1DD2A

Biotin carboxyl carrier domain of transcarboxylase (tc 1.3s)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
AGAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TRANSCARBOXYLASE 1.3S SUBUNIT
publication title High resolution solution structure of the 1.3S subunit of transcarboxylase from Propionibacterium shermanii.
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
total genus 8
structure length 77
sequence length 77
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 1999-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dd2A00
1GUNA 3I4LA 1O7LA 1CFMA 3FMCA 2Q8IB 1GHJA 1DCZA 3M85A 3QJYA 4H44C 1V43A 3OPOA 3D4RA 3A7AB 5KNBA 3PUVA 1GHKA 3M7NA 2QF7A 1VF5C 3I73A 3QG1A 4DNRB 2ZT9C 2K32A 1LACA 2DN8A 2V4DA 3PUYA 2AWOA 4KI0A 3VR4A 1H9RA 2JXMB 1E2ZA 2KA7A 3VR5A 1ONLA 3LNNA 1Y69U 4OO1H 2A69D 3WDNA 4JBWA 4OO1G 4IFDH 1H9KA 2BA0A 2D62A 3EQLC 4DK0A 2BE5D 5C0XH 5BN4A 1CI3M 2D2CC 3GD7A 1HCZA 3VR3A 2NN6H 3D31A 1H9SA 3GQBA 4IQZA 1I6VC 2NN6G 3PUXA 2AUKA 3L7ZC 5KNDA 1QJOA 2A6EC 1PMRA 4BA1I 5JEAG 1YNJC 2EJGC 1ZKOA 1H9JA 1DXMA 1G291 4DNTB 3QIAA 1VF7A 2YYZA 3CRLC 1OXTA 1FR3A 3FPPA 4KN7C 3IFTA 1H9MA 4HR7B 2PCFB 2A6HC 4G7HC 1K8OA 5KNCA 2B8FA 1DD2A 1B9NA 1EWHA 3BDOA 3T53B 1GUTA 3VR2A 1E2WA 4KN4C 2E76C 2EDGA 2LMCB 4KKTA 4OGQC 3SDZA 4TKOB 3OOCA 3VA7A 2PPBC 2CW0C 1HTPA 2KCCA 2D5DA 2BA1A 3A8IE 3PV0A 5BN3A 3MFYA 2JE6I 4KKUA 1V8QA 1YNNC 1CTMA 3AB9A 4KHZA 2A6ED 3CRKC 4TQUS 1FYCA 4BA2I 5JEAH 1OXSC 2R6GA 2E74C 3OW7A 3PUWA 1B9MA 1VCIA 1ZYRC 2EJMA 1H9SB 4KMUC 2F1MA 1OXUA 3PUZA 3TZUA 1Q1EA 1Q90A 3I72A 3U9SA 1A6XA 1HPCA 2A6HD 3P20A 3HGBA 2O5JC 4RCNA 1T5EA 2EJFC 3A8KE 3W3AA 2JEAI 2DNCA 3A8JE 1Q12A 2A68C 2DNEA 3H94A 2A69C 1IW7C 2K7VA 3M4YA 3SE0A 3LWUA 4LJZC 3N6RA 1Y8NB 1LABA 1Z6HA 4G7OC 2K33A 3RLFA 1Q1BA 1E2VA 4I7ZC 3T51B 2O5IC 5A35A 3T56B 4GZYC 5K36G 3ND9A 1SMYC 1K8MA 4G7ZC 1O78A 1TKWB 1GUOA 4DK1A 2NN6I 1GUGA 1HQMC 1GJXA 3DXJC 4PV1C 4H13C 1Z7TA 5K36H 2PNRC 5BN5A 1IYUA 3MXUA 1BDOA 4L8JA 3VR6A 3IKJA 1IYVA 1VDZA 4JK1C 2L5TA 2B8GA 2A68D 2E75C 2EVBA 1IW7D 3NE5B 4XTCS 4KKSA 1OXVA 2AUJD 3ND8A 3BG3A 4XIGS 4IFDG 1Y8PB 2IT1A 1GUSA 1TU2B 5C0XG 2BDOA 3KLRA 4LK1C 2BE5C 1OXXK 1Y8OB 4H0LC 3A7LA 2JEBI
chains in the Genus database with same CATH superfamily
4H02A 2EOTA 3KF8A 2NVXH 3GTKB 2XWBB 4P74A 1YHAA 4JI7Q 4K14A 5IYCG 5EBCA 1HUMA 5EJWA 4A3GH 1RDPD 3M7NA 1DM0B 2L4NA 4DNRB 2ZT9C 3BYTB 4JC0A 4LF8L 1OO9B 1VMPA 1YVCA 3PMFA 4WJ4A 4HTHA 5LL6S 1RD9D 2NUCA 5CGKA 5AJ3L 1LTID 4POGA 5C0XH 2EY6A 5K5PA 1KRTA 3X3MA 1WOCA 2CQAA 2KHSA 1GD7A 4HIMA 3J81i 1BKBA 3MZ5A 2OCEA 3NPPA 4OX9L 1VS0A 4BY1B 4BBRH 3C1FA 4OWXB 4HJ7A 1ASZA 2WB1E 2MPMA 2ZTEA 4CDDC 1ICWA 3E9IA 1HUNA 2NVXB 5CV6A 4ZQ3A 2NYZD 2LSSA 1E1OA 4X3KA 2EDGA 2LMCB 3SDZA 2F0FA 4DK6C 1NMGA 3CP0A 4DV4L 3CRKC 3T1HL 2IW3A 1EYGA 3U4ZA 4EQNA 3GTMB 4BA2I 3VYTA 1P8LA 2J4XA 4A3MH 1SJED 1A6XA 3KBXA 4IPCA 5G3LD 1NY4A 4BBRB 2F0GA 4JCVE 1Q7YC 2A68C 1AZQA 2JYOA 3FPUB 5E3FA 3MFGA 3LX0A 3G6EA 3S15B 3MXNA 1VQOA 2IHEA 1SJHD 3OMCA 4HMJA 3HOXG 4EGVA 2FXQA 1HFGA 4DV5L 1PHJA 1Q1BA 3T56B 2K4KA 3ER0A 5CORA 1VQPA 2SNSA 3F8TA 3MC0B 1XTDA 4HJAA 1AE3A 4A76A 1D8LA 4BBSH 4H13C 4RA8A 2KJXA 3RUZA 4L8JA 3QO2A 3CXCA 1AP0A 5E4WC 4NXMQ 4JVZA 2KHIA 1YZ6A 3HKZB 3FEWX 1RTOA 2IT1A 4HIDA 2UUAL 2BE5C 4YWMA 4IPDA 4XXEA 2EYMA 3ERQA 2JEBI 3Q6SA 3HOUH 1EQTA 1CFMA 2A1AA 1STNA 2QILA 2C35B 1VQ4A 2QDLA 1EQVA 2F0KA 2BH8A 4JI1L 3KDFA 3WOFA 1BOSA 4V190 2KENA 3MVVA 1F2ZA 2MFIA 1IBML 1JOQA 1PYWD 2EY2A 1CA6A 4HJ5A 1L0YB 3I8ZA 3I2ZA 3GP7A 4Z9CB 1MI2A 1PRTB 3GTPH 2YYZA 3BDLA 3BZCA 4ID6A 1IXRA 3IFTA 3ITPA 4DPGA 5FLMG 4G7HC 1MGSA 3HOUB 1CK1A 4BY7H 2C9OA 2E76C 3VA7A 2ZXPA 3W5OA 4DV0Q 1I94Q 2CVRA 1LO5D 1I5FA 3OHXC 1C48A 4LAAA 5JEAJ 5DEHA 4DUYL 3BYYB 4ZAIA 2K05A 5JJLA 1VCIA 4DUZL 1IL8A 3CC4A 4LFBL 1N8RC 4OXPA 2MNAA 4A3EB 2NBFA 3PO3G 1TS5A 4KY6A 1ILPA 3A8KE 5IYDH 2EPBA 1RODA 1EEID 1JJ2A 1MIUA 4ME3A 3PCOB 4YCUA 1Z6HA 2B2WC 1JWMD 4BY7B 2O5IC 3SR1A 4IUVA 1SMYC 2WAQG 3CAMA 1WCMH 3I56A 3DXJC 1JOOA 1YIJA 3F2UA 3I4MG 1L0XB 4DV6L 3K57A 1EWIA 3RLNA 2HCCA 2XWJB 1E7ZA 2RSOA 1HTLD 3ND8A 4IFDG 2EXDA 4DAPA 4HCSA 1TWCH 1SN8A 5JVH3 4IUPA 1BBWA 3M3YH 1ENFA 5L37A 1CKMA 4MNOA 3A5ZB 4N9TA 4F7XA 2Y0SE 3MEFA 3H3VI 3I7FA 3NBHB 4FDBA 2GA4B 4A3IG 4K5WA 1LTLA 4K2KA 1B70B 2ES2A 2ZXOA 5GAEC 1PRTC 3VR4A 2F03A 1TR5A 2QDBA 2JA8G 4IALA 4FXDA 1YHBA 2SNMA 1PH4A 3HOZG 1HZAA 3CKIB 4MN3A 4DR7L 4A3CH 1E1TA 1VQFA 4ZKCB 2WKDA 1MBYA 2NVYB 3KK7A 5C44B 1QVGA 5C4XG 3D4WA 1BVSA 2B63G 2VY3A 2EJGC 1GVPA 2WFWA 1BR9A 3HG9A 4IPGA 4QMGA 1TS3A 1GM5A 4Q5VA 3JAMi 4FYDA 2SOBA 1VQ7A 4A3LG 1STEA 1UE7A 3D3RA 5M5YH 2FFKB 2M2LA 4AIMA 1IBLQ 1TXYA 4KKTA 2KEEA 2IY5B 2IHFA 1SAPA 5GROA 1F2YA 3PGZA 3A8IE 3RZOH 3K7UC 3D0FA 4KKUA 1B7YB 4RWSC 4A93H 4IFDI 3KJOA 4DR6Q 2RBMA 1SDFA 3NXWA 4HSVA 3J81j 1LTAD 2B2WA 3V96A 3F2BA 1X56A 1D6EC 5J39A 5IWAQ 1L0WA 4RCNA 4MTKA 4C56C 4BY1G 3AU7A 3S1MH 1N32L 1EIHA 1PA6A 1KD1C 4JW0A 1I4HA 1Q8IA 2DUDA 5M5YB 2K14A 1PH9A 1NR4A 3PO2H 4IURA 3T51B 1L1OB 3Q8DA 1YBYA 2YTVA 4DV1Q 1BCPD 4JI5L 1HR0Q 1EFWA 4MIUA 3RN2A 3S1RH 4A3GG 1EY5A 2OQKA 1I6HB 4A93B 3U58A 1F9QA 1ZEQX 5M3MH 4WFN3 2DY7A 4XTCS 1OXVA 3GTGH 5C0XG 1K83H 5CV8A 3OMGA 4QJFA 3Q23A 3I70A 3QR8A 5J3BA 5IYBH 4S3SA 1W3SA 2F4IA 4BBRG 2Z8LA 4IO9A 3NTIA 4KJNA 1FNUA 1Y1VH 4H44C 2QEJC 4DAYB 3A0JA 4AYBG 3PO2B 2DN8A 2V4DA 1STGA 1GUWA 1ONLA 1CSQA 1XXGA 2CWPA 5D14A 5I6WA 4DV0L 3S1RB 4DK0A 4WJ3M 4JG2A 3D6WA 4Y7NB 2A19A 4IJHA 4RFBA 3VR3A 2WINB 4KHPL 2WKCA 5M3MB 3DWPA 3L7ZC 3E5SA 3HZXA 2JK8A 3H15A 4KLKA 1ZKOA 1PDQA 3U4VA 3GTGB 3S1QH 3HKZG 4A3MG 1QWYA 2K52A 4ODGA 1PZJD 4KV6A 4OELB 2GN5A 1XPRA 4X66Q 5C4JH 4OGQC 4ZUJA 5IP7H 2TSSA 4F87A 2E2JH 3CHBD 1V9PA 2JE6I 1VQGA 2F0EA 1KL9A 1SNPA 4KY5A 3OTOQ 4RHSA 3PIP3 1AN8A 1S5BD 3HKSA 1HRJA 1K0RA 4BBSG 3KF8B 5KYIA 1L1OC 1BUVT 3P75A 3OIPA 2EJFC 3GTOH 5HY6A 2N3SA 4PZ7A 3S1QB 3CW2C 3M4YA 2N88A 3U50C 1R9TH 3J80L 4K2LA 1PFMA 2F4VL 2QKIC 3IAYA 1D1KA 4LUVA 5C4JB 4OX9Q 4ULLA 4GNXC 3HOUG 4BS9A 3R2TA 1EU4A 5EQ0A 3S16B 5ELOA 3K5MA 2R7ZH 1RL2A 2PO4A 1XJVA 1XPUA 1SE8A 2AMCB 3OSOA 1SNCA 3QWNA 3WOEA 4LK1C 4WORA 4OONA 1UE5A 4GLAC 1X3PA 4H0LC 4L5QA 3GTOB 3TQYA 4N8X1 5I9PA 1QVFA 2F0WA 2MHVA 4CJ0B 3AFQA 5DLQE 3I4NH 3URYA 1WD0A 1X6OA 3QG1A 2OXPA 3NK9A 1IBLL 5E4XA 1G91A 4BY7G 3VR5A 2C5CA 2K5QA 4OHJA 2JA5H 3HOYH 3R3OA 2F3WA 4WJWA 4FF1A 1FD7D 5CV9A 3K80C 4R4CA 1O80A 4QL5A 2ID0A 4XQJA 5IGDA 5IGBA 5E1FA 5J22A 5JJIA 1MJCA 2OQ0A 1GKHA 3NWSA 3GTJH 1K8AC 2OTLA 3J81c 3SK5A 5IWAL 2B8FA 1EWHA 1JE5A 2A8VA 1WTRA 1CM9A 3DM1A 1KABA 2K5DA 4XQNA 5IYDG 1L1OA 1FGUA 3I4NB 1X3QA 2RCNA 3E0EA 3IFDA 2UUAQ 3CQZH 3PO3B 4KHZA 3A55A 4R1JA 2V1CC 4DV1L 1HR0L 5JAVA 3OWEB 1WCMG 1IYJB 5IE8A 1PV4A 3HOWH 5IP9H 1EIYB 3CU7A 4GNXA 4UAIA 3K59A 2OF1A 3DEPA 3A8JE 2F0MA 5EPLA 1B3QA 4IUTA 3GTJB 3TEHB 3K5LA 3MAQA 1JC7A 3E9HA 1E2VA 5IGGA 1HZCA 1QCBD 2NTTA 2A5HA 3SXHA 1K8MA 4DR2Q 2XRSD 4DXGA 4JI8Q 4PV1C 2QW7A 1P16A 4X3TA 3H91A 5A2QL 1GO3E 5FJ8H 1PYBA 2UUCL 2CH4W 2VUMH 4A3KB 1JORA 2KOLA 3F1ZA 3MHBA 4KKSA 1A2TA 2AUJD 1XNQQ 2AHOB 4IZ8A 5JJZA 2LXJA 4A3IB 4A3CG 3S2HH 3EROA 3S14H 1UNSA 2XTIA 3S17H 2WP8J 1EOTA 1DCZA 1CUKA 1A62A 4DGZA 2ZM6L 4DR4L 3HOZB 5LHY1 3NENA 3D4RA 4EQ5A 1VQIA 1G6ZA 1GHKA 2YU9H 4IFDJ 4X66L 3ZYYX 1H9RA 4HN7A 1Y69U 2B63B 2A73B 1EOVA 1KTKA 2VQEQ 2K50A 1LYLA 2D2CC 1SFOB 2WV6D 5IIFA 3GTLH 4A93G 4XT1B 1M1KC 1Q46A 1LLRD 4QGUA 3BU2A 2UUBQ 2R92H 2Q2TA 2Q2UA 1STAA 4KN7C 3MWYW 4X3UA 3G48A 1H9MA 1K8OA 2I5HA 1L2FA 3FVQA 1WTPA 3S17B 4C3HH 2QA4A 4DV6Q 1U0LA 4KN4C 1I50H 4NP5A 4YHHQ 3W1GA 3UE1A 2PQAA 1B1ZA 4NKLA 4EVOA 1YNNC 1X55A 3FKIH 3NTHA 3PO2G 5C6AA 1J5EL 2K5NA 3D8GA 4R8NA 3K7AH 1F77A 3TZUA 3DEOA 2ZXRA 3U9SA 1QUQA 3GTLB 2BOSA 2KEDA 3DHQA 4O0AA 2KHJA 4BWGB 1G2SA 1SYBA 4HSPA 1LV9A 2PQEA 3UDFA 5M3MG 2FJ2A 1EY4A 1Q3LA 3J81E 1I4RA 1SYDA 1IHZA 2A69C 3EBEA 2R93H 1EQRA 4PQXA 5LMNW 3GTQH 1BBXC 4A3GB 4K8IA 4GN4B 4DR7Q 3GV6A 4I7AA 1Y1WH 3S1NH 5IYBG 3P1HA 2VS1A 1VMCA 5CBEE 4MTNA 1TKWB 1Y1VG 3NEMA 4CKCA 4DV3L 4P2CB 1OTCA 1JICA 2K75A 5BR8Q 4QUFA 4DU9A 3P7JA 4DV7Q 5CV5A 1JWSD 1XYIA 4F88A 1UEAB 4AYBB 2J0TD 3SHLA 3TZDA 1Q82C 1WI5A 2UXCQ 3M85A 1UE6A 4CDCC 3HS0C 2EIFA 1V43A 3F2CA 2YTYA 1Y1WB 3QOLA 1JOKA 1VQ6A 4C1NI 5C0XJ 5IGFA 1X3GA 3D4DA 4OO1G 1AZPA 1FJGQ 5IP7G 1CT1D 2D62A 1JQYD 4A3MB 2ATWA 1HQRD 1N32Q 3CF5A 3D31A 1F9PA 1I4XA 2Q2HA 3M4OH 1PVOA 1I6VC 1QJOA 1C0AA 2D0OA 4IUQA 1PMRA 1XNRQ 1RKNA 1DOMA 1G291 3W1BA 4JI5Q 3TBIB 2RVLA 1XWEA 4PG3A 2PZWA 1XMOQ 