4JI8Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji8Q00
3GTGH 1EOVA 3CCSA 2VQEQ 2PQAB 1E3PA 4PZ6A 1S40A 1IBML 3PF4A 1B8AA 3K8AA 4PMWA 2VY3A 4L5SA 4DV6L 4GN3B 4QL5A 3I2ZA 4A75A 1IBLQ 3M7NA 4LF8Q 4HIKA 3RLNA 2K75A 4GNXA 3GTQH 2D0OA 1BBWA 4JI3Q 4OWWB 1PV4A 3ULJA 2EQSA 1AE2A 3F2DA 4DR5L 2H5XA 4DUYQ 4YY3L 4BY7H 5DLQE 1EYGA 3CCVA 2NN6G 1Z9FA 2QGQA 2B3GA 2NVYH 2JA6H 4GLXA 2EIFA 1KRSA 2XTIA 4P75A 4IFDI 5K36G 2KCTA 4KI0A 4NXNQ 5M5XH 1TWAH 3S24A 1PH9A 2ID0A 1EQRA 3KDFB 4IO9A 4DV4Q 4A3DH 4OWXB 2JEBI 4EQ5A 3AQQA 2I0QA 2ZJQA 2RHQB 1VQ6A 4GKKL 5LMUL 1X55A 3BU2A 3TS0A 2WAQG 2YTXA 4HJAA 3OW2A 4L5RC 4BBSH 3CAMA 1RL2A 3JC66 5C44H 3PIOA 2ZM6Q 3RN2A 3PUZA 2XGTA 3HOXH 5M3FG 2B63H 4BA2I 4K0KQ 3OTOL 4A3GH 2N3SA 2Y0SE 3D31A 3H0GG 4QY7A 1EIFA 4TVAB 4DK6C 4A3JH 1OTCA 3PO3G 1B70B 2HHHL 1VQLA 4P73A 4R4IA 1QZHA 5IYBG 4DV1Q 3KYHC 3Q8DA 1HZ9A 2UUCQ 4IFDJ 5FLMH 3UE0A 4X62Q 1UE7A 1PYBA 2OTLA 2R7ZH 1U5KA 1LYLA 4KHPL 4BY1G 1VQ8A 4BXXG 3J7A5 3NELA 4DUZL 4UY8C 4B3RQ 3RZDH 1BKBA 4JYAQ 1HNZQ 1FL0A 4BBRG 3NEMA 2WB1E 5HY6A 3U50C 1OXTA 2JA7G 1Q1EA 3NENA 4JG2A 2CKZB 1CUKA 4YCWA 4B3SQ 4DV3Q 2PMZE 4NB3A 2OWOA 3HOVH 2R7DA 4B3ML 5JJIA 3L2PA 3I4MH 3UDGA 3STBD 1Q86C 1P8LA 3F1ZA 3K80C 2F4VL 4JI7Q 3S16H 2MO0A 2FXQA 4XTCS 4AQYQ 1PH4A 2ZJRA 2R92H 1I5FA 5J3BA 1WCMG 4R4TA 4POGA 3GTJH 1Q81C 4JI2Q 4FDBA 4LF5L 2ZTEA 1YI2A 3HOZG 3S15H 2ATWA 1Q8KA 4DR7Q 3AFPA 4IOCA 2R93G 3ER0A 1VQPA 3AEVA 2VZAA 2Q2HA 4OWTB 3PIPA 2R6GA 1QUQA 4RMFA 3J81c 4X66L 2E8GA 2JEAI 5EAYA 1JB7A 4A3FG 1N8RC 3GTPH 1SRUA 3U4VA 3STBC 1IBMQ 2L15A 1PYSB 2Q2IA 2A1AA 3UE1A 3RNUA 3I4NH 3B6YA 3PUVA 2HQLA 4JI4L 4DV6Q 3ULLA 3RZOH 2UUBL 1OXSC 4P72A 5IP9G 4HJ7A 2UXDL 2ZTDA 2KENA 3G48A 5GADC 3ERSX 4YHHL 3SGIA 5IYCH 1VQFA 5M3MH 3PO2G 3HOUG 4DR5Q 1Y1VG 4MZ9A 2WAQE 4DAYB 4YY3Q 4JI1L 1QVGA 3G6EA 2CWAA 2JA5G 1ASZA 1P16A 1YZ6A 4JC0A 1SROA 4QGUA 2VS1A 3H3VI 4X6AH 4GKJL 1IBKL 1J5EL 1H95A 3L7ZC 3W1BA 3BZKA 4DR6L 5AJ3Q 2K52A 1DGSA 2LXKA 3OYYA 4DR1L 5GAEC 5C4XH 1E24A 1PH7A 4OO1G 1L1OA 3FKIH 3KFUA 2AHOB 3CPFA 3GD7A 2ZTCA 4A3IG 1HNXL 2LSSA 4O2DA 2NZHA 1LUZA 4A3EG 1Y1WH 1IYJB 1UEBA 4GKKQ 5C4JH 1L1OC 2YTVA 3RN5A 1VS0A 4WJ4A 2A19A 5LMUQ 4UP7A 3PUXA 1EUJA 2IHEA 2JJQA 1HR0L 1B7YB 2JK8A 3F8TA 1VQ7A 1XNRL 2CQOA 1XMOL 1VQNA 1PH3A 1HH2P 3OTOQ 1VQMA 1UE1A 3K0XA 3M4OH 1FJGL 4X64L 1A8VA 1K83H 2HHHQ 4IPCA 2K50A 4OX9L 2E2HH 2KBNA 1Q7YC 2E2IH 2RF4A 3GDEA 5C0XI 2HT1A 4LFCQ 3W5OA 5JJLA 3TREA 1SR3A 2OCEA 5ELNA 4P71A 4GNXC 4IFDG 1LM0A 1WFQA 2MQHA 3PGZA 1SE8A 2F3IA 2IT1A 1A0IA 3CQZH 5AJ3L 4KHPQ 1OXVA 3H15A 3KF6A 3CC7A 3HKZG 4DUZQ 4H02A 3S1MH 4ME3A 1RIPA 1MKHA 4BA1I 4IPGA 5LMNL 4A4IA 3GO5A 1QZGA 4R4OA 1QVFA 2B29A 2D62A 1D8LA 1K3RA 4LF6L 4DR4L 1TWCH 4EX5A 1VQ5A 4C3HH 4B3MQ 2HIXA 3A74A 3PV0A 1PA6A 3CCLA 3IRBA 2F4VQ 4LF7L 1D7QA 4YCVA 3CP0A 5GAGC 4NXML 2QEXA 2VQFL 2VW9A 4RG1A 1YHQA 1KRTA 2OTJA 5C0XJ 1VCIA 3ULPA 5M3FH 4LF5Q 4A3LG 1YEZA 2PNHA 1S3OA 2N78A 4A76A 4LFCL 3H0GH 4IPHA 4LFAL 4OONA 4LUOA 1S72A 1N33L 1HZCA 2NVTH 4LFBQ 1Y14B 4X66Q 2ZJPA 4DAMA 1PFSA 4L5TA 1QVCA 2C35B 3BZCA 1MIUA 4XIGS 4A3JG 2KHJA 2MO1A 4A3BH 3I4OA 1E7ZA 4L5QA 3CCRA 4JI4Q 2Q2UA 1C0AA 2BA0A 3EN2A 4BY1H 3CMAA 2UUBQ 3TS2A 4BXXH 4A3CH 1EQQA 2UXDQ 1X3FA 4JBJA 3E9HA 3M4PA 1XNQL 5C3EG 5FLMG 4YHHQ 5JEAJ 4BBRH 1N36Q 3CC2A 3GTKH 1AH9A 1PHJA 3T1HL 4YWMA 5IT9c 2JA7H 1PVOA 1IZ6A 1Q12A 2D0PA 3A5ZB 4JI1Q 1K8GA 4JBKA 3HOWG 1KD1C 2VUMG 4A3MH 2I5MX 5JJKA 4HIOA 1TWFH 1IBKQ 1J5EQ 4GKJQ 3CCEA 3S1QH 1X6OA 4DR6Q 1YJ9A 1JE5A 5IP7G 3M85A 3W1GA 1NJIC 1VQKA 4DR1Q 1QUQB 4GLVB 3CC4A 2UXBL 1JT8A 1TWHH 3FP9A 3CXCA 2BA1A 1HNWL 1MJCA 4A93G 4R4CA 3FHWA 1HNXQ 1MJEA 4DV7L 1K0RA 4LW1A 2E2JH 3HOZH 3PUWA 3KLWA 1VQ4A 1GM5A 2R93H 3K7AH 3GTOH 4JOIA 4LF9L 1WOCA 2R92G 1PH1A 3HKSA 3HOYG 1NE3A 2CFMA 3MEFA 1HR0Q 1XNRQ 3VDYA 2NVQH 3HKZE 2WFWA 4DR2L 5IWAQ 1XMOQ 1PH5A 2VNUD 5IYDG 5E7NA 4JOIC 3J81j 4IJHA 3UDXA 2V1CC 4X64Q 4JI6Q 3KF8B 1FJGQ 1PH6A 1NMGA 1CKNA 3KJOA 1N36L 1U0LA 1L2FA 2UUAL 5IP9H 4JBMA 4OX9Q 2UXCL 1UWVA 5ELOA 2JA8G 4MNOA 1G6PA 4IPDA 3D0FA 1VQ9A 3PO2H 1JJCB 4C3IH 4HJ8A 3J7ZC 5FJ8G 2ES2A 1VQBA 4LF4L 1L1OB 1R9TH 3HOUH 1Y1VH 3CF5A 3CMEA 1Q82C 3CCQA 1E1OA 4PZ8A 3G71A 4JI0Q 1A62A 3PCOB 4YWKA 2AKWB 3HFZB 1X3GA 2YYZA 2F52A 1YIJA 5IYCG 5LMNQ 1YVCA 3PSIA 1EIYB 3UDIA 2RCNA 4GOPA 1CSPA 4DKAC 2MFIA 3M3YH 2N49A 1WYDA 4C3JH 1XPOA 5IY0A 1C7YA 2PI2A 4P74A 4LF6Q 4DR4Q 2CWPA 4A3IH 4JI5L 1N32L 1KL9A 1Q1BA 3K81C 3M4QA 2UU9L 4A3EH 4GOPC 1GVPA 1YHBA 4GNXB 2BH2A 4LF7Q 2IY5B 4DV0L 5C4XG 5IWAL 4NXMQ 4NPSA 4A3KG 2VQFQ 4PZ7A 1YJNA 1GO3E 4R1JA 4JI6L 4DR3Q 2A8VA 1X3EA 5C0XG 3CD6A 1VQAA 3LGJA 3J81i 1G51A 1KC8C 1Z47A 4JI8L 1VQEA 4AH6A 4LFAQ 2JQOA 4GS3A 1JJGA 1KAWA 3KF6B 5GROA 1N33Q 2NN6I 1SFOH 1NBWA 2JA9A 1BBUA 1M1KC 4IOAA 4Y7NH 1K9MC 2Q2TA 1YNXA 3PUYA 1C9OA 4JI0L 2ASBA 4JBWA 1VQOA 1I94L 2PQAA 1V1QA 2IHFA 2QA4A 4B3TL 2HIVA 1KQSA 2K4KA 4QQBX 1XPUA 4GLAC 1OXXK 4BY7G 1XMQL 3TQYA 2JE6I 2E5LL 3S2HH 4JCVE 1VQJA 1EFWA 3CCUA 3F2BA 1XNQQ 1CKOA 3KOJA 5JEAG 2JA6G 3CCMA 2GVBA 3A5UA 3T1HQ 5GAHC 1JJ2A 2Z6KA 1X65A 4QIWE 3GTMH 4O0AA 3GTLH 4DV2L 3U58A 3EIVA 4UP9A 3T1YL 3U4ZA 3I55A 1W2BA 4LUVA 4PG3A 4DR3L 1N34L 2Z6KC 1KXLA 3RLOA 1PH8A 4OXPA 2CCZA 4A3DG 4HJ5A 2VL6A 2R7FA 4DK3C 2UXBQ 4JV5L 3RR5A 1L0WA 3S1NH 4QJFA 3PO3H 3S17H 1HNWQ 1HZAA 1UE5A 4X65L 4LFBL 4A3LH 3PF5A 1FGUA 4BBSG 5C44G 2VQEL 4DV7Q 3RLFA 4KHZA 5M5YH 2IX0A 4TQUS 5IYBH 1SMXA 4AYBG 3HOXG 2B63G 3KDFA 2MNAA 4LF9Q 4A3GG 1X9NA 1X54A 4DV5Q 4MTNA 1YJWA 1AE3A 3JAMc 1IBLL 3S14H 3A0JA 4APVA 4DR2Q 1YBYA 2AWOA 4LF8L 2YV5A 4JI3L 3E0EA 4HIMA 3TRZA 1W3SA 3ZJYC 1E22A 2UUAQ 2UXCQ 5BR8Q 4DUYL 3J80c 2R7ZG 4LUZA 4WJ3M 2ALYB 1CKMA 1CSQA 1N9WA 2AMCB 5C3EH 2NVXH 4DPGA 1XPRA 4LWCA 4LF4Q 4A3BG 2OQ0A 5GQOA 4HIDA 1WJJA 4A3CG 2NZOA 2K5VA 2KCMA 3CW2C 3F2CA 4J15A 4NXNL 2RHSB 3HOWH 2VUMH 1XTDA 1HR0W 2GVAA 1Q46A 1WCMH 1YHAA 3HOVG 4YWLA 4DV4L 5IP7H 2PI2E 3I4MG 3L0OA 3MXNB 1EWIA 1BVSA 4UPAA 4DNIA 1VQCA 4LNQA 1I50H 3WWVA 1VQIA 4A3MG 2BH8A 3EBEA 4A93H 3K7UC 3G4SA 4DV5L 1KIXA 4JI5Q 2ZM6L 3DLLA 1V43A 1N32Q 2UU9Q 4C2MH 3AFQA 4A3FH 1CKNB 1SLJA 5IE8A 4DV0Q 4K0KL 3NBHB 1XJVA 1M90C 3BJUA 4KLKA 4IJLA 3HOYH 4ALPA 3E9IA 1FVIA 5BR8L 3AYHB 2K5HA 5IYDH 5LMNW 5FLXc 3KJPA 4DV1L 4JI8Q 1K73C 1OXUA 2KHIA 2UUCL 3UDFA 1A63A 1G291 5HGQA 1NY4A 4X62L 3ICEA 3I4NG 1K8AC 3I7FA 1TXYA 3JAMi 2JA8H 1X56A 1LTLA 1NMFA 3H3VH 4Y52H 4UP8A 3TEHB 2JA5H 2GN5A 2LXJA 4GOPB 2I5LX 2K5NA 1I94Q 1NTGA 5FJ8H 4HJ9A 4B3RL 4JYAL 1HNZL 1VQGA 4B3TQ 2K14A 2IX1A 5M3MG 2Y0SG 1HZBA 1J6QA 1GD7A 1GKHA 3J80i 1XMQQ 1HJPA 1WI5A 2E5LQ 4B3SL 4DV3L 2YTYA 1PH2A 1T9HA 2DUDA 4AYBE 1VQHA 2YU9H 1ASYA 1YITA 3I56A 4JI7L 1E1TA 4AQYL 1IXRA 3DM3A 3M9BA 3CPWA 3S1RH 3CCJA 1IL2A 1SN8A 4R4QA 5M5WH 3S2DH 2AWNA 2DGYA 4DV2Q 1V9PA 3FKIG 3T1YQ 1UE6A 4JI2L 1TWGH 2N8NA 4YCUA 1I3QH 1KHIA 1N34Q 1I6HH 2Z0SA 4AIMA 1JMCA 2OQKA 4GN4B 1Y1WG 4A3KH 2I5HA 4DR7L 4JV5Q 1O7IA 2WB1G 1VQDA 5H1SE 4OO1I 4POFA 4X65Q 2WP8J 2EXDA 4GN5A
chains in the Genus database with same CATH superfamily
1TWAB 1VDZA 2XN9C 1SE4A 1S40A 1PFBA 4IFDH 4PMWA 2RBMA 4DXGA 4DV6L 3M7NA 4LF8Q 2QKIC 3RLNA 2K75A 4GNXA 3GTQH 4OWWB 3ULJA 4A3GB 1K8OA 2H5XA 4BY7H 5DLQE 2B2UC 4K6DA 1PTOC 1A2TA 1LV9A 3O13A 4N8X1 4GLXA 4IFDI 1PRTC 5IGEA 1MI2A 1TWAH 1PH9A 2BOSA 2KCCA 3OIPA 2NUCA 2VUMB 3L9AX 1Y8NB 4WORA 4OWXB 4EQ5A 4G7HC 4RKBA 1WTHA 1SYEA 3OHXC 3OMGA 3BU2A 1AZPA 3TS0A 4BBSH 3CAMA 3PIOA 3RN2A 1QWYA 4HEDA 3HOVB 2B63H 5ELEA 4BA2I 2O2LD 4OL7A 4A3GH 3VA7A 4K2KA 2Y0SE 3H0GG 5NUCA 4TVAB 1VQLA 4FO2A 4DV1Q 3KYHC 3Q8DA 1S5FD 5FLMH 2EOTA 3DWQA 3I3CA 3BVMA 4BY1G 1RHPA 4ZKCB 1O7ZA 3NELA 4Q5VA 1SJHD 4UY8C 3RZDH 1BKBA 3J80E 4BBRG 2P5ZX 5HY6A 2D5DA 3RZOB 3HOVH 2PMZE 2NBFA 2OWOA 2R7DA 3K6OA 4B3ML 5CC4A 3L2PA 5LL6S 4ME5A 4JI7Q 1CT1D 5M3MB 1O7LA 4HR7B 5HURA 2AQ3B 2ZJRA 1I5FA 1TR5A 3J80L 4JI2Q 3D3RA 3PMFA 4RH6A 1YI2A 4QB4A 3EJIA 2ATWA 1C8CA 2NTTA 2R6GA 3DHQA 3J81c 5C4XB 4X66L 2JEAI 1JB7A 4MN3A 1UUPA 1SRUA 4NW2A 2KJXA 2L15A 3KK7A 4GZYC 1EWHA 1JWSD 3FRPB 3RZOH 5IP9G 1SYDA 2N88A 2ZTDA 3LWUA 4L63B 2A6EC 3ERSX 5CV7A 1AW7A 1I4PA 1VQFA 2XRQD 4XXEA 5M3MH 3HOUG 1KNAA 3M4OB 5D3DA 4YY3Q 1QVGA 4JI1L 3IFDA 2CWAA 2D2CC 1E2WA 2SEBD 4QGUA 2MP1A 4X6AH 5G3LD 4GKJL 3L7ZC 1ET9A 3W1BA 1WTRA 2M9VA 2NTSA 2K52A 1DGSA 3OYYA 4R9WA 4DR1L 5C4XH 1CHPD 1E24A 5A35A 1SBBB 1V1OA 4KY6A 4XQNA 2ZTCA 2F0UA 4A3IG 4A3EG 1BCPF 1UEBA 1YNNC 1EU3A 2MHVA 4WJ4A 2A19A 2IHEA 1XNRL 1VQ7A 5L37A 1I4RA 1HH2P 3OTOQ 1UE1A 3M4OH 1A3TA 4X64L 3GV6A 5J1ZA 2HHHQ 5C0XI 1TVXA 1SDFA 3KBGA 3I70A 3QJYA 1SR3A 4GNXC 4IFDG 2ENBA 3I4LA 3A7LA 1H9JA 4F88A 1A0IA 1OXVA 1ZXTA 2F4IA 2NVTB 2LKVA 2R7ZB 4H02A 1MKHA 5K36H 4IPGA 1IW7C 3A8IE 1NNXA 1B1ZA 1EOTA 4LF6L 1EY0A 4DR4L 4R8NA 3A74A 3PV0A 3CCLA 3MAQA 2VQFL 4XT3B 1EEFD 1KRTA 2OTJA 1F9QA 1VCIA 3ULPA 4LF5Q 2L55A 1YEZA 1LTTD 3BVGA 4K6LA 4A76A 1JOQA 4LFCL 3NXWA 2PW7A 4ABNA 4KJNA 1N33L 2NVTH 4RHRA 4JW0A 3VYUA 3W3AA 2ZJPA 4L5TA 1CHQD 3MFYA 1MIUA 2L9HA 2B2YA 2MO1A 3GTPB 2R93B 3Q23A 2F0IA 3EN2A 4A3CH 3TS2A 2CW0C 2XWJB 1JWUD 5FLMG 5JEAJ 3EROA 1N36Q 3CC2A 4CDDC 3J7YW 4YWMA 3HRZC 5IT9c 5EPJA 4OEMB 1Q3LA 3A5ZB 1KD1C 1DJRD 2VUMG 1ENAA 5JJKA 4M1UB 3MWYW 3K59A 4DR6Q 2BE5C 4C3IB 1JT8A 2SOBA 2BA1A 1HNWL 1MJCA 4J8QA 4R4CA 5DAUA 3FHWA 4LW1A 1VMCA 2FINB 2R93H 4LF9L 1BNZA 1PH1A 1H9SA 3HKSA 1NE3A 2R61A 3MEFA 3VR2A 3M3YB 4XDXA 1RKNA 4IURA 