2UUAL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uuaL00
4GNXB 4A4IA 1PV4A 3PUXA 1EWIA 3E0EA 1WCMG 1QVGA 5BR8L 2JA5G 5C0XJ 3S24A 1LTLA 2HIVA 1VQ5A 4IOAA 3L2PA 4DV5L 2E5LQ 3CXCA 4X66L 2KHJA 1MJEA 1VS0A 1N34Q 3K81C 4KHPL 1VQ8A 1CKNA 1YHAA 1G6PA 1LYLA 1X55A 3JAMi 1FJGQ 2AWNA 2RCNA 3JAMc 1SFOH 4OXPA 2BH2A 3KF6A 4GNXC 5AJ3L 3K7AH 1R9TH 5GQOA 2IY5B 3I4NH 1L1OB 3GO5A 4X66Q 1O7IA 2VL6A 4L5TA 3KOJA 1V43A 4GN3B 3RN5A 1XNRL 3HOYH 2UUAQ 3D0FA 1UE7A 3FHWA 2UUCL 2D62A 1N9WA 3BU2A 4TVAB 4R4QA 2VQFQ 5IWAQ 2QGQA 1JJ2A 4C3HH 1X3GA 5IP9G 4PZ8A 4GKJL 4LUVA 4UY8C 3RLNA 1TWFH 4PMWA 2PQAA 3RLOA 3I56A 1VQ7A 4LF4Q 2R7ZH 4HJAA 3CAMA 4IPDA 4LFCL 3CW2C 1K8GA 2UUCQ 1J6QA 3WWVA 5HGQA 1U0LA 4R4TA 4L5QA 4DKAC 3M3YH 1VQAA 1NMGA 1I94L 4GKJQ 4BY1G 4R4CA 1A0IA 3AYHB 3GTKH 3K0XA 3HKZG 1N32Q 3T1HL 2DUDA 5FLXc 1SR3A 4HIOA 2R92H 2VUMH 1YEZA 3GTPH 3TQYA 3S2DH 5FLMG 1BVSA 2E8GA 2UU9Q 4R4IA 1MIUA 1B70B 2Z0SA 1IL2A 2R6GA 1XTDA 3I55A 4AQYQ 2LSSA 4B3TQ 4DV1L 4RG1A 3T1HQ 4LF9L 1L2FA 3FKIH 5EAYA 4X62Q 2PMZE 2PI2E 2F3IA 4KHZA 4JI3L 4JI7L 4QJFA 3J81j 3L0OA 3CC7A 1TWCH 3L7ZC 3M4OH 4BY7H 1LM0A 2MQHA 4A93H 3K8AA 3PUYA 3HKSA 3T1YL 1XMQL 1KQSA 3HKZE 1EFWA 5IYCH 4DV1Q 4LF5L 4JI6L 2VQEL 2DGYA 5GADC 1NY4A 4LF6L 3ULJA 1Y14B 5JJLA 3MXNB 2RHSB 1MKHA 2A1AA 2K5HA 1HNWQ 2YTXA 4YY3L 4IOCA 2JQOA 1A62A 3RLFA 5C4XH 2KBNA 4GKKQ 2K75A 3KDFA 1YVCA 2ES2A 3I7FA 4JI8Q 1XMQQ 2YV5A 4LF7Q 3HOZH 4DV4L 5GAGC 1S72A 1JB7A 4X6AH 4BA1I 1HR0Q 1FL0A 4DR3L 4DUYL 4JV5Q 4A3EG 1YI2A 4DR7Q 2MO1A 1SE8A 5M5WH 2HHHQ 4DV6L 1RL2A 5ELOA 3HOXH 4JOIA 3CCRA 4B3RL 1W3SA 3UDXA 5IY0A 3M85A 4UP7A 4A3KH 4LNQA 3CCQA 4DV4Q 3S1QH 1GKHA 4JBKA 1PFSA 1VQEA 3K80C 4DR3Q 1VQ4A 1Q82C 3GTLH 2XTIA 1WJJA 1D7QA 3E9HA 4DV0Q 4YWMA 2ZTDA 1N8RC 4JYAQ 2I5HA 3RNUA 1KHIA 2JA6H 4JI1Q 1NBWA 1UEBA 3F2BA 1PH3A 4GOPB 1HZCA 4LUZA 3W1BA 3HOUH 4QY7A 3K7UC 4P71A 1HZ9A 4DR2L 1CUKA 1FVIA 3I4NG 2Y0SG 1NE3A 1SRUA 4A3IH 4LW1A 1OXUA 2KCMA 4FDBA 1YBYA 4HIMA 1A8VA 5JJIA 3GD7A 1WFQA 3I4MH 1A63A 3STBC 4IPGA 4PG3A 1HH2P 1S40A 3GTMH 3KFUA 1MJCA 1CKMA 2HIXA 5JEAJ 1I5FA 3TRZA 4A3BG 3U4ZA 1L0WA 3PGZA 2CWPA 4A3MH 1XPUA 3A74A 1T9HA 5C3EH 1IZ6A 4IJHA 4LUOA 1D8LA 4O0AA 1PH2A 4JI2L 4DR6Q 2QEXA 4GNXA 2B3GA 4EX5A 1Y1WH 1K0RA 3HOWH 4DR4Q 2R7ZG 4P75A 1CKOA 3BZCA 4POGA 2VZAA 2BA1A 1XMOL 2UXCL 1Q81C 2RHQB 1SN8A 3OTOQ 2AHOB 1N33L 2Y0SE 1S3OA 4LFAQ 1PH5A 3D31A 3G6EA 3UDGA 2VNUD 1Q12A 1K3RA 1BKBA 3M9BA 4X65L 4AYBG 2A8VA 2HT1A 5BR8Q 2JK8A 2K52A 2KHIA 1AH9A 3NENA 2ID0A 4UPAA 3TS0A 3F8TA 2K4KA 4XIGS 2BA0A 1VQLA 4LWCA 2FXQA 2K50A 2VUMG 4NXML 1E7ZA 4DV5Q 2Q2IA 1GD7A 1L1OA 1HJPA 3KYHC 1BBWA 2PNHA 3PSIA 2JA8H 4X65Q 4KHPQ 3S14H 1YNXA 1PHJA 1IYJB 4UP8A 4IO9A 1K73C 3FKIG 4DR5L 1KD1C 1PYSB 4DV2L 3CCVA 2MFIA 1EYGA 3S2HH 4DUZL 1G291 2ZTEA 5AJ3Q 2CWAA 2GN5A 1KIXA 5LMUL 4BY7G 1XNRQ 4GLVB 4A93G 4AYBE 4WJ3M 4OO1I 2WB1G 5IYCG 1I3QH 5ELNA 2MO0A 3IRBA 4HJ8A 3TS2A 1L1OC 2R7FA 5JEAG 3CCEA 3F1ZA 4P74A 1TWGH 3HFZB 2LXKA 5LMUQ 5C4XG 3S16H 4GN4B 4GS3A 3UE1A 5IYBG 2NN6I 4LFBL 3KLWA 4JBWA 3PF4A 4R4OA 4X64L 3HOZG 4LFCQ 5IE8A 2HQLA 1SROA 2EXDA 4B3ML 1VQ6A 3ULPA 5LMNL 5IT9c 5FJ8H 3G71A 4L5SA 4JG2A 1NMFA 1I94Q 5C44H 1IBML 3HOXG 2R93H 1HNZL 5M5YH 1X6OA 4Y52H 1XJVA 3PO3H 2WB1E 4A3KG 1YJWA 2L15A 2YU9H 4O2DA 2JJQA 2ZM6L 1B7YB 1K9MC 4A3CH 1VCIA 2ZJRA 1JT8A 2R7DA 3F2CA 4A3DH 3H3VH 4IFDI 4P72A 1K8AC 2N49A 1PH6A 3KF8B 1HZBA 4OWWB 4AH6A 2Q2TA 2IHEA 5IP7H 2UUBL 2JA6G 3S1NH 4OX9L 4BXXH 4HIKA 4HJ5A 1GM5A 3HOUG 4LF9Q 2ZM6Q 2F4VL 1VQKA 1TWAH 2JEAI 3S17H 3BJUA 1YHBA 1KC8C 3CCUA 4A3IG 4JI3Q 4JI7Q 2ZJQA 2ASBA 3HOVH 3M7NA 1EQQA 3I4MG 1Q86C 1SMXA 3PV0A 4WJ4A 1HR0W 3T1YQ 3ZJYC 3S1MH 4IPHA 1E24A 4JI5L 5C0XI 4LF5Q 3LGJA 2VQEQ 4JI6Q 2F4VQ 4YWLA 4LF6Q 3RZOH 3H0GH 3S1RH 4A3MG 4BBRH 4H02A 3W1GA 5C3EG 4K0KL 4JI4L 1BBUA 4YCUA 4YY3Q 1Y1WG 4GLAC 3UE0A 3HOWG 2N3SA 4B3SL 1X54A 3PUVA 3G4SA 3ERSX 2WFWA 4YCVA 5K36G 4DR1L 1OXXK 4OWXB 3KJOA 4HIDA 1EOVA 2WAQG 4MZ9A 4DUYQ 2K5NA 2NVQH 3GTOH 5HY6A 5M3FH 2D0OA 4MNOA 4TQUS 1W2BA 1QVCA 1Q46A 3F2DA 1EQRA 4DV6Q 1E1TA 3CD6A 1KL9A 3UDIA 3U50C 1EUJA 3J80i 2K5VA 4B3RQ 2OCEA 3J80c 4ME3A 5E7NA 2OQ0A 5J3BA 2WP8J 2OWOA 4A3LH 2RF4A 2IX0A 4GOPA 2OTLA 4NXNL 4YHHL 3CMAA 2UXBL 2BH8A 2YYZA 3TREA 3U58A 1UE6A 5M5XH 3HOYG 1YIJA 2JA8G 4YWKA 4BA2I 4DV7L 4A3GH 1PH8A 3AFPA 3PIOA 1YITA 4NPSA 2Z6KA 3PIPA 3FP9A 1NJIC 1K83H 1VQOA 3J81i 2XGTA 4DR2Q 4QQBX 4XTCS 3J81c 2UXDL 3M4PA 3GTQH 2E2HH 1Q1EA 2VS1A 4GOPC 3RR5A 2VW9A 3CMEA 1OTCA 4JI0L 1GVPA 2Q2HA 4OWTB 3A5UA 4DV3L 2CKZB 2IX1A 4QL5A 5GAHC 4A3FH 4RMFA 1NTGA 2OQKA 4YCWA 2JA7H 1IBKL 4JI2Q 2Z6KC 4OONA 2B63H 1XPRA 2KCTA 1QZHA 3CCMA 1X65A 2K14A 1JMCA 1G51A 3EBEA 4A3JH 1QUQB 4PZ7A 1E3PA 3OYYA 1HNXL 1XNQL 3CPFA 1XMOQ 1Z9FA 2E5LL 2R92G 5FJ8G 1B8AA 3CCLA 2UXCQ 1CSQA 1Y1VH 4PZ6A 1IXRA 4JBMA 1N33Q 1I50H 2AKWB 5C44G 1N34L 1IBKQ 4KI0A 2R93G 2ZTCA 4JCVE 5M3MH 4A75A 2NZHA 3NBHB 2ATWA 3PO2H 1N36L 3PO3G 4OO1G 1WOCA 3PF5A 1Q1BA 1HNXQ 1FJGL 1XNQQ 4A3CG 3STBD 1C9OA 2KENA 1KRSA 5GROA 4A3DG 3ULLA 3U4VA 3CCJA 3KJPA 4NXMQ 5IYDH 1P8LA 2EIFA 2NN6G 1VQMA 1UE5A 1VQPA 2UUAL 1CKNB 2AMCB 5IP7G 1N36Q 4BXXG 3GTGH 2E2JH 4BBSH 3EIVA 2MNAA 3KF6B 1V9PA 4DAMA 1AE2A 4DR5Q 3NELA 4DV2Q 2VQFL 5IWAL 4DUZQ 4HJ9A 3HOVG 4EQ5A 2H5XA 3PUZA 3H15A 1PH4A 3CC2A 1OXTA 3H3VI 1JE5A 3UDFA 1YJNA 1EIFA 2I5LX 2JE6I 3I2ZA 4LF4L 3AEVA 1PVOA 3CQZH 2F52A 3M4QA 4A3BH 2N8NA 4LF8L 3H0GG 4POFA 1PH9A 4IFDG 2V1CC 4BBRG 3Q8DA 5GAEC 3NEMA 2NVYH 3S15H 1KXLA 3RZDH 2PQAB 2CQOA 2YTYA 1WCMH 2I0QA 2JA5H 4LFBQ 1N32L 1E1OA 4X64Q 5LMNW 2VY3A 2CFMA 2N78A 4LF8Q 4B3MQ 3G48A 1VQJA 2GVBA 2JEBI 2UU9L 2Q2UA 1M1KC 5LMNQ 3J7A5 3RN2A 5M3FG 2ALYB 1IBLL 3CCSA 1IBMQ 4DNIA 4AQYL 4A76A 3DM3A 2NZOA 1HNZQ 1OXSC 4B3TL 5C0XG 1PA6A 1ASYA 3W5OA 4MTNA 4A3LG 3ICEA 3PCOB 2C35B 1C0AA 4X62L 1JJCB 1Z47A 2GVAA 1VQBA 3AQQA 1VQ9A 1YZ6A 1UE1A 1VQNA 1PYBA 1IBLQ 2JA9A 4QGUA 3A5ZB 2ZJPA 4C3IH 2A19A 3CP0A 1YJ9A 3J7ZC 2CCZA 4A3GG 1H95A 2UUBQ 2D0PA 1WYDA 4P73A 4Y7NH 3CPWA 1EIYB 4OX9Q 1QZGA 3EN2A 2OTJA 1HNWL 3GTJH 1E22A 1AE3A 5C4JH 1LUZA 1VQIA 5IP9H 4J15A 2E2IH 4DAYB 4GKKL 5JJKA 2PI2A 4JI8L 5DLQE 4LF7L 1TXYA 4R1JA 1V1QA 4AIMA 1HR0L 4JI5Q 1VQFA 4ALPA 4A3FG 4JV5L 1VQDA 2EQSA 1X3FA 3GDEA 4IPCA 5H1SE 1YHQA 1J5EL 1C7YA 2B29A 1KRTA 1ASZA 2JA7G 2HHHL 4DR7L 2B63G 3KDFB 4K0KQ 4BY1H 5IYBH 4JI4Q 4HJ7A 4C3JH 4A3JG 4DPGA 4B3SQ 1FGUA 1QVFA 3A0JA 4DR1Q 1VQGA 1X56A 4UP9A 4L5RC 1DGSA 1Y1VG 5FLMH 1J5EQ 1PH7A 4DV0L 4GLXA 3SGIA 1UWVA 1WI5A 2YTVA 2NVTH 5M3MG 4APVA 3PO2G 4JYAL 3CC4A 3ER0A 4JBJA 4JI1L 3OW2A 1GO3E 2LXJA 1JJGA 2I5MX 3JC66 1KAWA 4QIWE 2UXDQ 3BZKA 1XPOA 1X3EA 2QA4A 4NXNQ 2WAQE 4YHHQ 1I6HH 5IYDG 2UXBQ 1Q7YC 3B6YA 4DK3C 3PUWA 1TWHH 1OXVA 4JC0A 4DV7Q 3TEHB 3DLLA 4BBSG 3MEFA 4DK6C 1HZAA 1Q8KA 1VQCA 2NVXH 1P16A 3CF5A 1M90C 4JOIC 4IFDJ 4KLKA 2AWOA 2IHFA 4NB3A 4DR6L 1PH1A 1U5KA 4DR4L 4IJLA 4JI0Q 4GN5A 1SLJA 3VDYA 1RIPA 1QUQA 1VQHA 4DV3Q 3I4OA 1CSPA 3E9IA 3OTOL 1X9NA 4LFAL 4A3EH 2IT1A 4C2MH 3AFQA
chains in the Genus database with same CATH superfamily
4GNXB 1TS3A 3E0EA 1YNNC 3NBHA 3S24A 2HIVA 4CJ1B 1VQ5A 3LX0A 3BG3A 1TS2A 4XXEA 1K0SA 3L2PA 1EIGA 4X66L 1VS0A 3K7AB 1R9TB 2K01A 5C4HA 3H6MA 4RFBA 1EYAA 1AW7A 1B53A 2A5HA 2RCNA 3KK7A 3JAMc 3KF6A 1JE4A 3KOJA 1A2TA 4GN3B 1XNRL 3HOYH 2R61A 2UUCL 2K04A 3BU2A 4TVAB 2L4NA 4M8AA 2PZTA 1TWGB 3RLNA 1BCPB 4RH6A 4LF4Q 4WFN3 2R7ZH 3CAMA 1K8GA 1J6QA 3WWVA 3M3YH 1SYBA 1VQAA 4GKJQ 1A0IA 4WJWA 3GTKH 3HKZG 1N32Q 3SK8A 2X6LA 2KCNA 2VUMH 1O7ZA 1H9JA 2UU9Q 4R4IA 2PW7A 4IUQA 2Z0SA 1Q8IA 4LF9L 2IW3A 2PMZE 4QJFA 1JWSD 5IGBA 3J81j 2B2WA 4CKCA 3BDLA 3ERQA 4DAYA 3K8AA 3HKSA 1KQSA 2M2LA 4OHJA 5EKKA 5IYCH 4DV1Q 1AFPA 1QJOA 2YTXA 5BN4A 2JQOA 1A62A 1EY9A 5IODA 1KNAA 3OWEB 2ES2A 1TU2B 4H44C 3I7FA 4LF7Q 3HS0C 1A15A 4OEMB 4A3KB 2KUMA 1HR0Q 4X6AH 4DR3L 2XWJB 2K5QA 2OT2A 1D1IA 4XYOA 4JOIA 3UDXA 1QCBD 4QMGA 1B4OA 3E9HA 4JYAQ 3RNUA 3I4MB 3DUZA 5CV5A 1AN8A 1HZCA 3HOUH 1CUKA 3I4NG 4NW2A 4A3IH 4HIMA 3TP6A 1WFQA 2E2HB 4KKUA 4IPGA 3GTMH 3KFUA 5JEAJ 4Z9CB 3TRZA 4A3BG 5EPLA 1XPUA 3PGZA 2CWPA 2FINB 4K2KA 1IYUA 1IZ6A 1X3PA 4O0AA 1STEA 4GNXA 3MEHA 1GOZA 3BZCA 4POGA 1CT1D 1Q81C 4CJ0B 2Y0SE 3H94A 1Q12A 1EU4A 1K3RA 4X65L 4RCNA 5BR8Q 1O80A 1SNDA 2EY2A 3MHBA 4ZLTF 1VQLA 4NXML 4DV5Q 3NQIA 4ZQ3A 1HJPA 5G3LF 2F0LA 1BBWA 3PSIA 2JA8H 1RHPA 1YNXA 1PRTC 1NSNS 2B2UA 3KBXA 4IO9A 4HTHA 4DR5L 1BBXC 3S2HH 3K6OA 2CWAA 4ZRZA 4BY7G 4GLVB 3UI2A 2Z4HA 4OO1I 2WB1G 1I3QH 2NWGA 3CCEA 2DNCA 1TR5A 2PW5A 1CK1A 4P74A 3HFZB 4LJZC 1HRJA 5C4XG 4HEDA 5C44B 2IL8A 3HOZG 1WCMB 5D65A 1BCPF 5JPNC 3ULPA 5IT9c 5FJ8H 3NK9A 4JG2A 1WVLA 1IBML 1DZ1A 2R93H 5M5YH 4Y52H 2F0MA 2JN4A 1XJVA 2JJQA 2ZM6L 1B7YB 3GQBA 4A3CH 1K28A 4KMUC 4A3DH 3S17B 1K8AC 1PTOH 5JPMC 4AH6A 2Q2TA 3S1NH 4HJ5A 1EY5A 2F4VL 1TWAH 2JEAI 1CA5A 3HGBA 3N6RA 3CCUA 3GTJB 2ZJQA 4JI3Q 2RA4A 1EQQA 1PTOC 5IGDA 2RDHA 1D5ZC 3T1YQ 2PYKA 1E24A 3A54A 2WIIB 1FGBD 4JI5L 2JYOA 4DFAA 4LF5Q 3RZOH 1B2TA 4YWLA 1TY2A 4A3MG 4BBRH 3W1GA 1WTPA 1D6EC 1BBUA 4YCUA 2L5TA 4YY3Q 1Y1WG 3HOWG 5E4WC 3PUVA 3G4SA 3BZDB 4F88A 5EGTA 2RSOA 3R93A 4HIDA 2F0SA 1EOVA 4MZ9A 2LY7A 2K5NA 5HY6A 1AZPA 3T13A 4MNOA 3NBIA 1QVCA 4DV6Q 1EUJA 3J80i 2K5VA 5C0XH 2OCEA 2OWOA 3Q6SA 1CQFA 4K2LA 5I9OA 3U58A 1UE6A 4BA2I 2WINB 3GTQB 3QOLA 3SR1A 3FRPB 3FP9A 4XQQA 5F2DA 2NVXB 4CJ2C 3K5MA 2BE5D 2F3WA 4XTCS 3J81c 3VR6A 3M4PA 4ULLA 2JA7B 3M7GA 