1NR2A

High resolution crystal structures of thymus and activation-regulated chemokine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
RECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of thymus and activation-regulated chemokine (TARC).
pubmed doi rcsb
molecule tags Cytokine
molecule keywords Thymus and activation-regulated chemokine
total genus 13
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1nr2A00
2X6LA 4IUPA 4MHEA 2B2VC 1F9PA 3I3CA 3GV3A 2K28A 3D6WA 2FHTA 1B3AA 2L9HA 2HDMA 2DY8A 1IL8A 1EL0A 5CBAE 4CJ1B 1E0BA 2HDLA 4R9WA 3DEPA 1ZXTA 4X3SA 1HHVA 1WTRA 1G6ZA 3I91A 3MTSA 1BF4A 1TVXA 2L4NA 2FINB 1KNAA 1AZQA 2KECA 2NYZD 2Q8RE 4RWSC 1U4MA 2EPBA 4X3UA 2JYOA 2K01A 4IUUA 1JICA 2B2TA 5COYA 5D14A 1DZ1A 1WTXA 2BDNA 3GV6A 4UAIA 5EJWA 5EPKA 1MSHA 1PDQA 3LWEA 4XT3B 1U4RA 3SVMA 1BO0A 1B2TA 4LMQD 5DNFA 4RAUC 4NW2A 1PFMA 1RODA 1HRJA 5CORA 1O7YA 1GUWA 2XIWA 4XDXA 2MJ8A 1QNKA 1F9QA 4IUTA 1C8CA 1HUNA 1VMCA 1RTNA 1HFGA 1EIGA 2CVRA 2FJ2A 3N52A 4HEDA 1A15A 4R8IA 2R3ZA 4IURA 2RA4A 2KUMA 2B2UA 1SSOA 2FFKB 1PFNA 3I90A 1VMPA 4ZK9B 3KUPA 1F9SA 4CJ2C 5CBEE 2K04A 2NZ1D 1U4LA 1X3PA 2B2YA 1NR2A 2K05A 1ML0D 2L11A 2B2YC 2MPMA 4QUCA 1IKMA 1DOKA 2L1BA 4RA8A 2Q8TA 1O80A 2B2TC 1XX8A 1HFNA 4HSVA 1JE4A 2RVLA 2B2UC 5EPJA 4U68A 1MSGA 1ICWA 5EQ0A 1EOTA 1NAPA 2HCIA 3FPUB 4QUFA 2B2VA 3TZDA 1CA5A 1ESRA 2KVMA 5AFWA 5T1IA 1WTVA 5D65A 4ZKCB 2K03A 2L12A 1G2SA 1F2LA 2EOTA 1WVLA 1J8IA 2X69A 1ILPA 1RTOA 1B53A 1SDFA 1G91A 3FDTA 4HAEA 1QE6A 4ZLTF 1M8AA 1NR4A 1MGSA 2H1EA 2HCCA 2NWGA 5T1GA 1AP0A 1U4PA 3QO2A 4X3KA 3Q6SA 3R93A 4CJ0B 1EIHA 1B4OA 2EE1A 3H91A 3F2UA 1O7ZA 2N88A 2JP1A 3ONAB 5E4WC 2VXWA 4O42A 4MN3A 2HUGA 1WTPA 2RSOA 1B50A 1DONA 1HUMA 2KEEA 2FMMA 4IUQA 1G2TA 1WD1A 1ILQA 5E4XA 1WTQA 1F9RA 1PFBA 3HP3A 3IL8A 2B2WA 2RSNA 3G7LA 5CMDA 1KNEA 1BNZA 1X32A 4ZKBB 1DOLA 2X6GA 3KBXA 3DEOA 4HCSA 1RJTA 2D9UA 1CA6A 3P7JA 2MP1A 1DOMA 2N55A 4IUVA 4ZAIA 1MI2A 4X3TA 1WD0A 1S4ZA 1J9OA 2IL8A 5EPLA 2SDFA 1CM9A 4OIKA 5JJZA 1HA6A 3MWYW 1LV9A 2MGSA 1QG7A 3IFDA 4XT1B 5EKIA 2B2WC 2KOLA 1NCVA 1RHPA 1SAPA 1AZPA 1EQTA 1IKLA 2M2LA 1PLFA 3UI2A 4DN4M 3DM1A 1XYIA 2J7ZA 3TN2A 1WTOA 2KEDA 1WTWA 4OIJA 1X3QA 3I8ZA 1Q3LA 2K1BA 1BBXC 2DY7A
chains in the Genus database with same CATH superfamily
1I6VC 4IUPA 1NUCA 4RCOA 1ET9A 1D6EC 3T1YL 2YYZA 3WOEA 2VL6A 2A68D 5CV5A 1N33L 1I4RA 3NP8A 1GXDC 3PIPA 1D1KA 2NVQB 4LFBQ 2Y0SB 4DNTB 1I50H 4LF9Q 3P1HA 1U4MA 5DM63 4DV7Q 1D5MC 1JR0D 3T1HL 4AQYQ 1CSPA 2PZTA 3Q24A 2Z8LA 5HGQA 2PMZB 3U9SA 1DJRD 1Y1VB 1QNKA 4IPCA 3GTKB 1N8RC 4RH6A 4NMZA 1YJNA 2FJ2A 5KYLA 2OTLA 4X64Q 1W2BA 1VMPA 1STGA 3CMEA 1PH7A 2IWHA 4A3EB 2F3IA 3A7LA 2F0NA 1WCMB 1JWMD 1YBYA 3LNNA 3U9OA 3HOUH 2QEJC 3MHBA 1JB7A 3RZDH 2B2VA 2D62A 1XTDA 2PQAA 2QDLA 3HOYB 2XNAC 4KN4C 2GVBA 5M5XH 4PMCA 5A35A 3MFGA 5C4XG 4GLVB 2NZOA 2IX1A 3PO3G 5GQOA 2F0JA 3K5LA 2E2JB 2H1EA 2HCCA 2E5LQ 4X3KA 3R93A 1N36L 3D4DA 4ME3A 3CCJA 1BBWA 1EWIA 1BCPD 5E4WC 1YNXA 2KJXA 2F4IA 3RLNA 3D4WA 4BXXH 1KRSA 3QIAA 3VR3A 4DUZL 2D2CC 5M5YB 3TQYA 5CMDA 1SJED 1XMOL 4OEMB 2N55A 2R92B 2F0OA 3NBIA 3EROA 3HOWH 4A3GB 1BKBA 1QVFA 5JJZA 2B63H 2NVXB 3KOJA 1EY0A 1HPCA 5EKIA 1CK1A 2F52A 4A3FG 4UPAA 4L6TB 5J1ZA 2E5LL 2JSOA 2KBNA 2NZHA 3IKJA 4BBRH 1B3QA 4RHSA 1EY5A 1GHJA 1B7YB 2PZWA 2ICIA 2D5DA 3UDIA 4A3JG 4IFDI 1Y8NB 3MXGA 1DXMA 5C5MA 3JAMc 4A93H 4A3DB 3GTMB 3SDZA 2TMPA 4DUZQ 1EY8A 1OXVA 4O2DA 1HNWL 2B63G 1XNQQ 1XNRQ 3PUZA 3FKIH 2B39A 4P72A 3GTPH 2F0TA 4X66Q 1EY4A 1YHAA 2K01A 5COYA 3O13A 4TKOB 1HQRD 1GUNA 2MO1A 4ULLA 4JI1L 2K5QA 2AWOA 3ER0A 3SK5A 2GVAA 3KF6A 2F1MA 3GTJB 3H6MA 3GQBA 2PMZE 1I4XA 1VF5C 3W5OA 2BA1A 4IPDA 4BA1I 3M85A 1B8AA 2JA7H 5CBEE 4QF4A 1IKMA 3PO3H 1QCBD 4DR6Q 4WJ4A 4LJZC 5IOCA 2IJ0A 1PH4A 2Q2IA 1HCZA 2K03A 3S1RB 4QIWB 1WVLA 4A3IG 4DV1L 2QCPX 1K28A 1RTOA 1KC8C 3BDLA 3K5OA 3UE0A 3VR4A 1LTLA 3K80C 3S16B 1MGSA 5T1GA 4NXMQ 4DV0L 2EXZA 3RLFA 1U5KA 1L0YB 1EWHA 2UUCL 4QL5A 1Z7TA 4A3EG 1PZKD 4KY6A 2FXQA 1A8VA 1JJCB 4LF6Q 4A3LG 3CCVA 3ERSX 1YJWA 2V1CC 4DR7L 4QGUA 1QVGA 2A6HD 2B2WA 4DR5Q 4DAYA 4F87A 1PRTD 3OSOA 2A69D 1Q1BA 1B70B 1DOMA 5IP7G 4ZAIA 4DR2Q 1GUTA 3HKZB 4CBVA 5LL6S 1UE1A 1H95A 3IFDA 3GP7A 4RMFA 3L0OA 5A2QL 1E22A 1IBKQ 3C1FA 3KDFA 3T13A 4C3HG 3NQIA 2H4OA 2AWNA 1IYUA 2KEDA 3K81C 1VQLA 2A8VA 1II3A 5I6WA 3A8IE 5JPNC 1IW7C 2JXMB 2A69C 3HOUB 3NWSA 3GV3A 2Q8IB 1Q82C 4B3RL 3A8JE 4P74A 3NENA 2K5DA 4BS9A 3S1MH 4YCWA 5IYCG 5K36G 3DEPA 3K7UC 3FP9A 4DGZA 1A62A 1YITA 3H15A 2YV5A 3T4AC 2F0EA 1YNNC 3DWAA 4A3MB 3CRKC 2EY1A 3A5ZB 4A3KH 3QB3A 4MTKA 5GAHC 1NTGA 4DXFA 4HIDA 4N8X1 2QA4A 3NBHB 1UNSA 1TWHB 2CVRA 3G4SA 3AB9A 3CD6A 2FFKB 2F0WA 4ZK9B 2AQ2B 4X65Q 1VS0A 2NZ1D 1X3PA 1CHPD 1SFOB 3OIQA 4DAPA 1PH6A 4X62L 3AQQA 4LF7Q 1BUVT 5KRUA 2ZXPA 4RA8A 4ZRZA 5EKLA 4LFBL 1PZID 4HSVA 2ES2A 1IBML 2EJGC 3OYYA 4H02A 3KF8B 5EBDA 5TSSA 5ELOA 4MIUA 3SHLA 5D65A 3MC0B 4E6IA 2EYJA 2JA6B 2R7ZB 4KLKA 1G91A 3S1NB 4C3HB 1BR9A 1LT4D 2D0PA 2EDGA 4F8MA 3I2ZA 1XMQL 2F4VQ 3FHWA 4FYDA 1VQ5A 4FF2A 5IP9H 1DONA 2KEEA 1TKWB 2IY5B 3D31A 5C4XH 2CFMA 3HP3A 1BNZA 3F2BA 4A75A 4ZKBB 4A3CH 1EZ8A 1RJTA 4DAVA 4HMJA 4HMIA 3NELA 4AYBE 3KK7A 2DN8A 1LV9A 1TWFB 1SYDA 4QMGA 4B3TL 4LUVA 3MAQA 1DCZA 1O7LA 1WJJA 4R4TA 5FLMH 1YEZA 2K1BA 3LX0A 2DY7A 1MBYA 2LXKA 2X6LA 2A74C 4MHEA 2B8GA 4C1NI 4JV5L 3T53B 1HNZQ 1I3QH 5IGBA 2EY2A 3Q0AA 1CI3M 3SE0A 2F0VA 3N6RA 3RD4A 1C48A 3OTOQ 2IHEA 4X3SA 1JC7A 2KHJA 3OWEB 4DFAA 4LF8Q 4NXNQ 3PO2G 1IYJB 3FMCA 4DR1Q 4A3CG 1PYSB 1JOQA 4IN3A 1QUQB 4J1MA 4IFDG 4LMQD 3BJUA 5M3FG 2WB1B 1WYDA 4MTNA 1VQ7A 2F0UA 3R2TA 4AQYL 3X3MA 3BS1A 1VMCA 2WKDA 1CKOA 2ZXOA 4DK3C 4C3IB 5FLMG 1KIXA 1UE6A 3S2DB 4FF3A 1P8LA 3H3VI 4Q0FA 2B2UC 2VS1A 5IP7H 5IGDA 4X66L 2EY5A 3SK4A 1KABA 1CHQD 3SXHA 4PV1C 1Q86C 2JA5B 2HHHQ 1A3UA 1WTVA 4ZKCB 2EXDA 2Q2UA 3H3VH 1J8IA 2KCCA 1E2WA 1R9TH 1TWCH 5ELFA 1LM0A 2TSSA 2DNEA 4GKJL 2R92H 2N49A 2NTTA 2QW7A 1V1QA 1EIHA 4C56C 5C4JH 3F2UA 1S40A 3OW7A 4DR4Q 4A3BG 4L5TA 3U4VA 3E9HA 1Z47A 2UU9Q 2PQAB 3PF4A 4F88A 1I4GA 5E4XA 4A3IH 3NUCA 2ALYB 3M4YA 5C0XH 1H9KA 1HR0W 3IL8A 2WAQE 5JOBA 4KTAA 1D5ZC 3SGIA 4HJ5A 4A3DH 2D9UA 3GTGH 3URYA 2Z4IA 4B3MQ 1FYCA 4XQJA 4KI0A 3CCSA 4B08A 2IX0A 1IKLA 2M2LA 1LT3D 1I4HA 2K52A 4ZYSA 3L9AX 2VB3X 3TS2A 5C3EH 5IGFA 3MVVA 3BVGA 1VQIA 2F0KA 3NXWA 4YWMA 1Q8IA 4YWLA 2KENA 4GKKL 2R7ZG 3X3NA 4CDCC 1PTOF 4FP5D 3GTQB 2JA8G 1HJPA 2LXJA 2RCFA 4IOCA 4JV5Q 4L5RC 3HOYG 3K5NA 1LTAD 3UDGA 1YHQA 1AZQA 1VQ6A 2QILA 1FD7D 1PYWD 1LACA 1PDQA 3I4LA 4XT3B 3OIPA 2E2JH 1JE5A 4BWGB 2F03A 4BY7G 2O5IC 2VY3A 1VQPA 2DJGC 4JI6L 3GTOB 4XDXA 1PVOA 1I94Q 1X54A 3TP7A 1TWAB 3N52A 1FJGL 5E1FA 1R4PB 3U50C 3FRPB 2A6ED 4I7ZC 2GN5A 4HIOA 3RMHA 3A56A 5D3IB 1M1KC 1EEFD 1LTID 5M3MB 1XTCD 1RL2A 2O5JC 1WCMH 5ELBA 2VQFL 3CF5A 3BDOA 2RVLA 1VQAA 3C3LA 5IGEA 3Q22A 3F2DA 2KHSA 4QB4A 1SYFA 3MZ5A 4RCNA 4C3JG 1KRTA 2IX3A 4BXXG 2AHOB 1SNPA 2F3VA 3DMUA 4HAEA 4OONA 3VDYA 2NVTH 1EIYB 2UXDQ 3R8BA 2G9HD 3HKZE 3OPOA 3VR6A 4K6DA 3PUVA 1A2UA 1BQQT 3M4QA 4X65L 1YHBA 3KF8A 1G2TA 3NWTA 5LMNQ 1PFBA 4EQPA 1F2ZA 4BY7B 2BE5D 4J6HA 1U9RA 4G7HC 4O1NA 5I9PA 3MXNA 4YWKA 1EYCA 2JQOA 1FNWA 1S4ZA 2WINB 2SOBA 1ONLA 4IO9A 2MGSA 3I4OA 2B3GA 1LUZA 5IYDG 3CPFA 3ULPA 2JA7G 1N36Q 1WTOA 2EJMA 2PW7A 5C4HA 4AH6A 1IYVA 1SMYC 2B2VC 2QDBA 1ZKOA 4HR7B 4U673 4YIJA 1M4VA 5FO9B 2AMCB 1JJ2A 2R61A 2F3WA 1KTKA 3L7ZC 4GZYC 1GM5A 3SK8A 5GADC 5E3FA 3HZXA 4P2CB 1ET6A 5C3XA 4RGNA 3W1GA 2E2DC 4QY7A 5IP9G 5EPKA 1BCPF 5IGCA 5DNFA 3S16H 2LMCB 2K7VA 1TY0A 4Y7NH 2E2HH 3FEWX 4ILWA 3S17B 2J4XA 5DM73 4CHTB 1C8CA 1VQJA 4JBKA 1HNZL 2A19A 5IIFA 4NB3A 2KHIA 1F9SA 2PCFB 4QUCA 5FLXL 1J5EQ 2K4KA 1ML0D 3VYRA 4LF4Q 1N32Q 1X65A 4IJLA 2ZTCA 3R2IA 4DV0Q 1VQEA 3A54A 4JOIA 4C3HH 1L2FA 4JI8Q 3I73A 2F0LA 4QUFA 3S2DH 1EY6A 1PFSA 4DR4L 4JI5L 1IL2A 4BBRB 1HR0Q 4DXGA 2EYFA 2KQ3A 4RHRA 2VUMG 4OHJA 1EYGA 2Z6KC 1U4PA 3BZCA 4GS3A 4YY3Q 3T51B 4BY7H 3ND9A 5DLQE 5GROA 4O42A 1RD9D 3E9IA 3HFZB 1Y1WB 2DJFC 4KD4A 1IZ6A 1TY2A 1SNCA 4C2MH 4JI0Q 1ILQA 4WORA 1S72A 1SYCA 2MFIA 4PZ8A 3ERQA 4R4IA 4FXDA 5EKKA 4JI6Q 1JOOA 1JJGA 5C0XI 3J7AV 5EPLA 5C6AA 2SDFA 2OQ0A 4A3MG 4C3IG 1YJ9A 4A3JH 2R7ZH 4JI8L 4DF7A 1KDCA 1GJXA 4XIGS 4GOPA 2RCNA 2J7ZA 1FGBD 4GKJQ 2QEXA 3J81i 1OO9B 4GN5A 4O0AA 1BCPC 3H0GB 4V0BA 4KKTA 5DEHA 4RGMA 4HIMA 3RZOB 4FF4A 4WJWA 4UP7A 2K28A 3RN2A 2A6EC 3J80c 5LMNW 2XGTA 3OTOL 1JCKB 1XNRL 4WJ3M 1AW7A 4N9PA 4CDEC 1E0BA 2HDLA 3PO2H 2R93G 2L4NA 3AFQA 1N34L 5JJKA 3DM3A 1PH1A 3V96A 1G291 4X3UA 3NK9A 2R7DA 4AYBG 2YTXA 4HJ8A 1VQCA 2MO0A 3MXPA 