1NE3A

Solution structure of ribosomal protein s28e from methanobacterium thermoautotrophicum. ontario centre for structural proteomics target mth0256_1_68; northeast structural genomics target tt744
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
68
Chain Sequence
b'MDDATPAEVIEVLKRTGMTGEVMQVKCRILDGRDKGRILTRNVMGPIREGDILMLLDTIREAKEIRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S28E
molecule tags Ribosome
source organism Methanothermococcus thermolithotrophicus
publication title Solution structure of ribosomal protein S28E from Methanobacterium thermoautotrophicum.
pubmed doi rcsb
total genus 3
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2002-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01200 Ribosomal_S28e Ribosomal protein S28e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ne3A00
4DV4L 2VY3A 2UXCQ 4LWCA 3K7AH 4X62L 3I4MG 3AYHB 3E0EA 1LTLA 1VQOA 4B3RQ 4Y52H 4TVAB 4YY3Q 3UDFA 4L5SA 4OONA 4AQYL 1ASZA 5IYDH 1VQGA 4J15A 2OWOA 4DPGA 3PSIA 4UP7A 2ZM6Q 2IHEA 3F1ZA 1M90C 3GTMH 4OXPA 4ME3A 4WJ3M 1MJEA 2VQFL 2I5HA 2KCTA 1I94Q 4GOPA 1Q81C 1JMCA 1EOVA 3UE1A 1PH9A 4DR7Q 1HH2P 3CC7A 1KHIA 1VQKA 1VQFA 4LFAQ 3LGJA 2F3IA 1X6OA 2JEAI 1D7QA 1JB7A 3OTOQ 4JI8L 5C4XH 1X65A 3GTLH 4A3BH 4BBRH 1QVFA 2ZM6L 1VQ9A 3PO2G 1WJJA 3BU2A 2VW9A 4IFDG 1YBYA 4GS3A 3W5OA 1Q7YC 1N33Q 3HFZB 3GTKH 4GKKL 3RLOA 1EQRA 1AE2A 3CCRA 2ATWA 4BXXG 4POFA 4DR3L 1K8GA 2YTYA 5GROA 1VQDA 4C2MH 4UPAA 5IE8A 2LXJA 2PQAA 4MNOA 4GOPC 1YITA 3AEVA 1I6HH 1C9OA 3W1GA 5C0XG 3H15A 1J5EQ 1YNXA 2GVBA 1VQHA 4GLVB 3S2HH 4MTNA 1PA6A 4R4CA 2RF4A 3FP9A 3H0GG 4B3SL 1NJIC 1Q8KA 2I5MX 1N34L 3MXNB 4P73A 4BA1I 2UUBQ 2ZTEA 1UE6A 3F2BA 4LFBQ 1RIPA 5GAEC 2HHHQ 1V1QA 3CCLA 1PYBA 5JJIA 4YCVA 4DUYL 4X66Q 2AHOB 1A8VA 3EIVA 4DKAC 1TWAH 4IFDJ 1J5EL 1Q1BA 2XTIA 2D62A 1YVCA 4P71A 5GQOA 3STBC 3CCMA 4A3IG 4LF9L 3M3YH 3S14H 1VQIA 2VZAA 1W2BA 3S1QH 3A0JA 4JI2Q 2JA7H 1VQEA 1L1OA 1YHBA 3G71A 1SFOH 4DK6C 3HOUH 3U58A 3TS2A 4DV3Q 4RMFA 1MJCA 4HIDA 2JA7G 3M4QA 4JI7Q 4DR2L 2HQLA 3EN2A 5IP7G 4GKJL 1KXLA 1VQMA 3HOZG 1XTDA 1X3EA 3GTQH 3ERSX 4JYAL 4LUZA 3HOYG 4UP9A 2AWNA 4XTCS 3ULLA 3JC66 2C35B 3K80C 4NPSA 1N9WA 2A1AA 1XMQQ 2F4VQ 1N36L 2JE6I 4A3FG 1HZ9A 3IRBA 3BZCA 4X62Q 5HGQA 3G4SA 4HJAA 4NXML 1XNRQ 3RZOH 1H95A 4X64L 2PNHA 1RL2A 4A3JH 4A3KH 2UU9L 2UUCQ 3J81i 2R93H 2Q2HA 3U4VA 2R7ZH 2AWOA 3I4NH 4X65L 1PYSB 1FVIA 1PH3A 1WFQA 2KBNA 1TWFH 5JEAG 1VQPA 4JBJA 2YU9H 3K81C 1SMXA 1IBKL 1C0AA 5J3BA 2IY5B 1R9TH 2PQAB 5M3MG 2E2IH 2ZJRA 4JI5Q 4YWMA 5IYBG 3KDFA 1CKNB 4C3IH 1U0LA 3T1YQ 4L5RC 2VQEQ 1N33L 1KAWA 4IPDA 4DUZQ 5LMUL 4GLXA 2UUCL 2UUAL 2WAQG 3S16H 2XGTA 4GNXC 1CSQA 1SE8A 1FGUA 2CQOA 1Y1WG 1HR0W 4A3LG 2AKWB 1Y14B 4IPGA 3HOXG 1HNXL 4DV2Q 4A3GG 5M3MH 1E3PA 1B7YB 3AFPA 3AQQA 4BY1G 3JAMc 3CAMA 1Z47A 5M3FG 4JC0A 1X3GA 2VS1A 4LUOA 3HKSA 3K0XA 1QUQB 1VQ8A 4GN4B 2YTXA 5DLQE 1L0WA 5AJ3Q 4OX9L 1JJCB 4B3RL 2Y0SE 1UWVA 4K0KQ 3FHWA 4BY1H 3J81j 1TWGH 1VQBA 1CUKA 3NENA 5IYBH 4KLKA 4A3DG 3KF6B 3UDGA 5IP9H 3KOJA 1Y1WH 1N32L 4JV5L 4JI5L 3RR5A 3RN5A 2E5LQ 2B63H 4A93H 1QVCA 4PZ6A 2H5XA 2QEXA 3PUXA 1PH1A 5ELNA 4HIKA 1IZ6A 4GLAC 5M5YH 3A5UA 4DV0L 1WI5A 4DV7Q 3RN2A 4HJ5A 1A62A 1A0IA 4HJ7A 4HJ9A 3E9HA 1UE1A 2Q2TA 2DUDA 5JJKA 4IJLA 3M9BA 4AIMA 4DAYB 1OTCA 4DR2Q 2JA8G 1VCIA 4GN5A 1ASYA 1LM0A 1XMOL 2Y0SG 1HR0L 2E8GA 1I50H 5C44H 3HOVG 4A3JG 4YCUA 4DK3C 4JI8Q 4OX9Q 1NTGA 3M85A 2R7FA 2R93G 2NN6G 2N78A 1PHJA 4MZ9A 4IO9A 1TWHH 1N36Q 2A8VA 3HOVH 4R4IA 2YTVA 4A3EH 3ICEA 1OXSC 2OTJA 4LFCL 3T1HQ 1SN8A 4LF6Q 4JI6L 1YHAA 2JQOA 3GTPH 1K83H 1G6PA 1E24A 2KHIA 1K8AC 4GNXB 1UEBA 3H0GH 4QL5A 1TWCH 1VQ5A 1N8RC 2Z0SA 1P8LA 3RNUA 3Q8DA 2RHSB 1VQLA 4LF5Q 1MKHA 5GAHC 2R92G 4P75A 2KCMA 2D0PA 2ZTDA 4A3EG 3T1HL 5C3EH 4LFCQ 4POGA 2OQKA 3NELA 4IOCA 4A3IH 3S15H 2HIVA 3VDYA 1PH4A 2K14A 1XNQL 4JI0Q 1L1OB 2CWPA 2UUAQ 4AQYQ 1G51A 1KRTA 1C7YA 1WCMG 4DV1Q 2NVTH 2ZTCA 2B63G 4A3MG 3RLFA 4A93G 1E1TA 2JA8H 2QA4A 1X3FA 2OCEA 3S24A 4LF4Q 4JBKA 2UXCL 3U4ZA 3KF8B 4DR1Q 1IBLQ 4A3DH 1U5KA 4DUZL 2MQHA 3K7UC 2D0OA 3ULJA 1YIJA 3KDFB 1OXUA 3NBHB 1YI2A 4IOAA 4B3ML 4PG3A 3D0FA 5JJLA 5H1SE 1YHQA 3GTGH 3CCSA 1BKBA 4GNXA 5M3FH 2IX0A 3PUVA 2IHFA 1KRSA 5IP9G 3UE0A 1GM5A 3PO2H 4BBRG 2L15A 4A75A 2VNUD 3J7A5 4JOIC 4JYAQ 1EUJA 3WWVA 1XPUA 1IBLL 4X64Q 2UU9Q 4JI0L 3GO5A 1FJGL 3PGZA 3M4PA 2Q2IA 1XMQL 2UXDQ 4DR5L 5C0XJ 3NEMA 1N32Q 1VQCA 4JV5Q 3CC2A 2GVAA 4A4IA 3S2DH 1VQ6A 1TXYA 3I4NG 3ULPA 2CKZB 4DNIA 2WFWA 4KHZA 5GADC 4JBMA 2PI2E 1T9HA 3BJUA 3PCOB 4A3KG 3JAMi 1HNWQ 3CD6A 4R4OA 3HOXH 2IT1A 4BY7G 4QY7A 3CC4A 1X54A 1M1KC 3CW2C 2DGYA 5HY6A 3HKZE 1WCMH 4APVA 3PF5A 1BBUA 1VS0A 2Z6KA 2JJQA 4KI0A 3CCUA 3KFUA 1HJPA 2MO0A 4JG2A 3CP0A 1A63A 1B70B 2Z6KC 1HR0Q 4O2DA 1G291 1GO3E 2VL6A 3PV0A 4P72A 5IYDG 4A3FH 2ASBA 4DR6L 3HOWG 4BA2I 3L7ZC 5ELOA 5JEAJ 4QQBX 1SLJA 1PVOA 4P74A 3STBD 3KJOA 3GTJH 3RLNA 4OWWB 5IP7H 2R7ZG 2B29A 1K0RA 1P16A 2EXDA 4A3CG 2WB1G 2N49A 5LMNW 3PIPA 3KJPA 4HJ8A 1KD1C 3CXCA 2VUMH 3G6EA 1VQ7A 3HOUG 2RHQB 4JI7L 1WYDA 3A5ZB 4DR7L 4IFDI 1IYJB 4DAMA 4R1JA 1JT8A 4B3TL 2MFIA 4TQUS 1VQ4A 3UDIA 3OTOL 3HOYH 2BA1A 4JOIA 4GKKQ 2BH8A 1IXRA 4DV6L 1NMGA 5LMNL 2A19A 5C44G 3E9IA 2N3SA 1XNRL 2IX1A 4DR6Q 4DV5Q 4NB3A 3I4OA 1PV4A 1PFSA 1Y1VH 1KQSA 3J80c 3BZKA 3F8TA 3EBEA 1NMFA 4DV1L 2NZHA 3U50C 1KIXA 1EFWA 3F2CA 2K50A 1PH6A 4B3TQ 4LF8Q 1XMOQ 1S3OA 4ALPA 2WB1E 1Q86C 1Q82C 4B3SQ 1UE7A 4QIWE 4JI1Q 5FJ8H 1PH2A 2ES2A 2MNAA 4X6AH 1QUQA 2MO1A 4AYBG 4WJ4A 4DV6Q 1OXVA 3W1BA 2E2HH 3PO3H 1YJNA 4LFBL 3PIOA 2UXBL 4L5QA 4LUVA 1Q12A 5IWAQ 1CSPA 3T1YL 1CKOA 4R4QA 5C0XI 2NN6I 3CMEA 5LMUQ 1N34Q 3B6YA 1HNZQ 3UDXA 4DR5Q 2BH2A 4IPHA 5LMNQ 2WAQE 1BVSA 2EQSA 1S40A 1KC8C 2JA5G 3MEFA 1BBWA 4DV4Q 2HHHL 4IJHA 4XIGS 2K4KA 3S1MH 5M5WH 4JI6Q 2VQEL 2NVQH 4A3BG 3DLLA 1JE5A 2ID0A 4OWTB 3I55A 3GTOH 2K52A 3PUZA 4NXNL 4YWKA 3S17H 2OQ0A 4A3GH 1CKNA 1V9PA 2I5LX 4A3LH 5IYCG 2VUMG 5AJ3L 3S1RH 4L5TA 3TEHB 2V1CC 4AYBE 3CPWA 1JJGA 3CCJA 2WP8J 1NBWA 1SROA 4A3CH 4OO1G 1XPRA 4EQ5A 4BBSH 1O7IA 2N8NA 3CF5A 1VQNA 3CMAA 2BA0A 3PUYA 5FLXc 3AFQA 4DR1L 4JBWA 3HOWH 1YJ9A 4PMWA 5C4XG 2JA6G 2RCNA 1HNZL 1Z9FA 3OW2A 4LF7L 2LSSA 4X65Q 4NXNQ 4DR3Q 3KLWA 1SRUA 4UY8C 4DV7L 4KHPQ 1X55A 1EQQA 5GAGC 3GD7A 4UP8A 4LNQA 4BBSG 4PZ7A 1I5FA 2R7DA 2B3GA 1HZCA 5M5XH 1E22A 1DGSA 3I2ZA 1GD7A 1EIFA 2YV5A 2K5HA 1QZHA 2NVXH 4PZ8A 1YEZA 3TREA 2YYZA 1W3SA 1JJ2A 1Q1EA 5IT9c 2JA6H 4YCWA 1IBKQ 2HIXA 2AMCB 1FL0A 1Q46A 5FLMG 3L2PA 2Q2UA 3CPFA 5IY0A 4YHHL 4JI4L 4LF7Q 4QGUA 3I4MH 2UUBL 3TRZA 3HOZH 4LF6L 2K5NA 3GDEA 3S1NH 4X66L 1SR3A 3K8AA 3M4OH 3H3VI 2KENA 1V43A 1PH8A 3I7FA 3PF4A 4HIMA 1X56A 4LF8L 5EAYA 1EYGA 4DV2L 1IL2A 3CQZH 4DUYQ 4JI3L 4YWLA 3J81c 4DV5L 2E2JH 2R6GA 3ZJYC 1XJVA 1QVGA 3CCVA 3OYYA 4YHHQ 5IYCH 1HNWL 2K75A 5C4JH 3TQYA 1IBMQ 2NVYH 1YZ6A 4LFAL 3FKIH 1QZGA 2E5LL 4JI1L 1E7ZA 1K73C 4K0KL 1AE3A 4JI4Q 4FDBA 1D8LA 3L0OA 2NZOA 1YJWA 4A76A 1S72A 2JA5H 4A3MH 3G48A 4GKJQ 2ZJQA 4R4TA 4GN3B 4LF4L 2EIFA 3KYHC 1AH9A 1NE3A 1NY4A 5E7NA 5K36G 1X9NA 4H02A 1K9MC 1HZAA 2JK8A 2OTLA 2F4VL 2FXQA 5C3EG 4DR4Q 1IBML 3FKIG 1MIUA 3J80i 3PO3G 4DV0Q 4B3MQ 3CCQA 2R92H 4BXXH 3I56A 4HIOA 4NXMQ 4JI3Q 1GVPA 5FJ8G 4OO1I 3DM3A 2GN5A 3ER0A 2ALYB 1PH7A 5BR8Q 1E1OA 3J7ZC 3CCEA 2K5VA 2ZJPA 1VQAA 1Y1VG 4O0AA 3SGIA 1VQJA 4EX5A 1LUZA 4C3JH 4YY3L 5FLMH 4JCVE 2F52A 2JEBI 4AH6A 1KL9A 1L2FA 3TS0A 1PH5A 1EIYB 3H3VH 4QJFA 2HT1A 2QGQA 4JI2L 2PMZE 2I0QA 1OXTA 2VQFQ 1EWIA 3KF6A 1XPOA 4GOPB 1I94L 1L1OC 4LW1A 1K3RA 1FJGQ 2UXDL 1GKHA 2CCZA 4LF5L 4LF9Q 4DR4L 2JA9A 4OWXB 3D31A 4Y7NH 1J6QA 1HNXQ 2CWAA 2UXBQ 1I3QH 4KHPL 4BY7H 3F2DA 5IWAL 3RZDH 1XNQQ 2KHJA 2LXKA 3HKZG 2CFMA 1CKMA 4RG1A 4DV3L 1UE5A 1HZBA 1LYLA 1OXXK 3A74A 4C3HH 3M7NA 1WOCA 4IPCA 1B8AA 2PI2A 3PUWA 5BR8L
chains in the Genus database with same CATH superfamily
1MGSA 2UXCQ 2E74C 4X62L 4B3RQ 1LTLA 5IGFA 4Y52H 3FMCA 4Q0FA 4L5SA 1LTAD 4AQYL 1ASZA 1RKNA 4J15A 5CV4A 3PSIA 4UP7A 4A3DB 2IHEA 3F1ZA 4CDFC 4GOPA 2RBMA 4OO1H 2B2TC 1JR0D 3QIAA 1VQFA 4M8AA 1EY8A 2SNMA 2F3IA 1XTCD 2JEAI 5NUCA 5DM73 4JI8L 1X65A 3DUZA 1WTOA 1RD9D 1Q3LA 2B2UC 1QVFA 1WJJA 2VW9A 1FNVA 1Q7YC 2QF7A 1SYFA 3GTKH 3GTMB 4GKKL 1F9QA 4BXXG 4POFA 3TP7A 3X3NA 5IE8A 3AEVA 2PQAA 1I6HH 5CBAE 2L55A 1Z6HA 1JQYD 3H15A 1J5EQ 1YNXA 2JA7B 2F0MA 4ZK9B 2XN9C 1SJHD 3A8KE 3TSSA 3GTLB 4TKOB 5I6WA 3H3VC 1Q8KA 3MXNB 3D4RA 4P73A 2EY5A 2ZTEA 2M00A 3GTKB 1RIPA 4DUYL 2M9VA 4X66Q 3W2DA 5JVG3 1KDBA 4OIJA 1RHPA 2IL8A 1I6HB 1VQIA 2PO4A 3I70A 3G71A 1PFNA 2EYMA 1TU2B 1TWFB 2EYPA 4KN7C 1EYCA 1KXLA 5IP7G 1VQMA 1PZKD 1I4HA 1X3EA 1PXUA 2EY1A 2F0TA 2EJGC 1HZ9A 1SE4A 1YNND 1KTKA 3BZCA 4X62Q 3WOEA 2L1BA 1H95A 4LJZC 4A3KH 4DXFA 5D65A 4IQZA 5CV6A 1VQPA 1H9SB 5FK9C 5IGCA 5FO8B 1IBKL 5A2QL 1S5DD 1WVLA 1R9TH 4XYQA 2EY6A 2JYOA 2F0KA 2HDMA 3MHBA 3NSWA 4YWMA 5IYBG 1EEID 4C3IH 4IPDA 1Y1WB 2NWGA 2UUAL 3S16H 3K57A 2ICEC 1CSQA 1HR0W 3HS0C 2MUYA 2XNAC 1AW7A 1EQTA 3KLSA 4H44C 4ZUJA 3L3OC 4A3GB 1IHZA 1X3GA 2VS1A 4C1NI 3HKSA 4GN4B 1O78A 5DLQE 5AJ3Q 2NTTA 1MHWC 3KBGA 3J81j 1VQBA 3RUZA 1CUKA 2BCOA 1FYCA 3BVZA 3RR5A 4RA8A 2E5LQ 2QEXA 2VB2X 2N88A 4HIKA 5JAVA 4GLAC 1CZGA 3A5UA 4DV7Q 1PRTF 1PRTD 2MP1A 2EJMA 1A0IA 4K5XA 4HJ9A 4KMUC 1TWCB 1D5XC 5JJKA 5JEAH 1LV9A 4DR2Q 2JA8G 4BY1B 2Y0SG 5C44H 3NWSA 2R93G 3E5SA 4YCUA 4DK3C 1E2ZA 1BF4A 4A3EH 3NXWA 2OTJA 4C3JB 3K58A 3J80E 2JQOA 3K5NA 1G6PA 5COYA 4GNXB 1DJRD 2AQ2B 1TWCH 1VQ5A 1TKWB 1HTPA 3TMEA 3K6OA 4ZRZA 3SK6A 