1DD2A

Biotin carboxyl carrier domain of transcarboxylase (tc 1.3s)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
AGAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution solution structure of the 1.3S subunit of transcarboxylase from Propionibacterium shermanii.
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
molecule tags Transferase
molecule keywords TRANSCARBOXYLASE 1.3S SUBUNIT
total genus 8
structure length 77
sequence length 77
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 1999-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dd2A00
2EDGA 3PV0A 2DN8A 1I6VC 2A6EC 4H44C 3ND8A 2JEBI 3SDZA 2A69C 2D62A 3SE0A 3I73A 1DCZA 1H9RA 2BA0A 2E74C 4I7ZC 1Q90A 4KN4C 3T53B 1E2ZA 4KKTA 1OXVA 1HTPA 2AWOA 1E2WA 2BA1A 4KN7C 4LJZC 1Z7TA 5C0XG 4TKOB 1H9SB 3AB9A 3OPOA 1A6XA 1T5EA 3A7AB 3PUWA 4TQUS 3PUVA 2K7VA 5KNCA 2B8FA 4JK1C 1GJXA 1DD2A 3VR6A 2B8GA 2D5DA 1V43A 3GD7A 1GUOA 1OXSC 2QF7A 1GUNA 1H9KA 2ZT9C 1H9SA 2PNRC 1Y8PB 1GHKA 2LMCB 5BN5A 2NN6G 3PUZA 3QG1A 4HR7B 3VR5A 1GUSA 1H9JA 2EJMA 3N6RA 3I4LA 1IYVA 4KMUC 3LWUA 1G291 4G7ZC 4H0LC 1ONLA 3BDOA 2E76C 1GUTA 1E2VA 3QJYA 1HPCA 2A69D 4BA2I 1DXMA 1VF5C 1HQMC 3D4RA 3H94A 4KI0A 4DK1A 3A8KE 3EQLC 4IFDH 1IYUA 1LACA 1ZKOA 3U9SA 5A35A 3D31A 2K32A 2PCFB 3PUYA 1BDOA 1EWHA 1O7LA 4XIGS 2D2CC 3FPPA 5KNDA 1VF7A 1H9MA 3P20A 1OXUA 5BN4A 2JXMB 4DNTB 3M7NA 4DNRB 3T51B 1FYCA 1GUGA 1Y69U 1ZYRC 5C0XH 1Q1BA 2V4DA 1Z6HA 4XTCS 3VR2A 3VA7A 2DNEA 3M4YA 4H13C 5BN3A 5KNBA 4OO1H 4G7OC 3HGBA 2BE5C 1GHJA 1VCIA 1Y8NB 2EVBA 3A8JE 3BG3A 3OW7A 4BA1I 2K33A 2E75C 4DK0A 2YYZA 1IW7D 3CRKC 1O78A 3CRLC 3VR3A 1YNJC 2NN6I 1Q12A 2L5TA 4IQZA 2KCCA 1FR3A 3A7LA 1K8MA 3I72A 3NE5B 5JEAG 4OO1G 1B9MA 2EJGC 3OOCA 2A68C 3QIAA 4KKSA 4KKUA 4PV1C 3TZUA 1V8QA 3WDNA 5K36H 5JEAH 1K8OA 1HCZA 4OGQC 3RLFA 1IW7C 5K36G 1QJOA 2EJFC 1TKWB 1VDZA 2BDOA 1CI3M 2AUKA 2DNCA 4KHZA 4IFDG 1TU2B 2R6GA 4G7HC 2A68D 4L8JA 1CTMA 4JBWA 3M85A 1OXXK 1Y8OB 2F1MA 1YNNC 1CFMA 1B9NA 2AUJD 2KA7A 3ND9A 3PUXA 1OXTA 3W3AA 4GZYC 2JEAI 1Q1EA 3L7ZC 3DXJC 2O5IC 4LK1C 1SMYC 2IT1A 3IFTA 3A8IE 2NN6H 4RCNA 2Q8IB 3IKJA 3LNNA 3VR4A 3T56B 2A6HC 3MXUA 2BE5D 2JE6I 2A6ED 1PMRA 3KLRA 2A6HD 2O5JC 2CW0C 3GQBA 2PPBC 1LABA 3FMCA 3MFYA
chains in the Genus database with same CATH superfamily
1JORA 3HOWG 4DR7L 1CUKA 1ICFB 1Y1VH 1G2TA 1PXUA 2N8NA 4HIKA 2A6EC 4X65L 1IKLA 3ER0A 4KY7A 3GTPH 3KYHC 2NVXB 1LM0A 3HOXH 2E2IB 4O2DA 4KKTA 5C0XJ 1L0YB 3HOWB 4JBJA 1E7ZA 2JA6B 2LFNA 1UE5A 1YJWA 1JJ2A 3EJIA 3Q24A 1PTOD 5GADC 3CCLA 1EZ6A 2D5DA 5IYCG 2F0SA 3MXGA 3I4NB 1FL0A 2TSSA 2JA7H 2PW7A 1SAPA 2XN9C 2NVYH 3E9HA 3CC4A 4IO9A 3H0GG 3WOEA 4G7ZC 3LWUA 3L9AX 3BDOA 1YNJD 5M3MH 1EZ8A 5NUCA 2B2YC 4IZ8A 4DK1A 2OQKA 3S17H 5BR8Q 2O5JC 2L55A 4NDXA 2XVSA 2FXQA 4IFDJ 1SJHD 4DNRB 3H09A 2KHJA 3HS0C 2IHEA 1S5BD 4A3CG 1QILA 2QKIC 2XNAC 3M4YA 1LTSD 3TP6A 1VQ5A 1NTGA 4JYAL 3NQTA 3GTQB 4JPBW 3MXPA 4XDXA 1PZJD 1NCVA 3TQYA 3CCVA 1ICWA 1KAWA 2IPKD 4KV6A 1ESFA 1UEAB 5EPKA 4IPHA 4KKSA 2JA5G 2O2LD 1K8OA 4WORA 4DUYL 1YJNA 1RJTA 1ZXTA 1TKWB 4Y7NH 5FJ8G 3URYA 4DV0Q 1A2UA 4A3IB 2E5LQ 5I9OA 4LFBL 3IRBA 4GNXB 2EYMA 4IOCA 2YU9B 3KDFB 3FKIG 1JQYD 1TS5A 3VYUA 1UUPA 3IFTA 3MXNA 3E5SA 1CHQD 1T5XD 3TP5A 5FKAC 1R4QB 3U50C 1CA6A 3FMCA 1VQEA 2B2WC 1SNOA 3GTPB 2NVXH 4P73A 5GAGC 4IUNA 1HTPA 4RGMA 4TKOB 3A0JA 4OWWB 4BBRB 1T5EA 3A7AB 5ELOA 2KJXA 2B8FA 2QA4A 4DU9A 1LT6D 1RHPA 4R4IA 3S16B 3M3YH 2VB3X 1EY4A 1S40A 3ICEA 1AE2A 3Q23A 4ILWA 3K7AB 2K5NA 3HOVG 2L0CA 4CDFC 3CPFA 5M3MG 1B3QA 1RTNA 1IYVA 5AFWA 4LUOA 2F0VA 4A4IA 5C0XI 4JI0Q 4RHRA 4WJ3M 1K0RA 1YBYA 5E3FA 2ASBA 4BXXG 5I6YA 1PFNA 4CBVA 1I50H 4ZUJA 1VQ6A 4AIMA 1XMQQ 2SNSA 3H91A 2EY2A 1EWHA 2K05A 1VQCA 3UE0A 2A1AA 4TRDA 5KNDA 4IUVA 5FO9B 2CCZA 1XPOA 5LL6X 1HNZL 2NTSA 2CWPA 1VQBA 5FLXE 1I4QA 1EY8A 1PRTF 2RDFA 2ALYB 4FP5D 1NAPA 4OL7A 5KNBA 4OONA 3SXHA 5C4XB 1B44D 3HOWH 3PO2B 2CQAA 5BR8L 1JC7A 3NTIA 3OW7A 2K33A 1TWHH 2Z8LA 2UXBL 5C4HA 4RAUC 3ZJYC 1SFOH 3LWEA 4J8QA 5CV4A 4E6IA 2H4OA 1N34Q 1II3A 1SR3A 4OIKA 1JE5A 3T1YL 2PQAB 3C1FA 3NEMA 4DXFA 4ODGA 3BYYB 2R7FA 2F0DA 3HZXA 3KF6B 1LTGD 2BDOA 2QILA 4DV2L 3S14B 1L1OC 1OXXK 1UE7A 2OCEA 3W3AA 4AQYQ 1CFMA 2AUJD 2KA7A 3W1GA 2MJ8A 4HAEA 4FXDA 2NZ1D 3HKZE 1VQOA 3L7ZC 3EVQA 3S17B 5EKKA 4DAVA 2NYZD 2MQHA 1KNAA 4EX5A 3OHXC 1DGSA 5M5YH 3LNNA 4QY7A 1KHIA 1K8GA 1D1IA 5TSSA 3J81j 5ELFA 5EJWA 4JI7L 3MHBA 4UP9A 4DV0L 1U4MA 1SYDA 1YEZA 3NSWA 1PH4A 2D62A 2Z4IA 1LTLA 1E2ZA 5DM63 4LW1A 2F0TA 5IE8A 4UHVA 4JI8L 2L9HA 4UPAA 3PUWA 4GN4B 3VYTA 4CKEA 4FF2A 2CH4W 3MWYW 2K7VA 5KNCA 3A5UA 4ABNA 4HCSA 4DV5Q 2JQOA 1ENCA 4L63B 3GDEA 1AH9A 3DWAA 2ZT9C 2PNRC 3NUCA 1XXGA 4XYOA 1UE6A 2L12A 1XWEA 4C3JG 3S14H 3SK5A 2HQLA 5LMNQ 3I90A 2R93G 2E76C 1E3PA 4MHEA 3QJYA 2A69D 5I2YA 3CXCA 3KF8B 3S1QB 1S5FD 1HR0W 1STGA 1SYCA 1A15A 2B2VC 4X64Q 4CGYB 2R93B 3NBHB 1DM0B 4X3SA 3K57A 5C3EH 1HTLD 3MTSA 3UDGA 4O0AA 3DWPA 5C0XH 2K6AA 1SE2A 1KL9A 3K5NA 5CV8A 1S5CD 2R92B 3R2TA 4JI0L 4H13C 4DPGA 4X3KA 1R9TH 1STNA 4DR1L 4C1NK 3A8JE 4A3JG 2KCTA 2I5HA 3J81L 3IL8A 1XMQL 2B2TA 1WTOA 1MBYA 4A3EH 4QGUA 3OW2A 1SBBB 1HA6A 1FGBD 1STYA 1IYJB 3W1BA 1CI3M 2J0TD 4JW0A 4NXNQ 3P75A 3CMEA 2LXKA 3HKZB 5CMDA 1HUMA 4K8IA 3J7ZC 5M5WB 1SYGA 3OTOQ 4R8IA 4KY5A 2F0KA 1AFPA 3OYYA 4XYQA 1EIHA 1A63A 4FVMA 2PNHA 4LFAQ 2UXDL 2DUDA 1N33L 3PF5A 4IPGA 1K73C 1BOSA 4DV2Q 5IGEA 3H3VC 1Y1VB 4PMWA 2Z0SA 1LTRD 3SE0A 2E2IH 3C46A 2G5DA 2R7ZG 3S2HB 1B2TA 1FJGL 3EA6A 4KN4C 1Q90A 1N32Q 2NVQB 3Q6SA 2VY3A 3HKSA 4JI1L 1I5FA 1SFOB 4WFN3 1Z7TA 2JA6H 5JJZA 1JJGA 4BY7G 2HCCA 2Z4HA 5IT9L 2HD3A 2R7ZH 3D6WA 5EKLA 4CHTB 3J7AV 4NMZA 4JI4Q 3ERSX 1GUOA 1X54A 2JA7B 2F03A 4HIMA 3V96A 2EJMA 3O13A 1V1OA 4KMUC 4HJ5A 3A5ZB 1PYWD 2K14A 4RCOA 3S1MB 3EBEA 1HNWQ 1ESRA 1KLGD 1P16A 4HCEA 5D14A 5FO8B 2H1EA 1MJCA 5M5YB 2AQ1B 2KECA 4LUZA 1J5EL 4GN5A 4FYDA 4R8NA 2Y0SB 4RGNA 3PCOB 4R9WA 1H9MA 3N52A 1OXUA 3VDYA 5DNFA 4R4QA 3J7YW 1BBUA 1P8LA 1F2LA 3T1HL 3H3VI 5M5XB 1TXYA 1QE6A 2F0JA 5C5MA 1B50A 3KBGA 1HR0Q 1A3TA 4ZRZA 3PO3B 2F0WA 1X32A 4JI6Q 4X64L 1IBLL 2E75C 4A3JH 4BBSG 2IX3A 2N78A 4J6HA 4QIWE 2NTTA 2R7ZB 1G6PA 3TZUA 5CBAE 1VQHA 4A93G 3G4SA 4WJWA 3CCSA 5DM73 1X9NA 3KLSX 5A2QL 2LY7A 1V1PA 1Z9FA 3FVQA 2BDNA 1PH5A 3D4DA 4GS3A 4K2KA 1MJEA 3MEFA 3S1QH 3GO5A 5CC4A 4POGA 2R93H 3K5OA 4JI8Q 2Q8IB 4HIOA 2BCOA 2NUCA 3V2TA 4AYBB 4CJ2C 3NBHA 2F3VA 4J15A 3SGIA 3KLRA 3PGZA 1CZWA 3HP3A 3J80E 3X3NA 2I5LX 1R9TB 4DR6Q 2NVQH 1EQVA 1X65A 1MSGA 1AEXA 3MA2B 3HFZB 1QUQA 3W5OA 3AMUA 2B2VA 2VNUD 5EPJA 4XQJA 1GVPA 3RZDH 1GUNA 4O42A 4IJHA 1KC8C 1U0LA 3NP8A 3KBXA 1UNSA 3MAQA 1E0BA 3PO3G 1C4QA 1CHPD 1ET6A 1GUTA 1WCMH 1V9PA 3D4WA 3NTHA 1VQ4A 1JE4A 3E0EA 4S3SA 2NVTB 2EYLA 4JV5L 1GOZA 3D31A 3PUYA 3JAMc 1XNQL 1HHVA 2NWGA 1PH9A 2CVRA 4DR2Q 2SEBD 2J7ZA 2WACA 4DR3L 2PQEA 1WOCA 2GVBA 4A3FH 2KUMA 4JI3Q 1HH2P 1S3OA 2RSNA 5C5LA 3GTOB 2PZWA 1SYEA 1O78A 4YHHL 1TQOA 1YNJC 3OTOL 3HG9A 2FINB 3I72A 3UDIA 1JOQA 2IWHA 1SE3A 3QIAA 1EQQA 3QOJA 5K36G 4NXMQ 1OTCA 4IFDG 1E22A 1PTOC 3NPPA 4JI6L 3KOJA 2KHSA 4A3GG 1CT1D 4C2MB 3SK4A 1KDCA 1SMXA 3S1NH 1G51A 2JK8A 1HRJA 1ZYRD 3UDXA 1HNXL 4JI1Q 2NVTH 4DGZA 5EKIA 1ILQA 2JE6I 2A6ED 3HOVH 1BXTA 4OX9Q 5H1SE 2UXCL 1PH2A 4DR7Q 4A3MG 1RIPA 1I6VC 1GD7A 4FF1A 2ZTEA 3G6JB 3VYRA 1G8ZD 2LS01 2CHBD 1RDPD 3RN5A 4LF6L 4DAYA 1N36Q 3GTMB 3I4NG 1A6XA 1K83B 4ZKCB 4ZYSA 2N3SA 1E1TA 5IGCA 1Q7YC 1YHQA 5HGTA 3VR6A 3RZDB 2B8GA 3GD7A 2ID0A 1EFWA 2E2HH 3DHQA 2LMCB 2JA9A 4MTKA 3PSIA 1D5ZC 3Q22A 4B3SL 1VMCA 2EZVA 1G291 3NQIA 1X56A 4J1MA 1NUCA 3D4RA 2QDBA 2A5HA 1WVLA 1BCPD 2WB1E 2Z1CA 3F2BA 1STBA 4R1JA 2K32A 5E4WC 2B2TC 1U4LA 4DR5L 1QVFA 5C3EB 1TWGH 2C35B 4DNTB 4A3FB 5IT9E 4UP7A 5JJLA 1NJIC 1Q1BA 2Q2TA 1JWSD 1TWCB 1B4OA 4APVA 4LFCQ 3I4MH 1A2TA 2AWNA 4KD3A 3HOXB 4QUFA 1KDAA 2NBFA 1JJCB 5KIXA 1G91A 1O7ZA 3D3RA 4BA1I 4F87A 2RCNA 4BBRG 3IAYA 1XNQQ 3QR8A 5CV7A 2YYZA 1ASYA 4DV7Q 4A93B 1A3VA 1F9PA 4DNIA 4A3DH 1F2ZA 1MKHA 3H6MA 5CORA 1HA5A 2PMZB 3BYTB 3SEBA 2EYJA 3U4VA 2EJGC 2QEXA 1QG7A 4A3CH 5I6WA 3I4NH 1V8QA 4JI3L 2NZHA 4QL5A 3U9OA 4A3MB 2IHFA 4DR4Q 4CDDC 2WB1G 2N49A 1SN8A 1B8AA 1CTMA 3FEWX 3EIVA 4LFBQ 2RHQB 1Y8OB 5K36H 5CV6A 1B9NA 1IKMA 3S1NB 2RDGA 3DEPA 3DXJC 3KF8A 1SMYC 4X3UA 4GOPB 2IT1A 4YHHQ 3T16A 2RA4A 2NN6H 1RTOA 4RGOS 4EGVA 3IKJA 1CQVA 1VQGA 3OIQA 2OEOA 3CC2A 4GN3B 3T1YQ 1MGSA 1VQFA 2CH4A 5EBCA 1BCPB 3A55A 3I70A 4B3RQ 2XGTA 1EL0A 5J1ZA 3OWEB 1PTOB 2EY1A 3ND8A 3K0YA 1PH3A 1SNDA 4AQYL 3S2HH 1ML0D 3GTMH 3BZCA 3GTKH 2VQFL 1TWHB 1K9MC 