4DNIA

Structure of editosome protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
257
structure length
257
Chain Sequence
TILPQAPQYHLDVAPNAPEEGEVAAHWRCVNHCVMLGVVQNIQEGFVFEDKVLQFTLITDFEGPSPGDPDKDFHTVRVFDSDYSSRVKEQLRDGEWFLVTGRLRMVPQYDGSMRKYYHYPVIQVHPGCGSVLKVKLASGAGHMKSVNSVTLVGVVHDIQSGFVYEDAVTQFTLTTTSIDTTHPTQEVVVEKDHHTIRCFGELFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNKHFYFPYIQVQPPHGQVAVIHGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion protein of RNA-editing complex proteins MP42 and MP18
publication title Explorations of linked editosome domains leading to the discovery of motifs defining conserved pockets in editosome OB-folds.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Protein binding, rna binding protein
total genus 47
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dniA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dniA02
4DV7Q 2BH2A 1N33Q 3KF6B 3PGZA 2UUAL 3AYHB 2V1CC 4A3DG 1VQIA 4JG2A 3J81c 4QJFA 3GO5A 1P8LA 2Q2IA 2NVYH 5GADC 2R92G 3D0FA 1L0WA 4JI1Q 4GLXA 2R7FA 5LMNQ 1JE5A 1L1OB 4B3SL 3A5ZB 4DR4L 4IFDI 4YY3L 1IBKL 1PYBA 3I7FA 1N36L 1HNZQ 4LFBQ 4IPCA 1JB7A 2UXCQ 4YCUA 2EQSA 3T1YL 4R4TA 3A5UA 1JJ2A 3J81i 4DAMA 2ATWA 3D31A 5M3FG 4GOPC 2CKZB 4P75A 3M3YH 5GROA 5LMNW 1G6PA 4DV7L 5M3MG 3I4NG 1WFQA 4QIWE 4HJAA 1EIFA 1N33L 4A3MG 4FDBA 5GAHC 3CCRA 4DUZQ 3RN2A 4A76A 1X54A 5IYBH 4P73A 1TWFH 4A3EH 5JJLA 3CAMA 2HIXA 3BZCA 4O2DA 4PZ6A 1X3GA 2AWNA 3NBHB 4KHPL 1PH2A 3STBC 4JI7L 3EN2A 3UDXA 1VQPA 2I5MX 3UDGA 2MO0A 1I94Q 3MEFA 1EFWA 4A93G 1HNZL 4TQUS 4LFBL 2UXCL 3ULLA 3ER0A 4MZ9A 3GDEA 4UP7A 4A3FH 1SFOH 1N8RC 5JJIA 4AIMA 3W1GA 3CMEA 3OYYA 3S1QH 4NXMQ 1YJNA 3CPFA 4DK3C 1WYDA 4HIDA 3S2DH 5ELNA 3NENA 1VQ6A 4GKJQ 4HIOA 1YI2A 1LM0A 4DV2Q 1YITA 4GN4B 1G291 1S3OA 3I56A 2BA0A 1PH6A 1NJIC 1J5EQ 1MIUA 2R7DA 3L2PA 1FL0A 5IT9c 4LWCA 5FJ8G 1KXLA 4NXNQ 2XGTA 3W5OA 5C0XJ 4OX9Q 2JA8H 1QVFA 4GLAC 2UUBL 1YZ6A 2AMCB 2E2IH 1XMQQ 2NN6G 5M5YH 3TEHB 1PH8A 1AE3A 4NXML 1N32L 1NMFA 1C7YA 1HJPA 1E1TA 1E1OA 1UE1A 3IRBA 4P74A 3HKZG 2MFIA 3TQYA 3U58A 4GKJL 5M5WH 1I50H 5IP7H 4DV2L 1RIPA 2UXDQ 3FKIG 2I0QA 2YTVA 1OXXK 3NEMA 2NVQH 2ALYB 3AQQA 2D62A 3K0XA 2CWAA 3S2HH 4QL5A 4NXNL 2HHHQ 3HOYG 4OX9L 4RG1A 4BBSH 3ZJYC 3H0GG 2E2HH 3HFZB 1LUZA 1AE2A 3KLWA 3PUYA 1XMQL 5FLMG 1Q86C 4LNQA 1UE7A 4B3RL 4BXXG 4GOPB 2R7ZH 3HOWG 3BZKA 2ZJRA 1CSQA 1KD1C 5C4XG 2PI2E 1X6OA 3KOJA 1X3FA 4DR7Q 3GTGH 3KYHC 1BKBA 1WCMG 4JOIA 4A3BH 2ZM6Q 5C3EG 1WOCA 3B6YA 2KCTA 1ASZA 1X56A 4LF5Q 1Y14B 4LF4Q 1PA6A 4IJHA 4X62Q 2PQAA 4OO1G 4C3JH 2HHHL 2JA7H 3I55A 1E22A 1CUKA 3M9BA 1CKMA 1CKOA 2LXKA 2PI2A 4JBWA 3RNUA 4IOCA 4WJ3M 1MKHA 4DV4Q 1CKNA 4NPSA 5BR8Q 1KIXA 1YNXA 4DR2Q 2UU9Q 4C3HH 3A0JA 3I4OA 3DLLA 4DR1Q 4A3JH 1K8AC 1HR0W 2R6GA 1Y1WH 2WP8J 3HOXG 1VQ5A 1Q1BA 4A3IH 4LF4L 1OXVA 1FVIA 2DUDA 1C0AA 3PV0A 4GNXA 3ICEA 3FHWA 3HOZH 3M4PA 3TS0A 4BY7G 3TREA 2JE6I 3PO3H 2QEXA 2I5LX 1NTGA 4JCVE 2ZJPA 2QA4A 3KF6A 1TWGH 4YWLA 4X64Q 2D0OA 3S15H 2RCNA 4JI6Q 2AHOB 2A19A 5IE8A 3EBEA 4DV4L 1H95A 5BR8L 2NVXH 2VQEL 1YHQA 3RR5A 1EOVA 4DR1L 3CCJA 4JI2Q 1W2BA 2Y0SE 4PMWA 3J81j 1GKHA 1KL9A 1Q81C 2E5LQ 3U4VA 2K5HA 4MTNA 4OONA 3GTJH 4J15A 1Q1EA 1SE8A 4QGUA 5C4JH 2ZJQA 1TWHH 2Y0SG 2ZTEA 4LF8Q 1KHIA 3RLOA 1GD7A 2AKWB 5AJ3Q 3CMAA 4K0KQ 1LYLA 2GN5A 4DV6L 4X64L 4H02A 3I4MH 4A3LH 4JI6L 3RLFA 4C3IH 3E9HA 4YWKA 4OO1I 1SLJA 5IYBG 4JC0A 3NELA 1MJCA 4R4OA 4X66Q 4A3EG 2F4VQ 1K83H 2CQOA 3W1BA 3F2CA 4JI4Q 4JI2L 4OWTB 1Z9FA 4DKAC 2KHJA 3UE0A 3F2DA 2KHIA 2E5LL 2VUMH 5C0XI 1M1KC 1QVGA 1SR3A 1AH9A 1IZ6A 3CCSA 1V1QA 1E7ZA 2EIFA 4JI1L 5LMNL 1YJ9A 4LF8L 2K14A 4LFAQ 4DV5Q 4A3FG 4ALPA 4K0KL 1VQJA 5AJ3L 1EQRA 3CCQA 2IX1A 1TWCH 1M90C 1PYSB 3STBD 5IYCH 2JA5H 2KBNA 1Z47A 2L15A 3CC2A 1K0RA 4JI5Q 2WB1E 2HIVA 3ULJA 3ULPA 4LF7Q 2F4VL 3GTQH 4JBMA 3TRZA 4LUZA 4HJ5A 4EQ5A 4JI4L 1S40A 1VQCA 4PZ8A 4UY8C 4DUZL 3LGJA 3PIOA 1KQSA 1VQLA 1Y1VH 4BA2I 5GAGC 3A74A 5HY6A 4L5RC 1PVOA 1HNXQ 1MJEA 3G6EA 4DUYQ 2WB1G 4IOAA 1A8VA 1X55A 3E0EA 3J80c 3AEVA 1PV4A 1PH7A 4JOIC 4L5SA 1WJJA 2ASBA 2JA8G 2D0PA 4LFAL 4DV5L 4A3KH 1VQBA 1I94L 3S14H 4A3CH 1VQFA 5JJKA 1A0IA 3CC7A 1JJCB 3MXNB 4LFCQ 2RHQB 2VW9A 2KCMA 3PF4A 4P72A 4MNOA 4JI5L 4X65Q 4LF7L 3PUWA 3JAMc 3KF8B 3HOUH 2KENA 5IP9H 2K50A 2R93H 1VQ9A 3RZDH 5IP7G 3K7AH 4IJLA 4JI3Q 1SROA 1HNXL 1J6QA 4POGA 5IYDH 2A1AA 4DUYL 5J3BA 1DGSA 1N34Q 2VNUD 2F52A 2K52A 1SRUA 1QZHA 1J5EL 2VZAA 4JI8Q 3M85A 2A8VA 3JAMi 4DR6Q 4BBSG 3G48A 2JJQA 1U5KA 4UP8A 4DAYB 2ZTCA 3CCMA 3GD7A 1U0LA 4LFCL 4GNXC 5C44H 1GO3E 3K8AA 2R7ZG 1GVPA 4GN3B 3CXCA 4IPHA 1VQGA 4Y52H 1PH3A 4A3BG 3CW2C 3KFUA 3S16H 4JI3L 1R9TH 1L2FA 4ME3A 3G4SA 1RL2A 4YWMA 4HJ9A 4APVA 5M5XH 1YVCA 1EYGA 2JA6H 2E8GA 4DR3Q 2IT1A 2UXDL 2GVAA 1I3QH 4JI8L 2JA7G 1VQ4A 1PH9A 1V43A 2K5VA 5JEAG 1A63A 1C9OA 1YIJA 3BJUA 4R1JA 2N78A 4TVAB 3F2BA 1UWVA 1HZBA 3BU2A 5GQOA 1HR0Q 1QZGA 4LF9Q 1E3PA 1YBYA 3JC66 1Y1WG 4A3IG 1IL2A 1K9MC 4DR7L 3KDFA 2ZM6L 4IFDG 4DR3L 2NN6I 3OW2A 3HOZG 1JT8A 2ID0A 4BBRH 4LF5L 1O7IA 3OTOQ 2NVTH 3PO2H 3J7ZC 4A75A 2YYZA 2Q2UA 4JBKA 3PO3G 4X62L 4NB3A 4GS3A 1CSPA 3K81C 4YHHQ 3HOVH 2B63H 4BY1H 1QUQA 3F8TA 1T9HA 4UPAA 3GTKH 1BBWA 2IY5B 1JMCA 4DPGA 2Q2HA 1HR0L 1HZCA 2JEBI 2N8NA 1PH5A 1I5FA 2PQAB 4LF9L 3H3VI 3TS2A 2PMZE 1OXTA 4IPGA 1IYJB 2RF4A 4AYBE 4DR2L 2UU9L 2JEAI 5IY0A 1OXSC 3U50C 4LW1A 2UUAQ 1K8GA 1L1OA 1LTLA 3GTOH 4A3GH 3UDFA 1EWIA 4LUOA 3OTOL 3S1RH 1X65A 3CC4A 1I6HH 2DGYA 2CCZA 3CF5A 4AYBG 4DV3Q 1HZ9A 2GVBA 4YHHL 4C2MH 3PCOB 2JA9A 1Q82C 3I4MG 4A3LG 4PG3A 4XIGS 3CPWA 1IBKQ 4IO9A 3UDIA 3T1YQ 2VY3A 1VQHA 1Q7YC 1V9PA 2OWOA 1NBWA 4JYAQ 2VUMG 1XTDA 1OTCA 4YCVA 3T1HQ 1BVSA 4JI0Q 3VDYA 2OCEA 5ELOA 3F1ZA 4IPDA 2YU9H 4DV1Q 4POFA 4DV3L 2B3GA 3S17H 4A3DH 4KHPQ 2VS1A 2FXQA 4QQBX 4JI7Q 1TXYA 5IYCG 1UE5A 2JA5G 3I2ZA 4B3MQ 4RMFA 1VQEA 2R92H 2Z6KA 1IBLQ 1D8LA 2YV5A 1VQOA 2Q2TA 3S1MH 1VQ7A 1VCIA 2XTIA 1ASYA 1X9NA 3M4QA 4HJ7A 1OXUA 1Y1VG 5IWAQ 3CCVA 1PH1A 3GTPH 4X66L 4JYAL 3L0OA 4OXPA 4DV0Q 3K80C 3T1HL 4JI0L 5M3FH 2I5HA 3GTLH 4A4IA 1KAWA 5M3MH 3KJPA 3I4NH 3CCUA 4A3MH 5JEAJ 4DV1L 4HJ8A 4A3KG 2OQKA 1VQKA 3M7NA 4A3CG 3GTMH 2HQLA 3UE1A 2IX0A 4L5QA 2B29A 1VQ8A 4B3ML 4LUVA 2UUCQ 1JJGA 1IBLL 1PFSA 1G51A 1NY4A 2QGQA 1N9WA 3HOUG 1NMGA 4KLKA 5IP9G 2R93G 2UUBQ 1TWAH 4A93H 3K7UC 5IWAL 5FLXc 3J80i 5IYDG 1IBMQ 1N32Q 4DV0L 2JQOA 4IFDJ 2K75A 3PF5A 1NE3A 1HH2P 5GAEC 1HZAA 3S24A 1PH4A 3CCEA 1UEBA 5EAYA 1A62A 2OTJA 1E24A 1Q8KA 3PIPA 5C44G 2UUCL 5H1SE 1XNRQ 4GOPA 1K73C 4AH6A 4BA1I 1EIYB 3HKZE 2N3SA 1B8AA 4X65L 4WJ4A 5FJ8H 1X3EA 1SMXA 2YTXA 3RLNA 2HT1A 4GLVB 1XMOQ 1IBML 2YTYA 4B3RQ 2MQHA 2JA6G 4XTCS 4LF6Q 2CFMA 5DLQE 1GM5A 2K5NA 3PUZA 1VQDA 4KHZA 4AQYQ 1N34L 2UXBQ 3CCLA 2ZTDA 1KRSA 1XPRA 1L1OC 3RZOH 4DR6L 5K36G 4Y7NH 3FKIH 4OWXB 1XNRL 3J7A5 1BBUA 4DK6C 4JV5Q 3DM3A 2WAQE 3E9IA 1KRTA 3H3VH 2LXJA 3S1NH 2IHFA 1W3SA 3HOYH 3CD6A 1XMOL 4A3JG 3FP9A 2N49A 4DR5Q 2JK8A 1YEZA 2OQ0A 3H0GH 2K4KA 2MO1A 2Z0SA 4LF6L 4HIKA 4KI0A 3H15A 5LMUQ 5FLMH 2ES2A 4BBRG 2WAQG 3HKSA 1IXRA 1Q12A 2PNHA 4DNIA 1VQNA 1FJGQ 1XPUA 4O0AA 1VQAA 3CQZH 4AQYL 4BXXH 1YHAA 1VS0A 3AFPA 3HOWH 3AFQA 2UXBL 5C4XH 4B3TQ 3HOVG 2B63G 3Q8DA 4BY1G 1FGUA 2OTLA 5HGQA 1XJVA 1WCMH 2F3IA 4R4IA 1YJWA 5C3EH 1VQMA 1QVCA 4JBJA 1PHJA 3L7ZC 4R4CA 4JV5L 1SN8A 2CWPA 2EXDA 2BH8A 2VQFQ 2RHSB 3M4OH 2LSSA 1S72A 4GKKQ 2H5XA 2VL6A 2Z6KC 3WWVA 5C0XG 4DR5L 3G71A 2NZHA 4PZ7A 4UP9A 3KJOA 3PSIA 1KC8C 4A3GG 1HNWQ 4QY7A 2VQEQ 5LMUL 2WFWA 1XPOA 3RN5A 4R4QA 5E7NA 3EIVA 1FJGL 1WI5A 1P16A 4GN5A 4B3TL 1B7YB 1CKNB 4HIMA 1K3RA 2BA1A 3ERSX 4X6AH 2C35B 3HOXH 3SGIA 4YCWA 3KDFB 2IHEA 1B70B 2NZOA 3U4ZA 4EX5A 2E2JH 1YHBA 1Q46A 4P71A 2AWOA 2MNAA 4B3SQ 4DR4Q 4YY3Q 3PUXA 1EUJA 4L5TA 2VQFL 1N36Q 4DV6Q 4GKKL 1D7QA 3CP0A 1EQQA 1XNQQ 4BY7H 4OWWB 4GNXB 1XNQL 1HNWL 1UE6A 3PUVA 1QUQB 3PO2G
chains in the Genus database with same CATH superfamily
4DV7Q 1N33Q 1TS2A 1TWGB 3IAYA 1U4RA 3PGZA 1DOMA 1VQIA 4QJFA 3GO5A 3T4AC 2NVYH 3D0FA 4I65A 4GLXA 1X32A 4RGOS 2QILA 2XRSD 3ONAB 1PYBA 1N36L 4IPCA 4YCUA 5M3FG 2CKZB 2F0UA 4K14A 1EOTA 1JCKB 4P75A 5D3DA 5GROA 5LMNW 2HCCA 2KCCA 1AW7A 4FDBA 4DUZQ 1ML0D 4A76A 1X54A 4C3IB 4FVMA 2HIXA 4PZ6A 2F0PA 3A8KE 2GA4B 1X3GA 2AWNA 1DM0B 3N6RA 2L4NA 3J80L 3UDXA 1VQPA 4J8QA 1HHVA 1SEBD 2VUMB 2B2UC 4A93G 3GDEA 1N8RC 1JOOA 5KGUA 3JAML 5AFWA 2JA5B 1HQMC 4HIOA 1YI2A 1LM0A 5KNDA 1VF7A 1YITA 4GN4B 1G291 1S3OA 3OHXC 3I56A 1J5EQ 5IT9c 2EY1A 5FJ8G 4NXNQ 1WD0A 2JA8H 3DM1A 5L37A 2E2IH 1XMQQ 4NXML 1N32L 3SDZA 3NBIA 3PIO3 3IRBA 3HKZG 4PMBA 2MFIA 1DJRD 4XT3B 3K5NA 4DV2L 1RIPA 3OOCA 2UXDQ 3ZYYX 3K0XA 3S2HH 4QL5A 1KNEA 3NP8A 4BS9A 4B3RL 3VR2A 4GOPB 2ZJRA 1KD1C 1LTAD 1X6OA 1SXTA 3KOJA 4NW2A 2EJFC 1BKBA 3V05A 5LHY1 1ASZA 4LF4Q 5IIFA 4X62Q 4KV6A 5M5XB 4NKLA 5FO8B 3I55A 1GOZA 1NR4A 1CKMA 1CKOA 1I3QB 4JBWA 2LS01 5DAUA 4R8IA 2FMMA 4IOCA 3SEBA 4NPSA 3I4LA 2BDOA 1Y8NB 2Q8IB 2UU9Q 2KQ3A 1K8AC 1O80A 1Y1WH 1VQ5A 3CHBD 5J1ZA 2X69A 4A3IH 3KLRA 1OXVA 1C0AA 1KLUD 3CU7A 4U68A 1T5EA 5LL6X 3M4PA 3RUZA 4TSSA 3TS0A 1PZID 3FEWX 3PO2B 1ZXTA 1BCPC 2ZJPA 3S15H 1ENAA 3EBEA 2NBFA 2NVXH 1CZWA 2A6ED 4XQQA 2VQEL 4DR1L 3NUCA 5ELEA 4KKSA 1GKHA 2HCIA 1Q81C 1O78A 1HA6A 3GTJH 4J15A 4FNFA 3GTOB 4A3GB 1TWHH 2ZTEA 1V1PB 4K0KQ 3S1RB 2EYLA 1LLRD 4H02A 3I4MH 2MP1A 3RLFA 4ZAIA 1SLJA 2ZT9C 3NELA 4A3EG 4X66Q 4FXGC 1K83H 3W1BA 3NSWA 1CTMA 3TP7A 2NUCA 3UE0A 3OW7A 1M1KC 1QVGA 3TP5A 1AH9A 3CCSA 2EIFA 3LX0A 5LMNL 1YJ9A 2YU9B 2NYZD 1VQJA 