4DNIA

Structure of editosome protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
257
structure length
257
Chain Sequence
TILPQAPQYHLDVAPNAPEEGEVAAHWRCVNHCVMLGVVQNIQEGFVFEDKVLQFTLITDFEGPSPGDPDKDFHTVRVFDSDYSSRVKEQLRDGEWFLVTGRLRMVPQYDGSMRKYYHYPVIQVHPGCGSVLKVKLASGAGHMKSVNSVTLVGVVHDIQSGFVYEDAVTQFTLTTTSIDTTHPTQEVVVEKDHHTIRCFGELFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNKHFYFPYIQVQPPHGQVAVIHGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Explorations of linked editosome domains leading to the discovery of motifs defining conserved pockets in editosome OB-folds.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Protein binding, rna binding protein
molecule keywords Fusion protein of RNA-editing complex proteins MP42 and MP18
total genus 47
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dniA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dniA02
2WP8J 4P75A 2N78A 1PV4A 2F4VQ 4DR1L 1L2FA 1HNZQ 3TS2A 2UXBL 1GO3E 1HZ9A 1NBWA 2NVQH 5M3MG 4DR5L 1WFQA 4DR4Q 1VQHA 2A1AA 3F8TA 3PUXA 1R9TH 3J7A5 5IY0A 4GNXA 4BBSG 4HJ9A 1U5KA 1EQQA 1B8AA 1UE7A 2XTIA 2LSSA 1W3SA 1MIUA 2Q2HA 3FKIG 4EX5A 4LFAQ 1NMGA 1XPOA 2WAQG 2K5HA 4GLVB 1PH5A 2K50A 4AQYL 4DNIA 2WB1E 2UUAL 1X6OA 4AYBE 1X9NA 2WFWA 2E2JH 1YHQA 1WCMG 3HOWG 2RHQB 2JEAI 2BH8A 2YTVA 3ULLA 2E2IH 1JE5A 3PO2H 5C3EG 3PIOA 4DUZQ 1VQ8A 2NVTH 3PUWA 3S14H 4JI0L 1HJPA 4LW1A 4LUOA 4HIDA 1PHJA 3FKIH 3F2CA 4KLKA 1L1OA 4A76A 2VW9A 4IJHA 4IPHA 2OWOA 4LF4Q 4PZ7A 4DV6L 2K4KA 1A8VA 3S24A 4DAYB 5FLXc 2JA6G 1XMQQ 2JA8G 2F3IA 2E8GA 3K7AH 3RR5A 3UDFA 4A3IH 5M5XH 3S1MH 4Y52H 3CCRA 3HOUG 2UU9L 5IYBH 1JB7A 2CKZB 2JK8A 2QEXA 1PH2A 1PYBA 4HJ5A 4POGA 2YTXA 3GTJH 3T1YL 3CMAA 3PUYA 1KQSA 5ELOA 2WB1G 1K0RA 1VQMA 4LWCA 4LF5L 1N32Q 5DLQE 1TWHH 2D0OA 1N36Q 3RN2A 1I94Q 3HOWH 1FJGQ 1LM0A 5C0XG 3A5UA 4LF6L 1YIJA 1TWFH 4A3GH 4IFDJ 1QUQB 3ERSX 3M85A 1Q1BA 5M3FG 3S1RH 2B63H 3PUZA 3S1NH 4R4TA 1VQPA 2IY5B 3D0FA 1UE5A 5GAGC 1KC8C 1KRTA 1I94L 2JA9A 2LXJA 1JMCA 1FGUA 3I4NH 1IL2A 1XJVA 1X3GA 5J3BA 2ZJRA 4GKKQ 2GN5A 2ZJPA 1OTCA 1B70B 5FLMH 4DV2Q 4JI4L 2VL6A 4JI6L 3A74A 1J5EL 4P74A 1Y1WG 4NXMQ 4A3LG 3PGZA 4K0KL 1G51A 3GTMH 1IZ6A 5FJ8G 4TQUS 2UUAQ 3KF8B 4X66L 5IYDG 3J80c 1KHIA 4A4IA 2Z6KC 5IP9G 1IBKQ 3PO2G 3HFZB 4QY7A 3OW2A 4IFDI 4LF7L 1VQAA 3TQYA 4JI0Q 3K80C 3G4SA 5C4JH 4GN5A 3IRBA 4BA2I 1NMFA 3W5OA 1PFSA 3I2ZA 3M9BA 2CFMA 4DKAC 4B3RL 4A3LH 3CF5A 4HJ7A 4JI3Q 2K75A 1IBML 4PMWA 1LYLA 1NE3A 3S1QH 2F52A 3J81j 3M4OH 4A3FG 4H02A 3CC2A 4POFA 4MZ9A 3VDYA 4YHHL 4DUYL 4BA1I 4A3MH 3LGJA 1AE2A 2RF4A 2ES2A 4LFCQ 2KBNA 5IWAQ 3OTOQ 4DV7L 3HOXH 1UWVA 3U58A 1IBMQ 3W1GA 1P16A 1QVCA 1YZ6A 5M5YH 2OTJA 1PA6A 1K3RA 5GADC 4JOIA 4L5SA 3DM3A 3CCMA 1L0WA 4DV3Q 4A3JH 1HZCA 4DV0L 3PF5A 4P72A 4QL5A 3CCSA 3GTKH 1TWAH 1OXXK 1HR0L 3NBHB 2LXKA 3CCVA 4B3ML 5JEAG 3KLWA 4KHPL 1T9HA 3OYYA 3I4OA 2RCNA 4BBSH 4NXML 2VQEQ 3BU2A 1GKHA 3K7UC 4A3EH 4QQBX 3J81c 3KJOA 1N36L 3I4MH 2IX0A 2PMZE 4GOPC 2JA6H 3CXCA 4BY1G 4C3HH 4DV1L 1KD1C 2B29A 1PH7A 4IOAA 5GQOA 4JI8L 4JI5L 2Y0SE 2D0PA 4A93G 5H1SE 3J81i 4GNXC 2BH2A 1AH9A 1S40A 2KCMA 3CPFA 3STBC 1IXRA 3RLOA 2JQOA 1YVCA 2NZOA 4BBRG 5IYCG 3ULPA 1C0AA 3UE1A 1EUJA 1X3EA 3S16H 2MO0A 1YBYA 4DV4Q 3G48A 1Q7YC 1IBLQ 4BY1H 3BZCA 3L7ZC 1YNXA 4NB3A 3J7ZC 3RZDH 4HJ8A 1X56A 1JJ2A 2NVXH 3GO5A 4P73A 4NPSA 1H95A 2R7DA 1SMXA 1PH9A 3HOYG 4A3CH 5E7NA 1UE1A 4A3JG 4GNXB 4DR6L 1V43A 4IPCA 3PF4A 1Q1EA 3PCOB 1K73C 4UP8A 4X66Q 1PVOA 1Y14B 5IWAL 2OQKA 1VQ4A 2Y0SG 2QA4A 1SE8A 2HQLA 4LFAL 1PH6A 3AEVA 5LMNL 3TRZA 5C0XJ 4J15A 4DV5L 4JI6Q 3EN2A 1Y1WH 2E2HH 2JJQA 4L5RC 1EOVA 3CCQA 4KHZA 2NN6I 1CSQA 2C35B 2N8NA 4NXNL 1XNRQ 4JC0A 2GVAA 3L0OA 4DV4L 2K5NA 1N33Q 3I4NG 1VQEA 4YWKA 5LMUQ 1N34Q 3S17H 4JI2Q 1VCIA 4C2MH 1SFOH 2A19A 5JJLA 1VQNA 4A3FH 1Q8KA 2MNAA 4GLXA 5FLMG 1VQIA 1W2BA 1EYGA 3DLLA 5M3FH 2K52A 2K14A 4A3DG 2JA5G 1PH1A 3KDFB 2HHHL 1IYJB 2QGQA 1P8LA 1PH3A 1E1OA 1N34L 1XTDA 2AKWB 4XIGS 3L2PA 4YCUA 2L15A 4HJAA 1EIFA 4K0KQ 5IYDH 1K83H 1UE6A 1V1QA 4A3BH 4JCVE 2AHOB 2FXQA 2IHFA 4OXPA 3RLFA 2B63G 3ER0A 4DK6C 2YV5A 2V1CC 5IT9c 1HNWL 4LF9L 1CKNB 3F2BA 1KXLA 4LFBL 3S15H 3CW2C 2CCZA 1YI2A 1VQ9A 4EQ5A 3EBEA 3M4PA 4DAMA 4X64L 4HIOA 2DGYA 3ICEA 1BVSA 5HGQA 1XPRA 2Q2UA 1EFWA 4A3GG 3JAMi 4A3CG 4DR6Q 3HOUH 2KHJA 4BY7H 4YCWA 5C4XG 2RHSB 1GD7A 2R92G 2ID0A 1VQOA 3H3VI 4R4IA 1QZHA 1U0LA 1HR0Q 1VQ7A 2PI2E 2Q2IA 3HOXG 3CCJA 1ASYA 4YHHQ 4DUYQ 2UXDL 2I5HA 4IJLA 4RMFA 3M4QA 4OWXB 4A3EG 4LF8Q 3HKZG 2CWPA 3HOYH 4A3DH 4BXXH 1XMQL 1JJCB 4LF4L 1X55A 2MQHA 3A0JA 3BJUA 2Z6KA 5BR8Q 1G291 2I5LX 2KCTA 3E9IA 1VQGA 5JEAJ 2ZTCA 1WI5A 4LF7Q 2H5XA 4JOIC 5IYBG 5IYCH 4DK3C 3BZKA 2PI2A 5C4XH 3JAMc 4X65L 4KI0A 4JBKA 1SROA 1N33L 4KHPQ 1O7IA 4B3MQ 1I50H 3AFPA 1NJIC 3PSIA 4DPGA 3CD6A 4DR7Q 2ZTEA 1OXTA 1FL0A 3STBD 4OO1G 3T1HQ 4JV5L 5K36G 4NXNQ 1XNRL 2VZAA 4B3RQ 1XMOQ 4Y7NH 3NENA 4OWWB 3KF6B 4UP9A 2HIXA 4A3MG 3HOVG 4BY7G 2IX1A 1KRSA 3PO3H 1QVFA 5IE8A 4JI1L 3CMEA 2ZJQA 1PH4A 2PQAA 4ME3A 2E5LL 4DR7L 3J80i 4LF9Q 1Y1VH 5GROA 5M5WH 2CWAA 2F4VL 5IP9H 2CQOA 1HZAA 1S72A 1HZBA 4X62Q 4PZ8A 1C7YA 1WYDA 3GD7A 3KYHC 4GN3B 4LFCL 1VQ6A 1E24A 4YY3Q 2UXCQ 3JC66 1ASZA 1CKOA 1QUQA 2UUBL 4B3TL 1YJWA 4BBRH 1JJGA 1WJJA 1E7ZA 5GAHC 1M90C 3U50C 1E22A 1HNXQ 2ZTDA 4RG1A 3T1YQ 4B3TQ 4UY8C 1DGSA 2R93H 3E0EA 2UXCL 1D8LA 2WAQE 5AJ3Q 2VUMH 1K9MC 1A62A 3MEFA 2UUCQ 2I5MX 1YHAA 2B3GA 4AYBG 4X64Q 2AWNA 4GOPA 1WOCA 4LFBQ 1FJGL 2E5LQ 3CP0A 4R1JA 4JI8Q 3UE0A 3PIPA 1VQJA 4R4OA 3HOZH 4WJ4A 1Z9FA 3AQQA 2OQ0A 1PYSB 3UDIA 4HIMA 4JBWA 3KDFA 2KHIA 4OWTB 1EIYB 2R7FA 3K0XA 3H0GG 4JG2A 3KJPA 1Q81C 4BXXG 1K8AC 4JYAQ 3W1BA 1RIPA 3MXNB 1D7QA 1CUKA 1EQRA 4A3IG 3RZOH 5GAEC 4GKJL 3CCLA 4DV0Q 4JI1Q 5EAYA 1PH8A 4P71A 4DV3L 4C3JH 1A0IA 5HY6A 1VQKA 3M7NA 1OXSC 3HKZE 4DUZL 2R92H 1CKNA 2JA7G 3I55A 1LTLA 1SLJA 2KENA 3F1ZA 1GM5A 2YU9H 4LF6Q 1EWIA 3AFQA 4DR3L 5M3MH 1HNXL 4JI7Q 1XNQL 1YITA 1Q86C 3CC7A 3GTOH 1I3QH 2PNHA 2ATWA 3CCEA 5JJKA 1JT8A 5C0XI 4GN4B 4LF8L 4O2DA 4IPDA 4OONA 3WWVA 1TWGH 2VY3A 3CCUA 2UUBQ 3B6YA 5C3EH 1LUZA 4DR2Q 4O0AA 4JBJA 2UU9Q 2GVBA 2JA7H 4DV1Q 4JYAL 1K8GA 3ZJYC 1VQBA 3U4VA 4DR5Q 1B7YB 4DV6Q 4JI7L 1XNQQ 4DR4L 2R93G 2UXBQ 1J6QA 2OTLA 3F2DA 1HNZL 4A3BG 4DR1Q 2EXDA 1SR3A 3GTLH 1VQCA 1QVGA 3UDXA 4HIKA 3ULJA 3UDGA 3D31A 3CQZH 1OXVA 4MNOA 1HH2P 1C9OA 1VQLA 1IBLL 4JI5Q 2VS1A 1Z47A 3GTQH 1KIXA 3SGIA 1RL2A 2MFIA 1SRUA 4AQYQ 1VQ5A 1UEBA 4LNQA 1M1KC 5C44H 1E3PA 4A3KH 1MJCA 4YCVA 1N8RC 3G71A 4APVA 1L1OC 1YJ9A 4OX9L 2VNUD 1YJNA 1X3FA 2N3SA 4YWMA 2BA0A 4UPAA 2IT1A 1X54A 1Y1VG 4PZ6A 4MTNA 3OTOL 2K5VA 4DV7Q 1VS0A 3GTGH 1Q12A 1YEZA 4TVAB 4XTCS 4L5QA 4YY3L 4IPGA 1FVIA 3NEMA 3S2DH 5IP7G 1I6HH 2NZHA 3NELA 3FP9A 4GOPB 1S3OA 3A5ZB 2I0QA 4JI2L 5LMUL 3GTPH 4C3IH 4PG3A 2JA5H 2R6GA 3TREA 2UXDQ 1TWCH 4UP7A 1BBUA 1VQDA 4ALPA 1QZGA 3RLNA 3G6EA 3RN5A 4IO9A 2IHEA 4LF5Q 1N32L 3H15A 2JA8H 1N9WA 4LUZA 2HHHQ 4AIMA 4A93H 3GDEA 3TS0A 4A3KG 2R7ZG 2EQSA 2N49A 2VQEL 1MJEA 4LUVA 4B3SQ 3CPWA 4WJ3M 4X62L 3PO3G 1NTGA 1Q82C 1OXUA 2BA1A 2NVYH 4R4QA 3HKSA 4X65Q 4B3SL 4QIWE 1TXYA 3PV0A 2VUMG 1HNWQ 4IFDG 4JI4Q 1G6PA 1HR0W 1NY4A 2XGTA 2ZM6Q 2R7ZH 1KAWA 3I56A 3CC4A 2DUDA 1YHBA 3FHWA 1XMOL 3I4MG 5BR8L 3KF6A 3T1HL 4DR3Q 5LMNQ 3K8AA 4L5TA 3K81C 1WCMH 4YWLA 3S2HH 3Q8DA 3CAMA 2PQAB 2UUCL 2ALYB 1VQFA 5AJ3L 2HIVA 2VQFQ 2D62A 3E9HA 4AH6A 1BBWA 2ASBA 2YYZA 4JBMA 1IBKL 3EIVA 4R4CA 2YTYA 3H0GH 1GVPA 4QGUA 1BKBA 3PUVA 1A63A 4JI3L 3AYHB 2EIFA 2Z0SA 5ELNA 3RNUA 3I7FA 1I5FA 2ZM6L 5C44G 2NN6G 4DV5Q 1L1OB 4GKJQ 1XPUA 2Q2TA 1E1TA 3H3VH 1SN8A 4GS3A 4A75A 2MO1A 2HT1A 3KFUA 5JJIA 4OO1I 1V9PA 1KL9A 3KOJA 2AWOA 3TEHB 4OX9Q 1X65A 4X6AH 2OCEA 1J5EQ 3HOVH 5LMNW 3U4ZA 4QJFA 4JV5Q 4DV2L 1CSPA 1CKMA 5FJ8H 3HOZG 3M3YH 4GKKL 1MKHA 2JEBI 2A8VA 4GLAC 4FDBA 2JE6I 1Q46A 4DR2L 4IOCA 2AMCB 2VQFL 5IP7H 1AE3A
chains in the Genus database with same CATH superfamily
2PCFB 2WP8J 3A56A 3TP7A 3AMUA 3J81L 4DAYA 5M3MG 4DR4Q 5FK9C 1R9TH 3I70A 4XQQA 3PQIA 2LSSA 4GLVB 2B2TC 1ILQA 1X6OA 1STYA 3NPPA 1PFBA 2E2JH 3HOWG 2YTVA 4A3MB 2F4IA 1H9KA 4DUZQ 1VQ8A 1C48A 3PUWA 3S14H 1HJPA 1I4QA 4HIDA 1X3QA 3LNNA 3WOEA 1PFMA 3DXJC 4PZ7A 2K4KA 2F3IA 3K7AH 3UDFA 5M5XH 4F87A 3HOUG 5CV4A 2AUJD 4NMZA 4DA2A 1AN8A 1Y69U 4F7XA 2EY1A 2WB1G 1VQMA 4I65A 3TZUA 4DFAA 2ZXOA 3G7LA 3Q6SA 1LM0A 5C0XG 1YIJA 3P20A 3A8KE 1QCBD 4A3GH 3M85A 2B63H 3I4MB 3D0FA 1UE5A 2EPBA 1I94L 1MGSA 1DOMA 1XJVA 1OTCA 1J5EL 1II3A 1KDBA 4K5VA 2EOTA 2F0MA 4TQUS 3TSSA 3OSOA 1XX8A 4IQZA 3EVQA 3PO2G 4QY7A 4FF1A 4LF7L 1VQAA 2C9OA 3TQYA 3K80C 5C4JH 1NCVA 2UXCQ 1NMFA 3W5OA 1PFSA 2E75C 4A3LH 4DKAC 4P2CB 2K75A 1IBML 1A3VA 4K5XA 3S1QH 3M4OH 3HRZC 1JWMD 3EJIA 4A3FG 3IFDA 3VDYA 4YHHL 4DUYL 4BA1I 4LFCQ 1LT6D 3HOXH 1UWVA 2CVRA 4K6LA 2O4XA 3NQIA 3W1GA 1LT4D 4HR7B 1M4VA 2TMPA 3CCMA 4A3JH 1HZCA 2B2YA 2F0TA 3CCSA 4HMJA 1CHQD 3D6CA 1H9SA 4HMIA 3OYYA 1HUMA 5CV5A 4CJ1B 4HSPA 3KK7A 3J81c 5CC4A 4X3UA 4F8MA 2IX0A 4GOPC 3CXCA 1NAPA 2AQ1B 5IIFA 4IOAA 2XN9C 1RTNA 4BY7B 2D0PA 4DAVA 3STBC 4FF4A 1YVCA 4H13C 2NZOA 1BF4A 1C0AA 2QW7A 4U68A 1KAAA 1PDQA 1YBYA 5IGCA 4DV4Q 3G48A 1F77A 4BS9A 4JI5Q 3L7ZC 1YNXA 3RZDH 3NXWA 3TBIB 1EYAA 3GO5A 4P73A 3MHBA 4G57A 1SMXA 3OHXC 2DJFC 1X32A 3HOYG 4A3JG 5A35A 4FXKC 3PCOB 2F0LA 4UP8A 1VQ4A 3IFTA 3TRZA 3AEVA 4CKEA 2Q8RE 3FEWX 5C0XJ 4J15A 4JI6Q 3R2TA 5A2QL 2E2HH 5KRUA 1SAPA 4I7AA 1DD2A 2QILA 1G8ZD 1EZ8A 4OGQC 1VQEA 1BCPD 1SNCA 5LMUQ 3S17H 1SFOH 3DWQA 1TS3A 2A19A 1J9OA 3DEOA 