1NR2A

High resolution crystal structures of thymus and activation-regulated chemokine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
RECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Thymus and activation-regulated chemokine
publication title Structures of thymus and activation-regulated chemokine (TARC).
pubmed doi rcsb
total genus 13
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1nr2A00
1EL0A 1AZQA 2X6GA 1HFNA 5COYA 4IUUA 2JYOA 2Q8RE 3P7JA 1WTOA 1RHPA 3MWYW 1EOTA 1X3QA 4NW2A 1DZ1A 1ICWA 2Q8TA 4X3UA 2KVMA 1G2SA 2KEDA 2K03A 2SDFA 1X3PA 1PFMA 1KNEA 2N88A 1B3AA 1F9PA 1QNKA 3D6WA 1WTRA 1KNAA 2X69A 1ESRA 1BF4A 1A15A 3R93A 4ZK9B 1U4MA 1WD0A 1C8CA 1HUNA 4RWSC 4ZLTF 3DM1A 2CVRA 1B53A 3I90A 1RTOA 2L12A 5AFWA 1WD1A 2BDNA 5EKIA 1U4RA 1G91A 2N55A 2NYZD 5CBEE 2RVLA 3IFDA 2K01A 3IL8A 1ZXTA 1SAPA 1ML0D 4RAUC 1AZPA 2FJ2A 5CMDA 4MN3A 1PFNA 1QE6A 4DN4M 2HUGA 4IUVA 2NWGA 4O42A 2B2TA 1Q3LA 2EOTA 3G7LA 1O7ZA 4RA8A 4MHEA 2HDMA 1XYIA 1HUMA 2FHTA 2IL8A 2KECA 4XDXA 4QUFA 1RTNA 2NZ1D 4R8IA 1O7YA 2R3ZA 1SSOA 3DEPA 2HCCA 4QUCA 3I8ZA 5CORA 3N52A 4ZAIA 5EQ0A 4IUPA 5T1IA 1IL8A 2B2VC 2K28A 4UAIA 1SDFA 1BBXC 1B2TA 1PLFA 1MGSA 1F9QA 5E4WC 2B2YC 4HAEA 5E4XA 1B50A 3FPUB 1X32A 1RJTA 1EIHA 1PFBA 2MGSA 1WTWA 4HCSA 2VXWA 1JICA 2FMMA 3FDTA 4CJ0B 1G2TA 3UI2A 1RODA 1WTPA 4CJ2C 3TN2A 1O80A 4IURA 1EIGA 1JE4A 4XT3B 1GUWA 2FFKB 1VMCA 2KUMA 2M2LA 4OIJA 2L11A 1NCVA 1J8IA 5T1GA 1IKMA 2B2WA 1CM9A 2MJ8A 3H91A 1B4OA 1HHVA 1DONA 2H1EA 5D14A 5EPKA 2MP1A 3HP3A 2J7ZA 2X6LA 3DEOA 5DNFA 1WVLA 1HRJA 1ILQA 4R9WA 3F2UA 1VMPA 1E0BA 3LWEA 1BNZA 2B2UA 1DOMA 1F2LA 2L9HA 1AP0A 1NR2A 1S4ZA 2KOLA 4OIKA 2RA4A 1F9SA 2K1BA 2B2TC 1PDQA 3TZDA 2RSOA 1XX8A 1U4PA 1HFGA 2B2WC 1IKLA 1F9RA 2KEEA 3KBXA 1G6ZA 2HDLA 2RSNA 4X3TA 5CBAE 3KUPA 5D65A 2JP1A 4CJ1B 5JJZA 2DY7A 4X3SA 1WTQA 4XT1B 1WTXA 3GV6A 2L1BA 4U68A 1NR4A 2FINB 3Q6SA 3QO2A 1DOKA 1WTVA 1ILPA 1NAPA 2HCIA 2K04A 1CA5A 4LMQD 2D9UA 1MI2A 1MSHA 2K05A 2B2UC 2EE1A 2DY8A 3I91A 3GV3A 4HEDA 1CA6A 1BO0A 1DOLA 4ZKBB 2EPBA 1HA6A 3MTSA 4ZKCB 5EPJA 5EJWA 2XIWA 1LV9A 1TVXA 5EPLA 3I3CA 4IUQA 1U4LA 3ONAB 1J9OA 1MSGA 2B2VA 4IUTA 1EQTA 2L4NA 4X3KA 1M8AA 2MPMA 3SVMA 2B2YA 1QG7A 4HSVA
chains in the Genus database with same CATH superfamily
4TRDA 2EYHA 4DXFA 1AE3A 1X3QA 3OW2A 2DGYA 4A3EH 1DZ1A 4R8NA 2XTIA 3VYTA 2K03A 3BG3A 3PUXA 5ISRA 3F2CA 4A3CH 5JEAH 5JPNC 1ESRA 5IGFA 1BF4A 5DM73 1I50B 3FPPA 5CYUA 3R2IA 4TKOB 4R4CA 1UUPA 2K75A 3EROA 2CCZA 1Y8PB 5LMNW 1XNRQ 1TKWB 1M4VA 4RGMA 1STGA 2UU9Q 2FXQA 3G48A 1Z9FA 2F4VQ 4O42A 1O7ZA 4LK1C 3AFQA 1YEZA 2MO0A 1YNJC 2ES2A 5G3LD 4DR7Q 4JI5L 3SXHA 5C0XI 2K28A 4B3SL 5KIXA 4DUYL 1MGSA 4L8JA 1BBWA 2F0NA 3NELA 4KY7A 1SNQA 4UP9A 1B50A 4LF5Q 1JJGA 1EZ6A 4HCSA 1TWHH 5FKAC 1SNDA 3HGBA 4IFDG 1RODA 4QMGA 4CJ2C 4EVOA 1EIGA 1HNZQ 3CP0A 1X65A 5C6AA 2PCFB 4POGA 3CCQA 2A6HD 3A5UA 1B4OA 3NBIA 1Y1WG 1HHVA 4OGQC 2RHQB 1E24A 5IGCA 2J7ZA 5TSSA 3WOEA 1VMPA 3UE0A 1DOMA 1NR2A 4J8QA 2JA6B 1SE2A 2ZXPA 3L0OA 1TS2A 1PDQA 4DV0Q 2QDLA 5FO7B 3M3YH 4KHPQ 1YI2A 1IYUA 2E2JH 3S1MB 2XSCA 1S5CD 2E2IB 2CH4A 4DR2Q 2FINB 2JA8G 2MHVA 2OTLA 3PO3B 1RCVD 2K05A 2QKIC 1J5EQ 4GLVB 3PUZA 5ELDA 3CD6A 3TRZA 4BBSH 2OQ0A 4LF8L 4JVZA 1VQ7A 4H0LC 2K5NA 3ONAB 2ICIA 4YWMA 2K50A 3IAYA 1RDPD 1GVPA 4C2MH 1I94Q 2F0SA 2X6GA 3D4WA 1VQNA 3PCOB 1X3EA 4A3JH 3S17H 2NBFA 4A4IA 3J81L 2BDOA 1G2SA 1VCIA 2KEDA 2VL6A 4C3JB 4GKKQ 2KENA 1SE4A 4JI4L 3BZDB 4JI7L 4N9PA 1E2ZA 3D6WA 1C9OA 3Q22A 4L63B 3GO5A 1KRTA 1WJJA 1UE1A 4ZLTF 1D5ZC 5EBDA 1CQVA 3NP8A 4IO9A 4HIMA 2RVLA 3IFDA 3UE1A 2E2HB 2QEJC 3LWUA 4A3KH 1CFMA 1N8RC 2F0HA 3A55A 1Q3LA 3OMGA 3CCSA 1GM5A 2HDMA 1XYIA 5K36H 2IL8A 1PH3A 4FF3A 1RTNA 4CDEC 2DUDA 1A0IA 3N52A 3WDNA 1J6QA 4IUPA 2BE5D 3A7AB 2R7FA 4RMFA 1T5XD 1XPUA 2YTYA 3KF8A 4L5SA 1F2ZA 1CZWA 1HNXL 1HR0W 5HY6A 5LHY1 4OX9Q 2NTTA 2UUCQ 4CJ0B 4L5TA 4MTNA 3P1HA 4DV3L 1HXYD 2CW0C 2ZJPA 4F7XA 5JJIA 1JE4A 3LGJA 1HZ9A 3MEFA 1K8GA 1LACA 3URYA 4FP5D 3H6MA 4LF7Q 4IZ8A 4LWCA 4LFCQ 4DR1Q 5KYIA 4EQPA 4JI0L 1UNSA 2EVBA 1LYLA 3TQYA 5C4ZA 5M3FB 3TEHB 1CKNB 2PMZE 4PQXA 5M5WB 4DV1L 1JJ2A 3ER0A 1HNWQ 2UXDQ 5IP7G 4JI2Q 1TWFB 4V190 4QL5A 2GA4B 2K5DA 2ZJQA 3HOWG 1B9NA 2EZVA 4JBKA 4LJZC 3HS0C 5C4JH 3AB9A 4DU9A 1KXLA 2CHBD 4OONA 4MZ9A 3H09A 3LX0A 4OO1G 1E22A 1EY4A 1S5BD 3S16H 4O2DA 1SNPA 3K7AH 3OYYA 3I55A 1K3BC 2NB0A 3K59A 1HA6A 1EIFA 2R7ZH 3HOYG 1SBBB 2Q2UA 3PQIA 1EFID 1NMGA 3VDYA 4Y7NH 2OCEA 5GADC 2EJMA 5IGDA 3S2HH 1BKBA 1YHAA 3J81j 1UE5A 4X3UA 3ERQA 4XIGS 1B3AA 4IOCA 2Z4IA 3RZDB 3CMEA 2VB2X 1K0RA 2F0KA 3OW7A 1V1PA 1MBYA 1ZYRD 2RDFA 5K5PA 3HOXH 5EKIA 4A3DG 2N55A 4DUZQ 5C0XJ 3T56B 2EYMA 3BS1A 2I0QA 5CMDA 2R7ZB 2N8NA 1HTPA 2JN4A 4DR3L 2L15A 3D31A 1VQDA 1Q90A 1U5KA 2NZ1D 4R8IA 2KCMA 5M5XB 1SRUA 2C5CA 3G71A 4QIWB 1JC7A 1KABA 1SYEA 4HJ9A 4A3FG 1F9QA 4J15A 3I4MG 4ME5A 1F2MA 5GQOA 3S2DB 3NHHA 3FDTA 4A3MG 1ET6A 3DHQA 3LNNA 4NXMQ 4XQNA 3E9IA 2UU9L 4C1NI 3SK6A 3MA2B 1LTID 2XWBB 3PSIA 5GAGC 2F52A 1QB5D 3HKSA 1WOCA 5C4XG 1JWUD 1LABA 1VQ4A 4IPDA 1GD7A 5DNFA 3M7NA 4AQYL 1NBWA 4DV6Q 5ELEA 4K5XA 1F2LA 2PQAA 3M4OB 1KQSA 1HR0L 2PNHA 4LF5L 5E7NA 1FNUA 5C0XH 1X6OA 1XNQQ 5CBAE 5JAVA 1EY6A 2SEBD 1VQGA 1DXMA 2Z0SA 2VNUD 5JJKA 5CV9A 1NR4A 3R8BA 3PF5A 5F2DA 2D9UA 3C2PA 4BY1B 2Y0SB 1IW7C 3S15H 2KHIA 4XXEA 3J80i 5DLQE 1M90C 4A3EG 3MTSA 1BUVT 5M5YH 3KBGA 3GTJH 1F2YA 4A3CG 5JEAG 4JG2A 3PMFA 4IALA 3S1NB 2QGQA 3STBC 3U50C 1YJWA 3KF6A 3GTPB 1D8LA 2R6GA 1K83B 2R61A 3QB3A 3R3OA 1CQFA 1JCKB 4TSSA 4DR2L 1YBYA 1X3PA 2BOSA 4ULLA 1LM0A 2QDBA 2I5MX 1SE3A 1KRSA 1XTCD 3MAQA 2CVRA 1IYJB 1L0WA 1GO3E 3CHBD 4B3TL 4A3GB 3A8IE 1SLJA 4JI6L 2PO4A 1LTLA 2B39A 1TU2B 1I94L 3NTKA 2FHTA 3MFYA 1Q1EA 2V4DA 3D3RA 2G5DA 5GROA 2HCCA 3GTKB 4GKKL 4BA2I 3J7A5 3RLNA 3CKIB 5T1IA 5C5LA 3C46A 3CCJA 5BN5A 5E4WC 2Z1CA 4YCWA 1H9JA 1GUTA 1VQFA 1G2TA 1K9MC 1LT3D 2AHOB 4KK7A 2VY3A 4AYBB 2F1MA 3GTQB 1IL2A 2B63H 2BH2A 1EY7A 3I4OA 3UDGA 1RKNA 2D0OA 4C3IH 5HURA 3K0YA 4KY6A 3NBHB 2B8FA 1VQCA 1WFQA 5EPKA 2WV6D 1EY0A 3DEOA 3OMCA 1WVLA 1BNZA 3DUZA 3PIO3 2L9HA 1HH2P 3VYUA 3RZOH 4J6HA 4BBSG 4K2KA 2RSOA 4OX9L 3VA7A 1H95A 3K0XA 2EIFA 4LFAQ 2RSNA 3Q0AA 5FO9B 5C44H 5JJZA 4BBRB 1KTKA 1I4GA 1V1QA 2ZXOA 3FKIH 4GOPB 1WTVA 2K04A 2E76C 1MI2A 2AQ1B 2B2UC 2EE1A 1XPRA 3MVVA 4A3JG 1DOLA 2OT2A 4QY7A 3NWTA 4LFCL 4DR1L 1KHIA 4KHZA 4EGVA 5H1SE 3OWFA 2VQEQ 4GNXC 4G7HC 1BOSA 2VQFQ 4XQJA 5LL6X 2EXDA 2TSSA 4P72A 1HNWL 1WTOA 2UXDL 1EOTA 1I3QB 5HGQA 3DWPA 3NTHA 4PNYA 4GKJQ 2D0PA 5M3MH 2L55A 4HIDA 4WJ3M 1JT8A 1CI3M 1HUNA 2NVTB 2LS01 4O0AA 5IP7H 1PHJA 2OQKA 3JAME 1U4RA 1VDZA 4C3HH 3IL8A 1E7ZA 1QVFA 4IQZA 3QWNA 3HOVH 1QE6A 5I9PA 2AQ2B 3B6YA 1A3VA 3ERSX 4TQUS 2LXJA 2KECA 2Y0SE 2KCCA 3CPFA 1SSOA 1E1OA 1W6KA 2RDGA 5HGTA 1HTLD 4ZUJA 1PTOC 3DWQA 3L9AX 1PH6A 1EYGA 3L3OC 4B9WA 2G9HD 3HG9A 4IUNA 3R2TA 2VUMB 4S3SA 1HPCA 4CDCC 1IYVA 1R4QB 2A73B 4DUZL 1OO9B 3AFPA 3NK9A 2XVSA 4DR5Q 1CUKA 3CU7A 4LF6L 5BR8L 2A8VA 1NE3A 3H91A 3HKZB 1DONA 1RF2D 5D14A 1L1OC 4IPHA 4JBMA 1IBLQ 2K32A 2TMPA 3OPOA 3BU2A 2X6LA 1P16A 4JOIA 3G6JB 3NXWA 3P75A 2WB1G 1LT4D 1JB7A 1CTMA 3OWEB 2R7ZG 4LF9Q 1DM0B 3D6CA 3KUPA 1HZAA 1PTOB 4CJ1B 2F0TA 4YY3L 2NVQB 3ULPA 3PUVA 1SEBD 4B3RQ 1YJNA 4A3FH 1JWSD 3EFXD 1EYCA 1GUNA 1FVIA 1STAA 4FYDA 3RUZA 3CQZH 5KRUA 2NVYH 1QZHA 3W1BA 4BWGB 3CCEA 1QWYA 3OOCA 2B29A 3PIPA 1IXRA 4CHTB 4DXGA 1DGSA 1TVXA 2A68D 3IKJA 3E5SA 4N8FA 1B9MA 3J7ZC 1XMQL 4AYBE 4EQ5A 1S40A 2PI2E 1D7QA 1L1OB 2AWNA 5IWAQ 3HOXG 3EVQA 5IY0A 1XNQL 1Y69U 1ESFA 1I50H 1K8AC 1EU4A 2KJXA 1ICFB 5BN3A 1A2UA 1KNAA 1VQLA 1MIUA 4JK1C 3KDFB 2YTXA 1EQQA 2KBNA 1G6PA 4NXNQ 4DV7Q 4RAUC 1SNMA 4LNQA 2WKDA 1N32Q 4LUVA 1WCMB 1FYCA 1NNXA 4K0KL 4A75A 3P20A 1HUMA 4H7BA 4JI3L 4X62Q 1NTGA 3DEPA 3U9OA 3I8ZA 5CORA 1K8OA 4A3BB 1JWMD 1YZ6A 1UE6A 4ZAIA 4QGUA 3TBIB 5CV6A 2MO1A 1VQPA 1BBXC 3PV0A 3C3LA 1MD2D 4A3IB 4F8MA 2BCOA 3ULLA 1I4PA 2FMMA 2IHEA 2HIVA 4CKCA 1AEXA 2PMZB 4IURA 1N9WA 4B3MQ 4YHHL 4DR4L 2M2LA 3RN2A 1R4PB 4JV5Q 1XWEA 2WAQE 1JOKA 5C0XG 2F0GA 2EYJA 4FF4A 3SE0A 2PYKA 5IYBG 2XNAC 1PYBA 2JA6H 2EYPA 1D5MC 2KHSA 4R4IA 2YU9B 3OSOA 3S1MH 2KOLA 1VQIA 2RA4A 2E2IH 4WFN3 3K7UC 3H3VC 4A76A 3PO3H 1SMXA 1B44D 4HMIA 5IE8A 4XT1B 5G3LF 4L5RC 2QA4A 3BZCA 2LMCB 3HEJA 2E74C 3FMCA 3GV3A 2DJFC 1Q8KA 1C48A 2BA0A 1HZCA 3A8KE 1CT1D 1LTSD 2HHHQ 5EPLA 1A63A 1A8VA 4KMUC 3TP6A 2A6EC 5E3FA 4C3JH 4KKSA 2RQXA 4P2CB 2PNRC 3M85A 3BYTB 4BXXG 2HQLA 5COYA 1PMRA 4RCNA 1A3UA 1I6VC 3HKZE 1V43A 1KAAA 4IPCA 4G7ZC 1GUSA 1X9NA 3KLRA 1LT6D 1QNKA 1EWHA 3A0JA 4DPGA 