1NE3A

Solution structure of ribosomal protein s28e from methanobacterium thermoautotrophicum. ontario centre for structural proteomics target mth0256_1_68; northeast structural genomics target tt744
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
68
Chain Sequence
MDDATPAEVIEVLKRTGMTGEVMQVKCRILDGRDKGRILTRNVMGPIREGDILMLLDTIREAKEIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S28E
publication title Solution structure of ribosomal protein S28E from Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermococcus thermolithotrophicus
molecule tags Ribosome
total genus 3
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2002-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01200 Ribosomal_S28e Ribosomal protein S28e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ne3A00
3PUVA 4GNXA 1WOCA 2ZTCA 2VS1A 1X65A 2UXBQ 1Q1EA 3H3VI 1GO3E 4A3FH 2B63H 4OWXB 3UDIA 3RNUA 2OQKA 2D62A 4DR4Q 3M85A 1M1KC 2Z0SA 3PO2G 1LM0A 5GAEC 1IL2A 2PNHA 1FGUA 1HJPA 4YCVA 4LFAL 1NE3A 4A3CG 1K8GA 2PI2A 3GDEA 5ELNA 1PH7A 1PH5A 2UUCL 3T1YQ 3CC4A 4JI0L 4DNIA 1WJJA 2ALYB 1PH6A 1HNXQ 4LFCL 4X62L 1VQ5A 4JI8Q 1QVCA 1RIPA 4JI7L 1FJGL 3U4VA 1KIXA 3KFUA 4WJ4A 4JI4Q 3OYYA 2E8GA 4AYBE 4C2MH 5GAGC 4IO9A 3W1BA 2VUMH 3S1NH 2EXDA 1V43A 4GKJL 2AHOB 1UE6A 2VY3A 3STBD 1N34Q 1K9MC 2JA8G 2EQSA 1EOVA 2YYZA 3KDFA 1N33L 4BXXH 4K0KL 4UP8A 4Y7NH 2PQAA 1UEBA 1EQRA 1EYGA 3EBEA 3I4NH 5IWAL 3CD6A 1UE7A 3ULJA 3ICEA 1CUKA 1EUJA 4YCWA 4JOIA 2JEAI 5IYCG 3I55A 4A3BG 1X3FA 2HQLA 4AH6A 2WB1G 5JJLA 4LFBQ 1E7ZA 4IOAA 4O0AA 1R9TH 4POFA 2NVQH 3KF6A 4JI8L 1YEZA 1IXRA 1VQMA 4IOCA 4A75A 1A0IA 4QGUA 3PIPA 2IX0A 5LMUL 4R4CA 4MNOA 1PH1A 4IFDJ 3TRZA 2ES2A 3TREA 2QA4A 4YWLA 3NEMA 3F2BA 1PHJA 2CCZA 1VQAA 3JAMi 4X65Q 3HOZH 4AQYQ 2UXCQ 3FHWA 4IJLA 3KF8B 5AJ3L 3HOYH 3K80C 4EX5A 1VQBA 4IFDI 2R7FA 4L5SA 4OX9Q 1PH3A 1X3EA 3M3YH 1VQHA 1G291 4HIDA 1IBKQ 1MIUA 1JB7A 2R7DA 5GROA 3STBC 5C44H 3I4MG 2XTIA 4DV2Q 4BY7H 2UXDL 3CPFA 1L1OB 4OONA 4DUZQ 4A93H 4OWWB 2UUBQ 1N8RC 2MQHA 3PSIA 4NXML 3M9BA 3JAMc 1IBMQ 1VQKA 2RHQB 2UU9Q 1V1QA 1XNRQ 1Q12A 3TS2A 1NBWA 1SMXA 4EQ5A 2Q2UA 4POGA 3HKZG 1AE3A 4RG1A 1XNQQ 3OTOL 4P75A 1E1TA 2CWAA 2K52A 1QZHA 1VQ8A 4GKKL 3A74A 2VQFQ 2AKWB 1Q7YC 2E2HH 2JA7H 3S1MH 2IT1A 3J7A5 4JI3L 5C4XH 2NVTH 1KRSA 5E7NA 5IT9c 5IYBH 1L2FA 2E5LQ 1JMCA 5IP9H 4R4IA 4B3SL 4A76A 4JYAQ 3ULLA 1AH9A 3F8TA 3PUZA 1Q8KA 2ID0A 4AYBG 1XNRL 2VW9A 2A1AA 2WFWA 4KHZA 2JA5H 2CFMA 3MEFA 4X66Q 1VS0A 4ALPA 3S16H 1XPRA 3L0OA 4ME3A 3PIOA 1X54A 4WJ3M 1SR3A 1YHBA 2JK8A 4DK6C 3ULPA 4DV0Q 4A3MH 3CC7A 1TWHH 2N49A 3DLLA 2Z6KC 4YY3Q 4A3EH 2E5LL 1X56A 4JI5Q 1KXLA 4AIMA 1OTCA 3RLNA 4X64L 4A3IH 1IBLL 1OXUA 4YHHQ 1XMOL 3HOUG 3H0GG 4GNXC 1VQDA 1VQLA 3NENA 1YJ9A 5K36G 4JV5Q 5IY0A 4LF7Q 3GO5A 1PA6A 1GM5A 3RZDH 1QUQB 4NPSA 1K73C 3GTQH 2IY5B 3S17H 4B3RL 3AFPA 4GN4B 4DR5Q 3PUYA 5C0XJ 1GKHA 3U50C 3FP9A 1FVIA 1E22A 3CCUA 4YY3L 4GOPA 3G6EA 4DV3Q 2F4VL 4LUVA 2AMCB 2OTLA 1J5EQ 1AE2A 5JEAG 2VQEQ 2VL6A 3AQQA 3HKSA 3J7ZC 1SFOH 4UY8C 5JJIA 1A8VA 4A3DH 3F1ZA 5C0XI 3HOWH 4DV5Q 2EIFA 4KLKA 5M5XH 1VQGA 4DR2L 3K7UC 1HR0W 3AEVA 2R92H 2VNUD 1SN8A 1XTDA 5FJ8H 5LMNL 2N3SA 5JEAJ 1Y14B 2XGTA 2JJQA 1N36Q 1EWIA 3PF4A 2ASBA 3CCJA 2I5MX 4A3KH 2ZTEA 1JE5A 3CC2A 4A3JG 1NJIC 4JOIC 3CCSA 1QVGA 3HOVH 1N32L 5GAHC 4A4IA 4IJHA 1YHQA 1OXXK 2VQEL 1J5EL 1Y1WH 1CKNA 1Y1VG 1Z9FA 1PH4A 1L1OC 4JI2L 1PFSA 4LWCA 1NTGA 4R4TA 4MTNA 1Z47A 1I5FA 3UDFA 1KRTA 1PH9A 2UXBL 4LF5Q 4BY1H 1VQJA 4GNXB 1NY4A 5C3EH 1S72A 3CW2C 1K83H 3KOJA 2UUAQ 1SE8A 3GTLH 1I6HH 4BBRG 1P8LA 4DR1Q 4DR4L 2Y0SE 1BBUA 2JQOA 2ZM6Q 3HFZB 4IFDG 4X6AH 2K5VA 2IX1A 4BA1I 4JI1Q 3T1YL 1S3OA 3FKIG 3LGJA 1HNXL 1LUZA 1W2BA 1I94Q 2IHEA 1CSPA 2KENA 1PVOA 1KD1C 4LF9Q 2QEXA 5M3FG 5GADC 4JI4L 3CAMA 4GLAC 4BBSG 1O7IA 3KJOA 1B7YB 1MKHA 1PH8A 1YITA 5JJKA 1N34L 3J81i 4GN3B 4DV6Q 4HJ8A 1PH2A 3G4SA 1VQ9A 3KDFB 4DKAC 3E0EA 4OXPA 1NMGA 4PZ7A 4A3LG 2PQAB 1WCMG 5IYDG 4DR6Q 1PYBA 4JI1L 4LFBL 4A3GG 3HOXH 3ER0A 3EN2A 1I94L 2N8NA 1Q46A 4LUOA 4UP9A 2MFIA 1HZAA 3BU2A 3KF6B 3CPWA 2DUDA 2AWNA 2OWOA 4KHPQ 4QQBX 4QY7A 3J81c 1PYSB 3ZJYC 1ASYA 4OO1I 3CF5A 4PMWA 3K0XA 2V1CC 4HIMA 1U5KA 1HNZQ 1VQFA 3RR5A 3PO3G 3PO2H 4MZ9A 4X65L 2ZJPA 4AQYL 1VQNA 2UXCL 1X55A 1EFWA 2K75A 1HR0Q 4LF6Q 4HJ9A 5BR8Q 1WFQA 3CCRA 2R7ZG 4A3CH 2OTJA 4OX9L 3CXCA 1V9PA 2OCEA 1CKMA 2KCTA 2WAQE 3K7AH 4RMFA 3J80i 1NMFA 1UE1A 1P16A 1Y1VH 2ZTDA 3TQYA 3U58A 1IBKL 2HHHQ 1QVFA 3RZOH 4OWTB 1YZ6A 1BKBA 2KHJA 2AWOA 2I5LX 3BZKA 4JG2A 1DGSA 5HY6A 4DV2L 1X9NA 1X6OA 4DUZL 1E24A 2MO1A 2HIVA 5FLMG 4R4OA 2UUBL 4DUYQ 3HOWG 1IBML 2UU9L 1D7QA 1OXTA 1Y1WG 3S15H 5M3MG 3CCMA 1TWGH 2JA8H 2KHIA 4DAYB 3GTKH 2BA1A 2H5XA 1GD7A 2F52A 3UDXA 4IPGA 1XNQL 2D0PA 3J80c 1C0AA 1Q82C 4A3FG 1TWFH 2LXKA 3E9IA 5BR8L 5IYCH 2B63G 2VQFL 3SGIA 4A3BH 2LXJA 3M4PA 3T1HQ 2RF4A 3U4ZA 1CKOA 2C35B 3BZCA 1XMQQ 2CWPA 3L7ZC 1HZCA 3NBHB 3CMEA 2YU9H 4B3MQ 3K8AA 1BVSA 3J81j 1YNXA 2MNAA 4JYAL 1BBWA 5HGQA 5C0XG 2PI2E 3UDGA 3D31A 3JC66 4NXNQ 3NELA 4R1JA 4X66L 1TWAH 3RN2A 2F3IA 2NN6I 2VUMG 1W3SA 2A19A 3RLOA 4LF8Q 1YBYA 1XPOA 4BXXG 4DV0L 5DLQE 4JI6Q 3T1HL 3I56A 2NVYH 4LF4Q 1EQQA 3S2DH 4DV7Q 2K4KA 1OXSC 3I4MH 1JT8A 1KAWA 1C7YA 4JI5L 1K0RA 2KBNA 4HIKA 4JBKA 4YHHL 2IHFA 2PMZE 1IYJB 4PG3A 3GTJH 4PZ8A 2I5HA 1G51A 4P72A 2N78A 2GN5A 4NB3A 1YJNA 4JV5L 4LF7L 2HIXA 2CKZB 2Q2IA 1YJWA 1VQPA 3GTGH 4KI0A 4DV1Q 3H15A 3I4OA 1VQ7A 4DR5L 3F2DA 1SRUA 3L2PA 2JEBI 3HOZG 2K5HA 2Z6KA 4LFAQ 3HOYG 2WAQG 4DV3L 1I3QH 4HJ7A 1YIJA 4FDBA 2BH2A 4GOPB 1VQ4A 4TQUS 2B29A 4TVAB 4JI0Q 4YWKA 5M5YH 3KJPA 1MJCA 1UWVA 3A0JA 2BA0A 2GVBA 3I2ZA 4C3IH 4X62Q 3A5UA 3CCEA 4DV5L 2YV5A 5C44G 4JI7Q 4BY7G 4A93G 3GTMH 5M5WH 3RLFA 2JA9A 1XPUA 2ATWA 1TXYA 1E3PA 3S1RH 1EIFA 3AFQA 3HKZE 4QJFA 5ELOA 4JC0A 4DV1L 1N36L 3S1QH 4GKJQ 4K0KQ 2R93G 3Q8DA 1N33Q 2BH8A 2K50A 2R6GA 4H02A 5IWAQ 1K8AC 3CP0A 3K81C 4LNQA 1RL2A 3PUXA 5IP7G 4BA2I 1JJGA 4GLVB 2JA7G 4GS3A 5C4XG 1TWCH 4QL5A 5IYBG 3HOUH 1H95A 1CKNB 4APVA 3H0GH 5IP9G 1T9HA 1B70B 4YCUA 4LF5L 1SROA 5LMUQ 3H3VH 4OO1G 4HJ5A 2E2JH 2UUAL 1SLJA 2NZOA 3VDYA 1UE5A 4DV4Q 4DR1L 2JA5G 5H1SE 3CCQA 1LYLA 2I0QA 4DAMA 1HH2P 2ZM6L 1A62A 3AYHB 5AJ3Q 4JBWA 3KLWA 3PGZA 4P73A 1XJVA 4A3MG 1OXVA 2OQ0A 2JA6G 2B3GA 4JBJA 1L1OA 3S24A 4HJAA 4A3EG 1M90C 1KQSA 2ZJQA 4LF9L 3KYHC 4DR7Q 5LMNW 3E9HA 2WP8J 3F2CA 2UXDQ 3W1GA 1KL9A 2ZJRA 4A3IG 4R4QA 4NXMQ 4DR3Q 3PCOB 1VQCA 5J3BA 4DV4L 2NVXH 4DV6L 1YHAA 4PZ6A 5C4JH 3GD7A 3UE1A 3OTOQ 4A3JH 1ASZA 4GKKQ 4DR6L 4Y52H 2Q2HA 2FXQA 4L5TA 2GVAA 3CCLA 4C3HH 4JI3Q 4DR7L 1HNWQ 2RHSB 1Q81C 4B3TQ 4KHPL 3G71A 2CQOA 1GVPA 2NZHA 4B3SQ 2MO0A 2E2IH 2HT1A 4A3DG 1WI5A 4DR3L 1Q86C 1C9OA 1FL0A 1VQEA 4J15A 1HNZL 4BBRH 2R92G 2R93H 1Q1BA 2YTXA 3CQZH 1PV4A 2NN6G 1MJEA 5FJ8G 1HR0L 4LF6L 2Y0SG 3W5OA 4A3KG 5EAYA 3MXNB 3S2HH 3PV0A 5IP7H 1A63A 3FKIH 1YI2A 2LSSA 4GN5A 2HHHL 4GOPC 1U0LA 1G6PA 1HNWL 3CMAA 5M3FH 1D8LA 4UP7A 2Q2TA 4B3TL 3HOVG 1L0WA 2L15A 4QIWE 4DUYL 4X64Q 1IBLQ 4BBSH 4XIGS 1JJ2A 2RCNA 4P74A 1QZGA 1VCIA 1XMOQ 3S14H 3DM3A 2QGQA 1QUQA 2VZAA 4BY1G 1KHIA 5IE8A 1E1OA 5C3EG 1YVCA 4A3LH 2D0OA 3OW2A 4B3RQ 1WCMH 1N9WA 1JJCB 2JE6I 2K14A 5IYDH 4YWMA 3CCVA 3TEHB 4A3GH 3A5ZB 3I4NG 1EIYB 2JA6H 4C3JH 2KCMA 2WB1E 1WYDA 1XMQL 3D0FA 2F4VQ 3EIVA 3ERSX 4B3ML 4JBMA 2YTVA 1IZ6A 3PF5A 4O2DA 5GQOA 3M7NA 3M4QA 3GTOH 1VQ6A 1KC8C 4JCVE 1S40A 4LW1A 4NXNL 2K5NA 4DR2Q 3PO3H 4P71A 1I50H 1VQIA 1J6QA 4IPDA 3GTPH 3IRBA 5LMNQ 2DGYA 4LF8L 3B6YA 4XTCS 4IPHA 2R7ZH 4DK3C 1VQOA 3G48A 4IPCA 1HZBA 4JI6L 1B8AA 4L5RC 4HIOA 4LF4L 4L5QA 3UE0A 4DPGA 1X3GA 3PUWA 4DV7L 3WWVA 2YTYA 3TS0A 3RN5A 3BJUA 4GLXA 1HZ9A 2UUCQ 1N32Q 1CSQA 3I7FA 1LTLA 5FLMH 3HOXG 2A8VA 5FLXc 4LFCQ 1K3RA 1FJGQ 4JI2Q 4UPAA 3M4OH 5M3MH 4LUZA
chains in the Genus database with same CATH superfamily
3PUVA 4GNXA 1WOCA 3VYUA 2C5CA 1Q1EA 1RTOA 3H3VI 4C56C 4YIJA 4OWXB 1KDCA 2OQKA 2D62A 3HOYB 2WAQB 4HMIA 2Z0SA 3PO2G 1LO5D 1V1PB 5IT9L 3GDEA 1PH5A 2MPMA 3CC4A 4JI0L 1EEID 4QMGA 1SNQA 2ALYB 5FLXE 1QVCA 2J7ZA 4G7OC 3U4VA 3WOFA 4DU9A 1RODA 3PIP3 3OYYA 4AYBE 1EY8A 1CM9A 2SDFA 3V96A 3MFYA 4GKJL 2VY3A 4G7HC 4K0KL 1EOVA 2YYZA 4TSSA 2K32A 4CDFC 1EQRA 1EYGA 3I4NH 3ULJA 3ICEA 1EUJA 2JEAI 1ML0D 2F0FA 1MI2A 2NVTB 1S5ED 5IOCA 4LFBQ 4IOAA 1R9TH 1U4LA 5I4DA 2DJFC 1IHZA 4MNOA 2B2YC 5F2DA 1PH1A 4ZCKA 1CZGA 1SYBA 2P5ZX 1JWSD 3NEMA 4CGYB 5ELBA 4DAVA 4A3MB 3KF8B 4IFDI 1PH3A 1VQHA 2KCCA 1JB7A 3DMUA 1A2TA 3I73A 5EGTA 4BY7H 2UXDL 4OONA 1AW7A 2UUBQ 2PPBC 4DAYA 5CV4A 1IBMQ 1I4QA 2RHQB 1CI3M 1SMXA 4EQ5A 3S17B 3ITPA 3HKZG 4RG1A 1D6EC 5JVG3 1AZPA 2CWAA 5T1IA 4EVOA 2VQFQ 2AKWB 3NQTA 2JA7H 3S1MH 3J7A5 2EYLA 3NBHA 1EZ6A 5E7NA 5IT9c 3D4DA 3BZDB 5IP9H 5EPLA 4B3SL 3MA2B 2EYFA 5M5XB 4C3IG 3OPOA 3JAME 2KVMA 4MN3A 1XNRL 2VW9A 4HN7A 4F87A 2IL8A 4X66Q 3S16H 3FPPA 2K7VA 1KTKA 1XPRA 1X54A 3R8BA 4WJ3M 1SR3A 1YHBA 4RGNA 1CFMA 2CH4A 1S5FD 1TWHH 3NPPA 1F2LA 2F0UA 3TMEA 3QR8A 2E5LL 4JI5Q 3NWSA 1OXUA 3H09A 2A6HD 4YHHQ 2A74C 3R3OA 3NENA 5K36G 4JV5Q 1PA6A 1GM5A 5E1FA 3GTQH 2IY5B 3I4NB 4B3RL 4GN4B 4F88A 3PUYA 5C0XJ 1GUSA 2HCCA 1SDFA 1SBBB 3G6EA 1AE2A 4UY8C 3AQQA 3MC0B 5JJIA 1A8VA 1MBYA 2EJFC 3J7AF 1BR9A 3F1ZA 4A3DH 2EIFA 1CK1A 2F0PA 4KLKA 4RKBA 1VQGA 4DR2L 3K7UC 3VYRA 1SN8A 3QOJA 2NN6H 1EOTA 3MVVA 5FJ8H 4IUPA 4CJ2C 2ASBA 4G4KA 4JVZA 3CCJA 4A3KH 3R2IA 3OHXC 3CKIB 1NJIC 3HOXB 3CCSA 1QVGA 3HOVH 1ICWA 1J5EL 1XWEA 5CBEE 5DEHA 1GUGA 4JI2L 3LNNA 4LWCA 4XT1B 1Z47A 4G7ZC 2EPBA 4OL7A 