1NR2A

High resolution crystal structures of thymus and activation-regulated chemokine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
RECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of thymus and activation-regulated chemokine (TARC).
pubmed doi rcsb
molecule tags Cytokine
molecule keywords Thymus and activation-regulated chemokine
total genus 13
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1nr2A00
3Q6SA 1U4RA 2K03A 3TN2A 4RA8A 4DN4M 5EPLA 3QO2A 2X6GA 2X6LA 1NR4A 1EIHA 4HAEA 1HHVA 4HEDA 3SVMA 4X3TA 2K01A 1KNEA 1IL8A 5D65A 2FHTA 1F2LA 1PFNA 3IFDA 5EPJA 3H91A 2NYZD 3I3CA 2N55A 1WTVA 1WD1A 1ILQA 2KEEA 1WTWA 3N52A 4MN3A 2B2TC 2FINB 1MSGA 2HUGA 5JJZA 1WTQA 1ICWA 1HUNA 2EPBA 4R8IA 4ZK9B 1PFBA 2L9HA 1ESRA 5D14A 2KOLA 1NR2A 4ZKBB 1QE6A 5DNFA 1O7ZA 2D9UA 4LMQD 2MPMA 1G6ZA 2MJ8A 2NZ1D 4ZLTF 1C8CA 1JE4A 2K1BA 2N88A 5AFWA 1Q3LA 2L12A 1A15A 4ZAIA 2K04A 1HA6A 4X3KA 1KNAA 3P7JA 4IURA 2HCCA 2B2VA 3MWYW 4HCSA 1M8AA 2KUMA 4XT3B 5EPKA 1WTRA 1WTPA 1MI2A 2FMMA 4MHEA 1PLFA 2IL8A 1PFMA 1BNZA 5CORA 2HDMA 2JP1A 5EQ0A 1CA5A 4IUUA 2J7ZA 1TVXA 3GV6A 4ZKCB 2MGSA 3LWEA 3F2UA 2L1BA 1DZ1A 3I8ZA 1HFGA 5CMDA 1G2TA 2RA4A 1EIGA 1SDFA 2L4NA 2RSNA 1F9SA 2K28A 3MTSA 1G91A 2BDNA 4IUVA 3TZDA 1S4ZA 4QUCA 4HSVA 1EL0A 2B2UA 4RAUC 1B50A 4CJ2C 1RTNA 1AZQA 2XIWA 1LV9A 1SSOA 1U4LA 4O42A 1MSHA 1RODA 1EQTA 1HFNA 2B2UC 1X3QA 2B2WA 1RHPA 3D6WA 3G7LA 1ZXTA 1HRJA 1WTOA 1B3AA 2KECA 4UAIA 2Q8TA 1SAPA 2FJ2A 1EOTA 2FFKB 2JYOA 1BO0A 1O80A 2EE1A 1G2SA 5EKIA 5T1IA 2B2TA 1QG7A 2M2LA 1AP0A 2EOTA 1J9OA 1BBXC 4IUTA 4X3SA 1WTXA 1ILPA 1QNKA 1NCVA 2B2YA 1NAPA 4XDXA 2VXWA 1RTOA 5COYA 4X3UA 3R93A 2DY8A 2CVRA 1IKLA 1B2TA 3KBXA 2B2VC 1DOKA 1XYIA 1U4PA 1IKMA 1J8IA 1PDQA 1CA6A 3DEOA 2B2WC 2R3ZA 3FPUB 3ONAB 1AZPA 1E0BA 2RVLA 1MGSA 3DEPA 1F9PA 1BF4A 1JICA 3I90A 4CJ0B 1DONA 1GUWA 3UI2A 2HDLA 1CM9A 4NW2A 3FDTA 3I91A 2H1EA 1ML0D 4OIJA 1B4OA 1DOMA 5EJWA 1U4MA 2RSOA 2X69A 1HUMA 4XT1B 2KEDA 2B2YC 1VMPA 1X3PA 1F9QA 2SDFA 2KVMA 3IL8A 5T1GA 1RJTA 1DOLA 2Q8RE 4RWSC 5E4WC 3KUPA 5CBEE 1XX8A 4OIKA 4CJ1B 4QUFA 2L11A 1F9RA 2HCIA 1VMCA 2DY7A 4U68A 1X32A 1WD0A 2MP1A 4R9WA 3DM1A 4IUPA 5E4XA 1WVLA 5CBAE 3HP3A 2NWGA 2K05A 1O7YA 3GV3A 1B53A 4IUQA
chains in the Genus database with same CATH superfamily
3PO3H 1PYSB 2JA8H 2D0OA 1EQQA 5KIXA 1G8ZD 2JE6I 2ID0A 2K4KA 3X3MA 1QCBD 5JJKA 4K14A 1EIHA 1KLUD 4C56C 5C3EH 1Y8OB 4YCWA 1N32L 2JA6H 3PMFA 1EU3A 4LF6Q 3BZDB 3BZKA 3GTGH 2AWOA 3LGJA 1WD1A 5LL6S 4DR7L 3UDFA 2EYOA 3CMAA 4ZK9B 1EIFA 2XWBB 3L2PA 4BY7G 1PXUA 1O7ZA 1S5ED 4FXKC 2E2JB 4RG1A 3HOZG 1N33Q 3S16H 3H6MA 1YJNA 1VQKA 3CC2A 1FD7D 1NY4A 4LF9L 4IQZA 3HFZB 2MUYA 2FMMA 3A5ZB 2UUAL 3HKZG 2IT1A 1IYVA 1HNZQ 5GAHC 3HOWG 4DR6L 3GTLB 1QJOA 1KC8C 1HQMC 3A5UA 5FO9B 2L5TA 1SMYD 3ERQA 3TZDA 1S40A 5D3IB 4FNFA 4JOIA 3V96A 1QZHA 1VCIA 2QEJC 2F4VL 2B2WA 1SYEA 4DK0A 1Y69U 4WJWA 2YV5A 1XPOA 1YZ6A 1GUTA 3TREA 5EKIA 5IP9G 3NQIA 1AP0A 1J9OA 1RL2A 3K8AA 2IWHA 2EY1A 4UDUC 3J80i 3N6RA 4PMCA 3FRPB 5C4JH 3D4DA 2B2VC 2H4OA 3WOEA 4G7ZC 5IOCA 1M90C 1STAA 1A3UA 4KLKA 1MGSA 1F9PA 4MZ9A 1DONA 2BCOA 1S5FD 5ELNA 3RN5A 3A56A 1C48A 1GUSA 3HG9A 2IHEA 4DV5L 1HNXQ 3MEFA 2L11A 3STBC 4U68A 4IN3A 5IYBG 4LF8Q 3NE5B 2NWGA 4GOPA 4KY6A 1EZ8A 4JI4Q 1I4RA 2R7DA 3CRKC 4RA8A 5K5PA 5A35A 3PSIA 4A3JG 3DWQA 5M3FG 3KDFA 5C0XH 3E0JA 1W3SA 1SNMA 1FVIA 4RMFA 1SYFA 3EIVA 2IPKD 3VA5A 2Q2UA 1Y1WB 1I94Q 1I3QH 2E2HH 3N52A 2VL6A 4UHVA 4DUYQ 4OONA 3S9WA 5GAEC 4R8IA 1ESRA 2CFMA 5EBDA 1GHJA 1NR2A 2UXBL 5FLMG 1W2BA 1BOSA 4JI6Q 4A93G 3K57A 3HOUH 2AUJD 2A1AA 4A3BB 1Q3LA 4XQJA 3P75A 1EY4A 1VQ9A 2EZVA 2E74C 2PQAA 4HCSA 3M4PA 1WTRA 2IL8A 3JAME 3RLNA 1UAPA 4FXGC 4IPCA 4EQPA 3K5LA 4GKJL 2BE5D 4AYBE 3NWSA 2MGSA 4GOPB 2EDGA 4KK7A 4C3HG 1Q81C 1G2TA 3L9AX 1SDFA 1ET9A 3AYHB 2BOSA 4C3IG 4R4OA 4WRDA 1FNUA 1FYCA 3GTJB 1PZJD 3A8JE 4O42A 1N32Q 1A3TA 2UUCL 1BKBA 1TWHB 3K6OA 4P72A 5IY0A 4DU9A 2ALYB 3KBGA 5CV7A 1PTOF 4IFDI 4FF2A 1TWGB 3J80L 3V05A 1VQEA 1QG7A 3MZ5A 2JA5H 4A3MB 2NVXH 3S14H 3GTOB 1PRTC 4Q5VA 3DHQA 5KYIA 1STBA 2RVLA 2Z6BA 1LYLA 5IWAL 1Z9FA 3RZOB 3G4SA 2DNEA 1E2ZA 4OIJA 5DAUA 1JC7A 4B3SL 1QILA 1A6XA 1X3PA 1LT3D 3PUXA 4YWMA 3MFYA 1XX8A 3NBHA 3U9OA 1H9SB 4AH6A 1FGUA 2CCZA 1O7YA 4NXML 4AQYQ 1QNUA 3VDYA 1EY9A 2ZTEA 2VB2X 2X6GA 2X6LA 1U0LA 3PUVA 3IRBA 5IT9L 3SGIA 1UE7A 1SE3A 3J80E 3GD7A 4QCLA 4DK3C 2MHVA 3IFTA 2R93B 1IBLL 1TS2A 1PFSA 4CKEA 3GTMB 1C0AA 4DV1L 3T51B 2Z8LA 3VA7A 3ULJA 4GNXB 1H95A 3SDZA 3CF5A 5FO8B 1SROA 1AN8A 4JI6L 4XXEA 3BG3A 2NUCA 1BR9A 4KJNA 4OWTB 1PRTB 3KF8B 2EXDA 2AQ2B 4IPGA 2R61A 1PLFA 4DR5L 5CGKA 1Y1VB 1TWFB 2HDMA 2F0WA 1CA5A 3URYA 3DWAA 1TS3A 5M5WB 2N3SA 1Z6HA 3RR5A 1LUZA 4QIWB 1ET6A 1WJJA 1GO3E 1UUPA 3I55A 3BYYB 1HTPA 2JA6B 5FJ8H 3TSSA 1HA5A 2F3WA 2CW0C 4RAUC 1C7YA 1KQSA 2HIXA 2AMCB 1F77A 1A2UA 2WACA 4JC0A 2YU9B 2QEXA 5I4DA 3MVVA 4KN4C 2VZAA 1S5DD 4DV7Q 1SXTA 2K5QA 4J6HA 1VQNA 1NAPA 1VQHA 3S1MH 1IBML 1IKMA 3FVQA 1STGA 3W1GA 1I4QA 3FPUB 4OELB 1RIPA 2QDLA 3I91A 4NKLA 1XNQQ 1B4OA 2AKWB 2IX0A 4GKJQ 2O5JC 2SDFA 3K7AB 4F87A 1RJTA 3DMUA 2JSOA 4JVZA 2XWJB 1WCMH 2HCIA 2DY7A 1PH4A 3EFXD 1SLJA 2WAQB 3DM1A 4KI0A 3GTKB 3CCQA 2XVSA 1PH6A 5JEAJ 2K05A 1DGSA 1VQPA 1TWGH 2WINB 3CCJA 4L5QA 4LAAA 5C44B 1K3BC 1NTGA 1T9HA 4A3MH 4N8FA 3T1HQ 1Q8KA 5JPMC 4QL5A 3SVMA 1PRTD 3S2DB 5FK9C 1C9OA 4X64Q 2FMCA 2N55A 3S17H 1WTWA 1I6HB 3J81E 2HUGA 2F03A 2JA8B 3PGZA 3S1NB 3CCUA 3R2IA 1SNCA 4H13C 2KOLA 3IAYA 1EFID 2A68C 4R4CA 3I4NB 2NZ1D 4ZLTF 3J81i 3KLSA 5JVG3 2K1BA 3L7ZC 2NVYB 1E7ZA 3GO5A 3CD6A 1K83H 4DV3Q 4X3KA 1PMRA 2EYJA 4RKBA 2KUMA 1MI2A 3BVZA 3G71A 2SNSA 2G5DA 4PG3A 2A6HC 4JBJA 3TMEA 4DR5Q 3CC4A 1GJXA 2F4IA 4JYAL 4DR3Q 1QUQB 1HZBA 4G7OC 5CMDA 1MIUA 2JXMB 3SEBA 1G91A 1B8AA 1S4ZA 4HSVA 1EEFD 1PZID 4AIMA 2OQ0A 1OTCA 2O5IC 2A6HD 2XRSD 5IP7H 3CPFA 3TS0A 2F0IA 2F0PA 1Y1VH 5E3FA 2Q2IA 4A3KH 1M1KC 3HOXB 2JYOA 1P16A 1O80A 3CAMA 3PCOB 3H09A 1I6VC 2KJXA 5IGGA 2F0QA 2PYKA 4I7ZC 4DV1Q 4WJ4A 2K75A 3J7YW 4A3CG 1IKLA 2AQ1B 2UU9L 2VQEL 2TSSA 2JJQA 2UUCQ 1L2FA 3FKIB 4BWGB 4X62L 3S1NH 2M9VA 3I90A 3UI2A 1H9RA 2H1EA 5ELCA 3CRLC 1EY8A 4HTHA 4MNOA 2PW7A 3K5OA 1BCPF 1XNRQ 1WI5A 1DOLA 2UUBQ 4LW1A 3FKIG 5J1ZA 4QUFA 2OEOA 4DXFA 4OX9Q 1PYWD 1F9RA 5LMNL 1JJ2A 1R9TH 1PH8A 5FJ8G 2EJGC 1ZEQX 5IGCA 4V190 1XTDA 2ICEC 2MO1A 2WAQG 4DAYB 1B9MA 1Y8PB 2F0HA 3TN2A 4A3LG 1FNWA 4GS3A 4HIDA 1DJRD 4QMGA 4HJ5A 1F2ZA 3OYYA 1VQIA 2RDGA 4A75A 3OTOL 3VR5A 4X65L 3ERSX 1CKNB 3H91A 1TT2A 3NHHA 3E9HA 2G9DA 3D3RA 1AFPA 4KD3A 1QWYA 3KLSX 3HKZE 2KCCA 3W1BA 2CQAA 1EUJA 2LS01 1L0XB 2PNHA 1W6KA 1BBWA 2O2LD 3E6ZX 2CH4A 2ICIA 3VR3A 5M5XB 1HA6A 3GTGB 4LWCA 3C46A 3P7JA 1PTOD 4L5TA 4DV3L 3RMHA 3UE1A 3GTQH 3EQLC 1DYQA 4JI7L 3ULPA 3KLRA 5JEAH 4WJ3M 2E2IH 4R1JA 5DLQE 1YNXA 3F2UA 3G6EA 5KEEA 2E2JH 4R4TA 1JE5A 1I4PA 1HZ9A 2C5CA 5C3EG 4HJ7A 4C3HH 4RCNA 5CV9A 2XIWA 1RODA 2NVQB 3FPPA 4NP5A 3CC7A 1WTOA 4NB3A 2Q8TA 4BBSG 3SR1A 1G2SA 2Y0SG 1VQFA 4S3SA 1VQ4A 5CR3A 1QVGA 1BCPB 3KJPA 1IYUA 1NCVA 4XDXA 3K59A 1R4PB 1VDZA 3PUWA 5J22A 2CVRA 3RZDB 3MXNA 1B70B 3T1YQ 3PUZA 4DR7Q 1EQVA 4JI2L 2R7ZB 4NW2A 1ML0D 3VYSA 1YEZA 2RSOA 2EYFA 1VMPA 1NE3A 4K0KQ 3QIAA 4DR3L 2Y0SE 4JI5L 2JEAI 2NZHA 5G3LD 3NPPA 3CKIB 1TWHH 2KENA 4YCVA 3OW2A 3KF8A 5I2YA 3RUZA 3TP8A 4XIGS 4ZRZA 3VR2A 2E5LQ 3ITPA 3D31A 4LF9Q 4G4KA 3I7FA 2WB1B 1YNND 3M3YB 1OXUA 1L1OC 1JWSD 5ISRA 1VQ5A 5HGQA 1LTTD 1SYDA 2EVBA 1E24A 3EROA 4EQ5A 5EBCA 2NN6H 1EYCA 4AYBB 3OWEB 1KDCA 3T1HL 1MBYA 3CW2C 5DNFA 4G7HC 1Y1WG 4B9WA 4LFCQ 2IX1A 3RZDH 1HCZA 2PPBC 4GNXA 5HGTA 1Y1WH 3S17B 3HOZB 4DUZL 3H0GG 5IT9E 4KKSA 1TIID 1WYDA 3EVQA 1GD7A 4K5WA 3T13A 4BXXH 2QF7A 1X3GA 1TVXA 1X9NA 2K5VA 1RDPD 5AJ3L 1SMXA 4YCUA 2RHQB 4EX5A 2KCTA 4TQUS 2UXCQ 2F0MA 1LTSD 2F0VA 3B6YA 2NBFA 3LX0A 2RSNA 2HQEA 2H5XA 1SE8A 5C5LA 3L0OA 1F2MA 1LT4D 4P2CB 3SXHA 1PTOB 4DAPA 1B50A 1EOVA 4PZ7A 1RCVD 1TWFH 5JVH3 1JB3A 3C2PA 3TRZA 5C4ZA 2K32A 1A63A 4BA1I 1WTHA 4A3DH 1HQRD 3U4VA 1T5XD 1E2WA 1B2TA 2KHJA 4QB4A 1BDOA 3G6JB 5IGEA 1LO5D 3I2ZA 1A3VA 3T1YL 2E2HB 5EJWA 2N8NA 1HR0L 2UXDQ 5DM63 4JI7Q 2OTJA 2CWAA 4RHSA 1YITA 2Q8RE 2R7FA 2LXJA 1Z47A 4DR2L 2UXBQ 4F88A 1SNOA 1WD0A 4M1UB 4BY7B 1H9JA 4C3JH 1V43A 3CPWA 4HCEA 1KRSA 2XN9C 3U9SA 4A3IG 1A62A 3DUZA 3Q6SA 4YIJA 1QUQA 3HS0C 2A69D 1XNRL 1OO9B 4FF1A 4G57A 5HURA 2N49A 1VQOA 1Q7YC 3TBIB 5I6WA 1EYDA 1BXTA 3OIPA 4IUNA 2NVYH 3ER0A 1WTVA 1BUVT 3NQTA 4L8JA 1D6EC 1J5EQ 4X66L 3BYTB 3GTKH 3KK7A 4FDBA 1TY0A 2I07B 2PNRC 2Q2HA 4H7BA 2L15A 5ELEA 3HEJA 3KFUA 1VQGA 4KV6A 4QIWE 2MPMA 4OGQC 1TS4A 