2UUAL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uuaL00
1CUKA 3BU2A 1PHJA 3HOWH 1A0IA 2HT1A 3GTMH 5J3BA 1KL9A 1GD7A 3CCMA 1B7YB 1G291 5M5XH 5LMUL 3ER0A 4C3HH 3RNUA 3KFUA 1LM0A 3TEHB 4FDBA 1YBYA 4JV5Q 3RN2A 3HOVH 1HNWQ 1Q81C 1HZ9A 1S3OA 3FKIH 2F4VQ 3F2DA 5K36G 1VQEA 3E9IA 3AFPA 3CCJA 2RHSB 1O7IA 1IBLL 3CCRA 3GO5A 4LF9Q 4DV6Q 1N33Q 1FJGQ 4DR7Q 1NY4A 2N78A 3H15A 4DV3Q 4K0KL 1HR0Q 3HKSA 1VQMA 1N32Q 5FLMG 1A62A 4ALPA 1FVIA 1YITA 4JI4L 2MQHA 4DPGA 5IT9c 4JOIC 3ERSX 1SMXA 4X64Q 4R4QA 3CQZH 1IXRA 1X6OA 4DUYQ 3GTQH 1CKOA 1VQ8A 3NEMA 4P72A 3T1YQ 4A3FG 3J81c 1FJGL 4LF7Q 1WI5A 2Z6KC 1YI2A 2IX0A 3GD7A 3BZCA 3K8AA 3TS2A 2OQKA 4JCVE 4JI4Q 4A3IG 1UE1A 4JI3L 3HOVG 2WP8J 4A3EH 1Q8KA 3NENA 3CC7A 4BY1H 4R4TA 5JEAJ 1HJPA 4LF7L 1E22A 1X3FA 4GLAC 5H1SE 4YCWA 2AWNA 4YHHQ 3S2DH 2VY3A 1OXXK 4DNIA 4POGA 1YIJA 4RG1A 5GAGC 4YY3L 4P71A 1Y1WH 4X62L 4OXPA 2ZTCA 2VUMG 1JE5A 1U0LA 1YHAA 1GO3E 3KLWA 2WAQG 5LMUQ 1N34Q 1I50H 1VQNA 2MO0A 2CCZA 5FLXc 2C35B 2JA5G 4A3CG 2VNUD 3HOWG 4A75A 5JEAG 4YY3Q 2K5VA 1KIXA 1JJGA 2F4VL 1WCMG 3RZDH 4A3LH 3S1NH 4ME3A 4IOCA 2ID0A 2CKZB 3PUWA 4JV5L 2NN6I 2NVTH 1HNWL 1PH8A 4DV6L 3U4VA 4OWTB 5EAYA 4DV3L 2B63G 2ALYB 3ICEA 3M4QA 4K0KQ 2ZJPA 1IBLQ 1N33L 1YEZA 2EQSA 4R4OA 2AKWB 2K4KA 2OQ0A 3F1ZA 1HZBA 1QUQB 4NXNL 3S24A 3UDIA 4JI2Q 1K73C 2HIXA 3EBEA 3E0EA 2QA4A 1XMOQ 1BVSA 3IRBA 2A1AA 4Y7NH 1CKNB 1ASZA 1HH2P 4YWMA 4NPSA 1HR0W 1IZ6A 3AEVA 4WJ3M 3H0GH 4L5RC 1N36Q 5HY6A 4X65Q 1VCIA 4B3MQ 1XPRA 2E5LL 3S1MH 1Q12A 3RN5A 3PGZA 3CMAA 5IWAL 1D8LA 4JG2A 2E2IH 1LUZA 3J81i 4DR6Q 1U5KA 1BBWA 4LF8L 1NJIC 2UU9L 4UY8C 2IT1A 4KHPL 1GVPA 4HJAA 3U58A 1K83H 2PMZE 1PA6A 2HHHQ 2B63H 3HOUG 4X66Q 4YHHL 4B3ML 2CWAA 4A3JH 3KF6A 1PH9A 2NVQH 1YNXA 4X62Q 3DLLA 4IO9A 1HNXQ 4JI6L 1N34L 2JE6I 4JBMA 1Z9FA 5LMNW 1XPUA 3NBHB 2R7ZH 3M7NA 1SN8A 2CFMA 3CCVA 2MNAA 3I7FA 1I5FA 1A8VA 1SE8A 1NMGA 2Q2IA 1K9MC 2ASBA 3B6YA 4AH6A 1Y1WG 2JA7G 4WJ4A 2UUBL 2ZTDA 1KC8C 1K0RA 2IHEA 5JJLA 4P74A 2VQFL 4DUZQ 3A5UA 3ZJYC 1L1OA 3W5OA 3F8TA 1V1QA 4A4IA 2A8VA 1VQ5A 2K50A 2ZM6L 1UE5A 1VQLA 3S1QH 5IYBG 4A3LG 4DV4Q 4A3GH 2B3GA 3VDYA 2UXCQ 4O0AA 1EQRA 3ULLA 3KJOA 1SFOH 3S2HH 4LUVA 1X55A 4DK6C 3F2BA 1EQQA 1OXUA 4DV0Q 2ZM6Q 2VZAA 3FP9A 3KYHC 5M3MG 4JI1L 2UXBL 1E3PA 4X64L 1E1OA 1RIPA 3CD6A 1WJJA 2DGYA 3OYYA 3AYHB 1HNZL 1PFSA 4AQYL 2JA8G 1IBML 2R92G 2BA0A 2RCNA 1WFQA 2I5LX 1YJ9A 1XMQL 1BKBA 2BH2A 1K3RA 5FLMH 5C4JH 2UXBQ 1Q82C 4P75A 2K14A 4GOPC 3Q8DA 4GOPB 4A3KH 3A0JA 5C0XI 3CPWA 2YTXA 4O2DA 1VQHA 3CCUA 3PO2H 4BBSH 3H0GG 2QGQA 4GN5A 4A93G 2I0QA 2OTJA 2VL6A 4LFAQ 1PVOA 1UE7A 4GLXA 1XPOA 3M3YH 1YVCA 1VQGA 5GQOA 1JT8A 2HQLA 2UUBQ 3RR5A 4A3FH 2F3IA 1NE3A 5LMNQ 4DR1Q 4LF5L 5IYDG 1M1KC 3T1HL 4A3JG 2VQFQ 2AMCB 1VQ9A 5C4XG 3PUZA 1NBWA 4A3MH 4DV5Q 2NVXH 2EXDA 4UP7A 5HGQA 3FKIG 2Q2UA 1J6QA 1E24A 3HOXG 3PF4A 1SLJA 4R1JA 3CCEA 3L2PA 4DR4Q 2A19A 1EIFA 2KHIA 1KRTA 5IYBH 2JJQA 3CCLA 2YYZA 4B3RQ 2D62A 1FL0A 4GKJQ 3HOYH 5E7NA 5BR8L 3G48A 4LWCA 4PZ7A 4B3SQ 1XTDA 4MNOA 4LW1A 4OONA 5AJ3L 1XMOL 4A3BG 4JOIA 1NTGA 2VS1A 1KRSA 4TQUS 4JI7L 3PSIA 2N49A 5ELOA 1EYGA 1E7ZA 1VS0A 3CF5A 4DR4L 4YWLA 3EN2A 1TWGH 1VQ4A 1JMCA 4QL5A 3HOUH 5AJ3Q 4YWKA 4PZ6A 2VQEQ 1FGUA 4JYAQ 1G51A 2GN5A 4P73A 3W1GA 5BR8Q 5IP9H 3L7ZC 3BZKA 3K7UC 1VQPA 3UDGA 2R92H 2LSSA 4LF4Q 1EWIA 1SROA 1N9WA 1OXSC 4J15A 2R93G 2JK8A 5M3FG 4EQ5A 5IE8A 1BBUA 3J7ZC 1TWFH 3CPFA 1PH1A 3AQQA 4C3IH 3U50C 5IY0A 1V43A 1I3QH 2H5XA 1EOVA 1IBKQ 2ATWA 4UP8A 1TWHH 2Q2HA 4KLKA 4DAYB 3I56A 4LFCL 2UUCQ 1Q1BA 1PH4A 3MXNB 1UE6A 2FXQA 1XNRQ 2ZTEA 4OO1G 1H95A 4DR1L 4LF5Q 4X6AH 1G6PA 3PO3H 3J80i 4LF9L 3S15H 3GDEA 2DUDA 4GNXA 1W3SA 2RF4A 1JJ2A 1CKNA 4PMWA 5IYDH 1N32L 2R6GA 1XNRL 2PQAB 1L1OC 2XGTA 1L1OB 3I4OA 5M3MH 3HOXH 4DV4L 1Q7YC 1CSPA 1WYDA 4C2MH 1KXLA 4B3RL 2JA7H 4H02A 1HZCA 4DUYL 4IPHA 4OO1I 1VQJA 4DV1L 1J5EQ 3H3VI 1KAWA 1VQDA 2WAQE 4B3SL 4LFBQ 4JC0A 1PH3A 1QUQA 4NXML 4IJHA 1N8RC 3T1YL 1Q46A 2D0OA 3A74A 3I55A 3S1RH 3BJUA 4AQYQ 3I4NH 1VQAA 3FHWA 3PUXA 3STBC 4DV1Q 1J5EL 4JI3Q 3KF6B 4IJLA 3CAMA 3H3VH 1PV4A 3HOYG 4JI8Q 2IHFA 2BH8A 1ASYA 4A93H 5JJIA 2K5NA 1MIUA 2Z0SA 1W2BA 1L0WA 4HJ9A 1EIYB 1VQCA 3UDXA 2OCEA 3M9BA 1HZAA 5M5YH 2KHJA 2L15A 2GVBA 4UPAA 4JBKA 4PZ8A 4PG3A 3J80c 4DUZL 3D0FA 2NVYH 1VQBA 4L5QA 5GAHC 4A3DG 2PNHA 1X3GA 5IP7H 1LTLA 4L5SA 3I2ZA 3M4PA 2Q2TA 4BA2I 3CMEA 1S72A 2HHHL 4BBSG 3WWVA 5IYCG 2XTIA 2B29A 1P8LA 2K75A 4X66L 2UXCL 3PIPA 3KJPA 5ELNA 1E1TA 4DV2Q 5C44H 3J81j 3G4SA 1KD1C 3JAMi 3HOZG 1AH9A 4DV5L 4OWWB 3GTGH 5C0XJ 4JI0L 3UE1A 4GNXC 1MJEA 1VQKA 2E2JH 1XNQQ 1XJVA 3K0XA 1QZHA 4A3BH 3UDFA 4BXXH 2IY5B 3OTOQ 1RL2A 3D31A 3E9HA 3K7AH 2WB1E 3OW2A 4BY7G 1IBMQ 4GKKQ 4OWXB 2CQOA 2Y0SE 4GN3B 1WOCA 4NB3A 1YJWA 4LFBL 2F52A 1KHIA 5GADC 2KBNA 4A3CH 3RLFA 2AWOA 4HJ5A 1CSQA 3KOJA 3JC66 4B3TL 3OTOL 3J7A5 1T9HA 4YCVA 1N36L 1X65A 3S14H 4GKKL 1GM5A 1K8GA 1PH2A 3W1BA 1I94L 4JI7Q 4OX9L 4DR6L 1TWCH 1S40A 5C4XH 4DR5Q 2NZOA 3KDFB 1EFWA 4GKJL 2JEAI 4HIKA 4KHPQ 4IPDA 4IFDJ 3F2CA 2KCMA 2JA6G 2E2HH 1SR3A 4LF8Q 1CKMA 4LFAL 4DAMA 5IYCH 2R93H 2JEBI 4LF6Q 4JYAL 4MTNA 4A3KG 3HFZB 2I5MX 2BA1A 1I94Q 1IYJB 3CC4A 2E8GA 4IPGA 2CWPA 3TRZA 5JJKA 1Y1VG 4BBRH 4R4CA 3CCQA 4OX9Q 3I4NG 5LMNL 3CC2A 3CXCA 2OWOA 2Z6KA 1L2FA 2R7DA 4DR5L 3GTKH 4L5TA 1UEBA 4HJ8A 1B8AA 3RZOH 2I5HA 3JAMc 2YV5A 1QVGA 2K52A 4IFDG 1EUJA 4AIMA 3KF8B 2GVAA 2ZJRA 4GNXB 3PO2G 4MZ9A 4APVA 1PYSB 3PCOB 4JI2L 1NMFA 1YHBA 1VQIA 1MJCA 2JA9A 4JBJA 3STBD 4POFA 1AE2A 1R9TH 4DV2L 5GAEC 1OXVA 4QGUA 4LUZA 3CW2C 1VQFA 2LXKA 1XNQL 1QVCA 4BY1G 1PYBA 2MO1A 4XIGS 1D7QA 1TXYA 2N3SA 3HKZG 4JI0Q 4IFDI 2HIVA 4A3IH 1X54A 1X56A 2UUAQ 3K81C 4UP9A 3SGIA 4AYBE 4DV7Q 4A3MG 4LUOA 2UXDQ 1Y1VH 4JI1Q 4BBRG 4C3JH 5C3EH 5FJ8H 3A5ZB 3PUVA 3S17H 1P16A 4TVAB 4XTCS 1V9PA 1Q1EA 4BY7H 5C3EG 4IOAA 2UUAL 4GLVB 4QIWE 4DR3L 1HNZQ 3RLNA 2JA5H 1A63A 4R4IA 4NXMQ 3HKZE 3GTLH 3I4MG 1Z47A 3PIOA 2IX1A 1TWAH 2N8NA 1C0AA 4DV7L 2AHOB 3EIVA 4DR3Q 4JI8L 5DLQE 3S16H 1WCMH 2JA6H 2LXJA 5IWAQ 4QQBX 2JA8H 3KDFA 1VQ7A 4A3DH 3UE0A 2VW9A 1OXTA 1X3EA 2UUCL 4LFCQ 2ZJQA 4IPCA 4RMFA 3DM3A 4YCUA 4LF4L 2V1CC 1JJCB 3HOZH 4JBWA 3M4OH 2K5HA 2NN6G 2RHQB 4AYBG 2EIFA 5C44G 4DV0L 1YJNA 1HNXL 4JI6Q 3LGJA 2VUMH 2QEXA 3GTOH 3MEFA 3PUYA 4HIOA 1OTCA 1KQSA 4GS3A 4BXXG 2YU9H 4DR7L 1IL2A 4BA1I 3PV0A 4EX5A 2OTLA 1LYLA 3AFQA 1SRUA 5IP9G 1C7YA 1HR0L 4NXNQ 1IBKL 4DR2Q 3L0OA 1AE3A 1XMQQ 5M5WH 3K80C 1QZGA 2UXDL 3ULPA 4QJFA 4DK3C 4A76A 1I6HH 4A3EG 5C0XG 2WFWA 4GOPA 3TQYA 3NELA 2PI2E 3CCSA 4HIMA 1VQOA 2PI2A 1PH6A 2MFIA 2ES2A 4LNQA 1C9OA 4X65L 3GTPH 5IP7G 2KENA 4JI5L 2Y0SG 1MKHA 4GN4B 2E5LQ 4HJ7A 1B70B 2WB1G 2PQAA 3ULJA 5M3FH 1Q86C 4DR2L 4B3TQ 2NZHA 3G71A 2R7FA 3PF5A 1QVFA 5FJ8G 2UU9Q 2R7ZG 1YHQA 2VQEL 3RLOA 1Y14B 2YTYA 4KI0A 1X9NA 4DKAC 1YZ6A 1GKHA 2KCTA 3G6EA 2YTVA 4QY7A 1DGSA 3TREA 2D0PA 4Y52H 3TS0A 1VQ6A 3U4ZA 5GROA 3M85A 4JI5Q 4A3GG 1UWVA 1PH5A 4KHZA 1M90C 4HIDA 1K8AC 4LF6L 2JQOA 3T1HQ 1JB7A 3GTJH 3CP0A 3PO3G 3I4MH 1PH7A
chains in the Genus database with same CATH superfamily
4DXGA 1TWFB 5J3BA 2DY8A 3CCMA 1G291 1SNCA 4C3HH 2K5DA 3KFUA 2B2VA 1STNA 1HNWQ 3RN2A 1S3OA 4ZUJA 4OIJA 4PMCA 1STEA 3IAYA 1T5EA 5DEHA 5KIXA 2F0FA 3AFPA 2RHSB 1IBLL 4LF9Q 3CCRA 4K2LA 2EXZA 4DV6Q 1FJGQ 1NY4A 3KF8A 3MTSA 4FXGC 4X64Q 4R4QA 1ENFA 3NEMA 4P72A 3T1YQ 4A3FG 1KDAA 2WV6D 5LHY1 2BCOA 2Z6KC 3GP7A 2IX0A 3K8AA 3BZCA 1TVXA 1EZ8A 3EVQA 4A93B 4A3IG 3HOVG 2WP8J 2LKVA 4XXEA 5T1IA 4R4TA 1HJPA 4GLAC 1E22A 1QG7A 1X3FA 5H1SE 2XWJB 4YHHQ 3OMCA 4EQNA 4POGA 2QDBA 4P71A 4OXPA 2ZTCA 5CBEE 3CRKC 4IN3A 5LMUQ 1U0LA 1VQNA 1GO3E 4OL7A 2C35B 5FLXc 1I6VC 1SXTA 4C3IB 1H9SA 2NTTA 1J9OA 1STYA 3S1NH 2NN6I 2NVTH 4B9WA 3D4RA 3U4VA 2L9HA 2EE1A 4CJ1B 2ALYB 4CDCC 1IBLQ 4ZQ3A 2K4KA 4MHEA 1AFPA 2K28A 3UDIA 4JI2Q 4O1NA 1K73C 2J0TD 2QA4A 3NXWA 2B2VC 2AQ2B 2B2UA 3IRBA 2A1AA 4Y7NH 3H91A 1IZ6A 1STHA 4RKBA 2F0DA 3F2UA 4X65Q 3CMAA 1U4RA 4JVZA 5IWAL 4JG2A 2E2IH 4LF8L 4UY8C 4KHPL 4KD3A 1GVPA 2Z4IA 1PA6A 1BXTA 2G9HD 4XQJA 4ME5A 2MUYA 2N55A 4HEDA 2X6LA 2HCIA 4B3ML 1WTOA 3KF6A 1PH9A 2NVQH 1HQMC 3H09A 3BVGA 1I50B 2L12A 2JE6I 1O7LA 2M9VA 1JWUD 1KDBA 3NBHB 2R7ZH 4RKLA 3SK8A 2CFMA 2NVQB 1IYVA 2O2LD 5EPLA 1SE8A 3NTHA 1K9MC 3B6YA 2ZTDA 1KC8C 3IFTA 4DUZQ 5J39A 3HOXB 3OIPA 1FNUA 4PMBA 1UE5A 4HR7B 4QF4A 2EY1A 1H9MA 4A3GH 4X3SA 1QJOA 3S2HH 2E2DC 3P7JA 1SFOH 4LUVA 1X55A 4DK6C 3KLSA 1WTPA 2CHBD 4Y7NB 2VZAA 4X64L 3AYHB 1HNZL 4AQYL 1BCPD 1Y1VB 4U673 2I5LX 1BKBA 2WKDA 1DONA 4RHRA 5C4JH 1Q82C 2K14A 3Q8DA 1TR5A 3OSOA 3CPWA 4O2DA 4TKOB 3PO2H 4BBSH 5EKIA 5KNDA 4RAUC 5KYLA 1SYBA 4F88A 4FO2A 4DK1A 4LK1C 4R9WA 5GQOA 2A6HC 2K32A 2EOTA 2JSOA 2K6AA 5LMNQ 1MD2D 5IYDG 1M1KC 3NBHA 2B2TC 3TZDA 4UP7A 1E24A 5ELEA 1J8IA 3SDZA 3OW7A 3CCEA 3L2PA 2L55A 1X3PA 3MA2B 1SE2A 1TS5A 2F0UA 1JC7A 5IYBH 5M3FB 4C1NI 2D62A 1FL0A 1QNUA 3G48A 1PMRA 1XMOL 4A3BG 4JOIA 1MSHA 4PNYA 5ELOA 1SAPA 1E7ZA 1SSOA 3CF5A 3ND9A 4QL5A 2WINB 1B2TA 3JAML 2QW7A 4I7AA 4JYAQ 3TP6A 2E2IB 1E2WA 5IP9H 5K36H 2A6ED 2FMCA 4CKCA 4RGTA 3GTGB 3O13A 1JWSD 2VXWA 2HDLA 1BBUA 1PZKD 4ABNA 1TWFH 5DAUA 3AQQA 3ZYYX 1DOMA 1V43A 3MEHA 2IWHA 4M1UB 2A73B 4IZ8A 2JXMB 2ATWA 1JB3A 3A7LA 2Q2HA 4DAYB 4LFCL 2ZXRA 2UUCQ 1Y8OB 3MXNB 4OO1G 4DR1L 1EY7A 1HTPA 4X6AH 4X3TA 4ID6A 4GNXA 1W3SA 1JJ2A 2AUKA 1CKNA 1ZKOA 5EJWA 5IYDH 5FK9C 5J22A 4XQNA 1KNAA 2XGTA 1L1OB 5M3MH 1CSPA 1WYDA 1RTOA 4IPHA 1VQJA 