4K8IA 1HTPA 5AJ3L 2IX1A 3S17B 1PYSB 5IYCH 2KBNA 2KHSA 1Z47A 3GV3A 4LF7Q 3ULJA 2F4VL 4IUPA 3TRZA 4LUZA 4JI4L 4EQ5A 3S1MB 3VA5A 3E3XA 4L5RC 1HNXQ 1F77A 1MJEA 1OO9B 4DUYQ 2WB1G 5M3FB 4QCLA 4JOIC 2ASBA 1PFMA 4LFAL 4HN7A 4DV5L 4A3KH 3S14H 2D2CC 4TRDA 2G5DA 2G9DA 2N88A 4HCSA 2ZXOA 4RGMA 4P72A 4JI5L 5IP9H 2HDMA 2CHBD 4A93B 4POGA 5IYDH 5ELBA 4CBVA 2F52A 1SRUA 1QZHA 2VZAA 3EQLC 4DR6Q 4ILWA 2JJQA 4UP8A 1RCVD 4DAYB 1SMYC 3CCMA 1JORA 1HXYD 2EZVA 4Y52H 1VQGA 1PH3A 3LWEA 3HZXA 5E3FA 2F1MA 1E2WA 1H9KA 3SVMA 1R9TH 4U673 1RL2A 2FJ2A 2C9OA 1EYGA 2E8GA 1U4PA 2HUGA 1SYEA 2JA7G 2KVMA 1VQ4A 4XDXA 1PH9A 1V43A 1A63A 4R1JA 3HKZB 3BU2A 2Q8TA 1HR0Q 1QZGA 4C3HG 2ZXPA 3FPUB 1LTTD 5BN4A 1YBYA 2O2LD 4N8FA 1LTRD 4DR7L 3KDFA 1BBXC 3HP3A 2DNCA 4LF5L 2NVTH 4IUVA 2B2TC 3J7ZC 4A75A 1XX8A 2YYZA 3PO3G 4GS3A 3HOVH 1K8OA 1T9HA 2G9HD 3CRKC 1JMCA 2Q2HA 1MHWC 4KJNA 5IGFA 2N8NA 1U4LA 5E4XA 2DNEA 3BDOA 4LF9L 2Z4IA 3TS2A 4AYBE 2RF4A 4DR2L 2JEAI 2A74C 3S9WA 4N8X1 2A5HA 1W6KA 1EWIA 4KTAA 4CKBA 4NP5A 3OTOL 3CC4A 2L9HA 2CCZA 1NUCA 4DV3Q 4YHHL 2EYFA 4HMJA 4C2MH 1H9JA 2LKVA 2Q8RE 1H9MA 1F9QA 3Q22A 4IO9A 1HA5A 1STEA 2F0QA 3UDIA 1C8CA 5C6AA 2F0LA 1JOQA 1V9PA 2RDGA 4LAAA 4PQXA 1CA6A 1EY8A 3A56A 4C56C 1KAAA 5D3IB 3F1ZA 4XYQA 2B3GA 2ICEC 1HFNA 1PMRA 2FXQA 3ND9A 3A7AB 3I2ZA 4RMFA 2E76C 2Z6KA 1D8LA 3P7JA 1VQOA 2Q2TA 1Y8OB 1I4RA 3VR3A 4HJ7A 1Y1VG 1PH1A 4HSPA 1QNKA 2OT2A 1II3A 3L0OA 4BWGB 2CH4A 5CBAE 4A4IA 3TSSA 5DNFA 3FPPA 2OQKA 1LT3D 2HQLA 3UE1A 1BDOA 1TWFB 4A3EB 2A69C 2EYJA 4B3ML 4LUVA 3AB9A 1IBLL 2XIWA 1NY4A 1PDQA 1K8MA 2R93G 1LT6D 4ZUIA 1FGBD 2PW7A 5FLXc 4DAVA 1G8ZD 2K7VA 1N32Q 1IBMQ 4DV0L 2JQOA 3Q6SA 4IFDJ 2K75A 4KHVA 3CCEA 1PH4A 2RDHA 5EAYA 1A62A 1C48A 2E2DC 3S2DB 3J7AF 2UUCL 2VXWA 1LTSD 3SK5A 1XNRQ 4BA1I 1G2SA 3HKZE 3FVQA 1F2MA 2N3SA 4L6TB 2KA7A 4WJ4A 3VR5A 3QWNA 4O42A 4B3RQ 1GUWA 2JA6G 4LF6Q 2CFMA 1DD2A 2L11A 2NN6H 3SK6A 2PYKA 2XSCA 1N34L 2B2UA 4HMIA 1E0BA 3RZOH 2H1EA 4RGTA 4KJOA 3FKIH 1QILA 1L0XB 3BDLA 3HS0C 1BBUA 4DK6C 1CQFA 2EDGA 3DM3A 3E9IA 1B4OA 3RD4A 1KDAA 5C4HA 5JPNC 3H3VH 3ITPA 1XMOL 2KEDA 3H0GH 4IURA 2F0SA 2Z0SA 1WTHA 4BBRG 1VQNA 1Q12A 2PNHA 4CDCC 1SE4A 4O0AA 4AQYL 1LTBD 1MBYA 1ZEQX 4IUTA 4X3SA 2C5CA 3C3LA 1FGUA 1ICFB 1SE2A 4FXKC 1GUGA 1NR2A 1STGA 5M9OA 2RHSB 4OO1H 1TU2B 3WWVA 1XNQQ 1STAA 2NZHA 1FYCA 4PZ7A 2KCNA 3VR6A 2JA7B 4JK1C 2VQEQ 5CBEE 2WFWA 5E7NA 3EIVA 1FJGL 1S5BD 1P16A 1NCVA 1PLFA 1K3RA 1SNDA 1ZYRD 4C3HB 4ZKBB 4YCWA 4EX5A 2E2JH 3U4ZA 1QNUA 1EEFD 1JWMD 4YY3Q 1EQQA 4OWWB 1HNWL 1F2YA 4ZUJA 1QUQB 1QB5D 3PO3B 1EY5A 2OF1A 3AYHB 4ABNA 4WORA 1S5ED 1ILPA 3J81c 1P8LA 3DUZA 2R92G 1JE4A 1L0WA 1Q3LA 5LMNQ 3A5ZB 4IFDI 4MTKA 4F88A 1IBKL 4JPBW 5CV4A 5C4JB 4B08A 4GOPC 3NTKA 5I9PA 1G6PA 4XQJA 5GAHC 3RN2A 5IYBH 5G3LD 5G3LF 4IN3A 4OIKA 3TP6A 1SNMA 3CAMA 3BZCA 3MXNA 3EROA 4CHTB 2PZTA 1HRJA 1HNZL 4TQUS 4LFBL 2UXCL 3ULLA 4MZ9A 4A3FH 4S3SA 1SFOH 4K5VA 3W1GA 3WOFA 4DXFA 4JVZA 3CPFA 1TWCB 4DK3C 4PV1C 1WYDA 1SAPA 3VYSA 2BE5C 1PH6A 1GJXA 1MIUA 3BDCA 1VMPA 1WTQA 1IL8A 1KXLA 1STNA 2XGTA 3SHLA 5C0XJ 2F3VA 1CHQD 3GQBA 2B39A 3TEHB 1TKWB 1PH8A 1E1TA 1E1OA 1UE1A 4P74A 1SNCA 1TS3A 4GKJL 3DEPA 5M5WH 4DGZA 4ZK9B 2R93B 2H4OA 1OXXK 1EEID 3AQQA 2K03A 3A8IE 4IALA 2CWAA 3BYTB 3HOYG 4OX9L 4RG1A 4BBSH 2E2HH 1Q86C 5FLMG 1BR9A 4BXXG 2F0GA 3QOJA 1G6ZA 3BZKA 1CSQA 5C4XG 1X3FA 4DR7Q 4JOIA 1WCMG 1LV9A 5C3EG 4LF5Q 4IJHA 2TMPA 2J4XA 2JA6B 2HHHL 3UI2A 3M9BA 2A6HD 2F0DA 2LXKA 5JEAH 4DK0A 2Z8LA 1M8AA 4CJ0B 1HTLD 4WJWA 1F2ZA 4RWSC 3SXHA 4I7AA 3IFDA 5BR8Q 4DR2Q 3A0JA 3I4OA 1A2TA 5HGTA 1RDPD 2RSNA 5IGCA 3HOXG 1A2UA 2DUDA 1FVIA 3D8GA 3ICEA 3HOZH 3LWUA 3KUPA 3KLSX 4BBRB 5CV7A 1NTGA 4OL7A 1QG7A 3NWTA 2RCNA 2PNRC 2AHOB 1JICA 5IE8A 2F3WA 4DV4L 3GTKB 3K59A 1CM9A 3BZDB 3CCJA 2SEBD 3I8ZA 2O4XA 3RMHA 2WV6D 4PMWA 2AQ1B 1KL9A 5J22A 2N55A 4OONA 1I4QA 1SE8A 1D5XC 2Y0SG 4LF8Q 1KHIA 3RLOA 2AKWB 1LYLA 2MJ8A 4DA2A 1CK1A 4X64L 1EWHA 4JI6L 1TY0A 3E9HA 3H09A 4FYDA 2PMZB 2F0OA 4OEMB 4R4OA 1Q8IA 4JI2L 1Z9FA 4DKAC 2KHJA 2B2TA 1BOSA 2E5LL 5JVH3 5C0XI 4EGVA 3Q24A 2IJ0A 4RCOA 1IZ6A 2IPKD 1E7ZA 4JI1L 1FNVA 2PZUA 3BG3A 5CYUA 1EQRA 1PTOH 2NWGA 1EY6A 3VYRA 5ELCA 3STBD 2WKDA 3GTQH 1K0RA 1AEXA 2Z4HA 4JBMA 2R92B 5FLXL 4HJ5A 1RHPA 1VQCA 4TKOB 2CW0D 5HY6A 1PVOA 1PRTD 4V0BA 1X55A 3E0EA 3AEVA 5DEHA 1PV4A 5ELFA 3K0YA 1ET9A 2JA8G 1F9SA 4K6DA 2F0JA 1YNJD 4MNOA 3PUWA 3KF8B 4QIWB 1HQRD 1F9PA 3E5SA 3RZDH 3K7AH 5CMDA 1TWAB 2KUMA 1J6QA 4MN3A 1E2ZA 3HOUB 1N34Q 1SYCA 4JI8Q 3JAMi 2RVLA 1U5KA 4KN7C 3GD7A 1U0LA 4LFCL 4GNXC 3M4YA 3NWSA 2JN4A 5C44H 1GO3E 2EY6A 3K8AA 5KYIA 3J7YW 4KY6A 2FMCA 3CW2C 3L9AX 3KFUA 3S16H 4JI3L 1U4MA 4ME3A 3G4SA 2K04A 2F0VA 4YWMA 1YVCA 1EU4A 2IT1A 4X3TA 4EQPA 3WOEA 1C9OA 3BJUA 1UWVA 1HZBA 1JR0D 3U9OA 5K36H 1STYA 3SK8A 4Y7NB 1BNZA 2A68C 4FF3A 3JC66 1Y1WG 4A3IG 1EY9A 2LFNA 1WTVA 3HOYB 2PZWA 1EYCA 1EL0A 4DR3L 3OW2A 1UUPA 2Q2UA 4H44C 2FHTA 3NHHA 4Q5VA 2K5DA 4BY1H 2B63H 4QMGA 5C4XB 2RKSA 4DPGA 1HZCA 1EY4A 1WCMB 1PH5A 5C3EB 1ONLA 4P2CB 2PQAB 2EE1A 2PMZE 2QW7A 3CRLC 2OEOA 3A55A 1OXSC 3D3RA 2RSOA 1K8GA 4F8MA 3UDFA 1I4GA 4CKEA 3P75A 4LUOA 1X65A 1I6HH 2DGYA 4RA8A 3J81L 2X6LA 4N9PA 1HZ9A 3PCOB 3I4MG 1Q82C 3E0JA 1IBKQ 5EKLA 3HOXB 4XT1B 1Q7YC 2QKIC 2OWOA 2KEEA 5A35A 1B50A 3K6OA 4JYAQ 4YCVA 4OGQC 2FINB 2OCEA 2DN8A 5EBDA 4A3DH 2VS1A 4QQBX 5KRUA 5IYCG 4RGNA 3DWQA 2NVYB 3SE0A 2EYOA 1XXGA 1ASYA 3GTPH 3CCVA 2EJGC 3OPOA 3T1HL 4DAPA 4JI0L 5ISRA 2Y0SB 3GTLH 3F2UA 2K01A 3I4NH 5M3MH 1B9MA 3C1EA 4A3MH 4DV1L 1G2TA 4A3KG 3GTMH 2PQEA 3AU7A 1VQ8A 1JJGA 4ZKCB 1NMGA 4KLKA 5IP9G 3K7UC 5IWAL 1TS4A 1TY2A 5D14A 1LABA 5IYDG 1LO5D 1SBBB 4ULLA 1NE3A 1DXMA 1HH2P 4FF4A 2QDBA 5GAEC 1PZKD 2B8GA 3S24A 1UEBA 2OTJA 1YNJC 3IFTA 3K57A 5A2QL 5EBCA 5C5MA 2EVBA 3BVGA 5KYLA 4GOPA 4AH6A 2M00A 1SMXA 4GLVB 4RAUC 1Z6HA 4XTCS 2JA8B 5DLQE 1BO0A 2E2IB 5IOCA 3J80E 3NQIA 2ZTDA 5IGGA 4KKUA 3H94A 4EQNA 3MWYW 1LTID 5CV8A 4JV5Q 1KRTA 2LXJA 1EFID 3EVQA 3JAME 1EZ8A 3D4DA 4A3JG 2N49A 4DR5Q 3S2HB 2JK8A 1YEZA 2OQ0A 2K4KA 1I4XA 2KOLA 2MHVA 5LMUQ 1WTWA 3S1NB 2XVSA 2WAQG 2B8FA 1CI3M 4H7BA 4DNIA 1VQAA 3CQZH 1YHAA 2UXBL 4IUUA 3HOWH 2Z9HA 3HOVG 2F0TA 4B3TQ 1QWYA 1YJWA 2OXPA 1JQYD 1VQMA 4KY5A 4JBJA 1ESFA 3L7ZC 2EXDA 3PQIA 2VQFQ 3M4OH 3NTIA 2LSSA 5C3WA 1S72A 4GKKQ 3T56B 4RFBA 3SK4A 1KC8C 4XQNA 1UEAB 2O5JC 1XPOA 3U9SA 4R4QA 1LTGD 4HEDA 4EVOA 5C3XA 1S5FD 1V1PA 1YNND 1NSNS 2BA1A 5KIXA 3ERSX 2JXMB 1FNUA 2C35B 5I6WA 1Y1WB 2IHEA 2NZOA 5I9OA 2JYOA 1Q46A 3KBGA 4P71A 4A3IB 2A6EC 3GV6A 1N36Q 3CP0A 4BY7H 5CV9A 4GNXB 2MPMA 5FO7B 4NDXA 1UE6A 4GZYC 1D1KA 3O13A 3KF6B 2D9UA 3S15B 2B2VC 3D4RA 2NVXB 3QIAA 1IKLA 4OIJA 4JI1Q 1SYBA 2V4DA 2K33A 1L1OB 4B3SL 4DR4L 3OWEB 3OSOA 1JB7A 5FOBB 3GTJB 4R4TA 2M2LA 1Q90A 4DAMA 2ATWA 3D31A 1TWHB 5TSSA 3M3YH 1S4ZA 4DV7L 5FO9B 1EIFA 4ZQ3A 5IGBA 1N33L 5T1GA 5BN5A 3I4MB 5FKAC 5JJLA 4H13C 2O5IC 1K83B 1AZPA 3NBHB 4KHPL 1PH2A 1XYIA 1B44D 2I5MX 2MO0A 2RA4A 5IT9L 2NTTA 3ER0A 2PPBC 5JJIA 4AIMA 2PW5A 3OYYA 3S1QH 4NXMQ 4C1NI 3OWFA 2FFKB 3HG9A 2EYPA 1EWCA 4HIDA 2F0NA 3FRPB 3NENA 4DAYA 3G6JB 3J81E 4DV2Q 3QB3A 4G4KA 2BA0A 1NJIC 2R61A 1FL0A 2RQXA 4DFAA 1SJED 3W5OA 4PNYA 1YZ6A 4G7OC 2AMCB 2WB1B 4A3KB 3C2PA 3S14B 2NN6G 5M5YH 1AE3A 1C7YA 1WD1A 2EJMA 2EOTA 4HSVA 3TQYA 1I50H 5IP7H 3FKIG 1TS5A 2NVQH 1ENFA 2D62A 1GHJA 1RF2D 4NXNL 3ZJYC 3H0GG 3I73A 3PUYA 1AE2A 3KLWA 1NAPA 3W3AA 1XMQL 4CJ1B 3TMEA 1I4PA 2QF7A 2RBMA 1IW7D 2R7ZH 1SYFA 1AN8A 3GTGH 4CDDC 4A3BH 3MEHA 2KCTA 1KABA 1PA6A 1JWUD 1XWEA 1R9TB 4OO1G 4C3JH 1E22A 5E4WC 3RNUA 1MKHA 3NPPA 1KIXA 1BF4A 1CA5A 1YNXA 3DLLA 4DR1Q 1PRTB 1PTOD 4QUFA 1HR0W 2R6GA 3A54A 5FK9C 1QJOA 1Q1BA 5A2QE 2PO4A 4LF4L 3PV0A 4A3JB 4IFDH 1A3UA 4GNXA 3EJIA 2JE6I 3KLSA 2QEXA 2WAQB 2NVTB 1DYQA 2I5LX 1IHZA 4JCVE 2QA4A 3KF6A 1TWGH 1STBA 4OHJA 4EQOA 1H95A 1YHQA 3RR5A 3K5OA 1W2BA 3J81j 1DCZA 5I4DA 3U4VA 3URYA 1Q1EA 4QGUA 2ZJQA 1GD7A 3OMCA 5AJ3Q 3CMAA 2HD3A 2GN5A 1JB3A 5JVG3 4A3LH 2EXZA 3IL8A 3MFGA 4C3IH 4YWKA 4C2MB 4OO1I 5IYBG 1MJCA 2F4VQ 4JI4Q 4X3KA 3T51B 4OWTB 3BVZA 3F2DA 2VUMH 3TZDA 1V1QA 2RCFA 2KJXA 3MHBA 1KLGD 5CV5A 4LFAQ 4DV5Q 4A3FG 4ALPA 4K0KL 3K5LA 1M90C 3OMGA 1EY0A 4F7XA 4G7ZC 2JA5H 2L15A 4JI5Q 2WB1E 3ULPA 5J39A 1AFPA 4UY8C 3PIOA 1KQSA 4PMCA 3A74A 2ENBA 1PH7A 1QCBD 1Y1VB 4L5SA 1WJJA 2F0WA 2D0PA 1VQBA 1SYGA 1I94L 4A3CH 3NTHA 5JJKA 3DWPA 1A0IA 3CC7A 1JJCB 1KDCA 2VW9A 3PF4A 2VB3X 4LF7L 3HOUH 2K50A 1IKMA 5IGEA 4NMZA 1KNAA 5ELDA 5LL6S 1EYDA 1PFNA 2A1AA 2L55A 5JOBA 3BVMA 1B53A 4DUYL 1DGSA 2VNUD 2K52A 4ME5A 2P5ZX 3G48A 4BBSG 4UAIA 3NE5B 1J9OA 1CFMA 4CDEC 3QJYA 1Z7TA 3CXCA 5JJZA 3LNNA 3NK9A 1RKNA 4HJ9A 4APVA 5M5XH 1I3QH 4LK1C 2K5VA 5JEAG 5IT9E 4TVAB 3F2BA 3HGBA 4QF4A 3RZOB 1EIGA 1O7YA 3W2DA 1ZKOA 3FKIB 4LF9Q 1E3PA 4KY7A 4UDUC 3D6CA 1K9MC 3CKIB 2ZM6L 3H0GB 3HOZG 1JT8A 3PO2H 1O7IA 3OTOQ 2A73B 3TZUA 4NB3A 4E6IA 1CSPA 3K81C 4YHHQ 1QUQA 3F8TA 2HDLA 2IY5B 1KTKA 1HR0L 1WTOA 3T53B 1A3VA 1BCPD 1HUMA 1IYJB 4IPGA 1ZYRC 2CVRA 4LW1A 5C0XH 1EYAA 1LTLA 3GTOH 4A3GH 1BUVT 3L3OC 4C1NK 3S1RH 1TVXA 3CF5A 4AYBG 2B2WC 4ODGA 2DY7A 2ZXRA 2J7ZA 5COYA 4DNTB 2JA9A 1K28A 1C4QA 4CGYB 3CPWA 2D5DA 4UHVA 3H91A 1B1ZA 2E2JB 1IYUA 1GHKA 1OTCA 1O7LA 5ELOA 4IPDA 2SNMA 2YU9H 1ESRA 4X3UA 5DM73 2L1BA 4DV3L 3S17H 1DONA 4KHPQ 3V96A 1UE5A 4B3MQ 2BCOA 1IBLQ 3HRZC 1K3BC 2YV5A 1LACA 3S1MH 1VQ7A 4JW0A 4ZRZA 2XTIA 2DY8A 1X9NA 3M4QA 3MVVA 1DOKA 5CC4A 4DV0Q 5M3FH 2I5HA 1GUNA 3QR8A 3CCUA 4HJ8A 1PRTF 1VQKA 3M7NA 2AQ2B 1BXTA 2X6GA 3DHQA 4FP5D 2UUCQ 