1DD2A

Biotin carboxyl carrier domain of transcarboxylase (tc 1.3s)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
AGAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCARBOXYLASE 1.3S SUBUNIT
publication title High resolution solution structure of the 1.3S subunit of transcarboxylase from Propionibacterium shermanii.
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
molecule tags Transferase
total genus 8
structure length 77
sequence length 77
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 1999-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dd2A00
4IQZA 5JEAH 2F1MA 2DNCA 1Y69U 4H0LC 4KI0A 4PV1C 2LMCB 2D2CC 3PUVA 3OOCA 2NN6G 2EJGC 3HGBA 3BG3A 1GHKA 1VF7A 4KKTA 1DXMA 3L7ZC 3M7NA 2A6EC 1Z6HA 2A69D 1K8OA 1Q1BA 2NN6I 1LABA 1VDZA 3GQBA 3MFYA 3ND9A 2ZT9C 3OPOA 5KNBA 4KKUA 1FR3A 1OXXK 1Q1EA 3MXUA 3VA7A 2JEAI 1ZYRC 3U9SA 3TZUA 1Z7TA 1GUOA 4DNTB 5C0XH 2KCCA 2R6GA 1B9MA 5JEAG 1GUTA 1OXSC 1TKWB 2PPBC 2A68D 2A6HD 2PNRC 3DXJC 2BE5D 2E75C 3PUWA 1HQMC 1SMYC 1GJXA 3IFTA 5BN5A 2D62A 1V8QA 1IW7D 3PUXA 1H9SB 4DK1A 2B8FA 4GZYC 2CW0C 2EDGA 4BA1I 2A69C 2YYZA 1YNJC 3H94A 3PUZA 3VR5A 5BN4A 5BN3A 1G291 1K8MA 1Y8PB 3A8IE 1H9KA 1FYCA 5K36H 4H13C 3CRKC 3T56B 1H9MA 5A35A 3A8JE 2DNEA 3P20A 3OW7A 1H9JA 5C0XG 4LJZC 1IYUA 2E76C 4G7ZC 2QF7A 3CRLC 3LNNA 2L5TA 4BA2I 4OO1G 1EWHA 3W3AA 3LWUA 3SDZA 3T51B 1I6VC 1DD2A 1O7LA 2A68C 4JK1C 4OGQC 3VR2A 1Y8NB 3VR3A 2BE5C 1OXTA 3M85A 2BDOA 1ZKOA 4G7HC 4XTCS 3GD7A 2DN8A 1YNNC 1IW7C 2IT1A 1OXVA 4H44C 3KLRA 1GUNA 3A7AB 1O78A 3VR4A 2BA1A 1DCZA 2EJMA 3BDOA 4IFDH 2K32A 1QJOA 5K36G 1BDOA 2NN6H 2A6ED 1E2WA 1LACA 2BA0A 1CTMA 3ND8A 3FPPA 4KN7C 4XIGS 1Y8OB 2K33A 2D5DA 5KNDA 1H9SA 2E74C 1ONLA 4L8JA 1A6XA 3I73A 2JE6I 3I4LA 1H9RA 1E2ZA 1VF5C 1PMRA 3M4YA 1GUSA 1IYVA 3FMCA 3VR6A 3I72A 3D4RA 2K7VA 3AB9A 3SE0A 2B8GA 2AUJD 2A6HC 4KKSA 3EQLC 2EVBA 4RCNA 4TQUS 3QJYA 3NE5B 3WDNA 4IFDG 4LK1C 2AUKA 3QIAA 3RLFA 1Q90A 3IKJA 3QG1A 2PCFB 3D31A 3PUYA 2KA7A 4KMUC 2O5JC 1HCZA 1Q12A 4G7OC 1HPCA 2AWOA 3T53B 2V4DA 1TU2B 4I7ZC 1OXUA 4DK0A 1VCIA 4TKOB 1E2VA 1HTPA 1CI3M 4KHZA 5KNCA 3PV0A 1T5EA 1GHJA 3A8KE 2Q8IB 3A7LA 2EJFC 1V43A 4OO1H 1B9NA 1CFMA 4HR7B 4DNRB 4KN4C 2O5IC 1GUGA 4JBWA 2JXMB 3N6RA 2JEBI
chains in the Genus database with same CATH superfamily
4HJ7A 1NY4A 1PZKD 2K75A 4ME3A 1AZQA 2KUMA 4JI4Q 1O80A 1N33Q 3BG3A 4KKTA 5GQOA 2WINB 1S5BD 2CW0D 3M7NA 4JV5L 3Q22A 1R4PB 1LABA 1VDZA 4HIOA 2N88A 4CHTB 1FR3A 2JQOA 1FVIA 2F0SA 5A2QE 2EYJA 2K50A 3HG9A 4LMQD 4IALA 2KCCA 4MIUA 1LTTD 4IOAA 1TWFB 1JB7A 3P75A 3G48A 1PH5A 1N32L 2R61A 1Z47A 2MNAA 1B7YB 2LS01 2HUGA 3T1YQ 4A93B 2YYZA 3VR5A 4OONA 3S1MH 4Y7NH 4TSSA 4NW2A 1EY4A 3BDLA 3ULPA 4NPSA 2HDMA 3TREA 2IJ0A 5C6AA 3OTOQ 3CCLA 1IYUA 1ET9A 3G6EA 3BVZA 4ILWA 1WOCA 4DV7Q 4HJ9A 3U50C 2R7ZB 5FOBB 1LO5D 1DJRD 1EIGA 2JA7B 2IT1A 4NXMQ 5CGKA 2ENBA 1KRSA 4M1UB 1M1KC 4P71A 3VA5A 1I4PA 3QOJA 1QJOA 2L1BA 3UE1A 5CV9A 2B63H 2A6ED 1W6JA 2EY2A 2SEBD 1V1PA 2HCIA 2F0WA 4GLXA 1ENFA 4CJ1B 2B2TA 3IFDA 1OO9B 2XRQD 1WTWA 2CWPA 1BBUA 4DUYQ 1KDCA 4ID6A 1XMOQ 3OIPA 4A3IB 4QQBX 2RSOA 1B53A 3Q6SA 4IN3A 4MZ9A 2JA8B 1FGBD 1I94L 2OT2A 3ZJYC 1VQIA 5C4XG 2IHEA 1VQOA 5EPJA 2K14A 1E2VA 2QDBA 2B2VA 4KY5A 1HTPA 2N78A 3I91A 4DF7A 1JORA 3EBEA 5DM63 5HGQA 3KJOA 5M5YB 1TWHH 2WV6D 3HEJA 5I2YA 1X55A 3FVQA 2JXMB 4LAAA 2WB1E 1HNZL 1SNCA 2LMCB 1X3QA 4A3LH 3PCOB 1NCVA 3GTGH 5C3EG 3CPWA 4IUUA 3DWPA 2ATWA 1Y1VG 3M7GA 3S14B 1G6ZA 1F9QA 4TVAB 3FDTA 3PO3H 4DV6Q 4H02A 2PPBC 3KF8A 2JA5B 3IRBA 1JOKA 5FK9C 2A6HD 2ICIA 3CPFA 2BE5D 4X3UA 1C7YA 5D14A 4F87A 4GN3B 1PRTF 5BN5A 4K6DA 4KJNA 4QIWB 4HN7A 1X3GA 1HNXQ 2CW0C 3UDIA 5JOBA 3WOEA 2HIXA 5FLXc 2FXQA 2N8NA 1S5FD 1ILPA 1LT6D 1H9KA 4IPDA 3TS2A 1CZGA 3SEBA 1H9JA 3R2IA 2AQ2B 4EQPA 2Z1CA 1LT4D 4JI4L 1CZWA 3NBHA 2RSNA 1Y8NB 1C4QA 2CWAA 3K8AA 1XJVA 1TS3A 1SNQA 2HT1A 2TMPA 1D5MC 1QZHA 4ZKCB 4G4KA 5M5WB 4BBSB 5EKIA 3CC4A 1A2UA 3BDOA 3EA6A 4A3CH 2JSOA 4JC0A 2XIWA 4POFA 1CTMA 3FPPA 3H0GH 5CR3A 1GUWA 5FLXL 5C3EH 2HQLA 3H3VI 1E2ZA 1VF5C 1PMRA 1Y1VH 2CH4W 3JAMi 1HJPA 3FMCA 4IPCA 3Q0AA 4GOPC 2F3VA 1RCVD 3TEHB 2F4IA 4HSVA 2YU9B 1NSNS 4X3TA 1ET6A 1VQ4A 1F2YA 3QIAA 4DR1L 2ZXPA 3TP5A 1Q90A 1FNWA 2LXJA 3HS0C 1TXYA 3V2TA 3K7AB 2UXDQ 4KMUC 5ELEA 4XQNA 5IOCA 1HQRD 1E1TA 3J81c 4KY6A 5KIXA 4HSPA 3A56A 4TKOB 4B3RQ 4O1NA 1CI3M 5KNCA 3NK9A 1JCKB 2VW9A 2NWGA 2D0PA 2N49A 3PV0A 3A8KE 4WJ4A 4CKCA 1VQMA 5K5PA 3S1NB 2O5IC 4OXPA 2JEBI 4ZUJA 3DEOA 4QMGA 5IGEA 4DFAA 2XNAC 2PZWA 2F0EA 3PGZA 1DXMA 4HIMA 3C3LA 5JJZA 2SDFA 3SK5A 4A3EH 2Z6BA 4R1JA 1HR0L 3J81L 3RN2A 3URYA 3AFPA 2M2LA 2IX0A 1HUNA 5F2DA 2PZTA 4CDDC 3FRPB 5C4HA 4IZ8A 1BQQT 1LTBD 2OWOA 1AEXA 1UAPA 2FMCA 4V0BA 4FF4A 1IL8A 4BBRH 3ULJA 2HCCA 1Q8KA 1NAPA 5DLQE 1K8GA 1UWVA 1E22A 2CVRA 2RF4A 1FYCA 5K36H 1T9HA 3X3NA 2K5HA 1BXTA 4DV3Q 3M3YB 4IPHA 1LYLA 2G9DA 2E76C 2P5ZX 2L5TA 5IYCG 4OO1G 2RDGA 4YCUA 3MA2B 3KF6B 3GTQB 5C4XB 2BE5C 1MJCA 4LUZA 1QB5D 1Y14B 1WTVA 1PTOD 2B2TC 4NDXA 3HOWG 2WIIB 1KNEA 5IODA 5C4JH 4DV6L 3AEVA 4IUTA 1BR9A 1L0WA 3FKIH 3DLLA 5EGTA 5EKLA 1JQYD 1N36L 2IL8A 2RHSB 3OMGA 1GUSA 4X3KA 1IKLA 5IP7G 1AE2A 4GLVB 4FDBA 4KV6A 1A0IA 2B2VC 4LFBL 4A3FG 3FHWA 5TSSA 5LMUQ 1L2FA 1PH2A 1XNQQ 4OELB 1QNKA 3MXNB 1IBML 3KBXA 3HOUG 3U4ZA 5I9OA 5IWAQ 1E24A 2QW7A 1EL0A 2FJ2A 2KVMA 1VCIA 4ME5A 1WD1A 2EYPA 3B6YA 3K7UC 2UUCQ 4A3GG 4RHSA 4C3HG 1XYIA 2CKZB 3GTJB 2EIFA 3N52A 3NHHA 1GKHA 1CKNA 2VQFL 1EY0A 4OO1H 1CA6A 4JI6L 2OTLA 1E0BA 1TVXA 4UY8C 2R92H 3CAMA 3N6RA 2ES2A 3D6WA 2F1MA 4A3KG 3K5MA 2UXCL 4DN4M 4N9TA 3BVMA 3CMEA 2DY8A 3H6MA 2X6GA 5LMNL 1X56A 1YNJD 4RHRA 4BXXG 4AIMA 1X3FA 1XMQQ 5IT9c 5KYLA 3SXHA 4WJWA 3VA7A 2IX3A 1KDBA 4FF3A 4ZKBB 3TZUA 4LF4Q 4AYBE 2UXDL 1VQFA 1HR0W 4L6TB 1EU3A 4A3JH 1NR4A 4IJHA 4L5TA 4BY1G 3RZOH 3GDEA 4A3FH 1V8QA 3HFZB 4DA2A 4DAYA 2N3SA 1VQDA 2EDGA 1JJ2A 1J9OA 1K8MA 3HOUH 1RODA 1CT1D 2MP1A 2F0KA 2R93H 3E0EA 2UUAQ 1VS0A 5C0XG 3OW7A 1W2BA 5COYA 2PMZE 3G7LA 5IT9L 3NQTA 1G2TA 2WAQE 5C44G 1PYBA 3UI2A 3NTHA 1YNXA 5J39A 3HOXG 1ZEQX 1FL0A 1I6HB 1GUNA 2X69A 5I2XA 1PFNA 1TS4A 4LWCA 4TRDA 4YWKA 1EWCA 1TY0A 4YCVA 1HNWQ 1RL2A 5FLMG 1ZYRD 5IGCA 2VQEQ 3EVQA 3HOZH 2B8GA 1RKNA 1KXLA 1EQQA 1STYA 5FJ8G 1U0LA 4F8MA 1PTOC 4X62L 1LLRD 2YTXA 1RD9D 1I3QB 4R9WA 3K5OA 3S9WA 2UUBQ 1KLUD 3A5UA 1EU4A 3JAME 5C3WA 2GVAA 3L9AX 3GTKH 5C3XA 1JR0D 3F1ZA 1TWGB 2OEOA 4KHPL 2B39A 3NTKA 2RHQB 2A5HA 4H0LC 3CQZB 3HOXH 2NN6G 2R7ZG 3AYHB 2K5DA 5IGGA 3DMUA 3MTSA 3J80i 2JA7G 1SJHD 2HD3A 4KKUA 4DV5L 5LMNW 4POGA 4OWTB 2Q2HA 1DGSA 1EQTA 1X3PA 4IFDJ 3D8GA 1XNQL 3BYYB 5FLMH 1GVPA 1WTXA 2F52A 5IWAL 1AN8A 1MGSA 4CGYB 3HOWB 2NUCA 2L0CA 1IW7D 3PUXA 2KJXA 3MWYW 3R93A 4JI8L 5E4WC 1YNJC 1I4RA 4A3IG 3UDGA 1TWFH 4H13C 1QILA 1M90C 5A35A 3A8JE 3KDFB 3P20A 4HJ5A 1DM0B 3PF4A 2PQAB 4CDEC 1STHA 4X66Q 4HTHA 2B3GA 3A5ZB 2CFMA 2B2WC 3NTIA 3SGIA 4A93H 1DD2A 3VR3A 4JI5Q 1X65A 4X6AH 4LF6L 1YJWA 3KLSX 1ESRA 3H3VC 1E1OA 1ICFB 4P75A 4A3GB 1STNA 3H91A 4C3HB 3PIPA 3DEPA 3KF6A 4LF4L 2NN6H 3RUZA 1CKMA 3GO5A 2R7ZH 2XWJB 2NVTB 4RGOS 2JA7H 2E74C 2KQ3A 1PRTB 5IYDG 4A3KB 2ZJQA 1BVSA 3CC7A 1AZPA 5EBDA 3U4VA 4RCOA 4KKSA 1VMPA 4DV1L 1LT5D 4K8IA 4CKBA 4C3IB 4IOCA 1ICWA 4A3MG 2UUAL 3NPPA 4BWGB 2Q2TA 3QO2A 3GTPB 2KENA 1B8AA 5BR8Q 2JA5G 4H7BA 1SNDA 1LV9A 1YJ9A 5IE8A 4A3IH 1F2MA 3EJIA 1GHJA 1SYFA 3A7LA 4BY1B 1CQVA 3I4NG 2JA8H 4X64L 4ABNA 1PLFA 3C1FA 1QUQB 3MZ5A 1HUMA 3CMAA 1VQCA 1GXDC 1Y69U 4IUVA 1B3AA 2EJGC 1QVCA 5JVG3 1NUCA 5M5YH 3GQBA 2VUMG 3OPOA 3MEFA 1KNAA 5C44B 1S3OA 1TIID 2Q8RE 1PH7A 1OXXK 1Q1EA 2OQ0A 2JEAI 1KL9A 1J5EL 2C9OA 4B9XA 1O7ZA 1RDPD 2OXPA 5CC4A 1PH6A 4V190 3S17B 4K5VA 4LF7Q 3PUWA 1VQ6A 4UP7A 3E6ZX 3W5OA 3EN2A 1CA5A 2GN5A 4DK1A 1A62A 5IP9H 3S14H 4QUCA 1L1OB 2WP8J 3NUCA 2JA5H 1PFMA 4RMFA 1NE3A 4DUZQ 4JI2L 3A0JA 2H4OA 1KAAA 2B29A 4G7ZC 4B3SQ 1S5ED 5I9PA 3F8TA 1MSGA 1BCPD 4QIWE 2CQOA 3PIO3 1VQ9A 2FFKB 3BS1A 1PFBA 1IBLL 1IW7C 5CV7A 4A75A 3KLRA 2L4NA 3OW2A 4JI0Q 1O78A 2QCPX 3E9IA 5G3LD 3K5NA 4IFDH 1EQRA 3TZDA 2K32A 3G4SA 1EOTA 2KCTA 4P72A 3C1EA 5JJIA 5D3DA 5DEHA 4ZCKA 3F2CA 4DAVA 2XSCA 3OIQA 1SFOB 4DR7Q 3NBIA 1MBYA 1ILQA 1D6EC 2KHJA 4L8JA 1PH3A 5M5WH 4BBSH 4K0KL 2E2DC 4QB4A 2JA6B 3RNUA 4NMZA 4DV4L 4C3JG 3S2HB 4R4TA 1E7ZA 5M5XB 3T1HQ 3C46A 1SDFA 1JT8A 4KD3A 4XYQA 2F3IA 4JVZA 2JA9A 3IKJA 2RCNA 1VQPA 1NMGA 2PCFB 4X66L 2O5JC 1I4GA 1TT2A 2F3WA 5M3MG 4DR4L 2EE1A 1TU2B 3T13A 3MVVA 1JE5A 3MFGA 2YU9H 1KAWA 1UE6A 5ELDA 1B1ZA 1KRTA 4N8X1 4CDCC 3K7AH 2RDHA 2PZUA 1TY2A 1F2ZA 4GKKQ 4LFCL 