2MNAA 1VQIA 1EYGA 3CRLC 1KDCA 2JA5G 1PH1A 3KDFB 1E1OA 3V2TA 1XTDA 4XIGS 2L11A 4YCUA 2L15A 5IYDH 1UE6A 2KECA 4X3SA 1MHWC 4JCVE 4OXPA 3RLFA 2O5IC 3ER0A 4DU9A 1TS2A 2PQEA 5C3XA 1X3PA 1KXLA 4LFBL 3NBHA 3S15H 1STHA 4DAMA 4A3GG 1BVSA 5C5MA 5HGQA 4A3CG 4DR6Q 2WINB 1GD7A 4L6TB 4CKBA 4R4IA 1U0LA 1HR0Q 1XXGA 1VQ7A 2PI2E 2VB2X 1ASYA 3S16B 4KKSA 4RCOA 1RDPD 4IJLA 4RMFA 1R4QB 3MZ5A 4LF8Q 2NVXB 2G9DA 4BXXH 1XMQL 1EY5A 2RSNA 4LF4L 3A0JA 4B08A 2H5XA 1KABA 5IYCH 5C4XH 3VR5A 4JBKA 1Y1WB 1O7IA 3QOJA 5E1FA 4MHEA 3PSIA 1NJIC 1UUPA 1OXTA 4OO1G 4ZYSA 2VZAA 4B3RQ 4MIUA 1GUOA 1I4HA 2IJ0A 4OWWB 4UP9A 4CHTB 4RKBA 5I2YA 5ELCA 4O42A 1V1OA 2RDFA 2L4NA 1MD2D 1LTSD 4IURA 3J80i 3T53B 5M5WH 2CQOA 1EWCA 1HZAA 1HZBA 4X62Q 4K2LA 1E24A 2XRQD 1ASZA 4B3TL 3ND8A 1JJGA 3DUZA 1FD7D 5CV8A 1HNXQ 4B9XA 1JQYD 3I4NB 2DNEA 5C4ZA 3NHHA 1STNA 2UXCL 2WAQE 1UNSA 3MEFA 1DXMA 2I5MX 2Q8IB 4AYBG 1WOCA 1T5EA 3GTMB 1Z9FA 1JE4A 1PRTC 2B63B 2A6HC 4ZCKA 1PYSB 2KHIA 2X6LA 2N55A 3W1BA 4OEMB 4J1MA 4C3HG 2K5QA 3RZOH 4UHVA 2QEJC 3QWNA 1ET6A 4P71A 4DV3L 1A0IA 5HY6A 2F0JA 1LTLA 3HG9A 1EWIA 2QKIC 3NK9A 5M3MH 3GTOH 2G9HD 1YITA 1Q86C 3I72A 2ATWA 4C3JB 5M9OA 3AU7A 3FVQA 2VY3A 5EBDA 2FMCA 1LUZA 4DR2Q 4JBJA 4Y7NB 2GVBA 4R9WA 3KLSA 4CJ2C 4CDCC 3S1QB 1B7YB 2R93G 2NBFA 2OTLA 1HNZL 2KOLA 1VQCA 3D31A 2F0QA 1NUCA 3CQZH 4A3EB 2LKVA 1VQLA 3I90A 3GTLB 2NTSA 2MFIA 2JYOA 1E2VA 1F9RA 1G2TA 1BQQT 3GTQB 4APVA 1L1OC 2DY8A 4B9WA 1YJ9A 1Y1VG 4MTNA 2K5VA 5C3WA 3MXNA 3SK8A 4JVZA 4A3KB 4ZRZA 4XTCS 1TU2B 1JWSD 4YY3L 1FVIA 4ZLTF 3GTPH 4JI2L 3A5ZB 1TWHB 3H94A 2UXDQ 2WAQB 3E0JA 2HHHQ 4A3KG 1UAPA 4K8JA 3E6ZX 2N49A 4LUVA 1GHJA 1QB5D 1LO5D 4WJ3M 4X62L 1AP0A 1S5ED 3RZDB 1Q82C 5JAVA 2R92B 3I4LA 1PTOC 2B2VA 3HKSA 4DF7A 1ZXTA 2K6AA 4LMQD 3PV0A 1HNWQ 4C2MB 1CQVA 4X3KA 1KAWA 3I56A 1K3BC 4ULLA 3ZYYX 5M3FB 4FVMA 4DR3Q 5LMNQ 4ILWA 1KLGD 1SE2A 3D8GA 3S2HH 2PQAB 1D5MC 3BG3A 1VQFA 2BDNA 2HIVA 5A2QE 2YYZA 5IODA 3H0GH 1BUVT 3NWTA 2EVBA 4F88A 1BKBA 1GUNA 3PUVA 4C3JG 2MHVA 2NN6G 3A8IE 1KNEA 2A73B 3EQLC 4DV5Q 3C3LA 2EJFC 3M7GA 2SNMA 2Q2TA 1E1TA 1XPUA 3H3VC 4GS3A 2IWHA 1EY9A 1A6XA 2HT1A 3KFUA 3N6RA 5JJIA 1KL9A 5KNBA 2M2LA 1SSOA 3R2IA 1J5EQ 4QIWB 5LMNW 4JV5Q 2GA4B 3QG1A 1CKMA 1Z7TA 5EJWA 4GKKL 3S15B 4PQXA 2JEBI 4FDBA 4C3IB 1B4OA 4DR2L 3O13A 4KHVA 3LWEA 5CV6A 5IP7H 4P75A 2N78A 3SXHA 1HNZQ 1D1KA 1GO3E 2NVQH 3F8TA 4EVOA 2F03A 3BS1A 4H0LC 5CYUA 2Z1CA 5EPLA 1NR2A 4HJ9A 1B8AA 1UE7A 2ICEC 2XTIA 4NKLA 3VYUA 4ZKBB 1W3SA 2E2IB 3K5LA 1XPOA 1PH5A 4L63B 2WB1E 5IGEA 2UUAL 2A69C 5EPJA 2WFWA 3J81E 2EYLA 1WCMG 2RHQB 1BBXC 1A3UA 5KGUA 3PO2H 3PIOA 2NVTH 4JI0L 4LW1A 1RF2D 1PHJA 3FKIH 4A76A 3C46A 1HXYD 4IJHA 4IPHA 5DNFA 4BBRB 2OWOA 3NWSA 3S24A 2JA6G 1D2BA 2JA8G 4A3IH 3RR5A 3QJYA 3VYRA 1TR5A 1QG7A 4EGVA 1JB7A 2LFNA 2JK8A 1ZYRC 4HJ5A 4ZUJA 3HZXA 2YTXA 3GTJH 4DAPA 2A6EC 3PUYA 1KQSA 1K0RA 1STGA 2Z9HA 4LWCA 1N32Q 5DLQE 1B53A 3SEBA 3URYA 1B3AA 3HOWH 1DZ1A 3BDOA 2V4DA 4IUPA 5TSSA 4LF6L 3S1RH 4PMCA 3MFGA 4R4TA 1VQPA 1K28A 3F2UA 1J8IA 5EGTA 4KJNA 2I46A 1KRTA 4MN3A 1FGUA 3I4NH 5J3BA 1B70B 3A74A 4CBVA 1Y1WG 4NXMQ 1TT2A 4K0KL 3Q0AA 3GTMH 1IZ6A 1WD1A 1EY0A 2KQ3A 3KF8B 5EKLA 5EPKA 3J80c 1KHIA 2OEOA 2Z6BA 4KY7A 1ICWA 1IBKQ 3HFZB 3WOFA 4IFDI 3BVZA 1B50A 3MXUA 4JI0Q 2HDLA 2BOSA 3KLSX 4B3RL 3GQBA 2CFMA 1WD0A 4N9TA 5IGFA 4PMWA 1LYLA 5KIXA 2J4XA 1NE3A 1Q3LA 2RCFA 1DOKA 2XWJB 1LT3D 3QIAA 1LTBD 4H02A 3T4AC 4K2KA 4A3MH 1AE2A 2KBNA 2NB0A 1WTOA 1IBMQ 5M5YH 2OTJA 1C8CA 1PA6A 4DK1A 4N8X1 4DV0L 2K1BA 2EDGA 1SYBA 1FR3A 1TWAH 1HR0L 3NBHB 2E76C 1DCZA 4B3ML 3KLWA 4A3JB 4C3HB 5FLXL 2RCNA 2VQEQ 2A5HA 4A3EH 1O78A 3E3XA 1MSGA 3I4MH 1TVXA 1LABA 2X69A 5GQOA 4CKCA 2Y0SE 3TMEA 3SVMA 1S40A 2KCMA 1WTVA 1IXRA 3RLOA 1AFPA 5D3DA 4RGMA 3CU7A 1Q7YC 1N33L 4BY1H 1JJ2A 1U4LA 1EY7A 1X56A 2CHBD 4FXGC 3GTPB 3HGBA 4A3CH 1SYFA 3IL8A 3K5NA 4DR6L 1FNWA 3S14B 2Z4HA 2IL8A 1Y14B 5IWAL 5D3IB 3GV3A 2O5JC 1U9RA 5LMNL 1K8OA 5EKIA 4FXDA 2JJQA 1QILA 2C35B 2N8NA 2XSCA 2K32A 4NXNL 3SR1A 1N33Q 3IAYA 1ESRA 4YWKA 5ELFA 4RA8A 4C2MH 5JJLA 4RH6A 1W2BA 3I8ZA 4A3GB 5M3FH 2R61A 3MXGA 4A3DG 2HHHL 1WTQA 1PH3A 1P8LA 3U9OA 1N34L 2AKWB 3L2PA 1K83H 4OO1H 1OO9B 2FXQA 3M4YA 1E2ZA 2PW5A 1VF5C 3NTKA 2YV5A 5IT9c 1TS5A 1EWHA 3F2BA 4RGTA 3AB9A 2CCZA 1YI2A 3M4PA 3ICEA 2CW0C 2SNSA 1YNJD 5LL6S 2MP1A 1T5XD 2L9HA 4XXEA 4BY7H 1DM0B 2NUCA 2R92G 2ID0A 3H3VI 2M00A 1SJHD 5BN3A 4ZAIA 2Q2IA 3HOXG 3CCJA 2XNAC 3J7YW 4NP5A 3M4QA 3HKZG 4QB4A 2F0NA 1O7ZA 4A3DH 4ODGA 2Y0SB 2HQEA 1CM9A 2MQHA 1RD9D 3BJUA 3EFXD 1G291 2I5LX 2KCTA 5J1ZA 1Q90A 1CFMA 1WVLA 4RAUC 3VR6A 1HTLD 1QNUA 4DK3C 3JAMc 2PI2A 3BVMA 4HCSA 1SROA 1C4QA 4KHPQ 1KTKA 1JOQA 4DPGA 4DR7Q 1D5ZC 2ZTEA 5K36G 4NXNQ 1XMOQ 1O7YA 3HOVG 4A3MG 4BY7G 1KRSA 1SFOB 1F9PA 1PRTF 2PZTA 2VXWA 2E5LL 2F4VL 5IP9H 2EXZA 2AQ2B 5IT9E 4GN3B 4LFCL 4YY3Q 2B8FA 5M5WB 4BBRH 1E7ZA 1KNAA 4RCNA 1BNZA 4RG1A 3I91A 4UY8C 2R93H 1V1PB 3E0EA 2HDMA 3H91A 4RGNA 2AWNA 3K0YA 2KCNA 2E5LQ 4KY5A 3CP0A 3HOZH 4FYDA 1VQJA 2HCIA 1F2ZA 4HTHA 3S1RB 3AQQA 3OOCA 1GUSA 2DJGC 4M8AA 4JBWA 3KDFA 1EIYB 4E6IA 4JG2A 1MSHA 1K8AC 4Q0FA 1I4GA 4ZUIA 1RIPA 5FKAC 2ENBA 1CT1D 4GKJL 3CCLA 5IOCA 1TY0A 5I4DA 1H9MA 3VA7A 1F9QA 4DUZL 3C1FA 2JA7G 3I55A 4EQOA 2KENA 5FLXE 3AFQA 1FGBD 3K6OA 3QR8A 4JI7Q 1XNQL 4XT1B 3CCEA 1G2SA 1SBBB 4O2DA 2UUBQ 2D5DA 1WTPA 4K8IA 4K5WA 5G3LF 4JYAL 3MXPA 4DR4L 1EOTA 1J6QA 1NNXA 3F2DA 4A3BG 4DR1Q 5ELBA 1U4MA 4KMUC 1QVGA 3UDXA 4FF3A 5F2DA 3A7LA 4LJZC 3VA5A 4TSSA 2MGSA 2A68D 1BXTA 1E3PA 4YCVA 2F0EA 2VNUD 3GP7A 2H4OA 2BA0A 4UPAA 4YWMA 1X54A 3QOLA 3OTOL 1ESFA 3GTGH 1Q12A 3OWEB 1ENFA 4L5QA 1ICFB 3LX0A 4HEDA 2BE5C 1XYIA 1WTWA 5IP7G 5DAUA 3BZDB 1CA6A 5IGGA 3FP9A 1S3OA 5I9PA 3BDLA 1A2UA 1F2MA 1Y8OB 2E74C 3TREA 1TWCH 2CH4W 1STEA 4UP7A 1PLFA 3OWFA 1QZGA 3RN5A 1RCVD 2K03A 2IHEA 5BN5A 4LF5Q 1N9WA 2WACA 4AYBB 3RZOB 1SMYD 3BDCA 3PO3G 1BCPC 1G91A 1HFNA 4IFDG 1HR0W 1NY4A 1TQOA 2XGTA 2ZM6Q 2R7ZH 2DUDA 3CHBD 3FHWA 2NTTA 2A74C 1BO0A 5BR8L 3KF6A 4ZK9B 4IZ8A 3T1HL 3K8AA 3PIO3 2ALYB 4IUTA 5CV7A 2VQFQ 1CI3M 2F0VA 1BBWA 1IBKL 3EIVA 1AEXA 3S1MB 3S2HB 2YTYA 1PZID 3CQZB 4Z9CB 3Q23A 4QGUA 5FO8B 1K8MA 2EIFA 3D6WA 3RNUA 1I5FA 1NR4A 3H09A 3D4WA 5C44G 3HOUB 3T51B 4GKJQ 3FDTA 4IUVA 1SN8A 4A75A 1K83B 4KKTA 3A8JE 3JAML 4OO1I 1EYCA 3TEHB 4OX9Q 1GUTA 1X65A 1HCZA 1RKNA 4QF4A 4QJFA 4DV2L 2Q8TA 1CSPA 3HOZG 3M3YH 1MKHA 2A8VA 4GLAC 2A6ED 4RHRA 3J80L 4IOCA 4ME5A 2AMCB 3P75A 3DEPA 2EJGC 2K01A 1CZGA 2EY6A 2JA6B 3A55A 5JPNC 4NW2A 5D14A 1VQHA 2A1AA 5IY0A 4GNXA 4BBSG 2KHSA 3ITPA 1EQQA 4RHSA 2K5DA 5IGDA 2NVQB 4LFAQ 3UI2A 2WAQG 2BCOA 2K5HA 1B1ZA 2K50A 2A69D 3SE0A 4DNIA 1B44D 4AYBE 4XDXA 1X9NA 3SK6A 2JEAI 2BH8A 1CHPD 2E2IH 1JE5A 4V0BA 1GJXA 2XIWA 4ZQ3A 2F0FA 4LUOA 1DYQA 4OELB 1L1OA 2VW9A 3PO2B 5FLXc 2E8GA 2B8GA 3I73A 5K5PA 2UU9L 3Q24A 2CKZB 3X3NA 2QEXA 1PH2A 1IHZA 1PYBA 2F0WA 3CMAA 5ELOA 4A3IB 4LF5L 4KD4A 1TWHH 5J22A 1N36Q 1W6JA 1I94Q 4A3FB 3HKZB 1TWFH 3VR4A 1QUQB 5M3FG 1Q1BA 3PUZA 2IY5B 3K5OA 2LXJA 3J80E 2SEBD 2RDGA 4L8JA 1VF7A 4KKUA 5JVG3 1LTID 1JWUD 5FLMH 3KUPA 3N52A 4JI4L 1U4PA 4CGYB 4I7ZC 4A3LG 2DNCA 1SYDA 5ELEA 5FJ8G 1BDOA 4X66L 4A4IA 2Z6KC 3SK4A 3OW2A 3QB3A 1S5CD 4R8IA 2EY5A 3IRBA 2ICIA 5C3EB 1TY2A 2L5TA 3CF5A 4JI3Q 2F3WA 3H0GB 5C5LA 3K57A 1PRTD 2HD3A 3CC2A 2H1EA 4MZ9A 4IUNA 2B2YC 4WORA 5IWAQ 4DV7L 1ILPA 2B2UC 3U58A 4YIJA 4HAEA 5DM63 1YZ6A 1MI2A 2PMZB 1K3RA 4L5SA 2FMMA 1Y8PB 1SE4A 5KEEA 4HSVA 5M5YB 1EFID 3GTKH 2J7ZA 2F0UA 4CDEC 2LXKA 3A7AB 3CCVA 5JEAG 1EIHA 1S5DD 1LTGD 1T9HA 4K14A 1E0BA 1PRTB 3HOWB 1GKHA 3K7UC 4QQBX 3KJOA 2XRSD 4HCEA 2PMZE 1LTRD 4C3HH 4DV1L 2B29A 1PH7A 1ENAA 4N9PA 4JI5L 4LAAA 1STBA 1STAA 3J81i 5CR3A 2AUKA 3CPFA 1LTTD 4A93B 2BDOA 3FMCA 1D1IA 4BBRG 5IYCG 3ULPA 3UE1A 1EUJA 4IUQA 5FO9B 2MO0A 1PTOB 1GUWA 1IBLQ 4NB3A 3J7ZC 1SJED 4HJ8A 4XYOA 4DK0A 4H44C 5DM73 1PH9A 5EQ0A 1UE1A 1JORA 4GNXB 4BY1B 1V43A 4IPCA 4C1NI 1B2TA 3PF4A 1Q1EA 1K73C 3FKIB 4X66Q 1PVOA 2OQKA 2QA4A 2HQLA 2FINB 5CBAE 3ONAB 1WTXA 4DV5L 3EN2A 2RBMA 4L5RC 1EOVA 1V1PA 2RVLA 3OW7A 2NN6I 1CSQA 2K04A 2F0KA 4RKLA 3OMGA 2GVAA 3LWUA 4DV4L 3I4NG 1PTOD 1SNQA 4GZYC 3TDQA 3V05A 4GLXA 2K14A 4K6DA 2L12A 5JVH3 4K0KQ 4A3BH 1B9NA 2WKDA 5K36H 2AHOB 2BE5D 1B3QA 1HQMC 2V1CC 3DM1A 4LF9L 2B2WC 3MAQA 3CW2C 3W2DA 4HIOA 1FNUA 2Q2UA 1XPRA 4M1UB 3HOUH 1M8AA 3KBXA 5D65A 1VQOA 1QZHA 1I6VC 2RKSA 4YHHQ 4DUYQ 2UXDL 2F0PA 1F2LA 4OWXB 4KTAA 2CWPA 3HOYH 4DNRB 4QMGA 3D3RA 1X55A 2Z6KA 3NQTA 2JN4A 2K28A 5JEAJ 1I50B 3J7AF 4LF7Q 3QO2A 4JOIC 1IKLA 1CQFA 2L1BA 4KI0A 2EE1A 1IKMA 4JK1C 1H9SB 1TWAB 2I07B 4RWSC 2JA7B 3NENA 1CZWA 5CORA 3PO3H 2KJXA 5IE8A 1S5BD 1PH4A 2PQAA 1PMRA 4ME3A 4C3IG 1IL8A 1Y1VH 1EU3A 5GROA 2D2CC 1D6EC 1S72A 1D5XC 1C7YA 4KD3A 1IYVA 1VQ6A 3GD7A 3KYHC 4TRDA 5FOBB 1CKOA 2UUBL 1YJWA 1QNKA 4RFBA 1WJJA 3U50C 1PFNA 3MEHA 2QF7A 1E22A 1JB3A 4OIKA 5HGTA 1JOKA 1R4PB 1D8LA 2VUMH 3NSWA 1A62A 1YHAA 2B3GA 1SMYC 4GOPA 1RHPA 3VR3A 4LFBQ 2NWGA 3C1EA 1FJGL 3H6MA 4R1JA 3PIPA 5CGKA 4R4OA 4CDDC 2JXMB 4HIMA 3UDIA 3I3CA 1L0YB 2CQAA 3HOZB 3K0XA 3KJPA 1AZPA 4MTKA 4BXXG 4CDFC 4A3DB 1CUKA 4A3IG 2KCCA 5ISRA 5GAEC 4DV0Q 1IW7D 3DWPA 1PH8A 2FJ2A 2KEDA 3HKZE 1CKNA 2EYHA 3BYYB 3T16A 1SLJA 3F1ZA 2YU9H 4DR3L 3CC7A 1I3QH 5JJKA 1JT8A 2P5ZX 2Z4IA 5C0XI 5JEAH 4IPDA 3WWVA 1SEBD 3L9AX 5C3EH 3JAME 4O0AA 2F0DA 2UU9Q 4PV1C 1K8GA 3V96A 4KN7C 4DR5Q 3R93A 4DV6Q 2QDBA 2UXBQ 4G7ZC 4KN4C 4KV6A 1SR3A 2IX3A 3RUZA 3ULJA 5LL6X 1SYGA 3W3AA 4BBSB 4MNOA 1C9OA 5C44B 1Z47A 4JW0A 1KIXA 1EEFD 4ZKCB 1ZYRD 