4LFCL 2K5HA 4DAYA 3OTOQ 3UDXA 3QR8A 3AMUA 1CUKA 2VUMH 4PMBA 2OT2A 2JP1A 5E7NA 5IODA 2F0DA 2RKSA 4HJ9A 2WKCA 2E8GA 2AUKA 3J7A5 3Q0AA 3PO3G 3UDIA 3Q24A 1HZCA 4HIOA 4BBRG 2JA7G 1EZ6A 4DGZA 4C3JG 5IGFA 4CJ2C 1AZQA 2DN8A 4LFBL 5HY6A 4L63B 2RQXA 3G48A 2K5WA 4CKBA 4ALPA 2KECA 2YTXA 1FL0A 2SOBA 3F2CA 1JWMD 4JK1C 4DV0L 1Q12A 4GLVB 1PH1A 1HH2P 2Z4IA 4HMIA 3FMCA 2B2YA 4H02A 3DXJC 3M85A 5L37A 2KHIA 1O7LA 2WFWA 4JI1L 4P74A 4IO9A 3MA2B 4A3GB 4IFDG 1IBKQ 3AFPA 4DUZQ 4JOIC 4DNTB 2CKZB 1TR5A 1HNWQ 1NMFA 1XXGA 1PH9A 1JJCB 4A3KB 1SN8A 2CW0D 5GAGC 4E6IA 4UP8A 3WDNA 4GLXA 2QA4A 3TP6A 3PF5A 2NVQH 2BA0A 2L55A 3VYTA 1WVLA 2A6EC 1R9TB 3C1FA 4A3EB 1KABA 1X55A 2ZM6Q 1G6PA 5IGDA 3KJOA 3A55A 3NBIA 1KAWA 3A0JA 4J1MA 1LM0A 1NR4A 1B3QA 4HAEA 5IYDG 4HEDA 3NTKA 1BBUA 1BVSA 3OOCA 3VYUA 1GUOA 2FHTA 3I72A 3BZCA 5IWAQ 3LNNA 5KRUA 5NUCA 5M5XH 2FXQA 2A68D 4GN5A 4F8MA 3GTLH 1XPRA 5CV6A 2JA5G 4L5RC 4YWLA 1V1OA 3D4WA 3NELA 3VR4A 1G6ZA 1AH9A 1EQRA 3D4RA 1FJGL 1H9SA 2MFIA 5FKAC 4Q0FA 4JI8L 5JPNC 2XGTA 4DR2Q 4BY1H 4A93H 1K8MA 5EPKA 1M8AA 4CKCA 2E75C 5LMUQ 3BVGA 1TKWB 3PQIA 5CORA 1JQYD 4LF4Q 2C35B 4X6AH 2BH2A 1SE2A 1NSNS 4QGUA 1EIYB 3MC0B 4GKKL 5IYBH 4IUVA 4Y7NH 2EYPA 4KHZA 1OXVA 1RTNA 3WWVA 3F2DA 2VUMB 1EQTA 1EY6A 2EYHA 3S15B 3GTQB 1ZXTA 4H44C 2HD3A 2K52A 4UAIA 4LF5Q 3NBHB 3PIP3 4DV2Q 2R7ZH 4K6DA 1GVPA 1VQDA 5C0XG 2KA7A 4A3CH 3D6CA 4HIKA 3A74A 5M3MG 1OXTA 3JC66 1PV4A 1KTKA 1QNKA 4A4IA 1VQ7A 5COYA 4X3UA 2DGYA 2A19A 3KBXA 1Q1BA 4IOAA 2Z1CA 2I5HA 1U4PA 2Q8IB 2D2CC 3VR6A 1J8IA 2R92G 3ZYYX 4BY1G 1W6JA 2WIIB 3T56B 5ELFA 1Q90A 1GUNA 4WORA 1I4HA 2R93H 3S2DH 2X69A 3S2HB 2KEDA 2KVMA 3AFQA 2R93G 4IALA 2IW3A 4BY1B 1D5XC 1V1PB 1PH7A 4IJHA 5C4HA 4RKLA 3CCSA 4LF6L 2IJ0A 4O2DA 3NK9A 1I3QB 1WCMG 4HMJA 3M7NA 3TEHB 3CU7A 4UP7A 1U4RA 4DV7L 3I4NG 1LTAD 4CDDC 2F0NA 1CKNA 1PRTF 2SEBD 3OW7A 1MHWC 5KNCA 3Q22A 2WV6D 2QW7A 2B8FA 4AYBG 1N33L 5D65A 4CDFC 3IFDA 1O78A 2PQAB 2V1CC 1ZKOA 1ILQA 1LTID 1PH2A 4DR1L 4KKTA 4DFAA 5GROA 4DR6Q 2AQ3B 1PH5A 4H0LC 4GNXC 1NNXA 3R2TA 3J81L 5BR8L 3GTOH 4DA2A 1C8CA 2QCPX 3QJYA 4B3TL 2F0EA 3TDQA 1N36Q 1KNAA 4KHVA 1PTOH 3RN2A 4YWKA 1UWVA 3HOXH 1V1PA 2E76C 1BQQT 4I65A 5EQ0A 1V8QA 1RKNA 2J7ZA 3SK4A 3HOXG 4BBRH 2JA7H 1I4XA 3GV6A 1A0IA 4RFBA 2UUBL 4LF4L 3J7AV 4FF4A 2I46A 3OWFA 3FEWX 4P73A 1SYCA 4X64L 1UE5A 4ULLA 4HN7A 3I73A 1PYBA 4K5VA 4DV6L 3HOVH 1HFNA 1I5FA 1MD2D 1STHA 1HNZL 1SAPA 4MIUA 5BN3A 2EE1A 2RCFA 4LF5L 2PO4A 3GDEA 2NB0A 1VQAA 3S1QB 1K28A 1SBBB 4A3EG 3DM3A 5C5MA 1PH3A 3OIQA 4ID6A 4NXNL 5M3MB 3K81C 1Q82C 1GUGA 4JBMA 4OO1I 1BF4A 3EN2A 3MHBA 4N8X1 3PIPA 1GUWA 3W2DA 3E0EA 4J8QA 1JORA 1XMQQ 4XT1B 1ASZA 1BCPD 1IYJB 1KDAA 3IL8A 4RHRA 2HQLA 2K6AA 2F52A 1U5KA 2A69C 3VYRA 1X32A 3I70A 5E4XA 4IUPA 1L0WA 1I94L 1B44D 4A3JB 2CQOA 4OO1G 3HOYB 4IUQA 3I4OA 3NSWA 5CV8A 2J0TD 2K03A 3CXCA 1HNWL 1ENFA 1K73C 2KHSA 4JI0L 3GTPB 1X56A 1S5CD 1T5EA 4JW0A 3I3CA 4HJ8A 1FR3A 1K8AC 3H94A 2Z6KA 4NDXA 1MSGA 5KNBA 1WTQA 4PV1C 4JI4L 5D14A 1S5BD 4OEMB 1N9WA 5C4JB 1KLGD 1QVCA 3T53B 1B9NA 3BDOA 1H9MA 1EY0A 4ZAIA 4GLAC 4B3TQ 3ND8A 3ICEA 1X54A 2B63G 4XTCS 4XT3B 1G51A 3HOYH 3MXNB 1PFMA 3U50C 1GKHA 3S1RH 1TQOA 2LSSA 5GADC 5DM73 3H15A 3H0GH 4IJLA 3J7AF 1JOOA 3LWEA 4A3FB 3BS1A 5A2QL 5C4XB 3MTSA 4A3BG 2G9HD 4QUCA 4FP5D 5KYLA 2YTVA 1LV9A 3S24A 1X3QA 1TWCH 3QWNA 3Q23A 4RGMA 2EIFA 4KMUC 1B3AA 4A3MG 1VS0A 1EOTA 3M4OB 5T1IA 1VF5C 2B39A 3K0YA 4X3SA 3PO2H 3S1QH 1RTOA 1PZKD 4P75A 2ZTCA 2BA1A 1DOKA 1WOCA 1XYIA 2EY5A 4A3DG 1IBMQ 5TSSA 3BVMA 4KN7C 3DEOA 2B8GA 2R3ZA 3K5MA 4YY3Q 4RCOA 1IHZA 1IXRA 5JOBA 1DOMA 1DCZA 1VQJA 4CBVA 1XMQL 3TQYA 1UEBA 5IGBA 5CV4A 4CJ1B 3GTPH 1TWAH 4IPHA 2EQSA 3V2TA 3OMCA 3W5OA 3HP3A 1KAAA 5K36H 4BXXG 1EWIA 1SNDA 4LMQD 5IYDH 4ABNA 5J3BA 5K36G 1Y8NB 3NEMA 4N9TA 4R8NA 1V1QA 5IT9c 1CK1A 4F7XA 4X3TA 3R8BA 2RCNA 2Z4HA 1ZYRD 1X6OA 3OSOA 3TZUA 2DUDA 4GZYC 2ZXRA 1F2LA 3DWPA 1K83B 4HIMA 1SEBD 4IFDJ 3HOWB 1AE3A 1B7YB 1SRUA 4JBKA 3RZOH 1LTLA 2RDHA 1BCPC 3JAMi 1HUNA 4B3RL 2EPBA 2F0OA 2L9HA 4B3MQ 1ZYRC 4K8IA 1ENAA 2TMPA 2I5LX 2CWPA 5M5YB 2A6ED 5I9OA 4DKAC 5C44G 4NPSA 1SFOH 3ND9A 1WTPA 1HRJA 3CQZH 4DR1Q 2NTTA 2K5NA 2MO0A 1VQBA 4DV4L 2WP8J 1JB7A 2ASBA 2JA8G 3QOJA 1DZ1A 4JYAQ 1HR0Q 3E3XA 1F9SA 5JAVA 2PI2E 4KY7A 4FF3A 2B29A 1L0YB 3U58A 4FYDA 3NP8A 3G7LA 1E3PA 5F2DA 5GQOA 3S15H 2KBNA 3STBD 1XPUA 4MTNA 5C3WA 3PO2G 1PVOA 2P5ZX 2QKIC 1WFQA 2M2LA 1WTXA 3QG1A 4JPBW 1CHPD 3WOFA 3R93A 2DY8A 1JR0D 1I50B 2B63B 1HTLD 4RGTA 3J81c 1EU4A 2NN6G 1E0BA 1HR0W 1JICA 4CJ0B 4B3SQ 4LFAQ 1YJ9A 4C1NK 1JOQA 3EJIA 4K2LA 1HZAA 5T1GA 4ME5A 5E4WC 4Y7NB 3MXGA 4DNIA 3M4OH 4KY5A 2RDFA 4LJZC 3FHWA 3O13A 1YNNC 3P1HA 2EY6A 4R9WA 1PHJA 1KXLA 4DAVA 2F0JA 5CBAE 3HOWH 2K33A 4AQYL 3HOVG 5H1SE 2NN6I 4TRDA 2EYMA 2ZTDA 1MJCA 3GTMH 4PMWA 5LHY1 2MQHA 4DN4M 3PO2B 1A2TA 4QY7A 3I56A 1E2VA 3HRZC 4CDCC 3EA6A 2EJFC 2ZJPA 4JI3L 2DJGC 3HGBA 2C9OA 2LY7A 3J81j 2UXDL 2Z9HA 5JJZA 5FLMH 3PUYA 2VY3A 2I5MX 1PFBA 4DV0Q 3SK6A 3F2BA 4JI0Q 2WKDA 1CSPA 1CKOA 1QE6A 1V9PA 3GQBA 2K7VA 1JCKB 4XYOA 4A76A 1EYAA 2F3IA 1D8LA 4JI1Q 3A8IE 1OXXK 2QDBA 4ZYSA 3D8GA 1YIJA 3HOUG 1UE1A 1Q46A 2KCNA 3AEVA 1H9KA 4ZKCB 3NXWA 1XJVA 4LUOA 4ZCKA 1SJHD 4DV4Q 4V0BA 1CSQA 3KYHC 2R6GA 4ODGA 5DEHA 5A2QE 2A5HA 4ILWA 3SHLA 1P8LA 4U673 4PQXA 1SSOA 2ENBA 1HNXL 2JEBI 4O1NA 3TP5A 2O4XA 3D6WA 2OXPA 4FVMA 1RF2D 2IX3A 1MJEA 2B2TA 3ZJYC 5M9OA 1YI2A 4QJFA 1K8GA 4OX9L 3RNUA 5M5YH 4C3HB 1VQMA 3W3AA 2B2WC 3S1RB 3A8KE 2A8VA 3J80c 3I4MG 2YU9H 2B3GA 2VW9A 1K0RA 3PV0A 3M3YH 1F9QA 3E9IA 1IW7C 4RWSC 4KJOA 1CQVA 2XSCA 1FJGQ 1EWHA 3H3VC 1X3FA 2LXKA 4OIKA 2F4VQ 1D1IA 1JWUD 2QILA 3KOJA 3H3VI 4I7AA 5LMUL 1IZ6A 5BN5A 4LF7L 2F0KA 1DXMA 1L1OB 3KF6A 2ZXOA 3GV3A 1Z7TA 4A3JH 3BDLA 1B53A 1XMOQ 5JJIA 1HPCA 2HT1A 1YNJD 5EPLA 1TS5A 4JCVE 5G3LF 1EY5A 2JA5B 1EFWA 2JN4A 5IYCG 1HHVA 2L0CA 3BU2A 3U4ZA 1STNA 1TWAB 1N34L 4CGYB 1KDBA 4RGOS 2OQKA 2RF4A 4LUZA 1PFNA 4HSPA 4P71A 5EPJA 2PW5A 2EXZA 2JA9A 2NYZD 1Q1EA 1EY7A 2FINB 3M4YA 4KHPL 5FOBB 3A54A 3BJUA 2NTSA 2Z0SA 2JQOA 3MFGA 4TVAB 4DV2L 1SE4A 2E2DC 3MXUA 4LF8L 1JE4A 3CMEA 2N88A 3HOYG 2F0LA 1E1OA 2A73B 4K6LA 4DV5Q 1QVFA 3HOZH 5JEAG 4UPAA 2QGQA 4MHEA 1BNZA 2HIVA 1MKHA 4IUUA 2Z6KC 3KDFB 5JJLA 3K80C 5KGUA 2WB1E 2L1BA 3QB3A 5AJ3Q 1D7QA 1GM5A 2RA4A 2L4NA 2IHFA 2K28A 1QZGA 2ATWA 1E1TA 5BN4A 1GHKA 2GN5A 3JAMc 1S72A 1RD9D 2B2UC 5ELBA 1TWCB 1ENCA 1JMCA 4DR4Q 3RD4A 1BO0A 3H3VH 1SYBA 4CHTB 2EOTA 1KD1C 3CHBD 2PQEA 1B1ZA 4XQNA 1ILPA 4OWXB 4BY7H 2NVXB 5IP9H 2XNAC 4DNRB 3E5SA 2GA4B 5C4XG 3M4QA 2WAQE 4TSSA 5C3XA 1CT1D 1YJWA 4BA2I 3T4AC 2E5LL 2D0PA 1KIXA 3HKZB 4EGVA 2E2IB 3FDTA 1G291 1STYA 1U4MA 3QOLA 2XTIA 4JV5L 3I4LA 3A7AB 4JBWA 5C0XJ 1IL2A 2B63H 5BR8Q 3S16B 1VF7A 4HJAA 2F0UA 1N36L 3MAQA 1F2YA 2ZT9C 2KQ3A 1XMOL 2SNMA 4BBSH 3DLLA 3MEHA 4DXGA 4IPDA 1D5MC 1M4VA 1FGBD 1KNEA 2K01A 1HXYD 1N34Q 1CKMA 4DV6Q 4L5SA 1AW7A 2EYLA 4KTAA 5IYCH 1SYGA 1K0SA 1EEID 4A93B 2ZJQA 4A3KG 3UDGA 4BS9A 2HHHQ 1CQFA 3SE0A 1J5EL 3M7GA 4IOCA 5I6YA 1VQ6A 2D9UA 1II3A 3OMGA 3UE0A 5AFWA 4NXNQ 2L12A 1CI3M 4Z9CB 4B9XA 2VB3X 3K0XA 2ZXPA 3MWYW 1U9RA 4C1NI 2BH8A 1D5ZC 4NXMQ 2CH4W 4BBSB 4C2MH 2R92B 3KLWA 4C3IB 2Y0SB 4ZQ3A 2IY5B 1QB5D 1EIGA 1ASYA 3CCLA 2BDNA 1D1KA 1L1OA 1CZWA 2F0SA 2LKVA 3KF6B 4OXPA 4POFA 4YHHL 3I4MB 3S14B 1IBLQ 1U4LA 3K58A 3CCRA 1X3EA 1SNQA 4K8JA 1KRTA 2FJ2A 3CQZB 4KHPQ 2FFKB 3BDCA 3K5NA 1I4GA 2UXCL 1Y1VG 1SFOB 1BBXC 1LTGD 4TKOB 3CCEA 3HKSA 4B08A 2JA6G 2VXWA 4GN4B 3RLFA 5M3MH 5EAYA 1ESFA 1WCMB 4J15A 4UY8C 1SR3A 3F8TA 5IIFA 4LUVA 4A3EH 1AZPA 2VUMG 2EY2A 2EJMA 1YHBA 2K50A 5M5WH 1LTBD 1CTMA 4IFDH 1XWEA 1HUMA 1Q86C 4K0KL 4EVOA 4JI5Q 5C44H 1DD2A 1YNJC 5CBEE 2KCMA 2OF1A 1Q8IA 2VQFQ 2D62A 5CYUA 1CHQD 3HOUB 2PMZB 3FKIH 4RGNA 4IZ8A 2YTYA 5CV5A 3K7AH 3K7UC 4HR7B 3QO2A 4A3IB 1A8VA 4FO2A 2VS1A 3NTIA 4ZUJA 1SMYC 1SJED 3X3NA 2OWOA 3PIOA 4A3LH 3NWTA 5IP7G 3JAML 5CC4A 4DAMA 5M3FH 2A74C 2XRQD 4KD4A 3AU7A 4LF7Q 4K2KA 1AEXA 4MN3A 4NMZA 4A3FH 2GVAA 2PZWA 3J7ZC 4DF7A 1YHQA 1E22A 2F0GA 2I0QA 2NZOA 1XNQL 2HHHL 4ZKBB 4DK1A 2RBMA 2NVTB 4A3FG 3NENA 1IW7D 4K5XA 4XQQA 1YHAA 5LMNW 1LACA 4JV5Q 4EQOA 1UEAB 4OHJA 4DPGA 1EWCA 1J6QA 5EGTA 4UP9A 3TS2A 2K04A 4JI8Q 4IURA 2HCCA 1UE6A 2PZUA 4R4QA 2VQEQ 1GOZA 2J4XA 4A3GH 4PZ6A 4X62Q 2RHSB 3I4NH 4C3IH 1GXDC 4A3DB 3AB9A 4CDEC 1LLRD 3ULLA 4JG2A 3PF4A 1EL0A 2B2UA 1Y14B 2PCFB 1I6HH 1MSHA 2R7ZG 2BE5C 4OO1H 1TU2B 5I2XA 1RHPA 3NUCA 5LMNQ 1VQLA 2CHBD 1YBYA 1O7IA 3IKJA 3S2HH 1UNSA 1LT5D 5C4XH 1K9MC 4LK1C 2F0TA 2BDOA 1D2BA 1HJPA 3I4MH 1R4QB 1YVCA 1K8OA 4DK6C 5EKLA 1K3RA 1PDQA 3A7LA 1CA6A 4LFBQ 5ELOA 2YYZA 2ZM6L 1FNVA 2OTLA 4C2MB 4B3RQ 4QQBX 3C1EA 4DR4L 4B3ML 2F1MA 5C3EB 4POGA 1TXYA 2K5DA 2B2YC 1DM0B 3KUPA 1JOKA 5C0XI 2DNCA 1KHIA 4Y52H 1I50H 4GN3B 1KL9A 3FP9A 1VMCA 5FLXL 2JK8A 2MP1A 4A3BH 2UUAQ 1QOHA 4YHHQ 4A3GG 1XTCD 4DUYL 3D0FA 1SNPA 5IE8A 4WFN3 5D3DA 3SK8A 5FO7B 4EQNA 3H0GB 4XYQA 1IL8A 3TP7A 4ME3A 4APVA 3CCVA 3HOVB 3L3OC 4YY3L 2F0FA 1STEA 2UU9Q 2Q2TA 4OL7A 1OXSC 4X66Q 2KEEA 1ONLA 2B2TC 4FXDA 5J39A 4C3JB 1CZGA 1ICWA 4KKUA 3PO3B 2GVBA 4BBRB 2JA7B 2VNUD 1C4QA 3SK5A 3PIO3 3R3OA 2MJ8A 3T16A 1NJIC 1S3OA 4ZUIA 2MNAA 2VQFL 1A15A 5M3FB 5C6AA 3GTJH 2B2VA 4PZ8A 1AE2A 3NTHA 2LFNA 3EBEA 5LL6X 2ZJRA 2WB1G 4A3IH 4RH6A 1ICFB 1VQ8A 4JI2Q 3S1MB 2ES2A 1LTRD 4LFAL 4X65Q 2AHOB 1PA6A 2NVTH 3I8ZA 1HFGA 1JJGA 3P20A 4QF4A 3OHXC 1JT8A 2D5DA 1PTOC 2AWNA 3RLOA 4L6TB 2F3VA 1TY2A 5E1FA 4LNQA 1NBWA 1NMGA 5KNDA 1CFMA 2PZTA 2V4DA 1VQCA 2K14A 3M9BA 4GOPC 5EKKA 5FLXE 3LWUA 2LMCB 1N8RC 4IUTA 4GKKQ 5ELDA 4M8AA 4N9PA 4O0AA 1X65A 2OCEA 3GP7A 3HZXA 2PMZE 4MTKA 2N78A 3C3LA 3OPOA 1IBKL 3ONAB 4R4IA 3DEPA 2M00A 5FLXc 2HDLA 1EYGA 1CM9A 4JI3Q 2R92H 3MXPA 3AQQA 3Q8DA 1NUCA 3F1ZA 3CP0A 4PNYA 5I9PA 2PI2A 1LT6D 3CCMA 2DJFC 1LABA 4OWWB