1E2WA 2NTSA 4GN3B 1NSNS 2E8GA 2RDGA 2L1BA 4BBSB 5FLXc 3MFYA 3JAMc 2MGSA 1B4OA 4QQBX 4FF4A 4R4IA 3RZDH 2FHTA 1FYCA 3UI2A 4A3JH 4BXXH 4DR2L 1VQEA 5I2XA 1BCPC 4DA2A 4JI8L 5HURA 3ULPA 1KXLA 1NCVA 1X3EA 5I6YA 1TWGH 2F0DA 4IOAA 2JA7H 2R7ZG 5M3FH 4JV5L 1PH2A 1JJCB 1Q12A 1Y14B 3AMUA 2DNEA 2IX3A 3MXPA 1XNQL 4N9PA 1HZ9A 3N52A 2ENBA 5D3IB 1WTWA 4OO1I 2XIWA 1RJTA 3NSWA 2F0TA 2K33A 4PMBA 4KHPQ 1WYDA 1EEFD 4WRDA 3C46A 1G8ZD 1VQ9A 2HIVA 3TS0A 2O2LD 4ZKBB 3I4NG 4YCWA 4C3JH 1IYVA 2Z4HA 2L5TA 4I65A 1QVCA 2DJGC 2B2TC 2EVBA 1TIID 2G5DA 4NW2A 2JA5G 2VQEL 3GTPB 4HIOA 4HIKA 3HOYG 1TWGB 2N78A 1SEBD 1YNND 5M3FB 3HOVH 4J6HA 5IT9E 5E7NA 3SK6A 4O1NA 2L0CA 2EYHA 2UUBL 3QJYA 2K1BA 1AFPA 3AEVA 3I73A 1LUZA 4KI0A 2JXMB 4L5RC 4EQPA 2A69D 4A3DH 4YHHL 1KLUD 1I3QH 1SSOA 2QCPX 4LFAL 1HA5A 4CDFC 1G2TA 1DJRD 2NN6G 1II3A 2F4VQ 2YTXA 4A3KG 3E6ZX 5FOBB 4R4OA 2X6GA 2RF4A 2EYOA 3LGJA 3HOWG 3FPPA 1F9SA 5IP9G 2B2VC 5D65A 2L55A 1A3TA 2Z6BA 5ELFA 4AQYQ 1GUTA 2G9DA 2O4XA 1NUCA 4NMZA 3CCVA 1VQNA 1K0SA 4TKOB 1WCMB 1EFID 2MO1A 2D5DA 2HHHQ 1E0BA 4B3RQ 2EYFA 1DZ1A 5TSSA 5C3WA 1S40A 4CKBA 4TQUS 2R6GA 1SE4A 1TWAH 3TS2A 4B9XA 1I3QB 4KMUC 2KQ3A 1Q90A 3I72A 4RMFA 1TWCB 2A6HD 2Q2IA 1SLJA 5FJ8G 4EQOA 2VUMG 5BR8L 2CCZA 1VQJA 3M3YB 4RCOA 2F0OA 1W6KA 4QIWB 3TN2A 3I3CA 4DV7L 2H4OA 1A63A 3HRZC 2B2TA 4O2DA 3TP6A 2WAQE 5EPKA 5FLXE 4G7OC 4I7ZC 3JAME 1VQ5A 2UXCL 4LF4Q 3Q0AA 1JWUD 2R61A 1STHA 5KGUA 2NN6I 3J7ZC 1GUGA 1PLFA 3G71A 1EIFA 2NVTH 1IYUA 5ELEA 4JK1C 2RSNA 2B8GA 3RN5A 1TWAB 1SYEA 4C2MH 1D1IA 5CYUA 3L3OC 1IW7D 1SMXA 5DNFA 2ICEC 1E3PA 1FJGL 1TU2B 1SRUA 3KLRA 4HMIA 5FKAC 3T13A 2WB1B 5BN4A 4MZ9A 3G6JB 3L2PA 1EY8A 4JBJA 1XNRL 3TRZA 2R92G 1ILQA 2F0JA 2EYLA 1JMCA 1FNWA 1SROA 1PRTF 3BVMA 3I90A 1GXDC 1NMFA 5T1GA 3RZOB 2QF7A 3R93A 1KAAA 5EAYA 4YWLA 2AWOA 4C3HG 3MTSA 1XMOL 3LNNA 3OWFA 1EUJA 1LTBD 2B2VA 1QB5D 1LTGD 4GNXB 2NVTB 3STBD 1MSHA 2JA6H 4IQZA 1KC8C 4C2MB 3U9OA 3FKIG 1PH8A 1QG7A 4KD4A 1JCKB 4BA1I 1PTOH 3S1MB 1WD1A 3CRLC 1A0IA 2IX1A 2UXDQ 1IKLA 2YV5A 1B50A 1KQSA 2UUCQ 1VQBA 3C3LA 1R4PB 3BDOA 2EQSA 1QNUA 1VQDA 2R93G 2R3ZA 1X3FA 3QOJA 2BA1A 3PV0A 3TDQA 5KYLA 1B8AA 3CC2A 2VXWA 4JBMA 4C3IH 1Y1WG 1LT5D 1B9MA 1JB3A 2FMMA 2I5MX 1AH9A 4DR4Q 5C5LA 2ZM6Q 1K83B 1CKNA 3M7GA 1SE3A 1H95A 4X65L 3C1EA 2JA6B 2O5JC 4CJ1B 3OW2A 1U5KA 1VQCA 1T5EA 1VQAA 2AWNA 2FMCA 2F0QA 3BS1A 4ZK9B 1FNVA 1KHIA 4TVAB 4Y52H 1Y1VB 3R2IA 3HOXH 4DXFA 4IN3A 2OTJA 1S4ZA 4B3SQ 4DK3C 1XTCD 1PH1A 3ICEA 2JN4A 3RLFA 4JI3L 5C0XI 2I46A 1VQMA 2UU9L 1EWCA 3AFPA 2NVQH 3S2DH 1Z7TA 2K03A 4JI0L 5M5XH 1VDZA 1DYQA 2RCFA 4C3IB 2BCOA 5T1IA 4RGNA 1EY9A 2VW9A 1YNXA 1PFBA 1K28A 4R4TA 3T4AC 1WTVA 1V1QA 4A75A 3GDEA 1Y8PB 2X6LA 3F2DA 2K5WA 1STBA 3KOJA 1Y8OB 4XYQA 3MEHA 3FMCA 1J5EQ 2PQAB 1LT3D 2VB3X 3G4SA 4AYBE 5IOCA 2E2JB 3BVGA 3J80i 4XQQA 3A7AB 1SYCA 2LXKA 3CMAA 2OEOA 2Z4IA 1N36Q 1YITA 1K3BC 1WTHA 2PI2A 2E2HH 3PUYA 4AQYL 1DOLA 3W2DA 1QUQB 2BA0A 2KCTA 2Q8RE 2HHHL 2B2YC 3GD7A 4B3RL 3DMUA 1PXUA 3NQTA 3UDIA 4K6LA 4YWKA 4BXXG 1EY7A 4PZ8A 1ENCA 3HKZE 4A3JG 2E2DC 2R7DA 1Q8KA 1HH2P 1O7YA 2B29A 1R9TB 5FLMH 2H5XA 1UUPA 4RHRA 4DV3Q 2JA7G 2PCFB 3Q24A 5M3FG 3C2PA 1HNZL 2HCIA 1HTPA 1X54A 4GKJL 4LF9Q 2KCCA 4FNFA 1KDCA 1V8QA 2R7ZB 3H3VH 2E2HB 2HDLA 2LKVA 1PTOC 2A6ED 2XNAC 4LF4L 1OXSC 4J15A 3PUWA 4R9WA 1IZ6A 3PIPA 3PQIA 4LFCQ 1R4QB 3KLSA 3UDXA 4A3BH 4C3JG 1MHWC 1I4GA 1UAPA 2MQHA 3J7AF 1KNAA 4UP9A 4A3FH 3SE0A 1XMQQ 1ASYA 1BF4A 4PMWA 2EE1A 1LTSD 1B2TA 4DR5Q 4GLVB 2F3VA 5IGCA 4UY8C 3KF6A 1NAPA 2F0LA 2JA5B 2EY5A 1HQMC 4CJ2C 3HOYB 2SEBD 2RQXA 3GV3A 1ET9A 4DR3L 4ZRZA 2AQ2B 1TQOA 2CWAA 1WFQA 3Q22A 1U4PA 5C4HA 1TS4A 1M90C 4A3DG 2IX0A 2PZTA 1NTGA 1GUSA 2CFMA 1B53A 4A3BB 3CCSA 1HA6A 5CC4A 4LNQA 5NUCA 3K5NA 1GUNA 2CQOA 2HQEA 2B2YA 2XGTA 2ZJPA 4A3FB 4RH6A 3RR5A 2F3IA 3NHHA 4FF2A 1PFNA 1CHPD 2UXDL 3CQZB 1SNMA 1YJWA 3H0GH 2G9HD 4RKBA 4POFA 1LM0A 1C9OA 3L9AX 4JV5Q 1QOHA 2KA7A 1TWHH 2EY1A 2RKSA 2IJ0A 1BXTA 1NJIC 3RNUA 3CCLA 3HOWB 3T1YQ 2MUYA 5C4XH 3ULJA 1E24A 1H9JA 2KVMA 1DXMA 4UPAA 1DONA 3EFXD 2OT2A 5G3LF 3TP7A 4IOCA 1PH7A 1JJGA 4KY7A 2WB1G 2AQ3B 4DAVA 1J9OA 1UWVA 1K3RA 4FXKC 3H09A 3V2TA 1BO0A 4PNYA 4B3SL 4TRDA 1M8AA 2JSOA 3H0GB 2VUMB 1YNJD 3H6MA 4X64Q 2DY8A 1HNWL 4N8FA 1HXYD 3S2HB 1JE4A 5H1SE 3S14B 4LF6L 2Z9HA 4R4QA 1J6QA 3K5OA 3HEJA 4K8JA 3K8AA 4FO2A 3VDYA 1HZBA 5ELNA 5I2YA 4LFAQ 3BDCA 4DNIA 1VQ8A 4QIWE 2YU9B 5A35A 1RHPA 2E5LQ 1EQQA 4DF7A 4GKKL 2AKWB 4B08A 1N36L 4LF5L 4PMCA 1I4PA 2VZAA 2Q8TA 3J81L 3GTMH 2R92B 3PSIA 4XIGS 3BG3A 3PF5A 2XSCA 4OL7A 2BDOA 4GLXA 1BCPB 1G6PA 5IT9c 2IL8A 2PMZB 4ZYSA 4P73A 1RF2D 3M4PA 1PTOD 5ISRA 2JA6G 5K36H 4C3HB 4YCVA 1D5XC 2QGQA 1I50B 4X62Q 4KD3A 2VNUD 3VYSA 1HNXL 3S15H 3VA5A 4APVA 5HGTA 4M8AA 3UDGA 5DAUA 2ASBA 3FKIB 3EVQA 3K7AB 3BJUA 5LMUQ 4RGOS 3TP8A 4LF9L 2XVSA 4ZUIA 1CI3M 4L5TA 3KFUA 3CCEA 1ET6A 4B3MQ 5M9OA 4XT3B 4C3IG 1E22A 1PZID 5DM73 4JYAQ 4QF4A 4X3SA 4K0KQ 2R93B 1EL0A 4LFCL 4L6TB 1EYCA 4V0BA 3B6YA 3K58A 1U4MA 1VF7A 3GTQB 3NTKA 3VYUA 1KDBA 1F2MA 2A6HC 3S1NB 4DV2Q 1DD2A 4JBKA 1HR0W 2HUGA 2UXBQ 4RKLA 2D9UA 4UP7A 2L9HA 1XMQL 4LWCA 1YHQA 5CMDA 2HQLA 4DR5L 4GN5A 1BQQT 1LT6D 5JEAH 4NXNL 3M4QA 1CQFA 1DOKA 3I4OA 2EJMA 4H7BA 4JOIC 1T5XD 1PH5A 2JJQA 3CCQA 3S9WA 5EKKA 2DNCA 5IGEA 4A4IA 1IW7C 1X32A 3V05A 3A74A 3LWUA 4L5SA 5CV7A 4IPHA 3CC7A 1W6JA 4L63B 2EYPA 5CR3A 3ULLA 5COYA 1V1PB 2LS01 2BDNA 4K5XA 2K04A 5GQOA 1TWFH 2VL6A 1O78A 4DK1A 1GUOA 1GJXA 5KIXA 1D5MC 1HJPA 3M4OB 3CCJA 5KEEA 3PIO3 2E75C 1ESRA 1MD2D 1AE2A 1V1OA 2F0SA 4FXGC 3UE0A 4X6AH 2PYKA 1EYDA 1SXTA 1RTNA 2I0QA 3T1YL 3STBC 2DGYA 4P71A 4A3EH 2K5HA 2X69A 3NELA 5I4DA 1FVIA 3DUZA 5DM63 3SK8A 3KJPA 2OWOA 4AH6A 4CDEC 1Z47A 1WTOA 5C3EH 2Y0SG 4X65Q 2L11A 3RZDB 4A3JB 1TWFB 1CKNB 1ZXTA 3WDNA 3E3XA 3CMEA 4DR1Q 4CHTB 2JA7B 5IT9L 4RAUC 1A2UA 1EZ8A 2NWGA 3GQBA 4P75A 1BNZA 1X65A 5KNDA 3FHWA 3I55A 4JI3Q 1YJNA 1NR2A 4X64L 1TVXA 2UU9Q 5EKLA 3VYRA 4YIJA 3EJIA 1OXTA 4U68A 4R8IA 1A15A 4A3BG 4JI0Q 1YI2A 5ELBA 3MA2B 5JVG3 3LWEA 3IRBA 4PZ6A 2HD3A 4JOIA 3WWVA 2AQ1B 1SYFA 2NZHA 5GAGC 1KIXA 2CW0C 2PPBC 3J7YW 5JJKA 4A3FG 1CZWA 5C3EB 2QEXA 4C3JB 1IKMA 1BCPF 2E5LL 3RMHA 4JI7L 3BZDB 1ZYRC 1QZGA 1H9SB 3G7LA 3DWAA 3OYYA 1PZKD 1KNEA 1KRSA 3HOVB 3HFZB 2EXZA 2NVYH 5C44H 1O7ZA 3W3AA 4CGYB 1XPOA 3PIOA 5IODA 3H94A 2K7VA 5ELDA 4HEDA 1S72A 2ZTDA 3S24A 4JPBW 1Y8NB 1KAWA 1J8IA 4QUCA 1MJEA 4P72A 4GZYC 3K81C 5AFWA 4X62L 4A3DB 2A74C 1XX8A 1CQVA 2I07B 5GAHC 3SVMA 3K0YA 4B3TQ 5JPNC 4CBVA 4ZCKA 1JB7A 1SBBB 3QB3A 3IKJA 4JI2Q 2CH4A 4C1NK 4LUOA 2KUMA 5EPJA 5JPMC 1N34Q 3H0GG 2A68D 4FF3A 5LMUL 1HNZQ 1QILA 4GKJQ 1C7YA 2M9VA 4J8QA 1OXXK 2RDHA 5FLXL 4B3ML 3A7LA 3JAML 4XDXA 5FK9C 4JYAL 1D2BA 1O7LA 4K0KL 4K6DA 3OPOA 4QCLA 3SEBA 5FO9B 2RHSB 2L12A 4GOPB 2Z6KC 5LMNQ 3CCRA 4JI6Q 2K32A 3L0OA 4LF7Q 4DV2L 5C5MA 5GADC 2UXBL 2GVBA 1SNQA 1E2ZA 4UDUC 4OIJA 2VB2X 4JBWA 4KTAA 2HIXA 3IL8A 4F8MA 4G57A 2HDMA 2BE5D 3J80c 5C4ZA 3CCMA 1I6HH 1MKHA 3AYHB 5M5WH 3E0JA 4ALPA 4EX5A 3PUXA 2AUKA 1WTXA 2A6EC 3CPFA 4FVMA 1I4QA 1B3AA 4IUUA 5ELCA 3RD4A 1KDAA 5IYCH 4DNTB 1SYGA 3A5UA 1HHVA 3QIAA 3EA6A 1ML0D 4ME5A 1FR3A 2K5VA 3KF6B 4NXML 3GO5A 4DR3Q 5KNCA 3KBGA 1CKOA 4M1UB 3VR2A 2F0UA 3M9BA 3OOCA 1V1PA 1N33Q 1ESFA 1EZ6A 4DKAC 2VQFQ 5BN3A 4MHEA 2EZVA 2E2IH 4E6IA 4O42A 2LY7A 2HT1A 2E74C 4OIKA 1OXUA 3PUZA 1Q1EA 4TSSA 1TY0A 2I5LX 4FP5D 1HPCA 4IJLA 4Y7NH 5M5WB 1Z9FA 2IWHA 2JQOA 2N8NA 3P20A 3HGBA 1F9RA 1D5ZC 1JR0D 4Q0FA 4OWTB 2BH2A 4J1MA 2JA9A 1PH6A 3CD6A 2F0IA 2J7ZA 3A54A 5CV4A 3NWTA 5K36G 3ND9A 2F52A 5CBAE 2L15A 1C4QA 1FL0A 2B3GA 1IBKQ 4ABNA 2ALYB 3DLLA 2PNRC 3VR6A 2K6AA 2E2IB 1CSPA 3NE5B 1PTOB 4DR1L 1ICFB 2CW0D 2Z6KA 1I94L 1IL2A 4GOPC 1B44D 4DN4M 3KUPA 2KBNA 3FRPB 2K01A 1SMYD 1GHJA 4RG1A 1ZYRD 2M00A 3NQIA 2NB0A 4NDXA 2PMZE 1HNWQ 3PUVA 4OEMB 1VQHA 5KRUA 2NZ1D 1VF5C 1S5ED 5D3DA 1LACA 2KCMA 1HFNA 5LL6X 1CHQD 1WJJA 4OO1H 3SGIA 1YJ9A 1SR3A 3BVZA 4YY3Q 4LF6Q 1WVLA 3EQLC 3CCUA 3S16H 1HCZA 4JI4Q 1H9SA 1CA5A 2P5ZX 5JEAG 1YNJC 2F0HA 1S5FD 1K8GA 5I9OA 3EIVA 1CZGA 3HOXB 3NBIA 5EGTA 4GKKQ 2XN9C 3AQQA 1BBUA 2D0PA 3KYHC 1TT2A 1PRTD 4LF8Q 1JT8A 2H1EA 3K6OA 4LF5Q 1B9NA 3T53B 1Q81C 1LTRD 5AJ3Q 1KLGD 1A3VA 2F0NA 2NVQB 3S2DB 5M5XB 3J80E 3NBHA 3AB9A 2RDFA 2F0PA 1TS2A 3I91A 4OWWB 3HP3A 2F1MA 4B3TL 4XYOA 1HNXQ 2NZOA 2B2UC 3OIQA 4JI2L 1ENAA 3DWQA 4KK7A 1N34L 4HCEA 4B9WA 1S5CD 2CKZB 3SK4A 2PZUA 4A3EG 1RCVD 4DV4Q 4K5VA 1NBWA 2ZJQA 1AEXA 3T1HQ 2KECA 4GOPA 1Q86C 5JOBA 1VQKA 4QB4A 1MSGA 2TMPA 5BN5A 4KJOA 2PW7A 3MXUA 5LMNL 3R8BA 5C3EG 1PYSB 4JI6L 3PO3H 4DFAA 4LF7L 4ILWA 3PF4A 1EY6A 5IY0A 1UE1A 1C8CA 1QZHA 4LW1A 2IPKD 2R7FA 1YEZA 1PH3A 1LTTD 3TMEA 5C3XA 3ZJYC 2RA4A 1EIGA 2WIIB 1FGBD 2ZTCA 4DR6L 2Y0SB 4DV5Q 4NB3A 2B39A 1EYAA 3HOVG 3MXNB 2N55A 3I4LA 4NPSA 2Q8IB 2DJFC 4QY7A 1SE2A 1SNOA 1U4LA 4NXNQ 1RIPA 2N49A 5KNBA 2K28A 4IUNA 2SDFA 3J7A5 2WACA 1QE6A 3TSSA 3BZKA 3I4MH 1LT4D 3KLWA 2FINB 1K73C 1TY2A 1K9MC 1N33L 4IFDH 1H9KA 3CPWA 2VQFL 5EKIA 4CKEA 2NN6H 5F2DA 5FO8B 2ZJRA 1VQLA 4A3KH 3NUCA 2JP1A 1NNXA 3FDTA 3X3NA 1N9WA 1G51A 1SNDA 2Z1CA 4A3IH 4JI1Q 2XRQD 4HR7B 3K0XA 2GVAA 4UP8A 5C44G 3TP5A 1A3UA 2JA8H 2CHBD 2WAQB 3ERSX 4RGTA 3RLOA 1S3OA 3KDFB 3T16A 2EYJA 2PNHA 2B2UA 1EU3A 1IBMQ 3HOZH 1PTOF 1A8VA 2PW5A 4G4KA 2MO0A 4HJ8A 1F2LA 3I4MB 1CTMA 4HJ9A 4DAYA 4ZLTF 2B63H 4GS3A 3OW7A 4UHVA 3JC66 5EBDA 3J7AV 1IBKL 1PFSA 1SFOH 2MJ8A 3DM3A 5A2QE 4A3LH 1AW7A 3FP9A 2JEAI 1EY0A 3GTKH 3KLSX 1GOZA 4KHVA 4HAEA 3O13A 1W2BA 5HGQA 4LJZC 1S5DD 3N6RA 2RHQB 3ONAB 1LABA 4DAMA 1U4RA 1O7IA 4RGMA 4DUYQ 2JA8B 3EN2A 5FO7B 4LUZA 2LFNA 1TWHB 1STYA 4G7ZC 2PI2E 3NP8A 4DUZQ 1QNKA 4LFBQ 1M4VA 2F0VA 2ICIA 3A56A 1BDOA 1T9HA 3TREA 5C4XB 1NE3A 1WTQA 4BY1H 2KCNA 4LMQD 2Z0SA 4YY3L 2MP1A 3D6CA 1D7QA 4U673 5J1ZA 1DGSA 1UEBA 1X9NA 3H3VC 4JI4L 3MXGA 3OTOL 1U9RA