2VW9A 1EOTA 1D1KA 2CW0C 1U9RA 1S5BD 2RCFA 5DEHA 4DV3L 2VB3X 2CKZB 1IBKL 4JI2Q 3QWNA 1HQMC 1QZHA 3CCMA 5M3MB 3EBEA 3ZYYX 1QUQB 1E3PA 5ELDA 1B8AA 2KVMA 1CQVA 2A6ED 4JBMA 2XRQD 4KY6A 1SYEA 4OO1G 3IFTA 1NNXA 3I4LA 3PO3G 4ID6A 1ZYRC 1WOCA 1HNXQ 3STBD 1UNSA 3GTGB 1QWYA 5FO8B 2E2JB 2O2LD 4JVZA 1SFOB 1G6ZA 3U4VA 2EIFA 1UE5A 3DWAA 5EJWA 1HCZA 5IP7G 1V9PA 5C6AA 4DV2Q 3VYRA 3HOVG 4LF4L 5ELBA 1MBYA 4UHVA 2ENBA 2F0GA 3CQZH 1Q90A 2F52A 3M4QA 4A3BH 3H0GG 4POFA 1PH9A 1Y8OB 2V1CC 2MHVA 1STGA 3S15H 3RZDH 3A55A 1EY7A 1LT6D 2EXZA 2E2DC 1EIHA 2I0QA 2JA5H 3C1FA 4LFBQ 1N32L 2VY3A 4LF8Q 2UU9L 5LMNQ 1QNKA 2F0UA 1HNZQ 3DM1A 1PA6A 1ASYA 3W5OA 4A3LG 3H09A 1EY4A 4YIJA 1LV9A 1HA5A 2KCCA 4Y7NB 1VQBA 1UE1A 2K5DA 2L1BA 3VA5A 4EQOA 2CCZA 1H95A 1UAPA 1KABA 3TZUA 2F0KA 4UAIA 4OX9Q 4A93B 4MTKA 1ESFA 1E22A 1AE3A 5IP9H 4GZYC 2E2IH 4ZKCB 2B2YA 4LF7L 4CDDC 1PFMA 1HR0L 3HKZB 5LL6X 1VQDA 4RKBA 2QILA 1S5CD 5H1SE 4ZAIA 1ASZA 4ZUIA 2B63G 2F4IA 1JOQA 5D3IB 1QVFA 4DPGA 1FGUA 3FPUB 4DR1Q 4L5RC 1J5EQ 1Y1VG 2OXPA 5FLMH 1NCVA 1KAAA 4GLXA 1I6HB 4JYAL 1JWMD 3PO2G 3DWQA 2MJ8A 3OW2A 2LXJA 2QW7A 5C5MA 3LWEA 2L55A 3R2IA 4YHHQ 2UXBQ 1BUVT 1TWHH 1CFMA 1FNWA 4DV7Q 1ZXTA 5KIXA 4OIKA 4DK6C 1HZAA 1Q8KA 4JOIC 4KLKA 2JSOA 4NB3A 1VF7A 4C2MB 4RGOS 4E6IA 4NMZA 1NR2A 3VDYA 1SLJA 5CV9A 2OEOA 1QUQA 1R4PB 1LTAD 2ZXOA 4A3EH 3BVGA 4A4IA 2ZXPA 1WCMG 3V2TA 5BR8L 3TN2A 5C0XJ 3J7AF 2EY1A 5C5LA 4DV5L 1MJEA 3KBGA 1VMPA 1T5EA 3SEBA 1N34Q 2RSNA 4RA8A 4IQZA 2F1MA 1X55A 5EKLA 4IZ8A 1FJGQ 5J1ZA 1S4ZA 4GNXC 3K7AH 1R9TH 5GQOA 2X6GA 1L1OB 2RQXA 1Y69U 2VL6A 1IYVA 1V43A 3D0FA 3J7YW 1DXMA 5IT9L 2D62A 1AZQA 5T1GA 1H9MA 1RF2D 4R4QA 5DM73 2Q8IB 2KEDA 3X3NA 4LUVA 4UY8C 2XNAC 4PMWA 1VQ7A 4O1NA 2B39A 2J0TD 1MSHA 2EOTA 1Y8PB 4R4TA 2K32A 1NMGA 3NE5B 1G91A 4KD3A 3S2DB 1SE4A 3NQTA 4BY1G 3JAME 4R8IA 3T1HL 1LACA 2F0VA 4HIOA 1F9RA 3A8JE 1BCPC 1U4MA 3MWYW 5CR3A 1BVSA 3WOFA 1XTCD 1JR0D 3D4DA 5FOBB 3VA7A 3FVQA 1XTDA 3M4OB 4BY7B 1WTHA 4B3TQ 2HDMA 3E6ZX 5IGEA 4FF4A 2NYZD 1L2FA 3FKIH 2F0HA 2TMPA 5ELFA 2PI2E 3T53B 4JI3L 3KLSX 2PO4A 3L0OA 1TWCH 3CC7A 2MQHA 2XSCA 1O78A 3T1YL 5C4XB 3N52A 1I4PA 4LF5L 2DGYA 5GADC 1NY4A 3ULJA 2RHSB 3TZDA 1HNWQ 2K5HA 2RDGA 5JOBA 2MUYA 3MVVA 5I6WA 4YY3L 4IOCA 4LK1C 2KBNA 4GKKQ 1XMQQ 2YV5A 1WTVA 1GUSA 1SE8A 2HHHQ 1EZ8A 5ELOA 4DV6L 3GTLB 1I4HA 5A35A 4PQXA 5IY0A 4A3KH 3CCQA 4DV4Q 3J81L 1VQEA 3K80C 4IN3A 4B9XA 1WJJA 1D7QA 4DV0Q 1ICWA 1DONA 1F9QA 2JA6H 1IKMA 1WTQA 2HCIA 3W1BA 4P71A 1HZ9A 1FVIA 3TSSA 2CH4A 1NE3A 2KCMA 4A3MB 1SYGA 4FDBA 5JJIA 3GD7A 3I4MH 2XIWA 1ENCA 3EFXD 2LS01 4PG3A 1Y1WB 1HH2P 3HOWB 3ND8A 1I5FA 4RWSC 1WD1A 1HTPA 1L0WA 2A6HC 1A6XA 1AEXA 4IALA 4C3HG 4JI2L 4LUOA 1HA6A 4DR4Q 4P75A 5K36H 4A3JB 2RHQB 1SN8A 3FEWX 1IW7C 4G4KA 5CV8A 1PH5A 3G6EA 4FF2A 4QUCA 5CV4A 1GJXA 3PQIA 4AYBG 2C9OA 1SE3A 2JK8A 1AH9A 1JQYD 3F8TA 4XIGS 5FK9C 3DEOA 2XRSD 1L1OA 5EBDA 5CC4A 2PNHA 3OOCA 3MC0B 4KHPQ 4FXKC 1PXUA 1IYJB 4DV2L 3CCVA 2ZTEA 5AJ3Q 1SMYD 2GN5A 1KIXA 4CDEC 1PDQA 1E2ZA 4DGZA 4NDXA 4A93G 1W6JA 4WJ3M 3S16B 1DM0B 1YNND 3IRBA 3TS2A 1B9MA 1SYDA 3DXJC 5LMUQ 1VF5C 5FLXL 2KEEA 4LFBL 5A2QE 3KLWA 3PF4A 5IE8A 1EEFD 2HQLA 3PO3B 2EY6A 2YU9B 1STAA 1UUPA 2PZWA 4KN7C 5LMNL 3OIQA 4L5SA 2XWBB 1NMFA 1I94Q 5C44H 2G9HD 3HOXG 1KTKA 1HNZL 1X6OA 1B1ZA 1K3BC 2L15A 2QDBA 3K5OA 5KEEA 2IPKD 1VCIA 4IFDI 4P72A 3SK4A 2NN6H 2N49A 1PH6A 3KLRA 3I90A 1HZBA 3HOVB 1QOHA 2IHEA 3I8ZA 5I2XA 4BXXH 4FYDA 2SEBD 4OX9L 2CQAA 3S17H 1SDFA 3CRKC 1KC8C 1MHWC 3H0GB 4JI7Q 2ASBA 2V4DA 5C4JB 3M7NA 3S1MH 2VQEQ 1S5FD 3HZXA 2WKDA 3VYUA 1IHZA 4X3SA 1T5XD 5C3EG 1J8IA 2PMZB 2NVQB 3BS1A 4PMBA 1X54A 2WFWA 3SE0A 4YCVA 4DR1L 1OXXK 2J4XA 2WACA 4KY5A 4K5VA 1UEAB 1O7YA 3CD6A 2E74C 3UDIA 4B3RQ 3U50C 4ME3A 2OQ0A 2WP8J 3C46A 2IX0A 1ICFB 2OTLA 4YHHL 2UXBL 2YYZA 5CGKA 3MXUA 1DJRD 3Q23A 1TIID 4DV7L 2QCPX 3BDOA 4NPSA 2Z6KA 4HCSA 3S9WA 1DOMA 4TKOB 2RDFA 2L9HA 4IUVA 5E3FA 1G2SA 3NTKA 3GTQH 2I46A 4X3UA 4GOPC 1OTCA 2B63B 5D3DA 5JVG3 3HRZC 2Q2HA 1WTXA 3A5UA 1GUWA 1BO0A 5GAHC 4A3FH 3MFGA 2JA7H 3QG1A 1Y1VB 1XPRA 1ESRA 3BYYB 1M4VA 1G51A 3PO2B 1LTID 3NUCA 3QB3A 3C1EA 3CPFA 3TBIB 1QILA 1HXYD 5DAUA 3C2PA 2KECA 1CSQA 4PZ6A 3OSOA 1N34L 4B08A 2ZTCA 5M3MH 2NZHA 1N36L 1FJGL 1XNQQ 2K33A 5AFWA 1EY8A 3J81E 2O5JC 5GROA 3CCJA 3KJPA 1JICA 5IYDH 2EJMA 2K1BA 2Y0SB 1CKNB 4DA2A 3PIO3 4HSVA 2E2JH 3GTGH 3PIP3 4BBSH 2MNAA 3NELA 1SE2A 4LAAA 4HJ9A 3CHBD 3PUZA 1PH4A 3CC2A 3H3VI 1JE5A 3UDFA 3I2ZA 2N88A 2B8GA 3BVMA 4Q0FA 5KGUA 2R7ZB 5J39A 1A3UA 4IFDG 3MXGA 5GAEC 1ONLA 3NEMA 5FKAC 2PQAB 3NP8A 1LTRD 2CQOA 1W6KA 1QE6A 2K28A 2B2VA 4TRDA 1E1OA 1F9PA 4X64Q 5LMNW 3GTKB 1PRTD 1CZGA 2CFMA 4B3MQ 1VQJA 2JEBI 1WD0A 2Q2UA 3RN2A 5M3FG 1IBLL 3DM3A 1SYCA 2NZOA 4B3TL 3DHQA 2IX3A 1Y8NB 3ICEA 4PMCA 1Q3LA 3OIPA 3VYSA 4Q5VA 1JJCB 1Z47A 2GVAA 3J7AV 3AQQA 1D2BA 1YJ9A 3CP0A 5KRUA 4A3GG 1CHQD 1ZKOA 4ODGA 5KYIA 2PPBC 3CPWA 5JVH3 4Y7NH 1QZGA 1PZJD 1EEID 1K8OA 1HNWL 4GKKL 5JJKA 3E0JA 1DOLA 4BY1B 5C3XA 1HFGA 4WORA 2EQSA 4J6HA 1KRTA 3J80L 2HHHL 3KDFB 3I73A 5CYUA 4A3JG 4B3SQ 1TVXA 2DNEA 2MPMA 1VQGA 2NBFA 3P7JA 4KY7A 3K5LA 4DV0L 1A3TA 1OO9B 2NVTH 5IOCA 3DMUA 1PTOD 4QIWE 2RBMA 3T4AC 5IIFA 2UXDQ 3BZKA 2QA4A 4L8JA 4NXNQ 2WAQE 1I6HH 3O13A 4LMQD 2Q8TA 5IGFA 3B6YA 3PUWA 1OXVA 4A3IB 3MEFA 1VQCA 3GTMB 1D5XC 3NWSA 4ABNA 2Z4IA 2H4OA 1GHJA 5BN5A 4R9WA 2IHFA 1PH1A 3CKIB 4DR4L 3OMCA 1KDCA 4JI0Q 4GN5A 2JP1A 1WTOA 1S5ED 4U673 1CZWA 3A7AB 4C2MH 3JC66 3AFQA 1EY6A 1PV4A 1PZID 1JOKA 3D6WA 1RKNA 1QVGA 4KHVA 2EVBA 2L0CA 2F0OA 1LTLA 1B3QA 1QB5D 1PRTB 2PZUA 4IOAA 2EJGC 3CXCA 2E5LQ 2AUJD 4HSPA 5T1IA 3C3LA 3K81C 4KHPL 1VQ8A 1CKNA 4I7AA 2JA8B 1LYLA 1G6PA 3RMHA 3JAMi 2CW0D 4DXFA 5AJ3L 1B3AA 3VYTA 3I4NH 5FO9B 4X66Q 3GO5A 4L5TA 2K5WA 3IL8A 4C3IG 4C3HB 1UE7A 2HUGA 1TWFB 1LABA 4DNRB 5NUCA 1I3QB 2LFNA 2DJGC 2TSSA 2VQFQ 5IWAQ 2QGQA 1JJ2A 1F2ZA 1NUCA 1X3GA 4PZ8A 4GKJL 1I4GA 4IURA 1B50A 2PQAA 3I56A 4WRDA 4CBVA 4MN3A 4HJAA 4IPDA 3CW2C 2UUCQ 1SEBD 1ZYRD 4AYBB 5HGQA 5BN3A 1U0LA 4DKAC 4RAUC 2VB2X 1I94L 2R92B 3GTPB 2E75C 2R93B 4C3JG 3R2TA 3AYHB 3K0XA 1TT2A 2DUDA 5FLXc 4RGMA 1SR3A 4FO2A 4BS9A 3S2DH 2E8GA 4H13C 4QF4A 3TP8A 1ENAA 3VR4A 3A56A 5ELEA 1KLUD 1XWEA 2Z9HA 4KTAA 2CH4W 4I65A 1PTOB 3D4WA 4DV1L 4RG1A 2PCFB 4G7ZC 4K8IA 5EAYA 4X62Q 4DK0A 4KHZA 4JI7L 1G2TA 3M4OH 4BY7H 4DXGA 1EFWA 3HKZE 5KNBA 2VQEL 1HUNA 5E1FA 4QUFA 5JJLA 1Y14B 3MXNB 2A1AA 4IUUA 5EPKA 5C4XH 3M4YA 3QO2A 2K75A 3KDFA 4OL7A 4IUPA 5HURA 4X3TA 3HOXB 5JJZA 1E2VA 3HOZH 3Q24A 2EYFA 1S72A 2B2WC 1YNJC 3S1QB 1B9NA 4JV5Q 3L3OC 1YI2A 5M5WH 3R3OA 1RL2A 3QIAA 3CCRA 4B3RL 2LMCB 4KJNA 1W3SA 3M85A 4UP7A 1ENFA 3QJYA 1GKHA 1PZKD 1VDZA 4JBKA 4DR3Q 4HR7B 3GTLH 2XTIA 3GV6A 3RD4A 1N8RC 1EWCA 2I5HA 4JI1Q 1UEBA 5JAVA 2Z6BA 4R8NA 4LUZA 4QY7A 2Q8RE 2Y0SG 1SRUA 4LW1A 1OXUA 2N55A 1A8VA 1A63A 2KOLA 5C3EB 5CBAE 4ZCKA 1U4PA 2G5DA 1S40A 3IAYA 1JCKB 3P20A 3SDZA 4A3MH 4EVOA 3A74A 1T9HA 4IJHA 1D8LA 4DR6Q 2QEXA 2B3GA 2F0EA 1Y1WH 1K0RA 1V1OA 3HOWH 2R7ZG 4K8JA 1CKOA 1TQOA 2VZAA 2BA1A 2Z8LA 3OTOQ 2AHOB 4LFAQ 3ND9A 3UDGA 3R8BA 1BKBA 3FPPA 3M9BA 2HT1A 2EY5A 1EZ6A 1Z6HA 2K52A 1B44D 3NENA 2EYLA 3S14B 2ID0A 2K4KA 2VUMG 3MXPA 2K50A 2ZT9C 2SNMA 1HHVA 3BVZA 3KYHC 2IWHA 2F0DA 4X65Q 1CI3M 3OW7A 1EYCA 2MFIA 3I70A 4RGTA 3PMFA 2F0PA 1TY0A 5IYCG 4XT3B 2MO0A 2F0FA 2R7FA 3CQZB 2EYJA 3F1ZA 1TWGH 2LXKA 4KD4A 1DD2A 3S16H 2D5DA 2B2UC 4GN4B 3G7LA 1MGSA 4GS3A 3V05A 3S15B 4X64L 2F3VA 4LFCQ 1RDPD 2BCOA 1QNUA 4B3ML 5EBCA 3HP3A 1JB3A 3G71A 1X32A 3OWFA 4K5XA 4DF7A 4OO1H 3PO3H 3BDCA 2WB1E 5G3LD 1YJWA 2YU9H 4RGNA 3Q0AA 2HD3A 1JC7A 5FO7B 1K9MC 1JT8A 3H3VH 4F87A 3H91A 2ZXRA 3KF8B 5IP7H 5CV6A 4HIKA 1GM5A 3HOUG 2ZM6Q 2AUKA 3MXNA 4A3IG 3S1RB 3HOVH 3LWUA 1C4QA 4FNFA 1HR0W 3D4RA 2H1EA 5C0XI 1HTLD 3LGJA 3DWPA 4JI6Q 2F4VQ 4LF6Q 3H0GH 1SNCA 1FD7D 4H02A 4KKSA 1BCPD 3GTOB 4OELB 1II3A 5M3FB 3UE0A 4B3SL 3ERSX 2K6AA 4KK7A 1H9SB 1FR3A 2SOBA 2WAQG 4DUYQ 2NVQH 1CM9A 2XVSA 3AB9A 2D0OA 4K5WA 1W2BA 3F2DA 1EQRA 1E1TA 3SK6A 4DAPA 1KL9A 5M5XB 1EYDA 3J80c 5E7NA 4A3GB 4A3LH 2UXDL 1RCVD 2RF4A 4NXNL 3CMAA 1K83B 1MI2A 4H7BA 5COYA 1YIJA 1XYIA 4YWKA 2JA8G 2B2TA 1ET6A 3A8IE 2OF1A 2F0NA 1VQOA 3J81i 2XGTA 4DR2Q 4QQBX 4XQJA 4KJOA 4DN4M 2E2HH 1Q1EA 2IJ0A 2VS1A 3RR5A 1LTBD 4JI0L 1EU3A 1SNMA 3I3CA 3NWTA 4RMFA 4YCWA 5J22A 3HEJA 2B63H 1BNZA 1I50B 5C4ZA 1D5MC 2KCTA 1JMCA 1X65A 2K14A 2DY7A 1JOOA 4HAEA 4PZ7A 1HNXL 1EY0A 1XMOQ 1Z9FA 2E5LL 2R92G 5FJ8G 2UXCQ 1Y1VH 1N33Q 2AKWB 1IBKQ 1C8CA 4KI0A 2R93G 4JCVE 4A75A 3PO2H 2B8FA 2M9VA 3KUPA 1Q1BA 4A3CG 1C9OA 1JWUD 2JXMB 1KRSA 2D9UA 4A3DG 3K0YA 1LTGD 2A6HD 1P8LA 1VQMA 1I6VC 5HGTA 4DAMA 1AE2A 4IUTA 2VQFL 5IWAL 4DUZQ 3MZ5A 4EQ5A 1IW7D 1OXTA 2NVYB 1EIFA 2I5LX 5I4DA 2CVRA 2D2CC 1HFNA 2EYPA 3QOJA 2N8NA 4EGVA 5IGGA 4LF8L 3AMUA 3NTIA 4BBRG 1TS5A 1DCZA 4N9PA 1KXLA 2YTYA 1SYFA 1WCMH 4HCEA 1SJHD 4OIJA 2XN9C 4B9WA 4FF1A 4FP5D 3G48A 1F2LA 1LT3D 2A68C 3J7A5 5EPJA 2ALYB 3CCSA 4G7OC 1U4LA 1OXSC 3KF8A 4C3IB 3VR5A 5C0XG 4MTNA 2P5ZX 2C35B 3LNNA 1C0AA 3K5NA 1HQRD 4X62L 3FKIB 2NUCA 4HN7A 1PYBA 4MIUA 4KKTA 3A5ZB 2ZJPA 4FVMA 3J7ZC 1WTWA 1TWCB 5EKIA 1RTNA 3SVMA 1H9KA 5IT9E 2UUBQ 2D0PA 1WYDA 5CMDA 1EIYB 1S5DD 1H9RA 3GTJH 4OGQC 1VQIA 4MHEA 4DAVA 2PI2A 4ZKBB 1WTRA 5DLQE 4R1JA 1KDAA 4C3JB 4ALPA 2F03A 4JV5L 4IPCA 1YHQA 1H9SA 1X3FA 3GDEA 1J5EL 1C7YA 2B29A 2A68D 4K0KQ 4BY1H 4JI4Q 2FFKB 4XDXA 1I4RA 2F0JA 1STBA 5LHY1 