chains in the Genus database with same CATH topology
5KIXA 1G8ZD 2JE6I 2ID0A 3X3MA 1QCBD 4K14A 1EIHA 1KLUD 4C56C 1Y8OB 3PMFA 1EU3A 3BZDB 2AWOA 1WD1A 5LL6S 2EYOA 4ZK9B 2XWBB 1PXUA 1O7ZA 1S5ED 4FXKC 2E2JB 3H6MA 1FD7D 4IQZA 2MUYA 2FMMA 2IT1A 1IYVA 3GTLB 1QJOA 1HQMC 5FO9B 2L5TA 1SMYD 3ERQA 3TZDA 5D3IB 4FNFA 3V96A 1VCIA 2QEJC 2B2WA 1SYEA 4DK0A 1Y69U 4WJWA 1GUTA 5EKIA 3NQIA 1AP0A 1J9OA 2IWHA 2EY1A 4UDUC 3N6RA 4PMCA 3FRPB 3D4DA 2B2VC 2H4OA 3WOEA 4G7ZC 5IOCA 1STAA 1A3UA 1MGSA 1F9PA 1DONA 2BCOA 1S5FD 3A56A 1C48A 1GUSA 3HG9A 2L11A 4U68A 4IN3A 3NE5B 2NWGA 4KY6A 1EZ8A 1I4RA 3CRKC 4RA8A 5K5PA 5A35A 3DWQA 5C0XH 3E0JA 1SNMA 1SYFA 3VA5A 2IPKD 1Y1WB 3N52A 3S9WA 4R8IA 1ESRA 5EBDA 1GHJA 1NR2A 1BOSA 3K57A 2AUJD 4A3BB 1Q3LA 4XQJA 3P75A 1EY4A 2EZVA 2E74C 4HCSA 1WTRA 2IL8A 3JAME 1UAPA 4FXGC 4EQPA 3K5LA 2BE5D 3NWSA 2MGSA 2EDGA 4KK7A 4C3HG 1G2TA 3L9AX 1SDFA 1ET9A 2BOSA 4C3IG 4WRDA 1FNUA 1FYCA 3GTJB 1PZJD 3A8JE 4O42A 1A3TA 1TWHB 3K6OA 4DU9A 3KBGA 5CV7A 1PTOF 4IFDI 4FF2A 1TWGB 3J80L 3V05A 1QG7A 3MZ5A 4A3MB 3GTOB 1PRTC 4Q5VA 3DHQA 5KYIA 1STBA 2RVLA 3RZOB 2DNEA 1E2ZA 4OIJA 5DAUA 1JC7A 1QILA 1A6XA 1X3PA 1LT3D 3PUXA 3MFYA 1XX8A 3NBHA 3U9OA 1H9SB 1O7YA 1QNUA 1EY9A 2VB2X 2X6GA 2X6LA 3PUVA 5IT9L 1SE3A 3J80E 3GD7A 4QCLA 2MHVA 3IFTA 2R93B 1TS2A 4CKEA 3GTMB 3T51B 2Z8LA 3VA7A 3SDZA 5FO8B 1AN8A 4XXEA 3BG3A 2NUCA 1BR9A 4KJNA 1PRTB 2AQ2B 2R61A 1PLFA 5CGKA 1Y1VB 1TWFB 2HDMA 2F0WA 1CA5A 3URYA 3DWAA 1TS3A 5M5WB 1Z6HA 4QIWB 1ET6A 1UUPA 3BYYB 1HTPA 2JA6B 3TSSA 1HA5A 2F3WA 2CW0C 4RAUC 1F77A 1A2UA 2WACA 2YU9B 5I4DA 3MVVA 4KN4C 1S5DD 1SXTA 2K5QA 4J6HA 1NAPA 1IKMA 3FVQA 1STGA 1I4QA 3FPUB 3I91A 4NKLA 1B4OA 2IX0A 2O5JC 2SDFA 3K7AB 4F87A 1RJTA 3DMUA 2JSOA 2XWJB 2HCIA 2DY7A 3EFXD 2WAQB 3DM1A 3GTKB 4KI0A 2XVSA 5JEAJ 2K05A 2WINB 4LAAA 5C44B 5JPMC 3SVMA 1PRTD 3S2DB 5FK9C 2FMCA 2N55A 1WTWA 1I6HB 3J81E 2HUGA 2F03A 2JA8B 3S1NB 3R2IA 1SNCA 4H13C 2KOLA 3IAYA 1EFID 2A68C 3I4NB 2NZ1D 4ZLTF 3KLSA 5JVG3 2K1BA 3L7ZC 2NVYB 3GO5A 4X3KA 1PMRA 2EYJA 4RKBA 2KUMA 1MI2A 3BVZA 2SNSA 2A6HC 3TMEA 1GJXA 2F4IA 4G7OC 5CMDA 2JXMB 3SEBA 1G91A 1S4ZA 4HSVA 1EEFD 1PZID 2O5IC 2A6HD 2XRSD 2F0IA 2F0PA 5E3FA 3HOXB 2JYOA 1O80A 3H09A 1I6VC 2KJXA 5IGGA 2F0QA 2PYKA 4I7ZC 3J7YW 1IKLA 2AQ1B 2TSSA 3FKIB 4BWGB 2M9VA 3I90A 3UI2A 1H9RA 2H1EA 5ELCA 3CRLC 1EY8A 4HTHA 2PW7A 3K5OA 1BCPF 1DOLA 5J1ZA 4QUFA 2OEOA 4DXFA 1PYWD 1F9RA 2EJGC 1ZEQX 5IGCA 4V190 2ICEC 1B9MA 1Y8PB 2F0HA 3TN2A 1FNWA 1DJRD 4QMGA 1F2ZA 2RDGA 3VR5A 3H91A 1TT2A 3NHHA 2G9DA 3D3RA 1AFPA 4KD3A 1QWYA 3KLSX 2KCCA 2CQAA 2LS01 1L0XB 1W6KA 2O2LD 3E6ZX 2ICIA 3VR3A 5M5XB 1HA6A 3GTGB 3C46A 3P7JA 1PTOD 3RMHA 3EQLC 1DYQA 3KLRA 5JEAH 3F2UA 5KEEA 1I4PA 2C5CA 4RCNA 5CV9A 2XIWA 1RODA 2NVQB 3FPPA 4NP5A 1WTOA 2Q8TA 3SR1A 1G2SA 4S3SA 5CR3A 1BCPB 1IYUA 1NCVA 4XDXA 3K59A 1R4PB 1VDZA 3PUWA 5J22A 2CVRA 3RZDB 3MXNA 3PUZA 1EQVA 2R7ZB 4NW2A 1ML0D 3VYSA 2RSOA 2EYFA 1VMPA 3QIAA 2JEAI 5G3LD 3NPPA 3CKIB 3KF8A 5I2YA 3RUZA 3TP8A 4XIGS 4ZRZA 3VR2A 3ITPA 3D31A 4G4KA 2WB1B 1YNND 3M3YB 1OXUA 1JWSD 5ISRA 1LTTD 1SYDA 2EVBA 3EROA 5EBCA 2NN6H 1EYCA 4AYBB 3OWEB 1KDCA 1MBYA 5DNFA 4G7HC 4B9WA 2IX1A 1HCZA 2PPBC 5HGTA 3S17B 3HOZB 5IT9E 4KKSA 1TIID 3EVQA 4K5WA 3T13A 2QF7A 1TVXA 1RDPD 4TQUS 2F0MA 1LTSD 2F0VA 2NBFA 3LX0A 2RSNA 5C5LA 2HQEA 1F2MA 1LT4D 4P2CB 3SXHA 1PTOB 4DAPA 1B50A 1RCVD 5JVH3 1JB3A 3C2PA 5C4ZA 2K32A 4BA1I 1HQRD 1T5XD 1E2WA 1B2TA 4QB4A 1BDOA 3G6JB 5IGEA 1LO5D 1A3VA 2E2HB 5EJWA 5DM63 4RHSA 2Q8RE 1Z47A 4F88A 1SNOA 1WD0A 4M1UB 4BY7B 1H9JA 1V43A 4HCEA 2XN9C 3U9SA 3DUZA 3Q6SA 4YIJA 3HS0C 2A69D 1OO9B 4FF1A 4G57A 5HURA 3TBIB 5I6WA 1EYDA 1BXTA 3OIPA 4IUNA 1WTVA 1BUVT 3NQTA 4L8JA 1D6EC 3BYTB 3KK7A 1TY0A 2I07B 2PNRC 4H7BA 5ELEA 3HEJA 4KV6A 2MPMA 4OGQC 1TS4A 4DAYA 3AMUA 4PMBA 2OT2A 2JP1A 5IODA 2F0DA 2RKSA 2WKCA 2AUKA 3Q0AA 3Q24A 1EZ6A 4DGZA 4C3JG 5IGFA 4CJ2C 1AZQA 2DN8A 4L63B 2RQXA 2K5WA 4CKBA 2KECA 2SOBA 1JWMD 4JK1C 1Q12A 2Z4IA 4HMIA 3FMCA 2B2YA 3DXJC 3M85A 1O7LA 3MA2B 4A3GB 4IFDG 4DNTB 1TR5A 1XXGA 4A3KB 2CW0D 4E6IA 3WDNA 3TP6A 2BA0A 2L55A 3VYTA 1WVLA 2A6EC 1R9TB 3C1FA 4A3EB 1KABA 5IGDA 3A55A 3NBIA 4J1MA 1NR4A 4HAEA 4HEDA 3NTKA 3OOCA 3VYUA 1GUOA 2FHTA 3I72A 3LNNA 5KRUA 5NUCA 2A68D 4F8MA 5CV6A 1V1OA 3D4WA 3VR4A 1G6ZA 3D4RA 1H9SA 5FKAC 4Q0FA 5JPNC 1K8MA 5EPKA 1M8AA 4CKCA 2E75C 3BVGA 1TKWB 5CORA 1JQYD 1SE2A 1NSNS 3MC0B 4IUVA 2EYPA 4KHZA 1OXVA 1RTNA 2VUMB 1EQTA 1EY6A 2EYHA 3S15B 3GTQB 1ZXTA 4H44C 4UAIA 3PIP3 4K6DA 5C0XG 2KA7A 3D6CA 1OXTA 1KTKA 1QNKA 5COYA 4X3UA 3KBXA 1Q1BA 2Z1CA 1U4PA 2Q8IB 2D2CC 3VR6A 1J8IA 3ZYYX 1W6JA 2WIIB 3T56B 5ELFA 1Q90A 1GUNA 4WORA 1I4HA 2X69A 3S2HB 2KEDA 2KVMA 4IALA 2IW3A 4BY1B 1D5XC 1V1PB 5C4HA 4RKLA 2IJ0A 3NK9A 1I3QB 4HMJA 3M7NA 3CU7A 1U4RA 1LTAD 2F0NA 1PRTF 2SEBD 3OW7A 5KNCA 3Q22A 2WV6D 2B8FA 5D65A 3IFDA 1O78A 1ZKOA 1ILQA 1LTID 4KKTA 4DFAA 2AQ3B 4H0LC 3R2TA 3J81L 4DA2A 1C8CA 2QCPX 3QJYA 2F0EA 3TDQA 1KNAA 4KHVA 1PTOH 1V1PA 2E76C 1BQQT 4I65A 5EQ0A 1V8QA 1RKNA 2J7ZA 3SK4A 1I4XA 3GV6A 4RFBA 3J7AV 4FF4A 2I46A 3OWFA 3FEWX 1SYCA 4ULLA 4HN7A 3I73A 4K5VA 1HFNA 1MD2D 1STHA 1SAPA 4MIUA 5BN3A 2EE1A 2PO4A 2NB0A 3S1QB 1SBBB 5C5MA 3OIQA 4ID6A 5M3MB 1GUGA 4OO1I 1BF4A 3MHBA 1GUWA 3W2DA 4J8QA 1JORA 4XT1B 1BCPD 1KDAA 3IL8A 4RHRA 2K6AA 2A69C 3VYRA 1X32A 3I70A 5E4XA 4IUPA 1B44D 4A3JB 4OO1G 3HOYB 4IUQA 3NSWA 5CV8A 2J0TD 2K03A 1ENFA 2KHSA 3GTPB 1S5CD 1T5EA 3I3CA 1FR3A 3H94A 4NDXA 1MSGA 5KNBA 1WTQA 4PV1C 5D14A 1S5BD 5C4JB 1KLGD 3T53B 1B9NA 3BDOA 1H9MA 1EY0A 4ZAIA 3ND8A 4XTCS 4XT3B 1PFMA 1TQOA 5DM73 3J7AF 1JOOA 3LWEA 4A3FB 3BS1A 5A2QL 5C4XB 3MTSA 2G9HD 4QUCA 4FP5D 5KYLA 1LV9A 1X3QA 3QWNA 3Q23A 4RGMA 4KMUC 1B3AA 1EOTA 3M4OB 5T1IA 1VF5C 2B39A 3K0YA 4X3SA 1RTOA 1PZKD 2BA1A 1DOKA 1XYIA 2EY5A 5TSSA 3BVMA 4KN7C 3DEOA 2B8GA 2R3ZA 3K5MA 4RCOA 1IHZA 5JOBA 1DOMA 1DCZA 4CBVA 5IGBA 5CV4A 4CJ1B 3V2TA 3OMCA 3HP3A 1KAAA 5K36H 1SNDA 4LMQD 4ABNA 5K36G 1Y8NB 4N9TA 4R8NA 1CK1A 4F7XA 4X3TA 3R8BA 2Z4HA 1ZYRD 3OSOA 3TZUA 4GZYC 2ZXRA 1F2LA 3DWPA 1K83B 1SEBD 4IFDJ 3HOWB 2RDHA 1BCPC 1HUNA 2EPBA 2F0OA 2L9HA 1ZYRC 4K8IA 1ENAA 2TMPA 5M5YB 2A6ED 5I9OA 3ND9A 1WTPA 1HRJA 2NTTA 2WP8J 3QOJA 1DZ1A 1F9SA 5JAVA 4KY7A 4FF3A 1L0YB 4FYDA 3NP8A 3G7LA 5F2DA 5C3WA 2QKIC 2M2LA 1WTXA 3QG1A 1CHPD 3WOFA 3R93A 2DY8A 1JR0D 1I50B 2B63B 1HTLD 4RGTA 1EU4A 2NN6G 1E0BA 1JICA 4CJ0B 4C1NK 1JOQA 3EJIA 4K2LA 5T1GA 4ME5A 5E4WC 4Y7NB 3MXGA 4KY5A 2RDFA 4LJZC 3O13A 1YNNC 3P1HA 2EY6A 4R9WA 4DAVA 2F0JA 5CBAE 2K33A 2NN6I 4TRDA 2EYMA 4PMWA 5LHY1 4DN4M 3PO2B 1A2TA 1E2VA 3HRZC 3EA6A 2EJFC 3HGBA 2C9OA 2LY7A 5JJZA 3PUYA 1PFBA 3SK6A 2WKDA 1QE6A 3GQBA 2K7VA 1JCKB 4XYOA 1EYAA 3A8IE 1OXXK 2QDBA 4ZYSA 3D8GA 2KCNA 1H9KA 4ZKCB 3NXWA 1SJHD 4V0BA 2R6GA 4ODGA 5DEHA 5A2QE 2A5HA 4ILWA 3SHLA 4U673 4PQXA 1SSOA 2ENBA 2JEBI 4O1NA 3TP5A 2O4XA 3D6WA 2OXPA 4FVMA 1RF2D 2IX3A 2B2TA 5M9OA 4C3HB 3W3AA 2B2WC 3S1RB 3A8KE 3PV0A 1F9QA 1IW7C 4RWSC 4KJOA 1CQVA 2XSCA 3H3VC 1EWHA 4OIKA 1D1IA 1JWUD 2QILA 5BN5A 2F0KA 1DXMA 2ZXOA 3GV3A 1Z7TA 3BDLA 1B53A 1HPCA 1YNJD 5EPLA 1TS5A 5G3LF 2JA5B 1EY5A 1HHVA 2L0CA 1STNA 1TWAB 4CGYB 1KDBA 4RGOS 1PFNA 4HSPA 5EPJA 2PW5A 2EXZA 2NYZD 1Q1EA 1EY7A 2FINB 3M4YA 5FOBB 3A54A 2NTSA 3MFGA 1SE4A 2E2DC 3MXUA 1JE4A 2N88A 2F0LA 2A73B 4K6LA 5JEAG 1BNZA 4MHEA 4IUUA 5KGUA 2L1BA 3QB3A 2RA4A 2L4NA 2K28A 5BN4A 1GHKA 