2UUAL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uuaL00
1V9PA 2KHJA 1I3QH 4JI3L 4A76A 3RNUA 3T1YL 1KQSA 1HR0Q 2JA7H 3RZOH 2ZM6Q 1AH9A 3GD7A 5E7NA 2UUAL 1VQLA 1X65A 4L5TA 5FJ8H 1SE8A 2KBNA 3G48A 5M5WH 3FHWA 4JI0Q 2NN6I 2Q2HA 4DR5Q 1PH7A 4DR1L 2PI2A 3ZJYC 3NELA 4HIKA 3MXNB 4GLAC 2GVBA 4IOCA 4X65L 3ICEA 2CWAA 2HQLA 1OXVA 1CKNB 1SN8A 1E1OA 4POGA 4HJ7A 1TWHH 1IL2A 3S2HH 1L1OA 3ULLA 1IXRA 4MZ9A 4LFBL 1J5EQ 4YY3Q 4GNXB 1M90C 3KLWA 5C4JH 4DV0Q 1I50H 3E9HA 3A5UA 3NBHB 2UXCL 4GN3B 1N32Q 2LXKA 1JE5A 1SLJA 1JJGA 4A3EG 3J7A5 3F8TA 3DM3A 5M5YH 4GLXA 1R9TH 2OQ0A 1XMOL 1XNRL 2UXBQ 2JA5G 4DR4Q 2ZM6L 4DR6L 4PG3A 1LYLA 3CC4A 2JEAI 1K8AC 2IX1A 5JJIA 3UDGA 4LF7L 3J81c 1NJIC 1CKOA 3UDIA 3FP9A 3CCUA 4JI0L 4DR3L 2R7ZH 4LF6Q 2A1AA 3LGJA 2F52A 4GOPC 4APVA 2JA9A 2R93G 1IBML 3GDEA 4NPSA 2B63G 4K0KL 3A0JA 3PUZA 4QY7A 3KF6A 1QUQA 1M1KC 1WOCA 3CAMA 5IYBH 1C0AA 1KL9A 1KAWA 2D0PA 1DGSA 4HJ9A 2ATWA 1K3RA 3HOVG 4DV1L 4DUYQ 3PUYA 1Y1VH 3H0GG 5DLQE 2Q2TA 2R92H 3GTJH 2CKZB 2CQOA 4IPGA 4TQUS 1X54A 3AYHB 3GTMH 4JOIC 4OO1I 1N36L 4IFDJ 1UE6A 2Y0SG 2V1CC 3HOZH 3FKIG 3I7FA 4DR4L 1Q1BA 1EIYB 4P74A 1LUZA 4DV7Q 4OWTB 1NMFA 3PGZA 4JBJA 1FL0A 1K9MC 2HHHL 3CCLA 3M3YH 3K7AH 2Z0SA 5LMNQ 3J81i 2H5XA 1YJ9A 3L7ZC 5ELOA 4A3JH 3S2DH 4B3RL 4DR7Q 4OO1G 1EQRA 3J80c 4A3KH 1L1OB 3UE0A 2KCTA 4OWWB 1KC8C 3M4PA 1TWGH 2VW9A 3ULPA 2ZTDA 3UDFA 4LF8L 3EIVA 4DUYL 4DV3Q 3AFQA 4BY7H 4IFDI 1VQPA 2L15A 1X6OA 5GROA 4X64Q 3CP0A 5LMUL 3M85A 2ES2A 1UE7A 2WP8J 1Q7YC 2MFIA 1VQOA 5HGQA 2JA8G 5C3EH 4LUZA 4JI8Q 4YWMA 3W1GA 5C4XH 1Q86C 3RLNA 2IHFA 1E7ZA 3TQYA 2LSSA 4MNOA 4BA1I 1WI5A 4B3MQ 1HZBA 4JBMA 3G6EA 1HNXQ 2N78A 3CW2C 2OTJA 3HKZG 1KRSA 4A3MH 2JJQA 4MTNA 5LMNL 3PCOB 4IPDA 1K73C 3I4OA 4C3IH 2ZTCA 3U4VA 2WAQG 4DV6L 1B7YB 4LFAL 3I4MG 1HNWL 4A93H 3MEFA 4RG1A 3T1YQ 1Y14B 3JC66 4JI3Q 3HOUH 4NXML 3K80C 4DAMA 1VQFA 3J80i 1QVFA 4HIOA 1EOVA 1N9WA 1PYSB 4IJHA 2UUAQ 4R4IA 2D0OA 3S24A 5M3FG 4BA2I 3PUWA 1A63A 4H02A 1V43A 2YTYA 4X64L 5GAHC 1EUJA 5FLMG 4DR1Q 1YITA 2B3GA 4BXXH 1E3PA 1G51A 4X66L 1PA6A 1E1TA 3STBD 3L0OA 4LNQA 1X56A 1Y1WG 1PYBA 1JMCA 1PH2A 2HIVA 4JI8L 1UEBA 4X65Q 4A3CH 5JJKA 2K14A 4JV5Q 1VQJA 1SR3A 3S14H 2JA6H 5IWAL 2KCMA 1MIUA 3M9BA 4OONA 4OWXB 1EWIA 3PIOA 4DV5L 1NMGA 4B3ML 2ID0A 4GKKL 2YV5A 2VZAA 2VNUD 3GTOH 1PH4A 2FXQA 4DAYB 3CQZH 2E2HH 5IP9H 1VQ6A 3TRZA 2IX0A 1S3OA 3BZCA 1AE3A 4P72A 2UXCQ 2MO1A 4Y52H 4Y7NH 1YEZA 5C44H 4XIGS 5C0XJ 1XMOQ 1XNRQ 3CCRA 4JI5L 5IY0A 4DR6Q 3U4ZA 3J7ZC 5IT9c 4HIMA 1I94Q 4A3GH 2K5HA 3K81C 4LF7Q 1Q46A 1W2BA 4DR3Q 2ZTEA 3CMEA 4UP7A 1EIFA 2OCEA 2VUMG 4IJLA 4JI7Q 2MNAA 1FGUA 3PO2G 2F4VL 4AIMA 4A3LG 1WFQA 3PO3H 1VQGA 2PNHA 1IBMQ 1QZHA 2Z6KC 4K0KQ 4JV5L 3S1MH 3S1RH 2I5LX 4DV2Q 2UUBL 4B3SL 1E22A 4A3DG 3PIPA 2D62A 4DV1Q 4GOPA 4QJFA 1C7YA 1VS0A 2VY3A 3M4QA 3HOWH 5C3EG 4DV4L 1H95A 4GLVB 2BH8A 1PVOA 4KI0A 4NB3A 3W1BA 2NN6G 1W3SA 4EX5A 1N36Q 4A3IH 1N34L 1HZ9A 5IP7G 4A3FG 4BBSH 1SRUA 4OX9Q 4JG2A 2EIFA 4R1JA 2E5LL 5IYCG 2KHIA 1OTCA 1X3GA 2HHHQ 1VQBA 1I94L 4QQBX 4JOIA 2Q2UA 4JYAL 3KFUA 1XMQL 3J81j 5M3MH 3OW2A 1UWVA 4JI7L 3RN2A 3I4NG 4B3RQ 4QIWE 2R6GA 4BBRG 3I55A 5IYDH 1OXXK 1LM0A 3S17H 2XGTA 4P71A 5AJ3L 2PQAA 2UUCQ 4R4TA 4LF8Q 4DV2L 1XTDA 4AQYQ 4A3BG 4DPGA 5LMUQ 4NXNL 1RL2A 1LTLA 3D0FA 4JI4L 1NY4A 3D31A 3VDYA 3I2ZA 2JK8A 2K5VA 1PH8A 2NVXH 3M4OH 3OYYA 4JI1L 4GN5A 2JEBI 1YJWA 4OX9L 3CF5A 4FDBA 3HOXH 3AQQA 2OQKA 4QL5A 1KHIA 1E24A 1WCMH 4R4CA 4LF4L 1CUKA 1V1QA 3KOJA 1MKHA 5C44G 4POFA 1HZAA 4HJ8A 4O0AA 2WFWA 1Q12A 3TREA 4DV6Q 4LFAQ 3T1HL 2JA7G 3BJUA 3RR5A 3GO5A 1HNWQ 3G71A 4L5QA 5FJ8G 1HJPA 4NXMQ 4R4QA 2UUCL 3GTLH 2CCZA 4YCUA 1PHJA 1YBYA 4IPCA 1JJCB 1QVCA 3CCQA 1BKBA 4AQYL 4BY1H 4UPAA 3K0XA 3KJPA 1IBKL 1KD1C 4X66Q 4O2DA 4X62Q 1QVGA 2VQEL 4PZ8A 4UP8A 2WB1E 4OXPA 3UE1A 3KJOA 1AE2A 2HT1A 5IWAQ 1CSQA 3EBEA 5M5XH 4LF9L 4GKKQ 2MO0A 1GO3E 1K83H 3I56A 4DV5Q 4KHPL 4DNIA 4ME3A 3F2DA 4JI6Q 2VL6A 4AYBE 2Q2IA 4R4OA 3SGIA 3U58A 1G291 3ER0A 1C9OA 4LUOA 4IFDG 3NEMA 2NZHA 4DK6C 3CCEA 3CCVA 4JI5Q 4LWCA 3UDXA 3KF6B 1QUQB 1VQHA 1OXTA 2R7ZG 3CPFA 3KDFA 5GADC 3AEVA 3GTPH 1VQNA 2I0QA 3S15H 1BVSA 1VQ8A 3RLFA 4IPHA 1TWAH 4A3EH 2NZOA 2ZJPA 2NVTH 3KF8B 4X62L 2N3SA 3IRBA 4B3TL 1GVPA 5IYBG 2F4VQ 1D7QA 2JA5H 3HOYH 2A19A 1P8LA 1WYDA 4JI2Q 3TS0A 3JAMi 1Y1VG 2R92G 4WJ4A 1Q82C 1NTGA 4LFCL 1HZCA 1YVCA 4XTCS 4GS3A 2ZJQA 2YTXA 1S40A 2UUBQ 1ASZA 4B3SQ 4JI6L 2XTIA 2IHEA 1A8VA 2ASBA 2N49A 4YWLA 4DV4Q 1JB7A 5K36G 2Z6KA 1L0WA 4IOAA 3HFZB 2EQSA 3HOXG 3HOZG 2R93H 2E8GA 2RHSB 1N34Q 3EN2A 3CC7A 3CMAA 3GTGH 2LXJA 2E5LQ 4RMFA 3HOVH 1P16A 4GNXC 2YYZA 2F3IA 1SFOH 3H0GH 1I5FA 4GKJL 4JYAQ 4A3JG 2UXDQ 1YHBA 1XMQQ 4P73A 1KXLA 5H1SE 2OTLA 1VQCA 2ZJRA 1OXUA 4A3KG 2E2JH 2AWNA 3FKIH 3A74A 3F2BA 3CCSA 4DK3C 4JI2L 2GN5A 4A4IA 4KLKA 5AJ3Q 1N33L 2K52A 1YZ6A 3PUVA 2KENA 1VQMA 5BR8Q 4AH6A 4J15A 4LUVA 3OTOQ 1GKHA 4PZ7A 5J3BA 5C0XI 5C4XG 4YWKA 4NXNQ 2EXDA 1YIJA 4JI4Q 2IT1A 4WJ3M 2JE6I 3E9IA 4C3JH 4JI1Q 4YCWA 3GTQH 4A3MG 5GAGC 3Q8DA 4LF4Q 1SROA 2ALYB 3KDFB 2NVQH 1VQ9A 1XPUA 2UXDL 4DR2L 1XNQL 1TXYA 1HR0W 3DLLA 4A93G 2JA8H 1G6PA 1VQEA 1D8LA 3L2PA 4DUZL 3HOUG 5C0XG 4IO9A 3T1HQ 1QZGA 4UY8C 4LF5Q 1FJGL 3B6YA 1PV4A 4QGUA 1A0IA 1EYGA 2Y0SE 1YHAA 1PH5A 2I5HA 3BZKA 4P75A 2PI2E 2YTVA 1EQQA 5BR8L 1YJNA 1HNZQ 1PH3A 4BXXG 1K0RA 1IBKQ 3OTOL 3I4MH 1HR0L 1CSPA 1VQ7A 3HOYG 4A3CG 1J6QA 3CPWA 2AHOB 2JA6G 1JT8A 2VQEQ 4JC0A 2QGQA 3F1ZA 1L1OC 4A75A 4DR5L 1B70B 1VCIA 4LF9Q 1YNXA 1FVIA 5IP9G 3K7UC 5M3FH 4KHPQ 1N33Q 1VQ5A 3RLOA 2N8NA 5FLMH 3K8AA 1TWFH 4YCVA 4C3HH 1S72A 1Y1WH 1J5EL 4YY3L 4L5RC 1PH6A 2AMCB 1RIPA 2K5NA 2DUDA 3PF5A 4LF5L 3TS2A 2RCNA 1TWCH 4DKAC 4A3GG 4DV0L 2IY5B 4GN4B 3H15A 1N32L 3CCMA 1HNZL 1L2FA 1OXSC 4HJAA 4GOPB 2R7DA 1ASYA 3NENA 3PO3G 2BH2A 2UXBL 3HKZE 5ELNA 1PH1A 3TEHB 2CWPA 1N8RC 1UE1A 2I5MX 4B3TQ 5FLXc 2AWOA 1U0LA 2B29A 2WAQE 1VQAA 5GQOA 3JAMc 1MJEA 1K8GA 1JJ2A 1Q8KA 3RZDH 4LF6L 3M7NA 4LFCQ 3HOWG 1HH2P 1VQIA 4C2MH 1Q81C 1VQKA 2BA1A 3H3VH 1X3EA 2R7FA 2CFMA 2YU9H 1X55A 3BU2A 3F2CA 4A3IG 1PH9A 2VUMH 5JEAJ 3S1NH 3PO2H 1YHQA 2HIXA 3S16H 4BBSG 4A3LH 5IE8A 1VQ4A 4X6AH 1X9NA 1BBWA 1NE3A 1A62A 1GD7A 4HIDA 1IBLQ 5LMNW 2VS1A 1Q1EA 4JBWA 2UU9Q 1EFWA 2C35B 4LW1A 2VQFQ 3GTKH 2PQAB 5GAEC 4A3DH 2NVYH 4GKJQ 1T9HA 2RHQB 3U50C 4TVAB 5M3MG 1GM5A 1IYJB 1CKNA 5IYDG 1O7IA 4UP9A 2BA0A 2OWOA 5IP7H 1CKMA 4DV7L 1KRTA 4GNXA 4A3FH 2QEXA 1I6HH 2DGYA 3PV0A 2A8VA 5IYCH 3CC2A 3PF4A 2E2IH 3ERSX 1WJJA 4YHHQ 2K4KA 1Z47A 1XPRA 4DR7L 3G4SA 2K50A 2WB1G 2QA4A 4BY7G 3A5ZB 1VQDA 3CCJA 1XPOA 3I4NH 3WWVA 2MQHA 1Z9FA 4BBRH 2GVAA 4AYBG 2K75A 1XJVA 1IBLL 2B63H 1MJCA 1WCMG 4DV3L 4L5SA 3PSIA 2UU9L 4ALPA 3HKSA 3AFPA 3W5OA 2VQFL 3RN5A 2AKWB 5EAYA 1PFSA 1IZ6A 1BBUA 2PMZE 3KYHC 4JCVE 2JQOA 3CXCA 1YI2A 4A3BH 1UE5A 5JEAG 4DR2Q 1XNQQ 3E0EA 4EQ5A 2RF4A 4LFBQ 3STBC 4DUZQ 5HY6A 1U5KA 1SMXA 3H3VI 4PZ6A 1HNXL 3CD6A 1FJGQ 5JJLA 4HJ5A 3S1QH 1B8AA 3PUXA 4KHZA 1KIXA 4JBKA 4YHHL 4BY1G 4PMWA 3ULJA 1X3FA 1NBWA
chains in the Genus database with same CATH superfamily
1LTBD 4KY6A 2KHJA 3VYUA 4A76A 3RNUA 1XX8A 4LK1C 1JORA 1KQSA 4K8IA 2EY6A 3NQIA 5J1ZA 4L5TA 1SE8A 2EYLA 1JCKB 3FHWA 4CGYB 5FO9B 2SOBA 4HIKA 1OXVA 1K83B 1L1OA 3ULLA 5CMDA 5ELCA 3K58A 4RH6A 4Z9CB 4YY3Q 2F0QA 5DM63 3KLWA 1EIHA 1NR4A 5C4JH 4R8IA 4NW2A 5I2XA 3NBHB 2LMCB 2LXKA 1I4PA 1V8QA 2BCOA 5M5YH 4X3KA 3SK5A 1XNRL 5G3LD 2UXBQ 2BE5D 2JA5G 4DR4Q 4DR6L 4PG3A 1K8AC 2M2LA 3UDGA 1D5MC 3J81c 1CKOA 3NWTA 3UDIA 3A8IE 2MHVA 5KNDA 4LF6Q 2JA5B 1CA6A 5EJWA 4GOPC 4R9WA 2NTSA 2JA9A 3KF6A 1GXDC 2SDFA 1SNMA 3CAMA 4MIUA 4IZ8A 1PRTF 5DLQE 1CFMA 1M8AA 2R92H 5EKKA 5J39A 2SNMA 4IUQA 4DF7A 1N36L 2D2CC 4IFDJ 1IW7C 4DR4L 4BWGB 1EIYB 3D3RA 1LUZA 4DV7Q 4OWTB 1K9MC 3PGZA 2HHHL 3M3YH 1LTAD 2Z8LA 5LMNQ 4DAYA 2EOTA 4A3JH 4DR7Q 5CV7A 1ML0D 3TP6A 4ZYSA 3K0YA 1QJOA 4P2CB 2MP1A 3DWQA 1L1OB 3TP5A 4LF8L 1TWGH 3V05A 2ZTDA 2JA7B 4DV3Q 1HXYD 2NB0A 1UEAB 4RGTA 4X64Q 5GROA 5M5WB 3M85A 5HGQA 3OIQA 5HGTA 2DY7A 3ND8A 4BA1I 2E2DC 1HZBA 3G6EA 3CW2C 1H9KA 1KRSA 3HKZG 3MTSA 4KMUC 5LMNL 4A3MH 3PCOB 4IPDA 3I4OA 1B3QA 2HQEA 4PQXA 4A93H 1HNWL 3T1YQ 3JC66 3HOUH 1YNJC 3BDOA 1VQFA 5D65A 4IJHA 1IKLA 2UUAQ 1BR9A 1I4QA 3DHQA 2M9VA 5M3FG 1EL0A 4BA2I 4KKSA 4X64L 5GAHC 1YITA 1A63A 3D8GA 2B3GA 3J7YW 1BCPD 1PA6A 5CBAE 3L0OA 1PH2A 1UEBA 5M3FB 3S14H 1SNCA 3U9SA 4EVOA 3BVMA 5IOCA 2JA6H 4OONA 1EWIA 1NMGA 1IYUA 3NK9A 2VZAA 3GTOH 2FXQA 3G7LA 4DAYB 3CQZH 2E2HH 1S3OA 2UXCQ 3GTJB 1YNNC 1YEZA 3CCRA 2OF1A 4JI5L 3HOZB 4A3GH 4LF7Q 5ISRA 3SK8A 1UAPA 2K5WA 1TT2A 4UP7A 2OCEA 4JI7Q 2F0FA 1WFQA 2QF7A 1VQGA 1ZEQX 4CJ1B 3OWFA 3C3LA 2I5LX 2NYZD 1GUWA 1SXTA 4Q5VA 4B3SL 3N6RA 3S1NB 3PIPA 2D62A 4DV1Q 3DWAA 3M4QA 5C3EG 4GLVB 2BH8A 4OEMB 5E4XA 1Y8OB 2NN6G 1W3SA 3J7AF 4K8JA 5IP7G 4A3FG 1SRUA 4OX9Q 1F77A 5C3EB 4WFN3 1X3GA 3T56B 1VQBA 2PW7A 1B9MA 2Q2UA 3NPPA 4IALA 4A3FB 4MHEA 3OW2A 1UWVA 4JI7L 3PQIA 3I4NG 4B3RQ 4QIWE 4H0LC 4BBRG 5I6WA 3I55A 5EBDA 4C3IB 4X3TA 3H91A 5KIXA 5IT9E 4R4TA 1SEBD 4BBRB 3TZDA 3QOLA 4AQYQ 3W3AA 4NXNL 2K7VA 3KLSA 1LTLA 4JI4L 2AQ1B 3D31A 2NVXH 1PH8A 1EOTA 2K5VA 3RMHA 3Q24A 5CV4A 4GN5A 1YJWA 4OX9L 2TSSA 3R2IA 4J6HA 4QL5A 3A7LA 2F1MA 3NUCA 2EJFC 4OGQC 5C44G 4KD4A 4FF4A 1ENCA 1PZJD 2PYKA 3T1HL 5I9PA 3RR5A 3G71A 2E75C 5FJ8G 4Y7NB 3DEPA 5C44B 4R4QA 4YCUA 5KEEA 1YBYA 1ET9A 1SYDA 4IPCA 1JJCB 3UI2A 4AQYL 4BY1H 5KYLA 1D5ZC 2VB2X 5A2QE 