1NE3A

Solution structure of ribosomal protein s28e from methanobacterium thermoautotrophicum. ontario centre for structural proteomics target mth0256_1_68; northeast structural genomics target tt744
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
68
Chain Sequence
MDDATPAEVIEVLKRTGMTGEVMQVKCRILDGRDKGRILTRNVMGPIREGDILMLLDTIREAKEIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 30S ribosomal protein S28E
publication title Solution structure of ribosomal protein S28E from Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermococcus thermolithotrophicus
total genus 3
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2002-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01200 Ribosomal_S28e Ribosomal protein S28e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ne3A00
3CCEA 4AIMA 1N34L 1IBKL 2VL6A 3HOYG 4LF7L 5FLMG 4C3HH 2JA8H 2JK8A 2Z6KA 4JI2Q 2GN5A 2E2IH 2JA5H 2RCNA 4IOAA 1L1OC 4IOCA 3TREA 4JI7Q 3T1HQ 4LF4L 2UXBQ 4B3RQ 3VDYA 4XIGS 4DKAC 1I3QH 3GTMH 3E9HA 3I7FA 1UWVA 3NENA 1QVGA 1PH3A 3HOXG 4UY8C 2JEAI 2MFIA 2XTIA 5IP9H 5M5WH 3STBC 4DR4L 4GOPA 4BXXH 4UP7A 1N36Q 2AKWB 1M90C 1N33Q 2B3GA 4H02A 2NN6G 4IPGA 2YTVA 1E1OA 5FJ8G 1NTGA 5IYCG 4XTCS 3ER0A 5HGQA 4A3EG 2V1CC 4LF6L 4MTNA 1PH4A 1N32L 4AQYL 3G4SA 4DV2L 4O2DA 2RHQB 1YZ6A 4APVA 1Y1WG 2R7FA 2FXQA 4JOIA 2UUBL 4X64Q 5JJIA 4JC0A 1X9NA 1HJPA 3RLNA 1VQMA 3B6YA 3M85A 2WFWA 1VQDA 3T1YL 1M1KC 1PH2A 4X62Q 2YV5A 1BKBA 1VQNA 4IO9A 1B70B 4LW1A 1HR0Q 3OYYA 3KDFB 3EBEA 3RR5A 4X66L 2GVBA 1PH9A 2YTYA 3CC4A 4YWMA 3M4PA 1S40A 1FJGQ 2QEXA 1CKMA 4GOPC 4JI0L 1RIPA 2BH8A 3OW2A 4TQUS 1G291 2ALYB 2L15A 4L5QA 1YITA 1VQ8A 3RZDH 3HKZE 4IFDJ 2VQFL 1XNQL 4NXML 3W1GA 1VQEA 3S1MH 4GKJQ 2JEBI 4DV3L 3E9IA 3GDEA 2AWOA 3KDFA 3KJOA 3J7A5 4JI2L 3TQYA 2N78A 4OX9Q 4BA2I 4AYBE 4EQ5A 2UU9L 1X55A 1UE6A 3J7ZC 3NEMA 4OONA 1CSQA 4BY7G 5IYDH 2K5VA 4O0AA 3HOYH 1N9WA 3PO2G 1GVPA 4JBWA 4A3JG 1KD1C 5FLMH 4BBSH 3HKSA 1FGUA 1MKHA 1AE3A 4X6AH 4GN4B 2PMZE 2NVYH 3J80c 1SMXA 2OQKA 2PQAB 4YHHQ 1IBML 4JI4L 4JCVE 4R4CA 1N33L 3GTQH 4DV4L 4IFDG 4HIMA 3E0EA 3H0GG 4JI8L 2ID0A 4BBRG 2KCTA 4JI5Q 2HT1A 1JJGA 3GTPH 1S72A 2CFMA 3HOXH 4PMWA 1IBKQ 2KHJA 1WJJA 1EOVA 5BR8Q 3KF6B 4AH6A 4LF7Q 3S1QH 3RLOA 3K7UC 1NMFA 2D62A 3AFQA 1QUQB 1ASYA 4X64L 3S14H 1K8AC 5FJ8H 4A3DG 4LF4Q 2N3SA 4LFCL 3U4ZA 4GNXA 5IYCH 1GO3E 3A5UA 4DV5L 4A3EH 4X62L 4GLAC 4DAMA 5C4XG 3CCSA 1OXTA 3JC66 1IXRA 1HR0L 3UDXA 1Y1WH 3KF6A 1NY4A 1EQRA 3DLLA 1FJGL 4DR4Q 3CCRA 1HNXQ 4JBMA 1CKNB 5IWAL 4LF5L 2R92H 2IY5B 1SR3A 2N8NA 3PUVA 4IPCA 2IHEA 4WJ4A 2CWPA 4P75A 3OTOL 4LF6Q 1H95A 1GKHA 1MJCA 2JJQA 1K83H 4AQYQ 3GTOH 1OXXK 4C3JH 2CCZA 4DV2Q 4OX9L 2NZHA 1YHAA 1XJVA 2VY3A 3PGZA 1CKNA 1R9TH 5LMNL 3J80i 1HZAA 1TWAH 4QGUA 1YIJA 2I0QA 3T1YQ 3PO3G 3BZKA 1JMCA 3I56A 4GNXC 2Y0SE 1CUKA 2UUAL 1HR0W 1EWIA 1KRTA 4X66Q 1Y1VG 2EIFA 5GAHC 2UXDL 1JE5A 1T9HA 1EFWA 3CD6A 4BY7H 4JYAL 2IX1A 1U0LA 2YYZA 2RHSB 2NVQH 1VQFA 2BH2A 1VQHA 4A75A 3S2HH 3L2PA 4JI0Q 4BY1G 4JI5L 3PO2H 2I5MX 4A3JH 3HFZB 1PH5A 4JI6Q 1UEBA 3G71A 4A93G 2IT1A 4NB3A 5C44G 2VQFQ 3H3VI 4KLKA 4NXMQ 1J6QA 3GTKH 4DV3Q 2E8GA 5BR8L 3PIPA 3K8AA 2HIXA 3L0OA 1VQ4A 1VQCA 4LWCA 1UE1A 4YWKA 4GOPB 1B8AA 2UU9Q 1VQGA 2HHHL 3KLWA 3H0GH 3MEFA 4BBRH 4WJ3M 5GAEC 1O7IA 5K36G 4LF9L 1MIUA 5H1SE 5C0XJ 1JJCB 1Q1EA 4X65L 4GLXA 4A4IA 4DV0L 3GTGH 1MJEA 4KHZA 1B7YB 4B3TL 3G48A 1HZBA 1KRSA 1V1QA 4A3IG 2Z0SA 3ICEA 1SE8A 3KFUA 1HNXL 4A3DH 4JI4Q 4DK3C 1JJ2A 3JAMi 1IBMQ 1TXYA 1VQ5A 2OTLA 1PA6A 3RZOH 4LFBQ 4DV4Q 2D0PA 1QZGA 4P74A 1V9PA 2K14A 4JI8Q 5C4XH 4HJAA 3I4NG 1IBLQ 4GN5A 1V43A 1PYBA 1WFQA 4DR7Q 4GLVB 4POFA 2Z6KC 3CQZH 4P71A 4B3MQ 1X54A 2DUDA 4R1JA 3I4OA 4HIDA 4HJ9A 1XNRQ 3A74A 4A3LH 1VQIA 3W5OA 4GS3A 5C3EG 1YI2A 4LFCQ 4DV5Q 1K3RA 3SGIA 3ZJYC 3I2ZA 4RMFA 5E7NA 1BBUA 1OXSC 2JA6G 3KOJA 1TWHH 1HNWL 1PV4A 1D7QA 4A3FG 1K73C 2B29A 2QA4A 1C7YA 1X3GA 1K0RA 1VQPA 3M7NA 4UP8A 2Q2HA 3PV0A 5IWAQ 3PIOA 4LF5Q 1RL2A 1C0AA 3PO3H 2XGTA 4JI6L 4A3MG 2A8VA 4PZ7A 3OTOQ 2VQEL 3U4VA 4QJFA 2YTXA 1Y1VH 4J15A 1AH9A 4YY3L 1PH8A 3BJUA 4ALPA 1HZ9A 3PUZA 2Q2IA 1PHJA 4HJ7A 2AWNA 3K80C 5C0XI 1XPRA 4BY1H 2HQLA 2ZM6L 4BA1I 4JOIC 2PNHA 5LMNQ 4A93H 5C44H 3RN2A 3CC2A 4K0KL 1XTDA 2UXCQ 5J3BA 1YVCA 4MZ9A 4Y52H 2UUAQ 1VQ9A 4HIOA 3EIVA 4R4IA 3PUWA 3RN5A 2BA0A 1EIYB 2R7ZG 2UXDQ 1UE5A 2ASBA 4IPHA 1LYLA 2C35B 4R4QA 3S1RH 4DV1L 2NVXH 2F4VL 4JYAQ 4LFBL 1HNWQ 4GNXB 4DNIA 1IBLL 3TS2A 2CQOA 2EXDA 2R6GA 1XMQL 3CCVA 4DR3Q 2PI2A 1GM5A 1A62A 4A3IH 2OTJA 4DR7L 5M5YH 2NVTH 1WYDA 1VQBA 2ZTEA 1A8VA 4B3ML 3PUYA 3HKZG 4IJHA 2HHHQ 1XNRL 4PZ6A 3I4NH 1EIFA 1VCIA 3GTJH 4DUZL 3CF5A 1WCMG 4LF9Q 3TRZA 2ATWA 5GQOA 4X65Q 4AYBG 5JJLA 4DV0Q 5IT9c 4TVAB 1Q1BA 3CPFA 5FLXc 1TWCH 1QZHA 4OO1I 3PSIA 2ZJQA 4B3TQ 1I6HH 2IHFA 4DV7L 2VNUD 4B3SL 1OTCA 4KHPL 1VS0A 1KL9A 4R4OA 5C3EH 4P72A 3HOUG 1D8LA 3CP0A 2E5LQ 2JA6H 2LXJA 4RG1A 3PCOB 3CCQA 1Q86C 1VQ7A 2JA7G 2WP8J 4A3FH 1XPUA 3CC7A 3W1BA 1PFSA 3FHWA 1KHIA 3K7AH 1OXUA 1IYJB 2ZJPA 1KAWA 2K5HA 1CKOA 3CPWA 4A3KG 4A3MH 1NJIC 3ERSX 2N49A 1SN8A 2UXCL 1YJ9A 3F2CA 4ME3A 4NPSA 2PI2E 3I4MG 2F52A 4OXPA 2CKZB 4LUVA 5ELOA 4EX5A 3CXCA 1J5EL 4GN3B 2ZTCA 5AJ3L 1E7ZA 1G51A 1DGSA 1X6OA 3AQQA 3D31A 4UPAA 3FKIG 5C4JH 2VUMG 3J81c 4A3GG 4DR3L 2VQEQ 3FP9A 1VQKA 4YY3Q 1NBWA 2R7ZH 3HOVG 3S17H 3KJPA 2B63G 3A5ZB 5IY0A 4HIKA 1SROA 1X3EA 2ZM6Q 5LMNW 3I55A 3M3YH 1L0WA 3S2DH 1IL2A 3S16H 3A0JA 1CSPA 4K0KQ 4PZ8A 2OCEA 1PH7A 1JT8A 3UDFA 1X65A 1LM0A 3NBHB 3HOWG 2KHIA 3UDGA 1Q7YC 1PH6A 2AMCB 1W3SA 3PF4A 3WWVA 2KENA 1HH2P 1S3OA 1NMGA 2ZJRA 1YBYA 4A3CG 4QQBX 2WAQE 1W2BA 2F4VQ 2Y0SG 4DV1Q 2E5LL 1WCMH 4JI1L 3CCMA 1A0IA 4BBSG 2R93G 4JBKA 4C3IH 3CMAA 1XMQQ 4LF8L 4DR6L 3UDIA 1Q46A 1YHBA 2H5XA 4C2MH 2K5NA 3TEHB 1X56A 3CW2C 2K50A 1P16A 3HOUH 4GKKL 1PVOA 4DAYB 4LFAQ 5C0XG 1VQOA 1Y14B 2JA9A 4QIWE 5EAYA 2HIVA 4QL5A 5JEAJ 4DUZQ 4HJ8A 1I5FA 5HY6A 3H15A 3F2BA 3TS0A 2Q2TA 2JA7H 1U5KA 1LTLA 2F3IA 2JQOA 5M3FG 3H3VH 2LXKA 3GD7A 4FDBA 2WB1E 5M3MG 1KIXA 3J81i 1E3PA 3NELA 4DV7Q 4B3SQ 2I5LX 4KHPQ 1YNXA 4A3KH 3HOZG 3CCLA 2EQSA 1EYGA 2KBNA 4POGA 4JBJA 2MQHA 3I4MH 1YEZA 4KI0A 1I50H 4JV5L 3MXNB 1HNZL 3M4OH 1X3FA 4YCWA 2YU9H 2WAQG 3AYHB 1Q81C 4P73A 1ASZA 1K9MC 2R92G 1JB7A 2D0OA 5JEAG 3FKIH 2UUCL 4OWXB 1KC8C 1C9OA 5LMUL 3LGJA 1I94Q 2VUMH 1FVIA 1SLJA 4A3GH 3K81C 4R4TA 5ELNA 3HOVH 4L5SA 2NN6I 1Z47A 5IYBG 1Z9FA 4NXNQ 2I5HA 3RLFA 4DUYL 1J5EQ 4DR1Q 2LSSA 3M9BA 5AJ3Q 2B63H 2AHOB 4DR2L 1VQ6A 3GTLH 4OO1G 1G6PA 3Q8DA 2K52A 3J81j 2Q2UA 3RNUA 3S24A 1Q8KA 2R7DA 3K0XA 2WB1G 4L5RC 2MNAA 1Q82C 4YCVA 3HOWH 4A3BG 3AEVA 1TWGH 1WI5A 1XMOQ 3F1ZA 3UE0A 3T1HL 4JI7L 2UXBL 3UE1A 2E2JH 4A3CH 2QGQA 2RF4A 4A76A 1AE2A 1SFOH 3G6EA 4B3RL 3EN2A 5IP7G 3S1NH 4LFAL 4JI3Q 2R93H 1WOCA 4Y7NH 5M5XH 1EUJA 4DV6Q 4DPGA 4DR5Q 3ULPA 2JA8G 5DLQE 3KF8B 3S15H 3F2DA 1N36L 4DK6C 2JA5G 1Q12A 2VZAA 1YJWA 3CAMA 1LUZA 1IZ6A 1PH1A 5GAGC 1VQAA 1OXVA 2ZTDA 1N34Q 2OQ0A 4JI1Q 3D0FA 1GD7A 5M3FH 1PYSB 5M3MH 2CWAA 4L5TA 3AFPA 5IP9G 1YHQA 4LF8Q 4DR6Q 2PQAA 1FL0A 1VQLA 2DGYA 1SRUA 3STBD 2K75A 4BXXG 2VS1A 1N8RC 2E2HH 3GO5A 3HOZH 1E24A 4OWWB 4GKKQ 1QVCA 3BZCA 1I94L 1BVSA 4QY7A 1BBWA 1NE3A 1L1OB 4LUZA 1UE7A 3BU2A 4IFDI 4IJLA 2VW9A 3CMEA 1QUQA 4NXNL 4LNQA 3PUXA 5GADC 4DR1L 1TWFH 3U50C 2K4KA 1E22A 3F8TA 4A3LG 3KYHC 1P8LA 3ULJA 4GKJL 1VQJA 2GVAA 4PG3A 2MO1A 3JAMc 1XPOA 3CCJA 1N32Q 3U58A 4LUOA 5IE8A 3L7ZC 1L1OA 5GROA 5IYBH 4JV5Q 1HNZQ 2OWOA 4OWTB 1XMOL 5JJKA 1E1TA 2UUBQ 3ULLA 1QVFA 2JE6I 2KCMA 4JG2A 1YJNA 2IX0A 4YCUA 2UUCQ 4JI3L 3PF5A 1KXLA 3IRBA 5LMUQ 1EQQA 3DM3A 3M4QA 4MNOA 2A19A 4DV6L 4HJ5A 4A3BH 1L2FA 4DR5L 1K8GA 1A63A 4YWLA 4YHHL 3CCUA 4IPDA 2BA1A 2NZOA 2A1AA 4DUYQ 4UP9A 5IYDG 5IP7H 4DR2Q 2ES2A 1XNQQ 1HZCA 2MO0A 1KQSA
chains in the Genus database with same CATH superfamily
1IBKL 5LL6S 2Z6KA 4JI2Q 2E2IH 2JA5H 3TREA 5EBCA 4B3RQ 3VDYA 4RGNA 5I2XA 3KLSA 1WTQA 3E9HA 1PRTF 4KMUC 4UY8C 5JPNC 1QVGA 2MFIA 4BWGB 1AW7A 1AEXA 2B2VC 2XTIA 2ZXRA 3L9AX 2EY5A 4UP7A 3H94A 2AKWB 3GV3A 1M90C 4H02A 2NN6G 1TWHB 5FJ8G 2L11A 2XN9C 1B9MA 4A3EG 1LTID 1AN8A 3GV6A 4O2DA 2R7FA 2FINB 2FXQA 1T5XD 4JOIA 2O5JC 2PCFB 1EIGA 1VQMA 3U9OA 3M85A 3T1YL 1MGSA 1BKBA 1VQNA 3OWEB 1CHPD 4DU9A 2GVBA 1S40A 2NBFA 2DNEA 1L0YB 4XT1B 2ALYB 2QF7A 3G6JB 1STHA 4IFDJ 1EWHA 1BXTA 4K14A 3KDFA 4BA2I 5IGGA 4EQ5A 1X55A 1HFNA 2K5VA 5IGEA 3H3VC 4HMJA 4A3JG 3JAME 4X6AH 4OL7A 3I4NB 5BN4A 4YHHQ 3OOCA 2K05A 4JCVE 4R4CA 1N33L 3E0EA 1JJGA 2H1EA 3P1HA 3HOXH 1S72A 2A68D 2KHJA 1JOKA 1EOVA 5F2DA 3RLOA 4J1MA 2RSNA 3NSWA 3AFQA 1EYDA 4LF4Q 4A3FB 1AZQA 3I72A 2MJ8A 3A5UA 2PQEA 4DAMA 3CCSA 2Z4HA 4TSSA 1IXRA 4WORA 1HR0L 2LKVA 3KF6A 2B2UC 3DLLA 1FJGL 5CV6A 1RTNA 4LF5L 1SR3A 3N52A 3MXUA 2IHEA 3N6RA 4KKUA 2ZT9C 4WJ4A 2CWPA 3OTOL 3I73A 1MJCA 5E1FA 4HCEA 3GTOH 5C4JB 2CCZA 4OX9L 3BDLA 2VY3A 1PXUA 1R9TH 1HHVA 4QGUA 1TY2A 2EPBA 3S17B 1JMCA 4GNXC 1MSGA 2DJFC 1JCKB 2KUMA 1EU4A 1JE5A 5FO7B 1EQVA 4KD3A 3I90A 1M4VA 1U0LA 2YYZA 2IX1A 1HNWL 3QG1A 4JI5L 1SNOA 2VXWA 1PH5A 3HFZB 3BS1A 5JJZA 3I8ZA 4NB3A 2VQFQ 2F0MA 1BQQT 1S5ED 4DV3Q 3HEJA 1Y8NB 2HIXA 3L0OA 1VQCA 4OELB 1VQGA 5GAEC 1O7IA 1LTRD 4C2MB 2A68C 3CRLC 2B2YA 4A4IA 1SNQA 4R9WA 2F0FA 1NR4A 3KFUA 1B9NA 2JA7B 4DK3C 3JAMi 1VQ5A 3MXGA 1QNUA 4DV4Q 4RFBA 1V9PA 4JI8Q 3I4NG 4Q5VA 4A3KB 3J80E 1Y8OB 3NBHA 3QO2A 3I4MB 3CQZH 4B3MQ 4U68A 4R1JA 5T1IA 5I9PA 4KY7A 1DCZA 1XNRQ 3R3OA 5IGFA 1VQIA 1U4MA 4DV5Q 1K3RA 1CHQD 2IW3A 3S9WA 3KOJA 4A3FG 4K6DA 