1RD9D 2B2UC 5ELBA 1TWCB 1ENCA 3RD4A 1BO0A 1SYBA 4CHTB 2EOTA 3CHBD 2PQEA 1B1ZA 4XQNA 1ILPA 2NVXB 2XNAC 4DNRB 3E5SA 2GA4B 4TSSA 5C3XA 1CT1D 4BA2I 3T4AC 3HKZB 4EGVA 2E2IB 3FDTA 1G291 1STYA 1U4MA 3QOLA 3I4LA 3A7AB 4JBWA 5C0XJ 3S16B 1VF7A 2F0UA 3MAQA 1F2YA 2ZT9C 2KQ3A 2SNMA 3MEHA 4DXGA 1D5MC 1M4VA 1FGBD 1KNEA 2K01A 1HXYD 1AW7A 2EYLA 4KTAA 1SYGA 1EEID 4A93B 4BS9A 1CQFA 3SE0A 3M7GA 5I6YA 2D9UA 1II3A 3OMGA 5AFWA 2L12A 1CI3M 4Z9CB 4B9XA 2VB3X 2ZXPA 3MWYW 1U9RA 4C1NI 1D5ZC 4BBSB 2R92B 4C3IB 2Y0SB 4ZQ3A 1QB5D 1EIGA 2BDNA 3I4MB 1D1KA 1CZWA 2F0SA 2LKVA 3S14B 1U4LA 3K58A 1SNQA 4K8JA 2FJ2A 3CQZB 2FFKB 3BDCA 3K5NA 1I4GA 1SFOB 1BBXC 1LTGD 4TKOB 4B08A 2VXWA 3RLFA 1ESFA 1WCMB 5IIFA 1AZPA 2EY2A 2EJMA 1LTBD 1CTMA 4IFDH 1XWEA 1HUMA 4EVOA 1DD2A 1YNJC 5CBEE 2OF1A 1Q8IA 2D62A 5CYUA 1CHQD 3HOUB 2PMZB 4RGNA 4IZ8A 5CV5A 4HR7B 3QO2A 4A3IB 4FO2A 3NTIA 4ZUJA 1SMYC 1SJED 3X3NA 3NWTA 3JAML 5CC4A 2A74C 2XRQD 4KD4A 3AU7A 4K2KA 1AEXA 4MN3A 4NMZA 2PZWA 4DF7A 2F0GA 4ZKBB 4DK1A 2RBMA 2NVTB 4XQQA 1IW7D 4K5XA 1LACA 4EQOA 1UEAB 4OHJA 1EWCA 5EGTA 2K04A 4IURA 2HCCA 2PZUA 1GOZA 2J4XA 1GXDC 4A3DB 3AB9A 1LLRD 1EL0A 2B2UA 2PCFB 1MSHA 2BE5C 4OO1H 1TU2B 5I2XA 1RHPA 3NUCA 2CHBD 3IKJA 1UNSA 1LT5D 4LK1C 2F0TA 2BDOA 1D2BA 1R4QB 1K8OA 5EKLA 3A7LA 1PDQA 1CA6A 2YYZA 1FNVA 4C2MB 3C1EA 2F1MA 5C3EB 2K5DA 2B2YC 1DM0B 3KUPA 1JOKA 5C0XI 2DNCA 1VMCA 5FLXL 2MP1A 1QOHA 1XTCD 1SNPA 4WFN3 5D3DA 3SK8A 5FO7B 4EQNA 3H0GB 4XYQA 1IL8A 3TP7A 3HOVB 3L3OC 2F0FA 1STEA 4OL7A 1OXSC 2KEEA 1ONLA 2B2TC 4FXDA 5J39A 4C3JB 1CZGA 1ICWA 4KKUA 3PO3B 4BBRB 2JA7B 2VNUD 1C4QA 3SK5A 3PIO3 3R3OA 2MJ8A 3T16A 4ZUIA 1A15A 5M3FB 5C6AA 2B2VA 3NTHA 2LFNA 5LL6X 4RH6A 3S1MB 1LTRD 3I8ZA 1HFGA 3P20A 4QF4A 3OHXC 2D5DA 1PTOC 2AWNA 4L6TB 2F3VA 1TY2A 5E1FA 5KNDA 1CFMA 2PZTA 2V4DA 5EKKA 5FLXE 3LWUA 2LMCB 4IUTA 5ELDA 4M8AA 4N9PA 3GP7A 3HZXA 3C3LA 3OPOA 3ONAB 3DEPA 2M00A 2HDLA 1CM9A 3MXPA 1NUCA 4PNYA 5I9PA 1LT6D 1LABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6S A;  1U4R A;  2K03 A;  3TN2 A;  4RA8 A;  4DN4 M;  5EPL A;  3QO2 A;  2X6G A;  2X6L A;  1NR4 A;  1EIH A;  4HAE A;  1HHV A;  4HED A;  3SVM A;  4X3T A;  2K01 A;  1KNE A;  1IL8 A;  5D65 A;  2FHT A;  1F2L A;  1PFN A;  3IFD A;  5EPJ A;  3H91 A;  2NYZ D;  3I3C A;  2N55 A;  1WTV A;  1WD1 A;  1ILQ A;  2KEE A;  1WTW A;  3N52 A;  4MN3 A;  2B2T C;  2FIN B;  1MSG A;  2HUG A;  5JJZ A;  1WTQ A;  1ICW A;  1HUN A;  2EPB A;  4R8I A;  4ZK9 B;  1PFB A;  2L9H A;  1ESR A;  5D14 A;  2KOL A;  1NR2 A;  4ZKB B;  1QE6 A;  5DNF A;  1O7Z A;  2D9U A;  4LMQ D;  2MPM A;  1G6Z A;  2MJ8 A;  2NZ1 D;  4ZLT F;  1C8C A;  1JE4 A;  2K1B A;  2N88 A;  5AFW A;  1Q3L A;  2L12 A;  1A15 A;  4ZAI A;  2K04 A;  1HA6 A;  4X3K A;  1KNA A;  3P7J A;  4IUR A;  2HCC A;  2B2V A;  3MWY W;  4HCS A;  1M8A A;  2KUM A;  4XT3 B;  5EPK A;  1WTR A;  1WTP A;  1MI2 A;  2FMM A;  4MHE A;  1PLF A;  2IL8 A;  1PFM A;  1BNZ A;  5COR A;  2HDM A;  2JP1 A;  5EQ0 A;  1CA5 A;  4IUU A;  2J7Z A;  1TVX A;  3GV6 A;  4ZKC B;  2MGS A;  3LWE A;  3F2U A;  2L1B A;  1DZ1 A;  3I8Z A;  1HFG A;  5CMD A;  1G2T A;  2RA4 A;  1EIG A;  1SDF A;  2L4N A;  2RSN A;  1F9S A;  2K28 A;  3MTS A;  1G91 A;  2BDN A;  4IUV A;  3TZD A;  1S4Z A;  4QUC A;  4HSV A;  1EL0 A;  2B2U A;  4RAU C;  1B50 A;  4CJ2 C;  1RTN A;  1AZQ A;  2XIW A;  1LV9 A;  1SSO A;  1U4L A;  4O42 A;  1MSH A;  1ROD A;  1EQT A;  1HFN A;  2B2U C;  1X3Q A;  2B2W A;  1RHP A;  3D6W A;  3G7L A;  1ZXT A;  1HRJ A;  1WTO A;  1B3A A;  2KEC A;  4UAI A;  2Q8T A;  1SAP A;  2FJ2 A;  1EOT A;  2FFK B;  2JYO A;  1BO0 A;  1O80 A;  2EE1 A;  1G2S A;  5EKI A;  5T1I A;  2B2T A;  1QG7 A;  2M2L A;  1AP0 A;  2EOT A;  1J9O A;  1BBX C;  4IUT A;  4X3S A;  1WTX A;  1ILP A;  1QNK A;  1NCV A;  2B2Y A;  1NAP A;  4XDX A;  2VXW A;  1RTO A;  5COY A;  4X3U A;  3R93 A;  2DY8 A;  2CVR A;  1IKL A;  1B2T A;  3KBX A;  2B2V C;  1DOK A;  1XYI A;  1U4P A;  1IKM A;  1J8I A;  1PDQ A;  1CA6 A;  3DEO A;  2B2W C;  2R3Z A;  3FPU B;  3ONA B;  1AZP A;  1E0B A;  2RVL A;  1MGS A;  3DEP A;  1F9P A;  1BF4 A;  1JIC A;  3I90 A;  4CJ0 B;  1DON A;  1GUW A;  3UI2 A;  2HDL A;  1CM9 A;  4NW2 A;  3FDT A;  3I91 A;  2H1E A;  1ML0 D;  4OIJ A;  1B4O A;  1DOM A;  5EJW A;  1U4M A;  2RSO A;  2X69 A;  1HUM A;  4XT1 B;  2KED A;  2B2Y C;  1VMP A;  1X3P A;  1F9Q A;  2SDF A;  2KVM A;  3IL8 A;  5T1G A;  1RJT A;  1DOL A;  2Q8R E;  4RWS C;  5E4W C;  3KUP A;  5CBE E;  1XX8 A;  4OIK A;  4CJ1 B;  4QUF A;  2L11 A;  1F9R A;  2HCI A;  1VMC A;  2DY7 A;  4U68 A;  1X32 A;  1WD0 A;  2MP1 A;  4R9W A;  3DM1 A;  4IUP A;  5E4X A;  1WVL A;  5CBA E;  3HP3 A;  2NWG A;  2K05 A;  1O7Y A;  3GV3 A;  1B53 A;  4IUQ A; 
#chains in the Genus database with same CATH topology
 3PO3 H;  1PYS B;  2JA8 H;  2D0O A;  1EQQ A;  5KIX A;  1G8Z D;  2JE6 I;  2ID0 A;  2K4K A;  3X3M A;  1QCB D;  5JJK A;  4K14 A;  1EIH A;  1KLU D;  4C56 C;  5C3E H;  1Y8O B;  4YCW A;  1N32 L;  2JA6 H;  3PMF A;  1EU3 A;  4LF6 Q;  3BZD B;  3BZK A;  3GTG H;  2AWO A;  3LGJ A;  1WD1 A;  5LL6 S;  4DR7 L;  3UDF A;  2EYO A;  3CMA A;  4ZK9 B;  1EIF A;  2XWB B;  3L2P A;  4BY7 G;  1PXU A;  1O7Z A;  1S5E D;  4FXK C;  2E2J B;  4RG1 A;  3HOZ G;  1N33 Q;  3S16 H;  3H6M A;  1YJN A;  1VQK A;  3CC2 A;  1FD7 D;  1NY4 A;  4LF9 L;  4IQZ A;  3HFZ B;  2MUY A;  2FMM A;  3A5Z B;  2UUA L;  3HKZ G;  2IT1 A;  1IYV A;  1HNZ Q;  5GAH C;  3HOW G;  4DR6 L;  3GTL B;  1QJO A;  1KC8 C;  1HQM C;  3A5U A;  5FO9 B;  2L5T A;  1SMY D;  3ERQ A;  3TZD A;  1S40 A;  5D3I B;  4FNF A;  4JOI A;  3V96 A;  1QZH A;  1VCI A;  2QEJ C;  2F4V L;  2B2W A;  1SYE A;  4DK0 A;  1Y69 U;  4WJW A;  2YV5 A;  1XPO A;  1YZ6 A;  1GUT A;  3TRE A;  5EKI A;  5IP9 G;  3NQI A;  1AP0 A;  1J9O A;  1RL2 A;  3K8A A;  2IWH A;  2EY1 A;  4UDU C;  3J80 i;  3N6R A;  4PMC A;  3FRP B;  5C4J H;  3D4D A;  2B2V C;  2H4O A;  3WOE A;  4G7Z C;  5IOC A;  1M90 C;  1STA A;  1A3U A;  4KLK A;  1MGS A;  1F9P A;  4MZ9 A;  1DON A;  2BCO A;  1S5F D;  5ELN A;  3RN5 A;  3A56 A;  1C48 A;  1GUS A;  3HG9 A;  2IHE A;  4DV5 L;  1HNX Q;  3MEF A;  2L11 A;  3STB C;  4U68 A;  4IN3 A;  5IYB G;  4LF8 Q;  3NE5 B;  2NWG A;  4GOP A;  4KY6 A;  1EZ8 A;  4JI4 Q;  1I4R A;  2R7D A;  3CRK C;  4RA8 A;  5K5P A;  5A35 A;  3PSI A;  4A3J G;  3DWQ A;  5M3F G;  3KDF A;  5C0X H;  3E0J A;  1W3S A;  1SNM A;  1FVI A;  4RMF A;  1SYF A;  3EIV A;  2IPK D;  3VA5 A;  2Q2U A;  1Y1W B;  1I94 Q;  1I3Q H;  2E2H H;  3N52 A;  2VL6 A;  4UHV A;  4DUY Q;  4OON A;  3S9W A;  5GAE C;  4R8I A;  1ESR A;  2CFM A;  5EBD A;  1GHJ A;  1NR2 A;  2UXB L;  5FLM G;  1W2B A;  1BOS A;  4JI6 Q;  4A93 G;  3K57 A;  3HOU H;  2AUJ D;  2A1A A;  4A3B B;  1Q3L A;  4XQJ A;  3P75 A;  1EY4 A;  1VQ9 A;  2EZV A;  2E74 C;  2PQA A;  4HCS A;  3M4P A;  1WTR A;  2IL8 A;  3JAM E;  3RLN A;  1UAP A;  4FXG C;  4IPC A;  4EQP A;  3K5L A;  4GKJ L;  2BE5 D;  4AYB E;  3NWS A;  2MGS A;  4GOP B;  2EDG A;  4KK7 A;  4C3H G;  1Q81 C;  1G2T A;  3L9A X;  1SDF A;  1ET9 A;  3AYH B;  2BOS A;  4C3I G;  4R4O A;  4WRD A;  1FNU A;  1FYC A;  3GTJ B;  1PZJ D;  3A8J E;  4O42 A;  1N32 Q;  1A3T A;  2UUC L;  1BKB A;  1TWH B;  3K6O A;  4P72 A;  5IY0 A;  4DU9 A;  2ALY B;  3KBG A;  5CV7 A;  1PTO F;  4IFD I;  4FF2 A;  1TWG B;  3J80 L;  3V05 A;  1VQE A;  1QG7 A;  3MZ5 A;  2JA5 H;  4A3M B;  2NVX H;  3S14 H;  3GTO B;  1PRT C;  4Q5V A;  3DHQ A;  5KYI A;  1STB A;  2RVL A;  2Z6B A;  1LYL A;  5IWA L;  1Z9F A;  3RZO B;  3G4S A;  2DNE A;  1E2Z A;  4OIJ A;  5DAU A;  1JC7 A;  4B3S L;  1QIL A;  1A6X A;  1X3P A;  1LT3 D;  3PUX A;  4YWM A;  3MFY A;  1XX8 A;  3NBH A;  3U9O A;  1H9S B;  4AH6 A;  1FGU A;  2CCZ A;  1O7Y A;  4NXM L;  4AQY Q;  1QNU A;  3VDY A;  1EY9 A;  2ZTE A;  2VB2 X;  2X6G A;  2X6L A;  1U0L A;  3PUV A;  3IRB A;  5IT9 L;  3SGI A;  1UE7 A;  1SE3 A;  3J80 E;  3GD7 A;  4QCL A;  4DK3 C;  2MHV A;  3IFT A;  2R93 B;  1IBL L;  1TS2 A;  1PFS A;  4CKE A;  3GTM B;  1C0A A;  4DV1 L;  3T51 B;  2Z8L A;  3VA7 A;  3ULJ A;  4GNX B;  1H95 A;  3SDZ A;  3CF5 A;  5FO8 B;  1SRO A;  1AN8 A;  4JI6 L;  4XXE A;  3BG3 A;  2NUC A;  1BR9 A;  4KJN A;  4OWT B;  1PRT B;  3KF8 B;  2EXD A;  2AQ2 B;  4IPG A;  2R61 A;  1PLF A;  4DR5 L;  5CGK A;  1Y1V B;  1TWF B;  2HDM A;  2F0W A;  1CA5 A;  3URY A;  3DWA A;  1TS3 A;  5M5W B;  2N3S A;  1Z6H A;  3RR5 A;  1LUZ A;  4QIW B;  1ET6 A;  1WJJ A;  1GO3 E;  1UUP A;  3I55 A;  3BYY B;  1HTP A;  2JA6 B;  5FJ8 H;  3TSS A;  1HA5 A;  2F3W A;  2CW0 C;  4RAU C;  1C7Y A;  1KQS A;  2HIX A;  2AMC B;  