2B2YC 1C48A 2EE1A 3SGIA 1WI5A 4JI1L 2ICIA 1JJGA 5I6YA 2I5MX 2JA6B 1G8ZD 1X3EA 4XYQA 2K03A 4DK3C 4DU9A 4JC0A 3TEHB 2FMMA 5M9OA 3DLLA 4C56C 3NXWA 1L0YB 2NVXH 3CF5A 1BR9A 1M90C 1STHA 1STYA 4I7ZC 4DR6L 1U5KA 3AU7A 1A3VA 4U68A 1RIPA 2NB0A 3V96A 1PYWD 4F8MA 4UDUC 3OTOL 1X9NA 4LFAL 3CRLC 5CORA 1JORA 2SNSA 2SDFA 2QKIC 3PUXA 1EWIA 2JA5G 3A8KE 1DOKA 2CHBD 1V8QA 2PNRC 5TSSA 2KHJA 3WDNA 1K8MA 4HMIA 4BWGB 2G9DA 3HOYB 1YHAA 2KQ3A 5KNCA 3GP7A 1O7LA 3QR8A 2AWNA 1V1PB 1SFOH 4OXPA 2BH2A 2FJ2A 1KDBA 2IY5B 2F0QA 1O7IA 3EJIA 3RN5A 5I9PA 2UUAQ 3FHWA 2KHSA 3D8GA 5L37A 3NTHA 1N9WA 1PMRA 2AQ1B 3T51B 4C3HH 5IP9G 3M3YB 1TWFH 1EL0A 3RLOA 1BDOA 4K14A 4LFCL 4NKLA 1L0XB 2ICEC 1R4QB 2EYMA 5CV7A 4L5QA 4DNTB 2VUMB 1MSGA 4V190 4R4CA 1IKLA 1TS4A 1Z7TA 5ISRA 3NHHA 1CTMA 2RKSA 2HCCA 2R92H 3GTPH 1YEZA 2HQEA 3TQYA 5FLMG 4H0LC 1MIUA 1B70B 1IL2A 2R6GA 3G6JB 3I55A 4AQYQ 2LSSA 4ZUJA 3OHXC 4K6LA 3T1HQ 4QCLA 2F3IA 3NSWA 3L7ZC 4ZK9B 1LM0A 3NPPA 1SNOA 1F2YA 3PUYA 4A93H 1XMQL 1LTSD 4JI6L 3S1MB 4LF6L 1BQQT 2AQ2B 1SSOA 1MKHA 3FDTA 4RCOA 3I91A 3EROA 1MD2D 3RLFA 5FLXE 1YVCA 1DYQA 4N8X1 4JI8Q 1ET9A 4DV4L 5GAGC 1JB7A 4BA1I 1FL0A 2BE5C 4DUYL 4A3EG 4S3SA 2RVLA 4M1UB 4DR7Q 1ML0D 2MO1A 3HOXH 3IFDA 4LNQA 2GA4B 3S1QH 1PFSA 2A69C 2AQ3B 1VQ4A 1Q82C 3HOUB 1ZEQX 1SXTA 1LT4D 4YWMA 3HG9A 1ILQA 4J1MA 2ZTDA 3ONAB 2EZVA 1KLGD 1KHIA 3A7LA 1NBWA 3F2BA 1PH3A 4GOPB 5KYLA 2A6EC 3K7UC 4KV6A 4DR2L 5KNDA 3VR2A 1YBYA 3P75A 2DY8A 3STBC 2MGSA 1RTOA 4CGYB 2EYHA 5D14A 1MJCA 1CKMA 2HIXA 4C1NK 4QIWB 3TMEA 3U4ZA 4A3FB 3CU7A 5C3EH 2WAQB 1PH2A 2LKVA 4CHTB 4EX5A 2HDLA 2E76C 3W2DA 4P2CB 2FMCA 1XMOL 2UXCL 5C3WA 2B2TC 2A69D 1N33L 1S3OA 1SBBB 3D31A 2VNUD 3JAML 1XXGA 3MA2B 2A8VA 2NTSA 3K57A 2KHIA 4UPAA 3TS0A 2EDGA 2BA0A 1V1PA 4LWCA 2FXQA 4X3KA 3S2HB 1E7ZA 2Q2IA 1GD7A 1LTTD 4C1NI 1PLFA 4ZYSA 4K6DA 3S14H 1PFBA 1PHJA 4UP8A 1EQTA 5K5PA 3FKIG 1K73C 1KD1C 1PYSB 4BBSB 1EYGA 1PFNA 4DUZL 1G291 2DN8A 1LT5D 2EPBA 5LMUL 1GXDC 1XNRQ 1TKWB 4AYBE 2WV6D 1RJTA 1SJED 5ELNA 4HJ8A 1L1OC 5JEAG 1BXTA 1GUTA 2K7VA 3UE1A 5IYBG 2NN6I 3BYTB 5CBEE 4JBWA 4R4OA 5M5YB 2KJXA 1SROA 2EXDA 4RHSA 3TP7A 1VQ6A 2M00A 1SNPA 3DEPA 4A3DB 1F2MA 5DM63 1XX8A 4A3KG 3S1NB 4O2DA 2ZJRA 2A73B 2R7DA 3F2CA 1IL8A 2Z1CA 1TWAB 4CKBA 1KNEA 1ILPA 4OWWB 3SHLA 3SXHA 2UUBL 2JA6G 4L63B 4LF9Q 1VQKA 2VXWA 3BJUA 3RZOB 1YHBA 4BBRB 2BDOA 3I4MG 3F2UA 1Q86C 1SMXA 3PV0A 4WJ4A 3EQLC 3ZJYC 4IPHA 1E2WA 1VMCA 3S1RH 4IFDH 2WKCA 4K0KL 2QDLA 4JI4L 4GLAC 4XT1B 3TDQA 2N3SA 3OPOA 1M8AA 4DK1A 2NTTA 1FNVA 2EJFC 3FMCA 5K36G 4TSSA 4OWXB 3KJOA 2KA7A 3GTOH 5EQ0A 5M3FH 1J9OA 4HMJA 4TQUS 4JPBW 1Q46A 2J7ZA 2NVTB 4RHRA 4V0BA 1BF4A 5J3BA 4GOPA 2NZ1D 3D6CA 2BH8A 3P1HA 3TREA 5M5XH 3HOYG 4FF3A 4A3GH 1PH8A 3AFPA 3PIOA 1YITA 3PIPA 3ITPA 5E4XA 1NJIC 1K83H 3OMGA 1YNJD 1BOSA 2EYOA 4EQNA 4QB4A 1AP0A 3CMEA 1GVPA 4OWTB 1SAPA 1STNA 2IX1A 4QL5A 2O5IC 1NTGA 2OQKA 3MTSA 3J80E 2Z6KC 2BOSA 4OONA 3U9OA 2F0TA 5A2QL 2F0WA 4A3JH 1XNQL 3OYYA 1I4XA 3CCLA 1X3QA 1IXRA 1I50H 5C44G 3IKJA 1RD9D 2ATWA 2MP1A 3NBHB 1PRTF 4IUNA 2QF7A 2QEJC 3PF5A 2KENA 4CDFC 3MFYA 3ULLA 4NXMQ 4O42A 2UUAL 3I4NB 2NN6G 3E5SA 1VQPA 4KN4C 2AMCB 1N36Q 4BXXG 2A74C 3K59A 3T16A 3EIVA 3KF6B 4DR5Q 2FHTA 4A3BB 2I07B 2H5XA 3H15A 1YJNA 3RZDB 2JE6I 3AEVA 2R3ZA 5LL6S 1PVOA 4CDCC 4J8QA 2JA5B 3I72A 3TP5A 2PQEA 3Q8DA 2BDNA 2NVYH 4EQPA 3K58A 2L11A 3MAQA 4PNYA 1GUOA 1NAPA 1GUNA 2N78A 4G57A 2GVBA 1M1KC 3VR3A 1CHPD 1IBMQ 3WOEA 4DNIA 4A76A 4AQYL 3PCOB 4XQNA 1VQ9A 1YZ6A 1VQNA 3H3VC 1IBLQ 2B2VC 1F77A 1PTOF 2JA9A 4QGUA 4C3IH 2A19A 3GV3A 2E2IB 3L9AX 4P73A 4JW0A 2L12A 4RKLA 2WB1B 3EN2A 2OTJA 3U9SA 1FNUA 1LLRD 1LUZA 3URYA 5C4JH 4J15A 4DAYB 1EWHA 4JI8L 1TXYA 1V1QA 3D3RA 2K05A 5IGCA 4AIMA 4JI5Q 1F9SA 1VQFA 5JEAH 4ME5A 4A3FG 3HOZB 3T56B 2JA7G 4DR7L 5DNFA 1GUGA 5IYBH 5M5WB 1NR4A 5I2YA 4HJ7A 4C3JH 4FXGC 3EA6A 3A0JA 4NP5A 1X56A 4UP9A 1DGSA 3E3XA 2DJFC 1A2UA 1FYCA 1PH7A 4N9TA 1UWVA 2YTVA 4F7XA 5M3MG 4APVA 1E0BA 1HPCA 5ELCA 3CC4A 3ER0A 4JBJA 1EQVA 3Q22A 1TWHB 3KLSA 1GO3E 3SK5A 1KAWA 3W3AA 1CA6A 4G7HC 1XPOA 1LO5D 1QG7A 1SNQA 5IYDG 1Q7YC 1U4RA 2C5CA 4JK1C 1GHKA 2X69A 1EFID 4ILWA 4PV1C 2F0IA 4BBSG 4FXDA 4N8FA 4CKEA 3EVQA 1P16A 4IFDJ 2AWOA 1HUMA 4A3EB 1I4QA 2O4XA 4IJLA 3X3MA 3RUZA 1VQHA 4DV3Q 4L6TB 3I4OA 1SMYC 1CSPA 3E9IA 1RODA 2IT1A
chains in the Genus database with same CATH topology
4GNXB 4A4IA 1PV4A 3PUXA 1EWIA 3E0EA 1WCMG 1QVGA 5BR8L 2JA5G 5C0XJ 3S24A 1LTLA 2HIVA 1VQ5A 4IOAA 3L2PA 4DV5L 2E5LQ 3CXCA 4X66L 2KHJA 1MJEA 1VS0A 1N34Q 3K81C 4KHPL 1VQ8A 1CKNA 1YHAA 1G6PA 1LYLA 1X55A 3JAMi 1FJGQ 2AWNA 2RCNA 3JAMc 1SFOH 4OXPA 2BH2A 3KF6A 4GNXC 5AJ3L 3K7AH 1R9TH 5GQOA 2IY5B 3I4NH 1L1OB 3GO5A 4X66Q 1O7IA 2VL6A 4L5TA 3KOJA 1V43A 4GN3B 3RN5A 1XNRL 3HOYH 2UUAQ 3D0FA 1UE7A 3FHWA 2UUCL 2D62A 1N9WA 3BU2A 4TVAB 4R4QA 2VQFQ 5IWAQ 2QGQA 1JJ2A 4C3HH 1X3GA 5IP9G 4PZ8A 4GKJL 4LUVA 4UY8C 3RLNA 1TWFH 4PMWA 2PQAA 3RLOA 3I56A 1VQ7A 4LF4Q 2R7ZH 4HJAA 3CAMA 4IPDA 4LFCL 3CW2C 1K8GA 2UUCQ 1J6QA 3WWVA 5HGQA 1U0LA 4R4TA 4L5QA 4DKAC 3M3YH 1VQAA 1NMGA 1I94L 4GKJQ 4BY1G 4R4CA 1A0IA 3AYHB 3GTKH 3K0XA 3HKZG 1N32Q 3T1HL 2DUDA 5FLXc 1SR3A 4HIOA 2R92H 2VUMH 1YEZA 3GTPH 3TQYA 3S2DH 5FLMG 1BVSA 2E8GA 2UU9Q 4R4IA 1MIUA 1B70B 2Z0SA 1IL2A 2R6GA 1XTDA 3I55A 4AQYQ 2LSSA 4B3TQ 4DV1L 4RG1A 3T1HQ 4LF9L 1L2FA 3FKIH 5EAYA 4X62Q 2PMZE 2PI2E 2F3IA 4KHZA 4JI3L 4JI7L 4QJFA 3J81j 3L0OA 3CC7A 1TWCH 3L7ZC 3M4OH 4BY7H 1LM0A 2MQHA 4A93H 3K8AA 3PUYA 3HKSA 3T1YL 1XMQL 1KQSA 3HKZE 1EFWA 5IYCH 4DV1Q 4LF5L 4JI6L 2VQEL 2DGYA 5GADC 1NY4A 4LF6L 3ULJA 1Y14B 5JJLA 3MXNB 2RHSB 1MKHA 2A1AA 2K5HA 1HNWQ 2YTXA 4YY3L 4IOCA 2JQOA 1A62A 3RLFA 5C4XH 2KBNA 4GKKQ 2K75A 3KDFA 1YVCA 2ES2A 3I7FA 4JI8Q 1XMQQ 2YV5A 4LF7Q 3HOZH 4DV4L 5GAGC 1S72A 1JB7A 4X6AH 4BA1I 1HR0Q 1FL0A 4DR3L 4DUYL 4JV5Q 4A3EG 1YI2A 4DR7Q 2MO1A 1SE8A 5M5WH 2HHHQ 4DV6L 1RL2A 5ELOA 3HOXH 4JOIA 3CCRA 4B3RL 1W3SA 3UDXA 5IY0A 3M85A 4UP7A 4A3KH 4LNQA 3CCQA 4DV4Q 3S1QH 1GKHA 4JBKA 1PFSA 1VQEA 3K80C 4DR3Q 1VQ4A 1Q82C 3GTLH 2XTIA 1WJJA 1D7QA 3E9HA 4DV0Q 4YWMA 2ZTDA 1N8RC 4JYAQ 2I5HA 3RNUA 1KHIA 2JA6H 4JI1Q 1NBWA 1UEBA 3F2BA 1PH3A 4GOPB 1HZCA 4LUZA 3W1BA 3HOUH 4QY7A 3K7UC 4P71A 1HZ9A 4DR2L 1CUKA 1FVIA 3I4NG 2Y0SG 1NE3A 1SRUA 4A3IH 4LW1A 1OXUA 2KCMA 4FDBA 1YBYA 4HIMA 1A8VA 5JJIA 3GD7A 1WFQA 3I4MH 1A63A 3STBC 4IPGA 4PG3A 1HH2P 1S40A 3GTMH 3KFUA 1MJCA 1CKMA 2HIXA 5JEAJ 1I5FA 3TRZA 4A3BG 3U4ZA 1L0WA 3PGZA 2CWPA 4A3MH 1XPUA 3A74A 1T9HA 5C3EH 1IZ6A 4IJHA 4LUOA 1D8LA 4O0AA 1PH2A 4JI2L 4DR6Q 2QEXA 4GNXA 2B3GA 4EX5A 1Y1WH 1K0RA 3HOWH 4DR4Q 2R7ZG 4P75A 1CKOA 3BZCA 4POGA 2VZAA 2BA1A 1XMOL 2UXCL 1Q81C 2RHQB 1SN8A 3OTOQ 2AHOB 1N33L 2Y0SE 1S3OA 4LFAQ 1PH5A 3D31A 3G6EA 3UDGA 2VNUD 1Q12A 1K3RA 1BKBA 3M9BA 4X65L 4AYBG 2A8VA 2HT1A 5BR8Q 2JK8A 2K52A 2KHIA 1AH9A 3NENA 2ID0A 4UPAA 3TS0A 3F8TA 2K4KA 4XIGS 2BA0A 1VQLA 4LWCA 2FXQA 2K50A 2VUMG 4NXML 1E7ZA 4DV5Q 2Q2IA 1GD7A 1L1OA 1HJPA 3KYHC 1BBWA 2PNHA 3PSIA 2JA8H 4X65Q 4KHPQ 3S14H 1YNXA 1PHJA 1IYJB 4UP8A 4IO9A 1K73C 3FKIG 4DR5L 1KD1C 1PYSB 4DV2L 3CCVA 2MFIA 1EYGA 3S2HH 4DUZL 1G291 2ZTEA 5AJ3Q 2CWAA 2GN5A 1KIXA 5LMUL 4BY7G 1XNRQ 4GLVB 4A93G 4AYBE 4WJ3M 4OO1I 2WB1G 5IYCG 1I3QH 5ELNA 2MO0A 3IRBA 4HJ8A 3TS2A 1L1OC 2R7FA 5JEAG 3CCEA 3F1ZA 4P74A 1TWGH 3HFZB 2LXKA 5LMUQ 5C4XG 3S16H 4GN4B 4GS3A 3UE1A 5IYBG 2NN6I 4LFBL 3KLWA 4JBWA 3PF4A 4R4OA 4X64L 3HOZG 4LFCQ 5IE8A 2HQLA 1SROA 2EXDA 4B3ML 1VQ6A 3ULPA 5LMNL 5IT9c 5FJ8H 3G71A 4L5SA 4JG2A 1NMFA 1I94Q 5C44H 1IBML 3HOXG 2R93H 1HNZL 5M5YH 1X6OA 4Y52H 1XJVA 3PO3H 2WB1E 4A3KG 1YJWA 2L15A 2YU9H 4O2DA 2JJQA 2ZM6L 1B7YB 1K9MC 4A3CH 1VCIA 2ZJRA 1JT8A 2R7DA 3F2CA 4A3DH 3H3VH 4IFDI 4P72A 1K8AC 2N49A 1PH6A 3KF8B 1HZBA 4OWWB 4AH6A 2Q2TA 2IHEA 5IP7H 2UUBL 2JA6G 3S1NH 4OX9L 4BXXH 4HIKA 4HJ5A 1GM5A 3HOUG 4LF9Q 2ZM6Q 2F4VL 1VQKA 1TWAH 2JEAI 3S17H 3BJUA 1YHBA 1KC8C 3CCUA 4A3IG 4JI3Q 4JI7Q 2ZJQA 2ASBA 3HOVH 3M7NA 1EQQA 3I4MG 1Q86C 1SMXA 3PV0A 4WJ4A 1HR0W 3T1YQ 3ZJYC 3S1MH 4IPHA 1E24A 4JI5L 5C0XI 4LF5Q 3LGJA 2VQEQ 4JI6Q 2F4VQ 4YWLA 4LF6Q 3RZOH 3H0GH 3S1RH 4A3MG 4BBRH 4H02A 3W1GA 5C3EG 4K0KL 4JI4L 1BBUA 4YCUA 4YY3Q 1Y1WG 4GLAC 3UE0A 3HOWG 2N3SA 4B3SL 1X54A 3PUVA 3G4SA 3ERSX 2WFWA 4YCVA 5K36G 4DR1L 1OXXK 4OWXB 3KJOA 4HIDA 1EOVA 2WAQG 4MZ9A 4DUYQ 2K5NA 2NVQH 3GTOH 5HY6A 5M3FH 2D0OA 4MNOA 4TQUS 1W2BA 1QVCA 1Q46A 3F2DA 1EQRA 4DV6Q 1E1TA 3CD6A 1KL9A 3UDIA 3U50C 1EUJA 3J80i 2K5VA 4B3RQ 2OCEA 3J80c 4ME3A 5E7NA 2OQ0A 5J3BA 2WP8J 2OWOA 4A3LH 2RF4A 2IX0A 4GOPA 2OTLA 4NXNL 4YHHL 3CMAA 2UXBL 2BH8A 2YYZA 3TREA 3U58A 1UE6A 5M5XH 3HOYG 1YIJA 2JA8G 4YWKA 4BA2I 4DV7L 4A3GH 1PH8A 3AFPA 3PIOA 1YITA 4NPSA 2Z6KA 3PIPA 3FP9A 1NJIC 1K83H 1VQOA 3J81i 2XGTA 4DR2Q 4QQBX 4XTCS 3J81c 2UXDL 3M4PA 3GTQH 2E2HH 1Q1EA 2VS1A 4GOPC 3RR5A 2VW9A 3CMEA 1OTCA 4JI0L 1GVPA 2Q2HA 4OWTB 3A5UA 4DV3L 2CKZB 2IX1A 4QL5A 5GAHC 4A3FH 4RMFA 1NTGA 2OQKA 4YCWA 2JA7H 1IBKL 4JI2Q 2Z6KC 4OONA 2B63H 1XPRA 2KCTA 1QZHA 3CCMA 1X65A 2K14A 1JMCA 1G51A 3EBEA 4A3JH 1QUQB 4PZ7A 1E3PA 3OYYA 1HNXL 1XNQL 3CPFA 1XMOQ 1Z9FA 2E5LL 2R92G 5FJ8G 1B8AA 3CCLA 2UXCQ 1CSQA 1Y1VH 4PZ6A 1IXRA 4JBMA 1N33Q 1I50H 2AKWB 5C44G 1N34L 1IBKQ 4KI0A 2R93G 2ZTCA 4JCVE 5M3MH 4A75A 2NZHA 3NBHB 2ATWA 3PO2H 1N36L 3PO3G 4OO1G 1WOCA 3PF5A 1Q1BA 1HNXQ 1FJGL 1XNQQ 4A3CG 3STBD 1C9OA 2KENA 1KRSA 5GROA 4A3DG 3ULLA 3U4VA 3CCJA 3KJPA 4NXMQ 5IYDH 1P8LA 2EIFA 2NN6G 