4A3GB 1X3GA 1MD2D 4UP8A 3HOVB 5IWAQ 2L4NA 1RL2A 1C0AA 3PO3H 1KABA 4FO2A 3U4VA 1LT6D 2YTXA 4J15A 4ILWA 1EIHA 5DAUA 5LL6X 1VF7A 3QWNA 3HOWB 4BA1I 4A93H 3RN2A 1XTDA 1KDAA 5J3BA 1A2UA 1KDCA 2R93B 1RHPA 2QKIC 3J81L 1ZKOA 4ZAIA 3EJIA 1ZEQX 4JYAQ 3S1RH 1LYLA 4LFBL 2NVXH 1CA5A 3S15B 4QF4A 4X3SA 2VB2X 1MHWC 1VF5C 1LTTD 3CCVA 1GUNA 5CBAE 5M5YH 5FKAC 1WYDA 2XRSD 1A8VA 5M3MB 2HHHQ 4U673 1JR0D 4LF9Q 3HOZB 1GXDC 4X65Q 5IT9c 1Q1BA 1TWCH 1QZHA 4PV1C 4DV7L 1HTLD 1QILA 4KHPL 1SJHD 1KL9A 2EY1A 1S4ZA 4PQXA 3IFDA 3MXPA 2JA6H 2F0KA 1VQ7A 2JA7G 1XPUA 5E4XA 1KHIA 1IYJB 1NUCA 2IPKD 1EZ6A 1HRJA 1CKOA 4A3KG 4OGQC 2WV6D 2UXCL 2A69D 1YJ9A 2PI2E 3I4MG 5KIXA 3VR5A 4OXPA 1IKMA 5ELOA 1G51A 1X6OA 3MEHA 1EY6A 4HAEA 3P20A 2F4IA 1WVLA 1GUSA 1R4PB 4DR3L 4A3GG 1ESFA 4RGMA 4YY3Q 3HOVG 2JA8B 3A5ZB 1EY0A 5IY0A 1O78A 2ZM6Q 4V190 3M3YH 1KNEA 2K7VA 2Z9HA 4K0KQ 2Z1CA 2F0OA 2HUGA 4HSVA 3HOUB 1BNZA 1I3QB 3HOWG 4RA8A 4N9TA 1S5DD 1S3OA 5M5WB 1YBYA 2N55A 2F4VQ 4DV1Q 2IWHA 1A0IA 2LFNA 1F2LA 2R93G 4JBKA 1HQRD 4LF8L 2TMPA 2H5XA 4FYDA 1SNPA 1D5MC 2NTSA 3HOUH 1PYWD 5C0XG 1Y14B 4OEMB 4HJ8A 4DUZQ 5HY6A 3H15A 3F2BA 3T53B 3TS0A 1U5KA 1LTLA 2JQOA 4FF4A 2LXKA 2E74C 2F0NA 3NP8A 4OIKA 5M3MG 1Q90A 3J81i 1CM9A 5EKIA 2QDBA 3NELA 1CK1A 2EDGA 1WD1A 3C2PA 3HOZG 1D1KA 5I9OA 2A69C 3CCLA 1UUPA 2MPMA 1F9PA 1I50H 1HNZL 4HSPA 3RZDB 3M4OH 2K5DA 4KJNA 1SE3A 3MAQA 1Q81C 3S1MB 4K2KA 4TRDA 1JB7A 4M8AA 1ILPA 3FKIH 1KC8C 1B3QA 3LGJA 5C4HA 3J7AF 4R4TA 3MZ5A 3V05A 4EVOA 1Z47A 1Z9FA 3RLFA 4DUYL 4N9PA 1VQ6A 5AJ3Q 2F0VA 3VYRA 3HG9A 2HCIA 2K52A 2NVYB 2Q2UA 2QDLA 4DXFA 3RNUA 1EY9A 4CKEA 2BDNA 1PZJD 3AEVA 1A3TA 1TWGH 2KCNA 1XMOQ 1ICWA 3UE0A 2UXBL 3V96A 4A3CH 2RBMA 1HQMC 3G6EA 3S1NH 2AQ1B 3A8KE 1ENFA 1I4XA 2RCFA 3ULPA 2JA8G 4DFAA 4KN7C 1PFNA 4IUQA 4B08A 2X6GA 1PRTD 1VQAA 1OXVA 2K32A 1SYEA 4JI1Q 4N8FA 4DAPA 4XQNA 2KVMA 2R61A 3VYTA 1TS3A 1Z6HA 1N8RC 1K83B 4BXXG 2M00A 5I6YA 4GKKQ 1EY5A 1I94L 1BBWA 4LUZA 3BU2A 1WTVA 3PUXA 5GADC 3K5NA 2K4KA 2KQ3A 3F8TA 2X69A 3VA5A 5T1GA 4BY7B 1M8AA 1RDPD 2NVQB 3JAMc 3CCJA 4IZ8A 3PO2B 1L1OA 4JV5Q 5FK9C 2OWOA 4OWTB 2N88A 3ULLA 4O42A 1G8ZD 4HTHA 4JG2A 2IX0A 4YCUA 2UUCQ 4JI3L 3IRBA 3DM3A 2K1BA 3H0GB 4BBRB 1CA6A 4HJ5A 4DR5L 1V1PB 1F2ZA 3CCUA 4QUCA 3BVZA 2JYOA 5IP7H 2ES2A 5FO8B 1KQSA 1PFMA 4A3DB 3RZOB 5IGDA 5FLMG 2JK8A 2GN5A 2DNCA 1STBA 4IOAA 4KD4A 3DM1A 1PRTC 1PTOB 3D4DA 1HFGA 2K03A 2PW5A 4DK1A 4ZYSA 5IP9H 4DR4L 1WTHA 1GHKA 1ICFB 1N33Q 2B3GA 2YTVA 1E1OA 4LF6L 2PNRC 1PTOH 1N32L 2SNMA 1EY4A 4DV2L 3EA6A 1XWEA 4XXEA 2UUBL 5JJIA 2I07B 1X9NA 1Y1VB 3B6YA 1II3A 2WFWA 1M1KC 5IGBA 4LW1A 1HR0Q 3VYUA 3EBEA 4X66L 2EXZA 5KYIA 2PPBC 4YWMA 5BN5A 1FJGQ 1SNDA 4GOPC 1RIPA 1XNQL 4TQUS 1I4RA 2L15A 5G3LD 3NTIA 2PO4A 1B50A 4NXML 3GDEA 2AWOA 2BDOA 2O2LD 4OX9Q 2UU9L 1GUWA 4K5VA 3NEMA 1HUNA 1CSQA 4BY7G 3DXJC 5IYDH 4L6TB 4O0AA 3X3MA 1GOZA 1N9WA 3PO2G 4JBWA 1KD1C 1W6KA 4BBSH 3C46A 1MKHA 1SEBD 3J80c 4JI4L 2PQAB 3SK8A 1ESRA 4RHSA 4IFDG 2NWGA 3H0GG 4BBRG 4JI5Q 2KCTA 4J6HA 1H9JA 3GTPH 1CTMA 4ODGA 2CFMA 5J22A 5C3EB 1WJJA 4LF7Q 1H9SB 3LWEA 1NMFA 2J4XA 3MC0B 1QUQB 2FMMA 4M1UB 2NN6H 3QR8A 4X64L 1K8AC 1X3QA 4XQQA 5FJ8H 4A3DG 2KEDA 4LFCL 3U4ZA 3AMUA 4A3EH 4X62L 4GLAC 3K7AB 1I4GA 2RQXA 5DEHA 3UDXA 1WD0A 3KLSX 3VA7A 3TBIB 4A3MB 1EQRA 5CYUA 4CDCC 2R92H 2FMCA 3KBXA 1I4HA 3C1FA 3R2TA 1BR9A 4IQZA 3F2UA 1GKHA 1DOLA 1EL0A 4AQYQ 2EYPA 1YHAA 1YNJD 1FGBD 3PGZA 5KNDA 3T56B 1XX8A 3ONAB 1CKNA 1SYDA 1HZAA 1MBYA 4RH6A 2I0QA 3DUZA 1K28A 1HR0W 3X3NA 1B2TA 1Y1VG 2UXDL 3HGBA 1ET9A 2B8GA 3CD6A 3QB3A 4Q0FA 2RHSB 4UHVA 4KV6A 3L2PA 4JI0Q 4A3JH 1UEBA 4K6LA 5C44G 5ELEA 1LT3D 3T13A 2F0UA 2JXMB 2LS01 5BR8L 2PYKA 3K8AA 3PIPA 3NQTA 5CORA 4YWKA 2RDHA 2F0HA 2PZTA 4WJ3M 1MIUA 1JC7A 5CV8A 4DV0L 3GTGH 2EJGC 2QCPX 1SE8A 3W3AA 1S5CD 5A2QL 1IBMQ 1TXYA 4LFBQ 4DNRB 5HGTA 4ABNA 4P74A 1LTBD 2K14A 3NK9A 1G2TA 1F77A 1ENAA 5J1ZA 1SBBB 1V43A 1PYBA 1WFQA 3WDNA 1DJRD 1R4QB 1X54A 1KLUD 4HJ9A 5FLXL 2RSOA 4P2CB 3C1EA 1YI2A 5C3EG 2ENBA 5A2QE 4CJ2C 1S5FD 3ZJYC 4RGTA 1OXSC 4KKSA 4C56C 1YNJC 1TWHH 1LTAD 4MTKA 3I3CA 2QA4A 5JVH3 3M7NA 2Q2HA 1RJTA 1CZGA 2L55A 5TSSA 2CW0C 1U4PA 2XGTA 3E3XA 3D8GA 4A3MG 4JI6L 4PZ7A 2VQEL 2BE5D 1PH8A 3BJUA 1Q3LA 2HQLA 1A2TA 3NTHA 5LMNQ 2K6AA 5FO9B 3CC2A 2UXCQ 4MZ9A 1SFOB 2UUAQ 4GZYC 3EIVA 1CT1D 3NHHA 3RN5A 3GTJB 1EIYB 4PMBA 1BCPF 1OO9B 4GNXB 1EYAA 4DNIA 1IBLL 1PTOF 1X3PA 5EPLA 4DR3Q 2PI2A 1GM5A 3WOFA 1A62A 1WTOA 2ZTEA 4F88A 3PUYA 4FXGC 3I4NH 1NSNS 2XIWA 1VCIA 3GTJH 1TQOA 3D3RA 2ATWA 2E2HB 1C4QA 4IURA 4B3TQ 2ZJQA 4QMGA 1W6JA 4B3SL 5JPMC 1CQVA 4R4OA 2WAQB 3PIP3 3CKIB 4FNFA 5KGUA 4EGVA 1TWFB 4RG1A 1Y69U 3PCOB 4A3FH 3CC7A 1ZYRD 1PFSA 4DK0A 1SDFA 4MHEA 1B3AA 1KAWA 2K5HA 3CPWA 4FVMA 5EPJA 2N49A 1SN8A 1LLRD 2BE5C 3F2CA 4ME3A 4NPSA 5E4WC 1D5XC 1EY7A 1LABA 2F52A 2CKZB 4EX5A 2F03A 4GN3B 2ZTCA 3R8BA 5L37A 3S2DB 4A3BB 5IGCA 1DGSA 1K0SA 3VYSA 5C4JH 3IFTA 4TKOB 2DY8A 1EU3A 2EYFA 3S17H 2L5TA 3KJPA 3QIAA 4C3HB 2Q8RE 2V4DA 5CBEE 2AUKA 5LMNW 1DONA 1L0WA 3SK4A 3S2DH 2F0EA 3A0JA 4HCSA 5CR3A 1PH7A 1JT8A 3UDFA 3GTMB 2KHIA 1Q7YC 1H9KA 1W3SA 3PF4A 4CDDC 3WWVA 3LX0A 1NMGA 4N8X1 2IX3A 2Q8IB 2E5LL 4RGOS 1XMQQ 1JQYD 2QILA 5EPKA 1QB5D 4DR6L 1Q46A 1EWCA 4C2MH 2K5NA 2PW7A 2BOSA 1P16A 4IUVA 4DNTB 4DAYB 1LT4D 1FNUA 5K5PA 1HPCA 4QIWE 4QL5A 1STGA 2Q2TA 2JA7H 4EQOA 1ZYRC 3L3OC 4XYOA 1TS5A 1E3PA 4QB4A 4A3KH 2KBNA 3I4MH 1UNSA 3MXNB 4CKCA 2WAQG 3AYHB 4CJ0B 2MP1A 2TSSA 1I94Q 2F0GA 1FVIA 4A3GH 3K0YA 5ELNA 2KA7A 3HOVH 3HOYB 2CHBD 2NN6I 1SXTA 1J5EQ 2AHOB 4DR2L 3PMFA 4OO1G 1UEAB 3Q8DA 2A74C 2KHSA 2VB3X 3GTQB 5EBDA 2MNAA 1Q82C 4YCVA 3HOWH 4A3BG 4V0BA 3TMEA 3GQBA 4K8IA 3S1QB 4B3RL 1FR3A 1AE2A 4A76A 3EN2A 4G7OC 2R93H 4JI3Q 1JWUD 3J81E 3FEWX 1EUJA 1IHZA 1SNCA 4DPGA 2SEBD 4DR5Q 4C3HG 3D6WA 3S15H 2KOLA 1Y1WB 3RUZA 5C0XH 1PH1A 1TVXA 2ZTDA 2G5DA 2XRQD 3BZDB 5JAVA 4IN3A 2CQAA 5M3MH 4X3UA 4L5TA 3AFPA 3KF8A 4NKLA 2PQAA 1FL0A 4RCOA 1VQLA 1SRUA 1STNA 3STBD 1DD2A 2VS1A 2K04A 3HOZH 1JORA 1D5ZC 1E2VA 4C3JB 1QVCA 1KNAA 2SOBA 4DF7A 3CRKC 1JWMD 4QY7A 4QIWB 2C5CA 1H9SA 1SE2A 1NE3A 3MFGA 1WTWA 1UE7A 1AP0A 1QUQA 4NXNL 4DR1L 2DN8A 4E6IA 1E22A 4ZK9B 3KYHC 3DWAA 3Q23A 1UAPA 2FJ2A 1A3UA 1N32Q 3S2HB 3U58A 5IE8A 4FF3A 2KEEA 1RF2D 2UUBQ 3TP7A 2HDMA 3K5MA 4KY6A 3TZDA 1YJNA 4KKTA 3Q0AA 2B2VA 5LMUQ 3E5SA 4MNOA 2A19A 5EQ0A 4F7XA 4H13C 4YWLA 4YHHL 2A1AA 3T16A 3LWUA 1XNQQ 3FMCA 5IOCA 1IW7D 4AIMA 1N34L 3HOYG 2VL6A 1D2BA 2JA8H 2B2WC 3NUCA 1EEID 5C4XB 5KYLA 4G7ZC 2WKCA 3K6OA 1G6ZA 4JI7Q 4LF4L 3T1HQ 5DNFA 2WACA 4DKAC 1I3QH 2B2TC 1UWVA 4DN4M 5M5WH 3STBC 3QJYA 4BXXH 1N36Q 5EKKA 4IPGA 3OHXC 4C1NI 1VMPA 1NTGA 1ENCA 1YNND 1SNMA 3H09A 5IYCG 4XTCS 3URYA 1WTRA 1PH4A 3TP6A 3G4SA 3VR2A 2RHQB 1YZ6A 4X3TA 4APVA 1Y1WG 3DMUA 4X64Q 4JC0A 1LACA 2RVLA 1SJED 4EQNA 2M9VA 3RLNA 3VR4A 1PH2A 4X62Q 3T4AC 1B70B 3NBIA 4BY1B 3KDFB 3RR5A 3A55A 4HEDA 2YTYA 4ZCKA 4C3JG 3M4PA 4G7HC 2QEXA 4FF2A 3TP8A 2HDLA 2BH8A 3OW2A 1G291 1QG7A 4L5QA 3RZDH 3HKZE 1F2YA 5J39A 2VQFL 3OPOA 3M4YA 3W1GA 2RA4A 3S1MH 4GKJQ 2JEBI 4DV3L 3E9IA 1TKWB 3J7A5 3KJOA 3TQYA 2N78A 4AYBE 1IL8A 1UE6A 4ZUJA 3J7ZC 2J0TD 4DXGA 5KRUA 1IW7C 4CKBA 4PNYA 1X32A 1GVPA 3NXWA 5FLMH 2B2UA 1FGUA 3EFXD 1AE3A 5I6WA 5CC4A 1TT2A 2NVYH 1MI2A 5ELBA 3KUPA 1SMXA 3MA2B 4RKBA 5KNBA 4DV4L 4JI8L 2ID0A 1I6HB 3NQIA 1F9RA 4DGZA 2JP1A 4PMWA 1IBKQ 1F9SA 2MHVA 4DA2A 5BR8Q 3KF6B 2J7ZA 3H6MA 2F3VA 4UAIA 2N3SA 3AU7A 4GNXA 1GO3E 2D2CC 2XVSA 3QOLA 4RWSC 4DV5L 2MUYA 5C4XG 4KHVA 1PRTB 4JBMA 5IWAL 2IY5B 2N8NA 3O13A 4IPCA 5JEAH 1A3VA 2EYLA 2JJQA 4RAUC 1K83H 3MHBA 2NZHA 1XJVA 3LNNA 1JE4A 2DY7A 2R7ZB 4EQPA 1YIJA 3T1YQ 3BZKA 5IIFA 2JN4A 2Y0SE 1CUKA 4H44C 1F2MA 5GAHC 1RTOA 3S16B 4BY7H 4JYAL 5CGKA 2NVQH 1TR5A 2I46A 2SDFA 1VQFA 1WTPA 1T5EA 3PO2H 4BY1G 4H7BA 2KJXA 3K57A 4JI6Q 3HKZB 3E6ZX 1ET6A 2E8GA 1WCMB 1VQ4A 1SYGA 4GOPB 4AYBB 4C3IB 4IFDH 2HHHL 3KLWA 3H0GH 4BBRH 2G9HD 5K36G 1TU2B 4LF9L 1RKNA 1PZID 1JJCB 4X65L 5C0XJ 1MJEA 4KHZA 3K58A 1B7YB 3G48A 1HZBA 4A3IG 2Z0SA 4OIJA 1U4LA 5CV4A 3HS0C 1HNXL 4A3DH 1JJ2A 1HCZA 3RZOH 3NE5B 2D0PA 1QZGA 2SNSA 4HJAA 1IBLQ 4GN5A 2WIIB 2EYHA 4GLVB 3SR1A 4XDXA 4P71A 5IT9L 4HIDA 3I4OA 1BDOA 2A6ED 4A3LH 3W5OA 2OXPA 4GS3A 2YU9B 2NTTA 2Z8LA 1RODA 3I2ZA 4DAVA 3A8JE 2VUMB 2B2YC 1MSHA 1NCVA 1NNXA 2B39A 4IUUA 5C44B 1XTCD 1VQPA 1C7YA 1I4QA 3PV0A 5M9OA 4KJOA 4DAYA 3PIOA 4LF5Q 2LMCB 2B63B 3GTLB 5IT9E 2B8FA 4I65A 3OTOQ 3HRZC 4QJFA 1Y1VH 4YY3L 3DWPA 4ALPA 5D14A 5ELDA 3PUZA 4HJ7A 5C0XI 3AB9A 3UI2A 2ZM6L 2PNHA 5C44H 4K0KL 2NVTB 2E2JB 1YVCA 3K59A 2Y0SB 5I2YA 1VQ9A 1IYVA 4HIOA 4R4IA 4Y7NB 3OWFA 2R7ZG 5M5XB 1O80A 3G7LA 2ASBA 4IPHA 2OF1A 4R4QA 2F4VL 4DV1L 1H9MA 1HNWQ 3TS2A 2CQOA 2AUJD 3TN2A 1DOKA 4QCLA 4DR7L 2NVTH 2K01A 4Z9CB 5M3FB 1GHJA 3HKZG 4ULLA 3NWTA 4CDFC 4DUZL 3CF5A 1WCMG 3TRZA 5GQOA 4R8NA 4AYBG 4C3IG 2ICIA 4TVAB 1QNKA 3CPFA 3V2TA 2IHFA 2A6EC 2VNUD 1PLFA 4FF1A 2Z6BA 1OTCA 1VS0A 1EFID 5C3EH 1QE6A 4P72A 5CV5A 3CP0A 2E5LQ 4JPBW 2LXJA 1RCVD 3BDCA 1CI3M 1Q86C 3DWQA 4I7AA 5KEEA 3TP5A 1EYCA 3K7AH 2XWBB 4A3MH 3ERSX 1DYQA 1NR2A 4G57A 2WB1B 5AJ3L 1E7ZA 2F0PA 2QW7A 2HCCA 4UPAA 2VUMG 4ZQ3A 1CQFA 1BUVT 3J81c 3D4WA 3ND8A 1VQKA 1HA6A 4HR7B 3BG3A 1GUGA 1KAAA 2B63G 4HIKA 2EY6A 1ONLA 2JA5B 2E2IB 5EKLA 5IODA 3I55A 1IL2A 1NAPA 1FD7D 2OCEA 3I91A 3PIO3 1C8CA 4XYQA 1KDBA 3WOEA 3UDGA 1PH6A 2AMCB 4XQJA 4YIJA 1G2SA 2KENA 3DHQA 3A54A 2ZJRA 2F0QA 2WAQE 1W2BA 2Y0SG 1A15A 4JI1L 3CCMA 4BBSG 3OSOA 3DEPA 3CMAA 1YHBA 5ELFA 3TEHB 1X56A 3SHLA 2K50A 