2UUAL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uuaL00
2F3IA 3PUXA 4IJHA 4JI5Q 1JJGA 3S1NH 4GN3B 4DV3Q 3HKZG 1PH9A 4LNQA 2Z0SA 4R4TA 5IYCG 2AMCB 2LXKA 1Y1WG 2N78A 1YI2A 2LXJA 3F2CA 2ZTDA 1I94L 1J5EL 2RHSB 4DV7Q 3A74A 4JOIC 4AYBG 1Y1VH 2YTXA 3TREA 4BBRG 3CMEA 2VQFQ 4B3RL 1JJCB 4UPAA 3HOZG 4A3LH 1RIPA 4GN5A 2R7DA 4GKKL 1K83H 2D62A 4OONA 3GO5A 3J81j 4A75A 1R9TH 1E1TA 1X65A 2IX1A 3RLNA 2NVXH 2JJQA 1PYSB 2JQOA 1SFOH 4JI6Q 1QVFA 4DKAC 5FJ8G 3I4MH 3A0JA 5ELNA 1E22A 5LMUQ 4LF6L 5C4JH 3UE0A 2QGQA 5IE8A 2JK8A 3G4SA 1XNRQ 3PGZA 4LF5Q 5JJKA 3UDIA 2ZTCA 4YHHL 4JI8Q 1FGUA 2N49A 3JAMi 5C0XG 1VQJA 3GTKH 4A3CG 4X62L 2R7FA 4X66L 3KF8B 4OXPA 3CMAA 4LF4L 1M90C 5IP7H 3FHWA 4QL5A 4OWXB 1XTDA 1K9MC 5HGQA 3HOXG 4LW1A 4DR1L 5C4XH 1PFSA 2MFIA 1D8LA 5IP9G 4XIGS 5DLQE 2B3GA 4A3JH 4L5TA 1XNQL 3PO3G 2HHHQ 2V1CC 3CCUA 4A3IH 3CC2A 1TWHH 1W2BA 3MXNB 1B7YB 3T1YL 5LMNW 2R7ZH 5BR8L 4A3BH 1QUQB 1Q7YC 2CKZB 2IT1A 5M3MG 1X56A 5M3FH 4GNXB 2PI2A 3H0GG 1S40A 2BH2A 3J7A5 2UXCL 4BY1G 2BA1A 1TWFH 4J15A 4LFCL 1WYDA 2GVAA 1Y1VG 1YNXA 2K75A 4O2DA 4KI0A 4NXNL 4ALPA 4B3TL 3CCEA 4A3LG 1CSPA 1VQIA 4UP9A 2VL6A 2H5XA 4BA2I 4OX9L 4X65L 3E0EA 1VQPA 2K5NA 1I94Q 4C2MH 3Q8DA 4JI2L 4X64L 2VUMG 5H1SE 3GTQH 4B3RQ 1Q86C 4NXMQ 3K7AH 1VQCA 4GKKQ 2CQOA 2K4KA 4MZ9A 3ULPA 4UP7A 1VQBA 1GM5A 2JE6I 4PMWA 4L5QA 4DR5L 1GVPA 3K8AA 2AWNA 4JBJA 4GLVB 2UU9Q 4DV0Q 4QQBX 1KD1C 3AQQA 1XMQQ 4LF6Q 5LMNL 4PZ8A 4JI3L 1U5KA 3OW2A 3RLFA 4GOPA 2K5HA 4PZ6A 3K81C 1A62A 4QGUA 1PH2A 1WCMH 1YIJA 3H3VI 1HR0W 2ALYB 2Y0SE 2UUAL 1JE5A 2D0PA 4DAMA 2A8VA 4X62Q 5C4XG 4YCUA 5FLXc 2YTYA 3J80i 3H15A 3KJPA 1WOCA 4P71A 3VDYA 1MKHA 3D31A 1YZ6A 3B6YA 4Y7NH 1V43A 2D0OA 4A3MG 4HJ5A 2NZOA 4DR1Q 4A3BG 4DR4L 1C7YA 1TWAH 1E24A 4DV2L 3S15H 1G51A 5GADC 2MNAA 3F2BA 1PHJA 2E2HH 1CSQA 2WAQG 2WB1G 1CKMA 3T1YQ 4NB3A 3PF4A 1YHQA 5C0XI 1P16A 2Q2TA 2AWOA 2FXQA 3HOYH 3CAMA 2K14A 1DGSA 4P75A 2JA5H 4LUVA 1VQFA 4POFA 3G6EA 4OWWB 1I3QH 4BY7H 2UXCQ 5C0XJ 2R92G 1N33L 1VQMA 3UDGA 1QVGA 3GTJH 4JI4Q 4NXNQ 4A3DH 1BBWA 3CF5A 2CCZA 5M5XH 1C9OA 4LF7L 1XPOA 1HR0L 1IBML 4OX9Q 5JEAJ 4X65Q 5K36G 1CKNA 1N36L 4A76A 2F52A 3PO2G 4P73A 4JI2Q 4X64Q 2N8NA 3CC7A 1KRTA 4LFBL 2JA7H 1VQ9A 3M85A 1OTCA 2E5LL 3GTGH 4IFDG 1TWGH 1YJNA 1JMCA 2OTLA 1HZBA 3UE1A 3WWVA 4A3FH 2UUBL 5HY6A 4BXXH 1G6PA 1ASZA 1NMFA 4R1JA 4HIOA 4GOPC 4JI0L 3HOWG 4DR5Q 3I4NH 1N32L 1WCMG 2A19A 1WI5A 2ZJRA 3MEFA 5FLMH 1OXUA 1U0LA 2ZJPA 1PH5A 3CW2C 5LMNQ 4DUZL 1VQ5A 1E3PA 3NBHB 4JI3Q 4YWLA 4DK3C 4AH6A 3RZOH 4R4QA 2YYZA 3GTLH 1BVSA 5EAYA 1LYLA 1VQHA 1UE6A 2LSSA 3A5ZB 1NE3A 1FJGL 1VQ6A 3S16H 4APVA 3M4PA 4POGA 2I0QA 1A8VA 3F1ZA 3EN2A 5IYBH 1ASYA 1A63A 3KJOA 2JA6H 2NVTH 1X3EA 5C44H 4PZ7A 2KCTA 3ICEA 3K0XA 3CQZH 2OQKA 4JBMA 4DV2Q 3KDFB 4B3ML 2HIVA 4A93H 3PUWA 4IPGA 2QEXA 1PV4A 2ZM6L 1IYJB 1EYGA 2JA5G 2Q2UA 1Z9FA 4A3GH 1Y14B 1VQKA 4A3DG 1EQRA 1EIYB 3BJUA 3A5UA 3OYYA 1L1OA 2PQAA 2VW9A 5JEAG 1I5FA 4JV5Q 5C3EH 2VQEQ 4A4IA 1N33Q 1SN8A 2K50A 3KF6B 3E9HA 4KHPL 2JA7G 4LF7Q 1YBYA 1HNWQ 1L0WA 4BA1I 3CXCA 4HJAA 1HR0Q 4YCWA 1IBMQ 1IL2A 3TQYA 3S2HH 1TWCH 4A3FG 1N36Q 2K5VA 3BZKA 3JAMc 4P74A 1IBKL 2ID0A 3OTOL 1SLJA 4DR3L 3PCOB 1HNXL 2E5LQ 1NJIC 1O7IA 1X55A 2EIFA 3IRBA 4NPSA 3KFUA 1VS0A 2UUBQ 1PH1A 3NELA 4IJLA 3ER0A 4JI0Q 2HIXA 2NZHA 2MQHA 1KQSA 1H95A 1WJJA 1N32Q 3CPWA 3PIPA 3G71A 4R4CA 1X3GA 3AFQA 1J5EQ 3TEHB 3M9BA 3L0OA 4C3HH 3S17H 1CUKA 2PI2E 2YU9H 4Y52H 4LF9L 3I4MG 3HKSA 4RG1A 2E8GA 2QA4A 4YWKA 1EOVA 2ES2A 4L5SA 2JA6G 1EWIA 2E2JH 2JEAI 1FJGQ 3AFPA 4A3EH 4DV5L 2YV5A 1Q1BA 3JC66 3M4QA 1KXLA 3I55A 3TS0A 1OXVA 2UXBL 4IFDJ 1KRSA 2UUCL 3E9IA 3DLLA 1FL0A 4XTCS 3UDXA 3ZJYC 5IY0A 3T1HL 3CCLA 1I50H 3U4ZA 3RLOA 4DR2L 4IO9A 1N34L 3SGIA 3W5OA 1YJWA 4B3MQ 5IP7G 5M5YH 3RZDH 2ZM6Q 1L1OC 4YHHQ 1YITA 3AEVA 2B63H 1SR3A 3CCVA 1NY4A 3PSIA 4TQUS 5C3EG 3CCJA 2HT1A 4X66Q 5E7NA 4JG2A 4LF4Q 4DR6L 4A3JG 1VQ4A 3RNUA 4DAYB 4A3IG 1HZ9A 4DV3L 1Q46A 3KF6A 2R6GA 4MTNA 2UXDL 2Y0SG 1VCIA 2OWOA 2R7ZG 3HOUH 4KHPQ 4DV4L 1XNQQ 4DV1L 2YTVA 4HIMA 3PUZA 2VZAA 5M3FG 4GKJL 4UP8A 1BKBA 1QUQA 1QVCA 1D7QA 2ZJQA 4EX5A 5AJ3L 1KIXA 4WJ3M 2XTIA 5BR8Q 4GNXA 1GKHA 2KHIA 1IBKQ 3OTOQ 4DR3Q 4YY3L 1XPRA 4PG3A 2OCEA 1HNXQ 3PIOA 4BBRH 1AH9A 1B70B 3J80c 1PH8A 3G48A 2JA8H 4LFCQ 3GTPH 4JI6L 1JJ2A 4IPDA 2MO1A 2WB1E 4B3TQ 1EIFA 3EIVA 4DR7L 1X3FA 4LUZA 2DGYA 2RCNA 4JYAL 3FKIH 2OQ0A 3STBC 1PH4A 4UY8C 3CP0A 1IZ6A 4FDBA 1KL9A 1HJPA 1S72A 4ME3A 4RMFA 3TS2A 4JI8L 1VQGA 2JEBI 4LF9Q 2AHOB 4JBWA 4JI7L 3CPFA 1EFWA 3ERSX 1VQ8A 3HOVH 3KLWA 1HZAA 1UEBA 1C0AA 2UXBQ 4A3CH 4IOAA 1IXRA 2UUCQ 1PH7A 1S3OA 3GTOH 3ULJA 4OO1G 2IHFA 5GROA 3T1HQ 2HHHL 4DR2Q 1IBLL 1KAWA 1N34Q 4X6AH 2JA9A 3HKZE 4C3JH 3HOXH 2E2IH 1Q12A 4HJ9A 1A0IA 2PMZE 2UUAQ 1TXYA 3ULLA 4LFAL 1HH2P 1UWVA 2I5MX 4QJFA 4JI1L 3U58A 4JBKA 1PH6A 2IHEA 1JB7A 4DR6Q 3STBD 3KOJA 4AYBE 1X9NA 1YHAA 3FP9A 4WJ4A 2UXDQ 3W1BA 1G291 5M3MH 4GNXC 2ATWA 4L5RC 4DR4Q 2AKWB 3H0GH 4DV4Q 4BY1H 4DV1Q 3HOYG 4GKJQ 3PV0A 2L15A 2JA8G 3J7ZC 4BY7G 1OXTA 5AJ3Q 4HJ8A 4NXML 4EQ5A 3S1MH 1FVIA 4GS3A 1UE7A 4JC0A 1Q8KA 4YY3Q 2MO0A 4C3IH 1WFQA 4GLAC 4DPGA 3FKIG 2DUDA 5JJLA 1W3SA 2VUMH 2BH8A 1LM0A 2Q2IA 2NN6G 2F4VL 3DM3A 2UU9L 4DV0L 3KYHC 3TRZA 5IWAL 1T9HA 1XMQL 1PH3A 3M4OH 4AQYL 1XMOL 4DR7Q 1NBWA 2IX0A 2KCMA 4JYAQ 1SMXA 3I56A 4BXXG 2Z6KA 3HOVG 3GTMH 3S14H 1PYBA 1K0RA 3I2ZA 4R4OA 1HNZL 4GOPB 4LFBQ 3I4NG 1QZGA 3LGJA 4K0KL 4JI7Q 1VQEA 3L2PA 5FLMG 3CCMA 1N8RC 5GAEC 2CWPA 4IPHA 5J3BA 1B8AA 4KHZA 1XPUA 2ASBA 1J6QA 2CWAA 1OXXK 5IYDH 3CD6A 1YHBA 2VY3A 3K80C 2PNHA 5M5WH 4DUZQ 2EQSA 3CCRA 3BZCA 4IPCA 1SRUA 5ELOA 5GAHC 1IBLQ 2I5HA 3PF5A 4A3MH 1OXSC 5IYBG 3CC4A 2K52A 3F8TA 1VQLA 1YEZA 4OWTB 4P72A 4O0AA 4LFAQ 5C44G 3J81i 4IFDI 4LUOA 4JI1Q 2XGTA 1GO3E 1VQDA 1NTGA 3EBEA 1Q82C 1K8GA 3RR5A 1K8AC 4A93G 1I6HH 4A3GG 1BBUA 4JI4L 2EXDA 1CKOA 1VQOA 4H02A 3KDFA 4LF8L 2N3SA 1UE1A 2B29A 1SROA 4QY7A 2NVYH 2R93H 4DV6L 1AE3A 2WP8J 5GQOA 3U50C 3RN5A 3F2DA 1PA6A 3M7NA 2KENA 4OO1I 4AIMA 4DUYL 2R92H 3S1QH 2C35B 3NEMA 1CKNB 1PVOA 3UDFA 4B3SL 2I5LX 4JI5L 4A3KH 3D0FA 3J81c 1Q1EA 4BBSH 2OTJA 2RHQB 3PO2H 1X6OA 2Z6KC 4HIKA 2KHJA 2F4VQ 2A1AA 1M1KC 1XJVA 1X54A 5IWAQ 3PUVA 1Q81C 1VQ7A 4AQYQ 1XMOQ 2Q2HA 4DV7L 4IOCA 2HQLA 2VQFL 1E7ZA 1MJEA 5IYCH 1QZHA 3HOWH 1K3RA 1Y1WH 3S1RH 1MJCA 1HNZQ 1LTLA 4YWMA 4K0KQ 2CFMA 4JOIA 2GN5A 5IYDG 3S24A 1UE5A 3HOZH 3S2DH 1V9PA 3I4OA 4MNOA 3GD7A 1MIUA 3H3VH 2KBNA 2WAQE 3BU2A 3I7FA 2NN6I 5LMUL 2WFWA 3L7ZC 1EQQA 3W1GA 2ZTEA 2RF4A 1YVCA 3AYHB 2IY5B 4KLKA 1XNRL 2GVBA 4JCVE 4YCVA 5FJ8H 4HJ7A 4A3EG 4LF5L 1E1OA 3RN2A 1JT8A 5JJIA 3U4VA 1KHIA 3K7UC 4LWCA 4DNIA 3CCQA 1YJ9A 1Z47A 2R93G 1VQAA 1VQNA 1AE2A 3PUYA 1NMGA 1EUJA 4QIWE 4TVAB 4DV5Q 5IT9c 4JV5L 1SE8A 2VQEL 2VS1A 2NVQH 1L1OB 2PQAB 5GAGC 1GD7A 1N9WA 2B63G 4LF8Q 3CCSA 4GLXA 1HNWL 3GDEA 1K73C 4DV6Q 4A3KG 1KC8C 2VNUD 4GN4B 4R4IA 4BBSG 4DK6C 4DUYQ 1HZCA 1LUZA 3NENA 4HIDA 1L2FA 1RL2A 1P8LA 5IP9H 1V1QA 2BA0A 3HOUG 3HFZB 3PO3H 4B3SQ 3M3YH
chains in the Genus database with same CATH superfamily
1O7YA 4JI5Q 1R4PB 3S1NH 3MFGA 4DFAA 5FLXE 5CV6A 2Z0SA 2B2UC 4R4TA 2MJ8A 1BXTA 4I7ZC 5CV9A 5J39A 2AMCB 2LXKA 1Y1WG 2LXJA 2ZTDA 1EWHA 3CMEA 1WTXA 1JJCB 3HOZG 2E74C 2D62A 5KRUA 2F0OA 5CGKA 4CJ0B 1X65A 3M4OB 1HFGA 2IX1A 2JQOA 1QVFA 5FK9C 1TWCB 1CHQD 4DGZA 5ELNA 3J7AV 5LMUQ 4LF6L 5KNCA 2RKSA 2JK8A 3G4SA 1XNRQ 4QCLA 5JJKA 3UDIA 1HTLD 3NHHA 2N49A 2K7VA 1VQJA 1PZID 5FO7B 2EYFA 3KF8B 3R2IA 1EU3A 1FNWA 5IP7H 3OIQA 2RSOA 4KHVA 3OIPA 2OT2A 4C3JG 4LW1A 1PMRA 2F0WA 1VF7A 2HQEA 2NZ1D 1D8LA 5IP9G 4X3UA 5DLQE 2B3GA 4KV6A 1SNMA 4L5TA 5FOBB 4A3IH 1CQVA 4A3EB 2EOTA 3LWEA 2F0EA 2F0IA 4WORA 4R8IA 4N9TA 5BN4A 2IT1A 1F2ZA 4GNXB 3H0GG 4RGMA 2BH2A 3J7A5 2UXCL 4BY1G 5C3XA 2GVAA 1B1ZA 1Y1VG 1YNXA 4O2DA 4B3TL 1HQRD 3GV3A 3QOLA 1CSPA 5EJWA 2B63B 2VL6A 3E0JA 2H5XA 4OX9L 3TSSA 4X65L 4BS9A 2K5NA 4L8JA 1QNUA 1I94Q 1D1KA 5D14A 3Q8DA 4ZUIA 4GKKQ 2WKCA 1EZ6A 1BCPC 3DXJC 3HKZB 4L5QA 1GVPA 1PRTF 4IUUA 5T1IA 4DV0Q 1AEXA 2B8GA 5LMNL 1BBXC 5IGCA 1BO0A 3RLFA 4GOPA 3HG9A 2XSCA 4PZ6A 1PH2A 1YIJA 3S2DB 2ALYB 2EJMA 2A8VA 4OIKA 4X62Q 5C4XG 5FLXc 3J80i 3IFTA 3H15A 4FF3A 1MKHA 4Y7NH 2WV6D 2NZOA 2PZTA 4DR1Q 4XDXA 1SYDA 1C7YA 1TWAH 3S15H 1I4QA 5GADC 1PHJA 2E2HH 1CKMA 3T1YQ 1YNJD 5C0XI 2EY6A 2FXQA 4IURA 2K14A 1DGSA 2C5CA 3SXHA 2JA5H 4POFA 1VQFA 1I3QH 3Q23A 5C0XJ 1N33L 1QVGA 4B9WA 2Z9HA 3HOXB 5M5XH 5JEAJ 1N36L 1HA5A 4A76A 4X64Q 2N8NA 3CC7A 1QNKA 3F2UA 4LFBL 2JA7H 1HFNA 1VQ9A 2Q8IB 2E5LL 1JMCA 2OTLA 3UE1A 3WWVA 4A3FH 1ILQA 5HY6A 4XQQA 4R1JA 4GOPC 1SSOA 1X3QA 2FMMA 3D6CA 4HR7B 1WCMG 1PDQA 2ZJRA 3UI2A 1U4PA 3T51B 4JI3Q 1GUNA 1LTID 1CZWA 4KN4C 1EY8A 3GTLH 2VUMB 5EAYA 3R8BA 2XIWA 1UE6A 2Q8TA 3P75A 4PNYA 4TKOB 2F4IA 3CU7A 1DXMA 3M4PA 4RFBA 4IN3A 2K01A 3WOEA 2I0QA 4POGA 1A63A 5IYBH 1DOLA 2NVTH 4KK7A 3MAQA 1QCBD 2SOBA 1NSNS 2N88A 4DV2Q 2HIVA 1EYGA 2Q2UA 2WACA 3TZDA 2HUGA 1Y14B 2EE1A 4A3DG 1EQRA 1EU4A 2EY2A 2A6ED 2F0LA 3A5UA 4JV5Q 2RSNA 4K2KA 1ZEQX 3NQTA 3KF6B 4XQJA 4RCNA 3CXCA 4FF1A 3HP3A 1KABA 4HSVA 2K5VA 2WAQB 2WB1B 1F9QA 3ITPA 5BN5A 1IBKL 2GA4B 1I4RA 2LFNA 5EQ0A 3IRBA 1NR4A 1STEA 1VS0A 2UUBQ 3BYYB 4IJLA 2HCIA 3ER0A 4JI0Q 2HIXA 1DCZA 2MQHA 3S1QB 1N32Q 3O13A 2EXZA 4R4CA 3AFQA 3L0OA 2YU9H 4Y52H 3PO2B 2JP1A 5D65A 3DWAA 1B3QA 2JA6G 2DY8A 4KKUA 5IGDA 1EWIA 1RD9D 2XNAC 2RDHA 2JEAI 1Q1BA 5I6YA 3I55A 3VYTA 2UUCL 1Z7TA 