4DV1L 2F0PA 4B3SL 1B3AA 3D4WA 3QR8A 4NXML 4IJHA 1Z7TA 3T1YL 1H9JA 3S1RH 2R7ZB 5I2XA 1XX8A 2XRSD 2SEBD 4IJLA 4JK1C 1PV4A 3PO2B 3U9SA 1ASYA 4KY7A 4XT1B 3URYA 1BNZA 1GUNA 1HZAA 4ILWA 2L15A 1JOOA 3A55A 3VA7A 2CH4W 4PG3A 2EYFA 3D0FA 3K59A 2K01A 1GHKA 1MGSA 4L5QA 2PNHA 1X3GA 2B2YA 3M4PA 1KAAA 1S72A 2P5ZX 1SNPA 4M8AA 2R61A 4X66L 3PIPA 3T51B 4A3GB 4HMJA 3VR5A 4NMZA 5CORA 2F0GA 2CW0D 1H9SB 2E2JH 1XJVA 3HRZC 3D31A 2NVTB 4XQQA 3GTMB 4OWXB 2Y0SE 1PZJD 3G7LA 4A3CH 2DNEA 3KOJA 4F7XA 1EFID 3JC66 1FNWA 1LT4D 3OTOL 3J7A5 3TDQA 1GUWA 1GM5A 1I4HA 3W1BA 1F2LA 1PTOD 1I94L 3VA5A 3J80E 1U4LA 4IFDJ 2JA6G 3SR1A 1BF4A 1SR3A 1CKMA 2EZVA 5KNCA 4MTNA 1YNJC 1I94Q 1IYJB 2CWPA 2DY7A 3R8BA 5JJKA 4BBRH 5I6YA 1L2FA 3QIAA 4GZYC 5FO7B 2K52A 4GNXB 2ZJRA 3PCOB 5ISRA 1WD1A 1YHBA 5KGUA 1MJCA 1LACA 3J81L 1VQFA 2LXKA 1PXUA 3RUZA 2KCNA 4HSVA 1JR0D 1DJRD 1KNEA 1X54A 1X56A 2UUAQ 2AQ3B 1F9SA 4EQPA 4A3MG 4LUOA 2UXDQ 1Y1VH 3MXGA 3GTLB 3SE0A 3PUVA 3S17H 2EJMA 3ONAB 2KEDA 1V9PA 1RF2D 4QIWE 4DR3L 1MSGA 1XYIA 1Z47A 2B8FA 3HP3A 1KDCA 3S2DB 3JAME 4WRDA 4IQZA 5E1FA 3T16A 1WCMH 3DEOA 3C46A 1E2VA 4A3DH 1PTOH 1LT5D 3T56B 3L9AX 4QCLA 3M4OH 2K5HA 2NN6G 4J6HA 2BE5D 5C44G 1YJNA 4JI6Q 4BBSG 4WJ4A 3LGJA 3MEFA 3PUYA 4GS3A 5CV9A 4DR7L 4IURA 3PV0A 4EQOA 1C7YA 4NXNQ 3UI2A 3L0OA 3K80C 4A3EG 3IL8A 1ESFA 4GOPA 3NELA 3CCSA 1E0BA 4C3HB 1VQOA 2PI2A 4GKJL 4LNQA 3HOZB 4C2MB 4JI5L 4U68A 2HDMA 2E5LQ 1B70B 2PQAA 3R2IA 4A3JB 2PW7A 5K5PA 1K8MA 3PF5A 1QVFA 2A5HA 2UU9Q 1YHQA 4FXKC 4DKAC 1GKHA 3G6EA 3P20A 2Z9HA 1LT3D 3M85A 4JI5Q 3TBIB 4A3GG 1LLRD 1PH5A 3E5SA 1FNVA 3MXNA 5C5MA 1EY5A 3N6RA 3T1HQ 1I3QB 3GTJH 4UAIA 3PO3G 3BU2A 3KBGA 2HT1A 2QF7A 3L3OC 1KL9A 1GD7A 2PMZB 3MXPA 3A7AB 1I6HB 4FDBA 5EGTA 2I46A 1Q81C 1GJXA 1II3A 4R8IA 2WIIB 3A56A 4QUFA 4DV3Q 4L6TB 4K0KL 4HAEA 3TP8A 5FLMG 1YITA 4JI4L 3H94A 2J7ZA 2PO4A 1SE4A 4JOIC 1D2BA 3ERSX 1SMXA 3CQZH 2LS01 1IXRA 1CT1D 2E75C 4DUYQ 1VQ8A 1CA5A 1FJGL 4LF7Q 2BE5C 2F0NA 3GD7A 1O7ZA 4KKUA 1DM0B 5J1ZA 4NKLA 1Q8KA 4ZAIA 1EYDA 2B2TA 3CC7A 5JEAJ 3FVQA 4LF7L 2XRQD 1IKMA 3K0YA 1STAA 4YCWA 2AWNA 1OXXK 4DNIA 3P1HA 2IW3A 4RG1A 4YY3L 1LTBD 1Y1WH 1I4PA 2XN9C 3D4DA 2VUMG 1N34Q 3WOEA 1TWHB 1B50A 2MO0A 2LMCB 2EYMA 2VNUD 1RJTA 4F8MA 2K5VA 1KIXA 3I4MB 1WCMG 3RZDH 4A3LH 4ME3A 3QB3A 1HNWL 2CKZB 4CBVA 3VYRA 2V4DA 3M4QA 2EQSA 3HOVB 4CDDC 1D5ZC 4CHTB 3H0GB 1BOSA 4G7HC 1BVSA 1ASZA 1SJHD 2QCPX 1N36Q 4CKBA 1VCIA 2B8GA 4B3MQ 2JN4A 5ELCA 1PYWD 3RN5A 3PGZA 1A2UA 4DNTB 3VYUA 3MVVA 2K05A 2ICEC 1NJIC 2UU9L 2IT1A 3C2PA 1TWGB 1RKNA 2EVBA 5JJZA 3QO2A 4G7OC 4A3JH 2BDOA 4X62Q 4X3KA 4IUNA 4JBMA 1LV9A 2O4XA 1WD0A 2EY5A 4ZKCB 3M7NA 3VR3A 1D1KA 1JWMD 1BBXC 1UAPA 1A8VA 2Q2IA 1B9NA 1PTOC 2WACA 4AH6A 3FRPB 2ASBA 2VQFL 2JA8B 2NVXB 3F8TA 1ML0D 2L5TA 5C4ZA 3S1QH 2J4XA 3WOFA 4A3LG 1ZEQX 3DWPA 5I4DA 4DV4Q 2B3GA 3TMEA 2UXCQ 4K14A 4O0AA 4WORA 4MN3A 3ULLA 4DAPA 3F2BA 2NTSA 1UNSA 3GV3A 2JA5B 5M3MG 4JI1L 2B2WA 5KRUA 1PFBA 1E1OA 3CQZB 2UXBL 1WJJA 3OYYA 1PFSA 4ZK9B 4H0LC 1IBML 2RCNA 1TQOA 3LWEA 1LO5D 2BH2A 1GUGA 4A3KB 1EY0A 4RA8A 2UXBQ 4P75A 3MFYA 4GOPC 4A3KH 3I90A 3A0JA 3RZDB 4G57A 3E0JA 2PW5A 3H0GG 3H6MA 1S4ZA 2I0QA 5FO9B 3I8ZA 1GUSA 3M3YH 5EPKA 1ONLA 1YVCA 2KQ3A 2SNSA 1HQRD 3GTKB 1NE3A 3E3XA 1CQFA 3IKJA 4DR1Q 3T1HL 1HUNA 2VQFQ 2F3WA 2KHSA 1NBWA 4IALA 4A3MH 3PIP3 3FKIG 1J6QA 4R1JA 2AQ1B 3PO3B 2A19A 1CHPD 2KHIA 4HSPA 2YYZA 3HOYH 3FPUB 5L37A 4PZ7A 4O42A 4LW1A 4OONA 1NTGA 3M4YA 4JI7L 3PSIA 2N49A 3EN2A 1K83B 1JMCA 3KLRA 4YWKA 4PZ6A 1FGUA 2GN5A 4P73A 4R8NA 3KBXA 1AZPA 4C56C 3L7ZC 3K7UC 2R92H 1G2TA 3UDGA 1CZWA 4KJNA 1SROA 2F4IA 5IE8A 2XVSA 5JVH3 2L11A 3TP5A 1U4MA 1MHWC 1DCZA 4UP8A 1TWHH 4KLKA 4TRDA 5IT9L 1Q1BA 1UE6A 2ZTEA 2Z1CA 3NQIA 5M5YB 5D14A 3S15H 1HFGA 3GDEA 5EKLA 4DK0A 4PMWA 4JPBW 3S1QB 2PQAB 1L1OC 4L8JA 4C1NK 4C2MH 3LX0A 4H02A 1HZCA 2Y0SB 1J5EQ 5CMDA 2Z6BA 1A3UA 2WAQE 4HCEA 4LFBQ 1IW7C 5CGKA 3BYYB 5JOBA 4V190 4AQYQ 2RBMA 1J5EL 3KF6B 1EU4A 1O78A 3HOYG 2KA7A 3V96A 3OMGA 1RCVD 2K5NA 1CTMA 1MIUA 2MJ8A 3KK7A 1W2BA 4LAAA 4PQXA 2EDGA 1NSNS 2ZXPA 3J80c 3K57A 1NUCA 1C4QA 5GAHC 1W6KA 5IP7H 4A3DG 1LTLA 2FMMA 3I2ZA 1AW7A 3CMEA 1V8QA 5IYCG 1WCMB 1F9PA 2A69D 3BYTB 3KJPA 2Q8TA 5ELNA 1E1TA 3BVMA 1OO9B 3UE1A 1MJEA 2KJXA 4BXXH 2IY5B 1RL2A 1AZQA 2WB1E 4N9TA 4BY7G 4CJ0B 4GN3B 1YJWA 4LFBL 5GADC 4HJ5A 1NCVA 1XXGA 5CV4A 1B53A 2TSSA 1K8GA 5EQ0A 5G3LF 2PZTA 3BVZA 1EFWA 3F2CA 4LFAL 5HGTA 2N88A 1RHPA 5IYCH 2JEBI 4JYAL 4L63B 3HFZB 2I5MX 4A3MB 1MBYA 3CRLC 2L4NA 3DWAA 2YU9B 3J7AF 3I70A 3MFGA 2OT2A 3VR4A 2F0LA 3GTKH 3AMUA 4L5TA 4HJ8A 1B8AA 3JAMc 3OPOA 2C9OA 1QVGA 1EUJA 2GVAA 4IFDH 1NMFA 1R9TH 4JBJA 3K5NA 4DV2L 4LUZA 3CW2C 4G4KA 1F2MA 4OEMB 1TWCB 4Q0FA 4UDUC 2AUJD 4KKTA 1D7QA 4IFDI 2K7VA 2M2LA 4HTHA 1AEXA 4A3IH 2K04A 1BCPC 2F0HA 1BCPB 1TWAB 3K81C 4UP9A 2F03A 5C3EH 3A5ZB 1CM9A 3VR6A 4XTCS 4TVAB 1Q1EA 4BY7H 3S17B 3RLNA 3HKZE 3WDNA 2O5JC 4ODGA 5BN3A 4OO1H 1C0AA 4DV7L 1C48A 5I2YA 5IGEA 4C3HG 3S16H 4A3EB 2JA6H 2RVLA 2RDGA 1JE4A 5IWAQ 1SDFA 3HG9A 4QQBX 5TSSA 1EY6A 2F0OA 3GQBA 2UUCL 4LFCQ 2VB3X 1KLGD 1Q90A 1H9KA 4IPCA 4LF4L 1JJCB 3HOZH 4JBWA 1AH9A 3GTGH 4AYBG 4DV0L 1V1PA 2EIFA 4OGQC 1ILQA 1B3QA 2WKCA 4BXXG 2NWGA 1IL2A 2KVMA 4KV6A 1HR0L 3CKIB 1B1ZA 4DF7A 3SVMA 1IL8A 4QJFA 4DK3C 4A76A 5C0XG 1PH6A 2EYOA 2HD3A 4HIMA 1SE3A 2IX3A 3GTPH 5IP7G 1MKHA 3QG1A 3NPPA 2LY7A 1ENCA 1CQVA 2PZUA 4N8FA 4DR2L 2NZHA 2R7FA 1CZGA 1PTOB 2R7ZG 2VQEL 1X9NA 4KI0A 1A3TA 1YZ6A 2KCTA 5I9PA 4QY7A 5AFWA 4A3BB 1LT6D 4Y52H 1VQ6A 1M90C 1V1PB 2B39A 2RDFA 3CP0A 3I4MH 4HMIA 3HOWH 1A0IA 4WFN3 3GTMH 4CKEA 1B7YB 5M5XH 4B08A 3RNUA 1BUVT 1HZ9A 2KECA 3FKIH 2F4VQ 1EQTA 5DM63 1VQEA 3E9IA 3CCJA 1N33Q 1S5CD 3H15A 2N78A 3QJYA 3NK9A 3HKSA 1N32Q 1FVIA 3BG3A 2MQHA 4DPGA 3S9WA 1X6OA 3GTQH 5JEAH 1TY2A 4I65A 2PCFB 1WI5A 1YI2A 2OQKA 1DXMA 4JI4Q 4QUCA 1UE1A 4JI3L 4KN4C 2RA4A 4K5XA 3CHBD 1PFMA 3S2DH 1EY8A 4PV1C 2EYJA 2HUGA 4FF4A 1YHAA 3KLWA 5C6AA 1I50H 2CCZA 4A3CG 2JA5G 4J1MA 3FEWX 4YY3Q 1ENAA 1CI3M 2VB2X 5DNFA 3RMHA 4IOCA 4JV5L 3PUWA 5KEEA 4DV6L 1VMPA 5EAYA 2B63G 3ICEA 1R4PB 1N33L 2AKWB 1GUOA 2OQ0A 1HZBA 1F9QA 3S24A 1EYAA 1K8OA 1K3BC 2F0IA 2HIXA 2EY2A 3EA6A 1HH2P 1UEAB 4NPSA 1HR0W 2X69A 4L5RC 4KK7A 4XDXA 2E5LL 3S1MH 3A8IE 2ZT9C 2G5DA 1D8LA 2OF1A 5ELBA 2MHVA 1LUZA 2CQAA 3J81i 4DR6Q 1B44D 1U5KA 3Q0AA 4BWGB 4UHVA 2DJFC 4HJAA 2RDHA 3HOUG 1STBA 5E4XA 1BCPF 4YHHL 2CWAA 5IGCA 1YNXA 4IO9A 4JI6L 1Q8IA 2R3ZA 1XPUA 1LTGD 2PNRC 1SN8A 1JORA 5D3IB 3CCVA 2Z4HA 1JCKB 1NMGA 1XTCD 4ZUIA 1EQVA 1K0RA 3M7GA 4P74A 3HZXA 4C3IG 1QB5D 3A5UA 1L1OA 1V1QA 2RSOA 2L0CA 2E2JB 1VQ5A 2ZM6L 3CU7A 1VQLA 4K5WA 5CR3A 1EQRA 2RSNA 3KJOA 4Z9CB 2TMPA 1EQQA 4DV0Q 2NZ1D 3FP9A 3I3CA 3EROA 5CV8A 4IUUA 1E3PA 2ICIA 1RIPA 4IUTA 1EY9A 2DGYA 2MGSA 1S5ED 2A69C 1YJ9A 1I4XA 5CYUA 1TKWB 4OHJA 5C4JB 1W6JA 1PRTC 4DU9A 5BN4A 5C0XI 2KUMA 3CCUA 1D5MC 3C3LA 2EYHA 5D65A 1SYCA 1C8CA 3MZ5A 4WJWA 5M5XB 1LABA 2VL6A 2EY6A 1A3VA 4LFAQ 3HOUB 1UE7A 4GLXA 1XPOA 1VQGA 1JT8A 1VF5C 3TSSA 3RZOB 3RR5A 1R4QB 3TP7A 1L0YB 4LF5L 1YNJD 3OWFA 5LL6X 3PUZA 5C3XA 4FF3A 1CFMA 2NYZD 2HQEA 3PF4A 1SLJA 2F0TA 1EIFA 3U9OA 2JJQA 1WTXA 3CCLA 1IKLA 5E7NA 3NHHA 4LWCA 3GTPB 1XTDA 4MNOA 5AJ3L 1HCZA 3FMCA 1KRSA 4TQUS 4ZCKA 4CDEC 3QOLA 1EYGA 4DR4L 3HOUH 1HRJA 1ET9A 1IHZA 1TS3A 2B2UC 2F0JA 4RHSA 5BR8Q 1VQPA 3NE5B 2LSSA 4FP5D 4LF4Q 3OHXC 5C4XB 1EWIA 1WTQA 1AP0A 2D9UA 2F0MA 3AU7A 2JK8A 5M3FG 4EQ5A 3HOWB 3CPFA 1LTID 3SXHA 3HEJA 4C3IH 1HXYD 3U50C 2H5XA 5CV5A 1IBKQ 2NVYB 1G8ZD 1NAPA 3A8KE 1H95A 2FXQA 1XNRQ 5C4HA 2K5WA 3ITPA 4FXDA 1G6PA 3J80i 3S2HB 2DUDA 2RF4A 3S1NB 3HOXH 1Q7YC 4RCOA 3I4OA 1KXLA 3SHLA 1SYDA 2WB1B 4DUYL 1KAWA 2RKSA 1K28A 4ZYSA 3D6WA 5EBDA 1HA5A 1QUQA 2G9DA 5JPNC 1PH3A 5ELFA 1N8RC 1Q46A 1MI2A 2D0OA 3BJUA 3FHWA 3H3VC 3PUXA 4DV1Q 4JI3Q 1HHVA 2D5DA 3CAMA 2F0KA 5M9OA 2NBFA 4JI8Q 2IHFA 4QMGA 2BH8A 2E74C 4A93H 2KCCA 2Z0SA 1L0WA 3UDXA 3K5MA 1Y69U 3VYSA 3FDTA 4TSSA 2IPKD 3E6ZX 4QIWB 1D1IA 4F87A 4UPAA 1O7YA 2H1EA 2RQXA 1IW7D 3S1MB 5IGFA 1TU2B 2NVYH 4L5SA 2BOSA 1G2SA 2FINB 3WWVA 1UUPA 2B29A 1P8LA 4CGYB 1QCBD 2K75A 4N8X1 1HPCA 2UXCL 1STGA 5F2DA 3FKIB 2E76C 3J81j 3G4SA 4V0BA 3JAMi 4DV5L 5C0XJ 1VQKA 1TY0A 1QZHA 4A3BH 4BY7B 3E9HA 4GKKQ 1IBMQ 5C3EB 3FPPA 1WOCA 2F52A 1U9RA 2KBNA 3RLFA 1CSQA 1SNMA 3X3MA 2CH4A 2D2CC 4A3IB 4B3TL 3NBIA 1T9HA 1N36L 3S14H 4GKKL 2EJGC 4JI7Q 1LTAD 3EFXD 1TWCH 3HKZB 1KLUD 1D6EC 1GOZA 4KHPQ 4N9PA 4IPDA 5HURA 2KCMA 2E2HH 1S5DD 4LF8Q 1SNDA 2SOBA 4DAVA 2R93H 4LF6Q 4A3KG 2BA1A 4IPGA 4NP5A 4RH6A 1I4RA 3K6OA 1ICWA 4R4CA 5LMNL 3A8JE 3CXCA 1A63A 2R7DA 4DR5L 1UEBA 5ELDA 3RZOH 3RD4A 3I72A 3AB9A 4IFDG 3HOYB 1TS4A 1EEFD 3KF8B 4MZ9A 4APVA 1HA6A 2EYPA 1VQIA 1AE2A 3NUCA 5E3FA 1OXVA 3NSWA 3OIQA 1LTRD 2MP1A 3ND8A 1QVCA 4BY1G 3BDLA 1VDZA 2MO1A 4XIGS 3V2TA 3HKZG 2N3SA 2PYKA 1EOTA 4JI0Q 2HIVA 1PTOF 3LWUA 3I4NB 3TN2A 5LL6S 1HFNA 3DHQA 4AYBE 4DV7Q 3NTIA 2JP1A 1F2YA 4ZKBB 5C3EG 4IOAA 2UUAL 1XWEA 4GLVB 1HNZQ 2XIWA 1ICFB 4NXMQ 4AYBB 3A54A 3PIOA 1TWAH 4XT3B 2AHOB 1JOKA 4JI8L 4K2KA 5A35A 4FVMA 4BS9A 3QOJA 3D3RA 3UE0A 1OXTA 1X3EA 2VW9A 1SBBB 4J8QA 2DNCA 4RMFA 3LNNA 2V1CC 2PPBC 2EPBA 4E6IA 2VUMH 5EKKA 2QEXA 1A6XA 3J80L 3P75A 2YU9H 1RD9D 1GHJA 4EX5A 1LYLA 2OTLA 1SNQA 1CHQD 1IBKL 4HCSA 4DFAA 1AE3A 5M5WH 2UXDL 5IGGA 4DAYA 2JYOA 2QILA 3Q23A 1M4VA 3TQYA 3D6CA 2MFIA 2ES2A 1U4PA 4X65L 2KENA 4GN4B 4IUQA 4HJ7A 2O5IC 1SEBD 