4GKKL 5JEAJ 2HIVA 4K8JA 1A6XA 1I5FA 2F3IA 5M3FG 2X6LA 3H3VH 3GD7A 4FDBA 1KIXA 2ZXPA 3ND9A 2AQ3B 3OMCA 4DV7Q 4KHPQ 1IKLA 2EQSA 1EYGA 2XSCA 4POGA 1PMRA 4KI0A 5FLXE 4JV5L 4ID6A 4P73A 1CFMA 1ASZA 2R92G 2D0OA 3Q6SA 4B9XA 2UUCL 1STYA 4L63B 2F1MA 3SK5A 1EZ8A 3I70A 5IYBG 4NXNQ 3JAML 5AFWA 1HTPA 4DR1Q 1BO0A 2LSSA 3M9BA 1G6PA 4KY5A 3J81j 4KN4C 2R7DA 3K0XA 2WB1G 3QOJA 4L5RC 2NUCA 5COYA 1PZKD 3HOXB 1E2ZA 2QGQA 1F9QA 1SFOH 3R2IA 4LFAL 2EY2A 1WOCA 4F8MA 1LV9A 3R93A 2D9UA 1HUMA 5D3IB 4DK6C 2JA5G 1Q12A 3CAMA 2PZUA 3BVGA 1LUZA 5EGTA 4I7ZC 1IZ6A 5EJWA 1N34Q 3D0FA 3ZYYX 1PYSB 4LF8Q 1O7YA 3EROA 2K75A 2E2HH 3GO5A 3GTOB 1TS4A 3BVMA 3P7JA 4J8QA 5HURA 4ZKBB 4ZLTF 4FXDA 1R9TB 1QWYA 1AZPA 1V8QA 1L1OB 4IFDI 4IJLA 4CJ1B 3CMEA 3CHBD 4LNQA 3A8IE 1TWFH 4NMZA 1P8LA 3ULJA 1XPOA 2CVRA 2RDFA 1DOMA 3L7ZC 5DM73 4OHJA 1HNZQ 3FPPA 4OO1H 2CH4A 2KCMA 3PF5A 5G3LF 3M4QA 2F0WA 3SXHA 4DV6L 4A3BH 1L2FA 4LMQD 1DM0B 4IPDA 2BA1A 2NZOA 4DUYQ 5C5MA 3SK6A 3HZXA 2M2LA 3VR3A 1EY8A 1HZCA 2MO0A 3CCEA 4KTAA 4LF7L 1VMCA 4C3HH 3A7LA 1V1PA 4MIUA 4O1NA 2A6HD 2RCNA 3RMHA 1L1OC 4IOCA 5JVG3 2UXBQ 3J80L 2F0LA 1KLGD 4XIGS 3GTMH 1ML0D 3CQZB 3I7FA 3NENA 1PH3A 2JEAI 3HOXG 4PMCA 4GOPA 5E3FA 4QUFA 4IALA 4S3SA 3KK7A 3W2DA 3HP3A 3FVQA 3ER0A 5HGQA 2V1CC 4MTNA 4AQYL 2CH4W 1J8IA 1J9OA 5ELCA 3PO3B 1JICA 2E2DC 4LJZC 1STEA 1BOSA 1HJPA 1VQDA 2YV5A 4IO9A 4JK1C 3OYYA 5CV7A 1PH9A 4A93B 3I4LA 3CC4A 4ZKCB 1CKMA 4JI0L 1YITA 1VQ8A 2AQ2B 1VQEA 3S1RB 2NVXB 4JI2L 3ITPA 3OIPA 4H0LC 4OONA 5C6AA 5KNCA 2NYZD 2JSOA 2L1BA 3HOYH 5M5YB 1Y8PB 3HKSA 3S14B 4GN4B 2PMZE 2A6HC 2OQKA 2HQEA 1IBML 1SMYD 2NZ1D 3GTQH 2XWJB 3SEBA 4HIMA 2C9OA 2HT1A 1RD9D 1TWCB 5D3DA 1BBXC 3IL8A 1G91A 1O7LA 2OEOA 2O4XA 3EQLC 4AH6A 3S1QH 3TZUA 3K7UC 2D62A 4MN3A 1ASYA 4RCNA 5JOBA 2JA6B 4K5WA 3S14H 2PZWA 3P75A 1JOOA 5IYCH 3PQIA 1JOQA 1OXTA 1QOHA 3JC66 5C3XA 1Y1WH 4HN7A 1TWAB 1NY4A 4DR4Q 3CCRA 1HNXQ 1CKNB 1B1ZA 3CU7A 3PUVA 2GA4B 2EZVA 2BCOA 1D6EC 3SE0A 4P75A 1H95A 4LF6Q 2A5HA 1EOTA 2FFKB 2RDGA 1OXXK 4C3JH 4DV2Q 4ME5A 3MWYW 3GTKB 5LMNL 3J80i 1TWAH 4CBVA 3PO3G 3I56A 2UUAL 3Q22A 5C5LA 4R8IA 1EWIA 2F3WA 2L12A 4K2LA 1KRTA 4X66Q 3M3YB 2EIFA 2D5DA 3NTKA 1T9HA 1EFWA 1FNVA 1SE4A 2EYMA 2BH2A 3S2HH 1VQHA 4A75A 4RHRA 2I5MX 4A93G 3G71A 2IT1A 5CV9A 4KLKA 4NXMQ 1J6QA 3GTKH 3H3VI 2KECA 3MVVA 1LO5D 1SMYC 1K8OA 4LWCA 3A56A 1UE1A 3GP7A 3ERQA 1B8AA 2UU9Q 3MEFA 3K5OA 4LAAA 4CHTB 5H1SE 1D1IA 1Q1EA 4GLXA 2E76C 1HXYD 2L0CA 3OIQA 2H4OA 4B3TL 1ILQA 1GJXA 2PMZB 1KRSA 1V1QA 3ICEA 1WTXA 1BF4A 4JI4Q 2OTLA 2IL8A 3M7GA 1PA6A 5C4XH 2ICEC 3H91A 1C48A 4DR7Q 2Z4IA 1AFPA 1Q8IA 4POFA 2Z6KC 1I50B 2DUDA 2EE1A 3RD4A 3M4OB 3A74A 2HD3A 4LFCQ 3BYTB 3SGIA 4RMFA 5E7NA 1I6VC 1BBUA 2JA6G 3FKIB 1PV4A 1D7QA 1K73C 2B29A 3E0JA 1K0RA 1EQTA 4JVZA 2A8VA 1E2WA 4L8JA 1AH9A 1FYCA 2K28A 1HZ9A 2Q2IA 1PHJA 2AWNA 2G9DA 3K80C 1XPRA 4BY1H 1TWGB 4JOIC 4A3IB 3IKJA 3FRPB 3C3LA 1QJOA 1DZ1A 4Y52H 3J7YW 3S1NB 3PUWA 1FNWA 2BA0A 2UXDQ 1UE5A 2C35B 5K36H 1H9RA 1SAPA 2EXDA 2R6GA 5C3WA 1XMQL 2RKSA 4FXKC 4A3IH 2O5IC 2OTJA 1JB3A 1VQBA 4ZRZA 4B3ML 3BYYB 4IJHA 1XNRL 1YNNC 4PZ6A 4WRDA 1EIFA 4B9WA 5JJLA 4DV0Q 4OO1I 1HA5A 5FLXc 1I6HH 3PSIA 4IUTA 1TIID 4NP5A 3HOUG 1D8LA 4UDUC 5BN3A 2EJFC 1DXMA 3CCQA 5CMDA 2WP8J 5FOBB 2WINB 3MTSA 3W1BA 3FHWA 2K5QA 3BDOA 1OXUA 2ZJPA 1IYUA 1L0XB 5A35A 1NJIC 3SVMA 3J7AV 4LUVA 3CXCA 1J5EL 5I4DA 3A7AB 3NWSA 3FDTA 4KK7A 3AQQA 3D31A 3FKIG 1Z7TA 2K33A 3MFYA 4LK1C 2VQEQ 3FP9A 2F0JA 1NBWA 3TDQA 2R7ZH 1BCPD 4IUNA 5D65A 3KLRA 4CDEC 3T51B 5C4ZA 1SROA 1X3EA 1PTOD 3S16H 1JWSD 1KTKA 1CSPA 4F87A 4PZ8A 1X65A 1LM0A 3NBHB 5DM63 4JW0A 1HH2P 4HMIA 4QQBX 4A3CG 2R3ZA 1WCMH 1BCPB 4C3IH 4C1NK 1B44D 1K8MA 3UDIA 3U9SA 3K5LA 3CW2C 1QCBD 2E75C 1XXGA 1PVOA 1PFBA 4LFAQ 1VQOA 2JA9A 5EAYA 2ZXOA 3IAYA 4WJWA 3DEOA 2WB1E 4NDXA 3VR6A 5LHY1 1STAA 4G4KA 2I5LX 4B3SQ 1YNXA 2OT2A 1E0BA 1I4PA 1PDQA 4JBJA 2MQHA 1YEZA 1GUTA 3OMGA 1U4RA 1X3FA 4YCWA 2YU9H 1B53A 1K9MC 4WFN3 1SYBA 5JEAG 3NPPA 1SSOA 3OW7A 4OWXB 2VUMH 1C9OA 5LMUL 1SLJA 2Q8TA 3K81C 1BCPC 1LTSD 3MXNA 4L5SA 2FHTA 2KCCA 2F0TA 2F0IA 4BBSB 2I5HA 2B63H 3GTLH 1EEFD 5ISRA 1PTOC 3S24A 1Q8KA 1WI5A 2L9HA 3GTPB 4FP5D 1XYIA 3F1ZA 4JI7L 1U9RA 3T1HL 3UE1A 2E2JH 2RF4A 2EVBA 5IP7G 2XNAC 4Y7NH 4XT3B 5M5XH 4DV6Q 2LY7A 4A3EB 5DLQE 3KF8B 1S5BD 3F2DA 1N36L 2MGSA 1TS2A 2VZAA 1YJWA 3SDZA 5GAGC 1SYFA 2OQ0A 1LT5D 4X3KA 2EYJA 1GD7A 5M3FH 2R92B 3TSSA 2CWAA 1YHQA 5IP9G 5NUCA 4DR6Q 2DJGC 1GUOA 2DGYA 2EYOA 1SYCA 1E24A 4BS9A 4OWWB 1LTGD 2EOTA 3BZCA 2K5WA 1BVSA 4NW2A 2VW9A 3U50C 1B4OA 1V1OA 4A3LG 2F0DA 1CZWA 3KBGA 4ZUIA 2EJMA 2A73B 2B2WA 2F0SA 4GKJL 1K3BC 1TY0A 1VQJA 2GVAA 2MO1A 4PG3A 2WKDA 4LUOA 4A3JB 5GROA 5IYBH 2NB0A 1XMOL 4CGYB 5JJKA 1E1TA 1QVFA 2JE6I 1ZXTA 2B2TA 1VDZA 1O7ZA 2CW0D 1KXLA 2IJ0A 1EQQA 4IUPA 3D4RA 3D6CA 1K8GA 1A63A 4K5XA 3FPUB 3GTGB 4RKLA 2P5ZX 4UP9A 5IYDG 4DR2Q 2QEJC 3EVQA 3Q24A
chains in the Genus database with same CATH topology
3CCEA 4AIMA 1N34L 1IBKL 2VL6A 3HOYG 4LF7L 5FLMG 4C3HH 2JA8H 2JK8A 2Z6KA 4JI2Q 2GN5A 2E2IH 2JA5H 2RCNA 4IOAA 1L1OC 4IOCA 3TREA 4JI7Q 3T1HQ 4LF4L 2UXBQ 4B3RQ 3VDYA 4XIGS 4DKAC 1I3QH 3GTMH 3E9HA 3I7FA 1UWVA 3NENA 1QVGA 1PH3A 3HOXG 4UY8C 2JEAI 2MFIA 2XTIA 5IP9H 5M5WH 3STBC 4DR4L 4GOPA 4BXXH 4UP7A 1N36Q 2AKWB 1M90C 1N33Q 2B3GA 4H02A 2NN6G 4IPGA 2YTVA 1E1OA 5FJ8G 1NTGA 5IYCG 4XTCS 3ER0A 5HGQA 4A3EG 2V1CC 4LF6L 4MTNA 1PH4A 1N32L 4AQYL 3G4SA 4DV2L 4O2DA 2RHQB 1YZ6A 4APVA 1Y1WG 2R7FA 2FXQA 4JOIA 2UUBL 4X64Q 5JJIA 4JC0A 1X9NA 1HJPA 3RLNA 1VQMA 3B6YA 3M85A 2WFWA 1VQDA 3T1YL 1M1KC 1PH2A 4X62Q 2YV5A 1BKBA 1VQNA 4IO9A 1B70B 4LW1A 1HR0Q 3OYYA 3KDFB 3EBEA 3RR5A 4X66L 2GVBA 1PH9A 2YTYA 3CC4A 4YWMA 3M4PA 1S40A 1FJGQ 2QEXA 1CKMA 4GOPC 4JI0L 1RIPA 2BH8A 3OW2A 4TQUS 1G291 2ALYB 2L15A 4L5QA 1YITA 1VQ8A 3RZDH 3HKZE 4IFDJ 2VQFL 1XNQL 4NXML 3W1GA 1VQEA 3S1MH 4GKJQ 2JEBI 4DV3L 3E9IA 3GDEA 2AWOA 3KDFA 3KJOA 3J7A5 4JI2L 3TQYA 2N78A 4OX9Q 4BA2I 4AYBE 4EQ5A 2UU9L 1X55A 1UE6A 3J7ZC 3NEMA 4OONA 1CSQA 4BY7G 5IYDH 2K5VA 4O0AA 3HOYH 1N9WA 3PO2G 1GVPA 4JBWA 4A3JG 1KD1C 5FLMH 4BBSH 3HKSA 1FGUA 1MKHA 1AE3A 4X6AH 4GN4B 2PMZE 2NVYH 3J80c 1SMXA 2OQKA 2PQAB 4YHHQ 1IBML 4JI4L 4JCVE 4R4CA 1N33L 3GTQH 4DV4L 4IFDG 4HIMA 3E0EA 3H0GG 4JI8L 2ID0A 4BBRG 2KCTA 4JI5Q 2HT1A 1JJGA 3GTPH 1S72A 2CFMA 3HOXH 4PMWA 1IBKQ 2KHJA 1WJJA 1EOVA 5BR8Q 3KF6B 4AH6A 4LF7Q 3S1QH 3RLOA 3K7UC 1NMFA 2D62A 3AFQA 1QUQB 1ASYA 4X64L 3S14H 1K8AC 5FJ8H 4A3DG 4LF4Q 2N3SA 4LFCL 3U4ZA 4GNXA 5IYCH 1GO3E 3A5UA 4DV5L 4A3EH 4X62L 4GLAC 4DAMA 5C4XG 3CCSA 1OXTA 3JC66 1IXRA 1HR0L 3UDXA 1Y1WH 3KF6A 1NY4A 1EQRA 3DLLA 1FJGL 4DR4Q 3CCRA 1HNXQ 4JBMA 1CKNB 5IWAL 4LF5L 2R92H 2IY5B 1SR3A 2N8NA 3PUVA 4IPCA 2IHEA 4WJ4A 2CWPA 4P75A 3OTOL 4LF6Q 1H95A 1GKHA 1MJCA 2JJQA 1K83H 4AQYQ 3GTOH 1OXXK 4C3JH 2CCZA 4DV2Q 4OX9L 2NZHA 1YHAA 1XJVA 2VY3A 3PGZA 1CKNA 1R9TH 5LMNL 3J80i 1HZAA 1TWAH 4QGUA 1YIJA 2I0QA 3T1YQ 3PO3G 3BZKA 1JMCA 3I56A 4GNXC 2Y0SE 1CUKA 2UUAL 1HR0W 1EWIA 1KRTA 4X66Q 1Y1VG 2EIFA 5GAHC 2UXDL 1JE5A 1T9HA 1EFWA 3CD6A 4BY7H 4JYAL 2IX1A 1U0LA 2YYZA 2RHSB 2NVQH 1VQFA 2BH2A 1VQHA 4A75A 3S2HH 3L2PA 4JI0Q 4BY1G 4JI5L 3PO2H 2I5MX 4A3JH 3HFZB 1PH5A 4JI6Q 1UEBA 3G71A 4A93G 2IT1A 4NB3A 5C44G 2VQFQ 3H3VI 4KLKA 4NXMQ 1J6QA 3GTKH 4DV3Q 2E8GA 5BR8L 3PIPA 3K8AA 2HIXA 3L0OA 1VQ4A 1VQCA 4LWCA 1UE1A 4YWKA 4GOPB 1B8AA 2UU9Q 1VQGA 2HHHL 3KLWA 3H0GH 3MEFA 4BBRH 4WJ3M 5GAEC 1O7IA 5K36G 4LF9L 1MIUA 5H1SE 5C0XJ 1JJCB 1Q1EA 4X65L 4GLXA 4A4IA 4DV0L 3GTGH 1MJEA 4KHZA 1B7YB 4B3TL 3G48A 1HZBA 1KRSA 1V1QA 4A3IG 2Z0SA 3ICEA 1SE8A 3KFUA 1HNXL 4A3DH 4JI4Q 4DK3C 1JJ2A 3JAMi 1IBMQ 1TXYA 1VQ5A 2OTLA 1PA6A 3RZOH 4LFBQ 4DV4Q 2D0PA 1QZGA 4P74A 1V9PA 2K14A 4JI8Q 5C4XH 4HJAA 3I4NG 1IBLQ 4GN5A 1V43A 1PYBA 1WFQA 4DR7Q 4GLVB 4POFA 2Z6KC 3CQZH 4P71A 4B3MQ 1X54A 2DUDA 4R1JA 3I4OA 4HIDA 4HJ9A 1XNRQ 3A74A 4A3LH 1VQIA 3W5OA 4GS3A 5C3EG 1YI2A 4LFCQ 4DV5Q 1K3RA 3SGIA 3ZJYC 3I2ZA 4RMFA 5E7NA 1BBUA 1OXSC 2JA6G 3KOJA 1TWHH 1HNWL 1PV4A 1D7QA 4A3FG 1K73C 2B29A 2QA4A 1C7YA 1X3GA 1K0RA 1VQPA 3M7NA 4UP8A 2Q2HA 3PV0A 5IWAQ 3PIOA 4LF5Q 1RL2A 1C0AA 3PO3H 2XGTA 4JI6L 4A3MG 2A8VA 4PZ7A 3OTOQ 2VQEL 3U4VA 4QJFA 2YTXA 1Y1VH 4J15A 1AH9A 4YY3L 1PH8A 3BJUA 4ALPA 1HZ9A 3PUZA 2Q2IA 1PHJA 4HJ7A 2AWNA 3K80C 5C0XI 1XPRA 4BY1H 2HQLA 2ZM6L 4BA1I 4JOIC 2PNHA 5LMNQ 4A93H 5C44H 3RN2A 3CC2A 4K0KL 1XTDA 2UXCQ 5J3BA 1YVCA 4MZ9A 4Y52H 2UUAQ 1VQ9A 4HIOA 3EIVA 4R4IA 3PUWA 3RN5A 2BA0A 1EIYB 2R7ZG 2UXDQ 1UE5A 2ASBA 4IPHA 1LYLA 2C35B 4R4QA 3S1RH 4DV1L 2NVXH 2F4VL 4JYAQ 4LFBL 1HNWQ 4GNXB 4DNIA 1IBLL 3TS2A 2CQOA 2EXDA 2R6GA 1XMQL 3CCVA 4DR3Q 2PI2A 1GM5A 1A62A 4A3IH 2OTJA 4DR7L 5M5YH 2NVTH 1WYDA 1VQBA 2ZTEA 1A8VA 4B3ML 3PUYA 3HKZG 4IJHA 2HHHQ 1XNRL 4PZ6A 3I4NH 1EIFA 1VCIA 3GTJH 4DUZL 3CF5A 1WCMG 4LF9Q 3TRZA 2ATWA 5GQOA 4X65Q 4AYBG 5JJLA 4DV0Q 5IT9c 4TVAB 1Q1BA 3CPFA 5FLXc 1TWCH 1QZHA 4OO1I 3PSIA 2ZJQA 4B3TQ 1I6HH 2IHFA 4DV7L 2VNUD 4B3SL 1OTCA 4KHPL 1VS0A 1KL9A 4R4OA 5C3EH 4P72A 3HOUG 1D8LA 3CP0A 2E5LQ 2JA6H 2LXJA 4RG1A 3PCOB 3CCQA 1Q86C 1VQ7A 2JA7G 2WP8J 4A3FH 1XPUA 3CC7A 3W1BA 1PFSA 3FHWA 1KHIA 3K7AH 1OXUA 1IYJB 2ZJPA 1KAWA 2K5HA 1CKOA 3CPWA 4A3KG 4A3MH 1NJIC 3ERSX 2N49A 1SN8A 2UXCL 1YJ9A 3F2CA 4ME3A 4NPSA 2PI2E 3I4MG 2F52A 4OXPA 2CKZB 4LUVA 5ELOA 4EX5A 3CXCA 1J5EL 4GN3B 2ZTCA 5AJ3L 1E7ZA 1G51A 1DGSA 1X6OA 3AQQA 3D31A 4UPAA 3FKIG 5C4JH 2VUMG 3J81c 4A3GG 4DR3L 2VQEQ 3FP9A 1VQKA 4YY3Q 1NBWA 2R7ZH 3HOVG 3S17H 3KJPA 2B63G 3A5ZB 5IY0A 4HIKA 