4DNIA

Structure of editosome protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
257
structure length
257
Chain Sequence
TILPQAPQYHLDVAPNAPEEGEVAAHWRCVNHCVMLGVVQNIQEGFVFEDKVLQFTLITDFEGPSPGDPDKDFHTVRVFDSDYSSRVKEQLRDGEWFLVTGRLRMVPQYDGSMRKYYHYPVIQVHPGCGSVLKVKLASGAGHMKSVNSVTLVGVVHDIQSGFVYEDAVTQFTLTTTSIDTTHPTQEVVVEKDHHTIRCFGELFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNKHFYFPYIQVQPPHGQVAVIHGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding, rna binding protein
molecule keywords Fusion protein of RNA-editing complex proteins MP42 and MP18
publication title Explorations of linked editosome domains leading to the discovery of motifs defining conserved pockets in editosome OB-folds.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 47
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dniA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dniA02
1NJIC 1VQKA 1Z9FA 3IRBA 1M1KC 3PIPA 1X56A 2CKZB 2EIFA 4R4QA 1O7IA 1UEBA 5C0XJ 4ALPA 4DR1L 1VQ6A 4JBKA 3I7FA 4C3HH 4JBJA 1QZHA 2D0OA 1XNRL 3KDFA 3NELA 1PFSA 4GOPA 2A8VA 1XNQQ 3TEHB 4JI3Q 3RLFA 1K83H 3KDFB 2WFWA 3JC66 4A3CG 4JYAQ 2N78A 3GDEA 3PSIA 1YVCA 4HJAA 2PNHA 4GOPB 1IZ6A 1L1OC 1VCIA 1GO3E 4YWKA 1YJWA 4JI8L 3J81i 1YHQA 5ELOA 1N32L 3M4QA 1QZGA 1YJ9A 1IYJB 5FLXc 2NZOA 4DUYL 1YJNA 4HJ8A 1EIYB 1Q81C 1K3RA 3PGZA 2R7ZG 4C3JH 3TS2A 4IOCA 4A3GG 4JI6Q 2E2IH 4DR2Q 3OTOQ 2CCZA 1GVPA 1N9WA 2NVYH 4OX9L 3F2BA 2N49A 4BY1G 1I50H 3F1ZA 3GTQH 1VQGA 3HOZH 3ERSX 4JOIA 1OXUA 2NVXH 2OCEA 1YHBA 2Z0SA 1FJGL 1VQEA 3JAMc 4DUZL 3RN2A 1E22A 3G48A 4LFAQ 4A4IA 2AWOA 1E1OA 3CC7A 2CWAA 3CC4A 4IOAA 5JJLA 3OYYA 1U0LA 1MJCA 2EXDA 4A3LG 2IY5B 3I4MH 5IP7G 1PH5A 2UUBQ 2KHJA 3T1YL 4BBRH 1J5EQ 4PZ8A 4UP9A 2FXQA 5M5XH 1HNWL 2K50A 1I5FA 1I3QH 2R7DA 1C7YA 4NXML 4DR4L 4TVAB 1PV4A 4LFBQ 4P72A 2R6GA 4IJLA 4OWXB 3UDGA 5BR8Q 4AYBG 1KAWA 4JI1L 1PHJA 3KFUA 4IO9A 2H5XA 2JA6H 3G4SA 4LF9Q 5C3EH 4QJFA 3CCQA 3DM3A 1PH8A 1MJEA 3BZCA 1Y1WH 4H02A 5FLMH 5IP9G 4KHPQ 1WYDA 4DV7Q 1HNXQ 2E5LQ 4OO1I 1QVGA 4DAMA 4DV0L 3GTGH 2I0QA 3K8AA 4DV1Q 1TWCH 3NEMA 1WJJA 4JI3L 1VQLA 2DUDA 1KRTA 4B3TQ 4JYAL 1KL9A 1LTLA 1S72A 3CCJA 1RL2A 1NE3A 4IFDG 1V9PA 1PYBA 1KD1C 4GKKQ 1I6HH 5IYBH 2PMZE 1VQJA 1E3PA 4A76A 3TQYA 4QGUA 1SN8A 3BU2A 1A8VA 2E2JH 4X62Q 1IBLQ 3I55A 3KF8B 3KJOA 3HOXG 5HY6A 3HOVH 4RG1A 4EX5A 3I4MG 3HKSA 1PH6A 2HQLA 2PI2E 5JEAG 5IYDG 3FKIH 4BBRG 3CCUA 1WOCA 3W1BA 5GAHC 1IBMQ 4JI6L 4A3DG 2VQFL 2K5HA 4DR2L 1KHIA 1QUQA 2JA7H 3OTOL 2B63G 3HFZB 3S14H 3EIVA 1YIJA 1JJCB 1W3SA 1HZAA 1QUQB 2D62A 2AKWB 1Q8KA 4LUVA 2R93G 3A0JA 5M3FH 3S17H 2KBNA 1NBWA 1WI5A 2RCNA 4YY3Q 1J6QA 1G51A 3KJPA 4LFAL 2IHFA 2K14A 4KI0A 1LM0A 4GN5A 2I5MX 3CW2C 1EFWA 2MQHA 4B3SQ 4YWMA 1VQMA 3HKZE 2DGYA 2UUBL 2WB1G 1L1OA 2Q2UA 1OXTA 1J5EL 4L5SA 1X55A 4WJ4A 4A3BG 4DV5Q 5C4JH 4LFBL 2UUAQ 3RLNA 3PCOB 2UXDQ 2RHQB 3GD7A 1ASYA 1Q86C 4LUOA 5BR8L 5IYBG 3G71A 2R7ZH 1NTGA 3K80C 3EBEA 1OXVA 2MO0A 3CCVA 3I2ZA 1LYLA 3UDIA 3HOVG 4LF6Q 3J7ZC 4DV7L 5EAYA 2EQSA 4DR5Q 1HNXL 3E9HA 2E5LL 4BY1H 3FKIG 1VQIA 2JJQA 4DV4Q 1PA6A 2JA7G 4DV1L 4LF4Q 2UXBQ 2K75A 3I4NH 2GN5A 4DR7Q 1TXYA 2L15A 4R4TA 1XMQQ 4JI0Q 5LMUQ 1I94Q 3GTMH 4GKJQ 4TQUS 5M3FG 3CMAA 1CUKA 3J81c 4A3LH 5IP7H 3STBD 1VQNA 1JT8A 1XMOL 2E2HH 1VS0A 1HZCA 2MFIA 4X62L 3E9IA 1IBLL 2MNAA 1PVOA 4QL5A 2ASBA 4QQBX 1P16A 2VUMG 1PH3A 1FL0A 4NPSA 2K5NA 4QY7A 4JG2A 4AIMA 1IBML 2WAQG 4K0KQ 5AJ3Q 2KHIA 1Q82C 1VQ7A 4BXXH 4EQ5A 2VW9A 3A74A 3U58A 3CC2A 1EWIA 3S16H 4L5RC 4DV6Q 4KLKA 5IP9H 1AE2A 3F2DA 1PYSB 2UXCQ 3UDXA 3RN5A 1IL2A 1SLJA 4OO1G 3OW2A 1CSQA 4YCUA 1YNXA 3CCEA 3HKZG 1UE5A 3TREA 1XJVA 1S40A 2VZAA 2Y0SE 2RF4A 2VNUD 1X65A 2KENA 3PUZA 3PIOA 3M4PA 1PH1A 1N36L 2F4VQ 3I4NG 2WP8J 4HJ5A 4DV5L 1OTCA 1V1QA 1X3GA 1X9NA 2JEAI 2R92H 4OWTB 3GTJH 4R4IA 3HOXH 4JI7Q 2UXDL 4GNXC 3SGIA 1Q7YC 4X6AH 5IYDH 2ZJRA 4A3DH 2C35B 2V1CC 1RIPA 4BBSH 4P75A 1NMFA 4DKAC 3S1MH 4LF6L 1N33Q 3T1HQ 1VQOA 2B63H 3J80i 4A93H 2AMCB 4DPGA 1C9OA 2R93H 3W1GA 3S15H 4HJ7A 2HHHQ 2AHOB 3GO5A 2UXBL 1X3EA 3S24A 2QGQA 1PH7A 4GLVB 4BXXG 5LMNQ 3PO3H 1A62A 4DK3C 4DV2Q 1SR3A 4DR7L 4J15A 4ME3A 4JI0L 3D31A 5GROA 2ATWA 1GD7A 3MXNB 5LMUL 2PI2A 3B6YA 1XPRA 4GKJL 1Q1BA 5C4XG 3WWVA 3ULLA 2BH2A 2ZM6Q 2I5HA 2K52A 2YU9H 3GTOH 1BVSA 3CAMA 3F8TA 1L0WA 4LF5Q 1YHAA 5C44G 2I5LX 3UE0A 3S2DH 1K9MC 1XNQL 3AFQA 4A3BH 3M9BA 3ZJYC 1X6OA 5GAGC 3CCMA 1JMCA 1KC8C 4JBWA 4JBMA 4K0KL 1W2BA 4P71A 5AJ3L 3W5OA 2LXKA 1VQ5A 2R92G 4KHZA 1N34Q 2YTXA 4JI5Q 4DV6L 4YWLA 3U50C 3CF5A 4NB3A 3S2HH 4UP8A 1Q1EA 1WCMG 2Z6KC 2Y0SG 2UXCL 1HZ9A 3K0XA 1SROA 4GN3B 1P8LA 2K4KA 5M3MH 4BBSG 1KQSA 4HIOA 2YV5A 1E24A 5FJ8H 4BA2I 1KXLA 1MKHA 3KLWA 4DNIA 1PH4A 4B3MQ 4DR6Q 4A93G 4P73A 1PH9A 3KF6A 3GTKH 3S1QH 3NENA 4L5QA 4RMFA 2F4VL 3PO3G 2BA0A 3KF6B 3VDYA 2HT1A 1OXXK 4FDBA 2OQKA 3H15A 3KOJA 4BY7H 3AFPA 1NMGA 4JI7L 1VQBA 4Y52H 1VQ9A 2OQ0A 1TWGH 1C0AA 4XIGS 2VUMH 1SFOH 2HIVA 2MO1A 4YHHQ 3G6EA 3GTLH 3M4OH 2IX1A 1L1OB 1CSPA 1YI2A 4JI8Q 1A63A 4JV5Q 3LGJA 3UDFA 3ICEA 2GVAA 3L2PA 4C2MH 3T1HL 4LFCQ 5HGQA 1TWHH 1N33L 1LUZA 2JA8G 2NVTH 3L0OA 4X64Q 1GKHA 2OTJA 2HHHL 1U5KA 3S1RH 4IPGA 4UPAA 4XTCS 1PH2A 1JJGA 2Q2IA 2CFMA 2ES2A 4LF9L 4LF8Q 3CD6A 4POFA 3M85A 3K7AH 1QVCA 4YCVA 2JA5H 4KHPL 2K5VA 1HR0Q 2NN6I 3H0GH 2ZTEA 3F2CA 4GS3A 4GLAC 3PUXA 3S1NH 5M3MG 4OWWB 5FJ8G 1AE3A 2B3GA 3CPFA 3U4VA 4B3TL 1VQDA 2LSSA 3STBC 4LNQA 4P74A 1UE1A 3CCLA 4BA1I 4HJ9A 4GKKL 2XGTA 5JJKA 4GNXA 1XPUA 3I4OA 4A3KH 4PZ7A 2ZJPA 4GNXB 1M90C 4PZ6A 4BY7G 1N34L 1GM5A 1OXSC 3A5UA 4JI5L 5GAEC 4YCWA 3HOUH 1HNWQ 3FHWA 2A1AA 2JQOA 4DAYB 3U4ZA 4MZ9A 2VY3A 4GN4B 3RNUA 4B3RQ 2JA9A 3FP9A 1Q12A 1HH2P 2NZHA 1YITA 4A75A 1WFQA 1EQQA 1G6PA 4LF7Q 1YEZA 3RLOA 5C0XI 2VQEQ 4B3ML 4DR6L 4AYBE 1EOVA 5C4XH 1K0RA 1TWAH 1Q46A 2A19A 2YTVA 4LWCA 4YY3L 2UUCQ 5C44H 1V43A 2IX0A 4R4OA 4DV0Q 1IXRA 1AH9A 2JA5G 1D7QA 2QEXA 1BKBA 4B3SL 3PUVA 4IPDA 3H0GG 1Y1VG 4HIDA 3GTPH 5IWAQ 4X66Q 1XTDA 2UU9Q 4YHHL 3K81C 4AQYQ 3PO2H 4A3IG 1JE5A 2VS1A 3HOWG 5IYCG 3NBHB 1K8AC 4UY8C 2ZTCA 3J80c 3RZDH 4O2DA 1QVFA 4JV5L 4LFCL 2UUAL 1A0IA 2RHSB 5J3BA 3PF4A 4A3FH 4X64L 3UE1A 4JI2Q 4GLXA 1WCMH 2Z6KA 4A3KG 3HOYG 5DLQE 3HOUG 3I56A 4LF8L 1UWVA 2JK8A 2VQFQ 2AWNA 4HIKA 1HR0L 1KIXA 3CMEA 4DR5L 3CCSA 4AH6A 2GVBA 1VQFA 3ER0A 3AYHB 2CWPA 4DV4L 1VQAA 1Z47A 4A3MH 2CQOA 2VL6A 4R1JA 3TS0A 4LF4L 3RZOH 1UE6A 1XMQL 1I94L 5JJIA 4L5TA 4R4CA 4APVA 3J81j 4NXNQ 4HIMA 5M5YH 5LMNW 1IBKQ 2ZJQA 3CPWA 1YZ6A 1B7YB 5GQOA 3E0EA 3EN2A 1BBWA 4GOPC 1L2FA 1E7ZA 4A3EH 1DGSA 1CKNA 2WB1E 1BBUA 4PG3A 3JAMi 1SMXA 4DR3Q 1JJ2A 2JA8H 1MIUA 3PO2G 2IHEA 4X65Q 1CKNB 1H95A 2YYZA 2R7FA 4B3RL 5IE8A 3MEFA 3TRZA 1XPOA 1HNZQ 2HIXA 2XTIA 4LF7L 4DV3Q 3D0FA 2VQEL 4A3FG 2ZTDA 5M5WH 1CKOA 4JI4Q 2LXJA 3K7UC 1B70B 1HJPA 1X3FA 2B29A 2JE6I 2NN6G 3CQZH 3Q8DA 4LW1A 2N8NA 2UUCL 3PV0A 2ALYB 2D0PA 2IT1A 3BZKA 3KYHC 4POGA 2F52A 2Q2HA 3H3VI 3M3YH 1NY4A 4X66L 5IWAL 5E7NA 2UU9L 5K36G 2QA4A 1ASZA 2JEBI 4AQYL 3HOZG 4A3MG 4JOIC 4QIWE 4DR1Q 1R9TH 3J7A5 3BJUA 1XMOQ 1JB7A 1EUJA 1XNRQ 4WJ3M 3AQQA 1EQRA 5GADC 1T9HA 1YBYA 3L7ZC 1VQPA 1VQ8A 1EYGA 4JI2L 1UE7A 4A3JH 3CP0A 3PUYA 4PMWA 2Q2TA 2PQAA 3A5ZB 1K8GA 4A3EG 2PQAB 2YTYA 4OONA 1N32Q 4IJHA 3PUWA 4IPCA 4JC0A 5C0XG 4DUYQ 2WAQE 3AEVA 3DLLA 1X54A 1B8AA 1EIFA 4C3IH 2N3SA 1E1TA 4MNOA 1N8RC 2ID0A 2OWOA 5LMNL 4DV2L 1D8LA 1CKMA 2JA6G 4O0AA 5C3EG 2E8GA 1SRUA 4LUZA 4DK6C 1S3OA 4NXNL 5FLMG 3ULPA 1Y1WG 1K73C 2ZM6L 1Y1VH 3RR5A 3PF5A 5IT9c 4OX9Q 4A3CH 4LF5L 4Y7NH 1IBKL 2F3IA 2OTLA 3ULJA 2KCMA 5H1SE 4A3IH 1SE8A 2BH8A 1VQCA 1FGUA 5IYCH 1Y14B 5ELNA 4DUZQ 1N36Q 1HR0W 1FJGQ 3HOWH 4OXPA 4IPHA 4DR3L 1VQ4A 2NVQH 1FVIA 4X65L 4IFDI 4IFDJ 3CXCA 1HNZL 3HOYH 4DV3L 3T1YQ 3CCRA 3M7NA 4A3GH 4JCVE 5IY0A 4NXMQ 4JI4L 1HZBA 4DR4Q 4A3JG 3H3VH 1KRSA 2BA1A 2KCTA 4JI1Q 1G291 1VQHA 5JEAJ 1TWFH 4UP7A 4MTNA
chains in the Genus database with same CATH superfamily
1NJIC 1M1KC 2F0LA 3PIPA 2WKDA 1LTTD 1UEBA 3VYTA 4RKLA 1BQQT 4JBKA 2A68C 3I7FA 1QZHA 1B9NA 5M5YB 1XNRL 3KDFA 3NELA 4GOPA 1WTVA 2RKSA 2PNHA 2EVBA 2G5DA 4JI8L 4FF1A 3M4QA 2M9VA 2E2DC 1YJNA 1QZGA 2NZOA 1EIYB 1K3RA 3PGZA 3MXPA 3TS2A 3E6ZX 3MZ5A 1JOQA 4MN3A 4RGMA 1LTSD 4DNRB 2NVYH 3F2BA 1SMYC 3M3YB 3F1ZA 3FDTA 3ERSX 4JOIA 4IFDH 1YHBA 4DUZL 4LFAQ 1PYWD 5E4XA 4ZUIA 5JJLA 3OYYA 2IY5B 5IP7G 2JP1A 4C3HG 4XQJA 4FP5D 3W3AA 4A3JB 4R8NA 1HNWL 2FXQA 4K6DA 5M5XH 3OOCA 5A2QL 4NXML 4DR4L 1PV4A 1GJXA 1SNCA 4IJLA 4OWXB 3UDGA 4AYBG 3ND8A 1O7LA 1JE4A 4IO9A 1GUNA 2PYKA 2NYZD 3QIAA 5C3EH 3DM3A 3BS1A 1Y1WH 1E0BA 4IUQA 3MTSA 4CJ0B 1HNXQ 4OO1I 4LMQD 1TWCH 1WJJA 3HOWB 5J1ZA 1M8AA 3A8KE 3DWPA 3D8GA 4L6TB 1LTLA 3FEWX 1RL2A 1NE3A 4IURA 1KD1C 5EJWA 1SN8A 4X62Q 3KJOA 5HY6A 1MSGA 3HOVH 4PMCA 4A3GB 4EX5A 3BYYB 4KV6A 2HQLA 5IYDG 4BBRG 5GAHC 4X3KA 2HQEA 5M9OA 2B63G 3HFZB 1TWFB 3EIVA 3R3OA 5JVH3 1YIJA 3S14H 1HZAA 4LUVA 5M3FH 2QCPX 1MGSA 3I8ZA 2RCNA 3TMEA 2A69C 4LFAL 4EQNA 4DXFA 2I5MX 3CW2C 2MQHA 2DNEA 4YWMA 3TP7A 2DGYA 1HFGA 3GV6A 4QMGA 3TDQA 2JXMB 5CC4A 3PIP3 3U9OA 2L11A 2GA4B 4WJ4A 1SJED 2UUAQ 4H13C 3P7JA 5ELDA 2UXDQ 2RHQB 1LT3D 4RHRA 1PRTD 4C3JB 2A6HC 3A54A 3CU7A 1PZID 1TVXA 4DGZA 1U4RA 3E9HA 1HNXL 3M4YA 1K0SA 4DV4Q 1I50B 1PA6A 2JA7G 4LF4Q 2UXBQ 1GXDC 3MC0B 2K75A 3SK5A 2L15A 1C8CA 1I94Q 5KEEA 4X3SA 2AUJD 3CMAA 2E75C 3S9WA 1ONLA 5IP7H 1XMOL 3I4MB 1VS0A 4X62L 1PVOA 1IL8A 4QL5A 4RGNA 1LTGD 1PH3A 1OO9B 4JG2A 2F4IA 5IGDA 4K0KQ 1BXTA 1T5EA 3QR8A 1VDZA 3PQIA 2UXCQ 3RN5A 4TRDA 3OW2A 1LTID 2Z4IA 