1SRUA 5DEHA 4AQYQ 1EZ6A 1EQTA 2JSOA 1M1KC 1MJCA 1N8RC 4OX9L 1HQRD 3GTKB 2IT1A 4PZ6A 3KLRA 4DV7Q 3OIQA 1CTMA 5M5XB 4TVAB 5JJZA 3ND9A 1A3TA 1HUNA 4IPGA 1I6HH 3NEMA 2ZXPA 5HURA 3NTHA 3S2DH 4JPBW 2I0QA 3MFYA 2JA5H 2R6GA 3X3MA 1L0XB 3DWAA 3NP8A 4PNYA 3RLNA 1N32L 3RMHA 3H15A 4AIMA 4A93H 1JR0D 2WB1B 2EQSA 4KY6A 4B3SQ 2DN8A 5IT9L 1LV9A 1PTOH 2EYFA 1OXUA 2NVYH 2WIIB 4X65Q 2F0SA 3DMUA 2HCCA 4S3SA 5I6WA 2PW7A 4LK1C 1ET9A 2CH4A 1CK1A 4RGOS 1YHBA 1FNVA 1XMOL 3I4MG 2E2JB 3MWYW 1WCMH 4YWLA 5KNCA 3CAMA 1EY8A 1SDFA 5C4JB 3SDZA 2R93B 3K58A 2D62A 4AH6A 2NN6H 2ASBA 4R4CA 3K7AB 3P1HA 1GVPA 1SXTA 1JCKB 1TKWB 2LMCB 1A63A 4JI3L 5ELNA 1O7LA 3I7FA 1S5FD 1L1OB 3R3OA 1I4PA 4QUCA 4DGZA 3H3VH 1JOOA 3KF8A 4A3BB 2ZXRA 2F0IA 2B39A 1V9PA 3KOJA 3GTGB 1EL0A 2OCEA 2E2DC 2D9UA 4V190 3WDNA 5FJ8H 4ID6A 1QOHA 3NE5B 1KLUD 1TWCB 2VQFL 2PYKA 2AQ3B 1AE3A 1R9TB 1A15A 1PXUA 2XVSA 1PV4A 2F4VQ 4DR1L 1L2FA 3T56B 2JP1A 4WFN3 2O2LD 1Y8NB 3TS2A 2UXBL 1HZ9A 1NBWA 4EQPA 2EYMA 1WFQA 4DR5L 2KVMA 3PUXA 3J7A5 2PZUA 1U5KA 1SNPA 5EKKA 4EX5A 1MIUA 2Q2HA 3FKIG 4XYQA 4BWGB 1NMGA 1HFGA 4AQYL 1H9RA 1YHQA 3ULLA 5L37A 3K5MA 1EY4A 5C3EG 5BN4A 4OL7A 3F2CA 1QWYA 4KLKA 5G3LD 3BYTB 3FPUB 4LF4Q 4DV6L 1A8VA 4DAYB 1XMQQ 3S1MH 4Y52H 2A68C 3CCRA 3L3OC 5IYBH 1TIID 4TKOB 3PO3B 4POGA 3T1YL 5CV9A 3TP6A 2D0OA 3RN2A 1PZKD 1W6KA 1FJGQ 3HS0C 1V8QA 3A5UA 4IFDJ 3ERSX 2NZ1D 3S1NH 1O80A 1DONA 5GAGC 1KC8C 1ML0D 4X3TA 1IYUA 2JA9A 1JMCA 1UEAB 1XWEA 1IL2A 1X3GA 2ZJRA 2GN5A 2ZJPA 4KJOA 4DV2Q 2VL6A 1HPCA 4JI6L 4H7BA 1AW7A 1EYDA 4P74A 3PGZA 2R7ZB 1G51A 1EU4A 1PTOF 2WV6D 2UUAQ 2B2WA 5IYDG 2PPBC 5IP9G 3TZDA 1EY6A 3VYSA 3G4SA 2X6GA 1TWGB 4GN5A 4QCLA 4BA2I 3I2ZA 3M9BA 4HJ7A 1JICA 2B2VC 1SNOA 4FP5D 1I4RA 2E2HB 3PMFA 2F52A 3J81j 3HOXB 1A2TA 1F9SA 4POFA 3EA6A 3LGJA 4FF2A 2RF4A 2ES2A 4QUFA 3S17B 1LT5D 3OTOQ 1I3QB 1P16A 1QVCA 3OPOA 5E3FA 1LLRD 5C0XH 3Q22A 1G6ZA 2F0OA 5GADC 4JOIA 2EY2A 5C4XB 3DM3A 1L0WA 4DV3Q 4XQJA 3PF5A 4P72A 4QL5A 3M3YB 1OXXK 1FYCA 4KHPL 5KYIA 2QCPX 3I4OA 4BBSH 4NXML 2F0GA 3BU2A 1N36L 3J7AV 3C2PA 2JA6H 3MC0B 4BY1G 2EJMA 4FNFA 3MA2B 1KD1C 2QDLA 4JI8L 4A93G 5IGBA 5H1SE 4GNXC 2BH2A 1QE6A 1ONLA 2JA8B 1AH9A 4DXFA 2JQOA 4HN7A 1X3EA 1QJOA 3S16H 4XQNA 2B2TA 3S9WA 3BZCA 1KDAA 2NVXH 3PIP3 2KA7A 1LACA 4NPSA 1I6HB 1H95A 2R7DA 2LY7A 5E7NA 4U673 4KK7A 4ABNA 5J39A 4J8QA 2PNRC 2K05A 3IKJA 2Y0SG 1SE8A 4LFAL 1PH6A 1GHKA 1Y1WH 3CCQA 2EZVA 1TS4A 4KHZA 1XNRQ 4JC0A 1Z6HA 2NVYB 3DHQA 2K5NA 3L0OA 5I2XA 3D4RA 3P7JA 1N34Q 4JI2Q 1VCIA 3R8BA 2KEEA 4FO2A 1VQNA 1AZQA 3NTIA 4A3FH 5KNDA 1Q8KA 1WTRA 1TWFB 5FLMG 3DLLA 5JPMC 2K52A 1IYJB 2QGQA 1WCMB 4HJAA 1EIFA 1Q8IA 1V1QA 2WKCA 5C4HA 2IHFA 2B63G 4DK6C 3HOVB 2M9VA 1HNWL 1CKNB 3GV6A 1VQ9A 4EQ5A 3EBEA 4X64L 4GKKQ 2DGYA 1EFWA 5LHY1 3JAMi 4DXGA 3FPPA 5FO7B 4C1NK 1LTAD 1VMPA 2KHJA 1K0SA 4YCWA 4N8FA 5C4XG 2RHSB 2Z8LA 3NUCA 2K33A 1GUGA 2I5HA 1HRJA 1VDZA 4A3EG 1YNND 5I9OA 1CA5A 2DY7A 1JJCB 5COYA 1SYEA 3A54A 3NBIA 5BR8Q 4EQNA 1NSNS 3E9IA 1VQGA 3RD4A 1EIGA 2ZTCA 1WI5A 3HOYB 5IYBG 1JC7A 3BZKA 4G7HC 4X65L 4B3MQ 1I50H 2ZT9C 3AFPA 2LS01 3CD6A 3STBD 1FL0A 4JV5L 3T1HQ 2F0HA 1XNRL 2KUMA 4UDUC 3HP3A 4Y7NH 2OT2A 3KF6B 2HIXA 2IX1A 1IW7C 1BCPB 1QVFA 4JI1L 3CMEA 3VYTA 2ZJQA 2MUYA 2RQXA 4G7OC 4DR7L 2PZWA 4LF9Q 2CWAA 4OIJA 2IPKD 4XT3B 1I4XA 4PZ8A 1WYDA 3T13A 4WRDA 3JC66 4Q5VA 1QUQA 1Y1VB 1BOSA 5GAHC 1M90C 3OMCA 2ZTDA 3T1YQ 4B3TQ 1SE3A 1DGSA 4DN4M 1HTPA 5AJ3Q 1U4RA 1K9MC 2UUCQ 2C5CA 2CW0D 1WTHA 4X64Q 2SOBA 1RJTA 2K5WA 4PMBA 3KBGA 3UE0A 4JI8Q 1HA5A 4WJ4A 2OF1A 3S1NB 2EYPA 2OQ0A 1EEID 4OWTB 1PYWD 2R7FA 2RDHA 3H0GG 1BR9A 1Q81C 3SK5A 5JOBA 4JYAQ 4UAIA 3MXNB 1D7QA 1EQRA 2J0TD 5T1GA 2MPMA 3K59A 4JI1Q 5M3MB 5EAYA 3GTOB 2RSOA 1B9MA 3M4OB 3BVGA 1HA6A 3HEJA 2FFKB 4C3JH 1VQKA 3M7NA 1OXSC 2R92H 3TP5A 2F3VA 1GM5A 4LF6Q 3G6JB 1HNXL 3U9SA 2PNHA 1HHVA 2F1MA 4GN4B 3MVVA 4IFDH 2HUGA 5CMDA 1DJRD 2NYZD 1RTOA 4OONA 1TWGH 3CCUA 4LF8L 3B6YA 1SNMA 3CKIB 3TN2A 5CBEE 2JA7H 1DOLA 4OHJA 4DV1Q 3EROA 2VB3X 3ZJYC 1VQBA 3U4VA 4JI7L 1XNQQ 1GXDC 2FHTA 1ZKOA 1H9JA 2EXDA 3E5SA 5T1IA 3GTLH 4WJWA 4HIKA 3UDGA 1OXVA 4NDXA 1HH2P 1IBLL 2VS1A 3GTQH 3SGIA 1BCPF 1RL2A 1XTCD 1SNDA 4DNTB 1UEBA 1VQ5A 4LNQA 1ZEQX 5C44H 2L55A 4A3KH 5C6AA 4IN3A 3G71A 1YNJC 1YJNA 1X3FA 2N3SA 2MJ8A 1VS0A 1YEZA 2RA4A 3GTJB 1MBYA 2NZHA 3NELA 4GOPB 5LMUL 4C3IH 4PG3A 1S4ZA 4IUUA 2A6HD 2EYOA 4IALA 3TP8A 1BBUA 1VQDA 4ALPA 3G6EA 4IO9A 1SYCA 4LUZA 2JA8H 3GDEA 5ELDA 3TS0A 2JA5B 3D4DA 2R7ZG 2TSSA 1MJEA 2VQEL 3CPWA 3FRPB 1NTGA 3MTSA 2BA1A 4R4QA 5E4WC 4B3SL 4QIWE 1TXYA 4R8NA 2VUMG 1PZJD 4JI4Q 1G6PA 2K7VA 3CC4A 5KYLA 2PO4A 2SDFA 1RODA 4L5TA 2B2UA 3K81C 3SHLA 2NVTB 3Q8DA 2R3ZA 2UUCL 3ERQA 5E4XA 5AJ3L 3E9HA 4J6HA 2VUMB 2N88A 4JBMA 1GOZA 1VMCA 2EYJA 3OIPA 3AYHB 2Z0SA 5EBCA 5I6YA 1E2WA 4G4KA 1ENCA 2ZM6L 5AFWA 3CRKC 2OXPA 2G5DA 2MO1A 2XWBB 1EQVA 4C56C 4CJ0B 2AWOA 2IW3A 4X6AH 3HOVH 3U4ZA 1YNNC 3S2DB 2L0CA 2YU9B 4O1NA 2JE6I 1Q46A 1F2YA 5NUCA 3VR2A
chains in the Genus database with same CATH topology
2WP8J 4P75A 2N78A 1PV4A 2F4VQ 4DR1L 1L2FA 1HNZQ 3TS2A 2UXBL 1GO3E 1HZ9A 1NBWA 2NVQH 5M3MG 4DR5L 1WFQA 4DR4Q 1VQHA 2A1AA 3F8TA 3PUXA 1R9TH 3J7A5 5IY0A 4GNXA 4BBSG 4HJ9A 1U5KA 1EQQA 1B8AA 1UE7A 2XTIA 2LSSA 1W3SA 1MIUA 2Q2HA 3FKIG 4EX5A 4LFAQ 1NMGA 1XPOA 2WAQG 2K5HA 4GLVB 1PH5A 2K50A 4AQYL 4DNIA 2WB1E 2UUAL 1X6OA 4AYBE 1X9NA 2WFWA 2E2JH 1YHQA 1WCMG 3HOWG 2RHQB 2JEAI 2BH8A 2YTVA 3ULLA 2E2IH 1JE5A 3PO2H 5C3EG 3PIOA 4DUZQ 1VQ8A 2NVTH 3PUWA 3S14H 4JI0L 1HJPA 4LW1A 4LUOA 4HIDA 1PHJA 3FKIH 3F2CA 4KLKA 1L1OA 4A76A 2VW9A 4IJHA 4IPHA 2OWOA 4LF4Q 4PZ7A 4DV6L 2K4KA 1A8VA 3S24A 4DAYB 5FLXc 2JA6G 1XMQQ 2JA8G 2F3IA 2E8GA 3K7AH 3RR5A 3UDFA 4A3IH 5M5XH 3S1MH 4Y52H 3CCRA 3HOUG 2UU9L 5IYBH 1JB7A 2CKZB 2JK8A 2QEXA 1PH2A 1PYBA 4HJ5A 4POGA 2YTXA 3GTJH 3T1YL 3CMAA 3PUYA 1KQSA 5ELOA 2WB1G 1K0RA 1VQMA 4LWCA 4LF5L 1N32Q 5DLQE 1TWHH 2D0OA 1N36Q 3RN2A 1I94Q 3HOWH 1FJGQ 1LM0A 5C0XG 3A5UA 4LF6L 1YIJA 1TWFH 4A3GH 4IFDJ 1QUQB 3ERSX 3M85A 1Q1BA 5M3FG 3S1RH 2B63H 3PUZA 3S1NH 4R4TA 1VQPA 2IY5B 3D0FA 1UE5A 5GAGC 1KC8C 1KRTA 1I94L 2JA9A 2LXJA 1JMCA 1FGUA 3I4NH 1IL2A 1XJVA 1X3GA 5J3BA 2ZJRA 4GKKQ 2GN5A 2ZJPA 1OTCA 1B70B 5FLMH 4DV2Q 4JI4L 2VL6A 4JI6L 3A74A 1J5EL 4P74A 1Y1WG 4NXMQ 4A3LG 3PGZA 4K0KL 1G51A 3GTMH 1IZ6A 5FJ8G 4TQUS 2UUAQ 3KF8B 4X66L 5IYDG 3J80c 1KHIA 4A4IA 2Z6KC 5IP9G 1IBKQ 3PO2G 3HFZB 4QY7A 3OW2A 4IFDI 4LF7L 1VQAA 3TQYA 4JI0Q 3K80C 3G4SA 5C4JH 4GN5A 3IRBA 4BA2I 1NMFA 3W5OA 1PFSA 3I2ZA 3M9BA 2CFMA 4DKAC 4B3RL 4A3LH 3CF5A 4HJ7A 4JI3Q 2K75A 1IBML 4PMWA 1LYLA 1NE3A 3S1QH 2F52A 3J81j 3M4OH 4A3FG 4H02A 3CC2A 4POFA 4MZ9A 3VDYA 4YHHL 4DUYL 4BA1I 4A3MH 3LGJA 1AE2A 2RF4A 2ES2A 4LFCQ 2KBNA 5IWAQ 3OTOQ 4DV7L 3HOXH 1UWVA 3U58A 1IBMQ 3W1GA 1P16A 1QVCA 1YZ6A 5M5YH 2OTJA 1PA6A 1K3RA 5GADC 4JOIA 4L5SA 3DM3A 3CCMA 1L0WA 4DV3Q 4A3JH 1HZCA 4DV0L 3PF5A 4P72A 4QL5A 3CCSA 3GTKH 1TWAH 1OXXK 1HR0L 3NBHB 2LXKA 3CCVA 4B3ML 5JEAG 3KLWA 4KHPL 1T9HA 3OYYA 3I4OA 2RCNA 4BBSH 4NXML 2VQEQ 3BU2A 1GKHA 3K7UC 4A3EH 4QQBX 3J81c 3KJOA 1N36L 3I4MH 2IX0A 2PMZE 4GOPC 2JA6H 3CXCA 4BY1G 4C3HH 4DV1L 1KD1C 2B29A 1PH7A 4IOAA 5GQOA 4JI8L 4JI5L 2Y0SE 2D0PA 4A93G 5H1SE 3J81i 4GNXC 2BH2A 1AH9A 1S40A 2KCMA 3CPFA 3STBC 1IXRA 3RLOA 2JQOA 1YVCA 2NZOA 4BBRG 5IYCG 3ULPA 1C0AA 3UE1A 1EUJA 1X3EA 3S16H 2MO0A 1YBYA 4DV4Q 3G48A 1Q7YC 1IBLQ 4BY1H 3BZCA 3L7ZC 1YNXA 4NB3A 3J7ZC 3RZDH 4HJ8A 1X56A 1JJ2A 2NVXH 3GO5A 4P73A 4NPSA 1H95A 2R7DA 1SMXA 1PH9A 3HOYG 4A3CH 5E7NA 1UE1A 4A3JG 4GNXB 4DR6L 1V43A 4IPCA 3PF4A 1Q1EA 3PCOB 1K73C 4UP8A 4X66Q 1PVOA 1Y14B 5IWAL 2OQKA 1VQ4A 2Y0SG 2QA4A 1SE8A 2HQLA 4LFAL 1PH6A 3AEVA 5LMNL 3TRZA 5C0XJ 4J15A 4DV5L 4JI6Q 3EN2A 1Y1WH 2E2HH 2JJQA 4L5RC 1EOVA 3CCQA 4KHZA 2NN6I 1CSQA 2C35B 2N8NA 4NXNL 1XNRQ 4JC0A 2GVAA 3L0OA 4DV4L 2K5NA 1N33Q 3I4NG 1VQEA 4YWKA 5LMUQ 1N34Q 3S17H 4JI2Q 1VCIA 4C2MH 1SFOH 2A19A 5JJLA 1VQNA 4A3FH 1Q8KA 2MNAA 4GLXA 5FLMG 1VQIA 1W2BA 1EYGA 3DLLA 5M3FH 2K52A 2K14A 4A3DG 2JA5G 1PH1A 3KDFB 2HHHL 1IYJB 2QGQA 1P8LA 1PH3A 1E1OA 1N34L 1XTDA 2AKWB 4XIGS 3L2PA 4YCUA 2L15A 4HJAA 1EIFA 4K0KQ 5IYDH 1K83H 1UE6A 1V1QA 4A3BH 4JCVE 2AHOB 2FXQA 2IHFA 4OXPA 3RLFA 2B63G 3ER0A 4DK6C 2YV5A 2V1CC 5IT9c 1HNWL 4LF9L 1CKNB 3F2BA 1KXLA 4LFBL 3S15H 3CW2C 2CCZA 1YI2A 1VQ9A 4EQ5A 3EBEA 3M4PA 4DAMA 4X64L 4HIOA 2DGYA 3ICEA 1BVSA 5HGQA 1XPRA 2Q2UA 1EFWA 4A3GG 3JAMi 4A3CG 4DR6Q 3HOUH 2KHJA 4BY7H 4YCWA 5C4XG 2RHSB 1GD7A 2R92G 2ID0A 1VQOA 3H3VI 4R4IA 1QZHA 1U0LA 1HR0Q 1VQ7A 2PI2E 2Q2IA 3HOXG 3CCJA 1ASYA 4YHHQ 4DUYQ 2UXDL 2I5HA 4IJLA 4RMFA 3M4QA 4OWXB 4A3EG 4LF8Q 3HKZG 2CWPA 3HOYH 4A3DH 4BXXH 1XMQL 1JJCB 4LF4L 1X55A 2MQHA 3A0JA 3BJUA 2Z6KA 5BR8Q 1G291 2I5LX 2KCTA 3E9IA 1VQGA 5JEAJ 2ZTCA 1WI5A 4LF7Q 2H5XA 4JOIC 5IYBG 5IYCH 4DK3C 3BZKA 2PI2A 5C4XH 3JAMc 4X65L 4KI0A 4JBKA 1SROA 1N33L 4KHPQ 1O7IA 4B3MQ 1I50H 3AFPA 1NJIC 3PSIA 4DPGA 3CD6A 4DR7Q 2ZTEA 1OXTA 1FL0A 3STBD 4OO1G 3T1HQ 4JV5L 5K36G 4NXNQ 1XNRL 2VZAA 4B3RQ 1XMOQ 4Y7NH 3NENA 4OWWB 3KF6B 4UP9A 2HIXA 4A3MG 3HOVG 4BY7G 2IX1A 1KRSA 3PO3H 1QVFA 5IE8A 4JI1L 3CMEA 2ZJQA 1PH4A 2PQAA 4ME3A 2E5LL 4DR7L 3J80i 4LF9Q 1Y1VH 5GROA 5M5WH 2CWAA 2F4VL 5IP9H 2CQOA 1HZAA 1S72A 1HZBA 4X62Q 4PZ8A 1C7YA 1WYDA 3GD7A 3KYHC 4GN3B 4LFCL 1VQ6A 1E24A 4YY3Q 2UXCQ 3JC66 1ASZA 1CKOA 1QUQA 2UUBL 4B3TL 1YJWA 4BBRH 1JJGA 1WJJA 1E7ZA 5GAHC 1M90C 3U50C 1E22A 1HNXQ 2ZTDA 4RG1A 3T1YQ 4B3TQ 4UY8C 1DGSA 2R93H 3E0EA 2UXCL 1D8LA 2WAQE 5AJ3Q 2VUMH 1K9MC 1A62A 3MEFA 2UUCQ 