2L5TA 1PFSA 4L63B 1N9WA 4A93H 4K2LA 2WIIB 2B2VA 3J80i 5KEEA 1GUOA 4A3FB 5CORA 1SFOB 3X3MA 1H9SB 1HZAA 1X3PA 1E24A 2LMCB 1SNQA 3PIPA 5C44G 4DF7A 5H1SE 5I2XA 1M4VA 4CDFC 4X65L 2DJFC 5FJ8H 2YTXA 1XMOQ 1IBML 1SMYD 1EY7A 3VA7A 3P20A 1MD2D 2I07B 2K5NA 3PUZA 3M7GA 1FNWA 4KHZA 4AQYQ 1KRSA 1L1OC 1ICWA 5K36G 1B9NA 5M5WB 1XNRL 3S1NH 4HTHA 1W3SA 4MIUA 3CD6A 3FP9A 2F0FA 4LF6L 4HIKA 4BBSB 2E2HB 3HKSA 1IXRA 1XPUA 1I6VC 1FJGQ 1VS0A 2F0EA 3TN2A 3VR4A 2B63G 2A6HC 4BY1G 2SDFA 2OTLA 5HGQA 1XJVA 4IQZA 1ILQA 4R4IA 3I90A 1NNXA 1PHJA 1DOLA 1SN8A 1EIHA 2BH8A 1WTPA 3N52A 2H5XA 1ET6A 4MHEA 1HNWQ 4UP9A 3KJOA 3PSIA 4QY7A 4J6HA 4DXGA 2Z1CA 1S5DD 4J1MA 3J7AV 4M1UB 4V190 1CKNB 1PZJD 4HIMA 1ENCA 4X6AH 4I7ZC 3SGIA 5C4ZA 1AZQA 3KDFB 5K5PA 2F0KA 2AWOA 1MGSA 2AQ3B 3PUXA 1EUJA 4L5TA 1D7QA 3FDTA 3I91A 4K8JA 3HOZB 1XNQL 3PUVA 2WACA 2BH2A 1STHA 2UUAL 2V1CC 4A3DG 4JG2A 1GUTA 2WINB 2Q2IA 3A7LA 5GADC 5CR3A 1SSOA 2R7FA 2K5QA 1JE5A 2K5WA 4KMUC 4YY3L 4DNRB 3I7FA 1HNZQ 4H0LC 4LFBQ 2UXCQ 2EQSA 3T1YL 3A5UA 2NZ1D 1JJ2A 4ZCKA 3J81i 4AYBB 3I4NG 3EFXD 5M3MG 1WFQA 4QIWE 1UAPA 4HJAA 4A3MG 3A8JE 2XRQD 2IWHA 3CCRA 4B9WA 1D1IA 4P73A 1TWFH 4A3EH 3QG1A 4O2DA 3STBC 4JI7L 3EN2A 3KF8A 3UDGA 1I94Q 3MEFA 1FD7D 1F9RA 4UP7A 4M8AA 4FXDA 1KDBA 2A69D 2CW0C 4WRDA 3CMEA 1H9SA 3DXJC 2F0IA 1YJNA 1PTOB 1PRTC 3AMUA 3C1FA 2Z6BA 3D4WA 1VMCA 3S2DH 1HNXL 5ELNA 1VQ6A 3GTQB 4GKJQ 2R7DA 3L2PA 1D6EC 4LWCA 5EPLA 4OX9Q 1QVFA 4GLAC 2UUBL 1G91A 3VYUA 2NTSA 3FMCA 3SR1A 2TSSA 1F2LA 2E74C 1NMFA 3MC0B 5E1FA 1HJPA 2IW3A 2B2YC 2EY2A 1EQTA 1SNPA 3R3OA 2BOSA 3U58A 2I0QA 2YTVA 3RZDB 3NEMA 3K7AB 2ALYB 3TBIB 4FF1A 3C46A 5EJWA 2HHHQ 3I72A 3OIPA 3K58A 2F03A 3HFZB 1LUZA 5NUCA 5FLXE 4LNQA 1UE7A 1LT4D 3WDNA 4RKLA 3DEOA 3HOWG 5C44B 1WVLA 2PI2E 3PMFA 4KD4A 3KYHC 3MFYA 2ZM6Q 2LY7A 1WOCA 3B6YA 3S16B 1X56A 1Y14B 2QEJC 3PIP3 4KN4C 4RHRA 2PQAA 2MGSA 2JA7H 1CUKA 3MTSA 2PI2A 5CGKA 1EZ6A 3V2TA 1MSHA 4WJ3M 3T16A 4DV4Q 1CKNA 2J0TD 4RHSA 4C3HH 5IODA 4QUCA 4A3JH 2WP8J 1QOHA 5EQ0A 3FHWA 3R2IA 4BY7G 1L0YB 3TREA 3GP7A 3DWAA 3PO3H 2EYMA 1HUNA 4O1NA 4YWLA 4X64Q 2D0OA 4JI6Q 4R8NA 2A19A 4BY1B 2B63B 1VDZA 1H9RA 5BR8L 3R8BA 2IX3A 1EOVA 1A6XA 4JI2Q 2Y0SE 2E5LQ 3I3CA 1B3AA 2K05A 2K5HA 2IL8A 4MTNA 5C4JH 1BQQT 4KKTA 3K5MA 1I6HB 4DV6L 2KECA 2F4IA 5EPKA 5EKKA 4JC0A 5CV6A 2CQOA 3F2CA 1B2TA 2KHIA 1SE3A 1SR3A 4KD3A 1D2BA 4HR7B 4IUNA 4OELB 1LT5D 4HCEA 1J8IA 3T13A 2K14A 4LF8L 3CCQA 1TWCH 4A3DB 3CC2A 1V1OA 2HIVA 3G7LA 3H3VC 3MXGA 5EPJA 1S40A 4PZ8A 4BA2I 3BS1A 4DUZL 3LGJA 4L8JA 1DZ1A 2L12A 1Y1VH 4LJZC 1VQLA 5GAGC 5KNCA 2B2WA 3GTPB 3G6EA 4IOAA 1A8VA 3J80c 2EPBA 3GTLB 3I4NB 5M3MB 1RTNA 1VQFA 4A3MB 2BE5D 3GTMB 3MXNB 4Z9CB 3ND8A 2RHQB 4LFCQ 2KCMA 4K5WA 2QCPX 1BCPB 4X65Q 4ZYSA 3JAMc 2KENA 2R93H 1TT2A 1VQ9A 5IP7G 2L0CA 4RH6A 4IJLA 4JI3Q 1SROA 3BYYB 1RODA 5J3BA 1J5EL 1W6JA 3M85A 4G57A 2A8VA 2DJGC 5JAVA 3OIQA 2ZTCA 1JWSD 1FR3A 2M9VA 2R7ZG 1GVPA 1MI2A 4GN3B 1K0SA 4IPHA 5EKIA 4A3BG 3R93A 3NQTA 3ERQA 1L2FA 2JA6H 4ID6A 1HFGA 2EYHA 4DR3Q 2UXDL 4C3JG 2GVAA 4JI8L 2PCFB 4RKBA 1YIJA 1GXDC 2N78A 1CZGA 5GQOA 3X3NA 1R4QB 2VB2X 1Y8PB 1E2VA 2NB0A 1WTXA 1IL2A 1CQVA 1PTOF 1JOKA 1U9RA 4IFDG 2NN6I 2EY5A 2ID0A 4BBRH 4JBKA 4X62L 1T5XD 5I6YA 1D5ZC 3CQZB 2AUKA 1XTCD 2K6AA 5D65A 3GTKH 3MZ5A 3HOWB 4UPAA 1TR5A 1BBWA 5F2DA 2JEBI 3H6MA 1I5FA 4FO2A 4K5XA 3IKJA 3HOVB 3VYTA 3H3VI 1YNNC 1OXTA 2UU9L 3KBXA 1UNSA 5IY0A 3U50C 3M4OB 3DMUA 2E75C 2UUAQ 1L1OA 4K6LA 1X3QA 1EQVA 1RJTA 2GVBA 5EGTA 1TIID 1RTOA 4A3LG 4C3IG 4PG3A 4Q0FA 4XIGS 1JC7A 5BN3A 3QO2A 2R3ZA 3EA6A 4HAEA 3T1YQ 2VY3A 1VQHA 1SDFA 5HURA 4K2KA 4F87A 3D6WA 4XYOA 2SOBA 2ICIA 1NBWA 2VUMG 1XTDA 3NBHA 3T1HQ 1BVSA 4JI0Q 3VDYA 4CJ2C 4BY7B 2HQEA 3KK7A 2K32A 4LMQD 4DV1Q 2MUYA 4POFA 1IYVA 1TQOA 4JI7Q 1TXYA 2BDNA 2JA5G 1Y69U 1VQEA 2R92H 2AUJD 1VCIA 4G7HC 5IGDA 1OXUA 5IWAQ 4X66L 4JYAL 5JPMC 2JSOA 4OXPA 3K80C 3Q0AA 1AP0A 1KAWA 3KJPA 3M3YB 5JEAJ 1D5MC 4A3CG 4QB4A 4RCNA 1EU3A 2IX0A 4L5QA 2B29A 4B9XA 4DN4M 3MAQA 2QGQA 1G51A 1R4PB 3HOUG 2UUBQ 1TWAH 4ZLTF 2F0HA 5KNBA 4KK7A 4IUQA 4DU9A 1PXUA 3PF5A 4DK1A 4WFN3 3I70A 3S1QB 3R2TA 3QOLA 3Q23A 4YIJA 1A15A 1CHPD 1Q8KA 2RDFA 1MSGA 4IZ8A 1K73C 1EIYB 2K28A 2XWJB 1B8AA 2QDLA 1RD9D 1X3EA 2JP1A 3RLNA 2HT1A 2YTYA 1B3QA 2MQHA 2XWBB 3TDQA 1PFBA 3TP8A 3MXUA 1GM5A 1VQDA 5M5YB 1VF5C 1S5CD 4CKCA 3CCLA 2UXBQ 4FF2A 1XPRA 4DR6L 5I2YA 4Y7NH 1CT1D 1I50B 4OWXB 3J7A5 5DM63 1IW7C 1SNOA 2NVQB 2WAQE 2IHFA 2SNSA 3HOYH 2MO1A 4KI0A 1HCZA 3MXPA 5FLMH 3H15A 2ES2A 3PO2G 2K1BA 2CH4W 1HPCA 1PYWD 2A68D 4BXXH 3AFPA 1O7ZA 3AFQA 1QE6A 5C4XH 2R7ZB 3Q8DA 2XN9C 1I4HA 1WCMH 2F3IA 5C3EH 3GTGB 4A3BB 1QVCA 5T1IA 4R4CA 4JV5L 2CWPA 1SJHD 3P1HA 1WTRA 2XNAC 1PTOC 2VL6A 2Z6KC 4C3JB 5C0XG 4DR5L 1EFWA 2B2YA 3G71A 5C5LA 4XXEA 1BCPF 4A3GG 5LMUL 2CQAA 1GUSA 2F0MA 3RN5A 3HEJA 1SYDA 1WI5A 4GN5A 3E6ZX 4B3TL 4R9WA 1B7YB 2I46A 3HOXH 1V8QA 1B70B 3NXWA 1YHBA 2MNAA 4B3SQ 4DR4Q 2VQFL 4GKKL 3MA2B 4DV6Q 1A3TA 2WKCA 4N9TA
chains in the Genus database with same CATH topology
4DV7Q 2BH2A 1N33Q 3KF6B 3PGZA 2UUAL 3AYHB 2V1CC 4A3DG 1VQIA 4JG2A 3J81c 4QJFA 3GO5A 1P8LA 2Q2IA 2NVYH 5GADC 2R92G 3D0FA 1L0WA 4JI1Q 4GLXA 2R7FA 5LMNQ 1JE5A 1L1OB 4B3SL 3A5ZB 4DR4L 4IFDI 4YY3L 1IBKL 1PYBA 3I7FA 1N36L 1HNZQ 4LFBQ 4IPCA 1JB7A 2UXCQ 4YCUA 2EQSA 3T1YL 4R4TA 3A5UA 1JJ2A 3J81i 4DAMA 2ATWA 3D31A 5M3FG 4GOPC 2CKZB 4P75A 3M3YH 5GROA 5LMNW 1G6PA 4DV7L 5M3MG 3I4NG 1WFQA 4QIWE 4HJAA 1EIFA 1N33L 4A3MG 4FDBA 5GAHC 3CCRA 4DUZQ 3RN2A 4A76A 1X54A 5IYBH 4P73A 1TWFH 4A3EH 5JJLA 3CAMA 2HIXA 3BZCA 4O2DA 4PZ6A 1X3GA 2AWNA 3NBHB 4KHPL 1PH2A 3STBC 4JI7L 3EN2A 3UDXA 1VQPA 2I5MX 3UDGA 2MO0A 1I94Q 3MEFA 1EFWA 4A93G 1HNZL 4TQUS 4LFBL 2UXCL 3ULLA 3ER0A 4MZ9A 3GDEA 4UP7A 4A3FH 1SFOH 1N8RC 5JJIA 4AIMA 3W1GA 3CMEA 3OYYA 3S1QH 4NXMQ 1YJNA 3CPFA 4DK3C 1WYDA 4HIDA 3S2DH 5ELNA 3NENA 1VQ6A 4GKJQ 4HIOA 1YI2A 1LM0A 4DV2Q 1YITA 4GN4B 1G291 1S3OA 3I56A 2BA0A 1PH6A 1NJIC 1J5EQ 1MIUA 2R7DA 3L2PA 1FL0A 5IT9c 4LWCA 5FJ8G 1KXLA 4NXNQ 2XGTA 3W5OA 5C0XJ 4OX9Q 2JA8H 1QVFA 4GLAC 2UUBL 1YZ6A 2AMCB 2E2IH 1XMQQ 2NN6G 5M5YH 3TEHB 1PH8A 1AE3A 4NXML 1N32L 1NMFA 1C7YA 1HJPA 1E1TA 1E1OA 1UE1A 3IRBA 4P74A 3HKZG 2MFIA 3TQYA 3U58A 4GKJL 5M5WH 1I50H 5IP7H 4DV2L 1RIPA 2UXDQ 3FKIG 2I0QA 2YTVA 1OXXK 3NEMA 2NVQH 2ALYB 3AQQA 2D62A 3K0XA 2CWAA 3S2HH 4QL5A 4NXNL 2HHHQ 3HOYG 4OX9L 4RG1A 4BBSH 3ZJYC 3H0GG 2E2HH 3HFZB 1LUZA 1AE2A 3KLWA 3PUYA 1XMQL 5FLMG 1Q86C 4LNQA 1UE7A 4B3RL 4BXXG 4GOPB 2R7ZH 3HOWG 3BZKA 2ZJRA 1CSQA 1KD1C 5C4XG 2PI2E 1X6OA 3KOJA 1X3FA 4DR7Q 3GTGH 3KYHC 1BKBA 1WCMG 4JOIA 4A3BH 2ZM6Q 5C3EG 1WOCA 3B6YA 2KCTA 1ASZA 1X56A 4LF5Q 1Y14B 4LF4Q 1PA6A 4IJHA 4X62Q 2PQAA 4OO1G 4C3JH 2HHHL 2JA7H 3I55A 1E22A 1CUKA 3M9BA 1CKMA 1CKOA 2LXKA 2PI2A 4JBWA 3RNUA 4IOCA 4WJ3M 1MKHA 4DV4Q 1CKNA 4NPSA 5BR8Q 1KIXA 1YNXA 4DR2Q 2UU9Q 4C3HH 3A0JA 3I4OA 3DLLA 4DR1Q 4A3JH 1K8AC 1HR0W 2R6GA 1Y1WH 2WP8J 3HOXG 1VQ5A 1Q1BA 4A3IH 4LF4L 1OXVA 1FVIA 2DUDA 1C0AA 3PV0A 4GNXA 3ICEA 3FHWA 3HOZH 3M4PA 3TS0A 4BY7G 3TREA 2JE6I 3PO3H 2QEXA 2I5LX 1NTGA 4JCVE 2ZJPA 2QA4A 3KF6A 1TWGH 4YWLA 4X64Q 2D0OA 3S15H 2RCNA 4JI6Q 2AHOB 2A19A 5IE8A 3EBEA 4DV4L 1H95A 5BR8L 2NVXH 2VQEL 1YHQA 3RR5A 1EOVA 4DR1L 3CCJA 4JI2Q 1W2BA 2Y0SE 4PMWA 3J81j 1GKHA 1KL9A 1Q81C 2E5LQ 3U4VA 2K5HA 4MTNA 4OONA 3GTJH 4J15A 1Q1EA 1SE8A 4QGUA 5C4JH 2ZJQA 1TWHH 2Y0SG 2ZTEA 4LF8Q 1KHIA 3RLOA 1GD7A 2AKWB 5AJ3Q 3CMAA 4K0KQ 1LYLA 2GN5A 4DV6L 4X64L 4H02A 3I4MH 4A3LH 4JI6L 3RLFA 4C3IH 3E9HA 4YWKA 4OO1I 1SLJA 5IYBG 4JC0A 3NELA 1MJCA 4R4OA 4X66Q 4A3EG 2F4VQ 1K83H 2CQOA 3W1BA 3F2CA 4JI4Q 4JI2L 4OWTB 1Z9FA 4DKAC 2KHJA 3UE0A 3F2DA 2KHIA 2E5LL 2VUMH 5C0XI 1M1KC 1QVGA 1SR3A 1AH9A 1IZ6A 3CCSA 1V1QA 1E7ZA 2EIFA 4JI1L 5LMNL 1YJ9A 4LF8L 2K14A 4LFAQ 4DV5Q 4A3FG 4ALPA 4K0KL 1VQJA 5AJ3L 1EQRA 3CCQA 2IX1A 1TWCH 1M90C 1PYSB 3STBD 5IYCH 2JA5H 2KBNA 1Z47A 2L15A 3CC2A 1K0RA 4JI5Q 2WB1E 2HIVA 3ULJA 3ULPA 4LF7Q 2F4VL 3GTQH 4JBMA 3TRZA 4LUZA 4HJ5A 4EQ5A 4JI4L 1S40A 1VQCA 4PZ8A 4UY8C 4DUZL 3LGJA 3PIOA 1KQSA 1VQLA 1Y1VH 4BA2I 5GAGC 3A74A 5HY6A 4L5RC 1PVOA 1HNXQ 1MJEA 3G6EA 4DUYQ 2WB1G 4IOAA 1A8VA 1X55A 3E0EA 3J80c 3AEVA 1PV4A 1PH7A 4JOIC 4L5SA 1WJJA 2ASBA 2JA8G 2D0PA 4LFAL 4DV5L 4A3KH 1VQBA 1I94L 3S14H 4A3CH 1VQFA 5JJKA 1A0IA 3CC7A 1JJCB 3MXNB 4LFCQ 2RHQB 2VW9A 2KCMA 3PF4A 4P72A 4MNOA 4JI5L 4X65Q 4LF7L 3PUWA 3JAMc 3KF8B 3HOUH 2KENA 5IP9H 2K50A 2R93H 1VQ9A 3RZDH 5IP7G 3K7AH 4IJLA 4JI3Q 1SROA 1HNXL 1J6QA 4POGA 5IYDH 2A1AA 4DUYL 5J3BA 1DGSA 1N34Q 2VNUD 2F52A 2K52A 1SRUA 1QZHA 1J5EL 2VZAA 4JI8Q 3M85A 2A8VA 3JAMi 4DR6Q 4BBSG 3G48A 2JJQA 1U5KA 4UP8A 4DAYB 2ZTCA 3CCMA 3GD7A 1U0LA 4LFCL 4GNXC 5C44H 1GO3E 3K8AA 2R7ZG 1GVPA 4GN3B 3CXCA 4IPHA 1VQGA 4Y52H 1PH3A 4A3BG 3CW2C 3KFUA 3S16H 4JI3L 1R9TH 1L2FA 4ME3A 3G4SA 1RL2A 4YWMA 4HJ9A 4APVA 5M5XH 1YVCA 1EYGA 2JA6H 2E8GA 4DR3Q 2IT1A 2UXDL 2GVAA 1I3QH 4JI8L 2JA7G 1VQ4A 1PH9A 1V43A 2K5VA 5JEAG 1A63A 1C9OA 1YIJA 3BJUA 4R1JA 2N78A 4TVAB 3F2BA 1UWVA 1HZBA 3BU2A 5GQOA 1HR0Q 1QZGA 4LF9Q 1E3PA 1YBYA 3JC66 1Y1WG 4A3IG 1IL2A 1K9MC 4DR7L 3KDFA 2ZM6L 4IFDG 4DR3L 2NN6I 3OW2A 3HOZG 1JT8A 2ID0A 4BBRH 4LF5L 1O7IA 3OTOQ 2NVTH 3PO2H 3J7ZC 4A75A 2YYZA 2Q2UA 4JBKA 3PO3G 4X62L 4NB3A 4GS3A 1CSPA 3K81C 4YHHQ 3HOVH 2B63H 4BY1H 1QUQA 3F8TA 1T9HA 4UPAA 3GTKH 1BBWA 2IY5B 1JMCA 4DPGA 2Q2HA 1HR0L 1HZCA 2JEBI 2N8NA 1PH5A 1I5FA 2PQAB 4LF9L 3H3VI 3TS2A 2PMZE 1OXTA 4IPGA 1IYJB 2RF4A 4AYBE 4DR2L 2UU9L 2JEAI 5IY0A 1OXSC 3U50C 4LW1A 2UUAQ 1K8GA 1L1OA 1LTLA 