2WB1G 3W2DA 3ULJA 4MTKA 3G71A 4K8JA 5IODA 2HCCA 2YTYA 3TREA 4HN7A 2FFKB 4RGMA 2D0PA 3NTKA 3TS0A 2JA6B 4NW2A 1LTSD 4KHZA 4KMUC 4HIDA 1K8AC 4LF6L 2EYLA 2JQOA 3MAQA 1YNNC 2FHTA 1TIID 1CUKA 3C1EA 1TT2A 3T53B 5LMUL 3ER0A 1H9RA 4XYOA 1FD7D 4C3JB 1LM0A 3SK4A 3TEHB 2L1BA 1YBYA 4JV5Q 1PZID 3HOVH 4CDFC 3F2DA 5K36G 3N52A 2QDLA 2K1BA 1O7IA 4DR7Q 3GO5A 1PRTB 1BDOA 1SYEA 2X6GA 1SJED 4KY6A 1HR0Q 1JICA 1VQMA 2DN8A 1A62A 4ALPA 3D8GA 5IT9c 3T13A 1WTRA 1CKOA 5C0XH 1O80A 3GTQB 3J81c 2SNMA 3TS2A 4JCVE 4RWSC 4DXFA 4BY1B 3BS1A 4A3EH 1SYFA 4RFBA 3S16B 3NENA 4BY1H 5EPJA 3X3NA 1D5XC 2F0VA 2VY3A 3I91A 3MHBA 1YIJA 5GAGC 5IOCA 4X62L 3DM1A 1JE5A 3DWQA 2WAQG 3V05A 1LTTD 1T5XD 3HOWG 1NR2A 4A75A 5JEAG 2OEOA 1JJGA 2F4VL 2F3VA 2ID0A 3K7AB 1PH8A 2IL8A 4OWTB 4DV3L 4K0KQ 2ZJPA 2K03A 3Q22A 1YEZA 4R4OA 3F1ZA 1ZXTA 1QUQB 5C44B 5FO8B 4NXNL 1E2ZA 3EBEA 3EJIA 3PMFA 3E0EA 1XMOQ 1QILA 1CKNB 4FYDA 4YWMA 4ZLTF 2B2YC 2XNAC 3AEVA 4WJ3M 3H0GH 1VF7A 5I6WA 4K8IA 5HY6A 4FNFA 1XPRA 2K5QA 3K5OA 1Q12A 5D3DA 2R92B 2ENBA 1BBWA 1Y8NB 2F0SA 5EBCA 3U58A 1K83H 2KEEA 2PMZE 2HHHQ 3T4AC 2B63H 4X66Q 1ET6A 2I07B 3GTOB 2DJGC 1EYCA 3DLLA 2H4OA 1HNXQ 1N34L 1Z9FA 5LMNW 3K58A 1EY4A 5G3LD 3I7FA 2MNAA 1I5FA 1Y1WG 2JA7G 2UUBL 3M3YB 5JJLA 2IHEA 1WVLA 2JA7B 3ZJYC 4LMQD 3W5OA 5JVG3 1ESRA 4A4IA 2A8VA 1DOLA 2K50A 4EGVA 3NWSA 5IYBG 5FKAC 3VDYA 3S15B 1OXUA 4P2CB 2ZM6Q 3G6JB 2CW0C 3KYHC 1QWYA 1SMYD 5C3WA 3HGBA 1ZYRD 3CD6A 1PFNA 2Q8RE 2XWBB 4H13C 2JA8G 2R92G 2BA0A 3DXJC 1WFQA 1XMQL 1EU3A 1K3RA 2F0EA 3BZDB 4K5VA 3J7AV 5FLMH 4GOPB 2YTXA 1VQHA 1RDPD 2GA4B 1NR4A 4YIJA 2QGQA 4GN5A 3PIO3 1QOHA 4A93G 2RCFA 2OTJA 1R9TB 1PVOA 1GXDC 1B9MA 2BDNA 2HQLA 3DMUA 3NP8A 2UUBQ 3J81E 2F0QA 4A3FH 2F3IA 4A3JG 2AMCB 4KD4A 1VQ9A 5C4XG 4DV5Q 2XSCA 2NVXH 2WAQB 2EXDA 5HGQA 2Q2UA 3HOXG 1JOQA 5IGBA 4DR4Q 1EIHA 1KRTA 1PDQA 2KOLA 4S3SA 4B3RQ 4GKJQ 2NN6H 1DZ1A 4KTAA 3IFDA 5BR8L 1FR3A 4DA2A 4B3SQ 1AN8A 1HTLD 1CK1A 2VS1A 1WTHA 1DD2A 4ZRZA 1VS0A 4YWLA 4KY5A 3SK5A 1TWGH 3DUZA 1VQ4A 5E4WC 5AJ3Q 2VQEQ 3SEBA 5BN5A 1G51A 3W1GA 1L0XB 2MPMA 3BZKA 1N9WA 1EWCA 1OXSC 1VMCA 4J15A 2R93G 5CBAE 1RODA 2Q8IB 3J7ZC 2A6EC 2F1MA 1PH1A 3QWNA 5IY0A 1I3QH 1EOVA 1JQYD 3I56A 4OELB 2K33A 1PH4A 1Y1WB 3OOCA 4LF5Q 4H44C 5IGDA 3PO3H 5T1GA 4LF9L 4G7ZC 3KUPA 2Z8LA 4X3UA 1N32L 2R6GA 3VR2A 1XNRL 4DV4L 1PHJA 4OIKA 4DNRB 4B3RL 2JA7H 3Q24A 1EEID 4OO1I 2NB0A 3H3VI 1VQDA 4XYQA 4JC0A 1DOKA 3A74A 3I55A 3I4NH 1VQAA 3ERQA 4NDXA 3STBC 4IUPA 3GV6A 1V1OA 3H3VH 5COYA 2VUMB 5JJIA 1GUTA 4HJ9A 1EIYB 1VQCA 4K6DA 3VYTA 2OCEA 3M9BA 4K6LA 4DN4M 5M5YH 1TS2A 2KHJA 3BDCA 2GVBA 4JBKA 4PZ8A 1Y8PB 4DUZL 4A3DB 1PRTD 1VQBA 4BA2I 4BBRB 2Q2TA 4H7BA 2HHHL 2LFNA 2XTIA 3HS0C 3MWYW 5IT9E 4QB4A 1EL0A 1F9RA 2FJ2A 1ZYRC 4DV2Q 5C44H 5A2QE 1KD1C 4LJZC 3HOZG 4OWWB 3NWTA 4GNXC 4JI0L 1XNQQ 1X32A 3K0XA 1WTWA 4KHVA 3UDFA 3OTOQ 3OW2A 3K7AH 5KNBA 2CQOA 4NB3A 3PQIA 1KHIA 3I73A 2AWOA 4FF1A 1G6ZA 5KYIA 3MXUA 4YCVA 1X65A 1BQQT 1PH2A 3K5LA 4OX9L 4DR6L 4Q5VA 2C5CA 1S40A 5C4XH 4DR5Q 2NZOA 3KDFB 3C1FA 2JEAI 4HIKA 2NUCA 4KKSA 2B63B 4DAMA 3Q6SA 3CC4A 1SNOA 2E8GA 2IJ0A 3TRZA 5DM73 1KTKA 1Y1VG 2CVRA 3CCQA 4OX9Q 3I4NG 3CC2A 2OWOA 2Z6KA 4A3FB 3M4OB 2I5HA 2YV5A 3R2TA 1Z6HA 5I9OA 1HUMA 1RTNA 4AIMA 3PO2G 1EIGA 5JAVA 2A74C 1K0SA 1PYSB 1SYGA 4JI2L 1QE6A 2PQEA 1M8AA 1FGBD 2JA9A 3STBD 4POFA 1WTVA 5GAEC 2F0WA 4QGUA 1XNQL 1IYUA 1F2ZA 1PYBA 1QNKA 5CC4A 1TXYA 5FLXL 4CJ2C 4JW0A 2OXPA 3SGIA 1BR9A 2PZWA 5IIFA 2B2WC 1FYCA 1SMYC 4JI1Q 4BBRG 4C3JH 5FJ8H 1P16A 5FLXE 1A2TA 1KABA 2JA5H 4R4IA 3GTLH 3I4MG 1I4GA 4EVOA 4BBSB 2IX1A 4RGOS 2N8NA 3W3AA 4FF2A 1EZ6A 3TZUA 3EIVA 4DR3Q 5DLQE 2LXJA 3DEPA 2QKIC 2ZXOA 2JA8H 4B9XA 1F77A 3KDFA 1VQ7A 2EJFC 1EWHA 1PRTF 2ZJQA 1NNXA 4IUVA 3DM3A 3EQLC 4YCUA 1DYQA 1SFOB 1X3QA 1HNXL 2RHQB 5JPMC 1S5FD 1G91A 4I7ZC 4C3JG 3GTOH 2QEJC 4HIOA 1KQSA 1OTCA 4KJOA 5M5WB 2SDFA 1S5BD 4BA1I 1PLFA 3AFQA 1SRUA 3KLSX 5IP9G 3S1RB 3BDOA 4DR2Q 3MC0B 3R93A 1XMQQ 1QZGA 1Q3LA 3ULPA 5CV7A 1I6HH 1B4OA 2WFWA 4DGZA 3J7YW 2PI2E 3I4LA 4ULLA 3S14B 1C9OA 3R3OA 5C5LA 2Y0SG 5M3MB 1BO0A 5M3FH 1A15A 3NQTA 5FOBB 1Q86C 4B3TQ 3GTJB 2R93B 5FJ8G 5A2QL 3RLOA 1Y14B 5NUCA 2E2HB 2YTVA 1DGSA 2A6HD 5CV6A 4MIUA 4RGNA 3U4ZA 5GROA 4RCNA 1UWVA 1YNND 1CA6A 4KN7C 3OWEB 2A68D 1ILPA 2A68C 1JB7A 1I4QA 2M00A 1PH7A 3SK6A
chains in the Genus database with same CATH topology
1CUKA 3BU2A 1PHJA 3HOWH 1A0IA 2HT1A 3GTMH 5J3BA 1KL9A 1GD7A 3CCMA 1B7YB 1G291 5M5XH 5LMUL 3ER0A 4C3HH 3RNUA 3KFUA 1LM0A 3TEHB 4FDBA 1YBYA 4JV5Q 3RN2A 3HOVH 1HNWQ 1Q81C 1HZ9A 1S3OA 3FKIH 2F4VQ 3F2DA 5K36G 1VQEA 3E9IA 3AFPA 3CCJA 2RHSB 1O7IA 1IBLL 3CCRA 3GO5A 4LF9Q 4DV6Q 1N33Q 1FJGQ 4DR7Q 1NY4A 2N78A 3H15A 4DV3Q 4K0KL 1HR0Q 3HKSA 1VQMA 1N32Q 5FLMG 1A62A 4ALPA 1FVIA 1YITA 4JI4L 2MQHA 4DPGA 5IT9c 4JOIC 3ERSX 1SMXA 4X64Q 4R4QA 3CQZH 1IXRA 1X6OA 4DUYQ 3GTQH 1CKOA 1VQ8A 3NEMA 4P72A 3T1YQ 4A3FG 3J81c 1FJGL 4LF7Q 1WI5A 2Z6KC 1YI2A 2IX0A 3GD7A 3BZCA 3K8AA 3TS2A 2OQKA 4JCVE 4JI4Q 4A3IG 1UE1A 4JI3L 3HOVG 2WP8J 4A3EH 1Q8KA 3NENA 3CC7A 4BY1H 4R4TA 5JEAJ 1HJPA 4LF7L 1E22A 1X3FA 4GLAC 5H1SE 4YCWA 2AWNA 4YHHQ 3S2DH 2VY3A 1OXXK 4DNIA 4POGA 1YIJA 4RG1A 5GAGC 4YY3L 4P71A 1Y1WH 4X62L 4OXPA 2ZTCA 2VUMG 1JE5A 1U0LA 1YHAA 1GO3E 3KLWA 2WAQG 5LMUQ 1N34Q 1I50H 1VQNA 2MO0A 2CCZA 5FLXc 2C35B 2JA5G 4A3CG 2VNUD 3HOWG 4A75A 5JEAG 4YY3Q 2K5VA 1KIXA 1JJGA 2F4VL 1WCMG 3RZDH 4A3LH 3S1NH 4ME3A 4IOCA 2ID0A 2CKZB 3PUWA 4JV5L 2NN6I 2NVTH 1HNWL 1PH8A 4DV6L 3U4VA 4OWTB 5EAYA 4DV3L 2B63G 2ALYB 3ICEA 3M4QA 4K0KQ 2ZJPA 1IBLQ 1N33L 1YEZA 2EQSA 4R4OA 2AKWB 2K4KA 2OQ0A 3F1ZA 1HZBA 1QUQB 4NXNL 3S24A 3UDIA 4JI2Q 1K73C 2HIXA 3EBEA 3E0EA 2QA4A 1XMOQ 1BVSA 3IRBA 2A1AA 4Y7NH 1CKNB 1ASZA 1HH2P 4YWMA 4NPSA 1HR0W 1IZ6A 3AEVA 4WJ3M 3H0GH 4L5RC 1N36Q 5HY6A 4X65Q 1VCIA 4B3MQ 1XPRA 2E5LL 3S1MH 1Q12A 3RN5A 3PGZA 3CMAA 5IWAL 1D8LA 4JG2A 2E2IH 1LUZA 3J81i 4DR6Q 1U5KA 1BBWA 4LF8L 1NJIC 2UU9L 4UY8C 2IT1A 4KHPL 1GVPA 4HJAA 3U58A 1K83H 2PMZE 1PA6A 2HHHQ 2B63H 3HOUG 4X66Q 4YHHL 4B3ML 2CWAA 4A3JH 3KF6A 1PH9A 2NVQH 1YNXA 4X62Q 3DLLA 4IO9A 1HNXQ 4JI6L 1N34L 2JE6I 4JBMA 1Z9FA 5LMNW 1XPUA 3NBHB 2R7ZH 3M7NA 1SN8A 2CFMA 3CCVA 2MNAA 3I7FA 1I5FA 1A8VA 1SE8A 1NMGA 2Q2IA 1K9MC 2ASBA 3B6YA 4AH6A 1Y1WG 2JA7G 4WJ4A 2UUBL 2ZTDA 1KC8C 1K0RA 2IHEA 5JJLA 4P74A 2VQFL 4DUZQ 3A5UA 3ZJYC 1L1OA 3W5OA 3F8TA 1V1QA 4A4IA 2A8VA 1VQ5A 2K50A 2ZM6L 1UE5A 1VQLA 3S1QH 5IYBG 4A3LG 4DV4Q 4A3GH 2B3GA 3VDYA 2UXCQ 4O0AA 1EQRA 3ULLA 3KJOA 1SFOH 3S2HH 4LUVA 1X55A 4DK6C 3F2BA 1EQQA 1OXUA 4DV0Q 2ZM6Q 2VZAA 3FP9A 3KYHC 5M3MG 4JI1L 2UXBL 1E3PA 4X64L 1E1OA 1RIPA 3CD6A 1WJJA 2DGYA 3OYYA 3AYHB 1HNZL 1PFSA 4AQYL 2JA8G 1IBML 2R92G 2BA0A 2RCNA 1WFQA 2I5LX 1YJ9A 1XMQL 1BKBA 2BH2A 1K3RA 5FLMH 5C4JH 2UXBQ 1Q82C 4P75A 2K14A 4GOPC 3Q8DA 4GOPB 4A3KH 3A0JA 5C0XI 3CPWA 2YTXA 4O2DA 1VQHA 3CCUA 3PO2H 4BBSH 3H0GG 2QGQA 4GN5A 4A93G 2I0QA 2OTJA 2VL6A 4LFAQ 1PVOA 1UE7A 4GLXA 1XPOA 3M3YH 1YVCA 1VQGA 5GQOA 1JT8A 2HQLA 2UUBQ 3RR5A 4A3FH 2F3IA 1NE3A 5LMNQ 4DR1Q 4LF5L 5IYDG 1M1KC 3T1HL 4A3JG 2VQFQ 2AMCB 1VQ9A 5C4XG 3PUZA 1NBWA 4A3MH 4DV5Q 2NVXH 2EXDA 4UP7A 5HGQA 3FKIG 2Q2UA 1J6QA 1E24A 3HOXG 3PF4A 1SLJA 4R1JA 3CCEA 3L2PA 4DR4Q 2A19A 1EIFA 2KHIA 1KRTA 5IYBH 2JJQA 3CCLA 2YYZA 4B3RQ 2D62A 1FL0A 4GKJQ 3HOYH 5E7NA 5BR8L 3G48A 4LWCA 4PZ7A 4B3SQ 1XTDA 4MNOA 4LW1A 4OONA 5AJ3L 1XMOL 4A3BG 4JOIA 1NTGA 2VS1A 1KRSA 4TQUS 4JI7L 3PSIA 2N49A 5ELOA 1EYGA 1E7ZA 1VS0A 3CF5A 4DR4L 4YWLA 3EN2A 1TWGH 1VQ4A 1JMCA 4QL5A 3HOUH 5AJ3Q 4YWKA 4PZ6A 2VQEQ 1FGUA 4JYAQ 1G51A 2GN5A 4P73A 3W1GA 5BR8Q 5IP9H 3L7ZC 3BZKA 3K7UC 1VQPA 3UDGA 2R92H 2LSSA 4LF4Q 1EWIA 1SROA 1N9WA 1OXSC 4J15A 2R93G 2JK8A 5M3FG 4EQ5A 5IE8A 1BBUA 3J7ZC 1TWFH 3CPFA 1PH1A 3AQQA 4C3IH 3U50C 5IY0A 1V43A 1I3QH 2H5XA 1EOVA 1IBKQ 2ATWA 4UP8A 1TWHH 2Q2HA 4KLKA 4DAYB 3I56A 4LFCL 2UUCQ 1Q1BA 1PH4A 3MXNB 1UE6A 2FXQA 1XNRQ 2ZTEA 4OO1G 1H95A 4DR1L 4LF5Q 4X6AH 1G6PA 3PO3H 3J80i 4LF9L 3S15H 3GDEA 2DUDA 4GNXA 1W3SA 2RF4A 1JJ2A 1CKNA 4PMWA 5IYDH 1N32L 2R6GA 1XNRL 2PQAB 1L1OC 2XGTA 1L1OB 3I4OA 5M3MH 3HOXH 4DV4L 1Q7YC 1CSPA 1WYDA 4C2MH 1KXLA 4B3RL 2JA7H 4H02A 1HZCA 4DUYL 4IPHA 4OO1I 1VQJA 4DV1L 1J5EQ 3H3VI 1KAWA 1VQDA 2WAQE 4B3SL 4LFBQ 4JC0A 1PH3A 1QUQA 4NXML 4IJHA 1N8RC 3T1YL 1Q46A 2D0OA 3A74A 3I55A 3S1RH 3BJUA 4AQYQ 3I4NH 1VQAA 3FHWA 3PUXA 3STBC 4DV1Q 1J5EL 4JI3Q 3KF6B 4IJLA 3CAMA 3H3VH 1PV4A 3HOYG 4JI8Q 2IHFA 2BH8A 1ASYA 4A93H 5JJIA 2K5NA 1MIUA 2Z0SA 1W2BA 1L0WA 4HJ9A 1EIYB 1VQCA 3UDXA 2OCEA 3M9BA 1HZAA 5M5YH 2KHJA 2L15A 2GVBA 4UPAA 4JBKA 4PZ8A 4PG3A 3J80c 4DUZL 3D0FA 2NVYH 1VQBA 4L5QA 5GAHC 4A3DG 2PNHA 1X3GA 5IP7H 1LTLA 4L5SA 3I2ZA 3M4PA 2Q2TA 4BA2I 3CMEA 1S72A 2HHHL 4BBSG 3WWVA 5IYCG 2XTIA 2B29A 1P8LA 2K75A 4X66L 2UXCL 3PIPA 3KJPA 5ELNA 1E1TA 4DV2Q 5C44H 3J81j 3G4SA 1KD1C 3JAMi 3HOZG 1AH9A 4DV5L 4OWWB 3GTGH 5C0XJ 4JI0L 3UE1A 4GNXC 1MJEA 1VQKA 2E2JH 1XNQQ 1XJVA 3K0XA 1QZHA 4A3BH 3UDFA 4BXXH 2IY5B 3OTOQ 1RL2A 3D31A 3E9HA 3K7AH 2WB1E 3OW2A 4BY7G 1IBMQ 4GKKQ 4OWXB 2CQOA 2Y0SE 4GN3B 1WOCA 4NB3A 1YJWA 4LFBL 2F52A 1KHIA 5GADC 2KBNA 4A3CH 3RLFA 2AWOA 4HJ5A 1CSQA 3KOJA 3JC66 4B3TL 3OTOL 3J7A5 1T9HA 4YCVA 1N36L 1X65A 3S14H 4GKKL 1GM5A 1K8GA 1PH2A 3W1BA 1I94L 4JI7Q 4OX9L 4DR6L 1TWCH 1S40A 5C4XH 4DR5Q 2NZOA 3KDFB 1EFWA 4GKJL 2JEAI 4HIKA 4KHPQ 4IPDA 4IFDJ 3F2CA 2KCMA 2JA6G 2E2HH 1SR3A 4LF8Q 1CKMA 4LFAL 4DAMA 5IYCH 2R93H 2JEBI 