;  3UDX A;  3F2C A;  4UP9 A;  3TP7 A;  4K2L A;  5EKK A;  4DR6 L;  3A8I E;  3ULL A;  1HR0 L;  4PG3 A;  2JP1 A;  3A56 A;  2XIW A;  5EQ0 A;  5I2X A;  1H9J A;  1QOH A;  3CCE A;  3RLN A;  2QIL A;  4J15 A;  1BBX C;  3MFG A;  2RDG A;  1WTX A;  3CCM A;  3C1E A;  3KF8 B;  1O7I A;  2N8N A;  3U4Z A;  2JQO A;  2E2H B;  3NTH A;  2F0T A;  2K50 A;  4R8I A;  3GO5 A;  3UI2 A;  1G91 A;  1HNX L;  2KCC A;  1MSH A;  4LFC L;  3HOV H;  4DV3 Q;  1RHP A;  2IY5 B;  3HOZ B;  5K36 H;  2H1E A;  1NCV A;  2PI2 E;  1KNE A;  2KHS A;  2CW0 D;  1F9Q A;  5CYU A;  2R3Z A;  4R4Q A;  1S3O A;  3CRL C;  4LFA L;  3G7L A;  1GHK A;  4L8J A;  4X64 L;  1YNN C;  5KGU A;  3VDY A;  2A68 D;  5C3E B;  2JA5 B;  4POG A;  1U9R A;  3IFD A;  4IN3 A;  4BBS G;  2D0P A;  1EY6 A;  1S72 A;  1AW7 A;  4IPC A;  4DV0 Q;  3T16 A;  4JBK A;  2HD3 A;  1SE3 A;  2WV6 D;  2HCI A;  1E3P A;  1R4Q B;  5C3X A;  1JB3 A;  5CV4 A;  3HP3 A;  1IHZ A;  4K14 A;  5ELD A;  2D0O A;  4JI1 Q;  3RMH A;  1EQR A;  3J7Y W;  4JI5 L;  3TN2 A;  3STB D;  1FJG L;  4I65 A;  1V9P A;  4HCE A;  4LF5 Q;  2K6A A;  4JI8 L;  4K2K A;  3I56 A;  1ILQ A;  3KUP A;  1TXY A;  3U58 A;  3KDF A;  1L1O C;  3WOF A;  4KKT A;  1LT5 D;  3BDO A;  1IZ6 A;  4TQU S;  4JV5 L;  1EOT A;  3T1Y Q;  3S1M B;  2J4X A;  3GP7 A;  2Q8I B;  1GD7 A;  3G6E A;  2ZTC A;  3D4W A;  1GUT A;  1BR9 A;  1WTV A;  2QW7 A;  3ITP A;  5FKA C;  3TBI B;  4ZYS A;  3CHB D;  2UUB L;  1G8Z D;  1QWY A;  1YIT A;  4HMI A;  5LL6 X;  3DXJ C;  4V19 0;  1I6H B;  2F0N A;  1ESR A;  5C3W A;  1N33 L;  3NHH A;  2A6E D;  3K7A H;  3GTO B;  3OSO A;  1O78 A;  2KUM A;  1S5B D;  3PMF A;  3ND8 A;  3C2P A;  1E1T A;  1B53 A;  2PZU A;  2E74 C;  3KOJ A;  1NY4 A;  2CQA A;  1UWV A;  1RTN A;  2K5H A;  5KYL A;  2E2J H;  2L1B A;  2JA7 G;  3HOW B;  1PYW D;  2NB0 A;  4R9W A;  3S1Q B;  2WAQ G;  1HUN A;  4HSP A;  4NKL A;  1I50 H;  2K05 A;  3EBE A;  1SNC A;  5C4X G;  1EIF A;  4DV1 Q;  2ICI A;  1XMQ L;  2KED A;  3GTM H;  1YHQ A;  1HNW L;  2RKS A;  3P20 A;  4C3I G;  4QCL A;  1PDQ A;  3SE0 A;  2AQ3 B;  1TWH B;  5FOB B;  2KHI A;  3CQZ H;  2OXP A;  2EVB A;  2PZW A;  4KJN A;  4YWK A;  4DR5 L;  3R8B A;  2HDL A;  1FVI A;  4JI3 Q;  1LAC A;  4A3E B;  1JJ2 A;  1KDB A;  