1SROA 1X3EA 2ZM6Q 5LMNW 3I55A 3M3YH 1L0WA 3S2DH 1IL2A 3S16H 3A0JA 1CSPA 4K0KQ 4PZ8A 2OCEA 1PH7A 1JT8A 3UDFA 1X65A 1LM0A 3NBHB 3HOWG 2KHIA 3UDGA 1Q7YC 1PH6A 2AMCB 1W3SA 3PF4A 3WWVA 2KENA 1HH2P 1S3OA 1NMGA 2ZJRA 1YBYA 4A3CG 4QQBX 2WAQE 1W2BA 2F4VQ 2Y0SG 4DV1Q 2E5LL 1WCMH 4JI1L 3CCMA 1A0IA 4BBSG 2R93G 4JBKA 4C3IH 3CMAA 1XMQQ 4LF8L 4DR6L 3UDIA 1Q46A 1YHBA 2H5XA 4C2MH 2K5NA 3TEHB 1X56A 3CW2C 2K50A 1P16A 3HOUH 4GKKL 1PVOA 4DAYB 4LFAQ 5C0XG 1VQOA 1Y14B 2JA9A 4QIWE 5EAYA 2HIVA 4QL5A 5JEAJ 4DUZQ 4HJ8A 1I5FA 5HY6A 3H15A 3F2BA 3TS0A 2Q2TA 2JA7H 1U5KA 1LTLA 2F3IA 2JQOA 5M3FG 3H3VH 2LXKA 3GD7A 4FDBA 2WB1E 5M3MG 1KIXA 3J81i 1E3PA 3NELA 4DV7Q 4B3SQ 2I5LX 4KHPQ 1YNXA 4A3KH 3HOZG 3CCLA 2EQSA 1EYGA 2KBNA 4POGA 4JBJA 2MQHA 3I4MH 1YEZA 4KI0A 1I50H 4JV5L 3MXNB 1HNZL 3M4OH 1X3FA 4YCWA 2YU9H 2WAQG 3AYHB 1Q81C 4P73A 1ASZA 1K9MC 2R92G 1JB7A 2D0OA 5JEAG 3FKIH 2UUCL 4OWXB 1KC8C 1C9OA 5LMUL 3LGJA 1I94Q 2VUMH 1FVIA 1SLJA 4A3GH 3K81C 4R4TA 5ELNA 3HOVH 4L5SA 2NN6I 1Z47A 5IYBG 1Z9FA 4NXNQ 2I5HA 3RLFA 4DUYL 1J5EQ 4DR1Q 2LSSA 3M9BA 5AJ3Q 2B63H 2AHOB 4DR2L 1VQ6A 3GTLH 4OO1G 1G6PA 3Q8DA 2K52A 3J81j 2Q2UA 3RNUA 3S24A 1Q8KA 2R7DA 3K0XA 2WB1G 4L5RC 2MNAA 1Q82C 4YCVA 3HOWH 4A3BG 3AEVA 1TWGH 1WI5A 1XMOQ 3F1ZA 3UE0A 3T1HL 4JI7L 2UXBL 3UE1A 2E2JH 4A3CH 2QGQA 2RF4A 4A76A 1AE2A 1SFOH 3G6EA 4B3RL 3EN2A 5IP7G 3S1NH 4LFAL 4JI3Q 2R93H 1WOCA 4Y7NH 5M5XH 1EUJA 4DV6Q 4DPGA 4DR5Q 3ULPA 2JA8G 5DLQE 3KF8B 3S15H 3F2DA 1N36L 4DK6C 2JA5G 1Q12A 2VZAA 1YJWA 3CAMA 1LUZA 1IZ6A 1PH1A 5GAGC 1VQAA 1OXVA 2ZTDA 1N34Q 2OQ0A 4JI1Q 3D0FA 1GD7A 5M3FH 1PYSB 5M3MH 2CWAA 4L5TA 3AFPA 5IP9G 1YHQA 4LF8Q 4DR6Q 2PQAA 1FL0A 1VQLA 2DGYA 1SRUA 3STBD 2K75A 4BXXG 2VS1A 1N8RC 2E2HH 3GO5A 3HOZH 1E24A 4OWWB 4GKKQ 1QVCA 3BZCA 1I94L 1BVSA 4QY7A 1BBWA 1NE3A 1L1OB 4LUZA 1UE7A 3BU2A 4IFDI 4IJLA 2VW9A 3CMEA 1QUQA 4NXNL 4LNQA 3PUXA 5GADC 4DR1L 1TWFH 3U50C 2K4KA 1E22A 3F8TA 4A3LG 3KYHC 1P8LA 3ULJA 4GKJL 1VQJA 2GVAA 4PG3A 2MO1A 3JAMc 1XPOA 3CCJA 1N32Q 3U58A 4LUOA 5IE8A 3L7ZC 1L1OA 5GROA 5IYBH 4JV5Q 1HNZQ 2OWOA 4OWTB 1XMOL 5JJKA 1E1TA 2UUBQ 3ULLA 1QVFA 2JE6I 2KCMA 4JG2A 1YJNA 2IX0A 4YCUA 2UUCQ 4JI3L 3PF5A 1KXLA 3IRBA 5LMUQ 1EQQA 3DM3A 3M4QA 4MNOA 2A19A 4DV6L 4HJ5A 4A3BH 1L2FA 4DR5L 1K8GA 1A63A 4YWLA 4YHHL 3CCUA 4IPDA 2BA1A 2NZOA 2A1AA 4DUYQ 4UP9A 5IYDG 5IP7H 4DR2Q 2ES2A 1XNQQ 1HZCA 2MO0A 1KQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE A;  4AIM A;  1N34 L;  1IBK L;  2VL6 A;  3HOY G;  4LF7 L;  5FLM G;  4C3H H;  2JA8 H;  2JK8 A;  2Z6K A;  4JI2 Q;  2GN5 A;  2E2I H;  2JA5 H;  2RCN A;  4IOA A;  1L1O C;  4IOC A;  3TRE A;  4JI7 Q;  3T1H Q;  4LF4 L;  2UXB Q;  4B3R Q;  3VDY A;  4XIG S;  4DKA C;  1I3Q H;  3GTM H;  3E9H A;  3I7F A;  1UWV A;  3NEN A;  1QVG A;  1PH3 A;  3HOX G;  4UY8 C;  2JEA I;  2MFI A;  2XTI A;  5IP9 H;  5M5W H;  3STB C;  4DR4 L;  4GOP A;  4BXX H;  4UP7 A;  1N36 Q;  2AKW B;  1M90 C;  1N33 Q;  2B3G A;  4H02 A;  2NN6 G;  4IPG A;  2YTV A;  1E1O A;  5FJ8 G;  1NTG A;  5IYC G;  4XTC S;  3ER0 A;  5HGQ A;  4A3E G;  2V1C C;  4LF6 L;  4MTN A;  1PH4 A;  1N32 L;  4AQY L;  3G4S A;  4DV2 L;  4O2D A;  2RHQ B;  1YZ6 A;  4APV A;  1Y1W G;  2R7F A;  2FXQ A;  4JOI A;  2UUB L;  4X64 Q;  5JJI A;  4JC0 A;  1X9N A;  1HJP A;  3RLN A;  1VQM A;  3B6Y A;  3M85 A;  2WFW A;  1VQD A;  3T1Y L;  1M1K C;  1PH2 A;  4X62 Q;  2YV5 A;  1BKB A;  1VQN A;  4IO9 A;  1B70 B;  4LW1 A;  1HR0 Q;  3OYY A;  3KDF B;  3EBE A;  3RR5 A;  4X66 L;  2GVB A;  1PH9 A;  2YTY A;  3CC4 A;  4YWM A;  3M4P A;  1S40 A;  1FJG Q;  2QEX A;  1CKM A;  4GOP C;  4JI0 L;  1RIP A;  2BH8 A;  3OW2 A;  4TQU S;  1G29 1;  2ALY B;  2L15 A;  4L5Q A;  1YIT A;  1VQ8 A;  3RZD H;  3HKZ E;  4IFD J;  2VQF L;  1XNQ L;  4NXM L;  3W1G A;  1VQE A;  3S1M H;  4GKJ Q;  2JEB I;  4DV3 L;  3E9I A;  3GDE A;  2AWO A;  3KDF A;  3KJO A;  3J7A 5;  4JI2 L;  3TQY A;  2N78 A;  4OX9 Q;  4BA2 I;  4AYB E;  4EQ5 A;  2UU9 L;  1X55 A;  1UE6 A;  3J7Z C;  3NEM A;  4OON A;  1CSQ A;  4BY7 G;  5IYD H;  2K5V A;  4O0A A;  3HOY H;  1N9W A;  3PO2 G;  1GVP A;  4JBW A;  4A3J G;  1KD1 C;  5FLM H;  4BBS H;  3HKS A;  1FGU A;  1MKH A;  1AE3 A;  4X6A H;  4GN4 B;  2PMZ E;  2NVY H;  3J80 c;  1SMX A;  2OQK A;  2PQA B;  4YHH Q;  1IBM L;  4JI4 L;  4JCV E;  4R4C A;  1N33 L;  3GTQ H;  4DV4 L;  4IFD G;  4HIM A;  3E0E A;  3H0G G;  4JI8 L;  2ID0 A;  4BBR G;  2KCT A;  4JI5 Q;  2HT1 A;  1JJG A;  3GTP H;  1S72 A;  2CFM A;  3HOX H;  4PMW A;  1IBK Q;  2KHJ A;  1WJJ A;  1EOV A;  5BR8 Q;  3KF6 B;  4AH6 A;  4LF7 Q;  3S1Q H;  3RLO A;  3K7U C;  1NMF A;  2D62 A;  3AFQ A;  1QUQ B;  1ASY A;  4X64 L;  3S14 H;  1K8A C;  5FJ8 H;  4A3D G;  4LF4 Q;  2N3S A;  4LFC L;  3U4Z A;  4GNX A;  5IYC H;  1GO3 E;  3A5U A;  4DV5 L;  4A3E H;  4X62 L;  4GLA C;  4DAM A;  5C4X G;  3CCS A;  1OXT A;  3JC6 6;  1IXR A;  1HR0 L;  3UDX A;  1Y1W H;  3KF6 A;  1NY4 A;  1EQR A;  3DLL A;  1FJG L;  4DR4 Q;  3CCR A;  1HNX Q;  4JBM A;  1CKN B;  5IWA L;  4LF5 L;  2R92 H;  2IY5 B;  1SR3 A;  2N8N A;  3PUV A;  4IPC A;  2IHE A;  4WJ4 A;  2CWP A;  4P75 A;  3OTO L;  4LF6 Q;  1H95 A;  1GKH A;  1MJC A;  2JJQ A;  1K83 H;  4AQY Q;  3GTO H;  1OXX K;  4C3J H;  2CCZ A;  4DV2 Q;  4OX9 L;  2NZH A;  1YHA A;  1XJV A;  2VY3 A;  3PGZ A;  1CKN A;  1R9T H;  5LMN L;  3J80 i;  1HZA A;  1TWA H;  4QGU A;  1YIJ A;  2I0Q A;  3T1Y Q;  3PO3 G;  3BZK A;  1JMC A;  3I56 A;  4GNX C;  2Y0S E;  1CUK A;  2UUA L;  1HR0 W;  1EWI A;  1KRT A;  4X66 Q;  1Y1V G;  2EIF A;  5GAH C;  2UXD L;  1JE5 A;  1T9H A;  1EFW A;  3CD6 A;  4BY7 H;  4JYA L;  2IX1 A;  1U0L A;  2YYZ A;  2RHS B;  2NVQ H;  1VQF A;  2BH2 A;  1VQH A;  4A75 A;  3S2H H;  3L2P A;  4JI0 Q;  4BY1 G;  4JI5 L;  3PO2 H;  2I5M X;  4A3J H;  3HFZ B;  1PH5 A;  4JI6 Q;  1UEB A;  3G71 A;  4A93 G;  2IT1 A;  4NB3 A;  5C44 G;  2VQF Q;  3H3V I;  4KLK A;  4NXM Q;  1J6Q A;  3GTK H;  4DV3 Q;  2E8G A;  5BR8 L;  3PIP A;  3K8A A;  2HIX A;  3L0O A;  1VQ4 A;  1VQC A;  4LWC A;  1UE1 A;  4YWK A;  4GOP B;  1B8A A;  2UU9 Q;  1VQG A;  2HHH L;  3KLW A;  3H0G H;  3MEF A;  4BBR H;  4WJ3 M;  5GAE C;  1O7I A;  5K36 G;  4LF9 L;  1MIU A;  5H1S E;  5C0X J;  1JJC B;  1Q1E A;  4X65 L;  4GLX A;  4A4I A;  4DV0 L;  3GTG H;  1MJE A;  4KHZ A;  1B7Y B;  4B3T L;  3G48 A;  1HZB A;  1KRS A;  1V1Q A;  4A3I G;  2Z0S A;  3ICE A;  1SE8 A;  3KFU A;  1HNX L;  4A3D H;  4JI4 Q;  4DK3 C;  1JJ2 A;  3JAM i;  1IBM Q;  1TXY A;  1VQ5 A;  2OTL A;  1PA6 A;  3RZO H;  4LFB Q;  4DV4 Q;  2D0P A;  1QZG A;  4P74 A;  1V9P A;  2K14 A;  4JI8 Q;  5C4X H;  4HJA A;  3I4N G;  1IBL Q;  4GN5 A;  1V43 A;  1PYB A;  1WFQ A;  4DR7 Q;  4GLV B;  4POF A;  2Z6K C;  3CQZ H;  4P71 A;  4B3M Q;  1X54 A;  2DUD A;  4R1J A;  3I4O A;  4HID A;  4HJ9 A;  1XNR Q;  3A74 A;  4A3L H;  1VQI A;  3W5O A;  4GS3 A;  5C3E G;  1YI2 A;  4LFC Q;  4DV5 Q;  1K3R A;  3SGI A;  3ZJY C;  3I2Z A;  4RMF A;  5E7N A;  1BBU A;  1OXS C;  2JA6 G;  3KOJ A;  1TWH H;  1HNW L;  1PV4 A;  1D7Q A;  4A3F G;  1K73 C;  2B29 A;  2QA4 A;  1C7Y A;  1X3G A;  1K0R A;  1VQP A;  3M7N A;  4UP8 A;  2Q2H A;  3PV0 A;  5IWA Q;  3PIO A;  4LF5 Q;  1RL2 A;  1C0A A;  3PO3 H;  2XGT A;  4JI6 L;  4A3M G;  2A8V A;  4PZ7 A;  3OTO Q;  2VQE L;  3U4V A;  4QJF A;  2YTX A;  1Y1V H;  4J15 A;  1AH9 A;  4YY3 L;  1PH8 A;  3BJU A;  4ALP A;  1HZ9 A;  3PUZ A;  2Q2I A;  1PHJ A;  4HJ7 A;  2AWN A;  3K80 C;  5C0X I;  1XPR A;  4BY1 H;  2HQL A;  2ZM6 L;  4BA1 I;  4JOI C;  2PNH A;  5LMN Q;  4A93 H;  5C44 H;  3RN2 A;  3CC2 A;  4K0K L;  1XTD A;  2UXC Q;  5J3B A;  1YVC A;  4MZ9 A;  4Y52 H;  2UUA Q;  1VQ9 A;  4HIO A;  3EIV A;  4R4I A;  3PUW A;  3RN5 A;  2BA0 A;  1EIY B;  2R7Z G;  2UXD Q;  1UE5 A;  2ASB A;  4IPH A;  1LYL A;  2C35 B;  4R4Q A;  3S1R H;  4DV1 L;  2NVX H;  2F4V L;  4JYA Q;  4LFB L;  1HNW Q;  4GNX B;  4DNI A;  1IBL L;  3TS2 A;  2CQO A;  2EXD A;  2R6G A;  1XMQ L;  3CCV A;  4DR3 Q;  2PI2 A;  1GM5 A;  1A62 A;  4A3I H;  2OTJ A;  4DR7 L;  5M5Y H;  2NVT H;  1WYD A;  1VQB A;  2ZTE A;  1A8V A;  4B3M L;  3PUY A;  3HKZ G;  4IJH A;  2HHH Q;  1XNR L;  4PZ6 A;  3I4N H;  1EIF A;  1VCI A;  3GTJ H;  4DUZ L;  3CF5 A;  1WCM G;  4LF9 Q;  3TRZ A;  2ATW A;  5GQO A;  4X65 Q;  4AYB G;  5JJL A;  4DV0 Q;  5IT9 c;  4TVA B;  1Q1B A;  3CPF A;  5FLX c;  1TWC H;  1QZH A;  4OO1 I;  3PSI A;  2ZJQ A;  4B3T Q;  1I6H H;  2IHF A;  4DV7 L;  2VNU D;  4B3S L;  1OTC A;  4KHP L;  1VS0 A;  1KL9 A;  4R4O A;  5C3E H;  4P72 A;  3HOU G;  1D8L A;  3CP0 A;  2E5L Q;  2JA6 H;  2LXJ A;  4RG1 A;  3PCO B;  3CCQ A;  1Q86 C;  1VQ7 A;  2JA7 G;  2WP8 J;  4A3F H;  1XPU A;  3CC7 A;  3W1B A;  1PFS A;  3FHW A;  1KHI A;  3K7A H;  1OXU A;  1IYJ B;  2ZJP A;  1KAW A;  2K5H A;  1CKO A;  3CPW A;  4A3K G;  4A3M H;  1NJI C;  3ERS X;  2N49 A;  1SN8 A;  2UXC L;  1YJ9 A;  3F2C A;  4ME3 A;  4NPS A;  2PI2 E;  3I4M G;  2F52 A;  4OXP A;  2CKZ B;  4LUV A;  5ELO A;  4EX5 A;  3CXC A;  1J5E L;  4GN3 B;  2ZTC A;  5AJ3 L;  1E7Z A;  1G51 A;  1DGS A;  1X6O A;  3AQQ A;  3D31 A;  4UPA A;  3FKI G;  5C4J H;  2VUM G;  3J81 c;  4A3G G;  4DR3 L;  2VQE Q;  3FP9 A;  1VQK A;  4YY3 Q;  1NBW A;  2R7Z H;  3HOV G;  3S17 H;  3KJP A;  2B63 G;  3A5Z B;  5IY0 A;  4HIK A;  1SRO A;  1X3E A;  2ZM6 Q;  5LMN W;  3I55 A;  3M3Y H;  1L0W A;  3S2D H;  1IL2 A;  3S16 H;  3A0J A;  1CSP A;  4K0K Q;  4PZ8 A;  2OCE A;  1PH7 A;  1JT8 A;  3UDF A;  1X65 A;  1LM0 A;  3NBH B;  3HOW G;  2KHI A;  3UDG A;  1Q7Y C;  1PH6 A;  2AMC B;  