4K2LA 2G9HD 4A3DB 3F1ZA 1EYCA 2LKVA 4LNQA 4OX9L 1WFQA 2B2YA 2O4XA 5KRUA 4KJNA 1OXSC 2Z6KA 5BN5A 5IP9G 4DR3Q 3NTKA 5IODA 2HIVA 1KLUD 1TS4A 2YU9H 2PZUA 1WTWA 1DXMA 3E0JA 1A3UA 3TMEA 4B08A 3SK6A 2ICEC 5IYBH 2Q8TA 4Q5VA 3KJPA 4EQPA 1PH7A 2QDLA 3R3OA 3NK9A 4UP8A 1WD0A 4WRDA 1BQQT 4H7BA 1NE3A 1CSQA 3T51B 2OXPA 3VYSA 1IBKQ 3TP8A 2IW3A 1JR0D 3VR2A 4F7XA 3PO3H 1VQNA 1LT5D 1KNEA 2VZAA 1SNMA 1Y1WB 3J80c 5C3XA 3K5LA 4KHPL 2RCFA 3HGBA 4IUTA 4U673 2L4NA 4HMIA 3X3MA 1PH6A 5FK9C 3JAML 2UUBQ 3CRKC 1VMPA 3I2ZA 4QCLA 1QOHA 4DUZL 4KY6A 1K0SA 3M3YB 3OOCA 3AU7A 2HHHL 4OO1I 2RSOA 1VQPA 4LFCL 1IW7C 1X3PA 5IOCA 1J6QA 3R8BA 4PG3A 3VA5A 1BR9A 4RFBA 2R6GA 4IURA 1EU3A 5T1GA 2I5MX 1M1KC 1FNVA 4K8JA 2TMPA 4ME3A 5HGQA 4C3IH 4RCNA 3UDFA 4BBSH 2X6GA 2VQEL 3IFDA 5CBEE 1HZ9A 2NZOA 1PFBA 3NENA 2PPBC 3E6ZX 3CKIB 4CJ0B 2KBNA 1YNND 2B39A 5GAEC 3PO2H 4B3SQ 1IXRA 2Z6KC 4PNYA 2F0PA 1DYQA 4PZ8A 4A93H 1B1ZA 4LJZC 3NWSA 4XQQA 4BY1B 5IIFA 2YTVA 3KLSA 3HKZG 2YV5A 3H0GB 1RKNA 2NVYB 1FNWA 1BF4A 3QG1A 2QCPX 4HR7B 1H9JA 4A76A 3I4LA 1VQ9A 3MFGA 2JA8G 4H0LC 4ZK9B 1GM5A 1EIGA 1WTVA 3PIO3 5AJ3Q 3I3CA 3K8AA 4A3DG 3GTLB 1EYDA 2EYOA 3H94A 4KI0A 1A0IA 4A3KH 4DV4Q 1IYUA 1O7LA 2I07B 3DLLA 2A19A 2RBMA 4IALA 2HCIA 1GUGA 1W3SA 2CW0D 4XTCS 4Q0FA 4DV6Q 2WAQB 1IBMQ 4OO1H 4G7OC 1HNWL 2HT1A 3GP7A 1EIYB 1QCBD 2PI2E 2PQAA 3PIP3 3GTOH 4BY1H 5IWAL 3K5MA 1Q12A 4RHSA 2L5TA 1Y14B 2KCCA 5C4XG 1K8MA 2NB0A 3H15A 1N9WA 2AQ2B 1TY0A 3FDTA 1EQRA 3C3LA 3OSOA 5CV5A 1D8LA 4MIUA 4K5VA 4KHZA 2UUCQ 3S2DH 4YWKA 4L8JA 4A3KG 2VUMH 1TS3A 4C1NI 2WIIB 1QNKA 3ND9A 2DGYA 3STBC 1I4HA 1O7YA 4DUZQ 3C2PA 1HUNA 2EYPA 4B3ML 4BBSB 5JPMC 5I4DA 3VR4A 3D8GA 2OWOA 3T56B 2HDLA 1N33Q 2JA8B 1VQJA 4JBKA 1PRTC 4CKBA 2WKDA 1D5MC 2MO0A 2EY6A 2JYOA 3V05A 2D0OA 4UY8C 2JN4A 4TSSA 3TDQA 2ZJRA 4KTAA 1FJGQ 2AKWB 2FFKB 1DCZA 4HMJA 1WI5A 1X6OA 2HUGA 1M90C 3HOZG 1JB3A 4K14A 5G3LD 3T53B 4AYBG 4LF7L 4YCVA 1K83H 1CK1A 4KN7C 1VS0A 2VL6A 3AFQA 1CKNB 2K5QA 2JA7G 4LAAA 4A3JB 1HZCA 5D65A 2K5VA 2XRSD 2VQEQ 4P74A 3ITPA 4A3EG 1K8AC 1KRTA 2B3GA 4ALPA 1H9SA 1WYDA 4CKCA 4CDEC 1DOKA 4CJ1B 1IBKL 1PFMA 3FHWA 4GNXA 2WV6D 4DFAA 3I91A 4F8MA 5M5WH 2V1CC 4NXNL 5HURA 4GOPA 5C3WA 2ZM6Q 3E9IA 4C3IB 1FGUA 3G71A 3SVMA 1I4GA 2PCFB 1BDOA 5IT9c 3HEJA 1TWGB 4ZLTF 1I4XA 3J7A5 1PRTD 1NNXA 1QB5D 3I55A 1BNZA 1X55A 2KOLA 1TWCH 1STAA 1SEBD 4Y52H 1I4RA 2BH2A 1WTRA 4P75A 3I4MB 4MNOA 2XRQD 1NBWA 2BE5C 2WAQG 5C44G 3E3XA 4HJ9A 3NHHA 3JAME 4DV4L 5FLXc 1CQFA 4FDBA 1SRUA 2RVLA 3K80C 1WCMG 2WP8J 5JEAG 2ZJQA 4DXGA 3NE5B 3T4AC 4FXGC 1SYFA 1AN8A 3RLFA 2IJ0A 3EFXD 4PMCA 1J8IA 2DY8A 1XMOL 1SLJA 2M2LA 2WKCA 3LX0A 4C3HB 1QWYA 3FRPB 4LF4Q 4BS9A 1SJED 2E2JB 1XTCD 2XWJB 1A8VA 4RMFA 5E4XA 2MFIA 1PDQA 5JJKA 3NXWA 1VQDA 5J22A 5EAYA 3KLWA 4HSPA 1G6ZA 4DV3Q 4R4TA 2QGQA 1QZHA 1J5EQ 4X66L 1BVSA 1S5DD 4X3TA 4KHVA 4UDUC 1B53A 3RUZA 4DN4M 4NXML 1FNUA 1HXYD 1I6HB 4B3TL 2Z6BA 4RA8A 1L1OB 1D5XC 3TRZA 4YY3Q 3I73A 3BVGA 3G48A 2Q2UA 1LT4D 1PH8A 1HNXQ 3FP9A 5IGGA 5M3FG 5LMNW 4JYAQ 1Q46A 4N8FA 1HFGA 4DV1Q 1STEA 1B7YB 4F88A 5KGUA 2SNMA 1H9KA 4L5RC 4A3BG 3I4OA 2M00A 2NN6G 4IN3A 2L1BA 4LF7Q 3D6CA 2B29A 1ONLA 1VQ8A 4C2MH 1PRTB 1PYSB 1KTKA 5F2DA 2UUAL 4JI7Q 4PZ7A 1YI2A 1EY0A 3PF4A 1C0AA 4RH6A 3FPPA 5HY6A 1JB7A 3M7NA 1CZGA 4NPSA 5C4JH 5JVH3 3MC0B 1RCVD 4O1NA 5IYDH 2F0GA 3TBIB 1LYLA 4L5QA 3MVVA 2CQOA 3M4OH 2EVBA 2GA4B 4P2CB 3BVZA 1LTID 2VXWA 1KD1C 1PZKD 3UE1A 1N34L 3CCUA 2VB2X 1HZAA 3ERQA 2EXDA 4ZKBB 5GAHC 3FKIH 2XWBB 4PV1C 4DAYB 3CHBD 1OO9B 2R7DA 2BH8A 4QB4A 2E2HB 5EQ0A 1TR5A 3HRZC 5FJ8H 4NKLA 3W2DA 2I0QA 4UAIA 2A73B 2IX1A 2F4IA 1PH1A 4A3GB 4DA2A 3M7GA 2JA5H 2RQXA 3KUPA 2JA6G 1DONA 1R4PB 3L0OA 4V190 3EN2A 4RKBA 5IGFA 3K6OA 3K58A 4NB3A 1S5ED 4ZAIA 2F0HA 2PI2A 3GV3A 1LABA 3J81c 2Y0SE 1XMOQ 3MFYA 2OQ0A 3RZOH 4R4OA 2Z9HA 1HNZQ 4H44C 2VW9A 1W6KA 2JEBI 1HQRD 3PIOA 2BA0A 1YITA 4LF4L 5ELNA 3CMAA 2OTLA 4DK3C 4GLVB 2AWOA 2M9VA 3BZKA 4B9XA 3P1HA 1EYAA 3BZDB 4HN7A 4ID6A 4JK1C 4YWMA 5J39A 1Y1WG 2WAQE 4DV3L 1V43A 1EU4A 1FVIA 1AW7A 4B3TQ 3H0GH 1LV9A 4V0BA 1VQKA 1EY5A 3BDLA 1XNRQ 4DK6C 1EUJA 1SE8A 1E2VA 4A3KB 2K50A 5C6AA 1F9QA 3ULPA 4HSVA 5A2QE 5CGKA 3A8KE 5ELBA 3CCEA 4IFDH 1I3QB 4YCWA 1L0XB 1SE4A 3HOXG 2A74C 1BCPC 4X65Q 1NR4A 3TS0A 5M5XH 5CR3A 2V4DA 1BKBA 2YTYA 1Z6HA 4OHJA 3VA7A 4XT1B 4DR1Q 1F9RA 2WINB 2J4XA 1QNUA 3BG3A 4WJ4A 3WOFA 2LXJA 1JICA 1NY4A 3L2PA 4DV7L 5M3FH 2ZTCA 2UUAQ 1VQAA 1C48A 3RD4A 1FR3A 4TVAB 2PZTA 3QOLA 3L3OC 4QMGA 1IZ6A 1U4RA 1C9OA 1VDZA 4MN3A 3S2DB 1KRSA 2AMCB 2A68D 4JBWA 4RKLA 1BBXC 1JOKA 2ZXOA 2VUMB 3GV6A 3J7AF 1SYBA 4EQ5A 2EQSA 5FLMH 4I65A 2JEAI 1Q1EA 1PFSA 2KQ3A 2E2DC 2UUBL 5D3DA 2PYKA 3A8IE 4JG2A 4ZCKA 4LFAL 3CP0A 2HHHQ 2OT2A 2VS1A 4FNFA 4PMBA 4OXPA 1A62A 1LLRD 2K28A 3RZOB 2DN8A 3HOUG 3OWFA 4DAPA 3SDZA 2Q2IA 3M4OB 2MO1A 2X6LA 1CKOA 2K5DA 5IP7H 1O80A 4R4CA 1EOVA 1EFID 4IPDA 3AB9A 3DMUA 5IP7G 1XPUA 1WTHA 3PUVA 5LMUQ 1X3GA 3R93A 3HOZB 4JOIA 4POFA 4JI4L 2KEDA 1Q82C 3SK8A 5IYBG 2E5LL 3J80L 4IFDI 1Y8PB 1V1PB 3TSSA 3S24A 4IJLA 5E1FA 3VR5A 2HIXA 2ATWA 2K01A 1EWIA 4HJAA 1H95A 3U58A 5IP9H 3TEHB 2MP1A 4XXEA 1IHZA 1SNQA 3QWNA 4H02A 3TZDA 2ICIA 1Q8IA 4XIGS 3R2IA 1YHBA 2D2CC 3HOYG 4K6DA 3CCMA 1TVXA 3TN2A 1YNXA 5BN4A 4GKJQ 4A75A 5T1IA 1UWVA 5JOBA 1ENFA 1FYCA 2KVMA 3PIPA 3I8ZA 4U68A 2LSSA 1HFNA 4IUQA 3WWVA 2DNEA 5M9OA 2R92H 1ASZA 2K04A 1MHWC 1TWAH 2N55A 3BDCA 3M9BA 1LTTD 3ONAB 3GTKB 5M3FB 4BXXH 4LF9Q 3CRLC 2Q8RE 1U4PA 2NN6I 3A7LA 4AYBE 1B9MA 2A68C 4KKUA 5I2XA 4LWCA 4K6LA 1D2BA 5CYUA 4C56C 3ULJA 1QVGA 1TU2B 3DWQA 3A54A 3M85A 1UAPA 1C7YA 1YNNC 1OXTA 2N88A 1LUZA 3F2DA 1FD7D 4CDCC 2E2JH 3RNUA 3GTLH 1SDFA 2ES2A 4RGTA 3GTGB 1E24A 2MGSA 3S15H 3KJOA 3F8TA 2MHVA 2CW0C 2MPMA 5JEAJ 3BJUA 1JWMD 4BY7H 1SMYD 1RODA 4K0KL 1PLFA 1Y1WH 4K5WA 2PO4A 3I4MG 1XNRL 1W2BA 3T13A 5IGDA 1HR0L 1U5KA 3OMGA 2C5CA 5C4XH 2F0FA 1DJRD 4BY1G 2FMCA 3OPOA 2F0OA 4TQUS 1GXDC 4HEDA 4QJFA 3BVMA 3J80i 1L2FA 2E8GA 4Y7NB 1GHKA 2PMZE 4N9PA 1KIXA 1SXTA 1PV4A 3OMCA 3N6RA 5KYLA 1BCPF 1JCKB 2FJ2A 1VF5C 2X69A 3U4ZA 2ZTDA 1AZPA 3EQLC 3LGJA 4DF7A 2UXCQ 1PVOA 5A35A 1F77A 2K52A 3ULLA 4LF5Q 5FO7B 1BBWA 3P20A 3GTGH 3S15B 3JAMi 5JJIA 1SROA 4EQNA 4DV6L 5C4JB 4L6TB 2K5HA 1QUQB 1N36L 2DJFC 4C3HG 1TWAB 1QZGA 3QO2A 5G3LF 4OWXB 1I94L 2Y0SG 4EVOA 4I7AA 1HZBA 2UXBQ 3P7JA 2MNAA 3VR3A 1X3FA 5CV9A 4GKJL 2EXZA 4IQZA 4P71A 3S16H 1UEBA 3FKIB 1NSNS 2HQEA 2KCMA 5C3EG 3CD6A 1KXLA 2QEJC 1QJOA 2EJFC 3K7AH 4QF4A 2B63B 2QW7A 4N9TA 3A74A 2UUCL 4LF8L 1GUWA 1MD2D 4A3GH 1UE1A 1JWUD 4GZYC 2F3IA 3HOUB 2EYHA 4JCVE 3CCJA 2K1BA 4LF9L 2F52A 1I50B 1QVCA 2O5IC 4C3IG 4PZ6A 4C3JH 4JOIC 2F0IA 1CM9A 5AJ3L 1LTAD 1VQLA 2RHSB 2FMMA 2BE5D 3DM3A 3S9WA 1XTDA 1PHJA 3SHLA 1PMRA 2K4KA 5LMUL 3S1RB 3HOYH 4JV5Q 1JT8A 1Y1VG 3CAMA 4A3BH 1AZQA 2EDGA 3PV0A 4YCUA 1PTOH 1L1OA 1S72A 1SNPA 4A3IG 1YHAA 4QIWB 2E74C 2DJGC 4MTNA 3Q8DA 2IY5B 3GTJH 1EY9A 2UU9L 1YVCA 1JMCA 3AQQA 1GJXA 5KEEA 1J9OA 4GKKQ 2L11A 2F3WA 1WD1A 5EBDA 5IWAQ 1RD9D 1RL2A 4Z9CB 2F0NA 4X66Q 2DY7A 5K5PA 4ZQ3A 3PUZA 3RLOA 2AQ3B 1GUSA 5DAUA 3RLNA 3JC66 1XYIA 4YY3L 1TWFB 2F0QA 1HPCA 1RF2D 1K28A 2ZM6L 3HOUH 3J81i 1Z47A 1ZKOA 4ME5A 2CFMA 1MI2A 4BWGB 3CQZH 2RKSA 4DR5Q 1STHA 1VF7A 4DV1L 3CCRA 1Q86C 2OTJA 2EY5A 2I46A 4B3MQ 4PQXA 1M8AA 1Y69U 3NELA 2FHTA 1EQTA 1EWCA 4GLXA 4A3BB 1VQMA 1LTBD 1N32L 1L0WA 1Q3LA 2JP1A 1SSOA 1D6EC 1D1KA 3I7FA 2K75A 4MZ9A 2KHIA 1EOTA 4DKAC 2YTXA 5C44H 3F2UA 1IW7D 3GTQH 1HJPA 5JAVA 1YJ9A 4LF5L 4IUUA 4FF4A 3STBD 3DUZA 3G7LA 2B63H 1KABA 2KENA 5IGBA 4OGQC 5KYIA 1K3BC 3KK7A 3OIPA 1WTXA 4DR4L 2R61A 3CU7A 4A3IH 1XX8A 3TS2A 2IL8A 1KDBA 1AE3A 1EEFD 4YIJA 1I94Q 2H5XA 4P72A 3SR1A 2B2WA 2RDHA 4K0KQ 5COYA 1CSPA 5DLQE 1TWFH 1WTQA 4LK1C 2EE1A 5J3BA 1DZ1A 4JI2Q 4DV5L 3CW2C 4QQBX 2F0UA 2JSOA 3G6EA 2K5WA 1PYBA 4B3RL 4LF8Q 2D0PA 4KLKA 2A69C 5LMNL 2XTIA 1H9RA 4HJ8A 4I7ZC 4M1UB 3Q0AA 1ET9A 1DOMA 1OXVA 3GTJB 3RN2A 2BA1A 1H9SB 2P5ZX 3TP7A 1DOLA 2VQFQ 2XIWA 3J81E 5C44B 3HOZH 4BBRH 1EEID 4KK7A 1DD2A 2EIFA 4GOPC 4X6AH 1S4ZA 2EYFA 4X62Q 1CKNA 4GNXC 4XQNA 3BS1A 4GLAC 2B2UA 4C3HH 4FXKC 1NMFA 4G57A 2CWAA 3KF6A 4BA2I 3AEVA 1WTPA 4OWTB 5GQOA 1HQMC 1D7QA 2UU9Q 5JPNC 3CQZB 4KJOA 1F2MA 3S1RH 3HOYB 2VUMG 4GKKL 3K7UC 5E7NA 2JXMB 1AP0A 4NW2A 1E1OA 1F2YA 3MEHA 4JC0A 4L5TA 2F4VL 1WJJA 4G4KA 4ULLA 1ILPA 3T1HQ 3AYHB 2BOSA 4KHPQ 4XT3B 2SOBA 4DAMA 2D9UA 3CPWA 1GHJA 4IPCA 1IBLQ 5LHY1 3A56A 1C8CA 4OO1G 3BU2A 5LL6S 2A8VA 1EYGA 4JI5Q 2UXDQ 2WFWA 2GVAA 2XSCA 1I4PA 1NMGA 1TS2A 2DNCA 3FPUB 4RWSC 4A3MH 3DEOA 3S1MH 1IL8A 4HJ7A 2F1MA 3PUXA 1EY7A 5ELDA 3KFUA 5IYDG 1F9SA 1WCMB 1U9RA 2F0LA 3MZ5A 2L15A 3DM1A 4DR2L 4LUVA 2JA8H 1I3QH 3MXUA 3NBIA 2GN5A 2R3ZA 4AH6A 5IYCH 1YIJA 1W6JA 1K3RA 1LT3D 2A6HD 4JVZA 1IBML 1PZID 4K5XA 4N8X1 4BY7B 3PQIA 5EGTA 3MXNB 2R92G 5FOBB 1TY2A 3K81C 2B2UC 1MSHA 1V1QA 1ENAA 4OEMB 3F2CA 4QUCA 2F0MA 1E2WA 2ENBA 5C0XG 4IUPA 5DEHA 3CF5A 1IL2A 3PO2G 2C9OA 1MIUA 2F0EA 5L37A 1X3QA 5ISRA 3C1EA 1X3EA 1EIFA 2QF7A 1N8RC 4HTHA 4A3LH 2MUYA 2OF1A 1BUVT 4A3FG 2B63G 1YZ6A 1NR2A 2Q2HA 2JA5B 1BO0A 1TT2A 2SDFA 1CKMA 5M3MB 3CCQA 3ZYYX 5I9PA 1M4VA 1VQ7A 5D3IB 5EPLA 1LACA 1KAAA 3U9SA 1XJVA 5C4ZA 1PA6A 2ZXPA 2ZXRA 4RG1A 4X62L 3QB3A 5IY0A 5JVG3 2IX0A 1G2SA 2RF4A 4OELB 3HOVB 4FF3A 1ZYRC 1GO3E 2EOTA 3PMFA 1XPRA 4DUYQ 1JOOA 2CKZB 3I56A 3K0XA 4LF6Q 4IOAA 5BN3A 3B6YA 1B3AA 2G9DA 4L5SA 2WB1B 1Q81C 1VCIA 1VQIA 1Y8NB 1B70B 1TIID 3D0FA 4DK0A 3UI2A 4A3EB 4FO2A 2HDMA 2JJQA 2EPBA 2K03A 3EROA 5GROA 3WDNA 4JI2L 4EQOA 5JEAH 5FLMG 1HCZA 4OIJA 4JBMA 4M8AA 2F4VQ 1EY6A 2AUKA 4YWLA 1Q8KA 4ZUIA 5FLXL 3RMHA 4G7HC 3M4PA 1GKHA 4KD4A 3RR5A 1ZEQX 4DR6L 1T9HA 4C3JB 4HIDA 3KDFA 3TREA 3NWTA 2AHOB 2ZJPA 1PTOF 3H3VH 1SNCA 2KCNA 5ELEA 1CA5A 4A3LG 4JI5L 3K59A 1O7IA 2A6HC 4LMQD 3M4QA 3AFPA 1LO5D 3CC7A 2PW5A 1KQSA 3GQBA 2KEEA 4NP5A 4B9WA 5ELCA 1I6HH