3RUZA 2RVLA 4X62Q 4RHSA 3UE1A 1B4OA 4LF9L 1NR2A 4DV5Q 3I56A 4KHPL 3F2DA 2VL6A 2EDGA 3QG1A 3KBXA 4IFDG 2LFNA 3HOWB 2HDMA 5HURA 5I9OA 1D1KA 2RSOA 2CH4W 5CGKA 3HGBA 1OXTA 1X3PA 3H94A 4PV1C 2CW0D 1H9SA 3GTPH 2JSOA 1VQNA 5IGEA 2F0JA 3S15H 1BVSA 3RLFA 1QOHA 1Q3LA 4IPHA 3OIPA 2NZOA 5JPNC 4X62L 4B3TL 2F4VQ 1D7QA 3K5LA 1GVPA 5M3MB 5IYBG 3HOYH 4CBVA 1P8LA 5C3WA 4O1NA 1Y1VG 2C9OA 1NTGA 1HZCA 1YVCA 3A8JE 2YTXA 1ASZA 3C1EA 1D6EC 4DV4Q 1JB7A 1LLRD 4IOAA 1Y1VB 3HOXG 1STNA 2K32A 2WB1B 3CC7A 3V96A 3NWSA 3GTGH 4FYDA 2C5CA 1F9PA 1EYAA 3EQLC 3H0GH 1I5FA 3EA6A 3HOXB 4JYAQ 1K8OA 4XXEA 2UXDQ 4HCSA 2EY1A 4P73A 3BVZA 2WKDA 4A3KG 3X3NA 2E2JH 1JOQA 3FKIH 1NCVA 2EE1A 1QWYA 1CTMA 1TU2B 2KENA 5BR8Q 1TR5A 5IGCA 3R8BA 4YIJA 1LTGD 4LUVA 1GKHA 2CH4A 2EXDA 4OO1H 4WJ3M 2JE6I 3OPOA 3GV6A 3Q8DA 5FO7B 1H9SB 5M5XB 2UXDL 3DLLA 2DY8A 1WTPA 1OO9B 3VR2A 2Y0SE 2Q8TA 2EYPA 1F2YA 4P75A 2PI2E 2YTVA 5BR8L 1YJNA 1PH3A 3MFGA 1IBKQ 2JYOA 5FKAC 3VR3A 4A3CG 5K5PA 1PTOH 3SK4A 4CKEA 2QGQA 3F1ZA 3K5OA 4NP5A 2FMCA 3I90A 1KABA 2F0GA 1TWFH 4DAVA 1Y1WH 2IL8A 2RCNA 1G8ZD 4DV0L 4KN7C 4GN4B 4TKOB 2F0UA 4ZUJA 4K5VA 1DM0B 1Q90A 3JAML 4DGZA 3T53B 2XSCA 4NDXA 2WV6D 1LO5D 1PTOD 1MJEA 4LFCQ 1VQIA 4C2MH 5I4DA 1PH9A 4KKTA 4BBSG 3PO2H 1YHQA 2HIXA 1U4PA 1GD7A 5DEHA 4NKLA 1IHZA 4LW1A 2VQFQ 1A3TA 1O7ZA 1CQVA 3U50C 4GKJQ 2DJGC 1CKNA 2H1EA 5IGFA 1G91A 2OWOA 2MPMA 1KRTA 4GNXA 2QEXA 2DGYA 3PV0A 3PF4A 5L37A 3SEBA 1WJJA 1ZYRD 1I4HA 3KBGA 1XPRA 2K50A 3BDLA 2R61A 1DD2A 1XPOA 1TQOA 3WDNA 2MQHA 1KDAA 2GVAA 1TY2A 5FLXE 4AYBG 1PFNA 2K75A 2SNSA 3PIP3 2B63H 1Y8PB 3AFPA 3M4OB 2VQFL 1FYCA 4JCVE 2JQOA 4C1NK 2QDBA 4A3BH 4QMGA 4DUZQ 1KLUD 5EKLA 4C3HB 1HNXL 1FJGQ 4KHZA 1KIXA 3OOCA 3GTMH 3AMUA 1SYBA 4HMJA 2A74C 1HR0Q 3RZOH 1AH9A 2ZM6Q 2MJ8A 2EY2A 5E7NA 1G6ZA 1X65A 1LTTD 1PFBA 2QCPX 3G48A 4HSPA 2NN6I 2Q2HA 4DR5Q 2N88A 2FMMA 2J4XA 4DR1L 1SSOA 1RJTA 1X32A 3ICEA 1WTRA 1PMRA 4LJZC 2HQLA 1SN8A 1CKNB 3S2HH 2MGSA 2A6EC 4K6LA 1EWCA 2K5QA 1H9RA 4GNXB 2XRQD 5AFWA 4EGVA 1N32Q 1O80A 1ZXTA 3MEHA 4A3EG 3GTKB 4A3DB 3F8TA 2NVYB 4RCOA 1R9TH 1XMOL 2KHSA 2H4OA 3WOFA 2ZM6L 1HFGA 4L6TB 1LYLA 5LL6S 3VA5A 4A3EB 2NVTB 3FP9A 5C5LA 4DR3L 4DU9A 1GHKA 3LGJA 3GP7A 1ESFA 2R93G 1IBML 3W2DA 1M1KC 1C0AA 4I65A 1KL9A 4Q0FA 3HOVG 1DGSA 2ATWA 1K3RA 5DNFA 3PUYA 2B2TA 1K8MA 2R93B 1EU4A 3NBIA 2CKZB 1C4QA 4TQUS 1X54A 4WORA 4OO1I 3DEOA 1UE6A 2V1CC 1MD2D 3I3CA 2KQ3A 1F2ZA 1JR0D 3A8KE 3C2PA 1YJ9A 1PRTC 4RGOS 4CDEC 5M9OA 1B2TA 1JWMD 3S2DH 2PNRC 4RA8A 2A6HD 1EQRA 2EZVA 1G2SA 1TS2A 4C3JG 3QR8A 1EEID 3M4PA 1K28A 3UDFA 3OSOA 2F0VA 1WD1A 4IFDI 1VQPA 3HG9A 2L15A 2ES2A 1JOKA 5EPJA 4C3JB 1Q7YC 2F3VA 4IUUA 1VQOA 4LUZA 3W1GA 5C4XH 2J0TD 2IHFA 1TS3A 4IQZA 2LSSA 4B3MQ 4KHVA 1WI5A 1U4MA 3I8ZA 1SMYD 2I46A 1QNUA 1NAPA 2ZTCA 3I4MG 2WAQG 2XWJB 1B7YB 4DV6L 4RWSC 4EQNA 4G7OC 4NXML 3DMUA 5C0XH 1QVFA 3J80i 5M5YB 4HIOA 2HUGA 1EOVA 1N9WA 3I4MB 2WAQB 4R4IA 5ELDA 3S24A 2B2WC 3BDCA 4H02A 1V43A 2YTYA 1EUJA 5FLMG 1G51A 4CKCA 1PYBA 2HIVA 1SYEA 2K5DA 3J80E 5T1GA 1F9SA 1SR3A 3I72A 2KCMA 3M9BA 4B3ML 2G9HD 1PH4A 3NQTA 1VQ6A 2IX0A 2R92B 5IT9L 3BZCA 4P72A 4UHVA 1C8CA 1I4XA 1XXGA 4XIGS 2J7ZA 1XNRQ 5IY0A 4DR6Q 5CR3A 4DXFA 2K5HA 4S3SA 2BOSA 1EY4A 4F88A 4IJLA 4ILWA 1JWSD 4AIMA 2CQAA 3S1MH 3HP3A 2YU9B 1AFPA 4K5XA 2PZWA 2SEBD 4DV2Q 3E6ZX 2EYHA 2B8FA 2VY3A 3OMCA 3DM1A 2PMZB 1BCPB 1N36Q 4A3IH 1HZ9A 4JG2A 4R1JA 2E5LL 2B2VC 5IYCG 5A2QL 1TIID 2HHHQ 4JOIA 2L5TA 2AQ2B 1MSGA 2F0EA 1XMQL 1I6HB 3CHBD 2E2IB 5IYDH 1OXXK 2Q8IB 1QB5D 2XGTA 1PXUA 4P71A 5AJ3L 1RODA 1T5EA 2UUCQ 4LF8Q 4ZRZA 4DV2L 1SJHD 4V190 1V1PB 2WIIB 1IW7D 2DN8A 3SXHA 3J7A5 3WOEA 1NY4A 4BY7H 3I2ZA 2JK8A 4JI1L 2RDHA 2X6LA 1E24A 4R4CA 3BS1A 4LF4L 3J7AV 1CUKA 2K01A 3Q0AA 4HJ8A 1U4RA 4O0AA 1STHA 2WFWA 2JA7G 3GTOB 3CQZB 2E2HB 3VR5A 3BJUA 1WTXA 4IUTA 1HNWQ 1RKNA 1BXTA 2UUCL 3GTLH 1I3QB 3E0JA 3VYTA 4IURA 3K0XA 3KJPA 5T1IA 1SJED 4QIWB 4OL7A 1KD1C 3F2UA 5CYUA 1DXMA 3NSWA 2VQEL 1U4LA 5IODA 3L3OC 1FD7D 1AE2A 1K83H 1TWHB 2FHTA 2Q2IA 4R4OA 1G291 1C9OA 4LUOA 1YNJD 2DNCA 1I50B 4JPBW 4DK6C 3CCEA 3FEWX 1BO0A 4JI5Q 3KF6B 1BF4A 1JOOA 2R7ZG 1GOZA 1VQ8A 2PCFB 1E2ZA 2KVMA 2R7ZB 3IRBA 2JA5H 2B8GA 4JI2Q 1WYDA 5D3IB 2P5ZX 3OW7A 1Q82C 5I6YA 2ZJQA 1ONLA 4B3SQ 3D4DA 2XTIA 1R4PB 1YNND 2IHEA 2N49A 4L63B 4N9TA 5K36G 2Z6KA 3HOZG 3CMAA 2NVXB 3FPPA 3BYYB 4RMFA 2YYZA 2B2UC 1KNEA 2HDLA 3C46A 2VXWA 1VQCA 1I4RA 3K7AB 1AZQA 4XT1B 1RTOA 5FO8B 4CDFC 1G2TA 2EJGC 4JI2L 1B3AA 4KJOA 1F2MA 4TRDA 5KYIA 1VMCA 2B2YA 3EVQA 4AH6A 4R8NA 4J15A 4PZ7A 5J3BA 5C0XI 1CHQD 2F0TA 4NXNQ 2KCNA 3D6CA 4JI4Q 2RSNA 3CKIB 4OHJA 5CV8A 2XWBB 1RF2D 2ALYB 4C3IG 1XPUA 1KNAA 2PW5A 4DR2L 3A54A 1A2UA 1VQEA 1D8LA 3L2PA 5CBEE 3T1HQ 1QZGA 1Z7TA 4K6DA 1EYGA 1PH5A 3IKJA 4RCNA 2WACA 1EQQA 5E1FA 1HNZQ 4BXXG 4EQOA 3HOYG 1CSPA 3GTPB 4KJNA 3NXWA 1JT8A 3RD4A 4M1UB 3V2TA 3NTIA 1PFMA 1M4VA 1L1OC 1EY7A 1D5XC 4LF9Q 3HOYB 1FVIA 5IP9G 4KHPQ 5M3FH 3RLOA 1L0YB 2L4NA 3EJIA 1SDFA 2F0NA 1J5EL 1SNQA 5JEAH 1CT1D 1RIPA 2DUDA 2XVSA 2IY5B 4LMQD 2NTTA 3GTGB 4K5WA 1EZ8A 5FLXL 3CCMA 1HNZL 1L2FA 4HJAA 1X3QA 3PO3G 3HKZE 5ELNA 3TEHB 2CWPA 1N8RC 2I5MX 4B3TQ 4HN7A 3JAMc 2Y0SB 5IGBA 2R3ZA 2E2JB 2ZXOA 1ILPA 3PO3B 2KCCA 3RZDH 2WINB 3HOWG 5COYA 4UAIA 2RBMA 1Q81C 3S1RB 2BA1A 1LT4D 3L9AX 1X55A 3F2CA 3S1NH 5IE8A 4XQQA 1X9NA 4DN4M 1A62A 1HQRD 1EY5A 2PZUA 2VS1A 1WTOA 1H9MA 4JBWA 2IX3A 1FNUA 5GAEC 1WVLA 5M3MG 3MXNA 2BDOA 1SYFA 1IYJB 2NN6H 4UP9A 2BA0A 5IP7H 1CKMA 4A3FH 2RCFA 3OWEB 3KUPA 3ERSX 1I6VC 4YHHQ 3S17B 2RA4A 2WB1G 1BCPF 3T16A 3G4SA 5DM73 4KY7A 1IKMA 1VQDA 3I4NH 3T4AC 3IL8A 4BBRH 3HZXA 4QB4A 1XJVA 1MJCA 1WCMG 2O4XA 1CI3M 4L5SA 1PTOB 1SNPA 3RN5A 1LTRD 1PFSA 1IZ6A 3KYHC 2I07B 1WCMB 1LT3D 4LFBQ 3STBC 1SMXA 1TWFB 4PZ6A 3CD6A 1Y1WB 3S1QH 1B8AA 3G6JB 4YHHL 4KY5A 1ZKOA 4JI3L 1ICFB 2KJXA 3AU7A 2A73B 5FJ8H 1KDBA 4IUNA 1K0SA 3NELA 2QILA 3MXNB 4GLAC 2GVBA 4IOCA 1FNVA 4X65L 2CWAA 4C2MB 1RDPD 4HJ7A 1S5DD 4LFBL 2PZTA 4U673 3NP8A 4PMCA 3SVMA 2KECA 4DV0Q 4KKUA 1QILA 1TS4A 3FPUB 4L8JA 4ME5A 1SLJA 4CKBA 3SK6A 1JJGA 4K14A 4GLXA 4IFDH 2OQ0A 1CK1A 5FOBB 3CC4A 2JEAI 1RHPA 2EYOA 5JJIA 1NJIC 3R93A 2F0KA 3CCUA 1SE4A 4B9XA 5IIFA 1QG7A 2A1AA 2F52A 1JE4A 2L11A 4APVA 3GDEA 2B63G 4K0KL 3A0JA 1QUQA 1WOCA 4RKLA 5IYBH 2K1BA 1Y1VH 3FDTA 2B63B 2CQOA 4WRDA 3KF8A 3VYSA 3I7FA 4A3BB 1Q1BA 2IJ0A 1NMFA 4JBJA 1FL0A 3CCLA 4OELB 3J80L 1E2VA 3J81i 2H5XA 1MSHA 3KK7A 5ELOA 1STAA 1VDZA 3GTMB 2V4DA 4A3KH 2KCTA 4OWWB 5JVG3 2ZXRA 1CZGA 3ULPA 2VW9A 3J81E 1W6JA 3IFDA 1X6OA 1CHPD 5LMUL 2JA8G 3GTQB 4F8MA 2F0SA 4JI8Q 1Q86C 1E7ZA 1Y69U 3S2HB 1Q8IA 2N55A 2B39A 1HNXQ 2N78A 2JA8B 2OTJA 1EY6A 2A69C 2F4IA 2KOLA 2JJQA 4MTNA 1FR3A 1WTHA 1EY0A 4LFAL 2KEDA 3MEFA 4MN3A 1Y14B 2F0MA 3K80C 4DAMA 4FF2A 5BN3A 1PYSB 1NSNS 5EBCA 3K5MA 4JK1C 3MWYW 3PUWA 5ELBA 4DR1Q 1E3PA 4X66L 1E1TA 4LNQA 4C3HG 1X56A 1JMCA 4GZYC 4JI8L 3Q22A 2CVRA 4A3CH 5JJKA 2K14A 4JV5Q 5IWAL 1MIUA 3PIOA 4OWXB 4GKKL 2DJFC 2YV5A 2VNUD 4XQJA 2RQXA 3TRZA 3SDZA 4ZKCB 1FGBD 1AE3A 1TWCB 2Z4HA 3Q6SA 4Y52H 1HFNA 1ENFA 3EFXD 4N9PA 1XMOQ 1LT5D 1EQTA 3U4ZA 5IT9c 4HIMA 1GHJA 3K81C 1Q46A 1W2BA 4DR3Q 2ZTEA 3CMEA 1EIFA 1T5XD 2AQ3B 1EIGA 2G9DA 2VUMG 5KGUA 4A3LG 1IBMQ 1QZHA 4JV5L 3A56A 4CDDC 4I7ZC 2IWHA 5TSSA 2A68C 2VUMB 2UUBL 4A3DG 3S16B 4GOPA 1LV9A 1VS0A 4N8FA 1C7YA 1H95A 4NB3A 1F9RA 1N34L 3R3OA 1HTLD 3Q23A 4BBSH 2F0HA 1HPCA 2EIFA 3QJYA 1A2TA 4QQBX 1A6XA 3KFUA 3K59A 1A3UA 2ICIA 4HMIA 4DFAA 1MGSA 4DK1A 5CV9A 1QE6A 1LM0A 3A7AB 1J8IA 1SE2A 2PQAA 4DK0A 3I73A 1JC7A 1DOMA 4KD3A 3EROA 1RL2A 3VDYA 1F9QA 2RKSA 3M4OH 2LKVA 3OYYA 3S9WA 3CF5A 3E3XA 4WJWA 1PRTD 4QCLA 4CHTB 1V1QA 1EWHA 2OT2A 5FK9C 4POFA 1HZAA 1JB3A 1VMPA 3CRLC 5BN4A 1BBXC 1L0XB 1JWUD 3TREA 4DV6Q 3MXGA 1E2WA 3GO5A 4L5QA 1QCBD 1HJPA 4O42A 4NXMQ 1PTOF 4ODGA 1XWEA 2F0DA 1DONA 1QVCA 1HTPA 4O2DA 1QVGA 5ELFA 4OXPA 3KJOA 2K04A 2MO0A 4DNIA 4ME3A 3S1MB 3TSSA 4AYBE 3SGIA 3IAYA 3ER0A 3TMEA 5C4JB 3NEMA 1EY8A 3CCVA 2G5DA 4A3IB 4LWCA 4RAUC 3CPFA 3KDFA 5GADC 4FVMA 5KNBA 1KLGD 1ESRA 1Z6HA 1TWAH 4A3EH 1WTWA 3VR6A 2ZJPA 2NVTH 2F0PA 2A19A 3TS0A 3JAMi 2R92G 5EKIA 1S40A 1S4ZA 2EYJA 1A8VA 4QUFA 1PDQA 4YWLA 1B53A 2E76C 5CORA 2Z6BA 3NHHA 1STBA 3E5SA 2R93H 2RHSB 3EN2A 3ND9A 2AUKA 3H3VC 2LXJA 2E5LQ 2RDFA 3HOVH 4FNFA 4GNXC 3P20A 1SFOH 4A3JG 1O7LA 1XMQQ 1KXLA 3TP7A 5H1SE 3M3YB 2E74C 3D4WA 2ZJRA 4ZLTF 1B44D 3A74A 2LY7A 1BOSA 4A3JB 2GN5A 4A4IA 4KLKA 5AJ3Q 2K52A 3PUVA 1VQMA 2LS01 3GTLB 3QOJA 2K33A 1TWGB 3MFYA 3OTOQ 4YWKA 1YIJA 2IT1A 1GUGA 3E9IA 4C3JH 4JI1Q 1TS5A 1S5ED 3I70A 4YCWA 3H6MA 4A3MG 4LF4Q 3KDFB 2NVQH 1DZ1A 1VQ9A 1RTNA 2EVBA 1XNQL 1SNOA 3SHLA 1C48A 4ZK9B 1WD0A 4A93G 1G6PA 3HOUG 4A3MB 4UY8C 4LF5Q 1YHAA 1E0BA 2L12A 1HA6A 3HEJA 4A93B 2XRSD 3T51B 3HOUB 1A3VA 1TY0A 1K0RA 3DXJC 3OTOL 3I4MH 2F3WA 1VF5C 2JA6G 3FMCA 2VQEQ 4JC0A 4V0BA 2BE5C 1VCIA 3ITPA 1YNXA 1LTSD 3S14B 1VQ5A 3MHBA 2JA6B 5FLMH 5C6AA 4L5RC 4YY3L 2AMCB 2K5NA 2K6AA 2QKIC 4LF5L 1ILQA 3TN2A 4A3GG 3N52A 2R7DA 1CM9A 2EPBA 2BH2A 4A3GB 2UXBL 4HR7B 1PH1A 5FLXc 2AWOA 2WAQE 2EYFA 1JJ2A 4LF6L 3M7NA 1HH2P 2B2TC 1CA5A 1LABA 2R7FA 2YU9H 1GUNA 5A35A 1VQ4A 4DAPA 3PIO3 4HIDA 1NE3A 1IBLQ 5LMNW 1ENAA 5JOBA 1Q1EA 2UU9Q 5KRUA 2RHQB 4TVAB 1O7IA 4TSSA 1HCZA 4DV7L 1I6HH 2A8VA 5IYCH 3CC2A 2E2IH 1WTVA 2RDGA 4ZUIA 2KA7A 4H44C 4MTKA 4PNYA 4DR7L 1BQQT 2QA4A 4FO2A 3A5ZB 1D1IA 4FXGC 3HKZB 3TP8A 1ET6A 3WWVA 4KK7A 1EYCA 