1EIGA 4P75A 1PRTC 2D0PA 2ZTDA 4A3EG 4POGA 2OQKA 3NELA 4IOCA 3NTIA 1JOQA 1PH4A 2Q8RE 1VF7A 5EPJA 2NVTH 1Y69U 4A93G 1PTOH 1CHQD 4XYOA 2OCEA 3S24A 4LF4Q 1B9MA 1HCZA 1IBLQ 4J6HA 1YIJA 1H9JA 3D0FA 1Y8PB 4GZYC 1HXYD 4GNXA 1BKBA 1ZEQX 2K7VA 4RGMA 4CJ2C 3QJYA 4BBRG 2L15A 2NVTB 2KCNA 1B4OA 4X64Q 1STBA 3PGZA 5DEHA 1I4PA 1TS4A 5IGGA 1SYGA 1VQCA 2NZ1D 3ULPA 2WFWA 3PCOB 1HNWQ 2H1EA 3A7LA 3RZDB 2IT1A 5T1GA 3CC4A 4RH6A 1WTVA 5CGKA 5HY6A 3HKZE 1VS0A 3K59A 4HAEA 1IYUA 3A55A 4CDCC 1B70B 3PV0A 2H4OA 4P72A 2K5WA 1I4QA 5ELOA 4ZCKA 4N9TA 4P74A 4DA2A 5FO9B 2QW7A 3BVGA 2WB1G 4H0LC 2AUKA 2VB3X 3PIPA 3S1QB 1KD1C 5EBDA 3CXCA 3G6EA 2D5DA 4R1JA 1HQRD 2MFIA 4YIJA 3PO3B 3O13A 3HRZC 4GKKQ 1DOLA 3GTQB 2LY7A 4DV6L 5LMNL 5C44G 3SK5A 4DNRB 2O2LD 1XNRL 2IX1A 2QCPX 1U4RA 1PFSA 3T53B 3BZKA 2NVQB 4LF8Q 1XWEA 1S3OA 2R7ZB 1LLRD 2ES2A 1EIHA 1KNEA 4PMBA 1QUQA 5CV7A 3MXUA 2E2HH 3PO3H 1RTOA 4MHEA 1YJNA 3T1YL 5K36H 5C0XI 5LMUQ 1HNZQ 2BH2A 4IPHA 5LMNQ 2WAQE 1BVSA 2FMCA 3TP5A 1KC8C 2JA5G 3BYTB 1Y1VB 2KHSA 2WKDA 2HHHL 3OOCA 1JE5A 2ID0A 3M7GA 1QOHA 1KLGD 2L0CA 1G8ZD 3I55A 5JVH3 4X3SA 1AFPA 1CKNA 2VXWA 2VUMG 3ONAB 1STEA 1WD0A 3CPWA 3CCJA 1U4PA 2WP8J 1SAPA 1O7IA 4ME5A 3H6MA 1JWUD 4G57A 1KDCA 1SDFA 2PW7A 4JBWA 3HOWH 2JA6G 1HNZL 3OW2A 2LSSA 3S1NB 3KLWA 1SRUA 2RQXA 5FLXL 2Z4IA 4KHPQ 1EQQA 5GAGC 4LNQA 4KHVA 2R7DA 4HCSA 3C46A 1QZHA 1GUWA 4PZ8A 5TSSA 1LABA 2YYZA 2BDNA 3NHHA 1HRJA 1FL0A 1Q46A 3KLSX 3CPFA 2F0IA 1G91A 1LTBD 2A69C 5J1ZA 1WD1A 4X66L 5M9OA 3BYYB 3K8AA 3M4OH 1V43A 1PH8A 2KOLA 3NK9A 3PF4A 4HEDA 4DV2L 1FD7D 1NUCA 3NE5B 1W6JA 3CQZH 3HGBA 2EY2A 4JI3L 4YHHQ 5IYCH 1IBMQ 3I4MB 1QZGA 3FRPB 2E5LL 1E7ZA 1M4VA 3HOZB 1PDQA 4RGOS 1AE3A 4A76A 2JA5H 1Y8NB 4A3MH 4FYDA 1FNWA 1NE3A 2JK8A 1UAPA 2V4DA 2F4VL 1BQQT 3VR2A 1F9PA 4B3MQ 4BXXH 4NXMQ 5FLXE 2NVYB 4JI3Q 2F0UA 3DM3A 1V1PB 2NBFA 2Z6BA 3Q23A 2ALYB 1KAAA 3FVQA 1TWHB 1VQAA 1Y1VG 1VQJA 5FLMH 2CHBD 3QOJA 1KL9A 4R8NA 1PZID 2HT1A 2PMZE 1OXTA 2VQFQ 1EWIA 1I94L 4CKBA 2QEJC 1I4GA 1FJGQ 5EKKA 2CCZA 4IUTA 4K8JA 1K0SA 5HGTA 1HNXQ 4KHPL 3F2DA 3HOXB 1SNPA 2KHJA 2LXKA 4QB4A 4U68A 4RG1A 1OXXK 2F0PA 2PI2A 3PUWA 2G9DA 3K7AH 5I2YA 1VQOA 2Q8TA 1B53A 1VQGA 4KKSA 2ZXRA 5FO7B 3GTMH 1G6ZA 4X3TA 2VQFL 1I94Q 2KCTA 4FXGC 4OEMB 3OHXC 1BDOA 3BG3A 2P5ZX 1VQKA 3U9SA 4QUFA 3LGJA 1JB7A 1QWYA 5C4XH 1E0BA 1CI3M 3GTLH 4BBRH 2RCFA 2L12A 2ZM6L 1VQ9A 2TSSA 2JSOA 5LL6S 3HFZB 1KDAA 3NUCA 2EPBA 3MAQA 1VQDA 4C2MH 2LXJA 2BE5C 4GOPC 2B2WA 1C9OA 5C0XG 4UHVA 4GLVB 5CBEE 1BNZA 3S2HH 2EXZA 2K03A 1IL8A 4B3SL 2DY8A 1QB5D 1X3QA 1D5ZC 1AN8A 1EY0A 2EVBA 2F0SA 1UE6A 3R93A 4WFN3 5GAEC 4JPBW 5JJIA 4YCVA 2AHOB 1A8VA 1KIXA 2D62A 2FMMA 3M3YH 2O5JC 4RKBA 4ZUIA 3S1QH 1ZYRC 3A0JA 2JA7H 1VQEA 2RDGA 1L1OA 1YHBA 2A6HC 3HG9A 4I7AA 3U58A 1VMPA 4KJOA 2EYHA 3A8IE 4DR2L 4GKJL 2TMPA 3HOZG 3EJIA 4R9WA 3ERSX 4FO2A 4LUZA 4UP9A 2AWNA 3ULLA 3K80C 1N9WA 3IRBA 1DONA 5HGQA 3KLRA 4A3JH 2R7ZH 3L9AX 4X65L 3HOUB 2K28A 1SMYC 1WFQA 2YU9H 3K5MA 2E2HB 4WRDA 2SDFA 5C5LA 2WINB 5J3BA 1SMYD 5M3MG 3J7YW 1B9NA 2KQ3A 1EL0A 1N33L 4L5RC 1BXTA 4QF4A 2UUCL 2O4XA 3TZDA 1FGUA 3RZOB 2HQEA 1Y14B 2BE5D 3HOXG 3URYA 5M3MH 4UDUC 3JAMc 4KY6A 1Z47A 4MIUA 3I4LA 1I6VC 3K0XA 1CT1D 1QUQB 1VQ8A 2YTXA 1D1IA 1TY2A 4B3RL 4OX9L 1UWVA 4K0KQ 1T5XD 4BY1H 1TWGH 1BCPC 3FKIB 3UDGA 5IP9H 3CKIB 3OW7A 2B63H 1QVCA 3QB3A 3SK4A 4RGTA 2F3VA 2X6LA 2LMCB 1QNKA 1AEXA 3T51B 4HJ5A 1O7LA 1UE1A 4IJLA 2JA6B 3GV3A 1II3A 3MEHA 1LM0A 1JCKB 3MFYA 1HR0L 1I50H 4OX9Q 2N78A 1PHJA 4IO9A 3C2PA 3HOVH 4R4IA 3ICEA 3OWEB 3NQIA 4LFCL 3T1HQ 1SN8A 1YHAA 1ZXTA 1GHKA 3GTPH 4IALA 4C3JG 2EYJA 1E24A 1K8AC 4RHSA 2GA4B 1CZWA 3MTSA 4ID6A 5LHY1 2Z0SA 2KJXA 1P8LA 3Q8DA 5C0XH 2RHSB 3P7JA 4H13C 2F0HA 5C3WA 5IGDA 2HIVA 3VDYA 2K14A 2JXMB 3IFTA 4AQYQ 2E76C 1KRTA 1C7YA 1WCMG 2ZTCA 5LL6X 4A3MG 2ZXPA 4DN4M 5IIFA 4Q5VA 5CV9A 4DR1Q 1SYBA 1S5ED 4QIWB 2WIIB 3H94A 2MQHA 1K8OA 3K7UC 1HPCA 1B3AA 3NBHB 4M1UB 1YI2A 4IOAA 4OELB 1WTRA 3GTGH 5JPNC 5CYUA 2WAQB 5BN3A 5IP9G 4N9PA 3UE0A 2VNUD 4JOIC 4L63B 1EUJA 4JYAQ 3WWVA 1DXMA 3GO5A 3ITPA 5EJWA 3M4PA 1XMQL 1FJGL 5C0XJ 4XQJA 2F0EA 2G9HD 2HUGA 4NDXA 1SXTA 3CC2A 2GVAA 5CV5A 2HCCA 4EQNA 4JBMA 1HQMC 2PI2E 4A3KG 3CD6A 4R4OA 3HOXH 2F3WA 4QY7A 2JP1A 1M1KC 1RDPD 2FJ2A 3CW2C 3V96A 4HSVA 2LFNA 2B8GA 2RA4A 4DAPA 4DXGA 1BBUA 1LACA 1BR9A 4V0BA 1HR0Q 4O2DA 1GO3E 2ASBA 3U9OA 4BA2I 3L7ZC 5IODA 3ND8A 1W6KA 3OSOA 4U673 3GTJH 1F2YA 1TWAB 3RMHA 4OWWB 2R7ZG 1K0RA 1P16A 3HZXA 4HJ8A 4IZ8A 2LS01 1F9RA 4DR7L 4IFDI 1WYDA 3A5ZB 1IYJB 1JT8A 4B3TL 1HHVA 5ELCA 2XVSA 3OTOL 2KECA 2F1MA 5EBCA 3HOYH 2K04A 3TDQA 2BH8A 2F0QA 2F0OA 4CKCA 5JOBA 1TS5A 2N3SA 3GP7A 4NB3A 4RGNA 2A6ED 1KQSA 4K8IA 3J80c 1NMFA 4EQOA 1UUPA 3U50C 3F2CA 1D5MC 2VUMB 2WB1E 4B3SQ 1UE7A 1PH2A 3S2HB 2MO1A 4AYBG 1RJTA 3ERQA 3BDLA 1OXVA 3NWTA 4IUNA 2EYOA 4LUVA 1CKOA 2R61A 1N34Q 2MGSA 1K28A 4ILWA 4KN4C 4XT3B 4RFBA 1BBWA 4DV4Q 2K4KA 3S1MH 1S5FD 5M5WH 4JI6Q 4DK0A 4A3BG 3DLLA 1D6EC 3PUZA 4NXNL 5IT9L 4ZLTF 3S17H 4A3GH 1V9PA 2I5LX 5AJ3L 3S1RH 4L5TA 2NTSA 3DHQA 4OO1G 1LO5D 1XPRA 3DEPA 1VQNA 1PTOD 3PMFA 1BCPD 3PUYA 1BCPF 1STGA 1HTLD 1TWGB 4FNFA 5C4XG 1GUSA 2F0VA 1EOTA 1Z9FA 2AQ1B 5M5WB 2B63B 4X65Q 1VMCA 2B2UA 3BZDB 1F2MA 4A3JB 2PZWA 2PNRC 4DV7L 4UY8C 2ZT9C 2K33A 3JAML 3GD7A 4C1NK 1I5FA 2B3GA 1HZCA 3S1RB 5CV8A 1E22A 4XXEA 1GD7A 2YV5A 2XIWA 1YEZA 3TREA 1A2UA 1QG7A 1Q1EA 5IT9c 4YCWA 5DAUA 3L2PA 2Q2UA 3D6CA 2F0LA 5KGUA 4LF7Q 1ICWA 4QGUA 3KF8A 1EWCA 5E4WC 1CQVA 2KENA 4K6DA 4RCNA 4DU9A 1HUNA 4HIMA 1X56A 1EYGA 3HKZB 4YWLA 3IFDA 5C6AA 3ZJYC 5EPKA 5A35A 2NVYH 1YZ6A 1U4MA 2MHVA 5KNDA 3Q0AA 5IGBA 4F88A 1K8MA 3E3XA 4LF4L 4GN3B 3M4OB 2EIFA 2PZUA 5E7NA 1PTOB 1X9NA 2OTLA 5ELBA 3SHLA 4DR4Q 3FKIG 4DV0Q 3CCQA 5FJ8G 1F9SA 1BOSA 5EGTA 1QCBD 5A2QE 1PH7A 3J7ZC 1E1OA 1BBXC 5FOBB 1F77A 3TZUA 4RHRA 2JA5B 2ICIA 1NR2A 1PH5A 2A68D 4QJFA 5KEEA 5E3FA 4JI2L 2I0QA 3TBIB 1XPOA 1CTMA 3FPPA 1L1OC 1K3RA 2UXDL 4RKLA 1ENFA 4DR4L 2JA9A 3D31A 4XQNA 1VF5C 3VYSA 4BY7H 3RZDH 5I9PA 5CMDA 2CFMA 1CKMA 3HKZG 5C3XA 4KD3A 5C5MA 2DY7A 1B8AA 2MJ8A 1PZJD 2VY3A 4LK1C 3I4MG 3TN2A 2RVLA 1ET6A 2F0NA 3E0EA 1SYCA 3UDFA 4OONA 4DPGA 4RCOA 2A68C 4WJ3M 4N8X1 1MJEA 3DM1A 2I5HA 2ZXOA 1JMCA 2B2VC 1Q81C 1EOVA 4Y7NB 2I46A 1PH9A 3GTGB 1DCZA 3CC7A 1KHIA 1QNUA 1V1PA 5M3FB 4LFAQ 1H9RA 1X6OA 3CRLC 1D7QA 4RAUC 1EYDA 3HEJA 3PO2B 4A3BH 1ESRA 2R3ZA 3OIPA 1O80A 4IFDG 1YBYA 2K5QA 4GS3A 1N33Q 1NNXA 5CC4A 3S2DB 2ATWA 1EQRA 1AE2A 4N8FA 5GROA 1EZ6A 1IYVA 2AQ3B 4HMJA 4MTNA 1CFMA 2RF4A 3H0GG 3AMUA 4CGYB 1AP0A 2I5MX 1DZ1A 1ESFA 4BA1I 2OF1A 3N52A 3F2BA 1A15A 4IUUA 2HHHQ 1V1QA 4HTHA 4MTKA 4K2KA 3EIVA 3NPPA 1TWAH 1J5EL 1Q1BA 4P71A 4LF9L 5GQOA 3S1MB 2VZAA 1W2BA 1A2TA 3AB9A 4JI2Q 4B9WA 1SFOH 4DK6C 1C48A 3TS2A 1NAPA 4DV3Q 4RMFA 1MJCA 4DGZA 4BS9A 2YU9B 4JI7Q 3EN2A 3HOYB 3DWAA 4BBSB 3GTQH 4JYAL 2XWBB 3JC66 2E2IB 2C35B 4NPSA 1XMQQ 2A1AA 1FNUA 2F4VQ 1GXDC 2K6AA 4A3FG 3BVMA 3G4SA 4HJAA 4E6IA 4NXML 3S14B 3RZOH 5DNFA 2UU9L 3Q22A 4ODGA 3J81i 2Q2HA 3U4VA 2DNEA 1PFMA 4TRDA 4FF1A 4Z9CB 3MXNA 1PH3A 2KBNA 1TWFH 3UI2A 4JBJA 1SYDA 5L37A 4FF3A 1C0AA 3RD4A 2PQAB 2IX3A 1B44D 3SXHA 1U0LA 3V2TA 4DUZQ 2XGTA 4CDEC 4GNXC 4OGQC 4C3IG 3M4YA 2CQOA 2JN4A 2CVRA 2AKWB 1HNXL 4C56C 4DV2Q 1E3PA 1B7YB 3AFPA 3T13A 1HA6A 4K6LA 4BY1G 4K14A 5M5YB 1YNJD 4LUOA 1TS2A 3KBXA 5EKLA 4B08A 1L0WA 1JJCB 1STNA 2E75C 3NENA 1L0YB 4A3DG 4KLKA 3GV6A 2I07B 1GOZA 1ZKOA 1N32L 1Y1WH 4JV5L 3RN5A 2C9OA 2H5XA 3PUXA 1PH1A 3QR8A 4PMCA 5ELNA 1IZ6A 4BWGB 5M5YH 4UAIA 1WI5A 1S5CD 1A62A 3AU7A 1Q90A 4HJ7A 3E9HA 2Q2TA 2DUDA 2R92B 4AIMA 3M9BA 3BDCA 4DAYB 5ISRA 5T1IA 1ASYA 1XMOL 1STYA 1YNJC 2E8GA 3HOVG 4NMZA 4A3JG 1NTGA 1PMRA 2R7FA 3M85A 2M2LA 1NCVA 1SBBB 1N36Q 1AZPA 2A8VA 1OXSC 1EY6A 4LF6Q 4JI6L 1K83H 2IW3A 1UEBA 5K5PA 3H0GH 4QL5A 2PCFB 3K5OA 3ZYYX 1N8RC 1E2VA 1HUMA 3I3CA 3V05A 3J81L 2SEBD 5C3EH 4C3HB 4A3IH 5KNCA 4A3MB 1L1OB 2CWPA 1G51A 2QDLA 2IJ0A 1X3PA 2B63G 3PIP3 2DJFC 2JA8H 1TT2A 3KF8B 2G5DA 1U5KA 3T16A 4DUZL 3VA7A 1G2TA 4KTAA 2D0OA 4JVZA 1JICA 1C8CA 1HA5A 2K32A 4PG3A 1GUTA 2CW0C 4CKEA 1GUOA 2WACA 5M3FH 1G2SA 1KRSA 3PO2H 1MBYA 3NTHA 4A75A 3DWQA 3J7A5 3E0JA 1XPUA 1IBLL 2UXDQ 1PFBA 2RSOA 2A5HA 1N32Q 2PQEA 4JV5Q 4A4IA 3S2DH 1VQ6A 1TXYA 3I4NG 4KHZA 1F2ZA 2A73B 1T9HA 2KEEA 4C2MB 3JAMi 3D4DA 3EFXD 2NB0A 4NW2A 4BY7G 2ENBA 1X54A 2CH4W 2DGYA 2DNCA 4APVA 1TQOA 2JJQA 2IWHA 2Z4HA 4CJ0B 3CCUA 3KFUA 2CW0D 3G7LA 1SSOA 1G291 2VL6A 4J1MA 5IYDG 4DR6L 2CH4A 5JEAJ 3STBD 3RLNA 2B29A 4C3HG 3M3YB 2EXDA 1UEAB 2N49A 3R2TA 5LMNW 3P75A 1VQ7A 2RHQB 3HOUG 4DAMA 1WTHA 4EVOA 3UDIA 4JOIA 1R4QB 3FEWX 4KY5A 2WV6D 4OHJA 1NMGA 3E9IA 3OPOA 3I73A 1H9MA 4DR6Q 1LT3D 3D4WA 1PV4A 1ILPA 3OMGA 1Y1VH 1CHPD 4HMIA 4L6TB 3VR6A 1K3BC 1EFWA 1PH6A 1Q86C 1Q82C 4JI1Q 2MNAA 4X6AH 1SNQA 1TVXA 4WJ4A 2B2YC 4DV6Q 3SR1A 3W1BA 1IKMA 4PQXA 1V8QA 2UXBL 3P1HA 1CSPA 5IWAQ 3EA6A 3B6YA 4DR5Q 5I2XA 2EQSA 1S40A 3MEFA 1GJXA 2PPBC 2B2YA 4IJHA 3S16B 5D3IB 2VQEL 2XWJB 3DEOA 3GTOH 3TP8A 3MVVA 2K52A 4YWKA 5E4XA 2PYKA 5M5XB 5IYCG 2V1CC 4AYBE 5KRUA 5DM63 1NBWA 1C4QA 4A3CH 2NVXB 4EQ5A 5CORA 3GQBA 3CMAA 1A3VA 1GUGA 5FLXc 4TSSA 4DR1L 1WTPA 3NTKA 2RCNA 4A3KB 3GTOB 1JC7A 4BBSG 5ELDA 2F0WA 5M5XH 1VDZA 1IW7C 3LX0A 1DGSA 4O42A 3WOFA 3OIQA 2NVXH 4CDDC 1W3SA 3I8ZA 1JJ2A 2JA6H 2EOTA 1IBKQ 1PYWD 1LT5D 1RF2D 5FLMG 3I4MH 4YHHL 1I50B 4JI4L 2EYLA 1F2LA 2NYZD 2QKIC 3HOWB 3TRZA 2A6EC 4XQQA 3VYTA 1IKLA 3S1NH 2OXPA 3FDTA 5JPMC 3H3VI 3PIO3 1K83B 3D8GA 1T5EA 2RSNA 2K1BA 4DF7A 2OEOA 