2UUAL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uuaL00
3STBC 4JBJA 1BBWA 2KENA 1WCMH 1MKHA 4P71A 5IWAL 1H95A 1Y1VG 1XNRL 1XTDA 4JBMA 2DGYA 3RZDH 1L1OA 3DLLA 1UE1A 4L5RC 2K50A 4X66L 1X3EA 3KOJA 3PIPA 4DR1L 4X64L 1Y1WG 1YJ9A 2PNHA 1JB7A 1SRUA 3PCOB 1OXVA 4DK3C 3BJUA 3CC7A 3M3YH 4IPDA 4LF6L 1VQ5A 3S17H 3CCRA 4DR5L 2R7DA 2VY3A 5FLMH 1L0WA 4KHPQ 1QVCA 4JYAQ 3NEMA 1K8GA 3CD6A 5EAYA 2ZJPA 1X56A 1VQ4A 4LF4Q 4B3SL 4X62L 3M9BA 1HNXQ 2D62A 1KHIA 4DV5Q 3ULPA 3S1NH 4HIMA 4DV2Q 5K36G 2R6GA 1XJVA 3F2BA 4MTNA 4KI0A 4XIGS 1FGUA 2UUBQ 1QZGA 5LMUQ 3E0EA 4EQ5A 4R4OA 5M3MH 3KJOA 4OX9Q 1NTGA 1VQJA 1PH1A 3AFQA 2Q2HA 1IXRA 5GAHC 3S16H 2GVBA 1QVFA 2CFMA 1GD7A 2AKWB 1L1OB 3HKZE 1MJEA 4X6AH 2OQKA 1WI5A 1Q1EA 3GTKH 3PF4A 4R4QA 3S1QH 2N8NA 3MXNB 4C2MH 1SROA 4UY8C 4JI7L 2JA5H 2VQEQ 1J5EL 4HJ5A 3RNUA 3HOWH 1X54A 4BY7G 4POGA 4UPAA 4LFCL 2N3SA 2K75A 3HOYH 4B3RL 5IE8A 1LM0A 4JI5L 1Q8KA 4KHZA 1TWGH 1K3RA 3G48A 4DAMA 2L15A 4GN5A 3PUYA 3CCVA 1XNRQ 4GN3B 4BBRH 3JAMi 4X66Q 2MO0A 5FLXc 4DR1Q 3HFZB 4GOPB 4IOAA 4R4TA 1N9WA 4JOIA 2NN6I 3FKIG 4BY1G 1PYSB 3PV0A 3CW2C 2E5LL 4DR5Q 1KXLA 4C3HH 2CKZB 4UP8A 2XTIA 2RCNA 1YJWA 1WJJA 5IT9c 2B29A 4B3ML 1UE7A 1N32L 2R93H 1X3GA 4YCVA 1KRSA 2PI2E 4A3CH 1VQAA 1JJCB 2K5NA 1T9HA 4YCWA 3NBHB 4A3JH 5C0XI 2PQAA 1EQRA 2K5VA 1IBLL 3E9HA 1C0AA 5LMNW 2A19A 2VW9A 2JA6G 3HOVH 3UE0A 3U50C 2B3GA 3VDYA 2E2HH 3M4OH 2HHHQ 4YWLA 2FXQA 4DNIA 4JI6Q 4BA2I 4DV4L 2UU9L 2ZJQA 4NXNQ 4QIWE 4YHHL 4JI7Q 4POFA 2V1CC 1EWIA 4JOIC 4A3EH 2A8VA 1SR3A 5M5YH 3KDFA 1TWFH 1IYJB 1EFWA 4K0KL 1E3PA 2BA0A 4L5TA 4A3LH 5M3FH 4A75A 4JCVE 1VQNA 1FJGQ 1GO3E 1WOCA 2GVAA 5IP9G 2NVQH 4MZ9A 4P74A 4BXXH 3PGZA 4GLVB 3BZKA 2PQAB 3RN5A 1N36Q 2E2IH 1YNXA 4IFDG 4JI0Q 2UXDL 1Z47A 2VQFQ 2B63H 4KHPL 4JYAL 1PYBA 3KYHC 5IYBG 3J81j 3L0OA 4DV7Q 4TVAB 4LF4L 4OWXB 3HOZG 1LYLA 3PO2G 3D31A 4LF8Q 4GLAC 1Y1VH 3CPFA 3RLNA 2OWOA 5JJIA 2QGQA 2UUBL 1KD1C 4DUZQ 2CQOA 2RF4A 4DV3Q 2Q2TA 1Y1WH 3RR5A 4OX9L 4R1JA 3ULLA 3PO3G 1CSQA 2IX0A 3FP9A 4WJ4A 4IJHA 3GTLH 2JA8G 5C44G 3S15H 1AE2A 1VQ9A 3RN2A 1W2BA 2YU9H 2RHQB 1I5FA 4DV4Q 2EXDA 4A93G 1NE3A 1VQCA 1VQHA 1PH3A 4YHHQ 2VQEL 1X55A 4A4IA 3W1BA 2C35B 3AQQA 4JBWA 1BKBA 3UDXA 4IPHA 1Q82C 3G71A 1VQ7A 1PH2A 4LF7Q 5IP7G 1D8LA 2ZM6Q 2ASBA 2UXCQ 1FVIA 4JI4Q 3CC4A 5J3BA 3T1YL 2AHOB 1V43A 2D0OA 2UUCQ 3GTOH 2UXBL 2MNAA 1XPOA 3A5ZB 2DUDA 2KCTA 1SMXA 2JK8A 1D7QA 3EN2A 2K5HA 4QQBX 4LUVA 3A74A 3ZJYC 3G6EA 2K4KA 2IHFA 3J81c 1KC8C 1CSPA 1A63A 1YHAA 1YZ6A 2UXDQ 1N34Q 3CMEA 3TEHB 4HIDA 4BY7H 1Q12A 1NY4A 1HR0L 3D0FA 4GLXA 2VZAA 1XNQQ 3UDIA 1C7YA 1OXSC 2JQOA 1Q86C 2AWNA 4L5SA 3E9IA 3I4OA 1NBWA 2EIFA 2ATWA 3GTQH 1RIPA 2CWAA 3F2DA 1GM5A 2R7ZG 1HNWL 4DR3Q 1LTLA 1CUKA 4ME3A 2QA4A 3TQYA 4J15A 4GOPA 3TS2A 5M5WH 1OXUA 4Y52H 3S2HH 3FKIH 4O2DA 4BY1H 2KBNA 2KCMA 2F4VL 3CQZH 3PSIA 4JI2Q 1EQQA 3LGJA 4BA1I 4C3IH 2HHHL 4OO1G 4EX5A 5IY0A 2ZJRA 4DV1Q 4JI6L 3J80c 3HOUG 1L1OC 2F3IA 2LXJA 4NXNL 5C3EG 4YY3L 1G51A 4A3FG 2NVXH 3I55A 2VS1A 1YVCA 4LF5L 4DUYQ 4DR4Q 4RG1A 3K0XA 3A0JA 4PZ8A 2NZOA 4QL5A 1YHQA 3T1YQ 2PMZE 2UXBQ 2JA6H 2MO1A 1K83H 2WB1E 4R4IA 2YV5A 4YWMA 1FJGL 3CPWA 3GTJH 1IBKL 1KL9A 3J7A5 2HIVA 3I2ZA 3KJPA 1I50H 3CC2A 2F52A 1N36L 2CWPA 1Q46A 1XPRA 4P73A 1JMCA 4P72A 2MFIA 4PMWA 4GOPC 4H02A 4JI0L 4LF9Q 4DR6Q 1X9NA 4IOCA 1M1KC 1TWAH 2VQFL 4WJ3M 1HR0Q 4DV7L 3CF5A 3L7ZC 4HJAA 1GKHA 1U0LA 4OONA 3SGIA 1S72A 5GAEC 5IYCG 4GNXA 1OXXK 2R7FA 5IP9H 4LF8L 1PFSA 2WB1G 3ERSX 3CCSA 1UE5A 4A3BG 1HNWQ 1SLJA 1MJCA 3PF5A 4HIKA 1DGSA 1PH9A 3K80C 4DUZL 3K81C 3WWVA 4DV3L 3GTMH 4A3IG 2F4VQ 5C0XJ 5FJ8G 5DLQE 1QUQA 1FL0A 5IYBH 2IT1A 2IX1A 2LXKA 1VCIA 1K73C 5GAGC 3HOZH 1HZAA 2Q2IA 4YY3Q 3CCUA 4NB3A 4LFAQ 3GTGH 3STBD 4JI1Q 3PO2H 4LF5Q 2AWOA 1CKOA 2JEBI 1V1QA 4GN4B 4YWKA 4DAYB 4JC0A 3S1RH 2UXCL 4DPGA 2ZM6L 4JI8Q 2YTVA 4JI4L 4GNXB 3PO3H 2I5LX 3OYYA 1HZCA 5IYDG 1HZBA 2UUCL 3I7FA 2JA8H 3TS0A 4GNXC 1VQFA 5C44H 1IBKQ 1YHBA 3U4ZA 4A76A 1PVOA 4AQYQ 2R92G 1PA6A 4A93H 4A3DG 4HJ8A 1I94Q 4X65Q 5JEAJ 4O0AA 1N34L 3KF6A 4FDBA 1N8RC 3S1MH 1QUQB 4OWWB 3L2PA 5IP7H 1XNQL 4ALPA 2I5MX 1J6QA 4GKJL 1BBUA 1G291 3BZCA 2RHSB 1CKNA 1SE8A 3EIVA 4KLKA 3CCJA 4A3KG 1PHJA 4DR3L 3AEVA 3ICEA 4NXMQ 5M5XH 1JE5A 4IJLA 1VQ8A 1VQPA 4L5QA 4A3MG 4JI2L 2QEXA 3TRZA 4IFDI 2KHJA 3CXCA 4LFBQ 2GN5A 3JAMc 4DV1L 1P16A 1VQIA 5GROA 4JV5L 2JEAI 3I4MG 1HJPA 1X65A 1VQOA 1A0IA 3KF6B 4DUYL 4DR4L 1I6HH 1W3SA 2ZTCA 2R7ZH 3H15A 4OWTB 1Q7YC 3HOXG 2BA1A 1EIYB 3BU2A 5C4XG 1M90C 1PH7A 1LUZA 1XPUA 1CKNB 1N33Q 1V9PA 1VQKA 2VUMG 1OTCA 2JA7G 4GKKL 1NMFA 3HOUH 4P75A 5C3EH 4A3FH 1JT8A 3AYHB 3M85A 4LUOA 1YIJA 3OW2A 4LF9L 4DV6Q 4DR6L 3GTPH 1AE3A 1UEBA 1IZ6A 2BH8A 4RMFA 5AJ3L 5C4JH 2OTJA 2Z0SA 1VQ6A 4HJ7A 1B7YB 4GKJQ 1B70B 3UE1A 2PI2A 4HJ9A 1G6PA 1K9MC 3IRBA 1S3OA 2A1AA 3GDEA 1Q81C 4C3JH 3CCEA 2K52A 4DR2L 4LWCA 5GADC 1IL2A 2NVTH 3PUWA 1VQLA 4AYBG 3I4NG 1Q1BA 4BBSG 5ELNA 4DK6C 2OCEA 3NELA 1ASZA 1WYDA 3H0GG 1VQGA 3A5UA 1TWCH 3S2DH 1E7ZA 4QY7A 4UP9A 1YI2A 1HH2P 4DR7Q 4JV5Q 1UE6A 5IYCH 3S14H 1YITA 4LFAL 4Y7NH 1JJ2A 4JI1L 2D0PA 2LSSA 5BR8Q 4A3GG 3Q8DA 3OTOL 5LMNL 3RLFA 4A3BH 2VL6A 3GD7A 1PH6A 4JI8L 3CP0A 1WFQA 4DKAC 1HNZQ 3PUZA 4QJFA 4GS3A 4LNQA 4A3IH 1E1TA 1A8VA 5FJ8H 3PUXA 1I3QH 3K7AH 1VQMA 1VQBA 4DV0L 4JI3L 1WCMG 1P8LA 4AQYL 1KAWA 2Y0SE 4GKKQ 2Q2UA 4IO9A 1K0RA 1X6OA 1IBMQ 4OO1I 1I94L 2IY5B 2NN6G 5H1SE 4X65L 3PUVA 1R9TH 2OTLA 3S24A 4B3TQ 1EIFA 5AJ3Q 3UDGA 1X3FA 3UDFA 4NPSA 2ES2A 2HIXA 2KHIA 5FLMG 5IYDH 2H5XA 3DM3A 1MIUA 1A62A 2WP8J 4MNOA 3CCQA 2ALYB 2ZTEA 5C0XG 1C9OA 5IWAQ 4NXML 2ID0A 3EBEA 4DR2Q 1HR0W 2R92H 3H3VI 2Y0SG 4A3DH 1EUJA 1RL2A 1YBYA 1TWHH 2WAQE 3HKZG 4JG2A 1NJIC 2YTYA 4X64Q 1QVGA 1XMOL 5M3MG 4LFBL 3J7ZC 1XMQL 4LF6Q 2YTXA 2JE6I 1U5KA 2UUAL 5JJKA 1SN8A 4QGUA 1TXYA 1SFOH 2JJQA 2YYZA 4X62Q 2NZHA 3OTOQ 5LMNQ 4B3SQ 1CKMA 1E24A 2JA9A 3CAMA 4A3KH 1YJNA 1ASYA 3AFPA 2JA5G 3CCMA 3W1GA 1VQDA 3KF8B 3HOWG 3I56A 3HOYG 1PH5A 2WAQG 3J81i 1GVPA 4A3MH 1N33L 3F1ZA 3M4PA 5JEAG 3KFUA 4DV0Q 4JI3Q 3CMAA 3T1HL 1YEZA 3M4QA 3I4MH 4PZ6A 4BBRG 4YCUA 4DV6L 3HKSA 2HT1A 2CCZA 2Z6KA 1B8AA 3HOXH 1J5EQ 4AIMA 1E22A 1EOVA 3ER0A 3NENA 4B3RQ 4LFCQ 2E8GA 5C4XH 4JI5Q 1EYGA 5ELOA 3TREA 4OXPA 4LF7L 3M7NA 2R93G 2OQ0A 2VUMH 3G4SA 1VS0A 1PV4A 4IPGA 2JA7H 4A3CG 3JC66 1QZHA 1AH9A 1VQEA 3MEFA 4UP7A 4A3JG 1N32Q 3GO5A 1OXTA 4LW1A 4PZ7A 3J80i 3RLOA 5HGQA 1JJGA 1UWVA 2IHEA 2E2JH 1NMGA 1XMOQ 2I0QA 2WFWA 5E7NA 1XMQQ 1KQSA 2N49A 2E5LQ 3HOVG 2VNUD 4DR7L 2UUAQ 1BVSA 1HZ9A 4AH6A 3W5OA 3B6YA 3ULJA 2XGTA 4IFDJ 5BR8L 4B3MQ 2EQSA 2MQHA 3K8AA 4LUZA 2HQLA 4TQUS 4DV5L 3PIOA 4APVA 1HNXL 4JBKA 5HY6A 4DV2L 1Y14B 1K8AC 3FHWA 4A3EG 1Z9FA 3KDFB 4R4CA 1PH4A 1HNZL 2Z6KC 2BH2A 3I4NH 4BBSH 1IBLQ 5LMUL 3H0GH 4PG3A 4A3LG 5M3FG 2NVYH 1O7IA 4BXXG 3T1HQ 3U58A 3CCLA 1E1OA 4XTCS 4AYBE 3F2CA 4HIOA 1IBML 4A3GH 2UU9Q 4IPCA 1PH8A 4B3TL 3KLWA 2N78A 3K7UC 1L2FA 2AMCB 5GQOA 1KRTA 1S40A 3U4VA 3F8TA 2I5HA 2B63G 1KIXA 5JJLA 4K0KQ 3H3VH 3RZOH 2ZTDA 2K14A
chains in the Genus database with same CATH superfamily
4JBJA 5FKAC 1BBWA 1WCMH 5FO8B 5IWAL 5IGBA 1A3UA 2F0KA 4DNRB 4HCEA 2K50A 4X66L 4DR1L 3BZDB 1QB5D 1E0BA 1OXVA 4NMZA 3BJUA 4DK3C 1CHPD 1T5EA 2R7DA 4KHPQ 1QVCA 4JK1C 4JYAQ 3NEMA 2RVLA 5M9OA 1M8AA 5C0XH 3S16B 1BOSA 2ZT9C 4DV2Q 5K36G 4KJNA 4CKBA 2BDNA 3N52A 2UUBQ 1QZGA 3FDTA 1R9TB 4R4OA 5M3MH 2Q2HA 4RFBA 1F2LA 1QVFA 2CFMA 1GD7A 5KNBA 2K5WA 1MJEA 3GTKH 1Q1EA 3PF4A 2N8NA 2BE5C 4C2MH 1SROA 4UY8C 2F0UA 4FXKC 2IWHA 4HJ5A 3HOWH 1X54A 2HD3A 3HZXA 4LFCL 3OW7A 3HOYH 4B3RL 4BBRB 2M00A 4KHZA 1TWGH 4RKLA 5JEAH 4HR7B 3SK8A 2B2WA 3CCVA 1XNRQ 3TSSA 1CA5A 5FLXc 3VR4A 1Z7TA 1K28A 1KNEA 4BY1G 1PYSB 4ABNA 1II3A 5CBAE 4DR5Q 2CKZB 2XTIA 1K8OA 4A3JB 3HP3A 3IAYA 1WJJA 1STAA 5C4HA 2R93H 1X3GA 4CKEA 3HOVB 3NBHB 3PIO3 2PQAA 1AW7A 4ZCKA 2O5JC 3SE0A 1J8IA 1I4RA 4XQJA 4LJZC 5M5YB 3SK4A 2E2HH 3LWUA 1TWFB 1QCBD 3AMUA 2K5QA 1LTTD 1PFBA 2V1CC 1EWIA 4JOIC 2A8VA 3OWEB 4IALA 3CKIB 5KGUA 1YNJC 2MHVA 4JCVE 1VQNA 1FJGQ 5IP9G 1PDQA 2F0LA 4MZ9A 4ID6A 3E5SA 3T53B 2TMPA 1N36Q 1YNXA 1LTAD 1V1PB 3TP8A 2VQFQ 2B63H 1YNNC 3LX0A 4DV7Q 4TVAB 2JYOA 2C5CA 2F3WA 3PO2G 4XDXA 3RLNA 2OWOA 5CV8A 1KD1C 4L6TB 2EVBA 1Q8IA 4A3GB 3KLSX 3RR5A 2NB0A 4OX9L 1CSQA 2G9HD 2IX0A 3FP9A 4WJ4A 3GTLH 2I46A 4IURA 1AE2A 2F0WA 2RHQB 4DV4Q 2KUMA 3H3VC 1EIGA 3SK6A 1X55A 1Z6HA 2VQEL 1EQTA 3W1BA 4JBWA 1FYCA 1A15A 5CV9A 2ZM6Q 2ASBA 1FVIA 4ILWA 1GHJA 2AHOB 1V43A 3GTOH 2UXBL 1WTPA 2KCTA 2SDFA 2RQXA 1S5BD 1ONLA 4KKSA 2IHFA 3J81c 1CSPA 1YZ6A 2IW3A 2UXDQ 2Y0SB 1I4PA 1EY7A 1JICA 3D0FA 1XNQQ 3C46A 2B2TA 3MHBA 1HNWL 3MAQA 2QA4A 3TQYA 5DNFA 5M5WH 3FKIH 1B9MA 4O2DA 1LT6D 2RA4A 2KCMA 3FMCA 1HCZA 1DYQA 5EBCA 3M7GA 1R4PB 1EQQA 3LGJA 4C3IH 5IY0A 1SNMA 3DUZA 4N8X1 2LXJA 1YVCA 1MBYA 4RG1A 3K0XA 2QEJC 3A0JA 2NZOA 3FPUB 4PZ8A 1JWUD 3E0JA 1EEFD 1HA6A 3J7A5 4WRDA 4C3JG 2HIVA 2F52A 4KV6A 4H0LC 4JI0L 2MPMA 4DR6Q 1TWAH 5LL6X 1TVXA 1HR0Q 3CF5A 3L7ZC 1U0LA 4OONA 5ELBA 4DGZA 3GTMB 1HTLD 5IYCG 3DWQA 1ICWA 2R7FA 4LF8L 1LTRD 3ERSX 1SLJA 4KD3A 1EY8A 4PMBA 1STYA 4HIKA 1PH9A 1RHPA 5ELDA 3C1FA 1PTOD 4XYOA 5DAUA 1JWSD 5FJ8G 3D4RA 3EQLC 4JPBW 5IYBH 1IYVA 1VCIA 5GAGC 2Q2IA 1S5FD 5M3FB 4LFAQ 3NP8A 3GTGH 2XIWA 4LF5Q 2NVQB 2J4XA 2AWOA 1CKOA 2JEBI 4S3SA 4DPGA 3BVZA 3FEWX 5EPKA 4JI8Q 4ZKCB 4A93B 4GNXB 3PO3H 3OYYA 3TS0A 3J7AF 4AQYQ 4A3DG 5ISRA 4HJ8A 1QG7A 5TSSA 3S1MH 4OWWB 3VR3A 