4LF6Q 4JYAL 4MTNA 4A3KG 3HFZB 2I5MX 2BA1A 1I94Q 1IYJB 3CC4A 2E8GA 4IPGA 2CWPA 3TRZA 5JJKA 1Y1VG 4BBRH 4R4CA 3CCQA 4OX9Q 3I4NG 5LMNL 3CC2A 3CXCA 2OWOA 2Z6KA 1L2FA 2R7DA 4DR5L 3GTKH 4L5TA 1UEBA 4HJ8A 1B8AA 3RZOH 2I5HA 3JAMc 2YV5A 1QVGA 2K52A 4IFDG 1EUJA 4AIMA 3KF8B 2GVAA 2ZJRA 4GNXB 3PO2G 4MZ9A 4APVA 1PYSB 3PCOB 4JI2L 1NMFA 1YHBA 1VQIA 1MJCA 2JA9A 4JBJA 3STBD 4POFA 1AE2A 1R9TH 4DV2L 5GAEC 1OXVA 4QGUA 4LUZA 3CW2C 1VQFA 2LXKA 1XNQL 1QVCA 4BY1G 1PYBA 2MO1A 4XIGS 1D7QA 1TXYA 2N3SA 3HKZG 4JI0Q 4IFDI 2HIVA 4A3IH 1X54A 1X56A 2UUAQ 3K81C 4UP9A 3SGIA 4AYBE 4DV7Q 4A3MG 4LUOA 2UXDQ 1Y1VH 4JI1Q 4BBRG 4C3JH 5C3EH 5FJ8H 3A5ZB 3PUVA 3S17H 1P16A 4TVAB 4XTCS 1V9PA 1Q1EA 4BY7H 5C3EG 4IOAA 2UUAL 4GLVB 4QIWE 4DR3L 1HNZQ 3RLNA 2JA5H 1A63A 4R4IA 4NXMQ 3HKZE 3GTLH 3I4MG 1Z47A 3PIOA 2IX1A 1TWAH 2N8NA 1C0AA 4DV7L 2AHOB 3EIVA 4DR3Q 4JI8L 5DLQE 3S16H 1WCMH 2JA6H 2LXJA 5IWAQ 4QQBX 2JA8H 3KDFA 1VQ7A 4A3DH 3UE0A 2VW9A 1OXTA 1X3EA 2UUCL 4LFCQ 2ZJQA 4IPCA 4RMFA 3DM3A 4YCUA 4LF4L 2V1CC 1JJCB 3HOZH 4JBWA 3M4OH 2K5HA 2NN6G 2RHQB 4AYBG 2EIFA 5C44G 4DV0L 1YJNA 1HNXL 4JI6Q 3LGJA 2VUMH 2QEXA 3GTOH 3MEFA 3PUYA 4HIOA 1OTCA 1KQSA 4GS3A 4BXXG 2YU9H 4DR7L 1IL2A 4BA1I 3PV0A 4EX5A 2OTLA 1LYLA 3AFQA 1SRUA 5IP9G 1C7YA 1HR0L 4NXNQ 1IBKL 4DR2Q 3L0OA 1AE3A 1XMQQ 5M5WH 3K80C 1QZGA 2UXDL 3ULPA 4QJFA 4DK3C 4A76A 1I6HH 4A3EG 5C0XG 2WFWA 4GOPA 3TQYA 3NELA 2PI2E 3CCSA 4HIMA 1VQOA 2PI2A 1PH6A 2MFIA 2ES2A 4LNQA 1C9OA 4X65L 3GTPH 5IP7G 2KENA 4JI5L 2Y0SG 1MKHA 4GN4B 2E5LQ 4HJ7A 1B70B 2WB1G 2PQAA 3ULJA 5M3FH 1Q86C 4DR2L 4B3TQ 2NZHA 3G71A 2R7FA 3PF5A 1QVFA 5FJ8G 2UU9Q 2R7ZG 1YHQA 2VQEL 3RLOA 1Y14B 2YTYA 4KI0A 1X9NA 4DKAC 1YZ6A 1GKHA 2KCTA 3G6EA 2YTVA 4QY7A 1DGSA 3TREA 2D0PA 4Y52H 3TS0A 1VQ6A 3U4ZA 5GROA 3M85A 4JI5Q 4A3GG 1UWVA 1PH5A 4KHZA 1M90C 4HIDA 1K8AC 4LF6L 2JQOA 3T1HQ 1JB7A 3GTJH 3CP0A 3PO3G 3I4MH 1PH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CUK A;  3BU2 A;  1PHJ A;  3HOW H;  1A0I A;  2HT1 A;  3GTM H;  5J3B A;  1KL9 A;  1GD7 A;  3CCM A;  1B7Y B;  1G29 1;  5M5X H;  5LMU L;  3ER0 A;  4C3H H;  3RNU A;  3KFU A;  1LM0 A;  3TEH B;  4FDB A;  1YBY A;  4JV5 Q;  3RN2 A;  3HOV H;  1HNW Q;  1Q81 C;  1HZ9 A;  1S3O A;  3FKI H;  2F4V Q;  3F2D A;  5K36 G;  1VQE A;  3E9I A;  3AFP A;  3CCJ A;  2RHS B;  1O7I A;  1IBL L;  3CCR A;  3GO5 A;  4LF9 Q;  4DV6 Q;  1N33 Q;  1FJG Q;  4DR7 Q;  1NY4 A;  2N78 A;  3H15 A;  4DV3 Q;  4K0K L;  1HR0 Q;  3HKS A;  1VQM A;  1N32 Q;  5FLM G;  1A62 A;  4ALP A;  1FVI A;  1YIT A;  4JI4 L;  2MQH A;  4DPG A;  5IT9 c;  4JOI C;  3ERS X;  1SMX A;  4X64 Q;  4R4Q A;  3CQZ H;  1IXR A;  1X6O A;  4DUY Q;  3GTQ H;  1CKO A;  1VQ8 A;  3NEM A;  4P72 A;  3T1Y Q;  4A3F G;  3J81 c;  1FJG L;  4LF7 Q;  1WI5 A;  2Z6K C;  1YI2 A;  2IX0 A;  3GD7 A;  3BZC A;  3K8A A;  3TS2 A;  2OQK A;  4JCV E;  4JI4 Q;  4A3I G;  1UE1 A;  4JI3 L;  3HOV G;  2WP8 J;  4A3E H;  1Q8K A;  3NEN A;  3CC7 A;  4BY1 H;  4R4T A;  5JEA J;  1HJP A;  4LF7 L;  1E22 A;  1X3F A;  4GLA C;  5H1S E;  4YCW A;  2AWN A;  4YHH Q;  3S2D H;  2VY3 A;  1OXX K;  4DNI A;  4POG A;  1YIJ A;  4RG1 A;  5GAG C;  4YY3 L;  4P71 A;  1Y1W H;  4X62 L;  4OXP A;  2ZTC A;  2VUM G;  1JE5 A;  1U0L A;  1YHA A;  1GO3 E;  3KLW A;  2WAQ G;  5LMU Q;  1N34 Q;  1I50 H;  1VQN A;  2MO0 A;  2CCZ A;  5FLX c;  2C35 B;  2JA5 G;  4A3C G;  2VNU D;  3HOW G;  4A75 A;  5JEA G;  4YY3 Q;  2K5V A;  1KIX A;  1JJG A;  2F4V L;  1WCM G;  3RZD H;  4A3L H;  3S1N H;  4ME3 A;  4IOC A;  2ID0 A;  2CKZ B;  3PUW A;  4JV5 L;  2NN6 I;  2NVT H;  1HNW L;  1PH8 A;  4DV6 L;  3U4V A;  4OWT B;  5EAY A;  4DV3 L;  2B63 G;  2ALY B;  3ICE A;  3M4Q A;  4K0K Q;  2ZJP A;  1IBL Q;  1N33 L;  1YEZ A;  2EQS A;  4R4O A;  2AKW B;  2K4K A;  2OQ0 A;  3F1Z A;  1HZB A;  1QUQ B;  4NXN L;  3S24 A;  3UDI A;  4JI2 Q;  1K73 C;  2HIX A;  3EBE A;  3E0E A;  2QA4 A;  1XMO Q;  1BVS A;  3IRB A;  2A1A A;  4Y7N H;  1CKN B;  1ASZ A;  1HH2 P;  4YWM A;  4NPS A;  1HR0 W;  1IZ6 A;  3AEV A;  4WJ3 M;  3H0G H;  4L5R C;  1N36 Q;  5HY6 A;  4X65 Q;  1VCI A;  4B3M Q;  1XPR A;  2E5L L;  3S1M H;  1Q12 A;  3RN5 A;  3PGZ A;  3CMA A;  5IWA L;  1D8L A;  4JG2 A;  2E2I H;  1LUZ A;  3J81 i;  4DR6 Q;  1U5K A;  1BBW A;  4LF8 L;  1NJI C;  2UU9 L;  4UY8 C;  2IT1 A;  4KHP L;  1GVP A;  4HJA A;  3U58 A;  1K83 H;  2PMZ E;  1PA6 A;  2HHH Q;  2B63 H;  3HOU G;  4X66 Q;  4YHH L;  4B3M L;  2CWA A;  4A3J H;  3KF6 A;  1PH9 A;  2NVQ H;  1YNX A;  4X62 Q;  3DLL A;  4IO9 A;  1HNX Q;  4JI6 L;  1N34 L;  2JE6 I;  4JBM A;  1Z9F A;  5LMN W;  1XPU A;  3NBH B;  2R7Z H;  3M7N A;  1SN8 A;  2CFM A;  3CCV A;  2MNA A;  3I7F A;  1I5F A;  1A8V A;  1SE8 A;  1NMG A;  2Q2I A;  1K9M C;  2ASB A;  3B6Y A;  4AH6 A;  1Y1W G;  2JA7 G;  4WJ4 A;  2UUB L;  2ZTD A;  1KC8 C;  1K0R A;  2IHE A;  5JJL A;  4P74 A;  2VQF L;  4DUZ Q;  3A5U A;  3ZJY C;  1L1O A;  3W5O A;  3F8T A;  1V1Q A;  4A4I A;  2A8V A;  1VQ5 A;  2K50 A;  2ZM6 L;  1UE5 A;  1VQL A;  3S1Q H;  5IYB G;  4A3L G;  4DV4 Q;  4A3G H;  2B3G A;  3VDY A;  2UXC Q;  4O0A A;  1EQR A;  3ULL A;  3KJO A;  1SFO H;  3S2H H;  4LUV A;  1X55 A;  4DK6 C;  3F2B A;  1EQQ A;  1OXU A;  4DV0 Q;  2ZM6 Q;  2VZA A;  3FP9 A;  3KYH C;  5M3M G;  4JI1 L;  2UXB L;  1E3P A;  4X64 L;  1E1O A;  1RIP A;  3CD6 A;  1WJJ A;  2DGY A;  3OYY A;  3AYH B;  1HNZ L;  1PFS A;  4AQY L;  2JA8 G;  1IBM L;  2R92 G;  2BA0 A;  2RCN A;  1WFQ A;  2I5L X;  1YJ9 A;  1XMQ L;  1BKB A;  2BH2 A;  1K3R A;  5FLM H;  5C4J H;  2UXB Q;  1Q82 C;  4P75 A;  2K14 A;  4GOP C;  3Q8D A;  4GOP B;  4A3K H;  3A0J A;  5C0X I;  3CPW A;  2YTX A;  4O2D A;  1VQH A;  3CCU A;  3PO2 H;  4BBS H;  3H0G G;  2QGQ A;  4GN5 A;  4A93 G;  2I0Q A;  2OTJ A;  2VL6 A;  4LFA Q;  1PVO A;  1UE7 A;  4GLX A;  1XPO A;  3M3Y H;  1YVC A;  1VQG A;  5GQO A;  1JT8 A;  2HQL A;  2UUB Q;  3RR5 A;  4A3F H;  2F3I A;  1NE3 A;  5LMN Q;  4DR1 Q;  4LF5 L;  5IYD G;  1M1K C;  3T1H L;  4A3J G;  2VQF Q;  2AMC B;  1VQ9 A;  5C4X G;  3PUZ A;  1NBW A;  4A3M H;  4DV5 Q;  2NVX H;  2EXD A;  4UP7 A;  5HGQ A;  3FKI G;  2Q2U A;  1J6Q A;  1E24 A;  3HOX G;  3PF4 A;  1SLJ A;  4R1J A;  3CCE A;  3L2P A;  4DR4 Q;  2A19 A;  1EIF A;  2KHI A;  1KRT A;  5IYB H;  2JJQ A;  3CCL A;  2YYZ A;  4B3R Q;  2D62 A;  1FL0 A;  4GKJ Q;  3HOY H;  5E7N A;  5BR8 L;  3G48 A;  4LWC A;  4PZ7 A;  4B3S Q;  1XTD A;  4MNO A;  4LW1 A;  4OON A;  5AJ3 L;  1XMO L;  4A3B G;  4JOI A;  1NTG A;  2VS1 A;  1KRS A;  4TQU S;  4JI7 L;  3PSI A;  2N49 A;  5ELO A;  1EYG A;  1E7Z A;  1VS0 A;  3CF5 A;  4DR4 L;  4YWL A;  3EN2 A;  1TWG H;  1VQ4 A;  1JMC A;  4QL5 A;  3HOU H;  5AJ3 Q;  4YWK A;  4PZ6 A;  2VQE Q;  1FGU A;  4JYA Q;  1G51 A;  2GN5 A;  4P73 A;  3W1G A;  5BR8 Q;  5IP9 H;  3L7Z C;  3BZK A;  3K7U C;  1VQP A;  3UDG A;  2R92 H;  2LSS A;  4LF4 Q;  1EWI A;  1SRO A;  1N9W A;  1OXS C;  4J15 A;  2R93 G;  2JK8 A;  5M3F G;  4EQ5 A;  5IE8 A;  1BBU A;  3J7Z C;  1TWF H;  3CPF A;  1PH1 A;  3AQQ A;  4C3I H;  3U50 C;  5IY0 A;  1V43 A;  1I3Q H;  2H5X A;  1EOV A;  1IBK Q;  2ATW A;  4UP8 A;  1TWH H;  2Q2H A;  4KLK A;  4DAY B;  3I56 A;  4LFC L;  2UUC Q;  1Q1B A;  1PH4 A;  3MXN B;  1UE6 A;  2FXQ A;  1XNR Q;  2ZTE A;  4OO1 G;  1H95 A;  4DR1 L;  4LF5 Q;  4X6A H;  1G6P A;  3PO3 H;  3J80 i;  4LF9 L;  3S15 H;  3GDE A;  2DUD A;  4GNX A;  1W3S A;  2RF4 A;  1JJ2 A;  1CKN A;  4PMW A;  5IYD H;  1N32 L;  2R6G A;  1XNR L;  2PQA B;  1L1O C;  2XGT A;  1L1O B;  3I4O A;  5M3M H;  3HOX H;  4DV4 L;  1Q7Y C;  1CSP A;  1WYD A;  4C2M H;  1KXL A;  4B3R L;  2JA7 H;  4H02 A;  1HZC A;  4DUY L;  4IPH A;  4OO1 I;  1VQJ A;  4DV1 L;  1J5E Q;  3H3V I;  1KAW A;  1VQD A;  2WAQ E;  4B3S L;  4LFB Q;  4JC0 A;  1PH3 A;  1QUQ A;  4NXM L;  4IJH A;  1N8R C;  3T1Y L;  1Q46 A;  2D0O A;  3A74 A;  3I55 A;  3S1R H;  3BJU A;  4AQY Q;  3I4N H;  1VQA A;  3FHW A;  3PUX A;  3STB C;  4DV1 Q;  1J5E L;  4JI3 Q;  3KF6 B;  4IJL A;  3CAM A;  3H3V H;  1PV4 A;  3HOY G;  4JI8 Q;  2IHF A;  2BH8 A;  1ASY A;  4A93 H;  5JJI A;  2K5N A;  1MIU A;  2Z0S A;  1W2B A;  1L0W A;  4HJ9 A;  1EIY B;  1VQC A;  3UDX A;  2OCE A;  3M9B A;  1HZA A;  5M5Y H;  2KHJ A;  2L15 A;  2GVB A;  4UPA A;  4JBK A;  4PZ8 A;  4PG3 A;  3J80 c;  4DUZ L;  3D0F A;  2NVY H;  1VQB A;  4L5Q A;  5GAH C;  4A3D G;  2PNH A;  1X3G A;  5IP7 H;  1LTL A;  4L5S A;  3I2Z A;  3M4P A;  2Q2T A;  4BA2 I;  3CME A;  1S72 A;  2HHH L;  4BBS G;  3WWV A;  5IYC G;  2XTI A;  2B29 A;  1P8L A;  2K75 A;  4X66 L;  2UXC L;  3PIP A;  3KJP A;  5ELN A;  1E1T A;  4DV2 Q;  5C44 H;  3J81 j;  3G4S A;  1KD1 C;  3JAM i;  3HOZ G;  1AH9 A;  4DV5 L;  4OWW B;  3GTG H;  5C0X J;  4JI0 L;  3UE1 A;  4GNX C;  1MJE A;  1VQK A;  2E2J H;  1XNQ Q;  1XJV A;  3K0X A;  1QZH A;  4A3B H;  3UDF A;  4BXX H;  2IY5 B;  3OTO Q;  1RL2 A;  3D31 A;  3E9H A;  3K7A H;  2WB1 E;  3OW2 A;  4BY7 G;  1IBM Q;  4GKK Q;  4OWX B;  2CQO A;  2Y0S E;  4GN3 B;  1WOC A;  4NB3 A;  1YJW A;  4LFB L;  2F52 A;  1KHI A;  5GAD C;  2KBN A;  4A3C H;  3RLF A;  2AWO A;  4HJ5 A;  1CSQ A;  3KOJ A;  3JC6 6;  4B3T L;  3OTO L;  3J7A 5;  1T9H A;  4YCV A;  1N36 L;  1X65 A;  3S14 H;  4GKK L;  1GM5 A;  1K8G A;  1PH2 A;  3W1B A;  1I94 L;  4JI7 Q;  4OX9 L;  4DR6 L;  1TWC H;  1S40 A;  5C4X H;  4DR5 Q;  2NZO A;  3KDF B;  1EFW A;  4GKJ L;  2JEA I;  4HIK A;  4KHP Q;  4IPD A;  4IFD J;  3F2C A;  2KCM A;  2JA6 