4DFAA 1LTRD 1IL2A 4DUYQ 2E2JH 2R6GA 1XJVA 1Z7TA 3LNNA 3R3OA 5G3LF 3OYYA 2WKCA 2B8FA 2K75A 3KK7A 1JB3A 4LFAL 4JI1L 4XT1B 1MI2A 4JI4Q 2A74C 4FDBA 1ET9A 2NZOA 1S72A 2O5IC 2EYFA 3KYHC 5K36G 2JA8B 1K9MC 1HZAA 2EE1A 2RDFA 3CQZB 5KNBA 1IBML 1MIUA 3J80i 4R8IA 3PO3G 2R92H 1FGBD 3I56A 1UNSA 1GVPA 1SJED 5C44B 4KJNA 3EROA 3SDZA 1S4ZA 5BR8Q 2K5VA 4G4KA 1MSGA 2ZJPA 1CK1A 3SGIA 1LUZA 3ND9A 4C3JH 4YY3L 2F52A 2JEBI 4AH6A 1L2FA 3K7AB 3TS0A 1O7YA 1D1KA 1EIYB 2J0TD 3H3VH 4O1NA 2QGQA 2NN6H 1DYQA 4GOPB 4LW1A 4LF9Q 2F4IA 1YNNC 3NBHA 3NBIA 3TP6A 3P20A 5KYIA 4Y7NH 1J6QA 2CWAA 3N6RA 4K5WA 4DV3L 1UE5A 2QDBA 4C3HH 1M8AA 1X32A 2FFKB 1WOCA 5C4XB 5BR8L 4DV4L 4XDXA 4LWCA 1EY5A 3AYHB 4TVAB 2PMZB 5EPLA 4YY3Q 4PNYA 5IYDH 2OWOA 2ZM6Q 5C4HA 4I7ZC 1LTTD 1M90C 4K2LA 4OXPA 4ME3A 4QUCA 1XX8A 3D6WA 2CQAA 2HD3A 3NQTA 1SYEA 4ABNA 3UE1A 2DJGC 4DR7Q 5IT9E 1HH2P 1TIID 1H9SA 1PRTB 3QO2A 3OTOQ 3EQLC 2OT2A 3PO2G 3BU2A 4LAAA 4PV1C 1EU4A 2F03A 4OL7A 3LWEA 3W5OA 1E2WA 1ICFB 1SE3A 4DAYA 2XRQD 2N55A 2X6GA 3RLOA 3CCRA 4DR3L 1K8GA 2YTYA 4UPAA 4RWSC 1YITA 4MNOA 2B2VA 2F0JA 2EJFC 3PQIA 4FF4A 3F2UA 5F2DA 3W1GA 5J39A 2GVBA 1VQHA 2L11A 4V190 1PA6A 4R4CA 5JJZA 3FP9A 1B3QA 2FHTA 4A3BB 4BBRB 1FR3A 1NJIC 1TR5A 1PTOC 1N34L 1GUNA 4A3FB 3WDNA 5KIXA 3DWPA 2UUBQ 4LFBQ 3CCLA 1PYBA 1SE2A 2F0GA 1JOKA 4F7XA 1B50A 4IFDJ 4DKAC 4HCEA 3CCMA 2XTIA 4A3IG 1YVCA 2HDLA 3STBC 3BS1A 3OWFA 4J8QA 2WB1B 3S14H 3CU7A 1STHA 3Q6SA 3I91A 4L8JA 3HOUH 5D14A 3S17B 4HIDA 2JA7G 3M4QA 2HQLA 4G7OC 1XTDA 2XRSD 3HOYG 4XTCS 5BN5A 1S5BD 4HN7A 1N36L 4C3IB 2JE6I 1RODA 3BDOA 1XNRQ 5D3DA 1STAA 4X64L 2PNHA 1RL2A 2X69A 2UUCQ 2R93H 4HR7B 1L0XB 4QCLA 2AWOA 1SFOB 3I4NH 4KKUA 1PYSB 1FVIA 1SNCA 1BO0A 4OIKA 5JEAG 3QG1A 3K81C 1SMXA 2EZVA 1ONLA 1V1OA 1EEFD 2IY5B 1ZYRD 4IUVA 1XXGA 4IUQA 2E2IH 2ZJRA 4JI5Q 3IKJA 3KDFA 1CKNB 4FP5D 3T1YQ 2VQEQ 1KAWA 5LMUL 5ELFA 4GLXA 2WAQG 1SE8A 3H09A 3NP8A 1Y1WG 4A3LG 4CBVA 4IPGA 1J9OA 1Q8IA 4A3GG 1ENCA 3AQQA 5CR3A 3I72A 4FVMA 3CAMA 4G7HC 1R4PB 4JC0A 5M3FG 3C1EA 3C1FA 4F8MA 3EVQA 3A8JE 2KUMA 2Y0SE 2DN8A 3FHWA 4H7BA 5EKIA 1U4LA 2PW5A 4ZKCB 5IYBH 3A54A 3KF6B 4KD4A 3KOJA 4JI5L 4DNTB 4A93H 1TS3A 1EY4A 1U9RA 4PZ6A 2K5DA 5M3MB 1A6XA 3S9WA 3GTPB 2RDHA 2B2TA 4DV0L 1QILA 4X3UA 1JORA 3RN2A 1SEBD 1RTNA 4EQPA 3H0GB 4FF2A 2MPMA 5IGEA 3D3RA 1OTCA 1VCIA 4GN5A 4JI8Q 2NN6G 2KEDA 4MZ9A 2K01A 1EY7A 1TWHH 4A3IB 2YTVA 3R2IA 1LT6D 3CHBD 2Z9HA 3OMCA 4QMGA 1B2TA 2KHIA 3I90A 1CA5A 3W3AA 1SNDA 3LWUA 1LTID 2L5TA 5C4JB 3J81E 1DM0B 3RNUA 1SNMA 2F0DA 1VQLA 3K5LA 4LF5Q 1MKHA 5GAHC 2R92G 1TY0A 2KCMA 2KVMA 4ZYSA 3T1HL 4LFCQ 1ENAA 1I4RA 3HOVB 3S15H 4A3EB 1XNQL 4S3SA 4JI0Q 2UUAQ 1BCPB 5AFWA 5C4ZA 4DV1Q 5ELEA 3RLFA 1E1TA 4IUPA 2QILA 1X3FA 2QA4A 2UXCL 4P2CB 4JBKA 3T56B 3U4ZA 4A3DH 3R8BA 3SE0A 4KKTA 3ULJA 4CHTB 3C3LA 3KDFB 1OXUA 5FKAC 4B3ML 3VYUA 3MZ5A 5JJLA 5H1SE 1J8IA 3CCSA 1EYAA 2BOSA 2IX0A 3KUPA 4IFDH 3PUVA 2A6HD 2IHFA 3S15B 1QJOA 3K0YA 1GM5A 3MC0B 2Y0SB 4K5VA 2UU9Q 2Z1CA 1DOKA 4JI0L 4B9XA 2Q2IA 4DR5L 2BDOA 4ZQ3A 3NEMA 1RCVD 2CKZB 4DNIA 1OO9B 5GADC 3GTJB 3BJUA 1JE4A 1I3QB 2FINB 4CJ1B 1D2BA 2D2CC 1JWMD 5BN4A 2XSCA 3IL8A 5I9OA 3IAYA 1WCMH 3PF5A 2Z6KA 4KI0A 1HJPA 2MO0A 4JG2A 3CP0A 1A63A 1MSHA 2Z6KC 4A3FH 3HOWG 1PVOA 5I4DA 1SLJA 4QQBX 3KJOA 1PLFA 3VR5A 5IP7H 2J4XA 4A3CG 4X3KA 2L4NA 2K05A 3QWNA 3KJPA 5EQ0A 1ILQA 2VUMH 4JI7L 2Q8IB 1WCMB 3SK8A 1WTQA 4TQUS 3JAME 1I4XA 4EGVA 1VQ4A 3CRKC 4WORA 2BA1A 5G3LD 1IXRA 1LTSD 4IN3A 2A19A 1H9KA 4IURA 2AUJD 4FXDA 4DV5Q 3I4OA 3VA5A 5HURA 3MWYW 3A56A 4DV1L 3F8TA 3EBEA 2NZHA 2K50A 4B3TQ 4F87A 1XMOQ 4ALPA 4QIWE 3I4NB 5FJ8H 1GHJA 4KY7A 2D9UA 3MXPA 4LFBL 4NP5A 3PIOA 4L5QA 3X3MA 2E2DC 5I6YA 1Q12A 1EZ8A 1ML0D 1EY9A 4R4QA 3CMEA 2NN6I 2C5CA 3UDXA 3VR4A 1JWSD 2B39A 4XIGS 1JOOA 1AZQA 2NVQH 4OWTB 3H91A 2OQ0A 1KNAA 4A3LH 3TEHB 1EQVA 1JJGA 2HCIA 1QE6A 1SROA 1EFID 1A3TA 1NR4A 3MFGA 4BBSH 2N8NA 3CF5A 2BA0A 1PTOF 3J7AF 4ZKBB 3AFQA 4KV6A 1YJ9A 4PMWA 1DD2A 4LF7L 4A93B 3T4AC 4NXNQ 1O7ZA 4DR3Q 2EDGA 2R93B 1Y8OB 3HP3A 1X55A 1LTGD 4UP8A 4PZ7A 4WJWA 3I2ZA 1EIFA 5J22A 2K5HA 1R9TB 1LT4D 1HFNA 2HIXA 4JW0A 2AMCB 4ZAIA 2SNSA 3VR3A 1SNOA 5IY0A 2LKVA 2UUBL 2L9HA 1CA6A 3HOZH 4LF6L 2K5NA 2PZTA 3GDEA 3VYRA 4KK7A 4LMQD 1SR3A 1HFGA 4AYBB 2A69D 3I7FA 4JK1C 4LF8L 5EAYA 1A3UA 3SEBA 1BUVT 3J81c 4DV5L 3A7AB 3J80L 1QVGA 3CCVA 1HNWL 1EWHA 5C4JH 2B2WC 3TQYA 3E6ZX 5IOCA 3FKIH 4DAVA 1KLUD 1K73C 4K0KL 1CQFA 1B1ZA 1D8LA 3L0OA 1YJWA 4DK1A 4GKJQ 3G48A 4NKLA 2ZJQA 4R4TA 3QOLA 1AH9A 1NY4A 2KA7A 1WTWA 1XYIA 4H02A 5E1FA 3FPUB 2J7ZA 4ULLA 2FXQA 5C3EG 1MD2D 2RKSA 2E2JB 4G7ZC 1WTXA 4HIOA 4FXKC 3G6JB 1CM9A 2SOBA 4OO1I 3MA2B 2GN5A 3ER0A 4BY7B 3SVMA 4MN3A 3CCEA 2Z8LA 3J7AV 2IPKD 4O0AA 1DOMA 4I65A 4EX5A 4JCVE 4HSPA 3DMUA 1EU3A 2F0FA 1IW7D 3KF6A 1KABA 2KCCA 1GKHA 4LF5L 4OWXB 2UXBQ 1I3QH 5KYLA 5IWAL 1XNQQ 3MXGA 3DXJC 5C3EB 3M7NA 1HZBA 3A74A 1LYLA 2NUCA 1NSNS 4IPCA 3Q24A 1YHQA
chains in the Genus database with same CATH topology
4DV4L 2VY3A 2UXCQ 4LWCA 3K7AH 4X62L 3I4MG 3AYHB 3E0EA 1LTLA 1VQOA 4B3RQ 4Y52H 4TVAB 4YY3Q 3UDFA 4L5SA 4OONA 4AQYL 1ASZA 5IYDH 1VQGA 4J15A 2OWOA 4DPGA 3PSIA 4UP7A 2ZM6Q 2IHEA 3F1ZA 1M90C 3GTMH 4OXPA 4ME3A 4WJ3M 1MJEA 2VQFL 2I5HA 2KCTA 1I94Q 4GOPA 1Q81C 1JMCA 1EOVA 3UE1A 1PH9A 4DR7Q 1HH2P 3CC7A 1KHIA 1VQKA 1VQFA 4LFAQ 3LGJA 2F3IA 1X6OA 2JEAI 1D7QA 1JB7A 3OTOQ 4JI8L 5C4XH 1X65A 3GTLH 4A3BH 4BBRH 1QVFA 2ZM6L 1VQ9A 3PO2G 1WJJA 3BU2A 2VW9A 4IFDG 1YBYA 4GS3A 3W5OA 1Q7YC 1N33Q 3HFZB 3GTKH 4GKKL 3RLOA 1EQRA 1AE2A 3CCRA 2ATWA 4BXXG 4POFA 4DR3L 1K8GA 2YTYA 5GROA 1VQDA 4C2MH 4UPAA 5IE8A 2LXJA 2PQAA 4MNOA 4GOPC 1YITA 3AEVA 1I6HH 1C9OA 3W1GA 5C0XG 3H15A 1J5EQ 1YNXA 2GVBA 1VQHA 4GLVB 3S2HH 4MTNA 1PA6A 4R4CA 2RF4A 3FP9A 3H0GG 4B3SL 1NJIC 1Q8KA 2I5MX 1N34L 3MXNB 4P73A 4BA1I 2UUBQ 2ZTEA 1UE6A 3F2BA 4LFBQ 1RIPA 5GAEC 2HHHQ 1V1QA 3CCLA 1PYBA 5JJIA 4YCVA 4DUYL 4X66Q 2AHOB 1A8VA 3EIVA 4DKAC 1TWAH 4IFDJ 1J5EL 1Q1BA 2XTIA 2D62A 1YVCA 4P71A 5GQOA 3STBC 3CCMA 4A3IG 4LF9L 3M3YH 3S14H 1VQIA 2VZAA 1W2BA 3S1QH 3A0JA 4JI2Q 2JA7H 1VQEA 1L1OA 1YHBA 3G71A 1SFOH 4DK6C 3HOUH 3U58A 3TS2A 4DV3Q 4RMFA 1MJCA 4HIDA 2JA7G 3M4QA 4JI7Q 4DR2L 2HQLA 3EN2A 5IP7G 4GKJL 1KXLA 1VQMA 3HOZG 1XTDA 1X3EA 3GTQH 3ERSX 4JYAL 4LUZA 3HOYG 4UP9A 2AWNA 4XTCS 3ULLA 3JC66 2C35B 3K80C 4NPSA 1N9WA 2A1AA 1XMQQ 2F4VQ 1N36L 2JE6I 4A3FG 1HZ9A 3IRBA 3BZCA 4X62Q 5HGQA 3G4SA 4HJAA 4NXML 1XNRQ 3RZOH 1H95A 4X64L 2PNHA 1RL2A 4A3JH 4A3KH 2UU9L 2UUCQ 3J81i 2R93H 2Q2HA 3U4VA 2R7ZH 2AWOA 3I4NH 4X65L 1PYSB 1FVIA 1PH3A 1WFQA 2KBNA 1TWFH 5JEAG 1VQPA 4JBJA 2YU9H 3K81C 1SMXA 1IBKL 1C0AA 5J3BA 2IY5B 1R9TH 2PQAB 5M3MG 2E2IH 2ZJRA 4JI5Q 4YWMA 5IYBG 3KDFA 1CKNB 4C3IH 1U0LA 3T1YQ 4L5RC 2VQEQ 1N33L 1KAWA 4IPDA 4DUZQ 5LMUL 4GLXA 2UUCL 2UUAL 2WAQG 3S16H 2XGTA 4GNXC 1CSQA 1SE8A 1FGUA 2CQOA 1Y1WG 1HR0W 4A3LG 2AKWB 1Y14B 4IPGA 3HOXG 1HNXL 4DV2Q 4A3GG 5M3MH 1E3PA 1B7YB 3AFPA 3AQQA 4BY1G 3JAMc 3CAMA 1Z47A 5M3FG 4JC0A 1X3GA 2VS1A 4LUOA 3HKSA 3K0XA 1QUQB 1VQ8A 4GN4B 2YTXA 5DLQE 1L0WA 5AJ3Q 4OX9L 1JJCB 4B3RL 2Y0SE 1UWVA 4K0KQ 3FHWA 4BY1H 3J81j 1TWGH 1VQBA 1CUKA 3NENA 5IYBH 4KLKA 4A3DG 3KF6B 3UDGA 5IP9H 3KOJA 1Y1WH 1N32L 4JV5L 4JI5L 3RR5A 3RN5A 2E5LQ 2B63H 4A93H 1QVCA 4PZ6A 2H5XA 2QEXA 3PUXA 1PH1A 5ELNA 4HIKA 1IZ6A 4GLAC 5M5YH 3A5UA 4DV0L 1WI5A 4DV7Q 3RN2A 4HJ5A 1A62A 1A0IA 4HJ7A 4HJ9A 3E9HA 1UE1A 2Q2TA 2DUDA 5JJKA 4IJLA 3M9BA 4AIMA 4DAYB 1OTCA 4DR2Q 2JA8G 1VCIA 4GN5A 1ASYA 1LM0A 1XMOL 2Y0SG 1HR0L 2E8GA 1I50H 5C44H 3HOVG 4A3JG 4YCUA 4DK3C 4JI8Q 4OX9Q 1NTGA 3M85A 2R7FA 2R93G 2NN6G 2N78A 1PHJA 4MZ9A 4IO9A 1TWHH 1N36Q 2A8VA 3HOVH 4R4IA 2YTVA 4A3EH 3ICEA 1OXSC 2OTJA 4LFCL 3T1HQ 1SN8A 4LF6Q 4JI6L 1YHAA 2JQOA 3GTPH 1K83H 1G6PA 1E24A 2KHIA 1K8AC 4GNXB 1UEBA 3H0GH 4QL5A 1TWCH 1VQ5A 1N8RC 2Z0SA 1P8LA 3RNUA 3Q8DA 2RHSB 1VQLA 4LF5Q 1MKHA 5GAHC 2R92G 4P75A 2KCMA 2D0PA 2ZTDA 4A3EG 3T1HL 5C3EH 4LFCQ 4POGA 2OQKA 3NELA 4IOCA 4A3IH 3S15H 2HIVA 3VDYA 1PH4A 2K14A 1XNQL 4JI0Q 1L1OB 2CWPA 2UUAQ 4AQYQ 1G51A 1KRTA 1C7YA 1WCMG 4DV1Q 2NVTH 2ZTCA 2B63G 4A3MG 3RLFA 4A93G 1E1TA 2JA8H 2QA4A 1X3FA 2OCEA 3S24A 4LF4Q 4JBKA 2UXCL 3U4ZA 3KF8B 4DR1Q 1IBLQ 4A3DH 1U5KA 4DUZL 2MQHA 3K7UC 2D0OA 3ULJA 1YIJA 3KDFB 1OXUA 3NBHB 1YI2A 4IOAA 4B3ML 4PG3A 3D0FA 5JJLA 5H1SE 1YHQA 3GTGH 3CCSA 1BKBA 4GNXA 5M3FH 2IX0A 3PUVA 2IHFA 1KRSA 5IP9G 3UE0A 1GM5A 3PO2H 4BBRG 2L15A 4A75A 2VNUD 3J7A5 4JOIC 4JYAQ 1EUJA 3WWVA 1XPUA 1IBLL 4X64Q 2UU9Q 4JI0L 3GO5A 1FJGL 3PGZA 3M4PA 2Q2IA 1XMQL 2UXDQ 4DR5L 5C0XJ 3NEMA 1N32Q 1VQCA 4JV5Q 3CC2A 2GVAA 4A4IA 3S2DH 1VQ6A 1TXYA 3I4NG 3ULPA 2CKZB 4DNIA 2WFWA 4KHZA 5GADC 4JBMA 2PI2E 1T9HA 3BJUA 3PCOB 4A3KG 3JAMi 1HNWQ 3CD6A 4R4OA 3HOXH 2IT1A 4BY7G 4QY7A 3CC4A 1X54A 1M1KC 3CW2C 2DGYA 5HY6A 3HKZE 1WCMH 4APVA 3PF5A 1BBUA 1VS0A 2Z6KA 2JJQA 4KI0A 3CCUA 3KFUA 1HJPA 2MO0A 4JG2A 3CP0A 1A63A 1B70B 2Z6KC 1HR0Q 4O2DA 1G291 1GO3E 2VL6A 3PV0A 4P72A 5IYDG 4A3FH 2ASBA 4DR6L 3HOWG 4BA2I 3L7ZC 5ELOA 5JEAJ 4QQBX 1SLJA 1PVOA 4P74A 3STBD 3KJOA 3GTJH 3RLNA 4OWWB 5IP7H 2R7ZG 2B29A 1K0RA 1P16A 2EXDA 4A3CG 2WB1G 2N49A 5LMNW 3PIPA 3KJPA 4HJ8A 1KD1C 3CXCA 2VUMH 3G6EA 1VQ7A 3HOUG 2RHQB 4JI7L 1WYDA 3A5ZB 4DR7L 4IFDI 1IYJB 4DAMA 4R1JA 1JT8A 4B3TL 2MFIA 4TQUS 1VQ4A 3UDIA 3OTOL 3HOYH 2BA1A 4JOIA 4GKKQ 2BH8A 1IXRA 4DV6L 1NMGA 5LMNL 2A19A 5C44G 3E9IA 2N3SA 1XNRL 2IX1A 4DR6Q 4DV5Q 4NB3A 3I4OA 1PV4A 1PFSA 1Y1VH 1KQSA 3J80c 3BZKA 3F8TA 3EBEA 1NMFA 4DV1L 2NZHA 3U50C 1KIXA 1EFWA 3F2CA 2K50A 1PH6A 