2E2HH 5C4HA 1I4XA 4XQQA 1E2VA 1VF5C 5J22A 5IOCA 5C3XA 2VQEL 1JORA 3BVZA 3RD4A 2OWOA 2UXCQ 3E6ZX 4JI8L 1NJIC 3U9SA 1S5ED 1DCZA 2VQFL 3KLSX 3RR5A 1LO5D 5J39A 1N33L 1AN8A 1L2FA 1TY2A 2DJGC 4QUCA 4K8IA 1Q1BA 3H0GB 4BY7B 1CK1A 4LUZA 1IHZA 4UAIA 1N36L 3GDEA 5EKLA 2EYFA 1STNA 2MNAA 1PLFA 1RD9D 1PH4A 2N78A 2B63G 4HAEA 1YNJD 2AMCB 1YNNC 2H5XA 2PQEA 4C3IG 1T5EA 1MJCA 1X3FA 2L0CA 1R9TB 4FF1A 3PF4A 1PH9A 1S5FD 4GNXA 1SJED 1FJGQ 1O7LA 2KHJA 1PRTD 1BR9A 1C4QA 2EDGA 2IW3A 4APVA 1UEAB 5C44G 2JA5B 3TZUA 5M3FH 4Y52H 5M5WH 3FKIG 4R9WA 4RFBA 3LWEA 1TWFH 4YIJA 2B2WC 2F3VA 2HDLA 2EY6A 3ZYYX 2Q8IB 3HOZB 3DXJC 2JQOA 4KN7C 2DY7A 3OTOQ 4DV2Q 3VR6A 4NB3A 1QUQB 1GJXA 1NAPA 3GTMB 4DKAC 4LMQD 1S5DD 2EXZA 3TMEA 3CCRA 2D5DA 4KTAA 1SFOB 5IIFA 2EPBA 3MXNA 4KKTA 2XGTA 4ZKCB 4WJ4A 3J80L 5M3MG 1EQRA 5I2XA 2VUMG 2L4NA 3PGZA 1XTDA 1Q7YC 1EEID 2IPKD 2R92B 2NUCA 1W6JA 4DR6Q 3E0JA 2Q8RE 5LMUL 3RZDH 1B7YB 4LF9L 1AFPA 4C3HG 5IODA 1TXYA 4NP5A 3HOVG 3VR2A 1X54A 4ALPA 5EBCA 3FHWA 5FLXE 3MHBA 4HR7B 2IWHA 1B53A 1FL0A 3VR5A 3HZXA 3KYHC 1L1OA 5A2QE 4DAVA 3EN2A 3K58A 4CKEA 4IN3A 2A69C 3J80E 2WKCA 4H13C 1TS3A 4DN4M 5KNDA 1GHJA 2NWGA 4A3LH 5M5XH 1EIYB 3I4NB 2SOBA 4QF4A 4QUFA 5KNBA 5IWAL 5FO8B 4UPAA 1KAWA 3S2DH 4MIUA 2J4XA 3BZKA 1B2TA 2JJQA 1XMOQ 4DF7A 3W5OA 1X32A 1RJTA 5M9OA 3FEWX 3E3XA 2JA9A 3CC7A 4DV7L 1LTGD 1TIID 1N32L 4K5VA 2V1CC 5IGBA 1YNXA 4NPSA 1Y1VB 2CW0D 4GS3A 4X62L 1Q81C 3M4OH 5CV7A 1BBUA 5KNCA 3HOUB 4RKBA 2E8GA 3JAMc 3SK8A 1HRJA 1FNVA 1VQJA 1ILQA 2LFNA 2E5LQ 5AJ3Q 4CKBA 1KDCA 4BA1I 5CV8A 1BCPD 3J81i 2A74C 3NUCA 4IJLA 4BY1H 4F88A 1XNRL 2DNEA 4B3ML 1JE5A 2F0OA 2F4VL 1CA5A 4JV5L 5ELFA 1SMYC 4DGZA 3GTLB 1LTBD 3EBEA 1TWAB 1KDAA 1F77A 3S1NH 4LW1A 4DR7L 1ENAA 5IP9G 2XRQD 5IYDG 1SYGA 4JYAQ 2KCTA 4PZ8A 3CCVA 3GTPH 2AUJD 1K83H 3H15A 2VZAA 4B08A 2F0UA 2FMCA 4OHJA 1H9SB 3AQQA 4POFA 2M00A 2XN9C 3RLFA 5IYBH 4NW2A 5I4DA 1U0LA 1HNZL 4H44C 2N88A 4OWTB 2SNSA 3J7AF 4DV4Q 3FRPB 3PO2B 1PYWD 2NTSA 2IX3A 3V2TA 1Z6HA 4C1NK 2ZM6Q 3HFZB 1EWCA 2BH8A 4ZK9B 4A3GH 1RTOA 2UXBQ 2L5TA 1L0YB 4RHRA 3D4RA 2PW7A 2EYOA 3I7FA 2HHHL 4O1NA 1PV4A 1ML0D 4Z9CB 3AEVA 4MN3A 4LAAA 1VQMA 2HUGA 1S3OA 4DV0L 3GTKH 1SJHD 4KHPL 2K14A 4JBJA 5I6WA 4FXKC 4GN4B 2WP8J 4JI1Q 3L2PA 2PZWA 4PMWA 5KGUA 4KN4C 5CV4A 3V05A 1JMCA 4ABNA 3BVGA 3WWVA 4DAYB 2ZTDA 1BQQT 1J5EL 4BXXH 3K5MA 2N3SA 2NVXB 3GTQH 3I4LA 2JA6G 4X66Q 3S24A 2KA7A 1O80A 4RHSA 1GUWA 4OELB 2FFKB 2UXCL 1NCVA 1STEA 5T1GA 1LUZA 4PMBA 4YCVA 3O13A 4XYQA 3PO3G 1LTAD 1UAPA 1Y8OB 4K14A 4GOPC 2B3GA 5C3EB 4OIKA 4BBRH 2UUAQ 3H3VI 2WFWA 2B2TC 4CBVA 1U4PA 2SNMA 1IBMQ 5J1ZA 1WTQA 2K7VA 3FP9A 2EY1A 3TP5A 1Y1WB 1ILPA 2K5VA 1SN8A 1SYBA 1V8QA 4C3JG 4DUYQ 1D2BA 5IT9c 2E2DC 2F0IA 2IY5B 4IUQA 3I73A 4X3KA 5CR3A 1IW7D 3Q8DA 1I3QH 1STYA 2F0QA 4RH6A 1KD1C 1N34Q 1Y14B 2UUCL 1P8LA 1TT2A 2JYOA 4JW0A 4F87A 1SNCA 3MWYW 4NDXA 2O5IC 2JA8B 2JEAI 2KVMA 2Z6BA 3OTOL 4DV2L 1KNEA 3M7GA 2Q2HA 2NVTH 3KFUA 1JJCB 3CCUA 1PZID 4ZYSA 3JAML 3D4DA 1CKNA 3R93A 1QZGA 3G4SA 4LF7L 5GAEC 1QVGA 3GD7A 1CHPD 3M4PA 2BDNA 3K80C 4YWLA 2E75C 1JOQA 5D3DA 2K01A 1E1TA 1SR3A 2FJ2A 2JEBI 3CCLA 5JVH3 4JI2L 3K5OA 1CSPA 2JE6I 1B70B 2OF1A 2HQEA 5J3BA 5D3IB 2VUMH 2WAQB 1H9KA 4K2LA 2ATWA 3S9WA 5LL6S 1W2BA 5E4XA 1EIHA 1EQVA 5M3FG 3SEBA 2PZUA 2H4OA 1EUJA 1VMCA 1ENFA 1NY4A 1MJEA 1OTCA 1PH1A 4IOAA 2A68C 3RMHA 2F0JA 4GN5A 4NMZA 3SDZA 1AE2A 3GTGB 3S1RB 3HP3A 3JC66 3OIPA 4FO2A 1UEBA 1TWCB 3QJYA 2F3WA 1PTOH 1S4ZA 1XMOL 4E6IA 2XRSD 2NVQH 2EYLA 1F9RA 5FJ8H 5C3WA 2JP1A 2ZJRA 4HIOA 4R1JA 3I4NG 1Q82C 4G4KA 1KLGD 4I7ZC 5EKKA 1GXDC 2DY8A 1VQBA 1EY9A 1BO0A 2J0TD 4UP8A 4KD3A 3VYSA 4CDDC 3W3AA 2R93B 4HJAA 2A1AA 1LLRD 1V1OA 1BXTA 5LMNQ 1XJVA 1EQTA 1CKMA 2E5LL 1B8AA 1EFWA 2MPMA 4L5QA 4P73A 3SVMA 3K8AA 5AJ3L 3KF8B 2F0WA 1AZQA 2GVBA 1DJRD 5DEHA 1XPOA 3HOWB 3BDOA 3F8TA 4NXML 3SHLA 4JI0Q 4N8X1 4R4TA 2IX1A 1YHQA 1AH9A 1F9PA 2X69A 3A74A 3NQTA 4A3LG 3KLSA 4DAMA 3HOUG 4LFBQ 3HOYB 3BYYB 2OTJA 1KLUD 2O2LD 5AFWA 4DV1Q 1OXSC 2Z6KC 3IRBA 4YWKA 1WCMH 3Q23A 2I07B 3ZJYC 5I9OA 4DV6L 1SAPA 1D6EC 4I7AA 1AW7A 3SK5A 1SYFA 2P5ZX 3UDIA 4A3BH 4JCVE 2RCNA 1PZJD 4HTHA 1O7YA 5IP9H 1VQOA 5IYDH 2OXPA 2MUYA 1D5XC 5IT9L 4A3IH 4HMJA 2B2VC 3KOJA 1SNOA 1ZKOA 2F3IA 3MEHA 1TWGB 3MXPA 4A3DB 4QJFA 2ZM6L 1QNUA 2ALYB 1PH5A 3EQLC 2UXBL 1PTOD 1SROA 1WI5A 2A6HC 3RLOA 1LTRD 2RBMA 4ILWA 3AYHB 4PZ7A 1I4HA 3S14B 1B3QA 1J8IA 1IKMA 1CSQA 2DNCA 2AQ3B 1CZGA 1MHWC 5FLXc 2YU9H 1K0SA 5ELNA 1X56A 3GTOB 4BY1G 2Y0SG 2MP1A 1VQAA 4NKLA 2JA7B 3I4MB 4FXGC 4C56C 5IT9E 1JR0D 4GLXA 1G51A 4A3MB 1F9SA 3J80c 4UY8C 4DR3Q 1V1PB 2OEOA 3J7YW 3CMAA 5D65A 4X66L 3CRKC 2ZTEA 2Z8LA 5EGTA 3TS0A 1DOKA 1PFSA 5DM63 5L37A 2D62A 5C4XB 1EEFD 1STHA 3NWSA 1A3TA 5FLMH 3KK7A 4UP7A 2VW9A 4J1MA 4HJ8A 3EA6A 3CC4A 1RL2A 4EX5A 1IBKQ 2I5LX 2PI2A 2JSOA 4A93B 4G57A 2UUAL 1QG7A 4XDXA 4A3GG 1I6HB 5JJLA 1ET9A 1QJOA 2CKZB 1HCZA 3NBHA 1IBML 1FD7D 1ICWA 4JPBW 3KJOA 3H3VH 3H94A 1ASZA 1FGBD 2HD3A 5IGGA 4AQYQ 2LXKA 4A3EB 2CWPA 2QF7A 4DA2A 1C8CA 5I6YA 2F0PA 1HR0Q 2LY7A 1PH7A 1WD1A 1PRTC 5A35A 3T16A 1K3RA 1I4RA 3PUWA 2Q2IA 3C1FA 4DAPA 5CBEE 5KEEA 5C3EG 4N9TA 3A7LA 4GOPA 1OXXK 4M1UB 5IYCH 1PFNA 2PQAB 1GHKA 4IFDI 4AYBG 3H0GH 2B2TA 2BE5C 4PV1C 4BY7H 1N34L 2ENBA 4DK1A 4LFAL 2ZXRA 3PIP3 4X6AH 3QIAA 4LF4Q 3TP8A 3A56A 3I56A 5JPMC 5BN4A 1EOVA 2C35B 4CDFC 1R9TH 2B2YC 2RF4A 1T9HA 3CXCA 4FNFA 2MGSA 1LTTD 1VS0A 1FNWA 4HCEA 2K5HA 2F0LA 2AKWB 4RG1A 1NUCA 2JA5H 1TWHB 4OIJA 4BBRG 3KF6B 3KJPA 1PRTB 4QCLA 4YCUA 1O78A 1QOHA 1TS4A 2EQSA 4GKJL 3MFGA 4OL7A 3UDXA 3MXUA 1SE8A 4B3TQ 3F1ZA 3DWAA 5ELCA 2B2UA 3HOZH 1AP0A 2KQ3A 1I4QA 4XYOA 4JI6Q 2F4IA 1XX8A 1KIXA 3GTMH 1HQRD 3C1EA 4UHVA 3NTIA 1PH8A 3M9BA 4U68A 2A5HA 1Q46A 2EY5A 1SFOH 1H9RA 3M3YB 2B8GA 1VQ9A 2E2JB 1MSHA 3Q24A 1STBA 1GUOA 3I91A 4HEDA 1GUGA 3CCMA 1OXTA 2WAQG 2GVAA 3VR3A 2QCPX 2R92H 3K57A 4BBSB 2K52A 3D8GA 1PRTF 1D1IA 3NENA 2RCFA 4IUUA 3NE5B 5FLXL 4DR5L 1ZYRC 1OXVA 2Z4HA 4C2MB 1VQ5A 4UDUC 4DK3C 1W3SA 2A6ED 3ICEA 1WTRA 4A3JB 2RHSB 3S17B 4ZRZA 3J81E 3M4QA 4WJWA 1Z47A 5A2QL 2IJ0A 1U4MA 3MC0B 2O4XA 5CC4A 1QCBD 3AU7A 1IBLL 5KYLA 2NYZD 2CQAA 3G6EA 2NN6H 3I4NH 5LMNL 2ZTCA 2F03A 2YV5A 1YHBA 1B1ZA 4RA8A 4AH6A 3M4YA 4KKUA 4A3KB 4X64Q 1K28A 4DV5Q 4B3RL 2A19A 5EQ0A 3HKZG 1BCPC 3CAMA 3QOLA 4JC0A 3RN5A 3BDCA 2LSSA 2R93G 4KLKA 1L0XB 4LFBL 4DK6C 1VQKA 1Y1VH 3MZ5A 4X65Q 1YNND 1YVCA 2KUMA 1PXUA 4ZQ3A 5EAYA 3HOUH 3T1HQ 1CM9A 3KDFA 5FJ8G 2H1EA 1KC8C 2K4KA 3X3NA 3I70A 2N49A 1YJ9A 4OO1I 3F2UA 4Q0FA 2ID0A 2Q2TA 4WRDA 1A6XA 1FR3A 3X3MA 1K73C 1YITA 1G6ZA 1VQHA 2Z6KA 4NXNL 1BCPB 1K8MA 2JXMB 2L1BA 3GTLH 2JK8A 1TWAH 4KY5A 5FOBB 4JOIC 2MFIA 2GN5A 1VQEA 2HIXA 4CGYB 5C4JB 2WB1B 3I3CA 4FXDA 1J9OA 2B2VA 3N6RA 3S16B 3K7AB 3T53B 1M8AA 4K5WA 3K5LA 2K5QA 4LF6Q 1VQ8A 5BR8Q 3ND8A 1CHQD 1EY8A 3D0FA 3BDLA 1WCMG 3PO2H 3TREA 4Y7NB 4KHVA 4DFAA 1PFMA 5JOBA 3CC2A 2XWJB 2UUBQ 1SXTA 3S2HB 3U4VA 4IFDJ 5ELBA 4A3BG 1TS5A 1WD0A 4HN7A 3V96A 2JA7G 3CPWA 1BCPF 2NZHA 1G91A 4A3IG 1ZXTA 1IBKL 4YY3Q 1AZPA 3TSSA 4B9XA 3K5NA 3QG1A 3PIOA 3HOXB 5C5MA 1A62A 2IT1A 2EOTA 3G7LA 4MHEA 2F0VA 4DK0A 1DD2A 3FVQA 2F0DA 2I46A 2A69D 2R3ZA 3T1YQ 4EQOA 2WINB 3E0EA 2Z9HA 4KJNA 2NVXH 1IL8A 3W1GA 4P74A 1XMQQ 2CQOA 1C0AA 3SR1A 1FGUA 3AMUA 4MNOA 1ONLA 3ULJA 2QEXA 1WTWA 1V9PA 3UI2A 4A93G 1WTPA 3WOFA 4XT3B 1ENCA 2RKSA 1Q8IA 2L11A 3QR8A 1PZKD 1GOZA 2QILA 3A5ZB 3BVMA 3KLWA 2PPBC 2MJ8A 3NPPA 4WORA 5C3EH 4LF4L 4GLAC 4IFDH 4ZUIA 4OEMB 1EZ8A 4G7OC 4AIMA 5FLMG 4K0KQ 2KEEA 3DLLA 4P71A 1Y1WH 1TY0A 1ZEQX 4JI3Q 4X3SA 1WTXA 2K33A 3DM3A 4XTCS 3QO2A 5JVG3 2IHFA 3BJUA 4LUOA 2HT1A 3OHXC 3VR4A 4K6LA 1U9RA 4FVMA 1CA6A 4ZKBB 4KD4A 4PZ6A 1Y8NB 3L7ZC 1CKOA 2ZT9C 4OXPA 1MSGA 4EQNA 3S15B 1E3PA 4IUTA 2M9VA 1SMYD 3DMUA 2RDHA 1HA5A 2JA8H 2AUKA 4YHHQ 2B2YA 4DR4Q 3GTJB 5M5YB 1EL0A 4RGTA 5GAHC 1VQ6A 2AWOA 1NSNS 3T13A 4FF2A 1X3GA 3ND9A 4ME3A 1FJGL 1NMFA 4JI5Q 1DYQA 5IYCG 3RNUA 4B3SQ 4QQBX 1G8ZD 3H0GG 4BY7G 1A15A 4H02A 4RWSC 2L12A 4P75A 2C9OA 3EIVA 1QUQA 1WTHA 2DN8A 3UDFA 1HZBA 3NEMA 3STBD 2WB1E 1A2TA 2JA5G 2WACA 3W2DA 1GKHA 3FPUB 4TVAB 1PFBA 2CH4W 3A54A 1BDOA 3S1QH 3TN2A 3HOZG 4KV6A 4Q5VA 3I72A 1ASYA 4U673 3GTGH 3S1RH 4DR6L 1I5FA 2D2CC 2B2WA 1TR5A 4QIWE 3F2DA 1JOOA 1TWCH 4X64L 4LF8Q 2CFMA 4DV5L 2B63B 3U4ZA 2EY2A 1EYDA 3GP7A 1E0BA 4C3IB 4R4QA 4RCOA 2ASBA 2EJFC 4JI8Q 2I5HA 3TZDA 4JBWA 1Z7TA 2ICEC 1IKLA 1EYAA 1KL9A 3CW2C 4KJOA 1N33Q 2R92G 3RZOB 3QOJA 3GV6A 5IGEA 4JI4Q 4JI7Q 3Q6SA 1G291 4GZYC 4X65L 2YTVA 3TDQA 4A3KG 1YIJA 1N36Q 3S1QB 5C44B 2R93H 2K5WA 3T1HL 1PA6A 3FKIB 5K36G 1XXGA 1X55A 4KI0A 5EPJA 1QVCA 2XIWA 1PH2A 4RGNA 1QILA 1U4LA 4FDBA 3CF5A 3HOWH 3SK4A 3K81C 1EU3A 4HJ7A 4ID6A 2O5JC 3EJIA 4HSVA 4OWWB 3CRLC 5E1FA 1HFNA 4OO1H 3P7JA 1RIPA 1RHPA 2Q8TA 2NN6G 3A8JE 2SDFA 4GNXB 3HOYH 2KCNA 3PUYA 1JQYD 2VS1A 2NN6I 4PMCA 4ZCKA 3F2BA 5CGKA 4BS9A 5FK9C 1HNXQ 5M3MB 1UE7A 3DM1A 3I90A 4V0BA 3IFTA 4RGOS 4DV3Q 3TP7A 2IX0A 1SYCA 4IUVA 2NZOA 2G9DA 2CWAA 4C3HB 1JB3A 4K6DA 1VF7A 3HOVB 1IZ6A 4HJ5A 4DNTB 4HIKA 1TWGH 2LKVA 1WYDA 4L6TB 5NUCA 4A3DH 1Y1VG 4DNRB 2EJGC 3NSWA 2VB3X 4QB4A 3T51B 2UUBL 1TQOA 1SDFA 1SYDA 1EY5A 2R7DA 1S72A 1KDBA 2PZTA 2MQHA 1H9SA 4MTKA 5I2YA 3MXNB 1OXUA 3S14H 2VXWA 1JICA 4IPGA 5CV5A 3VA5A 4JYAL 1PVOA 5LMUQ 5ELOA 4RKLA 3U58A 3GQBA 2BA1A 4R4OA 3GTOH 3SGIA 1D1KA 3E9HA 5JEAJ 1UWVA 3J7AV 1Q86C 1Q12A 1BVSA 1E2WA 3J81c 4HSPA 2JA7H 3I4MH 2QW7A 2WIIB 2F0MA 3T1YL 1LT5D 2F0EA 3T4AC 4A3MH 1II3A 2K6AA 2PW5A 4K8JA 4DV4L 2YYZA 2K1BA 5DAUA 1HFGA 3KBXA 3TS2A 1HQMC 5C4XH 4X3TA 1M1KC 4M8AA 1H9MA 3OIQA 4DAYA 4DNIA 3HRZC 3JAMi 1HJPA 2HCIA 4PG3A 4GN3B 1PYSB 4JI1L 4A3FB 3PO2G 1PTOF 4ODGA 3VYRA 4A93H 5EJWA 1LV9A 4I65A 1O7IA 3CQZB 3K6OA 2NVYB 4IJHA 3MXGA 1I6HH 1MKHA 2F0FA 3ITPA 1C7YA 1EWIA 3I2ZA 3NQIA 4OWXB