1W3S A;  3PF4 A;  3WWV A;  2KEN A;  1HH2 P;  1S3O A;  1NMG A;  2ZJR A;  1YBY A;  4A3C G;  4QQB X;  2WAQ E;  1W2B A;  2F4V Q;  2Y0S G;  4DV1 Q;  2E5L L;  1WCM H;  4JI1 L;  3CCM A;  1A0I A;  4BBS G;  2R93 G;  4JBK A;  4C3I H;  3CMA A;  1XMQ Q;  4LF8 L;  4DR6 L;  3UDI A;  1Q46 A;  1YHB A;  2H5X A;  4C2M H;  2K5N A;  3TEH B;  1X56 A;  3CW2 C;  2K50 A;  1P16 A;  3HOU H;  4GKK L;  1PVO A;  4DAY B;  4LFA Q;  5C0X G;  1VQO A;  1Y14 B;  2JA9 A;  4QIW E;  5EAY A;  2HIV A;  4QL5 A;  5JEA J;  4DUZ Q;  4HJ8 A;  1I5F A;  5HY6 A;  3H15 A;  3F2B A;  3TS0 A;  2Q2T A;  2JA7 H;  1U5K A;  1LTL A;  2F3I A;  2JQO A;  5M3F G;  3H3V H;  2LXK A;  3GD7 A;  4FDB A;  2WB1 E;  5M3M G;  1KIX A;  3J81 i;  1E3P A;  3NEL A;  4DV7 Q;  4B3S Q;  2I5L X;  4KHP Q;  1YNX A;  4A3K H;  3HOZ G;  3CCL A;  2EQS A;  1EYG A;  2KBN A;  4POG A;  4JBJ A;  2MQH A;  3I4M H;  1YEZ A;  4KI0 A;  1I50 H;  4JV5 L;  3MXN B;  1HNZ L;  3M4O H;  1X3F A;  4YCW A;  2YU9 H;  2WAQ G;  3AYH B;  1Q81 C;  4P73 A;  1ASZ A;  1K9M C;  2R92 G;  1JB7 A;  2D0O A;  5JEA G;  3FKI H;  2UUC L;  4OWX B;  1KC8 C;  1C9O A;  5LMU L;  3LGJ A;  1I94 Q;  2VUM H;  1FVI A;  1SLJ A;  4A3G H;  3K81 C;  4R4T A;  5ELN A;  3HOV H;  4L5S A;  2NN6 I;  1Z47 A;  5IYB G;  1Z9F A;  4NXN Q;  2I5H A;  3RLF A;  4DUY L;  1J5E Q;  4DR1 Q;  2LSS A;  3M9B A;  5AJ3 Q;  2B63 H;  2AHO B;  4DR2 L;  1VQ6 A;  3GTL H;  4OO1 G;  1G6P A;  3Q8D A;  2K52 A;  3J81 j;  2Q2U A;  3RNU A;  3S24 A;  1Q8K A;  2R7D A;  3K0X A;  2WB1 G;  4L5R C;  2MNA A;  1Q82 C;  4YCV A;  3HOW H;  4A3B G;  3AEV A;  1TWG H;  1WI5 A;  1XMO Q;  3F1Z A;  3UE0 A;  3T1H L;  4JI7 L;  2UXB L;  3UE1 A;  2E2J H;  4A3C H;  2QGQ A;  2RF4 A;  4A76 A;  1AE2 A;  1SFO H;  3G6E A;  4B3R L;  3EN2 A;  5IP7 G;  3S1N H;  4LFA L;  4JI3 Q;  2R93 H;  1WOC A;  4Y7N H;  5M5X H;  1EUJ A;  4DV6 Q;  4DPG A;  4DR5 Q;  3ULP A;  2JA8 G;  5DLQ E;  3KF8 B;  3S15 H;  3F2D A;  1N36 L;  4DK6 C;  2JA5 G;  1Q12 A;  2VZA A;  1YJW A;  3CAM A;  1LUZ A;  1IZ6 A;  1PH1 A;  5GAG C;  1VQA A;  1OXV A;  2ZTD A;  1N34 Q;  2OQ0 A;  4JI1 Q;  3D0F A;  1GD7 A;  5M3F H;  1PYS B;  5M3M H;  2CWA A;  4L5T A;  3AFP A;  5IP9 G;  1YHQ A;  4LF8 Q;  4DR6 Q;  2PQA A;  1FL0 A;  1VQL A;  2DGY A;  1SRU A;  3STB D;  2K75 A;  4BXX G;  2VS1 A;  1N8R C;  2E2H H;  3GO5 A;  3HOZ H;  1E24 A;  4OWW B;  4GKK Q;  1QVC A;  3BZC A;  1I94 L;  1BVS A;  4QY7 A;  1BBW A;  1NE3 A;  1L1O B;  4LUZ A;  1UE7 A;  3BU2 A;  4IFD I;  4IJL A;  2VW9 A;  3CME A;  1QUQ A;  4NXN L;  4LNQ A;  3PUX A;  5GAD C;  4DR1 L;  1TWF H;  3U50 C;  2K4K A;  1E22 A;  3F8T A;  4A3L G;  3KYH C;  1P8L A;  3ULJ A;  4GKJ L;  1VQJ A;  2GVA A;  4PG3 A;  2MO1 A;  3JAM c;  1XPO A;  3CCJ A;  1N32 Q;  3U58 A;  4LUO A;  5IE8 A;  3L7Z C;  1L1O A;  5GRO A;  5IYB H;  4JV5 Q;  1HNZ Q;  2OWO A;  4OWT B;  1XMO L;  5JJK A;  1E1T A;  2UUB Q;  3ULL A;  1QVF A;  2JE6 I;  2KCM A;  4JG2 A;  1YJN A;  2IX0 A;  4YCU A;  2UUC Q;  4JI3 L;  3PF5 A;  1KXL A;  3IRB A;  5LMU Q;  1EQQ A;  3DM3 A;  3M4Q A;  4MNO A;  2A19 A;  4DV6 L;  4HJ5 A;  4A3B H;  1L2F A;  4DR5 L;  1K8G A;  1A63 A;  4YWL A;  4YHH L;  3CCU A;  4IPD A;  2BA1 A;  2NZO A;  2A1A A;  4DUY Q;  4UP9 A;  5IYD G;  5IP7 H;  4DR2 Q;  2ES2 A;  1XNQ Q;  1HZC A;  2MO0 A;  1KQS A; 
#chains in the Genus database with same CATH topology
 1IBK L;  5LL6 S;  2Z6K A;  4JI2 Q;  2E2I H;  2JA5 H;  3TRE A;  5EBC A;  4B3R Q;  3VDY A;  4RGN A;  5I2X A;  3KLS A;  1WTQ A;  3E9H A;  1PRT F;  4KMU C;  4UY8 C;  5JPN C;  1QVG A;  2MFI A;  4BWG B;  1AW7 A;  1AEX A;  2B2V C;  2XTI A;  2ZXR A;  3L9A X;  2EY5 A;  4UP7 A;  3H94 A;  2AKW B;  3GV3 A;  1M90 C;  4H02 A;  2NN6 G;  1TWH B;  5FJ8 G;  2L11 A;  2XN9 C;  1B9M A;  4A3E G;  1LTI D;  1AN8 A;  3GV6 A;  4O2D A;  2R7F A;  2FIN B;  2FXQ A;  1T5X D;  4JOI A;  2O5J C;  2PCF B;  1EIG A;  1VQM A;  3U9O A;  3M85 A;  3T1Y L;  1MGS A;  1BKB A;  1VQN A;  3OWE B;  1CHP D;  4DU9 A;  2GVB A;  1S40 A;  2NBF A;  2DNE A;  1L0Y B;  4XT1 B;  2ALY B;  2QF7 A;  3G6J B;  1STH A;  4IFD J;  1EWH A;  1BXT A;  4K14 A;  3KDF A;  4BA2 I;  5IGG A;  4EQ5 A;  1X55 A;  1HFN A;  2K5V A;  5IGE A;  3H3V C;  4HMJ A;  4A3J G;  3JAM E;  4X6A H;  4OL7 A;  3I4N B;  5BN4 A;  4YHH Q;  3OOC A;  2K05 A;  4JCV E;  4R4C A;  1N33 L;  3E0E A;  1JJG A;  2H1E A;  3P1H A;  3HOX H;  1S72 A;  2A68 D;  2KHJ A;  1JOK A;  1EOV A;  5F2D A;  3RLO A;  4J1M A;  2RSN A;  3NSW A;  3AFQ A;  1EYD A;  4LF4 Q;  4A3F B;  1AZQ A;  3I72 A;  2MJ8 A;  3A5U A;  2PQE A;  4DAM A;  3CCS A;  2Z4H A;  4TSS A;  1IXR A;  4WOR A;  1HR0 L;  2LKV A;  3KF6 A;  2B2U C;  3DLL A;  1FJG L;  5CV6 A;  1RTN A;  4LF5 L;  1SR3 A;  3N52 A;  3MXU A;  2IHE A;  3N6R A;  4KKU A;  2ZT9 C;  4WJ4 A;  2CWP A;  3OTO L;  3I73 A;  1MJC A;  5E1F A;  4HCE A;  3GTO H;  5C4J B;  2CCZ A;  4OX9 L;  3BDL A;  2VY3 A;  1PXU A;  1R9T H;  1HHV A;  4QGU A;  1TY2 A;  2EPB A;  3S17 B;  1JMC A;  4GNX C;  1MSG A;  2DJF C;  1JCK B;  2KUM A;  1EU4 A;  1JE5 A;  5FO7 B;  1EQV A;  4KD3 A;  3I90 A;  1M4V A;  1U0L A;  2YYZ A;  2IX1 A;  1HNW L;  3QG1 A;  4JI5 L;  1SNO A;  2VXW A;  1PH5 A;  3HFZ B;  3BS1 A;  5JJZ A;  3I8Z A;  4NB3 A;  2VQF Q;  2F0M A;  1BQQ T;  1S5E D;  4DV3 Q;  3HEJ A;  1Y8N B;  2HIX A;  3L0O A;  1VQC A;  4OEL B;  1VQG A;  5GAE C;  1O7I A;  1LTR D;  4C2M B;  2A68 C;  3CRL C;  2B2Y A;  4A4I A;  1SNQ A;  4R9W A;  2F0F A;  1NR4 A;  3KFU A;  1B9N A;  2JA7 B;  4DK3 C;  3JAM i;  1VQ5 A;  3MXG A;  1QNU A;  4DV4 Q;  4RFB A;  1V9P A;  4JI8 Q;  3I4N G;  4Q5V A;  4A3K B;  3J80 E;  1Y8O B;  3NBH A;  3QO2 A;  3I4M B;  3CQZ H;  4B3M Q;  4U68 A;  4R1J A;  5T1I A;  5I9P A;  4KY7 A;  1DCZ A;  1XNR Q;  3R3O A;  5IGF A;  1VQI A;  1U4M A;  4DV5 Q;  1K3R A;  1CHQ D;  2IW3 A;  3S9W A;  3KOJ A;  4A3F G;  4K6D A;  4A3G B;  1X3G A;  1MD2 D;  4UP8 A;  3HOV B;  5IWA Q;  2L4N A;  1RL2 A;  1C0A A;  3PO3 H;  1KAB A;  4FO2 A;  3U4V A;  1LT6 D;  2YTX A;  4J15 A;  4ILW A;  1EIH A;  5DAU A;  5LL6 X;  1VF7 A;  3QWN A;  3HOW B;  4BA1 I;  4A93 H;  3RN2 A;  1XTD A;  1KDA A;  5J3B A;  1A2U A;  1KDC A;  2R93 B;  1RHP A;  2QKI C;  3J81 L;  1ZKO A;  4ZAI A;  3EJI A;  1ZEQ X;  4JYA Q;  3S1R H;  1LYL A;  4LFB L;  2NVX H;  1CA5 A;  3S15 B;  4QF4 A;  4X3S A;  2VB2 X;  1MHW C;  1VF5 C;  1LTT D;  3CCV A;  1GUN A;  5CBA E;  5M5Y H;  5FKA C;  1WYD A;  2XRS D;  1A8V A;  5M3M B;  2HHH Q;  4U67 3;  1JR0 D;  4LF9 Q;  3HOZ B;  1GXD C;  4X65 Q;  5IT9 c;  1Q1B A;  1TWC H;  1QZH A;  4PV1 C;  4DV7 L;  1HTL D;  1QIL A;  4KHP L;  1SJH D;  1KL9 A;  2EY1 A;  1S4Z A;  4PQX A;  3IFD A;  3MXP A;  2JA6 H;  2F0K A;  1VQ7 A;  2JA7 G;  1XPU A;  5E4X A;  1KHI A;  1IYJ B;  1NUC A;  2IPK D;  1EZ6 A;  1HRJ A;  1CKO A;  4A3K G;  4OGQ C;  2WV6 D;  2UXC L;  2A69 D;  1YJ9 A;  2PI2 E;  3I4M G;  5KIX A;  3VR5 A;  4OXP A;  1IKM A;  5ELO A;  1G51 A;  1X6O A;  3MEH A;  1EY6 A;  4HAE A;  3P20 A;  2F4I A;  1WVL A;  1GUS A;  1R4P B;  4DR3 L;  4A3G G;  1ESF A;  4RGM A;  4YY3 Q;  3HOV G;  2JA8 B;  3A5Z B;  1EY0 A;  5IY0 A;  1O78 A;  2ZM6 Q;  4V19 0;  3M3Y H;  1KNE A;  2K7V A;  2Z9H A;  4K0K Q;  2Z1C A;  2F0O A;  2HUG A;  4HSV A;  3HOU B;  1BNZ A;  1I3Q B;  3HOW G;  4RA8 A;  4N9T A;  1S5D D;  1S3O A;  5M5W B;  1YBY A;  2N55 A;  2F4V Q;  4DV1 Q;  2IWH A;  1A0I A;  2LFN A;  1F2L A;  2R93 G;  4JBK A;  1HQR D;  4LF8 L;  2TMP A;  2H5X A;  4FYD A;  1SNP A;  1D5M C;  2NTS A;  3HOU H;  1PYW D;  5C0X G;  1Y14 B;  4OEM B;  4HJ8 A;  4DUZ Q;  5HY6 A;  3H15 A;  3F2B A;  3T53 B;  3TS0 A;  1U5K A;  1LTL A;  2JQO A;  4FF4 A;  2LXK A;  2E74 C;  2F0N A;  3NP8 A;  4OIK A;  5M3M G;  1Q90 A;  3J81 i;  1CM9 A;  5EKI A;  2QDB A;  3NEL A;  1CK1 A;  2EDG A;  1WD1 A;  3C2P A;  3HOZ G;  1D1K A;  5I9O A;  2A69 C;  3CCL A;  1UUP A;  2MPM A;  1F9P A;  1I50 H;  1HNZ L;  4HSP A;  3RZD B;  3M4O H;  2K5D A;  4KJN A;  1SE3 A;  3MAQ A;  1Q81 C;  3S1M B;  4K2K A;  4TRD A;  1JB7 A;  4M8A A;  1ILP A;  3FKI H;  1KC8 C;  1B3Q A;  3LGJ A;  5C4H A;  3J7A F;  4R4T A;  3MZ5 A;  3V05 A;  4EVO A;  1Z47 A;  1Z9F A;  3RLF A;  4DUY L;  4N9P A;  1VQ6 A;  5AJ3 Q;  2F0V A;  3VYR A;  3HG9 A;  2HCI A;  2K52 A;  2NVY B;  2Q2U A;  2QDL A;  4DXF A;  3RNU A;  1EY9 A;  4CKE A;  2BDN A;  1PZJ D;  3AEV A;  1A3T A;  1TWG H;  2KCN A;  1XMO Q;  1ICW A;  3UE0 A;  2UXB L;  3V96 A;  4A3C H;  2RBM A;  1HQM C;  3G6E A;  3S1N H;  2AQ1 B;  3A8K E;  1ENF A;  1I4X A;  2RCF A;  3ULP A;  2JA8 G;  4DFA A;  4KN7 C;  1PFN A;  4IUQ A;  4B08 A;  2X6G A;  1PRT D;  1VQA A;  1OXV A;  2K32 A;  1SYE A;  4JI1 Q;  4N8F A;  4DAP A;  4XQN A;  2KVM A;  2R61 A;  3VYT A;  1TS3 A;  1Z6H A;  1N8R C;  1K83 B;  4BXX G;  2M00 A;  5I6Y A;  4GKK Q;  1EY5 A;  1I94 L;  1BBW A;  4LUZ A;  3BU2 A;  1WTV A;  3PUX A;  5GAD C;  3K5N A;  2K4K A;  2KQ3 A;  3F8T A;  2X69 A;  3VA5 A;  5T1G A;  4BY7 B;  1M8A A;  1RDP D;  2NVQ B;  3JAM c;  3CCJ A;  4IZ8 A;  3PO2 B;  1L1O A;  4JV5 Q;  5FK9 C;  2OWO A;  4OWT B;  2N88 A;  3ULL A;  4O42 A;  1G8Z D;  4HTH A;  4JG2 A;  2IX0 A;  4YCU A;  2UUC Q;  4JI3 L;  3IRB A;  3DM3 A;  2K1B A;  3H0G B;  4BBR B;  1CA6 A;  4HJ5 A;  4DR5 L;  1V1P B;  1F2Z A;  3CCU A;  4QUC A;  3BVZ A;  2JYO A;  5IP7 H;  2ES2 A;  5FO8 B;  1KQS A;  1PFM A;  4A3D B;  3RZO B;  5IGD A;  5FLM G;  2JK8 A;  2GN5 A;  2DNC A;  1STB A;  4IOA A;  4KD4 A;  3DM1 A;  1PRT C;  1PTO B;  3D4D A;  1HFG A;  2K03 