4JI8Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji8Q00
3UE1A 3KJOA 2ZTEA 1DGSA 3GTQH 4DV4Q 2E8GA 1VQ9A 1J5EQ 3CCRA 3CMEA 3VDYA 1E1OA 1EFWA 4B3TL 5HY6A 4HJ9A 1QVCA 1RL2A 3CP0A 1N34Q 4C3HH 1XNRQ 2KCMA 3AQQA 2VL6A 1SE8A 4TVAB 4QGUA 1Z47A 2YU9H 4B3TQ 4BBRG 2OTLA 2JA7G 3RN2A 3KDFB 4JBJA 4A3JH 1N8RC 3H3VI 1KRTA 3L2PA 2YV5A 4A3EH 2K4KA 1X56A 1WYDA 2PQAB 1N32L 1PYBA 5IYCG 4OO1G 4LW1A 3T1YQ 2ASBA 5C4XG 3GTOH 3CCLA 4IFDG 3HFZB 5C3EG 1N33L 2WB1G 4BY1G 3HOUH 2ZTDA 4APVA 3TS0A 3CMAA 4L5TA 3KOJA 2R7DA 1L1OC 3PUYA 1FGUA 5AJ3L 3CPWA 3L7ZC 4H02A 4JCVE 1TWHH 4GNXC 1V43A 1PH5A 3CCJA 3UDIA 5GAGC 4JBWA 3M4PA 4A3KH 1G6PA 2E2HH 4A75A 2JJQA 4B3ML 5IP9H 1U5KA 1VQDA 3KF8B 4YCVA 2I5MX 1YJNA 1FL0A 4B3MQ 1VQJA 2WB1E 2UUBL 1H95A 2OTJA 1LM0A 1PFSA 1TWGH 2I5LX 5JEAG 1C7YA 2K50A 4JI6L 2CWAA 2UUBQ 4DK6C 1NY4A 4IPDA 4UP9A 5M3MG 4JI6Q 1UEBA 3HOYG 3RN5A 3HOXH 3UDFA 1YZ6A 3G6EA 1AE3A 5JEAJ 4JI8L 4ALPA 2JA8G 1X3EA 1CKNB 1I94L 2Q2IA 4BY7G 3H0GH 5H1SE 2HQLA 3BZCA 3TRZA 3RR5A 1XPUA 1PH9A 3OTOQ 1I94Q 4YCWA 1OXTA 3A5ZB 4DPGA 1KC8C 1GO3E 4HIDA 3M7NA 1UE5A 3GDEA 3PUWA 3GTPH 3I4NG 1QUQB 1YITA 2JK8A 2PQAA 3FKIH 1XPRA 1KD1C 1LTLA 2ZJQA 4DR1Q 1KXLA 5IT9c 1WOCA 3CC7A 2OWOA 2NN6I 3CC2A 2R93G 2IY5B 3KF6A 1HH2P 3KLWA 3F2DA 1SMXA 1HNWL 3J80c 2QEXA 4A93G 1IL2A 1WCMG 1X65A 3S1MH 2MO0A 1LUZA 2NVYH 2XTIA 2AWNA 1JT8A 4BBRH 1IBKL 3TEHB 1EUJA 3PUVA 1Y1WG 1VQMA 4A3FG 2AMCB 4B3SQ 3A0JA 3LGJA 4KI0A 1VQOA 3HOUG 3HKSA 3STBC 3STBD 3G71A 4JI3Q 3RLFA 1VQ4A 2R7FA 3K0XA 5IP7G 4PZ8A 2HIXA 3RZDH 4C3JH 1P16A 2GVAA 2E2JH 4BA2I 4IPGA 4KLKA 4A4IA 2RHQB 3NEMA 1YI2A 1X55A 5GQOA 1Q86C 2ALYB 1TWCH 3EIVA 2IHFA 2CCZA 4XIGS 3HOWG 3K7UC 1TWAH 1NBWA 3G48A 2GN5A 3PO2H 4A3GG 4DR6L 1CSQA 4AYBG 3CQZH 1CUKA 2R6GA 4LF5L 5IWAL 2PMZE 2Y0SG 4DR6Q 4NPSA 4C3IH 1M1KC 3HKZG 1M90C 3EN2A 4LF5Q 3J81c 5IWAQ 1VQ7A 1I5FA 4A3IH 1W2BA 1QUQA 1KQSA 4HJ8A 1VQNA 1WJJA 5C44H 4X64L 4LFAQ 3G4SA 3RLNA 3ULJA 2B63G 3HOVH 3PV0A 1E7ZA 3PIPA 4OONA 5M3MH 3CCQA 4RG1A 2RF4A 5EAYA 5IYDG 1MKHA 3PUXA 1HR0W 4HIOA 4JBMA 1E1TA 3GO5A 5FLMG 5M3FG 2VY3A 4ME3A 1OTCA 4LUVA 2NVXH 4GS3A 4NXML 2HT1A 5GAHC 2DUDA 1B70B 2Y0SE 2UU9Q 2XGTA 4NXMQ 4DK3C 4DAMA 3HKZE 1X3FA 3CCMA 3ULPA 3U58A 2N3SA 3JAMc 1QZHA 2F4VL 4B3RQ 1GKHA 4OWWB 3PCOB 4Y52H 2NZOA 1RIPA 2JA6H 3CPFA 1O7IA 1XJVA 3ICEA 1OXSC 2AHOB 1L0WA 2VW9A 3H15A 3CCUA 4DV0L 2YTVA 4HJ7A 4JYAL 1CKMA 4JI5L 1MIUA 2R92H 1VQCA 4DV3L 3PF4A 4DUYL 4JI5Q 5JJIA 1GD7A 1OXUA 3BJUA 2WAQG 4OWXB 5M5WH 4DUYQ 2F52A 4DV3Q 4IO9A 1PH4A 1N36L 1HNXL 4LF9L 1N36Q 1G291 1GVPA 2HHHL 1N32Q 1Q1BA 4L5RC 3KF6B 4LF8L 1W3SA 3M4QA 1IBLL 1YHBA 1XPOA 4DR2L 2I0QA 1N33Q 1K83H 2E5LL 5HGQA 3DLLA 3B6YA 4IFDJ 3W5OA 1YHAA 4JI2L 4KHPL 4IPHA 1VQAA 1A8VA 4OO1I 1E22A 2EIFA 1XMOL 3W1GA 2K5NA 4JI2Q 2CFMA 5AJ3Q 3J81j 2WAQE 1KAWA 2JA5H 1HZBA 4A3MG 1XMOQ 1G51A 1PH1A 4A3DH 2D0OA 3CC4A 4UP8A 3HOWH 2MQHA 2I5HA 3S1NH 4JI1L 1D7QA 1YJ9A 1Y14B 4EX5A 3GTKH 5DLQE 4JG2A 2KENA 4QIWE 1IZ6A 4JI1Q 3PF5A 4AH6A 4DR7L 4A3LH 4OWTB 2LSSA 3HOZH 2KHJA 3GTMH 1K0RA 4C2MH 2VUMG 3PO3H 4DR7Q 3ZJYC 4A76A 4KHZA 4TQUS 4MNOA 4DV6L 1PH8A 1VQ8A 4POGA 1VQ6A 2BA1A 1ASZA 1AH9A 4LWCA 1PA6A 1E3PA 2JE6I 2MO1A 1VQLA 4JI8Q 4LFCL 1BVSA 2UXDL 1OXVA 1BBWA 5FLMH 1PH6A 2D0PA 1YNXA 4R1JA 4LUZA 2IT1A 4BA1I 3KJPA 3WWVA 4LNQA 5IYBG 2NVQH 4BBSH 4GLVB 3S1QH 2OQKA 1Y1VG 3CCVA 4BXXG 2ZJRA 2K5HA 4LFBL 2CWPA 1IBML 2IX0A 5M5XH 3L0OA 1MJCA 1S3OA 2V1CC 2C35B 3GD7A 1HJPA 1PVOA 2WP8J 4J15A 1C0AA 2QA4A 3E9HA 2NN6G 4YWLA 5M5YH 1HNWQ 1YHQA 4YCUA 2WFWA 1HZAA 1VQIA 3S16H 2JA7H 3GTJH 1GM5A 3M85A 3M4OH 4A3CG 2RCNA 4RMFA 4GLXA 4DNIA 3OW2A 3PGZA 4YY3L 5K36G 3S24A 1IBKQ 3K81C 1EIYB 4OX9L 2Q2HA 5IYCH 4IOCA 5C4XH 5GROA 4YWKA 5BR8L 4JV5L 2CQOA 3BZKA 2UUAL 4HIKA 1R9TH 5C3EH 4NXNL 4OX9Q 2JQOA 4BY1H 4JV5Q 5C0XG 2UUAQ 4NXNQ 4DV1L 2MNAA 1YIJA 4GN4B 4A3JG 1L2FA 4NB3A 4P75A 2BH8A 1I6HH 2KBNA 2E2IH 2UUCL 4UY8C 4A3EG 4K0KL 1J6QA 2N8NA 4IPCA 1Q1EA 2K75A 3AFQA 4R4CA 3U4ZA 5C0XJ 3CXCA 4DR3L 1X9NA 3S2HH 4K0KQ 1HNZL 3I4OA 1QVFA 4A3MH 4DR4L 4DR3Q 2PI2E 1EQRA 3E0EA 2VZAA 4EQ5A 1YVCA 2GVBA 1A62A 2IHEA 5IE8A 4DV2L 1S40A 1HZ9A 1V1QA 2AKWB 4X62L 4YHHL 5LMNL 2Z6KA 3K8AA 3CW2C 4JOIA 4DV2Q 2ZM6L 4Y7NH 1HR0L 2MFIA 3I7FA 1A63A 3F8TA 1PH7A 3I4MG 5LMNW 3S14H 1HR0Q 1EIFA 4X64Q 1FJGL 5GAEC 4QL5A 1VQKA 4DV7L 1KL9A 3CD6A 4GN5A 4A3KG 1U0LA 2JA8H 3HOYH 1PV4A 1VCIA 1C9OA 4PZ6A 4QJFA 1XMQL 3S15H 3RZOH 3RLOA 5IP9G 4BY7H 1I3QH 2PI2A 2YYZA 2OQ0A 4DAYB 1MJEA 1FVIA 2K52A 3S2DH 1VQFA 1WI5A 3I4NH 1YJWA 4JI0L 4PMWA 2F4VQ 4IOAA 1Q7YC 1Q8KA 1SN8A 4LF7L 1Q81C 3HOXG 3J7A5 1BKBA 2LXKA 2R93H 2VQFL 4DR5L 2VNUD 1X6OA 1A0IA 2B3GA 3AFPA 4DV0Q 4JYAQ 4A93H 4FDBA 1WCMH 3J81i 1SFOH 4WJ3M 4LF6L 4P71A 1YEZA 2PNHA 3K7AH 5JJLA 3FKIG 4UP7A 5ELOA 2VQEL 1Y1WH 1HNXQ 4LF9Q 1XNQL 2A19A 4A3FH 4O0AA 1T9HA 2Z6KC 1K9MC 2VQEQ 2B29A 4JOIC 1EWIA 2HHHQ 2YTYA 3I56A 1XNQQ 1N34L 1XNRL 4LF8Q 3F2BA 1V9PA 1IBLQ 5E7NA 3GTLH 3NBHB 4PG3A 4JI4L 4DR2Q 2E5LQ 5LMUL 3A5UA 2BA0A 5IP7H 3SGIA 4A3BG 2KCTA 4KHPQ 4JI4Q 1SLJA 2N78A 3JAMi 4IFDI 4JI7L 3D31A 5FJ8G 5LMUQ 3RNUA 4XTCS 2UXCL 3T1YL 3NELA 2A8VA 1EYGA 1JE5A 4GKJL 2DGYA 3BU2A 4JI7Q 4R4OA 4A3GH 1XTDA 3ER0A 2UXCQ 4GKJQ 2YTXA 4OXPA 5JJKA 1OXXK 3NENA 1JMCA 3KFUA 1PYSB 1VQ5A 3Q8DA 1IYJB 1KIXA 3I55A 4GOPB 4DKAC 3AEVA 3CAMA 1CSPA 2IX1A 4HJ5A 1NMFA 3FHWA 3I4MH 1VQGA 2B63H 3MEFA 4DV6Q 3PO2G 4IJHA 5IYDH 3M3YH 1YBYA 2BH2A 5M3FH 1X3GA 3A74A 1VQPA 3UE0A 5IY0A 1PH3A 4LFCQ 2UXDQ 4A3IG 1Q46A 2K5VA 5GADC 1B8AA 1D8LA 1KHIA 1AE2A 5C44G 1NMGA 2VS1A 1Q82C 1WFQA 4JBKA 3HOVG 1E24A 5FLXc 1K3RA 4QQBX 1JJ2A 1QVGA 1JJCB 1SROA 4LFBQ 3EBEA 1IBMQ 2R7ZG 3OYYA 2UXBL 2KHIA 3OTOL 4AIMA 2EXDA 2QGQA 3TREA 4X66L 4R4TA 1K8AC 3S1RH 2UXBQ 1UE7A 1VQBA 3DM3A 2H5XA 3KDFA 1QZGA 4X66Q 3S17H 4MTNA 4DR1L 5ELNA 4IJLA 4JC0A 2JA6G 1Q12A 1CKOA 2HIVA 4UPAA 3UDGA 4YY3Q 2A1AA 3UDXA 1JB7A 1S72A 3H3VH 3ERSX 3AYHB 5BR8Q 2R92G 1L1OB 1HZCA 3CCEA 3FP9A 4GOPA 2RHSB 1Z9FA 2CKZB 1N9WA 3CCSA 2N49A 4L5QA 3GTGH 4GNXB 3J7ZC 5C4JH 1X54A 4DV1Q 3TQYA 2NZHA 4A3BH 1TXYA 1P8LA 3T1HL 2F3IA 4X6AH 3PUZA 4HJAA 2EQSA 2UUCQ 4B3SL 3F1ZA 5FJ8H 4AQYL 2JEAI 3T1HQ 5J3BA 5C0XI 1K8GA 4P74A 4JI3L 1HNZQ 2NVTH 4AQYQ 3TS2A 1JJGA 3IRBA 1J5EL 1NJIC 2FXQA 3J80i 2OCEA 1B7YB 2D62A 2ZTCA 3CF5A 4R4QA 5LMNQ 4YHHQ 1VQHA 4X62Q 4HIMA 4GKKL 1VQEA 2LXJA 2ZJPA 3JC66 2ZM6Q 2K14A 3E9IA 2VUMH 4X65L 4GKKQ 2JA5G 4WJ4A 2ID0A 4A3DG 4DV5L 2JEBI 1FJGQ 1SRUA 4POFA 4X65Q 1CKNA 3PIOA 4DV7Q 1K73C 3U4VA 4DV5Q 4GLAC 4GN3B 1I50H 1XMQQ 3PSIA 4L5SA 4LF4L 3I2ZA 1EQQA 4A3LG 2Z0SA 5IYBH 3KYHC 3ULLA 4LF4Q 3HOZG 4LFAL 1VS0A 1Y1VH 1NTGA 4YWMA 3PO3G 4BXXH 1UE6A 4P73A 1TWFH 4DR4Q 4JI0Q 2AWOA 1LYLA 4GOPC 4LF7Q 2L15A 2Q2UA 1EOVA 4LUOA 1KRSA 3D0FA 1L1OA 3H0GG 3M9BA 4QY7A 4DUZL 2ATWA 3W1BA 2R7ZH 2Q2TA 2UU9L 2VQFQ 4DR5Q 4GNXA 4BBSG 1IXRA 2JA9A 4P72A 4AYBE 4DUZQ 1UE1A 3K80C 4MZ9A 2ES2A 1NE3A 4O2DA 4PZ7A 1PH2A 4B3RL 1SR3A 4R4IA 1UWVA 1ASYA 1BBUA 3F2CA 1PHJA 4DV4L 4A3CH 4LF6Q 3MXNB 3U50C
chains in the Genus database with same CATH superfamily
3OW7A 1K0SA 3MVVA 2FFKB 1VQ9A 1Z7TA 2JA7B 3GV6A 1PXUA 2X6LA 2KQ3A 5HY6A 1QVCA 2RVLA 2JP1A 3CP0A 1FR3A 4C3HH 1SE8A 1Z47A 1H9RA 1C48A 4KD4A 3A8JE 4HN7A 2JA7G 5IGEA 3RN2A 1MSGA 1BCPC 2EPBA 1N8RC 1KRTA 2PNRC 1S5ED 1X3PA 5C3EB 1PZJD 4A3EH 1X56A 1HFGA 3VYTA 4OEMB 4OO1G 2ASBA 5EBCA 4IFDG 2E2IB 1K8MA 5C3EG 1I4RA 1N33L 2NB0A 2BCOA 2K5WA 1ONLA 4MIUA 3NQTA 2R7DA 2Z4HA 3TP8A 5AJ3L 5E4XA 4CJ1B 5IOCA 3C3LA 1O7ZA 3IL8A 1TS2A 3CCJA 3M4PA 1VMCA 4ALPA 1G6PA 1JOOA 4A75A 4B3ML 1C8CA 3WOEA 1ILQA 1LLRD 3SHLA 1CZWA 4B3MQ 1VQJA 1H95A 1D5XC 1GUGA 1LM0A 1ZEQX 2C5CA 3SVMA 4LMQD 3LWEA 3HOXH 3UDFA 3TDQA 3I4NB 2K5DA 2Q2IA 2QCPX 2HQLA 4X3KA 3TRZA 1PRTD 4DPGA 4HIDA 2NYZD 3I4NG 5M9OA 2JK8A 2JSOA 2PQAA 3I4LA 1CA5A 1BNZA 5E4WC 3MHBA 2LFNA 2NN6I 1SFOB 2IY5B 2MUYA 3KLWA 3F2DA 1Y1WB 4A3FB 2EJFC 1STGA 2PMZB 5C5LA 2MO0A 2NVYH 1JT8A 1Y1WG 2EE1A 4DXFA 4A3FG 2OT2A 4OO1H 3STBC 2L1BA 3RLFA 3DXJC 3I72A 3CU7A 4AYBB 1WD0A 1A6XA 1O78A 2Y0SB 2IPKD 3NEMA 2A5HA 1X55A 5GQOA 1YI2A 1Q86C 2IHFA 2CCZA 4XIGS 2GN5A 4AYBG 1CUKA 4LF5L 5IWAL 1PTOB 1A3TA 2Y0SG 1Q3LA 3D8GA 1M90C 4LF5Q 5IWAQ 1I5FA 1QUQA 3M3YB 5IT9E 4CDFC 3K0YA 4TRDA 3G4SA 1EY5A 1E7ZA 5EPJA 3HZXA 1LTGD 4RG1A 5EAYA 5DAUA 3PUXA 5D65A 5G3LF 1WTQA 1UNSA 4GS3A 1RJTA 1B70B 4KMUC 4OWWB 1KABA 3PMFA 3A54A 1MI2A 3S1RB 2D9UA 1CZGA 3D4WA 5T1GA 3S17B 3H15A 2AHOB 5EQ0A 4CDDC 4E6IA 3T51B 1JR0D 5JJIA 1BCPD 4OWXB 3HEJA 4QUFA 1HXYD 1V1PA 2QF7A 2HHHL 2EY6A 3NBIA 4HSVA 1N32Q 1AN8A 2EDGA 3M4QA 1YHBA 4DR2L 2SNMA 3W2DA 3DLLA 3B6YA 1Y69U 1SNQA 3A7AB 3VR4A 1CFMA 1G51A 1PH1A 5I6WA 4UP8A 2MQHA 3A55A 2LY7A 2O4XA 4JI1L 1KLGD 2NWGA 1D7QA 1HQMC 4EX5A 3TP7A 5DLQE 3M7GA 2KENA 2AQ2B 2A6EC 4JI1Q 1SDFA 1CA6A 1ET9A 2LSSA 1JWUD 1WVLA 2KHJA 1K0RA 4C2MH 3PO3H 1BR9A 1VQ8A 4POGA 1ASZA 4L63B 1ENAA 2JE6I 2F0LA 2JN4A 3QR8A 1VQLA 1H9KA 4K2LA 2MHVA 3T13A 1AEXA 3NHHA 4QCLA 4LUZA 3NP8A 1PLFA 1ICWA 2B2VA 5K5PA 1B1ZA 2OQKA 1PTOD 1CK1A 1JB3A 2DNEA 4LFBL 1GHJA 1JORA 1RTOA 1LTAD 2MJ8A 3DWQA 2WP8J 4RHSA 4JPBW 1ML0D 2EOTA 3GTQB 2EYPA 3MXPA 4FO2A 1YHQA 3DUZA 1VQIA 3M4OH 3M85A 2RCNA 3SXHA 1L0YB 3PGZA 4I7AA 1IBKQ 1NR2A 2SDFA 4IOCA 4K14A 2EY5A 5GROA 1XYIA 1R9TH 2JQOA 1F9PA 2A69C 4KY5A 3ERQA 3J7YW 1J6QA 2N8NA 4FVMA 4R4CA 1G8ZD 1HNZL 1V1PB 2B2VC 1ESFA 3K58A 1E2ZA 4H0LC 5LMNL 4YHHL 1EFID 2Z6KA 3CW2C 3T56B 1HR0L 