G;  2E2H H;  1SR3 A;  4LF8 Q;  1CKM A;  4LFA L;  4DAM A;  5IYC H;  2R93 H;  2JEB I;  4LF6 Q;  4JYA L;  4MTN A;  4A3K G;  3HFZ B;  2I5M X;  2BA1 A;  1I94 Q;  1IYJ B;  3CC4 A;  2E8G A;  4IPG A;  2CWP A;  3TRZ A;  5JJK A;  1Y1V G;  4BBR H;  4R4C A;  3CCQ A;  4OX9 Q;  3I4N G;  5LMN L;  3CC2 A;  3CXC A;  2OWO A;  2Z6K A;  1L2F A;  2R7D A;  4DR5 L;  3GTK H;  4L5T A;  1UEB A;  4HJ8 A;  1B8A A;  3RZO H;  2I5H A;  3JAM c;  2YV5 A;  1QVG A;  2K52 A;  4IFD G;  1EUJ A;  4AIM A;  3KF8 B;  2GVA A;  2ZJR A;  4GNX B;  3PO2 G;  4MZ9 A;  4APV A;  1PYS B;  3PCO B;  4JI2 L;  1NMF A;  1YHB A;  1VQI A;  1MJC A;  2JA9 A;  4JBJ A;  3STB D;  4POF A;  1AE2 A;  1R9T H;  4DV2 L;  5GAE C;  1OXV A;  4QGU A;  4LUZ A;  3CW2 C;  1VQF A;  2LXK A;  1XNQ L;  1QVC A;  4BY1 G;  1PYB A;  2MO1 A;  4XIG S;  1D7Q A;  1TXY A;  2N3S A;  3HKZ G;  4JI0 Q;  4IFD I;  2HIV A;  4A3I H;  1X54 A;  1X56 A;  2UUA Q;  3K81 C;  4UP9 A;  3SGI A;  4AYB E;  4DV7 Q;  4A3M G;  4LUO A;  2UXD Q;  1Y1V H;  4JI1 Q;  4BBR G;  4C3J H;  5C3E H;  5FJ8 H;  3A5Z B;  3PUV A;  3S17 H;  1P16 A;  4TVA B;  4XTC S;  1V9P A;  1Q1E A;  4BY7 H;  5C3E G;  4IOA A;  2UUA L;  4GLV B;  4QIW E;  4DR3 L;  1HNZ Q;  3RLN A;  2JA5 H;  1A63 A;  4R4I A;  4NXM Q;  3HKZ E;  3GTL H;  3I4M G;  1Z47 A;  3PIO A;  2IX1 A;  1TWA H;  2N8N A;  1C0A A;  4DV7 L;  2AHO B;  3EIV A;  4DR3 Q;  4JI8 L;  5DLQ E;  3S16 H;  1WCM H;  2JA6 H;  2LXJ A;  5IWA Q;  4QQB X;  2JA8 H;  3KDF A;  1VQ7 A;  4A3D H;  3UE0 A;  2VW9 A;  1OXT A;  1X3E A;  2UUC L;  4LFC Q;  2ZJQ A;  4IPC A;  4RMF A;  3DM3 A;  4YCU A;  4LF4 L;  2V1C C;  1JJC B;  3HOZ H;  4JBW A;  3M4O H;  2K5H A;  2NN6 G;  2RHQ B;  4AYB G;  2EIF A;  5C44 G;  4DV0 L;  1YJN A;  1HNX L;  4JI6 Q;  3LGJ A;  2VUM H;  2QEX A;  3GTO H;  3MEF A;  3PUY A;  4HIO A;  1OTC A;  1KQS A;  4GS3 A;  4BXX G;  2YU9 H;  4DR7 L;  1IL2 A;  4BA1 I;  3PV0 A;  4EX5 A;  2OTL A;  1LYL A;  3AFQ A;  1SRU A;  5IP9 G;  1C7Y A;  1HR0 L;  4NXN Q;  1IBK L;  4DR2 Q;  3L0O A;  1AE3 A;  1XMQ Q;  5M5W H;  3K80 C;  1QZG A;  2UXD L;  3ULP A;  4QJF A;  4DK3 C;  4A76 A;  1I6H H;  4A3E G;  5C0X G;  2WFW A;  4GOP A;  3TQY A;  3NEL A;  2PI2 E;  3CCS A;  4HIM A;  1VQO A;  2PI2 A;  1PH6 A;  2MFI A;  2ES2 A;  4LNQ A;  1C9O A;  4X65 L;  3GTP H;  5IP7 G;  2KEN A;  4JI5 L;  2Y0S G;  1MKH A;  4GN4 B;  2E5L Q;  4HJ7 A;  1B70 B;  2WB1 G;  2PQA A;  3ULJ A;  5M3F H;  1Q86 C;  4DR2 L;  4B3T Q;  2NZH A;  3G71 A;  2R7F A;  3PF5 A;  1QVF A;  5FJ8 G;  2UU9 Q;  2R7Z G;  1YHQ A;  2VQE L;  3RLO A;  1Y14 B;  2YTY A;  4KI0 A;  1X9N A;  4DKA C;  1YZ6 A;  1GKH A;  2KCT A;  3G6E A;  2YTV A;  4QY7 A;  1DGS A;  3TRE A;  2D0P A;  4Y52 H;  3TS0 A;  1VQ6 A;  3U4Z A;  5GRO A;  3M85 A;  4JI5 Q;  4A3G G;  1UWV A;  1PH5 A;  4KHZ A;  1M90 C;  4HID A;  1K8A C;  4LF6 L;  2JQO A;  3T1H Q;  1JB7 A;  3GTJ H;  3CP0 A;  3PO3 G;  3I4M H;  1PH7 A; 
#chains in the Genus database with same CATH topology
 4DXG A;  1TWF B;  5J3B A;  2DY8 A;  3CCM A;  1G29 1;  1SNC A;  4C3H H;  2K5D A;  3KFU A;  2B2V A;  1STN A;  1HNW Q;  3RN2 A;  1S3O A;  4ZUJ A;  4OIJ A;  4PMC A;  1STE A;  3IAY A;  1T5E A;  5DEH A;  5KIX A;  2F0F A;  3AFP A;  2RHS B;  1IBL L;  4LF9 Q;  3CCR A;  4K2L A;  2EXZ A;  4DV6 Q;  1FJG Q;  1NY4 A;  3KF8 A;  3MTS A;  4FXG C;  4X64 Q;  4R4Q A;  1ENF A;  3NEM A;  4P72 A;  3T1Y Q;  4A3F G;  1KDA A;  2WV6 D;  5LHY 1;  2BCO A;  2Z6K C;  3GP7 A;  2IX0 A;  3K8A A;  3BZC A;  1TVX A;  1EZ8 A;  3EVQ A;  4A93 B;  4A3I G;  3HOV G;  2WP8 J;  2LKV A;  4XXE A;  5T1I A;  4R4T A;  1HJP A;  4GLA C;  1E22 A;  1QG7 A;  1X3F A;  5H1S E;  2XWJ B;  4YHH Q;  3OMC A;  4EQN A;  4POG A;  2QDB A;  4P71 A;  4OXP A;  2ZTC A;  5CBE E;  3CRK C;  4IN3 A;  5LMU Q;  1U0L A;  1VQN A;  1GO3 E;  4OL7 A;  2C35 B;  5FLX c;  1I6V C;  1SXT A;  4C3I B;  1H9S A;  2NTT A;  1J9O A;  1STY A;  3S1N H;  2NN6 I;  2NVT H;  4B9W A;  3D4R A;  3U4V A;  2L9H A;  2EE1 A;  4CJ1 B;  2ALY B;  4CDC C;  1IBL Q;  4ZQ3 A;  2K4K A;  4MHE A;  1AFP A;  2K28 A;  3UDI A;  4JI2 Q;  4O1N A;  1K73 C;  2J0T D;  2QA4 A;  3NXW A;  2B2V C;  2AQ2 B;  2B2U A;  3IRB A;  2A1A A;  4Y7N H;  3H91 A;  1IZ6 A;  1STH A;  4RKB A;  2F0D A;  3F2U A;  4X65 Q;  3CMA A;  1U4R A;  4JVZ A;  5IWA L;  4JG2 A;  2E2I H;  4LF8 L;  4UY8 C;  4KHP L;  4KD3 A;  1GVP A;  2Z4I A;  1PA6 A;  1BXT A;  2G9H D;  4XQJ A;  4ME5 A;  2MUY A;  2N55 A;  4HED A;  2X6L A;  2HCI A;  4B3M L;  1WTO A;  3KF6 A;  1PH9 A;  2NVQ H;  1HQM C;  3H09 A;  3BVG A;  1I50 B;  2L12 A;  2JE6 I;  1O7L A;  2M9V A;  1JWU D;  1KDB A;  3NBH B;  2R7Z H;  4RKL A;  3SK8 A;  2CFM A;  2NVQ B;  1IYV A;  2O2L D;  5EPL A;  1SE8 A;  3NTH A;  1K9M C;  3B6Y A;  2ZTD A;  1KC8 C;  3IFT A;  4DUZ Q;  5J39 A;  3HOX B;  3OIP A;  1FNU A;  4PMB A;  1UE5 A;  4HR7 B;  4QF4 A;  2EY1 A;  1H9M A;  4A3G H;  4X3S A;  1QJO A;  3S2H H;  2E2D C;  3P7J A;  1SFO H;  4LUV A;  1X55 A;  4DK6 C;  3KLS A;  1WTP A;  2CHB D;  4Y7N B;  2VZA A;  4X64 L;  3AYH B;  1HNZ L;  4AQY L;  1BCP D;  1Y1V B;  4U67 3;  2I5L X;  1BKB A;  2WKD A;  1DON A;  4RHR A;  5C4J H;  1Q82 C;  2K14 A;  3Q8D A;  1TR5 A;  3OSO A;  3CPW A;  4O2D A;  4TKO B;  3PO2 H;  4BBS H;  5EKI A;  5KND A;  4RAU C;  5KYL A;  1SYB A;  4F88 A;  4FO2 A;  4DK1 A;  4LK1 C;  4R9W A;  5GQO A;  2A6H C;  2K32 A;  2EOT A;  2JSO A;  2K6A A;  5LMN Q;  1MD2 D;  5IYD G;  1M1K C;  3NBH A;  2B2T C;  3TZD A;  4UP7 A;  1E24 A;  5ELE A;  1J8I A;  3SDZ A;  3OW7 A;  3CCE A;  3L2P A;  2L55 A;  1X3P A;  3MA2 B;  1SE2 A;  1TS5 A;  2F0U A;  1JC7 A;  5IYB H;  5M3F B;  4C1N I;  2D62 A;  1FL0 A;  1QNU A;  3G48 A;  1PMR A;  1XMO L;  4A3B G;  4JOI A;  1MSH A;  4PNY A;  5ELO A;  1SAP A;  1E7Z A;  1SSO A;  3CF5 A;  3ND9 A;  4QL5 A;  2WIN B;  1B2T A;  3JAM L;  2QW7 A;  4I7A A;  4JYA Q;  3TP6 A;  2E2I B;  1E2W A;  5IP9 H;  5K36 H;  2A6E D;  2FMC A;  4CKC A;  4RGT A;  3GTG B;  3O13 A;  1JWS D;  2VXW A;  2HDL A;  1BBU A;  1PZK D;  4ABN A;  1TWF H;  5DAU A;  3AQQ A;  3ZYY X;  1DOM A;  1V43 A;  3MEH A;  2IWH A;  4M1U B;  2A73 B;  4IZ8 A;  2JXM B;  2ATW A;  1JB3 A;  3A7L A;  2Q2H A;  4DAY B;  4LFC L;  2ZXR A;  2UUC Q;  1Y8O B;  3MXN B;  4OO1 G;  4DR1 L;  1EY7 A;  1HTP A;  4X6A H;  4X3T A;  4ID6 A;  4GNX A;  1W3S A;  1JJ2 A;  2AUK A;  1CKN A;  1ZKO A;  5EJW A;  5IYD H;  5FK9 C;  5J22 A;  4XQN A;  1KNA A;  2XGT A;  1L1O B;  5M3M H;  1CSP A;  1WYD A;  1RTO A;  4IPH A;  1VQJ A;  4DV1 L;  2F0P A;  4B3S L;  1B3A A;  3D4W A;  3QR8 A;  4NXM L;  4IJH A;  1Z7T A;  3T1Y L;  1H9J A;  3S1R H;  2R7Z B;  5I2X A;  1XX8 A;  2XRS D;  2SEB D;  4IJL A;  4JK1 C;  1PV4 A;  3PO2 B;  3U9S A;  1ASY A;  4KY7 A;  4XT1 B;  3URY A;  1BNZ A;  1GUN A;  1HZA A;  4ILW A;  2L15 A;  1JOO A;  3A55 A;  3VA7 A;  2CH4 W;  4PG3 A;  2EYF A;  3D0F A;  3K59 A;  2K01 A;  1GHK A;  1MGS A;  4L5Q A;  2PNH A;  1X3G A;  2B2Y A;  3M4P A;  1KAA A;  1S72 A;  2P5Z X;  1SNP A;  4M8A A;  2R61 A;  4X66 L;  3PIP A;  3T51 B;  4A3G B;  4HMJ A;  3VR5 A;  4NMZ A;  5COR A;  2F0G A;  2CW0 D;  1H9S B;  2E2J H;  1XJV A;  3HRZ C;  3D31 A;  2NVT B;  4XQQ A;  3GTM B;  4OWX B;  2Y0S E;  1PZJ D;  3G7L A;  4A3C H;  2DNE A;  3KOJ A;  4F7X A;  1EFI D;  3JC6 6;  1FNW A;  1LT4 D;  3OTO L;  3J7A 5;  3TDQ A;  1GUW A;  1GM5 A;  1I4H A;  3W1B A;  1F2L A;  1PTO D;  1I94 L;  3VA5 A;  3J80 E;  1U4L A;  4IFD J;  2JA6 G;  3SR1 A;  1BF4 A;  1SR3 A;  1CKM A;  2EZV A;  5KNC A;  4MTN A;  1YNJ C;  1I94 Q;  1IYJ B;  2CWP A;  2DY7 A;  3R8B A;  5JJK A;  4BBR H;  5I6Y A;  1L2F A;  3QIA A;  4GZY C;  5FO7 B;  2K52 A;  4GNX B;  2ZJR A;  3PCO B;  5ISR A;  1WD1 A;  1YHB A;  5KGU A;  1MJC A;  1LAC A;  3J81 L;  1VQF A;  2LXK A;  1PXU A;  3RUZ A;  2KCN A;  4HSV A;  1JR0 D;  1DJR D;  1KNE A;  1X54 A;  1X56 A;  2UUA Q;  2AQ3 B;  1F9S A;  4EQP A;  4A3M G;  4LUO A;  2UXD Q;  1Y1V H;  3MXG A;  3GTL B;  3SE0 A;  3PUV A;  3S17 H;  2EJM A;  3ONA B;  2KED A;  1V9P A;  1RF2 D;  4QIW E;  4DR3 L;  1MSG A;  1XYI A;  1Z47 A;  2B8F A;  3HP3 A;  1KDC A;  3S2D B;  3JAM E;  4WRD A;  4IQZ A;  5E1F A;  3T16 A;  1WCM H;  3DEO A;  3C46 A;  1E2V A;  4A3D H;  1PTO H;  1LT5 D;  3T56 B;  3L9A X;  4QCL A;  3M4O H;  2K5H A;  2NN6 G;  4J6H A;  2BE5 D;  5C44 G;  1YJN A;  4JI6 Q;  4BBS G;  4WJ4 A;  3LGJ A;  3MEF A;  3PUY A;  4GS3 A;  5CV9 A;  4DR7 L;  4IUR A;  3PV0 A;  4EQO A;  1C7Y A;  4NXN Q;  3UI2 A;  3L0O A;  3K80 C;  4A3E G;  3IL8 A;  1ESF A;  4GOP A;  3NEL A;  3CCS A;  1E0B A;  4C3H B;  1VQO A;  2PI2 A;  4GKJ L;  4LNQ A;  3HOZ B;  4C2M B;  4JI5 L;  4U68 A;  2HDM A;  2E5L Q;  1B70 B;  2PQA A;  3R2I A;  4A3J B;  2PW7 A;  5K5P A;  1K8M A;  3PF5 A;  1QVF A;  2A5H A;  2UU9 Q;  1YHQ A;  4FXK C;  4DKA C;  1GKH A;  3G6E A;  3P20 A;  2Z9H A;  1LT3 D;  3M85 A;  4JI5 Q;  3TBI B;  4A3G G;  1LLR D;  1PH5 A;  3E5S A;  1FNV A;  3MXN A;  5C5M A;  1EY5 A;  3N6R A;  3T1H Q;  1I3Q B;  3GTJ H;  4UAI A;  3PO3 G;  3BU2 A;  3KBG A;  2HT1 A;  2QF7 A;  3L3O C;  1KL9 A;  1GD7 A;  2PMZ B;  3MXP A;  3A7A B;  1I6H B;  4FDB A;  5EGT A;  2I46 A;  1Q81 C;  1GJX A;  1II3 A;  4R8I A;  2WII B;  3A56 A;  4QUF A;  4DV3 Q;  4L6T B;  4K0K L;  4HAE A;  3TP8 A;  5FLM G;  1YIT A;  4JI4 L;  3H94 A;  2J7Z A;  2PO4 A;  1SE4 A;  4JOI C;  1D2B A;  3ERS X;  1SMX A;  3CQZ H;  2LS0 1;  