2EYMA

Crystal structure of staphylococcal nuclease mutant t120c
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNCHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 37
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eymA00
5IODA 1STNA 4WORA 2F0NA 1KDCA 3OWFA 5KEEA 2PW5A 1EY7A 1STHA 4ZUJA 3BDLA 2SNSA 2F3VA 1EYCA 5F2DA 5JOBA 3LX0A 4EQPA 2M00A 3ERQA 4IZ8A 1JOKA 4DFAA 1JORA 2F0LA 2F0DA 1A2UA 2EYJA 5KIXA 1RKNA 4DU9A 1SYCA 1SYBA 4KY7A 2EYOA 4N9PA 2RKSA 4IALA 5IGCA 4KTAA 5CR3A 3MHBA 5C3XA 3C1FA 2EYFA 1F2YA 4PNYA 3NUCA 4RKLA 4H7BA 4E6IA 5KGUA 1A3UA 1NUCA 2F0SA 2F0MA 4K2KA 5DEHA 1SNPA 2OEOA 4KJNA 4LAAA 1EYAA 3EJIA 4K5VA 4QF4A 2KHSA 3R3OA 4ZQ3A 4K5WA 3U9OA 1KDAA 1IHZA 3QB3A 3PMFA 4J1MA 1EY6A 5J1ZA 4K2LA 4EVOA 2HQEA 2EYMA 1TQOA 1U9RA 4DF7A 4K6DA 1TT2A 4PMBA 4TRDA 5J39A 1STYA 3V2TA 2EY2A 3QOJA 5I9PA 2EYPA 5EKKA 4HTHA 3E5SA 3SK4A 3S9WA 5J22A 1STAA 1KDBA 2F0UA 4HMJA 2PYKA 5E3FA 5I6WA 5IGFA 5ISRA 3QOLA 2QDBA 1ENCA 2PZUA 5KYLA 4KHVA 5IGEA 3SK5A 3T16A 3P75A 4B9WA 2PQEA 3HEJA 1SYEA 1EY8A 2SNMA 1SYFA 5CV7A 3SK8A 1STBA 4K8JA 5K5PA 4K8IA 5E1FA 5HGTA 4KD3A 3SXHA 5IGDA 4KJOA 2F0GA 5EKLA 2RDFA 4QB4A 5CGKA 4F8MA 1EQVA 4EQOA 5C4HA 1SYDA 2EY1A 2F0KA 4PMCA 4B9XA 1SNDA 4HMIA 5C6AA 5M9OA 1EY5A 5C5MA 1JOQA 1TR5A 3SHLA 4N9TA 1II3A 1STGA 3SR1A 5JAVA 2F0WA 3D4DA 2RBMA 3NK9A 4IUNA 5EGTA 2F0JA 2F0HA 5KRUA 2WACA 1KAAA 4ZUIA 5C3WA 1SNQA 2F0TA 5KYIA 2EYHA 4OL7A 2O4XA 3OMCA 4QMGA 4KV6A 5C4ZA 1EY4A 2F0OA 5CV9A 3P1HA 3BDCA 4NDXA 2OF1A 5CV5A 4RKBA 3TP8A 5IGGA 4KY6A 4I65A 3NQTA 1EYDA 1NSNS 2F0EA 2PZTA 1A3TA 3DMUA 4ME5A 3TP6A 3VA5A 5IOCA 3H6MA 2SOBA 3NXWA 1SNCA 4DGZA 3TMEA 5C5LA 4YIJA 3RUZA 4G57A 5IGBA 1AEXA 1EZ8A 3D8GA 4NP5A 3TP5A 2EY5A 3MZ5A 5CV6A 4ODGA 5I6YA 2OXPA 4F7XA 3SK6A 5I9OA 2F0VA 3OSOA 3C1EA 3MEHA 4ID6A 3NHHA 2KQ3A 3T13A 2PW7A 1A2TA 4MIUA 1SNMA 2F0QA 2LKVA 3MVVA 4NKLA 5NUCA 5CV4A 1EZ6A 2PZWA 3EVQA 2EYLA 2NUCA 4S3SA 4WRDA 5CV8A 3HZXA 3OMGA 3TP7A 4K5XA 4KD4A 2F0PA 2EXZA 1SYGA 5DAUA 2EY6A 3MXPA 4K14A 1JOOA 5HURA 1ENAA 1F2ZA 1EY9A 1KABA 2F0FA 2F0IA 3EROA 1EY0A 1F2MA 2F3WA 2ENBA 3DHQA 3D6CA 5IIFA 4J6HA 3D4WA 4R8NA 3ITPA 4NMZA 4EQNA 5CC4A 3NP8A 1A3VA 4KY5A 1SNOA
chains in the Genus database with same CATH superfamily
3VDYA 2A19A 4YWLA 5M5WH 2KCNA 4KMUC 2F3VA 1D5XC 3U4ZA 1ZXTA 2KOLA 3QO2A 1OO9B 4IQZA 1PVOA 1CKMA 1RKNA 5H1SE 1BCPD 1Q81C 3I55A 3GTGH 3HOWH 4C1NI 5T1IA 5FOBB 1AP0A 2F0MA 2RCNA 4XDXA 3I56A 2NVYB 3Q24A 3DWQA 1TKWB 3PCOB 1ET9A 1U9RA 5JEAG 3M3YB 1N33L 3I7FA 4ILWA 2QGQA 4HTHA 1PH6A 5E4WC 2ZM6L 2D0OA 2XGTA 2WKCA 2VB2X 2UUCL 2F52A 1J8IA 4B3TL 4B9WA 2R7ZB 2WINB 1J5EQ 1D2BA 1E2WA 2VUMB 4RCNA 4V0BA 4L5TA 5HGTA 1OXVA 1KNAA 1EQVA 3X3NA 4EQOA 1UE7A 4FXDA 1X3EA 3RLFA 3C2PA 1G91A 4DV2L 1PLFA 3I4NH 1TS4A 2Z4HA 4IJHA 3QG1A 1VQFA 5GAHC 2VL6A 3H15A 3VR4A 5IY0A 4LF9L 3W1GA 4UHVA 5D65A 2NVXH 3PO2H 5CV5A 4DR4L 4L8JA 4BXXH 1HA6A 1S5CD 3TP6A 4C2MH 2OWOA 1OXUA 3RZDB 1B50A 3A5ZB 4A76A 1LM0A 1KLGD 4FF2A 5CV6A 1VQKA 2YTYA 2E2IB 2KQ3A 4GNXB 2ID0A 1OTCA 4LF4Q 3S1QB 1EFID 4GS3A 4WRDA 4LWCA 4G7HC 3I70A 2EXZA 3FPUB 4LUZA 1ICFB 1WFQA 3CQZH 5K36G 1JE5A 4HJ9A 1ENAA 4POGA 4X62Q 1F2MA 2JA7G 3CC7A 4JBJA 4A75A 5CC4A 3ITPA 4JI7Q 5LL6X 1I94Q 3VR3A 2PW5A 4AYBB 1ENFA 5JPMC 3RN5A 5IP9H 2R7FA 4EQPA 4A3EG 2JEAI 3HOVH 4FVMA 2L5TA 4C3IG 2Q8TA 2ZJQA 1I4PA 5DM63 1D7QA 1GD7A 1PH3A 5IT9c 4C3HG 4BBSB 5IT9E 4RGOS 4B3RQ 3NUCA 5KGUA 1VQ4A 4KJNA 1EIFA 1EIGA 3FPPA 4K5WA 3LGJA 5C4JB 1CM9A 1K0RA 2I5HA 4G4KA 2K05A 1CFMA 4LK1C 4JI4L 1IZ6A 1RL2A 3BZKA 3T4AC 1AE3A 1SFOH 1SYEA 4FF4A 1LT5D 3S2DB 2Y0SB 1YNXA 2MQHA 4A3GH 4F8MA 1PFBA 2SDFA 1WTRA 2JXMB 2E76C 1A0IA 2DJFC 1QNKA 5C0XJ 1STGA 4L5QA 3M7GA 2C9OA 1N36L 4PZ6A 5E7NA 4MTNA 2KBNA 2XWBB 4PV1C 2BOSA 2PMZB 1Y14B 4A3CH 2JJQA 3KDFA 1DJRD 4RKBA 2UUCQ 2AMCB 4IURA 1I50H 1YITA 4B3TQ 3PO3H 3H6MA 2UUBL 4JOIC 4O2DA 2NB0A 2K4KA 3TQYA 1G2TA 3K80C 2IL8A 3OSOA 4TVAB 4M1UB 2JA6G 2XNAC 1BCPC 3H0GG 4P2CB 1V8QA 2HHHL 3G6JB 5BN5A 1ILQA 2J4XA 3EVQA 4S3SA 5CV4A 2BA0A 2K32A 1HNWL 1SXTA 4KD4A 3ONAB 3RN2A 2X6LA 1XMOL 1GXDC 4KHPL 3KLRA 3BVMA 4X3KA 3VYTA 2UXCQ 1B53A 2TMPA 2ENBA 3D6CA 1Q12A 4ZUJA 4WORA 2LXJA 1PFMA 3BG3A 4LF5L 1STHA 1WCMB 4FXGC 3KBGA 2K75A 4HCEA 1XNQL 4PZ8A 1PYBA 3HOWG 4ZLTF 2WAQE 4DV6L 1IBKL 4LUOA 3DWAA 3CHBD 3RNUA 3A55A 4ABNA 1HH2P 4DKAC 3S16H 4A3MH 1GVPA 1XX8A 1BQQT 4CDEC 1TWGB 1NTGA 2L1BA 4L6TB 5KNCA 1XTDA 5JVH3 4IO9A 3EJIA 4CKBA 1O7LA 2ICIA 5C0XH 5IWAQ 1K3BC 1KL9A 3OHXC 4TRDA 2ATWA 4Z9CB 3FRPB 3F1ZA 3M4OB 3DEPA 5CMDA 5IGFA 1S5DD 2K5VA 5AFWA 2FINB 3N52A 2DGYA 1AZQA 1MGSA 2PQEA 1BNZA 3CW2C 3SGIA 4UPAA 3I4NG 3TDQA 1B2TA 3T1HQ 5TSSA 1EOTA 2JA9A 4GKKL 1WTHA 2E2JH 1SYDA 1XNRL 3EIVA 3PO2G 4CDCC 4OWTB 1HFGA 1LTSD 3LWEA 2F0WA 4BXXG 5DLQE 2H4OA 2F0JA 2WACA 2JA7B 1KAAA 1R9TH 5KYIA 3IKJA 3IL8A 4QMGA 1UWVA 3UDIA 4JI4Q 4KHZA 5JJKA 2IPKD 2A69D 1JJ2A 2I07B 3E0JA 3CD6A 1GO3E 3NQTA 5A35A 2I5LX 4A3EB 3DMUA 2D2CC 2R3ZA 4ME5A 1L0XB 1HHVA 4ME3A 4C3IB 2QCPX 3L9AX 1KAWA 5IGBA 5I9OA 2XRQD 3PUZA 2VQEQ 3S1MB 3T13A 4QIWE 2MO0A 4LFAL 1N36Q 2R93B 1G6PA 2G9DA 1HPCA 5DAUA 4XIGS 4JI8L 1TWAH 1PYSB 4FXKC 4JI6L 2JN4A 5IP9G 3T56B 3HOVG 1VQGA 4YCUA 3MC0B 2Q2HA 2UUBQ 4EQNA 2CQAA 3OWFA 2Z9HA 5CBEE 2AKWB 5IT9L 1L0YB 2HHHQ 3UDGA 4HIKA 1IBLQ 4KY7A 1AH9A 3K81C 3NTKA 4GLVB 2K5QA 2MP1A 2RKSA 2TSSA 3EBEA 4DV0Q 3AMUA 4OX9L 1XMOQ 4KHPQ 1BO0A 1FYCA 4B3SL 4XQQA 3A7LA 3G6EA 3M4YA 4O1NA 1EEFD 1KC8C 1K3RA 3RZOB 3QB3A 3OIQA 4JI5L 4AQYQ 1JB7A 4UP9A 2MJ8A 4LF5Q 4BS9A 2NVTB 3H3VH 4K6DA 3J81j 4QGUA 4NXNL 3S15B 1IBKQ 3H3VC 4BBRH 1STAA 2PYKA 5I6WA 5ISRA 4A3GG 4DR5L 4KHVA 1WVLA 3H0GB 3S17H 2R61A 1TIID 2CFMA 4OWWB 2K04A 3Q8DA 3IFTA 4PQXA 2EY1A 4PMCA 4B9XA 3J7AV 4A3CG 1N34L 1TWFH 5ELOA 4K6LA 3HOYH 1C4QA 1XPUA 5M5WB 2KUMA 4PZ7A 5EBCA 3SVMA 2K50A 3PQIA 3PO3G 3S14H 3E6ZX 4KV6A 1CKOA 2N49A 1F9QA 3M85A 2XN9C 3H91A 2OT2A 3GTGB 4KK7A 1TWCH 1VQPA 3HOWB 1VMPA 1KTKA 3E3XA 4A3KH 3TP5A 1LTID 1EIYB 2OXPA 4GOPB 1XNRQ 4DK6C 1LLRD 3TN2A 1CHQD 1SLJA 1DOLA 2JEBI 3WOEA 3MXPA 4DV1L 4GOPA 1TWGH 1PA6A 1Y69U 2UXBL 1EY9A 1I6HB 2K5WA 1XMQQ 3PUXA 1B3AA 3A8IE 4FF3A 4K0KL 5IODA 5KEEA 2MGSA 3CKIB 3A5UA 3GV3A 5F2DA 5JOBA 1VQ7A 4A3MG 3S1NH 3DXJC 2VUMG 1B7YB 5DM73 3I4NB 2J0TD 1BUVT 4P73A 4DAYB 1TS3A 5C0XG 3GD7A 2B2UA 3RD4A 2NVXB 4JI8Q 2BE5D 1D1IA 4JI6Q 4R4OA 3BS1A 3HOZB 4LAAA 1L0WA 4C2MB 2ZTEA 3NWSA 4EVOA 2HQEA 2K28A 4DF7A 4G7ZC 1LTBD 1STYA 3KK7A 2A69C 4BA2I 2Q8IB 1AFPA 5EKKA 4A3JH 4L5SA 3ULPA 4LF6Q 1LABA 1JB3A 2PNHA 3GDEA 3J80i 1HZ9A 2BCOA 4JVZA 1QZGA 3RR5A 4KKUA 4B3SQ 1VQAA 1HUMA 3GP7A 2LMCB 1V1PB 2VW9A 5ELCA 2RDFA 4EX5A 3CPWA 2HUGA 3S1MH 1K28A 4QJFA 5C5MA 1GUTA 4DUYL 5FKAC 5CBAE 4RAUC 1VQ9A 3HOVB 2CQOA 3UE1A 3HKZB 4ZUIA 4NXNQ 2VB3X 4OL7A 2OCEA 2HIVA 1P8LA 4AYBG 2XWJB 2QDLA 4OIKA 1SMXA 1NSNS 1F9PA 1ET6A 3HFZB 1HXYD 4L5RC 2AUJD 2HDMA 1IYVA 4XYOA 4YIJA 1Y8NB 3BU2A 3MZ5A 5I6YA 2B2TC 1VQIA 1K0SA 5J3BA 3MEHA 4N8X1 1CZGA 3PGZA 4MIUA 5FLXc 1ZEQX 2B2WA 3AQQA 3HZXA 1ESRA 1A62A 4RHSA 1WTXA 1G51A 2ZTDA 4FYDA 3L0OA 1Q46A 1Q3LA 1NJIC 3EN2A 3KJOA 3JAMc 1S5BD 1SFOB 4JW0A 3MXNB 1RCVD 2RSOA 3I2ZA 3S24A 2HCIA 3GTPH 2G5DA 1PFNA 2I46A 1B8AA 2F4VL 3B6YA 1KLUD 3MXNA 1B70B 4UP8A 2G9HD 1KQSA 3EFXD 5C3XA 1J6QA 2QF7A 2UXBQ 3KF6A 2WFWA 3BVZA 4M8AA 1X65A 1KRSA 3BZCA 1SNPA 1I50B 4QF4A 1EYAA 2WV6D 3T51B 3PO3B 5D3DA 2I0QA 4FO2A 1VDZA 4BBRG 4A3BH 2JQOA 3CC4A 1BCPB 3M4QA 2BDNA 2B3GA 3I3CA 1K9MC 2WB1E 4GN5A 4J8QA 3SEBA 2O5JC 4LW1A 5EPJA 3T53B 1QUQB 5I9PA 1KDBA 3PSIA 1PH8A 5ELEA 5IGEA 1PH4A 1CKNB 2KJXA 1FR3A 3HOYG 3HEJA 1PZJD 1E1TA 1Q1EA 3WOFA 4X3TA 4KD3A 1CI3M 1H9SB 4DR1L 3MFYA 1N32L 1X6OA 1SNDA 5EKIA 3MXGA 1KXLA 3OW7A 1N8RC 1II3A 4DAMA 1LTLA 2KEEA 3G7LA 2VS1A 3AFQA 5C3WA 1H9SA 1QJOA 4Y7NH 1R4QB 2L0CA 1WCMG 3CCQA 3S16B 4IFDJ 3IAYA 1I6HH 4Q5VA 1UE5A 4A3MB 3CCLA 2KCMA 3I8ZA 3NXWA 3I4LA 4AH6A 2DNCA 4WJWA 4DUYQ 1Q90A 1TY0A 5KNBA 2CWPA 4XQNA 2B29A 3NBHB 2BE5C 1S5ED 1U4RA 1F2ZA 2Z6KA 3A0JA 4KLKA 1RD9D 2MFIA 1MJEA 3HOZH 2UXCL 2D5DA 4A3IB 3NP8A 5GROA 1EU4A 3S1RH 4HEDA 1PXUA 2F1MA 3BYTB 3LX0A 2E2JB 4IZ8A 1CSQA 1LACA 1JORA 1SBBB 2JK8A 4ZKBB 2Y0SE 3NELA 1R9TB 5JJLA 1IL2A 3KLSX 3C1FA 4NXMQ 4GNXA 1EQTA 1F9SA 2Z1CA 5BN3A 2N88A 4MTKA 5C3EH 4HIMA 4A3JG 5IWAL 1VQLA 2QILA 1LT6D 1SAPA 3Q22A 2MHVA 1SSOA 4HAEA 4JC0A 3HOUH 1HQMC 3MA2B 1TY2A 5ELFA 3OYYA 2F4VQ 3SK4A 4IFDH 4HMJA 2B8FA 2EJMA 1L1OC 2PQAB 4LNQA 3M4PA 5LMNW 1NMFA 3GTJH 1TWHH 2R93G 3D4RA 1EU3A 1TWAB 4R4QA 4K8JA 4K8IA 3T1HL 4OXPA 5IYDH 5EKLA 3FP9A 3V05A 4B3ML 1D5ZC 1EL0A 1YHBA 2BA1A 1EFWA 5IYCH 1EOVA 4KN4C 2E75C 2EYHA 