2WB1B 4LAAA 1S5CD 1DONA 2KENA 2A6ED 1H9JA 3PIOA 1PH1A 2F4VQ 2RDGA 2UXDL 2E2JB 3H6MA 4MIUA 4FF3A 1LACA 5EKIA 5IYDH 3KUPA 2C35B 2V1CC 1CHPD 1NMFA 3S1MH 3T1HQ 2B63H 4I65A 1JWSD 4DPGA 1KLUD 2RVLA 1F2LA 2UXBL 2QDLA 3S17B 3PO3H 4DV2Q 1A63A 4J15A 5J39A 1GD7A 1XPRA 5JAVA 1X3QA 2PI2A 1HTPA 1Q1BA 5C4XG 3WWVA 2EE1A 2CH4A 1JOKA 3GTOH 2O4XA 4J1MA 4QF4A 1TS5A 2EDGA 2I5LX 3S2DH 3KBXA 1XNQL 4FF2A 5E1FA 1WD1A 3ZJYC 5C4JB 3TP8A 3FVQA 2OXPA 1KC8C 4JBMA 4K0KL 1H9SA 1G2SA 4IN3A 2R92G 1BBXC 1LTBD 3LWEA 4F87A 4NB3A 2UXCL 1WCMG 2RA4A 4NKLA 1CT1D 5LL6S 2OF1A 1SROA 4BY1B 5M3MH 3URYA 2EYJA 1KXLA 1ESRA 4DNIA 1PH4A 4B3MQ 2X6GA 4JW0A 3I4LA 3GTMB 1NR2A 2F4VL 2HT1A 1OXXK 4BY7H 2M00A 2E2HB 4Y52H 2L9HA 5I9PA 4YHHQ 2A74C 3M4OH 2J7ZA 2IX1A 3I70A 1YI2A 4HSPA 3LGJA 3T1HL 1QWYA 1TWHH 3L0OA 1PZJD 1F9RA 1U5KA 4C1NI 1STBA 4XTCS 1JJGA 2PCFB 5C4HA 2XVSA 5ISRA 1EIGA 4POFA 4KHPL 4YCVA 3VYUA 1HR0Q 3H0GH 1PFMA 4GS3A 1DOMA 2O5IC 3PUXA 3S1NH 3Q0AA 3LNNA 2Z1CA 5FK9C 4B3TL 1VQDA 4ZQ3A 2F0SA 3N6RA 1KDBA 4CDDC 4L63B 3CCLA 4LK1C 3HOXB 5JJKA 5CV9A 2XNAC 1B50A 1M90C 4DAYA 3HOUH 4A3DB 1ENAA 4BBSB 3U4ZA 3PIO3 4CHTB 1ZYRC 1CA6A 4B3RQ 1D2BA 4A93B 1Q12A 1JR0D 2LMCB 1WFQA 1S5ED 4I7AA 4R8IA 4B3ML 1EOVA 4G4KA 5C4XH 1K0RA 4L8JA 1TWAH 2A19A 4ZYSA 2IX0A 4R4OA 2QF7A 1D7QA 2JA5G 4FXGC 2QEXA 4IPDA 1Y1VG 1XTDA 4YHHL 3K81C 1PTOH 2FFKB 3HP3A 4CJ1B 3K0YA 1II3A 4KJNA 1QVFA 5I6WA 3K59A 2RHSB 4A3FH 2HCIA 4K8JA 5AFWA 1CA5A 3UE1A 5FO8B 1WCMH 2Z6KA 3QOJA 4A3KG 2ENBA 1Y69U 3S2HB 3VR2A 5DLQE 1MSHA 2EY2A 3I56A 2EY1A 3RUZA 1HR0L 1KIXA 4DR5L 2GVBA 1K3BC 2CWPA 5FO9B 1ML0D 3GTKB 4R1JA 3S1QB 1S5DD 1CQFA 3RZOH 1UE6A 4R9WA 2DN8A 4R4CA 3J81j 4NXNQ 4HIMA 1EWHA 3C3LA 3CRLC 3E0EA 4K5XA 1QNUA 1DGSA 2CW0C 4PG3A 3JAMi 4RA8A 3PO2G 4C2MB 2K32A 2YYZA 4B3RL 3T56B 3BVMA 3TRZA 1XWEA 2HIXA 4DV3Q 1H9SB 1K8OA 1CKOA 2CVRA 3BDCA 1B70B 1X3FA 3CQZH 3DM1A 2OT2A 3BZKA 5K36G 2IPKD 3NBIA 2JEBI 3HOZG 2KCCA 4QIWE 1BCPD 2KVMA 4WJ3M 2PW7A 2F0IA 5GADC 1YBYA 3L7ZC 1VQ8A 2QEJC 4PMWA 2PQAA 3A5ZB 2LS01 3QJYA 1K8GA 3KLSX 4A3EG 4OONA 1SYFA 1J9OA 3GP7A 4JK1C 1B8AA 1EIFA 1EY5A 4C3IH 2OWOA 1SYEA 3EFXD 4B9WA 1O7ZA 2JA6G 1ILQA 5EPKA 4FXDA 3O13A 5BN4A 1SRUA 5IT9E 4NXNL 1Y1VH 4OX9Q 5IT9c 4A3CH 3ULJA 5H1SE 2L1BA 1AFPA 1SE8A 2PPBC 1S4ZA 3BYTB 1N36Q 4IPHA 1V8QA 2KEEA 3OHXC 3CXCA 4IFDJ 2BOSA 3AB9A 4DV3L 4M8AA 5EBCA 1O80A 3F2UA 1ENCA 4KD3A 1IYUA 4EQOA 1KRSA 5KIXA 4XT3B 2KCTA 1ET9A 1VQHA 3CCQA 2KA7A 1SNDA 2RDFA 3D4WA 4F8MA 4A3MB 3IRBA 1VQKA 1R4PB 1X56A 2CKZB 2EIFA 1RDPD 2XWJB 3I91A 2LFNA 4RWSC 3J7AF 1VQ6A 4JBJA 3T51B 2D0OA 4JYAQ 3HEJA 4HJAA 1IZ6A 1QB5D 2K33A 1VCIA 3G6JB 3NQTA 5DM63 3J81i 5LHY1 4ZKCB 2BE5D 4RGTA 1YJ9A 1FNVA 5CV7A 3TP6A 3NHHA 5M5WB 2B2UC 2MHVA 3C1FA 2R7ZG 4JI6Q 2E2IH 4DU9A 4UAIA 4OX9L 5K36H 1WTPA 3GTQH 3HOZH 2NVXH 2OCEA 2Z0SA 3X3MA 3G48A 2MUYA 2AWOA 3SK8A 1E1OA 4WORA 3CC7A 2CWAA 1GUOA 2TSSA 4IOAA 1PZKD 1MJCA 3HS0C 5ELEA 2UUBQ 2F0KA 5JEAH 1J5EQ 4PZ8A 3TZUA 2R7DA 2B2TC 4TVAB 4LFBQ 1LTAD 3C46A 2R6GA 2A5HA 5A2QE 1DYQA 2H5XA 3SK6A 1PRTF 3I72A 3H09A 2JA6H 4LF9Q 2XRQD 1WYDA 2SOBA 1AEXA 5DNFA 4DV0L 3GTGH 2I0QA 3K8AA 4A3IB 1VQLA 4JYAL 2DUDA 1KRTA 4CKEA 1SYDA 4IFDG 2Z4HA 4DN4M 2NVQB 4GKKQ 1I6HH 1GOZA 5IYBH 1VQJA 4TKOB 4A76A 1IBLQ 3RD4A 5IGCA 4N8FA 2FINB 3KF8B 4P2CB 5KYLA 3HOYB 1TR5A 1WD0A 3L3OC 3FKIH 3R2IA 3SHLA 3W1BA 4JI6L 1JJCB 1QUQB 2D62A 2AKWB 4CBVA 1SXTA 1NBWA 1WI5A 3VR4A 4YY3Q 1AP0A 2K05A 3N52A 4C3HB 4GN5A 4G7OC 1YNJD 2JYOA 1ICWA 4B3SQ 1V1OA 3HKZE 1K83B 2UUBL 1B2TA 2Q2UA 2JN4A 3NE5B 1J5EL 4J6HA 2E74C 1X55A 1WTHA 4AYBB 3E5SA 4DV5Q 4LFBL 4KHVA 2FMCA 3RLNA 2B2WC 5CR3A 1V1PB 2N88A 3GD7A 4UDUC 4KKTA 4LUOA 4M1UB 2R7ZH 1CHQD 3KK7A 3I2ZA 1LYLA 2F0EA 3UDIA 3HOVG 4LF6Q 3J7ZC 3VR5A 2K5DA 2R61A 1VQIA 2K7VA 3NP8A 5CYUA 1CZGA 3I4NH 2GN5A 4DR7Q 4R4TA 1A3TA 2PZUA 5M3FG 4HMJA 1CUKA 2MFIA 1ZKOA 1IBLL 4HN7A 2MNAA 5EPLA 3V2TA 4BBRB 2VUMG 1I3QB 3SR1A 3WOEA 1FL0A 2B63B 3U9SA 2WAQG 5AJ3Q 2KHIA 1D1KA 4HEDA 3TZDA 2VW9A 1VQ7A 3A74A 5EKKA 3CC2A 5CBEE 3S16H 4KLKA 1AE2A 4U673 1PYSB 3UDXA 1IL2A 2F3WA 1YNXA 3HKZG 2VZAA 1HQRD 2Y0SE 3IFTA 4HTHA 1QE6A 2F0WA 1KDCA 1BO0A 3HRZC 4CDFC 2WP8J 2M2LA 1PTOD 1EFID 2F0FA 4DV5L 1OTCA 1X3GA 4QUFA 1SSOA 5CV5A 3GTJH 2EYPA 4GNXC 3E3XA 3SGIA 4X6AH 3K5MA 3I3CA 2NTTA 4LF6L 1N33Q 1VQOA 2JA7B 3J80i 1HCZA 2AUKA 4J8QA 3VA7A 4HJ7A 3GO5A 1X3EA 2KQ3A 2QGQA 3Q22A 1SR3A 1SMYD 4DR7L 2ATWA 3MXNB 4NDXA 1AZPA 2ZM6Q 4ZUJA 1BVSA 4LF5Q 5C44G 1ICFB 3AFQA 4HR7B 1Y8OB 3M9BA 2IJ0A 1JMCA 1UEAB 4KN7C 1A6XA 1W2BA 5AJ3L 3W5OA 4XQNA 1D5XC 2ZT9C 3U50C 4DAPA 4RHSA 1Q1EA 2DJGC 2Y0SG 2F0OA 2EZVA 2NUCA 3OPOA 1KQSA 1K28A 2YV5A 2F0VA 5FO7B 1PH9A 3NENA 3PO3G 3VDYA 4FDBA 2OQKA 5IGFA 3KOJA 1LLRD 1W6KA 2K04A 1RJTA 4XIGS 2VUMH 4WJWA 3NUCA 4JV5Q 1PRTC 1N33L 3L2PA 5HGQA 2NVTH 1LUZA 3QWNA 3CRKC 2OTJA 2HDLA 3S1RH 1EZ6A 4IPGA 5C4XB 2Q2IA 4ZCKA 1GUSA 4H0LC 4LF8Q 1L0XB 2NB0A 1A15A 2ZTEA 3F2CA 4ZK9B 5M3MG 4OWWB 1D6EC 2B3GA 3CPFA 2PNRC 2LSSA 1UE1A 1STEA 2R92B 4ABNA 2EY6A 1XPUA 3I4OA 3OWFA 4PZ7A 2ZJPA 4GNXB 4BY7G 4PZ6A 1U4PA 1OXSC 4OL7A 4YCWA 4F7XA 4ZRZA 2AQ1B 2D5DA 2VY3A 4MZ9A 3A7LA 2R93B 3S15B 1SE3A 1EQQA 1G6PA 1YEZA 3RLOA 1I4GA 5D65A 2YTVA 2YU9B 5C44H 5JOBA 1IXRA 2A6EC 1GHJA 4HIDA 3H0GG 3GTPH 4FVMA 1SJHD 4XYOA 2ZXPA 4A3BB 4AQYQ 2ICEC 1JE5A 3HOWG 3NBHB 4JV5L 3RZDH 3BDOA 4OIJA 1BCPF 3NK9A 5T1GA 2UUAL 1A0IA 5J3BA 3PMFA 1TS2A 2XSCA 4GLXA 2IL8A 4OGQC 2EJGC 3HOUG 4LF8L 1UWVA 2JK8A 3SE0A 2VQFQ 2AWNA 4HIKA 3T4AC 2O5JC 1YNND 2BDOA 2PMZB 4DV4L 1Z47A 4LF4L 3TS0A 4LJZC 5CMDA 1I94L 4APVA 4HAEA 1HRJA 2O2LD 4HMIA 3R8BA 5D14A 5M5YH 5LMNW 4ILWA 3Q24A 1IBKQ 2ZJQA 3CPWA 1SFOB 2F1MA 5GQOA 2F0UA 5JVG3 3GTLB 4WFN3 4K8IA 2WB1E 1SMXA 1RODA 1PRTB 1CKNB 4X65Q 3T13A 4K2LA 5IE8A 1HNZQ 4A3FG 1EZ8A 3K58A 2NN6G 3K7AB 2JA5B 2JE6I 4LW1A 4C3JG 5KGUA 3IKJA 2IW3A 2IT1A 3MXGA 1TY2A 1NY4A 1PXUA 3M3YH 2DY8A 3MVVA 1ASZA 4AQYL 5JPMC 1C48A 3BJUA 4G7HC 1FNWA 4A3KB 1T9HA 3K5OA 1EYGA 1UE7A 4A3JH 3PUYA 2Q2TA 3OMGA 4IJHA 3PUWA 4IPCA 5C0XG 5IGGA 4DUYQ 3AEVA 1E1TA 4MNOA 1N8RC 1UUPA 2ID0A 1GUTA 4DV2L 2KECA 3E0JA 5BN3A 4LUZA 5FLMG 1SYBA 4H44C 3RR5A 2L12A 1IBKL 3PO2B 2BH8A 1VQCA 1FGUA 1FJGQ 1Y14B 3HOWH 1F9QA 4X65L 1STGA 4RAUC 1JORA 1HNZL 5C5LA 3CCRA 3EJIA 4A3GH 2N55A 2XN9C 1EY7A 3H3VC 1A2TA 4JI1Q 3A8JE 5JEAJ 1TWFH 3HOZB 1Z9FA 2B2YC 1UAPA 4FNFA 1Y8PB 1HUMA 4R4QA 4C3IG 4IUTA 3BVZA 5F2DA 2SNSA 1JC7A 1PFSA 3TEHB 4JI3Q 2WFWA 3JC66 4A3CG 4A3EB 2N78A 4CDCC 1YVCA 4O1NA 1L1OC 1GO3E 2JA8B 3OWEB 4HCSA 4YWKA 3VYRA 1YJWA 4XT1B 1YHQA 5ELOA 1QJOA 5FLXc 4DUYL 1A3VA 3NWSA 1GUGA 2NN6H 2J4XA 4C3JH 3K6OA 2TMPA 3JAML 2CCZA 3GTGB 1N9WA 5I6YA 4BY1G 1I50H 5ELFA 2WKCA 1RCVD 2K1BA 1OXUA 1FJGL 1VQEA 3RN2A 1E22A 4KK7A 1R9TB 5IGEA 2F0TA 1E2WA 3K57A 4BS9A 2Z9HA 3FPPA 2EXDA 3DWAA 4A3LG 3I4MH 1LT4D 1PH5A 5IGBA 5ELCA 1FR3A 1MBYA 5C3WA 4PNYA 2K50A 1I5FA 4YIJA 4P72A 5C0XH 1RTOA 3ZYYX 4IZ8A 5JJZA 5BR8Q 1KAWA 1FNUA 2NTSA 4JI1L 3TP5A 1PHJA 3KFUA 1JB3A 4DFAA 3G4SA 1MJEA 1SYGA 1PH8A 3BZCA 5FLMH 5J22A 4DV7Q 1EYDA 1QVGA 1HTLD 4DAMA 4Y7NB 4K5WA 3NEMA 4JI3L 1BCPC 1S72A 1EY0A 3CCJA 4I7ZC 3V96A 1V9PA 1PYBA 3OMCA 4KKSA 3KF8A 1CFMA 5KRUA 3TQYA 1SE2A 1HXYD 1A8VA 4OIKA 4UHVA 2E2JH 3I55A 3L9AX 2RSNA 3HOXG 4RG1A 1TQOA 1F9PA 4EQPA 1PH6A 3J7YW 1A2UA 1D5ZC 1LV9A 5JEAG 2PI2E 2K6AA 2BDNA 3MA2B 1WOCA 4A3DG 2X6LA 1KHIA 1QUQA 3H91A 1W3SA 2LY7A 1FGBD 4N8X1 1Q8KA 2FJ2A 2OEOA 2XIWA 3A0JA 3S17H 2KBNA 1I6VC 1MHWC 1HUNA 1QILA 1EOTA 2K14A 4IUPA 1LM0A 1Q8IA 1PLFA 1W6JA 1U4MA 1OXTA 2LKVA 1V1PA 1WTOA 5C4JH 1O78A 2V4DA 1PTOF 3PCOB 1SEBD 1FD7D 1BF4A 2NZ1D 1Q86C 2B2UA 5BR8L 5IYBG 3G71A 1CZWA 4KJOA 2HUGA 3FMCA 1I4HA 3EBEA 1OXVA 1TKWB 1JQYD 3QO2A 3D3RA 3H94A 4DV7L 4BY1H 2NVYB 2K28A 3FKIG 2VB2X 3J81L 1MI2A 1PFNA 2K5WA 4FYDA 1TXYA 2H1EA 1XMQQ 3BDLA 5LMUQ 3GTMH 4GKJQ 4A3LH 3MEHA 3STBD 1JT8A 4TSSA 1CQVA 2E2HH 1HZCA 2PQEA 2D9UA 4DNTB 2B2VC 2B2TA 2ASBA 5FLXL 5M5XB 1P16A 4AIMA 5C5MA 1Q82C 4BXXH 2QKIC 1VF7A 4EQ5A 3U58A 4O42A 4G57A 4L5RC 4NP5A 4DV6Q 1G6ZA 4QB4A 5C3EB 1QNKA 3F2DA 1Y1WB 2PZTA 3CKIB 4OO1G 1UE5A 1I4QA 1XJVA 3QG1A 3A7AB 1T5XD 2HDMA 1TWCB 1X65A 2J0TD 1BCPB 3DHQA 1H9RA 3M4PA 1N36L 3I4NG 3V05A 2DY7A 4HJ5A 1F2ZA 1X9NA 2JEAI 4OWTB 3HOXH 4R4IA 3HG9A 1BOSA 3HOVB 3BG3A 1Q7YC 2K5QA 4JPBW 4MHEA 5I9OA 2WIIB 4A3DH 1RIPA 4BBSH 4P75A 1RKNA 4A93H 3S14B 1C9OA 5L37A 3W1GA 3I73A 3IAYA 1PH7A 5M3FB 3MXNA 4K6LA 5LMNQ 1A62A 4DK3C 4DK1A 1STHA 5LMUL 4GKJL 3B6YA 2I5HA 4PV1C 3CAMA 2AQ2B 1L0WA 3DWQA 4XDXA 1L0YB 2Z8LA 1K9MC 3Q23A 2WAQB 1B3QA 2B2WA 4XYQA 3CCMA 2MJ8A 4JBWA 1VF5C 4P71A 3NTHA 3S1RB 2LXKA 2RCFA 1VQ5A 4N9TA 4KHZA 2YTXA 4JI5Q 2KJXA 4DV6L 4YWLA 1XYIA 5HGTA 3S2HH 5DAUA 4UP8A 1IW7D 3TBIB 3LX0A 2EOTA 3BZDB 5FJ8H 4BA2I 1MKHA 2F03A 3KLWA 3SXHA 4DR6Q 2H4OA 3GTKH 3S1QH 1YNJC 4L5QA 3K5LA 3OSOA 4RMFA 2ZXRA 3KF6B 1DD2A 1ET6A 3EA6A 3H15A 3AFPA 1NMGA 2MPMA 2OQ0A 1TWGH 5CV4A 2MO1A 4Q5VA 1R4QB 3D6CA 4CGYB 1CSPA 4JI8Q 3UDFA 1EEID 2GVAA 4C2MH 2Q8IB 1G8ZD 1JCKB 1GKHA 4UPAA 1PMRA 1PH2A 4OO1H 2ES2A 4LF9L 1JWMD 5CORA 1QVCA 1S5BD 5IIFA 5I4DA 4CKBA 1TIID 1KNEA 1AE3A 3U4VA 4LNQA 1TT2A 3DUZA 3TSSA 4GKKL 1EIHA 4GNXA 1LTRD 2F0PA 4HSVA 3ND9A 2C9OA 1XX8A 3A5UA 4JI5L 3KLSA 1Z7TA 4IQZA 5BN5A 5GAEC 1HNWQ 2JQOA 2ICIA 4CJ2C 3NTKA 3S1MB 3SEBA 1E2VA 2JA9A 1NSNS 1BNZA 4A75A 1WVLA 4RGOS 1LT5D 4LF7Q 2VQEQ 4RCOA 3PO3B 2P5ZX 2G9DA 4AYBE 2B8GA 3MWYW 3SVMA 4DR6L 3J7AV 2E76C 3OIQA 4YY3L 3GTOB 4KN4C 1V43A 1RHPA 3NWTA 1AH9A 3J80L 1BKBA 4B3SL 2Q8RE 4ID6A 3S2DB 1X3PA 