3E9IA 4LMQD 1FL0A 3DLLA 2QDLA 2CQAA 4IO9A 2LMCB 4B3MQ 3OW7A 5IP7G 3J7YW 2ZM6Q 4YHHQ 2A73B 3AEVA 4F7XA 2L0CA 1HXYD 4X66Q 5LHY1 4DR6L 1VQ4A 3RNUA 4A3IG 1HZ9A 2BDNA 3M4YA 3S15B 2UXDL 3K5MA 2Y0SG 3HOUH 5L37A 2K04A 2L11A 1E2ZA 3FPUB 1EIHA 2XRQD 1IYUA 1D7QA 5AJ3L 2JA5B 4CHTB 2XTIA 5BR8Q 4DAPA 1GKHA 3OTOQ 4QUCA 3PIO3 4YY3L 1EZ8A 1PFBA 3SDZA 4BBRH 5M5XB 1GUTA 1EY6A 3A7LA 3TMEA 2VB3X 2X69A 1JJ2A 2B2TC 3EIVA 4DR7L 4LUZA 2JA7B 1AW7A 3FKIH 1T5EA 3CP0A 1HJPA 2NN6H 4ME3A 4RMFA 4A3FB 1VQGA 4XXEA 3V05A 2O5IC 1LTTD 1DYQA 4UHVA 3KLWA 1HZAA 1UEBA 5C4HA 1C0AA 4K5WA 4A3CH 1LACA 3GTOH 1PZJD 2PPBC 3MEHA 4EVOA 1TVXA 3T1HQ 2AQ1B 1A3VA 4L63B 3HKZE 1SBBB 2PNRC 2E2IH 1A0IA 3I4MB 2UUAQ 4G7OC 3K57A 5C4JB 1V1PB 1JB7A 2RCFA 3KOJA 5JVG3 3FP9A 2HDMA 1TIID 4FXKC 3W1BA 4L5RC 4DV4Q 1LTGD 2L15A 3J7ZC 2K1BA 3SEBA 3DM1A 4EQ5A 3T4AC 1SJHD 1H9JA 2MO0A 4C3IH 2FINB 2DUDA 1W3SA 1GUOA 1TWHB 4DV0L 4RKLA 5I2YA 3ONAB 4XT3B 2Z6KA 3LX0A 2KEEA 3HOVG 3GTMH 3S14H 3I2ZA 1H9MA 4R4OA 3K6OA 1QJOA 3SE0A 2ICIA 5J3BA 4EQOA 3EJIA 3MVVA 5NUCA 5IYDH 4ZYSA 1YHBA 4S3SA 5ELBA 4HCSA 1XYIA 3QO2A 3CCRA 1Y8OB 5FO8B 3MXGA 3PF5A 2FFKB 4A3MH 5IYBG 1VQLA 4IFDI 1BOSA 4LUOA 5CYUA 4C1NK 4HMJA 2XGTA 1GO3E 3EBEA 3IKJA 1CKOA 3SR1A 4RHRA 3KDFA 2B2WC 2B29A 2FMCA 4MTKA 2R93H 2NVYH 1PRTC 4OO1I 2R92H 3IAYA 1D6EC 4R9WA 4A3KH 2OTJA 3A55A 3KLSA 1RF2D 5EPJA 5CC4A 2EPBA 2Z6KC 3TBIB 2WIIB 3LWUA 1M1KC 2VXWA 3PUVA 5IWAQ 1Q81C 1VQ7A 3AB9A 2Q2HA 2HQLA 1A2UA 3BVGA 3HOWH 1K3RA 1Y1WH 3S1RH 5D3DA 3E6ZX 3RUZA 2E2DC 3EROA 3N52A 2PYKA 1UE5A 3HOZH 1V9PA 4MNOA 3FKIB 2WAQE 3GV6A 2WFWA 3L7ZC 1EQQA 2RF4A 1EQVA 1YNNC 1O80A 4DNRB 1JT8A 5C5MA 2EYPA 1K28A 1PLFA 3MHBA 3CCQA 1YJ9A 1Z47A 2DY7A 1BF4A 3GTOB 1EUJA 4JV5L 2F0TA 4ZCKA 2VS1A 1L1OB 2PQAB 2MUYA 3A7AB 4ID6A 1AZPA 3CCSA 3S16B 4BBSG 1DD2A 1LUZA 1RL2A 1P8LA 2G5DA 1V1QA 5IP9H 2IWHA 3HOUG 4IJHA 3S9WA 1D5XC 1MD2D 3CQZB 1PH9A 1VMCA 4A93B 3E3XA 1STNA 4A3GB 2N78A 1YI2A 1ESRA 3V2TA 4CJ1B 2RHSB 4DV7Q 3A74A 4BBRG 1Y1VH 1H9RA 2YTXA 3TREA 2VQFQ 3QR8A 3ND8A 4UPAA 1RIPA 5A35A 3J81j 4RKBA 1SYBA 1BUVT 1ENFA 4RWSC 3RLNA 1PYSB 1WTHA 5FJ8G 3S2HB 5DM73 3A0JA 1SYEA 3S14B 1W6KA 3H09A 3NTHA 5IE8A 4G7HC 2CH4A 1BDOA 1KNAA 2ZTCA 4YHHL 4JK1C 3JAMi 3GTKH 2L1BA 4A3CG 4X66L 1PTOF 5IGFA 3K5OA 3FHWA 2Z6BA 1K9MC 2I46A 4NMZA 2Z4IA 3E5SA 5C4XH 2F0PA 2MFIA 1E0BA 2F0GA 5CMDA 2CH4W 3MXNB 1HCZA 2D9UA 2R7ZH 5BR8L 4JPBW 1SEBD 2BOSA 5M3FH 2R93B 1ICWA 2NVYB 1I50B 4J15A 1PFNA 1IW7C 5IT9L 4NXNL 4ALPA 5M5YB 4A3LG 5EPLA 4UP9A 2DNCA 1MGSA 1F2MA 4C3IG 4A3KB 3EQLC 4B3RQ 3D6WA 1Q86C 1FD7D 3K7AH 1VQCA 4KD4A 3K5NA 1JWUD 2CQOA 5JPNC 1A2TA 1ICFB 1VQBA 5TSSA 1RHPA 2JE6I 3OWEB 2UU9Q 3K58A 4QQBX 1F2YA 1Y1WB 1XMQQ 2XN9C 2A6HC 2B2UA 1C4QA 2QW7A 1WTOA 3QIAA 3K81C 1WCMH 2MP1A 3HOZB 4X3SA 1R4QB 3H3VI 1HR0W 2UUAL 1JE5A 2V4DA 1Q90A 4K14A 2NUCA 2YTYA 1U9RA 3KJPA 3VDYA 3VA7A 1RTNA 3B6YA 1UNSA 1KAAA 1V43A 4GZYC 4A3MG 3K0YA 2NYZD 1G51A 2J4XA 4NB3A 1TY0A 5G3LF 1YHQA 4V0BA 3U9SA 3CAMA 4P75A 4LUVA 4KTAA 4BY7H 4OWWB 2R92G 3I72A 3VR5A 4A3DH 3VR3A 4K8IA 4C3JB 4LF7L 1FGBD 2CVRA 1IBML 1CKNA 1DZ1A 4JI2Q 2OF1A 3GTGH 1OTCA 4IFDG 4CDDC 3MC0B 4BXXH 3H0GB 4K5VA 1ENAA 4BY1B 3NWTA 3HOWG 5F2DA 4DR5Q 1Y1VB 3I4NH 3FMCA 4DAVA 1WTQA 1WI5A 1X32A 1OXUA 5HGTA 2ZJPA 4NW2A 1VQ5A 4DK3C 1C8CA 4IUVA 1LYLA 3OWFA 1NE3A 2WINB 4KJOA 4APVA 4QUFA 1B50A 3A8IE 3J80E 1A8VA 2JA6H 4FNFA 1X3EA 5C44H 2KVMA 4PZ7A 2KCTA 4MN3A 2RA4A 5KGUA 3GTKB 2LY7A 5M9OA 1IYJB 3MXPA 4C1NI 2RDGA 2DNEA 5C4XB 2J0TD 3LNNA 1Y69U 5FLXL 2VW9A 1I5FA 4CDEC 1HPCA 4A4IA 4K6DA 1SN8A 3KLSX 3E9HA 1MHWC 1YBYA 4BA1I 4HJAA 1HR0Q 1IL2A 3TQYA 1BNZA 4RAUC 1E2WA 1CA5A 1CA6A 4DR3L 1KNEA 3PCOB 1EEID 4RGNA 3CHBD 1O7IA 1HNXL 3KBXA 2HD3A 4KMUC 2Q8RE 1WJJA 2E75C 3K7AB 3EFXD 3TEHB 3M9BA 2O5JC 4C3HH 5JVH3 4LF9L 4RG1A 2QA4A 1JWSD 1EOVA 2ES2A 4L5SA 4ILWA 4F8MA 1FJGQ 1PYWD 4IUNA 1JWMD 2UXBL 1D5ZC 3C1FA 1KRSA 4ABNA 1WCMB 1RDPD 5FKAC 3ZJYC 1TS3A 2KHSA 3RLOA 3H94A 4DR2L 3SGIA 3W5OA 1D5MC 3L3OC 3W3AA 4PV1C 1NY4A 1S4ZA 4TQUS 3CCVA 3CCJA 5J1ZA 2HT1A 2L5TA 4LF4Q 1O78A 4DAYB 2F03A 4UAIA 1Q46A 3KF6A 4MTNA 2OWOA 1VCIA 2R7ZG 4FXGC 4KHPQ 3Q0AA 4PQXA 1XNQQ 4DV1L 5M3FG 2VZAA 4UP8A 1QUQA 1QVCA 5IODA 1BCPD 1KIXA 4MIUA 3VYUA 2L4NA 4A3DB 2OCEA 1DJRD 3J80c 1PH8A 3GQBA 1EWCA 1A3UA 1SNQA 2RCNA 1F9SA 4CBVA 4JYAL 1MSHA 2I07B 1KL9A 3S1NB 1IL8A 1BQQT 4JI7L 4N9PA 1JOOA 1VQ8A 3HOVH 1KDBA 1FR3A 3NUCA 3MTSA 1PH7A 2IHFA 5GROA 1IBLL 1KAWA 1STBA 1N34Q 1JQYD 2E76C 2QDBA 1GJXA 4QJFA 2JA6B 3U58A 5C44B 1PH6A 4HN7A 5DAUA 1YHAA 2MGSA 1G291 1NNXA 5M3MH 1GOZA 2O2LD 4GKJQ 3PV0A 5IGEA 2JA8G 4BY7G 1OXTA 4IUQA 4HJ8A 3S1MH 1FVIA 3OPOA 1Q8KA 2QCPX 1LTSD 4DPGA 1STYA 1PTOC 2Q2IA 2BH8A 2FJ2A 4A3IB 2K33A 2UU9L 2Y0SB 3TRZA 1XMQL 3CRKC 1PH3A 1KLUD 2BCOA 4AQYL 1XMOL 2LS01 4K2LA 4M1UB 3PMFA 4BXXG 2CHBD 4GOPB 3I4NG 3LGJA 2EYJA 4K0KL 1II3A 1VQEA 3KUPA 3CCMA 2CWPA 4IPHA 1MSGA 1B8AA 1XPUA 2EZVA 4I65A 2F0UA 3AMUA 1OXXK 3CD6A 2VY3A 5M5WH 4DUZQ 2EQSA 2SNMA 2B2TA 5ELOA 5GAHC 3I90A 1XX8A 1GUWA 2I5HA 5ELCA 3RMHA 1YEZA 4OWTB 4LFAQ 5C44G 4CDFC 3J81i 3QWNA 4JI1Q 1NTGA 3Q24A 1LT5D 2X6GA 2N55A 1B44D 3AU7A 4LF8L 1SROA 2PW7A 4DV6L 2WP8J 5GQOA 3U50C 3F2DA 3DEOA 4J1MA 1U4LA 4DUYL 2C35B 3NEMA 4EQNA 4Y7NB 1SDFA 2KA7A 2M2LA 3UDFA 4B3SL 2I5LX 1TS5A 4JI5L 3D0FA 3J81c 4BBSH 1EY5A 1TWAB 4ZK9B 1QOHA 1RJTA 3HGBA 2E2HB 2F4VQ 5I2XA 1X54A 2H4OA 1TR5A 1E7ZA 1QZHA 4FF4A 1I3QB 1MJCA 1ET9A 1HNZQ 2DJFC 1LTLA 4JOIA 3S24A 5J22A 2G9DA 3ERQA 3GD7A 1IKLA 3MA2B 4C3HG 3NBIA 2NN6I 5LMUL 1XXGA 2ZTEA 4KLKA 1F2LA 4RGTA 5EKIA 1XNRL 2GVBA 4JCVE 4YCVA 5FJ8H 2CW0C 3HOVB 5JJIA 3U4VA 3K7UC 4DNIA 2EYOA 4WRDA 1SAPA 3SVMA 1VQAA 1TY2A 2KUMA 3PUYA 4DV5Q 2RBMA 4TVAB 5I6WA 4ZLTF 2KOLA 5C3WA 1WD1A 3VYRA 2NVQH 5GAGC 1GD7A 3GTLB 4GLXA 3GDEA 4DXGA 4GN4B 1O7ZA 4R4IA 4DK6C 3NENA 2H1EA 2BA0A 2NVTB 3M3YH 2F3IA 1JJGA 3I91A 3VA5A 4LNQA 4P2CB 1ILPA 3TP7A 2EJFC 5IYCG 3F2CA 3C46A 3S1MB 1I94L 4JOIC 4AYBG 5E1FA 2B2WA 4A3LH 3CRLC 4GN5A 1IHZA 2MPMA 3FPPA 1K83H 4GKKL 4OONA 3GO5A 3VR6A 1R9TH 5CV8A 1GHJA 2L12A 2NVXH 2JJQA 4K6LA 1SFOH 1S5DD 4DKAC 1TS2A 4M8AA 1E22A 2B2YA 4OEMB 1VDZA 2A68C 4LF5Q 1WD0A 4JI8Q 3BDLA 1FGUA 5C0XG 1SE3A 4X62L 2R7FA 4OXPA 4G7ZC 3CMAA 4LF4L 4QL5A 2F0NA 1B3AA 1XTDA 4HCEA 5M5WB 5HGQA 3C1EA 2YU9B 4DR1L 4B08A 1PFSA 1G91A 4PMBA 4XIGS 1V8QA 4A3JH 1XNQL 3PO3G 3X3NA 2V1CC 1W2BA 3T1YL 5LMNW 2X6LA 1F9PA 3WOFA 2QF7A 1X56A 5M3MG 2F3VA 1S40A 1I6VC 4HTHA 5JAVA 2EY5A 1EY9A 2K75A 4KI0A 1L0YB 1CM9A 1SMYC 1VQIA 1BR9A 3OMGA 1WTPA 1VQPA 1EYDA 1CFMA 4DXFA 4C2MH 4X64L 4KY6A 5H1SE 3GTQH 4BBSB 2EVBA 3VR4A 2B2YC 3HOUB 4IALA 3ULPA 4UP7A 2XVSA 1HQMC 2TSSA 1GM5A 3K8AA 2AWNA 2F0MA 3BG3A 4GLVB 4IFDH 3FRPB 3AQQA 4LF6Q 3D4DA 3HEJA 4JI3L 1U5KA 1CQFA 2K5HA 1S5ED 4BBRB 1MI2A 1DOMA 4QGUA 1A62A 1WVLA 1SYGA 1UAPA 2AUKA 3NE5B 2Y0SE 5IGGA 1HTPA 4DAMA 3JAME 4OO1H 4NDXA 4YCUA 1PRTD 1PXUA 4P71A 3D31A 1YZ6A 4CGYB 4Q0FA 2D0OA 1QB5D 4A3BG 2SNSA 3MXUA 1E24A 4DV2L 2AQ3B 3NPPA 2MNAA 3PF4A 1P16A 2Q2TA 1AN8A 3HOYH 2K6AA 4OGQC 1ZYRC 2UXCQ 2P5ZX 1VQMA 3UDGA 4JI4Q 3GTJH 3CF5A 2E2IB 4TRDA 1SYFA 1XPOA 1EYAA 3T53B 4OX9Q 2IJ0A 4X65Q 4X3TA 4P73A 3SHLA 4IQZA 4ZKCB 1QE6A 3M85A 1EY7A 1CK1A 4K8JA 1TWGH 1YJNA 1HZBA 2UUBL 2KCCA 1G6PA 1YNND 1ASZA 1NMFA 4HIOA 4JI0L 4FP5D 2F0SA 1WTWA 1N32L 2A19A 2OXPA 2Z4HA 1U0LA 1PH5A 1K83B 4F88A 5LMNQ 4DUZL 1E3PA 1ML0D 3NBHB 4C3IB 1R9TB 1ZYRD 3RZOH 2NVXB 1BVSA 1TKWB 3R93A 1O7LA 3A5ZB 1LTRD 1VQ6A 1RKNA 2D5DA 1H9SA 1STHA 1QILA 3EN2A 5BN3A 3GTMB 1GUGA 1FNVA 3K0XA 3KDFB 4B3ML 3PUWA 4IPGA 3EVQA 5EKKA 2ZM6L 1PV4A 1Z9FA 2QILA 3BJUA 3R2TA 3OYYA 4OELB 3WDNA 1N33Q 5C4ZA 2BE5C 4A3MB 4QF4A 1HNWQ 1L0WA 4B9XA 4JW0A 2QKIC 4YCWA 1TWCH 1N36Q 1X3PA 2BDOA 3JAMc 2ID0A 5E4WC 3OTOL 2JYOA 4CKEA 2E5LQ 1F9RA 1NJIC 1X55A 3D8GA 3NELA 2VB2X 2PCFB 2EJGC 2NZHA 2R92B 1H95A 4C2MB 5DM63 3PIPA 1SXTA 3G71A 1SNDA 1J5EQ 1LT6D 3S17H 1CUKA 2PI2E 3OHXC 3HKSA 3W2DA 2E8GA 4YWKA 3NXWA 2BE5D 2E2JH 2LKVA 4DF7A 4A3EH 4DV5L 2A69C 3TS0A 1OXVA 3HOWB 4U673 3S1RB 1S5FD 3UDXA 4H13C 3T1HL 3U4ZA 2C9OA 4FF2A 2HDLA 2RVLA 4BWGB 5CR3A 1E2VA 1IW7D 5LL6X 3KF8A 4DK1A 2B63H 1SR3A 2NTTA 3PSIA 5DNFA 5C3EG 4OL7A 4JG2A 4A3JG 2EDGA 2R6GA 2XWBB 3K5LA 2F0JA 5KNBA 4DV4L 4HIMA 2YTVA 3PUZA 2M00A 2ZJQA 4QMGA 1VMPA 3I4LA 4GNXA 1IBKQ 2WKDA 4PG3A 2A6HD 1AH9A 1B70B 2JA8H 3G48A 4LFCQ 3GTPH 4LAAA 1QG7A 4H7BA 2MO1A 1EIFA 1PH4A 2OQ0A 4FDBA 1IZ6A 1IKMA 2IPKD 1EY4A 4JI8L 1XWEA 4TSSA 2AHOB 5IOCA 1A15A 1EEFD 3T16A 3BYTB 3EA6A 4HSPA 4PMCA 1IXRA 4RA8A 2UUCQ 4LK1C 3DWPA 3ULJA 1TT2A 4OO1G 1CI3M 4X6AH 3NP8A 3HOXH 1Q12A 3BDOA 4HJ9A 1TXYA 4ME5A 3ULLA 1HH2P 1UWVA 4JBKA 4DR6Q 2IHEA 3NK9A 1PFMA 1X9NA 3IFDA 3VR2A 4WJ4A 2UXDQ 2F0KA 2ATWA 4GNXC 4FVMA 4DR4Q 2JXMB 2AKWB 3HOYG 4XT1B 5AJ3Q 1SJED 1ZKOA 4JC0A 4YY3Q 1JORA 5I4DA 3U9OA 5JJLA 3KBGA 2VUMH 3DMUA 2F0QA 2NB0A 5CV4A 4E6IA 3KYHC 2R7ZB 5IWAL 3TZUA 4DR7Q 1NBWA 5JJZA 2KCMA 2PW5A 1SMXA 5M3FB 2K03A 1HHVA 3TDQA 1J9OA 1KLGD 1Q8IA 5CV5A 1N8RC 1I4HA 3A8JE 3J80L 1HA6A 4XYOA 3H3VC 3DUZA 1J6QA 3S17B 2CWAA 1NUCA 1TS4A 2OEOA 3BZCA 4IPCA 5EBCA 2E2JB 1L0XB 1HUMA 1OXSC 4O0AA 3HZXA 3OSOA 5E4XA 3URYA 4MHEA 1VQDA 1K8GA 3TN2A 1K8AC 1I6HH 4JI4L 1I4PA 1F77A 2EXDA 3NWSA 1VQOA 5C5LA 1EQTA 1B53A 1PA6A 1AE3A 3RN5A 4L6TB 3M7NA 2KENA 4AIMA 3S1QH 1K8OA 4KN7C 1CKNB 3FDTA 2RHQB 5K36H 1PTOH 5CBEE 3PO2H 1X6OA 2ZXOA 4Z9CB 1YNJC 2F0HA 2F0FA 4HIKA 2KHJA 