4KHPL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
125
structure length
125
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 14
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4khpL00
3U50C 1JJCB 3E0EA 2CQOA 2QGQA 1XMQQ 2K14A 4B3SQ 3L0OA 4YY3Q 4PMWA 4DR2L 2ZJQA 1E3PA 4PZ8A 1KRTA 2XGTA 1FGUA 2A19A 5GROA 5ELOA 1I5FA 1KAWA 1PH3A 3H0GH 4JI7L 4JI3L 4A3IH 4AH6A 5C0XJ 2ATWA 4DV1L 2CWAA 3CCMA 4TQUS 5JEAJ 2LSSA 1JMCA 3KFUA 4PZ6A 1JJ2A 1GO3E 1CSQA 1EOVA 4DV3Q 4JI4L 3TS2A 4KHPL 5E7NA 2E2HH 4A3MG 2B29A 1HZCA 4R4CA 3PO3G 2Q2IA 4JOIA 4HJ7A 1T9HA 2YTXA 3CF5A 4OX9L 4BBRH 3GO5A 1G6PA 4GKKQ 1D8LA 1J6QA 5IYDH 1XJVA 4A3GH 3GTMH 1G51A 3A74A 4DV6L 2JE6I 1L1OA 3STBC 3GTGH 1QZHA 3K80C 2CFMA 3K7UC 4OXPA 4YCWA 2ZTCA 4GLAC 1G291 1YHAA 2N3SA 4KHZA 2UUBQ 2K5HA 4DR6L 1L2FA 1MJEA 3HOYG 1PVOA 4APVA 2HIXA 2E5LQ 3BZCA 1PYSB 5IYCH 1YHQA 2OWOA 2NN6I 3M4PA 1HZAA 5M3MG 1XTDA 3CQZH 4GN3B 2R92G 2UUAQ 4IFDI 1S3OA 1ASZA 1CUKA 1B8AA 4A3JH 4NXNQ 1HNWL 4JI8Q 2AMCB 3ULLA 2FXQA 3NBHB 1VQ9A 4YWMA 4JYAL 1U0LA 3DM3A 1N34L 1IBML 4BY7G 5GAEC 4HIKA 2VZAA 1K83H 5AJ3Q 1HNXQ 1A62A 3CMEA 4AYBE 3NENA 5FLXc 1CKOA 4JI5Q 3OW2A 4C3IH 4B3TQ 1N8RC 2YTYA 3RR5A 3PO2G 1AE3A 4UPAA 4R1JA 4IFDJ 2RF4A 5IP9G 3AYHB 1HNZL 1YJNA 3W1BA 2GVBA 4DR7Q 3G4SA 3RLOA 4JI0Q 2HT1A 4B3SL 4IPDA 4YY3L 2PQAB 4DV4Q 1I6HH 4YWLA 1C7YA 4X64L 4A75A 3M3YH 1EYGA 1PH6A 4QJFA 2NVXH 3GD7A 2EQSA 3AEVA 1VQ5A 4WJ4A 4X62Q 3SGIA 1PH4A 2WAQE 3I56A 2ASBA 2JA7G 4IOAA 1EIYB 1VQCA 5HY6A 1OTCA 2K52A 2E2IH 2JA5G 1UEBA 4UY8C 1XNRQ 1GKHA 1KIXA 3PUYA 3HOYH 2MFIA 4MZ9A 2PNHA 3PF5A 3PSIA 4DV3L 1E7ZA 1M1KC 1V1QA 1KD1C 1YJWA 3J7ZC 1EWIA 1SN8A 1VQPA 3F8TA 1V43A 5M3MH 1QVFA 2OQKA 4DV7Q 1QUQB 2F4VQ 1V9PA 5GAHC 2R92H 2KENA 3G48A 2VS1A 4PZ7A 1HZBA 3HOXG 4B3ML 4A3DG 2NZOA 4GKKL 3CC4A 1TWGH 2Y0SG 2Q2UA 4JBWA 2NVYH 3M7NA 1HR0Q 3LGJA 4GS3A 2ID0A 1SROA 4DUZQ 3ULPA 3F2DA 3TEHB 2ZM6Q 4K0KQ 1P16A 5IE8A 1K9MC 2UUBL 1A63A 4QGUA 3OTOQ 4HJ8A 1WYDA 5IP7G 1QZGA 2E5LL 1IBKQ 3PO2H 3STBD 4X65Q 4LFBQ 4POFA 1YZ6A 4LF6Q 4A3CG 3JC66 2PQAA 1E22A 1BBWA 2ZJRA 4GNXA 1VCIA 2UUAL 2JEAI 1X55A 3H3VH 1IBLQ 1SR3A 1YHBA 2Z0SA 3K8AA 1PH5A 1B7YB 2N78A 3CD6A 4AYBG 1BVSA 4JI8L 3KJOA 3CPWA 2VQEQ 2R93G 2UXBQ 2IY5B 5C4XG 3H3VI 4BA2I 1RL2A 1WOCA 3EIVA 3RLFA 2YU9H 4UP9A 4YWKA 2JA7H 1PH1A 5IT9c 5AJ3L 1DGSA 1X54A 3S24A 1HNXL 4YHHL 4WJ3M 3S1QH 4JI5L 3VDYA 3TREA 1VQGA 2BA0A 3PUXA 3PUWA 5C3EG 1VQAA 1KQSA 4B3TL 4HIMA 2Z6KA 2EXDA 1Q7YC 2R7ZH 1N32L 1LTLA 1NTGA 3MXNB 3UDXA 4EQ5A 5M3FG 3ICEA 4IPHA 3GTLH 4DV2L 3HOVG 2WFWA 1KXLA 4DR4Q 4DR7L 2PMZE 2WAQG 3G71A 3RZDH 1PHJA 2C35B 5ELNA 4GN5A 2UUCQ 4DV4L 1D7QA 4DAYB 4X66Q 3HOXH 1NJIC 1FVIA 1HH2P 4A3LH 3FP9A 4DAMA 4X62L 1EQQA 2YTVA 4DV5Q 2K50A 4DR3Q 1GD7A 3KF8B 1A8VA 1Z9FA 2K5NA 3KDFA 3W1GA 1VQ4A 1XMOQ 4BBSG 3G6EA 4XIGS 4LF5Q 1N33Q 3GTQH 4C2MH 4R4QA 3CCEA 4OONA 1PH2A 1K8GA 4GOPC 4A3FH 1N9WA 2EIFA 3S2HH 2L15A 5IP7H 4LNQA 3CCUA 2VUMG 1PH7A 2BA1A 1Y1VG 4GOPB 1YVCA 4IJLA 2H5XA 3K0XA 2VL6A 3T1YQ 4BXXG 4MNOA 4KI0A 4BY1G 4A3CH 1VQLA 5FJ8G 4DV7L 2F4VL 5K36G 3FKIG 4DV0L 3E9HA 2AHOB 2RHQB 3PIPA 2Y0SE 2JA6G 1TWFH 5EAYA 1K8AC 2R93H 3K81C 1EQRA 5C4XH 4DUYQ 3CCLA 1WI5A 1Q12A 3T1HL 3EBEA 3WWVA 2QA4A 2D0PA 3JAMi 4YCVA 2N8NA 4P73A 3ZJYC 1FJGQ 1OXXK 1Y14B 3S2DH 4K0KL 4IO9A 3RN5A 1VQKA 1E1TA 1PFSA 4L5TA 5GQOA 2GN5A 2JA9A 5C3EH 3E9IA 1X9NA 3GTPH 1C0AA 1NMFA 1IBKL 2I5LX 4HIDA 2B63G 2JQOA 3ERSX 4X65L 4LFBL 4LF6L 2HHHQ 2CCZA 4P74A 1K3RA 4JV5Q 4LF8Q 4LF9Q 4NB3A 3A5ZB 3CCVA 1RIPA 3S14H 3JAMc 3U4ZA 5M5XH 3CCSA 3RZOH 2AWNA 4PG3A 1AE2A 3EN2A 3F1ZA 4A3MH 4OO1G 1VQBA 3PO3H 4KLKA 5M5WH 4BBSH 4LFAQ 4GOPA 1XMQL 5FLMG 5GADC 2QEXA 4DR5Q 3UDIA 3KF6B 1YI2A 2JK8A 3AFQA 3B6YA 3HKSA 4NPSA 1GVPA 5LMUQ 4A3KG 3PCOB 5BR8Q 1VQHA 2VUMH 4X6AH 3KOJA 1IL2A 4MTNA 4R4TA 1B70B 3CMAA 2BH8A 4DR4L 4OWXB 4R4OA 4L5RC 2A8VA 1X65A 4BA1I 2CKZB 3CAMA 3FKIH 1XNQQ 4C3JH 1VQ8A 1MKHA 4X66L 1X3EA 2JA6H 1OXVA 4P75A 1CSPA 3PF4A 5C0XG 1WFQA 2OQ0A 1XMOL 1VQ7A 2GVAA 2D0OA 3L7ZC 5JEAG 4JI6Q 4LF5L 2AWOA 5IYBG 1N33L 5H1SE 5JJKA 3GDEA 3UE0A 3NEMA 1X3GA 4LF4Q 3I4NG 2B63H 3T1YL 3RLNA 2WB1E 4BY7H 1EIFA 1U5KA 2R6GA 4LF7Q 1CKNB 2R7DA 2RHSB 3CPFA 1BKBA 4YCUA 3HOUG 2HQLA 1NMGA 2Q2HA 2ALYB 3H0GG 2BH2A 4DUYL 1YEZA 5IP9H 3TRZA 1C9OA 1W3SA 3KF6A 4DNIA 5JJLA 3F2BA 3I4MG 2LXJA 1UWVA 3PIOA 1WCMG 1FJGL 2YYZA 5M5YH 2CWPA 3AQQA 1M90C 4NXNL 1K0RA 3PV0A 1IXRA 4GLVB 1NE3A 2VQFQ 2IX0A 1KHIA 4DK3C 3J81i 2NVQH 2HHHL 2DGYA 3GTKH 3M4OH 3J80i 4JOIC 2RCNA 1Y1WG 1Q82C 1S40A 5IYDG 4GN4B 3L2PA 2D62A 2JA5H 4LF9L 4A3GG 4JV5L 2VW9A 4NXMQ 1N36Q 3TS0A 4AIMA 4Y7NH 1QUQA 2F52A 4LUZA 2UU9Q 1J5EQ 4A76A 2HIVA 4UP7A 4LUOA 4DKAC 4JI1Q 1PH9A 3GTOH 3CW2C 5C44G 1XPOA 5LMNQ 1TWHH 1SRUA 4L5QA 4JI0L 5C0XI 5IYCG 4DR5L 3J81c 2K75A 4FDBA 4HJ9A 1W2BA 2ZJPA 2KCTA 1TWAH 3NELA 3J80c 1I3QH 2K4KA 4A3EG 4IFDG 4QQBX 3I2ZA 2KCMA 1X3FA 1MJCA 1OXUA 1S72A 2VY3A 4B3RQ 4AQYQ 4A3JG 3BU2A 5C4JH 4GLXA 1VQOA 4X64Q 3Q8DA 1XNRL 3BJUA 1XNQL 4JI2Q 1VQDA 3M9BA 2MO0A 1I94Q 4L5SA 3HOUH 4A93G 4LWCA 4POGA 2UXDQ 1VQIA 1LM0A 1Q1BA 1Q46A 5GAGC 1QVCA 4O0AA 2MQHA 2PI2E 2I0QA 1HZ9A 1TWCH 2I5HA 3I4OA 4JI6L 2WB1G 3I4MH 2Q2TA 1WCMH 4DR1Q 2MNAA 4C3HH 2KHJA 2PI2A 1VQFA 1K73C 3CCRA 1JT8A 4JBJA 4LFCQ 4LF4L 1LUZA 4P71A 2JA8G 4A3BG 3J7A5 4A3DH 1VS0A 3U58A 3H15A 1SE8A 1HR0L 1HJPA 4H02A 4EX5A 5IWAQ 3A0JA 4DUZL 1E1OA 4HJAA 2OTJA 4LF7L 2ZM6L 1YITA 4B3MQ 3S15H 2WP8J 1Y1WH 3K7AH 2UXCQ 3HKZG 2MO1A 3OTOL 3IRBA 3DLLA 1JB7A 3D31A 1P8LA 4HJ5A 2OCEA 1NBWA 1Q81C 5M3FH 1XPUA 5J3BA 4JCVE 4QY7A 1Q1EA 3HOVH 3HOZG 1AH9A 2XTIA 3HFZB 5C44H 2R7FA 4OWWB 5HGQA 4JG2A 3I7FA 4ALPA 4OWTB 1PV4A 1IZ6A 1IBLL 1OXTA 2VQEL 2UXBL 1UE6A 1Q8KA 3UDGA 1LYLA 4A3EH 3HOWG 3KLWA 3PUVA 2NVTH 3FHWA 4R4IA 2VQFL 1PA6A 3CC7A 1YJ9A 4GKJQ 1XPRA 1SLJA 1YBYA 3M4QA 3GTJH 2YV5A 4NXML 3KJPA 1VQNA 1N36L 4A93H 3CXCA 1A0IA 4TVAB 3S1NH 1N32Q 1Y1VH 1H95A 2UU9L 4IJHA 5DLQE 3W5OA 3CCQA 1J5EL 2E2JH 1EUJA 1I50H 1X56A 4JI1L 4YHHQ 