1GUGA 4C2MB 4QUFA 3HOYB 1DZ1A 4PMBA 2A73B 1B2TA 1RF2D 2PQEA 4RGNA 5EQ0A 1VQLA 4JOIA 4NXNQ 4R4IA 3A55A 3D3RA 3DWQA 3L7ZC 2VS1A 5C4ZA 5L37A 3RN5A 3PO2G 3M4OB 2K6AA 3S1NH 3MXUA 1KD1C 1GUOA 1M8AA 1U4LA 1WD0A 3K58A 4Y52H 4JYAL 3DXJC 2ZXRA 4FXGC 1X6OA 3NEMA 1II3A 2I07B 1N34Q 1H9SB 4B3MQ 1I50B 3J80E 1K0RA 4HMIA 1HFGA 1EIHA 4L5QA 1K28A 2ZTEA 2F0OA 2F0LA 2BOSA 1Y1WG 1EWHA 4Q0FA 4A3MB 2OTJA 1EY6A 2A74C 1WCMB 3VR2A 2ASBA 3HKZG 1OXTA 3M85A 1ZKOA 3CCMA 5CBEE 3M3YH 2BDNA 4GNXB 4PQXA 3R3OA 3STBD 2E2JB 1MSHA 4DPGA 4DV0L 1HZAA 2E2IB 2NVQB 3I4NB 1HZCA 3MXGA 5KEEA 2NTSA 3QOLA 5KYIA 4XIGS 3KFUA 5C4XH 1EIYB 3GTQH 4LF7L 1ONLA 1D1IA 1PA6A 1BCPC 2EOTA 1LTRD 1O7IA 1P8LA 2FINB 3K81C 4A76A 4K14A 1N33L 1EUJA 3SE0A 5HURA 3BJUA 1B50A 4RGMA 2VUMB 5IY0A 3S15B 2K01A 3QG1A 5ELCA 4YY3Q 1YITA 5AJ3Q 3OMCA 4LW1A 4J8QA 2WKDA 3EIVA 4DK0A 2A19A 4OWXB 1HZBA 2XTIA 1MHWC 1SE3A 4R4QA 3T1YL 1Y1WH 4P2CB 1WI5A 1DOLA 4NKLA 4IQZA 1S5CD 4ZYSA 3OTOL 4APVA 2DY7A 3GTJH 2A6EC 4FF1A 1F9PA 4XT1B 1DYQA 4K2LA 4A3DB 4DV7L 5EAYA 4F7XA 4RH6A 1SE8A 2K52A 3L0OA 1PTOF 4NXML 1VQAA 4JBMA 1EYAA 2QDLA 4UHVA 1CSPA 3EROA 1CKOA 1GJXA 1TWCB 1PZJD 2L15A 4O42A 1SXTA 4OWWB 1G291 4GKKL 4RKBA 3M9BA 4RKLA 3CRKC 4JI7Q 1DOMA 4C3JB 4DUYL 4CJ0B 1XMOL 4LF5Q 5H1SE 1XPOA 4EX5A 3IAYA 3NWSA 4YWMA 2HDLA 1C0AA 1S72A 3PIP3 2ZM6Q 1N8RC 3SHLA 3TRZA 5M3MB 4MNOA 3GD7A 5ISRA 2QGQA 4H44C 3VR4A 2YV5A 5ELFA 4B08A 4FF2A 2L55A 3IL8A 2WB1B 4LUOA 2UU9Q 1SAPA 4XQQA 1B3QA 3ND8A 2F0DA 5GAHC 3I4MG 3CCEA 2JN4A 2D9UA 2KEEA 4K5WA 1I6HH 4K5XA 4HCSA 1R9TB 1XPUA 3I72A 5JPNC 1ZXTA 2A6HC 3P1HA 1IZ6A 3PO2B 1GOZA 4K2KA 3STBC 5C0XJ 1BKBA 4IFDI 2KA7A 3W2DA 4J6HA 2IY5B 1ML0D 5CV6A 1NJIC 3VYRA 1BO0A 2F0PA 4IO9A 4HMJA 4JG2A 2MGSA 4JOIC 3RLNA 1I3QH 4B3TQ 2LY7A 1B9NA 4JBJA 1HNXL 4DV2Q 4KY7A 4KJOA 2R7FA 4WORA 3CCJA 3KYHC 2Y0SG 1PZID 2I5LX 1TWGH 1Y1WB 2YTYA 3VYUA 3TQYA 3CCQA 2L12A 4EVOA 1H95A 3GTMB 3HKZB 2NVXH 4B9WA 4UP8A 2ALYB 2K05A 3CQZH 1YEZA 3U58A 1S5DD 4YY3L 3F2UA 2K5WA 2XVSA 5IGDA 5IYCH 4C1NI 5IIFA 2K28A 2E75C 2KEDA 4A3BG 3HOVB 5C5LA 1YNND 2A8VA 1XXGA 4RG1A 1X3EA 1PVOA 4GZYC 4IPGA 4GN4B 3S1QB 1TQOA 1TWAB 4C3IG 3HOWH 3L3OC 3CC2A 2X6LA 1HH2P 2QKIC 3T51B 5M3FG 2Z6KA 3J7AV 4OGQC 2WFWA 1HHVA 4GOPB 2BDOA 4EGVA 3NP8A 5IP7H 4B3RL 4J15A 1SLJA 3JAMc 5GADC 3NELA 1LACA 2GVBA 1Q46A 4YCWA 1IBKQ 4WFN3 4ZAIA 2ZTDA 2BH2A 4NB3A 3MXPA 2E2HH 4QGUA 1C48A 4GLAC 3S16B 2EY5A 3BYTB 3T16A 1H9RA 4MTKA 4FXKC 4A3GH 4C3HH 2F0FA 2V1CC 3D4RA 1XNRQ 3TS0A 1EFWA 4YHHQ 2NVTH 3DM1A 5JVH3 4JI7L 1FNVA 5M9OA 1JMCA 4IJLA 4A3KH 1SROA 1V1OA 4GKJQ 1JJCB 1GM5A 1ENCA 1NNXA 3JAML 5HGTA 4RA8A 5CORA 4C3IH 4BXXH 1VQGA 4S3SA 3E9HA 3GTPH 1JC7A 4DNRB 3H09A 2UU9L 1CHPD 1FJGQ 4KD4A 1TR5A 2LKVA 2RQXA 1G2SA 4DR3Q 3EFXD 4DV3L 4OX9Q 4BY1H 4X65Q 1GHKA 1CHQD 4K6LA 2A69D 5T1GA 2ZJRA 1Q1BA 1FNUA 4N9PA 3GP7A 3MFYA 4RWSC 1YHAA 4UPAA 5KRUA 3AFQA 4DKAC 1WTPA 3U9OA 1XX8A 1EQVA 4HIDA 5C0XH 1WYDA 1XTDA 2Z4HA 3S24A 1GUTA 5JEAG 3H15A 1FD7D 3KUPA 5FO9B 5C44H 1HFNA 5J22A 2EXDA 1V1PB 3I4MB 2NVXB 1U4PA 2JA6G 1DOKA 3HZXA 5BN3A 4B3TL 3S17H 4E6IA 1X54A 3T56B 4LF8Q 3MHBA 2K5VA 3GTLB 4OIKA 2F0IA 4DR6Q 1E3PA 2EY1A 2H1EA 3LNNA 5LMUL 4JV5Q 4EQOA 1B70B 5AFWA 4R8NA 2VB3X 1ASYA 4YIJA 2PW5A 2SOBA 1YNNC 1BUVT 1SYBA 5E1FA 2UUCL 1VQNA 5FJ8H 4QCLA 2SNMA 1X9NA 5IYBG 2Q2UA 3HOYG 1N32Q 1CUKA 3F2BA 2D5DA 1Q8IA 2AQ1B 4IURA 1T5XD 2JK8A 5CBAE 2KBNA 4KK7A 3L2PA 2K7VA 3AB9A 2VNUD 1WTQA 2QILA 2Y0SB 2IHFA 1YJNA 2EYFA 5CV8A 1SFOH 4L63B 4AYBB 1XMQL 3W1BA 2E2HB 4DK6C 1Q3LA 1Q12A 2JA6H 2XGTA 5GAGC 2RBMA 3UDXA 3KF8B 3S2HH 1HZ9A 5M5XH 1VQJA 2ZTCA 2EJFC 4CJ2C 4L5RC 4A3BB 2KHSA 1PYWD 1F9SA 3NXWA 1V43A 1A3TA 1A3UA 1D5ZC 4QY7A 4C1NK 1K73C 4JCVE 4LNQA 1YVCA 3I7FA 1SNPA 3GTOB 1VQHA 1WCMG 3HGBA 2PYKA 1BCPF 1IXRA 2EQSA 4IUNA 1JB3A 4J1MA 5IYBH 5M3FB 4G57A 5FO7B 1VQBA 4C2MH 2K4KA 3HOYH 3CCUA 1I94Q 1ZYRC 2G9HD 3MXNA 5G3LF 1Z7TA 4UP9A 4DNTB 3S2DB 2OQKA 3K6OA 3S1RB 1MKHA 1NBWA 1OXSC 1B4OA 1SNMA 4GKJL 1JJGA 5E4XA 3WWVA 3PQIA 3M4OH 1AFPA 2PNRC 3HKSA 1D5XC 1D1KA 4KHVA 3R2TA 1HNWL 2O4XA 3CHBD 2A69C 5BN4A 1K3RA 1G6PA 4BY7B 2VQEL 4GN5A 1OTCA 2F0MA 3OWEB 2OCEA 5A2QL 4DR5Q 3ONAB 2VB2X 2DJFC 3UE0A 1I50H 3OSOA 3LWUA 4OX9L 4X65L 1I6VC 4OO1I 5IYDH 2HHHQ 2NVYB 4DR2Q 1PYSB 2UUBL 1J6QA 2OF1A 2ICEC 1K83B 1A15A 4OIJA 1OXVA 3UDFA 1A3VA 1SYCA 1S4ZA 4AH6A 2RDFA 4PZ6A 1PTOB 5D65A 4A3MH 1WCMH 1ESFA 1SJED 1P16A 2EXZA 1GO3E 4I7AA 1S40A 2F03A 4OL7A 1EZ8A 4ALPA 4C56C 3CF5A 2DJGC 2E2JH 3M4YA 1SBBB 2E2IH 3SK6A 2NVQH 1X32A 3I4NH 4A3DG 3EQLC 3NE5B 2YTVA 2IW3A 3KOJA 4LF8L 3ERSX 4LUVA 2B63G 1JWSD 4DR6L 4UDUC 2B2YA 2KCNA 2AWOA 1HRJA 1IL2A 1EY7A 5LHY1 1VQ7A 2MUYA 1OXUA 2F0VA 1DONA 1IHZA 3AMUA 2VUMH 1T5EA 2Q8IB 3S15H 3D4WA 4HR7B 1LTGD 3J80c 3CXCA 2Z9HA 1NR2A 1EZ6A 3J81i 1LTID 1Q82C 1RTNA 1YHBA 4ZLTF 4N8FA 2AWNA 5JAVA 3DHQA 2MO0A 1HTLD 5HY6A 1K8OA 4X3SA 4JI5L 4DR1Q 3SVMA 1EY8A 1K9MC 3KBGA 1STEA 1YBYA 1BBWA 1U9RA 2MPMA 5GROA 3K57A 2WB1G 5CYUA 5EJWA 1PFSA 1RJTA 3CCSA 4XXEA 1VQKA 3J81j 2A68D 3I8ZA 1BOSA 1M4VA 4A3DH 3CP0A 1HQMC 3F2DA 4K8JA 1CSQA 3J80L 1G51A 4A3LG 4MTNA 1AW7A 2B8FA 2FMMA 4BA1I 3DUZA 2F0GA 4DK3C 1SYEA 4U68A 3M4QA 1EY9A 4DGZA 4XYOA 4NP5A 1QE6A 1TWCH 2MO1A 5I4DA 4LF9Q 3PO3G 4ZK9B 3RZDB 5C0XI 2ID0A 3V05A 1PH8A 2NYZD 1HR0Q 5BR8L 1UE1A 2DN8A 2QEXA 4C3JH 1QZGA 2BA1A 3VYTA 2AHOB 1CKNB 1C9OA 1G8ZD 4ZQ3A 3QR8A 2AKWB 2LSSA 5LL6X 5M3MH 2K33A 4IUQA 5KNDA 1I4QA 3I73A 3I4OA 1IYVA 3R8BA 1SRUA 2LXKA 1SR3A 3KDFA 3I70A 5JJLA 2PQAA 4DR5L 2BCOA 2B2UA 4A3CG 1SNOA 3FPUB 2FHTA 3OWFA 1R9TH 4G7OC 3H0GG 3J7YW 3I2ZA 2F4VQ 1CM9A 2EYLA 2F0JA 2HHHL 3A54A 1XPRA 4DR2L 3HOVG 3PO2H 1L0XB 3SR1A 2L9HA 4RGTA 1NMFA 4DAYB 1U5KA 1J8IA 3K80C 4QF4A 1KDAA 4KN4C 3FEWX 3MC0B 2MFIA 1EEID 1N36Q 2DNCA 1SMYD 4DUZL 2C5CA 4HCEA 2J7ZA 3PUVA 3AQQA 2XWBB 2WKCA 5CMDA 5IGFA 3CU7A 1VF7A 4B3SL 2MQHA 3J7ZC 4LFBQ 2NN6I 2PI2A 4GS3A 1Z9FA 1Q7YC 1IBMQ 4JI0L 3S1MB 1KC8C 2R6GA 4Y7NB 5I6WA 2KOLA 2NB0A 3HP3A 3X3MA 3GTMH 2Q8TA 1K3BC 4DR7L 1QWYA 2VQFQ 2E5LQ 3HKZE 3TP6A 4JI6Q 2NZOA 3CKIB 5D3IB 4A3EG 3PUZA 1QUQA 3PMFA 2SNSA 1I4HA 2MHVA 2UXCQ 4XQJA 3TMEA 2EYMA 3T1HL 1VQ5A 4LJZC 3SK8A 4FYDA 5LMNQ 2JJQA 5LL6S 3HOVH 3CRLC 1WTHA 4BA2I 1STAA 5EKKA 3W3AA 4MHEA 3SDZA 2B63B 1QNUA 2A68C 4XT3B 5T1IA 3S1QH 4BBRG 1TWAH 5JJKA 2XRSD 2D0OA 2K5QA 3A7AB 2N55A 1HA6A 1PH1A 1PHJA 5K36G 1BDOA 4KN7C 2K03A 4PNYA 1WTRA 1VQEA 3TN2A 4PZ8A 1UEAB 1ENAA 1L0YB 1PRTD 5ELNA 2B2YC 2JE6I 3I4LA 1L1OA 1PDQA 5FLXE 2M00A 3CCVA 2IX1A 4NXNL 1G91A 3TP7A 1JOQA 1RIPA 4RCNA 4TQUS 3QJYA 1NTGA 4RFBA 3W1GA 1K8AC 5CV4A 4LF9L 5J1ZA 3CCRA 3S16H 1TWHB 1AP0A 3FKIG 2V4DA 3MAQA 4EQNA 2CQAA 3TDQA 3LX0A 4OEMB 1CQFA 2TSSA 2F0TA 1N34L 3RD4A 3KK7A 4B3ML 2EYOA 2GA4B 3GTGB 1KIXA 1EYGA 3LGJA 1STGA 1EFID 5EBCA 1UE5A 1LUZA 4R8IA 4PV1C 3PSIA 2D2CC 3OOCA 1GD7A 3PO3B 1KHIA 5EPLA 1JE4A 1QCBD 1Z6HA 2K5NA 3ND9A 3BZDB 4X62Q 4ULLA 1SE4A 3TBIB 2I0QA 1EWIA 2Z0SA 3U9SA 3J81E 2PO4A 1SMXA 2R92G 4R4OA 2I5HA 3FP9A 4F88A 3HRZC 1BNZA 2F4VL 4Q5VA 1A2TA 2M9VA 2RCFA 3JC66 1QVFA 1SMYC 3AU7A 1JOOA 2HIVA 1UE7A 1Q81C 2VY3A 4KHPQ 3PIOA 4DU9A 4HIKA 2B2WA 1WFQA 1IYJB 1TS5A 3A8IE 4UAIA 4AYBG 1H9MA 3SK4A 4CDFC 4JW0A 3I4MH 3D4DA 2AQ3B 5FO8B 3D0FA 1KTKA 5CV5A 3I90A 4A3JG 5E3FA 1KABA 1BCPB 1O7LA 5AJ3L 4DXGA 4DV5Q 2NBFA 3H0GB 1EYDA 4L5SA 5C3EB 3GTLH 3GV6A 4ODGA 2K1BA 1KLGD 5IGBA 1Y1VB 1K0SA 2CCZA 4P73A 2R93G 3OHXC 3PF5A 1E2WA 2VL6A 2BA0A 5JEAJ 5JPMC 2WAQG 2B2UC 4U673 1H9SA 4JI8Q 1A6XA 5ELOA 3BVGA 2E5LL 3WOFA 2Z8LA 2UXBQ 3VR6A 2RA4A 2AUJD 2CHBD 2KCMA 3V96A 2F0UA 1HA5A 4LK1C 2AUKA 4AQYQ 1BF4A 4HJAA 4JI3Q 2MJ8A 4LF6Q 4PMCA 2F0QA 2E8GA 1XWEA 2DGYA 1AE3A 2J0TD 5DAUA 1PRTC 4GNXA 2Y0SE 4YWLA 1MJEA 1VQ8A 3HOZG 2NZ1D 1ASZA 1IKMA 1LTSD 4BY7G 3ULLA 1F9RA 4A3EB 2BH8A 5J3BA 4O0AA 2VXWA 4M8AA 1W6KA 2A1AA 1EEFD 5KGUA 4CKEA 2L11A 2HQEA 1PH4A 4LF5L 4A3BH 4MN3A 3I56A 1WVLA 2AMCB 4DV1Q 3BZCA 3O13A 4FVMA 4JI1Q 3T4AC 4BS9A 5KNBA 1I4XA 3VDYA 2ZM6L 3J7AF 2QA4A 3ITPA 4QL5A 1EOVA 1SN8A 4BBRB 5NUCA 2PI2E 3G6JB 1EYCA 3DWAA 2KHIA 3D6CA 1RHPA 2EYHA 4OHJA 3GTOH 1LTAD 2LFNA 2DUDA 1B9MA 4WRDA 2JP1A 3GV3A 5ELBA 5M3FH 2XN9C 2D62A 4X64Q 4I65A 4RAUC 3TSSA 3S2DH 3NSWA 3Q23A 3CD6A 3NENA 3S1RH 1YIJA 1AH9A 3J7A5 1N9WA 3A74A 2H5XA 1RTOA 2DNEA 3ZYYX 1D7QA 1STBA 2WACA 5C4JB 2NTTA 5IT9E 2C35B 2Z4IA 3FKIB 4G7HC 1PV4A 4BY7H 4HEDA 4XTCS 1J5EQ 4LFAQ 4R4CA 2I46A 1HXYD 1L1OC 4QJFA 1YI2A 2J4XA 2PW7A 2EJMA 4KLKA 2QEJC 5I6YA 2NVYH 1JWUD 4FO2A 1Y8OB 4DV2L 4Z9CB 1WTOA 3RR5A 1F2LA 1K83H 4A93G 3K0XA 3E3XA 2RKSA 1PTOH 4DAMA 4ZUIA 1YZ6A 3M4PA 1EY5A 4JI2Q 1XTCD 4ZRZA 3WDNA 1SEBD 1JWMD 3RLFA 1MD2D 3MEHA 4PMWA 4EQ5A 3D31A 4A4IA 1IBLQ 2R92B 5FKAC 3OYYA 3KLWA 2CH4A 3BU2A 1A63A 2ZJPA 4KHZA 4CBVA 1UEBA 2EY6A 4FXDA 1CFMA 4KTAA 2IWHA 3BZKA 2F0NA 2Q2IA 5JEAH 1V9PA 4K0KQ 4KI0A 1LM0A 1LTLA 4O2DA 1FGUA 2I5MX 3RMHA 4DV4Q 1V1QA 4WJ3M 4HAEA 4HJ8A 5C5MA 1PH9A 2UXBL 3E5SA 4PZ7A 4A3JB 1SYGA 2ZT9C 1I5FA 2O2LD 4DXFA 3RZOB 1MIUA 2JA8G 4A3FB 3Q8DA 2G5DA 5DNFA 1W3SA 4DR4Q 4AQYL 3I3CA 4JI3L 1EIFA 3VYSA 3HOUB 5GAEC 5DM73 1TKWB 2PNHA 1TS2A 4P74A 2R93B 3RLOA 2ZXOA 2PMZB 3IFTA 1UUPA 1LT3D 1IBKL 2WAQB 4DNIA 4LFCQ 4JPBW 3H94A 1SSOA 3P7JA 2RVLA 1JICA 1PXUA 3NBHB 2K04A 1Y8PB 4DAPA 1XNRL 4YHHL 1C8CA 1U4MA 1A8VA 1VMCA 3LWEA 5EPKA 3ICEA 2QF7A 4FNFA 3H3VH 4JK1C 1QOHA 3QWNA 2JYOA 1CK1A 3ERQA 3K0YA 3K59A 4JI1L 3QB3A 5IP9G 1D8LA 3KLSA 1O7YA 1UNSA 3NQIA 1DCZA 3RZDH 2Z6KC 3HOZB 4JYAQ 3DM3A 1QG7A 3NWTA 1HNZQ 1FJGL 2KECA 4XDXA 4DR3L 2EZVA 3TP8A 3CW2C 3E0JA 2EVBA 4GNXC 3C2PA 2F0HA 4IFDG 1R4QB 2R7DA 1B44D 2NZHA 3GTKB 3ER0A 3PUYA 3Q24A 4FP5D 1HCZA 4PG3A 1HPCA 2R3ZA 3T53B 1F77A 3KJPA 1YHQA 4GOPA 1MI2A 4I7ZC 5E7NA 1KQSA 4BBSG 1QVGA 2IPKD 4DV0Q 4LFAL 3HOXB 1D2BA 1U4RA 3G71A 3BDCA 2EPBA 4IUPA 3K5LA 1WJJA 1Q86C 2VZAA 4JBKA 1SYDA 1SE2A 3I55A 4JBWA 1BBXC