1WTW A;  2Q8T A;  1TKW B;  4A3D B;  1DCZ A;  3A7L A;  4A3B B;  1G6Z A;  4X6A H;  3K81 C;  4X3U A;  4A3I H;  1SYG A;  5G3L F;  2EYF A;  1AEX A;  4KY5 A;  3I4O A;  1HR0 Q;  4L6T B;  3EA6 A;  2HT1 A;  1WCM H;  1PV4 A;  1D1K A;  3M3Y B;  3U4V A;  1XTC D;  3A5Z B;  3G48 A;  1WTR A;  1H9K A;  3GTP H;  1VMC A;  2JA9 A;  1HFN A;  3LX0 A;  3K5L A;  2IHE A;  1Y14 B;  1VS0 A;  2I0Q A;  4TKO B;  3BJU A;  2F0G A;  2K75 A;  3K57 A;  2YU9 H;  4AH6 A;  3W2D A;  2JK8 A;  2JA8 B;  2WKC A;  1B70 B;  1LAB A;  5CV8 A;  4GNX A;  1XNR L;  4DK0 A;  3T56 B;  1HNX Q;  3KFU A;  3UDI A;  1QZG A;  4LF9 Q;  3PUV A;  4DV2 L;  5M5X B;  1TS4 A;  4IUR A;  4R4T A;  1ROD A;  1KC8 C;  1SE2 A;  4B3S L;  4N8X 1;  4N9P A;  1HTL D;  1SE8 A;  2K5Q A;  3MC0 B;  3GTL B;  1J9O A;  2Q2H A;  1A0I A;  4X64 Q;  1HH2 P;  1VQN A;  1EZ6 A;  1Y1V B;  4IPH A;  4CHT B;  1IBL Q;  3D4D A;  3AFP A;  1EIG A;  4A93 B;  5COY A;  2MHV A;  5IWA Q;  2Q2T A;  4H7B A;  1SRO A;  1STH A;  2XN9 C;  1YNJ D;  2WB1 G;  1I4Q A;  1WVL A;  3VYT A;  3VR2 A;  2AWO A;  1VQB A;  3GTG H;  1SJE D;  4JOI C;  5LHY 1;  1C8C A;  2NTT A;  1KRS A;  4JI5 Q;  4A3G G;  1K83 H;  1CHQ D;  3DEP A;  2XRS D;  3UDF A;  4AYB B;  5CMD A;  5LMN Q;  3GTK H;  2X69 A;  2HCC A;  3EVQ A;  3M4Q A;  1ONL A;  2OTL A;  3MXN A;  2NZH A;  4L5Q A;  3KF6 A;  3L9A X;  5JOB A;  1BKB A;  1PFN A;  1HNZ L;  4JV5 Q;  4DPG A;  2HDM A;  1A8V A;  3CCS A;  3G71 A;  1BNZ A;  1VQI A;  1VQE A;  1SFO H;  1EY7 A;  4QUF A;  3HZX A;  1VQ7 A;  3I8Z A;  4DK1 A;  2EJG C;  5GQO A;  3S1N B;  2N55 A;  2UXD L;  1CUK A;  4EGV A;  1JJG A;  5FLX L;  1XJV A;  1EQQ A;  3TZD A;  5ELF A;  3OIP A;  4A3F H;  2FFK B;  3M4O H;  1PZI D;  4C3H B;  3PIP 3;  1S5D D;  1KHI A;  4PNY A;  4EVO A;  4G7H C;  1LTA D;  1I4X A;  3HKZ G;  5AJ3 L;  3S2D H;  1BCP D;  2LXK A;  1JOQ A;  1KD1 C;  1JT8 A;  1HNW Q;  2RBM A;  1E2Z A;  1IXR A;  4OON A;  1QB5 D;  5TSS A;  2R92 H;  4YHH L;  4DR5 Q;  1V43 A;  4NP5 A;  4GS3 A;  4QY7 A;  4YY3 Q;  5JEA H;  4WFN 3;  1NNX A;  4DR2 L;  1HPC A;  4DXG A;  3S2H H;  2YTY A;  2MFI A;  1I94 L;  3W5O A;  3QO2 A;  3Q23 A;  1HHV A;  1VQH A;  3K5O A;  5IP7 H;  5EKI A;  1TWA B;  3A55 A;  2Z6K A;  3CXC A;  2BA0 