1VQJA 3K58A 5C3EH 3A56A 3KOJA 3GTLH 2B2TA 1I6HH 2KECA 5C3XA 2ZXPA 4FXGC 4DR1Q 4HSVA 1VMCA 2KCNA 2Y0SE 1CQVA 1KABA 4IFDG 3RZOB 2IX1A 4BA1I 4JI1Q 4QIWB 4KN4C 5IGBA 1I94Q 5E4WC 2KENA 3K5NA 4KMUC 3C2PA 1ENFA 1I4PA 1LTAD 3OIQA 1S5CD 1PH8A 1MKHA 1YITA 5JJKA 5I2XA 1ZYRD 3J81i 1YNJC 1PH2A 2B39A 1VQ9A 3KDFB 3LWUA 1NMGA 5IYDG 4H44C 2V4DA 5IGGA 4LFBL 3I3CA 2YU9B 4K6DA 1Q46A 2PMZB 1MSHA 4JK1C 1HZAA 1HNZQ 4HIMA 3MXNA 1B44D 4A3CH 2OTJA 2MP1A 1UNSA 3I4MB 5D65A 3KFUA 2J0TD 1F2MA 1P16A 2ZTDA 4OWTB 3BZKA 1SYFA 3Q0AA 5FLXL 1DGSA 1RJTA 1NR4A 4M8AA 2UUBL 3U9SA 1X3QA 2KEEA 1IBML 1Y1WG 5M3MG 3CCMA 3GTGB 2JA8H 1TY2A 1B3QA 4IPGA 2ICIA 5G3LF 2HQEA 5IYCH 2VQFL 3SGIA 2F0WA 2RF4A 1CKOA 2C35B 3CU7A 5CV5A 3L7ZC 2DNCA 3HRZC 3EFXD 3GTMB 1BBWA 1DJRD 3DXJC 4CJ0B 1JWMD 2X69A 1UAPA 3D31A 3ERQA 4X66L 4QCLA 3RN2A 2F3IA 2NN6I 3SEBA 3SK4A 3A7AB 1YBYA 4CKCA 1HUMA 2K5QA 5DLQE 2NVYH 4LF4Q 3S2DH 1OXSC 1EFID 1TWCB 5G3LD 4JI5L 3HOUB 4CBVA 4DXFA 3ONAB 2KBNA 4HIKA 4YHHL 5LL6S 1IYJB 4P72A 2N78A 4JV5L 1EY6A 2CKZB 2F4IA 1YJWA 1TY0A 4DV1Q 3I4OA 2L11A 1V1PA 3R2TA 1SRUA 1H9RA 3E3XA 2A6HC 3BYTB 1YIJA 1A3TA 5T1GA 1VQ4A 4YWKA 3OW7A 1UWVA 3A0JA 3A5UA 4X62Q 5E4XA 4JI7Q 5ELFA 4F7XA 3JAML 4BY7G 3BDCA 5M5WH 2JA9A 1TXYA 1GUWA 2OXPA 1HFGA 3AFQA 4QJFA 5ELOA 4JC0A 1SEBD 1WTWA 1K3BC 1D2BA 3CP0A 1STAA 3LX0A 4C3HB 5IP7G 3BG3A 2JA7G 1A3UA 4GS3A 1G2TA 2F0MA 3DWAA 4APVA 1CHQD 3H0GH 3U9OA 2K33A 5IP9G 1G91A 1STEA 5IIFA 2SNSA 1S5BD 2MJ8A 4PMCA 4ZK9B 5LMUQ 1BXTA 1SLJA 1Y8PB 4DR1L 5H1SE 1S5DD 3KF8A 2WB1B 4QUFA 3S2HB 1A62A 3KLWA 1I4GA 4ZYSA 5LHY1 5JEAH 1E2ZA 5M3FB 2JA6G 3SE0A 4JBJA 2ZJQA 2Z4IA 3S24A 1M90C 4ZKCB 4DR7Q 4BBSB 1L0YB 2B2UC 3D6WA 3S14B 1KL9A 2ZJRA 4R4QA 4DR3Q 3VR2A 5LL6X 4ULLA 4DV4L 3FMCA 2PCFB 1PYWD 1WCMB 1YHAA 1KLUD 3OTOQ 1ENCA 4A3GB 1JWUD 4GKKQ 2CQAA 4OHJA 2XSCA 1WTXA 2GVAA 2WINB 2ZXOA 4JI3Q 1EU3A 1F9RA 4F8MA 1ZYRC 3GTOB 2MO0A 1TT2A 2E2IH 4FXDA 2HT1A 4A3DG 3PO3B 1HNZL 4IUNA 3GTPB 3BDLA 1Q1BA 1SAPA 4EQPA 2NN6G 5FJ8G 3OIPA 4WFN3 2Y0SG 2EJMA 3W5OA 2EY1A 5EAYA 4A3KG 1YI2A 5IGDA 1G6PA 3HG9A 1HA6A 1VF5C 1HNWL 5TSSA 3CMAA 2Q2TA 4B3TL 3HOVG 4X64Q 1WTPA 3D8GA 4IQZA 3TP8A 4IUUA 1HUNA 4P74A 5BN4A 5COYA 3NP8A 2VZAA 1KHIA 5C3EG 1YVCA 4A3LH 2D0OA 1JJCB 1NUCA 1EIYB 4C3JH 2KCMA 1BOSA 1KNEA 4HSPA 2AQ2B 3KBGA 1IZ6A 2EJGC 3M4QA 5D3IB 1VQ6A 4Z9CB 2VUMB 2PZTA 1DXMA 3I72A 5LMNQ 3B6YA 2R7ZH 4OIKA 4ZAIA 2BOSA 4IPCA 4KY5A 4LF4L 3NBIA 1X3GA 3PUWA 4X3TA 2FFKB 2YTYA 3RN5A 2EZVA 2EYHA 3H91A 3D4WA 2K01A 4B9WA 2A8VA 3M4OH 1RD9D 2ZTCA 3M4YA 3C1FA 4A3FH 2F0VA 4FF4A 3UDIA 3RNUA 4N8FA 3M85A 1D5XC 1JR0D 2NZ1D 4ODGA 5GAEC 2PNHA 4A3CG 5CYUA 2PI2A 4E6IA 2F0HA 4X62L 2Z4HA 4JI7L 4XYQA 4TKOB 4JI4Q 4C2MH 2F0NA 5DNFA 3W1BA 3S1NH 2EXDA 2NBFA 1STNA 2IPKD 2JA8G 1N34Q 3KDFA 4Y7NH 2QEJC 1EIGA 3EBEA 1UE7A 1Z6HA 5IYCG 1B1ZA 1X3FA 5L37A 2WB1G 1QNUA 4O0AA 1M4VA 4NW2A 2HD3A 4A75A 1EEFD 2G5DA 4QGUA 5LMUL 2DN8A 1X3PA 4IFDJ 2JA5B 3IFTA 1VDZA 2D9UA 3LWEA 1JB3A 4YWLA 2CCZA 3AB9A 3JAMi 1ESRA 3HOYH 2SOBA 1VQBA 2R7FA 2A5HA 4A3EB 1HHVA 5K5PA 3T4AC 3AMUA 2CVRA 1MIUA 4KKTA 2R7DA 4A3IB 5GROA 2X6GA 3STBC 3URYA 3CPFA 2SEBD 1NCVA 4OWWB 2MQHA 3M9BA 2UU9Q 1VQKA 4ZLTF 1V1QA 3VR6A 1Q12A 1XNRQ 1JOKA 4KTAA 3GV3A 2IW3A 4DAPA 1XNQQ 3OTOL 1SNDA 4K5XA 2RBMA 1E1TA 2A69C 4GKKL 4U68A 1YNND 1Q7YC 1PFNA 1MHWC 4JI3L 2NVTH 1KRSA 4JPBW 5IYBH 1SFOB 1L2FA 4KKSA 5EBCA 2E5LQ 2RSNA 5EPKA 4R4IA 3NK9A 1RDPD 5FO7B 4A76A 4JYAQ 3OMCA 3F8TA 2ID0A 1TS3A 3MEFA 5CV7A 2N88A 3PIOA 3J7AV 4HMJA 4A3MH 3SVMA 2I46A 4CJ1B 1OTCA 3RLNA 4X64L 3K5OA 4BY1B 3DWPA 3H0GG 1VQLA 3OWEB 1Q8IA 4LF7Q 3GO5A 1QUQB 3VYTA 1PZJD 1SNCA 1K73C 3S17H 1J9OA 4XQNA 1II3A 3U50C 3FP9A 2F0EA 1FVIA 2EDGA 4DV3Q 1O80A 1J5EQ 5JEAG 2OT2A 5C6AA 3BVGA 3J81L 1BUVT 5C4ZA 1TQOA 5M5XH 3SDZA 5KIXA 1B2TA 1XTDA 1IKLA 5LMNL 1Y14B 5CGKA 2JJQA 1N36Q 2ZTEA 5EBDA 3CC2A 4JOIC 1QCBD 2PNRC 1OXXK 2VQEL 1NR2A 1LLRD 1YNJD 1Z9FA 4XYOA 3HEJA 4R4TA 1I5FA 3UDFA 1JCKB 3PMFA 2JSOA 1XXGA 2M2LA 1BQQT 1SYGA 2UUAQ 1SE8A 1P8LA 4KD3A 1BBUA 3HFZB 4H7BA 4X6AH 2RDGA 4IALA 1LUZA 1W2BA 1PVOA 4LF9Q 2QEXA 5GADC 4OIJA 4JI4L 3CAMA 1SNMA 3GTKB 3SK6A 4N9TA 5FOBB 1EYAA 1N34L 3MHBA 1Q90A 4EGVA 5EKIA 2H1EA 4GN3B 4A3BB 4DV6Q 4HJ8A 1CA6A 3G4SA 5D14A 4OXPA 4X3SA 4PZ7A 4A3LG 2PQAB 2RSOA 2LS01 1TR5A 3AU7A 4RGTA 3HOXH 3ER0A 3EN2A 4C3JG 4NP5A 1TU2B 3BU2A 3KF6B 1BDOA 2DUDA 1A15A 2BDOA 1PTOC 1PYSB 3J81c 1SXTA 1ASYA 3CF5A 4PMWA 1A6XA 3UI2A 1U5KA 1JQYD 1EIHA 5DM63 1VQNA 1GUOA 2K75A 1HR0Q 4LK1C 4HJ9A 2R7ZG 3CXCA 1V9PA 3CMEA 3K7AH 3ND9A 2KCTA 4J8QA 1NMFA 1UE1A 1Y1VH 2EY6A 1QVFA 2Z1CA 3RZOH 1STHA 2F0TA 1A3VA 4HCEA 1Q3LA 2KHJA 4JG2A 5ELCA 1Y8NB 2MO1A 2WACA 4DUYQ 2UU9L 2WV6D 3W2DA 2BA1A 2H5XA 3IKJA 1FNWA 1XNQL 2NYZD 2PW5A 4KK7A 3VR5A 1Q82C 4A3FG 1ET9A 3GV6A 2K03A 1SSOA 3U4ZA 1MGSA 5M5YB 3A55A 3BZCA 4QUCA 4FNFA 2CWPA 4AYBB 4B3MQ 1EU4A 2YU9H 4JYAL 1BVSA 3WOEA 3J81j 2MNAA 5HGQA 2PI2E 5I9PA 4TRDA 1YNNC 3IFDA 4Q5VA 1W3SA 2BDNA 2L0CA 3RLOA 1HCZA 4XT3B 2MHVA 1XTCD 1SNOA 3T1HL 2C9OA 2K4KA 3RD4A 3I4MH 1C7YA 1BBXC 1K0RA 4JBKA 2PMZE 5EKLA 4PZ8A 1YJNA 4LF7L 3GTGH 4KI0A 2TSSA 1B9MA 2KUMA 3F2DA 3HOYG 1PZKD 2WAQG 4DV3L 1I3QH 2BH2A 2PO4A 4GOPB 1T5EA 4TVAB 3F2UA 3VYSA 3C46A 1L0XB 3KJPA 2BA0A 3TP7A 2F0OA 4O42A 3HOWH 5FO9B 3FVQA 4KY7A 3GTMH 1SYDA 3RLFA 2ATWA 2NVXB 2F0LA 3IL8A 1N36L 4A3JB 3Q8DA 1N33Q 2CH4W 3K7AB 5IWAQ 1Y1VB 3K81C 3PUXA 5KEEA 4BA2I 5JAVA 1JJGA 1SYEA 1TWCH 2IJ0A 4S3SA 5IYBG 3HOUH 1H95A 1LT3D 1PDQA 1B70B 2B2WC 1GUTA 4BBRB 1LABA 2UUAL 2NZOA 3VDYA 2EY5A 1UE5A 2M9VA 4DV4Q 3CCQA 2MGSA 2I0QA 5CORA 1QILA 1HH2P 1DM0B 3FKIB 1LACA 3AYHB 5AJ3Q 1ILQA 3I91A 2EYJA 4A3MG 2L55A 4HJAA 1KQSA 4LF9L 3KYHC 4RGMA 5LMNW 3QO2A 2QKIC 4CDEC 4NXMQ 4RCNA 1F2YA 1VQCA 4OEMB 1K8MA 5C5LA 3K0YA 4DV6L 3QB3A 3UE1A 2Q2HA 1JOOA 3NWTA 4C3HH 1LV9A 1HNWQ 4B3TQ 1GVPA 2DNEA 2B2YA 3A54A 2KQ3A 1VQEA 1Y69U 3TP6A 2R93H 3KLSX 3K5LA 3CQZH 1B3AA 1PZID 1HR0L 1BCPC 1I3QB 1FNUA 3S2HH 3PV0A 2LSSA 4GN5A 2K5DA 3QOLA 4GOPC 4EQNA 3HOWB 5M3FH 1L0WA 1STYA 3P7JA 3W3AA 4DUYL 4BBSH 1F9QA 1STBA 2F0GA 2RCNA 2PQEA 3S14H 1QUQA 5I6WA 2B63B 3H94A 1HXYD 2WIIB 1E1OA 1WCMH 4RA8A 1N9WA 4KJOA 3NE5B 4A3GH 3I4NG 2WB1E 1WYDA 3D0FA 3E5SA 3EIVA 4B3ML 4O2DA 4FYDA 4IZ8A 4DFAA 3GTOH 1S40A 5FK9C 1OO9B 3C3LA 3PO3H 1I50H 1J6QA 2GA4B 3GTPH 4XTCS 1ZKOA 4DK3C 1VQOA 5EQ0A 2O5IC 1B8AA 4L5RC 4HIOA 3CRLC 5CR3A 3WWVA 3H6MA 3DEPA 4FF2A 2NVQB 4H13C 4GLXA 1HZ9A 1CSQA 3NHHA 1LTLA 1F9SA 2AUJD 3HOXG 5FLXc 1IL8A 4LUZA 1EQTA 2AUKA 2NTSA 1GO3E 3P75A 3HOZB 5A2QE 2X6LA 3SHLA 2XIWA 4DR4Q 3X3NA 1LM0A 1FGUA 1HJPA 4YCVA 1NE3A 5KYLA 4ZKBB 1K8GA 5C44B 1PH7A 1WJJA 2XWBB 1PH6A 4A93B 4LFCL 1VQ5A 1FJGL 1R4QB 3RUZA 1GHJA 2R93B 2VUMH 5JPNC 3CQZB 4RKLA 3N52A 1UE6A 3MWYW 3STBD 1E2VA 2QF7A 4BXXH 1N33L 3E0JA 1QG7A 2PQAA 5IWAL 3CD6A 2E2HB 1CUKA 1DOMA 1M8AA 3I55A 5C4XB 3P1HA 2HQLA 5BN5A 4AH6A 2EYMA 2Q8TA 5JJLA 3MTSA 4POFA 3KF6A 4JI8L 3BS1A 1O7LA 2A69D 3A7LA 4I7AA 3PIPA 4R4CA 4CHTB 2A73B 3F2BA 2EXZA 1WTVA 4I7ZC 1VQAA 3KBXA 1IYUA 4X65Q 4AQYQ 1PXUA 3FHWA 2IX3A 2QW7A 3L9AX 5AJ3L 3K80C 1HPCA 1I4HA 1I6VC 3M3YH 1G291 2E2DC 3VA7A 2E74C 1IBKQ 1GXDC 4DK1A 3I4MG 2XTIA 2F3VA 1L1OB 4DUZQ 2B2WA 1CQFA 1HTPA 4NXML 3JAMc 1I50B 1G8ZD 3EA6A 1NAPA 4POGA 1AE3A 5I6YA 1VQ8A 2LMCB 5J22A 1HTLD 1TKWB 3I70A 2IT1A 2KHSA 2A6ED 2Q8IB 1GHKA 5JPMC 4XQQA 3QJYA 2R92B 1AH9A 3FDTA 1Q8KA 1AEXA 3MZ5A 1SNPA 4ME5A 2BCOA 2A1AA 5CV6A 2CW0D 2KJXA 2JA5H 2CFMA 3L0OA 4ME3A 1IKMA 5HURA 3ULPA 4HAEA 4A3EH 3K57A 4FP5D 1WVLA 2B8GA 2ENBA 4A3IH 3KLRA 5IGCA 3HOUG 4NMZA 4GNXC 2CHBD 1K83B 2ICEC 1YJ9A 4ABNA 5IY0A 2FHTA 4NPSA 3EJIA 4XQJA 4DR5Q 1KNAA 4HCSA 3G7LA 1C4QA 3CCUA 4YY3L 4GOPA 3KLSA 4LUVA 2OTLA 4FF3A 2VQEQ 2VL6A 1SFOH 3M7GA 2L9HA 1V8QA 4DV5Q 1PTOF 3BDOA 3AEVA 1HR0W 2VNUD 1DD2A 4K2KA 2N3SA 2XGTA 1EWIA 5JOBA 2I5MX 1CHPD 3SXHA 3M3YB 4IUTA 3OWFA 5GAHC 2JXMB 1WD0A 4KHVA 1Y1WH 4C3HG 1PH4A 5IGFA 1L1OC 1PFSA 3DUZA 1NTGA 4CDCC 2XWJB 2XNAC 1SYCA 4BY1H 1NY4A 1S72A 3L3OC 3CW2C 3VA5A 3PO2B 4DR4L 2OF1A 1IYVA 1PTOD 3ND8A 4QB4A 2ZM6Q 5KGUA 2DY7A 3K59A 5J39A 2F03A 1S3OA 3LGJA 3BYYB 3HGBA 3PQIA 5EJWA 1O78A 1KD1C 5M3FG 4UDUC 5FO8B 2EY2A 3S15B 1BNZA 5K36H 1TWGB 3FPUB 4BBSG 1HQMC 2LFNA 1SMYC 4KV6A 4DKAC 3E0EA 1EY0A 1WCMG 1SE3A 2TMPA 5HGTA 2JP1A 5D3DA 4A3GG 1NNXA 4K8IA 4UP9A 4KHPQ 3CPWA 2K04A 2AWNA 1A2UA 3S9WA 4QQBX 3ZJYC 5NUCA 2VXWA 3K0XA 2G9HD 2V1CC 5M9OA 3RR5A 3PO3G 5A2QL 1EY9A 1ICFB 4X65L 4AQYL 1B50A 4LF6Q 1WFQA 4KD4A 3CCRA 5CBAE 2DJGC 2OCEA 1CKMA 2WAQE 4IUQA 3J80i 3U58A 3TQYA 1JT8A 2J4XA 1IBKL 2HHHQ 3A8JE 1BKBA 1YZ6A 2AWOA 2I5LX 2B2UA 1X9NA 4DUZL 3GTJB 2HIVA 5FKAC 1OXTA 3HKZB 1LTTD 3N6RA 5BN3A 2KHIA 3GTKH 1GD7A 3NTHA 4PNYA 2D0PA 2F1MA 1TWFH 1V1OA 2LXKA 5BR8L 4A3BH 4R9WA 3T1HQ 1HA5A 1FNVA 3VR3A 4C3IB 1ENAA 3HS0C 1HZCA 3EROA 4WJWA 2EOTA 2K28A 2NWGA 3NUCA 3S1RB 2F0QA 1PTOB 3JC66 1SE2A 3NELA 4NXNQ 1Y8OB 3NQIA 3T16A 2VUMG 1LTSD 2A19A 2A6EC 3G6JB 2Z9HA 4B08A 3DHQA 1GUNA 5KYIA 4BXXG 4JI6Q 1RCVD 4DV7Q 2PZUA 1H9SB 4ZRZA 2CW0C 1KAWA 3DEOA 2IHFA 1B4OA 2F0JA 4PG3A 2E2JB 2GN5A 1ZEQX 2HIXA 1ZXTA 2B2TC 3H15A 1VQ7A 4DR5L 3HZXA 2JEBI 1H9MA 1PMRA 4LFAQ 2QDLA 4FDBA 5CMDA 5CV8A 2B29A 5M5YH 1MJCA 3I2ZA 3PF4A 2RCFA 4DV5L 5KRUA 3C1EA 3RMHA 4C1NI 1TS4A 3Q23A 5C4JB 4K6LA 4L63B 4LMQD 3MFGA 2K50A 1KLGD 3E6ZX 1BCPF 4H02A 1JE4A 5JVH3 3Q24A 5I2YA 4ZUIA 1LT4D 4JW0A 2NUCA 4QL5A 2F3WA 1CKNB 5C4HA 1T9HA 2AQ3B 4ZQ3A 2RKSA 3DWQA 1D5ZC 1IW7C 2H4OA 1UEAB 1F2ZA 1LTRD 2K6AA 2JA5G 1TWFB 1LYLA 4DAMA 