chains in the Genus database with same CATH topology
1PZKD 1AZQA 2KUMA 1O80A 3BG3A 4KKTA 2WINB 1S5BD 2CW0D 3M7NA 3Q22A 1R4PB 1LABA 1VDZA 2N88A 4CHTB 1FR3A 2F0SA 5A2QE 2EYJA 3HG9A 4LMQD 4IALA 2KCCA 4MIUA 1LTTD 1TWFB 3P75A 2R61A 1Z47A 2LS01 2HUGA 4A93B 2YYZA 3VR5A 4TSSA 4NW2A 1EY4A 3BDLA 2HDMA 2IJ0A 5C6AA 1IYUA 1ET9A 3BVZA 4ILWA 2R7ZB 5FOBB 1LO5D 1DJRD 1EIGA 2JA7B 2IT1A 5CGKA 2ENBA 4M1UB 3VA5A 1I4PA 3QOJA 1QJOA 2L1BA 5CV9A 2A6ED 1W6JA 2EY2A 2SEBD 1V1PA 2HCIA 2F0WA 1ENFA 4CJ1B 2B2TA 3IFDA 1OO9B 2XRQD 1WTWA 1KDCA 4ID6A 3OIPA 4A3IB 2RSOA 1B53A 3Q6SA 4IN3A 2JA8B 1FGBD 2OT2A 5EPJA 1E2VA 2QDBA 2B2VA 4KY5A 1HTPA 3I91A 4DF7A 1JORA 5DM63 5M5YB 2WV6D 3HEJA 5I2YA 3FVQA 2JXMB 4LAAA 1SNCA 2LMCB 1X3QA 1NCVA 4IUUA 3DWPA 3M7GA 3S14B 1G6ZA 1F9QA 3FDTA 2PPBC 3KF8A 2JA5B 5FK9C 1JOKA 2A6HD 2ICIA 4X3UA 2BE5D 5D14A 4F87A 1PRTF 5BN5A 4K6DA 4KJNA 4QIWB 4HN7A 2CW0C 5JOBA 3WOEA 1S5FD 1ILPA 1LT6D 1H9KA 1CZGA 3SEBA 1H9JA 3R2IA 2AQ2B 4EQPA 2Z1CA 1LT4D 1CZWA 3NBHA 2RSNA 1Y8NB 1C4QA 1TS3A 1SNQA 2TMPA 1D5MC 4ZKCB 4G4KA 5M5WB 4BBSB 5EKIA 1A2UA 3BDOA 3EA6A 2JSOA 2XIWA 1CTMA 3FPPA 5CR3A 1GUWA 5FLXL 1E2ZA 1VF5C 1PMRA 3FMCA 3Q0AA 2F3VA 1RCVD 2F4IA 4HSVA 2YU9B 1NSNS 4X3TA 1ET6A 1F2YA 3QIAA 2ZXPA 3TP5A 1Q90A 1FNWA 3HS0C 3V2TA 3K7AB 4KMUC 5ELEA 4XQNA 5IOCA 1HQRD 4KY6A 5KIXA 4HSPA 3A56A 4TKOB 4O1NA 1CI3M 5KNCA 3NK9A 1JCKB 2NWGA 3PV0A 3A8KE 4CKCA 5K5PA 3S1NB 2O5IC 2JEBI 4ZUJA 3DEOA 4QMGA 5IGEA 4DFAA 2XNAC 2PZWA 2F0EA 1DXMA 3C3LA 5JJZA 2SDFA 3SK5A 3J81L 3URYA 2M2LA 2IX0A 1HUNA 5F2DA 2PZTA 3FRPB 5C4HA 4IZ8A 1BQQT 1LTBD 1AEXA 1UAPA 2FMCA 4V0BA 4FF4A 1IL8A 2HCCA 1NAPA 2CVRA 1FYCA 5K36H 3X3NA 1BXTA 3M3YB 2G9DA 2E76C 4OO1G 2L5TA 2RDGA 3MA2B 3GTQB 5C4XB 2BE5C 1QB5D 1WTVA 1PTOD 2B2TC 4NDXA 2WIIB 1KNEA 5IODA 4IUTA 1BR9A 5EGTA 5EKLA 1JQYD 2IL8A 3OMGA 1GUSA 4X3KA 1IKLA 4KV6A 2B2VC 5TSSA 1QNKA 3KBXA 5I9OA 1EL0A 2FJ2A 2KVMA 1VCIA 4ME5A 1WD1A 2EYPA 4RHSA 4C3HG 1XYIA 3GTJB 3N52A 3NHHA 1EY0A 4OO1H 1CA6A 1E0BA 1TVXA 3N6RA 3D6WA 2F1MA 3K5MA 4DN4M 4N9TA 3BVMA 2DY8A 3H6MA 2X6GA 1YNJD 4RHRA 5KYLA 3SXHA 4WJWA 3VA7A 2IX3A 1KDBA 4FF3A 4ZKBB 3TZUA 4L6TB 1EU3A 1NR4A 1V8QA 4DA2A 4DAYA 2EDGA 1J9OA 1K8MA 1RODA 1CT1D 2MP1A 2F0KA 5C0XG 3OW7A 5COYA 3G7LA 5IT9L 3NQTA 1G2TA 3UI2A 3NTHA 5J39A 1ZEQX 1I6HB 1GUNA 2X69A 5I2XA 1PFNA 1TS4A 4TRDA 1EWCA 1TY0A 1ZYRD 5IGCA 3EVQA 2B8GA 1RKNA 1STYA 4F8MA 1PTOC 1LLRD 1RD9D 1I3QB 4R9WA 3K5OA 3S9WA 1KLUD 1EU4A 3JAME 5C3WA 3L9AX 5C3XA 1JR0D 1TWGB 2OEOA 2B39A 3NTKA 2A5HA 4H0LC 3CQZB 2NN6G 2K5DA 5IGGA 3DMUA 3MTSA 1SJHD 4KKUA 4IFDJ 1EQTA 1X3PA 3D8GA 3BYYB 1WTXA 1AN8A 1MGSA 4CGYB 3HOWB 2NUCA 2L0CA 1IW7D 3PUXA 2KJXA 3MWYW 3R93A 5E4WC 1YNJC 1I4RA 4H13C 1QILA 5A35A 3A8JE 3P20A 1DM0B 1STHA 4HTHA 2B2WC 3NTIA 1DD2A 3VR3A 3KLSX 1ESRA 3H3VC 4A3GB 1STNA 3H91A 4C3HB 3DEPA 2NN6H 3RUZA 3GO5A 2XWJB 2NVTB 4RGOS 2E74C 2KQ3A 1PRTB 4A3KB 1AZPA 5EBDA 4RCOA 4KKSA 1VMPA 1LT5D 4K8IA 4CKBA 4C3IB 1ICWA 3NPPA 4BWGB 3GTPB 3QO2A 4H7BA 1SNDA 1LV9A 1F2MA 3EJIA 1GHJA 1SYFA 3A7LA 4BY1B 1CQVA 4ABNA 1PLFA 3C1FA 3MZ5A 1HUMA 1GXDC 1Y69U 4IUVA 1B3AA 2EJGC 5JVG3 1NUCA 3GQBA 3OPOA 1KNAA 5C44B 2Q8RE 1TIID 1OXXK 1Q1EA 2JEAI 2C9OA 4B9XA 1O7ZA 1RDPD 2OXPA 5CC4A 4V190 3S17B 4K5VA 3PUWA 3E6ZX 1CA5A 4DK1A 4QUCA 2WP8J 3NUCA 1PFMA 2H4OA 1KAAA 4G7ZC 1S5ED 5I9PA 1MSGA 1BCPD 3PIO3 2FFKB 3BS1A 1PFBA 1IW7C 5CV7A 3KLRA 2L4NA 1O78A 2QCPX 3K5NA 5G3LD 4IFDH 3TZDA 2K32A 1EOTA 3C1EA 5D3DA 5DEHA 4DAVA 2XSCA 3OIQA 1SFOB 3NBIA 1MBYA 1ILQA 1D6EC 4L8JA 2E2DC 4QB4A 2JA6B 4NMZA 4C3JG 3S2HB 5M5XB 3C46A 1SDFA 4KD3A 4XYQA 3IKJA 2PCFB 2O5JC 1I4GA 1TT2A 2F3WA 2EE1A 1TU2B 3T13A 3MVVA 3MFGA 5ELDA 1B1ZA 2RDHA 2PZUA 1TY2A 1F2ZA 1GUGA 4C2MB 4QUFA 3HOYB 1DZ1A 4PMBA 2A73B 1B2TA 1RF2D 2PQEA 4RGNA 5EQ0A 5C4ZA 3A55A 3D3RA 3DWQA 3L7ZC 3M4OB 2K6AA 3MXUA 1GUOA 1M8AA 1U4LA 1WD0A 3K58A 3DXJC 2ZXRA 4FXGC 1II3A 2I07B 1H9SB 1I50B 3J80E 4HMIA 1HFGA 1EIHA 2F0OA 2F0LA 2BOSA 1EWHA 4Q0FA 4A3MB 1EY6A 2A74C 1WCMB 3VR2A 1OXTA 3M85A 1ZKOA 5CBEE 2BDNA 4PQXA 3R3OA 2E2JB 1MSHA 2E2IB 2NVQB 3I4NB 3MXGA 5KEEA 2NTSA 3QOLA 5KYIA 4XIGS 1ONLA 1D1IA 1BCPC 2EOTA 1LTRD 2FINB 4K14A 3SE0A 5HURA 1B50A 4RGMA 2VUMB 3S15B 2K01A 3QG1A 5ELCA 3OMCA 4J8QA 2WKDA 4DK0A 1SE3A 4P2CB 1DOLA 4NKLA 4IQZA 1S5CD 4ZYSA 2DY7A 2A6EC 4FF1A 1F9PA 4XT1B 1DYQA 4K2LA 4A3DB 4F7XA 4RH6A 1PTOF 1EYAA 3EROA 1GJXA 1TWCB 1PZJD 4O42A 1SXTA 1G291 4RKBA 4RKLA 3CRKC 1DOMA 4C3JB 4CJ0B 3IAYA 3NWSA 2HDLA 3PIP3 3SHLA 5M3MB 3GD7A 5ISRA 4H44C 3VR4A 5ELFA 4FF2A 4B08A 2L55A 3IL8A 2WB1B 1SAPA 4XQQA 3ND8A 2F0DA 2D9UA 2KEEA 4K5WA 4K5XA 4HCSA 1R9TB 3I72A 5JPNC 1ZXTA 2A6HC 3P1HA 3PO2B 1GOZA 4K2KA 5C0XJ 4IFDI 2KA7A 3W2DA 4J6HA 1ML0D 5CV6A 3VYRA 1BO0A 2F0PA 4HMJA 2MGSA 2LY7A 1B9NA 4KY7A 4KJOA 4WORA 1PZID 1Y1WB 3VYUA 2L12A 4EVOA 3GTMB 3HKZB 4B9WA 2K05A 1S5DD 3F2UA 2K5WA 2XVSA 5IGDA 4C1NI 5IIFA 2K28A 2E75C 2KEDA 3HOVB 5C5LA 1YNND 1XXGA 4GZYC 3S1QB 1TQOA 1TWAB 4C3IG 3L3OC 2X6LA 2QKIC 3T51B 3J7AV 4OGQC 1HHVA 2BDOA 4EGVA 3NP8A 1LACA 4WFN3 4ZAIA 3MXPA 1C48A 3S16B 2EY5A 3BYTB 3T16A 1H9RA 4FXKC 2F0FA 3D4RA 3DM1A 5JVH3 1FNVA 5M9OA 1V1OA 1ENCA 3JAML 5HGTA 4RA8A 5CORA 4S3SA 1JC7A 4DNRB 3H09A 1CHPD 4KD4A 1TR5A 2LKVA 2RQXA 1G2SA 3EFXD 1GHKA 1CHQD 4K6LA 2A69D 5T1GA 1Q1BA 1FNUA 4N9PA 3GP7A 3MFYA 4RWSC 5KRUA 1WTPA 3U9OA 1XX8A 1EQVA 5C0XH 2Z4HA 5JEAG 1GUTA 1FD7D 3KUPA 5FO9B 1HFNA 5J22A 1V1PB 3I4MB 2NVXB 1U4PA 1DOKA 3HZXA 5BN3A 4E6IA 3T56B 3MHBA 3GTLB 4OIKA 2F0IA 2H1EA 2EY1A 3LNNA 4EQOA 5AFWA 4R8NA 2VB3X 4YIJA 2PW5A 2SOBA 1YNNC 1BUVT 1SYBA 5E1FA 4QCLA 2SNMA 2D5DA 1Q8IA 2AQ1B 4IURA 1T5XD 5CBAE 4KK7A 2K7VA 3AB9A 2VNUD 1WTQA 2QILA 2Y0SB 2EYFA 5CV8A 4L63B 4AYBB 2E2HB 1Q3LA 1Q12A 2RBMA 2EJFC 4CJ2C 4A3BB 2KHSA 1PYWD 1F9SA 3NXWA 1V43A 1A3TA 1A3UA 1D5ZC 4C1NK 1SNPA 3GTOB 3HGBA 2PYKA 1BCPF 4IUNA 1JB3A 4J1MA 5M3FB 4G57A 5FO7B 1ZYRC 2G9HD 3MXNA 5G3LF 1Z7TA 4DNTB 3S2DB 3K6OA 3S1RB 1OXSC 1B4OA 1SNMA 5E4XA 1AFPA 2PNRC 1D5XC 1D1KA 4KHVA 3R2TA 2O4XA 3CHBD 2A69C 5BN4A 4BY7B 2F0MA 3OWEB 5A2QL 3ONAB 2VB2X 3OSOA 3LWUA 1I6VC 4OO1I 2NVYB 2OF1A 2ICEC 1K83B 1A15A 4OIJA 1OXVA 1A3VA 1SYCA 1S4ZA 2RDFA 1PTOB 5D65A 1ESFA 1SJED 2EXZA 2F03A 4OL7A 1EZ8A 4C56C 3M4YA 1SBBB 3SK6A 1X32A 3EQLC 3NE5B 2IW3A 1JWSD 4UDUC 2B2YA 2KCNA 2AWOA 1HRJA 1EY7A 5LHY1 2MUYA 1OXUA 2F0VA 1DONA 1IHZA 3AMUA 1T5EA 2Q8IB 3D4WA 4HR7B 1LTGD 1NR2A 1EZ6A 1LTID 1RTNA 4ZLTF 2AWNA 5JAVA 3DHQA 1HTLD 1K8OA 4X3SA 3SVMA 1EY8A 3KBGA 1STEA 1U9RA 2MPMA 3K57A 5EJWA 5CYUA 1RJTA 4XXEA 2A68D 3I8ZA 1BOSA 1M4VA 1HQMC 4K8JA 3J80L 1AW7A 2B8FA 2FMMA 4BA1I 3DUZA 2F0GA 1SYEA 4U68A 1EY9A 4DGZA 4XYOA 4NP5A 1QE6A 5I4DA 4ZK9B 3RZDB 5C0XI 2ID0A 3V05A 2NYZD 2DN8A 2BA1A 3VYTA 1G8ZD 4ZQ3A 5LL6X 2K33A 4IUQA 5KNDA 1I4QA 3I73A 1IYVA 3R8BA 3I70A 2BCOA 2B2UA 1SNOA 3FPUB 2FHTA 3OWFA 4G7OC 3J7YW 1CM9A 2EYLA 2F0JA 3A54A 1L0XB 3SR1A 2L9HA 4RGTA 1J8IA 4QF4A 1KDAA 4KN4C 3FEWX 3MC0B 1EEID 2DNCA 1SMYD 2C5CA 4HCEA 2J7ZA 3PUVA 2XWBB 2WKCA 5CMDA 5IGFA 3CU7A 1VF7A 2NN6I 3S1MB 2R6GA 4Y7NB 5I6WA 2KOLA 2NB0A 3HP3A 3X3MA 2Q8TA 1QWYA 3TP6A 3CKIB 5D3IB 3PUZA 3PMFA 2SNSA 1I4HA 2MHVA 4XQJA 3TMEA 2EYMA 4FYDA 4LJZC 3SK8A 5LL6S 3CRLC 4BA2I 1STAA 5EKKA 3W3AA 4MHEA 3SDZA 2B63B 1QNUA 2A68C 4XT3B 5T1IA 2XRSD 2K5QA 