3I7FA 1PH7A 5LMNW 3ZYYX 1STEA 3OSOA 1HR0Q 5GAEC 3DEPA 4QL5A 4DV7L 4GN5A 3HOYH 2BDOA 1TWGB 1C9OA 4QJFA 3VA7A 3RZOH 1KTKA 1D1KA 1HUNA 2ZXRA 1AW7A 1B9NA 1I4GA 1QB5D 2F4VQ 1Q8KA 3A56A 1SN8A 5EBDA 1CQFA 2D5DA 2HDMA 4K6DA 3J7A5 1RCVD 4FXKC 1NAPA 2QKIC 2VQFL 2R61A 4EQOA 4DR5L 2VNUD 2J0TD 1X6OA 4J1MA 4JYAQ 1WCMH 3VA5A 4P71A 3K7AH 4FF1A 3NUCA 1X32A 1B50A 2DJFC 5JAVA 1HNXQ 4LF9Q 1XNQL 1T9HA 1KNAA 2Z6KC 2M00A 4A3BB 2B29A 2F0QA 4R9WA 2K28A 1XNQQ 1N34L 1V9PA 1IBLQ 1SE4A 3NBHB 2L0CA 2N88A 3NK9A 4A3BG 2F0PA 5IP7H 1LABA 5C5MA 5FK9C 2UXCL 1EYGA 1U4RA 2DGYA 3BU2A 4R4OA 2VB3X 3ER0A 2UXCQ 4KKUA 1O80A 1FNVA 3WOFA 1GUNA 1PYSB 2A6ED 1IYJB 3BG3A 1KIXA 1TWAB 3I55A 3PO2B 1GJXA 1I50B 3AEVA 2IX1A 4UAIA 2Z4IA 2AQ3B 1VQGA 2B63H 5IGFA 4A3IB 3MEFA 1SMYC 1NNXA 3PO2G 5IIFA 5EKIA 2OEOA 1X3GA 4XQQA 3HOVB 1PH3A 4LFCQ 2UXDQ 4A3IG 2K5VA 1FYCA 1B8AA 1WTWA 3E3XA 1EL0A 2QW7A 1WFQA 4QB4A 3HOVG 1JJCB 1SROA 3EBEA 5DM63 2H4OA 4XQJA 3OWEB 4AIMA 2PZWA 2QGQA 4RGTA 2KOLA 1K8AC 1RHPA 3J80L 3KK7A 3NE5B 1MGSA 5CGKA 4DAPA 4YY3Q 1A3VA 1JB7A 1S72A 5KGUA 5CV7A 5M5WB 2B2WA 3BVGA 1L1OB 2K5QA 4GOPA 3MEHA 1N9WA 2A69D 2RDFA 3G6JB 1S5FD 4DV1Q 1VMPA 4H7BA 4A3BH 1P8LA 5G3LD 3T1HL 3PUZA 1D6EC 4N8FA 4AQYL 1VF7A 3T1HQ 5J3BA 5C0XI 2JYOA 2NVTH 1JJGA 4AQYQ 1TY2A 4RCOA 4OIKA 2OCEA 4GKKL 3K5NA 2LXJA 2ZJPA 3JC66 1B2TA 4GKKQ 1PDQA 5BN4A 1S5CD 4WJ4A 1FJGQ 1SRUA 4H44C 1CKNA 4GLAC 1I50H 1FNUA 2I07B 1VF5C 5KNBA 5IYBH 3ULLA 3H0GB 3U9OA 4LFAL 1AP0A 1Y1VH 4G57A 5CV5A 2B2WC 1UE6A 3OIPA 1TWFH 5LHY1 4BBSB 2NVQB 4JI0Q 1L0XB 1OO9B 4XXEA 4GOPC 1TY0A 2HDLA 2L15A 4LUOA 3U9SA 3X3MA 2ZXOA 1JOKA 3H0GG 3K6OA 1RD9D 4QY7A 4BBSG 3TSSA 4IZ8A 1UWVA 1ASYA 4LF6Q 1J5EL 3UE1A 3AU7A 2AUJD 1J5EQ 2RQXA 1GUTA 1R4QB 1EFWA 1S4ZA 4FXDA 3AQQA 2YU9H 2Q8RE 2O5IC 3H3VI 4ILWA 1NCVA 1ZXTA 2YV5A 2WB1B 3L2PA 4BY1B 2K4KA 1DJRD 1WYDA 1PYBA 5HURA 5IYCG 2NBFA 2RBMA 5KIXA 3TZDA 2WB1G 4BY1G 4U673 3AMUA 3KOJA 1QCBD 4F7XA 3L7ZC 3O13A 4JCVE 1SMYD 3QG1A 3UDIA 5GAGC 4KY6A 4Y7NB 4A3KH 4CKCA 5IP9H 3S14B 5M3MB 3J7AF 3MXUA 1EEID 1YJNA 2UUBL 2KJXA 5CMDA 2FMCA 3FMCA 3S15B 2I5LX 5JEAG 4N9PA 2K50A 1I3QB 2UUBQ 1NY4A 4DAVA 5M3MG 3S2DB 3RN5A 3G6EA 1AE3A 2K01A 4KV6A 1X3EA 1CKNB 1CHQD 2EYHA 3H0GH 4YCWA 4B9XA 3A5ZB 3M4YA 1FD7D 1UE5A 2R93B 2XSCA 1MSHA 3CKIB 3FKIH 1KD1C 3A7LA 4DR1Q 4A93B 5L37A 1HTLD 2R93G 5DM73 3I3CA 4CJ2C 4A93G 2QEXA 3BDOA 4PMCA 2F0DA 4ZYSA 1LUZA 4O1NA 1EZ8A 1PTOF 3TEHB 2B2UA 1VQMA 2AMCB 4B3SQ 1EOTA 4HTHA 1VQOA 5CV6A 3HKSA 5KRUA 3OHXC 5IODA 3HOWB 2R7FA 4A3GB 4PMBA 2HIXA 4C3JH 3GTKB 1P16A 2GVAA 3HKZB 2ALYB 1TWCH 2K03A 2Z9HA 5CORA 5DEHA 2EZVA 3HOWG 3K7UC 4A3GG 3NPPA 3CQZH 2QEJC 5C3XA 2PMZE 3BZDB 2XWBB 3HKZG 4BWGB 4QUCA 5JJZA 3IAYA 1F9QA 2SEBD 1B3AA 1VQNA 1WJJA 2F0EA 2CW0C 2OXPA 3MC0B 3URYA 4EQPA 4ZKBB 3ULJA 2WKCA 3PV0A 5FO9B 2HD3A 5M3MH 2RA4A 3CCQA 2RF4A 3J80E 1OTCA 5A35A 4NXML 4ME3A 2PPBC 2L11A 2DN8A 2Y0SE 2UU9Q 2B2UC 4NXMQ 3V2TA 3RUZA 4DK3C 1W6JA 1JOQA 1X3FA 3CCMA 1S5BD 1QZHA 3JAMc 1O7LA 5M5YB 2JA6H 3K5LA 1HA6A 3ICEA 1L0WA 2VW9A 4UDUC 4CGYB 2WAQB 4DV0L 2YTVA 1QILA 2R92H 1VQCA 3FPPA 1Q90A 1OXUA 3BJUA 2WAQG 2F52A 4IO9A 4QIWB 2ICIA 4G7OC 5CBEE 4KTAA 3GTGB 1G291 1SBBB 1T5EA 2J7ZA 5C4JB 4L5RC 1BQQT 4IALA 1EZ6A 5KYLA 3S2HB 2EY2A 3TP6A 1YNND 1N33Q 1K83H 1NSNS 2IW3A 1YHAA 1WTXA 4IPHA 5I2XA 1A8VA 2X6GA 5C3WA 4OO1I 2CFMA 2G5DA 5AJ3Q 3KBGA 3QO2A 4A3DH 3CC4A 3HOWH 2I5HA 5AFWA 2VUMB 1IL8A 1BXTA 5JOBA 3GTKH 4JG2A 3MA2B 1IZ6A 4A3LH 3ND9A 4AH6A 4CDCC 1K3BC 4OWTB 1SE3A 3HOZH 1ET6A 2VUMG 1PZID 1G91A 4A76A 4KHZA 4MNOA 4DV6L 1AH9A 1JWMD 2BA1A 1QNUA 4XT1B 1QNKA 4XYOA 1BVSA 5I9PA 1BBWA 1PH6A 1YNXA 4R1JA 3KJPA 2IT1A 3X3NA 3WWVA 4KK7A 5KNDA 3BDCA 3MAQA 1I6VC 1PTOC 5ISRA 3CCVA 2X69A 4MN3A 2K5HA 1IBML 1DONA 1MJCA 1HA5A 4DU9A 1S3OA 2V1CC 3GD7A 1SNMA 1PVOA 4J15A 2ICEC 2E76C 2O2LD 1C0AA 1EY9A 2NN6G 3EA6A 5M5YH 1B3QA 4YCUA 2WFWA 1A2UA 3BYYB 2JA7H 3GTLB 4GLXA 3OW2A 3IFTA 1A2TA 5K36G 1UEAB 3Q0AA 2Q2HA 3H6MA 4A3JB 4YWKA 5BR8L 4G7HC 1JCKB 4IFDH 2MP1A 5C3EH 4NXNL 2PQEA 2H1EA 1U9RA 4NXNQ 3P20A 3GTOB 2MNAA 2EYLA 2ZXPA 1L2FA 5IGGA 4A3JG 2KBNA 2E2IH 1Q1EA 2K75A 5C0XJ 3HOUB 4DNRB 4I65A 3S2HH 3I4OA 4DR4L 2PI2E 4EQ5A 4DR4Q 2IHEA 1S40A 3HOUG 2AKWB 4X62L 3K8AA 4CDEC 1STNA 1EY6A 4K2KA 5F2DA 2IWHA 2E2HB 2CW0D 2MFIA 1EQTA 4X3UA 1KL9A 4DXGA 1XMQL 3OMCA 3PIO3 2XRQD 2PI2A 5KEEA 2OQ0A 1I4QA 1MJEA 1DOKA 4XQNA 3I4NH 4IOAA 3MFYA 4LF7L 1Q81C 3JAML 2CH4W 1F9SA 5JVG3 5C6AA 2G9HD 1IKMA 2M2LA 1SFOH 5EPLA 3HP3A 2VQEL 1Y1WH 2AQ1B 3S1MB 1B53A 4EVOA 4A3FH 4O0AA 2VQEQ 2HHHQ 3I91A 4XT3B 1XNRL 3DM1A 3GTLH 3R2TA 2NZ1D 5FO7B 4DR2Q 4WORA 4ZKCB 1ZKOA 4JI7L 5FJ8G 2RSNA 3T1YL 3NELA 3Q23A 4JI7Q 1H9MA 4OXPA 3K57A 3HGBA 1FNWA 4FP5D 3CAMA 4MHEA 4KKSA 1PTOH 4CKBA 4HJ5A 2MPMA 3F2UA 2F03A 1BF4A 5NUCA 2KCCA 4IJHA 4KJNA 4PNYA 5C44B 3M3YH 4HMJA 1VQPA 3UE0A 5IY0A 3VYRA 1Q46A 4JK1C 3N52A 5C44G 2NVXB 2OF1A 4K5XA 4IQZA 5J39A 5FLXc 4QQBX 1JJ2A 5C4ZA 4LFBQ 3BDLA 2Q8IB 2KEDA 4G4KA 1SJED 1LTTD 2LMCB 2UXBL 3NBHA 2KHIA 3OTOL 2F0MA 3TMEA 4R4TA 3VR2A 3S1RH 2UXBQ 1VQBA 3DM3A 2H5XA 3KDFA 5TSSA 1QZGA 3S17H 4V190 1QG7A 4JC0A 2V4DA 2LS01 5CV9A 5KYIA 2A1AA 3DMUA 4IUTA 1K28A 3MZ5A 4A3CH 3FP9A 1Z9FA 1TR5A 2N55A 4HEDA 1ENFA 4L5QA 1PFMA 3CCSA 4GNXB 1EY4A 3LX0A 2LKVA 2NZHA 2F0HA 3NTIA 4NW2A 2IX3A 5FO8B 3F1ZA 5FJ8H 2G9DA 4DGZA 1A3UA 4P74A 3MFGA 4JI3L 5CC4A 1HNZQ 1TWHB 3IRBA 4EQNA 1NJIC 3J80i 2C9OA 4IURA 2JA5B 2D62A 2ZTCA 3BVZA 1TS5A 5LMNQ 4YHHQ 3S1NB 3R2IA 1JWSD 3OIQA 3E9IA 4X65L 2JA5G 2ID0A 3P7JA 4DV5L 2JEBI 4POFA 4X65Q 3PIOA 4DV7Q 1BUVT 4RFBA 3I90A 1ESRA 3GTMB 4DV5Q 4GN3B 2B2TA 3NQIA 2QILA 4QF4A 4ZQ3A 2Z0SA 1VS0A 1NTGA 1SNPA 2B2YA 1SNCA 1EOVA 3S1QB 3Q24A 1KRSA 1QE6A 1L1OA 3M9BA 1J9OA 4DUZL 2Z1CA 4DA2A 2VQFQ 4DR5Q 4DUZQ 1UE1A 2EXZA 3K80C 4KN4C 5M5XB 2ES2A 3WDNA 4O2DA 4PZ7A 4B3RL 4FF2A 3KLRA 1PHJA 4DV4L 2E74C 2DY7A 3KJOA 2EYJA 2ZTEA 1DGSA 4KD3A 3GTQH 2F3VA 4DV4Q 2E8GA 2KECA 3MWYW 3S16B 3GTJB 1SNOA 5EJWA 4B3TL 4HJ9A 1YNJC 1STAA 1N34Q 2KCMA 2VL6A 4J6HA 4B3TQ 5C4XB 3KDFB 5KNCA 3NWSA 3IFDA 1NR4A 2B2TC 3RZDB 4LJZC 5C4XG 1K8OA 2HCCA 1I6HB 3CCLA 3HFZB 4RWSC 4X3SA 1CM9A 2B2YC 1F2YA 3TS0A 3FRPB 4L5TA 4HCEA 3H94A 4C3IB 3CPWA 1L1OC 1SAPA 3PUYA 3T16A 4H02A 1TWHH 1V43A 1PH5A 4FF4A 3QOLA 4JBWA 2PO4A 1WTHA 4C3IG 1U5KA 1VQDA 2F0SA 3KF8B 2WB1E 2JA8B 3JAME 1PFSA 1EU4A 1TWGH 4JI6L 1G2TA 2CWAA 4BY7B 4DK6C 1T5XD 4JI6Q 2JA8G 1LO5D 1GOZA 1YZ6A 4KKTA 2A6HC 2SOBA 4OIJA 1D5ZC 2WKDA 4JI8L 3GV3A 3TBIB 1E2WA 4BY7G 4RA8A 5FLXL 2CH4A 1KC8C 3VYSA 3GDEA 1XPRA 2ZJQA 1LTLA 2F0KA 4ZK9B 5IT9c 3CC7A 1HNWL 1IYUA 1X65A 3UI2A 4XYQA 2XTIA 3G7LA 1D2BA 2K05A 3A0JA 4OL7A 1PYWD 3OMGA 4B9WA 3KBXA 3K0XA 4PZ8A 2DY8A 4C1NK 3RZDH 4BA2I 4IPGA 2CHBD 1KDCA 2RHQB 4A4IA 3EIVA 1HHVA 3J7AV 4DR6L 1TWAH 1IW7C 3G48A 3PO2H 2R6GA 4NDXA 4DR6Q 3SK4A 4C3IH 1M1KC 2BDNA 3L3OC 3J81c 1VQ7A 4A3IH 5M3FB 1IKLA 4X64L 4LFAQ 1LACA 4DK1A 3HOVH 4OONA 2O5JC 3NWTA 5IYDG 1MKHA 1NUCA 2F0FA 1E1TA 3GO5A 5M3FG 2VY3A 2HT1A 5GAHC 2EY1A 5E1FA 4DAMA 1Y8PB 3HKZE 3U58A 2N3SA 3ND8A 2L12A 3PCOB 4Y52H 3QIAA 2NZOA 1RIPA 1E0BA 5IGCA 1O7IA 1J8IA 2FINB 1XJVA 1OXSC 1EIGA 1CKMA 1RODA 1YNJD 2QDLA 3BYTB 4IUQA 4DK0A 4R8NA 3PF4A 1C4QA 4DUYL 1F2MA 1JC7A 1N36L 5M5WH 4DUYQ 3C2PA 1N36Q 4HSPA 2B39A 1GVPA 1F2LA 1Q1BA 4IUVA 4KHVA 4LF8L 1XPOA 1YNNC 2I0QA 2E5LL 5HGQA 4ZUIA 3W5OA 1KDAA 4KHPL 1VQAA 2PCFB 4K8JA 1E22A 2EIFA 1XMOL 2WAQE 1KAWA 3SK8A 1XMOQ 2VXWA 3A8KE 4OELB 1YJ9A 3BS1A 3Q22A 4QIWE 3PF5A 4DR7L 2E2DC 1H9JA 4DR7Q 3EQLC 3ZJYC 1PH8A 2P5ZX 2F0NA 2A6HD 1E3PA 5CR3A 4BA1I 5COYA 2NVQH 4BBSH 4LNQA 4GLVB 3FDTA 1GUOA 4BXXG 2KEEA 2ZJRA 1PFNA 1DCZA 1B44D 1KDBA 1V1OA 5BN3A 5JVH3 3ONAB 3AB9A 2QDBA 3CRLC 4ODGA 2CVRA 4LK1C 1GM5A 4A3CG 1WTRA 5HGTA 1SEBD 1SSOA 4M1UB 1CHPD 4C3HB 3MXGA 5EPKA 5EKKA 4IN3A 5IYCH 4JV5L 4A3EB 3DHQA 4C3HG 4BY1H 4JV5Q 3D3RA 1EWHA 1YIJA 2NTTA 4P75A 2UUCL 4UY8C 4A3EG 4K0KL 4HAEA 4IPCA 3AFQA 1PMRA 3U4ZA 4DR3L 2F0OA 1IW7D 2KHSA 1PFBA 4K0KQ 1MD2D 4DR3Q 3E0EA 2VZAA 2GVBA 1C7YA 1A62A 4DV2L 3T53B 5IE8A 1HZ9A 1V1QA 4OGQC 4JOIA 4DV2Q 2ZM6L 4Y7NH 5BN5A 3F8TA 5JEAH 4P2CB 5FLXE 4RGOS 3S14H 1EIFA 3J81L 1VQKA 3CD6A 4K5VA 1QWYA 1PV4A 1VCIA 3S15H 1ZYRC 1HQRD 4RKLA 1LV9A 1I3QH 1TS3A 5D14A 2YYZA 4BS9A 3HOXB 1FVIA 1STYA 3S2DH 1VQFA 1I4PA 4PMWA 1Q7YC 1U4MA 3HOXG 1BKBA 2LXKA 2R93H 1LTSD 2B3GA 3AFPA 4DV0Q 3V05A 4A93H 4FDBA 2SNSA 4ID6A 4C1NI 5JJLA 4UP7A 1JQYD 5ELOA 1A15A 4FNFA 1H9SB 2A19A 1K9MC 2NVYB 4EGVA 4JOIC 2IL8A 1EWIA 3OWFA 3F2BA 4PG3A 4RKBA 4JI4L 3MTSA 1AFPA 2BA0A 3SGIA 4JI4Q 4IFDI 2N78A 3JAMi 3R8BA 4K8IA 4GKJL 2AUKA 1JE5A 1DD2A 1HTPA 5J22A 4A3GH 4GKJQ 1LT3D 5JJKA 1OXXK 3NENA 5ELEA 1VQ5A 1SYGA 3I73A 1WD1A 5LL6S 3FHWA 1GHKA 4RCNA 1DOMA 4DV6Q 2WIIB 1CQVA 3W3AA 4ME5A 1WTOA 1Y8OB 5GADC 1D8LA 1KHIA 1AE2A 3MXNA 1LTRD 5ELFA 2F0IA 1QVGA 3EVQA 4ZRZA 1IBMQ 3OYYA 1EY8A 1F2ZA 1XX8A 1BCPB 4WJWA 2EXDA 2F0VA 4X66L 2WACA 4DNTB 4X66Q 4MTNA 2FMMA 3H09A 5ELNA 4IJLA 4H13C 1DXMA 1M4VA 1Q12A 3UDGA 1SJHD 1LT5D 2A74C 5BR8Q 3NTHA 1HZCA 1AZQA 1RDPD 1SE2A 2CKZB 2TMPA 1Y8NB 2N49A 3GTGH 3V96A 5C4JH 3TQYA 2EJGC 3BVMA 4X6AH 4HJAA 1TKWB 1K8GA 4HMIA 3TS2A 2IJ0A 2KVMA 2EVBA 4HIMA 1VQHA 4X62Q 1VQEA 2RKSA 2VUMH 1MHWC 3VR6A 1PZKD 5IGBA 1ICFB 1EIHA 1ZYRD 1K73C 3U4VA 3SR1A 2M9VA 4C2MB 3PO3B 1FGBD 1XMQQ 1EYAA 4DFAA 3PSIA 4LF4L 2D2CC 3I2ZA 5EGTA 2XWJB 1EQQA 1AZPA 4LF4Q 4YWMA 5C4HA 3PO3G 1LYLA 3GTPB 