4KI0A 3OMCA 1PH2A 1LUZA 1PTOD 2XVSA 5G3LD 2ASBA 4DR6L 1YHQA 1NNXA 3P1HA 2L55A 4BY1B 5FO9B 1K8GA 1DONA 1S4ZA 4R1JA 1A3TA 1PH9A 5FLXL 4QCLA 4A3DH 1AEXA 1EZ8A 3D8GA 1IBML 4DR1Q 1M90C 1N32Q 2EQSA 2VQEL 1ZYRD 4ULLA 2LKVA 1EIHA 4FP5D 2FHTA 3JAML 2JYOA 2NZOA 3C46A 1S3OA 3J80c 4DV4L 4BBRB 2E2HH 3J80E 1E22A 2OQKA 3GQBA 3MXUA 1SJHD 2RSNA 3ND8A 5IGGA 1RODA 4KY5A 3S17B 4HIDA 4OWXB 2B2YA 2O5IC 1GHKA 2SNSA 2VZAA 4IPCA 1TWFB 2B2VA 5JJZA 3CU7A 3HOYB 1DCZA 1O7IA 4ZK9B 4DU9A 5KIXA 1IBLL 3TBIB 1WTQA 1AN8A 4DV0L 1LYLA 3S14B 4HN7A 4XTCS 4A3BG 1IYUA 3PIO3 4OEMB 2RDHA 4IOAA 1TWCB 3U9OA 1IHZA 3NE5B 4AQYL 1HUNA 4A3KB 4K2LA 1IKLA 5CYUA 2VQFQ 1DOMA 4MZ9A 4XT3B 1K73C 4YCVA 3QOJA 3D31A 2EYPA 3J7A5 2CH4W 3AB9A 2CWAA 1EWCA 1F9RA 3SDZA 2NN6H 2UXDL 3KLWA 4NPSA 1QOHA 3KF8B 1TS5A 4CJ1B 2KHIA 3HOXH 4GLXA 3H09A 3KJPA 5CGKA 4QB4A 5JPNC 5C44H 4CDDC 1LTTD 2P5ZX 3NBIA 1ASYA 3NK9A 4DK1A 3K57A 4CGYB 2NWGA 4TSSA 1AW7A 1VF7A 3S1NB 1KHIA 2B39A 4OO1H 4CHTB 5C4ZA 1EY4A 4JI3Q 3DM3A 4DN4M 1QB5D 4DNTB 4I65A 1O78A 5D3IB 2F0EA 4C1NK 4A3IH 3AEVA 2K6AA 4F88A 4IOCA 4DGZA 3RUZA 2GVAA 3JAMi 1TXYA 4NP5A 1OXXK 3Q6SA 4XT1B 4B3MQ 4ODGA 2K14A 1CHPD 1F2LA 4HJ7A 3PF4A 2E8GA 1ICWA 4JCVE 1U5KA 1YEZA 2NTSA 3MVVA 3SK5A 1CA6A 3HOZG 1GUGA 4OELB 1MSHA 1N9WA 3TEHB 4DR6Q 4A3JB 2JP1A 1JOOA 2PO4A 1CZWA 1U4MA 2IHFA 1EY0A 3CMAA 4G7OC 1HA5A 2FMCA 3DHQA 5IIFA 2CVRA 1XMQL 3ULLA 2DN8A 3LNNA 4V190 2EJGC 4MNOA 3K58A 3Q23A 1IBMQ 3STBD 4GLAC 3K59A 4WFN3 3I91A 4QUFA 2F0DA 4A3FB 4IUUA 1PRTB 5C3EG 3WDNA 4DV4Q 1R4PB 4RKLA 2JA5H 1A3UA 1NUCA 1AE2A 2RDGA 3HKZG 3V96A 1VQJA 2BDOA 4R4IA 3HOUG 5LL6S 3RMHA 1ASZA 1PTOH 2IWHA 4DAVA 4IFDG 2Z8LA 1H9KA 1K83H 3VR2A 2EOTA 1JWMD 1GHJA 1SE2A 1HNZQ 1RDPD 1PTOC 1VQ8A 3HGBA 2HQLA 3F8TA 3HS0C 1Y1VH 1M4VA 1EQQA 1E7ZA 3TSSA 5E3FA 4LF6L 5IYDG 4BY1H 2DY8A 2QDBA 1H9JA 4JV5Q 4JYAL 3T16A 4HR7B 1HTPA 4RWSC 5IYCG 4X3SA 1PDQA 2F3IA 1O7ZA 1ZYRC 1YI2A 3A8JE 4IUQA 4EQ5A 1PYWD 3VYUA 1QE6A 5A2QL 3SHLA 4DK0A 5C0XI 1JWUD 1BCPF 4AIMA 3GTPB 2WIIB 3R2IA 5KRUA 1HQRD 2F0TA 1HJPA 1HNXQ 2K7VA 1GUSA 2F0OA 5D14A 4A3DG 1PFSA 2UXDQ 2JA8H 3AFPA 1CQFA 2A6HD 2WKDA 3I73A 3S2HH 1JICA 1Z47A 3I90A 3SE0A 4U673 2H1EA 1LT4D 5GQOA 5BR8Q 2EY5A 2XRSD 5I2YA 4R4TA 3J80L 1XTCD 4Q0FA 3U50C 1VCIA 4A3BB 1GKHA 1Y1WH 1DD2A 2PZWA 4KKSA 3X3MA 1X56A 2OTJA 3OTOQ 3CP0A 5ELDA 1GJXA 4B08A 3GTLH 3E9IA 4QIWB 3R93A 4WJ4A 4O0AA 3K5LA 4X66Q 5FO8B 4UP7A 1ESFA 1Q82C 3DEOA 3K0XA 3NTHA 3U9SA 4P72A 1PH7A 1SEBD 2K52A 5I4DA 4HJAA 4UDUC 4JPBW 4OIJA 1A2UA 3DUZA 1MKHA 2YV5A 2EJFC 4RGNA 3F2CA 2EYOA 4N9PA 1I4HA 2FJ2A 4IALA 5CR3A 1HR0W 1V1QA 1VQ5A 4Y7NB 4LF7Q 4ZYSA 2J7ZA 4RGTA 1QWYA 2EDGA 4K2KA 5DEHA 1S5FD 2OEOA 1E2ZA 4CJ0B 1B9NA 1KDAA 2A8VA 2UU9Q 2NN6G 1O7YA 1JCKB 2DY7A 3K7AH 2V1CC 4GN4B 1V1OA 1W6KA 3GTOH 1OXSC 3BJUA 1JR0D 1D5MC 3D0FA 2A1AA 3A8KE 5L37A 5IP7H 3K0YA 1X32A 4DR3Q 3SK8A 1STBA 5K5PA 2CKZB 4QUCA 1IYJB 4KJOA 3UDFA 4OO1G 3NPPA 4LF8Q 2GN5A 4DAYA 2F0KA 5IYBH 5M9OA 1E1OA 1FGBD 3TZDA 4DK3C 4UAIA 3S1RB 1WOCA 1VQMA 2F0HA 4A3IG 3H3VI 2R92B 2FFKB 1WYDA 1EWIA 4JI0Q 3QWNA 1FGUA 1Z6HA 4FNFA 5KNDA 4JYAQ 2PNRC 1ONLA 2IX3A 1SNCA 1B4OA 5EPKA 3STBC 2EXDA 1IKMA 2NYZD 2WP8J 2ZXPA 3QIAA 4H0LC 5C3EB 1K8MA 4H44C 3C3LA 1SRUA 1YZ6A 4A3FH 2NUCA 2ZXRA 1HCZA 4JK1C 5CV8A 1XXGA 1V1PA 3QJYA 3HOUB 1L1OB 1FNUA 3MAQA 4APVA 1SMYD 2L12A 1H9RA 2NTTA 4GKJQ 1DXMA 2AQ2B 3GTJB 1TWHB 2HCCA 1SNOA 1QVGA 1STNA 4C3HH 1DOKA 2AQ1B 3BDLA 2YTXA 1UE6A 5LMUQ 3URYA 1RTNA 4LJZC 5FK9C 2M00A 1PV4A 4MHEA 1I3QH 2QEJC 3PIOA 5EBDA 3CAMA 3RLNA 1C0AA 5FLXE 2EIFA 1XJVA 4NXML 3TRZA 3OOCA 3J81i 4XXEA 4CJ2C 4DPGA 1Y1VG 1BBWA 3T1YL 2LS01 5GADC 3JAME 4KKTA 4A3DB 4BY1G 3TS0A 1TT2A 4PMBA 4YCWA 4RG1A 1T5EA 1VMCA 2EY2A 1LTRD 2Q2IA 1UE1A 2A6HC 3D3RA 1YNND 1MSGA 1QNUA 4C3JH 1ENCA 5FJ8H 3JC66 3FHWA 3W2DA 1NCVA 1CUKA 2E2HB 2Z4IA 1M8AA 5IGDA 1HZBA 5ELNA 3I4MH 1TU2B 4HJ8A 4OHJA 3A54A 2JA8G 1WD1A 3K5MA 1EQRA 4JOIA 5COYA 1BKBA 3CCMA 3P20A 3L3OC 2JA6H 1LT3D 3GTQH 1ILPA 2A5HA 3FKIH 5AJ3L 2AHOB 4DV7L 5M5YH 2M2LA 3VR5A 3VA5A 2K5DA 1QUQA 2A73B 4DAPA 4R8IA 1MHWC 1CQVA 1GM5A 4F7XA 2KECA 5HGQA 3NHHA 1I4XA 2ZJPA 1CKNA 2QA4A 4J15A 5NUCA 4LUVA 4NKLA 1BVSA 2L11A 2F0PA 3U58A 2YU9H 4A3KG 4AYBE 1X3QA 2F0IA 1EYGA 1Q86C 2Z6BA 1EUJA 2XTIA 3HOXB 1BR9A 3MTSA 1QVFA 1YNJD 4GOPC 1XPOA 5T1GA 2VNUD 1JOKA 5ELBA 1L2FA 5C44B 3HKSA 4RH6A 1G8ZD 4RMFA 1G2SA 1SYCA 1SYBA 2NZ1D 5EAYA 4EGVA 3KFUA 2CW0D 1B44D 1F2YA 1RF2D 3WWVA 2DJGC 4JI1Q 1CSPA 2VY3A 1TS2A 4K5VA 1VQBA 1EEID 2KHSA 4X3UA 2ZTCA 3NBHA 4J1MA 5J1ZA 2CH4A 1SDFA 1EY6A 3PMFA 2B2UC 2VQFL 2GA4B 5IP7G 2R92H 4A93H 1C9OA 2X69A 2AUKA 3E5SA 2Q2TA 4WJ3M 3PV0A 3GTMH 2QEXA 1HTLD 2N8NA 1TVXA 2QKIC 5LMNL 5IYBG 1PRTF 3PIPA 2WB1B 3QR8A 5JVG3 2LY7A 3GO5A 4XQJA 3NENA 5CV7A 4MN3A 3P7JA 2PMZE 3R2TA 3T1YQ 4BY7H 3OPOA 2OQ0A 5C6AA 4DV3Q 4A3LH 5C4XH 1JOQA 3PUVA 4KN7C 1UUPA 2Q8RE 3IFDA 3D4DA 1VQCA 2A74C 3GTKB 3GV6A 1SNQA 1LTGD 1YJ9A 3HRZC 1SMYC 1NR4A 3TS2A 2PCFB 4FF1A 4JI3L 2R7DA 2RHQB 3CC2A 4OGQC 2ES2A 2E5LL 4NB3A 4QL5A 1VS0A 4IJLA 3NQIA 2ZT9C 4TQUS 5C5LA 3CXCA 3AYHB 4A3FG 1QZHA 2JA5B 1NMGA 2PQAA 3K6OA 4ID6A 5M3FH 4PG3A 1PTOB 2C5CA 3J7YW 4OONA 2WAQG 4LFBQ 1K83B 1SNMA 3KYHC 3OMGA 1FD7D 1Y1VB 1KNEA 1VQEA 2B63H 2LSSA 1JC7A 2E2DC 1J9OA 5AJ3Q 2ZXOA 2SEBD 4DV7Q 5A2QE 1VQHA 4J6HA 3D4WA 2B2WC 4NMZA 2XIWA 1A3VA 2YTVA 2F0NA 2HT1A 1NR2A 1EY7A 3FDTA 3ERSX 4IPHA 4DFAA 1YNNC 1PH5A 1K8AC 1DZ1A 5M3MH 1QCBD 4IPGA 1BOSA 4POFA 3MHBA 1GUOA 3A74A 4QY7A 1WTWA 2JA8B 4UY8C 4CBVA 4DXFA 4ZQ3A 3S2HB 1YIJA 2A6ED 2KCTA 3ZJYC 1D6EC 2EPBA 3KDFB 2K01A 4P75A 4C3JG 4ZKCB 2BH8A 3R8BA 5FJ8G 1C7YA 1HNZL 2MPMA 4F87A 3G4SA 1N33Q 2NVQB 4JI2L 4CKEA 4DNIA 2OTLA 1HFNA 2IX1A 4HCSA 1Y1WB 4DA2A 1JJCB 3H94A 4DNRB 1JT8A 2ZM6Q 2X6GA 4IUPA 3LWUA 2ALYB 4JV5L 3I4MG 3PUYA 1DGSA 3GTLB 1BF4A 1X55A 2UUAL 2DNEA 2GVBA 2FXQA 4DV2Q 1TR5A 5JAVA 3FKIG 2IT1A 2RBMA 4ZRZA 2D0PA 1HNXL 4LF9Q 1C48A 1V9PA 4DV5L 4DR4Q 2HIXA 4IFDI 5LMNQ 1EYDA 3J81c 1X3FA 3ULJA 1YNJC 2NVYH 2SOBA 3J81E 4HIOA 1RTOA 1RHPA 5M5XB 2Z0SA 5BR8L 3MEFA 3VR6A 3M3YH 4I7ZC 4CDFC 4LFCL 1CTMA 3KF8A 1W6JA 1WI5A 3Q0AA 4YHHL 1MBYA 4ALPA 1EZ6A 2KENA 3NEMA 2CW0C 2NZHA 3F2DA 3K7AB 4K5XA 3OTOL 5EPLA 2M9VA 2R7ZH 2ZJRA 2VUMH 2D9UA 3GTOB 1KABA 2RCFA 4X66L 2E5LQ 1RIPA 5GAGC 1WTPA 1UEAB 1KDCA 1X3GA 4X65L 3M9BA 1X54A 2E74C 2CHBD 3CCVA 3CCRA 1W2BA 2Z6KC 3UI2A 1SE3A 2F4IA 1FJGL 1LV9A 3NWTA 1VQDA 1I5FA 3TREA 1STEA 1K8OA 4FDBA 2IJ0A 3ND9A 5IGCA 1S40A 2L9HA 4LF7L 3RZDH 4PNYA 1V43A 4A4IA 4GN3B 2R92G 2RA4A 4A93G 3R3OA 3UE0A 3W1BA 1Z7TA 3CCEA 2E2IH 1Y8OB 2LXKA 3S1QH 3D6WA 2UU9L 3L2PA 2Q2UA 1KIXA 3CCSA 1W3SA 3GTKH 3L7ZC 4GNXC 2MO1A 3V2TA 2V4DA 4IPDA 4BA1I 4XYQA 2XSCA 1PHJA 1B3QA 1HZCA 2EE1A 2F0UA 1ML0D 4BY7G 3E9HA 1Z9FA 4A3LG 2H5XA 5C4XG 5EJWA 3CCUA 1U0LA 2K1BA 2SNMA 4DR3L 2BH2A 2WAQB 3PF5A 4QQBX 1YVCA 5E1FA 2RF4A 1A6XA 3ZYYX 5C4HA 4LF8L 4HMIA 2HD3A 4C3HB 2IHEA 1IW7D 1XYIA 3BYYB 1YJNA 2K33A 4DUZL 2CCZA 1I3QB 2O2LD 1Q8KA 4JI2Q 2L15A 1DM0B 2O4XA 5HY6A 3FVQA 4BBSH 1C8CA 3K8AA 2B2TA 3A7AB 4NDXA 2KEDA 4JI0L 5E4XA 4C56C 3TP8A 4KY6A 1Y8PB 1P16A 2NN6I 4H13C 3KLSA 5M3FG 4X6AH 1PRTD 1B9MA 4RGMA 5JEAJ 5C4JH 4PMWA 3TMEA 3I72A 2UUAQ 1IXRA 1BBXC 3PIP3 2B63G 4DR7L 2K5NA 2AWNA 4P74A 1D1KA 2ICEC 3EA6A 3TP7A 1HNWQ 5DNFA 2EY6A 1BDOA 3CPFA 4OO1I 3HG9A 5HURA 4DV5Q 3CMEA 3S2DH 4C3JB 2YYZA 2A6EC 2K5HA 4RCOA 1M1KC 1FL0A 3OWEB 4GKJL 3ER0A 5M3MG 2R6GA 5FLMH 1Q7YC 5LMUL 1EYCA 5BN4A 1I4GA 3K5NA 3DWPA 1XNQQ 4LFCQ 3I4MB 2NVQH 2IY5B 3OIPA 5CORA 4YHHQ 3BDOA 4DV6Q 3DM1A 3CF5A 2PI2E 2B2YC 1FNVA 3VA7A 1FNWA 1HR0L 2A68D 2EYFA 4DR2L 5IE8A 2JA6B 3GTQB 1MJCA 1Q1BA 3G71A 2B2VC 2F0SA 4JBMA 3FKIB 5M5YB 1GUNA 1NE3A 2EYMA 4X65Q 1SJED 5J39A 1ZKOA 1O80A 1Q8IA 4YY3L 4O42A 4P71A 3IRBA 1X3PA 1FJGQ 2NBFA 2N3SA 3TZUA 5J22A 1JJGA 1F77A 3W5OA 2EZVA 1SR3A 4H02A 2PZUA 5JEAH 1JMCA 3FMCA 4R9WA 3P75A 2YU9B 1EY8A 1SYFA 1CT1D 5M5XH 2N55A 4IUVA 3HKZE 3KUPA 1WCMH 4GKKQ 4GZYC 3F2UA 1KRTA 2EVBA 4X64L 1T9HA 2KA7A 4N9TA 3J81L 2RVLA 5EGTA 3MWYW 1HZAA 4YWMA 1JE4A 4CKCA 3HOXG 3NSWA 2C35B 3RLOA 3KOJA 1EWHA 2FMMA 5IOCA 5C44G 1WTVA 4ZCKA 2B8GA 1DYQA 4IUTA 3CRLC 3AU7A 1JQYD 3K7UC 4L63B 3CCJA 1NBWA 2R7ZG 2K03A 4N8FA 3M4OH 2RQXA 3U4VA 4LFAQ 1XPRA 2F0QA 4LMQD 1VQOA 2EYLA 4DUZQ 1CK1A 1VQNA 3HP3A 2RHSB 1B1ZA 2QW7A 1SE8A 1SYGA 2PI2A 4A93B 3I4OA 2JSOA 3PO2B 3N6RA 2F0FA 3EROA 3FEWX 3G48A 3GTMB 2MUYA 2HDLA 3NTIA 4Y52H 4NW2A 2L4NA 4I7AA 5K36H 3K5OA 1H9MA 1S72A 1U4LA 3BVGA 3VYSA 1YHAA 3ERQA 2WB1G 4TKOB 2JA7H 4BY7B 4RFBA 4DR7Q 5C4XB 1PTOF 1SROA 5G3LF 1I6VC 1JWSD 2F0LA 2EYJA 3EQLC 2F03A 1UAPA 1LTAD 1KD1C 4A3EH 4KTAA 4OX9Q 4HSPA 3CQZB 1G6ZA 1I4RA 1PZKD 1J5EL 4HSVA 4C3IH 4JI1L 1RJTA 4E6IA 4H7BA 1NY4A 3F2BA 1GOZA 3PUWA 1E2VA 3DLLA 1IW7C 3MFGA 3BZDB 3A56A 4JI5Q 1L1OA 1QILA 2KVMA 1UNSA 2R93H 1TQOA 1MIUA 4ZAIA 1A63A 1CA5A 1YBYA 5GAEC 5M3FB 4DXGA 2JA5G 1AZPA 1WJJA 3S9WA 1OXTA 1U4PA 1PRTC 3QOLA 4R4CA 4DR5Q 5KYLA 1HR0Q 1A8VA 2I5MX 1MI2A 1LO5D 1D8LA 4DR2Q 1PZID 2JE6I 2B63B 1SN8A 1E24A 1VF5C 3OW2A 1FVIA 3SXHA 1IL8A 1PMRA 4JG2A 2F0GA 2D62A 1A15A 1X9NA 2VXWA 4BBSG 4DV3L 1N34Q 1EY5A 3CRKC 1BXTA 4LF4L 1HRJA 3SR1A 1MD2D 3M7NA 1UEBA 3J7AF 4IUNA 2LFNA 4YY3Q 2MNAA 2AQ3B 1I4QA 5CV9A 2PPBC 5LHY1 3BDCA 5M3MB 2OF1A 1BBUA 3UDXA 4BWGB 2KCCA 4X62L 1WD0A 3O13A 1WTOA 2IX0A 2PZTA 1VQ6A 1XWEA 3RZOH 4JI7L 3E0EA 3W3AA 1I94L 5JJIA 4G57A 1GUWA 4RA8A 2DUDA 2NVTH 4IN3A 3SK6A 4A3GB 1E3PA 2F0VA 3C1EA 4U68A 2IW3A 3S15H 3KF6B 4X64Q 2PW7A 5EQ0A 3VYRA 4LFBL 4HJ5A 1A2TA 1SE4A 3KBXA 3J7ZC 2Y0SG 1PH1A 2A68C 5FO7B 4YWKA 1NAPA 4JBWA 1YJWA 2AWOA 1T5XD 4K14A 4DV1Q 5FLMG 3H0GH 1QG7A 1H95A 4B3RL 2N78A 1G291 2KHJA 4JBKA 1E0BA 4RHRA 3ICEA 4R8NA 1QVCA 5I2XA 1Y1WG 2F3WA 4K0KQ