chains in the Genus database with same CATH topology
2EOTA 3KF8A 3GTKB 2XWBB 4K14A 5EBCA 1HUMA 5EJWA 1RDPD 3M7NA 1DM0B 2L4NA 4DNRB 2ZT9C 3BYTB 1OO9B 1VMPA 3PMFA 4HTHA 5LL6S 1RD9D 2NUCA 5CGKA 1LTID 5C0XH 2EY6A 5K5PA 3X3MA 2CQAA 2KHSA 3MZ5A 3NPPA 4BY1B 3C1FA 2MPMA 1ICWA 1HUNA 2NVXB 5CV6A 4ZQ3A 2NYZD 4X3KA 2EDGA 2LMCB 3SDZA 2F0FA 3CRKC 2IW3A 4EQNA 4BA2I 3GTMB 3VYTA 2J4XA 1SJED 1A6XA 3KBXA 5G3LD 4BBRB 2F0GA 1AZQA 2A68C 2JYOA 3FPUB 5E3FA 3MFGA 3LX0A 3S15B 3MXNA 1SJHD 3OMCA 4HMJA 4EGVA 1HFGA 1Q1BA 3T56B 5CORA 2SNSA 3MC0B 4H13C 4RA8A 2KJXA 3RUZA 4L8JA 3QO2A 1AP0A 5E4WC 3HKZB 3FEWX 1RTOA 2IT1A 2BE5C 4XXEA 2EYMA 3ERQA 2JEBI 3Q6SA 1EQTA 1CFMA 1STNA 2QILA 1EQVA 2F0KA 3WOFA 1BOSA 4V190 3MVVA 1F2ZA 1JOQA 1PYWD 2EY2A 1CA6A 1L0YB 3I8ZA 3GP7A 4Z9CB 1MI2A 1PRTB 2YYZA 3BDLA 4ID6A 3IFTA 3ITPA 4G7HC 1MGSA 3HOUB 1CK1A 2C9OA 2E76C 3VA7A 2ZXPA 2CVRA 1LO5D 3OHXC 1C48A 4LAAA 5JEAJ 5DEHA 3BYYB 4ZAIA 2K05A 1VCIA 1IL8A 4A3EB 2NBFA 1TS5A 4KY6A 1ILPA 3A8KE 2EPBA 1RODA 1EEID 1Z6HA 2B2WC 1JWMD 4BY7B 2O5IC 3SR1A 4IUVA 1SMYC 3DXJC 1JOOA 3F2UA 1L0XB 3K57A 2HCCA 2XWJB 2RSOA 1HTLD 3ND8A 4IFDG 4DAPA 4HCSA 5JVH3 4IUPA 1ENFA 4N9TA 4F7XA 2GA4B 4K5WA 4K2KA 2ZXOA 1PRTC 3VR4A 2F03A 1TR5A 2QDBA 4IALA 4FXDA 2SNMA 3CKIB 4MN3A 4ZKCB 2WKDA 1MBYA 2NVYB 3KK7A 5C44B 3D4WA 2EJGC 1BR9A 3HG9A 4QMGA 1TS3A 4Q5VA 4FYDA 2SOBA 1STEA 3D3RA 2FFKB 2M2LA 4KKTA 2KEEA 1SAPA 1F2YA 3A8IE 4KKUA 4RWSC 4IFDI 2RBMA 1SDFA 3NXWA 4HSVA 1LTAD 2B2WA 3V96A 1D6EC 5J39A 4RCNA 4C56C 3AU7A 1EIHA 1I4HA 1Q8IA 5M5YB 1NR4A 4IURA 3T51B 1BCPD 4MIUA 1EY5A 1I6HB 4A93B 1F9QA 1ZEQX 4WFN3 2DY7A 4XTCS 1OXVA 5C0XG 5CV8A 3OMGA 3Q23A 3I70A 4S3SA 2F4IA 2Z8LA 3NTIA 4KJNA 1FNUA 4H44C 2QEJC 3PO2B 2DN8A 2V4DA 1STGA 1GUWA 1ONLA 1XXGA 5D14A 5I6WA 3S1RB 4DK0A 3D6WA 4Y7NB 4RFBA 3VR3A 2WINB 2WKCA 5M3MB 3DWPA 3L7ZC 3E5SA 3HZXA 1ZKOA 1PDQA 3GTGB 1QWYA 4ODGA 1PZJD 4KV6A 4OGQC 4ZUJA 2TSSA 4F87A 3CHBD 2JE6I 2F0EA 1SNPA 4KY5A 4RHSA 3PIP3 1AN8A 1S5BD 1HRJA 5KYIA 3P75A 1BUVT 3OIPA 2EJFC 3S1QB 3M4YA 2N88A 3J80L 4K2LA 1PFMA 2QKIC 3IAYA 1D1KA 5C4JB 4ULLA 4BS9A 3R2TA 1EU4A 5EQ0A 3S16B 3K5MA 2PO4A 3OSOA 1SNCA 3QWNA 3WOEA 4LK1C 4WORA 1X3PA 4H0LC 3GTOB 5I9PA 2F0WA 2MHVA 4CJ0B 3URYA 1WD0A 3QG1A 2OXPA 3NK9A 1G91A 5E4XA 3VR5A 2C5CA 2K5QA 4OHJA 3R3OA 2F3WA 4WJWA 4FF1A 1FD7D 5CV9A 1O80A 2ID0A 4XQJA 5IGDA 5IGBA 5E1FA 5J22A 3NWSA 3SK5A 2B8FA 1EWHA 1WTRA 1CM9A 3DM1A 1KABA 2K5DA 4XQNA 3I4NB 1X3QA 3IFDA 3PO3B 4KHZA 3A55A 5JAVA 3OWEB 3CU7A 4UAIA 3K59A 2OF1A 3DEPA 3A8JE 2F0MA 5EPLA 4IUTA 3GTJB 3K5LA 3MAQA 1JC7A 1E2VA 5IGGA 1QCBD 2NTTA 2A5HA 3SXHA 1K8MA 2XRSD 4DXGA 4PV1C 4X3TA 3H91A 5A2QL 4A3KB 1JORA 2KOLA 3MHBA 4KKSA 1A2TA 2AUJD 4IZ8A 5JJZA 4A3IB 3EROA 1UNSA 2WP8J 1EOTA 1DCZA 4DGZA 3HOZB 5LHY1 3D4RA 1G6ZA 1GHKA 4IFDJ 3ZYYX 1H9RA 4HN7A 1Y69U 2B63B 2A73B 1KTKA 2D2CC 1SFOB 2WV6D 5IIFA 4XT1B 1LLRD 1STAA 4KN7C 3MWYW 4X3UA 1H9MA 1K8OA 3FVQA 1WTPA 3S17B 4KN4C 4NP5A 1B1ZA 4NKLA 4EVOA 1YNNC 3NTHA 5C6AA 3D8GA 4R8NA 1F77A 3TZUA 3DEOA 2ZXRA 3U9SA 3GTLB 2BOSA 2KEDA 3DHQA 4BWGB 1G2SA 1SYBA 4HSPA 1LV9A 2PQEA 2FJ2A 1EY4A 1Q3LA 3J81E 1I4RA 1SYDA 1IHZA 2A69C 4PQXA 4A3GB 1BBXC 4K8IA 3GV6A 3P1HA 1VMCA 5CBEE 1TKWB 4CKCA 4P2CB 1JICA 4QUFA 4DU9A 3P7JA 5CV5A 1JWSD 1XYIA 4F88A 1UEAB 4AYBB 2J0TD 3SHLA 3TZDA 3M85A 3HS0C 1V43A 1Y1WB 3QOLA 1JOKA 4C1NI 5C0XJ 5IGFA 3D4DA 4OO1G 1AZPA 1CT1D 2D62A 1JQYD 4A3MB 1HQRD 3D31A 1F9PA 1I4XA 1I6VC 1QJOA 4IUQA 1PMRA 1RKNA 1DOMA 1G291 3TBIB 2RVLA 1XWEA 2PZWA 1E2WA 2NTSA 1NSNS 2RDGA 2L1BA 4BBSB 3MFYA 2MGSA 1B4OA 4FF4A 2FHTA 1FYCA 3UI2A 5I2XA 1BCPC 4DA2A 5HURA 1NCVA 5I6YA 2F0DA 1Q12A 3AMUA 2DNEA 2IX3A 3MXPA 4N9PA 3N52A 2ENBA 5D3IB 1WTWA 4OO1I 2XIWA 1RJTA 3NSWA 2F0TA 2K33A 4PMBA 1EEFD 4WRDA 3C46A 1G8ZD 2O2LD 4ZKBB 1IYVA 2Z4HA 2L5TA 4I65A 2B2TC 2EVBA 1TIID 4NW2A 3GTPB 1TWGB 1SEBD 1YNND 5M3FB 4J6HA 5IT9E 3SK6A 4O1NA 2L0CA 2EYHA 3QJYA 2K1BA 1AFPA 3I73A 4KI0A 2JXMB 4EQPA 2A69D 1KLUD 1SSOA 2QCPX 1HA5A 1G2TA 1DJRD 2NN6G 1II3A 3E6ZX 5FOBB 2X6GA 2EYOA 3FPPA 1F9SA 2B2VC 5D65A 2L55A 1A3TA 5ELFA 1GUTA 2G9DA 2O4XA 1NUCA 4NMZA 4TKOB 1WCMB 1EFID 2D5DA 1E0BA 1DZ1A 2EYFA 5TSSA 5C3WA 4CKBA 4TQUS 2R6GA 1SE4A 4B9XA 1I3QB 4KMUC 2KQ3A 1Q90A 3I72A 1TWCB 2A6HD 4EQOA 3M3YB 4RCOA 2F0OA 1W6KA 4QIWB 3TN2A 3I3CA 2H4OA 3HRZC 2B2TA 3TP6A 5FLXE 5EPKA 4G7OC 4I7ZC 3JAME 3Q0AA 1JWUD 2R61A 1STHA 5KGUA 2NN6I 1GUGA 1PLFA 1IYUA 5ELEA 4JK1C 2RSNA 2B8GA 1TWAB 1SYEA 1D1IA 5CYUA 3L3OC 1IW7D 5DNFA 2ICEC 1TU2B 3KLRA 4HMIA 5FKAC 3T13A 2WB1B 5BN4A 3G6JB 1EY8A 1ILQA 2F0JA 2EYLA 1FNWA 1PRTF 3BVMA 3I90A 1GXDC 3RZOB 5T1GA 2QF7A 3R93A 1KAAA 2AWOA 4C3HG 3MTSA 3LNNA 3OWFA 1LTBD 2B2VA 1QB5D 1LTGD 2NVTB 1MSHA 4IQZA 4C2MB 3U9OA 1QG7A 4KD4A 1JCKB 4BA1I 1PTOH 3S1MB 1WD1A 3CRLC 2IX1A 1IKLA 1B50A 3C3LA 1R4PB 3BDOA 1QNUA 2R3ZA 3QOJA 2BA1A 3PV0A 3TDQA 5KYLA 2VXWA 1LT5D 1B9MA 1JB3A 2FMMA 5C5LA 1K83B 3M7GA 1SE3A 3C1EA 2JA6B 2O5JC 4CJ1B 1T5EA 2AWNA 2FMCA 2F0QA 3BS1A 4ZK9B 1FNVA 1Y1VB 3R2IA 4DXFA 4IN3A 1S4ZA 1XTCD 3RLFA 5C0XI 2I46A 1EWCA 1Z7TA 2K03A 1VDZA 1DYQA 4C3IB 2BCOA 5T1IA 4RGNA 1EY9A 1PFBA 3T4AC 1WTVA 1Y8PB 2X6LA 2K5WA 1STBA 1Y8OB 4XYQA 3MEHA 3FMCA 2VB3X 1LT3D 2E2JB 5IOCA 3BVGA 4XQQA 3A7AB 1SYCA 2OEOA 2Z4IA 3PUYA 1DOLA 3W2DA 2BA0A 2Q8RE 2B2YC 3GD7A 3DMUA 1PXUA 3NQTA 4K6LA 1EY7A 1ENCA 2E2DC 1O7YA 1R9TB 1UUPA 4RHRA 2PCFB 3Q24A 3C2PA 2HCIA 1HTPA 2KCCA 4FNFA 1KDCA 1V8QA 2R7ZB 2E2HB 2HDLA 2LKVA 1PTOC 2A6ED 2XNAC 1OXSC 3PUWA 4R9WA 1R4QB 3KLSA 4C3JG 1I4GA 1UAPA 3J7AF 1KNAA 3SE0A 1BF4A 4PMWA 2EE1A 1LTSD 1B2TA 2F3VA 5IGCA 1NAPA 2F0LA 2JA5B 2EY5A 1HQMC 4CJ2C 3HOYB 2SEBD 2RQXA 3GV3A 1ET9A 4ZRZA 2AQ2B 1TQOA 3Q22A 1U4PA 5C4HA 1TS4A 2IX0A 2PZTA 1GUSA 1B53A 4A3BB 1HA6A 5CC4A 5NUCA 3K5NA 1GUNA 2HQEA 2B2YA 4A3FB 4RH6A 3NHHA 4FF2A 1PFNA 1CHPD 3CQZB 1SNMA 2G9HD 4RKBA 3L9AX 1QOHA 2KA7A 2EY1A 2RKSA 2IJ0A 1BXTA 3HOWB 2MUYA 1H9JA 2KVMA 1DXMA 1DONA 3EFXD 2OT2A 5G3LF 3TP7A 4KY7A 4DAVA 2AQ3B 1J9OA 4FXKC 3H09A 3V2TA 1BO0A 4PNYA 4TRDA 1M8AA 2JSOA 3H0GB 2VUMB 1YNJD 3H6MA 2DY8A 1HXYD 3S2HB 1JE4A 3S14B 3K5OA 3HEJA 4K8JA 4FO2A 5I2YA 3BDCA 2YU9B 5A35A 1RHPA 4DF7A 4B08A 4PMCA 1I4PA 2Q8TA 3J81L 2R92B 4XIGS 3BG3A 2XSCA 4OL7A 2BDOA 1BCPB 2IL8A 2PMZB 4ZYSA 1RF2D 1PTOD 5ISRA 5K36H 4C3HB 1D5XC 1I50B 2VNUD 4KD3A 3VYSA 3VA5A 5HGTA 4M8AA 5DAUA 3FKIB 3EVQA 3K7AB 4RGOS 3TP8A 2XVSA 4ZUIA 1CI3M 1ET6A 5M9OA 4XT3B 4C3IG 1PZID 5DM73 4QF4A 4X3SA 2R93B 1EL0A 4L6TB 1EYCA 4V0BA 3K58A 3GTQB 1U4MA 1VF7A 3NTKA 3VYUA 1KDBA 1F2MA 2A6HC 3S1NB 1DD2A 2HUGA 4RKLA 2D9UA 2L9HA 5CMDA 1BQQT 1LT6D 5JEAH 1CQFA 1DOKA 2EJMA 4H7BA 1T5XD 3S9WA 5EKKA 2DNCA 5IGEA 1IW7C 1X32A 3V05A 3LWUA 5CV7A 1W6JA 4L63B 2EYPA 5CR3A 5COYA 1V1PB 2LS01 2BDNA 4K5XA 2K04A 4DK1A 1O78A 1GUOA 1GJXA 5KIXA 1D5MC 3M4OB 5KEEA 3PIO3 2E75C 1ESRA 1MD2D 1V1OA 2F0SA 4FXGC 2PYKA 1EYDA 1SXTA 1RTNA 2X69A 5I4DA 3DUZA 5DM63 3SK8A 1Z47A 1WTOA 2L11A 3RZDB 4A3JB 1TWFB 1ZXTA 3WDNA 4CHTB 2JA7B 5IT9L 4RAUC 1A2UA 1EZ8A 2NWGA 3GQBA 1BNZA 5KNDA 1NR2A 1TVXA 5EKLA 3VYRA 4YIJA 3EJIA 1OXTA 4U68A 4R8IA 1A15A 5ELBA 3MA2B 5JVG3 3LWEA 2AQ1B 1SYFA 2PPBC 2CW0C 3J7YW 1CZWA 5C3EB 4C3JB 1IKMA 1BCPF 3RMHA 3BZDB 1ZYRC 1H9SB 3G7LA 3DWAA 1PZKD 1KNEA 3HOVB 2EXZA 1O7ZA 3W3AA 4CGYB 5IODA 3H94A 2K7VA 5ELDA 