1NR2A

High resolution crystal structures of thymus and activation-regulated chemokine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
RECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymus and activation-regulated chemokine
publication title Structures of thymus and activation-regulated chemokine (TARC).
pubmed doi rcsb
molecule tags Cytokine
total genus 13
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1nr2A00
1G6ZA 3I91A 1ILQA 1XYIA 1MI2A 1HHVA 1HA6A 2HUGA 3GV6A 3I90A 2K1BA 1X32A 1EIHA 2N55A 5E4WC 1CA5A 1ESRA 4OIJA 4X3SA 2B2UC 1M8AA 1KNEA 3I3CA 2B2VA 3IL8A 4QUCA 2EOTA 1F9PA 1G2TA 1SSOA 1PDQA 1C8CA 2NWGA 2J7ZA 1RTNA 1BBXC 1JE4A 1VMPA 4RWSC 1B4OA 4XT3B 1QNKA 3MWYW 2EPBA 1F2LA 1E0BA 1DOKA 2KVMA 2RSNA 1EIGA 2MJ8A 3P7JA 2K05A 5EKIA 3IFDA 2KECA 4LMQD 5EQ0A 2NZ1D 4MN3A 2FHTA 1RJTA 1U4MA 2KUMA 1RODA 2H1EA 1SDFA 3KBXA 5CMDA 1RTOA 1U4LA 1X3QA 2VXWA 3FPUB 4IUVA 2B2YA 1B2TA 5D14A 1EOTA 4HSVA 3QO2A 2L11A 1DOLA 2XIWA 3FDTA 1DONA 1WTPA 1ZXTA 1EL0A 2N88A 1ICWA 4NW2A 4CJ2C 2IL8A 1J8IA 2HCCA 1S4ZA 1G2SA 3G7LA 3DEPA 3MTSA 1EQTA 4O42A 1B3AA 2EE1A 3GV3A 5DNFA 5E4XA 1IKLA 2BDNA 1PFBA 2R3ZA 4MHEA 3TZDA 3TN2A 1DOMA 2Q8TA 4XT1B 2L4NA 3UI2A 2B2VC 1ILPA 1BO0A 4IUQA 2KEDA 2B2TA 3D6WA 2K01A 1J9OA 4IUUA 2CVRA 1A15A 2MGSA 2JP1A 1IL8A 2Q8RE 1DZ1A 1QG7A 5T1GA 5CORA 4QUFA 4HAEA 5D65A 5EPLA 2HDMA 3HP3A 1ML0D 4ZK9B 1Q3LA 2KEEA 1B50A 2FJ2A 1WTXA 4HEDA 2MP1A 1VMCA 4ZAIA 1AZPA 1TVXA 4DN4M 4R8IA 3Q6SA 1IKMA 1RHPA 2RVLA 1HUMA 2DY8A 3I8ZA 4ZLTF 2DY7A 5EPKA 1WVLA 2B2WC 1WTRA 1HFGA 4IURA 1G91A 5CBAE 1WTVA 4RA8A 1U4PA 2SDFA 1NCVA 1O7ZA 1XX8A 2FMMA 2MPMA 1WD0A 4X3TA 4U68A 2HDLA 2K28A 3KUPA 2D9UA 5JJZA 2K04A 1CA6A 2B2YC 1PLFA 4OIKA 2B2UA 1BNZA 4ZKCB 4XDXA 4HCSA 1NR4A 1JICA 2K03A 2X6LA 4RAUC 1O80A 1X3PA 1WD1A 1SAPA 1WTOA 1F9SA 3R93A 2FINB 2RA4A 1B53A 1MGSA 1LV9A 3DM1A 4IUTA 2L12A 4X3UA 4CJ1B 1F9QA 3N52A 1HUNA 4UAIA 5EPJA 4CJ0B 4ZKBB 4X3KA 3SVMA 1MSGA 1GUWA 4IUPA 5CBEE 3LWEA 2JYOA 1AZQA 2KOLA 1CM9A 2B2TC 2L9HA 2X69A 1HFNA 1F9RA 1KNAA 5AFWA 1NR2A 2NYZD 3F2UA 3ONAB 5COYA 1AP0A 4R9WA 5EJWA 5T1IA 1HRJA 1QE6A 2M2LA 1PFMA 2FFKB 1U4RA 1WTQA 2X6GA 1MSHA 2B2WA 2L1BA 1NAPA 2RSOA 3H91A 1O7YA 1WTWA 1PFNA 2HCIA 3DEOA 1BF4A
chains in the Genus database with same CATH superfamily
3PMFA 1ZKOA 2HUGA 3B6YA 4CDEC 1FD7D 3K7AH 1HPCA 3NK9A 3PO3G 4IJHA 2Z0SA 2F0LA 1YBYA 3I4NG 1PDQA 4TQUS 4OO1I 3K0YA 3HOZG 1ICFB 5IGCA 1QOHA 5D3IB 1BBXC 3U4ZA 3W3AA 2ZM6Q 5IYCG 5JJKA 2PYKA 1ASYA 3C1EA 2DJFC 3E9IA 2NUCA 4LMQD 1M90C 2RBMA 3J80c 3KOJA 1A2UA 1NE3A 4X62Q 3CAMA 3K7AB 3J7YW 1W3SA 1RTOA 5GQOA 1X3QA 1B2TA 1S3OA 2CQOA 3T4AC 5GAHC 2MNAA 1QZGA 3H94A 3NBHA 1U5KA 4CJ2C 2KENA 2EYLA 3GQBA 1MJEA 4O42A 3S1QH 4BY7H 4UY8C 1M1KC 5CGKA 1PYBA 4MHEA 1OO9B 1EY9A 2NN6H 5I6WA 4DV4L 1A2TA 2F0QA 3A5ZB 4YHHQ 1Q46A 2F0OA 4NKLA 5CV8A 1PZKD 1STYA 2PW5A 1VQEA 1X3FA 4X65L 3R8BA 2B2WC 1U4PA 1IW7D 4DNRB 2OQ0A 2PNHA 3EJIA 1YNXA 4LF4L 4FXGC 4JI4Q 4JI3Q 2F0UA 4JOIC 5LL6X 2JA9A 5CV6A 1LTGD 2XWBB 4DU9A 2D0PA 2N78A 3HKZB 1VF5C 1SAPA 4IJLA 1QVGA 1Z6HA 3I70A 5NUCA 3RD4A 4DUZQ 1CUKA 4LUZA 1QUQB 1XMOL 1TXYA 5I2XA 1V1OA 3A7LA 3LWEA 3JAMi 1CQFA 1LABA 4Y7NB 2ZJRA 1JB3A 5HGTA 1Q86C 2NYZD 5DLQE 3I4OA 1SE8A 4KHZA 5DM73 1EIFA 1VDZA 3FEWX 5EBDA 3K80C 5GAGC 1MI2A 4EGVA 3R3OA 1PH7A 3CRKC 4EQOA 2N55A 1Y1WG 3VYUA 1U0LA 2BA0A 1KQSA 1WTHA 3UE1A 1W6KA 2UU9L 4LF6L 3A7AB 2A6EC 4DNIA 3VR6A 1JE4A 3F2DA 2VQEQ 1VQAA 4DKAC 1K8AC 2O4XA 3PGZA 4IFDJ 3CHBD 3CC7A 5DM63 1X56A 1Y8OB 5IWAL 2UXDQ 4UP7A 4KN4C 4A3DG 4NDXA 5ELOA 1I4XA 1D7QA 2F0DA 4JI1L 1V1QA 2RKSA 1F77A 1U4LA 1IBMQ 4IUVA 4GKJL 1GKHA 5FLXc 3FDTA 4NW2A 2JSOA 3T1HL 4HJAA 3G7LA 1UE1A 1QVCA 3OW2A 2NBFA 4XQNA 3GV3A 4YIJA 1IBKQ 4K8IA 1DOMA 2O2LD 3KFUA 4XT1B 3A55A 3NTHA 4LF7Q 2UXBL 2O5IC 3PO2G 4A4IA 4DV6L 5K5PA 4E6IA 1D2BA 2FMCA 4G57A 3CPWA 1ASZA 3A56A 1RDPD 4JI8L 1OXTA 4ZQ3A 3RLFA 2E5LL 4HAEA 4K2KA 4J8QA 1NMFA 1YHAA 1VQ9A 4XTCS 1BQQT 2LMCB 1WVLA 1WTRA 1G91A 4IURA 5JEAH 3TS2A 2E76C 3BG3A 5IGGA 4QMGA 4CKEA 3I7FA 4JVZA 3MFGA 1XTDA 2B8GA 2UXCQ 1JT8A 1D5ZC 1PH8A 4PG3A 1BCPB 3C3LA 2Y0SB 3KJOA 1I4GA 4NB3A 3J81j 4KD4A 5JPNC 2XRQD 3NWSA 1PA6A 2Z1CA 4G7OC 2RQXA 5JJLA 1MGSA 3U9OA 3PO3H 5EBCA 3J7ZC 4HIDA 3HOZH 4B9WA 1PRTB 1GUWA 1LT3D 2JA5H 1WCMH 1AZQA 2M00A 5IYCH 2X69A 2R7DA 5C0XG 4B3ML 4QGUA 1N33L 4NPSA 1FNUA 2YTXA 1HNXL 2F0SA 1ZEQX 2QKIC 2Z4HA 1HR0L 5EAYA 3PO3B 5D65A 1XMQQ 2EY1A 2JK8A 2VB3X 1EU3A 4GOPB 2JA5B 1V43A 1WCMB 1CZGA 4OIJA 3J81L 1NTGA 3IL8A 4AYBG 4YCUA 1S5FD 1E2VA 3KJPA 3S17H 1PYWD 2MO1A 3J80i 2E2JH 4LFAL 1VMPA 2FXQA 4HJ7A 1HQRD 4HMIA 5IY0A 4XQQA 2AUJD 4IPDA 1JB7A 2HQLA 5EKLA 5A2QL 3IFTA 4GS3A 4ABNA 1JJ2A 2IT1A 1O7IA 2NVYH 4AH6A 5IGEA 1YJ9A 3S17B 4A3FG 3HOUB 1IBLQ 5D14A 2XTIA 1EOTA 2L11A 2KJXA 2E2JB 3FKIH 1TR5A 1WTPA 5H1SE 2JEAI 1BCPF 4OHJA 2WP8J 1G2SA 3S1RH 1B3AA 3DUZA 2EYOA 1K0RA 4ZUJA 3EFXD 2R3ZA 2R6GA 3SE0A 3TN2A 2HT1A 3K7UC 2A68C 1YEZA 2B63G 3SK4A 3D6CA 3OIQA 2NVYB 1J9OA 3RR5A 1PRTF 2DN8A 1QG7A 3TS0A 5CORA 1PRTD 3T1YL 3FKIB 3HP3A 5IT9E 1Q3LA 3KLWA 3PQIA 4DR1Q 1QJOA 4GOPA 3S1RB 4KJNA 2EZVA 2DNEA 4LAAA 2QEXA 4HJ9A 4NXML 2EYFA 3UDIA 4IO9A 2EYPA 4LF9L 1GOZA 4H44C 4AQYQ 2B2UA 1OXVA 2CHBD 2AMCB 2ZTEA 1J6QA 3OSOA 2NZHA 2I07B 3S2HH 2NB0A 1Y1WH 1Y14B 1FL0A 1AH9A 4TSSA 1VQDA 2A8VA 3ZJYC 2ZJPA 4KKSA 5M3FG 1H9SB 4LF8L 4DV3Q 1HZBA 5JJIA 2EYJA 4DK0A 1SJHD 5FLMG 1KNAA 2F0GA 3FVQA 3J80E 4IOAA 2R93G 1EYCA 1C0AA 3S2HB 4S3SA 2X6GA 1STBA 3E0JA 3MHBA 1G6ZA 1TWAH 3QR8A 4A93H 1N9WA 1JOQA 2BDOA 3K5OA 4HTHA 3PIO3 1CA5A 4X6AH 1ESRA 5LMNL 1F9PA 3W1GA 2NN6I 3AB9A 4N8FA 3H09A 3F2BA 5EGTA 3TSSA 1C8CA 1LTLA 3KLSA 4EX5A 3PUXA 1RTNA 1N36L 4OONA 1QNUA 2HHHQ 1BVSA 1SBBB 2KHIA 3NXWA 1TWAB 4A93B 2R92G 4GZYC 3D0FA 1PZID 5C4XB 1LLRD 3W2DA 2F0KA 1J5EQ 1SE3A 4KTAA 2NZ1D 3A5UA 1CKNB 1IYVA 1RODA 1V1PB 3CPFA 1G291 2G9DA 1PVOA 1B1ZA 1ZXTA 1R4PB 3G4SA 1CSQA 2A6ED 3VA5A 2PQAA 4P2CB 1B9NA 1XTCD 2BA1A 4JI2L 1XNQL 2VUMH 3UI2A 1YITA 5BN5A 3J81c 3MXPA 2MHVA 1PTOC 1I4HA 1KD1C 1TWFB 1SE4A 1VQBA 1YZ6A 1Q7YC 2F4VL 3EN2A 2KEEA 1EWCA 2M9VA 5CYUA 1KAAA 3CD6A 5C0XH 2RVLA 1SRUA 5C44H 1HFGA 3BDCA 1VQCA 3RLNA 2VUMB 2OCEA 4DXGA 3HOWG 5FO9B 4DV1L 4J1MA 1EY5A 4K6LA 1O80A 1UE6A 4IQZA 2E8GA 3R93A 4KY7A 2FINB 4IUTA 5C44B 4OX9L 4UAIA 2NVXB 1SMYC 4FNFA 3GTJH 5CBEE 4IPCA 3HOVG 4DK1A 3ONAB 2JEBI 3K59A 4A3GG 1T5XD 2I0QA 1SNCA 1YI2A 2EIFA 2K5DA 3J7A5 1NNXA 5FLXE 1CZWA 1YHBA 1QVFA 2Z6KA 3DEOA 1XYIA 3GTJB 4BBSH 1T5EA 2L15A 4C3JG 1JQYD 2JA6H 5GAEC 3OMGA 1L2FA 1G8ZD 2KCTA 4LW1A 1KIXA 1TKWB 1HJPA 2SNMA 2NZOA 4DFAA 2B63H 1JR0D 3SHLA 4X65Q 4M8AA 1MIUA 1JMCA 2CCZA 2EJMA 4POGA 3I4LA 4BBSB 2Z6BA 4WJWA 4LF4Q 1Z47A 2WIIB 2JA6B 3KBXA 3DHQA 3OHXC 2B3GA 2B2YA 3KDFB 2PCFB 3QO2A 3KF8A 1DONA 5E1FA 1I6HH 5M5XH 1HA5A 1H9JA 4R4IA 3RZDH 1XMOQ 3E9HA 1WYDA 2WINB 1L0XB 2D2CC 2L4NA 1K73C 3DLLA 1BO0A 4IUQA 5IIFA 2VS1A 4RKLA 3WOEA 1GUNA 3PUYA 2Q8RE 1DZ1A 3DMUA 5M3MB 1EQVA 2WB1E 5M3FH 1MHWC 1I6HB 5M5XB 1X55A 2MP1A 3RZDB 1SJED 2E2IH 2MPMA 1VQ4A 1E2WA 1R4QB 2D9UA 3D4WA 2A68D 4APVA 1N8RC 1X3EA 4LF6Q 3AQQA 4JYAL 1YIJA 1JICA 1KTKA 4FXDA 1AW7A 4J6HA 3H0GG 1K8MA 2WAQG 1YVCA 5IWAQ 2E2IB 4BA2I 1PTOH 2OF1A 4IUPA 3NHHA 3KDFA 5ELBA 2L9HA 4P75A 4JI1Q 1XJVA 1Q12A 2F0PA 1NR2A 2UUAL 4GKJQ 5KIXA 2R92H 3HG9A 1DCZA 1KL9A 2F0EA 4UPAA 5L37A 1BR9A 1NBWA 4DR3L 3T1HQ 1GUGA 3E3XA 5CV9A 1NAPA 3CCLA 2SEBD 4K6DA 3MEHA 1ILQA 3BU2A 1NJIC 2OTLA 4A3KH 2UXBQ 2VZAA 1EIHA 5E4WC 4K0KL 4DV6Q 1KNEA 2B2VA 3V96A 2EOTA 2E5LQ 4JI8Q 3NWTA 3CU7A 3E6ZX 4RG1A 4B3TL 5BN4A 2QF7A 3RN2A 1L1OA 4UP8A 5IT9c 1EUJA 5FO7B 1E2ZA 3SR1A 1GD7A 4A3KB 4N9PA 1F2ZA 1N34L 3SDZA 2R7ZH 2CW0D 3I4MG 2G9HD 3FMCA 2UUCL 3CKIB 2VXWA 2ZJQA 1X65A 3GO5A 2XVSA 4A3EG 1GJXA 3J81i 3HOYG 2IX0A 2HCCA 1E1TA 4FF3A 1I94L 2RDGA 5CC4A 1HZCA 3GP7A 3RNUA 3S2DH 1IKLA 5G3LF 4B9XA 5G3LD 3D3RA 4B3MQ 4L5SA 1N33Q 2R7ZB 2EYMA 5ISRA 1K28A 4IUUA 1HNXQ 4ILWA 1A15A 2F52A 5IYBH 4KN7C 4RFBA 2LSSA 1GUSA 3X3NA 4UHVA 1TS5A 1PH5A 1D8LA 4OL7A 3DWAA 5DAUA 1Y1VH 3HOVH 3E5SA 1RKNA 4A3GH 3S2DB 4RHSA 2MO0A 1WD0A 2HDLA 2K04A 4OELB 3DWPA 4QY7A 1SMXA 1PLFA 2BH8A 1PTOF 1VQFA 1KXLA 2AWOA 1PTOD 3U58A 2PZTA 3OIPA 3TP8A 2K5VA 3D4DA 3CMAA 5IP9G 5FO8B 1Q81C 1Y1VB 4HIOA 1LV9A 3D31A 5F2DA 2HD3A 2IW3A 5KYIA 2N3SA 3S1QB 4BY7B 4A3CH 2WFWA 1AEXA 3F2UA 4ZUIA 3C1FA 4EQNA 4QB4A 4B3SL 3JC66 2F0NA 3P20A 4NXNL 1U4RA 1STGA 1O7LA 4BS9A 5KNCA 5C0XJ 1C9OA 3K0XA 4QL5A 1JOKA 4ID6A 4DK6C 4DR2L 4JI7L 2L5TA 3GTLH 3KLSX 3DM3A 2EJFC 1AE2A 4DV0L 1SMYD 4X3SA 2Q2UA 2B2UC 2BCOA 4P72A 