chains in the Genus database with same CATH topology
4TRDA 2EYHA 4DXFA 1X3QA 1DZ1A 4R8NA 3VYTA 2K03A 3BG3A 3PUXA 5ISRA 5JEAH 5JPNC 1ESRA 5IGFA 1BF4A 5DM73 1I50B 3FPPA 5CYUA 3R2IA 4TKOB 1UUPA 3EROA 1Y8PB 1TKWB 1M4VA 4RGMA 1STGA 4O42A 1O7ZA 4LK1C 1YNJC 5G3LD 3SXHA 5C0XI 2K28A 5KIXA 1MGSA 4L8JA 2F0NA 4KY7A 1SNQA 1B50A 1EZ6A 4HCSA 5FKAC 1SNDA 3HGBA 4IFDG 1RODA 4QMGA 4CJ2C 4EVOA 1EIGA 5C6AA 2PCFB 2A6HD 1B4OA 3NBIA 1HHVA 4OGQC 5IGCA 2J7ZA 5TSSA 3WOEA 1VMPA 1DOMA 1NR2A 4J8QA 2JA6B 1SE2A 2ZXPA 1TS2A 1PDQA 5FO7B 1IYUA 3S1MB 2XSCA 1S5CD 2E2IB 2FINB 2MHVA 3PO3B 1RCVD 2K05A 2QKIC 3PUZA 5ELDA 4H0LC 3ONAB 2ICIA 3IAYA 1RDPD 2F0SA 2X6GA 3D4WA 2NBFA 3J81L 2BDOA 1G2SA 1VCIA 2KEDA 4C3JB 1SE4A 3BZDB 4N9PA 1E2ZA 3D6WA 3Q22A 4L63B 3GO5A 4ZLTF 1D5ZC 5EBDA 1CQVA 3NP8A 2RVLA 3IFDA 2E2HB 2QEJC 3LWUA 1CFMA 2F0HA 3A55A 1Q3LA 3OMGA 2HDMA 1XYIA 5K36H 2IL8A 4FF3A 1RTNA 3N52A 3WDNA 4IUPA 2BE5D 3A7AB 1T5XD 3KF8A 1F2ZA 1CZWA 5LHY1 2NTTA 4CJ0B 3P1HA 1HXYD 2CW0C 4F7XA 1JE4A 1LACA 3URYA 4FP5D 3H6MA 4IZ8A 5KYIA 4EQPA 1UNSA 2EVBA 5C4ZA 5M3FB 4PQXA 5M5WB 1TWFB 4V190 2GA4B 2K5DA 1B9NA 2EZVA 4LJZC 3HS0C 3AB9A 4DU9A 2CHBD 3H09A 3LX0A 4OO1G 1EY4A 1S5BD 1SNPA 3K59A 1HA6A 2NB0A 1SBBB 1EFID 2EJMA 5IGDA 4X3UA 3ERQA 4XIGS 1B3AA 2Z4IA 3RZDB 2VB2X 2F0KA 3OW7A 1V1PA 1MBYA 1ZYRD 2RDFA 5K5PA 5EKIA 2N55A 5C0XJ 3T56B 2EYMA 3BS1A 5CMDA 2R7ZB 1HTPA 3D31A 1Q90A 2NZ1D 4R8IA 5M5XB 2C5CA 4QIWB 1JC7A 1KABA 1SYEA 1F9QA 4ME5A 1F2MA 3S2DB 3NHHA 3FDTA 1ET6A 3DHQA 3LNNA 4XQNA 4C1NI 3SK6A 3MA2B 1LTID 2XWBB 1QB5D 1JWUD 1LABA 5DNFA 3M7NA 5ELEA 4K5XA 1F2LA 3M4OB 1FNUA 5C0XH 5CBAE 5JAVA 1EY6A 2SEBD 1DXMA 2VNUD 5CV9A 1NR4A 3R8BA 5F2DA 2D9UA 3C2PA 4BY1B 2Y0SB 1IW7C 4XXEA 3MTSA 1BUVT 3KBGA 1F2YA 5JEAG 3PMFA 4IALA 3S1NB 3GTPB 2R6GA 1K83B 2R61A 3QB3A 3R3OA 1CQFA 1JCKB 4TSSA 1X3PA 2BOSA 4ULLA 2QDBA 1SE3A 1XTCD 3MAQA 2CVRA 3CHBD 4A3GB 3A8IE 2PO4A 2B39A 1TU2B 3NTKA 2FHTA 3MFYA 1Q1EA 2V4DA 3D3RA 2HCCA 3GTKB 4BA2I 3CKIB 5T1IA 5C5LA 3C46A 5BN5A 5E4WC 2Z1CA 1H9JA 1GUTA 1G2TA 1LT3D 4KK7A 4AYBB 2F1MA 3GTQB 1EY7A 1RKNA 5HURA 3K0YA 4KY6A 2B8FA 5EPKA 2WV6D 1EY0A 3DEOA 3OMCA 1WVLA 1BNZA 3DUZA 3PIO3 2L9HA 3VYUA 4J6HA 4K2KA 2RSOA 3VA7A 2RSNA 3Q0AA 5FO9B 5JJZA 4BBRB 1KTKA 1I4GA 2ZXOA 1WTVA 2K04A 2E76C 1MI2A 2AQ1B 2B2UC 2EE1A 3MVVA 1DOLA 2OT2A 3NWTA 4KHZA 4EGVA 3OWFA 4G7HC 1BOSA 4XQJA 5LL6X 2TSSA 1WTOA 1EOTA 1I3QB 3DWPA 3NTHA 4PNYA 2L55A 1CI3M 1HUNA 2NVTB 2LS01 3JAME 1U4RA 1VDZA 3IL8A 4IQZA 3QWNA 1QE6A 5I9PA 2AQ2B 1A3VA 4TQUS 2KECA 2KCCA 1SSOA 1W6KA 2RDGA 5HGTA 1HTLD 4ZUJA 1PTOC 3DWQA 3L9AX 3L3OC 4B9WA 2G9HD 3HG9A 4IUNA 3R2TA 2VUMB 4S3SA 1HPCA 1IYVA 1R4QB 2A73B 1OO9B 3NK9A 2XVSA 3CU7A 3H91A 3HKZB 1DONA 1RF2D 5D14A 2K32A 2TMPA 3OPOA 2X6LA 3G6JB 3NXWA 3P75A 1LT4D 1CTMA 3OWEB 1DM0B 3D6CA 3KUPA 1PTOB 4CJ1B 2F0TA 2NVQB 3PUVA 1SEBD 1JWSD 3EFXD 1EYCA 1GUNA 1STAA 4FYDA 3RUZA 5KRUA 4BWGB 1QWYA 3OOCA 4CHTB 4DXGA 3IKJA 1TVXA 2A68D 3E5SA 1B9MA 2AWNA 3EVQA 1Y69U 1ESFA 1EU4A 2KJXA 5BN3A 1A2UA 1KNAA 4JK1C 4RAUC 1SNMA 2WKDA 1WCMB 1FYCA 3P20A 1HUMA 4H7BA 3DEPA 3U9OA 3I8ZA 5CORA 1K8OA 4A3BB 1JWMD 4ZAIA 3TBIB 5CV6A 1BBXC 3PV0A 3C3LA 1MD2D 4A3IB 4F8MA 2BCOA 1I4PA 2FMMA 4CKCA 1AEXA 2PMZB 4IURA 2M2LA 1R4PB 1XWEA 1JOKA 5C0XG 2F0GA 2EYJA 4FF4A 3SE0A 2PYKA 2XNAC 2EYPA 1D5MC 2KHSA 2YU9B 3OSOA 2KOLA 2RA4A 4WFN3 3H3VC 1B44D 4HMIA 4XT1B 5G3LF 2LMCB 3HEJA 2E74C 3FMCA 3GV3A 1C48A 2BA0A 3A8KE 1CT1D 1LTSD 5EPLA 4KMUC 3TP6A 2A6EC 5E3FA 4KKSA 2RQXA 4P2CB 2PNRC 3M85A 3BYTB 5COYA 1PMRA 4RCNA 1A3UA 1I6VC 1V43A 1KAAA 4G7ZC 1GUSA 3KLRA 1LT6D 1QNKA 1EWHA 5C4HA 1I4XA 4XQQA 1E2VA 1VF5C 5J22A 5IOCA 5C3XA 1JORA 3BVZA 3RD4A 3E6ZX 3U9SA 1S5ED 1DCZA 3KLSX 1LO5D 5J39A 1AN8A 1TY2A 4QUCA 4K8IA 1Q1BA 3H0GB 4BY7B 1CK1A 1IHZA 4UAIA 5EKLA 2EYFA 1STNA 1PLFA 1RD9D 4HAEA 1YNJD 1YNNC 2PQEA 4C3IG 1T5EA 2L0CA 1R9TB 4FF1A 1S5FD 1SJED 1O7LA 1PRTD 1BR9A 1C4QA 2EDGA 2IW3A 1UEAB 2JA5B 3TZUA 4R9WA 4RFBA 3LWEA 4YIJA 2B2WC 2F3VA 2HDLA 2EY6A 3ZYYX 2Q8IB 3HOZB 3DXJC 4KN7C 2DY7A 3VR6A 1GJXA 1NAPA 3GTMB 4LMQD 1S5DD 2EXZA 3TMEA 2D5DA 4KTAA 1SFOB 5IIFA 2EPBA 3MXNA 4KKTA 4ZKCB 3J80L 5I2XA 2L4NA 1EEID 2IPKD 2R92B 2NUCA 1W6JA 3E0JA 2Q8RE 1AFPA 4C3HG 5IODA 4NP5A 3VR2A 5EBCA 5FLXE 3MHBA 4HR7B 2IWHA 1B53A 3VR5A 3HZXA 5A2QE 4DAVA 3K58A 4CKEA 4IN3A 2A69C 3J80E 2WKCA 4H13C 1TS3A 4DN4M 5KNDA 1GHJA 2NWGA 3I4NB 2SOBA 4QF4A 4QUFA 5KNBA 5FO8B 4MIUA 2J4XA 1B2TA 4DF7A 1X32A 1RJTA 5M9OA 3FEWX 1LTGD 1TIID 4K5VA 5IGBA 1Y1VB 2CW0D 5CV7A 5KNCA 3HOUB 4RKBA 3SK8A 1HRJA 1FNVA 1ILQA 2LFNA 4CKBA 1KDCA 4BA1I 5CV8A 1BCPD 2A74C 3NUCA 4F88A 2DNEA 2F0OA 1CA5A 5ELFA 1SMYC 4DGZA 3GTLB 1LTBD 1TWAB 1KDAA 1F77A 1ENAA 2XRQD 1SYGA 2AUJD 4B08A 2F0UA 2FMCA 4OHJA 1H9SB 2M00A 2XN9C 3RLFA 4NW2A 5I4DA 4H44C 2N88A 2SNSA 3J7AF 3FRPB 3PO2B 1PYWD 2NTSA 2IX3A 3V2TA 1Z6HA 4C1NK 1EWCA 4ZK9B 1RTOA 2L5TA 1L0YB 4RHRA 3D4RA 2PW7A 2EYOA 4O1NA 1ML0D 4Z9CB 4MN3A 4LAAA 2HUGA 1SJHD 5I6WA 4FXKC 2WP8J 2PZWA 4PMWA 5KGUA 4KN4C 5CV4A 3V05A 4ABNA 3BVGA 1BQQT 3K5MA 2NVXB 3I4LA 2KA7A 1O80A 4RHSA 1GUWA 2FFKB 1NCVA 1STEA 5T1GA 4PMBA 3O13A 4XYQA 1LTAD 1UAPA 1Y8OB 4K14A 5C3EB 4OIKA 2B2TC 4CBVA 1U4PA 2SNMA 5J1ZA 1WTQA 2K7VA 2EY1A 3TP5A 1Y1WB 1ILPA 1SYBA 1V8QA 4C3JG 1D2BA 2E2DC 2F0IA 4IUQA 3I73A 4X3KA 5CR3A 1IW7D 1STYA 2F0QA 4RH6A 1TT2A 2JYOA 4F87A 1SNCA 3MWYW 4NDXA 2O5IC 2JA8B 2JEAI 2KVMA 1KNEA 3M7GA 1PZID 4ZYSA 3JAML 3D4DA 3R93A 3GD7A 1CHPD 2BDNA 2E75C 1JOQA 5D3DA 2K01A 2FJ2A 2JEBI 5JVH3 3K5OA 2JE6I 2OF1A 2HQEA 5D3IB 2WAQB 1H9KA 4K2LA 3S9WA 5LL6S 5E4XA 1EIHA 1EQVA 3SEBA 2PZUA 2H4OA 1VMCA 1ENFA 2A68C 3RMHA 2F0JA 4NMZA 3SDZA 3GTGB 3S1RB 3HP3A 3OIPA 4FO2A 1TWCB 3QJYA 2F3WA 1PTOH 1S4ZA 4E6IA 2XRSD 2EYLA 1F9RA 5C3WA 2JP1A 4G4KA 1KLGD 4I7ZC 5EKKA 1GXDC 2DY8A 1EY9A 1BO0A 2J0TD 4KD3A 3VYSA 3W3AA 2R93B 1LLRD 1V1OA 1BXTA 1EQTA 2MPMA 3SVMA 2F0WA 1AZQA 1DJRD 5DEHA 3HOWB 3BDOA 3SHLA 2IX1A 1F9PA 2X69A 3NQTA 3KLSA 3HOYB 3BYYB 1KLUD 2O2LD 5AFWA 1OXSC 3Q23A 2I07B 5I9OA 1SAPA 1D6EC 1AW7A 3SK5A 1SYFA 1PZJD 4HTHA 1O7YA 2OXPA 2MUYA 1D5XC 5IT9L 4HMJA 2B2VC 1SNOA 1ZKOA 3MEHA 1TWGB 3MXPA 4A3DB 1QNUA 3EQLC 1PTOD 2A6HC 1LTRD 2RBMA 4ILWA 1I4HA 3S14B 1J8IA 1IKMA 2DNCA 2AQ3B 1CZGA 3GTOB 2MP1A 4NKLA 2JA7B 3I4MB 4C56C 4FXGC 5IT9E 1JR0D 4A3MB 1F9SA 1V1PB 2OEOA 3J7YW 5D65A 3CRKC 2Z8LA 5EGTA 1DOKA 5DM63 2D62A 5C4XB 1EEFD 1STHA 3NWSA 1A3TA 3KK7A 4J1MA 3EA6A 2JSOA 4A93B 4G57A 1QG7A 4XDXA 1I6HB 1ET9A 1QJOA 1HCZA 3NBHA 1FD7D 1ICWA 3H94A 1FGBD 5IGGA 4A3EB 2QF7A 4DA2A 1C8CA 5I6YA 2F0PA 2LY7A 1WD1A 1PRTC 5A35A 3T16A 1I4RA 3PUWA 5CBEE 3C1FA 4DAPA 5KEEA 4N9TA 3A7LA 1OXXK 4M1UB 1PFNA 1GHKA 4IFDI 2B2TA 2BE5C 4PV1C 2ENBA 4DK1A 2ZXRA 3PIP3 3QIAA 3TP8A 3A56A 5JPMC 5BN4A 2B2YC 4FNFA 2MGSA 1LTTD 1FNWA 4HCEA 2F0LA 1NUCA 1TWHB 4OIJA 1PRTB 4QCLA 1O78A 1QOHA 1TS4A 3MFGA 4OL7A 3MXUA 3DWAA 5ELCA 2B2UA 1AP0A 2KQ3A 1I4QA 4XYOA 2F4IA 1XX8A 1HQRD 3C1EA 3NTIA 4U68A 2A5HA 2EY5A 1H9RA 3M3YB 2B8GA 2E2JB 1MSHA 3Q24A 1STBA 1GUOA 3I91A 4HEDA 1GUGA 1OXTA 3VR3A 2QCPX 3K57A 4BBSB 3D8GA 1PRTF 1D1IA 4IUUA 3NE5B 5FLXL 1ZYRC 1OXVA 2Z4HA 4C2MB 4UDUC 2A6ED 1WTRA 4A3JB 3S17B 4ZRZA 3J81E 4WJWA 1Z47A 5A2QL 2IJ0A 1U4MA 3MC0B 2O4XA 5CC4A 1QCBD 3AU7A 5KYLA 2NYZD 2CQAA 2NN6H 2F03A 1B1ZA 4RA8A 3M4YA 4KKUA 4A3KB 5EQ0A 3QOLA 1BCPC 3BDCA 1L0XB 3MZ5A 1YNND 2KUMA 1PXUA 4ZQ3A 1CM9A 2H1EA 3X3NA 