1DD2A

Biotin carboxyl carrier domain of transcarboxylase (tc 1.3s)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
AGAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution solution structure of the 1.3S subunit of transcarboxylase from Propionibacterium shermanii.
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
molecule tags Transferase
molecule keywords TRANSCARBOXYLASE 1.3S SUBUNIT
total genus 8
structure length 77
sequence length 77
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 1999-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dd2A00
2A68C 1HTPA 2A69D 2EJMA 4KMUC 2D62A 3VR4A 2E75C 5KNDA 2AUJD 2ZT9C 4XTCS 3D31A 2NN6I 4HR7B 2BDOA 1I6VC 4BA2I 1GUNA 2JEAI 4KKUA 1B9MA 1O7LA 2D5DA 3A7AB 1V8QA 3A8KE 5C0XH 3ND8A 4H44C 2KCCA 3W3AA 4IFDG 1T5EA 3A8IE 1ONLA 2K32A 3P20A 1FR3A 1HQMC 1OXVA 1ZKOA 3OPOA 1K8MA 2K7VA 2R6GA 2DN8A 2JXMB 2NN6H 3HGBA 3WDNA 1OXXK 3PUZA 4TQUS 3D4RA 2EJFC 3OW7A 3OOCA 4JK1C 1PMRA 3GD7A 1Z7TA 1Y8PB 1Z6HA 4KN7C 4DNRB 4L8JA 3LWUA 4KI0A 2DNCA 4I7ZC 5KNBA 3FPPA 1QJOA 1GUGA 2EDGA 1O78A 2BE5D 2PPBC 1OXUA 1A6XA 3CRLC 2LMCB 4JBWA 3MXUA 1SMYC 1IYVA 1CFMA 1Q1EA 1OXSC 2A6EC 3PUWA 2A69C 2A68D 3EQLC 1ZYRC 3VR6A 3BG3A 3IKJA 1V43A 3U9SA 3KLRA 3GQBA 3NE5B 2AUKA 2CW0C 3T51B 3N6RA 1VF5C 1Q90A 1YNNC 3I73A 5JEAG 1Q12A 2DNEA 1TU2B 4OO1G 1B9NA 3M85A 2B8FA 3PUXA 3SDZA 2JEBI 2K33A 2D2CC 4LK1C 1VDZA 2Q8IB 3SE0A 4KN4C 2V4DA 3M4YA 1LABA 3VA7A 3VR3A 2A6HD 1H9SA 4H0LC 5A35A 4H13C 1Y8NB 2EVBA 3I4LA 3TZUA 1GHJA 1H9SB 4DNTB 1H9JA 1IW7D 4BA1I 2O5JC 1Q1BA 3ND9A 1HCZA 2PCFB 1HPCA 2O5IC 3H94A 4G7OC 2JE6I 3T56B 2NN6G 3VR5A 3BDOA 2A6ED 1VCIA 2B8GA 3FMCA 4KKSA 5BN5A 5K36H 2F1MA 1H9MA 3A8JE 4DK0A 1CI3M 2BE5C 1E2VA 1H9KA 5K36G 1H9RA 1DCZA 4IFDH 3CRKC 2E74C 5BN3A 2PNRC 1FYCA 2BA0A 2IT1A 4PV1C 4GZYC 3RLFA 1IYUA 2BA1A 1EWHA 3IFTA 1TKWB 3PUYA 4G7ZC 1DD2A 1GHKA 4TKOB 1CTMA 1GJXA 1IW7C 2E76C 5BN4A 3M7NA 2YYZA 3A7LA 2KA7A 3LNNA 5KNCA 3PV0A 4DK1A 1OXTA 4OGQC 2A6HC 1YNJC 3QG1A 1K8OA 1VF7A 3QJYA 5JEAH 3VR2A 4KHZA 4OO1H 2QF7A 1Y8OB 4KKTA 2L5TA 3PUVA 3DXJC 3T53B 1G291 3AB9A 4XIGS 3QIAA 1E2WA 3MFYA 4IQZA 1LACA 1GUTA 4RCNA 5C0XG 1E2ZA 1DXMA 1Y69U 1GUSA 3I72A 3L7ZC 2EJGC 4G7HC 1GUOA 4LJZC 1BDOA 2AWOA
chains in the Genus database with same CATH superfamily
4OELB 3H91A 1WTHA 3KJPA 4R8IA 1YHQA 2CWAA 1RHPA 1TXYA 4DUYL 3MWYW 4C1NK 3URYA 5C4JH 1ASZA 1SNMA 3CP0A 3EA6A 4KKUA 3EJIA 1CSPA 3BDCA 4PZ6A 2AHOB 2TMPA 1EIYB 1EY9A 1A63A 1DOLA 3KBXA 3GTGB 4DV7Q 2IY5B 4A75A 4JI7Q 1S5BD 3E6ZX 4IJLA 1KLGD 4A3MB 5TSSA 4DR2Q 4UP8A 1NSNS 3DHQA 2E2DC 2ZXOA 4X3KA 2F0HA 1QOHA 1Q8IA 2EOTA 2SDFA 1TWAB 2PMZB 3GQBA 5J39A 3T51B 1YEZA 1MI2A 1RKNA 1WCMB 2IPKD 4A3BH 3GTMH 4QB4A 1TU2B 4GKKQ 1KL9A 3M85A 2AQ1B 4A3CG 4LUOA 1E1OA 5NUCA 2F0QA 3S2DH 4C3HB 3TP7A 1PYSB 4LF5L 1W3SA 1VQ9A 1ILPA 4DNTB 4JI5Q 5CV9A 1HCZA 4NXNQ 2LSSA 5C3WA 3GTLB 2KCTA 2F0MA 5C44H 3HKSA 4YY3L 4DN4M 1MJEA 1DONA 2VB2X 1VQKA 4BY7G 2PNRC 4K2KA 4CKCA 1HUMA 4KY5A 1PZKD 5CGKA 4V0BA 1E3PA 1PFNA 4TKOB 4WRDA 1HJPA 3LNNA 1STNA 4CKBA 4EQ5A 4JI2L 3OTOL 3R93A 1NBWA 1SAPA 2UUBQ 3VR2A 1B3AA 3FKIB 1YBYA 1G291 2DY7A 1KNEA 1I4QA 2UUCQ 3OHXC 4KD4A 4ZYSA 2O2LD 4IN3A 2ICIA 4NPSA 2F0PA 5FO8B 3S14B 5DNFA 1N33L 1Q86C 3A74A 1RJTA 1FGBD 1K3RA 3SR1A 2NN6I 1WTOA 5H1SE 1GUNA 4P2CB 4U68A 4DK6C 2IX0A 2XIWA 2JA8B 2F0EA 4LF5Q 1F2ZA 1L0WA 2K32A 1FR3A 4OHJA 1HH2P 1PH7A 4TQUS 3DEOA 1EYDA 4C3JG 1KAAA 4N8FA 1D1KA 1TWAH 2JA9A 4GKJQ 4PNYA 4B3RQ 2EIFA 3MXNA 3OW2A 1QUQB 2CH4A 1TWCH 2RKSA 4A3MG 5GAGC 1II3A 1IBKL 5IOCA 2WIIB 3KFUA 1S5CD 3HFZB 4DNIA 2CCZA 3VR6A 4ZK9B 1YNND 5D14A 1RD9D 2JA6H 4DR5Q 1HZ9A 4ZAIA 4A3EG 1L1OC 1VQ5A 2WAQE 4RWSC 5LL6S 2NZOA 3F2CA 1JMCA 3SE0A 1PYBA 3AYHB 2G5DA 3JAME 4C3HG 2R7FA 4Y7NB 2A8VA 4DUYQ 1C8CA 2IW3A 4AIMA 2NN6G 1O7IA 4K5VA 1Q8KA 4HTHA 1P16A 5ELDA 5AFWA 1EY6A 2BE5C 1PTOB 4B08A 3JAML 3I4MG 2E2IB 4XYQA 2WACA 1PVOA 2JA6B 3W1BA 1NJIC 5C4XB 1X55A 1FD7D 4CDFC 1EQQA 3K5OA 2QEXA 1CUKA 1WTRA 3K5MA 3HOWH 3M7GA 1Y8OB 3VYUA 1GXDC 4ZCKA 1U0LA 3QOJA 1S4ZA 3X3MA 4JI6L 4EX5A 3CC2A 1SSOA 1XPUA 3NPPA 2R7ZG 3DWAA 5HURA 5M9OA 2RHQB 5E4WC 4DV0Q 1BF4A 1DOMA 1FGUA 1JE4A 4K0KQ 1HTPA 1ESRA 1QUQA 1S5FD 1SMYD 2KQ3A 4XTCS 1E22A 3LWEA 4JI3L 1LTBD 2EE1A 3S16B 3I4MB 5C3EB 5IGGA 2VZAA 1P8LA 2Z4IA 2KOLA 1Q46A 2VB3X 4GOPC 3CW2C 3W3AA 1ONLA 1IKMA 2F0JA 1EUJA 4YWKA 3GV3A 2LXJA 1TIID 5IT9c 4OWTB 3TBIB 1M8AA 3D4RA 2K03A 1PMRA 1D1IA 1K3BC 3C2PA 1DZ1A 2L55A 1SNDA 3GTPB 3V2TA 1JWSD 4P73A 3CRLC 1F2YA 3MXUA 5FKAC 4LFCL 2A69C 4IZ8A 4TRDA 2Y0SB 4C2MH 4B3ML 1SNOA 4NKLA 2JA7B 2VY3A 1Q12A 4B3RL 3S1RB 2B8FA 3PUXA 1LT5D 3EVQA 3NELA 3PO2B 3J81L 2V4DA 1ENCA 4KV6A 3SK4A 5I2XA 2O5JC 1Q1BA 2WB1E 1XYIA 1ML0D 2CKZB 4APVA 2NVTB 4ZKCB 5A2QL 1LT4D 3F2UA 3TS2A 5C0XJ 4GLXA 4A3KH 3J81E 2I0QA 1JORA 1X3EA 4DFAA 2H5XA 4CJ0B 1H9RA 2R93G 2VL6A 4GZYC 4CKEA 2BA1A 2EY5A 2NTSA 5AJ3Q 5EKIA 1XPRA 4B3MQ 2JA6G 5D65A 1L2FA 2B2VC 2F4VL 1K8OA 5T1IA 1NCVA 2XN9C 5JEAH 1I4GA 1UE5A 5M3MH 2WINB 4A3MH 1XNQQ 3J7YW 3C1EA 4IQZA 1C48A 3G48A 2NTTA 2OXPA 4BWGB 1B1ZA 2RSNA 3I72A 3DEPA 2I07B 2K5DA 4G7HC 4Y52H 2AWOA 3STBD 2A69D 3EROA 2E75C 2V1CC 1HUNA 1WTQA 4Z9CB 4IUVA 2Z8LA 4RHRA 2JEAI 4DF7A 4A3IH 1J6QA 5C0XH 1WD0A 3A7AB 3P1HA 1I3QB 4JI5L 3IFDA 4R4CA 1AZPA 1SYDA 1K8MA 5M5XH 2R6GA 5GADC 3HGBA 1SEBD 5CYUA 5M3MG 4R4QA 3X3NA 4AQYL 1FNUA 1LTRD 2ASBA 5C0XI 1STAA 1Z7TA 1X3FA 3KLSA 1DOKA 3VYTA 4DUZQ 1WD1A 4L8JA 2ZJQA 3FPPA 1EQRA 1D5MC 5CV5A 1Q7YC 4EVOA 1BUVT 4QGUA 1NTGA 2E2JB 1IYVA 2BOSA 2D0PA 3UDXA 4I7AA 2PZTA 2WAQG 3GTLH 1LTGD 2VXWA 4DR2L 3FRPB 1KABA 4C56C 3NQIA 3EIVA 2XVSA 4JI0Q 4LF8L 4JI7L 1LT6D 3S17H 1W2BA 2OQKA 4YWLA 3EFXD 5JAVA 2DGYA 5FO9B 3MEFA 5A35A 3BYYB 4JI4L 4L5QA 1U5KA 4IFDI 1U4LA 1Y1VH 3T1YQ 1BBUA 4C3IB 1TWGB 2KENA 2HCCA 1PFBA 2K1BA 3VR5A 2PO4A 1FVIA 2K5VA 1WTVA 1SE3A 3NBIA 1CT1D 4BXXG 4L6TB 4JYAL 3PQIA 5ELNA 3OIQA 5JOBA 2F0LA 3L9AX 2L9HA 1UE1A 4OO1I 2K14A 4G7ZC 3KF6B 1O80A 4DR5L 3A7LA 1A2TA 2KA7A 5EBCA 1HZBA 2Z1CA 1VQHA 3QG1A 1EY8A 3BVGA 3K7AH 1PTOF 5M3FB 5M3FH 2HDMA 3PUVA 3DWQA 4K5WA 1E24A 3HOYB 2EYHA 2ZJPA 1J8IA 4PMBA 1DXMA 2IWHA 4JYAQ 1SNQA 2JA5B 1LM0A 2RHSB 4XQQA 1BDOA 4C3IH 2SNMA 5M5XB 1I4HA 4DR7L 3EBEA 2N78A 2E2HH 5CORA 1CK1A 2NVQH 4TSSA 5IODA 4DR6Q 2UXCL 3HEJA 1AZQA 4JI3Q 1JICA 4H44C 4NW2A 1OXVA 2AMCB 2K5NA 2KVMA 3OMGA 1NY4A 5JPNC 2KHIA 4RKBA 1X6OA 5CMDA 2I46A 1K8AC 2YU9H 3M4OB 2B2YC 3PMFA 2UUCL 4FXDA 1I50H 4JPBW 2PZWA 1KD1C 1VQBA 2BE5D 3U9OA 1OO9B 1TWCB 1XMQQ 5FJ8G 1NR2A 3E5SA 2UUBL 4X62Q 1ZYRC 1DYQA 3GV6A 3IKJA 3TP8A 2CQAA 3UI2A 1FJGL 3NE5B 2AUKA 2R7DA 2WAQB 1EIHA 1AW7A 4BY7H 3RMHA 5JEAG 1X65A 1S5DD 1UUPA 1PRTC 1G51A 3K0XA 2C35B 1EQVA 2D2CC 5CV6A 5CV7A 4A3IG 2FMMA 1K83H 3DUZA 1DGSA 1A62A 4YY3Q 3RN2A 3AFQA 3EN2A 1H9JA 3H3VI 2Z0SA 1BQQT 2B2UA 2ES2A 2EY2A 2N55A 2J4XA 1QE6A 1JB3A 2A5HA 1MSGA 4POFA 3FKIG 4KHVA 3D0FA 1XNQL 1EWHA 1JQYD 1XPOA 2J7ZA 1QVFA 1X56A 3K59A 3UE1A 1IBMQ 2F4VQ 5LL6X 2KEDA 4EQNA 2F0DA 4XT1B 4MIUA 1KHIA 2O4XA 2NBFA 3Q6SA 5C44B 2BH8A 3QIAA 1IL2A 4A3GG 4GKJL 1Y1WH 1LTSD 2XWBB 5IP9G 3Q24A 1L1OB 1TS3A 2JA8G 2Q2TA 4IJHA 1LO5D 3CPWA 4KMUC 4YCWA 3VR4A 2Z9HA 5IIFA 2ZT9C 1BR9A 4IUPA 1A0IA 4DR3Q 5D3IB 2K52A 1YHAA 5ELEA 3HKZG 4WJWA 4OX9Q 1PDQA 2XGTA 1QVCA 3R2TA 4C2MB 4C3IG 1IBLL 2QW7A 2HHHQ 3PGZA 2DN8A 1K8GA 4WFN3 2HDLA 5DEHA 2BH2A 4IPHA 2XRQD 4XQNA 4YWMA 2WFWA 1HNZL 1Z6HA 2RF4A 2C5CA 3BS1A 3GTPH 4DV2Q 3NXWA 2RQXA 1F9PA 3OWFA 4KJOA 4A3KB 1SMYC 4JI2Q 1PFMA 1PH5A 1CKMA 5CR3A 1MGSA 1QVGA 1HNXL 1KDCA 3QR8A 3I4NG 5IWAQ 4V190 1SDFA 5C44G 4Q5VA 3PF5A 1KAWA 5ELOA 2VQEQ 4OO1G 4QUFA 3HZXA 1TQOA 3ZYYX 4A3DB 4A3JG 4A93H 3J80i 2PW5A 2R92H 5DM73 2EQSA 3I4LA 5C3EH 1F9RA 1UE6A 4BY7B 1B3QA 4P75A 2K05A 3NEMA 3Q0AA 4DAPA 2Z6KA 4KHPL 3PO3B 1HTLD 4DU9A 1QG7A 2OT2A 3NTKA 1WTPA 4LF4L 1JE5A 3A8JE 4DK0A 1E2VA 3K7AB 4GKKL 1ESFA 2HD3A 3CRKC 3IRBA 3RLOA 1M90C 4GN5A 1R9TB 2VUMG 3HRZC 5EQ0A 4LF6L 4R9WA 2R93B 2R93H 1XMOL 3RR5A 1YNJC 1N32L 1JJCB 1G6ZA 2ZTCA 2OCEA 3K80C 4JC0A 2EY6A 4KKTA 2KBNA 2L4NA 1FNVA 4GN4B 1N36Q 3S1NB 4DV7L 1LACA 2CVRA 3MAQA 1CZWA 1GUTA 1E2ZA 2QDBA 2K04A 1JOOA 4A4IA 2B2WA 5LHY1 1GUOA 4ALPA 3M9BA 1RTNA 1SJHD 1K28A 4BBSH 3WWVA 3MFGA 2MHVA 3PO2G 1KDBA 3KOJA 3CCSA 4EGVA 3GO5A 4NB3A 4JI1Q 2A1AA 3A8KE 3R2IA 4X66Q 2VUMH 3NTHA 2RDHA 1B70B 5EPJA 4JCVE 3HG9A 1JWMD 4K8IA 1HR0L 3BDLA 4OL7A 1A3UA 2PYKA 3HOVG 3D8GA 4KK7A 2B2TA 1PXUA 2L12A 4A3BG 4NMZA 3I91A 4H02A 2PPBC 1O78A 3OIPA 2QGQA 1IBKQ 4LAAA 2KCMA 4UY8C 1EFWA 4UHVA 3BG3A 1GM5A 