chains in the Genus database with same CATH topology
2KCNA 4KMUC 2F3VA 1D5XC 1ZXTA 2KOLA 3QO2A 1OO9B 4IQZA 1RKNA 1BCPD 4C1NI 5T1IA 5FOBB 1AP0A 2F0MA 4XDXA 2NVYB 3Q24A 3DWQA 1TKWB 1ET9A 1U9RA 5JEAG 3M3YB 4ILWA 4HTHA 5E4WC 2WKCA 2VB2X 1J8IA 4B9WA 2R7ZB 2WINB 1D2BA 1E2WA 2VUMB 4RCNA 4V0BA 5HGTA 1OXVA 1KNAA 1EQVA 3X3NA 4EQOA 4FXDA 3RLFA 3C2PA 1G91A 1PLFA 1TS4A 2Z4HA 3QG1A 3VR4A 5D65A 5CV5A 4L8JA 1HA6A 1S5CD 3TP6A 1OXUA 3RZDB 1B50A 1KLGD 4FF2A 5CV6A 2E2IB 2KQ3A 2ID0A 3S1QB 1EFID 4WRDA 4G7HC 3I70A 2EXZA 3FPUB 5K36G 1ENAA 1F2MA 5CC4A 3ITPA 5LL6X 3VR3A 2PW5A 4AYBB 1ENFA 5JPMC 4EQPA 2JEAI 4FVMA 2L5TA 4C3IG 2Q8TA 1I4PA 5DM63 4C3HG 4BBSB 5IT9E 4RGOS 3NUCA 5KGUA 4KJNA 1EIGA 3FPPA 4K5WA 5C4JB 1CM9A 4G4KA 2K05A 1CFMA 4LK1C 3T4AC 1SYEA 4FF4A 1LT5D 3S2DB 2Y0SB 4F8MA 1PFBA 2SDFA 1WTRA 2JXMB 2E76C 1QNKA 5C0XJ 1STGA 3M7GA 2C9OA 2XWBB 4PV1C 2BOSA 2PMZB 4RKBA 1DJRD 4IURA 3H6MA 2NB0A 1G2TA 2IL8A 3OSOA 4M1UB 2XNAC 1BCPC 4P2CB 1V8QA 3G6JB 5BN5A 1ILQA 5CV4A 2J4XA 3EVQA 4S3SA 2BA0A 2K32A 1SXTA 4KD4A 3ONAB 2X6LA 1GXDC 3KLRA 3BVMA 4X3KA 3VYTA 1B53A 2TMPA 2ENBA 3D6CA 1Q12A 4ZUJA 4WORA 3BG3A 1PFMA 1STHA 1WCMB 3KBGA 4FXGC 4HCEA 4ZLTF 3DWAA 3CHBD 3A55A 4ABNA 1XX8A 1BQQT 1TWGB 2L1BA 4L6TB 5KNCA 5JVH3 3EJIA 4CKBA 1O7LA 2ICIA 5C0XH 3OHXC 4TRDA 4Z9CB 3FRPB 3M4OB 3DEPA 5CMDA 5IGFA 1S5DD 5AFWA 2FINB 3N52A 1AZQA 1MGSA 2PQEA 1BNZA 3TDQA 1B2TA 5TSSA 1EOTA 1SYDA 1HFGA 1LTSD 3LWEA 2F0WA 2H4OA 2F0JA 2WACA 2JA7B 1KAAA 5KYIA 3IKJA 3IL8A 4QMGA 4KHZA 2IPKD 2A69D 2I07B 3E0JA 3NQTA 5A35A 4A3EB 3DMUA 2D2CC 2R3ZA 4ME5A 1L0XB 1HHVA 4C3IB 2QCPX 3L9AX 5IGBA 5I9OA 2XRQD 3PUZA 3S1MB 3T13A 2R93B 2G9DA 1HPCA 5DAUA 4XIGS 4FXKC 3T56B 3MC0B 4EQNA 2CQAA 3OWFA 5CBEE 5IT9L 1L0YB 4KY7A 3NTKA 2K5QA 2MP1A 2RKSA 2TSSA 3AMUA 1BO0A 1FYCA 4XQQA 3A7LA 3M4YA 4O1NA 1EEFD 3RZOB 3QB3A 3OIQA 2MJ8A 4BS9A 2NVTB 4K6DA 3S15B 3H3VC 1STAA 2PYKA 5I6WA 5ISRA 4KHVA 1WVLA 3H0GB 2R61A 1TIID 2K04A 3IFTA 4PQXA 2EY1A 4PMCA 4B9XA 3J7AV 4K6LA 1C4QA 5M5WB 2KUMA 5EBCA 3SVMA 3E6ZX 4KV6A 1F9QA 3M85A 2XN9C 3H91A 2OT2A 3GTGB 4KK7A 3HOWB 1VMPA 1KTKA 3TP5A 1LTID 2OXPA 1LLRD 3TN2A 1CHQD 1DOLA 2JEBI 3WOEA 3MXPA 1Y69U 1EY9A 1I6HB 2K5WA 3PUXA 1B3AA 3A8IE 4FF3A 5IODA 5KEEA 2MGSA 3CKIB 3GV3A 5F2DA 5JOBA 3DXJC 5DM73 3I4NB 2J0TD 1BUVT 1TS3A 5C0XG 3GD7A 2B2UA 3RD4A 2NVXB 2BE5D 1D1IA 3BS1A 3HOZB 4LAAA 4C2MB 3NWSA 4EVOA 2HQEA 2K28A 4DF7A 4G7ZC 1LTBD 1STYA 3KK7A 2A69C 4BA2I 2Q8IB 1AFPA 5EKKA 1LABA 1JB3A 2BCOA 4KKUA 3GP7A 1HUMA 2LMCB 1V1PB 5ELCA 2RDFA 2HUGA 5C5MA 1GUTA 5FKAC 5CBAE 4RAUC 3HOVB 3HKZB 4ZUIA 2VB3X 4OL7A 2XWJB 4OIKA 1NSNS 1F9PA 1ET6A 1HXYD 1IYVA 2AUJD 2HDMA 4XYOA 4YIJA 1Y8NB 3MZ5A 5I6YA 2B2TC 3MEHA 1CZGA 4MIUA 1ZEQX 2B2WA 3HZXA 1ESRA 4RHSA 1WTXA 4FYDA 1Q3LA 1S5BD 1SFOB 1RCVD 2RSOA 2HCIA 1PFNA 2I46A 1KLUD 3MXNA 2G9HD 3EFXD 5C3XA 2QF7A 3BVZA 4M8AA 1SNPA 1I50B 4QF4A 1EYAA 2WV6D 3T51B 3PO3B 5D3DA 4FO2A 1VDZA 1BCPB 2BDNA 3I3CA 4J8QA 3SEBA 2O5JC 5EPJA 3T53B 5I9PA 1KDBA 5ELEA 5IGEA 2KJXA 1FR3A 3HEJA 1PZJD 1Q1EA 3WOFA 4X3TA 4KD3A 1CI3M 1H9SB 3MFYA 1SNDA 5EKIA 3MXGA 3OW7A 1II3A 2KEEA 3G7LA 5C3WA 1H9SA 1QJOA 1R4QB 2L0CA 3S16B 4IFDJ 3IAYA 4Q5VA 4A3MB 3I8ZA 3NXWA 3I4LA 2DNCA 4WJWA 1Q90A 1TY0A 5KNBA 4XQNA 2BE5C 1S5ED 1U4RA 1F2ZA 1RD9D 2D5DA 4A3IB 3NP8A 1EU4A 4HEDA 1PXUA 2F1MA 3BYTB 3LX0A 2E2JB 4IZ8A 1LACA 1JORA 1SBBB 4ZKBB 1R9TB 3KLSX 3C1FA 1EQTA 1F9SA 2Z1CA 5BN3A 2N88A 2QILA 1LT6D 1SAPA 3Q22A 2MHVA 1SSOA 4HAEA 1HQMC 3MA2B 1TY2A 5ELFA 3SK4A 4IFDH 4HMJA 2B8FA 2EJMA 3D4RA 1EU3A 1TWAB 4K8JA 4K8IA 5EKLA 3V05A 1EL0A 1D5ZC 2BA1A 4KN4C 2E75C 2EYHA 4KI0A 3OMCA 1PTOD 2XVSA 5G3LD 3P1HA 2L55A 4BY1B 5FO9B 1DONA 1S4ZA 1A3TA 5FLXL 4QCLA 1AEXA 1EZ8A 3D8GA 1ZYRD 4ULLA 2LKVA 1EIHA 4FP5D 2FHTA 3JAML 2JYOA 3C46A 4BBRB 3J80E 3GQBA 3MXUA 1SJHD 2RSNA 3ND8A 5IGGA 1RODA 4KY5A 3S17B 2B2YA 2O5IC 1GHKA 2SNSA 1TWFB 2B2VA 5JJZA 3CU7A 3HOYB 1DCZA 4ZK9B 5KIXA 4DU9A 3TBIB 1WTQA 1AN8A 3S14B 4HN7A 4XTCS 1IYUA 3PIO3 2RDHA 1TWCB 3U9OA 1IHZA 3NE5B 1HUNA 4A3KB 4K2LA 1IKLA 5CYUA 1DOMA 4XT3B 3QOJA 3D31A 2EYPA 3AB9A 1EWCA 1F9RA 3SDZA 2NN6H 1QOHA 1TS5A 4CJ1B 3H09A 5CGKA 4QB4A 5JPNC 1LTTD 3NBIA 3NK9A 4DK1A 3K57A 4CGYB 2NWGA 4TSSA 1AW7A 1VF7A 3S1NB 2B39A 4OO1H 4CHTB 5C4ZA 1EY4A 4DN4M 1QB5D 4DNTB 4I65A 1O78A 5D3IB 2F0EA 4C1NK 2K6AA 4F88A 4DGZA 3RUZA 4NP5A 1OXXK 3Q6SA 4XT1B 4ODGA 1CHPD 1F2LA 1ICWA 2NTSA 3MVVA 3SK5A 1CA6A 1GUGA 1MSHA 4A3JB 2JP1A 1JOOA 2PO4A 1CZWA 1U4MA 1EY0A 4G7OC 1HA5A 2FMCA 3DHQA 5IIFA 2CVRA 2DN8A 3LNNA 4V190 2EJGC 3K58A 3Q23A 3K59A 4WFN3 3I91A 4QUFA 2F0DA 4A3FB 4IUUA 1PRTB 3WDNA 1R4PB 4RKLA 1A3UA 1NUCA 2RDGA 3V96A 2BDOA 5LL6S 3RMHA 1PTOH 2IWHA 4DAVA 4IFDG 2Z8LA 1H9KA 3VR2A 2EOTA 1JWMD 1GHJA 1SE2A 1RDPD 1PTOC 3HGBA 3HS0C 1M4VA 3TSSA 5E3FA 2DY8A 2QDBA 1H9JA 3T16A 4HR7B 1HTPA 4RWSC 4X3SA 1PDQA 1O7ZA 1ZYRC 3A8JE 4IUQA 1PYWD 3VYUA 1QE6A 5A2QL 3SHLA 4DK0A 5C0XI 1JWUD 1BCPF 3GTPB 2WIIB 3R2IA 5KRUA 1HQRD 2F0TA 2K7VA 1GUSA 2F0OA 5D14A 1CQFA 2A6HD 2WKDA 3I73A 1JICA 1Z47A 3I90A 3SE0A 4U673 2H1EA 1LT4D 2EY5A 2XRSD 5I2YA 3J80L 1XTCD 4Q0FA 1VCIA 4A3BB 1DD2A 2PZWA 4KKSA 3X3MA 5ELDA 1GJXA 4B08A 4QIWB 3R93A 3K5LA 5FO8B 1ESFA 3DEOA 3NTHA 3U9SA 1SEBD 5I4DA 4UDUC 4OIJA 1A2UA 3DUZA 2EJFC 4RGNA 2EYOA 4N9PA 1I4HA 2FJ2A 4IALA 5CR3A 4Y7NB 4ZYSA 2J7ZA 4RGTA 1QWYA 2EDGA 4K2KA 5DEHA 1S5FD 2OEOA 1E2ZA 4CJ0B 1B9NA 1KDAA 2NN6G 1O7YA 1JCKB 2DY7A 1V1OA 1W6KA 1OXSC 1JR0D 1D5MC 3A8KE 3K0YA 1X32A 3SK8A 1STBA 5K5PA 4QUCA 4KJOA 4OO1G 3NPPA 4DAYA 2F0KA 5M9OA 1FGBD 3TZDA 4UAIA 3S1RB 2F0HA 2R92B 2FFKB 3QWNA 1Z6HA 4FNFA 5KNDA 2PNRC 1ONLA 2IX3A 1SNCA 1B4OA 5EPKA 1IKMA 2NYZD 2WP8J 2ZXPA 3QIAA 4H0LC 5C3EB 1K8MA 4H44C 3C3LA 2NUCA 2ZXRA 1HCZA 4JK1C 5CV8A 1XXGA 1V1PA 3QJYA 3HOUB 1FNUA 3MAQA 1SMYD 2L12A 1H9RA 2NTTA 1DXMA 2AQ2B 3GTJB 1TWHB 2HCCA 1SNOA 1STNA 1DOKA 2AQ1B 3BDLA 3URYA 1RTNA 4LJZC 5FK9C 2M00A 4MHEA 2QEJC 5EBDA 5FLXE 3OOCA 4XXEA 4CJ2C 2LS01 3JAME 4KKTA 4A3DB 1TT2A 4PMBA 1T5EA 1VMCA 2EY2A 1LTRD 2A6HC 3D3RA 1YNND 1MSGA 1QNUA 1ENCA 3W2DA 1NCVA 2E2HB 2Z4IA 1M8AA 5IGDA 1TU2B 4OHJA 3A54A 1WD1A 3K5MA 5COYA 3P20A 3L3OC 1LT3D 1ILPA 2A5HA 2M2LA 3VR5A 3VA5A 2K5DA 2A73B 4DAPA 4R8IA 1CQVA 4F7XA 2KECA 3NHHA 1I4XA 5NUCA 4NKLA 2L11A 2F0PA 1X3QA 2F0IA 3HOXB 1BR9A 3MTSA 1YNJD 5T1GA 2VNUD 1JOKA 5ELBA 5C44B 4RH6A 1G8ZD 1G2SA 1SYCA 1SYBA 2NZ1D 4EGVA 2CW0D 1B44D 1F2YA 1RF2D 1TS2A 4K5VA 2KHSA 1EEID 4X3UA 3NBHA 4J1MA 5J1ZA 3PMFA 1SDFA 1EY6A 2B2UC 2GA4B 2X69A 2AUKA 3E5SA 3PV0A 1HTLD 2QKIC 1TVXA 1PRTF 2WB1B 5JVG3 2LY7A 3GO5A 4XQJA 5CV7A 4MN3A 3P7JA 3R2TA 3OPOA 5C6AA 1JOQA 3PUVA 4KN7C 1UUPA 2Q8RE 3IFDA 3D4DA 2A74C 3GTKB 3GV6A 1SNQA 1LTGD 3HRZC 1SMYC 1NR4A 2PCFB 4FF1A 4OGQC 3NQIA 2ZT9C 4TQUS 5C5LA 2JA5B 3K6OA 4ID6A 3J7YW 1PTOB 2C5CA 1K83B 1SNMA 3OMGA 1FD7D 1Y1VB 1KNEA 1JC7A 2E2DC 1J9OA 2ZXOA 2SEBD 5A2QE 4J6HA 3D4WA 2B2WC 4NMZA 2XIWA 1A3VA 2F0NA 1NR2A 1EY7A 3FDTA 4DFAA 1YNNC 1DZ1A 1QCBD 1BOSA 3MHBA 1GUOA 1WTWA 2JA8B 4CBVA 4DXFA 4ZQ3A 3S2HB 2A6ED 1D6EC 2EPBA 2K01A 4C3JG 4ZKCB 3R8BA 2MPMA 4F87A 2NVQB 1HFNA 4CKEA 2IX1A 4HCSA 1Y1WB 4DA2A 3H94A 4DNRB 2X6GA 4IUPA 3LWUA 3PUYA 3GTLB 1BF4A 2DNEA 1TR5A 5JAVA 2IT1A 2RBMA 4ZRZA 1C48A 4IFDI 1EYDA 1YNJC 2SOBA 3J81E 1RTOA 1RHPA 5M5XB 3VR6A 4I7ZC 1CTMA 3KF8A 1W6JA 3Q0AA 1MBYA 1EZ6A 2CW0C 3K7AB 4K5XA 5EPLA 2M9VA 2D9UA 3GTOB 1KABA 1WTPA 1UEAB 1KDCA 2E74C 2CHBD 3UI2A 1SE3A 2F4IA 1LV9A 3NWTA 1STEA 1K8OA 2IJ0A 3ND9A 5IGCA 2L9HA 4PNYA 1V43A 