1CSPA 2CFMA 2K5HA 1IZ6A 2F0IA 4C56C 3T1YQ 2EXZA 3J81E 1LTID 5E3FA 2K7VA 2EPBA 4WORA 1FVIA 4KY5A 1STEA 4JI5L 4NXMQ 3GTLB 2WACA 4C3IG 2F3IA 5IP7H 5A2QE 2QEJC 3AU7A 2L0CA 1VS0A 2A6HC 2XIWA 2IL8A 4F88A 2F1MA 2WB1B 1S4ZA 4GNXB 1EEFD 1EQTA 3CCRA 1JJGA 1EEID 1XWEA 4LF8Q 4P73A 3H3VI 2PQEA 3Q24A 1KRSA 1SLJA 3D6WA 1V9PA 2IX1A 4OO1G 1IYUA 1BKBA 2PO4A 3G6EA 4K2LA 4RGOS 2IPKD 4GKKL 4HEDA 1IKMA 1EWIA 3MC0B 1QUQA 3M7GA 2ENBA 1F2MA 1I6VC 2F0WA 1XX8A 3GTGH 3OTOQ 3G48A 5LMNQ 4R4CA 4C3HG 2JA7G 2VL6A 4IFDI 3S16H 3K5LA 4A3JG 1N36Q 1KDAA 2PI2E 2XN9C 2ZXRA 2K33A 4JK1C 1HUNA 1F9QA 1LT6D 4A3BG 4ZKBB 4A3IH 3GTGB 1S5DD 3TBIB 3R2IA 1C48A 1HQMC 4QQBX 1CT1D 2RHSB 5AFWA 4BBRG 1EZ8A 1E24A 3S16B 4R9WA 4DR5L 1SNMA 1HZAA 4RGMA 5C5LA 4G7HC 3FRPB 1S5ED 2B29A 1EU4A 5JAVA 4JI2Q 1XNQQ 4A3IB 1OXXK 3E0EA 3EIVA 2I5MX 4FXKC 1VQHA 2QA4A 5BR8L 3HOYH 3GTMH 3I4NH 3KK7A 2NTSA 4HCEA 2I5HA 2BE5C 2JJQA 3OOCA 5HY6A 4BY1G 1G6PA 2F4VQ 2KA7A 3PIP3 1X6OA 1FJGL 1F2LA 3G71A 2GN5A 3ICEA 1AE3A 4MN3A 3ERSX 4KK7A 3GTMB 3I4NB 1FGBD 2JN4A 3HOZB 2AHOB 2ZM6L 1SR3A 4DV1Q 1I3QH 3KF6B 3MXGA 4HSVA 4JBMA 4OWWB 2F0FA 2Z6KC 5C3EG 4OX9Q 1SNPA 4AYBE 4YY3L 5IP9H 2E74C 4DAYB 1ILPA 1I3QB 3HKSA 1IL8A 1D1KA 2F3WA 1UUPA 2EY5A 3LGJA 2V1CC 2JE6I 4DR7L 4U673 2K5QA 3FHWA 3H15A 2PNRC 4DV2L 1B8AA 1HUMA 2WKDA 3I8ZA 4ZLTF 3AMUA 1NCVA 5LMUL 2YV5A 1Q82C 2B2YC 4YCWA 4RCOA 3TP6A 3MFYA 4ZRZA 4JBWA 2F0TA 4X66Q 3PSIA 1VCIA 2ASBA 3HRZC 1LT5D 1R9TH 1FNWA 1B53A 4C1NI 2E2DC 1EY4A 4KKUA 4CJ0B 4IFDG 4ME3A 4PMBA 1DYQA 4NMZA 4POFA 1LO5D 4PNYA 5IE8A 4B08A 1F9RA 4YCVA 3NTKA 2J4XA 4KY6A 3H3VC 4DUZL 4TRDA 3A8IE 4C3IH 1R9TB 2B2WA 2RSOA 1O7YA 3QB3A 5ELNA 3I91A 4PMWA 1HHVA 4HMJA 1JCKB 3TP5A 2K1BA 2PW7A 3NBIA 1EIYB 3QJYA 2VW9A 1EY6A 4K8JA 3TP7A 4QUCA 2J0TD 4BWGB 4RMFA 1PH9A 1OTCA 2YTVA 1CFMA 3HOXG 5K36G 4RWSC 5KYLA 4DV7L 4C3IB 4PZ6A 3MWYW 3NUCA 1H95A 2A73B 4KV6A 2ES2A 2OTJA 4OO1H 1Y1WB 3IFDA 4A3DH 3K57A 1PH6A 1FNVA 3A8JE 2JA8G 5CMDA 1STHA 1A0IA 2IHFA 1TS4A 2Q8IB 3I55A 4JYAQ 4RHRA 1DGSA 2UUBQ 4DAVA 2IJ0A 1EL0A 1HTLD 5I6YA 4C3HH 1IYJB 2JA7H 1WJJA 3NP8A 4CHTB 5FK9C 2IWHA 1KHIA 3BYTB 4A3DB 3NQTA 1PFBA 1A6XA 1EQRA 3PO2H 2F0VA 3K6OA 2B2VC 4FO2A 1K8OA 1D1IA 2IHEA 2PMZE 2KEDA 2UUAQ 2B2TA 4HIKA 1M4VA 1O78A 4IALA 3U4VA 2A69C 1VQ7A 4QUFA 1L1OC 1SNDA 2HDMA 1PFSA 4H02A 3BJUA 2FJ2A 3BZKA 1I4QA 3P1HA 5JPMC 2A6HD 1VMCA 4C3HB 4RCNA 3Q6SA 1RHPA 1CHPD 4HR7B 5ELFA 1Q8KA 4LF7L 4L5TA 4HJ8A 4V190 1FYCA 1F2YA 3LNNA 4FF2A 3PO2B 1VQNA 3RMHA 3I73A 4X3TA 4K0KQ 1H9SA 2EVBA 3EBEA 4OIKA 1E7ZA 4B3TQ 4TVAB 3GDEA 2SNSA 4DNTB 2X6LA 3BVMA 4JG2A 3SK5A 3SEBA 5EPJA 4R1JA 4X64L 3KBGA 1N34Q 3QWNA 2UXCL 3BYYB 2A5HA 4R4QA 4J15A 4O2DA 5FJ8G 4F7XA 2UUCQ 1FR3A 3F2CA 1B7YB 5COYA 3RZOH 2VQFL 2CH4W 1E22A 1DM0B 1ONLA 3RLOA 4JPBW 3VR5A 1G51A 2AQ3B 2FFKB 3M4QA 4RH6A 3MXNB 5JVH3 1I94Q 2L1BA 2MFIA 3H91A 1PFNA 1SYEA 2XRSD 2VNUD 5IYDG 1HA6A 4RKBA 4KJOA 1KC8C 3I56A 1U9RA 1DJRD 1XXGA 1CKNA 2K75A 1KLUD 3I3CA 1V1PA 4LFCL 4H13C 2K52A 1S72A 4KKTA 2NWGA 1GUOA 3PIOA 5IGFA 2ATWA 3Q8DA 1QILA 3FP9A 4JI0L 3M4PA 1Y8PB 3MXUA 2Q2IA 4KI0A 5EKIA 4AYBB 2NVTH 2CWAA 2H1EA 4A3FH 2B8FA 3FPUB 5J3BA 4DV4Q 2BE5D 1BBWA 2N88A 4DV5L 3CRLC 5CV4A 2K5WA 3WWVA 4ZYSA 4DR4L 1YHQA 2EE1A 4K5WA 3FPPA 3QIAA 3HZXA 4XQJA 2NVTB 4NP5A 1IBLL 4A3FB 2OEOA 2NN6G 3T56B 2CVRA 2LFNA 3MXNA 1HTPA 5EPLA 4NXNQ 1PMRA 1LM0A 1LYLA 5TSSA 4ZAIA 3HKZG 4R8NA 5AJ3L 2B63B 1H9KA 2EJGC 4DR2Q 2JQOA 2D5DA 4JI7Q 3BVGA 4DV0Q 2EYHA 2C35B 4PMCA 4O1NA 4KHVA 1I4RA 4XYQA 2RDHA 3W5OA 2I46A 5KGUA 1H9RA 4OEMB 3Q23A 3I2ZA 1PYSB 2PPBC 4PQXA 1F9SA 4CGYB 1TWCH 4JI5Q 1A62A 3N52A 4X3KA 5KEEA 2LXKA 4ALPA 4R4TA 5A35A 4IPGA 3TDQA 5FLMH 2R93H 2Z4IA 2DJGC 3CCQA 1PV4A 4L5RC 4BXXG 3PUVA 1ET6A 2JA8H 1A8VA 2UU9Q 1CKMA 1K83H 1TWCB 5M3FB 1KLGD 4MNOA 1XNRL 4ODGA 1FGUA 1K0SA 5JOBA 1JJCB 2R93B 3A54A 1NSNS 1LACA 5KRUA 3VR2A 4FF4A 2WAQE 2J7ZA 2Q2HA 2BOSA 1DXMA 3L3OC 1STAA 1SROA 2K6AA 5ELDA 1EYGA 4OWXB 1RJTA 1EQQA 1ENCA 2CWPA 2KUMA 3ULPA 1SDFA 2AQ2B 1TU2B 1PTOB 2PMZB 3NELA 2HHHL 4A3LG 4GN3B 2CKZB 1MKHA 1SYCA 2Q2TA 3EROA 2R92B 1B3QA 1BBUA 4TKOB 1EYDA 3DWQA 5E4XA 4I65A 1CKOA 1VF7A 4OGQC 1WI5A 4OXPA 4EVOA 4LF5L 4DR5Q 3AEVA 3NE5B 5IGBA 4K14A 4DUYL 2Y0SG 1WTXA 4PZ8A 5FJ8H 1A63A 3ITPA 1QZHA 2NVQH 4KHPL 1HXYD 4RA8A 1BUVT 1HNZL 2FMMA 5JEAG 3HOWH 3KUPA 5JJZA 5FOBB 4GLAC 1VQ8A 4AIMA 3NEMA 1FJGQ 3RN5A 2A69D 3URYA 3VDYA 4G4KA 5C3WA 3QOJA 1UEBA 5BN3A 2EDGA 4IPHA 3IAYA 2NVQB 1HR0Q 3U9SA 3CCUA 4DPGA 1UE7A 2CH4A 2KCMA 3HOWB 1Q1BA 4B3RL 2Z8LA 2JA5G 1WCMG 1BCPC 4LUOA 1VQIA 1EYAA 3STBC 1QE6A 3NTIA 1TWHH 2B39A 3J7AV 1TY2A 1WFQA 3OPOA 4A3MG 1LT4D 1NMGA 4YWLA 4LFAQ 4YY3Q 2QILA 1VQ5A 3OWEB 1PRTC 3GV6A 4C3JH 3U50C 3P75A 1VQLA 3J7AF 3HOVB 3T53B 2F3VA 3SK8A 4A3GB 1STNA 5I9PA 4GLVB 1TWHB 3HOUG 3PV0A 4GN5A 4DR7Q 4JI6L 5J39A 2TMPA 1JWMD 3TMEA 1EOVA 4DV2Q 3G6JB 5C6AA 2MJ8A 3L2PA 5LHY1 3CCVA 2IY5B 4C3JB 4GOPC 3CCJA 1EY7A 1K8GA 3S1NH 5LMUQ 2XWJB 4WJ4A 2V4DA 1U4MA 1ZYRC 4QF4A 1I4PA 2TSSA 2DUDA 1GVPA 3AFQA 1PH4A 5GROA 4A75A 3MA2B 4XYOA 3GTKH 1A3VA 1DOLA 2EXDA 1XPRA 2EY6A 3FKIG 4CDDC 4DAPA 1CI3M 3CW2C 4Y7NH 4ZCKA 3S1NB 4LUVA 4LFBL 3WOFA 4P71A 2VY3A 3Q0AA 1P16A 2K01A 3PUWA 5C0XI 4LF9Q 1HH2P 3GD7A 3GTKB 4EQ5A 2K14A 5ELCA 2P5ZX 5C4ZA 1TVXA 1HZ9A 3ER0A 4DAMA 2O5JC 3M4YA 2QDLA 1N32L 5CBAE 4HN7A 5HGQA 5FKAC 4UDUC 4BXXH 1TWGH 2K28A 3BZDB 1A3UA 3PF5A 2F4IA 1VQMA 1HR0W 5CV5A 3TZUA 4DV7Q 2OWOA 4C1NK 1QB5D 3H0GH 4WJ3M 1X3GA 1SXTA 4CDCC 1UWVA 4KD3A 3UDGA 4FYDA 3O13A 5KNDA 4JV5L 1TWGB 2K50A 5GADC 2KOLA 1CM9A 1A3TA 2B2TC 2PZUA 3V05A 4BA1I 1KAWA 1I50H 1VQPA 1AP0A 1GXDC 3K5MA 1PFMA 2LXJA 4CDFC 1CK1A 2XGTA 3H0GB 2WAQB 1PH1A 1SYDA 1IL2A 4DR6L 1JE5A 1WTWA 2QCPX 3VR4A 3BZCA 3L0OA 4X3UA 3S14H 2EY2A 2HCIA 1BF4A 1EFWA 2QGQA 1YJWA 4A3LH 4A93G 3PCOB 4PZ7A 5C4XG 4DGZA 1Q8IA 4CKCA 5E7NA 2QDBA 2K4KA 1S40A 1TT2A 3QG1A 1I50B 3BVZA 1SYBA 4I7ZC 4CBVA 4A76A 1TY0A 2KCCA 2YU9H 1PH2A 2KBNA 3N6RA 2OQKA 4PV1C 4GNXA 3S14B 4FDBA 4XXEA 2AWNA 3TEHB 1BXTA 2ALYB 3I4MH 3BS1A 4F8MA 4KLKA 2XSCA 3MVVA 4V0BA 3CP0A 1EY0A 1XPUA 4A3EH 3HFZB 2GA4B 2MUYA 2YU9B 3JAME 1WOCA 1J8IA 2OXPA 3CQZH 1GO3E 2ZXOA 4GLXA 3DEPA 1HNWL 4O0AA 1RD9D 4X64Q 1W2BA 1C7YA 3A8KE 1QCBD 3ULLA 3I4MB 5JVG3 1CHQD 3S24A 2VUMG 1II3A 2VQFQ 1ET9A 3VR3A 2H5XA 3IKJA 2MGSA 5C4JH 3MAQA 4A3EB 3HOYB 1B50A 3CQZB 5M5YH 3Q22A 1MJCA 4Y52H 4Q5VA 2DY7A 3LX0A 3GTOH 5C44G 1O7ZA 5IOCA 1W6JA 1VQKA 4LFCQ 4X62L 1EWHA 3X3MA 4A3MH 4QIWE 4R4OA 3K5NA 4HIMA 1S5BD 4ZKCB 4JCVE 5C4JB 3UDFA 1X3PA 3KLRA 4RGNA 2LKVA 5M5YB 4JI0Q 3DM1A 4CJ1B 4F87A 5LMNW 3GTOB 4KMUC 5M9OA 1JWUD 3HOUH 4C2MH 2C5CA 4A3MB 2A19A 2RF4A 2IX3A 1YNJC 4YHHL 3SGIA 3IRBA 5T1IA 5LL6S 1AN8A 4IUNA 2I5LX 2NTTA 4DV5Q 1MSHA 4DR4Q 1Z9FA 5M5WH 3H6MA 1JC7A 3K8AA 1EY8A 4C2MB 3I72A 2XNAC 4BBSG 1M8AA 1SN8A 4JI4L 4JI3L 2AKWB 2JA6G 1K3RA 3KF6A 4JW0A 1BCPD 1T9HA 2KHSA 2WV6D 5CV7A 1MD2D 2N49A 4MTNA 3STBD 2KCNA 1B70B 5D3DA 5AJ3Q 4I7AA 4L6TB 3T51B 5M5WB 3K81C 2D62A 5KNBA 3F8TA 3P7JA 3PIPA 3NSWA 2A74C 2KECA 1UNSA 3ND8A 1OXSC 1V8QA 4QJFA 5I4DA 4DAYA 4DF7A 1YNNC 2E75C 1C4QA 1DD2A 3CC4A 4JOIA 3OMCA 3HGBA 3A74A 5M3MG 3NENA 3S9WA 2ICEC 3VA7A 1Q1EA 1EFID 4K5VA 3S15H 2GVBA 4Z9CB 2BDNA 4YWKA 4L63B 1RF2D 1ZYRD 4L5QA 3AYHB 1Q90A 3M9BA 1OXUA 1NY4A 1HCZA 1TS3A 3JAML 1UEAB 3A0JA 2VQEL 2ZTCA 2PQAB 1B9MA 2DY8A 5EPKA 4L8JA 1XNRQ 3S15B 2N8NA 3K58A 1JORA 2UXDL 4DXFA 1LTBD 5C5MA 3WDNA 3F1ZA 1RL2A 4A3JH 4XDXA 1IBML 1IXRA 4YWMA 2K03A 1CQVA 4RAUC 5C4XH 1WD1A 3M4OH 2CW0C 3EVQA 4A3BH 3OTOL 4DR3Q 3L9AX 2JA7B 1IBKL 1GHKA 4ME5A 4BBRH 1PH3A 4HJ5A 3V2TA 4LK1C 2LS01 3M7NA 4OWTB 4HSPA 4A3JB 1P8LA 3C46A 3CMEA 3L7ZC 5EJWA 2EQSA 1LTSD 2AUKA 3M4OB 1SFOH 2R7FA 4A3BB 1LTRD 1L0YB 4G7ZC 1E3PA 1JOOA 1LTAD 2DNCA 1X32A 1TWFH 2RCFA 1QWYA 3MZ5A 4BBRB 3LWUA 4A3KG 4LF5Q 2E2HH 3GTPH 4BY1H 4LWCA 1VQOA 1Z7TA 4DUYQ 1TS2A 1KABA 1PHJA 1TIID 2RHQB 1PZJD 4XT3B 1KRTA 1QNKA 1SFOB 2WKCA 4LNQA 1SYFA 2F03A 1E0BA 2OT2A 1K9MC 2KVMA 4XIGS 3SXHA 4KHPQ 3VYTA 2K05A 4JBJA 1HNZQ 5EQ0A 3CCSA 5J22A 3GTPB 2VB2X 2E2HB 3QOLA 3ULJA 4BY1B 3DXJC 2R7ZG 1E1OA 4FVMA 3CF5A 4DK3C 2HIXA 3RZOB 5C4HA 5C3EH 1ICWA 4H7BA 3NQIA 4N8X1 2NVXH 1Y69U 1GUTA 2PI2A 1IW7C 2Z9HA 5J1ZA 3ND9A 1XMQL 4FP5D 1ESFA 2K32A 2ZXPA 4B3RQ 3OYYA 3ZYYX 4WRDA 1L0WA 2HQEA 5IT9L 2F0JA 1VQGA 2AQ1B 4QIWB 3CCMA 3KF8B 4Q0FA 5IYBG 1ML0D 3H3VH 5C3EB 4EQPA 4IOCA 5ELEA 1X54A 1AZPA 4R8IA 3EQLC 5HURA 1Y1VG 2SOBA 4IN3A 1ENFA 2SDFA 3M85A 4U68A 3KYHC 3GTQH 1KDBA 3OWFA 3CXCA 4UP9A 4BY7G 2YYZA 1NR4A 1Y8NB 1D5MC 4JI6Q 5JEAJ 2H4OA 1WTOA 3HS0C 4B3SQ 4IFDH 3TRZA 2F0HA 2HIVA 2DGYA 3RUZA 3SVMA 4MZ9A 1LUZA 3J80L 3S1MH 5DEHA 3BDOA 4K5XA 3GTQB 1SNQA 4X66L 5CR3A 1PXUA 1HFNA 3M3YH 1RIPA 3CCEA 3TREA 4A3CG 2RDFA 1B44D 3HKZE 3PF4A 1GM5A 4FF1A 4QCLA 1KDCA 2BH2A 4MIUA 1AFPA 3JAMc 3HEJA 1WTQA 3D4RA 4DR1L 5EKKA 1YJNA 4LFBQ 1SNOA 4M1UB 3I90A 3S1MB 1SEBD 3SK6A 1GHJA 5M3MH 3M3YB 1G2TA 1RCVD 3HOXH 4AQYL 1SSOA 5K36H 1D6EC 1H9MA 1VQJA 3AFPA 2G5DA 1YNJD 1B4OA 3OW7A 3UDXA 1DOKA 2RCNA 3W1BA 2RSNA 1EIGA 1N32Q 2WB1G 3C2PA 2JXMB 2FHTA 1VQ6A 2L55A 3PUZA 4DV3L 1XPOA 3NPPA 2ZT9C 2KQ3A 3UE0A 5IP7G 2F0MA 3HOXB 3R2TA 1MBYA 2KHJA 3TQYA 4CKBA 4IZ8A 1L1OB 4H0LC 4ULLA 4P74A 3BDLA 3MTSA 1NUCA 5IODA 4LJZC 3CC2A 4GKKQ 5DNFA 2JA8B 3D8GA 2C9OA 3TZDA 4JV5Q 1UE5A 1K83B 2Q8TA 4JBKA 4RGTA 2R61A 4N9TA 2UUBL 2GVAA 1S5CD 1YNND 2JP1A 1IHZA 1UAPA 5T1GA 1EZ6A 3VYRA 4DR6Q 4ZK9B 4GNXC 2PZWA 1X9NA 3ERQA 4DN4M 4MTKA 1CTMA 1JWSD 2D0OA 1SE2A 1BDOA 1WTVA 4GN4B 3EA6A 3T16A 1J5EL 5I2YA 1CA6A 1SYGA 2QW7A 5I9OA 2ICIA 2YTYA 1BNZA 2LY7A 2K5NA 4HCSA 2CQAA 3MEFA 4DA2A 2ID0A 2RA4A 1TQOA 2ZTDA 3VYSA 1D5XC 2L12A 3NBHB 4WFN3 1ENAA 1I5FA 1MSGA 5C3XA 4A3IG 2JYOA 1BOSA 2Y0SE 1K3BC 5IGDA 5BR8Q 1HRJA 5FLXL 2A1AA 2M2LA 1LTTD 3T13A 1HNWQ 4JC0A 2MQHA 5IYDH