4CDFC 1N32L 2Q2HA 5D3DA 5I4DA 1FR3A 1PFMA 1YNND 1HRJA 5JJLA 3T16A 3A0JA 3H0GG 3S1QH 1H9JA 1JMCA 1ASYA 4KY7A 4IQZA 2D0OA 1F2YA 2HIXA 4B3RQ 1LTGD 3TREA 3KUPA 4IZ8A 4CJ2C 3PSIA 1ZYRD 1NNXA 1KAAA 5FLXE 1KDAA 3TZDA 1QILA 5EQ0A 1L1OC 2IT1A 5GAEC 2ZJQA 1V9PA 1ENFA 5IT9E 1G2SA 3ITPA 4Z9CB 3HOZH 1GUGA 4A93B 2JA5H 2HT1A 2K33A 2K32A 2EYMA 4J15A 4RG1A 4FF1A 3GTGB 3S1NH 2F0FA 4RKLA 3AU7A 1O7ZA 1AE2A 3PUWA 4LFAL 2VUMB 1YNJD 4MNOA 3CCUA 2ZJRA 3AEVA 1WTHA 2ZTEA 1CZWA 2F0HA 4B3TQ 4R4QA 1Y1VG 1V8QA 2F0QA 3HEJA 1KNEA 4DUYL 2UUAL 4DR2L 1DOLA 4PG3A 3NEMA 4Y7NB 2E2HB 1GVPA 1XWEA 1SROA 4IUVA 3AFPA 1MI2A 2JEBI 1IBKL 2ZM6L 1HA6A 3MWYW 2EYLA 3I4MH 4TVAB 3CKIB 1KHIA 2F0DA 2I5LX 4LF4L 4P73A 2ID0A 1F2MA 3DUZA 2LY7A 1Y1WG 3D6WA 1D5XC 4R1JA 1YVCA 1EU4A 2HDMA 1IL8A 4QJFA 4N9TA 1C4QA 1VQNA 3QOLA 2WAQG 5IYDH 1LO5D 1OXUA 4N8FA 1BF4A 1KAWA 4POFA 3OMCA 1KNAA 2E2IB 3ND8A 3K7AH 2BDNA 4UAIA 5EJWA 3HOVG 3J7A5 2M00A 2WV6D 2M9VA 1QOHA 3EFXD 4KV6A 4DV3L 1O7YA 4IFDJ 1E1OA 2YTVA 1HFGA 3GTKH 3CAMA 2OXPA 4M8AA 5ELCA 5IT9c 3VYTA 2I07B 4HTHA 4EVOA 5C4ZA 1PH5A 4JVZA 1SSOA 5C3WA 1CQFA 5IT9L 1NY4A 1Q1EA 3BVZA 1B9NA 2K05A 2OTJA 3ULJA 4JI1Q 1CFMA 3K58A 1MSGA 2NVTB 2XWJB 3L2PA 2HCIA 2QGQA 1BOSA 4A3MH 1ESRA 4IPGA 1MKHA 3I55A 4JI2L 3LGJA 3S15H 3NTKA 1PTOH 3CC7A 4R4OA 4A3GH 3A7AB 3AYHB 5C0XG 1G8ZD 3TP8A 4K8IA 1GO3E 4IFDH 1N34Q 1STNA 2HHHL 3I4NG 4GOPC 2RHSB 3H94A 1PMRA 1E1TA 4C3JB 1BVSA 2JN4A 3D3RA 1F9RA 3D0FA 2NN6I 5FLXc 4XYOA 1JQYD 5EBCA 3J80E 5LMNL 3CU7A 5IWAL 3PGZA 1MJEA 1J9OA 3D8GA 4LUZA 4DU9A 4BY1H 2EZVA 2KCMA 5I9OA 1RHPA 1AZPA 1EQTA 5C5LA 2NTSA 2RF4A 4J8QA 4LW1A 4K8JA 1Q3LA 3BZDB 2OQKA 1TR5A 4DV1Q 1VQGA 4LFCL 3K7AB 1Z6HA 1Y14B 1X3FA 4POGA 3J81c 3U4ZA 3K0YA 1WI5A 2I0QA 2P5ZX 3FKIG 2L15A 3QOJA 3J81L 4LF6L 4LF8L 1Q7YC 1EY9A 3SVMA 1QZHA 4NW2A 1VQOA 1RODA 4OXPA 4RKBA 3QG1A 1EY7A 4EQNA 2QF7A 1ESFA 1VQ4A 4JI5Q 4EGVA 2AUKA 3I90A 1K8GA 2N78A 4NPSA 4ABNA 1LLRD 1K8OA 3TBIB 2R92G 2K04A 2JEAI 2MNAA 2B2YA 4CKCA 4APVA 2Q8TA 4NP5A 5M3MH 1AE3A 4H7BA 1PH2A 4GLAC 1HFNA 4U68A 5K5PA 1EOTA 1FNVA 1PRTC 1QB5D 2NBFA 5CGKA 4Y52H 1SNQA 2KA7A 1PA6A 2CQAA 2X69A 2HD3A 4NXML 5CV7A 4JI3Q 4I65A 1K83H 4DK0A 1I4QA 2JK8A 2PO4A 1SJHD 3MFYA 3PCOB 2PZUA 1D1IA 4PZ6A 1I50B 4WRDA 2MQHA 1CKNB 1HXYD 1S5FD 2NVYH 2CKZB 4OGQC 4G7ZC 4JK1C 1BDOA 3S14B 5IYCH 3KBXA 5K36H 1QNUA 3M4PA 1SRUA 5JVH3 1STYA 3MXUA 1XXGA 2Z0SA 2RDFA 1N33Q 5CV6A 5ISRA 5LHY1 4GLXA 1PH3A 2WKCA 1AFPA 1S5ED 2G9DA 3RLOA 1IBMQ 3H3VC 4GKKQ 1J6QA 2A5HA 3KBGA 3G71A 4B9XA 3RR5A 4A3FH 4JI7L 3S2HB 1TT2A 5CV8A 1QJOA 1SMYD 4XQNA 3L3OC 2Z6BA 2Z4HA 5FJ8H 2PYKA 1SYBA 4FNFA 1SN8A 4Q5VA 4ZQ3A 4C3IH 3M4OB 3S1MB 1HHVA 1GOZA 2F0IA 2E74C 2FINB 3CQZH 1UE5A 1JICA 3A74A 2O2LD 5CR3A 3JAME 2NVXH 1A2TA 1DM0B 2OWOA 2BE5C 1B2TA 1G6PA 5A2QE 1I94L 2RKSA 2PQEA 2XIWA 1GD7A 2C5CA 1KD1C 1UWVA 2ATWA 1NMFA 3TSSA 3G6JB 2R3ZA 4DR7Q 4GNXA 3STBC 1PFNA 1VQDA 3GO5A 5E7NA 4XYQA 4DR1L 2CH4W 5ELNA 1TS4A 3E3XA 1K8MA 1U4LA 3GTLH 4UY8C 1HTLD 1LTSD 2L1BA 5IY0A 5CYUA 1B1ZA 1X3GA 3GD7A 4TSSA 3IAYA 1JE4A 5JJIA 4EQOA 1Q8KA 2BH2A 1BXTA 1V43A 4R8NA 2KVMA 3HOVB 1JWSD 4GN3B 5ELEA 4JCVE 1ILPA 1B53A 4KJOA 2DUDA 3JAMi 5AJ3Q 2JJQA 2N3SA 2RDGA 1QE6A 3KJPA 1DGSA 3I72A 1STBA 5C44H 4H44C 5I6YA 1TWCB 3S15B 3E5SA 1EZ6A 3OOCA 2WACA 3I4NH 5FO7B 4KD3A 2RSOA 2K5NA 1PH8A 2XTIA 3H0GH 3JAML 3Q8DA 1SYEA 4XTCS 4DV7L 3TP6A 1VQFA 1PTOC 5M3FB 1S3OA 3DEOA 3LWUA 1OXSC 1EIFA 4X3TA 1Q90A 1SNDA 5M3MG 4JYAQ 4DUYQ 2UUAQ 2YU9H 1Y69U 3J7ZC 3BVMA 4LNQA 2JA6H 5FJ8G 3Q23A 1E2ZA 1TS2A 3I8ZA 3J7YW 1BBXC 1GUOA 1VQHA 5FO8B 3G48A 4GN4B 4IUNA 4UP9A 5JVG3 4LK1C 2FHTA 3RZOH 1HA5A 1A0IA 3A55A 1NMGA 3R3OA 4C1NK 4JBWA 2UUCQ 2CQOA 2VQFQ 2ZT9C 4GNXB 3TDQA 2KECA 2Q8RE 1TWAH 3W3AA 3S1RH 4IUUA 3HS0C 4CDDC 1VQBA 4OWXB 2LSSA 3VR5A 2LKVA 3PIO3 2Z9HA 3TP5A 3DWQA 1YIJA 2A68C 1D2BA 2EJFC 4FO2A 1FL0A 1IHZA 1IBLL 5C44G 4DV3Q 1LTBD 4HEDA 1EIGA 1TWGB 5M5XB 1SEBD 3I56A 4IURA 2RA4A 2Y0SE 3HOZG 2SNSA 1CT1D 3QWNA 1F77A 1NR2A 3ZYYX 2K5WA 2L11A 2MPMA 4AYBB 1RCVD 2CHBD 1VQKA 1DYQA 2ENBA 1UE7A 1XX8A 2Y0SG 1X6OA 1EUJA 5EPJA 3W1BA 1XJVA 2JA6G 4V190 1K3RA 1OXXK 4YCVA 3M3YB 1Z9FA 1W3SA 5LMUQ 4H0LC 1TWHH 4F7XA 4HSPA 5L37A 1EQQA 1NR4A 2EYPA 3CRLC 1KQSA 3Q6SA 4UHVA 4UP8A 2EE1A 5EGTA 3H91A 4K5XA 1FGUA 3PIOA 2N88A 2JP1A 4KHVA 5M3FH 1YZ6A 3GTLB 1WFQA 2HQEA 2VXWA 1D7QA 4IOAA 4B9WA 3ULLA 4CKBA 1WTQA 3I70A 4QCLA 4L5QA 3TRZA 2ICEC 3WOFA 1S5BD 4OWTB 4QIWE 1AEXA 4L5SA 2IL8A 2XVSA 4DR3Q 1PTOB 3QJYA 5JPMC 3CW2C 1HZ9A 1PLFA 1U0LA 1XYIA 3HRZC 4OO1H 5J39A 2VQEL 1CTMA 1VCIA 5BN4A 1L1OB 3J80i 2F4VL 5M5WH 2F0MA 1A6XA 5IGGA 1JT8A 4OO1I 3T1YQ 3NQTA 2F0SA 4CKEA 3I4MG 4I7AA 2CCZA 3KFUA 1WOCA 1ZXTA 4JPBW 1WTRA 3I91A 3MTSA 3NPPA 3E0EA 3JC66 1SR3A 1A3VA 4RWSC 1WTPA 5D14A 2ASBA 3I7FA 3EN2A 5HGTA 4WFN3 3VR2A 4KJNA 3M9BA 1KLUD 1PRTF 1K3BC 5KEEA 2Z6KA 2MUYA 4ME5A 3VYUA 1CSQA 3CQZB 4IUTA 2UXCL 2UXBL 1RKNA 1X56A 4X64L 1HH2P 2UUBQ 2BCOA 4K0KQ 4OO1G 2KUMA 3NSWA 5M9OA 4LUOA 3MXNB 3OWFA 3ICEA 2B2YC 4A3GG 4LF5Q 4BY1G 1XNQL 2Z1CA 4CGYB 3PUYA 4DV5Q 5CV9A 1I6HB 3FVQA 1S5DD 2I5HA 3TEHB 5AFWA 1LABA 3I4NB 3C2PA 3GTQH 3HOXG 1HNXL 1H9SB 4EQ5A 2EVBA 2EYOA 2K5HA 4P71A 1SXTA 4ZLTF 1M8AA 1Q46A 2NUCA 2H5XA 4K2KA 2JE6I 5IE8A 1AP0A 2E8GA 1EYDA 1HQMC 4JC0A 2NB0A 1SFOH 2PPBC 1ENAA 5C4XB 2FMMA 4HJ7A 4DV5L 3MEFA 2VQEQ 2XWBB 3RUZA 3C1EA 1E3PA 1VF7A 3S2HH 1B9MA 1PV4A 4LAAA 3RNUA 2JA7B 4A3FB 4ZCKA 1WD0A 2BH8A 4GOPB 5FK9C 3VA7A 2K75A 3TN2A 3HKSA 1X3QA 4LF9L 1SE3A 4P75A 1GKHA 4PMWA 3IFTA 4OELB 2RQXA 1B3AA 2L9HA 3P75A 4DV4Q 4L63B 4X6AH 1EL0A 5IYBG 4DV2Q 1SLJA 5CV4A 3UDXA 1TVXA 1IXRA 1AN8A 4L8JA 1TWGH 3S1QB 4K2LA 1CZGA 2EPBA 2JYOA 1HNWQ 2LFNA 3KLRA 2B2TA 3PO3B 4JI4L 4HCEA 4EX5A 3OMGA 3KLSA 1BO0A 4DK1A 2MHVA 1OTCA 1QUQA 3E0JA 5CORA 4HJ9A 1L0XB 4B3SL 2AQ3B 1HZBA 1P16A 5I2YA 2UXCQ 2UXBQ 2KCNA 3WDNA 2E76C 3HKZG 3TZUA 3CCLA 2C9OA 2NN6G 2E2IH 2C35B 1NAPA 4A4IA 4JI2Q 1PHJA 1LTTD 1O7IA 2O4XA 3FPUB 4IALA 5C3EB 1CA5A 1T9HA 1E2VA 3PUXA 2XRSD 4PQXA 1AH9A 4DV2L 1Y1VH 1NBWA 3FKIB 3IRBA 3GTOH 4ALPA 1VQ8A 5NUCA 1H9RA 2IPKD 3EIVA 3K57A 1I4PA 3PMFA 3UDFA 1OXTA 1EQVA 2AUJD 1HUMA 4A3IB 5G3LF 1UEBA 1WD1A 3NTIA 2VZAA 3PIP3 2RSNA 3G7LA 2RDHA 5IWAQ 1KXLA 5KNCA 3P7JA 4JBMA 2MP1A 3K6OA 1LTRD 2WIIB 3EBEA 1UAPA 1HZCA 5DAUA 4DKAC 2B2WC 1C0AA 4DN4M 1H9SA 4OIJA 1UEAB 3HOXB 4A3KB 4PNYA 4KHPL 2WFWA 4RFBA 1G51A 1TS5A 4ODGA 2G5DA 3GDEA 1BCPB 1HNXQ 2KCTA 2R6GA 5HY6A 4R9WA 1CKNA 1SNMA 2HQLA 5J22A 4BBSH 3KLSX 3RZDB 2K6AA 2QKIC 1A3TA 3DXJC 2F0GA 3BU2A 2VNUD 3NTHA 4XXEA 3LWEA 5BN5A 1NE3A 3HOWB 4LF5L 4DNRB 3OHXC 1LYLA 1E7ZA 2OEOA 3SEBA 3EA6A 4FXKC 3MEHA 2SEBD 2I46A 2UU9L 1XPOA 1HZAA 1QVCA 1RTNA 3STBD 1X9NA 3AMUA 2JA8H 1A15A 2NVYB 5KNBA 1L1OA 4G57A 2B2UA 1IBLQ 1A63A 2PI2A 1KLGD 3CP0A 2XRQD 1FVIA 2XSCA 4DA2A 2VUMH 2K14A 5H1SE 5G3LD 4OX9Q 4B3ML 1ZYRC 4KHPQ 1UUPA 1YI2A 3SR1A 2K50A 1PTOD 4NXNL 1EFWA 4ZUIA 2JA9A 4PZ7A 4H13C 1F2LA 2EOTA 4K6LA 4YHHQ 4A3LH 1PRTB 5C4JB 3FDTA 2OF1A 4DV4L 1K0SA 3CC2A 4JI3L 2NWGA 2PNRC 2PI2E 3F2CA 1XMQQ 4BA2I 1HTPA 4CJ0B 2BDOA 1E24A 3BZKA 4TRDA 3SK6A 2N8NA 4DAMA 4ID6A 1C9OA 1KL9A 1Q12A 3K8AA 3ONAB 4M1UB 3BYTB 4A3BH 3M4OH 1B50A 3D6CA 1J5EL 1SNOA 2YTYA 3PQIA 1K8AC 4PMBA 3KJOA 1KDBA 1T5XD 5FOBB 3B6YA 1JB3A 1MHWC 3CMAA 4A3KG 1I5FA 1NSNS 1MIUA 5F2DA 3BYYB 1I3QB 2OT2A 2R7FA 2L0CA 1CA6A 4FDBA 4RGTA 3FPPA 3WWVA 2BA0A 4NDXA 4DR3L 1WCMG 3BDCA 5M5WB 2HIVA 4OIKA 1GUSA 1TU2B 1FJGQ 5AJ3L 1V1PA 1K83B 2E75C 3HOZB 3K59A 3H09A 3UI2A 3I4MB 3OW2A 1CKMA 1R4QB 4DR5L 3P20A 4A93G 2DNCA 3W2DA 5C44B 1F9PA 3S9WA 4JI4Q 1XMOQ 4ZUJA 5C3EG 3S14H 3TMEA 1ENCA 5LL6X 1XPUA 1RDPD 3GTPB 1CUKA 4YY3L 1JOKA 1V1PB 2CW0D 4UDUC 4KK7A 1SYGA 2A73B 2B8FA 5HURA 5I2XA 2RBMA 5J3BA 1SE2A 1G6ZA 4FXGC 1SE4A 2NYZD 4JYAL 3BG3A 1C7YA 5KIXA 1S5CD 3GTMH 3A5UA 1WTXA 4A3DG 3GV6A 3UE1A 1MD2D 1FNUA 4S3SA 2PNHA 4JI7Q 4OX9L 1U4RA 1SE8A 1W6KA 4JW0A 4RAUC 4BBSG 1GUWA 5KNDA 2EQSA 1F9QA 1HUNA 5JAVA 3KF6B 4R8IA 3C46A 1TS3A 4GNXC 4KKUA 2WB1E 5EAYA 4LFAQ 3CCQA 4HIKA 2CW0C 1EU3A 2VW9A 1DOKA 4HJAA 3GTJH 3J7AF 5BR8L 1O80A 2B2TC 4G7OC 2EYHA 3CPWA 1CQVA 3NE5B 5BN3A 5T1IA 1TQOA 4DV6Q 2L12A 2ZXRA 4JI0L 1N9WA 1TXYA 2XN9C 3HOUG 1STAA 4DNIA 2L55A 2R93B 1O78A 4JOIC 4X62Q 4LF7L 1STEA 1BBUA 1EQRA 1PZJD 4K14A 3T1HQ 2EIFA 3M7NA 3KDFB 1EYAA 3HG9A 4MN3A 4C2MB 3RN5A 4IUQA 4C3JH 3J80L 4KHZA 3V2TA 1RIPA 1X32A 2DGYA 1X3EA 4HCSA 4IJHA 2WB1G 1PH9A 1Y8PB 1LT6D 4K0KL 5KGUA 1ASZA 4K5WA 4HN7A 1SAPA 3M7GA 2WP8J 4JG2A 4QQBX 5FKAC 3DM1A 2NN6H 5M5YH 1EOVA 2IW3A 1EEID 2CWAA 4BBSB 1JWUD 2K5VA 5IODA 2A1AA 1XPRA 4MZ9A 3D4RA 2FMCA 2ZTDA 4FVMA 3CCMA 3TS0A 4RGOS 3I3CA 2SNMA 1B44D 3U58A 4BBRG 2RHQB 4KMUC 2CH4A 2DY8A 4LWCA 4IPHA 1IW7D 5CBAE 4CJ1B 3M3YH 1QZGA 4A76A 1HR0L 1X55A 3PO2B 1PYBA 1L0WA 2VB2X 3EJIA 4YHHL 1VDZA 2GA4B 3V05A 3F1ZA 2JA8B 1M90C 5JEAH 5JEAJ 1DZ1A 3S24A 3S17H 3CXCA 1RF2D 3K5MA 1LT5D 1H9MA 1MSHA 3HOYH 4A3EH 5BR8Q 1QWYA 3VA5A 3T56B 5GAGC 1TIID 3KLWA 1EWCA 2EY6A 4KKSA 1R9TB 2LS01 2Q2TA 2MJ8A 1STHA 4OWWB 2ZM6Q 2A6HC 1K0RA 1MJCA 4DV6L 3J81E 3DWPA 2OCEA 4B3SQ 4BY1B 3CC4A 4AIMA 4KN7C 1PXUA 4XQQA 4DPGA 3MA2B 2B29A 4JBJA 5CC4A 3CCEA 4R4CA 1V1OA 2AKWB 1ICWA 3F8TA 2CWPA 4TQUS 1W6JA 1ICFB 1VQMA 3EQLC 3E6ZX 2NVQH 1GHKA 1DD2A 3DHQA 4A3BB 4DAYB 3HOWG 3DLLA 1VQ9A 3NHHA 3J81j 1TWFH 5LMUL 1SDFA 1SMXA 5C0XJ 2IHFA 4OL7A 2B63B 4NKLA 1D8LA 2ZJPA 5KYIA 3VYSA 1JORA 4G4KA 1Y8OB 3QO2A 1B4OA 2F0PA 3CCRA 3PF5A 2UXDL 3QR8A 4YCUA 3K0XA 3EVQA 2BOSA 2HUGA 4A3JB 2J0TD 3KYHC 3HOVH 3ZJYC 1YNJC 4LFCQ 2JA5G 1K73C 2YU9B 1T5EA 1SBBB 1I6HH 3A8KE 2UUBL 2X6GA 1Q81C 1K9MC 4DK6C 2V4DA 5JEAG 3HOXH 1NJIC 2L5TA 4DR6L 2R93H 3HGBA 3CHBD 1Y1WH 1CM9A 4K5VA 4XT1B 1QG7A 2PW5A 2KOLA 1NCVA 5ELDA 5IYBH 1EFID 2AQ1B 2I5MX 2WAQB 3NBHA 1ZEQX 1WTWA 3G6EA 3PV0A 4KY5A