3A7AB 2N55A 1HA6A 5K36G 1BDOA 4KN7C 2K03A 4PNYA 1WTRA 3TN2A 1UEAB 1ENAA 1L0YB 1PRTD 2B2YC 2JE6I 3I4LA 5FLXE 1PDQA 2M00A 2IX1A 1G91A 3TP7A 1JOQA 4RCNA 4TQUS 3QJYA 4RFBA 5CV4A 5J1ZA 1TWHB 1AP0A 2V4DA 3MAQA 4EQNA 2CQAA 3TDQA 3LX0A 1CQFA 2TSSA 2F0TA 3RD4A 3KK7A 2EYOA 2GA4B 3GTGB 1STGA 1EFID 5EBCA 4R8IA 4PV1C 2D2CC 3OOCA 3PO3B 5EPLA 1JE4A 1QCBD 1Z6HA 3ND9A 3BZDB 4ULLA 1SE4A 3TBIB 3U9SA 3J81E 2PO4A 4F88A 3HRZC 1BNZA 4Q5VA 1A2TA 2M9VA 1SMYC 3AU7A 1JOOA 4DU9A 2B2WA 1TS5A 3A8IE 4UAIA 1H9MA 3SK4A 3D4DA 2AQ3B 5FO8B 1KTKA 5CV5A 3I90A 5E3FA 1KABA 1BCPB 1O7LA 4DXGA 2NBFA 3H0GB 1EYDA 5C3EB 3GV6A 4ODGA 2K1BA 1KLGD 5IGBA 1Y1VB 3OHXC 1E2WA 2BA0A 5JEAJ 5JPMC 2B2UC 4U673 1H9SA 1A6XA 3BVGA 3WOFA 2Z8LA 3VR6A 2RA4A 2AUJD 2CHBD 3V96A 2F0UA 1HA5A 4LK1C 2AUKA 1BF4A 2MJ8A 4PMCA 2F0QA 1XWEA 5DAUA 2J0TD 1PRTC 2NZ1D 1IKMA 1LTSD 1F9RA 4A3EB 2VXWA 4M8AA 1W6KA 5KGUA 1EEFD 4CKEA 2L11A 2HQEA 4MN3A 1WVLA 3O13A 4FVMA 3T4AC 4BS9A 5KNBA 1I4XA 3J7AF 3ITPA 4BBRB 5NUCA 3G6JB 1EYCA 3DWAA 3D6CA 1RHPA 2EYHA 4OHJA 1LTAD 2LFNA 1B9MA 4WRDA 2JP1A 3GV3A 5ELBA 2XN9C 2D62A 4I65A 4RAUC 3TSSA 3NSWA 3Q23A 1RTOA 2DNEA 3ZYYX 1STBA 2WACA 5C4JB 2NTTA 5IT9E 2Z4IA 3FKIB 4G7HC 4HEDA 4XTCS 2I46A 1HXYD 2J4XA 2PW7A 2EJMA 2QEJC 5I6YA 4FO2A 1JWUD 1Y8OB 4Z9CB 1WTOA 1F2LA 2RKSA 1PTOH 4ZUIA 1EY5A 1XTCD 4ZRZA 3WDNA 1SEBD 1JWMD 3RLFA 1MD2D 3MEHA 4PMWA 3D31A 2R92B 5FKAC 4KHZA 4CBVA 2EY6A 4FXDA 1CFMA 4KTAA 2IWHA 2F0NA 5JEAH 4KI0A 3RMHA 4HAEA 5C5MA 3E5SA 4A3JB 1SYGA 2ZT9C 2O2LD 4DXFA 3RZOB 4A3FB 5DNFA 3I3CA 3VYSA 3HOUB 5DM73 1TKWB 1TS2A 2R93B 2ZXOA 2PMZB 3IFTA 1UUPA 1LT3D 2WAQB 3H94A 1SSOA 3P7JA 2RVLA 1JICA 1PXUA 2K04A 1Y8PB 4DAPA 1C8CA 1U4MA 1VMCA 5EPKA 3LWEA 2QF7A 4FNFA 4JK1C 1QOHA 3QWNA 2JYOA 1CK1A 3ERQA 3K0YA 3K59A 3QB3A 3KLSA 1O7YA 1UNSA 3NQIA 1DCZA 3HOZB 1QG7A 3NWTA 2KECA 4XDXA 2EZVA 3TP8A 3E0JA 2EVBA 3C2PA 2F0HA 4IFDG 1R4QB 1B44D 3GTKB 3PUYA 3Q24A 4FP5D 1HCZA 1HPCA 2R3ZA 3T53B 1F77A 1MI2A 4I7ZC 2IPKD 3HOXB 1D2BA 1U4RA 3BDCA 2EPBA 4IUPA 3K5LA 1SYDA 1SE2A 4JBWA 1BBXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQZ A;  5JEA H;  2F1M A;  2DNC A;  1Y69 U;  4H0L C;  4KI0 A;  4PV1 C;  2LMC B;  2D2C C;  3PUV A;  3OOC A;  2NN6 G;  2EJG C;  3HGB A;  3BG3 A;  1GHK A;  1VF7 A;  4KKT A;  1DXM A;  3L7Z C;  3M7N A;  2A6E C;  1Z6H A;  2A69 D;  1K8O A;  1Q1B A;  2NN6 I;  1LAB A;  1VDZ A;  3GQB A;  3MFY A;  3ND9 A;  2ZT9 C;  3OPO A;  5KNB A;  4KKU A;  1FR3 A;  1OXX K;  1Q1E A;  3MXU A;  3VA7 A;  2JEA I;  1ZYR C;  3U9S A;  3TZU A;  1Z7T A;  1GUO A;  4DNT B;  5C0X H;  2KCC A;  2R6G A;  1B9M A;  5JEA G;  1GUT A;  1OXS C;  1TKW B;  2PPB C;  2A68 D;  2A6H D;  2PNR C;  3DXJ C;  2BE5 D;  2E75 C;  3PUW A;  1HQM C;  1SMY C;  1GJX A;  3IFT A;  5BN5 A;  2D62 A;  1V8Q A;  1IW7 D;  3PUX A;  1H9S B;  4DK1 A;  2B8F A;  4GZY C;  2CW0 C;  2EDG A;  4BA1 I;  2A69 C;  2YYZ A;  1YNJ C;  3H94 A;  3PUZ A;  3VR5 A;  5BN4 A;  5BN3 A;  1G29 1;  1K8M A;  1Y8P B;  3A8I E;  1H9K A;  1FYC A;  5K36 H;  4H13 C;  3CRK C;  3T56 B;  1H9M A;  5A35 A;  3A8J E;  2DNE A;  3P20 A;  3OW7 A;  1H9J A;  5C0X G;  4LJZ C;  1IYU A;  2E76 C;  4G7Z C;  2QF7 A;  3CRL C;  3LNN A;  2L5T A;  4BA2 I;  4OO1 G;  1EWH A;  3W3A A;  3LWU A;  3SDZ A;  3T51 B;  1I6V C;  1DD2 A;  1O7L A;  2A68 C;  4JK1 C;  4OGQ C;  3VR2 A;  1Y8N B;  3VR3 A;  2BE5 C;  1OXT A;  3M85 A;  2BDO A;  1ZKO A;  4G7H C;  4XTC S;  3GD7 A;  2DN8 A;  1YNN C;  1IW7 C;  2IT1 A;  1OXV A;  4H44 C;  3KLR A;  1GUN A;  3A7A B;  1O78 A;  3VR4 A;  2BA1 A;  1DCZ A;  2EJM A;  3BDO A;  4IFD H;  2K32 A;  1QJO A;  5K36 G;  1BDO A;  2NN6 H;  2A6E D;  1E2W A;  1LAC A;  2BA0 A;  1CTM A;  3ND8 A;  3FPP A;  4KN7 C;  4XIG S;  1Y8O B;  2K33 A;  2D5D A;  5KND A;  1H9S A;  2E74 C;  1ONL A;  4L8J A;  1A6X A;  3I73 A;  2JE6 I;  3I4L A;  1H9R A;  1E2Z A;  1VF5 C;  1PMR A;  3M4Y A;  1GUS A;  1IYV A;  3FMC A;  3VR6 A;  3I72 A;  3D4R A;  2K7V A;  3AB9 A;  3SE0 A;  2B8G A;  2AUJ D;  2A6H C;  4KKS A;  3EQL C;  2EVB A;  4RCN A;  4TQU S;  3QJY A;  3NE5 B;  3WDN A;  4IFD G;  4LK1 C;  2AUK A;  3QIA A;  3RLF A;  1Q90 A;  3IKJ A;  3QG1 A;  2PCF B;  3D31 A;  3PUY A;  2KA7 A;  4KMU C;  2O5J C;  1HCZ A;  1Q12 A;  4G7O C;  1HPC A;  2AWO A;  3T53 B;  2V4D A;  1TU2 B;  4I7Z C;  1OXU A;  4DK0 A;  1VCI A;  4TKO B;  1E2V A;  1HTP A;  1CI3 M;  4KHZ A;  5KNC A;  3PV0 A;  1T5E A;  1GHJ A;  3A8K E;  2Q8I B;  3A7L A;  2EJF C;  1V43 A;  4OO1 H;  1B9N A;  1CFM A;  4HR7 B;  4DNR B;  4KN4 C;  2O5I C;  1GUG A;  4JBW A;  2JXM B;  3N6R A;  2JEB I; 
#chains in the Genus database with same CATH topology
 4HJ7 A;  1NY4 A;  1PZK D;  2K75 A;  4ME3 A;  1AZQ A;  2KUM A;  4JI4 Q;  1O80 A;  1N33 Q;  3BG3 A;  4KKT A;  5GQO A;  2WIN B;  1S5B D;  2CW0 D;  3M7N A;  4JV5 L;  3Q22 A;  1R4P B;  1LAB A;  1VDZ A;  4HIO A;  2N88 A;  4CHT B;  1FR3 A;  2JQO A;  1FVI A;  2F0S A;  5A2Q E;  2EYJ A;  2K50 A;  3HG9 A;  4LMQ D;  4IAL A;  2KCC A;  4MIU A;  1LTT D;  4IOA A;  1TWF B;  1JB7 A;  3P75 A;  3G48 A;  1PH5 A;  1N32 L;  2R61 A;  1Z47 A;  2MNA A;  1B7Y B;  2LS0 1;  2HUG A;  3T1Y Q;  4A93 B;  2YYZ A;  3VR5 A;  4OON A;  3S1M H;  4Y7N H;  4TSS A;  4NW2 A;  1EY4 A;  3BDL A;  3ULP A;  4NPS A;  2HDM A;  3TRE A;  2IJ0 A;  5C6A A;  3OTO Q;  3CCL A;  1IYU A;  1ET9 A;  3G6E A;  3BVZ A;  4ILW A;  1WOC A;  4DV7 Q;  4HJ9 A;  3U50 C;  2R7Z B;  5FOB B;  1LO5 D;  1DJR D;  1EIG A;  2JA7 B;  2IT1 A;  4NXM Q;  5CGK A;  2ENB A;  1KRS A;  4M1U B;  1M1K C;  4P71 A;  3VA5 A;  1I4P A;  3QOJ A;  1QJO A;  2L1B A;  3UE1 A;  5CV9 A;  2B63 H;  2A6E D;  1W6J A;  2EY2 A;  2SEB D;  1V1P A;  2HCI A;  2F0W A;  4GLX A;  1ENF A;  4CJ1 B;  2B2T A;  3IFD A;  1OO9 B;  2XRQ D;  1WTW A;  2CWP A;  1BBU A;  4DUY Q;  1KDC A;  4ID6 A;  1XMO Q;  3OIP A;  4A3I B;  4QQB X;  2RSO A;  1B53 A;  3Q6S A;  4IN3 A;  4MZ9 A;  2JA8 B;  1FGB D;  1I94 L;  2OT2 A;  3ZJY C;  1VQI A;  5C4X G;  2IHE A;  1VQO A;  5EPJ A;  2K14 A;  1E2V A;  2QDB A;  2B2V A;  4KY5 A;  1HTP A;  2N78 A;  3I91 A;  4DF7 A;  1JOR A;  3EBE A;  5DM6 3;  5HGQ A;  3KJO A;  5M5Y B;  1TWH H;  2WV6 D;  3HEJ A;  5I2Y A;  1X55 A;  3FVQ A;  2JXM B;  4LAA A;  2WB1 E;  1HNZ L;  1SNC A;  2LMC B;  1X3Q A;  4A3L H;  3PCO B;  1NCV A;  3GTG H;  5C3E G;  3CPW A;  4IUU A;  3DWP A;  2ATW A;  1Y1V G;  3M7G A;  3S14 B;  1G6Z A;  1F9Q A;  4TVA B;  3FDT A;  3PO3 H;  4DV6 Q;  4H02 A;  2PPB C;  3KF8 A;  2JA5 B;  3IRB A;  1JOK A;  5FK9 C;  2A6H D;  2ICI A;  3CPF A;  2BE5 D;  4X3U A;  1C7Y A;  5D14 A;  4F87 A;  4GN3 B;  1PRT F;  5BN5 A;  4K6D A;  4KJN A;  4QIW B;  4HN7 A;  1X3G A;  1HNX Q;  2CW0 C;  3UDI A;  5JOB A;  3WOE A;  2HIX A;  5FLX c;  2FXQ A;  2N8N A;  1S5F D;  1ILP A;  1LT6 D;  1H9K A;  4IPD A;  3TS2 A;  1CZG A;  3SEB A;  1H9J A;  3R2I A;  2AQ2 B;  4EQP A;  2Z1C A;  1LT4 D;  4JI4 L;  1CZW A;  3NBH A;  2RSN A;  1Y8N B;  1C4Q A;  2CWA A;  3K8A A;  1XJV A;  1TS3 A;  1SNQ A;  2HT1 A;  2TMP A;  1D5M C;  1QZH A;  4ZKC B;  4G4K A;  5M5W B;  4BBS B;  5EKI A;  3CC4 A;  1A2U A;  3BDO A;  3EA6 A;  4A3C H;  2JSO A;  4JC0 A;  2XIW A;  4POF A;  1CTM A;  3FPP A;  3H0G H;  5CR3 A;  1GUW A;  5FLX L;  5C3E H;  2HQL A;  3H3V I;  1E2Z A;  1VF5 C;  1PMR A;  1Y1V H;  2CH4 W;  3JAM i;  1HJP A;  3FMC A;  4IPC A;  3Q0A A;  4GOP C;  2F3V A;  1RCV D;  3TEH B;  2F4I A;  4HSV A;  2YU9 B;  1NSN S;  4X3T A;  1ET6 A;  1VQ4 A;  1F2Y A;  3QIA A;  4DR1 L;  2ZXP A;  3TP5 A;  1Q90 A;  1FNW A;  2LXJ A;  3HS0 C;  1TXY A;  3V2T A;  3K7A B;  2UXD Q;  4KMU C;  5ELE A;  4XQN A;  5IOC A;  1HQR D;  1E1T A;  3J81 c;  4KY6 A;  5KIX A;  4HSP A;  3A56 A;  4TKO B;  4B3R Q;  4O1N A;  1CI3 M;  5KNC A;  3NK9 A;  1JCK B;  2VW9 A;  2NWG A;  2D0P A;  2N49 A;  3PV0 A;  3A8K E;  4WJ4 A;  4CKC A;  1VQM A;  5K5P A;  3S1N B;  2O5I C;  4OXP A;  2JEB I;  4ZUJ A;  3DEO A;  4QMG A;  5IGE A;  4DFA A;  2XNA C;  2PZW A;  2F0E A;  3PGZ A;  1DXM A;  4HIM A;  3C3L A;  5JJZ A;  2SDF A;  3SK5 A;  4A3E H;  2Z6B A;  4R1J A;  1HR0 L;  3J81 L;  3RN2 A;  3URY A;  3AFP A;  2M2L A;  2IX0 A;  1HUN A;  5F2D A;  2PZT A;  4CDD C;  3FRP B;  5C4H A;  4IZ8 A;  1BQQ T;  1LTB D;  2OWO A;  1AEX A;  1UAP A;  2FMC A;  4V0B A;  4FF4 A;  1IL8 A;  4BBR H;  3ULJ A;  2HCC A;  1Q8K A;  1NAP A;  5DLQ E;  1K8G A;  1UWV A;  1E22 A;  2CVR A;  2RF4 A;  1FYC A;  5K36 H;  1T9H A;  3X3N A;  2K5H A;  1BXT A;  4DV3 Q;  3M3Y B;  4IPH A;  1LYL A;  2G9D A;  2E76 C;  2P5Z X;  2L5T A;  5IYC G;  4OO1 G;  2RDG