4HEDA 1Y8NB 1J8IA 4QUCA 4GZYC 5AFWA 4A3DB 2A74C 1XX8A 1CQVA 2I07B 3SVMA 3K0YA 5JPNC 4CBVA 1SBBB 3QB3A 3IKJA 4C1NK 5JPMC 2KUMA 5EPJA 2A68D 4FF3A 1QILA 2M9VA 4J8QA 1OXXK 2RDHA 5FLXL 3A7LA 3JAML 4XDXA 5FK9C 1D2BA 1O7LA 4K6DA 3OPOA 4QCLA 3SEBA 5FO9B 2L12A 2K32A 5C5MA 1SNQA 1E2ZA 4UDUC 4OIJA 2VB2X 4JBWA 4KTAA 3IL8A 4F8MA 4G57A 2HDMA 2BE5D 5C4ZA 3E0JA 3PUXA 2AUKA 1WTXA 2A6EC 4FVMA 1I4QA 1B3AA 4IUUA 5ELCA 3RD4A 1KDAA 4DNTB 1SYGA 1HHVA 3QIAA 3EA6A 1ML0D 4ME5A 1FR3A 3GO5A 5KNCA 3KBGA 4M1UB 3VR2A 2F0UA 3OOCA 1V1PA 1ESFA 1EZ6A 5BN3A 4MHEA 2EZVA 4E6IA 4O42A 2LY7A 2E74C 4OIKA 1OXUA 3PUZA 1Q1EA 4TSSA 1TY0A 4FP5D 5M5WB 1HPCA 2IWHA 3P20A 3HGBA 1F9RA 1D5ZC 1JR0D 4Q0FA 4J1MA 2F0IA 2J7ZA 3A54A 5CV4A 3NWTA 5K36G 3ND9A 5CBAE 1C4QA 4ABNA 2PNRC 3VR6A 2K6AA 2E2IB 3NE5B 1PTOB 2CW0D 1B44D 4DN4M 3KUPA 3FRPB 2K01A 1SMYD 1GHJA 1ZYRD 2M00A 3NQIA 2NB0A 4NDXA 3PUVA 5KRUA 2NZ1D 1VF5C 1S5ED 5D3DA 1LACA 1HFNA 5LL6X 1CHQD 4OO1H 3BVZA 1WVLA 3EQLC 1HCZA 1H9SA 1CA5A 5JEAG 1YNJC 2F0HA 1S5FD 5I9OA 1CZGA 3HOXB 3NBIA 5EGTA 2XN9C 1TT2A 1PRTD 2H1EA 3K6OA 1B9NA 3T53B 1LTRD 1KLGD 1A3VA 2F0NA 2NVQB 3S2DB 5M5XB 3J80E 3NBHA 3AB9A 2RDFA 2F0PA 1TS2A 3I91A 3HP3A 2F1MA 4XYOA 2B2UC 3OIQA 1ENAA 3DWQA 4KK7A 4HCEA 4B9WA 1S5CD 3SK4A 2PZUA 1RCVD 4K5VA 1AEXA 2KECA 5JOBA 4QB4A 1MSGA 2TMPA 5BN5A 4KJOA 2PW7A 3MXUA 3R8BA 4DFAA 4ILWA 1EY6A 1C8CA 2IPKD 1LTTD 3TMEA 5C3XA 2RA4A 1EIGA 2WIIB 1FGBD 2Y0SB 2B39A 1EYAA 2N55A 3I4LA 2Q8IB 1SE2A 1SNOA 1U4LA 5KNBA 2K28A 4IUNA 2SDFA 2WACA 1QE6A 3TSSA 1LT4D 2FINB 1TY2A 4IFDH 1H9KA 5EKIA 4CKEA 2NN6H 5F2DA 5FO8B 3NUCA 2JP1A 3FDTA 3X3NA 1SNDA 2Z1CA 2XRQD 4HR7B 3TP5A 1A3UA 2CHBD 2WAQB 4RGTA 3T16A 2EYJA 2B2UA 1EU3A 1PTOF 2PW5A 4G4KA 1F2LA 3I4MB 1CTMA 4DAYA 4ZLTF 3OW7A 5EBDA 3J7AV 2MJ8A 5A2QE 1AW7A 2JEAI 1EY0A 3KLSX 4KHVA 1GOZA 4HAEA 3O13A 4LJZC 1S5DD 3N6RA 3ONAB 1LABA 1U4RA 4RGMA 2JA8B 5FO7B 2LFNA 1TWHB 1STYA 4G7ZC 3NP8A 1QNKA 1M4VA 2F0VA 2ICIA 3A56A 1BDOA 5C4XB 1WTQA 2KCNA 4LMQD 2MP1A 3D6CA 4U673 5J1ZA 3H3VC 3MXGA 1U9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUN A;  3I4L A;  1O7L A;  1CFM A;  3FMC A;  2Q8I B;  1GHJ A;  1DCZ A;  3M85 A;  3QJY A;  4H44 C;  1V43 A;  3OPO A;  3D4R A;  3A7A B;  5KNB A;  3PUV A;  1GHK A;  3M7N A;  2QF7 A;  1VF5 C;  3I73 A;  3QG1 A;  4DNR B;  2ZT9 C;  2K32 A;  1LAC A;  2DN8 A;  2V4D A;  3PUY A;  2AWO A;  4KI0 A;  3VR4 A;  1H9R A;  2JXM B;  1E2Z A;  2KA7 A;  3VR5 A;  1ONL A;  3LNN A;  1Y69 U;  4OO1 H;  2A69 D;  3WDN A;  4JBW A;  4OO1 G;  4IFD H;  1H9K A;  2BA0 A;  2D62 A;  3EQL C;  4DK0 A;  2BE5 D;  5C0X H;  5BN4 A;  1CI3 M;  2D2C C;  3GD7 A;  1HCZ A;  3VR3 A;  2NN6 H;  3D31 A;  1H9S A;  3GQB A;  4IQZ A;  1I6V C;  2NN6 G;  3PUX A;  2AUK A;  3L7Z C;  5KND A;  1QJO A;  2A6E C;  1PMR A;  4BA1 I;  5JEA G;  1YNJ C;  2EJG C;  1ZKO A;  1H9J A;  1DXM A;  1G29 1;  4DNT B;  3QIA A;  1VF7 A;  2YYZ A;  3CRL C;  1OXT A;  1FR3 A;  3FPP A;  4KN7 C;  3IFT A;  1H9M A;  4HR7 B;  2PCF B;  2A6H C;  4G7H C;  1K8O A;  5KNC A;  2B8F A;  1DD2 A;  1B9N A;  1EWH A;  3BDO A;  3T53 B;  1GUT A;  3VR2 A;  1E2W A;  4KN4 C;  2E76 C;  2EDG A;  2LMC B;  4KKT A;  4OGQ C;  3SDZ A;  4TKO B;  3OOC A;  3VA7 A;  2PPB C;  2CW0 C;  1HTP A;  2KCC A;  2D5D A;  2BA1 A;  3A8I E;  3PV0 A;  5BN3 A;  3MFY A;  2JE6 I;  4KKU A;  1V8Q A;  1YNN C;  1CTM A;  3AB9 A;  4KHZ A;  2A6E D;  3CRK C;  4TQU S;  1FYC A;  4BA2 I;  5JEA H;  1OXS C;  2R6G A;  2E74 C;  3OW7 A;  3PUW A;  1B9M A;  1VCI A;  1ZYR C;  2EJM A;  1H9S B;  4KMU C;  2F1M A;  1OXU A;  3PUZ A;  3TZU A;  1Q1E A;  1Q90 A;  3I72 A;  3U9S A;  1A6X A;  1HPC A;  2A6H D;  3P20 A;  3HGB A;  2O5J C;  4RCN A;  1T5E A;  2EJF C;  3A8K E;  3W3A A;  2JEA I;  2DNC A;  3A8J E;  1Q12 A;  2A68 C;  2DNE A;  3H94 A;  2A69 C;  1IW7 C;  2K7V A;  3M4Y A;  3SE0 A;  3LWU A;  4LJZ C;  3N6R A;  1Y8N B;  1LAB A;  1Z6H A;  4G7O C;  2K33 A;  3RLF A;  1Q1B A;  1E2V A;  4I7Z C;  3T51 B;  2O5I C;  5A35 A;  3T56 B;  4GZY C;  5K36 G;  3ND9 A;  1SMY C;  1K8M A;  4G7Z C;  1O78 A;  1TKW B;  1GUO A;  4DK1 A;  2NN6 I;  1GUG A;  1HQM C;  1GJX A;  3DXJ C;  4PV1 C;  4H13 C;  1Z7T A;  5K36 H;  2PNR C;  5BN5 A;  1IYU A;  3MXU A;  1BDO A;  4L8J A;  3VR6 A;  3IKJ A;  1IYV A;  1VDZ A;  4JK1 C;  2L5T A;  2B8G A;  2A68 D;  2E75 C;  2EVB A;  1IW7 D;  3NE5 B;  4XTC S;  4KKS A;  1OXV A;  2AUJ D;  3ND8 A;  3BG3 A;  4XIG S;  4IFD G;  1Y8P B;  2IT1 A;  1GUS A;  1TU2 B;  5C0X G;  2BDO A;  3KLR A;  4LK1 C;  2BE5 C;  1OXX K;  1Y8O B;  4H0L C;  3A7L A;  2JEB I; 
#chains in the Genus database with same CATH topology
 4H02 A;  2EOT A;  3KF8 A;  2NVX H;  3GTK B;  2XWB B;  4P74 A;  1YHA A;  4JI7 Q;  4K14 A;  5IYC G;  5EBC A;  1HUM A;  5EJW A;  4A3G H;  1RDP D;  3M7N A;  1DM0 B;  2L4N A;  4DNR B;  2ZT9 C;  3BYT B;  4JC0 A;  4LF8 L;  1OO9 B;  1VMP A;  1YVC A;  3PMF A;  4WJ4 A;  4HTH A;  5LL6 S;  1RD9 D;  2NUC A;  5CGK A;  5AJ3 L;  1LTI D;  4POG A;  5C0X H;  2EY6 A;  5K5P A;  1KRT A;  3X3M A;  1WOC A;  2CQA A;  2KHS A;  1GD7 A;  4HIM A;  3J81 i;  1BKB A;  3MZ5 A;  2OCE A;  3NPP A;  4OX9 L;  1VS0 A;  4BY1 B;  4BBR H;  3C1F A;  4OWX B;  4HJ7 A;  1ASZ A;  2WB1 E;  2MPM A;  2ZTE A;  4CDD C;  1ICW A;  3E9I A;  1HUN A;  2NVX B;  5CV6 A;  4ZQ3 A;  2NYZ D;  2LSS A;  1E1O A;  4X3K A;  2EDG A;  2LMC B;  3SDZ A;  2F0F A;  4DK6 C;  1NMG A;  3CP0 A;  4DV4 L;  3CRK C;  3T1H L;  2IW3 A;  1EYG A;  3U4Z A;  4EQN A;  3GTM B;  4BA2 I;  3VYT A;  1P8L A;  2J4X A;  4A3M H;  1SJE D;  1A6X A;  3KBX A;  4IPC A;  5G3L D;  1NY4 A;  4BBR B;  2F0G A;  4JCV E;  1Q7Y C;  2A68 C;  1AZQ A;  2JYO A;  3FPU B;  5E3F A;  3MFG A;  3LX0 A;  3G6E A;  3S15 B;  3MXN A;  1VQO A;  2IHE A;  1SJH D;  3OMC A;  4HMJ A;  3HOX G;  4EGV A;  2FXQ A;  1HFG A;  4DV5 L;  1PHJ A;  1Q1B A;  3T56 B;  2K4K A;  3ER0 A;  5COR A;  1VQP A;  2SNS A;  3F8T A;  3MC0 B;  1XTD A;  4HJA A;  1AE3 A;  4A76 A;  1D8L A;  4BBS H;  4H13 C;  4RA8 A;  2KJX A;  3RUZ A;  4L8J A;  3QO2 A;  3CXC A;  1AP0 A;  5E4W C;  4NXM Q;  4JVZ A;  2KHI A;  1YZ6 A;  3HKZ B;  3FEW X;  1RTO A;  2IT1 A;  4HID A;  2UUA L;  2BE5 C;  4YWM A;  4IPD A;  4XXE A;  2EYM A;  3ERQ A;  2JEB I;  3Q6S A;  3HOU H;  1EQT A;  1CFM A;  2A1A A;  1STN A;  2QIL A;  2C35 B;  1VQ4 A;  2QDL A;  1EQV A;  2F0K A;  2BH8 A;  4JI1 L;  3KDF A;  3WOF A;  1BOS A;  4V19 0;  2KEN A;  3MVV A;  1F2Z A;  2MFI A;  1IBM L;  1JOQ A;  1PYW D;  2EY2 A;  1CA6 A;  4HJ5 A;  1L0Y B;  3I8Z A;  3I2Z A;  3GP7 A;  4Z9C B;  1MI2 A;  1PRT B;  3GTP H;  2YYZ A;  3BDL A;  3BZC A;  4ID6 A;  1IXR A;  3IFT A;  3ITP A;  4DPG A;  5FLM G;  4G7H C;  1MGS A;  3HOU B;  1CK1 A;  4BY7 H;  2C9O A;  2E76 C;  3VA7 A;  2ZXP A;  3W5O A;  4DV0 Q;  1I94 Q;  2CVR A;  1LO5 D;  1I5F A;  3OHX C;  1C48 A;  4LAA A;  5JEA J;  5DEH A;  4DUY L;  3BYY B;  4ZAI A;  2K05 A;  5JJL A;  1VCI A;  4DUZ L;  1IL8 A;  3CC4 A;  4LFB L;  1N8R C;  4OXP A;  2MNA A;  4A3E B;  2NBF A;  3PO3 G;  1TS5 A;  4KY6 A;  1ILP A;  3A8K E;  5IYD H;  2EPB A;  1ROD A;  1EEI D;  1JJ2 A;  1MIU A;  4ME3 A;  3PCO B;  4YCU A;  1Z6H A;  2B2W C;  1JWM D;  4BY7 B;  2O5I C;  3SR1 A;  4IUV A;  1SMY C;  2WAQ G;  3CAM A;  1WCM H;  3I56 A;  3DXJ C;  1JOO A;  1YIJ A;  3F2U A;  3I4M G;  1L0X B;  4DV6 L;  3K57 A;  1EWI A;  3RLN A;  2HCC A;  2XWJ B;  1E7Z A;  2RSO A;  1HTL D;  3ND8 A;  4IFD G;  2EXD A;  4DAP A;  4HCS A;  1TWC H;  1SN8 A;  5JVH 3;  4IUP A;  1BBW A;  3M3Y H;  1ENF A;  5L37 A;  1CKM A;  4MNO A;  3A5Z B;  4N9T A;  4F7X A;  2Y0S E;  3MEF A;  3H3V I;  3I7F A;  3NBH B;  4FDB A;  2GA4 B;  4A3I G;  4K5W A;  1LTL A;  4K2K A;  1B70 B;  2ES2 A;  2ZXO A;  5GAE C;  1PRT C;  3VR4 A;  2F03 A;  1TR5 A;  2QDB A;  2JA8 G;  4IAL A;  4FXD A;  1YHB A;  2SNM A;  1PH4 A;  3HOZ G;  1HZA A;  3CKI B;  4MN3 A;  4DR7 L;  4A3C H;  1E1T A;  1VQF A;  4ZKC B;  2WKD A;  1MBY A;  2NVY B;  3KK7 A;  5C44 B;  1QVG A;  5C4X G;  3D4W A;  1BVS A;  2B63 G;  2VY3 A;  2EJG C;  1GVP A;  2WFW A;  1BR9 A;  3HG9 A;  4IPG A;  4QMG A;  1TS3 A;  1GM5 A;  4Q5V A;  3JAM i;  4FYD A;  2SOB A;  1VQ7 A;  4A3L G;  1STE A;  1UE7 A;  3D3R A;  5M5Y H;  2FFK B;  2M2L A;  4AIM A;  1IBL Q;  1TXY A;  4KKT A;  2KEE A;  2IY5 B;  2IHF A;  1SAP A;  5GRO A;  1F2Y A;  3PGZ A;  3A8I E;  3RZO H;  3K7U C;  3D0F A;  4KKU A;  1B7Y B;  4RWS C;  4A93 H;  4IFD I;  3KJO A;  4DR6 Q;  2RBM A;  1SDF A;  3NXW A;  4HSV A;  3J81 j;  1LTA D;  2B2W A;  3V96 A;  3F2B A;  1X56 A;  1D6E C;  5J39 