4B3TQ 4LF8Q 1XMOQ 1S3OA 4ALPA 2WB1E 1Q86C 1Q82C 4B3SQ 1UE7A 4QIWE 4JI1Q 5FJ8H 1PH2A 2ES2A 2MNAA 4X6AH 1QUQA 2MO1A 4AYBG 4WJ4A 4DV6Q 1OXVA 3W1BA 2E2HH 3PO3H 1YJNA 4LFBL 3PIOA 2UXBL 4L5QA 4LUVA 1Q12A 5IWAQ 1CSPA 3T1YL 1CKOA 4R4QA 5C0XI 2NN6I 3CMEA 5LMUQ 1N34Q 3B6YA 1HNZQ 3UDXA 4DR5Q 2BH2A 4IPHA 5LMNQ 2WAQE 1BVSA 2EQSA 1S40A 1KC8C 2JA5G 3MEFA 1BBWA 4DV4Q 2HHHL 4IJHA 4XIGS 2K4KA 3S1MH 5M5WH 4JI6Q 2VQEL 2NVQH 4A3BG 3DLLA 1JE5A 2ID0A 4OWTB 3I55A 3GTOH 2K52A 3PUZA 4NXNL 4YWKA 3S17H 2OQ0A 4A3GH 1CKNA 1V9PA 2I5LX 4A3LH 5IYCG 2VUMG 5AJ3L 3S1RH 4L5TA 3TEHB 2V1CC 4AYBE 3CPWA 1JJGA 3CCJA 2WP8J 1NBWA 1SROA 4A3CH 4OO1G 1XPRA 4EQ5A 4BBSH 1O7IA 2N8NA 3CF5A 1VQNA 3CMAA 2BA0A 3PUYA 5FLXc 3AFQA 4DR1L 4JBWA 3HOWH 1YJ9A 4PMWA 5C4XG 2JA6G 2RCNA 1HNZL 1Z9FA 3OW2A 4LF7L 2LSSA 4X65Q 4NXNQ 4DR3Q 3KLWA 1SRUA 4UY8C 4DV7L 4KHPQ 1X55A 1EQQA 5GAGC 3GD7A 4UP8A 4LNQA 4BBSG 4PZ7A 1I5FA 2R7DA 2B3GA 1HZCA 5M5XH 1E22A 1DGSA 3I2ZA 1GD7A 1EIFA 2YV5A 2K5HA 1QZHA 2NVXH 4PZ8A 1YEZA 3TREA 2YYZA 1W3SA 1JJ2A 1Q1EA 5IT9c 2JA6H 4YCWA 1IBKQ 2HIXA 2AMCB 1FL0A 1Q46A 5FLMG 3L2PA 2Q2UA 3CPFA 5IY0A 4YHHL 4JI4L 4LF7Q 4QGUA 3I4MH 2UUBL 3TRZA 3HOZH 4LF6L 2K5NA 3GDEA 3S1NH 4X66L 1SR3A 3K8AA 3M4OH 3H3VI 2KENA 1V43A 1PH8A 3I7FA 3PF4A 4HIMA 1X56A 4LF8L 5EAYA 1EYGA 4DV2L 1IL2A 3CQZH 4DUYQ 4JI3L 4YWLA 3J81c 4DV5L 2E2JH 2R6GA 3ZJYC 1XJVA 1QVGA 3CCVA 3OYYA 4YHHQ 5IYCH 1HNWL 2K75A 5C4JH 3TQYA 1IBMQ 2NVYH 1YZ6A 4LFAL 3FKIH 1QZGA 2E5LL 4JI1L 1E7ZA 1K73C 4K0KL 1AE3A 4JI4Q 4FDBA 1D8LA 3L0OA 2NZOA 1YJWA 4A76A 1S72A 2JA5H 4A3MH 3G48A 4GKJQ 2ZJQA 4R4TA 4GN3B 4LF4L 2EIFA 3KYHC 1AH9A 1NE3A 1NY4A 5E7NA 5K36G 1X9NA 4H02A 1K9MC 1HZAA 2JK8A 2OTLA 2F4VL 2FXQA 5C3EG 4DR4Q 1IBML 3FKIG 1MIUA 3J80i 3PO3G 4DV0Q 4B3MQ 3CCQA 2R92H 4BXXH 3I56A 4HIOA 4NXMQ 4JI3Q 1GVPA 5FJ8G 4OO1I 3DM3A 2GN5A 3ER0A 2ALYB 1PH7A 5BR8Q 1E1OA 3J7ZC 3CCEA 2K5VA 2ZJPA 1VQAA 1Y1VG 4O0AA 3SGIA 1VQJA 4EX5A 1LUZA 4C3JH 4YY3L 5FLMH 4JCVE 2F52A 2JEBI 4AH6A 1KL9A 1L2FA 3TS0A 1PH5A 1EIYB 3H3VH 4QJFA 2HT1A 2QGQA 4JI2L 2PMZE 2I0QA 1OXTA 2VQFQ 1EWIA 3KF6A 1XPOA 4GOPB 1I94L 1L1OC 4LW1A 1K3RA 1FJGQ 2UXDL 1GKHA 2CCZA 4LF5L 4LF9Q 4DR4L 2JA9A 4OWXB 3D31A 4Y7NH 1J6QA 1HNXQ 2CWAA 2UXBQ 1I3QH 4KHPL 4BY7H 3F2DA 5IWAL 3RZDH 1XNQQ 2KHJA 2LXKA 3HKZG 2CFMA 1CKMA 4RG1A 4DV3L 1UE5A 1HZBA 1LYLA 1OXXK 3A74A 4C3HH 3M7NA 1WOCA 4IPCA 1B8AA 2PI2A 3PUWA 5BR8L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 L;  2VY3 A;  2UXC Q;  4LWC A;  3K7A H;  4X62 L;  3I4M G;  3AYH B;  3E0E A;  1LTL A;  1VQO A;  4B3R Q;  4Y52 H;  4TVA B;  4YY3 Q;  3UDF A;  4L5S A;  4OON A;  4AQY L;  1ASZ A;  5IYD H;  1VQG A;  4J15 A;  2OWO A;  4DPG A;  3PSI A;  4UP7 A;  2ZM6 Q;  2IHE A;  3F1Z A;  1M90 C;  3GTM H;  4OXP A;  4ME3 A;  4WJ3 M;  1MJE A;  2VQF L;  2I5H A;  2KCT A;  1I94 Q;  4GOP A;  1Q81 C;  1JMC A;  1EOV A;  3UE1 A;  1PH9 A;  4DR7 Q;  1HH2 P;  3CC7 A;  1KHI A;  1VQK A;  1VQF A;  4LFA Q;  3LGJ A;  2F3I A;  1X6O A;  2JEA I;  1D7Q A;  1JB7 A;  3OTO Q;  4JI8 L;  5C4X H;  1X65 A;  3GTL H;  4A3B H;  4BBR H;  1QVF A;  2ZM6 L;  1VQ9 A;  3PO2 G;  1WJJ A;  3BU2 A;  2VW9 A;  4IFD G;  1YBY A;  4GS3 A;  3W5O A;  1Q7Y C;  1N33 Q;  3HFZ B;  3GTK H;  4GKK L;  3RLO A;  1EQR A;  1AE2 A;  3CCR A;  2ATW A;  4BXX G;  4POF A;  4DR3 L;  1K8G A;  2YTY A;  5GRO A;  1VQD A;  4C2M H;  4UPA A;  5IE8 A;  2LXJ A;  2PQA A;  4MNO A;  4GOP C;  1YIT A;  3AEV A;  1I6H H;  1C9O A;  3W1G A;  5C0X G;  3H15 A;  1J5E Q;  1YNX A;  2GVB A;  1VQH A;  4GLV B;  3S2H H;  4MTN A;  1PA6 A;  4R4C A;  2RF4 A;  3FP9 A;  3H0G G;  4B3S L;  1NJI C;  1Q8K A;  2I5M X;  1N34 L;  3MXN B;  4P73 A;  4BA1 I;  2UUB Q;  2ZTE A;  1UE6 A;  3F2B A;  4LFB Q;  1RIP A;  5GAE C;  2HHH Q;  1V1Q A;  3CCL A;  1PYB A;  5JJI A;  4YCV A;  4DUY L;  4X66 Q;  2AHO B;  1A8V A;  3EIV A;  4DKA C;  1TWA H;  4IFD J;  1J5E L;  1Q1B A;  2XTI A;  2D62 A;  1YVC A;  4P71 A;  5GQO A;  3STB C;  3CCM A;  4A3I G;  4LF9 L;  3M3Y H;  3S14 H;  1VQI A;  2VZA A;  1W2B A;  3S1Q H;  3A0J A;  4JI2 Q;  2JA7 H;  1VQE A;  1L1O A;  1YHB A;  3G71 A;  1SFO H;  4DK6 C;  3HOU H;  3U58 A;  3TS2 A;  4DV3 Q;  4RMF A;  1MJC A;  4HID A;  2JA7 G;  3M4Q A;  4JI7 Q;  4DR2 L;  2HQL A;  3EN2 A;  5IP7 G;  4GKJ L;  1KXL A;  1VQM A;  3HOZ G;  1XTD A;  1X3E A;  3GTQ H;  3ERS X;  4JYA L;  4LUZ A;  3HOY G;  4UP9 A;  2AWN A;  4XTC S;  3ULL A;  3JC6 6;  2C35 B;  3K80 C;  4NPS A;  1N9W A;  2A1A A;  1XMQ Q;  2F4V Q;  1N36 L;  2JE6 I;  4A3F G;  1HZ9 A;  3IRB A;  3BZC A;  4X62 Q;  5HGQ A;  3G4S A;  4HJA A;  4NXM L;  1XNR Q;  3RZO H;  1H95 A;  4X64 L;  2PNH A;  1RL2 A;  4A3J H;  4A3K H;  2UU9 L;  2UUC Q;  3J81 i;  2R93 H;  2Q2H A;  3U4V A;  2R7Z H;  2AWO A;  3I4N H;  4X65 L;  1PYS B;  1FVI A;  1PH3 A;  1WFQ A;  2KBN A;  1TWF H;  5JEA G;  1VQP A;  4JBJ A;  2YU9 H;  3K81 C;  1SMX A;  1IBK L;  1C0A A;  5J3B A;  2IY5 B;  1R9T H;  2PQA B;  5M3M G;  2E2I H;  2ZJR A;  4JI5 Q;  4YWM A;  5IYB G;  3KDF A;  1CKN B;  4C3I H;  1U0L A;  3T1Y Q;  4L5R C;  2VQE Q;  1N33 L;  1KAW A;  4IPD A;  4DUZ Q;  5LMU L;  4GLX A;  2UUC L;  2UUA L;  2WAQ G;  3S16 H;  2XGT A;  4GNX C;  1CSQ A;  1SE8 A;  1FGU A;  2CQO A;  1Y1W G;  1HR0 W;  4A3L G;  2AKW B;  1Y14 B;  4IPG A;  3HOX G;  1HNX L;  4DV2 Q;  4A3G G;  5M3M H;  1E3P A;  1B7Y B;  3AFP A;  3AQQ A;  4BY1 G;  3JAM c;  3CAM A;  1Z47 A;  5M3F G;  4JC0 A;  1X3G A;  2VS1 A;  4LUO A;  3HKS A;  3K0X A;  1QUQ B;  1VQ8 A;  4GN4 B;  2YTX A;  5DLQ E;  1L0W A;  5AJ3 Q;  4OX9 L;  1JJC B;  4B3R L;  2Y0S E;  1UWV A;  4K0K Q;  3FHW A;  4BY1 H;  3J81 j;  1TWG H;  1VQB A;  1CUK A;  3NEN A;  5IYB H;  4KLK A;  4A3D G;  3KF6 B;  3UDG A;  5IP9 H;  3KOJ A;  1Y1W H;  1N32 L;  4JV5 L;  4JI5 L;  3RR5 A;  3RN5 A;  2E5L Q;  2B63 H;  4A93 H;  1QVC A;  4PZ6 A;  2H5X A;  2QEX A;  3PUX A;  1PH1 A;  5ELN A;  4HIK A;  1IZ6 A;  4GLA C;  5M5Y H;  3A5U A;  4DV0 L;  1WI5 A;  4DV7 Q;  3RN2 A;  4HJ5 A;  1A62 A;  1A0I A;  4HJ7 A;  4HJ9 A;  3E9H A;  1UE1 A;  2Q2T A;  2DUD A;  5JJK A;  4IJL A;  3M9B A;  4AIM A;  4DAY B;  1OTC A;  4DR2 Q;  2JA8 G;  1VCI A;  4GN5 A;  1ASY A;  1LM0 A;  1XMO L;  2Y0S G;  1HR0 L;  2E8G A;  1I50 H;  5C44 H;  3HOV G;  4A3J G;  4YCU A;  4DK3 C;  4JI8 Q;  4OX9 Q;  1NTG A;  3M85 A;  2R7F A;  2R93 G;  2NN6 G;  2N78 A;  1PHJ A;  4MZ9 A;  4IO9 A;  1TWH H;  1N36 Q;  2A8V A;  3HOV H;  4R4I A;  2YTV A;  4A3E H;  3ICE A;  1OXS C;  2OTJ A;  4LFC L;  3T1H Q;  1SN8 A;  4LF6 Q;  4JI6 L;  1YHA A;  2JQO A;  3GTP H;  1K83 H;  1G6P A;  1E24 A;  2KHI A;  1K8A C;  4GNX B;  1UEB A;  3H0G H;  4QL5 A;  1TWC H;  1VQ5 A;  1N8R C;  2Z0S A;  1P8L A;  3RNU A;  3Q8D A;  2RHS B;  1VQL A;  4LF5 Q;  1MKH A;  5GAH C;  2R92 G;  4P75 A;  2KCM A;  2D0P A;  2ZTD A;  4A3E G;  3T1H L;  5C3E H;  4LFC Q;  4POG A;  2OQK A;  3NEL A;  4IOC A;  4A3I H;  3S15 H;  2HIV A;  3VDY A;  1PH4 A;  2K14 A;  1XNQ L;  4JI0 Q;  1L1O B;  2CWP A;  2UUA Q;  4AQY Q;  1G51 A;  1KRT A;  1C7Y A;  1WCM G;  4DV1 Q;  2NVT H;  2ZTC A;  2B63 G;  4A3M G;  3RLF A;  4A93 G;  1E1T A;  2JA8 H;  2QA4 A;  1X3F A;  2OCE A;  3S24 A;  4LF4 Q;  4JBK A;  2UXC L;  3U4Z A;  3KF8 B;  4DR1 Q;  1IBL Q;  4A3D H;  1U5K A;  4DUZ L;  2MQH A;  3K7U C;  2D0O A;  3ULJ A;  1YIJ A;  3KDF B;  1OXU A;  3NBH B;  1YI2 A;  4IOA A;  4B3M L;  4PG3 A;  3D0F A;  5JJL A;  5H1S E;  1YHQ A;  3GTG H;  3CCS A;  1BKB A;  4GNX A;  5M3F H;  2IX0 A;  3PUV A;  2IHF A;  1KRS A;  5IP9 G;  3UE0 A;  1GM5 A;  3PO2 H;  4BBR G;  2L15 A;  4A75 A;  2VNU D;  3J7A 5;  4JOI C;  4JYA Q;  1EUJ A;  3WWV A;  1XPU A;  1IBL L;  4X64 Q;  2UU9 Q;  4JI0 L;  3GO5 A;  1FJG L;  3PGZ A;  3M4P A;  2Q2I A;  1XMQ L;  2UXD Q;  4DR5 L;  5C0X J;  3NEM A;  1N32 Q;  1VQC A;  4JV5 Q;  3CC2 A;  2GVA A;  4A4I A;  3S2D H;  1VQ6 A;  1TXY A;  3I4N G;  3ULP A;  2CKZ B;  4DNI A;  2WFW A;  4KHZ A;  5GAD C;  4JBM A;  2PI2 E;  1T9H A;  3BJU A;  3PCO B;  4A3K G;  3JAM i;  1HNW Q;  3CD6 A;  4R4O A;  3HOX H;  2IT1 A;  4BY7 G;  4QY7 A;  3CC4 A;  1X54 A;  1M1K C;  3CW2 C;  2DGY A;  5HY6 A;  3HKZ E;  1WCM H;  4APV A;  3PF5 A;  1BBU A;  1VS0 A;  2Z6K A;  2JJQ A;  4KI0 A;  3CCU A;  3KFU A;  1HJP A;  2MO0 A;  4JG2 A;  3CP0 A;  1A63 A;  1B70 B;  2Z6K C;  1HR0 Q;  4O2D A;  1G29 1;  1GO3 E;  2VL6 A;  3PV0 A;  4P72 A;  5IYD G;  4A3F H;  2ASB A;  4DR6 L;  3HOW G;  4BA2 I;  3L7Z C;  5ELO A;  5JEA J;  4QQB X;  1SLJ A;  1PVO A;  4P74 A;  3STB D;  3KJO A;  3GTJ H;  3RLN A;  4OWW B;  5IP7 H;  2R7Z G;  2B29 A;  1K0R A;  1P16 A;  2EXD A;  4A3C G;  2WB1 G;  2N49 A;  5LMN W;  3PIP A;  3KJP A;  4HJ8 A;  1KD1 C;  3CXC A;  2VUM H;  3G6E A;  1VQ7 A;  3HOU G;  2RHQ B;  4JI7 L;  1WYD A;  3A5Z B;  4DR7 L;  4IFD I;  1IYJ B;  4DAM A;  4R1J A;  1JT8 A;  4B3T L;  2MFI A;  4TQU S;  1VQ4 A;  3UDI A;  3OTO L;  3HOY H;  2BA1 A;  4JOI A;  4GKK Q;  2BH8 A;  1IXR A;  4DV6 L;  1NMG A;  5LMN L;  2A19 A;  5C44 G;  3E9I A;  2N3S A;  1XNR L;  2IX1 A;  4DR6 Q;  4DV5 Q;  4NB3 A;  3I4O A;  1PV4 A;  1PFS A;  1Y1V H;  1KQS A;  3J80 c;  3BZK A;  3F8T A;  3EBE A;  1NMF A;  4DV1 L;  2NZH A;  3U50 C;  1KIX A;  1EFW A;  3F2C A;  2K50 A;  1PH6 A;  4B3T Q;  4LF8 Q;  1XMO Q;  1S3O A;  4ALP A;  2WB1 E;  1Q86 C;  1Q82 C;  4B3S Q;  1UE7 A;  4QIW E;  4JI1 Q;  5FJ8 H;  1PH2 A;  2ES2 A;  2MNA A;  4X6A H;  1QUQ A;  2MO1 A;  4AYB G;  4WJ4 A;  4DV6 Q;  1OXV A;  3W1B A;  2E2H H;  3PO3 H;  1YJN A;  4LFB L;  3PIO