3L2PA 1IL8A 3K5MA 4ODGA 2I5MX 4XT3B 2L9HA 3ERQA 1J6QA 1VMCA 4KY5A 3H91A 5HGTA 1G291 3BZCA 4HMJA 1SE8A 3S15B 4I65A 2YU9B 3ICEA 2B2VA 2FJ2A 1HXYD 2Z4IA 5I9OA 4GZYC 2HDMA 4L5QA 5DM63 3HGBA 4F87A 2KJXA 3LNNA 5FK9C 2MGSA 2Q8RE 1VQOA 4O42A 2Q8IB 4DR4L 1W3SA 1T5XD 3AU7A 3C2PA 4KMUC 1Q7YC 3HOXG 2BA1A 1ZYRD 1XXGA 3W2DA 3HEJA 4B08A 1XPUA 1CKNB 1D1KA 2K05A 3ITPA 1QNUA 1VQKA 4OO1H 1SNOA 3TMEA 5A2QL 1OTCA 2JA7G 1CFMA 5C3EH 4O1NA 4DF7A 1JT8A 3I90A 3GTPH 3GTQB 1PRTD 2BH8A 4RMFA 5AJ3L 5A2QE 2FHTA 1SYEA 4NP5A 1PTOH 4BY1B 1B70B 3G7LA 2KOLA 3GDEA 2Z9HA 2PZTA 1TWCB 3CCEA 2K52A 2EXZA 4DU9A 4IUUA 5GADC 4IOAA 1IL2A 2R3ZA 3PUWA 4AYBG 3I4NG 1CK1A 1UUPA 3I91A 5ELNA 5IT9L 2PO4A 4A3BB 1ASZA 3H0GG 3A5UA 1VQGA 4TSSA 1E7ZA 1YI2A 2QDLA 2CVRA 1FNUA 4JV5Q 3S14H 3KK7A 1YITA 3SXHA 1K83B 5IT9E 2LSSA 3OTOL 1F9PA 2VL6A 1I50B 2WACA 1HNZQ 3U9OA 4LNQA 4GS3A 3R3OA 4A3IH 3TP6A 1I3QH 3NTHA 4DV0L 4OL7A 3R93A 1EYDA 2ZXPA 4DAPA 4KJOA 2NN6G 4C56C 1STEA 1EIFA 4QF4A 2F0DA 4IZ8A 1SNQA 2ES2A 3QOJA 5C5LA 1A62A 4P2CB 2WP8J 2ALYB 1C9OA 5L37A 2R92H 3PO2B 1K0SA 2WAQE 5EKLA 4JG2A 2XRQD 1NJIC 3S1RB 1XMOL 5EBDA 4LFBL 2EYHA 4IN3A 2JE6I 1U5KA 2O4XA 4QGUA 2KA7A 1TXYA 2X69A 2JJQA 2NZHA 4A3KH 1W6KA 3AFPA 3KF8B 2E74C 1WTXA 3P20A 5KNDA 1GVPA 4A3MH 1N33L 2XWBB 4KN4C 4JI3Q 3CMAA 1YEZA 1HUNA 2HDLA 1SYCA 4BBRG 2B39A 3WDNA 2HT1A 2A6HD 1B8AA 1J5EQ 1E22A 1EOVA 3ZYYX 4C3HG 3R2IA 5CYUA 3BYYB 2EYJA 2BCOA 4Z9CB 5I2YA 1UNSA 1BXTA 2B2YA 3M7NA 2E2JB 4A3CG 1MSGA 3JC66 1AH9A 4CDCC 2EPBA 4UP7A 4A3JG 1AP0A 3GO5A 1OXTA 3EROA 2IHEA 4DXFA 5JVG3 2I0QA 2WFWA 1Y69U 2DNEA 3HOVG 2E5LQ 5IGDA 4DR7L 3VR6A 2A68C 1A63A 1PYWD 2HQLA 3X3MA 4APVA 4JBKA 5HY6A 4DV2L 1Y14B 3MFYA 3FHWA 2B2UA 4A3EG 2BH2A 1TKWB 1IBLQ 4A3LG 1DJRD 5C4JB 1W6JA 1LABA 3CCLA 3MWYW 1IBML 5DEHA 4ZLTF 4RH6A 2JN4A 3BDCA 1KRTA 4C3JB 1BUVT 2I5HA 1MD2D 4H7BA 5FLXL 1RKNA 2F4IA 1LV9A 4KKUA 1VQ5A 4ZKBB 5IGFA 4RGNA 2D2CC 1H95A 4YIJA 1XNRL 3K58A 3T16A 2DGYA 3C1EA 3RZDH 1LTGD 1U4LA 4M8AA 2WINB 2PNHA 4RAUC 1JB7A 3MXNA 4OIJA 2E76C 3M3YH 3K5NA 4DR5L 5CGKA 2VY3A 5A35A 1K8GA 1NNXA 1VQ4A 4HCSA 4B3SL 4X62L 2D62A 1KHIA 4EQOA 4DV5Q 2RCFA 2SOBA 1ML0D 2R6GA 1IYUA 1XJVA 1F2YA 4KI0A 3E0EA 2VB2X 4EQ5A 2F0SA 2KECA 4C2MB 2WIIB 3KJOA 1PH1A 3MVVA 4CDDC 2GVBA 1IKLA 1C4QA 1L1OB 1QNKA 2ZXOA 3HOYB 4X6AH 2PW7A 1TWGB 3S1QH 2JA5H 2HUGA 4ZK9B 5IGCA 3RNUA 3RMHA 4BY7G 2RSNA 4POGA 1ZXTA 4UPAA 1TWHB 3P75A 4KY6A 2RBMA 4OIKA 3G48A 1DXMA 3UI2A 4DAMA 2L15A 2K03A 3PUYA 1C8CA 4CDEC 1NR2A 3JAMi 2J0TD 2MO0A 1SFOB 3FPPA 2PCFB 1A2TA 2NN6I 4K8JA 1H9MA 5C6AA 2EY6A 1SYDA 2QDBA 5IT9c 2EDGA 1UE7A 2WV6D 2B8GA 1N32L 2PI2E 1AZQA 1VQAA 1T9HA 3GQBA 2E2DC 1EU4A 1GJXA 3E9HA 4NKLA 1C0AA 4RGMA 3HOXB 1G2SA 2K7VA 2B3GA 3VDYA 3M4OH 3JAME 4JI6Q 4DV4L 4BA2I 2ZJQA 4NXNQ 3A56A 3CRLC 2K5DA 3HS0C 3DEPA 4QIWE 4EGVA 3CRKC 1IYJB 4K0KL 1L0YB 2BA0A 3J81L 2J7ZA 4EQNA 1JC7A 1WOCA 1GOZA 2B63B 3PGZA 4GLVB 3VYUA 2PYKA 3A8JE 5CBEE 3RN5A 4R8IA 2E2IH 1HPCA 4IFDG 1R4QB 3N6RA 3PIP3 2UXDL 1CTMA 1EOTA 2EJFC 1PYBA 1PFMA 4Q0FA 4AYBB 1UEAB 4LF4L 3V05A 4KN7C 4OWXB 3LWEA 3DHQA 3A7LA 3H0GB 4J8QA 5G3LF 3HOZG 1MHWC 2NVYB 1Y1VH 2F0OA 3GTLB 2QGQA 2CQOA 4DV3Q 1BCPD 1Y1WH 3NQIA 1ZEQX 2JA8G 1SMYD 1SYGA 5C44G 1B1ZA 5JVH3 1NE3A 4A93G 5KEEA 4YHHQ 3GTOB 5KYLA 1BKBA 3IKJA 4IPHA 4LAAA 3SR1A 5IP7G 3F2UA 2WKDA 4JI4Q 1D6EC 5J3BA 4FYDA 2UUCQ 2MNAA 1WVLA 3X3NA 1XPOA 3S17B 1SMXA 1D7QA 4FP5D 2K01A 4LUVA 1D2BA 3G6EA 2CW0C 1J9OA 1YHAA 3CMEA 1JB3A 1HR0L 1EZ6A 3FKIB 1Q86C 1CA6A 4CDFC 2EIFA 2AUJD 4DR3Q 1CUKA 1EY0A 3TS2A 5EGTA 2BOSA 2JXMB 3BVGA 4JVZA 3S2HH 4Y52H 3PSIA 5CV7A 4FF4A 1SAPA 3QOLA 1RTNA 4BA1I 2HHHL 4EX5A 4DV1Q 1FGBD 2ZJRA 1IKMA 1ILQA 1L1OC 1U9RA 2F3IA 4A3FG 1G51A 2AUKA 2F0MA 3MFGA 2NVXH 1GHKA 2X6LA 4LF5L 1RTOA 5BN3A 1IW7D 5JPNC 2KHSA 1FR3A 1YHQA 1GUSA 1EU3A 2ICEC 4QCLA 3T1YQ 2PMZE 2JA6H 2MO1A 2WB1E 4C3HB 2B2TC 3QG1A 3I2ZA 2CWPA 2R61A 4P72A 4LF9Q 4BWGB 2F0NA 4OEMB 2H1EA 5GAEC 5JAVA 1OXXK 1LO5D 3E3XA 2SEBD 3CCSA 1SNPA 4A3BG 3VYTA 1DGSA 3MXGA 4DUZL 3K81C 4H13C 3GTGB 4A3EB 2PPBC 1QUQA 1GUOA 3ND9A 2IX1A 4IUPA 2QKIC 1HZAA 4YY3Q 3CU7A 3STBD 2L4NA 4HSVA 4YWKA 1NSNS 1EYCA 2UXCL 2YTVA 5IGGA 5IYDG 3L9AX 1HZCA 3OMCA 1ZKOA 1IBKQ 1YHBA 1F2ZA 1PA6A 3TN2A 2V4DA 1DONA 4X65Q 4O0AA 1N34L 3KF6A 4R8NA 4I7ZC 1N8RC 2O2LD 2Z1CA 1BQQT 1KDBA 3CHBD 1BBUA 5E1FA 2Z6BA 2RHSB 3CCJA 3AEVA 4OGQC 4B9XA 1RCVD 4NXMQ 1D5XC 3EJIA 1STHA 1VQPA 1ENAA 1KLGD 4JI2L 3TRZA 4IFDI 3CXCA 4MTKA 1PMRA 3JAMc 4JV5L 4QB4A 3I4MG 2OXPA 1A0IA 4DUYL 1B2TA 2R7ZH 3V2TA 5C3EB 1EIYB 3BU2A 3BYTB 1STBA 3TBIB 4BY7B 5ELFA 1NMFA 3HOUH 3VA5A 2CH4W 2B2VC 1E2VA 2F0EA 1IZ6A 2NTTA 2Z0SA 4UAIA 1VQ6A 4GKJQ 1B7YB 5LL6S 2PI2A 4LK1C 1KLUD 3CQZB 3TP5A 1S3OA 4G57A 1Q81C 5JOBA 1RDPD 1TU2B 2EY2A 4LWCA 2NVTH 3S14B 4BBSG 4RCOA 2A6ED 4UHVA 3SHLA 1TR5A 3RUZA 1UE6A 4Y7NH 4JI1L 5BR8Q 4FF1A 3Q8DA 3FVQA 3MTSA 1SNCA 3GTJB 4C1NI 1PH6A 4ZRZA 3BDOA 3PUZA 2EE1A 1LTSD 1HQMC 1A8VA 1EY6A 3SEBA 4MHEA 2EY1A 2A5HA 4ZQ3A 1OO9B 3I72A 3K6OA 1VQMA 4JI3L 1WCMG 4GKKQ 2Y0SE 5DM73 1CQFA 4WORA 4IO9A 2Q2UA 4V190 1G6ZA 1X6OA 3BDLA 2IY5B 1I94L 1C48A 3PUVA 1EY4A 1R9TH 2NYZD 4B3TQ 1SDFA 3UDGA 2KEEA 2KVMA 3CCQA 4J1MA 5I6YA 5C0XG 3Q22A 5IWAQ 3EBEA 4DR2Q 3HOZB 5I9PA 5KIXA 1QVGA 1B50A 5M3MG 1SYBA 4RGOS 4B9WA 2YTXA 5JJKA 2JA8B 2YYZA 2K1BA 5C44B 1CKMA 2F0HA 2JA9A 2CQAA 3CCMA 1VQDA 2PW5A 3I56A 3HOWG 1JWMD 2KCCA 3HOYG 3D4DA 1PH5A 5J22A 3F1ZA 2SNSA 5JEAG 1GUWA 2NTSA 1KAAA 5COYA 1B44D 1WD1A 4YCUA 4DV6L 1ILPA 2Z6KA 1JORA 2DY7A 5M5XB 4B3RQ 1CQVA 2E8GA 5C4XH 4LFCQ 1G8ZD 1EYGA 4NDXA 4OXPA 2R93G 2OQ0A 1S5CD 2VUMH 4IPGA 1ESRA 1AEXA 3KBXA 1H9JA 1V8QA 3DXJC 1H9SB 4LW1A 5HGQA 1JJGA 2OF1A 1K3BC 5FO7B 5LHY1 1I6HB 1NMGA 1KQSA 1HZ9A 2F0IA 1QJOA 4IFDJ 2DN8A 5EQ0A 4DV5L 3PIOA 2F03A 4KK7A 1EL0A 5CV4A 4V0BA 2EYOA 4A3FB 1UAPA 3AB9A 1CM9A 4IUQA 2CHBD 2Q8TA 2ZXRA 2B2YC 4XTCS 5CORA 4HIOA 4A3GH 1PTOC 5C3WA 1L2FA 1ESFA 3U4VA 2B63G 1KIXA 5JJLA 2RDFA 3T51B 3E6ZX 4LF7Q 5IOCA 2PZWA 3O13A 2KENA 1MKHA 3M3YB 3IFDA 1XTDA 1ET6A 4JBMA 3DLLA 1UE1A 2B2UC 1X3EA 4X64L 2OEOA 2MP1A 1YJ9A 3CC7A 4LF6L 3CCRA 3I8ZA 5FLMH 5EPLA 1L0WA 3OOCA 3CD6A 5EAYA 3T56B 2ZJPA 1HNXQ 2HCCA 3S1NH 1XTCD 1JOQA 4MTNA 4XIGS 1FD7D 3D4WA 4OX9Q 3A54A 3KUPA 1VQJA 3AFQA 3D8GA 2AKWB 3HKZE 4CKCA 3H09A 4M1UB 2WAQB 2OQKA 1WI5A 2A74C 2IL8A 1TS3A 3NTKA 2VQEQ 1WTWA 4L8JA 1MSHA 5IE8A 1LM0A 4JI5L 5CMDA 1AZPA 4K5VA 1EYAA 2ENBA 4GN5A 3HG9A 2EJMA 2L12A 2M2LA 4LMQD 1XWEA 5J1ZA 1Y8OB 1ZYRC 3HFZB 4R4TA 1N9WA 3FKIG 3PV0A 3CW2C 2L5TA 2NBFA 4UP8A 2RCNA 4KHVA 2EYPA 4C3IG 2A69D 2F0TA 5JPMC 2B29A 4B3ML 1RD9D 1PRTC 1H9KA 1JJCB 1PLFA 1E2WA 2C9OA 3NPPA 4K6LA 4N9TA 3NE5B 5C0XI 4KKTA 3I4MB 3M4OB 1MGSA 5LMNW 2VW9A 3VA7A 2F0QA 2FXQA 2UU9L 1VF5C 2DY8A 4YHHL 4JI7Q 1SR3A 3KDFA 1LT5D 1I4GA 1KDAA 1EFWA 1E3PA 3H6MA 2E2IB 5M3FH 1GO3E 2GVAA 4BXXH 2NVQH 3BZKA 2PQAB 1GUNA 3Q6SA 1TS4A 4JI0Q 2E75C 4KHPL 4JYAL 5IYBG 4BBSB 3J81j 1EY9A 3L0OA 2L0CA 4HAEA 3VR2A 4LF8Q 3CPFA 3TZDA 2XWJB 1O7YA 1NAPA 2LMCB 2UUBL 2RF4A 3DWAA 4R1JA 3ULLA 3PO3G 4FXGC 4IJHA 3Q0AA 3S15H 3T4AC 3OPOA 2YU9H 1I5FA 4KTAA 5NUCA 3RZOB 2EXDA 4HSPA 1VQCA 1VQHA 1WCMB 5K36H 4A4IA 3D6WA 2C35B 4IUTA 3K0YA 1Q82C 1Q90A 3GV6A 3G71A 1PH2A 3Q23A 3CC4A 3T1YL 2D0OA 3ND8A 2PNRC 1SE3A 3A5ZB 2JK8A 1HFGA 3EN2A 4QQBX 3A74A 5EKIA 3ZJYC 1EZ8A 2XRSD 1KNAA 5I4DA 1JOKA 3G6JB 1RF2D 3TEHB 1Q12A 1NY4A 4F88A 3UDIA 3WOEA 5M3MB 1OXSC 1C7YA 4KD4A 3S2HB 2AWNA 4L5SA 3E9IA 3I4OA 2ATWA 2A6HC 3GTQH 1RIPA 2CWAA 3F2DA 1GM5A 3ONAB 1LTLA 1HHVA 3GTKB 4J15A 4GOPA 5D3DA 4BY1H 4NW2A 3HOWB 4OO1G 4HEDA 5C3EG 4YY3L 3I55A 3VYRA 4DR4Q 2VXWA 3MC0B 1PXUA 4RWSC 3RD4A 1Q3LA 4YWMA 1K83H 1FJGL 1IBKL 1KL9A 1A6XA 1BCPB 3KJPA 1I50H 3BS1A 3CC2A 1N36L 1JMCA 1Q46A 2R93B 4PMWA 2MFIA 1G2TA 3M4YA 4IOCA 1KTKA 2Z4HA 2VQFL 1U4RA 4DV7L 2Z8LA 4HJAA 1GKHA 4GNXA 5IP9H 1PFSA 4X3TA 1MJCA 2E2HB 2F0FA 3JAML 3WWVA 4K2LA 4A3IG 1F77A 2F4VQ 5C0XJ 1A3TA 5FOBB 3KLSA 5DLQE 2B2WC 1FL0A 4RHRA 2IT1A 3EVQA 3D6CA 2DNCA 1B3AA 1DM0B 4L63B 4NB3A 2GA4B 3CCUA 3PO2H 1WTQA 4GN4B 3S1RH 4JC0A 3TDQA 2ZM6L 1DOMA 2CW0D 3QR8A 2NUCA 2PZUA 3R2TA 2R92G 5JEAJ 3U9SA 3DMUA 4FDBA 1LTBD 1XNQL 4GKJL 1DD2A 3NSWA 1F9QA 1B53A 1CKNA 3EIVA 2EOTA 4A3KG 1PHJA 4HTHA 1KDCA 2XN9C 1FNVA 4RKBA 1JE5A 5F2DA 1STGA 2BE5D 4IJLA 1VQ8A 4PV1C 4A3MG 1FNWA 3NWSA 1VF7A 2KHJA 4N8FA 4LFBQ 2GN5A 4ZYSA 3EA6A 3DWPA 1CZGA 1X65A 1PZJD 2ZTCA 1ET9A 1BNZA 3H15A 4OWTB 2EJGC 2N55A 1U4PA 3HOUB 4TRDA 1M90C 3K5OA 1LUZA 1PH7A 4XQQA 1N33Q 1LACA 1V9PA 5C5MA 1Y8PB 3NTIA 4G7OC 4GKKL 3H94A 4P75A 2EYLA 3M85A 4LUOA 4DR6L 1UEBA 1B9NA 3SK5A 5I2XA 5C4JH 2OTJA 1B4OA 2FFKB 1HUMA 3DEOA 5M5WB 4HJ7A 3UE1A 2A1AA 2RSOA 4C3IB 4C3JH 4DR2L 4K5XA 3A55A 1VQLA 1QOHA 2PMZB 4Y7NB 4DK6C 2WB1B 3NELA 1BR9A 1WYDA 3S2DH 3URYA 4QY7A 1O7LA 4DR7Q 5IYCH 3K5LA 4LFAL 5EKKA 1F9RA 1YNJD 1SJED 1JJ2A 3J7AV 1S5DD 1ICFB 1PZKD 3GD7A 1WTOA 4JI8L 1VMPA 4DKAC 1BDOA 2L11A 3K57A 1E1TA 2EYMA 4K2KA 5FJ8H 3PUXA 1BF4A 1TWAB 3OIPA 3K7AH 1VQBA 5IIFA 1P8LA 1YNND 1KAWA 4AQYL 3DM1A 1K0RA 1IBMQ 4OO1I 1BCPC 5H1SE 5T1IA 2OTLA 1GUGA 2G5DA 3GP7A 4DAYA 1SMYC 1X3FA 1PRTF 4NPSA 2HIXA 3KF8A 3IFTA 2AQ3B 1MIUA 4G4KA 2WKCA 1D5ZC 1CT1D 2DJGC 3NUCA 1IHZA 4A3DH 1EUJA 1RL2A 1TWHH 3HKZG 4FF2A 3OSOA 4OHJA 3J7ZC 2RDGA 2X6GA 1TY0A 4DFAA 4R9WA 3PO3B 1TIID 2D9UA 3I70A 1SFOH 4B3SQ 4X62Q 5LMNQ 5E4XA 5D14A 1G91A 2JA5G 4DK1A 3W1GA 3OWFA 4I7AA 2QW7A 