A;  1FD7 D;  2A73 B;  1TU2 B;  1BVS A;  2OEO A;  4DR3 L;  1I4P A;  2VB2 X;  2BDO A;  3Q8D A;  2DY8 A;  4KJO A;  2EPB A;  1VQA A;  2FXQ A;  2B2W A;  1SE4 A;  5I4D A;  3OOC A;  3TS2 A;  3F2D A;  3PV0 A;  2IJ0 A;  4A3I G;  4DAY B;  4BY7 B;  2DNC A;  3A0J A;  1EEF D;  2PNH A;  4MIU A;  4XDX A;  1I4H A;  1JB7 A;  2L11 A;  3HS0 C;  4A3C H;  1JC7 A;  2UXC L;  2L0C A;  1IL8 A;  2MNA A;  2IWH A;  3K5N A;  4TVA B;  3F2B A;  3HOZ H;  3D6C A;  3NXW A;  2Y0S G;  4HJ9 A;  4GN5 A;  5CV7 A;  2Z4I A;  2BE5 C;  3H91 A;  2BH8 A;  4UY8 C;  3CC4 A;  2DNE A;  3L2P A;  4KHP L;  4CJ1 B;  5FO8 B;  5J22 A;  1ZYR D;  3VA7 A;  2RHS B;  1R4P B;  1FGB D;  3FKI G;  1WI5 A;  4O2D A;  5C3E H;  2JA5 H;  2B8G A;  1BXT A;  2PQE A;  1X3Q A;  1XMO L;  1D1I A;  3VYU A;  4DR4 L;  3TSS A;  1CKN A;  1WOC A;  5EBD A;  3I4M B;  2AUK A;  3EIV A;  1N36 Q;  3K80 C;  4NDX A;  1M1K C;  4A3J B;  1Y8P B;  4B3T L;  3UE0 A;  5JEA J;  4A3M B;  1G2S A;  1TQO A;  4JK1 C;  2MP1 A;  5FJ8 H;  4B9X A;  4CDF C;  2IPK D;  1V1P A;  1ZEQ X;  2CH4 A;  5C4H A;  5BN5 A;  1NE3 A;  5T1G A;  5CR3 A;  3K59 A;  1Q8K A;  5IOC A;  3S1M H;  5M5Y B;  2PW5 A;  5E7N A;  5I6Y A;  3GD7 A;  1IW7 C;  4NMZ A;  4U67 3;  1KNA A;  1I6H H;  3SVM A;  1WTH A;  4IFD H;  2EDG A;  3E3X A;  2O2L D;  5D14 A;  4KMU C;  4X66 L;  2L4N A;  3W1G A;  4B3R L;  3C46 A;  1X32 A;  5IYB H;  3KJO A;  2OCE A;  5KIX A;  2IX3 A;  1S5C D;  3HOY B;  1K73 C;  1CI3 M;  3D4R A;  2A74 C;  2NWG A;  1KXL A;  1WTQ A;  3HOW H;  4MNO A;  3T4A C;  3CCQ A;  3R93 A;  4JCV E;  2AWN A;  1OTC A;  5HY6 A;  1EU4 A;  2KBN A;  1HZ9 A;  4YHH Q;  1S40 A;  2UUA Q;  1Q46 A;  4OIJ A;  1PRT D;  1TWH H;  4DR2 Q;  3AEV A;  4IUU A;  2LMC B;  5M3F B;  1AP0 A;  4A3E H;  1KAB A;  3OW7 A;  5C44 B;  1I94 Q;  1PZK D;  4NPS A;  1B9N A;  1FNW A;  2B2T C;  1QVG A;  4A3D H;  3TP5 A;  2NYZ D;  1DZ1 A;  1EZ8 A;  1JE4 A;  3CME A;  4A3B H;  1W6J A;  3H0G B;  1LT3 D;  1L1O B;  4FXG C;  5EKL A;  2F0E A;  3TZU A;  1PTO F;  4OEL B;  1LM0 A;  3M3Y H;  2QDL A;  2I5H A;  5E1F A;  3EJI A;  2R92 G;  1SSO A;  4DR3 Q;  1YBY A;  3RZO B;  1A15 A;  5JEA G;  2EY2 A;  4XYO A;  4X65 L;  3T1H L;  3C3L A;  3PO3 G;  4ALP A;  1PTO C;  3L0O A;  