5IWAQ 2A68D 5KNBA 1PTOC 2UU9Q 3NBHA 4A3IG 1HQMC 1ZEQX 5IYCG 1K8AC 4UY8C 2ZTCA 1B3AA 1U9RA 4JI2Q 2C5CA 4N9PA 2RQXA 2EYOA 3HOYG 4DAVA 1ENFA 3FRPB 5M3MB 3VA5A 3CMEA 3CCSA 3A56A 3ER0A 3AYHB 4A3MH 1IHZA 2CQOA 3ERQA 1BUVT 5JJIA 4L5TA 4BY7B 3D6WA 2QDBA 1HHVA 3WOFA 5A35A 3EN2A 5ELBA 3M4OB 4GOPC 5EPJA 1L2FA 1E7ZA 1CKNA 1BBUA 4DR3Q 1JJ2A 1MIUA 2IHEA 1TWHB 4H7BA 5T1IA 1BDOA 2F0QA 3EROA 4OHJA 4LF7L 1RF2D 2VQEL 2ZTDA 2JSOA 5M5WH 4ZKBB 2EJFC 2LXJA 1HJPA 2B29A 2ZXOA 2N8NA 3H0GB 3PV0A 4KTAA 1H9KA 2ALYB 5D3DA 3S1NB 2Q8TA 1EU4A 1TU2B 4EGVA 3H3VI 5IWAL 2UU9L 2G9HD 2XWBB 4JOIC 2KEDA 4DR1Q 1DM0B 3NSWA 1Q3LA 1XMOQ 3AQQA 1NAPA 1VQPA 3HOUB 4JI2L 2VXWA 1B1ZA 3CP0A 2CHBD 3QB3A 2YTYA 1N32Q 1Z6HA 1WTRA 3SK4A 3DLLA 1TS4A 1X54A 1RTNA 5E3FA 3OIPA 5G3LD 3DMUA 1B53A 1CKMA 1TWAB 1CK1A 2E8GA 2RBMA 3ULPA 4DK6C 1K73C 2ZM6L 2FHTA 2QW7A 2A69D 4LF5L 2F3IA 1BR9A 2OTLA 3AMUA 4CDEC 2KCMA 4A3IH 1PTOB 1HFNA 5IYCH 4FF4A 4Z9CB 4CKCA 4DR3L 1VQ4A 2NVQH 4IFDI 5IOCA 4A3FB 1DXMA 1HA5A 4U68A 3HGBA 1WCMB 3HOYH 3T1YQ 1CM9A 4JCVE 3P1HA 3T16A 4A3JG 1CTMA 2BA1A 2A6HD 4KKUA 1Y8NB 3C2PA 3ONAB 4UP7A 2XRSD 1CI3M 3RZOB 1O7IA 5C0XJ 4ALPA 2BCOA 4DR1L 4C3HH 2NBFA 4K2KA 1STNA 2A8VA 1XNQQ 1F9SA 3RLFA 1K83H 3KDFB 3GDEA 3PSIA 4GOPB 2DJFC 1SBBB 2WV6D 2AQ3B 1N32L 1IYJB 4HJ8A 1JOOA 4Q0FA 1RD9D 1Q81C 3I90A 3CQZB 4IOCA 4QUCA 1KLGD 5EGTA 1UNSA 1YNNC 4A3GG 3ITPA 4DR2Q 2CH4W 3K5NA 4OEMB 3DXJC 1B9MA 1GVPA 3OTOQ 1SNOA 2N49A 1VQGA 3MFGA 3JAME 3JAMc 4A4IA 4ODGA 3CC4A 3QOLA 1U0LA 5CV6A 2KHJA 3T1YL 4BBRH 4UP9A 1C7YA 1I3QH 1PDQA 4K14A 4GZYC 1B44D 5FOBB 4C3IB 4XXEA 2F0DA 4QJFA 1F77A 2VB3X 4H02A 5IP9G 4KHPQ 3FPUB 2WACA 4K5VA 2E5LQ 1Y1VB 4DV1Q 4B3TQ 1XXGA 1AW7A 1KL9A 4X3UA 5D3IB 1K8MA 1DOLA 2PMZE 1E3PA 3DEOA 1I4RA 4QGUA 3BU2A 4KY7A 3R2TA 4OELB 3I4MG 4PMBA 3HKSA 4V0BA 1IBMQ 3CCUA 4EVOA 2VQFL 2K5HA 4DR2L 3VR3A 2JA7H 3OTOL 2B2YA 2MGSA 2R93G 2B39A 1J6QA 1G51A 4RCNA 3KJPA 2IHFA 4KI0A 1WTWA 1EFWA 5I2XA 1VQMA 1B4OA 3G7LA 2PW5A 2WB1G 1L1OA 4NMZA 1D1IA 4L5SA 1LT6D 4A3BG 2I07B 1ASYA 1STYA 2KCNA 2QILA 1NTGA 3P75A 2L4NA 3K80C 3EVQA 2MO0A 1H9MA 3CCVA 1NUCA 2E2IB 3EQLC 5EAYA 2EQSA 4DR5Q 2E5LL 1J8IA 2JJQA 1EQVA 5EBDA 3GTQB 5KYIA 4DV1L 1AZQA 4PQXA 2NVXB 4JI0Q 3NXWA 1SAPA 2PZWA 1VMPA 3J81E 2MP1A 4TQUS 1O7YA 1PFBA 1KABA 3J81c 1VQNA 3E9IA 1GHKA 4QQBX 4XQQA 3T53B 1EY8A 1G91A 4NPSA 2K5NA 4QY7A 1IBML 5FLXE 1ZYRD 1TY0A 4DF7A 1EWIA 3MFYA 2JA6B 3X3NA 2KOLA 5IP9H 4S3SA 1SLJA 1CSQA 4YCUA 4IUVA 3CCEA 2K03A 3TREA 1S40A 2R3ZA 2RF4A 5EQ0A 2VNUD 1XTCD 2EY5A 1QCBD 3PUZA 4IALA 4RH6A 5HURA 3MAQA 2F0MA 1NCVA 1I6HB 1V1QA 2R92H 1IYVA 4JI7Q 4HCEA 1FYCA 2ZJRA 2X69A 3FKIB 4DKAC 1EY9A 4BWGB 2IWHA 4E6IA 4QIWB 2AMCB 2R93H 3S15H 2HHHQ 4DXGA 2AHOB 3S24A 4BXXG 4GLVB 5CV8A 4ME3A 4JI0L 3D31A 5GROA 1DOKA 2L0CA 1ESFA 1DCZA 1SE4A 3ULLA 2BH2A 4DA2A 4V190 2YU9H 2K52A 3F8TA 1TWGB 1YHAA 3UE0A 2D2CC 4A3BH 5E4WC 4QCLA 1I4XA 1X6OA 5GAGC 2CW0D 2R7ZB 2EJMA 1N34Q 1TS3A 5DM73 1C4QA 3CF5A 1Q90A 2WINB 2Z6KC 1HZ9A 3K0XA 4GN3B 3RMHA 1P8LA 2K4KA 2EXZA 5C4ZA 4BBSG 4HIOA 2L5TA 4C56C 1E24A 2F3VA 3OW7A 5DEHA 4A93G 3I4NB 4P73A 3KF6A 2EYMA 2BA0A 3Q6SA 1EYCA 1EY6A 2DNCA 2B2VA 2F0NA 5NUCA 1VQBA 4JI7L 1VQ9A 3SDZA 1C0AA 1SFOH 2HIVA 2F0HA 1IKMA 3G6EA 2B8FA 3GTLH 4KY6A 3WDNA 1L1OB 1A3UA 1LABA 3ICEA 1JWUD 4ZAIA 3IL8A 4LFCQ 2JA8G 3TN2A 4X64Q 3D4DA 3A55A 4DK0A 2HHHL 3S16B 2HD3A 2CFMA 1EL0A 4B08A 1KDAA 1DZ1A 3CD6A 2CQAA 3M85A 3K7AH 2JA5H 2RDHA 2K5VA 2NN6I 4KY5A 4GLAC 3R93A 3IFDA 1X32A 1QOHA 1STAA 5FJ8G 4ZLTF 4B9XA 2F0JA 3STBC 4P74A 4WRDA 1EEFD 1F2YA 4BA1I 4HJ9A 3GTJB 2XGTA 4A3KH 3GV3A 2SNMA 4JVZA 1N34L 1GM5A 5TSSA 3FHWA 2A1AA 5CGKA 4G7ZC 4DAYB 5IODA 2BE5C 2HCCA 3D4RA 4GN4B 3RNUA 3FP9A 1YITA 1HH2P 2NZHA 1DJRD 3LWUA 1QG7A 5C0XI 4RKBA 4IUNA 5EKLA 4KD4A 3UI2A 2KHSA 1Q46A 3HZXA 4LWCA 3VYSA 2UUCQ 3NQIA 4DV0Q 1VMCA 3PUVA 1HA6A 1AN8A 4X66Q 3DEPA 3PO2H 2PO4A 3J80E 3CHBD 2VS1A 3J80c 4O2DA 4LFCL 1HPCA 3PF4A 4X64L 1M4VA 4MTKA 3W2DA 5C6AA 1WTXA 2K01A 4AH6A 1VQFA 1JICA 1VQAA 1EU3A 1G2TA 2VL6A 3MXUA 1SDFA 2Z6BA 5G3LF 1XMQL 1F2MA 1LO5D 1IKLA 2F0GA 1SYCA 2SEBD 1E2ZA 1D5MC 1U4LA 4RFBA 2EPBA 2VUMB 5C3XA 1YZ6A 1B7YB 5KNDA 4IUUA 1BBWA 4A3EH 4ULLA 1KTKA 2EYHA 2RSOA 2IX3A 2JA8H 3C1EA 1H95A 2R7FA 2NVTB 1EWCA 3MEFA 1XPOA 2XTIA 3D0FA 1I4PA 1NR4A 1IW7C 3HKZB 4JI4Q 4F88A 3K7UC 2EYLA 3Q8DA 2UUCL 4NW2A 2A73B 3NPPA 2D0PA 4X3TA 3KYHC 4POGA 2F52A 2Q2HA 4X66L 5E7NA 2QA4A 3BVGA 3NTIA 1EYAA 4A3MG 5KNCA 5COYA 1R9TH 3J7A5 1JB7A 3A8IE 1EUJA 1XNRQ 1EQRA 3AU7A 1EQTA 1KAAA 5K5PA 1ZXTA 2I46A 2FMMA 3KLRA 1SNMA 2PQAB 1SNQA 1ILPA 4JC0A 2WAQE 3GQBA 5LL6X 2NWGA 3M7GA 5IT9L 2EYFA 2N3SA 5LMNL 4C1NK 1D8LA 5FKAC 5JPNC 4O0AA 5C3EG 3P20A 1NNXA 5CBAE 5C44B 1Y1WG 1S3OA 4KMUC 3PF5A 1EY4A 4Y7NH 3GTPB 3MHBA 3KBGA 4FO2A 1S5FD 5ELNA 1HR0W 4DUZQ 4ME5A 4OXPA 3RZDB 1KNAA 1FVIA 2KUMA 2L55A 5I2YA 2Y0SB 1MD2D 3M7NA 1SNPA 5IY0A 4NXMQ 4JI4L 1HZBA 4DR4Q 3H3VH 2SDFA 1GUWA 4FXKC 1G291 1WTQA 3VR6A 4MTNA
chains in the Genus database with same CATH topology
1NJIC 1VQKA 1Z9FA 3IRBA 1M1KC 3PIPA 1X56A 2CKZB 2EIFA 4R4QA 1O7IA 1UEBA 5C0XJ 4ALPA 4DR1L 1VQ6A 4JBKA 3I7FA 4C3HH 4JBJA 1QZHA 2D0OA 1XNRL 3KDFA 3NELA 1PFSA 4GOPA 2A8VA 1XNQQ 3TEHB 4JI3Q 3RLFA 1K83H 3KDFB 2WFWA 3JC66 4A3CG 4JYAQ 2N78A 3GDEA 3PSIA 1YVCA 4HJAA 2PNHA 4GOPB 1IZ6A 1L1OC 1VCIA 1GO3E 4YWKA 1YJWA 4JI8L 3J81i 1YHQA 5ELOA 1N32L 3M4QA 1QZGA 1YJ9A 1IYJB 5FLXc 2NZOA 4DUYL 1YJNA 4HJ8A 1EIYB 1Q81C 1K3RA 3PGZA 2R7ZG 4C3JH 3TS2A 4IOCA 4A3GG 4JI6Q 2E2IH 4DR2Q 3OTOQ 2CCZA 1GVPA 1N9WA 2NVYH 4OX9L 3F2BA 2N49A 4BY1G 1I50H 3F1ZA 3GTQH 1VQGA 3HOZH 3ERSX 4JOIA 1OXUA 2NVXH 2OCEA 1YHBA 2Z0SA 1FJGL 1VQEA 3JAMc 4DUZL 3RN2A 1E22A 3G48A 4LFAQ 4A4IA 2AWOA 1E1OA 3CC7A 2CWAA 3CC4A 4IOAA 5JJLA 3OYYA 1U0LA 1MJCA 2EXDA 4A3LG 2IY5B 3I4MH 5IP7G 1PH5A 2UUBQ 2KHJA 3T1YL 4BBRH 1J5EQ 4PZ8A 4UP9A 2FXQA 5M5XH 1HNWL 2K50A 1I5FA 1I3QH 2R7DA 1C7YA 4NXML 4DR4L 4TVAB 1PV4A 4LFBQ 4P72A 2R6GA 4IJLA 4OWXB 3UDGA 5BR8Q 4AYBG 1KAWA 4JI1L 1PHJA 3KFUA 4IO9A 2H5XA 2JA6H 3G4SA 4LF9Q 5C3EH 4QJFA 3CCQA 3DM3A 1PH8A 1MJEA 3BZCA 1Y1WH 4H02A 5FLMH 5IP9G 4KHPQ 1WYDA 4DV7Q 1HNXQ 2E5LQ 4OO1I 1QVGA 4DAMA 4DV0L 3GTGH 2I0QA 3K8AA 4DV1Q 1TWCH 3NEMA 1WJJA 4JI3L 1VQLA 2DUDA 1KRTA 4B3TQ 4JYAL 1KL9A 1LTLA 1S72A 3CCJA 1RL2A 1NE3A 4IFDG 1V9PA 1PYBA 1KD1C 4GKKQ 1I6HH 5IYBH 2PMZE 1VQJA 1E3PA 4A76A 3TQYA 4QGUA 1SN8A 3BU2A 1A8VA 2E2JH 4X62Q 1IBLQ 3I55A 3KF8B 3KJOA 3HOXG 5HY6A 3HOVH 4RG1A 4EX5A 3I4MG 3HKSA 1PH6A 2HQLA 2PI2E 5JEAG 5IYDG 3FKIH 4BBRG 3CCUA 1WOCA 3W1BA 5GAHC 1IBMQ 4JI6L 4A3DG 2VQFL 2K5HA 4DR2L 1KHIA 1QUQA 2JA7H 3OTOL 2B63G 3HFZB 3S14H 3EIVA 1YIJA 1JJCB 1W3SA 1HZAA 1QUQB 2D62A 2AKWB 1Q8KA 4LUVA 2R93G 3A0JA 5M3FH 3S17H 2KBNA 1NBWA 1WI5A 2RCNA 4YY3Q 1J6QA 1G51A 3KJPA 4LFAL 2IHFA 2K14A 4KI0A 1LM0A 4GN5A 2I5MX 3CW2C 1EFWA 2MQHA 4B3SQ 4YWMA 1VQMA 3HKZE 2DGYA 2UUBL 2WB1G 1L1OA 2Q2UA 1OXTA 1J5EL 4L5SA 1X55A 4WJ4A 4A3BG 4DV5Q 5C4JH 4LFBL 2UUAQ 3RLNA 3PCOB 2UXDQ 2RHQB 3GD7A 1ASYA 1Q86C 4LUOA 5BR8L 5IYBG 3G71A 2R7ZH 1NTGA 3K80C 3EBEA 1OXVA 2MO0A 3CCVA 3I2ZA 1LYLA 3UDIA 3HOVG 4LF6Q 3J7ZC 4DV7L 5EAYA 2EQSA 4DR5Q 1HNXL 3E9HA 2E5LL 4BY1H 3FKIG 1VQIA 2JJQA 4DV4Q 1PA6A 2JA7G 4DV1L 4LF4Q 2UXBQ 2K75A 3I4NH 2GN5A 4DR7Q 1TXYA 2L15A 4R4TA 1XMQQ 4JI0Q 5LMUQ 1I94Q 3GTMH 4GKJQ 4TQUS 5M3FG 3CMAA 1CUKA 3J81c 4A3LH 5IP7H 3STBD 1VQNA 1JT8A 1XMOL 2E2HH 1VS0A 1HZCA 2MFIA 4X62L 3E9IA 1IBLL 2MNAA 1PVOA 4QL5A 2ASBA 4QQBX 1P16A 2VUMG 1PH3A 1FL0A 4NPSA 2K5NA 4QY7A 4JG2A 4AIMA 1IBML 2WAQG 4K0KQ 5AJ3Q 2KHIA 1Q82C 1VQ7A 4BXXH 4EQ5A 2VW9A 3A74A 3U58A 3CC2A 1EWIA 3S16H 4L5RC 4DV6Q 4KLKA 5IP9H 1AE2A 3F2DA 1PYSB 2UXCQ 3UDXA 3RN5A 1IL2A 1SLJA 4OO1G 3OW2A 1CSQA 4YCUA 1YNXA 3CCEA 3HKZG 1UE5A 3TREA 1XJVA 1S40A 2VZAA 2Y0SE 2RF4A 2VNUD 1X65A 2KENA 3PUZA 3PIOA 3M4PA 1PH1A 1N36L 2F4VQ 3I4NG 2WP8J 4HJ5A 4DV5L 1OTCA 1V1QA 1X3GA 1X9NA 2JEAI 2R92H 4OWTB 3GTJH 4R4IA 3HOXH 4JI7Q 2UXDL 4GNXC 3SGIA 1Q7YC 4X6AH 5IYDH 2ZJRA 4A3DH 2C35B 2V1CC 1RIPA 4BBSH 4P75A 1NMFA 4DKAC 3S1MH 4LF6L 1N33Q 3T1HQ 1VQOA 2B63H 3J80i 4A93H 2AMCB 4DPGA 1C9OA 2R93H 3W1GA 3S15H 4HJ7A 2HHHQ 2AHOB 3GO5A 2UXBL 1X3EA 3S24A 2QGQA 1PH7A 4GLVB 4BXXG 5LMNQ 3PO3H 1A62A 4DK3C 4DV2Q 1SR3A 4DR7L 4J15A 4ME3A 4JI0L 3D31A 5GROA 2ATWA 1GD7A 3MXNB 5LMUL 2PI2A 3B6YA 1XPRA 4GKJL 1Q1BA 5C4XG 3WWVA 3ULLA 2BH2A 2ZM6Q 2I5HA 2K52A 2YU9H 3GTOH 1BVSA 3CAMA 3F8TA 1L0WA 4LF5Q 1YHAA 5C44G 2I5LX 3UE0A 3S2DH 1K9MC 1XNQL 3AFQA 4A3BH 3M9BA 3ZJYC 1X6OA 5GAGC 3CCMA 1JMCA 1KC8C 4JBWA 4JBMA 4K0KL 1W2BA 4P71A 5AJ3L 3W5OA 2LXKA 1VQ5A 2R92G 4KHZA 1N34Q 2YTXA 4JI5Q 4DV6L 4YWLA 3U50C 3CF5A 4NB3A 3S2HH 4UP8A 1Q1EA 1WCMG 2Z6KC 2Y0SG 2UXCL 1HZ9A 3K0XA 1SROA 4GN3B 1P8LA 2K4KA 5M3MH 4BBSG 1KQSA 4HIOA 2YV5A 1E24A 5FJ8H 4BA2I 1KXLA 1MKHA 3KLWA 4DNIA 1PH4A 4B3MQ 4DR6Q 4A93G 4P73A 1PH9A 3KF6A 3GTKH 3S1QH 3NENA 4L5QA 4RMFA 2F4VL 3PO3G 2BA0A 3KF6B 3VDYA 2HT1A 1OXXK 4FDBA 2OQKA 3H15A 3KOJA 4BY7H 3AFPA 1NMGA 4JI7L 1VQBA 4Y52H 1VQ9A 2OQ0A 1TWGH 1C0AA 4XIGS 2VUMH 1SFOH 2HIVA 2MO1A 4YHHQ 3G6EA 3GTLH 3M4OH 2IX1A 1L1OB 1CSPA 1YI2A 4JI8Q 1A63A 4JV5Q 3LGJA 3UDFA 3ICEA 2GVAA 3L2PA 4C2MH 3T1HL 4LFCQ 5HGQA 1TWHH 1N33L 1LUZA 2JA8G 2NVTH 3L0OA 4X64Q 1GKHA 2OTJA 2HHHL 1U5KA 3S1RH 4IPGA 4UPAA 4XTCS 1PH2A 1JJGA 2Q2IA 2CFMA 2ES2A 4LF9L 4LF8Q 3CD6A 4POFA 3M85A 3K7AH 1QVCA 4YCVA 2JA5H 4KHPL 2K5VA 1HR0Q 2NN6I 3H0GH 2ZTEA 3F2CA 4GS3A 4GLAC 3PUXA 3S1NH 5M3MG 4OWWB 5FJ8G 1AE3A 2B3GA 3CPFA 3U4VA 4B3TL 1VQDA 2LSSA 3STBC 