3GTOH 4A3GH 3UDFA 1EWIA 4LUOA 3OTOL 3S1RH 1X65A 3CC4A 1I6HH 2DGYA 2CCZA 3CF5A 4AYBG 4DV3Q 1HZ9A 2GVBA 4YHHL 4C2MH 3PCOB 2JA9A 1Q82C 3I4MG 4A3LG 4PG3A 4XIGS 3CPWA 1IBKQ 4IO9A 3UDIA 3T1YQ 2VY3A 1VQHA 1Q7YC 1V9PA 2OWOA 1NBWA 4JYAQ 2VUMG 1XTDA 1OTCA 4YCVA 3T1HQ 1BVSA 4JI0Q 3VDYA 2OCEA 5ELOA 3F1ZA 4IPDA 2YU9H 4DV1Q 4POFA 4DV3L 2B3GA 3S17H 4A3DH 4KHPQ 2VS1A 2FXQA 4QQBX 4JI7Q 1TXYA 5IYCG 1UE5A 2JA5G 3I2ZA 4B3MQ 4RMFA 1VQEA 2R92H 2Z6KA 1IBLQ 1D8LA 2YV5A 1VQOA 2Q2TA 3S1MH 1VQ7A 1VCIA 2XTIA 1ASYA 1X9NA 3M4QA 4HJ7A 1OXUA 1Y1VG 5IWAQ 3CCVA 1PH1A 3GTPH 4X66L 4JYAL 3L0OA 4OXPA 4DV0Q 3K80C 3T1HL 4JI0L 5M3FH 2I5HA 3GTLH 4A4IA 1KAWA 5M3MH 3KJPA 3I4NH 3CCUA 4A3MH 5JEAJ 4DV1L 4HJ8A 4A3KG 2OQKA 1VQKA 3M7NA 4A3CG 3GTMH 2HQLA 3UE1A 2IX0A 4L5QA 2B29A 1VQ8A 4B3ML 4LUVA 2UUCQ 1JJGA 1IBLL 1PFSA 1G51A 1NY4A 2QGQA 1N9WA 3HOUG 1NMGA 4KLKA 5IP9G 2R93G 2UUBQ 1TWAH 4A93H 3K7UC 5IWAL 5FLXc 3J80i 5IYDG 1IBMQ 1N32Q 4DV0L 2JQOA 4IFDJ 2K75A 3PF5A 1NE3A 1HH2P 5GAEC 1HZAA 3S24A 1PH4A 3CCEA 1UEBA 5EAYA 1A62A 2OTJA 1E24A 1Q8KA 3PIPA 5C44G 2UUCL 5H1SE 1XNRQ 4GOPA 1K73C 4AH6A 4BA1I 1EIYB 3HKZE 2N3SA 1B8AA 4X65L 4WJ4A 5FJ8H 1X3EA 1SMXA 2YTXA 3RLNA 2HT1A 4GLVB 1XMOQ 1IBML 2YTYA 4B3RQ 2MQHA 2JA6G 4XTCS 4LF6Q 2CFMA 5DLQE 1GM5A 2K5NA 3PUZA 1VQDA 4KHZA 4AQYQ 1N34L 2UXBQ 3CCLA 2ZTDA 1KRSA 1XPRA 1L1OC 3RZOH 4DR6L 5K36G 4Y7NH 3FKIH 4OWXB 1XNRL 3J7A5 1BBUA 4DK6C 4JV5Q 3DM3A 2WAQE 3E9IA 1KRTA 3H3VH 2LXJA 3S1NH 2IHFA 1W3SA 3HOYH 3CD6A 1XMOL 4A3JG 3FP9A 2N49A 4DR5Q 2JK8A 1YEZA 2OQ0A 3H0GH 2K4KA 2MO1A 2Z0SA 4LF6L 4HIKA 4KI0A 3H15A 5LMUQ 5FLMH 2ES2A 4BBRG 2WAQG 3HKSA 1IXRA 1Q12A 2PNHA 4DNIA 1VQNA 1FJGQ 1XPUA 4O0AA 1VQAA 3CQZH 4AQYL 4BXXH 1YHAA 1VS0A 3AFPA 3HOWH 3AFQA 2UXBL 5C4XH 4B3TQ 3HOVG 2B63G 3Q8DA 4BY1G 1FGUA 2OTLA 5HGQA 1XJVA 1WCMH 2F3IA 4R4IA 1YJWA 5C3EH 1VQMA 1QVCA 4JBJA 1PHJA 3L7ZC 4R4CA 4JV5L 1SN8A 2CWPA 2EXDA 2BH8A 2VQFQ 2RHSB 3M4OH 2LSSA 1S72A 4GKKQ 2H5XA 2VL6A 2Z6KC 3WWVA 5C0XG 4DR5L 3G71A 2NZHA 4PZ7A 4UP9A 3KJOA 3PSIA 1KC8C 4A3GG 1HNWQ 4QY7A 2VQEQ 5LMUL 2WFWA 1XPOA 3RN5A 4R4QA 5E7NA 3EIVA 1FJGL 1WI5A 1P16A 4GN5A 4B3TL 1B7YB 1CKNB 4HIMA 1K3RA 2BA1A 3ERSX 4X6AH 2C35B 3HOXH 3SGIA 4YCWA 3KDFB 2IHEA 1B70B 2NZOA 3U4ZA 4EX5A 2E2JH 1YHBA 1Q46A 4P71A 2AWOA 2MNAA 4B3SQ 4DR4Q 4YY3Q 3PUXA 1EUJA 4L5TA 2VQFL 1N36Q 4DV6Q 4GKKL 1D7QA 3CP0A 1EQQA 1XNQQ 4BY7H 4OWWB 4GNXB 1XNQL 1HNWL 1UE6A 3PUVA 1QUQB 3PO2G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 Q;  2BH2 A;  1N33 Q;  3KF6 B;  3PGZ A;  2UUA L;  3AYH B;  2V1C C;  4A3D G;  1VQI A;  4JG2 A;  3J81 c;  4QJF A;  3GO5 A;  1P8L A;  2Q2I A;  2NVY H;  5GAD C;  2R92 G;  3D0F A;  1L0W A;  4JI1 Q;  4GLX A;  2R7F A;  5LMN Q;  1JE5 A;  1L1O B;  4B3S L;  3A5Z B;  4DR4 L;  4IFD I;  4YY3 L;  1IBK L;  1PYB A;  3I7F A;  1N36 L;  1HNZ Q;  4LFB Q;  4IPC A;  1JB7 A;  2UXC Q;  4YCU A;  2EQS A;  3T1Y L;  4R4T A;  3A5U A;  1JJ2 A;  3J81 i;  4DAM A;  2ATW A;  3D31 A;  5M3F G;  4GOP C;  2CKZ B;  4P75 A;  3M3Y H;  5GRO A;  5LMN W;  1G6P A;  4DV7 L;  5M3M G;  3I4N G;  1WFQ A;  4QIW E;  4HJA A;  1EIF A;  1N33 L;  4A3M G;  4FDB A;  5GAH C;  3CCR A;  4DUZ Q;  3RN2 A;  4A76 A;  1X54 A;  5IYB H;  4P73 A;  1TWF H;  4A3E H;  5JJL A;  3CAM A;  2HIX A;  3BZC A;  4O2D A;  4PZ6 A;  1X3G A;  2AWN A;  3NBH B;  4KHP L;  1PH2 A;  3STB C;  4JI7 L;  3EN2 A;  3UDX A;  1VQP A;  2I5M X;  3UDG A;  2MO0 A;  1I94 Q;  3MEF A;  1EFW A;  4A93 G;  1HNZ L;  4TQU S;  4LFB L;  2UXC L;  3ULL A;  3ER0 A;  4MZ9 A;  3GDE A;  4UP7 A;  4A3F H;  1SFO H;  1N8R C;  5JJI A;  4AIM A;  3W1G A;  3CME A;  3OYY A;  3S1Q H;  4NXM Q;  1YJN A;  3CPF A;  4DK3 C;  1WYD A;  4HID A;  3S2D H;  5ELN A;  3NEN A;  1VQ6 A;  4GKJ Q;  4HIO A;  1YI2 A;  1LM0 A;  4DV2 Q;  1YIT A;  4GN4 B;  1G29 1;  1S3O A;  3I56 A;  2BA0 A;  1PH6 A;  1NJI C;  1J5E Q;  1MIU A;  2R7D A;  3L2P A;  1FL0 A;  5IT9 c;  4LWC A;  5FJ8 G;  1KXL A;  4NXN Q;  2XGT A;  3W5O A;  5C0X J;  4OX9 Q;  2JA8 H;  1QVF A;  4GLA C;  2UUB L;  1YZ6 A;  2AMC B;  2E2I H;  1XMQ Q;  2NN6 G;  5M5Y H;  3TEH B;  1PH8 A;  1AE3 A;  4NXM L;  1N32 L;  1NMF A;  1C7Y A;  1HJP A;  1E1T A;  1E1O A;  1UE1 A;  3IRB A;  4P74 A;  3HKZ G;  2MFI A;  3TQY A;  3U58 A;  4GKJ L;  5M5W H;  1I50 H;  5IP7 H;  4DV2 L;  1RIP A;  2UXD Q;  3FKI G;  2I0Q A;  2YTV A;  1OXX K;  3NEM A;  2NVQ H;  2ALY B;  3AQQ A;  2D62 A;  3K0X A;  2CWA A;  3S2H H;  4QL5 A;  4NXN L;  2HHH Q;  3HOY G;  4OX9 L;  4RG1 A;  4BBS H;  3ZJY C;  3H0G G;  2E2H H;  3HFZ B;  1LUZ A;  1AE2 A;  3KLW A;  3PUY A;  1XMQ L;  5FLM G;  1Q86 C;  4LNQ A;  1UE7 A;  4B3R L;  4BXX G;  4GOP B;  2R7Z H;  3HOW G;  3BZK A;  2ZJR A;  1CSQ A;  1KD1 C;  5C4X G;  2PI2 E;  1X6O A;  3KOJ A;  1X3F A;  4DR7 Q;  3GTG H;  3KYH C;  1BKB A;  1WCM G;  4JOI A;  4A3B H;  2ZM6 Q;  5C3E G;  1WOC A;  3B6Y A;  2KCT A;  1ASZ A;  1X56 A;  4LF5 Q;  1Y14 B;  4LF4 Q;  1PA6 A;  4IJH A;  4X62 Q;  2PQA A;  4OO1 G;  4C3J H;  2HHH L;  2JA7 H;  3I55 A;  1E22 A;  1CUK A;  3M9B A;  1CKM A;  1CKO A;  2LXK A;  2PI2 A;  4JBW A;  3RNU A;  4IOC A;  4WJ3 M;  1MKH A;  4DV4 Q;  1CKN A;  4NPS A;  5BR8 Q;  1KIX A;  1YNX A;  4DR2 Q;  2UU9 Q;  4C3H H;  3A0J A;  3I4O A;  3DLL A;  4DR1 Q;  4A3J H;  1K8A C;  1HR0 W;  2R6G A;  1Y1W H;  2WP8 J;  3HOX G;  1VQ5 A;  1Q1B A;  4A3I H;  4LF4 L;  1OXV A;  1FVI A;  2DUD A;  1C0A A;  3PV0 A;  4GNX A;  3ICE A;  3FHW A;  3HOZ H;  3M4P A;  3TS0 A;  4BY7 G;  3TRE A;  2JE6 I;  3PO3 H;  2QEX A;  2I5L X;  1NTG A;  4JCV E;  2ZJP A;  2QA4 A;  3KF6 A;  1TWG H;  4YWL A;  4X64 Q;  2D0O A;  3S15 H;  2RCN A;  4JI6 Q;  2AHO B;  2A19 A;  5IE8 A;  3EBE A;  4DV4 L;  1H95 A;  5BR8 L;  2NVX H;  2VQE L;  1YHQ A;  3RR5 A;  1EOV A;  4DR1 L;  3CCJ A;  4JI2 Q;  1W2B A;  2Y0S E;  4PMW A;  3J81 j;  1GKH A;  1KL9 A;  1Q81 C;  2E5L Q;  3U4V A;  2K5H A;  4MTN A;  4OON A;  3GTJ H;  4J15 A;  1Q1E A;  1SE8 A;  4QGU A;  5C4J H;  2ZJQ A;  1TWH H;  2Y0S G;  2ZTE A;  4LF8 Q;  1KHI A;  3RLO A;  1GD7 A;  2AKW B;  5AJ3 Q;  3CMA A;  4K0K Q;  1LYL A;  2GN5 A;  4DV6 L;  4X64 L;  4H02 A;  3I4M H;  4A3L H;  4JI6 L;  3RLF A;  4C3I H;  3E9H A;  4YWK A;  4OO1 I;  1SLJ A;  5IYB G;  4JC0 A;  3NEL A;  1MJC A;  4R4O A;  4X66 Q;  4A3E G;  2F4V Q;  1K83 H;  2CQO A;  3W1B A;  3F2C A;  4JI4 Q;  4JI2 L;  4OWT B;  1Z9F A;  4DKA C;  2KHJ A;  3UE0 A;  3F2D A;  2KHI A;  2E5L L;  2VUM H;  5C0X I;  1M1K C;  1QVG A;  1SR3 A;  1AH9 A;  1IZ6 A;  3CCS A;  1V1Q A;  1E7Z A;  2EIF A;  4JI1 L;  5LMN L;  1YJ9 A;  4LF8 L;  2K14 A;  4LFA Q;  4DV5 Q;  4A3F G;  4ALP A;  4K0K L;  1VQJ A;  5AJ3 L;  1EQR A;  3CCQ A;  2IX1 A;  1TWC H;  1M90 C;  1PYS B;  3STB D;  5IYC H;  2JA5 H;  2KBN A;  1Z47 A;  2L15 A;  3CC2 A;  1K0R A;  4JI5 Q;  2WB1 E;  2HIV A;  3ULJ A;  3ULP A;  4LF7 Q;  2F4V L;  3GTQ H;  4JBM A;  3TRZ A;  4LUZ A;  4HJ5 A;  4EQ5 A;  4JI4 L;  1S40 A;  1VQC A;  4PZ8 A;  4UY8 C;  4DUZ L;  3LGJ A;  3PIO A;  1KQS A;  1VQL A;  1Y1V H;  4BA2 I;  5GAG C;  3A74 A;  5HY6 A;  4L5R C;  1PVO A;  1HNX Q;  1MJE A;  3G6E A;  4DUY Q;  2WB1 G;  4IOA A;  1A8V A;  1X55 A;  3E0E A;  3J80 c;  3AEV A;  1PV4 A;  1PH7 A;  4JOI C;  4L5S A;  1WJJ A;  2ASB A;  2JA8 G;  2D0P A;  4LFA L;  4DV5 L;  4A3K H;  1VQB A;  1I94 L;  3S14 H;  4A3C H;  1VQF A;  5JJK A;  1A0I A;  3CC7 A;  1JJC B;  3MXN B;  4LFC Q;  2RHQ B;  2VW9 A;  2KCM A;  3PF4 A;  4P72 A;  4MNO A;  4JI5 L;  4X65 Q;  4LF7 L;  3PUW A;  3JAM c;  3KF8 B;  3HOU H;  2KEN A;  5IP9 H;  2K50 A;  2R93 H;  1VQ9 A;  3RZD H;  5IP7 G;  3K7A H;  4IJL A;  4JI3 Q;  1SRO A;  1HNX L;  1J6Q A;  4POG A;  5IYD H;  2A1A A;  4DUY L;  5J3B A;  1DGS A;  1N34 Q;  2VNU D;  2F52 A;  2K52 A;  1SRU A;  1QZH A;  1J5E L;  2VZA A;  4JI8 Q;  3M85 A;  2A8V A;  3JAM i;  4DR6 Q;  4BBS G;  3G48 A;  2JJQ A;  1U5K A;  4UP8 A;  4DAY B;  2ZTC A;  3CCM A;  3GD7 A;  1U0L A;  4LFC L;  4GNX C;  5C44 H;  1GO3 E;  3K8A A;  2R7Z G;  1GVP A;  4GN3 B;  3CXC A;  4IPH A;  1VQG A;  4Y52 H;  1PH3 A;  4A3B G;  3CW2 C;  3KFU A;  3S16 H;  4JI3 L;  1R9T H;  1L2F A;  4ME3 A;  3G4S A;  1RL2 A;  4YWM A;  4HJ9 A;  4APV A;  5M5X H;  1YVC A;  1EYG A;  2JA6 H;  2E8G A;  4DR3 Q;  2IT1 A;  2UXD L;  2GVA A;  1I3Q H;  4JI8 L;  2JA7 G;  1VQ4 A;  1PH9 A;  1V43 A;  2K5V A;  5JEA G;  1A63 A;  1C9O A;  1YIJ A;  3BJU A;  4R1J A;  2N78 A;  4TVA B;  3F2B A;  1UWV A;  1HZB A;  3BU2 A;  5GQO A;  1HR0 Q;  1QZG A;  4LF9 Q;  1E3P A;  1YBY A;  3JC6 6;  1Y1W G;  4A3I G;  1IL2 A;  1K9M C;  4DR7 L;  3KDF A;  2ZM6 L;  4IFD G;  4DR3 L;  2NN6 I;  3OW2 A;  3HOZ G;  1JT8 A;  2ID0 A;  4BBR H;  4LF5 L;  1O7I A;  3OTO Q;  2NVT H;  3PO2 H;  3J7Z C;  4A75 A;  2YYZ A;  2Q2U A;  4JBK A;  3PO3 G;  4X62 L;  4NB3 A;  4GS3 A;  1CSP A;  3K81 C;  4YHH Q;  3HOV H;  2B63 H;  4BY1 H;  1QUQ A;  3F8T A;  1T9H A;  4UPA A;  3GTK H;  1BBW A;  2IY5 B;  1JMC A;  4DPG A;  2Q2H A;  1HR0 L;  1HZC A;  2JEB I;  2N8N A;  1PH5 A;  1I5F A;  2PQA B;  4LF9 L;  3H3V I;  3TS2 A;  2PMZ E;  1OXT A;  4IPG A;  1IYJ B;  2RF4 A;  4AYB E;  4DR2 L;  2UU9 L;  2JEA I;  5IY0 A;  1OXS C;  3U50 C;  4LW1 A;  2UUA Q;  1K8G A;  1L1O A;  1LTL A;  3GTO H;  4A3G H;  3UDF A;  1EWI A;  4LUO A;  3OTO L;  3S1R H;  1X65 A;  3CC4 A;  1I6H H;  2DGY A;  2CCZ A;  3CF5 A;  4AYB G;  4DV3 Q;  1HZ9 A;  2GVB A;  4YHH L;  4C2M H;  3PCO B;  2JA9 A;  1Q82 C;  3I4M G;  4A3L G;  4PG3 A;  4XIG S;  3CPW A;  1IBK Q;  4IO9 A;  3UDI A;  3T1Y