2B2VA 2IL8A 3TP8A 4DV7L 2VQFL 4WJWA 1MJEA 5IYCH 1NAPA 2JA8B 4BY7B 2NBFA 3GTPB 1Z6HA 1EIGA 4YWMA 2K5WA 2CFMA 4XYQA 2K5DA 5LL6S 3X3MA 4DN4M 1MIUA 3W1GA 3NQIA 1AZQA 2IY5B 1CZGA 3GTGB 2FHTA 4A3EG 4HJ7A 1BCPB 2ZXPA 5CORA 3I4NB 3BS1A 1G2TA 1VQNA 1NMGA 3TP5A 2F0VA 3J81E 4HEDA 1SE8A 2PZWA 5C0XH 1LV9A 4KJNA 2B63G 3H6MA 4U68A 1HNWL 4EGVA 5JEAH 5EBDA 1LO5D 2J7ZA 2QEJC 3I70A 1HZCA 1L2FA 3BZDB 3HFZB 3PO3H 2B2VC 3PUXA 4GN3B 2AUJD 4JVZA 4QB4A 4DV3Q 3HKZG 1LTBD 4IUTA 1SNPA 5A2QE 4KD3A 5CBAE 2A6EC 3OMCA 1J5EL 2SEBD 3I73A 4B3RL 2R7DA 2A5HA 5IIFA 1EY0A 4A75A 1E1TA 3J81L 1G8ZD 2R61A 2EYLA 1KDCA 4JI6Q 1LABA 3I4MH 4R8NA 5C4JH 1WTRA 2R3ZA 3UE0A 4RGOS 2QGQA 2O4XA 3PGZA 4OHJA 4Q5VA 2B39A 3G6JB 3IL8A 4FYDA 2F1MA 3MZ5A 1M90C 4OWXB 4CKBA 4C3HB 3HOXG 5A2QL 1DONA 3RD4A 2HHHQ 2JSOA 3CCUA 3CC2A 1TWHH 5KEEA 1M8AA 1B7YB 1PTOD 4A3BH 1QUQB 1Q7YC 2CKZB 1JE4A 1V1PA 1I6HB 1EOTA 5K5PA 2PI2A 2BA1A 1STGA 1TWFH 4LFCL 1WYDA 2F0DA 3SK4A 1STAA 3CCEA 2PZUA 1A6XA 4BA2I 2ENBA 3E0EA 1U4MA 5E3FA 4JI2L 2VUMG 3C3LA 2K28A 1PTOB 4NXMQ 4IZ8A 2K4KA 4MZ9A 4DU9A 1EL0A 4PMWA 4DR5L 4JBJA 1VF5C 2PMZB 1KD1C 4PZ8A 3OW2A 4AYBB 2F3WA 5EKLA 1H9KA 2D0PA 5I9PA 2L55A 3SK8A 1WOCA 1SE2A 4CJ2C 4HJ5A 4KY7A 4DR4L 4ULLA 3F2BA 1CSQA 1KTKA 2WAQG 2WB1G 1I4XA 4NKLA 2AWOA 4DA2A 2K32A 3G6EA 4HMIA 2RDFA 4NXNQ 4UDUC 1JICA 1G6ZA 1BBWA 2CCZA 1C9OA 1HR0L 5G3LD 3PO3B 5K36G 1ET6A 4ZKBB 2F52A 2EYMA 3PO2G 2SDFA 2DN8A 1KRTA 5M3MB 1DOKA 3QJYA 2CW0D 1ENCA 3G7LA 3MEFA 5FLMH 2KECA 3R3OA 2M9VA 3CW2C 2D2CC 2XWJB 1KDAA 2Z1CA 3Q6SA 4YWLA 4AH6A 5KYIA 4R4QA 2YYZA 3T13A 1VQHA 3DEPA 3H91A 2LSSA 1TQOA 1FJGL 3S16H 4ZRZA 1CHPD 2ZXRA 4RHSA 3GP7A 1B4OA 3A54A 4G57A 1LT3D 1SNOA 5JPMC 1OO9B 3F1ZA 2ICEC 2NTSA 1ASYA 3KJOA 3ICEA 4FO2A 3CQZH 2OQKA 4JBMA 4A93H 2QEXA 2JA5G 3VYSA 4A3GH 4OIJA 2HCCA 1VQKA 3C2PA 1EIYB 1W6JA 5DEHA 1NR2A 1L1OA 2PQAA 2NWGA 5JEAG 3KLRA 5C3EH 2VQEQ 3CKIB 2K50A 4KHPL 2JA7G 4LF7Q 4A3BB 1IBMQ 5KNDA 1T5XD 3S2HH 2L9HA 3DHQA 4A3FG 3BZKA 1TWFB 4P74A 5I9OA 1SLJA 4NPSA 1K3BC 2EIFA 1WTVA 3KFUA 1RTOA 4KKSA 4X3KA 1PH1A 3HS0C 2IW3A 2A68D 1HUNA 3PIP3 1KQSA 4DK0A 3ZYYX 3CPWA 3NBHA 4ZUJA 3MFYA 1X3GA 4C56C 1Y8PB 1JB3A 1LT4D 4QIWB 5HURA 1B9NA 3I4MG 2IX3A 3QOJA 3AFPA 4O1NA 2YV5A 3JC66 4ZQ3A 3M4QA 1KXLA 5EPKA 4KY5A 1JC7A 4IFDJ 1UUPA 4XTCS 2RQXA 3CCLA 5IY0A 1I50H 1N34L 1YJWA 5M5YH 3RZDH 1L1OC 1YITA 1S5CD 5COYA 1K0SA 1A3TA 1BCPF 1SMYD 1GUSA 5E7NA 1DM0B 4DV3L 1JR0D 2DJGC 3FVQA 3MXNA 1HRJA 1G2SA 4GKJL 2PQEA 4F87A 1BKBA 2EY1A 4CDCC 4EQPA 4EX5A 1GHKA 4WJ3M 2KHIA 4DR3Q 1XPRA 2NVQB 1EYCA 3P1HA 1HNXQ 3PIOA 1PRTB 5ELEA 1FYCA 1S5BD 4JI6L 5ISRA 4IPDA 4B3TQ 2WB1E 2AQ2B 1X3FA 3MWYW 2DGYA 3SK6A 1CT1D 3STBC 4UY8C 3M3YB 1S72A 3TS2A 3BDCA 1JOQA 2JEBI 4NP5A 4LF9Q 4JBWA 3JAML 3CPFA 1EFWA 3ERSX 3I3CA 1UEAB 3P7JA 4KKTA 2UXBQ 4IOAA 1S3OA 1ONLA 2HHHL 3PQIA 3D4WA 4RH6A 4DR2Q 2JA9A 4C3JH 1SFOB 2PMZE 1PZKD 4LFAL 1SYCA 3KK7A 1CTMA 2I5MX 4JI1L 3L9AX 4N8FA 1NCVA 3STBD 4AYBE 1TU2B 4V190 3OOCA 2MHVA 1C48A 1IYVA 2K5QA 3QG1A 2KEDA 3H0GH 4BY1H 4DV1Q 3D4RA 1FNUA 1ZXTA 4NXML 1U4RA 1MBYA 1J8IA 4GS3A 5C3EB 5ELFA 1UE7A 3TP6A 1WFQA 4GLAC 4A3JB 3FKIG 4N8X1 3ND9A 1LM0A 2NN6G 2ZT9C 5CV7A 1LTAD 5IT9E 2F4VL 3DM3A 1I4GA 3M4OH 1T9HA 3BVZA 4H44C 1V1OA 4I7AA 2IX0A 4JYAQ 1Q3LA 3I56A 1GXDC 1PYBA 1K0RA 1HNZL 4LFBQ 1QZGA 4JI7Q 3L2PA 5FLMG 1B9MA 3V96A 5GAEC 4RCOA 4KHZA 2ASBA 4H0LC 2XRSD 3A8KE 3GTQB 3A56A 4LJZC 1SNCA 3K80C 2PNHA 1SRUA 2KJXA 4XQNA 1IBLQ 1QWYA 3CC4A 2K52A 3F8TA 4P72A 3SK5A 4YIJA 1AFPA 4J8QA 1D1IA 1Q82C 2Z8LA 4A93G 5KYLA 3RR5A 4A3GG 2EYHA 1BBUA 3NSWA 1JOKA 4CKCA 3RZDB 4H02A 2KCNA 2N3SA 1UE1A 5IGBA 4QY7A 3P20A 2PO4A 1SE4A 2K05A 3Q22A 1PVOA 5ELDA 1LLRD 3HRZC 1Q1EA 4K5XA 2A1AA 1XJVA 4AQYQ 1XMOQ 1ESFA 5D3IB 4IOCA 5JOBA 3HOYB 2A69D 1EFID 5C6AA 3N6RA 5T1GA 4O42A 3K59A 3FEWX 4ZAIA 3NTKA 3GTJB 2G9HD 1JCKB 5IYDG 2GN5A 4K0KQ 2A74C 1AP0A 4IUPA 2TMPA 4ODGA 3S2DH 3I4OA 2B8FA 3H3VH 4G4KA 2KBNA 3BU2A 3I7FA 1H9SB 1YVCA 3T56B 3AYHB 2JN4A 4DNTB 1Y8NB 3BVMA 4WFN3 4FXDA 1TWGB 1B2TA 4LF5L 1RCVD 1E1OA 3RN2A 1D2BA 3I8ZA 5KIXA 1KHIA 4HAEA 4LWCA 2R93G 1AE2A 3J7AF 3M7GA 3QB3A 4QIWE 5IT9c 3D3RA 2VQEL 5FO9B 1XTCD 3RZOB 1N9WA 3NTIA 4LF8Q 3DWQA 1RODA 1K73C 2KQ3A 4DV6Q 4A3KG 1KC8C 4J6HA 1K8MA 2VNUD 4DUYQ 5EGTA 4HIDA 1M4VA 5AFWA 4DAYA 4B3SQ
chains in the Genus database with same CATH topology
2F3IA 3PUXA 4IJHA 4JI5Q 1JJGA 3S1NH 4GN3B 4DV3Q 3HKZG 1PH9A 4LNQA 2Z0SA 4R4TA 5IYCG 2AMCB 2LXKA 1Y1WG 2N78A 1YI2A 2LXJA 3F2CA 2ZTDA 1I94L 1J5EL 2RHSB 4DV7Q 3A74A 4JOIC 4AYBG 1Y1VH 2YTXA 3TREA 4BBRG 3CMEA 2VQFQ 4B3RL 1JJCB 4UPAA 3HOZG 4A3LH 1RIPA 4GN5A 2R7DA 4GKKL 1K83H 2D62A 4OONA 3GO5A 3J81j 4A75A 1R9TH 1E1TA 1X65A 2IX1A 3RLNA 2NVXH 2JJQA 1PYSB 2JQOA 1SFOH 4JI6Q 1QVFA 4DKAC 5FJ8G 3I4MH 3A0JA 5ELNA 1E22A 5LMUQ 4LF6L 5C4JH 3UE0A 2QGQA 5IE8A 2JK8A 3G4SA 1XNRQ 3PGZA 4LF5Q 5JJKA 3UDIA 2ZTCA 4YHHL 4JI8Q 1FGUA 2N49A 3JAMi 5C0XG 1VQJA 3GTKH 4A3CG 4X62L 2R7FA 4X66L 3KF8B 4OXPA 3CMAA 4LF4L 1M90C 5IP7H 3FHWA 4QL5A 4OWXB 1XTDA 1K9MC 5HGQA 3HOXG 4LW1A 4DR1L 5C4XH 1PFSA 2MFIA 1D8LA 5IP9G 4XIGS 5DLQE 2B3GA 4A3JH 4L5TA 1XNQL 3PO3G 2HHHQ 2V1CC 3CCUA 4A3IH 3CC2A 1TWHH 1W2BA 3MXNB 1B7YB 3T1YL 5LMNW 2R7ZH 5BR8L 4A3BH 1QUQB 1Q7YC 2CKZB 2IT1A 5M3MG 1X56A 5M3FH 4GNXB 2PI2A 3H0GG 1S40A 2BH2A 3J7A5 2UXCL 4BY1G 2BA1A 1TWFH 4J15A 4LFCL 1WYDA 2GVAA 1Y1VG 1YNXA 2K75A 4O2DA 4KI0A 4NXNL 4ALPA 4B3TL 3CCEA 4A3LG 1CSPA 1VQIA 4UP9A 2VL6A 2H5XA 4BA2I 4OX9L 4X65L 3E0EA 1VQPA 2K5NA 1I94Q 4C2MH 3Q8DA 4JI2L 4X64L 2VUMG 5H1SE 3GTQH 4B3RQ 1Q86C 4NXMQ 3K7AH 1VQCA 4GKKQ 2CQOA 2K4KA 4MZ9A 3ULPA 4UP7A 1VQBA 1GM5A 2JE6I 4PMWA 4L5QA 4DR5L 1GVPA 3K8AA 2AWNA 4JBJA 4GLVB 2UU9Q 4DV0Q 4QQBX 1KD1C 3AQQA 1XMQQ 4LF6Q 5LMNL 4PZ8A 4JI3L 1U5KA 3OW2A 3RLFA 4GOPA 2K5HA 4PZ6A 3K81C 1A62A 4QGUA 1PH2A 1WCMH 1YIJA 3H3VI 1HR0W 2ALYB 2Y0SE 2UUAL 1JE5A 2D0PA 4DAMA 2A8VA 4X62Q 5C4XG 4YCUA 5FLXc 2YTYA 3J80i 3H15A 3KJPA 1WOCA 4P71A 3VDYA 1MKHA 3D31A 1YZ6A 3B6YA 4Y7NH 1V43A 2D0OA 4A3MG 4HJ5A 2NZOA 4DR1Q 4A3BG 4DR4L 1C7YA 1TWAH 1E24A 4DV2L 3S15H 1G51A 5GADC 2MNAA 3F2BA 1PHJA 2E2HH 1CSQA 2WAQG 2WB1G 1CKMA 3T1YQ 4NB3A 3PF4A 1YHQA 5C0XI 1P16A 2Q2TA 2AWOA 2FXQA 3HOYH 3CAMA 2K14A 1DGSA 4P75A 2JA5H 4LUVA 1VQFA 4POFA 3G6EA 4OWWB 1I3QH 4BY7H 2UXCQ 5C0XJ 2R92G 1N33L 1VQMA 3UDGA 1QVGA 3GTJH 4JI4Q 4NXNQ 4A3DH 1BBWA 3CF5A 2CCZA 5M5XH 1C9OA 4LF7L 1XPOA 1HR0L 1IBML 4OX9Q 5JEAJ 4X65Q 5K36G 1CKNA 1N36L 4A76A 2F52A 3PO2G 4P73A 4JI2Q 4X64Q 2N8NA 3CC7A 1KRTA 4LFBL 2JA7H 1VQ9A 3M85A 1OTCA 2E5LL 3GTGH 4IFDG 1TWGH 1YJNA 1JMCA 2OTLA 1HZBA 3UE1A 3WWVA 4A3FH 2UUBL 5HY6A 4BXXH 1G6PA 1ASZA 1NMFA 4R1JA 4HIOA 4GOPC 4JI0L 3HOWG 4DR5Q 3I4NH 1N32L 1WCMG 2A19A 1WI5A 2ZJRA 3MEFA 5FLMH 1OXUA 1U0LA 2ZJPA 1PH5A 3CW2C 5LMNQ 4DUZL 1VQ5A 1E3PA 3NBHB 4JI3Q 4YWLA 4DK3C 4AH6A 3RZOH 4R4QA 2YYZA 3GTLH 1BVSA 5EAYA 1LYLA 1VQHA 1UE6A 2LSSA 3A5ZB 1NE3A 1FJGL 1VQ6A 3S16H 4APVA 3M4PA 4POGA 2I0QA 1A8VA 3F1ZA 3EN2A 5IYBH 1ASYA 1A63A 3KJOA 2JA6H 2NVTH 1X3EA 5C44H 4PZ7A 2KCTA 3ICEA 3K0XA 3CQZH 2OQKA 4JBMA 4DV2Q 3KDFB 4B3ML 2HIVA 4A93H 3PUWA 4IPGA 2QEXA 1PV4A 2ZM6L 1IYJB 1EYGA 2JA5G 2Q2UA 1Z9FA 4A3GH 1Y14B 1VQKA 4A3DG 1EQRA 1EIYB 3BJUA 3A5UA 3OYYA 1L1OA 2PQAA 2VW9A 5JEAG 1I5FA 4JV5Q 5C3EH 2VQEQ 4A4IA 1N33Q 1SN8A 2K50A 3KF6B 3E9HA 4KHPL 2JA7G 4LF7Q 1YBYA 1HNWQ 1L0WA 4BA1I 3CXCA 4HJAA 1HR0Q 4YCWA 1IBMQ 1IL2A 3TQYA 3S2HH 1TWCH 4A3FG 1N36Q 2K5VA 3BZKA 3JAMc 4P74A 1IBKL 2ID0A 3OTOL 1SLJA 4DR3L 3PCOB 1HNXL 2E5LQ 1NJIC 1O7IA 1X55A 2EIFA 3IRBA 4NPSA 3KFUA 1VS0A 2UUBQ 1PH1A 3NELA 4IJLA 3ER0A 4JI0Q 2HIXA 2NZHA 2MQHA 1KQSA 1H95A 1WJJA 1N32Q 3CPWA 3PIPA 3G71A 4R4CA 1X3GA 3AFQA 1J5EQ 3TEHB 3M9BA 3L0OA 4C3HH 3S17H 1CUKA 2PI2E 2YU9H 4Y52H 4LF9L 3I4MG 3HKSA 4RG1A 2E8GA 2QA4A 4YWKA 1EOVA 2ES2A 4L5SA 2JA6G 1EWIA 2E2JH 2JEAI 1FJGQ 3AFPA 4A3EH 4DV5L 2YV5A 1Q1BA 3JC66 3M4QA 1KXLA 3I55A 3TS0A 1OXVA 2UXBL 4IFDJ 1KRSA 2UUCL 3E9IA 3DLLA 1FL0A 4XTCS 3UDXA 3ZJYC 5IY0A 3T1HL 3CCLA 1I50H 3U4ZA 3RLOA 4DR2L 4IO9A 1N34L 3SGIA 3W5OA 1YJWA 4B3MQ 5IP7G 5M5YH 3RZDH 2ZM6Q 1L1OC 4YHHQ 1YITA 3AEVA 2B63H 1SR3A 3CCVA 1NY4A 3PSIA 4TQUS 5C3EG 3CCJA 2HT1A 4X66Q 5E7NA 4JG2A 4LF4Q 4DR6L 4A3JG 1VQ4A 3RNUA 4DAYB 4A3IG 1HZ9A 4DV3L 1Q46A 3KF6A 2R6GA 4MTNA 2UXDL 2Y0SG 1VCIA 2OWOA 2R7ZG 3HOUH 4KHPQ 4DV4L 1XNQQ 4DV1L 2YTVA 4HIMA 3PUZA 2VZAA 5M3FG 4GKJL 4UP8A 1BKBA 1QUQA 1QVCA 1D7QA 2ZJQA 4EX5A 5AJ3L 1KIXA 4WJ3M 2XTIA 5BR8Q 4GNXA 1GKHA 2KHIA 1IBKQ 3OTOQ 4DR3Q 4YY3L 1XPRA 4PG3A 2OCEA 1HNXQ 3PIOA 4BBRH 1AH9A 1B70B 3J80c 1PH8A 3G48A 2JA8H 4LFCQ 3GTPH 4JI6L 1JJ2A 4IPDA 2MO1A 2WB1E 4B3TQ 1EIFA 3EIVA 4DR7L 1X3FA 4LUZA 2DGYA 2RCNA 4JYAL 3FKIH 2OQ0A 3STBC 1PH4A 4UY8C 3CP0A 1IZ6A 4FDBA 1KL9A 1HJPA 1S72A 4ME3A 4RMFA 3TS2A 4JI8L 1VQGA 2JEBI 4LF9Q 2AHOB 4JBWA 4JI7L 3CPFA 1EFWA 3ERSX 1VQ8A 3HOVH 3KLWA 1HZAA 1UEBA 1C0AA 2UXBQ 4A3CH 4IOAA 1IXRA 2UUCQ 1PH7A 1S3OA 3GTOH 3ULJA 4OO1G 2IHFA 5GROA 3T1HQ 2HHHL 4DR2Q 1IBLL 1KAWA 1N34Q 4X6AH 2JA9A 3HKZE 4C3JH 3HOXH 2E2IH 1Q12A 4HJ9A 1A0IA 2PMZE 2UUAQ 1TXYA 3ULLA 4LFAL 1HH2P 1UWVA 2I5MX 4QJFA 4JI1L 3U58A 4JBKA 1PH6A 2IHEA 1JB7A 4DR6Q 3STBD 3KOJA 4AYBE 1X9NA 1YHAA 3FP9A 4WJ4A 2UXDQ 3W1BA 1G291 5M3MH 4GNXC 2ATWA 4L5RC 4DR4Q 2AKWB 3H0GH 4DV4Q 4BY1H 4DV1Q 3HOYG 4GKJQ 3PV0A 2L15A 2JA8G 3J7ZC 4BY7G 1OXTA 5AJ3Q 4HJ8A 4NXML 4EQ5A 3S1MH 1FVIA 4GS3A 1UE7A 4JC0A 1Q8KA 