3QIAA 2WFWA 4DR2L 1PH5A 1BCPC 1DONA 3J81j 5CV5A 2CH4A 2Z9HA 1FJGQ 2PMZB 4JI6Q 1JOOA 1NMGA 1CKNA 3L3OC 1L2FA 4JBMA 1Q8IA 2NWGA 2IL8A 1ZYRC 4IPDA 1A3UA 1VQ9A 1JJCB 2J0TD 4C3IH 4LF4L 2E2IB 1Y1VH 3H91A 3E0JA 2OXPA 1CI3M 4UAIA 1WD0A 1S4ZA 1YIJA 5LMNQ 1YVCA 1LT6D 1CSPA 1GJXA 2MFIA 3M3YH 2N49A 1WYDA 1XPOA 2NYZD 5IY0A 4P74A 4ILWA 4JI5L 4FXGC 2MGSA 5CV9A 1GVPA 2F0HA 2BH2A 3KLSX 5C4XG 5EPKA 4NPSA 2QDLA 1O7YA 4PZ7A 1G91A 4DR3Q 2A8VA 4PMBA 5C0XG 3NUCA 3CD6A 4KJOA 4FXDA 1VQEA 2KCNA 5M3FB 4IUTA 5GROA 1T5XD 1BBUA 3PO3B 1A6XA 2Q2TA 1YNXA 1SNQA 2ASBA 5M5YB 2WKDA 5D14A 5M9OA 1XPUA 2XNAC 1XMQL 3TQYA 1EFWA 3F2BA 3E6ZX 2JA6G 3A5UA 1JJ2A 5LHY1 2Z6KA 1X65A 2K01A 3ERQA 3U58A 3T1YL 5A2QE 2HQEA 3RLOA 3D4RA 4OXPA 1J8IA 2XRSD 1XWEA 4QJFA 3PO3H 1HZAA 4X65L 5CGKA 4YIJA 1FGUA 3I72A 4KHZA 3C1FA 2IX0A 4K8JA 4TQUS 1SMXA 5M5YH 4FP5D 4DV5Q 3QO2A 3SDZA 3HOZB 3JAMc 3A0JA 2AWOA 1R4PB 4LF8L 1BDOA 5K5PA 2YV5A 1E22A 4K14A 1D1KA 2B39A 2K03A 2R7ZG 3QWNA 5FO9B 1STBA 4RFBA 4HSVA 1C48A 1EY5A 2Q8TA 5GQOA 1EZ8A 4A3CG 2X6GA 2KCMA 4JVZA 5I9OA 3F2CA 4C56C 2B2TC 4DK1A 2HDMA 3V05A 4EQNA 5IP7H 4DNRB 1H9SB 5KGUA 4UPAA 1VQCA 4PV1C 1VQIA 1G2SA 1NCVA 1KIXA 1NUCA 4J6HA 1CKNB 2SNMA 3K57A 3FEWX 1STHA 1FVIA 2QW7A 2HCCA 2K5HA 5IYDH 3KJPA 4DV1L 4JI8Q 1OXUA 1TWGB 2KHIA 3IAYA 1I6HB 5HGQA 1NY4A 3I73A 3LWEA 5KNDA 1LTLA 3H3VH 3TEHB 1TS2A 4ZRZA 2K5NA 4DK0A 1NTGA 5FJ8H 2DY8A 1RTOA 2Y0SG 1HZBA 1LTID 5JVG3 1J6QA 5EJWA 2A69D 2DUDA 2YU9H 1ASYA 3NWSA 4JI7L 4K5XA 2GA4B 4JI2L 1TWGH 2N8NA 4YCUA 1I6HH 3EVQA 3KBXA 4RKLA 2OQKA 3GV3A 1Y1WG 1H9KA 4JV5Q 3H09A 3R2IA 4FF2A 3H6MA 3ONAB 3MVVA 3CCSA 1F2ZA 2VQEQ 1DOKA 1E3PA 3S17B 1STYA 3K8AA 2SDFA 2VY3A 4DAPA 1JOKA 1TS3A 4GN3B 4QL5A 1PLFA 4G7OC 3VYSA 2F0PA 3NE5B 2CH4W 3HOXB 1WTOA 4JI3Q 3S14B 1PV4A 3C3LA 2HDLA 2EQSA 3F2DA 1BUVT 4ZAIA 4YY3L 2N55A 3DEOA 1Z9FA 2K5QA 3Q0AA 2B3GA 2XSCA 5JEAH 3CRKC 2EIFA 3QR8A 2XTIA 1HTLD 4C1NK 2BCOA 4K5VA 1QNUA 1SMYD 3Q6SA 4NXNQ 4QMGA 3VYRA 4ZKBB 1EQRA 2JN4A 4IO9A 4DV4Q 3QOJA 2JEBI 2ZJQA 3AQQA 4HMJA 3OW2A 1STGA 2F3VA 3PUZA 3HOXH 5J22A 5M3FG 5IODA 1WTPA 4A93B 4K0KQ 3OTOL 3I4MB 2N3SA 3D31A 3PO3G 4QY7A 4DK6C 2HHHL 2L5TA 4R4IA 2R92B 2D9UA 1PRTF 1F2LA 5TSSA 4N8FA 5BN5A 1HZ9A 3K5LA 1HQMC 1V1PA 4DN4M 1WTWA 2UUCQ 3VR4A 4DF7A 1UE7A 2OTLA 1G8ZD 5JOBA 3HGBA 1STAA 1GUGA 1OXTA 1Q1EA 4QUCA 3NENA 1BR9A 2CKZB 2I07B 4B3SQ 4DV3Q 4NB3A 3NHHA 3I4MH 2QF7A 1LABA 1P8LA 3K80C 3S16H 1PH4A 1MSGA 4J1MA 2R92H 5J3BA 2BDNA 4LF5L 4FDBA 2ZTEA 2Z1CA 3HOZG 1HQRD 5DM63 2K32A 2EPBA 4IOCA 3ER0A 4RAUC 2VZAA 1OO9B 2Q2HA 4OWTB 4RMFA 1QUQA 5KRUA 2EZVA 2E8GA 3U4VA 5IGDA 4PMCA 3I4NH 1RODA 2PCFB 1XTCD 2HCIA 1EL0A 2V4DA 4HJ7A 5GADC 2G9HD 1EQTA 5IYCH 1F2MA 5I6YA 1NR2A 4I7AA 4HMIA 3G6EA 4KY5A 4FF3A 2E2HB 4JC0A 1SROA 2RA4A 4BY7B 5BN4A 1ENFA 1QNKA 5FLXL 5AJ3Q 1F9SA 4DR6L 3CRLC 1PH7A 2K28A 4XYOA 1RDPD 1MHWC 2EJMA 2NZHA 4H13C 5C5LA 3CHBD 1L1OC 2JJQA 1PTOB 1PH3A 2DNEA 4BBSB 1FJGL 1U4PA 2B63B 4RA8A 2E2HH 2KBNA 3GDEA 1M8AA 4EQOA 5EBDA 3G7LA 3NSWA 2OCEA 5ELNA 4P71A 3NTIA 2MQHA 3U9OA 1SE8A 4KHPQ 3H15A 3KF6A 1CK1A 5C3XA 2RDHA 1FR3A 2EXZA 4DUZQ 1G6ZA 4FXKC 1RIPA 5LMNL 1GUSA 1QVFA 2D62A 3RZDB 3PIO3 1GHJA 1PTOH 1TWCH 4C3HH 2HIXA 1CFMA 4B9WA 4CDFC 3BZDB 1S5BD 4YCVA 3T51B 1YHQA 5C6AA 3BDOA 3HEJA 5EQ0A 1EYCA 2PNRC 1V1PB 4A3LG 1I4GA 2PNHA 1EZ6A 1BF4A 2PZWA 4CBVA 1SNPA 2A74C 1S72A 1Y8PB 1JR0D 4DAMA 4RGOS 2L4NA 3MXUA 3OW7A 3BZCA 4XIGS 5FO7B 4JI4Q 2Q2UA 1C0AA 4TSSA 4BXXH 1ML0D 4HCEA 1ILQA 2UXDQ 2EY5A 3D6WA 1GUNA 3X3MA 3M4PA 4WJWA 3NP8A 4YHHQ 2B8FA 3OPOA 2JA7H 4LAAA 1IZ6A 1Q12A 2D0PA 1Z7TA 4JBKA 1VF7A 3TZUA 2R3ZA 2I5MX 1SNMA 4HIOA 1X6OA 1YJ9A 2F0KA 3M85A 1VQKA 3SE0A 1QUQB 4GLVB 2EJGC 3CXCA 4A93G 1T5EA 2EYFA 3E3XA 4PNYA 2A68D 3VR3A 1VQ4A 2ICEC 3K7AH 2R92G 5JPNC 3MXNA 3HOYG 2F0OA 3KLSA 3HKZE 5IWAQ 1XMOQ 4I65A 2AQ1B 2ZXRA 2VNUD 4JOIC 5IT9L 2F0FA 3UDXA 5DM73 3KF8B 2Q8RE 3ZYYX 1PH6A 1U0LA 3A7AB 1UWVA 5ELOA 1U4LA 4HJ8A 3BVZA 3PO2H 3J7ZC 1VQBA 5FKAC 1HPCA 1Q82C 1L0YB 2AUKA 1E1OA 4PZ8A 4JI0Q 4YWKA 1LTBD 1SFOB 1X3GA 2F52A 4RGTA 4Z9CB 4Y7NB 5IYCG 1RD9D 5ELFA 2CQAA 3TP7A 2RCNA 2B2WC 5F2DA 3TDQA 1WVLA 1ILPA 1S5CD 1EYAA 2NN6H 1Q1BA 4GOPC 1QB5D 4GNXB 4LF7Q 4R8IA 3V2TA 4NXMQ 3SK5A 4FF4A 1HHVA 1LLRD 4IN3A 1YJNA 2AQ2B 3GTLB 1G51A 3FDTA 4JI8L 4AH6A 4LFAQ 1KAWA 3KF6B 3BDCA 1F9RA 3MXGA 1KLUD 4IUPA 2NN6I 1WTVA 1SFOH 1M1KC 1EY6A 1PTOD 3S1NB 4Y7NH 4OHJA 1C9OA 2PQAA 2IHFA 3NWTA 2EY1A 2QA4A 4X3UA 4GLAC 4BY7G 2WACA 1X3QA 1B9MA 2JE6I 4JCVE 1VQJA 1EY8A 4F8MA 3KOJA 3KUPA 3T1HQ 4ZQ3A 4OIJA 1GHKA 4QIWE 5HGTA 4ODGA 4O0AA 2F1MA 3GTLH 5KNBA 2H1EA 2E76C 3EIVA 3U4ZA 3K58A 4LUVA 3P1HA 2EE1A 2R7FA 4JV5L 3S1NH 3HOWB 1HFNA 1JC7A 1UE5A 3SK4A 3PF5A 4OIKA 4BBSG 2VQEL 4DV7Q 2B63G 2F0GA 4A3GG 1X54A 1YJWA 1W6JA 2TSSA 1SE2A 4APVA 1SYFA 2DY7A 3K5OA 4A3FB 4JI3L 3E0EA 1R4QB 1KNEA 1W3SA 5D65A 3W2DA 1ICWA 5BR8Q 5C5MA 3J80c 4LUZA 4WJ3M 2LMCB 1IKLA 5C3EH 2B2TA 3NBIA 4LWCA 2B8GA 4NMZA 2OQ0A 3IL8A 4ZUIA 4HIDA 1WJJA 3CW2C 2K5VA 3HOWH 4J15A 4NXNL 2RHSB 4S3SA 3PIP3 2GVAA 2L11A 1Y1VB 1Q46A 2PQEA 1BCPB 1YHAA 3HOVG 3FPUB 4DV4L 2JA5B 3MXNB 1BQQT 1BVSA 2XWBB 3H94A 5C4ZA 1O80A 1RF2D 1NSNS 2BH8A 2OEOA 4B9XA 4CKBA 3K7UC 3DLLA 4C2MH 4A3FH 5CV6A 1O78A 4DV0Q 4K0KL 1B44D 4C1NI 4KKUA 4H44C 4ALPA 3E9IA 3T56B 3AYHB 5LMNW 1GOZA 4CDCC 2UUCL 1K28A 3ICEA 3I7FA 2OT2A 3JAMi 4ZLTF 2JA8H 1D6EC 4Y52H 2JA5H 4M8AA 1CA6A 1DZ1A 4B3TQ 3P20A 5M3MG 5I4DA 4CKEA 1GD7A 1GKHA 4IUNA 1ESRA 2KEEA 3F2UA 1B53A 1I4XA 2E5LQ 4B3SL 4DV3L 4OO1H 1KDBA 1PH2A 1I6VC 1T9HA 3T16A 1YNND 1EYDA 3HKZB 3PQIA 1YITA 1CTMA 2A5HA 1DD2A 1IXRA 2HUGA 3DM3A 3M9BA 3CPWA 3C46A 1SN8A 4R4QA 1PZID 2DGYA 4DV2Q 1V9PA 4DAYA 1KHIA 2F0MA 2Z0SA 4AIMA 3R8BA 1JMCA 1FNUA 1UAPA 4A3KH 1O7IA 4OO1I 2PZTA 4POFA 2NN6G 4YCWA 1HUMA 2K04A 3I8ZA 2A69C 2PQAB 2FMCA 3URYA 5I6WA 4PZ6A 2FJ2A 1B8AA 3PF4A 4MHEA 1WD1A 4KMUC 4L5SA 2HD3A 1CZWA 3TZDA 5C44B 4HIKA 1TT2A 3MTSA 1BBWA 1W6KA 1AE2A 1TS5A 1EYGA 3T13A 4F87A 1KRSA 4P75A 4NDXA 1MSHA 5K36G 3QOLA 4KI0A 3EA6A 2EJFC 5M5XH 3DMUA 3FMCA 4A3DH 2I0QA 1RCVD 1VQ6A 5IGGA 1X55A 2YTXA 1RL2A 5C44H 2ZM6Q 5KEEA 2EYJA 4HN7A 1QJOA 2MPMA 2XGTA 1EIFA 1YNJD 1LT4D 4QIWB 2A6HD 1X3PA 4IFDJ 1VF5C 2O5JC 4X62Q 3S15B 1PYBA 4WRDA 1U5KA 1B3AA 4KTAA 4KHPL 1DYQA 1ONLA 4DUZL 4B3RQ 5J39A 1A15A 2QEJC 3NQTA 5D3IB 4JYAQ 3NEMA 2WB1E 5JPMC 2NB0A 4IUQA 4JG2A 1CUKA 1D1IA 1A3VA 3NK9A 3G6JB 3UDGA 3STBD 3F1ZA 2FXQA 4AQYQ 1SNCA 2YU9B 2J4XA 5IGCA 2RDFA 4R4TA 4CDEC 1SNDA 3T53B 2BDOA 3BDLA 3S15H 4DR7Q 3AFPA 2R93G 1VQPA 2B2VC 4A3FG 1N8RC 1IBMQ 1V8QA 5E3FA 1F2YA 1SYBA 2A1AA 3D8GA 3RNUA 5EKKA 2HQLA 5C4JB 4JI4L 4FF1A 1OXSC 4P72A 3NQIA 1AEXA 2UXDL 2KENA 5DNFA 1X32A 2LS01 4YHHL 3K5MA 3SGIA 3X3NA 2F0WA 4C3IG 1JWMD 2Z4HA 4DR5Q 1Y1VG 2WAQE 4DAYB 1K83B 2JA5G 1ZEQX 1ASZA 1P16A 1YZ6A 1H95A 3H3VI 1TS4A 4G4KA 1ESFA 5GAEC 2X6LA 4OO1G 1EQVA 1L1OA 4ULLA 3FKIH 3KFUA 5CBEE 2AHOB 3CQZB 3NTKA 3CPFA 3GD7A 2LSSA 3LNNA 1LUZA 4XYQA 1IYJB 2Z8LA 3S1MB 2XIWA 2PW5A 4K8IA 5C4JH 4GKKQ 3R2TA 5LMUQ 3PUXA 3AMUA 5BN3A 1B7YB 2AUJD 1KABA 2JK8A 3F8TA 4IALA 1XMOL 1VQNA 1LT5D 4I7ZC 3CU7A 1K83H 2K50A 3AB9A 1F9PA 1Q7YC 3D4DA 2RF4A 2HT1A 3VA5A 4LFCQ 3C1EA 3TREA 4LMQD 1LACA 1ZKOA 3H0GB 3PGZA 2IT1A 3CQZH 3P7JA 1CM9A 3A8KE 4HSPA 2EY2A 2G5DA 1DXMA 3HKZG 1PFNA 3S1MH 4BA1I 3TP5A 1QZGA 1MD2D 5G3LF 4MIUA 2B29A 4BS9A 4KV6A 3I91A 2K6AA 4BY1B 1VQ5A 1PA6A 2WIIB 2F4VQ 4LF7L 1D7QA 4BBRB 1K8MA 5IOCA 5GAGC 3CP0A 4NXML 4RCOA 2EVBA 2QEXA 2VW9A 5KNCA 3TP8A 3DXJC 4LK1C 1SNOA 5C0XJ 3S16B 1TY2A 4A3MB 2C9OA 3RMHA 1TWFB 1TIID 3S1QB 3H0GH 4IPHA 4LFAL 4OONA 1TWHB 4E6IA 1SJED 1SSOA 2CVRA 4L5QA 3CCRA 4BY1H 3CMAA 2UUBQ 1EQQA 2VB2X 4O1NA 3I4NB 4JBJA 4PQXA 3E9HA 4BBRH 4H0LC 4EGVA 4KD3A 2O5IC 1AH9A 1S5DD 3T1HL 2O4XA 1K8GA 3BYTB 4A3MH 1EY7A 1TWFH 1IBKQ 1J5EQ 2VB3X 3S1QH 1JE5A 5IP7G 3S9WA 3W1GA 1NJIC 3HOUB 1R9TB 1TWHH 5JVH3 1BOSA 1HNXQ 4XQJA 1MJEA 4DV7L 1K0RA 1QE6A 2E2JH 3GTOH 4JOIA 3WOEA 2CFMA 4X3KA 1HR0Q 1SYGA 2WB1B 5FLXE 1D5MC 2NVQH 5IYDG 5E7NA 2FFKB 1PZJD 2V1CC 5IGBA 3KJOA 1N36L 4OX9Q 5IP9H 2A68C 3A55A 1G6PA 2ES2A 5FJ8G 3HOUH 1L1OB 1R9TH 3CMEA 3FVQA 3CCQA 4FVMA 2K5DA 3ND9A 2DJFC 3OSOA 3J81L 2AKWB 2B2WA 3HFZB 1PMRA 3BG3A 3PSIA 5DEHA 4GOPA 4DKAC 1Q90A 2QILA 4EQPA 2PI2A 3SXHA 1C7YA 4KKTA 1QOHA 3GP7A 2CWPA 3VR5A 4A3IH 4U68A 1KL9A 3K81C 4A3EH 2KHSA 2IY5B 4DV0L 1TWCB 4C3HB 1GO3E 1PRTB 4R1JA 4JI6L 1VQAA 3LGJA 4IUVA 3J81i 3Q24A 2A73B 2WAQB 4G7ZC 4K2LA 5I2XA 3C2PA 2IPKD 4GS3A 1JJGA 1U4RA 1WTXA 4IOAA 2JA9A 1K9MC 1H9MA 2F0QA 2IW3A 2TMPA 3PUYA 4JBWA 4B3TL 1KQSA 2K4KA 4QQBX 1OXXK 2E5LL 3DWAA 1XNQQ 1CKOA 5JEAG 1LTGD 2CHBD 4DXFA 3I90A 5GAHC 3GTMH 3HZXA 4H7BA 1II3A 4DV2L 4OGQC 2JA7B 1W2BA 2NVXB 4PG3A 4DR3L 1KXLA 1GXDC 3MA2B 4ZCKA 1PH8A 2CCZA 2UXBQ 4HJ5A 2VL6A 4KK7A 2WINB 4X3SA 5IYBH 1WCMB 3HOXG 3V96A 1E2VA 3KDFA 5CV8A 4MTNA 2ICIA 2KUMA 1I50B 1EY4A 3SK8A 1PZKD 3K7AB 3DUZA 3ZJYC 2UUAQ 2UXCQ 1STNA 2H4OA 2Z4IA 1ICFB 2ALYB 3MHBA 5AFWA 1CSQA 1N9WA 2NVXH 3IKJA 2X69A 1D2BA 2E2DC 3DWPA 4HCSA 2VUMH 3PO2B 1FGBD 1WCMH 5IT9E 4TRDA 1HFGA 3I4MG 3L0OA 1EWIA 1JICA 4DNIA 5IGFA 4LNQA 1I50H 1UEAB 4A3MG 3EBEA 3SHLA 4DV5L 2ZM6L 1N32Q 2UU9Q 3AFQA 4KD4A 1IYUA 2FHTA 1SLJA 5IE8A 3MXPA 3BJUA 4HTHA 2M00A 4IJLA 4KLKA 1WTQA 4V190 2E74C 2FMMA 5M5WB 3S2DB 5FLXc 1A63A 1I3QB 3UDFA 4CJ0B 1B2TA 4WFN3 1ENCA 3MEHA 4BWGB 4X62L 1KLGD 3I4NG 5CYUA 1X56A 1RJTA 2KEDA 