4LF7Q 2Q2UA 3D6CA 3PIP3 2PZTA 3D0FA 2BE5C 3W1BA 3C46A 4GNXA 4P72A 1DM0B 1EYDA 2NN6H 1PH2A 1JE4A 2HUGA 5J1ZA 3F2CA 2EYFA 3MXNB 1O7YA 1DZ1A 5I9OA 5K36H 3NSWA 3CCRA 4M8AA 1SYFA 4BBRB 3CMEA 3VDYA 3M4OB 1E1OA 1MBYA 4F88A 3D4RA 1RL2A 1XNRQ 1SYEA 3OPOA 4TVAB 4QGUA 4J8QA 4BBRG 2OTLA 2EYOA 4V0BA 4JBJA 4A3JH 1R9TB 1EU3A 1E2VA 2PQAB 1N32L 3GQBA 4LW1A 3T1YQ 2E2JB 3GTOH 3E6ZX 1DYQA 2I46A 2FHTA 3J81E 3QB3A 1II3A 3HOUH 2ZTDA 4APVA 1TS4A 4Z9CB 3CMAA 1FGUA 2JXMB 2A73B 4GNXC 1HUMA 1STHA 3QWNA 4XDXA 2E2HH 2GA4B 3EJIA 2JJQA 4K5WA 4YCVA 2I5MX 3SEBA 1FL0A 3HOYB 3SE0A 2OTJA 3RZOB 1EWCA 1STBA 3DWAA 3GP7A 4FXGC 4IPDA 3QOJA 2L9HA 4UP9A 1UEBA 2J4XA 3VR5A 3HOYG 5JEAJ 1I94L 2K32A 5H1SE 3BZCA 3RR5A 1XPUA 1PH9A 3OTOQ 1I94Q 1OXTA 3M7NA 1GO3E 1CT1D 3PUWA 3GTPH 1QUQB 1YITA 5JPNC 1KXLA 2A68C 1WOCA 5ELDA 2OWOA 1WCMB 1TU2B 1ENCA 3CC2A 3KF6A 3K7AB 1HPCA 1HH2P 4JW0A 1SMXA 3J80c 3NTKA 4PQXA 1IL2A 1WCMG 5EKLA 3D4DA 3S1MH 4ZCKA 2AWNA 4BBRH 1IBKL 1EUJA 3PUVA 1XTCD 3LGJA 4KI0A 4N9TA 1W6KA 3KF8A 3G71A 3STBD 4JI3Q 1VQ4A 5D3DA 2R3ZA 5IP7G 4ABNA 4O42A 2E2JH 4KLKA 3KUPA 1M8AA 1NBWA 1CSQA 4MTKA 1SYDA 3TP5A 4NPSA 2B63B 3EN2A 1WTPA 5E3FA 1KQSA 1W2BA 2KUMA 4HJ8A 1WTVA 5C44H 4CJ0B 3HRZC 2BOSA 2EYMA 3RLNA 2B63G 3FEWX 3PIPA 2BE5D 2PYKA 1HR0W 4U68A 4HIOA 4JBMA 5FLMG 4FF3A 3TN2A 2NVXH 4LUVA 3C1FA 2DUDA 3HG9A 2XGTA 3ULPA 2K04A 1RKNA 2F4VL 4B3RQ 1GKHA 4ZUJA 4G7ZC 1U4PA 2F4IA 1HFNA 4RGNA 3CPFA 4F8MA 5DNFA 4TKOB 3SK6A 4Q0FA 4JYAL 3CCUA 4NP5A 4HJ7A 4JI5L 5I2YA 1MIUA 2NTSA 2ZT9C 4DV3L 4JI5Q 1RF2D 4CBVA 4L8JA 3VYUA 1GD7A 2E75C 1LTID 5I6YA 4DV3Q 1PH4A 2F1MA 4RHRA 1HNXL 1X3QA 5A2QL 4LF9L 5IGDA 2F3WA 3KLSX 3KF6B 4RAUC 1W3SA 4UHVA 3SK5A 4ZAIA 1IBLL 1IHZA 5ELCA 2K6AA 4A3MB 4IFDJ 3EROA 4JI2L 2NVTB 2F0JA 3HS0C 3Q6SA 4NMZA 5FOBB 3H91A 3W1GA 2K5NA 1B9MA 4JI2Q 3E5SA 3J81j 2JA5H 4N8X1 1HZBA 4A3MG 1XXGA 1XWEA 2D0OA 2F0GA 3I70A 2HCIA 3S1NH 1Y14B 4ZLTF 3NXWA 4DAYA 2ENBA 1HRJA 3GTMH 1SXTA 1LT6D 5FKAC 4TQUS 1VQ6A 3FPUB 5I4DA 4LWCA 1D5MC 1PA6A 1EY7A 3IKJA 2MO1A 1Y1VB 4Q5VA 4JI8Q 4LFCL 2UXDL 1TWFB 2RDHA 1OXVA 5FLMH 2D0PA 2PZUA 5IYBG 3S1QH 1Y1VG 2CQAA 2A68D 2EJMA 2CWPA 1B4OA 2IX0A 5M5XH 3L0OA 1BO0A 4YIJA 4I7ZC 4HR7B 2C35B 1HJPA 3KLSA 1QJOA 2QA4A 3E9HA 4YWLA 2XRSD 1HNWQ 5CV4A 2B8FA 1HZAA 3S16H 3GTJH 4RMFA 4DNIA 4YY3L 2RSOA 2Q8TA 3S24A 3K81C 2YU9B 1EIYB 4X3TA 4OX9L 5C4XH 3I8ZA 3C1EA 3R93A 1EEFD 2CQOA 2KA7A 3BZKA 2UUAL 4OX9Q 1EYCA 1JICA 3L9AX 2F0UA 3T4AC 5C0XG 4NKLA 2UUAQ 4DV1L 5LL6X 2L5TA 4GN4B 1I6HH 4NB3A 2BH8A 4C56C 1G6ZA 1S5DD 1PRTF 3D6WA 4WRDA 2Z6BA 3CXCA 3DEOA 4HIKA 1X9NA 4RGMA 3H3VC 2L4NA 4R8IA 1QVFA 4A3MH 2HQEA 3I4MB 1EQRA 4KY7A 1YVCA 1UAPA 2FJ2A 1F9RA 1KAAA 4A3KB 1EY0A 2RCFA 4IUPA 1A63A 3I4MG 4OHJA 1SYCA 1FJGL 4X64Q 4A3KG 1U0LA 2JA8H 4PZ6A 4FYDA 3RLOA 5IP9G 4BY7H 1F77A 2DNCA 3P75A 4DAYB 1GXDC 1ILPA 2K52A 1WI5A 1YJWA 4S3SA 4JI0L 4B08A 4DF7A 3FKIB 2MGSA 5CYUA 1A0IA 1QOHA 3J81i 1R4PB 4K6LA 4QMGA 4WJ3M 4LAAA 4LF6L 1YEZA 2PNHA 3FKIG 3P1HA 1U4LA 3A8IE 2YTYA 3ITPA 3I56A 3EFXD 4LF8Q 1Z6HA 2PW7A 3CHBD 3RD4A 5E7NA 5C0XH 2E5LQ 5LMUL 3A5UA 3OOCA 2KCTA 3S9WA 4KHPQ 1SLJA 3D31A 5LMUQ 3RNUA 4XTCS 2A8VA 2KCNA 1XTDA 4C3JB 2YTXA 1JMCA 2XNAC 5ELBA 3KFUA 1TWCB 1DOLA 2WINB 3Q8DA 1V8QA 4GOPB 1KLUD 3CQZB 4C3JG 4DKAC 1CSPA 4IUUA 1NMFA 3I4MH 1BCPF 5CV8A 1LT4D 5IYDH 1YBYA 5T1IA 2BH2A 5M3FH 3A74A 3PQIA 3R3OA 4KJOA 1TT2A 4GZYC 2R7ZB 1CTMA 1RTNA 3LNNA 1NMGA 2VS1A 4RH6A 4F87A 1Q82C 1H9SA 4JBKA 1E24A 1K3RA 1SYBA 2PW5A 2R7ZG 5IT9L 3RMHA 5A2QE 3FVQA 3TREA 2JA6B 4WFN3 1TIID 1UE7A 2Z8LA 1PRTC 3DWPA 4HCSA 3CRKC 1BOSA 1I4XA 3K5MA 4DR1L 1HCZA 2RDGA 4DN4M 2R92B 2JA6G 2B8GA 1CKOA 2HIVA 4UPAA 1LTBD 1I4HA 3UDXA 1SNDA 3H3VH 3ERSX 3AYHB 1EQVA 1UUPA 3N6RA 2R92G 4ULLA 3CCEA 2RHSB 4JVZA 1Q8IA 3J7ZC 1X54A 1TXYA 2K33A 1BBXC 2F3IA 2EQSA 2UUCQ 1K83B 4B3SL 2JEAI 2NUCA 3LWUA 1BDOA 3E0JA 2TSSA 2FXQA 1TQOA 2K7VA 1B7YB 4A3DB 3VR3A 1GUWA 3CF5A 4R4QA 4TSSA 4KN7C 3QJYA 1IYVA 2F0TA 2ZM6Q 2K14A 2DJGC 2L55A 4A3DG 4CKEA 3TZUA 1PRTB 3HOZB 4L6TB 2K1BA 1D1IA 2VB2X 1TVXA 5JPMC 4L5SA 1VDZA 4A3LG 1KNEA 3SDZA 3KYHC 5CBAE 3HOZG 4BXXH 4P73A 2XN9C 3K59A 2AWOA 5D3IB 2XIWA 2WV6D 1G2SA 1GUSA 2ATWA 4IUNA 2R7ZH 2Q2TA 2UU9L 4CHTB 3K5OA 1IXRA 2JA9A 4PV1C 4AYBE 4MZ9A 1NE3A 2XVSA 1SR3A 4R4IA 1BBUA 2F0WA 1CI3M 3U50C
chains in the Genus database with same CATH topology
3UE1A 3KJOA 2ZTEA 1DGSA 3GTQH 4DV4Q 2E8GA 1VQ9A 1J5EQ 3CCRA 3CMEA 3VDYA 1E1OA 1EFWA 4B3TL 5HY6A 4HJ9A 1QVCA 1RL2A 3CP0A 1N34Q 4C3HH 1XNRQ 2KCMA 3AQQA 2VL6A 1SE8A 4TVAB 4QGUA 1Z47A 2YU9H 4B3TQ 4BBRG 2OTLA 2JA7G 3RN2A 3KDFB 4JBJA 4A3JH 1N8RC 3H3VI 1KRTA 3L2PA 2YV5A 4A3EH 2K4KA 1X56A 1WYDA 2PQAB 1N32L 1PYBA 5IYCG 4OO1G 4LW1A 3T1YQ 2ASBA 5C4XG 3GTOH 3CCLA 4IFDG 3HFZB 5C3EG 1N33L 2WB1G 4BY1G 3HOUH 2ZTDA 4APVA 3TS0A 3CMAA 4L5TA 3KOJA 2R7DA 1L1OC 3PUYA 1FGUA 5AJ3L 3CPWA 3L7ZC 4H02A 4JCVE 1TWHH 4GNXC 1V43A 1PH5A 3CCJA 3UDIA 5GAGC 4JBWA 3M4PA 4A3KH 1G6PA 2E2HH 4A75A 2JJQA 4B3ML 5IP9H 1U5KA 1VQDA 3KF8B 4YCVA 2I5MX 1YJNA 1FL0A 4B3MQ 1VQJA 2WB1E 2UUBL 1H95A 2OTJA 1LM0A 1PFSA 1TWGH 2I5LX 5JEAG 1C7YA 2K50A 4JI6L 2CWAA 2UUBQ 4DK6C 1NY4A 4IPDA 4UP9A 5M3MG 4JI6Q 1UEBA 3HOYG 3RN5A 3HOXH 3UDFA 1YZ6A 3G6EA 1AE3A 5JEAJ 4JI8L 4ALPA 2JA8G 1X3EA 1CKNB 1I94L 2Q2IA 4BY7G 3H0GH 5H1SE 2HQLA 3BZCA 3TRZA 3RR5A 1XPUA 1PH9A 3OTOQ 1I94Q 4YCWA 1OXTA 3A5ZB 4DPGA 1KC8C 1GO3E 4HIDA 3M7NA 1UE5A 3GDEA 3PUWA 3GTPH 3I4NG 1QUQB 1YITA 2JK8A 2PQAA 3FKIH 1XPRA 1KD1C 1LTLA 2ZJQA 4DR1Q 1KXLA 5IT9c 1WOCA 3CC7A 2OWOA 2NN6I 3CC2A 2R93G 2IY5B 3KF6A 1HH2P 3KLWA 3F2DA 1SMXA 1HNWL 3J80c 2QEXA 4A93G 1IL2A 1WCMG 1X65A 3S1MH 2MO0A 1LUZA 2NVYH 2XTIA 2AWNA 1JT8A 4BBRH 1IBKL 3TEHB 1EUJA 3PUVA 1Y1WG 1VQMA 4A3FG 2AMCB 4B3SQ 3A0JA 3LGJA 4KI0A 1VQOA 3HOUG 3HKSA 3STBC 3STBD 3G71A 4JI3Q 3RLFA 1VQ4A 2R7FA 3K0XA 5IP7G 4PZ8A 2HIXA 3RZDH 4C3JH 1P16A 2GVAA 2E2JH 4BA2I 4IPGA 4KLKA 4A4IA 2RHQB 3NEMA 1YI2A 1X55A 5GQOA 1Q86C 2ALYB 1TWCH 3EIVA 2IHFA 2CCZA 4XIGS 3HOWG 3K7UC 1TWAH 1NBWA 3G48A 2GN5A 3PO2H 4A3GG 4DR6L 1CSQA 4AYBG 3CQZH 1CUKA 2R6GA 4LF5L 5IWAL 2PMZE 2Y0SG 4DR6Q 4NPSA 4C3IH 1M1KC 3HKZG 1M90C 3EN2A 4LF5Q 3J81c 5IWAQ 1VQ7A 1I5FA 4A3IH 1W2BA 1QUQA 1KQSA 4HJ8A 1VQNA 1WJJA 5C44H 4X64L 4LFAQ 3G4SA 3RLNA 3ULJA 2B63G 3HOVH 3PV0A 1E7ZA 3PIPA 4OONA 5M3MH 3CCQA 4RG1A 2RF4A 5EAYA 5IYDG 1MKHA 3PUXA 1HR0W 4HIOA 4JBMA 1E1TA 3GO5A 5FLMG 5M3FG 2VY3A 4ME3A 1OTCA 4LUVA 2NVXH 4GS3A 4NXML 2HT1A 5GAHC 2DUDA 1B70B 2Y0SE 2UU9Q 2XGTA 4NXMQ 4DK3C 4DAMA 3HKZE 1X3FA 3CCMA 3ULPA 3U58A 2N3SA 3JAMc 1QZHA 2F4VL 4B3RQ 1GKHA 4OWWB 3PCOB 4Y52H 2NZOA 1RIPA 2JA6H 3CPFA 1O7IA 1XJVA 3ICEA 1OXSC 2AHOB 1L0WA 2VW9A 3H15A 3CCUA 4DV0L 2YTVA 4HJ7A 4JYAL 1CKMA 4JI5L 1MIUA 2R92H 1VQCA 4DV3L 3PF4A 4DUYL 4JI5Q 5JJIA 1GD7A 1OXUA 3BJUA 2WAQG 4OWXB 5M5WH 4DUYQ 2F52A 4DV3Q 4IO9A 1PH4A 1N36L 1HNXL 4LF9L 1N36Q 1G291 1GVPA 2HHHL 1N32Q 1Q1BA 4L5RC 3KF6B 4LF8L 1W3SA 3M4QA 1IBLL 1YHBA 1XPOA 4DR2L 2I0QA 1N33Q 1K83H 2E5LL 5HGQA 3DLLA 3B6YA 4IFDJ 3W5OA 1YHAA 4JI2L 4KHPL 4IPHA 1VQAA 1A8VA 4OO1I 1E22A 2EIFA 1XMOL 3W1GA 2K5NA 4JI2Q 2CFMA 5AJ3Q 3J81j 2WAQE 1KAWA 2JA5H 1HZBA 4A3MG 1XMOQ 1G51A 1PH1A 4A3DH 2D0OA 3CC4A 4UP8A 3HOWH 2MQHA 2I5HA 3S1NH 4JI1L 1D7QA 1YJ9A 1Y14B 4EX5A 3GTKH 5DLQE 4JG2A 2KENA 4QIWE 1IZ6A 4JI1Q 3PF5A 4AH6A 4DR7L 4A3LH 4OWTB 2LSSA 3HOZH 2KHJA 3GTMH 1K0RA 4C2MH 2VUMG 3PO3H 4DR7Q 3ZJYC 4A76A 4KHZA 4TQUS 4MNOA 4DV6L 1PH8A 1VQ8A 4POGA 1VQ6A 2BA1A 1ASZA 1AH9A 4LWCA 1PA6A 1E3PA 2JE6I 2MO1A 1VQLA 4JI8Q 4LFCL 1BVSA 2UXDL 1OXVA 1BBWA 5FLMH 1PH6A 2D0PA 1YNXA 4R1JA 4LUZA 2IT1A 4BA1I 3KJPA 3WWVA 4LNQA 5IYBG 2NVQH 4BBSH 4GLVB 3S1QH 2OQKA 1Y1VG 3CCVA 4BXXG 2ZJRA 2K5HA 4LFBL 2CWPA 1IBML 2IX0A 5M5XH 3L0OA 1MJCA 1S3OA 2V1CC 2C35B 3GD7A 1HJPA 1PVOA 2WP8J 4J15A 1C0AA 2QA4A 3E9HA 2NN6G 4YWLA 5M5YH 1HNWQ 1YHQA 4YCUA 2WFWA 1HZAA 1VQIA 3S16H 2JA7H 3GTJH 1GM5A 3M85A 3M4OH 4A3CG 2RCNA 4RMFA 4GLXA 4DNIA 3OW2A 3PGZA 4YY3L 5K36G 3S24A 1IBKQ 3K81C 1EIYB 4OX9L 2Q2HA 5IYCH 4IOCA 5C4XH 5GROA 4YWKA 5BR8L 4JV5L 2CQOA 3BZKA 2UUAL 4HIKA 1R9TH 5C3EH 4NXNL 4OX9Q 2JQOA 4BY1H 4JV5Q 5C0XG 2UUAQ 4NXNQ 4DV1L 2MNAA 1YIJA 4GN4B 4A3JG 1L2FA 4NB3A 4P75A 2BH8A 1I6HH 2KBNA 2E2IH 2UUCL 4UY8C 4A3EG 4K0KL 1J6QA 2N8NA 4IPCA 1Q1EA 2K75A 3AFQA 4R4CA 3U4ZA 5C0XJ 3CXCA 4DR3L 1X9NA 3S2HH 4K0KQ 1HNZL 3I4OA 1QVFA 4A3MH 4DR4L 4DR3Q 2PI2E 1EQRA 3E0EA 2VZAA 4EQ5A 1YVCA 2GVBA 1A62A 2IHEA 5IE8A 4DV2L 1S40A 1HZ9A 1V1QA 2AKWB 4X62L 4YHHL 5LMNL 2Z6KA 3K8AA 3CW2C 4JOIA 4DV2Q 2ZM6L 4Y7NH 1HR0L 2MFIA 3I7FA 1A63A 3F8TA 1PH7A 3I4MG 5LMNW 3S14H 1HR0Q 1EIFA 4X64Q 1FJGL 5GAEC 4QL5A 1VQKA 4DV7L 1KL9A 3CD6A 4GN5A 4A3KG 1U0LA 2JA8H 3HOYH 1PV4A 1VCIA 1C9OA 4PZ6A 4QJFA 1XMQL 3S15H 3RZOH 3RLOA 5IP9G 4BY7H 1I3QH 2PI2A 2YYZA 2OQ0A 4DAYB 1MJEA 1FVIA 2K52A 3S2DH 1VQFA 1WI5A 3I4NH 1YJWA 4JI0L 4PMWA 2F4VQ 4IOAA 1Q7YC 1Q8KA 1SN8A 4LF7L 1Q81C 3HOXG 3J7A5 1BKBA 2LXKA 2R93H 2VQFL 4DR5L 2VNUD 1X6OA 1A0IA 2B3GA 3AFPA 4DV0Q 4JYAQ 4A93H 4FDBA 1WCMH 3J81i 1SFOH 4WJ3M 4LF6L 4P71A 1YEZA 2PNHA 3K7AH 5JJLA 3FKIG 4UP7A 5ELOA 2VQEL 1Y1WH 1HNXQ 4LF9Q 1XNQL 2A19A 4A3FH 4O0AA 1T9HA 2Z6KC 1K9MC 2VQEQ 2B29A 4JOIC 1EWIA 2HHHQ 2YTYA 3I56A 1XNQQ 1N34L 1XNRL 4LF8Q 3F2BA 1V9PA 1IBLQ 5E7NA 3GTLH 3NBHB 4PG3A 4JI4L 4DR2Q 2E5LQ 5LMUL 3A5UA 2BA0A 5IP7H 3SGIA 4A3BG 2KCTA 4KHPQ 4JI4Q 1SLJA 2N78A 3JAMi 4IFDI 4JI7L 3D31A 5FJ8G 5LMUQ 