A;  5IWA Q;  1L0W A;  4RCN A;  4MTK A;  4C56 C;  4BY1 G;  3AU7 A;  3S1M H;  1N32 L;  1EIH A;  1PA6 A;  1KD1 C;  4JW0 A;  1I4H A;  1Q8I A;  2DUD A;  5M5Y B;  2K14 A;  1PH9 A;  1NR4 A;  3PO2 H;  4IUR A;  3T51 B;  1L1O B;  3Q8D A;  1YBY A;  2YTV A;  4DV1 Q;  1BCP D;  4JI5 L;  1HR0 Q;  1EFW A;  4MIU A;  3RN2 A;  3S1R H;  4A3G G;  1EY5 A;  2OQK A;  1I6H B;  4A93 B;  3U58 A;  1F9Q A;  1ZEQ X;  5M3M H;  4WFN 3;  2DY7 A;  4XTC S;  1OXV A;  3GTG H;  5C0X G;  1K83 H;  5CV8 A;  3OMG A;  4QJF A;  3Q23 A;  3I70 A;  3QR8 A;  5J3B A;  5IYB H;  4S3S A;  1W3S A;  2F4I A;  4BBR G;  2Z8L A;  4IO9 A;  3NTI A;  4KJN A;  1FNU A;  1Y1V H;  4H44 C;  2QEJ C;  4DAY B;  3A0J A;  4AYB G;  3PO2 B;  2DN8 A;  2V4D A;  1STG A;  1GUW A;  1ONL A;  1CSQ A;  1XXG A;  2CWP A;  5D14 A;  5I6W A;  4DV0 L;  3S1R B;  4DK0 A;  4WJ3 M;  4JG2 A;  3D6W A;  4Y7N B;  2A19 A;  4IJH A;  4RFB A;  3VR3 A;  2WIN B;  4KHP L;  2WKC A;  5M3M B;  3DWP A;  3L7Z C;  3E5S A;  3HZX A;  2JK8 A;  3H15 A;  4KLK A;  1ZKO A;  1PDQ A;  3U4V A;  3GTG B;  3S1Q H;  3HKZ G;  4A3M G;  1QWY A;  2K52 A;  4ODG A;  1PZJ D;  4KV6 A;  4OEL B;  2GN5 A;  1XPR A;  4X66 Q;  5C4J H;  4OGQ C;  4ZUJ A;  5IP7 H;  2TSS A;  4F87 A;  2E2J H;  3CHB D;  1V9P A;  2JE6 I;  1VQG A;  2F0E A;  1KL9 A;  1SNP A;  4KY5 A;  3OTO Q;  4RHS A;  3PIP 3;  1AN8 A;  1S5B D;  3HKS A;  1HRJ A;  1K0R A;  4BBS G;  3KF8 B;  5KYI A;  1L1O C;  1BUV T;  3P75 A;  3OIP A;  2EJF C;  3GTO H;  5HY6 A;  2N3S A;  4PZ7 A;  3S1Q B;  3CW2 C;  3M4Y A;  2N88 A;  3U50 C;  1R9T H;  3J80 L;  4K2L A;  1PFM A;  2F4V L;  2QKI C;  3IAY A;  1D1K A;  4LUV A;  5C4J B;  4OX9 Q;  4ULL A;  4GNX C;  3HOU G;  4BS9 A;  3R2T A;  1EU4 A;  5EQ0 A;  3S16 B;  5ELO A;  3K5M A;  2R7Z H;  1RL2 A;  2PO4 A;  1XJV A;  1XPU A;  1SE8 A;  2AMC B;  3OSO A;  1SNC A;  3QWN A;  3WOE A;  4LK1 C;  4WOR A;  4OON A;  1UE5 A;  4GLA C;  1X3P A;  4H0L C;  4L5Q A;  3GTO B;  3TQY A;  4N8X 1;  5I9P A;  1QVF A;  2F0W A;  2MHV A;  4CJ0 B;  3AFQ A;  5DLQ E;  3I4N H;  3URY A;  1WD0 A;  1X6O A;  3QG1 A;  2OXP A;  3NK9 A;  1IBL L;  5E4X A;  1G91 A;  4BY7 G;  3VR5 A;  2C5C A;  2K5Q A;  4OHJ A;  2JA5 H;  3HOY H;  3R3O A;  2F3W A;  4WJW A;  4FF1 A;  1FD7 D;  5CV9 A;  3K80 C;  4R4C A;  1O80 A;  4QL5 A;  2ID0 A;  4XQJ A;  5IGD A;  5IGB A;  5E1F A;  5J22 A;  5JJI A;  1MJC A;  2OQ0 A;  1GKH A;  3NWS A;  3GTJ H;  1K8A C;  2OTL A;  3J81 c;  3SK5 A;  5IWA L;  2B8F A;  1EWH A;  1JE5 A;  2A8V A;  1WTR A;  1CM9 A;  3DM1 A;  1KAB A;  2K5D A;  4XQN A;  5IYD G;  1L1O A;  1FGU A;  3I4N B;  1X3Q A;  2RCN A;  3E0E A;  3IFD A;  2UUA Q;  3CQZ H;  3PO3 B;  4KHZ A;  3A55 A;  4R1J A;  2V1C C;  4DV1 L;  1HR0 L;  5JAV A;  3OWE B;  1WCM G;  1IYJ B;  5IE8 A;  1PV4 A;  3HOW H;  5IP9 H;  1EIY B;  3CU7 A;  4GNX A;  4UAI A;  3K59 A;  2OF1 A;  3DEP A;  3A8J E;  2F0M A;  5EPL A;  1B3Q A;  4IUT A;  3GTJ B;  3TEH B;  3K5L A;  3MAQ A;  1JC7 A;  3E9H A;  1E2V A;  5IGG A;  1HZC A;  1QCB D;  2NTT A;  2A5H A;  3SXH A;  1K8M A;  4DR2 Q;  2XRS D;  4DXG A;  4JI8 Q;  4PV1 C;  2QW7 A;  1P16 A;  4X3T A;  3H91 A;  5A2Q L;  1GO3 E;  5FJ8 H;  1PYB A;  2UUC L;  2CH4 W;  2VUM H;  4A3K B;  1JOR A;  2KOL A;  3F1Z A;  3MHB A;  4KKS A;  1A2T A;  2AUJ D;  1XNQ Q;  2AHO B;  4IZ8 A;  5JJZ A;  2LXJ A;  4A3I B;  4A3C G;  3S2H H;  3ERO A;  3S14 H;  1UNS A;  2XTI A;  3S17 H;  2WP8 J;  1EOT A;  1DCZ A;  1CUK A;  1A62 A;  4DGZ A;  2ZM6 L;  4DR4 L;  3HOZ B;  5LHY 1;  3NEN A;  3D4R A;  4EQ5 A;  1VQI A;  1G6Z A;  1GHK A;  2YU9 H;  4IFD J;  4X66 L;  3ZYY X;  1H9R A;  4HN7 A;  1Y69 U;  2B63 B;  2A73 B;  1EOV A;  1KTK A;  2VQE Q;  2K50 A;  1LYL A;  2D2C C;  1SFO B;  2WV6 D;  5IIF A;  3GTL H;  4A93 G;  4XT1 B;  1M1K C;  1Q46 A;  1LLR D;  4QGU A;  3BU2 A;  2UUB Q;  2R92 H;  2Q2T A;  2Q2U A;  1STA A;  4KN7 C;  3MWY W;  4X3U A;  3G48 A;  1H9M A;  1K8O A;  2I5H A;  1L2F A;  3FVQ A;  1WTP A;  3S17 B;  4C3H H;  2QA4 A;  4DV6 Q;  1U0L A;  4KN4 C;  1I50 H;  4NP5 A;  4YHH Q;  3W1G A;  3UE1 A;  2PQA A;  1B1Z A;  4NKL A;  4EVO A;  1YNN C;  1X55 A;  3FKI H;  3NTH A;  3PO2 G;  5C6A A;  1J5E L;  2K5N A;  3D8G A;  4R8N A;  3K7A H;  1F77 A;  3TZU A;  3DEO A;  2ZXR A;  3U9S A;  1QUQ A;  3GTL B;  2BOS A;  2KED A;  3DHQ A;  4O0A A;  2KHJ A;  4BWG B;  1G2S A;  1SYB A;  4HSP A;  1LV9 A;  2PQE A;  3UDF A;  5M3M G;  2FJ2 A;  1EY4 A;  1Q3L A;  3J81 E;  1I4R A;  1SYD A;  1IHZ A;  2A69 C;  3EBE A;  2R93 H;  1EQR A;  4PQX A;  5LMN W;  3GTQ H;  1BBX C;  4A3G B;  4K8I A;  4GN4 B;  4DR7 Q;  3GV6 A;  4I7A A;  1Y1W H;  3S1N H;  5IYB G;  3P1H A;  2VS1 A;  1VMC A;  5CBE E;  4MTN A;  1TKW B;  1Y1V G;  3NEM A;  4CKC A;  4DV3 L;  4P2C B;  1OTC A;  1JIC A;  2K75 A;  5BR8 Q;  4QUF A;  4DU9 A;  3P7J A;  4DV7 Q;  5CV5 A;  1JWS D;  1XYI A;  4F88 A;  1UEA B;  4AYB B;  2J0T D;  3SHL A;  3TZD A;  1Q82 C;  1WI5 A;  2UXC Q;  3M85 A;  1UE6 A;  4CDC C;  3HS0 C;  2EIF A;  1V43 A;  3F2C A;  2YTY A;  1Y1W B;  3QOL A;  1JOK A;  1VQ6 A;  4C1N I;  5C0X J;  5IGF A;  1X3G A;  3D4D A;  4OO1 G;  1AZP A;  1FJG Q;  5IP7 G;  1CT1 D;  2D62 A;  1JQY D;  4A3M B;  2ATW A;  1HQR D;  1N32 Q;  3CF5 A;  3D31 A;  1F9P A;  1I4X A;  2Q2H A;  3M4O H;  1PVO A;  1I6V C;  1QJO A;  1C0A A;  2D0O A;  4IUQ A;  1PMR A;  1XNR Q;  1RKN A;  1DOM A;  1G29 1;  3W1B A;  4JI5 Q;  3TBI B;  2RVL A;  1XWE A;  4PG3 A;  2PZW A;  1XMO Q;  1E2W A;  2NTS A;  4GN3 B;  1NSN S;  2E8G A;  2RDG A;  2L1B A;  4BBS B;  5FLX c;  3MFY A;  3JAM c;  2MGS A;  1B4O A;  4QQB X;  4FF4 A;  4R4I A;  3RZD H;  2FHT A;  1FYC A;  3UI2 A;  4A3J H;  4BXX H;  4DR2 L;  1VQE A;  5I2X A;  1BCP C;  4DA2 A;  4JI8 L;  5HUR A;  3ULP A;  1KXL A;  1NCV A;  1X3E A;  5I6Y A;  1TWG H;  2F0D A;  4IOA A;  2JA7 H;  2R7Z G;  5M3F H;  4JV5 L;  1PH2 A;  1JJC B;  1Q12 A;  1Y14 B;  3AMU A;  2DNE A;  2IX3 A;  3MXP A;  1XNQ L;  4N9P A;  1HZ9 A;  3N52 A;  2ENB A;  5D3I B;  1WTW A;  4OO1 I;  2XIW A;  1RJT A;  3NSW A;  2F0T A;  2K33 A;  4PMB A;  4KHP Q;  1WYD A;  1EEF D;  4WRD A;  3C46 A;  1G8Z D;  1VQ9 A;  2HIV A;  3TS0 A;  2O2L D;  4ZKB B;  3I4N G;  4YCW A;  4C3J H;  1IYV A;  2Z4H A;  2L5T A;  4I65 A;  1QVC A;  2DJG C;  2B2T C;  2EVB A;  1TII D;  2G5D A;  4NW2 A;  2JA5 G;  2VQE L;  3GTP B;  4HIO A;  4HIK A;  3HOY G;  1TWG B;  2N78 A;  1SEB D;  1YNN D;  5M3F B;  3HOV H;  4J6H A;  5IT9 E;  5E7N A;  3SK6 A;  4O1N A;  2L0C A;  2EYH A;  2UUB L;  3QJY A;  2K1B A;  1AFP A;  3AEV A;  3I73 A;  1LUZ A;  4KI0 A;  2JXM B;  4L5R C;  4EQP A;  2A69 D;  4A3D H;  4YHH L;  1KLU D;  1I3Q H;  1SSO A;  2QCP X;  4LFA L;  1HA5 A;  4CDF C;  1G2T A;  1DJR D;  2NN6 G;  1II3 A;  2F4V Q;  2YTX A;  4A3K G;  3E6Z X;  5FOB B;  4R4O A;  2X6G A;  2RF4 A;  2EYO A;  3LGJ A;  3HOW G;  3FPP A;  1F9S A;  5IP9 G;  2B2V C;  5D65 A;  2L55 A;  1A3T A;  2Z6B A;  5ELF A;  4AQY Q;  1GUT A;  2G9D A;  2O4X A;  1NUC A;  4NMZ A;  3CCV A;  1VQN A;  1K0S A;  4TKO B;  1WCM B;  1EFI D;  2MO1 A;  2D5D A;  2HHH Q;  1E0B A;  4B3R Q;  2EYF A;  1DZ1 A;  5TSS A;  5C3W A;  1S40 A;  4CKB A;  4TQU S;  2R6G A;  1SE4 A;  1TWA H;  3TS2 A;  4B9X A;  1I3Q B;  4KMU C;  2KQ3 A;  1Q90 A;  3I72 A;  4RMF A;  1TWC B;  2A6H D;  2Q2I A;  1SLJ A;  5FJ8 G;  4EQO A;  2VUM G;  5BR8 L;  2CCZ A;  1VQJ A;  3M3Y B;  4RCO A;  2F0O A;  1W6K A;  4QIW B;  3TN2 A;  3I3C A;  4DV7 L;  2H4O A;  1A63 A;  3HRZ C;  2B2T A;  4O2D A;  3TP6 A;  2WAQ E;  5EPK A;  5FLX E;  4G7O C;  4I7Z C;  3JAM E;  1VQ5 A;  2UXC L;  4LF4 Q;  3Q0A A;  1JWU D;  2R61 A;  1STH A;  5KGU A;  2NN6 I;  3J7Z C;  1GUG A;  1PLF A;  3G71 A;  1EIF A;  2NVT H;  1IYU A;  5ELE A;  4JK1 C;  2RSN A;  2B8G A;  3RN5 A;  1TWA B;  1SYE A;  4C2M H;  1D1I A;  5CYU A;  3L3O C;  1IW7 D;  1SMX A;  5DNF A;  2ICE C;  1E3P A;  1FJG L;  1TU2 B;  1SRU A;  3KLR A;  4HMI A;  5FKA C;  3T13 A;  2WB1 B;  5BN4 A;  4MZ9 A;  3G6J B;  3L2P A;  1EY8 A;  4JBJ A;  1XNR L;  3TRZ A;  2R92 G;  1ILQ A;  2F0J A;  2EYL A;  1JMC A;  1FNW A;  1SRO A;  1PRT F;  3BVM A;  3I90 A;  1GXD C;  1NMF A;  5T1G A;  3RZO B;  2QF7 A;  3R93 A;  1KAA A;  5EAY A;  4YWL A;  2AWO A;  4C3H G;  3MTS A;  1XMO L;  3LNN A;  3OWF A;  1EUJ A;  1LTB D;  2B2V A;  1QB5 D;  1LTG D;  4GNX B;  2NVT B;  3STB D;  1MSH A;  2JA6 H;  4IQZ A;  1KC8 C;  4C2M B;  3U9O A;  3FKI G;  1PH8 A;  1QG7 A;  4KD4 A;  1JCK B;  4BA1 I;  1PTO H;  3S1M B;  1WD1 A;  3CRL C;  1A0I A;  2IX1 A;  2UXD Q;  1IKL A;  2YV5 A;  1B50 A;  1KQS A;  2UUC Q;  