2RA4A 3R3OA 1Z7TA 1Y8OB 3D6WA 3L7ZC 3V2TA 2V4DA 4BA1I 4XYQA 2XSCA 2EE1A 2F0UA 1ML0D 5EJWA 2K1BA 2SNMA 2WAQB 5E1FA 1A6XA 3ZYYX 5C4HA 4HMIA 4C3HB 1IW7D 1XYIA 3BYYB 2K33A 1I3QB 2O2LD 1DM0B 2O4XA 3FVQA 1C8CA 2B2TA 3A7AB 4NDXA 2KEDA 5E4XA 4C56C 3TP8A 4KY6A 1Y8PB 2NN6I 4H13C 3KLSA 1PRTD 1B9MA 4RGMA 5JEAJ 4PMWA 3TMEA 3I72A 1BBXC 3PIP3 2AWNA 1D1KA 2ICEC 3EA6A 3TP7A 5DNFA 2EY6A 1BDOA 4OO1I 3HG9A 5HURA 4C3JB 2YYZA 2A6EC 4RCOA 3OWEB 2R6GA 1EYCA 5BN4A 1I4GA 3K5NA 3DWPA 3I4MB 3OIPA 5CORA 3BDOA 3DM1A 2B2YC 1FNVA 3VA7A 1FNWA 2A68D 2EYFA 2JA6B 3GTQB 1Q1BA 2B2VC 2F0SA 3FKIB 5M5YB 1GUNA 2EYMA 1SJED 5J39A 1ZKOA 1O80A 1Q8IA 4O42A 1X3PA 2NBFA 3TZUA 5J22A 1F77A 2EZVA 2PZUA 5JEAH 3FMCA 4R9WA 3P75A 2YU9B 1EY8A 1SYFA 1CT1D 2N55A 4IUVA 3KUPA 4GZYC 3F2UA 2EVBA 2KA7A 4N9TA 3J81L 2RVLA 5EGTA 3MWYW 1JE4A 4CKCA 3NSWA 1EWHA 2FMMA 5IOCA 1WTVA 2B8GA 1DYQA 4IUTA 3CRLC 3AU7A 1JQYD 4L63B 2K03A 2RQXA 2F0QA 4LMQD 2EYLA 1CK1A 3HP3A 1B1ZA 1SYGA 4A93B 2JSOA 3PO2B 3N6RA 2F0FA 3EROA 3FEWX 3GTMB 2MUYA 2HDLA 3NTIA 4NW2A 2L4NA 5K36H 3K5OA 1H9MA 1U4LA 3BVGA 3VYSA 3ERQA 4TKOB 4BY7B 4RFBA 5C4XB 1PTOF 5G3LF 1I6VC 1JWSD 2F0LA 2EYJA 3EQLC 2F03A 1UAPA 1LTAD 4KTAA 4HSPA 3CQZB 1G6ZA 1I4RA 1PZKD 4HSVA 1RJTA 4E6IA 4H7BA 1GOZA 3PUWA 1E2VA 1IW7C 3MFGA 3BZDB 3A56A 1QILA 2KVMA 1UNSA 1TQOA 4ZAIA 1CA5A 5M3FB 4DXGA 1AZPA 3S9WA 1OXTA 1U4PA 1PRTC 3QOLA 5KYLA 1MI2A 1LO5D 1PZID 2JE6I 2B63B 1VF5C 3SXHA 1IL8A 1PMRA 2F0GA 2D62A 1A15A 2VXWA 1EY5A 3CRKC 1BXTA 1HRJA 3SR1A 1MD2D 3M7NA 3J7AF 4IUNA 2LFNA 2AQ3B 1I4QA 5CV9A 2PPBC 5LHY1 3BDCA 5M3MB 2OF1A 4BWGB 2KCCA 1WD0A 3O13A 1WTOA 2IX0A 2PZTA 1XWEA 3W3AA 4G57A 1GUWA 4RA8A 4IN3A 3SK6A 4A3GB 2F0VA 3C1EA 4U68A 2IW3A 2PW7A 5EQ0A 3VYRA 1A2TA 1SE4A 3KBXA 2A68C 5FO7B 1NAPA 4JBWA 2AWOA 1T5XD 4K14A 1QG7A 1G291 1E0BA 4RHRA 4R8NA 5I2XA 2F3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOD A;  1STN A;  4WOR A;  2F0N A;  1KDC A;  3OWF A;  5KEE A;  2PW5 A;  1EY7 A;  1STH A;  4ZUJ A;  3BDL A;  2SNS A;  2F3V A;  1EYC A;  5F2D A;  5JOB A;  3LX0 A;  4EQP A;  2M00 A;  3ERQ A;  4IZ8 A;  1JOK A;  4DFA A;  1JOR A;  2F0L A;  2F0D A;  1A2U A;  2EYJ A;  5KIX A;  1RKN A;  4DU9 A;  1SYC A;  1SYB A;  4KY7 A;  2EYO A;  4N9P A;  2RKS A;  4IAL A;  5IGC A;  4KTA A;  5CR3 A;  3MHB A;  5C3X A;  3C1F A;  2EYF A;  1F2Y A;  4PNY A;  3NUC A;  4RKL A;  4H7B A;  4E6I A;  5KGU A;  1A3U A;  1NUC A;  2F0S A;  2F0M A;  4K2K A;  5DEH A;  1SNP A;  2OEO A;  4KJN A;  4LAA A;  1EYA A;  3EJI A;  4K5V A;  4QF4 A;  2KHS A;  3R3O A;  4ZQ3 A;  4K5W A;  3U9O A;  1KDA A;  1IHZ A;  3QB3 A;  3PMF A;  4J1M A;  1EY6 A;  5J1Z A;  4K2L A;  4EVO A;  2HQE A;  2EYM A;  1TQO A;  1U9R A;  4DF7 A;  4K6D A;  1TT2 A;  4PMB A;  4TRD A;  5J39 A;  1STY A;  3V2T A;  2EY2 A;  3QOJ A;  5I9P A;  2EYP A;  5EKK A;  4HTH A;  3E5S A;  3SK4 A;  3S9W A;  5J22 A;  1STA A;  1KDB A;  2F0U A;  4HMJ A;  2PYK A;  5E3F A;  5I6W A;  5IGF A;  5ISR A;  3QOL A;  2QDB A;  1ENC A;  2PZU A;  5KYL A;  4KHV A;  5IGE A;  3SK5 A;  3T16 A;  3P75 A;  4B9W A;  2PQE A;  3HEJ A;  1SYE A;  1EY8 A;  2SNM A;  1SYF A;  5CV7 A;  3SK8 A;  1STB A;  4K8J A;  5K5P A;  4K8I A;  5E1F A;  5HGT A;  4KD3 A;  3SXH A;  5IGD A;  4KJO A;  2F0G A;  5EKL A;  2RDF A;  4QB4 A;  5CGK A;  4F8M A;  1EQV A;  4EQO A;  5C4H A;  1SYD A;  2EY1 A;  2F0K A;  4PMC A;  4B9X A;  1SND A;  4HMI A;  5C6A A;  5M9O A;  1EY5 A;  5C5M A;  1JOQ A;  1TR5 A;  3SHL A;  4N9T A;  1II3 A;  1STG A;  3SR1 A;  5JAV A;  2F0W A;  3D4D A;  2RBM A;  3NK9 A;  4IUN A;  5EGT A;  2F0J A;  2F0H A;  5KRU A;  2WAC A;  1KAA A;  4ZUI A;  5C3W A;  1SNQ A;  2F0T A;  5KYI A;  2EYH A;  4OL7 A;  2O4X A;  3OMC A;  4QMG A;  4KV6 A;  5C4Z A;  1EY4 A;  2F0O A;  5CV9 A;  3P1H A;  3BDC A;  4NDX A;  2OF1 A;  5CV5 A;  4RKB A;  3TP8 A;  5IGG A;  4KY6 A;  4I65 A;  3NQT A;  1EYD A;  1NSN S;  2F0E A;  2PZT A;  1A3T A;  3DMU A;  4ME5 A;  3TP6 A;  3VA5 A;  5IOC A;  3H6M A;  2SOB A;  3NXW A;  1SNC A;  4DGZ A;  3TME A;  5C5L A;  4YIJ A;  3RUZ A;  4G57 A;  5IGB A;  1AEX A;  1EZ8 A;  3D8G A;  4NP5 A;  3TP5 A;  2EY5 A;  3MZ5 A;  5CV6 A;  4ODG A;  5I6Y A;  2OXP A;  4F7X A;  3SK6 A;  5I9O A;  2F0V A;  3OSO A;  3C1E A;  3MEH A;  4ID6 A;  3NHH A;  2KQ3 A;  3T13 A;  2PW7 A;  1A2T A;  4MIU A;  1SNM A;  2F0Q A;  2LKV A;  3MVV A;  4NKL A;  5NUC A;  5CV4 A;  1EZ6 A;  2PZW A;  3EVQ A;  2EYL A;  2NUC A;  4S3S A;  4WRD A;  5CV8 A;  3HZX A;  3OMG A;  3TP7 A;  4K5X A;  4KD4 A;  2F0P A;  2EXZ A;  1SYG A;  5DAU A;  2EY6 A;  3MXP A;  4K14 A;  1JOO A;  5HUR A;  1ENA A;  1F2Z A;  1EY9 A;  1KAB A;  2F0F A;  2F0I A;  3ERO A;  1EY0 A;  1F2M A;  2F3W A;  2ENB A;  3DHQ A;  3D6C A;  5IIF A;  4J6H A;  3D4W A;  4R8N A;  3ITP A;  4NMZ A;  4EQN A;  5CC4 A;  3NP8 A;  1A3V A;  4KY5 A;  1SNO A; 
#chains in the Genus database with same CATH topology
 3VDY A;  2A19 A;  4YWL A;  5M5W H;  2KCN A;  4KMU C;  2F3V A;  1D5X C;  3U4Z A;  1ZXT A;  2KOL A;  3QO2 A;  1OO9 B;  4IQZ A;  1PVO A;  1CKM A;  1RKN A;  5H1S E;  1BCP D;  1Q81 C;  3I55 A;  3GTG H;  3HOW H;  4C1N I;  5T1I A;  5FOB B;  1AP0 A;  2F0M A;  2RCN A;  4XDX A;  3I56 A;  2NVY B;  3Q24 A;  3DWQ A;  1TKW B;  3PCO B;  1ET9 A;  1U9R A;  5JEA G;  3M3Y B;  1N33 L;  3I7F A;  4ILW A;  2QGQ A;  4HTH A;  1PH6 A;  5E4W C;  2ZM6 L;  2D0O A;  2XGT A;  2WKC A;  2VB2 X;  2UUC L;  2F52 A;  1J8I A;  4B3T L;  4B9W A;  2R7Z B;  2WIN B;  1J5E Q;  1D2B A;  1E2W A;  2VUM B;  4RCN A;  4V0B A;  4L5T A;  5HGT A;  1OXV A;  1KNA A;  1EQV A;  3X3N A;  4EQO A;  1UE7 A;  4FXD A;  1X3E A;  3RLF A;  3C2P A;  1G91 A;  4DV2 L;  1PLF A;  3I4N H;  1TS4 A;  2Z4H A;  4IJH A;  3QG1 A;  1VQF A;  5GAH C;  2VL6 A;  3H15 A;  3VR4 A;  5IY0 A;  4LF9 L;  3W1G A;  4UHV A;  5D65 A;  2NVX H;  3PO2 H;  5CV5 A;  4DR4 L;  4L8J A;  4BXX H;  1HA6 A;  1S5C D;  3TP6 A;  4C2M H;  2OWO A;  1OXU A;  3RZD B;  1B50 A;  3A5Z B;  4A76 A;  1LM0 A;  1KLG D;  4FF2 A;  5CV6 A;  1VQK A;  2YTY A;  2E2I B;  2KQ3 A;  4GNX B;  2ID0 A;  1OTC A;  4LF4 Q;  3S1Q B;  1EFI D;  4GS3 A;  4WRD A;  4LWC A;  4G7H C;  3I70 A;  2EXZ A;  3FPU B;  4LUZ A;  1ICF B;  1WFQ A;  3CQZ H;  5K36 G;  1JE5 A;  4HJ9 A;  1ENA A;  4POG A;  4X62 Q;  1F2M A;  2JA7 G;  3CC7 A;  4JBJ A;  4A75 A;  5CC4 A;  3ITP A;  4JI7 Q;  5LL6 X;  1I94 Q;  3VR3 A;  2PW5 A;  4AYB B;  1ENF A;  5JPM C;  3RN5 A;  5IP9 H;  2R7F A;  4EQP A;  4A3E G;  2JEA I;  3HOV H;  4FVM A;  2L5T A;  4C3I G;  2Q8T A;  2ZJQ A;  1I4P A;  5DM6 3;  1D7Q A;  1GD7 A;  1PH3 A;  5IT9 c;  4C3H G;  4BBS B;  5IT9 E;  4RGO S;  4B3R Q;  3NUC A;  5KGU A;  1VQ4 A;  4KJN A;  1EIF A;  1EIG A;  3FPP A;  4K5W A;  3LGJ A;  5C4J B;  1CM9 A;  1K0R A;  2I5H A;  4G4K A;  2K05 A;  1CFM A;  4LK1 C;  4JI4 L;  1IZ6 A;  1RL2 A;  3BZK A;  3T4A C;  1AE3 A;  1SFO H;  1SYE A;  4FF4 A;  1LT5 D;  3S2D B;  2Y0S B;  1YNX A;  2MQH A;  4A3G H;  4F8M A;  1PFB A;  2SDF A;  1WTR A;  2JXM B;  2E76 C;  1A0I A;  2DJF C;  1QNK A;  5C0X J;  1STG A;  4L5Q A;  3M7G A;  2C9O A;  1N36 L;  4PZ6 A;  5E7N A;  4MTN A;  2KBN A;  2XWB B;  4PV1 C;  2BOS A;  2PMZ B;  1Y14 B;  4A3C H;  2JJQ A;  3KDF A;  1DJR D;  4RKB A;  2UUC Q;  2AMC B;  4IUR A;  1I50 H;  1YIT A;  4B3T Q;  3PO3 H;  3H6M A;  2UUB L;  4JOI C;  4O2D A;  2NB0 A;  2K4K A;  3TQY A;  1G2T A;  3K80 C;  2IL8 A;  3OSO A;  4TVA B;  4M1U B;  2JA6 G;  2XNA C;  1BCP C;  3H0G G;  4P2C B;  1V8Q A;  2HHH L;  3G6J B;  5BN5 A;  1ILQ A;  2J4X A;  3EVQ A;  4S3S A;  5CV4 A;  2BA0 A;  2K32 A;  1HNW L;  1SXT A;  4KD4 A;  3ONA B;  3RN2 A;  2X6L A;  1XMO L;  1GXD C;  4KHP L;  3KLR A;  3BVM A;  4X3K A;  3VYT A;  2UXC Q;  1B53 A;  2TMP A;  2ENB A;  3D6C A;  1Q12 A;  4ZUJ A;  4WOR A;  2LXJ A;  1PFM A;  3BG3 A;  4LF5 L;  1STH A;  1WCM B;  4FXG C;  3KBG A;  2K75 A;  4HCE A;  1XNQ L;  4PZ8 A;  1PYB A;  3HOW G;  4ZLT F;  2WAQ E;  4DV6 L;  1IBK L;  4LUO A;  3DWA A;  3CHB D;  3RNU A;  3A55 A;  4ABN A;  1HH2 P;  4DKA C;  3S16 H;  4A3M H;  1GVP A;  1XX8 A;  1BQQ T;  4CDE C;  1TWG B;  1NTG A;  2L1B A;  4L6T B;  5KNC A;  1XTD A;  5JVH 3;  4IO9 A;  3EJI A;  4CKB A;  1O7L A;  2ICI A;  5C0X H;  5IWA Q;  1K3B C;  1KL9 A;  3OHX C;  4TRD A;  2ATW A;  4Z9C B;  3FRP B;  3F1Z A;  3M4O B;  3DEP A;  5CMD A;  5IGF A;  1S5D D;  2K5V A;  5AFW A;  2FIN B;  3N52 A;  2DGY A;  1AZQ A;  1MGS A;  2PQE A;  1BNZ A;  3CW2 C;  3SGI A;  4UPA A;  3I4N G;  3TDQ A;  1B2T A;  3T1H Q;  5TSS A;  1EOT A;  2JA9 A;  4GKK L;  1WTH A;  2E2J H;  1SYD A;  1XNR L;  3EIV A;  3PO2 G;  4CDC