chains in the Genus database with same CATH topology
1JORA 1G2TA 1PXUA 2A6EC 1IKLA 4KY7A 2NVXB 2E2IB 4KKTA 5C0XJ 1L0YB 3HOWB 2JA6B 2LFNA 3EJIA 3Q24A 1PTOD 1EZ6A 2D5DA 2F0SA 3MXGA 3I4NB 2TSSA 2PW7A 1SAPA 2XN9C 3WOEA 4G7ZC 3LWUA 3L9AX 3BDOA 1YNJD 1EZ8A 5NUCA 2B2YC 4IZ8A 4DK1A 2O5JC 2L55A 4NDXA 2XVSA 4IFDJ 1SJHD 4DNRB 3H09A 3HS0C 1S5BD 1QILA 2QKIC 2XNAC 3M4YA 1LTSD 3TP6A 3NQTA 3GTQB 3MXPA 4XDXA 1PZJD 1NCVA 1ICWA 2IPKD 4KV6A 1ESFA 1UEAB 5EPKA 4KKSA 2O2LD 1K8OA 4WORA 1RJTA 1ZXTA 1TKWB 3URYA 1A2UA 4A3IB 5I9OA 2EYMA 2YU9B 1JQYD 1TS5A 3VYUA 1UUPA 3IFTA 3MXNA 3E5SA 1CHQD 1T5XD 3TP5A 5FKAC 1R4QB 1CA6A 3FMCA 2B2WC 1SNOA 3GTPB 4IUNA 1HTPA 4RGMA 4TKOB 4BBRB 1T5EA 3A7AB 2KJXA 2B8FA 4DU9A 1LT6D 1RHPA 3S16B 2VB3X 1EY4A 3Q23A 4ILWA 3K7AB 2L0CA 1RTNA 1IYVA 5AFWA 2F0VA 5C0XI 4RHRA 5E3FA 5I6YA 1PFNA 4CBVA 4ZUJA 2SNSA 3H91A 2EY2A 1EWHA 2K05A 4TRDA 5KNDA 4IUVA 5FO9B 5LL6X 2NTSA 5FLXE 1I4QA 1EY8A 1PRTF 2RDFA 4FP5D 1NAPA 4OL7A 5KNBA 3SXHA 5C4XB 1B44D 3PO2B 2CQAA 1JC7A 3NTIA 3OW7A 2K33A 2Z8LA 5C4HA 4RAUC 3LWEA 4J8QA 5CV4A 4E6IA 2H4OA 1II3A 4OIKA 3C1FA 4DXFA 4ODGA 3BYYB 3HZXA 2F0DA 1LTGD 2BDOA 2QILA 3S14B 1OXXK 3W3AA 1CFMA 2AUJD 2KA7A 4FXDA 2MJ8A 4HAEA 2NZ1D 3L7ZC 3EVQA 3S17B 5EKKA 4DAVA 2NYZD 1KNAA 3OHXC 3LNNA 1D1IA 5TSSA 5ELFA 5EJWA 3MHBA 1U4MA 1SYDA 3NSWA 2D62A 2Z4IA 1E2ZA 5DM63 2F0TA 2L9HA 3PUWA 3VYTA 4FF2A 4CKEA 3MWYW 2K7VA 5KNCA 4ABNA 4HCSA 1ENCA 4L63B 3DWAA 2ZT9C 2PNRC 3NUCA 1XXGA 4XYOA 2L12A 1XWEA 4C3JG 3SK5A 3I90A 2E76C 4MHEA 3QJYA 2A69D 5I2YA 3S1QB 1S5FD 1SYCA 1STGA 1A15A 2B2VC 4CGYB 2R93B 1DM0B 4X3SA 3K57A 1HTLD 3MTSA 3DWPA 5C0XH 2K6AA 1SE2A 3K5NA 5CV8A 1S5CD 2R92B 3R2TA 4H13C 4X3KA 1STNA 4C1NK 3A8JE 3J81L 3IL8A 2B2TA 1WTOA 1MBYA 1SBBB 1HA6A 1FGBD 1STYA 1CI3M 2J0TD 3P75A 3HKZB 5CMDA 1HUMA 4K8IA 5M5WB 1SYGA 4R8IA 4KY5A 2F0KA 1AFPA 1EIHA 4XYQA 4FVMA 1BOSA 5IGEA 3H3VC 1Y1VB 4PMWA 1LTRD 3SE0A 3C46A 3S2HB 1B2TA 3EA6A 1Q90A 4KN4C 2NVQB 3Q6SA 1SFOB 4WFN3 1Z7TA 5JJZA 2HCCA 2Z4HA 5IT9L 3D6WA 5EKLA 4CHTB 3J7AV 4NMZA 1GUOA 2JA7B 2F03A 3V96A 2EJMA 3O13A 1V1OA 4KMUC 3S1MB 1PYWD 4RCOA 1ESRA 1KLGD 4HCEA 5D14A 5FO8B 2H1EA 5M5YB 2AQ1B 2KECA 4FYDA 4R8NA 2Y0SB 4RGNA 4R9WA 1H9MA 3N52A 1OXUA 5DNFA 3J7YW 1F2LA 5M5XB 1B50A 1QE6A 2F0JA 5C5MA 3KBGA 1A3TA 4ZRZA 3PO3B 2F0WA 1X32A 2E75C 2IX3A 4J6HA 2NTTA 2R7ZB 3TZUA 5CBAE 4WJWA 5DM73 3KLSX 5A2QL 2LY7A 1V1PA 3FVQA 2BDNA 3D4DA 4K2KA 3GO5A 5CC4A 3K5OA 2Q8IB 2BCOA 2NUCA 3V2TA 4AYBB 4CJ2C 3NBHA 2F3VA 3KLRA 1CZWA 3HP3A 3J80E 3X3NA 1R9TB 1EQVA 1MSGA 1AEXA 3MA2B 3AMUA 2B2VA 2VNUD 5EPJA 4XQJA 1GUNA 4O42A 3NP8A 3KBXA 1UNSA 3MAQA 1E0BA 1C4QA 1CHPD 1ET6A 1GUTA 3D4WA 3NTHA 1JE4A 2NVTB 4S3SA 2EYLA 1GOZA 3D31A 3PUYA 1HHVA 2NWGA 2CVRA 2SEBD 2J7ZA 2WACA 2PQEA 2KUMA 2RSNA 5C5LA 3GTOB 2PZWA 1SYEA 1O78A 1TQOA 1YNJC 3HG9A 2FINB 3I72A 1JOQA 2IWHA 1SE3A 3QIAA 3QOJA 5K36G 4IFDG 1PTOC 3NPPA 2KHSA 1CT1D 4C2MB 3SK4A 1KDCA 1HRJA 1ZYRD 4DGZA 5EKIA 1ILQA 2JE6I 2A6ED 1BXTA 1I6VC 4FF1A 3G6JB 3VYRA 1G8ZD 2LS01 2CHBD 1RDPD 4DAYA 3GTMB 1A6XA 1K83B 4ZKCB 4ZYSA 5IGCA 5HGTA 3VR6A 3RZDB 2B8GA 3GD7A 2ID0A 3DHQA 2LMCB 1D5ZC 3Q22A 1VMCA 2EZVA 1G291 3NQIA 4J1MA 1NUCA 3D4RA 2QDBA 2A5HA 1WVLA 1BCPD 2Z1CA 1STBA 2K32A 5E4WC 2B2TC 1U4LA 5C3EB 4DNTB 4A3FB 5IT9E 1Q1BA 1JWSD 1TWCB 1B4OA 1A2TA 2AWNA 4KD3A 3HOXB 4QUFA 1KDAA 2NBFA 5KIXA 1G91A 1O7ZA 3D3RA 4BA1I 4F87A 3IAYA 5CV7A 2YYZA 4A93B 1A3VA 1F9PA 1F2ZA 3H6MA 5CORA 1HA5A 2PMZB 3BYTB 3SEBA 2EYJA 2EJGC 1QG7A 5I6WA 1V8QA 3U9OA 4A3MB 3FEWX 1CTMA 1Y8OB 5K36H 5CV6A 1B9NA 1IKMA 3S1NB 2RDGA 3DEPA 3DXJC 3KF8A 1SMYC 4X3UA 2IT1A 3T16A 2RA4A 2NN6H 1RTOA 4RGOS 4EGVA 3IKJA 1CQVA 3OIQA 2OEOA 1MGSA 5EBCA 1BCPB 3A55A 3I70A 1EL0A 5J1ZA 3OWEB 1PTOB 2EY1A 3ND8A 3K0YA 1SNDA 1ML0D 1TWHB 4K2LA 2G9HD 4A3DB 1EYCA 2LKVA 2B2YA 2O4XA 5KRUA 4KJNA 1OXSC 5BN5A 3NTKA 5IODA 1KLUD 1TS4A 2PZUA 1WTWA 1DXMA 3E0JA 1A3UA 3TMEA 4B08A 3SK6A 2ICEC 2Q8TA 4Q5VA 4EQPA 3R3OA 3NK9A 1WD0A 4WRDA 1BQQT 4H7BA 3T51B 2OXPA 3VYSA 3TP8A 2IW3A 1JR0D 3VR2A 4F7XA 1LT5D 1KNEA 1Y1WB 1SNMA 3K5LA 5C3XA 3HGBA 4IUTA 4U673 2L4NA 4HMIA 3X3MA 5FK9C 3JAML 3CRKC 1VMPA 4QCLA 1QOHA 4KY6A 3M3YB 3OOCA 3AU7A 4OO1I 2RSOA 1IW7C 1X3PA 5IOCA 3R8BA 3VA5A 1BR9A 4RFBA 2R6GA 4IURA 1EU3A 5T1GA 1FNVA 4K8JA 2TMPA 4RCNA 2X6GA 3IFDA 5CBEE 1PFBA 2PPBC 3E6ZX 3CKIB 4CJ0B 1YNND 2B39A 4PNYA 2F0PA 1DYQA 1B1ZA 4LJZC 4BY1B 3NWSA 4XQQA 5IIFA 3KLSA 3H0GB 1RKNA 2NVYB 1FNWA 1BF4A 3QG1A 2QCPX 4HR7B 1H9JA 3I4LA 3MFGA 4H0LC 4ZK9B 1EIGA 1WTVA 3PIO3 3I3CA 3GTLB 1EYDA 2EYOA 3H94A 4KI0A 1IYUA 1O7LA 2I07B 2RBMA 4IALA 2HCIA 1GUGA 2CW0D 4XTCS 4Q0FA 2WAQB 4OO1H 4G7OC 3GP7A 1QCBD 3PIP3 3K5MA 1Q12A 4RHSA 2L5TA 2KCCA 1K8MA 2NB0A 2AQ2B 1TY0A 3FDTA 3C3LA 3OSOA 5CV5A 4MIUA 4K5VA 4KHZA 4L8JA 1TS3A 4C1NI 2WIIB 1QNKA 3ND9A 1I4HA 1O7YA 3C2PA 1HUNA 2EYPA 4BBSB 5JPMC 5I4DA 3VR4A 3D8GA 3T56B 2HDLA 2JA8B 1PRTC 4CKBA 2WKDA 1D5MC 2JYOA 2EY6A 3V05A 4TSSA 3TDQA 4KTAA 2FFKB 1DCZA 4HMJA 2HUGA 1JB3A 4K14A 5G3LD 3T53B 4KN7C 1CK1A 2K5QA 4LAAA 4A3JB 5D65A 2XRSD 3ITPA 1H9SA 4CKCA 4CJ1B 1DOKA 1PFMA 2WV6D 4DFAA 3I91A 4F8MA 5HURA 5C3WA 4C3IB 3SVMA 1I4GA 2PCFB 1BDOA 3HEJA 1TWGB 4ZLTF 1I4XA 1PRTD 1QB5D 1BNZA 2KOLA 1STAA 1SEBD 1I4RA 1WTRA 3I4MB 2XRQD 2BE5C 3NHHA 3JAME 1CQFA 2RVLA 2WP8J 5JEAG 4DXGA 3NE5B 3T4AC 4FXGC 1SYFA 1AN8A 3RLFA 2IJ0A 3EFXD 4PMCA 1J8IA 2DY8A 2M2LA 2WKCA 3LX0A 4C3HB 1QWYA 3FRPB 4BS9A 1SJED 2E2JB 1XTCD 2XWJB 5E4XA 1PDQA 3NXWA 5J22A 4HSPA 1G6ZA 1S5DD 4X3TA 4KHVA 4UDUC 1B53A 4DN4M 3RUZA 1FNUA 1HXYD 1I6HB 4RA8A 1D5XC 3I73A 3BVGA 1LT4D 5IGGA 1HFGA 1STEA 4F88A 5KGUA 2SNMA 1H9KA 2M00A 2NN6G 4IN3A 2L1BA 3D6CA 1ONLA 1PRTB 5F2DA 1KTKA 1EY0A 4RH6A 3FPPA 3M7NA 1CZGA 5JVH3 3MC0B 1RCVD 4O1NA 2F0GA 3TBIB 3MVVA 2EVBA 2GA4B 4P2CB 3BVZA 1LTID 2VXWA 1PZKD 2VB2X 3ERQA 4ZKBB 2XWBB 4PV1C 3CHBD 1OO9B 4QB4A 2E2HB 5EQ0A 1TR5A 3HRZC 4NKLA 3W2DA 4UAIA 2A73B 2IX1A 2F4IA 4A3GB 4DA2A 3M7GA 2RQXA 3KUPA 1DONA 1R4PB 4V190 4RKBA 5IGFA 3K6OA 3K58A 1S5ED 4ZAIA 2F0HA 3GV3A 1LABA 3MFYA 4H44C 1W6KA 2JEBI 1HQRD 2BA0A 2AWOA 2M9VA 4B9XA 3P1HA 1EYAA 3BZDB 4HN7A 4ID6A 4JK1C 5J39A 1V43A 1EU4A 1AW7A 1LV9A 4V0BA 1EY5A 3BDLA 1E2VA 4A3KB 5C6AA 1F9QA 4HSVA 5A2QE 5CGKA 3A8KE 5ELBA 4IFDH 1I3QB 1L0XB 1SE4A 2A74C 1BCPC 1NR4A 5CR3A 2V4DA 1Z6HA 4OHJA 3VA7A 4XT1B 1F9RA 2WINB 2J4XA 1QNUA 3BG3A 3WOFA 1JICA 1C48A 3RD4A 1FR3A 2PZTA 3QOLA 3L3OC 4QMGA 1U4RA 1VDZA 4MN3A 3S2DB 2A68D 4JBWA 4RKLA 1BBXC 1JOKA 2ZXOA 2VUMB 3GV6A 3J7AF 1SYBA 2JEAI 4I65A 1Q1EA 2KQ3A 2E2DC 5D3DA 2PYKA 3A8IE 2OT2A 4FNFA 4PMBA 1LLRD 2K28A 3RZOB 2DN8A 3OWFA 4DAPA 3SDZA 3M4OB 2X6LA 2K5DA 1O80A 1EFID 3AB9A 3DMUA 3PUVA 3R93A 3HOZB 2KEDA 3SK8A 3J80L 4IFDI 1Y8PB 1V1PB 3TSSA 5E1FA 3VR5A 2K01A 2MP1A 4XXEA 1IHZA 1SNQA 3QWNA 3TZDA 2ICIA 1Q8IA 4XIGS 3R2IA 2D2CC 4K6DA 1TVXA 3TN2A 5BN4A 5T1IA 5JOBA 1ENFA 1FYCA 2KVMA 3I8ZA 4U68A 1HFNA 4IUQA 2DNEA 5M9OA 2K04A 2N55A 3BDCA 1LTTD 3ONAB 3GTKB 5M3FB 3CRLC 2Q8RE 1U4PA 2NN6I 3A7LA 1B9MA 2A68C 4KKUA 5I2XA 4K6LA 1D2BA 5CYUA 4C56C 1TU2B 3DWQA 3A54A 3M85A 1UAPA 1YNNC 1OXTA 2N88A 1FD7D 1SDFA 4RGTA 3GTGB 2MGSA 2MHVA 2CW0C 2MPMA 5JEAJ 1JWMD 1SMYD 1RODA 1PLFA 4K5WA 2PO4A 3T13A 5IGDA 3OMGA 2C5CA 2F0FA 1DJRD 2FMCA 3OPOA 2F0OA 4TQUS 1GXDC 4HEDA 3BVMA 4Y7NB 