4BY1H 1E24A 1JE5A 2LXKA 2JJQA 5LMNL 4DR2Q 4BXXH 3CCJA 1SFOH 5FJ8H 1QVGA 1PYBA 4LUVA 3S1MH 2UUCL 4DK6C 2KBNA 3A5UA 3CC2A 4JI7Q 4LW1A 4DV2Q 4JI3Q 3S16H 2K5VA 1MIUA 1VQJA 1WJJA 1SMXA 1X6OA 1YIJA 2JA8H 3AFPA 5IY0A 4DV5L 1HR0W 4DV1Q 4DR3L 4A3BH 4B3RL 4AQYL 4GNXC 3I55A 3PUZA 3RNUA 2KHIA 4GNXB 4JI2L 1I94L 4UP8A 4JI4Q 4KHPQ 1BBUA 1NY4A 2UXDL 4QIWE 4DPGA 2NZHA 2OTLA 1VQEA 1R9TH 4JBKA 1ASYA 4A4IA 4OX9Q 3HOZH 1UE7A 2A1AA 2AKWB 4P72A 4DR1L 2R7ZG 1VQMA 2DUDA 2E8GA 2IT1A 2IHEA 3OYYA 4IPCA 4DV6Q 3S1RH 2Z6KC 4LFCL 1Q86C 4A3IG 3F2CA 1FL0A 2IX1A 3HOWH 4IPGA 5IWAL 4DV0Q 2ES2A 2JEBI 4DR6Q 1O7IA 4HIOA 3HKZE 2IHFA 1PH8A 3ULJA 2B3GA 1UE1A 1Z47A 4A3LG 5FLMH 2UXCL 4Y52H 4OO1I 3UDFA 4A3KH 1OXSC 3T1HQ 1CKMA 3D0FA 3TQYA 4BBRG 3J81j 4A3FG 1HNWQ 5LMNW 1UE5A 3MEFA 4XTCS 3KDFB 4LF8L 4ME3A 1VQ6A 3BZKA 1KC8C 1KL9A 4JYAQ 5JJIA 4JBMA 3CP0A 4J15A 3PGZA 2F3IA 1IYJB 1N34Q 3UE1A 1IBMQ 4JC0A 1L1OC 1TXYA 1YNXA 3U4VA 3ER0A 2N49A 4RMFA 1L1OB 4RG1A 3M85A 1GM5A 2I5MX 2NN6G 4GKJL 1KRSA 2ZTEA 4O2DA 4LFAL 5IYBH 3S17H 2VNUD 3RN2A 1JJGA 4QL5A 4IOCA 1EFWA 3KYHC 5LMUL 1CKNA 5BR8L 1HNZQ 1L0WA 2V1CC 2ZTDA 3I4NH
chains in the Genus database with same CATH superfamily
1I4PA 2XRSD 2CQOA 2K14A 5COYA 1LTGD 2QCPX 2ZJQA 4B3SQ 1E3PA 3A54A 3LNNA 1KRTA 5GROA 1IKLA 3K5MA 3L3OC 3HOUB 5BN3A 2KECA 3N52A 4GZYC 4G7OC 1JJ2A 1EOVA 4DV3Q 3TS2A 1HTLD 4FXKC 4DNRB 1T9HA 3CF5A 1G6PA 1QG7A 5JJZA 3Q22A 4DV6L 2EYMA 3KBGA 3K7AB 1EY4A 1G291 1EY9A 5C44B 3OWEB 5CV7A 5M3MG 3CQZH 1O7YA 1ZYRD 2Z9HA 1CK1A 2UUAQ 1X3QA 3IFTA 4NXNQ 3NBHB 1VQ9A 3DM3A 2K5QA 5AJ3Q 4CHTB 1HNXQ 1A62A 4YIJA 1RTNA 1SJED 4AYBE 4DGZA 2TSSA 2ZXPA 3PMFA 4C3IH 2E2JB 1I50B 1AE3A 4BY1B 2RDGA 3Q24A 2RF4A 3AYHB 1WTQA 4UAIA 3W1BA 1EY8A 2B2VC 4XXEA 2PZWA 4YY3L 1I6HH 5F2DA 1PRTD 1LT3D 2G9HD 5E1FA 4X64L 4A75A 1C7YA 2JA8B 4A3BB 4QJFA 4DFAA 2EQSA 1TT2A 1VQ5A 3AEVA 4X62Q 1VQCA 1OTCA 3SEBA 4RGMA 1A2TA 4LAAA 3IFDA 1R9TB 3L9AX 1IKMA 3J7ZC 1M8AA 5IGEA 1WD1A 3F8TA 3DWAA 5M3MH 2OQKA 3NBHA 4TKOB 2KENA 3R8BA 5CC4A 3CC4A 1EQTA 2Y0SG 4DK1A 1HR0Q 3LGJA 2ID0A 3F2DA 4BWGB 2R61A 3TZDA 4K0KQ 5CYUA 2OXPA 1K9MC 2UUBL 1DJRD 1WYDA 5IP7G 2E5LL 1IBKQ 3STBD 1WTRA 1YZ6A 4LF6Q 3JC66 4FVMA 2G5DA 1BF4A 1TQOA 1JWMD 1PH5A 3CD6A 1O80A 4E6IA 5C4XG 2PCFB 5J22A 1CM9A 1WOCA 5I9PA 2YU9H 1F2MA 4UP9A 2F0KA 4HSVA 1B1ZA 4IZ8A 1STYA 3K59A 1DGSA 1X54A 3S24A 5KYIA 4CDCC 3VDYA 3TREA 3MTSA 3PUXA 5C3EG 4HIMA 5M3FG 4IPHA 2V4DA 3HOVG 1KXLA 2WFWA 3H0GB 2EZVA 5ELNA 4DV4L 1IL8A 4X66Q 1PTOF 1FVIA 1NJIC 3GQBA 2K50A 3JAML 2CH4A 4DR3Q 1XMOQ 4BBSG 2BDOA 4Q0FA 3CCEA 4OONA 1K8GA 1GJXA 4DXGA 5CV6A 5IP7H 1PH7A 4BBRB 1Y1VG 3K0XA 3C1EA 5D65A 2FFKB 1Y8PB 4BXXG 4KI0A 3UI2A 5FJ8G 1D6EC 3FKIG 2RHQB 2JA6G 5C4XH 4NW2A 4S3SA 3T1HL 1AFPA 1D1IA 4KJOA 1VQKA 5GQOA 1X9NA 2JA9A 5C3EH 3E9IA 3SK4A 2B63G 3FVQA 1SNMA 3ERSX 3D4DA 4RCOA 5A2QE 1Q90A 4NDXA 1K83B 4ODGA 3K6OA 3QIAA 1U4MA 2XWBB 3F2UA 4QIWB 4KV6A 3U4ZA 4H13C 1Z7TA 1EU4A 2WB1B 2AWNA 3TP5A 4A3MH 3I4LA 3PO3H 4BBSH 1RJTA 5FLMG 2JXMB 3UDIA 2JK8A 5LMUQ 3HKSA 4NPSA 4A3KG 1D1KA 2VB2X 4X3SA 4H7BA 4QUFA 2NVXB 3FKIH 1MKHA 2E2IB 2JA6H 1EYCA 2A6HD 4KJNA 1A3TA 3Q23A 3C1FA 1WFQA 1XYIA 2BE5C 1VQ7A 2CW0C 1EFID 3L7ZC 2F0QA 5JJKA 1NSNS 3GDEA 1TS3A 4F87A 3UE0A 1STEA 2R92B 1M4VA 3I4NG 2B63H 2OEOA 5KNBA 4BY7H 1L0YB 4MN3A 5G3LF 2IJ0A 2K05A 4L6TB 1SYFA 3NTHA 1OO9B 1W3SA 1ZYRC 4DNIA 3F2BA 2B2VA 2LXJA 5C4HA 1FJGL 1KNEA 3RMHA 3H3VC 4KK7A 1LLRD 3H6MA 3PV0A 1IXRA 2PNRC 2HHHL 3J80i 4JOIC 4JV5L 2D62A 4A3GG 5IGFA 3CKIB 3D4WA 4AIMA 4Y7NH 2F52A 1ET9A 4LUZA 1J5EQ 5ELCA 2M00A 4LUOA 3GTOH 5KGUA 1XPOA 2B2WA 4JI0L 2HDLA 1FNUA 1PRTC 5C0XI 3TSSA 1TWAH 3V2TA 2XN9C 3G7LA 2QF7A 2KCMA 1X3FA 3HOXB 4B3RQ 2EYHA 3I73A 4AQYQ 1QB5D 1EEFD 4A3JG 5C4JH 3NP8A 1VQOA 1JB3A 1XNQL 1VQDA 2MO0A 1LTTD 1DD2A 1PZJD 2MUYA 1Q1BA 1WTPA 4JW0A 1QNUA 4O0AA 2NB0A 2OF1A 3S2HB 2I0QA 3IKJA 1VF5C 3I4OA 1AW7A 4C3HH 1JT8A 2PI2A 2SNSA 5D3IB 4ME5A 1EYAA 4P71A 5ISRA 5K5PA 3U58A 3K57A 2F0LA 4H02A 4AYBB 4EX5A 5IWAQ 3A0JA 1ZKOA 4LF7L 3MZ5A 5E4XA 2WP8J 4I7ZC 1JC7A 1EY6A 1MI2A 3OTOL 1FD7D 4B08A 1BXTA 3DLLA 1I4XA 3D31A 1P8LA 4HJ5A 3HS0C 2DNCA 4DAYA 5FKAC 4OWWB 4ALPA 1PV4A 1B2TA 1IBLL 1F77A 2VQEL 2UXBL 1UE6A 1Q8KA 1G8ZD 2NVTH 2VQFL 1II3A 3S14B 3NTIA 4GKJQ 1XPRA 1YBYA 1LT4D 3BDOA 1S4ZA 3KJPA 1N36L 1JOQA 5M5WB 4RGNA 3S1NH 1BOSA 4YHHQ 3M3YB 2JN4A 4M8AA 1JE5A 5FO9B 1PZKD 2VUMB 4V190 1O78A 1ZEQX 3S1MH 2UUCL 3Q0AA 3CC2A 4DV2Q 2K5VA 1MIUA 1VQJA 5IY0A 4DV5L 1HR0W 4DV1Q 4GNXC 3W3AA 2KHIA 4JI2L 3SR1A 1I94L 1LT6D 3NTKA 4JBKA 5HGTA 4A4IA 4OX9Q 1WD0A 1D5ZC 2AKWB 4I7AA 3ND8A 4Z9CB 4NKLA 2R7ZG 2EVBA 4C56C 2IT1A 3NBIA 2Z6KC 3JAME 3GP7A 1NUCA 4K2KA 4A3IG 2TMPA 4KMUC 4IPGA 2ES2A 3PO2B 3HKZE 2IHFA 1PH8A 2EYLA 1CA6A 3ONAB 4Y52H 1TY2A 1R4PB 1PDQA 1D5MC 4IUPA 2F0FA 4A3FG 5E3FA 1ET6A 3MEFA 3KDFB 4XTCS 4ME3A 4LF8L 3BZKA 2NVQB 1KL9A 5D3DA 1PFBA 1IYJB 1N34Q 1IBMQ 1EIGA 4JC0A 2RVLA 3NQTA 3QR8A 3S17H 5IYBH 2VNUD 4IOCA 3TBIB 2E76C 1TWHB 4HSPA 1PRTB 2EE1A 1SE3A 1L0WA 1JJCB 2KEDA 4A3DB 2KVMA 1XMQQ 4DR2L 4PMWA 1KDBA 2XGTA 1FGUA 2A19A 2BOSA 1EYDA 1PH3A 4JI7L 2F0SA 2NYZD 4A3IH 4AH6A 5C0XJ 4N9PA 1BQQT 2CWAA 4TQUS 5JEAJ 3KFUA 1EU3A 4EGVA 2MGSA 1GO3E 5M9OA 5IGBA 1CSQA 3A56A 3DEPA 4ABNA 5I6YA 4JI4L 4KHPL 3KBXA 3DMUA 1WCMB 1S5DD 2E2HH 1B9MA 2B29A 1HZCA 2FHTA 4JOIA 4XQJA 2EY2A 4GKKQ 5IYDH 3N6RA 1XJVA 2M2LA 1G51A 4K5WA 5KNCA 3S15B 2Z4HA 2SOBA 2CFMA 3CRLC 2BCOA 1YHAA 4HAEA 1B4OA 4DR6L 2K5HA 2XNAC 4C3JG 1RHPA 3BS1A 3BZCA 2NN6I 1HZAA 1WTVA 2Q8TA 1JE4A 2A68C 4A3EB 2EOTA 1SNOA 2NZ1D 4F8MA 4JI8Q 2AMCB 1HNWL 2FXQA 3NE5B 1PTOH 4JYAL 3GTJB 2VZAA 1JWSD 2JP1A 2YTYA 3MC0B 4UPAA 4IFDJ 5IP9G 2B2YA 1SYDA 1BCPF 1HNZL 1KDCA 1AN8A 4DR7Q 3U9SA 4ZKBB 2PQEA 3RLOA 2L12A 2A69D 4B3SL 4LJZC 4IPDA 1CQVA 3S16B 1EYGA 1PH6A 3BDCA 3GD7A 3TDQA 1PH4A 3SGIA 3I56A 4IOAA 1KNAA 2K52A 2N55A 5I2XA 2JA5G 1GKHA 4NP5A 2K32A 4MZ9A 5CV8A 3HOZB 3PSIA 2KQ3A 4DV3L 1E7ZA 4H44C 1YJWA 1RD9D 1VQPA 4OELB 1IW7D 