2I5MX 1YHAA 2B3GA 4AYBG 4X64Q 2AWNA 4GOPA 1WOCA 4LFBQ 1FJGL 2E5LQ 3CP0A 4R1JA 4JI8Q 3UE0A 3PIPA 1VQJA 4R4OA 3HOZH 4WJ4A 1Z9FA 3AQQA 2OQ0A 1PYSB 3UDIA 4HIMA 4JBWA 3KDFA 2KHIA 4OWTB 1EIYB 2R7FA 3K0XA 3H0GG 4JG2A 3KJPA 1Q81C 4BXXG 1K8AC 4JYAQ 3W1BA 1RIPA 3MXNB 1D7QA 1CUKA 1EQRA 4A3IG 3RZOH 5GAEC 4GKJL 3CCLA 4DV0Q 4JI1Q 5EAYA 1PH8A 4P71A 4DV3L 4C3JH 1A0IA 5HY6A 1VQKA 3M7NA 1OXSC 3HKZE 4DUZL 2R92H 1CKNA 2JA7G 3I55A 1LTLA 1SLJA 2KENA 3F1ZA 1GM5A 2YU9H 4LF6Q 1EWIA 3AFQA 4DR3L 5M3MH 1HNXL 4JI7Q 1XNQL 1YITA 1Q86C 3CC7A 3GTOH 1I3QH 2PNHA 2ATWA 3CCEA 5JJKA 1JT8A 5C0XI 4GN4B 4LF8L 4O2DA 4IPDA 4OONA 3WWVA 1TWGH 2VY3A 3CCUA 2UUBQ 3B6YA 5C3EH 1LUZA 4DR2Q 4O0AA 4JBJA 2UU9Q 2GVBA 2JA7H 4DV1Q 4JYAL 1K8GA 3ZJYC 1VQBA 3U4VA 4DR5Q 1B7YB 4DV6Q 4JI7L 1XNQQ 4DR4L 2R93G 2UXBQ 1J6QA 2OTLA 3F2DA 1HNZL 4A3BG 4DR1Q 2EXDA 1SR3A 3GTLH 1VQCA 1QVGA 3UDXA 4HIKA 3ULJA 3UDGA 3D31A 3CQZH 1OXVA 4MNOA 1HH2P 1C9OA 1VQLA 1IBLL 4JI5Q 2VS1A 1Z47A 3GTQH 1KIXA 3SGIA 1RL2A 2MFIA 1SRUA 4AQYQ 1VQ5A 1UEBA 4LNQA 1M1KC 5C44H 1E3PA 4A3KH 1MJCA 4YCVA 1N8RC 3G71A 4APVA 1L1OC 1YJ9A 4OX9L 2VNUD 1YJNA 1X3FA 2N3SA 4YWMA 2BA0A 4UPAA 2IT1A 1X54A 1Y1VG 4PZ6A 4MTNA 3OTOL 2K5VA 4DV7Q 1VS0A 3GTGH 1Q12A 1YEZA 4TVAB 4XTCS 4L5QA 4YY3L 4IPGA 1FVIA 3NEMA 3S2DH 5IP7G 1I6HH 2NZHA 3NELA 3FP9A 4GOPB 1S3OA 3A5ZB 2I0QA 4JI2L 5LMUL 3GTPH 4C3IH 4PG3A 2JA5H 2R6GA 3TREA 2UXDQ 1TWCH 4UP7A 1BBUA 1VQDA 4ALPA 1QZGA 3RLNA 3G6EA 3RN5A 4IO9A 2IHEA 4LF5Q 1N32L 3H15A 2JA8H 1N9WA 4LUZA 2HHHQ 4AIMA 4A93H 3GDEA 3TS0A 4A3KG 2R7ZG 2EQSA 2N49A 2VQEL 1MJEA 4LUVA 4B3SQ 3CPWA 4WJ3M 4X62L 3PO3G 1NTGA 1Q82C 1OXUA 2BA1A 2NVYH 4R4QA 3HKSA 4X65Q 4B3SL 4QIWE 1TXYA 3PV0A 2VUMG 1HNWQ 4IFDG 4JI4Q 1G6PA 1HR0W 1NY4A 2XGTA 2ZM6Q 2R7ZH 1KAWA 3I56A 3CC4A 2DUDA 1YHBA 3FHWA 1XMOL 3I4MG 5BR8L 3KF6A 3T1HL 4DR3Q 5LMNQ 3K8AA 4L5TA 3K81C 1WCMH 4YWLA 3S2HH 3Q8DA 3CAMA 2PQAB 2UUCL 2ALYB 1VQFA 5AJ3L 2HIVA 2VQFQ 2D62A 3E9HA 4AH6A 1BBWA 2ASBA 2YYZA 4JBMA 1IBKL 3EIVA 4R4CA 2YTYA 3H0GH 1GVPA 4QGUA 1BKBA 3PUVA 1A63A 4JI3L 3AYHB 2EIFA 2Z0SA 5ELNA 3RNUA 3I7FA 1I5FA 2ZM6L 5C44G 2NN6G 4DV5Q 1L1OB 4GKJQ 1XPUA 2Q2TA 1E1TA 3H3VH 1SN8A 4GS3A 4A75A 2MO1A 2HT1A 3KFUA 5JJIA 4OO1I 1V9PA 1KL9A 3KOJA 2AWOA 3TEHB 4OX9Q 1X65A 4X6AH 2OCEA 1J5EQ 3HOVH 5LMNW 3U4ZA 4QJFA 4JV5Q 4DV2L 1CSPA 1CKMA 5FJ8H 3HOZG 3M3YH 4GKKL 1MKHA 2JEBI 2A8VA 4GLAC 4FDBA 2JE6I 1Q46A 4DR2L 4IOCA 2AMCB 2VQFL 5IP7H 1AE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP8 J;  4P75 A;  2N78 A;  1PV4 A;  2F4V Q;  4DR1 L;  1L2F A;  1HNZ Q;  3TS2 A;  2UXB L;  1GO3 E;  1HZ9 A;  1NBW A;  2NVQ H;  5M3M G;  4DR5 L;  1WFQ A;  4DR4 Q;  1VQH A;  2A1A A;  3F8T A;  3PUX A;  1R9T H;  3J7A 5;  5IY0 A;  4GNX A;  4BBS G;  4HJ9 A;  1U5K A;  1EQQ A;  1B8A A;  1UE7 A;  2XTI A;  2LSS A;  1W3S A;  1MIU A;  2Q2H A;  3FKI G;  4EX5 A;  4LFA Q;  1NMG A;  1XPO A;  2WAQ G;  2K5H A;  4GLV B;  1PH5 A;  2K50 A;  4AQY L;  4DNI A;  2WB1 E;  2UUA L;  1X6O A;  4AYB E;  1X9N A;  2WFW A;  2E2J H;  1YHQ A;  1WCM G;  3HOW G;  2RHQ B;  2JEA I;  2BH8 A;  2YTV A;  3ULL A;  2E2I H;  1JE5 A;  3PO2 H;  5C3E G;  3PIO A;  4DUZ Q;  1VQ8 A;  2NVT H;  3PUW A;  3S14 H;  4JI0 L;  1HJP A;  4LW1 A;  4LUO A;  4HID A;  1PHJ A;  3FKI H;  3F2C A;  4KLK A;  1L1O A;  4A76 A;  2VW9 A;  4IJH A;  4IPH A;  2OWO A;  4LF4 Q;  4PZ7 A;  4DV6 L;  2K4K A;  1A8V A;  3S24 A;  4DAY B;  5FLX c;  2JA6 G;  1XMQ Q;  2JA8 G;  2F3I A;  2E8G A;  3K7A H;  3RR5 A;  3UDF A;  4A3I H;  5M5X H;  3S1M H;  4Y52 H;  3CCR A;  3HOU G;  2UU9 L;  5IYB H;  1JB7 A;  2CKZ B;  2JK8 A;  2QEX A;  1PH2 A;  1PYB A;  4HJ5 A;  4POG A;  2YTX A;  3GTJ H;  3T1Y L;  3CMA A;  3PUY A;  1KQS A;  5ELO A;  2WB1 G;  1K0R A;  1VQM A;  4LWC A;  4LF5 L;  1N32 Q;  5DLQ E;  1TWH H;  2D0O A;  1N36 Q;  3RN2 A;  1I94 Q;  3HOW H;  1FJG Q;  1LM0 A;  5C0X G;  3A5U A;  4LF6 L;  1YIJ A;  1TWF H;  4A3G H;  4IFD J;  1QUQ B;  3ERS X;  3M85 A;  1Q1B A;  5M3F G;  3S1R H;  2B63 H;  3PUZ A;  3S1N H;  4R4T A;  1VQP A;  2IY5 B;  3D0F A;  1UE5 A;  5GAG C;  1KC8 C;  1KRT A;  1I94 L;  2JA9 A;  2LXJ A;  1JMC A;  1FGU A;  3I4N H;  1IL2 A;  1XJV A;  1X3G A;  5J3B A;  2ZJR A;  4GKK Q;  2GN5 A;  2ZJP A;  1OTC A;  1B70 B;  5FLM H;  4DV2 Q;  4JI4 L;  2VL6 A;  4JI6 L;  3A74 A;  1J5E L;  4P74 A;  1Y1W G;  4NXM Q;  4A3L G;  3PGZ A;  4K0K L;  1G51 A;  3GTM H;  1IZ6 A;  5FJ8 G;  4TQU S;  2UUA Q;  3KF8 B;  4X66 L;  5IYD G;  3J80 c;  1KHI A;  4A4I A;  2Z6K C;  5IP9 G;  1IBK Q;  3PO2 G;  3HFZ B;  4QY7 A;  3OW2 A;  4IFD I;  4LF7 L;  1VQA A;  3TQY A;  4JI0 Q;  3K80 C;  3G4S A;  5C4J H;  4GN5 A;  3IRB A;  4BA2 I;  1NMF A;  3W5O A;  1PFS A;  3I2Z A;  3M9B A;  2CFM A;  4DKA C;  4B3R L;  4A3L H;  3CF5 A;  4HJ7 A;  4JI3 Q;  2K75 A;  1IBM L;  4PMW A;  1LYL A;  1NE3 A;  3S1Q H;  2F52 A;  3J81 j;  3M4O H;  4A3F G;  4H02 A;  3CC2 A;  4POF A;  4MZ9 A;  3VDY A;  4YHH L;  4DUY L;  4BA1 I;  4A3M H;  3LGJ A;  1AE2 A;  2RF4 A;  2ES2 A;  4LFC Q;  2KBN A;  5IWA Q;  3OTO Q;  4DV7 L;  3HOX H;  1UWV A;  3U58 A;  1IBM Q;  3W1G A;  1P16 A;  1QVC A;  1YZ6 A;  5M5Y H;  2OTJ A;  1PA6 A;  1K3R A;  5GAD C;  4JOI A;  4L5S A;  3DM3 A;  3CCM A;  1L0W A;  4DV3 Q;  4A3J H;  1HZC A;  4DV0 L;  3PF5 A;  4P72 A;  4QL5 A;  3CCS A;  3GTK H;  1TWA H;  1OXX K;  1HR0 L;  3NBH B;  2LXK A;  3CCV A;  4B3M L;  5JEA G;  3KLW A;  4KHP L;  1T9H A;  3OYY A;  3I4O A;  2RCN A;  4BBS H;  4NXM L;  2VQE Q;  3BU2 A;  1GKH A;  3K7U C;  4A3E H;  4QQB X;  3J81 c;  3KJO A;  1N36 L;  3I4M H;  2IX0 A;  2PMZ E;  4GOP C;  2JA6 H;  3CXC A;  4BY1 G;  4C3H H;  4DV1 L;  1KD1 C;  2B29 A;  1PH7 A;  4IOA A;  5GQO A;  4JI8 L;  4JI5 L;  2Y0S E;  2D0P A;  4A93 G;  5H1S E;  3J81 i;  4GNX C;  2BH2 A;  1AH9 A;  1S40 A;  2KCM A;  3CPF A;  3STB C;  1IXR A;  3RLO A;  2JQO A;  1YVC A;  2NZO A;  4BBR G;  5IYC G;  3ULP A;  1C0A A;  3UE1 A;  1EUJ A;  1X3E A;  3S16 H;  2MO0 A;  1YBY A;  4DV4 Q;  3G48 A;  1Q7Y C;  1IBL Q;  4BY1 H;  3BZC A;  3L7Z C;  1YNX A;  4NB3 A;  3J7Z C;  3RZD H;  4HJ8 A;  1X56 A;  1JJ2 A;  2NVX H;  3GO5 A;  4P73 A;  4NPS A;  1H95 A;  2R7D A;  1SMX A;  1PH9 A;  3HOY G;  4A3C H;  5E7N A;  1UE1 A;  4A3J G;  4GNX B;  4DR6 L;  1V43 A;  4IPC A;  3PF4 A;  1Q1E A;  3PCO B;  1K73 C;  4UP8 A;  4X66 Q;  1PVO A;  1Y14 B;  5IWA L;  2OQK A;  1VQ4 A;  2Y0S G;  2QA4 A;  1SE8 A;  2HQL A;  4LFA L;  1PH6 A;  3AEV A;  5LMN L;  3TRZ A;  5C0X J;  4J15 A;  4DV5 L;  4JI6 Q;  3EN2 A;  1Y1W H;  2E2H H;  2JJQ A;  4L5R C;  1EOV A;  3CCQ A;  4KHZ A;  2NN6 I;  1CSQ A;  2C35 B;  2N8N A;  4NXN L;  1XNR Q;  4JC0 A;  2GVA A;  3L0O A;  4DV4 L;  2K5N A;  1N33 Q;  3I4N G;  1VQE A;  4YWK A;  5LMU Q;  1N34 Q;  3S17 H;  4JI2 Q;  1VCI A;  4C2M H;  1SFO H;  2A19 A;  5JJL A;  1VQN A;  4A3F H;  1Q8K A;  2MNA A;  4GLX A;  5FLM G;  1VQI A;  1W2B A;  1EYG A;  3DLL A;  5M3F H;  2K52 A;  2K14 A;  4A3D G;  2JA5 G;  1PH1 A;  3KDF B;  2HHH L;  1IYJ B;  2QGQ A;  1P8L A;  1PH3 A;  1E1O A;  1N34 L;  1XTD A;  2AKW B;  4XIG S;  3L2P A;  4YCU A;  2L15 A;  4HJA A;  1EIF A;  4K0K Q;  5IYD H;  1K83 H;  1UE6 A;  1V1Q A;  4A3B H;  4JCV E;  2AHO B;  2FXQ A;  2IHF A;  4OXP A;  3RLF A;  2B63 G;  3ER0 A;  4DK6 C;  2YV5 A;  2V1C C;  5IT9 c;  1HNW L;  4LF9 L;  1CKN B;  3F2B A;  1KXL A;  4LFB L;  3S15 H;  3CW2 C;  2CCZ A;  1YI2 A;  1VQ9 A;  4EQ5 A;  3EBE A;  3M4P A;  4DAM A;  4X64 L;  4HIO A;  2DGY A;  3ICE A;  1BVS A;  5HGQ A;  1XPR A;  2Q2U A;  1EFW A;  4A3G G;  3JAM i;  4A3C G;  4DR6 Q;  3HOU H;  2KHJ A;  4BY7 H;  4YCW A;  5C4X G;  2RHS B;  1GD7 A;  2R92 G;  2ID0 A;  1VQO A;  3H3V I;  4R4I A;  1QZH A;  1U0L A;  1HR0 Q;  1VQ7 A;  2PI2 E;  2Q2I A;  3HOX G;  3CCJ A;  1ASY A;  4YHH Q;  4DUY Q;  2UXD L;  2I5H A;  4IJL A;  4RMF A;  3M4Q A;  4OWX B;  4A3E G;  4LF8 Q;  3HKZ G;  2CWP A;  3HOY H;  4A3D H;  4BXX H;  1XMQ L;  1JJC B;  4LF4 L;  1X55 A;  2MQH A;  3A0J A;  3BJU A;  2Z6K A;  5BR8 Q;  1G29 1;  2I5L X;  2KCT A;  3E9I A;  1VQG A;  5JEA J;  2ZTC A;  1WI5 A;  4LF7 Q;  2H5X A;  4JOI C;  5IYB G;  5IYC H;  4DK3 C;  3BZK A;  2PI2 A;  5C4X H;  3JAM c;  4X65 L;  4KI0 A;  4JBK A;  1SRO A;  1N33 L;  4KHP Q;  1O7I A;  4B3M Q;  1I50 H;  3AFP A;  1NJI C;  3PSI A;  4DPG A;  3CD6 A;  4DR7 Q;  2ZTE A;  1OXT A;  1FL0 A;  3STB D;  4OO1 G;  3T1H Q;  4JV5 L;  5K36 G;  4NXN Q;  1XNR L;  2VZA A;  4B3R Q;  1XMO Q;  4Y7N H;  3NEN A;  4OWW B;  3KF6 B;  4UP9 A;  2HIX A;  4A3M G;  3HOV G;  4BY7 G;  2IX1 A;  1KRS A;  3PO3 H;  1QVF A;  5IE8 A;  4JI1 L;  3CME A;  2ZJQ A;  1PH4 A;  2PQA A;  4ME3 A;  2E5L L;  4DR7 L;  3J80 i;  4LF9 Q;  1Y1V H;  5GRO A;  5M5W H;  2CWA A;  2F4V L;  5IP9 H;  2CQO A;  1HZA A;  1S72 A;  1HZB A;  4X62 Q;  4PZ8 A;  1C7Y A;  1WYD A;  3GD7 A;  3KYH C;  4GN3 B;  4LFC L;  1VQ6 A;  1E24 A;  4YY3 Q;  2UXC Q;  3JC6 6;  1ASZ A;  1CKO A;  1QUQ A;  2UUB L;  4B3T L;  1YJW A;  4BBR H;  1JJG A;  1WJJ A;  1E7Z A;  5GAH C;  1M90 C;  3U50 C;  1E22 A;  1HNX Q;  2ZTD A;  4RG1 A;  3T1Y Q;  4B3T Q;  4UY8 C;  1DGS A;  2R93 H;  3E0E A;  2UXC L;  1D8L A;  2WAQ E;  5AJ3 Q;  2VUM H;  1K9M C;  1A62 A;  3MEF A;  2UUC Q;  2I5M X;  1YHA A;  2B3G A;  4AYB G;  4X64 Q;  2AWN A;  4GOP A;  1WOC A;  4LFB Q;  1FJG L;  2E5L Q;  3CP0 A;  4R1J A;  4JI8 Q;  3UE0 A;  3PIP A;  1VQJ A;  4R4O A;  3HOZ H;  4WJ4 A;  1Z9F A;  3AQQ A;  2OQ0 A;  1PYS B;  3UDI A;  4HIM A;  4JBW A;  3KDF A;  2KHI A;  4OWT B;  1EIY B;  