chains in the Genus database with same CATH topology
1I6VC 4IUPA 1NUCA 4RCOA 1ET9A 1D6EC 2YYZA 3WOEA 2A68D 5CV5A 1I4RA 3NP8A 1GXDC 1D1KA 2NVQB 2Y0SB 4DNTB 3P1HA 1U4MA 5DM63 1D5MC 1JR0D 2PZTA 3Q24A 2Z8LA 2PMZB 3U9SA 1DJRD 1Y1VB 1QNKA 3GTKB 4RH6A 4NMZA 2FJ2A 5KYLA 1VMPA 1STGA 2IWHA 4A3EB 3A7LA 2F0NA 1WCMB 1JWMD 3LNNA 3U9OA 2QEJC 3MHBA 2B2VA 2D62A 3HOYB 2XNAC 4KN4C 4PMCA 5A35A 3MFGA 2IX1A 2F0JA 3K5LA 2E2JB 2H1EA 2HCCA 4X3KA 3R93A 3D4DA 1BCPD 5E4WC 2KJXA 2F4IA 3D4WA 3QIAA 3VR3A 2D2CC 5M5YB 5CMDA 1SJED 2N55A 2R92B 2F0OA 3NBIA 3EROA 4A3GB 5JJZA 2NVXB 1EY0A 1HPCA 5EKIA 1CK1A 4L6TB 5J1ZA 2JSOA 3IKJA 4RHSA 1EY5A 1GHJA 2PZWA 2ICIA 2D5DA 4IFDI 1Y8NB 3MXGA 1DXMA 5C5MA 4A3DB 3GTMB 3SDZA 2TMPA 1EY8A 1OXVA 3PUZA 2B39A 2F0TA 1EY4A 2K01A 5COYA 3O13A 4TKOB 1HQRD 1GUNA 4ULLA 2K5QA 2AWOA 3SK5A 2F1MA 3GTJB 3H6MA 3GQBA 1I4XA 1VF5C 2BA1A 4BA1I 3M85A 5CBEE 4QF4A 1IKMA 1QCBD 4LJZC 5IOCA 2IJ0A 1HCZA 2K03A 3S1RB 4QIWB 1WVLA 2QCPX 1RTOA 3BDLA 3K5OA 3VR4A 3S16B 1MGSA 5T1GA 2EXZA 3RLFA 1L0YB 1EWHA 1Z7TA 1PZKD 4KY6A 2A6HD 2B2WA 4DAYA 4F87A 1PRTD 3OSOA 2A69D 1Q1BA 1DOMA 4ZAIA 1GUTA 3HKZB 4CBVA 5LL6S 3IFDA 3GP7A 5A2QL 3C1FA 3T13A 4C3HG 3NQIA 2H4OA 2AWNA 1IYUA 2KEDA 1II3A 5I6WA 3A8IE 5JPNC 1IW7C 2JXMB 2A69C 3HOUB 3NWSA 3GV3A 2Q8IB 3A8JE 2K5DA 4BS9A 5K36G 3DEPA 4DGZA 3T4AC 2F0EA 1YNNC 3DWAA 4A3MB 3CRKC 2EY1A 3QB3A 4DXFA 1UNSA 1TWHB 2CVRA 3AB9A 2FFKB 2F0WA 4ZK9B 2AQ2B 2NZ1D 1X3PA 1CHPD 1SFOB 3OIQA 4DAPA 5KRUA 1BUVT 2ZXPA 4RA8A 4ZRZA 5EKLA 1PZID 4HSVA 2EJGC 5EBDA 5TSSA 4MIUA 3SHLA 5D65A 3MC0B 4E6IA 2EYJA 2JA6B 2R7ZB 1G91A 3S1NB 4C3HB 1BR9A 1LT4D 2EDGA 4F8MA 4FYDA 4FF2A 1DONA 2KEEA 1TKWB 3D31A 3HP3A 1BNZA 4ZKBB 1EZ8A 1RJTA 4DAVA 4HMJA 4HMIA 3KK7A 2DN8A 1TWFB 1LV9A 1SYDA 4QMGA 3MAQA 1DCZA 1O7LA 2K1BA 3LX0A 2DY7A 1MBYA 2X6LA 2A74C 4MHEA 2B8GA 4C1NI 3T53B 5IGBA 2EY2A 3Q0AA 1CI3M 3SE0A 2F0VA 3N6RA 3RD4A 1C48A 4X3SA 1JC7A 3OWEB 4DFAA 3FMCA 1JOQA 4IN3A 4IFDG 4J1MA 4LMQD 2WB1B 2F0UA 3R2TA 3X3MA 3BS1A 1VMCA 2WKDA 2ZXOA 4C3IB 3S2DB 4FF3A 4Q0FA 2B2UC 5IGDA 2EY5A 3SK4A 1KABA 1CHQD 3SXHA 4PV1C 2JA5B 1A3UA 1WTVA 4ZKCB 1J8IA 2KCCA 1E2WA 5ELFA 2TSSA 2DNEA 2NTTA 1EIHA 4C56C 3F2UA 3OW7A 1Z47A 4F88A 1I4GA 5E4XA 3NUCA 3M4YA 5C0XH 1H9KA 3IL8A 5JOBA 4KTAA 1D5ZC 2D9UA 3URYA 2Z4IA 1FYCA 4XQJA 4KI0A 4B08A 2IX0A 1IKLA 2M2LA 1LT3D 1I4HA 4ZYSA 3L9AX 2VB3X 5IGFA 3MVVA 3BVGA 2F0KA 3NXWA 1Q8IA 3X3NA 1PTOF 4FP5D 3GTQB 3K5NA 1LTAD 1AZQA 2QILA 1FD7D 1PYWD 1LACA 1PDQA 3I4LA 4XT3B 3OIPA 4BWGB 2F03A 2O5IC 3GTOB 4XDXA 3TP7A 1TWAB 3N52A 5E1FA 1R4PB 3FRPB 2A6ED 4I7ZC 3RMHA 3A56A 5D3IB 1EEFD 1LTID 5M3MB 1XTCD 2O5JC 5ELBA 3BDOA 2RVLA 3C3LA 5IGEA 3Q22A 2KHSA 4QB4A 1SYFA 3MZ5A 4RCNA 4C3JG 2IX3A 1SNPA 2F3VA 3DMUA 4HAEA 3R8BA 2G9HD 3OPOA 3VR6A 4K6DA 3PUVA 1A2UA 1BQQT 3KF8A 1G2TA 3NWTA 1PFBA 4EQPA 1F2ZA 4BY7B 2BE5D 4J6HA 1U9RA 4G7HC 4O1NA 5I9PA 3MXNA 1EYCA 2WINB 1FNWA 1S4ZA 2SOBA 1ONLA 2MGSA 1WTOA 2EJMA 2PW7A 5C4HA 1IYVA 1SMYC 2B2VC 2QDBA 1ZKOA 4U673 4HR7B 4YIJA 1M4VA 5FO9B 2R61A 2F3WA 1KTKA 3L7ZC 4GZYC 3SK8A 5E3FA 3HZXA 4P2CB 1ET6A 5C3XA 4RGNA 2E2DC 5EPKA 1BCPF 5IGCA 5DNFA 2LMCB 2K7VA 1TY0A 3FEWX 4ILWA 3S17B 2J4XA 5DM73 4CHTB 1C8CA 5IIFA 1F9SA 2PCFB 4QUCA 5FLXL 1ML0D 3VYRA 3R2IA 3A54A 3I73A 2F0LA 4QUFA 1EY6A 4BBRB 4DXGA 2EYFA 2KQ3A 4RHRA 4OHJA 1U4PA 3T51B 3ND9A 4O42A 1RD9D 1Y1WB 4KD4A 1TY2A 1SNCA 1ILQA 4WORA 1SYCA 3ERQA 4FXDA 5EKKA 1JOOA 5C0XI 3J7AV 5EPLA 5C6AA 2SDFA 4C3IG 4DF7A 1KDCA 1GJXA 4XIGS 2J7ZA 1FGBD 1OO9B 1BCPC 3H0GB 4V0BA 4KKTA 5DEHA 4RGMA 3RZOB 4FF4A 4WJWA 2K28A 2A6EC 1JCKB 1AW7A 4N9PA 1E0BA 2HDLA 2L4NA 3V96A 1G291 4X3UA 3NK9A 3MXPA 5D3DA 5I4DA 1FR3A 1PFMA 1YNND 1HRJA 3T16A 1H9JA 4KY7A 4IQZA 1F2YA 1LTGD 3KUPA 4IZ8A 4CJ2C 1ZYRD 1KAAA 5FLXE 1KDAA 3TZDA 1QILA 5EQ0A 2IT1A 1ENFA 5IT9E 1G2SA 3ITPA 4Z9CB 1GUGA 4A93B 2K33A 2K32A 2EYMA 3GTGB 4FF1A 2F0FA 4RKLA 3AU7A 1O7ZA 3PUWA 2VUMB 1YNJD 1CZWA 2F0HA 1V8QA 2F0QA 3HEJA 1KNEA 1DOLA 4Y7NB 2E2HB 1XWEA 4IUVA 1MI2A 2JEBI 1HA6A 3MWYW 2EYLA 3CKIB 2F0DA 2ID0A 1F2MA 3DUZA 2LY7A 3D6WA 1D5XC 2HDMA 1EU4A 1IL8A 4N9TA 1C4QA 3QOLA 1LO5D 1OXUA 1BF4A 2E2IB 3OMCA 1KNAA 3ND8A 2BDNA 4UAIA 5EJWA 2M00A 2WV6D 2M9VA 1QOHA 3EFXD 4KV6A 1O7YA 4IFDJ 1HFGA 2OXPA 4M8AA 5ELCA 3VYTA 2I07B 4HTHA 4EVOA 5C4ZA 1SSOA 5C3WA 1CQFA 5IT9L 1Q1EA 3BVZA 1B9NA 2K05A 1CFMA 3K58A 1MSGA 2NVTB 2XWJB 2HCIA 1BOSA 1ESRA 3NTKA 1PTOH 3A7AB 5C0XG 1G8ZD 3TP8A 4K8IA 4IFDH 1STNA 3H94A 1PMRA 4C3JB 3D3RA 1F9RA 2NN6I 3J80E 4XYOA 1JQYD 5EBCA 3CU7A 1J9OA 3D8GA 4DU9A 2EZVA 5I9OA 1RHPA 1AZPA 1EQTA 5C5LA 2NTSA 4J8QA 4K8JA 1Q3LA 3BZDB 1TR5A 3K7AB 1Z6HA 3K0YA 3QOJA 3J81L 1EY9A 3SVMA 4NW2A 1RODA 4RKBA 3QG1A 1EY7A 4EQNA 2QF7A 1ESFA 4EGVA 2AUKA 3I90A 4ABNA 1LLRD 1K8OA 3TBIB 2K04A 2JEAI 2B2YA 4CKCA 2Q8TA 4NP5A 4H7BA 1HFNA 4U68A 5K5PA 1EOTA 1FNVA 1PRTC 1QB5D 2NBFA 5CGKA 1SNQA 2KA7A 2CQAA 2X69A 5CV7A 4I65A 4DK0A 1I4QA 2PO4A 1SJHD 3MFYA 2PZUA 1D1IA 1I50B 4WRDA 1HXYD 1S5FD 4OGQC 4G7ZC 4JK1C 1BDOA 3S14B 5K36H 3KBXA 1QNUA 5JVH3 1STYA 3MXUA 1XXGA 2RDFA 5CV6A 5ISRA 5LHY1 1AFPA 2WKCA 1S5ED 2G9DA 3H3VC 2A5HA 3KBGA 4B9XA 3S2HB 1TT2A 5CV8A 1QJOA 1SMYD 4XQNA 3L3OC 2Z4HA 2PYKA 1SYBA 4FNFA 4Q5VA 4ZQ3A 3M4OB 3S1MB 1HHVA 1GOZA 2F0IA 2E74C 2FINB 1JICA 2O2LD 5CR3A 3JAME 1A2TA 1DM0B 2BE5C 1B2TA 5A2QE 2RKSA 2PQEA 2XIWA 2C5CA 3TSSA 3G6JB 2R3ZA 1PFNA 3GO5A 4XYQA 1TS4A 1K8MA 1U4LA 1HTLD 1LTSD 2L1BA 5CYUA 1B1ZA 3GD7A 3IAYA 4TSSA 1JE4A 4EQOA 1BXTA 1V43A 4R8NA 2KVMA 3HOVB 1JWSD 5ELEA 1ILPA 1B53A 4KJOA 2RDGA 1QE6A 3I72A 1STBA 4H44C 5I6YA 1TWCB 3S15B 3E5SA 1EZ6A 3OOCA 2WACA 5FO7B 4KD3A 2RSOA 3JAML 1SYEA 4XTCS 3TP6A 1PTOC 5M3FB 3DEOA 3LWUA 1OXSC 4X3TA 1Q90A 1SNDA 1Y69U 3BVMA 3Q23A 1E2ZA 1TS2A 3I8ZA 3J7YW 1BBXC 1GUOA 5FO8B 4IUNA 5JVG3 4LK1C 2FHTA 1HA5A 3A55A 3R3OA 4C1NK 4JBWA 2ZT9C 3TDQA 2KECA 2Q8RE 3W3AA 4IUUA 3HS0C 3VR5A 2LKVA 3PIO3 3TP5A 3DWQA 2A68C 1D2BA 2EJFC 4FO2A 1IHZA 1LTBD 4HEDA 1EIGA 1TWGB 5M5XB 1SEBD 4IURA 2RA4A 2SNSA 1CT1D 3QWNA 1F77A 1NR2A 3ZYYX 2K5WA 2L11A 2MPMA 4AYBB 1RCVD 2CHBD 1DYQA 2ENBA 1XX8A 5EPJA 4V190 1OXXK 3M3YB 4H0LC 4F7XA 4HSPA 1NR4A 2EYPA 3CRLC 3Q6SA 2EE1A 5EGTA 3H91A 4K5XA 2N88A 2JP1A 4KHVA 3GTLB 2HQEA 2VXWA 4B9WA 4CKBA 1WTQA 3I70A 4QCLA 2ICEC 3WOFA 1S5BD 1AEXA 2IL8A 2XVSA 1PTOB 3QJYA 5JPMC 1PLFA 1XYIA 3HRZC 4OO1H 5J39A 1VCIA 1CTMA 5BN4A 2F0MA 1A6XA 5IGGA 4OO1I 3NQTA 2F0SA 4CKEA 1ZXTA 1WTRA 3I91A 3MTSA 3NPPA 1A3VA 4RWSC 1WTPA 5D14A 5HGTA 4WFN3 3VR2A 4KJNA 1KLUD 1PRTF 5KEEA 2MUYA 4ME5A 3VYUA 4IUTA 3CQZB 1RKNA 2BCOA 4OO1G 2KUMA 3NSWA 5M9OA 3OWFA 2B2YC 2Z1CA 4CGYB 3PUYA 5CV9A 1I6HB 3FVQA 1S5DD 5AFWA 1LABA 3I4NB 3C2PA 1H9SB 2EVBA 2EYOA 1SXTA 4ZLTF 1M8AA 2NUCA 4K2KA 2JE6I 1AP0A 1EYDA 1HQMC 2NB0A 2PPBC 1ENAA 5C4XB 2FMMA 2XWBB 3RUZA 3C1EA 1VF7A 1B9MA 4LAAA 2JA7B 4A3FB 1WD0A 5FK9C 3VA7A 3TN2A 1X3QA 1SE3A 4PMWA 3IFTA 2RQXA 1B3AA 2L9HA 3P75A 4L63B 1EL0A 5CV4A 1TVXA 1AN8A 4L8JA 3S1QB 4K2LA 1CZGA 2EPBA 2JYOA 2LFNA 3KLRA 2B2TA 3PO3B 4HCEA 3OMGA 3KLSA 1BO0A 4DK1A 2MHVA 3E0JA 5CORA 1L0XB 2AQ3B 5I2YA 2KCNA 3WDNA 2E76C 3TZUA 2C9OA 2NN6G 1NAPA 1LTTD 2O4XA 3FPUB 4IALA 5C3EB 1CA5A 1E2VA 3PUXA 2XRSD 4PQXA 3FKIB 5NUCA 1H9RA 2IPKD 3K57A 1I4PA 3PMFA 1OXTA 1EQVA 2AUJD 1HUMA 4A3IB 5G3LF 1WD1A 3NTIA 3PIP3 2RSNA 3G7LA 2RDHA 5KNCA 3P7JA 2MP1A 3K6OA 1LTRD 2WIIB 1UAPA 5DAUA 2B2WC 4DN4M 1H9SA 