1Z9FA 1IBLL 5EPKA 4DV3L 3PSIA 2UU9L 3PMFA 2F0LA 3P1HA 1BBUA 2PMZE 3CXCA 1YI2A 5CV5A 5JEAG 5J22A 4DR2Q 1IYVA 1BCPC 2RF4A 1F2LA 3H3VI 2CHBD 4HJ5A 5JAVA 4JBKA 4CJ0B 4BY1G 4PMWA 5CV6A 1CZWA 1X3FA 1SNDA 1STEA 1NBWA 3TDQA 3ULJA 3OHXC 5KNCA 3QWNA 1V9PA 4XDXA 1I3QH 3T1YL 2NZ1D 2JA7H 2DNEA 1BUVT 3GD7A 3A55A 1W6KA 1VQLA 2UUAL 4BY1B 3MVVA 2KBNA 5M5WH 4JI0Q 1PH7A 2PI2A 3ZJYC 2IPKD 3AB9A 4G57A 3RZDB 1EY9A 4POGA 1E1OA 1IL2A 1TWHH 3I91A 5G3LF 1IXRA 4MZ9A 2L1BA 1J5EQ 5LHY1 3HRZC 1M90C 1CQFA 1I50H 4ZAIA 5E4WC 1TVXA 3E9HA 3GV3A 1KAAA 4XT3B 3A5UA 4GN3B 2UXCL 1A15A 1JE5A 3J81L 3DM3A 1LTID 3R2TA 2F0WA 4F7XA 4QF4A 3S15B 4IUVA 2IX1A 4LF7L 1KTKA 4K2LA 4JI0L 4FXDA 2R7ZH 2FINB 4RHRA 4HSVA 1DOKA 4NPSA 3PUZA 4QY7A 4M8AA 3QIAA 1HQMC 1SE3A 1KAWA 2D0PA 4HJ9A 3I4NB 1EFID 5ELEA 5BN5A 4DUYQ 3H0GG 5D3DA 4UDUC 4DV1L 2Q2TA 3ZYYX 3MA2B 2OEOA 3GTJH 3SR1A 4IPGA 4IUPA 3AYHB 4JOIC 5LL6X 3BG3A 4CDCC 2KUMA 2Y0SG 5K36H 1K3BC 3H0GB 1GUSA 3HOZH 3FKIG 4P74A 3D4RA 3K7AH 2Z0SA 5C4ZA 1GUTA 4I7AA 3FKIB 3L7ZC 3S1QB 1STGA 4B3RL 1R4QB 4G4KA 4OO1G 3J80c 3UE0A 1KC8C 1SYGA 3EIVA 4DUYL 3AFQA 1BDOA 2BDNA 4IN3A 5EPLA 1AN8A 3CP0A 4XYQA 4B9WA 1UE7A 1U9RA 2WP8J 1UUPA 2WKCA 2MFIA 5C3EH 4YWMA 3RLNA 3LX0A 4RGMA 2OXPA 3TQYA 4MNOA 1PLFA 4JBMA 4DXGA 4U68A 2EYMA 2PQEA 3NTHA 1K73C 1LT6D 2O5JC 2HCIA 1RD9D 4C3IH 3U4VA 2QEJC 5C5MA 4C56C 4RG1A 4JI3Q 1SBBB 4RFBA 1JQYD 4KN4C 2D0OA 3O13A 3DWPA 3MZ5A 2QW7A 1EU3A 4BXXH 2CW0C 2GA4B 1PVOA 2PPBC 3STBD 5IGDA 1Y1WG 4X65Q 2EY5A 1VQJA 3CRKC 4OIJA 4DV5L 2ID0A 5C3XA 3C1FA 3M7GA 5IP9H 1TKWB 4XYOA 1S5BD 2MO1A 4ZCKA 4Y7NH 1GUOA 2FFKB 5C44H 1EQVA 5C0XJ 1ICWA 1B9NA 2F03A 3J7ZC 1I94Q 2Z4IA 4FF3A 4HEDA 4JVZA 1QNKA 3I4LA 2ICEC 3KLSX 2MNAA 1FGUA 3PO2G 2F4VL 4DNRB 3PO3H 2PNHA 4K0KQ 2Z6KC 3S1RH 4HCEA 3VR4A 1E22A 4A3KB 1V1OA 3PO2B 4QJFA 4OIKA 5JJZA 4DV4L 5C4HA 3HOWH 1NUCA 4N8X1 4KI0A 3W1BA 2JN4A 4EX5A 2FJ2A 2ENBA 3U9OA 1DYQA 1B1ZA 2KHIA 1OTCA 3CU7A 1I94L 1J9OA 4JYAL 2O5IC 3J81j 4ULLA 5M3MH 2B2YC 3RN2A 2R6GA 3QO2A 3DUZA 3S17H 1LACA 2ZXPA 1XTDA 4A3BG 3T13A 2JP1A 5CC4A 1HUMA 4DPGA 5LMUQ 3D0FA 2JEBI 1AEXA 4FDBA 3HOXH 4KTAA 3AQQA 2OQKA 1KHIA 1WCMH 3LWUA 3KOJA 1MKHA 2X69A 4K2KA 2Z9HA 3K5NA 1Q12A 3K57A 2HD3A 4LFAQ 2K03A 2QDLA 3MXUA 1S5CD 4DNTB 4XQNA 2O2LD 2CCZA 2L0CA 1PHJA 4DA2A 3RZOB 3VA7A 3MC0B 3CCQA 1BKBA 4RGNA 4UPAA 1IBKL 4X66Q 4B08A 5IGGA 3ERQA 4PZ8A 4UP8A 2WB1E 1AP0A 2B2WA 2A69D 2JXMB 2HT1A 5JPMC 1CSQA 3EBEA 5M5XH 5IWAQ 4GKKQ 2Q8RE 3NE5B 1GO3E 4G7ZC 4JI6Q 1PTOC 1O78A 4J1MA 3URYA 3U58A 2NZHA 3ONAB 3UDXA 1II3A 1QUQB 1S5FD 1VQHA 4BBSB 1R9TB 3H09A 1PRTB 1DJRD 3MAQA 2L9HA 3AEVA 3LWEA 3KLRA 3NTKA 2I0QA 2XN9C 3TZUA 1MI2A 2ZT9C 1EEFD 3KF8B 4HTHA 2N3SA 4X3SA 2NWGA 4FF1A 2A5HA 4RKBA 4JW0A 3VYRA 3BYTB 4WJ4A 1N33Q 4LFCL 4CJ2C 4XTCS 4GS3A 2UUBQ 4JI6L 3FVQA 1EYDA 2ASBA 3TBIB 1ZYRC 1B50A 2K05A 1L0WA 3HFZB 4H7BA 4ID6A 2EQSA 2E8GA 1IL8A 1N34Q 2D5DA 2VB3X 1VF7A 5D14A 5I2YA 1P16A 4X3UA 2F3IA 3M4YA 4GKJL 1HHVA 1PZID 4AYBB 2F0IA 1YHBA 4NMZA 2OTLA 2A6ED 2B2VA 3P7JA 1OXUA 1Y8NB 2A68D 2AWNA 4BS9A 3F2BA 3CCSA 4DK3C 3S2DB 4FXKC 1N33L 1YZ6A 4E6IA 4J8QA 1EZ6A 5C4XG 3K6OA 1MHWC 1GJXA 3QB3A 4EQPA 2X6GA 3GTQH 5C4XB 2K28A 5GAGC 3BVGA 1SROA 2KEEA 5F2DA 1TXYA 2EJMA 1HR0W 3MXPA 4F87A 2JA8H 2M00A 4DUZL 1HUNA 5C0XG 3OMGA 4IO9A 1RCVD 1FJGL 3B6YA 1PV4A 4QGUA 1A0IA 1DOLA 2I5HA 3BZKA 5DAUA 3HS0C 2D9UA 3SE0A 1HR0L 1VQ7A 1J6QA 3CPWA 2AHOB 1AZPA 1TWAB 4A75A 1AW7A 4DR5L 1B70B 3FRPB 3K7UC 2N8NA 2Z1CA 3K8AA 4ZQ3A 4YCVA 4C3HH 1S72A 1PH6A 3PF5A 4PMBA 3TS2A 1TWCH 4DKAC 3D6WA 3H15A 1N32L 4G7HC 1I4GA 1OXSC 2L55A 3HOVB 1DCZA 2XNAC 2HCCA 4ZKBB 4GOPB 1SFOB 1ASYA 3LNNA 3BZDB 3NENA 1STYA 4ABNA 1HRJA 1NNXA 1UE1A 1H9JA 1KDCA 1U0LA 2B29A 1XYIA 1VQAA 5GQOA 1K8GA 1Q8KA 2IW3A 4LAAA 2NUCA 4HAEA 5JVH3 1VQKA 3H3VH 1X3EA 2CFMA 3BU2A 4C1NI 4A3IG 5E3FA 2VUMH 5JEAJ 3S16H 4A3LH 4X6AH 1BBWA 2A6HC 2TMPA 2EXZA 2AUJD 2C35B 1EFWA 3GTKH 2PQAB 4A3DH 2NVYH 1T9HA 1GM5A 1SAPA 5IYDG 2NVQB 1WTQA 2B2UA 3X3MA 1PZKD 1O7YA 3NBHA 2K4KA 1Z47A 1SMYC 1XTCD 4H13C 1BNZA 4BY7G 3CCJA 2F0OA 1D2BA 3P75A 2NBFA 1UNSA 1FNWA 3JAME 3GQBA 4BY7B 4QUCA 4ALPA 1PYWD 3HKSA 3W5OA 2AKWB 5EAYA 1JICA 5EGTA 5NUCA 1UE5A 1XNQQ 4KV6A 3E0EA 4EQ5A 5EQ0A 2MUYA 5HY6A 1U5KA 1SYCA 1HA5A 1V1PA 3IFTA 5JJLA 2PO4A 2XIWA 3PUXA 4FP5D 1MBYA
chains in the Genus database with same CATH topology
1V9PA 2KHJA 1I3QH 4JI3L 4A76A 3RNUA 3T1YL 1KQSA 1HR0Q 2JA7H 3RZOH 2ZM6Q 1AH9A 3GD7A 5E7NA 2UUAL 1VQLA 1X65A 4L5TA 5FJ8H 1SE8A 2KBNA 3G48A 5M5WH 3FHWA 4JI0Q 2NN6I 2Q2HA 4DR5Q 1PH7A 4DR1L 2PI2A 3ZJYC 3NELA 4HIKA 3MXNB 4GLAC 2GVBA 4IOCA 4X65L 3ICEA 2CWAA 2HQLA 1OXVA 1CKNB 1SN8A 1E1OA 4POGA 4HJ7A 1TWHH 1IL2A 3S2HH 1L1OA 3ULLA 1IXRA 4MZ9A 4LFBL 1J5EQ 4YY3Q 4GNXB 1M90C 3KLWA 5C4JH 4DV0Q 1I50H 3E9HA 3A5UA 3NBHB 2UXCL 4GN3B 1N32Q 2LXKA 1JE5A 1SLJA 1JJGA 4A3EG 3J7A5 3F8TA 3DM3A 5M5YH 4GLXA 1R9TH 2OQ0A 1XMOL 1XNRL 2UXBQ 2JA5G 4DR4Q 2ZM6L 4DR6L 4PG3A 1LYLA 3CC4A 2JEAI 1K8AC 2IX1A 5JJIA 3UDGA 4LF7L 3J81c 1NJIC 1CKOA 3UDIA 3FP9A 3CCUA 4JI0L 4DR3L 2R7ZH 4LF6Q 2A1AA 3LGJA 2F52A 4GOPC 4APVA 2JA9A 2R93G 1IBML 3GDEA 4NPSA 2B63G 4K0KL 3A0JA 3PUZA 4QY7A 3KF6A 1QUQA 1M1KC 1WOCA 3CAMA 5IYBH 1C0AA 1KL9A 1KAWA 2D0PA 1DGSA 4HJ9A 2ATWA 1K3RA 3HOVG 4DV1L 4DUYQ 3PUYA 1Y1VH 3H0GG 5DLQE 2Q2TA 2R92H 3GTJH 2CKZB 2CQOA 4IPGA 4TQUS 1X54A 3AYHB 3GTMH 4JOIC 4OO1I 1N36L 4IFDJ 1UE6A 2Y0SG 2V1CC 3HOZH 3FKIG 3I7FA 4DR4L 1Q1BA 1EIYB 4P74A 1LUZA 4DV7Q 4OWTB 1NMFA 3PGZA 4JBJA 1FL0A 1K9MC 2HHHL 3CCLA 3M3YH 3K7AH 2Z0SA 5LMNQ 3J81i 2H5XA 1YJ9A 3L7ZC 5ELOA 4A3JH 3S2DH 4B3RL 4DR7Q 4OO1G 1EQRA 3J80c 4A3KH 1L1OB 3UE0A 2KCTA 4OWWB 1KC8C 3M4PA 1TWGH 2VW9A 3ULPA 2ZTDA 3UDFA 4LF8L 3EIVA 4DUYL 4DV3Q 3AFQA 4BY7H 4IFDI 1VQPA 2L15A 1X6OA 5GROA 4X64Q 3CP0A 5LMUL 3M85A 2ES2A 1UE7A 2WP8J 1Q7YC 2MFIA 1VQOA 5HGQA 2JA8G 5C3EH 4LUZA 4JI8Q 4YWMA 3W1GA 5C4XH 1Q86C 3RLNA 2IHFA 1E7ZA 3TQYA 2LSSA 4MNOA 4BA1I 1WI5A 4B3MQ 1HZBA 4JBMA 3G6EA 1HNXQ 2N78A 3CW2C 2OTJA 3HKZG 1KRSA 4A3MH 2JJQA 4MTNA 5LMNL 3PCOB 4IPDA 1K73C 3I4OA 4C3IH 2ZTCA 3U4VA 2WAQG 4DV6L 1B7YB 4LFAL 3I4MG 1HNWL 4A93H 3MEFA 4RG1A 3T1YQ 1Y14B 3JC66 4JI3Q 3HOUH 4NXML 3K80C 4DAMA 1VQFA 3J80i 1QVFA 4HIOA 1EOVA 1N9WA 1PYSB 4IJHA 2UUAQ 4R4IA 2D0OA 3S24A 5M3FG 4BA2I 3PUWA 1A63A 4H02A 1V43A 2YTYA 4X64L 5GAHC 1EUJA 5FLMG 4DR1Q 1YITA 2B3GA 4BXXH 1E3PA 1G51A 4X66L 1PA6A 1E1TA 3STBD 3L0OA 4LNQA 1X56A 1Y1WG 1PYBA 1JMCA 1PH2A 2HIVA 4JI8L 1UEBA 4X65Q 4A3CH 5JJKA 2K14A 4JV5Q 1VQJA 1SR3A 3S14H 2JA6H 5IWAL 2KCMA 1MIUA 3M9BA 4OONA 4OWXB 1EWIA 3PIOA 4DV5L 1NMGA 4B3ML 2ID0A 4GKKL 2YV5A 2VZAA 2VNUD 3GTOH 1PH4A 2FXQA 4DAYB 3CQZH 2E2HH 5IP9H 1VQ6A 3TRZA 2IX0A 1S3OA 3BZCA 1AE3A 4P72A 2UXCQ 2MO1A 4Y52H 4Y7NH 1YEZA 5C44H 4XIGS 5C0XJ 1XMOQ 1XNRQ 3CCRA 4JI5L 5IY0A 4DR6Q 3U4ZA 3J7ZC 5IT9c 4HIMA 1I94Q 4A3GH 2K5HA 3K81C 4LF7Q 1Q46A 1W2BA 4DR3Q 2ZTEA 3CMEA 4UP7A 1EIFA 2OCEA 2VUMG 4IJLA 4JI7Q 2MNAA 1FGUA 3PO2G 2F4VL 4AIMA 4A3LG 1WFQA 3PO3H 1VQGA 2PNHA 1IBMQ 1QZHA 2Z6KC 4K0KQ 4JV5L 3S1MH 3S1RH 2I5LX 4DV2Q 2UUBL 4B3SL 1E22A 4A3DG 3PIPA 2D62A 4DV1Q 4GOPA 4QJFA 1C7YA 1VS0A 2VY3A 3M4QA 3HOWH 5C3EG 4DV4L 1H95A 4GLVB 2BH8A 1PVOA 4KI0A 4NB3A 3W1BA 2NN6G 1W3SA 4EX5A 1N36Q 4A3IH 1N34L 1HZ9A 5IP7G 4A3FG 4BBSH 1SRUA 4OX9Q 4JG2A 2EIFA 4R1JA 2E5LL 5IYCG 2KHIA 1OTCA 1X3GA 2HHHQ 1VQBA 1I94L 4QQBX 4JOIA 2Q2UA 4JYAL 3KFUA 1XMQL 3J81j 5M3MH 3OW2A 1UWVA 4JI7L 3RN2A 3I4NG 4B3RQ 4QIWE 2R6GA 4BBRG 3I55A 5IYDH 1OXXK 1LM0A 3S17H 2XGTA 4P71A 5AJ3L 2PQAA 2UUCQ 4R4TA 4LF8Q 4DV2L 1XTDA 4AQYQ 4A3BG 4DPGA 5LMUQ 4NXNL 1RL2A 1LTLA 3D0FA 4JI4L 1NY4A 3D31A 3VDYA 3I2ZA 2JK8A 2K5VA 1PH8A 2NVXH 3M4OH 3OYYA 4JI1L 4GN5A 2JEBI 1YJWA 4OX9L 3CF5A 4FDBA 3HOXH 3AQQA 2OQKA 4QL5A 1KHIA 1E24A 1WCMH 4R4CA 4LF4L 1CUKA 1V1QA 3KOJA 1MKHA 5C44G 4POFA 1HZAA 4HJ8A 4O0AA 2WFWA 1Q12A 3TREA 4DV6Q 4LFAQ 3T1HL 2JA7G 3BJUA 3RR5A 3GO5A 1HNWQ 3G71A 4L5QA 5FJ8G 1HJPA 4NXMQ 4R4QA 2UUCL 3GTLH 2CCZA 4YCUA 1PHJA 1YBYA 4IPCA 1JJCB 1QVCA 3CCQA 1BKBA 4AQYL 4BY1H 4UPAA 3K0XA 3KJPA 1IBKL 1KD1C 4X66Q 4O2DA 4X62Q 1QVGA 2VQEL 4PZ8A 4UP8A 2WB1E 4OXPA 3UE1A 3KJOA 1AE2A 2HT1A 5IWAQ 1CSQA 3EBEA 5M5XH 4LF9L 4GKKQ 2MO0A 1GO3E 1K83H 3I56A 4DV5Q 4KHPL 4DNIA 4ME3A 3F2DA 4JI6Q 2VL6A 4AYBE 2Q2IA 4R4OA 3SGIA 3U58A 1G291 3ER0A 1C9OA 4LUOA 4IFDG 3NEMA 2NZHA 4DK6C 3CCEA 3CCVA 4JI5Q 4LWCA 3UDXA 3KF6B 1QUQB 1VQHA 1OXTA 2R7ZG 3CPFA 3KDFA 5GADC 3AEVA 3GTPH 1VQNA 2I0QA 3S15H 1BVSA 1VQ8A 3RLFA 4IPHA 1TWAH 4A3EH 2NZOA 2ZJPA 2NVTH 3KF8B 4X62L 2N3SA 3IRBA 4B3TL 1GVPA 5IYBG 2F4VQ 1D7QA 2JA5H 3HOYH 2A19A 1P8LA 1WYDA 4JI2Q 3TS0A 3JAMi 1Y1VG 2R92G 4WJ4A 1Q82C 1NTGA 4LFCL 1HZCA 1YVCA 4XTCS 4GS3A 2ZJQA 2YTXA 1S40A 2UUBQ 1ASZA 4B3SQ 4JI6L 2XTIA 2IHEA 1A8VA 2ASBA 2N49A 4YWLA 4DV4Q 1JB7A 5K36G 2Z6KA 1L0WA 4IOAA 3HFZB 2EQSA 3HOXG 3HOZG 2R93H 2E8GA 2RHSB 1N34Q 3EN2A 3CC7A 3CMAA 3GTGH 2LXJA 2E5LQ 4RMFA 3HOVH 1P16A 4GNXC 2YYZA 2F3IA 1SFOH 3H0GH 1I5FA 4GKJL 4JYAQ 4A3JG 2UXDQ 1YHBA 1XMQQ 4P73A 1KXLA 5H1SE 2OTLA 1VQCA 2ZJRA 1OXUA 4A3KG 2E2JH 2AWNA 3FKIH 3A74A 3F2BA 3CCSA 4DK3C 4JI2L 2GN5A 4A4IA 4KLKA 5AJ3Q 1N33L 2K52A 1YZ6A 3PUVA 2KENA 1VQMA 5BR8Q 4AH6A 4J15A 4LUVA 3OTOQ 1GKHA 4PZ7A 5J3BA 5C0XI 5C4XG 4YWKA 4NXNQ 2EXDA 1YIJA 4JI4Q 2IT1A 4WJ3M 2JE6I 3E9IA 4C3JH 4JI1Q 4YCWA 3GTQH 4A3MG 5GAGC 3Q8DA 4LF4Q 1SROA 2ALYB 3KDFB 2NVQH 1VQ9A 1XPUA 2UXDL 4DR2L 1XNQL 1TXYA 