1IXR A;  1CT1 D;  2E75 C;  4DUY Q;  1VQ8 A;  1CA5 A;  1FJG L;  4LF7 Q;  2BE5 C;  2F0N A;  3GD7 A;  1O7Z A;  4KKU A;  1DM0 B;  5J1Z A;  4NKL A;  1Q8K A;  4ZAI A;  1EYD A;  2B2T A;  3CC7 A;  5JEA J;  3FVQ A;  4LF7 L;  2XRQ D;  1IKM A;  3K0Y A;  1STA A;  4YCW A;  2AWN A;  1OXX K;  4DNI A;  3P1H A;  2IW3 A;  4RG1 A;  4YY3 L;  1LTB D;  1Y1W H;  1I4P A;  2XN9 C;  3D4D A;  2VUM G;  1N34 Q;  3WOE A;  1TWH B;  1B50 A;  2MO0 A;  2LMC B;  2EYM A;  2VNU D;  1RJT A;  4F8M A;  2K5V A;  1KIX A;  3I4M B;  1WCM G;  3RZD H;  4A3L H;  4ME3 A;  3QB3 A;  1HNW L;  2CKZ B;  4CBV A;  3VYR A;  2V4D A;  3M4Q A;  2EQS A;  3HOV B;  4CDD C;  1D5Z C;  4CHT B;  3H0G B;  1BOS A;  4G7H C;  1BVS A;  1ASZ A;  1SJH D;  2QCP X;  1N36 Q;  4CKB A;  1VCI A;  2B8G A;  4B3M Q;  2JN4 A;  5ELC A;  1PYW D;  3RN5 A;  3PGZ A;  1A2U A;  4DNT B;  3VYU A;  3MVV A;  2K05 A;  2ICE C;  1NJI C;  2UU9 L;  2IT1 A;  3C2P A;  1TWG B;  1RKN A;  2EVB A;  5JJZ A;  3QO2 A;  4G7O C;  4A3J H;  2BDO A;  4X62 Q;  4X3K A;  4IUN A;  4JBM A;  1LV9 A;  2O4X A;  1WD0 A;  2EY5 A;  4ZKC B;  3M7N A;  3VR3 A;  1D1K A;  1JWM D;  1BBX C;  1UAP A;  1A8V A;  2Q2I A;  1B9N A;  1PTO C;  2WAC A;  4AH6 A;  3FRP B;  2ASB A;  2VQF L;  2JA8 B;  2NVX B;  3F8T A;  1ML0 D;  2L5T A;  5C4Z A;  3S1Q H;  2J4X A;  3WOF A;  4A3L G;  1ZEQ X;  3DWP A;  5I4D A;  4DV4 Q;  2B3G A;  3TME A;  2UXC Q;  4K14 A;  4O0A A;  4WOR A;  4MN3 A;  3ULL A;  4DAP A;  3F2B A;  2NTS A;  1UNS A;  3GV3 A;  2JA5 B;  5M3M G;  4JI1 L;  2B2W A;  5KRU A;  1PFB A;  1E1O A;  3CQZ B;  2UXB L;  1WJJ A;  3OYY A;  1PFS A;  4ZK9 B;  4H0L C;  1IBM L;  2RCN A;  1TQO A;  3LWE A;  1LO5 D;  2BH2 A;  1GUG A;  4A3K B;  1EY0 A;  4RA8 A;  2UXB Q;  4P75 A;  3MFY A;  4GOP C;  4A3K H;  3I90 A;  3A0J A;  3RZD B;  4G57 A;  3E0J A;  2PW5 A;  3H0G G;  3H6M A;  1S4Z A;  2I0Q A;  5FO9 B;  3I8Z A;  1GUS A;  3M3Y H;  5EPK A;  1ONL A;  1YVC A;  2KQ3 A;  2SNS A;  1HQR D;  3GTK B;  1NE3 A;  3E3X A;  1CQF A;  3IKJ A;  4DR1 Q;  3T1H L;  1HUN A;  2VQF Q;  2F3W A;  2KHS A;  1NBW A;  4IAL A;  4A3M H;  3PIP 3;  3FKI G;  1J6Q A;  4R1J A;  2AQ1 B;  3PO3 B;  2A19 A;  1CHP D;  2KHI A;  4HSP A;  2YYZ A;  3HOY H;  3FPU B;  5L37 A;  4PZ7 A;  4O42 A;  4LW1 A;  4OON A;  1NTG A;  3M4Y A;  4JI7 L;  3PSI A;  2N49 A;  3EN2 A;  1K83 B;  1JMC A;  3KLR A;  4YWK A;  4PZ6 A;  1FGU A;  2GN5 A;  4P73 A;  4R8N A;  3KBX A;  1AZP A;  4C56 C;  3L7Z C;  3K7U C;  2R92 H;  1G2T A;  3UDG A;  1CZW A;  4KJN A;  1SRO A;  2F4I A;  5IE8 A;  2XVS A;  5JVH 3;  2L11 A;  3TP5 A;  1U4M A;  1MHW C;  1DCZ A;  4UP8 A;  1TWH H;  4KLK A;  4TRD A;  5IT9 L;  1Q1B A;  1UE6 A;  2ZTE A;  2Z1C A;  3NQI A;  5M5Y B;  5D14 A;  3S15 H;  1HFG A;  3GDE A;  5EKL A;  4DK0 A;  4PMW A;  4JPB W;  3S1Q B;  2PQA B;  1L1O C;  4L8J A;  4C1N K;  4C2M H;  3LX0 A;  4H02 A;  1HZC A;  2Y0S B;  1J5E Q;  5CMD A;  2Z6B A;  1A3U A;  2WAQ E;  4HCE A;  4LFB Q;  1IW7 C;  5CGK A;  3BYY B;  5JOB A;  4V19 0;  4AQY Q;  2RBM A;  1J5E L;  3KF6 B;  1EU4 A;  1O78 A;  3HOY G;  2KA7 A;  3V96 A;  3OMG A;  1RCV D;  2K5N A;  1CTM A;  1MIU A;  2MJ8 A;  3KK7 A;  1W2B A;  4LAA A;  4PQX A;  2EDG A;  1NSN S;  2ZXP A;  3J80 c;  3K57 A;  1NUC A;  1C4Q A;  5GAH C;  1W6K A;  5IP7 H;  4A3D G;  1LTL A;  2FMM A;  3I2Z A;  1AW7 A;  3CME A;  1V8Q A;  5IYC G;  1WCM B;  1F9P A;  2A69 D;  3BYT B;  3KJP A;  2Q8T A;  5ELN A;  1E1T A;  3BVM A;  1OO9 B;  3UE1 A;  1MJE A;  2KJX A;  4BXX H;  2IY5 B;  1RL2 A;  1AZQ A;  2WB1 E;  4N9T A;  4BY7 G;  4CJ0 B;  4GN3 B;  1YJW A;  4LFB L;  5GAD C;  4HJ5 A;  1NCV A;  1XXG A;  5CV4 A;  1B53 A;  2TSS A;  1K8G A;  5EQ0 A;  5G3L F;  2PZT A;  3BVZ A;  1EFW A;  3F2C A;  4LFA L;  5HGT A;  2N88 A;  1RHP A;  5IYC H;  2JEB I;  4JYA L;  4L63 B;  3HFZ B;  2I5M X;  4A3M B;  1MBY A;  3CRL C;  2L4N A;  3DWA A;  2YU9 B;  3J7A F;  3I70 A;  3MFG A;  2OT2 A;  3VR4 A;  2F0L A;  3GTK H;  3AMU A;  4L5T A;  4HJ8 A;  1B8A A;  3JAM c;  3OPO A;  2C9O A;  1QVG A;  1EUJ A;  2GVA A;  4IFD H;  1NMF A;  1R9T H;  4JBJ A;  3K5N A;  4DV2 L;  4LUZ A;  3CW2 C;  4G4K A;  1F2M A;  4OEM B;  1TWC B;  4Q0F A;  4UDU C;  2AUJ D;  4KKT A;  1D7Q A;  4IFD I;  2K7V A;  2M2L A;  4HTH A;  1AEX A;  4A3I H;  2K04 A;  1BCP C;  2F0H A;  1BCP B;  1TWA B;  3K81 C;  4UP9 A;  2F03 A;  5C3E H;  3A5Z B;  1CM9 A;  3VR6 A;  4XTC S;  4TVA B;  1Q1E A;  4BY7 H;  3S17 B;  3RLN A;  3HKZ E;  3WDN A;  2O5J C;  4ODG A;  5BN3 A;  4OO1 H;  1C0A A;  4DV7 L;  1C48 A;  5I2Y A;  5IGE A;  4C3H G;  3S16 H;  4A3E B;  2JA6 H;  2RVL A;  2RDG A;  1JE4 A;  5IWA Q;  1SDF A;  3HG9 A;  4QQB X;  5TSS A;  1EY6 A;  2F0O A;  3GQB A;  2UUC L;  4LFC Q;  2VB3 X;  1KLG D;  1Q90 A;  1H9K A;  4IPC A;  4LF4 L;  1JJC B;  3HOZ H;  4JBW A;  1AH9 A;  3GTG H;  4AYB G;  4DV0 L;  1V1P A;  2EIF A;  4OGQ C;  1ILQ A;  1B3Q A;  2WKC A;  4BXX G;  2NWG A;  1IL2 A;  2KVM A;  4KV6 A;  1HR0 L;  3CKI B;  1B1Z A;  4DF7 A;  3SVM A;  1IL8 A;  4QJF A;  4DK3 C;  4A76 A;  5C0X G;  1PH6 A;  2EYO A;  2HD3 A;  4HIM A;  1SE3 A;  2IX3 A;  3GTP H;  5IP7 G;  1MKH A;  3QG1 A;  3NPP A;  2LY7 A;  1ENC A;  1CQV A;  2PZU A;  4N8F A;  4DR2 L;  2NZH A;  2R7F A;  1CZG A;  1PTO B;  2R7Z G;  2VQE L;  1X9N A;  4KI0 A;  1A3T A;  1YZ6 A;  2KCT A;  5I9P A;  4QY7 A;  5AFW A;  4A3B B;  1LT6 D;  4Y52 H;  1VQ6 A;  1M90 C;  1V1P B;  2B39 A;  2RDF A;  3CP0 A;  3I4M H;  4HMI A;  3HOW H;  1A0I A;  4WFN 3;  3GTM H;  4CKE A;  1B7Y B;  5M5X H;  4B08 A;  3RNU A;  1BUV T;  1HZ9 A;  2KEC A;  3FKI H;  2F4V Q;  1EQT A;  5DM6 3;  1VQE A;  3E9I A;  3CCJ A;  1N33 Q;  1S5C D;  3H15 A;  2N78 A;  3QJY A;  3NK9 A;  3HKS A;  1N32 Q;  1FVI A;  3BG3 A;  2MQH A;  4DPG A;  3S9W A;  1X6O A;  3GTQ H;  5JEA H;  1TY2 A;  4I65 A;  2PCF B;  1WI5 A;  1YI2 A;  2OQK A;  1DXM A;  4JI4 Q;  4QUC A;  1UE1 A;  4JI3 L;  4KN4 C;  2RA4 A;  4K5X A;  3CHB D;  1PFM A;  3S2D H;  1EY8 A;  4PV1 C;  2EYJ A;  2HUG A;  4FF4 A;  1YHA A;  3KLW A;  5C6A A;  1I50 H;  2CCZ A;  4A3C G;  2JA5 G;  4J1M A;  3FEW X;  4YY3 Q;  1ENA A;  1CI3 M;  2VB2 X;  5DNF A;  3RMH A;  4IOC A;  4JV5 L;  3PUW A;  5KEE A;  4DV6 L;  1VMP A;  5EAY A;  2B63 G;  3ICE A;  1R4P B;  1N33 L;  2AKW B;  1GUO A;  2OQ0 A;  1HZB A;  1F9Q A;  3S24 A;  1EYA A;  1K8O A;  1K3B C;  2F0I A;  2HIX A;  2EY2 A;  3EA6 A;  1HH2 P;  1UEA B;  4NPS A;  1HR0 W;  2X69 A;  4L5R C;  4KK7 A;  4XDX A;  2E5L L;  3S1M H;  3A8I E;  2ZT9 C;  2G5D A;  1D8L A;  2OF1 A;  5ELB A;  2MHV A;  1LUZ A;  2CQA A;  3J81 i;  4DR6 Q;  1B44 D;  1U5K A;  3Q0A A;  4BWG B;  4UHV A;  2DJF C;  4HJA A;  2RDH A;  3HOU G;  1STB A;  5E4X A;  1BCP F;  4YHH L;  2CWA A;  5IGC A;  1YNX A;  4IO9 A;  4JI6 L;  1Q8I A;  2R3Z A;  1XPU A;  1LTG D;  2PNR C;  1SN8 A;  1JOR A;  5D3I B;  3CCV A;  2Z4H A;  1JCK B;  1NMG A;  1XTC D;  4ZUI A;  1EQV A;  1K0R A;  3M7G A;  4P74 A;  3HZX A;  4C3I G;  1QB5 D;  3A5U A;  1L1O A;  1V1Q A;  2RSO A;  2L0C A;  2E2J B;  1VQ5 A;  2ZM6 L;  3CU7 A;  1VQL A;  4K5W A;  5CR3 A;  1EQR A;  2RSN A;  3KJO A;  4Z9C B;  2TMP A;  1EQQ A;  4DV0 Q;  2NZ1 D;  3FP9 A;  3I3C A;  3ERO A;  5CV8 A;  4IUU A;  1E3P A;  2ICI A;  1RIP A;  4IUT A;  1EY9 A;  2DGY A;  2MGS A;  1S5E D;  2A69 C;  1YJ9 A;  1I4X A;  5CYU A;  1TKW B;  4OHJ A;  5C4J B;  1W6J A;  1PRT C;  4DU9 A;  5BN4 A;  5C0X I;  2KUM A;  3CCU A;  1D5M C;  3C3L A;  2EYH A;  5D65 A;  1SYC A;  1C8C A;  3MZ5 A;  4WJW A;  5M5X B;  1LAB A;  2VL6 A;  2EY6 A;  1A3V A;  4LFA Q;  3HOU B;  1UE7 A;  4GLX A;  1XPO A;  1VQG A;  1JT8 A;  1VF5 C;  3TSS A;  3RZO B;  3RR5 A;  1R4Q B;  3TP7 A;  1L0Y B;  4LF5 L;  1YNJ D;  3OWF A;  5LL6 X;  3PUZ A;  5C3X A;  4FF3 A;  1CFM A;  2NYZ D;  2HQE A;  3PF4 A;  1SLJ A;  2F0T A;  1EIF A;  3U9O A;  2JJQ A;  1WTX A;  3CCL A;  1IKL A;  5E7N A;  3NHH A;  4LWC A;  3GTP B;  1XTD A;  4MNO A;  5AJ3 L;  1HCZ A;  3FMC A;  1KRS A;  4TQU S;  4ZCK A;  4CDE C;  3QOL A;  1EYG A;  4DR4 L;  3HOU H;  1HRJ A;  1ET9 A;  1IHZ A;  1TS3 A;  2B2U C;  2F0J A;  4RHS A;  5BR8 Q;  1VQP A;  3NE5 B;  2LSS A;  4FP5 D;  4LF4 Q;  3OHX C;  5C4X B;  1EWI A;  1WTQ A;  1AP0 A;  2D9U A;  2F0M A;  3AU7 A;  2JK8 A;  5M3F G;  4EQ5 A;  3HOW B;  3CPF A;  1LTI D;  3SXH A;  3HEJ A;  4C3I H;  1HXY D;  3U50 C;  2H5X A;  5CV5 A;  1IBK Q;  2NVY B;  1G8Z D;  1NAP A;  3A8K E;  1H95 A;  2FXQ A;  1XNR Q;  5C4H A;  2K5W A;  3ITP A;  4FXD A;  1G6P A;  3J80 i;  3S2H B;  2DUD A;  2RF4 A;  3S1N B;  3HOX H;  1Q7Y C;  4RCO A;  3I4O A;  1KXL A;  3SHL A;  1SYD A;  2WB1 B;  4DUY L;  1KAW A;  2RKS A;  1K28 A;  4ZYS A;  3D6W A;  5EBD A;  1HA5 A;  1QUQ A;  2G9D A;  5JPN C;  1PH3 A;  5ELF A;  1N8R C;  1Q46 A;  1MI2 A;  2D0O A;  3BJU A;  3FHW A;  3H3V C;  3PUX A;  4DV1 Q;  4JI3 Q;  1HHV A;  2D5D A;  3CAM A;  2F0K A;  5M9O A;  2NBF A;  4JI8 Q;  2IHF A;  4QMG A;  2BH8 A;  2E74 C;  4A93 H;  2KCC A;  2Z0S A;  1L0W A;  3UDX A;  3K5M A;  1Y69 U;  3VYS A;  3FDT A;  4TSS A;  2IPK D;  3E6Z X;  4QIW B;  1D1I A;  4F87 A;  4UPA A;  1O7Y A;  2H1E A;  2RQX A;  1IW7 D;  3S1M B;  5IGF A;  1TU2 B;  2NVY H;  4L5S A;  2BOS A;  1G2S A;  2FIN B;  3WWV A;  1UUP A;  2B29 A;  1P8L A;  4CGY B;  1QCB D;  2K75 A;  4N8X 1;  1HPC A;  2UXC L;  1STG A;  5F2D A;  3FKI B;  2E76 C;  3J81 j;  3G4S A;  4V0B A;  3JAM i;  4DV5 L;  5C0X J;  1VQK