4LNQA 4P74A 1UE1A 3CCLA 4BA1I 4HJ9A 4GKKL 2XGTA 5JJKA 4GNXA 1XPUA 3I4OA 4A3KH 4PZ7A 2ZJPA 4GNXB 1M90C 4PZ6A 4BY7G 1N34L 1GM5A 1OXSC 3A5UA 4JI5L 5GAEC 4YCWA 3HOUH 1HNWQ 3FHWA 2A1AA 2JQOA 4DAYB 3U4ZA 4MZ9A 2VY3A 4GN4B 3RNUA 4B3RQ 2JA9A 3FP9A 1Q12A 1HH2P 2NZHA 1YITA 4A75A 1WFQA 1EQQA 1G6PA 4LF7Q 1YEZA 3RLOA 5C0XI 2VQEQ 4B3ML 4DR6L 4AYBE 1EOVA 5C4XH 1K0RA 1TWAH 1Q46A 2A19A 2YTVA 4LWCA 4YY3L 2UUCQ 5C44H 1V43A 2IX0A 4R4OA 4DV0Q 1IXRA 1AH9A 2JA5G 1D7QA 2QEXA 1BKBA 4B3SL 3PUVA 4IPDA 3H0GG 1Y1VG 4HIDA 3GTPH 5IWAQ 4X66Q 1XTDA 2UU9Q 4YHHL 3K81C 4AQYQ 3PO2H 4A3IG 1JE5A 2VS1A 3HOWG 5IYCG 3NBHB 1K8AC 4UY8C 2ZTCA 3J80c 3RZDH 4O2DA 1QVFA 4JV5L 4LFCL 2UUAL 1A0IA 2RHSB 5J3BA 3PF4A 4A3FH 4X64L 3UE1A 4JI2Q 4GLXA 1WCMH 2Z6KA 4A3KG 3HOYG 5DLQE 3HOUG 3I56A 4LF8L 1UWVA 2JK8A 2VQFQ 2AWNA 4HIKA 1HR0L 1KIXA 3CMEA 4DR5L 3CCSA 4AH6A 2GVBA 1VQFA 3ER0A 3AYHB 2CWPA 4DV4L 1VQAA 1Z47A 4A3MH 2CQOA 2VL6A 4R1JA 3TS0A 4LF4L 3RZOH 1UE6A 1XMQL 1I94L 5JJIA 4L5TA 4R4CA 4APVA 3J81j 4NXNQ 4HIMA 5M5YH 5LMNW 1IBKQ 2ZJQA 3CPWA 1YZ6A 1B7YB 5GQOA 3E0EA 3EN2A 1BBWA 4GOPC 1L2FA 1E7ZA 4A3EH 1DGSA 1CKNA 2WB1E 1BBUA 4PG3A 3JAMi 1SMXA 4DR3Q 1JJ2A 2JA8H 1MIUA 3PO2G 2IHEA 4X65Q 1CKNB 1H95A 2YYZA 2R7FA 4B3RL 5IE8A 3MEFA 3TRZA 1XPOA 1HNZQ 2HIXA 2XTIA 4LF7L 4DV3Q 3D0FA 2VQEL 4A3FG 2ZTDA 5M5WH 1CKOA 4JI4Q 2LXJA 3K7UC 1B70B 1HJPA 1X3FA 2B29A 2JE6I 2NN6G 3CQZH 3Q8DA 4LW1A 2N8NA 2UUCL 3PV0A 2ALYB 2D0PA 2IT1A 3BZKA 3KYHC 4POGA 2F52A 2Q2HA 3H3VI 3M3YH 1NY4A 4X66L 5IWAL 5E7NA 2UU9L 5K36G 2QA4A 1ASZA 2JEBI 4AQYL 3HOZG 4A3MG 4JOIC 4QIWE 4DR1Q 1R9TH 3J7A5 3BJUA 1XMOQ 1JB7A 1EUJA 1XNRQ 4WJ3M 3AQQA 1EQRA 5GADC 1T9HA 1YBYA 3L7ZC 1VQPA 1VQ8A 1EYGA 4JI2L 1UE7A 4A3JH 3CP0A 3PUYA 4PMWA 2Q2TA 2PQAA 3A5ZB 1K8GA 4A3EG 2PQAB 2YTYA 4OONA 1N32Q 4IJHA 3PUWA 4IPCA 4JC0A 5C0XG 4DUYQ 2WAQE 3AEVA 3DLLA 1X54A 1B8AA 1EIFA 4C3IH 2N3SA 1E1TA 4MNOA 1N8RC 2ID0A 2OWOA 5LMNL 4DV2L 1D8LA 1CKMA 2JA6G 4O0AA 5C3EG 2E8GA 1SRUA 4LUZA 4DK6C 1S3OA 4NXNL 5FLMG 3ULPA 1Y1WG 1K73C 2ZM6L 1Y1VH 3RR5A 3PF5A 5IT9c 4OX9Q 4A3CH 4LF5L 4Y7NH 1IBKL 2F3IA 2OTLA 3ULJA 2KCMA 5H1SE 4A3IH 1SE8A 2BH8A 1VQCA 1FGUA 5IYCH 1Y14B 5ELNA 4DUZQ 1N36Q 1HR0W 1FJGQ 3HOWH 4OXPA 4IPHA 4DR3L 1VQ4A 2NVQH 1FVIA 4X65L 4IFDI 4IFDJ 3CXCA 1HNZL 3HOYH 4DV3L 3T1YQ 3CCRA 3M7NA 4A3GH 4JCVE 5IY0A 4NXMQ 4JI4L 1HZBA 4DR4Q 4A3JG 3H3VH 1KRSA 2BA1A 2KCTA 4JI1Q 1G291 1VQHA 5JEAJ 1TWFH 4UP7A 4MTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI C;  1VQK A;  1Z9F A;  3IRB A;  1M1K C;  3PIP A;  1X56 A;  2CKZ B;  2EIF A;  4R4Q A;  1O7I A;  1UEB A;  5C0X J;  4ALP A;  4DR1 L;  1VQ6 A;  4JBK A;  3I7F A;  4C3H H;  4JBJ A;  1QZH A;  2D0O A;  1XNR L;  3KDF A;  3NEL A;  1PFS A;  4GOP A;  2A8V A;  1XNQ Q;  3TEH B;  4JI3 Q;  3RLF A;  1K83 H;  3KDF B;  2WFW A;  3JC6 6;  4A3C G;  4JYA Q;  2N78 A;  3GDE A;  3PSI A;  1YVC A;  4HJA A;  2PNH A;  4GOP B;  1IZ6 A;  1L1O C;  1VCI A;  1GO3 E;  4YWK A;  1YJW A;  4JI8 L;  3J81 i;  1YHQ A;  5ELO A;  1N32 L;  3M4Q A;  1QZG A;  1YJ9 A;  1IYJ B;  5FLX c;  2NZO A;  4DUY L;  1YJN A;  4HJ8 A;  1EIY B;  1Q81 C;  1K3R A;  3PGZ A;  2R7Z G;  4C3J H;  3TS2 A;  4IOC A;  4A3G G;  4JI6 Q;  2E2I H;  4DR2 Q;  3OTO Q;  2CCZ A;  1GVP A;  1N9W A;  2NVY H;  4OX9 L;  3F2B A;  2N49 A;  4BY1 G;  1I50 H;  3F1Z A;  3GTQ H;  1VQG A;  3HOZ H;  3ERS X;  4JOI A;  1OXU A;  2NVX H;  2OCE A;  1YHB A;  2Z0S A;  1FJG L;  1VQE A;  3JAM c;  4DUZ L;  3RN2 A;  1E22 A;  3G48 A;  4LFA Q;  4A4I A;  2AWO A;  1E1O A;  3CC7 A;  2CWA A;  3CC4 A;  4IOA A;  5JJL A;  3OYY A;  1U0L A;  1MJC A;  2EXD A;  4A3L G;  2IY5 B;  3I4M H;  5IP7 G;  1PH5 A;  2UUB Q;  2KHJ A;  3T1Y L;  4BBR H;  1J5E Q;  4PZ8 A;  4UP9 A;  2FXQ A;  5M5X H;  1HNW L;  2K50 A;  1I5F A;  1I3Q H;  2R7D A;  1C7Y A;  4NXM L;  4DR4 L;  4TVA B;  1PV4 A;  4LFB Q;  4P72 A;  2R6G A;  4IJL A;  4OWX B;  3UDG A;  5BR8 Q;  4AYB G;  1KAW A;  4JI1 L;  1PHJ A;  3KFU A;  4IO9 A;  2H5X A;  2JA6 H;  3G4S A;  4LF9 Q;  5C3E H;  4QJF A;  3CCQ A;  3DM3 A;  1PH8 A;  1MJE A;  3BZC A;  1Y1W H;  4H02 A;  5FLM H;  5IP9 G;  4KHP Q;  1WYD A;  4DV7 Q;  1HNX Q;  2E5L Q;  4OO1 I;  1QVG A;  4DAM A;  4DV0 L;  3GTG H;  2I0Q A;  3K8A A;  4DV1 Q;  1TWC H;  3NEM A;  1WJJ A;  4JI3 L;  1VQL A;  2DUD A;  1KRT A;  4B3T Q;  4JYA L;  1KL9 A;  1LTL A;  1S72 A;  3CCJ A;  1RL2 A;  1NE3 A;  4IFD G;  1V9P A;  1PYB A;  1KD1 C;  4GKK Q;  1I6H H;  5IYB H;  2PMZ E;  1VQJ A;  1E3P A;  4A76 A;  3TQY A;  4QGU A;  1SN8 A;  3BU2 A;  1A8V A;  2E2J H;  4X62 Q;  1IBL Q;  3I55 A;  3KF8 B;  3KJO A;  3HOX G;  5HY6 A;  3HOV H;  4RG1 A;  4EX5 A;  3I4M G;  3HKS A;  1PH6 A;  2HQL A;  2PI2 E;  5JEA G;  5IYD G;  3FKI H;  4BBR G;  3CCU A;  1WOC A;  3W1B A;  5GAH C;  1IBM Q;  4JI6 L;  4A3D G;  2VQF L;  2K5H A;  4DR2 L;  1KHI A;  1QUQ A;  2JA7 H;  3OTO L;  2B63 G;  3HFZ B;  3S14 H;  3EIV A;  1YIJ A;  1JJC B;  1W3S A;  1HZA A;  1QUQ B;  2D62 A;  2AKW B;  1Q8K A;  4LUV A;  2R93 G;  3A0J A;  5M3F H;  3S17 H;  2KBN A;  1NBW A;  1WI5 A;  2RCN A;  4YY3 Q;  1J6Q A;  1G51 A;  3KJP A;  4LFA L;  2IHF A;  2K14 A;  4KI0 A;  1LM0 A;  4GN5 A;  2I5M X;  3CW2 C;  1EFW A;  2MQH A;  4B3S Q;  4YWM A;  1VQM A;  3HKZ E;  2DGY A;  2UUB L;  2WB1 G;  1L1O A;  2Q2U A;  1OXT A;  1J5E L;  4L5S A;  1X55 A;  4WJ4 A;  4A3B G;  4DV5 Q;  5C4J H;  4LFB L;  2UUA Q;  3RLN A;  3PCO B;  2UXD Q;  2RHQ B;  3GD7 A;  1ASY A;  1Q86 C;  4LUO A;  5BR8 L;  5IYB G;  3G71 A;  2R7Z H;  1NTG A;  3K80 C;  3EBE A;  1OXV A;  2MO0 A;  3CCV A;  3I2Z A;  1LYL A;  3UDI A;  3HOV G;  4LF6 Q;  3J7Z C;  4DV7 L;  5EAY A;  2EQS A;  4DR5 Q;  1HNX L;  3E9H A;  2E5L L;  4BY1 H;  3FKI G;  1VQI A;  2JJQ A;  4DV4 Q;  1PA6 A;  2JA7 G;  4DV1 L;  4LF4 Q;  2UXB Q;  2K75 A;  3I4N H;  2GN5 A;  4DR7 Q;  1TXY A;  2L15 A;  4R4T A;  1XMQ Q;  4JI0 Q;  5LMU Q;  1I94 Q;  3GTM H;  4GKJ Q;  4TQU S;  5M3F G;  3CMA A;  1CUK A;  3J81 c;  4A3L H;  5IP7 H;  3STB D;  1VQN A;  1JT8 A;  1XMO L;  2E2H H;  1VS0 A;  1HZC A;  2MFI A;  4X62 L;  3E9I A;  1IBL L;  2MNA A;  1PVO A;  4QL5 A;  2ASB A;  4QQB X;  1P16 A;  2VUM G;  1PH3 A;  1FL0 A;  4NPS A;  2K5N A;  4QY7 A;  4JG2 A;  4AIM A;  1IBM L;  2WAQ G;  4K0K Q;  5AJ3 Q;  2KHI A;  1Q82 C;  1VQ7 A;  4BXX H;  4EQ5 A;  2VW9 A;  3A74 A;  3U58 A;  3CC2 A;  1EWI A;  3S16 H;  4L5R C;  4DV6 Q;  4KLK A;  5IP9 H;  1AE2 A;  3F2D A;  1PYS B;  2UXC Q;  3UDX A;  3RN5 A;  1IL2 A;  1SLJ A;  4OO1 G;  3OW2 A;  1CSQ A;  4YCU A;  1YNX A;  3CCE A;  3HKZ G;  1UE5 A;  3TRE A;  1XJV A;  1S40 A;  2VZA A;  2Y0S E;  2RF4 A;  2VNU D;  1X65 A;  2KEN A;  3PUZ A;  3PIO A;  3M4P A;  1PH1 A;  1N36 L;  2F4V Q;  3I4N G;  2WP8 J;  4HJ5 A;  4DV5 L;  1OTC A;  1V1Q A;  1X3G A;  1X9N A;  2JEA I;  2R92 H;  4OWT B;  3GTJ H;  4R4I A;  3HOX H;  4JI7 Q;  2UXD L;  4GNX C;  3SGI A;  1Q7Y C;  4X6A H;  5IYD H;  2ZJR A;  4A3D H;  2C35 B;  2V1C C;  1RIP A;  4BBS H;  4P75 A;  1NMF A;  4DKA C;  3S1M H;  4LF6 L;  1N33 Q;  3T1H Q;  1VQO A;  2B63 H;  3J80 i;  4A93 H;  2AMC B;  4DPG A;  1C9O A;  2R93 H;  3W1G A;  3S15 H;  4HJ7 A;  2HHH Q;  2AHO B;  3GO5 A;  2UXB L;  1X3E A;  3S24 A;  2QGQ A;  1PH7 A;  4GLV B;  4BXX G;  5LMN Q;  3PO3 H;  1A62 A;  4DK3 C;  4DV2 Q;  1SR3 A;  4DR7 L;  4J15 A;  4ME3 A;  4JI0 L;  3D31 A;  5GRO A;  2ATW A;  1GD7 A;  3MXN B;  5LMU L;  2PI2 A;  3B6Y A;  1XPR A;  4GKJ L;  1Q1B A;  5C4X G;  3WWV A;  3ULL A;  2BH2 A;  2ZM6 Q;  2I5H A;  2K52 A;  2YU9 H;  3GTO H;  1BVS A;  3CAM A;  3F8T A;  1L0W A;  4LF5 Q;  1YHA A;  5C44 G;  2I5L X;  3UE0 A;  3S2D H;  1K9M C;  1XNQ L;  3AFQ A;  4A3B H;  3M9B A;  3ZJY C;  1X6O A;  5GAG C;  3CCM A;  1JMC A;  1KC8 C;  4JBW A;  4JBM A;  4K0K L;  1W2B A;  4P71 A;  5AJ3 L;  3W5O A;  2LXK A;  1VQ5 A;  2R92 G;  4KHZ A;  1N34 Q;  2YTX A;  4JI5 Q;  4DV6 L;  4YWL A;  3U50 C;  3CF5 A;  4NB3 A;  3S2H H;  4UP8 A;  1Q1E A;  1WCM G;  2Z6K C;  2Y0S G;  2UXC L;  1HZ9 A;  3K0X A;  1SRO A;  4GN3 B;  1P8L A;  2K4K A;  5M3M H;  4BBS G;  1KQS A;  4HIO A;  2YV5 A;  1E24 A;  5FJ8 H;  4BA2 I;  1KXL A;  1MKH A;  3KLW A;  4DNI A;  1PH4 A;  4B3M Q;  4DR6 Q;  4A93 G;  4P73 A;  1PH9 A;  3KF6 A;  3GTK H;  3S1Q H;  3NEN A;  4L5Q A;  4RMF A;  2F4V L;  3PO3 G;  2BA0 A;  3KF6 B;  3VDY A;  2HT1 A;  1OXX K;  4FDB A;  2OQK A;  3H15 A;  3KOJ A;  4BY7 H;  3AFP A;  1NMG A;  4JI7 L;  1VQB A;  4Y52 H;  1VQ9 A;  2OQ0 A;  1TWG H;  1C0A A;  4XIG S;  2VUM H;  1SFO H;  2HIV A;  2MO1 A;  4YHH Q;  3G6E A;  3GTL H;  3M4O H;  2IX1 A;  1L1O B;  1CSP A;  1YI2 A;  4JI8 Q;  1A63 A;  4JV5 Q;  3LGJ A;  3UDF A;  3ICE A;  2GVA A;  3L2P A;  4C2M H;  3T1H L;  4LFC Q;  5HGQ A;  1TWH H;  1N33 L;  1LUZ A;  2JA8 G;  2NVT H;  3L0O A;  4X64 Q;  1GKH A;  2OTJ A;  2HHH L;  1U5K A;  3S1R H;  4IPG A;  4UPA A;  4XTC S;  1PH2 A;  1JJG A;  2Q2I A;  2CFM A;  2ES2 A;  4LF9 L;  4LF8 Q;  3CD6 A;  4POF A;  3M85 A;  3K7A H;  1QVC A;  4YCV A;  2JA5 H;  4KHP L;  2K5V A;  1HR0 Q;  2NN6 I;  3H0G H;  2ZTE A;  3F2C A;  4GS3 A;  4GLA C;  3PUX A;  3S1N H;  5M3M G;  4OWW B;  5FJ8 G;  1AE3 A;  2B3G A;  3CPF A;  3U4V A;  4B3T L;  1VQD A;  2LSS A;  3STB C;  4LNQ A;  4P74 A;  1UE1 A;  3CCL A;  4BA1 I;  4HJ9 A;  4GKK L;  2XGT A;  5JJK A;  4GNX A;  1XPU A;  3I4O A;  4A3K H;  4PZ7 A;  2ZJP A;  4GNX B;  1M90 C;  4PZ6 A;  4BY7 G;  1N34 L;  1GM5 A;  1OXS C;  3A5U A;  4JI5 L;  5GAE C;  4YCW A;  3HOU H;  1HNW Q;  3FHW A;  2A1A A;  2JQO