A;  4YCU A;  3MA2 B;  3KF6 B;  3GTQ B;  5C4X B;  2BE5 C;  1MJC A;  4LUZ A;  1QB5 D;  1Y14 B;  1WTV A;  1PTO D;  2B2T C;  4NDX A;  3HOW G;  2WII B;  1KNE A;  5IOD A;  5C4J H;  4DV6 L;  3AEV A;  4IUT A;  1BR9 A;  1L0W A;  3FKI H;  3DLL A;  5EGT A;  5EKL A;  1JQY D;  1N36 L;  2IL8 A;  2RHS B;  3OMG A;  1GUS A;  4X3K A;  1IKL A;  5IP7 G;  1AE2 A;  4GLV B;  4FDB A;  4KV6 A;  1A0I A;  2B2V C;  4LFB L;  4A3F G;  3FHW A;  5TSS A;  5LMU Q;  1L2F A;  1PH2 A;  1XNQ Q;  4OEL B;  1QNK A;  3MXN B;  1IBM L;  3KBX A;  3HOU G;  3U4Z A;  5I9O A;  5IWA Q;  1E24 A;  2QW7 A;  1EL0 A;  2FJ2 A;  2KVM A;  1VCI A;  4ME5 A;  1WD1 A;  2EYP A;  3B6Y A;  3K7U C;  2UUC Q;  4A3G G;  4RHS A;  4C3H G;  1XYI A;  2CKZ B;  3GTJ B;  2EIF A;  3N52 A;  3NHH A;  1GKH A;  1CKN A;  2VQF L;  1EY0 A;  4OO1 H;  1CA6 A;  4JI6 L;  2OTL A;  1E0B A;  1TVX A;  4UY8 C;  2R92 H;  3CAM A;  3N6R A;  2ES2 A;  3D6W A;  2F1M A;  4A3K G;  3K5M A;  2UXC L;  4DN4 M;  4N9T A;  3BVM A;  3CME A;  2DY8 A;  3H6M A;  2X6G A;  5LMN L;  1X56 A;  1YNJ D;  4RHR A;  4BXX G;  4AIM A;  1X3F A;  1XMQ Q;  5IT9 c;  5KYL A;  3SXH A;  4WJW A;  3VA7 A;  2IX3 A;  1KDB A;  4FF3 A;  4ZKB B;  3TZU A;  4LF4 Q;  4AYB E;  2UXD L;  1VQF A;  1HR0 W;  4L6T B;  1EU3 A;  4A3J H;  1NR4 A;  4IJH A;  4L5T A;  4BY1 G;  3RZO H;  3GDE A;  4A3F H;  1V8Q A;  3HFZ B;  4DA2 A;  4DAY A;  2N3S A;  1VQD A;  2EDG A;  1JJ2 A;  1J9O A;  1K8M A;  3HOU H;  1ROD A;  1CT1 D;  2MP1 A;  2F0K A;  2R93 H;  3E0E A;  2UUA Q;  1VS0 A;  5C0X G;  3OW7 A;  1W2B A;  5COY A;  2PMZ E;  3G7L A;  5IT9 L;  3NQT A;  1G2T A;  2WAQ E;  5C44 G;  1PYB A;  3UI2 A;  3NTH A;  1YNX A;  5J39 A;  3HOX G;  1ZEQ X;  1FL0 A;  1I6H B;  1GUN A;  2X69 A;  5I2X A;  1PFN A;  1TS4 A;  4LWC A;  4TRD A;  4YWK A;  1EWC A;  1TY0 A;  4YCV A;  1HNW Q;  1RL2 A;  5FLM G;  1ZYR D;  5IGC A;  2VQE Q;  3EVQ A;  3HOZ H;  2B8G A;  1RKN A;  1KXL A;  1EQQ A;  1STY A;  5FJ8 G;  1U0L A;  4F8M A;  1PTO C;  4X62 L;  1LLR D;  2YTX A;  1RD9 D;  1I3Q B;  4R9W A;  3K5O A;  3S9W A;  2UUB Q;  1KLU D;  3A5U A;  1EU4 A;  3JAM E;  5C3W A;  2GVA A;  3L9A X;  3GTK H;  5C3X A;  1JR0 D;  3F1Z A;  1TWG B;  2OEO A;  4KHP L;  2B39 A;  3NTK A;  2RHQ B;  2A5H A;  4H0L C;  3CQZ B;  3HOX H;  2NN6 G;  2R7Z G;  3AYH B;  2K5D A;  5IGG A;  3DMU A;  3MTS A;  3J80 i;  2JA7 G;  1SJH D;  2HD3 A;  4KKU A;  4DV5 L;  5LMN W;  4POG A;  4OWT B;  2Q2H A;  1DGS A;  1EQT A;  1X3P A;  4IFD J;  3D8G A;  1XNQ L;  3BYY B;  5FLM H;  1GVP A;  1WTX A;  2F52 A;  5IWA L;  1AN8 A;  1MGS A;  4CGY B;  3HOW B;  2NUC A;  2L0C A;  1IW7 D;  3PUX A;  2KJX A;  3MWY W;  3R93 A;  4JI8 L;  5E4W C;  1YNJ C;  1I4R A;  4A3I G;  3UDG A;  1TWF H;  4H13 C;  1QIL A;  1M90 C;  5A35 A;  3A8J E;  3KDF B;  3P20 A;  4HJ5 A;  1DM0 B;  3PF4 A;  2PQA B;  4CDE C;  1STH A;  4X66 Q;  4HTH A;  2B3G A;  3A5Z B;  2CFM A;  2B2W C;  3NTI A;  3SGI A;  4A93 H;  1DD2 A;  3VR3 A;  4JI5 Q;  1X65 A;  4X6A H;  4LF6 L;  1YJW A;  3KLS X;  1ESR A;  3H3V C;  1E1O A;  1ICF B;  4P75 A;  4A3G B;  1STN A;  3H91 A;  4C3H B;  3PIP A;  3DEP A;  3KF6 A;  4LF4 L;  2NN6 H;  3RUZ A;  1CKM A;  3GO5 A;  2R7Z H;  2XWJ B;  2NVT B;  4RGO S;  2JA7 H;  2E74 C;  2KQ3 A;  1PRT B;  5IYD G;  4A3K B;  2ZJQ A;  1BVS A;  3CC7 A;  1AZP A;  5EBD A;  3U4V A;  4RCO A;  4KKS A;  1VMP A;  4DV1 L;  1LT5 D;  4K8I A;  4CKB A;  4C3I B;  4IOC A;  1ICW A;  4A3M G;  2UUA L;  3NPP A;  4BWG B;  2Q2T A;  3QO2 A;  3GTP B;  2KEN A;  1B8A A;  5BR8 Q;  2JA5 G;  4H7B A;  1SND A;  1LV9 A;  1YJ9 A;  5IE8 A;  4A3I H;  1F2M A;  3EJI A;  1GHJ A;  1SYF A;  3A7L A;  4BY1 B;  1CQV A;  3I4N G;  2JA8 H;  4X64 L;  4ABN A;  1PLF A;  3C1F A;  1QUQ B;  3MZ5 A;  1HUM A;  3CMA A;  1VQC A;  1GXD C;  1Y69 U;  4IUV A;  1B3A A;  2EJG C;  1QVC A;  5JVG 3;  1NUC A;  5M5Y H;  3GQB A;  2VUM G;  3OPO A;  3MEF A;  1KNA A;  5C44 B;  1S3O A;  1TII D;  2Q8R E;  1PH7 A;  1OXX K;  1Q1E A;  2OQ0 A;  2JEA I;  1KL9 A;  1J5E L;  2C9O A;  4B9X A;  1O7Z A;  1RDP D;  2OXP A;  5CC4 A;  1PH6 A;  4V19 0;  3S17 B;  4K5V A;  4LF7 Q;  3PUW A;  1VQ6 A;  4UP7 A;  3E6Z X;  3W5O A;  3EN2 A;  1CA5 A;  2GN5 A;  4DK1 A;  1A62 A;  5IP9 H;  3S14 H;  4QUC A;  1L1O B;  2WP8 J;  3NUC A;  2JA5 H;  1PFM A;  4RMF A;  1NE3 A;  4DUZ Q;  4JI2 L;  3A0J A;  2H4O A;  1KAA A;  2B29 A;  4G7Z C;  4B3S Q;  1S5E D;  5I9P A;  3F8T A;  1MSG A;  1BCP D;  4QIW E;  2CQO A;  3PIO 3;  1VQ9 A;  2FFK B;  3BS1 A;  1PFB A;  1IBL L;  1IW7 C;  5CV7 A;  4A75 A;  3KLR A;  2L4N A;  3OW2 A;  4JI0 Q;  1O78 A;  2QCP X;  3E9I A;  5G3L D;  3K5N A;  4IFD H;  1EQR A;  3TZD A;  2K32 A;  3G4S A;  1EOT A;  2KCT A;  4P72 A;  3C1E A;  5JJI A;  5D3D A;  5DEH A;  4ZCK A;  3F2C A;  4DAV A;  2XSC A;  3OIQ A;  1SFO B;  4DR7 Q;  3NBI A;  1MBY A;  1ILQ A;  1D6E C;  2KHJ A;  4L8J A;  1PH3 A;  5M5W H;  4BBS H;  4K0K L;  2E2D C;  4QB4 A;  2JA6 B;  3RNU A;  4NMZ A;  4DV4 L;  4C3J G;  3S2H B;  4R4T A;  1E7Z A;  5M5X B;  3T1H Q;  3C46 A;  1SDF A;  1JT8 A;  4KD3 A;  4XYQ A;  2F3I A;  4JVZ A;  2JA9 A;  3IKJ A;  2RCN A;  1VQP A;  1NMG A;  2PCF B;  4X66 L;  2O5J C;  1I4G A;  1TT2 A;  2F3W A;  5M3M G;  4DR4 L;  2EE1 A;  1TU2 B;  3T13 A;  3MVV A;  1JE5 A;  3MFG A;  2YU9 H;  1KAW A;  1UE6 A;  5ELD A;  1B1Z A;  1KRT A;  4N8X 1;  4CDC C;  3K7A H;  2RDH A;  2PZU A;  1TY2 A;  1F2Z A;  4GKK Q;  4LFC L;  1GUG A;  4C2M B;  4QUF A;  3HOY B;  1DZ1 A;  4PMB A;  2A73 B;  1B2T A;  1RF2 D;  2PQE A;  4RGN A;  5EQ0 A;  1VQL A;  4JOI A;  4NXN Q;  4R4I A;  3A55 A;  3D3R A;  3DWQ A;  3L7Z C;  2VS1 A;  5C4Z A;  5L37 A;  3RN5 A;  3PO2 G;  3M4O B;  2K6A A;  3S1N H;  3MXU A;  1KD1 C;  1GUO A;  1M8A A;  1U4L A;  1WD0 A;  3K58 A;  4Y52 H;  4JYA L;  3DXJ C;  2ZXR A;  4FXG C;  1X6O A;  3NEM A;  1II3 A;  2I07 B;  1N34 Q;  1H9S B;  4B3M Q;  1I50 B;  3J80 E;  1K0R A;  4HMI A;  1HFG A;  1EIH A;  4L5Q A;  1K28 A;  2ZTE A;  2F0O A;  2F0L A;  2BOS A;  1Y1W G;  1EWH A;  4Q0F A;  4A3M B;  2OTJ A;  1EY6 A;  2A74 C;  1WCM B;  3VR2 A;  2ASB A;  3HKZ G;  1OXT A;  3M85 A;  1ZKO A;  3CCM A;  5CBE E;  3M3Y H;  2BDN A;  4GNX B;  4PQX A;  3R3O A;  3STB D;  2E2J B;  1MSH A;  4DPG A;  4DV0 L;  1HZA A;  2E2I B;  2NVQ B;  3I4N B;  1HZC A;  3MXG A;  5KEE A;  2NTS A;  3QOL A;  5KYI A;  4XIG S;  3KFU A;  5C4X H;  1EIY B;  3GTQ H;  4LF7 L;  1ONL A;  1D1I A;  1PA6 A;  1BCP C;  2EOT A;  1LTR D;  1O7I A;  1P8L A;  2FIN B;  3K81 C;  4A76 A;  4K14 A;  1N33 L;  1EUJ A;  3SE0 A;  5HUR A;  3BJU A;  1B50 A;  4RGM A;  2VUM B;  5IY0 A;  3S15 B;  2K01 A;  3QG1 A;  5ELC A;  4YY3 Q;  1YIT A;  5AJ3 Q;  3OMC A;  4LW1 A;  4J8Q A;  2WKD A;  3EIV A;  4DK0 A;  2A19 A;  4OWX B;  1HZB A;  2XTI A;  1MHW C;  1SE3 A;  4R4Q A;  3T1Y L;  1Y1W H;  4P2C B;  1WI5 A;  1DOL A;  4NKL A;  4IQZ A;  1S5C D;  4ZYS A;  3OTO L;  4APV A;  2DY7 A;  3GTJ H;  2A6E C;  4FF1 A;  1F9P A;  4XT1 B;  1DYQ A;  4K2L A;  4A3D B;  4DV7 L;  5EAY A;  4F7X A;  4RH6 A;  1SE8 A;  2K52 A;  3L0O A;  1PTO F;  4NXM L;  1VQA A;  4JBM A;  1EYA A;  2QDL A;  4UHV A;  1CSP A;  3ERO A;  1CKO A;  1GJX A;  1TWC B;  1PZJ D;  2L15 A;  4O42 A;  1SXT A;  4OWW B;  1G29 1;  4GKK L;  4RKB A;  3M9B A;  4RKL A;  3CRK C;  4JI7 Q;  1DOM A;  4C3J B;  4DUY L;  4CJ0 B;  1XMO L;  4LF5 Q;  5H1S E;  1XPO A;  4EX5 A;  3IAY A;  3NWS A;  4YWM A;  2HDL A;  1C0A A;  1S72 A;  3PIP 3;  2ZM6 Q;  1N8R C;  3SHL A;  3TRZ A;  5M3M B;  4MNO A;  3GD7 A;  5ISR A;  2QGQ A;  4H44 C;  3VR4 A;  2YV5 A;  5ELF A;  4B08 A;  4FF2 A;  2L55 A;  3IL8 A;  2WB1 B;  4LUO A;  2UU9 Q;  1SAP A;  4XQQ A;  1B3Q A;  3ND8 A;  2F0D A;  5GAH C;  3I4M G;  3CCE A;  2JN4 A;  2D9U A;  2KEE A;  4K5W A;  1I6H H;  4K5X A;  4HCS A;  1R9T B;  1XPU A;  3I72 A;  5JPN C;  1ZXT A;  2A6H C;  3P1H A;  1IZ6 A;  3PO2 B;  1GOZ A;  4K2K A;  3STB C;  5C0X J;  1BKB A;  4IFD I;  2KA7 A;  3W2D A;  4J6H A;  2IY5 B;  1ML0 D;  5CV6 A;  1NJI C;  3VYR A;  1BO0 A;  2F0P A;  4IO9 A;  4HMJ A;  4JG2 A;  2MGS A;  4JOI C;  3RLN A;  1I3Q H;  4B3T Q;  2LY7 A;  1B9N A;  4JBJ A;  1HNX L;  4DV2 Q;  4KY7 A;  4KJO A;  2R7F A;  4WOR A;  3CCJ A;  3KYH C;  2Y0S G;  1PZI D;  2I5L X;  1TWG H;  1Y1W B;  2YTY A;  3VYU A;  3TQY A;  3CCQ A;  2L12 A;  4EVO A;  1H95 A;  3GTM B;  3HKZ B;  2NVX H;  4B9W A;  4UP8 A;  2ALY B;  2K05 A;  3CQZ H;  1YEZ A;  3U58 A;  1S5D D;  4YY3 L;  3F2U A;  2K5W A;  2XVS A;  5IGD A;  5IYC H;  4C1N I;  5IIF A;  2K28 A;  2E75 C;  2KED A;  4A3B G;  3HOV B;  