A;  1TY0 A;  1QZH A;  4A3B H;  4BY7 B;  3E9H A;  4GKK Q;  1IBM Q;  5C3E B;  3FPP A;  1WOC A;  2F52 A;  1U9R A;  2KBN A;  3RLF A;  1CSQ A;  1SNM A;  3X3M A;  2CH4 A;  2D2C C;  4A3I B;  4B3T L;  3NBI A;  1T9H A;  1N36 L;  3S14 H;  4GKK L;  2EJG C;  4JI7 Q;  1LTA D;  3EFX D;  1TWC H;  3HKZ B;  1KLU D;  1D6E C;  1GOZ A;  4KHP Q;  4N9P A;  4IPD A;  5HUR A;  2KCM A;  2E2H H;  1S5D D;  4LF8 Q;  1SND A;  2SOB A;  4DAV A;  2R93 H;  4LF6 Q;  4A3K G;  2BA1 A;  4IPG A;  4NP5 A;  4RH6 A;  1I4R A;  3K6O A;  1ICW A;  4R4C A;  5LMN L;  3A8J E;  3CXC A;  1A63 A;  2R7D A;  4DR5 L;  1UEB A;  5ELD A;  3RZO H;  3RD4 A;  3I72 A;  3AB9 A;  4IFD G;  3HOY B;  1TS4 A;  1EEF D;  3KF8 B;  4MZ9 A;  4APV A;  1HA6 A;  2EYP A;  1VQI A;  1AE2 A;  3NUC A;  5E3F A;  1OXV A;  3NSW A;  3OIQ A;  1LTR D;  2MP1 A;  3ND8 A;  1QVC A;  4BY1 G;  3BDL A;  1VDZ A;  2MO1 A;  4XIG S;  3V2T A;  3HKZ G;  2N3S A;  2PYK A;  1EOT A;  4JI0 Q;  2HIV A;  1PTO F;  3LWU A;  3I4N B;  3TN2 A;  5LL6 S;  1HFN A;  3DHQ A;  4AYB E;  4DV7 Q;  3NTI A;  2JP1 A;  1F2Y A;  4ZKB B;  5C3E G;  4IOA A;  2UUA L;  1XWE A;  4GLV B;  1HNZ Q;  2XIW A;  1ICF B;  4NXM Q;  4AYB B;  3A54 A;  3PIO A;  1TWA H;  4XT3 B;  2AHO B;  1JOK A;  4JI8 L;  4K2K A;  5A35 A;  4FVM A;  4BS9 A;  3QOJ A;  3D3R A;  3UE0 A;  1OXT A;  1X3E A;  2VW9 A;  1SBB B;  4J8Q A;  2DNC A;  4RMF A;  3LNN A;  2V1C C;  2PPB C;  2EPB A;  4E6I A;  2VUM H;  5EKK A;  2QEX A;  1A6X A;  3J80 L;  3P75 A;  2YU9 H;  1RD9 D;  1GHJ A;  4EX5 A;  1LYL A;  2OTL A;  1SNQ A;  1CHQ D;  1IBK L;  4HCS A;  4DFA A;  1AE3 A;  5M5W H;  2UXD L;  5IGG A;  4DAY A;  2JYO A;  2QIL A;  3Q23 A;  1M4V A;  3TQY A;  3D6C A;  2MFI A;  2ES2 A;  1U4P A;  4X65 L;  2KEN A;  4GN4 B;  4IUQ A;  4HJ7 A;  2O5I C;  1SEB D;  2WB1 G;  3W2D A;  3ULJ A;  4MTK A;  3G71 A;  4K8J A;  5IOD A;  2HCC A;  2YTY A;  3TRE A;  4HN7 A;  2FFK B;  4RGM A;  2D0P A;  3NTK A;  3TS0 A;  2JA6 B;  4NW2 A;  1LTS D;  4KHZ A;  4KMU C;  4HID A;  1K8A C;  4LF6 L;  2EYL A;  2JQO A;  3MAQ A;  1YNN C;  2FHT A;  1TII D;  1CUK A;  3C1E A;  1TT2 A;  3T53 B;  5LMU L;  3ER0 A;  1H9R A;  4XYO A;  1FD7 D;  4C3J B;  1LM0 A;  3SK4 A;  3TEH B;  2L1B A;  1YBY A;  4JV5 Q;  1PZI D;  3HOV H;  4CDF C;  3F2D A;  5K36 G;  3N52 A;  2QDL A;  2K1B A;  1O7I A;  4DR7 Q;  3GO5 A;  1PRT B;  1BDO A;  1SYE A;  2X6G A;  1SJE D;  4KY6 A;  1HR0 Q;  1JIC A;  1VQM A;  2DN8 A;  1A62 A;  4ALP A;  3D8G A;  5IT9 c;  3T13 A;  1WTR A;  1CKO A;  5C0X H;  1O80 A;  3GTQ B;  3J81 c;  2SNM A;  3TS2 A;  4JCV E;  4RWS C;  4DXF A;  4BY1 B;  3BS1 A;  4A3E H;  1SYF A;  4RFB A;  3S16 B;  3NEN A;  4BY1 H;  5EPJ A;  3X3N A;  1D5X C;  2F0V A;  2VY3 A;  3I91 A;  3MHB A;  1YIJ A;  5GAG C;  5IOC A;  4X62 L;  3DM1 A;  1JE5 A;  3DWQ A;  2WAQ G;  3V05 A;  1LTT D;  1T5X D;  3HOW G;  1NR2 A;  4A75 A;  5JEA G;  2OEO A;  1JJG A;  2F4V L;  2F3V A;  2ID0 A;  3K7A B;  1PH8 A;  2IL8 A;  4OWT B;  4DV3 L;  4K0K Q;  2ZJP A;  2K03 A;  3Q22 A;  1YEZ A;  4R4O A;  3F1Z A;  1ZXT A;  1QUQ B;  5C44 B;  5FO8 B;  4NXN L;  1E2Z A;  3EBE A;  3EJI A;  3PMF A;  3E0E A;  1XMO Q;  1QIL A;  1CKN B;  4FYD A;  4YWM A;  4ZLT F;  2B2Y C;  2XNA C;  3AEV A;  4WJ3 M;  3H0G H;  1VF7 A;  5I6W A;  4K8I A;  5HY6 A;  4FNF A;  1XPR A;  2K5Q A;  3K5O A;  1Q12 A;  5D3D A;  2R92 B;  2ENB A;  1BBW A;  1Y8N B;  2F0S A;  5EBC A;  3U58 A;  1K83 H;  2KEE A;  2PMZ E;  2HHH Q;  3T4A C;  2B63 H;  4X66 Q;  1ET6 A;  2I07 B;  3GTO B;  2DJG C;  1EYC A;  3DLL A;  2H4O A;  1HNX Q;  1N34 L;  1Z9F A;  5LMN W;  3K58 A;  1EY4 A;  5G3L D;  3I7F A;  2MNA A;  1I5F A;  1Y1W G;  2JA7 G;  2UUB L;  3M3Y B;  5JJL A;  2IHE A;  1WVL A;  2JA7 B;  3ZJY C;  4LMQ D;  3W5O A;  5JVG 3;  1ESR A;  4A4I A;  2A8V A;  1DOL A;  2K50 A;  4EGV A;  3NWS A;  5IYB G;  5FKA C;  3VDY A;  3S15 B;  1OXU A;  4P2C B;  2ZM6 Q;  3G6J B;  2CW0 C;  3KYH C;  1QWY A;  1SMY D;  5C3W A;  3HGB A;  1ZYR D;  3CD6 A;  1PFN A;  2Q8R E;  2XWB B;  4H13 C;  2JA8 G;  2R92 G;  2BA0 A;  3DXJ C;  1WFQ A;  1XMQ L;  1EU3 A;  1K3R A;  2F0E A;  3BZD B;  4K5V A;  3J7A V;  5FLM H;  4GOP B;  2YTX A;  1VQH A;  1RDP D;  2GA4 B;  1NR4 A;  4YIJ A;  2QGQ A;  4GN5 A;  3PIO 3;  1QOH A;  4A93 G;  2RCF A;  2OTJ A;  1R9T B;  1PVO A;  1GXD C;  1B9M A;  2BDN A;  2HQL A;  3DMU A;  3NP8 A;  2UUB Q;  3J81 E;  2F0Q A;  4A3F H;  2F3I A;  4A3J G;  2AMC B;  4KD4 A;  1VQ9 A;  5C4X G;  4DV5 Q;  2XSC A;  2NVX H;  2WAQ B;  2EXD A;  5HGQ A;  2Q2U A;  3HOX G;  1JOQ A;  5IGB A;  4DR4 Q;  1EIH A;  1KRT A;  1PDQ A;  2KOL A;  4S3S A;  4B3R Q;  4GKJ Q;  2NN6 H;  1DZ1 A;  4KTA A;  3IFD A;  5BR8 L;  1FR3 A;  4DA2 A;  4B3S Q;  1AN8 A;  1HTL D;  1CK1 A;  2VS1 A;  1WTH A;  1DD2 A;  4ZRZ A;  1VS0 A;  4YWL A;  4KY5 A;  3SK5 A;  1TWG H;  3DUZ A;  1VQ4 A;  5E4W C;  5AJ3 Q;  2VQE Q;  3SEB A;  5BN5 A;  1G51 A;  3W1G A;  1L0X B;  2MPM A;  3BZK A;  1N9W A;  1EWC A;  1OXS C;  1VMC A;  4J15 A;  2R93 G;  5CBA E;  1ROD A;  2Q8I B;  3J7Z C;  2A6E C;  2F1M A;  1PH1 A;  3QWN A;  5IY0 A;  1I3Q H;  1EOV A;  1JQY D;  3I56 A;  4OEL B;  2K33 A;  1PH4 A;  1Y1W B;  3OOC A;  4LF5 Q;  4H44 C;  5IGD A;  3PO3 H;  5T1G A;  4LF9 L;  4G7Z C;  3KUP A;  2Z8L A;  4X3U A;  1N32 L;  2R6G A;  3VR2 A;  1XNR L;  4DV4 L;  1PHJ A;  4OIK A;  4DNR B;  4B3R L;  2JA7 H;  3Q24 A;  1EEI D;  4OO1 I;  2NB0 A;  3H3V I;  1VQD A;  4XYQ A;  4JC0 A;  1DOK A;  3A74 A;  3I55 A;  3I4N H;  1VQA A;  3ERQ A;  4NDX A;  3STB C;  4IUP A;  3GV6 A;  1V1O A;  3H3V H;  5COY A;  2VUM B;  5JJI A;  1GUT A;  4HJ9 A;  1EIY B;  1VQC A;  4K6D A;  3VYT A;  2OCE A;  3M9B A;  4K6L A;  4DN4 M;  5M5Y H;  1TS2 A;  2KHJ A;  3BDC A;  2GVB A;  4JBK A;  4PZ8 A;  1Y8P B;  4DUZ L;  4A3D B;  1PRT D;  1VQB A;  4BA2 I;  4BBR B;  2Q2T A;  4H7B A;  2HHH L;  2LFN A;  2XTI A;  3HS0 C;  3MWY W;  5IT9 E;  4QB4 A;  1EL0 A;  1F9R A;  2FJ2 A;  1ZYR C;  4DV2 Q;  5C44 H;  5A2Q E;  1KD1 C;  4LJZ C;  3HOZ G;  4OWW B;  3NWT A;  4GNX C;  4JI0 L;  1XNQ Q;  1X32 A;  3K0X A;  1WTW A;  4KHV A;  3UDF A;  3OTO Q;  3OW2 A;  3K7A H;  5KNB A;  2CQO A;  4NB3 A;  3PQI A;  1KHI A;  3I73 A;  2AWO A;  4FF1 A;  1G6Z A;  5KYI A;  3MXU A;  4YCV A;  1X65 A;  1BQQ T;  1PH2 A;  3K5L A;  4OX9 L;  4DR6 L;  4Q5V A;  2C5C A;  1S40 A;  5C4X H;  4DR5 Q;  2NZO A;  3KDF B;  3C1F A;  2JEA I;  4HIK A;  2NUC A;  4KKS A;  2B63 B;  4DAM A;  3Q6S A;  3CC4 A;  1SNO A;  2E8G A;  2IJ0 A;  3TRZ A;  5DM7 3;  1KTK A;  1Y1V G;  2CVR A;  3CCQ A;  4OX9 Q;  3I4N G;  3CC2 A;  2OWO A;  2Z6K A;  4A3F B;  3M4O B;  2I5H A;  2YV5 A;  3R2T A;  1Z6H A;  5I9O A;  1HUM A;  1RTN A;  4AIM A;  3PO2 G;  1EIG A;  5JAV A;  2A74 C;  1K0S A;  1PYS B;  1SYG A;  4JI2 L;  1QE6 A;  2PQE A;  1M8A A;  1FGB D;  2JA9 A;  3STB D;  4POF A;  1WTV A;  5GAE C;  2F0W A;  4QGU A;  1XNQ L;  1IYU A;  1F2Z A;  1PYB A;  1QNK A;  5CC4 A;  1TXY A;  5FLX L;  4CJ2 C;  4JW0 A;  2OXP A;  3SGI A;  1BR9 A;  2PZW A;  5IIF A;  2B2W C;  1FYC A;  1SMY C;  4JI1 Q;  4BBR G;  4C3J H;  5FJ8 H;  1P16 A;  5FLX E;  1A2T A;  1KAB A;  2JA5 H;  4R4I A;  3GTL H;  3I4M G;  1I4G A;  4EVO A;  4BBS B;  2IX1 A;  4RGO S;  2N8N A;  3W3A A;  4FF2 A;  1EZ6 A;  3TZU A;  3EIV A;  4DR3 Q;  5DLQ E;  2LXJ A;  3DEP A;  2QKI C;  2ZXO A;  2JA8 H;  4B9X A;  1F77 A;  3KDF A;  1VQ7 A;  2EJF C;  1EWH A;  1PRT F;  2ZJQ A;  1NNX A;  4IUV A;  3DM3 A;  3EQL C;  4YCU A;  1DYQ A;  1SFO B;  1X3Q A;  1HNX L;  2RHQ B;  5JPM C;  1S5F D;  1G91 A;  4I7Z C;  4C3J G;  3GTO H;  2QEJ C;  4HIO A;  1KQS A;  1OTC A;  4KJO A;  5M5W B;  2SDF A;  1S5B D;  4BA1 I;  1PLF A;  3AFQ A;  1SRU A;  3KLS X;  5IP9 G;  3S1R B;  3BDO A;  4DR2 Q;  3MC0 B;  3R93 A;  1XMQ Q;  1QZG A;  1Q3L A;  3ULP A;  5CV7 A;  1I6H H;  1B4O A;  2WFW A;  4DGZ A;  3J7Y W;  2PI2 E;  3I4L A;  4ULL A;  3S14 B;  1C9O A;  3R3O A;  5C5L A;  2Y0S G;  5M3M B;  1BO0 A;  5M3F H;  1A15 A;  3NQT A;  5FOB B;  1Q86 C;  4B3T Q;  3GTJ B;  2R93 B;  5FJ8 G;  5A2Q L;  3RLO A;  1Y14 B;  5NUC A;  2E2H B;  2YTV A;  1DGS A;  2A6H D;  5CV6 A;  4MIU A;  4RGN A;  3U4Z A;  5GRO A;  4RCN A;  1UWV A;  1YNN D;  1CA6 A;  4KN7 C;  3OWE B;  2A68 D;  1ILP A;  2A68 C;  1JB7 A;  1I4Q A;  2M00 A;  1PH7 A;  3SK6 A; 
#chains in the Genus database with same CATH homology