1V43A 3U9SA 4YCUA 4FO2A 3N6RA 4P74A 1VF5C 4LFBQ 1Q90A 2K75A 1S3OA 1EU3A 3CD6A 1PH2A 1EYAA 1TWHH 1STEA 3G7LA 3CPFA 1XXGA 2FJ2A 4LK1C 2KJXA 1BKBA 3RN5A 1YJNA 4AYBB 3B6YA 3I4OA 3BVZA 5JJLA 1LTAD 3L2PA 4GOPB 4K14A 1AE2A 3CCUA 2K01A 2LY7A 5CV4A 3I7FA 3RLNA 2O5IC 4C3JB 2M00A 1N33Q 1WCMG 1AEXA 3KF8B 4LMQD 2KCNA 4PZ8A 1CI3M 4JI8Q 5K36G 3S1RH 5C5LA 4DV3L 2PMZE 4N8X1 4QY7A 1PV4A 2HT1A 2F4IA 1IYUA 4ULLA 3UDGA 4B3TL 2E5LQ 3S2HH 4N9TA 2ZTDA 1RDPD 1WJJA 1ET9A 3FHWA 3STBC 1PLFA 4A76A 3MVVA 2B2UC 3H09A 4MN3A 3K6OA 2ZM6L 3M3YH 2L11A 3T53B 4K2LA 1Y1WB 2AKWB 1I50B 5JEAJ 3FVQA 3MFYA 3CAMA 3GTMB 1JOQA 2JA7H 2KHJA 3SK8A 1A15A 4B3TQ 1I94Q 2IL8A 5I6WA 2F52A 4FF4A 1HZAA 1BO0A 1YZ6A 3C3LA 5E1FA 2XRSD 3J80c 4B3SL 2AUJD 4DV4L 4ID6A 1SNCA 4X3TA 4NXNL 1GKHA 4HR7B 4DA2A 1VQLA 1O7LA 1V8QA 5IT9L 1WI5A 4DAYA 1PH6A 1T5EA 2M9VA 5I9PA 3P20A 1S40A 3M4PA 1ICFB 2R61A 1RODA 2VQFQ 3CC4A 3HOYG 1SYFA 1FNWA 3HKZE 3SEBA 4NXMQ 2PNHA 4HIDA 3H15A 5LMUL 2UXDQ 3G6EA 1X3QA 4KN7C 2DUDA 2I5HA 1LTTD 4KTAA 1N34L 1TWHB 4LFBL 5IP7H 4J15A 1OXUA 1ASYA 1F77A 4LF7Q 4A3BB 2ALYB 4X3UA 1NR4A 1VQNA 1T5XD 4A3EB 5EAYA 3TREA 4DR1L 1I5FA 4JG2A 3TS0A 5IP7G 1BNZA 3HOXG 1MIUA 3I56A 1VQ8A 4DV1Q 2IJ0A 3I73A 2DNEA 4POGA 2LFNA 1CZGA 4L63B 2RCNA 3AMUA 3AEVA 5I9OA 2KUMA 4KN4C 3M4YA 1X54A 2M2LA 1IZ6A 4LWCA 4MTKA 3VR3A 3BJUA 4DV6L 1Y8NB 1V1PB 4AYBG 1TY0A 4U673 2EYJA 5M5WH 4E6IA 1IYJB 2D0OA 3Q23A 5FJ8H 2EYFA 4MHEA 2MGSA 3PIP3 4RGTA 3E9HA 5LMNW 1EWIA 3T56B 3TP5A 5FLXE 4DV6Q 4RCOA 1ENAA 3NHHA 5K36H 1R4PB 1UWVA 3E3XA 1BCPB 3OYYA 1DCZA 4F87A 2B39A 3VYRA 3SK6A 1U4RA 3RLFA 3Q8DA 1LTLA 2PW7A 3IFTA 1CA5A 5C4ZA 1FL0A 1G91A 1HQRD 4OWWB 2A6HC 2X69A 3QJYA 4JBKA 4A3FG 1AN8A 3C46A 1JJGA 2L5TA 3VA5A 4BY1G 2B63B 2I5LX 4F88A 1GUWA 2A74C 2RCFA 5D3DA 2QILA 5IYCH 5JVH3 1N34Q 3KLWA 1WFQA 3FEWX 2UU9L 1U4PA 3WOFA 1PRTB 3P7JA 5IYCG 4K5XA 5LMNL 3S1MB 1XJVA 1SLJA 4IUNA 4JV5L 4GS3A 3VYSA 2F0WA 2WKCA 4UPAA 5EKLA 1EL0A 2F0OA 4A3IB 5COYA 2ATWA 1BCPF 4IALA 1B9MA 1DD2A 1N8RC 2Q8RE 4CDCC 4GOPA 3RZDH 3NSWA 4LFAL 1RIPA 1JWUD 1YNJD 4B3SQ 5IYDH 4JOIA 5C4XH 5C3EG 3CMAA 3MXGA 5M5WB 4A93B 2RSOA 4DNRB 2JQOA 1RCVD 1ZEQX 1JJ2A 1JT8A 3KLSX 1JOKA 2GVAA 2EDGA 3DM3A 1EEID 4K6DA 1Q1EA 2IHFA 3HOWB 2ZM6Q 5GAEC 1EYGA 1MSHA 2H4OA 1VQDA 3PO3H 5KEEA 2Q8TA 3A5UA 1D7QA 4QIWB 1DJRD 3WOEA 1QB5D 3CKIB 3ONAB 3I55A 3BU2A 4FVMA 3HOZH 2WKDA 3MXNB 1YI2A 2L1BA 1LABA 4DGZA 4DKAC 2UUAQ 2YV5A 5ISRA 1IBLQ 4WJ4A 3FP9A 4A93G 1ET6A 1HPCA 3CXCA 4B9XA 2I5MX 4DR3L 1PH1A 2CHBD 2EYOA 1HZCA 4MNOA 3I4NH 3I4NB 3P75A 4CGYB 1EY5A 5GROA 3K0YA 2NVTH 4HCEA 3NQTA 2E8GA 1QNKA 5BN4A 2J0TD 1HRJA 1QNUA 4AH6A 1G8ZD 5E7NA 1BVSA 2FINB 1L0XB 5I6YA 1V1QA 2X6GA 2EZVA 4P72A 2Z4HA 1X9NA 4BY1B 1M4VA 2K50A 5GAHC 3OWEB 2EYMA 3IL8A 3DLLA 2XSCA 1V1OA 1SROA 2CH4W 1SYCA 1LUZA 1CSQA 1HA6A 2N88A 1EWCA 2F0IA 4K8JA 2OQ0A 2SNSA 2DJFC 4JI1L 2D5DA 3HOUG 1CQFA 2UUAL 1OTCA 3GTKH 4CDDC 4L5RC 3W1GA 1OXXK 1KC8C 4J6HA 4YCVA 3OOCA 3GD7A 4N9PA 2JSOA 3NTIA 1I4XA 3PCOB 5ELCA 1EOVA 2PI2A 3GTQB 4FF1A 3GTJB 1N36L 2NVXH 4JBMA 3GTGH 5ELFA 5M3MB 4X62L 5KIXA 3ER0A 4KLKA 4CBVA 4ME5A 2A19A 1XMOQ 4LF6Q 3E9IA 1K83B 1MD2D 1XTCD 3MTSA 3SXHA 3T1HQ 4IUQA 1A8VA 2IHEA 2YTYA 3MZ5A 2QKIC 3S15B 3TZUA 3I2ZA 5EKKA 3ND9A 4KHPQ 2QDLA 2PCFB 3J80E 3GTOH 3HOZG 3KUPA 2JE6I 5LMNQ 3HOYH 2Q2IA 2A6ED 4A3LH 5C4JB 2B8GA 4A3FB 1CHQD 3S16H 1ILQA 1H9MA 4DXGA 3M4QA 2UU9Q 1J9OA 5IGBA 2E74C 2ZTEA 3H0GG 1SJED 5EPKA 1B53A 4HMIA 1GJXA 3BZCA 2E76C 4BBSB 1S72A 1I4RA 1OXTA 4OGQC 2RA4A 5E3FA 1K9MC 2RDFA 3G71A 5HY6A 1KNAA 5FLMG 4IUTA 1G2TA 1GD7A 3PIPA 1TY2A 3PIO3 1G2SA 4DV2L 1BXTA 1VQMA 3F2BA 5JPMC 2ENBA 2EXDA 1J5EQ 4F8MA 3OSOA 1GUSA 1XNRQ 4Y7NH 2MPMA 1CHPD 2FFKB 3NUCA 1PH4A 2CFMA 4OIJA 4FF3A 4X3SA 5IGEA 1R9TH 1G6PA 3MEHA 4PZ7A 4PQXA 5J22A 1I6VC 5C4HA 3KDFA 3T1YL 1VS0A 4O0AA 1I6HB 3ND8A 2MQHA 2WV6D 3TDQA 4ZQ3A 5KYIA 3T4AC 1Y1VG 1A3TA 4EQOA 5JJIA 2L0CA 1RL2A 4LUZA 2HIXA 4A3CH 3T1HL 3NP8A 4RGOS 5JJZA 2ICEC 3I8ZA 4DV1L 1UE7A 3N52A 2N49A 5FLXc 2OF1A 3VDYA 1A3VA 4KI0A 5KNBA 2YTXA 5BR8L 1HNWL 4M1UB 2K28A 1EZ8A 4A3DG 4LF7L 2F3WA 2K4KA 3G4SA 4IOAA 4CJ1B 1AFPA 2EPBA 5K5PA 1IBML 1Y1VB 1A2UA 2AQ2B 4YHHL 4BBRB 2CW0C 3A0JA 3RUZA 2F0VA 3K81C 1HXYD 3GTJH 2B3GA 1QWYA 4GLVB 4LUVA 4QIWE 1X32A 4A3KG 3SDZA 1EFID 3D6CA 4G57A 2K33A 5IYBG 2Q8IB 3D3RA 5FO7B 4A3FH 3OMCA 5HGQA 1KLUD 4JW0A 4RG1A 1Q81C 2ZXRA 2HUGA 4IO9A 1GHJA 1H9SB 4DXFA 2KECA 4R4TA 5F2DA 3K5NA 4XYOA 4DAVA 1SN8A 1Q82C 4OWXB 3A54A 4QF4A 2JA8H 1K73C 2SOBA 4QJFA 3FMCA 1YJ9A 3HOXB 3HOXH 4TVAB 4IURA 4WORA 2F03A 3UDFA 4IOCA 1PH9A 1F2LA 3C1FA 3PUYA 1HNXQ 4BBRH 1IW7C 2PI2E 1D8LA 2YTVA 2PQAB 1Y14B 3KDFB 4YHHQ 1QZGA 4BY1H 5M5YH 3S24A 2NB0A 3FDTA 2GVBA 3CCJA 2DY8A 3O13A 4XIGS 5ELBA 5BR8Q 1HNWQ 1C0AA 1E2WA 2F0TA 2CWPA 3HOUB 1KDAA 2VW9A 4JOIC 3JAMc 4X64L 1D5ZC 3W2DA 4QMGA 4HJ7A 2HHHL 2EJMA 2B29A 3CQZH 4BXXH 1YVCA 3S2HB 5HGTA 4OX9L 2VUMB 2FHTA 3E0JA 2LXKA 1MJCA 1NAPA 2MO1A 3J81c 4L5SA 5T1GA 5E4XA 2ID0A 1STHA 1CKNA 3S9WA 3M4OH 2MFIA 4DR6L 3I90A 3R3OA 3QB3A 4ZRZA 2B63G 5M5YB 2EJFC 1Y8PB 2B2YA 2IX3A 3R8BA 4KJNA 2DNCA 1QJOA 1XTDA 2DJGC 1STGA 2N8NA 1CM9A 4A3JH 1EEFD 4LF9L 2A68D 3HOVB 2XNAC 3E0EA 2PQEA 3ZJYC 3BVMA 1NMFA 5J3BA 1E1TA 3A56A 1ZYRD 1HR0Q 4NDXA 1BOSA 3CCVA 5G3LD 2FMCA 1SYGA 1PRTD 1JC7A 1TWGH 5GQOA 1TWFB 1F9QA 2G9DA 1SYBA 5CC4A 2F0KA 4EQPA 2E2IH 1PTOD 4A3GB 1BCPD 1PH3A 5KYLA 3BDOA 4KKSA 5CV8A 2Y0SG 2F1MA 4K0KL 1E7ZA 3J81j 3PO2H 4IPGA 4LW1A 5IYDG 5BN3A 1FYCA 3DMUA 1VQFA 3UE0A 4GNXC 2K5WA 1YJWA 4JI6Q 1V1PA 3SVMA 5IGFA 1S5ED 3KF6A 2P5ZX 2PZUA 4GLAC 1STYA 1NUCA 2VNUD 2PQAA 1CKNB 1VF7A 1XMQL 1VQIA 1B2TA 3L0OA 5C6AA 4CHTB 1GOZA 4DPGA 1K0SA 3F1ZA 5IYBH 4HAEA 2F3IA 1SR3A 3AQQA 4BBRG 5EPLA 5FLXL 4KY7A 4DUZL 4HCSA 4RCNA 1EY0A 1PFSA 1EY7A 1L0YB 3KYHC 4LJZC 2GN5A 4AQYQ 1RTOA 2A68C 1E0BA 2D62A 3K7UC 1BBXC 3D31A 5EBDA 5A2QE 4PG3A 4GN3B 4CJ2C 4FF2A 3TQYA 2H1EA 1STBA 1QCBD 1RF2D 3A55A 1HQMC 1SYEA 3SHLA 2JXMB 1BCPC 4L5TA 2ZJRA 1C9OA 3HOWG 2TSSA 1J5EL 3NENA 4JK1C 3RD4A 3FPUB 1IKLA 2JP1A 1L1OA 2X6LA 2B2WC 2HCIA 1I3QH 1SE4A 5FK9C 2WP8J 4OXPA 4RHSA 1MBYA 2HQLA 3SGIA 4I7ZC 5EGTA 1LTID 3DWPA 2VS1A 3U4ZA 1UEAB 4RGNA 4LF9Q 4R4IA 3NBHA 1VQ7A 3EQLC 3CCEA 3JC66 1PH8A 3AFPA 3LX0A 1HNZQ 1KTKA 3K57A 3KJOA 3D6WA 1XX8A 3BZDB 1B4OA 5LMUQ 2UXDL 2JEBI 1SFOH 4HJAA 4RAUC 4NXML 1D6EC 1EY4A 2KEEA 1CKOA 1GVPA 3ULPA 1EU4A 1VQAA 2EVBA 4X6AH 4O42A 3TMEA 1IW7D 4JI4Q 1NNXA 3J81i 4PMWA 2Z6KC 3KBGA 4RMFA 4WJ3M 4A3EH 4IFDJ 5IGCA 4DV4Q 1YITA 2IX1A 1EQTA 1ICWA 4X64Q 4JI0L 3HOZB 3S17B 1LT3D 1HFNA 3RNUA 2G9HD 3A5ZB 4R1JA 2IT1A 5C5MA 4LNQA 1TS4A 4P71A 1VQ4A 3CCLA 2R3ZA 3CU7A 4FXGC 5FLMH 4HJ8A 4DK1A 1NMGA 5JVG3 5G3LF 1SE8A 2JK8A 4KD3A 1SRUA 3DXJC 1JCKB 1AH9A 3ULLA 1YHBA 1U4MA 1WCMH 1F2MA 2ZXPA 3NK9A 1O7ZA 2Y0SE 3CQZB 3H6MA 4JI8L 1YIJA 2EYPA 2OTLA 4I65A 2MP1A 3MHBA 3CHBD 1KQSA 5IY0A 2BDOA 3U58A 1HR0W 2JN4A 2MJ8A 2WB1G 3A8IE 1Y1WG 3NBHB 1SFOB 1WVLA 1ZKOA 2WB1B 1R4QB 1NE3A 3PUZA 3J7AF 1QZHA 1SMXA 4OEMB 5C4XG 2B2TC 3H0GH 4JBJA 2NYZD 3HOUH 3UDIA 2JYOA 1IL8A 1GUGA 2NZHA 3L3OC 2LMCB 1CFMA 1Q3LA 3ITPA 3BZKA 1B7YB 2GA4B 1HA5A 5IE8A 1HFGA 1SNPA 5AJ3L 4YIJA 3CC7A 2N3SA 5CBAE 4XXEA 3K58A 4QCLA 2QCPX 4ILWA 1EIFA 2OEOA 4XDXA 1B9NA 2K5QA 1SE2A 1PTOH 4O2DA 4OIKA 4AYBE 1C7YA 3S1QB 5FOBB 2RDGA 2A6HD 4H13C 3I4MH 3F2DA 2UXCQ 2BDNA 4X66L 2NVYH 2NVYB 4FNFA 3K5LA 2CW0D 4MZ9A 4RKLA 3PSIA 3ICEA 4A3LG 2AQ3B 4DR7Q 4FDBA 2B63H 3TN2A 2BCOA 1XNRL 1EIGA 3MA2B 3Q22A 4IFDH 4CDEC 4UP7A 1KIXA 1YNXA 1VQPA 2R92G 1F9SA 3ULJA 5IT9E 3TRZA 3HS0C 3CCMA 2HQEA 3M7NA 2YYZA 3D4DA 1TT2A 3S15H 1CA6A 3PV0A 2EXZA 3TSSA 3S1NH 4FYDA 1EZ6A 4DR1Q 5KGUA 4QL5A 4KHZA 1UNSA 3G6JB 2QF7A 4OO1H 4A3DH 3RZDB 3T13A 2LS01 5DM63 1T9HA 2NVQB 4FXKC 3L7ZC 1M1KC 2JJQA 3HOVH 1IHZA 4LFAQ 5KNDA 3PIOA 3U4VA 2OWOA 4LF4Q 2F0FA 1PHJA 3GTKB 5KRUA 2NZ1D 4BA2I 2XTIA 5JJKA 1D5XC 3H0GB 3PF4A 1W6KA 3QWNA 4RH6A 3F8TA 3GTOB 2KCCA 4HIMA 1AE3A 3OPOA 2K7VA 3WDNA 1VQGA 3TZDA 1PTOC 4Q0FA 1VQCA 5EJWA 4LF8Q 3KF8A 5M3FG 2JA5H 2NVXB 1IXRA 5CBEE 2XWJB 3LWUA 2HIVA 1WYDA 2R92B 5IWAL 2JA5G 4JBWA 4ODGA 3S1QH 3ERSX 4HJ9A 2A6EC 3PUWA 2A73B 2FXQA 4FP5D 4IPCA 1VMPA 3OTOQ 4A3GH 1VMCA 5IP9H 4S3SA 3NWTA 3TEHB 3CCQA 1YNNC 1TR5A 5I2YA 4J1MA 1MKHA 1O7YA 1Z9FA 4DK3C 1TVXA 4H7BA 3M3YB 1VDZA 4M8AA 3VA7A 4H0LC 5J1ZA 1EOTA 2QEJC 5I4DA 4UAIA 1EYCA 3J80L 3GDEA 1ENFA 1B44D 3HP3A 4HN7A 3D4WA 3SK5A 1Z47A 1TS5A 3H94A 2UXBQ 4G7OC 3S14H 2F3VA 3CF5A 1K0RA 4C3HH 2CQOA 3HKZB 1XWEA 4HJ5A 2RBMA 4BS9A 4UP9A 3RZOH 4C3JH 1H95A 3MXPA 4PV1C 1TKWB 4XT3B 2F0SA 1WTXA 1N9WA 3V05A 3CCRA 3QOLA 4RA8A 4KY6A 4IUUA 1CQVA 2B2VA 4J8QA 1LLRD 4HSVA 2R7ZH 2R7ZB 3FKIH 3AB9A 2EYLA 3PO3G 2Q2UA 2NWGA 1KRSA 3K8AA 4HIKA 5C0XG 5C3XA 1JR0D 1UEBA 1WTWA 2EJGC 1JB7A 3J7A5 2VQFL 4ZKBB 1W6JA 3I3CA 3IAYA 5L37A 1C4QA 3I70A 2F0GA 2D9UA 1HHVA 2UXBL 1I6HH 1TS2A 2MUYA 3RZOB 4IFDG 3J7ZC 2NUCA 2JA7G 1PZJD 4HSPA 2NN6H 4NP5A 4PMCA 3OW7A 1I94L 2F0NA 5DAUA 1D2BA 1DM0B 2RVLA 4GNXB 2KHSA 1VQJA 3V96A 1VQOA 3CMEA 4R4OA 4ZUJA 5IGDA 1UAPA 1FJGQ 4LFCQ 1A6XA 2AWNA 2YU9B 1SBBB 2K5HA 1V9PA 4HEDA 4MTNA 1OXSC 4DAMA 4K6LA 1X3GA 1N32Q 2E5LL 3T16A 1SXTA 3KLRA 3U50C 2MNAA 4O1NA 4X65L 4DR4L 4OONA 4RGMA 3W5OA 4DV3Q 1PZID 1I4PA 3JAMi 3MC0B 1VQ6A 4ABNA 4DV5Q 1KXLA 3LGJA 3DM1A 1B8AA 4JVZA 4ZUIA 4B9WA 1H9SA 4ZLTF 1VQEA 1ZXTA 4XQJA 4BA1I 2MO0A 2C9OA 4F7XA 3S1MH 2L15A 4ME3A 4JV5Q 2QA4A 1PA6A 3ERQA 1VCIA 1KRTA 5BN5A 4DV0L 4R8NA 3S2DB 4C1NI 3H3VH 1H9KA 2SEBD 4G4KA 4DV5L 2BA0A 4BBSG 4GNXA 3J7AV 4RFBA 2VQEL 4HMJA 4QUCA 2LKVA 4DR4Q 1CTMA 4X65Q 2E2HB 1GHKA 2K6AA 1TWFH 3TP6A 1PRTF 5KNCA 4QQBX 3GP7A 1AP0A 3H3VC 2OTJA 4A3JB 4DAYB 2Z6BA 2E2JH 4HIOA 3KK7A 5DLQE 1GO3E 1B50A 1LV9A 3GTQH 1BBWA 2Q2HA 1MHWC 3BYTB 4UDUC 4IPDA 1X3PA 3QO2A 2EY1A 1Y69U 1U9RA 1PYWD 1WOCA 1QILA 3AU7A 1LYLA 2F0UA 3NWSA