3RNUA 4XTCS 2UXCL 3T1YL 3NELA 2A8VA 1EYGA 1JE5A 4GKJL 2DGYA 3BU2A 4JI7Q 4R4OA 4A3GH 1XTDA 3ER0A 2UXCQ 4GKJQ 2YTXA 4OXPA 5JJKA 1OXXK 3NENA 1JMCA 3KFUA 1PYSB 1VQ5A 3Q8DA 1IYJB 1KIXA 3I55A 4GOPB 4DKAC 3AEVA 3CAMA 1CSPA 2IX1A 4HJ5A 1NMFA 3FHWA 3I4MH 1VQGA 2B63H 3MEFA 4DV6Q 3PO2G 4IJHA 5IYDH 3M3YH 1YBYA 2BH2A 5M3FH 1X3GA 3A74A 1VQPA 3UE0A 5IY0A 1PH3A 4LFCQ 2UXDQ 4A3IG 1Q46A 2K5VA 5GADC 1B8AA 1D8LA 1KHIA 1AE2A 5C44G 1NMGA 2VS1A 1Q82C 1WFQA 4JBKA 3HOVG 1E24A 5FLXc 1K3RA 4QQBX 1JJ2A 1QVGA 1JJCB 1SROA 4LFBQ 3EBEA 1IBMQ 2R7ZG 3OYYA 2UXBL 2KHIA 3OTOL 4AIMA 2EXDA 2QGQA 3TREA 4X66L 4R4TA 1K8AC 3S1RH 2UXBQ 1UE7A 1VQBA 3DM3A 2H5XA 3KDFA 1QZGA 4X66Q 3S17H 4MTNA 4DR1L 5ELNA 4IJLA 4JC0A 2JA6G 1Q12A 1CKOA 2HIVA 4UPAA 3UDGA 4YY3Q 2A1AA 3UDXA 1JB7A 1S72A 3H3VH 3ERSX 3AYHB 5BR8Q 2R92G 1L1OB 1HZCA 3CCEA 3FP9A 4GOPA 2RHSB 1Z9FA 2CKZB 1N9WA 3CCSA 2N49A 4L5QA 3GTGH 4GNXB 3J7ZC 5C4JH 1X54A 4DV1Q 3TQYA 2NZHA 4A3BH 1TXYA 1P8LA 3T1HL 2F3IA 4X6AH 3PUZA 4HJAA 2EQSA 2UUCQ 4B3SL 3F1ZA 5FJ8H 4AQYL 2JEAI 3T1HQ 5J3BA 5C0XI 1K8GA 4P74A 4JI3L 1HNZQ 2NVTH 4AQYQ 3TS2A 1JJGA 3IRBA 1J5EL 1NJIC 2FXQA 3J80i 2OCEA 1B7YB 2D62A 2ZTCA 3CF5A 4R4QA 5LMNQ 4YHHQ 1VQHA 4X62Q 4HIMA 4GKKL 1VQEA 2LXJA 2ZJPA 3JC66 2ZM6Q 2K14A 3E9IA 2VUMH 4X65L 4GKKQ 2JA5G 4WJ4A 2ID0A 4A3DG 4DV5L 2JEBI 1FJGQ 1SRUA 4POFA 4X65Q 1CKNA 3PIOA 4DV7Q 1K73C 3U4VA 4DV5Q 4GLAC 4GN3B 1I50H 1XMQQ 3PSIA 4L5SA 4LF4L 3I2ZA 1EQQA 4A3LG 2Z0SA 5IYBH 3KYHC 3ULLA 4LF4Q 3HOZG 4LFAL 1VS0A 1Y1VH 1NTGA 4YWMA 3PO3G 4BXXH 1UE6A 4P73A 1TWFH 4DR4Q 4JI0Q 2AWOA 1LYLA 4GOPC 4LF7Q 2L15A 2Q2UA 1EOVA 4LUOA 1KRSA 3D0FA 1L1OA 3H0GG 3M9BA 4QY7A 4DUZL 2ATWA 3W1BA 2R7ZH 2Q2TA 2UU9L 2VQFQ 4DR5Q 4GNXA 4BBSG 1IXRA 2JA9A 4P72A 4AYBE 4DUZQ 1UE1A 3K80C 4MZ9A 2ES2A 1NE3A 4O2DA 4PZ7A 1PH2A 4B3RL 1SR3A 4R4IA 1UWVA 1ASYA 1BBUA 3F2CA 1PHJA 4DV4L 4A3CH 4LF6Q 3MXNB 3U50C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UE1 A;  3KJO A;  2ZTE A;  1DGS A;  3GTQ H;  4DV4 Q;  2E8G A;  1VQ9 A;  1J5E Q;  3CCR A;  3CME A;  3VDY A;  1E1O A;  1EFW A;  4B3T L;  5HY6 A;  4HJ9 A;  1QVC A;  1RL2 A;  3CP0 A;  1N34 Q;  4C3H H;  1XNR Q;  2KCM A;  3AQQ A;  2VL6 A;  1SE8 A;  4TVA B;  4QGU A;  1Z47 A;  2YU9 H;  4B3T Q;  4BBR G;  2OTL A;  2JA7 G;  3RN2 A;  3KDF B;  4JBJ A;  4A3J H;  1N8R C;  3H3V I;  1KRT A;  3L2P A;  2YV5 A;  4A3E H;  2K4K A;  1X56 A;  1WYD A;  2PQA B;  1N32 L;  1PYB A;  5IYC G;  4OO1 G;  4LW1 A;  3T1Y Q;  2ASB A;  5C4X G;  3GTO H;  3CCL A;  4IFD G;  3HFZ B;  5C3E G;  1N33 L;  2WB1 G;  4BY1 G;  3HOU H;  2ZTD A;  4APV A;  3TS0 A;  3CMA A;  4L5T A;  3KOJ A;  2R7D A;  1L1O C;  3PUY A;  1FGU A;  5AJ3 L;  3CPW A;  3L7Z C;  4H02 A;  4JCV E;  1TWH H;  4GNX C;  1V43 A;  1PH5 A;  3CCJ A;  3UDI A;  5GAG C;  4JBW A;  3M4P A;  4A3K H;  1G6P A;  2E2H H;  4A75 A;  2JJQ A;  4B3M L;  5IP9 H;  1U5K A;  1VQD A;  3KF8 B;  4YCV A;  2I5M X;  1YJN A;  1FL0 A;  4B3M Q;  1VQJ A;  2WB1 E;  2UUB L;  1H95 A;  2OTJ A;  1LM0 A;  1PFS A;  1TWG H;  2I5L X;  5JEA G;  1C7Y A;  2K50 A;  4JI6 L;  2CWA A;  2UUB Q;  4DK6 C;  1NY4 A;  4IPD A;  4UP9 A;  5M3M G;  4JI6 Q;  1UEB A;  3HOY G;  3RN5 A;  3HOX H;  3UDF A;  1YZ6 A;  3G6E A;  1AE3 A;  5JEA J;  4JI8 L;  4ALP A;  2JA8 G;  1X3E A;  1CKN B;  1I94 L;  2Q2I A;  4BY7 G;  3H0G H;  5H1S E;  2HQL A;  3BZC A;  3TRZ A;  3RR5 A;  1XPU A;  1PH9 A;  3OTO Q;  1I94 Q;  4YCW A;  1OXT A;  3A5Z B;  4DPG A;  1KC8 C;  1GO3 E;  4HID A;  3M7N A;  1UE5 A;  3GDE A;  3PUW A;  3GTP H;  3I4N G;  1QUQ B;  1YIT A;  2JK8 A;  2PQA A;  3FKI H;  1XPR A;  1KD1 C;  1LTL A;  2ZJQ A;  4DR1 Q;  1KXL A;  5IT9 c;  1WOC A;  3CC7 A;  2OWO A;  2NN6 I;  3CC2 A;  2R93 G;  2IY5 B;  3KF6 A;  1HH2 P;  3KLW A;  3F2D A;  1SMX A;  1HNW L;  3J80 c;  2QEX A;  4A93 G;  1IL2 A;  1WCM G;  1X65 A;  3S1M H;  2MO0 A;  1LUZ A;  2NVY H;  2XTI A;  2AWN A;  1JT8 A;  4BBR H;  1IBK L;  3TEH B;  1EUJ A;  3PUV A;  1Y1W G;  1VQM A;  4A3F G;  2AMC B;  4B3S Q;  3A0J A;  3LGJ A;  4KI0 A;  1VQO A;  3HOU G;  3HKS A;  3STB C;  3STB D;  3G71 A;  4JI3 Q;  3RLF A;  1VQ4 A;  2R7F A;  3K0X A;  5IP7 G;  4PZ8 A;  2HIX A;  3RZD H;  4C3J H;  1P16 A;  2GVA A;  2E2J H;  4BA2 I;  4IPG A;  4KLK A;  4A4I A;  2RHQ B;  3NEM A;  1YI2 A;  1X55 A;  5GQO A;  1Q86 C;  2ALY B;  1TWC H;  3EIV A;  2IHF A;  2CCZ A;  4XIG S;  3HOW G;  3K7U C;  1TWA H;  1NBW A;  3G48 A;  2GN5 A;  3PO2 H;  4A3G G;  4DR6 L;  1CSQ A;  4AYB G;  3CQZ H;  1CUK A;  2R6G A;  4LF5 L;  5IWA L;  2PMZ E;  2Y0S G;  4DR6 Q;  4NPS A;  4C3I H;  1M1K C;  3HKZ G;  1M90 C;  3EN2 A;  4LF5 Q;  3J81 c;  5IWA Q;  1VQ7 A;  1I5F A;  4A3I H;  1W2B A;  1QUQ A;  1KQS A;  4HJ8 A;  1VQN A;  1WJJ A;  5C44 H;  4X64 L;  4LFA Q;  3G4S A;  3RLN A;  3ULJ A;  2B63 G;  3HOV H;  3PV0 A;  1E7Z A;  3PIP A;  4OON A;  5M3M H;  3CCQ A;  4RG1 A;  2RF4 A;  5EAY A;  5IYD G;  1MKH A;  3PUX A;  1HR0 W;  4HIO A;  4JBM A;  1E1T A;  3GO5 A;  5FLM G;  5M3F G;  2VY3 A;  4ME3 A;  1OTC A;  4LUV A;  2NVX H;  4GS3 A;  4NXM L;  2HT1 A;  5GAH C;  2DUD A;  1B70 B;  2Y0S E;  2UU9 Q;  2XGT A;  4NXM Q;  4DK3 C;  4DAM A;  3HKZ E;  1X3F A;  3CCM A;  3ULP A;  3U58 A;  2N3S A;  3JAM c;  1QZH A;  2F4V L;  4B3R Q;  1GKH A;  4OWW B;  3PCO B;  4Y52 H;  2NZO A;  1RIP A;  2JA6 H;  3CPF A;  1O7I A;  1XJV A;  3ICE A;  1OXS C;  2AHO B;  1L0W A;  2VW9 A;  3H15 A;  3CCU A;  4DV0 L;  2YTV A;  4HJ7 A;  4JYA L;  1CKM A;  4JI5 L;  1MIU A;  2R92 H;  1VQC A;  4DV3 L;  3PF4 A;  4DUY L;  4JI5 Q;  5JJI A;  1GD7 A;  1OXU A;  3BJU A;  2WAQ G;  4OWX B;  5M5W H;  4DUY Q;  2F52 A;  4DV3 Q;  4IO9 A;  1PH4 A;  1N36 L;  1HNX L;  4LF9 L;  1N36 Q;  1G29 1;  1GVP A;  2HHH L;  1N32 Q;  1Q1B A;  4L5R C;  3KF6 B;  4LF8 L;  1W3S A;  3M4Q A;  1IBL L;  1YHB A;  1XPO A;  4DR2 L;  2I0Q A;  1N33 Q;  1K83 H;  2E5L L;  5HGQ A;  3DLL A;  3B6Y A;  4IFD J;  3W5O A;  1YHA A;  4JI2 L;  4KHP L;  4IPH A;  1VQA A;  1A8V A;  4OO1 I;  1E22 A;  2EIF A;  1XMO L;  3W1G A;  2K5N A;  4JI2 Q;  2CFM A;  5AJ3 Q;  3J81 j;  2WAQ E;  1KAW A;  2JA5 H;  1HZB A;  4A3M G;  1XMO Q;  1G51 A;  1PH1 A;  4A3D H;  2D0O A;  3CC4 A;  4UP8 A;  3HOW H;  2MQH A;  2I5H A;  3S1N H;  4JI1 L;  1D7Q A;  1YJ9 A;  1Y14 B;  4EX5 A;  3GTK H;  5DLQ E;  4JG2 A;  2KEN A;  4QIW E;  1IZ6 A;  4JI1 Q;  3PF5 A;  4AH6 A;  4DR7 L;  4A3L H;  4OWT B;  2LSS A;  3HOZ H;  2KHJ A;  3GTM H;  1K0R A;  4C2M H;  2VUM G;  3PO3 H;  4DR7 Q;  3ZJY C;  4A76 A;  4KHZ A;  4TQU S;  4MNO A;  4DV6 L;  1PH8 A;  1VQ8 A;  4POG A;  1VQ6 A;  2BA1 A;  1ASZ A;  1AH9 A;  4LWC A;  1PA6 A;  1E3P A;  2JE6 I;  2MO1 A;  1VQL A;  4JI8 Q;  4LFC L;  1BVS A;  2UXD L;  1OXV A;  1BBW A;  5FLM H;  1PH6 A;  2D0P A;  1YNX A;  4R1J A;  4LUZ A;  2IT1 A;  4BA1 I;  3KJP A;  3WWV A;  4LNQ A;  5IYB G;  2NVQ H;  4BBS H;  4GLV B;  3S1Q H;  2OQK A;  1Y1V G;  3CCV A;  4BXX G;  2ZJR A;  2K5H A;  4LFB L;  2CWP A;  1IBM L;  2IX0 A;  5M5X H;  3L0O A;  1MJC A;  1S3O A;  2V1C C;  2C35 B;  3GD7 A;  1HJP A;  1PVO A;  2WP8 J;  4J15 A;  1C0A A;  2QA4 A;  3E9H A;  2NN6 G;  4YWL A;  5M5Y H;  1HNW Q;  1YHQ A;  4YCU A;  2WFW A;  1HZA A;  1VQI A;  3S16 H;  2JA7 H;  3GTJ H;  1GM5 A;  3M85 A;  3M4O H;  4A3C G;  2RCN A;  4RMF A;  4GLX A;  4DNI A;  3OW2 A;  3PGZ A;  4YY3 L;  5K36 G;  3S24 A;  1IBK Q;  3K81 C;  1EIY B;  4OX9 L;  2Q2H A;  5IYC H;  4IOC A;  5C4X H;  5GRO A;  4YWK A;  5BR8 L;  4JV5 L;  2CQO A;  3BZK A;  2UUA L;  4HIK A;  1R9T H;  5C3E H;  4NXN L;  4OX9 Q;  2JQO A;  4BY1 H;  4JV5 Q;  5C0X G;  2UUA Q;  4NXN Q;  4DV1 L;  2MNA A;  1YIJ A;  4GN4 B;  4A3J G;  1L2F A;  4NB3 A;  4P75 A;  2BH8 A;  1I6H H;  2KBN A;  2E2I H;  2UUC L;  4UY8 C;  4A3E G;  4K0K L;  1J6Q A;  2N8N A;  4IPC A;  1Q1E A;  2K75 A;  3AFQ A;  4R4C A;  3U4Z A;  5C0X J;  3CXC A;  4DR3 L;  1X9N A;  3S2H H;  4K0K Q;  1HNZ L;  3I4O A;  1QVF A;  4A3M H;  4DR4 L;  4DR3 Q;  2PI2 E;  1EQR A;  3E0E A;  2VZA A;  4EQ5 A;  1YVC A;  2GVB A;  1A62 A;  2IHE A;  5IE8 A;  4DV2 L;  1S40 A;  1HZ9 A;  1V1Q A;  2AKW B;  4X62 L;  4YHH L;  5LMN L;  2Z6K A;  3K8A A;  3CW2 C;  4JOI A;  4DV2 Q;  2ZM6 L;  4Y7N H;  1HR0 L;  2MFI A;  3I7F A;  1A63 A;  3F8T A;  1PH7 A;  3I4M G;  5LMN W;  3S14 H;  1HR0 Q;  1EIF A;  4X64 Q;  1FJG L;  5GAE C;  4QL5 A;  1VQK A;  4DV7 L;  1KL9 A;  3CD6 A;  4GN5 A;  4A3K G;  1U0L A;  2JA8 H;  3HOY H;  1PV4 A;  1VCI A;  1C9O A;  4PZ6 A;  4QJF A;  1XMQ L;  3S15 H;  3RZO H;  3RLO A;  5IP9 G;  4BY7 H;  1I3Q H;  2PI2 A;  2YYZ A;  2OQ0 A;  4DAY B;  1MJE A;  1FVI A;  2K52 A;  3S2D H;  1VQF A;  1WI5 A;  3I4N H;  1YJW A;  4JI0 L;  4PMW A;  2F4V Q;  4IOA A;  1Q7Y C;  1Q8K A;  1SN8 A;  4LF7 L;  1Q81 C;  3HOX G;  3J7A 5;  1BKB A;  2LXK A;  2R93 H;  2VQF L;  4DR5 L;  2VNU D;  1X6O A;  1A0I A;  2B3G A;  3AFP A;  4DV0 Q;  4JYA Q;  4A93 H;  4FDB A;  1WCM H;  3J81 i;  1SFO H;  4WJ3 M;  4LF6 L;  4P71 A;  1YEZ A;  2PNH A;  3K7A H;  5JJL A;  3FKI G;  4UP7 A;  5ELO A;  2VQE L;  1Y1W H;  1HNX Q;  4LF9 Q;  1XNQ L;  2A19 A;  4A3F H;  4O0A A;  1T9H A;  2Z6K C;  1K9M C;  2VQE Q;  2B29 A;  4JOI C;  1EWI A;  2HHH Q;  2YTY A;  3I56 A;  1XNQ Q;  1N34 L;  1XNR L;  4LF8 Q;  3F2B A;  1V9P A;  1IBL Q;  5E7N A;  3GTL H;  3NBH B;  4PG3 A;  4JI4 L;  4DR2 Q;  2E5L Q;  5LMU L;  3A5U A;  2BA0 A;  5IP7 H;  3SGI A;  4A3B G;  2KCT A;  4KHP