3I70A 4OO1I 3F2UA 4Q0FA 2ID0A 4WRDA 1A6XA 1FR3A 3X3MA 1G6ZA 1BCPB 1K8MA 2JXMB 2L1BA 4KY5A 5FOBB 4CGYB 5C4JB 2WB1B 3I3CA 4FXDA 1J9OA 2B2VA 3N6RA 3S16B 3K7AB 3T53B 1M8AA 4K5WA 3K5LA 2K5QA 3ND8A 1CHQD 1EY8A 3BDLA 4Y7NB 4KHVA 4DFAA 1PFMA 5JOBA 2XWJB 1SXTA 3S2HB 4IFDJ 5ELBA 1TS5A 1WD0A 4HN7A 3V96A 1BCPF 1G91A 1ZXTA 1AZPA 3TSSA 4B9XA 3K5NA 3QG1A 3HOXB 5C5MA 2IT1A 2EOTA 3G7LA 4MHEA 2F0VA 4DK0A 1DD2A 3FVQA 2F0DA 2I46A 2A69D 2R3ZA 4EQOA 2WINB 4KJNA 1IL8A 3SR1A 3AMUA 1ONLA 1WTWA 3UI2A 1WTPA 3WOFA 4XT3B 1ENCA 2RKSA 1Q8IA 2L11A 1PZKD 1GOZA 2QILA 3BVMA 2PPBC 2MJ8A 3NPPA 4WORA 4IFDH 4ZUIA 1EZ8A 4G7OC 2KEEA 1TY0A 1ZEQX 4X3SA 1WTXA 2K33A 4XTCS 3QO2A 5JVG3 3OHXC 3VR4A 4K6LA 1U9RA 4FVMA 1CA6A 4ZKBB 4KD4A 1Y8NB 3L7ZC 2ZT9C 1MSGA 4EQNA 3S15B 4IUTA 2M9VA 1SMYD 3DMUA 2RDHA 1HA5A 2AUKA 2B2YA 3GTJB 5M5YB 1EL0A 4RGTA 2AWOA 1NSNS 3T13A 4FF2A 3ND9A 1DYQA 1G8ZD 1A15A 4RWSC 2L12A 2C9OA 2DN8A 1A2TA 2WACA 3W2DA 3FPUB 1PFBA 3A54A 1BDOA 3TN2A 4KV6A 4Q5VA 3I72A 4U673 2D2CC 2B2WA 1TR5A 1JOOA 2B63B 2EY2A 1EYDA 3GP7A 1E0BA 4C3IB 4RCOA 2EJFC 3TZDA 4JBWA 1Z7TA 2ICEC 1IKLA 1EYAA 4KJOA 3RZOB 3QOJA 3GV6A 5IGEA 3Q6SA 1G291 4GZYC 3TDQA 3S1QB 5C44B 2K5WA 3FKIB 5K36G 1XXGA 4KI0A 5EPJA 2XIWA 4RGNA 1QILA 1U4LA 3SK4A 1EU3A 4ID6A 2O5JC 3EJIA 4HSVA 3CRLC 5E1FA 1HFNA 4OO1H 3P7JA 1RHPA 2Q8TA 2NN6G 3A8JE 2SDFA 2KCNA 3PUYA 1JQYD 2NN6I 4PMCA 5CGKA 4BS9A 5FK9C 5M3MB 3DM1A 3I90A 4V0BA 3IFTA 4RGOS 3TP7A 2IX0A 1SYCA 4IUVA 2G9DA 4C3HB 1JB3A 4K6DA 1VF7A 3HOVB 4DNTB 2LKVA 4L6TB 5NUCA 4DNRB 2EJGC 3NSWA 2VB3X 4QB4A 3T51B 1TQOA 1SDFA 1SYDA 1EY5A 1KDBA 2PZTA 1H9SA 5I2YA 1OXUA 2VXWA 1JICA 3VA5A 5CV5A 4RKLA 3GQBA 2BA1A 1D1KA 5JEAJ 3J7AV 1Q12A 1E2WA 4HSPA 2WIIB 2F0MA 1LT5D 2F0EA 3T4AC 1II3A 2K6AA 2PW5A 4K8JA 2YYZA 2K1BA 5DAUA 1HFGA 3KBXA 1HQMC 4X3TA 4M8AA 1H9MA 3OIQA 4DAYA 3HRZC 2HCIA 4A3FB 1PTOF 4ODGA 3VYRA 5EJWA 1LV9A 4I65A 3CQZB 3K6OA 2NVYB 3MXGA 2F0FA 3ITPA 3NQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EL0 A;  1AZQ A;  2X6G A;  1HFN A;  5COY A;  4IUU A;  2JYO A;  2Q8R E;  3P7J A;  1WTO A;  1RHP A;  3MWY W;  1EOT A;  1X3Q A;  4NW2 A;  1DZ1 A;  1ICW A;  2Q8T A;  4X3U A;  2KVM A;  1G2S A;  2KED A;  2K03 A;  2SDF A;  1X3P A;  1PFM A;  1KNE A;  2N88 A;  1B3A A;  1F9P A;  1QNK A;  3D6W A;  1WTR A;  1KNA A;  2X69 A;  1ESR A;  1BF4 A;  1A15 A;  3R93 A;  4ZK9 B;  1U4M A;  1WD0 A;  1C8C A;  1HUN A;  4RWS C;  4ZLT F;  3DM1 A;  2CVR A;  1B53 A;  3I90 A;  1RTO A;  2L12 A;  5AFW A;  1WD1 A;  2BDN A;  5EKI A;  1U4R A;  1G91 A;  2N55 A;  2NYZ D;  5CBE E;  2RVL A;  3IFD A;  2K01 A;  3IL8 A;  1ZXT A;  1SAP A;  1ML0 D;  4RAU C;  1AZP A;  2FJ2 A;  5CMD A;  4MN3 A;  1PFN A;  1QE6 A;  4DN4 M;  2HUG A;  4IUV A;  2NWG A;  4O42 A;  2B2T A;  1Q3L A;  2EOT A;  3G7L A;  1O7Z A;  4RA8 A;  4MHE A;  2HDM A;  1XYI A;  1HUM A;  2FHT A;  2IL8 A;  2KEC A;  4XDX A;  4QUF A;  1RTN A;  2NZ1 D;  4R8I A;  1O7Y A;  2R3Z A;  1SSO A;  3DEP A;  2HCC A;  4QUC A;  3I8Z A;  5COR A;  3N52 A;  4ZAI A;  5EQ0 A;  4IUP A;  5T1I A;  1IL8 A;  2B2V C;  2K28 A;  4UAI A;  1SDF A;  1BBX C;  1B2T A;  1PLF A;  1MGS A;  1F9Q A;  5E4W C;  2B2Y C;  4HAE A;  5E4X A;  1B50 A;  3FPU B;  1X32 A;  1RJT A;  1EIH A;  1PFB A;  2MGS A;  1WTW A;  4HCS A;  2VXW A;  1JIC A;  2FMM A;  3FDT A;  4CJ0 B;  1G2T A;  3UI2 A;  1ROD A;  1WTP A;  4CJ2 C;  3TN2 A;  1O80 A;  4IUR A;  1EIG A;  1JE4 A;  4XT3 B;  1GUW A;  2FFK B;  1VMC A;  2KUM A;  2M2L A;  4OIJ A;  2L11 A;  1NCV A;  1J8I A;  5T1G A;  1IKM A;  2B2W A;  1CM9 A;  2MJ8 A;  3H91 A;  1B4O A;  1HHV A;  1DON A;  2H1E A;  5D14 A;  5EPK A;  2MP1 A;  3HP3 A;  2J7Z A;  2X6L A;  3DEO A;  5DNF A;  1WVL A;  1HRJ A;  1ILQ A;  4R9W A;  3F2U A;  1VMP A;  1E0B A;  3LWE A;  1BNZ A;  2B2U A;  1DOM A;  1F2L A;  2L9H A;  1AP0 A;  1NR2 A;  1S4Z A;  2KOL A;  4OIK A;  2RA4 A;  1F9S A;  2K1B A;  2B2T C;  1PDQ A;  3TZD A;  2RSO A;  1XX8 A;  1U4P A;  1HFG A;  2B2W C;  1IKL A;  1F9R A;  2KEE A;  3KBX A;  1G6Z A;  2HDL A;  2RSN A;  4X3T A;  5CBA E;  3KUP A;  5D65 A;  2JP1 A;  4CJ1 B;  5JJZ A;  2DY7 A;  4X3S A;  1WTQ A;  4XT1 B;  1WTX A;  3GV6 A;  2L1B A;  4U68 A;  1NR4 A;  2FIN B;  3Q6S A;  3QO2 A;  1DOK A;  1WTV A;  1ILP A;  1NAP A;  2HCI A;  2K04 A;  1CA5 A;  4LMQ D;  2D9U A;  1MI2 A;  1MSH A;  2K05 A;  2B2U C;  2EE1 A;  2DY8 A;  3I91 A;  3GV3 A;  4HED A;  1CA6 A;  1BO0 A;  1DOL A;  4ZKB B;  2EPB A;  1HA6 A;  3MTS A;  4ZKC B;  5EPJ A;  5EJW A;  2XIW A;  1LV9 A;  1TVX A;  5EPL A;  3I3C A;  4IUQ A;  1U4L A;  3ONA B;  1J9O A;  1MSG A;  2B2V A;  4IUT A;  1EQT A;  2L4N A;  4X3K A;  1M8A A;  2MPM A;  3SVM A;  2B2Y A;  1QG7 A;  4HSV A; 
#chains in the Genus database with same CATH topology
 4TRD A;  2EYH A;  4DXF A;  1AE3 A;  1X3Q A;  3OW2 A;  2DGY A;  4A3E H;  1DZ1 A;  4R8N A;  2XTI A;  3VYT A;  2K03 A;  3BG3 A;  3PUX A;  5ISR A;  3F2C A;  4A3C H;  5JEA H;  5JPN C;  1ESR A;  5IGF A;  1BF4 A;  5DM7 3;  1I50 B;  3FPP A;  5CYU A;  3R2I A;  4TKO B;  4R4C A;  1UUP A;  2K75 A;  3ERO A;  2CCZ A;  1Y8P B;  5LMN W;  1XNR Q;  1TKW B;  1M4V A;  4RGM A;  1STG A;  2UU9 Q;  2FXQ A;  3G48 A;  1Z9F A;  2F4V Q;  4O42 A;  1O7Z A;  4LK1 C;  3AFQ A;  1YEZ A;  2MO0 A;  1YNJ C;  2ES2 A;  5G3L D;  4DR7 Q;  4JI5 L;  3SXH A;  5C0X I;  2K28 A;  4B3S L;  5KIX A;  4DUY L;  1MGS A;  4L8J A;  1BBW A;  2F0N A;  3NEL A;  4KY7 A;  1SNQ A;  4UP9 A;  1B50 A;  4LF5 Q;  1JJG A;  1EZ6 A;  4HCS A;  1TWH H;  5FKA C;  1SND A;  3HGB A;  4IFD G;  1ROD A;  4QMG A;  4CJ2 C;  4EVO A;  1EIG A;  1HNZ Q;  3CP0 A;  1X65 A;  5C6A A;  2PCF B;  4POG A;  3CCQ A;  2A6H D;  3A5U A;  1B4O A;  3NBI A;  1Y1W G;  1HHV A;  4OGQ C;  2RHQ B;  1E24 A;  5IGC A;  2J7Z A;  5TSS A;  3WOE A;  1VMP A;  3UE0 A;  1DOM A;  1NR2 A;  4J8Q A;  2JA6 B;  1SE2 A;  2ZXP A;  3L0O A;  1TS2 A;  1PDQ A;  4DV0 Q;  2QDL A;  5FO7 B;  3M3Y H;  4KHP Q;  1YI2 A;  1IYU A;  2E2J H;  3S1M B;  2XSC A;  1S5C D;  2E2I B;  2CH4 A;  4DR2 Q;  2FIN B;  2JA8 G;  2MHV A;  2OTL A;  3PO3 B;  1RCV D;  2K05 A;  2QKI C;  1J5E Q;  4GLV B;  3PUZ A;  5ELD A;  3CD6 A;  3TRZ A;  4BBS H;  2OQ0 A;  4LF8 L;  4JVZ A;  1VQ7 A;  4H0L C;  2K5N A;  3ONA B;  2ICI A;  4YWM A;  2K50 A;  3IAY A;  1RDP D;  1GVP A;  4C2M H;  1I94 Q;  2F0S A;  2X6G A;  3D4W A;  1VQN A;  3PCO B;  1X3E A;  4A3J H;  3S17 H;  2NBF A;  4A4I A;  3J81 L;  2BDO A;  1G2S A;  1VCI A;  2KED A;  2VL6 A;  4C3J B;  4GKK Q;  2KEN A;  1SE4 A;  4JI4 L;  3BZD B;  4JI7 L;  4N9P A;  1E2Z A;  3D6W A;  1C9O A;  3Q22 A;  4L63 B;  3GO5 A;  1KRT A;  1WJJ A;  1UE1 A;  4ZLT F;  1D5Z C;  5EBD A;  1CQV A;  3NP8 A;  4IO9 A;  4HIM A;  2RVL A;  3IFD A;  3UE1 A;  2E2H B;  2QEJ C;  3LWU A;  4A3K H;  1CFM A;  1N8R C;  2F0H A;  3A55 A;  1Q3L A;  3OMG A;  3CCS A;  1GM5 A;  2HDM A;  1XYI A;  5K36 H;  2IL8 A;  1PH3 A;  4FF3 A;  1RTN A;  4CDE C;  2DUD A;  1A0I A;  3N52 A;  3WDN A;  1J6Q A;  4IUP A;  2BE5 D;  3A7A B;  2R7F A;  4RMF A;  1T5X D;  1XPU A;  2YTY A;  3KF8 A;  4L5S A;  1F2Z A;  1CZW A;  1HNX L;  1HR0 W;  5HY6 A;  5LHY 1;  4OX9 Q;  2NTT A;  2UUC Q;  4CJ0 B;  4L5T A;  4MTN A;  3P1H A;  4DV3 L;  1HXY D;  2CW0 C;  2ZJP A;  4F7X A;  5JJI A;  1JE4 A;  3LGJ A;  1HZ9 A;  3MEF A;  1K8G A;  1LAC A;  3URY A;  4FP5 D;  3H6M A;  4LF7 Q;  4IZ8 A;  4LWC A;  4LFC Q;  4DR1 Q;  5KYI A;  4EQP A;  4JI0 L;  1UNS A;  2EVB A;  1LYL A;  3TQY A;  5C4Z A;  5M3F B;  3TEH B;  1CKN B;  2PMZ E;  4PQX A;  5M5W B;  4DV1 L;  1JJ2 A;  3ER0 A;  1HNW Q;  2UXD Q;  5IP7 G;  4JI2 Q;  1TWF B;  4V19 0;  4QL5 A;  2GA4 B;  2K5D A;  2ZJQ A;  3HOW G;  1B9N A;  2EZV A;  4JBK A;  4LJZ C;  3HS0 C;  5C4J H;  3AB9 A;  4DU9 A;  1KXL A;  2CHB D;  4OON A;  4MZ9 A;  3H09 A;  3LX0 A;  4OO1 G;  1E22 A;  1EY4 A;  1S5B D;  3S16 H;  4O2D A;  1SNP A;  3K7A H;  3OYY A;  3I55 A;  1K3B C;  2NB0 A;  3K59 A;  1HA6 A;  1EIF A;  2R7Z H;  3HOY G;  1SBB B;  2Q2U A;  3PQI A;  1EFI D;  1NMG A;  3VDY A;  4Y7N H;  2OCE A;  5GAD C;  2EJM A;  5IGD A;  3S2H H;  1BKB A;  1YHA A;  3J81 j;  1UE5 A;  4X3U A;  3ERQ A;  4XIG S;  1B3A A;  4IOC A;  2Z4I A;  3RZD B;  3CME A;  2VB2 X;  1K0R A;  2F0K A;  3OW7 A;  1V1P A;  1MBY A;  1ZYR D;  2RDF A;  5K5P A;  3HOX H;  5EKI A;  4A3D G;  2N55 A;  4DUZ Q;  5C0X J;  3T56 B;  2EYM A;  3BS1 A;  2I0Q A;  5CMD A;  2R7Z B;  2N8N A;  1HTP A;  2JN4 A;  4DR3 L;  2L15 A;  3D31 A;  1VQD A;  1Q90 A;  1U5K A;  2NZ1 D;  4R8I A;  2KCM A;  5M5X B;  1SRU A;  2C5C A;  3G71 A;  4QIW B;  1JC7 A;  1KAB