1L0XB 2WAQG 1WD0A 3S1MB 1SXTA 1SBBB 3M4QA 4WJWA 5C4XB 1RODA 3C3LA 2F0JA 4F7XA 4U68A 4JW0A 2VUMB 2PQEA 2CCZA 3HOXH 4AIMA 3TREA 5K5PA 4LF7L 3G4SA 1VS0A 1PV4A 5KYIA 2JA7H 2M9VA 1IW7C 1SE2A 3MEFA 1B3QA 1I4QA 3J80i 1UWVA 4RCNA 3K59A 1TY2A 3MXPA 1QILA 5E7NA 1XMQQ 2VNUD 2N49A 2K28A 2UUAQ 1BVSA 3EFXD 2EQSA 2MQHA 1HNXL 4LUZA 1N32Q 5BN5A 1I4HA 1K8AC 1Z9FA 1EWCA 3KDFB 4R4CA 1HNZL 2Z6KC 4K8IA 3I4NH 1ENFA 2NZ1D 1WTHA 4DK0A 3J80L 3GTPB 3H0GH 2NVYH 1O7IA 3OHXC 3T1HQ 3U58A 1E1OA 1PTOB 2K04A 3J80E 1PH8A 3KLWA 2N78A 3K7UC 1HRJA 2AMCB 1S40A 4K0KQ 4PNYA 3H3VH 2ZTDA 2K14A 3STBC 3SDZA 1I4XA 4P71A 3QB3A 1Y1VG 2VB3X 1L1OA 2NN6H 4L5RC 3PIPA 4CJ2C 3KOJA 1Y1WG 3SVMA 1SRUA 3PCOB 3S1NB 4IPDA 3S17H 1AN8A 1EWHA 1F2MA 4A3IB 4LF4Q 1X56A 1I3QB 3M9BA 4ME5A 1CHQD 1LTID 1TS2A 3ULPA 4HIMA 3F2BA 1FGUA 3TP7A 2KCNA 4CGYB 3VYSA 5LMUQ 1NCVA 1NTGA 3S16H 5GAHC 1IXRA 4XT1B 3A7AB 2QCPX 4PQXA 3NXWA 4R4QA 3NQTA 4HN7A 3MXNB 4JI7L 3V96A 2R92B 1GXDC 1J5EL 1CI3M 2K75A 2N3SA 1Q8KA 1K3RA 2NWGA 3W3AA 4BS9A 4DXGA 3I4LA 3PMFA 4GN3B 1HA5A 4C1NK 4BBRH 1TQOA 4IQZA 1TT2A 4X66Q 4DR1Q 4GOPB 2RKSA 4JOIA 4A3KB 2FMCA 1SNDA 3Q24A 4DNTB 2E5LL 1KXLA 4C3HH 3I3CA 2BDOA 1YJWA 5G3LD 1O78A 1PRTB 4A3MB 4YCVA 1KRSA 4A3CH 2K5NA 4YCWA 4A3JH 1EQRA 2K5VA 1IBLL 1Y8NB 5ELCA 2A19A 2JA6G 3HOVH 3UE0A 4CBVA 3U50C 3TZUA 4E6IA 2HHHQ 4YWLA 4DNIA 2A6EC 4POFA 2P5ZX 4A3EH 5M5YH 2N88A 5EPJA 1TWFH 4L5TA 4A3LH 1SEBD 4A75A 5CV6A 1A2UA 1VDZA 2G9DA 4P74A 4QUFA 2HQEA 1AFPA 4FXDA 3MZ5A 1A3VA 1E2ZA 1Z47A 3S9WA 4RHSA 2EZVA 3KYHC 4DA2A 1LYLA 4X3KA 3D31A 4RA8A 4GLAC 4IUNA 1MI2A 3GV3A 5JJIA 4ZUIA 4DUZQ 2Q2TA 4WFN3 4CJ1B 1VQ9A 3RN2A 1W2BA 4H44C 1PH3A 1O7ZA 2DJFC 3AQQA 1VQ7A 3UDXA 4Q5VA 3RZDB 2UXCQ 1D8LA 1X32A 3OMGA 5BN4A 3J7YW 3QIAA 2LY7A 2IJ0A 1PFNA 2DUDA 5ELEA 2K5HA 3HRZC 2K4KA 2MUYA 4K14A 1KC8C 1LT4D 1N34Q 4HIDA 4BY7H 3QO2A 3HKZB 4GLXA 2VZAA 1JQYD 3P7JA 2L55A 2JQOA 4ULLA 1NBWA 1BBXC 1JOOA 2R7ZG 1CZWA 4ME3A 3S1QB 1OXUA 4F8MA 2FINB 1BCPF 2KBNA 1S4ZA 2JA5B 2F4VL 3CQZH 2OT2A 4JI2Q 4DAVA 2AQ1B 4OELB 2LS01 3J80c 4JI6L 3HOUG 4NXNL 1HFNA 5EJWA 5CV5A 2D5DA 2VS1A 4ZUJA 4DUYQ 1PZID 1SE4A 4XQNA 3NBHA 4QL5A 1U4MA 2KQ3A 1X3PA 2UXBQ 4R4IA 2YV5A 3CPWA 3A8IE 3GTJH 3D3RA 4QMGA 2A68D 1XPRA 3MEHA 4P73A 1NUCA 4GOPC 3VR5A 4H02A 1X9NA 1M1KC 4FF3A 3P1HA 4WJ3M 4UDUC 1S72A 3SGIA 2LKVA 2WB1G 1DOLA 1UE5A 1HNWQ 3PF5A 4K5WA 3K80C 4X3SA 4DV3L 3GTMH 4IFDH 2F1MA 2F3VA 4EQPA 5CR3A 1V1PA 2LXKA 2LFNA 2O5IC 1K73C 5HURA 3HOZH 1D1IA 3T13A 4JI1Q 4FNFA 1V1OA 1V1QA 4DAYB 1M4VA 4DN4M 4JI4L 1EQVA 5KNCA 2F0GA 2I5LX 4QUCA 2UUCL 1HZBA 2XVSA 3I7FA 2JA8H 4GNXC 1VQFA 5C44H 1HQRD 2L1BA 1H9RA 3U4ZA 2XSCA 1JE4A 4A76A 1XX8A 2XNAC 5C4ZA 1PVOA 4A93H 1I94Q 1Y1VB 2TSSA 1QUQB 5IP7H 4ALPA 1I6VC 1Y1WB 5E4WC 4KY7A 1QE6A 4KLKA 4DR3L 4EVOA 4TKOB 3PQIA 5M5XH 4RGTA 3R8BA 2AQ2B 1KABA 4X3UA 4U673 2QEXA 1SSOA 3OIQA 4DV1L 1P16A 1VQIA 5GROA 2JEAI 2QILA 1GUTA 1HJPA 4N9PA 3KF6B 1WTVA 4PMCA 1I6HH 2A69C 4CJ0B 5KRUA 5C4XG 3QJYA 2VUMG 5CC4A 4A3FH 1DCZA 3AYHB 1JCKB 1YIJA 3OW2A 4LF9L 4DV6Q 4CHTB 1AE3A 3NWTA 2F0PA 4HJ9A 1G6PA 1K9MC 2H4OA 3IRBA 3S2DB 3WOFA 2EY5A 2NVXB 1Q1BA 1SJHD 1RJTA 2OCEA 5FLXE 4G7ZC 1TWCH 5I6WA 3KLRA 4UP9A 1HH2P 2K6AA 1EIHA 2JA6B 2D0PA 1HTPA 4A3GG 4A3BH 3NHHA 3RLFA 5LMNL 3K7AB 5C3XA 4MN3A 2K33A 3CP0A 1WFQA 3KBGA 4QJFA 1BO0A 2JSOA 1ENCA 3BG3A 2CH4A 4FVMA 4X65L 4XYQA 2F0VA 5J39A 1S5ED 3S24A 5FO9B 5AJ3Q 3UDFA 2KHIA 1NR4A 1LT3D 5FLMG 1DOKA 2H5XA 4A3DB 5IYDH 4QIWB 3DM3A 1TS5A 5T1GA 4MNOA 2ZTEA 3NBIA 4NXML 2ID0A 3H3VI 1HR0W 2Y0SG 5D65A 1F9SA 1YBYA 3MA2B 2YTYA 4X64Q 1XMQL 4LF6Q 2UUAL 1D5MC 2A73B 1SN8A 2RDHA 3BVMA 4XXEA 4J6HA 3OTOQ 3L3OC 3QWNA 1DZ1A 1E24A 3CAMA 1YJNA 1ASYA 1EY5A 1H9SA 3J81i 4ZAIA 4G7HC 3M4PA 4K6DA 3KFUA 4DV0Q 2JP1A 5IGEA 3T1HL 3I4MH 4PZ6A 2HCIA 1O80A 1K8MA 3HKSA 2JA7B 3ER0A 3NENA 4FO2A 4JI5Q 2FMMA 5ELOA 2SNMA 3FRPB 1QZHA 1VQEA 2IPKD 4PZ7A 3RLOA 5E3FA 3J81E 1PTOF 2E2JH 1XMOQ 2R7ZB 2MJ8A 3NK9A 2K32A 3I4NB 4AH6A 2ICIA 2EYFA 3B6YA 2XGTA 1STNA 3MXUA 5AFWA 3ULJA 3W5OA 4MIUA 3K8AA 5BR8L 4B3MQ 4TQUS 5D3IB 4IUVA 5JJZA 3A8KE 3I73A 1PH4A 3IL8A 2QF7A 4BBSH 5LMUL 1XYIA 1QWYA 1EFID 4PG3A 5M3FG 2IX3A 4BXXG 1WTRA 5IODA 4AYBE 3F2CA 4HMIA 1SYFA 2UU9Q 4IPCA 4B3TL 2KEDA 2I07B 5GQOA 1JR0D 3F8TA 2NVTB 2B8FA 1X3QA 1EEID 3RZOH 1LLRD
chains in the Genus database with same CATH topology
3STBC 4JBJA 1BBWA 2KENA 1WCMH 1MKHA 4P71A 5IWAL 1H95A 1Y1VG 1XNRL 1XTDA 4JBMA 2DGYA 3RZDH 1L1OA 3DLLA 1UE1A 4L5RC 2K50A 4X66L 1X3EA 3KOJA 3PIPA 4DR1L 4X64L 1Y1WG 1YJ9A 2PNHA 1JB7A 1SRUA 3PCOB 1OXVA 4DK3C 3BJUA 3CC7A 3M3YH 4IPDA 4LF6L 1VQ5A 3S17H 3CCRA 4DR5L 2R7DA 2VY3A 5FLMH 1L0WA 4KHPQ 1QVCA 4JYAQ 3NEMA 1K8GA 3CD6A 5EAYA 2ZJPA 1X56A 1VQ4A 4LF4Q 4B3SL 4X62L 3M9BA 1HNXQ 2D62A 1KHIA 4DV5Q 3ULPA 3S1NH 4HIMA 4DV2Q 5K36G 2R6GA 1XJVA 3F2BA 4MTNA 4KI0A 4XIGS 1FGUA 2UUBQ 1QZGA 5LMUQ 3E0EA 4EQ5A 4R4OA 5M3MH 3KJOA 4OX9Q 1NTGA 1VQJA 1PH1A 3AFQA 2Q2HA 1IXRA 5GAHC 3S16H 2GVBA 1QVFA 2CFMA 1GD7A 2AKWB 1L1OB 3HKZE 1MJEA 4X6AH 2OQKA 1WI5A 1Q1EA 3GTKH 3PF4A 4R4QA 3S1QH 2N8NA 3MXNB 4C2MH 1SROA 4UY8C 4JI7L 2JA5H 2VQEQ 1J5EL 4HJ5A 3RNUA 3HOWH 1X54A 4BY7G 4POGA 4UPAA 4LFCL 2N3SA 2K75A 3HOYH 4B3RL 5IE8A 1LM0A 4JI5L 1Q8KA 4KHZA 1TWGH 1K3RA 3G48A 4DAMA 2L15A 4GN5A 3PUYA 3CCVA 1XNRQ 4GN3B 4BBRH 3JAMi 4X66Q 2MO0A 5FLXc 4DR1Q 3HFZB 4GOPB 4IOAA 4R4TA 1N9WA 4JOIA 2NN6I 3FKIG 4BY1G 1PYSB 3PV0A 3CW2C 2E5LL 4DR5Q 1KXLA 4C3HH 2CKZB 4UP8A 2XTIA 2RCNA 1YJWA 1WJJA 5IT9c 2B29A 4B3ML 1UE7A 1N32L 2R93H 1X3GA 4YCVA 1KRSA 2PI2E 4A3CH 1VQAA 1JJCB 2K5NA 1T9HA 4YCWA 3NBHB 4A3JH 5C0XI 2PQAA 1EQRA 2K5VA 1IBLL 3E9HA 1C0AA 5LMNW 2A19A 2VW9A 2JA6G 3HOVH 3UE0A 3U50C 2B3GA 3VDYA 2E2HH 3M4OH 2HHHQ 4YWLA 2FXQA 4DNIA 4JI6Q 4BA2I 4DV4L 2UU9L 2ZJQA 4NXNQ 4QIWE 4YHHL 4JI7Q 4POFA 2V1CC 1EWIA 4JOIC 4A3EH 2A8VA 1SR3A 5M5YH 3KDFA 1TWFH 1IYJB 1EFWA 4K0KL 1E3PA 2BA0A 4L5TA 4A3LH 5M3FH 4A75A 4JCVE 1VQNA 1FJGQ 1GO3E 1WOCA 2GVAA 5IP9G 2NVQH 4MZ9A 4P74A 4BXXH 3PGZA 4GLVB 3BZKA 2PQAB 3RN5A 1N36Q 2E2IH 1YNXA 4IFDG 4JI0Q 2UXDL 1Z47A 2VQFQ 2B63H 4KHPL 4JYAL 1PYBA 3KYHC 5IYBG 3J81j 3L0OA 4DV7Q 4TVAB 4LF4L 4OWXB 3HOZG 1LYLA 3PO2G 3D31A 4LF8Q 4GLAC 1Y1VH 3CPFA 3RLNA 2OWOA 5JJIA 2QGQA 2UUBL 1KD1C 4DUZQ 2CQOA 2RF4A 4DV3Q 2Q2TA 1Y1WH 3RR5A 4OX9L 4R1JA 3ULLA 3PO3G 1CSQA 2IX0A 3FP9A 4WJ4A 4IJHA 3GTLH 2JA8G 5C44G 3S15H 1AE2A 1VQ9A 3RN2A 1W2BA 2YU9H 2RHQB 1I5FA 4DV4Q 2EXDA 4A93G 1NE3A 1VQCA 1VQHA 1PH3A 4YHHQ 2VQEL 1X55A 4A4IA 3W1BA 2C35B 3AQQA 4JBWA 1BKBA 3UDXA 4IPHA 1Q82C 3G71A 1VQ7A 1PH2A 4LF7Q 5IP7G 1D8LA 2ZM6Q 2ASBA 2UXCQ 1FVIA 4JI4Q 3CC4A 5J3BA 3T1YL 2AHOB 1V43A 2D0OA 2UUCQ 3GTOH 2UXBL 2MNAA 1XPOA 3A5ZB 2DUDA 2KCTA 1SMXA 2JK8A 1D7QA 3EN2A 2K5HA 4QQBX 4LUVA 3A74A 3ZJYC 3G6EA 2K4KA 2IHFA 3J81c 1KC8C 1CSPA 1A63A 1YHAA 1YZ6A 2UXDQ 1N34Q 3CMEA 3TEHB 4HIDA 4BY7H 1Q12A 1NY4A 1HR0L 3D0FA 4GLXA 2VZAA 1XNQQ 3UDIA 1C7YA 1OXSC 2JQOA 1Q86C 2AWNA 4L5SA 3E9IA 3I4OA 1NBWA 2EIFA 2ATWA 3GTQH 1RIPA 2CWAA 3F2DA 1GM5A 2R7ZG 1HNWL 4DR3Q 1LTLA 1CUKA 4ME3A 2QA4A 3TQYA 4J15A 4GOPA 3TS2A 5M5WH 1OXUA 4Y52H 3S2HH 3FKIH 4O2DA 4BY1H 2KBNA 2KCMA 2F4VL 3CQZH 3PSIA 4JI2Q 1EQQA 3LGJA 4BA1I 4C3IH 2HHHL 4OO1G 4EX5A 5IY0A 2ZJRA 4DV1Q 4JI6L 3J80c 3HOUG 1L1OC 2F3IA 2LXJA 4NXNL 5C3EG 4YY3L 1G51A 4A3FG 2NVXH 3I55A 2VS1A 1YVCA 4LF5L 4DUYQ 4DR4Q 4RG1A 3K0XA 3A0JA 4PZ8A 2NZOA 4QL5A 1YHQA 3T1YQ 2PMZE 2UXBQ 2JA6H 2MO1A 1K83H 2WB1E 4R4IA 2YV5A 4YWMA 1FJGL 3CPWA 3GTJH 1IBKL 1KL9A 3J7A5 2HIVA 3I2ZA 3KJPA 1I50H 3CC2A 2F52A 1N36L 2CWPA 1Q46A 1XPRA 4P73A 1JMCA 4P72A 2MFIA 4PMWA 4GOPC 4H02A 4JI0L 4LF9Q 4DR6Q 1X9NA 4IOCA 1M1KC 1TWAH 2VQFL 4WJ3M 1HR0Q 4DV7L 3CF5A 3L7ZC 4HJAA 1GKHA 1U0LA 4OONA 3SGIA 1S72A 5GAEC 5IYCG 4GNXA 1OXXK 2R7FA 5IP9H 4LF8L 1PFSA 2WB1G 3ERSX 3CCSA 1UE5A 4A3BG 1HNWQ 1SLJA 1MJCA 3PF5A 4HIKA 1DGSA 1PH9A 3K80C 4DUZL 3K81C 3WWVA 4DV3L 3GTMH 4A3IG 2F4VQ 5C0XJ 5FJ8G 5DLQE 1QUQA 1FL0A 5IYBH 2IT1A 2IX1A 2LXKA 1VCIA 1K73C 5GAGC 3HOZH 1HZAA 2Q2IA 4YY3Q 3CCUA 4NB3A 4LFAQ 3GTGH 3STBD 4JI1Q 3PO2H 4LF5Q 2AWOA 1CKOA 2JEBI 1V1QA 4GN4B 4YWKA 4DAYB 4JC0A 3S1RH 2UXCL 4DPGA 2ZM6L 4JI8Q 2YTVA 4JI4L 4GNXB 3PO3H 2I5LX 3OYYA 1HZCA 5IYDG 1HZBA 2UUCL 3I7FA 2JA8H 3TS0A 4GNXC 1VQFA 5C44H 1IBKQ 1YHBA 3U4ZA 4A76A 1PVOA 4AQYQ 2R92G 1PA6A 4A93H 4A3DG 4HJ8A 1I94Q 4X65Q 5JEAJ 4O0AA 1N34L 3KF6A 4FDBA 1N8RC 3S1MH 1QUQB 4OWWB 3L2PA 5IP7H 1XNQL 4ALPA 2I5MX 1J6QA 4GKJL 1BBUA 1G291 3BZCA 2RHSB 1CKNA 1SE8A 3EIVA 4KLKA 3CCJA 4A3KG 1PHJA 4DR3L 3AEVA 3ICEA 4NXMQ 5M5XH 1JE5A 4IJLA 1VQ8A 1VQPA 4L5QA 4A3MG 4JI2L 2QEXA 3TRZA 4IFDI 2KHJA 3CXCA 4LFBQ 2GN5A 3JAMc 4DV1L 1P16A 1VQIA 5GROA 4JV5L 2JEAI 3I4MG 1HJPA 1X65A 1VQOA 1A0IA 3KF6B 4DUYL 4DR4L 1I6HH 1W3SA 2ZTCA 2R7ZH 3H15A 4OWTB 1Q7YC 3HOXG 2BA1A 1EIYB 3BU2A 5C4XG 1M90C 1PH7A 1LUZA 1XPUA 1CKNB 1N33Q 1V9PA 1VQKA 2VUMG 1OTCA 2JA7G 4GKKL 1NMFA 3HOUH 4P75A 5C3EH 4A3FH 1JT8A 3AYHB 3M85A 4LUOA 1YIJA 3OW2A 4LF9L 4DV6Q 4DR6L 3GTPH 1AE3A 1UEBA 1IZ6A 2BH8A 4RMFA 5AJ3L 5C4JH 2OTJA 2Z0SA 1VQ6A 4HJ7A 1B7YB 4GKJQ 1B70B 3UE1A 2PI2A 4HJ9A 1G6PA 1K9MC 3IRBA 1S3OA 2A1AA 3GDEA 1Q81C 4C3JH 3CCEA 2K52A 4DR2L 4LWCA 5GADC 1IL2A 2NVTH 3PUWA 1VQLA 4AYBG 3I4NG 1Q1BA 4BBSG 5ELNA 4DK6C 2OCEA 3NELA 1ASZA 1WYDA 3H0GG 1VQGA 3A5UA 1TWCH 3S2DH 1E7ZA 4QY7A 4UP9A 1YI2A 1HH2P 4DR7Q 4JV5Q 1UE6A 5IYCH 3S14H 1YITA 4LFAL 4Y7NH 1JJ2A 4JI1L 2D0PA 2LSSA 