1GHKA 4N9PA 1SXTA 3OMCA 3N6RA 5KYLA 1BCPF 1JCKB 2FJ2A 1VF5C 2X69A 1AZPA 3EQLC 4DF7A 5A35A 1F77A 5FO7B 3P20A 3S15B 4EQNA 5C4JB 4L6TB 4C3HG 1TWAB 3QO2A 5G3LF 4EVOA 3P7JA 3VR3A 5CV9A 2EXZA 4IQZA 3FKIB 1NSNS 2HQEA 2QEJC 1QJOA 2EJFC 4QF4A 2B63B 4N9TA 1GUWA 1MD2D 1JWUD 4GZYC 3HOUB 2EYHA 2K1BA 1I50B 2O5IC 4C3IG 2F0IA 1CM9A 1LTAD 2FMMA 3S9WA 2BE5D 3SHLA 1PMRA 3S1RB 1AZQA 2EDGA 3PV0A 1PTOH 1SNPA 4QIWB 2E74C 1EY9A 1GJXA 5KEEA 1J9OA 2L11A 2F3WA 1WD1A 5EBDA 1RD9D 4Z9CB 2F0NA 2DY7A 5K5PA 4ZQ3A 3PUZA 2AQ3B 1GUSA 5DAUA 1XYIA 1TWFB 2F0QA 1HPCA 1RF2D 1Z47A 1ZKOA 4ME5A 1MI2A 4BWGB 2RKSA 1STHA 1VF7A 2EY5A 2I46A 4PQXA 1M8AA 1Y69U 2FHTA 1EQTA 1EWCA 4A3BB 1LTBD 1Q3LA 2JP1A 1SSOA 1D6EC 1D1KA 1EOTA 3F2UA 1IW7D 5JAVA 4FF4A 4IUUA 3DUZA 3G7LA 1KABA 5IGBA 4OGQC 5KYIA 3KK7A 3OIPA 1WTXA 2R61A 3CU7A 1XX8A 2IL8A 1KDBA 4YIJA 1EEFD 3SR1A 2B2WA 2RDHA 5COYA 1WTQA 4LK1C 2EE1A 1DZ1A 2F0UA 2JSOA 2K5WA 2A69C 1H9RA 4I7ZC 4M1UB 3Q0AA 1ET9A 1DOMA 1OXVA 3GTJB 2BA1A 1H9SB 3TP7A 1DOLA 5C44B 2XIWA 3J81E 1EEID 4KK7A 1DD2A 1S4ZA 2EYFA 4XQNA 3BS1A 2B2UA 4FXKC 4G57A 4BA2I 1WTPA 1HQMC 5JPNC 3CQZB 4KJOA 1F2MA 3HOYB 2JXMB 1AP0A 4NW2A 1F2YA 3MEHA 4G4KA 4ULLA 1ILPA 2BOSA 4XT3B 2SOBA 2D9UA 1GHJA 5LHY1 3A56A 1C8CA 4OO1G 5LL6S 2XSCA 1I4PA 1TS2A 2DNCA 3FPUB 4RWSC 3DEOA 1IL8A 2F1MA 3PUXA 1EY7A 5ELDA 1F9SA 1WCMB 1U9RA 2F0LA 3MZ5A 3DM1A 3MXUA 3NBIA 2R3ZA 1W6JA 1LT3D 2A6HD 1PZID 4K5XA 4BY7B 5EGTA 5FOBB 1TY2A 2B2UC 1MSHA 1ENAA 4QUCA 2F0MA 1E2WA 2ENBA 5C0XG 4IUPA 5DEHA 2C9OA 2F0EA 1X3QA 5ISRA 3C1EA 2QF7A 4HTHA 2MUYA 2OF1A 1BUVT 1NR2A 2JA5B 1BO0A 1TT2A 2SDFA 5M3MB 5I9PA 3ZYYX 1M4VA 5D3IB 5EPLA 1LACA 1KAAA 3U9SA 5C4ZA 2ZXPA 2ZXRA 3QB3A 5JVG3 2IX0A 1G2SA 3HOVB 4FF3A 1ZYRC 2EOTA 3PMFA 1JOOA 5BN3A 1B3AA 2G9DA 2WB1B 1VCIA 1Y8NB 1TIID 4DK0A 3UI2A 4A3EB 4FO2A 2HDMA 2EPBA 2K03A 3EROA 3WDNA 4EQOA 5JEAH 1HCZA 4OIJA 4M8AA 1EY6A 2AUKA 4ZUIA 5FLXL 3RMHA 4G7HC 4KD4A 1ZEQX 4C3JB 3NWTA 1PTOF 1SNCA 2KCNA 5ELEA 1CA5A 3K59A 2A6HC 4LMQD 1LO5D 2PW5A 3GQBA 2KEEA 4NP5A 4B9WA 5ELCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EDG A;  3PV0 A;  2DN8 A;  1I6V C;  2A6E C;  4H44 C;  3ND8 A;  2JEB I;  3SDZ A;  2A69 C;  2D62 A;  3SE0 A;  3I73 A;  1DCZ A;  1H9R A;  2BA0 A;  2E74 C;  4I7Z C;  1Q90 A;  4KN4 C;  3T53 B;  1E2Z A;  4KKT A;  1OXV A;  1HTP A;  2AWO A;  1E2W A;  2BA1 A;  4KN7 C;  4LJZ C;  1Z7T A;  5C0X G;  4TKO B;  1H9S B;  3AB9 A;  3OPO A;  1A6X A;  1T5E A;  3A7A B;  3PUW A;  4TQU S;  3PUV A;  2K7V A;  5KNC A;  2B8F A;  4JK1 C;  1GJX A;  1DD2 A;  3VR6 A;  2B8G A;  2D5D A;  1V43 A;  3GD7 A;  1GUO A;  1OXS C;  2QF7 A;  1GUN A;  1H9K A;  2ZT9 C;  1H9S A;  2PNR C;  1Y8P B;  1GHK A;  2LMC B;  5BN5 A;  2NN6 G;  3PUZ A;  3QG1 A;  4HR7 B;  3VR5 A;  1GUS A;  1H9J A;  2EJM A;  3N6R A;  3I4L A;  1IYV A;  4KMU C;  3LWU A;  1G29 1;  4G7Z C;  4H0L C;  1ONL A;  3BDO A;  2E76 C;  1GUT A;  1E2V A;  3QJY A;  1HPC A;  2A69 D;  4BA2 I;  1DXM A;  1VF5 C;  1HQM C;  3D4R A;  3H94 A;  4KI0 A;  4DK1 A;  3A8K E;  3EQL C;  4IFD H;  1IYU A;  1LAC A;  1ZKO A;  3U9S A;  5A35 A;  3D31 A;  2K32 A;  2PCF B;  3PUY A;  1BDO A;  1EWH A;  1O7L A;  4XIG S;  2D2C C;  3FPP A;  5KND A;  1VF7 A;  1H9M A;  3P20 A;  1OXU A;  5BN4 A;  2JXM B;  4DNT B;  3M7N A;  4DNR B;  3T51 B;  1FYC A;  1GUG A;  1Y69 U;  1ZYR C;  5C0X H;  1Q1B A;  2V4D A;  1Z6H A;  4XTC S;  3VR2 A;  3VA7 A;  2DNE A;  3M4Y A;  4H13 C;  5BN3 A;  5KNB A;  4OO1 H;  4G7O C;  3HGB A;  2BE5 C;  1GHJ A;  1VCI A;  1Y8N B;  2EVB A;  3A8J E;  3BG3 A;  3OW7 A;  4BA1 I;  2K33 A;  2E75 C;  4DK0 A;  2YYZ A;  1IW7 D;  3CRK C;  1O78 A;  3CRL C;  3VR3 A;  1YNJ C;  2NN6 I;  1Q12 A;  2L5T A;  4IQZ A;  2KCC A;  1FR3 A;  3A7L A;  1K8M A;  3I72 A;  3NE5 B;  5JEA G;  4OO1 G;  1B9M A;  2EJG C;  3OOC A;  2A68 C;  3QIA A;  4KKS A;  4KKU A;  4PV1 C;  3TZU A;  1V8Q A;  3WDN A;  5K36 H;  5JEA H;  1K8O A;  1HCZ A;  4OGQ C;  3RLF A;  1IW7 C;  5K36 G;  1QJO A;  2EJF C;  1TKW B;  1VDZ A;  2BDO A;  1CI3 M;  2AUK A;  2DNC A;  4KHZ A;  4IFD G;  1TU2 B;  2R6G A;  4G7H C;  2A68 D;  4L8J A;  1CTM A;  4JBW A;  3M85 A;  1OXX K;  1Y8O B;  2F1M A;  1YNN C;  1CFM A;  1B9N A;  2AUJ D;  2KA7 A;  3ND9 A;  3PUX A;  1OXT A;  3W3A A;  4GZY C;  2JEA I;  1Q1E A;  3L7Z C;  3DXJ C;  2O5I C;  4LK1 C;  1SMY C;  2IT1 A;  3IFT A;  3A8I E;  2NN6 H;  4RCN A;  2Q8I B;  3IKJ A;  3LNN A;  3VR4 A;  3T56 B;  2A6H C;  3MXU A;  2BE5 D;  2JE6 I;  2A6E D;  1PMR A;  3KLR A;  2A6H D;  2O5J C;  2CW0 C;  3GQB A;  2PPB C;  1LAB A;  3FMC A;  3MFY A; 
#chains in the Genus database with same CATH topology
 1JOR A;  3HOW G;  4DR7 L;  1CUK A;  1ICF B;  1Y1V H;  1G2T A;  1PXU A;  2N8N A;  4HIK A;  2A6E C;  4X65 L;  1IKL A;  3ER0 A;  4KY7 A;  3GTP H;  3KYH C;  2NVX B;  1LM0 A;  3HOX H;  2E2I B;  4O2D A;  4KKT A;  5C0X J;  1L0Y B;  3HOW B;  4JBJ A;  1E7Z A;  2JA6 B;  2LFN A;  1UE5 A;  1YJW A;  1JJ2 A;  3EJI A;  3Q24 A;  1PTO D;  5GAD C;  3CCL A;  1EZ6 A;  2D5D A;  5IYC G;  2F0S A;  3MXG A;  3I4N B;  1FL0 A;  2TSS A;  2JA7 H;  2PW7 A;  1SAP A;  2XN9 C;  2NVY H;  3E9H A;  3CC4 A;  4IO9 A;  3H0G G;  3WOE A;  4G7Z C;  3LWU A;  3L9A X;  3BDO A;  1YNJ D;  5M3M H;  1EZ8 A;  5NUC A;  2B2Y C;  4IZ8 A;  4DK1 A;  2OQK A;  3S17 H;  5BR8 Q;  2O5J C;  2L55 A;  4NDX A;  2XVS A;  2FXQ A;  4IFD J;  1SJH D;  4DNR B;  3H09 A;  2KHJ A;  3HS0 C;  2IHE A;  1S5B D;  4A3C G;  1QIL A;  2QKI C;  2XNA C;  3M4Y A;  1LTS D;  3TP6 A;  1VQ5 A;  1NTG A;  4JYA L;  3NQT A;  3GTQ B;  4JPB W;  3MXP A;  4XDX A;  1PZJ D;  1NCV A;  3TQY A;  3CCV A;  1ICW A;  1KAW A;  2IPK D;  4KV6 A;  1ESF A;  1UEA B;  5EPK A;  4IPH A;  4KKS A;  2JA5 G;  2O2L D;  1K8O A;  4WOR A;  4DUY L;  1YJN A;  1RJT A;  1ZXT A;  1TKW B;  4Y7N H;  5FJ8 G;  3URY A;  4DV0 Q;  1A2U A;  4A3I B;  2E5L Q;  5I9O A;  4LFB L;  3IRB A;  4GNX B;  2EYM A;  4IOC A;  2YU9 B;  3KDF B;  3FKI G;  1JQY D;  1TS5 A;  3VYU A;  1UUP A;  3IFT A;  3MXN A;  3E5S A;  1CHQ D;  1T5X D;  3TP5 A;  5FKA C;  1R4Q B;  3U50 C;  1CA6 A;  3FMC A;  1VQE A;  2B2W C;  1SNO A;  3GTP B;  2NVX H;  4P73 A;  5GAG C;  4IUN A;  1HTP A;  4RGM A;  4TKO B;  3A0J A;  4OWW B;  4BBR B;  1T5E A;  3A7A B;  5ELO A;  2KJX A;  2B8F A;  2QA4 A;  4DU9 A;  1LT6 D;  1RHP A;  4R4I A;  3S16 B;  3M3Y H;  2VB3 X;  1EY4 A;  1S40 A;  3ICE A;  1AE2 A;  3Q23 A;  4ILW A;  3K7A B;  2K5N A;  3HOV G;  2L0C A;  4CDF C;  3CPF A;  5M3M G;  1B3Q A;  1RTN A;  1IYV A;  5AFW A;  4LUO A;  2F0V A;  4A4I A;  5C0X I;  4JI0 Q;  4RHR A;  4WJ3 M;  1K0R A;  1YBY A;  5E3F A;  2ASB A;  4BXX G;  5I6Y A;  1PFN A;  4CBV A;  1I50 H;  4ZUJ A;  1VQ6 A;  4AIM A;  1XMQ Q;  2SNS A;  3H91 A;  2EY2 A;  1EWH A;  2K05 A;  1VQC A;  3UE0 A;  2A1A A;  4TRD A;  5KND A;  4IUV A;  5FO9 B;  2CCZ A;  1XPO A;  5LL6 X;  1HNZ L;  2NTS A;  2CWP A;  1VQB A;  5FLX E;  1I4Q A;  1EY8 A;  1PRT F;  2RDF A;  2ALY B;  4FP5 D;  1NAP A;  4OL7 A;  5KNB A;  4OON A;  3SXH A;  5C4X B;  1B44 D;  3HOW H;  3PO2 B;  2CQA A;  5BR8 L;  1JC7 A;  3NTI A;  3OW7 A;  2K33 A;  1TWH H;  2Z8L A;  2UXB L;  5C4H A;  4RAU C;  3ZJY C;  1SFO H;  3LWE A;  4J8Q A;  5CV4 A;  4E6I A;  2H4O A;  1N34 Q;  1II3 A;  1SR3 A;  4OIK A;  1JE5 A;  3T1Y L;  2PQA B;  3C1F A;  3NEM A;  4DXF A;  4ODG A;  3BYY B;  2R7F A;  2F0D A;  3HZX A;  3KF6 B;  1LTG D;  2BDO A;  2QIL A;  4DV2 L;  3S14 B;  1L1O C;  1OXX K;  1UE7 A;  2OCE A;  3W3A A;  4AQY Q;  1CFM A;  2AUJ D;  2KA7 A;  3W1G A;  2MJ8 A;  4HAE A;  4FXD A;  2NZ1 D;  3HKZ E;  1VQO A;  3L7Z C;  3EVQ A;  3S17 B;  5EKK A;  4DAV A;  2NYZ D;  2MQH A;  1KNA A;  4EX5 A;  3OHX C;  1DGS A;  5M5Y H;  3LNN A;  4QY7 A;  1KHI A;  1K8G A;  1D1I A;  5TSS A;  3J81 j;  5ELF A;  5EJW A;  4JI7 L;  3MHB A;  4UP9 A;  4DV0 L;  1U4M A;  1SYD A;  1YEZ A;  3NSW A;  1PH4 A;  2D62 A;  2Z4I A;  1LTL A;  1E2Z A;  5DM6 3;  4LW1 A;  2F0T A;  5IE8 A;  4UHV A;  4JI8 L;  2L9H A;  4UPA A;  3PUW A;  4GN4 B;  3VYT A;  4CKE A;  4FF2 A;  2CH4 W;  3MWY W;  2K7V A;  5KNC A;  3A5U A;  4ABN A;  4HCS A;  4DV5 Q;  2JQO A;  1ENC A;  4L63 B;  3GDE A;  1AH9 A;  3DWA A;  2ZT9 C;  2PNR C;  3NUC A;  1XXG A;  4XYO A;  1UE6 A;  2L12 A;  1XWE A;  4C3J G;  3S14 H;  3SK5 A;  2HQL A;  5LMN Q;  3I90 A;  2R93 G;  2E76 C;  1E3P A;  4MHE A;  3QJY A;  2A69 D;  5I2Y A;  3CXC A;  3KF8 B;  3S1Q B;  1S5F D;  1HR0 W;  1STG A;  1SYC A;  1A15 A;  2B2V C;  4X64 Q;  4CGY B;  2R93 B;  3NBH B;  1DM0 B;  4X3S A;  3K57 A;  5C3E H;  1HTL D;  