chains in the Genus database with same CATH topology
3H91A 4R8IA 1RHPA 3MWYW 4C1NK 3URYA 1SNMA 3EA6A 4KKUA 3EJIA 3BDCA 2TMPA 1EY9A 1DOLA 3KBXA 3GTGB 1S5BD 3E6ZX 1KLGD 4A3MB 5TSSA 1NSNS 3DHQA 2E2DC 2ZXOA 4X3KA 2F0HA 1QOHA 1Q8IA 2EOTA 2SDFA 1TWAB 2PMZB 3GQBA 5J39A 3T51B 1MI2A 1RKNA 1WCMB 2IPKD 4QB4A 1TU2B 3M85A 2AQ1B 5NUCA 2F0QA 4C3HB 3TP7A 1ILPA 4DNTB 5CV9A 1HCZA 5C3WA 3GTLB 2F0MA 4DN4M 1DONA 2VB2X 2PNRC 4K2KA 4CKCA 1HUMA 4KY5A 1PZKD 5CGKA 4V0BA 4TKOB 1PFNA 4WRDA 3LNNA 1STNA 4CKBA 3R93A 1SAPA 3VR2A 1B3AA 3FKIB 1G291 2DY7A 1KNEA 1I4QA 3OHXC 4KD4A 4ZYSA 2O2LD 4IN3A 2ICIA 2F0PA 5FO8B 3S14B 5DNFA 1RJTA 1FGBD 3SR1A 2NN6I 1WTOA 1GUNA 4P2CB 4U68A 2IX0A 2XIWA 2JA8B 2F0EA 1F2ZA 2K32A 1FR3A 4OHJA 4TQUS 3DEOA 1EYDA 4C3JG 1KAAA 1D1KA 4PNYA 3MXNA 2RKSA 1II3A 5IOCA 2WIIB 1S5CD 3VR6A 4ZK9B 1YNND 5D14A 1RD9D 4ZAIA 4RWSC 5LL6S 3SE0A 3JAME 4C3HG 4Y7NB 1C8CA 2IW3A 2NN6G 4K5VA 4HTHA 5ELDA 5AFWA 1EY6A 2BE5C 1PTOB 4B08A 3JAML 2E2IB 4XYQA 2WACA 2JA6B 5C4XB 1FD7D 3K5OA 1WTRA 3K5MA 3M7GA 1Y8OB 3VYUA 1GXDC 3QOJA 1S4ZA 3X3MA 1SSOA 3NPPA 3DWAA 5HURA 5M9OA 5E4WC 1BF4A 1DOMA 1JE4A 1HTPA 1ESRA 1S5FD 1SMYD 2KQ3A 4XTCS 3LWEA 1LTBD 2EE1A 3S16B 3I4MB 5C3EB 5IGGA 2Z4IA 2KOLA 2VB3X 3W3AA 1ONLA 1IKMA 2F0JA 3GV3A 1TIID 3TBIB 1M8AA 3D4RA 2K03A 1PMRA 1D1IA 3C2PA 1DZ1A 2L55A 1SNDA 3GTPB 3V2TA 1JWSD 3CRLC 1F2YA 3MXUA 5FKAC 2A69C 4IZ8A 4TRDA 2Y0SB 1SNOA 4NKLA 2JA7B 1Q12A 3S1RB 2B8FA 3PUXA 1LT5D 3EVQA 3PO2B 3J81L 2V4DA 1ENCA 4KV6A 3SK4A 5I2XA 2O5JC 1Q1BA 1XYIA 1ML0D 2NVTB 4ZKCB 5A2QL 1LT4D 3F2UA 5C0XJ 1JORA 3J81E 4DFAA 4CJ0B 1H9RA 4GZYC 4CKEA 2BA1A 2EY5A 2NTSA 5EKIA 5D65A 2B2VC 1K8OA 5T1IA 1NCVA 2XN9C 5JEAH 1I4GA 2WINB 3J7YW 3C1EA 4IQZA 1C48A 2NTTA 2OXPA 4BWGB 1B1ZA 2RSNA 3I72A 3DEPA 2I07B 2K5DA 4G7HC 2AWOA 2A69D 3EROA 2E75C 1HUNA 1WTQA 4Z9CB 4IUVA 2Z8LA 4RHRA 2JEAI 4DF7A 1WD0A 5C0XH 3A7AB 3P1HA 1I3QB 3IFDA 1AZPA 1SYDA 1K8MA 2R6GA 3HGBA 1SEBD 5CYUA 3X3NA 1FNUA 1LTRD 5C0XI 1STAA 1Z7TA 3KLSA 1DOKA 3VYTA 1WD1A 4L8JA 3FPPA 1D5MC 5CV5A 4EVOA 1BUVT 2E2JB 1IYVA 2BOSA 2PZTA 1LTGD 2VXWA 3FRPB 1KABA 4C56C 3NQIA 2XVSA 1LT6D 3EFXD 5JAVA 5FO9B 5A35A 3BYYB 4IFDI 1U4LA 4C3IB 1TWGB 2HCCA 1PFBA 2K1BA 3VR5A 2PO4A 1WTVA 1SE3A 3NBIA 1CT1D 4L6TB 3OIQA 5JOBA 2F0LA 3L9AX 2L9HA 4OO1I 4G7ZC 1O80A 3A7LA 1A2TA 2KA7A 5EBCA 2Z1CA 3QG1A 1EY8A 3BVGA 1PTOF 5M3FB 2HDMA 3PUVA 3DWQA 4K5WA 3HOYB 2EYHA 1J8IA 4PMBA 1DXMA 2IWHA 1SNQA 2JA5B 4XQQA 1BDOA 2SNMA 5M5XB 1I4HA 5CORA 1CK1A 4TSSA 5IODA 3HEJA 1AZQA 1JICA 4H44C 4NW2A 1OXVA 2KVMA 3OMGA 5JPNC 4RKBA 5CMDA 2I46A 3M4OB 2B2YC 3PMFA 4FXDA 2PZWA 2BE5D 3U9OA 1TWCB 1OO9B 1NR2A 3E5SA 1ZYRC 1DYQA 3GV6A 3TP8A 3IKJA 2CQAA 3UI2A 3NE5B 2AUKA 2WAQB 1EIHA 1AW7A 3RMHA 5JEAG 1S5DD 1UUPA 1PRTC 1EQVA 2D2CC 5CV6A 5CV7A 2FMMA 3DUZA 1H9JA 1BQQT 2B2UA 2EY2A 2N55A 2J4XA 1QE6A 1JB3A 2A5HA 1MSGA 4KHVA 1EWHA 1JQYD 2J7ZA 3K59A 5LL6X 2KEDA 4EQNA 2F0DA 4XT1B 4MIUA 2O4XA 2NBFA 3Q6SA 5C44B 3QIAA 1LTSD 2XWBB 3Q24A 1TS3A 1LO5D 4KMUC 3VR4A 5IIFA 2ZT9C 1BR9A 4IUPA 5D3IB 5ELEA 4WJWA 1PDQA 3R2TA 4C2MB 4C3IG 2DN8A 4WFN3 2HDLA 5DEHA 2XRQD 4XQNA 1Z6HA 2C5CA 3BS1A 3NXWA 2RQXA 1F9PA 3OWFA 4KJOA 4A3KB 1SMYC 1PFMA 5CR3A 1MGSA 1KDCA 4V190 1SDFA 4Q5VA 4OO1G 4QUFA 3HZXA 1TQOA 3ZYYX 4A3DB 2PW5A 5DM73 3I4LA 1F9RA 4BY7B 2K05A 3Q0AA 4DAPA 3PO3B 1HTLD 4DU9A 1QG7A 2OT2A 3NTKA 1WTPA 4DK0A 3A8JE 1E2VA 3K7AB 1ESFA 3CRKC 1R9TB 3HRZC 5EQ0A 4R9WA 2R93B 1YNJC 1G6ZA 2EY6A 4KKTA 2L4NA 1FNVA 3S1NB 1LACA 2CVRA 3MAQA 1CZWA 1GUTA 1E2ZA 2QDBA 2K04A 1JOOA 2B2WA 5LHY1 1GUOA 1RTNA 1SJHD 3MFGA 2MHVA 1KDBA 4EGVA 3GO5A 3A8KE 3R2IA 3NTHA 2RDHA 5EPJA 3HG9A 1JWMD 4K8IA 3BDLA 4OL7A 1A3UA 2PYKA 3D8GA 4KK7A 2B2TA 1PXUA 2L12A 4NMZA 3I91A 2PPBC 1O78A 3OIPA 4LAAA 3BG3A 1V43A 3U9SA 4FO2A 3N6RA 1VF5C 1Q90A 1EU3A 1EYAA 1STEA 3G7LA 1XXGA 2FJ2A 4LK1C 2KJXA 4AYBB 3BVZA 1LTAD 4K14A 2O5IC 2K01A 2LY7A 5CV4A 4C3JB 2M00A 1AEXA 4LMQD 2KCNA 1CI3M 5K36G 5C5LA 2F4IA 1IYUA 4ULLA 4N9TA 1RDPD 1ET9A 1PLFA 3MVVA 2B2UC 3H09A 4MN3A 3K6OA 2L11A 3T53B 4K2LA 1Y1WB 1I50B 5JEAJ 3FVQA 3MFYA 3GTMB 1JOQA 3SK8A 1A15A 2IL8A 5I6WA 4FF4A 1BO0A 3C3LA 5E1FA 2XRSD 2AUJD 4ID6A 1SNCA 4X3TA 4HR7B 4DA2A 1O7LA 1V8QA 5IT9L 4DAYA 1T5EA 2M9VA 5I9PA 3P20A 2R61A 1RODA 1SYFA 1FNWA 3SEBA 1X3QA 4KN7C 1LTTD 4KTAA 1TWHB 1OXUA 1F77A 4A3BB 4X3UA 1NR4A 1T5XD 4A3EB 1BNZA 2IJ0A 3I73A 2DNEA 2LFNA 1CZGA 4L63B 3AMUA 5I9OA 2KUMA 4KN4C 3M4YA 2M2LA 3VR3A 1Y8NB 1V1PB 1TY0A 4U673 2EYJA 4E6IA 3Q23A 2EYFA 4MHEA 2MGSA 3PIP3 4RGTA 3T56B 3TP5A 5FLXE 4RCOA 1ENAA 3NHHA 5K36H 1R4PB 1BCPB 1DCZA 4F87A 2B39A 3VYRA 3SK6A 1U4RA 3RLFA 3IFTA 2PW7A 1CA5A 5C4ZA 1G91A 1HQRD 2A6HC 2X69A 3QJYA 3C46A 1AN8A 2L5TA 3VA5A 2B63B 4F88A 1GUWA 2A74C 5D3DA 5JVH3 2QILA 3FEWX 1U4PA 3WOFA 1PRTB 3P7JA 3S1MB 4K5XA 4IUNA 3VYSA 2F0WA 2WKCA 5EKLA 1EL0A 2F0OA 4A3IB 5COYA 1BCPF 4IALA 1B9MA 1DD2A 2Q8RE 3NSWA 1JWUD 1YNJD 3MXGA 5M5WB 4A93B 2RSOA 4DNRB 1RCVD 1ZEQX 3KLSX 1JOKA 2EDGA 1EEID 4K6DA 1Q1EA 3HOWB 1MSHA 2H4OA 5KEEA 2Q8TA 4QIWB 1DJRD 3WOEA 1QB5D 3CKIB 3ONAB 4FVMA 2WKDA 2L1BA 1LABA 4DGZA 5ISRA 1ET6A 1HPCA 4B9XA 2CHBD 2EYOA 3I4NB 3P75A 4CGYB 1EY5A 3K0YA 4HCEA 3NQTA 1QNKA 5BN4A 2J0TD 1HRJA 1QNUA 1G8ZD 2FINB 1L0XB 5I6YA 2X6GA 2EZVA 2Z4HA 4BY1B 1M4VA 3OWEB 2EYMA 3IL8A 2XSCA 1V1OA 1SYCA 1HA6A 2N88A 1EWCA 2F0IA 4K8JA 2SNSA 2D5DA 1CQFA 1OXXK 4J6HA 3OOCA 3GD7A 4N9PA 2JSOA 3NTIA 1I4XA 5ELCA 3GTQB 4FF1A 3GTJB 5ELFA 5M3MB 5KIXA 4CBVA 4ME5A 1K83B 1MD2D 1XTCD 3MTSA 3SXHA 4IUQA 3MZ5A 2QKIC 3S15B 3TZUA 5EKKA 3ND9A 2PCFB 3J80E 3KUPA 2JE6I 2A6ED 5C4JB 2B8GA 4A3FB 1CHQD 1ILQA 1H9MA 4DXGA 1J9OA 5IGBA 2E74C 1SJED 5EPKA 1B53A 4HMIA 1GJXA 2E76C 4BBSB 1I4RA 1OXTA 4OGQC 2RA4A 5E3FA 2RDFA 1KNAA 4IUTA 1G2TA 1TY2A 3PIO3 1G2SA 1BXTA 5JPMC 2ENBA 4F8MA 3OSOA 1GUSA 2MPMA 1CHPD 2FFKB 3NUCA 4OIJA 4FF3A 4X3SA 5IGEA 3MEHA 4PQXA 5J22A 1I6VC 5C4HA 1I6HB 3ND8A 2WV6D 3TDQA 4ZQ3A 5KYIA 3T4AC 1A3TA 4EQOA 2L0CA 3NP8A 4RGOS 5JJZA 2ICEC 3I8ZA 3N52A 2OF1A 1A3VA 4KI0A 5KNBA 4M1UB 2K28A 1EZ8A 2F3WA 1AFPA 4CJ1B 2EPBA 5K5PA 1Y1VB 1A2UA 2AQ2B 4BBRB 2CW0C 3RUZA 2F0VA 1HXYD 1QWYA 1X32A 3SDZA 1EFID 3D6CA 4G57A 2K33A 2Q8IB 3D3RA 5FO7B 3OMCA 1KLUD 2ZXRA 2HUGA 1GHJA 1H9SB 4DXFA 2KECA 3K5NA 5F2DA 4XYOA 4DAVA 3A54A 4QF4A 2SOBA 3FMCA 3HOXB 4IURA 4WORA 2F03A 1F2LA 3C1FA 3PUYA 1IW7C 2NB0A 3FDTA 2DY8A 3O13A 4XIGS 5ELBA 1E2WA 2F0TA 3HOUB 1KDAA 1D5ZC 3W2DA 4QMGA 2EJMA 3S2HB 5HGTA 2VUMB 2FHTA 3E0JA 1NAPA 5T1GA 5E4XA 2ID0A 1STHA 3S9WA 3I90A 3R3OA 3QB3A 4ZRZA 5M5YB 2EJFC 1Y8PB 2B2YA 2IX3A 3R8BA 4KJNA 2DNCA 1QJOA 1STGA 1CM9A 1EEFD 2A68D 3HOVB 2XNAC 2PQEA 3BVMA 3A56A 1ZYRD 4NDXA 1BOSA 5G3LD 2FMCA 1SYGA 1PRTD 1JC7A 1TWFB 1F9QA 2G9DA 1SYBA 5CC4A 2F0KA 4EQPA 1PTOD 4A3GB 1BCPD 5KYLA 3BDOA 4KKSA 5CV8A 2F1MA 5BN3A 1FYCA 3DMUA 2K5WA 1V1PA 3SVMA 5IGFA 1S5ED 2PZUA 1STYA 1NUCA 2VNUD 1VF7A 1B2TA 5C6AA 4CHTB 1GOZA 4HAEA 5EPLA 5FLXL 4KY7A 4RCNA 4HCSA 1EY0A 1EY7A 1L0YB 4LJZC 1RTOA 2A68C 1E0BA 2D62A 1BBXC 3D31A 5EBDA 5A2QE 4CJ2C 4FF2A 2H1EA 1STBA 1QCBD 1RF2D 3A55A 1HQMC 1SYEA 3SHLA 2JXMB 1BCPC 2TSSA 4JK1C 3RD4A 3FPUB 1IKLA 2JP1A 2X6LA 2B2WC 2HCIA 5FK9C 1SE4A 2WP8J 4RHSA 1MBYA 4I7ZC 5EGTA 1LTID 3DWPA 1UEAB 4RGNA 3NBHA 3EQLC 3LX0A 1KTKA 3K57A 3D6WA 1XX8A 3BZDB 1B4OA 2JEBI 