4OIJA 1UEAB 3HOXB 4A3KB 4PNYA 4RFBA 1TS5A 4ODGA 1BCPB 2R6GA 4R9WA 5J22A 1SNMA 3KLSX 3RZDB 2K6AA 2QKIC 1A3TA 3DXJC 2F0GA 2VNUD 3NTHA 4XXEA 3LWEA 5BN5A 3HOWB 4DNRB 3OHXC 3SEBA 2OEOA 3EA6A 3MEHA 4FXKC 2SEBD 2I46A 1RTNA 3AMUA 1A15A 2NVYB 5KNBA 4G57A 2B2UA 1KLGD 2XRQD 2XSCA 4DA2A 5G3LD 1ZYRC 1UUPA 3SR1A 1PTOD 4ZUIA 4H13C 1F2LA 2EOTA 4K6LA 1PRTB 5C4JB 3FDTA 2OF1A 2NWGA 2PNRC 4BA2I 1HTPA 4CJ0B 2BDOA 4TRDA 3SK6A 4ID6A 1Q12A 3ONAB 4M1UB 3BYTB 1B50A 3D6CA 1SNOA 4PMBA 1KDBA 1T5XD 5FOBB 1JB3A 1NSNS 5F2DA 3BYYB 1I3QB 2OT2A 2L0CA 1CA6A 4RGTA 3FPPA 2BA0A 4NDXA 5M5WB 3BDCA 4OIKA 1GUSA 1TU2B 1V1PA 1K83B 2E75C 3HOZB 3K59A 3H09A 3UI2A 3I4MB 1R4QB 3P20A 2DNCA 3W2DA 5C44B 1F9PA 3S9WA 4ZUJA 3TMEA 1ENCA 5LL6X 1RDPD 3GTPB 1JOKA 1V1PB 2CW0D 4UDUC 5HURA 1SYGA 2A73B 2B8FA 4KK7A 5I2XA 2RBMA 1G6ZA 1SE2A 4FXGC 1SE4A 2NYZD 3BG3A 5KIXA 1S5CD 1WTXA 3GV6A 1MD2D 1FNUA 4S3SA 1U4RA 1W6KA 4RAUC 1GUWA 5KNDA 1F9QA 1HUNA 5JAVA 4R8IA 3C46A 1TS3A 4KKUA 2CW0C 1EU3A 1DOKA 3J7AF 1O80A 2B2TC 4G7OC 2EYHA 1CQVA 3NE5B 5BN3A 5T1IA 1TQOA 2L12A 2ZXRA 2XN9C 1STAA 2L55A 2R93B 1O78A 1STEA 1PZJD 4K14A 3M7NA 1EYAA 3HG9A 4MN3A 4C2MB 4IUQA 3J80L 4KHZA 3V2TA 1X32A 4HCSA 1Y8PB 1LT6D 5KGUA 4K5WA 4HN7A 1SAPA 3M7GA 2WP8J 5FKAC 3DM1A 2NN6H 1EEID 2IW3A 4BBSB 1JWUD 5IODA 3D4RA 2FMCA 4FVMA 4RGOS 3I3CA 2SNMA 1B44D 4KMUC 2DY8A 1IW7D 5CBAE 4CJ1B 3PO2B 2VB2X 3EJIA 1VDZA 2GA4B 3V05A 2JA8B 5JEAH 5JEAJ 1DZ1A 3K5MA 1RF2D 1LT5D 1H9MA 1MSHA 1QWYA 3VA5A 3T56B 1TIID 1EWCA 2EY6A 4KKSA 1R9TB 2LS01 2MJ8A 1STHA 2A6HC 3J81E 3DWPA 4BY1B 4KN7C 1PXUA 4XQQA 3MA2B 5CC4A 1V1OA 1ICWA 4TQUS 1W6JA 3EQLC 3E6ZX 1GHKA 1DD2A 3DHQA 4A3BB 3NHHA 1SDFA 5C0XJ 4OL7A 2B63B 4NKLA 5KYIA 3VYSA 1JORA 4G4KA 1Y8OB 3QO2A 1B4OA 2F0PA 3EVQA 2BOSA 2HUGA 4A3JB 2J0TD 1YNJC 2YU9B 1T5EA 1SBBB 3A8KE 2X6GA 2V4DA 5JEAG 2L5TA 3HGBA 3CHBD 1CM9A 4K5VA 4XT1B 1QG7A 5ELDA 2PW5A 2KOLA 1NCVA 1EFID 2AQ1B 2WAQB 3NBHA 1ZEQX 1WTWA 3PV0A 4KY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6L A;  4IUP A;  4MHE A;  2B2V C;  1F9P A;  3I3C A;  3GV3 A;  2K28 A;  3D6W A;  2FHT A;  1B3A A;  2L9H A;  2HDM A;  2DY8 A;  1IL8 A;  1EL0 A;  5CBA E;  4CJ1 B;  1E0B A;  2HDL A;  4R9W A;  3DEP A;  1ZXT A;  4X3S A;  1HHV A;  1WTR A;  1G6Z A;  3I91 A;  3MTS A;  1BF4 A;  1TVX A;  2L4N A;  2FIN B;  1KNA A;  1AZQ A;  2KEC A;  2NYZ D;  2Q8R E;  4RWS C;  1U4M A;  2EPB A;  4X3U A;  2JYO A;  2K01 A;  4IUU A;  1JIC A;  2B2T A;  5COY A;  5D14 A;  1DZ1 A;  1WTX A;  2BDN A;  3GV6 A;  4UAI A;  5EJW A;  5EPK A;  1MSH A;  1PDQ A;  3LWE A;  4XT3 B;  1U4R A;  3SVM A;  1BO0 A;  1B2T A;  4LMQ D;  5DNF A;  4RAU C;  4NW2 A;  1PFM A;  1ROD A;  1HRJ A;  5COR A;  1O7Y A;  1GUW A;  2XIW A;  4XDX A;  2MJ8 A;  1QNK A;  1F9Q A;  4IUT A;  1C8C A;  1HUN A;  1VMC A;  1RTN A;  1HFG A;  1EIG A;  2CVR A;  2FJ2 A;  3N52 A;  4HED A;  1A15 A;  4R8I A;  2R3Z A;  4IUR A;  2RA4 A;  2KUM A;  2B2U A;  1SSO A;  2FFK B;  1PFN A;  3I90 A;  1VMP A;  4ZK9 B;  3KUP A;  1F9S A;  4CJ2 C;  5CBE E;  2K04 A;  2NZ1 D;  1U4L A;  1X3P A;  2B2Y A;  1NR2 A;  2K05 A;  1ML0 D;  2L11 A;  2B2Y C;  2MPM A;  4QUC A;  1IKM A;  1DOK A;  2L1B A;  4RA8 A;  2Q8T A;  1O80 A;  2B2T C;  1XX8 A;  1HFN A;  4HSV A;  1JE4 A;  2RVL A;  2B2U C;  5EPJ A;  4U68 A;  1MSG A;  1ICW A;  5EQ0 A;  1EOT A;  1NAP A;  2HCI A;  3FPU B;  4QUF A;  2B2V A;  3TZD A;  1CA5 A;  1ESR A;  2KVM A;  5AFW A;  5T1I A;  1WTV A;  5D65 A;  4ZKC B;  2K03 A;  2L12 A;  1G2S A;  1F2L A;  2EOT A;  1WVL A;  1J8I A;  2X69 A;  1ILP A;  1RTO A;  1B53 A;  1SDF A;  1G91 A;  3FDT A;  4HAE A;  1QE6 A;  4ZLT F;  1M8A A;  1NR4 A;  1MGS A;  2H1E A;  2HCC A;  2NWG A;  5T1G A;  1AP0 A;  1U4P A;  3QO2 A;  4X3K A;  3Q6S A;  3R93 A;  4CJ0 B;  1EIH A;  1B4O A;  2EE1 A;  3H91 A;  3F2U A;  1O7Z A;  2N88 A;  2JP1 A;  3ONA B;  5E4W C;  2VXW A;  4O42 A;  4MN3 A;  2HUG A;  1WTP A;  2RSO A;  1B50 A;  1DON A;  1HUM A;  2KEE A;  2FMM A;  4IUQ A;  1G2T A;  1WD1 A;  1ILQ A;  5E4X A;  1WTQ A;  1F9R A;  1PFB A;  3HP3 A;  3IL8 A;  2B2W A;  2RSN A;  3G7L A;  5CMD A;  1KNE A;  1BNZ A;  1X32 A;  4ZKB B;  1DOL A;  2X6G A;  3KBX A;  3DEO A;  4HCS A;  1RJT A;  2D9U A;  1CA6 A;  3P7J A;  2MP1 A;  1DOM A;  2N55 A;  4IUV A;  4ZAI A;  1MI2 A;  4X3T A;  1WD0 A;  1S4Z A;  1J9O A;  2IL8 A;  5EPL A;  2SDF A;  1CM9 A;  4OIK A;  5JJZ A;  1HA6 A;  3MWY W;  1LV9 A;  2MGS A;  1QG7 A;  3IFD A;  4XT1 B;  5EKI A;  2B2W C;  2KOL A;  1NCV A;  1RHP A;  1SAP A;  1AZP A;  1EQT A;  1IKL A;  2M2L A;  1PLF A;  3UI2 A;  4DN4 M;  3DM1 A;  1XYI A;  2J7Z A;  3TN2 A;  1WTO A;  2KED A;  1WTW A;  4OIJ A;  1X3Q A;  3I8Z A;  1Q3L A;  2K1B A;  1BBX C;  2DY7 A; 
#chains in the Genus database with same CATH topology
 1I6V C;  4IUP A;  1NUC A;  4RCO A;  1ET9 A;  1D6E C;  3T1Y L;  2YYZ A;  3WOE A;  2VL6 A;  2A68 D;  5CV5 A;  1N33 L;  1I4R A;  3NP8 A;  1GXD C;  3PIP A;  1D1K A;  2NVQ B;  4LFB Q;  2Y0S B;  4DNT B;  1I50 H;  4LF9 Q;  3P1H A;  1U4M A;  5DM6 3;  4DV7 Q;  1D5M C;  1JR0 D;  3T1H L;  4AQY Q;  1CSP A;  2PZT A;  3Q24 A;  2Z8L A;  5HGQ A;  2PMZ B;  3U9S A;  1DJR D;  1Y1V B;  1QNK A;  4IPC A;  3GTK B;  1N8R C;  4RH6 A;  4NMZ A;  1YJN A;  2FJ2 A;  5KYL A;  2OTL A;  4X64 Q;  1W2B A;  1VMP A;  1STG A;  3CME A;  1PH7 A;  2IWH A;  4A3E B;  2F3I A;  3A7L A;  2F0N A;  1WCM B;  1JWM D;  1YBY A;  3LNN A;  3U9O A;  3HOU H;  2QEJ C;  3MHB A;  1JB7 A;  3RZD H;  2B2V A;  2D62 A;  1XTD A;  2PQA A;  2QDL A;  3HOY B;  2XNA C;  4KN4 C;  2GVB A;  5M5X H;  4PMC A;  5A35 A;  3MFG A;  5C4X G;  4GLV B;  2NZO A;  2IX1 A;  3PO3 G;  5GQO A;  2F0J A;  3K5L A;  2E2J B;  2H1E A;  2HCC A;  2E5L Q;  4X3K A;  3R93 A;  1N36 L;  3D4D A;  4ME3 A;  3CCJ A;  1BBW A;  1EWI A;  1BCP D;  5E4W C;  1YNX A;  2KJX A;  2F4I A;  3RLN A;  3D4W A;  4BXX H;  1KRS A;  3QIA A;  3VR3 A;  4DUZ L;  2D2C C;  5M5Y B;  3TQY A;  5CMD A;  1SJE D;  1XMO L;  4OEM B;  2N55 A;  2R92 B;  2F0O A;  3NBI A;  3ERO A;  3HOW H;  4A3G B;  1BKB A;  1QVF A;  5JJZ A;  2B63 H;  2NVX B;  3KOJ A;  1EY0 A;  1HPC A;  5EKI A;  1CK1 A;  2F52 A;  4A3F G;  4UPA A;  4L6T B;  5J1Z A;  2E5L L;  2JSO A;  2KBN A;  2NZH A;  3IKJ A;  4BBR H;  1B3Q A;  4RHS A;  1EY5 A;  1GHJ A;  1B7Y B;  2PZW A;  2ICI A;  2D5D A;  3UDI A;  4A3J G;  4IFD I;  1Y8N B;  3MXG A;  1DXM A;  5C5M A;  3JAM c;  4A93 H;  4A3D B;  3GTM B;  3SDZ A;  2TMP A;  4DUZ Q;  1EY8 A;  1OXV A;  4O2D A;  1HNW L;  2B63 G;  1XNQ Q;  1XNR Q;  3PUZ A;  3FKI H;  2B39 A;  4P72 A;  3GTP H;  2F0T A;  4X66 Q;  1EY4 A;  1YHA A;  2K01 A;  5COY A;  3O13 A;  4TKO B;  1HQR D;  1GUN A;  2MO1 A;  4ULL A;  4JI1 L;  2K5Q A;  2AWO A;  3ER0 A;  3SK5 A;  2GVA A;  3KF6 A;  2F1M A;  3GTJ B;  3H6M A;  3GQB A;  2PMZ E;  1I4X A;  1VF5 C;  3W5O A;  2BA1 A;  4IPD A;  4BA1 I;  3M85 A;  1B8A A;  2JA7 H;  5CBE E;  4QF4 A;  1IKM A;  3PO3 H;  1QCB D;  4DR6 Q;  4WJ4 A;  4LJZ C;  5IOC A;  2IJ0 A;  1PH4 A;  2Q2I A;  1HCZ A;  2K03 A;  3S1R B;  4QIW B;  1WVL A;  4A3I G;  4DV1 L;  2QCP X;  1K28 A;  1RTO A;  1KC8 C;  3BDL A;  3K5O A;  3UE0 A;  3VR4 A;  1LTL A;  3K80 C;  3S16 B;  1MGS A;  5T1G A;  4NXM Q;  4DV0 L;  2EXZ A;  3RLF A;  1U5K A;  1L0Y B;  1EWH A;  2UUC L;  4QL5 A;  1Z7T A;  4A3E G;  1PZK D;  4KY6 A;  2FXQ A;  1A8V A;  1JJC B;  4LF6 Q;  4A3L G;  3CCV A;  3ERS X;  1YJW A;  2V1C C;  4DR7 L;  4QGU A;  1QVG A;  2A6H D;  2B2W A;  4DR5 Q;  4DAY A;  4F87 A;  1PRT D;  3OSO A;  2A69 D;  1Q1B A;  1B70 B;  1DOM A;  5IP7 G;  4ZAI A;  4DR2 Q;  1GUT A;  3HKZ B;  4CBV A;  5LL6 S;  1UE1 A;  1H95 A;  3IFD A;  3GP7 A;  4RMF A;  3L0O A;  5A2Q L;  1E22 A;  1IBK Q;  3C1F A;  3KDF A;  3T13 A;  4C3H G;  3NQI A;  2H4O A;  2AWN A;  1IYU A;  2KED A;  3K81 C;  1VQL A;  2A8V A;  1II3 A;  5I6W A;  3A8I E;  5JPN C;  1IW7 C;  2JXM B;  2A69 C;  3HOU B;  3NWS A;  3GV3 A;  2Q8I B;  1Q82 C;  4B3R L;  3A8J E;  4P74 A;  3NEN A;  2K5D A;  4BS9 A;  3S1M H;  4YCW A;  5IYC G;  5K36 G;  3DEP A;  3K7U C;  3FP9 A;  4DGZ A;  1A62 A;  1YIT A;  3H15 A;  2YV5 A;  3T4A C;  2F0E A;  1YNN C;  3DWA A;  4A3M B;  3CRK C;  2EY1 A;  3A5Z B;  4A3K H;  3QB3 A;  4MTK A;  5GAH C;  1NTG A;  4DXF A;  4HID A;  4N8X 1;  2QA4 A;  3NBH B;  1UNS A;  1TWH B;  2CVR A;  3G4S A;  3AB9 A;  3CD6 A;  2FFK B;  2F0W A;  4ZK9 B;  2AQ2 B;  4X65 Q;  1VS0 A;  2NZ1 D;  1X3P A;  1CHP D;  1SFO B;  3OIQ A;  4DAP A;  1PH6 A;  4X62 L;  3AQQ A;  4LF7 Q;  1BUV T;  5KRU A;  2ZXP A;  4RA8 A;  4ZRZ A;  5EKL A;  4LFB L;  1PZI D;  4HSV A;  