3A8J E;  2B39 A;  1A2T A;  1OO9 B;  2R7Z B;  1SNQ A;  4GLA C;  2RVL A;  3SDZ A;  2JA8 H;  1JJC B;  1SYD A;  2IX0 A;  4OEM B;  4DGZ A;  2B29 A;  3CCU A;  3P75 A;  3OMC A;  2VQE L;  3PUZ A;  1HCZ A;  1OXV A;  5IP7 G;  2PQA B;  1VQ9 A;  2BH2 A;  1M8A A;  4RG1 A;  5FLX E;  5M5X H;  1SAP A;  4IFD J;  3A54 A;  4JI7 L;  4RA8 A;  3AYH B;  2EE1 A;  4A3L H;  1U4M A;  4OWW B;  1QUQ B;  3GTL H;  2KCT A;  1H9M A;  4H44 C;  1Y1V H;  3I7F A;  4O0A A;  1IBM L;  5IYC H;  4LF7 L;  2Z4H A;  4A3K G;  2F1M A;  3I3C A;  4DUY L;  4A3C G;  2XWJ B;  4HIM A;  1PH9 A;  3I90 A;  4CJ2 C;  4BY1 B;  3JAM L;  3HOZ G;  4KY7 A;  1IYU A;  1D8L A;  4B3M L;  1DOL A;  3CCR A;  1K8G A;  4GKJ Q;  1SYE A;  2A68 C;  1CTM A;  5C4J B;  1E0B A;  1N9W A;  3P7J A;  4K0K L;  1XPO A; 
#chains in the Genus database with same CATH homology
 5LMU L;  1NTG A;  1MJE A;  3BU2 A;  3K0X A;  2E5L Q;  3CCL A;  2KHI A;  3CQZ H;  3GTJ H;  3W1B A;  4DR1 L;  3GTO H;  3PUY A;  4YWK A;  4A76 A;  4DR5 L;  2UUC L;  4UP8 A;  1FVI A;  4JI3 Q;  3B6Y A;  1JJ2 A;  2QA4 A;  5IYD G;  1PH3 A;  2R6G A;  3S24 A;  5GAD C;  1I5F A;  1OXU A;  1LUZ A;  3ER0 A;  3WWV A;  1SLJ A;  2K14 A;  5AJ3 Q;  4X6A H;  3K81 C;  4XIG S;  4JI4 Q;  4A3I H;  3NEL A;  3S1Q H;  1VQL A;  3CAM A;  4ME3 A;  2RHQ B;  1K0R A;  4DV6 L;  4BBS H;  5ELN A;  4DV7 Q;  3I4O A;  1HR0 Q;  1EFW A;  2R7F A;  4AIM A;  2HT1 A;  2R7Z G;  1VQ4 A;  1WCM H;  1PV4 A;  4P72 A;  1FL0 A;  3U4V A;  3U50 C;  4LF4 Q;  2UUA L;  4XTC S;  4GOP C;  3E9H A;  4OO1 G;  4IPD A;  1D7Q A;  3A5Z B;  3G48 A;  1PH5 A;  3PO3 H;  3GTP H;  4APV A;  3PF5 A;  1E22 A;  2JA9 A;  2DGY A;  2GVA A;  4DV3 L;  2IHE A;  1Y14 B;  1VS0 A;  2I0Q A;  4C3H H;  3BJU A;  4NXM L;  5M3M H;  4A3F G;  2VUM H;  1R9T H;  1WFQ A;  2K75 A;  4JI2 L;  2EIF A;  4HJA A;  2R7D A;  2YU9 H;  4AH6 A;  1BBU A;  2VZA A;  1KAW A;  4HID A;  2NVT H;  3PUW A;  2JK8 A;  4JYA L;  1B70 B;  2F4V L;  4IJL A;  2B63 G;  1YJ9 A;  1FGU A;  4GNX A;  1XNR L;  3OTO L;  3ICE A;  4DR7 L;  2MO0 A;  4IOA A;  1OXT A;  1J6Q A;  4RMF A;  1HNX Q;  3KFU A;  1DGS A;  3GTQ H;  2NN6 G;  4GLX A;  3OW2 A;  3UDI A;  4IFD G;  5BR8 L;  2VQF Q;  1QZG A;  4LF9 Q;  3PUV A;  2GN5 A;  3JC6 