1QVFA 2F4VQ 1JQYD 5GAHC 1TR5A 1SJHD 4ZYSA 1SE2A 2RA4A 1TWGH 1WTWA 2Q2UA 1S5ED 3M7NA 5JPNC 2CH4W 1SROA 2ZM6Q 4G7HC 1P16A 5IE8A 1UEAB 4QGUA 1A63A 2DJFC 2B39A 5ELDA 5KRUA 1A15A 1GUTA 1KTKA 2L9HA 4X65Q 4QF4A 1GUWA 4GNXA 2UUAL 2JEAI 2Z0SA 4RKBA 3H91A 2RSOA 4WORA 2MJ8A 3E5SA 3KJOA 2R93G 2IY5B 3H3VI 4K5XA 1RL2A 3EIVA 3BYYB 3RLFA 4CDFC 4YWKA 5AJ3L 1HNXL 1ENCA 1ICFB 4XT3B 3MXUA 1VQGA 2BA0A 3PUWA 5CV5A 2XWJB 2Z6KA 1H95A 3D3RA 3UDXA 4DK0A 1T5EA 1FNWA 4IALA 2WAQG 1X3PA 2FMMA 2KCNA 1WTXA 1PHJA 3J7AF 2C35B 1SMYD 1AZPA 3C46A 3A7AB 5C3WA 4DAMA 4X62L 1EQQA 1GD7A 2LY7A 1VQ4A 3R3OA 2WKDA 3GTQH 4R4QA 2L5TA 1PH2A 1SBBB 4LNQA 3CCUA 4GOPB 3VA5A 2X6LA 4KD3A 1CHPD 1YNND 3T1YQ 3NWSA 4MNOA 1R4QB 1V1PB 4BY1G 1SDFA 5K36G 4IUNA 4DV0L 2AHOB 3PIPA 3QO2A 2PZUA 2R93H 1BNZA 4YCVA 5EPKA 4K0KL 1OXXK 1GUOA 4DAPA 2NBFA 3CQZB 2QDLA 1TVXA 2LKVA 5JOBA 1IBKL 4HIDA 2JQOA 1D5XC 3QWNA 3GV6A 4LF6L 2B2TA 1K3RA 1J8IA 5JAVA 3JAMc 1O7ZA 2A6ED 2Q8RE 5M5XH 4QB4A 3RZOH 1FNVA 2K03A 2L1BA 4C3IB 4OO1G 3PQIA 1VQBA 3HG9A 4GOPA 2CHBD 1SSOA 1LABA 3KF6B 3B6YA 2RCFA 1V1PA 1GVPA 2Z8LA 4WJWA 3PCOB 5BR8Q 4EQNA 5DM63 1IL2A 4MTNA 1I6HB 4C1NI 4ZRZA 3HKZB 4OWXB 1LTRD 4L5RC 2A8VA 4N8X1 2C5CA 4X66L 3W2DA 1OXVA 4P75A 3VR3A 4G57A 1GUNA 1PFMA 5C0XG 1ICWA 2OQ0A 2I46A 3VYUA 2GVAA 1XMOL 5JEAG 2B2WC 2KOLA 1JOKA 2NWGA 5EKLA 4LF4Q 3EQLC 3QOLA 4FXDA 3BZDB 2A73B 1EIFA 2DY7A 1U5KA 2EJMA 2R6GA 1CKNB 2RHSB 1EY5A 5CV9A 2L0CA 3H0GG 3WOFA 3FEWX 2BH2A 2G9DA 1EQVA 3KF6A 5EQ0A 3I4MG 1UWVA 1CT1D 1JCKB 5M5YH 2CWPA 1HTPA 3NWTA 1EEID 4DF7A 4XYQA 1UUPA 2XRQD 4DK3C 3M4OH 1DCZA 1O7LA 2YU9B 1Y1WG 4K8IA 1B44D 4GN4B 4RH6A 1S40A 2P5ZX 4KY6A 3TS0A 1PTOD 1WTHA 2ICIA 1TY0A 2UU9Q 4A76A 2HIVA 3I70A 4UP7A 4JI1Q 1PH9A 5C0XH 4B9WA 5JEAH 3RUZA 2AUJD 5IYCG 3J81c 2XIWA 4FDBA 4HJ9A 1W2BA 2ZJPA 2KCTA 3NELA 4IFDG 1I3QH 2K4KA 3I2ZA 1JORA 1A3VA 1S72A 2VY3A 1A3UA 1SYGA 4FF3A 2X6GA 3BVMA 4X64Q 1XNRL 3BJUA 3M9BA 4A93G 4L5SA 4LWCA 2EXZA 4K6LA 1I4RA 3LWEA 3GTMB 1TWCH 1G2SA 2WB1G 3D6WA 3I4MH 4DR1Q 4KY5A 4CJ2C 1K73C 1VQFA 4JBJA 4LFCQ 5DAUA 3R2TA 3WDNA 3FPPA 1VS0A 1SE8A 1HJPA 4G4KA 2ICEC 4DUZL 2OTJA 5C4XB 2F0HA 1YITA 1NNXA 1Y1WH 1I4HA 2K33A 2UXCQ 4KKSA 4IN3A 2E74C 3KLSA 1T5XD 2WIIB 1Q81C 1NBWA 5M3FH 5C3EB 3HOVH 2LMCB 2XVSA 5EBCA 1PYWD 4HEDA 1OXTA 4P2CB 4FP5D 4OGQC 2K6AA 4IFDH 1H9SB 3HOWG 3KLWA 1MGSA 1S5BD 4R4IA 2F1MA 3T13A 5KIXA 3CC7A 4RFBA 4O42A 1YJ9A 1HQRD 4A3MB 3E0JA 4JK1C 3TP6A 4A93H 3PO3B 3IAYA 3CXCA 2BDNA 4TVAB 4KTAA 1N32Q 1Y1VH 3D8GA 1J5EL 3A7LA 1X56A 2GA4B 4BXXH 2F3VA 2LXKA 1SFOH 3QJYA 5FJ8H 1PYBA 1VMPA 4LUVA 4F88A 1BR9A 2KBNA 4JI3Q 3FKIB 1QILA 1WJJA 1SMXA 1X6OA 3GV3A 2JA6B 4B3RL 4AQYL 2F0GA 3I55A 1EOTA 3LWUA 4UP8A 1BBUA 5G3LD 2RBMA 2NZHA 3J81L 2E2DC 1G6ZA 1UE7A 2K5WA 4QMGA 1IYUA 2B63B 1H9SA 2HD3A 1XXGA 4BY7B 1VQMA 2E8GA 1F9RA 3OYYA 4IPCA 3TN2A 3S1RH 1Q86C 3HOWH 5IWAL 2IW3A 1QCBD 3IL8A 1Z47A 1NR4A 4A3LG 5FLMH 3OMGA 3SE0A 4OO1I 1MHWC 4A3KH 3T1HQ 1JWUD 1L0XB 3D0FA 3TQYA 2AQ3B 1RTOA 1BCPB 5LMNW 1VQ6A 4HN7A 4WRDA 1JOOA 1E2VA 4K8JA 5JJIA 4J15A 1GHJA 1KLGD 1TXYA 2DN8A 4Y7NB 1L1OB 3SK6A 2NN6G 4GKJL 3V96A 4QCLA 4LFAL 1EZ6A 3GTOB 3RN2A 3BG3A 4QL5A 1EFWA 3KYHC 1I4QA 1FGBD 3G6JB 3I4NH 1H9RA 3E0EA 1TWAB 2XSCA 4PZ8A 5C4JB 4MTKA 1HPCA 4IUUA 2IWHA 4Q5VA 1WTOA 4CKBA 1HXYD 2VXWA 5EKIA 4DV1L 5A35A 3A8JE 3CCMA 2LSSA 1WVLA 2KJXA 5C6AA 4PZ6A 3KLRA 4ZAIA 4U673 5E7NA 2B2YC 4C3HB 3R93A 2Q2IA 1TWFB 2YTXA 4OX9L 2R3ZA 1D8LA 1J6QA 4A3GH 1L1OA 3STBC 3GTGH 1EZ8A 1QZHA 1CZWA 2K01A 3K7UC 4OXPA 2ZTCA 4EQPA 5I6WA 4CKCA 1BUVT 1L2FA 2NN6H 2ENBA 1MJEA 3HOYG 1PVOA 2HIXA 1TIID 1Q3LA 4FF1A 1PYSB 2WKCA 3A55A 2OWOA 5EJWA 2KHSA 4GN3B 1H9JA 4IFDI 1A6XA 1ASZA 4A3JH 3ULLA 5IIFA 5FO8B 2NVTB 2FJ2A 3VA7A 1AP0A 1RKNA 1U0LA 1J9OA 1N34L 1IBML 2OT2A 1I4GA 4K5VA 3S1NB 4JI5Q 1VF7A 3OW2A 4N8FA 4B3TQ 1U4LA 1N8RC 2IX3A 4JVZA 3RR5A 3PO2G 2D5DA 4NMZA 1BDOA 4OIJA 2HCCA 2GVBA 5BN5A 1STAA 1YNJD 2DY8A 4JI0Q 2F0EA 4YWLA 4IURA 2EYFA 3M3YH 3PIP3 4WJ4A 3HRZC 2ASBA 2WAQE 2JA7G 1K28A 4J8QA 3ITPA 1EIYB 1GHKA 4UHVA 2RDHA 5HY6A 5IT9L 3PUYA 1SE4A 2IL8A 3NHHA 3HOYH 2MFIA 2PNHA 3PF5A 1V1QA 5CBAE 3TP8A 1NAPA 1V43A 5J39A 4DV7Q 1QUQB 1V9PA 4KN4C 2VS1A 4PZ7A 1HZBA 4V0BA 4B3ML 4A3DG 2NZOA 4GKKL 2PW7A 4JBWA 2NVYH 4GS3A 2WV6D 3OOCA 3TEHB 1GXDC 1XTCD 3A8IE 3OTOQ 5I9OA 3NQIA 3PO2H 3R2IA 2DJGC 3MXGA 4LFBQ 4POFA 1EIHA 4A3CG 3MWYW 1E22A 2ZJRA 2QILA 1X55A 3H3VH 1IBLQ 2RDFA 1KABA 3K8AA 2MPMA 4KD4A 2N78A 1BVSA 4JI8L 3CPWA 3CRKC 2VQEQ 2UXBQ 2JYOA 3VR6A 2EJGC 3S17B 5DEHA 1DONA 2JA7H 3A8KE 5EBDA 1C8CA 1E2ZA 1TU2B 1VMCA 2CVRA 1CQFA 5ELEA 3S1QH 2R7ZH 2EXDA 1PXUA 1LTLA 3MXNB 1TS4A 3ICEA 2A6HC 4JPBW 3GTLH 4DR4Q 4DR7L 2PMZE 1AEXA 1SYCA 3RZDH 2B2TC 4A3IB 2UUCQ 3I8ZA 5ELFA 3WOEA 1HH2P 4ZCKA 2RKSA 3FP9A 4UDUC 1B53A 1DM0B 2RQXA 4DV5Q 1A8VA 3KDFA 3W1GA 1I6VC 1X32A 4LF5Q 4XIGS 1PMRA 1N33Q 2E2HB 3MFGA 4C2MH 4GOPC 2PYKA 5C4ZA 2EIFA 5ELBA 4A3FH 4TRDA 5CV4A 4IJLA 2EYJA 4A3CH 1VQLA 2F4VL 5EKKA 3E9HA 1FYCA 2Y0SE 3OHXC 4IQZA 4IUQA 5EAYA 1SYEA 3K81C 1EQRA 3J81E 4DUYQ 3CCLA 1WI5A 1Q12A 1Y8OB 3EBEA 2A5HA 2D0PA 3JAMi 4P73A 3S2DH 3MXNA 4IO9A 1E1TA 1PFSA 4L5TA 4XQNA 2GN5A 3GTPH 2F0NA 1NMFA 4X65L 5C3XA 1BCPD 1PTOB 2HDMA 4P74A 3T56B 3VYTA 3E3XA 4LF8Q 4KN7C 4NB3A 4LF9Q 3CCVA 1K8MA 1RIPA 2J0TD 3KLSX 4PQXA 3DM1A 3VYSA 1AE2A 3EN2A 3F1ZA 4KY7A 4IUVA 4L8JA 4KLKA 3E6ZX 3MEHA 1SAPA 4DR5Q 1YI2A 3SK5A 1K3BC 4X6AH 1VQHA 1W6JA 3VR4A 2EY6A 4HCEA 2PPBC 4R4OA 2EDGA 1D2BA 4BA1I 1STHA 2CKZB 4ZUIA 4C3JH 1X3EA 1MD2D 1GUSA 1CSPA 1EY7A 5IGDA 3Q6SA 4JI6Q 2D0OA 2AWOA 2B8GA 5H1SE 1DOLA 1CZGA 3T1YL 3RLNA 2WB1E 3J80L 1TWGB 3CPFA 1BKBA 3HOUG 1EL0A 5LL6S 5JPMC 4CKEA 3X3MA 2X69A 1SNQA 1Y8NB 1YEZA 5IP9H 3TRZA 5JJLA 3NK9A 3PIOA 4H0LC 4RHRA 2L55A 3OIQA 3AQQA 4L63B 4NXNL 4PNYA 2K7VA 3C2PA 2IX0A 1KHIA 5CMDA 3J81i 3GTKH 2DGYA 4KHVA 2RCNA 5DM73 2JA5H 4I65A 5FK9C 2VW9A 4NXMQ 4RKLA 4LK1C 3SK8A 4EVOA 2O2LD 4DKAC 4O1NA 3CW2C 5C44G 5LMNQ 2SDFA 1H9MA 2K75A 2K04A 