4YY3Q 2MO0A 4C3IH 1WFQA 4GLAC 4DPGA 3FKIG 2DUDA 5JJLA 1W3SA 2VUMH 2BH8A 1LM0A 2Q2IA 2NN6G 2F4VL 3DM3A 2UU9L 4DV0L 3KYHC 3TRZA 5IWAL 1T9HA 1XMQL 1PH3A 3M4OH 4AQYL 1XMOL 4DR7Q 1NBWA 2IX0A 2KCMA 4JYAQ 1SMXA 3I56A 4BXXG 2Z6KA 3HOVG 3GTMH 3S14H 1PYBA 1K0RA 3I2ZA 4R4OA 1HNZL 4GOPB 4LFBQ 3I4NG 1QZGA 3LGJA 4K0KL 4JI7Q 1VQEA 3L2PA 5FLMG 3CCMA 1N8RC 5GAEC 2CWPA 4IPHA 5J3BA 1B8AA 4KHZA 1XPUA 2ASBA 1J6QA 2CWAA 1OXXK 5IYDH 3CD6A 1YHBA 2VY3A 3K80C 2PNHA 5M5WH 4DUZQ 2EQSA 3CCRA 3BZCA 4IPCA 1SRUA 5ELOA 5GAHC 1IBLQ 2I5HA 3PF5A 4A3MH 1OXSC 5IYBG 3CC4A 2K52A 3F8TA 1VQLA 1YEZA 4OWTB 4P72A 4O0AA 4LFAQ 5C44G 3J81i 4IFDI 4LUOA 4JI1Q 2XGTA 1GO3E 1VQDA 1NTGA 3EBEA 1Q82C 1K8GA 3RR5A 1K8AC 4A93G 1I6HH 4A3GG 1BBUA 4JI4L 2EXDA 1CKOA 1VQOA 4H02A 3KDFA 4LF8L 2N3SA 1UE1A 2B29A 1SROA 4QY7A 2NVYH 2R93H 4DV6L 1AE3A 2WP8J 5GQOA 3U50C 3RN5A 3F2DA 1PA6A 3M7NA 2KENA 4OO1I 4AIMA 4DUYL 2R92H 3S1QH 2C35B 3NEMA 1CKNB 1PVOA 3UDFA 4B3SL 2I5LX 4JI5L 4A3KH 3D0FA 3J81c 1Q1EA 4BBSH 2OTJA 2RHQB 3PO2H 1X6OA 2Z6KC 4HIKA 2KHJA 2F4VQ 2A1AA 1M1KC 1XJVA 1X54A 5IWAQ 3PUVA 1Q81C 1VQ7A 4AQYQ 1XMOQ 2Q2HA 4DV7L 4IOCA 2HQLA 2VQFL 1E7ZA 1MJEA 5IYCH 1QZHA 3HOWH 1K3RA 1Y1WH 3S1RH 1MJCA 1HNZQ 1LTLA 4YWMA 4K0KQ 2CFMA 4JOIA 2GN5A 5IYDG 3S24A 1UE5A 3HOZH 3S2DH 1V9PA 3I4OA 4MNOA 3GD7A 1MIUA 3H3VH 2KBNA 2WAQE 3BU2A 3I7FA 2NN6I 5LMUL 2WFWA 3L7ZC 1EQQA 3W1GA 2ZTEA 2RF4A 1YVCA 3AYHB 2IY5B 4KLKA 1XNRL 2GVBA 4JCVE 4YCVA 5FJ8H 4HJ7A 4A3EG 4LF5L 1E1OA 3RN2A 1JT8A 5JJIA 3U4VA 1KHIA 3K7UC 4LWCA 4DNIA 3CCQA 1YJ9A 1Z47A 2R93G 1VQAA 1VQNA 1AE2A 3PUYA 1NMGA 1EUJA 4QIWE 4TVAB 4DV5Q 5IT9c 4JV5L 1SE8A 2VQEL 2VS1A 2NVQH 1L1OB 2PQAB 5GAGC 1GD7A 1N9WA 2B63G 4LF8Q 3CCSA 4GLXA 1HNWL 3GDEA 1K73C 4DV6Q 4A3KG 1KC8C 2VNUD 4GN4B 4R4IA 4BBSG 4DK6C 4DUYQ 1HZCA 1LUZA 3NENA 4HIDA 1L2FA 1RL2A 1P8LA 5IP9H 1V1QA 2BA0A 3HOUG 3HFZB 3PO3H 4B3SQ 3M3YH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3I A;  3PUX A;  4IJH A;  4JI5 Q;  1JJG A;  3S1N H;  4GN3 B;  4DV3 Q;  3HKZ G;  1PH9 A;  4LNQ A;  2Z0S A;  4R4T A;  5IYC G;  2AMC B;  2LXK A;  1Y1W G;  2N78 A;  1YI2 A;  2LXJ A;  3F2C A;  2ZTD A;  1I94 L;  1J5E L;  2RHS B;  4DV7 Q;  3A74 A;  4JOI C;  4AYB G;  1Y1V H;  2YTX A;  3TRE A;  4BBR G;  3CME A;  2VQF Q;  4B3R L;  1JJC B;  4UPA A;  3HOZ G;  4A3L H;  1RIP A;  4GN5 A;  2R7D A;  4GKK L;  1K83 H;  2D62 A;  4OON A;  3GO5 A;  3J81 j;  4A75 A;  1R9T H;  1E1T A;  1X65 A;  2IX1 A;  3RLN A;  2NVX H;  2JJQ A;  1PYS B;  2JQO A;  1SFO H;  4JI6 Q;  1QVF A;  4DKA C;  5FJ8 G;  3I4M H;  3A0J A;  5ELN A;  1E22 A;  5LMU Q;  4LF6 L;  5C4J H;  3UE0 A;  2QGQ A;  5IE8 A;  2JK8 A;  3G4S A;  1XNR Q;  3PGZ A;  4LF5 Q;  5JJK A;  3UDI A;  2ZTC A;  4YHH L;  4JI8 Q;  1FGU A;  2N49 A;  3JAM i;  5C0X G;  1VQJ A;  3GTK H;  4A3C G;  4X62 L;  2R7F A;  4X66 L;  3KF8 B;  4OXP A;  3CMA A;  4LF4 L;  1M90 C;  5IP7 H;  3FHW A;  4QL5 A;  4OWX B;  1XTD A;  1K9M C;  5HGQ A;  3HOX G;  4LW1 A;  4DR1 L;  5C4X H;  1PFS A;  2MFI A;  1D8L A;  5IP9 G;  4XIG S;  5DLQ E;  2B3G A;  4A3J H;  4L5T A;  1XNQ L;  3PO3 G;  2HHH Q;  2V1C C;  3CCU A;  4A3I H;  3CC2 A;  1TWH H;  1W2B A;  3MXN B;  1B7Y B;  3T1Y L;  5LMN W;  2R7Z H;  5BR8 L;  4A3B H;  1QUQ B;  1Q7Y C;  2CKZ B;  2IT1 A;  5M3M G;  1X56 A;  5M3F H;  4GNX B;  2PI2 A;  3H0G G;  1S40 A;  2BH2 A;  3J7A 5;  2UXC L;  4BY1 G;  2BA1 A;  1TWF H;  4J15 A;  4LFC L;  1WYD A;  2GVA A;  1Y1V G;  1YNX A;  2K75 A;  4O2D A;  4KI0 A;  4NXN L;  4ALP A;  4B3T L;  3CCE A;  4A3L G;  1CSP A;  1VQI A;  4UP9 A;  2VL6 A;  2H5X A;  4BA2 I;  4OX9 L;  4X65 L;  3E0E A;  1VQP A;  2K5N A;  1I94 Q;  4C2M H;  3Q8D A;  4JI2 L;  4X64 L;  2VUM G;  5H1S E;  3GTQ H;  4B3R Q;  1Q86 C;  4NXM Q;  3K7A H;  1VQC A;  4GKK Q;  2CQO A;  2K4K A;  4MZ9 A;  3ULP A;  4UP7 A;  1VQB A;  1GM5 A;  2JE6 I;  4PMW A;  4L5Q A;  4DR5 L;  1GVP A;  3K8A A;  2AWN A;  4JBJ A;  4GLV B;  2UU9 Q;  4DV0 Q;  4QQB X;  1KD1 C;  3AQQ A;  1XMQ Q;  4LF6 Q;  5LMN L;  4PZ8 A;  4JI3 L;  1U5K A;  3OW2 A;  3RLF A;  4GOP A;  2K5H A;  4PZ6 A;  3K81 C;  1A62 A;  4QGU A;  1PH2 A;  1WCM H;  1YIJ A;  3H3V I;  1HR0 W;  2ALY B;  2Y0S E;  2UUA L;  1JE5 A;  2D0P A;  4DAM A;  2A8V A;  4X62 Q;  5C4X G;  4YCU A;  5FLX c;  2YTY A;  3J80 i;  3H15 A;  3KJP A;  1WOC A;  4P71 A;  3VDY A;  1MKH A;  3D31 A;  1YZ6 A;  3B6Y A;  4Y7N H;  1V43 A;  2D0O A;  4A3M G;  4HJ5 A;  2NZO A;  4DR1 Q;  4A3B G;  4DR4 L;  1C7Y A;  1TWA H;  1E24 A;  4DV2 L;  3S15 H;  1G51 A;  5GAD C;  2MNA A;  3F2B A;  1PHJ A;  2E2H H;  1CSQ A;  2WAQ G;  2WB1 G;  1CKM A;  3T1Y Q;  4NB3 A;  3PF4 A;  1YHQ A;  5C0X I;  1P16 A;  2Q2T A;  2AWO A;  2FXQ A;  3HOY H;  3CAM A;  2K14 A;  1DGS A;  4P75 A;  2JA5 H;  4LUV A;  1VQF A;  4POF A;  3G6E A;  4OWW B;  1I3Q H;  4BY7 H;  2UXC Q;  5C0X J;  2R92 G;  1N33 L;  1VQM A;  3UDG A;  1QVG A;  3GTJ H;  4JI4 Q;  4NXN Q;  4A3D H;  1BBW A;  3CF5 A;  2CCZ A;  5M5X H;  1C9O A;  4LF7 L;  1XPO A;  1HR0 L;  1IBM L;  4OX9 Q;  5JEA J;  4X65 Q;  5K36 G;  1CKN A;  1N36 L;  4A76 A;  2F52 A;  3PO2 G;  4P73 A;  4JI2 Q;  4X64 Q;  2N8N A;  3CC7 A;  1KRT A;  4LFB L;  2JA7 H;  1VQ9 A;  3M85 A;  1OTC A;  2E5L L;  3GTG H;  4IFD G;  1TWG H;  1YJN A;  1JMC A;  2OTL A;  1HZB A;  3UE1 A;  3WWV A;  4A3F H;  2UUB L;  5HY6 A;  4BXX H;  1G6P A;  1ASZ A;  1NMF A;  4R1J A;  4HIO A;  4GOP C;  4JI0 L;  3HOW G;  4DR5 Q;  3I4N H;  1N32 L;  1WCM G;  2A19 A;  1WI5 A;  2ZJR A;  3MEF A;  5FLM H;  1OXU A;  1U0L A;  2ZJP A;  1PH5 A;  3CW2 C;  5LMN Q;  4DUZ L;  1VQ5 A;  1E3P A;  3NBH B;  4JI3 Q;  4YWL A;  4DK3 C;  4AH6 A;  3RZO H;  4R4Q A;  2YYZ A;  3GTL H;  1BVS A;  5EAY A;  1LYL A;  1VQH A;  1UE6 A;  2LSS A;  3A5Z B;  1NE3 A;  1FJG L;  1VQ6 A;  3S16 H;  4APV A;  3M4P A;  4POG A;  2I0Q A;  1A8V A;  3F1Z A;  3EN2 A;  5IYB H;  1ASY A;  1A63 A;  3KJO A;  2JA6 H;  2NVT H;  1X3E A;  5C44 H;  4PZ7 A;  2KCT A;  3ICE A;  3K0X A;  3CQZ H;  2OQK A;  4JBM A;  4DV2 Q;  3KDF B;  4B3M L;  2HIV A;  4A93 H;  3PUW A;  4IPG A;  2QEX A;  1PV4 A;  2ZM6 L;  1IYJ B;  1EYG A;  2JA5 G;  2Q2U A;  1Z9F A;  4A3G H;  1Y14 B;  1VQK A;  4A3D G;  1EQR A;  1EIY B;  3BJU A;  3A5U A;  3OYY A;  1L1O A;  2PQA A;  2VW9 A;  5JEA G;  1I5F A;  4JV5 Q;  5C3E H;  2VQE Q;  4A4I A;  1N33 Q;  1SN8 A;  2K50 A;  3KF6 B;  3E9H A;  4KHP L;  2JA7 G;  4LF7 Q;  1YBY A;  1HNW Q;  1L0W A;  4BA1 I;  3CXC A;  4HJA A;  1HR0 Q;  4YCW A;  1IBM Q;  1IL2 A;  3TQY A;  3S2H H;  1TWC H;  4A3F G;  1N36 Q;  2K5V A;  3BZK A;  3JAM c;  4P74 A;  1IBK L;  2ID0 A;  3OTO L;  1SLJ A;  4DR3 L;  3PCO B;  1HNX L;  2E5L Q;  1NJI C;  1O7I A;  1X55 A;  2EIF A;  3IRB A;  4NPS A;  3KFU A;  1VS0 A;  2UUB Q;  1PH1 A;  3NEL A;  4IJL A;  3ER0 A;  4JI0 Q;  2HIX A;  2NZH A;  2MQH A;  1KQS A;  1H95 A;  1WJJ A;  1N32 Q;  3CPW A;  3PIP A;  3G71 A;  4R4C A;  1X3G A;  3AFQ A;  1J5E Q;  3TEH B;  3M9B A;  3L0O A;  4C3H H;  3S17 H;  1CUK A;  2PI2 E;  2YU9 H;  4Y52 H;  4LF9 L;  3I4M G;  3HKS A;  4RG1 A;  2E8G A;  2QA4 A;  4YWK A;  1EOV A;  2ES2 A;  4L5S A;  2JA6 G;  1EWI A;  2E2J H;  2JEA I;  1FJG Q;  3AFP A;  4A3E H;  4DV5 L;  2YV5 A;  1Q1B A;  3JC6 6;  3M4Q A;  1KXL A;  3I55 A;  3TS0 A;  1OXV A;  2UXB L;  4IFD J;  1KRS A;  2UUC L;  3E9I A;  3DLL A;  1FL0 A;  4XTC S;  3UDX A;  3ZJY C;  5IY0 A;  3T1H L;  3CCL A;  1I50 H;  3U4Z A;  3RLO A;  4DR2 L;  4IO9 A;  1N34 L;  3SGI A;  3W5O A;  1YJW A;  4B3M Q;  5IP7 G;  5M5Y H;  3RZD H;  2ZM6 Q;  1L1O C;  4YHH Q;  1YIT A;  3AEV A;  2B63 H;  1SR3 A;  3CCV A;  1NY4 A;  3PSI A;  4TQU S;  5C3E G;  3CCJ A;  2HT1 A;  4X66 Q;  5E7N A;  4JG2 A;  4LF4 Q;  4DR6 L;  4A3J G;  1VQ4 A;  3RNU A;  4DAY B;  4A3I G;  1HZ9 A;  4DV3 L;  1Q46 A;  3KF6 A;  2R6G A;  4MTN A;  2UXD L;  2Y0S G;  1VCI A;  2OWO A;  2R7Z G;  3HOU H;  4KHP Q;  4DV4 L;  1XNQ Q;  4DV1 L;  2YTV A;  4HIM A;  3PUZ A;  2VZA A;  5M3F G;  4GKJ L;  4UP8 A;  1BKB A;  1QUQ A;  1QVC A;  1D7Q A;  2ZJQ A;  4EX5 A;  5AJ3 L;  1KIX A;  4WJ3 M;  2XTI A;  5BR8 Q;  4GNX A;  1GKH A;  2KHI A;  1IBK Q;  3OTO Q;  4DR3 Q;  4YY3 L;  1XPR A;  4PG3 A;  2OCE A;  1HNX Q;  3PIO A;  4BBR H;  1AH9 A;  1B70 B;  3J80 c;  1PH8 A;  3G48 A;  2JA8 H;  4LFC Q;  3GTP H;  4JI6 L;  1JJ2 A;  4IPD A;  2MO1 A;  2WB1 E;  4B3T Q;  1EIF A;  3EIV A;  4DR7 L;  1X3F A;  4LUZ A;  2DGY A;  2RCN A;  4JYA L;  3FKI H;  2OQ0 A;  3STB C;  1PH4 A;  4UY8 C;  3CP0 A;  1IZ6 A;  4FDB A;  1KL9 A;  1HJP A;  1S72 A;  4ME3 A;  4RMF A;  3TS2 A;  4JI8 L;  1VQG A;  2JEB I;  4LF9 Q;  2AHO B;  4JBW A;  4JI7 L;  3CPF A;  1EFW A;  3ERS X;  1VQ8 A;  3HOV H;  3KLW A;  1HZA A;  1UEB A;  1C0A A;  2UXB Q;  4A3C H;  4IOA A;  1IXR A;  2UUC Q;  1PH7 A;  1S3O A;  3GTO H;  3ULJ A;  4OO1 G;  2IHF A;  5GRO A;  3T1H Q;  2HHH L;  4DR2 Q;  1IBL L;  1KAW A;  1N34 Q;  4X6A H;  2JA9 A;  3HKZ E;  4C3J H;  3HOX H;  2E2I H;  1Q12 A;  4HJ9 A;  1A0I A;  2PMZ E;  2UUA Q;  1TXY A;  3ULL A;  4LFA L;  1HH2 P;  1UWV A;  2I5M X;  4QJF A;  4JI1 L;  3U58 A;  4JBK A;  1PH6 A;  2IHE A;  1JB7 A;  4DR6 Q;  3STB D;  3KOJ A;  4AYB E;  1X9N A;  1YHA A;  3FP9 A;  4WJ4 A;  2UXD Q;  3W1B A;  1G29 1;  5M3M H;  4GNX C;  2ATW A;  4L5R C;  4DR4 Q;  2AKW B;  3H0G H;  4DV4 Q;  4BY1 H;  4DV1 Q;  3HOY G;  4GKJ Q;  3PV0 A;  2L15 A;  2JA8 G;  3J7Z C;  4BY7 G;  1OXT A;  5AJ3 