Q;  2VY3 A;  1VQH A;  1Q7Y C;  1V9P A;  2OWO A;  1NBW A;  4JYA Q;  2VUM G;  1XTD A;  1OTC A;  4YCV A;  3T1H Q;  1BVS A;  4JI0 Q;  3VDY A;  2OCE A;  5ELO A;  3F1Z A;  4IPD A;  2YU9 H;  4DV1 Q;  4POF A;  4DV3 L;  2B3G A;  3S17 H;  4A3D H;  4KHP Q;  2VS1 A;  2FXQ A;  4QQB X;  4JI7 Q;  1TXY A;  5IYC G;  1UE5 A;  2JA5 G;  3I2Z A;  4B3M Q;  4RMF A;  1VQE A;  2R92 H;  2Z6K A;  1IBL Q;  1D8L A;  2YV5 A;  1VQO A;  2Q2T A;  3S1M H;  1VQ7 A;  1VCI A;  2XTI A;  1ASY A;  1X9N A;  3M4Q A;  4HJ7 A;  1OXU A;  1Y1V G;  5IWA Q;  3CCV A;  1PH1 A;  3GTP H;  4X66 L;  4JYA L;  3L0O A;  4OXP A;  4DV0 Q;  3K80 C;  3T1H L;  4JI0 L;  5M3F H;  2I5H A;  3GTL H;  4A4I A;  1KAW A;  5M3M H;  3KJP A;  3I4N H;  3CCU A;  4A3M H;  5JEA J;  4DV1 L;  4HJ8 A;  4A3K G;  2OQK A;  1VQK A;  3M7N A;  4A3C G;  3GTM H;  2HQL A;  3UE1 A;  2IX0 A;  4L5Q A;  2B29 A;  1VQ8 A;  4B3M L;  4LUV A;  2UUC Q;  1JJG A;  1IBL L;  1PFS A;  1G51 A;  1NY4 A;  2QGQ A;  1N9W A;  3HOU G;  1NMG A;  4KLK A;  5IP9 G;  2R93 G;  2UUB Q;  1TWA H;  4A93 H;  3K7U C;  5IWA L;  5FLX c;  3J80 i;  5IYD G;  1IBM Q;  1N32 Q;  4DV0 L;  2JQO A;  4IFD J;  2K75 A;  3PF5 A;  1NE3 A;  1HH2 P;  5GAE C;  1HZA A;  3S24 A;  1PH4 A;  3CCE A;  1UEB A;  5EAY A;  1A62 A;  2OTJ A;  1E24 A;  1Q8K A;  3PIP A;  5C44 G;  2UUC L;  5H1S E;  1XNR Q;  4GOP A;  1K73 C;  4AH6 A;  4BA1 I;  1EIY B;  3HKZ E;  2N3S A;  1B8A A;  4X65 L;  4WJ4 A;  5FJ8 H;  1X3E A;  1SMX A;  2YTX A;  3RLN A;  2HT1 A;  4GLV B;  1XMO Q;  1IBM L;  2YTY A;  4B3R Q;  2MQH A;  2JA6 G;  4XTC S;  4LF6 Q;  2CFM A;  5DLQ E;  1GM5 A;  2K5N A;  3PUZ A;  1VQD A;  4KHZ A;  4AQY Q;  1N34 L;  2UXB Q;  3CCL A;  2ZTD A;  1KRS A;  1XPR A;  1L1O C;  3RZO H;  4DR6 L;  5K36 G;  4Y7N H;  3FKI H;  4OWX B;  1XNR L;  3J7A 5;  1BBU A;  4DK6 C;  4JV5 Q;  3DM3 A;  2WAQ E;  3E9I A;  1KRT A;  3H3V H;  2LXJ A;  3S1N H;  2IHF A;  1W3S A;  3HOY H;  3CD6 A;  1XMO L;  4A3J G;  3FP9 A;  2N49 A;  4DR5 Q;  2JK8 A;  1YEZ A;  2OQ0 A;  3H0G H;  2K4K A;  2MO1 A;  2Z0S A;  4LF6 L;  4HIK A;  4KI0 A;  3H15 A;  5LMU Q;  5FLM H;  2ES2 A;  4BBR G;  2WAQ G;  3HKS A;  1IXR A;  1Q12 A;  2PNH A;  4DNI A;  1VQN A;  1FJG Q;  1XPU A;  4O0A A;  1VQA A;  3CQZ H;  4AQY L;  4BXX H;  1YHA A;  1VS0 A;  3AFP A;  3HOW H;  3AFQ A;  2UXB L;  5C4X H;  4B3T Q;  3HOV G;  2B63 G;  3Q8D A;  4BY1 G;  1FGU A;  2OTL A;  5HGQ A;  1XJV A;  1WCM H;  2F3I A;  4R4I A;  1YJW A;  5C3E H;  1VQM A;  1QVC A;  4JBJ A;  1PHJ A;  3L7Z C;  4R4C A;  4JV5 L;  1SN8 A;  2CWP A;  2EXD A;  2BH8 A;  2VQF Q;  2RHS B;  3M4O H;  2LSS A;  1S72 A;  4GKK Q;  2H5X A;  2VL6 A;  2Z6K C;  3WWV A;  5C0X G;  4DR5 L;  3G71 A;  2NZH A;  4PZ7 A;  4UP9 A;  3KJO A;  3PSI A;  1KC8 C;  4A3G G;  1HNW Q;  4QY7 A;  2VQE Q;  5LMU L;  2WFW A;  1XPO A;  3RN5 A;  4R4Q A;  5E7N A;  3EIV A;  1FJG L;  1WI5 A;  1P16 A;  4GN5 A;  4B3T L;  1B7Y B;  1CKN B;  4HIM A;  1K3R A;  2BA1 A;  3ERS X;  4X6A H;  2C35 B;  3HOX H;  3SGI A;  4YCW A;  3KDF B;  2IHE A;  1B70 B;  2NZO A;  3U4Z A;  4EX5 A;  2E2J H;  1YHB A;  1Q46 A;  4P71 A;  2AWO A;  2MNA A;  4B3S Q;  4DR4 Q;  4YY3 Q;  3PUX A;  1EUJ A;  4L5T A;  2VQF L;  1N36 Q;  4DV6 Q;  4GKK L;  1D7Q A;  3CP0 A;  1EQQ A;  1XNQ Q;  4BY7 H;  4OWW B;  4GNX B;  1XNQ L;  1HNW L;  1UE6 A;  3PUV A;  1QUQ B;  3PO2 G; 
#chains in the Genus database with same CATH topology
 4DV7 Q;  1N33 Q;  1TS2 A;  1TWG B;  3IAY A;  1U4R A;  3PGZ A;  1DOM A;  1VQI A;  4QJF A;  3GO5 A;  3T4A C;  2NVY H;  3D0F A;  4I65 A;  4GLX A;  1X32 A;  4RGO S;  2QIL A;  2XRS D;  3ONA B;  1PYB A;  1N36 L;  4IPC A;  4YCU A;  5M3F G;  2CKZ B;  2F0U A;  4K14 A;  1EOT A;  1JCK B;  4P75 A;  5D3D A;  5GRO A;  5LMN W;  2HCC A;  2KCC A;  1AW7 A;  4FDB A;  4DUZ Q;  1ML0 D;  4A76 A;  1X54 A;  4C3I B;  4FVM A;  2HIX A;  4PZ6 A;  2F0P A;  3A8K E;  2GA4 B;  1X3G A;  2AWN A;  1DM0 B;  3N6R A;  2L4N A;  3J80 L;  3UDX A;  1VQP A;  4J8Q A;  1HHV A;  1SEB D;  2VUM B;  2B2U C;  4A93 G;  3GDE A;  1N8R C;  1JOO A;  5KGU A;  3JAM L;  5AFW A;  2JA5 B;  1HQM C;  4HIO A;  1YI2 A;  1LM0 A;  5KND A;  1VF7 A;  1YIT A;  4GN4 B;  1G29 1;  1S3O A;  3OHX C;  3I56 A;  1J5E Q;  5IT9 c;  2EY1 A;  5FJ8 G;  4NXN Q;  1WD0 A;  2JA8 H;  3DM1 A;  5L37 A;  2E2I H;  1XMQ Q;  4NXM L;  1N32 L;  3SDZ A;  3NBI A;  3PIO 3;  3IRB A;  3HKZ G;  4PMB A;  2MFI A;  1DJR D;  4XT3 B;  3K5N A;  4DV2 L;  1RIP A;  3OOC A;  2UXD Q;  3ZYY X;  3K0X A;  3S2H H;  4QL5 A;  1KNE A;  3NP8 A;  4BS9 A;  4B3R L;  3VR2 A;  4GOP B;  2ZJR A;  1KD1 C;  1LTA D;  1X6O A;  1SXT A;  3KOJ A;  4NW2 A;  2EJF C;  1BKB A;  3V05 A;  5LHY 1;  1ASZ A;  4LF4 Q;  5IIF A;  4X62 Q;  4KV6 A;  5M5X B;  4NKL A;  5FO8 B;  3I55 A;  1GOZ A;  1NR4 A;  1CKM A;  1CKO A;  1I3Q B;  4JBW A;  2LS0 1;  5DAU A;  4R8I A;  2FMM A;  4IOC A;  3SEB A;  4NPS A;  3I4L A;  2BDO A;  1Y8N B;  2Q8I B;  2UU9 Q;  2KQ3 A;  1K8A C;  1O80 A;  1Y1W H;  1VQ5 A;  3CHB D;  5J1Z A;  2X69 A;  4A3I H;  3KLR A;  1OXV A;  1C0A A;  1KLU D;  3CU7 A;  4U68 A;  1T5E A;  5LL6 X;  3M4P A;  3RUZ A;  4TSS A;  3TS0 A;  1PZI D;  3FEW X;  3PO2 B;  1ZXT A;  1BCP C;  2ZJP A;  3S15 H;  1ENA A;  3EBE A;  2NBF A;  2NVX H;  1CZW A;  2A6E D;  4XQQ A;  2VQE L;  4DR1 L;  3NUC A;  5ELE A;  4KKS A;  1GKH A;  2HCI A;  1Q81 C;  1O78 A;  1HA6 A;  3GTJ H;  4J15 A;  4FNF A;  3GTO B;  4A3G B;  1TWH H;  2ZTE A;  1V1P B;  4K0K Q;  3S1R B;  2EYL A;  1LLR D;  4H02 A;  3I4M H;  2MP1 A;  3RLF A;  4ZAI A;  1SLJ A;  2ZT9 C;  3NEL A;  4A3E G;  4X66 Q;  4FXG C;  1K83 H;  3W1B A;  3NSW A;  1CTM A;  3TP7 A;  2NUC A;  3UE0 A;  3OW7 A;  1M1K C;  1QVG A;  3TP5 A;  1AH9 A;  3CCS A;  2EIF A;  3LX0 A;  5LMN L;  1YJ9 A;  2YU9 B;  2NYZ D;  1VQJ A;  4K8I A;  1HTP A;  5AJ3 L;  2IX1 A;  3S17 B;  1PYS B;  5IYC H;  2KBN A;  2KHS A;  1Z47 A;  3GV3 A;  4LF7 Q;  3ULJ A;  2F4V L;  4IUP A;  3TRZ A;  4LUZ A;  4JI4 L;  4EQ5 A;  3S1M B;  3VA5 A;  3E3X A;  4L5R C;  1HNX Q;  1F77 A;  1MJE A;  1OO9 B;  4DUY Q;  2WB1 G;  5M3F B;  4QCL A;  4JOI C;  2ASB A;  1PFM A;  4LFA L;  4HN7 A;  4DV5 L;  4A3K H;  3S14 H;  2D2C C;  4TRD A;  2G5D A;  2G9D A;  2N88 A;  4HCS A;  2ZXO A;  4RGM A;  4P72 A;  4JI5 L;  5IP9 H;  2HDM A;  2CHB D;  4A93 B;  4POG A;  5IYD H;  5ELB A;  4CBV A;  2F52 A;  1SRU A;  1QZH A;  2VZA A;  3EQL C;  4DR6 Q;  4ILW A;  2JJQ A;  4UP8 A;  1RCV D;  4DAY B;  1SMY C;  3CCM A;  1JOR A;  1HXY D;  2EZV A;  4Y52 H;  1VQG A;  1PH3 A;  3LWE A;  3HZX A;  5E3F A;  2F1M A;  1E2W A;  1H9K A;  3SVM A;  1R9T H;  4U67 3;  1RL2 A;  2FJ2 A;  2C9O A;  1EYG A;  2E8G A;  1U4P A;  2HUG A;  1SYE A;  2JA7 G;  2KVM A;  1VQ4 A;  4XDX A;  1PH9 A;  1V43 A;  1A63 A;  4R1J A;  3HKZ B;  3BU2 A;  2Q8T A;  1HR0 Q;  1QZG A;  4C3H G;  2ZXP A;  3FPU B;  1LTT D;  5BN4 A;  1YBY A;  2O2L D;  4N8F A;  1LTR D;  4DR7 L;  3KDF A;  1BBX C;  3HP3 A;  2DNC A;  4LF5 L;  2NVT H;  4IUV A;  2B2T C;  3J7Z C;  4A75 A;  1XX8 A;  2YYZ A;  3PO3 G;  4GS3 A;  3HOV H;  1K8O A;  1T9H A;  2G9H D;  3CRK C;  1JMC A;  2Q2H A;  1MHW C;  4KJN A;  5IGF A;  2N8N A;  1U4L A;  5E4X A;  2DNE A;  3BDO A;  4LF9 L;  2Z4I A;  3TS2 A;  4AYB E;  2RF4 A;  4DR2 L;  2JEA I;  2A74 C;  3S9W A;  4N8X 1;  2A5H A;  1W6K A;  1EWI A;  4KTA A;  4CKB A;  4NP5 A;  3OTO L;  3CC4 A;  2L9H A;  2CCZ A;  1NUC A;  4DV3 Q;  4YHH L;  2EYF A;  4HMJ A;  4C2M H;  1H9J A;  2LKV A;  2Q8R E;  1H9M A;  1F9Q A;  3Q22 A;  4IO9 A;  1HA5 A;  1STE A;  2F0Q A;  3UDI A;  1C8C A;  5C6A A;  2F0L A;  1JOQ A;  1V9P A;  2RDG A;  4LAA A;  4PQX A;  1CA6 A;  1EY8 A;  3A56 A;  4C56 C;  1KAA A;  5D3I B;  3F1Z A;  4XYQ A;  2B3G A;  2ICE C;  1HFN A;  1PMR A;  2FXQ A;  3ND9 A;  3A7A B;  3I2Z A;  4RMF A;  2E76 C;  2Z6K A;  1D8L A;  3P7J A;  1VQO A;  2Q2T A;  1Y8O B;  1I4R A;  3VR3 A;  4HJ7 A;  1Y1V G;  1PH1 A;  4HSP A;  1QNK A;  2OT2 A;  1II3 A;  3L0O A;  4BWG B;  2CH4 A;  5CBA E;  4A4I A;  3TSS A;  5DNF A;  3FPP A;  2OQK A;  1LT3 D;  2HQL A;  3UE1 A;  1BDO A;  1TWF B;  4A3E B;  2A69 C;  2EYJ A;  4B3M L;  4LUV A;  3AB9 A;  1IBL L;  2XIW A;  1NY4 A;  1PDQ A;  1K8M A;  2R93 G;  1LT6 D;  4ZUI A;  1FGB D;  2PW7 A;  5FLX c;  4DAV A;  1G8Z D;  2K7V A;  1N32 Q;  1IBM Q;  4DV0 L;  2JQO A;  3Q6S A;  4IFD J;  2K75 A;  4KHV A;  3CCE A;  1PH4 A;  2RDH A;  5EAY A;  1A62 A;  1C48 A;  2E2D C;  3S2D B;  3J7A F;  2UUC L;  2VXW A;  1LTS D;  3SK5 A;  1XNR Q;  4BA1 I;  1G2S A;  3HKZ E;  3FVQ A;  1F2M A;  2N3S A;  4L6T B;  2KA7 A;  4WJ4 A;  3VR5 A;  3QWN A;  4O42 A;  4B3R Q;  1GUW A;  2JA6 G;  4LF6 Q;  2CFM A;  1DD2 A;  2L11 A;  2NN6 H;  3SK6 A;  2PYK A;  2XSC A;  1N34 L;  2B2U A;  4HMI A;  1E0B A;  3RZO H;  2H1E A;  4RGT A;  4KJO A;  3FKI H;  1QIL A;  1L0X B;  3BDL A;  3HS0 C;  1BBU A;  4DK6 C;  1CQF A;  2EDG A;  3DM3 A;  3E9I A;  1B4O A;  3RD4 A;  1KDA A;  5C4H A;  5JPN C;  3H3V H;  3ITP A;  1XMO L;  2KED A;  3H0G H;  4IUR A;  2F0S A;  2Z0S A;  1WTH A;  4BBR G;  1VQN A;  1Q12 A;  2PNH A;  4CDC C;  1SE4 A;  4O0A A;  4AQY L;  1LTB D;  1MBY A;  1ZEQ X;  4IUT A;  4X3S A;  2C5C A;  3C3L A;  1FGU A;  1ICF B;  1SE2 A;  4FXK C;  1GUG A;  1NR2 A;  1STG A;  5M9O A;  2RHS B;  4OO1 H;  1TU2 B;  3WWV A;  1XNQ Q;  1STA A;  2NZH A;  1FYC A;  4PZ7 A;  2KCN A;  3VR6 A;  2JA7 B;  4JK1 C;  2VQE Q;  5CBE E;  2WFW A;  5E7N A;  3EIV A;  1FJG L;  1S5B D;  1P16 A;  1NCV A;  1PLF A;  1K3R A;  1SND A;  1ZYR D;  4C3H B;  4ZKB B;  4YCW A;  4EX5 A;  2E2J H;  3U4Z A;  1QNU A;  1EEF D;  1JWM D;  4YY3 Q;  1EQQ A;  4OWW B;  1HNW L;  1F2Y A;  4ZUJ A;  1QUQ B;  1QB5 D;  3PO3 B;  1EY5 A;  2OF1 A;  3AYH B;  4ABN A;  4WOR A;  1S5E D;  1ILP A;  3J81 c;  1P8L A;  3DUZ A;  2R92 G;  1JE4 A;  1L0W A;  1Q3L A;  5LMN Q;  3A5Z B;  4IFD I;  4MTK A;  4F88 A;  1IBK L;  4JPB W;  5CV4 A;  5C4J B;  4B08 A;  4GOP C;  3NTK A;  5I9P A;  1G6P A;  4XQJ A;  5GAH C;  3RN2 A;  5IYB H;  5G3L D;  5G3L F;  4IN3 A;  4OIK A;  3TP6 A;  1SNM A;  3CAM A;  3BZC A;  3MXN A;  3ERO A;  4CHT B;  2PZT A;  1HRJ A;  1HNZ L;  4TQU S;  4LFB L;  2UXC L;  3ULL A;  4MZ9 A;  4A3F H;  4S3S A;  1SFO H;  4K5V A;  3W1G A;  3WOF A;  4DXF A;  4JVZ A;  3CPF A;  1TWC B;  4DK3 C;  4PV1 C;  1WYD A;  1SAP A;  3VYS A;  2BE5 C;  1PH6 A;  1GJX A;  1MIU A;  3BDC A;  1VMP A;  1WTQ A;  1IL8 A;  1KXL A;  1STN A;  2XGT A;  3SHL A;  5C0X J;  2F3V A;  1CHQ D;  3GQB A;  2B39 A;  3TEH B;  1TKW B;  1PH8 A;  1E1T A;  1E1O A;  1UE1 A;  4P74 A;  1SNC A;  1TS3 A;  4GKJ L;  3DEP A;  5M5W H;  4DGZ A;  4ZK9 B;  2R93 B;  2H4O A;  1OXX K;  1EEI D;  3AQQ A;  2K03 A;  3A8I E;  4IAL A;  2CWA A;  3BYT B;  3HOY G;  4OX9 L;  4RG1 A;  4BBS H;  2E2H H;  1Q86 C;  5FLM G;  1BR9 A;  4BXX G;  2F0G A;  3QOJ A;  1G6Z A;  3BZK A;  1CSQ A;  5C4X G;  1X3F A;  4DR7 Q;  4JOI A;  1WCM G;  1LV9 A;  5C3E G;  4LF5 Q;  4IJH A;  2TMP A;  2J4X A;  2JA6 B;  2HHH L;  3UI2 A;  3M9B A;  2A6H D;  2F0D A;  2LXK A;  5JEA H;  4DK0 A;  2Z8L A;  1M8A A;  4CJ0 B;  1HTL D;  4WJW A;  1F2Z A;  4RWS C;  3SXH A;  4I7A A;  3IFD A;  5BR8 Q;  4DR2 Q;  3A0J A;  3I4O A;  1A2T A;  5HGT A;  1RDP D;  2RSN A;  5IGC A;  3HOX G;  1A2U A;  2DUD A;  1FVI A;  3D8G A;  3ICE A;  3HOZ H;  3LWU A;  3KUP A;  3KLS X;  4BBR B;  5CV7 A;  1NTG A;  4OL7 A;  1QG7 A;  3NWT A;  2RCN A;  2PNR C;  2AHO B;  1JIC A;  5IE8 A;  2F3W A;  4DV4 L;  3GTK B;  3K59 A;  1CM9 A;  3BZD B;  3CCJ A;  2SEB D;  3I8Z A;  2O4X A;  3RMH A;  2WV6 D;  4PMW A;  2AQ1 B;  1KL9 A;  5J22 A;  2N55 A;  4OON A;  1I4Q A;  1SE8 A;  1D5X C;  2Y0S G;  4LF8 Q;  1KHI A;  3RLO A;  2AKW B;  1LYL A;  2MJ8 A;  4DA2 A;  1CK1 A;  4X64 L;  1EWH A;  4JI6 L;  1TY0 A;  3E9H A;  3H09 A;  4FYD A;  2PMZ B;  2F0O A;  4OEM B;  4R4O A;  1Q8I A;  4JI2 L;  1Z9F A;  4DKA C;  2KHJ A;  2B2T A;  1BOS A;  2E5L L;  5JVH 3;  5C0X I;  4EGV A;  3Q24 A;  2IJ0 A;  4RCO A;  1IZ6 A;  2IPK D;  1E7Z A;  4JI1 L;  1FNV A;  2PZU A;  3BG3 A;  5CYU A;  1EQR A;  1PTO H;  2NWG A;  1EY6 A;  3VYR A;  5ELC A;  3STB D;  2WKD A;  3GTQ H;  1K0R A;  1AEX A;  2Z4H A;  4JBM A;  2R92 B;  5FLX L;  4HJ5 A;  1RHP A;  1VQC A;  4TKO B;  2CW0 D;  5HY6 A;  1PVO A;  1PRT D;  4V0B A;  1X55 A;  3E0E A;  3AEV A;  5DEH A;  1PV4 A;  5ELF A;  3K0Y A;  1ET9 A;  2JA8 G;  1F9S A;  4K6D A;  2F0J A;  1YNJ D;  4MNO A;  3PUW A;  3KF8 B;  4QIW B;  1HQR D;  1F9P A;  3E5S A;  3RZD H;  3K7A H;  5CMD A;  1TWA B;  2KUM A;  1J6Q A;  4MN3 A;  1E2Z A;  3HOU B;  1N34 Q;  1SYC A;  4JI8 Q;  3JAM i;  2RVL A;  1U5K A;  4KN7 C;  3GD7 A;  1U0L A;  4LFC L;  4GNX C;  3M4Y A;  3NWS A;  2JN4 A;  5C44 H;  1GO3 E;  2EY6 A;  3K8A A;  5KYI A;  3J7Y W;  4KY6 A;  2FMC A;  3CW2 C;  3L9A X;  3KFU A;  3S16 H;  4JI3 L;  1U4M A;  4ME3 A;  3G4S A;  2K04 A;  2F0V A;  4YWM A;  1YVC A;  1EU4 A;  2IT1 A;  4X3T A;  4EQP A;  3WOE A;  1C9O A;  3BJU A;  1UWV A;  1HZB A;  1JR0 D;  3U9O A;  5K36 H;  1STY A;  3SK8 A;  4Y7N B;  1BNZ A;  2A68 C;  4FF3 A;  3JC6 6;  1Y1W G;  4A3I G;  1EY9 A;  2LFN A;  1WTV A;  3HOY B;  2PZW A;  1EYC A;  1EL0 A;  4DR3 L;  3OW2 A;  1UUP A;  2Q2U A;  4H44 C;  2FHT A;  3NHH A;  4Q5V A;  2K5D A;  4BY1 H;  2B63 H;  4QMG A;  5C4X B;  2RKS A;  4DPG A;  1HZC A;  1EY4 A;  1WCM B;  1PH5 A;  5C3E B;  1ONL A;  4P2C B;  2PQA B;  2EE1 A;  2PMZ E;  2QW7 A;  3CRL C;  2OEO A;  3A55 A;  1OXS C;  3D3R A;  2RSO A;  1K8G A;  4F8M A;  3UDF A;  1I4G A;  4CKE A;  3P75 A;  4LUO A;  1X65 A;  1I6H H;  2DGY A;  4RA8 A;  3J81 L;  2X6L A;  4N9P A;  1HZ9 A;  3PCO B;  3I4M G;  1Q82 C;  3E0J A;  1IBK Q;  5EKL A;  3HOX B;  4XT1 B;  1Q7Y C;  2QKI C;  2OWO A;  2KEE A;  5A35 A;  1B50 A;  3K6O A;  4JYA Q;  4YCV A;  4OGQ C;  2FIN B;  2OCE A;  2DN8 A;  5EBD A;  4A3D H;  2VS1 A;  4QQB X;  5KRU A;  5IYC G;  4RGN A;  3DWQ A;  2NVY B;  3SE0 A;  2EYO A;  1XXG A;  1ASY A;  3GTP H;  3CCV A;  2EJG C;  3OPO A;  3T1H L;  4DAP A;  4JI0 L;  5ISR A;  2Y0S B;  3GTL H;  3F2U A;  2K01 A;  3I4N H;  5M3M H;  1B9M A;  3C1E A;  4A3M H;  4DV1 L;  1G2T A;  4A3K G;  3GTM H;  2PQE A;  3AU7 A;  1VQ8 A;  1JJG A;  4ZKC B;  1NMG A;  4KLK A;  5IP9 G;  3K7U C;  5IWA L;  1TS4 A;  1TY2 A;  5D14 A;  1LAB A;  5IYD G;  1LO5 D;  1SBB B;  4ULL A;  1NE3 A;  1DXM A;  1HH2 P;  4FF4 A;  2QDB A;  5GAE C;  1PZK D;  2B8G A;  3S24 A;  1UEB A;  2OTJ A;  1YNJ C;  3IFT A;  3K57 A;  5A2Q L;  5EBC A;  5C5M A;  2EVB A;  3BVG A;  5KYL A;  4GOP A;  4AH6 A;  2M00 A;  1SMX A;  4GLV B;  4RAU C;  1Z6H A;  4XTC S;  2JA8 B;  5DLQ E;  1BO0 A;  2E2I B;  5IOC A;  3J80 E;  3NQI A;  2ZTD A;  5IGG A;  4KKU A;  3H94 A;  4EQN A;  3MWY W;  1LTI D;  5CV8 A;  4JV5 Q;  1KRT A;  2LXJ A;  1EFI D;  3EVQ A;  3JAM E;  1EZ8 A;  3D4D A;  4A3J G;  2N49 A;  4DR5 Q;  3S2H B;  2JK8 A;  1YEZ A;  2OQ0 A;  2K4K A;  1I4X A;  2KOL A;  2MHV A;  5LMU Q;  1WTW A;  3S1N B;  2XVS A;  2WAQ G;  2B8F A;  1CI3 M;  4H7B A;  4DNI A;  1VQA A;  3CQZ H;  1YHA A;  2UXB L;  4IUU A;  3HOW H;  2Z9H A;  3HOV G;  2F0T A;  4B3T Q;  1QWY A;  1YJW A;  2OXP A;  1JQY D;  1VQM A;  4KY5 A;  4JBJ A;  1ESF A;  3L7Z C;  2EXD A;  3PQI A;  2VQF Q;  3M4O H;  3NTI A;  2LSS A;  5C3W A;  1S72 A;  4GKK Q;  3T56 B;  4RFB A;  3SK4 A;  1KC8 C;  4XQN A;  1UEA B;  2O5J C;  1XPO A;  3U9S A;  4R4Q A;  1LTG D;  4HED A;  4EVO A;  5C3X A;  1S5F D;  1V1P A;  1YNN D;  1NSN S;  2BA1 A;  5KIX A;  3ERS X;  2JXM B;  1FNU A;  2C35 B;  5I6W A;  1Y1W B;  2IHE A;  2NZO A;  5I9O A;  2JYO A;  1Q46 A;  3KBG A;  4P71 A;  4A3I B;  2A6E C;  3GV6 A;  1N36 Q;  3CP0 A;  4BY7 H;  5CV9 A;  4GNX B;  2MPM A;  5FO7 B;  4NDX A;  1UE6 A;  4GZY C;  1D1K A;  3O13 A;  3KF6 B;  2D9U A;  3S15 B;  2B2V C;  3D4R A;  2NVX B;  3QIA A;  1IKL A;  4OIJ A;  4JI1 Q;  1SYB A;  2V4D A;  2K33 A;  1L1O B;  4B3S L;  4DR4 L;  3OWE B;  3OSO A;  1JB7 A;  5FOB B;  3GTJ B;  4R4T A;  2M2L A;  1Q90 A;  4DAM A;  2ATW A;  3D31 A;  1TWH B;  5TSS A;  3M3Y H;  1S4Z A;  4DV7 L;  5FO9 B;  1EIF A;  4ZQ3 A;  5IGB A;  1N33 L;  5T1G A;  5BN5 A;  3I4M B;  5FKA C;  5JJL A;  4H13 C;  2O5I C;  1K83 B;  1AZP A;  3NBH B;  4KHP L;  1PH2 A;  1XYI A;  1B44 D;  2I5M X;  2MO0 A;  2RA4 A;  5IT9 L;  2NTT A;  3ER0 A;  2PPB C;  5JJI A;  4AIM A;  2PW5 A;  3OYY A;  3S1Q H;  4NXM Q;  4C1N I;  3OWF A;  2FFK B;  3HG9 A;  2EYP A;  1EWC A;  4HID A;  2F0N A;  3FRP B;  3NEN A;  4DAY A;  3G6J B;  3J81 E;  4DV2 Q;  3QB3 A;  4G4K A;  2BA0 A;  1NJI C;  2R61 A;  1FL0 A;  2RQX A;  4DFA A;  1SJE D;  3W5O A;  4PNY A;  1YZ6 A;  4G7O C;  2AMC B;  2WB1 B;  4A3K B;  3C2P A;  3S14 B;  2NN6 G;  5M5Y H;  1AE3 A;  1C7Y A;  1WD1 A;  2EJM A;  2EOT A;  4HSV A;  3TQY A;  1I50 H;  5IP7 H;  3FKI G;  1TS5 A;  2NVQ H;  1ENF A;  2D62 A;  1GHJ A;  1RF2 D;  4NXN L;  3ZJY C;  3H0G G;  3I73 A;  3PUY A;  1AE2 A;  3KLW A;  1NAP A;  3W3A A;  1XMQ L;  4CJ1 B;  3TME A;  1I4P A;  2QF7 A;  2RBM A;  1IW7 D;  2R7Z H;  1SYF A;  1AN8 A;  3GTG H;  4CDD C;  4A3B H;  3MEH A;  2KCT A;  1KAB A;  1PA6 A;  1JWU D;  1XWE A;  1R9T B;  4OO1 G;  4C3J H;  1E22 A;  5E4W C;  3RNU A;  1MKH A;  3NPP A;  1KIX A;  1BF4 A;  1CA5 A;  1YNX A;  3DLL A;  4DR1 Q;  1PRT B;  1PTO D;  4QUF A;  1HR0 W;  2R6G A;  3A54 A;  5FK9 C;  1QJO A;  1Q1B A;  5A2Q E;  2PO4 A;  4LF4 L;  3PV0 A;  4A3J B;  4IFD H;  1A3U A;  4GNX A;  3EJI A;  2JE6 I;  3KLS A;  2QEX A;  2WAQ B;  2NVT B;  1DYQ A;  2I5L X;  1IHZ A;  4JCV E;  2QA4 A;  3KF6 A;  1TWG H;  1STB A;  4OHJ A;  4EQO A;  1H95 A;  1YHQ A;  3RR5 A;  3K5O A;  1W2B A;  3J81 j;  1DCZ A;  5I4D A;  3U4V A;  3URY A;  1Q1E A;  4QGU A;  2ZJQ A;  1GD7 A;  3OMC A;  5AJ3 Q;  3CMA A;  2HD3 A;  2GN5 A;  1JB3 A;  5JVG 3;  4A3L H;  2EXZ A;  3IL8 A;  3MFG A;  4C3I H;  4YWK A;  4C2M B;  4OO1 I;  5IYB G;  1MJC A;  2F4V Q;  4JI4 Q;  4X3K A;  3T51 B;  4OWT B;  3BVZ A;  3F2D A;  2VUM H;  3TZD A;  1V1Q A;  2RCF A;  2KJX A;  3MHB A;  1KLG D;  5CV5 A;  4LFA Q;  4DV5 Q;  4A3F G;  4ALP A;  4K0K L;  3K5L A;  1M90 C;  3OMG A;  1EY0 A;  4F7X A;  4G7Z C;  2JA5 H;  2L15 A;  4JI5 Q;  2WB1 E;  3ULP A;  5J39 A;  1AFP A;  4UY8 C;  3PIO A;  1KQS A;  4PMC A;  3A74 A;  2ENB A;  1PH7 A;  1QCB D;  1Y1V B;  4L5S A;  1WJJ A;  2F0W A;  2D0P A;  1VQB A;  1SYG A;  1I94 L;  4A3C H;  3NTH A;  5JJK A;  3DWP A;  1A0I A;  3CC7 A;  1JJC B;  1KDC A;  2VW9 A;  3PF4 A;  2VB3 X;  4LF7 L;  3HOU H;  2K50 A;  1IKM A;  5IGE A;  4NMZ A;  1KNA A;  5ELD A;  5LL6 S;  1EYD A;  1PFN A;  2A1A A;  2L55 A;  5JOB A;  3BVM A;  1B53 A;  4DUY L;  1DGS A;  2VNU D;  2K52 A;  4ME5 A;  2P5Z X;  3G48 A;  4BBS G;  4UAI A;  3NE5 B;  1J9O A;  1CFM A;  4CDE C;  3QJY A;  1Z7T A;  3CXC A;  5JJZ A;  3LNN A;  3NK9 A;  1RKN A;  4HJ9 A;  4APV A;  5M5X H;  1I3Q H;  4LK1 C;  2K5V A;  5JEA G;  5IT9 E;  4TVA B;  3F2B A;  3HGB A;  4QF4 A;  3RZO B;  1EIG A;  1O7Y A;  3W2D A;  1ZKO A;  3FKI B;  4LF9 Q;  1E3P A;  4KY7 A;  4UDU C;  3D6C A;  1K9M C;  3CKI B;  2ZM6 L;  3H0G B;  