1SNPA 2I07B 1MJCA 2NUCA 2FMCA 2B2UA 2WINB 5EGTA 3Q8DA 1XWEA 3HOUH 2UXDQ 3GTQB 1U4RA 5GAGC 1Q46A 1LO5D 1QVCA 4HMIA 2MQHA 2PI2E 5LHY1 2I5HA 4C3IG 2Q2TA 2KHJA 4HTHA 4RAUC 3CCRA 3K5OA 3KK7A 4IUTA 4LF4L 1LUZA 3P20A 2JA8G 4A3BG 3H15A 1HR0L 3CHBD 2CQAA 2BE5D 4CJ1B 2CW0D 4HJAA 5IT9E 2R93B 4PV1C 2L4NA 3K7AH 3HKZG 2L11A 2OCEA 1HHVA 1XPUA 4JCVE 4QY7A 1Q1EA 5D14A 4DA2A 2XTIA 3HFZB 5C44H 5HGQA 2K28A 5EPJA 1H9KA 1LTID 2WAQB 4M1UB 4N9TA 3P1HA 1ZXTA 1PA6A 4J1MA 3HZXA 5M5XB 3M4QA 3RZOB 1HUMA 2YV5A 3HP3A 3SHLA 1LT5D 3OPOA 3DUZA 2UU9L 3W5OA 2E2JH 5NUCA 1EUJA 1I50H 4JI1L 5FOBB 4BY1H 4DN4M 4G7ZC 3CCJA 2EYOA 5K36H 3EA6A 4TSSA 1ENFA 4DK6C 2Z4IA 3A5UA 4LW1A 1PFNA 2F0VA 4RCNA 2JA8H 4A3BH 3AFPA 4DR3L 3PUZA 3RNUA 5M3MB 1NY4A 5BN4A 2H4OA 4RGTA 2EPBA 2H1EA 2OTLA 1VQEA 1R9TH 1PRTF 4DR1L 2DUDA 1B3QA 4DV6Q 4LFCL 3M4YA 3O13A 3I72A 3F2CA 1V1OA 2EY5A 4DV0Q 4OO1H 1DZ1A 1O7IA 4CDDC 1DYQA 3ULJA 2B3GA 1UE1A 3P7JA 2UXCL 5C5LA 1ESRA 1B3AA 2O4XA 5M5YB 1OXSC 2ZT9C 2PMZB 5T1IA 1BCPC 3D4RA 4BBRG 1HRJA 1UE5A 3QOJA 4ZLTF 3M4OB 3S9WA 1KC8C 2MP1A 1HA6A 3PGZA 2F3IA 3UE1A 3QG1A 4ZKCB 1NCVA 3K58A 1L1OC 1YNXA 3U4VA 5L37A 1VDZA 2ZXRA 1GM5A 2A69C 2HCIA 1JJGA 1S5FD 3U9OA 5LMUL 2VB3X 1HQMC 1CKNA 1N32L 2ZTDA 1ILQA 3U50C 2QGQA 1I3QB 3ZYYX 3H09A 3L0OA 4F7XA 4YY3Q 2Y0SB 4CDEC 5ELOA 1I5FA 1KAWA 3H0GH 2EJFC 3MA2B 1E2WA 2AQ1B 4JI3L 1IW7C 2ATWA 1JMCA 4LMQD 3DHQA 1TWCB 1CFMA 3I4MB 4A3MG 4R4CA 1DOMA 3PO3G 1F9PA 3J7YW 4HJ7A 5CBEE 4BBRH 3K5NA 3GO5A 1MBYA 3EFXD 2SNMA 3GTMH 3A74A 2JE6I 3K80C 1Y1WB 4YCWA 4GLAC 2N3SA 4KHZA 3EROA 1LACA 3CU7A 2UUBQ 5M3FB 4APVA 2AQ2B 1F9QA 2E5LQ 3HOVB 1V8QA 2ZXOA 5IYCH 1YHQA 3J80E 3M4PA 3NSWA 1XTDA 2D9UA 4FF2A 2R92G 5CORA 1S3OA 1CUKA 1B8AA 4R8IA 3FDTA 3BDLA 5E4WC 4YWMA 3P75A 3URYA 5AFWA 4BBSB 4BY7G 5GAEC 4HIKA 1K83H 3TZUA 1XX8A 4A93B 4R9WA 5KNDA 4BS9A 3CMEA 3NENA 5FLXc 1CKOA 1Y1VB 3DEOA 2EYPA 1SMYC 4R1JA 3K0YA 1FR3A 1SFOB 1YJNA 1G2TA 2LS01 3G4SA 2HT1A 2PQAB 3OSOA 4DV4Q 1BO0A 2NVXH 3MFYA 1YNNC 5HURA 1CI3M 2E2IH 1UEBA 4UY8C 1XNRQ 1KIXA 2B8FA 1ONLA 4HMJA 3C3LA 1M1KC 1KD1C 1EWIA 1SN8A 4WFN3 4DAVA 3S1RB 2R92H 3G48A 3HOXG 3EJIA 2Q8IB 3HOWB 2AUKA 3SVMA 1LV9A 3VR2A 1KAAA 4DUZQ 3T16A 4C1NK 3ULPA 4FNFA 1HFNA 4A3KB 1LTSD 1QZGA 4HJ8A 4J6HA 4DXFA 5J1ZA 1SEBD 2A6EC 1B9NA 1TS5A 2PQAA 3FPUB 1BBWA 1SXTA 1IHZA 1VCIA 1C48A 1E0BA 4C3HG 1SR3A 1YHBA 2F4IA 1B7YB 2E75C 4AYBG 2PO4A 4BA2I 5JVH3 1PH1A 3H94A 5IT9c 4DNTB 4YHHL 2A68D 2JSOA 4WJ3M 4JI5L 3I4NB 4EQOA 3ERQA 1VQAA 4RGOS 1KQSA 1GOZA 4B3TL 1Q7YC 1NTGA 1K0SA 4EQ5A 3X3NA 4DV2L 2F0TA 1SYBA 3G71A 3TMEA 5CR3A 4FF4A 4GN5A 3M7GA 1D7QA 4DAYB 4DU9A 3HOXH 4A3LH 5I2YA 2LFNA 5FLXL 4PMBA 4ID6A 2YTVA 3KF8B 1Z9FA 2K5NA 4FYDA 3G6EA 1CTMA 2K5DA 3PIO3 1N9WA 1RCVD 2M9VA 2L15A 3OIPA 4HR7B 3S2HH 2VUMG 2BA1A 4ZQ3A 1YVCA 2H5XA 2VL6A 1KLUD 2J4XA 3MHBA 1LTBD 3NXWA 4KKTA 3SXHA 2SEBD 4A3GB 3ND9A 3T51B 4DV7L 2Z6BA 1U9RA 3GTGB 1LTAD 1BBXC 1CHQD 1TWFH 1SNCA 1K8AC 3NPPA 1PLFA 4QUCA 1DOKA 3I91A 3WWVA 2KCCA 2QA4A 2F0JA 1HCZA 2N8NA 4PMCA 3RD4A 3ZJYC 1Y14B 1FJGQ 3RN5A 4HCSA 4X3KA 1C0AA 2I5LX 1PTOC 1F2LA 4A3JB 4LFBL 3D6CA 5IODA 2HHHQ 2CCZA 3HGBA 3AU7A 1GUGA 4JV5Q 2A74C 3SDZA 4XDXA 1AZQA 2QKIC 3A5ZB 3KF8A 1RDPD 2HQEA 2PZTA 3AB9A 3S14H 1F9SA 4CJ0B 3CCSA 4PG3A 1PZID 1KDAA 3S1MB 2QW7A 4ULLA 5M5WH 4LFAQ 1XMQL 4RA8A 5GADC 2QEXA 3DWPA 3AFQA 2VUMH 4X3UA 4CGYB 3KOJA 1UAPA 4R4TA 1B70B 3CMAA 2BH8A 4DR4L 2FINB 1W6KA 1HFGA 1X65A 3CAMA 1XNQQ 1VQ8A 2C9OA 1JR0D 1STBA 2F0WA 1STGA 3HOYB 3PF4A 3V05A 2QDBA 1NR2A 2F0UA 4LF5L 5IYBG 1N33L 3NEMA 1X3GA 4KKUA 5IGGA 1STNA 1QNKA 4LF7Q 2B2UC 2F0IA 2R7DA 2WACA 4OEMB 2NVYB 4YCUA 1UNSA 2HQLA 1NMGA 2Q2HA 2ALYB 3K5LA 2KUMA 2QEJC 4DUYL 1C9OA 5IGCA 1WCMG 2YYZA 2DNEA 1M90C 1K0RA 4GLVB 2PW5A 3KUPA 1NE3A 2VQFQ 2NVQH 2KA7A 4B9XA 3FMCA 1RODA 1RF2D 1Q82C 3NUCA 1JICA 5IYDG 3L2PA 4LF9L 2JA7B 1N36Q 3I3CA 1QUQA 3S1QB 2K1BA 3MVVA 3T4AC 2R7ZB 1EY0A 1TWHH 1SRUA 1SNDA 4L5QA 3GTLB 4XQQA 4DR5L 2IPKD 3RZDB 4A3DH 3HEJA 3J80c 4QQBX 4A3EG 1TS2A 1OXUA 3TP7A 3EVQA 2F0PA 3BU2A 4GLXA 2HUGA 4ILWA 4OHJA 4K6DA 4JI2Q 1I94Q 4POGA 1VQIA 2O5IC 1LM0A 1QOHA 4C2MB 4A3FB 2D2CC 2F0OA 1HZ9A 2F3WA 4XT1B 2J7ZA 1ENAA 2F0MA 4JI6L 3VYRA 1WCMH 2MNAA 1ESFA 3VR5A 3OW7A 1EWCA 4FO2A 4ZK9B 3J7A5 1B50A 3I90A 1E1OA 2ZM6L 1QE6A 4OL7A 4B3MQ 3S15H 3MAQA 2MO1A 2N88A 1U4PA 3IRBA 1ILPA 5KEEA 1F2ZA 1JB7A 3S2DB 4RHSA 5J3BA 5LL6X 3GTPB 5JVG3 3HOZG 2O5JC 1AH9A 3T53B 1C4QA 2R7FA 5FO7B 4JG2A 3I7FA 3AMUA 4OWTB 1IZ6A 1QJOA 5DNFA 1Y69U 4MIUA 3UDGA 1LYLA 5TSSA 5I4DA 4A3EH 1Z6HA 3PUVA 3FHWA 4K14A 1SLJA 3FRPB 1TKWB 3GTJH 4NXML 1VQNA 1HUNA 4MHEA 1A0IA 4ZUJA 4IJHA 5DLQE 3CCQA 5CGKA 1E24A 2JJQA 5LMNL 4DR2Q 2Z1CA 1EWHA 2NTSA 4X3TA 3BVGA 1QVGA 1DXMA 4JI7Q 3S16H 2F0DA 4C3JB 3BVZA 1YIJA 1QWYA 4RWSC 1CA5A 3LX0A 5C5MA 4GNXB 4JI4Q 4KHPQ 4OIKA 2UXDL 4XYOA 4QIWE 4DPGA 1MSGA 2F03A 3BYTB 1ASYA 3HOZH 1Q8IA 4CBVA 2A1AA 1K8OA 4P72A 5FLXE 1ML0D 2IHEA 5KYLA 4R8NA 5EPLA 1FL0A 2IX1A 2EY1A 3QB3A 4DR6Q 2JEBI 4HIOA 5A2QL 1MSHA 2KEEA 5IOCA 3UDFA 1F2YA 1HA5A 1CKMA 4U68A 2RSNA 2MHVA 3J7AV 1IYVA 3J81j 1G91A 1HNWQ 1S5CD 4FXGC 4JYAQ 3GTKB 1A2UA 4JBMA 3CP0A 2JA5B 5T1GA 3OWFA 3ER0A 2N49A 4RMFA 4RG1A 3M85A 2I5MX 1YNJC 1KRSA 3MXPA 3OMCA 2ZTEA 4K2LA 4O2DA 3DXJC 3DWQA 2NTTA 5BR8L 1HNZQ 2V1CC
chains in the Genus database with same CATH topology