2DY8A 2ZM6L 1U4RA 3EVQA 4P73A 1XJVA 1OXVA 2OQ0A 4B9XA 2F0KA 1L1OA 4A3EG 4KKUA 2N55A 4KJNA 1BCPD 5AFWA 3W1GA 4A3IG 4L8JA 3SR1A 4PV1C 5J3BA 2NVXH 4PZ6A 4A3JH 1X32A 4Y52H 1WD1A 3FEWX 2FXQA 3CCLA 3VR4A 5IODA 1Q81C 4KHPL 2CQOA 4DK0A 2NZHA 3MXPA 3H3VC 1WI5A 1Q86C 1C9OA 1DYQA 1FL0A 4FVMA 4J15A 4BBRH 1D1IA 1PV4A 4NKLA 4I65A 3T53B 4LF6L 4CKBA 1QNKA 5IP7H 1A63A 3FKIH 2HHHL 1U0LA 2JN4A 1Y1WB 2L15A 5M3MB 1W6KA 4QIWE 1E0BA 4PMBA 1IBLQ 1AFPA 4XIGS 1QZGA 1XMOQ 2QGQA 2VB3X 4BY1G 3J80E 2XN9C 1FD7D 3OW2A 2JE6I 1C8CA 1G6ZA 2ZT9C 2O4XA 2L12A 1UUPA 3CCVA 3TEHB 2B2VC 2JA6H 1CZWA 2F4VQ 4JBMA 2YTVA 5GQOA 1DZ1A 1I4RA 4NXNL 1ILPA 2L1BA 1W6JA 1VQIA 2G9DA 1JICA 2L5TA 4IPDA 3IRBA 2DGYA 4IPHA 4XDXA 3G48A 4R8NA 5ELDA 4JI6L 2K1BA 4L5QA 4KN7C 1BCPB 4DV7L 2KEDA 1AZQA 1R9TB 3TS0A 4IUVA 3BJUA 1N32Q 4DNRB 4OELB 5FLMH 3TP5A 1U9RA 4LFCQ 1EYDA 1FJGQ 3KUPA 2VB2X 2VS1A 1X65A 5ELEA 2UXBQ 1PFMA 5IGEA 2B63H 3GP7A 5ISRA 1KDBA 1M1KC 2SNMA 1IL2A 4LFAL 1XX8A 1CT1D 2KOLA 2EYPA 2UUCL 3V2TA 5ELNA 1EY5A 2OEOA 3T1YQ 4BY7B 4DNIA 1HNXQ 4JI8Q 1RIPA 4K5WA 5J1ZA 5C0XH 4L6TB 1KIXA 4WJ4A 1KAAA 2E8GA 4GZYC 5GAGC 1F9PA 4IO9A 3QIAA 1V43A 2AHOB 1K9MC 2EQSA 3MXGA 2WKDA 1EQVA 4UP8A 1CA5A 4IURA 1UEBA 2XVSA 4YCWA 3S1MB 2E76C 1E2WA 2LKVA 2FINB 4JOIA 4A3BG 2JA7B 1E7ZA 2NVQH 4RAUC 1YEZA 1VF7A 1IXRA 1VQMA 4RH6A 4IOCA 2RA4A 1A0IA 4CDDC 2IX0A 4RWSC 3TRZA 2ES2A 3TREA 2QA4A 3S16B 2O2LD 1C48A 1PHJA 1EWHA 4H0LC 3HOZH 2UXCQ 1TWHB 4IJLA 4EX5A 2JA6B 2IWHA 1AP0A 3R93A 4L5SA 4OX9Q 1X3EA 3OOCA 4HIDA 1QJOA 4K14A 3T13A 5C44H 4M1UB 4DV2Q 3HP3A 1LTBD 3QWNA 2AQ1B 5C5MA 4A93H 1SJHD 2ZXRA 1N8RC 3PSIA 3A8IE 3TS2A 1NBWA 2Q2UA 4UHVA 3GTQB 1SJED 2HCIA 3K5MA 1MSGA 4KY6A 4P75A 3PIO3 2K52A 1QZHA 3A74A 1BF4A 5CC4A 3EQLC 2E2HH 5C4XH 4FO2A 1AN8A 1EY7A 1JMCA 4A3DB 1DOLA 1HRJA 1CTMA 3TN2A 3ULLA 3PUZA 4OO1H 4AYBG 1RHPA 1RKNA 2WFWA 4KHZA 5A35A 2Y0SB 4V0BA 1VS0A 4ALPA 4A3KB 2E75C 2Q8RE 3NSWA 4FXKC 2JK8A 4DK6C 3GQBA 1EWCA 4DV0Q 1H9SA 3CC7A 3HOVB 2N49A 3DLLA 1WTHA 3J7YW 2Z6KC 1TVXA 4YY3Q 3CHBD 2K05A 1X56A 1G2SA 1KXLA 4AIMA 1ET6A 3O13A 3I4LA 1IBLL 1XMOL 4N9PA 1PRTF 5C3EB 1VQDA 4N8X1 3GTLB 1I6HB 3BVZA 3RZDH 1FYCA 2Z6BA 3AFPA 1WTOA 4DXGA 3K6OA 3WDNA 1GKHA 1E22A 3P20A 2F4VL 2AMCB 3J7ZC 3HKSA 2WKCA 5KNDA 1I4XA 5C0XI 4LJZC 2F0SA 2R92H 5JEAJ 2NB0A 1EZ8A 1KDAA 1LT6D 4X3KA 1JE5A 4J1MA 2B2VA 1ONLA 1PRTD 4XXEA 4A3JG 1SMYD 1DOKA 1N32L 1SE4A 2L4NA 4IJHA 4A4IA 3ZYYX 4U673 1YHQA 1CKNA 1Y1VG 4Q0FA 5EKKA 4MTNA 4DN4M 1KRTA 1PH9A 1VMPA 2RQXA 4LF5Q 2UXBL 4GNXB 3OSOA 1K83H 3J80L 1K8OA 4BBRG 4X3UA 1D1KA 1F77A 2JQOA 3NTKA 1XYIA 2EVBA 4MIUA 1HFNA 2R61A 2K5VA 4DNTB 1GJXA 2K5WA 3T1YL 3FKIG 1HNXL 2F0DA 2IHEA 1CSPA 5E3FA 2BE5D 3T51B 1NSNS 2JA8B 2FMCA 3Q6SA 4GLAC 2B8FA 1S4ZA 1O7IA 3KJOA 1B7YB 5KNBA 1U4PA 4ILWA 4DGZA 3I8ZA 4IN3A 4DR6Q 1PYBA 4JI1L 4R8IA 2NTTA 3SK8A 3NTIA 1I94L 2N8NA 4LUOA 2MFIA 5KNCA 1RF2D 2OWOA 1STGA 4QY7A 1RTNA 4ZUJA 2D5DA 4OO1I 3BVMA 3MEHA 4J6HA 3RZDB 1EY4A 1VQFA 4HTHA 3NXWA 3PO2H 4MZ9A 2ZJPA 4CKEA 2UXCL 1X55A 1EFWA 2NVYB 3S2DB 4V190 5BR8Q 2KA7A 4OX9L 4K5VA 3OMGA 3X3MA 4RMFA 5DM73 3MAQA 4DV2L 5HY6A 3T56B 1X6OA 4DF7A 1E24A 5FLMG 4R4OA 3J81E 3HOWG 2PYKA 1D7QA 3S15H 4RGOS 1HQRD 1PRTB 1TWGH 5C3WA 4DAYB 2F0IA 1FGBD 2F52A 3UDXA 1U4MA 3J80c 2A68D 1C0AA 2O5JC 2B63G 3E9IA 2PZWA 2LXJA 3M4PA 3TDQA 3I90A 1LTID 5IT9E 4EQOA 1XMQQ 1GOZA 3NBHB 3FRPB 2PW7A 2FMMA 3K8AA 1YNXA 4BS9A 5M5WB 5C0XG 3CRKC 4QF4A 3UDGA 3TZDA 4R1JA 1TWAH 1Z7TA 4LF8Q 1XPOA 1ESFA 3QG1A 4DV0L 3I56A 4HR7B 2Z8LA 1EQQA 3Q22A 2MUYA 2XRQD 1DCZA 3D4RA 3H0GB 1B9NA 2HUGA 3GTJH 2I5HA 1G51A 4NB3A 2M00A 2HDLA 2Q2IA 3TSSA 1VQPA 1TS5A 1O7ZA 4RFBA 3L2PA 3HOZG 1K28A 2K5HA 2Z6KA 4HJ7A 5CV9A 1IW7D 4TQUS 4JI0Q 2I07B 4C3IH 2GVBA 3CCEA 2YV5A 5C44G 4MHEA 4A93G 1BO0A 4OGQC 1XPUA 4G57A 2JYOA 1E3PA 1DONA 3S1RH 1EL0A 2FJ2A 1PTOH 1EIFA 3HKZE 4GKJQ 4DV1L 3S1QH 4K0KQ 2R93G 1K0SA 2QCPX 2BH8A 2R6GA 1K8AC 4LNQA 1RL2A 1JOQA 4RHSA 3KK7A 5JJZA 4WORA 4GLVB 4C1NK 5C4XG 4K8JA 2E2IB 1JORA 4YCUA 1PRTC 1SROA 4LF5L 3H3VH 4OO1G 4HJ5A 2E2JH 1QWYA 1WTQA 4NDXA 1LT5D 1FR3A 4JBWA 4UAIA 4MTKA 3MXUA 3PGZA 3IAYA 3D3RA 1D5MC 3TZUA 1R4PB 2R3ZA 2B3GA 5DAUA 3E9HA 2WP8J 3F2CA 2UXDQ 3SK5A 1TWAB 3PCOB 4HEDA 4PQXA 5C4JH 1B53A 3GD7A 2BE5C 1ASZA 1TS2A 2QDBA 5EPJA 4C3JB 4DR6L 4L5TA 1H9JA 4DA2A 4DR7L 2RHSB 4O1NA 1LTGD 3G71A 4B3SQ 4K2LA 2EYOA 4DR3L 1QE6A 4P2CB 5I9OA 2XRSD 2R92G 1J8IA 2R7ZB 2YTXA 1PFBA 1MJEA 4IFDH 3MXNB 1H9KA 2QILA 1MD2D 1D8LA 2LY7A 4UP7A 3M4OB 1QOHA 1JJ2A 1VCIA 3DM3A 1QB5D 3S1QB 4A3FB 4RCOA 5IE8A 4WRDA 1T5XD 4B3RQ 2K14A 2RDHA 4LAAA 1WTRA 5IYDH 4YWMA 3TBIB 1TIID 3A5ZB 3A8KE 4RHRA 1XMQL 3DM1A 3ERSX 3PF5A 1O7YA 3M7NA 2A68C 4C2MB 1KC8C 4JCVE 3S1NB 4LW1A 1EYCA 2K5NA 4DR2Q 4P71A 3D6CA 4Y7NB 2D2CC 4LF8L 1HZBA 4FF1A 3UE0A 4DPGA 3V05A 2RVLA 4BWGB 2RDFA 2UUCQ 2EE1A 4ID6A 3I7FA 1K3RA 1JC7A 1PLFA 4JI2Q 2HDMA 4UPAA 5M3MH
chains in the Genus database with same CATH topology
3PUVA 4GNXA 1WOCA 2ZTCA 2VS1A 1X65A 2UXBQ 1Q1EA 3H3VI 1GO3E 4A3FH 2B63H 4OWXB 3UDIA 3RNUA 2OQKA 2D62A 4DR4Q 3M85A 1M1KC 2Z0SA 3PO2G 1LM0A 5GAEC 1IL2A 2PNHA 1FGUA 1HJPA 4YCVA 4LFAL 1NE3A 4A3CG 1K8GA 2PI2A 3GDEA 5ELNA 1PH7A 1PH5A 2UUCL 3T1YQ 3CC4A 4JI0L 4DNIA 1WJJA 2ALYB 1PH6A 1HNXQ 4LFCL 4X62L 1VQ5A 4JI8Q 1QVCA 1RIPA 4JI7L 1FJGL 3U4VA 1KIXA 3KFUA 4WJ4A 4JI4Q 3OYYA 2E8GA 4AYBE 4C2MH 5GAGC 4IO9A 3W1BA 2VUMH 3S1NH 2EXDA 1V43A 4GKJL 2AHOB 1UE6A 2VY3A 3STBD 1N34Q 1K9MC 2JA8G 2EQSA 1EOVA 2YYZA 3KDFA 1N33L 4BXXH 4K0KL 4UP8A 4Y7NH 2PQAA 1UEBA 1EQRA 1EYGA 3EBEA 3I4NH 5IWAL 3CD6A 1UE7A 3ULJA 3ICEA 1CUKA 1EUJA 4YCWA 4JOIA 2JEAI 5IYCG 3I55A 4A3BG 1X3FA 2HQLA 4AH6A 2WB1G 5JJLA 4LFBQ 1E7ZA 4IOAA 4O0AA 1R9TH 4POFA 2NVQH 3KF6A 4JI8L 1YEZA 1IXRA 1VQMA 4IOCA 4A75A 1A0IA 4QGUA 3PIPA 2IX0A 5LMUL 4R4CA 4MNOA 1PH1A 4IFDJ 3TRZA 2ES2A 3TREA 2QA4A 4YWLA 3NEMA 3F2BA 1PHJA 2CCZA 1VQAA 3JAMi 4X65Q 3HOZH 4AQYQ 2UXCQ 3FHWA 4IJLA 3KF8B 5AJ3L 3HOYH 3K80C 4EX5A 1VQBA 4IFDI 2R7FA 4L5SA 4OX9Q 1PH3A 1X3EA 3M3YH 1VQHA 1G291 4HIDA 1IBKQ 1MIUA 1JB7A 2R7DA 5GROA 3STBC 5C44H 3I4MG 2XTIA 4DV2Q 4BY7H 2UXDL 3CPFA 1L1OB 4OONA 4DUZQ 4A93H 4OWWB 2UUBQ 1N8RC 2MQHA 3PSIA 4NXML 3M9BA 3JAMc 1IBMQ 1VQKA 2RHQB 2UU9Q 1V1QA 1XNRQ 1Q12A 3TS2A 1NBWA 1SMXA 4EQ5A 2Q2UA 4POGA 3HKZG 1AE3A 4RG1A 1XNQQ 3OTOL 4P75A 1E1TA 2CWAA 2K52A 1QZHA 1VQ8A 4GKKL 3A74A 2VQFQ 2AKWB 1Q7YC 2E2HH 2JA7H 3S1MH 2IT1A 3J7A5 4JI3L 5C4XH 2NVTH 1KRSA 5E7NA 5IT9c 5IYBH 1L2FA 2E5LQ 1JMCA 5IP9H 4R4IA 4B3SL 4A76A 4JYAQ 3ULLA 1AH9A 3F8TA 3PUZA 1Q8KA 2ID0A 4AYBG 1XNRL 2VW9A 2A1AA 2WFWA 4KHZA 2JA5H 2CFMA 3MEFA 4X66Q 1VS0A 4ALPA 3S16H 1XPRA 3L0OA 4ME3A 3PIOA 1X54A 4WJ3M 1SR3A 1YHBA 2JK8A 4DK6C 3ULPA 4DV0Q 4A3MH 3CC7A 1TWHH 2N49A 3DLLA 2Z6KC 4YY3Q 4A3EH 2E5LL 1X56A 4JI5Q 1KXLA 4AIMA 1OTCA 3RLNA 4X64L 4A3IH 1IBLL 1OXUA 4YHHQ 1XMOL 3HOUG 3H0GG 4GNXC 1VQDA 1VQLA 3NENA 1YJ9A 5K36G 4JV5Q 5IY0A 4LF7Q 3GO5A 1PA6A 1GM5A 3RZDH 1QUQB 4NPSA 1K73C 3GTQH 2IY5B 3S17H 4B3RL 3AFPA 4GN4B 4DR5Q 3PUYA 5C0XJ 1GKHA 3U50C 3FP9A 1FVIA 1E22A 3CCUA 4YY3L 4GOPA 3G6EA 4DV3Q 2F4VL 4LUVA 2AMCB 2OTLA 1J5EQ 1AE2A 5JEAG 2VQEQ 2VL6A 3AQQA 3HKSA 3J7ZC 1SFOH 4UY8C 5JJIA 1A8VA 4A3DH 3F1ZA 5C0XI 3HOWH 4DV5Q 2EIFA 4KLKA 5M5XH 1VQGA 4DR2L 3K7UC 1HR0W 3AEVA 2R92H 2VNUD 1SN8A 1XTDA 5FJ8H 5LMNL 2N3SA 5JEAJ 1Y14B 2XGTA 2JJQA 1N36Q 1EWIA 3PF4A 2ASBA 3CCJA 2I5MX 4A3KH 2ZTEA 1JE5A 3CC2A 4A3JG 1NJIC 4JOIC 3CCSA 1QVGA 3HOVH 1N32L 5GAHC 4A4IA 4IJHA 1YHQA 1OXXK 2VQEL 1J5EL 1Y1WH 1CKNA 1Y1VG 1Z9FA 1PH4A 1L1OC 4JI2L 1PFSA 4LWCA 1NTGA 4R4TA 4MTNA 1Z47A 1I5FA 3UDFA 1KRTA 1PH9A 2UXBL 4LF5Q 4BY1H 1VQJA 4GNXB 1NY4A 5C3EH 1S72A 3CW2C 1K83H 3KOJA 2UUAQ 1SE8A 3GTLH 1I6HH 4BBRG 1P8LA 4DR1Q 4DR4L 2Y0SE 1BBUA 2JQOA 2ZM6Q 3HFZB 4IFDG 4X6AH 2K5VA 2IX1A 4BA1I 4JI1Q 3T1YL 1S3OA 3FKIG 3LGJA 1HNXL 1LUZA 1W2BA 1I94Q 2IHEA 1CSPA 2KENA 1PVOA 1KD1C 4LF9Q 2QEXA 5M3FG 5GADC 4JI4L 3CAMA 4GLAC 4BBSG 1O7IA 3KJOA 1B7YB 1MKHA 1PH8A 1YITA 5JJKA 1N34L 3J81i 4GN3B 4DV6Q 4HJ8A 1PH2A 3G4SA 1VQ9A 3KDFB 4DKAC 3E0EA 4OXPA 1NMGA 4PZ7A 4A3LG 2PQAB 1WCMG 5IYDG 4DR6Q 1PYBA 4JI1L 4LFBL 4A3GG 3HOXH 3ER0A 3EN2A 1I94L 2N8NA 1Q46A 4LUOA 4UP9A 2MFIA 1HZAA 3BU2A 3KF6B 3CPWA 2DUDA 2AWNA 2OWOA 4KHPQ 4QQBX 4QY7A 3J81c 1PYSB 3ZJYC 1ASYA 4OO1I 3CF5A 4PMWA 3K0XA 2V1CC 4HIMA 1U5KA 1HNZQ 1VQFA 3RR5A 3PO3G 3PO2H 4MZ9A 4X65L 2ZJPA 4AQYL 1VQNA 2UXCL 1X55A 1EFWA 2K75A 1HR0Q 4LF6Q 4HJ9A 5BR8Q 1WFQA 3CCRA 2R7ZG 4A3CH 2OTJA 4OX9L 3CXCA 1V9PA 2OCEA 1CKMA 2KCTA 2WAQE 3K7AH 4RMFA 3J80i 1NMFA 1UE1A 1P16A 1Y1VH 2ZTDA 3TQYA 3U58A 1IBKL 2HHHQ 1QVFA 3RZOH 4OWTB 1YZ6A 1BKBA 2KHJA 2AWOA 2I5LX 3BZKA 4JG2A 1DGSA 5HY6A 4DV2L 1X9NA 1X6OA 4DUZL 1E24A 2MO1A 2HIVA 5FLMG 4R4OA 2UUBL 4DUYQ 3HOWG 1IBML 2UU9L 1D7QA 1OXTA 1Y1WG 3S15H 5M3MG 3CCMA 1TWGH 2JA8H 2KHIA 4DAYB 3GTKH 2BA1A 2H5XA 1GD7A 2F52A 3UDXA 4IPGA 1XNQL 2D0PA 3J80c 1C0AA 1Q82C 4A3FG 1TWFH 2LXKA 3E9IA 5BR8L 5IYCH 2B63G 2VQFL 3SGIA 4A3BH 2LXJA 3M4PA 3T1HQ 2RF4A 3U4ZA 1CKOA 2C35B 3BZCA 1XMQQ 2CWPA 3L7ZC 1HZCA 3NBHB 3CMEA 2YU9H 4B3MQ 3K8AA 1BVSA 3J81j 1YNXA 2MNAA 4JYAL 1BBWA 5HGQA 5C0XG 2PI2E 3UDGA 3D31A 3JC66 4NXNQ 3NELA 4R1JA 4X66L 1TWAH 3RN2A 2F3IA 2NN6I 2VUMG 1W3SA 2A19A 3RLOA 4LF8Q 1YBYA 1XPOA 4BXXG 4DV0L 5DLQE 4JI6Q 3T1HL 3I56A 2NVYH 4LF4Q 1EQQA 3S2DH 4DV7Q 2K4KA 1OXSC 3I4MH 1JT8A 1KAWA 1C7YA 4JI5L 1K0RA 2KBNA 4HIKA 4JBKA 4YHHL 2IHFA 2PMZE 1IYJB 4PG3A 3GTJH 4PZ8A 2I5HA 1G51A 4P72A 2N78A 2GN5A 4NB3A 1YJNA 4JV5L 4LF7L 