2ES2 A;  1IBM L;  2EJG C;  3OYY A;  4H02 A;  3KF8 B;  5EBD A;  5TSS A;  5ELO A;  4MIU A;  3SHL A;  5D65 A;  3MC0 B;  4E6I A;  2EYJ A;  2JA6 B;  2R7Z B;  4KLK A;  1G91 A;  3S1N B;  4C3H B;  1BR9 A;  1LT4 D;  2D0P A;  2EDG A;  4F8M A;  3I2Z A;  1XMQ L;  2F4V Q;  3FHW A;  4FYD A;  1VQ5 A;  4FF2 A;  5IP9 H;  1DON A;  2KEE A;  1TKW B;  2IY5 B;  3D31 A;  5C4X H;  2CFM A;  3HP3 A;  1BNZ A;  3F2B A;  4A75 A;  4ZKB B;  4A3C H;  1EZ8 A;  1RJT A;  4DAV A;  4HMJ A;  4HMI A;  3NEL A;  4AYB E;  3KK7 A;  2DN8 A;  1LV9 A;  1TWF B;  1SYD A;  4QMG A;  4B3T L;  4LUV A;  3MAQ A;  1DCZ A;  1O7L A;  1WJJ A;  4R4T A;  5FLM H;  1YEZ A;  2K1B A;  3LX0 A;  2DY7 A;  1MBY A;  2LXK A;  2X6L A;  2A74 C;  4MHE A;  2B8G A;  4C1N I;  4JV5 L;  3T53 B;  1HNZ Q;  1I3Q H;  5IGB A;  2EY2 A;  3Q0A A;  1CI3 M;  3SE0 A;  2F0V A;  3N6R A;  3RD4 A;  1C48 A;  3OTO Q;  2IHE A;  4X3S A;  1JC7 A;  2KHJ A;  3OWE B;  4DFA A;  4LF8 Q;  4NXN Q;  3PO2 G;  1IYJ B;  3FMC A;  4DR1 Q;  4A3C G;  1PYS B;  1JOQ A;  4IN3 A;  1QUQ B;  4J1M A;  4IFD G;  4LMQ D;  3BJU A;  5M3F G;  2WB1 B;  1WYD A;  4MTN A;  1VQ7 A;  2F0U A;  3R2T A;  4AQY L;  3X3M A;  3BS1 A;  1VMC A;  2WKD A;  1CKO A;  2ZXO A;  4DK3 C;  4C3I B;  5FLM G;  1KIX A;  1UE6 A;  3S2D B;  4FF3 A;  1P8L A;  3H3V I;  4Q0F A;  2B2U C;  2VS1 A;  5IP7 H;  5IGD A;  4X66 L;  2EY5 A;  3SK4 A;  1KAB A;  1CHQ D;  3SXH A;  4PV1 C;  1Q86 C;  2JA5 B;  2HHH Q;  1A3U A;  1WTV A;  4ZKC B;  2EXD A;  2Q2U A;  3H3V H;  1J8I A;  2KCC A;  1E2W A;  1R9T H;  1TWC H;  5ELF A;  1LM0 A;  2TSS A;  2DNE A;  4GKJ L;  2R92 H;  2N49 A;  2NTT A;  2QW7 A;  1V1Q A;  1EIH A;  4C56 C;  5C4J H;  3F2U A;  1S40 A;  3OW7 A;  4DR4 Q;  4A3B G;  4L5T A;  3U4V A;  3E9H A;  1Z47 A;  2UU9 Q;  2PQA B;  3PF4 A;  4F88 A;  1I4G A;  5E4X A;  4A3I H;  3NUC A;  2ALY B;  3M4Y A;  5C0X H;  1H9K A;  1HR0 W;  3IL8 A;  2WAQ E;  5JOB A;  4KTA A;  1D5Z C;  3SGI A;  4HJ5 A;  4A3D H;  2D9U A;  3GTG H;  3URY A;  2Z4I A;  4B3M Q;  1FYC A;  4XQJ A;  4KI0 A;  3CCS A;  4B08 A;  2IX0 A;  1IKL A;  2M2L A;  1LT3 D;  1I4H A;  2K52 A;  4ZYS A;  3L9A X;  2VB3 X;  3TS2 A;  5C3E H;  5IGF A;  3MVV A;  3BVG A;  1VQI A;  2F0K A;  3NXW A;  4YWM A;  1Q8I A;  4YWL A;  2KEN A;  4GKK L;  2R7Z G;  3X3N A;  4CDC C;  1PTO F;  4FP5 D;  3GTQ B;  2JA8 G;  1HJP A;  2LXJ A;  2RCF A;  4IOC A;  4JV5 Q;  4L5R C;  3HOY G;  3K5N A;  1LTA D;  3UDG A;  1YHQ A;  1AZQ A;  1VQ6 A;  2QIL A;  1FD7 D;  1PYW D;  1LAC A;  1PDQ A;  3I4L A;  4XT3 B;  3OIP A;  2E2J H;  1JE5 A;  4BWG B;  2F03 A;  4BY7 G;  2O5I C;  2VY3 A;  1VQP A;  2DJG C;  4JI6 L;  3GTO B;  4XDX A;  1PVO A;  1I94 Q;  1X54 A;  3TP7 A;  1TWA B;  3N52 A;  1FJG L;  5E1F A;  1R4P B;  3U50 C;  3FRP B;  2A6E D;  4I7Z C;  2GN5 A;  4HIO A;  3RMH A;  3A56 A;  5D3I B;  1M1K C;  1EEF D;  1LTI D;  5M3M B;  1XTC D;  1RL2 A;  2O5J C;  1WCM H;  5ELB A;  2VQF L;  3CF5 A;  3BDO A;  2RVL A;  1VQA A;  3C3L A;  5IGE A;  3Q22 A;  3F2D A;  2KHS A;  4QB4 A;  1SYF A;  3MZ5 A;  4RCN A;  4C3J G;  1KRT A;  2IX3 A;  4BXX G;  2AHO B;  1SNP A;  2F3V A;  3DMU A;  4HAE A;  4OON A;  3VDY A;  2NVT H;  1EIY B;  2UXD Q;  3R8B A;  2G9H D;  3HKZ E;  3OPO A;  3VR6 A;  4K6D A;  3PUV A;  1A2U A;  1BQQ T;  3M4Q A;  4X65 L;  1YHB A;  3KF8 A;  1G2T A;  3NWT A;  5LMN Q;  1PFB A;  4EQP A;  1F2Z A;  4BY7 B;  2BE5 D;  4J6H A;  1U9R A;  4G7H C;  4O1N A;  5I9P A;  3MXN A;  4YWK A;  1EYC A;  2JQO A;  1FNW A;  1S4Z A;  2WIN B;  2SOB A;  1ONL A;  4IO9 A;  2MGS A;  3I4O A;  2B3G A;  1LUZ A;  5IYD G;  3CPF A;  3ULP A;  2JA7 G;  1N36 Q;  1WTO A;  2EJM A;  2PW7 A;  5C4H A;  4AH6 A;  1IYV A;  1SMY C;  2B2V C;  2QDB A;  1ZKO A;  4HR7 B;  4U67 3;  4YIJ A;  1M4V A;  5FO9 B;  2AMC B;  1JJ2 A;  2R61 A;  2F3W A;  1KTK A;  3L7Z C;  4GZY C;  1GM5 A;  3SK8 A;  5GAD C;  5E3F A;  3HZX A;  4P2C B;  1ET6 A;  5C3X A;  4RGN A;  3W1G A;  2E2D C;  4QY7 A;  5IP9 G;  5EPK A;  1BCP F;  5IGC A;  5DNF A;  3S16 H;  2LMC B;  2K7V A;  1TY0 A;  4Y7N H;  2E2H H;  3FEW X;  4ILW A;  3S17 B;  2J4X A;  5DM7 3;  4CHT B;  1C8C A;  1VQJ A;  4JBK A;  1HNZ L;  2A19 A;  5IIF A;  4NB3 A;  2KHI A;  1F9S A;  2PCF B;  4QUC A;  5FLX L;  1J5E Q;  2K4K A;  1ML0 D;  3VYR A;  4LF4 Q;  1N32 Q;  1X65 A;  4IJL A;  2ZTC A;  3R2I A;  4DV0 Q;  1VQE A;  3A54 A;  4JOI A;  4C3H H;  1L2F A;  4JI8 Q;  3I73 A;  2F0L A;  4QUF A;  3S2D H;  1EY6 A;  1PFS A;  4DR4 L;  4JI5 L;  1IL2 A;  4BBR B;  1HR0 Q;  4DXG A;  2EYF A;  2KQ3 A;  4RHR A;  2VUM G;  4OHJ A;  1EYG A;  2Z6K C;  1U4P A;  3BZC A;  4GS3 A;  4YY3 Q;  3T51 B;  4BY7 H;  3ND9 A;  5DLQ E;  5GRO A;  4O42 A;  1RD9 D;  3E9I A;  3HFZ B;  1Y1W B;  2DJF C;  4KD4 A;  1IZ6 A;  1TY2 A;  1SNC A;  4C2M H;  4JI0 Q;  1ILQ A;  4WOR A;  1S72 A;  1SYC A;  2MFI A;  4PZ8 A;  3ERQ A;  4R4I A;  4FXD A;  5EKK A;  4JI6 Q;  1JOO A;  1JJG A;  5C0X I;  3J7A V;  5EPL A;  5C6A A;  2SDF A;  2OQ0 A;  4A3M G;  4C3I G;  1YJ9 A;  4A3J H;  2R7Z H;  4JI8 L;  4DF7 A;  1KDC A;  1GJX A;  4XIG S;  4GOP A;  2RCN A;  2J7Z A;  1FGB D;  4GKJ Q;  2QEX A;  3J81 i;  1OO9 B;  4GN5 A;  4O0A A;  1BCP C;  3H0G B;  4V0B A;  4KKT A;  5DEH A;  4RGM A;  4HIM A;  3RZO B;  4FF4 A;  4WJW A;  4UP7 A;  2K28 A;  3RN2 A;  2A6E C;  3J80 c;  5LMN W;  2XGT A;  3OTO L;  1JCK B;  1XNR L;  4WJ3 M;  1AW7 A;  4N9P A;  4CDE C;  1E0B A;  2HDL A;  3PO2 H;  2R93 G;  2L4N A;  3AFQ A;  1N34 L;  5JJK A;  3DM3 A;  1PH1 A;  3V96 A;  1G29 1;  4X3U A;  3NK9 A;  2R7D A;  4AYB G;  2YTX A;  4HJ8 A;  1VQC A;  2MO0 A;  3MXP A;  4CDF C;  1N32 L;  2Q2H A;  5D3D A;  5I4D A;  1FR3 A;  1PFM A;  1YNN D;  1HRJ A;  5JJL A;  3T16 A;  3A0J A;  3H0G G;  3S1Q H;  1H9J A;  1JMC A;  1ASY A;  4KY7 A;  4IQZ A;  2D0O A;  1F2Y A;  2HIX A;  4B3R Q;  1LTG D;  3TRE A;  3KUP A;  4IZ8 A;  4CJ2 C;  3PSI A;  1ZYR D;  1NNX A;  1KAA A;  5FLX E;  1KDA A;  3TZD A;  1QIL A;  5EQ0 A;  1L1O C;  2IT1 A;  5GAE C;  2ZJQ A;  1V9P A;  1ENF A;  5IT9 E;  1G2S A;  3ITP A;  4Z9C B;  3HOZ H;  1GUG A;  4A93 B;  2JA5 H;  2HT1 A;  2K33 A;  2K32 A;  2EYM A;  4J15 A;  4RG1 A;  4FF1 A;  3GTG B;  3S1N H;  2F0F A;  4RKL A;  3AU7 A;  1O7Z A;  1AE2 A;  3PUW A;  4LFA L;  2VUM B;  1YNJ D;  4MNO A;  3CCU A;  2ZJR A;  3AEV A;  1WTH A;  2ZTE A;  1CZW A;  2F0H A;  4B3T Q;  4R4Q A;  1Y1V G;  1V8Q A;  2F0Q A;  3HEJ A;  1KNE A;  4DUY L;  2UUA L;  4DR2 L;  1DOL A;  4PG3 A;  3NEM A;  4Y7N B;  2E2H B;  1GVP A;  1XWE A;  1SRO A;  4IUV A;  3AFP A;  1MI2 A;  2JEB I;  1IBK L;  2ZM6 L;  1HA6 A;  3MWY W;  2EYL A;  3I4M H;  4TVA B;  3CKI B;  1KHI A;  2F0D A;  2I5L X;  4LF4 L;  4P73 A;  2ID0 A;  1F2M A;  3DUZ A;  2LY7 A;  1Y1W G;  3D6W A;  1D5X C;  4R1J A;  1YVC A;  1EU4 A;  2HDM A;  1IL8 A;  4QJF A;  4N9T A;  1C4Q A;  1VQN A;  3QOL A;  2WAQ G;  5IYD H;  1LO5 D;  1OXU A;  4N8F A;  1BF4 A;  1KAW A;  4POF A;  3OMC A;  1KNA A;  2E2I B;  3ND8 A;  3K7A H;  2BDN A;  4UAI A;  5EJW A;  3HOV G;  3J7A 5;  2M00 A;  2WV6 D;  2M9V A;  1QOH A;  3EFX D;  4KV6 A;  4DV3 L;  1O7Y A;  4IFD J;  1E1O A;  2YTV A;  1HFG A;  3GTK H;  3CAM A;  2OXP A;  4M8A A;  5ELC A;  5IT9 c;  3VYT A;  2I07 B;  4HTH A;  4EVO A;  5C4Z A;  1PH5 A;  4JVZ A;  1SSO A;  5C3W A;  1CQF A;  5IT9 L;  1NY4 A;  1Q1E A;  3BVZ A;  1B9N A;  2K05 A;  2OTJ A;  3ULJ A;  4JI1 Q;  1CFM A;  3K58 A;  1MSG A;  2NVT B;  2XWJ B;  3L2P A;  2HCI A;  2QGQ A;  1BOS A;  4A3M H;  1ESR A;  4IPG A;  1MKH A;  3I55 A;  4JI2 L;  3LGJ A;  3S15 H;  3NTK A;  1PTO H;  3CC7 A;  4R4O A;  4A3G H;  3A7A B;  3AYH B;  5C0X G;  1G8Z D;  3TP8 A;  4K8I A;  1GO3 E;  4IFD H;  1N34 Q;  1STN A;  2HHH L;  3I4N G;  4GOP C;  2RHS B;  3H94 A;  1PMR A;  1E1T A;  4C3J B;  1BVS A;  2JN4 A;  3D3R A;  1F9R A;  3D0F A;  2NN6 I;  5FLX c;  4XYO A;  1JQY D;  5EBC A;  3J80 E;  5LMN L;  3CU7 A;  5IWA L;  3PGZ A;  1MJE A;  1J9O A;  3D8G A;  4LUZ A;  4DU9 A;  4BY1 H;  2EZV A;  2KCM A;  5I9O A;  1RHP A;  1AZP A;  1EQT A;  5C5L A;  2NTS A;  2RF4 A;  4J8Q A;  4LW1 A;  4K8J A;  1Q3L A;  3BZD B;  2OQK A;  1TR5 A;  4DV1 Q;  1VQG A;  4LFC L;  3K7A B;  1Z6H A;  1Y14 B;  1X3F A;  4POG A;  3J81 c;  3U4Z A;  3K0Y A;  1WI5 A;  2I0Q A;  2P5Z X;  3FKI G;  2L15 A;  3QOJ A;  3J81 L;  4LF6 L;  4LF8 L;  1Q7Y C;  1EY9 A;  3SVM A;  1QZH A;  4NW2 A;  1VQO A;  1ROD A;  4OXP A;  4RKB A;  3QG1 A;  1EY7 A;  4EQN A;  2QF7 A;  1ESF A;  1VQ4 A;  4JI5 Q;  4EGV A;  2AUK A;  3I90 A;  1K8G A;  2N78 A;  4NPS A;  4ABN A;  1LLR D;  1K8O A;  3TBI B;  2R92 G;  2K04 A;  2JEA