2R7F A;  3K0X A;  3H0G G;  4JG2 A;  3KJP A;  1Q81 C;  4BXX G;  1K8A C;  4JYA Q;  3W1B A;  1RIP A;  3MXN B;  1D7Q A;  1CUK A;  1EQR A;  4A3I G;  3RZO H;  5GAE C;  4GKJ L;  3CCL A;  4DV0 Q;  4JI1 Q;  5EAY A;  1PH8 A;  4P71 A;  4DV3 L;  4C3J H;  1A0I A;  5HY6 A;  1VQK A;  3M7N A;  1OXS C;  3HKZ E;  4DUZ L;  2R92 H;  1CKN A;  2JA7 G;  3I55 A;  1LTL A;  1SLJ A;  2KEN A;  3F1Z A;  1GM5 A;  2YU9 H;  4LF6 Q;  1EWI A;  3AFQ A;  4DR3 L;  5M3M H;  1HNX L;  4JI7 Q;  1XNQ L;  1YIT A;  1Q86 C;  3CC7 A;  3GTO H;  1I3Q H;  2PNH A;  2ATW A;  3CCE A;  5JJK A;  1JT8 A;  5C0X I;  4GN4 B;  4LF8 L;  4O2D A;  4IPD A;  4OON A;  3WWV A;  1TWG H;  2VY3 A;  3CCU A;  2UUB Q;  3B6Y A;  5C3E H;  1LUZ A;  4DR2 Q;  4O0A A;  4JBJ A;  2UU9 Q;  2GVB A;  2JA7 H;  4DV1 Q;  4JYA L;  1K8G A;  3ZJY C;  1VQB A;  3U4V A;  4DR5 Q;  1B7Y B;  4DV6 Q;  4JI7 L;  1XNQ Q;  4DR4 L;  2R93 G;  2UXB Q;  1J6Q A;  2OTL A;  3F2D A;  1HNZ L;  4A3B G;  4DR1 Q;  2EXD A;  1SR3 A;  3GTL H;  1VQC A;  1QVG A;  3UDX A;  4HIK A;  3ULJ A;  3UDG A;  3D31 A;  3CQZ H;  1OXV A;  4MNO A;  1HH2 P;  1C9O A;  1VQL A;  1IBL L;  4JI5 Q;  2VS1 A;  1Z47 A;  3GTQ H;  1KIX A;  3SGI A;  1RL2 A;  2MFI A;  1SRU A;  4AQY Q;  1VQ5 A;  1UEB A;  4LNQ A;  1M1K C;  5C44 H;  1E3P A;  4A3K H;  1MJC A;  4YCV A;  1N8R C;  3G71 A;  4APV A;  1L1O C;  1YJ9 A;  4OX9 L;  2VNU D;  1YJN A;  1X3F A;  2N3S A;  4YWM A;  2BA0 A;  4UPA A;  2IT1 A;  1X54 A;  1Y1V G;  4PZ6 A;  4MTN A;  3OTO L;  2K5V A;  4DV7 Q;  1VS0 A;  3GTG H;  1Q12 A;  1YEZ A;  4TVA B;  4XTC S;  4L5Q A;  4YY3 L;  4IPG A;  1FVI A;  3NEM A;  3S2D H;  5IP7 G;  1I6H H;  2NZH A;  3NEL A;  3FP9 A;  4GOP B;  1S3O A;  3A5Z B;  2I0Q A;  4JI2 L;  5LMU L;  3GTP H;  4C3I H;  4PG3 A;  2JA5 H;  2R6G A;  3TRE A;  2UXD Q;  1TWC H;  4UP7 A;  1BBU A;  1VQD A;  4ALP A;  1QZG A;  3RLN A;  3G6E A;  3RN5 A;  4IO9 A;  2IHE A;  4LF5 Q;  1N32 L;  3H15 A;  2JA8 H;  1N9W A;  4LUZ A;  2HHH Q;  4AIM A;  4A93 H;  3GDE A;  3TS0 A;  4A3K G;  2R7Z G;  2EQS A;  2N49 A;  2VQE L;  1MJE A;  4LUV A;  4B3S Q;  3CPW A;  4WJ3 M;  4X62 L;  3PO3 G;  1NTG A;  1Q82 C;  1OXU A;  2BA1 A;  2NVY H;  4R4Q A;  3HKS A;  4X65 Q;  4B3S L;  4QIW E;  1TXY A;  3PV0 A;  2VUM G;  1HNW Q;  4IFD G;  4JI4 Q;  1G6P A;  1HR0 W;  1NY4 A;  2XGT A;  2ZM6 Q;  2R7Z H;  1KAW A;  3I56 A;  3CC4 A;  2DUD A;  1YHB A;  3FHW A;  1XMO L;  3I4M G;  5BR8 L;  3KF6 A;  3T1H L;  4DR3 Q;  5LMN Q;  3K8A A;  4L5T A;  3K81 C;  1WCM H;  4YWL A;  3S2H H;  3Q8D A;  3CAM A;  2PQA B;  2UUC L;  2ALY B;  1VQF A;  5AJ3 L;  2HIV A;  2VQF Q;  2D62 A;  3E9H A;  4AH6 A;  1BBW A;  2ASB A;  2YYZ A;  4JBM A;  1IBK L;  3EIV A;  4R4C A;  2YTY A;  3H0G H;  1GVP A;  4QGU A;  1BKB A;  3PUV A;  1A63 A;  4JI3 L;  3AYH B;  2EIF A;  2Z0S A;  5ELN A;  3RNU A;  3I7F A;  1I5F A;  2ZM6 L;  5C44 G;  2NN6 G;  4DV5 Q;  1L1O B;  4GKJ Q;  1XPU A;  2Q2T A;  1E1T A;  3H3V H;  1SN8 A;  4GS3 A;  4A75 A;  2MO1 A;  2HT1 A;  3KFU A;  5JJI A;  4OO1 I;  1V9P A;  1KL9 A;  3KOJ A;  2AWO A;  3TEH B;  4OX9 Q;  1X65 A;  4X6A H;  2OCE A;  1J5E Q;  3HOV H;  5LMN W;  3U4Z A;  4QJF A;  4JV5 Q;  4DV2 L;  1CSP A;  1CKM A;  5FJ8 H;  3HOZ G;  3M3Y H;  4GKK L;  1MKH A;  2JEB I;  2A8V A;  4GLA C;  4FDB A;  2JE6 I;  1Q46 A;  4DR2 L;  4IOC A;  2AMC B;  2VQF L;  5IP7 H;  1AE3 A; 
#chains in the Genus database with same CATH topology
 2PCF B;  2WP8 J;  3A56 A;  3TP7 A;  3AMU A;  3J81 L;  4DAY A;  5M3M G;  4DR4 Q;  5FK9 C;  1R9T H;  3I70 A;  4XQQ A;  3PQI A;  2LSS A;  4GLV B;  2B2T C;  1ILQ A;  1X6O A;  1STY A;  3NPP A;  1PFB A;  2E2J H;  3HOW G;  2YTV A;  4A3M B;  2F4I A;  1H9K A;  4DUZ Q;  1VQ8 A;  1C48 A;  3PUW A;  3S14 H;  1HJP A;  1I4Q A;  4HID A;  1X3Q A;  3LNN A;  3WOE A;  1PFM A;  3DXJ C;  4PZ7 A;  2K4K A;  2F3I A;  3K7A H;  3UDF A;  5M5X H;  4F87 A;  3HOU G;  5CV4 A;  2AUJ D;  4NMZ A;  4DA2 A;  1AN8 A;  1Y69 U;  4F7X A;  2EY1 A;  2WB1 G;  1VQM A;  4I65 A;  3TZU A;  4DFA A;  2ZXO A;  3G7L A;  3Q6S A;  1LM0 A;  5C0X G;  1YIJ A;  3P20 A;  3A8K E;  1QCB D;  4A3G H;  3M85 A;  2B63 H;  3I4M B;  3D0F A;  1UE5 A;  2EPB A;  1I94 L;  1MGS A;  1DOM A;  1XJV A;  1OTC A;  1J5E L;  1II3 A;  1KDB A;  4K5V A;  2EOT A;  2F0M A;  4TQU S;  3TSS A;  3OSO A;  1XX8 A;  4IQZ A;  3EVQ A;  3PO2 G;  4QY7 A;  4FF1 A;  4LF7 L;  1VQA A;  2C9O A;  3TQY A;  3K80 C;  5C4J H;  1NCV A;  2UXC Q;  1NMF A;  3W5O A;  1PFS A;  2E75 C;  4A3L H;  4DKA C;  4P2C B;  2K75 A;  1IBM L;  1A3V A;  4K5X A;  3S1Q H;  3M4O H;  3HRZ C;  1JWM D;  3EJI A;  4A3F G;  3IFD A;  3VDY A;  4YHH L;  4DUY L;  4BA1 I;  4LFC Q;  1LT6 D;  3HOX H;  1UWV A;  2CVR A;  4K6L A;  2O4X A;  3NQI A;  3W1G A;  1LT4 D;  4HR7 B;  1M4V A;  2TMP A;  3CCM A;  4A3J H;  1HZC A;  2B2Y A;  2F0T A;  3CCS A;  4HMJ A;  1CHQ D;  3D6C A;  1H9S A;  4HMI A;  3OYY A;  1HUM A;  5CV5 A;  4CJ1 B;  4HSP A;  3KK7 A;  3J81 c;  5CC4 A;  4X3U A;  4F8M A;  2IX0 A;  4GOP C;  3CXC A;  1NAP A;  2AQ1 B;  5IIF A;  4IOA A;  2XN9 C;  1RTN A;  4BY7 B;  2D0P A;  4DAV A;  3STB C;  4FF4 A;  1YVC A;  4H13 C;  2NZO A;  1BF4 A;  1C0A A;  2QW7 A;  4U68 A;  1KAA A;  1PDQ A;  1YBY A;  5IGC A;  4DV4 Q;  3G48 A;  1F77 A;  4BS9 A;  4JI5 Q;  3L7Z C;  1YNX A;  3RZD H;  3NXW A;  3TBI B;  1EYA A;  3GO5 A;  4P73 A;  3MHB A;  4G57 A;  1SMX A;  3OHX C;  2DJF C;  1X32 A;  3HOY G;  4A3J G;  5A35 A;  4FXK C;  3PCO B;  2F0L A;  4UP8 A;  1VQ4 A;  3IFT A;  3TRZ A;  3AEV A;  4CKE A;  2Q8R E;  3FEW X;  5C0X J;  4J15 A;  4JI6 Q;  3R2T A;  5A2Q L;  2E2H H;  5KRU A;  1SAP A;  4I7A A;  1DD2 A;  2QIL A;  1G8Z D;  1EZ8 A;  4OGQ C;  1VQE A;  1BCP D;  1SNC A;  5LMU Q;  3S17 H;  1SFO H;  3DWQ A;  1TS3 A;  2A19 A;  1J9O A;  3DEO A;  2MNA A;  1VQI A;  1EYG A;  3CRL C;  1KDC A;  2JA5 G;  1PH1 A;  3KDF B;  1E1O A;  3V2T A;  1XTD A;  4XIG S;  2L11 A;  4YCU A;  2L15 A;  5IYD H;  1UE6 A;  2KEC A;  4X3S A;  1MHW C;  4JCV E;  4OXP A;  3RLF A;  2O5I C;  3ER0 A;  4DU9 A;  1TS2 A;  2PQE A;  5C3X A;  1X3P A;  1KXL A;  4LFB L;  3NBH A;  3S15 H;  1STH A;  4DAM A;  4A3G G;  1BVS A;  5C5M A;  5HGQ A;  4A3C G;  4DR6 Q;  2WIN B;  1GD7 A;  4L6T B;  4CKB A;  4R4I A;  1U0L A;  1HR0 Q;  1XXG A;  1VQ7 A;  2PI2 E;  2VB2 X;  1ASY A;  3S16 B;  4KKS A;  4RCO A;  1RDP D;  4IJL A;  4RMF A;  1R4Q B;  3MZ5 A;  4LF8 Q;  2NVX B;  2G9D A;  4BXX H;  1XMQ L;  1EY5 A;  2RSN A;  4LF4 L;  3A0J A;  4B08 A;  2H5X A;  1KAB A;  5IYC H;  5C4X H;  3VR5 A;  4JBK A;  1Y1W B;  1O7I A;  3QOJ A;  5E1F A;  4MHE A;  3PSI A;  1NJI C;  1UUP A;  1OXT A;  4OO1 G;  4ZYS A;  2VZA A;  4B3R Q;  4MIU A;  1GUO A;  1I4H A;  2IJ0 A;  4OWW B;  4UP9 A;  4CHT B;  4RKB A;  5I2Y A;  5ELC A;  4O42 A;  1V1O A;  2RDF A;  2L4N A;  1MD2 D;  1LTS D;  4IUR A;  3J80 i;  3T53 B;  5M5W H;  2CQO A;  1EWC A;  1HZA A;  1HZB A;  4X62 Q;  4K2L A;  1E24 A;  2XRQ D;  1ASZ A;  4B3T L;  3ND8 A;  1JJG A;  3DUZ A;  1FD7 D;  5CV8 A;  1HNX Q;  4B9X A;  1JQY D;  3I4N B;  2DNE A;  5C4Z A;  3NHH A;  1STN A;  2UXC L;  2WAQ E;  1UNS A;  3MEF A;  1DXM A;  2I5M X;  2Q8I B;  4AYB G;  1WOC A;  1T5E A;  3GTM B;  1Z9F A;  1JE4 A;  1PRT C;  2B63 B;  2A6H C;  4ZCK A;  1PYS B;  2KHI A;  2X6L A;  2N55 A;  3W1B A;  4OEM B;  4J1M A;  4C3H G;  2K5Q A;  3RZO H;  4UHV A;  2QEJ C;  3QWN A;  1ET6 A;  4P71 A;  4DV3 L;  1A0I A;  5HY6 A;  2F0J A;  1LTL A;  3HG9 A;  1EWI A;  2QKI C;  3NK9 A;  5M3M H;  3GTO H;  2G9H D;  1YIT A;  1Q86 C;  3I72 A;  2ATW A;  4C3J B;  5M9O A;  3AU7 A;  3FVQ A;  2VY3 A;  5EBD A;  2FMC A;  1LUZ A;  4DR2 Q;  4JBJ A;  4Y7N B;  2GVB A;  4R9W A;  3KLS A;  4CJ2 C;  4CDC C;  3S1Q B;  1B7Y B;  2R93 G;  2NBF A;  2OTL A;  1HNZ L;  2KOL A;  1VQC A;  3D31 A;  2F0Q A;  1NUC A;  3CQZ H;  4A3E B;  2LKV A;  1VQL A;  3I90 A;  3GTL B;  2NTS A;  2MFI A;  2JYO A;  1E2V A;  1F9R A;  1G2T A;  1BQQ T;  3GTQ B;  4APV A;  1L1O C;  2DY8 A;  4B9W A;  1YJ9 A;  1Y1V G;  4MTN A;  2K5V A;  5C3W A;  3MXN A;  3SK8 A;  4JVZ A;  4A3K B;  4ZRZ A;  4XTC S;  1TU2 B;  1JWS D;  4YY3 L;  1FVI A;  4ZLT F;  3GTP H;  4JI2 L;  3A5Z B;  1TWH B;  3H94 A;  2UXD Q;  2WAQ B;  3E0J A;  2HHH Q;  4A3K G;  1UAP A;  4K8J A;  3E6Z X;  2N49 A;  4LUV A;  1GHJ A;  1QB5 D;  1LO5 D;  4WJ3 M;  4X62 L;  1AP0 A;  1S5E D;  3RZD B;  1Q82 C;  5JAV A;  2R92 B;  3I4L A;  1PTO C;  2B2V A;  3HKS A;  4DF7 A;  1ZXT A;  2K6A A;  4LMQ D;  3PV0 A;  1HNW Q;  4C2M B;  1CQV A;  4X3K A;  1KAW A;  3I56 A;  1K3B C;  4ULL A;  3ZYY X;  5M3F B;  4FVM A;  4DR3 Q;  5LMN Q;  4ILW A;  1KLG D;  1SE2 A;  3D8G A;  3S2H H;  2PQA B;  1D5M C;  3BG3 A;  1VQF A;  2BDN A;  2HIV A;  5A2Q E;  2YYZ A;  5IOD A;  3H0G H;  1BUV T;  3NWT A;  2EVB A;  4F88 A;  1BKB A;  1GUN A;  3PUV A;  4C3J G;  2MHV A;  2NN6 G;  3A8I E;  1KNE A;  2A73 B;  3EQL C;  4DV5 Q;  3C3L A;  2EJF C;  3M7G A;  2SNM A;  2Q2T A;  1E1T A;  1XPU A;  3H3V C;  4GS3 A;  2IWH A;  1EY9 A;  1A6X A;  2HT1 A;  3KFU A;  3N6R A;  5JJI A;  1KL9 A;  5KNB A;  2M2L A;  1SSO A;  3R2I A;  1J5E Q;  4QIW B;  5LMN W;  4JV5 Q;  2GA4 B;  3QG1 A;  1CKM A;  1Z7T A;  5EJW A;  4GKK L;  3S15 B;  4PQX A;  2JEB I;  4FDB A;  4C3I B;  1B4O A;  4DR2 L;  3O13 A;  4KHV A;  3LWE A;  5CV6 A;  5IP7 H;  4P75 A;  2N78 A;  3SXH A;  1HNZ Q;  1D1K A;  1GO3 E;  2NVQ H;  3F8T A;  4EVO A;  2F03 A;  3BS1 A;  4H0L C;  5CYU A;  2Z1C A;  5EPL A;  1NR2 A;  4HJ9 A;  1B8A A;  1UE7 A;  2ICE C;  2XTI A;  