2HIXA 2CKZB 2Q2IA 1YJWA 1VQPA 3GTGH 4KI0A 4DV1Q 3H15A 3I4OA 1VQ7A 4DR5L 3F2DA 1SRUA 3L2PA 2JEBI 3HOZG 2K5HA 2Z6KA 4LFAQ 3HOYG 2WAQG 4DV3L 1I3QH 4HJ7A 1YIJA 4FDBA 2BH2A 4GOPB 1VQ4A 4TQUS 2B29A 4TVAB 4JI0Q 4YWKA 5M5YH 3KJPA 1MJCA 1UWVA 3A0JA 2BA0A 2GVBA 3I2ZA 4C3IH 4X62Q 3A5UA 3CCEA 4DV5L 2YV5A 5C44G 4JI7Q 4BY7G 4A93G 3GTMH 5M5WH 3RLFA 2JA9A 1XPUA 2ATWA 1TXYA 1E3PA 3S1RH 1EIFA 3AFQA 3HKZE 4QJFA 5ELOA 4JC0A 4DV1L 1N36L 3S1QH 4GKJQ 4K0KQ 2R93G 3Q8DA 1N33Q 2BH8A 2K50A 2R6GA 4H02A 5IWAQ 1K8AC 3CP0A 3K81C 4LNQA 1RL2A 3PUXA 5IP7G 4BA2I 1JJGA 4GLVB 2JA7G 4GS3A 5C4XG 1TWCH 4QL5A 5IYBG 3HOUH 1H95A 1CKNB 4APVA 3H0GH 5IP9G 1T9HA 1B70B 4YCUA 4LF5L 1SROA 5LMUQ 3H3VH 4OO1G 4HJ5A 2E2JH 2UUAL 1SLJA 2NZOA 3VDYA 1UE5A 4DV4Q 4DR1L 2JA5G 5H1SE 3CCQA 1LYLA 2I0QA 4DAMA 1HH2P 2ZM6L 1A62A 3AYHB 5AJ3Q 4JBWA 3KLWA 3PGZA 4P73A 1XJVA 4A3MG 1OXVA 2OQ0A 2JA6G 2B3GA 4JBJA 1L1OA 3S24A 4HJAA 4A3EG 1M90C 1KQSA 2ZJQA 4LF9L 3KYHC 4DR7Q 5LMNW 3E9HA 2WP8J 3F2CA 2UXDQ 3W1GA 1KL9A 2ZJRA 4A3IG 4R4QA 4NXMQ 4DR3Q 3PCOB 1VQCA 5J3BA 4DV4L 2NVXH 4DV6L 1YHAA 4PZ6A 5C4JH 3GD7A 3UE1A 3OTOQ 4A3JH 1ASZA 4GKKQ 4DR6L 4Y52H 2Q2HA 2FXQA 4L5TA 2GVAA 3CCLA 4C3HH 4JI3Q 4DR7L 1HNWQ 2RHSB 1Q81C 4B3TQ 4KHPL 3G71A 2CQOA 1GVPA 2NZHA 4B3SQ 2MO0A 2E2IH 2HT1A 4A3DG 1WI5A 4DR3L 1Q86C 1C9OA 1FL0A 1VQEA 4J15A 1HNZL 4BBRH 2R92G 2R93H 1Q1BA 2YTXA 3CQZH 1PV4A 2NN6G 1MJEA 5FJ8G 1HR0L 4LF6L 2Y0SG 3W5OA 4A3KG 5EAYA 3MXNB 3S2HH 3PV0A 5IP7H 1A63A 3FKIH 1YI2A 2LSSA 4GN5A 2HHHL 4GOPC 1U0LA 1G6PA 1HNWL 3CMAA 5M3FH 1D8LA 4UP7A 2Q2TA 4B3TL 3HOVG 1L0WA 2L15A 4QIWE 4DUYL 4X64Q 1IBLQ 4BBSH 4XIGS 1JJ2A 2RCNA 4P74A 1QZGA 1VCIA 1XMOQ 3S14H 3DM3A 2QGQA 1QUQA 2VZAA 4BY1G 1KHIA 5IE8A 1E1OA 5C3EG 1YVCA 4A3LH 2D0OA 3OW2A 4B3RQ 1WCMH 1N9WA 1JJCB 2JE6I 2K14A 5IYDH 4YWMA 3CCVA 3TEHB 4A3GH 3A5ZB 3I4NG 1EIYB 2JA6H 4C3JH 2KCMA 2WB1E 1WYDA 1XMQL 3D0FA 2F4VQ 3EIVA 3ERSX 4B3ML 4JBMA 2YTVA 1IZ6A 3PF5A 4O2DA 5GQOA 3M7NA 3M4QA 3GTOH 1VQ6A 1KC8C 4JCVE 1S40A 4LW1A 4NXNL 2K5NA 4DR2Q 3PO3H 4P71A 1I50H 1VQIA 1J6QA 4IPDA 3GTPH 3IRBA 5LMNQ 2DGYA 4LF8L 3B6YA 4XTCS 4IPHA 2R7ZH 4DK3C 1VQOA 3G48A 4IPCA 1HZBA 4JI6L 1B8AA 4L5RC 4HIOA 4LF4L 4L5QA 3UE0A 4DPGA 1X3GA 3PUWA 4DV7L 3WWVA 2YTYA 3TS0A 3RN5A 3BJUA 4GLXA 1HZ9A 2UUCQ 1N32Q 1CSQA 3I7FA 1LTLA 5FLMH 3HOXG 2A8VA 5FLXc 4LFCQ 1K3RA 1FJGQ 4JI2Q 4UPAA 3M4OH 5M3MH 4LUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUV A;  4GNX A;  1WOC A;  2ZTC A;  2VS1 A;  1X65 A;  2UXB Q;  1Q1E A;  3H3V I;  1GO3 E;  4A3F H;  2B63 H;  4OWX B;  3UDI A;  3RNU A;  2OQK A;  2D62 A;  4DR4 Q;  3M85 A;  1M1K C;  2Z0S A;  3PO2 G;  1LM0 A;  5GAE C;  1IL2 A;  2PNH A;  1FGU A;  1HJP A;  4YCV A;  4LFA L;  1NE3 A;  4A3C G;  1K8G A;  2PI2 A;  3GDE A;  5ELN A;  1PH7 A;  1PH5 A;  2UUC L;  3T1Y Q;  3CC4 A;  4JI0 L;  4DNI A;  1WJJ A;  2ALY B;  1PH6 A;  1HNX Q;  4LFC L;  4X62 L;  1VQ5 A;  4JI8 Q;  1QVC A;  1RIP A;  4JI7 L;  1FJG L;  3U4V A;  1KIX A;  3KFU A;  4WJ4 A;  4JI4 Q;  3OYY A;  2E8G A;  4AYB E;  4C2M H;  5GAG C;  4IO9 A;  3W1B A;  2VUM H;  3S1N H;  2EXD A;  1V43 A;  4GKJ L;  2AHO B;  1UE6 A;  2VY3 A;  3STB D;  1N34 Q;  1K9M C;  2JA8 G;  2EQS A;  1EOV A;  2YYZ A;  3KDF A;  1N33 L;  4BXX H;  4K0K L;  4UP8 A;  4Y7N H;  2PQA A;  1UEB A;  1EQR A;  1EYG A;  3EBE A;  3I4N H;  5IWA L;  3CD6 A;  1UE7 A;  3ULJ A;  3ICE A;  1CUK A;  1EUJ A;  4YCW A;  4JOI A;  2JEA I;  5IYC G;  3I55 A;  4A3B G;  1X3F A;  2HQL A;  4AH6 A;  2WB1 G;  5JJL A;  4LFB Q;  1E7Z A;  4IOA A;  4O0A A;  1R9T H;  4POF A;  2NVQ H;  3KF6 A;  4JI8 L;  1YEZ A;  1IXR A;  1VQM A;  4IOC A;  4A75 A;  1A0I A;  4QGU A;  3PIP A;  2IX0 A;  5LMU L;  4R4C A;  4MNO A;  1PH1 A;  4IFD J;  3TRZ A;  2ES2 A;  3TRE A;  2QA4 A;  4YWL A;  3NEM A;  3F2B A;  1PHJ A;  2CCZ A;  1VQA A;  3JAM i;  4X65 Q;  3HOZ H;  4AQY Q;  2UXC Q;  3FHW A;  4IJL A;  3KF8 B;  5AJ3 L;  3HOY H;  3K80 C;  4EX5 A;  1VQB A;  4IFD I;  2R7F A;  4L5S A;  4OX9 Q;  1PH3 A;  1X3E A;  3M3Y H;  1VQH A;  1G29 1;  4HID A;  1IBK Q;  1MIU A;  1JB7 A;  2R7D A;  5GRO A;  3STB C;  5C44 H;  3I4M G;  2XTI A;  4DV2 Q;  4BY7 H;  2UXD L;  3CPF A;  1L1O B;  4OON A;  4DUZ Q;  4A93 H;  4OWW B;  2UUB Q;  1N8R C;  2MQH A;  3PSI A;  4NXM L;  3M9B A;  3JAM c;  1IBM Q;  1VQK A;  2RHQ B;  2UU9 Q;  1V1Q A;  1XNR Q;  1Q12 A;  3TS2 A;  1NBW A;  1SMX A;  4EQ5 A;  2Q2U A;  4POG A;  3HKZ G;  1AE3 A;  4RG1 A;  1XNQ Q;  3OTO L;  4P75 A;  1E1T A;  2CWA A;  2K52 A;  1QZH A;  1VQ8 A;  4GKK L;  3A74 A;  2VQF Q;  2AKW B;  1Q7Y C;  2E2H H;  2JA7 H;  3S1M H;  2IT1 A;  3J7A 5;  4JI3 L;  5C4X H;  2NVT H;  1KRS A;  5E7N A;  5IT9 c;  5IYB H;  1L2F A;  2E5L Q;  1JMC A;  5IP9 H;  4R4I A;  4B3S L;  4A76 A;  4JYA Q;  3ULL A;  1AH9 A;  3F8T A;  3PUZ A;  1Q8K A;  2ID0 A;  4AYB G;  1XNR L;  2VW9 A;  2A1A A;  2WFW A;  4KHZ A;  2JA5 H;  2CFM A;  3MEF A;  4X66 Q;  1VS0 A;  4ALP A;  3S16 H;  1XPR A;  3L0O A;  4ME3 A;  3PIO A;  1X54 A;  4WJ3 M;  1SR3 A;  1YHB A;  2JK8 A;  4DK6 C;  3ULP A;  4DV0 Q;  4A3M H;  3CC7 A;  1TWH H;  2N49 A;  3DLL A;  2Z6K C;  4YY3 Q;  4A3E H;  2E5L L;  1X56 A;  4JI5 Q;  1KXL A;  4AIM A;  1OTC A;  3RLN A;  4X64 L;  4A3I H;  1IBL L;  1OXU A;  4YHH Q;  1XMO L;  3HOU G;  3H0G G;  4GNX C;  1VQD A;  1VQL A;  3NEN A;  1YJ9 A;  5K36 G;  4JV5 Q;  5IY0 A;  4LF7 Q;  3GO5 A;  1PA6 A;  1GM5 A;  3RZD H;  1QUQ B;  4NPS A;  1K73 C;  3GTQ H;  2IY5 B;  3S17 H;  4B3R L;  3AFP A;  4GN4 B;  4DR5 Q;  3PUY A;  5C0X J;  1GKH A;  3U50 C;  3FP9 A;  1FVI A;  1E22 A;  3CCU A;  4YY3 L;  4GOP A;  3G6E A;  4DV3 Q;  2F4V L;  4LUV A;  2AMC B;  2OTL A;  1J5E Q;  1AE2 A;  5JEA G;  2VQE Q;  2VL6 A;  3AQQ A;  3HKS A;  3J7Z C;  1SFO H;  4UY8 C;  5JJI A;  1A8V A;  4A3D H;  3F1Z A;  5C0X I;  3HOW H;  4DV5 Q;  2EIF A;  4KLK A;  5M5X H;  1VQG A;  4DR2 L;  3K7U C;  1HR0 W;  3AEV A;  2R92 H;  2VNU D;  1SN8 A;  1XTD A;  5FJ8 H;  5LMN L;  2N3S A;  5JEA J;  1Y14 B;  2XGT A;  2JJQ A;  1N36 Q;  1EWI A;  3PF4 A;  2ASB A;  3CCJ A;  2I5M X;  4A3K H;  2ZTE A;  1JE5 A;  3CC2 A;  4A3J G;  1NJI C;  4JOI C;  3CCS A;  1QVG A;  3HOV H;  1N32 L;  5GAH C;  4A4I A;  4IJH A;  1YHQ A;  1OXX K;  2VQE L;  1J5E L;  1Y1W H;  1CKN A;  1Y1V G;  1Z9F A;  1PH4 A;  1L1O C;  4JI2 L;  1PFS A;  4LWC A;  1NTG A;  4R4T A;  4MTN A;  1Z47 A;  1I5F A;  3UDF A;  1KRT A;  1PH9 A;  2UXB L;  4LF5 Q;  4BY1 H;  1VQJ A;  4GNX B;  1NY4 A;  5C3E H;  1S72 A;  3CW2 C;  1K83 H;  3KOJ A;  2UUA Q;  1SE8 A;  3GTL H;  1I6H H;  4BBR G;  1P8L A;  4DR1 Q;  4DR4 L;  2Y0S E;  1BBU A;  2JQO A;  2ZM6 Q;  3HFZ B;  4IFD G;  4X6A H;  2K5V A;  2IX1 A;  4BA1 I;  4JI1 Q;  3T1Y L;  1S3O A;  3FKI G;  3LGJ A;  1HNX L;  1LUZ A;  1W2B A;  1I94 Q;  2IHE A;  1CSP A;  2KEN A;  1PVO A;  1KD1 C;  4LF9 Q;  2QEX A;  5M3F G;  5GAD C;  4JI4 L;  3CAM A;  4GLA C;  4BBS G;  1O7I A;  3KJO A;  1B7Y B;  1MKH A;  1PH8 A;  1YIT A;  5JJK A;  1N34 L;  3J81 i;  4GN3 B;  4DV6 Q;  4HJ8 A;  1PH2 A;  3G4S A;  1VQ9 A;  3KDF B;  4DKA C;  3E0E A;  4OXP A;  1NMG A;  4PZ7 A;  4A3L G;  2PQA B;  1WCM G;  5IYD G;  4DR6 Q;  1PYB A;  4JI1 L;  4LFB L;  4A3G G;  3HOX H;  3ER0 A;  3EN2 A;  1I94 L;  2N8N A;  1Q46 A;  4LUO A;  4UP9 A;  2MFI A;  1HZA A;  3BU2 A;  3KF6 B;  3CPW A;  2DUD A;  2AWN A;  2OWO A;  4KHP Q;  4QQB X;  4QY7 A;  3J81 c;  1PYS B;  3ZJY C;  1ASY A;  4OO1 I;  3CF5 A;  4PMW A;  3K0X A;  2V1C C;  4HIM A;  1U5K A;  1HNZ Q;  1VQF A;  3RR5 A;  3PO3 G;  3PO2 H;  4MZ9 A;  4X65 L;  2ZJP A;  4AQY L;  1VQN A;  2UXC L;  1X55 A;  1EFW A;  2K75 A;  1HR0 Q;  4LF6 Q;  4HJ9 A;  5BR8 Q;  1WFQ A;  3CCR A;  2R7Z G;  4A3C H;  2OTJ A;  4OX9 L;  3CXC A;  1V9P A;  2OCE A;  1CKM A;  2KCT A;  2WAQ E;  3K7A H;  4RMF A;  3J80 i;  1NMF A;  1UE1 A;  1P16 A;  1Y1V H;  2ZTD A;  3TQY A;  3U58 A;  1IBK L;  2HHH Q;  1QVF A;  3RZO H;  4OWT B;  1YZ6 A;  1BKB A;  2KHJ A;  2AWO A;  2I5L X;  3BZK A;  4JG2 A;  1DGS A;  5HY6 A;  4DV2 L;  1X9N A;  1X6O A;  4DUZ L;  1E24 A;  2MO1 A;  2HIV A;  5FLM G;  4R4O A;  2UUB L;  4DUY Q;  3HOW G;  1IBM L;  2UU9 L;  1D7Q A;  1OXT A;  1Y1W G;  3S15 H;  5M3M G;  3CCM A;  1TWG H;  2JA8 H;  2KHI A;  4DAY B;  3GTK H;  2BA1 A;  2H5X A;  1GD7 A;  2F52 A;  3UDX A;  4IPG A;  1XNQ L;  2D0P A;  3J80 c;  1C0A A;  1Q82 C;  4A3F G;  1TWF H;  2LXK A;  3E9I A;  5BR8 L;  5IYC H;  2B63 G;  2VQF L;  3SGI A;  4A3B H;  2LXJ A;  3M4P A;  3T1H Q;  2RF4 A;  3U4Z A;  1CKO A;  2C35 B;  3BZC A;  1XMQ Q;  2CWP A;  3L7Z C;  1HZC A;  3NBH B;  3CME A;  2YU9 H;  4B3M Q;  3K8A A;  1BVS A;  3J81 j;  1YNX A;  2MNA A;  4JYA L;  1BBW A;  5HGQ A;  5C0X G;  2PI2 E;  3UDG A;  3D31 A;  3JC6 6;  4NXN Q;  3NEL A;  4R1J A;  4X66 L;  1TWA H;  3RN2 A;  2F3I A;  2NN6 I;  2VUM G;  1W3S A;  2A19 A;  3RLO A;  4LF8 Q;  1YBY A;  1XPO A;  4BXX G;  4DV0 L;  5DLQ E;  4JI6 Q;  3T1H L;  3I56 A;  2NVY H;  4LF4 Q;  1EQQ A;  3S2D H;  4DV7 Q;  2K4K A;  1OXS C;  3I4M H;  1JT8 A;  1KAW A;  1C7Y A;  4JI5 L;  1K0R A;  2KBN A;  4HIK A;  4JBK A;  4YHH L;  2IHF A;  2PMZ E;  1IYJ B;  4PG3 A;  3GTJ H;  4PZ8 A;  2I5H A;  1G51 A;  4P72 A;  2N78 A;  2GN5 A;  4NB3 A;  1YJN A;  4JV5 L;  4LF7 L;  2HIX A;  2CKZ B;  2Q2I A;  1YJW A;  1VQP A;  3GTG H;  4KI0 A;  4DV1 Q;  3H15 A;  3I4O A;  1VQ7 A;  4DR5 L;  3F2D A;  1SRU A;  3L2P A;  2JEB I;  3HOZ G;  2K5H A;  2Z6K A;  4LFA Q;  3HOY G;  2WAQ G;  4DV3 L;  1I3Q H;  4HJ7 A;  1YIJ A;  4FDB A;  