A;  4DAY B;  3U4Z A;  4MZ9 A;  2VY3 A;  4GN4 B;  3RNU A;  4B3R Q;  2JA9 A;  3FP9 A;  1Q12 A;  1HH2 P;  2NZH A;  1YIT A;  4A75 A;  1WFQ A;  1EQQ A;  1G6P A;  4LF7 Q;  1YEZ A;  3RLO A;  5C0X I;  2VQE Q;  4B3M L;  4DR6 L;  4AYB E;  1EOV A;  5C4X H;  1K0R A;  1TWA H;  1Q46 A;  2A19 A;  2YTV A;  4LWC A;  4YY3 L;  2UUC Q;  5C44 H;  1V43 A;  2IX0 A;  4R4O A;  4DV0 Q;  1IXR A;  1AH9 A;  2JA5 G;  1D7Q A;  2QEX A;  1BKB A;  4B3S L;  3PUV A;  4IPD A;  3H0G G;  1Y1V G;  4HID A;  3GTP H;  5IWA Q;  4X66 Q;  1XTD A;  2UU9 Q;  4YHH L;  3K81 C;  4AQY Q;  3PO2 H;  4A3I G;  1JE5 A;  2VS1 A;  3HOW G;  5IYC G;  3NBH B;  1K8A C;  4UY8 C;  2ZTC A;  3J80 c;  3RZD H;  4O2D A;  1QVF A;  4JV5 L;  4LFC L;  2UUA L;  1A0I A;  2RHS B;  5J3B A;  3PF4 A;  4A3F H;  4X64 L;  3UE1 A;  4JI2 Q;  4GLX A;  1WCM H;  2Z6K A;  4A3K G;  3HOY G;  5DLQ E;  3HOU G;  3I56 A;  4LF8 L;  1UWV A;  2JK8 A;  2VQF Q;  2AWN A;  4HIK A;  1HR0 L;  1KIX A;  3CME A;  4DR5 L;  3CCS A;  4AH6 A;  2GVB A;  1VQF A;  3ER0 A;  3AYH B;  2CWP A;  4DV4 L;  1VQA A;  1Z47 A;  4A3M H;  2CQO A;  2VL6 A;  4R1J A;  3TS0 A;  4LF4 L;  3RZO H;  1UE6 A;  1XMQ L;  1I94 L;  5JJI A;  4L5T A;  4R4C A;  4APV A;  3J81 j;  4NXN Q;  4HIM A;  5M5Y H;  5LMN W;  1IBK Q;  2ZJQ A;  3CPW A;  1YZ6 A;  1B7Y B;  5GQO A;  3E0E A;  3EN2 A;  1BBW A;  4GOP C;  1L2F A;  1E7Z A;  4A3E H;  1DGS A;  1CKN A;  2WB1 E;  1BBU A;  4PG3 A;  3JAM i;  1SMX A;  4DR3 Q;  1JJ2 A;  2JA8 H;  1MIU A;  3PO2 G;  2IHE A;  4X65 Q;  1CKN B;  1H95 A;  2YYZ A;  2R7F A;  4B3R L;  5IE8 A;  3MEF A;  3TRZ A;  1XPO A;  1HNZ Q;  2HIX A;  2XTI A;  4LF7 L;  4DV3 Q;  3D0F A;  2VQE L;  4A3F G;  2ZTD A;  5M5W H;  1CKO A;  4JI4 Q;  2LXJ A;  3K7U C;  1B70 B;  1HJP A;  1X3F A;  2B29 A;  2JE6 I;  2NN6 G;  3CQZ H;  3Q8D A;  4LW1 A;  2N8N A;  2UUC L;  3PV0 A;  2ALY B;  2D0P A;  2IT1 A;  3BZK A;  3KYH C;  4POG A;  2F52 A;  2Q2H A;  3H3V I;  3M3Y H;  1NY4 A;  4X66 L;  5IWA L;  5E7N A;  2UU9 L;  5K36 G;  2QA4 A;  1ASZ A;  2JEB I;  4AQY L;  3HOZ G;  4A3M G;  4JOI C;  4QIW E;  4DR1 Q;  1R9T H;  3J7A 5;  3BJU A;  1XMO Q;  1JB7 A;  1EUJ A;  1XNR Q;  4WJ3 M;  3AQQ A;  1EQR A;  5GAD C;  1T9H A;  1YBY A;  3L7Z C;  1VQP A;  1VQ8 A;  1EYG A;  4JI2 L;  1UE7 A;  4A3J H;  3CP0 A;  3PUY A;  4PMW A;  2Q2T A;  2PQA A;  3A5Z B;  1K8G A;  4A3E G;  2PQA B;  2YTY A;  4OON A;  1N32 Q;  4IJH A;  3PUW A;  4IPC A;  4JC0 A;  5C0X G;  4DUY Q;  2WAQ E;  3AEV A;  3DLL A;  1X54 A;  1B8A A;  1EIF A;  4C3I H;  2N3S A;  1E1T A;  4MNO A;  1N8R C;  2ID0 A;  2OWO A;  5LMN L;  4DV2 L;  1D8L A;  1CKM A;  2JA6 G;  4O0A A;  5C3E G;  2E8G A;  1SRU A;  4LUZ A;  4DK6 C;  1S3O A;  4NXN L;  5FLM G;  3ULP A;  1Y1W G;  1K73 C;  2ZM6 L;  1Y1V H;  3RR5 A;  3PF5 A;  5IT9 c;  4OX9 Q;  4A3C H;  4LF5 L;  4Y7N H;  1IBK L;  2F3I A;  2OTL A;  3ULJ A;  2KCM A;  5H1S E;  4A3I H;  1SE8 A;  2BH8 A;  1VQC A;  1FGU A;  5IYC H;  1Y14 B;  5ELN A;  4DUZ Q;  1N36 Q;  1HR0 W;  1FJG Q;  3HOW H;  4OXP A;  4IPH A;  4DR3 L;  1VQ4 A;  2NVQ H;  1FVI A;  4X65 L;  4IFD I;  4IFD J;  3CXC A;  1HNZ L;  3HOY H;  4DV3 L;  3T1Y Q;  3CCR A;  3M7N A;  4A3G H;  4JCV E;  5IY0 A;  4NXM Q;  4JI4 L;  1HZB A;  4DR4 Q;  4A3J G;  3H3V H;  1KRS A;  2BA1 A;  2KCT A;  4JI1 Q;  1G29 1;  1VQH A;  5JEA J;  1TWF H;  4UP7 A;  4MTN A; 
#chains in the Genus database with same CATH topology
 1NJI C;  1M1K C;  2F0L A;  3PIP A;  2WKD A;  1LTT D;  1UEB A;  3VYT A;  4RKL A;  1BQQ T;  4JBK A;  2A68 C;  3I7F A;  1QZH A;  1B9N A;  5M5Y B;  1XNR L;  3KDF A;  3NEL A;  4GOP A;  1WTV A;  2RKS A;  2PNH A;  2EVB A;  2G5D A;  4JI8 L;  4FF1 A;  3M4Q A;  2M9V A;  2E2D C;  1YJN A;  1QZG A;  2NZO A;  1EIY B;  1K3R A;  3PGZ A;  3MXP A;  3TS2 A;  3E6Z X;  3MZ5 A;  1JOQ A;  4MN3 A;  4RGM A;  1LTS D;  4DNR B;  2NVY H;  3F2B A;  1SMY C;  3M3Y B;  3F1Z A;  3FDT A;  3ERS X;  4JOI A;  4IFD H;  1YHB A;  4DUZ L;  4LFA Q;  1PYW D;  5E4X A;  4ZUI A;  5JJL A;  3OYY A;  2IY5 B;  5IP7 G;  2JP1 A;  4C3H G;  4XQJ A;  4FP5 D;  3W3A A;  4A3J B;  4R8N A;  1HNW L;  2FXQ A;  4K6D A;  5M5X H;  3OOC A;  5A2Q L;  4NXM L;  4DR4 L;  1PV4 A;  1GJX A;  1SNC A;  4IJL A;  4OWX B;  3UDG A;  4AYB G;  3ND8 A;  1O7L A;  1JE4 A;  4IO9 A;  1GUN A;  2PYK A;  2NYZ D;  3QIA A;  5C3E H;  3DM3 A;  3BS1 A;  1Y1W H;  1E0B A;  4IUQ A;  3MTS A;  4CJ0 B;  1HNX Q;  4OO1 I;  4LMQ D;  1TWC H;  1WJJ A;  3HOW B;  5J1Z A;  1M8A A;  3A8K E;  3DWP A;  3D8G A;  4L6T B;  1LTL A;  3FEW X;  1RL2 A;  1NE3 A;  4IUR A;  1KD1 C;  5EJW A;  1SN8 A;  4X62 Q;  3KJO A;  5HY6 A;  1MSG A;  3HOV H;  4PMC A;  4A3G B;  4EX5 A;  3BYY B;  4KV6 A;  2HQL A;  5IYD G;  4BBR G;  5GAH C;  4X3K A;  2HQE A;  5M9O A;  2B63 G;  3HFZ B;  1TWF B;  3EIV A;  3R3O A;  5JVH 3;  1YIJ A;  3S14 H;  1HZA A;  4LUV A;  5M3F H;  2QCP X;  1MGS A;  3I8Z A;  2RCN A;  3TME A;  2A69 C;  4LFA L;  4EQN A;  4DXF A;  2I5M X;  3CW2 C;  2MQH A;  2DNE A;  4YWM A;  3TP7 A;  2DGY A;  1HFG A;  3GV6 A;  4QMG A;  3TDQ A;  2JXM B;  5CC4 A;  3PIP 3;  3U9O A;  2L11 A;  2GA4 B;  4WJ4 A;  1SJE D;  2UUA Q;  4H13 C;  3P7J A;  5ELD A;  2UXD Q;  2RHQ B;  1LT3 D;  4RHR A;  1PRT D;  4C3J B;  2A6H C;  3A54 A;  3CU7 A;  1PZI D;  1TVX A;  4DGZ A;  1U4R A;  3E9H A;  1HNX L;  3M4Y A;  1K0S A;  4DV4 Q;  1I50 B;  1PA6 A;  2JA7 G;  4LF4 Q;  2UXB Q;  1GXD C;  3MC0 B;  2K75 A;  3SK5 A;  2L15 A;  1C8C A;  1I94 Q;  5KEE A;  4X3S A;  2AUJ D;  3CMA A;  2E75 C;  3S9W A;  1ONL A;  5IP7 H;  1XMO L;  3I4M B;  1VS0 A;  4X62 L;  1PVO A;  1IL8 A;  4QL5 A;  4RGN A;  1LTG D;  1PH3 A;  1OO9 B;  4JG2 A;  2F4I A;  5IGD A;  4K0K Q;  1BXT A;  1T5E A;  3QR8 A;  1VDZ A;  3PQI A;  2UXC Q;  3RN5 A;  4TRD A;  3OW2 A;  1LTI D;  2Z4I A;  2WB1 B;  4LAA A;  1S5C D;  1DON A;  2KEN A;  2A6E D;  1H9J A;  3PIO A;  1PH1 A;  2F4V Q;  2RDG A;  2UXD L;  2E2J B;  3H6M A;  4MIU A;  4FF3 A;  1LAC A;  5EKI A;  5IYD H;  3KUP A;  2C35 B;  2V1C C;  1CHP D;  1NMF A;  3S1M H;  3T1H Q;  2B63 H;  4I65 A;  1JWS D;  4DPG A;  1KLU D;  2RVL A;  1F2L A;  2UXB L;  2QDL A;  3S17 B;  3PO3 H;  4DV2 Q;  1A63 A;  4J15 A;  5J39 A;  1GD7 A;  1XPR A;  5JAV A;  1X3Q A;  2PI2 A;  1HTP A;  1Q1B A;  5C4X G;  3WWV A;  2EE1 A;  2CH4 A;  1JOK A;  3GTO H;  2O4X A;  4J1M A;  4QF4 A;  1TS5 A;  2EDG A;  2I5L X;  3S2D H;  3KBX A;  1XNQ L;  4FF2 A;  5E1F A;  1WD1 A;  3ZJY C;  5C4J B;  3TP8 A;  3FVQ A;  2OXP A;  1KC8 C;  4JBM A;  4K0K L;  1H9S A;  1G2S A;  4IN3 A;  2R92 G;  1BBX C;  1LTB D;  3LWE A;  4F87 A;  4NB3 A;  2UXC L;  1WCM G;  2RA4 A;  4NKL A;  1CT1 D;  5LL6 S;  2OF1 A;  1SRO A;  4BY1 B;  5M3M H;  3URY A;  2EYJ A;  1KXL A;  1ESR A;  4DNI A;  1PH4 A;  4B3M Q;  2X6G A;  4JW0 A;  3I4L A;  3GTM B;  1NR2 A;  2F4V L;  2HT1 A;  1OXX K;  4BY7 H;  2M00 A;  2E2H B;  4Y52 H;  2L9H A;  5I9P A;  4YHH Q;  2A74 C;  3M4O H;  2J7Z A;  2IX1 A;  3I70 A;  1YI2 A;  4HSP A;  3LGJ A;  3T1H L;  1QWY A;  1TWH H;  3L0O A;  1PZJ D;  1F9R A;  1U5K A;  4C1N I;  1STB A;  4XTC S;  1JJG A;  2PCF B;  5C4H A;  2XVS A;  5ISR A;  1EIG A;  4POF A;  4KHP L;  4YCV A;  3VYU A;  1HR0 Q;  3H0G H;  1PFM A;  4GS3 A;  1DOM A;  2O5I C;  3PUX A;  3S1N H;  3Q0A A;  3LNN A;  2Z1C A;  5FK9 C;  4B3T L;  1VQD A;  4ZQ3 A;  2F0S A;  3N6R A;  1KDB A;  4CDD C;  4L63 B;  3CCL A;  4LK1 C;  3HOX B;  5JJK A;  5CV9 A;  2XNA C;  1B50 A;  1M90 C;  4DAY A;  3HOU H;  4A3D B;  1ENA A;  4BBS B;  3U4Z A;  3PIO 3;  4CHT B;  1ZYR C;  1CA6 A;  4B3R Q;  1D2B A;  4A93 B;  1Q12 A;  1JR0 D;  2LMC B;  1WFQ A;  1S5E D;  4I7A A;  4R8I A;  4B3M L;  1EOV A;  4G4K A;  5C4X H;  1K0R A;  4L8J A;  1TWA H;  2A19 A;  4ZYS A;  2IX0 A;  4R4O A;  2QF7 A;  1D7Q A;  2JA5 G;  4FXG C;  2QEX A;  4IPD A;  1Y1V G;  1XTD A;  4YHH L;  3K81 C;  1PTO H;  2FFK B;  3HP3 A;  4CJ1 B;  3K0Y A;  1II3 A;  4KJN A;  1QVF A;  5I6W A;  3K59 A;  2RHS B;  4A3F H;  2HCI A;  4K8J A;  5AFW A;  1CA5 A;  3UE1 A;  5FO8 B;  1WCM H;  2Z6K A;  3QOJ A;  4A3K G;  2ENB A;  1Y69 U;  3S2H B;  3VR2 A;  5DLQ E;  1MSH A;  2EY2 A;  3I56 A;  2EY1 A;  3RUZ A;  1HR0 L;  1KIX A;  4DR5 L;  2GVB A;  1K3B C;  2CWP A;  5FO9 B;  1ML0 D;  3GTK B;  4R1J A;  3S1Q B;  1S5D D;  1CQF A;  3RZO H;  1UE6 A;  4R9W A;  2DN8 A;  4R4C A;  3J81 j;  4NXN Q;  4HIM A;  1EWH A;  3C3L A;  3CRL C;  3E0E A;  4K5X A;  1QNU A;  1DGS A;  2CW0 C;  4PG3 A;  3JAM i;  4RA8 A;  3PO2 G;  4C2M B;  2K32 A;  2YYZ A;  4B3R L;  3T56 B;  3BVM A;  3TRZ A;  1XWE A;  2HIX A;  4DV3 Q;  1H9S B;  1K8O A;  1CKO A;  2CVR A;  3BDC A;  1B70 B;  1X3F A;  3CQZ H;  3DM1 A;  2OT2 A;  3BZK A;  5K36 G;  2IPK D;  3NBI A;  2JEB I;  3HOZ G;  2KCC A;  4QIW E;  1BCP D;  2KVM A;  4WJ3 M;  2PW7 A;  2F0I A;  5GAD C;  1YBY A;  3L7Z C;  1VQ8 A;  2QEJ C;  4PMW A;  2PQA A;  3A5Z B;  2LS0 1;  3QJY A;  1K8G A;  3KLS X;  4A3E G;  4OON A;  1SYF A;  1J9O A;  3GP7 A;  4JK1 C;  1B8A A;  1EIF A;  1EY5 A;  4C3I H;  2OWO A;  1SYE A;  3EFX D;  4B9W A;  1O7Z A;  2JA6 G;  1ILQ A;  5EPK A;  4FXD A;  3O13 A;  5BN4 A;  1SRU A;  5IT9 E;  4NXN L;  1Y1V H;  4OX9 Q;  5IT9 c;  4A3C H;  3ULJ A;  5H1S E;  2L1B A;  1AFP A;  1SE8 A;  2PPB C;  1S4Z A;  3BYT B;  1N36 Q;  4IPH A;  1V8Q A;  2KEE A;  3OHX C;  3CXC A;  4IFD J;  2BOS A;  3AB9 A;  4DV3 L;  4M8A A;  5EBC A;  1O80 A;  3F2U A;  1ENC A;  4KD3 A;  1IYU A;  4EQO A;  1KRS A;  5KIX A;  4XT3 B;  2KCT A;  1ET9 A;  1VQH A;  3CCQ A;  2KA7 A;  