4NKL A;  3VYU A;  4ZKB B;  1W3S A;  2E2I B;  3K5L A;  1XPO A;  1PH5 A;  4L63 B;  2WB1 E;  5IGE A;  2UUA L;  2A69 C;  5EPJ A;  2WFW A;  3J81 E;  2EYL A;  1WCM G;  2RHQ B;  1BBX C;  1A3U A;  5KGU A;  3PO2 H;  3PIO A;  2NVT H;  4JI0 L;  4LW1 A;  1RF2 D;  1PHJ A;  3FKI H;  4A76 A;  3C46 A;  1HXY D;  4IJH A;  4IPH A;  5DNF A;  4BBR B;  2OWO A;  3NWS A;  3S24 A;  2JA6 G;  1D2B A;  2JA8 G;  4A3I H;  3RR5 A;  3QJY A;  3VYR A;  1TR5 A;  1QG7 A;  4EGV A;  1JB7 A;  2LFN A;  2JK8 A;  1ZYR C;  4HJ5 A;  4ZUJ A;  3HZX A;  2YTX A;  3GTJ H;  4DAP A;  2A6E C;  3PUY A;  1KQS A;  1K0R A;  1STG A;  2Z9H A;  4LWC A;  1N32 Q;  5DLQ E;  1B53 A;  3SEB A;  3URY A;  1B3A A;  3HOW H;  1DZ1 A;  3BDO A;  2V4D A;  4IUP A;  5TSS A;  4LF6 L;  3S1R H;  4PMC A;  3MFG A;  4R4T A;  1VQP A;  1K28 A;  3F2U A;  1J8I A;  5EGT A;  4KJN A;  2I46 A;  1KRT A;  4MN3 A;  1FGU A;  3I4N H;  5J3B A;  1B70 B;  3A74 A;  4CBV A;  1Y1W G;  4NXM Q;  1TT2 A;  4K0K L;  3Q0A A;  3GTM H;  1IZ6 A;  1WD1 A;  1EY0 A;  2KQ3 A;  3KF8 B;  5EKL A;  5EPK A;  3J80 c;  1KHI A;  2OEO A;  2Z6B A;  4KY7 A;  1ICW A;  1IBK Q;  3HFZ B;  3WOF A;  4IFD I;  3BVZ A;  1B50 A;  3MXU A;  4JI0 Q;  2HDL A;  2BOS A;  3KLS X;  4B3R L;  3GQB A;  2CFM A;  1WD0 A;  4N9T A;  5IGF A;  4PMW A;  1LYL A;  5KIX A;  2J4X A;  1NE3 A;  1Q3L A;  2RCF A;  1DOK A;  2XWJ B;  1LT3 D;  3QIA A;  1LTB D;  4H02 A;  3T4A C;  4K2K A;  4A3M H;  1AE2 A;  2KBN A;  2NB0 A;  1WTO A;  1IBM Q;  5M5Y H;  2OTJ A;  1C8C A;  1PA6 A;  4DK1 A;  4N8X 1;  4DV0 L;  2K1B A;  2EDG A;  1SYB A;  1FR3 A;  1TWA H;  1HR0 L;  3NBH B;  2E76 C;  1DCZ A;  4B3M L;  3KLW A;  4A3J B;  4C3H B;  5FLX L;  2RCN A;  2VQE Q;  2A5H A;  4A3E H;  1O78 A;  3E3X A;  1MSG A;  3I4M H;  1TVX A;  1LAB A;  2X69 A;  5GQO A;  4CKC A;  2Y0S E;  3TME A;  3SVM A;  1S40 A;  2KCM A;  1WTV A;  1IXR A;  3RLO A;  1AFP A;  5D3D A;  4RGM A;  3CU7 A;  1Q7Y C;  1N33 L;  4BY1 H;  1JJ2 A;  1U4L A;  1EY7 A;  1X56 A;  2CHB D;  4FXG C;  3GTP B;  3HGB A;  4A3C H;  1SYF A;  3IL8 A;  3K5N A;  4DR6 L;  1FNW A;  3S14 B;  2Z4H A;  2IL8 A;  1Y14 B;  5IWA L;  5D3I B;  3GV3 A;  2O5J C;  1U9R A;  5LMN L;  1K8O A;  5EKI A;  4FXD A;  2JJQ A;  1QIL A;  2C35 B;  2N8N A;  2XSC A;  2K32 A;  4NXN L;  3SR1 A;  1N33 Q;  3IAY A;  1ESR A;  4YWK A;  5ELF A;  4RA8 A;  4C2M H;  5JJL A;  4RH6 A;  1W2B A;  3I8Z A;  4A3G B;  5M3F H;  2R61 A;  3MXG A;  4A3D G;  2HHH L;  1WTQ A;  1PH3 A;  1P8L A;  3U9O A;  1N34 L;  2AKW B;  3L2P A;  1K83 H;  4OO1 H;  1OO9 B;  2FXQ A;  3M4Y A;  1E2Z A;  2PW5 A;  1VF5 C;  3NTK A;  2YV5 A;  5IT9 c;  1TS5 A;  1EWH A;  3F2B A;  4RGT A;  3AB9 A;  2CCZ A;  1YI2 A;  3M4P A;  3ICE A;  2CW0 C;  2SNS A;  1YNJ D;  5LL6 S;  2MP1 A;  1T5X D;  2L9H A;  4XXE A;  4BY7 H;  1DM0 B;  2NUC A;  2R92 G;  2ID0 A;  3H3V I;  2M00 A;  1SJH D;  5BN3 A;  4ZAI A;  2Q2I A;  3HOX G;  3CCJ A;  2XNA C;  3J7Y W;  4NP5 A;  3M4Q A;  3HKZ G;  4QB4 A;  2F0N A;  1O7Z A;  4A3D H;  4ODG A;  2Y0S B;  2HQE A;  1CM9 A;  2MQH A;  1RD9 D;  3BJU A;  3EFX D;  1G29 1;  2I5L X;  2KCT A;  5J1Z A;  1Q90 A;  1CFM A;  1WVL A;  4RAU C;  3VR6 A;  1HTL D;  1QNU A;  4DK3 C;  3JAM c;  2PI2 A;  3BVM A;  4HCS A;  1SRO A;  1C4Q A;  4KHP Q;  1KTK A;  1JOQ A;  4DPG A;  4DR7 Q;  1D5Z C;  2ZTE A;  5K36 G;  4NXN Q;  1XMO Q;  1O7Y A;  3HOV G;  4A3M G;  4BY7 G;  1KRS A;  1SFO B;  1F9P A;  1PRT F;  2PZT A;  2VXW A;  2E5L L;  2F4V L;  5IP9 H;  2EXZ A;  2AQ2 B;  5IT9 E;  4GN3 B;  4LFC L;  4YY3 Q;  2B8F A;  5M5W B;  4BBR H;  1E7Z A;  1KNA A;  4RCN A;  1BNZ A;  4RG1 A;  3I91 A;  4UY8 C;  2R93 H;  1V1P B;  3E0E A;  2HDM A;  3H91 A;  4RGN A;  2AWN A;  3K0Y A;  2KCN A;  2E5L Q;  4KY5 A;  3CP0 A;  3HOZ H;  4FYD A;  1VQJ A;  2HCI A;  1F2Z A;  4HTH A;  3S1R B;  3AQQ A;  3OOC A;  1GUS A;  2DJG C;  4M8A A;  4JBW A;  3KDF A;  1EIY B;  4E6I A;  4JG2 A;  1MSH A;  1K8A C;  4Q0F A;  1I4G A;  4ZUI A;  1RIP A;  5FKA C;  2ENB A;  1CT1 D;  4GKJ L;  3CCL A;  5IOC A;  1TY0 A;  5I4D A;  1H9M A;  3VA7 A;  1F9Q A;  4DUZ L;  3C1F A;  2JA7 G;  3I55 A;  4EQO A;  2KEN A;  5FLX E;  3AFQ A;  1FGB D;  3K6O A;  3QR8 A;  4JI7 Q;  1XNQ L;  4XT1 B;  3CCE A;  1G2S A;  1SBB B;  4O2D A;  2UUB Q;  2D5D A;  1WTP A;  4K8I A;  4K5W A;  5G3L F;  4JYA L;  3MXP A;  4DR4 L;  1EOT A;  1J6Q A;  1NNX A;  3F2D A;  4A3B G;  4DR1 Q;  5ELB A;  1U4M A;  4KMU C;  1QVG A;  3UDX A;  4FF3 A;  5F2D A;  3A7L A;  4LJZ C;  3VA5 A;  4TSS A;  2MGS A;  2A68 D;  1BXT A;  1E3P A;  4YCV A;  2F0E A;  2VNU D;  3GP7 A;  2H4O A;  2BA0 A;  4UPA A;  4YWM A;  1X54 A;  3QOL A;  3OTO L;  1ESF A;  3GTG H;  1Q12 A;  3OWE B;  1ENF A;  4L5Q A;  1ICF B;  3LX0 A;  4HED A;  2BE5 C;  1XYI A;  1WTW A;  5IP7 G;  5DAU A;  3BZD B;  1CA6 A;  5IGG A;  3FP9 A;  1S3O A;  5I9P A;  3BDL A;  1A2U A;  1F2M A;  1Y8O B;  2E74 C;  3TRE A;  1TWC H;  2CH4 W;  1STE A;  4UP7 A;  1PLF A;  3OWF A;  1QZG A;  3RN5 A;  1RCV D;  2K03 A;  2IHE A;  5BN5 A;  4LF5 Q;  1N9W A;  2WAC A;  4AYB B;  3RZO B;  1SMY D;  3BDC A;  3PO3 G;  1BCP C;  1G91 A;  1HFN A;  4IFD G;  1HR0 W;  1NY4 A;  1TQO A;  2XGT A;  2ZM6 Q;  2R7Z H;  2DUD A;  3CHB D;  3FHW A;  2NTT A;  2A74 C;  1BO0 A;  5BR8 L;  3KF6 A;  4ZK9 B;  4IZ8 A;  3T1H L;  3K8A A;  3PIO 3;  2ALY B;  4IUT A;  5CV7 A;  2VQF Q;  1CI3 M;  2F0V A;  1BBW A;  1IBK L;  3EIV A;  1AEX A;  3S1M B;  3S2H B;  2YTY A;  1PZI D;  3CQZ B;  4Z9C B;  3Q23 A;  4QGU A;  5FO8 B;  1K8M A;  2EIF A;  3D6W A;  3RNU A;  1I5F A;  1NR4 A;  3H09 A;  3D4W A;  5C44 G;  3HOU B;  3T51 B;  4GKJ Q;  3FDT A;  4IUV A;  1SN8 A;  4A75 A;  1K83 B;  4KKT A;  3A8J E;  3JAM L;  4OO1 I;  1EYC A;  3TEH B;  4OX9 Q;  1GUT A;  1X65 A;  1HCZ A;  1RKN A;  4QF4 A;  4QJF A;  4DV2 L;  2Q8T A;  1CSP A;  3HOZ G;  3M3Y H;  1MKH A;  2A8V A;  4GLA C;  2A6E D;  4RHR A;  3J80 L;  4IOC A;  4ME5 A;  2AMC B;  3P75 A;  3DEP A;  2EJG C;  2K01 A;  1CZG A;  2EY6 A;  2JA6 B;  3A55 A;  5JPN C;  4NW2 A;  5D14 A;  1VQH A;  2A1A A;  5IY0 A;  4GNX A;  4BBS G;  2KHS A;  3ITP A;  1EQQ A;  4RHS A;  2K5D A;  5IGD A;  2NVQ B;  4LFA Q;  3UI2 A;  2WAQ G;  2BCO A;  2K5H A;  1B1Z A;  2K50 A;  2A69 D;  3SE0 A;  4DNI A;  1B44 D;  4AYB E;  4XDX A;  1X9N A;  3SK6 A;  2JEA I;  2BH8 A;  1CHP D;  2E2I H;  1JE5 A;  4V0B A;  1GJX A;  2XIW A;  4ZQ3 A;  2F0F A;  4LUO A;  1DYQ A;  4OEL B;  1L1O A;  2VW9 A;  3PO2 B;  5FLX c;  2E8G A;  2B8G A;  3I73 A;  5K5P A;  2UU9 L;  3Q24 A;  2CKZ B;  3X3N A;  2QEX A;  1PH2 A;  1IHZ A;  1PYB A;  2F0W A;  3CMA A;  5ELO A;  4A3I B;  4LF5 L;  4KD4 A;  1TWH H;  5J22 A;  1N36 Q;  1W6J A;  1I94 Q;  4A3F B;  3HKZ B;  1TWF H;  3VR4 A;  1QUQ B;  5M3F G;  1Q1B A;  3PUZ A;  2IY5 B;  3K5O A;  2LXJ A;  3J80 E;  2SEB D;  2RDG A;  4L8J A;  1VF7 A;  4KKU A;  5JVG 3;  1LTI D;  1JWU D;  5FLM H;  3KUP A;  3N52 A;  4JI4 L;  1U4P A;  4CGY B;  4I7Z C;  4A3L G;  2DNC A;  1SYD A;  5ELE A;  5FJ8 G;  1BDO A;  4X66 L;  4A4I A;  2Z6K C;  3SK4 A;  3OW2 A;  3QB3 A;  1S5C D;  4R8I A;  2EY5 A;  3IRB A;  2ICI A;  5C3E B;  1TY2 A;  2L5T A;  3CF5 A;  4JI3 Q;  2F3W A;  3H0G B;  5C5L A;  3K57 A;  1PRT D;  2HD3 A;  3CC2 A;  2H1E A;  4MZ9 A;  4IUN A;  2B2Y C;  4WOR A;  5IWA Q;  4DV7 L;  1ILP A;  2B2U C;  3U58 A;  4YIJ A;  4HAE A;  5DM6 3;  1YZ6 A;  1MI2 A;  2PMZ B;  1K3R A;  4L5S A;  2FMM A;  1Y8P B;  1SE4 A;  5KEE A;  4HSV A;  5M5Y B;  1EFI D;  3GTK H;  2J7Z A;  2F0U A;  4CDE C;  2LXK A;  3A7A B;  3CCV A;  5JEA G;  1EIH A;  1S5D D;  1LTG D;  1T9H A;  4K14 A;  1E0B A;  1PRT B;  3HOW B;  1GKH A;  3K7U C;  4QQB X;  3KJO A;  2XRS D;  4HCE A;  2PMZ E;  1LTR D;  4C3H H;  4DV1 L;  2B29 A;  1PH7 A;  1ENA A;  4N9P A;  4JI5 L;  4LAA A;  1STB A;  1STA A;  3J81 i;  5CR3 A;  2AUK A;  3CPF A;  1LTT D;  4A93 B;  2BDO A;  3FMC A;  1D1I A;  4BBR G;  5IYC G;  3ULP A;  3UE1 A;  1EUJ A;  4IUQ A;  5FO9 B;  2MO0 A;  1PTO B;  1GUW A;  1IBL Q;  4NB3 A;  3J7Z C;  1SJE D;  4HJ8 A;  4XYO A;  4DK0 A;  4H44 C;  5DM7 3;  1PH9 A;  5EQ0 A;  1UE1 A;  1JOR A;  4GNX B;  4BY1 B;  1V43 A;  4IPC A;  4C1N I;  1B2T A;  3PF4 A;  1Q1E A;  1K73 C;  3FKI B;  4X66 Q;  1PVO A;  2OQK A;  2QA4 A;  2HQL A;  2FIN B;  5CBA E;  3ONA B;  1WTX A;  4DV5 L;  3EN2 A;  2RBM A;  4L5R C;  1EOV A;  1V1P A;  2RVL A;  3OW7 A;  2NN6 I;  1CSQ A;  2K04 A;  2F0K A;  4RKL A;  3OMG A;  2GVA A;  3LWU A;  4DV4 L;  3I4N G;  1PTO D;  1SNQ A;  4GZY C;  3TDQ A;  3V05 A;  4GLX A;  2K14 A;  4K6D A;  2L12 A;  5JVH 3;  4K0K Q;  4A3B H;  1B9N A;  2WKD A;  5K36 H;  2AHO B;  2BE5 D;  1B3Q A;  1HQM C;  2V1C C;  3DM1 A;  4LF9 L;  2B2W C;  3MAQ A;  3CW2 C;  3W2D A;  4HIO A;  1FNU A;  2Q2U A;  1XPR A;  4M1U B;  3HOU H;  1M8A A;  3KBX A;  5D65 A;  1VQO A;  1QZH A;  1I6V C;  2RKS A;  4YHH Q;  4DUY Q;  2UXD L;  2F0P A;  1F2L A;  4OWX B;  4KTA A;  2CWP A;  3HOY H;  4DNR B;  4QMG A;  3D3R A;  1X55 A;  2Z6K A;  3NQT A;  2JN4 A;  2K28 A;  5JEA J;  1I50 B;  3J7A F;  4LF7 Q;  3QO2 A;  4JOI C;  1IKL A;  1CQF A;  2L1B A;  4KI0 A;  2EE1 A;  1IKM A;  4JK1 C;  1H9S B;  1TWA B;  2I07 B;  4RWS C;  2JA7 B;  3NEN A;  1CZW A;  5COR A;  3PO3 H;  2KJX A;  5IE8 A;  1S5B D;  1PH4 A;  2PQA A;  1PMR A;  4ME3 A;  4C3I G;  1IL8 A;  1Y1V H;  1EU3 A;  5GRO A;  2D2C C;  1D6E C;  1S72 A;  1D5X C;  1C7Y A;  4KD3 A;  1IYV A;  1VQ6 A;  3GD7 A;  3KYH C;  4TRD A;  5FOB B;  1CKO A;  2UUB L;  1YJW A;  1QNK A;  4RFB A;  1WJJ A;  3U50 C;  