2BH2 A;  4GOP B;  1VQ4 A;  4TQU S;  2B29 A;  4TVA B;  4JI0 Q;  4YWK A;  5M5Y H;  3KJP A;  1MJC A;  1UWV A;  3A0J A;  2BA0 A;  2GVB A;  3I2Z A;  4C3I H;  4X62 Q;  3A5U A;  3CCE A;  4DV5 L;  2YV5 A;  5C44 G;  4JI7 Q;  4BY7 G;  4A93 G;  3GTM H;  5M5W H;  3RLF A;  2JA9 A;  1XPU A;  2ATW A;  1TXY A;  1E3P A;  3S1R H;  1EIF A;  3AFQ A;  3HKZ E;  4QJF A;  5ELO A;  4JC0 A;  4DV1 L;  1N36 L;  3S1Q H;  4GKJ Q;  4K0K Q;  2R93 G;  3Q8D A;  1N33 Q;  2BH8 A;  2K50 A;  2R6G A;  4H02 A;  5IWA Q;  1K8A C;  3CP0 A;  3K81 C;  4LNQ A;  1RL2 A;  3PUX A;  5IP7 G;  4BA2 I;  1JJG A;  4GLV B;  2JA7 G;  4GS3 A;  5C4X G;  1TWC H;  4QL5 A;  5IYB G;  3HOU H;  1H95 A;  1CKN B;  4APV A;  3H0G H;  5IP9 G;  1T9H A;  1B70 B;  4YCU A;  4LF5 L;  1SRO A;  5LMU Q;  3H3V H;  4OO1 G;  4HJ5 A;  2E2J H;  2UUA L;  1SLJ A;  2NZO A;  3VDY A;  1UE5 A;  4DV4 Q;  4DR1 L;  2JA5 G;  5H1S E;  3CCQ A;  1LYL A;  2I0Q A;  4DAM A;  1HH2 P;  2ZM6 L;  1A62 A;  3AYH B;  5AJ3 Q;  4JBW A;  3KLW A;  3PGZ A;  4P73 A;  1XJV A;  4A3M G;  1OXV A;  2OQ0 A;  2JA6 G;  2B3G A;  4JBJ A;  1L1O A;  3S24 A;  4HJA A;  4A3E G;  1M90 C;  1KQS A;  2ZJQ A;  4LF9 L;  3KYH C;  4DR7 Q;  5LMN W;  3E9H A;  2WP8 J;  3F2C A;  2UXD Q;  3W1G A;  1KL9 A;  2ZJR A;  4A3I G;  4R4Q A;  4NXM Q;  4DR3 Q;  3PCO B;  1VQC A;  5J3B A;  4DV4 L;  2NVX H;  4DV6 L;  1YHA A;  4PZ6 A;  5C4J H;  3GD7 A;  3UE1 A;  3OTO Q;  4A3J H;  1ASZ A;  4GKK Q;  4DR6 L;  4Y52 H;  2Q2H A;  2FXQ A;  4L5T A;  2GVA A;  3CCL A;  4C3H H;  4JI3 Q;  4DR7 L;  1HNW Q;  2RHS B;  1Q81 C;  4B3T Q;  4KHP L;  3G71 A;  2CQO A;  1GVP A;  2NZH A;  4B3S Q;  2MO0 A;  2E2I H;  2HT1 A;  4A3D G;  1WI5 A;  4DR3 L;  1Q86 C;  1C9O A;  1FL0 A;  1VQE A;  4J15 A;  1HNZ L;  4BBR H;  2R92 G;  2R93 H;  1Q1B A;  2YTX A;  3CQZ H;  1PV4 A;  2NN6 G;  1MJE A;  5FJ8 G;  1HR0 L;  4LF6 L;  2Y0S G;  3W5O A;  4A3K G;  5EAY A;  3MXN B;  3S2H H;  3PV0 A;  5IP7 H;  1A63 A;  3FKI H;  1YI2 A;  2LSS A;  4GN5 A;  2HHH L;  4GOP C;  1U0L A;  1G6P A;  1HNW L;  3CMA A;  5M3F H;  1D8L A;  4UP7 A;  2Q2T A;  4B3T L;  3HOV G;  1L0W A;  2L15 A;  4QIW E;  4DUY L;  4X64 Q;  1IBL Q;  4BBS H;  4XIG S;  1JJ2 A;  2RCN A;  4P74 A;  1QZG A;  1VCI A;  1XMO Q;  3S14 H;  3DM3 A;  2QGQ A;  1QUQ A;  2VZA A;  4BY1 G;  1KHI A;  5IE8 A;  1E1O A;  5C3E G;  1YVC A;  4A3L H;  2D0O A;  3OW2 A;  4B3R Q;  1WCM H;  1N9W A;  1JJC B;  2JE6 I;  2K14 A;  5IYD H;  4YWM A;  3CCV A;  3TEH B;  4A3G H;  3A5Z B;  3I4N G;  1EIY B;  2JA6 H;  4C3J H;  2KCM A;  2WB1 E;  1WYD A;  1XMQ L;  3D0F A;  2F4V Q;  3EIV A;  3ERS X;  4B3M L;  4JBM A;  2YTV A;  1IZ6 A;  3PF5 A;  4O2D A;  5GQO A;  3M7N A;  3M4Q A;  3GTO H;  1VQ6 A;  1KC8 C;  4JCV E;  1S40 A;  4LW1 A;  4NXN L;  2K5N A;  4DR2 Q;  3PO3 H;  4P71 A;  1I50 H;  1VQI A;  1J6Q A;  4IPD A;  3GTP H;  3IRB A;  5LMN Q;  2DGY A;  4LF8 L;  3B6Y A;  4XTC S;  4IPH A;  2R7Z H;  4DK3 C;  1VQO A;  3G48 A;  4IPC A;  1HZB A;  4JI6 L;  1B8A A;  4L5R C;  4HIO A;  4LF4 L;  4L5Q A;  3UE0 A;  4DPG A;  1X3G A;  3PUW A;  4DV7 L;  3WWV A;  2YTY A;  3TS0 A;  3RN5 A;  3BJU A;  4GLX A;  1HZ9 A;  2UUC Q;  1N32 Q;  1CSQ A;  3I7F A;  1LTL A;  5FLM H;  3HOX G;  2A8V A;  5FLX c;  4LFC Q;  1K3R A;  1FJG Q;  4JI2 Q;  4UPA A;  3M4O H;  5M3M H;  4LUZ A; 
#chains in the Genus database with same CATH topology
 3PUV A;  4GNX A;  1WOC A;  3VYU A;  2C5C A;  1Q1E A;  1RTO A;  3H3V I;  4C56 C;  4YIJ A;  4OWX B;  1KDC A;  2OQK A;  2D62 A;  3HOY B;  2WAQ B;  4HMI A;  2Z0S A;  3PO2 G;  1LO5 D;  1V1P B;  5IT9 L;  3GDE A;  1PH5 A;  2MPM A;  3CC4 A;  4JI0 L;  1EEI D;  4QMG A;  1SNQ A;  2ALY B;  5FLX E;  1QVC A;  2J7Z A;  4G7O C;  3U4V A;  3WOF A;  4DU9 A;  1ROD A;  3PIP 3;  3OYY A;  4AYB E;  1EY8 A;  1CM9 A;  2SDF A;  3V96 A;  3MFY A;  4GKJ L;  2VY3 A;  4G7H C;  4K0K L;  1EOV A;  2YYZ A;  4TSS A;  2K32 A;  4CDF C;  1EQR A;  1EYG A;  3I4N H;  3ULJ A;  3ICE A;  1EUJ A;  2JEA I;  1ML0 D;  2F0F A;  1MI2 A;  2NVT B;  1S5E D;  5IOC A;  4LFB Q;  4IOA A;  1R9T H;  1U4L A;  5I4D A;  2DJF C;  1IHZ A;  4MNO A;  2B2Y C;  5F2D A;  1PH1 A;  4ZCK A;  1CZG A;  1SYB A;  2P5Z X;  1JWS D;  3NEM A;  4CGY B;  5ELB A;  4DAV A;  4A3M B;  3KF8 B;  4IFD I;  1PH3 A;  1VQH A;  2KCC A;  1JB7 A;  3DMU A;  1A2T A;  3I73 A;  5EGT A;  4BY7 H;  2UXD L;  4OON A;  1AW7 A;  2UUB Q;  2PPB C;  4DAY A;  5CV4 A;  1IBM Q;  1I4Q A;  2RHQ B;  1CI3 M;  1SMX A;  4EQ5 A;  3S17 B;  3ITP A;  3HKZ G;  4RG1 A;  1D6E C;  5JVG 3;  1AZP A;  2CWA A;  5T1I A;  4EVO A;  2VQF Q;  2AKW B;  3NQT A;  2JA7 H;  3S1M H;  3J7A 5;  2EYL A;  3NBH A;  1EZ6 A;  5E7N A;  5IT9 c;  3D4D A;  3BZD B;  5IP9 H;  5EPL A;  4B3S L;  3MA2 B;  2EYF A;  5M5X B;  4C3I G;  3OPO A;  3JAM E;  2KVM A;  4MN3 A;  1XNR L;  2VW9 A;  4HN7 A;  4F87 A;  2IL8 A;  4X66 Q;  3S16 H;  3FPP A;  2K7V A;  1KTK A;  1XPR A;  1X54 A;  3R8B A;  4WJ3 M;  1SR3 A;  1YHB A;  4RGN A;  1CFM A;  2CH4 A;  1S5F D;  1TWH H;  3NPP A;  1F2L A;  2F0U A;  3TME A;  3QR8 A;  2E5L L;  4JI5 Q;  3NWS A;  1OXU A;  3H09 A;  2A6H D;  4YHH Q;  2A74 C;  3R3O A;  3NEN A;  5K36 G;  4JV5 Q;  1PA6 A;  1GM5 A;  5E1F A;  3GTQ H;  2IY5 B;  3I4N B;  4B3R L;  4GN4 B;  4F88 A;  3PUY A;  5C0X J;  1GUS A;  2HCC A;  1SDF A;  1SBB B;  3G6E A;  1AE2 A;  4UY8 C;  3AQQ A;  3MC0 B;  5JJI A;  1A8V A;  1MBY A;  2EJF C;  3J7A F;  1BR9 A;  3F1Z A;  4A3D H;  2EIF A;  1CK1 A;  2F0P A;  4KLK A;  4RKB A;  1VQG A;  4DR2 L;  3K7U C;  3VYR A;  1SN8 A;  3QOJ A;  2NN6 H;  1EOT A;  3MVV A;  5FJ8 H;  4IUP A;  4CJ2 C;  2ASB A;  4G4K A;  4JVZ A;  3CCJ A;  4A3K H;  3R2I A;  3OHX C;  3CKI B;  1NJI C;  3HOX B;  3CCS A;  1QVG A;  3HOV H;  1ICW A;  1J5E L;  1XWE A;  5CBE E;  5DEH A;  1GUG A;  4JI2 L;  3LNN A;  4LWC A;  4XT1 B;  1Z47 A;  4G7Z C;  2EPB A;  4OL7 A;  1VQJ A;  3K58 A;  5C3E H;  3A56 A;  3KOJ A;  3GTL H;  2B2T A;  1I6H H;  2KEC A;  5C3X A;  2ZXP A;  4FXG C;  4DR1 Q;  4HSV A;  1VMC A;  2KCN A;  2Y0S E;  1CQV A;  1KAB A;  4IFD G;  3RZO B;  2IX1 A;  4BA1 I;  4JI1 Q;  4QIW B;  4KN4 C;  5IGB A;  1I94 Q;  5E4W C;  2KEN A;  3K5N A;  4KMU C;  3C2P A;  1ENF A;  1I4P A;  1LTA D;  3OIQ A;  1S5C D;  1PH8 A;  1MKH A;  1YIT A;  5JJK A;  5I2X A;  1ZYR D;  3J81 i;  1YNJ C;  1PH2 A;  2B39 A;  1VQ9 A;  3KDF B;  3LWU A;  1NMG A;  5IYD G;  4H44 C;  2V4D A;  5IGG A;  4LFB L;  3I3C A;  2YU9 B;  4K6D A;  1Q46 A;  2PMZ B;  1MSH A;  4JK1 C;  1HZA A;  1HNZ Q;  4HIM A;  3MXN A;  1B44 D;  4A3C H;  2OTJ A;  2MP1 A;  1UNS A;  3I4M B;  5D65 A;  3KFU A;  2J0T D;  1F2M A;  1P16 A;  2ZTD A;  4OWT B;  3BZK A;  1SYF A;  3Q0A A;  5FLX L;  1DGS A;  1RJT A;  1NR4 A;  4M8A A;  2UUB L;  3U9S A;  1X3Q A;  2KEE A;  1IBM L;  1Y1W G;  5M3M G;  3CCM A;  3GTG B;  2JA8 H;  1TY2 A;  1B3Q A;  4IPG A;  2ICI A;  5G3L F;  2HQE A;  5IYC H;  2VQF L;  3SGI A;  2F0W A;  2RF4 A;  1CKO A;  2C35 B;  3CU7 A;  5CV5 A;  3L7Z C;  2DNC A;  3HRZ C;  3EFX D;  3GTM B;  1BBW A;  1DJR D;  3DXJ C;  4CJ0 B;  1JWM D;  2X69 A;  1UAP A;  3D31 A;  3ERQ A;  4X66 L;  4QCL A;  3RN2 A;  2F3I A;  2NN6 I;  3SEB A;  3SK4 A;  3A7A B;  1YBY A;  4CKC A;  1HUM A;  2K5Q A;  5DLQ E;  2NVY H;  4LF4 Q;  3S2D H;  1OXS C;  1EFI D;  1TWC B;  5G3L D;  4JI5 L;  3HOU B;  4CBV A;  4DXF A;  3ONA B;  2KBN A;  4HIK A;  4YHH L;  5LL6 S;  1IYJ B;  4P72 A;  2N78 A;  4JV5 L;  1EY6 A;  2CKZ B;  2F4I A;  1YJW A;  1TY0 A;  4DV1 Q;  3I4O A;  2L11 A;  1V1P A;  3R2T A;  1SRU A;  1H9R A;  3E3X A;  2A6H C;  3BYT B;  1YIJ A;  1A3T A;  5T1G A;  1VQ4 A;  4YWK A;  3OW7 A;  1UWV A;  3A0J A;  3A5U A;  4X62 Q;  5E4X A;  4JI7 Q;  5ELF A;  4F7X A;  3JAM L;  4BY7 G;  3BDC A;  5M5W H;  2JA9 A;  1TXY A;  1GUW A;  2OXP A;  1HFG A;  3AFQ A;  4QJF A;  5ELO A;  4JC0 A;  1SEB D;  1WTW A;  1K3B C;  1D2B A;  3CP0 A;  1STA A;  3LX0 A;  4C3H B;  5IP7 G;  3BG3 A;  2JA7 G;  1A3U A;  4GS3 A;  1G2T A;  2F0M A;  3DWA A;  4APV A;  1CHQ D;  3H0G H;  3U9O A;  2K33 A;  5IP9 G;  1G91 A;  1STE A;  5IIF A;  2SNS A;  1S5B D;  2MJ8 A;  4PMC A;  4ZK9 B;  5LMU Q;  1BXT A;  1SLJ A;  1Y8P B;  4DR1 L;  5H1S E;  1S5D D;  3KF8 A;  2WB1 B;  4QUF A;  3S2H B;  1A62 A;  3KLW A;  1I4G A;  4ZYS A;  5LHY 1;  5JEA H;  1E2Z A;  5M3F B;  2JA6 G;  3SE0 A;  4JBJ A;  2ZJQ A;  2Z4I A;  3S24 A;  1M90 C;  4ZKC B;  4DR7 Q;  4BBS B;  1L0Y B;  2B2U C;  3D6W A;  3S14 B;  1KL9 A;  2ZJR A;  4R4Q A;  4DR3 Q;  3VR2 A;  5LL6 X;  4ULL A;  4DV4 L;  3FMC A;  2PCF B;  1PYW D;  1WCM B;  1YHA A;  1KLU D;  3OTO Q;  1ENC A;  4A3G B;  1JWU D;  4GKK Q;  2CQA A;  4OHJ A;  2XSC A;  1WTX A;  2GVA A;  2WIN B;  2ZXO A;  4JI3 Q;  1EU3 A;  1F9R A;  4F8M A;  1ZYR C;  3GTO B;  2MO0 A;  1TT2 A;  2E2I H;  4FXD A;  2HT1 A;  4A3D G;  3PO3 B;  1HNZ L;  4IUN A;  3GTP B;  3BDL A;  1Q1B A;  1SAP A;  4EQP A;  2NN6 G;  5FJ8 G;  3OIP A;  4WFN 3;  2Y0S G;  2EJM A;  3W5O A;  2EY1 A;  5EAY A;  4A3K G;  1YI2 A;  5IGD A;  1G6P A;  3HG9 A;  1HA6 A;  1VF5 C;  1HNW L;  5TSS A;  3CMA A;  2Q2T A;  4B3T L;  3HOV G;  4X64 Q;  1WTP A;  3D8G A;  4IQZ A;  3TP8 A;  4IUU A;  1HUN A;  4P74 A;  5BN4 A;  5COY A;  3NP8 A;  2VZA A;  1KHI A;  5C3E G;  1YVC A;  4A3L H;  2D0O A;  1JJC B;  1NUC A;  1EIY B;  4C3J H;  2KCM A;  1BOS A;  1KNE A;  4HSP A;  2AQ2 B;  3KBG A;  1IZ6 A;  2EJG C;  3M4Q A;  5D3I B;  1VQ6 A;  4Z9C B;  2VUM B;  2PZT A;  1DXM A;  3I72 A;  5LMN Q;  3B6Y A;  2R7Z H;  4OIK A;  4ZAI