3MTS A;  3UDG A;  4O0A A;  3DWP A;  5C0X H;  2K6A A;  1SE2 A;  1KL9 A;  3K5N A;  5CV8 A;  1S5C D;  2R92 B;  3R2T A;  4JI0 L;  4H13 C;  4DPG A;  4X3K A;  1R9T H;  1STN A;  4DR1 L;  4C1N K;  3A8J E;  4A3J G;  2KCT A;  2I5H A;  3J81 L;  3IL8 A;  1XMQ L;  2B2T A;  1WTO A;  1MBY A;  4A3E H;  4QGU A;  3OW2 A;  1SBB B;  1HA6 A;  1FGB D;  1STY A;  1IYJ B;  3W1B A;  1CI3 M;  2J0T D;  4JW0 A;  4NXN Q;  3P75 A;  3CME A;  2LXK A;  3HKZ B;  5CMD A;  1HUM A;  4K8I A;  3J7Z C;  5M5W B;  1SYG A;  3OTO Q;  4R8I A;  4KY5 A;  2F0K A;  1AFP A;  3OYY A;  4XYQ A;  1EIH A;  1A63 A;  4FVM A;  2PNH A;  4LFA Q;  2UXD L;  2DUD A;  1N33 L;  3PF5 A;  4IPG A;  1K73 C;  1BOS A;  4DV2 Q;  5IGE A;  3H3V C;  1Y1V B;  4PMW A;  2Z0S A;  1LTR D;  3SE0 A;  2E2I H;  3C46 A;  2G5D A;  2R7Z G;  3S2H B;  1B2T A;  1FJG L;  3EA6 A;  4KN4 C;  1Q90 A;  1N32 Q;  2NVQ B;  3Q6S A;  2VY3 A;  3HKS A;  4JI1 L;  1I5F A;  1SFO B;  4WFN 3;  1Z7T A;  2JA6 H;  5JJZ A;  1JJG A;  4BY7 G;  2HCC A;  2Z4H A;  5IT9 L;  2HD3 A;  2R7Z H;  3D6W A;  5EKL A;  4CHT B;  3J7A V;  4NMZ A;  4JI4 Q;  3ERS X;  1GUO A;  1X54 A;  2JA7 B;  2F03 A;  4HIM A;  3V96 A;  2EJM A;  3O13 A;  1V1O A;  4KMU C;  4HJ5 A;  3A5Z B;  1PYW D;  2K14 A;  4RCO A;  3S1M B;  3EBE A;  1HNW Q;  1ESR A;  1KLG D;  1P16 A;  4HCE A;  5D14 A;  5FO8 B;  2H1E A;  1MJC A;  5M5Y B;  2AQ1 B;  2KEC A;  4LUZ A;  1J5E L;  4GN5 A;  4FYD A;  4R8N A;  2Y0S B;  4RGN A;  3PCO B;  4R9W A;  1H9M A;  3N52 A;  1OXU A;  3VDY A;  5DNF A;  4R4Q A;  3J7Y W;  1BBU A;  1P8L A;  1F2L A;  3T1H L;  3H3V I;  5M5X B;  1TXY A;  1QE6 A;  2F0J A;  5C5M A;  1B50 A;  3KBG A;  1HR0 Q;  1A3T A;  4ZRZ A;  3PO3 B;  2F0W A;  1X32 A;  4JI6 Q;  4X64 L;  1IBL L;  2E75 C;  4A3J H;  4BBS G;  2IX3 A;  2N78 A;  4J6H A;  4QIW E;  2NTT A;  2R7Z B;  1G6P A;  3TZU A;  5CBA E;  1VQH A;  4A93 G;  3G4S A;  4WJW A;  3CCS A;  5DM7 3;  1X9N A;  3KLS X;  5A2Q L;  2LY7 A;  1V1P A;  1Z9F A;  3FVQ A;  2BDN A;  1PH5 A;  3D4D A;  4GS3 A;  4K2K A;  1MJE A;  3MEF A;  3S1Q H;  3GO5 A;  5CC4 A;  4POG A;  2R93 H;  3K5O A;  4JI8 Q;  2Q8I B;  4HIO A;  2BCO A;  2NUC A;  3V2T A;  4AYB B;  4CJ2 C;  3NBH A;  2F3V A;  4J15 A;  3SGI A;  3KLR A;  3PGZ A;  1CZW A;  3HP3 A;  3J80 E;  3X3N A;  2I5L X;  1R9T B;  4DR6 Q;  2NVQ H;  1EQV A;  1X65 A;  1MSG A;  1AEX A;  3MA2 B;  3HFZ B;  1QUQ A;  3W5O A;  3AMU A;  2B2V A;  2VNU D;  5EPJ A;  4XQJ A;  1GVP A;  3RZD H;  1GUN A;  4O42 A;  4IJH A;  1KC8 C;  1U0L A;  3NP8 A;  3KBX A;  1UNS A;  3MAQ A;  1E0B A;  3PO3 G;  1C4Q A;  1CHP D;  1ET6 A;  1GUT A;  1WCM H;  1V9P A;  3D4W A;  3NTH A;  1VQ4 A;  1JE4 A;  3E0E A;  4S3S A;  2NVT B;  2EYL A;  4JV5 L;  1GOZ A;  3D31 A;  3PUY A;  3JAM c;  1XNQ L;  1HHV A;  2NWG A;  1PH9 A;  2CVR A;  4DR2 Q;  2SEB D;  2J7Z A;  2WAC A;  4DR3 L;  2PQE A;  1WOC A;  2GVB A;  4A3F H;  2KUM A;  4JI3 Q;  1HH2 P;  1S3O A;  2RSN A;  5C5L A;  3GTO B;  2PZW A;  1SYE A;  1O78 A;  4YHH L;  1TQO A;  1YNJ C;  3OTO L;  3HG9 A;  2FIN B;  3I72 A;  3UDI A;  1JOQ A;  2IWH A;  1SE3 A;  3QIA A;  1EQQ A;  3QOJ A;  5K36 G;  4NXM Q;  1OTC A;  4IFD G;  1E22 A;  1PTO C;  3NPP A;  4JI6 L;  3KOJ A;  2KHS A;  4A3G G;  1CT1 D;  4C2M B;  3SK4 A;  1KDC A;  1SMX A;  3S1N H;  1G51 A;  2JK8 A;  1HRJ A;  1ZYR D;  3UDX A;  1HNX L;  4JI1 Q;  2NVT H;  4DGZ A;  5EKI A;  1ILQ A;  2JE6 I;  2A6E D;  3HOV H;  1BXT A;  4OX9 Q;  5H1S E;  2UXC L;  1PH2 A;  4DR7 Q;  4A3M G;  1RIP A;  1I6V C;  1GD7 A;  4FF1 A;  2ZTE A;  3G6J B;  3VYR A;  1G8Z D;  2LS0 1;  2CHB D;  1RDP D;  3RN5 A;  4LF6 L;  4DAY A;  1N36 Q;  3GTM B;  3I4N G;  1A6X A;  1K83 B;  4ZKC B;  4ZYS A;  2N3S A;  1E1T A;  5IGC A;  1Q7Y C;  1YHQ A;  5HGT A;  3VR6 A;  3RZD B;  2B8G A;  3GD7 A;  2ID0 A;  1EFW A;  2E2H H;  3DHQ A;  2LMC B;  2JA9 A;  4MTK A;  3PSI A;  1D5Z C;  3Q22 A;  4B3S L;  1VMC A;  2EZV A;  1G29 1;  3NQI A;  1X56 A;  4J1M A;  1NUC A;  3D4R A;  2QDB A;  2A5H A;  1WVL A;  1BCP D;  2WB1 E;  2Z1C A;  3F2B A;  1STB A;  4R1J A;  2K32 A;  5E4W C;  2B2T C;  1U4L A;  4DR5 L;  1QVF A;  5C3E B;  1TWG H;  2C35 B;  4DNT B;  4A3F B;  5IT9 E;  4UP7 A;  5JJL A;  1NJI C;  1Q1B A;  2Q2T A;  1JWS D;  1TWC B;  1B4O A;  4APV A;  4LFC Q;  3I4M H;  1A2T A;  2AWN A;  4KD3 A;  3HOX B;  4QUF A;  1KDA A;  2NBF A;  1JJC B;  5KIX A;  1G91 A;  1O7Z A;  3D3R A;  4BA1 I;  4F87 A;  2RCN A;  4BBR G;  3IAY A;  1XNQ Q;  3QR8 A;  5CV7 A;  2YYZ A;  1ASY A;  4DV7 Q;  4A93 B;  1A3V A;  1F9P A;  4DNI A;  4A3D H;  1F2Z A;  1MKH A;  3H6M A;  5COR A;  1HA5 A;  2PMZ B;  3BYT B;  3SEB A;  2EYJ A;  3U4V A;  2EJG C;  2QEX A;  1QG7 A;  4A3C H;  5I6W A;  3I4N H;  1V8Q A;  4JI3 L;  2NZH A;  4QL5 A;  3U9O A;  4A3M B;  2IHF A;  4DR4 Q;  4CDD C;  2WB1 G;  2N49 A;  1SN8 A;  1B8A A;  1CTM A;  3FEW X;  3EIV A;  4LFB Q;  2RHQ B;  1Y8O B;  5K36 H;  5CV6 A;  1B9N A;  1IKM A;  3S1N B;  2RDG A;  3DEP A;  3DXJ C;  3KF8 A;  1SMY C;  4X3U A;  4GOP B;  2IT1 A;  4YHH Q;  3T16 A;  2RA4 A;  2NN6 H;  1RTO A;  4RGO S;  4EGV A;  3IKJ A;  1CQV A;  1VQG A;  3OIQ A;  2OEO A;  3CC2 A;  4GN3 B;  3T1Y Q;  1MGS A;  1VQF A;  2CH4 A;  5EBC A;  1BCP B;  3A55 A;  3I70 A;  4B3R Q;  2XGT A;  1EL0 A;  5J1Z A;  3OWE B;  1PTO B;  2EY1 A;  3ND8 A;  3K0Y A;  1PH3 A;  1SND A;  4AQY L;  3S2H H;  1ML0 D;  3GTM H;  3BZC A;  3GTK H;  2VQF L;  1TWH B;  1K9M C;  4K2L A;  2G9H D;  4A3D B;  3F1Z A;  1EYC A;  2LKV A;  4LNQ A;  4OX9 L;  1WFQ A;  2B2Y A;  2O4X A;  5KRU A;  4KJN A;  1OXS C;  2Z6K A;  5BN5 A;  5IP9 G;  4DR3 Q;  3NTK A;  5IOD A;  2HIV A;  1KLU D;  1TS4 A;  2YU9 H;  2PZU A;  1WTW A;  1DXM A;  3E0J A;  1A3U A;  3TME A;  4B08 A;  3SK6 A;  2ICE C;  5IYB H;  2Q8T A;  4Q5V A;  3KJP A;  4EQP A;  1PH7 A;  2QDL A;  3R3O A;  3NK9 A;  4UP8 A;  1WD0 A;  4WRD A;  1BQQ T;  4H7B A;  1NE3 A;  1CSQ A;  3T51 B;  2OXP A;  3VYS A;  1IBK Q;  3TP8 A;  2IW3 A;  1JR0 D;  3VR2 A;  4F7X A;  3PO3 H;  1VQN A;  1LT5 D;  1KNE A;  2VZA A;  1SNM A;  1Y1W B;  3J80 c;  5C3X A;  3K5L A;  4KHP L;  2RCF A;  3HGB A;  4IUT A;  4U67 3;  2L4N A;  4HMI A;  3X3M A;  1PH6 A;  5FK9 C;  3JAM L;  2UUB Q;  3CRK C;  1VMP A;  3I2Z A;  4QCL A;  1QOH A;  4DUZ L;  4KY6 A;  1K0S A;  3M3Y B;  3OOC A;  3AU7 A;  2HHH L;  4OO1 I;  2RSO A;  1VQP A;  4LFC L;  1IW7 C;  1X3P A;  5IOC A;  1J6Q A;  3R8B A;  4PG3 A;  3VA5 A;  1BR9 A;  4RFB A;  2R6G A;  4IUR A;  1EU3 A;  5T1G A;  2I5M X;  1M1K C;  1FNV A;  4K8J A;  2TMP A;  4ME3 A;  5HGQ A;  4C3I H;  4RCN A;  3UDF A;  4BBS H;  2X6G A;  2VQE L;  3IFD A;  5CBE E;  1HZ9 A;  2NZO A;  1PFB A;  3NEN A;  2PPB C;  3E6Z X;  3CKI B;  4CJ0 B;  2KBN A;  1YNN D;  2B39 A;  5GAE C;  3PO2 H;  4B3S Q;  1IXR A;  2Z6K C;  4PNY A;  2F0P A;  1DYQ A;  4PZ8 A;  4A93 H;  1B1Z A;  4LJZ C;  3NWS A;  4XQQ A;  4BY1 B;  5IIF A;  2YTV A;  3KLS A;  3HKZ G;  2YV5 A;  3H0G B;  1RKN A;  2NVY B;  1FNW A;  1BF4 A;  3QG1 A;  2QCP X;  4HR7 B;  1H9J A;  4A76 A;  3I4L A;  1VQ9 A;  3MFG A;  2JA8 G;  4H0L C;  4ZK9 B;  1GM5 A;  1EIG A;  1WTV A;  3PIO 3;  5AJ3 Q;  3I3C A;  3K8A A;  4A3D G;  3GTL B;  1EYD A;  2EYO A;  3H94 A;  4KI0 A;  1A0I A;  4A3K H;  4DV4 Q;  1IYU A;  1O7L A;  2I07 B;  3DLL A;  2A19 A;  2RBM A;  4IAL A;  2HCI A;  1GUG A;  1W3S A;  2CW0 D;  4XTC S;  4Q0F A;  4DV6 Q;  2WAQ B;  1IBM Q;  4OO1 H;  4G7O C;  1HNW L;  2HT1 A;  3GP7 A;  1EIY B;  1QCB D;  2PI2 E;  2PQA A;  3PIP 3;  3GTO H;  4BY1 H;  5IWA L;  3K5M A;  1Q12 A;  4RHS A;  2L5T A;  1Y14 B;  2KCC A;  5C4X G;  1K8M A;  2NB0 A;  3H15 A;  1N9W A;  2AQ2 B;  1TY0 A;  3FDT A;  1EQR A;  3C3L A;  3OSO A;  5CV5 A;  1D8L A;  4MIU A;  4K5V A;  4KHZ A;  2UUC Q;  3S2D H;  4YWK A;  4L8J A;  4A3K G;  2VUM H;  1TS3 A;  4C1N I;  2WII B;  1QNK A;  3ND9 A;  2DGY A;  3STB C;  1I4H A;  1O7Y A;  4DUZ Q;  3C2P A;  1HUN A;  2EYP A;  4B3M L;  4BBS B;  5JPM C;  5I4D A;  3VR4 A;  3D8G A;  2OWO A;  3T56 B;  2HDL A;  1N33 Q;  2JA8 B;  1VQJ A;  4JBK A;  1PRT C;  4CKB A;  2WKD A;  1D5M C;  2MO0 A;  2EY6 A;  2JYO A;  3V05 A;  2D0O A;  4UY8 C;  2JN4 A;  4TSS A;  3TDQ A;  2ZJR A;  4KTA A;  1FJG Q;  2AKW B;  2FFK B;  1DCZ A;  4HMJ A;  1WI5 A;  1X6O A;  2HUG A;  1M90 C;  3HOZ G;  1JB3 A;  4K14 A;  5G3L D;  3T53 B;  4AYB G;  4LF7 L;  4YCV A;  1K83 H;  1CK1 A;  4KN7 C;  1VS0 A;  2VL6 A;  3AFQ A;  1CKN B;  2K5Q A;  2JA7 G;  4LAA A;  4A3J B;  1HZC A;  5D65 A;  2K5V A;  2XRS D;  2VQE Q;  4P74 A;  3ITP A;  4A3E G;  1K8A C;  1KRT A;  2B3G A;  4ALP