5C5L A;  1YNN D;  2A8V A;  1XXG A;  4RG1 A;  1X3E A;  1PVO A;  4GZY C;  4IPG A;  4GN4 B;  3S1Q B;  1TQO A;  1TWA B;  4C3I G;  3HOW H;  3L3O C;  3CC2 A;  2X6L A;  1HH2 P;  2QKI C;  3T51 B;  5M3F G;  2Z6K A;  3J7A V;  4OGQ C;  2WFW A;  1HHV A;  4GOP B;  2BDO A;  4EGV A;  3NP8 A;  5IP7 H;  4B3R L;  4J15 A;  1SLJ A;  3JAM c;  5GAD C;  3NEL A;  1LAC A;  2GVB A;  1Q46 A;  4YCW A;  1IBK Q;  4WFN 3;  4ZAI A;  2ZTD A;  2BH2 A;  4NB3 A;  3MXP A;  2E2H H;  4QGU A;  1C48 A;  4GLA C;  3S16 B;  2EY5 A;  3BYT B;  3T16 A;  1H9R A;  4MTK A;  4FXK C;  4A3G H;  4C3H H;  2F0F A;  2V1C C;  3D4R A;  1XNR Q;  3TS0 A;  1EFW A;  4YHH Q;  2NVT H;  3DM1 A;  5JVH 3;  4JI7 L;  1FNV A;  5M9O A;  1JMC A;  4IJL A;  4A3K H;  1SRO A;  1V1O A;  4GKJ Q;  1JJC B;  1GM5 A;  1ENC A;  1NNX A;  3JAM L;  5HGT A;  4RA8 A;  5COR A;  4C3I H;  4BXX H;  1VQG A;  4S3S A;  3E9H A;  3GTP H;  1JC7 A;  4DNR B;  3H09 A;  2UU9 L;  1CHP D;  1FJG Q;  4KD4 A;  1TR5 A;  2LKV A;  2RQX A;  1G2S A;  4DR3 Q;  3EFX D;  4DV3 L;  4OX9 Q;  4BY1 H;  4X65 Q;  1GHK A;  1CHQ D;  4K6L A;  2A69 D;  5T1G A;  2ZJR A;  1Q1B A;  1FNU A;  4N9P A;  3GP7 A;  3MFY A;  4RWS C;  1YHA A;  4UPA A;  5KRU A;  3AFQ A;  4DKA C;  1WTP A;  3U9O A;  1XX8 A;  1EQV A;  4HID A;  5C0X H;  1WYD A;  1XTD A;  2Z4H A;  3S24 A;  1GUT A;  5JEA G;  3H15 A;  1FD7 D;  3KUP A;  5FO9 B;  5C44 H;  1HFN A;  5J22 A;  2EXD A;  1V1P B;  3I4M B;  2NVX B;  1U4P A;  2JA6 G;  1DOK A;  3HZX A;  5BN3 A;  4B3T L;  3S17 H;  4E6I A;  1X54 A;  3T56 B;  4LF8 Q;  3MHB A;  2K5V A;  3GTL B;  4OIK A;  2F0I A;  4DR6 Q;  1E3P A;  2EY1 A;  2H1E A;  3LNN A;  5LMU L;  4JV5 Q;  4EQO A;  1B70 B;  5AFW A;  4R8N A;  2VB3 X;  1ASY A;  4YIJ A;  2PW5 A;  2SOB A;  1YNN C;  1BUV T;  1SYB A;  5E1F A;  2UUC L;  1VQN A;  5FJ8 H;  4QCL A;  2SNM A;  1X9N A;  5IYB G;  2Q2U A;  3HOY G;  1N32 Q;  1CUK A;  3F2B A;  2D5D A;  1Q8I A;  2AQ1 B;  4IUR A;  1T5X D;  2JK8 A;  5CBA E;  2KBN A;  4KK7 A;  3L2P A;  2K7V A;  3AB9 A;  2VNU D;  1WTQ A;  2QIL A;  2Y0S B;  2IHF A;  1YJN A;  2EYF A;  5CV8 A;  1SFO H;  4L63 B;  4AYB B;  1XMQ L;  3W1B A;  2E2H B;  4DK6 C;  1Q3L A;  1Q12 A;  2JA6 H;  2XGT A;  5GAG C;  2RBM A;  3UDX A;  3KF8 B;  3S2H H;  1HZ9 A;  5M5X H;  1VQJ A;  2ZTC A;  2EJF C;  4CJ2 C;  4L5R C;  4A3B B;  2KHS A;  1PYW D;  1F9S A;  3NXW A;  1V43 A;  1A3T A;  1A3U A;  1D5Z C;  4QY7 A;  4C1N K;  1K73 C;  4JCV E;  4LNQ A;  1YVC A;  3I7F A;  1SNP A;  3GTO B;  1VQH A;  1WCM G;  3HGB A;  2PYK A;  1BCP F;  1IXR A;  2EQS A;  4IUN A;  1JB3 A;  4J1M A;  5IYB H;  5M3F B;  4G57 A;  5FO7 B;  1VQB A;  4C2M H;  2K4K A;  3HOY H;  3CCU A;  1I94 Q;  1ZYR C;  2G9H D;  3MXN A;  5G3L F;  1Z7T A;  4UP9 A;  4DNT B;  3S2D B;  2OQK A;  3K6O A;  3S1R B;  1MKH A;  1NBW A;  1OXS C;  1B4O A;  1SNM A;  4GKJ L;  1JJG A;  5E4X A;  3WWV A;  3PQI A;  3M4O H;  1AFP A;  2PNR C;  3HKS A;  1D5X C;  1D1K A;  4KHV A;  3R2T A;  1HNW L;  2O4X A;  3CHB D;  2A69 C;  5BN4 A;  1K3R A;  1G6P A;  4BY7 B;  2VQE L;  4GN5 A;  1OTC A;  2F0M A;  3OWE B;  2OCE A;  5A2Q L;  4DR5 Q;  3ONA B;  2VB2 X;  2DJF C;  3UE0 A;  1I50 H;  3OSO A;  3LWU A;  4OX9 L;  4X65 L;  1I6V C;  4OO1 I;  5IYD H;  2HHH Q;  2NVY B;  4DR2 Q;  1PYS B;  2UUB L;  1J6Q A;  2OF1 A;  2ICE C;  1K83 B;  1A15 A;  4OIJ A;  1OXV A;  3UDF A;  1A3V A;  1SYC A;  1S4Z A;  4AH6 A;  2RDF A;  4PZ6 A;  1PTO B;  5D65 A;  4A3M H;  1WCM H;  1ESF A;  1SJE D;  1P16 A;  2EXZ A;  1GO3 E;  4I7A A;  1S40 A;  2F03 A;  4OL7 A;  1EZ8 A;  4ALP A;  4C56 C;  3CF5 A;  2DJG C;  2E2J H;  3M4Y A;  1SBB B;  2E2I H;  3SK6 A;  2NVQ H;  1X32 A;  3I4N H;  4A3D G;  3EQL C;  3NE5 B;  2YTV A;  2IW3 A;  3KOJ A;  4LF8 L;  3ERS X;  4LUV A;  2B63 G;  1JWS D;  4DR6 L;  4UDU C;  2B2Y A;  2KCN A;  2AWO A;  1HRJ A;  1IL2 A;  1EY7 A;  5LHY 1;  1VQ7 A;  2MUY A;  1OXU A;  2F0V A;  1DON A;  1IHZ A;  3AMU A;  2VUM H;  1T5E A;  2Q8I B;  3S15 H;  3D4W A;  4HR7 B;  1LTG D;  3J80 c;  3CXC A;  2Z9H A;  1NR2 A;  1EZ6 A;  3J81 i;  1LTI D;  1Q82 C;  1RTN A;  1YHB A;  4ZLT F;  4N8F A;  2AWN A;  5JAV A;  3DHQ A;  2MO0 A;  1HTL D;  5HY6 A;  1K8O A;  4X3S A;  4JI5 L;  4DR1 Q;  3SVM A;  1EY8 A;  1K9M C;  3KBG A;  1STE A;  1YBY A;  1BBW A;  1U9R A;  2MPM A;  5GRO A;  3K57 A;  2WB1 G;  5CYU A;  5EJW A;  1PFS A;  1RJT A;  3CCS A;  4XXE A;  1VQK A;  3J81 j;  2A68 D;  3I8Z A;  1BOS A;  1M4V A;  4A3D H;  3CP0 A;  1HQM C;  3F2D A;  4K8J A;  1CSQ A;  3J80 L;  1G51 A;  4A3L G;  4MTN A;  1AW7 A;  2B8F A;  2FMM A;  4BA1 I;  3DUZ A;  2F0G A;  4DK3 C;  1SYE A;  4U68 A;  3M4Q A;  1EY9 A;  4DGZ A;  4XYO A;  4NP5 A;  1QE6 A;  1TWC H;  2MO1 A;  5I4D A;  4LF9 Q;  3PO3 G;  4ZK9 B;  3RZD B;  5C0X I;  2ID0 A;  3V05 A;  1PH8 A;  2NYZ D;  1HR0 Q;  5BR8 L;  1UE1 A;  2DN8 A;  2QEX A;  4C3J H;  1QZG A;  2BA1 A;  3VYT A;  2AHO B;  1CKN B;  1C9O A;  1G8Z D;  4ZQ3 A;  3QR8 A;  2AKW B;  2LSS A;  5LL6 X;  5M3M H;  2K33 A;  4IUQ A;  5KND A;  1I4Q A;  3I73 A;  3I4O A;  1IYV A;  3R8B A;  1SRU A;  2LXK A;  1SR3 A;  3KDF A;  3I70 A;  5JJL A;  2PQA A;  4DR5 L;  2BCO A;  2B2U A;  4A3C G;  1SNO A;  3FPU B;  2FHT A;  3OWF A;  1R9T H;  4G7O C;  3H0G G;  3J7Y W;  3I2Z A;  2F4V Q;  1CM9 A;  2EYL A;  2F0J A;  2HHH L;  3A54 A;  1XPR A;  4DR2 L;  3HOV G;  3PO2 H;  1L0X B;  3SR1 A;  2L9H A;  4RGT A;  1NMF A;  4DAY B;  1U5K A;  1J8I A;  3K80 C;  4QF4 A;  1KDA A;  4KN4 C;  3FEW X;  3MC0 B;  2MFI A;  1EEI D;  1N36 Q;  2DNC A;  1SMY D;  4DUZ L;  2C5C A;  4HCE A;  2J7Z A;  3PUV A;  3AQQ A;  2XWB B;  2WKC A;  5CMD A;  5IGF A;  3CU7 A;  1VF7 A;  4B3S L;  2MQH A;  3J7Z C;  4LFB Q;  2NN6 I;  2PI2 A;  4GS3 A;  1Z9F A;  1Q7Y C;  1IBM Q;  4JI0 L;  3S1M B;  1KC8 C;  2R6G A;  4Y7N B;  5I6W A;  2KOL A;  2NB0 A;  3HP3 A;  3X3M A;  3GTM H;  2Q8T A;  1K3B C;  4DR7 L;  1QWY A;  2VQF Q;  2E5L Q;  3HKZ E;  3TP6 A;  4JI6 Q;  2NZO A;  3CKI B;  5D3I B;  4A3E G;  3PUZ A;  1QUQ A;  3PMF A;  2SNS A;  1I4H A;  2MHV A;  2UXC Q;  4XQJ A;  3TME A;  2EYM A;  3T1H L;  1VQ5 A;  4LJZ C;  3SK8 A;  4FYD A;  5LMN Q;  2JJQ A;  5LL6 S;  3HOV H;  3CRL C;  1WTH A;  4BA2 I;  1STA A;  5EKK A;  3W3A A;  4MHE A;  3SDZ A;  2B63 B;  1QNU A;  2A68 C;  4XT3 B;  5T1I A;  3S1Q H;  4BBR G;  1TWA H;  5JJK A;  2XRS D;  2D0O A;  2K5Q A;  3A7A B;  2N55 A;  1HA6 A;  1PH1 A;  1PHJ A;  5K36 G;  1BDO A;  4KN7 C;  2K03 A;  4PNY A;  1WTR A;  1VQE A;  3TN2 A;  4PZ8 A;  1UEA B;  1ENA A;  1L0Y B;  1PRT D;  5ELN A;  2B2Y C;  2JE6 I;  3I4L A;  1L1O A;  1PDQ A;  5FLX E;  2M00 A;  3CCV A;  2IX1 A;  4NXN L;  1G91 A;  3TP7 A;  1JOQ A;  1RIP A;  4RCN A;  4TQU S;  3QJY A;  1NTG A;  4RFB A;  3W1G A;  1K8A C;  5CV4 A;  4LF9 L;  5J1Z A;  3CCR A;  3S16 H;  1TWH B;  1AP0 A;  3FKI G;  2V4D A;  3MAQ A;  4EQN A;  2CQA A;  3TDQ A;  3LX0 A;  4OEM B;  1CQF A;  2TSS A;  2F0T A;  1N34 L;  3RD4 A;  3KK7 A;  4B3M L;  2EYO A;  2GA4 B;  3GTG B;  1KIX A;  1EYG A;  3LGJ A;  1STG A;  1EFI D;  5EBC A;  1UE5 A;  1LUZ A;  4R8I A;  4PV1 C;  3PSI A;  2D2C C;  3OOC A;  1GD7 A;  3PO3 B;  1KHI A;  5EPL A;  1JE4 A;  1QCB D;  1Z6H A;  2K5N A;  3ND9 A;  3BZD B;  4X62 Q;  4ULL A;  1SE4 A;  3TBI B;  2I0Q A;  1EWI A;  2Z0S A;  3U9S A;  3J81 E;  2PO4 A;  1SMX A;  2R92 G;  4R4O A;  2I5H A;  3FP9 A;  4F88 A;  3HRZ C;  1BNZ A;  2F4V L;  4Q5V A;  1A2T A;  2M9V A;  2RCF A;  3JC6 6;  1QVF A;  1SMY C;  3AU7 A;  1JOO A;  2HIV A;  1UE7 A;  1Q81 C;  2VY3 A;  4KHP Q;  3PIO A;  4DU9 A;  4HIK A;  2B2W A;  1WFQ A;  1IYJ B;  1TS5 A;  3A8I E;  4UAI A;  4AYB G;  1H9M A;  3SK4 A;  4CDF C;  4JW0 A;  3I4M H;  3D4D A;  2AQ3 B;  5FO8 B;  3D0F A;  1KTK A;  5CV5 A;  3I90 A;  4A3J G;  5E3F A;  1KAB A;  1BCP B;  1O7L A;  5AJ3 L;  4DXG A;  4DV5 Q;  2NBF A;  3H0G B;  1EYD A;  4L5S A;  5C3E B;  3GTL H;  3GV6 A;  4ODG A;  2K1B A;  1KLG D;  5IGB A;  1Y1V B;  1K0S A;  2CCZ A;  4P73 A;  2R93 G;  3OHX C;  3PF5 A;  1E2W A;  2VL6 A;  2BA0 A;  5JEA J;  5JPM C;  2WAQ G;  2B2U C;  4U67 3;  1H9S A;  4JI8 Q;  1A6X A;  5ELO A;  3BVG A;  2E5L L;  3WOF A;  2Z8L A;  2UXB Q;  3VR6 A;  2RA4 A;  2AUJ D;  2CHB D;  2KCM A;  3V96 A;  2F0U A;  1HA5 A;  4LK1 C;  2AUK A;  4AQY Q;  1BF4 A;  4HJA A;  4JI3 Q;  2MJ8 A;  4LF6 Q;  4PMC A;  2F0Q A;  2E8G A;  1XWE A;  2DGY A;  1AE3 A;  2J0T D;  5DAU A;  1PRT C;  4GNX A;  2Y0S E;  4YWL A;  1MJE A;  1VQ8 A;  3HOZ G;  2NZ1 D;  1ASZ A;  1IKM A;  1LTS D;  4BY7 G;  3ULL A;  1F9R A;  4A3E B;  2BH8 A;  5J3B A;  4O0A