5BR8Q 4A3GG 3Q8DA 3OTOL 5LMNL 3RLFA 4A3BH 2VL6A 3GD7A 1PH6A 4JI8L 3CP0A 1WFQA 4DKAC 1HNZQ 3PUZA 4QJFA 4GS3A 4LNQA 4A3IH 1E1TA 1A8VA 5FJ8H 3PUXA 1I3QH 3K7AH 1VQMA 1VQBA 4DV0L 4JI3L 1WCMG 1P8LA 4AQYL 1KAWA 2Y0SE 4GKKQ 2Q2UA 4IO9A 1K0RA 1X6OA 1IBMQ 4OO1I 1I94L 2IY5B 2NN6G 5H1SE 4X65L 3PUVA 1R9TH 2OTLA 3S24A 4B3TQ 1EIFA 5AJ3Q 3UDGA 1X3FA 3UDFA 4NPSA 2ES2A 2HIXA 2KHIA 5FLMG 5IYDH 2H5XA 3DM3A 1MIUA 1A62A 2WP8J 4MNOA 3CCQA 2ALYB 2ZTEA 5C0XG 1C9OA 5IWAQ 4NXML 2ID0A 3EBEA 4DR2Q 1HR0W 2R92H 3H3VI 2Y0SG 4A3DH 1EUJA 1RL2A 1YBYA 1TWHH 2WAQE 3HKZG 4JG2A 1NJIC 2YTYA 4X64Q 1QVGA 1XMOL 5M3MG 4LFBL 3J7ZC 1XMQL 4LF6Q 2YTXA 2JE6I 1U5KA 2UUAL 5JJKA 1SN8A 4QGUA 1TXYA 1SFOH 2JJQA 2YYZA 4X62Q 2NZHA 3OTOQ 5LMNQ 4B3SQ 1CKMA 1E24A 2JA9A 3CAMA 4A3KH 1YJNA 1ASYA 3AFPA 2JA5G 3CCMA 3W1GA 1VQDA 3KF8B 3HOWG 3I56A 3HOYG 1PH5A 2WAQG 3J81i 1GVPA 4A3MH 1N33L 3F1ZA 3M4PA 5JEAG 3KFUA 4DV0Q 4JI3Q 3CMAA 3T1HL 1YEZA 3M4QA 3I4MH 4PZ6A 4BBRG 4YCUA 4DV6L 3HKSA 2HT1A 2CCZA 2Z6KA 1B8AA 3HOXH 1J5EQ 4AIMA 1E22A 1EOVA 3ER0A 3NENA 4B3RQ 4LFCQ 2E8GA 5C4XH 4JI5Q 1EYGA 5ELOA 3TREA 4OXPA 4LF7L 3M7NA 2R93G 2OQ0A 2VUMH 3G4SA 1VS0A 1PV4A 4IPGA 2JA7H 4A3CG 3JC66 1QZHA 1AH9A 1VQEA 3MEFA 4UP7A 4A3JG 1N32Q 3GO5A 1OXTA 4LW1A 4PZ7A 3J80i 3RLOA 5HGQA 1JJGA 1UWVA 2IHEA 2E2JH 1NMGA 1XMOQ 2I0QA 2WFWA 5E7NA 1XMQQ 1KQSA 2N49A 2E5LQ 3HOVG 2VNUD 4DR7L 2UUAQ 1BVSA 1HZ9A 4AH6A 3W5OA 3B6YA 3ULJA 2XGTA 4IFDJ 5BR8L 4B3MQ 2EQSA 2MQHA 3K8AA 4LUZA 2HQLA 4TQUS 4DV5L 3PIOA 4APVA 1HNXL 4JBKA 5HY6A 4DV2L 1Y14B 1K8AC 3FHWA 4A3EG 1Z9FA 3KDFB 4R4CA 1PH4A 1HNZL 2Z6KC 2BH2A 3I4NH 4BBSH 1IBLQ 5LMUL 3H0GH 4PG3A 4A3LG 5M3FG 2NVYH 1O7IA 4BXXG 3T1HQ 3U58A 3CCLA 1E1OA 4XTCS 4AYBE 3F2CA 4HIOA 1IBML 4A3GH 2UU9Q 4IPCA 1PH8A 4B3TL 3KLWA 2N78A 3K7UC 1L2FA 2AMCB 5GQOA 1KRTA 1S40A 3U4VA 3F8TA 2I5HA 2B63G 1KIXA 5JJLA 4K0KQ 3H3VH 3RZOH 2ZTDA 2K14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3STB C;  4JBJ A;  1BBW A;  2KEN A;  1WCM H;  1MKH A;  4P71 A;  5IWA L;  1H95 A;  1Y1V G;  1XNR L;  1XTD A;  4JBM A;  2DGY A;  3RZD H;  1L1O A;  3DLL A;  1UE1 A;  4L5R C;  2K50 A;  4X66 L;  1X3E A;  3KOJ A;  3PIP A;  4DR1 L;  4X64 L;  1Y1W G;  1YJ9 A;  2PNH A;  1JB7 A;  1SRU A;  3PCO B;  1OXV A;  4DK3 C;  3BJU A;  3CC7 A;  3M3Y H;  4IPD A;  4LF6 L;  1VQ5 A;  3S17 H;  3CCR A;  4DR5 L;  2R7D A;  2VY3 A;  5FLM H;  1L0W A;  4KHP Q;  1QVC A;  4JYA Q;  3NEM A;  1K8G A;  3CD6 A;  5EAY A;  2ZJP A;  1X56 A;  1VQ4 A;  4LF4 Q;  4B3S L;  4X62 L;  3M9B A;  1HNX Q;  2D62 A;  1KHI A;  4DV5 Q;  3ULP A;  3S1N H;  4HIM A;  4DV2 Q;  5K36 G;  2R6G A;  1XJV A;  3F2B A;  4MTN A;  4KI0 A;  4XIG S;  1FGU A;  2UUB Q;  1QZG A;  5LMU Q;  3E0E A;  4EQ5 A;  4R4O A;  5M3M H;  3KJO A;  4OX9 Q;  1NTG A;  1VQJ A;  1PH1 A;  3AFQ A;  2Q2H A;  1IXR A;  5GAH C;  3S16 H;  2GVB A;  1QVF A;  2CFM A;  1GD7 A;  2AKW B;  1L1O B;  3HKZ E;  1MJE A;  4X6A H;  2OQK A;  1WI5 A;  1Q1E A;  3GTK H;  3PF4 A;  4R4Q A;  3S1Q H;  2N8N A;  3MXN B;  4C2M H;  1SRO A;  4UY8 C;  4JI7 L;  2JA5 H;  2VQE Q;  1J5E L;  4HJ5 A;  3RNU A;  3HOW H;  1X54 A;  4BY7 G;  4POG A;  4UPA A;  4LFC L;  2N3S A;  2K75 A;  3HOY H;  4B3R L;  5IE8 A;  1LM0 A;  4JI5 L;  1Q8K A;  4KHZ A;  1TWG H;  1K3R A;  3G48 A;  4DAM A;  2L15 A;  4GN5 A;  3PUY A;  3CCV A;  1XNR Q;  4GN3 B;  4BBR H;  3JAM i;  4X66 Q;  2MO0 A;  5FLX c;  4DR1 Q;  3HFZ B;  4GOP B;  4IOA A;  4R4T A;  1N9W A;  4JOI A;  2NN6 I;  3FKI G;  4BY1 G;  1PYS B;  3PV0 A;  3CW2 C;  2E5L L;  4DR5 Q;  1KXL A;  4C3H H;  2CKZ B;  4UP8 A;  2XTI A;  2RCN A;  1YJW A;  1WJJ A;  5IT9 c;  2B29 A;  4B3M L;  1UE7 A;  1N32 L;  2R93 H;  1X3G A;  4YCV A;  1KRS A;  2PI2 E;  4A3C H;  1VQA A;  1JJC B;  2K5N A;  1T9H A;  4YCW A;  3NBH B;  4A3J H;  5C0X I;  2PQA A;  1EQR A;  2K5V A;  1IBL L;  3E9H A;  1C0A A;  5LMN W;  2A19 A;  2VW9 A;  2JA6 G;  3HOV H;  3UE0 A;  3U50 C;  2B3G A;  3VDY A;  2E2H H;  3M4O H;  2HHH Q;  4YWL A;  2FXQ A;  4DNI A;  4JI6 Q;  4BA2 I;  4DV4 L;  2UU9 L;  2ZJQ A;  4NXN Q;  4QIW E;  4YHH L;  4JI7 Q;  4POF A;  2V1C C;  1EWI A;  4JOI C;  4A3E H;  2A8V A;  1SR3 A;  5M5Y H;  3KDF A;  1TWF H;  1IYJ B;  1EFW A;  4K0K L;  1E3P A;  2BA0 A;  4L5T A;  4A3L H;  5M3F H;  4A75 A;  4JCV E;  1VQN A;  1FJG Q;  1GO3 E;  1WOC A;  2GVA A;  5IP9 G;  2NVQ H;  4MZ9 A;  4P74 A;  4BXX H;  3PGZ A;  4GLV B;  3BZK A;  2PQA B;  3RN5 A;  1N36 Q;  2E2I H;  1YNX A;  4IFD G;  4JI0 Q;  2UXD L;  1Z47 A;  2VQF Q;  2B63 H;  4KHP L;  4JYA L;  1PYB A;  3KYH C;  5IYB G;  3J81 j;  3L0O A;  4DV7 Q;  4TVA B;  4LF4 L;  4OWX B;  3HOZ G;  1LYL A;  3PO2 G;  3D31 A;  4LF8 Q;  4GLA C;  1Y1V H;  3CPF A;  3RLN A;  2OWO A;  5JJI A;  2QGQ A;  2UUB L;  1KD1 C;  4DUZ Q;  2CQO A;  2RF4 A;  4DV3 Q;  2Q2T A;  1Y1W H;  3RR5 A;  4OX9 L;  4R1J A;  3ULL A;  3PO3 G;  1CSQ A;  2IX0 A;  3FP9 A;  4WJ4 A;  4IJH A;  3GTL H;  2JA8 G;  5C44 G;  3S15 H;  1AE2 A;  1VQ9 A;  3RN2 A;  1W2B A;  2YU9 H;  2RHQ B;  1I5F A;  4DV4 Q;  2EXD A;  4A93 G;  1NE3 A;  1VQC A;  1VQH A;  1PH3 A;  4YHH Q;  2VQE L;  1X55 A;  4A4I A;  3W1B A;  2C35 B;  3AQQ A;  4JBW A;  1BKB A;  3UDX A;  4IPH A;  1Q82 C;  3G71 A;  1VQ7 A;  1PH2 A;  4LF7 Q;  5IP7 G;  1D8L A;  2ZM6 Q;  2ASB A;  2UXC Q;  1FVI A;  4JI4 Q;  3CC4 A;  5J3B A;  3T1Y L;  2AHO B;  1V43 A;  2D0O A;  2UUC Q;  3GTO H;  2UXB L;  2MNA A;  1XPO A;  3A5Z B;  2DUD A;  2KCT A;  1SMX A;  2JK8 A;  1D7Q A;  3EN2 A;  2K5H A;  4QQB X;  4LUV A;  3A74 A;  3ZJY C;  3G6E A;  2K4K A;  2IHF A;  3J81 c;  1KC8 C;  1CSP A;  1A63 A;  1YHA A;  1YZ6 A;  2UXD Q;  1N34 Q;  3CME A;  3TEH B;  4HID A;  4BY7 H;  1Q12 A;  1NY4 A;  1HR0 L;  3D0F A;  4GLX A;  2VZA A;  1XNQ Q;  3UDI A;  1C7Y A;  1OXS C;  2JQO A;  1Q86 C;  2AWN A;  4L5S A;  3E9I A;  3I4O A;  1NBW A;  2EIF A;  2ATW A;  3GTQ H;  1RIP A;  2CWA A;  3F2D A;  1GM5 A;  2R7Z G;  1HNW L;  4DR3 Q;  1LTL A;  1CUK A;  4ME3 A;  2QA4 A;  3TQY A;  4J15 A;  4GOP A;  3TS2 A;  5M5W H;  1OXU A;  4Y52 H;  3S2H H;  3FKI H;  4O2D A;  4BY1 H;  2KBN A;  2KCM A;  2F4V L;  3CQZ H;  3PSI A;  4JI2 Q;  1EQQ A;  3LGJ A;  4BA1 I;  4C3I H;  2HHH L;  4OO1 G;  4EX5 A;  5IY0 A;  2ZJR A;  4DV1 Q;  4JI6 L;  3J80 c;  3HOU G;  1L1O C;  2F3I A;  2LXJ A;  4NXN L;  5C3E G;  4YY3 L;  1G51 A;  4A3F G;  2NVX H;  3I55 A;  2VS1 A;  1YVC A;  4LF5 L;  4DUY Q;  4DR4 Q;  4RG1 A;  3K0X A;  3A0J A;  4PZ8 A;  2NZO A;  4QL5 A;  1YHQ A;  3T1Y Q;  2PMZ E;  2UXB Q;  2JA6 H;  2MO1 A;  1K83 H;  2WB1 E;  4R4I A;  2YV5 A;  4YWM A;  1FJG L;  3CPW A;  3GTJ H;  1IBK L;  1KL9 A;  3J7A 5;  2HIV A;  3I2Z A;  3KJP A;  1I50 H;  3CC2 A;  2F52 A;  1N36 L;  2CWP A;  1Q46 A;  1XPR A;  4P73 A;  1JMC A;  4P72 A;  2MFI A;  4PMW A;  4GOP C;  4H02 A;  4JI0 L;  4LF9 Q;  4DR6 Q;  1X9N A;  4IOC A;  1M1K C;  1TWA H;  2VQF L;  4WJ3 M;  1HR0 Q;  4DV7 L;  3CF5 A;  3L7Z C;  4HJA A;  1GKH A;  1U0L A;  4OON A;  3SGI A;  1S72 A;  5GAE C;  5IYC G;  4GNX A;  1OXX K;  2R7F A;  5IP9 H;  4LF8 L;  1PFS A;  2WB1 G;  3ERS X;  3CCS A;  1UE5 A;  4A3B G;  1HNW Q;  1SLJ A;  1MJC A;  3PF5 A;  4HIK A;  1DGS A;  1PH9 A;  3K80 C;  4DUZ L;  3K81 C;  3WWV A;  4DV3 L;  3GTM H;  4A3I G;  2F4V Q;  5C0X J;  5FJ8 G;  5DLQ E;  1QUQ A;  1FL0 A;  5IYB H;  2IT1 A;  2IX1 A;  2LXK A;  1VCI A;  1K73 C;  5GAG C;  3HOZ H;  1HZA A;  2Q2I A;  4YY3 Q;  3CCU A;  4NB3 A;  4LFA Q;  3GTG H;  3STB D;  4JI1 Q;  3PO2 H;  4LF5 Q;  2AWO A;  1CKO A;  2JEB I;  1V1Q A;  4GN4 B;  4YWK A;  4DAY B;  4JC0 A;  3S1R H;  2UXC L;  4DPG A;  2ZM6 L;  4JI8 Q;  2YTV A;  4JI4 L;  4GNX B;  3PO3 H;  2I5L X;  3OYY A;  1HZC A;  5IYD G;  1HZB A;  2UUC L;  3I7F A;  2JA8 H;  3TS0 A;  4GNX C;  1VQF A;  5C44 H;  1IBK Q;  1YHB A;  3U4Z A;  4A76 A;  1PVO A;  4AQY Q;  2R92 G;  1PA6 A;  4A93 H;  4A3D G;  4HJ8 A;  1I94 Q;  4X65 Q;  5JEA J;  4O0A A;  1N34 L;  3KF6 A;  4FDB A;  1N8R C;  3S1M H;  1QUQ B;  4OWW B;  3L2P A;  5IP7 H;  1XNQ L;  4ALP A;  2I5M X;  1J6Q A;  4GKJ L;  1BBU A;  1G29 1;  3BZC A;  2RHS B;  1CKN A;  1SE8 A;  3EIV A;  4KLK A;  3CCJ A;  4A3K G;  1PHJ A;  4DR3 L;  3AEV A;  3ICE A;  4NXM Q;  5M5X H;  1JE5 A;  4IJL A;  1VQ8 A;  1VQP A;  4L5Q A;  4A3M G;  4JI2 L;  2QEX A;  3TRZ A;  4IFD I;  2KHJ A;  3CXC A;  4LFB Q;  2GN5 A;  3JAM c;  4DV1 L;  1P16 A;  1VQI A;  5GRO A;  4JV5 L;  2JEA I;  3I4M G;  1HJP A;  1X65 A;  1VQO A;  1A0I A;  3KF6 B;  4DUY L;  4DR4 L;  1I6H H;  1W3S A;  2ZTC A;  2R7Z H;  3H15 A;  4OWT B;  1Q7Y C;  3HOX G;  2BA1 A;  1EIY B;  3BU2 A;  5C4X G;  1M90 C;  1PH7 A;  1LUZ A;  1XPU A;  1CKN B;  1N33 Q;  1V9P A;  1VQK A;  2VUM G;  1OTC A;  2JA7 G;  4GKK L;  1NMF A;  3HOU H;  4P75 A;  5C3E H;  4A3F H;  1JT8 A;  3AYH B;  3M85 A;  4LUO A;  1YIJ A;  3OW2 A;  4LF9 L;  4DV6 Q;  4DR6 L;  3GTP H;  1AE3 A;  1UEB A;  1IZ6 A;  2BH8 A;  4RMF A;  5AJ3 L;  5C4J H;  2OTJ A;  2Z0S A;  1VQ6 A;  4HJ7 A;  1B7Y B;  4GKJ Q;  1B70 B;  3UE1 A;  2PI2 A;  4HJ9 A;  1G6P A;  1K9M C;  3IRB A;  1S3O A;  2A1A A;  3GDE A;  1Q81 C;  4C3J H;  3CCE A;  2K52 A;  4DR2 L;  4LWC A;  5GAD C;  1IL2 A;  2NVT H;  3PUW A;  1VQL A;  4AYB G;  3I4N G;  1Q1B A;  4BBS G;  5ELN A;  4DK6 C;  2OCE A;  3NEL A;  1ASZ A;  1WYD A;  3H0G G;  1VQG A;  3A5U A;  1TWC H;  3S2D H;  1E7Z A;  4QY7 A;  4UP9 A;  1YI2 A;  1HH2 P;  4DR7 Q;  4JV5 Q;  1UE6 