A;  2UXB L;  4L5Q A;  4LUV A;  1Q12 A;  5IWA Q;  1CSP A;  3T1Y L;  1CKO A;  4R4Q A;  5C0X I;  2NN6 I;  3CME A;  5LMU Q;  1N34 Q;  3B6Y A;  1HNZ Q;  3UDX A;  4DR5 Q;  2BH2 A;  4IPH A;  5LMN Q;  2WAQ E;  1BVS A;  2EQS A;  1S40 A;  1KC8 C;  2JA5 G;  3MEF A;  1BBW A;  4DV4 Q;  2HHH L;  4IJH A;  4XIG S;  2K4K A;  3S1M H;  5M5W H;  4JI6 Q;  2VQE L;  2NVQ H;  4A3B G;  3DLL A;  1JE5 A;  2ID0 A;  4OWT B;  3I55 A;  3GTO H;  2K52 A;  3PUZ A;  4NXN L;  4YWK A;  3S17 H;  2OQ0 A;  4A3G H;  1CKN A;  1V9P A;  2I5L X;  4A3L H;  5IYC G;  2VUM G;  5AJ3 L;  3S1R H;  4L5T A;  3TEH B;  2V1C C;  4AYB E;  3CPW A;  1JJG A;  3CCJ A;  2WP8 J;  1NBW A;  1SRO A;  4A3C H;  4OO1 G;  1XPR A;  4EQ5 A;  4BBS H;  1O7I A;  2N8N A;  3CF5 A;  1VQN A;  3CMA A;  2BA0 A;  3PUY A;  5FLX c;  3AFQ A;  4DR1 L;  4JBW A;  3HOW H;  1YJ9 A;  4PMW A;  5C4X G;  2JA6 G;  2RCN A;  1HNZ L;  1Z9F A;  3OW2 A;  4LF7 L;  2LSS A;  4X65 Q;  4NXN Q;  4DR3 Q;  3KLW A;  1SRU A;  4UY8 C;  4DV7 L;  4KHP Q;  1X55 A;  1EQQ A;  5GAG C;  3GD7 A;  4UP8 A;  4LNQ A;  4BBS G;  4PZ7 A;  1I5F A;  2R7D A;  2B3G A;  1HZC A;  5M5X H;  1E22 A;  1DGS A;  3I2Z A;  1GD7 A;  1EIF A;  2YV5 A;  2K5H A;  1QZH A;  2NVX H;  4PZ8 A;  1YEZ A;  3TRE A;  2YYZ A;  1W3S A;  1JJ2 A;  1Q1E A;  5IT9 c;  2JA6 H;  4YCW A;  1IBK Q;  2HIX A;  2AMC B;  1FL0 A;  1Q46 A;  5FLM G;  3L2P A;  2Q2U A;  3CPF A;  5IY0 A;  4YHH L;  4JI4 L;  4LF7 Q;  4QGU A;  3I4M H;  2UUB L;  3TRZ A;  3HOZ H;  4LF6 L;  2K5N A;  3GDE A;  3S1N H;  4X66 L;  1SR3 A;  3K8A A;  3M4O H;  3H3V I;  2KEN A;  1V43 A;  1PH8 A;  3I7F A;  3PF4 A;  4HIM A;  1X56 A;  4LF8 L;  5EAY A;  1EYG A;  4DV2 L;  1IL2 A;  3CQZ H;  4DUY Q;  4JI3 L;  4YWL A;  3J81 c;  4DV5 L;  2E2J H;  2R6G A;  3ZJY C;  1XJV A;  1QVG A;  3CCV A;  3OYY A;  4YHH Q;  5IYC H;  1HNW L;  2K75 A;  5C4J H;  3TQY A;  1IBM Q;  2NVY H;  1YZ6 A;  4LFA L;  3FKI H;  1QZG A;  2E5L L;  4JI1 L;  1E7Z A;  1K73 C;  4K0K L;  1AE3 A;  4JI4 Q;  4FDB A;  1D8L A;  3L0O A;  2NZO A;  1YJW A;  4A76 A;  1S72 A;  2JA5 H;  4A3M H;  3G48 A;  4GKJ Q;  2ZJQ A;  4R4T A;  4GN3 B;  4LF4 L;  2EIF A;  3KYH C;  1AH9 A;  1NE3 A;  1NY4 A;  5E7N A;  5K36 G;  1X9N A;  4H02 A;  1K9M C;  1HZA A;  2JK8 A;  2OTL A;  2F4V L;  2FXQ A;  5C3E G;  4DR4 Q;  1IBM L;  3FKI G;  1MIU A;  3J80 i;  3PO3 G;  4DV0 Q;  4B3M Q;  3CCQ A;  2R92 H;  4BXX H;  3I56 A;  4HIO A;  4NXM Q;  4JI3 Q;  1GVP A;  5FJ8 G;  4OO1 I;  3DM3 A;  2GN5 A;  3ER0 A;  2ALY B;  1PH7 A;  5BR8 Q;  1E1O A;  3J7Z C;  3CCE A;  2K5V A;  2ZJP A;  1VQA A;  1Y1V G;  4O0A A;  3SGI A;  1VQJ A;  4EX5 A;  1LUZ A;  4C3J H;  4YY3 L;  5FLM H;  4JCV E;  2F52 A;  2JEB I;  4AH6 A;  1KL9 A;  1L2F A;  3TS0 A;  1PH5 A;  1EIY B;  3H3V H;  4QJF A;  2HT1 A;  2QGQ A;  4JI2 L;  2PMZ E;  2I0Q A;  1OXT A;  2VQF Q;  1EWI A;  3KF6 A;  1XPO A;  4GOP B;  1I94 L;  1L1O C;  4LW1 A;  1K3R A;  1FJG Q;  2UXD L;  1GKH A;  2CCZ A;  4LF5 L;  4LF9 Q;  4DR4 L;  2JA9 A;  4OWX B;  3D31 A;  4Y7N H;  1J6Q A;  1HNX Q;  2CWA A;  2UXB Q;  1I3Q H;  4KHP L;  4BY7 H;  3F2D A;  5IWA L;  3RZD H;  1XNQ Q;  2KHJ A;  2LXK A;  3HKZ G;  2CFM A;  1CKM A;  4RG1 A;  4DV3 L;  1UE5 A;  1HZB A;  1LYL A;  1OXX K;  3A74 A;  4C3H H;  3M7N A;  1WOC A;  4IPC A;  1B8A A;  2PI2 A;  3PUW A;  5BR8 L; 
#chains in the Genus database with same CATH topology
 1MGS A;  2UXC Q;  2E74 C;  4X62 L;  4B3R Q;  1LTL A;  5IGF A;  4Y52 H;  3FMC A;  4Q0F A;  4L5S A;  1LTA D;  4AQY L;  1ASZ A;  1RKN A;  4J15 A;  5CV4 A;  3PSI A;  4UP7 A;  4A3D B;  2IHE A;  3F1Z A;  4CDF C;  4GOP A;  2RBM A;  4OO1 H;  2B2T C;  1JR0 D;  3QIA A;  1VQF A;  4M8A A;  1EY8 A;  2SNM A;  2F3I A;  1XTC D;  2JEA I;  5NUC A;  5DM7 3;  4JI8 L;  1X65 A;  3DUZ A;  1WTO A;  1RD9 D;  1Q3L A;  2B2U C;  1QVF A;  1WJJ A;  2VW9 A;  1FNV A;  1Q7Y C;  2QF7 A;  1SYF A;  3GTK H;  3GTM B;  4GKK L;  1F9Q A;  4BXX G;  4POF A;  3TP7 A;  3X3N A;  5IE8 A;  3AEV A;  2PQA A;  1I6H H;  5CBA E;  2L55 A;  1Z6H A;  1JQY D;  3H15 A;  1J5E Q;  1YNX A;  2JA7 B;  2F0M A;  4ZK9 B;  2XN9 C;  1SJH D;  3A8K E;  3TSS A;  3GTL B;  4TKO B;  5I6W A;  3H3V C;  1Q8K A;  3MXN B;  3D4R A;  4P73 A;  2EY5 A;  2ZTE A;  2M00 A;  3GTK B;  1RIP A;  4DUY L;  2M9V A;  4X66 Q;  3W2D A;  5JVG 3;  1KDB A;  4OIJ A;  1RHP A;  2IL8 A;  1I6H B;  1VQI A;  2PO4 A;  3I70 A;  3G71 A;  1PFN A;  2EYM A;  1TU2 B;  1TWF B;  2EYP A;  4KN7 C;  1EYC A;  1KXL A;  5IP7 G;  1VQM A;  1PZK D;  1I4H A;  1X3E A;  1PXU A;  2EY1 A;  2F0T A;  2EJG C;  1HZ9 A;  1SE4 A;  1YNN D;  1KTK A;  3BZC A;  4X62 Q;  3WOE A;  2L1B A;  1H95 A;  4LJZ C;  4A3K H;  4DXF A;  5D65 A;  4IQZ A;  5CV6 A;  1VQP A;  1H9S B;  5FK9 C;  5IGC A;  5FO8 B;  1IBK L;  5A2Q L;  1S5D D;  1WVL A;  1R9T H;  4XYQ A;  2EY6 A;  2JYO A;  2F0K A;  2HDM A;  3MHB A;  3NSW A;  4YWM A;  5IYB G;  1EEI D;  4C3I H;  4IPD A;  1Y1W B;  2NWG A;  2UUA L;  3S16 H;  3K57 A;  2ICE C;  1CSQ A;  1HR0 W;  3HS0 C;  2MUY A;  2XNA C;  1AW7 A;  1EQT A;  3KLS A;  4H44 C;  4ZUJ A;  3L3O C;  4A3G B;  1IHZ A;  1X3G A;  2VS1 A;  4C1N I;  3HKS A;  4GN4 B;  1O78 A;  5DLQ E;  5AJ3 Q;  2NTT A;  1MHW C;  3KBG A;  3J81 j;  1VQB A;  3RUZ A;  1CUK A;  2BCO A;  1FYC A;  3BVZ A;  3RR5 A;  4RA8 A;  2E5L Q;  2QEX A;  2VB2 X;  2N88 A;  4HIK A;  5JAV A;  4GLA C;  1CZG A;  3A5U A;  4DV7 Q;  1PRT F;  1PRT D;  2MP1 A;  2EJM A;  1A0I A;  4K5X A;  4HJ9 A;  4KMU C;  1TWC B;  1D5X C;  5JJK A;  5JEA H;  1LV9 A;  4DR2 Q;  2JA8 G;  4BY1 B;  2Y0S G;  5C44 H;  3NWS A;  2R93 G;  3E5S A;  4YCU A;  4DK3 C;  1E2Z A;  1BF4 A;  4A3E H;  3NXW A;  2OTJ A;  4C3J B;  3K58 A;  3J80 E;  2JQO A;  3K5N A;  1G6P A;  5COY A;  4GNX B;  1DJR D;  2AQ2 B;  1TWC H;  1VQ5 A;  1TKW B;  1HTP A;  3TME A;  3K6O A;  4ZRZ A;  3SK6 A;  1EIG A;  4P75 A;  1PRT C;  2D0P A;  2ZTD A;  4A3E G;  4POG A;  2OQK A;  3NEL A;  4IOC A;  3NTI A;  1JOQ A;  1PH4 A;  2Q8R E;  1VF7 A;  5EPJ A;  2NVT H;  1Y69 U;  4A93 G;  1PTO H;  1CHQ D;  4XYO A;  2OCE A;  3S24 A;  4LF4 Q;  1B9M A;  1HCZ A;  1IBL Q;  4J6H A;  1YIJ A;  1H9J A;  3D0F A;  1Y8P B;  4GZY C;  1HXY D;  4GNX A;  1BKB A;  1ZEQ X;  2K7V A;  4RGM A;  4CJ2 C;  3QJY A;  4BBR G;  2L15 A;  2NVT B;  2KCN A;  1B4O A;  4X64 Q;  1STB A;  3PGZ A;  5DEH A;  1I4P A;  1TS4 A;  5IGG A;  1SYG A;  1VQC A;  2NZ1 D;  3ULP A;  2WFW A;  3PCO B;  1HNW Q;  2H1E A;  3A7L A;  3RZD B;  2IT1 A;  5T1G A;  3CC4 A;  4RH6 A;  1WTV A;  5CGK A;  5HY6 A;  3HKZ E;  1VS0 A;  3K59 A;  4HAE A;  1IYU A;  3A55 A;  4CDC C;  1B70 B;  3PV0 A;  2H4O A;  4P72 A;  2K5W A;  1I4Q A;  5ELO A;  4ZCK A;  4N9T A;  4P74 A;  4DA2 A;  5FO9 B;  2QW7 A;  3BVG A;  2WB1 G;  4H0L C;  2AUK A;  2VB3 X;  3PIP A;  3S1Q B;  1KD1 C;  5EBD A;  3CXC A;  3G6E A;  2D5D A;  4R1J A;  1HQR D;  2MFI A;  4YIJ A;  3PO3 B;  3O13 A;  3HRZ C;  4GKK Q;  1DOL A;  3GTQ B;  2LY7 A;  4DV6 L;  5LMN L;  5C44 G;  3SK5 A;  4DNR B;  2O2L D;  1XNR L;  2IX1 A;  2QCP X;  1U4R A;  1PFS A;  3T53 B;  3BZK A;  2NVQ B;  4LF8 Q;  1XWE A;  1S3O A;  2R7Z B;  1LLR D;  2ES2 A;  1EIH A;  1KNE A;  4PMB A;  1QUQ A;  5CV7 A;  3MXU A;  2E2H H;  3PO3 H;  1RTO A;  4MHE A;  1YJN A;  3T1Y L;  5K36 H;  5C0X I;  5LMU Q;  1HNZ Q;  2BH2 A;  4IPH A;  5LMN Q;  2WAQ E;  1BVS A;  2FMC A;  3TP5 A;  1KC8 C;  2JA5 G;  3BYT B;  1Y1V B;  2KHS A;  2WKD A;  2HHH L;  3OOC A;  1JE5 A;  2ID0 A;  3M7G A;  1QOH A;  1KLG D;  2L0C A;  1G8Z D;  3I55 A;  5JVH 3;  4X3S A;  1AFP A;  1CKN A;  2VXW A;  2VUM G;  3ONA B;  1STE A;  1WD0 A;  3CPW A;  3CCJ A;  1U4P A;  2WP8 J;  1SAP A;  1O7I A;  4ME5 A;  3H6M A;  1JWU D;  4G57 A;  1KDC A;  1SDF A;  2PW7 A;  4JBW A;  3HOW H;  2JA6 G;  1HNZ L;  3OW2 A;  2LSS A;  3S1N B;  3KLW A;  1SRU A;  2RQX A;  5FLX L;  2Z4I A;  4KHP Q;  1EQQ A;  5GAG C;  4LNQ A;  4KHV A;  2R7D A;  4HCS A;  3C46 A;  1QZH A;  1GUW A;  4PZ8 A;  5TSS A;  1LAB A;  2YYZ A;  2BDN A;  3NHH A;  1HRJ A;  1FL0 A;  1Q46 A;  3KLS X;  3CPF A;  2F0I A;  1G91 A;  1LTB D;  2A69 C;  5J1Z A;  1WD1 A;  4X66 L;  5M9O A;  3BYY B;  3K8A A;  3M4O H;  1V43 A;  1PH8 A;  2KOL A;  3NK9 A;  3PF4 A;  4HED A;  4DV2 L;  1FD7 D;  1NUC A;  3NE5 B;  1W6J A;  3CQZ H;  3HGB A;  2EY2 A;  4JI3 L;  4YHH Q;  5IYC H;  1IBM Q;  3I4M B;  1QZG A;  3FRP B;  2E5L L;  1E7Z A;  1M4V A;  3HOZ B;  1PDQ A;  4RGO S;  1AE3 A;  4A76 A;  2JA5 H;  1Y8N B;  4A3M H;  4FYD A;  1FNW A;  1NE3 A;  2JK8 A;  1UAP A;  2V4D A;  2F4V L;  1BQQ T;  3VR2 A;  1F9P A;  4B3M Q;  4BXX H;  4NXM Q;  5FLX E;  2NVY B;  4JI3 Q;  2F0U A;  3DM3 A;  1V1P B;  2NBF A;  2Z6B A;  3Q23 A;  2ALY B;  1KAA A;  3FVQ A;  1TWH B;  1VQA A;  1Y1V G;  1VQJ A;  5FLM H;  2CHB D;  3QOJ A;  1KL9 A;  4R8N A;  1PZI D;  2HT1 A;  2PMZ E;  1OXT A;  2VQF Q;  1EWI A;  1I94 L;  4CKB A;  2QEJ C;  1I4G A;  1FJG Q;  5EKK A;  2CCZ A;  4IUT A;  4K8J A;  1K0S A;  5HGT A;  1HNX Q;  4KHP L;  3F2D A;  3HOX B;  1SNP A;  2KHJ A;  2LXK A;  4QB4 A;  4U68 A;  4RG1 A;  1OXX K;  2F0P A;  2PI2 A;  3PUW A;  2G9D A;  3K7A H;  5I2Y A;  1VQO A;  2Q8T A;  1B53 A;  1VQG A;  4KKS A;  2ZXR A;  5FO7 B;  3GTM H;  1G6Z A;  4X3T A;  2VQF L;  1I94 Q;  2KCT A;  4FXG C;  4OEM B;  3OHX C;  1BDO A;  3BG3 A;  2P5Z X;  1VQK A;  3U9S A;  4QUF A;  3LGJ A;  1JB7 A;  1QWY A;  5C4X H;  1E0B A;  1CI3 M;  3GTL H;  4BBR H;  2RCF A;  2L12 A;  2ZM6 L;  1VQ9 A;  2TSS A;  2JSO A;  5LL6 S;  3HFZ B;  1KDA A;  3NUC