1VQMA 1UE5A 1VQPA 2UUAL 1CKNB 2AMCB 5IP7G 1N36Q 4BXXG 3GTGH 2E2JH 4BBSH 3EIVA 2MNAA 3KF6B 1V9PA 4DAMA 1AE2A 4DR5Q 3NELA 4DV2Q 2VQFL 5IWAL 4DUZQ 4HJ9A 3HOVG 4EQ5A 2H5XA 3PUZA 3H15A 1PH4A 3CC2A 1OXTA 3H3VI 1JE5A 3UDFA 1YJNA 1EIFA 2I5LX 2JE6I 3I2ZA 4LF4L 3AEVA 1PVOA 3CQZH 2F52A 3M4QA 4A3BH 2N8NA 4LF8L 3H0GG 4POFA 1PH9A 4IFDG 2V1CC 4BBRG 3Q8DA 5GAEC 3NEMA 2NVYH 3S15H 1KXLA 3RZDH 2PQAB 2CQOA 2YTYA 1WCMH 2I0QA 2JA5H 4LFBQ 1N32L 1E1OA 4X64Q 5LMNW 2VY3A 2CFMA 2N78A 4LF8Q 4B3MQ 3G48A 1VQJA 2GVBA 2JEBI 2UU9L 2Q2UA 1M1KC 5LMNQ 3J7A5 3RN2A 5M3FG 2ALYB 1IBLL 3CCSA 1IBMQ 4DNIA 4AQYL 4A76A 3DM3A 2NZOA 1HNZQ 1OXSC 4B3TL 5C0XG 1PA6A 1ASYA 3W5OA 4MTNA 4A3LG 3ICEA 3PCOB 2C35B 1C0AA 4X62L 1JJCB 1Z47A 2GVAA 1VQBA 3AQQA 1VQ9A 1YZ6A 1UE1A 1VQNA 1PYBA 1IBLQ 2JA9A 4QGUA 3A5ZB 2ZJPA 4C3IH 2A19A 3CP0A 1YJ9A 3J7ZC 2CCZA 4A3GG 1H95A 2UUBQ 2D0PA 1WYDA 4P73A 4Y7NH 3CPWA 1EIYB 4OX9Q 1QZGA 3EN2A 2OTJA 1HNWL 3GTJH 1E22A 1AE3A 5C4JH 1LUZA 1VQIA 5IP9H 4J15A 2E2IH 4DAYB 4GKKL 5JJKA 2PI2A 4JI8L 5DLQE 4LF7L 1TXYA 4R1JA 1V1QA 4AIMA 1HR0L 4JI5Q 1VQFA 4ALPA 4A3FG 4JV5L 1VQDA 2EQSA 1X3FA 3GDEA 4IPCA 5H1SE 1YHQA 1J5EL 1C7YA 2B29A 1KRTA 1ASZA 2JA7G 2HHHL 4DR7L 2B63G 3KDFB 4K0KQ 4BY1H 5IYBH 4JI4Q 4HJ7A 4C3JH 4A3JG 4DPGA 4B3SQ 1FGUA 1QVFA 3A0JA 4DR1Q 1VQGA 1X56A 4UP9A 4L5RC 1DGSA 1Y1VG 5FLMH 1J5EQ 1PH7A 4DV0L 4GLXA 3SGIA 1UWVA 1WI5A 2YTVA 2NVTH 5M3MG 4APVA 3PO2G 4JYAL 3CC4A 3ER0A 4JBJA 4JI1L 3OW2A 1GO3E 2LXJA 1JJGA 2I5MX 3JC66 1KAWA 4QIWE 2UXDQ 3BZKA 1XPOA 1X3EA 2QA4A 4NXNQ 2WAQE 4YHHQ 1I6HH 5IYDG 2UXBQ 1Q7YC 3B6YA 4DK3C 3PUWA 1TWHH 1OXVA 4JC0A 4DV7Q 3TEHB 3DLLA 4BBSG 3MEFA 4DK6C 1HZAA 1Q8KA 1VQCA 2NVXH 1P16A 3CF5A 1M90C 4JOIC 4IFDJ 4KLKA 2AWOA 2IHFA 4NB3A 4DR6L 1PH1A 1U5KA 4DR4L 4IJLA 4JI0Q 4GN5A 1SLJA 3VDYA 1RIPA 1QUQA 1VQHA 4DV3Q 3I4OA 1CSPA 3E9IA 3OTOL 1X9NA 4LFAL 4A3EH 2IT1A 4C2MH 3AFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNX B;  4A4I A;  1PV4 A;  3PUX A;  1EWI A;  3E0E A;  1WCM G;  1QVG A;  5BR8 L;  2JA5 G;  5C0X J;  3S24 A;  1LTL A;  2HIV A;  1VQ5 A;  4IOA A;  3L2P A;  4DV5 L;  2E5L Q;  3CXC A;  4X66 L;  2KHJ A;  1MJE A;  1VS0 A;  1N34 Q;  3K81 C;  4KHP L;  1VQ8 A;  1CKN A;  1YHA A;  1G6P A;  1LYL A;  1X55 A;  3JAM i;  1FJG Q;  2AWN A;  2RCN A;  3JAM c;  1SFO H;  4OXP A;  2BH2 A;  3KF6 A;  4GNX C;  5AJ3 L;  3K7A H;  1R9T H;  5GQO A;  2IY5 B;  3I4N H;  1L1O B;  3GO5 A;  4X66 Q;  1O7I A;  2VL6 A;  4L5T A;  3KOJ A;  1V43 A;  4GN3 B;  3RN5 A;  1XNR L;  3HOY H;  2UUA Q;  3D0F A;  1UE7 A;  3FHW A;  2UUC L;  2D62 A;  1N9W A;  3BU2 A;  4TVA B;  4R4Q A;  2VQF Q;  5IWA Q;  2QGQ A;  1JJ2 A;  4C3H H;  1X3G A;  5IP9 G;  4PZ8 A;  4GKJ L;  4LUV A;  4UY8 C;  3RLN A;  1TWF H;  4PMW A;  2PQA A;  3RLO A;  3I56 A;  1VQ7 A;  4LF4 Q;  2R7Z H;  4HJA A;  3CAM A;  4IPD A;  4LFC L;  3CW2 C;  1K8G A;  2UUC Q;  1J6Q A;  3WWV A;  5HGQ A;  1U0L A;  4R4T A;  4L5Q A;  4DKA C;  3M3Y H;  1VQA A;  1NMG A;  1I94 L;  4GKJ Q;  4BY1 G;  4R4C A;  1A0I A;  3AYH B;  3GTK H;  3K0X A;  3HKZ G;  1N32 Q;  3T1H L;  2DUD A;  5FLX c;  1SR3 A;  4HIO A;  2R92 H;  2VUM H;  1YEZ A;  3GTP H;  3TQY A;  3S2D H;  5FLM G;  1BVS A;  2E8G A;  2UU9 Q;  4R4I A;  1MIU A;  1B70 B;  2Z0S A;  1IL2 A;  2R6G A;  1XTD A;  3I55 A;  4AQY Q;  2LSS A;  4B3T Q;  4DV1 L;  4RG1 A;  3T1H Q;  4LF9 L;  1L2F A;  3FKI H;  5EAY A;  4X62 Q;  2PMZ E;  2PI2 E;  2F3I A;  4KHZ A;  4JI3 L;  4JI7 L;  4QJF A;  3J81 j;  3L0O A;  3CC7 A;  1TWC H;  3L7Z C;  3M4O H;  4BY7 H;  1LM0 A;  2MQH A;  4A93 H;  3K8A A;  3PUY A;  3HKS A;  3T1Y L;  1XMQ L;  1KQS A;  3HKZ E;  1EFW A;  5IYC H;  4DV1 Q;  4LF5 L;  4JI6 L;  2VQE L;  2DGY A;  5GAD C;  1NY4 A;  4LF6 L;  3ULJ A;  1Y14 B;  5JJL A;  3MXN B;  2RHS B;  1MKH A;  2A1A A;  2K5H A;  1HNW Q;  2YTX A;  4YY3 L;  4IOC A;  2JQO A;  1A62 A;  3RLF A;  5C4X H;  2KBN A;  4GKK Q;  2K75 A;  3KDF A;  1YVC A;  2ES2 A;  3I7F A;  4JI8 Q;  1XMQ Q;  2YV5 A;  4LF7 Q;  3HOZ H;  4DV4 L;  5GAG C;  1S72 A;  1JB7 A;  4X6A H;  4BA1 I;  1HR0 Q;  1FL0 A;  4DR3 L;  4DUY L;  4JV5 Q;  4A3E G;  1YI2 A;  4DR7 Q;  2MO1 A;  1SE8 A;  5M5W H;  2HHH Q;  4DV6 L;  1RL2 A;  5ELO A;  3HOX H;  4JOI A;  3CCR A;  4B3R L;  1W3S A;  3UDX A;  5IY0 A;  3M85 A;  4UP7 A;  4A3K H;  4LNQ A;  3CCQ A;  4DV4 Q;  3S1Q H;  1GKH A;  4JBK A;  1PFS A;  1VQE A;  3K80 C;  4DR3 Q;  1VQ4 A;  1Q82 C;  3GTL H;  2XTI A;  1WJJ A;  1D7Q A;  3E9H A;  4DV0 Q;  4YWM A;  2ZTD A;  1N8R C;  4JYA Q;  2I5H A;  3RNU A;  1KHI A;  2JA6 H;  4JI1 Q;  1NBW A;  1UEB A;  3F2B A;  1PH3 A;  4GOP B;  1HZC A;  4LUZ A;  3W1B A;  3HOU H;  4QY7 A;  3K7U C;  4P71 A;  1HZ9 A;  4DR2 L;  1CUK A;  1FVI A;  3I4N G;  2Y0S G;  1NE3 A;  1SRU A;  4A3I H;  4LW1 A;  1OXU A;  2KCM A;  4FDB A;  1YBY A;  4HIM A;  1A8V A;  5JJI A;  3GD7 A;  1WFQ A;  3I4M H;  1A63 A;  3STB C;  4IPG A;  4PG3 A;  1HH2 P;  1S40 A;  3GTM H;  3KFU A;  1MJC A;  1CKM A;  2HIX A;  5JEA J;  1I5F A;  3TRZ A;  4A3B G;  3U4Z A;  1L0W A;  3PGZ A;  2CWP A;  4A3M H;  1XPU A;  3A74 A;  1T9H A;  5C3E H;  1IZ6 A;  4IJH A;  4LUO A;  1D8L A;  4O0A A;  1PH2 A;  4JI2 L;  4DR6 Q;  2QEX A;  4GNX A;  2B3G A;  4EX5 A;  1Y1W H;  1K0R A;  3HOW H;  4DR4 Q;  2R7Z G;  4P75 A;  1CKO A;  3BZC A;  4POG A;  2VZA A;  2BA1 A;  1XMO L;  2UXC L;  1Q81 C;  2RHQ B;  1SN8 A;  3OTO Q;  2AHO B;  1N33 L;  2Y0S E;  1S3O A;  4LFA Q;  1PH5 A;  3D31 A;  3G6E A;  3UDG A;  2VNU D;  1Q12 A;  1K3R A;  1BKB A;  3M9B A;  4X65 L;  4AYB G;  2A8V A;  2HT1 A;  5BR8 Q;  2JK8 A;  2K52 A;  2KHI A;  1AH9 A;  3NEN A;  2ID0 A;  4UPA A;  3TS0 A;  3F8T A;  2K4K A;  4XIG S;  2BA0 A;  1VQL A;  4LWC A;  2FXQ A;  2K50 A;  2VUM G;  4NXM L;  1E7Z A;  4DV5 Q;  2Q2I A;  1GD7 A;  1L1O A;  1HJP A;  3KYH C;  1BBW A;  2PNH A;  3PSI A;  2JA8 H;  4X65 Q;  4KHP Q;  3S14 H;  1YNX A;  1PHJ A;  1IYJ B;  4UP8 A;  4IO9 A;  1K73 C;  3FKI G;  4DR5 L;  1KD1 C;  1PYS B;  4DV2 L;  3CCV A;  2MFI A;  1EYG A;  3S2H H;  4DUZ L;  1G29 1;  2ZTE A;  5AJ3 Q;  2CWA A;  2GN5 A;  1KIX A;  5LMU L;  4BY7 G;  1XNR Q;  4GLV B;  4A93 G;  4AYB E;  4WJ3 M;  4OO1 I;  2WB1 G;  5IYC G;  1I3Q H;  5ELN A;  2MO0 A;  3IRB A;  4HJ8 A;  3TS2 A;  1L1O C;  2R7F A;  5JEA G;  3CCE A;  3F1Z A;  4P74 A;  1TWG H;  3HFZ B;  2LXK A;  5LMU Q;  5C4X G;  3S16 H;  4GN4 B;  4GS3 A;  3UE1 A;  5IYB G;  2NN6 I;  4LFB L;  3KLW A;  4JBW A;  3PF4 A;  4R4O A;  4X64 L;  3HOZ G;  4LFC Q;  5IE8 A;  2HQL A;  1SRO A;  2EXD A;  4B3M L;  1VQ6 A;  3ULP A;  5LMN L;  5IT9 c;  5FJ8 H;  3G71 A;  4L5S A;  4JG2 A;  1NMF A;  1I94 Q;  5C44 H;  1IBM L;  3HOX G;  2R93 H;  1HNZ L;  5M5Y H;  1X6O A;  4Y52 H;  1XJV A;  3PO3 H;  2WB1 E;  4A3K G;  1YJW A;  2L15 A;  2YU9 H;  4O2D A;  2JJQ A;  2ZM6 L;  1B7Y B;  1K9M C;  4A3C H;  1VCI A;  2ZJR A;  1JT8 A;  2R7D A;  3F2C A;  4A3D H;  3H3V H;  4IFD I;  4P72 A;  1K8A C;  2N49 A;  1PH6 A;  3KF8 B;  1HZB A;  4OWW B;  4AH6 A;  2Q2T A;  2IHE A;  5IP7 H;  2UUB L;  2JA6 G;  3S1N H;  4OX9 L;  4BXX H;  4HIK A;  4HJ5 A;  1GM5 A;  3HOU G;  4LF9 Q;  2ZM6 Q;  2F4V L;  1VQK A;  1TWA H;  2JEA I;  3S17 H;  3BJU A;  1YHB A;  1KC8 C;  3CCU A;  4A3I G;  4JI3 Q;  4JI7 Q;  2ZJQ A;  2ASB A;  3HOV H;  3M7N A;  1EQQ A;  3I4M G;  1Q86 C;  1SMX A;  3PV0 A;  4WJ4 A;  1HR0 W;  3T1Y Q;  3ZJY C;  3S1M H;  4IPH A;  1E24 A;  4JI5 L;  5C0X I;  4LF5 Q;  3LGJ A;  2VQE Q;  4JI6 Q;  2F4V Q;  4YWL A;  4LF6 Q;  3RZO H;  3H0G H;  3S1R H;  4A3M G;  4BBR H;  4H02 A;  3W1G A;  5C3E G;  4K0K L;  4JI4 L;  1BBU A;  4YCU A;  4YY3 Q;  1Y1W G;  4GLA C;  3UE0 A;  3HOW G;  2N3S A;  4B3S L;  1X54 A;  3PUV A;  3G4S A;  3ERS X;  2WFW A;  4YCV A;  5K36 G;  4DR1 L;  1OXX K;  4OWX B;  3KJO A;  4HID A;  1EOV A;  2WAQ G;  4MZ9 A;  4DUY Q;  2K5N A;  2NVQ H;  3GTO H;  5HY6 A;  5M3F H;  2D0O A;  4MNO A;  4TQU S;  1W2B A;  1QVC A;  1Q46 A;  3F2D A;  1EQR A;  4DV6 Q;  1E1T A;  3CD6 A;  1KL9 A;  3UDI A;  3U50 C;  1EUJ A;  3J80 i;  2K5V A;  4B3R Q;  2OCE A;  3J80 c;  4ME3 A;  5E7N A;  2OQ0 A;  5J3B A;  2WP8 J;  2OWO A;  4A3L H;  2RF4 A;  2IX0 A;  4GOP A;  2OTL A;  4NXN L;  4YHH L;  3CMA A;  2UXB L;  2BH8 A;  2YYZ A;  3TRE A;  3U58 A;  1UE6 A;  5M5X H;  3HOY G;  1YIJ A;  2JA8 G;  4YWK A;  4BA2 I;  4DV7 L;  4A3G H;  1PH8 A;  3AFP A;  3PIO A;  1YIT A;  4NPS A;  2Z6K A;  3PIP A;  3FP9 A;  1NJI C;  1K83 H;  1VQO A;  3J81 i;  2XGT A;  4DR2 Q;  4QQB X;  4XTC S;  3J81 c;  2UXD L;  3M4P A;  3GTQ H;  2E2H H;  1Q1E A;  2VS1 A;  4GOP C;  3RR5 A;  2VW9 A;  3CME A;  1OTC A;  4JI0 L;  1GVP A;  2Q2H A;  4OWT B;  3A5U A;  4DV3 L;  2CKZ B;  2IX1 A;  4QL5 A;  5GAH C;  4A3F H;  4RMF A;  1NTG A;  2OQK A;  4YCW A;  2JA7 H;  1IBK L;  4JI2 Q;  2Z6K C;  4OON A;  2B63 H;  1XPR A;  2KCT A;  1QZH A;  3CCM A;  1X65 A;  2K14 A;  1JMC A;  1G51 A;  3EBE A;  4A3J H;  1QUQ B;  4PZ7 A;  1E3P A;  3OYY A;  1HNX L;  1XNQ L;  3CPF A;  1XMO Q;  1Z9F A;  2E5L L;  2R92 G;  5FJ8 G;  1B8A A;  3CCL A;  2UXC Q;  1CSQ A;  1Y1V H;  4PZ6 A;  1IXR A;  4JBM A;  1N33 Q;  1I50 H;  2AKW B;  5C44 G;  1N34 L;  1IBK Q;  4KI0 A;  2R93 G;  2ZTC A;  4JCV E;  5M3M H;  4A75 A;  2NZH A;  3NBH B;  2ATW A;  3PO2 H;  1N36 L;  3PO3 G;  4OO1 G;  1WOC A;  3PF5 A;  1Q1B A;  1HNX Q;  1FJG L;  1XNQ Q;  4A3C G;  3STB D;  1C9O A;  2KEN A;  1KRS A;  5GRO A;  4A3D