3U50C 1JJCB 3E0EA 2CQOA 2QGQA 1XMQQ 2K14A 4B3SQ 3L0OA 4YY3Q 4PMWA 4DR2L 2ZJQA 1E3PA 4PZ8A 1KRTA 2XGTA 1FGUA 2A19A 5GROA 5ELOA 1I5FA 1KAWA 1PH3A 3H0GH 4JI7L 4JI3L 4A3IH 4AH6A 5C0XJ 2ATWA 4DV1L 2CWAA 3CCMA 4TQUS 5JEAJ 2LSSA 1JMCA 3KFUA 4PZ6A 1JJ2A 1GO3E 1CSQA 1EOVA 4DV3Q 4JI4L 3TS2A 4KHPL 5E7NA 2E2HH 4A3MG 2B29A 1HZCA 4R4CA 3PO3G 2Q2IA 4JOIA 4HJ7A 1T9HA 2YTXA 3CF5A 4OX9L 4BBRH 3GO5A 1G6PA 4GKKQ 1D8LA 1J6QA 5IYDH 1XJVA 4A3GH 3GTMH 1G51A 3A74A 4DV6L 2JE6I 1L1OA 3STBC 3GTGH 1QZHA 3K80C 2CFMA 3K7UC 4OXPA 4YCWA 2ZTCA 4GLAC 1G291 1YHAA 2N3SA 4KHZA 2UUBQ 2K5HA 4DR6L 1L2FA 1MJEA 3HOYG 1PVOA 4APVA 2HIXA 2E5LQ 3BZCA 1PYSB 5IYCH 1YHQA 2OWOA 2NN6I 3M4PA 1HZAA 5M3MG 1XTDA 3CQZH 4GN3B 2R92G 2UUAQ 4IFDI 1S3OA 1ASZA 1CUKA 1B8AA 4A3JH 4NXNQ 1HNWL 4JI8Q 2AMCB 3ULLA 2FXQA 3NBHB 1VQ9A 4YWMA 4JYAL 1U0LA 3DM3A 1N34L 1IBML 4BY7G 5GAEC 4HIKA 2VZAA 1K83H 5AJ3Q 1HNXQ 1A62A 3CMEA 4AYBE 3NENA 5FLXc 1CKOA 4JI5Q 3OW2A 4C3IH 4B3TQ 1N8RC 2YTYA 3RR5A 3PO2G 1AE3A 4UPAA 4R1JA 4IFDJ 2RF4A 5IP9G 3AYHB 1HNZL 1YJNA 3W1BA 2GVBA 4DR7Q 3G4SA 3RLOA 4JI0Q 2HT1A 4B3SL 4IPDA 4YY3L 2PQAB 4DV4Q 1I6HH 4YWLA 1C7YA 4X64L 4A75A 3M3YH 1EYGA 1PH6A 4QJFA 2NVXH 3GD7A 2EQSA 3AEVA 1VQ5A 4WJ4A 4X62Q 3SGIA 1PH4A 2WAQE 3I56A 2ASBA 2JA7G 4IOAA 1EIYB 1VQCA 5HY6A 1OTCA 2K52A 2E2IH 2JA5G 1UEBA 4UY8C 1XNRQ 1GKHA 1KIXA 3PUYA 3HOYH 2MFIA 4MZ9A 2PNHA 3PF5A 3PSIA 4DV3L 1E7ZA 1M1KC 1V1QA 1KD1C 1YJWA 3J7ZC 1EWIA 1SN8A 1VQPA 3F8TA 1V43A 5M3MH 1QVFA 2OQKA 4DV7Q 1QUQB 2F4VQ 1V9PA 5GAHC 2R92H 2KENA 3G48A 2VS1A 4PZ7A 1HZBA 3HOXG 4B3ML 4A3DG 2NZOA 4GKKL 3CC4A 1TWGH 2Y0SG 2Q2UA 4JBWA 2NVYH 3M7NA 1HR0Q 3LGJA 4GS3A 2ID0A 1SROA 4DUZQ 3ULPA 3F2DA 3TEHB 2ZM6Q 4K0KQ 1P16A 5IE8A 1K9MC 2UUBL 1A63A 4QGUA 3OTOQ 4HJ8A 1WYDA 5IP7G 1QZGA 2E5LL 1IBKQ 3PO2H 3STBD 4X65Q 4LFBQ 4POFA 1YZ6A 4LF6Q 4A3CG 3JC66 2PQAA 1E22A 1BBWA 2ZJRA 4GNXA 1VCIA 2UUAL 2JEAI 1X55A 3H3VH 1IBLQ 1SR3A 1YHBA 2Z0SA 3K8AA 1PH5A 1B7YB 2N78A 3CD6A 4AYBG 1BVSA 4JI8L 3KJOA 3CPWA 2VQEQ 2R93G 2UXBQ 2IY5B 5C4XG 3H3VI 4BA2I 1RL2A 1WOCA 3EIVA 3RLFA 2YU9H 4UP9A 4YWKA 2JA7H 1PH1A 5IT9c 5AJ3L 1DGSA 1X54A 3S24A 1HNXL 4YHHL 4WJ3M 3S1QH 4JI5L 3VDYA 3TREA 1VQGA 2BA0A 3PUXA 3PUWA 5C3EG 1VQAA 1KQSA 4B3TL 4HIMA 2Z6KA 2EXDA 1Q7YC 2R7ZH 1N32L 1LTLA 1NTGA 3MXNB 3UDXA 4EQ5A 5M3FG 3ICEA 4IPHA 3GTLH 4DV2L 3HOVG 2WFWA 1KXLA 4DR4Q 4DR7L 2PMZE 2WAQG 3G71A 3RZDH 1PHJA 2C35B 5ELNA 4GN5A 2UUCQ 4DV4L 1D7QA 4DAYB 4X66Q 3HOXH 1NJIC 1FVIA 1HH2P 4A3LH 3FP9A 4DAMA 4X62L 1EQQA 2YTVA 4DV5Q 2K50A 4DR3Q 1GD7A 3KF8B 1A8VA 1Z9FA 2K5NA 3KDFA 3W1GA 1VQ4A 1XMOQ 4BBSG 3G6EA 4XIGS 4LF5Q 1N33Q 3GTQH 4C2MH 4R4QA 3CCEA 4OONA 1PH2A 1K8GA 4GOPC 4A3FH 1N9WA 2EIFA 3S2HH 2L15A 5IP7H 4LNQA 3CCUA 2VUMG 1PH7A 2BA1A 1Y1VG 4GOPB 1YVCA 4IJLA 2H5XA 3K0XA 2VL6A 3T1YQ 4BXXG 4MNOA 4KI0A 4BY1G 4A3CH 1VQLA 5FJ8G 4DV7L 2F4VL 5K36G 3FKIG 4DV0L 3E9HA 2AHOB 2RHQB 3PIPA 2Y0SE 2JA6G 1TWFH 5EAYA 1K8AC 2R93H 3K81C 1EQRA 5C4XH 4DUYQ 3CCLA 1WI5A 1Q12A 3T1HL 3EBEA 3WWVA 2QA4A 2D0PA 3JAMi 4YCVA 2N8NA 4P73A 3ZJYC 1FJGQ 1OXXK 1Y14B 3S2DH 4K0KL 4IO9A 3RN5A 1VQKA 1E1TA 1PFSA 4L5TA 5GQOA 2GN5A 2JA9A 5C3EH 3E9IA 1X9NA 3GTPH 1C0AA 1NMFA 1IBKL 2I5LX 4HIDA 2B63G 2JQOA 3ERSX 4X65L 4LFBL 4LF6L 2HHHQ 2CCZA 4P74A 1K3RA 4JV5Q 4LF8Q 4LF9Q 4NB3A 3A5ZB 3CCVA 1RIPA 3S14H 3JAMc 3U4ZA 5M5XH 3CCSA 3RZOH 2AWNA 4PG3A 1AE2A 3EN2A 3F1ZA 4A3MH 4OO1G 1VQBA 3PO3H 4KLKA 5M5WH 4BBSH 4LFAQ 4GOPA 1XMQL 5FLMG 5GADC 2QEXA 4DR5Q 3UDIA 3KF6B 1YI2A 2JK8A 3AFQA 3B6YA 3HKSA 4NPSA 1GVPA 5LMUQ 4A3KG 3PCOB 5BR8Q 1VQHA 2VUMH 4X6AH 3KOJA 1IL2A 4MTNA 4R4TA 1B70B 3CMAA 2BH8A 4DR4L 4OWXB 4R4OA 4L5RC 2A8VA 1X65A 4BA1I 2CKZB 3CAMA 3FKIH 1XNQQ 4C3JH 1VQ8A 1MKHA 4X66L 1X3EA 2JA6H 1OXVA 4P75A 1CSPA 3PF4A 5C0XG 1WFQA 2OQ0A 1XMOL 1VQ7A 2GVAA 2D0OA 3L7ZC 5JEAG 4JI6Q 4LF5L 2AWOA 5IYBG 1N33L 5H1SE 5JJKA 3GDEA 3UE0A 3NEMA 1X3GA 4LF4Q 3I4NG 2B63H 3T1YL 3RLNA 2WB1E 4BY7H 1EIFA 1U5KA 2R6GA 4LF7Q 1CKNB 2R7DA 2RHSB 3CPFA 1BKBA 4YCUA 3HOUG 2HQLA 1NMGA 2Q2HA 2ALYB 3H0GG 2BH2A 4DUYL 1YEZA 5IP9H 3TRZA 1C9OA 1W3SA 3KF6A 4DNIA 5JJLA 3F2BA 3I4MG 2LXJA 1UWVA 3PIOA 1WCMG 1FJGL 2YYZA 5M5YH 2CWPA 3AQQA 1M90C 4NXNL 1K0RA 3PV0A 1IXRA 4GLVB 1NE3A 2VQFQ 2IX0A 1KHIA 4DK3C 3J81i 2NVQH 2HHHL 2DGYA 3GTKH 3M4OH 3J80i 4JOIC 2RCNA 1Y1WG 1Q82C 1S40A 5IYDG 4GN4B 3L2PA 2D62A 2JA5H 4LF9L 4A3GG 4JV5L 2VW9A 4NXMQ 1N36Q 3TS0A 4AIMA 4Y7NH 1QUQA 2F52A 4LUZA 2UU9Q 1J5EQ 4A76A 2HIVA 4UP7A 4LUOA 4DKAC 4JI1Q 1PH9A 3GTOH 3CW2C 5C44G 1XPOA 5LMNQ 1TWHH 1SRUA 4L5QA 4JI0L 5C0XI 5IYCG 4DR5L 3J81c 2K75A 4FDBA 4HJ9A 1W2BA 2ZJPA 2KCTA 1TWAH 3NELA 3J80c 1I3QH 2K4KA 4A3EG 4IFDG 4QQBX 3I2ZA 2KCMA 1X3FA 1MJCA 1OXUA 1S72A 2VY3A 4B3RQ 4AQYQ 4A3JG 3BU2A 5C4JH 4GLXA 1VQOA 4X64Q 3Q8DA 1XNRL 3BJUA 1XNQL 4JI2Q 1VQDA 3M9BA 2MO0A 1I94Q 4L5SA 3HOUH 4A93G 4LWCA 4POGA 2UXDQ 1VQIA 1LM0A 1Q1BA 1Q46A 5GAGC 1QVCA 4O0AA 2MQHA 2PI2E 2I0QA 1HZ9A 1TWCH 2I5HA 3I4OA 4JI6L 2WB1G 3I4MH 2Q2TA 1WCMH 4DR1Q 2MNAA 4C3HH 2KHJA 2PI2A 1VQFA 1K73C 3CCRA 1JT8A 4JBJA 4LFCQ 4LF4L 1LUZA 4P71A 2JA8G 4A3BG 3J7A5 4A3DH 1VS0A 3U58A 3H15A 1SE8A 1HR0L 1HJPA 4H02A 4EX5A 5IWAQ 3A0JA 4DUZL 1E1OA 4HJAA 2OTJA 4LF7L 2ZM6L 1YITA 4B3MQ 3S15H 2WP8J 1Y1WH 3K7AH 2UXCQ 3HKZG 2MO1A 3OTOL 3IRBA 3DLLA 1JB7A 3D31A 1P8LA 4HJ5A 2OCEA 1NBWA 1Q81C 5M3FH 1XPUA 5J3BA 4JCVE 4QY7A 1Q1EA 3HOVH 3HOZG 1AH9A 2XTIA 3HFZB 5C44H 2R7FA 4OWWB 5HGQA 4JG2A 3I7FA 4ALPA 4OWTB 1PV4A 1IZ6A 1IBLL 1OXTA 2VQEL 2UXBL 1UE6A 1Q8KA 3UDGA 1LYLA 4A3EH 3HOWG 3KLWA 3PUVA 2NVTH 3FHWA 4R4IA 2VQFL 1PA6A 3CC7A 1YJ9A 4GKJQ 1XPRA 1SLJA 1YBYA 3M4QA 3GTJH 2YV5A 4NXML 3KJPA 1VQNA 1N36L 4A93H 3CXCA 1A0IA 4TVAB 3S1NH 1N32Q 1Y1VH 1H95A 2UU9L 4IJHA 5DLQE 3W5OA 3CCQA 1J5EL 2E2JH 1EUJA 1I50H 1X56A 4JI1L 4YHHQ 4BY1H 1E24A 1JE5A 2LXKA 2JJQA 5LMNL 4DR2Q 4BXXH 3CCJA 1SFOH 5FJ8H 1QVGA 1PYBA 4LUVA 3S1MH 2UUCL 4DK6C 2KBNA 3A5UA 3CC2A 4JI7Q 4LW1A 4DV2Q 4JI3Q 3S16H 2K5VA 1MIUA 1VQJA 1WJJA 1SMXA 1X6OA 1YIJA 2JA8H 3AFPA 5IY0A 4DV5L 1HR0W 4DV1Q 4DR3L 4A3BH 4B3RL 4AQYL 4GNXC 3I55A 3PUZA 3RNUA 2KHIA 4GNXB 4JI2L 1I94L 4UP8A 4JI4Q 4KHPQ 1BBUA 1NY4A 2UXDL 4QIWE 4DPGA 2NZHA 2OTLA 1VQEA 1R9TH 4JBKA 1ASYA 4A4IA 4OX9Q 3HOZH 1UE7A 2A1AA 2AKWB 4P72A 4DR1L 2R7ZG 1VQMA 2DUDA 2E8GA 2IT1A 2IHEA 3OYYA 4IPCA 4DV6Q 3S1RH 2Z6KC 4LFCL 1Q86C 4A3IG 3F2CA 1FL0A 2IX1A 3HOWH 4IPGA 5IWAL 4DV0Q 2ES2A 2JEBI 4DR6Q 1O7IA 4HIOA 3HKZE 2IHFA 1PH8A 3ULJA 2B3GA 1UE1A 1Z47A 4A3LG 5FLMH 2UXCL 4Y52H 4OO1I 3UDFA 4A3KH 1OXSC 3T1HQ 1CKMA 3D0FA 3TQYA 4BBRG 3J81j 4A3FG 1HNWQ 5LMNW 1UE5A 3MEFA 4XTCS 3KDFB 4LF8L 4ME3A 1VQ6A 3BZKA 1KC8C 1KL9A 4JYAQ 