A;  1SYE A;  4HJ9 A;  4A3F G;  1F9Q A;  4J15 A;  3I4M G;  4ME5 A;  1F2M A;  5GQO A;  3S2D B;  3NHH A;  3FDT A;  4A3M G;  1ET6 A;  3DHQ A;  3LNN A;  4NXM Q;  4XQN A;  3E9I A;  2UU9 L;  4C1N I;  3SK6 A;  3MA2 B;  1LTI D;  2XWB B;  3PSI A;  5GAG C;  2F52 A;  1QB5 D;  3HKS A;  1WOC A;  5C4X G;  1JWU D;  1LAB A;  1VQ4 A;  4IPD A;  1GD7 A;  5DNF A;  3M7N A;  4AQY L;  1NBW A;  4DV6 Q;  5ELE A;  4K5X A;  1F2L A;  2PQA A;  3M4O B;  1KQS A;  1HR0 L;  2PNH A;  4LF5 L;  5E7N A;  1FNU A;  5C0X H;  1X6O A;  1XNQ Q;  5CBA E;  5JAV A;  1EY6 A;  2SEB D;  1VQG A;  1DXM A;  2Z0S A;  2VNU D;  5JJK A;  5CV9 A;  1NR4 A;  3R8B A;  3PF5 A;  5F2D A;  2D9U A;  3C2P A;  4BY1 B;  2Y0S B;  1IW7 C;  3S15 H;  2KHI A;  4XXE A;  3J80 i;  5DLQ E;  1M90 C;  4A3E G;  3MTS A;  1BUV T;  5M5Y H;  3KBG A;  3GTJ H;  1F2Y A;  4A3C G;  5JEA G;  4JG2 A;  3PMF A;  4IAL A;  3S1N B;  2QGQ A;  3STB C;  3U50 C;  1YJW A;  3KF6 A;  3GTP B;  1D8L A;  2R6G A;  1K83 B;  2R61 A;  3QB3 A;  3R3O A;  1CQF A;  1JCK B;  4TSS A;  4DR2 L;  1YBY A;  1X3P A;  2BOS A;  4ULL A;  1LM0 A;  2QDB A;  2I5M X;  1SE3 A;  1KRS A;  1XTC D;  3MAQ A;  2CVR A;  1IYJ B;  1L0W A;  1GO3 E;  3CHB D;  4B3T L;  4A3G B;  3A8I E;  1SLJ A;  4JI6 L;  2PO4 A;  1LTL A;  2B39 A;  1TU2 B;  1I94 L;  3NTK A;  2FHT A;  3MFY A;  1Q1E A;  2V4D A;  3D3R A;  2G5D A;  5GRO A;  2HCC A;  3GTK B;  4GKK L;  4BA2 I;  3J7A 5;  3RLN A;  3CKI B;  5T1I A;  5C5L A;  3C46 A;  3CCJ A;  5BN5 A;  5E4W C;  2Z1C A;  4YCW A;  1H9J A;  1GUT A;  1VQF A;  1G2T A;  1K9M C;  1LT3 D;  2AHO B;  4KK7 A;  2VY3 A;  4AYB B;  2F1M A;  3GTQ B;  1IL2 A;  2B63 H;  2BH2 A;  1EY7 A;  3I4O A;  3UDG A;  1RKN A;  2D0O A;  4C3I H;  5HUR A;  3K0Y A;  4KY6 A;  3NBH B;  2B8F A;  1VQC A;  1WFQ A;  5EPK A;  2WV6 D;  1EY0 A;  3DEO A;  3OMC A;  1WVL A;  1BNZ A;  3DUZ A;  3PIO 3;  2L9H A;  1HH2 P;  3VYU A;  3RZO H;  4J6H A;  4BBS G;  4K2K A;  2RSO A;  4OX9 L;  3VA7 A;  1H95 A;  3K0X A;  2EIF A;  4LFA Q;  2RSN A;  3Q0A A;  5FO9 B;  5C44 H;  5JJZ A;  4BBR B;  1KTK A;  1I4G A;  1V1Q A;  2ZXO A;  3FKI H;  4GOP B;  1WTV A;  2K04 A;  2E76 C;  1MI2 A;  2AQ1 B;  2B2U C;  2EE1 A;  1XPR A;  3MVV A;  4A3J G;  1DOL A;  2OT2 A;  4QY7 A;  3NWT A;  4LFC L;  4DR1 L;  1KHI A;  4KHZ A;  4EGV A;  5H1S E;  3OWF A;  2VQE Q;  4GNX C;  4G7H C;  1BOS A;  2VQF Q;  4XQJ A;  5LL6 X;  2EXD A;  2TSS A;  4P72 A;  1HNW L;  1WTO A;  2UXD L;  1EOT A;  1I3Q B;  5HGQ A;  3DWP A;  3NTH A;  4PNY A;  4GKJ Q;  2D0P A;  5M3M H;  2L55 A;  4HID A;  4WJ3 M;  1JT8 A;  1CI3 M;  1HUN A;  2NVT B;  2LS0 1;  4O0A A;  5IP7 H;  1PHJ A;  2OQK A;  3JAM E;  1U4R A;  1VDZ A;  4C3H H;  3IL8 A;  1E7Z A;  1QVF A;  4IQZ A;  3QWN A;  3HOV H;  1QE6 A;  5I9P A;  2AQ2 B;  3B6Y A;  1A3V A;  3ERS X;  4TQU S;  2LXJ A;  2KEC A;  2Y0S E;  2KCC A;  3CPF A;  1SSO A;  1E1O A;  1W6K A;  2RDG A;  5HGT A;  1HTL D;  4ZUJ A;  1PTO C;  3DWQ A;  3L9A X;  1PH6 A;  1EYG A;  3L3O C;  4B9W A;  2G9H D;  3HG9 A;  4IUN A;  3R2T A;  2VUM B;  4S3S A;  1HPC A;  4CDC C;  1IYV A;  1R4Q B;  2A73 B;  4DUZ L;  1OO9 B;  3AFP A;  3NK9 A;  2XVS A;  4DR5 Q;  1CUK A;  3CU7 A;  4LF6 L;  5BR8 L;  2A8V A;  1NE3 A;  3H91 A;  3HKZ B;  1DON A;  1RF2 D;  5D14 A;  1L1O C;  4IPH A;  4JBM A;  1IBL Q;  2K32 A;  2TMP A;  3OPO A;  3BU2 A;  2X6L A;  1P16 A;  4JOI A;  3G6J B;  3NXW A;  3P75 A;  2WB1 G;  1LT4 D;  1JB7 A;  1CTM A;  3OWE B;  2R7Z G;  4LF9 Q;  1DM0 B;  3D6C A;  3KUP A;  1HZA A;  1PTO B;  4CJ1 B;  2F0T A;  4YY3 L;  2NVQ B;  3ULP A;  3PUV A;  1SEB D;  4B3R Q;  1YJN A;  4A3F H;  1JWS D;  3EFX D;  1EYC A;  1GUN A;  1FVI A;  1STA A;  4FYD A;  3RUZ A;  3CQZ H;  5KRU A;  2NVY H;  1QZH A;  3W1B A;  4BWG B;  3CCE A;  1QWY A;  3OOC A;  2B29 A;  3PIP A;  1IXR A;  4CHT B;  4DXG A;  1DGS A;  1TVX A;  2A68 D;  3IKJ A;  3E5S A;  4N8F A;  1B9M A;  3J7Z C;  1XMQ L;  4AYB E;  4EQ5 A;  1S40 A;  2PI2 E;  1D7Q A;  1L1O B;  2AWN A;  5IWA Q;  3HOX G;  3EVQ A;  5IY0 A;  1XNQ L;  1Y69 U;  1ESF A;  1I50 H;  1K8A C;  1EU4 A;  2KJX A;  1ICF B;  5BN3 A;  1A2U A;  1KNA A;  1VQL A;  1MIU A;  4JK1 C;  3KDF B;  2YTX A;  1EQQ A;  2KBN A;  1G6P A;  4NXN Q;  4DV7 Q;  4RAU C;  1SNM A;  4LNQ A;  2WKD A;  1N32 Q;  4LUV A;  1WCM B;  1FYC A;  1NNX A;  4K0K L;  4A75 A;  3P20 A;  1HUM A;  4H7B A;  4JI3 L;  4X62 Q;  1NTG A;  3DEP A;  3U9O A;  3I8Z A;  5COR A;  1K8O A;  4A3B B;  1JWM D;  1YZ6 A;  1UE6 A;  4ZAI A;  4QGU A;  3TBI B;  5CV6 A;  2MO1 A;  1VQP A;  1BBX C;  3PV0 A;  3C3L A;  1MD2 D;  4A3I B;  4F8M A;  2BCO A;  3ULL A;  1I4P A;  2FMM A;  2IHE A;  2HIV A;  4CKC A;  1AEX A;  2PMZ B;  4IUR A;  1N9W A;  4B3M Q;  4YHH L;  4DR4 L;  2M2L A;  3RN2 A;  1R4P B;  4JV5 Q;  1XWE A;  2WAQ E;  1JOK A;  5C0X G;  2F0G A;  2EYJ A;  4FF4 A;  3SE0 A;  2PYK A;  5IYB G;  2XNA C;  1PYB A;  2JA6 H;  2EYP A;  1D5M C;  2KHS A;  4R4I A;  2YU9 B;  3OSO A;  3S1M H;  2KOL A;  1VQI A;  2RA4 A;  2E2I H;  4WFN 3;  3K7U C;  3H3V C;  4A76 A;  3PO3 H;  1SMX A;  1B44 D;  4HMI A;  5IE8 A;  4XT1 B;  5G3L F;  4L5R C;  2QA4 A;  3BZC A;  2LMC B;  3HEJ A;  2E74 C;  3FMC A;  3GV3 A;  2DJF C;  1Q8K A;  1C48 A;  2BA0 A;  1HZC A;  3A8K E;  1CT1 D;  1LTS D;  2HHH Q;  5EPL A;  1A63 A;  1A8V A;  4KMU C;  3TP6 A;  2A6E C;  5E3F A;  4C3J H;  4KKS A;  2RQX A;  4P2C B;  2PNR C;  3M85 A;  3BYT B;  4BXX G;  2HQL A;  5COY A;  1PMR A;  4RCN A;  1A3U A;  1I6V C;  3HKZ E;  1V43 A;  1KAA A;  4IPC A;  4G7Z C;  1GUS A;  1X9N A;  3KLR A;  1LT6 D;  1QNK A;  1EWH A;  3A0J A;  4DPG A;  2E2H H;  5C4H A;  1I4X A;  4XQQ A;  1E2V A;  1VF5 C;  5J22 A;  5IOC A;  5C3X A;  2VQE L;  1JOR A;  3BVZ A;  3RD4 A;  2OWO A;  2UXC Q;  3E6Z X;  4JI8 L;  1NJI C;  3U9S A;  1S5E D;  1DCZ A;  2VQF L;  3KLS X;  3RR5 A;  1LO5 D;  5J39 A;  1N33 L;  1AN8 A;  1L2F A;  1TY2 A;  2DJG C;  4QUC A;  4K8I A;  1Q1B A;  3H0G B;  4BY7 B;  1CK1 A;  4LUZ A;  1IHZ A;  4UAI A;  1N36 L;  3GDE A;  5EKL A;  2EYF A;  1STN A;  2MNA A;  1PLF A;  1RD9 D;  1PH4 A;  2N78 A;  2B63 G;  4HAE A;  1YNJ D;  2AMC B;  1YNN C;  2H5X A;  2PQE A;  4C3I G;  1T5E A;  1MJC A;  1X3F A;  2L0C A;  1R9T B;  4FF1 A;  3PF4 A;  1PH9 A;  1S5F D;  4GNX A;  1SJE D;  1FJG Q;  1O7L A;  2KHJ A;  1PRT D;  1BR9 A;  1C4Q A;  2EDG A;  2IW3 A;  4APV A;  1UEA B;  5C44 G;  2JA5 B;  3TZU A;  5M3F H;  4Y52 H;  5M5W H;  3FKI G;  4R9W A;  4RFB A;  3LWE A;  1TWF H;  4YIJ A;  2B2W C;  2F3V A;  2HDL A;  2EY6 A;  3ZYY X;  2Q8I B;  3HOZ B;  3DXJ C;  2JQO A;  4KN7 C;  2DY7 A;  3OTO Q;  4DV2 Q;  3VR6 A;  4NB3 A;  1QUQ B;  1GJX A;  1NAP A;  3GTM B;  4DKA C;  4LMQ D;  1S5D D;  2EXZ A;  3TME A;  3CCR A;  2D5D A;  4KTA A;  1SFO B;  5IIF A;  2EPB A;  3MXN A;  4KKT A;  2XGT A;  4ZKC B;  4WJ4 A;  3J80 L;  5M3M G;  1EQR A;  5I2X A;  2VUM G;  2L4N A;  3PGZ A;  1XTD A;  1Q7Y C;  1EEI D;  2IPK D;  2R92 B;  2NUC A;  1W6J A;  4DR6 Q;  3E0J A;  2Q8R E;  5LMU L;  3RZD H;  1B7Y B;  4LF9 L;  1AFP A;  4C3H G;  5IOD A;  1TXY A;  4NP5 A;  3HOV G;  3VR2 A;  1X54 A;  4ALP A;  5EBC A;  3FHW A;  5FLX E;  3MHB A;  4HR7 B;  2IWH A;  1B53 A;  1FL0 A;  3VR5 A;  3HZX A;  3KYH C;  1L1O A;  5A2Q E;  4DAV A;  3EN2 A;  3K58 A;  4CKE A;  4IN3 A;  2A69 C;  3J80 E;  2WKC A;  4H13 C;  1TS3 A;  4DN4 M;  5KND A;  1GHJ A;  2NWG A;  4A3L H;  5M5X H;  1EIY B;  3I4N B;  2SOB A;  4QF4 A;  4QUF A;  5KNB A;  5IWA L;  5FO8 B;  4UPA A;  1KAW A;  3S2D H;  4MIU A;  2J4X A;  3BZK A;  1B2T A;  2JJQ A;  1XMO Q;  4DF7 A;  3W5O A;  1X32 A;  1RJT A;  5M9O A;  3FEW X;  3E3X A;  2JA9 A;  3CC7 A;  4DV7 L;  1LTG D;  1TII D;  1N32 L;  4K5V A;  2V1C C;  5IGB A;  1YNX A;  4NPS A;  1Y1V B;  2CW0 D;  4GS3 A;  4X62 L;  1Q81 C;  3M4O H;  5CV7 A;  1BBU A;  5KNC A;  3HOU B;  4RKB A;  2E8G A;  3JAM c;  3SK8 A;  1HRJ A;  1FNV A;  1VQJ A;  1ILQ A;  2LFN A;  2E5L Q;  5AJ3 Q;  4CKB A;  1KDC A;  4BA1 I;  5CV8 A;  1BCP D;  3J81 i;  2A74 C;  3NUC A;  4IJL A;  4BY1 H;  4F88 A;  1XNR L;  2DNE A;  4B3M L;  1JE5 A;  2F0O A;  2F4V L;  1CA5 A;  4JV5 L;  5ELF A;  1SMY C;  4DGZ A;  3GTL B;  1LTB D;  3EBE A;  1TWA B;  1KDA A;  1F77 A;  3S1N H;  4LW1 A;  4DR7 L;  1ENA A;  5IP9 G;  2XRQ D;  5IYD G;  1SYG A;  4JYA Q;  2KCT A;  4PZ8 A;  3CCV A;  3GTP H;  2AUJ D;  1K83 H;  3H15 A;  2VZA A;  4B08 A;  2F0U A;  2FMC A;  4OHJ A;  1H9S B;  3AQQ A;  4POF A;  2M00 A;  2XN9 C;  3RLF A;  5IYB H;  4NW2 A;  5I4D A;  1U0L A;  1HNZ L;  4H44 C;  2N88 A;  4OWT B;  2SNS A;  3J7A F;  4DV4 Q;  3FRP B;  3PO2 