A;  5IYC H;  3S14 H;  1YIT A;  4LFA L;  4Y7N H;  1JJ2 A;  4JI1 L;  2D0P A;  2LSS A;  5BR8 Q;  4A3G G;  3Q8D A;  3OTO L;  5LMN L;  3RLF A;  4A3B H;  2VL6 A;  3GD7 A;  1PH6 A;  4JI8 L;  3CP0 A;  1WFQ A;  4DKA C;  1HNZ Q;  3PUZ A;  4QJF A;  4GS3 A;  4LNQ A;  4A3I H;  1E1T A;  1A8V A;  5FJ8 H;  3PUX A;  1I3Q H;  3K7A H;  1VQM A;  1VQB A;  4DV0 L;  4JI3 L;  1WCM G;  1P8L A;  4AQY L;  1KAW A;  2Y0S E;  4GKK Q;  2Q2U A;  4IO9 A;  1K0R A;  1X6O A;  1IBM Q;  4OO1 I;  1I94 L;  2IY5 B;  2NN6 G;  5H1S E;  4X65 L;  3PUV A;  1R9T H;  2OTL A;  3S24 A;  4B3T Q;  1EIF A;  5AJ3 Q;  3UDG A;  1X3F A;  3UDF A;  4NPS A;  2ES2 A;  2HIX A;  2KHI A;  5FLM G;  5IYD H;  2H5X A;  3DM3 A;  1MIU A;  1A62 A;  2WP8 J;  4MNO A;  3CCQ A;  2ALY B;  2ZTE A;  5C0X G;  1C9O A;  5IWA Q;  4NXM L;  2ID0 A;  3EBE A;  4DR2 Q;  1HR0 W;  2R92 H;  3H3V I;  2Y0S G;  4A3D H;  1EUJ A;  1RL2 A;  1YBY A;  1TWH H;  2WAQ E;  3HKZ G;  4JG2 A;  1NJI C;  2YTY A;  4X64 Q;  1QVG A;  1XMO L;  5M3M G;  4LFB L;  3J7Z C;  1XMQ L;  4LF6 Q;  2YTX A;  2JE6 I;  1U5K A;  2UUA L;  5JJK A;  1SN8 A;  4QGU A;  1TXY A;  1SFO H;  2JJQ A;  2YYZ A;  4X62 Q;  2NZH A;  3OTO Q;  5LMN Q;  4B3S Q;  1CKM A;  1E24 A;  2JA9 A;  3CAM A;  4A3K H;  1YJN A;  1ASY A;  3AFP A;  2JA5 G;  3CCM A;  3W1G A;  1VQD A;  3KF8 B;  3HOW G;  3I56 A;  3HOY G;  1PH5 A;  2WAQ G;  3J81 i;  1GVP A;  4A3M H;  1N33 L;  3F1Z A;  3M4P A;  5JEA G;  3KFU A;  4DV0 Q;  4JI3 Q;  3CMA A;  3T1H L;  1YEZ A;  3M4Q A;  3I4M H;  4PZ6 A;  4BBR G;  4YCU A;  4DV6 L;  3HKS A;  2HT1 A;  2CCZ A;  2Z6K A;  1B8A A;  3HOX H;  1J5E Q;  4AIM A;  1E22 A;  1EOV A;  3ER0 A;  3NEN A;  4B3R Q;  4LFC Q;  2E8G A;  5C4X H;  4JI5 Q;  1EYG A;  5ELO A;  3TRE A;  4OXP A;  4LF7 L;  3M7N A;  2R93 G;  2OQ0 A;  2VUM H;  3G4S A;  1VS0 A;  1PV4 A;  4IPG A;  2JA7 H;  4A3C G;  3JC6 6;  1QZH A;  1AH9 A;  1VQE A;  3MEF A;  4UP7 A;  4A3J G;  1N32 Q;  3GO5 A;  1OXT A;  4LW1 A;  4PZ7 A;  3J80 i;  3RLO A;  5HGQ A;  1JJG A;  1UWV A;  2IHE A;  2E2J H;  1NMG A;  1XMO Q;  2I0Q A;  2WFW A;  5E7N A;  1XMQ Q;  1KQS A;  2N49 A;  2E5L Q;  3HOV G;  2VNU D;  4DR7 L;  2UUA Q;  1BVS A;  1HZ9 A;  4AH6 A;  3W5O A;  3B6Y A;  3ULJ A;  2XGT A;  4IFD J;  5BR8 L;  4B3M Q;  2EQS A;  2MQH A;  3K8A A;  4LUZ A;  2HQL A;  4TQU S;  4DV5 L;  3PIO A;  4APV A;  1HNX L;  4JBK A;  5HY6 A;  4DV2 L;  1Y14 B;  1K8A C;  3FHW A;  4A3E G;  1Z9F A;  3KDF B;  4R4C A;  1PH4 A;  1HNZ L;  2Z6K C;  2BH2 A;  3I4N H;  4BBS H;  1IBL Q;  5LMU L;  3H0G H;  4PG3 A;  4A3L G;  5M3F G;  2NVY H;  1O7I A;  4BXX G;  3T1H Q;  3U58 A;  3CCL A;  1E1O A;  4XTC S;  4AYB E;  3F2C A;  4HIO A;  1IBM L;  4A3G H;  2UU9 Q;  4IPC A;  1PH8 A;  4B3T L;  3KLW A;  2N78 A;  3K7U C;  1L2F A;  2AMC B;  5GQO A;  1KRT A;  1S40 A;  3U4V A;  3F8T A;  2I5H A;  2B63 G;  1KIX A;  5JJL A;  4K0K Q;  3H3V H;  3RZO H;  2ZTD A;  2K14 A; 
#chains in the Genus database with same CATH topology
 4JBJ A;  5FKA C;  1BBW A;  1WCM H;  5FO8 B;  5IWA L;  5IGB A;  1A3U A;  2F0K A;  4DNR B;  4HCE A;  2K50 A;  4X66 L;  4DR1 L;  3BZD B;  1QB5 D;  1E0B A;  1OXV A;  4NMZ A;  3BJU A;  4DK3 C;  1CHP D;  1T5E A;  2R7D A;  4KHP Q;  1QVC A;  4JK1 C;  4JYA Q;  3NEM A;  2RVL A;  5M9O A;  1M8A A;  5C0X H;  3S16 B;  1BOS A;  2ZT9 C;  4DV2 Q;  5K36 G;  4KJN A;  4CKB A;  2BDN A;  3N52 A;  2UUB Q;  1QZG A;  3FDT A;  1R9T B;  4R4O A;  5M3M H;  2Q2H A;  4RFB A;  1F2L A;  1QVF A;  2CFM A;  1GD7 A;  5KNB A;  2K5W A;  1MJE A;  3GTK H;  1Q1E A;  3PF4 A;  2N8N A;  2BE5 C;  4C2M H;  1SRO A;  4UY8 C;  2F0U A;  4FXK C;  2IWH A;  4HJ5 A;  3HOW H;  1X54 A;  2HD3 A;  3HZX A;  4LFC L;  3OW7 A;  3HOY H;  4B3R L;  4BBR B;  2M00 A;  4KHZ A;  1TWG H;  4RKL A;  5JEA H;  4HR7 B;  3SK8 A;  2B2W A;  3CCV A;  1XNR Q;  3TSS A;  1CA5 A;  5FLX c;  3VR4 A;  1Z7T A;  1K28 A;  1KNE A;  4BY1 G;  1PYS B;  4ABN A;  1II3 A;  5CBA E;  4DR5 Q;  2CKZ B;  2XTI A;  1K8O A;  4A3J B;  3HP3 A;  3IAY A;  1WJJ A;  1STA A;  5C4H A;  2R93 H;  1X3G A;  4CKE A;  3HOV B;  3NBH B;  3PIO 3;  2PQA A;  1AW7 A;  4ZCK A;  2O5J C;  3SE0 A;  1J8I A;  1I4R A;  4XQJ A;  4LJZ C;  5M5Y B;  3SK4 A;  2E2H H;  3LWU A;  1TWF B;  1QCB D;  3AMU A;  2K5Q A;  1LTT D;  1PFB A;  2V1C C;  1EWI A;  4JOI C;  2A8V A;  3OWE B;  4IAL A;  3CKI B;  5KGU A;  1YNJ C;  2MHV A;  4JCV E;  1VQN A;  1FJG Q;  5IP9 G;  1PDQ A;  2F0L A;  4MZ9 A;  4ID6 A;  3E5S A;  3T53 B;  2TMP A;  1N36 Q;  1YNX A;  1LTA D;  1V1P B;  3TP8 A;  2VQF Q;  2B63 H;  1YNN C;  3LX0 A;  4DV7 Q;  4TVA B;  2JYO A;  2C5C A;  2F3W A;  3PO2 G;  4XDX A;  3RLN A;  2OWO A;  5CV8 A;  1KD1 C;  4L6T B;  2EVB A;  1Q8I A;  4A3G B;  3KLS X;  3RR5 A;  2NB0 A;  4OX9 L;  1CSQ A;  2G9H D;  2IX0 A;  3FP9 A;  4WJ4 A;  3GTL H;  2I46 A;  4IUR A;  1AE2 A;  2F0W A;  2RHQ B;  4DV4 Q;  2KUM A;  3H3V C;  1EIG A;  3SK6 A;  1X55 A;  1Z6H A;  2VQE L;  1EQT A;  3W1B A;  4JBW A;  1FYC A;  1A15 A;  5CV9 A;  2ZM6 Q;  2ASB A;  1FVI A;  4ILW A;  1GHJ A;  2AHO B;  1V43 A;  3GTO H;  2UXB L;  1WTP A;  2KCT A;  2SDF A;  2RQX A;  1S5B D;  1ONL A;  4KKS A;  2IHF A;  3J81 c;  1CSP A;  1YZ6 A;  2IW3 A;  2UXD Q;  2Y0S B;  1I4P A;  1EY7 A;  1JIC A;  3D0F A;  1XNQ Q;  3C46 A;  2B2T A;  3MHB A;  1HNW L;  3MAQ A;  2QA4 A;  3TQY A;  5DNF A;  5M5W H;  3FKI H;  1B9M A;  4O2D A;  1LT6 D;  2RA4 A;  2KCM A;  3FMC A;  1HCZ A;  1DYQ A;  5EBC A;  3M7G A;  1R4P B;  1EQQ A;  3LGJ A;  4C3I H;  5IY0 A;  1SNM A;  3DUZ A;  4N8X 1;  2LXJ A;  1YVC A;  1MBY A;  4RG1 A;  3K0X A;  2QEJ C;  3A0J A;  2NZO A;  3FPU B;  4PZ8 A;  1JWU D;  3E0J A;  1EEF D;  1HA6 A;  3J7A 5;  4WRD A;  4C3J G;  2HIV A;  2F52 A;  4KV6 A;  4H0L C;  4JI0 L;  2MPM A;  4DR6 Q;  1TWA H;  5LL6 X;  1TVX A;  1HR0 Q;  3CF5 A;  3L7Z C;  1U0L A;  4OON A;  5ELB A;  4DGZ A;  3GTM B;  1HTL D;  5IYC G;  3DWQ A;  1ICW A;  2R7F A;  4LF8 L;  1LTR D;  3ERS X;  1SLJ A;  4KD3 A;  1EY8 A;  4PMB A;  1STY A;  4HIK A;  1PH9 A;  1RHP A;  5ELD A;  3C1F A;  1PTO D;  4XYO A;  5DAU A;  1JWS D;  5FJ8 G;  3D4R A;  3EQL C;  4JPB W;  5IYB H;  1IYV A;  1VCI A;  5GAG C;  2Q2I A;  1S5F D;  5M3F B;  4LFA Q;  3NP8 A;  3GTG H;  2XIW A;  4LF5 Q;  2NVQ B;  2J4X A;  2AWO A;  1CKO A;  2JEB I;  4S3S A;  4DPG A;  3BVZ A;  3FEW X;  5EPK A;  4JI8 Q;  4ZKC B;  4A93 B;  4GNX B;  3PO3 H;  3OYY A;  3TS0 A;  3J7A F;  4AQY Q;  4A3D G;  5ISR A;  4HJ8 A;  1QG7 A;  5TSS A;  3S1M H;  4OWW B;  3VR3 A;  3L2P A;  1IL8 A;  3K5M A;  4ODG A;  2I5M X;  4XT3 B;  2L9H A;  3ERQ A;  1J6Q A;  1VMC A;  4KY5 A;  3H91 A;  5HGT A;  1G29 1;  3BZC A;  4HMJ A;  1SE8 A;  3S15 B;  4I65 A;  2YU9 B;  3ICE A;  2B2V A;  2FJ2 A;  1HXY D;  2Z4I A;  5I9O A;  4GZY C;  2HDM A;  4L5Q A;  5DM6 3;  3HGB A;  4F87 A;  2KJX A;  3LNN A;  5FK9 C;  2MGS A;  2Q8R E;  1VQO A;  4O42 A;  2Q8I B;  4DR4 L;  1W3S A;  1T5X D;  3AU7 A;  3C2P A;  4KMU C;  1Q7Y C;  3HOX G;  2BA1 A;  1ZYR D;  1XXG A;  3W2D A;  3HEJ A;  4B08 A;  1XPU A;  1CKN B;  1D1K A;  2K05 A;  3ITP A;  1QNU A;  1VQK A;  4OO1 H;  1SNO A;  3TME A;  5A2Q L;  1OTC A;  2JA7 G;  1CFM A;  5C3E H;  4O1N A;  4DF7 A;  1JT8 A;  3I90 A;  3GTP H;  3GTQ B;  1PRT D;  2BH8 A;  4RMF A;  5AJ3 L;  5A2Q E;  2FHT A;  1SYE A;  4NP5 A;  1PTO H;  4BY1 B;  1B70 B;  3G7L A;  2KOL A;  3GDE A;  2Z9H A;  2PZT A;  1TWC B;  3CCE A;  2K52 A;  2EXZ A;  4DU9 A;  4IUU A;  5GAD C;  4IOA A;  1IL2 A;  2R3Z A;  3PUW A;  4AYB G;  3I4N G;  1CK1 A;  1UUP A;  3I91 A;  5ELN A;  5IT9 L;  2PO4 A;  4A3B B;  1ASZ A;  3H0G G;  3A5U A;  1VQG A;  4TSS A;  1E7Z A;  1YI2 A;  2QDL A;  2CVR A;  1FNU A;  4JV5 Q;  3S14 H;  3KK7 A;  1YIT A;  3SXH A;  1K83 B;  5IT9 E;  2LSS A;  3OTO L;  1F9P A;  2VL6 A;  1I50 B;  2WAC A;  1HNZ Q;  3U9O A;  4LNQ A;  4GS3 A;  3R3O A;  4A3I H;  3TP6 A;  1I3Q H;  3NTH A;  4DV0 L;  4OL7 A;  3R93 A;  1EYD A;  2ZXP A;  4DAP A;  4KJO A;  2NN6 G;  4C56 C;  1STE A;  1EIF A;  4QF4 A;  2F0D A;  4IZ8 A;  1SNQ A;  2ES2 A;  3QOJ A;  5C5L A;  1A62 A;  4P2C B;  2WP8 J;  2ALY B;  1C9O A;  5L37 A;  2R92 H;  3PO2 B;  1K0S A;  2WAQ E;  5EKL A;  4JG2 A;  2XRQ D;  1NJI C;  3S1R B;  1XMO L;  5EBD A;  4LFB L;  2EYH A;  4IN3 A;  2JE6 I;  1U5K A;  2O4X A;  4QGU A;  2KA7 A;  1TXY A;  2X69 A;  2JJQ A;  2NZH A;  4A3K H;  1W6K A;  3AFP A;  3KF8 B;  2E74 C;  1WTX A;  3P20 A;  5KND A;  1GVP A;  4A3M H;  1N33 L;  2XWB B;  4KN4 C;  4JI3 Q;  3CMA A;  1YEZ A;  1HUN A;  2HDL A;  1SYC A;  4BBR G;  2B39 A;  3WDN A;  2HT1 A;  2A6H D;  1B8A A;  1J5E Q;  1E22 A;  1EOV A;  3ZYY X;  4C3H G;  3R2I A;  5CYU A;  3BYY B;  2EYJ A;  2BCO A;  4Z9C B;  5I2Y A;  1UNS A;  1BXT A;  2B2Y A;  3M7N A;  2E2J B;  4A3C G;  1MSG A;  3JC6 6;  1AH9 A;  4CDC C;  2EPB A;  4UP7 A;  4A3J G;  1AP0 A;  3GO5 A;  1OXT A;  3ERO A;  2IHE A;  4DXF A;  5JVG 3;  2I0Q A;  2WFW A;  1Y69 U;  2DNE A;  3HOV G;  2E5L Q;  5IGD A;  4DR7 L;  3VR6 A;  2A68 C;  1A63 A;  1PYW D;  2HQL A;  3X3M A;  4APV A;  4JBK A;  5HY6 A;  4DV2 L;  1Y14 B;  3MFY A;  3FHW A;  2B2U A;  4A3E G;  2BH2 A;  1TKW B;  1IBL Q;  4A3L G;  1DJR D;  5C4J B;  1W6J A;  1LAB A;  3CCL A;  3MWY W;  1IBM L;  5DEH A;  4ZLT F;  4RH6 A;  2JN4 A;  3BDC A;  1KRT A;  4C3J B;  1BUV T;  2I5H A;  1MD2 D;  4H7B A;  5FLX L;  1RKN A;  2F4I A;  1LV9 A;  4KKU A;  1VQ5 A;  4ZKB B;  