Q;  4HJ8 A;  4NXM L;  4EQ5 A;  3S1M H;  1FVI A;  4GS3 A;  1UE7 A;  4JC0 A;  1Q8K A;  4YY3 Q;  2MO0 A;  4C3I H;  1WFQ A;  4GLA C;  4DPG A;  3FKI G;  2DUD A;  5JJL A;  1W3S A;  2VUM H;  2BH8 A;  1LM0 A;  2Q2I A;  2NN6 G;  2F4V L;  3DM3 A;  2UU9 L;  4DV0 L;  3KYH C;  3TRZ A;  5IWA L;  1T9H A;  1XMQ L;  1PH3 A;  3M4O H;  4AQY L;  1XMO L;  4DR7 Q;  1NBW A;  2IX0 A;  2KCM A;  4JYA Q;  1SMX A;  3I56 A;  4BXX G;  2Z6K A;  3HOV G;  3GTM H;  3S14 H;  1PYB A;  1K0R A;  3I2Z A;  4R4O A;  1HNZ L;  4GOP B;  4LFB Q;  3I4N G;  1QZG A;  3LGJ A;  4K0K L;  4JI7 Q;  1VQE A;  3L2P A;  5FLM G;  3CCM A;  1N8R C;  5GAE C;  2CWP A;  4IPH A;  5J3B A;  1B8A A;  4KHZ A;  1XPU A;  2ASB A;  1J6Q A;  2CWA A;  1OXX K;  5IYD H;  3CD6 A;  1YHB A;  2VY3 A;  3K80 C;  2PNH A;  5M5W H;  4DUZ Q;  2EQS A;  3CCR A;  3BZC A;  4IPC A;  1SRU A;  5ELO A;  5GAH C;  1IBL Q;  2I5H A;  3PF5 A;  4A3M H;  1OXS C;  5IYB G;  3CC4 A;  2K52 A;  3F8T A;  1VQL A;  1YEZ A;  4OWT B;  4P72 A;  4O0A A;  4LFA Q;  5C44 G;  3J81 i;  4IFD I;  4LUO A;  4JI1 Q;  2XGT A;  1GO3 E;  1VQD A;  1NTG A;  3EBE A;  1Q82 C;  1K8G A;  3RR5 A;  1K8A C;  4A93 G;  1I6H H;  4A3G G;  1BBU A;  4JI4 L;  2EXD A;  1CKO A;  1VQO A;  4H02 A;  3KDF A;  4LF8 L;  2N3S A;  1UE1 A;  2B29 A;  1SRO A;  4QY7 A;  2NVY H;  2R93 H;  4DV6 L;  1AE3 A;  2WP8 J;  5GQO A;  3U50 C;  3RN5 A;  3F2D A;  1PA6 A;  3M7N A;  2KEN A;  4OO1 I;  4AIM A;  4DUY L;  2R92 H;  3S1Q H;  2C35 B;  3NEM A;  1CKN B;  1PVO A;  3UDF A;  4B3S L;  2I5L X;  4JI5 L;  4A3K H;  3D0F A;  3J81 c;  1Q1E A;  4BBS H;  2OTJ A;  2RHQ B;  3PO2 H;  1X6O A;  2Z6K C;  4HIK A;  2KHJ A;  2F4V Q;  2A1A A;  1M1K C;  1XJV A;  1X54 A;  5IWA Q;  3PUV A;  1Q81 C;  1VQ7 A;  4AQY Q;  1XMO Q;  2Q2H A;  4DV7 L;  4IOC A;  2HQL A;  2VQF L;  1E7Z A;  1MJE A;  5IYC H;  1QZH A;  3HOW H;  1K3R A;  1Y1W H;  3S1R H;  1MJC A;  1HNZ Q;  1LTL A;  4YWM A;  4K0K Q;  2CFM A;  4JOI A;  2GN5 A;  5IYD G;  3S24 A;  1UE5 A;  3HOZ H;  3S2D H;  1V9P A;  3I4O A;  4MNO A;  3GD7 A;  1MIU A;  3H3V H;  2KBN A;  2WAQ E;  3BU2 A;  3I7F A;  2NN6 I;  5LMU L;  2WFW A;  3L7Z C;  1EQQ A;  3W1G A;  2ZTE A;  2RF4 A;  1YVC A;  3AYH B;  2IY5 B;  4KLK A;  1XNR L;  2GVB A;  4JCV E;  4YCV A;  5FJ8 H;  4HJ7 A;  4A3E G;  4LF5 L;  1E1O A;  3RN2 A;  1JT8 A;  5JJI A;  3U4V A;  1KHI A;  3K7U C;  4LWC A;  4DNI A;  3CCQ A;  1YJ9 A;  1Z47 A;  2R93 G;  1VQA A;  1VQN A;  1AE2 A;  3PUY A;  1NMG A;  1EUJ A;  4QIW E;  4TVA B;  4DV5 Q;  5IT9 c;  4JV5 L;  1SE8 A;  2VQE L;  2VS1 A;  2NVQ H;  1L1O B;  2PQA B;  5GAG C;  1GD7 A;  1N9W A;  2B63 G;  4LF8 Q;  3CCS A;  4GLX A;  1HNW L;  3GDE A;  1K73 C;  4DV6 Q;  4A3K G;  1KC8 C;  2VNU D;  4GN4 B;  4R4I A;  4BBS G;  4DK6 C;  4DUY Q;  1HZC A;  1LUZ A;  3NEN A;  4HID A;  1L2F A;  1RL2 A;  1P8L A;  5IP9 H;  1V1Q A;  2BA0 A;  3HOU G;  3HFZ B;  3PO3 H;  4B3S Q;  3M3Y H; 
#chains in the Genus database with same CATH topology
 1O7Y A;  4JI5 Q;  1R4P B;  3S1N H;  3MFG A;  4DFA A;  5FLX E;  5CV6 A;  2Z0S A;  2B2U C;  4R4T A;  2MJ8 A;  1BXT A;  4I7Z C;  5CV9 A;  5J39 A;  2AMC B;  2LXK A;  1Y1W G;  2LXJ A;  2ZTD A;  1EWH A;  3CME A;  1WTX A;  1JJC B;  3HOZ G;  2E74 C;  2D62 A;  5KRU A;  2F0O A;  5CGK A;  4CJ0 B;  1X65 A;  3M4O B;  1HFG A;  2IX1 A;  2JQO A;  1QVF A;  5FK9 C;  1TWC B;  1CHQ D;  4DGZ A;  5ELN A;  3J7A V;  5LMU Q;  4LF6 L;  5KNC A;  2RKS A;  2JK8 A;  3G4S A;  1XNR Q;  4QCL A;  5JJK A;  3UDI A;  1HTL D;  3NHH A;  2N49 A;  2K7V A;  1VQJ A;  1PZI D;  5FO7 B;  2EYF A;  3KF8 B;  3R2I A;  1EU3 A;  1FNW A;  5IP7 H;  3OIQ A;  2RSO A;  4KHV A;  3OIP A;  2OT2 A;  4C3J G;  4LW1 A;  1PMR A;  2F0W A;  1VF7 A;  2HQE A;  2NZ1 D;  1D8L A;  5IP9 G;  4X3U A;  5DLQ E;  2B3G A;  4KV6 A;  1SNM A;  4L5T A;  5FOB B;  4A3I H;  1CQV A;  4A3E B;  2EOT A;  3LWE A;  2F0E A;  2F0I A;  4WOR A;  4R8I A;  4N9T A;  5BN4 A;  2IT1 A;  1F2Z A;  4GNX B;  3H0G G;  4RGM A;  2BH2 A;  3J7A 5;  2UXC L;  4BY1 G;  5C3X A;  2GVA A;  1B1Z A;  1Y1V G;  1YNX A;  4O2D A;  4B3T L;  1HQR D;  3GV3 A;  3QOL A;  1CSP A;  5EJW A;  2B63 B;  2VL6 A;  3E0J A;  2H5X A;  4OX9 L;  3TSS A;  4X65 L;  4BS9 A;  2K5N A;  4L8J A;  1QNU A;  1I94 Q;  1D1K A;  5D14 A;  3Q8D A;  4ZUI A;  4GKK Q;  2WKC A;  1EZ6 A;  1BCP C;  3DXJ C;  3HKZ B;  4L5Q A;  1GVP A;  1PRT F;  4IUU A;  5T1I A;  4DV0 Q;  1AEX A;  2B8G A;  5LMN L;  1BBX C;  5IGC A;  1BO0 A;  3RLF A;  4GOP A;  3HG9 A;  2XSC A;  4PZ6 A;  1PH2 A;  1YIJ A;  3S2D B;  2ALY B;  2EJM A;  2A8V A;  4OIK A;  4X62 Q;  5C4X G;  5FLX c;  3J80 i;  3IFT A;  3H15 A;  4FF3 A;  1MKH A;  4Y7N H;  2WV6 D;  2NZO A;  2PZT A;  4DR1 Q;  4XDX A;  1SYD A;  1C7Y A;  1TWA H;  3S15 H;  1I4Q A;  5GAD C;  1PHJ A;  2E2H H;  1CKM A;  3T1Y Q;  1YNJ D;  5C0X I;  2EY6 A;  2FXQ A;  4IUR A;  2K14 A;  1DGS A;  2C5C A;  3SXH A;  2JA5 H;  4POF A;  1VQF A;  1I3Q H;  3Q23 A;  5C0X J;  1N33 L;  1QVG A;  4B9W A;  2Z9H A;  3HOX B;  5M5X H;  5JEA J;  1N36 L;  1HA5 A;  4A76 A;  4X64 Q;  2N8N A;  3CC7 A;  1QNK A;  3F2U A;  4LFB L;  2JA7 H;  1HFN A;  1VQ9 A;  2Q8I B;  2E5L L;  1JMC A;  2OTL A;  3UE1 A;  3WWV A;  4A3F H;  1ILQ A;  5HY6 A;  4XQQ A;  4R1J A;  4GOP C;  1SSO A;  1X3Q A;  2FMM A;  3D6C A;  4HR7 B;  1WCM G;  1PDQ A;  2ZJR A;  3UI2 A;  1U4P A;  3T51 B;  4JI3 Q;  1GUN A;  1LTI D;  1CZW A;  4KN4 C;  1EY8 A;  3GTL H;  2VUM B;  5EAY A;  3R8B A;  2XIW A;  1UE6 A;  2Q8T A;  3P75 A;  4PNY A;  4TKO B;  2F4I A;  3CU7 A;  1DXM A;  3M4P A;  4RFB A;  4IN3 A;  2K01 A;  3WOE A;  2I0Q A;  4POG A;  1A63 A;  5IYB H;  1DOL A;  2NVT H;  4KK7 A;  3MAQ A;  1QCB D;  2SOB A;  1NSN S;  2N88 A;  4DV2 Q;  2HIV A;  1EYG A;  2Q2U A;  2WAC A;  3TZD A;  2HUG A;  1Y14 B;  2EE1 A;  4A3D G;  1EQR A;  1EU4 A;  2EY2 A;  2A6E D;  2F0L A;  3A5U A;  4JV5 Q;  2RSN A;  4K2K A;  1ZEQ X;  3NQT A;  3KF6 B;  4XQJ A;  4RCN A;  3CXC A;  4FF1 A;  3HP3 A;  1KAB A;  4HSV A;  2K5V A;  2WAQ B;  2WB1 B;  1F9Q A;  3ITP A;  5BN5 A;  1IBK L;  2GA4 B;  1I4R A;  2LFN A;  5EQ0 A;  3IRB A;  1NR4 A;  1STE A;  1VS0 A;  2UUB Q;  3BYY B;  4IJL A;  2HCI A;  3ER0 A;  4JI0 Q;  2HIX A;  1DCZ A;  2MQH A;  3S1Q B;  1N32 Q;  3O13 A;  2EXZ A;  4R4C A;  3AFQ A;  3L0O A;  2YU9 H;  4Y52 H;  3PO2 B;  2JP1 A;  5D65 A;  3DWA A;  1B3Q A;  2JA6 G;  2DY8 A;  4KKU A;  5IGD A;  1EWI A;  1RD9 D;  2XNA C;  2RDH A;  2JEA I;  1Q1B A;  5I6Y A;  3I55 A;  3VYT A;  2UUC L;  1Z7T A;  3E9I A;  4LMQ D;  1FL0 A;  3DLL A;  2QDL A;  2CQA A;  4IO9 A;  2LMC B;  4B3M Q;  3OW7 A;  5IP7 G;  3J7Y W;  2ZM6 Q;  4YHH Q;  2A73 B;  3AEV A;  4F7X A;  2L0C A;  1HXY D;  4X66 Q;  5LHY 1;  4DR6 L;  1VQ4 A;  3RNU A;  4A3I G;  1HZ9 A;  2BDN A;  3M4Y A;  3S15 B;  2UXD L;  3K5M A;  2Y0S G;  3HOU H;  5L37 A;  2K04 A;  2L11 A;  1E2Z A;  3FPU B;  1EIH A;  2XRQ D;  1IYU A;  1D7Q A;  5AJ3 L;  2JA5 B;  4CHT B;  2XTI A;  5BR8 Q;  4DAP A;  1GKH A;  3OTO Q;  4QUC A;  3PIO 3;  4YY3 L;  1EZ8 A;  1PFB A;  3SDZ A;  4BBR H;  5M5X B;  1GUT A;  1EY6 A;  3A7L A;  3TME A;  2VB3 X;  2X69 A;  1JJ2 A;  2B2T C;  3EIV A;  4DR7 L;  4LUZ A;  2JA7 B;  1AW7 A;  3FKI H;  1T5E A;  3CP0 A;  1HJP A;  2NN6 H;  4ME3 A;  4RMF A;  4A3F B;  1VQG A;  4XXE A;  3V05 A;  2O5I C;  1LTT D;  1DYQ A;  4UHV A;  3KLW A;  1HZA A;  1UEB A;  5C4H A;  1C0A A;  4K5W A;  4A3C H;  1LAC A;  3GTO H;  1PZJ D;  2PPB C;  3MEH A;  4EVO A;  1TVX A;  3T1H Q;  2AQ1 B;  1A3V A;  4L63 B;  3HKZ E;  1SBB B;  2PNR C;  2E2I H;  1A0I A;  3I4M B;  2UUA Q;  4G7O C;  3K57 A;  5C4J B;  1V1P B;  1JB7 A;  2RCF A;  3KOJ A;  5JVG 3;  3FP9 A;  2HDM A;  1TII D;  4FXK C;  3W1B A;  4L5R C;  4DV4 Q;  1LTG D;  2L15 A;  3J7Z C;  2K1B A;  3SEB A;  3DM1 A;  4EQ5 A;  3T4A C;  1SJH D;  1H9J A;  2MO0 A;  4C3I H;  2FIN B;  2DUD A;  1W3S A;  1GUO A;  1TWH B;  4DV0 L;  4RKL A;  5I2Y A;  3ONA B;  4XT3 B;  2Z6K A;  3LX0 A;  2KEE A;  3HOV G;  3GTM H;  3S14 H;  3I2Z A;  1H9M A;  4R4O A;  3K6O A;  1QJO A;  3SE0 A;  2ICI A;  5J3B A;  4EQO A;  3EJI A;  3MVV A;  5NUC A;  5IYD H;  4ZYS A;  1YHB A;  4S3S A;  5ELB A;  4HCS A;  1XYI A;  3QO2 A;  3CCR A;  1Y8O B;  5FO8 B;  3MXG A;  3PF5 A;  2FFK B;  4A3M H;  5IYB G;  1VQL A;  4IFD I;  1BOS A;  4LUO A;  5CYU A;  4C1N K;  4HMJ A;  2XGT A;  1GO3 E;  3EBE A;  3IKJ A;  1CKO A;  3SR1 A;  4RHR A;  3KDF A;  2B2W C;  2B29 A;  2FMC A;  4MTK A;  2R93 H;  2NVY H;  1PRT C;  4OO1 I;  2R92 H;  3IAY A;  1D6E C;  4R9W A;  4A3K H;  2OTJ A;  3A55 A;  3KLS A;  1RF2 D;  5EPJ A;  5CC4 A;  2EPB A;  2Z6K C;  3TBI B;  2WII B;  3LWU A;  1M1K C;  2VXW A;  3PUV A;  5IWA Q;  1Q81 C;  1VQ7 A;  3AB9 A;  2Q2H A;  2HQL A;  1A2U A;  3BVG A;  3HOW H;  1K3R A;  1Y1W H;  3S1R H;  5D3D A;  3E6Z X;  3RUZ A;  2E2D C;  3ERO A;  3N52 A;  2PYK A;  1UE5 A;  3HOZ H;  1V9P A;  4MNO A;  3FKI B;  2WAQ E;  3GV6 A;  2WFW A;  3L7Z C;  1EQQ A;  2RF4 A;  1EQV A;  1YNN C;  1O80 A;  4DNR B;  1JT8 A;  5C5M A;  2EYP A;  1K28 A;  1PLF A;  3MHB A;  3CCQ A;  1YJ9 A;  1Z47 A;  2DY7 A;  1BF4 A;  3GTO B;  1EUJ A;  4JV5 L;  2F0T A;  4ZCK A;  2VS1 A;  1L1O B;  2PQA B;  2MUY A;  3A7A B;  4ID6 A;  1AZP A;  3CCS A;  3S16 B;  4BBS G;  1DD2 A;  1LUZ A;  1RL2 A;  1P8L A;  2G5D A;  1V1Q A;  5IP9 H;  2IWH A;  3HOU G;  4IJH A;  3S9W A;  1D5X C;  1MD2 D;  3CQZ B;  1PH9 A;  