B;  1PYW D;  2NTS A;  2IX3 A;  3V2T A;  1Z6H A;  4C1N K;  2ZM6 Q;  3HFZ B;  1EWC A;  2BH8 A;  4ZK9 B;  4A3G H;  1RTO A;  2UXB Q;  2L5T A;  1L0Y B;  4RHR A;  3D4R A;  2PW7 A;  2EYO A;  3I7F A;  2HHH L;  4O1N A;  1PV4 A;  1ML0 D;  4Z9C B;  3AEV A;  4MN3 A;  4LAA A;  1VQM A;  2HUG A;  1S3O A;  4DV0 L;  3GTK H;  1SJH D;  4KHP L;  2K14 A;  4JBJ A;  5I6W A;  4FXK C;  4GN4 B;  2WP8 J;  4JI1 Q;  3L2P A;  2PZW A;  4PMW A;  5KGU A;  4KN4 C;  5CV4 A;  3V05 A;  1JMC A;  4ABN A;  3BVG A;  3WWV A;  4DAY B;  2ZTD A;  1BQQ T;  1J5E L;  4BXX H;  3K5M A;  2N3S A;  2NVX B;  3GTQ H;  3I4L A;  2JA6 G;  4X66 Q;  3S24 A;  2KA7 A;  1O80 A;  4RHS A;  1GUW A;  4OEL B;  2FFK B;  2UXC L;  1NCV A;  1STE A;  5T1G A;  1LUZ A;  4PMB A;  4YCV A;  3O13 A;  4XYQ A;  3PO3 G;  1LTA D;  1UAP A;  1Y8O B;  4K14 A;  4GOP C;  2B3G A;  5C3E B;  4OIK A;  4BBR H;  2UUA Q;  3H3V I;  2WFW A;  2B2T C;  4CBV A;  1U4P A;  2SNM A;  1IBM Q;  5J1Z A;  1WTQ A;  2K7V A;  3FP9 A;  2EY1 A;  3TP5 A;  1Y1W B;  1ILP A;  2K5V A;  1SN8 A;  1SYB A;  1V8Q A;  4C3J G;  4DUY Q;  1D2B A;  5IT9 c;  2E2D C;  2F0I A;  2IY5 B;  4IUQ A;  3I73 A;  4X3K A;  5CR3 A;  1IW7 D;  3Q8D A;  1I3Q H;  1STY A;  2F0Q A;  4RH6 A;  1KD1 C;  1N34 Q;  1Y14 B;  2UUC L;  1P8L A;  1TT2 A;  2JYO A;  4JW0 A;  4F87 A;  1SNC A;  3MWY W;  4NDX A;  2O5I C;  2JA8 B;  2JEA I;  2KVM A;  2Z6B A;  3OTO L;  4DV2 L;  1KNE A;  3M7G A;  2Q2H A;  2NVT H;  3KFU A;  1JJC B;  3CCU A;  1PZI D;  4ZYS A;  3JAM L;  3D4D A;  1CKN A;  3R93 A;  1QZG A;  3G4S A;  4LF7 L;  5GAE C;  1QVG A;  3GD7 A;  1CHP D;  3M4P A;  2BDN A;  3K80 C;  4YWL A;  2E75 C;  1JOQ A;  5D3D A;  2K01 A;  1E1T A;  1SR3 A;  2FJ2 A;  2JEB I;  3CCL A;  5JVH 3;  4JI2 L;  3K5O A;  1CSP A;  2JE6 I;  1B70 B;  2OF1 A;  2HQE A;  5J3B A;  5D3I B;  2VUM H;  2WAQ B;  1H9K A;  4K2L A;  2ATW A;  3S9W A;  5LL6 S;  1W2B A;  5E4X A;  1EIH A;  1EQV A;  5M3F G;  3SEB A;  2PZU A;  2H4O A;  1EUJ A;  1VMC A;  1ENF A;  1NY4 A;  1MJE A;  1OTC A;  1PH1 A;  4IOA A;  2A68 C;  3RMH A;  2F0J A;  4GN5 A;  4NMZ A;  3SDZ A;  1AE2 A;  3GTG B;  3S1R B;  3HP3 A;  3JC6 6;  3OIP A;  4FO2 A;  1UEB A;  1TWC B;  3QJY A;  2F3W A;  1PTO H;  1S4Z A;  1XMO L;  4E6I A;  2XRS D;  2NVQ H;  2EYL A;  1F9R A;  5FJ8 H;  5C3W A;  2JP1 A;  2ZJR A;  4HIO A;  4R1J A;  3I4N G;  1Q82 C;  4G4K A;  1KLG D;  4I7Z C;  5EKK A;  1GXD C;  2DY8 A;  1VQB A;  1EY9 A;  1BO0 A;  2J0T D;  4UP8 A;  4KD3 A;  3VYS A;  4CDD C;  3W3A A;  2R93 B;  4HJA A;  2A1A A;  1LLR D;  1V1O A;  1BXT A;  5LMN Q;  1XJV A;  1EQT A;  1CKM A;  2E5L L;  1B8A A;  1EFW A;  2MPM A;  4L5Q A;  4P73 A;  3SVM A;  3K8A A;  5AJ3 L;  3KF8 B;  2F0W A;  1AZQ A;  2GVB A;  1DJR D;  5DEH A;  1XPO A;  3HOW B;  3BDO A;  3F8T A;  4NXM L;  3SHL A;  4JI0 Q;  4N8X 1;  4R4T A;  2IX1 A;  1YHQ A;  1AH9 A;  1F9P A;  2X69 A;  3A74 A;  3NQT A;  4A3L G;  3KLS A;  4DAM A;  3HOU G;  4LFB Q;  3HOY B;  3BYY B;  2OTJ A;  1KLU D;  2O2L D;  5AFW A;  4DV1 Q;  1OXS C;  2Z6K C;  3IRB A;  4YWK A;  1WCM H;  3Q23 A;  2I07 B;  3ZJY C;  5I9O A;  4DV6 L;  1SAP A;  1D6E C;  4I7A A;  1AW7 A;  3SK5 A;  1SYF A;  2P5Z X;  3UDI A;  4A3B H;  4JCV E;  2RCN A;  1PZJ D;  4HTH A;  1O7Y A;  5IP9 H;  1VQO A;  5IYD H;  2OXP A;  2MUY A;  1D5X C;  5IT9 L;  4A3I H;  4HMJ A;  2B2V C;  3KOJ A;  1SNO A;  1ZKO A;  2F3I A;  3MEH A;  1TWG B;  3MXP A;  4A3D B;  4QJF A;  2ZM6 L;  1QNU A;  2ALY B;  1PH5 A;  3EQL C;  2UXB L;  1PTO D;  1SRO A;  1WI5 A;  2A6H C;  3RLO A;  1LTR D;  2RBM A;  4ILW A;  3AYH B;  4PZ7 A;  1I4H A;  3S14 B;  1B3Q A;  1J8I A;  1IKM A;  1CSQ A;  2DNC A;  2AQ3 B;  1CZG A;  1MHW C;  5FLX c;  2YU9 H;  1K0S A;  5ELN A;  1X56 A;  3GTO B;  4BY1 G;  2Y0S G;  2MP1 A;  1VQA A;  4NKL A;  2JA7 B;  3I4M B;  4FXG C;  4C56 C;  5IT9 E;  1JR0 D;  4GLX A;  1G51 A;  4A3M B;  1F9S A;  3J80 c;  4UY8 C;  4DR3 Q;  1V1P B;  2OEO A;  3J7Y W;  3CMA A;  5D65 A;  4X66 L;  3CRK C;  2ZTE A;  2Z8L A;  5EGT A;  3TS0 A;  1DOK A;  1PFS A;  5DM6 3;  5L37 A;  2D62 A;  5C4X B;  1EEF D;  1STH A;  3NWS A;  1A3T A;  5FLM H;  3KK7 A;  4UP7 A;  2VW9 A;  4J1M A;  4HJ8 A;  3EA6 A;  3CC4 A;  1RL2 A;  4EX5 A;  1IBK Q;  2I5L X;  2PI2 A;  2JSO A;  4A93 B;  4G57 A;  2UUA L;  1QG7 A;  4XDX A;  4A3G G;  1I6H B;  5JJL A;  1ET9 A;  1QJO A;  2CKZ B;  1HCZ A;  3NBH A;  1IBM L;  1FD7 D;  1ICW A;  4JPB W;  3KJO A;  3H3V H;  3H94 A;  1ASZ A;  1FGB D;  2HD3 A;  5IGG A;  4AQY Q;  2LXK A;  4A3E B;  2CWP A;  2QF7 A;  4DA2 A;  1C8C A;  5I6Y A;  2F0P A;  1HR0 Q;  2LY7 A;  1PH7 A;  1WD1 A;  1PRT C;  5A35 A;  3T16 A;  1K3R A;  1I4R A;  3PUW A;  2Q2I A;  3C1F A;  4DAP A;  5CBE E;  5KEE A;  5C3E G;  4N9T A;  3A7L A;  4GOP A;  1OXX K;  4M1U B;  5IYC H;  1PFN A;  2PQA B;  1GHK A;  4IFD I;  4AYB G;  3H0G H;  2B2T A;  2BE5 C;  4PV1 C;  4BY7 H;  1N34 L;  2ENB A;  4DK1 A;  4LFA L;  2ZXR A;  3PIP 3;  4X6A H;  3QIA A;  4LF4 Q;  3TP8 A;  3A56 A;  3I56 A;  5JPM C;  5BN4 A;  1EOV A;  2C35 B;  4CDF C;  1R9T H;  2B2Y C;  2RF4 A;  1T9H A;  3CXC A;  4FNF A;  2MGS A;  1LTT D;  1VS0 A;  1FNW A;  4HCE A;  2K5H A;  2F0L A;  2AKW B;  4RG1 A;  1NUC A;  2JA5 H;  1TWH B;  4OIJ A;  4BBR G;  3KF6 B;  3KJP A;  1PRT B;  4QCL A;  4YCU A;  1O78 A;  1QOH A;  1TS4 A;  2EQS A;  4GKJ L;  3MFG A;  4OL7 A;  3UDX A;  3MXU A;  1SE8 A;  4B3T Q;  3F1Z A;  3DWA A;  5ELC A;  2B2U A;  3HOZ H;  1AP0 A;  2KQ3 A;  1I4Q A;  4XYO A;  4JI6 Q;  2F4I A;  1XX8 A;  1KIX A;  3GTM H;  1HQR D;  3C1E A;  4UHV A;  3NTI A;  1PH8 A;  3M9B A;  4U68 A;  2A5H A;  1Q46 A;  2EY5 A;  1SFO H;  1H9R A;  3M3Y B;  2B8G A;  1VQ9 A;  2E2J B;  1MSH A;  3Q24 A;  1STB A;  1GUO A;  3I91 A;  4HED A;  1GUG A;  3CCM A;  1OXT A;  2WAQ G;  2GVA A;  3VR3 A;  2QCP X;  2R92 H;  3K57 A;  4BBS B;  2K52 A;  3D8G A;  1PRT F;  1D1I A;  3NEN A;  2RCF A;  4IUU A;  3NE5 B;  5FLX L;  4DR5 L;  1ZYR C;  1OXV A;  2Z4H A;  4C2M B;  1VQ5 A;  4UDU C;  4DK3 C;  1W3S A;  2A6E D;  3ICE A;  1WTR A;  4A3J B;  2RHS B;  3S17 B;  4ZRZ A;  3J81 E;  3M4Q A;  4WJW A;  1Z47 A;  5A2Q L;  2IJ0 A;  1U4M A;  3MC0 B;  2O4X A;  5CC4 A;  1QCB D;  3AU7 A;  1IBL L;  5KYL A;  2NYZ D;  2CQA A;  3G6E A;  2NN6 H;  3I4N H;  5LMN L;  2ZTC A;  2F03 A;  2YV5 A;  1YHB A;  1B1Z A;  4RA8 A;  4AH6 A;  3M4Y A;  4KKU A;  4A3K B;  4X64 Q;  1K28 A;  4DV5 Q;  4B3R L;  2A19 A;  5EQ0 A;  3HKZ G;  1BCP C;  3CAM A;  3QOL A;  4JC0 A;  3RN5 A;  3BDC A;  2LSS A;  2R93 G;  4KLK A;  1L0X B;  4LFB L;  4DK6 C;  1VQK A;  1Y1V H;  3MZ5 A;  4X65 Q;  1YNN D;  1YVC A;  2KUM A;  1PXU A;  4ZQ3 A;  5EAY A;  3HOU H;  3T1H Q;  1CM9 A;  3KDF A;  5FJ8 G;  2H1E A;  1KC8 C;  2K4K A;  3X3N A;  3I70 A;  2N49 A;  1YJ9 A;  4OO1 I;  3F2U A;  4Q0F A;  2ID0 A;  2Q2T A;  4WRD A;  1A6X A;  1FR3 A;  3X3M A;  1K73 C;  1YIT A;  1G6Z A;  1VQH A;  2Z6K A;  4NXN L;  1BCP B;  1K8M A;  2JXM B;  2L1B A;  3GTL H;  2JK8 A;  1TWA H;  4KY5 A;  5FOB B;  4JOI C;  2MFI A;  2GN5 A;  1VQE A;  2HIX A;  4CGY B;  5C4J B;  2WB1 B;  3I3C A;  4FXD A;  1J9O A;  2B2V A;  3N6R A;  3S16 B;  3K7A B;  3T53 B;  1M8A A;  4K5W A;  3K5L A;  2K5Q A;  4LF6 Q;  1VQ8 A;  5BR8 Q;  3ND8 A;  1CHQ D;  1EY8 A;  3D0F A;  3BDL A;  1WCM G;  3PO2 H;  3TRE A;  4Y7N B;  4KHV A;  4DFA A;  1PFM A;  5JOB A;  3CC2 A;  2XWJ B;  2UUB Q;  1SXT A;  3S2H B;  3U4V A;  4IFD J;  5ELB A;  4A3B G;  1TS5 A;  1WD0 A;  4HN7 A;  3V96 A;  2JA7 G;  3CPW A;  1BCP F;  2NZH A;  1G91 A;  4A3I G;  1ZXT A;  1IBK L;  4YY3 Q;  1AZP A;  3TSS A;  4B9X A;  3K5N A;  3QG1 A;  3PIO A;  3HOX B;  5C5M A;  1A62 A;  2IT1 A;  2EOT A;  3G7L A;  4MHE A;  2F0V A;  4DK0 A;  1DD2 A;  3FVQ A;  2F0D A;  2I46 A;  2A69 D;  2R3Z A;  3T1Y Q;  4EQO A;  2WIN B;  3E0E A;  2Z9H A;  4KJN A;  2NVX H;  1IL8 A;  3W1G A;  4P74 A;  1XMQ Q;  2CQO A;  1C0A A;  3SR1 A;  1FGU A;  3AMU A;  4MNO A;  1ONL A;  3ULJ A;  2QEX A;  1WTW A;  1V9P A;  3UI2 A;  4A93 G;  1WTP A;  3WOF A;  4XT3 B;  1ENC A;  2RKS A;  1Q8I A;  2L11 A;  3QR8 A;  1PZK D;  1GOZ A;  2QIL A;  3A5Z B;  3BVM A;  3KLW A;  2PPB C;  2MJ8 A;  3NPP A;  4WOR A;  5C3E H;  4LF4 L;  4GLA C;  4IFD H;  4ZUI A;  4OEM B;  1EZ8 A;  4G7O C;  4AIM A;  5FLM G;  4K0K Q;  2KEE A;  3DLL A;  4P71 A;  1Y1W H;  1TY0 A;  1ZEQ X;  4JI3 Q;  4X3S A;  1WTX A;  2K33 A;  3DM3 A;  4XTC S;  3QO2 A;  5JVG 3;  2IHF A;  3BJU A;  4LUO A;  2HT1 A;  3OHX C;  3VR4 A;  4K6L A;  1U9R A;  4FVM A;  1CA6 A;  4ZKB B;  4KD4 A;  4PZ6 A;  1Y8N B;  3L7Z C;  1CKO A;  2ZT9 C;  4OXP