1HR0W 3DLLA 4A93G 2JA8H 1G6PA 1VQEA 1D8LA 3L2PA 4DUZL 3HOUG 5C0XG 4IO9A 3T1HQ 1QZGA 4UY8C 4LF5Q 1FJGL 3B6YA 1PV4A 4QGUA 1A0IA 1EYGA 2Y0SE 1YHAA 1PH5A 2I5HA 3BZKA 4P75A 2PI2E 2YTVA 1EQQA 5BR8L 1YJNA 1HNZQ 1PH3A 4BXXG 1K0RA 1IBKQ 3OTOL 3I4MH 1HR0L 1CSPA 1VQ7A 3HOYG 4A3CG 1J6QA 3CPWA 2AHOB 2JA6G 1JT8A 2VQEQ 4JC0A 2QGQA 3F1ZA 1L1OC 4A75A 4DR5L 1B70B 1VCIA 4LF9Q 1YNXA 1FVIA 5IP9G 3K7UC 5M3FH 4KHPQ 1N33Q 1VQ5A 3RLOA 2N8NA 5FLMH 3K8AA 1TWFH 4YCVA 4C3HH 1S72A 1Y1WH 1J5EL 4YY3L 4L5RC 1PH6A 2AMCB 1RIPA 2K5NA 2DUDA 3PF5A 4LF5L 3TS2A 2RCNA 1TWCH 4DKAC 4A3GG 4DV0L 2IY5B 4GN4B 3H15A 1N32L 3CCMA 1HNZL 1L2FA 1OXSC 4HJAA 4GOPB 2R7DA 1ASYA 3NENA 3PO3G 2BH2A 2UXBL 3HKZE 5ELNA 1PH1A 3TEHB 2CWPA 1N8RC 1UE1A 2I5MX 4B3TQ 5FLXc 2AWOA 1U0LA 2B29A 2WAQE 1VQAA 5GQOA 3JAMc 1MJEA 1K8GA 1JJ2A 1Q8KA 3RZDH 4LF6L 3M7NA 4LFCQ 3HOWG 1HH2P 1VQIA 4C2MH 1Q81C 1VQKA 2BA1A 3H3VH 1X3EA 2R7FA 2CFMA 2YU9H 1X55A 3BU2A 3F2CA 4A3IG 1PH9A 2VUMH 5JEAJ 3S1NH 3PO2H 1YHQA 2HIXA 3S16H 4BBSG 4A3LH 5IE8A 1VQ4A 4X6AH 1X9NA 1BBWA 1NE3A 1A62A 1GD7A 4HIDA 1IBLQ 5LMNW 2VS1A 1Q1EA 4JBWA 2UU9Q 1EFWA 2C35B 4LW1A 2VQFQ 3GTKH 2PQAB 5GAEC 4A3DH 2NVYH 4GKJQ 1T9HA 2RHQB 3U50C 4TVAB 5M3MG 1GM5A 1IYJB 1CKNA 5IYDG 1O7IA 4UP9A 2BA0A 2OWOA 5IP7H 1CKMA 4DV7L 1KRTA 4GNXA 4A3FH 2QEXA 1I6HH 2DGYA 3PV0A 2A8VA 5IYCH 3CC2A 3PF4A 2E2IH 3ERSX 1WJJA 4YHHQ 2K4KA 1Z47A 1XPRA 4DR7L 3G4SA 2K50A 2WB1G 2QA4A 4BY7G 3A5ZB 1VQDA 3CCJA 1XPOA 3I4NH 3WWVA 2MQHA 1Z9FA 4BBRH 2GVAA 4AYBG 2K75A 1XJVA 1IBLL 2B63H 1MJCA 1WCMG 4DV3L 4L5SA 3PSIA 2UU9L 4ALPA 3HKSA 3AFPA 3W5OA 2VQFL 3RN5A 2AKWB 5EAYA 1PFSA 1IZ6A 1BBUA 2PMZE 3KYHC 4JCVE 2JQOA 3CXCA 1YI2A 4A3BH 1UE5A 5JEAG 4DR2Q 1XNQQ 3E0EA 4EQ5A 2RF4A 4LFBQ 3STBC 4DUZQ 5HY6A 1U5KA 1SMXA 3H3VI 4PZ6A 1HNXL 3CD6A 1FJGQ 5JJLA 4HJ5A 3S1QH 1B8AA 3PUXA 4KHZA 1KIXA 4JBKA 4YHHL 4BY1G 4PMWA 3ULJA 1X3FA 1NBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V9P A;  2KHJ A;  1I3Q H;  4JI3 L;  4A76 A;  3RNU A;  3T1Y L;  1KQS A;  1HR0 Q;  2JA7 H;  3RZO H;  2ZM6 Q;  1AH9 A;  3GD7 A;  5E7N A;  2UUA L;  1VQL A;  1X65 A;  4L5T A;  5FJ8 H;  1SE8 A;  2KBN A;  3G48 A;  5M5W H;  3FHW A;  4JI0 Q;  2NN6 I;  2Q2H A;  4DR5 Q;  1PH7 A;  4DR1 L;  2PI2 A;  3ZJY C;  3NEL A;  4HIK A;  3MXN B;  4GLA C;  2GVB A;  4IOC A;  4X65 L;  3ICE A;  2CWA A;  2HQL A;  1OXV A;  1CKN B;  1SN8 A;  1E1O A;  4POG A;  4HJ7 A;  1TWH H;  1IL2 A;  3S2H H;  1L1O A;  3ULL A;  1IXR A;  4MZ9 A;  4LFB L;  1J5E Q;  4YY3 Q;  4GNX B;  1M90 C;  3KLW A;  5C4J H;  4DV0 Q;  1I50 H;  3E9H A;  3A5U A;  3NBH B;  2UXC L;  4GN3 B;  1N32 Q;  2LXK A;  1JE5 A;  1SLJ A;  1JJG A;  4A3E G;  3J7A 5;  3F8T A;  3DM3 A;  5M5Y H;  4GLX A;  1R9T H;  2OQ0 A;  1XMO L;  1XNR L;  2UXB Q;  2JA5 G;  4DR4 Q;  2ZM6 L;  4DR6 L;  4PG3 A;  1LYL A;  3CC4 A;  2JEA I;  1K8A C;  2IX1 A;  5JJI A;  3UDG A;  4LF7 L;  3J81 c;  1NJI C;  1CKO A;  3UDI A;  3FP9 A;  3CCU A;  4JI0 L;  4DR3 L;  2R7Z H;  4LF6 Q;  2A1A A;  3LGJ A;  2F52 A;  4GOP C;  4APV A;  2JA9 A;  2R93 G;  1IBM L;  3GDE A;  4NPS A;  2B63 G;  4K0K L;  3A0J A;  3PUZ A;  4QY7 A;  3KF6 A;  1QUQ A;  1M1K C;  1WOC A;  3CAM A;  5IYB H;  1C0A A;  1KL9 A;  1KAW A;  2D0P A;  1DGS A;  4HJ9 A;  2ATW A;  1K3R A;  3HOV G;  4DV1 L;  4DUY Q;  3PUY A;  1Y1V H;  3H0G G;  5DLQ E;  2Q2T A;  2R92 H;  3GTJ H;  2CKZ B;  2CQO A;  4IPG A;  4TQU S;  1X54 A;  3AYH B;  3GTM H;  4JOI C;  4OO1 I;  1N36 L;  4IFD J;  1UE6 A;  2Y0S G;  2V1C C;  3HOZ H;  3FKI G;  3I7F A;  4DR4 L;  1Q1B A;  1EIY B;  4P74 A;  1LUZ A;  4DV7 Q;  4OWT B;  1NMF A;  3PGZ A;  4JBJ A;  1FL0 A;  1K9M C;  2HHH L;  3CCL A;  3M3Y H;  3K7A H;  2Z0S A;  5LMN Q;  3J81 i;  2H5X A;  1YJ9 A;  3L7Z C;  5ELO A;  4A3J H;  3S2D H;  4B3R L;  4DR7 Q;  4OO1 G;  1EQR A;  3J80 c;  4A3K H;  1L1O B;  3UE0 A;  2KCT A;  4OWW B;  1KC8 C;  3M4P A;  1TWG H;  2VW9 A;  3ULP A;  2ZTD A;  3UDF A;  4LF8 L;  3EIV A;  4DUY L;  4DV3 Q;  3AFQ A;  4BY7 H;  4IFD I;  1VQP A;  2L15 A;  1X6O A;  5GRO A;  4X64 Q;  3CP0 A;  5LMU L;  3M85 A;  2ES2 A;  1UE7 A;  2WP8 J;  1Q7Y C;  2MFI A;  1VQO A;  5HGQ A;  2JA8 G;  5C3E H;  4LUZ A;  4JI8 Q;  4YWM A;  3W1G A;  5C4X H;  1Q86 C;  3RLN A;  2IHF A;  1E7Z A;  3TQY A;  2LSS A;  4MNO A;  4BA1 I;  1WI5 A;  4B3M Q;  1HZB A;  4JBM A;  3G6E A;  1HNX Q;  2N78 A;  3CW2 C;  2OTJ A;  3HKZ G;  1KRS A;  4A3M H;  2JJQ A;  4MTN A;  5LMN L;  3PCO B;  4IPD A;  1K73 C;  3I4O A;  4C3I H;  2ZTC A;  3U4V A;  2WAQ G;  4DV6 L;  1B7Y B;  4LFA L;  3I4M G;  1HNW L;  4A93 H;  3MEF A;  4RG1 A;  3T1Y Q;  1Y14 B;  3JC6 6;  4JI3 Q;  3HOU H;  4NXM L;  3K80 C;  4DAM A;  1VQF A;  3J80 i;  1QVF A;  4HIO A;  1EOV A;  1N9W A;  1PYS B;  4IJH A;  2UUA Q;  4R4I A;  2D0O A;  3S24 A;  5M3F G;  4BA2 I;  3PUW A;  1A63 A;  4H02 A;  1V43 A;  2YTY A;  4X64 L;  5GAH C;  1EUJ A;  5FLM G;  4DR1 Q;  1YIT A;  2B3G A;  4BXX H;  1E3P A;  1G51 A;  4X66 L;  1PA6 A;  1E1T A;  3STB D;  3L0O A;  4LNQ A;  1X56 A;  1Y1W G;  1PYB A;  1JMC A;  1PH2 A;  2HIV A;  4JI8 L;  1UEB A;  4X65 Q;  4A3C H;  5JJK A;  2K14 A;  4JV5 Q;  1VQJ A;  1SR3 A;  3S14 H;  2JA6 H;  5IWA L;  2KCM A;  1MIU A;  3M9B A;  4OON A;  4OWX B;  1EWI A;  3PIO A;  4DV5 L;  1NMG A;  4B3M L;  2ID0 A;  4GKK L;  2YV5 A;  2VZA A;  2VNU D;  3GTO H;  1PH4 A;  2FXQ A;  4DAY B;  3CQZ H;  2E2H H;  5IP9 H;  1VQ6 A;  3TRZ A;  2IX0 A;  1S3O A;  3BZC A;  1AE3 A;  4P72 A;  2UXC Q;  2MO1 A;  4Y52 H;  4Y7N H;  1YEZ A;  5C44 H;  4XIG S;  5C0X J;  1XMO Q;  1XNR Q;  3CCR A;  4JI5 L;  5IY0 A;  4DR6 Q;  3U4Z A;  3J7Z C;  5IT9 c;  4HIM A;  1I94 Q;  4A3G H;  2K5H A;  3K81 C;  4LF7 Q;  1Q46 A;  1W2B A;  4DR3 Q;  2ZTE A;  3CME A;  4UP7 A;  1EIF A;  2OCE A;  2VUM G;  4IJL A;  4JI7 Q;  2MNA A;  1FGU A;  3PO2 G;  2F4V L;  4AIM A;  4A3L G;  1WFQ A;  3PO3 H;  1VQG A;  2PNH A;  1IBM Q;  1QZH A;  2Z6K C;  4K0K Q;  4JV5 L;  3S1M H;  3S1R H;  2I5L X;  4DV2 Q;  2UUB L;  4B3S L;  1E22 A;  4A3D G;  3PIP A;  2D62 A;  4DV1 Q;  4GOP A;  4QJF A;  1C7Y A;  1VS0 A;  2VY3 A;  3M4Q A;  3HOW H;  5C3E G;  4DV4 L;  1H95 A;  4GLV B;  2BH8 A;  1PVO A;  4KI0 A;  4NB3 A;  3W1B A;  2NN6 G;  1W3S A;  4EX5 A;  1N36 Q;  4A3I H;  1N34 L;  1HZ9 A;  5IP7 G;  4A3F G;  4BBS H;  1SRU A;  4OX9 Q;  4JG2 A;  2EIF A;  4R1J A;  2E5L L;  5IYC G;  2KHI A;  1OTC A;  1X3G A;  2HHH Q;  1VQB A;  1I94 L;  4QQB X;  4JOI A;  2Q2U A;  4JYA L;  3KFU A;  1XMQ L;  3J81 j;  5M3M H;  3OW2 A;  1UWV A;  4JI7 L;  3RN2 A;  3I4N G;  4B3R Q;  4QIW E;  2R6G A;  4BBR G;  3I55 A;  5IYD H;  1OXX K;  1LM0 A;  3S17 H;  2XGT A;  4P71 A;  5AJ3 L;  2PQA A;  2UUC Q;  4R4T A;  4LF8 Q;  4DV2 L;  1XTD A;  4AQY Q;  4A3B G;  4DPG A;  5LMU Q;  4NXN L;  1RL2 A;  1LTL A;  3D0F A;  4JI4 L;  1NY4 A;  3D31 A;  3VDY A;  3I2Z A;  2JK8 A;  2K5V A;  1PH8 A;  2NVX H;  3M4O H;  3OYY A;  4JI1 L;  4GN5 A;  2JEB I;  1YJW A;  4OX9 L;  3CF5 A;  4FDB A;  3HOX H;  3AQQ A;  2OQK A;  4QL5 A;  1KHI A;  1E24 A;  1WCM H;  4R4C A;  4LF4 L;  1CUK A;  1V1Q A;  3KOJ A;  1MKH A;  5C44 G;  4POF A;  1HZA A;  4HJ8 A;  4O0A A;  2WFW A;  1Q12 A;  3TRE A;  4DV6 Q;  4LFA Q;  3T1H L;  2JA7 G;  3BJU A;  3RR5 A;  3GO5 A;  1HNW Q;  3G71 A;  4L5Q A;  5FJ8 G;  1HJP A;  4NXM Q;  4R4Q A;  2UUC L;  3GTL H;  2CCZ A;  4YCU A;  1PHJ A;  1YBY A;  4IPC A;  1JJC B;  1QVC A;  3CCQ A;  1BKB A;  4AQY L;  4BY1 H;  4UPA A;  3K0X A;  3KJP A;  1IBK L;  1KD1 C;  4X66 Q;  4O2D A;  4X62 Q;  1QVG A;  2VQE L;  4PZ8 A;  4UP8 A;  2WB1 E;  4OXP A;  3UE1 A;  3KJO A;  1AE2 A;  2HT1 A;  5IWA Q;  1CSQ A;  3EBE A;  5M5X H;  4LF9 L;  4GKK Q;  2MO0 A;  1GO3 E;  1K83 H;  3I56 A;  4DV5 Q;  4KHP L;  4DNI A;  4ME3 A;  3F2D A;  4JI6 Q;  2VL6 A;  4AYB E;  2Q2I A;  4R4O A;  3SGI A;  3U58 A;  1G29 1;  3ER0 A;  1C9O A;  4LUO A;  4IFD G;  3NEM A;  2NZH A;  4DK6 C;  3CCE A;  3CCV A;  4JI5 Q;  4LWC A;  3UDX A;  3KF6 B;  1QUQ B;  1VQH A;  1OXT A;  2R7Z G;  3CPF A;  3KDF A;  5GAD C;  3AEV A;  3GTP H;  1VQN A;  2I0Q A;  3S15 H;  1BVS A;  1VQ8 A;  3RLF A;  4IPH A;  1TWA H;  4A3E H;  2NZO A;  2ZJP A;  2NVT H;  3KF8 B;  4X62 L;  2N3S A;  3IRB A;  4B3T L;  1GVP A;  5IYB G;  2F4V Q;  1D7Q A;  2JA5 H;  3HOY H;  2A19 A;  1P8L A;  1WYD A;  4JI2 Q;  3TS0 A;  3JAM i;  1Y1V G;  2R92 G;  4WJ4 A;  1Q82 C;  1NTG A;  4LFC L;  1HZC A;  1YVC A;  4XTC S;  4GS3 A;  2ZJQ A;  2YTX A;  1S40 A;  2UUB Q;  1ASZ A;  4B3S Q;  4JI6 L;  2XTI A;  2IHE A;  1A8V A;  2ASB A;  2N49 A;  4YWL A;  4DV4 Q;  1JB7 A;  5K36 G;  2Z6K A;  1L0W A;  4IOA A;  3HFZ B;  2EQS A;  3HOX G;  3HOZ G;  2R93 H;  2E8G A;  2RHS B;  1N34 Q;  3EN2 A;  3CC7 A;  3CMA A;  3GTG H;  2LXJ A;  2E5L Q;  4RMF A;  3HOV H;  1P16 A;  4GNX C;  2YYZ A;  2F3I A;  1SFO H;  3H0G H;  1I5F A;  4GKJ L;  4JYA Q;  4A3J G;  2UXD Q;  1YHB A;  1XMQ Q;  4P73 A;  1KXL A;  5H1S E;  2OTL A;  1VQC A;  2ZJR A;  1OXU A;  4A3K G;  2E2J H;  2AWN A;  3FKI H;  3A74 A;  3F2B A;  3CCS A;  4DK3 C;  4JI2 L;  2GN5 A;  4A4I A;  4KLK A;  5AJ3 Q;  1N33 L;  2K52 A;  1YZ6 A;  3PUV A;  2KEN A;  1VQM A;  5BR8 Q;  4AH6 A;  4J15 A;  4LUV A;  3OTO Q;  1GKH A;  4PZ7 A;  5J3B A;  5C0X I;  5C4X G;  4YWK A;  4NXN Q;  2EXD A;  1YIJ A;  4JI4 Q;  2IT1 A;  4WJ3 M;  2JE6 I;  3E9I A;  4C3J H;  4JI1 Q;  4YCW A;  3GTQ H;  4A3M G;  5GAG C;  3Q8D A;  4LF4 Q;  1SRO