A;  2PW5 A;  4DK1 A;  4ZYS A;  5IP9 H;  4DR4 L;  1WTH A;  1GHK A;  1ICF B;  1N33 Q;  2B3G A;  2YTV A;  1E1O A;  4LF6 L;  2PNR C;  1PTO H;  1N32 L;  2SNM A;  1EY4 A;  4DV2 L;  3EA6 A;  1XWE A;  4XXE A;  2UUB L;  5JJI A;  2I07 B;  1X9N A;  1Y1V B;  3B6Y A;  1II3 A;  2WFW A;  1M1K C;  5IGB A;  4LW1 A;  1HR0 Q;  3VYU A;  3EBE A;  4X66 L;  2EXZ A;  5KYI A;  2PPB C;  4YWM A;  5BN5 A;  1FJG Q;  1SND A;  4GOP C;  1RIP A;  1XNQ L;  4TQU S;  1I4R A;  2L15 A;  5G3L D;  3NTI A;  2PO4 A;  1B50 A;  4NXM L;  3GDE A;  2AWO A;  2BDO A;  2O2L D;  4OX9 Q;  2UU9 L;  1GUW A;  4K5V A;  3NEM A;  1HUN A;  1CSQ A;  4BY7 G;  3DXJ C;  5IYD H;  4L6T B;  4O0A A;  3X3M A;  1GOZ A;  1N9W A;  3PO2 G;  4JBW A;  1KD1 C;  1W6K A;  4BBS H;  3C46 A;  1MKH A;  1SEB D;  3J80 c;  4JI4 L;  2PQA B;  3SK8 A;  1ESR A;  4RHS A;  4IFD G;  2NWG A;  3H0G G;  4BBR G;  4JI5 Q;  2KCT A;  4J6H A;  1H9J A;  3GTP H;  1CTM A;  4ODG A;  2CFM A;  5J22 A;  5C3E B;  1WJJ A;  4LF7 Q;  1H9S B;  3LWE A;  1NMF A;  2J4X A;  3MC0 B;  1QUQ B;  2FMM A;  4M1U B;  2NN6 H;  3QR8 A;  4X64 L;  1K8A C;  1X3Q A;  4XQQ A;  5FJ8 H;  4A3D G;  2KED A;  4LFC L;  3U4Z A;  3AMU A;  4A3E H;  4X62 L;  4GLA C;  3K7A B;  1I4G A;  2RQX A;  5DEH A;  3UDX A;  1WD0 A;  3KLS X;  3VA7 A;  3TBI B;  4A3M B;  1EQR A;  5CYU A;  4CDC C;  2R92 H;  2FMC A;  3KBX A;  1I4H A;  3C1F A;  3R2T A;  1BR9 A;  4IQZ A;  3F2U A;  1GKH A;  1DOL A;  1EL0 A;  4AQY Q;  2EYP A;  1YHA A;  1YNJ D;  1FGB D;  3PGZ A;  5KND A;  3T56 B;  1XX8 A;  3ONA B;  1CKN A;  1SYD A;  1HZA A;  1MBY A;  4RH6 A;  2I0Q A;  3DUZ A;  1K28 A;  1HR0 W;  3X3N A;  1B2T A;  1Y1V G;  2UXD L;  3HGB A;  1ET9 A;  2B8G A;  3CD6 A;  3QB3 A;  4Q0F A;  2RHS B;  4UHV A;  4KV6 A;  3L2P A;  4JI0 Q;  4A3J H;  1UEB A;  4K6L A;  5C44 G;  5ELE A;  1LT3 D;  3T13 A;  2F0U A;  2JXM B;  2LS0 1;  5BR8 L;  2PYK A;  3K8A A;  3PIP A;  3NQT A;  5COR A;  4YWK A;  2RDH A;  2F0H A;  2PZT A;  4WJ3 M;  1MIU A;  1JC7 A;  5CV8 A;  4DV0 L;  3GTG H;  2EJG C;  2QCP X;  1SE8 A;  3W3A A;  1S5C D;  5A2Q L;  1IBM Q;  1TXY A;  4LFB Q;  4DNR B;  5HGT A;  4ABN A;  4P74 A;  1LTB D;  2K14 A;  3NK9 A;  1G2T A;  1F77 A;  1ENA A;  5J1Z A;  1SBB B;  1V43 A;  1PYB A;  1WFQ A;  3WDN A;  1DJR D;  1R4Q B;  1X54 A;  1KLU D;  4HJ9 A;  5FLX L;  2RSO A;  4P2C B;  3C1E A;  1YI2 A;  5C3E G;  2ENB A;  5A2Q E;  4CJ2 C;  1S5F D;  3ZJY C;  4RGT A;  1OXS C;  4KKS A;  4C56 C;  1YNJ C;  1TWH H;  1LTA D;  4MTK A;  3I3C A;  2QA4 A;  5JVH 3;  3M7N A;  2Q2H A;  1RJT A;  1CZG A;  2L55 A;  5TSS A;  2CW0 C;  1U4P A;  2XGT A;  3E3X A;  3D8G A;  4A3M G;  4JI6 L;  4PZ7 A;  2VQE L;  2BE5 D;  1PH8 A;  3BJU A;  1Q3L A;  2HQL A;  1A2T A;  3NTH A;  5LMN Q;  2K6A A;  5FO9 B;  3CC2 A;  2UXC Q;  4MZ9 A;  1SFO B;  2UUA Q;  4GZY C;  3EIV A;  1CT1 D;  3NHH A;  3RN5 A;  3GTJ B;  1EIY B;  4PMB A;  1BCP F;  1OO9 B;  4GNX B;  1EYA A;  4DNI A;  1IBL L;  1PTO F;  1X3P A;  5EPL A;  4DR3 Q;  2PI2 A;  1GM5 A;  3WOF A;  1A62 A;  1WTO A;  2ZTE A;  4F88 A;  3PUY A;  4FXG C;  3I4N H;  1NSN S;  2XIW A;  1VCI A;  3GTJ H;  1TQO A;  3D3R A;  2ATW A;  2E2H B;  1C4Q A;  4IUR A;  4B3T Q;  2ZJQ A;  4QMG A;  1W6J A;  4B3S L;  5JPM C;  1CQV A;  4R4O A;  2WAQ B;  3PIP 3;  3CKI B;  4FNF A;  5KGU A;  4EGV A;  1TWF B;  4RG1 A;  1Y69 U;  3PCO B;  4A3F H;  3CC7 A;  1ZYR D;  1PFS A;  4DK0 A;  1SDF A;  4MHE A;  1B3A A;  1KAW A;  2K5H A;  3CPW A;  4FVM A;  5EPJ A;  2N49 A;  1SN8 A;  1LLR D;  2BE5 C;  3F2C A;  4ME3 A;  4NPS A;  5E4W C;  1D5X C;  1EY7 A;  1LAB A;  2F52 A;  2CKZ B;  4EX5 A;  2F03 A;  4GN3 B;  2ZTC A;  3R8B A;  5L37 A;  3S2D B;  4A3B B;  5IGC A;  1DGS A;  1K0S A;  3VYS A;  5C4J H;  3IFT A;  4TKO B;  2DY8 A;  1EU3 A;  2EYF A;  3S17 H;  2L5T A;  3KJP A;  3QIA A;  4C3H B;  2Q8R E;  2V4D A;  5CBE E;  2AUK A;  5LMN W;  1DON A;  1L0W A;  3SK4 A;  3S2D H;  2F0E A;  3A0J A;  4HCS A;  5CR3 A;  1PH7 A;  1JT8 A;  3UDF A;  3GTM B;  2KHI A;  1Q7Y C;  1H9K A;  1W3S A;  3PF4 A;  4CDD C;  3WWV A;  3LX0 A;  1NMG A;  4N8X 1;  2IX3 A;  2Q8I B;  2E5L L;  4RGO S;  1XMQ Q;  1JQY D;  2QIL A;  5EPK A;  1QB5 D;  4DR6 L;  1Q46 A;  1EWC A;  4C2M H;  2K5N A;  2PW7 A;  2BOS A;  1P16 A;  4IUV A;  4DNT B;  4DAY B;  1LT4 D;  1FNU A;  5K5P A;  1HPC A;  4QIW E;  4QL5 A;  1STG A;  2Q2T A;  2JA7 H;  4EQO A;  1ZYR C;  3L3O C;  4XYO A;  1TS5 A;  1E3P A;  4QB4 A;  4A3K H;  2KBN A;  3I4M H;  1UNS A;  3MXN B;  4CKC A;  2WAQ G;  3AYH B;  4CJ0 B;  2MP1 A;  2TSS A;  1I94 Q;  2F0G A;  1FVI A;  4A3G H;  3K0Y A;  5ELN A;  2KA7 A;  3HOV H;  3HOY B;  2CHB D;  2NN6 I;  1SXT A;  1J5E Q;  2AHO B;  4DR2 L;  3PMF A;  4OO1 G;  1UEA B;  3Q8D A;  2A74 C;  2KHS A;  2VB3 X;  3GTQ B;  5EBD A;  2MNA A;  1Q82 C;  4YCV A;  3HOW H;  4A3B G;  4V0B A;  3TME A;  3GQB A;  4K8I A;  3S1Q B;  4B3R L;  1FR3 A;  1AE2 A;  4A76 A;  3EN2 A;  4G7O C;  2R93 H;  4JI3 Q;  1JWU D;  3J81 E;  3FEW X;  1EUJ A;  1IHZ A;  1SNC A;  4DPG A;  2SEB D;  4DR5 Q;  4C3H G;  3D6W A;  3S15 H;  2KOL A;  1Y1W B;  3RUZ A;  5C0X H;  1PH1 A;  1TVX A;  2ZTD A;  2G5D A;  2XRQ D;  3BZD B;  5JAV A;  4IN3 A;  2CQA A;  5M3M H;  4X3U A;  4L5T A;  3AFP A;  3KF8 A;  4NKL A;  2PQA A;  1FL0 A;  4RCO A;  1VQL A;  1SRU A;  1STN A;  3STB D;  1DD2 A;  2VS1 A;  2K04 A;  3HOZ H;  1JOR A;  1D5Z C;  1E2V A;  4C3J B;  1QVC A;  1KNA A;  2SOB A;  4DF7 A;  3CRK C;  1JWM D;  4QY7 A;  4QIW B;  2C5C A;  1H9S A;  1SE2 A;  1NE3 A;  3MFG A;  1WTW A;  1UE7 A;  1AP0 A;  1QUQ A;  4NXN L;  4DR1 L;  2DN8 A;  4E6I A;  1E22 A;  4ZK9 B;  3KYH C;  3DWA A;  3Q23 A;  1UAP A;  2FJ2 A;  1A3U A;  1N32 Q;  3S2H B;  3U58 A;  5IE8 A;  4FF3 A;  2KEE A;  1RF2 D;  2UUB Q;  3TP7 A;  2HDM A;  3K5M A;  4KY6 A;  3TZD A;  1YJN A;  4KKT A;  3Q0A A;  2B2V A;  5LMU Q;  3E5S A;  4MNO A;  2A19 A;  5EQ0 A;  4F7X A;  4H13 C;  4YWL A;  4YHH L;  2A1A A;  3T16 A;  3LWU A;  1XNQ Q;  3FMC A;  5IOC A;  1IW7 D;  4AIM A;  1N34 L;  3HOY G;  2VL6 A;  1D2B A;  2JA8 H;  2B2W C;  3NUC A;  1EEI D;  5C4X B;  5KYL A;  4G7Z C;  2WKC A;  3K6O A;  1G6Z A;  4JI7 Q;  4LF4 L;  3T1H Q;  5DNF A;  2WAC A;  4DKA C;  1I3Q H;  2B2T C;  1UWV A;  4DN4 M;  5M5W H;  3STB C;  3QJY A;  4BXX H;  1N36 Q;  5EKK A;  4IPG A;  3OHX C;  4C1N I;  1VMP A;  1NTG A;  1ENC A;  1YNN D;  1SNM A;  3H09 A;  5IYC G;  4XTC S;  3URY A;  1WTR A;  1PH4 A;  3TP6 A;  3G4S A;  3VR2 A;  2RHQ B;  1YZ6 A;  4X3T A;  4APV A;  1Y1W G;  3DMU A;  4X64 Q;  4JC0 A;  1LAC A;  2RVL A;  1SJE D;  4EQN A;  2M9V A;  3RLN A;  3VR4 A;  1PH2 A;  4X62 Q;  3T4A C;  1B70 B;  3NBI A;  4BY1 B;  3KDF B;  3RR5 A;  3A55 A;  4HED A;  2YTY A;  4ZCK A;  4C3J G;  3M4P A;  4G7H C;  2QEX A;  4FF2 A;  3TP8 A;  2HDL A;  2BH8 A;  3OW2 A;  1G29 1;  1QG7 A;  4L5Q A;  3RZD H;  3HKZ E;  1F2Y A;  5J39 A;  2VQF L;  3OPO A;  3M4Y A;  3W1G A;  2RA4 A;  3S1M H;  4GKJ Q;  2JEB I;  4DV3 L;  3E9I A;  1TKW B;  3J7A 5;  3KJO A;  3TQY A;  2N78 A;  4AYB E;  1IL8 A;  1UE6 A;  4ZUJ A;  3J7Z C;  2J0T D;  4DXG A;  5KRU A;  1IW7 C;  4CKB A;  4PNY A;  1X32 A;  1GVP A;  3NXW A;  5FLM H;  2B2U A;  1FGU A;  3EFX D;  1AE3 A;  5I6W A;  5CC4 A;  1TT2 A;  2NVY H;  1MI2 A;  5ELB A;  3KUP A;  1SMX A;  3MA2 B;  4RKB A;  5KNB A;  4DV4 L;  4JI8 L;  2ID0 A;  1I6H B;  3NQI A;  1F9R A;  4DGZ A;  2JP1 A;  4PMW A;  1IBK Q;  1F9S A;  2MHV A;  4DA2 A;  5BR8 Q;  3KF6 B;  2J7Z A;  3H6M A;  2F3V A;  4UAI A;  2N3S A;  3AU7 A;  4GNX A;  1GO3 E;  2D2C C;  2XVS A;  3QOL A;  4RWS C;  4DV5 L;  2MUY A;  5C4X G;  4KHV A;  1PRT B;  4JBM A;  5IWA L;  2IY5 B;  2N8N A;  3O13 A;  4IPC A;  5JEA H;  1A3V A;  2EYL A;  2JJQ A;  4RAU C;  1K83 H;  3MHB A;  2NZH A;  1XJV A;  3LNN A;  1JE4 A;  2DY7 A;  2R7Z B;  4EQP A;  1YIJ A;  3T1Y Q;  3BZK A;  5IIF A;  2JN4 A;  2Y0S E;  1CUK A;  4H44 C;  1F2M A;  5GAH C;  1RTO A;  3S16 B;  4BY7 H;  4JYA L;  5CGK A;  2NVQ H;  1TR5 A;  2I46 A;  2SDF A;  1VQF A;  1WTP A;  1T5E A;  3PO2 H;  4BY1 G;  4H7B A;  2KJX A;  3K57 A;  4JI6 Q;  3HKZ B;  3E6Z X;  1ET6 A;  2E8G A;  1WCM B;  1VQ4 A;  1SYG A;  4GOP B;  4AYB B;  4C3I B;  4IFD H;  2HHH L;  3KLW A;  3H0G H;  4BBR H;  2G9H D;  5K36 G;  1TU2 B;  4LF9 L;  1RKN A;  1PZI D;  1JJC B;  4X65 L;  5C0X J;  1MJE A;  4KHZ A;  3K58 A;  1B7Y B;  3G48 A;  1HZB A;  4A3I G;  2Z0S A;  4OIJ A;  1U4L A;  5CV4 A;  3HS0 C;  1HNX L;  4A3D H;  1JJ2 A;  1HCZ A;  3RZO H;  3NE5 B;  2D0P A;  1QZG A;  2SNS A;  4HJA A;  1IBL Q;  4GN5 A;  2WII B;  2EYH A;  4GLV B;  3SR1 A;  4XDX A;  4P71 A;  5IT9 L;  4HID A;  3I4O A;  1BDO A;  2A6E D;  4A3L H;  3W5O A;  2OXP A;  4GS3 A;  2YU9 B;  2NTT A;  2Z8L A;  1ROD A;  3I2Z A;  4DAV A;  3A8J E;  2VUM B;  2B2Y C;  1MSH A;  1NCV A;  1NNX A;  2B39 A;  4IUU A;  5C44 B;  1XTC D;  1VQP A;  1C7Y A;  1I4Q A;  3PV0 A;  5M9O A;  4KJO A;  4DAY A;  3PIO A;  4LF5 Q;  2LMC B;  2B63 B;  3GTL B;  5IT9 E;  2B8F A;  4I65 A;  3OTO Q;  3HRZ C;  4QJF A;  1Y1V H;  4YY3 L;  3DWP A;  4ALP A;  5D14 A;  5ELD A;  3PUZ A;  4HJ7 A;  5C0X I;  3AB9 A;  3UI2 A;  2ZM6 L;  2PNH A;  5C44 H;  4K0K L;  2NVT B;  2E2J B;  1YVC A;  3K59 A;  2Y0S B;  5I2Y A;  1VQ9 A;  1IYV A;  4HIO A;  4R4I A;  4Y7N B;  3OWF A;  2R7Z G;  5M5X B;  1O80 A;  3G7L A;  2ASB A;  4IPH A;  2OF1 A;  4R4Q A;  2F4V L;  4DV1 L;  1H9M A;  1HNW Q;  3TS2 A;  2CQO A;  2AUJ D;  3TN2 A;  1DOK A;  4QCL A;  4DR7 L;  2NVT H;  2K01 A;  4Z9C B;  5M3F