A;  1H9S A;  1WYD A;  4CKC A;  4CDE C;  1DOK A;  4CJ1 B;  1IBK L;  1PFM A;  3FHW A;  4GNX A;  2WV6 D;  4DFA A;  3I91 A;  4F8M A;  5M5W H;  2V1C C;  4NXN L;  5HUR A;  4GOP A;  5C3W A;  2ZM6 Q;  3E9I A;  4C3I B;  1FGU A;  3G71 A;  3SVM A;  1I4G A;  2PCF B;  1BDO A;  5IT9 c;  3HEJ A;  1TWG B;  4ZLT F;  1I4X A;  3J7A 5;  1PRT D;  1NNX A;  1QB5 D;  3I55 A;  1BNZ A;  1X55 A;  2KOL A;  1TWC H;  1STA A;  1SEB D;  4Y52 H;  1I4R A;  2BH2 A;  1WTR A;  4P75 A;  3I4M B;  4MNO A;  2XRQ D;  1NBW A;  2BE5 C;  2WAQ G;  5C44 G;  3E3X A;  4HJ9 A;  3NHH A;  3JAM E;  4DV4 L;  5FLX c;  1CQF A;  4FDB A;  1SRU A;  2RVL A;  3K80 C;  1WCM G;  2WP8 J;  5JEA G;  2ZJQ A;  4DXG A;  3NE5 B;  3T4A C;  4FXG C;  1SYF A;  1AN8 A;  3RLF A;  2IJ0 A;  3EFX D;  4PMC A;  1J8I A;  2DY8 A;  1XMO L;  1SLJ A;  2M2L A;  2WKC A;  3LX0 A;  4C3H B;  1QWY A;  3FRP B;  4LF4 Q;  4BS9 A;  1SJE D;  2E2J B;  1XTC D;  2XWJ B;  1A8V A;  4RMF A;  5E4X A;  2MFI A;  1PDQ A;  5JJK A;  3NXW A;  1VQD A;  5J22 A;  5EAY A;  3KLW A;  4HSP A;  1G6Z A;  4DV3 Q;  4R4T A;  2QGQ A;  1QZH A;  1J5E Q;  4X66 L;  1BVS A;  1S5D D;  4X3T A;  4KHV A;  4UDU C;  1B53 A;  3RUZ A;  4DN4 M;  4NXM L;  1FNU A;  1HXY D;  1I6H B;  4B3T L;  2Z6B A;  4RA8 A;  1L1O B;  1D5X C;  3TRZ A;  4YY3 Q;  3I73 A;  3BVG A;  3G48 A;  2Q2U A;  1LT4 D;  1PH8 A;  1HNX Q;  3FP9 A;  5IGG A;  5M3F G;  5LMN W;  4JYA Q;  1Q46 A;  4N8F A;  1HFG A;  4DV1 Q;  1STE A;  1B7Y B;  4F88 A;  5KGU A;  2SNM A;  1H9K A;  4L5R C;  4A3B G;  3I4O A;  2M00 A;  2NN6 G;  4IN3 A;  2L1B A;  4LF7 Q;  3D6C A;  2B29 A;  1ONL A;  1VQ8 A;  4C2M H;  1PRT B;  1PYS B;  1KTK A;  5F2D A;  2UUA L;  4JI7 Q;  4PZ7 A;  1YI2 A;  1EY0 A;  3PF4 A;  1C0A A;  4RH6 A;  3FPP A;  5HY6 A;  1JB7 A;  3M7N A;  1CZG A;  4NPS A;  5C4J H;  5JVH 3;  3MC0 B;  1RCV D;  4O1N A;  5IYD H;  2F0G A;  3TBI B;  1LYL A;  4L5Q A;  3MVV A;  2CQO A;  3M4O H;  2EVB A;  2GA4 B;  4P2C B;  3BVZ A;  1LTI D;  2VXW A;  1KD1 C;  1PZK D;  3UE1 A;  1N34 L;  3CCU A;  2VB2 X;  1HZA A;  3ERQ A;  2EXD A;  4ZKB B;  5GAH C;  3FKI H;  2XWB B;  4PV1 C;  4DAY B;  3CHB D;  1OO9 B;  2R7D A;  2BH8 A;  4QB4 A;  2E2H B;  5EQ0 A;  1TR5 A;  3HRZ C;  5FJ8 H;  4NKL A;  3W2D A;  2I0Q A;  4UAI A;  2A73 B;  2IX1 A;  2F4I A;  1PH1 A;  4A3G B;  4DA2 A;  3M7G A;  2JA5 H;  2RQX A;  3KUP A;  2JA6 G;  1DON A;  1R4P B;  3L0O A;  4V19 0;  3EN2 A;  4RKB A;  5IGF A;  3K6O A;  3K58 A;  4NB3 A;  1S5E D;  4ZAI A;  2F0H A;  2PI2 A;  3GV3 A;  1LAB A;  3J81 c;  2Y0S E;  1XMO Q;  3MFY A;  2OQ0 A;  3RZO H;  4R4O A;  2Z9H A;  1HNZ Q;  4H44 C;  2VW9 A;  1W6K A;  2JEB I;  1HQR D;  3PIO A;  2BA0 A;  1YIT A;  4LF4 L;  5ELN A;  3CMA A;  2OTL A;  4DK3 C;  4GLV B;  2AWO A;  2M9V A;  3BZK A;  4B9X A;  3P1H A;  1EYA A;  3BZD B;  4HN7 A;  4ID6 A;  4JK1 C;  4YWM A;  5J39 A;  1Y1W G;  2WAQ E;  4DV3 L;  1V43 A;  1EU4 A;  1FVI A;  1AW7 A;  4B3T Q;  3H0G H;  1LV9 A;  4V0B A;  1VQK A;  1EY5 A;  3BDL A;  1XNR Q;  4DK6 C;  1EUJ A;  1SE8 A;  1E2V A;  4A3K B;  2K50 A;  5C6A A;  1F9Q A;  3ULP A;  4HSV A;  5A2Q E;  5CGK A;  3A8K E;  5ELB A;  3CCE A;  4IFD H;  1I3Q B;  4YCW A;  1L0X B;  1SE4 A;  3HOX G;  2A74 C;  1BCP C;  4X65 Q;  1NR4 A;  3TS0 A;  5M5X H;  5CR3 A;  2V4D A;  1BKB A;  2YTY A;  1Z6H A;  4OHJ A;  3VA7 A;  4XT1 B;  4DR1 Q;  1F9R A;  2WIN B;  2J4X A;  1QNU A;  3BG3 A;  4WJ4 A;  3WOF A;  2LXJ A;  1JIC A;  1NY4 A;  3L2P A;  4DV7 L;  5M3F H;  2ZTC A;  2UUA Q;  1VQA A;  1C48 A;  3RD4 A;  1FR3 A;  4TVA B;  2PZT A;  3QOL A;  3L3O C;  4QMG A;  1IZ6 A;  1U4R A;  1C9O A;  1VDZ A;  4MN3 A;  3S2D B;  1KRS A;  2AMC B;  2A68 D;  4JBW A;  4RKL A;  1BBX C;  1JOK A;  2ZXO A;  2VUM B;  3GV6 A;  3J7A F;  1SYB A;  4EQ5 A;  2EQS A;  5FLM H;  4I65 A;  2JEA I;  1Q1E A;  1PFS A;  2KQ3 A;  2E2D C;  2UUB L;  5D3D A;  2PYK A;  3A8I E;  4JG2 A;  4ZCK A;  4LFA L;  3CP0 A;  2HHH Q;  2OT2 A;  2VS1 A;  4FNF A;  4PMB A;  4OXP A;  1A62 A;  1LLR D;  2K28 A;  3RZO B;  2DN8 A;  3HOU G;  3OWF A;  4DAP A;  3SDZ A;  2Q2I A;  3M4O B;  2MO1 A;  2X6L A;  1CKO A;  2K5D A;  5IP7 H;  1O80 A;  4R4C A;  1EOV A;  1EFI D;  4IPD A;  3AB9 A;  3DMU A;  5IP7 G;  1XPU A;  1WTH A;  3PUV A;  5LMU Q;  1X3G A;  3R93 A;  3HOZ B;  4JOI A;  4POF A;  4JI4 L;  2KED A;  1Q82 C;  3SK8 A;  5IYB G;  2E5L L;  3J80 L;  4IFD I;  1Y8P B;  1V1P B;  3TSS A;  3S24 A;  4IJL A;  5E1F A;  3VR5 A;  2HIX A;  2ATW A;  2K01 A;  1EWI A;  4HJA A;  1H95 A;  3U58 A;  5IP9 H;  3TEH B;  2MP1 A;  4XXE A;  1IHZ A;  1SNQ A;  3QWN A;  4H02 A;  3TZD A;  2ICI A;  1Q8I A;  4XIG S;  3R2I A;  1YHB A;  2D2C C;  3HOY G;  4K6D A;  3CCM A;  1TVX A;  3TN2 A;  1YNX A;  5BN4 A;  4GKJ Q;  4A75 A;  5T1I A;  1UWV A;  5JOB A;  1ENF A;  1FYC A;  2KVM A;  3PIP A;  3I8Z A;  4U68 A;  2LSS A;  1HFN A;  4IUQ A;  3WWV A;  2DNE A;  5M9O A;  2R92 H;  1ASZ A;  2K04 A;  1MHW C;  1TWA H;  2N55 A;  3BDC A;  3M9B A;  1LTT D;  3ONA B;  3GTK B;  5M3F B;  4BXX H;  4LF9 Q;  3CRL C;  2Q8R E;  1U4P A;  2NN6 I;  3A7L A;  4AYB E;  1B9M A;  2A68 C;  4KKU A;  5I2X A;  4LWC A;  4K6L A;  1D2B A;  5CYU A;  4C56 C;  3ULJ A;  1QVG A;  1TU2 B;  3DWQ A;  3A54 A;  3M85 A;  1UAP A;  1C7Y A;  1YNN C;  1OXT A;  2N88 A;  1LUZ A;  3F2D A;  1FD7 D;  4CDC C;  2E2J H;  3RNU A;  3GTL H;  1SDF A;  2ES2 A;  4RGT A;  3GTG B;  1E24 A;  2MGS A;  3S15 H;  3KJO A;  3F8T A;  2MHV A;  2CW0 C;  2MPM A;  5JEA J;  3BJU A;  1JWM D;  4BY7 H;  1SMY D;  1ROD A;  4K0K L;  1PLF A;  1Y1W H;  4K5W A;  2PO4 A;  3I4M G;  1XNR L;  1W2B A;  3T13 A;  5IGD A;  1HR0 L;  1U5K A;  3OMG A;  2C5C A;  5C4X H;  2F0F A;  1DJR D;  4BY1 G;  2FMC A;  3OPO A;  2F0O A;  4TQU S;  1GXD C;  4HED A;  4QJF A;  3BVM A;  3J80 i;  1L2F A;  2E8G A;  4Y7N B;  1GHK A;  2PMZ E;  4N9P A;  1KIX A;  1SXT A;  1PV4 A;  3OMC A;  3N6R A;  5KYL A;  1BCP F;  1JCK B;  2FJ2 A;  1VF5 C;  2X69 A;  3U4Z A;  2ZTD A;  1AZP A;  3EQL C;  3LGJ A;  4DF7 A;  2UXC Q;  1PVO A;  5A35 A;  1F77 A;  2K52 A;  3ULL A;  4LF5 Q;  5FO7 B;  1BBW A;  3P20 A;  3GTG H;  3S15 B;  3JAM i;  5JJI A;  1SRO A;  4EQN A;  4DV6 L;  5C4J B;  4L6T B;  2K5H A;  1QUQ B;  1N36 L;  2DJF C;  4C3H G;  1TWA B;  1QZG A;  3QO2 A;  5G3L F;  4OWX B;  1I94 L;  2Y0S G;  4EVO A;  4I7A A;  1HZB A;  2UXB Q;  3P7J A;  2MNA A;  3VR3 A;  1X3F A;  5CV9 A;  4GKJ L;  2EXZ A;  4IQZ A;  4P71 A;  3S16 H;  1UEB A;  3FKI B;  1NSN S;  2HQE A;  2KCM A;  5C3E G;  3CD6 A;  1KXL A;  2QEJ C;  1QJO A;  2EJF C;  3K7A H;  4QF4 A;  2B63 B;  2QW7 A;  4N9T A;  3A74 A;  2UUC L;  4LF8 L;  1GUW A;  1MD2 D;  4A3G H;  1UE1 A;  1JWU D;  4GZY C;  2F3I A;  3HOU B;  2EYH A;  4JCV E;  3CCJ A;  2K1B A;  4LF9 L;  2F52 A;  1I50 B;  1QVC A;  2O5I C;  4C3I G;  4PZ6 A;  4C3J H;  4JOI C;  2F0I A;  1CM9 A;  5AJ3 L;  1LTA D;  1VQL A;  2RHS B;  2FMM A;  2BE5 D;  3DM3 A;  3S9W A;  1XTD A;  1PHJ A;  3SHL A;  1PMR A;  2K4K A;  5LMU L;  3S1R B;  3HOY H;  4JV5 Q;  1JT8 A;  1Y1V G;  3CAM A;  4A3B H;  1AZQ A;  2EDG A;  3PV0 A;  4YCU A;  1PTO H;  1L1O A;  1S72 A;  1SNP A;  4A3I G;  1YHA A;  4QIW B;  2E74 C;  2DJG C;  4MTN A;  3Q8D A;  2IY5 B;  3GTJ H;  1EY9 A;  2UU9 L;  1YVC A;  1JMC A;  3AQQ A;  1GJX A;  5KEE A;  1J9O A;  4GKK Q;  2L11 A;  2F3W A;  1WD1 A;  5EBD A;  5IWA Q;  1RD9 D;  1RL2 A;  4Z9C B;  2F0N A;  4X66 Q;  2DY7 A;  5K5P A;  4ZQ3 A;  3PUZ A;  3RLO A;  2AQ3 B;  1GUS A;  5DAU A;  3RLN A;  3JC6 6;  1XYI A;  4YY3 L;  1TWF B;  2F0Q A;  1HPC A;  1RF2 D;  1K28 A;  2ZM6 L;  3HOU H;  3J81 i;  1Z47 A;  1ZKO A;  4ME5 A;  2CFM A;  1MI2 A;  4BWG B;  3CQZ H;  2RKS A;  4DR5 Q;  1STH A;  1VF7 A;  4DV1 L;  3CCR A;  1Q86 C;  2OTJ A;  2EY5 A;  2I46 A;  4B3M Q;  4PQX A;  1M8A A;  1Y69 U;  3NEL A;  2FHT A;  1EQT A;  1EWC A;  4GLX A;  4A3B B;  1VQM A;  1LTB D;  1N32 L;  1L0W A;  1Q3L A;  2JP1 A;  1SSO A;  1D6E C;  1D1K A;  3I7F A;  2K75 A;  4MZ9 A;  2KHI A;  1EOT A;  4DKA C;  2YTX A;  5C44 H;  3F2U A;  1IW7 D;  3GTQ H;  1HJP A;  5JAV A;  1YJ9 A;  4LF5 L;  4IUU A;  4FF4 A;  3STB D;  3DUZ A;  3G7L A;  2B63 H;  1KAB A;  2KEN A;  5IGB A;  4OGQ C;  5KYI A;  1K3B C;  3KK7 A;  3OIP A;  1WTX A;  4DR4 L;  2R61 A;  3CU7 A;  4A3I H;  1XX8 A;  3TS2 A;  2IL8 A;  1KDB A;  1AE3 A;  1EEF D;  4YIJ A;  1I94 Q;  2H5X A;  4P72 A;  3SR1 A;  2B2W A;  2RDH A;  4K0K Q;  5COY A;  1CSP A;  5DLQ E;  1TWF H;  1WTQ A;  4LK1 C;  2EE1 A;  5J3B A;  1DZ1 A;  4JI2 Q;  4DV5 L;  3CW2 C;  4QQB X;  2F0U A;  2JSO A;  3G6E A;  