I;  2MNA A;  2B2Y A;  4CKC A;  4APV A;  2Q8T A;  4NP5 A;  5M3M H;  1AE3 A;  4H7B A;  1PH2 A;  4GLA C;  1HFN A;  4U68 A;  5K5P A;  1EOT A;  1FNV A;  1PRT C;  1QB5 D;  2NBF A;  5CGK A;  4Y52 H;  1SNQ A;  2KA7 A;  1PA6 A;  2CQA A;  2X69 A;  2HD3 A;  4NXM L;  5CV7 A;  4JI3 Q;  4I65 A;  1K83 H;  4DK0 A;  1I4Q A;  2JK8 A;  2PO4 A;  1SJH D;  3MFY A;  3PCO B;  2PZU A;  1D1I A;  4PZ6 A;  1I50 B;  4WRD A;  2MQH A;  1CKN B;  1HXY D;  1S5F D;  2NVY H;  2CKZ B;  4OGQ C;  4G7Z C;  4JK1 C;  1BDO A;  3S14 B;  5IYC H;  3KBX A;  5K36 H;  1QNU A;  3M4P A;  1SRU A;  5JVH 3;  1STY A;  3MXU A;  1XXG A;  2Z0S A;  2RDF A;  1N33 Q;  5CV6 A;  5ISR A;  5LHY 1;  4GLX A;  1PH3 A;  2WKC A;  1AFP A;  1S5E D;  2G9D A;  3RLO A;  1IBM Q;  3H3V C;  4GKK Q;  1J6Q A;  2A5H A;  3KBG A;  3G71 A;  4B9X A;  3RR5 A;  4A3F H;  4JI7 L;  3S2H B;  1TT2 A;  5CV8 A;  1QJO A;  1SMY D;  4XQN A;  3L3O C;  2Z6B A;  2Z4H A;  5FJ8 H;  2PYK A;  1SYB A;  4FNF A;  1SN8 A;  4Q5V A;  4ZQ3 A;  4C3I H;  3M4O B;  3S1M B;  1HHV A;  1GOZ A;  2F0I A;  2E74 C;  2FIN B;  3CQZ H;  1UE5 A;  1JIC A;  3A74 A;  2O2L D;  5CR3 A;  3JAM E;  2NVX H;  1A2T A;  1DM0 B;  2OWO A;  2BE5 C;  1B2T A;  1G6P A;  5A2Q E;  1I94 L;  2RKS A;  2PQE A;  2XIW A;  1GD7 A;  2C5C A;  1KD1 C;  1UWV A;  2ATW A;  1NMF A;  3TSS A;  3G6J B;  2R3Z A;  4DR7 Q;  4GNX A;  3STB C;  1PFN A;  1VQD A;  3GO5 A;  5E7N A;  4XYQ A;  4DR1 L;  2CH4 W;  5ELN A;  1TS4 A;  3E3X A;  1K8M A;  1U4L A;  3GTL H;  4UY8 C;  1HTL D;  1LTS D;  2L1B A;  5IY0 A;  5CYU A;  1B1Z A;  1X3G A;  3GD7 A;  4TSS A;  3IAY A;  1JE4 A;  5JJI A;  4EQO A;  1Q8K A;  2BH2 A;  1BXT A;  1V43 A;  4R8N A;  2KVM A;  3HOV B;  1JWS D;  4GN3 B;  5ELE A;  4JCV E;  1ILP A;  1B53 A;  4KJO A;  2DUD A;  3JAM i;  5AJ3 Q;  2JJQ A;  2N3S A;  2RDG A;  1QE6 A;  3KJP A;  1DGS A;  3I72 A;  1STB A;  5C44 H;  4H44 C;  5I6Y A;  1TWC B;  3S15 B;  3E5S A;  1EZ6 A;  3OOC A;  2WAC A;  3I4N H;  5FO7 B;  4KD3 A;  2RSO A;  2K5N A;  1PH8 A;  2XTI A;  3H0G H;  3JAM L;  3Q8D A;  1SYE A;  4XTC S;  4DV7 L;  3TP6 A;  1VQF A;  1PTO C;  5M3F B;  1S3O A;  3DEO A;  3LWU A;  1OXS C;  1EIF A;  4X3T A;  1Q90 A;  1SND A;  5M3M G;  4JYA Q;  4DUY Q;  2UUA Q;  2YU9 H;  1Y69 U;  3J7Z C;  3BVM A;  4LNQ A;  2JA6 H;  5FJ8 G;  3Q23 A;  1E2Z A;  1TS2 A;  3I8Z A;  3J7Y W;  1BBX C;  1GUO A;  1VQH A;  5FO8 B;  3G48 A;  4GN4 B;  4IUN A;  4UP9 A;  5JVG 3;  4LK1 C;  2FHT A;  3RZO H;  1HA5 A;  1A0I A;  3A55 A;  1NMG A;  3R3O A;  4C1N K;  4JBW A;  2UUC Q;  2CQO A;  2VQF Q;  2ZT9 C;  4GNX B;  3TDQ A;  2KEC A;  2Q8R E;  1TWA H;  3W3A A;  3S1R H;  4IUU A;  3HS0 C;  4CDD C;  1VQB A;  4OWX B;  2LSS A;  3VR5 A;  2LKV A;  3PIO 3;  2Z9H A;  3TP5 A;  3DWQ A;  1YIJ A;  2A68 C;  1D2B A;  2EJF C;  4FO2 A;  1FL0 A;  1IHZ A;  1IBL L;  5C44 G;  4DV3 Q;  1LTB D;  4HED A;  1EIG A;  1TWG B;  5M5X B;  1SEB D;  3I56 A;  4IUR A;  2RA4 A;  2Y0S E;  3HOZ G;  2SNS A;  1CT1 D;  3QWN A;  1F77 A;  1NR2 A;  3ZYY X;  2K5W A;  2L11 A;  2MPM A;  4AYB B;  1RCV D;  2CHB D;  1VQK A;  1DYQ A;  2ENB A;  1UE7 A;  1XX8 A;  2Y0S G;  1X6O A;  1EUJ A;  5EPJ A;  3W1B A;  1XJV A;  2JA6 G;  4V19 0;  1K3R A;  1OXX K;  4YCV A;  3M3Y B;  1Z9F A;  1W3S A;  5LMU Q;  4H0L C;  1TWH H;  4F7X A;  4HSP A;  5L37 A;  1EQQ A;  1NR4 A;  2EYP A;  3CRL C;  1KQS A;  3Q6S A;  4UHV A;  4UP8 A;  2EE1 A;  5EGT A;  3H91 A;  4K5X A;  1FGU A;  3PIO A;  2N88 A;  2JP1 A;  4KHV A;  5M3F H;  1YZ6 A;  3GTL B;  1WFQ A;  2HQE A;  2VXW A;  1D7Q A;  4IOA A;  4B9W A;  3ULL A;  4CKB A;  1WTQ A;  3I70 A;  4QCL A;  4L5Q A;  3TRZ A;  2ICE C;  3WOF A;  1S5B D;  4OWT B;  4QIW E;  1AEX A;  4L5S A;  2IL8 A;  2XVS A;  4DR3 Q;  1PTO B;  3QJY A;  5JPM C;  3CW2 C;  1HZ9 A;  1PLF A;  1U0L A;  1XYI A;  3HRZ C;  4OO1 H;  5J39 A;  2VQE L;  1CTM A;  1VCI A;  5BN4 A;  1L1O B;  3J80 i;  2F4V L;  5M5W H;  2F0M A;  1A6X A;  5IGG A;  1JT8 A;  4OO1 I;  3T1Y Q;  3NQT A;  2F0S A;  4CKE A;  3I4M G;  4I7A A;  2CCZ A;  3KFU A;  1WOC A;  1ZXT A;  4JPB W;  1WTR A;  3I91 A;  3MTS A;  3NPP A;  3E0E A;  3JC6 6;  1SR3 A;  1A3V A;  4RWS C;  1WTP A;  5D14 A;  2ASB A;  3I7F A;  3EN2 A;  5HGT A;  4WFN 3;  3VR2 A;  4KJN A;  3M9B A;  1KLU D;  1PRT F;  1K3B C;  5KEE A;  2Z6K A;  2MUY A;  4ME5 A;  3VYU A;  1CSQ A;  3CQZ B;  4IUT A;  2UXC L;  2UXB L;  1RKN A;  1X56 A;  4X64 L;  1HH2 P;  2UUB Q;  2BCO A;  4K0K Q;  4OO1 G;  2KUM A;  3NSW A;  5M9O A;  4LUO A;  3MXN B;  3OWF A;  3ICE A;  2B2Y C;  4A3G G;  4LF5 Q;  4BY1 G;  1XNQ L;  2Z1C A;  4CGY B;  3PUY A;  4DV5 Q;  5CV9 A;  1I6H B;  3FVQ A;  1S5D D;  2I5H A;  3TEH B;  5AFW A;  1LAB A;  3I4N B;  3C2P A;  3GTQ H;  3HOX G;  1HNX L;  1H9S B;  4EQ5 A;  2EVB A;  2EYO A;  2K5H A;  4P71 A;  1SXT A;  4ZLT F;  1M8A A;  1Q46 A;  2NUC A;  2H5X A;  4K2K A;  2JE6 I;  5IE8 A;  1AP0 A;  2E8G A;  1EYD A;  1HQM C;  4JC0 A;  2NB0 A;  1SFO H;  2PPB C;  1ENA A;  5C4X B;  2FMM A;  4HJ7 A;  4DV5 L;  3MEF A;  2VQE Q;  2XWB B;  3RUZ A;  3C1E A;  1E3P A;  1VF7 A;  3S2H H;  1B9M A;  1PV4 A;  4LAA A;  3RNU A;  2JA7 B;  4A3F B;  4ZCK A;  1WD0 A;  2BH8 A;  4GOP B;  5FK9 C;  3VA7 A;  2K75 A;  3TN2 A;  3HKS A;  1X3Q A;  4LF9 L;  1SE3 A;  4P75 A;  1GKH A;  4PMW A;  3IFT A;  4OEL B;  2RQX A;  1B3A A;  2L9H A;  3P75 A;  4DV4 Q;  4L63 B;  4X6A H;  1EL0 A;  5IYB G;  4DV2 Q;  1SLJ A;  5CV4 A;  3UDX A;  1TVX A;  1IXR A;  1AN8 A;  4L8J A;  1TWG H;  3S1Q B;  4K2L A;  1CZG A;  2EPB A;  2JYO A;  1HNW Q;  2LFN A;  3KLR A;  2B2T A;  3PO3 B;  4JI4 L;  4HCE A;  4EX5 A;  3OMG A;  3KLS A;  1BO0 A;  4DK1 A;  2MHV A;  1OTC A;  1QUQ A;  3E0J A;  5COR A;  4HJ9 A;  1L0X B;  4B3S L;  2AQ3 B;  1HZB A;  1P16 A;  5I2Y A;  2UXC Q;  2UXB Q;  2KCN A;  3WDN A;  2E76 C;  3HKZ G;  3TZU A;  3CCL A;  2C9O A;  2NN6 G;  2E2I H;  2C35 B;  1NAP A;  4A4I A;  4JI2 Q;  1PHJ A;  1LTT D;  1O7I A;  2O4X A;  3FPU B;  4IAL A;  5C3E B;  1CA5 A;  1T9H A;  1E2V A;  3PUX A;  2XRS D;  4PQX A;  1AH9 A;  4DV2 L;  1Y1V H;  1NBW A;  3FKI B;  3IRB A;  3GTO H;  4ALP A;  1VQ8 A;  5NUC A;  1H9R A;  2IPK D;  3EIV A;  3K57 A;  1I4P A;  3PMF A;  3UDF A;  1OXT A;  1EQV A;  2AUJ D;  1HUM A;  4A3I B;  5G3L F;  1UEB A;  1WD1 A;  3NTI A;  2VZA A;  3PIP 3;  2RSN A;  3G7L A;  2RDH A;  5IWA Q;  1KXL A;  5KNC A;  3P7J A;  4JBM A;  2MP1 A;  3K6O A;  1LTR D;  2WII B;  3EBE A;  1UAP A;  1HZC A;  5DAU A;  4DKA C;  2B2W C;  1C0A A;  4DN4 M;  1H9S A;  4OIJ A;  1UEA B;  3HOX B;  4A3K B;  4PNY A;  4KHP L;  2WFW A;  4RFB A;  1G51 A;  1TS5 A;  4ODG A;  2G5D A;  3GDE A;  1BCP B;  1HNX Q;  2KCT A;  2R6G A;  5HY6 A;  4R9W A;  1CKN A;  1SNM A;  2HQL A;  5J22 A;  4BBS H;  3KLS X;  3RZD B;  2K6A A;  2QKI C;  1A3T A;  3DXJ C;  2F0G A;  3BU2 A;  2VNU D;  3NTH A;  4XXE A;  3LWE A;  5BN5 A;  1NE3 A;  3HOW B;  4LF5 L;  4DNR B;  3OHX C;  1LYL A;  1E7Z A;  2OEO A;  3SEB A;  3EA6 A;  4FXK C;  3MEH A;  2SEB D;  2I46 A;  2UU9 L;  1XPO A;  1HZA A;  1QVC A;  1RTN A;  3STB D;  1X9N A;  3AMU A;  2JA8 H;  1A15 A;  2NVY B;  5KNB A;  1L1O A;  4G57 A;  2B2U A;  1IBL Q;  1A63 A;  2PI2 A;  1KLG D;  3CP0 A;  2XRQ D;  1FVI A;  2XSC A;  4DA2 A;  2VUM H;  2K14 A;  5H1S E;  5G3L D;  4OX9 Q;  4B3M L;  1ZYR C;  4KHP Q;  1UUP A;  1YI2 A;  3SR1 A;  2K50 A;  1PTO D;  4NXN L;  1EFW A;  4ZUI A;  2JA9 A;  4PZ7 A;  4H13 C;  1F2L A;  2EOT A;  4K6L A;  4YHH Q;  4A3L H;  1PRT B;  5C4J B;  3FDT A;  2OF1 A;  4DV4 L;  1K0S A;  3CC2 A;  4JI3 L;  2NWG A;  2PNR C;  2PI2 E;  3F2C A;  1XMQ Q;  4BA2 I;  1HTP A;  4CJ0 B;  2BDO A;  1E24 A;  3BZK A;  4TRD A;  3SK6 A;  2N8N A;  4DAM A;  4ID6 A;  1C9O A;  1KL9 A;  1Q12 A;  3K8A A;  3ONA B;  4M1U B;  3BYT B;  4A3B H;  3M4O H;  1B50 A;  3D6C A;  1J5E L;  1SNO A;  2YTY A;  3PQI A;  1K8A C;  4PMB A;  3KJO A;  1KDB A;  1T5X D;  5FOB B;  3B6Y A;  1JB3 A;  1MHW C;  3CMA A;  4A3K G;  1I5F A;  1NSN S;  1MIU A;  5F2D A;  3BYY B;  1I3Q B;  2OT2 A;  2R7F A;  2L0C A;  1CA6 A;  4FDB A;  4RGT A;  3FPP A;  3WWV A;  2BA0 A;  4NDX A;  4DR3 L;  1WCM G;  3BDC A;  5M5W B;  2HIV A;  4OIK A;  1GUS A;  1TU2 B;  1FJG Q;  5AJ3 L;  1V1P A;  1K83 B;  2E75 C;  3HOZ B;  3K59 A;  3H09 A;  3UI2 A;  3I4M B;  3OW2 A;  1CKM A;  1R4Q B;  4DR5 L;  3P20 A;  4A93 G;  2DNC A;  3W2D A;  5C44 B;  1F9P A;  3S9W A;  4JI4 Q;  1XMO Q;  4ZUJ A;  5C3E G;  3S14 H;  3TME A;  1ENC A;  5LL6 X;  1XPU A;  1RDP D;  3GTP B;  1CUK A;  4YY3 L;  1JOK A;  1V1P B;  2CW0 D;  4UDU C;  4KK7 A;  1SYG A;  2A73 B;  2B8F