A;  2EPB A;  3MAQ A;  1VQD A;  4C2M H;  2LXJ A;  2BE5 C;  4GOP C;  2B2W A;  1C9O A;  5C0X G;  4UHV A;  4GLV B;  5CBE E;  1BNZ A;  3S2H H;  2EXZ A;  2K03 A;  1IL8 A;  4B3S L;  2DY8 A;  1QB5 D;  1X3Q A;  1D5Z C;  1AN8 A;  1EY0 A;  2EVB A;  2F0S A;  1UE6 A;  3R93 A;  4WFN 3;  5GAE C;  4JPB W;  5JJI A;  4YCV A;  2AHO B;  1A8V A;  1KIX A;  2D62 A;  2FMM A;  3M3Y H;  2O5J C;  4RKB A;  4ZUI A;  3S1Q H;  1ZYR C;  3A0J A;  2JA7 H;  1VQE A;  2RDG A;  1L1O A;  1YHB A;  2A6H C;  3HG9 A;  4I7A A;  3U58 A;  1VMP A;  4KJO A;  2EYH A;  3A8I E;  4DR2 L;  4GKJ L;  2TMP A;  3HOZ G;  3EJI A;  4R9W A;  3ERS X;  4FO2 A;  4LUZ A;  4UP9 A;  2AWN A;  3ULL A;  3K80 C;  1N9W A;  3IRB A;  1DON A;  5HGQ A;  3KLR A;  4A3J H;  2R7Z H;  3L9A X;  4X65 L;  3HOU B;  2K28 A;  1SMY C;  1WFQ A;  2YU9 H;  3K5M A;  2E2H B;  4WRD A;  2SDF A;  5C5L A;  2WIN B;  5J3B A;  1SMY D;  5M3M G;  3J7Y W;  1B9N A;  2KQ3 A;  1EL0 A;  1N33 L;  4L5R C;  1BXT A;  4QF4 A;  2UUC L;  2O4X A;  3TZD A;  1FGU A;  3RZO B;  2HQE A;  1Y14 B;  2BE5 D;  3HOX G;  3URY A;  5M3M H;  4UDU C;  3JAM c;  4KY6 A;  1Z47 A;  4MIU A;  3I4L A;  1I6V C;  3K0X A;  1CT1 D;  1QUQ B;  1VQ8 A;  2YTX A;  1D1I A;  1TY2 A;  4B3R L;  4OX9 L;  1UWV A;  4K0K Q;  1T5X D;  4BY1 H;  1TWG H;  1BCP C;  3FKI B;  3UDG A;  5IP9 H;  3CKI B;  3OW7 A;  2B63 H;  1QVC A;  3QB3 A;  3SK4 A;  4RGT A;  2F3V A;  2X6L A;  2LMC B;  1QNK A;  1AEX A;  3T51 B;  4HJ5 A;  1O7L A;  1UE1 A;  4IJL A;  2JA6 B;  3GV3 A;  1II3 A;  3MEH A;  1LM0 A;  1JCK B;  3MFY A;  1HR0 L;  1I50 H;  4OX9 Q;  2N78 A;  1PHJ A;  4IO9 A;  3C2P A;  3HOV H;  4R4I A;  3ICE A;  3OWE B;  3NQI A;  4LFC L;  3T1H Q;  1SN8 A;  1YHA A;  1ZXT A;  1GHK A;  3GTP H;  4IAL A;  4C3J G;  2EYJ A;  1E24 A;  1K8A C;  4RHS A;  2GA4 B;  1CZW A;  3MTS A;  4ID6 A;  5LHY 1;  2Z0S A;  2KJX A;  1P8L A;  3Q8D A;  5C0X H;  2RHS B;  3P7J A;  4H13 C;  2F0H A;  5C3W A;  5IGD A;  2HIV A;  3VDY A;  2K14 A;  2JXM B;  3IFT A;  4AQY Q;  2E76 C;  1KRT A;  1C7Y A;  1WCM G;  2ZTC A;  5LL6 X;  4A3M G;  2ZXP A;  4DN4 M;  5IIF A;  4Q5V A;  5CV9 A;  4DR1 Q;  1SYB A;  1S5E D;  4QIW B;  2WII B;  3H94 A;  2MQH A;  1K8O A;  3K7U C;  1HPC A;  1B3A A;  3NBH B;  4M1U B;  1YI2 A;  4IOA A;  4OEL B;  1WTR A;  3GTG H;  5JPN C;  5CYU A;  2WAQ B;  5BN3 A;  5IP9 G;  4N9P A;  3UE0 A;  2VNU D;  4JOI C;  4L63 B;  1EUJ A;  4JYA Q;  3WWV A;  1DXM A;  3GO5 A;  3ITP A;  5EJW A;  3M4P A;  1XMQ L;  1FJG L;  5C0X J;  4XQJ A;  2F0E A;  2G9H D;  2HUG A;  4NDX A;  1SXT A;  3CC2 A;  2GVA A;  5CV5 A;  2HCC A;  4EQN A;  4JBM A;  1HQM C;  2PI2 E;  4A3K G;  3CD6 A;  4R4O A;  3HOX H;  2F3W A;  4QY7 A;  2JP1 A;  1M1K C;  1RDP D;  2FJ2 A;  3CW2 C;  3V96 A;  4HSV A;  2LFN A;  2B8G A;  2RA4 A;  4DAP A;  4DXG A;  1BBU A;  1LAC A;  1BR9 A;  4V0B A;  1HR0 Q;  4O2D A;  1GO3 E;  2ASB A;  3U9O A;  4BA2 I;  3L7Z C;  5IOD A;  3ND8 A;  1W6K A;  3OSO A;  4U67 3;  3GTJ H;  1F2Y A;  1TWA B;  3RMH A;  4OWW B;  2R7Z G;  1K0R A;  1P16 A;  3HZX A;  4HJ8 A;  4IZ8 A;  2LS0 1;  1F9R A;  4DR7 L;  4IFD I;  1WYD A;  3A5Z B;  1IYJ B;  1JT8 A;  4B3T L;  1HHV A;  5ELC A;  2XVS A;  3OTO L;  2KEC A;  2F1M A;  5EBC A;  3HOY H;  2K04 A;  3TDQ A;  2BH8 A;  2F0Q A;  2F0O A;  4CKC A;  5JOB A;  1TS5 A;  2N3S A;  3GP7 A;  4NB3 A;  4RGN A;  2A6E D;  1KQS A;  4K8I A;  3J80 c;  1NMF A;  4EQO A;  1UUP A;  3U50 C;  3F2C A;  1D5M C;  2VUM B;  2WB1 E;  4B3S Q;  1UE7 A;  1PH2 A;  3S2H B;  2MO1 A;  4AYB G;  1RJT A;  3ERQ A;  3BDL A;  1OXV A;  3NWT A;  4IUN A;  2EYO A;  4LUV A;  1CKO A;  2R61 A;  1N34 Q;  2MGS A;  1K28 A;  4ILW A;  4KN4 C;  4XT3 B;  4RFB A;  1BBW A;  4DV4 Q;  2K4K A;  3S1M H;  1S5F D;  5M5W H;  4JI6 Q;  4DK0 A;  4A3B G;  3DLL A;  1D6E C;  3PUZ A;  4NXN L;  5IT9 L;  4ZLT F;  3S17 H;  4A3G H;  1V9P A;  2I5L X;  5AJ3 L;  3S1R H;  4L5T A;  2NTS A;  3DHQ A;  4OO1 G;  1LO5 D;  1XPR A;  3DEP A;  1VQN A;  1PTO D;  3PMF A;  1BCP D;  3PUY A;  1BCP F;  1STG A;  1HTL D;  1TWG B;  4FNF A;  5C4X G;  1GUS A;  2F0V A;  1EOT A;  1Z9F A;  2AQ1 B;  5M5W B;  2B63 B;  4X65 Q;  1VMC A;  2B2U A;  3BZD B;  1F2M A;  4A3J B;  2PZW A;  2PNR C;  4DV7 L;  4UY8 C;  2ZT9 C;  2K33 A;  3JAM L;  3GD7 A;  4C1N K;  1I5F A;  2B3G A;  1HZC A;  3S1R B;  5CV8 A;  1E22 A;  4XXE A;  1GD7 A;  2YV5 A;  2XIW A;  1YEZ A;  3TRE A;  1A2U A;  1QG7 A;  1Q1E A;  5IT9 c;  4YCW A;  5DAU A;  3L2P A;  2Q2U A;  3D6C A;  2F0L A;  5KGU A;  4LF7 Q;  1ICW A;  4QGU A;  3KF8 A;  1EWC A;  5E4W C;  1CQV A;  2KEN A;  4K6D A;  4RCN A;  4DU9 A;  1HUN A;  4HIM A;  1X56 A;  1EYG A;  3HKZ B;  4YWL A;  3IFD A;  5C6A A;  3ZJY C;  5EPK A;  5A35 A;  2NVY H;  1YZ6 A;  1U4M A;  2MHV A;  5KND A;  3Q0A A;  5IGB A;  4F88 A;  1K8M A;  3E3X A;  4LF4 L;  4GN3 B;  3M4O B;  2EIF A;  2PZU A;  5E7N A;  1PTO B;  1X9N A;  2OTL A;  5ELB A;  3SHL A;  4DR4 Q;  3FKI G;  4DV0 Q;  3CCQ A;  5FJ8 G;  1F9S A;  1BOS A;  5EGT A;  1QCB D;  5A2Q E;  1PH7 A;  3J7Z C;  1E1O A;  1BBX C;  5FOB B;  1F77 A;  3TZU A;  4RHR A;  2JA5 B;  2ICI A;  1NR2 A;  1PH5 A;  2A68 D;  4QJF A;  5KEE A;  5E3F A;  4JI2 L;  2I0Q A;  3TBI B;  1XPO A;  1CTM A;  3FPP A;  1L1O C;  1K3R A;  2UXD L;  4RKL A;  1ENF A;  4DR4 L;  2JA9 A;  3D31 A;  4XQN A;  1VF5 C;  3VYS A;  4BY7 H;  3RZD H;  5I9P A;  5CMD A;  2CFM A;  1CKM A;  3HKZ G;  5C3X A;  4KD3 A;  5C5M A;  2DY7 A;  1B8A A;  2MJ8 A;  1PZJ D;  2VY3 A;  4LK1 C;  3I4M G;  3TN2 A;  2RVL A;  1ET6 A;  2F0N A;  3E0E A;  1SYC A;  3UDF A;  4OON A;  4DPG A;  4RCO A;  2A68 C;  4WJ3 M;  4N8X 1;  1MJE A;  3DM1 A;  2I5H A;  2ZXO A;  1JMC A;  2B2V C;  1Q81 C;  1EOV A;  4Y7N B;  2I46 A;  1PH9 A;  3GTG B;  1DCZ A;  3CC7 A;  1KHI A;  1QNU A;  1V1P A;  5M3F B;  4LFA Q;  1H9R A;  1X6O A;  3CRL C;  1D7Q A;  4RAU C;  1EYD A;  3HEJ A;  3PO2 B;  4A3B H;  1ESR A;  2R3Z A;  3OIP A;  1O80 A;  4IFD G;  1YBY A;  2K5Q A;  4GS3 A;  1N33 Q;  1NNX A;  5CC4 A;  3S2D B;  2ATW A;  1EQR A;  1AE2 A;  4N8F A;  5GRO A;  1EZ6 A;  1IYV A;  2AQ3 B;  4HMJ A;  4MTN A;  1CFM A;  2RF4 A;  3H0G G;  3AMU A;  4CGY B;  1AP0 A;  2I5M X;  1DZ1 A;  1ESF A;  4BA1 I;  2OF1 A;  3N52 A;  3F2B A;  1A15 A;  4IUU A;  2HHH Q;  1V1Q A;  4HTH A;  4MTK A;  4K2K A;  3EIV A;  3NPP A;  1TWA H;  1J5E L;  1Q1B A;  4P71 A;  4LF9 L;  5GQO A;  3S1M B;  2VZA A;  1W2B A;  1A2T A;  3AB9 A;  4JI2 Q;  4B9W A;  1SFO H;  4DK6 C;  1C48 A;  3TS2 A;  1NAP A;  4DV3 Q;  4RMF A;  1MJC A;  4DGZ A;  4BS9 A;  2YU9 B;  4JI7 Q;  3EN2 A;  3HOY B;  3DWA A;  4BBS B;  3GTQ H;  4JYA L;  2XWB B;  3JC6 6;  2E2I B;  2C35 B;  4NPS A;  1XMQ Q;  2A1A A;  1FNU A;  2F4V Q;  1GXD C;  2K6A A;  4A3F G;  3BVM A;  3G4S A;  4HJA A;  4E6I A;  4NXM L;  3S14 B;  3RZO H;  5DNF A;  2UU9 L;  3Q22 A;  4ODG A;  3J81 i;  2Q2H A;  3U4V A;  2DNE A;  1PFM A;  4TRD A;  4FF1 A;  4Z9C B;  3MXN A;  1PH3 A;  2KBN A;  1TWF H;  3UI2 A;  4JBJ A;  1SYD A;  5L37 A;  4FF3 A;  1C0A A;  3RD4 A;  2PQA B;  2IX3 A;  1B44 D;  3SXH A;  1U0L A;  3V2T A;  4DUZ Q;  2XGT A;  4CDE C;  4GNX C;  4OGQ C;  4C3I G;  3M4Y A;  2CQO A;  2JN4 A;  2CVR A;  2AKW B;  1HNX L;  4C56 C;  4DV2 Q;  1E3P A;  1B7Y B;  3AFP A;  3T13 A;  1HA6 A;  4K6L A;  4BY1 G;  4K14 A;  5M5Y B;  1YNJ D;  4LUO A;  1TS2 A;  3KBX A;  5EKL A;  4B08 A;  1L0W A;  1JJC B;  1STN A;  2E75 C;  3NEN A;  1L0Y B;  4A3D G;  4KLK A;  3GV6 A;  2I07 B;  1GOZ A;  1ZKO A;  1N32 L;  1Y1W H;  4JV5 L;  3RN5 A;  2C9O A;  2H5X A;  3PUX A;  1PH1 A;  3QR8 A;  4PMC A;  5ELN A;  1IZ6 A;  4BWG B;  5M5Y H;  4UAI A;  1WI5 A;  1S5C D;  1A62 A;  3AU7 A;  1Q90 A;  4HJ7 A;  3E9H A;  2Q2T A;  2DUD A;  2R92 B;  4AIM A;  3M9B A;  3BDC A;  4DAY B;  5ISR A;  5T1I A;  1ASY A;  1XMO L;  1STY A;  1YNJ C;  2E8G A;  3HOV G;  4NMZ A;  4A3J G;  1NTG A;  1PMR A;  2R7F A;  3M85 A;  2M2L A;  1NCV A;  1SBB B;  1N36 Q;  1AZP A;  2A8V A;  1OXS C;  1EY6 A;  4LF6 Q;  4JI6 L;  1K83 H;  2IW3 A;  1UEB A;  5K5P A;  3H0G H;  4QL5 A;  2PCF B;  3K5O A;  3ZYY X;  1N8R C;  1E2V A;  1HUM A;  3I3C A;  3V05 A;  3J81 L;  2SEB D;  5C3E H;  4C3H B;  4A3I H;  5KNC A;  4A3M B;  1L1O B;  2CWP A;  1G51 A;  2QDL A;  2IJ0 A;  1X3P A;  2B63 G;  3PIP 3;  2DJF C;  2JA8 H;  1TT2 A;  3KF8 B;  2G5D A;  1U5K A;  3T16 A;  4DUZ L;  3VA7 A;  1G2T A;  4KTA A;  2D0O A;  4JVZ A;  1JIC A;  1C8C A;  1HA5 A;  2K32 A;  4PG3 A;  1GUT A;  2CW0 C;  4CKE A;  1GUO A;  2WAC A;  5M3F H;  1G2S A;  1KRS A;  3PO2 H;  1MBY A;  3NTH A;  4A75 A;  3DWQ A;  3J7A 5;  3E0J A;  1XPU A;  1IBL L;  2UXD Q;  1PFB A;  2RSO A;  2A5H A;  1N32 Q;  2PQE A;  4JV5 Q;  4A4I A;  3S2D H;  1VQ6 A;  1TXY A;  3I4N G;  4KHZ A;  1F2Z A;  2A73 B;  1T9H A;  2KEE A;  4C2M B;  3JAM i;  3D4D A;  3EFX D;  2NB0 A;  4NW2 A;  4BY7 G;  2ENB A;  1X54 A;  2CH4 W;  2DGY A;  2DNC A;  4APV A;  1TQO A;  2JJQ A;  2IWH A;  2Z4H A;  4CJ0 B;  3CCU A;  3KFU A;  2CW0 D;  3G7L A;  1SSO A;  1G29 1;  2VL6 A;  4J1M A;  5IYD G;  4DR6 L;  2CH4 A;  5JEA J;  3STB D;  3RLN A;  2B29 A;  4C3H G;  3M3Y B;  2EXD A;  1UEA B;  2N49 A;  3R2T A;  5LMN W;  3P75 A;  1VQ7 A;  2RHQ B;  3HOU G;  4DAM A;  1WTH A;  4EVO A;  3UDI A;  4JOI A;  1R4Q B;  3FEW X;  4KY5 A;  2WV6 D;  4OHJ A;  1NMG A;  3E9I A;  3OPO A;  3I73 A;  1H9M A;  4DR6 Q;  1LT3 D;  3D4W A;  1PV4 A;  1ILP A;  3OMG A;  1Y1V H;  1CHP D;  4HMI A;  4L6T B;  3VR6 A;  1K3B C;  1EFW A;  1PH6 A;  1Q86 C;  1Q82 C;  4JI1 