3HOZ G;  1JT8 A;  3PO2 H;  1O7I A;  3OTO Q;  2A73 B;  3TZU A;  4NB3 A;  4E6I A;  1CSP A;  3K81 C;  4YHH Q;  1QUQ A;  3F8T A;  2HDL A;  2IY5 B;  1KTK A;  1HR0 L;  1WTO A;  3T53 B;  1A3V A;  1BCP D;  1HUM A;  1IYJ B;  4IPG A;  1ZYR C;  2CVR A;  4LW1 A;  5C0X H;  1EYA A;  1LTL A;  3GTO H;  4A3G H;  1BUV T;  3L3O C;  4C1N K;  3S1R H;  1TVX A;  3CF5 A;  4AYB G;  2B2W C;  4ODG A;  2DY7 A;  2ZXR A;  2J7Z A;  5COY A;  4DNT B;  2JA9 A;  1K28 A;  1C4Q A;  4CGY B;  3CPW A;  2D5D A;  4UHV A;  3H91 A;  1B1Z A;  2E2J B;  1IYU A;  1GHK A;  1OTC A;  1O7L A;  5ELO A;  4IPD A;  2SNM A;  2YU9 H;  1ESR A;  4X3U A;  5DM7 3;  2L1B A;  4DV3 L;  3S17 H;  1DON A;  4KHP Q;  3V96 A;  1UE5 A;  4B3M Q;  2BCO A;  1IBL Q;  3HRZ C;  1K3B C;  2YV5 A;  1LAC A;  3S1M H;  1VQ7 A;  4JW0 A;  4ZRZ A;  2XTI A;  2DY8 A;  1X9N A;  3M4Q A;  3MVV A;  1DOK A;  5CC4 A;  4DV0 Q;  5M3F H;  2I5H A;  1GUN A;  3QR8 A;  3CCU A;  4HJ8 A;  1PRT F;  1VQK A;  3M7N A;  2AQ2 B;  1BXT A;  2X6G A;  3DHQ A;  4FP5 D;  2UUC Q;  2L5T A;  1PFS A;  4L63 B;  1N9W A;  4A93 H;  4K2L A;  2WII B;  2B2V A;  3J80 i;  5KEE A;  1GUO A;  4A3F B;  5COR A;  1SFO B;  3X3M A;  1H9S B;  1HZA A;  1X3P A;  1E24 A;  2LMC B;  1SNQ A;  3PIP A;  5C44 G;  4DF7 A;  5H1S E;  5I2X A;  1M4V A;  4CDF C;  4X65 L;  2DJF C;  5FJ8 H;  2YTX A;  1XMO Q;  1IBM L;  1SMY D;  1EY7 A;  3VA7 A;  3P20 A;  1MD2 D;  2I07 B;  2K5N A;  3PUZ A;  3M7G A;  1FNW A;  4KHZ A;  4AQY Q;  1KRS A;  1L1O C;  1ICW A;  5K36 G;  1B9N A;  5M5W B;  1XNR L;  3S1N H;  4HTH A;  1W3S A;  4MIU A;  3CD6 A;  3FP9 A;  2F0F A;  4LF6 L;  4HIK A;  4BBS B;  2E2H B;  3HKS A;  1IXR A;  1XPU A;  1I6V C;  1FJG Q;  1VS0 A;  2F0E A;  3TN2 A;  3VR4 A;  2B63 G;  2A6H C;  4BY1 G;  2SDF A;  2OTL A;  5HGQ A;  1XJV A;  4IQZ A;  1ILQ A;  4R4I A;  3I90 A;  1NNX A;  1PHJ A;  1DOL A;  1SN8 A;  1EIH A;  2BH8 A;  1WTP A;  3N52 A;  2H5X A;  1ET6 A;  4MHE A;  1HNW Q;  4UP9 A;  3KJO A;  3PSI A;  4QY7 A;  4J6H A;  4DXG A;  2Z1C A;  1S5D D;  4J1M A;  3J7A V;  4M1U B;  4V19 0;  1CKN B;  1PZJ D;  4HIM A;  1ENC A;  4X6A H;  4I7Z C;  3SGI A;  5C4Z A;  1AZQ A;  3KDF B;  5K5P A;  2F0K A;  2AWO A;  1MGS A;  2AQ3 B;  3PUX A;  1EUJ A;  4L5T A;  1D7Q A;  3FDT A;  3I91 A;  4K8J A;  3HOZ B;  1XNQ L;  3PUV A;  2WAC A;  2BH2 A;  1STH A;  2UUA L;  2V1C C;  4A3D G;  4JG2 A;  1GUT A;  2WIN B;  2Q2I A;  3A7L A;  5GAD C;  5CR3 A;  1SSO A;  2R7F A;  2K5Q A;  1JE5 A;  2K5W A;  4KMU C;  4YY3 L;  4DNR B;  3I7F A;  1HNZ Q;  4H0L C;  4LFB Q;  2UXC Q;  2EQS A;  3T1Y L;  3A5U A;  2NZ1 D;  1JJ2 A;  4ZCK A;  3J81 i;  4AYB B;  3I4N G;  3EFX D;  5M3M G;  1WFQ A;  4QIW E;  1UAP A;  4HJA A;  4A3M G;  3A8J E;  2XRQ D;  2IWH A;  3CCR A;  4B9W A;  1D1I A;  4P73 A;  1TWF H;  4A3E H;  3QG1 A;  4O2D A;  3STB C;  4JI7 L;  3EN2 A;  3KF8 A;  3UDG A;  1I94 Q;  3MEF A;  1FD7 D;  1F9R A;  4UP7 A;  4M8A A;  4FXD A;  1KDB A;  2A69 D;  2CW0 C;  4WRD A;  3CME A;  1H9S A;  3DXJ C;  2F0I A;  1YJN A;  1PTO B;  1PRT C;  3AMU A;  3C1F A;  2Z6B A;  3D4W A;  1VMC A;  3S2D H;  1HNX L;  5ELN A;  1VQ6 A;  3GTQ B;  4GKJ Q;  2R7D A;  3L2P A;  1D6E C;  4LWC A;  5EPL A;  4OX9 Q;  1QVF A;  4GLA C;  2UUB L;  1G91 A;  3VYU A;  2NTS A;  3FMC A;  3SR1 A;  2TSS A;  1F2L A;  2E74 C;  1NMF A;  3MC0 B;  5E1F A;  1HJP A;  2IW3 A;  2B2Y C;  2EY2 A;  1EQT A;  1SNP A;  3R3O A;  2BOS A;  3U58 A;  2I0Q A;  2YTV A;  3RZD B;  3NEM A;  3K7A B;  2ALY B;  3TBI B;  4FF1 A;  3C46 A;  5EJW A;  2HHH Q;  3I72 A;  3OIP A;  3K58 A;  2F03 A;  3HFZ B;  1LUZ A;  5NUC A;  5FLX E;  4LNQ A;  1UE7 A;  1LT4 D;  3WDN A;  4RKL A;  3DEO A;  3HOW G;  5C44 B;  1WVL A;  2PI2 E;  3PMF A;  4KD4 A;  3KYH C;  3MFY A;  2ZM6 Q;  2LY7 A;  1WOC A;  3B6Y A;  3S16 B;  1X56 A;  1Y14 B;  2QEJ C;  3PIP 3;  4KN4 C;  4RHR A;  2PQA A;  2MGS A;  2JA7 H;  1CUK A;  3MTS A;  2PI2 A;  5CGK A;  1EZ6 A;  3V2T A;  1MSH A;  4WJ3 M;  3T16 A;  4DV4 Q;  1CKN A;  2J0T D;  4RHS A;  4C3H H;  5IOD A;  4QUC A;  4A3J H;  2WP8 J;  1QOH A;  5EQ0 A;  3FHW A;  3R2I A;  4BY7 G;  1L0Y B;  3TRE A;  3GP7 A;  3DWA A;  3PO3 H;  2EYM A;  1HUN A;  4O1N A;  4YWL A;  4X64 Q;  2D0O A;  4JI6 Q;  4R8N A;  2A19 A;  4BY1 B;  2B63 B;  1VDZ A;  1H9R A;  5BR8 L;  3R8B A;  2IX3 A;  1EOV A;  1A6X A;  4JI2 Q;  2Y0S E;  2E5L Q;  3I3C A;  1B3A A;  2K05 A;  2K5H A;  2IL8 A;  4MTN A;  5C4J H;  1BQQ T;  4KKT A;  3K5M A;  1I6H B;  4DV6 L;  2KEC A;  2F4I A;  5EPK A;  5EKK A;  4JC0 A;  5CV6 A;  2CQO A;  3F2C A;  1B2T A;  2KHI A;  1SE3 A;  1SR3 A;  4KD3 A;  1D2B A;  4HR7 B;  4IUN A;  4OEL B;  1LT5 D;  4HCE A;  1J8I A;  3T13 A;  2K14 A;  4LF8 L;  3CCQ A;  1TWC H;  4A3D B;  3CC2 A;  1V1O A;  2HIV A;  3G7L A;  3H3V C;  3MXG A;  5EPJ A;  1S40 A;  4PZ8 A;  4BA2 I;  3BS1 A;  4DUZ L;  3LGJ A;  4L8J A;  1DZ1 A;  2L12 A;  1Y1V H;  4LJZ C;  1VQL A;  5GAG C;  5KNC A;  2B2W A;  3GTP B;  3G6E A;  4IOA A;  1A8V A;  3J80 c;  2EPB A;  3GTL B;  3I4N B;  5M3M B;  1RTN A;  1VQF A;  4A3M B;  2BE5 D;  3GTM B;  3MXN B;  4Z9C B;  3ND8 A;  2RHQ B;  4LFC Q;  2KCM A;  4K5W A;  2QCP X;  1BCP B;  4X65 Q;  4ZYS A;  3JAM c;  2KEN A;  2R93 H;  1TT2 A;  1VQ9 A;  5IP7 G;  2L0C A;  4RH6 A;  4IJL A;  4JI3 Q;  1SRO A;  3BYY B;  1ROD A;  5J3B A;  1J5E L;  1W6J A;  3M85 A;  4G57 A;  2A8V A;  2DJG C;  5JAV A;  3OIQ A;  2ZTC A;  1JWS D;  1FR3 A;  2M9V A;  2R7Z G;  1GVP A;  1MI2 A;  4GN3 B;  1K0S A;  4IPH A;  5EKI A;  4A3B G;  3R93 A;  3NQT A;  3ERQ A;  1L2F A;  2JA6 H;  4ID6 A;  1HFG A;  2EYH A;  4DR3 Q;  2UXD L;  4C3J G;  2GVA A;  4JI8 L;  2PCF B;  4RKB A;  1YIJ A;  1GXD C;  2N78 A;  1CZG A;  5GQO A;  3X3N A;  1R4Q B;  2VB2 X;  1Y8P B;  1E2V A;  2NB0 A;  1WTX A;  1IL2 A;  1CQV A;  1PTO F;  1JOK A;  1U9R A;  4IFD G;  2NN6 I;  2EY5 A;  2ID0 A;  4BBR H;  4JBK A;  4X62 L;  1T5X D;  5I6Y A;  1D5Z C;  3CQZ B;  2AUK A;  1XTC D;  2K6A A;  5D65 A;  3GTK H;  3MZ5 A;  3HOW B;  4UPA A;  1TR5 A;  1BBW A;  5F2D A;  2JEB I;  3H6M A;  1I5F A;  4FO2 A;  4K5X A;  3IKJ A;  3HOV B;  3VYT A;  3H3V I;  1YNN C;  1OXT A;  2UU9 L;  3KBX A;  1UNS A;  5IY0 A;  3U50 C;  3M4O B;  3DMU A;  2E75 C;  2UUA Q;  1L1O A;  4K6L A;  1X3Q A;  1EQV A;  1RJT A;  2GVB A;  5EGT A;  1TII D;  1RTO A;  4A3L G;  4C3I G;  4PG3 A;  4Q0F A;  4XIG S;  1JC7 A;  5BN3 A;  3QO2 A;  2R3Z A;  3EA6 A;  4HAE A;  3T1Y Q;  2VY3 A;  1VQH A;  1SDF A;  5HUR A;  4K2K A;  4F87 A;  3D6W A;  4XYO A;  2SOB A;  2ICI A;  1NBW A;  2VUM G;  1XTD A;  3NBH A;  3T1H Q;  1BVS A;  4JI0 Q;  3VDY A;  4CJ2 C;  4BY7 B;  2HQE A;  3KK7 A;  2K32 A;  4LMQ D;  4DV1 Q;  2MUY A;  4POF A;  1IYV A;  1TQO A;  4JI7 Q;  1TXY A;  2BDN A;  2JA5 G;  1Y69 U;  1VQE A;  2R92 H;  2AUJ D;  1VCI A;  4G7H C;  5IGD A;  1OXU A;  5IWA Q;  4X66 L;  4JYA L;  5JPM C;  2JSO A;  4OXP A;  3K80 C;  3Q0A A;  1AP0 A;  1KAW A;  3KJP A;  3M3Y B;  5JEA J;  1D5M C;  4A3C G;  4QB4 A;  4RCN A;  1EU3 A;  2IX0 A;  4L5Q A;  2B29 A;  4B9X A;  4DN4 M;  3MAQ A;  2QGQ A;  1G51 A;  1R4P B;  3HOU G;  2UUB Q;  1TWA H;  4ZLT F;  2F0H A;  5KNB A;  4KK7 A;  4IUQ A;  4DU9 A;  1PXU A;  3PF5 A;  4DK1 A;  4WFN 3;  3I70 A;  3S1Q B;  3R2T A;  3QOL A;  3Q23 A;  4YIJ A;  1A15 A;  1CHP D;  1Q8K A;  2RDF A;  1MSG A;  4IZ8 A;  1K73 C;  1EIY B;  2K28 A;  2XWJ B;  1B8A A;  2QDL A;  1RD9 D;  1X3E A;  2JP1 A;  3RLN A;  2HT1 A;  2YTY A;  1B3Q A;  2MQH A;  2XWB B;  3TDQ A;  1PFB A;  3TP8 A;  3MXU A;  1GM5 A;  1VQD A;  5M5Y B;  1VF5 C;  1S5C D;  4CKC A;  3CCL A;  2UXB Q;  4FF2 A;  1XPR A;  4DR6 L;  5I2Y A;  4Y7N H;  1CT1 D;  1I50 B;  4OWX B;  3J7A 5;  5DM6 3;  1IW7 C;  1SNO A;  2NVQ B;  2WAQ E;  2IHF A;  2SNS A;  3HOY H;  2MO1 A;  4KI0 A;  1HCZ A;  3MXP A;  5FLM H;  3H15 A;  2ES2 A;  3PO2 G;  2K1B A;  2CH4 W;  1HPC A;  1PYW D;  2A68 D;  4BXX H;  3AFP A;  1O7Z A;  3AFQ A;  1QE6 A;  5C4X H;  2R7Z B;  3Q8D A;  2XN9 C;  1I4H A;  1WCM H;  2F3I A;  5C3E H;  3GTG B;  4A3B B;  1QVC A;  5T1I A;  4R4C A;  4JV5 L;  2CWP A;  1SJH D;  3P1H A;  1WTR A;  2XNA C;  1PTO C;  2VL6 A;  2Z6K C;  4C3J B;  5C0X G;  4DR5 L;  1EFW A;  2B2Y A;  3G71 A;  5C5L A;  4XXE A;  1BCP F;  4A3G G;  5LMU L;  2CQA A;  1GUS A;  2F0M A;  3RN5 A;  3HEJ A;  1SYD A;  1WI5 A;  4GN5 A;  3E6Z X;  4B3T L;  4R9W A;  1B7Y B;  2I46 A;  3HOX H;  1V8Q A;  1B70 B;  3NXW A;  1YHB A;  2MNA A;  4B3S Q;  4DR4 Q;  2VQF L;  4GKK L;  3MA2 B;  4DV6 Q;  1A3T A;  2WKC A;  4N9T A; 
#chains in the Genus database with same CATH homology