5JJIA 4JBMA 3CP0A 4J15A 3PGZA 2F3IA 1IYJB 1N34Q 3UE1A 1IBMQ 4JC0A 1L1OC 1TXYA 1YNXA 3U4VA 3ER0A 2N49A 4RMFA 1L1OB 4RG1A 3M85A 1GM5A 2I5MX 2NN6G 4GKJL 1KRSA 2ZTEA 4O2DA 4LFAL 5IYBH 3S17H 2VNUD 3RN2A 1JJGA 4QL5A 4IOCA 1EFWA 3KYHC 5LMUL 1CKNA 5BR8L 1HNZQ 1L0WA 2V1CC 2ZTDA 3I4NH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U50 C;  1JJC B;  3E0E A;  2CQO A;  2QGQ A;  1XMQ Q;  2K14 A;  4B3S Q;  3L0O A;  4YY3 Q;  4PMW A;  4DR2 L;  2ZJQ A;  1E3P A;  4PZ8 A;  1KRT A;  2XGT A;  1FGU A;  2A19 A;  5GRO A;  5ELO A;  1I5F A;  1KAW A;  1PH3 A;  3H0G H;  4JI7 L;  4JI3 L;  4A3I H;  4AH6 A;  5C0X J;  2ATW A;  4DV1 L;  2CWA A;  3CCM A;  4TQU S;  5JEA J;  2LSS A;  1JMC A;  3KFU A;  4PZ6 A;  1JJ2 A;  1GO3 E;  1CSQ A;  1EOV A;  4DV3 Q;  4JI4 L;  3TS2 A;  4KHP L;  5E7N A;  2E2H H;  4A3M G;  2B29 A;  1HZC A;  4R4C A;  3PO3 G;  2Q2I A;  4JOI A;  4HJ7 A;  1T9H A;  2YTX A;  3CF5 A;  4OX9 L;  4BBR H;  3GO5 A;  1G6P A;  4GKK Q;  1D8L A;  1J6Q A;  5IYD H;  1XJV A;  4A3G H;  3GTM H;  1G51 A;  3A74 A;  4DV6 L;  2JE6 I;  1L1O A;  3STB C;  3GTG H;  1QZH A;  3K80 C;  2CFM A;  3K7U C;  4OXP A;  4YCW A;  2ZTC A;  4GLA C;  1G29 1;  1YHA A;  2N3S A;  4KHZ A;  2UUB Q;  2K5H A;  4DR6 L;  1L2F A;  1MJE A;  3HOY G;  1PVO A;  4APV A;  2HIX A;  2E5L Q;  3BZC A;  1PYS B;  5IYC H;  1YHQ A;  2OWO A;  2NN6 I;  3M4P A;  1HZA A;  5M3M G;  1XTD A;  3CQZ H;  4GN3 B;  2R92 G;  2UUA Q;  4IFD I;  1S3O A;  1ASZ A;  1CUK A;  1B8A A;  4A3J H;  4NXN Q;  1HNW L;  4JI8 Q;  2AMC B;  3ULL A;  2FXQ A;  3NBH B;  1VQ9 A;  4YWM A;  4JYA L;  1U0L A;  3DM3 A;  1N34 L;  1IBM L;  4BY7 G;  5GAE C;  4HIK A;  2VZA A;  1K83 H;  5AJ3 Q;  1HNX Q;  1A62 A;  3CME A;  4AYB E;  3NEN A;  5FLX c;  1CKO A;  4JI5 Q;  3OW2 A;  4C3I H;  4B3T Q;  1N8R C;  2YTY A;  3RR5 A;  3PO2 G;  1AE3 A;  4UPA A;  4R1J A;  4IFD J;  2RF4 A;  5IP9 G;  3AYH B;  1HNZ L;  1YJN A;  3W1B A;  2GVB A;  4DR7 Q;  3G4S A;  3RLO A;  4JI0 Q;  2HT1 A;  4B3S L;  4IPD A;  4YY3 L;  2PQA B;  4DV4 Q;  1I6H H;  4YWL A;  1C7Y A;  4X64 L;  4A75 A;  3M3Y H;  1EYG A;  1PH6 A;  4QJF A;  2NVX H;  3GD7 A;  2EQS A;  3AEV A;  1VQ5 A;  4WJ4 A;  4X62 Q;  3SGI A;  1PH4 A;  2WAQ E;  3I56 A;  2ASB A;  2JA7 G;  4IOA A;  1EIY B;  1VQC A;  5HY6 A;  1OTC A;  2K52 A;  2E2I H;  2JA5 G;  1UEB A;  4UY8 C;  1XNR Q;  1GKH A;  1KIX A;  3PUY A;  3HOY H;  2MFI A;  4MZ9 A;  2PNH A;  3PF5 A;  3PSI A;  4DV3 L;  1E7Z A;  1M1K C;  1V1Q A;  1KD1 C;  1YJW A;  3J7Z C;  1EWI A;  1SN8 A;  1VQP A;  3F8T A;  1V43 A;  5M3M H;  1QVF A;  2OQK A;  4DV7 Q;  1QUQ B;  2F4V Q;  1V9P A;  5GAH C;  2R92 H;  2KEN A;  3G48 A;  2VS1 A;  4PZ7 A;  1HZB A;  3HOX G;  4B3M L;  4A3D G;  2NZO A;  4GKK L;  3CC4 A;  1TWG H;  2Y0S G;  2Q2U A;  4JBW A;  2NVY H;  3M7N A;  1HR0 Q;  3LGJ A;  4GS3 A;  2ID0 A;  1SRO A;  4DUZ Q;  3ULP A;  3F2D A;  3TEH B;  2ZM6 Q;  4K0K Q;  1P16 A;  5IE8 A;  1K9M C;  2UUB L;  1A63 A;  4QGU A;  3OTO Q;  4HJ8 A;  1WYD A;  5IP7 G;  1QZG A;  2E5L L;  1IBK Q;  3PO2 H;  3STB D;  4X65 Q;  4LFB Q;  4POF A;  1YZ6 A;  4LF6 Q;  4A3C G;  3JC6 6;  2PQA A;  1E22 A;  1BBW A;  2ZJR A;  4GNX A;  1VCI A;  2UUA L;  2JEA I;  1X55 A;  3H3V H;  1IBL Q;  1SR3 A;  1YHB A;  2Z0S A;  3K8A A;  1PH5 A;  1B7Y B;  2N78 A;  3CD6 A;  4AYB G;  1BVS A;  4JI8 L;  3KJO A;  3CPW A;  2VQE Q;  2R93 G;  2UXB Q;  2IY5 B;  5C4X G;  3H3V I;  4BA2 I;  1RL2 A;  1WOC A;  3EIV A;  3RLF A;  2YU9 H;  4UP9 A;  4YWK A;  2JA7 H;  1PH1 A;  5IT9 c;  5AJ3 L;  1DGS A;  1X54 A;  3S24 A;  1HNX L;  4YHH L;  4WJ3 M;  3S1Q H;  4JI5 L;  3VDY A;  3TRE A;  1VQG A;  2BA0 A;  3PUX A;  3PUW A;  5C3E G;  1VQA A;  1KQS A;  4B3T L;  4HIM A;  2Z6K A;  2EXD A;  1Q7Y C;  2R7Z H;  1N32 L;  1LTL A;  1NTG A;  3MXN B;  3UDX A;  4EQ5 A;  5M3F G;  3ICE A;  4IPH A;  3GTL H;  4DV2 L;  3HOV G;  2WFW A;  1KXL A;  4DR4 Q;  4DR7 L;  2PMZ E;  2WAQ G;  3G71 A;  3RZD H;  1PHJ A;  2C35 B;  5ELN A;  4GN5 A;  2UUC Q;  4DV4 L;  1D7Q A;  4DAY B;  4X66 Q;  3HOX H;  1NJI C;  1FVI A;  1HH2 P;  4A3L H;  3FP9 A;  4DAM A;  4X62 L;  1EQQ A;  2YTV A;  4DV5 Q;  2K50 A;  4DR3 Q;  1GD7 A;  3KF8 B;  1A8V A;  1Z9F A;  2K5N A;  3KDF A;  3W1G A;  1VQ4 A;  1XMO Q;  4BBS G;  3G6E A;  4XIG S;  4LF5 Q;  1N33 Q;  3GTQ H;  4C2M H;  4R4Q A;  3CCE A;  4OON A;  1PH2 A;  1K8G A;  4GOP C;  4A3F H;  1N9W A;  2EIF A;  3S2H H;  2L15 A;  5IP7 H;  4LNQ A;  3CCU A;  2VUM G;  1PH7 A;  2BA1 A;  1Y1V G;  4GOP B;  1YVC A;  4IJL A;  2H5X A;  3K0X A;  2VL6 A;  3T1Y Q;  4BXX G;  4MNO A;  4KI0 A;  4BY1 G;  4A3C H;  1VQL A;  5FJ8 G;  4DV7 L;  2F4V L;  5K36 G;  3FKI G;  4DV0 L;  3E9H A;  2AHO B;  2RHQ B;  3PIP A;  2Y0S E;  2JA6 G;  1TWF H;  5EAY A;  1K8A C;  2R93 H;  3K81 C;  1EQR A;  5C4X H;  4DUY Q;  3CCL A;  1WI5 A;  1Q12 A;  3T1H L;  3EBE A;  3WWV A;  2QA4 A;  2D0P A;  3JAM i;  4YCV A;  2N8N A;  4P73 A;  3ZJY C;  1FJG Q;  1OXX K;  1Y14 B;  3S2D H;  4K0K L;  4IO9 A;  3RN5 A;  1VQK A;  1E1T A;  1PFS A;  4L5T A;  5GQO A;  2GN5 A;  2JA9 A;  5C3E H;  3E9I A;  1X9N A;  3GTP H;  1C0A A;  1NMF A;  1IBK L;  2I5L X;  4HID A;  2B63 G;  2JQO A;  3ERS X;  4X65 L;  4LFB L;  4LF6 L;  2HHH Q;  2CCZ A;  4P74 A;  1K3R A;  4JV5 Q;  4LF8 Q;  4LF9 Q;  4NB3 A;  3A5Z B;  3CCV A;  1RIP A;  3S14 H;  3JAM c;  3U4Z A;  5M5X H;  3CCS A;  3RZO H;  2AWN A;  4PG3 A;  1AE2 A;  3EN2 A;  3F1Z A;  4A3M H;  4OO1 G;  1VQB A;  3PO3 H;  4KLK A;  5M5W H;  4BBS H;  4LFA Q;  4GOP A;  1XMQ L;  5FLM G;  5GAD C;  2QEX A;  4DR5 Q;  3UDI A;  3KF6 B;  1YI2 A;  2JK8 A;  3AFQ A;  3B6Y A;  3HKS A;  4NPS A;  1GVP A;  5LMU Q;  4A3K G;  3PCO B;  5BR8 Q;  1VQH A;  2VUM H;  4X6A H;  3KOJ A;  1IL2 A;  4MTN A;  4R4T A;  1B70 B;  3CMA A;  2BH8 A;  4DR4 L;  4OWX B;  4R4O A;  4L5R C;  2A8V A;  1X65 A;  4BA1 I;  2CKZ B;  3CAM A;  3FKI H;  1XNQ Q;  4C3J H;  1VQ8 A;  1MKH A;  4X66 L;  1X3E A;  2JA6 H;  1OXV A;  4P75 A;  1CSP A;  