A;  5HUR A;  5I2X A;  2RBM A;  5J3B A;  1SE2 A;  1G6Z A;  4FXG C;  1SE4 A;  2NYZ D;  4JYA L;  3BG3 A;  1C7Y A;  5KIX A;  1S5C D;  3GTM H;  3A5U A;  1WTX A;  4A3D G;  3GV6 A;  3UE1 A;  1MD2 D;  1FNU A;  4S3S A;  2PNH A;  4JI7 Q;  4OX9 L;  1U4R A;  1SE8 A;  1W6K A;  4JW0 A;  4RAU C;  4BBS G;  1GUW A;  5KND A;  2EQS A;  1F9Q A;  1HUN A;  5JAV A;  3KF6 B;  4R8I A;  3C46 A;  1TS3 A;  4GNX C;  4KKU A;  2WB1 E;  5EAY A;  4LFA Q;  3CCQ A;  4HIK A;  2CW0 C;  1EU3 A;  2VW9 A;  1DOK A;  4HJA A;  3GTJ H;  3J7A F;  5BR8 L;  1O80 A;  2B2T C;  4G7O C;  2EYH A;  3CPW A;  1CQV A;  3NE5 B;  5BN3 A;  5T1I A;  1TQO A;  4DV6 Q;  2L12 A;  2ZXR A;  4JI0 L;  1N9W A;  1TXY A;  2XN9 C;  3HOU G;  1STA A;  4DNI A;  2L55 A;  2R93 B;  1O78 A;  4JOI C;  4X62 Q;  4LF7 L;  1STE A;  1BBU A;  1EQR A;  1PZJ D;  4K14 A;  3T1H Q;  2EIF A;  3M7N A;  3KDF B;  1EYA A;  3HG9 A;  4MN3 A;  4C2M B;  3RN5 A;  4IUQ A;  4C3J H;  3J80 L;  4KHZ A;  3V2T A;  1RIP A;  1X32 A;  2DGY A;  1X3E A;  4HCS A;  4IJH A;  2WB1 G;  1PH9 A;  1Y8P B;  1LT6 D;  4K0K L;  5KGU A;  1ASZ A;  4K5W A;  4HN7 A;  1SAP A;  3M7G A;  2WP8 J;  4JG2 A;  4QQB X;  5FKA C;  3DM1 A;  2NN6 H;  5M5Y H;  1EOV A;  2IW3 A;  1EEI D;  2CWA A;  4BBS B;  1JWU D;  2K5V A;  5IOD A;  2A1A A;  1XPR A;  4MZ9 A;  3D4R A;  2FMC A;  2ZTD A;  4FVM A;  3CCM A;  3TS0 A;  4RGO S;  3I3C A;  2SNM A;  1B44 D;  3U58 A;  4BBR G;  2RHQ B;  4KMU C;  2CH4 A;  2DY8 A;  4LWC A;  4IPH A;  1IW7 D;  5CBA E;  4CJ1 B;  3M3Y H;  1QZG A;  4A76 A;  1HR0 L;  1X55 A;  3PO2 B;  1PYB A;  1L0W A;  2VB2 X;  3EJI A;  4YHH L;  1VDZ A;  2GA4 B;  3V05 A;  3F1Z A;  2JA8 B;  1M90 C;  5JEA H;  5JEA J;  1DZ1 A;  3S24 A;  3S17 H;  3CXC A;  1RF2 D;  3K5M A;  1LT5 D;  1H9M A;  1MSH A;  3HOY H;  4A3E H;  5BR8 Q;  1QWY A;  3VA5 A;  3T56 B;  5GAG C;  1TII D;  3KLW A;  1EWC A;  2EY6 A;  4KKS A;  1R9T B;  2LS0 1;  2Q2T A;  2MJ8 A;  1STH A;  4OWW B;  2ZM6 Q;  2A6H C;  1K0R A;  1MJC A;  4DV6 L;  3J81 E;  3DWP A;  2OCE A;  4B3S Q;  4BY1 B;  3CC4 A;  4AIM A;  4KN7 C;  1PXU A;  4XQQ A;  4DPG A;  3MA2 B;  2B29 A;  4JBJ A;  5CC4 A;  3CCE A;  4R4C A;  1V1O A;  2AKW B;  1ICW A;  3F8T A;  2CWP A;  4TQU S;  1W6J A;  1ICF B;  1VQM A;  3EQL C;  3E6Z X;  2NVQ H;  1GHK A;  1DD2 A;  3DHQ A;  4A3B B;  4DAY B;  3HOW G;  3DLL A;  1VQ9 A;  3NHH A;  3J81 j;  1TWF H;  5LMU L;  1SDF A;  1SMX A;  5C0X J;  2IHF A;  4OL7 A;  2B63 B;  4NKL A;  1D8L A;  2ZJP A;  5KYI A;  3VYS A;  1JOR A;  4G4K A;  1Y8O B;  3QO2 A;  1B4O A;  2F0P A;  3CCR A;  3PF5 A;  2UXD L;  3QR8 A;  4YCU A;  3K0X A;  3EVQ A;  2BOS A;  2HUG A;  4A3J B;  2J0T D;  3KYH C;  3HOV H;  3ZJY C;  1YNJ C;  4LFC Q;  2JA5 G;  1K73 C;  2YU9 B;  1T5E A;  1SBB B;  1I6H H;  3A8K E;  2UUB L;  2X6G A;  1Q81 C;  1K9M C;  4DK6 C;  2V4D A;  5JEA G;  3HOX H;  1NJI C;  2L5T A;  4DR6 L;  2R93 H;  3HGB A;  3CHB D;  1Y1W H;  1CM9 A;  4K5V A;  4XT1 B;  1QG7 A;  2PW5 A;  2KOL A;  1NCV A;  5ELD A;  5IYB H;  1EFI D;  2AQ1 B;  2I5M X;  2WAQ B;  3NBH A;  1ZEQ X;  1WTW A;  3G6E A;  3PV0 A;  4KY5 A; 
#chains in the Genus database with same CATH homology
 1I6V C;  4IUP A;  1NUC A;  4RCO A;  1ET9 A;  1D6E C;  2YYZ A;  3WOE A;  2A68 D;  5CV5 A;  1I4R A;  3NP8 A;  1GXD C;  1D1K A;  2NVQ B;  2Y0S B;  4DNT B;  3P1H A;  1U4M A;  5DM6 3;  1D5M C;  1JR0 D;  2PZT A;  3Q24 A;  2Z8L A;  2PMZ B;  3U9S A;  1DJR D;  1Y1V B;  1QNK A;  3GTK B;  4RH6 A;  4NMZ A;  2FJ2 A;  5KYL A;  1VMP A;  1STG A;  2IWH A;  4A3E B;  3A7L A;  2F0N A;  1WCM B;  1JWM D;  3LNN A;  3U9O A;  2QEJ C;  3MHB A;  2B2V A;  2D62 A;  3HOY B;  2XNA C;  4KN4 C;  4PMC A;  5A35 A;  3MFG A;  2IX1 A;  2F0J A;  3K5L A;  2E2J B;  2H1E A;  2HCC A;  4X3K A;  3R93 A;  3D4D A;  1BCP D;  5E4W C;  2KJX A;  2F4I A;  3D4W A;  3QIA A;  3VR3 A;  2D2C C;  5M5Y B;  5CMD A;  1SJE D;  2N55 A;  2R92 B;  2F0O A;  3NBI A;  3ERO A;  4A3G B;  5JJZ A;  2NVX B;  1EY0 A;  1HPC A;  5EKI A;  1CK1 A;  4L6T B;  5J1Z A;  2JSO A;  3IKJ A;  4RHS A;  1EY5 A;  1GHJ A;  2PZW A;  2ICI A;  2D5D A;  4IFD I;  1Y8N B;  3MXG A;  1DXM A;  5C5M A;  4A3D B;  3GTM B;  3SDZ A;  2TMP A;  1EY8 A;  1OXV A;  3PUZ A;  2B39 A;  2F0T A;  1EY4 A;  2K01 A;  5COY A;  3O13 A;  4TKO B;  1HQR D;  1GUN A;  4ULL A;  2K5Q A;  2AWO A;  3SK5 A;  2F1M A;  3GTJ B;  3H6M A;  3GQB A;  1I4X A;  1VF5 C;  2BA1 A;  4BA1 I;  3M85 A;  5CBE E;  4QF4 A;  1IKM A;  1QCB D;  4LJZ C;  5IOC A;  2IJ0 A;  1HCZ A;  2K03 A;  3S1R B;  4QIW B;  1WVL A;  2QCP X;  1RTO A;  3BDL A;  3K5O A;  3VR4 A;  3S16 B;  1MGS A;  5T1G A;  2EXZ A;  3RLF A;  1L0Y B;  1EWH A;  1Z7T A;  1PZK D;  4KY6 A;  2A6H D;  2B2W A;  4DAY A;  4F87 A;  1PRT D;  3OSO A;  2A69 D;  1Q1B A;  1DOM A;  4ZAI A;  1GUT A;  3HKZ B;  4CBV A;  5LL6 S;  3IFD A;  3GP7 A;  5A2Q L;  3C1F A;  3T13 A;  4C3H G;  3NQI A;  2H4O A;  2AWN A;  1IYU A;  2KED A;  1II3 A;  5I6W A;  3A8I E;  5JPN C;  1IW7 C;  2JXM B;  2A69 C;  3HOU B;  3NWS A;  3GV3 A;  2Q8I B;  3A8J E;  2K5D A;  4BS9 A;  5K36 G;  3DEP A;  4DGZ A;  3T4A C;  2F0E A;  1YNN C;  3DWA A;  4A3M B;  3CRK C;  2EY1 A;  3QB3 A;  4DXF A;  1UNS A;  1TWH B;  2CVR A;  3AB9 A;  2FFK B;  2F0W A;  4ZK9 B;  2AQ2 B;  2NZ1 D;  1X3P A;  1CHP D;  1SFO B;  3OIQ A;  4DAP A;  5KRU A;  1BUV T;  2ZXP A;  4RA8 A;  4ZRZ A;  5EKL A;  1PZI D;  4HSV A;  2EJG C;  5EBD A;  5TSS A;  4MIU A;  3SHL A;  5D65 A;  3MC0 B;  4E6I A;  2EYJ A;  2JA6 B;  2R7Z B;  1G91 A;  3S1N B;  4C3H B;  1BR9 A;  1LT4 D;  2EDG A;  4F8M A;  4FYD A;  4FF2 A;  1DON A;  2KEE A;  1TKW B;  3D31 A;  3HP3 A;  1BNZ A;  4ZKB B;  1EZ8 A;  1RJT A;  4DAV A;  4HMJ A;  4HMI A;  3KK7 A;  2DN8 A;  1TWF B;  1LV9 A;  1SYD A;  4QMG A;  3MAQ A;  1DCZ A;  1O7L A;  2K1B A;  3LX0 A;  2DY7 A;  1MBY A;  2X6L A;  2A74 C;  4MHE A;  2B8G A;  4C1N I;  3T53 B;  5IGB A;  2EY2 A;  3Q0A A;  1CI3 M;  3SE0 A;  2F0V A;  3N6R A;  3RD4 A;  1C48 A;  4X3S A;  1JC7 A;  3OWE B;  4DFA A;  3FMC A;  1JOQ A;  4IN3 A;  4IFD G;  4J1M A;  4LMQ D;  2WB1 B;  2F0U A;  3R2T A;  3X3M A;  3BS1 A;  1VMC A;  2WKD A;  2ZXO A;  4C3I B;  3S2D B;  4FF3 A;  4Q0F A;  2B2U C;  5IGD A;  2EY5 A;  3SK4 A;  1KAB A;  1CHQ D;  3SXH A;  4PV1 C;  2JA5 B;  1A3U A;  1WTV A;  4ZKC B;  1J8I A;  2KCC A;  1E2W A;  5ELF A;  2TSS A;  2DNE A;  2NTT A;  1EIH A;  4C56 C;  3F2U A;  3OW7 A;  1Z47 A;  4F88 A;  1I4G A;  5E4X A;  3NUC A;  3M4Y A;  5C0X H;  1H9K A;  3IL8 A;  5JOB A;  4KTA A;  1D5Z C;  2D9U A;  3URY A;  2Z4I A;  1FYC A;  4XQJ A;  4KI0 A;  4B08 A;  2IX0 A;  1IKL A;  2M2L A;  1LT3 D;  1I4H A;  4ZYS A;  3L9A X;  2VB3 X;  5IGF A;  3MVV A;  3BVG A;  2F0K A;  3NXW A;  1Q8I A;  3X3N A;  1PTO F;  4FP5 D;  3GTQ B;  3K5N A;  1LTA D;  1AZQ A;  2QIL A;  1FD7 D;  1PYW D;  1LAC A;  1PDQ A;  3I4L A;  4XT3 B;  3OIP A;  4BWG B;  2F03 A;  2O5I C;  3GTO B;  4XDX A;  3TP7 A;  1TWA B;  3N52 A;  5E1F A;  1R4P B;  3FRP B;  2A6E D;  4I7Z C;  3RMH A;  3A56 A;  5D3I B;  1EEF D;  1LTI D;  5M3M B;  1XTC D;  2O5J C;  5ELB A;  3BDO A;  2RVL A;  3C3L A;  5IGE A;  3Q22 A;  2KHS A;  4QB4 A;  1SYF A;  3MZ5 A;  4RCN A;  4C3J G;  2IX3 A;  1SNP A;  2F3V A;  3DMU A;  4HAE A;  3R8B A;  2G9H D;  3OPO A;  3VR6 A;  4K6D A;  3PUV A;  1A2U A;  1BQQ T;  3KF8 A;  1G2T A;  3NWT A;  1PFB A;  4EQP A;  1F2Z A;  4BY7 B;  2BE5 D;  4J6H A;  1U9R A;  4G7H C;  4O1N A;  5I9P A;  3MXN A;  1EYC A;  2WIN B;  1FNW A;  1S4Z A;  2SOB A;  1ONL A;  2MGS A;  1WTO A;  2EJM A;  2PW7 A;  5C4H A;  1IYV A;  1SMY C;  2B2V C;  2QDB A;  1ZKO A;  4U67 3;  4HR7 B;  4YIJ A;  1M4V A;  5FO9 B;  2R61 A;  2F3W A;  1KTK A;  3L7Z C;  4GZY C;  3SK8 A;  5E3F A;  3HZX A;  4P2C B;  1ET6 A;  5C3X A;  4RGN A;  2E2D C;  5EPK A;  1BCP F;  5IGC A;  5DNF A;  2LMC B;  2K7V A;  1TY0 A;  3FEW X;  4ILW A;  3S17 B;  2J4X A;  5DM7 3;  4CHT B;  1C8C A;  5IIF A;  1F9S A;  2PCF B;  4QUC A;  5FLX L;  1ML0 D;  3VYR A;  3R2I A;  3A54 A;  3I73 A;  2F0L A;  4QUF A;  1EY6 A;  4BBR B;  4DXG A;  2EYF A;  2KQ3 A;  4RHR A;  4OHJ A;  1U4P A;  3T51 B;  3ND9 A;  4O42 A;  1RD9 D;  1Y1W B;  4KD4 A;  1TY2 A;  1SNC A;  1ILQ A;  4WOR A;  1SYC A;  3ERQ A;  4FXD A;  5EKK A;  1JOO A;  5C0X I;  3J7A V;  5EPL A;  5C6A A;  2SDF A;  4C3I G;  4DF7 A;  1KDC A;  1GJX A;  4XIG S;  2J7Z A;  1FGB D;  1OO9 B;  1BCP C;  3H0G B;  4V0B A;  4KKT A;  5DEH A;  4RGM A;  3RZO B;  4FF4 A;  4WJW A;  2K28 A;  2A6E C;  1JCK B;  1AW7 A;  4N9P A;  1E0B A;  2HDL A;  2L4N A;  3V96 A;  1G29 1;  4X3U A;  3NK9 