G;  3ULL A;  3U4V A;  3CCJ A;  3KJP A;  4NXM Q;  5IYD H;  1P8L A;  2EIF A;  2NN6 G;  1VQM A;  1UE5 A;  1VQP A;  2UUA L;  1CKN B;  2AMC B;  5IP7 G;  1N36 Q;  4BXX G;  3GTG H;  2E2J H;  4BBS H;  3EIV A;  2MNA A;  3KF6 B;  1V9P A;  4DAM A;  1AE2 A;  4DR5 Q;  3NEL A;  4DV2 Q;  2VQF L;  5IWA L;  4DUZ Q;  4HJ9 A;  3HOV G;  4EQ5 A;  2H5X A;  3PUZ A;  3H15 A;  1PH4 A;  3CC2 A;  1OXT A;  3H3V I;  1JE5 A;  3UDF A;  1YJN A;  1EIF A;  2I5L X;  2JE6 I;  3I2Z A;  4LF4 L;  3AEV A;  1PVO A;  3CQZ H;  2F52 A;  3M4Q A;  4A3B H;  2N8N A;  4LF8 L;  3H0G G;  4POF A;  1PH9 A;  4IFD G;  2V1C C;  4BBR G;  3Q8D A;  5GAE C;  3NEM A;  2NVY H;  3S15 H;  1KXL A;  3RZD H;  2PQA B;  2CQO A;  2YTY A;  1WCM H;  2I0Q A;  2JA5 H;  4LFB Q;  1N32 L;  1E1O A;  4X64 Q;  5LMN W;  2VY3 A;  2CFM A;  2N78 A;  4LF8 Q;  4B3M Q;  3G48 A;  1VQJ A;  2GVB A;  2JEB I;  2UU9 L;  2Q2U A;  1M1K C;  5LMN Q;  3J7A 5;  3RN2 A;  5M3F G;  2ALY B;  1IBL L;  3CCS A;  1IBM Q;  4DNI A;  4AQY L;  4A76 A;  3DM3 A;  2NZO A;  1HNZ Q;  1OXS C;  4B3T L;  5C0X G;  1PA6 A;  1ASY A;  3W5O A;  4MTN A;  4A3L G;  3ICE A;  3PCO B;  2C35 B;  1C0A A;  4X62 L;  1JJC B;  1Z47 A;  2GVA A;  1VQB A;  3AQQ A;  1VQ9 A;  1YZ6 A;  1UE1 A;  1VQN A;  1PYB A;  1IBL Q;  2JA9 A;  4QGU A;  3A5Z B;  2ZJP A;  4C3I H;  2A19 A;  3CP0 A;  1YJ9 A;  3J7Z C;  2CCZ A;  4A3G G;  1H95 A;  2UUB Q;  2D0P A;  1WYD A;  4P73 A;  4Y7N H;  3CPW A;  1EIY B;  4OX9 Q;  1QZG A;  3EN2 A;  2OTJ A;  1HNW L;  3GTJ H;  1E22 A;  1AE3 A;  5C4J H;  1LUZ A;  1VQI A;  5IP9 H;  4J15 A;  2E2I H;  4DAY B;  4GKK L;  5JJK A;  2PI2 A;  4JI8 L;  5DLQ E;  4LF7 L;  1TXY A;  4R1J A;  1V1Q A;  4AIM A;  1HR0 L;  4JI5 Q;  1VQF A;  4ALP A;  4A3F G;  4JV5 L;  1VQD A;  2EQS A;  1X3F A;  3GDE A;  4IPC A;  5H1S E;  1YHQ A;  1J5E L;  1C7Y A;  2B29 A;  1KRT A;  1ASZ A;  2JA7 G;  2HHH L;  4DR7 L;  2B63 G;  3KDF B;  4K0K Q;  4BY1 H;  5IYB H;  4JI4 Q;  4HJ7 A;  4C3J H;  4A3J G;  4DPG A;  4B3S Q;  1FGU A;  1QVF A;  3A0J A;  4DR1 Q;  1VQG A;  1X56 A;  4UP9 A;  4L5R C;  1DGS A;  1Y1V G;  5FLM H;  1J5E Q;  1PH7 A;  4DV0 L;  4GLX A;  3SGI A;  1UWV A;  1WI5 A;  2YTV A;  2NVT H;  5M3M G;  4APV A;  3PO2 G;  4JYA L;  3CC4 A;  3ER0 A;  4JBJ A;  4JI1 L;  3OW2 A;  1GO3 E;  2LXJ A;  1JJG A;  2I5M X;  3JC6 6;  1KAW A;  4QIW E;  2UXD Q;  3BZK A;  1XPO A;  1X3E A;  2QA4 A;  4NXN Q;  2WAQ E;  4YHH Q;  1I6H H;  5IYD G;  2UXB Q;  1Q7Y C;  3B6Y A;  4DK3 C;  3PUW A;  1TWH H;  1OXV A;  4JC0 A;  4DV7 Q;  3TEH B;  3DLL A;  4BBS G;  3MEF A;  4DK6 C;  1HZA A;  1Q8K A;  1VQC A;  2NVX H;  1P16 A;  3CF5 A;  1M90 C;  4JOI C;  4IFD J;  4KLK A;  2AWO A;  2IHF A;  4NB3 A;  4DR6 L;  1PH1 A;  1U5K A;  4DR4 L;  4IJL A;  4JI0 Q;  4GN5 A;  1SLJ A;  3VDY A;  1RIP A;  1QUQ A;  1VQH A;  4DV3 Q;  3I4O A;  1CSP A;  3E9I A;  3OTO L;  1X9N A;  4LFA L;  4A3E H;  2IT1 A;  4C2M H;  3AFQ A; 
#chains in the Genus database with same CATH topology
 4GNX B;  1TS3 A;  3E0E A;  1YNN C;  3NBH A;  3S24 A;  2HIV A;  4CJ1 B;  1VQ5 A;  3LX0 A;  3BG3 A;  1TS2 A;  4XXE A;  1K0S A;  3L2P A;  1EIG A;  4X66 L;  1VS0 A;  3K7A B;  1R9T B;  2K01 A;  5C4H A;  3H6M A;  4RFB A;  1EYA A;  1AW7 A;  1B53 A;  2A5H A;  2RCN A;  3KK7 A;  3JAM c;  3KF6 A;  1JE4 A;  3KOJ A;  1A2T A;  4GN3 B;  1XNR L;  3HOY H;  2R61 A;  2UUC L;  2K04 A;  3BU2 A;  4TVA B;  2L4N A;  4M8A A;  2PZT A;  1TWG B;  3RLN A;  1BCP B;  4RH6 A;  4LF4 Q;  4WFN 3;  2R7Z H;  3CAM A;  1K8G A;  1J6Q A;  3WWV A;  3M3Y H;  1SYB A;  1VQA A;  4GKJ Q;  1A0I A;  4WJW A;  3GTK H;  3HKZ G;  1N32 Q;  3SK8 A;  2X6L A;  2KCN A;  2VUM H;  1O7Z A;  1H9J A;  2UU9 Q;  4R4I A;  2PW7 A;  4IUQ A;  2Z0S A;  1Q8I A;  4LF9 L;  2IW3 A;  2PMZ E;  4QJF A;  1JWS D;  5IGB A;  3J81 j;  2B2W A;  4CKC A;  3BDL A;  3ERQ A;  4DAY A;  3K8A A;  3HKS A;  1KQS A;  2M2L A;  4OHJ A;  5EKK A;  5IYC H;  4DV1 Q;  1AFP A;  1QJO A;  2YTX A;  5BN4 A;  2JQO A;  1A62 A;  1EY9 A;  5IOD A;  1KNA A;  3OWE B;  2ES2 A;  1TU2 B;  4H44 C;  3I7F A;  4LF7 Q;  3HS0 C;  1A15 A;  4OEM B;  4A3K B;  2KUM A;  1HR0 Q;  4X6A H;  4DR3 L;  2XWJ B;  2K5Q A;  2OT2 A;  1D1I A;  4XYO A;  4JOI A;  3UDX A;  1QCB D;  4QMG A;  1B4O A;  3E9H A;  4JYA Q;  3RNU A;  3I4M B;  3DUZ A;  5CV5 A;  1AN8 A;  1HZC A;  3HOU H;  1CUK A;  3I4N G;  4NW2 A;  4A3I H;  4HIM A;  3TP6 A;  1WFQ A;  2E2H B;  4KKU A;  4IPG A;  3GTM H;  3KFU A;  5JEA J;  4Z9C B;  3TRZ A;  4A3B G;  5EPL A;  1XPU A;  3PGZ A;  2CWP A;  2FIN B;  4K2K A;  1IYU A;  1IZ6 A;  1X3P A;  4O0A A;  1STE A;  4GNX A;  3MEH A;  1GOZ A;  3BZC A;  4POG A;  1CT1 D;  1Q81 C;  4CJ0 B;  2Y0S E;  3H94 A;  1Q12 A;  1EU4 A;  1K3R A;  4X65 L;  4RCN A;  5BR8 Q;  1O80 A;  1SND A;  2EY2 A;  3MHB A;  4ZLT F;  1VQL A;  4NXM L;  4DV5 Q;  3NQI A;  4ZQ3 A;  1HJP A;  5G3L F;  2F0L A;  1BBW A;  3PSI A;  2JA8 H;  1RHP A;  1YNX A;  1PRT C;  1NSN S;  2B2U A;  3KBX A;  4IO9 A;  4HTH A;  4DR5 L;  1BBX C;  3S2H H;  3K6O A;  2CWA A;  4ZRZ A;  4BY7 G;  4GLV B;  3UI2 A;  2Z4H A;  4OO1 I;  2WB1 G;  1I3Q H;  2NWG A;  3CCE A;  2DNC A;  1TR5 A;  2PW5 A;  1CK1 A;  4P74 A;  3HFZ B;  4LJZ C;  1HRJ A;  5C4X G;  4HED A;  5C44 B;  2IL8 A;  3HOZ G;  1WCM B;  5D65 A;  1BCP F;  5JPN C;  3ULP A;  5IT9 c;  5FJ8 H;  3NK9 A;  4JG2 A;  1WVL A;  1IBM L;  1DZ1 A;  2R93 H;  5M5Y H;  4Y52 H;  2F0M A;  2JN4 A;  1XJV A;  2JJQ A;  2ZM6 L;  1B7Y B;  3GQB A;  4A3C H;  1K28 A;  4KMU C;  4A3D H;  3S17 B;  1K8A C;  1PTO H;  5JPM C;  4AH6 A;  2Q2T A;  3S1N H;  4HJ5 A;  1EY5 A;  2F4V L;  1TWA H;  2JEA I;  1CA5 A;  3HGB A;  3N6R A;  3CCU A;  3GTJ B;  2ZJQ A;  4JI3 Q;  2RA4 A;  1EQQ A;  1PTO C;  5IGD A;  2RDH A;  1D5Z C;  3T1Y Q;  2PYK A;  1E24 A;  3A54 A;  2WII B;  1FGB D;  4JI5 L;  2JYO A;  4DFA A;  4LF5 Q;  3RZO H;  1B2T A;  4YWL A;  1TY2 A;  4A3M G;  4BBR H;  3W1G A;  1WTP A;  1D6E C;  1BBU A;  4YCU A;  2L5T A;  4YY3 Q;  1Y1W G;  3HOW G;  5E4W C;  3PUV A;  3G4S A;  3BZD B;  4F88 A;  5EGT A;  2RSO A;  3R93 A;  4HID A;  2F0S A;  1EOV A;  4MZ9 A;  2LY7 A;  2K5N A;  5HY6 A;  1AZP A;  3T13 A;  4MNO A;  3NBI A;  1QVC A;  4DV6 Q;  1EUJ A;  3J80 i;  2K5V A;  5C0X H;  2OCE A;  2OWO A;  3Q6S A;  1CQF A;  4K2L A;  5I9O A;  3U58 A;  1UE6 A;  4BA2 I;  2WIN B;  3GTQ B;  3QOL A;  3SR1 A;  3FRP B;  3FP9 A;  4XQQ A;  5F2D A;  2NVX B;  4CJ2 C;  3K5M A;  2BE5 D;  2F3W A;  4XTC S;  3J81 c;  3VR6 A;  3M4P A;  4ULL A;  2JA7 B;  3M7G A;  2VW9 A;  1EOT A;  1D1K A;  2CW0 C;  1U9R A;  1S5B D;  2RCF A;  5DEH A;  4DV3 L;  2VB3 X;  2CKZ B;  1IBK L;  4JI2 Q;  3QWN A;  1HQM C;  1QZH A;  3CCM A;  5M3M B;  3EBE A;  3ZYY X;  1QUQ B;  1E3P A;  5ELD A;  1B8A A;  2KVM A;  1CQV A;  2A6E D;  4JBM A;  2XRQ D;  4KY6 A;  1SYE A;  4OO1 G;  3IFT A;  1NNX A;  3I4L A;  3PO3 G;  4ID6 A;  1ZYR C;  1WOC A;  1HNX Q;  3STB D;  1UNS A;  3GTG B;  1QWY A;  5FO8 B;  2E2J B;  2O2L D;  4JVZ A;  1SFO B;  1G6Z A;  3U4V A;  2EIF A;  1UE5 A;  3DWA A;  5EJW A;  1HCZ A;  5IP7 G;  1V9P A;  5C6A A;  4DV2 Q;  3VYR A;  3HOV G;  4LF4 L;  5ELB A;  1MBY A;  4UHV A;  2ENB A;  2F0G A;  3CQZ H;  1Q90 A;  2F52 A;  3M4Q A;  4A3B H;  3H0G G;  4POF A;  1PH9 A;  1Y8O B;  2V1C C;  2MHV A;  1STG A;  3S15 H;  3RZD H;  3A55 A;  1EY7 A;  1LT6 D;  2EXZ A;  2E2D C;  1EIH A;  2I0Q A;  2JA5 H;  3C1F A;  4LFB Q;  1N32 L;  2VY3 A;  4LF8 Q;  2UU9 L;  5LMN Q;  1QNK A;  2F0U A;  1HNZ Q;  3DM1 A;  1PA6 A;  1ASY A;  3W5O A;  4A3L G;  3H09 A;  1EY4 A;  4YIJ A;  1LV9 A;  1HA5 A;  2KCC A;  4Y7N B;  1VQB A;  1UE1 A;  2K5D A;  2L1B A;  3VA5 A;  4EQO A;  2CCZ A;  1H95 A;  1UAP A;  1KAB A;  3TZU A;  2F0K A;  4UAI A;  4OX9 Q;  4A93 B;  4MTK A;  1ESF A;  1E22 A;  1AE3 A;  5IP9 H;  4GZY C;  2E2I H;  4ZKC B;  2B2Y A;  4LF7 L;  4CDD C;  1PFM A;  1HR0 L;  3HKZ B;  5LL6 X;  1VQD A;  4RKB A;  2QIL A;  1S5C D;  5H1S E;  4ZAI A;  1ASZ A;  4ZUI A;  2B63 G;  2F4I A;  1JOQ A;  5D3I B;  1QVF A;  4DPG A;  1FGU A;  3FPU B;  4DR1 Q;  4L5R C;  1J5E Q;  1Y1V G;  2OXP A;  5FLM H;  1NCV A;  1KAA A;  4GLX A;  1I6H B;  4JYA L;  1JWM D;  3PO2 G;  3DWQ A;  2MJ8 A;  3OW2 A;  2LXJ A;  2QW7 A;  5C5M A;  3LWE A;  2L55 A;  3R2I A;  4YHH Q;  2UXB Q;  1BUV T;  1TWH H;  1CFM A;  1FNW A;  4DV7 Q;  1ZXT A;  5KIX A;  4OIK A;  4DK6 C;  1HZA A;  1Q8K A;  4JOI C;  4KLK A;  2JSO A;  4NB3 A;  1VF7 A;  4C2M B;  4RGO S;  4E6I A;  4NMZ A;  1NR2 A;  3VDY A;  1SLJ A;  5CV9 A;  2OEO A;  1QUQ A;  1R4P B;  1LTA D;  2ZXO A;  4A3E H;  3BVG A;  4A4I A;  2ZXP A;  1WCM G;  3V2T A;  5BR8 L;  3TN2 A;  5C0X J;  3J7A F;  2EY1 A;  5C5L A;  4DV5 L;  1MJE A;  3KBG A;  1VMP A;  1T5E A;  3SEB A;  1N34 Q;  2RSN A;  4RA8 A;  4IQZ A;  2F1M A;  1X55 A;  5EKL A;  4IZ8 A;  1FJG Q;  5J1Z A;  1S4Z A;  4GNX C;  3K7A H;  1R9T H;  5GQO A;  2X6G A;  1L1O B;  2RQX A;  1Y69 U;  2VL6 A;  1IYV A;  1V43 A;  3D0F A;  3J7Y W;  1DXM A;  5IT9 L;  2D62 A;  1AZQ A;  5T1G A;  1H9M A;  1RF2 D;  4R4Q A;  5DM7 3;  2Q8I B;  2KED A;  3X3N A;  4LUV A;  4UY8 C;  2XNA C;  4PMW A;  1VQ7 A;  4O1N A;  2B39 A;  2J0T D;  1MSH A;  2EOT A;  1Y8P B;  4R4T A;  2K32 A;  1NMG A;  3NE5 B;  1G91 A;  4KD3 A;  3S2D B;  1SE4 A;  3NQT A;  4BY1 G;  3JAM E;  4R8I A;  3T1H L;  1LAC A;  2F0V A;  4HIO A;  1F9R A;  3A8J E;  1BCP C;  1U4M A;  3MWY W;  5CR3 A;  1BVS A;  3WOF A;  1XTC D;  1JR0 D;  3D4D A;  5FOB B;  3VA7 A;  3FVQ A;  1XTD A;  3M4O B;  4BY7 B;  1WTH A;  4B3T Q;  2HDM A;  3E6Z X;  5IGE A;  4FF4 A;  2NYZ D;  1L2F A;  3FKI H;  2F0H A;  2TMP A;  5ELF A;  2PI2 E;  3T53 B;  4JI3 L;  3KLS X;  2PO4 A;  3L0O A;  1TWC H;  3CC7 A;  2MQH A;  2XSC A;  1O78 A;  3T1Y L;  5C4X B;  3N52 A;  1I4P A;  4LF5 L;  2DGY A;  5GAD C;  1NY4 A;  3ULJ A;  2RHS B;  3TZD A;  1HNW Q;  2K5H A;  2RDG A;  5JOB A;  2MUY A;  3MVV A;  5I6W A;  4YY3 L;  4IOC A;  4LK1 C;  2KBN A;  4GKK Q;  1XMQ Q;  2YV5 A;  1WTV A;  1GUS A;  1SE8 A;  2HHH Q;  1EZ8 A;  5ELO A;  4DV6 L;  3GTL B;  1I4H A;  5A35 A;  4PQX A;  5IY0 A;  4A3K H;  3CCQ A;  4DV4 Q;  3J81 L;  1VQE A;  3K80 C;  4IN3 A;  4B9X A;  1WJJ A;  1D7Q A;  4DV0 Q;  1ICW A;  1DON A;  1F9Q A;  2JA6 H;  1IKM A;  1WTQ A;  2HCI A;  3W1B A;  4P71 A;  1HZ9 A;  1FVI A;  3TSS A;  2CH4 A;  1NE3 A;  2KCM A;  4A3M B;  1SYG A;  4FDB A;  5JJI A;  3GD7 A;  3I4M H;  2XIW A;  1ENC A;  3EFX D;  2LS0 1;  4PG3 A;  1Y1W B;  1HH2 P;  3HOW B;  3ND8 A;  1I5F A;  4RWS C;  1WD1 A;  1HTP A;  1L0W A;  2A6H C;  1A6X A;  1AEX A;  4IAL A;  4C3H G;  4JI2 L;  4LUO A;  1HA6 A;  4DR4 Q;  4P75 A;  5K36 H;  4A3J B;  2RHQ B;  1SN8 A;  3FEW X;  1IW7 C;  4G4K A;  5CV8 A;  1PH5 A;  3G6E A;  4FF2 A;  4QUC A;  5CV4 A;  1GJX A;  3PQI A;  4AYB G;  2C9O A;  1SE3 A;  2JK8 A;  1AH9 A;  1JQY D;  3F8T A;  4XIG S;  5FK9 C;  3DEO A;  2XRS D;  1L1O A;  5EBD A;  5CC4 A;  2PNH A;  3OOC A;  3MC0 B;  4KHP Q;  4FXK C;  1PXU A;  1IYJ B;  4DV2 L;  3CCV A;  2ZTE A;  5AJ3 Q;  1SMY D;  2GN5 A;  1KIX A;  4CDE C;  1PDQ A;  1E2Z A;  4DGZ A;  4NDX A;  4A93 G;  1W6J A;  4WJ3 M;  3S16 B;  1DM0 B;  1YNN D;  3IRB A;  3TS2 A;  1B9M A;  1SYD A;  3DXJ C;  5LMU Q;  1VF5 C;  5FLX L;  2KEE A;  4LFB L;  5A2Q E;  3KLW A;  3PF4 A;  5IE8 A;  1EEF D;  2HQL A;  3PO3 B;  2EY6 A;  2YU9 B;  1STA A;  1UUP A;  2PZW A;  4KN7 C;  5LMN L;  3OIQ A;  4L5S A;  2XWB B;  1NMF A;  1I94 Q;  5C44 H;  2G9H D;  3HOX G;  1KTK A;  1HNZ L;  1X6O A;  1B1Z A;  1K3B C;  2L15 A;  2QDB A;  3K5O A;  5KEE A;  2IPK D;  1VCI A;  4IFD I;  4P72 A;  3SK4 A;  2NN6 H;  2N49 A;  1PH6 A;  3KLR A;  3I90 A;  1HZB A;  3HOV B;  1QOH A;  2IHE A;  3I8Z A;  5I2X A;  4BXX H;  4FYD A;  2SEB D;  4OX9 L;  2CQA A;  3S17 H;  1SDF A;  3CRK C;  1KC8 C;  1MHW C;  3H0G B;  4JI7 Q;  2ASB A;  2V4D A;  5C4J B;  3M7N A;  3S1M H;  2VQE Q;  1S5F D;  3HZX A;  2WKD A;  3VYU A;  1IHZ A;  4X3S A;  1T5X D;  5C3E G;  1J8I A;  2PMZ B;  2NVQ B;  3BS1 A;  4PMB A;  1X54 A;  2WFW A;  3SE0 A;  4YCV A;  4DR1 L;  1OXX K;  2J4X A;  2WAC A;  4KY5 A;  4K5V A;  1UEA B;  1O7Y A;  3CD6 A;  2E74 C;  3UDI A;  4B3R Q;  3U50 C;  4ME3 A;  2OQ0 A;  2WP8 J;  3C46 A;  2IX0 A;  1ICF B;  2OTL A;  4YHH L;  2UXB L;  2YYZ A;  5CGK A;  3MXU A;  1DJR D;  3Q23 A;  1TII D;  4DV7 L;  2QCP X;  3BDO A;  4NPS A;  2Z6K A;  4HCS A;  3S9W A;  1DOM A;  4TKO B;  2RDF A;  2L9H A;  4IUV A;  5E3F A;  1G2S A;  3NTK A;  3GTQ H;  2I46 A;  4X3U A;  4GOP C;  1OTC A;  2B63 B;  5D3D A;  5JVG 3;  3HRZ C;  2Q2H A;  1WTX A;  3A5U A;  1GUW A;  1BO0 A;  5GAH C;  4A3F H;  3MFG A;  2JA7 H;  3QG1 A;  1Y1V B;  1XPR A;  1ESR A;  3BYY B;  1M4V A;  1G51 A;  3PO2 B;  1LTI D;  3NUC A;  3QB3 A;  3C1E A;  3CPF A;  3TBI B;  1QIL A;  1HXY D;  5DAU A;  3C2P A;  2KEC A;  1CSQ A;  4PZ6 A;  3OSO A;  1N34 L;  4B08 A;  2ZTC A;  5M3M H;  2NZH A;  1N36 L;  1FJG L;  1XNQ Q;  2K33 A;  5AFW A;  1EY8 A;  3J81 E;  2O5J C;  5GRO A;  3CCJ A;  3KJP A;  1JIC A;  5IYD H;  2EJM A;  2K1B A;  2Y0S B;  1CKN B;  4DA2 A;  3PIO 3;  4HSV A;  2E2J H;  3GTG H;  3PIP 3;  4BBS H;  2MNA A;  3NEL A;  1SE2 A;  4LAA A;  4HJ9 A;  3CHB D;  3PUZ A;  1PH4 A;  3CC2 A;  3H3V I;  1JE5 A;  3UDF A;  3I2Z A;  2N88 A;  2B8G A;  3BVM A;  4Q0F A;  5KGU A;  2R7Z B;  5J39 A;  1A3U A;  4IFD G;  3MXG A;  5GAE C;  1ONL A;  3NEM A;  5FKA C;  2PQA B;  3NP8 A;  1LTR D;  2CQO A;  1W6K A;  1QE6 A;  2K28 A;  2B2V A;  4TRD A;  1E1O A;  1F9P A;  4X64 Q;  5LMN W;  3GTK B;  1PRT D;  1CZG A;  2CFM A;  4B3M Q;  1VQJ A;  2JEB I;  1WD0 A;  2Q2U A;  3RN2 A;  5M3F G;  1IBL L;  3DM3 A;  1SYC A;  2NZO A;  4B3T L;  3DHQ A;  2IX3 A;  1Y8N B;  3ICE A;  4PMC A;  1Q3L A;  3OIP A;  3VYS A;  4Q5V A;  1JJC B;  1Z47 A;  2GVA A;  3J7A V;  3AQQ A;  1D2B A;  1YJ9 A;  3CP0 A;  5KRU A;  4A3G G;  1CHQ D;  1ZKO A;  4ODG A;  5KYI A;  2PPB C;  3CPW A;  5JVH 3;  4Y7N H;  1QZG A;  1PZJ D;  1EEI D;  1K8O A;  1HNW L;  4GKK L;  5JJK A;  3E0J A;  1DOL A;  4BY1 B;  5C3X A;  1HFG A;  4WOR A;  2EQS A;  4J6H A;  1KRT A;  3J80 L;  2HHH L;  3KDF B;  3I73 A;  5CYU A;  4A3J G;  4B3S Q;  1TVX A;  2DNE A;  2MPM A;  1VQG A;  2NBF A;  3P7J A;  4KY7 A;  3K5L A;  4DV0 L;  1A3T A;  1OO9 B;  2NVT H;  5IOC A;  3DMU A;  1PTO D;  4QIW E;  2RBM A;  3T4A C;  5IIF A;  2UXD Q;  3BZK A;  2QA4 A;  4L8J A;  4NXN Q;  2WAQ E;  1I6H H;  3O13 A;  4LMQ D;  2Q8T A;  5IGF A;  3B6Y A;  3PUW A;  1OXV A;  4A3I B;  3MEF A;  1VQC A;  3GTM B;  1D5X C;  3NWS A;  4ABN A;  2Z4I A;  2H4O A;  1GHJ A;  5BN5 A;  4R9W A;  2IHF A;  1PH1 A;  3CKI B;  4DR4 L;  3OMC A;  1KDC A;  4JI0 Q;  4GN5 A;  2JP1 A;  1WTO A;  1S5E D;  4U67 3;  1CZW A;  3A7A B;  4C2M H;  3JC6 6;  3AFQ A;  1EY6 A;  1PV4 A;  1PZI D;  1JOK A;  3D6W A;  1RKN A;  1QVG A;  4KHV A;  2EVB A;  2L0C A;  2F0O A;  1LTL A;  1B3Q A;  1QB5 D;  1PRT B;  2PZU A;  4IOA A;  2EJG C;  3CXC A;  2E5L Q;  2AUJ D;  4HSP A;  5T1I A;  3C3L A;  3K81 C;  4KHP L;  1VQ8 A;  1CKN A;  4I7A A;  2JA8 B;  1LYL A;  1G6P A;  3RMH A;  3JAM i;  2CW0 D;  4DXF A;  5AJ3 L;  1B3A A;  3VYT A;  3I4N H;  5FO9 B;  4X66 Q;  3GO5 A;  4L5T A;  2K5W A;  3IL8 A;  4C3I G;  4C3H B;  1UE7 A;  2HUG A;  1TWF B;  1LAB A;  4DNR B;  5NUC A;  1I3Q B;  2LFN A;  2DJG C;  2TSS A;  2VQF Q;  5IWA Q;  2QGQ A;  1JJ2 A;  1F2Z A;  1NUC A;  1X3G A;  4PZ8 A;  4GKJ L;  1I4G A;  4IUR A;  1B50 A;  2PQA A;  3I56 A;  4WRD A;  4CBV A;  4MN3 A;  4HJA A;  4IPD A;  3CW2 C;  2UUC Q;  1SEB D;  1ZYR D;  4AYB B;  5HGQ A;  5BN3 A;  1U0L A;  4DKA C;  4RAU C;  2VB2 X;  1I94 L;  2R92 B;  3GTP B;  2E75 C;  2R93 B;  4C3J G;  3R2T A;  3AYH B;  3K0X A;  1TT2 A;  2DUD A;  5FLX c;  4RGM A;  1SR3 A;  4FO2 A;  4BS9 A;  3S2D H;  2E8G A;  4H13 C;  4QF4 A;  3TP8 A;  1ENA A;  3VR4 A;  3A56 A;  5ELE A;  1KLU D;  1XWE A;  2Z9H A;  4KTA A;  2CH4 W;  4I65 A;  1PTO B;  3D4W A;  4DV1 L;  4RG1 A;  2PCF B;  4G7Z C;  4K8I A;  5EAY A;  4X62 Q;  4DK0 A;  4KHZ A;  4JI7 L;  1G2T A;  3M4O H;  4BY7 H;  4DXG A;  1EFW A;  3HKZ E;  5KNB A;  2VQE L;  1HUN A;  5E1F A;  4QUF A;  5JJL A;  1Y14 B;  3MXN B;  2A1A A;  4IUU A;  5EPK A;  5C4X H;  3M4Y A;  3QO2 A;  2K75 A;  3KDF A;  4OL7 A;  4IUP A;  5HUR A;  4X3T A;  3HOX B;  5JJZ A;  1E2V A;  3HOZ H;  3Q24 A;  2EYF A;  1S72 A;  2B2W C;  1YNJ C;  3S1Q B;  1B9N A;  4JV5 Q;  3L3O C;  1YI2 A;  5M5W H;  3R3O A;  1RL2 A;  3QIA A;  3CCR A;  4B3R L;  2LMC B;  4KJN A;  1W3S A;  3M85 A;  4UP7 A;  1ENF A;  3QJY A;  1GKH A;  1PZK D;  1VDZ A;  4JBK A;  4DR3 Q;  4HR7 B;  3GTL H;  2XTI A;  3GV6 A;  3RD4 A;  1N8R C;  1EWC A;  2I5H A;  4JI1 Q;  1UEB A;  5JAV A;  2Z6B A;  4R8N A;  4LUZ A;  4QY7 A;  2Q8R E;  2Y0S G;  1SRU A;  4LW1 A;  1OXU A;  2N55 A;  1A8V A;  1A63 A;  2KOL A;  5C3E B;  5CBA E;  4ZCK A;  1U4P A;  2G5D A;  1S40 A;  3IAY A;  1JCK B;  3P20 A;  3SDZ A;  4A3M H;  4EVO A;  3A74 A;  1T9H A;  4IJH A;  1D8L A;  4DR6 Q;  2QEX A;  2B3G A;  2F0E A;  1Y1W H;  1K0R A;  1V1O A;  3HOW H;  2R7Z G;  4K8J A;  1CKO A;  1TQO A;  2VZA A;  2BA1 A;  2Z8L A;  3OTO Q;  2AHO B;  4LFA Q;  3ND9 A;  3UDG A;  3R8B A;  1BKB A;  3FPP A;  3M9B A;  2HT1 A;  2EY5 A;  1EZ6 A;  1Z6H A;  2K52 A;  1B44 D;  3NEN A;  2EYL A;  3S14 B;  2ID0 A;  2K4K A;  2VUM G;  3MXP A;  2K50 A;  2ZT9 C;  2SNM A;  1HHV A;  3BVZ A;  3KYH C;  2IWH A;  2F0D A;  4X65 Q;  1CI3 M;  3OW7 A;  1EYC A;  2MFI A;  3I70 A;  4RGT A;  3PMF A;  2F0P A;  1TY0 A;  5IYC G;  4XT3 B;  2MO0 A;  2F0F A;  2R7F A;  3CQZ B;  2EYJ A;  3F1Z A;  1TWG H;  2LXK A;  4KD4 A;  1DD2 A;  3S16 H;  2D5D A;  2B2U C;  4GN4 B;  3G7L A;  1MGS A;  4GS3 A;  3V05 A;  3S15 B;  4X64 L;  2F3V A;  4LFC Q;  1RDP D;  2BCO A;  1QNU A;  4B3M L;  5EBC A;  3HP3 A;  1JB3 A;  3G71 A;  1X32 A;  3OWF A;  4K5X A;  4DF7 A;  4OO1 H;  3PO3 H;  3BDC A;  2WB1 E;  5G3L D;  1YJW A;  2YU9 H;  4RGN A;  3Q0A A;  2HD3 A;  1JC7 A;  5FO7 B;  1K9M C;  1JT8 A;  3H3V H;  4F87 A;  3H91 A;  2ZXR A;  3KF8 B;  5IP7 H;  5CV6 A;  4HIK A;  1GM5 A;  3HOU G;  2ZM6 Q;  2AUK A;  3MXN A;  4A3I G;  3S1R B;  3HOV H;  3LWU A;  1C4Q A;  4FNF A;  1HR0 W;  3D4R A;  2H1E A;  5C0X I;  1HTL D;  3LGJ A;  3DWP A;  4JI6 Q;  2F4V Q;  4LF6 Q;  3H0G H;  1SNC A;  1FD7 D;  4H02 A;  4KKS A;  1BCP D;  3GTO B;  4OEL B;  1II3 A;  5M3F B;  3UE0 A;  4B3S L;  3ERS X;  2K6A A;  4KK7 A;  1H9S B;  1FR3 A;  2SOB A;  2WAQ G;  4DUY Q;  2NVQ H;  1CM9 A;  2XVS A;  3AB9 A;  2D0O A;  4K5W A;  1W2B A;  3F2D A;  1EQR A;  1E1T A;  3SK6 A;  4DAP A;  1KL9 A;  5M5X B;  1EYD A;  3J80 c;  5E7N A;  4A3G B;  4A3L H;  2UXD L;  1RCV D;  2RF4 A;  4NXN L;  3CMA A;  1K83 B;  1MI2 A;  4H7B A;  5COY A;  1YIJ A;  1XYI A;  4YWK A;  2JA8 G;  2B2T A;  1ET6 A;  3A8I E;  2OF1 A;  2F0N A;  1VQO A;  3J81 i;  2XGT A;  4DR2 