4RAUC 1D6EC 1EY4A 2KEEA 1EU4A 2EVBA 4O42A 3TMEA 1IW7D 4PMWA 3KBGA 4IFDJ 5IGCA 2IX1A 1EQTA 1ICWA 3S17B 3HOZB 1LT3D 1HFNA 2G9HD 2IT1A 5C5MA 1TS4A 2R3ZA 3CU7A 4FXGC 4DK1A 5JVG3 5G3LF 4KD3A 3DXJC 1JCKB 1U4MA 1F2MA 2ZXPA 3NK9A 1O7ZA 3CQZB 3H6MA 2EYPA 4I65A 2MP1A 3MHBA 3CHBD 2BDOA 2MJ8A 3A8IE 1SFOB 1WVLA 1ZKOA 2WB1B 1R4QB 3PUZA 3J7AF 2B2TC 2NYZD 2JYOA 1IL8A 1GUGA 3L3OC 2LMCB 1CFMA 1Q3LA 3ITPA 2GA4B 1HA5A 1HFGA 1SNPA 4YIJA 5CBAE 4XXEA 3K58A 4QCLA 2QCPX 4ILWA 2OEOA 4XDXA 1B9NA 2K5QA 1SE2A 1PTOH 4OIKA 3S1QB 5FOBB 2RDGA 2A6HD 4H13C 2BDNA 4FNFA 2NVYB 3K5LA 2CW0D 4RKLA 2AQ3B 3TN2A 2BCOA 1EIGA 3MA2B 3Q22A 4IFDH 1F9SA 5IT9E 3HS0C 2HQEA 3M7NA 2YYZA 3D4DA 1TT2A 1CA6A 3PV0A 2EXZA 3TSSA 4FYDA 1EZ6A 5KGUA 3G6JB 1UNSA 4KHZA 2QF7A 4OO1H 3RZDB 3T13A 2LS01 5DM63 2NVQB 4FXKC 3L7ZC 1IHZA 5KNDA 2F0FA 3GTKB 5KRUA 2NZ1D 4BA2I 1D5XC 3H0GB 1W6KA 3QWNA 4RH6A 3GTOB 2KCCA 3OPOA 2K7VA 3WDNA 3TZDA 1PTOC 4Q0FA 5EJWA 3KF8A 2NVXB 5CBEE 2XWJB 3LWUA 2R92B 4JBWA 4ODGA 2A6EC 3PUWA 2A73B 4FP5D 1VMPA 1VMCA 4S3SA 3NWTA 1YNNC 1TR5A 5I2YA 4J1MA 1O7YA 1TVXA 4H7BA 3M3YB 1VDZA 4M8AA 3VA7A 4H0LC 5J1ZA 1EOTA 2QEJC 5I4DA 4UAIA 1EYCA 3J80L 1ENFA 1B44D 3HP3A 4HN7A 3D4WA 3SK5A 1Z47A 1TS5A 3H94A 4G7OC 2F3VA 3HKZB 1XWEA 2RBMA 4BS9A 3MXPA 4PV1C 1TKWB 4XT3B 2F0SA 1WTXA 3V05A 3QOLA 4RA8A 4KY6A 4IUUA 1CQVA 2B2VA 4J8QA 1LLRD 4HSVA 2R7ZB 3AB9A 2EYLA 2NWGA 5C0XG 5C3XA 1JR0D 1WTWA 2EJGC 4ZKBB 1W6JA 3I3CA 3IAYA 1C4QA 3I70A 2F0GA 2D9UA 1HHVA 1TS2A 2MUYA 3RZOB 4IFDG 2NUCA 1PZJD 4HSPA 2NN6H 4NP5A 4PMCA 3OW7A 2F0NA 5DAUA 1D2BA 1DM0B 2RVLA 2KHSA 3V96A 4ZUJA 5IGDA 1UAPA 1A6XA 2AWNA 2YU9B 1SBBB 4HEDA 1OXSC 4K6LA 3T16A 1SXTA 3KLRA 4O1NA 4RGMA 1PZID 1I4PA 3MC0B 4ABNA 3DM1A 4ZUIA 4B9WA 1H9SA 4ZLTF 1ZXTA 4XQJA 4BA1I 2C9OA 4F7XA 3ERQA 1VCIA 5BN5A 3S2DB 4R8NA 4C1NI 1H9KA 2SEBD 4G4KA 2BA0A 3J7AV 4RFBA 4HMJA 4QUCA 2LKVA 1GHKA 1CTMA 2E2HB 2K6AA 3TP6A 1PRTF 5KNCA 3GP7A 1AP0A 3H3VC 4A3JB 3KK7A 1B50A 1LV9A 3BYTB 4UDUC 1X3PA 3QO2A 1Y69U 2EY1A 1U9RA 1PYWD 1QILA 3AU7A 2F0UA 3NWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A68 C;  1HTP A;  2A69 D;  2EJM A;  4KMU C;  2D62 A;  3VR4 A;  2E75 C;  5KND A;  2AUJ D;  2ZT9 C;  4XTC S;  3D31 A;  2NN6 I;  4HR7 B;  2BDO A;  1I6V C;  4BA2 I;  1GUN A;  2JEA I;  4KKU A;  1B9M A;  1O7L A;  2D5D A;  3A7A B;  1V8Q A;  3A8K E;  5C0X H;  3ND8 A;  4H44 C;  2KCC A;  3W3A A;  4IFD G;  1T5E A;  3A8I E;  1ONL A;  2K32 A;  3P20 A;  1FR3 A;  1HQM C;  1OXV A;  1ZKO A;  3OPO A;  1K8M A;  2K7V A;  2R6G A;  2DN8 A;  2JXM B;  2NN6 H;  3HGB A;  3WDN A;  1OXX K;  3PUZ A;  4TQU S;  3D4R A;  2EJF C;  3OW7 A;  3OOC A;  4JK1 C;  1PMR A;  3GD7 A;  1Z7T A;  1Y8P B;  1Z6H A;  4KN7 C;  4DNR B;  4L8J A;  3LWU A;  4KI0 A;  2DNC A;  4I7Z C;  5KNB A;  3FPP A;  1QJO A;  1GUG A;  2EDG A;  1O78 A;  2BE5 D;  2PPB C;  1OXU A;  1A6X A;  3CRL C;  2LMC B;  4JBW A;  3MXU A;  1SMY C;  1IYV A;  1CFM A;  1Q1E A;  1OXS C;  2A6E C;  3PUW A;  2A69 C;  2A68 D;  3EQL C;  1ZYR C;  3VR6 A;  3BG3 A;  3IKJ A;  1V43 A;  3U9S A;  3KLR A;  3GQB A;  3NE5 B;  2AUK A;  2CW0 C;  3T51 B;  3N6R A;  1VF5 C;  1Q90 A;  1YNN C;  3I73 A;  5JEA G;  1Q12 A;  2DNE A;  1TU2 B;  4OO1 G;  1B9N A;  3M85 A;  2B8F A;  3PUX A;  3SDZ A;  2JEB I;  2K33 A;  2D2C C;  4LK1 C;  1VDZ A;  2Q8I B;  3SE0 A;  4KN4 C;  2V4D A;  3M4Y A;  1LAB A;  3VA7 A;  3VR3 A;  2A6H D;  1H9S A;  4H0L C;  5A35 A;  4H13 C;  1Y8N B;  2EVB A;  3I4L A;  3TZU A;  1GHJ A;  1H9S B;  4DNT B;  1H9J A;  1IW7 D;  4BA1 I;  2O5J C;  1Q1B A;  3ND9 A;  1HCZ A;  2PCF B;  1HPC A;  2O5I C;  3H94 A;  4G7O C;  2JE6 I;  3T56 B;  2NN6 G;  3VR5 A;  3BDO A;  2A6E D;  1VCI A;  2B8G A;  3FMC A;  4KKS A;  5BN5 A;  5K36 H;  2F1M A;  1H9M A;  3A8J E;  4DK0 A;  1CI3 M;  2BE5 C;  1E2V A;  1H9K A;  5K36 G;  1H9R A;  1DCZ A;  4IFD H;  3CRK C;  2E74 C;  5BN3 A;  2PNR C;  1FYC A;  2BA0 A;  2IT1 A;  4PV1 C;  4GZY C;  3RLF A;  1IYU A;  2BA1 A;  1EWH A;  3IFT A;  1TKW B;  3PUY A;  4G7Z C;  1DD2 A;  1GHK A;  4TKO B;  1CTM A;  1GJX A;  1IW7 C;  2E76 C;  5BN4 A;  3M7N A;  2YYZ A;  3A7L A;  2KA7 A;  3LNN A;  5KNC A;  3PV0 A;  4DK1 A;  1OXT A;  4OGQ C;  2A6H C;  1YNJ C;  3QG1 A;  1K8O A;  1VF7 A;  3QJY A;  5JEA H;  3VR2 A;  4KHZ A;  4OO1 H;  2QF7 A;  1Y8O B;  4KKT A;  2L5T A;  3PUV A;  3DXJ C;  3T53 B;  1G29 1;  3AB9 A;  4XIG S;  3QIA A;  1E2W A;  3MFY A;  4IQZ A;  1LAC A;  1GUT A;  4RCN A;  5C0X G;  1E2Z A;  1DXM A;  1Y69 U;  1GUS A;  3I72 A;  3L7Z C;  2EJG C;  4G7H C;  1GUO A;  4LJZ C;  1BDO A;  2AWO A; 
#chains in the Genus database with same CATH topology
 4OEL B;  3H91 A;  1WTH A;  3KJP A;  4R8I A;  1YHQ A;  2CWA A;  1RHP A;  1TXY A;  4DUY L;  3MWY W;  4C1N K;  3URY A;  5C4J H;  1ASZ A;  1SNM A;  3CP0 A;  3EA6 A;  4KKU A;  3EJI A;  1CSP A;  3BDC A;  4PZ6 A;  2AHO B;  2TMP A;  1EIY B;  1EY9 A;  1A63 A;  1DOL A;  3KBX A;  3GTG B;  4DV7 Q;  2IY5 B;  4A75 A;  4JI7 Q;  1S5B D;  3E6Z X;  4IJL A;  1KLG D;  4A3M B;  5TSS A;  4DR2 Q;  4UP8 A;  1NSN S;  3DHQ A;  2E2D C;  2ZXO A;  4X3K A;  2F0H A;  1QOH A;  1Q8I A;  2EOT A;  2SDF A;  1TWA B;  2PMZ B;  3GQB A;  5J39 A;  3T51 B;  1YEZ A;  1MI2 A;  1RKN A;  1WCM B;  2IPK D;  4A3B H;  3GTM H;  4QB4 A;  1TU2 B;  4GKK Q;  1KL9 A;  3M85 A;  2AQ1 B;  4A3C G;  4LUO A;  1E1O A;  5NUC A;  2F0Q A;  3S2D H;  4C3H B;  3TP7 A;  1PYS B;  4LF5 L;  1W3S A;  1VQ9 A;  1ILP A;  4DNT B;  4JI5 Q;  5CV9 A;  1HCZ A;  4NXN Q;  2LSS A;  5C3W A;  3GTL B;  2KCT A;  2F0M A;  5C44 H;  3HKS A;  4YY3 L;  4DN4 M;  1MJE A;  1DON A;  2VB2 X;  1VQK A;  4BY7 G;  2PNR C;  4K2K A;  4CKC A;  1HUM A;  4KY5 A;  1PZK D;  5CGK A;  4V0B A;  1E3P A;  1PFN A;  4TKO B;  4WRD A;  1HJP A;  3LNN A;  1STN A;  4CKB A;  4EQ5 A;  4JI2 L;  3OTO L;  3R93 A;  1NBW A;  1SAP A;  2UUB Q;  3VR2 A;  1B3A A;  3FKI B;  1YBY A;  1G29 1;  2DY7 A;  1KNE A;  1I4Q A;  2UUC Q;  3OHX C;  4KD4 A;  4ZYS A;  2O2L D;  4IN3 A;  2ICI A;  4NPS A;  2F0P A;  5FO8 B;  3S14 B;  5DNF A;  1N33 L;  1Q86 C;  3A74 A;  1RJT A;  1FGB D;  1K3R A;  3SR1 A;  2NN6 I;  1WTO A;  5H1S E;  1GUN A;  4P2C B;  4U68 A;  4DK6 C;  2IX0 A;  2XIW A;  2JA8 B;  2F0E A;  4LF5 Q;  1F2Z A;  1L0W A;  2K32 A;  1FR3 A;  4OHJ A;  1HH2 P;  1PH7 A;  4TQU S;  3DEO A;  1EYD A;  4C3J G;  1KAA A;  4N8F A;  1D1K A;  1TWA H;  2JA9 A;  4GKJ Q;  4PNY A;  4B3R Q;  2EIF A;  3MXN A;  3OW2 A;  1QUQ B;  2CH4 A;  1TWC H;  2RKS A;  4A3M G;  5GAG C;  1II3 A;  1IBK L;  5IOC A;  2WII B;  3KFU A;  1S5C D;  3HFZ B;  4DNI A;  2CCZ A;  3VR6 A;  4ZK9 B;  1YNN D;  5D14 A;  1RD9 D;  2JA6 H;  4DR5 Q;  1HZ9 A;  4ZAI A;  4A3E G;  1L1O C;  1VQ5 A;  2WAQ E;  4RWS C;  5LL6 S;  2NZO A;  3F2C A;  1JMC A;  3SE0 A;  1PYB A;  3AYH B;  2G5D A;  3JAM E;  4C3H G;  2R7F A;  4Y7N B;  2A8V A;  4DUY Q;  1C8C A;  2IW3 A;  4AIM A;  2NN6 G;  1O7I A;  4K5V A;  1Q8K A;  4HTH A;  1P16 A;  5ELD A;  5AFW A;  1EY6 A;  2BE5 C;  1PTO B;  4B08 A;  3JAM L;  3I4M G;  2E2I B;  4XYQ A;  2WAC A;  1PVO A;  2JA6 B;  3W1B A;  1NJI C;  5C4X B;  1X55 A;  1FD7 D;  4CDF C;  1EQQ A;  3K5O A;  2QEX A;  1CUK A;  1WTR A;  3K5M A;  3HOW H;  3M7G A;  1Y8O B;  3VYU A;  1GXD C;  4ZCK A;  1U0L A;  3QOJ A;  1S4Z A;  3X3M A;  4JI6 L;  4EX5 A;  3CC2 A;  1SSO A;  1XPU A;  3NPP A;  2R7Z G;  3DWA A;  5HUR A;  5M9O A;  2RHQ B;  5E4W C;  4DV0 Q;  1BF4 A;  1DOM A;  1FGU A;  1JE4 A;  4K0K Q;  1HTP A;  1ESR A;  1QUQ A;  1S5F D;  1SMY D;  2KQ3 A;  4XTC S;  1E22 A;  3LWE A;  4JI3 L;  1LTB D;  2EE1 A;  3S16 B;  3I4M B;  5C3E B;  5IGG A;  2VZA A;  1P8L A;  2Z4I A;  2KOL A;  1Q46 A;  2VB3 X;  4GOP C;  3CW2 C;  3W3A A;  1ONL A;  1IKM A;  2F0J A;  1EUJ A;  4YWK A;  3GV3 A;  2LXJ A;  1TII D;  5IT9 c;  4OWT B;  3TBI B;  1M8A A;  3D4R A;  2K03 A;  1PMR A;  1D1I A;  1K3B C;  3C2P A;  1DZ1 A;  2L55 A;  1SND A;  3GTP B;  3V2T A;  1JWS D;  4P73 A;  3CRL C;  1F2Y A;  3MXU A;  5FKA C;  4LFC L;  2A69 C;  4IZ8 A;  4TRD A;  2Y0S B;  4C2M H;  4B3M L;  1SNO A;  4NKL A;  2JA7 B;  2VY3 A;  1Q12 A;  4B3R L;  3S1R B;  2B8F A;  3PUX A;  1LT5 D;  3EVQ A;  3NEL A;  3PO2 B;  3J81 L;  2V4D A;  1ENC A;  4KV6 A;  3SK4 A;  5I2X A;  2O5J C;  1Q1B A;  2WB1 E;  1XYI A;  1ML0 D;  2CKZ B;  4APV A;  2NVT B;  4ZKC B;  5A2Q L;  1LT4 D;  3F2U A;  3TS2 A;  5C0X J;  4GLX A;  4A3K H;  3J81 E;  2I0Q A;  1JOR A;  1X3E A;  4DFA A;  2H5X A;  4CJ0 B;  1H9R A;  2R93 G;  2VL6 A;  4GZY C;  4CKE A;  2BA1 A;  2EY5 A;  2NTS A;  5AJ3 Q;  5EKI A;  