6;  4DV2 L;  2YV5 A;  4DV0 L;  4R4T A;  1NBW A;  5EAY A;  2IX1 A;  1KC8 C;  4A4I A;  1XPU A;  1CKO A;  4L5T A;  4B3S L;  2UXB L;  4Y7N H;  2ASB A;  1SE8 A;  4JI1 L;  3A5U A;  3ULP A;  1L0W A;  3I4N G;  2KEN A;  4IPG A;  2Q2H A;  1A0I A;  4X64 Q;  1HH2 P;  4OX9 Q;  1VQN A;  5JJI A;  5HGQ A;  4KHP L;  4BY1 G;  4IPH A;  2HQL A;  1IBL Q;  2NZO A;  3AFP A;  4JG2 A;  3ZJY C;  1ASY A;  3PF4 A;  5GAG C;  4A3K H;  1TWA H;  5IWA Q;  3PCO B;  1I3Q H;  2Q2T A;  2KCM A;  2UXC Q;  3PGZ A;  5H1S E;  1SRO A;  1X3E A;  4PMW A;  2F3I A;  3K8A A;  3TQY A;  2YTX A;  2CWP A;  4X65 Q;  2WB1 G;  4P74 A;  5LMN W;  1PH1 A;  2AWO A;  1VQB A;  4YCV A;  1EYG A;  3GTG H;  4JOI C;  1B7Y B;  1KRS A;  3S16 H;  4BXX H;  4JI5 Q;  4A3G G;  2VL6 A;  1C0A A;  1K83 H;  3J7Z C;  4A3E G;  5IP9 H;  2Q2U A;  4KHP Q;  2CWA A;  3UDF A;  3S15 H;  3GTK H;  4C3I H;  5LMN Q;  2NVX H;  1HZA A;  2OQ0 A;  4HJ7 A;  2R93 H;  1HJP A;  1N32 L;  1T9H A;  3M4Q A;  2OTL A;  2UU9 Q;  4A75 A;  1E1O A;  1YJW A;  4BY7 H;  2NZH A;  1U0L A;  2NVY H;  1K3R A;  3KF6 A;  4L5Q A;  4DK6 C;  2JEA I;  1BKB A;  4LUV A;  1HNZ L;  1XMO Q;  4DPG A;  3HOU G;  3A74 A;  4A93 H;  4JV5 Q;  4QQB X;  2HIV A;  4DR4 Q;  1A8V A;  3CCS A;  1EIY B;  1PYS B;  2L15 A;  1W2B A;  3G71 A;  2V1C C;  3AFQ A;  1UE7 A;  4JBJ A;  3KDF B;  1VQI A;  1GM5 A;  1VQE A;  1SFO H;  2ATW A;  3TEH B;  2HHH L;  1AE2 A;  4GOP A;  1SR3 A;  4LF8 L;  4BA2 I;  1VQ7 A;  3I2Z A;  2ZM6 Q;  5J3B A;  4B3T Q;  1VCI A;  5GQO A;  4OO1 I;  4H02 A;  2EXD A;  5C44 G;  3M7N A;  2K52 A;  3CMA A;  3TRZ A;  1VQ6 A;  3PO2 G;  4R4O A;  3JAM i;  2IT1 A;  3CD6 A;  2UXD L;  4DUZ L;  1CUK A;  1JJG A;  1G51 A;  4GKJ L;  1XJV A;  4MZ9 A;  4L5S A;  2C35 B;  3H0G G;  1IBM Q;  1Q1B A;  1VQC A;  1E7Z A;  1EQQ A;  4NB3 A;  4OWT B;  5M5W H;  4JI6 Q;  4A3F H;  1YIJ A;  2ID0 A;  3BZK A;  1X54 A;  1YNX A;  3M4O H;  4P75 A;  5C3E G;  2JA5 G;  4Y52 H;  2OTJ A;  4QIW E;  4JI3 L;  1VQK A;  1PYB A;  4PZ6 A;  4DK3 C;  2Z0S A;  3I4M H;  4P73 A;  4NXN Q;  3NBH B;  1KL9 A;  1KHI A;  3PIP A;  4X62 Q;  4R1J A;  5C0X J;  2NN6 I;  4A3J H;  3HKZ G;  3RN5 A;  4IFD I;  1LTL A;  1YHB A;  1HR0 W;  5AJ3 L;  3S2D H;  3STB C;  3CCJ A;  