A;  2VXW A;  4M8A A;  1W6K A;  2A1A A;  1EEF D;  5KGU A;  4CKE A;  2L11 A;  2HQE A;  1PH4 A;  4LF5 L;  4A3B H;  4MN3 A;  3I56 A;  1WVL A;  2AMC B;  4DV1 Q;  3BZC A;  3O13 A;  4FVM A;  4JI1 Q;  3T4A C;  4BS9 A;  5KNB A;  1I4X A;  3VDY A;  2ZM6 L;  3J7A F;  2QA4 A;  3ITP A;  4QL5 A;  1EOV A;  1SN8 A;  4BBR B;  5NUC A;  2PI2 E;  3G6J B;  1EYC A;  3DWA A;  2KHI A;  3D6C A;  1RHP A;  2EYH A;  4OHJ A;  3GTO H;  1LTA D;  2LFN A;  2DUD A;  1B9M A;  4WRD A;  2JP1 A;  3GV3 A;  5ELB A;  5M3F H;  2XN9 C;  2D62 A;  4X64 Q;  4I65 A;  4RAU C;  3TSS A;  3S2D H;  3NSW A;  3Q23 A;  3CD6 A;  3NEN A;  3S1R H;  1YIJ A;  1AH9 A;  3J7A 5;  1N9W A;  3A74 A;  2H5X A;  1RTO A;  2DNE A;  3ZYY X;  1D7Q A;  1STB A;  2WAC A;  5C4J B;  2NTT A;  5IT9 E;  2C35 B;  2Z4I A;  3FKI B;  4G7H C;  1PV4 A;  4BY7 H;  4HED A;  4XTC S;  1J5E Q;  4LFA Q;  4R4C A;  2I46 A;  1HXY D;  1L1O C;  4QJF A;  1YI2 A;  2J4X A;  2PW7 A;  2EJM A;  4KLK A;  2QEJ C;  5I6Y A;  2NVY H;  1JWU D;  4FO2 A;  1Y8O B;  4DV2 L;  4Z9C B;  1WTO A;  3RR5 A;  1F2L A;  1K83 H;  4A93 G;  3K0X A;  3E3X A;  2RKS A;  1PTO H;  4DAM A;  4ZUI A;  1YZ6 A;  3M4P A;  1EY5 A;  4JI2 Q;  1XTC D;  4ZRZ A;  3WDN A;  1SEB D;  1JWM D;  3RLF A;  1MD2 D;  3MEH A;  4PMW A;  4EQ5 A;  3D31 A;  4A4I A;  1IBL Q;  2R92 B;  5FKA C;  3OYY A;  3KLW A;  2CH4 A;  3BU2 A;  1A63 A;  2ZJP A;  4KHZ A;  4CBV A;  1UEB A;  2EY6 A;  4FXD A;  1CFM A;  4KTA A;  2IWH A;  3BZK A;  2F0N A;  2Q2I A;  5JEA H;  1V9P A;  4K0K Q;  4KI0 A;  1LM0 A;  1LTL A;  4O2D A;  1FGU A;  2I5M X;  3RMH A;  4DV4 Q;  1V1Q A;  4WJ3 M;  4HAE A;  4HJ8 A;  5C5M A;  1PH9 A;  2UXB L;  3E5S A;  4PZ7 A;  4A3J B;  1SYG A;  2ZT9 C;  1I5F A;  2O2L D;  4DXF A;  3RZO B;  1MIU A;  2JA8 G;  4A3F B;  3Q8D A;  2G5D A;  5DNF A;  1W3S A;  4DR4 Q;  4AQY L;  3I3C A;  4JI3 L;  1EIF A;  3VYS A;  3HOU B;  5GAE C;  5DM7 3;  1TKW B;  2PNH A;  1TS2 A;  4P74 A;  2R93 B;  3RLO A;  2ZXO A;  2PMZ B;  3IFT A;  1UUP A;  1LT3 D;  1IBK L;  2WAQ B;  4DNI A;  4LFC Q;  4JPB W;  3H94 A;  1SSO A;  3P7J A;  2RVL A;  1JIC A;  1PXU A;  3NBH B;  2K04 A;  1Y8P B;  4DAP A;  1XNR L;  4YHH L;  1C8C A;  1U4M A;  1A8V A;  1VMC A;  3LWE A;  5EPK A;  3ICE A;  2QF7 A;  4FNF A;  3H3V H;  4JK1 C;  1QOH A;  3QWN A;  2JYO A;  1CK1 A;  3ERQ A;  3K0Y A;  3K59 A;  4JI1 L;  3QB3 A;  5IP9 G;  1D8L A;  3KLS A;  1O7Y A;  1UNS A;  3NQI A;  1DCZ A;  3RZD H;  2Z6K C;  3HOZ B;  4JYA Q;  3DM3 A;  1QG7 A;  3NWT A;  1HNZ Q;  1FJG L;  2KEC A;  4XDX A;  4DR3 L;  2EZV A;  3TP8 A;  3CW2 C;  3E0J A;  2EVB A;  4GNX C;  3C2P A;  2F0H A;  4IFD G;  1R4Q B;  2R7D A;  1B44 D;  2NZH A;  3GTK B;  3ER0 A;  3PUY A;  3Q24 A;  4FP5 D;  1HCZ A;  4PG3 A;  1HPC A;  2R3Z A;  3T53 B;  1F77 A;  3KJP A;  1YHQ A;  4GOP A;  1MI2 A;  4I7Z C;  5E7N A;  1KQS A;  4BBS G;  1QVG A;  2IPK D;  4DV0 Q;  4LFA L;  3HOX B;  1D2B A;  1U4R A;  3G71 A;  3BDC A;  2EPB A;  4IUP A;  3K5L A;  1WJJ A;  1Q86 C;  2VZA A;  4JBK A;  1SYD A;  1SE2 A;  3I55 A;  4JBW A;  1BBX C; 
#chains in the Genus database with same CATH homology
 1PZK D;  1AZQ A;  2KUM A;  1O80 A;  3BG3 A;  4KKT A;  2WIN B;  1S5B D;  2CW0 D;  3M7N A;  3Q22 A;  1R4P B;  1LAB A;  1VDZ A;  2N88 A;  4CHT B;  1FR3 A;  2F0S A;  5A2Q E;  2EYJ A;  3HG9 A;  4LMQ D;  4IAL A;  2KCC A;  4MIU A;  1LTT D;  1TWF B;  3P75 A;  2R61 A;  1Z47 A;  2LS0 1;  2HUG A;  4A93 B;  2YYZ A;  3VR5 A;  4TSS A;  4NW2 A;  1EY4 A;  3BDL A;  2HDM A;  2IJ0 A;  5C6A A;  1IYU A;  1ET9 A;  3BVZ A;  4ILW A;  2R7Z B;  5FOB B;  1LO5 D;  1DJR D;  1EIG A;  2JA7 B;  2IT1 A;  5CGK A;  2ENB A;  4M1U B;  3VA5 A;  1I4P A;  3QOJ A;  1QJO A;  2L1B A;  5CV9 A;  2A6E D;  1W6J A;  2EY2 A;  2SEB D;  1V1P A;  2HCI A;  2F0W A;  1ENF A;  4CJ1 B;  2B2T A;  3IFD A;  1OO9 B;  2XRQ D;  1WTW A;  1KDC A;  4ID6 A;  3OIP A;  4A3I B;  2RSO A;  1B53 A;  3Q6S A;  4IN3 A;  2JA8 B;  1FGB D;  2OT2 A;  5EPJ A;  1E2V A;  2QDB A;  2B2V A;  4KY5 A;  1HTP A;  3I91 A;  4DF7 A;  1JOR A;  5DM6 3;  5M5Y B;  2WV6 D;  3HEJ A;  5I2Y A;  3FVQ A;  2JXM B;  4LAA A;  1SNC A;  2LMC B;  1X3Q A;  1NCV A;  4IUU A;  3DWP A;  3M7G A;  3S14 B;  1G6Z A;  1F9Q A;  3FDT A;  2PPB C;  3KF8 A;  2JA5 B;  5FK9 C;  1JOK A;  2A6H D;  2ICI A;  4X3U A;  2BE5 D;  5D14 A;  4F87 A;  1PRT F;  5BN5 A;  4K6D A;  4KJN A;  4QIW B;  4HN7 A;  2CW0 C;  5JOB A;  3WOE A;  1S5F D;  1ILP A;  1LT6 D;  1H9K A;  1CZG A;  3SEB A;  1H9J A;  3R2I A;  2AQ2 B;  4EQP A;  2Z1C A;  1LT4 D;  1CZW A;  3NBH A;  2RSN A;  1Y8N B;  1C4Q A;  1TS3 A;  1SNQ A;  2TMP A;  1D5M C;  4ZKC B;  4G4K A;  5M5W B;  4BBS B;  5EKI A;  1A2U A;  3BDO A;  3EA6 A;  2JSO A;  2XIW A;  1CTM A;  3FPP A;  5CR3 A;  1GUW A;  5FLX L;  1E2Z A;  1VF5 C;  1PMR A;  3FMC A;  3Q0A A;  2F3V A;  1RCV D;  2F4I A;  4HSV A;  2YU9 B;  1NSN S;  4X3T A;  1ET6 A;  1F2Y A;  3QIA A;  2ZXP A;  3TP5 A;  1Q90 A;  1FNW A;  3HS0 C;  3V2T A;  3K7A B;  4KMU C;  5ELE A;  4XQN A;  5IOC A;  1HQR D;  4KY6 A;  5KIX A;  4HSP A;  3A56 A;  4TKO B;  4O1N A;  1CI3 M;  5KNC A;  3NK9 A;  1JCK B;  2NWG A;  3PV0 A;  3A8K E;  4CKC A;  5K5P A;  3S1N B;  2O5I C;  2JEB I;  4ZUJ A;  3DEO A;  4QMG A;  5IGE A;  4DFA A;  2XNA C;  2PZW A;  2F0E A;  1DXM A;  3C3L A;  5JJZ A;  2SDF A;  3SK5 A;  3J81 L;  3URY A;  2M2L A;  2IX0 A;  1HUN A;  5F2D A;  2PZT A;  3FRP B;  5C4H A;  4IZ8 A;  1BQQ T;  1LTB D;  1AEX A;  1UAP A;  2FMC A;  4V0B A;  4FF4 A;  1IL8 A;  2HCC A;  1NAP A;  2CVR A;  1FYC A;  5K36 H;  3X3N A;  1BXT A;  3M3Y B;  2G9D A;  2E76 C;  4OO1 G;  2L5T A;  2RDG A;  3MA2 B;  3GTQ B;  5C4X B;  2BE5 C;  1QB5 D;  1WTV A;  1PTO D;  2B2T C;  4NDX A;  2WII B;  1KNE A;  5IOD A;  4IUT A;  1BR9 A;  5EGT A;  5EKL A;  1JQY D;  2IL8 A;  3OMG A;  1GUS A;  4X3K A;  1IKL A;  4KV6 A;  2B2V C;  5TSS A;  1QNK A;  3KBX A;  5I9O A;  1EL0 A;  2FJ2 A;  2KVM A;  1VCI A;  4ME5 A;  1WD1 A;  2EYP A;  4RHS A;  4C3H G;  1XYI A;  3GTJ B;  3N52 A;  3NHH A;  1EY0 A;  4OO1 H;  1CA6 A;  1E0B A;  1TVX A;  3N6R A;  3D6W A;  2F1M A;  3K5M A;  4DN4 M;  4N9T A;  3BVM A;  2DY8 A;  3H6M A;  2X6G A;  1YNJ D;  4RHR A;  5KYL A;  3SXH A;  4WJW A;  3VA7 A;  2IX3 A;  1KDB A;  4FF3 A;  4ZKB B;  3TZU A;  4L6T B;  1EU3 A;  1NR4 A;  1V8Q A;  4DA2 A;  4DAY A;  2EDG A;  1J9O A;  1K8M A;  1ROD A;  1CT1 D;  2MP1 A;  2F0K A;  5C0X G;  3OW7 A;  5COY A;  3G7L A;  5IT9 L;  3NQT A;  1G2T A;  3UI2 A;  3NTH A;  5J39 A;  1ZEQ X;  1I6H B;  1GUN A;  2X69 A;  5I2X A;  1PFN A;  1TS4 A;  4TRD A;  1EWC A;  1TY0 A;  1ZYR D;  5IGC A;  3EVQ A;  2B8G A;  1RKN A;  1STY A;  4F8M A;  1PTO C;  1LLR D;  1RD9 D;  1I3Q B;  4R9W A;  3K5O A;  3S9W A;  1KLU D;  1EU4 A;  3JAM E;  5C3W A;  3L9A X;  5C3X A;  1JR0 D;  1TWG B;  2OEO A;  2B39 A;  3NTK A;  2A5H A;  4H0L C;  3CQZ B;  2NN6 G;  2K5D A;  5IGG A;  3DMU A;  3MTS A;  1SJH D;  4KKU A;  4IFD J;  1EQT A;  1X3P A;  3D8G A;  3BYY B;  1WTX A;  1AN8 A;  1MGS A;  4CGY B;  3HOW B;  2NUC A;  2L0C A;  1IW7 D;  3PUX A;  2KJX A;  3MWY W;  3R93 A;  5E4W C;  1YNJ C;  1I4R A;  4H13 C;  1QIL A;  5A35 A;  3A8J E;  3P20 A;  1DM0 B;  1STH A;  4HTH A;  2B2W C;  3NTI A;  1DD2 A;  3VR3 A;  3KLS X;  1ESR A;  3H3V C;  4A3G B;  1STN A;  3H91 A;  4C3H B;  3DEP A;  2NN6 H;  3RUZ A;  3GO5 A;  2XWJ B;  2NVT B;  4RGO S;  2E74 C;  2KQ3 A;  1PRT B;  4A3K B;  1AZP A;  5EBD A;  4RCO A;  4KKS A;  1VMP A;  1LT5 D;  4K8I A;  4CKB A;  4C3I B;  1ICW A;  3NPP A;  4BWG B;  3GTP B;  3QO2 A;  4H7B A;  1SND A;  1LV9 A;  1F2M A;  3EJI A;  1GHJ A;  1SYF A;  3A7L A;  4BY1 B;  1CQV A;  4ABN A;  1PLF A;  3C1F A;  3MZ5 A;  1HUM A;  1GXD C;  1Y69 U;  4IUV A;  1B3A A;  2EJG C;  5JVG 3;  1NUC A;  3GQB A;  3OPO A;  1KNA A;  5C44 B;  2Q8R E;  1TII D;  1OXX K;  1Q1E A;  2JEA I;  2C9O A;  4B9X A;  1O7Z A;  1RDP D;  2OXP A;  5CC4 A;  4V19 0;  3S17 B;  4K5V A;  3PUW A;  3E6Z X;  1CA5 A;  4DK1 A;  4QUC A;  2WP8 J;  3NUC A;  1PFM A;  2H4O A;  1KAA A;  4G7Z C;  1S5E D;  5I9P A;  1MSG A;  1BCP D;  3PIO 3;  2FFK B;  3BS1 A;  1PFB A;  1IW7 C;  5CV7 A;  3KLR A;  2L4N A;  1O78 A;  2QCP X;  3K5N A;  5G3L D;  4IFD H;  3TZD A;  2K32 A;  1EOT A;  3C1E A;  5D3D A;  5DEH A;  4DAV A;  2XSC A;  3OIQ A;  1SFO B;  3NBI A;  1MBY A;  1ILQ A;  1D6E C;  4L8J A;  2E2D C;  4QB4 A;  2JA6 B;  4NMZ A;  4C3J G;  3S2H B;  5M5X B;  3C46 A;  1SDF A;  4KD3 A;  4XYQ A;  3IKJ A;  2PCF B;  2O5J C;  1I4G A;  1TT2 A;  2F3W A;  2EE1 A;  1TU2 B;  3T13 A;  3MVV A;  