A;  1MSG A;  4EQN A;  3S15 B;  1E3P A;  4IUT A;  2M9V A;  1SMY D;  3DMU A;  2RDH A;  1HA5 A;  2JA8 H;  2AUK A;  4YHH Q;  2B2Y A;  4DR4 Q;  3GTJ B;  5M5Y B;  1EL0 A;  4RGT A;  5GAH C;  1VQ6 A;  2AWO A;  1NSN S;  3T13 A;  4FF2 A;  1X3G A;  3ND9 A;  4ME3 A;  1FJG L;  1NMF A;  4JI5 Q;  1DYQ A;  5IYC G;  3RNU A;  4B3S Q;  4QQB X;  1G8Z D;  3H0G G;  4BY7 G;  1A15 A;  4H02 A;  4RWS C;  2L12 A;  4P75 A;  2C9O A;  3EIV A;  1QUQ A;  1WTH A;  2DN8 A;  3UDF A;  1HZB A;  3NEM A;  3STB D;  2WB1 E;  1A2T A;  2JA5 G;  2WAC A;  3W2D A;  1GKH A;  3FPU B;  4TVA B;  1PFB A;  2CH4 W;  3A54 A;  1BDO A;  3S1Q H;  3TN2 A;  3HOZ G;  4KV6 A;  4Q5V A;  3I72 A;  1ASY A;  4U67 3;  3GTG H;  3S1R H;  4DR6 L;  1I5F A;  2D2C C;  2B2W A;  1TR5 A;  4QIW E;  3F2D A;  1JOO A;  1TWC H;  4X64 L;  4LF8 Q;  2CFM A;  4DV5 L;  2B63 B;  3U4Z A;  2EY2 A;  1EYD A;  3GP7 A;  1E0B A;  4C3I B;  4R4Q A;  4RCO A;  2ASB A;  2EJF C;  4JI8 Q;  2I5H A;  3TZD A;  4JBW A;  1Z7T A;  2ICE C;  1IKL A;  1EYA A;  1KL9 A;  3CW2 C;  4KJO A;  1N33 Q;  2R92 G;  3RZO B;  3QOJ A;  3GV6 A;  5IGE A;  4JI4 Q;  4JI7 Q;  3Q6S A;  1G29 1;  4GZY C;  4X65 L;  2YTV A;  3TDQ A;  4A3K G;  1YIJ A;  1N36 Q;  3S1Q B;  5C44 B;  2R93 H;  2K5W A;  3T1H L;  1PA6 A;  3FKI B;  5K36 G;  1XXG A;  1X55 A;  4KI0 A;  5EPJ A;  1QVC A;  2XIW A;  1PH2 A;  4RGN A;  1QIL A;  1U4L A;  4FDB A;  3CF5 A;  3HOW H;  3SK4 A;  3K81 C;  1EU3 A;  4HJ7 A;  4ID6 A;  2O5J C;  3EJI A;  4HSV A;  4OWW B;  3CRL C;  5E1F A;  1HFN A;  4OO1 H;  3P7J A;  1RIP A;  1RHP A;  2Q8T A;  2NN6 G;  3A8J E;  2SDF A;  4GNX B;  3HOY H;  2KCN A;  3PUY A;  1JQY D;  2VS1 A;  2NN6 I;  4PMC A;  4ZCK A;  3F2B A;  5CGK A;  4BS9 A;  5FK9 C;  1HNX Q;  5M3M B;  1UE7 A;  3DM1 A;  3I90 A;  4V0B A;  3IFT A;  4RGO S;  4DV3 Q;  3TP7 A;  2IX0 A;  1SYC A;  4IUV A;  2NZO A;  2G9D A;  2CWA A;  4C3H B;  1JB3 A;  4K6D A;  1VF7 A;  3HOV B;  1IZ6 A;  4HJ5 A;  4DNT B;  4HIK A;  1TWG H;  2LKV A;  1WYD A;  4L6T B;  5NUC A;  4A3D H;  1Y1V G;  4DNR B;  2EJG C;  3NSW A;  2VB3 X;  4QB4 A;  3T51 B;  2UUB L;  1TQO A;  1SDF A;  1SYD A;  1EY5 A;  2R7D A;  1S72 A;  1KDB A;  2PZT A;  2MQH A;  1H9S A;  4MTK A;  5I2Y A;  3MXN B;  1OXU A;  3S14 H;  2VXW A;  1JIC A;  4IPG A;  5CV5 A;  3VA5 A;  4JYA L;  1PVO A;  5LMU Q;  5ELO A;  4RKL A;  3U58 A;  3GQB A;  2BA1 A;  4R4O A;  3GTO H;  3SGI A;  1D1K A;  3E9H A;  5JEA J;  1UWV A;  3J7A V;  1Q86 C;  1Q12 A;  1BVS A;  1E2W A;  3J81 c;  4HSP A;  2JA7 H;  3I4M H;  2QW7 A;  2WII B;  2F0M A;  3T1Y L;  1LT5 D;  2F0E A;  3T4A C;  4A3M H;  1II3 A;  2K6A A;  2PW5 A;  4K8J A;  4DV4 L;  2YYZ A;  2K1B A;  5DAU A;  1HFG A;  3KBX A;  3TS2 A;  1HQM C;  5C4X H;  4X3T A;  1M1K C;  4M8A A;  1H9M A;  3OIQ A;  4DAY A;  4DNI A;  3HRZ C;  3JAM i;  1HJP A;  2HCI A;  4PG3 A;  4GN3 B;  1PYS B;  4JI1 L;  4A3F B;  3PO2 G;  1PTO F;  4ODG A;  3VYR A;  4A93 H;  5EJW A;  1LV9 A;  4I65 A;  1O7I A;  3CQZ B;  3K6O A;  2NVY B;  4IJH A;  3MXG A;  1I6H H;  1MKH A;  2F0F A;  3ITP A;  1C7Y A;  1EWI A;  3I2Z A;  3NQI A;  4OWX B; 
#chains in the Genus database with same CATH homology
 4TRD A;  2EYH A;  4DXF A;  1X3Q A;  1DZ1 A;  4R8N A;  3VYT A;  2K03 A;  3BG3 A;  3PUX A;  5ISR A;  5JEA H;  5JPN C;  1ESR A;  5IGF A;  1BF4 A;  5DM7 3;  1I50 B;  3FPP A;  5CYU A;  3R2I A;  4TKO B;  1UUP A;  3ERO A;  1Y8P B;  1TKW B;  1M4V A;  4RGM A;  1STG A;  4O42 A;  1O7Z A;  4LK1 C;  1YNJ C;  5G3L D;  3SXH A;  5C0X I;  2K28 A;  5KIX A;  1MGS A;  4L8J A;  2F0N A;  4KY7 A;  1SNQ A;  1B50 A;  1EZ6 A;  4HCS A;  5FKA C;  1SND A;  3HGB A;  4IFD G;  1ROD A;  4QMG A;  4CJ2 C;  4EVO A;  1EIG A;  5C6A A;  2PCF B;  2A6H D;  1B4O A;  3NBI A;  1HHV A;  4OGQ C;  5IGC A;  2J7Z A;  5TSS A;  3WOE A;  1VMP A;  1DOM A;  1NR2 A;  4J8Q A;  2JA6 B;  1SE2 A;  2ZXP A;  1TS2 A;  1PDQ A;  5FO7 B;  1IYU A;  3S1M B;  2XSC A;  1S5C D;  2E2I B;  2FIN B;  2MHV A;  3PO3 B;  1RCV D;  2K05 A;  2QKI C;  3PUZ A;  5ELD A;  4H0L C;  3ONA B;  2ICI A;  3IAY A;  1RDP D;  2F0S A;  2X6G A;  3D4W A;  2NBF A;  3J81 L;  2BDO A;  1G2S A;  1VCI A;  2KED A;  4C3J B;  1SE4 A;  3BZD B;  4N9P A;  1E2Z A;  3D6W A;  3Q22 A;  4L63 B;  3GO5 A;  4ZLT F;  1D5Z C;  5EBD A;  1CQV A;  3NP8 A;  2RVL A;  3IFD A;  2E2H B;  2QEJ C;  3LWU A;  1CFM A;  2F0H A;  3A55 A;  1Q3L A;  3OMG A;  2HDM A;  1XYI A;  5K36 H;  2IL8 A;  4FF3 A;  1RTN A;  3N52 A;  3WDN A;  4IUP A;  2BE5 D;  3A7A B;  1T5X D;  3KF8 A;  1F2Z A;  1CZW A;  5LHY 1;  2NTT A;  4CJ0 B;  3P1H A;  1HXY D;  2CW0 C;  4F7X A;  1JE4 A;  1LAC A;  3URY A;  4FP5 D;  3H6M A;  4IZ8 A;  5KYI A;  4EQP A;  1UNS A;  2EVB A;  5C4Z A;  5M3F B;  4PQX A;  5M5W B;  1TWF B;  4V19 0;  2GA4 B;  2K5D A;  1B9N A;  2EZV A;  4LJZ C;  3HS0 C;  3AB9 A;  4DU9 A;  2CHB D;  3H09 A;  3LX0 A;  4OO1 G;  1EY4 A;  1S5B D;  1SNP A;  3K59 A;  1HA6 A;  2NB0 A;  1SBB B;  1EFI D;  2EJM A;  5IGD A;  4X3U A;  3ERQ A;  4XIG S;  1B3A A;  2Z4I A;  3RZD B;  2VB2 X;  2F0K A;  3OW7 A;  1V1P A;  1MBY A;  1ZYR D;  2RDF A;  5K5P A;  5EKI A;  2N55 A;  5C0X J;  3T56 B;  2EYM A;  3BS1 A;  5CMD A;  2R7Z B;  1HTP A;  3D31 A;  1Q90 A;  2NZ1 D;  4R8I A;  5M5X B;  2C5C A;  4QIW B;  1JC7 A;  1KAB A;  1SYE A;  1F9Q A;  4ME5 A;  1F2M A;  3S2D B;  3NHH A;  3FDT A;  1ET6 A;  3DHQ A;  3LNN A;  4XQN A;  4C1N I;  3SK6 A;  3MA2 B;  1LTI D;  2XWB B;  1QB5 D;  1JWU D;  1LAB A;  5DNF A;  3M7N A;  5ELE A;  4K5X A;  1F2L A;  3M4O B;  1FNU A;  5C0X H;  5CBA E;  5JAV A;  1EY6 A;  2SEB D;  1DXM A;  2VNU D;  5CV9 A;  1NR4 A;  3R8B A;  5F2D A;  2D9U A;  3C2P A;  4BY1 B;  2Y0S B;  1IW7 C;  4XXE A;  3MTS A;  1BUV T;  3KBG A;  1F2Y A;  5JEA G;  3PMF A;  4IAL A;  3S1N B;  3GTP B;  2R6G A;  1K83 B;  2R61 A;  3QB3 A;  3R3O A;  1CQF A;  1JCK B;  4TSS A;  1X3P A;  2BOS A;  4ULL A;  2QDB A;  1SE3 A;  1XTC D;  3MAQ A;  2CVR A;  3CHB D;  4A3G B;  3A8I E;  2PO4 A;  2B39 A;  1TU2 B;  3NTK A;  2FHT A;  3MFY A;  1Q1E A;  2V4D A;  3D3R A;  2HCC A;  3GTK B;  4BA2 I;  3CKI B;  5T1I A;  5C5L A;  3C46 A;  5BN5 A;  5E4W C;  2Z1C A;  1H9J A;  1GUT A;  1G2T A;  1LT3 D;  4KK7 A;  4AYB B;  2F1M A;  3GTQ B;  1EY7 A;  1RKN A;  5HUR A;  3K0Y A;  4KY6 A;  2B8F A;  5EPK A;  2WV6 D;  1EY0 A;  3DEO A;  3OMC A;  1WVL A;  1BNZ A;  3DUZ A;  3PIO 3;  2L9H A;  3VYU A;  4J6H A;  4K2K A;  2RSO A;  3VA7 A;  2RSN A;  3Q0A A;  5FO9 B;  5JJZ A;  4BBR B;  1KTK A;  1I4G A;  2ZXO A;  1WTV A;  2K04 A;  2E76 C;  1MI2 A;  2AQ1 B;  2B2U C;  2EE1 A;  3MVV A;  1DOL A;  2OT2 A;  3NWT A;  4KHZ A;  4EGV A;  3OWF A;  4G7H C;  1BOS A;  4XQJ A;  5LL6 X;  2TSS A;  1WTO A;  1EOT A;  1I3Q B;  3DWP A;  3NTH A;  4PNY A;  2L55 A;  1CI3 M;  1HUN A;  2NVT B;  2LS0 1;  3JAM E;  1U4R A;  1VDZ A;  3IL8 A;  4IQZ A;  3QWN A;  1QE6 A;  5I9P A;  2AQ2 B;  1A3V A;  4TQU S;  2KEC A;  2KCC A;  1SSO A;  1W6K A;  2RDG A;  5HGT A;  1HTL D;  4ZUJ A;  1PTO C;  3DWQ A;  3L9A X;  3L3O C;  4B9W A;  2G9H D;  3HG9 A;  4IUN A;  3R2T A;  2VUM B;  4S3S A;  1HPC A;  1IYV A;  1R4Q B;  2A73 B;  1OO9 B;  3NK9 A;  2XVS A;  3CU7 A;  3H91 A;  3HKZ B;  1DON A;  1RF2 D;  5D14 A;  2K32 A;  2TMP A;  3OPO A;  2X6L A;  3G6J B;  3NXW A;  3P75 A;  1LT4 D;  1CTM A;  3OWE B;  1DM0 B;  3D6C A;  3KUP A;  1PTO B;  4CJ1 B;  2F0T A;  2NVQ B;  3PUV A;  1SEB D;  1JWS D;  3EFX D;  1EYC A;  1GUN A;  1STA A;  4FYD A;  3RUZ A;  5KRU A;  4BWG B;  1QWY A;  3OOC A;  4CHT B;  4DXG A;  3IKJ A;  1TVX A;  2A68 D;  3E5S A;  1B9M A;  2AWN A;  3EVQ A;  1Y69 U;  1ESF A;  1EU4 A;  2KJX A;  5BN3 A;  1A2U A;  1KNA A;  4JK1 C;  4RAU C;  1SNM A;  2WKD A;  1WCM B;  1FYC A;  3P20 A;  1HUM A;  4H7B A;  3DEP A;  3U9O A;  3I8Z A;  5COR A;  1K8O A;  4A3B B;  1JWM D;  4ZAI A;  3TBI B;  5CV6 A;  1BBX C;  3PV0 A;  3C3L A;  1MD2 D;  4A3I B;  4F8M A;  2BCO A;  1I4P A;  2FMM A;  4CKC A;  1AEX A;  2PMZ B;  4IUR A;  2M2L A;  1R4P B;  1XWE A;  1JOK A;  5C0X G;  2F0G A;  2EYJ A;  4FF4 A;  3SE0 A;  2PYK A;  2XNA C;  2EYP A;  1D5M C;  2KHS A;  2YU9 B;  3OSO A;  2KOL A;  2RA4 A;  4WFN 3;  3H3V C;  1B44 D;  4HMI A;  4XT1 B;  5G3L F;  2LMC B;  3HEJ A;  2E74 C;  3FMC A;  3GV3 A;  1C48 A;  2BA0 A;  3A8K E;  1CT1 D;  1LTS D;  5EPL A;  4KMU C;  3TP6 A;  2A6E C;  5E3F A;  4KKS A;  2RQX A;  4P2C B;  2PNR C;  3M85 A;  3BYT B;  5COY A;  1PMR A;  4RCN A;  1A3U A;  1I6V C;  1V43 A;  1KAA A;  4G7Z C;  1GUS A;  3KLR A;  1LT6 D;  1QNK A;  1EWH A;  5C4H A;  1I4X A;  4XQQ A;  1E2V A;  1VF5 C;  5J22 