chains in the Genus database with same CATH topology
3PMFA 1ZKOA 2HUGA 1FD7D 1HPCA 3NK9A 2F0LA 1PDQA 4TQUS 4OO1I 3K0YA 5IGCA 1QOHA 5D3IB 1BBXC 3W3AA 2PYKA 3C1EA 2NUCA 4LMQD 2RBMA 1A2UA 3K7AB 3J7YW 1RTOA 1X3QA 1B2TA 3T4AC 3H94A 3NBHA 4CJ2C 2EYLA 3GQBA 4O42A 5CGKA 4MHEA 1OO9B 1EY9A 2NN6H 5I6WA 1A2TA 2F0QA 2F0OA 4NKLA 5CV8A 1PZKD 1STYA 2PW5A 3R8BA 2B2WC 1U4PA 1IW7D 4DNRB 3EJIA 4FXGC 2F0UA 5LL6X 5CV6A 1LTGD 2XWBB 4DU9A 3HKZB 1VF5C 1SAPA 1Z6HA 3I70A 5NUCA 3RD4A 5I2XA 1V1OA 3A7LA 3LWEA 1CQFA 1LABA 4Y7NB 1JB3A 5HGTA 2NYZD 4KHZA 5DM73 1VDZA 3FEWX 5EBDA 1MI2A 4EGVA 3R3OA 3CRKC 4EQOA 2N55A 3VYUA 2BA0A 1W6KA 3A7AB 2A6EC 3VR6A 1JE4A 2O4XA 4IFDJ 3CHBD 5DM63 1Y8OB 4KN4C 4NDXA 1I4XA 2F0DA 2RKSA 1F77A 1U4LA 4IUVA 3FDTA 4NW2A 2JSOA 3G7LA 2NBFA 4XQNA 3GV3A 4YIJA 4K8IA 1DOMA 2O2LD 4XT1B 3A55A 3NTHA 2O5IC 5K5PA 4E6IA 1D2BA 2FMCA 4G57A 3A56A 1RDPD 1OXTA 4ZQ3A 3RLFA 4HAEA 4K2KA 4J8QA 4XTCS 1BQQT 2LMCB 1WVLA 1WTRA 1G91A 4IURA 5JEAH 2E76C 3BG3A 5IGGA 4QMGA 4CKEA 3MFGA 2B8GA 1D5ZC 1BCPB 3C3LA 2Y0SB 1I4GA 4KD4A 5JPNC 2XRQD 3NWSA 2Z1CA 4G7OC 2RQXA 1MGSA 3U9OA 5EBCA 4B9WA 1PRTB 1GUWA 1LT3D 1AZQA 2M00A 2X69A 5C0XG 1FNUA 2F0SA 1ZEQX 2QKIC 2Z4HA 3PO3B 5D65A 2EY1A 2VB3X 1EU3A 2JA5B 1V43A 1WCMB 1CZGA 4OIJA 3J81L 3IL8A 1S5FD 1E2VA 1PYWD 1VMPA 1HQRD 4HMIA 4XQQA 2AUJD 5EKLA 5A2QL 3IFTA 4ABNA 2IT1A 5IGEA 3S17B 3HOUB 5D14A 1EOTA 2L11A 2KJXA 2E2JB 1TR5A 1WTPA 2JEAI 1BCPF 4OHJA 2WP8J 1G2SA 1B3AA 3DUZA 2EYOA 4ZUJA 3EFXD 2R3ZA 2R6GA 3SE0A 3TN2A 2A68C 3SK4A 3D6CA 3OIQA 2NVYB 1J9OA 1PRTF 2DN8A 1QG7A 5CORA 1PRTD 3FKIB 3HP3A 5IT9E 1Q3LA 1QJOA 3S1RB 4KJNA 2EZVA 2DNEA 4LAAA 2EYFA 2EYPA 1GOZA 4H44C 2B2UA 1OXVA 2CHBD 3OSOA 2I07B 2NB0A 4TSSA 4KKSA 1H9SB 2EYJA 4DK0A 1SJHD 1KNAA 2F0GA 3FVQA 3J80E 1EYCA 3S2HB 4S3SA 2X6GA 1STBA 3E0JA 3MHBA 1G6ZA 1JOQA 2BDOA 3K5OA 4HTHA 3PIO3 1CA5A 1ESRA 1F9PA 2NN6I 3AB9A 3H09A 5EGTA 3TSSA 1C8CA 3KLSA 3PUXA 1RTNA 1QNUA 1SBBB 3NXWA 1TWAB 4A93B 4GZYC 1PZID 5C4XB 1LLRD 3W2DA 2F0KA 1SE3A 4KTAA 2NZ1D 1IYVA 1RODA 1V1PB 1G291 2G9DA 1B1ZA 1ZXTA 1R4PB 3VA5A 2A6ED 4P2CB 1B9NA 1XTCD 2BA1A 3UI2A 5BN5A 3MXPA 2MHVA 1PTOC 1I4HA 1TWFB 1SE4A 2KEEA 1EWCA 2M9VA 5CYUA 1KAAA 5C0XH 2RVLA 1HFGA 3BDCA 2VUMB 4DXGA 5FO9B 4J1MA 1EY5A 4K6LA 1O80A 4IQZA 3R93A 4KY7A 2FINB 4IUTA 5C44B 4UAIA 2NVXB 1SMYC 4FNFA 5CBEE 4DK1A 3ONAB 2JEBI 3K59A 1T5XD 1SNCA 2K5DA 5FLXE 1CZWA 3DEOA 1XYIA 3GTJB 1T5EA 4C3JG 1JQYD 3OMGA 1G8ZD 1TKWB 4DFAA 2SNMA 1JR0D 3SHLA 4M8AA 2EJMA 3I4LA 4BBSB 4WJWA 1Z47A 2WIIB 2JA6B 3KBXA 3DHQA 3OHXC 2B2YA 3QO2A 2PCFB 3KF8A 1DONA 5E1FA 1HA5A 1H9JA 2WINB 1L0XB 2D2CC 2L4NA 1BO0A 4IUQA 5IIFA 4RKLA 3WOEA 1GUNA 3PUYA 2Q8RE 1DZ1A 3DMUA 5M3MB 1EQVA 1I6HB 5M5XB 2MP1A 3RZDB 1SJED 2MPMA 1E2WA 1R4QB 2D9UA 3D4WA 2A68D 1JICA 1KTKA 4FXDA 1AW7A 4J6HA 1K8MA 2E2IB 4BA2I 1PTOH 2OF1A 4IUPA 3NHHA 5ELBA 2L9HA 1Q12A 2F0PA 1NR2A 5KIXA 3HG9A 1DCZA 2F0EA 1BR9A 1GUGA 5CV9A 1NAPA 2SEBD 4K6DA 3MEHA 1ILQA 1EIHA 5E4WC 1KNEA 2B2VA 3V96A 2EOTA 3NWTA 3CU7A 3E6ZX 5BN4A 2QF7A 5FO7B 1E2ZA 3SR1A 4A3KB 4N9PA 1F2ZA 3SDZA 2CW0D 2G9HD 3FMCA 3CKIB 2VXWA 3GO5A 2XVSA 1GJXA 2IX0A 2HCCA 4FF3A 2RDGA 5CC4A 3GP7A 1IKLA 5G3LF 4B9XA 5G3LD 3D3RA 2R7ZB 2EYMA 5ISRA 4IUUA 4ILWA 1A15A 4KN7C 4RFBA 1GUSA 3X3NA 1TS5A 4OL7A 3DWAA 5DAUA 3E5SA 1RKNA 3S2DB 4RHSA 1WD0A 2HDLA 2K04A 3DWPA 1PLFA 1PTOF 2AWOA 1PTOD 2PZTA 3OIPA 3TP8A 3D4DA 5FO8B 1Y1VB 1LV9A 3D31A 5F2DA 5KYIA 2IW3A 3S1QB 4BY7B 1AEXA 3F2UA 4ZUIA 3C1FA 4EQNA 4QB4A 2F0NA 3P20A 1U4RA 1STGA 1O7LA 4BS9A 5KNCA 5C0XJ 1JOKA 4ID6A 2L5TA 3KLSX 2EJFC 1SMYD 4X3SA 2B2UC 2BCOA 4C56C 2F0IA 2EXZA 3J81E 1LTID 5E3FA 2K7VA 2EPBA 4WORA 4KY5A 1STEA 3GTLB 2WACA 4C3IG 5A2QE 2QEJC 3AU7A 2L0CA 2A6HC 2XIWA 2IL8A 4F88A 2F1MA 2WB1B 1S4ZA 1EEFD 1EQTA 1EEID 1XWEA 2PQEA 3Q24A 3D6WA 2IX1A 4OO1G 1IYUA 2PO4A 4K2LA 4RGOS 2IPKD 4HEDA 1IKMA 3MC0B 3M7GA 2ENBA 1F2MA 1I6VC 2F0WA 1XX8A 4C3HG 4IFDI 3K5LA 1KDAA 2XN9C 2ZXRA 2K33A 4JK1C 1HUNA 1F9QA 1LT6D 4ZKBB 3GTGB 1S5DD 3TBIB 1HQMC 1C48A 3R2IA 1CT1D 5AFWA 1EZ8A 3S16B 4R9WA 1SNMA 4RGMA 5C5LA 4G7HC 3FRPB 1S5ED 1EU4A 5JAVA 4A3IB 1OXXK 4FXKC 3KK7A 2NTSA 4HCEA 2BE5C 3OOCA 2KA7A 3PIP3 1F2LA 4MN3A 4KK7A 3GTMB 3I4NB 1FGBD 3HOZB 3MXGA 4HSVA 2F0FA 1SNPA 2E74C 1ILPA 1I3QB 1IL8A 1D1KA 2F3WA 1UUPA 2EY5A 2JE6I 4U673 2K5QA 2PNRC 1HUMA 2WKDA 3I8ZA 4ZLTF 3AMUA 1NCVA 2B2YC 4RCOA 3TP6A 3MFYA 4ZRZA 4JBWA 2F0TA 1VCIA 3HRZC 1LT5D 1FNWA 1B53A 4C1NI 2E2DC 1EY4A 4KKUA 4CJ0B 4IFDG 4PMBA 1DYQA 4NMZA 1LO5D 4PNYA 4B08A 1F9RA 3NTKA 2J4XA 4KY6A 3H3VC 4TRDA 3A8IE 1R9TB 2B2WA 2RSOA 1O7YA 3QB3A 3I91A 4PMWA 1HHVA 4HMJA 1JCKB 3TP5A 2K1BA 2PW7A 3NBIA 3QJYA 1EY6A 4K8JA 3TP7A 4QUCA 2J0TD 4BWGB 1CFMA 5K36G 4RWSC 5KYLA 4C3IB 3MWYW 3NUCA 2A73B 4KV6A 4OO1H 1Y1WB 3IFDA 3K57A 1FNVA 3A8JE 5CMDA 1STHA 2Q8IB 1TS4A 4RHRA 4DAVA 2IJ0A 1EL0A 1HTLD 5I6YA 3NP8A 4CHTB 5FK9C 2IWHA 3BYTB 4A3DB 3NQTA 1PFBA 1A6XA 2F0VA 3K6OA 2B2VC 4FO2A 1K8OA 1D1IA 2KEDA 2B2TA 1M4VA 1O78A 4IALA 2A69C 4QUFA 1SNDA 2HDMA 2FJ2A 3P1HA 1I4QA 5JPMC 2A6HD 1VMCA 4C3HB 4RCNA 3Q6SA 1RHPA 1CHPD 4HR7B 5ELFA 4V190 1FYCA 1F2YA 3LNNA 4FF2A 3PO2B 3RMHA 3I73A 4X3TA 1H9SA 2EVBA 4OIKA 4DNTB 2SNSA 2X6LA 3BVMA 3SK5A 3SEBA 5EPJA 3KBGA 3QWNA 3BYYB 2A5HA 4F7XA 1FR3A 5COYA 1DM0B 1ONLA 3VR5A 2AQ3B 2FFKB 4RH6A 5JVH3 2L1BA 3H91A 1PFNA 1SYEA 2XRSD 2VNUD 1HA6A 4RKBA 4KJOA 1U9RA 1DJRD 1XXGA 1KLUD 3I3CA 1V1PA 4H13C 4KKTA 2NWGA 1GUOA 5IGFA 1QILA 3MXUA 1Y8PB 4KI0A 5EKIA 4AYBB 2H1EA 2B8FA 3FPUB 2BE5D 2N88A 3CRLC 5CV4A 2K5WA 4ZYSA 2EE1A 4K5WA 3FPPA 3QIAA 3HZXA 4XQJA 2NVTB 4NP5A 4A3FB 2OEOA 2NN6G 3T56B 2CVRA 2LFNA 3MXNA 1HTPA 5EPLA 1PMRA 5TSSA 4ZAIA 4R8NA 2B63B 1H9KA 2EJGC 2D5DA 3BVGA 2EYHA 4PMCA 4O1NA 4KHVA 1I4RA 4XYQA 2RDHA 2I46A 5KGUA 1H9RA 3Q23A 2PPBC 4PQXA 1F9SA 4CGYB 3N52A 4X3KA 5KEEA 5A35A 3TDQA 2Z4IA 3PUVA 1ET6A 1TWCB 5M3FB 1KLGD 4ODGA 5JOBA 2R93B 3A54A 1NSNS 1LACA 5KRUA 3VR2A 4FF4A 2J7ZA 2BOSA 1DXMA 3L3OC 1STAA 2K6AA 5ELDA 1RJTA 1ENCA 2KUMA 1SDFA 2AQ2B 1TU2B 1PTOB 2PMZB 1SYCA 3EROA 2R92B 4TKOB 1EYDA 3DWQA 5E4XA 4I65A 1VF7A 4OGQC 4EVOA 3NE5B 5IGBA 4K14A 1WTXA 3ITPA 1HXYD 4RA8A 1BUVT 2FMMA 5JEAG 3KUPA 5JJZA 5FOBB 2A69D 3URYA 4G4KA 5C3WA 3QOJA 5BN3A 2EDGA 3IAYA 2NVQB 3U9SA 3HOWB 1Q1BA 2Z8LA 1BCPC 1EYAA 1QE6A 3NTIA 2B39A 3J7AV 1TY2A 3OPOA 1LT4D 2QILA 3OWEB 1PRTC 3GV6A 3J7AF 3P75A 3HOVB 3T53B 2F3VA 3SK8A 4A3GB 1STNA 5I9PA 1TWHB 3PV0A 5J39A 2TMPA 1JWMD 3TMEA 3G6JB 5C6AA 2MJ8A 5LHY1 4C3JB 1EY7A 2XWJB 2V4DA 1U4MA 1ZYRC 4QF4A 1I4PA 2TSSA 3MA2B 4XYOA 1A3VA 1DOLA 2EY6A 4DAPA 1CI3M 3S1NB 3WOFA 3Q0AA 2K01A 3PUWA 5C0XI 3GD7A 3GTKB 5ELCA 5C4ZA 1TVXA 2O5JC 3M4YA 5CBAE 4HN7A 5FKAC 4UDUC 2K28A 3BZDB 1A3UA 2F4IA 5CV5A 3TZUA 4C1NK 1QB5D 1SXTA 4KD3A 4FYDA 3O13A 5KNDA 1TWGB 2KOLA 1CM9A 1A3TA 2B2TC 2PZUA 3V05A 4BA1I 1AP0A 1GXDC 3K5MA 1PFMA 1CK1A 3H0GB 2WAQB 1SYDA 1WTWA 2QCPX 3VR4A 4X3UA 2EY2A 2HCIA 1BF4A 4DGZA 1Q8IA 4CKCA 2QDBA 1TT2A 3QG1A 1I50B 3BVZA 1SYBA 4I7ZC 4CBVA 1TY0A 2KCCA 3N6RA 4PV1C 3S14B 4XXEA 2AWNA 1BXTA 3BS1A 4F8MA 2XSCA 3MVVA 4V0BA 1EY0A 2GA4B 2MUYA 2YU9B 3JAME 1J8IA 2OXPA 2ZXOA 3DEPA 1RD9D 3A8KE 1QCBD 3I4MB 5JVG3 1CHQD 1II3A 1ET9A 3VR3A 3IKJA 2MGSA 3MAQA 4A3EB 3HOYB 1B50A 3CQZB 3Q22A 4Q5VA 2DY7A 3LX0A 1O7ZA 5IOCA 1W6JA 1EWHA 3X3MA 3K5NA 1S5BD 4ZKCB 5C4JB 1X3PA 3KLRA 4RGNA 2LKVA 5M5YB 3DM1A 4CJ1B 4F87A 