1VMC A;  4A93 B;  3E3X A;  1STN A;  4A3G B;  2N78 A;  1YI2 A;  1ESR A;  3V2T A;  4CJ1 B;  2RHS B;  4DV7 Q;  3A74 A;  4BBR G;  1Y1V H;  1H9R A;  2YTX A;  3TRE A;  2VQF Q;  3QR8 A;  3ND8 A;  4UPA A;  1RIP A;  5A35 A;  3J81 j;  4RKB A;  1SYB A;  1BUV T;  1ENF A;  4RWS C;  3RLN A;  1PYS B;  1WTH A;  5FJ8 G;  3S2H B;  5DM7 3;  3A0J A;  1SYE A;  3S14 B;  1W6K A;  3H09 A;  3NTH A;  5IE8 A;  4G7H C;  2CH4 A;  1BDO A;  1KNA A;  2ZTC A;  4YHH L;  4JK1 C;  3JAM i;  3GTK H;  2L1B A;  4A3C G;  4X66 L;  1PTO F;  5IGF A;  3K5O A;  3FHW A;  2Z6B A;  1K9M C;  2I46 A;  4NMZ A;  2Z4I A;  3E5S A;  5C4X H;  2F0P A;  2MFI A;  1E0B A;  2F0G A;  5CMD A;  2CH4 W;  3MXN B;  1HCZ A;  2D9U A;  2R7Z H;  5BR8 L;  4JPB W;  1SEB D;  2BOS A;  5M3F H;  2R93 B;  1ICW A;  2NVY B;  1I50 B;  4J15 A;  1PFN A;  1IW7 C;  5IT9 L;  4NXN L;  4ALP A;  5M5Y B;  4A3L G;  5EPL A;  4UP9 A;  2DNC A;  1MGS A;  1F2M A;  4C3I G;  4A3K B;  3EQL C;  4B3R Q;  3D6W A;  1Q86 C;  1FD7 D;  3K7A H;  1VQC A;  4KD4 A;  3K5N A;  1JWU D;  2CQO A;  5JPN C;  1A2T A;  1ICF B;  1VQB A;  5TSS A;  1RHP A;  2JE6 I;  3OWE B;  2UU9 Q;  3K58 A;  4QQB X;  1F2Y A;  1Y1W B;  1XMQ Q;  2XN9 C;  2A6H C;  2B2U A;  1C4Q A;  2QW7 A;  1WTO A;  3QIA A;  3K81 C;  1WCM H;  2MP1 A;  3HOZ B;  4X3S A;  1R4Q B;  3H3V I;  1HR0 W;  2UUA L;  1JE5 A;  2V4D A;  1Q90 A;  4K14 A;  2NUC A;  2YTY A;  1U9R A;  3KJP A;  3VDY A;  3VA7 A;  1RTN A;  3B6Y A;  1UNS A;  1KAA A;  1V43 A;  4GZY C;  4A3M G;  3K0Y A;  2NYZ D;  1G51 A;  2J4X A;  4NB3 A;  1TY0 A;  5G3L F;  1YHQ A;  4V0B A;  3U9S A;  3CAM A;  4P75 A;  4LUV A;  4KTA A;  4BY7 H;  4OWW B;  2R92 G;  3I72 A;  3VR5 A;  4A3D H;  3VR3 A;  4K8I A;  4C3J B;  4LF7 L;  1FGB D;  2CVR A;  1IBM L;  1CKN A;  1DZ1 A;  4JI2 Q;  2OF1 A;  3GTG H;  1OTC A;  4IFD G;  4CDD C;  3MC0 B;  4BXX H;  3H0G B;  4K5V A;  1ENA A;  4BY1 B;  3NWT A;  3HOW G;  5F2D A;  4DR5 Q;  1Y1V B;  3I4N H;  3FMC A;  4DAV A;  1WTQ A;  1WI5 A;  1X32 A;  1OXU A;  5HGT A;  2ZJP A;  4NW2 A;  1VQ5 A;  4DK3 C;  1C8C A;  4IUV A;  1LYL A;  3OWF A;  1NE3 A;  2WIN B;  4KJO A;  4APV A;  4QUF A;  1B50 A;  3A8I E;  3J80 E;  1A8V A;  2JA6 H;  4FNF A;  1X3E A;  5C44 H;  2KVM A;  4PZ7 A;  2KCT A;  4MN3 A;  2RA4 A;  5KGU A;  3GTK B;  2LY7 A;  5M9O A;  1IYJ B;  3MXP A;  4C1N I;  2RDG A;  2DNE A;  5C4X B;  2J0T D;  3LNN A;  1Y69 U;  5FLX L;  2VW9 A;  1I5F A;  4CDE C;  1HPC A;  4A4I A;  4K6D A;  1SN8 A;  3KLS X;  3E9H A;  1MHW C;  1YBY A;  4BA1 I;  4HJA A;  1HR0 Q;  1IL2 A;  3TQY A;  1BNZ A;  4RAU C;  1E2W A;  1CA5 A;  1CA6 A;  4DR3 L;  1KNE A;  3PCO B;  1EEI D;  4RGN A;  3CHB D;  1O7I A;  1HNX L;  3KBX A;  2HD3 A;  4KMU C;  2Q8R E;  1WJJ A;  2E75 C;  3K7A B;  3EFX D;  3TEH B;  3M9B A;  2O5J C;  4C3H H;  5JVH 3;  4LF9 L;  4RG1 A;  2QA4 A;  1JWS D;  1EOV A;  2ES2 A;  4L5S A;  4ILW A;  4F8M A;  1FJG Q;  1PYW D;  4IUN A;  1JWM D;  2UXB L;  1D5Z C;  3C1F A;  1KRS A;  4ABN A;  1WCM B;  1RDP D;  5FKA C;  3ZJY C;  1TS3 A;  2KHS A;  3RLO A;  3H94 A;  4DR2 L;  3SGI A;  3W5O A;  1D5M C;  3L3O C;  3W3A A;  4PV1 C;  1NY4 A;  1S4Z A;  4TQU S;  3CCV A;  3CCJ A;  5J1Z A;  2HT1 A;  2L5T A;  4LF4 Q;  1O78 A;  4DAY B;  2F03 A;  4UAI A;  1Q46 A;  3KF6 A;  4MTN A;  2OWO A;  1VCI A;  2R7Z G;  4FXG C;  4KHP Q;  3Q0A A;  4PQX A;  1XNQ Q;  4DV1 L;  5M3F G;  2VZA A;  4UP8 A;  1QUQ A;  1QVC A;  5IOD A;  1BCP D;  1KIX A;  4MIU A;  3VYU A;  2L4N A;  4A3D B;  2OCE A;  1DJR D;  3J80 c;  1PH8 A;  3GQB A;  1EWC A;  1A3U A;  1SNQ A;  2RCN A;  1F9S A;  4CBV A;  4JYA L;  1MSH A;  2I07 B;  1KL9 A;  3S1N B;  1IL8 A;  1BQQ T;  4JI7 L;  4N9P A;  1JOO A;  1VQ8 A;  3HOV H;  1KDB A;  1FR3 A;  3NUC A;  3MTS A;  1PH7 A;  2IHF A;  5GRO A;  1IBL L;  1KAW A;  1STB A;  1N34 Q;  1JQY D;  2E76 C;  2QDB A;  1GJX A;  4QJF A;  2JA6 B;  3U58 A;  5C44 B;  1PH6 A;  4HN7 A;  5DAU A;  1YHA A;  2MGS A;  1G29 1;  1NNX A;  5M3M H;  1GOZ A;  2O2L D;  4GKJ Q;  3PV0 A;  5IGE A;  2JA8 G;  4BY7 G;  1OXT A;  4IUQ A;  4HJ8 A;  3S1M H;  1FVI A;  3OPO A;  1Q8K A;  2QCP X;  1LTS D;  4DPG A;  1STY A;  1PTO C;  2Q2I A;  2BH8 A;  2FJ2 A;  4A3I B;  2K33 A;  2UU9 L;  2Y0S B;  3TRZ A;  1XMQ L;  3CRK C;  1PH3 A;  1KLU D;  2BCO A;  4AQY L;  1XMO L;  2LS0 1;  4K2L A;  4M1U B;  3PMF A;  4BXX G;  2CHB D;  4GOP B;  3I4N G;  3LGJ A;  2EYJ A;  4K0K L;  1II3 A;  1VQE A;  3KUP A;  3CCM A;  2CWP A;  4IPH A;  1MSG A;  1B8A A;  1XPU A;  2EZV A;  4I65 A;  2F0U A;  3AMU A;  1OXX K;  3CD6 A;  2VY3 A;  5M5W H;  4DUZ Q;  2EQS A;  2SNM A;  2B2T A;  5ELO A;  5GAH C;  3I90 A;  1XX8 A;  1GUW A;  2I5H A;  5ELC A;  3RMH A;  1YEZ A;  4OWT B;  4LFA Q;  5C44 G;  4CDF C;  3J81 i;  3QWN A;  4JI1 Q;  1NTG A;  3Q24 A;  1LT5 D;  2X6G A;  2N55 A;  1B44 D;  3AU7 A;  4LF8 L;  1SRO A;  2PW7 A;  4DV6 L;  2WP8 J;  5GQO A;  3U50 C;  3F2D A;  3DEO A;  4J1M A;  1U4L A;  4DUY L;  2C35 B;  3NEM A;  4EQN A;  4Y7N B;  1SDF A;  2KA7 A;  2M2L A;  3UDF A;  4B3S L;  2I5L X;  1TS5 A;  4JI5 L;  3D0F A;  3J81 c;  4BBS H;  1EY5 A;  1TWA B;  4ZK9 B;  1QOH A;  1RJT A;  3HGB A;  2E2H B;  2F4V Q;  5I2X A;  1X54 A;  2H4O A;  1TR5 A;  1E7Z A;  1QZH A;  4FF4 A;  1I3Q B;  1MJC A;  1ET9 A;  1HNZ Q;  2DJF C;  1LTL A;  4JOI A;  3S24 A;  5J22 A;  2G9D A;  3ERQ A;  3GD7 A;  1IKL A;  3MA2 B;  4C3H G;  3NBI A;  2NN6 I;  5LMU L;  1XXG A;  2ZTE A;  4KLK A;  1F2L A;  4RGT A;  5EKI A;  1XNR L;  2GVB A;  4JCV E;  4YCV A;  5FJ8 H;  2CW0 C;  3HOV B;  5JJI A;  3U4V A;  3K7U C;  4DNI A;  2EYO A;  4WRD A;  1SAP A;  3SVM A;  1VQA A;  1TY2 A;  2KUM A;  3PUY A;  4DV5 Q;  2RBM A;  4TVA B;  5I6W A;  4ZLT F;  2KOL A;  5C3W A;  1WD1 A;  3VYR A;  2NVQ H;  5GAG C;  1GD7 A;  3GTL B;  4GLX A;  3GDE A;  4DXG A;  4GN4 B;  1O7Z A;  4R4I A;  4DK6 C;  3NEN A;  2H1E A;  2BA0 A;  2NVT B;  3M3Y H;  2F3I A;  1JJG A;  3I91 A;  3VA5 A;  4LNQ A;  4P2C B;  1ILP A;  3TP7 A;  2EJF C;  5IYC G;  3F2C A;  3C46 A;  3S1M B;  1I94 L;  4JOI C;  4AYB G;  5E1F A;  2B2W A;  4A3L H;  3CRL C;  4GN5 A;  1IHZ A;  2MPM A;  3FPP A;  1K83 H;  4GKK L;  4OON A;  3GO5 A;  3VR6 A;  1R9T H;  5CV8 A;  1GHJ A;  2L12 A;  2NVX H;  2JJQ A;  4K6L A;  1SFO H;  1S5D D;  4DKA C;  1TS2 A;  4M8A A;  1E22 A;  2B2Y A;  4OEM B;  1VDZ A;  2A68 C;  4LF5 Q;  1WD0 A;  4JI8 Q;  3BDL A;  1FGU A;  5C0X G;  1SE3 A;  4X62 L;  2R7F A;  4OXP A;  4G7Z C;  3CMA A;  4LF4 L;  4QL5 A;  2F0N A;  1B3A A;  1XTD A;  4HCE A;  5M5W B;  5HGQ A;  3C1E A;  2YU9 B;  4DR1 L;  4B08 A;  1PFS A;  1G91 A;  4PMB A;  4XIG S;  1V8Q A;  4A3J H;  1XNQ L;  3PO3 G;  3X3N A;  2V1C C;  1W2B A;  3T1Y L;  5LMN W;  2X6L A;  1F9P A;  3WOF A;  2QF7 A;  1X56 A;  5M3M G;  2F3V A;  1S40 A;  1I6V C;  4HTH A;  5JAV A;  2EY5 A;  1EY9 A;  2K75 A;  4KI0 A;  1L0Y B;  1CM9 A;  1SMY C;  1VQI A;  1BR9 A;  3OMG A;  1WTP A;  1VQP A;  1EYD A;  1CFM A;  4DXF A;  4C2M H;  4X64 L;  4KY6 A;  5H1S E;  3GTQ H;  4BBS B;  2EVB A;  3VR4 A;  2B2Y C;  3HOU B;  4IAL A;  3ULP A;  4UP7 A;  2XVS A;  1HQM C;  2TSS A;  1GM5 A;  3K8A A;  2AWN A;  2F0M A;  3BG3 A;  4GLV B;  4IFD H;  3FRP B;  3AQQ A;  4LF6 Q;  3D4D A;  3HEJ A;  4JI3 L;  1U5K A;  1CQF A;  2K5H A;  1S5E D;  4BBR B;  1MI2 A;  1DOM A;  4QGU A;  1A62 A;  1WVL A;  1SYG A;  1UAP A;  2AUK A;  3NE5 B;  2Y0S E;  5IGG A;  1HTP A;  4DAM A;  3JAM E;  4OO1 H;  4NDX A;  4YCU A;  1PRT D;  1PXU A;  4P71 A;  3D31 A;  1YZ6 A;  4CGY B;  4Q0F A;  2D0O A;  1QB5 D;  4A3B G;  2SNS A;  3MXU A;  1E24 A;  4DV2 L;  2AQ3 B;  3NPP A;  2MNA A;  3PF4 A;  1P16 A;  2Q2T A;  1AN8 A;  3HOY H;  2K6A A;  4OGQ C;  1ZYR C;  2UXC Q;  2P5Z X;  1VQM A;  3UDG A;  4JI4 Q;  3GTJ H;  3CF5 A;  2E2I B;  4TRD A;  1SYF A;  1XPO A;  1EYA A;  3T53 B;  4OX9 Q;  2IJ0 A;  4X65 Q;  4X3T A;  4P73 A;  3SHL A;  4IQZ A;  4ZKC B;  1QE6 A;  3M85 A;  1EY7 A;  1CK1 A;  4K8J A;  1TWG H;  1YJN A;  1HZB A;  2UUB L;  2KCC A;  1G6P A;  1YNN D;  1ASZ A;  1NMF A;  4HIO A;  4JI0 L;  4FP5 D;  2F0S A;  1WTW A;  1N32 L;  2A19 A;  2OXP A;  2Z4H A;  1U0L A;  1PH5 A;  1K83 B;  4F88 A;  5LMN Q;  4DUZ L;  1E3P A;  1ML0 D;  3NBH B;  4C3I B;  1R9T B;  1ZYR D;  3RZO H;  2NVX B;  1BVS A;  1TKW B;  3R93 A;  1O7L A;  3A5Z B;  1LTR D;  1VQ6 A;  1RKN A;  2D5D A;  1H9S A;  1STH A;  1QIL A;  3EN2 A;  5BN3 A;  3GTM B;  1GUG A;  1FNV A;  3K0X A;  3KDF B;  4B3M L;  3PUW A;  4IPG A;  3EVQ A;  5EKK A;  2ZM6 L;  1PV4 A;  1Z9F A;  2QIL A;  3BJU A;  3R2T A;  3OYY A;  4OEL B;  3WDN A;  1N33 Q;  5C4Z A;  2BE5 C;  4A3M B;  4QF4 A;  1HNW Q;  1L0W A;  4B9X A;  4JW0 A;  2QKI C;  4YCW A;  1TWC H;  1N36 Q;  1X3P A;  2BDO A;  3JAM c;  2ID0 A;  5E4W C;  3OTO L;  2JYO A;  4CKE A;  2E5L Q;  1F9R A;  1NJI C;  1X55 A;  3D8G A;  3NEL A;  2VB2 X;  2PCF B;  2EJG C;  2NZH A;  2R92 B;  1H95 A;  4C2M B;  5DM6 3;  3PIP A;  1SXT A;  3G71 A;  1SND A;  1J5E Q;  1LT6 D;  3S17 H;  1CUK A;  2PI2 E;  3OHX C;  3HKS A;  3W2D A;  2E8G A;  4YWK A;  3NXW A;  2BE5 D;  2E2J H;  2LKV A;  4DF7 A;  4A3E H;  4DV5 L;  2A69 C;  3TS0 A;  1OXV A;  3HOW B;  4U67 3;  3S1R B;  1S5F D;  3UDX A;  4H13 C;  3T1H L;  3U4Z A;  2C9O A;  4FF2 A;  2HDL A;  2RVL A;  4BWG B;  5CR3 A;  1E2V A;  1IW7 D;  5LL6 X;  3KF8 A;  4DK1 A;  2B63 H;  1SR3 A;  2NTT A;  3PSI A;  5DNF A;  5C3E G;  4OL7 A;  4JG2 A;  4A3J G;  