 4DV7 Q;  2BH2 A;  1N33 Q;  3KF6 B;  3PGZ A;  2UUA L;  3AYH B;  2V1C C;  4A3D G;  1VQI A;  4JG2 A;  3J81 c;  4QJF A;  3GO5 A;  1P8L A;  2Q2I A;  2NVY H;  5GAD C;  2R92 G;  3D0F A;  1L0W A;  4JI1 Q;  4GLX A;  2R7F A;  5LMN Q;  1JE5 A;  1L1O B;  4B3S L;  3A5Z B;  4DR4 L;  4IFD I;  4YY3 L;  1IBK L;  1PYB A;  3I7F A;  1N36 L;  1HNZ Q;  4LFB Q;  4IPC A;  1JB7 A;  2UXC Q;  4YCU A;  2EQS A;  3T1Y L;  4R4T A;  3A5U A;  1JJ2 A;  3J81 i;  4DAM A;  2ATW A;  3D31 A;  5M3F G;  4GOP C;  2CKZ B;  4P75 A;  3M3Y H;  5GRO A;  5LMN W;  1G6P A;  4DV7 L;  5M3M G;  3I4N G;  1WFQ A;  4QIW E;  4HJA A;  1EIF A;  1N33 L;  4A3M G;  4FDB A;  5GAH C;  3CCR A;  4DUZ Q;  3RN2 A;  4A76 A;  1X54 A;  5IYB H;  4P73 A;  1TWF H;  4A3E H;  5JJL A;  3CAM A;  2HIX A;  3BZC A;  4O2D A;  4PZ6 A;  1X3G A;  2AWN A;  3NBH B;  4KHP L;  1PH2 A;  3STB C;  4JI7 L;  3EN2 A;  3UDX A;  1VQP A;  2I5M X;  3UDG A;  2MO0 A;  1I94 Q;  3MEF A;  1EFW A;  4A93 G;  1HNZ L;  4TQU S;  4LFB L;  2UXC L;  3ULL A;  3ER0 A;  4MZ9 A;  3GDE A;  4UP7 A;  4A3F H;  1SFO H;  1N8R C;  5JJI A;  4AIM A;  3W1G A;  3CME A;  3OYY A;  3S1Q H;  4NXM Q;  1YJN A;  3CPF A;  4DK3 C;  1WYD A;  4HID A;  3S2D H;  5ELN A;  3NEN A;  1VQ6 A;  4GKJ Q;  4HIO A;  1YI2 A;  1LM0 A;  4DV2 Q;  1YIT A;  4GN4 B;  1G29 1;  1S3O A;  3I56 A;  2BA0 A;  1PH6 A;  1NJI C;  1J5E Q;  1MIU A;  2R7D A;  3L2P A;  1FL0 A;  5IT9 c;  4LWC A;  5FJ8 G;  1KXL A;  4NXN Q;  2XGT A;  3W5O A;  5C0X J;  4OX9 Q;  2JA8 H;  1QVF A;  4GLA C;  2UUB L;  1YZ6 A;  2AMC B;  2E2I H;  1XMQ Q;  2NN6 G;  5M5Y H;  3TEH B;  1PH8 A;  1AE3 A;  4NXM L;  1N32 L;  1NMF A;  1C7Y A;  1HJP A;  1E1T A;  1E1O A;  1UE1 A;  3IRB A;  4P74 A;  3HKZ G;  2MFI A;  3TQY A;  3U58 A;  4GKJ L;  5M5W H;  1I50 H;  5IP7 H;  4DV2 L;  1RIP A;  2UXD Q;  3FKI G;  2I0Q A;  2YTV A;  1OXX K;  3NEM A;  2NVQ H;  2ALY B;  3AQQ A;  2D62 A;  3K0X A;  2CWA A;  3S2H H;  4QL5 A;  4NXN L;  2HHH Q;  3HOY G;  4OX9 L;  4RG1 A;  4BBS H;  3ZJY C;  3H0G G;  2E2H H;  3HFZ B;  1LUZ A;  1AE2 A;  3KLW A;  3PUY A;  1XMQ L;  5FLM G;  1Q86 C;  4LNQ A;  1UE7 A;  4B3R L;  4BXX G;  4GOP B;  2R7Z H;  3HOW G;  3BZK A;  2ZJR A;  1CSQ A;  1KD1 C;  5C4X G;  2PI2 E;  1X6O A;  3KOJ A;  1X3F A;  4DR7 Q;  3GTG H;  3KYH C;  1BKB A;  1WCM G;  4JOI A;  4A3B H;  2ZM6 Q;  5C3E G;  1WOC A;  3B6Y A;  2KCT A;  1ASZ A;  1X56 A;  4LF5 Q;  1Y14 B;  4LF4 Q;  1PA6 A;  4IJH A;  4X62 Q;  2PQA A;  4OO1 G;  4C3J H;  2HHH L;  2JA7 H;  3I55 A;  1E22 A;  1CUK A;  3M9B A;  1CKM A;  1CKO A;  2LXK A;  2PI2 A;  4JBW A;  3RNU A;  4IOC A;  4WJ3 M;  1MKH A;  4DV4 Q;  1CKN A;  4NPS A;  5BR8 Q;  1KIX A;  1YNX A;  4DR2 Q;  2UU9 Q;  4C3H H;  3A0J A;  3I4O A;  3DLL A;  4DR1 Q;  4A3J H;  1K8A C;  1HR0 W;  2R6G A;  1Y1W H;  2WP8 J;  3HOX G;  1VQ5 A;  1Q1B A;  4A3I H;  4LF4 L;  1OXV A;  1FVI A;  2DUD A;  1C0A A;  3PV0 A;  4GNX A;  3ICE A;  3FHW A;  3HOZ H;  3M4P A;  3TS0 A;  4BY7 G;  3TRE A;  2JE6 I;  3PO3 H;  2QEX A;  2I5L X;  1NTG A;  4JCV E;  2ZJP A;  2QA4 A;  3KF6 A;  1TWG H;  4YWL A;  4X64 Q;  2D0O A;  3S15 H;  2RCN A;  4JI6 Q;  2AHO B;  2A19 A;  5IE8 A;  3EBE A;  4DV4 L;  1H95 A;  5BR8 L;  2NVX H;  2VQE L;  1YHQ A;  3RR5 A;  1EOV A;  4DR1 L;  3CCJ A;  4JI2 Q;  1W2B A;  2Y0S E;  4PMW A;  3J81 j;  1GKH A;  1KL9 A;  1Q81 C;  2E5L Q;  3U4V A;  2K5H A;  4MTN A;  4OON A;  3GTJ H;  4J15 A;  1Q1E A;  1SE8 A;  4QGU A;  5C4J H;  2ZJQ A;  1TWH H;  2Y0S G;  2ZTE A;  4LF8 Q;  1KHI A;  3RLO A;  1GD7 A;  2AKW B;  5AJ3 Q;  3CMA A;  4K0K Q;  1LYL A;  2GN5 A;  4DV6 L;  4X64 L;  4H02 A;  3I4M H;  4A3L H;  4JI6 L;  3RLF A;  4C3I H;  3E9H A;  4YWK A;  4OO1 I;  1SLJ A;  5IYB G;  4JC0 A;  3NEL A;  1MJC A;  4R4O A;  4X66 Q;  4A3E G;  2F4V Q;  1K83 H;  2CQO A;  3W1B A;  3F2C A;  4JI4 Q;  4JI2 L;  4OWT B;  1Z9F A;  4DKA C;  2KHJ A;  3UE0 A;  3F2D A;  2KHI A;  2E5L L;  2VUM H;  5C0X I;  1M1K C;  1QVG A;  1SR3 A;  1AH9 A;  1IZ6 A;  3CCS A;  1V1Q A;  1E7Z A;  2EIF A;  4JI1 L;  5LMN L;  1YJ9 A;  4LF8 L;  2K14 A;  4LFA Q;  4DV5 Q;  4A3F G;  4ALP A;  4K0K L;  1VQJ A;  5AJ3 L;  1EQR A;  3CCQ A;  2IX1 A;  1TWC H;  1M90 C;  1PYS B;  3STB D;  5IYC H;  2JA5 H;  2KBN A;  1Z47 A;  2L15 A;  3CC2 A;  1K0R A;  4JI5 Q;  2WB1 E;  2HIV A;  3ULJ A;  3ULP A;  4LF7 Q;  2F4V L;  3GTQ H;  4JBM A;  3TRZ A;  4LUZ A;  4HJ5 A;  4EQ5 A;  4JI4 L;  1S40 A;  1VQC A;  4PZ8 A;  4UY8 C;  4DUZ L;  3LGJ A;  3PIO A;  1KQS A;  1VQL A;  1Y1V H;  4BA2 I;  5GAG C;  3A74 A;  5HY6 A;  4L5R C;  1PVO A;  1HNX Q;  1MJE A;  3G6E A;  4DUY Q;  2WB1 G;  4IOA A;  1A8V A;  1X55 A;  3E0E A;  3J80 c;  3AEV A;  1PV4 A;  1PH7 A;  4JOI C;  4L5S A;  1WJJ A;  2ASB A;  2JA8 G;  2D0P A;  4LFA L;  4DV5 L;  4A3K H;  1VQB A;  1I94 L;  3S14 H;  4A3C H;  1VQF A;  5JJK A;  1A0I A;  3CC7 A;  1JJC B;  3MXN B;  4LFC Q;  2RHQ B;  2VW9 A;  2KCM A;  3PF4 A;  4P72 A;  4MNO A;  4JI5 L;  4X65 Q;  4LF7 L;  3PUW A;  3JAM c;  3KF8 B;  3HOU H;  2KEN A;  5IP9 H;  2K50 A;  2R93 H;  1VQ9 A;  3RZD H;  5IP7 G;  3K7A H;  4IJL A;  4JI3 Q;  1SRO A;  1HNX L;  1J6Q A;  4POG A;  5IYD H;  2A1A A;  4DUY L;  5J3B A;  1DGS A;  1N34 Q;  2VNU D;  2F52 A;  2K52 A;  1SRU A;  1QZH A;  1J5E L;  2VZA A;  4JI8 Q;  3M85 A;  2A8V A;  3JAM i;  4DR6 Q;  4BBS G;  3G48 A;  2JJQ A;  1U5K A;  4UP8 A;  4DAY B;  2ZTC A;  3CCM A;  3GD7 A;  1U0L A;  4LFC L;  4GNX C;  5C44 H;  1GO3 E;  3K8A A;  2R7Z G;  1GVP A;  4GN3 B;  3CXC A;  4IPH A;  1VQG A;  4Y52 H;  1PH3 A;  4A3B G;  3CW2 C;  3KFU A;  3S16 H;  4JI3 L;  1R9T H;  1L2F A;  4ME3 A;  3G4S A;  1RL2 A;  4YWM A;  4HJ9 A;  4APV A;  5M5X H;  1YVC A;  1EYG A;  2JA6 H;  2E8G A;  4DR3 Q;  2IT1 A;  2UXD L;  2GVA A;  1I3Q H;  4JI8 L;  2JA7 G;  1VQ4 A;  1PH9 A;  1V43 A;  2K5V A;  5JEA G;  1A63 A;  1C9O A;  1YIJ A;  3BJU A;  4R1J A;  2N78 A;  4TVA B;  3F2B A;  1UWV A;  1HZB A;  3BU2 A;  5GQO A;  1HR0 Q;  1QZG A;  4LF9 Q;  1E3P A;  1YBY A;  3JC6 6;  1Y1W G;  4A3I G;  1IL2 A;  1K9M C;  4DR7 L;  3KDF A;  2ZM6 L;  4IFD G;  4DR3 L;  2NN6 I;  3OW2 A;  3HOZ G;  1JT8 A;  2ID0 A;  4BBR H;  4LF5 L;  1O7I A;  3OTO Q;  2NVT H;  3PO2 H;  3J7Z C;  4A75 A;  2YYZ A;  2Q2U A;  4JBK A;  3PO3 G;  4X62 L;  4NB3 A;  4GS3 A;  1CSP A;  3K81 C;  4YHH Q;  3HOV H;  2B63 H;  4BY1 H;  1QUQ A;  3F8T A;  1T9H A;  4UPA A;  3GTK H;  1BBW A;  2IY5 B;  1JMC A;  4DPG A;  2Q2H A;  1HR0 L;  1HZC A;  2JEB I;  2N8N A;  1PH5 A;  1I5F A;  2PQA B;  4LF9 L;  3H3V I;  3TS2 A;  2PMZ E;  1OXT A;  4IPG A;  1IYJ B;  2RF4 A;  4AYB E;  4DR2 L;  2UU9 L;  2JEA I;  5IY0 A;  1OXS C;  3U50 C;  4LW1 A;  2UUA Q;  1K8G A;  1L1O A;  1LTL A;  3GTO H;  4A3G H;  3UDF A;  1EWI A;  4LUO A;  3OTO L;  3S1R H;  1X65 A;  3CC4 A;  1I6H H;  2DGY A;  2CCZ A;  3CF5 A;  4AYB G;  4DV3 Q;  1HZ9 A;  2GVB A;  4YHH L;  4C2M H;  3PCO B;  2JA9 A;  1Q82 C;  3I4M G;  4A3L G;  4PG3 A;  4XIG S;  3CPW A;  1IBK Q;  4IO9 A;  3UDI A;  3T1Y Q;  2VY3 A;  1VQH A;  1Q7Y C;  1V9P A;  2OWO A;  1NBW A;  4JYA Q;  2VUM G;  1XTD A;  1OTC A;  4YCV A;  3T1H Q;  1BVS A;  4JI0 Q;  3VDY A;  2OCE A;  5ELO A;  3F1Z A;  4IPD A;  2YU9 H;  4DV1 Q;  4POF A;  4DV3 L;  2B3G A;  3S17 H;  4A3D H;  4KHP Q;  2VS1 A;  2FXQ A;  4QQB X;  4JI7 Q;  1TXY A;  5IYC G;  1UE5 A;  2JA5 G;  3I2Z A;  4B3M Q;  4RMF A;  1VQE A;  2R92 H;  2Z6K A;  1IBL Q;  1D8L A;  2YV5 A;  1VQO A;  2Q2T A;  3S1M H;  1VQ7 A;  1VCI A;  2XTI A;  1ASY A;  1X9N A;  3M4Q A;  4HJ7 A;  1OXU A;  1Y1V G;  5IWA Q;  3CCV A;  1PH1 A;  3GTP H;  4X66 L;  4JYA L;  3L0O A;  4OXP A;  4DV0 Q;  3K80 C;  3T1H L;  4JI0 L;  5M3F H;  2I5H A;  3GTL H;  4A4I A;  1KAW A;  5M3M H;  3KJP A;  3I4N H;  3CCU A;  4A3M H;  5JEA J;  4DV1 L;  4HJ8 A;  4A3K G;  2OQK A;  1VQK A;  3M7N A;  4A3C G;  3GTM H;  2HQL A;  3UE1 A;  2IX0 A;  4L5Q A;  2B29 A;  1VQ8 A;  4B3M L;  4LUV A;  2UUC Q;  1JJG A;  1IBL L;  1PFS A;  1G51 A;  1NY4 A;  2QGQ A;  1N9W A;  3HOU G;  1NMG A;  4KLK A;  5IP9 G;  2R93 G;  2UUB Q;  1TWA H;  4A93 H;  3K7U C;  5IWA L;  5FLX c;  3J80 i;  5IYD G;  1IBM Q;  1N32 Q;  4DV0 L;  2JQO A;  4IFD J;  2K75 A;  3PF5 A;  1NE3 A;  1HH2 P;  5GAE C;  1HZA A;  3S24 A;  1PH4 A;  3CCE A;  1UEB A;  5EAY A;  1A62 A;  2OTJ A;  1E24 A;  1Q8K A;  3PIP A;  5C44 G;  2UUC L;  5H1S E;  1XNR Q;  4GOP A;  1K73 C;  4AH6 A;  4BA1 I;  1EIY B;  3HKZ E;  2N3S A;  1B8A A;  4X65 L;  4WJ4 A;  5FJ8 H;  1X3E A;  1SMX A;  2YTX A;  3RLN A;  2HT1 A;  4GLV B;  1XMO Q;  1IBM L;  2YTY A;  4B3R Q;  2MQH A;  2JA6 G;  4XTC S;  4LF6 Q;  2CFM A;  5DLQ E;  1GM5 A;  2K5N A;  3PUZ A;  1VQD A;  4KHZ A;  4AQY Q;  1N34 L;  2UXB Q;  3CCL A;  2ZTD A;  1KRS A;  1XPR A;  1L1O C;  3RZO H;  4DR6 L;  5K36 G;  4Y7N H;  3FKI H;  4OWX B;  1XNR L;  3J7A 5;  1BBU A;  4DK6 C;  4JV5 Q;  3DM3 A;  2WAQ E;  3E9I A;  1KRT A;  3H3V H;  2LXJ A;  3S1N H;  2IHF A;  1W3S A;  3HOY H;  3CD6 A;  1XMO L;  4A3J G;  3FP9 A;  2N49 A;  4DR5 Q;  2JK8 A;  1YEZ A;  2OQ0 A;  3H0G H;  2K4K A;  2MO1 A;  2Z0S A;  4LF6 L;  4HIK A;  4KI0 A;  3H15 A;  5LMU Q;  5FLM H;  2ES2 A;  4BBR G;  2WAQ G;  3HKS A;  1IXR A;  1Q12 A;  2PNH A;  4DNI A;  1VQN A;  1FJG Q;  1XPU A;  4O0A A;  1VQA A;  3CQZ H;  4AQY L;  4BXX H;  1YHA A;  1VS0 A;  3AFP A;  3HOW H;  3AFQ A;  2UXB L;  5C4X H;  4B3T Q;  3HOV G;  2B63 G;  3Q8D A;  4BY1 G;  1FGU A;  2OTL A;  5HGQ A;  1XJV A;  1WCM H;  2F3I A;  4R4I A;  1YJW A;  5C3E H;  1VQM A;  1QVC A;  4JBJ A;  1PHJ A;  3L7Z C;  4R4C A;  4JV5 L;  1SN8 A;  2CWP A;  2EXD A;  2BH8 A;  2VQF Q;  2RHS B;  3M4O H;  2LSS A;  1S72 A;  4GKK Q;  2H5X A;  2VL6 A;  2Z6K C;  3WWV A;  5C0X G;  4DR5 L;  3G71 A;  2NZH A;  4PZ7 A;  4UP9 A;  3KJO A;  3PSI A;  1KC8 C;  4A3G G;  1HNW Q;  4QY7 A;  2VQE Q;  5LMU L;  2WFW A;  1XPO A;  3RN5 A;  4R4Q A;  5E7N A;  3EIV A;  1FJG L;  1WI5 A;  1P16 A;  4GN5 A;  4B3T L;  1B7Y B;  1CKN B;  4HIM A;  1K3R A;  2BA1 A;  3ERS X;  4X6A H;  2C35 B;  3HOX H;  3SGI A;  4YCW A;  3KDF B;  2IHE A;  1B70 B;  2NZO A;  3U4Z A;  4EX5 A;  2E2J H;  1YHB A;  1Q46 A;  4P71 A;  2AWO A;  2MNA A;  4B3S Q;  4DR4 Q;  4YY3 Q;  3PUX A;  1EUJ A;  4L5T A;  2VQF L;  1N36 Q;  4DV6 Q;  4GKK L;  1D7Q A;  3CP0 A;  1EQQ A;  1XNQ Q;  4BY7 H;  4OWW B;  4GNX B;  1XNQ L;  1HNW L;  1UE6 A;  3PUV A;  1QUQ B;  3PO2 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...