3GTOB 4KMUC 5M9OA 1JWUD 2C5CA 4A3MB 2IX3A 1YNJC 5T1IA 5LL6S 1AN8A 4IUNA 2NTTA 1MSHA 3H6MA 1JC7A 1EY8A 4C2MB 3I72A 2XNAC 1M8AA 1BCPD 2KHSA 2WV6D 5CV7A 1MD2D 2KCNA 5D3DA 4L6TB 3T51B 5M5WB 2D62A 5KNBA 3P7JA 3NSWA 2A74C 2KECA 1UNSA 3ND8A 1OXSC 1V8QA 5I4DA 4DAYA 4DF7A 1YNNC 2E75C 1C4QA 1DD2A 3OMCA 3HGBA 3S9WA 2ICEC 3VA7A 1Q1EA 1EFID 4K5VA 4Z9CB 2BDNA 4L63B 1RF2D 1ZYRD 1Q90A 1OXUA 1HCZA 1TS3A 3JAML 1UEAB 1B9MA 2DY8A 5EPKA 4L8JA 3S15B 3K58A 1JORA 4DXFA 1LTBD 5C5MA 3WDNA 4XDXA 2K03A 1CQVA 4RAUC 1WD1A 2CW0C 3EVQA 3L9AX 2JA7B 1GHKA 4ME5A 3V2TA 4LK1C 2LS01 3M7NA 3C46A 4HSPA 4A3JB 3L7ZC 5EJWA 1LTSD 2AUKA 3M4OB 4A3BB 1LTRD 1L0YB 4G7ZC 1JOOA 1LTAD 2DNCA 1X32A 1QWYA 3MZ5A 4BBRB 3LWUA 1Z7TA 1TS2A 1KABA 1TIID 1PZJD 4XT3B 1QNKA 1SFOB 2WKCA 1SYFA 2F03A 1E0BA 2OT2A 2KVMA 4XIGS 3SXHA 3VYTA 2K05A 5EQ0A 5J22A 3GTPB 2VB2X 2E2HB 3QOLA 4BY1B 3DXJC 4FVMA 3RZOB 5C4HA 1ICWA 4H7BA 3NQIA 1Y69U 1GUTA 5J1ZA 1IW7C 3ND9A 4FP5D 1ESFA 2K32A 2ZXPA 3ZYYX 4WRDA 2HQEA 5IT9L 2F0JA 2AQ1B 4QIWB 4Q0FA 1ML0D 5C3EB 4EQPA 5ELEA 1AZPA 4R8IA 3EQLC 5HURA 2SOBA 4IN3A 1ENFA 2SDFA 3M85A 4U68A 1KDBA 3OWFA 2YYZA 1NR4A 1Y8NB 1D5MC 5JEAJ 2H4OA 1WTOA 3HS0C 4IFDH 2F0HA 3RUZA 3SVMA 3J80L 5DEHA 3BDOA 4K5XA 3GTQB 1SNQA 5CR3A 1PXUA 1HFNA 2RDFA 1B44D 4FF1A 4QCLA 1KDCA 4MIUA 1AFPA 3HEJA 1WTQA 3D4RA 5EKKA 1SNOA 4M1UB 3I90A 3S1MB 1SEBD 3SK6A 1GHJA 3M3YB 1G2TA 1RCVD 1SSOA 5K36H 1D6EC 1H9MA 1YNJD 1B4OA 3OW7A 1DOKA 2RSNA 1EIGA 3C2PA 2JXMB 2FHTA 2L55A 3PUZA 3NPPA 2ZT9C 2KQ3A 3HOXB 2F0MA 3R2TA 1MBYA 4CKBA 4IZ8A 4H0LC 4ULLA 3BDLA 3MTSA 1NUCA 5IODA 4LJZC 5DNFA 2JA8B 3D8GA 2C9OA 3TZDA 1K83B 2Q8TA 4RGTA 2R61A 4N9TA 1S5CD 1IHZA 1YNND 2JP1A 1UAPA 5T1GA 1EZ6A 3VYRA 4ZK9B 2PZWA 3ERQA 4DN4M 1CTMA 1JWSD 1SE2A 1BDOA 1WTVA 3EA6A 3T16A 5I2YA 1CA6A 1SYGA 5I9OA 2ICIA 1BNZA 2LY7A 4HCSA 2CQAA 4DA2A 2ID0A 2RA4A 1TQOA 3VYSA 1D5XC 2L12A 4WFN3 1ENAA 1MSGA 5C3XA 2JYOA 1BOSA 5IGDA 1HRJA 5FLXL 2M2LA 1LTTD 3T13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G6Z A;  3I91 A;  1ILQ A;  1XYI A;  1MI2 A;  1HHV A;  1HA6 A;  2HUG A;  3GV6 A;  3I90 A;  2K1B A;  1X32 A;  1EIH A;  2N55 A;  5E4W C;  1CA5 A;  1ESR A;  4OIJ A;  4X3S A;  2B2U C;  1M8A A;  1KNE A;  3I3C A;  2B2V A;  3IL8 A;  4QUC A;  2EOT A;  1F9P A;  1G2T A;  1SSO A;  1PDQ A;  1C8C A;  2NWG A;  2J7Z A;  1RTN A;  1BBX C;  1JE4 A;  1VMP A;  4RWS C;  1B4O A;  4XT3 B;  1QNK A;  3MWY W;  2EPB A;  1F2L A;  1E0B A;  1DOK A;  2KVM A;  2RSN A;  1EIG A;  2MJ8 A;  3P7J A;  2K05 A;  5EKI A;  3IFD A;  2KEC A;  4LMQ D;  5EQ0 A;  2NZ1 D;  4MN3 A;  2FHT A;  1RJT A;  1U4M A;  2KUM A;  1ROD A;  2H1E A;  1SDF A;  3KBX A;  5CMD A;  1RTO A;  1U4L A;  1X3Q A;  2VXW A;  3FPU B;  4IUV A;  2B2Y A;  1B2T A;  5D14 A;  1EOT A;  4HSV A;  3QO2 A;  2L11 A;  1DOL A;  2XIW A;  3FDT A;  1DON A;  1WTP A;  1ZXT A;  1EL0 A;  2N88 A;  1ICW A;  4NW2 A;  4CJ2 C;  2IL8 A;  1J8I A;  2HCC A;  1S4Z A;  1G2S A;  3G7L A;  3DEP A;  3MTS A;  1EQT A;  4O42 A;  1B3A A;  2EE1 A;  3GV3 A;  5DNF A;  5E4X A;  1IKL A;  2BDN A;  1PFB A;  2R3Z A;  4MHE A;  3TZD A;  3TN2 A;  1DOM A;  2Q8T A;  4XT1 B;  2L4N A;  3UI2 A;  2B2V C;  1ILP A;  1BO0 A;  4IUQ A;  2KED A;  2B2T A;  3D6W A;  2K01 A;  1J9O A;  4IUU A;  2CVR A;  1A15 A;  2MGS A;  2JP1 A;  1IL8 A;  2Q8R E;  1DZ1 A;  1QG7 A;  5T1G A;  5COR A;  4QUF A;  4HAE A;  5D65 A;  5EPL A;  2HDM A;  3HP3 A;  1ML0 D;  4ZK9 B;  1Q3L A;  2KEE A;  1B50 A;  2FJ2 A;  1WTX A;  4HED A;  2MP1 A;  1VMC A;  4ZAI A;  1AZP A;  1TVX A;  4DN4 M;  4R8I A;  3Q6S A;  1IKM A;  1RHP A;  2RVL A;  1HUM A;  2DY8 A;  3I8Z A;  4ZLT F;  2DY7 A;  5EPK A;  1WVL A;  2B2W C;  1WTR A;  1HFG A;  4IUR A;  1G91 A;  5CBA E;  1WTV A;  4RA8 A;  1U4P A;  2SDF A;  1NCV A;  1O7Z A;  1XX8 A;  2FMM A;  2MPM A;  1WD0 A;  4X3T A;  4U68 A;  2HDL A;  2K28 A;  3KUP A;  2D9U A;  5JJZ A;  2K04 A;  1CA6 A;  2B2Y C;  1PLF A;  4OIK A;  2B2U A;  1BNZ A;  4ZKC B;  4XDX A;  4HCS A;  1NR4 A;  1JIC A;  2K03 A;  2X6L A;  4RAU C;  1O80 A;  1X3P A;  1WD1 A;  1SAP A;  1WTO A;  1F9S A;  3R93 A;  2FIN B;  2RA4 A;  1B53 A;  1MGS A;  1LV9 A;  3DM1 A;  4IUT A;  2L12 A;  4X3U A;  4CJ1 B;  1F9Q A;  3N52 A;  1HUN A;  4UAI A;  5EPJ A;  4CJ0 B;  4ZKB B;  4X3K A;  3SVM A;  1MSG A;  1GUW A;  4IUP A;  5CBE E;  3LWE A;  2JYO A;  1AZQ A;  2KOL A;  1CM9 A;  2B2T C;  2L9H A;  2X69 A;  1HFN A;  1F9R A;  1KNA A;  5AFW A;  1NR2 A;  2NYZ D;  3F2U A;  3ONA B;  5COY A;  1AP0 A;  4R9W A;  5EJW A;  5T1I A;  1HRJ A;  1QE6 A;  2M2L A;  1PFM A;  2FFK B;  1U4R A;  1WTQ A;  2X6G A;  1MSH A;  2B2W A;  2L1B A;  1NAP A;  2RSO A;  3H91 A;  1O7Y A;  1WTW A;  1PFN A;  2HCI A;  3DEO A;  1BF4 A; 
#chains in the Genus database with same CATH topology
 3PMF A;  1ZKO A;  2HUG A;  3B6Y A;  4CDE C;  1FD7 D;  3K7A H;  1HPC A;  3NK9 A;  3PO3 G;  4IJH A;  2Z0S A;  2F0L A;  1YBY A;  3I4N G;  1PDQ A;  4TQU S;  4OO1 I;  3K0Y A;  3HOZ G;  1ICF B;  5IGC A;  1QOH A;  5D3I B;  1BBX C;  3U4Z A;  3W3A A;  2ZM6 Q;  5IYC G;  5JJK A;  2PYK A;  1ASY A;  3C1E A;  2DJF C;  3E9I A;  2NUC A;  4LMQ D;  1M90 C;  2RBM A;  3J80 c;  3KOJ A;  1A2U A;  1NE3 A;  4X62 Q;  3CAM A;  3K7A B;  3J7Y W;  1W3S A;  1RTO A;  5GQO A;  1X3Q A;  1B2T A;  1S3O A;  2CQO A;  3T4A C;  5GAH C;  2MNA A;  1QZG A;  3H94 A;  3NBH A;  1U5K A;  4CJ2 C;  2KEN A;  2EYL A;  3GQB A;  1MJE A;  4O42 A;  3S1Q H;  4BY7 H;  4UY8 C;  1M1K C;  5CGK A;  1PYB A;  4MHE A;  1OO9 B;  1EY9 A;  2NN6 H;  5I6W A;  4DV4 L;  1A2T A;  2F0Q A;  3A5Z B;  4YHH Q;  1Q46 A;  2F0O A;  4NKL A;  5CV8 A;  1PZK D;  1STY A;  2PW5 A;  1VQE A;  1X3F A;  4X65 L;  3R8B A;  2B2W C;  1U4P A;  1IW7 D;  4DNR B;  2OQ0 A;  2PNH A;  3EJI A;  1YNX A;  4LF4 L;  4FXG C;  4JI4 Q;  4JI3 Q;  2F0U A;  4JOI C;  5LL6 X;  2JA9 A;  5CV6 A;  1LTG D;  2XWB B;  4DU9 A;  2D0P A;  2N78 A;  3HKZ B;  1VF5 C;  1SAP A;  4IJL A;  1QVG A;  1Z6H A;  3I70 A;  5NUC A;  3RD4 A;  4DUZ Q;  1CUK A;  4LUZ A;  1QUQ B;  1XMO L;  1TXY A;  5I2X A;  1V1O A;  3A7L A;  3LWE A;  3JAM i;  1CQF A;  1LAB A;  4Y7N B;  2ZJR A;  1JB3 A;  5HGT A;  1Q86 C;  2NYZ D;  5DLQ E;  3I4O A;  1SE8 A;  4KHZ A;  5DM7 3;  1EIF A;  1VDZ A;  3FEW X;  5EBD A;  3K80 C;  5GAG C;  1MI2 A;  4EGV A;  3R3O A;  1PH7 A;  3CRK C;  4EQO A;  2N55 A;  1Y1W G;  3VYU A;  1U0L A;  2BA0 A;  1KQS A;  1WTH A;  3UE1 A;  1W6K A;  2UU9 L;  4LF6 L;  3A7A B;  2A6E C;  4DNI A;  3VR6 A;  1JE4 A;  3F2D A;  2VQE Q;  1VQA A;  4DKA C;  1K8A C;  2O4X A;  3PGZ A;  4IFD J;  3CHB D;  3CC7 A;  5DM6 3;  1X56 A;  1Y8O B;  5IWA L;  2UXD Q;  4UP7 A;  4KN4 C;  4A3D G;  4NDX A;  5ELO A;  1I4X A;  1D7Q A;  2F0D A;  4JI1 L;  1V1Q A;  2RKS A;  1F77 A;  1U4L A;  1IBM Q;  4IUV A;  4GKJ L;  1GKH A;  5FLX c;  3FDT A;  4NW2 A;  2JSO A;  3T1H L;  4HJA A;  3G7L A;  1UE1 A;  1QVC A;  3OW2 A;  2NBF A;  4XQN A;  3GV3 A;  4YIJ A;  1IBK Q;  4K8I A;  1DOM A;  2O2L D;  3KFU A;  4XT1 B;  3A55 A;  3NTH A;  4LF7 Q;  2UXB L;  2O5I C;  3PO2 G;  4A4I A;  4DV6 L;  5K5P A;  4E6I A;  1D2B A;  2FMC A;  4G57 A;  3CPW A;  1ASZ A;  3A56 A;  1RDP D;  4JI8 L;  1OXT A;  4ZQ3 A;  3RLF A;  2E5L L;  4HAE A;  4K2K A;  4J8Q A;  1NMF A;  1YHA A;  1VQ9 A;  4XTC S;  1BQQ T;  2LMC B;  1WVL A;  1WTR A;  1G91 A;  4IUR A;  5JEA H;  3TS2 A;  2E76 C;  3BG3 A;  5IGG A;  4QMG A;  4CKE A;  3I7F A;  4JVZ A;  3MFG A;  1XTD A;  2B8G A;  2UXC Q;  1JT8 A;  1D5Z C;  1PH8 A;  4PG3 A;  1BCP B;  3C3L A;  2Y0S B;  3KJO A;  1I4G A;  4NB3 A;  3J81 j;  4KD4 A;  5JPN C;  2XRQ D;  3NWS A;  1PA6 A;  2Z1C A;  4G7O C;  2RQX A;  5JJL A;  1MGS A;  3U9O A;  3PO3 H;  5EBC A;  3J7Z C;  4HID A;  3HOZ H;  4B9W A;  1PRT B;  1GUW A;  1LT3 D;  2JA5 H;  1WCM H;  1AZQ A;  2M00 A;  5IYC H;  2X69 A;  2R7D A;  5C0X G;  4B3M L;  4QGU A;  1N33 L;  4NPS A;  1FNU A;  2YTX A;  1HNX L;  2F0S A;  1ZEQ X;  2QKI C;  2Z4H A;  1HR0 L;  5EAY A;  3PO3 B;  5D65 A;  1XMQ Q;  2EY1 A;  2JK8 A;  2VB3 X;  1EU3 A;  4GOP B;  2JA5 B;  1V43 A;  1WCM B;  1CZG A;  4OIJ A;  3J81 L;  1NTG A;  3IL8 A;  4AYB G;  4YCU A;  1S5F D;  1E2V A;  3KJP A;  3S17 H;  1PYW D;  2MO1 A;  3J80 i;  2E2J H;  4LFA L;  1VMP A;  2FXQ A;  4HJ7 A;  1HQR D;  4HMI A;  5IY0 A;  4XQQ A;  2AUJ D;  4IPD A;  1JB7 A;  2HQL A;  5EKL A;  5A2Q L;  3IFT A;  4GS3 A;  4ABN A;  1JJ2 A;  2IT1 A;  1O7I A;  2NVY H;  4AH6 A;  5IGE A;  1YJ9 A;  3S17 B;  4A3F G;  3HOU B;  1IBL Q;  5D14 A;  2XTI A;  1EOT A;  2L11 A;  2KJX A;  2E2J B;  3FKI H;  1TR5 A;  1WTP A;  5H1S E;  2JEA