1VQB A;  3C3L A;  1R4P B;  3BDO A;  2EQS A;  1QNU A;  1VQD A;  2R93 G;  2R3Z A;  1X3F A;  3QOJ A;  2BA1 A;  3PV0 A;  3TDQ A;  5KYL A;  1B8A A;  3CC2 A;  2VXW A;  4JBM A;  4C3I H;  1Y1W G;  1LT5 D;  1B9M A;  1JB3 A;  2FMM A;  2I5M X;  1AH9 A;  4DR4 Q;  5C5L A;  2ZM6 Q;  1K83 B;  1CKN A;  3M7G A;  1SE3 A;  1H95 A;  4X65 L;  3C1E A;  2JA6 B;  2O5J C;  4CJ1 B;  3OW2 A;  1U5K A;  1VQC A;  1T5E A;  1VQA A;  2AWN A;  2FMC A;  2F0Q A;  3BS1 A;  4ZK9 B;  1FNV A;  1KHI A;  4TVA B;  4Y52 H;  1Y1V B;  3R2I A;  3HOX H;  4DXF A;  4IN3 A;  2OTJ A;  1S4Z A;  4B3S Q;  4DK3 C;  1XTC D;  1PH1 A;  3ICE A;  2JN4 A;  3RLF A;  4JI3 L;  5C0X I;  2I46 A;  1VQM A;  2UU9 L;  1EWC A;  3AFP A;  2NVQ H;  3S2D H;  1Z7T A;  2K03 A;  4JI0 L;  5M5X H;  1VDZ A;  1DYQ A;  2RCF A;  4C3I B;  2BCO A;  5T1I A;  4RGN A;  1EY9 A;  2VW9 A;  1YNX A;  1PFB A;  1K28 A;  4R4T A;  3T4A C;  1WTV A;  1V1Q A;  4A75 A;  3GDE A;  1Y8P B;  2X6L A;  3F2D A;  2K5W A;  1STB A;  3KOJ A;  1Y8O B;  4XYQ A;  3MEH A;  3FMC A;  1J5E Q;  2PQA B;  1LT3 D;  2VB3 X;  3G4S A;  4AYB E;  5IOC A;  2E2J B;  3BVG A;  3J80 i;  4XQQ A;  3A7A B;  1SYC A;  2LXK A;  3CMA A;  2OEO A;  2Z4I A;  1N36 Q;  1YIT A;  1K3B C;  1WTH A;  2PI2 A;  2E2H H;  3PUY A;  4AQY L;  1DOL A;  3W2D A;  1QUQ B;  2BA0 A;  2KCT A;  2Q8R E;  2HHH L;  2B2Y C;  3GD7 A;  4B3R L;  3DMU A;  1PXU A;  3NQT A;  3UDI A;  4K6L A;  4YWK A;  4BXX G;  1EY7 A;  4PZ8 A;  1ENC A;  3HKZ E;  4A3J G;  2E2D C;  2R7D A;  1Q8K A;  1HH2 P;  1O7Y A;  2B29 A;  1R9T B;  5FLM H;  2H5X A;  1UUP A;  4RHR A;  4DV3 Q;  2JA7 G;  2PCF B;  3Q24 A;  5M3F G;  3C2P A;  1HNZ L;  2HCI A;  1HTP A;  1X54 A;  4GKJ L;  4LF9 Q;  2KCC A;  4FNF A;  1KDC A;  1V8Q A;  2R7Z B;  3H3V H;  2E2H B;  2HDL A;  2LKV A;  1PTO C;  2A6E D;  2XNA C;  4LF4 L;  1OXS C;  4J15 A;  3PUW A;  4R9W A;  1IZ6 A;  3PIP A;  3PQI A;  4LFC Q;  1R4Q B;  3KLS A;  3UDX A;  4A3B H;  4C3J G;  1MHW C;  1I4G A;  1UAP A;  2MQH A;  3J7A F;  1KNA A;  4UP9 A;  4A3F H;  3SE0 A;  1XMQ Q;  1ASY A;  1BF4 A;  4PMW A;  2EE1 A;  1LTS D;  1B2T A;  4DR5 Q;  4GLV B;  2F3V A;  5IGC A;  4UY8 C;  3KF6 A;  1NAP A;  2F0L A;  2JA5 B;  2EY5 A;  1HQM C;  4CJ2 C;  3HOY B;  2SEB D;  2RQX A;  3GV3 A;  1ET9 A;  4DR3 L;  4ZRZ A;  2AQ2 B;  1TQO A;  2CWA A;  1WFQ A;  3Q22 A;  1U4P A;  5C4H A;  1TS4 A;  1M90 C;  4A3D G;  2IX0 A;  2PZT A;  1NTG A;  1GUS A;  2CFM A;  1B53 A;  4A3B B;  3CCS A;  1HA6 A;  5CC4 A;  4LNQ A;  5NUC A;  3K5N A;  1GUN A;  2CQO A;  2HQE A;  2B2Y A;  2XGT A;  2ZJP A;  4A3F B;  4RH6 A;  3RR5 A;  2F3I A;  3NHH A;  4FF2 A;  1PFN A;  1CHP D;  2UXD L;  3CQZ B;  1SNM A;  1YJW A;  3H0G H;  2G9H D;  4RKB A;  4POF A;  1LM0 A;  1C9O A;  3L9A X;  4JV5 Q;  1QOH A;  2KA7 A;  1TWH H;  2EY1 A;  2RKS A;  2IJ0 A;  1BXT A;  1NJI C;  3RNU A;  3CCL A;  3HOW B;  3T1Y Q;  2MUY A;  5C4X H;  3ULJ A;  1E24 A;  1H9J A;  2KVM A;  1DXM A;  4UPA A;  1DON A;  3EFX D;  2OT2 A;  5G3L F;  3TP7 A;  4IOC A;  1PH7 A;  1JJG A;  4KY7 A;  2WB1 G;  2AQ3 B;  4DAV A;  1J9O A;  1UWV A;  1K3R A;  4FXK C;  3H09 A;  3V2T A;  1BO0 A;  4PNY A;  4B3S L;  4TRD A;  1M8A A;  2JSO A;  3H0G B;  2VUM B;  1YNJ D;  3H6M A;  4X64 Q;  2DY8 A;  1HNW L;  4N8F A;  1HXY D;  3S2H B;  1JE4 A;  5H1S E;  3S14 B;  4LF6 L;  2Z9H A;  4R4Q A;  1J6Q A;  3K5O A;  3HEJ A;  4K8J A;  3K8A A;  4FO2 A;  3VDY A;  1HZB A;  5ELN A;  5I2Y A;  4LFA Q;  3BDC A;  4DNI A;  1VQ8 A;  4QIW E;  2YU9 B;  5A35 A;  1RHP A;  2E5L Q;  1EQQ A;  4DF7 A;  4GKK L;  2AKW B;  4B08 A;  1N36 L;  4LF5 L;  4PMC A;  1I4P A;  2VZA A;  2Q8T A;  3J81 L;  3GTM H;  2R92 B;  3PSI A;  4XIG S;  3BG3 A;  3PF5 A;  2XSC A;  4OL7 A;  2BDO A;  4GLX A;  1BCP B;  1G6P A;  5IT9 c;  2IL8 A;  2PMZ B;  4ZYS A;  4P73 A;  1RF2 D;  3M4P A;  1PTO D;  5ISR A;  2JA6 G;  5K36 H;  4C3H B;  4YCV A;  1D5X C;  2QGQ A;  1I50 B;  4X62 Q;  4KD3 A;  2VNU D;  3VYS A;  1HNX L;  3S15 H;  3VA5 A;  4APV A;  5HGT A;  4M8A A;  3UDG A;  5DAU A;  2ASB A;  3FKI B;  3EVQ A;  3K7A B;  3BJU A;  5LMU Q;  4RGO S;  3TP8 A;  4LF9 L;  2XVS A;  4ZUI A;  1CI3 M;  4L5T A;  3KFU A;  3CCE A;  1ET6 A;  4B3M Q;  5M9O A;  4XT3 B;  4C3I G;  1E22 A;  1PZI D;  5DM7 3;  4JYA Q;  4QF4 A;  4X3S A;  4K0K Q;  2R93 B;  1EL0 A;  4LFC L;  4L6T B;  1EYC A;  4V0B A;  3B6Y A;  3K58 A;  1U4M A;  1VF7 A;  3GTQ B;  3NTK A;  3VYU A;  1KDB A;  1F2M A;  2A6H C;  3S1N B;  4DV2 Q;  1DD2 A;  4JBK A;  1HR0 W;  2HUG A;  2UXB Q;  4RKL A;  2D9U A;  4UP7 A;  2L9H A;  1XMQ L;  4LWC A;  1YHQ A;  5CMD A;  2HQL A;  4DR5 L;  4GN5 A;  1BQQ T;  1LT6 D;  5JEA H;  4NXN L;  3M4Q A;  1CQF A;  1DOK A;  3I4O A;  2EJM A;  4H7B A;  4JOI C;  1T5X D;  1PH5 A;  2JJQ A;  3CCQ A;  3S9W A;  5EKK A;  2DNC A;  5IGE A;  4A4I A;  1IW7 C;  1X32 A;  3V05 A;  3A74 A;  3LWU A;  4L5S A;  5CV7 A;  4IPH A;  3CC7 A;  1W6J A;  4L63 B;  2EYP A;  5CR3 A;  3ULL A;  5COY A;  1V1P B;  2LS0 1;  2BDN A;  4K5X A;  2K04 A;  5GQO A;  1TWF H;  2VL6 A;  1O78 A;  4DK1 A;  1GUO A;  1GJX A;  5KIX A;  1D5M C;  1HJP A;  3M4O B;  3CCJ A;  5KEE A;  3PIO 3;  2E75 C;  1ESR A;  1MD2 D;  1AE2 A;  1V1O A;  2F0S A;  4FXG C;  3UE0 A;  4X6A H;  2PYK A;  1EYD A;  1SXT A;  1RTN A;  2I0Q A;  3T1Y L;  3STB C;  2DGY A;  4P71 A;  4A3E H;  2K5H A;  2X69 A;  3NEL A;  5I4D A;  1FVI A;  3DUZ A;  5DM6 3;  3SK8 A;  3KJP A;  2OWO A;  4AH6 A;  4CDE C;  1Z47 A;  1WTO A;  5C3E H;  2Y0S G;  4X65 Q;  2L11 A;  3RZD B;  4A3J B;  1TWF B;  1CKN B;  1ZXT A;  3WDN A;  3E3X A;  3CME A;  4DR1 Q;  4CHT B;  2JA7 B;  5IT9 L;  4RAU C;  1A2U A;  1EZ8 A;  2NWG A;  3GQB A;  4P75 A;  1BNZ A;  1X65 A;  5KND A;  3FHW A;  3I55 A;  4JI3 Q;  1YJN A;  1NR2 A;  4X64 L;  1TVX A;  2UU9 Q;  5EKL A;  3VYR A;  4YIJ A;  3EJI A;  1OXT A;  4U68 A;  4R8I A;  1A15 A;  4A3B G;  4JI0 Q;  1YI2 A;  5ELB A;  3MA2 B;  5JVG 3;  3LWE A;  3IRB A;  4PZ6 A;  2HD3 A;  4JOI A;  3WWV A;  2AQ1 B;  1SYF A;  2NZH A;  5GAG C;  1KIX A;  2CW0 C;  2PPB C;  3J7Y W;  5JJK A;  4A3F G;  1CZW A;  5C3E B;  2QEX A;  4C3J B;  1IKM A;  1BCP F;  2E5L L;  3RMH A;  4JI7 L;  3BZD B;  1ZYR C;  1QZG A;  1H9S B;  3G7L A;  3DWA A;  3OYY A;  1PZK D;  1KNE A;  1KRS A;  3HOV B;  3HFZ B;  2EXZ A;  2NVY H;  5C44 H;  1O7Z A;  3W3A A;  4CGY B;  1XPO A;  3PIO A;  5IOD A;  3H94 A;  2K7V A;  5ELD A;  4HED A;  1S72 A;  2ZTD A;  3S24 A;  4JPB W;  1Y8N B;  1KAW A;  1J8I A;  4QUC A;  1MJE A;  4P72 A;  4GZY C;  3K81 C;  5AFW A;  4X62 L;  4A3D B;  2A74 C;  1XX8 A;  1CQV A;  2I07 B;  5GAH C;  3SVM A;  3K0Y A;  4B3T Q;  5JPN C;  4CBV A;  4ZCK A;  1JB7 A;  1SBB B;  3QB3 A;  3IKJ A;  4JI2 Q;  2CH4 A;  4C1N K;  4LUO A;  2KUM A;  5EPJ A;  5JPM C;  1N34 Q;  3H0G G;  2A68 D;  4FF3 A;  5LMU L;  1HNZ Q;  1QIL A;  4GKJ Q;  1C7Y A;  2M9V A;  4J8Q A;  1OXX K;  2RDH A;  5FLX L;  4B3M L;  3A7L A;  3JAM L;  4XDX A;  5FK9 C;  4JYA L;  1D2B A;  1O7L A;  4K0K L;  4K6D A;  3OPO A;  4QCL A;  3SEB A;  5FO9 B;  2RHS B;  2L12 A;  4GOP B;  2Z6K C;  5LMN Q;  3CCR A;  4JI6 Q;  2K32 A;  3L0O A;  4LF7 Q;  4DV2 L;  5C5M A;  5GAD C;  2UXB L;  2GVB A;  1SNQ A;  1E2Z A;  4UDU C;  4OIJ A;  2VB2 X;  4JBW A;  4KTA A;  2HIX A;  3IL8 A;  4F8M A;  4G57 A;  2HDM A;  2BE5 D;  3J80 c;  5C4Z A;  3CCM A;  1I6H H;  1MKH A;  3AYH B;  5M5W H;  3E0J A;  4ALP A;  4EX5 A;  3PUX A;  2AUK A;  1WTX A;  2A6E C;  3CPF A;  4FVM A;  1I4Q A;  1B3A A;  4IUU A;  5ELC A;  3RD4 A;  1KDA A;  5IYC H;  4DNT B;  1SYG A;  3A5U A;  1HHV A;  3QIA A;  3EA6 A;  1ML0 D;  4ME5 A;  1FR3 A;  2K5V A;  3KF6 B;  4NXM L;  3GO5 A;  4DR3 Q;  5KNC A;  3KBG A;  1CKO A;  4M1U B;  3VR2 A;  2F0U A;  3M9B A;  3OOC A;  1V1P A;  1N33 Q;  1ESF A;  1EZ6 A;  4DKA C;  2VQF Q;  5BN3 A;  4MHE A;  2EZV A;  2E2I H;  4E6I A;  4O42 A;  2LY7 A;  2HT1 A;  2E74 C;  4OIK A;  1OXU A;  3PUZ A;  1Q1E A;  4TSS A;  1TY0 A;  2I5L X;  4FP5 D;  1HPC A;  4IJL A;  4Y7N H;  5M5W B;  1Z9F A;  2IWH A;  2JQO A;  2N8N A;  3P20 A;  3HGB A;  1F9R A;  1D5Z C;  1JR0 D;  4Q0F A;  4OWT B;  2BH2 A;  4J1M A;  2JA9 A;  1PH6 A;  3CD6 A;  2F0I A;  2J7Z A;  3A54 A;  5CV4 A;  3NWT A;  5K36 G;  3ND9 A;  2F52 A;  5CBA E;  2L15 A;  1C4Q A;  1FL0 A;  2B3G A;  1IBK Q;  4ABN A;  2ALY B;  3DLL A;  2PNR C;  3VR6 A;  2K6A A;  2E2I B;  1CSP A;  3NE5 B;  1PTO B;  4DR1 L;  1ICF B;  2CW0 D;  2Z6K A;  1I94 L;  1IL2 A;  4GOP C;  1B44 D;  4DN4 M;  3KUP A;  2KBN A;  3FRP B;  2K01 A;  1SMY D;  1GHJ A;  4RG1 A;  1ZYR D;  2M00 A;  