1F77 A;  1A2U A;  2WAC A;  4JC0 A;  2YU9 B;  2QEX A;  5I4D A;  3MVV A;  4KN4 C;  2VZA A;  1S5D D;  4DV7 Q;  1SXT A;  2K5Q A;  4J6H A;  1VQN A;  1NAP A;  1VQH A;  3S1M H;  1IBM L;  1IKM A;  3FVQ A;  1STG A;  3W1G A;  1I4Q A;  3FPU B;  4OEL B;  1RIP A;  2QDL A;  3I91 A;  4NKL A;  1XNQ Q;  1B4O A;  2AKW B;  2IX0 A;  4GKJ Q;  2O5J C;  2SDF A;  3K7A B;  4F87 A;  1RJT A;  3DMU A;  2JSO A;  4JVZ A;  2XWJ B;  1WCM H;  2HCI A;  2DY7 A;  1PH4 A;  3EFX D;  1SLJ A;  2WAQ B;  3DM1 A;  4KI0 A;  3GTK B;  3CCQ A;  2XVS A;  1PH6 A;  5JEA J;  2K05 A;  1DGS A;  1VQP A;  1TWG H;  2WIN B;  3CCJ A;  4L5Q A;  4LAA A;  5C44 B;  1K3B C;  1NTG A;  1T9H A;  4A3M H;  4N8F A;  3T1H Q;  1Q8K A;  5JPM C;  4QL5 A;  3SVM A;  1PRT D;  3S2D B;  5FK9 C;  1C9O A;  4X64 Q;  2FMC A;  2N55 A;  3S17 H;  1WTW A;  1I6H B;  3J81 E;  2HUG A;  2F03 A;  2JA8 B;  3PGZ A;  3S1N B;  3CCU A;  3R2I A;  1SNC A;  4H13 C;  2KOL A;  3IAY A;  1EFI D;  2A68 C;  4R4C A;  3I4N B;  2NZ1 D;  4ZLT F;  3J81 i;  3KLS A;  5JVG 3;  2K1B A;  3L7Z C;  2NVY B;  1E7Z A;  3GO5 A;  3CD6 A;  1K83 H;  4DV3 Q;  4X3K A;  1PMR A;  2EYJ A;  4RKB A;  2KUM A;  1MI2 A;  3BVZ A;  3G71 A;  2SNS A;  2G5D A;  4PG3 A;  2A6H C;  4JBJ A;  3TME A;  4DR5 Q;  3CC4 A;  1GJX A;  2F4I A;  4JYA L;  4DR3 Q;  1QUQ B;  1HZB A;  4G7O C;  5CMD A;  1MIU A;  2JXM B;  3SEB A;  1G91 A;  1B8A A;  1S4Z A;  4HSV A;  1EEF D;  1PZI D;  4AIM A;  2OQ0 A;  1OTC A;  2O5I C;  2A6H D;  2XRS D;  5IP7 H;  3CPF A;  3TS0 A;  2F0I A;  2F0P A;  1Y1V H;  5E3F A;  2Q2I A;  4A3K H;  1M1K C;  3HOX B;  2JYO A;  1P16 A;  1O80 A;  3CAM A;  3PCO B;  3H09 A;  1I6V C;  2KJX A;  5IGG A;  2F0Q A;  2PYK A;  4I7Z C;  4DV1 Q;  4WJ4 A;  2K75 A;  3J7Y W;  4A3C G;  1IKL A;  2AQ1 B;  2UU9 L;  2VQE L;  2TSS A;  2JJQ A;  2UUC Q;  1L2F A;  3FKI B;  4BWG B;  4X62 L;  3S1N H;  2M9V A;  3I90 A;  3UI2 A;  1H9R A;  2H1E A;  5ELC A;  3CRL C;  1EY8 A;  4HTH A;  4MNO A;  2PW7 A;  3K5O A;  1BCP F;  1XNR Q;  1WI5 A;  1DOL A;  2UUB Q;  4LW1 A;  3FKI G;  5J1Z A;  4QUF A;  2OEO A;  4DXF A;  4OX9 Q;  1PYW D;  1F9R A;  5LMN L;  1JJ2 A;  1R9T H;  1PH8 A;  5FJ8 G;  2EJG C;  1ZEQ X;  5IGC A;  4V19 0;  1XTD A;  2ICE C;  2MO1 A;  2WAQ G;  4DAY B;  1B9M A;  1Y8P B;  2F0H A;  3TN2 A;  4A3L G;  1FNW A;  4GS3 A;  4HID A;  1DJR D;  4QMG A;  4HJ5 A;  1F2Z A;  3OYY A;  1VQI A;  2RDG A;  4A75 A;  3OTO L;  3VR5 A;  4X65 L;  3ERS X;  1CKN B;  3H91 A;  1TT2 A;  3NHH A;  3E9H A;  2G9D A;  3D3R A;  1AFP A;  4KD3 A;  1QWY A;  3KLS X;  3HKZ E;  2KCC A;  3W1B A;  2CQA A;  1EUJ A;  2LS0 1;  1L0X B;  2PNH A;  1W6K A;  1BBW A;  2O2L D;  3E6Z X;  2CH4 A;  2ICI A;  3VR3 A;  5M5X B;  1HA6 A;  3GTG B;  4LWC A;  3C46 A;  3P7J A;  1PTO D;  4L5T A;  4DV3 L;  3RMH A;  3UE1 A;  3GTQ H;  3EQL C;  1DYQ A;  4JI7 L;  3ULP A;  3KLR A;  5JEA H;  4WJ3 M;  2E2I H;  4R1J A;  5DLQ E;  1YNX A;  3F2U A;  3G6E A;  5KEE A;  2E2J H;  4R4T A;  1JE5 A;  1I4P A;  1HZ9 A;  2C5C A;  5C3E G;  4HJ7 A;  4C3H H;  4RCN A;  5CV9 A;  2XIW A;  1ROD A;  2NVQ B;  3FPP A;  4NP5 A;  3CC7 A;  1WTO A;  4NB3 A;  2Q8T A;  4BBS G;  3SR1 A;  1G2S A;  2Y0S G;  1VQF A;  4S3S A;  1VQ4 A;  5CR3 A;  1QVG A;  1BCP B;  3KJP A;  1IYU A;  1NCV A;  4XDX A;  3K59 A;  1R4P B;  1VDZ A;  3PUW A;  5J22 A;  2CVR A;  3RZD B;  3MXN A;  1B70 B;  3T1Y Q;  3PUZ A;  4DR7 Q;  1EQV A;  4JI2 L;  2R7Z B;  4NW2 A;  1ML0 D;  3VYS A;  1YEZ A;  2RSO A;  2EYF A;  1VMP A;  1NE3 A;  4K0K Q;  3QIA A;  4DR3 L;  2Y0S E;  4JI5 L;  2JEA I;  2NZH A;  5G3L D;  3NPP A;  3CKI B;  1TWH H;  2KEN A;  4YCV A;  3OW2 A;  3KF8 A;  5I2Y A;  3RUZ A;  3TP8 A;  4XIG S;  4ZRZ A;  3VR2 A;  2E5L Q;  3ITP A;  3D31 A;  4LF9 Q;  4G4K A;  3I7F A;  2WB1 B;  1YNN D;  3M3Y B;  1OXU A;  1L1O C;  1JWS D;  5ISR A;  1VQ5 A;  5HGQ A;  1LTT D;  1SYD A;  2EVB A;  1E24 A;  3ERO A;  4EQ5 A;  5EBC A;  2NN6 H;  1EYC A;  4AYB B;  3OWE B;  1KDC A;  3T1H L;  1MBY A;  3CW2 C;  5DNF A;  4G7H C;  1Y1W G;  4B9W A;  4LFC Q;  2IX1 A;  3RZD H;  1HCZ A;  2PPB C;  4GNX A;  5HGT A;  1Y1W H;  3S17 B;  3HOZ B;  4DUZ L;  3H0G G;  5IT9 E;  4KKS A;  1TII D;  1WYD A;  3EVQ A;  1GD7 A;  4K5W A;  3T13 A;  4BXX H;  2QF7 A;  1X3G A;  1TVX A;  1X9N A;  2K5V A;  1RDP D;  5AJ3 L;  1SMX A;  4YCU A;  2RHQ B;  4EX5 A;  2KCT A;  4TQU S;  2UXC Q;  2F0M A;  1LTS D;  2F0V A;  3B6Y A;  2NBF A;  3LX0 A;  2RSN A;  2HQE A;  2H5X A;  1SE8 A;  5C5L A;  3L0O A;  1F2M A;  1LT4 D;  4P2C B;  3SXH A;  1PTO B;  4DAP A;  1B50 A;  1EOV A;  4PZ7 A;  1RCV D;  1TWF H;  5JVH 3;  1JB3 A;  3C2P A;  3TRZ A;  5C4Z A;  2K32 A;  1A63 A;  4BA1 I;  1WTH A;  4A3D H;  1HQR D;  3U4V A;  1T5X D;  1E2W A;  1B2T A;  2KHJ A;  4QB4 A;  1BDO A;  3G6J B;  5IGE A;  1LO5 D;  3I2Z A;  1A3V A;  3T1Y L;  2E2H B;  5EJW A;  2N8N A;  1HR0 L;  2UXD Q;  5DM6 3;  4JI7 Q;  2OTJ A;  2CWA A;  4RHS A;  1YIT A;  2Q8R E;  2R7F A;  2LXJ A;  1Z47 A;  4DR2 L;  2UXB Q;  4F88 A;  1SNO A;  1WD0 A;  4M1U B;  4BY7 B;  1H9J A;  4C3J H;  1V43 A;  3CPW A;  4HCE A;  1KRS A;  2XN9 C;  3U9S A;  4A3I G;  1A62 A;  3DUZ A;  3Q6S A;  4YIJ A;  1QUQ A;  3HS0 C;  2A69 D;  1XNR L;  1OO9 B;  4FF1 A;  4G57 A;  5HUR A;  2N49 A;  1VQO A;  1Q7Y C;  3TBI B;  5I6W A;  1EYD A;  1BXT A;  3OIP A;  4IUN A;  2NVY H;  3ER0 A;  1WTV A;  1BUV T;  3NQT A;  4L8J A;  1D6E C;  1J5E Q;  4X66 L;  3BYT B;  3GTK H;  3KK7 A;  4FDB A;  1TY0 A;  2I07 B;  2PNR C;  2Q2H A;  4H7B A;  2L15 A;  5ELE A;  3HEJ A;  3KFU A;  1VQG A;  4KV6 A;  4QIW E;  2MPM A;  4OGQ C;  1TS4 A;  4LFC L;  2K5H A;  4DAY A;  3OTO Q;  3UDX A;  3QR8 A;  3AMU A;  1CUK A;  2VUM H;  4PMB A;  2OT2 A;  2JP1 A;  5E7N A;  5IOD A;  2F0D A;  2RKS A;  4HJ9 A;  2WKC A;  2E8G A;  2AUK A;  3J7A 5;  3Q0A A;  3PO3 G;  3UDI A;  3Q24 A;  1HZC A;  4HIO A;  4BBR G;  2JA7 G;  1EZ6 A;  4DGZ A;  4C3J G;  5IGF A;  4CJ2 C;  1AZQ A;  2DN8 A;  4LFB L;  5HY6 A;  4L63 B;  2RQX A;  3G48 A;  2K5W A;  4CKB A;  4ALP A;  2KEC A;  2YTX A;  1FL0 A;  2SOB A;  3F2C A;  1JWM D;  4JK1 C;  4DV0 L;  1Q12 A;  4GLV B;  1PH1 A;  1HH2 P;  2Z4I A;  4HMI A;  3FMC A;  2B2Y A;  4H02 A;  3DXJ C;  3M85 A;  5L37 A;  2KHI A;  1O7L A;  2WFW A;  4JI1 L;  4P74 A;  4IO9 A;  3MA2 B;  4A3G B;  4IFD G;  1IBK Q;  3AFP A;  4DUZ Q;  4JOI C;  4DNT B;  2CKZ B;  1TR5 A;  1HNW Q;  1NMF A;  1XXG A;  1PH9 A;  1JJC B;  4A3K B;  1SN8 A;  2CW0 D;  5GAG C;  4E6I A;  4UP8 A;  3WDN A;  4GLX A;  2QA4 A;  3TP6 A;  3PF5 A;  2NVQ H;  2BA0 A;  2L55 A;  3VYT A;  1WVL A;  2A6E C;  1R9T B;  3C1F A;  4A3E B;  1KAB A;  1X55 A;  2ZM6 Q;  1G6P A;  5IGD A;  3KJO A;  3A55 A;  3NBI A;  1KAW A;  3A0J A;  4J1M A;  1LM0 A;  1NR4 A;  1B3Q A;  4HAE A;  5IYD G;  4HED A;  3NTK A;  1BBU A;  1BVS A;  3OOC A;  3VYU A;  1GUO A;  2FHT A;  3I72 A;  3BZC A;  5IWA Q;  3LNN A;  5KRU A;  5NUC A;  5M5X H;  2FXQ A;  2A68 D;  4GN5 A;  4F8M A;  3GTL H;  1XPR A;  5CV6 A;  2JA5 G;  4L5R C;  4YWL A;  1V1O A;  3D4W A;  3NEL A;  3VR4 A;  1G6Z A;  1AH9 A;  1EQR A;  3D4R A;  1FJG L;  1H9S A;  2MFI A;  5FKA C;  4Q0F A;  4JI8 L;  5JPN C;  2XGT A;  4DR2 Q;  4BY1 H;  4A93 H;  1K8M A;  5EPK A;  1M8A A;  4CKC A;  2E75 C;  5LMU Q;  3BVG A;  1TKW B;  3PQI A;  5COR A;  1JQY D;  4LF4 Q;  2C35 B;  4X6A H;  2BH2 A;  1SE2 A;  1NSN S;  4QGU A;  1EIY B;  3MC0 B;  4GKK L;  5IYB H;  4IUV A;  4Y7N H;  2EYP A;  4KHZ A;  1OXV A;  1RTN A;  3WWV A;  3F2D A;  2VUM B;  1EQT A;  1EY6 A;  2EYH A;  3S15 B;  3GTQ B;  1ZXT A;  4H44 C;  2HD3 A;  2K52 A;  4UAI A;  4LF5 Q;  3NBH B;  3PIP 3;  4DV2 Q;  2R7Z H;  4K6D A;  1GVP A;  1VQD A;  5C0X G;  2KA7 A;  4A3C H;  3D6C A;  4HIK A;  3A74 A;  5M3M G;  1OXT A;  3JC6 6;  1PV4 A;  1KTK A;  1QNK A;  4A4I A;  1VQ7 A;  5COY A;  4X3U A;  2DGY A;  2A19 A;  3KBX A;  1Q1B A;  4IOA A;  2Z1C A;  2I5H A;  1U4P A;  2Q8I B;  2D2C C;  3VR6 A;  1J8I A;  2R92 G;  3ZYY X;  4BY1 G;  1W6J A;  2WII B;  3T56 B;  5ELF A;  1Q90 A;  1GUN A;  4WOR A;  1I4H A;  2R93 H;  3S2D H;  2X69 A;  3S2H B;  2KED A;  2KVM A;  3AFQ A;  2R93 G;  4IAL A;  2IW3 A;  4BY1 B;  1D5X C;  1V1P B;  1PH7 A;  4IJH A;  5C4H A;  4RKL A;  3CCS A;  4LF6 L;  2IJ0 A;  4O2D A;  3NK9 A;  1I3Q B;  1WCM G;  4HMJ A;  3M7N A;  3TEH B;  3CU7 A;  4UP7 A;  1U4R A;  4DV7 L;  3I4N G;  1LTA D;  4CDD C;  2F0N A;  1CKN A;  1PRT F;  2SEB D;  3OW7 A;  1MHW C;  5KNC A;  3Q22 A;  2WV6 D;  2QW7 A;  2B8F A;  4AYB G;  1N33 L;  5D65 A;  4CDF C;  3IFD A;  1O78 A;  2PQA B;  2V1C C;  1ZKO A;  1ILQ A;  1LTI D;  