3OYY A;  2LXK A;  4A3M H;  1KD1 C;  1IL2 A;  1JT8 A;  3S1N H;  4A3L G;  1CSQ A;  1HNW Q;  4K0K Q;  2K5N A;  4DR6 Q;  2HIX A;  3DLL A;  1TWG H;  3TRE A;  4DV7 L;  1VQ5 A;  1PFS A;  1IXR A;  4OON A;  3S14 H;  4YCU A;  2R92 H;  4IJH A;  1A63 A;  5FLM H;  4X66 Q;  4BBR G;  4DR1 Q;  4YHH L;  5IE8 A;  4DR5 Q;  2UUC Q;  2JA6 G;  1V43 A;  1UE1 A;  4B3R Q;  4GS3 A;  4QY7 A;  4YY3 Q;  5FJ8 G;  2WP8 J;  2ZJP A;  3L7Z C;  4DR2 L;  1X56 A;  2GVB A;  3HOX G;  4MTN A;  5M5Y H;  2WB1 E;  1L1O A;  3S2H H;  1H95 A;  1W3S A;  1MKH A;  2MFI A;  1YHA A;  2YTY A;  1Y1W H;  1GO3 E;  2N78 A;  4LWC A;  1I94 L;  2ZJQ A;  3W5O A;  3PUX A;  1UE5 A;  2AHO B;  1UEB A;  1EWI A;  1TWF H;  2LSS A;  2CQO A;  4GKK Q;  4DV6 Q;  1X65 A;  4DKA C;  1SMX A;  1YZ6 A;  1VQH A;  1OXX K;  2VY3 A;  1NMG A;  3M4P A;  4YCW A;  5IP7 H;  1X9N A;  4AYB G;  4DV4 Q;  1N34 L;  2Z6K A;  3CXC A;  1XTD A;  2BA0 A;  3RR5 A;  3MEF A;  1PH8 A;  1AE3 A;  4LFC Q;  2VQF L;  4LF9 L;  1A62 A;  2JJQ A;  1J5E Q;  3J81 j;  2OWO A;  4JC0 A;  4EQ5 A;  1BVS A;  5IY0 A;  4A3G H;  3CC2 A;  3CCV A;  4DR3 L;  3RN2 A;  2RF4 A;  4LFB Q;  4JI2 Q;  3HOY H;  2ZTD A;  1VQM A;  3Q8D A;  2N49 A;  5IYB G;  1VQA A;  2FXQ A;  4JYA Q;  1X3G A;  3J81 i;  2WAQ E;  2A19 A;  4LFA Q;  2K5V A;  2F4V Q;  2KHJ A;  1K9M C;  1C7Y A;  4OX9 L;  2PQA A;  3OTO Q;  5C0X I;  3HOW G;  3HOU H;  3F2D A;  3PV0 A;  1RIP A;  4LF5 L;  3S17 H;  5DLQ E;  3TS2 A;  4A3I G;  4DAY B;  3KJP A;  1IBL L;  1E24 A;  1KRT A;  3A0J A;  2PNH A;  1X3F A;  3H15 A;  4HJ5 A;  1JB7 A;  4YWM A;  5IWA L;  4A3C H;  4GNX B;  2UXC L;  1U5K A;  2JA7 H;  2MNA A;  4LUO A;  1VQG A;  5M3F H;  3T1Y L;  1QUQ A;  4DV5 Q;  4LF6 Q;  4TVA B;  1X6O A;  3J80 i;  1BBW A;  4UPA A;  3F2B A;  3T1H Q;  1PHJ A;  1M90 C;  3HOZ H;  2Y0S G;  5C4X H;  5C44 H;  5GRO A;  3M85 A;  4GN5 A;  4HJ9 A;  3HOV G;  1VQP A;  3PO2 H;  2D62 A;  2BH8 A;  3HKS A;  4UY8 C;  5M3M G;  3CC4 A;  5K36 G;  3L2P A;  1KQS A;  3RNU A;  3HKZ E;  2ALY B;  3KLW A;  4KLK A;  1FJG Q;  2VUM G;  2JEB I;  1KIX A;  4L5R C;  3H0G H;  4JI8 Q;  5LMN L;  3RZD H;  1IBK L;  4A3D G;  2RHS B;  4P71 A;  4GLV B;  1MIU A;  4A3B G;  3H3V I;  1L2F A;  3FKI G;  3E0E A;  1WI5 