1SND A;  2RDF A;  3D4W A;  4F8M A;  4A3M B;  3IRB A;  1VQK A;  1R4P B;  1X56 A;  2CKZ B;  2EIF A;  1RDP D;  2XWJ B;  3I91 A;  2LFN A;  4RWS C;  3J7A F;  1VQ6 A;  4JBJ A;  3T51 B;  2D0O A;  4JYA Q;  3HEJ A;  4HJA A;  1IZ6 A;  1QB5 D;  2K33 A;  1VCI A;  3G6J B;  3NQT A;  5DM6 3;  3J81 i;  5LHY 1;  4ZKC B;  2BE5 D;  4RGT A;  1YJ9 A;  1FNV A;  5CV7 A;  3TP6 A;  3NHH A;  5M5W B;  2B2U C;  2MHV A;  3C1F A;  2R7Z G;  4JI6 Q;  2E2I H;  4DU9 A;  4UAI A;  4OX9 L;  5K36 H;  1WTP A;  3GTQ H;  3HOZ H;  2NVX H;  2OCE A;  2Z0S A;  3X3M A;  3G48 A;  2MUY A;  2AWO A;  3SK8 A;  1E1O A;  4WOR A;  3CC7 A;  2CWA A;  1GUO A;  2TSS A;  4IOA A;  1PZK D;  1MJC A;  3HS0 C;  5ELE A;  2UUB Q;  2F0K A;  5JEA H;  1J5E Q;  4PZ8 A;  3TZU A;  2R7D A;  2B2T C;  4TVA B;  4LFB Q;  1LTA D;  3C46 A;  2R6G A;  2A5H A;  5A2Q E;  1DYQ A;  2H5X A;  3SK6 A;  1PRT F;  3I72 A;  3H09 A;  2JA6 H;  4LF9 Q;  2XRQ D;  1WYD A;  2SOB A;  1AEX A;  5DNF A;  4DV0 L;  3GTG H;  2I0Q A;  3K8A A;  4A3I B;  1VQL A;  4JYA L;  2DUD A;  1KRT A;  4CKE A;  1SYD A;  4IFD G;  2Z4H A;  4DN4 M;  2NVQ B;  4GKK Q;  1I6H H;  1GOZ A;  5IYB H;  1VQJ A;  4TKO B;  4A76 A;  1IBL Q;  3RD4 A;  5IGC A;  4N8F A;  2FIN B;  3KF8 B;  4P2C B;  5KYL A;  3HOY B;  1TR5 A;  1WD0 A;  3L3O C;  3FKI H;  3R2I A;  3SHL A;  3W1B A;  4JI6 L;  1JJC B;  1QUQ B;  2D62 A;  2AKW B;  4CBV A;  1SXT A;  1NBW A;  1WI5 A;  3VR4 A;  4YY3 Q;  1AP0 A;  2K05 A;  3N52 A;  4C3H B;  4GN5 A;  4G7O C;  1YNJ D;  2JYO A;  1ICW A;  4B3S Q;  1V1O A;  3HKZ E;  1K83 B;  2UUB L;  1B2T A;  2Q2U A;  2JN4 A;  3NE5 B;  1J5E L;  4J6H A;  2E74 C;  1X55 A;  1WTH A;  4AYB B;  3E5S A;  4DV5 Q;  4LFB L;  4KHV A;  2FMC A;  3RLN A;  2B2W C;  5CR3 A;  1V1P B;  2N88 A;  3GD7 A;  4UDU C;  4KKT A;  4LUO A;  4M1U B;  2R7Z H;  1CHQ D;  3KK7 A;  3I2Z A;  1LYL A;  2F0E A;  3UDI A;  3HOV G;  4LF6 Q;  3J7Z C;  3VR5 A;  2K5D A;  2R61 A;  1VQI A;  2K7V A;  3NP8 A;  5CYU A;  1CZG A;  3I4N H;  2GN5 A;  4DR7 Q;  4R4T A;  1A3T A;  2PZU A;  5M3F G;  4HMJ A;  1CUK A;  2MFI A;  1ZKO A;  1IBL L;  4HN7 A;  2MNA A;  5EPL A;  3V2T A;  4BBR B;  2VUM G;  1I3Q B;  3SR1 A;  3WOE A;  1FL0 A;  2B63 B;  3U9S A;  2WAQ G;  5AJ3 Q;  2KHI A;  1D1K A;  4HED A;  3TZD A;  2VW9 A;  1VQ7 A;  3A74 A;  5EKK A;  3CC2 A;  5CBE E;  3S16 H;  4KLK A;  1AE2 A;  4U67 3;  1PYS B;  3UDX A;  1IL2 A;  2F3W A;  1YNX A;  3HKZ G;  2VZA A;  1HQR D;  2Y0S E;  3IFT A;  4HTH A;  1QE6 A;  2F0W A;  1KDC A;  1BO0 A;  3HRZ C;  4CDF C;  2WP8 J;  2M2L A;  1PTO D;  1EFI D;  2F0F A;  4DV5 L;  1OTC A;  1X3G A;  4QUF A;  1SSO A;  5CV5 A;  3GTJ H;  2EYP A;  4GNX C;  3E3X A;  3SGI A;  4X6A H;  3K5M A;  3I3C A;  2NTT A;  4LF6 L;  1N33 Q;  1VQO A;  2JA7 B;  3J80 i;  1HCZ A;  2AUK A;  4J8Q A;  3VA7 A;  4HJ7 A;  3GO5 A;  1X3E A;  2KQ3 A;  2QGQ A;  3Q22 A;  1SR3 A;  1SMY D;  4DR7 L;  2ATW A;  3MXN B;  4NDX A;  1AZP A;  2ZM6 Q;  4ZUJ A;  1BVS A;  4LF5 Q;  5C44 G;  1ICF B;  3AFQ A;  4HR7 B;  1Y8O B;  3M9B A;  2IJ0 A;  1JMC A;  1UEA B;  4KN7 C;  1A6X A;  1W2B A;  5AJ3 L;  3W5O A;  4XQN A;  1D5X C;  2ZT9 C;  3U50 C;  4DAP A;  4RHS A;  1Q1E A;  2DJG C;  2Y0S G;  2F0O A;  2EZV A;  2NUC A;  3OPO A;  1KQS A;  1K28 A;  2YV5 A;  2F0V A;  5FO7 B;  1PH9 A;  3NEN A;  3PO3 G;  3VDY A;  4FDB A;  2OQK A;  5IGF A;  3KOJ A;  1LLR D;  1W6K A;  2K04 A;  1RJT A;  4XIG S;  2VUM H;  4WJW A;  3NUC A;  4JV5 Q;  1PRT C;  1N33 L;  3L2P A;  5HGQ A;  2NVT H;  1LUZ A;  3QWN A;  3CRK C;  2OTJ A;  2HDL A;  3S1R H;  1EZ6 A;  4IPG A;  5C4X B;  2Q2I A;  4ZCK A;  1GUS A;  4H0L C;  4LF8 Q;  1L0X B;  2NB0 A;  1A15 A;  2ZTE A;  3F2C A;  4ZK9 B;  5M3M G;  4OWW B;  1D6E C;  2B3G A;  3CPF A;  2PNR C;  2LSS A;  1UE1 A;  1STE A;  2R92 B;  4ABN A;  2EY6 A;  1XPU A;  3I4O A;  3OWF A;  4PZ7 A;  2ZJP A;  4GNX B;  4BY7 G;  4PZ6 A;  1U4P A;  1OXS C;  4OL7 A;  4YCW A;  4F7X A;  4ZRZ A;  2AQ1 B;  2D5D A;  2VY3 A;  4MZ9 A;  3A7L A;  2R93 B;  3S15 B;  1SE3 A;  1EQQ A;  1G6P A;  1YEZ A;  3RLO A;  1I4G A;  5D65 A;  2YTV A;  2YU9 B;  5C44 H;  5JOB A;  1IXR A;  2A6E C;  1GHJ A;  4HID A;  3H0G G;  3GTP H;  4FVM A;  1SJH D;  4XYO A;  2ZXP A;  4A3B B;  4AQY Q;  2ICE C;  1JE5 A;  3HOW G;  3NBH B;  4JV5 L;  3RZD H;  3BDO A;  4OIJ A;  1BCP F;  3NK9 A;  5T1G A;  2UUA L;  1A0I A;  5J3B A;  3PMF A;  1TS2 A;  2XSC A;  4GLX A;  2IL8 A;  4OGQ C;  2EJG C;  3HOU G;  4LF8 L;  1UWV A;  2JK8 A;  3SE0 A;  2VQF Q;  2AWN A;  4HIK A;  3T4A C;  2O5J C;  1YNN D;  2BDO A;  2PMZ B;  4DV4 L;  1Z47 A;  4LF4 L;  3TS0 A;  4LJZ C;  5CMD A;  1I94 L;  4APV A;  4HAE A;  1HRJ A;  2O2L D;  4HMI A;  3R8B A;  5D14 A;  5M5Y H;  5LMN W;  4ILW A;  3Q24 A;  1IBK Q;  2ZJQ A;  3CPW A;  1SFO B;  2F1M A;  5GQO A;  2F0U A;  5JVG 3;  3GTL B;  4WFN 3;  4K8I A;  2WB1 E;  1SMX A;  1ROD A;  1PRT B;  1CKN B;  4X65 Q;  3T13 A;  4K2L A;  5IE8 A;  1HNZ Q;  4A3F G;  1EZ8 A;  3K58 A;  2NN6 G;  3K7A B;  2JA5 B;  2JE6 I;  4LW1 A;  4C3J G;  5KGU A;  3IKJ A;  2IW3 A;  2IT1 A;  3MXG A;  1TY2 A;  1NY4 A;  1PXU A;  3M3Y H;  2DY8 A;  3MVV A;  1ASZ A;  4AQY L;  5JPM C;  1C48 A;  3BJU A;  4G7H C;  1FNW A;  4A3K B;  1T9H A;  3K5O A;  1EYG A;  1UE7 A;  4A3J H;  3PUY A;  2Q2T A;  3OMG A;  4IJH A;  3PUW A;  4IPC A;  5C0X G;  5IGG A;  4DUY Q;  3AEV A;  1E1T A;  4MNO A;  1N8R C;  1UUP A;  2ID0 A;  1GUT A;  4DV2 L;  2KEC A;  3E0J A;  5BN3 A;  4LUZ A;  5FLM G;  1SYB A;  4H44 C;  3RR5 A;  2L12 A;  1IBK L;  3PO2 B;  2BH8 A;  1VQC A;  1FGU A;  1FJG Q;  1Y14 B;  3HOW H;  1F9Q A;  4X65 L;  1STG A;  4RAU C;  1JOR A;  1HNZ L;  5C5L A;  3CCR A;  3EJI A;  4A3G H;  2N55 A;  2XN9 C;  1EY7 A;  3H3V C;  1A2T A;  4JI1 Q;  3A8J E;  5JEA J;  1TWF H;  3HOZ B;  1Z9F A;  2B2Y C;  1UAP A;  4FNF A;  1Y8P B;  1HUM A;  4R4Q A;  4C3I G;  4IUT A;  3BVZ A;  5F2D A;  2SNS A;  1JC7 A;  1PFS A;  3TEH B;  4JI3 Q;  2WFW A;  3JC6 6;  4A3C G;  4A3E B;  2N78 A;  4CDC C;  1YVC A;  4O1N A;  1L1O C;  1GO3 E;  2JA8 B;  3OWE B;  4HCS A;  4YWK A;  3VYR A;  1YJW A;  4XT1 B;  1YHQ A;  5ELO A;  1QJO A;  5FLX c;  4DUY L;  1A3V A;  3NWS A;  1GUG A;  2NN6 H;  2J4X A;  4C3J H;  3K6O A;  2TMP A;  3JAM L;  2CCZ A;  3GTG B;  1N9W A;  5I6Y A;  4BY1 G;  1I50 H;  5ELF A;  2WKC A;  1RCV D;  2K1B A;  1OXU A;  1FJG L;  1VQE A;  3RN2 A;  1E22 A;  4KK7 A;  1R9T B;  5IGE A;  2F0T A;  1E2W A;  3K57 A;  4BS9 A;  2Z9H A;  3FPP A;  2EXD A;  3DWA A;  4A3L G;  3I4M H;  1LT4 D;  1PH5 A;  5IGB A;  5ELC A;  1FR3 A;  1MBY A;  5C3W A;  4PNY A;  2K50 A;  1I5F A;  4YIJ A;  4P72 A;  5C0X H;  1RTO A;  3ZYY X;  4IZ8 A;  5JJZ A;  5BR8 Q;  1KAW A;  1FNU A;  2NTS A;  4JI1 L;  3TP5 A;  1PHJ A;  3KFU A;  1JB3 A;  4DFA A;  3G4S A;  1MJE A;  1SYG A;  1PH8 A;  3BZC A;  5FLM H;  5J22 A;  4DV7 Q;  1EYD A;  1QVG A;  1HTL D;  4DAM A;  4Y7N B;  4K5W A;  3NEM A;  4JI3 L;  1BCP C;  1S72 A;  1EY0 A;  3CCJ A;  4I7Z C;  3V96 A;  1V9P A;  1PYB A;  3OMC A;  4KKS A;  3KF8 A;  1CFM A;  5KRU A;  3TQY A;  1SE2 A;  1HXY D;  1A8V A;  4OIK A;  4UHV A;  2E2J H;  3I55 A;  3L9A X;  2RSN A;  3HOX G;  4RG1 A;  1TQO A;  1F9P A;  4EQP A;  1PH6 A;  3J7Y W;  1A2U A;  1D5Z C;  1LV9 A;  5JEA G;  2PI2 E;  2K6A A;  2BDN A;  3MA2 B;  1WOC A;  4A3D G;  2X6L A;  1KHI A;  1QUQ A;  3H91 A;  1W3S A;  2LY7 A;  1FGB D;  4N8X 1;  1Q8K A;  2FJ2 A;  2OEO A;  2XIW A;  3A0J A;  3S17 H;  2KBN A;  1I6V C;  1MHW C;  1HUN A;  1QIL A;  1EOT A;  2K14 A;  4IUP A;  1LM0 A;  1Q8I A;  1PLF A;  1W6J A;  1U4M A;  1OXT A;  2LKV A;  1V1P A;  1WTO A;  5C4J H;  1O78 A;  2V4D A;  1PTO F;  3PCO B;  1SEB D;  1FD7 D;  1BF4 A;  2NZ1 D;  1Q86 C;  2B2U A;  5BR8 L;  5IYB G;  3G71 A;  1CZW A;  4KJO A;  2HUG A;  3FMC A;  1I4H A;  3EBE A;  1OXV A;  1TKW B;  1JQY D;  3QO2 A;  3D3R A;  3H94 A;  4DV7 L;  4BY1 H;  2NVY B;  2K28 A;  3FKI G;  2VB2 X;  3J81 L;  1MI2 A;  1PFN A;  2K5W A;  4FYD A;  1TXY A;  2H1E A;  1XMQ Q;  3BDL A;  5LMU Q;  3GTM H;  4GKJ Q;  4A3L H;  3MEH A;  3STB D;  1JT8 A;  4TSS A;  1CQV A;  2E2H H;  1HZC A;  2PQE A;  2D9U A;  4DNT B;  2B2V C;  2B2T A;  2ASB A;  5FLX L;  5M5X B;  1P16 A;  4AIM A;  5C5M A;  1Q82 C;  4BXX H;  2QKI C;  1VF7 A;  4EQ5 A;  3U58 A;  4O42 A;  4G57 A;  4L5R C;  4NP5 A;  4DV6 Q;  1G6Z A;  4QB4 A;  5C3E B;  1QNK A;  3F2D A;  1Y1W B;  2PZT A;  3CKI B;  4OO1 G;  1UE5 A;  1I4Q A;  1XJV A;  3QG1 A;  3A7A B;  1T5X D;  2HDM A;  1TWC B;  1X65 A;  2J0T D;  1BCP B;  3DHQ A;  1H9R A;  3M4P A;  1N36 L;  3I4N G;  3V05 A;  2DY7 A;  4HJ5 A;  1F2Z A;  1X9N A;  2JEA I;  4OWT B;  3HOX H;  4R4I A;  3HG9 A;  1BOS A;  3HOV B;  3BG3 A;  1Q7Y C;  2K5Q A;  4JPB W;  4MHE A;  5I9O A;  2WII B;  4A3D H;  1RIP A;  4BBS H;  4P75 A;  1RKN A;  4A93 H;  3S14 B;  1C9O A;  5L37 A;  3W1G A;  3I73 A;  3IAY A;  1PH7 A;  5M3F B;  3MXN A;  4K6L A;  5LMN Q;  1A62 A;  4DK3 C;  4DK1 A;  1STH A;  5LMU L;  4GKJ L;  3B6Y A;  2I5H A;  4PV1 C;  3CAM A;  2AQ2 B;  1L0W A;  3DWQ A;  4XDX A;  1L0Y B;  2Z8L A;  1K9M C;  3Q23 A;  2WAQ B;  1B3Q A;  2B2W A;  4XYQ A;  3CCM A;  2MJ8 A;  4JBW A;  1VF5 C;  4P71 A;  3NTH A;  3S1R B;  2LXK A;  2RCF A;  1VQ5 A;  4N9T A;  4KHZ A;  2YTX A;  4JI5 Q;  2KJX A;  4DV6 L;  4YWL A;  1XYI A;  5HGT A;  3S2H H;  5DAU A;  4UP8 A;  1IW7 D;  3TBI B;  3LX0 A;  2EOT A;  3BZD B;  5FJ8 H;  4BA2 I;  1MKH A;  2F03 A;  3KLW A;  3SXH A;  4DR6 Q;  2H4O A;  3GTK H;  3S1Q H;  1YNJ C;  4L5Q A;  3K5L A;  