1XPR A;  4B3M Q;  2JA6 G;  5D65 A;  1L2F A;  2B2V C;  2F4V L;  1K8O A;  5T1I A;  1NCV A;  2XN9 C;  5JEA H;  1I4G A;  1UE5 A;  5M3M H;  2WIN B;  4A3M H;  1XNQ Q;  3J7Y W;  3C1E A;  4IQZ A;  1C48 A;  3G48 A;  2NTT A;  2OXP A;  4BWG B;  1B1Z A;  2RSN A;  3I72 A;  3DEP A;  2I07 B;  2K5D A;  4G7H C;  4Y52 H;  2AWO A;  3STB D;  2A69 D;  3ERO A;  2E75 C;  2V1C C;  1HUN A;  1WTQ A;  4Z9C B;  4IUV A;  2Z8L A;  4RHR A;  2JEA I;  4DF7 A;  4A3I H;  1J6Q A;  5C0X H;  1WD0 A;  3A7A B;  3P1H A;  1I3Q B;  4JI5 L;  3IFD A;  4R4C A;  1AZP A;  1SYD A;  1K8M A;  5M5X H;  2R6G A;  5GAD C;  3HGB A;  1SEB D;  5CYU A;  5M3M G;  4R4Q A;  3X3N A;  4AQY L;  1FNU A;  1LTR D;  2ASB A;  5C0X I;  1STA A;  1Z7T A;  1X3F A;  3KLS A;  1DOK A;  3VYT A;  4DUZ Q;  1WD1 A;  4L8J A;  2ZJQ A;  3FPP A;  1EQR A;  1D5M C;  5CV5 A;  1Q7Y C;  4EVO A;  1BUV T;  4QGU A;  1NTG A;  2E2J B;  1IYV A;  2BOS A;  2D0P A;  3UDX A;  4I7A A;  2PZT A;  2WAQ G;  3GTL H;  1LTG D;  2VXW A;  4DR2 L;  3FRP B;  1KAB A;  4C56 C;  3NQI A;  3EIV A;  2XVS A;  4JI0 Q;  4LF8 L;  4JI7 L;  1LT6 D;  3S17 H;  1W2B A;  2OQK A;  4YWL A;  3EFX D;  5JAV A;  2DGY A;  5FO9 B;  3MEF A;  5A35 A;  3BYY B;  4JI4 L;  4L5Q A;  1U5K A;  4IFD I;  1U4L A;  1Y1V H;  3T1Y Q;  1BBU A;  4C3I B;  1TWG B;  2KEN A;  2HCC A;  1PFB A;  2K1B A;  3VR5 A;  2PO4 A;  1FVI A;  2K5V A;  1WTV A;  1SE3 A;  3NBI A;  1CT1 D;  4BXX G;  4L6T B;  4JYA L;  3PQI A;  5ELN A;  3OIQ A;  5JOB A;  2F0L A;  3L9A X;  2L9H A;  1UE1 A;  4OO1 I;  2K14 A;  4G7Z C;  3KF6 B;  1O80 A;  4DR5 L;  3A7L A;  1A2T A;  2KA7 A;  5EBC A;  1HZB A;  2Z1C A;  1VQH A;  3QG1 A;  1EY8 A;  3BVG A;  3K7A H;  1PTO F;  5M3F B;  5M3F H;  2HDM A;  3PUV A;  3DWQ A;  4K5W A;  1E24 A;  3HOY B;  2EYH A;  2ZJP A;  1J8I A;  4PMB A;  1DXM A;  2IWH A;  4JYA Q;  1SNQ A;  2JA5 B;  1LM0 A;  2RHS B;  4XQQ A;  1BDO A;  4C3I H;  2SNM A;  5M5X B;  1I4H A;  4DR7 L;  3EBE A;  2N78 A;  2E2H H;  5COR A;  1CK1 A;  2NVQ H;  4TSS A;  5IOD A;  4DR6 Q;  2UXC L;  3HEJ A;  1AZQ A;  4JI3 Q;  1JIC A;  4H44 C;  4NW2 A;  1OXV A;  2AMC B;  2K5N A;  2KVM A;  3OMG A;  1NY4 A;  5JPN C;  2KHI A;  4RKB A;  1X6O A;  5CMD A;  2I46 A;  1K8A C;  2YU9 H;  3M4O B;  2B2Y C;  3PMF A;  2UUC L;  4FXD A;  1I50 H;  4JPB W;  2PZW A;  1KD1 C;  1VQB A;  2BE5 D;  3U9O A;  1OO9 B;  1TWC B;  1XMQ Q;  5FJ8 G;  1NR2 A;  3E5S A;  2UUB L;  4X62 Q;  1ZYR C;  1DYQ A;  3GV6 A;  3IKJ A;  3TP8 A;  2CQA A;  3UI2 A;  1FJG L;  3NE5 B;  2AUK A;  2R7D A;  2WAQ B;  1EIH A;  1AW7 A;  4BY7 H;  3RMH A;  5JEA G;  1X65 A;  1S5D D;  1UUP A;  1PRT C;  1G51 A;  3K0X A;  2C35 B;  1EQV A;  2D2C C;  5CV6 A;  5CV7 A;  4A3I G;  2FMM A;  1K83 H;  3DUZ A;  1DGS A;  1A62 A;  4YY3 Q;  3RN2 A;  3AFQ A;  3EN2 A;  1H9J A;  3H3V I;  2Z0S A;  1BQQ T;  2B2U A;  2ES2 A;  2EY2 A;  2N55 A;  2J4X A;  1QE6 A;  1JB3 A;  2A5H A;  1MSG A;  4POF A;  3FKI G;  4KHV A;  3D0F A;  1XNQ L;  1EWH A;  1JQY D;  1XPO A;  2J7Z A;  1QVF A;  1X56 A;  3K59 A;  3UE1 A;  1IBM Q;  2F4V Q;  5LL6 X;  2KED A;  4EQN A;  2F0D A;  4XT1 B;  4MIU A;  1KHI A;  2O4X A;  2NBF A;  3Q6S A;  5C44 B;  2BH8 A;  3QIA A;  1IL2 A;  4A3G G;  4GKJ L;  1Y1W H;  1LTS D;  2XWB B;  5IP9 G;  3Q24 A;  1L1O B;  1TS3 A;  2JA8 G;  2Q2T A;  4IJH A;  1LO5 D;  3CPW A;  4KMU C;  4YCW A;  3VR4 A;  2Z9H A;  5IIF A;  2ZT9 C;  1BR9 A;  4IUP A;  1A0I A;  4DR3 Q;  5D3I B;  2K52 A;  1YHA A;  5ELE A;  3HKZ G;  4WJW A;  4OX9 Q;  1PDQ A;  2XGT A;  1QVC A;  3R2T A;  4C2M B;  4C3I G;  1IBL L;  2QW7 A;  2HHH Q;  3PGZ A;  2DN8 A;  1K8G A;  4WFN 3;  2HDL A;  5DEH A;  2BH2 A;  4IPH A;  2XRQ D;  4XQN A;  4YWM A;  2WFW A;  1HNZ L;  1Z6H A;  2RF4 A;  2C5C A;  3BS1 A;  3GTP H;  4DV2 Q;  3NXW A;  2RQX A;  1F9P A;  3OWF A;  4KJO A;  4A3K B;  1SMY C;  4JI2 Q;  1PFM A;  1PH5 A;  1CKM A;  5CR3 A;  1MGS A;  1QVG A;  1HNX L;  1KDC A;  3QR8 A;  3I4N G;  5IWA Q;  4V19 0;  1SDF A;  5C44 G;  4Q5V A;  3PF5 A;  1KAW A;  5ELO A;  2VQE Q;  4OO1 G;  4QUF A;  3HZX A;  1TQO A;  3ZYY X;  4A3D B;  4A3J G;  4A93 H;  3J80 i;  2PW5 A;  2R92 H;  5DM7 3;  2EQS A;  3I4L A;  5C3E H;  1F9R A;  1UE6 A;  4BY7 B;  1B3Q A;  4P75 A;  2K05 A;  3NEM A;  3Q0A A;  4DAP A;  2Z6K A;  4KHP L;  3PO3 B;  1HTL D;  4DU9 A;  1QG7 A;  2OT2 A;  3NTK A;  1WTP A;  4LF4 L;  1JE5 A;  3A8J E;  4DK0 A;  1E2V A;  3K7A B;  4GKK L;  1ESF A;  2HD3 A;  3CRK C;  3IRB A;  3RLO A;  1M90 C;  4GN5 A;  1R9T B;  2VUM G;  3HRZ C;  5EQ0 A;  4LF6 L;  4R9W A;  2R93 B;  2R93 H;  1XMO L;  3RR5 A;  1YNJ C;  1N32 L;  1JJC B;  1G6Z A;  2ZTC A;  2OCE A;  3K80 C;  4JC0 A;  2EY6 A;  4KKT A;  2KBN A;  2L4N A;  1FNV A;  4GN4 B;  1N36 Q;  3S1N B;  4DV7 L;  1LAC A;  2CVR A;  3MAQ A;  1CZW A;  1GUT A;  1E2Z A;  2QDB A;  2K04 A;  1JOO A;  4A4I A;  2B2W A;  5LHY 1;  1GUO A;  4ALP A;  3M9B A;  1RTN A;  1SJH D;  1K28 A;  4BBS H;  3WWV A;  3MFG A;  2MHV A;  3PO2 G;  1KDB A;  3KOJ A;  3CCS A;  4EGV A;  3GO5 A;  4NB3 A;  4JI1 Q;  2A1A A;  3A8K E;  3R2I A;  4X66 Q;  2VUM H;  3NTH A;  2RDH A;  1B70 B;  5EPJ A;  4JCV E;  3HG9 A;  1JWM D;  4K8I A;  1HR0 L;  3BDL A;  4OL7 A;  1A3U A;  2PYK A;  3HOV G;  3D8G A;  4KK7 A;  2B2T A;  1PXU A;  2L12 A;  4A3B G;  4NMZ A;  3I91 A;  4H02 A;  2PPB C;  1O78 A;  3OIP A;  2QGQ A;  1IBK Q;  4LAA A;  2KCM A;  4UY8 C;  1EFW A;  4UHV A;  3BG3 A;  1GM5 A;  1V43 A;  3U9S A;  4YCU A;  4FO2 A;  3N6R A;  4P74 A;  1VF5 C;  4LFB Q;  1Q90 A;  2K75 A;  1S3O A;  1EU3 A;  3CD6 A;  1PH2 A;  1EYA A;  1TWH H;  1STE A;  3G7L A;  3CPF A;  1XXG A;  2FJ2 A;  4LK1 C;  2KJX A;  1BKB A;  3RN5 A;  1YJN A;  4AYB B;  3B6Y A;  3I4O A;  3BVZ A;  5JJL A;  1LTA D;  3L2P A;  4GOP B;  4K14 A;  1AE2 A;  3CCU A;  2K01 A;  2LY7 A;  5CV4 A;  3I7F A;  3RLN A;  2O5I C;  4C3J B;  2M00 A;  1N33 Q;  1WCM G;  1AEX A;  3KF8 B;  4LMQ D;  2KCN A;  4PZ8 A;  1CI3 M;  4JI8 Q;  5K36 G;  3S1R H;  5C5L A;  4DV3 L;  2PMZ E;  4N8X 1;  4QY7 A;  1PV4 A;  2HT1 A;  2F4I A;  1IYU A;  4ULL A;  3UDG A;  4B3T L;  2E5L Q;  3S2H H;  4N9T A;  2ZTD A;  1RDP D;  1WJJ A;  1ET9 A;  3FHW A;  3STB C;  1PLF A;  4A76 A;  3MVV A;  2B2U C;  3H09 A;  4MN3 A;  3K6O A;  2ZM6 L;  3M3Y H;  2L11 A;  3T53 B;  4K2L A;  1Y1W B;  2AKW B;  1I50 B;  5JEA J;  3FVQ A;  3MFY A;  3CAM A;  3GTM B;  1JOQ A;  2JA7 H;  2KHJ A;  3SK8 A;  1A15 A;  4B3T Q;  1I94 Q;  2IL8 A;  5I6W A;  2F52 A;  4FF4 A;  1HZA A;  1BO0 A;  1YZ6 A;  3C3L A;  5E1F A;  2XRS D;  3J80 c;  4B3S L;  2AUJ D;  4DV4 L;  4ID6 A;  1SNC A;  4X3T A;  4NXN L;  1GKH A;  4HR7 B;  4DA2 A;  1VQL A;  1O7L A;  1V8Q A;  5IT9 L;  1WI5 A;  4DAY A;  1PH6 A;  1T5E A;  2M9V A;  5I9P A;  3P20 A;  1S40 A;  3M4P A;  1ICF B;  2R61 A;  1ROD A;  2VQF Q;  3CC4 A;  3HOY G;  1SYF A;  1FNW A;  3HKZ E;  3SEB A;  4NXM Q;  2PNH A;  4HID A;  3H15 A;  5LMU L;  2UXD Q;  3G6E A;  1X3Q A;  4KN7 C;  2DUD A;  2I5H A;  1LTT D;  4KTA A;  1N34 L;  1TWH B;  4LFB L;  5IP7 H;  4J15 A;  1OXU A;  1ASY A;  1F77 A;  4LF7 Q;  4A3B B;  2ALY B;  4X3U A;  1NR4 A;  1VQN A;  1T5X D;  4A3E B;  5EAY A;  3TRE A;  4DR1 L;  1I5F A;  4JG2 A;  3TS0 A;  5IP7 G;  1BNZ A;  3HOX G;  1MIU A;  3I56 A;  1VQ8 A;  4DV1 Q;  2IJ0 A;  3I73 A;  2DNE A;  4POG A;  2LFN A;  1CZG A;  4L63 B;  2RCN A;  3AMU A;  3AEV A;  5I9O A;  2KUM A;  4KN4 C;  3M4Y A;  1X54 A;  2M2L A;  1IZ6 A;  4LWC A;  4MTK A;  3VR3 A;  3BJU A;  4DV6 L;  1Y8N B;  1V1P B;  4AYB G;  1TY0 A;  4U67 3;  2EYJ A;  5M5W H;  4E6I A;  1IYJ B;  2D0O A;  3Q23 A;  5FJ8 H;  2EYF A;  4MHE A;  2MGS A;  3PIP 3;  4RGT A;  3E9H A;  5LMN W;  1EWI A;  3T56 B;  3TP5 A;  5FLX E;  4DV6 Q;  4RCO A;  1ENA A;  3NHH A;  5K36 H;  1R4P B;  1UWV A;  3E3X A;  1BCP B;  3OYY A;  1DCZ A;  4F87 A;  2B39 A;  3VYR A;  3SK6 A;  1U4R A;  3RLF A;  3Q8D A;  1LTL A;  2PW7 A;  3IFT A;  1CA5 A;  5C4Z A;  1FL0 A;  1G91 A;  1HQR D;  4OWW B;  2A6H C;  2X69 A;  3QJY A;  4JBK A;  4A3F G;  1AN8 A;  3C46 A;  1JJG A;  2L5T A;  3VA5 A;  4BY1 G;  2B63 B;  2I5L X;  4F88 A;  1GUW A;  2A74 C;  2RCF A;  5D3D A;  2QIL A;  5IYC H;  5JVH 3;  1N34 Q;  3KLW A;  1WFQ A;  3FEW X;  2UU9 L;  1U4P A;  3WOF A;  1PRT B;  3P7J A;  5IYC G;  4K5X A;  5LMN L;  3S1M B;  1XJV A;  1SLJ A;  4IUN A;  4JV5 L;  4GS3 A;  3VYS A;  2F0W A;  2WKC A;  4UPA A;  5EKL A;  1EL0 A;  2F0O A;  4A3I B;  5COY A;  2ATW A;  1BCP F;  4IAL A;  1B9M A;  1DD2 A;  1N8R C;  2Q8R E;  4CDC C;  4GOP A;  3RZD H;  3NSW A;  4LFA L;  1RIP A;  1JWU D;  1YNJ D;  4B3S Q;  5IYD H;  4JOI A;  5C4X H;  5C3E G;  3CMA A;  3MXG A;  5M5W B;  4A93 B;  2RSO A;  4DNR B;  2JQO A;  1RCV D;  1ZEQ X;  1JJ2 A;  1JT8 A;  3KLS X;  1JOK A;  2GVA A;  2EDG A;  3DM3 A;  1EEI D;  4K6D A;  1Q1E A;  2IHF A;  3HOW B;  2ZM6 Q;  5GAE C;  1EYG A;  1MSH A;  2H4O A;  1VQD A;  3PO3 H;  5KEE A;  2Q8T A;  3A5U A;  1D7Q A;  4QIW B;  1DJR D;  3WOE A;  1QB5 D;  3CKI B;  3ONA B;  3I55 A;  3BU2 A;  4FVM A;  3HOZ H;  2WKD A;  3MXN B;  1YI2 A;  2L1B A;  1LAB A;  4DGZ A;  4DKA C;  2UUA Q;  2YV5 A;  5ISR A;  1IBL Q;  4WJ4 A;  3FP9 A;  4A93 G;  1ET6 A;  1HPC A;  3CXC A;  4B9X A;  2I5M X;  4DR3 L;  1PH1 A;  2CHB D;  2EYO A;  1HZC A;  4MNO A;  3I4N H;  3I4N B;  3P75 A;  4CGY B;  1EY5 A;  5GRO A;  3K0Y A;  2NVT H;  4HCE A;  3NQT A;  2E8G A;  1QNK A;  5BN4 A;  2J0T D;  1HRJ A;  1QNU A;  4AH6 A;  1G8Z D;  5E7N A;  1BVS A;  2FIN B;  1L0X B;  5I6Y A;  1V1Q A;  2X6G A;  2EZV A;  4P72 A;  2Z4H A;  1X9N A;  4BY1 B;  1M4V A;  2K50 A;  5GAH C;  3OWE B;  2EYM A;  3IL8 A;  3DLL A;  2XSC A;  1V1O A;  1SRO A;  2CH4 W;  1SYC A;  1LUZ A;  1CSQ A;  1HA6 A;  2N88 A;  1EWC A;  2F0I A;  4K8J A;  2OQ0 A;  2SNS A;  2DJF C;  4JI1 L;  2D5D A;  3HOU G;  1CQF A;  2UUA L;  1OTC A;  3GTK H;  4CDD C;  4L5R C;  3W1G A;  1OXX K;  1KC8 C;  4J6H A;  4YCV A;  3OOC A;  3GD7 A;  4N9P A;  2JSO A;  3NTI A;  1I4X A;  3PCO B;  5ELC A;  1EOV A;  2PI2 A;  3GTQ B;  4FF1 A;  3GTJ B;  1N36 L;  2NVX H;  4JBM A;  3GTG H;  5ELF A;  5M3M B;  4X62 L;  5KIX A;  3ER0 A;  4KLK A;  4CBV A;  4ME5 A;  2A19 A;  1XMO Q;  4LF6 Q;  3E9I A;  1K83 B;  1MD2 D;  1XTC D;  3MTS A;  3SXH A;  3T1H Q;  4IUQ A;  1A8V A;  2IHE A;  2YTY A;  3MZ5 A;  2QKI C;  3S15 B;  3TZU A;  3I2Z A;  5EKK A;  3ND9 A;  4KHP Q;  2QDL A;  2PCF B;  3J80 E;  3GTO H;  3HOZ G;  3KUP A;  2JE6 I;  5LMN Q;  3HOY H;  2Q2I A;  2A6E D;  4A3L H;  5C4J B;  2B8G A;  4A3F B;  1CHQ D;  3S16 H;  1ILQ A;  1H9M A;  4DXG A;  3M4Q A;  2UU9 Q;  1J9O A;  5IGB A;  2E74 C;  2ZTE A;  3H0G G;  1SJE D;  5EPK A;  1B53 A;  4HMI A;  1GJX A;  3BZC A;  2E76 C;  4BBS B;  1S72 A;  1I4R A;  1OXT A;  4OGQ C;  2RA4 A;  5E3F A;  1K9M C;  2RDF A;  3G71 A;  5HY6 A;  1KNA A;  5FLM G;  4IUT A;  1G2T A;  1GD7 A;  3PIP A;  1TY2 A;  3PIO 3;  1G2S A;  4DV2 L;  1BXT A;  1VQM A;  3F2B A;  5JPM C;  2ENB A;  2EXD A;  1J5E Q;  4F8M A;  3OSO A;  1GUS A;  1XNR Q;  4Y7N H;  2MPM A;  1CHP D;  2FFK B;  3NUC A;  1PH4 A;  2CFM A;  4OIJ A;  4FF3 A;  4X3S A;  5IGE A;  1R9T H;  1G6P A;  3MEH A;  4PZ7 A;  4PQX A;  5J22 A;  1I6V C;  5C4H A;  3KDF A;  3T1Y L;  1VS0 A;  4O0A A;  1I6H B;  3ND8 A;  2MQH A;  2WV6 D;  3TDQ A;  4ZQ3 A;  5KYI A;  3T4A C;  1Y1V G;  1A3T A;  4EQO A;  5JJI A;  2L0C A;  1RL2 A;  4LUZ A;  2HIX A;  4A3C H;  3T1H L;  3NP8 A;  4RGO S;  5JJZ A;  2ICE C;  3I8Z A;  4DV1 L;  1UE7 A;  3N52 A;  2N49 A;  5FLX c;  2OF1 A;  3VDY A;  1A3V A;  4KI0 A;  5KNB A;  2YTX A;  5BR8 L;  1HNW L;  4M1U B;  2K28 A;  1EZ8 A;  4A3D G;  4LF7 L;  2F3W A;  2K4K A;  3G4S A;  4IOA A;  4CJ1 B;  1AFP A;  2EPB A;  5K5P A;  1IBM L;  1Y1V B;  1A2U A;  2AQ2 B;  4YHH L;  4BBR B;  2CW0 C;  3A0J A;  3RUZ A;  2F0V A;  3K81 C;  1HXY D;  3GTJ H;  2B3G A;  1QWY A;  4GLV B;  4LUV A;  4QIW E;  1X32 A;  4A3K G;  3SDZ A;  1EFI D;  3D6C A;  4G57 A;  2K33 A;  5IYB G;  2Q8I B;  3D3R A;  5FO7 B;  4A3F H;  3OMC A;  5HGQ A;  1KLU D;  4JW0 A;  4RG1 A;  1Q81 C;  2ZXR A;  2HUG A;  4IO9 A;  1GHJ A;  1H9S B;  4DXF A;  2KEC A;  4R4T A;  5F2D A;  3K5N A;  4XYO A;  4DAV A;  1SN8 A;  1Q82 C;  4OWX B;  3A54 A;  4QF4 A;  2JA8 H;  1K73 C;  2SOB A;  4QJF A;  3FMC A;  1YJ9 A;  3HOX B;  3HOX H;  4TVA B;  4IUR A;  4WOR A;  2F03 A;  3UDF A;  4IOC A;  1PH9 A;  1F2L A;  3C1F A;  3PUY A;  1HNX Q;  4BBR H;  1IW7 C;  2PI2 E;  1D8L A;  2YTV A;  2PQA B;  1Y14 B;  3KDF B;  4YHH Q;  1QZG A;  4BY1 H;  5M5Y H;  3S24 A;  2NB0 A;  3FDT A;  2GVB A;  3CCJ A;  2DY8 A;  3O13 A;  4XIG S;  5ELB A;  5BR8 Q;  1HNW Q;  1C0A A;  1E2W A;  2F0T A;  2CWP A;  3HOU B;  1KDA A;  2VW9 A;  4JOI C;  3JAM c;  4X64 L;  1D5Z C;  3W2D A;  4QMG A;  4HJ7 A;  2HHH L;  2EJM A;  2B29 A;  3CQZ H;  4BXX H;  1YVC A;  3S2H B;  5HGT A;  4OX9 L;  2VUM B;  2FHT A;  3E0J A;  2LXK A;  1MJC A;  1NAP A;  2MO1 A;  3J81 c;  4L5S A;  5T1G A;  5E4X A;  2ID0 A;  1STH A;  1CKN A;  3S9W A;  3M4O H;  2MFI A;  4DR6 L;  3I90 A;  3R3O A;  3QB3 A;  4ZRZ A;  2B63 G;  5M5Y B;  2EJF C;  1Y8P B;  2B2Y A;  2IX3 A;  3R8B A;  4KJN A;  2DNC A;  1QJO A;  1XTD A;  2DJG C;  1STG A;  2N8N A;  1CM9 A;  4A3J H;  1EEF D;  4LF9 L;  2A68 D;  3HOV B;  2XNA C;  3E0E A;  2PQE A;  3ZJY C;  3BVM A;  1NMF A;  5J3B A;  1E1T A;  3A56 A;  1ZYR D;  1HR0 Q;  4NDX A;  1BOS A;  3CCV A;  5G3L D;  2FMC A;  1SYG A;  1PRT D;  1JC7 A;  1TWG H;  5GQO A;  1TWF B;  1F9Q A;  2G9D A;  1SYB A;  5CC4 A;  2F0K A;  4EQP A;  2E2I H;  1PTO D;  4A3G B;  1BCP D;  1PH3 A;  5KYL A;  3BDO A;  4KKS A;  5CV8 A;  2Y0S G;  2F1M A;  4K0K L;  1E7Z A;  3J81 j;  3PO2 H;  4IPG A;  4LW1 A;  5IYD G;  5BN3 A;  1FYC A;  3DMU A;  1VQF A;  3UE0 A;  4GNX C;  2K5W A;  1YJW A;  4JI6 Q;  1V1P A;  3SVM A;  5IGF A;  1S5E D;  3KF6 A;  2P5Z X;  2PZU A;  4GLA C;  1STY A;  1NUC A;  2VNU D;  2PQA A;  1CKN B;  1VF7 A;  1XMQ L;  1VQI A;  1B2T A;  3L0O A;  5C6A A;  4CHT B;  1GOZ A;  4DPG A;  1K0S A;  3F1Z A;  5IYB H;  4HAE A;  2F3I A;  1SR3 A;  3AQQ A;  4BBR G;  5EPL A;  5FLX L;  4KY7 A;  4DUZ L;  4HCS A;  4RCN A;  1EY0 A;  1PFS A;  1EY7 A;  1L0Y B;  3KYH C;  4LJZ C;  2GN5 A;  4AQY Q;  1RTO A;  2A68 C;  1E0B A;  2D62 A;  3K7U C;  1BBX C;  3D31 A;  5EBD A;  5A2Q E;  4PG3 A;  4GN3 B;  4CJ2 C;  4FF2 A;  3TQY A;  2H1E A;  1STB A;  1QCB D;  1RF2 D;  3A55 A;  1HQM C;  1SYE A;  3SHL A;  2JXM B;  1BCP C;  4L5T A;  2ZJR A;  1C9O A;  3HOW G;  2TSS A;  1J5E L;  3NEN A;  4JK1 C;  3RD4 A;  3FPU B;  1IKL A;  2JP1 A;  1L1O A;  2X6L A;  2B2W C;  2HCI A;  1I3Q H;  1SE4 A;  5FK9 C;  2WP8 J;  4OXP A;  4RHS A;  1MBY A;  2HQL A;  3SGI A;  4I7Z C;  5EGT A;  1LTI D;  3DWP A;  2VS1 A;  3U4Z A;  1UEA B;  4RGN A;  4LF9 Q;  4R4I A;  3NBH A;  1VQ7 A;  3EQL C;  3CCE A;  3JC6 6;  1PH8 A;  3AFP A;  3LX0 A;  1HNZ Q;  1KTK A;  3K57 A;  3KJO A;  3D6W A;  1XX8 A;  3BZD B;  1B4O A;  5LMU Q;  2UXD L;  2JEB I;  1SFO H;  4HJA A;  4RAU C;  4NXM L;  1D6E C;  1EY4 A;  2KEE A;  1CKO A;  1GVP A;  3ULP A;  1EU4 A;  1VQA A;  2EVB A;  4X6A H;  4O42 A;  3TME A;  1IW7 D;  4JI4 Q;  1NNX A;  3J81 i;  4PMW A;  2Z6K C;  3KBG A;  4RMF A;  4WJ3 M;  4A3E H;  4IFD J;  5IGC A;  4DV4 Q;  1YIT A;  2IX1 A;  1EQT A;  1ICW A;  4X64 Q;  4JI0 L;  3HOZ B;  3S17 B;  1LT3 D;  1HFN A;  3RNU A;  2G9H D;  3A5Z B;  4R1J A;  2IT1 A;  5C5M A;  4LNQ A;  1TS4 A;  4P71 A;  1VQ4 A;  3CCL A;  2R3Z A;  3CU7 A;  4FXG C;  5FLM H;  4HJ8 A;  4DK1 A;  1NMG A;  5JVG 3;  5G3L F;  1SE8 A;  2JK8 A;  4KD3 A;  1SRU A;  3DXJ C;  1JCK B;  1AH9 A;  3ULL A;  1YHB A;  1U4M A;  1WCM H;  1F2M A;  2ZXP A;  3NK9 A;  1O7Z A;  2Y0S E;  3CQZ B;  3H6M A;  4JI8 L;  1YIJ A;  2EYP A;  2OTL A;  4I65 A;  2MP1 A;  3MHB A;  3CHB D;  1KQS A;  5IY0 A;  2BDO A;  3U58 A;  1HR0 W;  2JN4 A;  2MJ8 A;  2WB1 G;  3A8I E;  1Y1W G;  3NBH B;  1SFO B;  1WVL A;  1ZKO A;  2WB1 B;  1R4Q B;  1NE3 A;  3PUZ A;  3J7A F;  1QZH A;  1SMX A;  4OEM B;  5C4X G;  2B2T C;  3H0G H;  4JBJ A;  2NYZ D;  3HOU H;  3UDI A;  2JYO A;  1IL8 A;  1GUG A;  2NZH A;  3L3O C;  2LMC B;  1CFM A;  1Q3L A;  3ITP A;  3BZK A;  1B7Y B;  2GA4 B;  1HA5 A;  5IE8 A;  1HFG A;  1SNP A;  5AJ3 L;  4YIJ A;  3CC7 A;  2N3S A;  5CBA E;  4XXE A;  3K58 A;  4QCL A;  2QCP X;  4ILW A;  1EIF A;  2OEO A;  4XDX A;  1B9N A;  2K5Q A;  1SE2 A;  1PTO H;  4O2D A;  4OIK A;  4AYB E;  1C7Y A;  3S1Q B;  5FOB B;  2RDG A;  2A6H D;  4H13 C;  3I4M H;  3F2D A;  2UXC Q;  2BDN A;  4X66 L;  2NVY H;  2NVY B;  4FNF A;  3K5L A;  2CW0 D;  4MZ9 A;  4RKL A;  3PSI A;  3ICE A;  4A3L G;  2AQ3 B;  4DR7 Q;  4FDB A;  2B63 H;  3TN2 A;  2BCO A;  1XNR L;  1EIG A;  3MA2 B;  3Q22 A;  4IFD H;  4CDE C;  4UP7 A;  1KIX A;  1YNX A;  1VQP A;  2R92 G;  1F9S A;  3ULJ A;  5IT9 E;  3TRZ A;  3HS0 C;  3CCM A;  2HQE A;  3M7N A;  2YYZ A;  3D4D A;  1TT2 A;  3S15 H;  1CA6 A;  3PV0 A;  2EXZ A;  3TSS A;  3S1N H;  4FYD A;  1EZ6 A;  4DR1 Q;  5KGU A;  4QL5 A;  4KHZ A;  1UNS A;  3G6J B;  2QF7 A;  4OO1 H;  4A3D H;  3RZD B;  3T13 A;  2LS0 1;  5DM6 3;  1T9H A;  2NVQ B;  4FXK C;  3L7Z C;  1M1K C;  2JJQ A;  3HOV H;  1IHZ A;  4LFA Q;  5KND A;  3PIO A;  3U4V A;  2OWO A;  4LF4 Q;  2F0F A;  1PHJ A;  3GTK B;  5KRU A;  2NZ1 D;  4BA2 I;  2XTI A;  5JJK A;  1D5X C;  3H0G B;  3PF4 A;  1W6K A;  3QWN A;  4RH6 A;  3F8T A;  3GTO B;  2KCC A;  4HIM A;  1AE3 A;  3OPO A;  2K7V A;  3WDN A;  1VQG A;  3TZD A;  1PTO C;  4Q0F A;  1VQC A;  5EJW A;  4LF8 Q;  3KF8 A;  5M3F G;  2JA5 H;  2NVX B;  1IXR A;  5CBE E;  2XWJ B;  3LWU A;  2HIV A;  1WYD A;  2R92 B;  5IWA L;  2JA5 G;  4JBW A;  4ODG A;  3S1Q H;  3ERS X;  4HJ9 A;  2A6E C;  3PUW A;  2A73 B;  2FXQ A;  4FP5 D;  4IPC A;  1VMP A;  3OTO Q;  4A3G H;  1VMC A;  5IP9 H;  4S3S A;  3NWT A;  3TEH B;  3CCQ A;  1YNN C;  1TR5 A;  5I2Y A;  4J1M A;  1MKH A;  1O7Y A;  1Z9F A;  4DK3 C;  1TVX A;  4H7B A;  3M3Y B;  1VDZ A;  4M8A A;  3VA7 A;  4H0L C;  5J1Z A;  1EOT A;  2QEJ C;  5I4D A;  4UAI A;  1EYC A;  3J80 L;  3GDE A;  1ENF A;  1B44 D;  3HP3 A;  4HN7 A;  3D4W A;  3SK5 A;  1Z47 A;  1TS5 A;  3H94 A;  2UXB Q;  4G7O C;  3S14 H;  2F3V A;  3CF5 A;  1K0R A;  4C3H H;  2CQO A;  3HKZ B;  1XWE A;  4HJ5 A;  2RBM A;  4BS9 A;  4UP9 A;  3RZO H;  4C3J H;  1H95 A;  3MXP A;  4PV1 C;  1TKW B;  4XT3 B;  2F0S A;  1WTX A;  1N9W A;  3V05 A;  3CCR A;  3QOL A;  4RA8 A;  4KY6 A;  4IUU A;  1CQV A;  2B2V A;  4J8Q A;  1LLR D;  4HSV A;  2R7Z H;  2R7Z B;  3FKI H;  3AB9 A;  2EYL A;  3PO3 G;  2Q2U A;  2NWG A;  1KRS A;  3K8A A;  4HIK A;  5C0X G;  5C3X A;  1JR0 D;  1UEB A;  1WTW A;  2EJG C;  1JB7 A;  3J7A 5;  2VQF L;  4ZKB B;  1W6J A;  3I3C A;  3IAY A;  5L37 A;  1C4Q A;  3I70 A;  2F0G A;  2D9U A;  1HHV A;  2UXB L;  1I6H H;  1TS2 A;  2MUY A;  3RZO B;  4IFD G;  3J7Z C;  2NUC A;  2JA7 G;  1PZJ D;  4HSP A;  2NN6 H;  4NP5 A;  4PMC A;  3OW7 A;  1I94 L;  2F0N A;  5DAU A;  1D2B A;  1DM0 B;  2RVL A;  4GNX B;  2KHS A;  1VQJ A;  3V96 A;  1VQO A;  3CME A;  4R4O A;  4ZUJ A;  5IGD A;  1UAP A;  1FJG Q;  4LFC Q;  1A6X A;  2AWN A;  2YU9 B;  1SBB B;  2K5H A;  1V9P A;  4HED A;  4MTN A;  1OXS C;  4DAM A;  4K6L A;  1X3G A;  1N32 Q;  2E5L L;  3T16 A;  1SXT A;  3KLR A;  3U50 C;  2MNA A;  4O1N A;  4X65 L;  4DR4 L;  4OON A;  4RGM A;  3W5O A;  4DV3 Q;  1PZI D;  1I4P A;  3JAM i;  3MC0 B;  1VQ6 A;  4ABN A;  4DV5 Q;  1KXL A;  3LGJ A;  3DM1 A;  1B8A A;  4JVZ A;  4ZUI A;  4B9W A;  1H9S A;  4ZLT F;  1VQE A;  1ZXT A;  4XQJ A;  4BA1 I;  2MO0 A;  2C9O A;  4F7X A;  3S1M H;  2L15 A;  4ME3 A;  4JV5 Q;  2QA4 A;  1PA6 A;  3ERQ A;  1VCI A;  1KRT A;  5BN5 A;  4DV0 L;  4R8N A;  3S2D B;  4C1N I;  3H3V H;  1H9K A;  2SEB D;  4G4K A;  4DV5 L;  2BA0 A;  4BBS G;  4GNX A;  3J7A V;  4RFB A;  2VQE L;  4HMJ A;  4QUC A;  2LKV A;  4DR4 Q;  1CTM A;  4X65 Q;  2E2H B;  1GHK A;  2K6A A;  1TWF H;  3TP6 A;  1PRT F;  5KNC A;  4QQB X;  3GP7 A;  1AP0 A;  3H3V C;  2OTJ A;  4A3J B;  4DAY B;  2Z6B A;  2E2J H;  4HIO A;  3KK7 A;  5DLQ E;  1GO3 E;  1B50 A;  1LV9 A;  3GTQ H;  1BBW A;  2Q2H A;  1MHW C;  3BYT B;  4UDU C;  4IPD A;  1X3P A;  3QO2 A;  2EY1 A;  1Y69 U;  1U9R A;  1PYW D;  1WOC A;  1QIL A;  3AU7 A;  1LYL A;  2F0U A;  3NWS A; 
#chains in the Genus database with same CATH homology
 3H91 A;  4R8I A;  1RHP A;  3MWY W;  4C1N K;  3URY A;  1SNM A;  3EA6 A;  4KKU A;  3EJI A;  3BDC A;  2TMP A;  1EY9 A;  1DOL A;  3KBX A;  3GTG B;  1S5B D;  3E6Z X;  1KLG D;  4A3M B;  5TSS A;  1NSN S;  3DHQ A;  2E2D C;  2ZXO A;  4X3K A;  2F0H A;  1QOH A;  1Q8I A;  2EOT A;  2SDF A;  1TWA B;  2PMZ B;  3GQB A;  5J39 A;  3T51 B;  1MI2 A;  1RKN A;  1WCM B;  2IPK D;  4QB4 A;  1TU2 B;  3M85 A;  2AQ1 B;  5NUC A;  2F0Q A;  4C3H B;  3TP7 A;  1ILP A;  4DNT B;  5CV9 A;  1HCZ A;  5C3W A;  3GTL B;  2F0M A;  4DN4 M;  1DON A;  2VB2 X;  2PNR C;  4K2K A;  4CKC A;  1HUM A;  4KY5 A;  1PZK D;  5CGK A;  4V0B A;  4TKO B;  1PFN A;  4WRD A;  3LNN A;  1STN A;  4CKB A;  3R93 A;  1SAP A;  3VR2 A;  1B3A A;  3FKI B;  1G29 1;  2DY7 A;  1KNE A;  1I4Q A;  3OHX C;  4KD4 A;  4ZYS A;  2O2L D;  4IN3 A;  2ICI A;  2F0P A;  5FO8 B;  3S14 B;  5DNF A;  1RJT A;  1FGB D;  3SR1 A;  2NN6 I;  1WTO A;  1GUN A;  4P2C B;  4U68 A;  2IX0 A;  2XIW A;  2JA8 B;  2F0E A;  1F2Z A;  2K32 A;  1FR3 A;  4OHJ A;  4TQU S;  3DEO A;  1EYD A;  4C3J G;  1KAA A;  1D1K A;  4PNY A;  3MXN A;  2RKS A;  1II3 A;  5IOC A;  2WII B;  1S5C D;  3VR6 A;  4ZK9 B;  1YNN D;  5D14 A;  1RD9 D;  4ZAI A;  4RWS C;  5LL6 S;  3SE0 A;  3JAM E;  4C3H G;  4Y7N B;  1C8C A;  2IW3 A;  2NN6 G;  4K5V A;  4HTH A;  5ELD A;  5AFW A;  1EY6 A;  2BE5 C;  1PTO B;  4B08 A;  3JAM L;  2E2I B;  4XYQ A;  2WAC A;  2JA6 B;  5C4X B;  1FD7 D;  3K5O A;  1WTR A;  3K5M A;  3M7G A;  1Y8O B;  3VYU A;  1GXD C;  3QOJ A;  1S4Z A;  3X3M A;  1SSO A;  3NPP A;  3DWA A;  5HUR A;  5M9O A;  5E4W C;  1BF4 A;  1DOM A;  1JE4 A;  1HTP A;  1ESR A;  1S5F D;  1SMY D;  2KQ3 A;  4XTC S;  3LWE A;  1LTB D;  2EE1 A;  3S16 B;  3I4M B;  5C3E B;  5IGG A;  2Z4I A;  2KOL A;  2VB3 X;  3W3A A;  1ONL A;  1IKM A;  2F0J A;  3GV3 A;  1TII D;  3TBI B;  1M8A A;  3D4R A;  2K03 A;  1PMR A;  1D1I A;  3C2P A;  1DZ1 A;  2L55 A;  1SND A;  3GTP B;  3V2T A;  1JWS D;  3CRL C;  1F2Y A;  3MXU A;  5FKA C;  2A69 C;  4IZ8 A;  4TRD A;  2Y0S B;  1SNO A;  4NKL A;  2JA7 B;  1Q12 A;  3S1R B;  2B8F A;  3PUX A;  1LT5 D;  3EVQ A;  3PO2 B;  3J81 L;  2V4D A;  1ENC A;  4KV6 A;  3SK4 A;  5I2X A;  2O5J C;  1Q1B A;  1XYI A;  1ML0 D;  2NVT B;  4ZKC B;  5A2Q L;  1LT4 D;  3F2U A;  5C0X J;  1JOR A;  3J81 E;  4DFA A;  4CJ0 B;  1H9R A;  4GZY C;  4CKE A;  2BA1 A;  2EY5 A;  2NTS A;  5EKI A;  5D65 A;  2B2V C;  1K8O A;  5T1I A;  1NCV A;  2XN9 C;  5JEA H;  1I4G A;  2WIN B;  3J7Y W;  3C1E A;  4IQZ A;  1C48 A;  2NTT A;  2OXP A;  4BWG B;  1B1Z A;  2RSN A;  3I72 A;  3DEP A;  2I07 B;  2K5D A;  4G7H C;  2AWO A;  2A69 D;  3ERO A;  2E75 C;  1HUN A;  1WTQ A;  4Z9C B;  4IUV A;  2Z8L A;  4RHR A;  2JEA I;  4DF7 A;  1WD0 A;  5C0X H;  3A7A B;  3P1H A;  1I3Q B;  3IFD A;  1AZP A;  1SYD A;  1K8M A;  2R6G A;  3HGB A;  1SEB D;  5CYU A;  3X3N A;  1FNU A;  1LTR D;  5C0X I;  1STA A;  1Z7T A;  3KLS A;  1DOK A;  3VYT A;  1WD1 A;  4L8J A;  3FPP A;  1D5M C;  5CV5 A;  4EVO A;  1BUV T;  2E2J B;  1IYV A;  2BOS A;  2PZT A;  1LTG D;  2VXW A;  3FRP B;  1KAB A;  4C56 C;  3NQI A;  2XVS A;  1LT6 D;  3EFX D;  5JAV A;  5FO9 B;  5A35 A;  3BYY B;  4IFD I;  1U4L A;  4C3I B;  1TWG B;  2HCC A;  1PFB A;  2K1B A;  3VR5 A;  2PO4 A;  1WTV A;  1SE3 A;  3NBI A;  1CT1 D;  4L6T B;  3OIQ A;  5JOB A;  2F0L A;  3L9A X;  2L9H A;  4OO1 I;  4G7Z C;  1O80 A;  3A7L A;  1A2T A;  2KA7 A;  5EBC A;  2Z1C A;  3QG1 A;  1EY8 A;  3BVG A;  1PTO F;  5M3F B;  2HDM A;  3PUV A;  3DWQ A;  4K5W A;  3HOY B;  2EYH A;  1J8I A;  4PMB A;  1DXM A;  2IWH A;  1SNQ A;  2JA5 B;  4XQQ A;  1BDO A;  2SNM A;  5M5X B;  1I4H A;  5COR A;  1CK1 A;  4TSS A;  5IOD A;  3HEJ A;  1AZQ A;  1JIC A;  4H44 C;  4NW2 A;  1OXV A;  2KVM A;  3OMG A;  5JPN C;  4RKB A;  5CMD A;  2I46 A;  3M4O B;  2B2Y C;  3PMF A;  4FXD A;  2PZW A;  2BE5 D;  3U9O A;  1TWC B;  1OO9 B;  1NR2 A;  3E5S A;  1ZYR C;  1DYQ A;  3GV6 A;  3TP8 A;  3IKJ A;  2CQA A;  3UI2 A;  3NE5 B;  2AUK A;  2WAQ B;  1EIH A;  1AW7 A;  3RMH A;  5JEA G;  1S5D D;  1UUP A;  1PRT C;  1EQV A;  2D2C C;  5CV6 A;  5CV7 A;  2FMM A;  3DUZ A;  1H9J A;  1BQQ T;  2B2U A;  2EY2 A;  2N55 A;  2J4X A;  1QE6 A;  1JB3 A;  2A5H A;  1MSG A;  4KHV A;  1EWH A;  1JQY D;  2J7Z A;  3K59 A;  5LL6 X;  2KED A;  4EQN A;  2F0D A;  4XT1 B;  4MIU A;  2O4X A;  2NBF A;  3Q6S A;  5C44 B;  3QIA A;  1LTS D;  2XWB B;  3Q24 A;  1TS3 A;  1LO5 D;  4KMU C;  3VR4 A;  5IIF A;  2ZT9 C;  1BR9 A;  4IUP A;  5D3I B;  5ELE A;  4WJW A;  1PDQ A;  3R2T A;  4C2M B;  4C3I G;  2DN8 A;  4WFN 3;  2HDL A;  5DEH A;  2XRQ D;  4XQN A;  1Z6H A;  2C5C A;  3BS1 A;  3NXW A;  2RQX A;  1F9P A;  3OWF A;  4KJO A;  4A3K B;  1SMY C;  1PFM A;  5CR3 A;  1MGS A;  1KDC A;  4V19 0;  1SDF A;  4Q5V A;  4OO1 G;  4QUF A;  3HZX A;  1TQO A;  3ZYY X;  4A3D B;  2PW5 A;  5DM7 3;  3I4L A;  1F9R A;  4BY7 B;  2K05 A;  3Q0A A;  4DAP A;  3PO3 B;  1HTL D;  4DU9 A;  1QG7 A;  2OT2 A;  3NTK A;  1WTP A;  4DK0 A;  3A8J E;  1E2V A;  3K7A B;  1ESF A;  3CRK C;  1R9T B;  3HRZ C;  5EQ0 A;  4R9W A;  2R93 B;  1YNJ C;  1G6Z A;  2EY6 A;  4KKT A;  2L4N A;  1FNV A;  3S1N B;  1LAC A;  2CVR A;  3MAQ A;  1CZW A;  1GUT A;  1E2Z A;  2QDB A;  2K04 A;  1JOO A;  2B2W A;  5LHY 1;  1GUO A;  1RTN A;  1SJH D;  3MFG A;  2MHV A;  1KDB A;  4EGV A;  3GO5 A;  3A8K E;  3R2I A;  3NTH A;  2RDH A;  5EPJ A;  3HG9 A;  1JWM D;  4K8I A;  3BDL A;  