3PF4 A;  5C0X G;  1WFQ A;  2OQ0 A;  1XMO L;  1VQ7 A;  2GVA A;  2D0O A;  3L7Z C;  5JEA G;  4JI6 Q;  4LF5 L;  2AWO A;  5IYB G;  1N33 L;  5H1S E;  5JJK A;  3GDE A;  3UE0 A;  3NEM A;  1X3G A;  4LF4 Q;  3I4N G;  2B63 H;  3T1Y L;  3RLN A;  2WB1 E;  4BY7 H;  1EIF A;  1U5K A;  2R6G A;  4LF7 Q;  1CKN B;  2R7D A;  2RHS B;  3CPF A;  1BKB A;  4YCU A;  3HOU G;  2HQL A;  1NMG A;  2Q2H A;  2ALY B;  3H0G G;  2BH2 A;  4DUY L;  1YEZ A;  5IP9 H;  3TRZ A;  1C9O A;  1W3S A;  3KF6 A;  4DNI A;  5JJL A;  3F2B A;  3I4M G;  2LXJ A;  1UWV A;  3PIO A;  1WCM G;  1FJG L;  2YYZ A;  5M5Y H;  2CWP A;  3AQQ A;  1M90 C;  4NXN L;  1K0R A;  3PV0 A;  1IXR A;  4GLV B;  1NE3 A;  2VQF Q;  2IX0 A;  1KHI A;  4DK3 C;  3J81 i;  2NVQ H;  2HHH L;  2DGY A;  3GTK H;  3M4O H;  3J80 i;  4JOI C;  2RCN A;  1Y1W G;  1Q82 C;  1S40 A;  5IYD G;  4GN4 B;  3L2P A;  2D62 A;  2JA5 H;  4LF9 L;  4A3G G;  4JV5 L;  2VW9 A;  4NXM Q;  1N36 Q;  3TS0 A;  4AIM A;  4Y7N H;  1QUQ A;  2F52 A;  4LUZ A;  2UU9 Q;  1J5E Q;  4A76 A;  2HIV A;  4UP7 A;  4LUO A;  4DKA C;  4JI1 Q;  1PH9 A;  3GTO H;  3CW2 C;  5C44 G;  1XPO A;  5LMN Q;  1TWH H;  1SRU A;  4L5Q A;  4JI0 L;  5C0X I;  5IYC G;  4DR5 L;  3J81 c;  2K75 A;  4FDB A;  4HJ9 A;  1W2B A;  2ZJP A;  2KCT A;  1TWA H;  3NEL A;  3J80 c;  1I3Q H;  2K4K A;  4A3E G;  4IFD G;  4QQB X;  3I2Z A;  2KCM A;  1X3F A;  1MJC A;  1OXU A;  1S72 A;  2VY3 A;  4B3R Q;  4AQY Q;  4A3J G;  3BU2 A;  5C4J H;  4GLX A;  1VQO A;  4X64 Q;  3Q8D A;  1XNR L;  3BJU A;  1XNQ L;  4JI2 Q;  1VQD A;  3M9B A;  2MO0 A;  1I94 Q;  4L5S A;  3HOU H;  4A93 G;  4LWC A;  4POG A;  2UXD Q;  1VQI A;  1LM0 A;  1Q1B A;  1Q46 A;  5GAG C;  1QVC A;  4O0A A;  2MQH A;  2PI2 E;  2I0Q A;  1HZ9 A;  1TWC H;  2I5H A;  3I4O A;  4JI6 L;  2WB1 G;  3I4M H;  2Q2T A;  1WCM H;  4DR1 Q;  2MNA A;  4C3H H;  2KHJ A;  2PI2 A;  1VQF A;  1K73 C;  3CCR A;  1JT8 A;  4JBJ A;  4LFC Q;  4LF4 L;  1LUZ A;  4P71 A;  2JA8 G;  4A3B G;  3J7A 5;  4A3D H;  1VS0 A;  3U58 A;  3H15 A;  1SE8 A;  1HR0 L;  1HJP A;  4H02 A;  4EX5 A;  5IWA Q;  3A0J A;  4DUZ L;  1E1O A;  4HJA A;  2OTJ A;  4LF7 L;  2ZM6 L;  1YIT A;  4B3M Q;  3S15 H;  2WP8 J;  1Y1W H;  3K7A H;  2UXC Q;  3HKZ G;  2MO1 A;  3OTO L;  3IRB A;  3DLL A;  1JB7 A;  3D31 A;  1P8L A;  4HJ5 A;  2OCE A;  1NBW A;  1Q81 C;  5M3F H;  1XPU A;  5J3B A;  4JCV E;  4QY7 A;  1Q1E A;  3HOV H;  3HOZ G;  1AH9 A;  2XTI A;  3HFZ B;  5C44 H;  2R7F A;  4OWW B;  5HGQ A;  4JG2 A;  3I7F A;  4ALP A;  4OWT B;  1PV4 A;  1IZ6 A;  1IBL L;  1OXT A;  2VQE L;  2UXB L;  1UE6 A;  1Q8K A;  3UDG A;  1LYL A;  4A3E H;  3HOW G;  3KLW A;  3PUV A;  2NVT H;  3FHW A;  4R4I A;  2VQF L;  1PA6 A;  3CC7 A;  1YJ9 A;  4GKJ Q;  1XPR A;  1SLJ A;  1YBY A;  3M4Q A;  3GTJ H;  2YV5 A;  4NXM L;  3KJP A;  1VQN A;  1N36 L;  4A93 H;  3CXC A;  1A0I A;  4TVA B;  3S1N H;  1N32 Q;  1Y1V H;  1H95 A;  2UU9 L;  4IJH A;  5DLQ E;  3W5O A;  3CCQ A;  1J5E L;  2E2J H;  1EUJ A;  1I50 H;  1X56 A;  4JI1 L;  4YHH Q;  4BY1 H;  1E24 A;  1JE5 A;  2LXK A;  2JJQ A;  5LMN L;  4DR2 Q;  4BXX H;  3CCJ A;  1SFO H;  5FJ8 H;  1QVG A;  1PYB A;  4LUV A;  3S1M H;  2UUC L;  4DK6 C;  2KBN A;  3A5U A;  3CC2 A;  4JI7 Q;  4LW1 A;  4DV2 Q;  4JI3 Q;  3S16 H;  2K5V A;  1MIU A;  1VQJ A;  1WJJ A;  1SMX A;  1X6O A;  1YIJ A;  2JA8 H;  3AFP A;  5IY0 A;  4DV5 L;  1HR0 W;  4DV1 Q;  4DR3 L;  4A3B H;  4B3R L;  4AQY L;  4GNX C;  3I55 A;  3PUZ A;  3RNU A;  2KHI A;  4GNX B;  4JI2 L;  1I94 L;  4UP8 A;  4JI4 Q;  4KHP Q;  1BBU A;  1NY4 A;  2UXD L;  4QIW E;  4DPG A;  2NZH A;  2OTL A;  1VQE A;  1R9T H;  4JBK A;  1ASY A;  4A4I A;  4OX9 Q;  3HOZ H;  1UE7 A;  2A1A A;  2AKW B;  4P72 A;  4DR1 L;  2R7Z G;  1VQM A;  2DUD A;  2E8G A;  2IT1 A;  2IHE A;  3OYY A;  4IPC A;  4DV6 Q;  3S1R H;  2Z6K C;  4LFC L;  1Q86 C;  4A3I G;  3F2C A;  1FL0 A;  2IX1 A;  3HOW H;  4IPG A;  5IWA L;  4DV0 Q;  2ES2 A;  2JEB I;  4DR6 Q;  1O7I A;  4HIO A;  3HKZ E;  2IHF A;  1PH8 A;  3ULJ A;  2B3G A;  1UE1 A;  1Z47 A;  4A3L G;  5FLM H;  2UXC L;  4Y52 H;  4OO1 I;  3UDF A;  4A3K H;  1OXS C;  3T1H Q;  1CKM A;  3D0F A;  3TQY A;  4BBR G;  3J81 j;  4A3F G;  1HNW Q;  5LMN W;  1UE5 A;  3MEF A;  4XTC S;  3KDF B;  4LF8 L;  4ME3 A;  1VQ6 A;  3BZK A;  1KC8 C;  1KL9 A;  4JYA Q;  5JJI A;  4JBM A;  3CP0 A;  4J15 A;  3PGZ A;  2F3I A;  1IYJ B;  1N34 Q;  3UE1 A;  1IBM Q;  4JC0 A;  1L1O C;  1TXY A;  1YNX A;  3U4V A;  3ER0 A;  2N49 A;  4RMF A;  1L1O B;  4RG1 A;  3M85 A;  1GM5 A;  2I5M X;  2NN6 G;  4GKJ L;  1KRS A;  2ZTE A;  4O2D A;  4LFA L;  5IYB H;  3S17 H;  2VNU D;  3RN2 A;  1JJG A;  4QL5 A;  4IOC A;  1EFW A;  3KYH C;  5LMU L;  1CKN A;  5BR8 L;  1HNZ Q;  1L0W A;  2V1C C;  2ZTD A;  3I4N H; 
#chains in the Genus database with same CATH topology
 1I4P A;  2XRS D;  2CQO A;  2K14 A;  5COY A;  1LTG D;  2QCP X;  2ZJQ A;  4B3S Q;  1E3P A;  3A54 A;  3LNN A;  1KRT A;  5GRO A;  1IKL A;  3K5M A;  3L3O C;  3HOU B;  5BN3 A;  2KEC A;  3N52 A;  4GZY C;  4G7O C;  1JJ2 A;  1EOV A;  4DV3 Q;  3TS2 A;  1HTL D;  4FXK C;  4DNR B;  1T9H A;  3CF5 A;  1G6P A;  1QG7 A;  5JJZ A;  3Q22 A;  4DV6 L;  2EYM A;  3KBG A;  3K7A B;  1EY4 A;  1G29 1;  1EY9 A;  5C44 B;  3OWE B;  5CV7 A;  5M3M G;  3CQZ H;  1O7Y A;  1ZYR D;  2Z9H A;  1CK1 A;  2UUA Q;  1X3Q A;  3IFT A;  4NXN Q;  3NBH B;  1VQ9 A;  3DM3 A;  2K5Q A;  5AJ3 Q;  4CHT B;  1HNX Q;  1A62 A;  4YIJ A;  1RTN A;  1SJE D;  4AYB E;  4DGZ A;  2TSS A;  2ZXP A;  3PMF A;  4C3I H;  2E2J B;  1I50 B;  1AE3 A;  4BY1 B;  2RDG A;  3Q24 A;  2RF4 A;  3AYH B;  1WTQ A;  4UAI A;  3W1B A;  1EY8 A;  2B2V C;  4XXE A;  2PZW A;  4YY3 L;  1I6H H;  5F2D A;  1PRT D;  1LT3 D;  2G9H D;  5E1F A;  4X64 L;  4A75 A;  1C7Y A;  2JA8 B;  4A3B B;  4QJF A;  4DFA A;  2EQS A;  1TT2 A;  1VQ5 A;  3AEV A;  4X62 Q;  1VQC A;  1OTC A;  3SEB A;  4RGM A;  1A2T A;  4LAA A;  3IFD A;  1R9T B;  3L9A X;  1IKM A;  3J7Z C;  1M8A A;  5IGE A;  1WD1 A;  3F8T A;  3DWA