4UP8A 3GTGB 4GOPB 2LXJA 4B3RL 1I94Q 2DJGC 4JYAL 1VQGA 2K14A 2NZ1D 3A56A 3P75A 1KAAA 2IX1A 1JORA 5EKIA 3J80i 1FD7D 1KDCA 4AYBE 1VQHA 3MZ5A 4ID6A 4AQYL 3CCJA 1IL2A 3KLRA 5M5WH 3S2DH 5FO8B 2F3WA 1UE6A 4RHSA 1I3QH 1N34Q 2RCFA 2LY7A 2NVYB 2JA6B 4DR7L 2WB1G 5H1SE 3HP3A 2ZXPA 5C0XH 4LFBQ 1E2ZA 3ND8A 3GTGH 1EOVA 3D6CA 1IBML 2EYOA 1K0SA 1CQVA 1L0XB 3R93A 1PRTD 3SR1A 1IBLQ 4A75A 3I2ZA 1U9RA 5EPLA 5ELBA 2D0OA 4XQQA 1HCZA 4DR5L 4DUYQ 5T1IA 1EIHA 4A3JB 2Z6BA 3CCVA 3A8JE 2QGQA 2JP1A 4KHVA 1TU2B 2NVYH 2JA6H 2KCTA 1LT3D 5C3EB 1GUTA 2L12A 3S24A 5I9PA 2ID0A 3KDFB 2PPBC 4C3HG 2RHQB 4GKKL 3QG1A 3K5NA 5LMUL 4L5RC 2WAQG 4HJAA 4ZUJA 4N9PA 1S5ED 3JC66 1PXUA 1IHZA 1EY9A 4ZYSA 4C2MB 1Y69U 4A3JH 5E4WC 1OTCA 1B70B 2RSOA 1IKMA 1QG7A 4P73A 1QZHA 1HA6A 5IYBG 2K05A 3GTJB 4RGNA 3JAME 4EVOA 1FYCA 1B4OA 5E1FA 3UE0A 2G9DA 2R7ZH 1MBYA 1LYLA 1VQ8A 4BXXG 3J7A5 2RSNA 2JSOA 5E4XA 4UDUC 1HNZQ 3T4AC 2JA8B 1FL0A 5IIFA 1YNJC 3U50C 2JA7G 3IFTA 1F77A 2A6HC 3JAML 2EYMA 5JJIA 3OIQA 2ZXOA 1Q86C 2F4VL 2MO0A 4XTCS 5KIXA 2Y0SB 1QCBD 4L6TB 1WCMG 2F0VA 4V0BA 1HUNA 3DEPA 3N6RA 2VXWA 3GTJH 1Q81C 4POGA 3J7AV 1DCZA 2B2VA 3TN2A 1Z6HA 2A6ED 4CJ2C 1Q8KA 5I2YA 2EYHA 3AEVA 1H9RA 2QCPX 3PIPA 1I4HA 1EWCA 4A3KB 4KN4C 5EAYA 2ZT9C 3GTPH 4DFAA 2RKSA 3STBC 1PYSB 1QILA 2F0NA 2Q2IA 4RWSC 3UE1A 1Y1WB 1XYIA 3B6YA 3PUVA 4DV6Q 3ULLA 2UUBL 3G48A 3SVMA 5FOBB 1HRJA 3PO2G 5COYA 4MZ9A 4G57A 4KY7A 3N52A 2RVLA 2VS1A 1IBKL 1J5EL 1JQYD 5EBCA 3M7GA 3BZKA 2MJ8A 5CORA 3GQBA 5C4HA 1LO5D 1JCKB 2LXKA 1G2TA 2PO4A 2PZUA 4N9TA 3NPPA 5CMDA 1HNXL 4O2DA 5M5XB 1Y1WH 2YTVA 3RN5A 1VS0A 3AU7A 1MGSA 4IZ8A 4UP7A 1EUJA 4A3DB 1HR0L 2J7ZA 5JJZA 2CQOA 4LJZC 1JE4A 1VQMA 3K0XA 1J9OA 2Q8IB 4AYBB 1A8VA 1IW7D 2RQXA 4OX9L 4IPCA 1Y8OB 2E2IH 5KYLA 3W5OA 2F0SA 5JJLA 4FNFA 1LM0A 1WFQA 3TBIB 2F3IA 3BYYB 3UI2A 5AJ3L 5EGTA 3CC7A 2DNCA 3HS0C 4B08A 1BXTA 5CV4A 4ME3A 4A4IA 3GO5A 4R4OA 1DM0B 1BO0A 5KYIA 1D8LA 1K3RA 1SAPA 4A3BB 1NAPA 4EX5A 1AZQA 4B3MQ 4X3TA 3IRBA 3OMCA 3GTKB 4CHTB 4RGMA 4KN7C 4JK1C 4RG1A 1CZGA 2EYLA 1SMYC 1DOLA 5M3FH 2CW0D 3D4WA 1HA5A 4L8JA 1S3OA 2N78A 2IX3A 1ET6A 4LUOA 1HZCA 4NP5A 1Y14B 4X66Q 2F0TA 3K0YA 1PFSA 1QVCA 2C35B 5A2QL 4A3JG 2KHJA 4A3BH 2BE5D 1E7ZA 3I4OA 2L0CA 2BA0A 3Q22A 1KTKA 1X3FA 1KDAA 3WDNA 4XT1B 2B2YC 5C3EG 3FPPA 1XNQL 3GTKH 1A2UA 1M4VA 1PHJA 2RDGA 1BBXC 1PVOA 3U9SA 4JI1Q 1RTNA 4DAVA 3HOWG 2C5CA 1D5XC 4GKJQ 3CCEA 1PFMA 1BCPD 2K33A 4DR1Q 2UXBL 2F0LA 1CQFA 3CC4A 1B9NA 3FP9A 2F0DA 1FNVA 5FK9C 1SYCA 3HOZH 2K5WA 1ZYRD 3PUWA 3FKIB 3KLWA 1GM5A 1WOCA 2EYPA 1LTSD 4C3JB 1XNRQ 3VDYA 3VYTA 3H3VC 1B3QA 4IJHA 4X64Q 2F0JA 2UUAL 2UXCL 1STEA 3NBHA 5JAVA 4CKCA 5EKLA 5ELDA 4UHVA 2JA8G 4MNOA 3SEBA 4MTKA 3D0FA 4DA2A 4NKLA 3CF5A 4ZK9B 1NR4A 2E75C 3G71A 1A62A 1TY0A 3PCOB 2YYZA 4RCNA 1GUOA 2M2LA 3RUZA 1EIYB 3UDIA 1EIGA 2XVSA 2SNSA 4C3JH 3MC0B 3R3OA 5T1GA 4LF6Q 3BS1A 4DR4Q 1N32L 3M4QA 5CR3A 2UU9L 2EY6A 3S2HB 1D5ZC 1YHBA 5IWAL 1U4MA 5ISRA 2F0EA 4A3KG 2VQFQ 3WOFA 1X3EA 1SE3A 2JYOA 1E0BA 1KC8C 1Z47A 2LFNA 2JQOA 1LTAD 3OOCA 3OWEB 2IWHA 1N33Q 1PYWD 1NBWA 2K7VA 4QUFA 1PDQA 4JI0L 3TMEA 1VQOA 1I94L 3ITPA 1V1QA 1TKWB 2K1BA 2HIVA 3EFXD 2MUYA 4HAEA 2KVMA 2B2UA 2KA7A 2L1BA 3S2HH 3RD4A 3CCUA 3CCMA 2GVBA 1TQOA 4CJ1B 4UP9A 4Q0FA 1C4QA 3I55A 1VMPA 1N34L 2Z6KC 2OF1A 3J7AF 4QF4A 4A3DG 1K3BC 4DK3C 3RR5A 1L0WA 3S17H 1HNWQ 4A3LH 4LFBL 4DU9A 5C44G 3RLFA 4IQZA 4AYBG 1IYVA 1EEID 2MNAA 2F03A 4LF9Q 1X9NA 2KOLA 1AE3A 2I46A 3QB3A 4QCLA 2E2JB 3CKIB 1IBLL 3S14H 1FNWA 4DGZA 4DR2Q 1YBYA 3GTOB 1EU4A 1AN8A 4P2CB 1PTOF 1DOMA 2KQ3A 4HIMA 3TRZA 1JB3A 2NVQB 1XX8A 3HOYB 4DUYL 2QDBA 3A54A 3VR6A 2IJ0A 1CKMA 2AMCB 1LTRD 4DPGA 1XPRA 4LF4Q 4A3BG 2NZOA 3EQLC 1XTDA 1HR0W 2KECA 4YWLA 2PI2E 4OELB 3LX0A 5ELCA 1UNSA 3M4YA 3WWVA 2JXMB 1SEBD 4A93H 3HG9A 3G4SA 4JI5Q 5LL6X 1V43A 3OWFA 1AP0A 3NTHA 4CGYB 4K5WA 3TP6A 3NBHB 4A3IB 1XJVA 1M90C 3HOYH 3J81E 3MFGA 4A3EB 3S1RB 4U673 3TSSA 3SK6A 5BR8L 4DNTB 1K73C 1G291 4O42A 1GUWA 1K8AC 2PYKA 1TXYA 4FYDA 1SXTA 4F7XA 1NMFA 3DM1A 4KKSA 2GN5A 5CBAE 2I5LX 4HJ9A 1HNZL 1HXYD 2DN8A 2WV6D 1XMQQ 3E5SA 1HJPA 2WKCA 1WI5A 5C3WA 2YTYA 1AFPA 4JPBW 3GTQB 3I56A 3KF8A 1B50A 1E1TA 3S1RH 1XXGA 1EFID 2AWNA 4TKOB 3FKIG 3T1YQ 1IL8A 3GTMB 2EDGA 4GN4B 4IUUA 2I5HA 4C3JG 1VQDA 1CA5A 1HTPA 4X65Q 2WP8J 2EXDA 4GN5A 1I4QA
chains in the Genus database with same CATH topology
3GTGH 1EOVA 3CCSA 2VQEQ 2PQAB 1E3PA 4PZ6A 1S40A 1IBML 3PF4A 1B8AA 3K8AA 4PMWA 2VY3A 4L5SA 4DV6L 4GN3B 4QL5A 3I2ZA 4A75A 1IBLQ 3M7NA 4LF8Q 4HIKA 3RLNA 2K75A 4GNXA 3GTQH 2D0OA 1BBWA 4JI3Q 4OWWB 1PV4A 3ULJA 2EQSA 1AE2A 3F2DA 4DR5L 2H5XA 4DUYQ 4YY3L 4BY7H 5DLQE 1EYGA 3CCVA 2NN6G 1Z9FA 2QGQA 2B3GA 2NVYH 2JA6H 4GLXA 2EIFA 1KRSA 2XTIA 4P75A 4IFDI 5K36G 2KCTA 4KI0A 4NXNQ 5M5XH 1TWAH 3S24A 1PH9A 2ID0A 1EQRA 3KDFB 4IO9A 4DV4Q 4A3DH 4OWXB 2JEBI 4EQ5A 3AQQA 2I0QA 2ZJQA 2RHQB 1VQ6A 4GKKL 5LMUL 1X55A 3BU2A 3TS0A 2WAQG 2YTXA 4HJAA 3OW2A 4L5RC 4BBSH 3CAMA 1RL2A 3JC66 5C44H 3PIOA 2ZM6Q 3RN2A 3PUZA 2XGTA 3HOXH 5M3FG 2B63H 4BA2I 4K0KQ 3OTOL 4A3GH 2N3SA 2Y0SE 3D31A 3H0GG 4QY7A 1EIFA 4TVAB 4DK6C 4A3JH 1OTCA 3PO3G 1B70B 2HHHL 1VQLA 4P73A 4R4IA 1QZHA 5IYBG 4DV1Q 3KYHC 3Q8DA 1HZ9A 2UUCQ 4IFDJ 5FLMH 3UE0A 4X62Q 1UE7A 1PYBA 2OTLA 2R7ZH 1U5KA 1LYLA 4KHPL 4BY1G 1VQ8A 4BXXG 3J7A5 3NELA 4DUZL 4UY8C 4B3RQ 3RZDH 1BKBA 4JYAQ 1HNZQ 1FL0A 4BBRG 3NEMA 2WB1E 5HY6A 3U50C 1OXTA 2JA7G 1Q1EA 3NENA 4JG2A 2CKZB 1CUKA 4YCWA 4B3SQ 4DV3Q 2PMZE 4NB3A 2OWOA 3HOVH 2R7DA 4B3ML 5JJIA 3L2PA 3I4MH 3UDGA 3STBD 1Q86C 1P8LA 3F1ZA 3K80C 2F4VL 4JI7Q 3S16H 2MO0A 2FXQA 4XTCS 4AQYQ 1PH4A 2ZJRA 2R92H 1I5FA 5J3BA 1WCMG 4R4TA 4POGA 3GTJH 1Q81C 4JI2Q 4FDBA 4LF5L 2ZTEA 1YI2A 3HOZG 3S15H 2ATWA 1Q8KA 4DR7Q 3AFPA 4IOCA 2R93G 3ER0A 1VQPA 3AEVA 2VZAA 2Q2HA 4OWTB 3PIPA 2R6GA 1QUQA 4RMFA 3J81c 4X66L 2E8GA 2JEAI 5EAYA 1JB7A 4A3FG 1N8RC 3GTPH 1SRUA 3U4VA 3STBC 1IBMQ 2L15A 1PYSB 2Q2IA 2A1AA 3UE1A 3RNUA 3I4NH 3B6YA 3PUVA 2HQLA 4JI4L 4DV6Q 3ULLA 3RZOH 2UUBL 1OXSC 4P72A 5IP9G 4HJ7A 2UXDL 2ZTDA 2KENA 3G48A 5GADC 3ERSX 4YHHL 3SGIA 5IYCH 1VQFA 5M3MH 3PO2G 3HOUG 4DR5Q 1Y1VG 4MZ9A 2WAQE 4DAYB 4YY3Q 4JI1L 1QVGA 3G6EA 2CWAA 2JA5G 1ASZA 1P16A 1YZ6A 4JC0A 1SROA 4QGUA 2VS1A 3H3VI 4X6AH 4GKJL 1IBKL 1J5EL 1H95A 3L7ZC 3W1BA 3BZKA 4DR6L 5AJ3Q 2K52A 1DGSA 2LXKA 3OYYA 4DR1L 5GAEC 5C4XH 1E24A 1PH7A 4OO1G 1L1OA 3FKIH 3KFUA 2AHOB 3CPFA 3GD7A 2ZTCA 4A3IG 1HNXL 2LSSA 4O2DA 2NZHA 1LUZA 4A3EG 1Y1WH 1IYJB 1UEBA 4GKKQ 5C4JH 1L1OC 2YTVA 3RN5A 1VS0A 4WJ4A 2A19A 5LMUQ 4UP7A 3PUXA 1EUJA 2IHEA 2JJQA 1HR0L 1B7YB 2JK8A 3F8TA 1VQ7A 1XNRL 2CQOA 1XMOL 1VQNA 1PH3A 1HH2P 3OTOQ 1VQMA 1UE1A 3K0XA 3M4OH 1FJGL 4X64L 1A8VA 1K83H 2HHHQ 4IPCA 2K50A 4OX9L 2E2HH 2KBNA 1Q7YC 2E2IH 2RF4A 3GDEA 5C0XI 2HT1A 4LFCQ 3W5OA 5JJLA 3TREA 1SR3A 2OCEA 5ELNA 4P71A 4GNXC 4IFDG 1LM0A 1WFQA 2MQHA 3PGZA 1SE8A 2F3IA 2IT1A 1A0IA 3CQZH 5AJ3L 4KHPQ 1OXVA 3H15A 3KF6A 3CC7A 3HKZG 4DUZQ 4H02A 3S1MH 4ME3A 1RIPA 1MKHA 4BA1I 4IPGA 5LMNL 4A4IA 3GO5A 1QZGA 4R4OA 1QVFA 2B29A 2D62A 1D8LA 1K3RA 4LF6L 4DR4L 1TWCH 4EX5A 1VQ5A 4C3HH 4B3MQ 2HIXA 3A74A 3PV0A 1PA6A 3CCLA 3IRBA 2F4VQ 4LF7L 1D7QA 4YCVA 3CP0A 5GAGC 4NXML 2QEXA 2VQFL 2VW9A 4RG1A 1YHQA 1KRTA 2OTJA 5C0XJ 1VCIA 3ULPA 5M3FH 4LF5Q 4A3LG 1YEZA 2PNHA 1S3OA 2N78A 4A76A 4LFCL 3H0GH 4IPHA 4LFAL 4OONA 4LUOA 1S72A 1N33L 1HZCA 2NVTH 4LFBQ 1Y14B 4X66Q 2ZJPA 4DAMA 1PFSA 4L5TA 1QVCA 2C35B 3BZCA 1MIUA 4XIGS 4A3JG 2KHJA 2MO1A 4A3BH 3I4OA 1E7ZA 4L5QA 3CCRA 4JI4Q 2Q2UA 1C0AA 2BA0A 3EN2A 4BY1H 3CMAA 2UUBQ 3TS2A 4BXXH 4A3CH 1EQQA 2UXDQ 1X3FA 4JBJA 3E9HA 3M4PA 1XNQL 5C3EG 5FLMG 4YHHQ 5JEAJ 4BBRH 1N36Q 3CC2A 3GTKH 1AH9A 1PHJA 3T1HL 4YWMA 5IT9c 2JA7H 1PVOA 1IZ6A 1Q12A 2D0PA 3A5ZB 4JI1Q 1K8GA 4JBKA 3HOWG 1KD1C 2VUMG 4A3MH 2I5MX 5JJKA 4HIOA 1TWFH 1IBKQ 1J5EQ 4GKJQ 3CCEA 3S1QH 1X6OA 4DR6Q 1YJ9A 1JE5A 5IP7G 3M85A 3W1GA 1NJIC 1VQKA 4DR1Q 1QUQB 4GLVB 3CC4A 2UXBL 1JT8A 1TWHH 3FP9A 3CXCA 2BA1A 1HNWL 1MJCA 4A93G 4R4CA 3FHWA 1HNXQ 1MJEA 4DV7L 1K0RA 4LW1A 2E2JH 3HOZH 3PUWA 3KLWA 1VQ4A 1GM5A 2R93H 3K7AH 3GTOH 4JOIA 4LF9L 1WOCA 2R92G 1PH1A 3HKSA 3HOYG 1NE3A 2CFMA 3MEFA 1HR0Q 1XNRQ 3VDYA 2NVQH 3HKZE 2WFWA 4DR2L 5IWAQ 1XMOQ 1PH5A 2VNUD 5IYDG 5E7NA 4JOIC 3J81j 4IJHA 3UDXA 2V1CC 4X64Q 4JI6Q 3KF8B 1FJGQ 1PH6A 1NMGA 1CKNA 3KJOA 1N36L 1U0LA 1L2FA 2UUAL 5IP9H 4JBMA 4OX9Q 2UXCL 1UWVA 5ELOA 2JA8G 4MNOA 1G6PA 4IPDA 3D0FA 1VQ9A 3PO2H 1JJCB 4C3IH 4HJ8A 3J7ZC 5FJ8G 2ES2A 1VQBA 4LF4L 1L1OB 1R9TH 3HOUH 1Y1VH 3CF5A 3CMEA 1Q82C 3CCQA 1E1OA 4PZ8A 3G71A 4JI0Q 1A62A 3PCOB 4YWKA 2AKWB 3HFZB 1X3GA 2YYZA 2F52A 1YIJA 5IYCG 5LMNQ 1YVCA 3PSIA 1EIYB 3UDIA 2RCNA 4GOPA 1CSPA 4DKAC 2MFIA 3M3YH 2N49A 1WYDA 4C3JH 1XPOA 5IY0A 1C7YA 2PI2A 4P74A 4LF6Q 4DR4Q 2CWPA 4A3IH 4JI5L 1N32L 1KL9A 1Q1BA 3K81C 3M4QA 2UU9L 4A3EH 4GOPC 1GVPA 1YHBA 4GNXB 2BH2A 4LF7Q 2IY5B 4DV0L 5C4XG 5IWAL 4NXMQ 4NPSA 4A3KG 2VQFQ 4PZ7A 1YJNA 1GO3E 4R1JA 4JI6L 4DR3Q 2A8VA 1X3EA 5C0XG 3CD6A 1VQAA 3LGJA 3J81i 1G51A 1KC8C 1Z47A 4JI8L 1VQEA 4AH6A 4LFAQ 2JQOA 4GS3A 1JJGA 1KAWA 3KF6B 5GROA 1N33Q 2NN6I 1SFOH 1NBWA 2JA9A 1BBUA 1M1KC 4IOAA 4Y7NH 1K9MC 2Q2TA 1YNXA 3PUYA 1C9OA 4JI0L 2ASBA 4JBWA 1VQOA 1I94L 2PQAA 1V1QA 2IHFA 2QA4A 4B3TL 2HIVA 1KQSA 2K4KA 4QQBX 1XPUA 4GLAC 1OXXK 4BY7G 1XMQL 3TQYA 2JE6I 2E5LL 3S2HH 4JCVE 1VQJA 1EFWA 3CCUA 3F2BA 1XNQQ 1CKOA 3KOJA 5JEAG 2JA6G 3CCMA 2GVBA 3A5UA 3T1HQ 5GAHC 1JJ2A 2Z6KA 1X65A 