2K5W A;  1PYB A;  4B3R L;  4LF8 Q;  2D0P A;  4KLK A;  2A69 C;  5LMN L;  2XTI A;  1H9R A;  4HJ8 A;  4I7Z C;  4M1U B;  3Q0A A;  1ET9 A;  1DOM A;  1OXV A;  3GTJ B;  3RN2 A;  2BA1 A;  1H9S B;  2P5Z X;  3TP7 A;  1DOL A;  2VQF Q;  2XIW A;  3J81 E;  5C44 B;  3HOZ H;  4BBR H;  1EEI D;  4KK7 A;  1DD2 A;  2EIF A;  4GOP C;  4X6A H;  1S4Z A;  2EYF A;  4X62 Q;  1CKN A;  4GNX C;  4XQN A;  3BS1 A;  4GLA C;  2B2U A;  4C3H H;  4FXK C;  1NMF A;  4G57 A;  2CWA A;  3KF6 A;  4BA2 I;  3AEV A;  1WTP A;  4OWT B;  5GQO A;  1HQM C;  1D7Q A;  2UU9 Q;  5JPN C;  3CQZ B;  4KJO A;  1F2M A;  3S1R H;  3HOY B;  2VUM G;  4GKK L;  3K7U C;  5E7N A;  2JXM B;  1AP0 A;  4NW2 A;  1E1O A;  1F2Y A;  3MEH A;  4JC0 A;  4L5T A;  2F4V L;  1WJJ A;  4G4K A;  4ULL A;  1ILP A;  3T1H Q;  3AYH B;  2BOS A;  4KHP Q;  4XT3 B;  2SOB A;  4DAM A;  2D9U A;  3CPW A;  1GHJ A;  4IPC A;  1IBL Q;  5LHY 1;  3A56 A;  1C8C A;  4OO1 G;  3BU2 A;  5LL6 S;  2A8V A;  1EYG A;  4JI5 Q;  2UXD Q;  2WFW A;  2GVA A;  2XSC A;  1I4P A;  1NMG A;  1TS2 A;  2DNC A;  3FPU B;  4RWS C;  4A3M H;  3DEO A;  3S1M H;  1IL8 A;  4HJ7 A;  2F1M A;  3PUX A;  1EY7 A;  5ELD A;  3KFU A;  5IYD G;  1F9S A;  1WCM B;  1U9R A;  2F0L A;  3MZ5 A;  2L15 A;  3DM1 A;  4DR2 L;  4LUV A;  2JA8 H;  1I3Q H;  3MXU A;  3NBI A;  2GN5 A;  2R3Z A;  4AH6 A;  5IYC H;  1YIJ A;  1W6J A;  1K3R A;  1LT3 D;  2A6H D;  4JVZ A;  1IBM L;  1PZI D;  4K5X A;  4N8X 1;  4BY7 B;  3PQI A;  5EGT A;  3MXN B;  2R92 G;  5FOB B;  1TY2 A;  3K81 C;  2B2U C;  1MSH A;  1V1Q A;  1ENA A;  4OEM B;  3F2C A;  4QUC A;  2F0M A;  1E2W A;  2ENB A;  5C0X G;  4IUP A;  5DEH A;  3CF5 A;  1IL2 A;  3PO2 G;  2C9O A;  1MIU A;  2F0E A;  5L37 A;  1X3Q A;  5ISR A;  3C1E A;  1X3E A;  1EIF A;  2QF7 A;  1N8R C;  4HTH A;  4A3L H;  2MUY A;  2OF1 A;  1BUV T;  4A3F G;  2B63 G;  1YZ6 A;  1NR2 A;  2Q2H A;  2JA5 B;  1BO0 A;  1TT2 A;  2SDF A;  1CKM A;  5M3M B;  3CCQ A;  3ZYY X;  5I9P A;  1M4V A;  1VQ7 A;  5D3I B;  5EPL A;  1LAC A;  1KAA A;  3U9S A;  1XJV A;  5C4Z A;  1PA6 A;  2ZXP A;  2ZXR A;  4RG1 A;  4X62 L;  3QB3 A;  5IY0 A;  5JVG 3;  2IX0 A;  1G2S A;  2RF4 A;  4OEL B;  3HOV B;  4FF3 A;  1ZYR C;  1GO3 E;  2EOT A;  3PMF A;  1XPR A;  4DUY Q;  1JOO A;  2CKZ B;  3I56 A;  3K0X A;  4LF6 Q;  4IOA A;  5BN3 A;  3B6Y A;  1B3A A;  2G9D A;  4L5S A;  2WB1 B;  1Q81 C;  1VCI A;  1VQI A;  1Y8N B;  1B70 B;  1TII D;  3D0F A;  4DK0 A;  3UI2 A;  4A3E B;  4FO2 A;  2HDM A;  2JJQ A;  2EPB A;  2K03 A;  3ERO A;  5GRO A;  3WDN A;  4JI2 L;  4EQO A;  5JEA H;  5FLM G;  1HCZ A;  4OIJ A;  4JBM A;  4M8A A;  2F4V Q;  1EY6 A;  2AUK A;  4YWL A;  1Q8K A;  4ZUI A;  5FLX L;  3RMH A;  4G7H C;  3M4P A;  1GKH A;  4KD4 A;  3RR5 A;  1ZEQ X;  4DR6 L;  1T9H A;  4C3J B;  4HID A;  3KDF A;  3TRE A;  3NWT A;  2AHO B;  2ZJP A;  1PTO F;  3H3V H;  1SNC A;  2KCN A;  5ELE A;  1CA5 A;  4A3L G;  4JI5 L;  3K59 A;  1O7I A;  2A6H C;  4LMQ D;  3M4Q A;  3AFP A;  1LO5 D;  3CC7 A;  2PW5 A;  1KQS A;  3GQB A;  2KEE A;  4NP5 A;  4B9W A;  5ELC A;  1I6H H; 
#chains in the Genus database with same CATH homology
 1JOR A;  1G2T A;  1PXU A;  2A6E C;  1IKL A;  4KY7 A;  2NVX B;  2E2I B;  4KKT A;  5C0X J;  1L0Y B;  3HOW B;  2JA6 B;  2LFN A;  3EJI A;  3Q24 A;  1PTO D;  1EZ6 A;  2D5D A;  2F0S A;  3MXG A;  3I4N B;  2TSS A;  2PW7 A;  1SAP A;  2XN9 C;  3WOE A;  4G7Z C;  3LWU A;  3L9A X;  3BDO A;  1YNJ D;  1EZ8 A;  5NUC A;  2B2Y C;  4IZ8 A;  4DK1 A;  2O5J C;  2L55 A;  4NDX A;  2XVS A;  4IFD J;  1SJH D;  4DNR B;  3H09 A;  3HS0 C;  1S5B D;  1QIL A;  2QKI C;  2XNA C;  3M4Y A;  1LTS D;  3TP6 A;  3NQT A;  3GTQ B;  3MXP A;  4XDX A;  1PZJ D;  1NCV A;  1ICW A;  2IPK D;  4KV6 A;  1ESF A;  1UEA B;  5EPK A;  4KKS A;  2O2L D;  1K8O A;  4WOR A;  1RJT A;  1ZXT A;  1TKW B;  3URY A;  1A2U A;  4A3I B;  5I9O A;  2EYM A;  2YU9 B;  1JQY D;  1TS5 A;  3VYU A;  1UUP A;  3IFT A;  3MXN A;  3E5S A;  1CHQ D;  1T5X D;  3TP5 A;  5FKA C;  1R4Q B;  1CA6 A;  3FMC A;  2B2W C;  1SNO A;  3GTP B;  4IUN A;  1HTP A;  4RGM A;  4TKO B;  4BBR B;  1T5E A;  3A7A B;  2KJX A;  2B8F A;  4DU9 A;  1LT6 D;  1RHP A;  3S16 B;  2VB3 X;  1EY4 A;  3Q23 A;  4ILW A;  3K7A B;  2L0C A;  1RTN A;  1IYV A;  5AFW A;  2F0V A;  5C0X I;  4RHR A;  5E3F A;  5I6Y A;  1PFN A;  4CBV A;  4ZUJ A;  2SNS A;  3H91 A;  2EY2 A;  1EWH A;  2K05 A;  4TRD A;  5KND A;  4IUV A;  5FO9 B;  5LL6 X;  2NTS A;  5FLX E;  1I4Q A;  1EY8 A;  1PRT F;  2RDF A;  4FP5 D;  1NAP A;  4OL7 A;  5KNB A;  3SXH A;  5C4X B;  1B44 D;  3PO2 B;  2CQA A;  1JC7 A;  3NTI A;  3OW7 A;  2K33 A;  2Z8L A;  5C4H A;  4RAU C;  3LWE A;  4J8Q A;  5CV4 A;  4E6I A;  2H4O A;  1II3 A;  4OIK A;  3C1F A;  4DXF A;  4ODG A;  3BYY B;  3HZX A;  2F0D A;  1LTG D;  2BDO A;  2QIL A;  3S14 B;  1OXX K;  3W3A A;  1CFM A;  2AUJ D;  2KA7 A;  4FXD A;  2MJ8 A;  4HAE A;  2NZ1 D;  3L7Z C;  3EVQ A;  3S17 B;  5EKK A;  4DAV A;  2NYZ D;  1KNA A;  3OHX C;  3LNN A;  1D1I A;  5TSS A;  5ELF A;  5EJW A;  3MHB A;  1U4M A;  1SYD A;  3NSW A;  2D62 A;  2Z4I A;  1E2Z A;  5DM6 3;  2F0T A;  2L9H A;  3PUW A;  3VYT A;  4FF2 A;  4CKE A;  3MWY W;  2K7V A;  5KNC A;  4ABN A;  4HCS A;  1ENC A;  4L63 B;  3DWA A;  2ZT9 C;  2PNR C;  3NUC A;  1XXG A;  4XYO A;  2L12 A;  1XWE A;  4C3J G;  3SK5 A;  3I90 A;  2E76 C;  4MHE A;  3QJY A;  2A69 D;  5I2Y A;  3S1Q B;  1S5F D;  1SYC A;  1STG A;  1A15 A;  2B2V C;  4CGY B;  2R93 B;  1DM0 B;  4X3S A;  3K57 A;  1HTL D;  3MTS A;  3DWP A;  5C0X H;  2K6A A;  1SE2 A;  3K5N A;  5CV8 A;  1S5C D;  2R92 B;  3R2T A;  4H13 C;  4X3K A;  1STN A;  4C1N K;  3A8J E;  3J81 L;  3IL8 A;  2B2T A;  1WTO A;  1MBY A;  1SBB B;  1HA6 A;  1FGB D;  1STY A;  1CI3 M;  2J0T D;  3P75 A;  3HKZ B;  5CMD A;  1HUM A;  4K8I A;  5M5W B;  1SYG A;  4R8I A;  4KY5 A;  2F0K A;  1AFP A;  1EIH A;  4XYQ A;  4FVM A;  1BOS A;  5IGE A;  3H3V C;  1Y1V B;  4PMW A;  1LTR D;  3SE0 A;  3C46 A;  3S2H B;  1B2T A;  3EA6 A;  1Q90 A;  4KN4 C;  2NVQ B;  3Q6S A;  1SFO B;  4WFN 3;  1Z7T A;  5JJZ A;  2HCC A;  2Z4H A;  5IT9 L;  3D6W A;  5EKL A;  4CHT B;  3J7A V;  4NMZ A;  1GUO A;  2JA7 B;  2F03 A;  3V96 A;  2EJM A;  3O13 A;  1V1O A;  4KMU C;  3S1M B;  1PYW D;  4RCO A;  1ESR A;  1KLG D;  4HCE A;  5D14 A;  5FO8 B;  2H1E A;  5M5Y B;  2AQ1 B;  2KEC A;  4FYD A;  4R8N A;  2Y0S B;  4RGN A;  4R9W A;  1H9M A;  3N52 A;  1OXU A;  5DNF A;  3J7Y W;  1F2L A;  5M5X B;  1B50 A;  1QE6 A;  2F0J A;  5C5M A;  3KBG A;  1A3T A;  4ZRZ A;  3PO3 B;  2F0W A;  1X32 A;  2E75 C;  2IX3 A;  4J6H A;  2NTT A;  2R7Z B;  3TZU A;  5CBA E;  4WJW A;  5DM7 3;  3KLS X;  5A2Q L;  2LY7 A;  1V1P A;  3FVQ A;  2BDN A;  3D4D A;  4K2K A;  3GO5 A;  5CC4 A;  3K5O A;  2Q8I B;  2BCO A;  2NUC A;  3V2T A;  4AYB B;  4CJ2 C;  3NBH A;  2F3V A;  3KLR A;  1CZW A;  3HP3 A;  3J80 E;  3X3N A;  1R9T B;  1EQV A;  1MSG A;  1AEX A;  3MA2 B;  3AMU A;  2B2V A;  2VNU D;  5EPJ A;  4XQJ A;  1GUN A;  4O42 A;  3NP8 A;  3KBX A;  1UNS A;  3MAQ A;  1E0B A;  1C4Q A;  1CHP D;  1ET6 A;  1GUT A;  3D4W A;  3NTH A;  1JE4 A;  2NVT B;  4S3S A;  2EYL A;  1GOZ A;  3D31 A;  3PUY A;  1HHV A;  2NWG A;  2CVR A;  2SEB D;  2J7Z A;  2WAC A;  2PQE A;  2KUM A;  2RSN A;  5C5L A;  3GTO B;  2PZW A;  1SYE A;  1O78 A;  1TQO A;  1YNJ C;  3HG9 A;  2FIN B;  3I72 A;  1JOQ A;  2IWH A;  1SE3 A;  3QIA A;  3QOJ A;  5K36 G;  4IFD G;  1PTO C;  3NPP A;  2KHS A;  1CT1 D;  4C2M B;  3SK4 A;  1KDC A;  1HRJ A;  1ZYR D;  4DGZ A;  5EKI A;  1ILQ A;  2JE6 I;  2A6E D;  1BXT A;  1I6V C;  4FF1 A;  3G6J B;  3VYR A;  1G8Z D;  2LS0 1;  2CHB D;  1RDP D;  4DAY A;  3GTM B;  1A6X A;  1K83 B;  4ZKC B;  4ZYS A;  5IGC A;  5HGT A;  3VR6 A;  3RZD B;  2B8G A;  3GD7 A;  2ID0 A;  3DHQ A;  2LMC B;  1D5Z C;  3Q22 A;  1VMC A;  2EZV A;  1G29 1;  3NQI A;  4J1M A;  1NUC A;  3D4R A;  2QDB A;  2A5H A;  1WVL A;  1BCP D;  2Z1C A;  1STB A;  2K32 A;  5E4W C;  2B2T C;  1U4L A;  5C3E B;  4DNT B;  4A3F B;  5IT9 E;  1Q1B A;  1JWS D;  1TWC B;  1B4O A;  1A2T A;  2AWN A;  4KD3 A;  3HOX B;  4QUF A;  1KDA A;  2NBF A;  5KIX A;  1G91 A;  1O7Z A;  3D3R A;  4BA1 I;  4F87 A;  3IAY A;  5CV7 A;  2YYZ A;  4A93 B;  1A3V A;  1F9P A;  1F2Z A;  3H6M A;  5COR A;  1HA5 A;  2PMZ B;  3BYT B;  3SEB A;  2EYJ A;  2EJG C;  1QG7 A;  5I6W A;  1V8Q A;  3U9O A;  4A3M B;  3FEW X;  1CTM A;  1Y8O B;  5K36 H;  5CV6 A;  1B9N A;  1IKM A;  3S1N B;  2RDG A;  3DEP A;  3DXJ C;  3KF8 A;  1SMY C;  4X3U A;  2IT1 A;  3T16 A;  2RA4 A;  2NN6 H;  1RTO A;  4RGO S;  4EGV A;  3IKJ A;  