I;  1BCP F;  4OHJ A;  2WP8 J;  1G2S A;  3S1R H;  1B3A A;  3DUZ A;  2EYO A;  1K0R A;  4ZUJ A;  3EFX D;  2R3Z A;  2R6G A;  3SE0 A;  3TN2 A;  2HT1 A;  3K7U C;  2A68 C;  1YEZ A;  2B63 G;  3SK4 A;  3D6C A;  3OIQ A;  2NVY B;  1J9O A;  3RR5 A;  1PRT F;  2DN8 A;  1QG7 A;  3TS0 A;  5COR A;  1PRT D;  3T1Y L;  3FKI B;  3HP3 A;  5IT9 E;  1Q3L A;  3KLW A;  3PQI A;  4DR1 Q;  1QJO A;  4GOP A;  3S1R B;  4KJN A;  2EZV A;  2DNE A;  4LAA A;  2QEX A;  4HJ9 A;  4NXM L;  2EYF A;  3UDI A;  4IO9 A;  2EYP A;  4LF9 L;  1GOZ A;  4H44 C;  4AQY Q;  2B2U A;  1OXV A;  2CHB D;  2AMC B;  2ZTE A;  1J6Q A;  3OSO A;  2NZH A;  2I07 B;  3S2H H;  2NB0 A;  1Y1W H;  1Y14 B;  1FL0 A;  1AH9 A;  4TSS A;  1VQD A;  2A8V A;  3ZJY C;  2ZJP A;  4KKS A;  5M3F G;  1H9S B;  4LF8 L;  4DV3 Q;  1HZB A;  5JJI A;  2EYJ A;  4DK0 A;  1SJH D;  5FLM G;  1KNA A;  2F0G A;  3FVQ A;  3J80 E;  4IOA A;  2R93 G;  1EYC A;  1C0A A;  3S2H B;  4S3S A;  2X6G A;  1STB A;  3E0J A;  3MHB A;  1G6Z A;  1TWA H;  3QR8 A;  4A93 H;  1N9W A;  1JOQ A;  2BDO A;  3K5O A;  4HTH A;  3PIO 3;  1CA5 A;  4X6A H;  1ESR A;  5LMN L;  1F9P A;  3W1G A;  2NN6 I;  3AB9 A;  4N8F A;  3H09 A;  3F2B A;  5EGT A;  3TSS A;  1C8C A;  1LTL A;  3KLS A;  4EX5 A;  3PUX A;  1RTN A;  1N36 L;  4OON A;  1QNU A;  2HHH Q;  1BVS A;  1SBB B;  2KHI A;  3NXW A;  1TWA B;  4A93 B;  2R92 G;  4GZY C;  3D0F A;  1PZI D;  5C4X B;  1LLR D;  3W2D A;  2F0K A;  1J5E Q;  1SE3 A;  4KTA A;  2NZ1 D;  3A5U A;  1CKN B;  1IYV A;  1ROD A;  1V1P B;  3CPF A;  1G29 1;  2G9D A;  1PVO A;  1B1Z A;  1ZXT A;  1R4P B;  3G4S A;  1CSQ A;  2A6E D;  3VA5 A;  2PQA A;  4P2C B;  1B9N A;  1XTC D;  2BA1 A;  4JI2 L;  1XNQ L;  2VUM H;  3UI2 A;  1YIT A;  5BN5 A;  3J81 c;  3MXP A;  2MHV A;  1PTO C;  1I4H A;  1KD1 C;  1TWF B;  1SE4 A;  1VQB A;  1YZ6 A;  1Q7Y C;  2F4V L;  3EN2 A;  2KEE A;  1EWC A;  2M9V A;  5CYU A;  1KAA A;  3CD6 A;  5C0X H;  2RVL A;  1SRU A;  5C44 H;  1HFG A;  3BDC A;  1VQC A;  3RLN A;  2VUM B;  2OCE A;  4DXG A;  3HOW G;  5FO9 B;  4DV1 L;  4J1M A;  1EY5 A;  4K6L A;  1O80 A;  1UE6 A;  4IQZ A;  2E8G A;  3R93 A;  4KY7 A;  2FIN B;  4IUT A;  5C44 B;  4OX9 L;  4UAI A;  2NVX B;  1SMY C;  4FNF A;  3GTJ H;  5CBE E;  4IPC A;  3HOV G;  4DK1 A;  3ONA B;  2JEB I;  3K59 A;  4A3G G;  1T5X D;  2I0Q A;  1SNC A;  1YI2 A;  2EIF A;  2K5D A;  3J7A 5;  1NNX A;  5FLX E;  1CZW A;  1YHB A;  1QVF A;  2Z6K A;  3DEO A;  1XYI A;  3GTJ B;  4BBS H;  1T5E A;  2L15 A;  4C3J G;  1JQY D;  2JA6 H;  5GAE C;  3OMG A;  1L2F A;  1G8Z D;  2KCT A;  4LW1 A;  1KIX A;  1TKW B;  1HJP A;  2SNM A;  2NZO A;  4DFA A;  2B63 H;  1JR0 D;  3SHL A;  4X65 Q;  4M8A A;  1MIU A;  1JMC A;  2CCZ A;  2EJM A;  4POG A;  3I4L A;  4BBS B;  2Z6B A;  4WJW A;  4LF4 Q;  1Z47 A;  2WII B;  2JA6 B;  3KBX A;  3DHQ A;  3OHX C;  2B3G A;  2B2Y A;  3KDF B;  2PCF B;  3QO2 A;  3KF8 A;  1DON A;  5E1F A;  1I6H H;  5M5X H;  1HA5 A;  1H9J A;  4R4I A;  3RZD H;  1XMO Q;  3E9H A;  1WYD A;  2WIN B;  1L0X B;  2D2C C;  2L4N A;  1K73 C;  3DLL A;  1BO0 A;  4IUQ A;  5IIF A;  2VS1 A;  4RKL A;  3WOE A;  1GUN A;  3PUY A;  2Q8R E;  1DZ1 A;  3DMU A;  5M3M B;  1EQV A;  2WB1 E;  5M3F H;  1MHW C;  1I6H B;  5M5X B;  1X55 A;  2MP1 A;  3RZD B;  1SJE D;  2E2I H;  2MPM A;  1VQ4 A;  1E2W A;  1R4Q B;  2D9U A;  3D4W A;  2A68 D;  4APV A;  1N8R C;  1X3E A;  4LF6 Q;  3AQQ A;  4JYA L;  1YIJ A;  1JIC A;  1KTK A;  4FXD A;  1AW7 A;  4J6H A;  3H0G G;  1K8M A;  2WAQ G;  1YVC A;  5IWA Q;  2E2I B;  4BA2 I;  1PTO H;  2OF1 A;  4IUP A;  3NHH A;  3KDF A;  5ELB A;  2L9H A;  4P75 A;  4JI1 Q;  1XJV A;  1Q12 A;  2F0P A;  1NR2 A;  2UUA L;  4GKJ Q;  5KIX A;  2R92 H;  3HG9 A;  1DCZ A;  1KL9 A;  2F0E A;  4UPA A;  5L37 A;  1BR9 A;  1NBW A;  4DR3 L;  3T1H Q;  1GUG A;  3E3X A;  5CV9 A;  1NAP A;  3CCL A;  2SEB D;  4K6D A;  3MEH A;  1ILQ A;  3BU2 A;  1NJI C;  2OTL A;  4A3K H;  2UXB Q;  2VZA A;  1EIH A;  5E4W C;  4K0K L;  4DV6 Q;  1KNE A;  2B2V A;  3V96 A;  2EOT A;  2E5L Q;  4JI8 Q;  3NWT A;  3CU7 A;  3E6Z X;  4RG1 A;  4B3T L;  5BN4 A;  2QF7 A;  3RN2 A;  1L1O A;  4UP8 A;  5IT9 c;  1EUJ A;  5FO7 B;  1E2Z A;  3SR1 A;  1GD7 A;  4A3K B;  4N9P A;  1F2Z A;  1N34 L;  3SDZ A;  2R7Z H;  2CW0 D;  3I4M G;  2G9H D;  3FMC A;  2UUC L;  3CKI B;  2VXW A;  2ZJQ A;  1X65 A;  3GO5 A;  2XVS A;  4A3E G;  1GJX A;  3J81 i;  3HOY G;  2IX0 A;  2HCC A;  1E1T A;  4FF3 A;  1I94 L;  2RDG A;  5CC4 A;  1HZC A;  3GP7 A;  3RNU A;  3S2D H;  1IKL A;  5G3L F;  4B9X A;  5G3L D;  3D3R A;  4B3M Q;  4L5S A;  1N33 Q;  2R7Z B;  2EYM A;  5ISR A;  1K28 A;  4IUU A;  1HNX Q;  4ILW A;  1A15 A;  2F52 A;  5IYB H;  4KN7 C;  4RFB A;  2LSS A;  1GUS A;  3X3N A;  4UHV A;  1TS5 A;  1PH5 A;  1D8L A;  4OL7 A;  3DWA A;  5DAU A;  1Y1V H;  3HOV H;  3E5S A;  1RKN A;  4A3G H;  3S2D B;  4RHS A;  2MO0 A;  1WD0 A;  2HDL A;  2K04 A;  4OEL B;  3DWP A;  4QY7 A;  1SMX A;  1PLF A;  2BH8 A;  1PTO F;  1VQF A;  1KXL A;  2AWO A;  1PTO D;  3U58 A;  2PZT A;  3OIP A;  3TP8 A;  2K5V A;  3D4D A;  3CMA A;  5IP9 G;  5FO8 B;  1Q81 C;  1Y1V B;  4HIO A;  1LV9 A;  3D31 A;  5F2D A;  2HD3 A;  2IW3 A;  5KYI A;  2N3S A;  3S1Q B;  4BY7 B;  4A3C H;  2WFW A;  1AEX A;  3F2U A;  4ZUI A;  3C1F A;  4EQN A;  4QB4 A;  4B3S L;  3JC6 6;  2F0N A;  3P20 A;  4NXN L;  1U4R A;  1STG A;  1O7L A;  4BS9 A;  5KNC A;  5C0X J;  1C9O A;  3K0X A;  4QL5 A;  1JOK A;  4ID6 A;  4DK6 C;  4DR2 L;  4JI7 L;  2L5T A;  3GTL H;  3KLS X;  3DM3 A;  2EJF C;  1AE2 A;  4DV0 L;  1SMY D;  4X3S A;  2Q2U A;  2B2U C;  2BCO A;  4P72 A;  1CSP A;  2CFM A;  2K5H A;  1IZ6 A;  2F0I A;  4C56 C;  3T1Y Q;  2EXZ A;  3J81 E;  1LTI D;  5E3F A;  2K7V A;  2EPB A;  4WOR A;  1FVI A;  4KY5 A;  1STE A;  4JI5 L;  4NXM Q;  3GTL B;  2WAC A;  4C3I G;  2F3I A;  5IP7 H;  5A2Q E;  2QEJ C;  3AU7 A;  2L0C A;  1VS0 A;  2A6H C;  2XIW A;  2IL8 A;  4F88 A;  2F1M A;  2WB1 B;  1S4Z A;  4GNX B;  1EEF D;  1EQT A;  3CCR A;  1JJG A;  1EEI D;  1XWE A;  4LF8 Q;  4P73 A;  3H3V I;  2PQE A;  3Q24 A;  1KRS A;  1SLJ A;  3D6W A;  1V9P A;  2IX1 A;  4OO1 G;  1IYU A;  1BKB A;  2PO4 A;  3G6E A;  4K2L A;  4RGO S;  2IPK D;  4GKK L;  4HED A;  1IKM A;  1EWI A;  3MC0 B;  1QUQ A;  3M7G A;  2ENB A;  1F2M A;  1I6V C;  2F0W A;  1XX8 A;  3GTG H;  3OTO Q;  3G48 A;  5LMN Q;  4R4C A;  4C3H G;  2JA7 G;  2VL6 A;  4IFD I;  3S16 H;  3K5L A;  4A3J G;  1N36 Q;  1KDA A;  2PI2 E;  2XN9 C;  2ZXR A;  2K33 A;  4JK1 C;  1HUN A;  1F9Q A;  1LT6 D;  4A3B G;  4ZKB B;  4A3I H;  3GTG B;  1S5D D;  3TBI B;  3R2I A;  1C48 A;  1HQM C;  4QQB X;  1CT1 D;  2RHS B;  5AFW A;  4BBR G;  1EZ8 A;  1E24 A;  3S16 B;  4R9W A;  4DR5 L;  1SNM A;  1HZA A;  4RGM A;  5C5L A;  4G7H C;  3FRP B;  1S5E D;  2B29 A;  1EU4 A;  5JAV A;  4JI2 Q;  1XNQ Q;  4A3I B;  1OXX K;  3E0E A;  3EIV A;  2I5M X;  4FXK C;  1VQH A;  2QA4 A;  5BR8 L;  3HOY H;  3GTM H;  3I4N H;  3KK7 A;  2NTS A;  4HCE A;  2I5H A;  2BE5 C;  2JJQ A;  3OOC A;  5HY6 A;  4BY1 G;  1G6P A;  2F4V Q;  2KA7 A;  3PIP 3;  1X6O A;  1FJG L;  1F2L A;  3G71 A;  2GN5 A;  3ICE A;  1AE3 A;  4MN3 A;  3ERS X;  4KK7 A;  3GTM B;  3I4N B;  1FGB D;  2JN4 A;  3HOZ B;  2AHO B;  2ZM6 L;  1SR3 A;  4DV1 Q;  1I3Q H;  3KF6 B;  3MXG A;  4HSV A;  4JBM A;  4OWW B;  2F0F A;  2Z6K C;  5C3E G;  4OX9 Q;  1SNP A;  4AYB E;  4YY3 L;  5IP9 H;  2E74 C;  4DAY B;  1ILP A;  1I3Q B;  3HKS A;  1IL8 A;  1D1K A;  2F3W A;  1UUP A;  2EY5 A;  3LGJ A;  2V1C C;  2JE6 I;  4DR7 L;  4U67 3;  2K5Q A;  3FHW A;  3H15 A;  2PNR C;  4DV2 L;  1B8A A;  1HUM A;  2WKD A;  3I8Z A;  4ZLT F;  3AMU A;  1NCV A;  5LMU L;  2YV5 A;  1Q82 C;  2B2Y C;  4YCW A;  4RCO A;  3TP6 A;  3MFY A;  4ZRZ A;  4JBW A;  2F0T A;  4X66 Q;  3PSI A;  1VCI A;  2ASB A;  3HRZ C;  1LT5 D;  1R9T H;  1FNW A;  1B53 A;  4C1N I;  2E2D C;  1EY4 A;  4KKU A;  4CJ0 B;  4IFD G;  4ME3 A;  4PMB A;  1DYQ A;  4NMZ A;  4POF A;  1LO5 D;  4PNY A;  5IE8 A;  4B08 A;  1F9R A;  4YCV A;  3NTK A;  2J4X A;  4KY6 A;  3H3V C;  4DUZ L;  4TRD A;  3A8I E;  4C3I H;  1R9T B;  2B2W A;  2RSO A;  1O7Y A;  3QB3 A;  5ELN A;  3I91 A;  4PMW A;  1HHV A;  4HMJ A;  1JCK B;  3TP5 A;  2K1B A;  2PW7 A;  3NBI A;  1EIY B;  3QJY A;  2VW9 A;  1EY6 A;  4K8J A;  3TP7 A;  4QUC A;  2J0T D;  4BWG B;  4RMF A;  1PH9 A;  1OTC A;  2YTV A;  1CFM A;  3HOX G;  5K36 G;  4RWS C;  5KYL A;  4DV7 L;  4C3I B;  4PZ6 A;  3MWY W;  3NUC A;  1H95 A;  2A73 B;  4KV6 A;  2ES2 A;  2OTJ A;  4OO1 H;  1Y1W B;  3IFD A;  4A3D H;  3K57 A;  1PH6 A;  1FNV A;  3A8J E;  2JA8 G;  5CMD A;  1STH A;  1A0I A;  