Q;  4JI4 Q;  1SLJ A;  2N78 A;  3JAM i;  4IFD I;  4JI7 L;  3D31 A;  5FJ8 G;  5LMU Q;  3RNU A;  4XTC S;  2UXC L;  3T1Y L;  3NEL A;  2A8V A;  1EYG A;  1JE5 A;  4GKJ L;  2DGY A;  3BU2 A;  4JI7 Q;  4R4O A;  4A3G H;  1XTD A;  3ER0 A;  2UXC Q;  4GKJ Q;  2YTX A;  4OXP A;  5JJK A;  1OXX K;  3NEN A;  1JMC A;  3KFU A;  1PYS B;  1VQ5 A;  3Q8D A;  1IYJ B;  1KIX A;  3I55 A;  4GOP B;  4DKA C;  3AEV A;  3CAM A;  1CSP A;  2IX1 A;  4HJ5 A;  1NMF A;  3FHW A;  3I4M H;  1VQG A;  2B63 H;  3MEF A;  4DV6 Q;  3PO2 G;  4IJH A;  5IYD H;  3M3Y H;  1YBY A;  2BH2 A;  5M3F H;  1X3G A;  3A74 A;  1VQP A;  3UE0 A;  5IY0 A;  1PH3 A;  4LFC Q;  2UXD Q;  4A3I G;  1Q46 A;  2K5V A;  5GAD C;  1B8A A;  1D8L A;  1KHI A;  1AE2 A;  5C44 G;  1NMG A;  2VS1 A;  1Q82 C;  1WFQ A;  4JBK A;  3HOV G;  1E24 A;  5FLX c;  1K3R A;  4QQB X;  1JJ2 A;  1QVG A;  1JJC B;  1SRO A;  4LFB Q;  3EBE A;  1IBM Q;  2R7Z G;  3OYY A;  2UXB L;  2KHI A;  3OTO L;  4AIM A;  2EXD A;  2QGQ A;  3TRE A;  4X66 L;  4R4T A;  1K8A C;  3S1R H;  2UXB Q;  1UE7 A;  1VQB A;  3DM3 A;  2H5X A;  3KDF A;  1QZG A;  4X66 Q;  3S17 H;  4MTN A;  4DR1 L;  5ELN A;  4IJL A;  4JC0 A;  2JA6 G;  1Q12 A;  1CKO A;  2HIV A;  4UPA A;  3UDG A;  4YY3 Q;  2A1A A;  3UDX A;  1JB7 A;  1S72 A;  3H3V H;  3ERS X;  3AYH B;  5BR8 Q;  2R92 G;  1L1O B;  1HZC A;  3CCE A;  3FP9 A;  4GOP A;  2RHS B;  1Z9F A;  2CKZ B;  1N9W A;  3CCS A;  2N49 A;  4L5Q A;  3GTG H;  4GNX B;  3J7Z C;  5C4J H;  1X54 A;  4DV1 Q;  3TQY A;  2NZH A;  4A3B H;  1TXY A;  1P8L A;  3T1H L;  2F3I A;  4X6A H;  3PUZ A;  4HJA A;  2EQS A;  2UUC Q;  4B3S L;  3F1Z A;  5FJ8 H;  4AQY L;  2JEA I;  3T1H Q;  5J3B A;  5C0X I;  1K8G A;  4P74 A;  4JI3 L;  1HNZ Q;  2NVT H;  4AQY Q;  3TS2 A;  1JJG A;  3IRB A;  1J5E L;  1NJI C;  2FXQ A;  3J80 i;  2OCE A;  1B7Y B;  2D62 A;  2ZTC A;  3CF5 A;  4R4Q A;  5LMN Q;  4YHH Q;  1VQH A;  4X62 Q;  4HIM A;  4GKK L;  1VQE A;  2LXJ A;  2ZJP A;  3JC6 6;  2ZM6 Q;  2K14 A;  3E9I A;  2VUM H;  4X65 L;  4GKK Q;  2JA5 G;  4WJ4 A;  2ID0 A;  4A3D G;  4DV5 L;  2JEB I;  1FJG Q;  1SRU A;  4POF A;  4X65 Q;  1CKN A;  3PIO A;  4DV7 Q;  1K73 C;  3U4V A;  4DV5 Q;  4GLA C;  4GN3 B;  1I50 H;  1XMQ Q;  3PSI A;  4L5S A;  4LF4 L;  3I2Z A;  1EQQ A;  4A3L G;  2Z0S A;  5IYB H;  3KYH C;  3ULL A;  4LF4 Q;  3HOZ G;  4LFA L;  1VS0 A;  1Y1V H;  1NTG A;  4YWM A;  3PO3 G;  4BXX H;  1UE6 A;  4P73 A;  1TWF H;  4DR4 Q;  4JI0 Q;  2AWO A;  1LYL A;  4GOP C;  4LF7 Q;  2L15 A;  2Q2U A;  1EOV A;  4LUO A;  1KRS A;  3D0F A;  1L1O A;  3H0G G;  3M9B A;  4QY7 A;  4DUZ L;  2ATW A;  3W1B A;  2R7Z H;  2Q2T A;  2UU9 L;  2VQF Q;  4DR5 Q;  4GNX A;  4BBS G;  1IXR A;  2JA9 A;  4P72 A;  4AYB E;  4DUZ Q;  1UE1 A;  3K80 C;  4MZ9 A;  2ES2 A;  1NE3 A;  4O2D A;  4PZ7 A;  1PH2 A;  4B3R L;  1SR3 A;  4R4I A;  1UWV A;  1ASY A;  1BBU A;  3F2C A;  1PHJ A;  4DV4 L;  4A3C H;  4LF6 Q;  3MXN B;  3U50 C; 
#chains in the Genus database with same CATH topology
 3OW7 A;  1K0S A;  3MVV A;  2FFK B;  1VQ9 A;  1Z7T A;  2JA7 B;  3GV6 A;  1PXU A;  2X6L A;  2KQ3 A;  5HY6 A;  1QVC A;  2RVL A;  2JP1 A;  3CP0 A;  1FR3 A;  4C3H H;  1SE8 A;  1Z47 A;  1H9R A;  1C48 A;  4KD4 A;  3A8J E;  4HN7 A;  2JA7 G;  5IGE A;  3RN2 A;  1MSG A;  1BCP C;  2EPB A;  1N8R C;  1KRT A;  2PNR C;  1S5E D;  1X3P A;  5C3E B;  1PZJ D;  4A3E H;  1X56 A;  1HFG A;  3VYT A;  4OEM B;  4OO1 G;  2ASB A;  5EBC A;  4IFD G;  2E2I B;  1K8M A;  5C3E G;  1I4R A;  1N33 L;  2NB0 A;  2BCO A;  2K5W A;  1ONL A;  4MIU A;  3NQT A;  2R7D A;  2Z4H A;  3TP8 A;  5AJ3 L;  5E4X A;  4CJ1 B;  5IOC A;  3C3L A;  1O7Z A;  3IL8 A;  1TS2 A;  3CCJ A;  3M4P A;  1VMC A;  4ALP A;  1G6P A;  1JOO A;  4A75 A;  4B3M L;  1C8C A;  3WOE A;  1ILQ A;  1LLR D;  3SHL A;  1CZW A;  4B3M Q;  1VQJ A;  1H95 A;  1D5X C;  1GUG A;  1LM0 A;  1ZEQ X;  2C5C A;  3SVM A;  4LMQ D;  3LWE A;  3HOX H;  3UDF A;  3TDQ A;  3I4N B;  2K5D A;  2Q2I A;  2QCP X;  2HQL A;  4X3K A;  3TRZ A;  1PRT D;  4DPG A;  4HID A;  2NYZ D;  3I4N G;  5M9O A;  2JK8 A;  2JSO A;  2PQA A;  3I4L A;  1CA5 A;  1BNZ A;  5E4W C;  3MHB A;  2LFN A;  2NN6 I;  1SFO B;  2IY5 B;  2MUY A;  3KLW A;  3F2D A;  1Y1W B;  4A3F B;  2EJF C;  1STG A;  2PMZ B;  5C5L A;  2MO0 A;  2NVY H;  1JT8 A;  1Y1W G;  2EE1 A;  4DXF A;  4A3F G;  2OT2 A;  4OO1 H;  3STB C;  2L1B A;  3RLF A;  3DXJ C;  3I72 A;  3CU7 A;  4AYB B;  1WD0 A;  1A6X A;  1O78 A;  2Y0S B;  2IPK D;  3NEM A;  2A5H A;  1X55 A;  5GQO A;  1YI2 A;  1Q86 C;  2IHF A;  2CCZ A;  4XIG S;  2GN5 A;  4AYB G;  1CUK A;  4LF5 L;  5IWA L;  1PTO B;  1A3T A;  2Y0S G;  1Q3L A;  3D8G A;  1M90 C;  4LF5 Q;  5IWA Q;  1I5F A;  1QUQ A;  3M3Y B;  5IT9 E;  4CDF C;  3K0Y A;  4TRD A;  3G4S A;  1EY5 A;  1E7Z A;  5EPJ A;  3HZX A;  1LTG D;  4RG1 A;  5EAY A;  5DAU A;  3PUX A;  5D65 A;  5G3L F;  1WTQ A;  1UNS A;  4GS3 A;  1RJT A;  1B70 B;  4KMU C;  4OWW B;  1KAB A;  3PMF A;  3A54 A;  1MI2 A;  3S1R B;  2D9U A;  1CZG A;  3D4W A;  5T1G A;  3S17 B;  3H15 A;  2AHO B;  5EQ0 A;  4CDD C;  4E6I A;  3T51 B;  1JR0 D;  5JJI A;  1BCP D;  4OWX B;  3HEJ A;  4QUF A;  1HXY D;  1V1P A;  2QF7 A;  2HHH L;  2EY6 A;  3NBI A;  4HSV A;  1N32 Q;  1AN8 A;  2EDG A;  3M4Q A;  1YHB A;  4DR2 L;  2SNM A;  3W2D A;  3DLL A;  3B6Y A;  1Y69 U;  1SNQ A;  3A7A B;  3VR4 A;  1CFM A;  1G51 A;  1PH1 A;  5I6W A;  4UP8 A;  2MQH A;  3A55 A;  2LY7 A;  2O4X A;  4JI1 L;  1KLG D;  2NWG A;  1D7Q A;  1HQM C;  4EX5 A;  3TP7 A;  5DLQ E;  3M7G A;  2KEN A;  2AQ2 B;  2A6E C;  4JI1 Q;  1SDF A;  1CA6 A;  1ET9 A;  2LSS A;  1JWU D;  1WVL A;  2KHJ A;  1K0R A;  4C2M H;  3PO3 H;  1BR9 A;  1VQ8 A;  4POG A;  1ASZ A;  4L63 B;  1ENA A;  2JE6 I;  2F0L A;  2JN4 A;  3QR8 A;  1VQL A;  1H9K A;  4K2L A;  2MHV A;  3T13 A;  1AEX A;  3NHH A;  4QCL A;  4LUZ A;  3NP8 A;  1PLF A;  1ICW A;  2B2V A;  5K5P A;  1B1Z A;  2OQK A;  1PTO D;  1CK1 A;  1JB3 A;  2DNE A;  4LFB L;  1GHJ A;  1JOR A;  1RTO A;  1LTA D;  2MJ8 A;  3DWQ A;  2WP8 J;  4RHS A;  4JPB W;  1ML0 D;  2EOT A;  3GTQ B;  2EYP A;  3MXP A;  4FO2 A;  1YHQ A;  3DUZ A;  1VQI A;  3M4O H;  3M85 A;  2RCN A;  3SXH A;  1L0Y B;  3PGZ A;  4I7A A;  1IBK Q;  1NR2 A;  2SDF A;  4IOC A;  4K14 A;  2EY5 A;  5GRO A;  1XYI A;  1R9T H;  2JQO A;  1F9P A;  2A69 C;  4KY5 A;  3ERQ A;  3J7Y W;  1J6Q A;  2N8N A;  4FVM A;  4R4C A;  1G8Z D;  1HNZ L;  1V1P B;  2B2V C;  1ESF A;  3K58 A;  1E2Z A;  4H0L C;  5LMN L;  4YHH L;  1EFI D;  2Z6K A;  3CW2 C;  3T56 B;  1HR0 L;  3I7F A;  1PH7 A;  5LMN W;  3ZYY X;  1STE A;  3OSO A;  1HR0 Q;  5GAE C;  3DEP A;  4QL5 A;  4DV7 L;  4GN5 A;  3HOY H;  2BDO A;  1TWG B;  1C9O A;  4QJF A;  3VA7 A;  3RZO H;  1KTK A;  1D1K A;  1HUN A;  2ZXR A;  1AW7 A;  1B9N A;  1I4G A;  1QB5 D;  2F4V Q;  1Q8K A;  3A56 A;  1SN8 A;  5EBD A;  1CQF A;  2D5D A;  2HDM A;  4K6D A;  3J7A 5;  1RCV D;  4FXK C;  1NAP A;  2QKI C;  2VQF L;  2R61 A;  4EQO A;  4DR5 L;  2VNU D;  2J0T D;  1X6O A;  4J1M A;  4JYA Q;  1WCM H;  3VA5 A;  4P71 A;  3K7A H;  4FF1 A;  3NUC A;  1X32 A;  1B50 A;  2DJF C;  5JAV A;  1HNX Q;  4LF9 Q;  1XNQ L;  1T9H A;  1KNA A;  2Z6K C;  2M00 A;  4A3B B;  2B29 A;  2F0Q A;  4R9W A;  2K28 A;  1XNQ Q;  1N34 L;  1V9P A;  1IBL Q;  1SE4 A;  3NBH B;  2L0C A;  2N88 A;  3NK9 A;  4A3B G;  2F0P A;  5IP7 H;  1LAB A;  5C5M A;  5FK9 C;  2UXC L;  1EYG A;  1U4R A;  2DGY A;  3BU2 A;  4R4O A;  2VB3 X;  3ER0 A;  2UXC Q;  4KKU A;  1O80 A;  1FNV A;  3WOF A;  1GUN A;  1PYS B;  2A6E D;  1IYJ B;  3BG3 A;  1KIX A;  1TWA B;  3I55 A;  3PO2 B;  1GJX A;  1I50 B;  3AEV A;  2IX1 A;  4UAI A;  2Z4I A;  2AQ3 B;  1VQG A;  2B63 H;  5IGF A;  4A3I B;  3MEF A;  1SMY C;  1NNX A;  3PO2 G;  5IIF A;  5EKI A;  2OEO A;  1X3G A;  4XQQ A;  3HOV B;  1PH3 A;  4LFC Q;  2UXD Q;  4A3I G;  2K5V A;  1FYC A;  1B8A A;  1WTW A;  3E3X A;  1EL0 A;  2QW7 A;  1WFQ A;  4QB4 A;  3HOV G;  1JJC B;  1SRO A;  3EBE A;  5DM6 3;  2H4O A;  4XQJ A;  3OWE B;  4AIM A;  2PZW A;  2QGQ A;  4RGT A;  2KOL A;  1K8A C;  1RHP A;  3J80 L;  3KK7 A;  3NE5 B;  1MGS A;  5CGK A;  4DAP A;  4YY3 Q;  1A3V A;  1JB7 A;  1S72 A;  5KGU A;  5CV7 A;  5M5W B;  2B2W A;  3BVG A;  1L1O B;  2K5Q A;  4GOP A;  3MEH A;  1N9W A;  2A69 D;  2RDF A;  3G6J B;  1S5F D;  4DV1 Q;  1VMP A;  4H7B A;  4A3B H;  1P8L A;  5G3L D;  3T1H L;  3PUZ A;  1D6E C;  4N8F A;  4AQY L;  1VF7 A;  3T1H Q;  5J3B A;  5C0X I;  2JYO A;  2NVT H;  1JJG A;  4AQY Q;  1TY2 A;  4RCO A;  4OIK A;  2OCE A;  4GKK L;  3K5N A;  2LXJ A;  2ZJP A;  3JC6 6;  1B2T A;  4GKK Q;  1PDQ A;  5BN4 A;  1S5C D;  4WJ4 A;  1FJG Q;  1SRU A;  4H44 C;  1CKN A;  4GLA C;  1I50 H;  1FNU A;  2I07 B;  1VF5 C;  5KNB A;  5IYB H;  3ULL A;  3H0G B;  3U9O A;  4LFA L;  1AP0 A;  1Y1V H;  4G57 A;  5CV5 A;  2B2W C;  1UE6 A;  3OIP A;  1TWF H;  5LHY 1;  4BBS B;  2NVQ B;  4JI0 Q;  1L0X B;  1OO9 B;  4XXE A;  4GOP C;  1TY0 A;  2HDL A;  2L15 A;  4LUO A;  3U9S A;  3X3M A;  2ZXO A;  1JOK A;  3H0G G;  3K6O A;  1RD9 D;  4QY7 A;  4BBS G;  3TSS A;  4IZ8 A;  1UWV A;  1ASY A;  4LF6 Q;  1J5E L;  3UE1 A;  3AU7 A;  2AUJ D;  1J5E Q;  2RQX A;  1GUT A;  1R4Q B;  1EFW A;  1S4Z A;  4FXD A;  3AQQ A;  2YU9 H;  2Q8R E;  2O5I C;  3H3V I;  4ILW A;  1NCV A;  1ZXT A;  2YV5 A;  2WB1 B;  3L2P A;  4BY1 B;  2K4K A;  1DJR D;  1WYD A;  1PYB A;  5HUR A;  5IYC G;  2NBF A;  2RBM A;  5KIX A;  3TZD A;  2WB1 G;  