A;  3MXP A;  5D3D A;  5I4D A;  1FR3 A;  1PFM A;  1YNN D;  1HRJ A;  3T16 A;  1H9J A;  4KY7 A;  4IQZ A;  1F2Y A;  1LTG D;  3KUP A;  4IZ8 A;  4CJ2 C;  1ZYR D;  1KAA A;  5FLX E;  1KDA A;  3TZD A;  1QIL A;  5EQ0 A;  2IT1 A;  1ENF A;  5IT9 E;  1G2S A;  3ITP A;  4Z9C B;  1GUG A;  4A93 B;  2K33 A;  2K32 A;  2EYM A;  3GTG B;  4FF1 A;  2F0F A;  4RKL A;  3AU7 A;  1O7Z A;  3PUW A;  2VUM B;  1YNJ D;  1CZW A;  2F0H A;  1V8Q A;  2F0Q A;  3HEJ A;  1KNE A;  1DOL A;  4Y7N B;  2E2H B;  1XWE A;  4IUV A;  1MI2 A;  2JEB I;  1HA6 A;  3MWY W;  2EYL A;  3CKI B;  2F0D A;  2ID0 A;  1F2M A;  3DUZ A;  2LY7 A;  3D6W A;  1D5X C;  2HDM A;  1EU4 A;  1IL8 A;  4N9T A;  1C4Q A;  3QOL A;  1LO5 D;  1OXU A;  1BF4 A;  2E2I B;  3OMC A;  1KNA A;  3ND8 A;  2BDN A;  4UAI A;  5EJW A;  2M00 A;  2WV6 D;  2M9V A;  1QOH A;  3EFX D;  4KV6 A;  1O7Y A;  4IFD J;  1HFG A;  2OXP A;  4M8A A;  5ELC A;  3VYT A;  2I07 B;  4HTH A;  4EVO A;  5C4Z A;  1SSO A;  5C3W A;  1CQF A;  5IT9 L;  1Q1E A;  3BVZ A;  1B9N A;  2K05 A;  1CFM A;  3K58 A;  1MSG A;  2NVT B;  2XWJ B;  2HCI A;  1BOS A;  1ESR A;  3NTK A;  1PTO H;  3A7A B;  5C0X G;  1G8Z D;  3TP8 A;  4K8I A;  4IFD H;  1STN A;  3H94 A;  1PMR A;  4C3J B;  3D3R A;  1F9R A;  2NN6 I;  3J80 E;  4XYO A;  1JQY D;  5EBC A;  3CU7 A;  1J9O A;  3D8G A;  4DU9 A;  2EZV A;  5I9O A;  1RHP A;  1AZP A;  1EQT A;  5C5L A;  2NTS A;  4J8Q A;  4K8J A;  1Q3L A;  3BZD B;  1TR5 A;  3K7A B;  1Z6H A;  3K0Y A;  3QOJ A;  3J81 L;  1EY9 A;  3SVM A;  4NW2 A;  1ROD A;  4RKB A;  3QG1 A;  1EY7 A;  4EQN A;  2QF7 A;  1ESF A;  4EGV A;  2AUK A;  3I90 A;  4ABN A;  1LLR D;  1K8O A;  3TBI B;  2K04 A;  2JEA I;  2B2Y A;  4CKC A;  2Q8T A;  4NP5 A;  4H7B A;  1HFN A;  4U68 A;  5K5P A;  1EOT A;  1FNV A;  1PRT C;  1QB5 D;  2NBF A;  5CGK A;  1SNQ A;  2KA7 A;  2CQA A;  2X69 A;  5CV7 A;  4I65 A;  4DK0 A;  1I4Q A;  2PO4 A;  1SJH D;  3MFY A;  2PZU A;  1D1I A;  1I50 B;  4WRD A;  1HXY D;  1S5F D;  4OGQ C;  4G7Z C;  4JK1 C;  1BDO A;  3S14 B;  5K36 H;  3KBX A;  1QNU A;  5JVH 3;  1STY A;  3MXU A;  1XXG A;  2RDF A;  5CV6 A;  5ISR A;  5LHY 1;  1AFP A;  2WKC A;  1S5E D;  2G9D A;  3H3V C;  2A5H A;  3KBG A;  4B9X A;  3S2H B;  1TT2 A;  5CV8 A;  1QJO A;  1SMY D;  4XQN A;  3L3O C;  2Z4H A;  2PYK A;  1SYB A;  4FNF A;  4Q5V A;  4ZQ3 A;  3M4O B;  3S1M B;  1HHV A;  1GOZ A;  2F0I A;  2E74 C;  2FIN B;  1JIC A;  2O2L D;  5CR3 A;  3JAM E;  1A2T A;  1DM0 B;  2BE5 C;  1B2T A;  5A2Q E;  2RKS A;  2PQE A;  2XIW A;  2C5C A;  3TSS A;  3G6J B;  2R3Z A;  1PFN A;  3GO5 A;  4XYQ A;  1TS4 A;  1K8M A;  1U4L A;  1HTL D;  1LTS D;  2L1B A;  5CYU A;  1B1Z A;  3GD7 A;  3IAY A;  4TSS A;  1JE4 A;  4EQO A;  1BXT A;  1V43 A;  4R8N A;  2KVM A;  3HOV B;  1JWS D;  5ELE A;  1ILP A;  1B53 A;  4KJO A;  2RDG A;  1QE6 A;  3I72 A;  1STB A;  4H44 C;  5I6Y A;  1TWC B;  3S15 B;  3E5S A;  1EZ6 A;  3OOC A;  2WAC A;  5FO7 B;  4KD3 A;  2RSO A;  3JAM L;  1SYE A;  4XTC S;  3TP6 A;  1PTO C;  5M3F B;  3DEO A;  3LWU A;  1OXS C;  4X3T A;  1Q90 A;  1SND A;  1Y69 U;  3BVM A;  3Q23 A;  1E2Z A;  1TS2 A;  3I8Z A;  3J7Y W;  1BBX C;  1GUO A;  5FO8 B;  4IUN A;  5JVG 3;  4LK1 C;  2FHT A;  1HA5 A;  3A55 A;  3R3O A;  4C1N K;  4JBW A;  2ZT9 C;  3TDQ A;  2KEC A;  2Q8R E;  3W3A A;  4IUU A;  3HS0 C;  3VR5 A;  2LKV A;  3PIO 3;  3TP5 A;  3DWQ A;  2A68 C;  1D2B A;  2EJF C;  4FO2 A;  1IHZ A;  1LTB D;  4HED A;  1EIG A;  1TWG B;  5M5X B;  1SEB D;  4IUR A;  2RA4 A;  2SNS A;  1CT1 D;  3QWN A;  1F77 A;  1NR2 A;  3ZYY X;  2K5W A;  2L11 A;  2MPM A;  4AYB B;  1RCV D;  2CHB D;  1DYQ A;  2ENB A;  1XX8 A;  5EPJ A;  4V19 0;  1OXX K;  3M3Y B;  4H0L C;  4F7X A;  4HSP A;  1NR4 A;  2EYP A;  3CRL C;  3Q6S A;  2EE1 A;  5EGT A;  3H91 A;  4K5X A;  2N88 A;  2JP1 A;  4KHV A;  3GTL B;  2HQE A;  2VXW A;  4B9W A;  4CKB A;  1WTQ A;  3I70 A;  4QCL A;  2ICE C;  3WOF A;  1S5B D;  1AEX A;  2IL8 A;  2XVS A;  1PTO B;  3QJY A;  5JPM C;  1PLF A;  1XYI A;  3HRZ C;  4OO1 H;  5J39 A;  1VCI A;  1CTM A;  5BN4 A;  2F0M A;  1A6X A;  5IGG A;  4OO1 I;  3NQT A;  2F0S A;  4CKE A;  1ZXT A;  1WTR A;  3I91 A;  3MTS A;  3NPP A;  1A3V A;  4RWS C;  1WTP A;  5D14 A;  5HGT A;  4WFN 3;  3VR2 A;  4KJN A;  1KLU D;  1PRT F;  5KEE A;  2MUY A;  4ME5 A;  3VYU A;  4IUT A;  3CQZ B;  1RKN A;  2BCO A;  4OO1 G;  2KUM A;  3NSW A;  5M9O A;  3OWF A;  2B2Y C;  2Z1C A;  4CGY B;  3PUY A;  5CV9 A;  1I6H B;  3FVQ A;  1S5D D;  5AFW A;  1LAB A;  3I4N B;  3C2P A;  1H9S B;  2EVB A;  2EYO A;  1SXT A;  4ZLT F;  1M8A A;  2NUC A;  4K2K A;  2JE6 I;  1AP0 A;  1EYD A;  1HQM C;  2NB0 A;  2PPB C;  1ENA A;  5C4X B;  2FMM A;  2XWB B;  3RUZ A;  3C1E A;  1VF7 A;  1B9M A;  4LAA A;  2JA7 B;  4A3F B;  1WD0 A;  5FK9 C;  3VA7 A;  3TN2 A;  1X3Q A;  1SE3 A;  4PMW A;  3IFT A;  2RQX A;  1B3A A;  2L9H A;  3P75 A;  4L63 B;  1EL0 A;  5CV4 A;  1TVX A;  1AN8 A;  4L8J A;  3S1Q B;  4K2L A;  1CZG A;  2EPB A;  2JYO A;  2LFN A;  3KLR A;  2B2T A;  3PO3 B;  4HCE A;  3OMG A;  3KLS A;  1BO0 A;  4DK1 A;  2MHV A;  3E0J A;  5COR A;  1L0X B;  2AQ3 B;  5I2Y A;  2KCN A;  3WDN A;  2E76 C;  3TZU A;  2C9O A;  2NN6 G;  1NAP A;  1LTT D;  2O4X A;  3FPU B;  4IAL A;  5C3E B;  1CA5 A;  1E2V A;  3PUX A;  2XRS D;  4PQX A;  3FKI B;  5NUC A;  1H9R A;  2IPK D;  3K57 A;  1I4P A;  3PMF A;  1OXT A;  1EQV A;  2AUJ D;  1HUM A;  4A3I B;  5G3L F;  1WD1 A;  3NTI A;  3PIP 3;  2RSN A;  3G7L A;  2RDH A;  5KNC A;  3P7J A;  2MP1 A;  3K6O A;  1LTR D;  2WII B;  1UAP A;  5DAU A;  2B2W C;  4DN4 M;  1H9S A;  4OIJ A;  1UEA B;  3HOX B;  4A3K B;  4PNY A;  4RFB A;  1TS5 A;  4ODG A;  1BCP B;  2R6G A;  4R9W A;  5J22 A;  1SNM A;  3KLS X;  3RZD B;  2K6A A;  2QKI C;  1A3T A;  3DXJ C;  2F0G A;  2VNU D;  3NTH A;  4XXE A;  3LWE A;  5BN5 A;  3HOW B;  4DNR B;  3OHX C;  3SEB A;  2OEO A;  3EA6 A;  3MEH A;  4FXK C;  2SEB D;  2I46 A;  1RTN A;  3AMU A;  1A15 A;  2NVY B;  5KNB A;  4G57 A;  2B2U A;  1KLG D;  2XRQ D;  2XSC A;  4DA2 A;  5G3L D;  1ZYR C;  1UUP A;  3SR1 A;  1PTO D;  4ZUI A;  4H13 C;  1F2L A;  2EOT A;  4K6L A;  1PRT B;  5C4J B;  3FDT A;  2OF1 A;  2NWG A;  2PNR C;  4BA2 I;  1HTP A;  4CJ0 B;  2BDO A;  4TRD A;  3SK6 A;  4ID6 A;  1Q12 A;  3ONA B;  4M1U B;  3BYT B;  1B50 A;  3D6C A;  1SNO A;  4PMB A;  1KDB A;  1T5X D;  5FOB B;  1JB3 A;  1NSN S;  5F2D A;  3BYY B;  1I3Q B;  2OT2 A;  2L0C A;  1CA6 A;  4RGT A;  3FPP A;  2BA0 A;  4NDX A;  5M5W B;  3BDC A;  4OIK A;  1GUS A;  1TU2 B;  1V1P A;  1K83 B;  2E75 C;  3HOZ B;  3K59 A;  3H09 A;  3UI2 A;  3I4M B;  1R4Q B;  3P20 A;  2DNC A;  3W2D A;  5C44 B;  1F9P A;  3S9W A;  4ZUJ A;  3TME A;  1ENC A;  5LL6 X;  1RDP D;  3GTP B;  1JOK A;  1V1P B;  2CW0 D;  4UDU C;  5HUR A;  1SYG A;  2A73 B;  2B8F A;  4KK7 A;  5I2X A;  2RBM A;  1G6Z A;  1SE2 A;  4FXG C;  1SE4 A;  2NYZ D;  3BG3 A;  5KIX A;  1S5C D;  1WTX A;  3GV6 A;  1MD2 D;  1FNU A;  4S3S A;  1U4R A;  1W6K A;  4RAU C;  1GUW A;  5KND A;  1F9Q A;  1HUN A;  5JAV A;  4R8I A;  3C46 A;  1TS3 A;  4KKU A;  2CW0 C;  1EU3 A;  1DOK A;  3J7A F;  1O80 A;  2B2T C;  4G7O C;  2EYH A;  1CQV A;  3NE5 B;  5BN3 A;  5T1I A;  1TQO A;  2L12 A;  2ZXR A;  2XN9 C;  1STA A;  2L55 A;  2R93 B;  1O78 A;  1STE A;  1PZJ D;  4K14 A;  3M7N A;  1EYA A;  3HG9 A;  4MN3 A;  4C2M B;  4IUQ A;  3J80 L;  4KHZ A;  3V2T A;  1X32 A;  4HCS A;  1Y8P B;  1LT6 D;  5KGU A;  4K5W A;  4HN7 A;  1SAP A;  3M7G A;  2WP8 J;  5FKA C;  3DM1 A;  2NN6 H;  1EEI D;  2IW3 A;  4BBS B;  1JWU D;  5IOD A;  3D4R A;  2FMC A;  4FVM A;  4RGO S;  3I3C A;  2SNM A;  1B44 D;  4KMU C;  2DY8 A;  1IW7 D;  5CBA E;  4CJ1 B;  3PO2 B;  2VB2 X;  3EJI A;  1VDZ A;  2GA4 B;  3V05 A;  2JA8 B;  5JEA H;  5JEA J;  1DZ1 A;  3K5M A;  1RF2 D;  1LT5 D;  1H9M A;  1MSH A;  1QWY A;  3VA5 A;  3T56 B;  1TII D;  1EWC A;  2EY6 A;  4KKS A;  1R9T B;  2LS0 1;  2MJ8 A;  1STH A;  2A6H C;  3J81 E;  3DWP A;  4BY1 B;  4KN7 C;  1PXU A;  4XQQ A;  3MA2 B;  5CC4 A;  1V1O A;  1ICW A;  4TQU S;  1W6J A;  3EQL C;  3E6Z X;  1GHK A;  1DD2 A;  3DHQ A;  4A3B B;  3NHH A;  1SDF A;  5C0X J;  4OL7 A;  2B63 B;  4NKL A;  5KYI A;  3VYS A;  1JOR A;  4G4K A;  1Y8O B;  3QO2 A;  1B4O A;  2F0P A;  3EVQ A;  2BOS A;  2HUG A;  4A3J B;  2J0T D;  1YNJ C;  2YU9 B;  1T5E A;  1SBB B;  3A8K E;  2X6G A;  2V4D A;  5JEA G;  2L5T A;  3HGB A;  3CHB D;  1CM9 A;  4K5V A;  4XT1 B;  1QG7 A;  5ELD A;  2PW5 A;  2KOL A;  1NCV A;  1EFI D;  2AQ1 B;  2WAQ B;  3NBH A;  1ZEQ X;  1WTW A;  3PV0 A;  4KY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...