3NQI A;  2NB0 A;  4NDX A;  2PMZ E;  1HNW Q;  3PUV A;  4OEM B;  1VQH A;  5KRU A;  2NZ1 D;  1VF5 C;  1S5E D;  5D3D A;  1LAC A;  2KCM A;  1HFN A;  5LL6 X;  1CHQ D;  1WJJ A;  4OO1 H;  3SGI A;  1YJ9 A;  1SR3 A;  3BVZ A;  4YY3 Q;  4LF6 Q;  1WVL A;  3EQL C;  3CCU A;  3S16 H;  1HCZ A;  4JI4 Q;  1H9S A;  1CA5 A;  2P5Z X;  5JEA G;  1YNJ C;  2F0H A;  1S5F D;  1K8G A;  5I9O A;  3EIV A;  1CZG A;  3HOX B;  3NBI A;  5EGT A;  4GKK Q;  2XN9 C;  3AQQ A;  1BBU A;  2D0P A;  3KYH C;  1TT2 A;  1PRT D;  4LF8 Q;  1JT8 A;  2H1E A;  3K6O A;  4LF5 Q;  1B9N A;  3T53 B;  1Q81 C;  1LTR D;  5AJ3 Q;  1KLG D;  1A3V A;  2F0N A;  2NVQ B;  3S2D B;  5M5X B;  3J80 E;  3NBH A;  3AB9 A;  2RDF A;  2F0P A;  1TS2 A;  3I91 A;  4OWW B;  3HP3 A;  2F1M A;  4B3T L;  4XYO A;  1HNX Q;  2NZO A;  2B2U C;  3OIQ A;  4JI2 L;  1ENA A;  3DWQ A;  4KK7 A;  1N34 L;  4HCE A;  4B9W A;  1S5C D;  2CKZ B;  3SK4 A;  2PZU A;  4A3E G;  1RCV D;  4DV4 Q;  4K5V A;  1NBW A;  2ZJQ A;  1AEX A;  3T1H Q;  2KEC A;  4GOP A;  1Q86 C;  5JOB A;  1VQK A;  4QB4 A;  1MSG A;  2TMP A;  5BN5 A;  4KJO A;  2PW7 A;  3MXU A;  5LMN L;  3R8B A;  5C3E G;  1PYS B;  4JI6 L;  3PO3 H;  4DFA A;  4LF7 L;  4ILW A;  3PF4 A;  1EY6 A;  5IY0 A;  1UE1 A;  1C8C A;  1QZH A;  4LW1 A;  2IPK D;  2R7F A;  1YEZ A;  1PH3 A;  1LTT D;  3TME A;  5C3X A;  3ZJY C;  2RA4 A;  1EIG A;  2WII B;  1FGB D;  2ZTC A;  4DR6 L;  2Y0S B;  4DV5 Q;  4NB3 A;  2B39 A;  1EYA A;  3HOV G;  3MXN B;  2N55 A;  3I4L A;  4NPS A;  2Q8I B;  2DJF C;  4QY7 A;  1SE2 A;  1SNO A;  1U4L A;  4NXN Q;  1RIP A;  2N49 A;  5KNB A;  2K28 A;  4IUN A;  2SDF A;  3J7A 5;  2WAC A;  1QE6 A;  3TSS A;  3BZK A;  3I4M H;  1LT4 D;  3KLW A;  2FIN B;  1K73 C;  1TY2 A;  1K9M C;  1N33 L;  4IFD H;  1H9K A;  3CPW A;  2VQF L;  5EKI A;  4CKE A;  2NN6 H;  5F2D A;  5FO8 B;  2ZJR A;  1VQL A;  4A3K H;  3NUC A;  2JP1 A;  1NNX A;  3FDT A;  3X3N A;  1N9W A;  1G51 A;  1SND A;  2Z1C A;  4A3I H;  4JI1 Q;  2XRQ D;  4HR7 B;  3K0X A;  2GVA A;  4UP8 A;  5C44 G;  3TP5 A;  1A3U A;  2JA8 H;  2CHB D;  2WAQ B;  3ERS X;  4RGT A;  3RLO A;  1S3O A;  3KDF B;  3T16 A;  2EYJ A;  2PNH A;  2B2U A;  1EU3 A;  1IBM Q;  3HOZ H;  1PTO F;  1A8V A;  2PW5 A;  4G4K A;  2MO0 A;  4HJ8 A;  1F2L A;  3I4M B;  1CTM A;  4HJ9 A;  4DAY A;  4ZLT F;  2B63 H;  4GS3 A;  3OW7 A;  4UHV A;  3JC6 6;  5EBD A;  3J7A V;  1IBK L;  1PFS A;  1SFO H;  2MJ8 A;  3DM3 A;  5A2Q E;  4A3L H;  1AW7 A;  3FP9 A;  2JEA I;  1EY0 A;  3GTK H;  3KLS X;  1GOZ A;  4KHV A;  4HAE A;  3O13 A;  1W2B A;  5HGQ A;  4LJZ C;  1S5D D;  3N6R A;  2RHQ B;  3ONA B;  1LAB A;  4DAM A;  1U4R A;  1O7I A;  4RGM A;  4DUY Q;  2JA8 B;  3EN2 A;  5FO7 B;  4LUZ A;  2LFN A;  1TWH B;  1STY A;  4G7Z C;  2PI2 E;  3NP8 A;  4DUZ Q;  1QNK A;  4LFB Q;  1M4V A;  2F0V A;  2ICI A;  3A56 A;  1BDO A;  1T9H A;  3TRE A;  5C4X B;  1NE3 A;  1WTQ A;  4BY1 H;  2KCN A;  4LMQ D;  2Z0S A;  4YY3 L;  2MP1 A;  3D6C A;  1D7Q A;  4U67 3;  5J1Z A;  1DGS A;  1UEB A;  1X9N A;  3H3V C;  4JI4 L;  3MXG A;  3OTO L;  1U9R A; 
#chains in the Genus database with same CATH homology
 2EOT A;  3KF8 A;  3GTK B;  2XWB B;  4K14 A;  5EBC A;  1HUM A;  5EJW A;  1RDP D;  3M7N A;  1DM0 B;  2L4N A;  4DNR B;  2ZT9 C;  3BYT B;  1OO9 B;  1VMP A;  3PMF A;  4HTH A;  5LL6 S;  1RD9 D;  2NUC A;  5CGK A;  1LTI D;  5C0X H;  2EY6 A;  5K5P A;  3X3M A;  2CQA A;  2KHS A;  3MZ5 A;  3NPP A;  4BY1 B;  3C1F A;  2MPM A;  1ICW A;  1HUN A;  2NVX B;  5CV6 A;  4ZQ3 A;  2NYZ D;  4X3K A;  2EDG A;  2LMC B;  3SDZ A;  2F0F A;  3CRK C;  2IW3 A;  4EQN A;  4BA2 I;  3GTM B;  3VYT A;  2J4X A;  1SJE D;  1A6X A;  3KBX A;  5G3L D;  4BBR B;  2F0G A;  1AZQ A;  2A68 C;  2JYO A;  3FPU B;  5E3F A;  3MFG A;  3LX0 A;  3S15 B;  3MXN A;  1SJH D;  3OMC A;  4HMJ A;  4EGV A;  1HFG A;  1Q1B A;  3T56 B;  5COR A;  2SNS A;  3MC0 B;  4H13 C;  4RA8 A;  2KJX A;  3RUZ A;  4L8J A;  3QO2 A;  1AP0 A;  5E4W C;  3HKZ B;  3FEW X;  1RTO A;  2IT1 A;  2BE5 C;  4XXE A;  2EYM A;  3ERQ A;  2JEB I;  3Q6S A;  1EQT A;  1CFM A;  1STN A;  2QIL A;  1EQV A;  2F0K A;  3WOF A;  1BOS A;  4V19 0;  3MVV A;  1F2Z A;  1JOQ A;  1PYW D;  2EY2 A;  1CA6 A;  1L0Y B;  3I8Z A;  3GP7 A;  4Z9C B;  1MI2 A;  1PRT B;  2YYZ A;  3BDL A;  4ID6 A;  3IFT A;  3ITP A;  4G7H C;  1MGS A;  3HOU B;  1CK1 A;  2C9O A;  2E76 C;  3VA7 A;  2ZXP A;  2CVR A;  1LO5 D;  3OHX C;  1C48 A;  4LAA A;  5JEA J;  5DEH A;  3BYY B;  4ZAI A;  2K05 A;  1VCI A;  1IL8 A;  4A3E B;  2NBF A;  1TS5 A;  4KY6 A;  1ILP A;  3A8K E;  2EPB A;  1ROD A;  1EEI D;  1Z6H A;  2B2W C;  1JWM D;  4BY7 B;  2O5I C;  3SR1 A;  4IUV A;  1SMY C;  3DXJ C;  1JOO A;  3F2U A;  1L0X B;  3K57 A;  2HCC A;  2XWJ B;  2RSO A;  1HTL D;  3ND8 A;  4IFD G;  4DAP A;  4HCS A;  5JVH 3;  4IUP A;  1ENF A;  4N9T A;  4F7X A;  2GA4 B;  4K5W A;  4K2K A;  2ZXO A;  1PRT C;  3VR4 A;  2F03 A;  1TR5 A;  2QDB A;  4IAL A;  4FXD A;  2SNM A;  3CKI B;  4MN3 A;  4ZKC B;  2WKD A;  1MBY A;  2NVY B;  3KK7 A;  5C44 B;  3D4W A;  2EJG C;  1BR9 A;  3HG9 A;  4QMG A;  1TS3 A;  4Q5V A;  4FYD A;  2SOB A;  1STE A;  3D3R A;  2FFK B;  2M2L A;  4KKT A;  2KEE A;  1SAP A;  1F2Y A;  3A8I E;  4KKU A;  4RWS C;  4IFD I;  2RBM A;  1SDF A;  3NXW A;  4HSV A;  1LTA D;  2B2W A;  3V96 A;  1D6E C;  5J39 A;  4RCN A;  4C56 C;  3AU7 A;  1EIH A;  1I4H A;  1Q8I A;  5M5Y B;  1NR4 A;  4IUR A;  3T51 B;  1BCP D;  4MIU A;  1EY5 A;  1I6H B;  4A93 B;  1F9Q A;  1ZEQ X;  4WFN 3;  2DY7 A;  4XTC S;  1OXV A;  5C0X G;  5CV8 A;  3OMG A;  3Q23 A;  3I70 A;  4S3S A;  2F4I A;  2Z8L A;  3NTI A;  4KJN A;  1FNU A;  4H44 C;  2QEJ C;  3PO2 B;  2DN8 A;  2V4D A;  1STG A;  1GUW A;  1ONL A;  1XXG A;  5D14 A;  5I6W A;  3S1R B;  4DK0 A;  3D6W A;  4Y7N B;  4RFB A;  3VR3 A;  2WIN B;  2WKC A;  5M3M B;  3DWP A;  3L7Z C;  3E5S A;  3HZX A;  1ZKO A;  1PDQ A;  3GTG B;  1QWY A;  4ODG A;  1PZJ D;  4KV6 A;  4OGQ C;  4ZUJ A;  2TSS A;  4F87 A;  3CHB D;  2JE6 I;  2F0E A;  1SNP A;  4KY5 A;  4RHS A;  3PIP 3;  1AN8 A;  1S5B D;  1HRJ A;  5KYI A;  3P75 A;  1BUV T;  3OIP A;  2EJF C;  3S1Q B;  3M4Y A;  2N88 A;  3J80 L;  4K2L A;  1PFM A;  2QKI C;  3IAY A;  1D1K A;  5C4J B;  4ULL A;  4BS9 A;  3R2T A;  1EU4 A;  5EQ0 A;  3S16 B;  3K5M A;  2PO4 A;  3OSO A;  1SNC A;  3QWN A;  3WOE A;  4LK1 C;  4WOR A;  1X3P A;  4H0L C;  3GTO B;  5I9P A;  2F0W A;  2MHV A;  4CJ0 B;  3URY A;  1WD0 A;  3QG1 A;  2OXP A;  3NK9 A;  1G91 A;  5E4X A;  3VR5 A;  2C5C A;  2K5Q A;  4OHJ A;  3R3O A;  2F3W A;  4WJW A;  4FF1 A;  1FD7 D;  5CV9 A;  1O80 A;  2ID0 A;  4XQJ A;  5IGD A;  5IGB A;  5E1F A;  5J22 A;  3NWS A;  3SK5 A;  2B8F A;  1EWH A;  1WTR A;  1CM9 A;  3DM1 A;  1KAB A;  2K5D A;  4XQN A;  3I4N B;  1X3Q A;  3IFD A;  3PO3 B;  4KHZ A;  3A55 A;  5JAV A;  3OWE B;  3CU7 A;  4UAI A;  3K59 A;  2OF1 A;  3DEP A;  3A8J E;  2F0M A;  5EPL A;  4IUT A;  3GTJ B;  3K5L A;  3MAQ A;  1JC7 A;  1E2V A;  5IGG A;  1QCB D;  2NTT A;  2A5H A;  3SXH A;  1K8M A;  2XRS D;  4DXG A;  4PV1 C;  4X3T A;  3H91 A;  5A2Q L;  4A3K B;  1JOR A;  2KOL A;  3MHB A;  4KKS A;  1A2T A;  2AUJ D;  4IZ8 A;  5JJZ A;  4A3I B;  3ERO A;  1UNS A;  2WP8 J;  1EOT A;  1DCZ A;  4DGZ A;  3HOZ B;  5LHY 1;  3D4R A;  1G6Z A;  1GHK A;  4IFD J;  3ZYY X;  1H9R A;  4HN7 A;  1Y69 U;  2B63 B;  2A73 B;  1KTK A;  2D2C C;  1SFO B;  2WV6 D;  5IIF A;  4XT1 B;  1LLR D;  1STA A;  4KN7 C;  3MWY W;  4X3U A;  1H9M A;  1K8O A;  3FVQ A;  1WTP A;  3S17 B;  4KN4 C;  4NP5 A;  1B1Z A;  4NKL A;  4EVO A;  1YNN C;  3NTH A;  5C6A A;  3D8G A;  4R8N A;  1F77 A;  3TZU A;  3DEO A;  2ZXR A;  3U9S A;  3GTL B;  2BOS A;  2KED A;  3DHQ A;  4BWG B;  1G2S A;  1SYB A;  4HSP A;  1LV9 A;  2PQE A;  2FJ2 A;  1EY4 A;  1Q3L A;  3J81 E;  1I4R A;  1SYD A;  1IHZ A;  2A69 C;  4PQX A;  4A3G B;  1BBX C;  4K8I A;  3GV6 A;  3P1H A;  1VMC A;  5CBE E;  1TKW B;  4CKC A;  4P2C B;  1JIC A;  4QUF A;  4DU9 A;  3P7J A;  5CV5 A;  1JWS D;  1XYI A;  4F88 A;  1UEA B;  4AYB B;  2J0T D;  3SHL A;  3TZD A;  3M85 A;  3HS0 C;  1V43 A;  1Y1W B;  3QOL A;  1JOK A;  4C1N I;  5C0X J;  5IGF A;  3D4D A;  4OO1 G;  1AZP A;  1CT1 D;  2D62 A;  1JQY D;  4A3M B;  1HQR D;  3D31 A;  1F9P A;  1I4X A;  1I6V C;  1QJO A;  4IUQ A;  1PMR A;  1RKN A;  1DOM A;  1G29 1;  3TBI B;  2RVL A;  1XWE A;  2PZW A;  1E2W A;  2NTS A;  1NSN S;  2RDG A;  2L1B A;  4BBS B;  3MFY A;  2MGS A;  1B4O A;  4FF4 A;  2FHT A;  1FYC A;  3UI2 A;  5I2X A;  1BCP C;  4DA2 A;  5HUR A;  1NCV A;  5I6Y A;  2F0D A;  1Q12 A;  3AMU A;  2DNE A;  2IX3 