4QIWE 3GTMH 4O0AA 3GTLH 4DV2L 3U58A 3EIVA 4UP9A 3T1YL 3U4ZA 3I55A 1W2BA 4LUVA 4PG3A 4DR3L 1N34L 2Z6KC 1KXLA 3RLOA 1PH8A 4OXPA 2CCZA 4A3DG 4HJ5A 2VL6A 2R7FA 4DK3C 2UXBQ 4JV5L 3RR5A 1L0WA 3S1NH 4QJFA 3PO3H 3S17H 1HNWQ 1HZAA 1UE5A 4X65L 4LFBL 4A3LH 3PF5A 1FGUA 4BBSG 5C44G 2VQEL 4DV7Q 3RLFA 4KHZA 5M5YH 2IX0A 4TQUS 5IYBH 1SMXA 4AYBG 3HOXG 2B63G 3KDFA 2MNAA 4LF9Q 4A3GG 1X9NA 1X54A 4DV5Q 4MTNA 1YJWA 1AE3A 3JAMc 1IBLL 3S14H 3A0JA 4APVA 4DR2Q 1YBYA 2AWOA 4LF8L 2YV5A 4JI3L 3E0EA 4HIMA 3TRZA 1W3SA 3ZJYC 1E22A 2UUAQ 2UXCQ 5BR8Q 4DUYL 3J80c 2R7ZG 4LUZA 4WJ3M 2ALYB 1CKMA 1CSQA 1N9WA 2AMCB 5C3EH 2NVXH 4DPGA 1XPRA 4LWCA 4LF4Q 4A3BG 2OQ0A 5GQOA 4HIDA 1WJJA 4A3CG 2NZOA 2K5VA 2KCMA 3CW2C 3F2CA 4J15A 4NXNL 2RHSB 3HOWH 2VUMH 1XTDA 1HR0W 2GVAA 1Q46A 1WCMH 1YHAA 3HOVG 4YWLA 4DV4L 5IP7H 2PI2E 3I4MG 3L0OA 3MXNB 1EWIA 1BVSA 4UPAA 4DNIA 1VQCA 4LNQA 1I50H 3WWVA 1VQIA 4A3MG 2BH8A 3EBEA 4A93H 3K7UC 3G4SA 4DV5L 1KIXA 4JI5Q 2ZM6L 3DLLA 1V43A 1N32Q 2UU9Q 4C2MH 3AFQA 4A3FH 1CKNB 1SLJA 5IE8A 4DV0Q 4K0KL 3NBHB 1XJVA 1M90C 3BJUA 4KLKA 4IJLA 3HOYH 4ALPA 3E9IA 1FVIA 5BR8L 3AYHB 2K5HA 5IYDH 5LMNW 5FLXc 3KJPA 4DV1L 4JI8Q 1K73C 1OXUA 2KHIA 2UUCL 3UDFA 1A63A 1G291 5HGQA 1NY4A 4X62L 3ICEA 3I4NG 1K8AC 3I7FA 1TXYA 3JAMi 2JA8H 1X56A 1LTLA 1NMFA 3H3VH 4Y52H 4UP8A 3TEHB 2JA5H 2GN5A 2LXJA 4GOPB 2I5LX 2K5NA 1I94Q 1NTGA 5FJ8H 4HJ9A 4B3RL 4JYAL 1HNZL 1VQGA 4B3TQ 2K14A 2IX1A 5M3MG 2Y0SG 1HZBA 1J6QA 1GD7A 1GKHA 3J80i 1XMQQ 1HJPA 1WI5A 2E5LQ 4B3SL 4DV3L 2YTYA 1PH2A 1T9HA 2DUDA 4AYBE 1VQHA 2YU9H 1ASYA 1YITA 3I56A 4JI7L 1E1TA 4AQYL 1IXRA 3DM3A 3M9BA 3CPWA 3S1RH 3CCJA 1IL2A 1SN8A 4R4QA 5M5WH 3S2DH 2AWNA 2DGYA 4DV2Q 1V9PA 3FKIG 3T1YQ 1UE6A 4JI2L 1TWGH 2N8NA 4YCUA 1I3QH 1KHIA 1N34Q 1I6HH 2Z0SA 4AIMA 1JMCA 2OQKA 4GN4B 1Y1WG 4A3KH 2I5HA 4DR7L 4JV5Q 1O7IA 2WB1G 1VQDA 5H1SE 4OO1I 4POFA 4X65Q 2WP8J 2EXDA 4GN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTG H;  1EOV A;  3CCS A;  2VQE Q;  2PQA B;  1E3P A;  4PZ6 A;  1S40 A;  1IBM L;  3PF4 A;  1B8A A;  3K8A A;  4PMW A;  2VY3 A;  4L5S A;  4DV6 L;  4GN3 B;  4QL5 A;  3I2Z A;  4A75 A;  1IBL Q;  3M7N A;  4LF8 Q;  4HIK A;  3RLN A;  2K75 A;  4GNX A;  3GTQ H;  2D0O A;  1BBW A;  4JI3 Q;  4OWW B;  1PV4 A;  3ULJ A;  2EQS A;  1AE2 A;  3F2D A;  4DR5 L;  2H5X A;  4DUY Q;  4YY3 L;  4BY7 H;  5DLQ E;  1EYG A;  3CCV A;  2NN6 G;  1Z9F A;  2QGQ A;  2B3G A;  2NVY H;  2JA6 H;  4GLX A;  2EIF A;  1KRS A;  2XTI A;  4P75 A;  4IFD I;  5K36 G;  2KCT A;  4KI0 A;  4NXN Q;  5M5X H;  1TWA H;  3S24 A;  1PH9 A;  2ID0 A;  1EQR A;  3KDF B;  4IO9 A;  4DV4 Q;  4A3D H;  4OWX B;  2JEB I;  4EQ5 A;  3AQQ A;  2I0Q A;  2ZJQ A;  2RHQ B;  1VQ6 A;  4GKK L;  5LMU L;  1X55 A;  3BU2 A;  3TS0 A;  2WAQ G;  2YTX A;  4HJA A;  3OW2 A;  4L5R C;  4BBS H;  3CAM A;  1RL2 A;  3JC6 6;  5C44 H;  3PIO A;  2ZM6 Q;  3RN2 A;  3PUZ A;  2XGT A;  3HOX H;  5M3F G;  2B63 H;  4BA2 I;  4K0K Q;  3OTO L;  4A3G H;  2N3S A;  2Y0S E;  3D31 A;  3H0G G;  4QY7 A;  1EIF A;  4TVA B;  4DK6 C;  4A3J H;  1OTC A;  3PO3 G;  1B70 B;  2HHH L;  1VQL A;  4P73 A;  4R4I A;  1QZH A;  5IYB G;  4DV1 Q;  3KYH C;  3Q8D A;  1HZ9 A;  2UUC Q;  4IFD J;  5FLM H;  3UE0 A;  4X62 Q;  1UE7 A;  1PYB A;  2OTL A;  2R7Z H;  1U5K A;  1LYL A;  4KHP L;  4BY1 G;  1VQ8 A;  4BXX G;  3J7A 5;  3NEL A;  4DUZ L;  4UY8 C;  4B3R Q;  3RZD H;  1BKB A;  4JYA Q;  1HNZ Q;  1FL0 A;  4BBR G;  3NEM A;  2WB1 E;  5HY6 A;  3U50 C;  1OXT A;  2JA7 G;  1Q1E A;  3NEN A;  4JG2 A;  2CKZ B;  1CUK A;  4YCW A;  4B3S Q;  4DV3 Q;  2PMZ E;  4NB3 A;  2OWO A;  3HOV H;  2R7D A;  4B3M L;  5JJI A;  3L2P A;  3I4M H;  3UDG A;  3STB D;  1Q86 C;  1P8L A;  3F1Z A;  3K80 C;  2F4V L;  4JI7 Q;  3S16 H;  2MO0 A;  2FXQ A;  4XTC S;  4AQY Q;  1PH4 A;  2ZJR A;  2R92 H;  1I5F A;  5J3B A;  1WCM G;  4R4T A;  4POG A;  3GTJ H;  1Q81 C;  4JI2 Q;  4FDB A;  4LF5 L;  2ZTE A;  1YI2 A;  3HOZ G;  3S15 H;  2ATW A;  1Q8K A;  4DR7 Q;  3AFP A;  4IOC A;  2R93 G;  3ER0 A;  1VQP A;  3AEV A;  2VZA A;  2Q2H A;  4OWT B;  3PIP A;  2R6G A;  1QUQ A;  4RMF A;  3J81 c;  4X66 L;  2E8G A;  2JEA I;  5EAY A;  1JB7 A;  4A3F G;  1N8R C;  3GTP H;  1SRU A;  3U4V A;  3STB C;  1IBM Q;  2L15 A;  1PYS B;  2Q2I A;  2A1A A;  3UE1 A;  3RNU A;  3I4N H;  3B6Y A;  3PUV A;  2HQL A;  4JI4 L;  4DV6 Q;  3ULL A;  3RZO H;  2UUB L;  1OXS C;  4P72 A;  5IP9 G;  4HJ7 A;  2UXD L;  2ZTD A;  2KEN A;  3G48 A;  5GAD C;  3ERS X;  4YHH L;  3SGI A;  5IYC H;  1VQF A;  5M3M H;  3PO2 G;  3HOU G;  4DR5 Q;  1Y1V G;  4MZ9 A;  2WAQ E;  4DAY B;  4YY3 Q;  4JI1 L;  1QVG A;  3G6E A;  2CWA A;  2JA5 G;  1ASZ A;  1P16 A;  1YZ6 A;  4JC0 A;  1SRO A;  4QGU A;  2VS1 A;  3H3V I;  4X6A H;  4GKJ L;  1IBK L;  1J5E L;  1H95 A;  3L7Z C;  3W1B A;  3BZK A;  4DR6 L;  5AJ3 Q;  2K52 A;  1DGS A;  2LXK A;  3OYY A;  4DR1 L;  5GAE C;  5C4X H;  1E24 A;  1PH7 A;  4OO1 G;  1L1O A;  3FKI H;  3KFU A;  2AHO B;  3CPF A;  3GD7 A;  2ZTC A;  4A3I G;  1HNX L;  2LSS A;  4O2D A;  2NZH A;  1LUZ A;  4A3E G;  1Y1W H;  1IYJ B;  1UEB A;  4GKK Q;  5C4J H;  1L1O C;  2YTV A;  3RN5 A;  1VS0 A;  4WJ4 A;  2A19 A;  5LMU Q;  4UP7 A;  3PUX A;  1EUJ A;  2IHE A;  2JJQ A;  1HR0 L;  1B7Y B;  2JK8 A;  3F8T A;  1VQ7 A;  1XNR L;  2CQO A;  1XMO L;  1VQN A;  1PH3 A;  1HH2 P;  3OTO Q;  1VQM A;  1UE1 A;  3K0X A;  3M4O H;  1FJG L;  4X64 L;  1A8V A;  1K83 H;  2HHH Q;  4IPC A;  2K50 A;  4OX9 L;  2E2H H;  2KBN A;  1Q7Y C;  2E2I H;  2RF4 A;  3GDE A;  5C0X I;  2HT1 A;  4LFC Q;  3W5O A;  5JJL A;  3TRE A;  1SR3 A;  2OCE A;  5ELN A;  4P71 A;  4GNX C;  4IFD G;  1LM0 A;  1WFQ A;  2MQH A;  3PGZ A;  1SE8 A;  2F3I A;  2IT1 A;  1A0I A;  3CQZ H;  5AJ3 L;  4KHP Q;  1OXV A;  3H15 A;  3KF6 A;  3CC7 A;  3HKZ G;  4DUZ Q;  4H02 A;  3S1M H;  4ME3 A;  1RIP A;  1MKH A;  4BA1 I;  4IPG A;  5LMN L;  4A4I A;  3GO5 A;  1QZG A;  4R4O A;  1QVF A;  2B29 A;  2D62 A;  1D8L A;  1K3R A;  4LF6 L;  4DR4 L;  1TWC H;  4EX5 A;  1VQ5 A;  4C3H H;  4B3M Q;  2HIX A;  3A74 A;  3PV0 A;  1PA6 A;  3CCL A;  3IRB A;  2F4V Q;  4LF7 L;  1D7Q A;  4YCV A;  3CP0 A;  5GAG C;  4NXM L;  2QEX A;  2VQF L;  2VW9 A;  4RG1 A;  1YHQ A;  1KRT A;  2OTJ A;  5C0X J;  1VCI A;  3ULP A;  5M3F H;  4LF5 Q;  4A3L G;  1YEZ A;  2PNH A;  1S3O A;  2N78 A;  4A76 A;  4LFC L;  3H0G H;  4IPH A;  4LFA L;  4OON A;  4LUO A;  1S72 A;  1N33 L;  1HZC A;  2NVT H;  4LFB Q;  1Y14 B;  4X66 Q;  2ZJP A;  4DAM A;  1PFS A;  4L5T A;  1QVC A;  2C35 B;  3BZC A;  1MIU A;  4XIG S;  4A3J G;  2KHJ A;  2MO1 A;  4A3B H;  3I4O A;  1E7Z A;  4L5Q A;  3CCR A;  4JI4 Q;  2Q2U A;  1C0A A;  2BA0 A;  3EN2 A;  4BY1 H;  3CMA A;  2UUB Q;  3TS2 A;  4BXX H;  4A3C H;  1EQQ A;  2UXD Q;  1X3F A;  4JBJ A;  3E9H A;  3M4P A;  1XNQ L;  5C3E G;  5FLM G;  4YHH Q;  5JEA J;  4BBR H;  1N36 Q;  3CC2 A;  3GTK H;  1AH9 A;  1PHJ A;  3T1H L;  4YWM A;  5IT9 c;  2JA7 H;  1PVO A;  1IZ6 A;  1Q12 A;  2D0P A;  3A5Z B;  4JI1 Q;  1K8G A;  4JBK A;  3HOW G;  1KD1 C;  2VUM G;  4A3M H;  2I5M X;  5JJK A;  4HIO A;  1TWF H;  1IBK Q;  1J5E Q;  4GKJ Q;  3CCE A;  3S1Q H;  1X6O A;  4DR6 Q;  1YJ9 A;  1JE5 A;  5IP7 G;  3M85 A;  3W1G A;  1NJI C;  1VQK A;  4DR1 Q;  1QUQ B;  4GLV B;  3CC4 A;  2UXB L;  1JT8 A;  1TWH H;  3FP9 A;  3CXC A;  2BA1 A;  1HNW L;  1MJC A;  4A93 G;  4R4C A;  3FHW A;  1HNX Q;  1MJE A;  4DV7 L;  1K0R A;  4LW1 A;  2E2J H;  3HOZ H;  3PUW A;  3KLW A;  1VQ4 A;  1GM5 A;  2R93 H;  3K7A H;  3GTO H;  4JOI A;  4LF9 L;  1WOC A;  2R92 G;  1PH1 A;  3HKS A;  3HOY G;  1NE3 A;  2CFM A;  3MEF A;  1HR0 Q;  1XNR Q;  3VDY A;  2NVQ H;  3HKZ E;  2WFW A;  4DR2 L;  5IWA Q;  1XMO Q;  1PH5 A;  2VNU D;  5IYD G;  5E7N A;  4JOI C;  3J81 j;  4IJH A;  3UDX A;  2V1C C;  4X64 Q;  4JI6 Q;  3KF8 B;  1FJG Q;  1PH6 A;  1NMG A;  1CKN A;  3KJO A;  1N36 L;  1U0L A;  1L2F A;  2UUA L;  5IP9 H;  4JBM A;  4OX9 Q;  2UXC L;  1UWV A;  5ELO A;  2JA8 G;  4MNO A;  1G6P A;  4IPD A;  3D0F A;  1VQ9 A;  3PO2 H;  1JJC B;  4C3I H;  4HJ8 A;  3J7Z C;  5FJ8 G;  2ES2 A;  1VQB A;  4LF4 L;  1L1O B;  1R9T H;  3HOU H;  1Y1V H;  3CF5 A;  3CME A;  1Q82 C;  3CCQ A;  1E1O A;  4PZ8 A;  3G71 A;  4JI0 Q;  1A62 A;  3PCO B;  4YWK A;  2AKW B;  3HFZ B;  1X3G A;  2YYZ A;  2F52 A;  1YIJ A;  5IYC G;  5LMN Q;  1YVC A;  3PSI A;  1EIY B;  3UDI A;  2RCN A;  4GOP A;  1CSP A;  4DKA C;  2MFI A;  3M3Y H;  2N49 A;  1WYD A;  4C3J H;  1XPO A;  5IY0 A;  1C7Y A;  2PI2 A;  4P74 A;  4LF6 Q;  4DR4 Q;  2CWP A;  4A3I H;  4JI5 L;  1N32 L;  1KL9 A;  1Q1B A;  3K81 C;  3M4Q A;  2UU9 L;  4A3E H;  4GOP C;  1GVP A;  1YHB A;  4GNX B;  2BH2 A;  4LF7 Q;  2IY5 B;  4DV0 L;  5C4X G;  5IWA L;  4NXM Q;  4NPS A;  4A3K G;  2VQF Q;  4PZ7 A;  1YJN A;  1GO3 E;  4R1J A;  4JI6 L;  4DR3 Q;  2A8V A;  1X3E A;  5C0X G;  3CD6 A;  1VQA A;  3LGJ A;  3J81 i;  1G51 A;  1KC8 C;  1Z47 A;  4JI8 L;  1VQE A;  4AH6 A;  4LFA Q;  2JQO A;  4GS3 A;  1JJG A;  1KAW A;  3KF6 B;  5GRO A;  1N33 Q;  2NN6 I;  1SFO H;  1NBW A;  2JA9 A;  1BBU A;  1M1K C;  4IOA A;  4Y7N H;  1K9M C;  2Q2T A;  1YNX A;  3PUY A;  1C9O A;  4JI0 L;  2ASB A;  4JBW A;  1VQO A;  1I94 L;  2PQA A;  1V1Q A;  2IHF A;  2QA4 A;  4B3T L;  2HIV A;  1KQS A;  2K4K A;  4QQB X;  1XPU A;  4GLA C;  1OXX K;  4BY7 G;  1XMQ L;  3TQY A;  2JE6 I;  2E5L L;  3S2H H;  4JCV E;  1VQJ A;  1EFW A;  3CCU A;  3F2B A;  1XNQ Q;  1CKO A;  3KOJ A;  5JEA