Q;  4QQB X;  4XQJ A;  4KJO A;  4DN4 M;  2E2H H;  1Q1E A;  2IJ0 A;  2VS1 A;  3RR5 A;  1LTB D;  4JI0 L;  1EU3 A;  1SNM A;  3I3C A;  3NWT A;  4RMF A;  4YCW A;  5J22 A;  3HEJ A;  2B63 H;  1BNZ A;  1I50 B;  5C4Z A;  1D5M C;  2KCT A;  1JMC A;  1X65 A;  2K14 A;  2DY7 A;  1JOO A;  4HAE A;  4PZ7 A;  1HNX L;  1EY0 A;  1XMO Q;  1Z9F A;  2E5L L;  2R92 G;  5FJ8 G;  2UXC Q;  1Y1V H;  1N33 Q;  2AKW B;  1IBK Q;  1C8C A;  4KI0 A;  2R93 G;  4JCV E;  4A75 A;  3PO2 H;  2B8F A;  2M9V A;  3KUP A;  1Q1B A;  4A3C G;  1C9O A;  1JWU D;  2JXM B;  1KRS A;  2D9U A;  4A3D G;  3K0Y A;  1LTG D;  2A6H D;  1P8L A;  1VQM A;  1I6V C;  5HGT A;  4DAM A;  1AE2 A;  4IUT A;  2VQF L;  5IWA L;  4DUZ Q;  3MZ5 A;  4EQ5 A;  1IW7 D;  1OXT A;  2NVY B;  1EIF A;  2I5L X;  5I4D A;  2CVR A;  2D2C C;  1HFN A;  2EYP A;  3QOJ A;  2N8N A;  4EGV A;  5IGG A;  4LF8 L;  3AMU A;  3NTI A;  4BBR G;  1TS5 A;  1DCZ A;  4N9P A;  1KXL A;  2YTY A;  1SYF A;  1WCM H;  4HCE A;  1SJH D;  4OIJ A;  2XN9 C;  4B9W A;  4FF1 A;  4FP5 D;  3G48 A;  1F2L A;  1LT3 D;  2A68 C;  3J7A 5;  5EPJ A;  2ALY B;  3CCS A;  4G7O C;  1U4L A;  1OXS C;  3KF8 A;  4C3I B;  3VR5 A;  5C0X G;  4MTN A;  2P5Z X;  2C35 B;  3LNN A;  1C0A A;  3K5N A;  1HQR D;  4X62 L;  3FKI B;  2NUC A;  4HN7 A;  1PYB A;  4MIU A;  4KKT A;  3A5Z B;  2ZJP A;  4FVM A;  3J7Z C;  1WTW A;  1TWC B;  5EKI A;  1RTN A;  3SVM A;  1H9K A;  5IT9 E;  2UUB Q;  2D0P A;  1WYD A;  5CMD A;  1EIY B;  1S5D D;  1H9R A;  3GTJ H;  4OGQ C;  1VQI A;  4MHE A;  4DAV A;  2PI2 A;  4ZKB B;  1WTR A;  5DLQ E;  4R1J A;  1KDA A;  4C3J B;  4ALP A;  2F03 A;  4JV5 L;  4IPC A;  1YHQ A;  1H9S A;  1X3F A;  3GDE A;  1J5E L;  1C7Y A;  2B29 A;  2A68 D;  4K0K Q;  4BY1 H;  4JI4 Q;  2FFK B;  4XDX A;  1I4R A;  2F0J A;  1STB A;  5LHY 1;  2B2Y C;  1C48 A;  2EE1 A;  3SGI A;  1WI5 A;  4JI1 L;  2ICI A;  1JJG A;  5I6Y A;  2I5M X;  2JA6 B;  1G8Z D;  1X3E A;  4XYQ A;  2K03 A;  4DK3 C;  4DU9 A;  4JC0 A;  3TEH B;  2FMM A;  5M9O A;  3DLL A;  4C56 C;  3NXW A;  1L0Y B;  2NVX H;  3CF5 A;  1BR9 A;  1M90 C;  1STH A;  1STY A;  4I7Z C;  4DR6 L;  1U5K A;  3AU7 A;  1A3V A;  4U68 A;  1RIP A;  2NB0 A;  3V96 A;  1PYW D;  4F8M A;  4UDU C;  3OTO L;  1X9N A;  4LFA L;  3CRL C;  5COR A;  1JOR A;  2SNS A;  2SDF A;  2QKI C;  3PUX A;  1EWI A;  2JA5 G;  3A8K E;  1DOK A;  2CHB D;  1V8Q A;  2PNR C;  5TSS A;  2KHJ A;  3WDN A;  1K8M A;  4HMI A;  4BWG B;  2G9D A;  3HOY B;  1YHA A;  2KQ3 A;  5KNC A;  3GP7 A;  1O7L A;  3QR8 A;  2AWN A;  1V1P B;  1SFO H;  4OXP A;  2BH2 A;  2FJ2 A;  1KDB A;  2IY5 B;  2F0Q A;  1O7I A;  3EJI A;  3RN5 A;  5I9P A;  2UUA Q;  3FHW A;  2KHS A;  3D8G A;  5L37 A;  3NTH A;  1N9W A;  1PMR A;  2AQ1 B;  3T51 B;  4C3H H;  5IP9 G;  3M3Y B;  1TWF H;  1EL0 A;  3RLO A;  1BDO A;  4K14 A;  4LFC L;  4NKL A;  1L0X B;  2ICE C;  1R4Q B;  2EYM A;  5CV7 A;  4L5Q A;  4DNT B;  2VUM B;  1MSG A;  4V19 0;  4R4C A;  1IKL A;  1TS4 A;  1Z7T A;  5ISR A;  3NHH A;  1CTM A;  2RKS A;  2HCC A;  2R92 H;  3GTP H;  1YEZ A;  2HQE A;  3TQY A;  5FLM G;  4H0L C;  1MIU A;  1B70 B;  1IL2 A;  2R6G A;  3G6J B;  3I55 A;  4AQY Q;  2LSS A;  4ZUJ A;  3OHX C;  4K6L A;  3T1H Q;  4QCL A;  2F3I A;  3NSW A;  3L7Z C;  4ZK9 B;  1LM0 A;  3NPP A;  1SNO A;  1F2Y A;  3PUY A;  4A93 H;  1XMQ L;  1LTS D;  4JI6 L;  3S1M B;  4LF6 L;  1BQQ T;  2AQ2 B;  1SSO A;  1MKH A;  3FDT A;  4RCO A;  3I91 A;  3ERO A;  1MD2 D;  3RLF A;  5FLX E;  1YVC A;  1DYQ A;  4N8X 1;  4JI8 Q;  1ET9 A;  4DV4 L;  5GAG C;  1JB7 A;  4BA1 I;  1FL0 A;  2BE5 C;  4DUY L;  4A3E G;  4S3S A;  2RVL A;  4M1U B;  4DR7 Q;  1ML0 D;  2MO1 A;  3HOX H;  3IFD A;  4LNQ A;  2GA4 B;  3S1Q H;  1PFS A;  2A69 C;  2AQ3 B;  1VQ4 A;  1Q82 C;  3HOU B;  1ZEQ X;  1SXT A;  1LT4 D;  4YWM A;  3HG9 A;  1ILQ A;  4J1M A;  2ZTD A;  3ONA B;  2EZV A;  1KLG D;  1KHI A;  3A7L A;  1NBW A;  3F2B A;  1PH3 A;  4GOP B;  5KYL A;  2A6E C;  3K7U C;  4KV6 A;  4DR2 L;  5KND A;  3VR2 A;  1YBY A;  3P75 A;  2DY8 A;  3STB C;  2MGS A;  1RTO A;  4CGY B;  2EYH A;  5D14 A;  1MJC A;  1CKM A;  2HIX A;  4C1N K;  4QIW B;  3TME A;  3U4Z A;  4A3F B;  3CU7 A;  5C3E H;  2WAQ B;  1PH2 A;  2LKV A;  4CHT B;  4EX5 A;  2HDL A;  2E76 C;  3W2D A;  4P2C B;  2FMC A;  1XMO L;  2UXC L;  5C3W A;  2B2T C;  2A69 D;  1N33 L;  1S3O A;  1SBB B;  3D31 A;  2VNU D;  3JAM L;  1XXG A;  3MA2 B;  2A8V A;  2NTS A;  3K57 A;  2KHI A;  4UPA A;  3TS0 A;  2EDG A;  2BA0 A;  1V1P A;  4LWC A;  2FXQ A;  4X3K A;  3S2H B;  1E7Z A;  2Q2I A;  1GD7 A;  1LTT D;  4C1N I;  1PLF A;  4ZYS A;  4K6D A;  3S14 H;  1PFB A;  1PHJ A;  4UP8 A;  1EQT A;  5K5P A;  3FKI G;  1K73 C;  1KD1 C;  1PYS B;  4BBS B;  1EYG A;  1PFN A;  4DUZ L;  1G29 1;  2DN8 A;  1LT5 D;  2EPB A;  5LMU L;  1GXD C;  1XNR Q;  1TKW B;  4AYB E;  2WV6 D;  1RJT A;  1SJE D;  5ELN A;  4HJ8 A;  1L1O C;  5JEA G;  1BXT A;  1GUT A;  2K7V A;  3UE1 A;  5IYB G;  2NN6 I;  3BYT B;  5CBE E;  4JBW A;  4R4O A;  5M5Y B;  2KJX A;  1SRO A;  2EXD A;  4RHS A;  3TP7 A;  1VQ6 A;  2M00 A;  1SNP A;  3DEP A;  4A3D B;  1F2M A;  5DM6 3;  1XX8 A;  4A3K G;  3S1N B;  4O2D A;  2ZJR A;  2A73 B;  2R7D A;  3F2C A;  1IL8 A;  2Z1C A;  1TWA B;  4CKB A;  1KNE A;  1ILP A;  4OWW B;  3SHL A;  3SXH A;  2UUB L;  2JA6 G;  4L63 B;  4LF9 Q;  1VQK A;  2VXW A;  3BJU A;  3RZO B;  1YHB A;  4BBR B;  2BDO A;  3I4M G;  3F2U A;  1Q86 C;  1SMX A;  3PV0 A;  4WJ4 A;  3EQL C;  3ZJY C;  4IPH A;  1E2W A;  1VMC A;  3S1R H;  4IFD H;  2WKC A;  4K0K L;  2QDL A;  4JI4 L;  4GLA C;  4XT1 B;  3TDQ A;  2N3S A;  3OPO A;  1M8A A;  4DK1 A;  2NTT A;  1FNV A;  2EJF C;  3FMC A;  5K36 G;  4TSS A;  4OWX B;  3KJO A;  2KA7 A;  3GTO H;  5EQ0 A;  5M3F H;  1J9O A;  4HMJ A;  4TQU S;  4JPB W;  1Q46 A;  2J7Z A;  2NVT B;  4RHR A;  4V0B A;  1BF4 A;  5J3B A;  4GOP A;  2NZ1 D;  3D6C A;  2BH8 A;  3P1H A;  3TRE A;  5M5X H;  3HOY G;  4FF3 A;  4A3G H;  1PH8 A;  3AFP A;  3PIO A;  1YIT A;  3PIP A;  3ITP A;  5E4X A;  1NJI C;  1K83 H;  3OMG A;  1YNJ D;  1BOS A;  2EYO A;  4EQN A;  4QB4 A;  1AP0 A;  3CME A;  1GVP A;  4OWT B;  1SAP A;  1STN A;  2IX1 A;  4QL5 A;  2O5I C;  1NTG A;  2OQK A;  3MTS A;  3J80 E;  2Z6K C;  2BOS A;  4OON A;  3U9O A;  2F0T A;  5A2Q L;  2F0W A;  4A3J H;  1XNQ L;  3OYY A;  1I4X A;  3CCL A;  1X3Q A;  1IXR A;  1I50 H;  5C44 G;  3IKJ A;  1RD9 D;  2ATW A;  2MP1 A;  3NBH B;  1PRT F;  4IUN A;  2QF7 A;  2QEJ C;  3PF5 A;  2KEN A;  4CDF C;  3MFY A;  3ULL A;  4NXM Q;  4O42 A;  2UUA L;  3I4N B;  2NN6 G;  3E5S A;  1VQP A;  4KN4 C;  2AMC B;  1N36 Q;  4BXX G;  2A74 C;  3K59 A;  3T16 A;  3EIV A;  3KF6 B;  4DR5 Q;  2FHT A;  4A3B B;  2I07 B;  2H5X A;  3H15 A;  1YJN A;  3RZD B;  2JE6 I;  3AEV A;  2R3Z A;  5LL6 S;  1PVO A;  4CDC C;  4J8Q A;  2JA5 B;  3I72 A;  3TP5 A;  2PQE A;  3Q8D A;  2BDN A;  2NVY H;  4EQP A;  3K58 A;  2L11 A;  3MAQ A;  4PNY A;  1GUO A;  1NAP A;  1GUN A;  2N78 A;  4G57 A;  2GVB A;  1M1K C;  3VR3 A;  1CHP D;  1IBM Q;  3WOE A;  4DNI A;  4A76 A;  4AQY L;  3PCO B;  4XQN A;  1VQ9 A;  1YZ6 A;  1VQN A;  3H3V C;  1IBL Q;  2B2V C;  1F77 A;  1PTO F;  2JA9 A;  4QGU A;  4C3I H;  2A19 A;  3GV3 A;  2E2I B;  3L9A X;  4P73 A;  4JW0 A;  2L12 A;  4RKL A;  2WB1 B;  3EN2 A;  2OTJ A;  3U9S A;  1FNU A;  1LLR D;  1LUZ A;  3URY A;  5C4J H;  4J15 A;  4DAY B;  1EWH A;  4JI8 L;  1TXY A;  1V1Q A;  3D3R A;  2K05 A;  5IGC A;  4AIM A;  4JI5 Q;  1F9S A;  1VQF A;  5JEA H;  4ME5 A;  4A3F G;  3HOZ B;  3T56 B;  2JA7 G;  4DR7 L;  5DNF A;  1GUG A;  5IYB H;  5M5W B;  1NR4 A;  5I2Y A;  4HJ7 A;  4C3J H;  4FXG C;  3EA6 A;  3A0J A;  4NP5 A;  1X56 A;  4UP9 A;  1DGS A;  3E3X A;  2DJF C;  1A2U A;  1FYC A;  1PH7 A;  4N9T A;  1UWV A;  2YTV A;  4F7X A;  5M3M G;  4APV A;  1E0B A;  1HPC A;  5ELC A;  3CC4 A;  3ER0 A;  4JBJ A;  1EQV A;  3Q22 A;  1TWH B;  3KLS A;  1GO3 E;  3SK5 A;  1KAW A;  3W3A A;  1CA6 A;  4G7H C;  1XPO A;  1LO5 D;  1QG7 A;  1SNQ A;  5IYD G;  1Q7Y C;  1U4R A;  2C5C A;  4JK1 C;  1GHK A;  2X69 A;  1EFI D;  4ILW A;  4PV1 C;  2F0I A;  4BBS G;  4FXD A;  4N8F A;  4CKE A;  3EVQ A;  1P16 A;  4IFD J;  2AWO A;  1HUM A;  4A3E B;  1I4Q A;  2O4X A;  4IJL A;  3X3M A;  3RUZ A;  1VQH A;  4DV3 Q;  4L6T B;  3I4O A;  1SMY C;  1CSP A;  3E9I A;  1ROD A;  2IT1 A; 
#chains in the Genus database with same CATH homology