A;  2ALY B;  3KDF B;  2NVQ H;  1VQ9 A;  1XPU A;  2UXD L;  4DR2 L;  1XNQ L;  1TXY A;  1HR0 W;  3DLL A;  4A93 G;  2JA8 H;  1G6P A;  1VQE A;  1D8L A;  3L2P A;  4DUZ L;  3HOU G;  5C0X G;  4IO9 A;  3T1H Q;  1QZG A;  4UY8 C;  4LF5 Q;  1FJG L;  3B6Y A;  1PV4 A;  4QGU A;  1A0I A;  1EYG A;  2Y0S E;  1YHA A;  1PH5 A;  2I5H A;  3BZK A;  4P75 A;  2PI2 E;  2YTV A;  1EQQ A;  5BR8 L;  1YJN A;  1HNZ Q;  1PH3 A;  4BXX G;  1K0R A;  1IBK Q;  3OTO L;  3I4M H;  1HR0 L;  1CSP A;  1VQ7 A;  3HOY G;  4A3C G;  1J6Q A;  3CPW A;  2AHO B;  2JA6 G;  1JT8 A;  2VQE Q;  4JC0 A;  2QGQ A;  3F1Z A;  1L1O C;  4A75 A;  4DR5 L;  1B70 B;  1VCI A;  4LF9 Q;  1YNX A;  1FVI A;  5IP9 G;  3K7U C;  5M3F H;  4KHP Q;  1N33 Q;  1VQ5 A;  3RLO A;  2N8N A;  5FLM H;  3K8A A;  1TWF H;  4YCV A;  4C3H H;  1S72 A;  1Y1W H;  1J5E L;  4YY3 L;  4L5R C;  1PH6 A;  2AMC B;  1RIP A;  2K5N A;  2DUD A;  3PF5 A;  4LF5 L;  3TS2 A;  2RCN A;  1TWC H;  4DKA C;  4A3G G;  4DV0 L;  2IY5 B;  4GN4 B;  3H15 A;  1N32 L;  3CCM A;  1HNZ L;  1L2F A;  1OXS C;  4HJA A;  4GOP B;  2R7D A;  1ASY A;  3NEN A;  3PO3 G;  2BH2 A;  2UXB L;  3HKZ E;  5ELN A;  1PH1 A;  3TEH B;  2CWP A;  1N8R C;  1UE1 A;  2I5M X;  4B3T Q;  5FLX c;  2AWO A;  1U0L A;  2B29 A;  2WAQ E;  1VQA A;  5GQO A;  3JAM c;  1MJE A;  1K8G A;  1JJ2 A;  1Q8K A;  3RZD H;  4LF6 L;  3M7N A;  4LFC Q;  3HOW G;  1HH2 P;  1VQI A;  4C2M H;  1Q81 C;  1VQK A;  2BA1 A;  3H3V H;  1X3E A;  2R7F A;  2CFM A;  2YU9 H;  1X55 A;  3BU2 A;  3F2C A;  4A3I G;  1PH9 A;  2VUM H;  5JEA J;  3S1N H;  3PO2 H;  1YHQ A;  2HIX A;  3S16 H;  4BBS G;  4A3L H;  5IE8 A;  1VQ4 A;  4X6A H;  1X9N A;  1BBW A;  1NE3 A;  1A62 A;  1GD7 A;  4HID A;  1IBL Q;  5LMN W;  2VS1 A;  1Q1E A;  4JBW A;  2UU9 Q;  1EFW A;  2C35 B;  4LW1 A;  2VQF Q;  3GTK H;  2PQA B;  5GAE C;  4A3D H;  2NVY H;  4GKJ Q;  1T9H A;  2RHQ B;  3U50 C;  4TVA B;  5M3M G;  1GM5 A;  1IYJ B;  1CKN A;  5IYD G;  1O7I A;  4UP9 A;  2BA0 A;  2OWO A;  5IP7 H;  1CKM A;  4DV7 L;  1KRT A;  4GNX A;  4A3F H;  2QEX A;  1I6H H;  2DGY A;  3PV0 A;  2A8V A;  5IYC H;  3CC2 A;  3PF4 A;  2E2I H;  3ERS X;  1WJJ A;  4YHH Q;  2K4K A;  1Z47 A;  1XPR A;  4DR7 L;  3G4S A;  2K50 A;  2WB1 G;  2QA4 A;  4BY7 G;  3A5Z B;  1VQD A;  3CCJ A;  1XPO A;  3I4N H;  3WWV A;  2MQH A;  1Z9F A;  4BBR H;  2GVA A;  4AYB G;  2K75 A;  1XJV A;  1IBL L;  2B63 H;  1MJC A;  1WCM G;  4DV3 L;  4L5S A;  3PSI A;  2UU9 L;  4ALP A;  3HKS A;  3AFP A;  3W5O A;  2VQF L;  3RN5 A;  2AKW B;  5EAY A;  1PFS A;  1IZ6 A;  1BBU A;  2PMZ E;  3KYH C;  4JCV E;  2JQO A;  3CXC A;  1YI2 A;  4A3B H;  1UE5 A;  5JEA G;  4DR2 Q;  1XNQ Q;  3E0E A;  4EQ5 A;  2RF4 A;  4LFB Q;  3STB C;  4DUZ Q;  5HY6 A;  1U5K A;  1SMX A;  3H3V I;  4PZ6 A;  1HNX L;  3CD6 A;  1FJG Q;  5JJL A;  4HJ5 A;  3S1Q H;  1B8A A;  3PUX A;  4KHZ A;  1KIX A;  4JBK A;  4YHH L;  4BY1 G;  4PMW A;  3ULJ A;  1X3F A;  1NBW A; 
#chains in the Genus database with same CATH topology
 1LTB D;  4KY6 A;  2KHJ A;  3VYU A;  4A76 A;  3RNU A;  1XX8 A;  4LK1 C;  1JOR A;  1KQS A;  4K8I A;  2EY6 A;  3NQI A;  5J1Z A;  4L5T A;  1SE8 A;  2EYL A;  1JCK B;  3FHW A;  4CGY B;  5FO9 B;  2SOB A;  4HIK A;  1OXV A;  1K83 B;  1L1O A;  3ULL A;  5CMD A;  5ELC A;  3K58 A;  4RH6 A;  4Z9C B;  4YY3 Q;  2F0Q A;  5DM6 3;  3KLW A;  1EIH A;  1NR4 A;  5C4J H;  4R8I A;  4NW2 A;  5I2X A;  3NBH B;  2LMC B;  2LXK A;  1I4P A;  1V8Q A;  2BCO A;  5M5Y H;  4X3K A;  3SK5 A;  1XNR L;  5G3L D;  2UXB Q;  2BE5 D;  2JA5 G;  4DR4 Q;  4DR6 L;  4PG3 A;  1K8A C;  2M2L A;  3UDG A;  1D5M C;  3J81 c;  1CKO A;  3NWT A;  3UDI A;  3A8I E;  2MHV A;  5KND A;  4LF6 Q;  2JA5 B;  1CA6 A;  5EJW A;  4GOP C;  4R9W A;  2NTS A;  2JA9 A;  3KF6 A;  1GXD C;  2SDF A;  1SNM A;  3CAM A;  4MIU A;  4IZ8 A;  1PRT F;  5DLQ E;  1CFM A;  1M8A A;  2R92 H;  5EKK A;  5J39 A;  2SNM A;  4IUQ A;  4DF7 A;  1N36 L;  2D2C C;  4IFD J;  1IW7 C;  4DR4 L;  4BWG B;  1EIY B;  3D3R A;  1LUZ A;  4DV7 Q;  4OWT B;  1K9M C;  3PGZ A;  2HHH L;  3M3Y H;  1LTA D;  2Z8L A;  5LMN Q;  4DAY A;  2EOT A;  4A3J H;  4DR7 Q;  5CV7 A;  1ML0 D;  3TP6 A;  4ZYS A;  3K0Y A;  1QJO A;  4P2C B;  2MP1 A;  3DWQ A;  1L1O B;  3TP5 A;  4LF8 L;  1TWG H;  3V05 A;  2ZTD A;  2JA7 B;  4DV3 Q;  1HXY D;  2NB0 A;  1UEA B;  4RGT A;  4X64 Q;  5GRO A;  5M5W B;  3M85 A;  5HGQ A;  3OIQ A;  5HGT A;  2DY7 A;  3ND8 A;  4BA1 I;  2E2D C;  1HZB A;  3G6E A;  3CW2 C;  1H9K A;  1KRS A;  3HKZ G;  3MTS A;  4KMU C;  5LMN L;  4A3M H;  3PCO B;  4IPD A;  3I4O A;  1B3Q A;  2HQE A;  4PQX A;  4A93 H;  1HNW L;  3T1Y Q;  3JC6 6;  3HOU H;  1YNJ C;  3BDO A;  1VQF A;  5D65 A;  4IJH A;  1IKL A;  2UUA Q;  1BR9 A;  1I4Q A;  3DHQ A;  2M9V A;  5M3F G;  1EL0 A;  4BA2 I;  4KKS A;  4X64 L;  5GAH C;  1YIT A;  1A63 A;  3D8G A;  2B3G A;  3J7Y W;  1BCP D;  1PA6 A;  5CBA E;  3L0O A;  1PH2 A;  1UEB A;  5M3F B;  3S14 H;  1SNC A;  3U9S A;  4EVO A;  3BVM A;  5IOC A;  2JA6 H;  4OON A;  1EWI A;  1NMG A;  1IYU A;  3NK9 A;  2VZA A;  3GTO H;  2FXQ A;  3G7L A;  4DAY B;  3CQZ H;  2E2H H;  1S3O A;  2UXC Q;  3GTJ B;  1YNN C;  1YEZ A;  3CCR A;  2OF1 A;  4JI5 L;  3HOZ B;  4A3G H;  4LF7 Q;  5ISR A;  3SK8 A;  1UAP A;  2K5W A;  1TT2 A;  4UP7 A;  2OCE A;  4JI7 Q;  2F0F A;  1WFQ A;  2QF7 A;  1VQG A;  1ZEQ X;  4CJ1 B;  3OWF A;  3C3L A;  2I5L X;  2NYZ D;  1GUW A;  1SXT A;  4Q5V A;  4B3S L;  3N6R A;  3S1N B;  3PIP A;  2D62 A;  4DV1 Q;  3DWA A;  3M4Q A;  5C3E G;  4GLV B;  2BH8 A;  4OEM B;  5E4X A;  1Y8O B;  2NN6 G;  1W3S A;  3J7A F;  4K8J A;  5IP7 G;  4A3F G;  1SRU A;  4OX9 Q;  1F77 A;  5C3E B;  4WFN 3;  1X3G A;  3T56 B;  1VQB A;  2PW7 A;  1B9M A;  2Q2U A;  3NPP A;  4IAL A;  4A3F B;  4MHE A;  3OW2 A;  1UWV A;  4JI7 L;  3PQI A;  3I4N G;  4B3R Q;  4QIW E;  4H0L C;  4BBR G;  5I6W A;  3I55 A;  5EBD A;  4C3I B;  4X3T A;  3H91 A;  5KIX A;  5IT9 E;  4R4T A;  1SEB D;  4BBR B;  3TZD A;  3QOL A;  4AQY Q;  3W3A A;  4NXN L;  2K7V A;  3KLS A;  1LTL A;  4JI4 L;  2AQ1 B;  3D31 A;  2NVX H;  1PH8 A;  1EOT A;  2K5V A;  3RMH A;  3Q24 A;  5CV4 A;  4GN5 A;  1YJW A;  4OX9 L;  2TSS A;  3R2I A;  4J6H A;  4QL5 A;  3A7L A;  2F1M A;  3NUC A;  2EJF C;  4OGQ C;  5C44 G;  4KD4 A;  4FF4 A;  1ENC A;  1PZJ D;  2PYK A;  3T1H L;  5I9P A;  3RR5 A;  3G71 A;  2E75 C;  5FJ8 G;  4Y7N B;  3DEP A;  5C44 B;  4R4Q A;  4YCU A;  5KEE A;  1YBY A;  1ET9 A;  1SYD A;  4IPC A;  1JJC B;  3UI2 A;  4AQY L;  4BY1 H;  5KYL A;  1D5Z C;  2VB2 X;  5A2Q E;  3RUZ A;  2RVL A;  4X62 Q;  4RHS A;  3UE1 A;  1B4O A;  4LF9 L;  1NR2 A;  4DV5 Q;  3I56 A;  4KHP L;  3F2D A;  2VL6 A;  2EDG A;  3QG1 A;  3KBX A;  4IFD G;  2LFN A;  3HOW B;  2HDM A;  5HUR A;  5I9O A;  1D1K A;  2RSO A;  2CH4 W;  5CGK A;  3HGB A;  1OXT A;  1X3P A;  3H94 A;  4PV1 C;  2CW0 D;  1H9S A;  3GTP H;  2JSO A;  1VQN A;  5IGE A;  2F0J A;  3S15 H;  1BVS A;  3RLF A;  1QOH A;  1Q3L A;  4IPH A;  3OIP A;  2NZO A;  5JPN C;  4X62 L;  4B3T L;  2F4V Q;  1D7Q A;  3K5L A;  1GVP A;  5M3M B;  5IYB G;  3HOY H;  4CBV A;  1P8L A;  5C3W A;  4O1N A;  1Y1V G;  2C9O A;  1NTG A;  1HZC A;  1YVC A;  3A8J E;  2YTX A;  1ASZ A;  3C1E A;  1D6E C;  4DV4 Q;  1JB7 A;  1LLR D;  4IOA A;  1Y1V B;  3HOX G;  1STN A;  2K32 A;  2WB1 B;  3CC7 A;  3V96 A;  3NWS A;  3GTG H;  4FYD A;  2C5C A;  1F9P A;  1EYA A;  3EQL C;  3H0G H;  1I5F A;  3EA6 A;  3HOX B;  4JYA Q;  1K8O A;  4XXE A;  2UXD Q;  4HCS A;  2EY1 A;  4P73 A;  3BVZ A;  2WKD A;  4A3K G;  3X3N A;  2E2J H;  1JOQ A;  3FKI H;  1NCV A;  2EE1 A;  1QWY A;  1CTM A;  1TU2 B;  2KEN A;  5BR8 Q;  1TR5 A;  5IGC A;  3R8B A;  4YIJ A;  1LTG D;  4LUV A;  1GKH A;  2CH4 A;  2EXD A;  4OO1 H;  4WJ3 M;  2JE6 I;  3OPO A;  3GV6 A;  3Q8D A;  5FO7 B;  1H9S B;  5M5X B;  2UXD L;  3DLL A;  2DY8 A;  1WTP A;  1OO9 B;  3VR2 A;  2Y0S E;  2Q8T A;  2EYP A;  1F2Y A;  4P75 A;  2PI2 E;  2YTV A;  5BR8 L;  1YJN A;  1PH3 A;  3MFG A;  1IBK Q;  2JYO A;  5FKA C;  3VR3 A;  4A3C G;  5K5P A;  1PTO H;  3SK4 A;  4CKE A;  2QGQ A;  3F1Z A;  3K5O A;  4NP5 A;  2FMC A;  3I90 A;  1KAB A;  2F0G A;  1TWF H;  4DAV A;  1Y1W H;  2IL8 A;  2RCN A;  1G8Z D;  4DV0 L;  4KN7 C;  4GN4 B;  4TKO B;  2F0U A;  4ZUJ A;  4K5V A;  1DM0 B;  1Q90 A;  3JAM L;  4DGZ A;  3T53 B;  2XSC A;  4NDX A;  2WV6 D;  1LO5 D;  1PTO D;  1MJE A;  4LFC Q;  1VQI A;  4C2M H;  5I4D A;  1PH9 A;  4KKT A;  4BBS G;  3PO2 H;  1YHQ A;  2HIX A;  1U4P A;  1GD7 A;  5DEH A;  4NKL A;  1IHZ A;  4LW1 A;  2VQF Q;  1A3T A;  1O7Z A;  1CQV A;  3U50 C;  4GKJ Q;  2DJG C;  1CKN A;  2H1E A;  5IGF A;  1G91 A;  2OWO A;  2MPM A;  1KRT A;  4GNX A;  2QEX A;  2DGY A;  3PV0 A;  3PF4 A;  5L37 A;  3SEB A;  1WJJ A;  1ZYR D;  1I4H A;  3KBG A;  1XPR A;  2K50 A;  3BDL A;  2R61 A;  1DD2 A;  1XPO A;  1TQO A;  3WDN A;  2MQH A;  1KDA A;  2GVA A;  1TY2 A;  5FLX E;  4AYB G;  1PFN A;  2K75 A;  2SNS A;  3PIP 3;  2B63 H;  1Y8P B;  3AFP A;  3M4O B;  2VQF L;  1FYC A;  4JCV E;  2JQO A;  4C1N K;  2QDB A;  4A3B H;  4QMG A;  4DUZ Q;  1KLU D;  5EKL A;  4C3H B;  1HNX L;  1FJG Q;  4KHZ A;  1KIX A;  3OOC A;  3GTM H;  3AMU A;  1SYB A;  4HMJ A;  2A74 C;  1HR0 Q;  3RZO H;  1AH9 A;  2ZM6 Q;  2MJ8 A;  2EY2 A;  5E7N A;  1G6Z A;  1X65 A;  1LTT D;  1PFB A;  2QCP X;  3G48 A;  4HSP A;  2NN6 I;  2Q2H A;  4DR5 Q;  2N88 A;  2FMM A;  2J4X A;  4DR1 L;  1SSO A;  1RJT A;  1X32 A;  3ICE A;  