G;  2JA6 G;  3CCM A;  2GVB A;  3A5U A;  3T1H Q;  5GAH C;  1JJ2 A;  2Z6K A;  1X65 A;  4QIW E;  3GTM H;  4O0A A;  3GTL H;  4DV2 L;  3U58 A;  3EIV A;  4UP9 A;  3T1Y L;  3U4Z A;  3I55 A;  1W2B A;  4LUV A;  4PG3 A;  4DR3 L;  1N34 L;  2Z6K C;  1KXL A;  3RLO A;  1PH8 A;  4OXP A;  2CCZ A;  4A3D G;  4HJ5 A;  2VL6 A;  2R7F A;  4DK3 C;  2UXB Q;  4JV5 L;  3RR5 A;  1L0W A;  3S1N H;  4QJF A;  3PO3 H;  3S17 H;  1HNW Q;  1HZA A;  1UE5 A;  4X65 L;  4LFB L;  4A3L H;  3PF5 A;  1FGU A;  4BBS G;  5C44 G;  2VQE L;  4DV7 Q;  3RLF A;  4KHZ A;  5M5Y H;  2IX0 A;  4TQU S;  5IYB H;  1SMX A;  4AYB G;  3HOX G;  2B63 G;  3KDF A;  2MNA A;  4LF9 Q;  4A3G G;  1X9N A;  1X54 A;  4DV5 Q;  4MTN A;  1YJW A;  1AE3 A;  3JAM c;  1IBL L;  3S14 H;  3A0J A;  4APV A;  4DR2 Q;  1YBY A;  2AWO A;  4LF8 L;  2YV5 A;  4JI3 L;  3E0E A;  4HIM A;  3TRZ A;  1W3S A;  3ZJY C;  1E22 A;  2UUA Q;  2UXC Q;  5BR8 Q;  4DUY L;  3J80 c;  2R7Z G;  4LUZ A;  4WJ3 M;  2ALY B;  1CKM A;  1CSQ A;  1N9W A;  2AMC B;  5C3E H;  2NVX H;  4DPG A;  1XPR A;  4LWC A;  4LF4 Q;  4A3B G;  2OQ0 A;  5GQO A;  4HID A;  1WJJ A;  4A3C G;  2NZO A;  2K5V A;  2KCM A;  3CW2 C;  3F2C A;  4J15 A;  4NXN L;  2RHS B;  3HOW H;  2VUM H;  1XTD A;  1HR0 W;  2GVA A;  1Q46 A;  1WCM H;  1YHA A;  3HOV G;  4YWL A;  4DV4 L;  5IP7 H;  2PI2 E;  3I4M G;  3L0O A;  3MXN B;  1EWI A;  1BVS A;  4UPA A;  4DNI A;  1VQC A;  4LNQ A;  1I50 H;  3WWV A;  1VQI A;  4A3M G;  2BH8 A;  3EBE A;  4A93 H;  3K7U C;  3G4S A;  4DV5 L;  1KIX A;  4JI5 Q;  2ZM6 L;  3DLL A;  1V43 A;  1N32 Q;  2UU9 Q;  4C2M H;  3AFQ A;  4A3F H;  1CKN B;  1SLJ A;  5IE8 A;  4DV0 Q;  4K0K L;  3NBH B;  1XJV A;  1M90 C;  3BJU A;  4KLK A;  4IJL A;  3HOY H;  4ALP A;  3E9I A;  1FVI A;  5BR8 L;  3AYH B;  2K5H A;  5IYD H;  5LMN W;  5FLX c;  3KJP A;  4DV1 L;  4JI8 Q;  1K73 C;  1OXU A;  2KHI A;  2UUC L;  3UDF A;  1A63 A;  1G29 1;  5HGQ A;  1NY4 A;  4X62 L;  3ICE A;  3I4N G;  1K8A C;  3I7F A;  1TXY A;  3JAM i;  2JA8 H;  1X56 A;  1LTL A;  1NMF A;  3H3V H;  4Y52 H;  4UP8 A;  3TEH B;  2JA5 H;  2GN5 A;  2LXJ A;  4GOP B;  2I5L X;  2K5N A;  1I94 Q;  1NTG A;  5FJ8 H;  4HJ9 A;  4B3R L;  4JYA L;  1HNZ L;  1VQG A;  4B3T Q;  2K14 A;  2IX1 A;  5M3M G;  2Y0S G;  1HZB A;  1J6Q A;  1GD7 A;  1GKH A;  3J80 i;  1XMQ Q;  1HJP A;  1WI5 A;  2E5L Q;  4B3S L;  4DV3 L;  2YTY A;  1PH2 A;  1T9H A;  2DUD A;  4AYB E;  1VQH A;  2YU9 H;  1ASY A;  1YIT A;  3I56 A;  4JI7 L;  1E1T A;  4AQY L;  1IXR A;  3DM3 A;  3M9B A;  3CPW A;  3S1R H;  3CCJ A;  1IL2 A;  1SN8 A;  4R4Q A;  5M5W H;  3S2D H;  2AWN A;  2DGY A;  4DV2 Q;  1V9P A;  3FKI G;  3T1Y Q;  1UE6 A;  4JI2 L;  1TWG H;  2N8N A;  4YCU A;  1I3Q H;  1KHI A;  1N34 Q;  1I6H H;  2Z0S A;  4AIM A;  1JMC A;  2OQK A;  4GN4 B;  1Y1W G;  4A3K H;  2I5H A;  4DR7 L;  4JV5 Q;  1O7I A;  2WB1 G;  1VQD A;  5H1S E;  4OO1 I;  4POF A;  4X65 Q;  2WP8 J;  2EXD A;  4GN5 A; 
#chains in the Genus database with same CATH topology
 1TWA B;  1VDZ A;  2XN9 C;  1SE4 A;  1S40 A;  1PFB A;  4IFD H;  4PMW A;  2RBM A;  4DXG A;  4DV6 L;  3M7N A;  4LF8 Q;  2QKI C;  3RLN A;  2K75 A;  4GNX A;  3GTQ H;  4OWW B;  3ULJ A;  4A3G B;  1K8O A;  2H5X A;  4BY7 H;  5DLQ E;  2B2U C;  4K6D A;  1PTO C;  1A2T A;  1LV9 A;  3O13 A;  4N8X 1;  4GLX A;  4IFD I;  1PRT C;  5IGE A;  1MI2 A;  1TWA H;  1PH9 A;  2BOS A;  2KCC A;  3OIP A;  2NUC A;  2VUM B;  3L9A X;  1Y8N B;  4WOR A;  4OWX B;  4EQ5 A;  4G7H C;  4RKB A;  1WTH A;  1SYE A;  3OHX C;  3OMG A;  3BU2 A;  1AZP A;  3TS0 A;  4BBS H;  3CAM A;  3PIO A;  3RN2 A;  1QWY A;  4HED A;  3HOV B;  2B63 H;  5ELE A;  4BA2 I;  2O2L D;  4OL7 A;  4A3G H;  3VA7 A;  4K2K A;  2Y0S E;  3H0G G;  5NUC A;  4TVA B;  1VQL A;  4FO2 A;  4DV1 Q;  3KYH C;  3Q8D A;  1S5F D;  5FLM H;  2EOT A;  3DWQ A;  3I3C A;  3BVM A;  4BY1 G;  1RHP A;  4ZKC B;  1O7Z A;  3NEL A;  4Q5V A;  1SJH D;  4UY8 C;  3RZD H;  1BKB A;  3J80 E;  4BBR G;  2P5Z X;  5HY6 A;  2D5D A;  3RZO B;  3HOV H;  2PMZ E;  2NBF A;  2OWO A;  2R7D A;  3K6O A;  4B3M L;  5CC4 A;  3L2P A;  5LL6 S;  4ME5 A;  4JI7 Q;  1CT1 D;  5M3M B;  1O7L A;  4HR7 B;  5HUR A;  2AQ3 B;  2ZJR A;  1I5F A;  1TR5 A;  3J80 L;  4JI2 Q;  3D3R A;  3PMF A;  4RH6 A;  1YI2 A;  4QB4 A;  3EJI A;  2ATW A;  1C8C A;  2NTT A;  2R6G A;  3DHQ A;  3J81 c;  5C4X B;  4X66 L;  2JEA I;  1JB7 A;  4MN3 A;  1UUP A;  1SRU A;  4NW2 A;  2KJX A;  2L15 A;  3KK7 A;  4GZY C;  1EWH A;  1JWS D;  3FRP B;  3RZO H;  5IP9 G;  1SYD A;  2N88 A;  2ZTD A;  3LWU A;  4L63 B;  2A6E C;  3ERS X;  5CV7 A;  1AW7 A;  1I4P A;  1VQF A;  2XRQ D;  4XXE A;  5M3M H;  3HOU G;  1KNA A;  3M4O B;  5D3D A;  4YY3 Q;  1QVG A;  4JI1 L;  3IFD A;  2CWA A;  2D2C C;  1E2W A;  2SEB D;  4QGU A;  2MP1 A;  4X6A H;  5G3L D;  4GKJ L;  3L7Z C;  1ET9 A;  3W1B A;  1WTR A;  2M9V A;  2NTS A;  2K52 A;  1DGS A;  3OYY A;  4R9W A;  4DR1 L;  5C4X H;  1CHP D;  1E24 A;  5A35 A;  1SBB B;  1V1O A;  4KY6 A;  4XQN A;  2ZTC A;  2F0U A;  4A3I G;  4A3E G;  1BCP F;  1UEB A;  1YNN C;  1EU3 A;  2MHV A;  4WJ4 A;  2A19 A;  2IHE A;  1XNR L;  1VQ7 A;  5L37 A;  1I4R A;  1HH2 P;  3OTO Q;  1UE1 A;  3M4O H;  1A3T A;  4X64 L;  3GV6 A;  5J1Z A;  2HHH Q;  5C0X I;  1TVX A;  1SDF A;  3KBG A;  3I70 A;  3QJY A;  1SR3 A;  4GNX C;  4IFD G;  2ENB A;  3I4L A;  3A7L A;  1H9J A;  4F88 A;  1A0I A;  1OXV A;  1ZXT A;  2F4I A;  2NVT B;  2LKV A;  2R7Z B;  4H02 A;  1MKH A;  5K36 H;  4IPG A;  1IW7 C;  3A8I E;  1NNX A;  1B1Z A;  1EOT A;  4LF6 L;  1EY0 A;  4DR4 L;  4R8N A;  3A74 A;  3PV0 A;  3CCL A;  3MAQ A;  2VQF L;  4XT3 B;  1EEF D;  1KRT A;  2OTJ A;  1F9Q A;  1VCI A;  3ULP A;  4LF5 Q;  2L55 A;  1YEZ A;  1LTT D;  3BVG A;  4K6L A;  4A76 A;  1JOQ A;  4LFC L;  3NXW A;  2PW7 A;  4ABN A;  4KJN A;  1N33 L;  2NVT H;  4RHR A;  4JW0 A;  3VYU A;  3W3A A;  2ZJP A;  4L5T A;  1CHQ D;  3MFY A;  1MIU A;  2L9H A;  2B2Y A;  2MO1 A;  3GTP B;  2R93 B;  3Q23 A;  2F0I A;  3EN2 A;  4A3C H;  3TS2 A;  2CW0 C;  2XWJ B;  1JWU D;  5FLM G;  5JEA J;  3ERO A;  1N36 Q;  3CC2 A;  4CDD C;  3J7Y W;  4YWM A;  3HRZ C;  5IT9 c;  5EPJ A;  4OEM B;  1Q3L A;  3A5Z B;  1KD1 C;  1DJR D;  2VUM G;  1ENA A;  5JJK A;  4M1U B;  3MWY W;  3K59 A;  4DR6 Q;  2BE5 C;  4C3I B;  1JT8 A;  2SOB A;  2BA1 A;  1HNW L;  1MJC A;  4J8Q A;  4R4C A;  5DAU A;  3FHW A;  4LW1 A;  1VMC A;  2FIN B;  2R93 H;  4LF9 L;  1BNZ A;  1PH1 A;  1H9S A;  3HKS A;  1NE3 A;  2R61 A;  3MEF A;  3VR2 A;  3M3Y B;  4XDX A;  1RKN A;  4IUR A;  3QIA A;  2WFW A;  4DR2 L;  1PH5 A;  1BCP C;  1DON A;  3J81 j;  5CV5 A;  2CH4 A;  2Z9H A;  1FJG Q;  2PMZ B;  4JI6 Q;  1JOO A;  1NMG A;  1CKN A;  3L3O C;  1L2F A;  4JBM A;  1Q8I A;  2NWG A;  2IL8 A;  1ZYR C;  4IPD A;  1A3U A;  1VQ9 A;  1JJC B;  2J0T D;  4C3I H;  4LF4 L;  2E2I B;  1Y1V H;  3H91 A;  3E0J A;  2OXP A;  1CI3 M;  4UAI A;  1WD0 A;  1S4Z A;  1YIJ A;  5LMN Q;  1YVC A;  1LT6 D;  1CSP A;  1GJX A;  2MFI A;  3M3Y H;  2N49 A;  1WYD A;  1XPO A;  2NYZ D;  5IY0 A;  4P74 A;  4ILW A;  4JI5 L;  4FXG C;  2MGS A;  5CV9 A;  1GVP A;  2F0H A;  2BH2 A;  3KLS X;  5C4X G;  5EPK A;  4NPS A;  2QDL A;  1O7Y A;  4PZ7 A;  1G91 A;  4DR3 Q;  2A8V A;  4PMB A;  5C0X G;  3NUC A;  3CD6 A;  4KJO A;  4FXD A;  1VQE A;  2KCN A;  5M3F B;  4IUT A;  5GRO A;  1T5X D;  1BBU A;  3PO3 B;  1A6X A;  2Q2T A;  1YNX A;  1SNQ A;  2ASB A;  5M5Y B;  2WKD A;  5D14 A;  5M9O A;  1XPU A;  2XNA C;  1XMQ L;  3TQY A;  1EFW A;  3F2B A;  3E6Z X;  2JA6 G;  3A5U A;  1JJ2 A;  5LHY 1;  2Z6K A;  1X65 A;  2K01 A;  3ERQ A;  3U58 A;  3T1Y L;  5A2Q E;  2HQE A;  3RLO A;  3D4R A;  4OXP A;  1J8I A;  2XRS D;  1XWE A;  4QJF A;  3PO3 H;  1HZA A;  4X65 L;  5CGK A;  4YIJ A;  1FGU A;  3I72 A;  4KHZ A;  3C1F A;  2IX0 A;  4K8J A;  4TQU S;  1SMX A;  5M5Y H;  4FP5 D;  4DV5 Q;  3QO2 A;  3SDZ A;  3HOZ B;  3JAM c;  3A0J A;  2AWO A;  1R4P B;  4LF8 L;  1BDO A;  5K5P A;  2YV5 A;  1E22 A;  4K14 A;  1D1K A;  2B39 A;  2K03 A;  2R7Z G;  3QWN A;  5FO9 B;  1STB A;  4RFB A;  4HSV A;  1C48 A;  1EY5 A;  2Q8T A;  5GQO A;  1EZ8 A;  4A3C G;  2X6G A;  2KCM A;  4JVZ A;  5I9O A;  3F2C A;  4C56 C;  2B2T C;  4DK1 A;  2HDM A;  3V05 A;  4EQN A;  5IP7 H;  4DNR B;  1H9S B;  5KGU A;  4UPA A;  1VQC A;  4PV1 C;  1VQI A;  1G2S A;  1NCV A;  1KIX A;  1NUC A;  4J6H A;  1CKN B;  2SNM A;  3K57 A;  3FEW X;  1STH A;  1FVI A;  2QW7 A;  2HCC A;  2K5H A;  5IYD H;  3KJP A;  4DV1 L;  4JI8 Q;  1OXU A;  1TWG B;  2KHI A;  3IAY A;  1I6H B;  5HGQ A;  1NY4 A;  3I73 A;  3LWE A;  5KND A;  1LTL A;  3H3V H;  3TEH B;  1TS2 A;  4ZRZ A;  2K5N A;  4DK0 A;  1NTG A;  5FJ8 H;  2DY8 A;  1RTO A;  2Y0S G;  1HZB A;  1LTI D;  5JVG 3;  1J6Q A;  5EJW A;  2A69 D;  2DUD A;  2YU9 H;  1ASY A;  3NWS A;  4JI7 L;  4K5X A;  2GA4 B;  4JI2 L;  1TWG H;  2N8N A;  4YCU A;  1I6H H;  3EVQ A;  3KBX A;  4RKL A;  2OQK A;  3GV3 A;  1Y1W G;  1H9K A;  4JV5 Q;  3H09 A;  3R2I A;  4FF2 A;  3H6M A;  3ONA B;  3MVV A;  3CCS A;  1F2Z A;  2VQE Q;  1DOK A;  1E3P A;  3S17 B;  1STY A;  3K8A A;  2SDF A;  2VY3 A;  4DAP A;  1JOK A;  1TS3 A;  4GN3 B;  4QL5 A;  1PLF A;  4G7O C;  3VYS A;  2F0P A;  3NE5 B;  2CH4 W;  3HOX B;  1WTO A;  4JI3 Q;  3S14 B;  1PV4 A;  3C3L A;  2HDL A;  2EQS A;  3F2D A;  1BUV T;  4ZAI A;  4YY3 L;  2N55 A;  3DEO A;  1Z9F A;  2K5Q A;  3Q0A A;  2B3G A;  2XSC A;  5JEA H;  3CRK C;  2EIF A;  3QR8 A;  