5IGF A;  4RGN A;  2D2C C;  1H95 A;  4YIJ A;  1XNR L;  3K58 A;  3T16 A;  2DGY A;  3C1E A;  3RZD H;  1LTG D;  1U4L A;  4M8A A;  2WIN B;  2PNH A;  4RAU C;  1JB7 A;  3MXN A;  4OIJ A;  2E76 C;  3M3Y H;  3K5N A;  4DR5 L;  5CGK A;  2VY3 A;  5A35 A;  1K8G A;  1NNX A;  1VQ4 A;  4HCS A;  4B3S L;  4X62 L;  2D62 A;  1KHI A;  4EQO A;  4DV5 Q;  2RCF A;  2SOB A;  1ML0 D;  2R6G A;  1IYU A;  1XJV A;  1F2Y A;  4KI0 A;  3E0E A;  2VB2 X;  4EQ5 A;  2F0S A;  2KEC A;  4C2M B;  2WII B;  3KJO A;  1PH1 A;  3MVV A;  4CDD C;  2GVB A;  1IKL A;  1C4Q A;  1L1O B;  1QNK A;  2ZXO A;  3HOY B;  4X6A H;  2PW7 A;  1TWG B;  3S1Q H;  2JA5 H;  2HUG A;  4ZK9 B;  5IGC A;  3RNU A;  3RMH A;  4BY7 G;  2RSN A;  4POG A;  1ZXT A;  4UPA A;  1TWH B;  3P75 A;  4KY6 A;  2RBM A;  4OIK A;  3G48 A;  1DXM A;  3UI2 A;  4DAM A;  2L15 A;  2K03 A;  3PUY A;  1C8C A;  4CDE C;  1NR2 A;  3JAM i;  2J0T D;  2MO0 A;  1SFO B;  3FPP A;  2PCF B;  1A2T A;  2NN6 I;  4K8J A;  1H9M A;  5C6A A;  2EY6 A;  1SYD A;  2QDB A;  5IT9 c;  2EDG A;  1UE7 A;  2WV6 D;  2B8G A;  1N32 L;  2PI2 E;  1AZQ A;  1VQA A;  1T9H A;  3GQB A;  2E2D C;  1EU4 A;  1GJX A;  3E9H A;  4NKL A;  1C0A A;  4RGM A;  3HOX B;  1G2S A;  2K7V A;  2B3G A;  3VDY A;  3M4O H;  3JAM E;  4JI6 Q;  4DV4 L;  4BA2 I;  2ZJQ A;  4NXN Q;  3A56 A;  3CRL C;  2K5D A;  3HS0 C;  3DEP A;  4QIW E;  4EGV A;  3CRK C;  1IYJ B;  4K0K L;  1L0Y B;  2BA0 A;  3J81 L;  2J7Z A;  4EQN A;  1JC7 A;  1WOC A;  1GOZ A;  2B63 B;  3PGZ A;  4GLV B;  3VYU A;  2PYK A;  3A8J E;  5CBE E;  3RN5 A;  4R8I A;  2E2I H;  1HPC A;  4IFD G;  1R4Q B;  3N6R A;  3PIP 3;  2UXD L;  1CTM A;  1EOT A;  2EJF C;  1PYB A;  1PFM A;  4Q0F A;  4AYB B;  1UEA B;  4LF4 L;  3V05 A;  4KN7 C;  4OWX B;  3LWE A;  3DHQ A;  3A7L A;  3H0G B;  4J8Q A;  5G3L F;  3HOZ G;  1MHW C;  2NVY B;  1Y1V H;  2F0O A;  3GTL B;  2QGQ A;  2CQO A;  4DV3 Q;  1BCP D;  1Y1W H;  3NQI A;  1ZEQ X;  2JA8 G;  1SMY D;  1SYG A;  5C44 G;  1B1Z A;  5JVH 3;  1NE3 A;  4A93 G;  5KEE A;  4YHH Q;  3GTO B;  5KYL A;  1BKB A;  3IKJ A;  4IPH A;  4LAA A;  3SR1 A;  5IP7 G;  3F2U A;  2WKD A;  4JI4 Q;  1D6E C;  5J3B A;  4FYD A;  2UUC Q;  2MNA A;  1WVL A;  3X3N A;  1XPO A;  3S17 B;  1SMX A;  1D7Q A;  4FP5 D;  2K01 A;  4LUV A;  1D2B A;  3G6E A;  2CW0 C;  1J9O A;  1YHA A;  3CME A;  1JB3 A;  1HR0 L;  1EZ6 A;  3FKI B;  1Q86 C;  1CA6 A;  4CDF C;  2EIF A;  2AUJ D;  4DR3 Q;  1CUK A;  1EY0 A;  3TS2 A;  5EGT A;  2BOS A;  2JXM B;  3BVG A;  4JVZ A;  3S2H H;  4Y52 H;  3PSI A;  5CV7 A;  4FF4 A;  1SAP A;  3QOL A;  1RTN A;  4BA1 I;  2HHH L;  4EX5 A;  4DV1 Q;  1FGB D;  2ZJR A;  1IKM A;  1ILQ A;  1L1O C;  1U9R A;  2F3I A;  4A3F G;  1G51 A;  2AUK A;  2F0M A;  3MFG A;  2NVX H;  1GHK A;  2X6L A;  4LF5 L;  1RTO A;  5BN3 A;  1IW7 D;  5JPN C;  2KHS A;  1FR3 A;  1YHQ A;  1GUS A;  1EU3 A;  2ICE C;  4QCL A;  3T1Y Q;  2PMZ E;  2JA6 H;  2MO1 A;  2WB1 E;  4C3H B;  2B2T C;  3QG1 A;  3I2Z A;  2CWP A;  2R61 A;  4P72 A;  4LF9 Q;  4BWG B;  2F0N A;  4OEM B;  2H1E A;  5GAE C;  5JAV A;  1OXX K;  1LO5 D;  3E3X A;  2SEB D;  3CCS A;  1SNP A;  4A3B G;  3VYT A;  1DGS A;  3MXG A;  4DUZ L;  3K81 C;  4H13 C;  3GTG B;  4A3E B;  2PPB C;  1QUQ A;  1GUO A;  3ND9 A;  2IX1 A;  4IUP A;  2QKI C;  1HZA A;  4YY3 Q;  3CU7 A;  3STB D;  2L4N A;  4HSV A;  4YWK A;  1NSN S;  1EYC A;  2UXC L;  2YTV A;  5IGG A;  5IYD G;  3L9A X;  1HZC A;  3OMC A;  1ZKO A;  1IBK Q;  1YHB A;  1F2Z A;  1PA6 A;  3TN2 A;  2V4D A;  1DON A;  4X65 Q;  4O0A A;  1N34 L;  3KF6 A;  4R8N A;  4I7Z C;  1N8R C;  2O2L D;  2Z1C A;  1BQQ T;  1KDB A;  3CHB D;  1BBU A;  5E1F A;  2Z6B A;  2RHS B;  3CCJ A;  3AEV A;  4OGQ C;  4B9X A;  1RCV D;  4NXM Q;  1D5X C;  3EJI A;  1STH A;  1VQP A;  1ENA A;  1KLG D;  4JI2 L;  3TRZ A;  4IFD I;  3CXC A;  4MTK A;  1PMR A;  3JAM c;  4JV5 L;  4QB4 A;  3I4M G;  2OXP A;  1A0I A;  4DUY L;  1B2T A;  2R7Z H;  3V2T A;  5C3E B;  1EIY B;  3BU2 A;  3BYT B;  1STB A;  3TBI B;  4BY7 B;  5ELF A;  1NMF A;  3HOU H;  3VA5 A;  2CH4 W;  2B2V C;  1E2V A;  2F0E A;  1IZ6 A;  2NTT A;  2Z0S A;  4UAI A;  1VQ6 A;  4GKJ Q;  1B7Y B;  5LL6 S;  2PI2 A;  4LK1 C;  1KLU D;  3CQZ B;  3TP5 A;  1S3O A;  4G57 A;  1Q81 C;  5JOB A;  1RDP D;  1TU2 B;  2EY2 A;  4LWC A;  2NVT H;  3S14 B;  4BBS G;  4RCO A;  2A6E D;  4UHV A;  3SHL A;  1TR5 A;  3RUZ A;  1UE6 A;  4Y7N H;  4JI1 L;  5BR8 Q;  4FF1 A;  3Q8D A;  3FVQ A;  3MTS A;  1SNC A;  3GTJ B;  4C1N I;  1PH6 A;  4ZRZ A;  3BDO A;  3PUZ A;  2EE1 A;  1LTS D;  1HQM C;  1A8V A;  1EY6 A;  3SEB A;  4MHE A;  2EY1 A;  2A5H A;  4ZQ3 A;  1OO9 B;  3I72 A;  3K6O A;  1VQM A;  4JI3 L;  1WCM G;  4GKK Q;  2Y0S E;  5DM7 3;  1CQF A;  4WOR A;  4IO9 A;  2Q2U A;  4V19 0;  1G6Z A;  1X6O A;  3BDL A;  2IY5 B;  1I94 L;  1C48 A;  3PUV A;  1EY4 A;  1R9T H;  2NYZ D;  4B3T Q;  1SDF A;  3UDG A;  2KEE A;  2KVM A;  3CCQ A;  4J1M A;  5I6Y A;  5C0X G;  3Q22 A;  5IWA Q;  3EBE A;  4DR2 Q;  3HOZ B;  5I9P A;  5KIX A;  1QVG A;  1B50 A;  5M3M G;  1SYB A;  4RGO S;  4B9W A;  2YTX A;  5JJK A;  2JA8 B;  2YYZ A;  2K1B A;  5C44 B;  1CKM A;  2F0H A;  2JA9 A;  2CQA A;  3CCM A;  1VQD A;  2PW5 A;  3I56 A;  3HOW G;  1JWM D;  2KCC A;  3HOY G;  3D4D A;  1PH5 A;  5J22 A;  3F1Z A;  2SNS A;  5JEA G;  1GUW A;  2NTS A;  1KAA A;  5COY A;  1B44 D;  1WD1 A;  4YCU A;  4DV6 L;  1ILP A;  2Z6K A;  1JOR A;  2DY7 A;  5M5X B;  4B3R Q;  1CQV A;  2E8G A;  5C4X H;  4LFC Q;  1G8Z D;  1EYG A;  4NDX A;  4OXP A;  2R93 G;  2OQ0 A;  1S5C D;  2VUM H;  4IPG A;  1ESR A;  1AEX A;  3KBX A;  1H9J A;  1V8Q A;  3DXJ C;  1H9S B;  4LW1 A;  5HGQ A;  1JJG A;  2OF1 A;  1K3B C;  5FO7 B;  5LHY 1;  1I6H B;  1NMG A;  1KQS A;  1HZ9 A;  2F0I A;  1QJO A;  4IFD J;  2DN8 A;  5EQ0 A;  4DV5 L;  3PIO A;  2F03 A;  4KK7 A;  1EL0 A;  5CV4 A;  4V0B A;  2EYO A;  4A3F B;  1UAP A;  3AB9 A;  1CM9 A;  4IUQ A;  2CHB D;  2Q8T A;  2ZXR A;  2B2Y C;  4XTC S;  5COR A;  4HIO A;  4A3G H;  1PTO C;  5C3W A;  1L2F A;  1ESF A;  3U4V A;  2B63 G;  1KIX A;  5JJL A;  2RDF A;  3T51 B;  3E6Z X;  4LF7 Q;  5IOC A;  2PZW A;  3O13 A;  2KEN A;  1MKH A;  3M3Y B;  3IFD A;  1XTD A;  1ET6 A;  4JBM A;  3DLL A;  1UE1 A;  2B2U C;  1X3E A;  4X64 L;  2OEO A;  2MP1 A;  1YJ9 A;  3CC7 A;  4LF6 L;  3CCR A;  3I8Z A;  5FLM H;  5EPL A;  1L0W A;  3OOC A;  3CD6 A;  5EAY A;  3T56 B;  2ZJP A;  1HNX Q;  2HCC A;  3S1N H;  1XTC D;  1JOQ A;  4MTN A;  4XIG S;  1FD7 D;  3D4W A;  4OX9 Q;  3A54 A;  3KUP A;  1VQJ A;  3AFQ A;  3D8G A;  2AKW B;  3HKZ E;  4CKC A;  3H09 A;  4M1U B;  2WAQ B;  2OQK A;  1WI5 A;  2A74 C;  2IL8 A;  1TS3 A;  3NTK A;  2VQE Q;  1WTW A;  4L8J A;  1MSH A;  5IE8 A;  1LM0 A;  4JI5 L;  5CMD A;  1AZP A;  4K5V A;  1EYA A;  2ENB A;  4GN5 A;  3HG9 A;  2EJM A;  2L12 A;  2M2L A;  4LMQ D;  1XWE A;  5J1Z A;  1Y8O B;  1ZYR C;  3HFZ B;  4R4T A;  1N9W A;  3FKI G;  3PV0 A;  3CW2 C;  2L5T A;  2NBF A;  4UP8 A;  2RCN A;  4KHV A;  2EYP A;  4C3I G;  2A69 D;  2F0T A;  5JPM C;  2B29 A;  4B3M L;  1RD9 D;  1PRT C;  1H9K A;  1JJC B;  1PLF A;  1E2W A;  2C9O A;  3NPP A;  4K6L A;  4N9T A;  3NE5 B;  5C0X I;  4KKT A;  3I4M B;  3M4O B;  1MGS A;  5LMN W;  2VW9 A;  3VA7 A;  2F0Q A;  2FXQ A;  2UU9 L;  1VF5 C;  2DY8 A;  4YHH L;  4JI7 Q;  1SR3 A;  3KDF A;  1LT5 D;  1I4G A;  1KDA A;  1EFW A;  1E3P A;  3H6M A;  2E2I B;  5M3F H;  1GO3 E;  2GVA A;  4BXX H;  2NVQ H;  3BZK A;  2PQA B;  1GUN A;  3Q6S A;  1TS4 A;  4JI0 Q;  2E75 C;  4KHP L;  4JYA L;  5IYB G;  4BBS B;  3J81 j;  1EY9 A;  3L0O A;  2L0C A;  4HAE A;  3VR2 A;  4LF8 Q;  3CPF A;  3TZD A;  2XWJ B;  1O7Y A;  1NAP A;  2LMC B;  2UUB L;  2RF4 A;  3DWA A;  4R1J A;  3ULL A;  3PO3 G;  4FXG C;  4IJH A;  3Q0A A;  3S15 H;  3T4A C;  3OPO A;  2YU9 H;  1I5F A;  4KTA A;  5NUC A;  3RZO B;  2EXD A;  4HSP A;  1VQC A;  1VQH A;  1WCM B;  5K36 H;  4A4I A;  3D6W A;  2C35 B;  4IUT A;  3K0Y A;  1Q82 C;  1Q90 A;  3GV6 A;  3G71 A;  1PH2 A;  3Q23 A;  3CC4 A;  3T1Y L;  2D0O A;  3ND8 A;  2PNR C;  1SE3 A;  3A5Z B;  2JK8 A;  1HFG A;  3EN2 A;  4QQB X;  3A74 A;  5EKI A;  3ZJY C;  1EZ8 A;  2XRS D;  1KNA A;  5I4D A;  1JOK A;  3G6J B;  1RF2 D;  3TEH B;  1Q12 A;  1NY4 A;  4F88 A;  3UDI A;  3WOE A;  5M3M B;  1OXS C;  1C7Y A;  4KD4 A;  3S2H B;  2AWN A;  4L5S A;  3E9I A;  3I4O A;  2ATW A;  2A6H C;  3GTQ H;  1RIP A;  2CWA A;  3F2D A;  1GM5 A;  3ONA B;  1LTL A;  1HHV A;  3GTK B;  4J15 A;  4GOP A;  5D3D A;  4BY1 H;  4NW2 A;  3HOW B;  4OO1 G;  4HED A;  5C3E G;  4YY3 L;  3I55 A;  3VYR A;  4DR4 Q;  2VXW A;  3MC0 B;  1PXU A;  4RWS C;  3RD4 A;  1Q3L A;  4YWM A;  1K83 H;  1FJG L;  1IBK L;  1KL9 A;  1A6X A;  1BCP B;  3KJP A;  1I50 H;  3BS1 A;  3CC2 A;  1N36 L;  1JMC A;  1Q46 A;  2R93 B;  4PMW A;  2MFI A;  1G2T A;  3M4Y A;  4IOC A;  1KTK A;  2Z4H A;  2VQF L;  1U4R A;  4DV7 L;  2Z8L A;  4HJA A;  1GKH A;  4GNX A;  5IP9 H;  1PFS A;  4X3T A;  1MJC A;  2E2H B;  2F0F A;  3JAM L;  3WWV A;  4K2L A;  4A3I G;  1F77 A;  2F4V Q;  5C0X J;  1A3T A;  5FOB B;  3KLS A;  5DLQ E;  2B2W C;  1FL0 A;  4RHR A;  2IT1 A;  3EVQ A;  3D6C A;  2DNC A;  1B3A A;  1DM0 B;  4L63 B;  4NB3 A;  2GA4 B;  3CCU A;  3PO2 H;  1WTQ A;  4GN4 B;  3S1R H;  4JC0 A;  3TDQ A;  2ZM6 L;  1DOM A;  2CW0 D;  3QR8 A;  2NUC A;  2PZU A;  3R2T A;  2R92 G;  5JEA J;  3U9S A;  3DMU A;  4FDB A;  1LTB D;  1XNQ L;  4GKJ L;  1DD2 A;  3NSW A;  1F9Q