1WTR A;  1PMR A;  4LJZ C;  2HQL A;  1SN8 A;  1CKN B;  3S2H H;  2MGS A;  2A6E C;  4K6L A;  1EWC A;  2K5Q A;  1H9R A;  4GNX B;  2XRQ D;  5AFW A;  4EGV A;  1N32 Q;  1O80 A;  1ZXT A;  3MEH A;  4A3E G;  3GTK B;  4A3D B;  3F8T A;  2NVY B;  4RCO A;  1R9T H;  1XMO L;  2KHS A;  2H4O A;  3WOF A;  2ZM6 L;  1HFG A;  4L6T B;  1LYL A;  5LL6 S;  3VA5 A;  4A3E B;  2NVT B;  3FP9 A;  5C5L A;  4DR3 L;  4DU9 A;  1GHK A;  3LGJ A;  3GP7 A;  1ESF A;  2R93 G;  1IBM L;  3W2D A;  1M1K C;  1C0A A;  4I65 A;  1KL9 A;  4Q0F A;  3HOV G;  1DGS A;  2ATW A;  1K3R A;  5DNF A;  3PUY A;  2B2T A;  1K8M A;  2R93 B;  1EU4 A;  3NBI A;  2CKZ B;  1C4Q A;  4TQU S;  1X54 A;  4WOR A;  4OO1 I;  3DEO A;  1UE6 A;  2V1C C;  1MD2 D;  3I3C A;  2KQ3 A;  1F2Z A;  1JR0 D;  3A8K E;  3C2P A;  1YJ9 A;  1PRT C;  4RGO S;  4CDE C;  5M9O A;  1B2T A;  1JWM D;  3S2D H;  2PNR C;  4RA8 A;  2A6H D;  1EQR A;  2EZV A;  1G2S A;  1TS2 A;  4C3J G;  3QR8 A;  1EEI D;  3M4P A;  1K28 A;  3UDF A;  3OSO A;  2F0V A;  1WD1 A;  4IFD I;  1VQP A;  3HG9 A;  2L15 A;  2ES2 A;  1JOK A;  5EPJ A;  4C3J B;  1Q7Y C;  2F3V A;  4IUU A;  1VQO A;  4LUZ A;  3W1G A;  5C4X H;  2J0T D;  2IHF A;  1TS3 A;  4IQZ A;  2LSS A;  4B3M Q;  4KHV A;  1WI5 A;  1U4M A;  3I8Z A;  1SMY D;  2I46 A;  1QNU A;  1NAP A;  2ZTC A;  3I4M G;  2WAQ G;  2XWJ B;  1B7Y B;  4DV6 L;  4RWS C;  4EQN A;  4G7O C;  4NXM L;  3DMU A;  5C0X H;  1QVF A;  3J80 i;  5M5Y B;  4HIO A;  2HUG A;  1EOV A;  1N9W A;  3I4M B;  2WAQ B;  4R4I A;  5ELD A;  3S24 A;  2B2W C;  3BDC A;  4H02 A;  1V43 A;  2YTY A;  1EUJ A;  5FLM G;  1G51 A;  4CKC A;  1PYB A;  2HIV A;  1SYE A;  2K5D A;  3J80 E;  5T1G A;  1F9S A;  1SR3 A;  3I72 A;  2KCM A;  3M9B A;  4B3M L;  2G9H D;  1PH4 A;  3NQT A;  1VQ6 A;  2IX0 A;  2R92 B;  5IT9 L;  3BZC A;  4P72 A;  4UHV A;  1C8C A;  1I4X A;  1XXG A;  4XIG S;  2J7Z A;  1XNR Q;  5IY0 A;  4DR6 Q;  5CR3 A;  4DXF A;  2K5H A;  4S3S A;  2BOS A;  1EY4 A;  4F88 A;  4IJL A;  4ILW A;  1JWS D;  4AIM A;  2CQA A;  3S1M H;  3HP3 A;  2YU9 B;  1AFP A;  4K5X A;  2PZW A;  2SEB D;  4DV2 Q;  3E6Z X;  2EYH A;  2B8F A;  2VY3 A;  3OMC A;  3DM1 A;  2PMZ B;  1BCP B;  1N36 Q;  4A3I H;  1HZ9 A;  4JG2 A;  4R1J A;  2E5L L;  2B2V C;  5IYC G;  5A2Q L;  1TII D;  2HHH Q;  4JOI A;  2L5T A;  2AQ2 B;  1MSG A;  2F0E A;  1XMQ L;  1I6H B;  3CHB D;  2E2I B;  5IYD H;  1OXX K;  2Q8I B;  1QB5 D;  2XGT A;  1PXU A;  4P71 A;  5AJ3 L;  1ROD A;  1T5E A;  2UUC Q;  4LF8 Q;  4ZRZ A;  4DV2 L;  1SJH D;  4V19 0;  1V1P B;  2WII B;  1IW7 D;  2DN8 A;  3SXH A;  3J7A 5;  3WOE A;  1NY4 A;  4BY7 H;  3I2Z A;  2JK8 A;  4JI1 L;  2RDH A;  2X6L A;  1E24 A;  4R4C A;  3BS1 A;  4LF4 L;  3J7A V;  1CUK A;  2K01 A;  3Q0A A;  4HJ8 A;  1U4R A;  4O0A A;  1STH A;  2WFW A;  2JA7 G;  3GTO B;  3CQZ B;  2E2H B;  3VR5 A;  3BJU A;  1WTX A;  4IUT A;  1HNW Q;  1RKN A;  1BXT A;  2UUC L;  3GTL H;  1I3Q B;  3E0J A;  3VYT A;  4IUR A;  3K0X A;  3KJP A;  5T1I A;  1SJE D;  4QIW B;  4OL7 A;  1KD1 C;  3F2U A;  5CYU A;  1DXM A;  3NSW A;  2VQE L;  1U4L A;  5IOD A;  3L3O C;  1FD7 D;  1AE2 A;  1K83 H;  1TWH B;  2FHT A;  2Q2I A;  4R4O A;  1G29 1;  1C9O A;  4LUO A;  1YNJ D;  2DNC A;  1I50 B;  4JPB W;  4DK6 C;  3CCE A;  3FEW X;  1BO0 A;  4JI5 Q;  3KF6 B;  1BF4 A;  1JOO A;  2R7Z G;  1GOZ A;  1VQ8 A;  2PCF B;  1E2Z A;  2KVM A;  2R7Z B;  3IRB A;  2JA5 H;  2B8G A;  4JI2 Q;  1WYD A;  5D3I B;  2P5Z X;  3OW7 A;  1Q82 C;  5I6Y A;  2ZJQ A;  1ONL A;  4B3S Q;  3D4D A;  2XTI A;  1R4P B;  1YNN D;  2IHE A;  2N49 A;  4L63 B;  4N9T A;  5K36 G;  2Z6K A;  3HOZ G;  3CMA A;  2NVX B;  3FPP A;  3BYY B;  4RMF A;  2YYZ A;  2B2U C;  1KNE A;  2HDL A;  3C46 A;  2VXW A;  1VQC A;  1I4R A;  3K7A B;  1AZQ A;  4XT1 B;  1RTO A;  5FO8 B;  4CDF C;  1G2T A;  2EJG C;  4JI2 L;  1B3A A;  4KJO A;  1F2M A;  4TRD A;  5KYI A;  1VMC A;  2B2Y A;  3EVQ A;  4AH6 A;  4R8N A;  4J15 A;  4PZ7 A;  5J3B A;  5C0X I;  1CHQ D;  2F0T A;  4NXN Q;  2KCN A;  3D6C A;  4JI4 Q;  2RSN A;  3CKI B;  4OHJ A;  5CV8 A;  2XWB B;  1RF2 D;  2ALY B;  4C3I G;  1XPU A;  1KNA A;  2PW5 A;  4DR2 L;  3A54 A;  1A2U A;  1VQE A;  1D8L A;  3L2P A;  5CBE E;  3T1H Q;  1QZG A;  1Z7T A;  4K6D A;  1EYG A;  1PH5 A;  3IKJ A;  4RCN A;  2WAC A;  1EQQ A;  5E1F A;  1HNZ Q;  4BXX G;  4EQO A;  3HOY G;  1CSP A;  3GTP B;  4KJN A;  3NXW A;  1JT8 A;  3RD4 A;  4M1U B;  3V2T A;  3NTI A;  1PFM A;  1M4V A;  1L1O C;  1EY7 A;  1D5X C;  4LF9 Q;  3HOY B;  1FVI A;  5IP9 G;  4KHP Q;  5M3F H;  3RLO A;  1L0Y B;  2L4N A;  3EJI A;  1SDF A;  2F0N A;  1J5E L;  1SNQ A;  5JEA H;  1CT1 D;  1RIP A;  2DUD A;  2XVS A;  2IY5 B;  4LMQ D;  2NTT A;  3GTG B;  4K5W A;  1EZ8 A;  5FLX L;  3CCM A;  1HNZ L;  1L2F A;  4HJA A;  1X3Q A;  3PO3 G;  3HKZ E;  5ELN A;  3TEH B;  2CWP A;  1N8R C;  2I5M X;  4B3T Q;  4HN7 A;  3JAM c;  2Y0S B;  5IGB A;  2R3Z A;  2E2J B;  2ZXO A;  1ILP A;  3PO3 B;  2KCC A;  3RZD H;  2WIN B;  3HOW G;  5COY A;  4UAI A;  2RBM A;  1Q81 C;  3S1R B;  2BA1 A;  1LT4 D;  3L9A X;  1X55 A;  3F2C A;  3S1N H;  5IE8 A;  4XQQ A;  1X9N A;  4DN4 M;  1A62 A;  1HQR D;  1EY5 A;  2PZU A;  2VS1 A;  1WTO A;  1H9M A;  4JBW A;  2IX3 A;  1FNU A;  5GAE C;  1WVL A;  5M3M G;  3MXN A;  2BDO A;  1SYF A;  1IYJ B;  2NN6 H;  4UP9 A;  2BA0 A;  5IP7 H;  1CKM A;  4A3F H;  2RCF A;  3OWE B;  3KUP A;  3ERS X;  1I6V C;  4YHH Q;  3S17 B;  2RA4 A;  2WB1 G;  1BCP F;  3T16 A;  3G4S A;  5DM7 3;  4KY7 A;  1IKM A;  1VQD A;  3I4N H;  3T4A C;  3IL8 A;  4BBR H;  3HZX A;  4QB4 A;  1XJV A;  1MJC A;  1WCM G;  2O4X A;  1CI3 M;  4L5S A;  1PTO B;  1SNP A;  3RN5 A;  1LTR D;  1PFS A;  1IZ6 A;  3KYH C;  2I07 B;  1WCM B;  1LT3 D;  4LFB Q;  3STB C;  1SMX A;  1TWF B;  4PZ6 A;  3CD6 A;  1Y1W B;  3S1Q H;  1B8A A;  3G6J B;  4YHH L;  4KY5 A;  1ZKO A;  4JI3 L;  1ICF B;  2KJX A;  3AU7 A;  2A73 B;  5FJ8 H;  1KDB A;  4IUN A;  1K0S A;  3NEL A;  2QIL A;  3MXN B;  4GLA C;  2GVB A;  4IOC A;  1FNV A;  4X65 L;  2CWA A;  4C2M B;  1RDP D;  4HJ7 A;  1S5D D;  4LFB L;  2PZT A;  4U67 3;  3NP8 A;  4PMC A;  3SVM A;  2KEC A;  4DV0 Q;  4KKU A;  1QIL A;  1TS4 A;  3FPU B;  4L8J A;  4ME5 A;  1SLJ A;  4CKB A;  3SK6 A;  1JJG A;  4K14 A;  4GLX A;  4IFD H;  2OQ0 A;  1CK1 A;  5FOB B;  3CC4 A;  2JEA I;  1RHP A;  2EYO A;  5JJI A;  1NJI C;  3R93 A;  2F0K A;  3CCU A;  1SE4 A;  4B9X A;  5IIF A;  1QG7 A;  2A1A A;  2F52 A;  1JE4 A;  2L11 A;  4APV A;  3GDE A;  2B63 G;  4K0K L;  3A0J A;  1QUQ A;  1WOC A;  4RKL A;  5IYB H;  2K1B A;  1Y1V H;  3FDT A;  2B63 B;  2CQO A;  4WRD A;  3KF8 A;  3VYS A;  3I7F A;  4A3B B;  1Q1B A;  2IJ0 A;  1NMF A;  4JBJ A;  1FL0 A;  3CCL A;  4OEL B;  3J80 L;  1E2V A;  3J81 i;  2H5X A;  1MSH A;  3KK7 A;  5ELO A;  1STA A;  1VDZ A;  3GTM B;  2V4D A;  4A3K H;  2KCT A;  4OWW B;  5JVG 3;  2ZXR A;  1CZG A;  3ULP A;  2VW9 A;  3J81 E;  1W6J A;  3IFD A;  1X6O A;  1CHP D;  5LMU L;  2JA8 G;  3GTQ B;  4F8M A;  2F0S A;  4JI8 Q;  1Q86 C;  1E7Z A;  1Y69 U;  3S2H B;  1Q8I A;  2N55 A;  2B39 A;  1HNX Q;  2N78 A;  2JA8 B;  2OTJ A;  1EY6 A;  2A69 C;  2F4I A;  2KOL A;  2JJQ A;  4MTN A;  1FR3 A;  1WTH A;  1EY0 A;  4LFA L;  2KED A;  3MEF A;  4MN3 A;  1Y14 B;  2F0M A;  3K80 C;  4DAM A;  4FF2 A;  5BN3 A;  1PYS B;  1NSN S;  5EBC A;  3K5M A;  4JK1 C;  3MWY W;  3PUW A;  5ELB A;  4DR1 Q;  1E3P A;  4X66 L;  1E1T A;  4LNQ A;  4C3H G;  1X56 A;  1JMC A;  4GZY C;  4JI8 L;  3Q22 A;  2CVR A;  4A3C H;  5JJK A;  2K14 A;  4JV5 Q;  5IWA L;  1MIU A;  3PIO A;  4OWX B;  4GKK L;  2DJF C;  2YV5 A;  2VNU D;  4XQJ A;  2RQX A;  3TRZ A;  3SDZ A;  4ZKC B;  1FGB D;  1AE3 A;  1TWC B;  2Z4H A;  3Q6S A;  4Y52 H;  1HFN A;  1ENF A;  3EFX D;  4N9P A;  1XMO Q;  1LT5 D;  1EQT A;  3U4Z A;  5IT9 c;  4HIM A;  1GHJ A;  3K81 C;  1Q46 A;  1W2B A;  4DR3 Q;  2ZTE A;  3CME A;  1EIF A;  1T5X D;  2AQ3 B;  1EIG A;  2G9D A;  2VUM G;  5KGU A;  4A3L G;  1IBM Q;  1QZH A;  4JV5 L;  3A56 A;  4CDD C;  4I7Z C;  2IWH A;  5TSS A;  2A68 C;  2VUM B;  2UUB L;  4A3D G;  3S16 B;  4GOP A;  1LV9 A;  1VS0 A;  4N8F A;  1C7Y A;  1H95 A;  4NB3 A;  1F9R A;  1N34 L;  3R3O A;  1HTL D;  3Q23 A;  4BBS H;  2F0H A;  1HPC A;  2EIF A;  3QJY A;  1A2T A;  4QQB X;  1A6X A;  3KFU A;  3K59 A;  1A3U A;  2ICI A;  4HMI A;  4DFA A;  1MGS A;  4DK1 A;  5CV9 A;  1QE6 A;  1LM0 A;  3A7A B;  1J8I A;  1SE2 A;  2PQA A;  4DK0 A;  3I73 A;  1JC7 A;  1DOM A;  4KD3 A;  3ERO A;  1RL2 A;  3VDY A;  1F9Q A;  2RKS A;  3M4O H;  2LKV A;  3OYY A;  3S9W A;  3CF5 A;  3E3X A;  4WJW A;  1PRT D;  4QCL A;  4CHT B;  1V1Q A;  1EWH A;  2OT2 A;  5FK9 C;  4POF A;  1HZA A;  1JB3 A;  1VMP A;  3CRL C;  5BN4 A;  1BBX C;  1L0X B;  1JWU D;  3TRE A;  4DV6 Q;  3MXG A;  1E2W A;  3GO5 A;  4L5Q A;  1QCB D;  1HJP A;  4O42 A;  4NXM Q;  1PTO F;  4ODG A;  1XWE A;  2F0D A;  1DON A;  1QVC A;  1HTP A;  4O2D A;  1QVG A;  5ELF A;  4OXP A;  3KJO A;  2K04 A;  2MO0 A;  4DNI A;  4ME3 A;  3S1M B;  3TSS A;  4AYB E;  3SGI A;  3IAY A;  3ER0 A;  3TME A;  5C4J B;  3NEM A;  1EY8 A;  3CCV A;  2G5D A;  4A3I B;  4LWC A;  4RAU C;  3CPF A;  3KDF A;  5GAD C;  4FVM A;  5KNB A;  1KLG D;  1ESR A;  1Z6H A;  1TWA H;  4A3E H;  1WTW A;  3VR6 A;  2ZJP A;  2NVT H;  2F0P A;  2A19 A;  3TS0 A;  3JAM i;  2R92 G;  5EKI A;  1S40 A;  1S4Z A;  2EYJ A;  1A8V A;  4QUF A;  1PDQ A;  4YWL A;  1B53 A;  2E76 C;  5COR A;  2Z6B A;  3NHH