C;  4OWT B;  1HFG A;  1LTS D;  3LWE A;  2F0W A;  4BXX G;  5DLQ E;  2H4O A;  2F0J A;  2WAC A;  2JA7 B;  1KAA A;  1R9T H;  5KYI A;  3IKJ A;  3IL8 A;  4QMG A;  1UWV A;  3UDI A;  4JI4 Q;  4KHZ A;  5JJK A;  2IPK D;  2A69 D;  1JJ2 A;  2I07 B;  3E0J A;  3CD6 A;  1GO3 E;  3NQT A;  5A35 A;  2I5L X;  4A3E B;  3DMU A;  2D2C C;  2R3Z A;  4ME5 A;  1L0X B;  1HHV A;  4ME3 A;  4C3I B;  2QCP X;  3L9A X;  1KAW A;  5IGB A;  5I9O A;  2XRQ D;  3PUZ A;  2VQE Q;  3S1M B;  3T13 A;  4QIW E;  2MO0 A;  4LFA L;  1N36 Q;  2R93 B;  1G6P A;  2G9D A;  1HPC A;  5DAU A;  4XIG S;  4JI8 L;  1TWA H;  1PYS B;  4FXK C;  4JI6 L;  2JN4 A;  5IP9 G;  3T56 B;  3HOV G;  1VQG A;  4YCU A;  3MC0 B;  2Q2H A;  2UUB Q;  4EQN A;  2CQA A;  3OWF A;  2Z9H A;  5CBE E;  2AKW B;  5IT9 L;  1L0Y B;  2HHH Q;  3UDG A;  4HIK A;  1IBL Q;  4KY7 A;  1AH9 A;  3K81 C;  3NTK A;  4GLV B;  2K5Q A;  2MP1 A;  2RKS A;  2TSS A;  3EBE A;  4DV0 Q;  3AMU A;  4OX9 L;  1XMO Q;  4KHP Q;  1BO0 A;  1FYC A;  4B3S L;  4XQQ A;  3A7L A;  3G6E A;  3M4Y A;  4O1N A;  1EEF D;  1KC8 C;  1K3R A;  3RZO B;  3QB3 A;  3OIQ A;  4JI5 L;  4AQY Q;  1JB7 A;  4UP9 A;  2MJ8 A;  4LF5 Q;  4BS9 A;  2NVT B;  3H3V H;  4K6D A;  3J81 j;  4QGU A;  4NXN L;  3S15 B;  1IBK Q;  3H3V C;  4BBR H;  1STA A;  2PYK A;  5I6W A;  5ISR A;  4A3G G;  4DR5 L;  4KHV A;  1WVL A;  3H0G B;  3S17 H;  2R61 A;  1TII D;  2CFM A;  4OWW B;  2K04 A;  3Q8D A;  3IFT A;  4PQX A;  2EY1 A;  4PMC A;  4B9X A;  3J7A V;  4A3C G;  1N34 L;  1TWF H;  5ELO A;  4K6L A;  3HOY H;  1C4Q A;  1XPU A;  5M5W B;  2KUM A;  4PZ7 A;  5EBC A;  3SVM A;  2K50 A;  3PQI A;  3PO3 G;  3S14 H;  3E6Z X;  4KV6 A;  1CKO A;  2N49 A;  1F9Q A;  3M85 A;  2XN9 C;  3H91 A;  2OT2 A;  3GTG B;  4KK7 A;  1TWC H;  1VQP A;  3HOW B;  1VMP A;  1KTK A;  3E3X A;  4A3K H;  3TP5 A;  1LTI D;  1EIY B;  2OXP A;  4GOP B;  1XNR Q;  4DK6 C;  1LLR D;  3TN2 A;  1CHQ D;  1SLJ A;  1DOL A;  2JEB I;  3WOE A;  3MXP A;  4DV1 L;  4GOP A;  1TWG H;  1PA6 A;  1Y69 U;  2UXB L;  1EY9 A;  1I6H B;  2K5W A;  1XMQ Q;  3PUX A;  1B3A A;  3A8I E;  4FF3 A;  4K0K L;  5IOD A;  5KEE A;  2MGS A;  3CKI B;  3A5U A;  3GV3 A;  5F2D A;  5JOB A;  1VQ7 A;  4A3M G;  3S1N H;  3DXJ C;  2VUM G;  1B7Y B;  5DM7 3;  3I4N B;  2J0T D;  1BUV T;  4P73 A;  4DAY B;  1TS3 A;  5C0X G;  3GD7 A;  2B2U A;  3RD4 A;  2NVX B;  4JI8 Q;  2BE5 D;  1D1I A;  4JI6 Q;  4R4O A;  3BS1 A;  3HOZ B;  4LAA A;  1L0W A;  4C2M B;  2ZTE A;  3NWS A;  4EVO A;  2HQE A;  2K28 A;  4DF7 A;  4G7Z C;  1LTB D;  1STY A;  3KK7 A;  2A69 C;  4BA2 I;  2Q8I B;  1AFP A;  5EKK A;  4A3J H;  4L5S A;  3ULP A;  4LF6 Q;  1LAB A;  1JB3 A;  2PNH A;  3GDE A;  3J80 i;  1HZ9 A;  2BCO A;  4JVZ A;  1QZG A;  3RR5 A;  4KKU A;  4B3S Q;  1VQA A;  1HUM A;  3GP7 A;  2LMC B;  1V1P B;  2VW9 A;  5ELC A;  2RDF A;  4EX5 A;  3CPW A;  2HUG A;  3S1M H;  1K28 A;  4QJF A;  5C5M A;  1GUT A;  4DUY L;  5FKA C;  5CBA E;  4RAU C;  1VQ9 A;  3HOV B;  2CQO A;  3UE1 A;  3HKZ B;  4ZUI A;  4NXN Q;  2VB3 X;  4OL7 A;  2OCE A;  2HIV A;  1P8L A;  4AYB G;  2XWJ B;  2QDL A;  4OIK A;  1SMX A;  1NSN S;  1F9P A;  1ET6 A;  3HFZ B;  1HXY D;  4L5R C;  2AUJ D;  2HDM A;  1IYV A;  4XYO A;  4YIJ A;  1Y8N B;  3BU2 A;  3MZ5 A;  5I6Y A;  2B2T C;  1VQI A;  1K0S A;  5J3B A;  3MEH A;  4N8X 1;  1CZG A;  3PGZ A;  4MIU A;  5FLX c;  1ZEQ X;  2B2W A;  3AQQ A;  3HZX A;  1ESR A;  1A62 A;  4RHS A;  1WTX A;  1G51 A;  2ZTD A;  4FYD A;  3L0O A;  1Q46 A;  1Q3L A;  1NJI C;  3EN2 A;  3KJO A;  3JAM c;  1S5B D;  1SFO B;  4JW0 A;  3MXN B;  1RCV D;  2RSO A;  3I2Z A;  3S24 A;  2HCI A;  3GTP H;  2G5D A;  1PFN A;  2I46 A;  1B8A A;  2F4V L;  3B6Y A;  1KLU D;  3MXN A;  1B70 B;  4UP8 A;  2G9H D;  1KQS A;  3EFX D;  5C3X A;  1J6Q A;  2QF7 A;  2UXB Q;  3KF6 A;  2WFW A;  3BVZ A;  4M8A A;  1X65 A;  1KRS A;  3BZC A;  1SNP A;  1I50 B;  4QF4 A;  1EYA A;  2WV6 D;  3T51 B;  3PO3 B;  5D3D A;  2I0Q A;  4FO2 A;  1VDZ A;  4BBR G;  4A3B H;  2JQO A;  3CC4 A;  1BCP B;  3M4Q A;  2BDN A;  2B3G A;  3I3C A;  1K9M C;  2WB1 E;  4GN5 A;  4J8Q A;  3SEB A;  2O5J C;  4LW1 A;  5EPJ A;  3T53 B;  1QUQ B;  5I9P A;  1KDB A;  3PSI A;  1PH8 A;  5ELE A;  5IGE A;  1PH4 A;  1CKN B;  2KJX A;  1FR3 A;  3HOY G;  3HEJ A;  1PZJ D;  1E1T A;  1Q1E A;  3WOF A;  4X3T A;  4KD3 A;  1CI3 M;  1H9S B;  4DR1 L;  3MFY A;  1N32 L;  1X6O A;  1SND A;  5EKI A;  3MXG A;  1KXL A;  3OW7 A;  1N8R C;  1II3 A;  4DAM A;  1LTL A;  2KEE A;  3G7L A;  2VS1 A;  3AFQ A;  5C3W A;  1H9S A;  1QJO A;  4Y7N H;  1R4Q B;  2L0C A;  1WCM G;  3CCQ A;  3S16 B;  4IFD J;  3IAY A;  1I6H H;  4Q5V A;  1UE5 A;  4A3M B;  3CCL A;  2KCM A;  3I8Z A;  3NXW A;  3I4L A;  4AH6 A;  2DNC A;  4WJW A;  4DUY Q;  1Q90 A;  1TY0 A;  5KNB A;  2CWP A;  4XQN A;  2B29 A;  3NBH B;  2BE5 C;  1S5E D;  1U4R A;  1F2Z A;  2Z6K A;  3A0J A;  4KLK A;  1RD9 D;  2MFI A;  1MJE A;  3HOZ H;  2UXC L;  2D5D A;  4A3I B;  3NP8 A;  5GRO A;  1EU4 A;  3S1R H;  4HED A;  1PXU A;  2F1M A;  3BYT B;  3LX0 A;  2E2J B;  4IZ8 A;  1CSQ A;  1LAC A;  1JOR A;  1SBB B;  2JK8 A;  4ZKB B;  2Y0S E;  3NEL A;  1R9T B;  5JJL A;  1IL2 A;  3KLS X;  3C1F A;  4NXM Q;  4GNX A;  1EQT A;  1F9S A;  2Z1C A;  5BN3 A;  2N88 A;  4MTK A;  5C3E H;  4HIM A;  4A3J G;  5IWA L;  1VQL A;  2QIL A;  1LT6 D;  1SAP A;  3Q22 A;  2MHV A;  1SSO A;  4HAE A;  4JC0 A;  3HOU H;  1HQM C;  3MA2 B;  1TY2 A;  5ELF A;  3OYY A;  2F4V Q;  3SK4 A;  4IFD H;  4HMJ A;  2B8F A;  2EJM A;  1L1O C;  2PQA B;  4LNQ A;  3M4P A;  5LMN W;  1NMF A;  3GTJ H;  1TWH H;  2R93 G;  3D4R A;  1EU3 A;  1TWA B;  4R4Q A;  4K8J A;  4K8I A;  3T1H L;  4OXP A;  5IYD H;  5EKL A;  3FP9 A;  3V05 A;  4B3M L;  1D5Z C;  1EL0 A;  1YHB A;  2BA1 A;  1EFW A;  5IYC H;  1EOV A;  4KN4 C;  2E75 C;  2EYH A;  4KI0 A;  3OMC A;  1PH2 A;  1LUZ A;  1PTO D;  2XVS A;  5G3L D;  2ASB A;  4DR6 L;  1YHQ A;  1NNX A;  3P1H A;  2L55 A;  4BY1 B;  5FO9 B;  1K8G A;  1DON A;  1S4Z A;  4R1J A;  1A3T A;  1PH9 A;  5FLX L;  4QCL A;  4A3D H;  1AEX A;  1EZ8 A;  3D8G A;  1IBM L;  4DR1 Q;  1M90 C;  1N32 Q;  2EQS A;  2VQE L;  1ZYR D;  4ULL A;  2LKV A;  1EIH A;  4FP5 D;  2FHT A;  3JAM L;  2JYO A;  2NZO A;  3C46 A;  1S3O A;  3J80 c;  4DV4 L;  4BBR B;  2E2H H;  3J80 E;  1E22 A;  2OQK A;  3GQB A;  3MXU A;  1SJH D;  2RSN A;  3ND8 A;  5IGG A;  1ROD A;  4KY5 A;  3S17 B;  4HID A;  4OWX B;  2B2Y A;  2O5I C;  1GHK A;  2SNS A;  2VZA A;  4IPC A;  1TWF B;  2B2V A;  5JJZ A;  3CU7 A;  3HOY B;  1DCZ A;  1O7I A;  4ZK9 B;  4DU9 A;  5KIX A;  1IBL L;  3TBI B;  1WTQ A;  1AN8 A;  4DV0 L;  1LYL A;  3S14 B;  4HN7 A;  4XTC S;  4A3B G;  1IYU A;  3PIO 3;  4OEM B;  2RDH A;  4IOA A;  1TWC B;  3U9O A;  1IHZ A;  3NE5 B;  4AQY L;  1HUN A;  4A3K B;  4K2L A;  1IKL A;  5CYU A;  2VQF Q;  1DOM A;  4MZ9 A;  4XT3 B;  1K73 C;  4YCV A;  3QOJ A;  3D31 A;  2EYP A;  3J7A 5;  2CH4 W;  3AB9 A;  2CWA A;  1EWC A;  1F9R A;  3SDZ A;  2NN6 H;  2UXD L;  3KLW A;  4NPS A;  1QOH A;  3KF8 B;  1TS5 A;  4CJ1 B;  2KHI A;  3HOX H;  4GLX A;  3H09 A;  3KJP A;  5CGK A;  4QB4 A;  5JPN C;  5C44 H;  4CDD C;  1LTT D;  2P5Z X;  3NBI A;  1ASY A;  3NK9 A;  4DK1 A;  3K57 A;  4CGY B;  2NWG A;  4TSS A;  1AW7 A;  1VF7 A;  3S1N B;  1KHI A;  2B39 A;  4OO1 H;  4CHT B;  5C4Z A;  1EY4 A;  4JI3 Q;  3DM3 A;  4DN4 M;  1QB5 D;  4DNT B;  4I65 A;  1O78 A;  5D3I B;  2F0E A;  4C1N K;  4A3I H;  3AEV A;  2K6A A;  4F88 A;  4IOC A;  4DGZ A;  3RUZ A;  2GVA A;  3JAM i;  1TXY A;  4NP5 A;  1OXX K;  3Q6S A;  4XT1 B;  4B3M Q;  4ODG A;  2K14 A;  1CHP D;  1F2L A;  4HJ7 A;  3PF4 A;  2E8G A;  1ICW A;  4JCV E;  1U5K A;  1YEZ A;  2NTS A;  3MVV A;  3SK5 A;  1CA6 A;  3HOZ G;  1GUG A;  4OEL B;  1MSH A;  1N9W A;  3TEH B;  4DR6 Q;  4A3J B;  2JP1 A;  1JOO A;  2PO4 A;  1CZW A;  1U4M A;  2IHF A;  1EY0 A;  3CMA A;  4G7O C;  1HA5 A;  2FMC A;  3DHQ A;  5IIF A;  2CVR A;  1XMQ L;  3ULL A;  2DN8 A;  3LNN A;  4V19 0;  2EJG C;  4MNO A;  3K58 A;  3Q23 A;  1IBM Q;  3STB D;  4GLA C;  3K59 A;  4WFN 3;  3I91 A;  4QUF A;  2F0D A;  4A3F B;  4IUU A;  1PRT B;  5C3E G;  3WDN A;  4DV4 Q;  1R4P B;  4RKL A;  2JA5 H;  1A3U A;  1NUC A;  1AE2 A;  2RDG A;  3HKZ G;  3V96 A;  1VQJ A;  2BDO A;  4R4I A;  3HOU G;  5LL6 S;  3RMH A;  1ASZ A;  1PTO H;  2IWH A;  4DAV A;  4IFD G;  2Z8L A;  1H9K A;  1K83 H;  3VR2 A;  2EOT A;  1JWM D;  1GHJ A;  1SE2 A;  1HNZ Q;  1RDP D;  1PTO C;  1VQ8 A;  3HGB A;  2HQL A;  3F8T A;  3HS0 C;  1Y1V H;  1M4V A;  1EQQ A;  1E7Z A;  3TSS A;  5E3F A;  4LF6 L;  5IYD G;  4BY1 H;  2DY8 A;  2QDB A;  1H9J A;  4JV5 Q;  4JYA L;  3T16 