1PFN A;  3MEH A;  2QF7 A;  1E22 A;  1JB3 A;  4OIK A;  5HGT A;  1JOK A;  1R4P B;  1D8L A;  2VUM H;  3NSW A;  1A62 A;  1YHA A;  2B3G A;  1SMY C;  4GOP A;  1RHP A;  3VR3 A;  4LFB Q;  2NWG A;  3C1E A;  1FJG L;  3H6M A;  4R1J A;  3PIP A;  5CGK A;  4R4O A;  4CDD C;  2JXM B;  4HIM A;  3UDI A;  3I3C A;  1L0Y B;  2CQA A;  3HOZ B;  3K0X A;  3KJP A;  1AZP A;  4MTK A;  4BXX G;  4CDF C;  4A3D B;  1CUK A;  4A3I G;  2KCC A;  5ISR A;  5GAE C;  4DV0 Q;  1IW7 D;  3DWP A;  1PH8 A;  2FJ2 A;  2KED A;  3HKZ E;  1CKN A;  2EYH A;  3BYY B;  3T16 A;  1SLJ A;  3F1Z A;  2YU9 H;  4DR3 L;  3CC7 A;  1I3Q H;  5JJK A;  1JT8 A;  2P5Z X;  2Z4I A;  5C0X I;  5JEA H;  4IPD A;  3WWV A;  1SEB D;  3L9A X;  5C3E H;  3JAM E;  4O0A A;  2F0D A;  2UU9 Q;  4PV1 C;  1K8G A;  3V96 A;  4KN7 C;  4DR5 Q;  3R93 A;  4DV6 Q;  2QDB A;  2UXB Q;  4G7Z C;  4KN4 C;  4KV6 A;  1SR3 A;  2IX3 A;  3RUZ A;  3ULJ A;  5LL6 X;  1SYG A;  3W3A A;  4BBS B;  4MNO A;  1C9O A;  5C44 B;  1Z47 A;  4JW0 A;  1KIX A;  1EEF D;  4ZKC B;  1ZYR D;  1SRU A;  5DEH A;  4AQY Q;  1EZ6 A;  1EQT A;  2JSO A;  1M1K C;  1MJC A;  1N8R C;  4OX9 L;  1HQR D;  3GTK B;  2IT1 A;  4PZ6 A;  3KLR A;  4DV7 Q;  3OIQ A;  1CTM A;  5M5X B;  4TVA B;  5JJZ A;  3ND9 A;  1A3T A;  1HUN A;  4IPG A;  1I6H H;  3NEM A;  2ZXP A;  5HUR A;  3NTH A;  3S2D H;  4JPB W;  2I0Q A;  3MFY A;  2JA5 H;  2R6G A;  3X3M A;  1L0X B;  3DWA A;  3NP8 A;  4PNY A;  3RLN A;  1N32 L;  3RMH A;  3H15 A;  4AIM A;  4A93 H;  1JR0 D;  2WB1 B;  2EQS A;  4KY6 A;  4B3S Q;  2DN8 A;  5IT9 L;  1LV9 A;  1PTO H;  2EYF A;  1OXU A;  2NVY H;  2WII B;  4X65 Q;  2F0S A;  3DMU A;  2HCC A;  4S3S A;  5I6W A;  2PW7 A;  4LK1 C;  1ET9 A;  2CH4 A;  1CK1 A;  4RGO S;  1YHB A;  1FNV A;  1XMO L;  3I4M G;  2E2J B;  3MWY W;  1WCM H;  4YWL A;  5KNC A;  3CAM A;  1EY8 A;  1SDF A;  5C4J B;  3SDZ A;  2R93 B;  3K58 A;  2D62 A;  4AH6 A;  2NN6 H;  2ASB A;  4R4C A;  3K7A B;  3P1H A;  1GVP A;  1SXT A;  1JCK B;  1TKW B;  2LMC B;  1A63 A;  4JI3 L;  5ELN A;  1O7L A;  3I7F A;  1S5F D;  1L1O B;  3R3O A;  1I4P A;  4QUC A;  4DGZ A;  3H3V H;  1JOO A;  3KF8 A;  4A3B B;  2ZXR A;  2F0I A;  2B39 A;  1V9P A;  3KOJ A;  3GTG B;  1EL0 A;  2OCE A;  2E2D C;  2D9U A;  4V19 0;  3WDN A;  5FJ8 H;  4ID6 A;  1QOH A;  3NE5 B;  1KLU D;  1TWC B;  2VQF L;  2PYK A;  2AQ3 B;  1AE3 A;  1R9T B;  1A15 A;  1PXU A;  2XVS A;  1PV4 A;  2F4V Q;  4DR1 L;  1L2F A;  3T56 B;  2JP1 A;  4WFN 3;  2O2L D;  1Y8N B;  3TS2 A;  2UXB L;  1HZ9 A;  1NBW A;  4EQP A;  2EYM A;  1WFQ A;  4DR5 L;  2KVM A;  3PUX A;  3J7A 5;  2PZU A;  1U5K A;  1SNP A;  5EKK A;  4EX5 A;  1MIU A;  2Q2H A;  3FKI G;  4XYQ A;  4BWG B;  1NMG A;  1HFG A;  4AQY L;  1H9R A;  1YHQ A;  3ULL A;  5L37 A;  3K5M A;  1EY4 A;  5C3E G;  5BN4 A;  4OL7 A;  3F2C A;  1QWY A;  4KLK A;  5G3L D;  3BYT B;  3FPU B;  4LF4 Q;  4DV6 L;  1A8V A;  4DAY B;  1XMQ Q;  3S1M H;  4Y52 H;  2A68 C;  3CCR A;  3L3O C;  5IYB H;  1TII D;  4TKO B;  3PO3 B;  4POG A;  3T1Y L;  5CV9 A;  3TP6 A;  2D0O A;  3RN2 A;  1PZK D;  1W6K A;  1FJG Q;  3HS0 C;  1V8Q A;  3A5U A;  4IFD J;  3ERS X;  2NZ1 D;  3S1N H;  1O80 A;  1DON A;  5GAG C;  1KC8 C;  1ML0 D;  4X3T A;  1IYU A;  2JA9 A;  1JMC A;  1UEA B;  1XWE A;  1IL2 A;  1X3G A;  2ZJR A;  2GN5 A;  2ZJP A;  4KJO A;  4DV2 Q;  2VL6 A;  1HPC A;  4JI6 L;  4H7B A;  1AW7 A;  1EYD A;  4P74 A;  3PGZ A;  2R7Z B;  1G51 A;  1EU4 A;  1PTO F;  2WV6 D;  2UUA Q;  2B2W A;  5IYD G;  2PPB C;  5IP9 G;  3TZD A;  1EY6 A;  3VYS A;  3G4S A;  2X6G A;  1TWG B;  4GN5 A;  4QCL A;  4BA2 I;  3I2Z A;  3M9B A;  4HJ7 A;  1JIC A;  2B2V C;  1SNO A;  4FP5 D;  1I4R A;  2E2H B;  3PMF A;  2F52 A;  3J81 j;  3HOX B;  1A2T A;  1F9S A;  4POF A;  3EA6 A;  3LGJ A;  4FF2 A;  2RF4 A;  2ES2 A;  4QUF A;  3S17 B;  1LT5 D;  3OTO Q;  1I3Q B;  1P16 A;  1QVC A;  3OPO A;  5E3F A;  1LLR D;  5C0X H;  3Q22 A;  1G6Z A;  2F0O A;  5GAD C;  4JOI A;  2EY2 A;  5C4X B;  3DM3 A;  1L0W A;  4DV3 Q;  4XQJ A;  3PF5 A;  4P72 A;  4QL5 A;  3M3Y B;  1OXX K;  1FYC A;  4KHP L;  5KYI A;  2QCP X;  3I4O A;  4BBS H;  4NXM L;  2F0G A;  3BU2 A;  1N36 L;  3J7A V;  3C2P A;  2JA6 H;  3MC0 B;  4BY1 G;  2EJM A;  4FNF A;  3MA2 B;  1KD1 C;  2QDL A;  4JI8 L;  4A93 G;  5IGB A;  5H1S E;  4GNX C;  2BH2 A;  1QE6 A;  1ONL A;  2JA8 B;  1AH9 A;  4DXF A;  2JQO A;  4HN7 A;  1X3E A;  1QJO A;  3S16 H;  4XQN A;  2B2T A;  3S9W A;  3BZC A;  1KDA A;  2NVX H;  3PIP 3;  2KA7 A;  1LAC A;  4NPS A;  1I6H B;  1H95 A;  2R7D A;  2LY7 A;  5E7N A;  4U67 3;  4KK7 A;  4ABN A;  5J39 A;  4J8Q A;  2PNR C;  2K05 A;  3IKJ A;  2Y0S G;  1SE8 A;  4LFA L;  1PH6 A;  1GHK A;  1Y1W H;  3CCQ A;  2EZV A;  1TS4 A;  4KHZ A;  1XNR Q;  4JC0 A;  1Z6H A;  2NVY B;  3DHQ A;  2K5N A;  3L0O A;  5I2X A;  3D4R A;  3P7J A;  1N34 Q;  4JI2 Q;  1VCI A;  3R8B A;  2KEE A;  4FO2 A;  1VQN A;  1AZQ A;  3NTI A;  4A3F H;  5KND A;  1Q8K A;  1WTR A;  1TWF B;  5FLM G;  3DLL A;  5JPM C;  2K52 A;  1IYJ B;  2QGQ A;  1WCM B;  4HJA A;  1EIF A;  1Q8I A;  1V1Q A;  2WKC A;  5C4H A;  2IHF A;  2B63 G;  4DK6 C;  3HOV B;  2M9V A;  1HNW L;  1CKN B;  3GV6 A;  1VQ9 A;  4EQ5 A;  3EBE A;  4X64 L;  4GKK Q;  2DGY A;  1EFW A;  5LHY 1;  3JAM i;  4DXG A;  3FPP A;  5FO7 B;  4C1N K;  1LTA D;  1VMP A;  2KHJ A;  1K0S A;  4YCW A;  4N8F A;  5C4X G;  2RHS B;  2Z8L A;  3NUC A;  2K33 A;  1GUG A;  2I5H A;  1HRJ A;  1VDZ A;  4A3E G;  1YNN D;  5I9O A;  1CA5 A;  2DY7 A;  1JJC B;  5COY A;  1SYE A;  3A54 A;  3NBI A;  5BR8 Q;  4EQN A;  1NSN S;  3E9I A;  1VQG A;  3RD4 A;  1EIG A;  2ZTC A;  1WI5 A;  3HOY B;  5IYB G;  1JC7 A;  3BZK A;  4G7H C;  4X65 L;  4B3M Q;  1I50 H;  2ZT9 C;  3AFP A;  2LS0 1;  3CD6 A;  3STB D;  1FL0 A;  4JV5 L;  3T1H Q;  2F0H A;  1XNR L;  2KUM A;  4UDU C;  3HP3 A;  4Y7N H;  2OT2 A;  3KF6 B;  2HIX A;  2IX1 A;  1IW7 C;  1BCP B;  1QVF A;  4JI1 L;  3CME A;  3VYT A;  2ZJQ A;  2MUY A;  2RQX A;  4G7O C;  4DR7 L;  2PZW A;  4LF9 Q;  2CWA A;  4OIJ A;  2IPK D;  4XT3 B;  1I4X A;  4PZ8 A;  1WYD A;  3T13 A;  4WRD A;  3JC6 6;  4Q5V A;  1QUQ A;  1Y1V B;  1BOS A;  5GAH C;  1M90 C;  3OMC A;  2ZTD A;  3T1Y Q;  4B3T Q;  1SE3 A;  1DGS A;  4DN4 M;  1HTP A;  5AJ3 Q;  1U4R A;  1K9M C;  2UUC Q;  2C5C A;  2CW0 D;  1WTH A;  4X64 Q;  2SOB A;  1RJT A;  2K5W A;  4PMB A;  3KBG A;  3UE0 A;  4JI8 Q;  1HA5 A;  4WJ4 A;  2OF1 A;  3S1N B;  2EYP A;  2OQ0 A;  1EEI D;  4OWT B;  1PYW D;  2R7F A;  2RDH A;  3H0G G;  1BR9 A;  1Q81 C;  3SK5 A;  5JOB A;  4JYA Q;  4UAI A;  3MXN B;  1D7Q A;  1EQR A;  2J0T D;  5T1G A;  2MPM A;  3K59 A;  4JI1 Q;  5M3M B;  5EAY A;  3GTO B;  2RSO A;  1B9M A;  3M4O B;  3BVG A;  1HA6 A;  3HEJ A;  2FFK B;  4C3J H;  1VQK A;  3M7N A;  1OXS C;  2R92 H;  3TP5 A;  2F3V A;  1GM5 A;  4LF6 Q;  3G6J B;  1HNX L;  3U9S A;  2PNH A;  1HHV A;  2F1M A;  4GN4 B;  3MVV A;  4IFD H;  2HUG A;  5CMD A;  1DJR D;  2NYZ D;  1RTO A;  4OON A;  1TWG H;  3CCU A;  4LF8 L;  3B6Y A;  1SNM A;  3CKI B;  3TN2 A;  5CBE E;  2JA7 H;  1DOL A;  4OHJ A;  4DV1 Q;  3ERO A;  2VB3 X;  3ZJY C;  1VQB A;  3U4V A;  4JI7 L;  1XNQ Q;  1GXD C;  2FHT A;  1ZKO A;  1H9J A;  2EXD A;  3E5S A;  5T1I A;  3GTL H;  4WJW A;  4HIK A;  3UDG A;  1OXV A;  4NDX A;  1HH2 P;  1IBL L;  2VS1 A;  3GTQ H;  3SGI A;  1BCP F;  1RL2 A;  1XTC D;  1SND A;  4DNT B;  1UEB A;  1VQ5 A;  4LNQ A;  1ZEQ X;  5C44 H;  2L55 A;  4A3K H;  5C6A A;  4IN3 A;  3G71 A;  1YNJ C;  1YJN A;  1X3F A;  2N3S A;  2MJ8 A;  1VS0 A;  1YEZ A;  2RA4 A;  3GTJ B;  1MBY A;  2NZH A;  3NEL A;  4GOP B;  5LMU L;  4C3I H;  4PG3 A;  1S4Z A;  4IUU A;  2A6H D;  2EYO A;  4IAL A;  3TP8 A;  1BBU A;  1VQD A;  4ALP A;  3G6E A;  4IO9 A;  1SYC A;  4LUZ A;  2JA8 H;  3GDE A;  5ELD A;  3TS0 A;  2JA5 B;  3D4D A;  2R7Z G;  2TSS A;  1MJE A;  2VQE L;  3CPW A;  3FRP B;  1NTG A;  3MTS A;  2BA1 A;  4R4Q A;  5E4W C;  4B3S L;  4QIW E;  1TXY A;  4R8N A;  2VUM G;  1PZJ D;  4JI4 Q;  1G6P A;  2K7V A;  3CC4 A;  5KYL A;  2PO4 A;  2SDF A;  1ROD A;  4L5T A;  2B2U A;  3K81 C;  3SHL A;  2NVT B;  3Q8D A;  2R3Z A;  2UUC L;  3ERQ A;  5E4X A;  5AJ3 L;  3E9H A;  4J6H A;  2VUM B;  2N88 A;  4JBM A;  1GOZ A;  1VMC A;  2EYJ A;  3OIP A;  3AYH B;  2Z0S A;  5EBC A;  5I6Y A;  1E2W A;  4G4K A;  1ENC A;  2ZM6 L;  5AFW A;  3CRK C;  2OXP A;  2G5D A;  2MO1 A;  2XWB B;  1EQV A;  4C56 C;  4CJ0 B;  2AWO A;  2IW3 A;  4X6A H;  3HOV H;  3U4Z A;  1YNN C;  3S2D B;  2L0C A;  2YU9 B;  4O1N A;  2JE6 I;  1Q46 A;  1F2Y A;  5NUC A;  3VR2 A; 
#chains in the Genus database with same CATH homology