A;  2BOS A;  4IPC A;  4KY5 A;  4LF4 L;  3NBI A;  1X3G A;  3PUW A;  4X3T A;  2FFK B;  2YTY A;  3RN5 A;  2EZV A;  2EYH A;  3H91 A;  3D4W A;  2K01 A;  4B9W A;  2A8V A;  3M4O H;  1RD9 D;  2ZTC A;  3M4Y A;  3C1F A;  4A3F H;  2F0V A;  4FF4 A;  3UDI A;  3RNU A;  4N8F A;  3M85 A;  1D5X C;  1JR0 D;  2NZ1 D;  4ODG A;  5GAE C;  2PNH A;  4A3C G;  5CYU A;  2PI2 A;  4E6I A;  2F0H A;  4X62 L;  2Z4H A;  4JI7 L;  4XYQ A;  4TKO B;  4JI4 Q;  4C2M H;  2F0N A;  5DNF A;  3W1B A;  3S1N H;  2EXD A;  2NBF A;  1STN A;  2IPK D;  2JA8 G;  1N34 Q;  3KDF A;  4Y7N H;  2QEJ C;  1EIG A;  3EBE A;  1UE7 A;  1Z6H A;  5IYC G;  1B1Z A;  1X3F A;  5L37 A;  2WB1 G;  1QNU A;  4O0A A;  1M4V A;  4NW2 A;  2HD3 A;  4A75 A;  1EEF D;  2G5D A;  4QGU A;  5LMU L;  2DN8 A;  1X3P A;  4IFD J;  2JA5 B;  3IFT A;  1VDZ A;  2D9U A;  3LWE A;  1JB3 A;  4YWL A;  2CCZ A;  3AB9 A;  3JAM i;  1ESR A;  3HOY H;  2SOB A;  1VQB A;  2R7F A;  2A5H A;  4A3E B;  1HHV A;  5K5P A;  3T4A C;  3AMU A;  2CVR A;  1MIU A;  4KKT A;  2R7D A;  4A3I B;  5GRO A;  2X6G A;  3STB C;  3URY A;  3CPF A;  2SEB D;  1NCV A;  4OWW B;  2MQH A;  3M9B A;  2UU9 Q;  1VQK A;  4ZLT F;  1V1Q A;  3VR6 A;  1Q12 A;  1XNR Q;  1JOK A;  4KTA A;  3GV3 A;  2IW3 A;  4DAP A;  1XNQ Q;  3OTO L;  1SND A;  4K5X A;  2RBM A;  1E1T A;  2A69 C;  4GKK L;  4U68 A;  1YNN D;  1Q7Y C;  1PFN A;  1MHW C;  4JI3 L;  2NVT H;  1KRS A;  4JPB W;  5IYB H;  1SFO B;  1L2F A;  4KKS A;  5EBC A;  2E5L Q;  2RSN A;  5EPK A;  4R4I A;  3NK9 A;  1RDP D;  5FO7 B;  4A76 A;  4JYA Q;  3OMC A;  3F8T A;  2ID0 A;  1TS3 A;  3MEF A;  5CV7 A;  2N88 A;  3PIO A;  3J7A V;  4HMJ A;  4A3M H;  3SVM A;  2I46 A;  4CJ1 B;  1OTC A;  3RLN A;  4X64 L;  3K5O A;  4BY1 B;  3DWP A;  3H0G G;  1VQL A;  3OWE B;  1Q8I A;  4LF7 Q;  3GO5 A;  1QUQ B;  3VYT A;  1PZJ D;  1SNC A;  1K73 C;  3S17 H;  1J9O A;  4XQN A;  1II3 A;  3U50 C;  3FP9 A;  2F0E A;  1FVI A;  2EDG A;  4DV3 Q;  1O80 A;  1J5E Q;  5JEA G;  2OT2 A;  5C6A A;  3BVG A;  3J81 L;  1BUV T;  5C4Z A;  1TQO A;  5M5X H;  3SDZ A;  5KIX A;  1B2T A;  1XTD A;  1IKL A;  5LMN L;  1Y14 B;  5CGK A;  2JJQ A;  1N36 Q;  2ZTE A;  5EBD A;  3CC2 A;  4JOI C;  1QCB D;  2PNR C;  1OXX K;  2VQE L;  1NR2 A;  1LLR D;  1YNJ D;  1Z9F A;  4XYO A;  3HEJ A;  4R4T A;  1I5F A;  3UDF A;  1JCK B;  3PMF A;  2JSO A;  1XXG A;  2M2L A;  1BQQ T;  1SYG A;  2UUA Q;  1SE8 A;  1P8L A;  4KD3 A;  1BBU A;  3HFZ B;  4H7B A;  4X6A H;  2RDG A;  4IAL A;  1LUZ A;  1W2B A;  1PVO A;  4LF9 Q;  2QEX A;  5GAD C;  4OIJ A;  4JI4 L;  3CAM A;  1SNM A;  3GTK B;  3SK6 A;  4N9T A;  5FOB B;  1EYA A;  1N34 L;  3MHB A;  1Q90 A;  4EGV A;  5EKI A;  2H1E A;  4GN3 B;  4A3B B;  4DV6 Q;  4HJ8 A;  1CA6 A;  3G4S A;  5D14 A;  4OXP A;  4X3S A;  4PZ7 A;  4A3L G;  2PQA B;  2RSO A;  2LS0 1;  1TR5 A;  3AU7 A;  4RGT A;  3HOX H;  3ER0 A;  3EN2 A;  4C3J G;  4NP5 A;  1TU2 B;  3BU2 A;  3KF6 B;  1BDO A;  2DUD A;  1A15 A;  2BDO A;  1PTO C;  1PYS B;  3J81 c;  1SXT A;  1ASY A;  3CF5 A;  4PMW A;  1A6X A;  3UI2 A;  1U5K A;  1JQY D;  1EIH A;  5DM6 3;  1VQN A;  1GUO A;  2K75 A;  1HR0 Q;  4LK1 C;  4HJ9 A;  2R7Z G;  3CXC A;  1V9P A;  3CME A;  3K7A H;  3ND9 A;  2KCT A;  4J8Q A;  1NMF A;  1UE1 A;  1Y1V H;  2EY6 A;  1QVF A;  2Z1C A;  3RZO H;  1STH A;  2F0T A;  1A3V A;  4HCE A;  1Q3L A;  2KHJ A;  4JG2 A;  5ELC A;  1Y8N B;  2MO1 A;  2WAC A;  4DUY Q;  2UU9 L;  2WV6 D;  3W2D A;  2BA1 A;  2H5X A;  3IKJ A;  1FNW A;  1XNQ L;  2NYZ D;  2PW5 A;  4KK7 A;  3VR5 A;  1Q82 C;  4A3F G;  1ET9 A;  3GV6 A;  2K03 A;  1SSO A;  3U4Z A;  1MGS A;  5M5Y B;  3A55 A;  3BZC A;  4QUC A;  4FNF A;  2CWP A;  4AYB B;  4B3M Q;  1EU4 A;  2YU9 H;  4JYA L;  1BVS A;  3WOE A;  3J81 j;  2MNA A;  5HGQ A;  2PI2 E;  5I9P A;  4TRD A;  1YNN C;  3IFD A;  4Q5V A;  1W3S A;  2BDN A;  2L0C A;  3RLO A;  1HCZ A;  4XT3 B;  2MHV A;  1XTC D;  1SNO A;  3T1H L;  2C9O A;  2K4K A;  3RD4 A;  3I4M H;  1C7Y A;  1BBX C;  1K0R A;  4JBK A;  2PMZ E;  5EKL A;  4PZ8 A;  1YJN A;  4LF7 L;  3GTG H;  4KI0 A;  2TSS A;  1B9M A;  2KUM A;  3F2D A;  3HOY G;  1PZK D;  2WAQ G;  4DV3 L;  1I3Q H;  2BH2 A;  2PO4 A;  4GOP B;  1T5E A;  4TVA B;  3F2U A;  3VYS A;  3C46 A;  1L0X B;  3KJP A;  2BA0 A;  3TP7 A;  2F0O A;  4O42 A;  3HOW H;  5FO9 B;  3FVQ A;  4KY7 A;  3GTM H;  1SYD A;  3RLF A;  2ATW A;  2NVX B;  2F0L A;  3IL8 A;  1N36 L;  4A3J B;  3Q8D A;  1N33 Q;  2CH4 W;  3K7A B;  5IWA Q;  1Y1V B;  3K81 C;  3PUX A;  5KEE A;  4BA2 I;  5JAV A;  1JJG A;  1SYE A;  1TWC H;  2IJ0 A;  4S3S A;  5IYB G;  3HOU H;  1H95 A;  1LT3 D;  1PDQ A;  1B70 B;  2B2W C;  1GUT A;  4BBR B;  1LAB A;  2UUA L;  2NZO A;  3VDY A;  2EY5 A;  1UE5 A;  2M9V A;  4DV4 Q;  3CCQ A;  2MGS A;  2I0Q A;  5COR A;  1QIL A;  1HH2 P;  1DM0 B;  3FKI B;  1LAC A;  3AYH B;  5AJ3 Q;  1ILQ A;  3I91 A;  2EYJ A;  4A3M G;  2L55 A;  4HJA A;  1KQS A;  4LF9 L;  3KYH C;  4RGM A;  5LMN W;  3QO2 A;  2QKI C;  4CDE C;  4NXM Q;  4RCN A;  1F2Y A;  1VQC A;  4OEM B;  1K8M A;  5C5L A;  3K0Y A;  4DV6 L;  3QB3 A;  3UE1 A;  2Q2H A;  1JOO A;  3NWT A;  4C3H H;  1LV9 A;  1HNW Q;  4B3T Q;  1GVP A;  2DNE A;  2B2Y A;  3A54 A;  2KQ3 A;  1VQE A;  1Y69 U;  3TP6 A;  2R93 H;  3KLS X;  3K5L A;  3CQZ H;  1B3A A;  1PZI D;  1HR0 L;  1BCP C;  1I3Q B;  1FNU A;  3S2H H;  3PV0 A;  2LSS A;  4GN5 A;  2K5D A;  3QOL A;  4GOP C;  4EQN A;  3HOW B;  5M3F H;  1L0W A;  1STY A;  3P7J A;  3W3A A;  4DUY L;  4BBS H;  1F9Q A;  1STB A;  2F0G A;  2RCN A;  2PQE A;  3S14 H;  1QUQ A;  5I6W A;  2B63 B;  3H94 A;  1HXY D;  2WII B;  1E1O A;  1WCM H;  4RA8 A;  1N9W A;  4KJO A;  3NE5 B;  4A3G H;  3I4N G;  2WB1 E;  1WYD A;  3D0F A;  3E5S A;  3EIV A;  4B3M L;  4O2D A;  4FYD A;  4IZ8 A;  4DFA A;  3GTO H;  1S40 A;  5FK9 C;  1OO9 B;  3C3L A;  3PO3 H;  1I50 H;  1J6Q A;  2GA4 B;  3GTP H;  4XTC S;  1ZKO A;  4DK3 C;  1VQO A;  5EQ0 A;  2O5I C;  1B8A A;  4L5R C;  4HIO A;  3CRL C;  5CR3 A;  3WWV A;  3H6M A;  3DEP A;  4FF2 A;  2NVQ B;  4H13 C;  4GLX A;  1HZ9 A;  1CSQ A;  3NHH A;  1LTL A;  1F9S A;  2AUJ D;  3HOX G;  5FLX c;  1IL8 A;  4LUZ A;  1EQT A;  2AUK A;  2NTS A;  1GO3 E;  3P75 A;  3HOZ B;  5A2Q E;  2X6L A;  3SHL A;  2XIW A;  4DR4 Q;  3X3N A;  1LM0 A;  1FGU A;  1HJP A;  4YCV A;  1NE3 A;  5KYL A;  4ZKB B;  1K8G A;  5C44 B;  1PH7 A;  1WJJ A;  2XWB B;  1PH6 A;  4A93 B;  4LFC L;  1VQ5 A;  1FJG L;  1R4Q B;  3RUZ A;  1GHJ A;  2R93 B;  2VUM H;  5JPN C;  3CQZ B;  4RKL A;  3N52 A;  1UE6 A;  3MWY W;  3STB D;  1E2V A;  2QF7 A;  4BXX H;  1N33 L;  3E0J A;  1QG7 A;  2PQA A;  5IWA L;  3CD6 A;  2E2H B;  1CUK A;  1DOM A;  1M8A A;  3I55 A;  5C4X B;  3P1H A;  2HQL A;  5BN5 A;  4AH6 A;  2EYM A;  2Q8T A;  5JJL A;  3MTS A;  4POF A;  3KF6 A;  4JI8 L;  3BS1 A;  1O7L A;  2A69 D;  3A7L A;  4I7A A;  3PIP A;  4R4C A;  4CHT B;  2A73 B;  3F2B A;  2EXZ A;  1WTV A;  4I7Z C;  1VQA A;  3KBX A;  1IYU A;  4X65 Q;  4AQY Q;  1PXU A;  3FHW A;  2IX3 A;  2QW7 A;  3L9A X;  5AJ3 L;  3K80 C;  1HPC A;  1I4H A;  1I6V C;  3M3Y H;  1G29 1;  2E2D C;  3VA7 A;  2E74 C;  1IBK Q;  1GXD C;  4DK1 A;  3I4M G;  2XTI A;  2F3V A;  1L1O B;  4DUZ Q;  2B2W A;  1CQF A;  1HTP A;  4NXM L;  3JAM c;  1I50 B;  1G8Z D;  3EA6 A;  1NAP A;  4POG A;  1AE3 A;  5I6Y A;  1VQ8 A;  2LMC B;  5J22 A;  1HTL D;  1TKW B;  3I70 A;  2IT1 A;  2KHS A;  2A6E D;  2Q8I B;  1GHK A;  5JPM C;  4XQQ A;  3QJY A;  2R92 B;  1AH9 A;  3FDT A;  1Q8K A;  1AEX A;  3MZ5 A;  1SNP A;  4ME5 A;  2BCO A;  2A1A A;  5CV6 A;  2CW0 D;  2KJX A;  2JA5 H;  2CFM A;  3L0O A;  4ME3 A;  1IKM A;  5HUR A;  3ULP A;  4HAE A;  4A3E H;  3K57 A;  4FP5 D;  1WVL A;  2B8G A;  2ENB A;  4A3I H;  3KLR A;  5IGC A;  3HOU G;  4NMZ A;  4GNX C;  2CHB D;  1K83 B;  2ICE C;  1YJ9 A;  4ABN A;  5IY0 A;  2FHT A;  4NPS A;  3EJI A;  4XQJ A;  4DR5 Q;  1KNA A;  4HCS A;  3G7L A;  1C4Q A;  3CCU A;  4YY3 L;  4GOP A;  3KLS A;  4LUV A;  2OTL A;  4FF3 A;  2VQE Q;  2VL6 A;  1SFO H;  3M7G A;  2L9H A;  1V8Q A;  4DV5 Q;  1PTO F;  3BDO A;  3AEV A;  1HR0 W;  2VNU D;  1DD2 A;  4K2K A;  2N3S A;  2XGT A;  1EWI A;  5JOB A;  2I5M X;  1CHP D;  3SXH A;  3M3Y B;  4IUT A;  3OWF A;  5GAH C;  2JXM B;  1WD0 A;  4KHV A;  1Y1W H;  4C3H G;  1PH4 A;  5IGF A;  1L1O C;  1PFS A;  3DUZ A;  1NTG A;  4CDC C;  2XWJ B;  2XNA C;  1SYC A;  4BY1 H;  1NY4 A;  1S72 A;  3L3O C;  3CW2 C;  3VA5 A;  3PO2 B;  4DR4 L;  2OF1 A;  1IYV A;  1PTO D;  3ND8 A;  4QB4 A;  2ZM6 Q;  5KGU A;  2DY7 A;  3K59 A;  5J39 A;  2F03 A;  1S3O A;  3LGJ A;  3BYY B;  3HGB A;  3PQI A;  5EJW A;  1O78 A;  1KD1 C;  5M3F G;  4UDU C;  5FO8 B;  2EY2 A;  3S15 B;  1BNZ A;  5K36 H;  1TWG B;  3FPU B;  4BBS G;  1HQM C;  2LFN A;  1SMY C;  4KV6 A;  4DKA C;  3E0E A;  1EY0 A;  1WCM G;  1SE3 A;  2TMP A;  5HGT A;  2JP1 A;  5D3D A;  4A3G G;  1NNX A;  4K8I A;  4UP9 A;  4KHP Q;  3CPW A;  2K04 A;  2AWN A;  1A2U A;  3S9W A;  4QQB X;  3ZJY C;  5NUC A;  2VXW A;  3K0X A;  2G9H D;  2V1C C;  5M9O A;  3RR5 A;  3PO3 G;  5A2Q L;  1EY9 A;  1ICF B;  4X65 L;  4AQY L;  1B50 A;  4LF6 Q;  1WFQ A;  4KD4 A;  3CCR A;  5CBA E;  2DJG C;  2OCE A;  1CKM A;  2WAQ E;  4IUQ A;  3J80 i;  3U58 A;  3TQY A;  1JT8 A;  2J4X A;  1IBK L;  2HHH Q;  3A8J E;  1BKB A;  1YZ6 A;  2AWO A;  2I5L X;  2B2U A;  1X9N A;  4DUZ L;  3GTJ B;  2HIV A;  5FKA C;  1OXT A;  3HKZ B;  1LTT D;  3N6R A;  5BN3 A;  2KHI A;  3GTK H;  1GD7 A;  3NTH A;  4PNY A;  2D0P A;  2F1M A;  1TWF H;  1V1O A;  2LXK A;  5BR8 L;  4A3B H;  