2IHF A;  1TS4 A;  2Q8I B;  3I55 A;  4JYA Q;  4RHR A;  1DGS A;  2UUB Q;  4DAV A;  2IJ0 A;  1EL0 A;  1HTL D;  5I6Y A;  4C3H H;  1IYJ B;  2JA7 H;  1WJJ A;  3NP8 A;  4CHT B;  5FK9 C;  2IWH A;  1KHI A;  3BYT B;  4A3D B;  3NQT A;  1PFB A;  1A6X A;  1EQR A;  3PO2 H;  2F0V A;  3K6O A;  2B2V C;  4FO2 A;  1K8O A;  1D1I A;  2IHE A;  2PMZ E;  2KED A;  2UUA Q;  2B2T A;  4HIK A;  1M4V A;  1O78 A;  4IAL A;  3U4V A;  2A69 C;  1VQ7 A;  4QUF A;  1L1O C;  1SND A;  2HDM A;  1PFS A;  4H02 A;  3BJU A;  2FJ2 A;  3BZK A;  1I4Q A;  3P1H A;  5JPM C;  2A6H D;  1VMC A;  4C3H B;  4RCN A;  3Q6S A;  1RHP A;  1CHP D;  4HR7 B;  5ELF A;  1Q8K A;  4LF7 L;  4L5T A;  4HJ8 A;  4V19 0;  1FYC A;  1F2Y A;  3LNN A;  4FF2 A;  3PO2 B;  1VQN A;  3RMH A;  3I73 A;  4X3T A;  4K0K Q;  1H9S A;  2EVB A;  3EBE A;  4OIK A;  1E7Z A;  4B3T Q;  4TVA B;  3GDE A;  2SNS A;  4DNT B;  2X6L A;  3BVM A;  4JG2 A;  3SK5 A;  3SEB A;  5EPJ A;  4R1J A;  4X64 L;  3KBG A;  1N34 Q;  3QWN A;  2UXC L;  3BYY B;  2A5H A;  4R4Q A;  4J15 A;  4O2D A;  5FJ8 G;  4F7X A;  2UUC Q;  1FR3 A;  3F2C A;  1B7Y B;  5COY A;  3RZO H;  2VQF L;  2CH4 W;  1E22 A;  1DM0 B;  1ONL A;  3RLO A;  4JPB W;  3VR5 A;  1G51 A;  2AQ3 B;  2FFK B;  3M4Q A;  4RH6 A;  3MXN B;  5JVH 3;  1I94 Q;  2L1B A;  2MFI A;  3H91 A;  1PFN A;  1SYE A;  2XRS D;  2VNU D;  5IYD G;  1HA6 A;  4RKB A;  4KJO A;  1KC8 C;  3I56 A;  1U9R A;  1DJR D;  1XXG A;  1CKN A;  2K75 A;  1KLU D;  3I3C A;  1V1P A;  4LFC L;  4H13 C;  2K52 A;  1S72 A;  4KKT A;  2NWG A;  1GUO A;  3PIO A;  5IGF A;  2ATW A;  3Q8D A;  1QIL A;  3FP9 A;  4JI0 L;  3M4P A;  1Y8P B;  3MXU A;  2Q2I A;  4KI0 A;  5EKI A;  4AYB B;  2NVT H;  2CWA A;  2H1E A;  4A3F H;  2B8F A;  3FPU B;  5J3B A;  4DV4 Q;  2BE5 D;  1BBW A;  2N88 A;  4DV5 L;  3CRL C;  5CV4 A;  2K5W A;  3WWV A;  4ZYS A;  4DR4 L;  1YHQ A;  2EE1 A;  4K5W A;  3FPP A;  3QIA A;  3HZX A;  4XQJ A;  2NVT B;  4NP5 A;  1IBL L;  4A3F B;  2OEO A;  2NN6 G;  3T56 B;  2CVR A;  2LFN A;  3MXN A;  1HTP A;  5EPL A;  4NXN Q;  1PMR A;  1LM0 A;  1LYL A;  5TSS A;  4ZAI A;  3HKZ G;  4R8N A;  5AJ3 L;  2B63 B;  1H9K A;  2EJG C;  4DR2 Q;  2JQO A;  2D5D A;  4JI7 Q;  3BVG A;  4DV0 Q;  2EYH A;  2C35 B;  4PMC A;  4O1N A;  4KHV A;  1I4R A;  4XYQ A;  2RDH A;  3W5O A;  2I46 A;  5KGU A;  1H9R A;  4OEM B;  3Q23 A;  3I2Z A;  1PYS B;  2PPB C;  4PQX A;  1F9S A;  4CGY B;  1TWC H;  4JI5 Q;  1A62 A;  3N52 A;  4X3K A;  5KEE A;  2LXK A;  4ALP A;  4R4T A;  5A35 A;  4IPG A;  3TDQ A;  5FLM H;  2R93 H;  2Z4I A;  2DJG C;  3CCQ A;  1PV4 A;  4L5R C;  4BXX G;  3PUV A;  1ET6 A;  2JA8 H;  1A8V A;  2UU9 Q;  1CKM A;  1K83 H;  1TWC B;  5M3F B;  1KLG D;  4MNO A;  1XNR L;  4ODG A;  1FGU A;  1K0S A;  5JOB A;  1JJC B;  2R93 B;  3A54 A;  1NSN S;  1LAC A;  5KRU A;  3VR2 A;  4FF4 A;  2WAQ E;  2J7Z A;  2Q2H A;  2BOS A;  1DXM A;  3L3O C;  1STA A;  1SRO A;  2K6A A;  5ELD A;  1EYG A;  4OWX B;  1RJT A;  1EQQ A;  1ENC A;  2CWP A;  2KUM A;  3ULP A;  1SDF A;  2AQ2 B;  1TU2 B;  1PTO B;  2PMZ B;  3NEL A;  2HHH L;  4A3L G;  4GN3 B;  2CKZ B;  1MKH A;  1SYC A;  2Q2T A;  3ERO A;  2R92 B;  1B3Q A;  1BBU A;  4TKO B;  1EYD A;  3DWQ A;  5E4X A;  4I65 A;  1CKO A;  1VF7 A;  4OGQ C;  1WI5 A;  4OXP A;  4EVO A;  4LF5 L;  4DR5 Q;  3AEV A;  3NE5 B;  5IGB A;  4K14 A;  4DUY L;  2Y0S G;  1WTX A;  4PZ8 A;  5FJ8 H;  1A63 A;  3ITP A;  1QZH A;  2NVQ H;  4KHP L;  1HXY D;  4RA8 A;  1BUV T;  1HNZ L;  2FMM A;  5JEA G;  3HOW H;  3KUP A;  5JJZ A;  5FOB B;  4GLA C;  1VQ8 A;  4AIM A;  3NEM A;  1FJG Q;  3RN5 A;  2A69 D;  3URY A;  3VDY A;  4G4K A;  5C3W A;  3QOJ A;  1UEB A;  5BN3 A;  2EDG A;  4IPH A;  3IAY A;  2NVQ B;  1HR0 Q;  3U9S A;  3CCU A;  4DPG A;  1UE7 A;  2CH4 A;  2KCM A;  3HOW B;  1Q1B A;  4B3R L;  2Z8L A;  2JA5 G;  1WCM G;  1BCP C;  4LUO A;  1VQI A;  1EYA A;  3STB C;  1QE6 A;  3NTI A;  1TWH H;  2B39 A;  3J7A V;  1TY2 A;  1WFQ A;  3OPO A;  4A3M G;  1LT4 D;  1NMG A;  4YWL A;  4LFA Q;  4YY3 Q;  2QIL A;  1VQ5 A;  3OWE B;  1PRT C;  3GV6 A;  4C3J H;  3U50 C;  3P75 A;  1VQL A;  3J7A F;  3HOV B;  3T53 B;  2F3V A;  3SK8 A;  4A3G B;  1STN A;  5I9P A;  4GLV B;  1TWH B;  3HOU G;  3PV0 A;  4GN5 A;  4DR7 Q;  4JI6 L;  5J39 A;  2TMP A;  1JWM D;  3TME A;  1EOV A;  4DV2 Q;  3G6J B;  5C6A A;  2MJ8 A;  3L2P A;  5LHY 1;  3CCV A;  2IY5 B;  4C3J B;  4GOP C;  3CCJ A;  1EY7 A;  1K8G A;  3S1N H;  5LMU Q;  2XWJ B;  4WJ4 A;  2V4D A;  1U4M A;  1ZYR C;  4QF4 A;  1I4P A;  2TSS A;  2DUD A;  1GVP A;  3AFQ A;  1PH4 A;  5GRO A;  4A75 A;  3MA2 B;  4XYO A;  3GTK H;  1A3V A;  1DOL A;  2EXD A;  1XPR A;  2EY6 A;  3FKI G;  4CDD C;  4DAP A;  1CI3 M;  3CW2 C;  4Y7N H;  4ZCK A;  3S1N B;  4LUV A;  4LFB L;  3WOF A;  4P71 A;  2VY3 A;  3Q0A A;  1P16 A;  2K01 A;  3PUW A;  5C0X I;  4LF9 Q;  1HH2 P;  3GD7 A;  3GTK B;  4EQ5 A;  2K14 A;  5ELC A;  2P5Z X;  5C4Z A;  1TVX A;  1HZ9 A;  3ER0 A;  4DAM A;  2O5J C;  3M4Y A;  2QDL A;  1N32 L;  5CBA E;  4HN7 A;  5HGQ A;  5FKA C;  4UDU C;  4BXX H;  1TWG H;  2K28 A;  3BZD B;  1A3U A;  3PF5 A;  2F4I A;  1VQM A;  1HR0 W;  5CV5 A;  3TZU A;  4DV7 Q;  2OWO A;  4C1N K;  1QB5 D;  3H0G H;  4WJ3 M;  1X3G A;  1SXT A;  4CDC C;  1UWV A;  4KD3 A;  3UDG A;  4FYD A;  3O13 A;  5KND A;  4JV5 L;  1TWG B;  2K50 A;  5GAD C;  2KOL A;  1CM9 A;  1A3T A;  2B2T C;  2PZU A;  3V05 A;  4BA1 I;  1KAW A;  1I50 H;  1VQP A;  1AP0 A;  1GXD C;  3K5M A;  1PFM A;  2LXJ A;  4CDF C;  1CK1 A;  2XGT A;  3H0G B;  2WAQ B;  1PH1 A;  1SYD A;  1IL2 A;  4DR6 L;  1JE5 A;  1WTW A;  2QCP X;  3VR4 A;  3BZC A;  3L0O A;  4X3U A;  3S14 H;  2EY2 A;  2HCI A;  1BF4 A;  1EFW A;  2QGQ A;  1YJW A;  4A3L H;  4A93 G;  3PCO B;  4PZ7 A;  5C4X G;  4DGZ A;  1Q8I A;  4CKC A;  5E7N A;  2QDB A;  2K4K A;  1S40 A;  1TT2 A;  3QG1 A;  1I50 B;  3BVZ A;  1SYB A;  4I7Z C;  4CBV A;  4A76 A;  1TY0 A;  2KCC A;  2YU9 H;  1PH2 A;  2KBN A;  3N6R A;  2OQK A;  4PV1 C;  4GNX A;  3S14 B;  4FDB A;  4XXE A;  2AWN A;  3TEH B;  1BXT A;  2ALY B;  3I4M H;  3BS1 A;  4F8M A;  4KLK A;  2XSC A;  3MVV A;  4V0B A;  3CP0 A;  1EY0 A;  1XPU A;  4A3E H;  3HFZ B;  2GA4 B;  2MUY A;  2YU9 B;  3JAM E;  1WOC A;  1J8I A;  2OXP A;  3CQZ H;  1GO3 E;  2ZXO A;  4GLX A;  3DEP A;  1HNW L;  4O0A A;  1RD9 D;  4X64 Q;  1W2B A;  1C7Y A;  3A8K E;  1QCB D;  3ULL A;  3I4M B;  5JVG 3;  1CHQ D;  3S24 A;  2VUM G;  1II3 A;  2VQF Q;  1ET9 A;  3VR3 A;  2H5X A;  3IKJ A;  2MGS A;  5C4J H;  3MAQ A;  4A3E B;  3HOY B;  1B50 A;  3CQZ B;  5M5Y H;  3Q22 A;  1MJC A;  4Y52 H;  4Q5V A;  2DY7 A;  3LX0 A;  3GTO H;  5C44 G;  1O7Z A;  5IOC A;  1W6J A;  1VQK A;  4LFC Q;  4X62 L;  1EWH A;  3X3M A;  4A3M H;  4QIW E;  4R4O A;  3K5N A;  4HIM A;  1S5B D;  4ZKC B;  4JCV E;  5C4J B;  3UDF A;  1X3P A;  3KLR A;  4RGN A;  2LKV A;  5M5Y B;  4JI0 Q;  3DM1 A;  4CJ1 B;  4F87 A;  5LMN W;  3GTO B;  4KMU C;  5M9O A;  1JWU D;  3HOU H;  4C2M H;  2C5C A;  4A3M B;  2A19 A;  2RF4 A;  2IX3 A;  1YNJ C;  4YHH L;  3SGI A;  3IRB A;  5T1I A;  5LL6 S;  1AN8 A;  4IUN A;  2I5L X;  2NTT A;  4DV5 Q;  1MSH A;  4DR4 Q;  1Z9F A;  5M5W H;  3H6M A;  1JC7 A;  3K8A A;  1EY8 A;  4C2M B;  3I72 A;  2XNA C;  4BBS G;  1M8A A;  1SN8 A;  4JI4 L;  4JI3 L;  2AKW B;  2JA6 G;  1K3R A;  3KF6 A;  4JW0 A;  1BCP D;  1T9H A;  2KHS A;  2WV6 D;  5CV7 A;  1MD2 D;  2N49 A;  4MTN A;  3STB D;  2KCN A;  1B70 B;  5D3D A;  5AJ3 Q;  4I7A A;  4L6T B;  3T51 B;  5M5W B;  3K81 C;  2D62 A;  5KNB A;  3F8T A;  3P7J A;  3PIP A;  3NSW A;  2A74 C;  2KEC A;  1UNS A;  3ND8 A;  1OXS C;  1V8Q A;  4QJF A;  5I4D A;  4DAY A;  4DF7 A;  1YNN C;  2E75 C;  1C4Q A;  1DD2 A;  3CC4 A;  4JOI A;  3OMC A;  3HGB A;  3A74 A;  5M3M G;  3NEN A;  3S9W A;  2ICE C;  3VA7 A;  1Q1E A;  1EFI D;  4K5V A;  3S15 H;  2GVB A;  4Z9C B;  2BDN A;  4YWK A;  4L63 B;  1RF2 D;  1ZYR D;  4L5Q A;  3AYH B;  1Q90 A;  3M9B A;  1OXU A;  1NY4 A;  1HCZ A;  1TS3 A;  3JAM L;  1UEA B;  3A0J A;  2VQE L;  2ZTC A;  2PQA B;  1B9M A;  2DY8 A;  5EPK A;  4L8J A;  1XNR Q;  3S15 B;  2N8N A;  3K58 A;  1JOR A;  2UXD L;  4DXF A;  1LTB D;  5C5M A;  3WDN A;  3F1Z A;  1RL2 A;  4A3J H;  4XDX A;  1IBM L;  1IXR A;  4YWM A;  2K03 A;  1CQV A;  4RAU C;  5C4X H;  1WD1 A;  3M4O H;  2CW0 C;  3EVQ A;  4A3B H;  3OTO L;  4DR3 Q;  3L9A X;  2JA7 B;  1IBK L;  1GHK A;  4ME5 A;  4BBR H;  1PH3 A;  4HJ5 A;  3V2T A;  4LK1 C;  2LS0 1;  3M7N A;  4OWT B;  4HSP A;  4A3J B;  1P8L A;  3C46 A;  3CME A;  3L7Z C;  5EJW A;  2EQS A;  1LTS D;  2AUK A;  3M4O B;  1SFO H;  2R7F A;  4A3B B;  1LTR D;  