A;  1STB A;  3E5S A;  2R93 H;  2RHS B;  3EN2 A;  3ND9 A;  2AUK A;  3H3V C;  2LXJ A;  2E5L Q;  2RDF A;  3HOV H;  4FNF A;  4GNX C;  3P20 A;  1SFO H;  4A3J G;  1O7L A;  1XMQ Q;  1KXL A;  3TP7 A;  5H1S E;  3M3Y B;  2E74 C;  3D4W A;  2ZJR A;  4ZLT F;  1B44 D;  3A74 A;  2LY7 A;  1BOS A;  4A3J B;  2GN5 A;  4A4I A;  4KLK A;  5AJ3 Q;  2K52 A;  3PUV A;  1VQM A;  2LS0 1;  3GTL B;  3QOJ A;  2K33 A;  1TWG B;  3MFY A;  3OTO Q;  4YWK A;  1YIJ A;  2IT1 A;  1GUG A;  3E9I A;  4C3J H;  4JI1 Q;  1TS5 A;  1S5E D;  3I70 A;  4YCW A;  3H6M A;  4A3M G;  4LF4 Q;  3KDF B;  2NVQ H;  1DZ1 A;  1VQ9 A;  1RTN A;  2EVB A;  1XNQ L;  1SNO A;  3SHL A;  1C48 A;  4ZK9 B;  1WD0 A;  4A93 G;  1G6P A;  3HOU G;  4A3M B;  4UY8 C;  4LF5 Q;  1YHA A;  1E0B A;  2L12 A;  1HA6 A;  3HEJ A;  4A93 B;  2XRS D;  3T51 B;  3HOU B;  1A3V A;  1TY0 A;  1K0R A;  3DXJ C;  3OTO L;  3I4M H;  2F3W A;  1VF5 C;  2JA6 G;  3FMC A;  2VQE Q;  4JC0 A;  4V0B A;  2BE5 C;  1VCI A;  3ITP A;  1YNX A;  1LTS D;  3S14 B;  1VQ5 A;  3MHB A;  2JA6 B;  5FLM H;  5C6A A;  4L5R C;  4YY3 L;  2AMC B;  2K5N A;  2K6A A;  2QKI C;  4LF5 L;  1ILQ A;  3TN2 A;  4A3G G;  3N52 A;  2R7D A;  1CM9 A;  2EPB A;  2BH2 A;  4A3G B;  2UXB L;  4HR7 B;  1PH1 A;  5FLX c;  2AWO A;  2WAQ E;  2EYF A;  1JJ2 A;  4LF6 L;  3M7N A;  1HH2 P;  2B2T C;  1CA5 A;  1LAB A;  2R7F A;  2YU9 H;  1GUN A;  5A35 A;  1VQ4 A;  4DAP A;  3PIO 3;  4HID A;  1NE3 A;  1IBL Q;  5LMN W;  1ENA A;  5JOB A;  1Q1E A;  2UU9 Q;  5KRU A;  2RHQ B;  4TVA B;  1O7I A;  4TSS A;  1HCZ A;  4DV7 L;  1I6H H;  2A8V A;  5IYC H;  3CC2 A;  2E2I H;  1WTV A;  2RDG A;  4ZUI A;  2KA7 A;  4H44 C;  4MTK A;  4PNY A;  4DR7 L;  1BQQ T;  2QA4 A;  4FO2 A;  3A5Z B;  1D1I A;  4FXG C;  3HKZ B;  3TP8 A;  1ET6 A;  3WWV A;  4KK7 A;  1EYC A;  1Z9F A;  1IBL L;  5EPK A;  4DV3 L;  3PSI A;  2UU9 L;  3PMF A;  2F0L A;  3P1H A;  1BBU A;  2PMZ E;  3CXC A;  1YI2 A;  5CV5 A;  5JEA G;  5J22 A;  4DR2 Q;  1IYV A;  1BCP C;  2RF4 A;  1F2L A;  3H3V I;  2CHB D;  4HJ5 A;  5JAV A;  4JBK A;  4CJ0 B;  4BY1 G;  4PMW A;  5CV6 A;  1CZW A;  1X3F A;  1SND A;  1STE A;  1NBW A;  3TDQ A;  3ULJ A;  3OHX C;  5KNC A;  3QWN A;  1V9P A;  4XDX A;  1I3Q H;  3T1Y L;  2NZ1 D;  2JA7 H;  2DNE A;  1BUV T;  3GD7 A;  3A55 A;  1W6K A;  1VQL A;  2UUA L;  4BY1 B;  3MVV A;  2KBN A;  5M5W H;  4JI0 Q;  1PH7 A;  2PI2 A;  3ZJY C;  2IPK D;  3AB9 A;  4G57 A;  3RZD B;  1EY9 A;  4POG A;  1E1O A;  1IL2 A;  1TWH H;  3I91 A;  5G3L F;  1IXR A;  4MZ9 A;  2L1B A;  1J5E Q;  5LHY 1;  3HRZ C;  1M90 C;  1CQF A;  1I50 H;  4ZAI A;  5E4W C;  1TVX A;  3E9H A;  3GV3 A;  1KAA A;  4XT3 B;  3A5U A;  4GN3 B;  2UXC L;  1A15 A;  1JE5 A;  3J81 L;  3DM3 A;  1LTI D;  3R2T A;  2F0W A;  4F7X A;  4QF4 A;  3S15 B;  4IUV A;  2IX1 A;  4LF7 L;  1KTK A;  4K2L A;  4JI0 L;  4FXD A;  2R7Z H;  2FIN B;  4RHR A;  4HSV A;  1DOK A;  4NPS A;  3PUZ A;  4QY7 A;  4M8A A;  3QIA A;  1HQM C;  1SE3 A;  1KAW A;  2D0P A;  4HJ9 A;  3I4N B;  1EFI D;  5ELE A;  5BN5 A;  4DUY Q;  3H0G G;  5D3D A;  4UDU C;  4DV1 L;  2Q2T A;  3ZYY X;  3MA2 B;  2OEO A;  3GTJ H;  3SR1 A;  4IPG A;  4IUP A;  3AYH B;  4JOI C;  5LL6 X;  3BG3 A;  4CDC C;  2KUM A;  2Y0S G;  5K36 H;  1K3B C;  3H0G B;  1GUS A;  3HOZ H;  3FKI G;  4P74 A;  3D4R A;  3K7A H;  2Z0S A;  5C4Z A;  1GUT A;  4I7A A;  3FKI B;  3L7Z C;  3S1Q B;  1STG A;  4B3R L;  1R4Q B;  4G4K A;  4OO1 G;  3J80 c;  3UE0 A;  1KC8 C;  1SYG A;  3EIV A;  4DUY L;  3AFQ A;  1BDO A;  2BDN A;  4IN3 A;  5EPL A;  1AN8 A;  3CP0 A;  4XYQ A;  4B9W A;  1UE7 A;  1U9R A;  2WP8 J;  1UUP A;  2WKC A;  2MFI A;  5C3E H;  4YWM A;  3RLN A;  3LX0 A;  4RGM A;  2OXP A;  3TQY A;  4MNO A;  1PLF A;  4JBM A;  4DXG A;  4U68 A;  2EYM A;  2PQE A;  3NTH A;  1K73 C;  1LT6 D;  2O5J C;  2HCI A;  1RD9 D;  4C3I H;  3U4V A;  2QEJ C;  5C5M A;  4C56 C;  4RG1 A;  4JI3 Q;  1SBB B;  4RFB A;  1JQY D;  4KN4 C;  2D0O A;  3O13 A;  3DWP A;  3MZ5 A;  2QW7 A;  1EU3 A;  4BXX H;  2CW0 C;  2GA4 B;  1PVO A;  2PPB C;  3STB D;  5IGD A;  1Y1W G;  4X65 Q;  2EY5 A;  1VQJ A;  3CRK C;  4OIJ A;  4DV5 L;  2ID0 A;  5C3X A;  3C1F A;  3M7G A;  5IP9 H;  1TKW B;  4XYO A;  1S5B D;  2MO1 A;  4ZCK A;  4Y7N H;  1GUO A;  2FFK B;  5C44 H;  1EQV A;  5C0X J;  1ICW A;  1B9N A;  2F03 A;  3J7Z C;  1I94 Q;  2Z4I A;  4FF3 A;  4HED A;  4JVZ A;  1QNK A;  3I4L A;  2ICE C;  3KLS X;  2MNA A;  1FGU A;  3PO2 G;  2F4V L;  4DNR B;  3PO3 H;  2PNH A;  4K0K Q;  2Z6K C;  3S1R H;  4HCE A;  3VR4 A;  1E22 A;  4A3K B;  1V1O A;  3PO2 B;  4QJF A;  4OIK A;  5JJZ A;  4DV4 L;  5C4H A;  3HOW H;  1NUC A;  4N8X 1;  4KI0 A;  3W1B A;  2JN4 A;  4EX5 A;  2FJ2 A;  2ENB A;  3U9O A;  1DYQ A;  1B1Z A;  2KHI A;  1OTC A;  3CU7 A;  1I94 L;  1J9O A;  4JYA L;  2O5I C;  3J81 j;  4ULL A;  5M3M H;  2B2Y C;  3RN2 A;  2R6G A;  3QO2 A;  3DUZ A;  3S17 H;  1LAC A;  2ZXP A;  1XTD A;  4A3B G;  3T13 A;  2JP1 A;  5CC4 A;  1HUM A;  4DPG A;  5LMU Q;  3D0F A;  2JEB I;  1AEX A;  4FDB A;  3HOX H;  4KTA A;  3AQQ A;  2OQK A;  1KHI A;  1WCM H;  3LWU A;  3KOJ A;  1MKH A;  2X69 A;  4K2K A;  2Z9H A;  3K5N A;  1Q12 A;  3K57 A;  2HD3 A;  4LFA Q;  2K03 A;  2QDL A;  3MXU A;  1S5C D;  4DNT B;  4XQN A;  2O2L D;  2CCZ A;  2L0C A;  1PHJ A;  4DA2 A;  3RZO B;  3VA7 A;  3MC0 B;  3CCQ A;  1BKB A;  4RGN A;  4UPA A;  1IBK L;  4X66 Q;  4B08 A;  5IGG A;  3ERQ A;  4PZ8 A;  4UP8 A;  2WB1 E;  1AP0 A;  2B2W A;  2A69 D;  2JXM B;  2HT1 A;  5JPM C;  1CSQ A;  3EBE A;  5M5X H;  5IWA Q;  4GKK Q;  2Q8R E;  3NE5 B;  1GO3 E;  4G7Z C;  4JI6 Q;  1PTO C;  1O78 A;  4J1M A;  3URY A;  3U58 A;  2NZH A;  3ONA B;  3UDX A;  1II3 A;  1QUQ B;  1S5F D;  1VQH A;  4BBS B;  1R9T B;  3H09 A;  1PRT B;  1DJR D;  3MAQ A;  2L9H A;  3AEV A;  3LWE A;  3KLR A;  3NTK A;  2I0Q A;  2XN9 C;  3TZU A;  1MI2 A;  2ZT9 C;  1EEF D;  3KF8 B;  4HTH A;  2N3S A;  4X3S A;  2NWG A;  4FF1 A;  2A5H A;  4RKB A;  4JW0 A;  3VYR A;  3BYT B;  4WJ4 A;  1N33 Q;  4LFC L;  4CJ2 C;  4XTC S;  4GS3 A;  2UUB Q;  4JI6 L;  3FVQ A;  1EYD A;  2ASB A;  3TBI B;  1ZYR C;  1B50 A;  2K05 A;  1L0W A;  3HFZ B;  4H7B A;  4ID6 A;  2EQS A;  2E8G A;  1IL8 A;  1N34 Q;  2D5D A;  2VB3 X;  1VF7 A;  5D14 A;  5I2Y A;  1P16 A;  4X3U A;  2F3I A;  3M4Y A;  4GKJ L;  1HHV A;  1PZI D;  4AYB B;  2F0I A;  1YHB A;  4NMZ A;  2OTL A;  2A6E D;  2B2V A;  3P7J A;  1OXU A;  1Y8N B;  2A68 D;  2AWN A;  4BS9 A;  3F2B A;  3CCS A;  4DK3 C;  3S2D B;  4FXK C;  1N33 L;  1YZ6 A;  4E6I A;  4J8Q A;  1EZ6 A;  5C4X G;  3K6O A;  1MHW C;  1GJX A;  3QB3 A;  4EQP A;  2X6G A;  3GTQ H;  5C4X B;  2K28 A;  5GAG C;  3BVG A;  1SRO A;  2KEE A;  5F2D A;  1TXY A;  2EJM A;  1HR0 W;  3MXP A;  4F87 A;  2JA8 H;  2M00 A;  4DUZ L;  1HUN A;  5C0X G;  3OMG A;  4IO9 A;  1RCV D;  1FJG L;  3B6Y A;  1PV4 A;  4QGU A;  1A0I A;  1DOL A;  2I5H A;  3BZK A;  5DAU A;  3HS0 C;  2D9U A;  3SE0 A;  1HR0 L;  1VQ7 A;  1J6Q A;  3CPW A;  2AHO B;  1AZP A;  1TWA B;  4A75 A;  1AW7 A;  4DR5 L;  1B70 B;  3FRP B;  3K7U C;  2N8N A;  2Z1C A;  3K8A A;  4ZQ3 A;  4YCV A;  4C3H H;  1S72 A;  1PH6 A;  3PF5 A;  4PMB A;  3TS2 A;  1TWC H;  4DKA C;  3D6W A;  3H15 A;  1N32 L;  4G7H C;  1I4G A;  1OXS C;  2L55 A;  3HOV B;  1DCZ A;  2XNA C;  2HCC A;  4ZKB B;  4GOP B;  1SFO B;  1ASY A;  3LNN A;  3BZD B;  3NEN A;  1STY A;  4ABN A;  1HRJ A;  1NNX A;  1UE1 A;  1H9J A;  1KDC A;  1U0L A;  2B29 A;  1XYI A;  1VQA A;  5GQO A;  1K8G A;  1Q8K A;  2IW3 A;  4LAA A;  2NUC A;  4HAE A;  5JVH 3;  1VQK A;  3H3V H;  1X3E A;  2CFM A;  3BU2 A;  4C1N I;  4A3I G;  5E3F A;  2VUM H;  5JEA J;  3S16 H;  4A3L H;  4X6A H;  1BBW A;  2A6H C;  2TMP A;  2EXZ A;  2AUJ D;  2C35 B;  1EFW A;  3GTK H;  2PQA B;  4A3D H;  2NVY H;  1T9H A;  1GM5 A;  1SAP A;  5IYD G;  2NVQ B;  1WTQ A;  2B2U A;  3X3M A;  1PZK D;  1O7Y A;  3NBH A;  2K4K A;  1Z47 A;  1SMY C;  1XTC D;  4H13 C;  1BNZ A;  4BY7 G;  3CCJ A;  2F0O A;  1D2B A;  3P75 A;  2NBF A;  1UNS A;  1FNW A;  3JAM E;  3GQB A;  4BY7 B;  4QUC A;  4ALP A;  1PYW D;  3HKS A;  3W5O A;  2AKW B;  5EAY A;  1JIC A;  5EGT A;  5NUC A;  1UE5 A;  1XNQ Q;  4KV6 A;  3E0E A;  4EQ5 A;  5EQ0 A;  2MUY A;  5HY6 A;  1U5K A;  1SYC A;  1HA5 A;  1V1P A;  3IFT A;  5JJL A;  2PO4 A;  2XIW A;  3PUX A;  4FP5 D;  1MBY A; 
#chains in the Genus database with same CATH homology