4R9W A;  3T1H Q;  1HA5 A;  1FNV A;  3VR3 A;  4C3I B;  1ENA A;  3HS0 C;  1HZC A;  3ERO A;  4WJW A;  2EOT A;  2K28 A;  2NWG A;  3NUC A;  3S1R B;  2F0Q A;  1PTO B;  3JC6 6;  1SE2 A;  3NEL A;  4NXN Q;  1Y8O B;  3NQI A;  3T16 A;  2VUM G;  1LTS D;  2A19 A;  2A6E C;  3G6J B;  2Z9H A;  4B08 A;  3DHQ A;  1GUN A;  5KYI A;  4BXX G;  4JI6 Q;  1RCV D;  4DV7 Q;  2PZU A;  1H9S B;  4ZRZ A;  2CW0 C;  1KAW A;  3DEO A;  2IHF A;  1B4O A;  2F0J A;  4PG3 A;  2E2J B;  2GN5 A;  1ZEQ X;  2HIX A;  1ZXT A;  2B2T C;  3H15 A;  1VQ7 A;  4DR5 L;  3HZX A;  2JEB I;  1H9M A;  1PMR A;  4LFA Q;  2QDL A;  4FDB A;  5CMD A;  5CV8 A;  2B29 A;  5M5Y H;  1MJC A;  3I2Z A;  3PF4 A;  2RCF A;  4DV5 L;  5KRU A;  3C1E A;  3RMH A;  4C1N I;  1TS4 A;  3Q23 A;  5C4J B;  4K6L A;  4L63 B;  4LMQ D;  3MFG A;  2K50 A;  1KLG D;  3E6Z X;  1BCP F;  4H02 A;  1JE4 A;  5JVH 3;  3Q24 A;  5I2Y A;  4ZUI A;  1LT4 D;  4JW0 A;  2NUC A;  4QL5 A;  2F3W A;  1CKN B;  5C4H A;  1T9H A;  2AQ3 B;  4ZQ3 A;  2RKS A;  3DWQ A;  1D5Z C;  1IW7 C;  2H4O A;  1UEA B;  1F2Z A;  1LTR D;  2K6A A;  2JA5 G;  1TWF B;  1LYL A;  4DAM A;  2DY8 A;  2ZM6 L;  1U4R A;  3EVQ A;  4P73 A;  1XJV A;  1OXV A;  2OQ0 A;  4B9X A;  2F0K A;  1L1O A;  4A3E G;  4KKU A;  2N55 A;  4KJN A;  1BCP D;  5AFW A;  3W1G A;  4A3I G;  4L8J A;  3SR1 A;  4PV1 C;  5J3B A;  2NVX H;  4PZ6 A;  4A3J H;  1X32 A;  4Y52 H;  1WD1 A;  3FEW X;  2FXQ A;  3CCL A;  3VR4 A;  5IOD A;  1Q81 C;  4KHP L;  2CQO A;  4DK0 A;  2NZH A;  3MXP A;  3H3V C;  1WI5 A;  1Q86 C;  1C9O A;  1DYQ A;  1FL0 A;  4FVM A;  4J15 A;  4BBR H;  1D1I A;  1PV4 A;  4NKL A;  4I65 A;  3T53 B;  4LF6 L;  4CKB A;  1QNK A;  5IP7 H;  1A63 A;  3FKI H;  2HHH L;  1U0L A;  2JN4 A;  1Y1W B;  2L15 A;  5M3M B;  1W6K A;  4QIW E;  1E0B A;  4PMB A;  1IBL Q;  1AFP A;  4XIG S;  1QZG A;  1XMO Q;  2QGQ A;  2VB3 X;  4BY1 G;  3J80 E;  2XN9 C;  1FD7 D;  3OW2 A;  2JE6 I;  1C8C A;  1G6Z A;  2ZT9 C;  2O4X A;  2L12 A;  1UUP A;  3CCV A;  3TEH B;  2B2V C;  2JA6 H;  1CZW A;  2F4V Q;  4JBM A;  2YTV A;  5GQO A;  1DZ1 A;  1I4R A;  4NXN L;  1ILP A;  2L1B A;  1W6J A;  1VQI A;  2G9D A;  1JIC A;  2L5T A;  4IPD A;  3IRB A;  2DGY A;  4IPH A;  4XDX A;  3G48 A;  4R8N A;  5ELD A;  4JI6 L;  2K1B A;  4L5Q A;  4KN7 C;  1BCP B;  4DV7 L;  2KED A;  1AZQ A;  1R9T B;  3TS0 A;  4IUV A;  3BJU A;  1N32 Q;  4DNR B;  4OEL B;  5FLM H;  3TP5 A;  1U9R A;  4LFC Q;  1EYD A;  1FJG Q;  3KUP A;  2VB2 X;  2VS1 A;  1X65 A;  5ELE A;  2UXB Q;  1PFM A;  5IGE A;  2B63 H;  3GP7 A;  5ISR A;  1KDB A;  1M1K C;  2SNM A;  1IL2 A;  4LFA L;  1XX8 A;  1CT1 D;  2KOL A;  2EYP A;  2UUC L;  3V2T A;  5ELN A;  1EY5 A;  2OEO A;  3T1Y Q;  4BY7 B;  4DNI A;  1HNX Q;  4JI8 Q;  1RIP A;  4K5W A;  5J1Z A;  5C0X H;  4L6T B;  1KIX A;  4WJ4 A;  1KAA A;  2E8G A;  4GZY C;  5GAG C;  1F9P A;  4IO9 A;  3QIA A;  1V43 A;  2AHO B;  1K9M C;  2EQS A;  3MXG A;  2WKD A;  1EQV A;  4UP8 A;  1CA5 A;  4IUR A;  1UEB A;  2XVS A;  4YCW A;  3S1M B;  2E76 C;  1E2W A;  2LKV A;  2FIN B;  4JOI A;  4A3B G;  2JA7 B;  1E7Z A;  2NVQ H;  4RAU C;  1YEZ A;  1VF7 A;  1IXR A;  1VQM A;  4RH6 A;  4IOC A;  2RA4 A;  1A0I A;  4CDD C;  2IX0 A;  4RWS C;  3TRZ A;  2ES2 A;  3TRE A;  2QA4 A;  3S16 B;  2O2L D;  1C48 A;  1PHJ A;  1EWH A;  4H0L C;  3HOZ H;  2UXC Q;  1TWH B;  4IJL A;  4EX5 A;  2JA6 B;  2IWH A;  1AP0 A;  3R93 A;  4L5S A;  4OX9 Q;  1X3E A;  3OOC A;  4HID A;  1QJO A;  4K14 A;  3T13 A;  5C44 H;  4M1U B;  4DV2 Q;  3HP3 A;  1LTB D;  3QWN A;  2AQ1 B;  5C5M A;  4A93 H;  1SJH D;  2ZXR A;  1N8R C;  3PSI A;  3A8I E;  3TS2 A;  1NBW A;  2Q2U A;  4UHV A;  3GTQ B;  1SJE D;  2HCI A;  3K5M A;  1MSG A;  4KY6 A;  4P75 A;  3PIO 3;  2K52 A;  1QZH A;  3A74 A;  1BF4 A;  5CC4 A;  3EQL C;  2E2H H;  5C4X H;  4FO2 A;  1AN8 A;  1EY7 A;  1JMC A;  4A3D B;  1DOL A;  1HRJ A;  1CTM A;  3TN2 A;  3ULL A;  3PUZ A;  4OO1 H;  4AYB G;  1RHP A;  1RKN A;  2WFW A;  4KHZ A;  5A35 A;  2Y0S B;  4V0B A;  1VS0 A;  4ALP A;  4A3K B;  2E75 C;  2Q8R E;  3NSW A;  4FXK C;  2JK8 A;  4DK6 C;  3GQB A;  1EWC A;  4DV0 Q;  1H9S A;  3CC7 A;  3HOV B;  2N49 A;  3DLL A;  1WTH A;  3J7Y W;  2Z6K C;  1TVX A;  4YY3 Q;  3CHB D;  2K05 A;  1X56 A;  1G2S A;  1KXL A;  4AIM A;  1ET6 A;  3O13 A;  3I4L A;  1IBL L;  1XMO L;  4N9P A;  1PRT F;  5C3E B;  1VQD A;  4N8X 1;  3GTL B;  1I6H B;  3BVZ A;  3RZD H;  1FYC A;  2Z6B A;  3AFP A;  1WTO A;  4DXG A;  3K6O A;  3WDN A;  1GKH A;  1E22 A;  3P20 A;  2F4V L;  2AMC B;  3J7Z C;  3HKS A;  2WKC A;  5KND A;  1I4X A;  5C0X I;  4LJZ C;  2F0S A;  2R92 H;  5JEA J;  2NB0 A;  1EZ8 A;  1KDA A;  1LT6 D;  4X3K A;  1JE5 A;  4J1M A;  2B2V A;  1ONL A;  1PRT D;  4XXE A;  4A3J G;  1SMY D;  1DOK A;  1N32 L;  1SE4 A;  2L4N A;  4IJH A;  4A4I A;  3ZYY X;  4U67 3;  1YHQ A;  1CKN A;  1Y1V G;  4Q0F A;  5EKK A;  4MTN A;  4DN4 M;  1KRT A;  1PH9 A;  1VMP A;  2RQX A;  4LF5 Q;  2UXB L;  4GNX B;  3OSO A;  1K83 H;  3J80 L;  1K8O A;  4BBR G;  4X3U A;  1D1K A;  1F77 A;  2JQO A;  3NTK A;  1XYI A;  2EVB A;  4MIU A;  1HFN A;  2R61 A;  2K5V A;  4DNT B;  1GJX A;  2K5W A;  3T1Y L;  3FKI G;  1HNX L;  2F0D A;  2IHE A;  1CSP A;  5E3F A;  2BE5 D;  3T51 B;  1NSN S;  2JA8 B;  2FMC A;  3Q6S A;  4GLA C;  2B8F A;  1S4Z A;  1O7I A;  3KJO A;  1B7Y B;  5KNB A;  1U4P A;  4ILW A;  4DGZ A;  3I8Z A;  4IN3 A;  4DR6 Q;  1PYB A;  4JI1 L;  4R8I A;  2NTT A;  3SK8 A;  3NTI A;  1I94 L;  2N8N A;  4LUO A;  2MFI A;  5KNC A;  1RF2 D;  2OWO A;  1STG A;  4QY7 A;  1RTN A;  4ZUJ A;  2D5D A;  4OO1 I;  3BVM A;  3MEH A;  4J6H A;  3RZD B;  1EY4 A;  1VQF A;  4HTH A;  3NXW A;  3PO2 H;  4MZ9 A;  2ZJP A;  4CKE A;  2UXC L;  1X55 A;  1EFW A;  2NVY B;  3S2D B;  4V19 0;  5BR8 Q;  2KA7 A;  4OX9 L;  4K5V A;  3OMG A;  3X3M A;  4RMF A;  5DM7 3;  3MAQ A;  4DV2 L;  5HY6 A;  3T56 B;  1X6O A;  4DF7 A;  1E24 A;  5FLM G;  4R4O A;  3J81 E;  3HOW G;  2PYK A;  1D7Q A;  3S15 H;  4RGO S;  1HQR D;  1PRT B;  1TWG H;  5C3W A;  4DAY B;  2F0I A;  1FGB D;  2F52 A;  3UDX A;  1U4M A;  3J80 c;  2A68 D;  1C0A A;  2O5J C;  2B63 G;  3E9I A;  2PZW A;  2LXJ A;  3M4P A;  3TDQ A;  3I90 A;  1LTI D;  5IT9 E;  4EQO A;  1XMQ Q;  1GOZ A;  3NBH B;  3FRP B;  2PW7 A;  2FMM A;  3K8A A;  1YNX A;  4BS9 A;  5M5W B;  5C0X G;  3CRK C;  4QF4 A;  3UDG A;  3TZD A;  4R1J A;  1TWA H;  1Z7T A;  4LF8 Q;  1XPO A;  1ESF A;  3QG1 A;  4DV0 L;  3I56 A;  4HR7 B;  2Z8L A;  1EQQ A;  3Q22 A;  2MUY A;  2XRQ D;  1DCZ A;  3D4R A;  3H0G B;  1B9N A;  2HUG A;  3GTJ H;  2I5H A;  1G51 A;  4NB3 A;  2M00 A;  2HDL A;  2Q2I A;  3TSS A;  1VQP A;  1TS5 A;  1O7Z A;  4RFB A;  3L2P A;  3HOZ G;  1K28 A;  2K5H A;  2Z6K A;  4HJ7 A;  5CV9 A;  1IW7 D;  4TQU S;  4JI0 Q;  2I07 B;  4C3I H;  2GVB A;  3CCE A;  2YV5 A;  5C44 G;  4MHE A;  4A93 G;  1BO0 A;  4OGQ C;  1XPU A;  4G57 A;  2JYO A;  1E3P A;  1DON A;  3S1R H;  1EL0 A;  2FJ2 A;  1PTO H;  1EIF A;  3HKZ E;  4GKJ Q;  4DV1 L;  3S1Q H;  4K0K Q;  2R93 G;  1K0S A;  2QCP X;  2BH8 A;  2R6G A;  1K8A C;  4LNQ A;  1RL2 A;  1JOQ A;  4RHS A;  3KK7 A;  5JJZ A;  4WOR A;  4GLV B;  4C1N K;  5C4X G;  4K8J A;  2E2I B;  1JOR A;  4YCU A;  1PRT C;  1SRO A;  4LF5 L;  3H3V H;  4OO1 G;  4HJ5 A;  2E2J H;  1QWY A;  1WTQ A;  4NDX A;  1LT5 D;  1FR3 A;  4JBW A;  4UAI A;  4MTK A;  3MXU A;  3PGZ A;  3IAY A;  3D3R A;  1D5M C;  3TZU A;  1R4P B;  2R3Z A;  2B3G A;  5DAU A;  3E9H A;  2WP8 J;  3F2C A;  2UXD Q;  3SK5 A;  1TWA B;  3PCO B;  4HED A;  4PQX A;  5C4J H;  1B53 A;  3GD7 A;  2BE5 C;  1ASZ A;  1TS2 A;  2QDB A;  5EPJ A;  4C3J B;  4DR6 L;  4L5T A;  1H9J A;  4DA2 A;  4DR7 L;  2RHS B;  4O1N A;  1LTG D;  3G71 A;  4B3S Q;  4K2L A;  2EYO A;  4DR3 L;  1QE6 A;  4P2C B;  5I9O A;  2XRS D;  2R92 G;  1J8I A;  2R7Z B;  2YTX A;  1PFB A;  1MJE A;  4IFD H;  3MXN B;  1H9K A;  2QIL A;  1MD2 D;  1D8L A;  2LY7 A;  4UP7 A;  3M4O B;  1QOH A;  1JJ2 A;  1VCI A;  3DM3 A;  1QB5 D;  3S1Q B;  4A3F B;  4RCO A;  5IE8 A;  4WRD A;  1T5X D;  4B3R Q;  2K14 A;  2RDH A;  4LAA A;  1WTR A;  5IYD H;  4YWM A;  3TBI B;  1TII D;  3A5Z B;  3A8K E;  4RHR A;  1XMQ L;  3DM1 A;  3ERS X;  3PF5 A;  1O7Y A;  3M7N A;  2A68 C;  4C2M B;  1KC8 C;  4JCV E;  3S1N B;  4LW1 A;  1EYC A;  2K5N A;  4DR2 Q;  4P71 A;  3D6C A;  4Y7N B;  2D2C C;  4LF8 L;  1HZB A;  4FF1 A;  3UE0 A;  4DPG A;  3V05 A;  2RVL A;  4BWG B;  2RDF A;  2UUC Q;  2EE1 A;  4ID6 A;  3I7F A;  1K3R A;  1JC7 A;  1PLF A;  4JI2 Q;  2HDM A;  4UPA A;  5M3M H; 
#chains in the Genus database with same CATH homology