A;  4O2D A;  2VQE Q;  2CKZ B;  5C3E H;  2JA5 H;  4WJ3 M;  1XMO L;  2UXB Q;  3CC7 A;  3PSI A;  1Z47 A;  4DR4 L;  5IYD H;  2OQK A;  1HZB A;  1Q86 C;  4UP7 A;  1CKN A;  1WOC A;  4FDB A;  5C0X G;  3EIV A;  1N36 Q;  3K7U C;  3RZO H;  5JJL A;  1C9O A;  3UDG A;  1ASZ A;  4JI7 Q;  1G6P A;  3CF5 A;  3K80 C;  3LGJ A;  1SN8 A;  1TWC H;  1M1K C;  4YWL A;  2JE6 I;  3HFZ B;  2ZM6 L;  4B3T L;  3UE0 A;  2UUB Q;  5JEA J;  1XNQ L;  2AMC B;  2A1A A;  4IOC A;  2R7Z H;  1EOV A;  1GKH A;  4DV1 L;  1PA6 A;  1WYD A;  4C2M H;  1CSP A;  1G29 1;  4BBR H;  4AQY L;  2VNU D;  4JI0 Q;  2MO1 A;  3TS0 A;  1N33 Q;  4JBM A;  5FJ8 H;  4AYB E;  2JA8 G;  2N3S A;  1WJJ A;  1LYL A;  4DAM A;  4EX5 A;  3HOX H;  1NE3 A;  2B3G A;  3D31 A;  1PVO A;  4LF7 Q;  4JI6 L;  4OWX B;  2E5L L;  1Q8K A;  2ZTE A;  3MXN B;  2NVQ H;  2AKW B;  3RLO A;  3S1M H;  1B8A A;  5E7N A;  4DUY Q;  3KF6 B;  1IYJ B;  3IRB A;  4LF8 Q;  3GD7 A;  3JAM c;  2VS1 A;  5ELO A;  4QJF A;  4NXN L;  3CP0 A;  2VW9 A;  2QEX A;  1Q12 A;  2YYZ A;  4IO9 A;  3NEM A;  2B63 H;  1PH6 A;  3CPF A;  1YEZ A;  4B3M Q;  1X55 A;  2PI2 A;  1XMQ Q;  4DNI A;  1GVP A;  4JI4 L;  3UDX A;  4GOP B;  3F2C A;  4UP9 A;  5IP9 G;  3J7A 5;  1YJN A;  1I6H H;  4DR6 L;  3ULL A;  5LMU Q;  1JMC A;  1HR0 L;  2R93 G;  4PG3 A;  5IT9 c;  4HIK A;  1P16 A;  2K4K A;  5JJK A;  4X66 L;  4LW1 A;  3W1G A;  4LF4 L;  4BY7 G;  1Y1V G;  1N8R C;  4B3R L;  1PH2 A;  3UE1 A;  4YY3 L;  3CCE A;  3RLN A;  5IYB H;  4KI0 A;  3KJO A;  2OCE A;  4A93 G;  1K73 C;  1Q82 C;  5IYC G;  4J15 A;  2Y0S E;  3NEN A;  3I4N H;  1KXL A;  3KYH C;  2I5L X;  3HOW H;  4MNO A;  1V1Q A;  3CCM A;  4R4C A;  1YI2 A;  4BY1 H;  3E9I A;  3CCQ A;  3KF8 B;  1O7I A;  2N8N A;  3D0F A;  4GN3 B;  3U4Z A;  4GKK L;  4JCV E;  2JQO A;  2AWN A;  1EUJ A;  4BA1 I;  1OTC A;  2F52 A;  4JOI A;  3FHW A;  5HY6 A;  1XPR A;  1RL2 A;  2BA1 A;  1UE6 A;  5C4J H;  2K50 A;  3GO5 A;  2KBN A;  1VQJ A;  1HZ9 A;  4R4I A;  1Q1E A;  4YHH Q;  4LUZ A;  4DV4 L;  4POF A;  3G4S A;  1S40 A;  1Q46 A;  1JE5 A;  1HNX L;  2A8V A;  1TWH H;  4DR2 Q;  4LFC L;  3AEV A;  3HOV H;  1J5E L;  4DV3 Q;  3S1R H;  3CW2 C;  2DUD A;  4NXM Q;  2IY5 B;  4A3E H;  1VQD A;  2PI2 E;  2WFW A;  1I94 Q;  