2XTI A;  1HTL D;  4C1N K;  2BCO A;  4K5V A;  1QNU A;  1SMY D;  3Q6S A;  4NXN Q;  4QMG A;  3VYR A;  4ZKB B;  1EQR A;  2JN4 A;  4IO9 A;  4DV4 Q;  3QOJ A;  2JEB I;  2ZJQ A;  3AQQ A;  4HMJ A;  3OW2 A;  1STG A;  2F3V A;  3PUZ A;  3HOX H;  5J22 A;  5M3F G;  5IOD A;  1WTP A;  4A93 B;  4K0K Q;  3OTO L;  3I4M B;  2N3S A;  3D31 A;  3PO3 G;  4QY7 A;  4DK6 C;  2HHH L;  2L5T A;  4R4I A;  2R92 B;  2D9U A;  1PRT F;  1F2L A;  5TSS A;  4N8F A;  5BN5 A;  1HZ9 A;  3K5L A;  1HQM C;  1V1P A;  4DN4 M;  1WTW A;  2UUC Q;  3VR4 A;  4DF7 A;  1UE7 A;  2OTL A;  1G8Z D;  5JOB A;  3HGB A;  1STA A;  1GUG A;  1OXT A;  1Q1E A;  4QUC A;  3NEN A;  1BR9 A;  2CKZ B;  2I07 B;  4B3S Q;  4DV3 Q;  4NB3 A;  3NHH A;  3I4M H;  2QF7 A;  1LAB A;  1P8L A;  3K80 C;  3S16 H;  1PH4 A;  1MSG A;  4J1M A;  2R92 H;  5J3B A;  2BDN A;  4LF5 L;  4FDB A;  2ZTE A;  2Z1C A;  3HOZ G;  1HQR D;  5DM6 3;  2K32 A;  2EPB A;  4IOC A;  3ER0 A;  4RAU C;  2VZA A;  1OO9 B;  2Q2H A;  4OWT B;  4RMF A;  1QUQ A;  5KRU A;  2EZV A;  2E8G A;  3U4V A;  5IGD A;  4PMC A;  3I4N H;  1ROD A;  2PCF B;  1XTC D;  2HCI A;  1EL0 A;  2V4D A;  4HJ7 A;  5GAD C;  2G9H D;  1EQT A;  5IYC H;  1F2M A;  5I6Y A;  1NR2 A;  4I7A A;  4HMI A;  3G6E A;  4KY5 A;  4FF3 A;  2E2H B;  4JC0 A;  1SRO A;  2RA4 A;  4BY7 B;  5BN4 A;  1ENF A;  1QNK A;  5FLX L;  5AJ3 Q;  1F9S A;  4DR6 L;  3CRL C;  1PH7 A;  2K28 A;  4XYO A;  1RDP D;  1MHW C;  2EJM A;  2NZH A;  4H13 C;  5C5L A;  3CHB D;  1L1O C;  2JJQ A;  1PTO B;  1PH3 A;  2DNE A;  4BBS B;  1FJG L;  1U4P A;  2B63 B;  4RA8 A;  2E2H H;  2KBN A;  3GDE A;  1M8A A;  4EQO A;  5EBD A;  3G7L A;  3NSW A;  2OCE A;  5ELN A;  4P71 A;  3NTI A;  2MQH A;  3U9O A;  1SE8 A;  4KHP Q;  3H15 A;  3KF6 A;  1CK1 A;  5C3X A;  2RDH A;  1FR3 A;  2EXZ A;  4DUZ Q;  1G6Z A;  4FXK C;  1RIP A;  5LMN L;  1GUS A;  1QVF A;  2D62 A;  3RZD B;  3PIO 3;  1GHJ A;  1PTO H;  1TWC H;  4C3H H;  2HIX A;  1CFM A;  4B9W A;  4CDF C;  3BZD B;  1S5B D;  4YCV A;  3T51 B;  1YHQ A;  5C6A A;  3BDO A;  3HEJ A;  5EQ0 A;  1EYC A;  2PNR C;  1V1P B;  4A3L G;  1I4G A;  2PNH A;  1EZ6 A;  1BF4 A;  2PZW A;  4CBV A;  1SNP A;  2A74 C;  1S72 A;  1Y8P B;  1JR0 D;  4DAM A;  4RGO S;  2L4N A;  3MXU A;  3OW7 A;  3BZC A;  4XIG S;  5FO7 B;  4JI4 Q;  2Q2U A;  1C0A A;  4TSS A;  4BXX H;  1ML0 D;  4HCE A;  1ILQ A;  2UXD Q;  2EY5 A;  3D6W A;  1GUN A;  3X3M A;  3M4P A;  4WJW A;  3NP8 A;  4YHH Q;  2B8F A;  3OPO A;  2JA7 H;  4LAA A;  1IZ6 A;  1Q12 A;  2D0P A;  1Z7T A;  4JBK A;  1VF7 A;  3TZU A;  2R3Z A;  2I5M X;  1SNM A;  4HIO A;  1X6O A;  1YJ9 A;  2F0K A;  3M85 A;  1VQK A;  3SE0 A;  1QUQ B;  4GLV B;  2EJG C;  3CXC A;  4A93 G;  1T5E A;  2EYF A;  3E3X A;  4PNY A;  2A68 D;  3VR3 A;  1VQ4 A;  2ICE C;  3K7A H;  2R92 G;  5JPN C;  3MXN A;  3HOY G;  2F0O A;  3KLS A;  3HKZ E;  5IWA Q;  1XMO Q;  4I65 A;  2AQ1 B;  2ZXR A;  2VNU D;  4JOI C;  5IT9 L;  2F0F A;  3UDX A;  5DM7 3;  3KF8 B;  2Q8R E;  3ZYY X;  1PH6 A;  1U0L A;  3A7A B;  1UWV A;  5ELO A;  1U4L A;  4HJ8 A;  3BVZ A;  3PO2 H;  3J7Z C;  1VQB A;  5FKA C;  1HPC A;  1Q82 C;  1L0Y B;  2AUK A;  1E1O A;  4PZ8 A;  4JI0 Q;  4YWK A;  1LTB D;  1SFO B;  1X3G A;  2F52 A;  4RGT A;  4Z9C B;  4Y7N B;  5IYC G;  1RD9 D;  5ELF A;  2CQA A;  3TP7 A;  2RCN A;  2B2W C;  5F2D A;  3TDQ A;  1WVL A;  1ILP A;  1S5C D;  1EYA A;  2NN6 H;  1Q1B A;  4GOP C;  1QB5 D;  4GNX B;  4LF7 Q;  4R8I A;  3V2T A;  4NXM Q;  3SK5 A;  4FF4 A;  1HHV A;  1LLR D;  4IN3 A;  1YJN A;  2AQ2 B;  3GTL B;  1G51 A;  3FDT A;  4JI8 L;  4AH6 A;  4LFA Q;  1KAW A;  3KF6 B;  3BDC A;  1F9R A;  3MXG A;  1KLU D;  4IUP A;  2NN6 I;  1WTV A;  1SFO H;  1M1K C;  1EY6 A;  1PTO D;  3S1N B;  4Y7N H;  4OHJ A;  1C9O A;  2PQA A;  2IHF A;  3NWT A;  2EY1 A;  2QA4 A;  4X3U A;  4GLA C;  4BY7 G;  2WAC A;  1X3Q A;  1B9M A;  2JE6 I;  4JCV E;  1VQJ A;  1EY8 A;  4F8M A;  3KOJ A;  3KUP A;  3T1H Q;  4ZQ3 A;  4OIJ A;  1GHK A;  4QIW E;  5HGT A;  4ODG A;  4O0A A;  2F1M A;  3GTL H;  5KNB A;  2H1E A;  2E76 C;  3EIV A;  3U4Z A;  3K58 A;  4LUV A;  3P1H A;  2EE1 A;  2R7F A;  4JV5 L;  3S1N H;  3HOW B;  1HFN A;  1JC7 A;  1UE5 A;  3SK4 A;  3PF5 A;  4OIK A;  4BBS G;  2VQE L;  4DV7 Q;  2B63 G;  2F0G A;  4A3G G;  1X54 A;  1YJW A;  1W6J A;  2TSS A;  1SE2 A;  4APV A;  1SYF A;  2DY7 A;  3K5O A;  4A3F B;  4JI3 L;  3E0E A;  1R4Q B;  1KNE A;  1W3S A;  5D65 A;  3W2D A;  1ICW A;  5BR8 Q;  5C5M A;  3J80 c;  4LUZ A;  4WJ3 M;  2LMC B;  1IKL A;  5C3E H;  2B2T A;  3NBI A;  4LWC A;  2B8G A;  4NMZ A;  2OQ0 A;  3IL8 A;  4ZUI A;  4HID A;  1WJJ A;  3CW2 C;  2K5V A;  3HOW H;  4J15 A;  4NXN L;  2RHS B;  4S3S A;  3PIP 3;  2GVA A;  2L11 A;  1Y1V B;  1Q46 A;  2PQE A;  1BCP B;  1YHA A;  3HOV G;  3FPU B;  4DV4 L;  2JA5 B;  3MXN B;  1BQQ T;  1BVS A;  2XWB B;  3H94 A;  5C4Z A;  1O80 A;  1RF2 D;  1NSN S;  2BH8 A;  2OEO A;  4B9X A;  4CKB A;  3K7U C;  3DLL A;  4C2M H;  4A3F H;  5CV6 A;  1O78 A;  4DV0 Q;  4K0K L;  1B44 D;  4C1N I;  4KKU A;  4H44 C;  4ALP A;  3E9I A;  3T56 B;  3AYH B;  5LMN W;  1GOZ A;  4CDC C;  2UUC L;  1K28 A;  3ICE A;  3I7F A;  2OT2 A;  3JAM i;  4ZLT F;  2JA8 H;  1D6E C;  4Y52 H;  2JA5 H;  4M8A A;  1CA6 A;  1DZ1 A;  4B3T Q;  3P20 A;  5M3M G;  5I4D A;  4CKE A;  1GD7 A;  1GKH A;  4IUN A;  1ESR A;  2KEE A;  3F2U A;  1B53 A;  1I4X A;  2E5L Q;  4B3S L;  4DV3 L;  4OO1 H;  1KDB A;  1PH2 A;  1I6V C;  1T9H A;  3T16 A;  1YNN D;  1EYD A;  3HKZ B;  3PQI A;  1YIT A;  1CTM A;  2A5H A;  1DD2 A;  1IXR A;  2HUG A;  3DM3 A;  3M9B A;  3CPW A;  3C46 A;  1SN8 A;  4R4Q A;  1PZI D;  2DGY A;  4DV2 Q;  1V9P A;  4DAY A;  1KHI A;  2F0M A;  2Z0S A;  4AIM A;  3R8B A;  1JMC A;  1FNU A;  1UAP A;  4A3K H;  1O7I A;  4OO1 I;  2PZT A;  4POF A;  2NN6 G;  4YCW A;  1HUM A;  2K04 A;  3I8Z A;  2A69 C;  2PQA B;  2FMC A;  3URY A;  5I6W A;  4PZ6 A;  2FJ2 A;  1B8A A;  3PF4 A;  4MHE A;  1WD1 A;  4KMU C;  4L5S A;  2HD3 A;  1CZW A;  3TZD A;  5C44 B;  4HIK A;  1TT2 A;  3MTS A;  1BBW A;  1W6K A;  1AE2 A;  1TS5 A;  1EYG A;  3T13 A;  4F87 A;  1KRS A;  4P75 A;  4NDX A;  1MSH A;  5K36 G;  3QOL A;  4KI0 A;  3EA6 A;  2EJF C;  5M5X H;  3DMU A;  3FMC A;  4A3D H;  2I0Q A;  1RCV D;  1VQ6 A;  5IGG A;  1X55 A;  2YTX A;  1RL2 A;  5C44 H;  2ZM6 Q;  5KEE A;  2EYJ A;  4HN7 A;  1QJO A;  2MPM A;  2XGT A;  1EIF A;  1YNJ D;  1LT4 D;  4QIW B;  2A6H D;  1X3P A;  4IFD J;  1VF5 C;  2O5J C;  4X62 Q;  3S15 B;  1PYB A;  4WRD A;  1U5K A;  1B3A A;  4KTA A;  4KHP L;  1DYQ A;  1ONL A;  4DUZ L;  4B3R Q;  5J39 A;  1A15 A;  2QEJ C;  3NQT A;  5D3I B;  4JYA Q;  3NEM A;  2WB1 E;  5JPM C;  2NB0 A;  4IUQ A;  4JG2 A;  1CUK A;  1D1I A;  1A3V A;  3NK9 A;  3G6J B;  3UDG A;  3STB D;  3F1Z A;  2FXQ A;  4AQY Q;  1SNC A;  2YU9 B;  2J4X A;  5IGC A;  2RDF A;  4R4T A;  4CDE C;  1SND A;  3T53 B;  2BDO A;  3BDL A;  3S15 H;  4DR7 Q;  3AFP A;  2R93 G;  1VQP A;  2B2V C;  4A3F G;  1N8R C;  1IBM Q;  1V8Q A;  5E3F A;  1F2Y A;  1SYB A;  2A1A A;  3D8G A;  3RNU A;  5EKK A;  2HQL A;  5C4J B;  4JI4 L;  4FF1 A;  1OXS C;  4P72 A;  3NQI A;  1AEX A;  2UXD L;  2KEN A;  5DNF A;  1X32 A;  2LS0 1;  4YHH L;  3K5M A;  3SGI A;  3X3N A;  2F0W A;  4C3I G;  1JWM D;  2Z4H A;  4DR5 Q;  1Y1V G;  2WAQ E;  4DAY B;  1K83 B;  2JA5 G;  1ZEQ X;  1ASZ A;  1P16 A;  1YZ6 A;  1H95 A;  3H3V I;  1TS4 A;  4G4K A;  1ESF A;  5GAE C;  2X6L A;  4OO1 G;  1EQV A;  1L1O A;  4ULL A;  3FKI H;  3KFU A;  5CBE E;  2AHO B;  3CQZ B;  3NTK A;  3CPF A;  3GD7 A;  2LSS A;  3LNN A;  1LUZ A;  4XYQ A;  1IYJ B;  2Z8L A;  3S1M B;  2XIW A;  2PW5 A;  4K8I A;  5C4J H;  4GKK Q;  3R2T A;  5LMU Q;  3PUX A;  3AMU A;  5BN3 A;  1B7Y B;  2AUJ D;  1KAB A;  2JK8 A;  3F8T A;  4IAL A;  1XMO L;  1VQN A;  1LT5 D;  4I7Z C;  3CU7 A;  1K83 H;  2K50 A;  3AB9 A;  1F9P A;  1Q7Y C;  3D4D A;  2RF4 A;  2HT1 A;  3VA5 A;  4LFC Q;  3C1E A;  3TRE A;  4LMQ D;  1LAC A;  1ZKO A;  3H0G B;  3PGZ A;  2IT1 A;  3CQZ H;  3P7J A;  1CM9 A;  3A8K E;  4HSP A;  2EY2 A;  2G5D A;  1DXM A;  3HKZ G;  1PFN A;  3S1M H;  4BA1 I;  3TP5 A;  1QZG A;  1MD2 D;  5G3L F;  4MIU A;  2B29 A;  4BS9 A;  4KV6 A;  3I91 A;  2K6A A;  4BY1 B;  1VQ5 A;  1PA6 A;  2WII B;  2F4V Q;  4LF7 L;  1D7Q A;  4BBR B;  1K8M A;  5IOC A;  5GAG C;  3CP0 A;  4NXM L;  4RCO A;  2EVB A;  2QEX A;  2VW9 A;  5KNC A;  3TP8 A;  3DXJ C;  4LK1 C;  1SNO A;  5C0X J;  3S16 B;  1TY2 A;  4A3M B;  2C9O A;  3RMH A;  1TWF B;  1TII D;  3S1Q B;  3H0G H;  4IPH A;  4LFA L;  4OON A;  1TWH B;  4E6I A;  1SJE D;  1SSO A;  2CVR A;  4L5Q A;  3CCR A;  4BY1 H;  3CMA A;  2UUB Q;  1EQQ A;  2VB2 X;  4O1N A;  3I4N B;  4JBJ A;  4PQX A;  3E9H A;  4BBR H;  4H0L C;  4EGV A;  4KD3 A;  2O5I C;  1AH9 A;  1S5D D;  3T1H L;  2O4X A;  1K8G A;  3BYT B;  4A3M H;  1EY7 A;  1TWF H;  1IBK Q;  1J5E Q;  2VB3 X;  3S1Q H;  1JE5 A;  5IP7 G;  3S9W A;  3W1G A;  1NJI C;  3HOU B;  1R9T B;  1TWH H;  5JVH 3;  1BOS A;  1HNX Q;  4XQJ A;  1MJE A;  4DV7 L;  1K0R A;  1QE6 A;  2E2J H;  3GTO H;  4JOI A;  3WOE A;  2CFM A;  4X3K A;  1HR0 Q;  1SYG A;  2WB1 B;  5FLX E;  1D5M C;  2NVQ H;  5IYD G;  5E7N A;  2FFK B;  1PZJ D;  2V1C C;  5IGB A;  3KJO A;  1N36 L;  4OX9 Q;  5IP9 H;  2A68 C;  3A55 A;  1G6P A;  2ES2 A;  5FJ8 G;  3HOU H;  1L1O B;  1R9T H;  3CME A;  3FVQ A;  3CCQ A;  4FVM A;  2K5D A;  3ND9 A;  2DJF C;  3OSO A;  3J81 L;  2AKW B;  2B2W