Q;  2MNA A;  4X6A H;  1SNQ A;  1TVX A;  4WJ4 A;  2B2Y C;  4DV6 Q;  3SR1 A;  3W1B A;  1IKM A;  4PQX A;  1V8Q A;  2UXB L;  3P1H A;  1CSP A;  5IWA Q;  3EA6 A;  3B6Y A;  4DR5 Q;  5I2X A;  2EQS A;  1S40 A;  3MEF A;  1GJX A;  2PPB C;  2B2Y A;  4IJH A;  3S16 B;  5D3I B;  2VQE L;  2XWJ B;  3DEO A;  3GTO H;  3TP8 A;  3MVV A;  2K52 A;  4YWK A;  5E4X A;  2PYK A;  5M5X B;  5IYC G;  2V1C C;  4AYB E;  5KRU A;  5DM6 3;  1NBW A;  1C4Q A;  4A3C H;  2NVX B;  4EQ5 A;  5COR A;  3GQB A;  3CMA A;  1A3V A;  1GUG A;  5FLX c;  4TSS A;  4DR1 L;  1WTP A;  3NTK A;  2RCN A;  4A3K B;  3GTO B;  1JC7 A;  4BBS G;  5ELD A;  2F0W A;  5M5X H;  1VDZ A;  1IW7 C;  3LX0 A;  1DGS A;  4O42 A;  3WOF A;  3OIQ A;  2NVX H;  4CDD C;  1W3S A;  3I8Z A;  1JJ2 A;  2JA6 H;  2EOT A;  1IBK Q;  1PYW D;  1LT5 D;  1RF2 D;  5FLM G;  3I4M H;  4YHH L;  1I50 B;  4JI4 L;  2EYL A;  1F2L A;  2NYZ D;  2QKI C;  3HOW B;  3TRZ A;  2A6E C;  4XQQ A;  3VYT A;  1IKL A;  3S1N H;  2OXP A;  3FDT A;  5JPM C;  3H3V I;  3PIO 3;  1K83 B;  3D8G A;  1T5E A;  2RSN A;  2K1B A;  4DF7 A;  2OEO A;  4DFA A;  1LTR D;  1IL2 A;  4DUY Q;  2E2J H;  2R6G A;  1XJV A;  1Z7T A;  3LNN A;  3R3O A;  5G3L F;  3OYY A;  2WKC A;  2B8F A;  2K75 A;  3KK7 A;  1JB3 A;  4LFA L;  4JI1 L;  4XT1 B;  1MI2 A;  4JI4 Q;  2A74 C;  4FDB A;  1ET9 A;  2NZO A;  1S72 A;  2O5I C;  2EYF A;  3KYH C;  5K36 G;  2JA8 B;  1K9M C;  1HZA A;  2EE1 A;  2RDF A;  3CQZ B;  5KNB A;  1IBM L;  1MIU A;  3J80 i;  4R8I A;  3PO3 G;  2R92 H;  1FGB D;  3I56 A;  1UNS A;  1GVP A;  1SJE D;  5C44 B;  4KJN A;  3ERO A;  3SDZ A;  1S4Z A;  5BR8 Q;  2K5V A;  4G4K A;  1MSG A;  2ZJP A;  1CK1 A;  3SGI A;  1LUZ A;  3ND9 A;  4C3J H;  4YY3 L;  2F52 A;  2JEB I;  4AH6 A;  1L2F A;  3K7A B;  3TS0 A;  1O7Y A;  1D1K A;  1EIY B;  2J0T D;  3H3V H;  4O1N A;  2QGQ A;  2NN6 H;  1DYQ A;  4GOP B;  4LW1 A;  4LF9 Q;  2F4I A;  1YNN C;  3NBH A;  3NBI A;  3TP6 A;  3P20 A;  5KYI A;  4Y7N H;  1J6Q A;  2CWA A;  3N6R A;  4K5W A;  4DV3 L;  1UE5 A;  2QDB A;  4C3H H;  1M8A A;  1X32 A;  2FFK B;  1WOC A;  5C4X B;  5BR8 L;  4DV4 L;  4XDX A;  4LWC A;  1EY5 A;  3AYH B;  4TVA B;  2PMZ B;  5EPL A;  4YY3 Q;  4PNY A;  5IYD H;  2OWO A;  2ZM6 Q;  5C4H A;  4I7Z C;  1LTT D;  1M90 C;  4K2L A;  4OXP A;  4ME3 A;  4QUC A;  1XX8 A;  3D6W A;  2CQA A;  2HD3 A;  3NQT A;  1SYE A;  4ABN A;  3UE1 A;  2DJG C;  4DR7 Q;  5IT9 E;  1HH2 P;  1TII D;  1H9S A;  1PRT B;  3QO2 A;  3OTO Q;  3EQL C;  2OT2 A;  3PO2 G;  3BU2 A;  4LAA A;  4PV1 C;  1EU4 A;  2F03 A;  4OL7 A;  3LWE A;  3W5O A;  1E2W A;  1ICF B;  1SE3 A;  4DAY A;  2XRQ D;  2N55 A;  2X6G A;  3RLO A;  3CCR A;  4DR3 L;  1K8G A;  2YTY A;  4UPA A;  4RWS C;  1YIT A;  4MNO A;  2B2V A;  2F0J A;  2EJF C;  3PQI A;  4FF4 A;  3F2U A;  5F2D A;  3W1G A;  5J39 A;  2GVB A;  1VQH A;  2L11 A;  4V19 0;  1PA6 A;  4R4C A;  5JJZ A;  3FP9 A;  1B3Q A;  2FHT A;  4A3B B;  4BBR B;  1FR3 A;  1NJI C;  1TR5 A;  1PTO C;  1N34 L;  1GUN A;  4A3F B;  3WDN A;  5KIX A;  3DWP A;  2UUB Q;  4LFB Q;  3CCL A;  1PYB A;  1SE2 A;  2F0G A;  1JOK A;  4F7X A;  1B50 A;  4IFD J;  4DKA C;  4HCE A;  3CCM A;  2XTI A;  4A3I G;  1YVC A;  2HDL A;  3STB C;  3BS1 A;  3OWF A;  4J8Q A;  2WB1 B;  3S14 H;  3CU7 A;  1STH A;  3Q6S A;  3I91 A;  4L8J A;  3HOU H;  5D14 A;  3S17 B;  4HID A;  2JA7 G;  3M4Q A;  2HQL A;  4G7O C;  1XTD A;  2XRS D;  3HOY G;  4XTC S;  5BN5 A;  1S5B D;  4HN7 A;  1N36 L;  4C3I B;  2JE6 I;  1ROD A;  3BDO A;  1XNR Q;  5D3D A;  1STA A;  4X64 L;  2PNH A;  1RL2 A;  2X69 A;  2UUC Q;  2R93 H;  4HR7 B;  1L0X B;  4QCL A;  2AWO A;  1SFO B;  3I4N H;  4KKU A;  1PYS B;  1FVI A;  1SNC A;  1BO0 A;  4OIK A;  5JEA G;  3QG1 A;  3K81 C;  1SMX A;  2EZV A;  1ONL A;  1V1O A;  1EEF D;  2IY5 B;  1ZYR D;  4IUV A;  1XXG A;  4IUQ A;  2E2I H;  2ZJR A;  4JI5 Q;  3IKJ A;  3KDF A;  1CKN B;  4FP5 D;  3T1Y Q;  2VQE Q;  1KAW A;  5LMU L;  5ELF A;  4GLX A;  2WAQ G;  1SE8 A;  3H09 A;  3NP8 A;  1Y1W G;  4A3L G;  4CBV A;  4IPG A;  1J9O A;  1Q8I A;  4A3G G;  1ENC A;  3AQQ A;  5CR3 A;  3I72 A;  4FVM A;  3CAM A;  4G7H C;  1R4P B;  4JC0 A;  5M3F G;  3C1E A;  3C1F A;  4F8M A;  3EVQ A;  3A8J E;  2KUM A;  2Y0S E;  2DN8 A;  3FHW A;  4H7B A;  5EKI A;  1U4L A;  2PW5 A;  4ZKC B;  5IYB H;  3A54 A;  3KF6 B;  4KD4 A;  3KOJ A;  4JI5 L;  4DNT B;  4A93 H;  1TS3 A;  1EY4 A;  1U9R A;  4PZ6 A;  2K5D A;  5M3M B;  1A6X A;  3S9W A;  3GTP B;  2RDH A;  2B2T A;  4DV0 L;  1QIL A;  4X3U A;  1JOR A;  3RN2 A;  1SEB D;  1RTN A;  4EQP A;  3H0G B;  4FF2 A;  2MPM A;  5IGE A;  3D3R A;  1OTC A;  1VCI A;  4GN5 A;  4JI8 Q;  2NN6 G;  2KED A;  4MZ9 A;  2K01 A;  1EY7 A;  1TWH H;  4A3I B;  2YTV A;  3R2I A;  1LT6 D;  3CHB D;  2Z9H A;  3OMC A;  4QMG A;  1B2T A;  2KHI A;  3I90 A;  1CA5 A;  3W3A A;  1SND A;  3LWU A;  1LTI D;  2L5T A;  5C4J B;  3J81 E;  1DM0 B;  3RNU A;  1SNM A;  2F0D A;  1VQL A;  3K5L A;  4LF5 Q;  1MKH A;  5GAH C;  2R92 G;  1TY0 A;  2KCM A;  2KVM A;  4ZYS A;  3T1H L;  4LFC Q;  1ENA A;  1I4R A;  3HOV B;  3S15 H;  4A3E B;  1XNQ L;  4S3S A;  4JI0 Q;  2UUA Q;  1BCP B;  5AFW A;  5C4Z A;  4DV1 Q;  5ELE A;  3RLF A;  1E1T A;  4IUP A;  2QIL A;  1X3F A;  2QA4 A;  2UXC L;  4P2C B;  4JBK A;  3T56 B;  3U4Z A;  4A3D H;  3R8B A;  3SE0 A;  4KKT A;  3ULJ A;  4CHT B;  3C3L A;  3KDF B;  1OXU A;  5FKA C;  4B3M L;  3VYU A;  3MZ5 A;  5JJL A;  5H1S E;  1J8I A;  3CCS A;  1EYA A;  2BOS A;  2IX0 A;  3KUP A;  4IFD H;  3PUV A;  2A6H D;  2IHF A;  3S15 B;  1QJO A;  3K0Y A;  1GM5 A;  3MC0 B;  2Y0S B;  4K5V A;  2UU9 Q;  2Z1C A;  1DOK A;  4JI0 L;  4B9X A;  2Q2I A;  4DR5 L;  2BDO A;  4ZQ3 A;  3NEM A;  1RCV D;  2CKZ B;  4DNI A;  1OO9 B;  5GAD C;  3GTJ B;  3BJU A;  1JE4 A;  1I3Q B;  2FIN B;  4CJ1 B;  1D2B A;  2D2C C;  1JWM D;  5BN4 A;  2XSC A;  3IL8 A;  5I9O A;  3IAY A;  1WCM H;  3PF5 A;  2Z6K A;  4KI0 A;  1HJP A;  2MO0 A;  4JG2 A;  3CP0 A;  1A63 A;  1MSH A;  2Z6K C;  4A3F H;  3HOW G;  1PVO A;  5I4D A;  1SLJ A;  4QQB X;  3KJO A;  1PLF A;  3VR5 A;  5IP7 H;  2J4X A;  4A3C G;  4X3K A;  2L4N A;  2K05 A;  3QWN A;  3KJP A;  5EQ0 A;  1ILQ A;  2VUM H;  4JI7 L;  2Q8I B;  1WCM B;  3SK8 A;  1WTQ A;  4TQU S;  3JAM E;  1I4X A;  4EGV A;  1VQ4 A;  3CRK C;  4WOR A;  2BA1 A;  5G3L D;  1IXR A;  1LTS D;  4IN3 A;  2A19 A;  1H9K A;  4IUR A;  2AUJ D;  4FXD A;  4DV5 Q;  3I4O A;  3VA5 A;  5HUR A;  3MWY W;  3A56 A;  4DV1 L;  3F8T A;  3EBE A;  2NZH A;  2K50 A;  4B3T Q;  4F87 A;  1XMO Q;  4ALP A;  4QIW E;  3I4N B;  5FJ8 H;  1GHJ A;  4KY7 A;  2D9U A;  3MXP A;  4LFB L;  4NP5 A;  3PIO A;  4L5Q A;  3X3M A;  2E2D C;  5I6Y A;  1Q12 A;  1EZ8 A;  1ML0 D;  1EY9 A;  4R4Q A;  3CME A;  2NN6 I;  2C5C A;  3UDX A;  3VR4 A;  1JWS D;  2B39 A;  4XIG S;  1JOO A;  1AZQ A;  2NVQ H;  4OWT B;  3H91 A;  2OQ0 A;  1KNA A;  4A3L H;  3TEH B;  1EQV A;  1JJG A;  2HCI A;  1QE6 A;  1SRO A;  1EFI D;  1A3T A;  1NR4 A;  3MFG A;  4BBS H;  2N8N A;  3CF5 A;  2BA0 A;  1PTO F;  3J7A F;  4ZKB B;  3AFQ A;  4KV6 A;  1YJ9 A;  4PMW A;  1DD2 A;  4LF7 L;  4A93 B;  3T4A C;  4NXN Q;  1O7Z A;  4DR3 Q;  2EDG A;  2R93 B;  1Y8O B;  3HP3 A;  1X55 A;  1LTG D;  4UP8 A;  4PZ7 A;  4WJW A;  3I2Z A;  1EIF A;  5J22 A;  2K5H A;  1R9T B;  1LT4 D;  1HFN A;  2HIX A;  4JW0 A;  2AMC B;  4ZAI A;  2SNS A;  3VR3 A;  1SNO A;  5IY0 A;  2LKV A;  2UUB L;  2L9H A;  1CA6 A;  3HOZ H;  4LF6 L;  2K5N A;  2PZT A;  3GDE A;  3VYR A;  4KK7 A;  4LMQ D;  1SR3 A;  1HFG A;  4AYB B;  2A69 D;  3I7F A;  4JK1 C;  4LF8 L;  5EAY A;  1A3U A;  3SEB A;  1BUV T;  3J81 c;  4DV5 L;  3A7A B;  3J80 L;  1QVG A;  3CCV A;  1HNW L;  1EWH A;  5C4J H;  2B2W C;  3TQY A;  3E6Z X;  5IOC A;  3FKI H;  4DAV A;  1KLU D;  1K73 C;  4K0K L;  1CQF A;  1B1Z A;  1D8L A;  3L0O A;  1YJW A;  4DK1 A;  4GKJ Q;  3G48 A;  4NKL A;  2ZJQ A;  4R4T A;  3QOL A;  1AH9 A;  1NY4 A;  2KA7 A;  1WTW A;  1XYI A;  4H02 A;  5E1F A;  3FPU B;  2J7Z A;  4ULL A;  2FXQ A;  5C3E G;  1MD2 D;  2RKS A;  2E2J B;  4G7Z C;  1WTX A;  4HIO A;  4FXK C;  3G6J B;  1CM9 A;  2SOB A;  4OO1 I;  3MA2 B;  2GN5 A;  3ER0 A;  4BY7 B;  3SVM A;  4MN3 A;  3CCE A;  2Z8L A;  3J7A V;  2IPK D;  4O0A A;  1DOM A;  4I65 A;  4EX5 A;  4JCV E;  4HSP A;  3DMU A;  1EU3 A;  2F0F A;  1IW7 D;  3KF6 A;  1KAB A;  2KCC A;  1GKH A;  4LF5 L;  4OWX B;  2UXB Q;  1I3Q H;  5KYL A;  5IWA L;  1XNQ Q;  3MXG A;  3DXJ C;  5C3E B;  3M7N A;  1HZB A;  3A74 A;  1LYL A;  2NUC A;  1NSN S;  4IPC A;  3Q24 A;  1YHQ A; 
#chains in the Genus database with same CATH homology