B;  1GHJ A;  3HKZ G;  4ULL A;  3NWT A;  4CDF C;  4DUZ L;  3CF5 A;  1WCM G;  3TRZ A;  5GQO A;  4R8N A;  4AYB G;  4C3I G;  2ICI A;  4TVA B;  1QNK A;  3CPF A;  3V2T A;  2IHF A;  2A6E C;  2VNU D;  1PLF A;  4FF1 A;  2Z6B A;  1OTC A;  1VS0 A;  1EFI D;  5C3E H;  1QE6 A;  4P72 A;  5CV5 A;  3CP0 A;  2E5L Q;  4JPB W;  2LXJ A;  1RCV D;  3BDC A;  1CI3 M;  1Q86 C;  3DWQ A;  4I7A A;  5KEE A;  3TP5 A;  1EYC A;  3K7A H;  2XWB B;  4A3M H;  3ERS X;  1DYQ A;  1NR2 A;  4G57 A;  2WB1 B;  5AJ3 L;  1E7Z A;  2F0P A;  2QW7 A;  2HCC A;  4UPA A;  2VUM G;  4ZQ3 A;  1CQF A;  1BUV T;  3J81 c;  3D4W A;  3ND8 A;  1VQK A;  1HA6 A;  4HR7 B;  3BG3 A;  1GUG A;  1KAA A;  2B63 G;  4HIK A;  2EY6 A;  1ONL A;  2JA5 B;  2E2I B;  5EKL A;  5IOD A;  3I55 A;  1IL2 A;  1NAP A;  1FD7 D;  2OCE A;  3I91 A;  3PIO 3;  1C8C A;  4XYQ A;  1KDB A;  3WOE A;  3UDG A;  1PH6 A;  2AMC B;  4XQJ A;  4YIJ A;  1G2S A;  2KEN A;  3DHQ A;  3A54 A;  2ZJR A;  2F0Q A;  2WAQ E;  1W2B A;  2Y0S G;  1A15 A;  4JI1 L;  3CCM A;  4BBS G;  3OSO A;  3DEP A;  3CMA A;  1YHB A;  5ELF A;  3TEH B;  1X56 A;  3SHL A;  2K50 A;  4GKK L;  5JEA J;  2HIV A;  4K8J A;  1A6X A;  1I5F A;  2F3I A;  5M3F G;  2X6L A;  3H3V H;  3GD7 A;  4FDB A;  1KIX A;  2ZXP A;  3ND9 A;  2AQ3 B;  3OMC A;  4DV7 Q;  4KHP Q;  1IKL A;  2EQS A;  1EYG A;  2XSC A;  4POG A;  1PMR A;  4KI0 A;  5FLX E;  4JV5 L;  4ID6 A;  4P73 A;  1CFM A;  1ASZ A;  2R92 G;  2D0O A;  3Q6S A;  4B9X A;  2UUC L;  1STY A;  4L63 B;  2F1M A;  3SK5 A;  1EZ8 A;  3I70 A;  5IYB G;  4NXN Q;  3JAM L;  5AFW A;  1HTP A;  4DR1 Q;  1BO0 A;  2LSS A;  3M9B A;  1G6P A;  4KY5 A;  3J81 j;  4KN4 C;  2R7D A;  3K0X A;  2WB1 G;  3QOJ A;  4L5R C;  2NUC A;  5COY A;  1PZK D;  3HOX B;  1E2Z A;  2QGQ A;  1F9Q A;  1SFO H;  3R2I A;  4LFA L;  2EY2 A;  1WOC A;  4F8M A;  1LV9 A;  3R93 A;  2D9U A;  1HUM A;  5D3I B;  4DK6 C;  2JA5 G;  1Q12 A;  3CAM A;  2PZU A;  3BVG A;  1LUZ A;  5EGT A;  4I7Z C;  1IZ6 A;  5EJW A;  1N34 Q;  3D0F A;  3ZYY X;  1PYS B;  4LF8 Q;  1O7Y A;  3ERO A;  2K75 A;  2E2H H;  3GO5 A;  3GTO B;  1TS4 A;  3BVM A;  3P7J A;  4J8Q A;  5HUR A;  4ZKB B;  4ZLT F;  4FXD A;  1R9T B;  1QWY A;  1AZP A;  1V8Q A;  1L1O B;  4IFD I;  4IJL A;  4CJ1 B;  3CME A;  3CHB D;  4LNQ A;  3A8I E;  1TWF H;  4NMZ A;  1P8L A;  3ULJ A;  1XPO A;  2CVR A;  2RDF A;  1DOM A;  3L7Z C;  5DM7 3;  4OHJ A;  1HNZ Q;  3FPP A;  4OO1 H;  2CH4 A;  2KCM A;  3PF5 A;  5G3L F;  3M4Q A;  2F0W A;  3SXH A;  4DV6 L;  4A3B H;  1L2F A;  4LMQ D;  1DM0 B;  4IPD A;  2BA1 A;  2NZO A;  4DUY Q;  5C5M A;  3SK6 A;  3HZX A;  2M2L A;  3VR3 A;  1EY8 A;  1HZC A;  2MO0 A;  3CCE A;  4KTA A;  4LF7 L;  1VMC A;  4C3H H;  3A7L A;  1V1P A;  4MIU A;  4O1N A;  2A6H D;  2RCN A;  3RMH A;  1L1O C;  4IOC A;  5JVG 3;  2UXB Q;  3J80 L;  2F0L A;  1KLG D;  4XIG S;  3GTM H;  1ML0 D;  3CQZ B;  3I7F A;  3NEN A;  1PH3 A;  2JEA I;  3HOX G;  4PMC A;  4GOP A;  5E3F A;  4QUF A;  4IAL A;  4S3S A;  3KK7 A;  3W2D A;  3HP3 A;  3FVQ A;  3ER0 A;  5HGQ A;  2V1C C;  4MTN A;  4AQY L;  2CH4 W;  1J8I A;  1J9O A;  5ELC A;  3PO3 B;  1JIC A;  2E2D C;  4LJZ C;  1STE A;  1BOS A;  1HJP A;  1VQD A;  2YV5 A;  4IO9 A;  4JK1 C;  3OYY A;  5CV7 A;  1PH9 A;  4A93 B;  3I4L A;  3CC4 A;  4ZKC B;  1CKM A;  4JI0 L;  1YIT A;  1VQ8 A;  2AQ2 B;  1VQE A;  3S1R B;  2NVX B;  4JI2 L;  3ITP A;  3OIP A;  4H0L C;  4OON A;  5C6A A;  5KNC A;  2NYZ D;  2JSO A;  2L1B A;  3HOY H;  5M5Y B;  1Y8P B;  3HKS A;  3S14 B;  4GN4 B;  2PMZ E;  2A6H C;  2OQK A;  2HQE A;  1IBM L;  1SMY D;  2NZ1 D;  3GTQ H;  2XWJ B;  3SEB A;  4HIM A;  2C9O A;  2HT1 A;  1RD9 D;  1TWC B;  5D3D A;  1BBX C;  3IL8 A;  1G91 A;  1O7L A;  2OEO A;  2O4X A;  3EQL C;  4AH6 A;  3S1Q H;  3TZU A;  3K7U C;  2D62 A;  4MN3 A;  1ASY A;  4RCN A;  5JOB A;  2JA6 B;  4K5W A;  3S14 H;  2PZW A;  3P75 A;  1JOO A;  5IYC H;  3PQI A;  1JOQ A;  1OXT A;  1QOH A;  3JC6 6;  5C3X A;  1Y1W H;  4HN7 A;  1TWA B;  1NY4 A;  4DR4 Q;  3CCR A;  1HNX Q;  1CKN B;  1B1Z A;  3CU7 A;  3PUV A;  2GA4 B;  2EZV A;  2BCO A;  1D6E C;  3SE0 A;  4P75 A;  1H95 A;  4LF6 Q;  2A5H A;  1EOT A;  2FFK B;  2RDG A;  1OXX K;  4C3J H;  4DV2 Q;  4ME5 A;  3MWY W;  3GTK B;  5LMN L;  3J80 i;  1TWA H;  4CBV A;  3PO3 G;  3I56 A;  2UUA L;  3Q22 A;  5C5L A;  4R8I A;  1EWI A;  2F3W A;  2L12 A;  4K2L A;  1KRT A;  4X66 Q;  3M3Y B;  2EIF A;  2D5D A;  3NTK A;  1T9H A;  1EFW A;  1FNV A;  1SE4 A;  2EYM A;  2BH2 A;  3S2H H;  1VQH A;  4A75 A;  4RHR A;  2I5M X;  4A93 G;  3G71 A;  2IT1 A;  5CV9 A;  4KLK A;  4NXM Q;  1J6Q A;  3GTK H;  3H3V I;  2KEC A;  3MVV A;  1LO5 D;  1SMY C;  1K8O A;  4LWC A;  3A56 A;  1UE1 A;  3GP7 A;  3ERQ A;  1B8A A;  2UU9 Q;  3MEF A;  3K5O A;  4LAA A;  4CHT B;  5H1S E;  1D1I A;  1Q1E A;  4GLX A;  2E76 C;  1HXY D;  2L0C A;  3OIQ A;  2H4O A;  4B3T L;  1ILQ A;  1GJX A;  2PMZ B;  1KRS A;  1V1Q A;  3ICE A;  1WTX A;  1BF4 A;  4JI4 Q;  2OTL A;  2IL8 A;  3M7G A;  1PA6 A;  5C4X H;  2ICE C;  3H91 A;  1C48 A;  4DR7 Q;  2Z4I A;  1AFP A;  1Q8I A;  4POF A;  2Z6K C;  1I50 B;  2DUD A;  2EE1 A;  3RD4 A;  3M4O B;  3A74 A;  2HD3 A;  4LFC Q;  3BYT B;  3SGI A;  4RMF A;  5E7N A;  1I6V C;  1BBU A;  2JA6 G;  3FKI B;  1PV4 A;  1D7Q A;  1K73 C;  2B29 A;  3E0J A;  1K0R A;  1EQT A;  4JVZ A;  2A8V A;  1E2W A;  4L8J A;  1AH9 A;  1FYC A;  2K28 A;  1HZ9 A;  2Q2I A;  1PHJ A;  2AWN A;  2G9D A;  3K80 C;  1XPR A;  4BY1 H;  1TWG B;  4JOI C;  4A3I B;  3IKJ A;  3FRP B;  3C3L A;  1QJO A;  1DZ1 A;  4Y52 H;  3J7Y W;  3S1N B;  3PUW A;  1FNW A;  2BA0 A;  2UXD Q;  1UE5 A;  2C35 B;  5K36 H;  1H9R A;  1SAP A;  2EXD A;  2R6G A;  5C3W A;  1XMQ L;  2RKS A;  4FXK C;  4A3I H;  2O5I C;  2OTJ A;  1JB3 A;  1VQB A;  4ZRZ A;  4B3M L;  3BYY B;  4IJH A;  1XNR L;  1YNN C;  4PZ6 A;  4WRD A;  1EIF A;  4B9W A;  5JJL A;  4DV0 Q;  4OO1 I;  1HA5 A;  5FLX c;  1I6H H;  3PSI A;  4IUT A;  1TII D;  4NP5 A;  3HOU G;  1D8L A;  4UDU C;  5BN3 A;  2EJF C;  1DXM A;  3CCQ A;  5CMD A;  2WP8 J;  5FOB B;  2WIN B;  3MTS A;  3W1B A;  3FHW A;  2K5Q A;  3BDO A;  1OXU A;  2ZJP A;  1IYU A;  1L0X B;  5A35 A;  1NJI C;  3SVM A;  3J7A V;  4LUV A;  3CXC A;  1J5E L;  5I4D A;  3A7A B;  3NWS A;  3FDT A;  4KK7 A;  3AQQ A;  3D31 A;  3FKI G;  1Z7T A;  2K33 A;  3MFY A;  4LK1 C;  2VQE Q;  3FP9 A;  2F0J A;  1NBW A;  3TDQ A;  2R7Z H;  1BCP D;  4IUN A;  5D65 A;  3KLR A;  4CDE C;  3T51 B;  5C4Z A;  1SRO A;  1X3E A;  1PTO D;  3S16 H;  1JWS D;  1KTK A;  1CSP A;  4F87 A;  4PZ8 A;  1X65 A;  1LM0 A;  3NBH B;  5DM6 3;  4JW0 A;  1HH2 P;  4HMI A;  4QQB X;  4A3C G;  2R3Z A;  1WCM H;  1BCP B;  4C3I H;  4C1N K;  1B44 D;  1K8M A;  3UDI A;  3U9S A;  3K5L A;  3CW2 C;  1QCB D;  2E75 C;  1XXG A;  1PVO A;  1PFB A;  4LFA Q;  1VQO A;  2JA9 A;  5EAY A;  2ZXO A;  3IAY A;  4WJW A;  3DEO A;  2WB1 E;  4NDX A;  3VR6 A;  5LHY 1;  1STA A;  4G4K A;  2I5L X;  4B3S Q;  1YNX A;  2OT2 A;  1E0B A;  1I4P A;  1PDQ A;  4JBJ A;  2MQH A;  1YEZ A;  1GUT A;  3OMG A;  1U4R A;  1X3F A;  4YCW A;  2YU9 H;  1B53 A;  1K9M C;  4WFN 3;  1SYB A;  5JEA G;  3NPP A;  1SSO A;  3OW7 A;  4OWX B;  2VUM H;  1C9O A;  5LMU L;  1SLJ A;  2Q8T A;  3K81 C;  1BCP C;  1LTS D;  3MXN A;  4L5S A;  2FHT A;  2KCC A;  2F0T A;  2F0I A;  4BBS B;  2I5H A;  2B63 H;  3GTL H;  1EEF D;  5ISR A;  1PTO C;  3S24 A;  1Q8K A;  1WI5 A;  2L9H A;  3GTP B;  4FP5 D;  1XYI A;  3F1Z A;  4JI7 L;  1U9R A;  3T1H L;  3UE1 A;  2E2J H;  2RF4 A;  2EVB A;  5IP7 G;  2XNA C;  4Y7N H;  4XT3 B;  5M5X H;  4DV6 Q;  2LY7 A;  4A3E B;  5DLQ E;  3KF8 B;  1S5B D;  3F2D A;  1N36 L;  2MGS A;  1TS2 A;  2VZA A;  1YJW A;  3SDZ A;  5GAG C;  1SYF A;  2OQ0 A;  1LT5 D;  4X3K A;  2EYJ A;  1GD7 A;  5M3F H;  2R92 B;  3TSS A;  2CWA A;  1YHQ A;  5IP9 G;  5NUC A;  4DR6 Q;  2DJG C;  1GUO A;  2DGY A;  2EYO A;  1SYC A;  1E24 A;  4BS9 A;  4OWW B;  1LTG D;  2EOT A;  3BZC A;  2K5W A;  1BVS A;  4NW2 A;  2VW9 A;  3U50 C;  1B4O A;  1V1O A;  4A3L G;  2F0D A;  1CZW A;  3KBG A;  4ZUI A;  2EJM A;  2A73 B;  2B2W A;  2F0S A;  4GKJ L;  1K3B C;  1TY0 A;  1VQJ A;  2GVA A;  2MO1 A;  4PG3 A;  2WKD A;  4LUO A;  4A3J B;  5GRO A;  5IYB H;  2NB0 A;  1XMO L;  4CGY B;  5JJK A;  1E1T A;  1QVF A;  2JE6 I;  1ZXT A;  2B2T A;  1VDZ A;  1O7Z A;  2CW0 D;  1KXL A;  2IJ0 A;  1EQQ A;  4IUP A;  3D4R A;  3D6C A;  1K8G A;  1A63 A;  4K5X A;  3FPU B;  3GTG B;  4RKL A;  2P5Z X;  4UP9 A;  5IYD G;  4DR2 Q;  2QEJ C;  3EVQ A;  3Q24 A; 
#chains in the Genus database with same CATH homology