4BY1 G;  4U67 3;  3AMU A;  3KOJ A;  1QCB D;  4F7X A;  3L7Z C;  3O13 A;  4JCV E;  1SMY D;  3QG1 A;  3UDI A;  5GAG C;  4KY6 A;  4Y7N B;  4A3K H;  4CKC A;  5IP9 H;  3S14 B;  5M3M B;  3J7A F;  3MXU A;  1EEI D;  1YJN A;  2UUB L;  2KJX A;  5CMD A;  2FMC A;  3FMC A;  3S15 B;  2I5L X;  5JEA G;  4N9P A;  2K50 A;  1I3Q B;  2UUB Q;  1NY4 A;  4DAV A;  5M3M G;  3S2D B;  3RN5 A;  3G6E A;  1AE3 A;  2K01 A;  4KV6 A;  1X3E A;  1CKN B;  1CHQ D;  2EYH A;  3H0G H;  4YCW A;  4B9X A;  3A5Z B;  3M4Y A;  1FD7 D;  1UE5 A;  2R93 B;  2XSC A;  1MSH A;  3CKI B;  3FKI H;  1KD1 C;  3A7L A;  4DR1 Q;  4A93 B;  5L37 A;  1HTL D;  2R93 G;  5DM7 3;  3I3C A;  4CJ2 C;  4A93 G;  2QEX A;  3BDO A;  4PMC A;  2F0D A;  4ZYS A;  1LUZ A;  4O1N A;  1EZ8 A;  1PTO F;  3TEH B;  2B2U A;  1VQM A;  2AMC B;  4B3S Q;  1EOT A;  4HTH A;  1VQO A;  5CV6 A;  3HKS A;  5KRU A;  3OHX C;  5IOD A;  3HOW B;  2R7F A;  4A3G B;  4PMB A;  2HIX A;  4C3J H;  3GTK B;  1P16 A;  2GVA A;  3HKZ B;  2ALY B;  1TWC H;  2K03 A;  2Z9H A;  5COR A;  5DEH A;  2EZV A;  3HOW G;  3K7U C;  4A3G G;  3NPP A;  3CQZ H;  2QEJ C;  5C3X A;  2PMZ E;  3BZD B;  2XWB B;  3HKZ G;  4BWG B;  4QUC A;  5JJZ A;  3IAY A;  1F9Q A;  2SEB D;  1B3A A;  1VQN A;  1WJJ A;  2F0E A;  2CW0 C;  2OXP A;  3MC0 B;  3URY A;  4EQP A;  4ZKB B;  3ULJ A;  2WKC A;  3PV0 A;  5FO9 B;  2HD3 A;  5M3M H;  2RA4 A;  3CCQ A;  2RF4 A;  3J80 E;  1OTC A;  5A35 A;  4NXM L;  4ME3 A;  2PPB C;  2L11 A;  2DN8 A;  2Y0S E;  2UU9 Q;  2B2U C;  4NXM Q;  3V2T A;  3RUZ A;  4DK3 C;  1W6J A;  1JOQ A;  1X3F A;  3CCM A;  1S5B D;  1QZH A;  3JAM c;  1O7L A;  5M5Y B;  2JA6 H;  3K5L A;  1HA6 A;  3ICE A;  1L0W A;  2VW9 A;  4UDU C;  4CGY B;  2WAQ B;  4DV0 L;  2YTV A;  1QIL A;  2R92 H;  1VQC A;  3FPP A;  1Q90 A;  1OXU A;  3BJU A;  2WAQ G;  2F52 A;  4IO9 A;  4QIW B;  2ICI A;  4G7O C;  5CBE E;  4KTA A;  3GTG B;  1G29 1;  1SBB B;  1T5E A;  2J7Z A;  5C4J B;  4L5R C;  1BQQ T;  4IAL A;  1EZ6 A;  5KYL A;  3S2H B;  2EY2 A;  3TP6 A;  1YNN D;  1N33 Q;  1K83 H;  1NSN S;  2IW3 A;  1YHA A;  1WTX A;  4IPH A;  5I2X A;  1A8V A;  2X6G A;  5C3W A;  4OO1 I;  2CFM A;  2G5D A;  5AJ3 Q;  3KBG A;  3QO2 A;  4A3D H;  3CC4 A;  3HOW H;  2I5H A;  5AFW A;  2VUM B;  1IL8 A;  1BXT A;  5JOB A;  3GTK H;  4JG2 A;  3MA2 B;  1IZ6 A;  4A3L H;  3ND9 A;  4AH6 A;  4CDC C;  1K3B C;  4OWT B;  1SE3 A;  3HOZ H;  1ET6 A;  2VUM G;  1PZI D;  1G91 A;  4A76 A;  4KHZ A;  4MNO A;  4DV6 L;  1AH9 A;  1JWM D;  2BA1 A;  1QNU A;  4XT1 B;  1QNK A;  4XYO A;  1BVS A;  5I9P A;  1BBW A;  1PH6 A;  1YNX A;  4R1J A;  3KJP A;  2IT1 A;  3X3N A;  3WWV A;  4KK7 A;  5KND A;  3BDC A;  3MAQ A;  1I6V C;  1PTO C;  5ISR A;  3CCV A;  2X69 A;  4MN3 A;  2K5H A;  1IBM L;  1DON A;  1MJC A;  1HA5 A;  4DU9 A;  1S3O A;  2V1C C;  3GD7 A;  1SNM A;  1PVO A;  4J15 A;  2ICE C;  2E76 C;  2O2L D;  1C0A A;  1EY9 A;  2NN6 G;  3EA6 A;  5M5Y H;  1B3Q A;  4YCU A;  2WFW A;  1A2U A;  3BYY B;  2JA7 H;  3GTL B;  4GLX A;  3OW2 A;  3IFT A;  1A2T A;  5K36 G;  1UEA B;  3Q0A A;  2Q2H A;  3H6M A;  4A3J B;  4YWK A;  5BR8 L;  4G7H C;  1JCK B;  4IFD H;  2MP1 A;  5C3E H;  4NXN L;  2PQE A;  2H1E A;  1U9R A;  4NXN Q;  3P20 A;  3GTO B;  2MNA A;  2EYL A;  2ZXP A;  1L2F A;  5IGG A;  4A3J G;  2KBN A;  2E2I H;  1Q1E A;  2K75 A;  5C0X J;  3HOU B;  4DNR B;  4I65 A;  3S2H H;  3I4O A;  4DR4 L;  2PI2 E;  4EQ5 A;  4DR4 Q;  2IHE A;  1S40 A;  3HOU G;  2AKW B;  4X62 L;  3K8A A;  4CDE C;  1STN A;  1EY6 A;  4K2K A;  5F2D A;  2IWH A;  2E2H B;  2CW0 D;  2MFI A;  1EQT A;  4X3U A;  1KL9 A;  4DXG A;  1XMQ L;  3OMC A;  3PIO 3;  2XRQ D;  2PI2 A;  5KEE A;  2OQ0 A;  1I4Q A;  1MJE A;  1DOK A;  4XQN A;  3I4N H;  4IOA A;  3MFY A;  4LF7 L;  1Q81 C;  3JAM L;  2CH4 W;  1F9S A;  5JVG 3;  5C6A A;  2G9H D;  1IKM A;  2M2L A;  1SFO H;  5EPL A;  3HP3 A;  2VQE L;  1Y1W H;  2AQ1 B;  3S1M B;  1B53 A;  4EVO A;  4A3F H;  4O0A A;  2VQE Q;  2HHH Q;  3I91 A;  4XT3 B;  1XNR L;  3DM1 A;  3GTL H;  3R2T A;  2NZ1 D;  5FO7 B;  4DR2 Q;  4WOR A;  4ZKC B;  1ZKO A;  4JI7 L;  5FJ8 G;  2RSN A;  3T1Y L;  3NEL A;  3Q23 A;  4JI7 Q;  1H9M A;  4OXP A;  3K57 A;  3HGB A;  1FNW A;  4FP5 D;  3CAM A;  4MHE A;  4KKS A;  1PTO H;  4CKB A;  4HJ5 A;  2MPM A;  3F2U A;  2F03 A;  1BF4 A;  5NUC A;  2KCC A;  4IJH A;  4KJN A;  4PNY A;  5C44 B;  3M3Y H;  4HMJ A;  1VQP A;  3UE0 A;  5IY0 A;  3VYR A;  1Q46 A;  4JK1 C;  3N52 A;  5C44 G;  2NVX B;  2OF1 A;  4K5X A;  4IQZ A;  5J39 A;  5FLX c;  4QQB X;  1JJ2 A;  5C4Z A;  4LFB Q;  3BDL A;  2Q8I B;  2KED A;  4G4K A;  1SJE D;  1LTT D;  2LMC B;  2UXB L;  3NBH A;  2KHI A;  3OTO L;  2F0M A;  3TME A;  4R4T A;  3VR2 A;  3S1R H;  2UXB Q;  1VQB A;  3DM3 A;  2H5X A;  3KDF A;  5TSS A;  1QZG A;  3S17 H;  4V19 0;  1QG7 A;  4JC0 A;  2V4D A;  2LS0 1;  5CV9 A;  5KYI A;  2A1A A;  3DMU A;  4IUT A;  1K28 A;  3MZ5 A;  4A3C H;  3FP9 A;  1Z9F A;  1TR5 A;  2N55 A;  4HED A;  1ENF A;  4L5Q A;  1PFM A;  3CCS A;  4GNX B;  1EY4 A;  3LX0 A;  2LKV A;  2NZH A;  2F0H A;  3NTI A;  4NW2 A;  2IX3 A;  5FO8 B;  3F1Z A;  5FJ8 H;  2G9D A;  4DGZ A;  1A3U A;  4P74 A;  3MFG A;  4JI3 L;  5CC4 A;  1HNZ Q;  1TWH B;  3IRB A;  4EQN A;  1NJI C;  3J80 i;  2C9O A;  4IUR A;  2JA5 B;  2D62 A;  2ZTC A;  3BVZ A;  1TS5 A;  5LMN Q;  4YHH Q;  3S1N B;  3R2I A;  1JWS D;  3OIQ A;  3E9I A;  4X65 L;  2JA5 G;  2ID0 A;  3P7J A;  4DV5 L;  2JEB I;  4POF A;  4X65 Q;  3PIO A;  4DV7 Q;  1BUV T;  4RFB A;  3I90 A;  1ESR A;  3GTM B;  4DV5 Q;  4GN3 B;  2B2T A;  3NQI A;  2QIL A;  4QF4 A;  4ZQ3 A;  2Z0S A;  1VS0 A;  1NTG A;  1SNP A;  2B2Y A;  1SNC A;  1EOV A;  3S1Q B;  3Q24 A;  1KRS A;  1QE6 A;  1L1O A;  3M9B A;  1J9O A;  4DUZ L;  2Z1C A;  4DA2 A;  2VQF Q;  4DR5 Q;  4DUZ Q;  1UE1 A;  2EXZ A;  3K80 C;  4KN4 C;  5M5X B;  2ES2 A;  3WDN A;  4O2D A;  4PZ7 A;  4B3R L;  4FF2 A;  3KLR A;  1PHJ A;  4DV4 L;  2E74 C;  2DY7 A;  3KJO A;  2EYJ A;  2ZTE A;  1DGS A;  4KD3 A;  3GTQ H;  2F3V A;  4DV4 Q;  2E8G A;  2KEC A;  3MWY W;  3S16 B;  3GTJ B;  1SNO A;  5EJW A;  4B3T L;  4HJ9 A;  1YNJ C;  1STA A;  1N34 Q;  2KCM A;  2VL6 A;  4J6H A;  4B3T Q;  5C4X B;  3KDF B;  5KNC A;  3NWS A;  3IFD A;  1NR4 A;  2B2T C;  3RZD B;  4LJZ C;  5C4X G;  1K8O A;  2HCC A;  1I6H B;  3CCL A;  3HFZ B;  4RWS C;  4X3S A;  1CM9 A;  2B2Y C;  1F2Y A;  3TS0 A;  3FRP B;  4L5T A;  4HCE A;  3H94 A;  4C3I B;  3CPW A;  1L1O C;  1SAP A;  3PUY A;  3T16 A;  4H02 A;  1TWH H;  1V43 A;  1PH5 A;  4FF4 A;  3QOL A;  4JBW A;  2PO4 A;  1WTH A;  4C3I G;  1U5K A;  1VQD A;  2F0S A;  3KF8 B;  2WB1 E;  2JA8 B;  3JAM E;  1PFS A;  1EU4 A;  1TWG H;  4JI6 L;  1G2T A;  2CWA A;  4BY7 B;  4DK6 C;  1T5X D;  4JI6 Q;  2JA8 G;  1LO5 D;  1GOZ A;  1YZ6 A;  4KKT A;  2A6H C;  2SOB A;  4OIJ A;  1D5Z C;  2WKD A;  4JI8 L;  3GV3 A;  3TBI B;  1E2W A;  4BY7 G;  4RA8 A;  5FLX L;  2CH4 A;  1KC8 C;  3VYS A;  3GDE A;  1XPR A;  2ZJQ A;  1LTL A;  2F0K A;  4ZK9 B;  5IT9 c;  3CC7 A;  1HNW L;  1IYU A;  1X65 A;  3UI2 A;  4XYQ A;  2XTI A;  3G7L A;  1D2B A;  2K05 A;  3A0J A;  4OL7 A;  1PYW D;  3OMG A;  4B9W A;  3KBX A;  3K0X A;  4PZ8 A;  2DY8 A;  4C1N K;  3RZD H;  4BA2 I;  4IPG A;  2CHB D;  1KDC A;  2RHQ B;  4A4I A;  3EIV A;  1HHV A;  3J7A V;  4DR6 L;  1TWA H;  1IW7 C;  3G48 A;  3PO2 H;  2R6G A;  4NDX A;  4DR6 Q;  3SK4 A;  4C3I H;  1M1K C;  2BDN A;  3L3O C;  3J81 c;  1VQ7 A;  4A3I H;  5M3F B;  1IKL A;  4X64 L;  4LFA Q;  1LAC A;  4DK1 A;  3HOV H;  4OON A;  2O5J C;  3NWT A;  5IYD G;  1MKH A;  1NUC A;  2F0F A;  1E1T A;  3GO5 A;  5M3F G;  2VY3 A;  2HT1 A;  5GAH C;  2EY1 A;  5E1F A;  4DAM A;  1Y8P B;  3HKZ E;  3U58 A;  2N3S A;  3ND8 A;  2L12 A;  3PCO B;  4Y52 H;  3QIA A;  2NZO A;  1RIP A;  1E0B A;  5IGC A;  1O7I A;  1J8I A;  2FIN B;  1XJV A;  1OXS C;  1EIG A;  1CKM A;  1ROD A;  1YNJ D;  2QDL A;  3BYT B;  4IUQ A;  4DK0 A;  4R8N A;  3PF4 A;  1C4Q A;  4DUY L;  1F2M A;  1JC7 A;  1N36 L;  5M5W H;  4DUY Q;  3C2P A;  1N36 Q;  4HSP A;  2B39 A;  1GVP A;  1F2L A;  1Q1B A;  4IUV A;  4KHV A;  4LF8 L;  1XPO A;  1YNN C;  2I0Q A;  2E5L L;  5HGQ A;  4ZUI A;  3W5O A;  1KDA A;  4KHP L;  1VQA A;  2PCF B;  4K8J A;  1E22 A;  2EIF A;  1XMO L;  2WAQ E;  1KAW A;  3SK8 A;  1XMO Q;  2VXW A;  3A8K E;  4OEL B;  1YJ9 A;  3BS1 A;  3Q22 A;  4QIW E;  3PF5 A;  4DR7 L;  2E2D C;  1H9J A;  4DR7 Q;  3EQL C;  3ZJY C;  1PH8 A;  2P5Z X;  2F0N A;  2A6H D;  1E3P A;  5CR3 A;  4BA1 I;  5COY A;  2NVQ H;  4BBS H;  4LNQ A;  4GLV B;  3FDT A;  1GUO A;  4BXX G;  2KEE A;  2ZJR A;  1PFN A;  1DCZ A;  1B44 D;  1KDB A;  1V1O A;  5BN3 A;  5JVH 3;  3ONA B;  3AB9 A;  2QDB A;  3CRL C;  4ODG A;  2CVR A;  4LK1 C;  1GM5 A;  4A3C G;  1WTR A;  5HGT A;  1SEB D;  1SSO A;  4M1U B;  1CHP D;  4C3H B;  3MXG A;  5EPK A;  5EKK A;  4IN3 A;  5IYC H;  4JV5 L;  4A3E B;  3DHQ A;  4C3H G;  4BY1 H;  4JV5 Q;  3D3R A;  1EWH A;  1YIJ A;  2NTT A;  4P75 A;  2UUC L;  4UY8 C;  4A3E G;  4K0K L;  4HAE A;  4IPC A;  3AFQ A;  1PMR A;  3U4Z A;  4DR3 L;  2F0O A;  1IW7 D;  2KHS A;  1PFB A;  4K0K Q;  1MD2 D;  4DR3 Q;  3E0E A;  2VZA A;  2GVB A;  1C7Y A;  1A62 A;  4DV2 L;  3T53 B;  5IE8 A;  1HZ9 A;  1V1Q A;  4OGQ C;  4JOI A;  4DV2 Q;  2ZM6 L;  4Y7N H;  5BN5 A;  3F8T A;  5JEA H;  4P2C B;  5FLX E;  4RGO S;  3S14 H;  1EIF A;  3J81 L;  1VQK A;  3CD6 A;  4K5V A;  1QWY A;  1PV4 A;  1VCI A;  3S15 