A;  3HFZ B;  1PMR A;  3BG3 A;  3PSI A;  5DEH A;  4GOP A;  4DKA C;  1Q90 A;  2QIL A;  4EQP A;  2PI2 A;  3SXH A;  1C7Y A;  4KKT A;  1QOH A;  3GP7 A;  2CWP A;  3VR5 A;  4A3I H;  4U68 A;  1KL9 A;  3K81 C;  4A3E H;  2KHS A;  2IY5 B;  4DV0 L;  1TWC B;  4C3H B;  1GO3 E;  1PRT B;  4R1J A;  4JI6 L;  1VQA A;  3LGJ A;  4IUV A;  3J81 i;  3Q24 A;  2A73 B;  2WAQ B;  4G7Z C;  4K2L A;  5I2X A;  3C2P A;  2IPK D;  4GS3 A;  1JJG A;  1U4R A;  1WTX A;  4IOA A;  2JA9 A;  1K9M C;  1H9M A;  2F0Q A;  2IW3 A;  2TMP A;  3PUY A;  4JBW A;  4B3T L;  1KQS A;  2K4K A;  4QQB X;  1OXX K;  2E5L L;  3DWA A;  1XNQ Q;  1CKO A;  5JEA G;  1LTG D;  2CHB D;  4DXF A;  3I90 A;  5GAH C;  3GTM H;  3HZX A;  4H7B A;  1II3 A;  4DV2 L;  4OGQ C;  2JA7 B;  1W2B A;  2NVX B;  4PG3 A;  4DR3 L;  1KXL A;  1GXD C;  3MA2 B;  4ZCK A;  1PH8 A;  2CCZ A;  2UXB Q;  4HJ5 A;  2VL6 A;  4KK7 A;  2WIN B;  4X3S A;  5IYB H;  1WCM B;  3HOX G;  3V96 A;  1E2V A;  3KDF A;  5CV8 A;  4MTN A;  2ICI A;  2KUM A;  1I50 B;  1EY4 A;  3SK8 A;  1PZK D;  3K7A B;  3DUZ A;  3ZJY C;  2UUA Q;  2UXC Q;  1STN A;  2H4O A;  2Z4I A;  1ICF B;  2ALY B;  3MHB A;  5AFW A;  1CSQ A;  1N9W A;  2NVX H;  3IKJ A;  2X69 A;  1D2B A;  2E2D C;  3DWP A;  4HCS A;  2VUM H;  3PO2 B;  1FGB D;  1WCM H;  5IT9 E;  4TRD A;  1HFG A;  3I4M G;  3L0O A;  1EWI A;  1JIC A;  4DNI A;  5IGF A;  4LNQ A;  1I50 H;  1UEA B;  4A3M G;  3EBE A;  3SHL A;  4DV5 L;  2ZM6 L;  1N32 Q;  2UU9 Q;  3AFQ A;  4KD4 A;  1IYU A;  2FHT A;  1SLJ A;  5IE8 A;  3MXP A;  3BJU A;  4HTH A;  2M00 A;  4IJL A;  4KLK A;  1WTQ A;  4V19 0;  2E74 C;  2FMM A;  5M5W B;  3S2D B;  5FLX c;  1A63 A;  1I3Q B;  3UDF A;  4CJ0 B;  1B2T A;  4WFN 3;  1ENC A;  3MEH A;  4BWG B;  4X62 L;  1KLG D;  3I4N G;  5CYU A;  1X56 A;  1RJT A;  2KED A;  4UP8 A;  3GTG B;  4GOP B;  2LXJ A;  4B3R L;  1I94 Q;  2DJG C;  4JYA L;  1VQG A;  2K14 A;  2NZ1 D;  3A56 A;  3P75 A;  1KAA A;  2IX1 A;  1JOR A;  5EKI A;  3J80 i;  1FD7 D;  1KDC A;  4AYB E;  1VQH A;  3MZ5 A;  4ID6 A;  4AQY L;  3CCJ A;  1IL2 A;  3KLR A;  5M5W H;  3S2D H;  5FO8 B;  2F3W A;  1UE6 A;  4RHS A;  1I3Q H;  1N34 Q;  2RCF A;  2LY7 A;  2NVY B;  2JA6 B;  4DR7 L;  2WB1 G;  5H1S E;  3HP3 A;  2ZXP A;  5C0X H;  4LFB Q;  1E2Z A;  3ND8 A;  3GTG H;  1EOV A;  3D6C A;  1IBM L;  2EYO A;  1K0S A;  1CQV A;  1L0X B;  3R93 A;  1PRT D;  3SR1 A;  1IBL Q;  4A75 A;  3I2Z A;  1U9R A;  5EPL A;  5ELB A;  2D0O A;  4XQQ A;  1HCZ A;  4DR5 L;  4DUY Q;  5T1I A;  1EIH A;  4A3J B;  2Z6B A;  3CCV A;  3A8J E;  2QGQ A;  2JP1 A;  4KHV A;  1TU2 B;  2NVY H;  2JA6 H;  2KCT A;  1LT3 D;  5C3E B;  1GUT A;  2L12 A;  3S24 A;  5I9P A;  2ID0 A;  3KDF B;  2PPB C;  4C3H G;  2RHQ B;  4GKK L;  3QG1 A;  3K5N A;  5LMU L;  4L5R C;  2WAQ G;  4HJA A;  4ZUJ A;  4N9P A;  1S5E D;  3JC6 6;  1PXU A;  1IHZ A;  1EY9 A;  4ZYS A;  4C2M B;  1Y69 U;  4A3J H;  5E4W C;  1OTC A;  1B70 B;  2RSO A;  1IKM A;  1QG7 A;  4P73 A;  1QZH A;  1HA6 A;  5IYB G;  2K05 A;  3GTJ B;  4RGN A;  3JAM E;  4EVO A;  1FYC A;  1B4O A;  5E1F A;  3UE0 A;  2G9D A;  2R7Z H;  1MBY A;  1LYL A;  1VQ8 A;  4BXX G;  3J7A 5;  2RSN A;  2JSO A;  5E4X A;  4UDU C;  1HNZ Q;  3T4A C;  2JA8 B;  1FL0 A;  5IIF A;  1YNJ C;  3U50 C;  2JA7 G;  3IFT A;  1F77 A;  2A6H C;  3JAM L;  2EYM A;  5JJI A;  3OIQ A;  2ZXO A;  1Q86 C;  2F4V L;  2MO0 A;  4XTC S;  5KIX A;  2Y0S B;  1QCB D;  4L6T B;  1WCM G;  2F0V A;  4V0B A;  1HUN A;  3DEP A;  3N6R A;  2VXW A;  3GTJ H;  1Q81 C;  4POG A;  3J7A V;  1DCZ A;  2B2V A;  3TN2 A;  1Z6H A;  2A6E D;  4CJ2 C;  1Q8K A;  5I2Y A;  2EYH A;  3AEV A;  1H9R A;  2QCP X;  3PIP A;  1I4H A;  1EWC A;  4A3K B;  4KN4 C;  5EAY A;  2ZT9 C;  3GTP H;  4DFA A;  2RKS A;  3STB C;  1PYS B;  1QIL A;  2F0N A;  2Q2I A;  4RWS C;  3UE1 A;  1Y1W B;  1XYI A;  3B6Y A;  3PUV A;  4DV6 Q;  3ULL A;  2UUB L;  3G48 A;  3SVM A;  5FOB B;  1HRJ A;  3PO2 G;  5COY A;  4MZ9 A;  4G57 A;  4KY7 A;  3N52 A;  2RVL A;  2VS1 A;  1IBK L;  1J5E L;  1JQY D;  5EBC A;  3M7G A;  3BZK A;  2MJ8 A;  5COR A;  3GQB A;  5C4H A;  1LO5 D;  1JCK B;  2LXK A;  1G2T A;  2PO4 A;  2PZU A;  4N9T A;  3NPP A;  5CMD A;  1HNX L;  4O2D A;  5M5X B;  1Y1W H;  2YTV A;  3RN5 A;  1VS0 A;  3AU7 A;  1MGS A;  4IZ8 A;  4UP7 A;  1EUJ A;  4A3D B;  1HR0 L;  2J7Z A;  5JJZ A;  2CQO A;  4LJZ C;  1JE4 A;  1VQM A;  3K0X A;  1J9O A;  2Q8I B;  4AYB B;  1A8V A;  1IW7 D;  2RQX A;  4OX9 L;  4IPC A;  1Y8O B;  2E2I H;  5KYL A;  3W5O A;  2F0S A;  5JJL A;  4FNF A;  1LM0 A;  1WFQ A;  3TBI B;  2F3I A;  3BYY B;  3UI2 A;  5AJ3 L;  5EGT A;  3CC7 A;  2DNC A;  3HS0 C;  4B08 A;  1BXT A;  5CV4 A;  4ME3 A;  4A4I A;  3GO5 A;  4R4O A;  1DM0 B;  1BO0 A;  5KYI A;  1D8L A;  1K3R A;  1SAP A;  4A3B B;  1NAP A;  4EX5 A;  1AZQ A;  4B3M Q;  4X3T A;  3IRB A;  3OMC A;  3GTK B;  4CHT B;  4RGM A;  4KN7 C;  4JK1 C;  4RG1 A;  1CZG A;  2EYL A;  1SMY C;  1DOL A;  5M3F H;  2CW0 D;  3D4W A;  1HA5 A;  4L8J A;  1S3O A;  2N78 A;  2IX3 A;  1ET6 A;  4LUO A;  1HZC A;  4NP5 A;  1Y14 B;  4X66 Q;  2F0T A;  3K0Y A;  1PFS A;  1QVC A;  2C35 B;  5A2Q L;  4A3J G;  2KHJ A;  4A3B H;  2BE5 D;  1E7Z A;  3I4O A;  2L0C A;  2BA0 A;  3Q22 A;  1KTK A;  1X3F A;  1KDA A;  3WDN A;  4XT1 B;  2B2Y C;  5C3E G;  3FPP A;  1XNQ L;  3GTK H;  1A2U A;  1M4V A;  1PHJ A;  2RDG A;  1BBX C;  1PVO A;  3U9S A;  4JI1 Q;  1RTN A;  4DAV A;  3HOW G;  2C5C A;  1D5X C;  4GKJ Q;  3CCE A;  1PFM A;  1BCP D;  2K33 A;  4DR1 Q;  2UXB L;  2F0L A;  1CQF A;  3CC4 A;  1B9N A;  3FP9 A;  2F0D A;  1FNV A;  5FK9 C;  1SYC A;  3HOZ H;  2K5W A;  1ZYR D;  3PUW A;  3FKI B;  3KLW A;  1GM5 A;  1WOC A;  2EYP A;  1LTS D;  4C3J B;  1XNR Q;  3VDY A;  3VYT A;  3H3V C;  1B3Q A;  4IJH A;  4X64 Q;  2F0J A;  2UUA L;  2UXC L;  1STE A;  3NBH A;  5JAV A;  4CKC A;  5EKL A;  5ELD A;  4UHV A;  2JA8 G;  4MNO A;  3SEB A;  4MTK A;  3D0F A;  4DA2 A;  4NKL A;  3CF5 A;  4ZK9 B;  1NR4 A;  2E75 C;  3G71 A;  1A62 A;  1TY0 A;  3PCO B;  2YYZ A;  4RCN A;  1GUO A;  2M2L A;  3RUZ A;  1EIY B;  3UDI A;  1EIG A;  2XVS A;  2SNS A;  4C3J H;  3MC0 B;  3R3O A;  5T1G A;  4LF6 Q;  3BS1 A;  4DR4 Q;  1N32 L;  3M4Q A;  5CR3 A;  2UU9 L;  2EY6 A;  3S2H B;  1D5Z C;  1YHB A;  5IWA L;  1U4M A;  5ISR A;  2F0E A;  4A3K G;  2VQF Q;  3WOF A;  1X3E A;  1SE3 A;  2JYO A;  1E0B A;  1KC8 C;  1Z47 A;  2LFN A;  2JQO A;  1LTA D;  3OOC A;  3OWE B;  2IWH A;  1N33 Q;  1PYW D;  1NBW A;  2K7V A;  4QUF A;  1PDQ A;  4JI0 L;  3TME A;  1VQO A;  1I94 L;  3ITP A;  1V1Q A;  1TKW B;  2K1B A;  2HIV A;  3EFX D;  2MUY A;  4HAE A;  2KVM A;  2B2U A;  2KA7 A;  2L1B A;  3S2H H;  3RD4 A;  3CCU A;  3CCM A;  2GVB A;  1TQO A;  4CJ1 B;  4UP9 A;  4Q0F A;  1C4Q A;  3I55 A;  1VMP A;  1N34 L;  2Z6K C;  2OF1 A;  3J7A F;  4QF4 A;  4A3D G;  1K3B C;  4DK3 C;  3RR5 A;  1L0W A;  3S17 H;  1HNW Q;  4A3L H;  4LFB L;  4DU9 A;  5C44 G;  3RLF A;  4IQZ A;  4AYB G;  1IYV A;  1EEI D;  2MNA A;  2F03 A;  4LF9 Q;  1X9N A;  2KOL A;  1AE3 A;  2I46 A;  3QB3 A;  4QCL A;  2E2J B;  3CKI B;  1IBL L;  3S14 H;  1FNW A;  4DGZ A;  4DR2 Q;  1YBY A;  3GTO B;  1EU4 A;  1AN8 A;  4P2C B;  1PTO F;  1DOM A;  2KQ3 A;  4HIM A;  3TRZ A;  1JB3 A;  2NVQ B;  1XX8 A;  3HOY B;  4DUY L;  2QDB A;  3A54 A;  3VR6 A;  2IJ0 A;  1CKM A;  2AMC B;  1LTR D;  4DPG A;  1XPR A;  4LF4 Q;  4A3B G;  2NZO A;  3EQL C;  1XTD A;  1HR0 W;  2KEC A;  4YWL A;  2PI2 E;  4OEL B;  3LX0 A;  5ELC A;  1UNS A;  3M4Y A;  3WWV A;  2JXM B;  1SEB D;  4A93 H;  3HG9 A;  3G4S A;  4JI5 Q;  5LL6 X;  1V43 A;  3OWF A;  1AP0 A;  3NTH A;  4CGY B;  4K5W A;  3TP6 A;  3NBH B;  4A3I B;  1XJV A;  1M90 C;  3HOY H;  3J81 E;  3MFG A;  4A3E B;  3S1R B;  4U67 3;  3TSS A;  3SK6 A;  5BR8 L;  4DNT B;  1K73 C;  1G29 1;  4O42 A;  1GUW A;  1K8A C;  2PYK A;  1TXY A;  4FYD A;  1SXT A;  4F7X A;  1NMF A;  3DM1 A;  4KKS A;  2GN5 A;  5CBA E;  2I5L X;  4HJ9 A;  1HNZ L;  1HXY D;  2DN8 A;  2WV6 D;  1XMQ Q;  3E5S A;  1HJP A;  2WKC A;  1WI5 A;  5C3W A;  2YTY A;  1AFP A;  4JPB W;  3GTQ B;  3I56 A;  3KF8 A;  1B50 A;  1E1T A;  3S1R H;  1XXG A;  1EFI D;  2AWN A;  4TKO B;  3FKI G;  3T1Y Q;  1IL8 A;  3GTM B;  2EDG A;  4GN4 B;  4IUU A;  2I5H A;  4C3J G;  1VQD A;  1CA5 A;  1HTP A;  4X65 Q;  2WP8 J;  2EXD A;  4GN5 A;  1I4Q A; 
#chains in the Genus database with same CATH homology