3OSO A;  4RMF A;  2ZXR A;  3KF6 B;  1DD2 A;  1ET6 A;  3EA6 A;  3H15 A;  3AFP A;  1NMG A;  2MPM A;  2OQ0 A;  1TWG H;  5CV4 A;  2MO1 A;  4Q5V A;  1R4Q B;  3D6C A;  4CGY B;  1CSP A;  4JI8 Q;  3UDF A;  1EEI D;  2GVA A;  4C2M H;  2Q8I B;  1G8Z D;  1JCK B;  1GKH A;  4UPA A;  1PMR A;  1PH2 A;  4OO1 H;  2ES2 A;  4LF9 L;  1JWM D;  5COR A;  1QVC A;  1S5B D;  5IIF A;  5I4D A;  4CKB A;  1TII D;  1KNE A;  1AE3 A;  3U4V A;  4LNQ A;  1TT2 A;  3DUZ A;  3TSS A;  4GKK L;  1EIH A;  4GNX A;  1LTR D;  2F0P A;  4HSV A;  3ND9 A;  2C9O A;  1XX8 A;  3A5U A;  4JI5 L;  3KLS A;  1Z7T A;  4IQZ A;  5BN5 A;  5GAE C;  1HNW Q;  2JQO A;  2ICI A;  4CJ2 C;  3NTK A;  3S1M B;  3SEB A;  1E2V A;  2JA9 A;  1NSN S;  1BNZ A;  4A75 A;  1WVL A;  4RGO S;  1LT5 D;  4LF7 Q;  2VQE Q;  4RCO A;  3PO3 B;  2P5Z X;  2G9D A;  4AYB E;  2B8G A;  3MWY W;  3SVM A;  4DR6 L;  3J7A V;  2E76 C;  3OIQ A;  4YY3 L;  3GTO B;  4KN4 C;  1V43 A;  1RHP A;  3NWT A;  1AH9 A;  3J80 L;  1BKB A;  4B3S L;  2Q8R E;  4ID6 A;  3S2D B;  1X3P A;  5IWA Q;  2A68 D;  5KNB A;  1PTO C;  2UU9 Q;  3NBH A;  4A3I G;  1HQM C;  1ZEQ X;  5IYC G;  1K8A C;  4UY8 C;  2ZTC A;  1B3A A;  1U9R A;  4JI2 Q;  2C5C A;  4N9P A;  2RQX A;  2EYO A;  3HOY G;  4DAV A;  1ENF A;  3FRP B;  5M3M B;  3VA5 A;  3CME A;  3CCS A;  3A56 A;  3ER0 A;  3AYH B;  4A3M H;  1IHZ A;  2CQO A;  3ERQ A;  1BUV T;  5JJI A;  4L5T A;  4BY7 B;  3D6W A;  2QDB A;  1HHV A;  3WOF A;  5A35 A;  3EN2 A;  5ELB A;  3M4O B;  4GOP C;  5EPJ A;  1L2F A;  1E7Z A;  1CKN A;  1BBU A;  4DR3 Q;  1JJ2 A;  1MIU A;  2IHE A;  1TWH B;  4H7B A;  5T1I A;  1BDO A;  2F0Q A;  3ERO A;  4OHJ A;  4LF7 L;  1RF2 D;  2VQE L;  2ZTD A;  2JSO A;  5M5W H;  4ZKB B;  2EJF C;  2LXJ A;  1HJP A;  2B29 A;  2ZXO A;  2N8N A;  3H0G B;  3PV0 A;  4KTA A;  1H9K A;  2ALY B;  5D3D A;  3S1N B;  2Q8T A;  1EU4 A;  1TU2 B;  4EGV A;  3H3V I;  5IWA L;  2UU9 L;  2G9H D;  2XWB B;  4JOI C;  2KED A;  4DR1 Q;  1DM0 B;  3NSW A;  1Q3L A;  1XMO Q;  3AQQ A;  1NAP A;  1VQP A;  3HOU B;  4JI2 L;  2VXW A;  1B1Z A;  3CP0 A;  2CHB D;  3QB3 A;  2YTY A;  1N32 Q;  1Z6H A;  1WTR A;  3SK4 A;  3DLL A;  1TS4 A;  1X54 A;  1RTN A;  5E3F A;  3OIP A;  5G3L D;  3DMU A;  1B53 A;  1CKM A;  1TWA B;  1CK1 A;  2E8G A;  2RBM A;  3ULP A;  4DK6 C;  1K73 C;  2ZM6 L;  2FHT A;  2QW7 A;  2A69 D;  4LF5 L;  2F3I A;  1BR9 A;  2OTL A;  3AMU A;  4CDE C;  2KCM A;  4A3I H;  1PTO B;  1HFN A;  5IYC H;  4FF4 A;  4Z9C B;  4CKC A;  4DR3 L;  1VQ4 A;  2NVQ H;  4IFD I;  5IOC A;  4A3F B;  1DXM A;  1HA5 A;  4U68 A;  3HGB A;  1WCM B;  3HOY H;  3T1Y Q;  1CM9 A;  4JCV E;  3P1H A;  3T16 A;  4A3J G;  1CTM A;  2BA1 A;  2A6H D;  4KKU A;  1Y8N B;  3C2P A;  3ONA B;  4UP7 A;  2XRS D;  1CI3 M;  3RZO B;  1O7I A;  5C0X J;  4ALP A;  2BCO A;  4DR1 L;  4C3H H;  2NBF A;  4K2K A;  1STN A;  2A8V A;  1XNQ Q;  1F9S A;  3RLF A;  1K83 H;  3KDF B;  3GDE A;  3PSI A;  4GOP B;  2DJF C;  1SBB B;  2WV6 D;  2AQ3 B;  1N32 L;  1IYJ B;  4HJ8 A;  1JOO A;  4Q0F A;  1RD9 D;  1Q81 C;  3I90 A;  3CQZ B;  4IOC A;  4QUC A;  1KLG D;  5EGT A;  1UNS A;  1YNN C;  4A3G G;  3ITP A;  4DR2 Q;  2CH4 W;  3K5N A;  4OEM B;  3DXJ C;  1B9M A;  1GVP A;  3OTO Q;  1SNO A;  2N49 A;  1VQG A;  3MFG A;  3JAM E;  3JAM c;  4A4I A;  4ODG A;  3CC4 A;  3QOL A;  1U0L A;  5CV6 A;  2KHJ A;  3T1Y L;  4BBR H;  4UP9 A;  1C7Y A;  1I3Q H;  1PDQ A;  4K14 A;  4GZY C;  1B44 D;  5FOB B;  4C3I B;  4XXE A;  2F0D A;  4QJF A;  1F77 A;  2VB3 X;  4H02 A;  5IP9 G;  4KHP Q;  3FPU B;  2WAC A;  4K5V A;  2E5L Q;  1Y1V B;  4DV1 Q;  4B3T Q;  1XXG A;  1AW7 A;  1KL9 A;  4X3U A;  5D3I B;  1K8M A;  1DOL A;  2PMZ E;  1E3P A;  3DEO A;  1I4R A;  4QGU A;  3BU2 A;  4KY7 A;  3R2T A;  4OEL B;  3I4M G;  4PMB A;  3HKS A;  4V0B A;  1IBM Q;  3CCU A;  4EVO A;  2VQF L;  2K5H A;  4DR2 L;  3VR3 A;  2JA7 H;  3OTO L;  2B2Y A;  2MGS A;  2R93 G;  2B39 A;  1J6Q A;  1G51 A;  4RCN A;  3KJP A;  2IHF A;  4KI0 A;  1WTW A;  1EFW A;  5I2X A;  1VQM A;  1B4O A;  3G7L A;  2PW5 A;  2WB1 G;  1L1O A;  4NMZ A;  1D1I A;  4L5S A;  1LT6 D;  4A3B G;  2I07 B;  1ASY A;  1STY A;  2KCN A;  2QIL A;  1NTG A;  3P75 A;  2L4N A;  3K80 C;  3EVQ A;  2MO0 A;  1H9M A;  3CCV A;  1NUC A;  2E2I B;  3EQL C;  5EAY A;  2EQS A;  4DR5 Q;  2E5L L;  1J8I A;  2JJQ A;  1EQV A;  5EBD A;  3GTQ B;  5KYI A;  4DV1 L;  1AZQ A;  4PQX A;  2NVX B;  4JI0 Q;  3NXW A;  1SAP A;  2PZW A;  1VMP A;  3J81 E;  2MP1 A;  4TQU S;  1O7Y A;  1PFB A;  1KAB A;  3J81 c;  1VQN A;  3E9I A;  1GHK A;  4QQB X;  4XQQ A;  3T53 B;  1EY8 A;  1G91 A;  4NPS A;  2K5N A;  4QY7 A;  1IBM L;  5FLX E;  1ZYR D;  1TY0 A;  4DF7 A;  1EWI A;  3MFY A;  2JA6 B;  3X3N A;  2KOL A;  5IP9 H;  4S3S A;  1SLJ A;  1CSQ A;  4YCU A;  4IUV A;  3CCE A;  2K03 A;  3TRE A;  1S40 A;  2R3Z A;  2RF4 A;  5EQ0 A;  2VNU D;  1XTC D;  2EY5 A;  1QCB D;  3PUZ A;  4IAL A;  4RH6 A;  5HUR A;  3MAQ A;  2F0M A;  1NCV A;  1I6H B;  1V1Q A;  2R92 H;  1IYV A;  4JI7 Q;  4HCE A;  1FYC A;  2ZJR A;  2X69 A;  3FKI B;  4DKA C;  1EY9 A;  4BWG B;  2IWH A;  4E6I A;  4QIW B;  2AMC B;  2R93 H;  3S15 H;  2HHH Q;  4DXG A;  2AHO B;  3S24 A;  4BXX G;  4GLV B;  5CV8 A;  4ME3 A;  4JI0 L;  3D31 A;  5GRO A;  1DOK A;  2L0C A;  1ESF A;  1DCZ A;  1SE4 A;  3ULL A;  2BH2 A;  4DA2 A;  4V19 0;  2YU9 H;  2K52 A;  3F8T A;  1TWG B;  1YHA A;  3UE0 A;  2D2C C;  4A3B H;  5E4W C;  4QCL A;  1I4X A;  1X6O A;  5GAG C;  2CW0 D;  2R7Z B;  2EJM A;  1N34 Q;  1TS3 A;  5DM7 3;  1C4Q A;  3CF5 A;  1Q90 A;  2WIN B;  2Z6K C;  1HZ9 A;  3K0X A;  4GN3 B;  3RMH A;  1P8L A;  2K4K A;  2EXZ A;  5C4Z A;  4BBS G;  4HIO A;  2L5T A;  4C56 C;  1E24 A;  2F3V A;  3OW7 A;  5DEH A;  4A93 G;  3I4N B;  4P73 A;  3KF6 A;  2EYM A;  2BA0 A;  3Q6S A;  1EYC A;  1EY6 A;  2DNC A;  2B2V A;  2F0N A;  5NUC A;  1VQB A;  4JI7 L;  1VQ9 A;  3SDZ A;  1C0A A;  1SFO H;  2HIV A;  2F0H A;  1IKM A;  3G6E A;  2B8F A;  3GTL H;  4KY6 A;  3WDN A;  1L1O B;  1A3U A;  1LAB A;  3ICE A;  1JWU D;  4ZAI A;  3IL8 A;  4LFC Q;  2JA8 G;  3TN2 A;  4X64 Q;  3D4D A;  3A55 A;  4DK0 A;  2HHH L;  3S16 B;  2HD3 A;  2CFM A;  1EL0 A;  4B08 A;  1KDA A;  1DZ1 A;  3CD6 A;  2CQA A;  3M85 A;  3K7A H;  2JA5 H;  2RDH A;  2K5V A;  2NN6 I;  4KY5 A;  4GLA C;  3R93 A;  3IFD A;  1X32 A;  1QOH A;  1STA A;  5FJ8 G;  4ZLT F;  4B9X A;  2F0J A;  3STB C;  4P74 A;  4WRD A;  1EEF D;  1F2Y A;  4BA1 I;  4HJ9 A;  3GTJ B;  2XGT A;  4A3K H;  3GV3 A;  2SNM A;  4JVZ A;  1N34 L;  1GM5 A;  5TSS A;  3FHW A;  2A1A A;  5CGK A;  4G7Z C;  4DAY B;  5IOD A;  2BE5 C;  2HCC A;  3D4R A;  4GN4 B;  3RNU A;  3FP9 A;  1YIT A;  1HH2 P;  2NZH A;  1DJR D;  3LWU A;  1QG7 A;  5C0X I;  4RKB A;  4IUN A;  5EKL A;  4KD4 A;  3UI2 A;  2KHS A;  1Q46 A;  3HZX A;  4LWC A;  3VYS A;  2UUC Q;  3NQI A;  4DV0 Q;  1VMC A;  3PUV A;  1HA6 A;  1AN8 A;  4X66 Q;  3DEP A;  3PO2 H;  2PO4 A;  3J80 E;  3CHB D;  2VS1 A;  3J80 c;  4O2D A;  4LFC L;  1HPC A;  3PF4 A;  4X64 L;  1M4V A;  4MTK A;  3W2D A;  5C6A A;  1WTX A;  2K01 A;  4AH6 A;  1VQF A;  1JIC A;  1VQA A;  1EU3 A;  1G2T A;  2VL6 A;  3MXU A;  1SDF A;  2Z6B A;  5G3L F;  1XMQ L;  1F2M A;  1LO5 D;  1IKL A;  2F0G A;  1SYC A;  2SEB D;  1E2Z A;  1D5M C;  1U4L A;  4RFB A;  2EPB A;  2VUM B;  5C3X A;  1YZ6 A;  1B7Y B;  5KND A;  4IUU A;  1BBW A;  4A3E H;  4ULL A;  1KTK A;  2EYH A;  2RSO A;  2IX3 A;  2JA8 H;  3C1E A;  1H95 A;  2R7F A;  2NVT B;  1EWC A;  3MEF A;  1XPO A;  2XTI A;  3D0F A;  1I4P A;  1NR4 A;  1IW7 C;  3HKZ B;  4JI4 Q;  4F88 A;  3K7U C;  2EYL A;  3Q8D A;  2UUC L;  4NW2 A;  2A73 B;  3NPP A;  2D0P A;  4X3T A;  3KYH C;  4POG A;  2F52 A;  2Q2H A;  4X66 L;  5E7N A;  2QA4 A;  3BVG A;  3NTI A;  1EYA A;  4A3M G;  5KNC A;  5COY A;  1R9T H;  3J7A 5;  1JB7 A;  3A8I E;  1EUJ A;  1XNR Q;  1EQR A;  3AU7 A;  1EQT A;  1KAA A;  5K5P A;  1ZXT A;  2I46 A;  2FMM A;  3KLR A;  1SNM A;  2PQA B;  1SNQ A;  1ILP A;  4JC0 A;  2WAQ E;  3GQB A;  5LL6 X;  2NWG A;  3M7G A;  5IT9 L;  2EYF A;  2N3S A;  5LMN L;  4C1N K;  1D8L A;  5FKA C;  5JPN C;  4O0A A;  5C3E G;  3P20 A;  1NNX A;  5CBA E;  5C44 B;  1Y1W G;  1S3O A;  4KMU C;  3PF5 A;  1EY4 A;  4Y7N H;  3GTP B;  3MHB A;  3KBG A;  4FO2 A;  1S5F D;  5ELN A;  1HR0 W;  4DUZ Q;  4ME5 A;  4OXP A;  3RZD B;  1KNA A;  1FVI A;  2KUM A;  2L55 A;  5I2Y A;  2Y0S B;  1MD2 D;  3M7N A;  1SNP A;  5IY0 A;  4NXM Q;  4JI4 L;  1HZB A;  4DR4 Q;  3H3V H;  2SDF A;  1GUW A;  4FXK C;  1G29 1;  1WTQ A;  3VR6 A;  4MTN A; 
#chains in the Genus database with same CATH homology