H;  1ZYR C;  1HQR D;  4RKL A;  1LV9 A;  1I3Q H;  1TS3 A;  5D14 A;  2YYZ A;  4BS9 A;  3HOX B;  1FVI A;  1STY A;  3S2D H;  1VQF A;  1I4P A;  4PMW A;  1Q7Y C;  1U4M A;  3HOX G;  1BKB A;  2LXK A;  2R93 H;  1LTS D;  2B3G A;  3AFP A;  4DV0 Q;  3V05 A;  4A93 H;  4FDB A;  2SNS A;  4ID6 A;  4C1N I;  5JJL A;  4UP7 A;  1JQY D;  5ELO A;  1A15 A;  4FNF A;  1H9S B;  2A19 A;  1K9M C;  2NVY B;  4EGV A;  4JOI C;  2IL8 A;  1EWI A;  3OWF A;  3F2B A;  4PG3 A;  4RKB A;  4JI4 L;  3MTS A;  1AFP A;  2BA0 A;  3SGI A;  4JI4 Q;  4IFD I;  2N78 A;  3JAM i;  3R8B A;  4K8I A;  4GKJ L;  2AUK A;  1JE5 A;  1DD2 A;  1HTP A;  5J22 A;  4A3G H;  4GKJ Q;  1LT3 D;  5JJK A;  1OXX K;  3NEN A;  5ELE A;  1VQ5 A;  1SYG A;  3I73 A;  1WD1 A;  5LL6 S;  3FHW A;  1GHK A;  4RCN A;  1DOM A;  4DV6 Q;  2WII B;  1CQV A;  3W3A A;  4ME5 A;  1WTO A;  1Y8O B;  5GAD C;  1D8L A;  1KHI A;  1AE2 A;  3MXN A;  1LTR D;  5ELF A;  2F0I A;  1QVG A;  3EVQ A;  4ZRZ A;  1IBM Q;  3OYY A;  1EY8 A;  1F2Z A;  1XX8 A;  1BCP B;  4WJW A;  2EXD A;  2F0V A;  4X66 L;  2WAC A;  4DNT B;  4X66 Q;  4MTN A;  2FMM A;  3H09 A;  5ELN A;  4IJL A;  4H13 C;  1DXM A;  1M4V A;  1Q12 A;  3UDG A;  1SJH D;  1LT5 D;  2A74 C;  5BR8 Q;  3NTH A;  1HZC A;  1AZQ A;  1RDP D;  1SE2 A;  2CKZ B;  2TMP A;  1Y8N B;  2N49 A;  3GTG H;  3V96 A;  5C4J H;  3TQY A;  2EJG C;  3BVM A;  4X6A H;  4HJA A;  1TKW B;  1K8G A;  4HMI A;  3TS2 A;  2IJ0 A;  2KVM A;  2EVB A;  4HIM A;  1VQH A;  4X62 Q;  1VQE A;  2RKS A;  2VUM H;  1MHW C;  3VR6 A;  1PZK D;  5IGB A;  1ICF B;  1EIH A;  1ZYR D;  1K73 C;  3U4V A;  3SR1 A;  2M9V A;  4C2M B;  3PO3 B;  1FGB D;  1XMQ Q;  1EYA A;  4DFA A;  3PSI A;  4LF4 L;  2D2C C;  3I2Z A;  5EGT A;  2XWJ B;  1EQQ A;  1AZP A;  4LF4 Q;  4YWM A;  5C4H A;  3PO3 G;  1LYL A;  3GTP B;  4LF7 Q;  2Q2U A;  3D6C A;  3PIP 3;  2PZT A;  3D0F A;  2BE5 C;  3W1B A;  3C46 A;  4GNX A;  4P72 A;  1DM0 B;  1EYD A;  2NN6 H;  1PH2 A;  1JE4 A;  2HUG A;  5J1Z A;  3F2C A;  2EYF A;  3MXN B;  1O7Y A;  1DZ1 A;  5I9O A;  5K36 H;  3NSW A;  3CCR A;  4M8A A;  1SYF A;  4BBR B;  3CME A;  3VDY A;  3M4O B;  1E1O A;  1MBY A;  4F88 A;  3D4R A;  1RL2 A;  1XNR Q;  1SYE A;  3OPO A;  4TVA B;  4QGU A;  4J8Q A;  4BBR G;  2OTL A;  2EYO A;  4V0B A;  4JBJ A;  4A3J H;  1R9T B;  1EU3 A;  1E2V A;  2PQA B;  1N32 L;  3GQB A;  4LW1 A;  3T1Y Q;  2E2J B;  3GTO H;  3E6Z X;  1DYQ A;  2I46 A;  2FHT A;  3J81 E;  3QB3 A;  1II3 A;  3HOU H;  2ZTD A;  4APV A;  1TS4 A;  4Z9C B;  3CMA A;  1FGU A;  2JXM B;  2A73 B;  4GNX C;  1HUM A;  1STH A;  3QWN A;  4XDX A;  2E2H H;  2GA4 B;  3EJI A;  2JJQ A;  4K5W A;  4YCV A;  2I5M X;  3SEB A;  1FL0 A;  3HOY B;  3SE0 A;  2OTJ A;  3RZO B;  1EWC A;  1STB A;  3DWA A;  3GP7 A;  4FXG C;  4IPD A;  3QOJ A;  2L9H A;  4UP9 A;  1UEB A;  2J4X A;  3VR5 A;  3HOY G;  5JEA J;  1I94 L;  2K32 A;  5H1S E;  3BZC A;  3RR5 A;  1XPU A;  1PH9 A;  3OTO Q;  1I94 Q;  1OXT A;  3M7N A;  1GO3 E;  1CT1 D;  3PUW A;  3GTP H;  1QUQ B;  1YIT A;  5JPN C;  1KXL A;  2A68 C;  1WOC A;  5ELD A;  2OWO A;  1WCM B;  1TU2 B;  1ENC A;  3CC2 A;  3KF6 A;  3K7A B;  1HPC A;  1HH2 P;  4JW0 A;  1SMX A;  3J80 c;  3NTK A;  4PQX A;  1IL2 A;  1WCM G;  5EKL A;  3D4D A;  3S1M H;  4ZCK A;  2AWN A;  4BBR H;  1IBK L;  1EUJ A;  3PUV A;  1XTC D;  3LGJ A;  4KI0 A;  4N9T A;  1W6K A;  3KF8 A;  3G71 A;  3STB D;  4JI3 Q;  1VQ4 A;  5D3D A;  2R3Z A;  5IP7 G;  4ABN A;  4O42 A;  2E2J H;  4KLK A;  3KUP A;  1M8A A;  1NBW A;  1CSQ A;  4MTK A;  1SYD A;  3TP5 A;  4NPS A;  2B63 B;  3EN2 A;  1WTP A;  5E3F A;  1KQS A;  1W2B A;  2KUM A;  4HJ8 A;  1WTV A;  5C44 H;  4CJ0 B;  3HRZ C;  2BOS A;  2EYM A;  3RLN A;  2B63 G;  3FEW X;  3PIP A;  2BE5 D;  2PYK A;  1HR0 W;  4U68 A;  4HIO A;  4JBM A;  5FLM G;  4FF3 A;  3TN2 A;  2NVX H;  4LUV A;  3C1F A;  2DUD A;  3HG9 A;  2XGT A;  3ULP A;  2K04 A;  1RKN A;  2F4V L;  4B3R Q;  1GKH A;  4ZUJ A;  4G7Z C;  1U4P A;  2F4I A;  1HFN A;  4RGN A;  3CPF A;  4F8M A;  5DNF A;  4TKO B;  3SK6 A;  4Q0F A;  4JYA L;  3CCU A;  4NP5 A;  4HJ7 A;  4JI5 L;  5I2Y A;  1MIU A;  2NTS A;  2ZT9 C;  4DV3 L;  4JI5 Q;  1RF2 D;  4CBV A;  4L8J A;  3VYU A;  1GD7 A;  2E75 C;  1LTI D;  5I6Y A;  4DV3 Q;  1PH4 A;  2F1M A;  4RHR A;  1HNX L;  1X3Q A;  5A2Q L;  4LF9 L;  5IGD A;  2F3W A;  3KLS X;  3KF6 B;  4RAU C;  1W3S A;  4UHV A;  3SK5 A;  4ZAI A;  1IBL L;  1IHZ A;  5ELC A;  2K6A A;  4A3M B;  4IFD J;  3ERO A;  4JI2 L;  2NVT B;  2F0J A;  3HS0 C;  3Q6S A;  4NMZ A;  5FOB B;  3H91 A;  3W1G A;  2K5N A;  1B9M A;  4JI2 Q;  3E5S A;  3J81 j;  2JA5 H;  4N8X 1;  1HZB A;  4A3M G;  1XXG A;  1XWE A;  2D0O A;  2F0G A;  3I70 A;  2HCI A;  3S1N H;  1Y14 B;  4ZLT F;  3NXW A;  4DAY A;  2ENB A;  1HRJ A;  3GTM H;  1SXT A;  1LT6 D;  5FKA C;  4TQU S;  1VQ6 A;  3FPU B;  5I4D A;  4LWC A;  1D5M C;  1PA6 A;  1EY7 A;  3IKJ A;  2MO1 A;  1Y1V B;  4Q5V A;  4JI8 Q;  4LFC L;  2UXD L;  1TWF B;  2RDH A;  1OXV A;  5FLM H;  2D0P A;  2PZU A;  5IYB G;  3S1Q H;  1Y1V G;  2CQA A;  2A68 D;  2EJM A;  2CWP A;  1B4O A;  2IX0 A;  5M5X H;  3L0O A;  1BO0 A;  4YIJ A;  4I7Z C;  4HR7 B;  2C35 B;  1HJP A;  3KLS A;  1QJO A;  2QA4 A;  3E9H A;  4YWL A;  2XRS D;  1HNW Q;  5CV4 A;  2B8F A;  1HZA A;  3S16 H;  3GTJ H;  4RMF A;  4DNI A;  4YY3 L;  2RSO A;  2Q8T A;  3S24 A;  3K81 C;  2YU9 B;  1EIY B;  4X3T A;  4OX9 L;  5C4X H;  3I8Z A;  3C1E A;  3R93 A;  1EEF D;  2CQO A;  2KA7 A;  3BZK A;  2UUA L;  4OX9 Q;  1EYC A;  1JIC A;  3L9A X;  2F0U A;  3T4A C;  5C0X G;  4NKL A;  2UUA Q;  4DV1 L;  5LL6 X;  2L5T A;  4GN4 B;  1I6H H;  4NB3 A;  2BH8 A;  4C56 C;  1G6Z A;  1S5D D;  1PRT F;  3D6W A;  4WRD A;  2Z6B A;  3CXC A;  3DEO A;  4HIK A;  1X9N A;  4RGM A;  3H3V C;  2L4N A;  4R8I A;  1QVF A;  4A3M H;  2HQE A;  3I4M B;  1EQR A;  4KY7 A;  1YVC A;  1UAP A;  2FJ2 A;  1F9R A;  1KAA A;  4A3K B;  1EY0 A;  2RCF A;  4IUP A;  1A63 A;  3I4M G;  4OHJ A;  1SYC A;  1FJG L;  4X64 Q;  4A3K G;  1U0L A;  2JA8 H;  4PZ6 A;  4FYD A;  3RLO A;  5IP9 G;  4BY7 H;  1F77 A;  2DNC A;  3P75 A;  4DAY B;  1GXD C;  1ILP A;  2K52 A;  1WI5 A;  1YJW A;  4S3S A;  4JI0 L;  4B08 A;  4DF7 A;  3FKI B;  2MGS A;  5CYU A;  1A0I A;  1QOH A;  3J81 i;  1R4P B;  4K6L A;  4QMG A;  4WJ3 M;  4LAA A;  4LF6 L;  1YEZ A;  2PNH A;  3FKI G;  3P1H A;  1U4L A;  3A8I E;  2YTY A;  3ITP A;  3I56 A;  3EFX D;  4LF8 Q;  1Z6H A;  2PW7 A;  3CHB D;  3RD4 A;  5E7N A;  5C0X H;  2E5L Q;  5LMU L;  3A5U A;  3OOC A;  2KCT A;  3S9W A;  4KHP Q;  1SLJ A;  3D31 A;  5LMU Q;  3RNU A;  4XTC S;  2A8V A;  2KCN A;  1XTD A;  4C3J B;  2YTX A;  1JMC A;  2XNA C;  5ELB A;  3KFU A;  1TWC B;  1DOL A;  2WIN B;  3Q8D A;  1V8Q A;  4GOP B;  1KLU D;  3CQZ B;  4C3J G;  4DKA C;  1CSP A;  4IUU A;  1NMF A;  3I4M H;  1BCP F;  5CV8 A;  1LT4 D;  5IYD H;  1YBY A;  5T1I A;  2BH2 A;  5M3F H;  3A74 A;  3PQI A;  3R3O A;  4KJO A;  1TT2 A;  4GZY C;  2R7Z B;  1CTM A;  1RTN A;  3LNN A;  1NMG A;  2VS1 A;  4RH6 A;  4F87 A;  1Q82 C;  1H9S A;  4JBK A;  1E24 A;  1K3R A;  1SYB A;  2PW5 A;  2R7Z G;  5IT9 L;  3RMH A;  5A2Q E;  3FVQ A;  3TRE A;  2JA6 B;  4WFN 3;  1TII D;  1UE7 A;  2Z8L A;  1PRT C;  3DWP A;  4HCS A;  3CRK C;  1BOS A;  1I4X A;  3K5M A;  4DR1 L;  1HCZ A;  2RDG A;  4DN4 M;  2R92 B;  2JA6 G;  2B8G A;  1CKO A;  2HIV A;  4UPA A;  1LTB D;  1I4H A;  3UDX A;  1SND A;  3H3V H;  3ERS X;  3AYH B;  1EQV A;  1UUP A;  3N6R A;  2R92 G;  4ULL A;  3CCE A;  2RHS B;  4JVZ A;  1Q8I A;  3J7Z C;  1X54 A;  1TXY A;  2K33 A;  1BBX C;  2F3I A;  2EQS A;  2UUC Q;  1K83 B;  4B3S L;  2JEA I;  2NUC A;  3LWU A;  1BDO A;  3E0J A;  2TSS A;  2FXQ A;  1TQO A;  2K7V A;  1B7Y B;  4A3D B;  3VR3 A;  1GUW A;  3CF5 A;  4R4Q A;  4TSS A;  4KN7 C;  3QJY A;  1IYV A;  2F0T A;  2ZM6 Q;  2K14 A;  2DJG C;  2L55 A;  4A3D G;  4CKE A;  3TZU A;  1PRT B;  3HOZ B;  4L6T B;  2K1B A;  1D1I A;  2VB2 X;  1TVX A;  5JPM C;  4L5S A;  1VDZ A;  4A3L G;  1KNE A;  3SDZ A;  3KYH C;  5CBA E;  3HOZ G;  4BXX H;  4P73 A;  2XN9 C;  3K59 A;  2AWO A;  5D3I B;  2XIW A;  2WV6 D;  1G2S A;  1GUS A;  2ATW A;  4IUN A;  2R7Z H;  2Q2T A;  2UU9 L;  4CHT B;  3K5O A;  1IXR A;  2JA9 A;  4PV1 C;  4AYB E;  4MZ9 A;  1NE3 A;  2XVS A;  1SR3 A;  4R4I A;  1BBU A;  2F0W A;  1CI3 M;  3U50 C; 
#chains in the Genus database with same CATH homology