A;  4HR7 B;  1HTP A;  4RWS C;  5IYC G;  4X3S A;  1PDQ A;  2F3I A;  1O7Z A;  1ZYR C;  1YI2 A;  3A8J E;  4IUQ A;  4EQ5 A;  1PYW D;  3VYU A;  1QE6 A;  5A2Q L;  3SHL A;  4DK0 A;  5C0X I;  1JWU D;  1BCP F;  4AIM A;  3GTP B;  2WII B;  3R2I A;  5KRU A;  1HQR D;  2F0T A;  1HJP A;  1HNX Q;  2K7V A;  1GUS A;  2F0O A;  5D14 A;  4A3D G;  1PFS A;  2UXD Q;  2JA8 H;  3AFP A;  1CQF A;  2A6H D;  2WKD A;  3I73 A;  3S2H H;  1JIC A;  1Z47 A;  3I90 A;  3SE0 A;  4U67 3;  2H1E A;  1LT4 D;  5GQO A;  5BR8 Q;  2EY5 A;  2XRS D;  5I2Y A;  4R4T A;  3J80 L;  1XTC D;  4Q0F A;  3U50 C;  1VCI A;  4A3B B;  1GKH A;  1Y1W H;  1DD2 A;  2PZW A;  4KKS A;  3X3M A;  1X56 A;  2OTJ A;  3OTO Q;  3CP0 A;  5ELD A;  1GJX A;  4B08 A;  3GTL H;  3E9I A;  4QIW B;  3R93 A;  4WJ4 A;  4O0A A;  3K5L A;  4X66 Q;  5FO8 B;  4UP7 A;  1ESF A;  1Q82 C;  3DEO A;  3K0X A;  3NTH A;  3U9S A;  4P72 A;  1PH7 A;  1SEB D;  2K52 A;  5I4D A;  4HJA A;  4UDU C;  4JPB W;  4OIJ A;  1A2U A;  3DUZ A;  1MKH A;  2YV5 A;  2EJF C;  4RGN A;  3F2C A;  2EYO A;  4N9P A;  1I4H A;  2FJ2 A;  4IAL A;  5CR3 A;  1HR0 W;  1V1Q A;  1VQ5 A;  4Y7N B;  4LF7 Q;  4ZYS A;  2J7Z A;  4RGT A;  1QWY A;  2EDG A;  4K2K A;  5DEH A;  1S5F D;  2OEO A;  1E2Z A;  4CJ0 B;  1B9N A;  1KDA A;  2A8V A;  2UU9 Q;  2NN6 G;  1O7Y A;  1JCK B;  2DY7 A;  3K7A H;  2V1C C;  4GN4 B;  1V1O A;  1W6K A;  3GTO H;  1OXS C;  3BJU A;  1JR0 D;  1D5M C;  3D0F A;  2A1A A;  3A8K E;  5L37 A;  5IP7 H;  3K0Y A;  1X32 A;  4DR3 Q;  3SK8 A;  1STB A;  5K5P A;  2CKZ B;  4QUC A;  1IYJ B;  4KJO A;  3UDF A;  4OO1 G;  3NPP A;  4LF8 Q;  2GN5 A;  4DAY A;  2F0K A;  5IYB H;  5M9O A;  1E1O A;  1FGB D;  3TZD A;  4DK3 C;  4UAI A;  3S1R B;  1WOC A;  1VQM A;  2F0H A;  4A3I G;  3H3V I;  2R92 B;  2FFK B;  1WYD A;  1EWI A;  4JI0 Q;  3QWN A;  1FGU A;  1Z6H A;  4FNF A;  5KND A;  4JYA Q;  2PNR C;  1ONL A;  2IX3 A;  1SNC A;  1B4O A;  5EPK A;  3STB C;  2EXD A;  1IKM A;  2NYZ D;  2WP8 J;  2ZXP A;  3QIA A;  4H0L C;  5C3E B;  1K8M A;  4H44 C;  3C3L A;  1SRU A;  1YZ6 A;  4A3F H;  2NUC A;  2ZXR A;  1HCZ A;  4JK1 C;  5CV8 A;  1XXG A;  1V1P A;  3QJY A;  3HOU B;  1L1O B;  1FNU A;  3MAQ A;  4APV A;  1SMY D;  2L12 A;  1H9R A;  2NTT A;  4GKJ Q;  1DXM A;  2AQ2 B;  3GTJ B;  1TWH B;  2HCC A;  1SNO A;  1QVG A;  1STN A;  4C3H H;  1DOK A;  2AQ1 B;  3BDL A;  2YTX A;  1UE6 A;  5LMU Q;  3URY A;  1RTN A;  4LJZ C;  5FK9 C;  2M00 A;  1PV4 A;  4MHE A;  1I3Q H;  2QEJ C;  3PIO A;  5EBD A;  3CAM A;  3RLN A;  1C0A A;  5FLX E;  2EIF A;  1XJV A;  4NXM L;  3TRZ A;  3OOC A;  3J81 i;  4XXE A;  4CJ2 C;  4DPG A;  1Y1V G;  1BBW A;  3T1Y L;  2LS0 1;  5GAD C;  3JAM E;  4KKT A;  4A3D B;  4BY1 G;  3TS0 A;  1TT2 A;  4PMB A;  4YCW A;  4RG1 A;  1T5E A;  1VMC A;  2EY2 A;  1LTR D;  2Q2I A;  1UE1 A;  2A6H C;  3D3R A;  1YNN D;  1MSG A;  1QNU A;  4C3J H;  1ENC A;  5FJ8 H;  3JC6 6;  3FHW A;  3W2D A;  1NCV A;  1CUK A;  2E2H B;  2Z4I A;  1M8A A;  5IGD A;  1HZB A;  5ELN A;  3I4M H;  1TU2 B;  4HJ8 A;  4OHJ A;  3A54 A;  2JA8 G;  1WD1 A;  3K5M A;  1EQR A;  4JOI A;  5COY A;  1BKB A;  3CCM A;  3P20 A;  3L3O C;  2JA6 H;  1LT3 D;  3GTQ H;  1ILP A;  2A5H A;  3FKI H;  5AJ3 L;  2AHO B;  4DV7 L;  5M5Y H;  2M2L A;  3VR5 A;  3VA5 A;  2K5D A;  1QUQ A;  2A73 B;  4DAP A;  4R8I A;  1MHW C;  1CQV A;  1GM5 A;  4F7X A;  2KEC A;  5HGQ A;  3NHH A;  1I4X A;  2ZJP A;  1CKN A;  2QA4 A;  4J15 A;  5NUC A;  4LUV A;  4NKL A;  1BVS A;  2L11 A;  2F0P A;  3U58 A;  2YU9 H;  4A3K G;  4AYB E;  1X3Q A;  2F0I A;  1EYG A;  1Q86 C;  2Z6B A;  1EUJ A;  2XTI A;  3HOX B;  1BR9 A;  3MTS A;  1QVF A;  1YNJ D;  4GOP C;  1XPO A;  5T1G A;  2VNU D;  1JOK A;  5ELB A;  1L2F A;  5C44 B;  3HKS A;  4RH6 A;  1G8Z D;  4RMF A;  1G2S A;  1SYC A;  1SYB A;  2NZ1 D;  5EAY A;  4EGV A;  3KFU A;  2CW0 D;  1B44 D;  1F2Y A;  1RF2 D;  3WWV A;  2DJG C;  4JI1 Q;  1CSP A;  2VY3 A;  1TS2 A;  4K5V A;  1VQB A;  1EEI D;  2KHS A;  4X3U A;  2ZTC A;  3NBH A;  4J1M A;  5J1Z A;  2CH4 A;  1SDF A;  1EY6 A;  3PMF A;  2B2U C;  2VQF L;  2GA4 B;  5IP7 G;  2R92 H;  4A93 H;  1C9O A;  2X69 A;  2AUK A;  3E5S A;  2Q2T A;  4WJ3 M;  3PV0 A;  3GTM H;  2QEX A;  1HTL D;  2N8N A;  1TVX A;  2QKI C;  5LMN L;  5IYB G;  1PRT F;  3PIP A;  2WB1 B;  3QR8 A;  5JVG 3;  2LY7 A;  3GO5 A;  4XQJ A;  3NEN A;  5CV7 A;  4MN3 A;  3P7J A;  2PMZ E;  3R2T A;  3T1Y Q;  4BY7 H;  3OPO A;  2OQ0 A;  5C6A A;  4DV3 Q;  4A3L H;  5C4X H;  1JOQ A;  3PUV A;  4KN7 C;  1UUP A;  2Q8R E;  3IFD A;  3D4D A;  1VQC A;  2A74 C;  3GTK B;  3GV6 A;  1SNQ A;  1LTG D;  1YJ9 A;  3HRZ C;  1SMY C;  1NR4 A;  3TS2 A;  2PCF B;  4FF1 A;  4JI3 L;  2R7D A;  2RHQ B;  3CC2 A;  4OGQ C;  2ES2 A;  2E5L L;  4NB3 A;  4QL5 A;  1VS0 A;  4IJL A;  3NQI A;  2ZT9 C;  4TQU S;  5C5L A;  3CXC A;  3AYH B;  4A3F G;  1QZH A;  2JA5 B;  1NMG A;  2PQA A;  3K6O A;  4ID6 A;  5M3F H;  4PG3 A;  1PTO B;  2C5C A;  3J7Y W;  4OON A;  2WAQ G;  4LFB Q;  1K83 B;  1SNM A;  3KYH C;  3OMG A;  1FD7 D;  1Y1V B;  1KNE A;  1VQE A;  2B63 H;  2LSS A;  1JC7 A;  2E2D C;  1J9O A;  5AJ3 Q;  2ZXO A;  2SEB D;  4DV7 Q;  5A2Q E;  1VQH A;  4J6H A;  3D4W A;  2B2W C;  4NMZ A;  2XIW A;  1A3V A;  2YTV A;  2F0N A;  2HT1 A;  1NR2 A;  1EY7 A;  3FDT A;  3ERS X;  4IPH A;  4DFA A;  1YNN C;  1PH5 A;  1K8A C;  1DZ1 A;  5M3M H;  1QCB D;  4IPG A;  1BOS A;  4POF A;  3MHB A;  1GUO A;  3A74 A;  4QY7 A;  1WTW A;  2JA8 B;  4UY8 C;  4CBV A;  4DXF A;  4ZQ3 A;  3S2H B;  1YIJ A;  2A6E D;  2KCT A;  3ZJY C;  1D6E C;  2EPB A;  3KDF B;  2K01 A;  4P75 A;  4C3J G;  4ZKC B;  2BH8 A;  3R8B A;  5FJ8 G;  1C7Y A;  1HNZ L;  2MPM A;  4F87 A;  3G4S A;  1N33 Q;  2NVQ B;  4JI2 L;  4CKE A;  4DNI A;  2OTL A;  1HFN A;  2IX1 A;  4HCS A;  1Y1W B;  4DA2 A;  1JJC B;  3H94 A;  4DNR B;  1JT8 A;  2ZM6 Q;  2X6G A;  4IUP A;  3LWU A;  2ALY B;  4JV5 L;  3I4M G;  3PUY A;  1DGS A;  3GTL B;  1BF4 A;  1X55 A;  2UUA L;  2DNE A;  2GVB A;  2FXQ A;  4DV2 Q;  1TR5 A;  5JAV A;  3FKI G;  2IT1 A;  2RBM A;  4ZRZ A;  2D0P A;  1HNX L;  4LF9 Q;  1C48 A;  1V9P A;  4DV5 L;  4DR4 Q;  2HIX A;  4IFD I;  5LMN Q;  1EYD A;  3J81 c;  1X3F A;  3ULJ A;  1YNJ C;  2NVY H;  2SOB A;  3J81 E;  4HIO A;  1RTO A;  1RHP A;  5M5X B;  2Z0S A;  5BR8 L;  3MEF A;  3VR6 A;  3M3Y H;  4I7Z C;  4CDF C;  4LFC L;  1CTM A;  3KF8 A;  1W6J A;  1WI5 A;  3Q0A A;  4YHH L;  1MBY A;  4ALP A;  1EZ6 A;  2KEN A;  3NEM A;  2CW0 C;  2NZH A;  3F2D A;  3K7A B;  4K5X A;  3OTO L;  5EPL A;  2M9V A;  2R7Z H;  2ZJR A;  2VUM H;  2D9U A;  3GTO B;  1KAB A;  2RCF A;  4X66 L;  2E5L Q;  1RIP A;  5GAG C;  1WTP A;  1UEA B;  1KDC A;  1X3G A;  4X65 L;  3M9B A;  1X54 A;  2E74 C;  2CHB D;  3CCV A;  3CCR A;  1W2B A;  2Z6K C;  3UI2 A;  1SE3 A;  2F4I A;  1FJG L;  1LV9 A;  3NWT A;  1VQD A;  1I5F A;  3TRE A;  1STE A;  1K8O A;  4FDB A;  2IJ0 A;  3ND9 A;  5IGC A;  1S40 A;  2L9H A;  4LF7 L;  3RZD H;  4PNY A;  1V43 A;  4A4I A;  4GN3 B;  2R92 G;  2RA4 A;  4A93 G;  3R3O A;  3UE0 A;  3W1B A;  1Z7T A;  3CCE A;  2E2I H;  1Y8O B;  2LXK A;  3S1Q H;  3D6W A;  2UU9 L;  3L2P A;  2Q2U A;  1KIX A;  3CCS A;  1W3S A;  3GTK H;  3L7Z C;  4GNX C;  2MO1 A;  3V2T A;  2V4D A;  4IPD A;  4BA1 I;  4XYQ A;  2XSC A;  1PHJ A;  1B3Q A;  1HZC A;  2EE1 A;  2F0U A;  1ML0 D;  4BY7 G;  3E9H A;  1Z9F A;  4A3L G;  2H5X A;  5C4X G;  5EJW A;  3CCU A;  1U0L A;  2K1B A;  2SNM A;  4DR3 L;  2BH2 A;  2WAQ B;  3PF5 A;  4QQB X;  1YVC A;  5E1F A;  2RF4 A;  1A6X A;  3ZYY X;  5C4H A;  4LF8 L;  4HMI A;  2HD3 A;  4C3H B;  2IHE A;  1IW7 D;  1XYI A;  3BYY B;  1YJN A;  2K33 A;  4DUZ L;  2CCZ A;  1I3Q B;  2O2L D;  1Q8K A;  4JI2 Q;  2L15 A;  1DM0 B;  2O4X A;  5HY6 A;  3FVQ A;  4BBS H;  1C8C A;  3K8A A;  2B2T A;  3A7A B;  4NDX A;  2KED A;  4JI0 L;  5E4X A;  4C56 C;  3TP8 A;  4KY6 A;  1Y8P B;  1P16 A;  2NN6 I;  4H13 C;  3KLS A;  5M3F G;  4X6A H;  1PRT D;  1B9M A;  4RGM A;  5JEA J;  5C4J H;  4PMW A;  3TME A;  3I72 A;  2UUA Q;  1IXR A;  1BBX C;  3PIP 3;  2B63 G;  4DR7 L;  2K5N A;  2AWN A;  4P74 A;  1D1K A;  2ICE C;  3EA6 A;  3TP7 A;  1HNW Q;  5DNF A;  2EY6 A;  1BDO A;  3CPF A;  4OO1 I;  3HG9 A;  5HUR A;  4DV5 Q;  3CME A;  3S2D H;  4C3J B;  2YYZ A;  2A6E C;  2K5H A;  4RCO A;  1M1K C;  1FL0 A;  3OWE B;  4GKJ L;  3ER0 A;  5M3M G;  2R6G A;  5FLM H;  1Q7Y C;  5LMU L;  1EYC A;  5BN4 A;  1I4G A;  3K5N A;  3DWP A;  1XNQ Q;  4LFC Q;  3I4M B;  2NVQ H;  2IY5 B;  3OIP A;  5COR A;  4YHH Q;  3BDO A;  4DV6 Q;  3DM1 A;  3CF5 A;  2PI2 E;  2B2Y C;  1FNV A;  3VA7 A;  1FNW A;  1HR0 L;  2A68 D;  2EYF A;  4DR2 L;  