1L0Y B;  4G7Z C;  1E3P A;  1JOO A;  1LTA D;  2DNC A;  1X32 A;  1TWF H;  2RCF A;  1QWY A;  3MZ5 A;  4BBR B;  3LWU A;  4A3K G;  4LF5 Q;  2E2H H;  3GTP H;  4BY1 H;  4LWC A;  1VQO A;  1Z7T A;  4DUY Q;  1TS2 A;  1KAB A;  1PHJ A;  1TII D;  2RHQ B;  1PZJ D;  4XT3 B;  1KRT A;  1QNK A;  1SFO B;  2WKC A;  4LNQ A;  1SYF A;  2F03 A;  1E0B A;  2OT2 A;  1K9M C;  2KVM A;  4XIG S;  3SXH A;  4KHP Q;  3VYT A;  2K05 A;  4JBJ A;  1HNZ Q;  5EQ0 A;  3CCS A;  5J22 A;  3GTP B;  2VB2 X;  2E2H B;  3QOL A;  3ULJ A;  4BY1 B;  3DXJ C;  2R7Z G;  1E1O A;  4FVM A;  3CF5 A;  4DK3 C;  2HIX A;  3RZO B;  5C4H A;  5C3E H;  1ICW A;  4H7B A;  3NQI A;  4N8X 1;  2NVX H;  1Y69 U;  1GUT A;  2PI2 A;  1IW7 C;  2Z9H A;  5J1Z A;  3ND9 A;  1XMQ L;  4FP5 D;  1ESF A;  2K32 A;  2ZXP A;  4B3R Q;  3OYY A;  3ZYY X;  4WRD A;  1L0W A;  2HQE A;  5IT9 L;  2F0J A;  1VQG A;  2AQ1 B;  4QIW B;  3CCM A;  3KF8 B;  4Q0F A;  5IYB G;  1ML0 D;  3H3V H;  5C3E B;  4EQP A;  4IOC A;  5ELE A;  1X54 A;  1AZP A;  4R8I A;  3EQL C;  5HUR A;  1Y1V G;  2SOB A;  4IN3 A;  1ENF A;  2SDF A;  3M85 A;  4U68 A;  3KYH C;  3GTQ H;  1KDB A;  3OWF A;  3CXC A;  4UP9 A;  4BY7 G;  2YYZ A;  1NR4 A;  1Y8N B;  1D5M C;  4JI6 Q;  5JEA J;  2H4O A;  1WTO A;  3HS0 C;  4B3S Q;  4IFD H;  3TRZ A;  2F0H A;  2HIV A;  2DGY A;  3RUZ A;  3SVM A;  4MZ9 A;  1LUZ A;  3J80 L;  3S1M H;  5DEH A;  3BDO A;  4K5X A;  3GTQ B;  1SNQ A;  4X66 L;  5CR3 A;  1PXU A;  1HFN A;  3M3Y H;  1RIP A;  3CCE A;  3TRE A;  4A3C G;  2RDF A;  1B44 D;  3HKZ E;  3PF4 A;  1GM5 A;  4FF1 A;  4QCL A;  1KDC A;  2BH2 A;  4MIU A;  1AFP A;  3JAM c;  3HEJ A;  1WTQ A;  3D4R A;  4DR1 L;  5EKK A;  1YJN A;  4LFB Q;  1SNO A;  4M1U B;  3I90 A;  3S1M B;  1SEB D;  3SK6 A;  1GHJ A;  5M3M H;  3M3Y B;  1G2T A;  1RCV D;  3HOX H;  4AQY L;  1SSO A;  5K36 H;  1D6E C;  1H9M A;  1VQJ A;  3AFP A;  2G5D A;  1YNJ D;  1B4O A;  3OW7 A;  3UDX A;  1DOK A;  2RCN A;  3W1B A;  2RSN A;  1EIG A;  1N32 Q;  2WB1 G;  3C2P A;  2JXM B;  2FHT A;  1VQ6 A;  2L55 A;  3PUZ A;  4DV3 L;  1XPO A;  3NPP A;  2ZT9 C;  2KQ3 A;  3UE0 A;  5IP7 G;  2F0M A;  3HOX B;  3R2T A;  1MBY A;  2KHJ A;  3TQY A;  4CKB A;  4IZ8 A;  1L1O B;  4H0L C;  4ULL A;  4P74 A;  3BDL A;  3MTS A;  1NUC A;  5IOD A;  4LJZ C;  3CC2 A;  4GKK Q;  5DNF A;  2JA8 B;  3D8G A;  2C9O A;  3TZD A;  4JV5 Q;  1UE5 A;  1K83 B;  2Q8T A;  4JBK A;  4RGT A;  2R61 A;  4N9T A;  2UUB L;  2GVA A;  1S5C D;  1YNN D;  2JP1 A;  1IHZ A;  1UAP A;  5T1G A;  1EZ6 A;  3VYR A;  4DR6 Q;  4ZK9 B;  4GNX C;  2PZW A;  1X9N A;  3ERQ A;  4DN4 M;  4MTK A;  1CTM A;  1JWS D;  2D0O A;  1SE2 A;  1BDO A;  1WTV A;  4GN4 B;  3EA6 A;  3T16 A;  1J5E L;  5I2Y A;  1CA6 A;  1SYG A;  2QW7 A;  5I9O A;  2ICI A;  2YTY A;  1BNZ A;  2LY7 A;  2K5N A;  4HCS A;  2CQA A;  3MEF A;  4DA2 A;  2ID0 A;  2RA4 A;  1TQO A;  2ZTD A;  3VYS A;  1D5X C;  2L12 A;  3NBH B;  4WFN 3;  1ENA A;  1I5F A;  1MSG A;  5C3X A;  4A3I G;  2JYO A;  1BOS A;  2Y0S E;  1K3B C;  5IGD A;  5BR8 Q;  1HRJ A;  5FLX L;  2A1A A;  2M2L A;  1LTT D;  3T13 A;  1HNW Q;  4JC0 A;  2MQH A;  5IYD H; 
#chains in the Genus database with same CATH homology
 3PMF A;  1ZKO A;  2HUG A;  1FD7 D;  1HPC A;  3NK9 A;  2F0L A;  1PDQ A;  4TQU S;  4OO1 I;  3K0Y A;  5IGC A;  1QOH A;  5D3I B;  1BBX C;  3W3A A;  2PYK A;  3C1E A;  2NUC A;  4LMQ D;  2RBM A;  1A2U A;  3K7A B;  3J7Y W;  1RTO A;  1X3Q A;  1B2T A;  3T4A C;  3H94 A;  3NBH A;  4CJ2 C;  2EYL A;  3GQB A;  4O42 A;  5CGK A;  4MHE A;  1OO9 B;  1EY9 A;  2NN6 H;  5I6W A;  1A2T A;  2F0Q A;  2F0O A;  4NKL A;  5CV8 A;  1PZK D;  1STY A;  2PW5 A;  3R8B A;  2B2W C;  1U4P A;  1IW7 D;  4DNR B;  3EJI A;  4FXG C;  2F0U A;  5LL6 X;  5CV6 A;  1LTG D;  2XWB B;  4DU9 A;  3HKZ B;  1VF5 C;  1SAP A;  1Z6H A;  3I70 A;  5NUC A;  3RD4 A;  5I2X A;  1V1O A;  3A7L A;  3LWE A;  1CQF A;  1LAB A;  4Y7N B;  1JB3 A;  5HGT A;  2NYZ D;  4KHZ A;  5DM7 3;  1VDZ A;  3FEW X;  5EBD A;  1MI2 A;  4EGV A;  3R3O A;  3CRK C;  4EQO A;  2N55 A;  3VYU A;  2BA0 A;  1W6K A;  3A7A B;  2A6E C;  3VR6 A;  1JE4 A;  2O4X A;  4IFD J;  3CHB D;  5DM6 3;  1Y8O B;  4KN4 C;  4NDX A;  1I4X A;  2F0D A;  2RKS A;  1F77 A;  1U4L A;  4IUV A;  3FDT A;  4NW2 A;  2JSO A;  3G7L A;  2NBF A;  4XQN A;  3GV3 A;  4YIJ A;  4K8I A;  1DOM A;  2O2L D;  4XT1 B;  3A55 A;  3NTH A;  2O5I C;  5K5P A;  4E6I A;  1D2B A;  2FMC A;  4G57 A;  3A56 A;  1RDP D;  1OXT A;  4ZQ3 A;  3RLF A;  4HAE A;  4K2K A;  4J8Q A;  4XTC S;  1BQQ T;  2LMC B;  1WVL A;  1WTR A;  1G91 A;  4IUR A;  5JEA H;  2E76 C;  3BG3 A;  5IGG A;  4QMG A;  4CKE A;  3MFG A;  2B8G A;  1D5Z C;  1BCP B;  3C3L A;  2Y0S B;  1I4G A;  4KD4 A;  5JPN C;  2XRQ D;  3NWS A;  2Z1C A;  4G7O C;  2RQX A;  1MGS A;  3U9O A;  5EBC A;  4B9W A;  1PRT B;  1GUW A;  1LT3 D;  1AZQ A;  2M00 A;  2X69 A;  5C0X G;  1FNU A;  2F0S A;  1ZEQ X;  2QKI C;  2Z4H A;  3PO3 B;  5D65 A;  2EY1 A;  2VB3 X;  1EU3 A;  2JA5 B;  1V43 A;  1WCM B;  1CZG A;  4OIJ A;  3J81 L;  3IL8 A;  1S5F D;  1E2V A;  1PYW D;  1VMP A;  1HQR D;  4HMI A;  4XQQ A;  2AUJ D;  5EKL A;  5A2Q L;  3IFT A;  4ABN A;  2IT1 A;  5IGE A;  3S17 B;  3HOU B;  5D14 A;  1EOT A;  2L11 A;  2KJX A;  2E2J B;  1TR5 A;  1WTP A;  2JEA I;  1BCP F;  4OHJ A;  2WP8 J;  1G2S A;  1B3A A;  3DUZ A;  2EYO A;  4ZUJ A;  3EFX D;  2R3Z A;  2R6G A;  3SE0 A;  3TN2 A;  2A68 C;  3SK4 A;  3D6C A;  3OIQ A;  2NVY B;  1J9O A;  1PRT F;  2DN8 A;  1QG7 A;  5COR A;  1PRT D;  3FKI B;  3HP3 A;  5IT9 E;  1Q3L A;  1QJO A;  3S1R B;  4KJN A;  2EZV A;  2DNE A;  4LAA A;  2EYF A;  2EYP A;  1GOZ A;  4H44 C;  2B2U A;  1OXV A;  2CHB D;  3OSO A;  2I07 B;  2NB0 A;  4TSS A;  4KKS A;  1H9S B;  2EYJ A;  4DK0 A;  1SJH D;  1KNA A;  2F0G A;  3FVQ A;  3J80 E;  1EYC A;  3S2H B;  4S3S A;  2X6G A;  1STB A;  3E0J A;  3MHB A;  1G6Z A;  1JOQ A;  2BDO A;  3K5O A;  4HTH A;  3PIO 3;  1CA5 A;  1ESR A;  1F9P A;  2NN6 I;  3AB9 A;  3H09 A;  5EGT A;  3TSS A;  1C8C A;  3KLS A;  3PUX A;  1RTN A;  1QNU A;  1SBB B;  3NXW A;  1TWA B;  4A93 B;  4GZY C;  1PZI D;  5C4X B;  1LLR D;  3W2D A;  2F0K A;  1SE3 A;  4KTA A;  2NZ1 D;  1IYV A;  1ROD A;  1V1P B;  1G29 1;  2G9D A;  1B1Z A;  1ZXT A;  1R4P B;  3VA5 A;  2A6E D;  4P2C B;  1B9N A;  1XTC D;  2BA1 A;  3UI2 A;  5BN5 A;  3MXP A;  2MHV A;  1PTO C;  1I4H A;  1TWF B;  1SE4 A;  2KEE A;  1EWC A;  2M9V A;  5CYU A;  1KAA A;  5C0X H;  2RVL A;  1HFG A;  3BDC A;  2VUM B;  4DXG A;  5FO9 B;  4J1M A;  1EY5 A;  4K6L A;  1O80 A;  4IQZ A;  3R93 A;  4KY7 A;  2FIN B;  4IUT A;  5C44 B;  4UAI A;  2NVX B;  1SMY C;  4FNF A;  5CBE E;  4DK1 A;  3ONA B;  2JEB I;  3K59 A;  1T5X D;  1SNC A;  2K5D A;  5FLX E;  1CZW A;  3DEO A;  1XYI A;  3GTJ B;  1T5E A;  4C3J G;  1JQY D;  3OMG A;  1G8Z D;  1TKW B;  4DFA A;  2SNM A;  1JR0 D;  3SHL A;  4M8A A;  2EJM A;  3I4L A;  4BBS B;  4WJW A;  1Z47 A;  2WII B;  2JA6 B;  3KBX A;  3DHQ A;  3OHX C;  2B2Y A;  3QO2 A;  2PCF B;  3KF8 A;  1DON A;  5E1F A;  1HA5 A;  1H9J A;  2WIN B;  1L0X B;  2D2C C;  2L4N A;  1BO0 A;  4IUQ A;  5IIF A;  4RKL A;  3WOE A;  1GUN A;  3PUY A;  2Q8R E;  1DZ1 A;  3DMU A;  5M3M B;  1EQV A;  1I6H B;  5M5X B;  2MP1 A;  3RZD B;  1SJE D;  2MPM A;  1E2W A;  1R4Q B;  2D9U A;  3D4W A;  2A68 D;  1JIC A;  1KTK A;  4FXD A;  1AW7 A;  4J6H A;  1K8M A;  2E2I B;  4BA2 I;  1PTO H;  2OF1 A;  4IUP A;  3NHH A;  5ELB A;  2L9H A;  1Q12 A;  2F0P A;  1NR2 A;  5KIX A;  3HG9 A;  1DCZ A;  2F0E A;  1BR9 A;  1GUG A;  5CV9 A;  1NAP A;  2SEB D;  4K6D A;  3MEH A;  1ILQ A;  1EIH A;  5E4W C;  1KNE A;  2B2V A;  3V96 A;  2EOT A;  3NWT A;  3CU7 A;  3E6Z X;  5BN4 A;  2QF7 A;  5FO7 B;  1E2Z A;  3SR1 A;  4A3K B;  4N9P A;  1F2Z A;  3SDZ A;  2CW0 D;  2G9H D;  3FMC A;  3CKI B;  2VXW A;  3GO5 A;  2XVS A;  1GJX A;  2IX0 A;  2HCC A;  4FF3 A;  2RDG A;  5CC4 A;  3GP7 A;  1IKL A;  5G3L F;  4B9X A;  5G3L D;  3D3R A;  2R7Z B;  2EYM A;  5ISR A;  4IUU A;  4ILW A;  1A15 A;  4KN7 C;  4RFB A;  1GUS A;  3X3N A;  1TS5 A;  4OL7 A;  3DWA A;  5DAU A;  3E5S A;  1RKN A;  3S2D B;  4RHS A;  1WD0 A;  2HDL A;  2K04 A;  3DWP A;  1PLF A;  1PTO F;  2AWO A;  1PTO D;  2PZT A;  3OIP A;  3TP8 A;  3D4D A;  5FO8 B;  1Y1V B;  1LV9 A;  3D31 A;  5F2D A;  5KYI A;  2IW3 A;  3S1Q B;  4BY7 B;  1AEX A;  3F2U A;  4ZUI A;  3C1F A;  4EQN A;  4QB4 A;  2F0N A;  3P20 A;  1U4R A;  1STG A;  1O7L A;  4BS9 A;  5KNC A;  5C0X J;  1JOK A;  4ID6 A;  2L5T A;  3KLS X;  2EJF C;  1SMY D;  4X3S A;  2B2U C;  2BCO A;  4C56 C;  2F0I A;  2EXZ A;  3J81 E;  1LTI D;  5E3F A;  2K7V