 3UE1 A;  3KJO A;  2ZTE A;  1DGS A;  3GTQ H;  4DV4 Q;  2E8G A;  1VQ9 A;  1J5E Q;  3CCR A;  3CME A;  3VDY A;  1E1O A;  1EFW A;  4B3T L;  5HY6 A;  4HJ9 A;  1QVC A;  1RL2 A;  3CP0 A;  1N34 Q;  4C3H H;  1XNR Q;  2KCM A;  3AQQ A;  2VL6 A;  1SE8 A;  4TVA B;  4QGU A;  1Z47 A;  2YU9 H;  4B3T Q;  4BBR G;  2OTL A;  2JA7 G;  3RN2 A;  3KDF B;  4JBJ A;  4A3J H;  1N8R C;  3H3V I;  1KRT A;  3L2P A;  2YV5 A;  4A3E H;  2K4K A;  1X56 A;  1WYD A;  2PQA B;  1N32 L;  1PYB A;  5IYC G;  4OO1 G;  4LW1 A;  3T1Y Q;  2ASB A;  5C4X G;  3GTO H;  3CCL A;  4IFD G;  3HFZ B;  5C3E G;  1N33 L;  2WB1 G;  4BY1 G;  3HOU H;  2ZTD A;  4APV A;  3TS0 A;  3CMA A;  4L5T A;  3KOJ A;  2R7D A;  1L1O C;  3PUY A;  1FGU A;  5AJ3 L;  3CPW A;  3L7Z C;  4H02 A;  4JCV E;  1TWH H;  4GNX C;  1V43 A;  1PH5 A;  3CCJ A;  3UDI A;  5GAG C;  4JBW A;  3M4P A;  4A3K H;  1G6P A;  2E2H H;  4A75 A;  2JJQ A;  4B3M L;  5IP9 H;  1U5K A;  1VQD A;  3KF8 B;  4YCV A;  2I5M X;  1YJN A;  1FL0 A;  4B3M Q;  1VQJ A;  2WB1 E;  2UUB L;  1H95 A;  2OTJ A;  1LM0 A;  1PFS A;  1TWG H;  2I5L X;  5JEA G;  1C7Y A;  2K50 A;  4JI6 L;  2CWA A;  2UUB Q;  4DK6 C;  1NY4 A;  4IPD A;  4UP9 A;  5M3M G;  4JI6 Q;  1UEB A;  3HOY G;  3RN5 A;  3HOX H;  3UDF A;  1YZ6 A;  3G6E A;  1AE3 A;  5JEA J;  4JI8 L;  4ALP A;  2JA8 G;  1X3E A;  1CKN B;  1I94 L;  2Q2I A;  4BY7 G;  3H0G H;  5H1S E;  2HQL A;  3BZC A;  3TRZ A;  3RR5 A;  1XPU A;  1PH9 A;  3OTO Q;  1I94 Q;  4YCW A;  1OXT A;  3A5Z B;  4DPG A;  1KC8 C;  1GO3 E;  4HID A;  3M7N A;  1UE5 A;  3GDE A;  3PUW A;  3GTP H;  3I4N G;  1QUQ B;  1YIT A;  2JK8 A;  2PQA A;  3FKI H;  1XPR A;  1KD1 C;  1LTL A;  2ZJQ A;  4DR1 Q;  1KXL A;  5IT9 c;  1WOC A;  3CC7 A;  2OWO A;  2NN6 I;  3CC2 A;  2R93 G;  2IY5 B;  3KF6 A;  1HH2 P;  3KLW A;  3F2D A;  1SMX A;  1HNW L;  3J80 c;  2QEX A;  4A93 G;  1IL2 A;  1WCM G;  1X65 A;  3S1M H;  2MO0 A;  1LUZ A;  2NVY H;  2XTI A;  2AWN A;  1JT8 A;  4BBR H;  1IBK L;  3TEH B;  1EUJ A;  3PUV A;  1Y1W G;  1VQM A;  4A3F G;  2AMC B;  4B3S Q;  3A0J A;  3LGJ A;  4KI0 A;  1VQO A;  3HOU G;  3HKS A;  3STB C;  3STB D;  3G71 A;  4JI3 Q;  3RLF A;  1VQ4 A;  2R7F A;  3K0X A;  5IP7 G;  4PZ8 A;  2HIX A;  3RZD H;  4C3J H;  1P16 A;  2GVA A;  2E2J H;  4BA2 I;  4IPG A;  4KLK A;  4A4I A;  2RHQ B;  3NEM A;  1YI2 A;  1X55 A;  5GQO A;  1Q86 C;  2ALY B;  1TWC H;  3EIV A;  2IHF A;  2CCZ A;  4XIG S;  3HOW G;  3K7U C;  1TWA H;  1NBW A;  3G48 A;  2GN5 A;  3PO2 H;  4A3G G;  4DR6 L;  1CSQ A;  4AYB G;  3CQZ H;  1CUK A;  2R6G A;  4LF5 L;  5IWA L;  2PMZ E;  2Y0S G;  4DR6 Q;  4NPS A;  4C3I H;  1M1K C;  3HKZ G;  1M90 C;  3EN2 A;  4LF5 Q;  3J81 c;  5IWA Q;  1VQ7 A;  1I5F A;  4A3I H;  1W2B A;  1QUQ A;  1KQS A;  4HJ8 A;  1VQN A;  1WJJ A;  5C44 H;  4X64 L;  4LFA Q;  3G4S A;  3RLN A;  3ULJ A;  2B63 G;  3HOV H;  3PV0 A;  1E7Z A;  3PIP A;  4OON A;  5M3M H;  3CCQ A;  4RG1 A;  2RF4 A;  5EAY A;  5IYD G;  1MKH A;  3PUX A;  1HR0 W;  4HIO A;  4JBM A;  1E1T A;  3GO5 A;  5FLM G;  5M3F G;  2VY3 A;  4ME3 A;  1OTC A;  4LUV A;  2NVX H;  4GS3 A;  4NXM L;  2HT1 A;  5GAH C;  2DUD A;  1B70 B;  2Y0S E;  2UU9 Q;  2XGT A;  4NXM Q;  4DK3 C;  4DAM A;  3HKZ E;  1X3F A;  3CCM A;  3ULP A;  3U58 A;  2N3S A;  3JAM c;  1QZH A;  2F4V L;  4B3R Q;  1GKH A;  4OWW B;  3PCO B;  4Y52 H;  2NZO A;  1RIP A;  2JA6 H;  3CPF A;  1O7I A;  1XJV A;  3ICE A;  1OXS C;  2AHO B;  1L0W A;  2VW9 A;  3H15 A;  3CCU A;  4DV0 L;  2YTV A;  4HJ7 A;  4JYA L;  1CKM A;  4JI5 L;  1MIU A;  2R92 H;  1VQC A;  4DV3 L;  3PF4 A;  4DUY L;  4JI5 Q;  5JJI A;  1GD7 A;  1OXU A;  3BJU A;  2WAQ G;  4OWX B;  5M5W H;  4DUY Q;  2F52 A;  4DV3 Q;  4IO9 A;  1PH4 A;  1N36 L;  1HNX L;  4LF9 L;  1N36 Q;  1G29 1;  1GVP A;  2HHH L;  1N32 Q;  1Q1B A;  4L5R C;  3KF6 B;  4LF8 L;  1W3S A;  3M4Q A;  1IBL L;  1YHB A;  1XPO A;  4DR2 L;  2I0Q A;  1N33 Q;  1K83 H;  2E5L L;  5HGQ A;  3DLL A;  3B6Y A;  4IFD J;  3W5O A;  1YHA A;  4JI2 L;  4KHP L;  4IPH A;  1VQA A;  1A8V A;  4OO1 I;  1E22 A;  2EIF A;  1XMO L;  3W1G A;  2K5N A;  4JI2 Q;  2CFM A;  5AJ3 Q;  3J81 j;  2WAQ E;  1KAW A;  2JA5 H;  1HZB A;  4A3M G;  1XMO Q;  1G51 A;  1PH1 A;  4A3D H;  2D0O A;  3CC4 A;  4UP8 A;  3HOW H;  2MQH A;  2I5H A;  3S1N H;  4JI1 L;  1D7Q A;  1YJ9 A;  1Y14 B;  4EX5 A;  3GTK H;  5DLQ E;  4JG2 A;  2KEN A;  4QIW E;  1IZ6 A;  4JI1 Q;  3PF5 A;  4AH6 A;  4DR7 L;  4A3L H;  4OWT B;  2LSS A;  3HOZ H;  2KHJ A;  3GTM H;  1K0R A;  4C2M H;  2VUM G;  3PO3 H;  4DR7 Q;  3ZJY C;  4A76 A;  4KHZ A;  4TQU S;  4MNO A;  4DV6 L;  1PH8 A;  1VQ8 A;  4POG A;  1VQ6 A;  2BA1 A;  1ASZ A;  1AH9 A;  4LWC A;  1PA6 A;  1E3P A;  2JE6 I;  2MO1 A;  1VQL A;  4JI8 Q;  4LFC L;  1BVS A;  2UXD L;  1OXV A;  1BBW A;  5FLM H;  1PH6 A;  2D0P A;  1YNX A;  4R1J A;  4LUZ A;  2IT1 A;  4BA1 I;  3KJP A;  3WWV A;  4LNQ A;  5IYB G;  2NVQ H;  4BBS H;  4GLV B;  3S1Q H;  2OQK A;  1Y1V G;  3CCV A;  4BXX G;  2ZJR A;  2K5H A;  4LFB L;  2CWP A;  1IBM L;  2IX0 A;  5M5X H;  3L0O A;  1MJC A;  1S3O A;  2V1C C;  2C35 B;  3GD7 A;  1HJP A;  1PVO A;  2WP8 J;  4J15 A;  1C0A A;  2QA4 A;  3E9H A;  2NN6 G;  4YWL A;  5M5Y H;  1HNW Q;  1YHQ A;  4YCU A;  2WFW A;  1HZA A;  1VQI A;  3S16 H;  2JA7 H;  3GTJ H;  1GM5 A;  3M85 A;  3M4O H;  4A3C G;  2RCN A;  4RMF A;  4GLX A;  4DNI A;  3OW2 A;  3PGZ A;  4YY3 L;  5K36 G;  3S24 A;  1IBK Q;  3K81 C;  1EIY B;  4OX9 L;  2Q2H A;  5IYC H;  4IOC A;  5C4X H;  5GRO A;  4YWK A;  5BR8 L;  4JV5 L;  2CQO A;  3BZK A;  2UUA L;  4HIK A;  1R9T H;  5C3E H;  4NXN L;  4OX9 Q;  2JQO A;  4BY1 H;  4JV5 Q;  5C0X G;  2UUA Q;  4NXN Q;  4DV1 L;  2MNA A;  1YIJ A;  4GN4 B;  4A3J G;  1L2F A;  4NB3 A;  4P75 A;  2BH8 A;  1I6H H;  2KBN A;  2E2I H;  2UUC L;  4UY8 C;  4A3E G;  4K0K L;  1J6Q A;  2N8N A;  4IPC A;  1Q1E A;  2K75 A;  3AFQ A;  4R4C A;  3U4Z A;  5C0X J;  3CXC A;  4DR3 L;  1X9N A;  3S2H H;  4K0K Q;  1HNZ L;  3I4O A;  1QVF A;  4A3M H;  4DR4 L;  4DR3 Q;  2PI2 E;  1EQR A;  3E0E A;  2VZA A;  4EQ5 A;  1YVC A;  2GVB A;  1A62 A;  2IHE A;  5IE8 A;  4DV2 L;  1S40 A;  1HZ9 A;  1V1Q A;  2AKW B;  4X62 L;  4YHH L;  5LMN L;  2Z6K A;  3K8A A;  3CW2 C;  4JOI A;  4DV2 Q;  2ZM6 L;  4Y7N H;  1HR0 L;  2MFI A;  3I7F A;  1A63 A;  3F8T A;  1PH7 A;  3I4M G;  5LMN W;  3S14 H;  1HR0 Q;  1EIF A;  4X64 Q;  1FJG L;  5GAE C;  4QL5 A;  1VQK A;  4DV7 L;  1KL9 A;  3CD6 A;  4GN5 A;  4A3K G;  1U0L A;  2JA8 H;  3HOY H;  1PV4 A;  1VCI A;  1C9O A;  4PZ6 A;  4QJF A;  1XMQ L;  3S15 H;  3RZO H;  3RLO A;  5IP9 G;  4BY7 H;  1I3Q H;  2PI2 A;  2YYZ A;  2OQ0 A;  4DAY B;  1MJE A;  1FVI A;  2K52 A;  3S2D H;  1VQF A;  1WI5 A;  3I4N H;  1YJW A;  4JI0 L;  4PMW A;  2F4V Q;  4IOA A;  1Q7Y C;  1Q8K A;  1SN8 A;  4LF7 L;  1Q81 C;  3HOX G;  3J7A 5;  1BKB A;  2LXK A;  2R93 H;  2VQF L;  4DR5 L;  2VNU D;  1X6O A;  1A0I A;  2B3G A;  3AFP A;  4DV0 Q;  4JYA Q;  4A93 H;  4FDB A;  1WCM H;  3J81 i;  1SFO H;  4WJ3 M;  4LF6 L;  4P71 A;  1YEZ A;  2PNH A;  3K7A H;  5JJL A;  3FKI G;  4UP7 A;  5ELO A;  2VQE L;  1Y1W H;  1HNX Q;  4LF9 Q;  1XNQ L;  2A19 A;  4A3F H;  4O0A A;  1T9H A;  2Z6K C;  1K9M C;  2VQE Q;  2B29 A;  4JOI C;  1EWI A;  2HHH Q;  2YTY A;  3I56 A;  1XNQ Q;  1N34 L;  1XNR L;  4LF8 Q;  3F2B A;  1V9P A;  1IBL Q;  5E7N A;  3GTL H;  3NBH B;  4PG3 A;  4JI4 L;  4DR2 Q;  2E5L Q;  5LMU L;  3A5U A;  2BA0 A;  5IP7 H;  3SGI A;  4A3B G;  2KCT A;  4KHP Q;  4JI4 Q;  1SLJ A;  2N78 A;  3JAM i;  4IFD I;  4JI7 L;  3D31 A;  5FJ8 G;  5LMU Q;  3RNU A;  4XTC S;  2UXC L;  3T1Y L;  3NEL A;  2A8V A;  1EYG A;  1JE5 A;  4GKJ L;  2DGY A;  3BU2 A;  4JI7 Q;  4R4O A;  4A3G H;  1XTD A;  3ER0 A;  2UXC Q;  4GKJ Q;  2YTX A;  4OXP A;  5JJK A;  1OXX K;  3NEN A;  1JMC A;  3KFU A;  1PYS B;  1VQ5 A;  3Q8D A;  1IYJ B;  1KIX A;  3I55 A;  4GOP B;  4DKA C;  3AEV A;  3CAM A;  1CSP A;  2IX1 A;  4HJ5 A;  1NMF A;  3FHW A;  3I4M H;  1VQG A;  2B63 H;  3MEF A;  4DV6 Q;  3PO2 G;  4IJH A;  5IYD H;  3M3Y H;  1YBY A;  2BH2 A;  5M3F H;  1X3G A;  3A74 A;  1VQP A;  3UE0 A;  5IY0 A;  1PH3 A;  4LFC Q;  2UXD Q;  4A3I G;  1Q46 A;  2K5V A;  5GAD C;  1B8A A;  1D8L A;  1KHI A;  1AE2 A;  5C44 G;  1NMG A;  2VS1 A;  1Q82 C;  1WFQ A;  4JBK A;  3HOV G;  1E24 A;  5FLX c;  1K3R A;  4QQB X;  1JJ2 A;  1QVG A;  1JJC B;  1SRO A;  4LFB Q;  3EBE A;  1IBM Q;  2R7Z G;  3OYY A;  2UXB L;  2KHI A;  3OTO L;  4AIM A;  2EXD A;  2QGQ A;  3TRE A;  4X66 L;  4R4T A;  1K8A C;  3S1R H;  2UXB Q;  1UE7 A;  1VQB A;  3DM3 A;  2H5X A;  3KDF A;  1QZG A;  4X66 Q;  3S17 H;  4MTN A;  4DR1 L;  5ELN A;  4IJL A;  4JC0 A;  2JA6 G;  1Q12 A;  1CKO A;  2HIV A;  4UPA A;  3UDG A;  4YY3 Q;  2A1A A;  3UDX A;  1JB7 A;  1S72 A;  3H3V H;  3ERS X;  3AYH B;  5BR8 Q;  2R92 G;  1L1O B;  1HZC A;  3CCE A;  3FP9 A;  4GOP A;  2RHS B;  1Z9F A;  2CKZ B;  1N9W A;  3CCS A;  2N49 A;  4L5Q A;  3GTG H;  4GNX B;  3J7Z C;  5C4J H;  1X54 A;  4DV1 Q;  3TQY A;  2NZH A;  4A3B H;  1TXY A;  1P8L A;  3T1H L;  2F3I A;  4X6A H;  3PUZ A;  4HJA A;  2EQS A;  2UUC Q;  4B3S L;  3F1Z A;  5FJ8 H;  4AQY L;  2JEA I;  3T1H Q;  5J3B A;  5C0X I;  1K8G A;  4P74 A;  4JI3 L;  1HNZ Q;  2NVT H;  4AQY Q;  3TS2 A;  1JJG A;  3IRB A;  1J5E L;  1NJI C;  2FXQ A;  3J80 i;  2OCE A;  1B7Y B;  2D62 A;  2ZTC A;  3CF5 A;  4R4Q A;  5LMN Q;  4YHH Q;  1VQH A;  4X62 Q;  4HIM A;  4GKK L;  1VQE A;  2LXJ A;  2ZJP A;  3JC6 6;  2ZM6 Q;  2K14 A;  3E9I A;  2VUM H;  4X65 L;  4GKK Q;  2JA5 G;  4WJ4 A;  2ID0 A;  4A3D G;  4DV5 L;  2JEB I;  1FJG Q;  1SRU A;  4POF A;  4X65 Q;  1CKN A;  3PIO A;  4DV7 Q;  1K73 C;  3U4V A;  4DV5 Q;  4GLA C;  4GN3 B;  1I50 H;  1XMQ Q;  3PSI A;  4L5S A;  4LF4 L;  3I2Z A;  1EQQ A;  4A3L G;  2Z0S A;  5IYB H;  3KYH C;  3ULL A;  4LF4 Q;  3HOZ G;  4LFA L;  1VS0 A;  1Y1V H;  1NTG A;  4YWM A;  3PO3 G;  4BXX H;  1UE6 A;  4P73 A;  1TWF H;  4DR4 Q;  4JI0 Q;  2AWO A;  1LYL A;  4GOP C;  4LF7 Q;  2L15 A;  2Q2U A;  1EOV A;  4LUO A;  1KRS A;  3D0F A;  1L1O A;  3H0G G;  3M9B A;  4QY7 A;  4DUZ L;  2ATW A;  3W1B A;  2R7Z H;  2Q2T A;  2UU9 L;  2VQF Q;  4DR5 Q;  4GNX A;  4BBS G;  1IXR A;  2JA9 A;  4P72 A;  4AYB E;  4DUZ Q;  1UE1 A;  3K80 C;  4MZ9 A;  2ES2 A;  1NE3 A;  4O2D A;  4PZ7 A;  1PH2 A;  4B3R L;  1SR3 A;  4R4I A;  1UWV A;  1ASY A;  1BBU A;  3F2C A;  1PHJ A;  4DV4 L;  4A3C H;  4LF6 Q;  3MXN B;  3U50 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...