1PH2 A;  4DR1 L;  4KKT A;  4DFA A;  5GRO A;  4DR6 Q;  2AQ3 B;  1PH5 A;  4H0L C;  4GNX C;  1NNX A;  3R2T A;  3J81 L;  5BR8 L;  3GTO H;  4DA2 A;  1C8C A;  2QCP X;  3QJY A;  4B3T L;  2F0E A;  3TDQ A;  1N36 Q;  1KNA A;  4KHV A;  1PTO H;  3RN2 A;  4YWK A;  1UWV A;  3HOX H;  1V1P A;  2E76 C;  1BQQ T;  4I65 A;  5EQ0 A;  1V8Q A;  1RKN A;  2J7Z A;  3SK4 A;  3HOX G;  4BBR H;  2JA7 H;  1I4X A;  3GV6 A;  1A0I A;  4RFB A;  2UUB L;  4LF4 L;  3J7A V;  4FF4 A;  2I46 A;  3OWF A;  3FEW X;  4P73 A;  1SYC A;  4X64 L;  1UE5 A;  4ULL A;  4HN7 A;  3I73 A;  1PYB A;  4K5V A;  4DV6 L;  3HOV H;  1HFN A;  1I5F A;  1MD2 D;  1STH A;  1HNZ L;  1SAP A;  4MIU A;  5BN3 A;  2EE1 A;  2RCF A;  4LF5 L;  2PO4 A;  3GDE A;  2NB0 A;  1VQA A;  3S1Q B;  1K28 A;  1SBB B;  4A3E G;  3DM3 A;  5C5M A;  1PH3 A;  3OIQ A;  4ID6 A;  4NXN L;  5M3M B;  3K81 C;  1Q82 C;  1GUG A;  4JBM A;  4OO1 I;  1BF4 A;  3EN2 A;  3MHB A;  4N8X 1;  3PIP A;  1GUW A;  3W2D A;  3E0E A;  4J8Q A;  1JOR A;  1XMQ Q;  4XT1 B;  1ASZ A;  1BCP D;  1IYJ B;  1KDA A;  3IL8 A;  4RHR A;  2HQL A;  2K6A A;  2F52 A;  1U5K A;  2A69 C;  3VYR A;  1X32 A;  3I70 A;  5E4X A;  4IUP A;  1L0W A;  1I94 L;  1B44 D;  4A3J B;  2CQO A;  4OO1 G;  3HOY B;  4IUQ A;  3I4O A;  3NSW A;  5CV8 A;  2J0T D;  2K03 A;  3CXC A;  1HNW L;  1ENF A;  1K73 C;  2KHS A;  4JI0 L;  3GTP B;  1X56 A;  1S5C D;  1T5E A;  4JW0 A;  3I3C A;  4HJ8 A;  1FR3 A;  1K8A C;  3H94 A;  2Z6K A;  4NDX A;  1MSG A;  5KNB A;  1WTQ A;  4PV1 C;  4JI4 L;  5D14 A;  1S5B D;  4OEM B;  1N9W A;  5C4J B;  1KLG D;  1QVC A;  3T53 B;  1B9N A;  3BDO A;  1H9M A;  1EY0 A;  4ZAI A;  4GLA C;  4B3T Q;  3ND8 A;  3ICE A;  1X54 A;  2B63 G;  4XTC S;  4XT3 B;  1G51 A;  3HOY H;  3MXN B;  1PFM A;  3U50 C;  1GKH A;  3S1R H;  1TQO A;  2LSS A;  5GAD C;  5DM7 3;  3H15 A;  3H0G H;  4IJL A;  3J7A F;  1JOO A;  3LWE A;  4A3F B;  3BS1 A;  5A2Q L;  5C4X B;  3MTS A;  4A3B G;  2G9H D;  4QUC A;  4FP5 D;  5KYL A;  2YTV A;  1LV9 A;  3S24 A;  1X3Q A;  1TWC H;  3QWN A;  3Q23 A;  4RGM A;  2EIF A;  4KMU C;  1B3A A;  4A3M G;  1VS0 A;  1EOT A;  3M4O B;  5T1I A;  1VF5 C;  2B39 A;  3K0Y A;  4X3S A;  3PO2 H;  3S1Q H;  1RTO A;  1PZK D;  4P75 A;  2ZTC A;  2BA1 A;  1DOK A;  1WOC A;  1XYI A;  2EY5 A;  4A3D G;  1IBM Q;  5TSS A;  3BVM A;  4KN7 C;  3DEO A;  2B8G A;  2R3Z A;  3K5M A;  4YY3 Q;  4RCO A;  1IHZ A;  1IXR A;  5JOB A;  1DOM A;  1DCZ A;  1VQJ A;  4CBV A;  1XMQ L;  3TQY A;  1UEB A;  5IGB A;  5CV4 A;  4CJ1 B;  3GTP H;  1TWA H;  4IPH A;  2EQS A;  3V2T A;  3OMC A;  3W5O A;  3HP3 A;  1KAA A;  5K36 H;  4BXX G;  1EWI A;  1SND A;  4LMQ D;  5IYD H;  4ABN A;  5J3B A;  5K36 G;  1Y8N B;  3NEM A;  4N9T A;  4R8N A;  1V1Q A;  5IT9 c;  1CK1 A;  4F7X A;  4X3T A;  3R8B A;  2RCN A;  2Z4H A;  1ZYR D;  1X6O A;  3OSO A;  3TZU A;  2DUD A;  4GZY C;  2ZXR A;  1F2L A;  3DWP A;  1K83 B;  4HIM A;  1SEB D;  4IFD J;  3HOW B;  1AE3 A;  1B7Y B;  1SRU A;  4JBK A;  3RZO H;  1LTL A;  2RDH A;  1BCP C;  3JAM i;  1HUN A;  4B3R L;  2EPB A;  2F0O A;  2L9H A;  4B3M Q;  1ZYR C;  4K8I A;  1ENA A;  2TMP A;  2I5L X;  2CWP A;  5M5Y B;  2A6E D;  5I9O A;  4DKA C;  5C44 G;  4NPS A;  1SFO H;  3ND9 A;  1WTP A;  1HRJ A;  3CQZ H;  4DR1 Q;  2NTT A;  2K5N A;  2MO0 A;  1VQB A;  4DV4 L;  2WP8 J;  1JB7 A;  2ASB A;  2JA8 G;  3QOJ A;  1DZ1 A;  4JYA Q;  1HR0 Q;  3E3X A;  1F9S A;  5JAV A;  2PI2 E;  4KY7 A;  4FF3 A;  2B29 A;  1L0Y B;  3U58 A;  4FYD A;  3NP8 A;  3G7L A;  1E3P A;  5F2D A;  5GQO A;  3S15 H;  2KBN A;  3STB D;  1XPU A;  4MTN A;  5C3W A;  3PO2 G;  1PVO A;  2P5Z X;  2QKI C;  1WFQ A;  2M2L A;  1WTX A;  3QG1 A;  4JPB W;  1CHP D;  3WOF A;  3R93 A;  2DY8 A;  1JR0 D;  1I50 B;  2B63 B;  1HTL D;  4RGT A;  3J81 c;  1EU4 A;  2NN6 G;  1E0B A;  1HR0 W;  1JIC A;  4CJ0 B;  4B3S Q;  4LFA Q;  1YJ9 A;  4C1N K;  1JOQ A;  3EJI A;  4K2L A;  1HZA A;  5T1G A;  4ME5 A;  5E4W C;  4Y7N B;  3MXG A;  4DNI A;  3M4O H;  4KY5 A;  2RDF A;  4LJZ C;  3FHW A;  3O13 A;  1YNN C;  3P1H A;  2EY6 A;  4R9W A;  1PHJ A;  1KXL A;  4DAV A;  2F0J A;  5CBA E;  3HOW H;  2K33 A;  4AQY L;  3HOV G;  5H1S E;  2NN6 I;  4TRD A;  2EYM A;  2ZTD A;  1MJC A;  3GTM H;  4PMW A;  5LHY 1;  2MQH A;  4DN4 M;  3PO2 B;  1A2T A;  4QY7 A;  3I56 A;  1E2V A;  3HRZ C;  4CDC C;  3EA6 A;  2EJF C;  2ZJP A;  4JI3 L;  2DJG C;  3HGB A;  2C9O A;  2LY7 A;  3J81 j;  2UXD L;  2Z9H A;  5JJZ A;  5FLM H;  3PUY A;  2VY3 A;  2I5M X;  1PFB A;  4DV0 Q;  3SK6 A;  3F2B A;  4JI0 Q;  2WKD A;  1CSP A;  1CKO A;  1QE6 A;  1V9P A;  3GQB A;  2K7V A;  1JCK B;  4XYO A;  4A76 A;  1EYA A;  2F3I A;  1D8L A;  4JI1 Q;  3A8I E;  1OXX K;  2QDB A;  4ZYS A;  3D8G A;  1YIJ A;  3HOU G;  1UE1 A;  1Q46 A;  2KCN A;  3AEV A;  1H9K A;  4ZKC B;  3NXW A;  1XJV A;  4LUO A;  4ZCK A;  1SJH D;  4DV4 Q;  4V0B A;  1CSQ A;  3KYH C;  2R6G A;  4ODG A;  5DEH A;  5A2Q E;  2A5H A;  4ILW A;  3SHL A;  1P8L A;  4U67 3;  4PQX A;  1SSO A;  2ENB A;  1HNX L;  2JEB I;  4O1N A;  3TP5 A;  2O4X A;  3D6W A;  2OXP A;  4FVM A;  1RF2 D;  2IX3 A;  1MJE A;  2B2T A;  3ZJY C;  5M9O A;  1YI2 A;  4QJF A;  1K8G A;  4OX9 L;  3RNU A;  5M5Y H;  4C3H B;  1VQM A;  3W3A A;  2B2W C;  3S1R B;  3A8K E;  2A8V A;  3J80 c;  3I4M G;  2YU9 H;  2B3G A;  2VW9 A;  1K0R A;  3PV0 A;  3M3Y H;  1F9Q A;  3E9I A;  1IW7 C;  4RWS C;  4KJO A;  1CQV A;  2XSC A;  1FJG Q;  1EWH A;  3H3V C;  1X3F A;  2LXK A;  4OIK A;  2F4V Q;  1D1I A;  1JWU D;  2QIL A;  3KOJ A;  3H3V I;  4I7A A;  5LMU L;  1IZ6 A;  5BN5 A;  4LF7 L;  2F0K A;  1DXM A;  1L1O B;  3KF6 A;  2ZXO A;  3GV3 A;  1Z7T A;  4A3J H;  3BDL A;  1B53 A;  1XMO Q;  5JJI A;  1HPC A;  2HT1 A;  1YNJ D;  5EPL A;  1TS5 A;  4JCV E;  5G3L F;  1EY5 A;  2JA5 B;  1EFW A;  2JN4 A;  5IYC G;  1HHV A;  2L0C A;  3BU2 A;  3U4Z A;  1STN A;  1TWA B;  1N34 L;  4CGY B;  1KDB A;  4RGO S;  2OQK A;  2RF4 A;  4LUZ A;  1PFN A;  4HSP A;  4P71 A;  5EPJ A;  2PW5 A;  2EXZ A;  2JA9 A;  2NYZ D;  1Q1E A;  1EY7 A;  2FIN B;  3M4Y A;  4KHP L;  5FOB B;  3A54 A;  3BJU A;  2NTS A;  2Z0S A;  2JQO A;  3MFG A;  4TVA B;  4DV2 L;  1SE4 A;  2E2D C;  3MXU A;  4LF8 L;  1JE4 A;  3CME A;  2N88 A;  3HOY G;  2F0L A;  1E1O A;  2A73 B;  4K6L A;  4DV5 Q;  1QVF A;  3HOZ H;  5JEA G;  4UPA A;  2QGQ A;  4MHE A;  1BNZ A;  2HIV A;  1MKH A;  4IUU A;  2Z6K C;  3KDF B;  5JJL A;  3K80 C;  5KGU A;  2WB1 E;  2L1B A;  3QB3 A;  5AJ3 Q;  1D7Q A;  1GM5 A;  2RA4 A;  2L4N A;  2IHF A;  2K28 A;  1QZG A;  2ATW A;  1E1T A;  5BN4 A;  1GHK A;  2GN5 A;  3JAM c;  1S72 A;  1RD9 D;  2B2U C;  5ELB A;  1TWC B;  1ENC A;  1JMC A;  4DR4 Q;  3RD4 A;  1BO0 A;  3H3V H;  1SYB A;  4CHT B;  2EOT A;  1KD1 C;  3CHB D;  2PQE A;  1B1Z A;  4XQN A;  1ILP A;  4OWX B;  4BY7 H;  2NVX B;  5IP9 H;  2XNA C;  4DNR B;  3E5S A;  2GA4 B;  5C4X G;  3M4Q A;  2WAQ E;  4TSS A;  5C3X A;  1CT1 D;  1YJW A;  4BA2 I;  3T4A C;  2E5L L;  2D0P A;  1KIX A;  3HKZ B;  4EGV A;  2E2I B;  3FDT A;  1G29 1;  1STY A;  1U4M A;  3QOL A;  2XTI A;  4JV5 L;  3I4L A;  3A7A B;  4JBW A;  5C0X J;  1IL2 A;  2B63 H;  5BR8 Q;  3S16 B;  1VF7 A;  4HJA A;  2F0U A;  1N36 L;  3MAQ A;  1F2Y A;  2ZT9 C;  2KQ3 A;  1XMO L;  2SNM A;  4BBS H;  3DLL A;  3MEH A;  4DXG A;  4IPD A;  1D5M C;  1M4V A;  1FGB D;  1KNE A;  2K01 A;  1HXY D;  1N34 Q;  1CKM A;  4DV6 Q;  4L5S A;  1AW7 A;  2EYL A;  4KTA A;  5IYC H;  1SYG A;  1K0S A;  1EEI D;  4A93 B;  2ZJQ A;  4A3K G;  3UDG A;  4BS9 A;  2HHH Q;  1CQF A;  3SE0 A;  1J5E L;  3M7G A;  4IOC A;  5I6Y A;  1VQ6 A;  2D9U A;  1II3 A;  3OMG A;  3UE0 A;  5AFW A;  4NXN Q;  2L12 A;  1CI3 M;  4Z9C B;  4B9X A;  2VB3 X;  3K0X A;  2ZXP A;  3MWY W;  1U9R A;  4C1N I;  2BH8 A;  1D5Z C;  4NXM Q;  2CH4 W;  4BBS B;  4C2M H;  2R92 B;  3KLW A;  4C3I B;  2Y0S B;  4ZQ3 A;  2IY5 B;  1QB5 D;  1EIG A;  1ASY A;  3CCL A;  2BDN A;  1D1K A;  1L1O A;  1CZW A;  2F0S A;  2LKV A;  3KF6 B;  4OXP A;  4POF A;  4YHH L;  3I4M B;  3S14 B;  1IBL Q;  1U4L A;  3K58 A;  3CCR A;  1X3E A;  1SNQ A;  4K8J A;  1KRT A;  2FJ2 A;  3CQZ B;  4KHP Q;  2FFK B;  3BDC A;  3K5N A;  1I4G A;  2UXC L;  1Y1V G;  1SFO B;  1BBX C;  1LTG D;  4TKO B;  3CCE A;  3HKS A;  4B08 A;  2JA6 G;  2VXW A;  4GN4 B;  3RLF A;  5M3M H;  5EAY A;  1ESF A;  1WCM B;  4J15 A;  4UY8 C;  1SR3 A;  3F8T A;  5IIF A;  4LUV A;  4A3E H;  1AZP A;  2VUM G;  2EY2 A;  2EJM A;  1YHB A;  2K50 A;  5M5W H;  1LTB D;  1CTM A;  4IFD H;  1XWE A;  1HUM A;  1Q86 C;  4K0K L;  4EVO A;  4JI5 Q;  5C44 H;  1DD2 A;  1YNJ C;  5CBE E;  2KCM A;  2OF1 A;  1Q8I A;  2VQF Q;  2D62 