 1V9P A;  2KHJ A;  1I3Q H;  4JI3 L;  4A76 A;  3RNU A;  3T1Y L;  1KQS A;  1HR0 Q;  2JA7 H;  3RZO H;  2ZM6 Q;  1AH9 A;  3GD7 A;  5E7N A;  2UUA L;  1VQL A;  1X65 A;  4L5T A;  5FJ8 H;  1SE8 A;  2KBN A;  3G48 A;  5M5W H;  3FHW A;  4JI0 Q;  2NN6 I;  2Q2H A;  4DR5 Q;  1PH7 A;  4DR1 L;  2PI2 A;  3ZJY C;  3NEL A;  4HIK A;  3MXN B;  4GLA C;  2GVB A;  4IOC A;  4X65 L;  3ICE A;  2CWA A;  2HQL A;  1OXV A;  1CKN B;  1SN8 A;  1E1O A;  4POG A;  4HJ7 A;  1TWH H;  1IL2 A;  3S2H H;  1L1O A;  3ULL A;  1IXR A;  4MZ9 A;  4LFB L;  1J5E Q;  4YY3 Q;  4GNX B;  1M90 C;  3KLW A;  5C4J H;  4DV0 Q;  1I50 H;  3E9H A;  3A5U A;  3NBH B;  2UXC L;  4GN3 B;  1N32 Q;  2LXK A;  1JE5 A;  1SLJ A;  1JJG A;  4A3E G;  3J7A 5;  3F8T A;  3DM3 A;  5M5Y H;  4GLX A;  1R9T H;  2OQ0 A;  1XMO L;  1XNR L;  2UXB Q;  2JA5 G;  4DR4 Q;  2ZM6 L;  4DR6 L;  4PG3 A;  1LYL A;  3CC4 A;  2JEA I;  1K8A C;  2IX1 A;  5JJI A;  3UDG A;  4LF7 L;  3J81 c;  1NJI C;  1CKO A;  3UDI A;  3FP9 A;  3CCU A;  4JI0 L;  4DR3 L;  2R7Z H;  4LF6 Q;  2A1A A;  3LGJ A;  2F52 A;  4GOP C;  4APV A;  2JA9 A;  2R93 G;  1IBM L;  3GDE A;  4NPS A;  2B63 G;  4K0K L;  3A0J A;  3PUZ A;  4QY7 A;  3KF6 A;  1QUQ A;  1M1K C;  1WOC A;  3CAM A;  5IYB H;  1C0A A;  1KL9 A;  1KAW A;  2D0P A;  1DGS A;  4HJ9 A;  2ATW A;  1K3R A;  3HOV G;  4DV1 L;  4DUY Q;  3PUY A;  1Y1V H;  3H0G G;  5DLQ E;  2Q2T A;  2R92 H;  3GTJ H;  2CKZ B;  2CQO A;  4IPG A;  4TQU S;  1X54 A;  3AYH B;  3GTM H;  4JOI C;  4OO1 I;  1N36 L;  4IFD J;  1UE6 A;  2Y0S G;  2V1C C;  3HOZ H;  3FKI G;  3I7F A;  4DR4 L;  1Q1B A;  1EIY B;  4P74 A;  1LUZ A;  4DV7 Q;  4OWT B;  1NMF A;  3PGZ A;  4JBJ A;  1FL0 A;  1K9M C;  2HHH L;  3CCL A;  3M3Y H;  3K7A H;  2Z0S A;  5LMN Q;  3J81 i;  2H5X A;  1YJ9 A;  3L7Z C;  5ELO A;  4A3J H;  3S2D H;  4B3R L;  4DR7 Q;  4OO1 G;  1EQR A;  3J80 c;  4A3K H;  1L1O B;  3UE0 A;  2KCT A;  4OWW B;  1KC8 C;  3M4P A;  1TWG H;  2VW9 A;  3ULP A;  2ZTD A;  3UDF A;  4LF8 L;  3EIV A;  4DUY L;  4DV3 Q;  3AFQ A;  4BY7 H;  4IFD I;  1VQP A;  2L15 A;  1X6O A;  5GRO A;  4X64 Q;  3CP0 A;  5LMU L;  3M85 A;  2ES2 A;  1UE7 A;  2WP8 J;  1Q7Y C;  2MFI A;  1VQO A;  5HGQ A;  2JA8 G;  5C3E H;  4LUZ A;  4JI8 Q;  4YWM A;  3W1G A;  5C4X H;  1Q86 C;  3RLN A;  2IHF A;  1E7Z A;  3TQY A;  2LSS A;  4MNO A;  4BA1 I;  1WI5 A;  4B3M Q;  1HZB A;  4JBM A;  3G6E A;  1HNX Q;  2N78 A;  3CW2 C;  2OTJ A;  3HKZ G;  1KRS A;  4A3M H;  2JJQ A;  4MTN A;  5LMN L;  3PCO B;  4IPD A;  1K73 C;  3I4O A;  4C3I H;  2ZTC A;  3U4V A;  2WAQ G;  4DV6 L;  1B7Y B;  4LFA L;  3I4M G;  1HNW L;  4A93 H;  3MEF A;  4RG1 A;  3T1Y Q;  1Y14 B;  3JC6 6;  4JI3 Q;  3HOU H;  4NXM L;  3K80 C;  4DAM A;  1VQF A;  3J80 i;  1QVF A;  4HIO A;  1EOV A;  1N9W A;  1PYS B;  4IJH A;  2UUA Q;  4R4I A;  2D0O A;  3S24 A;  5M3F G;  4BA2 I;  3PUW A;  1A63 A;  4H02 A;  1V43 A;  2YTY A;  4X64 L;  5GAH C;  1EUJ A;  5FLM G;  4DR1 Q;  1YIT A;  2B3G A;  4BXX H;  1E3P A;  1G51 A;  4X66 L;  1PA6 A;  1E1T A;  3STB D;  3L0O A;  4LNQ A;  1X56 A;  1Y1W G;  1PYB A;  1JMC A;  1PH2 A;  2HIV A;  4JI8 L;  1UEB A;  4X65 Q;  4A3C H;  5JJK A;  2K14 A;  4JV5 Q;  1VQJ A;  1SR3 A;  3S14 H;  2JA6 H;  5IWA L;  2KCM A;  1MIU A;  3M9B A;  4OON A;  4OWX B;  1EWI A;  3PIO A;  4DV5 L;  1NMG A;  4B3M L;  2ID0 A;  4GKK L;  2YV5 A;  2VZA A;  2VNU D;  3GTO H;  1PH4 A;  2FXQ A;  4DAY B;  3CQZ H;  2E2H H;  5IP9 H;  1VQ6 A;  3TRZ A;  2IX0 A;  1S3O A;  3BZC A;  1AE3 A;  4P72 A;  2UXC Q;  2MO1 A;  4Y52 H;  4Y7N H;  1YEZ A;  5C44 H;  4XIG S;  5C0X J;  1XMO Q;  1XNR Q;  3CCR A;  4JI5 L;  5IY0 A;  4DR6 Q;  3U4Z A;  3J7Z C;  5IT9 c;  4HIM A;  1I94 Q;  4A3G H;  2K5H A;  3K81 C;  4LF7 Q;  1Q46 A;  1W2B A;  4DR3 Q;  2ZTE A;  3CME A;  4UP7 A;  1EIF A;  2OCE A;  2VUM G;  4IJL A;  4JI7 Q;  2MNA A;  1FGU A;  3PO2 G;  2F4V L;  4AIM A;  4A3L G;  1WFQ A;  3PO3 H;  1VQG A;  2PNH A;  1IBM Q;  1QZH A;  2Z6K C;  4K0K Q;  4JV5 L;  3S1M H;  3S1R H;  2I5L X;  4DV2 Q;  2UUB L;  4B3S L;  1E22 A;  4A3D G;  3PIP A;  2D62 A;  4DV1 Q;  4GOP A;  4QJF A;  1C7Y A;  1VS0 A;  2VY3 A;  3M4Q A;  3HOW H;  5C3E G;  4DV4 L;  1H95 A;  4GLV B;  2BH8 A;  1PVO A;  4KI0 A;  4NB3 A;  3W1B A;  2NN6 G;  1W3S A;  4EX5 A;  1N36 Q;  4A3I H;  1N34 L;  1HZ9 A;  5IP7 G;  4A3F G;  4BBS H;  1SRU A;  4OX9 Q;  4JG2 A;  2EIF A;  4R1J A;  2E5L L;  5IYC G;  2KHI A;  1OTC A;  1X3G A;  2HHH Q;  1VQB A;  1I94 L;  4QQB X;  4JOI A;  2Q2U A;  4JYA L;  3KFU A;  1XMQ L;  3J81 j;  5M3M H;  3OW2 A;  1UWV A;  4JI7 L;  3RN2 A;  3I4N G;  4B3R Q;  4QIW E;  2R6G A;  4BBR G;  3I55 A;  5IYD H;  1OXX K;  1LM0 A;  3S17 H;  2XGT A;  4P71 A;  5AJ3 L;  2PQA A;  2UUC Q;  4R4T A;  4LF8 Q;  4DV2 L;  1XTD A;  4AQY Q;  4A3B G;  4DPG A;  5LMU Q;  4NXN L;  1RL2 A;  1LTL A;  3D0F A;  4JI4 L;  1NY4 A;  3D31 A;  3VDY A;  3I2Z A;  2JK8 A;  2K5V A;  1PH8 A;  2NVX H;  3M4O H;  3OYY A;  4JI1 L;  4GN5 A;  2JEB I;  1YJW A;  4OX9 L;  3CF5 A;  4FDB A;  3HOX H;  3AQQ A;  2OQK A;  4QL5 A;  1KHI A;  1E24 A;  1WCM H;  4R4C A;  4LF4 L;  1CUK A;  1V1Q A;  3KOJ A;  1MKH A;  5C44 G;  4POF A;  1HZA A;  4HJ8 A;  4O0A A;  2WFW A;  1Q12 A;  3TRE A;  4DV6 Q;  4LFA Q;  3T1H L;  2JA7 G;  3BJU A;  3RR5 A;  3GO5 A;  1HNW Q;  3G71 A;  4L5Q A;  5FJ8 G;  1HJP A;  4NXM Q;  4R4Q A;  2UUC L;  3GTL H;  2CCZ A;  4YCU A;  1PHJ A;  1YBY A;  4IPC A;  1JJC B;  1QVC A;  3CCQ A;  1BKB A;  4AQY L;  4BY1 H;  4UPA A;  3K0X A;  3KJP A;  1IBK L;  1KD1 C;  4X66 Q;  4O2D A;  4X62 Q;  1QVG A;  2VQE L;  4PZ8 A;  4UP8 A;  2WB1 E;  4OXP A;  3UE1 A;  3KJO A;  1AE2 A;  2HT1 A;  5IWA Q;  1CSQ A;  3EBE A;  5M5X H;  4LF9 L;  4GKK Q;  2MO0 A;  1GO3 E;  1K83 H;  3I56 A;  4DV5 Q;  4KHP L;  4DNI A;  4ME3 A;  3F2D A;  4JI6 Q;  2VL6 A;  4AYB E;  2Q2I A;  4R4O A;  3SGI A;  3U58 A;  1G29 1;  3ER0 A;  1C9O A;  4LUO A;  4IFD G;  3NEM A;  2NZH A;  4DK6 C;  3CCE A;  3CCV A;  4JI5 Q;  4LWC A;  3UDX A;  3KF6 B;  1QUQ B;  1VQH A;  1OXT A;  2R7Z G;  3CPF A;  3KDF A;  5GAD C;  3AEV A;  3GTP H;  1VQN A;  2I0Q A;  3S15 H;  1BVS A;  1VQ8 A;  3RLF A;  4IPH A;  1TWA H;  4A3E H;  2NZO A;  2ZJP A;  2NVT H;  3KF8 B;  4X62 L;  2N3S A;  3IRB A;  4B3T L;  1GVP A;  5IYB G;  2F4V Q;  1D7Q A;  2JA5 H;  3HOY H;  2A19 A;  1P8L A;  1WYD A;  4JI2 Q;  3TS0 A;  3JAM i;  1Y1V G;  2R92 G;  4WJ4 A;  1Q82 C;  1NTG A;  4LFC L;  1HZC A;  1YVC A;  4XTC S;  4GS3 A;  2ZJQ A;  2YTX A;  1S40 A;  2UUB Q;  1ASZ A;  4B3S Q;  4JI6 L;  2XTI A;  2IHE A;  1A8V A;  2ASB A;  2N49 A;  4YWL A;  4DV4 Q;  1JB7 A;  5K36 G;  2Z6K A;  1L0W A;  4IOA A;  3HFZ B;  2EQS A;  3HOX G;  3HOZ G;  2R93 H;  2E8G A;  2RHS B;  1N34 Q;  3EN2 A;  3CC7 A;  3CMA A;  3GTG H;  2LXJ A;  2E5L Q;  4RMF A;  3HOV H;  1P16 A;  4GNX C;  2YYZ A;  2F3I A;  1SFO H;  3H0G H;  1I5F A;  4GKJ L;  4JYA Q;  4A3J G;  2UXD Q;  1YHB A;  1XMQ Q;  4P73 A;  1KXL A;  5H1S E;  2OTL A;  1VQC A;  2ZJR A;  1OXU A;  4A3K G;  2E2J H;  2AWN A;  3FKI H;  3A74 A;  3F2B A;  3CCS A;  4DK3 C;  4JI2 L;  2GN5 A;  4A4I A;  4KLK A;  5AJ3 Q;  1N33 L;  2K52 A;  1YZ6 A;  3PUV A;  2KEN A;  1VQM A;  5BR8 Q;  4AH6 A;  4J15 A;  4LUV A;  3OTO Q;  1GKH A;  4PZ7 A;  5J3B A;  5C0X I;  5C4X G;  4YWK A;  4NXN Q;  2EXD A;  1YIJ A;  4JI4 Q;  2IT1 A;  4WJ3 M;  2JE6 I;  3E9I A;  4C3J H;  4JI1 Q;  4YCW A;  3GTQ H;  4A3M G;  5GAG C;  3Q8D A;  4LF4 Q;  1SRO A;  2ALY B;  3KDF B;  2NVQ H;  1VQ9 A;  1XPU A;  2UXD L;  4DR2 L;  1XNQ L;  1TXY A;  1HR0 W;  3DLL A;  4A93 G;  2JA8 H;  1G6P A;  1VQE A;  1D8L A;  3L2P A;  4DUZ L;  3HOU G;  5C0X G;  4IO9 A;  3T1H Q;  1QZG A;  4UY8 C;  4LF5 Q;  1FJG L;  3B6Y A;  1PV4 A;  4QGU A;  1A0I A;  1EYG A;  2Y0S E;  1YHA A;  1PH5 A;  2I5H A;  3BZK A;  4P75 A;  2PI2 E;  2YTV A;  1EQQ A;  5BR8 L;  1YJN A;  1HNZ Q;  1PH3 A;  4BXX G;  1K0R A;  1IBK Q;  3OTO L;  3I4M H;  1HR0 L;  1CSP A;  1VQ7 A;  3HOY G;  4A3C G;  1J6Q A;  3CPW A;  2AHO B;  2JA6 G;  1JT8 A;  2VQE Q;  4JC0 A;  2QGQ A;  3F1Z A;  1L1O C;  4A75 A;  4DR5 L;  1B70 B;  1VCI A;  4LF9 Q;  1YNX A;  1FVI A;  5IP9 G;  3K7U C;  5M3F H;  4KHP Q;  1N33 Q;  1VQ5 A;  3RLO A;  2N8N A;  5FLM H;  3K8A A;  1TWF H;  4YCV A;  4C3H H;  1S72 A;  1Y1W H;  1J5E L;  4YY3 L;  4L5R C;  1PH6 A;  2AMC B;  1RIP A;  2K5N A;  2DUD A;  3PF5 A;  4LF5 L;  3TS2 A;  2RCN A;  1TWC H;  4DKA C;  4A3G G;  4DV0 L;  2IY5 B;  4GN4 B;  3H15 A;  1N32 L;  3CCM A;  1HNZ L;  1L2F A;  1OXS C;  4HJA A;  4GOP B;  2R7D A;  1ASY A;  3NEN A;  3PO3 G;  2BH2 A;  2UXB L;  3HKZ E;  5ELN A;  1PH1 A;  3TEH B;  2CWP A;  1N8R C;  1UE1 A;  2I5M X;  4B3T Q;  5FLX c;  2AWO A;  1U0L A;  2B29 A;  2WAQ E;  1VQA A;  5GQO A;  3JAM c;  1MJE A;  1K8G A;  1JJ2 A;  1Q8K A;  3RZD H;  4LF6 L;  3M7N A;  4LFC Q;  3HOW G;  1HH2 P;  1VQI A;  4C2M H;  1Q81 C;  1VQK A;  2BA1 A;  3H3V H;  1X3E A;  2R7F A;  2CFM A;  2YU9 H;  1X55 A;  3BU2 A;  3F2C A;  4A3I G;  1PH9 A;  2VUM H;  5JEA J;  3S1N H;  3PO2 H;  1YHQ A;  2HIX A;  3S16 H;  4BBS G;  4A3L H;  5IE8 A;  1VQ4 A;  4X6A H;  1X9N A;  1BBW A;  1NE3 A;  1A62 A;  1GD7 A;  4HID A;  1IBL Q;  5LMN W;  2VS1 A;  1Q1E A;  4JBW A;  2UU9 Q;  1EFW A;  2C35 B;  4LW1 A;  2VQF Q;  3GTK H;  2PQA B;  5GAE C;  4A3D H;  2NVY H;  4GKJ Q;  1T9H A;  2RHQ B;  3U50 C;  4TVA B;  5M3M G;  1GM5 A;  1IYJ B;  1CKN A;  5IYD G;  1O7I A;  4UP9 A;  2BA0 A;  2OWO A;  5IP7 H;  1CKM A;  4DV7 L;  1KRT A;  4GNX A;  4A3F H;  2QEX A;  1I6H H;  2DGY A;  3PV0 A;  2A8V A;  5IYC H;  3CC2 A;  3PF4 A;  2E2I H;  3ERS X;  1WJJ A;  4YHH Q;  2K4K A;  1Z47 A;  1XPR A;  4DR7 L;  3G4S A;  2K50 A;  2WB1 G;  2QA4 A;  4BY7 G;  3A5Z B;  1VQD A;  3CCJ A;  1XPO A;  3I4N H;  3WWV A;  2MQH A;  1Z9F A;  4BBR H;  2GVA A;  4AYB G;  2K75 A;  1XJV A;  1IBL L;  2B63 H;  1MJC A;  1WCM G;  4DV3 L;  4L5S A;  3PSI A;  2UU9 L;  4ALP A;  3HKS A;  3AFP A;  3W5O A;  2VQF L;  3RN5 A;  2AKW B;  5EAY A;  1PFS A;  1IZ6 A;  1BBU A;  2PMZ E;  3KYH C;  4JCV E;  2JQO A;  3CXC A;  1YI2 A;  4A3B H;  1UE5 A;  5JEA G;  4DR2 Q;  1XNQ Q;  3E0E A;  4EQ5 A;  2RF4 A;  4LFB Q;  3STB C;  4DUZ Q;  5HY6 A;  1U5K A;  1SMX A;  3H3V I;  4PZ6 A;  1HNX L;  3CD6 A;  1FJG Q;  5JJL A;  4HJ5 A;  3S1Q H;  1B8A A;  3PUX A;  4KHZ A;  1KIX A;  4JBK A;  4YHH L;  4BY1 G;  4PMW A;  3ULJ A;  1X3F A;  1NBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...