 3CCE A;  4AIM A;  1N34 L;  1IBK L;  2VL6 A;  3HOY G;  4LF7 L;  5FLM G;  4C3H H;  2JA8 H;  2JK8 A;  2Z6K A;  4JI2 Q;  2GN5 A;  2E2I H;  2JA5 H;  2RCN A;  4IOA A;  1L1O C;  4IOC A;  3TRE A;  4JI7 Q;  3T1H Q;  4LF4 L;  2UXB Q;  4B3R Q;  3VDY A;  4XIG S;  4DKA C;  1I3Q H;  3GTM H;  3E9H A;  3I7F A;  1UWV A;  3NEN A;  1QVG A;  1PH3 A;  3HOX G;  4UY8 C;  2JEA I;  2MFI A;  2XTI A;  5IP9 H;  5M5W H;  3STB C;  4DR4 L;  4GOP A;  4BXX H;  4UP7 A;  1N36 Q;  2AKW B;  1M90 C;  1N33 Q;  2B3G A;  4H02 A;  2NN6 G;  4IPG A;  2YTV A;  1E1O A;  5FJ8 G;  1NTG A;  5IYC G;  4XTC S;  3ER0 A;  5HGQ A;  4A3E G;  2V1C C;  4LF6 L;  4MTN A;  1PH4 A;  1N32 L;  4AQY L;  3G4S A;  4DV2 L;  4O2D A;  2RHQ B;  1YZ6 A;  4APV A;  1Y1W G;  2R7F A;  2FXQ A;  4JOI A;  2UUB L;  4X64 Q;  5JJI A;  4JC0 A;  1X9N A;  1HJP A;  3RLN A;  1VQM A;  3B6Y A;  3M85 A;  2WFW A;  1VQD A;  3T1Y L;  1M1K C;  1PH2 A;  4X62 Q;  2YV5 A;  1BKB A;  1VQN A;  4IO9 A;  1B70 B;  4LW1 A;  1HR0 Q;  3OYY A;  3KDF B;  3EBE A;  3RR5 A;  4X66 L;  2GVB A;  1PH9 A;  2YTY A;  3CC4 A;  4YWM A;  3M4P A;  1S40 A;  1FJG Q;  2QEX A;  1CKM A;  4GOP C;  4JI0 L;  1RIP A;  2BH8 A;  3OW2 A;  4TQU S;  1G29 1;  2ALY B;  2L15 A;  4L5Q A;  1YIT A;  1VQ8 A;  3RZD H;  3HKZ E;  4IFD J;  2VQF L;  1XNQ L;  4NXM L;  3W1G A;  1VQE A;  3S1M H;  4GKJ Q;  2JEB I;  4DV3 L;  3E9I A;  3GDE A;  2AWO A;  3KDF A;  3KJO A;  3J7A 5;  4JI2 L;  3TQY A;  2N78 A;  4OX9 Q;  4BA2 I;  4AYB E;  4EQ5 A;  2UU9 L;  1X55 A;  1UE6 A;  3J7Z C;  3NEM A;  4OON A;  1CSQ A;  4BY7 G;  5IYD H;  2K5V A;  4O0A A;  3HOY H;  1N9W A;  3PO2 G;  1GVP A;  4JBW A;  4A3J G;  1KD1 C;  5FLM H;  4BBS H;  3HKS A;  1FGU A;  1MKH A;  1AE3 A;  4X6A H;  4GN4 B;  2PMZ E;  2NVY H;  3J80 c;  1SMX A;  2OQK A;  2PQA B;  4YHH Q;  1IBM L;  4JI4 L;  4JCV E;  4R4C A;  1N33 L;  3GTQ H;  4DV4 L;  4IFD G;  4HIM A;  3E0E A;  3H0G G;  4JI8 L;  2ID0 A;  4BBR G;  2KCT A;  4JI5 Q;  2HT1 A;  1JJG A;  3GTP H;  1S72 A;  2CFM A;  3HOX H;  4PMW A;  1IBK Q;  2KHJ A;  1WJJ A;  1EOV A;  5BR8 Q;  3KF6 B;  4AH6 A;  4LF7 Q;  3S1Q H;  3RLO A;  3K7U C;  1NMF A;  2D62 A;  3AFQ A;  1QUQ B;  1ASY A;  4X64 L;  3S14 H;  1K8A C;  5FJ8 H;  4A3D G;  4LF4 Q;  2N3S A;  4LFC L;  3U4Z A;  4GNX A;  5IYC H;  1GO3 E;  3A5U A;  4DV5 L;  4A3E H;  4X62 L;  4GLA C;  4DAM A;  5C4X G;  3CCS A;  1OXT A;  3JC6 6;  1IXR A;  1HR0 L;  3UDX A;  1Y1W H;  3KF6 A;  1NY4 A;  1EQR A;  3DLL A;  1FJG L;  4DR4 Q;  3CCR A;  1HNX Q;  4JBM A;  1CKN B;  5IWA L;  4LF5 L;  2R92 H;  2IY5 B;  1SR3 A;  2N8N A;  3PUV A;  4IPC A;  2IHE A;  4WJ4 A;  2CWP A;  4P75 A;  3OTO L;  4LF6 Q;  1H95 A;  1GKH A;  1MJC A;  2JJQ A;  1K83 H;  4AQY Q;  3GTO H;  1OXX K;  4C3J H;  2CCZ A;  4DV2 Q;  4OX9 L;  2NZH A;  1YHA A;  1XJV A;  2VY3 A;  3PGZ A;  1CKN A;  1R9T H;  5LMN L;  3J80 i;  1HZA A;  1TWA H;  4QGU A;  1YIJ A;  2I0Q A;  3T1Y Q;  3PO3 G;  3BZK A;  1JMC A;  3I56 A;  4GNX C;  2Y0S E;  1CUK A;  2UUA L;  1HR0 W;  1EWI A;  1KRT A;  4X66 Q;  1Y1V G;  2EIF A;  5GAH C;  2UXD L;  1JE5 A;  1T9H A;  1EFW A;  3CD6 A;  4BY7 H;  4JYA L;  2IX1 A;  1U0L A;  2YYZ A;  2RHS B;  2NVQ H;  1VQF A;  2BH2 A;  1VQH A;  4A75 A;  3S2H H;  3L2P A;  4JI0 Q;  4BY1 G;  4JI5 L;  3PO2 H;  2I5M X;  4A3J H;  3HFZ B;  1PH5 A;  4JI6 Q;  1UEB A;  3G71 A;  4A93 G;  2IT1 A;  4NB3 A;  5C44 G;  2VQF Q;  3H3V I;  4KLK A;  4NXM Q;  1J6Q A;  3GTK H;  4DV3 Q;  2E8G A;  5BR8 L;  3PIP A;  3K8A A;  2HIX A;  3L0O A;  1VQ4 A;  1VQC A;  4LWC A;  1UE1 A;  4YWK A;  4GOP B;  1B8A A;  2UU9 Q;  1VQG A;  2HHH L;  3KLW A;  3H0G H;  3MEF A;  4BBR H;  4WJ3 M;  5GAE C;  1O7I A;  5K36 G;  4LF9 L;  1MIU A;  5H1S E;  5C0X J;  1JJC B;  1Q1E A;  4X65 L;  4GLX A;  4A4I A;  4DV0 L;  3GTG H;  1MJE A;  4KHZ A;  1B7Y B;  4B3T L;  3G48 A;  1HZB A;  1KRS A;  1V1Q A;  4A3I G;  2Z0S A;  3ICE A;  1SE8 A;  3KFU A;  1HNX L;  4A3D H;  4JI4 Q;  4DK3 C;  1JJ2 A;  3JAM i;  1IBM Q;  1TXY A;  1VQ5 A;  2OTL A;  1PA6 A;  3RZO H;  4LFB Q;  4DV4 Q;  2D0P A;  1QZG A;  4P74 A;  1V9P A;  2K14 A;  4JI8 Q;  5C4X H;  4HJA A;  3I4N G;  1IBL Q;  4GN5 A;  1V43 A;  1PYB A;  1WFQ A;  4DR7 Q;  4GLV B;  4POF A;  2Z6K C;  3CQZ H;  4P71 A;  4B3M Q;  1X54 A;  2DUD A;  4R1J A;  3I4O A;  4HID A;  4HJ9 A;  1XNR Q;  3A74 A;  4A3L H;  1VQI A;  3W5O A;  4GS3 A;  5C3E G;  1YI2 A;  4LFC Q;  4DV5 Q;  1K3R A;  3SGI A;  3ZJY C;  3I2Z A;  4RMF A;  5E7N A;  1BBU A;  1OXS C;  2JA6 G;  3KOJ A;  1TWH H;  1HNW L;  1PV4 A;  1D7Q A;  4A3F G;  1K73 C;  2B29 A;  2QA4 A;  1C7Y A;  1X3G A;  1K0R A;  1VQP A;  3M7N A;  4UP8 A;  2Q2H A;  3PV0 A;  5IWA Q;  3PIO A;  4LF5 Q;  1RL2 A;  1C0A A;  3PO3 H;  2XGT A;  4JI6 L;  4A3M G;  2A8V A;  4PZ7 A;  3OTO Q;  2VQE L;  3U4V A;  4QJF A;  2YTX A;  1Y1V H;  4J15 A;  1AH9 A;  4YY3 L;  1PH8 A;  3BJU A;  4ALP A;  1HZ9 A;  3PUZ A;  2Q2I A;  1PHJ A;  4HJ7 A;  2AWN A;  3K80 C;  5C0X I;  1XPR A;  4BY1 H;  2HQL A;  2ZM6 L;  4BA1 I;  4JOI C;  2PNH A;  5LMN Q;  4A93 H;  5C44 H;  3RN2 A;  3CC2 A;  4K0K L;  1XTD A;  2UXC Q;  5J3B A;  1YVC A;  4MZ9 A;  4Y52 H;  2UUA Q;  1VQ9 A;  4HIO A;  3EIV A;  4R4I A;  3PUW A;  3RN5 A;  2BA0 A;  1EIY B;  2R7Z G;  2UXD Q;  1UE5 A;  2ASB A;  4IPH A;  1LYL A;  2C35 B;  4R4Q A;  3S1R H;  4DV1 L;  2NVX H;  2F4V L;  4JYA Q;  4LFB L;  1HNW Q;  4GNX B;  4DNI A;  1IBL L;  3TS2 A;  2CQO A;  2EXD A;  2R6G A;  1XMQ L;  3CCV A;  4DR3 Q;  2PI2 A;  1GM5 A;  1A62 A;  4A3I H;  2OTJ A;  4DR7 L;  5M5Y H;  2NVT H;  1WYD A;  1VQB A;  2ZTE A;  1A8V A;  4B3M L;  3PUY A;  3HKZ G;  4IJH A;  2HHH Q;  1XNR L;  4PZ6 A;  3I4N H;  1EIF A;  1VCI A;  3GTJ H;  4DUZ L;  3CF5 A;  1WCM G;  4LF9 Q;  3TRZ A;  2ATW A;  5GQO A;  4X65 Q;  4AYB G;  5JJL A;  4DV0 Q;  5IT9 c;  4TVA B;  1Q1B A;  3CPF A;  5FLX c;  1TWC H;  1QZH A;  4OO1 I;  3PSI A;  2ZJQ A;  4B3T Q;  1I6H H;  2IHF A;  4DV7 L;  2VNU D;  4B3S L;  1OTC A;  4KHP L;  1VS0 A;  1KL9 A;  4R4O A;  5C3E H;  4P72 A;  3HOU G;  1D8L A;  3CP0 A;  2E5L Q;  2JA6 H;  2LXJ A;  4RG1 A;  3PCO B;  3CCQ A;  1Q86 C;  1VQ7 A;  2JA7 G;  2WP8 J;  4A3F H;  1XPU A;  3CC7 A;  3W1B A;  1PFS A;  3FHW A;  1KHI A;  3K7A H;  1OXU A;  1IYJ B;  2ZJP A;  1KAW A;  2K5H A;  1CKO A;  3CPW A;  4A3K G;  4A3M H;  1NJI C;  3ERS X;  2N49 A;  1SN8 A;  2UXC L;  1YJ9 A;  3F2C A;  4ME3 A;  4NPS A;  2PI2 E;  3I4M G;  2F52 A;  4OXP A;  2CKZ B;  4LUV A;  5ELO A;  4EX5 A;  3CXC A;  1J5E L;  4GN3 B;  2ZTC A;  5AJ3 L;  1E7Z A;  1G51 A;  1DGS A;  1X6O A;  3AQQ A;  3D31 A;  4UPA A;  3FKI G;  5C4J H;  2VUM G;  3J81 c;  4A3G G;  4DR3 L;  2VQE Q;  3FP9 A;  1VQK A;  4YY3 Q;  1NBW A;  2R7Z H;  3HOV G;  3S17 H;  3KJP A;  2B63 G;  3A5Z B;  5IY0 A;  4HIK A;  1SRO A;  1X3E A;  2ZM6 Q;  5LMN W;  3I55 A;  3M3Y H;  1L0W A;  3S2D H;  1IL2 A;  3S16 H;  3A0J A;  1CSP A;  4K0K Q;  4PZ8 A;  2OCE A;  1PH7 A;  1JT8 A;  3UDF A;  1X65 A;  1LM0 A;  3NBH B;  3HOW G;  2KHI A;  3UDG A;  1Q7Y C;  1PH6 A;  2AMC B;  1W3S A;  3PF4 A;  3WWV A;  2KEN A;  1HH2 P;  1S3O A;  1NMG A;  2ZJR A;  1YBY A;  4A3C G;  4QQB X;  2WAQ E;  1W2B A;  2F4V Q;  2Y0S G;  4DV1 Q;  2E5L L;  1WCM H;  4JI1 L;  3CCM A;  1A0I A;  4BBS G;  2R93 G;  4JBK A;  4C3I H;  3CMA A;  1XMQ Q;  4LF8 L;  4DR6 L;  3UDI A;  1Q46 A;  1YHB A;  2H5X A;  4C2M H;  2K5N A;  3TEH B;  1X56 A;  3CW2 C;  2K50 A;  1P16 A;  3HOU H;  4GKK L;  1PVO A;  4DAY B;  4LFA Q;  5C0X G;  1VQO A;  1Y14 B;  2JA9 A;  4QIW E;  5EAY A;  2HIV A;  4QL5 A;  5JEA J;  4DUZ Q;  4HJ8 A;  1I5F A;  5HY6 A;  3H15 A;  3F2B A;  3TS0 A;  2Q2T A;  2JA7 H;  1U5K A;  1LTL A;  2F3I A;  2JQO A;  5M3F G;  3H3V H;  2LXK A;  3GD7 A;  4FDB A;  2WB1 E;  5M3M G;  1KIX A;  3J81 i;  1E3P A;  3NEL A;  4DV7 Q;  4B3S Q;  2I5L X;  4KHP Q;  1YNX A;  4A3K H;  3HOZ G;  3CCL A;  2EQS A;  1EYG A;  2KBN A;  4POG A;  4JBJ A;  2MQH A;  3I4M H;  1YEZ A;  4KI0 A;  1I50 H;  4JV5 L;  3MXN B;  1HNZ L;  3M4O H;  1X3F A;  4YCW A;  2YU9 H;  2WAQ G;  3AYH B;  1Q81 C;  4P73 A;  1ASZ A;  1K9M C;  2R92 G;  1JB7 A;  2D0O A;  5JEA G;  3FKI H;  2UUC L;  4OWX B;  1KC8 C;  1C9O A;  5LMU L;  3LGJ A;  1I94 Q;  2VUM H;  1FVI A;  1SLJ A;  4A3G H;  3K81 C;  4R4T A;  5ELN A;  3HOV H;  4L5S A;  2NN6 I;  1Z47 A;  5IYB G;  1Z9F A;  4NXN Q;  2I5H A;  3RLF A;  4DUY L;  1J5E Q;  4DR1 Q;  2LSS A;  3M9B A;  5AJ3 Q;  2B63 H;  2AHO B;  4DR2 L;  1VQ6 A;  3GTL H;  4OO1 G;  1G6P A;  3Q8D A;  2K52 A;  3J81 j;  2Q2U A;  3RNU A;  3S24 A;  1Q8K A;  2R7D A;  3K0X A;  2WB1 G;  4L5R C;  2MNA A;  1Q82 C;  4YCV A;  3HOW H;  4A3B G;  3AEV A;  1TWG H;  1WI5 A;  1XMO Q;  3F1Z A;  3UE0 A;  3T1H L;  4JI7 L;  2UXB L;  3UE1 A;  2E2J H;  4A3C H;  2QGQ A;  2RF4 A;  4A76 A;  1AE2 A;  1SFO H;  3G6E A;  4B3R L;  3EN2 A;  5IP7 G;  3S1N H;  4LFA L;  4JI3 Q;  2R93 H;  1WOC A;  4Y7N H;  5M5X H;  1EUJ A;  4DV6 Q;  4DPG A;  4DR5 Q;  3ULP A;  2JA8 G;  5DLQ E;  3KF8 B;  3S15 H;  3F2D A;  1N36 L;  4DK6 C;  2JA5 G;  1Q12 A;  2VZA A;  1YJW A;  3CAM A;  1LUZ A;  1IZ6 A;  1PH1 A;  5GAG C;  1VQA A;  1OXV A;  2ZTD A;  1N34 Q;  2OQ0 A;  4JI1 Q;  3D0F A;  1GD7 A;  5M3F H;  1PYS B;  5M3M H;  2CWA A;  4L5T A;  3AFP A;  5IP9 G;  1YHQ A;  4LF8 Q;  4DR6 Q;  2PQA A;  1FL0 A;  1VQL A;  2DGY A;  1SRU A;  3STB D;  2K75 A;  4BXX G;  2VS1 A;  1N8R C;  2E2H H;  3GO5 A;  3HOZ H;  1E24 A;  4OWW B;  4GKK Q;  1QVC A;  3BZC A;  1I94 L;  1BVS A;  4QY7 A;  1BBW A;  1NE3 A;  1L1O B;  4LUZ A;  1UE7 A;  3BU2 A;  4IFD I;  4IJL A;  2VW9 A;  3CME A;  1QUQ A;  4NXN L;  4LNQ A;  3PUX A;  5GAD C;  4DR1 L;  1TWF H;  3U50 C;  2K4K A;  1E22 A;  3F8T A;  4A3L G;  3KYH C;  1P8L A;  3ULJ A;  4GKJ L;  1VQJ A;  2GVA A;  4PG3 A;  2MO1 A;  3JAM c;  1XPO A;  3CCJ A;  1N32 Q;  3U58 A;  4LUO A;  5IE8 A;  3L7Z C;  1L1O A;  5GRO A;  5IYB H;  4JV5 Q;  1HNZ Q;  2OWO A;  4OWT B;  1XMO L;  5JJK A;  1E1T A;  2UUB Q;  3ULL A;  1QVF A;  2JE6 I;  2KCM A;  4JG2 A;  1YJN A;  2IX0 A;  4YCU A;  2UUC Q;  4JI3 L;  3PF5 A;  1KXL A;  3IRB A;  5LMU Q;  1EQQ A;  3DM3 A;  3M4Q A;  4MNO A;  2A19 A;  4DV6 L;  4HJ5 A;  4A3B H;  1L2F A;  4DR5 L;  1K8G A;  1A63 A;  4YWL A;  4YHH L;  3CCU A;  4IPD A;  2BA1 A;  2NZO A;  2A1A A;  4DUY Q;  4UP9 A;  5IYD G;  5IP7 H;  4DR2 Q;  2ES2 A;  1XNQ Q;  1HZC A;  2MO0 A;  1KQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...