1CQV A;  3OIQ A;  2OEO A;  1MGS A;  5EBC A;  1BCP B;  3A55 A;  3I70 A;  1EL0 A;  5J1Z A;  3OWE B;  1PTO B;  2EY1 A;  3ND8 A;  3K0Y A;  1SND A;  1ML0 D;  1TWH B;  4K2L A;  2G9H D;  4A3D B;  1EYC A;  2LKV A;  2B2Y A;  2O4X A;  5KRU A;  4KJN A;  1OXS C;  5BN5 A;  3NTK A;  5IOD A;  1KLU D;  1TS4 A;  2PZU A;  1WTW A;  1DXM A;  3E0J A;  1A3U A;  3TME A;  4B08 A;  3SK6 A;  2ICE C;  2Q8T A;  4Q5V A;  4EQP A;  3R3O A;  3NK9 A;  1WD0 A;  4WRD A;  1BQQ T;  4H7B A;  3T51 B;  2OXP A;  3VYS A;  3TP8 A;  2IW3 A;  1JR0 D;  3VR2 A;  4F7X A;  1LT5 D;  1KNE A;  1Y1W B;  1SNM A;  3K5L A;  5C3X A;  3HGB A;  4IUT A;  4U67 3;  2L4N A;  4HMI A;  3X3M A;  5FK9 C;  3JAM L;  3CRK C;  1VMP A;  4QCL A;  1QOH A;  4KY6 A;  3M3Y B;  3OOC A;  3AU7 A;  4OO1 I;  2RSO A;  1IW7 C;  1X3P A;  5IOC A;  3R8B A;  3VA5 A;  1BR9 A;  4RFB A;  2R6G A;  4IUR A;  1EU3 A;  5T1G A;  1FNV A;  4K8J A;  2TMP A;  4RCN A;  2X6G A;  3IFD A;  5CBE E;  1PFB A;  2PPB C;  3E6Z X;  3CKI B;  4CJ0 B;  1YNN D;  2B39 A;  4PNY A;  2F0P A;  1DYQ A;  1B1Z A;  4LJZ C;  4BY1 B;  3NWS A;  4XQQ A;  5IIF A;  3KLS A;  3H0G B;  1RKN A;  2NVY B;  1FNW A;  1BF4 A;  3QG1 A;  2QCP X;  4HR7 B;  1H9J A;  3I4L A;  3MFG A;  4H0L C;  4ZK9 B;  1EIG A;  1WTV A;  3PIO 3;  3I3C A;  3GTL B;  1EYD A;  2EYO A;  3H94 A;  4KI0 A;  1IYU A;  1O7L A;  2I07 B;  2RBM A;  4IAL A;  2HCI A;  1GUG A;  2CW0 D;  4XTC S;  4Q0F A;  2WAQ B;  4OO1 H;  4G7O C;  3GP7 A;  1QCB D;  3PIP 3;  3K5M A;  1Q12 A;  4RHS A;  2L5T A;  2KCC A;  1K8M A;  2NB0 A;  2AQ2 B;  1TY0 A;  3FDT A;  3C3L A;  3OSO A;  5CV5 A;  4MIU A;  4K5V A;  4KHZ A;  4L8J A;  1TS3 A;  4C1N I;  2WII B;  1QNK A;  3ND9 A;  1I4H A;  1O7Y A;  3C2P A;  1HUN A;  2EYP A;  4BBS B;  5JPM C;  5I4D A;  3VR4 A;  3D8G A;  3T56 B;  2HDL A;  2JA8 B;  1PRT C;  4CKB A;  2WKD A;  1D5M C;  2JYO A;  2EY6 A;  3V05 A;  4TSS A;  3TDQ A;  4KTA A;  2FFK B;  1DCZ A;  4HMJ A;  2HUG A;  1JB3 A;  4K14 A;  5G3L D;  3T53 B;  4KN7 C;  1CK1 A;  2K5Q A;  4LAA A;  4A3J B;  5D65 A;  2XRS D;  3ITP A;  1H9S A;  4CKC A;  4CJ1 B;  1DOK A;  1PFM A;  2WV6 D;  4DFA A;  3I91 A;  4F8M A;  5HUR A;  5C3W A;  4C3I B;  3SVM A;  1I4G A;  2PCF B;  1BDO A;  3HEJ A;  1TWG B;  4ZLT F;  1I4X A;  1PRT D;  1QB5 D;  1BNZ A;  2KOL A;  1STA A;  1SEB D;  1I4R A;  1WTR A;  3I4M B;  2XRQ D;  2BE5 C;  3NHH A;  3JAM E;  1CQF A;  2RVL A;  2WP8 J;  5JEA G;  4DXG A;  3NE5 B;  3T4A C;  4FXG C;  1SYF A;  1AN8 A;  3RLF A;  2IJ0 A;  3EFX D;  4PMC A;  1J8I A;  2DY8 A;  2M2L A;  2WKC A;  3LX0 A;  4C3H B;  1QWY A;  3FRP B;  4BS9 A;  1SJE D;  2E2J B;  1XTC D;  2XWJ B;  5E4X A;  1PDQ A;  3NXW A;  5J22 A;  4HSP A;  1G6Z A;  1S5D D;  4X3T A;  4KHV A;  4UDU C;  1B53 A;  4DN4 M;  3RUZ A;  1FNU A;  1HXY D;  1I6H B;  4RA8 A;  1D5X C;  3I73 A;  3BVG A;  1LT4 D;  5IGG A;  1HFG A;  1STE A;  4F88 A;  5KGU A;  2SNM A;  1H9K A;  2M00 A;  2NN6 G;  4IN3 A;  2L1B A;  3D6C A;  1ONL A;  1PRT B;  5F2D A;  1KTK A;  1EY0 A;  4RH6 A;  3FPP A;  3M7N A;  1CZG A;  5JVH 3;  3MC0 B;  1RCV D;  4O1N A;  2F0G A;  3TBI B;  3MVV A;  2EVB A;  2GA4 B;  4P2C B;  3BVZ A;  1LTI D;  2VXW A;  1PZK D;  2VB2 X;  3ERQ A;  4ZKB B;  2XWB B;  4PV1 C;  3CHB D;  1OO9 B;  4QB4 A;  2E2H B;  5EQ0 A;  1TR5 A;  3HRZ C;  4NKL A;  3W2D A;  4UAI A;  2A73 B;  2IX1 A;  2F4I A;  4A3G B;  4DA2 A;  3M7G A;  2RQX A;  3KUP A;  1DON A;  1R4P B;  4V19 0;  4RKB A;  5IGF A;  3K6O A;  3K58 A;  1S5E D;  4ZAI A;  2F0H A;  3GV3 A;  1LAB A;  3MFY A;  4H44 C;  1W6K A;  2JEB I;  1HQR D;  2BA0 A;  2AWO A;  2M9V A;  4B9X A;  3P1H A;  1EYA A;  3BZD B;  4HN7 A;  4ID6 A;  4JK1 C;  5J39 A;  1V43 A;  1EU4 A;  1AW7 A;  1LV9 A;  4V0B A;  1EY5 A;  3BDL A;  1E2V A;  4A3K B;  5C6A A;  1F9Q A;  4HSV A;  5A2Q E;  5CGK A;  3A8K E;  5ELB A;  4IFD H;  1I3Q B;  1L0X B;  1SE4 A;  2A74 C;  1BCP C;  1NR4 A;  5CR3 A;  2V4D A;  1Z6H A;  4OHJ A;  3VA7 A;  4XT1 B;  1F9R A;  2WIN B;  2J4X A;  1QNU A;  3BG3 A;  3WOF A;  1JIC A;  1C48 A;  3RD4 A;  1FR3 A;  2PZT A;  3QOL A;  3L3O C;  4QMG A;  1U4R A;  1VDZ A;  4MN3 A;  3S2D B;  2A68 D;  4JBW A;  4RKL A;  1BBX C;  1JOK A;  2ZXO A;  2VUM B;  3GV6 A;  3J7A F;  1SYB A;  2JEA I;  4I65 A;  1Q1E A;  2KQ3 A;  2E2D C;  5D3D A;  2PYK A;  3A8I E;  2OT2 A;  4FNF A;  4PMB A;  1LLR D;  2K28 A;  3RZO B;  2DN8 A;  3OWF A;  4DAP A;  3SDZ A;  3M4O B;  2X6L A;  2K5D A;  1O80 A;  1EFI D;  3AB9 A;  3DMU A;  3PUV A;  3R93 A;  3HOZ B;  2KED A;  3SK8 A;  3J80 L;  4IFD I;  1Y8P B;  1V1P B;  3TSS A;  5E1F A;  3VR5 A;  2K01 A;  2MP1 A;  4XXE A;  1IHZ A;  1SNQ A;  3QWN A;  3TZD A;  2ICI A;  1Q8I A;  4XIG S;  3R2I A;  2D2C C;  4K6D A;  1TVX A;  3TN2 A;  5BN4 A;  5T1I A;  5JOB A;  1ENF A;  1FYC A;  2KVM A;  3I8Z A;  4U68 A;  1HFN A;  4IUQ A;  2DNE A;  5M9O A;  2K04 A;  2N55 A;  3BDC A;  1LTT D;  3ONA B;  3GTK B;  5M3F B;  3CRL C;  2Q8R E;  1U4P A;  2NN6 I;  3A7L A;  1B9M A;  2A68 C;  4KKU A;  5I2X A;  4K6L A;  1D2B A;  5CYU A;  4C56 C;  1TU2 B;  3DWQ A;  3A54 A;  3M85 A;  1UAP A;  1YNN C;  1OXT A;  2N88 A;  1FD7 D;  1SDF A;  4RGT A;  3GTG B;  2MGS A;  2MHV A;  2CW0 C;  2MPM A;  5JEA J;  1JWM D;  1SMY D;  1ROD A;  1PLF A;  4K5W A;  2PO4 A;  3T13 A;  5IGD A;  3OMG A;  2C5C A;  2F0F A;  1DJR D;  2FMC A;  3OPO A;  2F0O A;  4TQU S;  1GXD C;  4HED A;  3BVM A;  4Y7N B;  1GHK A;  4N9P A;  1SXT A;  3OMC A;  3N6R A;  5KYL A;  1BCP F;  1JCK B;  2FJ2 A;  1VF5 C;  2X69 A;  1AZP A;  3EQL C;  4DF7 A;  5A35 A;  1F77 A;  5FO7 B;  3P20 A;  3S15 B;  4EQN A;  5C4J B;  4L6T B;  4C3H G;  1TWA B;  3QO2 A;  5G3L F;  4EVO A;  3P7J A;  3VR3 A;  5CV9 A;  2EXZ A;  4IQZ A;  3FKI B;  1NSN S;  2HQE A;  2QEJ C;  1QJO A;  2EJF C;  4QF4 A;  2B63 B;  4N9T A;  1GUW A;  1MD2 D;  1JWU D;  4GZY C;  3HOU B;  2EYH A;  2K1B A;  1I50 B;  2O5I C;  4C3I G;  2F0I A;  1CM9 A;  1LTA D;  2FMM A;  3S9W A;  2BE5 D;  3SHL A;  1PMR A;  3S1R B;  1AZQ A;  2EDG A;  3PV0 A;  1PTO H;  1SNP A;  4QIW B;  2E74 C;  1EY9 A;  1GJX A;  5KEE A;  1J9O A;  2L11 A;  2F3W A;  1WD1 A;  5EBD A;  1RD9 D;  4Z9C B;  2F0N A;  2DY7 A;  5K5P A;  4ZQ3 A;  3PUZ A;  2AQ3 B;  1GUS A;  5DAU A;  1XYI A;  1TWF B;  2F0Q A;  1HPC A;  1RF2 D;  1Z47 A;  1ZKO A;  4ME5 A;  1MI2 A;  4BWG B;  2RKS A;  1STH A;  1VF7 A;  2EY5 A;  2I46 A;  4PQX A;  1M8A A;  1Y69 U;  2FHT A;  1EQT A;  1EWC A;  4A3B B;  1LTB D;  1Q3L A;  2JP1 A;  1SSO A;  1D6E C;  1D1K A;  1EOT A;  3F2U A;  1IW7 D;  5JAV A;  4FF4 A;  4IUU A;  3DUZ A;  3G7L A;  1KAB A;  5IGB A;  4OGQ C;  5KYI A;  3KK7 A;  3OIP A;  1WTX A;  2R61 A;  3CU7 A;  1XX8 A;  2IL8 A;  1KDB A;  4YIJ A;  1EEF D;  3SR1 A;  2B2W A;  2RDH A;  5COY A;  1WTQ A;  4LK1 C;  2EE1 A;  1DZ1 A;  2F0U A;  2JSO A;  2K5W A;  2A69 C;  1H9R A;  4I7Z C;  4M1U B;  3Q0A A;  1ET9 A;  1DOM A;  1OXV A;  3GTJ B;  2BA1 A;  1H9S B;  3TP7 A;  1DOL A;  5C44 B;  2XIW A;  3J81 E;  1EEI D;  4KK7 A;  1DD2 A;  1S4Z A;  2EYF A;  4XQN A;  3BS1 A;  2B2U A;  4FXK C;  4G57 A;  4BA2 I;  1WTP A;  1HQM C;  5JPN C;  3CQZ B;  4KJO A;  1F2M A;  3HOY B;  2JXM B;  1AP0 A;  4NW2 A;  1F2Y A;  3MEH A;  4G4K A;  4ULL A;  1ILP A;  2BOS A;  4XT3 B;  2SOB A;  2D9U A;  1GHJ A;  5LHY 1;  3A56 A;  1C8C A;  4OO1 G;  5LL6 S;  2XSC A;  1I4P A;  1TS2 A;  2DNC A;  3FPU B;  4RWS C;  3DEO A;  1IL8 A;  2F1M A;  3PUX A;  1EY7 A;  5ELD A;  1F9S A;  1WCM B;  1U9R A;  2F0L A;  3MZ5 A;  3DM1 A;  3MXU A;  3NBI A;  2R3Z A;  1W6J A;  1LT3 D;  2A6H D;  1PZI D;  4K5X A;  4BY7 B;  5EGT A;  5FOB B;  1TY2 A;  2B2U C;  1MSH A;  1ENA A;  4QUC A;  2F0M A;  1E2W A;  2ENB A;  5C0X G;  4IUP A;  5DEH A;  2C9O A;  2F0E A;  1X3Q A;  5ISR A;  3C1E A;  2QF7 A;  4HTH A;  2MUY A;  2OF1 A;  1BUV T;  1NR2 A;  2JA5 B;  1BO0 A;  1TT2 A;  2SDF A;  5M3M B;  5I9P A;  3ZYY X;  1M4V A;  5D3I B;  5EPL A;  1LAC A;  1KAA A;  3U9S A;  5C4Z A;  2ZXP A;  2ZXR A;  3QB3 A;  5JVG 3;  2IX0 A;  1G2S A;  3HOV B;  4FF3 A;  1ZYR C;  2EOT A;  3PMF A;  1JOO A;  5BN3 A;  1B3A A;  2G9D A;  2WB1 B;  1VCI A;  1Y8N B;  1TII D;  4DK0 A;  3UI2 A;  4A3E B;  4FO2 A;  2HDM A;  2EPB A;  2K03 A;  3ERO A;  3WDN A;  4EQO A;  5JEA H;  1HCZ A;  4OIJ A;  4M8A A;  1EY6 A;  2AUK A;  4ZUI A;  5FLX L;  3RMH A;  4G7H C;  4KD4 A;  1ZEQ X;  4C3J B;  3NWT A;  1PTO F;  1SNC A;  2KCN A;  5ELE A;  1CA5 A;  3K59 A;  2A6H C;  4LMQ D;  1LO5 D;  2PW5 A;  3GQB A;  2KEE A;  4NP5 A;  4B9W A;  5ELC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...