 4GNX B;  4A4I A;  1PV4 A;  3PUX A;  1EWI A;  3E0E A;  1WCM G;  1QVG A;  5BR8 L;  2JA5 G;  5C0X J;  3S24 A;  1LTL A;  2HIV A;  1VQ5 A;  4IOA A;  3L2P A;  4DV5 L;  2E5L Q;  3CXC A;  4X66 L;  2KHJ A;  1MJE A;  1VS0 A;  1N34 Q;  3K81 C;  4KHP L;  1VQ8 A;  1CKN A;  1YHA A;  1G6P A;  1LYL A;  1X55 A;  3JAM i;  1FJG Q;  2AWN A;  2RCN A;  3JAM c;  1SFO H;  4OXP A;  2BH2 A;  3KF6 A;  4GNX C;  5AJ3 L;  3K7A H;  1R9T H;  5GQO A;  2IY5 B;  3I4N H;  1L1O B;  3GO5 A;  4X66 Q;  1O7I A;  2VL6 A;  4L5T A;  3KOJ A;  1V43 A;  4GN3 B;  3RN5 A;  1XNR L;  3HOY H;  2UUA Q;  3D0F A;  1UE7 A;  3FHW A;  2UUC L;  2D62 A;  1N9W A;  3BU2 A;  4TVA B;  4R4Q A;  2VQF Q;  5IWA Q;  2QGQ A;  1JJ2 A;  4C3H H;  1X3G A;  5IP9 G;  4PZ8 A;  4GKJ L;  4LUV A;  4UY8 C;  3RLN A;  1TWF H;  4PMW A;  2PQA A;  3RLO A;  3I56 A;  1VQ7 A;  4LF4 Q;  2R7Z H;  4HJA A;  3CAM A;  4IPD A;  4LFC L;  3CW2 C;  1K8G A;  2UUC Q;  1J6Q A;  3WWV A;  5HGQ A;  1U0L A;  4R4T A;  4L5Q A;  4DKA C;  3M3Y H;  1VQA A;  1NMG A;  1I94 L;  4GKJ Q;  4BY1 G;  4R4C A;  1A0I A;  3AYH B;  3GTK H;  3K0X A;  3HKZ G;  1N32 Q;  3T1H L;  2DUD A;  5FLX c;  1SR3 A;  4HIO A;  2R92 H;  2VUM H;  1YEZ A;  3GTP H;  3TQY A;  3S2D H;  5FLM G;  1BVS A;  2E8G A;  2UU9 Q;  4R4I A;  1MIU A;  1B70 B;  2Z0S A;  1IL2 A;  2R6G A;  1XTD A;  3I55 A;  4AQY Q;  2LSS A;  4B3T Q;  4DV1 L;  4RG1 A;  3T1H Q;  4LF9 L;  1L2F A;  3FKI H;  5EAY A;  4X62 Q;  2PMZ E;  2PI2 E;  2F3I A;  4KHZ A;  4JI3 L;  4JI7 L;  4QJF A;  3J81 j;  3L0O A;  3CC7 A;  1TWC H;  3L7Z C;  3M4O H;  4BY7 H;  1LM0 A;  2MQH A;  4A93 H;  3K8A A;  3PUY A;  3HKS A;  3T1Y L;  1XMQ L;  1KQS A;  3HKZ E;  1EFW A;  5IYC H;  4DV1 Q;  4LF5 L;  4JI6 L;  2VQE L;  2DGY A;  5GAD C;  1NY4 A;  4LF6 L;  3ULJ A;  1Y14 B;  5JJL A;  3MXN B;  2RHS B;  1MKH A;  2A1A A;  2K5H A;  1HNW Q;  2YTX A;  4YY3 L;  4IOC A;  2JQO A;  1A62 A;  3RLF A;  5C4X H;  2KBN A;  4GKK Q;  2K75 A;  3KDF A;  1YVC A;  2ES2 A;  3I7F A;  4JI8 Q;  1XMQ Q;  2YV5 A;  4LF7 Q;  3HOZ H;  4DV4 L;  5GAG C;  1S72 A;  1JB7 A;  4X6A H;  4BA1 I;  1HR0 Q;  1FL0 A;  4DR3 L;  4DUY L;  4JV5 Q;  4A3E G;  1YI2 A;  4DR7 Q;  2MO1 A;  1SE8 A;  5M5W H;  2HHH Q;  4DV6 L;  1RL2 A;  5ELO A;  3HOX H;  4JOI A;  3CCR A;  4B3R L;  1W3S A;  3UDX A;  5IY0 A;  3M85 A;  4UP7 A;  4A3K H;  4LNQ A;  3CCQ A;  4DV4 Q;  3S1Q H;  1GKH A;  4JBK A;  1PFS A;  1VQE A;  3K80 C;  4DR3 Q;  1VQ4 A;  1Q82 C;  3GTL H;  2XTI A;  1WJJ A;  1D7Q A;  3E9H A;  4DV0 Q;  4YWM A;  2ZTD A;  1N8R C;  4JYA Q;  2I5H A;  3RNU A;  1KHI A;  2JA6 H;  4JI1 Q;  1NBW A;  1UEB A;  3F2B A;  1PH3 A;  4GOP B;  1HZC A;  4LUZ A;  3W1B A;  3HOU H;  4QY7 A;  3K7U C;  4P71 A;  1HZ9 A;  4DR2 L;  1CUK A;  1FVI A;  3I4N G;  2Y0S G;  1NE3 A;  1SRU A;  4A3I H;  4LW1 A;  1OXU A;  2KCM A;  4FDB A;  1YBY A;  4HIM A;  1A8V A;  5JJI A;  3GD7 A;  1WFQ A;  3I4M H;  1A63 A;  3STB C;  4IPG A;  4PG3 A;  1HH2 P;  1S40 A;  3GTM H;  3KFU A;  1MJC A;  1CKM A;  2HIX A;  5JEA J;  1I5F A;  3TRZ A;  4A3B G;  3U4Z A;  1L0W A;  3PGZ A;  2CWP A;  4A3M H;  1XPU A;  3A74 A;  1T9H A;  5C3E H;  1IZ6 A;  4IJH A;  4LUO A;  1D8L A;  4O0A A;  1PH2 A;  4JI2 L;  4DR6 Q;  2QEX A;  4GNX A;  2B3G A;  4EX5 A;  1Y1W H;  1K0R A;  3HOW H;  4DR4 Q;  2R7Z G;  4P75 A;  1CKO A;  3BZC A;  4POG A;  2VZA A;  2BA1 A;  1XMO L;  2UXC L;  1Q81 C;  2RHQ B;  1SN8 A;  3OTO Q;  2AHO B;  1N33 L;  2Y0S E;  1S3O A;  4LFA Q;  1PH5 A;  3D31 A;  3G6E A;  3UDG A;  2VNU D;  1Q12 A;  1K3R A;  1BKB A;  3M9B A;  4X65 L;  4AYB G;  2A8V A;  2HT1 A;  5BR8 Q;  2JK8 A;  2K52 A;  2KHI A;  1AH9 A;  3NEN A;  2ID0 A;  4UPA A;  3TS0 A;  3F8T A;  2K4K A;  4XIG S;  2BA0 A;  1VQL A;  4LWC A;  2FXQ A;  2K50 A;  2VUM G;  4NXM L;  1E7Z A;  4DV5 Q;  2Q2I A;  1GD7 A;  1L1O A;  1HJP A;  3KYH C;  1BBW A;  2PNH A;  3PSI A;  2JA8 H;  4X65 Q;  4KHP Q;  3S14 H;  1YNX A;  1PHJ A;  1IYJ B;  4UP8 A;  4IO9 A;  1K73 C;  3FKI G;  4DR5 L;  1KD1 C;  1PYS B;  4DV2 L;  3CCV A;  2MFI A;  1EYG A;  3S2H H;  4DUZ L;  1G29 1;  2ZTE A;  5AJ3 Q;  2CWA A;  2GN5 A;  1KIX A;  5LMU L;  4BY7 G;  1XNR Q;  4GLV B;  4A93 G;  4AYB E;  4WJ3 M;  4OO1 I;  2WB1 G;  5IYC G;  1I3Q H;  5ELN A;  2MO0 A;  3IRB A;  4HJ8 A;  3TS2 A;  1L1O C;  2R7F A;  5JEA G;  3CCE A;  3F1Z A;  4P74 A;  1TWG H;  3HFZ B;  2LXK A;  5LMU Q;  5C4X G;  3S16 H;  4GN4 B;  4GS3 A;  3UE1 A;  5IYB G;  2NN6 I;  4LFB L;  3KLW A;  4JBW A;  3PF4 A;  4R4O A;  4X64 L;  3HOZ G;  4LFC Q;  5IE8 A;  2HQL A;  1SRO A;  2EXD A;  4B3M L;  1VQ6 A;  3ULP A;  5LMN L;  5IT9 c;  5FJ8 H;  3G71 A;  4L5S A;  4JG2 A;  1NMF A;  1I94 Q;  5C44 H;  1IBM L;  3HOX G;  2R93 H;  1HNZ L;  5M5Y H;  1X6O A;  4Y52 H;  1XJV A;  3PO3 H;  2WB1 E;  4A3K G;  1YJW A;  2L15 A;  2YU9 H;  4O2D A;  2JJQ A;  2ZM6 L;  1B7Y B;  1K9M C;  4A3C H;  1VCI A;  2ZJR A;  1JT8 A;  2R7D A;  3F2C A;  4A3D H;  3H3V H;  4IFD I;  4P72 A;  1K8A C;  2N49 A;  1PH6 A;  3KF8 B;  1HZB A;  4OWW B;  4AH6 A;  2Q2T A;  2IHE A;  5IP7 H;  2UUB L;  2JA6 G;  3S1N H;  4OX9 L;  4BXX H;  4HIK A;  4HJ5 A;  1GM5 A;  3HOU G;  4LF9 Q;  2ZM6 Q;  2F4V L;  1VQK A;  1TWA H;  2JEA I;  3S17 H;  3BJU A;  1YHB A;  1KC8 C;  3CCU A;  4A3I G;  4JI3 Q;  4JI7 Q;  2ZJQ A;  2ASB A;  3HOV H;  3M7N A;  1EQQ A;  3I4M G;  1Q86 C;  1SMX A;  3PV0 A;  4WJ4 A;  1HR0 W;  3T1Y Q;  3ZJY C;  3S1M H;  4IPH A;  1E24 A;  4JI5 L;  5C0X I;  4LF5 Q;  3LGJ A;  2VQE Q;  4JI6 Q;  2F4V Q;  4YWL A;  4LF6 Q;  3RZO H;  3H0G H;  3S1R H;  4A3M G;  4BBR H;  4H02 A;  3W1G A;  5C3E G;  4K0K L;  4JI4 L;  1BBU A;  4YCU A;  4YY3 Q;  1Y1W G;  4GLA C;  3UE0 A;  3HOW G;  2N3S A;  4B3S L;  1X54 A;  3PUV A;  3G4S A;  3ERS X;  2WFW A;  4YCV A;  5K36 G;  4DR1 L;  1OXX K;  4OWX B;  3KJO A;  4HID A;  1EOV A;  2WAQ G;  4MZ9 A;  4DUY Q;  2K5N A;  2NVQ H;  3GTO H;  5HY6 A;  5M3F H;  2D0O A;  4MNO A;  4TQU S;  1W2B A;  1QVC A;  1Q46 A;  3F2D A;  1EQR A;  4DV6 Q;  1E1T A;  3CD6 A;  1KL9 A;  3UDI A;  3U50 C;  1EUJ A;  3J80 i;  2K5V A;  4B3R Q;  2OCE A;  3J80 c;  4ME3 A;  5E7N A;  2OQ0 A;  5J3B A;  2WP8 J;  2OWO A;  4A3L H;  2RF4 A;  2IX0 A;  4GOP A;  2OTL A;  4NXN L;  4YHH L;  3CMA A;  2UXB L;  2BH8 A;  2YYZ A;  3TRE A;  3U58 A;  1UE6 A;  5M5X H;  3HOY G;  1YIJ A;  2JA8 G;  4YWK A;  4BA2 I;  4DV7 L;  4A3G H;  1PH8 A;  3AFP A;  3PIO A;  1YIT A;  4NPS A;  2Z6K A;  3PIP A;  3FP9 A;  1NJI C;  1K83 H;  1VQO A;  3J81 i;  2XGT A;  4DR2 Q;  4QQB X;  4XTC S;  3J81 c;  2UXD L;  3M4P A;  3GTQ H;  2E2H H;  1Q1E A;  2VS1 A;  4GOP C;  3RR5 A;  2VW9 A;  3CME A;  1OTC A;  4JI0 L;  1GVP A;  2Q2H A;  4OWT B;  3A5U A;  4DV3 L;  2CKZ B;  2IX1 A;  4QL5 A;  5GAH C;  4A3F H;  4RMF A;  1NTG A;  2OQK A;  4YCW A;  2JA7 H;  1IBK L;  4JI2 Q;  2Z6K C;  4OON A;  2B63 H;  1XPR A;  2KCT A;  1QZH A;  3CCM A;  1X65 A;  2K14 A;  1JMC A;  1G51 A;  3EBE A;  4A3J H;  1QUQ B;  4PZ7 A;  1E3P A;  3OYY A;  1HNX L;  1XNQ L;  3CPF A;  1XMO Q;  1Z9F A;  2E5L L;  2R92 G;  5FJ8 G;  1B8A A;  3CCL A;  2UXC Q;  1CSQ A;  1Y1V H;  4PZ6 A;  1IXR A;  4JBM A;  1N33 Q;  1I50 H;  2AKW B;  5C44 G;  1N34 L;  1IBK Q;  4KI0 A;  2R93 G;  2ZTC A;  4JCV E;  5M3M H;  4A75 A;  2NZH A;  3NBH B;  2ATW A;  3PO2 H;  1N36 L;  3PO3 G;  4OO1 G;  1WOC A;  3PF5 A;  1Q1B A;  1HNX Q;  1FJG L;  1XNQ Q;  4A3C G;  3STB D;  1C9O A;  2KEN A;  1KRS A;  5GRO A;  4A3D G;  3ULL A;  3U4V A;  3CCJ A;  3KJP A;  4NXM Q;  5IYD H;  1P8L A;  2EIF A;  2NN6 G;  1VQM A;  1UE5 A;  1VQP A;  2UUA L;  1CKN B;  2AMC B;  5IP7 G;  1N36 Q;  4BXX G;  3GTG H;  2E2J H;  4BBS H;  3EIV A;  2MNA A;  3KF6 B;  1V9P A;  4DAM A;  1AE2 A;  4DR5 Q;  3NEL A;  4DV2 Q;  2VQF L;  5IWA L;  4DUZ Q;  4HJ9 A;  3HOV G;  4EQ5 A;  2H5X A;  3PUZ A;  3H15 A;  1PH4 A;  3CC2 A;  1OXT A;  3H3V I;  1JE5 A;  3UDF A;  1YJN A;  1EIF A;  2I5L X;  2JE6 I;  3I2Z A;  4LF4 L;  3AEV A;  1PVO A;  3CQZ H;  2F52 A;  3M4Q A;  4A3B H;  2N8N A;  4LF8 L;  3H0G G;  4POF A;  1PH9 A;  4IFD G;  2V1C C;  4BBR G;  3Q8D A;  5GAE C;  3NEM A;  2NVY H;  3S15 H;  1KXL A;  3RZD H;  2PQA B;  2CQO A;  2YTY A;  1WCM H;  2I0Q A;  2JA5 H;  4LFB Q;  1N32 L;  1E1O A;  4X64 Q;  5LMN W;  2VY3 A;  2CFM A;  2N78 A;  4LF8 Q;  4B3M Q;  3G48 A;  1VQJ A;  2GVB A;  2JEB I;  2UU9 L;  2Q2U A;  1M1K C;  5LMN Q;  3J7A 5;  3RN2 A;  5M3F G;  2ALY B;  1IBL L;  3CCS A;  1IBM Q;  4DNI A;  4AQY L;  4A76 A;  3DM3 A;  2NZO A;  1HNZ Q;  1OXS C;  4B3T L;  5C0X G;  1PA6 A;  1ASY A;  3W5O A;  4MTN A;  4A3L G;  3ICE A;  3PCO B;  2C35 B;  1C0A A;  4X62 L;  1JJC B;  1Z47 A;  2GVA A;  1VQB A;  3AQQ A;  1VQ9 A;  1YZ6 A;  1UE1 A;  1VQN A;  1PYB A;  1IBL Q;  2JA9 A;  4QGU A;  3A5Z B;  2ZJP A;  4C3I H;  2A19 A;  3CP0 A;  1YJ9 A;  3J7Z C;  2CCZ A;  4A3G G;  1H95 A;  2UUB Q;  2D0P A;  1WYD A;  4P73 A;  4Y7N H;  3CPW A;  1EIY B;  4OX9 Q;  1QZG A;  3EN2 A;  2OTJ A;  1HNW L;  3GTJ H;  1E22 A;  1AE3 A;  5C4J H;  1LUZ A;  1VQI A;  5IP9 H;  4J15 A;  2E2I H;  4DAY B;  4GKK L;  5JJK A;  2PI2 A;  4JI8 L;  5DLQ E;  4LF7 L;  1TXY A;  4R1J A;  1V1Q A;  4AIM A;  1HR0 L;  4JI5 Q;  1VQF A;  4ALP A;  4A3F G;  4JV5 L;  1VQD A;  2EQS A;  1X3F A;  3GDE A;  4IPC A;  5H1S E;  1YHQ A;  1J5E L;  1C7Y A;  2B29 A;  1KRT A;  1ASZ A;  2JA7 G;  2HHH L;  4DR7 L;  2B63 G;  3KDF B;  4K0K Q;  4BY1 H;  5IYB H;  4JI4 Q;  4HJ7 A;  4C3J H;  4A3J G;  4DPG A;  4B3S Q;  1FGU A;  1QVF A;  3A0J A;  4DR1 Q;  1VQG A;  1X56 A;  4UP9 A;  4L5R C;  1DGS A;  1Y1V G;  5FLM H;  1J5E Q;  1PH7 A;  4DV0 L;  4GLX A;  3SGI A;  1UWV A;  1WI5 A;  2YTV A;  2NVT H;  5M3M G;  4APV A;  3PO2 G;  4JYA L;  3CC4 A;  3ER0 A;  4JBJ A;  4JI1 L;  3OW2 A;  1GO3 E;  2LXJ A;  1JJG A;  2I5M X;  3JC6 6;  1KAW A;  4QIW E;  2UXD Q;  3BZK A;  1XPO A;  1X3E A;  2QA4 A;  4NXN Q;  2WAQ E;  4YHH Q;  1I6H H;  5IYD G;  2UXB Q;  1Q7Y C;  3B6Y A;  4DK3 C;  3PUW A;  1TWH H;  1OXV A;  4JC0 A;  4DV7 Q;  3TEH B;  3DLL A;  4BBS G;  3MEF A;  4DK6 C;  1HZA A;  1Q8K A;  1VQC A;  2NVX H;  1P16 A;  3CF5 A;  1M90 C;  4JOI C;  4IFD J;  4KLK A;  2AWO A;  2IHF A;  4NB3 A;  4DR6 L;  1PH1 A;  1U5K A;  4DR4 L;  4IJL A;  4JI0 Q;  4GN5 A;  1SLJ A;  3VDY A;  1RIP A;  1QUQ A;  1VQH A;  4DV3 Q;  3I4O A;  1CSP A;  3E9I A;  3OTO L;  1X9N A;  4LFA L;  4A3E H;  2IT1 A;  4C2M H;  3AFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...