A;  5CYU A;  1CHQ D;  3HOU B;  2PMZ B;  3FKI H;  4RGN A;  4IZ8 A;  2YTY A;  5CV5 A;  3K7A H;  3K7U C;  4HR7 B;  3QO2 A;  4A3I B;  1A8V A;  4FO2 A;  2VS1 A;  3NTI A;  4ZUJ A;  1SMY C;  1SJE D;  3X3N A;  2OWO A;  3PIO A;  4A3L H;  3NWT A;  5IP7 G;  3JAM L;  5CC4 A;  4DAM A;  5M3F H;  2A74 C;  2XRQ D;  4KD4 A;  3AU7 A;  4LF7 Q;  4K2K A;  1AEX A;  4MN3 A;  4NMZ A;  4A3F H;  2GVA A;  2PZW A;  3J7Z C;  4DF7 A;  1YHQ A;  1E22 A;  2F0G A;  2I0Q A;  2NZO A;  1XNQ L;  2HHH L;  4ZKB B;  4DK1 A;  2RBM A;  2NVT B;  4A3F G;  3NEN A;  1IW7 D;  4K5X A;  4XQQ A;  1YHA A;  5LMN W;  1LAC A;  4JV5 Q;  4EQO A;  1UEA B;  4OHJ A;  4DPG A;  1EWC A;  1J6Q A;  5EGT A;  4UP9 A;  3TS2 A;  2K04 A;  4JI8 Q;  4IUR A;  2HCC A;  1UE6 A;  2PZU A;  4R4Q A;  2VQE Q;  1GOZ A;  2J4X A;  4A3G H;  4PZ6 A;  4X62 Q;  2RHS B;  3I4N H;  4C3I H;  1GXD C;  4A3D B;  3AB9 A;  4CDE C;  1LLR D;  3ULL A;  4JG2 A;  3PF4 A;  1EL0 A;  2B2U A;  1Y14 B;  2PCF B;  1I6H H;  1MSH A;  2R7Z G;  2BE5 C;  4OO1 H;  1TU2 B;  5I2X A;  1RHP A;  3NUC A;  5LMN Q;  1VQL A;  2CHB D;  1YBY A;  1O7I A;  3IKJ A;  3S2H H;  1UNS A;  1LT5 D;  5C4X H;  1K9M C;  4LK1 C;  2F0T A;  2BDO A;  1D2B A;  1HJP A;  3I4M H;  1R4Q B;  1YVC A;  1K8O A;  4DK6 C;  5EKL A;  1K3R A;  1PDQ A;  3A7L A;  1CA6 A;  4LFB Q;  5ELO A;  2YYZ A;  2ZM6 L;  1FNV A;  2OTL A;  4C2M B;  4B3R Q;  4QQB X;  3C1E A;  4DR4 L;  4B3M L;  2F1M A;  5C3E B;  4POG A;  1TXY A;  2K5D A;  2B2Y C;  1DM0 B;  3KUP A;  1JOK A;  5C0X I;  2DNC A;  1KHI A;  4Y52 H;  1I50 H;  4GN3 B;  1KL9 A;  3FP9 A;  1VMC A;  5FLX L;  2JK8 A;  2MP1 A;  4A3B H;  2UUA Q;  1QOH A;  4YHH Q;  4A3G G;  1XTC D;  4DUY L;  3D0F A;  1SNP A;  5IE8 A;  4WFN 3;  5D3D A;  3SK8 A;  5FO7 B;  4EQN A;  3H0G B;  4XYQ A;  1IL8 A;  3TP7 A;  4ME3 A;  4APV A;  3CCV A;  3HOV B;  3L3O C;  4YY3 L;  2F0F A;  1STE A;  2UU9 Q;  2Q2T A;  4OL7 A;  1OXS C;  4X66 Q;  2KEE A;  1ONL A;  2B2T C;  4FXD A;  5J39 A;  4C3J B;  1CZG A;  1ICW A;  4KKU A;  3PO3 B;  2GVB A;  4BBR B;  2JA7 B;  2VNU D;  1C4Q A;  3SK5 A;  3PIO 3;  3R3O A;  2MJ8 A;  3T16 A;  1NJI C;  1S3O A;  4ZUI A;  2MNA A;  2VQF L;  1A15 A;  5M3F B;  5C6A A;  3GTJ H;  2B2V A;  4PZ8 A;  1AE2 A;  3NTH A;  2LFN A;  3EBE A;  5LL6 X;  2ZJR A;  2WB1 G;  4A3I H;  4RH6 A;  1ICF B;  1VQ8 A;  4JI2 Q;  3S1M B;  2ES2 A;  1LTR D;  4LFA L;  4X65 Q;  2AHO B;  1PA6 A;  2NVT H;  3I8Z A;  1HFG A;  1JJG A;  3P20 A;  4QF4 A;  3OHX C;  1JT8 A;  2D5D A;  1PTO C;  2AWN A;  3RLO A;  4L6T B;  2F3V A;  1TY2 A;  5E1F A;  4LNQ A;  1NBW A;  1NMG A;  5KND A;  1CFM A;  2PZT A;  2V4D A;  1VQC A;  2K14 A;  3M9B A;  4GOP C;  5EKK A;  5FLX E;  3LWU A;  2LMC B;  1N8R C;  4IUT A;  4GKK Q;  5ELD A;  4M8A A;  4N9P A;  4O0A A;  1X65 A;  2OCE A;  3GP7 A;  3HZX A;  2PMZ E;  4MTK A;  2N78 A;  3C3L A;  3OPO A;  1IBK L;  3ONA B;  4R4I A;  3DEP A;  2M00 A;  5FLX c;  2HDL A;  1EYG A;  1CM9 A;  4JI3 Q;  2R92 H;  3MXP A;  3AQQ A;  3Q8D A;  1NUC A;  3F1Z A;  3CP0 A;  4PNY A;  5I9P A;  2PI2 A;  1LT6 D;  3CCM A;  2DJF C;  1LAB A;  4OWW B; 
#chains in the Genus database with same CATH homology
 5KIX A;  1G8Z D;  2JE6 I;  2ID0 A;  3X3M A;  1QCB D;  4K14 A;  1EIH A;  1KLU D;  4C56 C;  1Y8O B;  3PMF A;  1EU3 A;  3BZD B;  2AWO A;  1WD1 A;  5LL6 S;  2EYO A;  4ZK9 B;  2XWB B;  1PXU A;  1O7Z A;  1S5E D;  4FXK C;  2E2J B;  3H6M A;  1FD7 D;  4IQZ A;  2MUY A;  2FMM A;  2IT1 A;  1IYV A;  3GTL B;  1QJO A;  1HQM C;  5FO9 B;  2L5T A;  1SMY D;  3ERQ A;  3TZD A;  5D3I B;  4FNF A;  3V96 A;  1VCI A;  2QEJ C;  2B2W A;  1SYE A;  4DK0 A;  1Y69 U;  4WJW A;  1GUT A;  5EKI A;  3NQI A;  1AP0 A;  1J9O A;  2IWH A;  2EY1 A;  4UDU C;  3N6R A;  4PMC A;  3FRP B;  3D4D A;  2B2V C;  2H4O A;  3WOE A;  4G7Z C;  5IOC A;  1STA A;  1A3U A;  1MGS A;  1F9P A;  1DON A;  2BCO A;  1S5F D;  3A56 A;  1C48 A;  1GUS A;  3HG9 A;  2L11 A;  4U68 A;  4IN3 A;  3NE5 B;  2NWG A;  4KY6 A;  1EZ8 A;  1I4R A;  3CRK C;  4RA8 A;  5K5P A;  5A35 A;  3DWQ A;  5C0X H;  3E0J A;  1SNM A;  1SYF A;  3VA5 A;  2IPK D;  1Y1W B;  3N52 A;  3S9W A;  4R8I A;  1ESR A;  5EBD A;  1GHJ A;  1NR2 A;  1BOS A;  3K57 A;  2AUJ D;  4A3B B;  1Q3L A;  4XQJ A;  3P75 A;  1EY4 A;  2EZV A;  2E74 C;  4HCS A;  1WTR A;  2IL8 A;  3JAM E;  1UAP A;  4FXG C;  4EQP A;  3K5L A;  2BE5 D;  3NWS A;  2MGS A;  2EDG A;  4KK7 A;  4C3H G;  1G2T A;  3L9A X;  1SDF A;  1ET9 A;  2BOS A;  4C3I G;  4WRD A;  1FNU A;  1FYC A;  3GTJ B;  1PZJ D;  3A8J E;  4O42 A;  1A3T A;  1TWH B;  3K6O A;  4DU9 A;  3KBG A;  5CV7 A;  1PTO F;  4IFD I;  4FF2 A;  1TWG B;  3J80 L;  3V05 A;  1QG7 A;  3MZ5 A;  4A3M B;  3GTO B;  1PRT C;  4Q5V A;  3DHQ A;  5KYI A;  1STB A;  2RVL A;  3RZO B;  2DNE A;  1E2Z A;  4OIJ A;  5DAU A;  1JC7 A;  1QIL A;  1A6X A;  1X3P A;  1LT3 D;  3PUX A;  3MFY A;  1XX8 A;  3NBH A;  3U9O A;  1H9S B;  1O7Y A;  1QNU A;  1EY9 A;  2VB2 X;  2X6G A;  2X6L A;  3PUV A;  5IT9 L;  1SE3 A;  3J80 E;  3GD7 A;  4QCL A;  2MHV A;  3IFT A;  2R93 B;  1TS2 A;  4CKE A;  3GTM B;  3T51 B;  2Z8L A;  3VA7 A;  3SDZ A;  5FO8 B;  1AN8 A;  4XXE A;  3BG3 A;  2NUC A;  1BR9 A;  4KJN A;  1PRT B;  2AQ2 B;  2R61 A;  1PLF A;  5CGK A;  1Y1V B;  1TWF B;  2HDM A;  2F0W A;  1CA5 A;  3URY A;  3DWA A;  1TS3 A;  5M5W B;  1Z6H A;  4QIW B;  1ET6 A;  1UUP A;  3BYY B;  1HTP A;  2JA6 B;  3TSS A;  1HA5 A;  2F3W A;  2CW0 C;  4RAU C;  1F77 A;  1A2U A;  2WAC A;  2YU9 B;  5I4D A;  3MVV A;  4KN4 C;  1S5D D;  1SXT A;  2K5Q A;  4J6H A;  1NAP A;  1IKM A;  3FVQ A;  1STG A;  1I4Q A;  3FPU B;  3I91 A;  4NKL A;  1B4O A;  2IX0 A;  2O5J C;  2SDF A;  3K7A B;  4F87 A;  1RJT A;  3DMU A;  2JSO A;  2XWJ B;  2HCI A;  2DY7 A;  3EFX D;  2WAQ B;  3DM1 A;  3GTK B;  4KI0 A;  2XVS A;  5JEA J;  2K05 A;  2WIN B;  4LAA A;  5C44 B;  5JPM C;  3SVM A;  1PRT D;  3S2D B;  5FK9 C;  2FMC A;  2N55 A;  1WTW A;  1I6H B;  3J81 E;  2HUG A;  2F03 A;  2JA8 B;  3S1N B;  3R2I A;  1SNC A;  4H13 C;  2KOL A;  3IAY A;  1EFI D;  2A68 C;  3I4N B;  2NZ1 D;  4ZLT F;  3KLS A;  5JVG 3;  2K1B A;  3L7Z C;  2NVY B;  3GO5 A;  4X3K A;  1PMR A;  2EYJ A;  4RKB A;  2KUM A;  1MI2 A;  3BVZ A;  2SNS A;  2A6H C;  3TME A;  1GJX A;  2F4I A;  4G7O C;  5CMD A;  2JXM B;  3SEB A;  1G91 A;  1S4Z A;  4HSV A;  1EEF D;  1PZI D;  2O5I C;  2A6H D;  2XRS D;  2F0I A;  2F0P A;  5E3F A;  3HOX B;  2JYO A;  1O80 A;  3H09 A;  1I6V C;  2KJX A;  5IGG A;  2F0Q A;  2PYK A;  4I7Z C;  3J7Y W;  1IKL A;  2AQ1 B;  2TSS A;  3FKI B;  4BWG B;  2M9V A;  3I90 A;  3UI2 A;  1H9R A;  2H1E A;  5ELC A;  3CRL C;  1EY8 A;  4HTH A;  2PW7 A;  3K5O A;  1BCP F;  1DOL A;  5J1Z A;  4QUF A;  2OEO A;  4DXF A;  1PYW D;  1F9R A;  2EJG C;  1ZEQ X;  5IGC A;  4V19 0;  2ICE C;  1B9M A;  1Y8P B;  2F0H A;  3TN2 A;  1FNW A;  1DJR D;  4QMG A;  1F2Z A;  2RDG A;  3VR5 A;  3H91 A;  1TT2 A;  3NHH A;  2G9D A;  3D3R A;  1AFP A;  4KD3 A;  1QWY A;  3KLS X;  2KCC A;  2CQA A;  2LS0 1;  1L0X B;  1W6K A;  2O2L D;  3E6Z X;  2ICI A;  3VR3 A;  5M5X B;  1HA6 A;  3GTG B;  3C46 A;  3P7J A;  1PTO D;  3RMH A;  3EQL C;  1DYQ A;  3KLR A;  5JEA H;  3F2U A;  5KEE A;  1I4P A;  2C5C A;  4RCN A;  5CV9 A;  2XIW A;  1ROD A;  2NVQ B;  3FPP A;  4NP5 A;  1WTO A;  2Q8T A;  3SR1 A;  1G2S A;  4S3S A;  5CR3 A;  1BCP B;  1IYU A;  1NCV A;  4XDX A;  3K59 A;  1R4P B;  1VDZ A;  3PUW A;  5J22 A;  2CVR A;  3RZD B;  3MXN A;  3PUZ A;  1EQV A;  2R7Z B;  4NW2 A;  1ML0 D;  3VYS A;  2RSO A;  2EYF A;  1VMP A;  3QIA A;  2JEA I;  5G3L D;  3NPP A;  3CKI B;  3KF8 A;  5I2Y A;  3RUZ A;  3TP8 A;  4XIG S;  4ZRZ A;  3VR2 A;  3ITP A;  3D31 A;  4G4K A;  2WB1 B;  1YNN D;  3M3Y B;  1OXU A;  1JWS D;  5ISR A;  1LTT D;  1SYD A;  2EVB A;  3ERO A;  5EBC A;  2NN6 H;  1EYC A;  4AYB B;  3OWE B;  1KDC A;  1MBY A;  5DNF A;  4G7H C;  4B9W A;  2IX1 A;  1HCZ A;  2PPB C;  5HGT A;  3S17 B;  3HOZ B;  5IT9 E;  4KKS A;  1TII D;  3EVQ A;  4K5W A;  3T13 A;  2QF7 A;  1TVX A;  1RDP D;  4TQU S;  2F0M A;  1LTS D;  2F0V A;  2NBF A;  3LX0 A;  2RSN A;  5C5L A;  2HQE A;  1F2M A;  1LT4 D;  4P2C B;  3SXH A;  1PTO B;  4DAP A;  1B50 A;  1RCV D;  5JVH 3;  1JB3 A;  3C2P A;  5C4Z A;  2K32 A;  4BA1 I;  1HQR D;  1T5X D;  1E2W A;  1B2T A;  4QB4 A;  1BDO A;  3G6J B;  5IGE A;  1LO5 D;  1A3V A;  2E2H B;  5EJW A;  5DM6 3;  4RHS A;  2Q8R E;  1Z47 A;  4F88 A;  1SNO A;  1WD0 A;  4M1U B;  4BY7 B;  1H9J A;  1V43 A;  4HCE A;  2XN9 C;  3U9S A;  3DUZ A;  3Q6S A;  4YIJ A;  3HS0 C;  2A69 D;  1OO9 B;  4FF1 A;  4G57 A;  5HUR A;  3TBI B;  5I6W