A;  3MXP A;  4N9P A;  3N52 A;  2ENB A;  5D3I B;  1WTW A;  4OO1 I;  2XIW A;  1RJT A;  3NSW A;  2F0T A;  2K33 A;  4PMB A;  1EEF D;  4WRD A;  3C46 A;  1G8Z D;  2O2L D;  4ZKB B;  1IYV A;  2Z4H A;  2L5T A;  4I65 A;  2B2T C;  2EVB A;  1TII D;  4NW2 A;  3GTP B;  1TWG B;  1SEB D;  1YNN D;  5M3F B;  4J6H A;  5IT9 E;  3SK6 A;  4O1N A;  2L0C A;  2EYH A;  3QJY A;  2K1B A;  1AFP A;  3I73 A;  4KI0 A;  2JXM B;  4EQP A;  2A69 D;  1KLU D;  1SSO A;  2QCP X;  1HA5 A;  1G2T A;  1DJR D;  2NN6 G;  1II3 A;  3E6Z X;  5FOB B;  2X6G A;  2EYO A;  3FPP A;  1F9S A;  2B2V C;  5D65 A;  2L55 A;  1A3T A;  5ELF A;  1GUT A;  2G9D A;  2O4X A;  1NUC A;  4NMZ A;  4TKO B;  1WCM B;  1EFI D;  2D5D A;  1E0B A;  1DZ1 A;  2EYF A;  5TSS A;  5C3W A;  4CKB A;  4TQU S;  2R6G A;  1SE4 A;  4B9X A;  1I3Q B;  4KMU C;  2KQ3 A;  1Q90 A;  3I72 A;  1TWC B;  2A6H D;  4EQO A;  3M3Y B;  4RCO A;  2F0O A;  1W6K A;  4QIW B;  3TN2 A;  3I3C A;  2H4O A;  3HRZ C;  2B2T A;  3TP6 A;  5FLX E;  5EPK A;  4G7O C;  4I7Z C;  3JAM E;  3Q0A A;  1JWU D;  2R61 A;  1STH A;  5KGU A;  2NN6 I;  1GUG A;  1PLF A;  1IYU A;  5ELE A;  4JK1 C;  2RSN A;  2B8G A;  1TWA B;  1SYE A;  1D1I A;  5CYU A;  3L3O C;  1IW7 D;  5DNF A;  2ICE C;  1TU2 B;  3KLR A;  4HMI A;  5FKA C;  3T13 A;  2WB1 B;  5BN4 A;  3G6J B;  1EY8 A;  1ILQ A;  2F0J A;  2EYL A;  1FNW A;  1PRT F;  3BVM A;  3I90 A;  1GXD C;  3RZO B;  5T1G A;  2QF7 A;  3R93 A;  1KAA A;  2AWO A;  4C3H G;  3MTS A;  3LNN A;  3OWF A;  1LTB D;  2B2V A;  1QB5 D;  1LTG D;  2NVT B;  1MSH A;  4IQZ A;  4C2M B;  3U9O A;  1QG7 A;  4KD4 A;  1JCK B;  4BA1 I;  1PTO H;  3S1M B;  1WD1 A;  3CRL C;  2IX1 A;  1IKL A;  1B50 A;  3C3L A;  1R4P B;  3BDO A;  1QNU A;  2R3Z A;  3QOJ A;  2BA1 A;  3PV0 A;  3TDQ A;  5KYL A;  2VXW A;  1LT5 D;  1B9M A;  1JB3 A;  2FMM A;  5C5L A;  1K83 B;  3M7G A;  1SE3 A;  3C1E A;  2JA6 B;  2O5J C;  4CJ1 B;  1T5E A;  2AWN A;  2FMC A;  2F0Q A;  3BS1 A;  4ZK9 B;  1FNV A;  1Y1V B;  3R2I A;  4DXF A;  4IN3 A;  1S4Z A;  1XTC D;  3RLF A;  5C0X I;  2I46 A;  1EWC A;  1Z7T A;  2K03 A;  1VDZ A;  1DYQ A;  4C3I B;  2BCO A;  5T1I A;  4RGN A;  1EY9 A;  1PFB A;  3T4A C;  1WTV A;  1Y8P B;  2X6L A;  2K5W A;  1STB A;  1Y8O B;  4XYQ A;  3MEH A;  3FMC A;  2VB3 X;  1LT3 D;  2E2J B;  5IOC A;  3BVG A;  4XQQ A;  3A7A B;  1SYC A;  2OEO A;  2Z4I A;  3PUY A;  1DOL A;  3W2D A;  2BA0 A;  2Q8R E;  2B2Y C;  3GD7 A;  3DMU A;  1PXU A;  3NQT A;  4K6L A;  1EY7 A;  1ENC A;  2E2D C;  1O7Y A;  1R9T B;  1UUP A;  4RHR A;  2PCF B;  3Q24 A;  3C2P A;  2HCI A;  1HTP A;  2KCC A;  4FNF A;  1KDC A;  1V8Q A;  2R7Z B;  2E2H B;  2HDL A;  2LKV A;  1PTO C;  2A6E D;  2XNA C;  1OXS C;  3PUW A;  4R9W A;  1R4Q B;  3KLS A;  4C3J G;  1I4G A;  1UAP A;  3J7A F;  1KNA A;  3SE0 A;  1BF4 A;  4PMW A;  2EE1 A;  1LTS D;  1B2T A;  2F3V A;  5IGC A;  1NAP A;  2F0L A;  2JA5 B;  2EY5 A;  1HQM C;  4CJ2 C;  3HOY B;  2SEB D;  2RQX A;  3GV3 A;  1ET9 A;  4ZRZ A;  2AQ2 B;  1TQO A;  3Q22 A;  1U4P A;  5C4H A;  1TS4 A;  2IX0 A;  2PZT A;  1GUS A;  1B53 A;  4A3B B;  1HA6 A;  5CC4 A;  5NUC A;  3K5N A;  1GUN A;  2HQE A;  2B2Y A;  4A3F B;  4RH6 A;  3NHH A;  4FF2 A;  1PFN A;  1CHP D;  3CQZ B;  1SNM A;  2G9H D;  4RKB A;  3L9A X;  1QOH A;  2KA7 A;  2EY1 A;  2RKS A;  2IJ0 A;  1BXT A;  3HOW B;  2MUY A;  1H9J A;  2KVM A;  1DXM A;  1DON A;  3EFX D;  2OT2 A;  5G3L F;  3TP7 A;  4KY7 A;  4DAV A;  2AQ3 B;  1J9O A;  4FXK C;  3H09 A;  3V2T A;  1BO0 A;  4PNY A;  4TRD A;  1M8A A;  2JSO A;  3H0G B;  2VUM B;  1YNJ D;  3H6M A;  2DY8 A;  1HXY D;  3S2H B;  1JE4 A;  3S14 B;  3K5O A;  3HEJ A;  4K8J A;  4FO2 A;  5I2Y A;  3BDC A;  2YU9 B;  5A35 A;  1RHP A;  4DF7 A;  4B08 A;  4PMC A;  1I4P A;  2Q8T A;  3J81 L;  2R92 B;  4XIG S;  3BG3 A;  2XSC A;  4OL7 A;  2BDO A;  1BCP B;  2IL8 A;  2PMZ B;  4ZYS A;  1RF2 D;  1PTO D;  5ISR A;  5K36 H;  4C3H B;  1D5X C;  1I50 B;  2VNU D;  4KD3 A;  3VYS A;  3VA5 A;  5HGT A;  4M8A A;  5DAU A;  3FKI B;  3EVQ A;  3K7A B;  4RGO S;  3TP8 A;  2XVS A;  4ZUI A;  1CI3 M;  1ET6 A;  5M9O A;  4XT3 B;  4C3I G;  1PZI D;  5DM7 3;  4QF4 A;  4X3S A;  2R93 B;  1EL0 A;  4L6T B;  1EYC A;  4V0B A;  3K58 A;  3GTQ B;  1U4M A;  1VF7 A;  3NTK A;  3VYU A;  1KDB A;  1F2M A;  2A6H C;  3S1N B;  1DD2 A;  2HUG A;  4RKL A;  2D9U A;  2L9H A;  5CMD A;  1BQQ T;  1LT6 D;  5JEA H;  1CQF A;  1DOK A;  2EJM A;  4H7B A;  1T5X D;  3S9W A;  5EKK A;  2DNC A;  5IGE A;  1IW7 C;  1X32 A;  3V05 A;  3LWU A;  5CV7 A;  1W6J A;  4L63 B;  2EYP A;  5CR3 A;  5COY A;  1V1P B;  2LS0 1;  2BDN A;  4K5X A;  2K04 A;  4DK1 A;  1O78 A;  1GUO A;  1GJX A;  5KIX A;  1D5M C;  3M4O B;  5KEE A;  3PIO 3;  2E75 C;  1ESR A;  1MD2 D;  1V1O A;  2F0S A;  4FXG C;  2PYK A;  1EYD A;  1SXT A;  1RTN A;  2X69 A;  5I4D A;  3DUZ A;  5DM6 3;  3SK8 A;  1Z47 A;  1WTO A;  2L11 A;  3RZD B;  4A3J B;  1TWF B;  1ZXT A;  3WDN A;  4CHT B;  2JA7 B;  5IT9 L;  4RAU C;  1A2U A;  1EZ8 A;  2NWG A;  3GQB A;  1BNZ A;  5KND A;  1NR2 A;  1TVX A;  5EKL A;  3VYR A;  4YIJ A;  3EJI A;  1OXT A;  4U68 A;  4R8I A;  1A15 A;  5ELB A;  3MA2 B;  5JVG 3;  3LWE A;  2AQ1 B;  1SYF A;  2PPB C;  2CW0 C;  3J7Y W;  1CZW A;  5C3E B;  4C3J B;  1IKM A;  1BCP F;  3RMH A;  3BZD B;  1ZYR C;  1H9S B;  3G7L A;  3DWA A;  1PZK D;  1KNE A;  3HOV B;  2EXZ A;  1O7Z A;  3W3A A;  4CGY B;  5IOD A;  3H94 A;  2K7V A;  5ELD A;  4HED A;  1Y8N B;  1J8I A;  4QUC A;  4GZY C;  5AFW A;  4A3D B;  2A74 C;  1XX8 A;  1CQV A;  2I07 B;  3SVM A;  3K0Y A;  5JPN C;  4CBV A;  1SBB B;  3QB3 A;  3IKJ A;  4C1N K;  5JPM C;  2KUM A;  5EPJ A;  2A68 D;  4FF3 A;  1QIL A;  2M9V A;  4J8Q A;  1OXX K;  2RDH A;  5FLX L;  3A7L A;  3JAM L;  4XDX A;  5FK9 C;  1D2B A;  1O7L A;  4K6D A;  3OPO A;  4QCL A;  3SEB A;  5FO9 B;  2L12 A;  2K32 A;  5C5M A;  1SNQ A;  1E2Z A;  4UDU C;  4OIJ A;  2VB2 X;  4JBW A;  4KTA A;  3IL8 A;  4F8M A;  4G57 A;  2HDM A;  2BE5 D;  5C4Z A;  3E0J A;  3PUX A;  2AUK A;  1WTX A;  2A6E C;  4FVM A;  1I4Q A;  1B3A A;  4IUU A;  5ELC A;  3RD4 A;  1KDA A;  4DNT B;  1SYG A;  1HHV A;  3QIA A;  3EA6 A;  1ML0 D;  4ME5 A;  1FR3 A;  3GO5 A;  5KNC A;  3KBG A;  4M1U B;  3VR2 A;  2F0U A;  3OOC A;  1V1P A;  1ESF A;  1EZ6 A;  5BN3 A;  4MHE A;  2EZV A;  4E6I A;  4O42 A;  2LY7 A;  2E74 C;  4OIK A;  1OXU A;  3PUZ A;  1Q1E A;  4TSS A;  1TY0 A;  4FP5 D;  5M5W B;  1HPC A;  2IWH A;  3P20 A;  3HGB A;  1F9R A;  1D5Z C;  1JR0 D;  4Q0F A;  4J1M A;  2F0I A;  2J7Z A;  3A54 A;  5CV4 A;  3NWT A;  5K36 G;  3ND9 A;  5CBA E;  1C4Q A;  4ABN A;  2PNR C;  3VR6 A;  2K6A A;  2E2I B;  3NE5 B;  1PTO B;  2CW0 D;  1B44 D;  4DN4 M;  3KUP A;  3FRP B;  2K01 A;  1SMY D;  1GHJ A;  1ZYR D;  2M00 A;  3NQI A;  2NB0 A;  4NDX A;  3PUV A;  5KRU A;  2NZ1 D;  1VF5 C;  1S5E D;  5D3D A;  1LAC A;  1HFN A;  5LL6 X;  1CHQ D;  4OO1 H;  3BVZ A;  1WVL A;  3EQL C;  1HCZ A;  1H9S A;  1CA5 A;  5JEA G;  1YNJ C;  2F0H A;  1S5F D;  5I9O A;  1CZG A;  3HOX B;  3NBI A;  5EGT A;  2XN9 C;  1TT2 A;  1PRT D;  2H1E A;  3K6O A;  1B9N A;  3T53 B;  1LTR D;  1KLG D;  1A3V A;  2F0N A;  2NVQ B;  3S2D B;  5M5X B;  3J80 E;  3NBH A;  3AB9 A;  2RDF A;  2F0P A;  1TS2 A;  3I91 A;  3HP3 A;  2F1M A;  4XYO A;  2B2U C;  3OIQ A;  1ENA A;  3DWQ A;  4KK7 A;  4HCE A;  4B9W A;  1S5C D;  3SK4 A;  2PZU A;  1RCV D;  4K5V A;  1AEX A;  2KEC A;  5JOB A;  4QB4 A;  1MSG A;  2TMP A;  5BN5 A;  4KJO A;  2PW7 A;  3MXU A;  3R8B A;  4DFA A;  4ILW A;  1EY6 A;  1C8C A;  2IPK D;  1LTT D;  3TME A;  5C3X A;  2RA4 A;  1EIG A;  2WII B;  1FGB D;  2Y0S B;  2B39 A;  1EYA A;  2N55 A;  3I4L A;  2Q8I B;  1SE2 A;  1SNO A;  1U4L A;  5KNB A;  2K28 A;  4IUN A;  2SDF A;  2WAC A;  1QE6 A;  3TSS A;  1LT4 D;  2FIN B;  1TY2 A;  4IFD H;  1H9K A;  5EKI A;  4CKE A;  2NN6 H;  5F2D A;  5FO8 B;  3NUC A;  2JP1 A;  3FDT A;  3X3N A;  1SND A;  2Z1C A;  2XRQ D;  4HR7 B;  3TP5 A;  1A3U A;  2CHB D;  2WAQ B;  4RGT A;  3T16 A;  2EYJ A;  2B2U A;  1EU3 A;  1PTO F;  2PW5 A;  4G4K A;  1F2L A;  3I4M B;  1CTM A;  4DAY A;  4ZLT F;  3OW7 A;  5EBD A;  3J7A V;  2MJ8 A;  5A2Q E;  1AW7 A;  2JEA I;  1EY0 A;  3KLS X;  4KHV A;  1GOZ A;  4HAE A;  3O13 A;  4LJZ C;  1S5D D;  3N6R A;  3ONA B;  1LAB A;  1U4R A;  4RGM A;  2JA8 B;  5FO7 B;  2LFN A;  1TWH B;  1STY A;  4G7Z C;  3NP8 A;  1QNK A;  1M4V A;  2F0V A;  2ICI A;  3A56 A;  1BDO A;  5C4X B;  1WTQ A;  2KCN A;  4LMQ D;  2MP1 A;  3D6C A;  4U67 3;  5J1Z A;  3H3V C;  3MXG A;  1U9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...