 4DV4 L;  2VY3 A;  2UXC Q;  4LWC A;  3K7A H;  4X62 L;  3I4M G;  3AYH B;  3E0E A;  1LTL A;  1VQO A;  4B3R Q;  4Y52 H;  4TVA B;  4YY3 Q;  3UDF A;  4L5S A;  4OON A;  4AQY L;  1ASZ A;  5IYD H;  1VQG A;  4J15 A;  2OWO A;  4DPG A;  3PSI A;  4UP7 A;  2ZM6 Q;  2IHE A;  3F1Z A;  1M90 C;  3GTM H;  4OXP A;  4ME3 A;  4WJ3 M;  1MJE A;  2VQF L;  2I5H A;  2KCT A;  1I94 Q;  4GOP A;  1Q81 C;  1JMC A;  1EOV A;  3UE1 A;  1PH9 A;  4DR7 Q;  1HH2 P;  3CC7 A;  1KHI A;  1VQK A;  1VQF A;  4LFA Q;  3LGJ A;  2F3I A;  1X6O A;  2JEA I;  1D7Q A;  1JB7 A;  3OTO Q;  4JI8 L;  5C4X H;  1X65 A;  3GTL H;  4A3B H;  4BBR H;  1QVF A;  2ZM6 L;  1VQ9 A;  3PO2 G;  1WJJ A;  3BU2 A;  2VW9 A;  4IFD G;  1YBY A;  4GS3 A;  3W5O A;  1Q7Y C;  1N33 Q;  3HFZ B;  3GTK H;  4GKK L;  3RLO A;  1EQR A;  1AE2 A;  3CCR A;  2ATW A;  4BXX G;  4POF A;  4DR3 L;  1K8G A;  2YTY A;  5GRO A;  1VQD A;  4C2M H;  4UPA A;  5IE8 A;  2LXJ A;  2PQA A;  4MNO A;  4GOP C;  1YIT A;  3AEV A;  1I6H H;  1C9O A;  3W1G A;  5C0X G;  3H15 A;  1J5E Q;  1YNX A;  2GVB A;  1VQH A;  4GLV B;  3S2H H;  4MTN A;  1PA6 A;  4R4C A;  2RF4 A;  3FP9 A;  3H0G G;  4B3S L;  1NJI C;  1Q8K A;  2I5M X;  1N34 L;  3MXN B;  4P73 A;  4BA1 I;  2UUB Q;  2ZTE A;  1UE6 A;  3F2B A;  4LFB Q;  1RIP A;  5GAE C;  2HHH Q;  1V1Q A;  3CCL A;  1PYB A;  5JJI A;  4YCV A;  4DUY L;  4X66 Q;  2AHO B;  1A8V A;  3EIV A;  4DKA C;  1TWA H;  4IFD J;  1J5E L;  1Q1B A;  2XTI A;  2D62 A;  1YVC A;  4P71 A;  5GQO A;  3STB C;  3CCM A;  4A3I G;  4LF9 L;  3M3Y H;  3S14 H;  1VQI A;  2VZA A;  1W2B A;  3S1Q H;  3A0J A;  4JI2 Q;  2JA7 H;  1VQE A;  1L1O A;  1YHB A;  3G71 A;  1SFO H;  4DK6 C;  3HOU H;  3U58 A;  3TS2 A;  4DV3 Q;  4RMF A;  1MJC A;  4HID A;  2JA7 G;  3M4Q A;  4JI7 Q;  4DR2 L;  2HQL A;  3EN2 A;  5IP7 G;  4GKJ L;  1KXL A;  1VQM A;  3HOZ G;  1XTD A;  1X3E A;  3GTQ H;  3ERS X;  4JYA L;  4LUZ A;  3HOY G;  4UP9 A;  2AWN A;  4XTC S;  3ULL A;  3JC6 6;  2C35 B;  3K80 C;  4NPS A;  1N9W A;  2A1A A;  1XMQ Q;  2F4V Q;  1N36 L;  2JE6 I;  4A3F G;  1HZ9 A;  3IRB A;  3BZC A;  4X62 Q;  5HGQ A;  3G4S A;  4HJA A;  4NXM L;  1XNR Q;  3RZO H;  1H95 A;  4X64 L;  2PNH A;  1RL2 A;  4A3J H;  4A3K H;  2UU9 L;  2UUC Q;  3J81 i;  2R93 H;  2Q2H A;  3U4V A;  2R7Z H;  2AWO A;  3I4N H;  4X65 L;  1PYS B;  1FVI A;  1PH3 A;  1WFQ A;  2KBN A;  1TWF H;  5JEA G;  1VQP A;  4JBJ A;  2YU9 H;  3K81 C;  1SMX A;  1IBK L;  1C0A A;  5J3B A;  2IY5 B;  1R9T H;  2PQA B;  5M3M G;  2E2I H;  2ZJR A;  4JI5 Q;  4YWM A;  5IYB G;  3KDF A;  1CKN B;  4C3I H;  1U0L A;  3T1Y Q;  4L5R C;  2VQE Q;  1N33 L;  1KAW A;  4IPD A;  4DUZ Q;  5LMU L;  4GLX A;  2UUC L;  2UUA L;  2WAQ G;  3S16 H;  2XGT A;  4GNX C;  1CSQ A;  1SE8 A;  1FGU A;  2CQO A;  1Y1W G;  1HR0 W;  4A3L G;  2AKW B;  1Y14 B;  4IPG A;  3HOX G;  1HNX L;  4DV2 Q;  4A3G G;  5M3M H;  1E3P A;  1B7Y B;  3AFP A;  3AQQ A;  4BY1 G;  3JAM c;  3CAM A;  1Z47 A;  5M3F G;  4JC0 A;  1X3G A;  2VS1 A;  4LUO A;  3HKS A;  3K0X A;  1QUQ B;  1VQ8 A;  4GN4 B;  2YTX A;  5DLQ E;  1L0W A;  5AJ3 Q;  4OX9 L;  1JJC B;  4B3R L;  2Y0S E;  1UWV A;  4K0K Q;  3FHW A;  4BY1 H;  3J81 j;  1TWG H;  1VQB A;  1CUK A;  3NEN A;  5IYB H;  4KLK A;  4A3D G;  3KF6 B;  3UDG A;  5IP9 H;  3KOJ A;  1Y1W H;  1N32 L;  4JV5 L;  4JI5 L;  3RR5 A;  3RN5 A;  2E5L Q;  2B63 H;  4A93 H;  1QVC A;  4PZ6 A;  2H5X A;  2QEX A;  3PUX A;  1PH1 A;  5ELN A;  4HIK A;  1IZ6 A;  4GLA C;  5M5Y H;  3A5U A;  4DV0 L;  1WI5 A;  4DV7 Q;  3RN2 A;  4HJ5 A;  1A62 A;  1A0I A;  4HJ7 A;  4HJ9 A;  3E9H A;  1UE1 A;  2Q2T A;  2DUD A;  5JJK A;  4IJL A;  3M9B A;  4AIM A;  4DAY B;  1OTC A;  4DR2 Q;  2JA8 G;  1VCI A;  4GN5 A;  1ASY A;  1LM0 A;  1XMO L;  2Y0S G;  1HR0 L;  2E8G A;  1I50 H;  5C44 H;  3HOV G;  4A3J G;  4YCU A;  4DK3 C;  4JI8 Q;  4OX9 Q;  1NTG A;  3M85 A;  2R7F A;  2R93 G;  2NN6 G;  2N78 A;  1PHJ A;  4MZ9 A;  4IO9 A;  1TWH H;  1N36 Q;  2A8V A;  3HOV H;  4R4I A;  2YTV A;  4A3E H;  3ICE A;  1OXS C;  2OTJ A;  4LFC L;  3T1H Q;  1SN8 A;  4LF6 Q;  4JI6 L;  1YHA A;  2JQO A;  3GTP H;  1K83 H;  1G6P A;  1E24 A;  2KHI A;  1K8A C;  4GNX B;  1UEB A;  3H0G H;  4QL5 A;  1TWC H;  1VQ5 A;  1N8R C;  2Z0S A;  1P8L A;  3RNU A;  3Q8D A;  2RHS B;  1VQL A;  4LF5 Q;  1MKH A;  5GAH C;  2R92 G;  4P75 A;  2KCM A;  2D0P A;  2ZTD A;  4A3E G;  3T1H L;  5C3E H;  4LFC Q;  4POG A;  2OQK A;  3NEL A;  4IOC A;  4A3I H;  3S15 H;  2HIV A;  3VDY A;  1PH4 A;  2K14 A;  1XNQ L;  4JI0 Q;  1L1O B;  2CWP A;  2UUA Q;  4AQY Q;  1G51 A;  1KRT A;  1C7Y A;  1WCM G;  4DV1 Q;  2NVT H;  2ZTC A;  2B63 G;  4A3M G;  3RLF A;  4A93 G;  1E1T A;  2JA8 H;  2QA4 A;  1X3F A;  2OCE A;  3S24 A;  4LF4 Q;  4JBK A;  2UXC L;  3U4Z A;  3KF8 B;  4DR1 Q;  1IBL Q;  4A3D H;  1U5K A;  4DUZ L;  2MQH A;  3K7U C;  2D0O A;  3ULJ A;  1YIJ A;  3KDF B;  1OXU A;  3NBH B;  1YI2 A;  4IOA A;  4B3M L;  4PG3 A;  3D0F A;  5JJL A;  5H1S E;  1YHQ A;  3GTG H;  3CCS A;  1BKB A;  4GNX A;  5M3F H;  2IX0 A;  3PUV A;  2IHF A;  1KRS A;  5IP9 G;  3UE0 A;  1GM5 A;  3PO2 H;  4BBR G;  2L15 A;  4A75 A;  2VNU D;  3J7A 5;  4JOI C;  4JYA Q;  1EUJ A;  3WWV A;  1XPU A;  1IBL L;  4X64 Q;  2UU9 Q;  4JI0 L;  3GO5 A;  1FJG L;  3PGZ A;  3M4P A;  2Q2I A;  1XMQ L;  2UXD Q;  4DR5 L;  5C0X J;  3NEM A;  1N32 Q;  1VQC A;  4JV5 Q;  3CC2 A;  2GVA A;  4A4I A;  3S2D H;  1VQ6 A;  1TXY A;  3I4N G;  3ULP A;  2CKZ B;  4DNI A;  2WFW A;  4KHZ A;  5GAD C;  4JBM A;  2PI2 E;  1T9H A;  3BJU A;  3PCO B;  4A3K G;  3JAM i;  1HNW Q;  3CD6 A;  4R4O A;  3HOX H;  2IT1 A;  4BY7 G;  4QY7 A;  3CC4 A;  1X54 A;  1M1K C;  3CW2 C;  2DGY A;  5HY6 A;  3HKZ E;  1WCM H;  4APV A;  3PF5 A;  1BBU A;  1VS0 A;  2Z6K A;  2JJQ A;  4KI0 A;  3CCU A;  3KFU A;  1HJP A;  2MO0 A;  4JG2 A;  3CP0 A;  1A63 A;  1B70 B;  2Z6K C;  1HR0 Q;  4O2D A;  1G29 1;  1GO3 E;  2VL6 A;  3PV0 A;  4P72 A;  5IYD G;  4A3F H;  2ASB A;  4DR6 L;  3HOW G;  4BA2 I;  3L7Z C;  5ELO A;  5JEA J;  4QQB X;  1SLJ A;  1PVO A;  4P74 A;  3STB D;  3KJO A;  3GTJ H;  3RLN A;  4OWW B;  5IP7 H;  2R7Z G;  2B29 A;  1K0R A;  1P16 A;  2EXD A;  4A3C G;  2WB1 G;  2N49 A;  5LMN W;  3PIP A;  3KJP A;  4HJ8 A;  1KD1 C;  3CXC A;  2VUM H;  3G6E A;  1VQ7 A;  3HOU G;  2RHQ B;  4JI7 L;  1WYD A;  3A5Z B;  4DR7 L;  4IFD I;  1IYJ B;  4DAM A;  4R1J A;  1JT8 A;  4B3T L;  2MFI A;  4TQU S;  1VQ4 A;  3UDI A;  3OTO L;  3HOY H;  2BA1 A;  4JOI A;  4GKK Q;  2BH8 A;  1IXR A;  4DV6 L;  1NMG A;  5LMN L;  2A19 A;  5C44 G;  3E9I A;  2N3S A;  1XNR L;  2IX1 A;  4DR6 Q;  4DV5 Q;  4NB3 A;  3I4O A;  1PV4 A;  1PFS A;  1Y1V H;  1KQS A;  3J80 c;  3BZK A;  3F8T A;  3EBE A;  1NMF A;  4DV1 L;  2NZH A;  3U50 C;  1KIX A;  1EFW A;  3F2C A;  2K50 A;  1PH6 A;  4B3T Q;  4LF8 Q;  1XMO Q;  1S3O A;  4ALP A;  2WB1 E;  1Q86 C;  1Q82 C;  4B3S Q;  1UE7 A;  4QIW E;  4JI1 Q;  5FJ8 H;  1PH2 A;  2ES2 A;  2MNA A;  4X6A H;  1QUQ A;  2MO1 A;  4AYB G;  4WJ4 A;  4DV6 Q;  1OXV A;  3W1B A;  2E2H H;  3PO3 H;  1YJN A;  4LFB L;  3PIO A;  2UXB L;  4L5Q A;  4LUV A;  1Q12 A;  5IWA Q;  1CSP A;  3T1Y L;  1CKO A;  4R4Q A;  5C0X I;  2NN6 I;  3CME A;  5LMU Q;  1N34 Q;  3B6Y A;  1HNZ Q;  3UDX A;  4DR5 Q;  2BH2 A;  4IPH A;  5LMN Q;  2WAQ E;  1BVS A;  2EQS A;  1S40 A;  1KC8 C;  2JA5 G;  3MEF A;  1BBW A;  4DV4 Q;  2HHH L;  4IJH A;  4XIG S;  2K4K A;  3S1M H;  5M5W H;  4JI6 Q;  2VQE L;  2NVQ H;  4A3B G;  3DLL A;  1JE5 A;  2ID0 A;  4OWT B;  3I55 A;  3GTO H;  2K52 A;  3PUZ A;  4NXN L;  4YWK A;  3S17 H;  2OQ0 A;  4A3G H;  1CKN A;  1V9P A;  2I5L X;  4A3L H;  5IYC G;  2VUM G;  5AJ3 L;  3S1R H;  4L5T A;  3TEH B;  2V1C C;  4AYB E;  3CPW A;  1JJG A;  3CCJ A;  2WP8 J;  1NBW A;  1SRO A;  4A3C H;  4OO1 G;  1XPR A;  4EQ5 A;  4BBS H;  1O7I A;  2N8N A;  3CF5 A;  1VQN A;  3CMA A;  2BA0 A;  3PUY A;  5FLX c;  3AFQ A;  4DR1 L;  4JBW A;  3HOW H;  1YJ9 A;  4PMW A;  5C4X G;  2JA6 G;  2RCN A;  1HNZ L;  1Z9F A;  3OW2 A;  4LF7 L;  2LSS A;  4X65 Q;  4NXN Q;  4DR3 Q;  3KLW A;  1SRU A;  4UY8 C;  4DV7 L;  4KHP Q;  1X55 A;  1EQQ A;  5GAG C;  3GD7 A;  4UP8 A;  4LNQ A;  4BBS G;  4PZ7 A;  1I5F A;  2R7D A;  2B3G A;  1HZC A;  5M5X H;  1E22 A;  1DGS A;  3I2Z A;  1GD7 A;  1EIF A;  2YV5 A;  2K5H A;  1QZH A;  2NVX H;  4PZ8 A;  1YEZ A;  3TRE A;  2YYZ A;  1W3S A;  1JJ2 A;  1Q1E A;  5IT9 c;  2JA6 H;  4YCW A;  1IBK Q;  2HIX A;  2AMC B;  1FL0 A;  1Q46 A;  5FLM G;  3L2P A;  2Q2U A;  3CPF A;  5IY0 A;  4YHH L;  4JI4 L;  4LF7 Q;  4QGU A;  3I4M H;  2UUB L;  3TRZ A;  3HOZ H;  4LF6 L;  2K5N A;  3GDE A;  3S1N H;  4X66 L;  1SR3 A;  3K8A A;  3M4O H;  3H3V I;  2KEN A;  1V43 A;  1PH8 A;  3I7F A;  3PF4 A;  4HIM A;  1X56 A;  4LF8 L;  5EAY A;  1EYG A;  4DV2 L;  1IL2 A;  3CQZ H;  4DUY Q;  4JI3 L;  4YWL A;  3J81 c;  4DV5 L;  2E2J H;  2R6G A;  3ZJY C;  1XJV A;  1QVG A;  3CCV A;  3OYY A;  4YHH Q;  5IYC H;  1HNW L;  2K75 A;  5C4J H;  3TQY A;  1IBM Q;  2NVY H;  1YZ6 A;  4LFA L;  3FKI H;  1QZG A;  2E5L L;  4JI1 L;  1E7Z A;  1K73 C;  4K0K L;  1AE3 A;  4JI4 Q;  4FDB A;  1D8L A;  3L0O A;  2NZO A;  1YJW A;  4A76 A;  1S72 A;  2JA5 H;  4A3M H;  3G48 A;  4GKJ Q;  2ZJQ A;  4R4T A;  4GN3 B;  4LF4 L;  2EIF A;  3KYH C;  1AH9 A;  1NE3 A;  1NY4 A;  5E7N A;  5K36 G;  1X9N A;  4H02 A;  1K9M C;  1HZA A;  2JK8 A;  2OTL A;  2F4V L;  2FXQ A;  5C3E G;  4DR4 Q;  1IBM L;  3FKI G;  1MIU A;  3J80 i;  3PO3 G;  4DV0 Q;  4B3M Q;  3CCQ A;  2R92 H;  4BXX H;  3I56 A;  4HIO A;  4NXM Q;  4JI3 Q;  1GVP A;  5FJ8 G;  4OO1 I;  3DM3 A;  2GN5 A;  3ER0 A;  2ALY B;  1PH7 A;  5BR8 Q;  1E1O A;  3J7Z C;  3CCE A;  2K5V A;  2ZJP A;  1VQA A;  1Y1V G;  4O0A A;  3SGI A;  1VQJ A;  4EX5 A;  1LUZ A;  4C3J H;  4YY3 L;  5FLM H;  4JCV E;  2F52 A;  2JEB I;  4AH6 A;  1KL9 A;  1L2F A;  3TS0 A;  1PH5 A;  1EIY B;  3H3V H;  4QJF A;  2HT1 A;  2QGQ A;  4JI2 L;  2PMZ E;  2I0Q A;  1OXT A;  2VQF Q;  1EWI A;  3KF6 A;  1XPO A;  4GOP B;  1I94 L;  1L1O C;  4LW1 A;  1K3R A;  1FJG Q;  2UXD L;  1GKH A;  2CCZ A;  4LF5 L;  4LF9 Q;  4DR4 L;  2JA9 A;  4OWX B;  3D31 A;  4Y7N H;  1J6Q A;  1HNX Q;  2CWA A;  2UXB Q;  1I3Q H;  4KHP L;  4BY7 H;  3F2D A;  5IWA L;  3RZD H;  1XNQ Q;  2KHJ A;  2LXK A;  3HKZ G;  2CFM A;  1CKM A;  4RG1 A;  4DV3 L;  1UE5 A;  1HZB A;  1LYL A;  1OXX K;  3A74 A;  4C3H H;  3M7N A;  1WOC A;  4IPC A;  1B8A A;  2PI2 A;  3PUW A;  5BR8 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...