A;  1EYD A;  1BXT A;  3OIP A;  4IUN A;  1WTV A;  1BUV T;  3NQT A;  4L8J A;  1D6E C;  3BYT B;  3KK7 A;  1TY0 A;  2I07 B;  2PNR C;  4H7B A;  5ELE A;  3HEJ A;  4KV6 A;  2MPM A;  4OGQ C;  1TS4 A;  4DAY A;  3AMU A;  4PMB A;  2OT2 A;  2JP1 A;  5IOD A;  2F0D A;  2RKS A;  2WKC A;  2AUK A;  3Q0A A;  3Q24 A;  1EZ6 A;  4DGZ A;  4C3J G;  5IGF A;  4CJ2 C;  1AZQ A;  2DN8 A;  4L63 B;  2RQX A;  2K5W A;  4CKB A;  2KEC A;  2SOB A;  1JWM D;  4JK1 C;  1Q12 A;  2Z4I A;  4HMI A;  3FMC A;  2B2Y A;  3DXJ C;  3M85 A;  1O7L A;  3MA2 B;  4A3G B;  4IFD G;  4DNT B;  1TR5 A;  1XXG A;  4A3K B;  2CW0 D;  4E6I A;  3WDN A;  3TP6 A;  2BA0 A;  2L55 A;  3VYT A;  1WVL A;  2A6E C;  1R9T B;  3C1F A;  4A3E B;  1KAB A;  5IGD A;  3A55 A;  3NBI A;  4J1M A;  1NR4 A;  4HAE A;  4HED A;  3NTK A;  3OOC A;  3VYU A;  1GUO A;  2FHT A;  3I72 A;  3LNN A;  5KRU A;  5NUC A;  2A68 D;  4F8M A;  5CV6 A;  1V1O A;  3D4W A;  3VR4 A;  1G6Z A;  3D4R A;  1H9S A;  5FKA C;  4Q0F A;  5JPN C;  1K8M A;  5EPK A;  1M8A A;  4CKC A;  2E75 C;  3BVG A;  1TKW B;  5COR A;  1JQY D;  1SE2 A;  1NSN S;  3MC0 B;  4IUV A;  2EYP A;  4KHZ A;  1OXV A;  1RTN A;  2VUM B;  1EQT A;  1EY6 A;  2EYH A;  3S15 B;  3GTQ B;  1ZXT A;  4H44 C;  4UAI A;  3PIP 3;  4K6D A;  5C0X G;  2KA7 A;  3D6C A;  1OXT A;  1KTK A;  1QNK A;  5COY A;  4X3U A;  3KBX A;  1Q1B A;  2Z1C A;  1U4P A;  2Q8I B;  2D2C C;  3VR6 A;  1J8I A;  3ZYY X;  1W6J A;  2WII B;  3T56 B;  5ELF A;  1Q90 A;  1GUN A;  4WOR A;  1I4H A;  2X69 A;  3S2H B;  2KED A;  2KVM A;  4IAL A;  2IW3 A;  4BY1 B;  1D5X C;  1V1P B;  5C4H A;  4RKL A;  2IJ0 A;  3NK9 A;  1I3Q B;  4HMJ A;  3M7N A;  3CU7 A;  1U4R A;  1LTA D;  2F0N A;  1PRT F;  2SEB D;  3OW7 A;  5KNC A;  3Q22 A;  2WV6 D;  2B8F A;  5D65 A;  3IFD A;  1O78 A;  1ZKO A;  1ILQ A;  1LTI D;  4KKT A;  4DFA A;  2AQ3 B;  4H0L C;  3R2T A;  3J81 L;  4DA2 A;  1C8C A;  2QCP X;  3QJY A;  2F0E A;  3TDQ A;  1KNA A;  4KHV A;  1PTO H;  1V1P A;  2E76 C;  1BQQ T;  4I65 A;  5EQ0 A;  1V8Q A;  1RKN A;  2J7Z A;  3SK4 A;  1I4X A;  3GV6 A;  4RFB A;  3J7A V;  4FF4 A;  2I46 A;  3OWF A;  3FEW X;  1SYC A;  4ULL A;  4HN7 A;  3I73 A;  4K5V A;  1HFN A;  1MD2 D;  1STH A;  1SAP A;  4MIU A;  5BN3 A;  2EE1 A;  2PO4 A;  2NB0 A;  3S1Q B;  1SBB B;  5C5M A;  3OIQ A;  4ID6 A;  5M3M B;  1GUG A;  4OO1 I;  1BF4 A;  3MHB A;  1GUW A;  3W2D A;  4J8Q A;  1JOR A;  4XT1 B;  1BCP D;  1KDA A;  3IL8 A;  4RHR A;  2K6A A;  2A69 C;  3VYR A;  1X32 A;  3I70 A;  5E4X A;  4IUP A;  1B44 D;  4A3J B;  4OO1 G;  3HOY B;  4IUQ A;  3NSW A;  5CV8 A;  2J0T D;  2K03 A;  1ENF A;  2KHS A;  3GTP B;  1S5C D;  1T5E A;  3I3C A;  1FR3 A;  3H94 A;  4NDX A;  1MSG A;  5KNB A;  1WTQ A;  4PV1 C;  5D14 A;  1S5B D;  5C4J B;  1KLG D;  3T53 B;  1B9N A;  3BDO A;  1H9M A;  1EY0 A;  4ZAI A;  3ND8 A;  4XTC S;  4XT3 B;  1PFM A;  1TQO A;  5DM7 3;  3J7A F;  1JOO A;  3LWE A;  4A3F B;  3BS1 A;  5A2Q L;  5C4X B;  3MTS A;  2G9H D;  4QUC A;  4FP5 D;  5KYL A;  1LV9 A;  1X3Q A;  3QWN A;  3Q23 A;  4RGM A;  4KMU C;  1B3A A;  1EOT A;  3M4O B;  5T1I A;  1VF5 C;  2B39 A;  3K0Y A;  4X3S A;  1RTO A;  1PZK D;  2BA1 A;  1DOK A;  1XYI A;  2EY5 A;  5TSS A;  3BVM A;  4KN7 C;  3DEO A;  2B8G A;  2R3Z A;  3K5M A;  4RCO A;  1IHZ A;  5JOB A;  1DOM A;  1DCZ A;  4CBV A;  5IGB A;  5CV4 A;  4CJ1 B;  3V2T A;  3OMC A;  3HP3 A;  1KAA A;  5K36 H;  1SND A;  4LMQ D;  4ABN A;  5K36 G;  1Y8N B;  4N9T A;  4R8N A;  1CK1 A;  4F7X A;  4X3T A;  3R8B A;  2Z4H A;  1ZYR D;  3OSO A;  3TZU A;  4GZY C;  2ZXR A;  1F2L A;  3DWP A;  1K83 B;  1SEB D;  4IFD J;  3HOW B;  2RDH A;  1BCP C;  1HUN A;  2EPB A;  2F0O A;  2L9H A;  1ZYR C;  4K8I A;  1ENA A;  2TMP A;  5M5Y B;  2A6E D;  5I9O A;  3ND9 A;  1WTP A;  1HRJ A;  2NTT A;  2WP8 J;  3QOJ A;  1DZ1 A;  1F9S A;  5JAV A;  4KY7 A;  4FF3 A;  1L0Y B;  4FYD A;  3NP8 A;  3G7L A;  5F2D A;  5C3W A;  2QKI C;  2M2L A;  1WTX A;  3QG1 A;  1CHP D;  3WOF A;  3R93 A;  2DY8 A;  1JR0 D;  1I50 B;  2B63 B;  1HTL D;  4RGT A;  1EU4 A;  2NN6 G;  1E0B A;  1JIC A;  4CJ0 B;  4C1N K;  1JOQ A;  3EJI A;  4K2L A;  5T1G A;  4ME5 A;  5E4W C;  4Y7N B;  3MXG A;  4KY5 A;  2RDF A;  4LJZ C;  3O13 A;  1YNN C;  3P1H A;  2EY6 A;  4R9W A;  4DAV A;  2F0J A;  5CBA E;  2K33 A;  2NN6 I;  4TRD A;  2EYM A;  4PMW A;  5LHY 1;  4DN4 M;  3PO2 B;  1A2T A;  1E2V A;  3HRZ C;  3EA6 A;  2EJF C;  3HGB A;  2C9O A;  2LY7 A;  5JJZ A;  3PUY A;  1PFB A;  3SK6 A;  2WKD A;  1QE6 A;  3GQB A;  2K7V A;  1JCK B;  4XYO A;  1EYA A;  3A8I E;  1OXX K;  2QDB A;  4ZYS A;  3D8G A;  2KCN A;  1H9K A;  4ZKC B;  3NXW A;  1SJH D;  4V0B A;  2R6G A;  4ODG A;  5DEH A;  5A2Q E;  2A5H A;  4ILW A;  3SHL A;  4U67 3;  4PQX A;  1SSO A;  2ENB A;  2JEB I;  4O1N A;  3TP5 A;  2O4X A;  3D6W A;  2OXP A;  4FVM A;  1RF2 D;  2IX3 A;  2B2T A;  5M9O A;  4C3H B;  3W3A A;  2B2W C;  3S1R B;  3A8K E;  3PV0 A;  1F9Q A;  1IW7 C;  4RWS C;  4KJO A;  1CQV A;  2XSC A;  3H3V C;  1EWH A;  4OIK A;  1D1I A;  1JWU D;  2QIL A;  5BN5 A;  2F0K A;  1DXM A;  2ZXO A;  3GV3 A;  1Z7T A;  3BDL A;  1B53 A;  1HPC A;  1YNJ D;  5EPL A;  1TS5 A;  5G3L F;  2JA5 B;  1EY5 A;  1HHV A;  2L0C A;  1STN A;  1TWA B;  4CGY B;  1KDB A;  4RGO S;  1PFN A;  4HSP A;  5EPJ A;  2PW5 A;  2EXZ A;  2NYZ D;  1Q1E A;  1EY7 A;  2FIN B;  3M4Y A;  5FOB B;  3A54 A;  2NTS A;  3MFG A;  1SE4 A;  2E2D C;  3MXU A;  1JE4 A;  2N88 A;  2F0L A;  2A73 B;  4K6L A;  5JEA G;  1BNZ A;  4MHE A;  4IUU A;  5KGU A;  2L1B A;  3QB3 A;  2RA4 A;  2L4N A;  2K28 A;  5BN4 A;  1GHK A;  1RD9 D;  2B2U C;  5ELB A;  1TWC B;  1ENC A;  3RD4 A;  1BO0 A;  1SYB A;  4CHT B;  2EOT A;  3CHB D;  2PQE A;  1B1Z A;  4XQN A;  1ILP A;  2NVX B;  2XNA C;  4DNR B;  3E5S A;  2GA4 B;  4TSS A;  5C3X A;  1CT1 D;  4BA2 I;  3T4A C;  3HKZ B;  4EGV A;  2E2I B;  3FDT A;  1G29 1;  1STY A;  1U4M A;  3QOL A;  3I4L A;  3A7A B;  4JBW A;  5C0X J;  3S16 B;  1VF7 A;  2F0U A;  3MAQ A;  1F2Y A;  2ZT9 C;  2KQ3 A;  2SNM A;  3MEH A;  4DXG A;  1D5M C;  1M4V A;  1FGB D;  1KNE A;  2K01 A;  1HXY D;  1AW7 A;  2EYL A;  4KTA A;  1SYG A;  1EEI D;  4A93 B;  4BS9 A;  1CQF A;  3SE0 A;  3M7G A;  5I6Y A;  2D9U A;  1II3 A;  3OMG A;  5AFW A;  2L12 A;  1CI3 M;  4Z9C B;  4B9X A;  2VB3 X;  2ZXP A;  3MWY W;  1U9R A;  4C1N I;  1D5Z C;  4BBS B;  2R92 B;  4C3I B;  2Y0S B;  4ZQ3 A;  1QB5 D;  1EIG A;  2BDN A;  3I4M B;  1D1K A;  1CZW A;  2F0S A;  2LKV A;  3S14 B;  1U4L A;  3K58 A;  1SNQ A;  4K8J A;  2FJ2 A;  3CQZ B;  2FFK B;  3BDC A;  3K5N A;  1I4G A;  1SFO B;  1BBX C;  1LTG D;  4TKO B;  4B08 A;  2VXW A;  3RLF A;  1ESF A;  1WCM B;  5IIF A;  1AZP A;  2EY2 A;  2EJM A;  1LTB D;  1CTM A;  4IFD H;  1XWE A;  1HUM A;  4EVO A;  1DD2 A;  1YNJ C;  5CBE E;  2OF1 A;  1Q8I A;  2D62 A;  5CYU A;  1CHQ D;  3HOU B;  2PMZ B;  4RGN A;  4IZ8 A;  5CV5 A;  4HR7 B;  3QO2 A;  4A3I B;  4FO2 A;  3NTI A;  4ZUJ A;  1SMY C;  1SJE D;  3X3N A;  3NWT A;  3JAM L;  5CC4 A;  2A74 C;  2XRQ D;  4KD4 A;  3AU7 A;  4K2K A;  1AEX A;  4MN3 A;  4NMZ A;  2PZW A;  4DF7 A;  2F0G A;  4ZKB B;  4DK1 A;  2RBM A;  2NVT B;  4XQQ A;  1IW7 D;  4K5X A;  1LAC A;  4EQO A;  1UEA B;  4OHJ A;  1EWC A;  5EGT A;  2K04 A;  4IUR A;  2HCC A;  2PZU A;  1GOZ A;  2J4X A;  1GXD C;  4A3D B;  3AB9 A;  1LLR D;  1EL0 A;  2B2U A;  2PCF B;  1MSH A;  2BE5 C;  4OO1 H;  1TU2 B;  5I2X A;  1RHP A;  3NUC A;  2CHB D;  3IKJ A;  1UNS A;  1LT5 D;  4LK1 C;  2F0T A;  2BDO A;  1D2B A;  1R4Q B;  1K8O A;  5EKL A;  3A7L A;  1PDQ A;  1CA6 A;  2YYZ A;  1FNV A;  4C2M B;  3C1E A;  2F1M A;  5C3E B;  2K5D A;  2B2Y C;  1DM0 B;  3KUP A;  1JOK A;  5C0X I;  2DNC A;  1VMC A;  5FLX L;  2MP1 A;  1QOH A;  1XTC D;  1SNP A;  4WFN 3;  5D3D A;  3SK8 A;  5FO7 B;  4EQN A;  3H0G B;  4XYQ A;  1IL8 A;  3TP7 A;  3HOV B;  3L3O C;  2F0F A;  1STE A;  4OL7 A;  1OXS C;  2KEE A;  1ONL A;  2B2T C;  4FXD A;  5J39 A;  4C3J B;  1CZG A;  1ICW A;  4KKU A;  3PO3 B;  4BBR B;  2JA7 B;  2VNU D;  1C4Q A;  3SK5 A;  3PIO 3;  3R3O A;  2MJ8 A;  3T16 A;  4ZUI A;  1A15 A;  5M3F B;  5C6A A;  2B2V A;  3NTH A;  2LFN A;  5LL6 X;  4RH6 A;  3S1M B;  1LTR D;  3I8Z A;  1HFG A;  3P20 A;  4QF4 A;  3OHX C;  2D5D A;  1PTO C;  2AWN A;  4L6T B;  2F3V A;  1TY2 A;  5E1F A;  5KND A;  1CFM A;  2PZT A;  2V4D A;  5EKK A;  5FLX E;  3LWU A;  2LMC B;  4IUT A;  5ELD A;  4M8A A;  4N9P A;  3GP7 A;  3HZX A;  3C3L A;  3OPO A;  3ONA B;  3DEP A;  2M00 A;  2HDL A;  1CM9 A;  3MXP A;  1NUC A;  4PNY A;  5I9P A;  1LT6 D;  1LAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...