A;  1B53 A;  1CKN A;  3EIV A;  2EOT A;  4A3K G;  1PHJ A;  4HTH A;  1KDC A;  2XN9 C;  1FNV A;  4RKB A;  1JE5 A;  5F2D A;  1STG A;  2BE5 D;  4IJL A;  1VQ8 A;  4PV1 C;  4A3M G;  1FNW A;  3NWS A;  1VF7 A;  2KHJ A;  4N8F A;  4LFB Q;  2GN5 A;  4ZYS A;  3EA6 A;  3DWP A;  1CZG A;  1X65 A;  1PZJ D;  2ZTC A;  1ET9 A;  1BNZ A;  3H15 A;  4OWT B;  2EJG C;  2N55 A;  1U4P A;  3HOU B;  4TRD A;  1M90 C;  3K5O A;  1LUZ A;  1PH7 A;  4XQQ A;  1N33 Q;  1LAC A;  1V9P A;  5C5M A;  1Y8P B;  3NTI A;  4G7O C;  4GKK L;  3H94 A;  4P75 A;  2EYL A;  3M85 A;  4LUO A;  4DR6 L;  1UEB A;  1B9N A;  3SK5 A;  5I2X A;  5C4J H;  2OTJ A;  1B4O A;  2FFK B;  1HUM A;  3DEO A;  5M5W B;  4HJ7 A;  3UE1 A;  2A1A A;  2RSO A;  4C3I B;  4C3J H;  4DR2 L;  4K5X A;  3A55 A;  1VQL A;  1QOH A;  2PMZ B;  4Y7N B;  4DK6 C;  2WB1 B;  3NEL A;  1BR9 A;  1WYD A;  3S2D H;  3URY A;  4QY7 A;  1O7L A;  4DR7 Q;  5IYC H;  3K5L A;  4LFA L;  5EKK A;  1F9R A;  1YNJ D;  1SJE D;  1JJ2 A;  3J7A V;  1S5D D;  1ICF B;  1PZK D;  3GD7 A;  1WTO A;  4JI8 L;  1VMP A;  4DKA C;  1BDO A;  2L11 A;  3K57 A;  1E1T A;  2EYM A;  4K2K A;  5FJ8 H;  3PUX A;  1BF4 A;  1TWA B;  3OIP A;  3K7A H;  1VQB A;  5IIF A;  1P8L A;  1YNN D;  1KAW A;  4AQY L;  3DM1 A;  1K0R A;  1IBM Q;  4OO1 I;  1BCP C;  5H1S E;  5T1I A;  2OTL A;  1GUG A;  2G5D A;  3GP7 A;  4DAY A;  1SMY C;  1X3F A;  1PRT F;  4NPS A;  2HIX A;  3KF8 A;  3IFT A;  2AQ3 B;  1MIU A;  4G4K A;  2WKC A;  1D5Z C;  1CT1 D;  2DJG C;  3NUC A;  1IHZ A;  4A3D H;  1EUJ A;  1RL2 A;  1TWH H;  3HKZ G;  4FF2 A;  3OSO A;  4OHJ A;  3J7Z C;  2RDG A;  2X6G A;  1TY0 A;  4DFA A;  4R9W A;  3PO3 B;  1TII D;  2D9U A;  3I70 A;  1SFO H;  4B3S Q;  4X62 Q;  5LMN Q;  5E4X A;  5D14 A;  1G91 A;  2JA5 G;  4DK1 A;  3W1G A;  3OWF A;  4I7A A;  2QW7 A;  1L0X B;  2WAQ G;  1WD0 A;  3S1M B;  1SXT A;  1SBB B;  3M4Q A;  4WJW A;  5C4X B;  1ROD A;  3C3L A;  2F0J A;  4F7X A;  4U68 A;  4JW0 A;  2VUM B;  2PQE A;  2CCZ A;  3HOX H;  4AIM A;  3TRE A;  5K5P A;  4LF7 L;  3G4S A;  1VS0 A;  1PV4 A;  5KYI A;  2JA7 H;  2M9V A;  1IW7 C;  1SE2 A;  3MEF A;  1B3Q A;  1I4Q A;  3J80 i;  1UWV A;  4RCN A;  3K59 A;  1TY2 A;  3MXP A;  1QIL A;  5E7N A;  1XMQ Q;  2VNU D;  2N49 A;  2K28 A;  2UUA Q;  1BVS A;  3EFX D;  2EQS A;  2MQH A;  1HNX L;  4LUZ A;  1N32 Q;  5BN5 A;  1I4H A;  1K8A C;  1Z9F A;  1EWC A;  3KDF B;  4R4C A;  1HNZ L;  2Z6K C;  4K8I A;  3I4N H;  1ENF A;  2NZ1 D;  1WTH A;  4DK0 A;  3J80 L;  3GTP B;  3H0G H;  2NVY H;  1O7I A;  3OHX C;  3T1H Q;  3U58 A;  1E1O A;  1PTO B;  2K04 A;  3J80 E;  1PH8 A;  3KLW A;  2N78 A;  3K7U C;  1HRJ A;  2AMC B;  1S40 A;  4K0K Q;  4PNY A;  3H3V H;  2ZTD A;  2K14 A;  3STB C;  3SDZ A;  1I4X A;  4P71 A;  3QB3 A;  1Y1V G;  2VB3 X;  1L1O A;  2NN6 H;  4L5R C;  3PIP A;  4CJ2 C;  3KOJ A;  1Y1W G;  3SVM A;  1SRU A;  3PCO B;  3S1N B;  4IPD A;  3S17 H;  1AN8 A;  1EWH A;  1F2M A;  4A3I B;  4LF4 Q;  1X56 A;  1I3Q B;  3M9B A;  4ME5 A;  1CHQ D;  1LTI D;  1TS2 A;  3ULP A;  4HIM A;  3F2B A;  1FGU A;  3TP7 A;  2KCN A;  4CGY B;  3VYS A;  5LMU Q;  1NCV A;  1NTG A;  3S16 H;  5GAH C;  1IXR A;  4XT1 B;  3A7A B;  2QCP X;  4PQX A;  3NXW A;  4R4Q A;  3NQT A;  4HN7 A;  3MXN B;  4JI7 L;  3V96 A;  2R92 B;  1GXD C;  1J5E L;  1CI3 M;  2K75 A;  2N3S A;  1Q8K A;  1K3R A;  2NWG A;  3W3A A;  4BS9 A;  4DXG A;  3I4L A;  3PMF A;  4GN3 B;  1HA5 A;  4C1N K;  4BBR H;  1TQO A;  4IQZ A;  1TT2 A;  4X66 Q;  4DR1 Q;  4GOP B;  2RKS A;  4JOI A;  4A3K B;  2FMC A;  1SND A;  3Q24 A;  4DNT B;  2E5L L;  1KXL A;  4C3H H;  3I3C A;  2BDO A;  1YJW A;  5G3L D;  1O78 A;  1PRT B;  4A3M B;  4YCV A;  1KRS A;  4A3C H;  2K5N A;  4YCW A;  4A3J H;  1EQR A;  2K5V A;  1IBL L;  1Y8N B;  5ELC A;  2A19 A;  2JA6 G;  3HOV H;  3UE0 A;  4CBV A;  3U50 C;  3TZU A;  4E6I A;  2HHH Q;  4YWL A;  4DNI A;  2A6E C;  4POF A;  2P5Z X;  4A3E H;  5M5Y H;  2N88 A;  5EPJ A;  1TWF H;  4L5T A;  4A3L H;  1SEB D;  4A75 A;  5CV6 A;  1A2U A;  1VDZ A;  2G9D A;  4P74 A;  4QUF A;  2HQE A;  1AFP A;  4FXD A;  3MZ5 A;  1A3V A;  1E2Z A;  1Z47 A;  3S9W A;  4RHS A;  2EZV A;  3KYH C;  4DA2 A;  1LYL A;  4X3K A;  3D31 A;  4RA8 A;  4GLA C;  4IUN A;  1MI2 A;  3GV3 A;  5JJI A;  4ZUI A;  4DUZ Q;  2Q2T A;  4WFN 3;  4CJ1 B;  1VQ9 A;  3RN2 A;  1W2B A;  4H44 C;  1PH3 A;  1O7Z A;  2DJF C;  3AQQ A;  1VQ7 A;  3UDX A;  4Q5V A;  3RZD B;  2UXC Q;  1D8L A;  1X32 A;  3OMG A;  5BN4 A;  3J7Y W;  3QIA A;  2LY7 A;  2IJ0 A;  1PFN A;  2DUD A;  5ELE A;  2K5H A;  3HRZ C;  2K4K A;  2MUY A;  4K14 A;  1KC8 C;  1LT4 D;  1N34 Q;  4HID A;  4BY7 H;  3QO2 A;  3HKZ B;  4GLX A;  2VZA A;  1JQY D;  3P7J A;  2L55 A;  2JQO A;  4ULL A;  1NBW A;  1BBX C;  1JOO A;  2R7Z G;  1CZW A;  4ME3 A;  3S1Q B;  1OXU A;  4F8M A;  2FIN B;  1BCP F;  2KBN A;  1S4Z A;  2JA5 B;  2F4V L;  3CQZ H;  2OT2 A;  4JI2 Q;  4DAV A;  2AQ1 B;  4OEL B;  2LS0 1;  3J80 c;  4JI6 L;  3HOU G;  4NXN L;  1HFN A;  5EJW A;  5CV5 A;  2D5D A;  2VS1 A;  4ZUJ A;  4DUY Q;  1PZI D;  1SE4 A;  4XQN A;  3NBH A;  4QL5 A;  1U4M A;  2KQ3 A;  1X3P A;  2UXB Q;  4R4I A;  2YV5 A;  3CPW A;  3A8I E;  3GTJ H;  3D3R A;  4QMG A;  2A68 D;  1XPR A;  3MEH A;  4P73 A;  1NUC A;  4GOP C;  3VR5 A;  4H02 A;  1X9N A;  1M1K C;  4FF3 A;  3P1H A;  4WJ3 M;  4UDU C;  1S72 A;  3SGI A;  2LKV A;  2WB1 G;  1DOL A;  1UE5 A;  1HNW Q;  3PF5 A;  4K5W A;  3K80 C;  4X3S A;  4DV3 L;  3GTM H;  4IFD H;  2F1M A;  2F3V A;  4EQP A;  5CR3 A;  1V1P A;  2LXK A;  2LFN A;  2O5I C;  1K73 C;  5HUR A;  3HOZ H;  1D1I A;  3T13 A;  4JI1 Q;  4FNF A;  1V1O A;  1V1Q A;  4DAY B;  1M4V A;  4DN4 M;  4JI4 L;  1EQV A;  5KNC A;  2F0G A;  2I5L X;  4QUC A;  2UUC L;  1HZB A;  2XVS A;  3I7F A;  2JA8 H;  4GNX C;  1VQF A;  5C44 H;  1HQR D;  2L1B A;  1H9R A;  3U4Z A;  2XSC A;  1JE4 A;  4A76 A;  1XX8 A;  2XNA C;  5C4Z A;  1PVO A;  4A93 H;  1I94 Q;  1Y1V B;  2TSS A;  1QUQ B;  5IP7 H;  4ALP A;  1I6V C;  1Y1W B;  5E4W C;  4KY7 A;  1QE6 A;  4KLK A;  4DR3 L;  4EVO A;  4TKO B;  3PQI A;  5M5X H;  4RGT A;  3R8B A;  2AQ2 B;  1KAB A;  4X3U A;  4U67 3;  2QEX A;  1SSO A;  3OIQ A;  4DV1 L;  1P16 A;  1VQI A;  5GRO A;  2JEA I;  2QIL A;  1GUT A;  1HJP A;  4N9P A;  3KF6 B;  1WTV A;  4PMC A;  1I6H H;  2A69 C;  4CJ0 B;  5KRU A;  5C4X G;  3QJY A;  2VUM G;  5CC4 A;  4A3F H;  1DCZ A;  3AYH B;  1JCK B;  1YIJ A;  3OW2 A;  4LF9 L;  4DV6 Q;  4CHT B;  1AE3 A;  3NWT A;  2F0P A;  4HJ9 A;  1G6P A;  1K9M C;  2H4O A;  3IRB A;  3S2D B;  3WOF A;  2EY5 A;  2NVX B;  1Q1B A;  1SJH D;  1RJT A;  2OCE A;  5FLX E;  4G7Z C;  1TWC H;  5I6W A;  3KLR A;  4UP9 A;  1HH2 P;  2K6A A;  1EIH A;  2JA6 B;  2D0P A;  1HTP A;  4A3G G;  4A3B H;  3NHH A;  3RLF A;  5LMN L;  3K7A B;  5C3X A;  4MN3 A;  2K33 A;  3CP0 A;  1WFQ A;  3KBG A;  4QJF A;  1BO0 A;  2JSO A;  1ENC A;  3BG3 A;  2CH4 A;  4FVM A;  4X65 L;  4XYQ A;  2F0V A;  5J39 A;  1S5E D;  3S24 A;  5FO9 B;  5AJ3 Q;  3UDF A;  2KHI A;  1NR4 A;  1LT3 D;  5FLM G;  1DOK A;  2H5X A;  4A3D B;  5IYD H;  4QIW B;  3DM3 A;  1TS5 A;  5T1G A;  4MNO A;  2ZTE A;  3NBI A;  4NXM L;  2ID0 A;  3H3V I;  1HR0 W;  2Y0S G;  5D65 A;  1F9S A;  1YBY A;  3MA2 B;  2YTY A;  4X64 Q;  1XMQ L;  4LF6 Q;  2UUA L;  1D5M C;  2A73 B;  1SN8 A;  2RDH A;  3BVM A;  4XXE A;  4J6H A;  3OTO Q;  3L3O C;  3QWN A;  1DZ1 A;  1E24 A;  3CAM A;  1YJN A;  1ASY A;  1EY5 A;  1H9S A;  3J81 i;  4ZAI A;  4G7H C;  3M4P A;  4K6D A;  3KFU A;  4DV0 Q;  2JP1 A;  5IGE A;  3T1H L;  3I4M H;  4PZ6 A;  2HCI A;  1O80 A;  1K8M A;  3HKS A;  2JA7 B;  3ER0 A;  3NEN A;  4FO2 A;  4JI5 Q;  2FMM A;  5ELO A;  2SNM A;  3FRP B;  1QZH A;  1VQE A;  2IPK D;  4PZ7 A;  3RLO A;  5E3F A;  3J81 E;  1PTO F;  2E2J H;  1XMO Q;  2R7Z B;  2MJ8 A;  3NK9 A;  2K32 A;  3I4N B;  4AH6 A;  2ICI A;  2EYF A;  3B6Y A;  2XGT A;  1STN A;  3MXU A;  5AFW A;  3ULJ A;  3W5O A;  4MIU A;  3K8A A;  5BR8 L;  4B3M Q;  4TQU S;  5D3I B;  4IUV A;  5JJZ A;  3A8K E;  3I73 A;  1PH4 A;  3IL8 A;  2QF7 A;  4BBS H;  5LMU L;  1XYI A;  1QWY A;  1EFI D;  4PG3 A;  5M3F G;  2IX3 A;  4BXX G;  1WTR A;  5IOD A;  4AYB E;  3F2C A;  4HMI A;  1SYF A;  2UU9 Q;  4IPC A;  4B3T L;  2KED A;  2I07 B;  5GQO A;  1JR0 D;  3F8T A;  2NVT B;  2B8F A;  1X3Q A;  1EEI D;  3RZO H;  1LLR D; 
#chains in the Genus database with same CATH homology