 3GTG H;  1EOV A;  3CCS A;  2VQE Q;  2PQA B;  1E3P A;  4PZ6 A;  1S40 A;  1IBM L;  3PF4 A;  1B8A A;  3K8A A;  4PMW A;  2VY3 A;  4L5S A;  4DV6 L;  4GN3 B;  4QL5 A;  3I2Z A;  4A75 A;  1IBL Q;  3M7N A;  4LF8 Q;  4HIK A;  3RLN A;  2K75 A;  4GNX A;  3GTQ H;  2D0O A;  1BBW A;  4JI3 Q;  4OWW B;  1PV4 A;  3ULJ A;  2EQS A;  1AE2 A;  3F2D A;  4DR5 L;  2H5X A;  4DUY Q;  4YY3 L;  4BY7 H;  5DLQ E;  1EYG A;  3CCV A;  2NN6 G;  1Z9F A;  2QGQ A;  2B3G A;  2NVY H;  2JA6 H;  4GLX A;  2EIF A;  1KRS A;  2XTI A;  4P75 A;  4IFD I;  5K36 G;  2KCT A;  4KI0 A;  4NXN Q;  5M5X H;  1TWA H;  3S24 A;  1PH9 A;  2ID0 A;  1EQR A;  3KDF B;  4IO9 A;  4DV4 Q;  4A3D H;  4OWX B;  2JEB I;  4EQ5 A;  3AQQ A;  2I0Q A;  2ZJQ A;  2RHQ B;  1VQ6 A;  4GKK L;  5LMU L;  1X55 A;  3BU2 A;  3TS0 A;  2WAQ G;  2YTX A;  4HJA A;  3OW2 A;  4L5R C;  4BBS H;  3CAM A;  1RL2 A;  3JC6 6;  5C44 H;  3PIO A;  2ZM6 Q;  3RN2 A;  3PUZ A;  2XGT A;  3HOX H;  5M3F G;  2B63 H;  4BA2 I;  4K0K Q;  3OTO L;  4A3G H;  2N3S A;  2Y0S E;  3D31 A;  3H0G G;  4QY7 A;  1EIF A;  4TVA B;  4DK6 C;  4A3J H;  1OTC A;  3PO3 G;  1B70 B;  2HHH L;  1VQL A;  4P73 A;  4R4I A;  1QZH A;  5IYB G;  4DV1 Q;  3KYH C;  3Q8D A;  1HZ9 A;  2UUC Q;  4IFD J;  5FLM H;  3UE0 A;  4X62 Q;  1UE7 A;  1PYB A;  2OTL A;  2R7Z H;  1U5K A;  1LYL A;  4KHP L;  4BY1 G;  1VQ8 A;  4BXX G;  3J7A 5;  3NEL A;  4DUZ L;  4UY8 C;  4B3R Q;  3RZD H;  1BKB A;  4JYA Q;  1HNZ Q;  1FL0 A;  4BBR G;  3NEM A;  2WB1 E;  5HY6 A;  3U50 C;  1OXT A;  2JA7 G;  1Q1E A;  3NEN A;  4JG2 A;  2CKZ B;  1CUK A;  4YCW A;  4B3S Q;  4DV3 Q;  2PMZ E;  4NB3 A;  2OWO A;  3HOV H;  2R7D A;  4B3M L;  5JJI A;  3L2P A;  3I4M H;  3UDG A;  3STB D;  1Q86 C;  1P8L A;  3F1Z A;  3K80 C;  2F4V L;  4JI7 Q;  3S16 H;  2MO0 A;  2FXQ A;  4XTC S;  4AQY Q;  1PH4 A;  2ZJR A;  2R92 H;  1I5F A;  5J3B A;  1WCM G;  4R4T A;  4POG A;  3GTJ H;  1Q81 C;  4JI2 Q;  4FDB A;  4LF5 L;  2ZTE A;  1YI2 A;  3HOZ G;  3S15 H;  2ATW A;  1Q8K A;  4DR7 Q;  3AFP A;  4IOC A;  2R93 G;  3ER0 A;  1VQP A;  3AEV A;  2VZA A;  2Q2H A;  4OWT B;  3PIP A;  2R6G A;  1QUQ A;  4RMF A;  3J81 c;  4X66 L;  2E8G A;  2JEA I;  5EAY A;  1JB7 A;  4A3F G;  1N8R C;  3GTP H;  1SRU A;  3U4V A;  3STB C;  1IBM Q;  2L15 A;  1PYS B;  2Q2I A;  2A1A A;  3UE1 A;  3RNU A;  3I4N H;  3B6Y A;  3PUV A;  2HQL A;  4JI4 L;  4DV6 Q;  3ULL A;  3RZO H;  2UUB L;  1OXS C;  4P72 A;  5IP9 G;  4HJ7 A;  2UXD L;  2ZTD A;  2KEN A;  3G48 A;  5GAD C;  3ERS X;  4YHH L;  3SGI A;  5IYC H;  1VQF A;  5M3M H;  3PO2 G;  3HOU G;  4DR5 Q;  1Y1V G;  4MZ9 A;  2WAQ E;  4DAY B;  4YY3 Q;  4JI1 L;  1QVG A;  3G6E A;  2CWA A;  2JA5 G;  1ASZ A;  1P16 A;  1YZ6 A;  4JC0 A;  1SRO A;  4QGU A;  2VS1 A;  3H3V I;  4X6A H;  4GKJ L;  1IBK L;  1J5E L;  1H95 A;  3L7Z C;  3W1B A;  3BZK A;  4DR6 L;  5AJ3 Q;  2K52 A;  1DGS A;  2LXK A;  3OYY A;  4DR1 L;  5GAE C;  5C4X H;  1E24 A;  1PH7 A;  4OO1 G;  1L1O A;  3FKI H;  3KFU A;  2AHO B;  3CPF A;  3GD7 A;  2ZTC A;  4A3I G;  1HNX L;  2LSS A;  4O2D A;  2NZH A;  1LUZ A;  4A3E G;  1Y1W H;  1IYJ B;  1UEB A;  4GKK Q;  5C4J H;  1L1O C;  2YTV A;  3RN5 A;  1VS0 A;  4WJ4 A;  2A19 A;  5LMU Q;  4UP7 A;  3PUX A;  1EUJ A;  2IHE A;  2JJQ A;  1HR0 L;  1B7Y B;  2JK8 A;  3F8T A;  1VQ7 A;  1XNR L;  2CQO A;  1XMO L;  1VQN A;  1PH3 A;  1HH2 P;  3OTO Q;  1VQM A;  1UE1 A;  3K0X A;  3M4O H;  1FJG L;  4X64 L;  1A8V A;  1K83 H;  2HHH Q;  4IPC A;  2K50 A;  4OX9 L;  2E2H H;  2KBN A;  1Q7Y C;  2E2I H;  2RF4 A;  3GDE A;  5C0X I;  2HT1 A;  4LFC Q;  3W5O A;  5JJL A;  3TRE A;  1SR3 A;  2OCE A;  5ELN A;  4P71 A;  4GNX C;  4IFD G;  1LM0 A;  1WFQ A;  2MQH A;  3PGZ A;  1SE8 A;  2F3I A;  2IT1 A;  1A0I A;  3CQZ H;  5AJ3 L;  4KHP Q;  1OXV A;  3H15 A;  3KF6 A;  3CC7 A;  3HKZ G;  4DUZ Q;  4H02 A;  3S1M H;  4ME3 A;  1RIP A;  1MKH A;  4BA1 I;  4IPG A;  5LMN L;  4A4I A;  3GO5 A;  1QZG A;  4R4O A;  1QVF A;  2B29 A;  2D62 A;  1D8L A;  1K3R A;  4LF6 L;  4DR4 L;  1TWC H;  4EX5 A;  1VQ5 A;  4C3H H;  4B3M Q;  2HIX A;  3A74 A;  3PV0 A;  1PA6 A;  3CCL A;  3IRB A;  2F4V Q;  4LF7 L;  1D7Q A;  4YCV A;  3CP0 A;  5GAG C;  4NXM L;  2QEX A;  2VQF L;  2VW9 A;  4RG1 A;  1YHQ A;  1KRT A;  2OTJ A;  5C0X J;  1VCI A;  3ULP A;  5M3F H;  4LF5 Q;  4A3L G;  1YEZ A;  2PNH A;  1S3O A;  2N78 A;  4A76 A;  4LFC L;  3H0G H;  4IPH A;  4LFA L;  4OON A;  4LUO A;  1S72 A;  1N33 L;  1HZC A;  2NVT H;  4LFB Q;  1Y14 B;  4X66 Q;  2ZJP A;  4DAM A;  1PFS A;  4L5T A;  1QVC A;  2C35 B;  3BZC A;  1MIU A;  4XIG S;  4A3J G;  2KHJ A;  2MO1 A;  4A3B H;  3I4O A;  1E7Z A;  4L5Q A;  3CCR A;  4JI4 Q;  2Q2U A;  1C0A A;  2BA0 A;  3EN2 A;  4BY1 H;  3CMA A;  2UUB Q;  3TS2 A;  4BXX H;  4A3C H;  1EQQ A;  2UXD Q;  1X3F A;  4JBJ A;  3E9H A;  3M4P A;  1XNQ L;  5C3E G;  5FLM G;  4YHH Q;  5JEA J;  4BBR H;  1N36 Q;  3CC2 A;  3GTK H;  1AH9 A;  1PHJ A;  3T1H L;  4YWM A;  5IT9 c;  2JA7 H;  1PVO A;  1IZ6 A;  1Q12 A;  2D0P A;  3A5Z B;  4JI1 Q;  1K8G A;  4JBK A;  3HOW G;  1KD1 C;  2VUM G;  4A3M H;  2I5M X;  5JJK A;  4HIO A;  1TWF H;  1IBK Q;  1J5E Q;  4GKJ Q;  3CCE A;  3S1Q H;  1X6O A;  4DR6 Q;  1YJ9 A;  1JE5 A;  5IP7 G;  3M85 A;  3W1G A;  1NJI C;  1VQK A;  4DR1 Q;  1QUQ B;  4GLV B;  3CC4 A;  2UXB L;  1JT8 A;  1TWH H;  3FP9 A;  3CXC A;  2BA1 A;  1HNW L;  1MJC A;  4A93 G;  4R4C A;  3FHW A;  1HNX Q;  1MJE A;  4DV7 L;  1K0R A;  4LW1 A;  2E2J H;  3HOZ H;  3PUW A;  3KLW A;  1VQ4 A;  1GM5 A;  2R93 H;  3K7A H;  3GTO H;  4JOI A;  4LF9 L;  1WOC A;  2R92 G;  1PH1 A;  3HKS A;  3HOY G;  1NE3 A;  2CFM A;  3MEF A;  1HR0 Q;  1XNR Q;  3VDY A;  2NVQ H;  3HKZ E;  2WFW A;  4DR2 L;  5IWA Q;  1XMO Q;  1PH5 A;  2VNU D;  5IYD G;  5E7N A;  4JOI C;  3J81 j;  4IJH A;  3UDX A;  2V1C C;  4X64 Q;  4JI6 Q;  3KF8 B;  1FJG Q;  1PH6 A;  1NMG A;  1CKN A;  3KJO A;  1N36 L;  1U0L A;  1L2F A;  2UUA L;  5IP9 H;  4JBM A;  4OX9 Q;  2UXC L;  1UWV A;  5ELO A;  2JA8 G;  4MNO A;  1G6P A;  4IPD A;  3D0F A;  1VQ9 A;  3PO2 H;  1JJC B;  4C3I H;  4HJ8 A;  3J7Z C;  5FJ8 G;  2ES2 A;  1VQB A;  4LF4 L;  1L1O B;  1R9T H;  3HOU H;  1Y1V H;  3CF5 A;  3CME A;  1Q82 C;  3CCQ A;  1E1O A;  4PZ8 A;  3G71 A;  4JI0 Q;  1A62 A;  3PCO B;  4YWK A;  2AKW B;  3HFZ B;  1X3G A;  2YYZ A;  2F52 A;  1YIJ A;  5IYC G;  5LMN Q;  1YVC A;  3PSI A;  1EIY B;  3UDI A;  2RCN A;  4GOP A;  1CSP A;  4DKA C;  2MFI A;  3M3Y H;  2N49 A;  1WYD A;  4C3J H;  1XPO A;  5IY0 A;  1C7Y A;  2PI2 A;  4P74 A;  4LF6 Q;  4DR4 Q;  2CWP A;  4A3I H;  4JI5 L;  1N32 L;  1KL9 A;  1Q1B A;  3K81 C;  3M4Q A;  2UU9 L;  4A3E H;  4GOP C;  1GVP A;  1YHB A;  4GNX B;  2BH2 A;  4LF7 Q;  2IY5 B;  4DV0 L;  5C4X G;  5IWA L;  4NXM Q;  4NPS A;  4A3K G;  2VQF Q;  4PZ7 A;  1YJN A;  1GO3 E;  4R1J A;  4JI6 L;  4DR3 Q;  2A8V A;  1X3E A;  5C0X G;  3CD6 A;  1VQA A;  3LGJ A;  3J81 i;  1G51 A;  1KC8 C;  1Z47 A;  4JI8 L;  1VQE A;  4AH6 A;  4LFA Q;  2JQO A;  4GS3 A;  1JJG A;  1KAW A;  3KF6 B;  5GRO A;  1N33 Q;  2NN6 I;  1SFO H;  1NBW A;  2JA9 A;  1BBU A;  1M1K C;  4IOA A;  4Y7N H;  1K9M C;  2Q2T A;  1YNX A;  3PUY A;  1C9O A;  4JI0 L;  2ASB A;  4JBW A;  1VQO A;  1I94 L;  2PQA A;  1V1Q A;  2IHF A;  2QA4 A;  4B3T L;  2HIV A;  1KQS A;  2K4K A;  4QQB X;  1XPU A;  4GLA C;  1OXX K;  4BY7 G;  1XMQ L;  3TQY A;  2JE6 I;  2E5L L;  3S2H H;  4JCV E;  1VQJ A;  1EFW A;  3CCU A;  3F2B A;  1XNQ Q;  1CKO A;  3KOJ A;  5JEA G;  2JA6 G;  3CCM A;  2GVB A;  3A5U A;  3T1H Q;  5GAH C;  1JJ2 A;  2Z6K A;  1X65 A;  4QIW E;  3GTM H;  4O0A A;  3GTL H;  4DV2 L;  3U58 A;  3EIV A;  4UP9 A;  3T1Y L;  3U4Z A;  3I55 A;  1W2B A;  4LUV A;  4PG3 A;  4DR3 L;  1N34 L;  2Z6K C;  1KXL A;  3RLO A;  1PH8 A;  4OXP A;  2CCZ A;  4A3D G;  4HJ5 A;  2VL6 A;  2R7F A;  4DK3 C;  2UXB Q;  4JV5 L;  3RR5 A;  1L0W A;  3S1N H;  4QJF A;  3PO3 H;  3S17 H;  1HNW Q;  1HZA A;  1UE5 A;  4X65 L;  4LFB L;  4A3L H;  3PF5 A;  1FGU A;  4BBS G;  5C44 G;  2VQE L;  4DV7 Q;  3RLF A;  4KHZ A;  5M5Y H;  2IX0 A;  4TQU S;  5IYB H;  1SMX A;  4AYB G;  3HOX G;  2B63 G;  3KDF A;  2MNA A;  4LF9 Q;  4A3G G;  1X9N A;  1X54 A;  4DV5 Q;  4MTN A;  1YJW A;  1AE3 A;  3JAM c;  1IBL L;  3S14 H;  3A0J A;  4APV A;  4DR2 Q;  1YBY A;  2AWO A;  4LF8 L;  2YV5 A;  4JI3 L;  3E0E A;  4HIM A;  3TRZ A;  1W3S A;  3ZJY C;  1E22 A;  2UUA Q;  2UXC Q;  5BR8 Q;  4DUY L;  3J80 c;  2R7Z G;  4LUZ A;  4WJ3 M;  2ALY B;  1CKM A;  1CSQ A;  1N9W A;  2AMC B;  5C3E H;  2NVX H;  4DPG A;  1XPR A;  4LWC A;  4LF4 Q;  4A3B G;  2OQ0 A;  5GQO A;  4HID A;  1WJJ A;  4A3C G;  2NZO A;  2K5V A;  2KCM A;  3CW2 C;  3F2C A;  4J15 A;  4NXN L;  2RHS B;  3HOW H;  2VUM H;  1XTD A;  1HR0 W;  2GVA A;  1Q46 A;  1WCM H;  1YHA A;  3HOV G;  4YWL A;  4DV4 L;  5IP7 H;  2PI2 E;  3I4M G;  3L0O A;  3MXN B;  1EWI A;  1BVS A;  4UPA A;  4DNI A;  1VQC A;  4LNQ A;  1I50 H;  3WWV A;  1VQI A;  4A3M G;  2BH8 A;  3EBE A;  4A93 H;  3K7U C;  3G4S A;  4DV5 L;  1KIX A;  4JI5 Q;  2ZM6 L;  3DLL A;  1V43 A;  1N32 Q;  2UU9 Q;  4C2M H;  3AFQ A;  4A3F H;  1CKN B;  1SLJ A;  5IE8 A;  4DV0 Q;  4K0K L;  3NBH B;  1XJV A;  1M90 C;  3BJU A;  4KLK A;  4IJL A;  3HOY H;  4ALP A;  3E9I A;  1FVI A;  5BR8 L;  3AYH B;  2K5H A;  5IYD H;  5LMN W;  5FLX c;  3KJP A;  4DV1 L;  4JI8 Q;  1K73 C;  1OXU A;  2KHI A;  2UUC L;  3UDF A;  1A63 A;  1G29 1;  5HGQ A;  1NY4 A;  4X62 L;  3ICE A;  3I4N G;  1K8A C;  3I7F A;  1TXY A;  3JAM i;  2JA8 H;  1X56 A;  1LTL A;  1NMF A;  3H3V H;  4Y52 H;  4UP8 A;  3TEH B;  2JA5 H;  2GN5 A;  2LXJ A;  4GOP B;  2I5L X;  2K5N A;  1I94 Q;  1NTG A;  5FJ8 H;  4HJ9 A;  4B3R L;  4JYA L;  1HNZ L;  1VQG A;  4B3T Q;  2K14 A;  2IX1 A;  5M3M G;  2Y0S G;  1HZB A;  1J6Q A;  1GD7 A;  1GKH A;  3J80 i;  1XMQ Q;  1HJP A;  1WI5 A;  2E5L Q;  4B3S L;  4DV3 L;  2YTY A;  1PH2 A;  1T9H A;  2DUD A;  4AYB E;  1VQH A;  2YU9 H;  1ASY A;  1YIT A;  3I56 A;  4JI7 L;  1E1T A;  4AQY L;  1IXR A;  3DM3 A;  3M9B A;  3CPW A;  3S1R H;  3CCJ A;  1IL2 A;  1SN8 A;  4R4Q A;  5M5W H;  3S2D H;  2AWN A;  2DGY A;  4DV2 Q;  1V9P A;  3FKI G;  3T1Y Q;  1UE6 A;  4JI2 L;  1TWG H;  2N8N A;  4YCU A;  1I3Q H;  1KHI A;  1N34 Q;  1I6H H;  2Z0S A;  4AIM A;  1JMC A;  2OQK A;  4GN4 B;  1Y1W G;  4A3K H;  2I5H A;  4DR7 L;  4JV5 Q;  1O7I A;  2WB1 G;  1VQD A;  5H1S E;  4OO1 I;  4POF A;  4X65 Q;  2WP8 J;  2EXD A;  4GN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...