 2WP8 J;  4P75 A;  2N78 A;  1PV4 A;  2F4V Q;  4DR1 L;  1L2F A;  1HNZ Q;  3TS2 A;  2UXB L;  1GO3 E;  1HZ9 A;  1NBW A;  2NVQ H;  5M3M G;  4DR5 L;  1WFQ A;  4DR4 Q;  1VQH A;  2A1A A;  3F8T A;  3PUX A;  1R9T H;  3J7A 5;  5IY0 A;  4GNX A;  4BBS G;  4HJ9 A;  1U5K A;  1EQQ A;  1B8A A;  1UE7 A;  2XTI A;  2LSS A;  1W3S A;  1MIU A;  2Q2H A;  3FKI G;  4EX5 A;  4LFA Q;  1NMG A;  1XPO A;  2WAQ G;  2K5H A;  4GLV B;  1PH5 A;  2K50 A;  4AQY L;  4DNI A;  2WB1 E;  2UUA L;  1X6O A;  4AYB E;  1X9N A;  2WFW A;  2E2J H;  1YHQ A;  1WCM G;  3HOW G;  2RHQ B;  2JEA I;  2BH8 A;  2YTV A;  3ULL A;  2E2I H;  1JE5 A;  3PO2 H;  5C3E G;  3PIO A;  4DUZ Q;  1VQ8 A;  2NVT H;  3PUW A;  3S14 H;  4JI0 L;  1HJP A;  4LW1 A;  4LUO A;  4HID A;  1PHJ A;  3FKI H;  3F2C A;  4KLK A;  1L1O A;  4A76 A;  2VW9 A;  4IJH A;  4IPH A;  2OWO A;  4LF4 Q;  4PZ7 A;  4DV6 L;  2K4K A;  1A8V A;  3S24 A;  4DAY B;  5FLX c;  2JA6 G;  1XMQ Q;  2JA8 G;  2F3I A;  2E8G A;  3K7A H;  3RR5 A;  3UDF A;  4A3I H;  5M5X H;  3S1M H;  4Y52 H;  3CCR A;  3HOU G;  2UU9 L;  5IYB H;  1JB7 A;  2CKZ B;  2JK8 A;  2QEX A;  1PH2 A;  1PYB A;  4HJ5 A;  4POG A;  2YTX A;  3GTJ H;  3T1Y L;  3CMA A;  3PUY A;  1KQS A;  5ELO A;  2WB1 G;  1K0R A;  1VQM A;  4LWC A;  4LF5 L;  1N32 Q;  5DLQ E;  1TWH H;  2D0O A;  1N36 Q;  3RN2 A;  1I94 Q;  3HOW H;  1FJG Q;  1LM0 A;  5C0X G;  3A5U A;  4LF6 L;  1YIJ A;  1TWF H;  4A3G H;  4IFD J;  1QUQ B;  3ERS X;  3M85 A;  1Q1B A;  5M3F G;  3S1R H;  2B63 H;  3PUZ A;  3S1N H;  4R4T A;  1VQP A;  2IY5 B;  3D0F A;  1UE5 A;  5GAG C;  1KC8 C;  1KRT A;  1I94 L;  2JA9 A;  2LXJ A;  1JMC A;  1FGU A;  3I4N H;  1IL2 A;  1XJV A;  1X3G A;  5J3B A;  2ZJR A;  4GKK Q;  2GN5 A;  2ZJP A;  1OTC A;  1B70 B;  5FLM H;  4DV2 Q;  4JI4 L;  2VL6 A;  4JI6 L;  3A74 A;  1J5E L;  4P74 A;  1Y1W G;  4NXM Q;  4A3L G;  3PGZ A;  4K0K L;  1G51 A;  3GTM H;  1IZ6 A;  5FJ8 G;  4TQU S;  2UUA Q;  3KF8 B;  4X66 L;  5IYD G;  3J80 c;  1KHI A;  4A4I A;  2Z6K C;  5IP9 G;  1IBK Q;  3PO2 G;  3HFZ B;  4QY7 A;  3OW2 A;  4IFD I;  4LF7 L;  1VQA A;  3TQY A;  4JI0 Q;  3K80 C;  3G4S A;  5C4J H;  4GN5 A;  3IRB A;  4BA2 I;  1NMF A;  3W5O A;  1PFS A;  3I2Z A;  3M9B A;  2CFM A;  4DKA C;  4B3R L;  4A3L H;  3CF5 A;  4HJ7 A;  4JI3 Q;  2K75 A;  1IBM L;  4PMW A;  1LYL A;  1NE3 A;  3S1Q H;  2F52 A;  3J81 j;  3M4O H;  4A3F G;  4H02 A;  3CC2 A;  4POF A;  4MZ9 A;  3VDY A;  4YHH L;  4DUY L;  4BA1 I;  4A3M H;  3LGJ A;  1AE2 A;  2RF4 A;  2ES2 A;  4LFC Q;  2KBN A;  5IWA Q;  3OTO Q;  4DV7 L;  3HOX H;  1UWV A;  3U58 A;  1IBM Q;  3W1G A;  1P16 A;  1QVC A;  1YZ6 A;  5M5Y H;  2OTJ A;  1PA6 A;  1K3R A;  5GAD C;  4JOI A;  4L5S A;  3DM3 A;  3CCM A;  1L0W A;  4DV3 Q;  4A3J H;  1HZC A;  4DV0 L;  3PF5 A;  4P72 A;  4QL5 A;  3CCS A;  3GTK H;  1TWA H;  1OXX K;  1HR0 L;  3NBH B;  2LXK A;  3CCV A;  4B3M L;  5JEA G;  3KLW A;  4KHP L;  1T9H A;  3OYY A;  3I4O A;  2RCN A;  4BBS H;  4NXM L;  2VQE Q;  3BU2 A;  1GKH A;  3K7U C;  4A3E H;  4QQB X;  3J81 c;  3KJO A;  1N36 L;  3I4M H;  2IX0 A;  2PMZ E;  4GOP C;  2JA6 H;  3CXC A;  4BY1 G;  4C3H H;  4DV1 L;  1KD1 C;  2B29 A;  1PH7 A;  4IOA A;  5GQO A;  4JI8 L;  4JI5 L;  2Y0S E;  2D0P A;  4A93 G;  5H1S E;  3J81 i;  4GNX C;  2BH2 A;  1AH9 A;  1S40 A;  2KCM A;  3CPF A;  3STB C;  1IXR A;  3RLO A;  2JQO A;  1YVC A;  2NZO A;  4BBR G;  5IYC G;  3ULP A;  1C0A A;  3UE1 A;  1EUJ A;  1X3E A;  3S16 H;  2MO0 A;  1YBY A;  4DV4 Q;  3G48 A;  1Q7Y C;  1IBL Q;  4BY1 H;  3BZC A;  3L7Z C;  1YNX A;  4NB3 A;  3J7Z C;  3RZD H;  4HJ8 A;  1X56 A;  1JJ2 A;  2NVX H;  3GO5 A;  4P73 A;  4NPS A;  1H95 A;  2R7D A;  1SMX A;  1PH9 A;  3HOY G;  4A3C H;  5E7N A;  1UE1 A;  4A3J G;  4GNX B;  4DR6 L;  1V43 A;  4IPC A;  3PF4 A;  1Q1E A;  3PCO B;  1K73 C;  4UP8 A;  4X66 Q;  1PVO A;  1Y14 B;  5IWA L;  2OQK A;  1VQ4 A;  2Y0S G;  2QA4 A;  1SE8 A;  2HQL A;  4LFA L;  1PH6 A;  3AEV A;  5LMN L;  3TRZ A;  5C0X J;  4J15 A;  4DV5 L;  4JI6 Q;  3EN2 A;  1Y1W H;  2E2H H;  2JJQ A;  4L5R C;  1EOV A;  3CCQ A;  4KHZ A;  2NN6 I;  1CSQ A;  2C35 B;  2N8N A;  4NXN L;  1XNR Q;  4JC0 A;  2GVA A;  3L0O A;  4DV4 L;  2K5N A;  1N33 Q;  3I4N G;  1VQE A;  4YWK A;  5LMU Q;  1N34 Q;  3S17 H;  4JI2 Q;  1VCI A;  4C2M H;  1SFO H;  2A19 A;  5JJL A;  1VQN A;  4A3F H;  1Q8K A;  2MNA A;  4GLX A;  5FLM G;  1VQI A;  1W2B A;  1EYG A;  3DLL A;  5M3F H;  2K52 A;  2K14 A;  4A3D G;  2JA5 G;  1PH1 A;  3KDF B;  2HHH L;  1IYJ B;  2QGQ A;  1P8L A;  1PH3 A;  1E1O A;  1N34 L;  1XTD A;  2AKW B;  4XIG S;  3L2P A;  4YCU A;  2L15 A;  4HJA A;  1EIF A;  4K0K Q;  5IYD H;  1K83 H;  1UE6 A;  1V1Q A;  4A3B H;  4JCV E;  2AHO B;  2FXQ A;  2IHF A;  4OXP A;  3RLF A;  2B63 G;  3ER0 A;  4DK6 C;  2YV5 A;  2V1C C;  5IT9 c;  1HNW L;  4LF9 L;  1CKN B;  3F2B A;  1KXL A;  4LFB L;  3S15 H;  3CW2 C;  2CCZ A;  1YI2 A;  1VQ9 A;  4EQ5 A;  3EBE A;  3M4P A;  4DAM A;  4X64 L;  4HIO A;  2DGY A;  3ICE A;  1BVS A;  5HGQ A;  1XPR A;  2Q2U A;  1EFW A;  4A3G G;  3JAM i;  4A3C G;  4DR6 Q;  3HOU H;  2KHJ A;  4BY7 H;  4YCW A;  5C4X G;  2RHS B;  1GD7 A;  2R92 G;  2ID0 A;  1VQO A;  3H3V I;  4R4I A;  1QZH A;  1U0L A;  1HR0 Q;  1VQ7 A;  2PI2 E;  2Q2I A;  3HOX G;  3CCJ A;  1ASY A;  4YHH Q;  4DUY Q;  2UXD L;  2I5H A;  4IJL A;  4RMF A;  3M4Q A;  4OWX B;  4A3E G;  4LF8 Q;  3HKZ G;  2CWP A;  3HOY H;  4A3D H;  4BXX H;  1XMQ L;  1JJC B;  4LF4 L;  1X55 A;  2MQH A;  3A0J A;  3BJU A;  2Z6K A;  5BR8 Q;  1G29 1;  2I5L X;  2KCT A;  3E9I A;  1VQG A;  5JEA J;  2ZTC A;  1WI5 A;  4LF7 Q;  2H5X A;  4JOI C;  5IYB G;  5IYC H;  4DK3 C;  3BZK A;  2PI2 A;  5C4X H;  3JAM c;  4X65 L;  4KI0 A;  4JBK A;  1SRO A;  1N33 L;  4KHP Q;  1O7I A;  4B3M Q;  1I50 H;  3AFP A;  1NJI C;  3PSI A;  4DPG A;  3CD6 A;  4DR7 Q;  2ZTE A;  1OXT A;  1FL0 A;  3STB D;  4OO1 G;  3T1H Q;  4JV5 L;  5K36 G;  4NXN Q;  1XNR L;  2VZA A;  4B3R Q;  1XMO Q;  4Y7N H;  3NEN A;  4OWW B;  3KF6 B;  4UP9 A;  2HIX A;  4A3M G;  3HOV G;  4BY7 G;  2IX1 A;  1KRS A;  3PO3 H;  1QVF A;  5IE8 A;  4JI1 L;  3CME A;  2ZJQ A;  1PH4 A;  2PQA A;  4ME3 A;  2E5L L;  4DR7 L;  3J80 i;  4LF9 Q;  1Y1V H;  5GRO A;  5M5W H;  2CWA A;  2F4V L;  5IP9 H;  2CQO A;  1HZA A;  1S72 A;  1HZB A;  4X62 Q;  4PZ8 A;  1C7Y A;  1WYD A;  3GD7 A;  3KYH C;  4GN3 B;  4LFC L;  1VQ6 A;  1E24 A;  4YY3 Q;  2UXC Q;  3JC6 6;  1ASZ A;  1CKO A;  1QUQ A;  2UUB L;  4B3T L;  1YJW A;  4BBR H;  1JJG A;  1WJJ A;  1E7Z A;  5GAH C;  1M90 C;  3U50 C;  1E22 A;  1HNX Q;  2ZTD A;  4RG1 A;  3T1Y Q;  4B3T Q;  4UY8 C;  1DGS A;  2R93 H;  3E0E A;  2UXC L;  1D8L A;  2WAQ E;  5AJ3 Q;  2VUM H;  1K9M C;  1A62 A;  3MEF A;  2UUC Q;  2I5M X;  1YHA A;  2B3G A;  4AYB G;  4X64 Q;  2AWN A;  4GOP A;  1WOC A;  4LFB Q;  1FJG L;  2E5L Q;  3CP0 A;  4R1J A;  4JI8 Q;  3UE0 A;  3PIP A;  1VQJ A;  4R4O A;  3HOZ H;  4WJ4 A;  1Z9F A;  3AQQ A;  2OQ0 A;  1PYS B;  3UDI A;  4HIM A;  4JBW A;  3KDF A;  2KHI A;  4OWT B;  1EIY B;  2R7F A;  3K0X A;  3H0G G;  4JG2 A;  3KJP A;  1Q81 C;  4BXX G;  1K8A C;  4JYA Q;  3W1B A;  1RIP A;  3MXN B;  1D7Q A;  1CUK A;  1EQR A;  4A3I G;  3RZO H;  5GAE C;  4GKJ L;  3CCL A;  4DV0 Q;  4JI1 Q;  5EAY A;  1PH8 A;  4P71 A;  4DV3 L;  4C3J H;  1A0I A;  5HY6 A;  1VQK A;  3M7N A;  1OXS C;  3HKZ E;  4DUZ L;  2R92 H;  1CKN A;  2JA7 G;  3I55 A;  1LTL A;  1SLJ A;  2KEN A;  3F1Z A;  1GM5 A;  2YU9 H;  4LF6 Q;  1EWI A;  3AFQ A;  4DR3 L;  5M3M H;  1HNX L;  4JI7 Q;  1XNQ L;  1YIT A;  1Q86 C;  3CC7 A;  3GTO H;  1I3Q H;  2PNH A;  2ATW A;  3CCE A;  5JJK A;  1JT8 A;  5C0X I;  4GN4 B;  4LF8 L;  4O2D A;  4IPD A;  4OON A;  3WWV A;  1TWG H;  2VY3 A;  3CCU A;  2UUB Q;  3B6Y A;  5C3E H;  1LUZ A;  4DR2 Q;  4O0A A;  4JBJ A;  2UU9 Q;  2GVB A;  2JA7 H;  4DV1 Q;  4JYA L;  1K8G A;  3ZJY C;  1VQB A;  3U4V A;  4DR5 Q;  1B7Y B;  4DV6 Q;  4JI7 L;  1XNQ Q;  4DR4 L;  2R93 G;  2UXB Q;  1J6Q A;  2OTL A;  3F2D A;  1HNZ L;  4A3B G;  4DR1 Q;  2EXD A;  1SR3 A;  3GTL H;  1VQC A;  1QVG A;  3UDX A;  4HIK A;  3ULJ A;  3UDG A;  3D31 A;  3CQZ H;  1OXV A;  4MNO A;  1HH2 P;  1C9O A;  1VQL A;  1IBL L;  4JI5 Q;  2VS1 A;  1Z47 A;  3GTQ H;  1KIX A;  3SGI A;  1RL2 A;  2MFI A;  1SRU A;  4AQY Q;  1VQ5 A;  1UEB A;  4LNQ A;  1M1K C;  5C44 H;  1E3P A;  4A3K H;  1MJC A;  4YCV A;  1N8R C;  3G71 A;  4APV A;  1L1O C;  1YJ9 A;  4OX9 L;  2VNU D;  1YJN A;  1X3F A;  2N3S A;  4YWM A;  2BA0 A;  4UPA A;  2IT1 A;  1X54 A;  1Y1V G;  4PZ6 A;  4MTN A;  3OTO L;  2K5V A;  4DV7 Q;  1VS0 A;  3GTG H;  1Q12 A;  1YEZ A;  4TVA B;  4XTC S;  4L5Q A;  4YY3 L;  4IPG A;  1FVI A;  3NEM A;  3S2D H;  5IP7 G;  1I6H H;  2NZH A;  3NEL A;  3FP9 A;  4GOP B;  1S3O A;  3A5Z B;  2I0Q A;  4JI2 L;  5LMU L;  3GTP H;  4C3I H;  4PG3 A;  2JA5 H;  2R6G A;  3TRE A;  2UXD Q;  1TWC H;  4UP7 A;  1BBU A;  1VQD A;  4ALP A;  1QZG A;  3RLN A;  3G6E A;  3RN5 A;  4IO9 A;  2IHE A;  4LF5 Q;  1N32 L;  3H15 A;  2JA8 H;  1N9W A;  4LUZ A;  2HHH Q;  4AIM A;  4A93 H;  3GDE A;  3TS0 A;  4A3K G;  2R7Z G;  2EQS A;  2N49 A;  2VQE L;  1MJE A;  4LUV A;  4B3S Q;  3CPW A;  4WJ3 M;  4X62 L;  3PO3 G;  1NTG A;  1Q82 C;  1OXU A;  2BA1 A;  2NVY H;  4R4Q A;  3HKS A;  4X65 Q;  4B3S L;  4QIW E;  1TXY A;  3PV0 A;  2VUM G;  1HNW Q;  4IFD G;  4JI4 Q;  1G6P A;  1HR0 W;  1NY4 A;  2XGT A;  2ZM6 Q;  2R7Z H;  1KAW A;  3I56 A;  3CC4 A;  2DUD A;  1YHB A;  3FHW A;  1XMO L;  3I4M G;  5BR8 L;  3KF6 A;  3T1H L;  4DR3 Q;  5LMN Q;  3K8A A;  4L5T A;  3K81 C;  1WCM H;  4YWL A;  3S2H H;  3Q8D A;  3CAM A;  2PQA B;  2UUC L;  2ALY B;  1VQF A;  5AJ3 L;  2HIV A;  2VQF Q;  2D62 A;  3E9H A;  4AH6 A;  1BBW A;  2ASB A;  2YYZ A;  4JBM A;  1IBK L;  3EIV A;  4R4C A;  2YTY A;  3H0G H;  1GVP A;  4QGU A;  1BKB A;  3PUV A;  1A63 A;  4JI3 L;  3AYH B;  2EIF A;  2Z0S A;  5ELN A;  3RNU A;  3I7F A;  1I5F A;  2ZM6 L;  5C44 G;  2NN6 G;  4DV5 Q;  1L1O B;  4GKJ Q;  1XPU A;  2Q2T A;  1E1T A;  3H3V H;  1SN8 A;  4GS3 A;  4A75 A;  2MO1 A;  2HT1 A;  3KFU A;  5JJI A;  4OO1 I;  1V9P A;  1KL9 A;  3KOJ A;  2AWO A;  3TEH B;  4OX9 Q;  1X65 A;  4X6A H;  2OCE A;  1J5E Q;  3HOV H;  5LMN W;  3U4Z A;  4QJF A;  4JV5 Q;  4DV2 L;  1CSP A;  1CKM A;  5FJ8 H;  3HOZ G;  3M3Y H;  4GKK L;  1MKH A;  2JEB I;  2A8V A;  4GLA C;  4FDB A;  2JE6 I;  1Q46 A;  4DR2 L;  4IOC A;  2AMC B;  2VQF L;  5IP7 H;  1AE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...