 3STB C;  4JBJ A;  1BBW A;  2KEN A;  1WCM H;  1MKH A;  4P71 A;  5IWA L;  1H95 A;  1Y1V G;  1XNR L;  1XTD A;  4JBM A;  2DGY A;  3RZD H;  1L1O A;  3DLL A;  1UE1 A;  4L5R C;  2K50 A;  4X66 L;  1X3E A;  3KOJ A;  3PIP A;  4DR1 L;  4X64 L;  1Y1W G;  1YJ9 A;  2PNH A;  1JB7 A;  1SRU A;  3PCO B;  1OXV A;  4DK3 C;  3BJU A;  3CC7 A;  3M3Y H;  4IPD A;  4LF6 L;  1VQ5 A;  3S17 H;  3CCR A;  4DR5 L;  2R7D A;  2VY3 A;  5FLM H;  1L0W A;  4KHP Q;  1QVC A;  4JYA Q;  3NEM A;  1K8G A;  3CD6 A;  5EAY A;  2ZJP A;  1X56 A;  1VQ4 A;  4LF4 Q;  4B3S L;  4X62 L;  3M9B A;  1HNX Q;  2D62 A;  1KHI A;  4DV5 Q;  3ULP A;  3S1N H;  4HIM A;  4DV2 Q;  5K36 G;  2R6G A;  1XJV A;  3F2B A;  4MTN A;  4KI0 A;  4XIG S;  1FGU A;  2UUB Q;  1QZG A;  5LMU Q;  3E0E A;  4EQ5 A;  4R4O A;  5M3M H;  3KJO A;  4OX9 Q;  1NTG A;  1VQJ A;  1PH1 A;  3AFQ A;  2Q2H A;  1IXR A;  5GAH C;  3S16 H;  2GVB A;  1QVF A;  2CFM A;  1GD7 A;  2AKW B;  1L1O B;  3HKZ E;  1MJE A;  4X6A H;  2OQK A;  1WI5 A;  1Q1E A;  3GTK H;  3PF4 A;  4R4Q A;  3S1Q H;  2N8N A;  3MXN B;  4C2M H;  1SRO A;  4UY8 C;  4JI7 L;  2JA5 H;  2VQE Q;  1J5E L;  4HJ5 A;  3RNU A;  3HOW H;  1X54 A;  4BY7 G;  4POG A;  4UPA A;  4LFC L;  2N3S A;  2K75 A;  3HOY H;  4B3R L;  5IE8 A;  1LM0 A;  4JI5 L;  1Q8K A;  4KHZ A;  1TWG H;  1K3R A;  3G48 A;  4DAM A;  2L15 A;  4GN5 A;  3PUY A;  3CCV A;  1XNR Q;  4GN3 B;  4BBR H;  3JAM i;  4X66 Q;  2MO0 A;  5FLX c;  4DR1 Q;  3HFZ B;  4GOP B;  4IOA A;  4R4T A;  1N9W A;  4JOI A;  2NN6 I;  3FKI G;  4BY1 G;  1PYS B;  3PV0 A;  3CW2 C;  2E5L L;  4DR5 Q;  1KXL A;  4C3H H;  2CKZ B;  4UP8 A;  2XTI A;  2RCN A;  1YJW A;  1WJJ A;  5IT9 c;  2B29 A;  4B3M L;  1UE7 A;  1N32 L;  2R93 H;  1X3G A;  4YCV A;  1KRS A;  2PI2 E;  4A3C H;  1VQA A;  1JJC B;  2K5N A;  1T9H A;  4YCW A;  3NBH B;  4A3J H;  5C0X I;  2PQA A;  1EQR A;  2K5V A;  1IBL L;  3E9H A;  1C0A A;  5LMN W;  2A19 A;  2VW9 A;  2JA6 G;  3HOV H;  3UE0 A;  3U50 C;  2B3G A;  3VDY A;  2E2H H;  3M4O H;  2HHH Q;  4YWL A;  2FXQ A;  4DNI A;  4JI6 Q;  4BA2 I;  4DV4 L;  2UU9 L;  2ZJQ A;  4NXN Q;  4QIW E;  4YHH L;  4JI7 Q;  4POF A;  2V1C C;  1EWI A;  4JOI C;  4A3E H;  2A8V A;  1SR3 A;  5M5Y H;  3KDF A;  1TWF H;  1IYJ B;  1EFW A;  4K0K L;  1E3P A;  2BA0 A;  4L5T A;  4A3L H;  5M3F H;  4A75 A;  4JCV E;  1VQN A;  1FJG Q;  1GO3 E;  1WOC A;  2GVA A;  5IP9 G;  2NVQ H;  4MZ9 A;  4P74 A;  4BXX H;  3PGZ A;  4GLV B;  3BZK A;  2PQA B;  3RN5 A;  1N36 Q;  2E2I H;  1YNX A;  4IFD G;  4JI0 Q;  2UXD L;  1Z47 A;  2VQF Q;  2B63 H;  4KHP L;  4JYA L;  1PYB A;  3KYH C;  5IYB G;  3J81 j;  3L0O A;  4DV7 Q;  4TVA B;  4LF4 L;  4OWX B;  3HOZ G;  1LYL A;  3PO2 G;  3D31 A;  4LF8 Q;  4GLA C;  1Y1V H;  3CPF A;  3RLN A;  2OWO A;  5JJI A;  2QGQ A;  2UUB L;  1KD1 C;  4DUZ Q;  2CQO A;  2RF4 A;  4DV3 Q;  2Q2T A;  1Y1W H;  3RR5 A;  4OX9 L;  4R1J A;  3ULL A;  3PO3 G;  1CSQ A;  2IX0 A;  3FP9 A;  4WJ4 A;  4IJH A;  3GTL H;  2JA8 G;  5C44 G;  3S15 H;  1AE2 A;  1VQ9 A;  3RN2 A;  1W2B A;  2YU9 H;  2RHQ B;  1I5F A;  4DV4 Q;  2EXD A;  4A93 G;  1NE3 A;  1VQC A;  1VQH A;  1PH3 A;  4YHH Q;  2VQE L;  1X55 A;  4A4I A;  3W1B A;  2C35 B;  3AQQ A;  4JBW A;  1BKB A;  3UDX A;  4IPH A;  1Q82 C;  3G71 A;  1VQ7 A;  1PH2 A;  4LF7 Q;  5IP7 G;  1D8L A;  2ZM6 Q;  2ASB A;  2UXC Q;  1FVI A;  4JI4 Q;  3CC4 A;  5J3B A;  3T1Y L;  2AHO B;  1V43 A;  2D0O A;  2UUC Q;  3GTO H;  2UXB L;  2MNA A;  1XPO A;  3A5Z B;  2DUD A;  2KCT A;  1SMX A;  2JK8 A;  1D7Q A;  3EN2 A;  2K5H A;  4QQB X;  4LUV A;  3A74 A;  3ZJY C;  3G6E A;  2K4K A;  2IHF A;  3J81 c;  1KC8 C;  1CSP A;  1A63 A;  1YHA A;  1YZ6 A;  2UXD Q;  1N34 Q;  3CME A;  3TEH B;  4HID A;  4BY7 H;  1Q12 A;  1NY4 A;  1HR0 L;  3D0F A;  4GLX A;  2VZA A;  1XNQ Q;  3UDI A;  1C7Y A;  1OXS C;  2JQO A;  1Q86 C;  2AWN A;  4L5S A;  3E9I A;  3I4O A;  1NBW A;  2EIF A;  2ATW A;  3GTQ H;  1RIP A;  2CWA A;  3F2D A;  1GM5 A;  2R7Z G;  1HNW L;  4DR3 Q;  1LTL A;  1CUK A;  4ME3 A;  2QA4 A;  3TQY A;  4J15 A;  4GOP A;  3TS2 A;  5M5W H;  1OXU A;  4Y52 H;  3S2H H;  3FKI H;  4O2D A;  4BY1 H;  2KBN A;  2KCM A;  2F4V L;  3CQZ H;  3PSI A;  4JI2 Q;  1EQQ A;  3LGJ A;  4BA1 I;  4C3I H;  2HHH L;  4OO1 G;  4EX5 A;  5IY0 A;  2ZJR A;  4DV1 Q;  4JI6 L;  3J80 c;  3HOU G;  1L1O C;  2F3I A;  2LXJ A;  4NXN L;  5C3E G;  4YY3 L;  1G51 A;  4A3F G;  2NVX H;  3I55 A;  2VS1 A;  1YVC A;  4LF5 L;  4DUY Q;  4DR4 Q;  4RG1 A;  3K0X A;  3A0J A;  4PZ8 A;  2NZO A;  4QL5 A;  1YHQ A;  3T1Y Q;  2PMZ E;  2UXB Q;  2JA6 H;  2MO1 A;  1K83 H;  2WB1 E;  4R4I A;  2YV5 A;  4YWM A;  1FJG L;  3CPW A;  3GTJ H;  1IBK L;  1KL9 A;  3J7A 5;  2HIV A;  3I2Z A;  3KJP A;  1I50 H;  3CC2 A;  2F52 A;  1N36 L;  2CWP A;  1Q46 A;  1XPR A;  4P73 A;  1JMC A;  4P72 A;  2MFI A;  4PMW A;  4GOP C;  4H02 A;  4JI0 L;  4LF9 Q;  4DR6 Q;  1X9N A;  4IOC A;  1M1K C;  1TWA H;  2VQF L;  4WJ3 M;  1HR0 Q;  4DV7 L;  3CF5 A;  3L7Z C;  4HJA A;  1GKH A;  1U0L A;  4OON A;  3SGI A;  1S72 A;  5GAE C;  5IYC G;  4GNX A;  1OXX K;  2R7F A;  5IP9 H;  4LF8 L;  1PFS A;  2WB1 G;  3ERS X;  3CCS A;  1UE5 A;  4A3B G;  1HNW Q;  1SLJ A;  1MJC A;  3PF5 A;  4HIK A;  1DGS A;  1PH9 A;  3K80 C;  4DUZ L;  3K81 C;  3WWV A;  4DV3 L;  3GTM H;  4A3I G;  2F4V Q;  5C0X J;  5FJ8 G;  5DLQ E;  1QUQ A;  1FL0 A;  5IYB H;  2IT1 A;  2IX1 A;  2LXK A;  1VCI A;  1K73 C;  5GAG C;  3HOZ H;  1HZA A;  2Q2I A;  4YY3 Q;  3CCU A;  4NB3 A;  4LFA Q;  3GTG H;  3STB D;  4JI1 Q;  3PO2 H;  4LF5 Q;  2AWO A;  1CKO A;  2JEB I;  1V1Q A;  4GN4 B;  4YWK A;  4DAY B;  4JC0 A;  3S1R H;  2UXC L;  4DPG A;  2ZM6 L;  4JI8 Q;  2YTV A;  4JI4 L;  4GNX B;  3PO3 H;  2I5L X;  3OYY A;  1HZC A;  5IYD G;  1HZB A;  2UUC L;  3I7F A;  2JA8 H;  3TS0 A;  4GNX C;  1VQF A;  5C44 H;  1IBK Q;  1YHB A;  3U4Z A;  4A76 A;  1PVO A;  4AQY Q;  2R92 G;  1PA6 A;  4A93 H;  4A3D G;  4HJ8 A;  1I94 Q;  4X65 Q;  5JEA J;  4O0A A;  1N34 L;  3KF6 A;  4FDB A;  1N8R C;  3S1M H;  1QUQ B;  4OWW B;  3L2P A;  5IP7 H;  1XNQ L;  4ALP A;  2I5M X;  1J6Q A;  4GKJ L;  1BBU A;  1G29 1;  3BZC A;  2RHS B;  1CKN A;  1SE8 A;  3EIV A;  4KLK A;  3CCJ A;  4A3K G;  1PHJ A;  4DR3 L;  3AEV A;  3ICE A;  4NXM Q;  5M5X H;  1JE5 A;  4IJL A;  1VQ8 A;  1VQP A;  4L5Q A;  4A3M G;  4JI2 L;  2QEX A;  3TRZ A;  4IFD I;  2KHJ A;  3CXC A;  4LFB Q;  2GN5 A;  3JAM c;  4DV1 L;  1P16 A;  1VQI A;  5GRO A;  4JV5 L;  2JEA I;  3I4M G;  1HJP A;  1X65 A;  1VQO A;  1A0I A;  3KF6 B;  4DUY L;  4DR4 L;  1I6H H;  1W3S A;  2ZTC A;  2R7Z H;  3H15 A;  4OWT B;  1Q7Y C;  3HOX G;  2BA1 A;  1EIY B;  3BU2 A;  5C4X G;  1M90 C;  1PH7 A;  1LUZ A;  1XPU A;  1CKN B;  1N33 Q;  1V9P A;  1VQK A;  2VUM G;  1OTC A;  2JA7 G;  4GKK L;  1NMF A;  3HOU H;  4P75 A;  5C3E H;  4A3F H;  1JT8 A;  3AYH B;  3M85 A;  4LUO A;  1YIJ A;  3OW2 A;  4LF9 L;  4DV6 Q;  4DR6 L;  3GTP H;  1AE3 A;  1UEB A;  1IZ6 A;  2BH8 A;  4RMF A;  5AJ3 L;  5C4J H;  2OTJ A;  2Z0S A;  1VQ6 A;  4HJ7 A;  1B7Y B;  4GKJ Q;  1B70 B;  3UE1 A;  2PI2 A;  4HJ9 A;  1G6P A;  1K9M C;  3IRB A;  1S3O A;  2A1A A;  3GDE A;  1Q81 C;  4C3J H;  3CCE A;  2K52 A;  4DR2 L;  4LWC A;  5GAD C;  1IL2 A;  2NVT H;  3PUW A;  1VQL A;  4AYB G;  3I4N G;  1Q1B A;  4BBS G;  5ELN A;  4DK6 C;  2OCE A;  3NEL A;  1ASZ A;  1WYD A;  3H0G G;  1VQG A;  3A5U A;  1TWC H;  3S2D H;  1E7Z A;  4QY7 A;  4UP9 A;  1YI2 A;  1HH2 P;  4DR7 Q;  4JV5 Q;  1UE6 A;  5IYC H;  3S14 H;  1YIT A;  4LFA L;  4Y7N H;  1JJ2 A;  4JI1 L;  2D0P A;  2LSS A;  5BR8 Q;  4A3G G;  3Q8D A;  3OTO L;  5LMN L;  3RLF A;  4A3B H;  2VL6 A;  3GD7 A;  1PH6 A;  4JI8 L;  3CP0 A;  1WFQ A;  4DKA C;  1HNZ Q;  3PUZ A;  4QJF A;  4GS3 A;  4LNQ A;  4A3I H;  1E1T A;  1A8V A;  5FJ8 H;  3PUX A;  1I3Q H;  3K7A H;  1VQM A;  1VQB A;  4DV0 L;  4JI3 L;  1WCM G;  1P8L A;  4AQY L;  1KAW A;  2Y0S E;  4GKK Q;  2Q2U A;  4IO9 A;  1K0R A;  1X6O A;  1IBM Q;  4OO1 I;  1I94 L;  2IY5 B;  2NN6 G;  5H1S E;  4X65 L;  3PUV A;  1R9T H;  2OTL A;  3S24 A;  4B3T Q;  1EIF A;  5AJ3 Q;  3UDG A;  1X3F A;  3UDF A;  4NPS A;  2ES2 A;  2HIX A;  2KHI A;  5FLM G;  5IYD H;  2H5X A;  3DM3 A;  1MIU A;  1A62 A;  2WP8 J;  4MNO A;  3CCQ A;  2ALY B;  2ZTE A;  5C0X G;  1C9O A;  5IWA Q;  4NXM L;  2ID0 A;  3EBE A;  4DR2 Q;  1HR0 W;  2R92 H;  3H3V I;  2Y0S G;  4A3D H;  1EUJ A;  1RL2 A;  1YBY A;  1TWH H;  2WAQ E;  3HKZ G;  4JG2 A;  1NJI C;  2YTY A;  4X64 Q;  1QVG A;  1XMO L;  5M3M G;  4LFB L;  3J7Z C;  1XMQ L;  4LF6 Q;  2YTX A;  2JE6 I;  1U5K A;  2UUA L;  5JJK A;  1SN8 A;  4QGU A;  1TXY A;  1SFO H;  2JJQ A;  2YYZ A;  4X62 Q;  2NZH A;  3OTO Q;  5LMN Q;  4B3S Q;  1CKM A;  1E24 A;  2JA9 A;  3CAM A;  4A3K H;  1YJN A;  1ASY A;  3AFP A;  2JA5 G;  3CCM A;  3W1G A;  1VQD A;  3KF8 B;  3HOW G;  3I56 A;  3HOY G;  1PH5 A;  2WAQ G;  3J81 i;  1GVP A;  4A3M H;  1N33 L;  3F1Z A;  3M4P A;  5JEA G;  3KFU A;  4DV0 Q;  4JI3 Q;  3CMA A;  3T1H L;  1YEZ A;  3M4Q A;  3I4M H;  4PZ6 A;  4BBR G;  4YCU A;  4DV6 L;  3HKS A;  2HT1 A;  2CCZ A;  2Z6K A;  1B8A A;  3HOX H;  1J5E Q;  4AIM A;  1E22 A;  1EOV A;  3ER0 A;  3NEN A;  4B3R Q;  4LFC Q;  2E8G A;  5C4X H;  4JI5 Q;  1EYG A;  5ELO A;  3TRE A;  4OXP A;  4LF7 L;  3M7N A;  2R93 G;  2OQ0 A;  2VUM H;  3G4S A;  1VS0 A;  1PV4 A;  4IPG A;  2JA7 H;  4A3C G;  3JC6 6;  1QZH A;  1AH9 A;  1VQE A;  3MEF A;  4UP7 A;  4A3J G;  1N32 Q;  3GO5 A;  1OXT A;  4LW1 A;  4PZ7 A;  3J80 i;  3RLO A;  5HGQ A;  1JJG A;  1UWV A;  2IHE A;  2E2J H;  1NMG A;  1XMO Q;  2I0Q A;  2WFW A;  5E7N A;  1XMQ Q;  1KQS A;  2N49 A;  2E5L Q;  3HOV G;  2VNU D;  4DR7 L;  2UUA Q;  1BVS A;  1HZ9 A;  4AH6 A;  3W5O A;  3B6Y A;  3ULJ A;  2XGT A;  4IFD J;  5BR8 L;  4B3M Q;  2EQS A;  2MQH A;  3K8A A;  4LUZ A;  2HQL A;  4TQU S;  4DV5 L;  3PIO A;  4APV A;  1HNX L;  4JBK A;  5HY6 A;  4DV2 L;  1Y14 B;  1K8A C;  3FHW A;  4A3E G;  1Z9F A;  3KDF B;  4R4C A;  1PH4 A;  1HNZ L;  2Z6K C;  2BH2 A;  3I4N H;  4BBS H;  1IBL Q;  5LMU L;  3H0G H;  4PG3 A;  4A3L G;  5M3F G;  2NVY H;  1O7I A;  4BXX G;  3T1H Q;  3U58 A;  3CCL A;  1E1O A;  4XTC S;  4AYB E;  3F2C A;  4HIO A;  1IBM L;  4A3G H;  2UU9 Q;  4IPC A;  1PH8 A;  4B3T L;  3KLW A;  2N78 A;  3K7U C;  1L2F A;  2AMC B;  5GQO A;  1KRT A;  1S40 A;  3U4V A;  3F8T A;  2I5H A;  2B63 G;  1KIX A;  5JJL A;  4K0K Q;  3H3V H;  3RZO H;  2ZTD A;  2K14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...