2EDG A;  2R6G A;  2XWB B;  3K5L A;  2F0J A;  5KNB A;  4DV4 L;  4HIM A;  2YTV A;  3PUZ A;  2M00 A;  2ZJQ A;  4QMG A;  1VMP A;  3I4L A;  4GNX A;  1IBK Q;  2WKD A;  4PG3 A;  2A6H D;  1AH9 A;  1B70 B;  2JA8 H;  3G48 A;  4LFC Q;  3GTP H;  4LAA A;  1QG7 A;  4H7B A;  2MO1 A;  1EIF A;  1PH4 A;  2OQ0 A;  4FDB A;  1IZ6 A;  1IKM A;  2IPK D;  1EY4 A;  4JI8 L;  1XWE A;  4TSS A;  2AHO B;  5IOC A;  1A15 A;  1EEF D;  3T16 A;  3BYT B;  3EA6 A;  4HSP A;  4PMC A;  1IXR A;  4RA8 A;  2UUC Q;  4LK1 C;  3DWP A;  3ULJ A;  1TT2 A;  4OO1 G;  1CI3 M;  4X6A H;  3NP8 A;  3HOX H;  1Q12 A;  3BDO A;  4HJ9 A;  1TXY A;  4ME5 A;  3ULL A;  1HH2 P;  1UWV A;  4JBK A;  4DR6 Q;  2IHE A;  3NK9 A;  1PFM A;  1X9N A;  3IFD A;  3VR2 A;  4WJ4 A;  2UXD Q;  2F0K A;  2ATW A;  4GNX C;  4FVM A;  4DR4 Q;  2JXM B;  2AKW B;  3HOY G;  4XT1 B;  5AJ3 Q;  1SJE D;  1ZKO A;  4JC0 A;  4YY3 Q;  1JOR A;  5I4D A;  3U9O A;  5JJL A;  3KBG A;  2VUM H;  3DMU A;  2F0Q A;  2NB0 A;  5CV4 A;  4E6I A;  3KYH C;  2R7Z B;  5IWA L;  3TZU A;  4DR7 Q;  1NBW A;  5JJZ A;  2KCM A;  2PW5 A;  1SMX A;  5M3F B;  2K03 A;  1HHV A;  3TDQ A;  1J9O A;  1KLG D;  1Q8I A;  5CV5 A;  1N8R C;  1I4H A;  3A8J E;  3J80 L;  1HA6 A;  4XYO A;  3H3V C;  3DUZ A;  1J6Q A;  3S17 B;  2CWA A;  1NUC A;  1TS4 A;  2OEO A;  3BZC A;  4IPC A;  5EBC A;  2E2J B;  1L0X B;  1HUM A;  1OXS C;  4O0A A;  3HZX A;  3OSO A;  5E4X A;  3URY A;  4MHE A;  1VQD A;  1K8G A;  3TN2 A;  1K8A C;  1I6H H;  4JI4 L;  1I4P A;  1F77 A;  2EXD A;  3NWS A;  1VQO A;  5C5L A;  1EQT A;  1B53 A;  1PA6 A;  1AE3 A;  3RN5 A;  4L6T B;  3M7N A;  2KEN A;  4AIM A;  3S1Q H;  1K8O A;  4KN7 C;  1CKN B;  3FDT A;  2RHQ B;  5K36 H;  1PTO H;  5CBE E;  3PO2 H;  1X6O A;  2ZXO A;  4Z9C B;  1YNJ C;  2F0H A;  2F0F A;  4HIK A;  2KHJ A;  2B2V A;  2IL8 A;  3TP8 A;  4DV7 L;  2VQF L;  4WJW A;  1MJE A;  5IYC H;  1NAP A;  2JA8 B;  4BY7 B;  2NBF A;  3GTP B;  1Z6H A;  1EIG A;  4YWM A;  2K5W A;  2CFM A;  4XYQ A;  2K5D A;  5LL6 S;  3X3M A;  4DN4 M;  1MIU A;  3W1G A;  3NQI A;  1AZQ A;  2IY5 B;  1CZG A;  3GTG B;  2FHT A;  4A3E G;  4HJ7 A;  1BCP B;  2ZXP A;  5COR A;  3I4N B;  3BS1 A;  1G2T A;  1VQN A;  1NMG A;  3TP5 A;  2F0V A;  3J81 E;  4HED A;  1SE8 A;  2PZW A;  5C0X H;  1LV9 A;  4KJN A;  2B63 G;  3H6M A;  4U68 A;  1HNW L;  4EGV A;  5JEA H;  5EBD A;  1LO5 D;  2J7Z A;  2QEJ C;  3I70 A;  1HZC A;  1L2F A;  3BZD B;  3HFZ B;  3PO3 H;  2B2V C;  3PUX A;  4GN3 B;  2AUJ D;  4JVZ A;  4QB4 A;  4DV3 Q;  3HKZ G;  1LTB D;  4IUT A;  1SNP A;  5A2Q E;  4KD3 A;  5CBA E;  2A6E C;  3OMC A;  1J5E L;  2SEB D;  3I73 A;  4B3R L;  2R7D A;  2A5H A;  5IIF A;  1EY0 A;  4A75 A;  1E1T A;  3J81 L;  1G8Z D;  2R61 A;  2EYL A;  1KDC A;  4JI6 Q;  1LAB A;  3I4M H;  4R8N A;  5C4J H;  1WTR A;  2R3Z A;  3UE0 A;  4RGO S;  2QGQ A;  2O4X A;  3PGZ A;  4OHJ A;  4Q5V A;  2B39 A;  3G6J B;  3IL8 A;  4FYD A;  2F1M A;  3MZ5 A;  1M90 C;  4OWX B;  4CKB A;  4C3H B;  3HOX G;  5A2Q L;  1DON A;  3RD4 A;  2HHH Q;  2JSO A;  3CCU A;  3CC2 A;  1TWH H;  5KEE A;  1M8A A;  1B7Y B;  1PTO D;  4A3B H;  1QUQ B;  1Q7Y C;  2CKZ B;  1JE4 A;  1V1P A;  1I6H B;  1EOT A;  5K5P A;  2PI2 A;  2BA1 A;  1STG A;  1TWF H;  4LFC L;  1WYD A;  2F0D A;  3SK4 A;  1STA A;  3CCE A;  2PZU A;  1A6X A;  4BA2 I;  2ENB A;  3E0E A;  1U4M A;  5E3F A;  4JI2 L;  2VUM G;  3C3L A;  2K28 A;  1PTO B;  4NXM Q;  4IZ8 A;  2K4K A;  4MZ9 A;  4DU9 A;  1EL0 A;  4PMW A;  4DR5 L;  4JBJ A;  1VF5 C;  2PMZ B;  1KD1 C;  4PZ8 A;  3OW2 A;  4AYB B;  2F3W A;  5EKL A;  1H9K A;  2D0P A;  5I9P A;  2L55 A;  3SK8 A;  1WOC A;  1SE2 A;  4CJ2 C;  4HJ5 A;  4KY7 A;  4DR4 L;  4ULL A;  3F2B A;  1CSQ A;  1KTK A;  2WAQ G;  2WB1 G;  1I4X A;  4NKL A;  2AWO A;  4DA2 A;  2K32 A;  3G6E A;  4HMI A;  2RDF A;  4NXN Q;  4UDU C;  1JIC A;  1G6Z A;  1BBW A;  2CCZ A;  1C9O A;  1HR0 L;  5G3L D;  3PO3 B;  5K36 G;  1ET6 A;  4ZKB B;  2F52 A;  2EYM A;  3PO2 G;  2SDF A;  2DN8 A;  1KRT A;  5M3M B;  1DOK A;  3QJY A;  2CW0 D;  1ENC A;  3G7L A;  3MEF A;  5FLM H;  2KEC A;  3R3O A;  2M9V A;  3CW2 C;  2D2C C;  2XWJ B;  1KDA A;  2Z1C A;  3Q6S A;  4YWL A;  4AH6 A;  5KYI A;  4R4Q A;  2YYZ A;  3T13 A;  1VQH A;  3DEP A;  3H91 A;  2LSS A;  1TQO A;  1FJG L;  3S16 H;  4ZRZ A;  1CHP D;  2ZXR A;  4RHS A;  3GP7 A;  1B4O A;  3A54 A;  4G57 A;  1LT3 D;  1SNO A;  5JPM C;  1OO9 B;  3F1Z A;  2ICE C;  2NTS A;  1ASY A;  3KJO A;  3ICE A;  4FO2 A;  3CQZ H;  2OQK A;  4JBM A;  4A93 H;  2QEX A;  2JA5 G;  3VYS A;  4A3G H;  4OIJ A;  2HCC A;  1VQK A;  3C2P A;  1EIY B;  1W6J A;  5DEH A;  1NR2 A;  1L1O A;  2PQA A;  2NWG A;  5JEA G;  3KLR A;  5C3E H;  2VQE Q;  3CKI B;  2K50 A;  4KHP L;  2JA7 G;  4LF7 Q;  4A3B B;  1IBM Q;  5KND A;  1T5X D;  3S2H H;  2L9H A;  3DHQ A;  4A3F G;  3BZK A;  1TWF B;  4P74 A;  5I9O A;  1SLJ A;  4NPS A;  1K3B C;  2EIF A;  1WTV A;  3KFU A;  1RTO A;  4KKS A;  4X3K A;  1PH1 A;  3HS0 C;  2IW3 A;  2A68 D;  1HUN A;  3PIP 3;  1KQS A;  4DK0 A;  3ZYY X;  3CPW A;  3NBH A;  4ZUJ A;  3MFY A;  1X3G A;  4C56 C;  1Y8P B;  1JB3 A;  1LT4 D;  4QIW B;  5HUR A;  1B9N A;  3I4M G;  2IX3 A;  3QOJ A;  3AFP A;  4O1N A;  2YV5 A;  3JC6 6;  4ZQ3 A;  3M4Q A;  1KXL A;  5EPK A;  4KY5 A;  1JC7 A;  4IFD J;  1UUP A;  4XTC S;  2RQX A;  3CCL A;  5IY0 A;  1I50 H;  1N34 L;  1YJW A;  5M5Y H;  3RZD H;  1L1O C;  1YIT A;  1S5C D;  5COY A;  1K0S A;  1A3T A;  1BCP F;  1SMY D;  1GUS A;  5E7N A;  1DM0 B;  4DV3 L;  1JR0 D;  2DJG C;  3FVQ A;  3MXN A;  1HRJ A;  1G2S A;  4GKJ L;  2PQE A;  4F87 A;  1BKB A;  2EY1 A;  4CDC C;  4EQP A;  4EX5 A;  1GHK A;  4WJ3 M;  2KHI A;  4DR3 Q;  1XPR A;  2NVQ B;  1EYC A;  3P1H A;  1HNX Q;  3PIO A;  1PRT B;  5ELE A;  1FYC A;  1S5B D;  4JI6 L;  5ISR A;  4IPD A;  4B3T Q;  2WB1 E;  2AQ2 B;  1X3F A;  3MWY W;  2DGY A;  3SK6 A;  1CT1 D;  3STB C;  4UY8 C;  3M3Y B;  1S72 A;  3TS2 A;  3BDC A;  1JOQ A;  2JEB I;  4NP5 A;  4LF9 Q;  4JBW A;  3JAM L;  3CPF A;  1EFW A;  3ERS X;  3I3C A;  1UEA B;  3P7J A;  4KKT A;  2UXB Q;  4IOA A;  1S3O A;  1ONL A;  2HHH L;  3PQI A;  3D4W A;  4RH6 A;  4DR2 Q;  2JA9 A;  4C3J H;  1SFO B;  2PMZ E;  1PZK D;  4LFA L;  1SYC A;  3KK7 A;  1CTM A;  2I5M X;  4JI1 L;  3L9A X;  4N8F A;  1NCV A;  3STB D;  4AYB E;  1TU2 B;  4V19 0;  3OOC A;  2MHV A;  1C48 A;  1IYV A;  2K5Q A;  3QG1 A;  2KED A;  3H0G H;  4BY1 H;  4DV1 Q;  3D4R A;  1FNU A;  1ZXT A;  4NXM L;  1U4R A;  1MBY A;  1J8I A;  4GS3 A;  5C3E B;  5ELF A;  1UE7 A;  3TP6 A;  1WFQ A;  4GLA C;  4A3J B;  3FKI G;  4N8X 1;  3ND9 A;  1LM0 A;  2NN6 G;  2ZT9 C;  5CV7 A;  1LTA D;  5IT9 E;  2F4V L;  3DM3 A;  1I4G A;  3M4O H;  1T9H A;  3BVZ A;  4H44 C;  1V1O A;  4I7A A;  2IX0 A;  4JYA Q;  1Q3L A;  3I56 A;  1GXD C;  1PYB A;  1K0R A;  1HNZ L;  4LFB Q;  1QZG A;  4JI7 Q;  3L2P A;  5FLM G;  1B9M A;  3V96 A;  5GAE C;  4RCO A;  4KHZ A;  2ASB A;  4H0L C;  2XRS D;  3A8K E;  3GTQ B;  3A56 A;  4LJZ C;  1SNC A;  3K80 C;  2PNH A;  1SRU A;  2KJX A;  4XQN A;  1IBL Q;  1QWY A;  3CC4 A;  2K52 A;  3F8T A;  4P72 A;  3SK5 A;  4YIJ A;  1AFP A;  4J8Q A;  1D1I A;  1Q82 C;  2Z8L A;  4A93 G;  5KYL A;  3RR5 A;  4A3G G;  2EYH A;  1BBU A;  3NSW A;  1JOK A;  4CKC A;  3RZD B;  4H02 A;  2KCN A;  2N3S A;  1UE1 A;  5IGB A;  4QY7 A;  3P20 A;  2PO4 A;  1SE4 A;  2K05 A;  3Q22 A;  1PVO A;  5ELD A;  1LLR D;  3HRZ C;  1Q1E A;  4K5X A;  2A1A A;  1XJV A;  4AQY Q;  1XMO Q;  1ESF A;  5D3I B;  4IOC A;  5JOB A;  3HOY B;  2A69 D;  1EFI D;  5C6A A;  3N6R A;  5T1G A;  4O42 A;  3K59 A;  3FEW X;  4ZAI A;  3NTK A;  3GTJ B;  2G9H D;  1JCK B;  5IYD G;  2GN5 A;  4K0K Q;  2A74 C;  1AP0 A;  4IUP A;  2TMP A;  4ODG A;  3S2D H;  3I4O A;  2B8F A;  3H3V H;  4G4K A;  2KBN A;  3BU2 A;  3I7F A;  1H9S B;  1YVC A;  3T56 B;  3AYH B;  2JN4 A;  4DNT B;  1Y8N B;  3BVM A;  4WFN 3;  4FXD A;  1TWG B;  1B2T A;  4LF5 L;  1RCV D;  1E1O A;  3RN2 A;  1D2B A;  3I8Z A;  5KIX A;  1KHI A;  4HAE A;  4LWC A;  2R93 G;  1AE2 A;  3J7A F;  3M7G A;  3QB3 A;  4QIW E;  5IT9 c;  3D3R A;  2VQE L;  5FO9 B;  1XTC D;  3RZO B;  1N9W A;  3NTI A;  4LF8 Q;  3DWQ A;  1ROD A;  1K73 C;  2KQ3 A;  4DV6 Q;  4A3K G;  1KC8 C;  4J6H A;  1K8M A;  2VNU D;  4DUY Q;  5EGT A;  4HID A;  1M4V A;  5AFW A;  4DAY A;  4B3S Q; 
#chains in the Genus database with same CATH homology