 3PUV A;  4GNX A;  1WOC A;  2ZTC A;  2VS1 A;  1X65 A;  2UXB Q;  1Q1E A;  3H3V I;  1GO3 E;  4A3F H;  2B63 H;  4OWX B;  3UDI A;  3RNU A;  2OQK A;  2D62 A;  4DR4 Q;  3M85 A;  1M1K C;  2Z0S A;  3PO2 G;  1LM0 A;  5GAE C;  1IL2 A;  2PNH A;  1FGU A;  1HJP A;  4YCV A;  4LFA L;  1NE3 A;  4A3C G;  1K8G A;  2PI2 A;  3GDE A;  5ELN A;  1PH7 A;  1PH5 A;  2UUC L;  3T1Y Q;  3CC4 A;  4JI0 L;  4DNI A;  1WJJ A;  2ALY B;  1PH6 A;  1HNX Q;  4LFC L;  4X62 L;  1VQ5 A;  4JI8 Q;  1QVC A;  1RIP A;  4JI7 L;  1FJG L;  3U4V A;  1KIX A;  3KFU A;  4WJ4 A;  4JI4 Q;  3OYY A;  2E8G A;  4AYB E;  4C2M H;  5GAG C;  4IO9 A;  3W1B A;  2VUM H;  3S1N H;  2EXD A;  1V43 A;  4GKJ L;  2AHO B;  1UE6 A;  2VY3 A;  3STB D;  1N34 Q;  1K9M C;  2JA8 G;  2EQS A;  1EOV A;  2YYZ A;  3KDF A;  1N33 L;  4BXX H;  4K0K L;  4UP8 A;  4Y7N H;  2PQA A;  1UEB A;  1EQR A;  1EYG A;  3EBE A;  3I4N H;  5IWA L;  3CD6 A;  1UE7 A;  3ULJ A;  3ICE A;  1CUK A;  1EUJ A;  4YCW A;  4JOI A;  2JEA I;  5IYC G;  3I55 A;  4A3B G;  1X3F A;  2HQL A;  4AH6 A;  2WB1 G;  5JJL A;  4LFB Q;  1E7Z A;  4IOA A;  4O0A A;  1R9T H;  4POF A;  2NVQ H;  3KF6 A;  4JI8 L;  1YEZ A;  1IXR A;  1VQM A;  4IOC A;  4A75 A;  1A0I A;  4QGU A;  3PIP A;  2IX0 A;  5LMU L;  4R4C A;  4MNO A;  1PH1 A;  4IFD J;  3TRZ A;  2ES2 A;  3TRE A;  2QA4 A;  4YWL A;  3NEM A;  3F2B A;  1PHJ A;  2CCZ A;  1VQA A;  3JAM i;  4X65 Q;  3HOZ H;  4AQY Q;  2UXC Q;  3FHW A;  4IJL A;  3KF8 B;  5AJ3 L;  3HOY H;  3K80 C;  4EX5 A;  1VQB A;  4IFD I;  2R7F A;  4L5S A;  4OX9 Q;  1PH3 A;  1X3E A;  3M3Y H;  1VQH A;  1G29 1;  4HID A;  1IBK Q;  1MIU A;  1JB7 A;  2R7D A;  5GRO A;  3STB C;  5C44 H;  3I4M G;  2XTI A;  4DV2 Q;  4BY7 H;  2UXD L;  3CPF A;  1L1O B;  4OON A;  4DUZ Q;  4A93 H;  4OWW B;  2UUB Q;  1N8R C;  2MQH A;  3PSI A;  4NXM L;  3M9B A;  3JAM c;  1IBM Q;  1VQK A;  2RHQ B;  2UU9 Q;  1V1Q A;  1XNR Q;  1Q12 A;  3TS2 A;  1NBW A;  1SMX A;  4EQ5 A;  2Q2U A;  4POG A;  3HKZ G;  1AE3 A;  4RG1 A;  1XNQ Q;  3OTO L;  4P75 A;  1E1T A;  2CWA A;  2K52 A;  1QZH A;  1VQ8 A;  4GKK L;  3A74 A;  2VQF Q;  2AKW B;  1Q7Y C;  2E2H H;  2JA7 H;  3S1M H;  2IT1 A;  3J7A 5;  4JI3 L;  5C4X H;  2NVT H;  1KRS A;  5E7N A;  5IT9 c;  5IYB H;  1L2F A;  2E5L Q;  1JMC A;  5IP9 H;  4R4I A;  4B3S L;  4A76 A;  4JYA Q;  3ULL A;  1AH9 A;  3F8T A;  3PUZ A;  1Q8K A;  2ID0 A;  4AYB G;  1XNR L;  2VW9 A;  2A1A A;  2WFW A;  4KHZ A;  2JA5 H;  2CFM A;  3MEF A;  4X66 Q;  1VS0 A;  4ALP A;  3S16 H;  1XPR A;  3L0O A;  4ME3 A;  3PIO A;  1X54 A;  4WJ3 M;  1SR3 A;  1YHB A;  2JK8 A;  4DK6 C;  3ULP A;  4DV0 Q;  4A3M H;  3CC7 A;  1TWH H;  2N49 A;  3DLL A;  2Z6K C;  4YY3 Q;  4A3E H;  2E5L L;  1X56 A;  4JI5 Q;  1KXL A;  4AIM A;  1OTC A;  3RLN A;  4X64 L;  4A3I H;  1IBL L;  1OXU A;  4YHH Q;  1XMO L;  3HOU G;  3H0G G;  4GNX C;  1VQD A;  1VQL A;  3NEN A;  1YJ9 A;  5K36 G;  4JV5 Q;  5IY0 A;  4LF7 Q;  3GO5 A;  1PA6 A;  1GM5 A;  3RZD H;  1QUQ B;  4NPS A;  1K73 C;  3GTQ H;  2IY5 B;  3S17 H;  4B3R L;  3AFP A;  4GN4 B;  4DR5 Q;  3PUY A;  5C0X J;  1GKH A;  3U50 C;  3FP9 A;  1FVI A;  1E22 A;  3CCU A;  4YY3 L;  4GOP A;  3G6E A;  4DV3 Q;  2F4V L;  4LUV A;  2AMC B;  2OTL A;  1J5E Q;  1AE2 A;  5JEA G;  2VQE Q;  2VL6 A;  3AQQ A;  3HKS A;  3J7Z C;  1SFO H;  4UY8 C;  5JJI A;  1A8V A;  4A3D H;  3F1Z A;  5C0X I;  3HOW H;  4DV5 Q;  2EIF A;  4KLK A;  5M5X H;  1VQG A;  4DR2 L;  3K7U C;  1HR0 W;  3AEV A;  2R92 H;  2VNU D;  1SN8 A;  1XTD A;  5FJ8 H;  5LMN L;  2N3S A;  5JEA J;  1Y14 B;  2XGT A;  2JJQ A;  1N36 Q;  1EWI A;  3PF4 A;  2ASB A;  3CCJ A;  2I5M X;  4A3K H;  2ZTE A;  1JE5 A;  3CC2 A;  4A3J G;  1NJI C;  4JOI C;  3CCS A;  1QVG A;  3HOV H;  1N32 L;  5GAH C;  4A4I A;  4IJH A;  1YHQ A;  1OXX K;  2VQE L;  1J5E L;  1Y1W H;  1CKN A;  1Y1V G;  1Z9F A;  1PH4 A;  1L1O C;  4JI2 L;  1PFS A;  4LWC A;  1NTG A;  4R4T A;  4MTN A;  1Z47 A;  1I5F A;  3UDF A;  1KRT A;  1PH9 A;  2UXB L;  4LF5 Q;  4BY1 H;  1VQJ A;  4GNX B;  1NY4 A;  5C3E H;  1S72 A;  3CW2 C;  1K83 H;  3KOJ A;  2UUA Q;  1SE8 A;  3GTL H;  1I6H H;  4BBR G;  1P8L A;  4DR1 Q;  4DR4 L;  2Y0S E;  1BBU A;  2JQO A;  2ZM6 Q;  3HFZ B;  4IFD G;  4X6A H;  2K5V A;  2IX1 A;  4BA1 I;  4JI1 Q;  3T1Y L;  1S3O A;  3FKI G;  3LGJ A;  1HNX L;  1LUZ A;  1W2B A;  1I94 Q;  2IHE A;  1CSP A;  2KEN A;  1PVO A;  1KD1 C;  4LF9 Q;  2QEX A;  5M3F G;  5GAD C;  4JI4 L;  3CAM A;  4GLA C;  4BBS G;  1O7I A;  3KJO A;  1B7Y B;  1MKH A;  1PH8 A;  1YIT A;  5JJK A;  1N34 L;  3J81 i;  4GN3 B;  4DV6 Q;  4HJ8 A;  1PH2 A;  3G4S A;  1VQ9 A;  3KDF B;  4DKA C;  3E0E A;  4OXP A;  1NMG A;  4PZ7 A;  4A3L G;  2PQA B;  1WCM G;  5IYD G;  4DR6 Q;  1PYB A;  4JI1 L;  4LFB L;  4A3G G;  3HOX H;  3ER0 A;  3EN2 A;  1I94 L;  2N8N A;  1Q46 A;  4LUO A;  4UP9 A;  2MFI A;  1HZA A;  3BU2 A;  3KF6 B;  3CPW A;  2DUD A;  2AWN A;  2OWO A;  4KHP Q;  4QQB X;  4QY7 A;  3J81 c;  1PYS B;  3ZJY C;  1ASY A;  4OO1 I;  3CF5 A;  4PMW A;  3K0X A;  2V1C C;  4HIM A;  1U5K A;  1HNZ Q;  1VQF A;  3RR5 A;  3PO3 G;  3PO2 H;  4MZ9 A;  4X65 L;  2ZJP A;  4AQY L;  1VQN A;  2UXC L;  1X55 A;  1EFW A;  2K75 A;  1HR0 Q;  4LF6 Q;  4HJ9 A;  5BR8 Q;  1WFQ A;  3CCR A;  2R7Z G;  4A3C H;  2OTJ A;  4OX9 L;  3CXC A;  1V9P A;  2OCE A;  1CKM A;  2KCT A;  2WAQ E;  3K7A H;  4RMF A;  3J80 i;  1NMF A;  1UE1 A;  1P16 A;  1Y1V H;  2ZTD A;  3TQY A;  3U58 A;  1IBK L;  2HHH Q;  1QVF A;  3RZO H;  4OWT B;  1YZ6 A;  1BKB A;  2KHJ A;  2AWO A;  2I5L X;  3BZK A;  4JG2 A;  1DGS A;  5HY6 A;  4DV2 L;  1X9N A;  1X6O A;  4DUZ L;  1E24 A;  2MO1 A;  2HIV A;  5FLM G;  4R4O A;  2UUB L;  4DUY Q;  3HOW G;  1IBM L;  2UU9 L;  1D7Q A;  1OXT A;  1Y1W G;  3S15 H;  5M3M G;  3CCM A;  1TWG H;  2JA8 H;  2KHI A;  4DAY B;  3GTK H;  2BA1 A;  2H5X A;  1GD7 A;  2F52 A;  3UDX A;  4IPG A;  1XNQ L;  2D0P A;  3J80 c;  1C0A A;  1Q82 C;  4A3F G;  1TWF H;  2LXK A;  3E9I A;  5BR8 L;  5IYC H;  2B63 G;  2VQF L;  3SGI A;  4A3B H;  2LXJ A;  3M4P A;  3T1H Q;  2RF4 A;  3U4Z A;  1CKO A;  2C35 B;  3BZC A;  1XMQ Q;  2CWP A;  3L7Z C;  1HZC A;  3NBH B;  3CME A;  2YU9 H;  4B3M Q;  3K8A A;  1BVS A;  3J81 j;  1YNX A;  2MNA A;  4JYA L;  1BBW A;  5HGQ A;  5C0X G;  2PI2 E;  3UDG A;  3D31 A;  3JC6 6;  4NXN Q;  3NEL A;  4R1J A;  4X66 L;  1TWA H;  3RN2 A;  2F3I A;  2NN6 I;  2VUM G;  1W3S A;  2A19 A;  3RLO A;  4LF8 Q;  1YBY A;  1XPO A;  4BXX G;  4DV0 L;  5DLQ E;  4JI6 Q;  3T1H L;  3I56 A;  2NVY H;  4LF4 Q;  1EQQ A;  3S2D H;  4DV7 Q;  2K4K A;  1OXS C;  3I4M H;  1JT8 A;  1KAW A;  1C7Y A;  4JI5 L;  1K0R A;  2KBN A;  4HIK A;  4JBK A;  4YHH L;  2IHF A;  2PMZ E;  1IYJ B;  4PG3 A;  3GTJ H;  4PZ8 A;  2I5H A;  1G51 A;  4P72 A;  2N78 A;  2GN5 A;  4NB3 A;  1YJN A;  4JV5 L;  4LF7 L;  2HIX A;  2CKZ B;  2Q2I A;  1YJW A;  1VQP A;  3GTG H;  4KI0 A;  4DV1 Q;  3H15 A;  3I4O A;  1VQ7 A;  4DR5 L;  3F2D A;  1SRU A;  3L2P A;  2JEB I;  3HOZ G;  2K5H A;  2Z6K A;  4LFA Q;  3HOY G;  2WAQ G;  4DV3 L;  1I3Q H;  4HJ7 A;  1YIJ A;  4FDB A;  2BH2 A;  4GOP B;  1VQ4 A;  4TQU S;  2B29 A;  4TVA B;  4JI0 Q;  4YWK A;  5M5Y H;  3KJP A;  1MJC A;  1UWV A;  3A0J A;  2BA0 A;  2GVB A;  3I2Z A;  4C3I H;  4X62 Q;  3A5U A;  3CCE A;  4DV5 L;  2YV5 A;  5C44 G;  4JI7 Q;  4BY7 G;  4A93 G;  3GTM H;  5M5W H;  3RLF A;  2JA9 A;  1XPU A;  2ATW A;  1TXY A;  1E3P A;  3S1R H;  1EIF A;  3AFQ A;  3HKZ E;  4QJF A;  5ELO A;  4JC0 A;  4DV1 L;  1N36 L;  3S1Q H;  4GKJ Q;  4K0K Q;  2R93 G;  3Q8D A;  1N33 Q;  2BH8 A;  2K50 A;  2R6G A;  4H02 A;  5IWA Q;  1K8A C;  3CP0 A;  3K81 C;  4LNQ A;  1RL2 A;  3PUX A;  5IP7 G;  4BA2 I;  1JJG A;  4GLV B;  2JA7 G;  4GS3 A;  5C4X G;  1TWC H;  4QL5 A;  5IYB G;  3HOU H;  1H95 A;  1CKN B;  4APV A;  3H0G H;  5IP9 G;  1T9H A;  1B70 B;  4YCU A;  4LF5 L;  1SRO A;  5LMU Q;  3H3V H;  4OO1 G;  4HJ5 A;  2E2J H;  2UUA L;  1SLJ A;  2NZO A;  3VDY A;  1UE5 A;  4DV4 Q;  4DR1 L;  2JA5 G;  5H1S E;  3CCQ A;  1LYL A;  2I0Q A;  4DAM A;  1HH2 P;  2ZM6 L;  1A62 A;  3AYH B;  5AJ3 Q;  4JBW A;  3KLW A;  3PGZ A;  4P73 A;  1XJV A;  4A3M G;  1OXV A;  2OQ0 A;  2JA6 G;  2B3G A;  4JBJ A;  1L1O A;  3S24 A;  4HJA A;  4A3E G;  1M90 C;  1KQS A;  2ZJQ A;  4LF9 L;  3KYH C;  4DR7 Q;  5LMN W;  3E9H A;  2WP8 J;  3F2C A;  2UXD Q;  3W1G A;  1KL9 A;  2ZJR A;  4A3I G;  4R4Q A;  4NXM Q;  4DR3 Q;  3PCO B;  1VQC A;  5J3B A;  4DV4 L;  2NVX H;  4DV6 L;  1YHA A;  4PZ6 A;  5C4J H;  3GD7 A;  3UE1 A;  3OTO Q;  4A3J H;  1ASZ A;  4GKK Q;  4DR6 L;  4Y52 H;  2Q2H A;  2FXQ A;  4L5T A;  2GVA A;  3CCL A;  4C3H H;  4JI3 Q;  4DR7 L;  1HNW Q;  2RHS B;  1Q81 C;  4B3T Q;  4KHP L;  3G71 A;  2CQO A;  1GVP A;  2NZH A;  4B3S Q;  2MO0 A;  2E2I H;  2HT1 A;  4A3D G;  1WI5 A;  4DR3 L;  1Q86 C;  1C9O A;  1FL0 A;  1VQE A;  4J15 A;  1HNZ L;  4BBR H;  2R92 G;  2R93 H;  1Q1B A;  2YTX A;  3CQZ H;  1PV4 A;  2NN6 G;  1MJE A;  5FJ8 G;  1HR0 L;  4LF6 L;  2Y0S G;  3W5O A;  4A3K G;  5EAY A;  3MXN B;  3S2H H;  3PV0 A;  5IP7 H;  1A63 A;  3FKI H;  1YI2 A;  2LSS A;  4GN5 A;  2HHH L;  4GOP C;  1U0L A;  1G6P A;  1HNW L;  3CMA A;  5M3F H;  1D8L A;  4UP7 A;  2Q2T A;  4B3T L;  3HOV G;  1L0W A;  2L15 A;  4QIW E;  4DUY L;  4X64 Q;  1IBL Q;  4BBS H;  4XIG S;  1JJ2 A;  2RCN A;  4P74 A;  1QZG A;  1VCI A;  1XMO Q;  3S14 H;  3DM3 A;  2QGQ A;  1QUQ A;  2VZA A;  4BY1 G;  1KHI A;  5IE8 A;  1E1O A;  5C3E G;  1YVC A;  4A3L H;  2D0O A;  3OW2 A;  4B3R Q;  1WCM H;  1N9W A;  1JJC B;  2JE6 I;  2K14 A;  5IYD H;  4YWM A;  3CCV A;  3TEH B;  4A3G H;  3A5Z B;  3I4N G;  1EIY B;  2JA6 H;  4C3J H;  2KCM A;  2WB1 E;  1WYD A;  1XMQ L;  3D0F A;  2F4V Q;  3EIV A;  3ERS X;  4B3M L;  4JBM A;  2YTV A;  1IZ6 A;  3PF5 A;  4O2D A;  5GQO A;  3M7N A;  3M4Q A;  3GTO H;  1VQ6 A;  1KC8 C;  4JCV E;  1S40 A;  4LW1 A;  4NXN L;  2K5N A;  4DR2 Q;  3PO3 H;  4P71 A;  1I50 H;  1VQI A;  1J6Q A;  4IPD A;  3GTP H;  3IRB A;  5LMN Q;  2DGY A;  4LF8 L;  3B6Y A;  4XTC S;  4IPH A;  2R7Z H;  4DK3 C;  1VQO A;  3G48 A;  4IPC A;  1HZB A;  4JI6 L;  1B8A A;  4L5R C;  4HIO A;  4LF4 L;  4L5Q A;  3UE0 A;  4DPG A;  1X3G A;  3PUW A;  4DV7 L;  3WWV A;  2YTY A;  3TS0 A;  3RN5 A;  3BJU A;  4GLX A;  1HZ9 A;  2UUC Q;  1N32 Q;  1CSQ A;  3I7F A;  1LTL A;  5FLM H;  3HOX G;  2A8V A;  5FLX c;  4LFC Q;  1K3R A;  1FJG Q;  4JI2 Q;  4UPA A;  3M4O H;  5M3M H;  4LUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...