A;  2EPB A;  4WOR A;  4KY5 A;  1STE A;  3GTL B;  2WAC A;  4C3I G;  5A2Q E;  2QEJ C;  3AU7 A;  2L0C A;  2A6H C;  2XIW A;  2IL8 A;  4F88 A;  2F1M A;  2WB1 B;  1S4Z A;  1EEF D;  1EQT A;  1EEI D;  1XWE A;  2PQE A;  3Q24 A;  3D6W A;  2IX1 A;  4OO1 G;  1IYU A;  2PO4 A;  4K2L A;  4RGO S;  2IPK D;  4HED A;  1IKM A;  3MC0 B;  3M7G A;  2ENB A;  1F2M A;  1I6V C;  2F0W A;  1XX8 A;  4C3H G;  4IFD I;  3K5L A;  1KDA A;  2XN9 C;  2ZXR A;  2K33 A;  4JK1 C;  1HUN A;  1F9Q A;  1LT6 D;  4ZKB B;  3GTG B;  1S5D D;  3TBI B;  1HQM C;  1C48 A;  3R2I A;  1CT1 D;  5AFW A;  1EZ8 A;  3S16 B;  4R9W A;  1SNM A;  4RGM A;  5C5L A;  4G7H C;  3FRP B;  1S5E D;  1EU4 A;  5JAV A;  4A3I B;  1OXX K;  4FXK C;  3KK7 A;  2NTS A;  4HCE A;  2BE5 C;  3OOC A;  2KA7 A;  3PIP 3;  1F2L A;  4MN3 A;  4KK7 A;  3GTM B;  3I4N B;  1FGB D;  3HOZ B;  3MXG A;  4HSV A;  2F0F A;  1SNP A;  2E74 C;  1ILP A;  1I3Q B;  1IL8 A;  1D1K A;  2F3W A;  1UUP A;  2EY5 A;  2JE6 I;  4U67 3;  2K5Q A;  2PNR C;  1HUM A;  2WKD A;  3I8Z A;  4ZLT F;  3AMU A;  1NCV A;  2B2Y C;  4RCO A;  3TP6 A;  3MFY A;  4ZRZ A;  4JBW A;  2F0T A;  1VCI A;  3HRZ C;  1LT5 D;  1FNW A;  1B53 A;  4C1N I;  2E2D C;  1EY4 A;  4KKU A;  4CJ0 B;  4IFD G;  4PMB A;  1DYQ A;  4NMZ A;  1LO5 D;  4PNY A;  4B08 A;  1F9R A;  3NTK A;  2J4X A;  4KY6 A;  3H3V C;  4TRD A;  3A8I E;  1R9T B;  2B2W A;  2RSO A;  1O7Y A;  3QB3 A;  3I91 A;  4PMW A;  1HHV A;  4HMJ A;  1JCK B;  3TP5 A;  2K1B A;  2PW7 A;  3NBI A;  3QJY A;  1EY6 A;  4K8J A;  3TP7 A;  4QUC A;  2J0T D;  4BWG B;  1CFM A;  5K36 G;  4RWS C;  5KYL A;  4C3I B;  3MWY W;  3NUC A;  2A73 B;  4KV6 A;  4OO1 H;  1Y1W B;  3IFD A;  3K57 A;  1FNV A;  3A8J E;  5CMD A;  1STH A;  2Q8I B;  1TS4 A;  4RHR A;  4DAV A;  2IJ0 A;  1EL0 A;  1HTL D;  5I6Y A;  3NP8 A;  4CHT B;  5FK9 C;  2IWH A;  3BYT B;  4A3D B;  3NQT A;  1PFB A;  1A6X A;  2F0V A;  3K6O A;  2B2V C;  4FO2 A;  1K8O A;  1D1I A;  2KED A;  2B2T A;  1M4V A;  1O78 A;  4IAL A;  2A69 C;  4QUF A;  1SND A;  2HDM A;  2FJ2 A;  3P1H A;  1I4Q A;  5JPM C;  2A6H D;  1VMC A;  4C3H B;  4RCN A;  3Q6S A;  1RHP A;  1CHP D;  4HR7 B;  5ELF A;  4V19 0;  1FYC A;  1F2Y A;  3LNN A;  4FF2 A;  3PO2 B;  3RMH A;  3I73 A;  4X3T A;  1H9S A;  2EVB A;  4OIK A;  4DNT B;  2SNS A;  2X6L A;  3BVM A;  3SK5 A;  3SEB A;  5EPJ A;  3KBG A;  3QWN A;  3BYY B;  2A5H A;  4F7X A;  1FR3 A;  5COY A;  1DM0 B;  1ONL A;  3VR5 A;  2AQ3 B;  2FFK B;  4RH6 A;  5JVH 3;  2L1B A;  3H91 A;  1PFN A;  1SYE A;  2XRS D;  2VNU D;  1HA6 A;  4RKB A;  4KJO A;  1U9R A;  1DJR D;  1XXG A;  1KLU D;  3I3C A;  1V1P A;  4H13 C;  4KKT A;  2NWG A;  1GUO A;  5IGF A;  1QIL A;  3MXU A;  1Y8P B;  4KI0 A;  5EKI A;  4AYB B;  2H1E A;  2B8F A;  3FPU B;  2BE5 D;  2N88 A;  3CRL C;  5CV4 A;  2K5W A;  4ZYS A;  2EE1 A;  4K5W A;  3FPP A;  3QIA A;  3HZX A;  4XQJ A;  2NVT B;  4NP5 A;  4A3F B;  2OEO A;  2NN6 G;  3T56 B;  2CVR A;  2LFN A;  3MXN A;  1HTP A;  5EPL A;  1PMR A;  5TSS A;  4ZAI A;  4R8N A;  2B63 B;  1H9K A;  2EJG C;  2D5D A;  3BVG A;  2EYH A;  4PMC A;  4O1N A;  4KHV A;  1I4R A;  4XYQ A;  2RDH A;  2I46 A;  5KGU A;  1H9R A;  3Q23 A;  2PPB C;  4PQX A;  1F9S A;  4CGY B;  3N52 A;  4X3K A;  5KEE A;  5A35 A;  3TDQ A;  2Z4I A;  3PUV A;  1ET6 A;  1TWC B;  5M3F B;  1KLG D;  4ODG A;  5JOB A;  2R93 B;  3A54 A;  1NSN S;  1LAC A;  5KRU A;  3VR2 A;  4FF4 A;  2J7Z A;  2BOS A;  1DXM A;  3L3O C;  1STA A;  2K6A A;  5ELD A;  1RJT A;  1ENC A;  2KUM A;  1SDF A;  2AQ2 B;  1TU2 B;  1PTO B;  2PMZ B;  1SYC A;  3ERO A;  2R92 B;  4TKO B;  1EYD A;  3DWQ A;  5E4X A;  4I65 A;  1VF7 A;  4OGQ C;  4EVO A;  3NE5 B;  5IGB A;  4K14 A;  1WTX A;  3ITP A;  1HXY D;  4RA8 A;  1BUV T;  2FMM A;  5JEA G;  3KUP A;  5JJZ A;  5FOB B;  2A69 D;  3URY A;  4G4K A;  5C3W A;  3QOJ A;  5BN3 A;  2EDG A;  3IAY A;  2NVQ B;  3U9S A;  3HOW B;  1Q1B A;  2Z8L A;  1BCP C;  1EYA A;  1QE6 A;  3NTI A;  2B39 A;  3J7A V;  1TY2 A;  3OPO A;  1LT4 D;  2QIL A;  3OWE B;  1PRT C;  3GV6 A;  3J7A F;  3P75 A;  3HOV B;  3T53 B;  2F3V A;  3SK8 A;  4A3G B;  1STN A;  5I9P A;  1TWH B;  3PV0 A;  5J39 A;  2TMP A;  1JWM D;  3TME A;  3G6J B;  5C6A A;  2MJ8 A;  5LHY 1;  4C3J B;  1EY7 A;  2XWJ B;  2V4D A;  1U4M A;  1ZYR C;  4QF4 A;  1I4P A;  2TSS A;  3MA2 B;  4XYO A;  1A3V A;  1DOL A;  2EY6 A;  4DAP A;  1CI3 M;  3S1N B;  3WOF A;  3Q0A A;  2K01 A;  3PUW A;  5C0X I;  3GD7 A;  3GTK B;  5ELC A;  5C4Z A;  1TVX A;  2O5J C;  3M4Y A;  5CBA E;  4HN7 A;  5FKA C;  4UDU C;  2K28 A;  3BZD B;  1A3U A;  2F4I A;  5CV5 A;  3TZU A;  4C1N K;  1QB5 D;  1SXT A;  4KD3 A;  4FYD A;  3O13 A;  5KND A;  1TWG B;  2KOL A;  1CM9 A;  1A3T A;  2B2T C;  2PZU A;  3V05 A;  4BA1 I;  1AP0 A;  1GXD C;  3K5M A;  1PFM A;  1CK1 A;  3H0G B;  2WAQ B;  1SYD A;  1WTW A;  2QCP X;  3VR4 A;  4X3U A;  2EY2 A;  2HCI A;  1BF4 A;  4DGZ A;  1Q8I A;  4CKC A;  2QDB A;  1TT2 A;  3QG1 A;  1I50 B;  3BVZ A;  1SYB A;  4I7Z C;  4CBV A;  1TY0 A;  2KCC A;  3N6R A;  4PV1 C;  3S14 B;  4XXE A;  2AWN A;  1BXT A;  3BS1 A;  4F8M A;  2XSC A;  3MVV A;  4V0B A;  1EY0 A;  2GA4 B;  2MUY A;  2YU9 B;  3JAM E;  1J8I A;  2OXP A;  2ZXO A;  3DEP A;  1RD9 D;  3A8K E;  1QCB D;  3I4M B;  5JVG 3;  1CHQ D;  1II3 A;  1ET9 A;  3VR3 A;  3IKJ A;  2MGS A;  3MAQ A;  4A3E B;  3HOY B;  1B50 A;  3CQZ B;  3Q22 A;  4Q5V A;  2DY7 A;  3LX0 A;  1O7Z A;  5IOC A;  1W6J A;  1EWH A;  3X3M A;  3K5N A;  1S5B D;  4ZKC B;  5C4J B;  1X3P A;  3KLR A;  4RGN A;  2LKV A;  5M5Y B;  3DM1 A;  4CJ1 B;  4F87 A;  3GTO B;  4KMU C;  5M9O A;  1JWU D;  2C5C A;  4A3M B;  2IX3 A;  1YNJ C;  5T1I A;  5LL6 S;  1AN8 A;  4IUN A;  2NTT A;  1MSH A;  3H6M A;  1JC7 A;  1EY8 A;  4C2M B;  3I72 A;  2XNA C;  1M8A A;  1BCP D;  2KHS A;  2WV6 D;  5CV7 A;  1MD2 D;  2KCN A;  5D3D A;  4L6T B;  3T51 B;  5M5W B;  2D62 A;  5KNB A;  3P7J A;  3NSW A;  2A74 C;  2KEC A;  1UNS A;  3ND8 A;  1OXS C;  1V8Q A;  5I4D A;  4DAY A;  4DF7 A;  1YNN C;  2E75 C;  1C4Q A;  1DD2 A;  3OMC A;  3HGB A;  3S9W A;  2ICE C;  3VA7 A;  1Q1E A;  1EFI D;  4K5V A;  4Z9C B;  2BDN A;  4L63 B;  1RF2 D;  1ZYR D;  1Q90 A;  1OXU A;  1HCZ A;  1TS3 A;  3JAM L;  1UEA B;  1B9M A;  2DY8 A;  5EPK A;  4L8J A;  3S15 B;  3K58 A;  1JOR A;  4DXF A;  1LTB D;  5C5M A;  3WDN A;  4XDX A;  2K03 A;  1CQV A;  4RAU C;  1WD1 A;  2CW0 C;  3EVQ A;  3L9A X;  2JA7 B;  1GHK A;  4ME5 A;  3V2T A;  4LK1 C;  2LS0 1;  3M7N A;  3C46 A;  4HSP A;  4A3J B;  3L7Z C;  5EJW A;  1LTS D;  2AUK A;  3M4O B;  4A3B B;  1LTR D;  1L0Y B;  4G7Z C;  1JOO A;  1LTA D;  2DNC A;  1X32 A;  1QWY A;  3MZ5 A;  4BBR B;  3LWU A;  1Z7T A;  1TS2 A;  1KAB A;  1TII D;  1PZJ D;  4XT3 B;  1QNK A;  1SFO B;  2WKC A;  1SYF A;  2F03 A;  1E0B A;  2OT2 A;  2KVM A;  4XIG S;  3SXH A;  3VYT A;  2K05 A;  5EQ0 A;  5J22 A;  3GTP B;  2VB2 X;  2E2H B;  3QOL A;  4BY1 B;  3DXJ C;  4FVM A;  3RZO B;  5C4H A;  1ICW A;  4H7B A;  3NQI A;  1Y69 U;  1GUT A;  5J1Z A;  1IW7 C;  3ND9 A;  4FP5 D;  1ESF A;  2K32 A;  2ZXP A;  3ZYY X;  4WRD A;  2HQE A;  5IT9 L;  2F0J A;  2AQ1 B;  4QIW B;  4Q0F A;  1ML0 D;  5C3E B;  4EQP A;  5ELE A;  1AZP A;  4R8I A;  3EQL C;  5HUR A;  2SOB A;  4IN3 A;  1ENF A;  2SDF A;  3M85 A;  4U68 A;  1KDB A;  3OWF A;  2YYZ A;  1NR4 A;  1Y8N B;  1D5M C;  5JEA J;  2H4O A;  1WTO A;  3HS0 C;  4IFD H;  2F0H A;  3RUZ A;  3SVM A;  3J80 L;  5DEH A;  3BDO A;  4K5X A;  3GTQ B;  1SNQ A;  5CR3 A;  1PXU A;  1HFN A;  2RDF A;  1B44 D;  4FF1 A;  4QCL A;  1KDC A;  4MIU A;  1AFP A;  3HEJ A;  1WTQ A;  3D4R A;  5EKK A;  1SNO A;  4M1U B;  3I90 A;  3S1M B;  1SEB D;  3SK6 A;  1GHJ A;  3M3Y B;  1G2T A;  1RCV D;  1SSO A;  5K36 H;  1D6E C;  1H9M A;  1YNJ D;  1B4O A;  3OW7 A;  1DOK A;  2RSN A;  1EIG A;  3C2P A;  2JXM B;  2FHT A;  2L55 A;  3PUZ A;  3NPP A;  2ZT9 C;  2KQ3 A;  3HOX B;  2F0M A;  3R2T A;  1MBY A;  4CKB A;  4IZ8 A;  4H0L C;  4ULL A;  3BDL A;  3MTS A;  1NUC A;  5IOD A;  4LJZ C;  5DNF A;  2JA8 B;  3D8G A;  2C9O A;  3TZD A;  1K83 B;  2Q8T A;  4RGT A;  2R61 A;  4N9T A;  1S5C D;  1IHZ A;  1YNN D;  2JP1 A;  1UAP A;  5T1G A;  1EZ6 A;  3VYR A;  4ZK9 B;  2PZW A;  3ERQ A;  4DN4 M;  1CTM A;  1JWS D;  1SE2 A;  1BDO A;  1WTV A;  3EA6 A;  3T16 A;  5I2Y A;  1CA6 A;  1SYG A;  5I9O A;  2ICI A;  1BNZ A;  2LY7 A;  4HCS A;  2CQA A;  4DA2 A;  2ID0 A;  2RA4 A;  1TQO A;  3VYS A;  1D5X C;  2L12 A;  4WFN 3;  1ENA A;  1MSG A;  5C3X A;  2JYO A;  1BOS A;  5IGD A;  1HRJ A;  5FLX L;  2M2L A;  1LTT D;  3T13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...