4OL7 A;  1A3U A;  2PYK A;  3D8G A;  4KK7 A;  2B2T A;  1PXU A;  2L12 A;  4NMZ A;  3I91 A;  2PPB C;  1O78 A;  3OIP A;  4LAA A;  3BG3 A;  1V43 A;  3U9S A;  4FO2 A;  3N6R A;  1VF5 C;  1Q90 A;  1EU3 A;  1EYA A;  1STE A;  3G7L A;  1XXG A;  2FJ2 A;  4LK1 C;  2KJX A;  4AYB B;  3BVZ A;  1LTA D;  4K14 A;  2O5I C;  2K01 A;  2LY7 A;  5CV4 A;  4C3J B;  2M00 A;  1AEX A;  4LMQ D;  2KCN A;  1CI3 M;  5K36 G;  5C5L A;  2F4I A;  1IYU A;  4ULL A;  4N9T A;  1RDP D;  1ET9 A;  1PLF A;  3MVV A;  2B2U C;  3H09 A;  4MN3 A;  3K6O A;  2L11 A;  3T53 B;  4K2L A;  1Y1W B;  1I50 B;  5JEA J;  3FVQ A;  3MFY A;  3GTM B;  1JOQ A;  3SK8 A;  1A15 A;  2IL8 A;  5I6W A;  4FF4 A;  1BO0 A;  3C3L A;  5E1F A;  2XRS D;  2AUJ D;  4ID6 A;  1SNC A;  4X3T A;  4HR7 B;  4DA2 A;  1O7L A;  1V8Q A;  5IT9 L;  4DAY A;  1T5E A;  2M9V A;  5I9P A;  3P20 A;  2R61 A;  1ROD A;  1SYF A;  1FNW A;  3SEB A;  1X3Q A;  4KN7 C;  1LTT D;  4KTA A;  1TWH B;  1OXU A;  1F77 A;  4A3B B;  4X3U A;  1NR4 A;  1T5X D;  4A3E B;  1BNZ A;  2IJ0 A;  3I73 A;  2DNE A;  2LFN A;  1CZG A;  4L63 B;  3AMU A;  5I9O A;  2KUM A;  4KN4 C;  3M4Y A;  2M2L A;  3VR3 A;  1Y8N B;  1V1P B;  1TY0 A;  4U67 3;  2EYJ A;  4E6I A;  3Q23 A;  2EYF A;  4MHE A;  2MGS A;  3PIP 3;  4RGT A;  3T56 B;  3TP5 A;  5FLX E;  4RCO A;  1ENA A;  3NHH A;  5K36 H;  1R4P B;  1BCP B;  1DCZ A;  4F87 A;  2B39 A;  3VYR A;  3SK6 A;  1U4R A;  3RLF A;  3IFT A;  2PW7 A;  1CA5 A;  5C4Z A;  1G91 A;  1HQR D;  2A6H C;  2X69 A;  3QJY A;  3C46 A;  1AN8 A;  2L5T A;  3VA5 A;  2B63 B;  4F88 A;  1GUW A;  2A74 C;  5D3D A;  5JVH 3;  2QIL A;  3FEW X;  1U4P A;  3WOF A;  1PRT B;  3P7J A;  3S1M B;  4K5X A;  4IUN A;  3VYS A;  2F0W A;  2WKC A;  5EKL A;  1EL0 A;  2F0O A;  4A3I B;  5COY A;  1BCP F;  4IAL A;  1B9M A;  1DD2 A;  2Q8R E;  3NSW A;  1JWU D;  1YNJ D;  3MXG A;  5M5W B;  4A93 B;  2RSO A;  4DNR B;  1RCV D;  1ZEQ X;  3KLS X;  1JOK A;  2EDG A;  1EEI D;  4K6D A;  1Q1E A;  3HOW B;  1MSH A;  2H4O A;  5KEE A;  2Q8T A;  4QIW B;  1DJR D;  3WOE A;  1QB5 D;  3CKI B;  3ONA B;  4FVM A;  2WKD A;  2L1B A;  1LAB A;  4DGZ A;  5ISR A;  1ET6 A;  1HPC A;  4B9X A;  2CHB D;  2EYO A;  3I4N B;  3P75 A;  4CGY B;  1EY5 A;  3K0Y A;  4HCE A;  3NQT A;  1QNK A;  5BN4 A;  2J0T D;  1HRJ A;  1QNU A;  1G8Z D;  2FIN B;  1L0X B;  5I6Y A;  2X6G A;  2EZV A;  2Z4H A;  4BY1 B;  1M4V A;  3OWE B;  2EYM A;  3IL8 A;  2XSC A;  1V1O A;  1SYC A;  1HA6 A;  2N88 A;  1EWC A;  2F0I A;  4K8J A;  2SNS A;  2D5D A;  1CQF A;  1OXX K;  4J6H A;  3OOC A;  3GD7 A;  4N9P A;  2JSO A;  3NTI A;  1I4X A;  5ELC A;  3GTQ B;  4FF1 A;  3GTJ B;  5ELF A;  5M3M B;  5KIX A;  4CBV A;  4ME5 A;  1K83 B;  1MD2 D;  1XTC D;  3MTS A;  3SXH A;  4IUQ A;  3MZ5 A;  2QKI C;  3S15 B;  3TZU A;  5EKK A;  3ND9 A;  2PCF B;  3J80 E;  3KUP A;  2JE6 I;  2A6E D;  5C4J B;  2B8G A;  4A3F B;  1CHQ D;  1ILQ A;  1H9M A;  4DXG A;  1J9O A;  5IGB A;  2E74 C;  1SJE D;  5EPK A;  1B53 A;  4HMI A;  1GJX A;  2E76 C;  4BBS B;  1I4R A;  1OXT A;  4OGQ C;  2RA4 A;  5E3F A;  2RDF A;  1KNA A;  4IUT A;  1G2T A;  1TY2 A;  3PIO 3;  1G2S A;  1BXT A;  5JPM C;  2ENB A;  4F8M A;  3OSO A;  1GUS A;  2MPM A;  1CHP D;  2FFK B;  3NUC A;  4OIJ A;  4FF3 A;  4X3S A;  5IGE A;  3MEH A;  4PQX A;  5J22 A;  1I6V C;  5C4H A;  1I6H B;  3ND8 A;  2WV6 D;  3TDQ A;  4ZQ3 A;  5KYI A;  3T4A C;  1A3T A;  4EQO A;  2L0C A;  3NP8 A;  4RGO S;  5JJZ A;  2ICE C;  3I8Z A;  3N52 A;  2OF1 A;  1A3V A;  4KI0 A;  5KNB A;  4M1U B;  2K28 A;  1EZ8 A;  2F3W A;  1AFP A;  4CJ1 B;  2EPB A;  5K5P A;  1Y1V B;  1A2U A;  2AQ2 B;  4BBR B;  2CW0 C;  3RUZ A;  2F0V A;  1HXY D;  1QWY A;  1X32 A;  3SDZ A;  1EFI D;  3D6C A;  4G57 A;  2K33 A;  2Q8I B;  3D3R A;  5FO7 B;  3OMC A;  1KLU D;  2ZXR A;  2HUG A;  1GHJ A;  1H9S B;  4DXF A;  2KEC A;  3K5N A;  5F2D A;  4XYO A;  4DAV A;  3A54 A;  4QF4 A;  2SOB A;  3FMC A;  3HOX B;  4IUR A;  4WOR A;  2F03 A;  1F2L A;  3C1F A;  3PUY A;  1IW7 C;  2NB0 A;  3FDT A;  2DY8 A;  3O13 A;  4XIG S;  5ELB A;  1E2W A;  2F0T A;  3HOU B;  1KDA A;  1D5Z C;  3W2D A;  4QMG A;  2EJM A;  3S2H B;  5HGT A;  2VUM B;  2FHT A;  3E0J A;  1NAP A;  5T1G A;  5E4X A;  2ID0 A;  1STH A;  3S9W A;  3I90 A;  3R3O A;  3QB3 A;  4ZRZ A;  5M5Y B;  2EJF C;  1Y8P B;  2B2Y A;  2IX3 A;  3R8B A;  4KJN A;  2DNC A;  1QJO A;  1STG A;  1CM9 A;  1EEF D;  2A68 D;  3HOV B;  2XNA C;  2PQE A;  3BVM A;  3A56 A;  1ZYR D;  4NDX A;  1BOS A;  5G3L D;  2FMC A;  1SYG A;  1PRT D;  1JC7 A;  1TWF B;  1F9Q A;  2G9D A;  1SYB A;  5CC4 A;  2F0K A;  4EQP A;  1PTO D;  4A3G B;  1BCP D;  5KYL A;  3BDO A;  4KKS A;  5CV8 A;  2F1M A;  5BN3 A;  1FYC A;  3DMU A;  2K5W A;  1V1P A;  3SVM A;  5IGF A;  1S5E D;  2PZU A;  1STY A;  1NUC A;  2VNU D;  1VF7 A;  1B2T A;  5C6A A;  4CHT B;  1GOZ A;  4HAE A;  5EPL A;  5FLX L;  4KY7 A;  4RCN A;  4HCS A;  1EY0 A;  1EY7 A;  1L0Y B;  4LJZ C;  1RTO A;  2A68 C;  1E0B A;  2D62 A;  1BBX C;  3D31 A;  5EBD A;  5A2Q E;  4CJ2 C;  4FF2 A;  2H1E A;  1STB A;  1QCB D;  1RF2 D;  3A55 A;  1HQM C;  1SYE A;  3SHL A;  2JXM B;  1BCP C;  2TSS A;  4JK1 C;  3RD4 A;  3FPU B;  1IKL A;  2JP1 A;  2X6L A;  2B2W C;  2HCI A;  5FK9 C;  1SE4 A;  2WP8 J;  4RHS A;  1MBY A;  4I7Z C;  5EGT A;  1LTI D;  3DWP A;  1UEA B;  4RGN A;  3NBH A;  3EQL C;  3LX0 A;  1KTK A;  3K57 A;  3D6W A;  1XX8 A;  3BZD B;  1B4O A;  2JEB I;  4RAU C;  1D6E C;  1EY4 A;  2KEE A;  1EU4 A;  2EVB A;  4O42 A;  3TME A;  1IW7 D;  4PMW A;  3KBG A;  4IFD J;  5IGC A;  2IX1 A;  1EQT A;  1ICW A;  3S17 B;  3HOZ B;  1LT3 D;  1HFN A;  2G9H D;  2IT1 A;  5C5M A;  1TS4 A;  2R3Z A;  3CU7 A;  4FXG C;  4DK1 A;  5JVG 3;  5G3L F;  4KD3 A;  3DXJ C;  1JCK B;  1U4M A;  1F2M A;  2ZXP A;  3NK9 A;  1O7Z A;  3CQZ B;  3H6M A;  2EYP A;  4I65 A;  2MP1 A;  3MHB A;  3CHB D;  2BDO A;  2MJ8 A;  3A8I E;  1SFO B;  1WVL A;  1ZKO A;  2WB1 B;  1R4Q B;  3PUZ A;  3J7A F;  2B2T C;  2NYZ D;  2JYO A;  1IL8 A;  1GUG A;  3L3O C;  2LMC B;  1CFM A;  1Q3L A;  3ITP A;  2GA4 B;  1HA5 A;  1HFG A;  1SNP A;  4YIJ A;  5CBA E;  4XXE A;  3K58 A;  4QCL A;  2QCP X;  4ILW A;  2OEO A;  4XDX A;  1B9N A;  2K5Q A;  1SE2 A;  1PTO H;  4OIK A;  3S1Q B;  5FOB B;  2RDG A;  2A6H D;  4H13 C;  2BDN A;  4FNF A;  2NVY B;  3K5L A;  2CW0 D;  4RKL A;  2AQ3 B;  3TN2 A;  2BCO A;  1EIG A;  3MA2 B;  3Q22 A;  4IFD H;  1F9S A;  5IT9 E;  3HS0 C;  2HQE A;  3M7N A;  2YYZ A;  3D4D A;  1TT2 A;  1CA6 A;  3PV0 A;  2EXZ A;  3TSS A;  4FYD A;  1EZ6 A;  5KGU A;  3G6J B;  1UNS A;  4KHZ A;  2QF7 A;  4OO1 H;  3RZD B;  3T13 A;  2LS0 1;  5DM6 3;  2NVQ B;  4FXK C;  3L7Z C;  1IHZ A;  5KND A;  2F0F A;  3GTK B;  5KRU A;  2NZ1 D;  4BA2 I;  1D5X C;  3H0G B;  1W6K A;  3QWN A;  4RH6 A;  3GTO B;  2KCC A;  3OPO A;  2K7V A;  3WDN A;  3TZD A;  1PTO C;  4Q0F A;  5EJW A;  3KF8 A;  2NVX B;  5CBE E;  2XWJ B;  3LWU A;  2R92 B;  4JBW A;  4ODG A;  2A6E C;  3PUW A;  2A73 B;  4FP5 D;  1VMP A;  1VMC A;  4S3S A;  3NWT A;  1YNN C;  1TR5 A;  5I2Y A;  4J1M A;  1O7Y A;  1TVX A;  4H7B A;  3M3Y B;  1VDZ A;  4M8A A;  3VA7 A;  4H0L C;  5J1Z A;  1EOT A;  2QEJ C;  5I4D A;  4UAI A;  1EYC A;  3J80 L;  1ENF A;  1B44 D;  3HP3 A;  4HN7 A;  3D4W A;  3SK5 A;  1Z47 A;  1TS5 A;  3H94 A;  4G7O C;  2F3V A;  3HKZ B;  1XWE A;  2RBM A;  4BS9 A;  3MXP A;  4PV1 C;  1TKW B;  4XT3 B;  2F0S A;  1WTX A;  3V05 A;  3QOL A;  4RA8 A;  4KY6 A;  4IUU A;  1CQV A;  2B2V A;  4J8Q A;  1LLR D;  4HSV A;  2R7Z B;  3AB9 A;  2EYL A;  2NWG A;  5C0X G;  5C3X A;  1JR0 D;  1WTW A;  2EJG C;  4ZKB B;  1W6J A;  3I3C A;  3IAY A;  1C4Q A;  3I70 A;  2F0G A;  2D9U A;  1HHV A;  1TS2 A;  2MUY A;  3RZO B;  4IFD G;  2NUC A;  1PZJ D;  4HSP A;  2NN6 H;  4NP5 A;  4PMC A;  3OW7 A;  2F0N A;  5DAU A;  1D2B A;  1DM0 B;  2RVL A;  2KHS A;  3V96 A;  4ZUJ A;  5IGD A;  1UAP A;  1A6X A;  2AWN A;  2YU9 B;  1SBB B;  4HED A;  1OXS C;  4K6L A;  3T16 A;  1SXT A;  3KLR A;  4O1N A;  4RGM A;  1PZI D;  1I4P A;  3MC0 B;  4ABN A;  3DM1 A;  4ZUI A;  4B9W A;  1H9S A;  4ZLT F;  1ZXT A;  4XQJ A;  4BA1 I;  2C9O A;  4F7X A;  3ERQ A;  1VCI A;  5BN5 A;  3S2D B;  4R8N A;  4C1N I;  1H9K A;  2SEB D;  4G4K A;  2BA0 A;  3J7A V;  4RFB A;  4HMJ A;  4QUC A;  2LKV A;  1GHK A;  1CTM A;  2E2H B;  2K6A A;  3TP6 A;  1PRT F;  5KNC A;  3GP7 A;  1AP0 A;  3H3V C;  4A3J B;  3KK7 A;  1B50 A;  1LV9 A;  3BYT B;  4UDU C;  1X3P A;  3QO2 A;  1Y69 U;  2EY1 A;  1U9R A;  1PYW D;  1QIL A;  3AU7 A;  2F0U A;  3NWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...