A;  5IOC A;  5C3X A;  1JOR A;  3BVZ A;  3RD4 A;  3E6Z X;  3U9S A;  1S5E D;  1DCZ A;  3KLS X;  1LO5 D;  5J39 A;  1AN8 A;  1TY2 A;  4QUC A;  4K8I A;  1Q1B A;  3H0G B;  4BY7 B;  1CK1 A;  1IHZ A;  4UAI A;  5EKL A;  2EYF A;  1STN A;  1PLF A;  1RD9 D;  4HAE A;  1YNJ D;  1YNN C;  2PQE A;  4C3I G;  1T5E A;  2L0C A;  1R9T B;  4FF1 A;  1S5F D;  1SJE D;  1O7L A;  1PRT D;  1BR9 A;  1C4Q A;  2EDG A;  2IW3 A;  1UEA B;  2JA5 B;  3TZU A;  4R9W A;  4RFB A;  3LWE A;  4YIJ A;  2B2W C;  2F3V A;  2HDL A;  2EY6 A;  3ZYY X;  2Q8I B;  3HOZ B;  3DXJ C;  4KN7 C;  2DY7 A;  3VR6 A;  1GJX A;  1NAP A;  3GTM B;  4LMQ D;  1S5D D;  2EXZ A;  3TME A;  2D5D A;  4KTA A;  1SFO B;  5IIF A;  2EPB A;  3MXN A;  4KKT A;  4ZKC B;  3J80 L;  5I2X A;  2L4N A;  1EEI D;  2IPK D;  2R92 B;  2NUC A;  1W6J A;  3E0J A;  2Q8R E;  1AFP A;  4C3H G;  5IOD A;  4NP5 A;  3VR2 A;  5EBC A;  5FLX E;  3MHB A;  4HR7 B;  2IWH A;  1B53 A;  3VR5 A;  3HZX A;  5A2Q E;  4DAV A;  3K58 A;  4CKE A;  4IN3 A;  2A69 C;  3J80 E;  2WKC A;  4H13 C;  1TS3 A;  4DN4 M;  5KND A;  1GHJ A;  2NWG A;  3I4N B;  2SOB A;  4QF4 A;  4QUF A;  5KNB A;  5FO8 B;  4MIU A;  2J4X A;  1B2T A;  4DF7 A;  1X32 A;  1RJT A;  5M9O A;  3FEW X;  1LTG D;  1TII D;  4K5V A;  5IGB A;  1Y1V B;  2CW0 D;  5CV7 A;  5KNC A;  3HOU B;  4RKB A;  3SK8 A;  1HRJ A;  1FNV A;  1ILQ A;  2LFN A;  4CKB A;  1KDC A;  4BA1 I;  5CV8 A;  1BCP D;  2A74 C;  3NUC A;  4F88 A;  2DNE A;  2F0O A;  1CA5 A;  5ELF A;  1SMY C;  4DGZ A;  3GTL B;  1LTB D;  1TWA B;  1KDA A;  1F77 A;  1ENA A;  2XRQ D;  1SYG A;  2AUJ D;  4B08 A;  2F0U A;  2FMC A;  4OHJ A;  1H9S B;  2M00 A;  2XN9 C;  3RLF A;  4NW2 A;  5I4D A;  4H44 C;  2N88 A;  2SNS A;  3J7A F;  3FRP B;  3PO2 B;  1PYW D;  2NTS A;  2IX3 A;  3V2T A;  1Z6H A;  4C1N K;  1EWC A;  4ZK9 B;  1RTO A;  2L5T A;  1L0Y B;  4RHR A;  3D4R A;  2PW7 A;  2EYO A;  4O1N A;  1ML0 D;  4Z9C B;  4MN3 A;  4LAA A;  2HUG A;  1SJH D;  5I6W A;  4FXK C;  2WP8 J;  2PZW A;  4PMW A;  5KGU A;  4KN4 C;  5CV4 A;  3V05 A;  4ABN A;  3BVG A;  1BQQ T;  3K5M A;  2NVX B;  3I4L A;  2KA7 A;  1O80 A;  4RHS A;  1GUW A;  2FFK B;  1NCV A;  1STE A;  5T1G A;  4PMB A;  3O13 A;  4XYQ A;  1LTA D;  1UAP A;  1Y8O B;  4K14 A;  5C3E B;  4OIK A;  2B2T C;  4CBV A;  1U4P A;  2SNM A;  5J1Z A;  1WTQ A;  2K7V A;  2EY1 A;  3TP5 A;  1Y1W B;  1ILP A;  1SYB A;  1V8Q A;  4C3J G;  1D2B A;  2E2D C;  2F0I A;  4IUQ A;  3I73 A;  4X3K A;  5CR3 A;  1IW7 D;  1STY A;  2F0Q A;  4RH6 A;  1TT2 A;  2JYO A;  4F87 A;  1SNC A;  3MWY W;  4NDX A;  2O5I C;  2JA8 B;  2JEA I;  2KVM A;  1KNE A;  3M7G A;  1PZI D;  4ZYS A;  3JAM L;  3D4D A;  3R93 A;  3GD7 A;  1CHP D;  2BDN A;  2E75 C;  1JOQ A;  5D3D A;  2K01 A;  2FJ2 A;  2JEB I;  5JVH 3;  3K5O A;  2JE6 I;  2OF1 A;  2HQE A;  5D3I B;  2WAQ B;  1H9K A;  4K2L A;  3S9W A;  5LL6 S;  5E4X A;  1EIH A;  1EQV A;  3SEB A;  2PZU A;  2H4O A;  1VMC A;  1ENF A;  2A68 C;  3RMH A;  2F0J A;  4NMZ A;  3SDZ A;  3GTG B;  3S1R B;  3HP3 A;  3OIP A;  4FO2 A;  1TWC B;  3QJY A;  2F3W A;  1PTO H;  1S4Z A;  4E6I A;  2XRS D;  2EYL A;  1F9R A;  5C3W A;  2JP1 A;  4G4K A;  1KLG D;  4I7Z C;  5EKK A;  1GXD C;  2DY8 A;  1EY9 A;  1BO0 A;  2J0T D;  4KD3 A;  3VYS A;  3W3A A;  2R93 B;  1LLR D;  1V1O A;  1BXT A;  1EQT A;  2MPM A;  3SVM A;  2F0W A;  1AZQ A;  1DJR D;  5DEH A;  3HOW B;  3BDO A;  3SHL A;  2IX1 A;  1F9P A;  2X69 A;  3NQT A;  3KLS A;  3HOY B;  3BYY B;  1KLU D;  2O2L D;  5AFW A;  1OXS C;  3Q23 A;  2I07 B;  5I9O A;  1SAP A;  1D6E C;  1AW7 A;  3SK5 A;  1SYF A;  1PZJ D;  4HTH A;  1O7Y A;  2OXP A;  2MUY A;  1D5X C;  5IT9 L;  4HMJ A;  2B2V C;  1SNO A;  1ZKO A;  3MEH A;  1TWG B;  3MXP A;  4A3D B;  1QNU A;  3EQL C;  1PTO D;  2A6H C;  1LTR D;  2RBM A;  4ILW A;  1I4H A;  3S14 B;  1J8I A;  1IKM A;  2DNC A;  2AQ3 B;  1CZG A;  3GTO B;  2MP1 A;  4NKL A;  2JA7 B;  3I4M B;  4C56 C;  4FXG C;  5IT9 E;  1JR0 D;  4A3M B;  1F9S A;  1V1P B;  2OEO A;  3J7Y W;  5D65 A;  3CRK C;  2Z8L A;  5EGT A;  1DOK A;  5DM6 3;  2D62 A;  5C4X B;  1EEF D;  1STH A;  3NWS A;  1A3T A;  3KK7 A;  4J1M A;  3EA6 A;  2JSO A;  4A93 B;  4G57 A;  1QG7 A;  4XDX A;  1I6H B;  1ET9 A;  1QJO A;  1HCZ A;  3NBH A;  1FD7 D;  1ICW A;  3H94 A;  1FGB D;  5IGG A;  4A3E B;  2QF7 A;  4DA2 A;  1C8C A;  5I6Y A;  2F0P A;  2LY7 A;  1WD1 A;  1PRT C;  5A35 A;  3T16 A;  1I4R A;  3PUW A;  5CBE E;  3C1F A;  4DAP A;  5KEE A;  4N9T A;  3A7L A;  1OXX K;  4M1U B;  1PFN A;  1GHK A;  4IFD I;  2B2T A;  2BE5 C;  4PV1 C;  2ENB A;  4DK1 A;  2ZXR A;  3PIP 3;  3QIA A;  3TP8 A;  3A56 A;  5JPM C;  5BN4 A;  2B2Y C;  4FNF A;  2MGS A;  1LTT D;  1FNW A;  4HCE A;  2F0L A;  1NUC A;  1TWH B;  4OIJ A;  1PRT B;  4QCL A;  1O78 A;  1QOH A;  1TS4 A;  3MFG A;  4OL7 A;  3MXU A;  3DWA A;  5ELC A;  2B2U A;  1AP0 A;  2KQ3 A;  1I4Q A;  4XYO A;  2F4I A;  1XX8 A;  1HQR D;  3C1E A;  3NTI A;  4U68 A;  2A5H A;  2EY5 A;  1H9R A;  3M3Y B;  2B8G A;  2E2J B;  1MSH A;  3Q24 A;  1STB A;  1GUO A;  3I91 A;  4HED A;  1GUG A;  1OXT A;  3VR3 A;  2QCP X;  3K57 A;  4BBS B;  3D8G A;  1PRT F;  1D1I A;  4IUU A;  3NE5 B;  5FLX L;  1ZYR C;  1OXV A;  2Z4H A;  4C2M B;  4UDU C;  2A6E D;  1WTR A;  4A3J B;  3S17 B;  4ZRZ A;  3J81 E;  4WJW A;  1Z47 A;  5A2Q L;  2IJ0 A;  1U4M A;  3MC0 B;  2O4X A;  5CC4 A;  1QCB D;  3AU7 A;  5KYL A;  2NYZ D;  2CQA A;  2NN6 H;  2F03 A;  1B1Z A;  4RA8 A;  3M4Y A;  4KKU A;  4A3K B;  5EQ0 A;  3QOL A;  1BCP C;  3BDC A;  1L0X B;  3MZ5 A;  1YNN D;  2KUM A;  1PXU A;  4ZQ3 A;  1CM9 A;  2H1E A;  3X3N A;  3I70 A;  4OO1 I;  3F2U A;  4Q0F A;  2ID0 A;  4WRD A;  1A6X A;  1FR3 A;  3X3M A;  1G6Z A;  1BCP B;  1K8M A;  2JXM B;  2L1B A;  4KY5 A;  5FOB B;  4CGY B;  5C4J B;  2WB1 B;  3I3C A;  4FXD A;  1J9O A;  2B2V A;  3N6R A;  3S16 B;  3K7A B;  3T53 B;  1M8A A;  4K5W A;  3K5L A;  2K5Q A;  3ND8 A;  1CHQ D;  1EY8 A;  3BDL A;  4Y7N B;  4KHV A;  4DFA A;  1PFM A;  5JOB A;  2XWJ B;  1SXT A;  3S2H B;  4IFD J;  5ELB A;  1TS5 A;  1WD0 A;  4HN7 A;  3V96 A;  1BCP F;  1G91 A;  1ZXT A;  1AZP A;  3TSS A;  4B9X A;  3K5N A;  3QG1 A;  3HOX B;  5C5M A;  2IT1 A;  2EOT A;  3G7L A;  4MHE A;  2F0V A;  4DK0 A;  1DD2 A;  3FVQ A;  2F0D A;  2I46 A;  2A69 D;  2R3Z A;  4EQO A;  2WIN B;  4KJN A;  1IL8 A;  3SR1 A;  3AMU A;  1ONL A;  1WTW A;  3UI2 A;  1WTP A;  3WOF A;  4XT3 B;  1ENC A;  2RKS A;  1Q8I A;  2L11 A;  1PZK D;  1GOZ A;  2QIL A;  3BVM A;  2PPB C;  2MJ8 A;  3NPP A;  4WOR A;  4IFD H;  4ZUI A;  1EZ8 A;  4G7O C;  2KEE A;  1TY0 A;  1ZEQ X;  4X3S A;  1WTX A;  2K33 A;  4XTC S;  3QO2 A;  5JVG 3;  3OHX C;  3VR4 A;  4K6L A;  1U9R A;  4FVM A;  1CA6 A;  4ZKB B;  4KD4 A;  1Y8N B;  3L7Z C;  2ZT9 C;  1MSG A;  4EQN A;  3S15 B;  4IUT A;  2M9V A;  1SMY D;  3DMU A;  2RDH A;  1HA5 A;  2AUK A;  2B2Y A;  3GTJ B;  5M5Y B;  1EL0 A;  4RGT A;  2AWO A;  1NSN S;  3T13 A;  4FF2 A;  3ND9 A;  1DYQ A;  1G8Z D;  1A15 A;  4RWS C;  2L12 A;  2C9O A;  2DN8 A;  1A2T A;  2WAC A;  3W2D A;  3FPU B;  1PFB A;  3A54 A;  1BDO A;  3TN2 A;  4KV6 A;  4Q5V A;  3I72 A;  4U67 3;  2D2C C;  2B2W A;  1TR5 A;  1JOO A;  2B63 B;  2EY2 A;  1EYD A;  3GP7 A;  1E0B A;  4C3I B;  4RCO A;  2EJF C;  3TZD A;  4JBW A;  1Z7T A;  2ICE C;  1IKL A;  1EYA A;  4KJO A;  3RZO B;  3QOJ A;  3GV6 A;  5IGE A;  3Q6S A;  1G29 1;  4GZY C;  3TDQ A;  3S1Q B;  5C44 B;  2K5W A;  3FKI B;  5K36 G;  1XXG A;  4KI0 A;  5EPJ A;  2XIW A;  4RGN A;  1QIL A;  1U4L A;  3SK4 A;  1EU3 A;  4ID6 A;  2O5J C;  3EJI A;  4HSV A;  3CRL C;  5E1F A;  1HFN A;  4OO1 H;  3P7J A;  1RHP A;  2Q8T A;  2NN6 G;  3A8J E;  2SDF A;  2KCN A;  3PUY A;  1JQY D;  2NN6 I;  4PMC A;  5CGK A;  4BS9 A;  5FK9 C;  5M3M B;  3DM1 A;  3I90 A;  4V0B A;  3IFT A;  4RGO S;  3TP7 A;  2IX0 A;  1SYC A;  4IUV A;  2G9D A;  4C3H B;  1JB3 A;  4K6D A;  1VF7 A;  3HOV B;  4DNT B;  2LKV A;  4L6T B;  5NUC A;  4DNR B;  2EJG C;  3NSW A;  2VB3 X;  4QB4 A;  3T51 B;  1TQO A;  1SDF A;  1SYD A;  1EY5 A;  1KDB A;  2PZT A;  1H9S A;  5I2Y A;  1OXU A;  2VXW A;  1JIC A;  3VA5 A;  5CV5 A;  4RKL A;  3GQB A;  2BA1 A;  1D1K A;  5JEA J;  3J7A V;  1Q12 A;  1E2W A;  4HSP A;  2WII B;  2F0M A;  1LT5 D;  2F0E A;  3T4A C;  1II3 A;  2K6A A;  2PW5 A;  4K8J A;  2YYZ A;  2K1B A;  5DAU A;  1HFG A;  3KBX A;  1HQM C;  4X3T A;  4M8A A;  1H9M A;  3OIQ A;  4DAY A;  3HRZ C;  2HCI A;  4A3F B;  1PTO F;  4ODG A;  3VYR A;  5EJW A;  1LV9 A;  4I65 A;  3CQZ B;  3K6O A;  2NVY B;  3MXG A;  2F0F A;  3ITP A;  3NQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...