5IE8 A;  2JA6 B;  3GTQ B;  1MJC A;  1Q1B A;  3G71 A;  2B2V C;  2F0S A;  4JBM A;  3FKI B;  5M5Y B;  1GUN A;  1NE3 A;  2EYM A;  4X65 Q;  1SJE D;  5J39 A;  1ZKO A;  1O80 A;  1Q8I A;  4YY3 L;  4O42 A;  4P71 A;  3IRB A;  1X3P A;  1FJG Q;  2NBF A;  2N3S A;  3TZU A;  5J22 A;  1JJG A;  1F77 A;  3W5O A;  2EZV A;  1SR3 A;  4H02 A;  2PZU A;  5JEA H;  1JMC A;  3FMC A;  4R9W A;  3P75 A;  2YU9 B;  1EY8 A;  1SYF A;  1CT1 D;  5M5X H;  2N55 A;  4IUV A;  3HKZ E;  3KUP A;  1WCM H;  4GKK Q;  4GZY C;  3F2U A;  1KRT A;  2EVB A;  4X64 L;  1T9H A;  2KA7 A;  4N9T A;  3J81 L;  2RVL A;  5EGT A;  3MWY W;  1HZA A;  4YWM A;  1JE4 A;  4CKC A;  3HOX G;  3NSW A;  2C35 B;  3RLO A;  3KOJ A;  1EWH A;  2FMM A;  5IOC A;  5C44 G;  1WTV A;  4ZCK A;  2B8G A;  1DYQ A;  4IUT A;  3CRL C;  3AU7 A;  1JQY D;  3K7U C;  4L63 B;  3CCJ A;  1NBW A;  2R7Z G;  2K03 A;  4N8F A;  3M4O H;  2RQX A;  3U4V A;  4LFA Q;  1XPR A;  2F0Q A;  4LMQ D;  1VQO A;  2EYL A;  4DUZ Q;  1CK1 A;  1VQN A;  3HP3 A;  2RHS B;  1B1Z A;  2QW7 A;  1SE8 A;  1SYG A;  2PI2 A;  4A93 B;  3I4O A;  2JSO A;  3PO2 B;  3N6R A;  2F0F A;  3ERO A;  3FEW X;  3G48 A;  3GTM B;  2MUY A;  2HDL A;  3NTI A;  4Y52 H;  4NW2 A;  2L4N A;  4I7A A;  5K36 H;  3K5O A;  1H9M A;  1S72 A;  1U4L A;  3BVG A;  3VYS A;  1YHA A;  3ERQ A;  2WB1 G;  4TKO B;  2JA7 H;  4BY7 B;  4RFB A;  4DR7 Q;  5C4X B;  1PTO F;  1SRO A;  5G3L F;  1I6V C;  1JWS D;  2F0L A;  2EYJ A;  3EQL C;  2F03 A;  1UAP A;  1LTA D;  1KD1 C;  4A3E H;  4KTA A;  4OX9 Q;  4HSP A;  3CQZ B;  1G6Z A;  1I4R A;  1PZK D;  1J5E L;  4HSV A;  4C3I H;  4JI1 L;  1RJT A;  4E6I A;  4H7B A;  1NY4 A;  3F2B A;  1GOZ A;  3PUW A;  1E2V A;  3DLL A;  1IW7 C;  3MFG A;  3BZD B;  3A56 A;  4JI5 Q;  1L1O A;  1QIL A;  2KVM A;  1UNS A;  2R93 H;  1TQO A;  1MIU A;  4ZAI A;  1A63 A;  1CA5 A;  1YBY A;  5GAE C;  5M3F B;  4DXG A;  2JA5 G;  1AZP A;  1WJJ A;  3S9W A;  1OXT A;  1U4P A;  1PRT C;  3QOL A;  4R4C A;  4DR5 Q;  5KYL A;  1HR0 Q;  1A8V A;  2I5M X;  1MI2 A;  1LO5 D;  1D8L A;  4DR2 Q;  1PZI D;  2JE6 I;  2B63 B;  1SN8 A;  1E24 A;  1VF5 C;  3OW2 A;  1FVI A;  3SXH A;  1IL8 A;  1PMR A;  4JG2 A;  2F0G A;  2D62 A;  1A15 A;  1X9N A;  2VXW A;  4BBS G;  4DV3 L;  1N34 Q;  1EY5 A;  3CRK C;  1BXT A;  4LF4 L;  1HRJ A;  3SR1 A;  1MD2 D;  3M7N A;  1UEB A;  3J7A F;  4IUN A;  2LFN A;  4YY3 Q;  2MNA A;  2AQ3 B;  1I4Q A;  5CV9 A;  2PPB C;  5LHY 1;  3BDC A;  5M3M B;  2OF1 A;  1BBU A;  3UDX A;  4BWG B;  2KCC A;  4X62 L;  1WD0 A;  3O13 A;  1WTO A;  2IX0 A;  2PZT A;  1VQ6 A;  1XWE A;  3RZO H;  4JI7 L;  3E0E A;  3W3A A;  1I94 L;  5JJI A;  4G57 A;  1GUW A;  4RA8 A;  2DUD A;  2NVT H;  4IN3 A;  3SK6 A;  4A3G B;  1E3P A;  2F0V A;  3C1E A;  4U68 A;  2IW3 A;  3S15 H;  3KF6 B;  4X64 Q;  2PW7 A;  5EQ0 A;  3VYR A;  4LFB L;  4HJ5 A;  1A2T A;  1SE4 A;  3KBX A;  3J7Z C;  2Y0S G;  1PH1 A;  2A68 C;  5FO7 B;  4YWK A;  1NAP A;  4JBW A;  1YJW A;  2AWO A;  1T5X D;  4K14 A;  4DV1 Q;  5FLM G;  3H0G H;  1QG7 A;  1H95 A;  4B3R L;  2N78 A;  1G29 1;  2KHJ A;  4JBK A;  1E0B A;  4RHR A;  3ICE A;  4R8N A;  1QVC A;  5I2X A;  1Y1W G;  2F3W A;  4K0K Q; 
#chains in the Genus database with same CATH homology
 2KCN A;  4KMU C;  2F3V A;  1D5X C;  1ZXT A;  2KOL A;  3QO2 A;  1OO9 B;  4IQZ A;  1RKN A;  1BCP D;  4C1N I;  5T1I A;  5FOB B;  1AP0 A;  2F0M A;  4XDX A;  2NVY B;  3Q24 A;  3DWQ A;  1TKW B;  1ET9 A;  1U9R A;  5JEA G;  3M3Y B;  4ILW A;  4HTH A;  5E4W C;  2WKC A;  2VB2 X;  1J8I A;  4B9W A;  2R7Z B;  2WIN B;  1D2B A;  1E2W A;  2VUM B;  4RCN A;  4V0B A;  5HGT A;  1OXV A;  1KNA A;  1EQV A;  3X3N A;  4EQO A;  4FXD A;  3RLF A;  3C2P A;  1G91 A;  1PLF A;  1TS4 A;  2Z4H A;  3QG1 A;  3VR4 A;  5D65 A;  5CV5 A;  4L8J A;  1HA6 A;  1S5C D;  3TP6 A;  1OXU A;  3RZD B;  1B50 A;  1KLG D;  4FF2 A;  5CV6 A;  2E2I B;  2KQ3 A;  2ID0 A;  3S1Q B;  1EFI D;  4WRD A;  4G7H C;  3I70 A;  2EXZ A;  3FPU B;  5K36 G;  1ENA A;  1F2M A;  5CC4 A;  3ITP A;  5LL6 X;  3VR3 A;  2PW5 A;  4AYB B;  1ENF A;  5JPM C;  4EQP A;  2JEA I;  4FVM A;  2L5T A;  4C3I G;  2Q8T A;  1I4P A;  5DM6 3;  4C3H G;  4BBS B;  5IT9 E;  4RGO S;  3NUC A;  5KGU A;  4KJN A;  1EIG A;  3FPP A;  4K5W A;  5C4J B;  1CM9 A;  4G4K A;  2K05 A;  1CFM A;  4LK1 C;  3T4A C;  1SYE A;  4FF4 A;  1LT5 D;  3S2D B;  2Y0S B;  4F8M A;  1PFB A;  2SDF A;  1WTR A;  2JXM B;  2E76 C;  1QNK A;  5C0X J;  1STG A;  3M7G A;  2C9O A;  2XWB B;  4PV1 C;  2BOS A;  2PMZ B;  4RKB A;  1DJR D;  4IUR A;  3H6M A;  2NB0 A;  1G2T A;  2IL8 A;  3OSO A;  4M1U B;  2XNA C;  1BCP C;  4P2C B;  1V8Q A;  3G6J B;  5BN5 A;  1ILQ A;  5CV4 A;  2J4X A;  3EVQ A;  4S3S A;  2BA0 A;  2K32 A;  1SXT A;  4KD4 A;  3ONA B;  2X6L A;  1GXD C;  3KLR A;  3BVM A;  4X3K A;  3VYT A;  1B53 A;  2TMP A;  2ENB A;  3D6C A;  1Q12 A;  4ZUJ A;  4WOR A;  3BG3 A;  1PFM A;  1STH A;  1WCM B;  3KBG A;  4FXG C;  4HCE A;  4ZLT F;  3DWA A;  3CHB D;  3A55 A;  4ABN A;  1XX8 A;  1BQQ T;  1TWG B;  2L1B A;  4L6T B;  5KNC A;  5JVH 3;  3EJI A;  4CKB A;  1O7L A;  2ICI A;  5C0X H;  3OHX C;  4TRD A;  4Z9C B;  3FRP B;  3M4O B;  3DEP A;  5CMD A;  5IGF A;  1S5D D;  5AFW A;  2FIN B;  3N52 A;  1AZQ A;  1MGS A;  2PQE A;  1BNZ A;  3TDQ A;  1B2T A;  5TSS A;  1EOT A;  1SYD A;  1HFG A;  1LTS D;  3LWE A;  2F0W A;  2H4O A;  2F0J A;  2WAC A;  2JA7 B;  1KAA A;  5KYI A;  3IKJ A;  3IL8 A;  4QMG A;  4KHZ A;  2IPK D;  2A69 D;  2I07 B;  3E0J A;  3NQT A;  5A35 A;  4A3E B;  3DMU A;  2D2C C;  2R3Z A;  4ME5 A;  1L0X B;  1HHV A;  4C3I B;  2QCP X;  3L9A X;  5IGB A;  5I9O A;  2XRQ D;  3PUZ A;  3S1M B;  3T13 A;  2R93 B;  2G9D A;  1HPC A;  5DAU A;  4XIG S;  4FXK C;  3T56 B;  3MC0 B;  4EQN A;  2CQA A;  3OWF A;  5CBE E;  5IT9 L;  1L0Y B;  4KY7 A;  3NTK A;  2K5Q A;  2MP1 A;  2RKS A;  2TSS A;  3AMU A;  1BO0 A;  1FYC A;  4XQQ A;  3A7L A;  3M4Y A;  4O1N A;  1EEF D;  3RZO B;  3QB3 A;  3OIQ A;  2MJ8 A;  4BS9 A;  2NVT B;  4K6D A;  3S15 B;  3H3V C;  1STA A;  2PYK A;  5I6W A;  5ISR A;  4KHV A;  1WVL A;  3H0G B;  2R61 A;  1TII D;  2K04 A;  3IFT A;  4PQX A;  2EY1 A;  4PMC A;  4B9X A;  3J7A V;  4K6L A;  1C4Q A;  5M5W B;  2KUM A;  5EBC A;  3SVM A;  3E6Z X;  4KV6 A;  1F9Q A;  3M85 A;  2XN9 C;  3H91 A;  2OT2 A;  3GTG B;  4KK7 A;  3HOW B;  1VMP A;  1KTK A;  3TP5 A;  1LTI D;  2OXP A;  1LLR D;  3TN2 A;  1CHQ D;  1DOL A;  2JEB I;  3WOE A;  3MXP A;  1Y69 U;  1EY9 A;  1I6H B;  2K5W A;  3PUX A;  1B3A A;  3A8I E;  4FF3 A;  5IOD A;  5KEE A;  2MGS A;  3CKI B;  3GV3 A;  5F2D A;  5JOB A;  3DXJ C;  5DM7 3;  3I4N B;  2J0T D;  1BUV T;  1TS3 A;  5C0X G;  3GD7 A;  2B2U A;  3RD4 A;  2NVX B;  2BE5 D;  1D1I A;  3BS1 A;  3HOZ B;  4LAA A;  4C2M B;  3NWS A;  4EVO A;  2HQE A;  2K28 A;  4DF7 A;  4G7Z C;  1LTB D;  1STY A;  3KK7 A;  2A69 C;  4BA2 I;  2Q8I B;  1AFP A;  5EKK A;  1LAB A;  1JB3 A;  2BCO A;  4KKU A;  3GP7 A;  1HUM A;  2LMC B;  1V1P B;  5ELC A;  2RDF A;  2HUG A;  5C5M A;  1GUT A;  5FKA C;  5CBA E;  4RAU C;  3HOV B;  3HKZ B;  4ZUI A;  2VB3 X;  4OL7 A;  2XWJ B;  4OIK A;  1NSN S;  1F9P A;  1ET6 A;  1HXY D;  1IYV A;  2AUJ D;  2HDM A;  4XYO A;  4YIJ A;  1Y8N B;  3MZ5 A;  5I6Y A;  2B2T C;  3MEH A;  1CZG A;  4MIU A;  1ZEQ X;  2B2W A;  3HZX A;  1ESR A;  4RHS A;  1WTX A;  4FYD A;  1Q3L A;  1S5B D;  1SFO B;  1RCV D;  2RSO A;  2HCI A;  1PFN A;  2I46 A;  1KLU D;  3MXN A;  2G9H D;  3EFX D;  5C3X A;  2QF7 A;  3BVZ A;  4M8A A;  1SNP A;  1I50 B;  4QF4 A;  1EYA A;  2WV6 D;  3T51 B;  3PO3 B;  5D3D A;  4FO2 A;  1VDZ A;  1BCP B;  2BDN A;  3I3C A;  4J8Q A;  3SEB A;  2O5J C;  5EPJ A;  3T53 B;  5I9P A;  1KDB A;  5ELE A;  5IGE A;  2KJX A;  1FR3 A;  3HEJ A;  1PZJ D;  1Q1E A;  3WOF A;  4X3T A;  4KD3 A;  1CI3 M;  1H9S B;  3MFY A;  1SND A;  5EKI A;  3MXG A;  3OW7 A;  1II3 A;  2KEE A;  3G7L A;  5C3W A;  1H9S A;  1QJO A;  1R4Q B;  2L0C A;  3S16 B;  4IFD J;  3IAY A;  4Q5V A;  4A3M B;  3I8Z A;  3NXW A;  3I4L A;  2DNC A;  4WJW A;  1Q90 A;  1TY0 A;  5KNB A;  4XQN A;  2BE5 C;  1S5E D;  1U4R A;  1F2Z A;  1RD9 D;  2D5D A;  4A3I B;  3NP8 A;  1EU4 A;  4HED A;  1PXU A;  2F1M A;  3BYT B;  3LX0 A;  2E2J B;  4IZ8 A;  1LAC A;  1JOR A;  1SBB B;  4ZKB B;  1R9T B;  3KLS X;  3C1F A;  1EQT A;  1F9S A;  2Z1C A;  5BN3 A;  2N88 A;  2QIL A;  1LT6 D;  1SAP A;  3Q22 A;  2MHV A;  1SSO A;  4HAE A;  1HQM C;  3MA2 B;  1TY2 A;  5ELF A;  3SK4 A;  4IFD H;  4HMJ A;  2B8F A;  2EJM A;  3D4R A;  1EU3 A;  1TWA B;  4K8J A;  4K8I A;  5EKL A;  3V05 A;  1EL0 A;  1D5Z C;  2BA1 A;  4KN4 C;  2E75 C;  2EYH A;  4KI0 A;  3OMC A;  