3MFG A;  5ELD A;  1B1Z A;  2RDH A;  2PZU A;  1TY2 A;  1F2Z A;  1GUG A;  4C2M B;  4QUF A;  3HOY B;  1DZ1 A;  4PMB A;  2A73 B;  1B2T A;  1RF2 D;  2PQE A;  4RGN A;  5EQ0 A;  5C4Z A;  3A55 A;  3D3R A;  3DWQ A;  3L7Z C;  3M4O B;  2K6A A;  3MXU A;  1GUO A;  1M8A A;  1U4L A;  1WD0 A;  3K58 A;  3DXJ C;  2ZXR A;  4FXG C;  1II3 A;  2I07 B;  1H9S B;  1I50 B;  3J80 E;  4HMI A;  1HFG A;  1EIH A;  2F0O A;  2F0L A;  2BOS A;  1EWH A;  4Q0F A;  4A3M B;  1EY6 A;  2A74 C;  1WCM B;  3VR2 A;  1OXT A;  3M85 A;  1ZKO A;  5CBE E;  2BDN A;  4PQX A;  3R3O A;  2E2J B;  1MSH A;  2E2I B;  2NVQ B;  3I4N B;  3MXG A;  5KEE A;  2NTS A;  3QOL A;  5KYI A;  4XIG S;  1ONL A;  1D1I A;  1BCP C;  2EOT A;  1LTR D;  2FIN B;  4K14 A;  3SE0 A;  5HUR A;  1B50 A;  4RGM A;  2VUM B;  3S15 B;  2K01 A;  3QG1 A;  5ELC A;  3OMC A;  4J8Q A;  2WKD A;  4DK0 A;  1SE3 A;  4P2C B;  1DOL A;  4NKL A;  4IQZ A;  1S5C D;  4ZYS A;  2DY7 A;  2A6E C;  4FF1 A;  1F9P A;  4XT1 B;  1DYQ A;  4K2L A;  4A3D B;  4F7X A;  4RH6 A;  1PTO F;  1EYA A;  3ERO A;  1GJX A;  1TWC B;  1PZJ D;  4O42 A;  1SXT A;  1G29 1;  4RKB A;  4RKL A;  3CRK C;  1DOM A;  4C3J B;  4CJ0 B;  3IAY A;  3NWS A;  2HDL A;  3PIP 3;  3SHL A;  5M3M B;  3GD7 A;  5ISR A;  4H44 C;  3VR4 A;  5ELF A;  4FF2 A;  4B08 A;  2L55 A;  3IL8 A;  2WB1 B;  1SAP A;  4XQQ A;  3ND8 A;  2F0D A;  2D9U A;  2KEE A;  4K5W A;  4K5X A;  4HCS A;  1R9T B;  3I72 A;  5JPN C;  1ZXT A;  2A6H C;  3P1H A;  3PO2 B;  1GOZ A;  4K2K A;  5C0X J;  4IFD I;  2KA7 A;  3W2D A;  4J6H A;  1ML0 D;  5CV6 A;  3VYR A;  1BO0 A;  2F0P A;  4HMJ A;  2MGS A;  2LY7 A;  1B9N A;  4KY7 A;  4KJO A;  4WOR A;  1PZI D;  1Y1W B;  3VYU A;  2L12 A;  4EVO A;  3GTM B;  3HKZ B;  4B9W A;  2K05 A;  1S5D D;  3F2U A;  2K5W A;  2XVS A;  5IGD A;  4C1N I;  5IIF A;  2K28 A;  2E75 C;  2KED A;  3HOV B;  5C5L A;  1YNN D;  1XXG A;  4GZY C;  3S1Q B;  1TQO A;  1TWA B;  4C3I G;  3L3O C;  2X6L A;  2QKI C;  3T51 B;  3J7A V;  4OGQ C;  1HHV A;  2BDO A;  4EGV A;  3NP8 A;  1LAC A;  4WFN 3;  4ZAI A;  3MXP A;  1C48 A;  3S16 B;  2EY5 A;  3BYT B;  3T16 A;  1H9R A;  4FXK C;  2F0F A;  3D4R A;  3DM1 A;  5JVH 3;  1FNV A;  5M9O A;  1V1O A;  1ENC A;  3JAM L;  5HGT A;  4RA8 A;  5COR A;  4S3S A;  1JC7 A;  4DNR B;  3H09 A;  1CHP D;  4KD4 A;  1TR5 A;  2LKV A;  2RQX A;  1G2S A;  3EFX D;  1GHK A;  1CHQ D;  4K6L A;  2A69 D;  5T1G A;  1Q1B A;  1FNU A;  4N9P A;  3GP7 A;  3MFY A;  4RWS C;  5KRU A;  1WTP A;  3U9O A;  1XX8 A;  1EQV A;  5C0X H;  2Z4H A;  5JEA G;  1GUT A;  1FD7 D;  3KUP A;  5FO9 B;  1HFN A;  5J22 A;  1V1P B;  3I4M B;  2NVX B;  1U4P A;  1DOK A;  3HZX A;  5BN3 A;  4E6I A;  3T56 B;  3MHB A;  3GTL B;  4OIK A;  2F0I A;  2H1E A;  2EY1 A;  3LNN A;  4EQO A;  5AFW A;  4R8N A;  2VB3 X;  4YIJ A;  2PW5 A;  2SOB A;  1YNN C;  1BUV T;  1SYB A;  5E1F A;  4QCL A;  2SNM A;  2D5D A;  1Q8I A;  2AQ1 B;  4IUR A;  1T5X D;  5CBA E;  4KK7 A;  2K7V A;  3AB9 A;  2VNU D;  1WTQ A;  2QIL A;  2Y0S B;  2EYF A;  5CV8 A;  4L63 B;  4AYB B;  2E2H B;  1Q3L A;  1Q12 A;  2RBM A;  2EJF C;  4CJ2 C;  4A3B B;  2KHS A;  1PYW D;  1F9S A;  3NXW A;  1V43 A;  1A3T A;  1A3U A;  1D5Z C;  4C1N K;  1SNP A;  3GTO B;  3HGB A;  2PYK A;  1BCP F;  4IUN A;  1JB3 A;  4J1M A;  5M3F B;  4G57 A;  5FO7 B;  1ZYR C;  2G9H D;  3MXN A;  5G3L F;  1Z7T A;  4DNT B;  3S2D B;  3K6O A;  3S1R B;  1OXS C;  1B4O A;  1SNM A;  5E4X A;  1AFP A;  2PNR C;  1D5X C;  1D1K A;  4KHV A;  3R2T A;  2O4X A;  3CHB D;  2A69 C;  5BN4 A;  4BY7 B;  2F0M A;  3OWE B;  5A2Q L;  3ONA B;  2VB2 X;  3OSO A;  3LWU A;  1I6V C;  4OO1 I;  2NVY B;  2OF1 A;  2ICE C;  1K83 B;  1A15 A;  4OIJ A;  1OXV A;  1A3V A;  1SYC A;  1S4Z A;  2RDF A;  1PTO B;  5D65 A;  1ESF A;  1SJE D;  2EXZ A;  2F03 A;  4OL7 A;  1EZ8 A;  4C56 C;  3M4Y A;  1SBB B;  3SK6 A;  1X32 A;  3EQL C;  3NE5 B;  2IW3 A;  1JWS D;  4UDU C;  2B2Y A;  2KCN A;  2AWO A;  1HRJ A;  1EY7 A;  5LHY 1;  2MUY A;  1OXU A;  2F0V A;  1DON A;  1IHZ A;  3AMU A;  1T5E A;  2Q8I B;  3D4W A;  4HR7 B;  1LTG D;  1NR2 A;  1EZ6 A;  1LTI D;  1RTN A;  4ZLT F;  2AWN A;  5JAV A;  3DHQ A;  1HTL D;  1K8O A;  4X3S A;  3SVM A;  1EY8 A;  3KBG A;  1STE A;  1U9R A;  2MPM A;  3K57 A;  5EJW A;  5CYU A;  1RJT A;  4XXE A;  2A68 D;  3I8Z A;  1BOS A;  1M4V A;  1HQM C;  4K8J A;  3J80 L;  1AW7 A;  2B8F A;  2FMM A;  4BA1 I;  3DUZ A;  2F0G A;  1SYE A;  4U68 A;  1EY9 A;  4DGZ A;  4XYO A;  4NP5 A;  1QE6 A;  5I4D A;  4ZK9 B;  3RZD B;  5C0X I;  2ID0 A;  3V05 A;  2NYZ D;  2DN8 A;  2BA1 A;  3VYT A;  1G8Z D;  4ZQ3 A;  5LL6 X;  2K33 A;  4IUQ A;  5KND A;  1I4Q A;  3I73 A;  1IYV A;  3R8B A;  3I70 A;  2BCO A;  2B2U A;  1SNO A;  3FPU B;  2FHT A;  3OWF A;  4G7O C;  3J7Y W;  1CM9 A;  2EYL A;  2F0J A;  3A54 A;  1L0X B;  3SR1 A;  2L9H A;  4RGT A;  1J8I A;  4QF4 A;  1KDA A;  4KN4 C;  3FEW X;  3MC0 B;  1EEI D;  2DNC A;  1SMY D;  2C5C A;  4HCE A;  2J7Z A;  3PUV A;  2XWB B;  2WKC A;  5CMD A;  5IGF A;  3CU7 A;  1VF7 A;  2NN6 I;  3S1M B;  2R6G A;  4Y7N B;  5I6W A;  2KOL A;  2NB0 A;  3HP3 A;  3X3M A;  2Q8T A;  1QWY A;  3TP6 A;  3CKI B;  5D3I B;  3PUZ A;  3PMF A;  2SNS A;  1I4H A;  2MHV A;  4XQJ A;  3TME A;  2EYM A;  4FYD A;  4LJZ C;  3SK8 A;  5LL6 S;  3CRL C;  4BA2 I;  1STA A;  5EKK A;  3W3A A;  4MHE A;  3SDZ A;  2B63 B;  1QNU A;  2A68 C;  4XT3 B;  5T1I A;  2XRS D;  2K5Q A;  3A7A B;  2N55 A;  1HA6 A;  5K36 G;  1BDO A;  4KN7 C;  2K03 A;  4PNY A;  1WTR A;  3TN2 A;  1UEA B;  1ENA A;  1L0Y B;  1PRT D;  2B2Y C;  2JE6 I;  3I4L A;  5FLX E;  1PDQ A;  2M00 A;  2IX1 A;  1G91 A;  3TP7 A;  1JOQ A;  4RCN A;  4TQU S;  3QJY A;  4RFB A;  5CV4 A;  5J1Z A;  1TWH B;  1AP0 A;  2V4D A;  3MAQ A;  4EQN A;  2CQA A;  3TDQ A;  3LX0 A;  1CQF A;  2TSS A;  2F0T A;  3RD4 A;  3KK7 A;  2EYO A;  2GA4 B;  3GTG B;  1STG A;  1EFI D;  5EBC A;  4R8I A;  4PV1 C;  2D2C C;  3OOC A;  3PO3 B;  5EPL A;  1JE4 A;  1QCB D;  1Z6H A;  3ND9 A;  3BZD B;  4ULL A;  1SE4 A;  3TBI B;  3U9S A;  3J81 E;  2PO4 A;  4F88 A;  3HRZ C;  1BNZ A;  4Q5V A;  1A2T A;  2M9V A;  1SMY C;  3AU7 A;  1JOO A;  4DU9 A;  2B2W A;  1TS5 A;  3A8I E;  4UAI A;  1H9M A;  3SK4 A;  3D4D A;  2AQ3 B;  5FO8 B;  1KTK A;  5CV5 A;  3I90 A;  5E3F A;  1KAB A;  1BCP B;  1O7L A;  4DXG A;  2NBF A;  3H0G B;  1EYD A;  5C3E B;  3GV6 A;  4ODG A;  2K1B A;  1KLG D;  5IGB A;  1Y1V B;  3OHX C;  1E2W A;  2BA0 A;  5JEA J;  5JPM C;  2B2U C;  4U67 3;  1H9S A;  1A6X A;  3BVG A;  3WOF A;  2Z8L A;  3VR6 A;  2RA4 A;  2AUJ D;  2CHB D;  3V96 A;  2F0U A;  1HA5 A;  4LK1 C;  2AUK A;  1BF4 A;  2MJ8 A;  4PMC A;  2F0Q A;  1XWE A;  5DAU A;  2J0T D;  1PRT C;  2NZ1 D;  1IKM A;  1LTS D;  1F9R A;  4A3E B;  2VXW A;  4M8A A;  1W6K A;  5KGU A;  1EEF D;  4CKE A;  2L11 A;  2HQE A;  4MN3 A;  1WVL A;  3O13 A;  4FVM A;  3T4A C;  4BS9 A;  5KNB A;  1I4X A;  3J7A F;  3ITP A;  4BBR B;  5NUC A;  3G6J B;  1EYC A;  3DWA A;  3D6C A;  1RHP A;  2EYH A;  4OHJ A;  1LTA D;  2LFN A;  1B9M A;  4WRD A;  2JP1 A;  3GV3 A;  5ELB A;  2XN9 C;  2D62 A;  4I65 A;  4RAU C;  3TSS A;  3NSW A;  3Q23 A;  1RTO A;  2DNE A;  3ZYY X;  1STB A;  2WAC A;  5C4J B;  2NTT A;  5IT9 E;  2Z4I A;  3FKI B;  4G7H C;  4HED A;  4XTC S;  2I46 A;  1HXY D;  2J4X A;  2PW7 A;  2EJM A;  2QEJ C;  5I6Y A;  4FO2 A;  1JWU D;  1Y8O B;  4Z9C B;  1WTO A;  1F2L A;  2RKS A;  1PTO H;  4ZUI A;  1EY5 A;  1XTC D;  4ZRZ A;  3WDN A;  1SEB D;  1JWM D;  3RLF A;  1MD2 D;  3MEH A;  4PMW A;  3D31 A;  2R92 B;  5FKA C;  4KHZ A;  4CBV A;  2EY6 A;  4FXD A;  1CFM A;  4KTA A;  2IWH A;  2F0N A;  5JEA H;  4KI0 A;  3RMH A;  4HAE A;  5C5M A;  3E5S A;  4A3J B;  1SYG A;  2ZT9 C;  2O2L D;  4DXF A;  3RZO B;  4A3F B;  5DNF A;  3I3C A;  3VYS A;  3HOU B;  5DM7 3;  1TKW B;  1TS2 A;  2R93 B;  2ZXO A;  2PMZ B;  3IFT A;  1UUP A;  1LT3 D;  2WAQ B;  3H94 A;  1SSO A;  3P7J A;  2RVL A;  1JIC A;  1PXU A;  2K04 A;  1Y8P B;  4DAP A;  1C8C A;  1U4M A;  1VMC A;  5EPK A;  3LWE A;  2QF7 A;  4FNF A;  4JK1 C;  1QOH A;  3QWN A;  2JYO A;  1CK1 A;  3ERQ A;  3K0Y A;  3K59 A;  3QB3 A;  3KLS A;  1O7Y A;  1UNS A;  3NQI A;  1DCZ A;  3HOZ B;  1QG7 A;  3NWT A;  2KEC A;  4XDX A;  2EZV A;  3TP8 A;  3E0J A;  2EVB A;  3C2P A;  2F0H A;  4IFD G;  1R4Q B;  1B44 D;  3GTK B;  3PUY A;  3Q24 A;  4FP5 D;  1HCZ A;  1HPC A;  2R3Z A;  3T53 B;  1F77 A;  1MI2 A;  4I7Z C;  2IPK D;  3HOX B;  1D2B A;  1U4R A;  3BDC A;  2EPB A;  4IUP A;  3K5L A;  1SYD A;  1SE2 A;  4JBW A;  1BBX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...