 1NJI C;  1VQK A;  1Z9F A;  3IRB A;  1M1K C;  3PIP A;  1X56 A;  2CKZ B;  2EIF A;  4R4Q A;  1O7I A;  1UEB A;  5C0X J;  4ALP A;  4DR1 L;  1VQ6 A;  4JBK A;  3I7F A;  4C3H H;  4JBJ A;  1QZH A;  2D0O A;  1XNR L;  3KDF A;  3NEL A;  1PFS A;  4GOP A;  2A8V A;  1XNQ Q;  3TEH B;  4JI3 Q;  3RLF A;  1K83 H;  3KDF B;  2WFW A;  3JC6 6;  4A3C G;  4JYA Q;  2N78 A;  3GDE A;  3PSI A;  1YVC A;  4HJA A;  2PNH A;  4GOP B;  1IZ6 A;  1L1O C;  1VCI A;  1GO3 E;  4YWK A;  1YJW A;  4JI8 L;  3J81 i;  1YHQ A;  5ELO A;  1N32 L;  3M4Q A;  1QZG A;  1YJ9 A;  1IYJ B;  5FLX c;  2NZO A;  4DUY L;  1YJN A;  4HJ8 A;  1EIY B;  1Q81 C;  1K3R A;  3PGZ A;  2R7Z G;  4C3J H;  3TS2 A;  4IOC A;  4A3G G;  4JI6 Q;  2E2I H;  4DR2 Q;  3OTO Q;  2CCZ A;  1GVP A;  1N9W A;  2NVY H;  4OX9 L;  3F2B A;  2N49 A;  4BY1 G;  1I50 H;  3F1Z A;  3GTQ H;  1VQG A;  3HOZ H;  3ERS X;  4JOI A;  1OXU A;  2NVX H;  2OCE A;  1YHB A;  2Z0S A;  1FJG L;  1VQE A;  3JAM c;  4DUZ L;  3RN2 A;  1E22 A;  3G48 A;  4LFA Q;  4A4I A;  2AWO A;  1E1O A;  3CC7 A;  2CWA A;  3CC4 A;  4IOA A;  5JJL A;  3OYY A;  1U0L A;  1MJC A;  2EXD A;  4A3L G;  2IY5 B;  3I4M H;  5IP7 G;  1PH5 A;  2UUB Q;  2KHJ A;  3T1Y L;  4BBR H;  1J5E Q;  4PZ8 A;  4UP9 A;  2FXQ A;  5M5X H;  1HNW L;  2K50 A;  1I5F A;  1I3Q H;  2R7D A;  1C7Y A;  4NXM L;  4DR4 L;  4TVA B;  1PV4 A;  4LFB Q;  4P72 A;  2R6G A;  4IJL A;  4OWX B;  3UDG A;  5BR8 Q;  4AYB G;  1KAW A;  4JI1 L;  1PHJ A;  3KFU A;  4IO9 A;  2H5X A;  2JA6 H;  3G4S A;  4LF9 Q;  5C3E H;  4QJF A;  3CCQ A;  3DM3 A;  1PH8 A;  1MJE A;  3BZC A;  1Y1W H;  4H02 A;  5FLM H;  5IP9 G;  4KHP Q;  1WYD A;  4DV7 Q;  1HNX Q;  2E5L Q;  4OO1 I;  1QVG A;  4DAM A;  4DV0 L;  3GTG H;  2I0Q A;  3K8A A;  4DV1 Q;  1TWC H;  3NEM A;  1WJJ A;  4JI3 L;  1VQL A;  2DUD A;  1KRT A;  4B3T Q;  4JYA L;  1KL9 A;  1LTL A;  1S72 A;  3CCJ A;  1RL2 A;  1NE3 A;  4IFD G;  1V9P A;  1PYB A;  1KD1 C;  4GKK Q;  1I6H H;  5IYB H;  2PMZ E;  1VQJ A;  1E3P A;  4A76 A;  3TQY A;  4QGU A;  1SN8 A;  3BU2 A;  1A8V A;  2E2J H;  4X62 Q;  1IBL Q;  3I55 A;  3KF8 B;  3KJO A;  3HOX G;  5HY6 A;  3HOV H;  4RG1 A;  4EX5 A;  3I4M G;  3HKS A;  1PH6 A;  2HQL A;  2PI2 E;  5JEA G;  5IYD G;  3FKI H;  4BBR G;  3CCU A;  1WOC A;  3W1B A;  5GAH C;  1IBM Q;  4JI6 L;  4A3D G;  2VQF L;  2K5H A;  4DR2 L;  1KHI A;  1QUQ A;  2JA7 H;  3OTO L;  2B63 G;  3HFZ B;  3S14 H;  3EIV A;  1YIJ A;  1JJC B;  1W3S A;  1HZA A;  1QUQ B;  2D62 A;  2AKW B;  1Q8K A;  4LUV A;  2R93 G;  3A0J A;  5M3F H;  3S17 H;  2KBN A;  1NBW A;  1WI5 A;  2RCN A;  4YY3 Q;  1J6Q A;  1G51 A;  3KJP A;  4LFA L;  2IHF A;  2K14 A;  4KI0 A;  1LM0 A;  4GN5 A;  2I5M X;  3CW2 C;  1EFW A;  2MQH A;  4B3S Q;  4YWM A;  1VQM A;  3HKZ E;  2DGY A;  2UUB L;  2WB1 G;  1L1O A;  2Q2U A;  1OXT A;  1J5E L;  4L5S A;  1X55 A;  4WJ4 A;  4A3B G;  4DV5 Q;  5C4J H;  4LFB L;  2UUA Q;  3RLN A;  3PCO B;  2UXD Q;  2RHQ B;  3GD7 A;  1ASY A;  1Q86 C;  4LUO A;  5BR8 L;  5IYB G;  3G71 A;  2R7Z H;  1NTG A;  3K80 C;  3EBE A;  1OXV A;  2MO0 A;  3CCV A;  3I2Z A;  1LYL A;  3UDI A;  3HOV G;  4LF6 Q;  3J7Z C;  4DV7 L;  5EAY A;  2EQS A;  4DR5 Q;  1HNX L;  3E9H A;  2E5L L;  4BY1 H;  3FKI G;  1VQI A;  2JJQ A;  4DV4 Q;  1PA6 A;  2JA7 G;  4DV1 L;  4LF4 Q;  2UXB Q;  2K75 A;  3I4N H;  2GN5 A;  4DR7 Q;  1TXY A;  2L15 A;  4R4T A;  1XMQ Q;  4JI0 Q;  5LMU Q;  1I94 Q;  3GTM H;  4GKJ Q;  4TQU S;  5M3F G;  3CMA A;  1CUK A;  3J81 c;  4A3L H;  5IP7 H;  3STB D;  1VQN A;  1JT8 A;  1XMO L;  2E2H H;  1VS0 A;  1HZC A;  2MFI A;  4X62 L;  3E9I A;  1IBL L;  2MNA A;  1PVO A;  4QL5 A;  2ASB A;  4QQB X;  1P16 A;  2VUM G;  1PH3 A;  1FL0 A;  4NPS A;  2K5N A;  4QY7 A;  4JG2 A;  4AIM A;  1IBM L;  2WAQ G;  4K0K Q;  5AJ3 Q;  2KHI A;  1Q82 C;  1VQ7 A;  4BXX H;  4EQ5 A;  2VW9 A;  3A74 A;  3U58 A;  3CC2 A;  1EWI A;  3S16 H;  4L5R C;  4DV6 Q;  4KLK A;  5IP9 H;  1AE2 A;  3F2D A;  1PYS B;  2UXC Q;  3UDX A;  3RN5 A;  1IL2 A;  1SLJ A;  4OO1 G;  3OW2 A;  1CSQ A;  4YCU A;  1YNX A;  3CCE A;  3HKZ G;  1UE5 A;  3TRE A;  1XJV A;  1S40 A;  2VZA A;  2Y0S E;  2RF4 A;  2VNU D;  1X65 A;  2KEN A;  3PUZ A;  3PIO A;  3M4P A;  1PH1 A;  1N36 L;  2F4V Q;  3I4N G;  2WP8 J;  4HJ5 A;  4DV5 L;  1OTC A;  1V1Q A;  1X3G A;  1X9N A;  2JEA I;  2R92 H;  4OWT B;  3GTJ H;  4R4I A;  3HOX H;  4JI7 Q;  2UXD L;  4GNX C;  3SGI A;  1Q7Y C;  4X6A H;  5IYD H;  2ZJR A;  4A3D H;  2C35 B;  2V1C C;  1RIP A;  4BBS H;  4P75 A;  1NMF A;  4DKA C;  3S1M H;  4LF6 L;  1N33 Q;  3T1H Q;  1VQO A;  2B63 H;  3J80 i;  4A93 H;  2AMC B;  4DPG A;  1C9O A;  2R93 H;  3W1G A;  3S15 H;  4HJ7 A;  2HHH Q;  2AHO B;  3GO5 A;  2UXB L;  1X3E A;  3S24 A;  2QGQ A;  1PH7 A;  4GLV B;  4BXX G;  5LMN Q;  3PO3 H;  1A62 A;  4DK3 C;  4DV2 Q;  1SR3 A;  4DR7 L;  4J15 A;  4ME3 A;  4JI0 L;  3D31 A;  5GRO A;  2ATW A;  1GD7 A;  3MXN B;  5LMU L;  2PI2 A;  3B6Y A;  1XPR A;  4GKJ L;  1Q1B A;  5C4X G;  3WWV A;  3ULL A;  2BH2 A;  2ZM6 Q;  2I5H A;  2K52 A;  2YU9 H;  3GTO H;  1BVS A;  3CAM A;  3F8T A;  1L0W A;  4LF5 Q;  1YHA A;  5C44 G;  2I5L X;  3UE0 A;  3S2D H;  1K9M C;  1XNQ L;  3AFQ A;  4A3B H;  3M9B A;  3ZJY C;  1X6O A;  5GAG C;  3CCM A;  1JMC A;  1KC8 C;  4JBW A;  4JBM A;  4K0K L;  1W2B A;  4P71 A;  5AJ3 L;  3W5O A;  2LXK A;  1VQ5 A;  2R92 G;  4KHZ A;  1N34 Q;  2YTX A;  4JI5 Q;  4DV6 L;  4YWL A;  3U50 C;  3CF5 A;  4NB3 A;  3S2H H;  4UP8 A;  1Q1E A;  1WCM G;  2Z6K C;  2Y0S G;  2UXC L;  1HZ9 A;  3K0X A;  1SRO A;  4GN3 B;  1P8L A;  2K4K A;  5M3M H;  4BBS G;  1KQS A;  4HIO A;  2YV5 A;  1E24 A;  5FJ8 H;  4BA2 I;  1KXL A;  1MKH A;  3KLW A;  4DNI A;  1PH4 A;  4B3M Q;  4DR6 Q;  4A93 G;  4P73 A;  1PH9 A;  3KF6 A;  3GTK H;  3S1Q H;  3NEN A;  4L5Q A;  4RMF A;  2F4V L;  3PO3 G;  2BA0 A;  3KF6 B;  3VDY A;  2HT1 A;  1OXX K;  4FDB A;  2OQK A;  3H15 A;  3KOJ A;  4BY7 H;  3AFP A;  1NMG A;  4JI7 L;  1VQB A;  4Y52 H;  1VQ9 A;  2OQ0 A;  1TWG H;  1C0A A;  4XIG S;  2VUM H;  1SFO H;  2HIV A;  2MO1 A;  4YHH Q;  3G6E A;  3GTL H;  3M4O H;  2IX1 A;  1L1O B;  1CSP A;  1YI2 A;  4JI8 Q;  1A63 A;  4JV5 Q;  3LGJ A;  3UDF A;  3ICE A;  2GVA A;  3L2P A;  4C2M H;  3T1H L;  4LFC Q;  5HGQ A;  1TWH H;  1N33 L;  1LUZ A;  2JA8 G;  2NVT H;  3L0O A;  4X64 Q;  1GKH A;  2OTJ A;  2HHH L;  1U5K A;  3S1R H;  4IPG A;  4UPA A;  4XTC S;  1PH2 A;  1JJG A;  2Q2I A;  2CFM A;  2ES2 A;  4LF9 L;  4LF8 Q;  3CD6 A;  4POF A;  3M85 A;  3K7A H;  1QVC A;  4YCV A;  2JA5 H;  4KHP L;  2K5V A;  1HR0 Q;  2NN6 I;  3H0G H;  2ZTE A;  3F2C A;  4GS3 A;  4GLA C;  3PUX A;  3S1N H;  5M3M G;  4OWW B;  5FJ8 G;  1AE3 A;  2B3G A;  3CPF A;  3U4V A;  4B3T L;  1VQD A;  2LSS A;  3STB C;  4LNQ A;  4P74 A;  1UE1 A;  3CCL A;  4BA1 I;  4HJ9 A;  4GKK L;  2XGT A;  5JJK A;  4GNX A;  1XPU A;  3I4O A;  4A3K H;  4PZ7 A;  2ZJP A;  4GNX B;  1M90 C;  4PZ6 A;  4BY7 G;  1N34 L;  1GM5 A;  1OXS C;  3A5U A;  4JI5 L;  5GAE C;  4YCW A;  3HOU H;  1HNW Q;  3FHW A;  2A1A A;  2JQO A;  4DAY B;  3U4Z A;  4MZ9 A;  2VY3 A;  4GN4 B;  3RNU A;  4B3R Q;  2JA9 A;  3FP9 A;  1Q12 A;  1HH2 P;  2NZH A;  1YIT A;  4A75 A;  1WFQ A;  1EQQ A;  1G6P A;  4LF7 Q;  1YEZ A;  3RLO A;  5C0X I;  2VQE Q;  4B3M L;  4DR6 L;  4AYB E;  1EOV A;  5C4X H;  1K0R A;  1TWA H;  1Q46 A;  2A19 A;  2YTV A;  4LWC A;  4YY3 L;  2UUC Q;  5C44 H;  1V43 A;  2IX0 A;  4R4O A;  4DV0 Q;  1IXR A;  1AH9 A;  2JA5 G;  1D7Q A;  2QEX A;  1BKB A;  4B3S L;  3PUV A;  4IPD A;  3H0G G;  1Y1V G;  4HID A;  3GTP H;  5IWA Q;  4X66 Q;  1XTD A;  2UU9 Q;  4YHH L;  3K81 C;  4AQY Q;  3PO2 H;  4A3I G;  1JE5 A;  2VS1 A;  3HOW G;  5IYC G;  3NBH B;  1K8A C;  4UY8 C;  2ZTC A;  3J80 c;  3RZD H;  4O2D A;  1QVF A;  4JV5 L;  4LFC L;  2UUA L;  1A0I A;  2RHS B;  5J3B A;  3PF4 A;  4A3F H;  4X64 L;  3UE1 A;  4JI2 Q;  4GLX A;  1WCM H;  2Z6K A;  4A3K G;  3HOY G;  5DLQ E;  3HOU G;  3I56 A;  4LF8 L;  1UWV A;  2JK8 A;  2VQF Q;  2AWN A;  4HIK A;  1HR0 L;  1KIX A;  3CME A;  4DR5 L;  3CCS A;  4AH6 A;  2GVB A;  1VQF A;  3ER0 A;  3AYH B;  2CWP A;  4DV4 L;  1VQA A;  1Z47 A;  4A3M H;  2CQO A;  2VL6 A;  4R1J A;  3TS0 A;  4LF4 L;  3RZO H;  1UE6 A;  1XMQ L;  1I94 L;  5JJI A;  4L5T A;  4R4C A;  4APV A;  3J81 j;  4NXN Q;  4HIM A;  5M5Y H;  5LMN W;  1IBK Q;  2ZJQ A;  3CPW A;  1YZ6 A;  1B7Y B;  5GQO A;  3E0E A;  3EN2 A;  1BBW A;  4GOP C;  1L2F A;  1E7Z A;  4A3E H;  1DGS A;  1CKN A;  2WB1 E;  1BBU A;  4PG3 A;  3JAM i;  1SMX A;  4DR3 Q;  1JJ2 A;  2JA8 H;  1MIU A;  3PO2 G;  2IHE A;  4X65 Q;  1CKN B;  1H95 A;  2YYZ A;  2R7F A;  4B3R L;  5IE8 A;  3MEF A;  3TRZ A;  1XPO A;  1HNZ Q;  2HIX A;  2XTI A;  4LF7 L;  4DV3 Q;  3D0F A;  2VQE L;  4A3F G;  2ZTD A;  5M5W H;  1CKO A;  4JI4 Q;  2LXJ A;  3K7U C;  1B70 B;  1HJP A;  1X3F A;  2B29 A;  2JE6 I;  2NN6 G;  3CQZ H;  3Q8D A;  4LW1 A;  2N8N A;  2UUC L;  3PV0 A;  2ALY B;  2D0P A;  2IT1 A;  3BZK A;  3KYH C;  4POG A;  2F52 A;  2Q2H A;  3H3V I;  3M3Y H;  1NY4 A;  4X66 L;  5IWA L;  5E7N A;  2UU9 L;  5K36 G;  2QA4 A;  1ASZ A;  2JEB I;  4AQY L;  3HOZ G;  4A3M G;  4JOI C;  4QIW E;  4DR1 Q;  1R9T H;  3J7A 5;  3BJU A;  1XMO Q;  1JB7 A;  1EUJ A;  1XNR Q;  4WJ3 M;  3AQQ A;  1EQR A;  5GAD C;  1T9H A;  1YBY A;  3L7Z C;  1VQP A;  1VQ8 A;  1EYG A;  4JI2 L;  1UE7 A;  4A3J H;  3CP0 A;  3PUY A;  4PMW A;  2Q2T A;  2PQA A;  3A5Z B;  1K8G A;  4A3E G;  2PQA B;  2YTY A;  4OON A;  1N32 Q;  4IJH A;  3PUW A;  4IPC A;  4JC0 A;  5C0X G;  4DUY Q;  2WAQ E;  3AEV A;  3DLL A;  1X54 A;  1B8A A;  1EIF A;  4C3I H;  2N3S A;  1E1T A;  4MNO A;  1N8R C;  2ID0 A;  2OWO A;  5LMN L;  4DV2 L;  1D8L A;  1CKM A;  2JA6 G;  4O0A A;  5C3E G;  2E8G A;  1SRU A;  4LUZ A;  4DK6 C;  1S3O A;  4NXN L;  5FLM G;  3ULP A;  1Y1W G;  1K73 C;  2ZM6 L;  1Y1V H;  3RR5 A;  3PF5 A;  5IT9 c;  4OX9 Q;  4A3C H;  4LF5 L;  4Y7N H;  1IBK L;  2F3I A;  2OTL A;  3ULJ A;  2KCM A;  5H1S E;  4A3I H;  1SE8 A;  2BH8 A;  1VQC A;  1FGU A;  5IYC H;  1Y14 B;  5ELN A;  4DUZ Q;  1N36 Q;  1HR0 W;  1FJG Q;  3HOW H;  4OXP A;  4IPH A;  4DR3 L;  1VQ4 A;  2NVQ H;  1FVI A;  4X65 L;  4IFD I;  4IFD J;  3CXC A;  1HNZ L;  3HOY H;  4DV3 L;  3T1Y Q;  3CCR A;  3M7N A;  4A3G H;  4JCV E;  5IY0 A;  4NXM Q;  4JI4 L;  1HZB A;  4DR4 Q;  4A3J G;  3H3V H;  1KRS A;  2BA1 A;  2KCT A;  4JI1 Q;  1G29 1;  1VQH A;  5JEA J;  1TWF H;  4UP7 A;  4MTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...