1PTO D;  2XVS A;  5G3L D;  3P1H A;  2L55 A;  4BY1 B;  5FO9 B;  1DON A;  1S4Z A;  1A3T A;  5FLX L;  4QCL A;  1AEX A;  1EZ8 A;  3D8G A;  1ZYR D;  4ULL A;  2LKV A;  1EIH A;  4FP5 D;  2FHT A;  3JAM L;  2JYO A;  3C46 A;  4BBR B;  3J80 E;  3GQB A;  3MXU A;  1SJH D;  2RSN A;  3ND8 A;  5IGG A;  1ROD A;  4KY5 A;  3S17 B;  2B2Y A;  2O5I C;  1GHK A;  2SNS A;  1TWF B;  2B2V A;  5JJZ A;  3CU7 A;  3HOY B;  1DCZ A;  4ZK9 B;  5KIX A;  4DU9 A;  3TBI B;  1WTQ A;  1AN8 A;  3S14 B;  4HN7 A;  4XTC S;  1IYU A;  3PIO 3;  2RDH A;  1TWC B;  3U9O A;  1IHZ A;  3NE5 B;  1HUN A;  4A3K B;  4K2L A;  1IKL A;  5CYU A;  1DOM A;  4XT3 B;  3QOJ A;  3D31 A;  2EYP A;  3AB9 A;  1EWC A;  1F9R A;  3SDZ A;  2NN6 H;  1QOH A;  1TS5 A;  4CJ1 B;  3H09 A;  5CGK A;  4QB4 A;  5JPN C;  1LTT D;  3NBI A;  3NK9 A;  4DK1 A;  3K57 A;  4CGY B;  2NWG A;  4TSS A;  1AW7 A;  1VF7 A;  3S1N B;  2B39 A;  4OO1 H;  4CHT B;  5C4Z A;  1EY4 A;  4DN4 M;  1QB5 D;  4DNT B;  4I65 A;  1O78 A;  5D3I B;  2F0E A;  4C1N K;  2K6A A;  4F88 A;  4DGZ A;  3RUZ A;  4NP5 A;  1OXX K;  3Q6S A;  4XT1 B;  4ODG A;  1CHP D;  1F2L A;  1ICW A;  2NTS A;  3MVV A;  3SK5 A;  1CA6 A;  1GUG A;  1MSH A;  4A3J B;  2JP1 A;  1JOO A;  2PO4 A;  1CZW A;  1U4M A;  1EY0 A;  4G7O C;  1HA5 A;  2FMC A;  3DHQ A;  5IIF A;  2CVR A;  2DN8 A;  3LNN A;  4V19 0;  2EJG C;  3K58 A;  3Q23 A;  3K59 A;  4WFN 3;  3I91 A;  4QUF A;  2F0D A;  4A3F B;  4IUU A;  1PRT B;  3WDN A;  1R4P B;  4RKL A;  1A3U A;  1NUC A;  2RDG A;  3V96 A;  2BDO A;  5LL6 S;  3RMH A;  1PTO H;  2IWH A;  4DAV A;  4IFD G;  2Z8L A;  1H9K A;  3VR2 A;  2EOT A;  1JWM D;  1GHJ A;  1SE2 A;  1RDP D;  1PTO C;  3HGB A;  3HS0 C;  1M4V A;  3TSS A;  5E3F A;  2DY8 A;  2QDB A;  1H9J A;  3T16 A;  4HR7 B;  1HTP A;  4RWS C;  4X3S A;  1PDQ A;  1O7Z A;  1ZYR C;  3A8J E;  4IUQ A;  1PYW D;  3VYU A;  1QE6 A;  5A2Q L;  3SHL A;  4DK0 A;  5C0X I;  1JWU D;  1BCP F;  3GTP B;  2WII B;  3R2I A;  5KRU A;  1HQR D;  2F0T A;  2K7V A;  1GUS A;  2F0O A;  5D14 A;  1CQF A;  2A6H D;  2WKD A;  3I73 A;  1JIC A;  1Z47 A;  3I90 A;  3SE0 A;  4U67 3;  2H1E A;  1LT4 D;  2EY5 A;  2XRS D;  5I2Y A;  3J80 L;  1XTC D;  4Q0F A;  1VCI A;  4A3B B;  1DD2 A;  2PZW A;  4KKS A;  3X3M A;  5ELD A;  1GJX A;  4B08 A;  4QIW B;  3R93 A;  3K5L A;  5FO8 B;  1ESF A;  3DEO A;  3NTH A;  3U9S A;  1SEB D;  5I4D A;  4UDU C;  4OIJ A;  1A2U A;  3DUZ A;  2EJF C;  4RGN A;  2EYO A;  4N9P A;  1I4H A;  2FJ2 A;  4IAL A;  5CR3 A;  4Y7N B;  4ZYS A;  2J7Z A;  4RGT A;  1QWY A;  2EDG A;  4K2K A;  5DEH A;  1S5F D;  2OEO A;  1E2Z A;  4CJ0 B;  1B9N A;  1KDA A;  2NN6 G;  1O7Y A;  1JCK B;  2DY7 A;  1V1O A;  1W6K A;  1OXS C;  1JR0 D;  1D5M C;  3A8K E;  3K0Y A;  1X32 A;  3SK8 A;  1STB A;  5K5P A;  4QUC A;  4KJO A;  4OO1 G;  3NPP A;  4DAY A;  2F0K A;  5M9O A;  1FGB D;  3TZD A;  4UAI A;  3S1R B;  2F0H A;  2R92 B;  2FFK B;  3QWN A;  1Z6H A;  4FNF A;  5KND A;  2PNR C;  1ONL A;  2IX3 A;  1SNC A;  1B4O A;  5EPK A;  1IKM A;  2NYZ D;  2WP8 J;  2ZXP A;  3QIA A;  4H0L C;  5C3E B;  1K8M A;  4H44 C;  3C3L A;  2NUC A;  2ZXR A;  1HCZ A;  4JK1 C;  5CV8 A;  1XXG A;  1V1P A;  3QJY A;  3HOU B;  1FNU A;  3MAQ A;  1SMY D;  2L12 A;  1H9R A;  2NTT A;  1DXM A;  2AQ2 B;  3GTJ B;  1TWH B;  2HCC A;  1SNO A;  1STN A;  1DOK A;  2AQ1 B;  3BDL A;  3URY A;  1RTN A;  4LJZ C;  5FK9 C;  2M00 A;  4MHE A;  2QEJ C;  5EBD A;  5FLX E;  3OOC A;  4XXE A;  4CJ2 C;  2LS0 1;  3JAM E;  4KKT A;  4A3D B;  1TT2 A;  4PMB A;  1T5E A;  1VMC A;  2EY2 A;  1LTR D;  2A6H C;  3D3R A;  1YNN D;  1MSG A;  1QNU A;  1ENC A;  3W2D A;  1NCV A;  2E2H B;  2Z4I A;  1M8A A;  5IGD A;  1TU2 B;  4OHJ A;  3A54 A;  1WD1 A;  3K5M A;  5COY A;  3P20 A;  3L3O C;  1LT3 D;  1ILP A;  2A5H A;  2M2L A;  3VR5 A;  3VA5 A;  2K5D A;  2A73 B;  4DAP A;  4R8I A;  1CQV A;  4F7X A;  2KEC A;  3NHH A;  1I4X A;  5NUC A;  4NKL A;  2L11 A;  2F0P A;  1X3Q A;  2F0I A;  3HOX B;  1BR9 A;  3MTS A;  1YNJ D;  5T1G A;  2VNU D;  1JOK A;  5ELB A;  5C44 B;  4RH6 A;  1G8Z D;  1G2S A;  1SYC A;  1SYB A;  2NZ1 D;  4EGV A;  2CW0 D;  1B44 D;  1F2Y A;  1RF2 D;  1TS2 A;  4K5V A;  2KHS A;  1EEI D;  4X3U A;  3NBH A;  4J1M A;  5J1Z A;  3PMF A;  1SDF A;  1EY6 A;  2B2U C;  2GA4 B;  2X69 A;  2AUK A;  3E5S A;  3PV0 A;  1HTL D;  2QKI C;  1TVX A;  1PRT F;  2WB1 B;  5JVG 3;  2LY7 A;  3GO5 A;  4XQJ A;  5CV7 A;  4MN3 A;  3P7J A;  3R2T A;  3OPO A;  5C6A A;  1JOQ A;  3PUV A;  4KN7 C;  1UUP A;  2Q8R E;  3IFD A;  3D4D A;  2A74 C;  3GTK B;  3GV6 A;  1SNQ A;  1LTG D;  3HRZ C;  1SMY C;  1NR4 A;  2PCF B;  4FF1 A;  4OGQ C;  3NQI A;  2ZT9 C;  4TQU S;  5C5L A;  2JA5 B;  3K6O A;  4ID6 A;  3J7Y W;  1PTO B;  2C5C A;  1K83 B;  1SNM A;  3OMG A;  1FD7 D;  1Y1V B;  1KNE A;  1JC7 A;  2E2D C;  1J9O A;  2ZXO A;  2SEB D;  5A2Q E;  4J6H A;  3D4W A;  2B2W C;  4NMZ A;  2XIW A;  1A3V A;  2F0N A;  1NR2 A;  1EY7 A;  3FDT A;  4DFA A;  1YNN C;  1DZ1 A;  1QCB D;  1BOS A;  3MHB A;  1GUO A;  1WTW A;  2JA8 B;  4CBV A;  4DXF A;  4ZQ3 A;  3S2H B;  2A6E D;  1D6E C;  2EPB A;  2K01 A;  4C3J G;  4ZKC B;  3R8B A;  2MPM A;  4F87 A;  2NVQ B;  1HFN A;  4CKE A;  2IX1 A;  4HCS A;  1Y1W B;  4DA2 A;  3H94 A;  4DNR B;  2X6G A;  4IUP A;  3LWU A;  3PUY A;  3GTL B;  1BF4 A;  2DNE A;  1TR5 A;  5JAV A;  2IT1 A;  2RBM A;  4ZRZ A;  1C48 A;  4IFD I;  1EYD A;  1YNJ C;  2SOB A;  3J81 E;  1RTO A;  1RHP A;  5M5X B;  3VR6 A;  4I7Z C;  1CTM A;  3KF8 A;  1W6J A;  3Q0A A;  1MBY A;  1EZ6 A;  2CW0 C;  3K7A B;  4K5X A;  5EPL A;  2M9V A;  2D9U A;  3GTO B;  1KAB A;  1WTP A;  1UEA B;  1KDC A;  2E74 C;  2CHB D;  3UI2 A;  1SE3 A;  2F4I A;  1LV9 A;  3NWT A;  1STE A;  1K8O A;  2IJ0 A;  3ND9 A;  5IGC A;  2L9H A;  4PNY A;  1V43 A;  2RA4 A;  3R3O A;  1Z7T A;  1Y8O B;  3D6W A;  3L7Z C;  3V2T A;  2V4D A;  4BA1 I;  4XYQ A;  2XSC A;  2EE1 A;  2F0U A;  1ML0 D;  5EJW A;  2K1B A;  2SNM A;  2WAQ B;  5E1F A;  1A6X A;  3ZYY X;  5C4H A;  4HMI A;  4C3H B;  1IW7 D;  1XYI A;  3BYY B;  2K33 A;  1I3Q B;  2O2L D;  1DM0 B;  2O4X A;  3FVQ A;  1C8C A;  2B2T A;  3A7A B;  4NDX A;  2KED A;  5E4X A;  4C56 C;  3TP8 A;  4KY6 A;  1Y8P B;  2NN6 I;  4H13 C;  3KLS A;  1PRT D;  1B9M A;  4RGM A;  5JEA J;  4PMW A;  3TME A;  3I72 A;  1BBX C;  3PIP 3;  2AWN A;  1D1K A;  2ICE C;  3EA6 A;  3TP7 A;  5DNF A;  2EY6 A;  1BDO A;  4OO1 I;  3HG9 A;  5HUR A;  4C3J B;  2YYZ A;  2A6E C;  4RCO A;  3OWE B;  2R6G A;  1EYC A;  5BN4 A;  1I4G A;  3K5N A;  3DWP A;  3I4M B;  3OIP A;  5COR A;  3BDO A;  3DM1 A;  2B2Y C;  1FNV A;  3VA7 A;  1FNW A;  2A68 D;  2EYF A;  2JA6 B;  3GTQ B;  1Q1B A;  2B2V C;  2F0S A;  3FKI B;  5M5Y B;  1GUN A;  2EYM A;  1SJE D;  5J39 A;  1ZKO A;  1O80 A;  1Q8I A;  4O42 A;  1X3P A;  2NBF A;  3TZU A;  5J22 A;  1F77 A;  2EZV A;  2PZU A;  5JEA H;  3FMC A;  4R9W A;  3P75 A;  2YU9 B;  1EY8 A;  1SYF A;  1CT1 D;  2N55 A;  4IUV A;  3KUP A;  4GZY C;  3F2U A;  2EVB A;  2KA7 A;  4N9T A;  3J81 L;  2RVL A;  5EGT A;  3MWY W;  1JE4 A;  4CKC A;  3NSW A;  1EWH A;  2FMM A;  5IOC A;  1WTV A;  2B8G A;  1DYQ A;  4IUT A;  3CRL C;  3AU7 A;  1JQY D;  4L63 B;  2K03 A;  2RQX A;  2F0Q A;  4LMQ D;  2EYL A;  1CK1 A;  3HP3 A;  1B1Z A;  1SYG A;  4A93 B;  2JSO A;  3PO2 B;  3N6R A;  2F0F A;  3ERO A;  3FEW X;  3GTM B;  2MUY A;  2HDL A;  3NTI A;  4NW2 A;  2L4N A;  5K36 H;  3K5O A;  1H9M A;  1U4L A;  3BVG A;  3VYS A;  3ERQ A;  4TKO B;  4BY7 B;  4RFB A;  5C4X B;  1PTO F;  5G3L F;  1I6V C;  1JWS D;  2F0L A;  2EYJ A;  3EQL C;  2F03 A;  1UAP A;  1LTA D;  4KTA A;  4HSP A;  3CQZ B;  1G6Z A;  1I4R A;  1PZK D;  4HSV A;  1RJT A;  4E6I A;  4H7B A;  1GOZ A;  3PUW A;  1E2V A;  1IW7 C;  3MFG A;  3BZD B;  3A56 A;  1QIL A;  2KVM A;  1UNS A;  1TQO A;  4ZAI A;  1CA5 A;  5M3F B;  4DXG A;  1AZP A;  3S9W A;  1OXT A;  1U4P A;  1PRT C;  3QOL A;  5KYL A;  1MI2 A;  1LO5 D;  1PZI D;  2JE6 I;  2B63 B;  1VF5 C;  3SXH A;  1IL8 A;  1PMR A;  2F0G A;  2D62 A;  1A15 A;  2VXW A;  1EY5 A;  3CRK C;  1BXT A;  1HRJ A;  3SR1 A;  1MD2 D;  3M7N A;  3J7A F;  4IUN A;  2LFN A;  2AQ3 B;  1I4Q A;  5CV9 A;  2PPB C;  5LHY 1;  3BDC A;  5M3M B;  2OF1 A;  4BWG B;  2KCC A;  1WD0 A;  3O13 A;  1WTO A;  2IX0 A;  2PZT A;  1XWE A;  3W3A A;  4G57 A;  1GUW A;  4RA8 A;  4IN3 A;  3SK6 A;  4A3G B;  2F0V A;  3C1E A;  4U68 A;  2IW3 A;  2PW7 A;  5EQ0 A;  3VYR A;  1A2T A;  1SE4 A;  3KBX A;  2A68 C;  5FO7 B;  1NAP A;  4JBW A;  2AWO A;  1T5X D;  4K14 A;  1QG7 A;  1G29 1;  1E0B A;  4RHR A;  4R8N A;  5I2X A;  2F3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...