 2F3I A;  3PUX A;  4IJH A;  4JI5 Q;  1JJG A;  3S1N H;  4GN3 B;  4DV3 Q;  3HKZ G;  1PH9 A;  4LNQ A;  2Z0S A;  4R4T A;  5IYC G;  2AMC B;  2LXK A;  1Y1W G;  2N78 A;  1YI2 A;  2LXJ A;  3F2C A;  2ZTD A;  1I94 L;  1J5E L;  2RHS B;  4DV7 Q;  3A74 A;  4JOI C;  4AYB G;  1Y1V H;  2YTX A;  3TRE A;  4BBR G;  3CME A;  2VQF Q;  4B3R L;  1JJC B;  4UPA A;  3HOZ G;  4A3L H;  1RIP A;  4GN5 A;  2R7D A;  4GKK L;  1K83 H;  2D62 A;  4OON A;  3GO5 A;  3J81 j;  4A75 A;  1R9T H;  1E1T A;  1X65 A;  2IX1 A;  3RLN A;  2NVX H;  2JJQ A;  1PYS B;  2JQO A;  1SFO H;  4JI6 Q;  1QVF A;  4DKA C;  5FJ8 G;  3I4M H;  3A0J A;  5ELN A;  1E22 A;  5LMU Q;  4LF6 L;  5C4J H;  3UE0 A;  2QGQ A;  5IE8 A;  2JK8 A;  3G4S A;  1XNR Q;  3PGZ A;  4LF5 Q;  5JJK A;  3UDI A;  2ZTC A;  4YHH L;  4JI8 Q;  1FGU A;  2N49 A;  3JAM i;  5C0X G;  1VQJ A;  3GTK H;  4A3C G;  4X62 L;  2R7F A;  4X66 L;  3KF8 B;  4OXP A;  3CMA A;  4LF4 L;  1M90 C;  5IP7 H;  3FHW A;  4QL5 A;  4OWX B;  1XTD A;  1K9M C;  5HGQ A;  3HOX G;  4LW1 A;  4DR1 L;  5C4X H;  1PFS A;  2MFI A;  1D8L A;  5IP9 G;  4XIG S;  5DLQ E;  2B3G A;  4A3J H;  4L5T A;  1XNQ L;  3PO3 G;  2HHH Q;  2V1C C;  3CCU A;  4A3I H;  3CC2 A;  1TWH H;  1W2B A;  3MXN B;  1B7Y B;  3T1Y L;  5LMN W;  2R7Z H;  5BR8 L;  4A3B H;  1QUQ B;  1Q7Y C;  2CKZ B;  2IT1 A;  5M3M G;  1X56 A;  5M3F H;  4GNX B;  2PI2 A;  3H0G G;  1S40 A;  2BH2 A;  3J7A 5;  2UXC L;  4BY1 G;  2BA1 A;  1TWF H;  4J15 A;  4LFC L;  1WYD A;  2GVA A;  1Y1V G;  1YNX A;  2K75 A;  4O2D A;  4KI0 A;  4NXN L;  4ALP A;  4B3T L;  3CCE A;  4A3L G;  1CSP A;  1VQI A;  4UP9 A;  2VL6 A;  2H5X A;  4BA2 I;  4OX9 L;  4X65 L;  3E0E A;  1VQP A;  2K5N A;  1I94 Q;  4C2M H;  3Q8D A;  4JI2 L;  4X64 L;  2VUM G;  5H1S E;  3GTQ H;  4B3R Q;  1Q86 C;  4NXM Q;  3K7A H;  1VQC A;  4GKK Q;  2CQO A;  2K4K A;  4MZ9 A;  3ULP A;  4UP7 A;  1VQB A;  1GM5 A;  2JE6 I;  4PMW A;  4L5Q A;  4DR5 L;  1GVP A;  3K8A A;  2AWN A;  4JBJ A;  4GLV B;  2UU9 Q;  4DV0 Q;  4QQB X;  1KD1 C;  3AQQ A;  1XMQ Q;  4LF6 Q;  5LMN L;  4PZ8 A;  4JI3 L;  1U5K A;  3OW2 A;  3RLF A;  4GOP A;  2K5H A;  4PZ6 A;  3K81 C;  1A62 A;  4QGU A;  1PH2 A;  1WCM H;  1YIJ A;  3H3V I;  1HR0 W;  2ALY B;  2Y0S E;  2UUA L;  1JE5 A;  2D0P A;  4DAM A;  2A8V A;  4X62 Q;  5C4X G;  4YCU A;  5FLX c;  2YTY A;  3J80 i;  3H15 A;  3KJP A;  1WOC A;  4P71 A;  3VDY A;  1MKH A;  3D31 A;  1YZ6 A;  3B6Y A;  4Y7N H;  1V43 A;  2D0O A;  4A3M G;  4HJ5 A;  2NZO A;  4DR1 Q;  4A3B G;  4DR4 L;  1C7Y A;  1TWA H;  1E24 A;  4DV2 L;  3S15 H;  1G51 A;  5GAD C;  2MNA A;  3F2B A;  1PHJ A;  2E2H H;  1CSQ A;  2WAQ G;  2WB1 G;  1CKM A;  3T1Y Q;  4NB3 A;  3PF4 A;  1YHQ A;  5C0X I;  1P16 A;  2Q2T A;  2AWO A;  2FXQ A;  3HOY H;  3CAM A;  2K14 A;  1DGS A;  4P75 A;  2JA5 H;  4LUV A;  1VQF A;  4POF A;  3G6E A;  4OWW B;  1I3Q H;  4BY7 H;  2UXC Q;  5C0X J;  2R92 G;  1N33 L;  1VQM A;  3UDG A;  1QVG A;  3GTJ H;  4JI4 Q;  4NXN Q;  4A3D H;  1BBW A;  3CF5 A;  2CCZ A;  5M5X H;  1C9O A;  4LF7 L;  1XPO A;  1HR0 L;  1IBM L;  4OX9 Q;  5JEA J;  4X65 Q;  5K36 G;  1CKN A;  1N36 L;  4A76 A;  2F52 A;  3PO2 G;  4P73 A;  4JI2 Q;  4X64 Q;  2N8N A;  3CC7 A;  1KRT A;  4LFB L;  2JA7 H;  1VQ9 A;  3M85 A;  1OTC A;  2E5L L;  3GTG H;  4IFD G;  1TWG H;  1YJN A;  1JMC A;  2OTL A;  1HZB A;  3UE1 A;  3WWV A;  4A3F H;  2UUB L;  5HY6 A;  4BXX H;  1G6P A;  1ASZ A;  1NMF A;  4R1J A;  4HIO A;  4GOP C;  4JI0 L;  3HOW G;  4DR5 Q;  3I4N H;  1N32 L;  1WCM G;  2A19 A;  1WI5 A;  2ZJR A;  3MEF A;  5FLM H;  1OXU A;  1U0L A;  2ZJP A;  1PH5 A;  3CW2 C;  5LMN Q;  4DUZ L;  1VQ5 A;  1E3P A;  3NBH B;  4JI3 Q;  4YWL A;  4DK3 C;  4AH6 A;  3RZO H;  4R4Q A;  2YYZ A;  3GTL H;  1BVS A;  5EAY A;  1LYL A;  1VQH A;  1UE6 A;  2LSS A;  3A5Z B;  1NE3 A;  1FJG L;  1VQ6 A;  3S16 H;  4APV A;  3M4P A;  4POG A;  2I0Q A;  1A8V A;  3F1Z A;  3EN2 A;  5IYB H;  1ASY A;  1A63 A;  3KJO A;  2JA6 H;  2NVT H;  1X3E A;  5C44 H;  4PZ7 A;  2KCT A;  3ICE A;  3K0X A;  3CQZ H;  2OQK A;  4JBM A;  4DV2 Q;  3KDF B;  4B3M L;  2HIV A;  4A93 H;  3PUW A;  4IPG A;  2QEX A;  1PV4 A;  2ZM6 L;  1IYJ B;  1EYG A;  2JA5 G;  2Q2U A;  1Z9F A;  4A3G H;  1Y14 B;  1VQK A;  4A3D G;  1EQR A;  1EIY B;  3BJU A;  3A5U A;  3OYY A;  1L1O A;  2PQA A;  2VW9 A;  5JEA G;  1I5F A;  4JV5 Q;  5C3E H;  2VQE Q;  4A4I A;  1N33 Q;  1SN8 A;  2K50 A;  3KF6 B;  3E9H A;  4KHP L;  2JA7 G;  4LF7 Q;  1YBY A;  1HNW Q;  1L0W A;  4BA1 I;  3CXC A;  4HJA A;  1HR0 Q;  4YCW A;  1IBM Q;  1IL2 A;  3TQY A;  3S2H H;  1TWC H;  4A3F G;  1N36 Q;  2K5V A;  3BZK A;  3JAM c;  4P74 A;  1IBK L;  2ID0 A;  3OTO L;  1SLJ A;  4DR3 L;  3PCO B;  1HNX L;  2E5L Q;  1NJI C;  1O7I A;  1X55 A;  2EIF A;  3IRB A;  4NPS A;  3KFU A;  1VS0 A;  2UUB Q;  1PH1 A;  3NEL A;  4IJL A;  3ER0 A;  4JI0 Q;  2HIX A;  2NZH A;  2MQH A;  1KQS A;  1H95 A;  1WJJ A;  1N32 Q;  3CPW A;  3PIP A;  3G71 A;  4R4C A;  1X3G A;  3AFQ A;  1J5E Q;  3TEH B;  3M9B A;  3L0O A;  4C3H H;  3S17 H;  1CUK A;  2PI2 E;  2YU9 H;  4Y52 H;  4LF9 L;  3I4M G;  3HKS A;  4RG1 A;  2E8G A;  2QA4 A;  4YWK A;  1EOV A;  2ES2 A;  4L5S A;  2JA6 G;  1EWI A;  2E2J H;  2JEA I;  1FJG Q;  3AFP A;  4A3E H;  4DV5 L;  2YV5 A;  1Q1B A;  3JC6 6;  3M4Q A;  1KXL A;  3I55 A;  3TS0 A;  1OXV A;  2UXB L;  4IFD J;  1KRS A;  2UUC L;  3E9I A;  3DLL A;  1FL0 A;  4XTC S;  3UDX A;  3ZJY C;  5IY0 A;  3T1H L;  3CCL A;  1I50 H;  3U4Z A;  3RLO A;  4DR2 L;  4IO9 A;  1N34 L;  3SGI A;  3W5O A;  1YJW A;  4B3M Q;  5IP7 G;  5M5Y H;  3RZD H;  2ZM6 Q;  1L1O C;  4YHH Q;  1YIT A;  3AEV A;  2B63 H;  1SR3 A;  3CCV A;  1NY4 A;  3PSI A;  4TQU S;  5C3E G;  3CCJ A;  2HT1 A;  4X66 Q;  5E7N A;  4JG2 A;  4LF4 Q;  4DR6 L;  4A3J G;  1VQ4 A;  3RNU A;  4DAY B;  4A3I G;  1HZ9 A;  4DV3 L;  1Q46 A;  3KF6 A;  2R6G A;  4MTN A;  2UXD L;  2Y0S G;  1VCI A;  2OWO A;  2R7Z G;  3HOU H;  4KHP Q;  4DV4 L;  1XNQ Q;  4DV1 L;  2YTV A;  4HIM A;  3PUZ A;  2VZA A;  5M3F G;  4GKJ L;  4UP8 A;  1BKB A;  1QUQ A;  1QVC A;  1D7Q A;  2ZJQ A;  4EX5 A;  5AJ3 L;  1KIX A;  4WJ3 M;  2XTI A;  5BR8 Q;  4GNX A;  1GKH A;  2KHI A;  1IBK Q;  3OTO Q;  4DR3 Q;  4YY3 L;  1XPR A;  4PG3 A;  2OCE A;  1HNX Q;  3PIO A;  4BBR H;  1AH9 A;  1B70 B;  3J80 c;  1PH8 A;  3G48 A;  2JA8 H;  4LFC Q;  3GTP H;  4JI6 L;  1JJ2 A;  4IPD A;  2MO1 A;  2WB1 E;  4B3T Q;  1EIF A;  3EIV A;  4DR7 L;  1X3F A;  4LUZ A;  2DGY A;  2RCN A;  4JYA L;  3FKI H;  2OQ0 A;  3STB C;  1PH4 A;  4UY8 C;  3CP0 A;  1IZ6 A;  4FDB A;  1KL9 A;  1HJP A;  1S72 A;  4ME3 A;  4RMF A;  3TS2 A;  4JI8 L;  1VQG A;  2JEB I;  4LF9 Q;  2AHO B;  4JBW A;  4JI7 L;  3CPF A;  1EFW A;  3ERS X;  1VQ8 A;  3HOV H;  3KLW A;  1HZA A;  1UEB A;  1C0A A;  2UXB Q;  4A3C H;  4IOA A;  1IXR A;  2UUC Q;  1PH7 A;  1S3O A;  3GTO H;  3ULJ A;  4OO1 G;  2IHF A;  5GRO A;  3T1H Q;  2HHH L;  4DR2 Q;  1IBL L;  1KAW A;  1N34 Q;  4X6A H;  2JA9 A;  3HKZ E;  4C3J H;  3HOX H;  2E2I H;  1Q12 A;  4HJ9 A;  1A0I A;  2PMZ E;  2UUA Q;  1TXY A;  3ULL A;  4LFA L;  1HH2 P;  1UWV A;  2I5M X;  4QJF A;  4JI1 L;  3U58 A;  4JBK A;  1PH6 A;  2IHE A;  1JB7 A;  4DR6 Q;  3STB D;  3KOJ A;  4AYB E;  1X9N A;  1YHA A;  3FP9 A;  4WJ4 A;  2UXD Q;  3W1B A;  1G29 1;  5M3M H;  4GNX C;  2ATW A;  4L5R C;  4DR4 Q;  2AKW B;  3H0G H;  4DV4 Q;  4BY1 H;  4DV1 Q;  3HOY G;  4GKJ Q;  3PV0 A;  2L15 A;  2JA8 G;  3J7Z C;  4BY7 G;  1OXT A;  5AJ3 Q;  4HJ8 A;  4NXM L;  4EQ5 A;  3S1M H;  1FVI A;  4GS3 A;  1UE7 A;  4JC0 A;  1Q8K A;  4YY3 Q;  2MO0 A;  4C3I H;  1WFQ A;  4GLA C;  4DPG A;  3FKI G;  2DUD A;  5JJL A;  1W3S A;  2VUM H;  2BH8 A;  1LM0 A;  2Q2I A;  2NN6 G;  2F4V L;  3DM3 A;  2UU9 L;  4DV0 L;  3KYH C;  3TRZ A;  5IWA L;  1T9H A;  1XMQ L;  1PH3 A;  3M4O H;  4AQY L;  1XMO L;  4DR7 Q;  1NBW A;  2IX0 A;  2KCM A;  4JYA Q;  1SMX A;  3I56 A;  4BXX G;  2Z6K A;  3HOV G;  3GTM H;  3S14 H;  1PYB A;  1K0R A;  3I2Z A;  4R4O A;  1HNZ L;  4GOP B;  4LFB Q;  3I4N G;  1QZG A;  3LGJ A;  4K0K L;  4JI7 Q;  1VQE A;  3L2P A;  5FLM G;  3CCM A;  1N8R C;  5GAE C;  2CWP A;  4IPH A;  5J3B A;  1B8A A;  4KHZ A;  1XPU A;  2ASB A;  1J6Q A;  2CWA A;  1OXX K;  5IYD H;  3CD6 A;  1YHB A;  2VY3 A;  3K80 C;  2PNH A;  5M5W H;  4DUZ Q;  2EQS A;  3CCR A;  3BZC A;  4IPC A;  1SRU A;  5ELO A;  5GAH C;  1IBL Q;  2I5H A;  3PF5 A;  4A3M H;  1OXS C;  5IYB G;  3CC4 A;  2K52 A;  3F8T A;  1VQL A;  1YEZ A;  4OWT B;  4P72 A;  4O0A A;  4LFA Q;  5C44 G;  3J81 i;  4IFD I;  4LUO A;  4JI1 Q;  2XGT A;  1GO3 E;  1VQD A;  1NTG A;  3EBE A;  1Q82 C;  1K8G A;  3RR5 A;  1K8A C;  4A93 G;  1I6H H;  4A3G G;  1BBU A;  4JI4 L;  2EXD A;  1CKO A;  1VQO A;  4H02 A;  3KDF A;  4LF8 L;  2N3S A;  1UE1 A;  2B29 A;  1SRO A;  4QY7 A;  2NVY H;  2R93 H;  4DV6 L;  1AE3 A;  2WP8 J;  5GQO A;  3U50 C;  3RN5 A;  3F2D A;  1PA6 A;  3M7N A;  2KEN A;  4OO1 I;  4AIM A;  4DUY L;  2R92 H;  3S1Q H;  2C35 B;  3NEM A;  1CKN B;  1PVO A;  3UDF A;  4B3S L;  2I5L X;  4JI5 L;  4A3K H;  3D0F A;  3J81 c;  1Q1E A;  4BBS H;  2OTJ A;  2RHQ B;  3PO2 H;  1X6O A;  2Z6K C;  4HIK A;  2KHJ A;  2F4V Q;  2A1A A;  1M1K C;  1XJV A;  1X54 A;  5IWA Q;  3PUV A;  1Q81 C;  1VQ7 A;  4AQY Q;  1XMO Q;  2Q2H A;  4DV7 L;  4IOC A;  2HQL A;  2VQF L;  1E7Z A;  1MJE A;  5IYC H;  1QZH A;  3HOW H;  1K3R A;  1Y1W H;  3S1R H;  1MJC A;  1HNZ Q;  1LTL A;  4YWM A;  4K0K Q;  2CFM A;  4JOI A;  2GN5 A;  5IYD G;  3S24 A;  1UE5 A;  3HOZ H;  3S2D H;  1V9P A;  3I4O A;  4MNO A;  3GD7 A;  1MIU A;  3H3V H;  2KBN A;  2WAQ E;  3BU2 A;  3I7F A;  2NN6 I;  5LMU L;  2WFW A;  3L7Z C;  1EQQ A;  3W1G A;  2ZTE A;  2RF4 A;  1YVC A;  3AYH B;  2IY5 B;  4KLK A;  1XNR L;  2GVB A;  4JCV E;  4YCV A;  5FJ8 H;  4HJ7 A;  4A3E G;  4LF5 L;  1E1O A;  3RN2 A;  1JT8 A;  5JJI A;  3U4V A;  1KHI A;  3K7U C;  4LWC A;  4DNI A;  3CCQ A;  1YJ9 A;  1Z47 A;  2R93 G;  1VQA A;  1VQN A;  1AE2 A;  3PUY A;  1NMG A;  1EUJ A;  4QIW E;  4TVA B;  4DV5 Q;  5IT9 c;  4JV5 L;  1SE8 A;  2VQE L;  2VS1 A;  2NVQ H;  1L1O B;  2PQA B;  5GAG C;  1GD7 A;  1N9W A;  2B63 G;  4LF8 Q;  3CCS A;  4GLX A;  1HNW L;  3GDE A;  1K73 C;  4DV6 Q;  4A3K G;  1KC8 C;  2VNU D;  4GN4 B;  4R4I A;  4BBS G;  4DK6 C;  4DUY Q;  1HZC A;  1LUZ A;  3NEN A;  4HID A;  1L2F A;  1RL2 A;  1P8L A;  5IP9 H;  1V1Q A;  2BA0 A;  3HOU G;  3HFZ B;  3PO3 H;  4B3S Q;  3M3Y H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...