4NPS A;  1CKM A;  2EQS A;  1QVG A;  2YTV A;  3RLF A;  4A3D H;  4LFB L;  3BZC A;  1AH9 A;  3CME A;  3I4M G;  2CFM A;  4A3B H;  4R4Q A;  3FKI H;  1S3O A;  1L1O B;  4LFA L;  3FP9 A;  4DR7 Q;  1MJC A;  4X64 L;  4A3J G;  1XNR Q;  3VDY A;  2MQH A;  1N34 Q;  2E2H H;  4A3M G;  4POG A;  1Q7Y C;  1HZC A;  1LM0 A;  1Q81 C;  5BR8 Q;  3M3Y H;  2I5H A;  2D0P A;  4BBS G;  4DV2 Q;  2XTI A;  1S72 A;  2ZJR A;  4IPC A;  4DV0 Q;  4JBK A;  1WCM G;  2R92 G;  3J81 c;  5FLM G;  4DR3 Q;  4QGU A;  1E3P A;  3SGI A;  1YBY A;  4LF6 L;  3ULJ A;  4DV5 L;  1PH7 A;  5JEA G;  4X65 L;  1VQ8 A;  4B3S Q;  3T1H L;  3PO3 G;  4ALP A;  3PIO A;  2XGT A;  4JI1 Q;  2D0O A;  3L0O A;  1EQR A;  4JI5 L;  1VQO A;  1Y1W G;  3STB D;  1FJG L;  3GDE A;  1V9P A;  1P8L A;  2E8G A;  4LF5 Q;  4GLA C;  2JA8 H;  4JI8 L;  1JJC B;  4C3J H;  3I56 A;  2UUA Q;  1VQF A;  2RCN A;  2IX0 A;  1TXY A;  1NMF A;  3CCU A;  2B29 A;  3U58 A;  2ES2 A;  3KDF A;  1L1O C;  3J80 c;  2UU9 L;  2VQE L;  3PUZ A;  1OXV A;  1VQ9 A;  5IP7 G;  2PQA B;  2BH2 A;  2QGQ A;  1IZ6 A;  4TQU S;  3H3V H;  4RG1 A;  4JV5 L;  5M5X H;  1XNQ Q;  3T1Y Q;  4GN4 B;  1Z9F A;  3G6E A;  1GD7 A;  4WJ4 A;  3EN2 A;  2ZTC A;  1QVC A;  4IFD J;  1N36 L;  4JI7 L;  4GNX C;  2E2I H;  3M9B A;  3AYH B;  4A3L H;  3HOY G;  1IBK Q;  4OWW B;  3AQQ A;  1QUQ B;  2Z6K C;  3GTL H;  2UUB L;  1YIT A;  4KHZ A;  1N32 Q;  1YVC A;  1OXS C;  3CPW A;  2KCT A;  4QL5 A;  4JI0 L;  1Y1V H;  3I7F A;  1N33 L;  2JA6 H;  4O0A A;  1K8A C;  1HNZ Q;  3K7A H;  4PZ8 A;  2IHF A;  3DM3 A;  1IBM L;  2H5X A;  5GAH C;  5IYC H;  1PH4 A;  1E1T A;  4LF7 L;  4A3K G;  3KOJ A;  1NY4 A;  1UWV A;  4PZ7 A;  4DUY L;  2K5H A;  2HHH Q;  2CCZ A;  4A3C G;  2E2J H;  4HIM A;  2Q2I A;  1PH9 A;  2JA7 G;  4HIO A;  1QZH A;  3F8T A;  5M3F G;  2WAQ G;  1NJI C;  1QVF A;  5GAE C;  4LNQ A;  1I50 H;  3ERS X;  3EBE A;  1CKN B;  4OXP A;  4X62 L;  3HOZ G;  1EIF A;  4DV1 Q;  5C4X G;  2I5M X;  1D8L A;  1SRU A;  3F1Z A;  5FLX c;  4AQY Q;  4B3M L;  3CCR A;  4BXX G;  4DUZ Q;  1XMQ L;  2UXD Q;  2LXJ A;  3GTM H;  4JBW A;  1K8G A;  4GKJ Q;  3I55 A;  4HJ8 A;  1YHQ A;  1HNW L;  1N9W A;  4K0K L;  2PMZ E;  1XPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...