 1CUK A;  3BU2 A;  1PHJ A;  3HOW H;  1A0I A;  2HT1 A;  3GTM H;  5J3B A;  1KL9 A;  1GD7 A;  3CCM A;  1B7Y B;  1G29 1;  5M5X H;  5LMU L;  3ER0 A;  4C3H H;  3RNU A;  3KFU A;  1LM0 A;  3TEH B;  4FDB A;  1YBY A;  4JV5 Q;  3RN2 A;  3HOV H;  1HNW Q;  1Q81 C;  1HZ9 A;  1S3O A;  3FKI H;  2F4V Q;  3F2D A;  5K36 G;  1VQE A;  3E9I A;  3AFP A;  3CCJ A;  2RHS B;  1O7I A;  1IBL L;  3CCR A;  3GO5 A;  4LF9 Q;  4DV6 Q;  1N33 Q;  1FJG Q;  4DR7 Q;  1NY4 A;  2N78 A;  3H15 A;  4DV3 Q;  4K0K L;  1HR0 Q;  3HKS A;  1VQM A;  1N32 Q;  5FLM G;  1A62 A;  4ALP A;  1FVI A;  1YIT A;  4JI4 L;  2MQH A;  4DPG A;  5IT9 c;  4JOI C;  3ERS X;  1SMX A;  4X64 Q;  4R4Q A;  3CQZ H;  1IXR A;  1X6O A;  4DUY Q;  3GTQ H;  1CKO A;  1VQ8 A;  3NEM A;  4P72 A;  3T1Y Q;  4A3F G;  3J81 c;  1FJG L;  4LF7 Q;  1WI5 A;  2Z6K C;  1YI2 A;  2IX0 A;  3GD7 A;  3BZC A;  3K8A A;  3TS2 A;  2OQK A;  4JCV E;  4JI4 Q;  4A3I G;  1UE1 A;  4JI3 L;  3HOV G;  2WP8 J;  4A3E H;  1Q8K A;  3NEN A;  3CC7 A;  4BY1 H;  4R4T A;  5JEA J;  1HJP A;  4LF7 L;  1E22 A;  1X3F A;  4GLA C;  5H1S E;  4YCW A;  2AWN A;  4YHH Q;  3S2D H;  2VY3 A;  1OXX K;  4DNI A;  4POG A;  1YIJ A;  4RG1 A;  5GAG C;  4YY3 L;  4P71 A;  1Y1W H;  4X62 L;  4OXP A;  2ZTC A;  2VUM G;  1JE5 A;  1U0L A;  1YHA A;  1GO3 E;  3KLW A;  2WAQ G;  5LMU Q;  1N34 Q;  1I50 H;  1VQN A;  2MO0 A;  2CCZ A;  5FLX c;  2C35 B;  2JA5 G;  4A3C G;  2VNU D;  3HOW G;  4A75 A;  5JEA G;  4YY3 Q;  2K5V A;  1KIX A;  1JJG A;  2F4V L;  1WCM G;  3RZD H;  4A3L H;  3S1N H;  4ME3 A;  4IOC A;  2ID0 A;  2CKZ B;  3PUW A;  4JV5 L;  2NN6 I;  2NVT H;  1HNW L;  1PH8 A;  4DV6 L;  3U4V A;  4OWT B;  5EAY A;  4DV3 L;  2B63 G;  2ALY B;  3ICE A;  3M4Q A;  4K0K Q;  2ZJP A;  1IBL Q;  1N33 L;  1YEZ A;  2EQS A;  4R4O A;  2AKW B;  2K4K A;  2OQ0 A;  3F1Z A;  1HZB A;  1QUQ B;  4NXN L;  3S24 A;  3UDI A;  4JI2 Q;  1K73 C;  2HIX A;  3EBE A;  3E0E A;  2QA4 A;  1XMO Q;  1BVS A;  3IRB A;  2A1A A;  4Y7N H;  1CKN B;  1ASZ A;  1HH2 P;  4YWM A;  4NPS A;  1HR0 W;  1IZ6 A;  3AEV A;  4WJ3 M;  3H0G H;  4L5R C;  1N36 Q;  5HY6 A;  4X65 Q;  1VCI A;  4B3M Q;  1XPR A;  2E5L L;  3S1M H;  1Q12 A;  3RN5 A;  3PGZ A;  3CMA A;  5IWA L;  1D8L A;  4JG2 A;  2E2I H;  1LUZ A;  3J81 i;  4DR6 Q;  1U5K A;  1BBW A;  4LF8 L;  1NJI C;  2UU9 L;  4UY8 C;  2IT1 A;  4KHP L;  1GVP A;  4HJA A;  3U58 A;  1K83 H;  2PMZ E;  1PA6 A;  2HHH Q;  2B63 H;  3HOU G;  4X66 Q;  4YHH L;  4B3M L;  2CWA A;  4A3J H;  3KF6 A;  1PH9 A;  2NVQ H;  1YNX A;  4X62 Q;  3DLL A;  4IO9 A;  1HNX Q;  4JI6 L;  1N34 L;  2JE6 I;  4JBM A;  1Z9F A;  5LMN W;  1XPU A;  3NBH B;  2R7Z H;  3M7N A;  1SN8 A;  2CFM A;  3CCV A;  2MNA A;  3I7F A;  1I5F A;  1A8V A;  1SE8 A;  1NMG A;  2Q2I A;  1K9M C;  2ASB A;  3B6Y A;  4AH6 A;  1Y1W G;  2JA7 G;  4WJ4 A;  2UUB L;  2ZTD A;  1KC8 C;  1K0R A;  2IHE A;  5JJL A;  4P74 A;  2VQF L;  4DUZ Q;  3A5U A;  3ZJY C;  1L1O A;  3W5O A;  3F8T A;  1V1Q A;  4A4I A;  2A8V A;  1VQ5 A;  2K50 A;  2ZM6 L;  1UE5 A;  1VQL A;  3S1Q H;  5IYB G;  4A3L G;  4DV4 Q;  4A3G H;  2B3G A;  3VDY A;  2UXC Q;  4O0A A;  1EQR A;  3ULL A;  3KJO A;  1SFO H;  3S2H H;  4LUV A;  1X55 A;  4DK6 C;  3F2B A;  1EQQ A;  1OXU A;  4DV0 Q;  2ZM6 Q;  2VZA A;  3FP9 A;  3KYH C;  5M3M G;  4JI1 L;  2UXB L;  1E3P A;  4X64 L;  1E1O A;  1RIP A;  3CD6 A;  1WJJ A;  2DGY A;  3OYY A;  3AYH B;  1HNZ L;  1PFS A;  4AQY L;  2JA8 G;  1IBM L;  2R92 G;  2BA0 A;  2RCN A;  1WFQ A;  2I5L X;  1YJ9 A;  1XMQ L;  1BKB A;  2BH2 A;  1K3R A;  5FLM H;  5C4J H;  2UXB Q;  1Q82 C;  4P75 A;  2K14 A;  4GOP C;  3Q8D A;  4GOP B;  4A3K H;  3A0J A;  5C0X I;  3CPW A;  2YTX A;  4O2D A;  1VQH A;  3CCU A;  3PO2 H;  4BBS H;  3H0G G;  2QGQ A;  4GN5 A;  4A93 G;  2I0Q A;  2OTJ A;  2VL6 A;  4LFA Q;  1PVO A;  1UE7 A;  4GLX A;  1XPO A;  3M3Y H;  1YVC A;  1VQG A;  5GQO A;  1JT8 A;  2HQL A;  2UUB Q;  3RR5 A;  4A3F H;  2F3I A;  1NE3 A;  5LMN Q;  4DR1 Q;  4LF5 L;  5IYD G;  1M1K C;  3T1H L;  4A3J G;  2VQF Q;  2AMC B;  1VQ9 A;  5C4X G;  3PUZ A;  1NBW A;  4A3M H;  4DV5 Q;  2NVX H;  2EXD A;  4UP7 A;  5HGQ A;  3FKI G;  2Q2U A;  1J6Q A;  1E24 A;  3HOX G;  3PF4 A;  1SLJ A;  4R1J A;  3CCE A;  3L2P A;  4DR4 Q;  2A19 A;  1EIF A;  2KHI A;  1KRT A;  5IYB H;  2JJQ A;  3CCL A;  2YYZ A;  4B3R Q;  2D62 A;  1FL0 A;  4GKJ Q;  3HOY H;  5E7N A;  5BR8 L;  3G48 A;  4LWC A;  4PZ7 A;  4B3S Q;  1XTD A;  4MNO A;  4LW1 A;  4OON A;  5AJ3 L;  1XMO L;  4A3B G;  4JOI A;  1NTG A;  2VS1 A;  1KRS A;  4TQU S;  4JI7 L;  3PSI A;  2N49 A;  5ELO A;  1EYG A;  1E7Z A;  1VS0 A;  3CF5 A;  4DR4 L;  4YWL A;  3EN2 A;  1TWG H;  1VQ4 A;  1JMC A;  4QL5 A;  3HOU H;  5AJ3 Q;  4YWK A;  4PZ6 A;  2VQE Q;  1FGU A;  4JYA Q;  1G51 A;  2GN5 A;  4P73 A;  3W1G A;  5BR8 Q;  5IP9 H;  3L7Z C;  3BZK A;  3K7U C;  1VQP A;  3UDG A;  2R92 H;  2LSS A;  4LF4 Q;  1EWI A;  1SRO A;  1N9W A;  1OXS C;  4J15 A;  2R93 G;  2JK8 A;  5M3F G;  4EQ5 A;  5IE8 A;  1BBU A;  3J7Z C;  1TWF H;  3CPF A;  1PH1 A;  3AQQ A;  4C3I H;  3U50 C;  5IY0 A;  1V43 A;  1I3Q H;  2H5X A;  1EOV A;  1IBK Q;  2ATW A;  4UP8 A;  1TWH H;  2Q2H A;  4KLK A;  4DAY B;  3I56 A;  4LFC L;  2UUC Q;  1Q1B A;  1PH4 A;  3MXN B;  1UE6 A;  2FXQ A;  1XNR Q;  2ZTE A;  4OO1 G;  1H95 A;  4DR1 L;  4LF5 Q;  4X6A H;  1G6P A;  3PO3 H;  3J80 i;  4LF9 L;  3S15 H;  3GDE A;  2DUD A;  4GNX A;  1W3S A;  2RF4 A;  1JJ2 A;  1CKN A;  4PMW A;  5IYD H;  1N32 L;  2R6G A;  1XNR L;  2PQA B;  1L1O C;  2XGT A;  1L1O B;  3I4O A;  5M3M H;  3HOX H;  4DV4 L;  1Q7Y C;  1CSP A;  1WYD A;  4C2M H;  1KXL A;  4B3R L;  2JA7 H;  4H02 A;  1HZC A;  4DUY L;  4IPH A;  4OO1 I;  1VQJ A;  4DV1 L;  1J5E Q;  3H3V I;  1KAW A;  1VQD A;  2WAQ E;  4B3S L;  4LFB Q;  4JC0 A;  1PH3 A;  1QUQ A;  4NXM L;  4IJH A;  1N8R C;  3T1Y L;  1Q46 A;  2D0O A;  3A74 A;  3I55 A;  3S1R H;  3BJU A;  4AQY Q;  3I4N H;  1VQA A;  3FHW A;  3PUX A;  3STB C;  4DV1 Q;  1J5E L;  4JI3 Q;  3KF6 B;  4IJL A;  3CAM A;  3H3V H;  1PV4 A;  3HOY G;  4JI8 Q;  2IHF A;  2BH8 A;  1ASY A;  4A93 H;  5JJI A;  2K5N A;  1MIU A;  2Z0S A;  1W2B A;  1L0W A;  4HJ9 A;  1EIY B;  1VQC A;  3UDX A;  2OCE A;  3M9B A;  1HZA A;  5M5Y H;  2KHJ A;  2L15 A;  2GVB A;  4UPA A;  4JBK A;  4PZ8 A;  4PG3 A;  3J80 c;  4DUZ L;  3D0F A;  2NVY H;  1VQB A;  4L5Q A;  5GAH C;  4A3D G;  2PNH A;  1X3G A;  5IP7 H;  1LTL A;  4L5S A;  3I2Z A;  3M4P A;  2Q2T A;  4BA2 I;  3CME A;  1S72 A;  2HHH L;  4BBS G;  3WWV A;  5IYC G;  2XTI A;  2B29 A;  1P8L A;  2K75 A;  4X66 L;  2UXC L;  3PIP A;  3KJP A;  5ELN A;  1E1T A;  4DV2 Q;  5C44 H;  3J81 j;  3G4S A;  1KD1 C;  3JAM i;  3HOZ G;  1AH9 A;  4DV5 L;  4OWW B;  3GTG H;  5C0X J;  4JI0 L;  3UE1 A;  4GNX C;  1MJE A;  1VQK A;  2E2J H;  1XNQ Q;  1XJV A;  3K0X A;  1QZH A;  4A3B H;  3UDF A;  4BXX H;  2IY5 B;  3OTO Q;  1RL2 A;  3D31 A;  3E9H A;  3K7A H;  2WB1 E;  3OW2 A;  4BY7 G;  1IBM Q;  4GKK Q;  4OWX B;  2CQO A;  2Y0S E;  4GN3 B;  1WOC A;  4NB3 A;  1YJW A;  4LFB L;  2F52 A;  1KHI A;  5GAD C;  2KBN A;  4A3C H;  3RLF A;  2AWO A;  4HJ5 A;  1CSQ A;  3KOJ A;  3JC6 6;  4B3T L;  3OTO L;  3J7A 5;  1T9H A;  4YCV A;  1N36 L;  1X65 A;  3S14 H;  4GKK L;  1GM5 A;  1K8G A;  1PH2 A;  3W1B A;  1I94 L;  4JI7 Q;  4OX9 L;  4DR6 L;  1TWC H;  1S40 A;  5C4X H;  4DR5 Q;  2NZO A;  3KDF B;  1EFW A;  4GKJ L;  2JEA I;  4HIK A;  4KHP Q;  4IPD A;  4IFD J;  3F2C A;  2KCM A;  2JA6 G;  2E2H H;  1SR3 A;  4LF8 Q;  1CKM A;  4LFA L;  4DAM A;  5IYC H;  2R93 H;  2JEB I;  4LF6 Q;  4JYA L;  4MTN A;  4A3K G;  3HFZ B;  2I5M X;  2BA1 A;  1I94 Q;  1IYJ B;  3CC4 A;  2E8G A;  4IPG A;  2CWP A;  3TRZ A;  5JJK A;  1Y1V G;  4BBR H;  4R4C A;  3CCQ A;  4OX9 Q;  3I4N G;  5LMN L;  3CC2 A;  3CXC A;  2OWO A;  2Z6K A;  1L2F A;  2R7D A;  4DR5 L;  3GTK H;  4L5T A;  1UEB A;  4HJ8 A;  1B8A A;  3RZO H;  2I5H A;  3JAM c;  2YV5 A;  1QVG A;  2K52 A;  4IFD G;  1EUJ A;  4AIM A;  3KF8 B;  2GVA A;  2ZJR A;  4GNX B;  3PO2 G;  4MZ9 A;  4APV A;  1PYS B;  3PCO B;  4JI2 L;  1NMF A;  1YHB A;  1VQI A;  1MJC A;  2JA9 A;  4JBJ A;  3STB D;  4POF A;  1AE2 A;  1R9T H;  4DV2 L;  5GAE C;  1OXV A;  4QGU A;  4LUZ A;  3CW2 C;  1VQF A;  2LXK A;  1XNQ L;  1QVC A;  4BY1 G;  1PYB A;  2MO1 A;  4XIG S;  1D7Q A;  1TXY A;  2N3S A;  3HKZ G;  4JI0 Q;  4IFD I;  2HIV A;  4A3I H;  1X54 A;  1X56 A;  2UUA Q;  3K81 C;  4UP9 A;  3SGI A;  4AYB E;  4DV7 Q;  4A3M G;  4LUO A;  2UXD Q;  1Y1V H;  4JI1 Q;  4BBR G;  4C3J H;  5C3E H;  5FJ8 H;  3A5Z B;  3PUV A;  3S17 H;  1P16 A;  4TVA B;  4XTC S;  1V9P A;  1Q1E A;  4BY7 H;  5C3E G;  4IOA A;  2UUA L;  4GLV B;  4QIW E;  4DR3 L;  1HNZ Q;  3RLN A;  2JA5 H;  1A63 A;  4R4I A;  4NXM Q;  3HKZ E;  3GTL H;  3I4M G;  1Z47 A;  3PIO A;  2IX1 A;  1TWA H;  2N8N A;  1C0A A;  4DV7 L;  2AHO B;  3EIV A;  4DR3 Q;  4JI8 L;  5DLQ E;  3S16 H;  1WCM H;  2JA6 H;  2LXJ A;  5IWA Q;  4QQB X;  2JA8 H;  3KDF A;  1VQ7 A;  4A3D H;  3UE0 A;  2VW9 A;  1OXT A;  1X3E A;  2UUC L;  4LFC Q;  2ZJQ A;  4IPC A;  4RMF A;  3DM3 A;  4YCU A;  4LF4 L;  2V1C C;  1JJC B;  3HOZ H;  4JBW A;  3M4O H;  2K5H A;  2NN6 G;  2RHQ B;  4AYB G;  2EIF A;  5C44 G;  4DV0 L;  1YJN A;  1HNX L;  4JI6 Q;  3LGJ A;  2VUM H;  2QEX A;  3GTO H;  3MEF A;  3PUY A;  4HIO A;  1OTC A;  1KQS A;  4GS3 A;  4BXX G;  2YU9 H;  4DR7 L;  1IL2 A;  4BA1 I;  3PV0 A;  4EX5 A;  2OTL A;  1LYL A;  3AFQ A;  1SRU A;  5IP9 G;  1C7Y A;  1HR0 L;  4NXN Q;  1IBK L;  4DR2 Q;  3L0O A;  1AE3 A;  1XMQ Q;  5M5W H;  3K80 C;  1QZG A;  2UXD L;  3ULP A;  4QJF A;  4DK3 C;  4A76 A;  1I6H H;  4A3E G;  5C0X G;  2WFW A;  4GOP A;  3TQY A;  3NEL A;  2PI2 E;  3CCS A;  4HIM A;  1VQO A;  2PI2 A;  1PH6 A;  2MFI A;  2ES2 A;  4LNQ A;  1C9O A;  4X65 L;  3GTP H;  5IP7 G;  2KEN A;  4JI5 L;  2Y0S G;  1MKH A;  4GN4 B;  2E5L Q;  4HJ7 A;  1B70 B;  2WB1 G;  2PQA A;  3ULJ A;  5M3F H;  1Q86 C;  4DR2 L;  4B3T Q;  2NZH A;  3G71 A;  2R7F A;  3PF5 A;  1QVF A;  5FJ8 G;  2UU9 Q;  2R7Z G;  1YHQ A;  2VQE L;  3RLO A;  1Y14 B;  2YTY A;  4KI0 A;  1X9N A;  4DKA C;  1YZ6 A;  1GKH A;  2KCT A;  3G6E A;  2YTV A;  4QY7 A;  1DGS A;  3TRE A;  2D0P A;  4Y52 H;  3TS0 A;  1VQ6 A;  3U4Z A;  5GRO A;  3M85 A;  4JI5 Q;  4A3G G;  1UWV A;  1PH5 A;  4KHZ A;  1M90 C;  4HID A;  1K8A C;  4LF6 L;  2JQO A;  3T1H Q;  1JB7 A;  3GTJ H;  3CP0 A;  3PO3 G;  3I4M H;  1PH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...