A;  5M3M H;  2OQK A;  3NBH A;  4TKO B;  2KEN A;  3R8B A;  5CC4 A;  3CC4 A;  1EQT A;  2Y0S G;  4DK1 A;  1HR0 Q;  3LGJ A;  2ID0 A;  3F2D A;  4BWG B;  2R61 A;  3TZD A;  4K0K Q;  5CYU A;  2OXP A;  1K9M C;  2UUB L;  1DJR D;  1WYD A;  5IP7 G;  2E5L L;  1IBK Q;  3STB D;  1WTR A;  1YZ6 A;  4LF6 Q;  3JC6 6;  4FVM A;  2G5D A;  1BF4 A;  1TQO A;  1JWM D;  1PH5 A;  3CD6 A;  1O80 A;  4E6I A;  5C4X G;  2PCF B;  5J22 A;  1CM9 A;  1WOC A;  5I9P A;  2YU9 H;  1F2M A;  4UP9 A;  2F0K A;  4HSV A;  1B1Z A;  4IZ8 A;  1STY A;  3K59 A;  1DGS A;  1X54 A;  3S24 A;  5KYI A;  4CDC C;  3VDY A;  3TRE A;  3MTS A;  3PUX A;  5C3E G;  4HIM A;  5M3F G;  4IPH A;  2V4D A;  3HOV G;  1KXL A;  2WFW A;  3H0G B;  2EZV A;  5ELN A;  4DV4 L;  1IL8 A;  4X66 Q;  1PTO F;  1FVI A;  1NJI C;  3GQB A;  2K50 A;  3JAM L;  2CH4 A;  4DR3 Q;  1XMO Q;  4BBS G;  2BDO A;  4Q0F A;  3CCE A;  4OON A;  1K8G A;  1GJX A;  4DXG A;  5CV6 A;  5IP7 H;  1PH7 A;  4BBR B;  1Y1V G;  3K0X A;  3C1E A;  5D65 A;  2FFK B;  1Y8P B;  4BXX G;  4KI0 A;  3UI2 A;  5FJ8 G;  1D6E C;  3FKI G;  2RHQ B;  2JA6 G;  5C4X H;  4NW2 A;  4S3S A;  3T1H L;  1AFP A;  1D1I A;  4KJO A;  1VQK A;  5GQO A;  1X9N A;  2JA9 A;  5C3E H;  3E9I A;  3SK4 A;  2B63 G;  3FVQ A;  1SNM A;  3ERS X;  3D4D A;  4RCO A;  5A2Q E;  1Q90 A;  4NDX A;  1K83 B;  4ODG A;  3K6O A;  3QIA A;  1U4M A;  2XWB B;  3F2U A;  4QIW B;  4KV6 A;  3U4Z A;  4H13 C;  1Z7T A;  1EU4 A;  2WB1 B;  2AWN A;  3TP5 A;  4A3M H;  3I4L A;  3PO3 H;  4BBS H;  1RJT A;  5FLM G;  2JXM B;  3UDI A;  2JK8 A;  5LMU Q;  3HKS A;  4NPS A;  4A3K G;  1D1K A;  2VB2 X;  4X3S A;  4H7B A;  4QUF A;  2NVX B;  3FKI H;  1MKH A;  2E2I B;  2JA6 H;  1EYC A;  2A6H D;  4KJN A;  1A3T A;  3Q23 A;  3C1F A;  1WFQ A;  1XYI A;  2BE5 C;  1VQ7 A;  2CW0 C;  1EFI D;  3L7Z C;  2F0Q A;  5JJK A;  1NSN S;  3GDE A;  1TS3 A;  4F87 A;  3UE0 A;  1STE A;  2R92 B;  1M4V A;  3I4N G;  2B63 H;  2OEO A;  5KNB A;  4BY7 H;  1L0Y B;  4MN3 A;  5G3L F;  2IJ0 A;  2K05 A;  4L6T B;  1SYF A;  3NTH A;  1OO9 B;  1W3S A;  1ZYR C;  4DNI A;  3F2B A;  2B2V A;  2LXJ A;  5C4H A;  1FJG L;  1KNE A;  3RMH A;  3H3V C;  4KK7 A;  1LLR D;  3H6M A;  3PV0 A;  1IXR A;  2PNR C;  2HHH L;  3J80 i;  4JOI C;  4JV5 L;  2D62 A;  4A3G G;  5IGF A;  3CKI B;  3D4W A;  4AIM A;  4Y7N H;  2F52 A;  1ET9 A;  4LUZ A;  1J5E Q;  5ELC A;  2M00 A;  4LUO A;  3GTO H;  5KGU A;  1XPO A;  2B2W A;  4JI0 L;  2HDL A;  1FNU A;  1PRT C;  5C0X I;  3TSS A;  1TWA H;  3V2T A;  2XN9 C;  3G7L A;  2QF7 A;  2KCM A;  1X3F A;  3HOX B;  4B3R Q;  2EYH A;  3I73 A;  4AQY Q;  1QB5 D;  1EEF D;  4A3J G;  5C4J H;  3NP8 A;  1VQO A;  1JB3 A;  1XNQ L;  1VQD A;  2MO0 A;  1LTT D;  1DD2 A;  1PZJ D;  2MUY A;  1Q1B A;  1WTP A;  4JW0 A;  1QNU A;  4O0A A;  2NB0 A;  2OF1 A;  3S2H B;  2I0Q A;  3IKJ A;  1VF5 C;  3I4O A;  1AW7 A;  4C3H H;  1JT8 A;  2PI2 A;  2SNS A;  5D3I B;  4ME5 A;  1EYA A;  4P71 A;  5ISR A;  5K5P A;  3U58 A;  3K57 A;  2F0L A;  4H02 A;  4AYB B;  4EX5 A;  5IWA Q;  3A0J A;  1ZKO A;  4LF7 L;  3MZ5 A;  5E4X A;  2WP8 J;  4I7Z C;  1JC7 A;  1EY6 A;  1MI2 A;  3OTO L;  1FD7 D;  4B08 A;  1BXT A;  3DLL A;  1I4X A;  3D31 A;  1P8L A;  4HJ5 A;  3HS0 C;  2DNC A;  4DAY A;  5FKA C;  4OWW B;  4ALP A;  1PV4 A;  1B2T A;  1IBL L;  1F77 A;  2VQE L;  2UXB L;  1UE6 A;  1Q8K A;  1G8Z D;  2NVT H;  2VQF L;  1II3 A;  3S14 B;  3NTI A;  4GKJ Q;  1XPR A;  1YBY A;  1LT4 D;  3BDO A;  1S4Z A;  3KJP A;  1N36 L;  1JOQ A;  5M5W B;  4RGN A;  3S1N H;  1BOS A;  4YHH Q;  3M3Y B;  2JN4 A;  4M8A A;  1JE5 A;  5FO9 B;  1PZK D;  2VUM B;  4V19 0;  1O78 A;  1ZEQ X;  3S1M H;  2UUC L;  3Q0A A;  3CC2 A;  4DV2 Q;  2K5V A;  1MIU A;  1VQJ A;  5IY0 A;  4DV5 L;  1HR0 W;  4DV1 Q;  4GNX C;  3W3A A;  2KHI A;  4JI2 L;  3SR1 A;  1I94 L;  1LT6 D;  3NTK A;  4JBK A;  5HGT A;  4A4I A;  4OX9 Q;  1WD0 A;  1D5Z C;  2AKW B;  4I7A A;  3ND8 A;  4Z9C B;  4NKL A;  2R7Z G;  2EVB A;  4C56 C;  2IT1 A;  3NBI A;  2Z6K C;  3JAM E;  3GP7 A;  1NUC A;  4K2K A;  4A3I G;  2TMP A;  4KMU C;  4IPG A;  2ES2 A;  3PO2 B;  3HKZ E;  2IHF A;  1PH8 A;  2EYL A;  1CA6 A;  3ONA B;  4Y52 H;  1TY2 A;  1R4P B;  1PDQ A;  1D5M C;  4IUP A;  2F0F A;  4A3F G;  5E3F A;  1ET6 A;  3MEF A;  3KDF B;  4XTC S;  4ME3 A;  4LF8 L;  3BZK A;  2NVQ B;  1KL9 A;  5D3D A;  1PFB A;  1IYJ B;  1N34 Q;  1IBM Q;  1EIG A;  4JC0 A;  2RVL A;  3NQT A;  3QR8 A;  3S17 H;  5IYB H;  2VNU D;  4IOC A;  3TBI B;  2E76 C;  1TWH B;  4HSP A;  1PRT B;  2EE1 A;  1SE3 A;  1L0W A;  1JJC B;  2KED A;  4A3D B;  2KVM A;  1XMQ Q;  4DR2 L;  4PMW A;  1KDB A;  2XGT A;  1FGU A;  2A19 A;  2BOS A;  1EYD A;  1PH3 A;  4JI7 L;  2F0S A;  2NYZ D;  4A3I H;  4AH6 A;  5C0X J;  4N9P A;  1BQQ T;  2CWA A;  4TQU S;  5JEA J;  3KFU A;  1EU3 A;  4EGV A;  2MGS A;  1GO3 E;  5M9O A;  5IGB A;  1CSQ A;  3A56 A;  3DEP A;  4ABN A;  5I6Y A;  4JI4 L;  4KHP L;  3KBX A;  3DMU A;  1WCM B;  1S5D D;  2E2H H;  1B9M A;  2B29 A;  1HZC A;  2FHT A;  4JOI A;  4XQJ A;  2EY2 A;  4GKK Q;  5IYD H;  3N6R A;  1XJV A;  2M2L A;  1G51 A;  4K5W A;  5KNC A;  3S15 B;  2Z4H A;  2SOB A;  2CFM A;  3CRL C;  2BCO A;  1YHA A;  4HAE A;  1B4O A;  4DR6 L;  2K5H A;  2XNA C;  4C3J G;  1RHP A;  3BS1 A;  3BZC A;  2NN6 I;  1HZA A;  1WTV A;  2Q8T A;  1JE4 A;  2A68 C;  4A3E B;  2EOT A;  1SNO A;  2NZ1 D;  4F8M A;  4JI8 Q;  2AMC B;  1HNW L;  2FXQ A;  3NE5 B;  1PTO H;  4JYA L;  3GTJ B;  2VZA A;  1JWS D;  2JP1 A;  2YTY A;  3MC0 B;  4UPA A;  4IFD J;  5IP9 G;  2B2Y A;  1SYD A;  1BCP F;  1HNZ L;  1KDC A;  1AN8 A;  4DR7 Q;  3U9S A;  4ZKB B;  2PQE A;  3RLO A;  2L12 A;  2A69 D;  4B3S L;  4LJZ C;  4IPD A;  1CQV A;  3S16 B;  1EYG A;  1PH6 A;  3BDC A;  3GD7 A;  3TDQ A;  1PH4 A;  3SGI A;  3I56 A;  4IOA A;  1KNA A;  2K52 A;  2N55 A;  5I2X A;  2JA5 G;  1GKH A;  4NP5 A;  2K32 A;  4MZ9 A;  5CV8 A;  3HOZ B;  3PSI A;  2KQ3 A;  4DV3 L;  1E7Z A;  4H44 C;  1YJW A;  1RD9 D;  1VQP A;  4OEL B;  1IW7 D;  1QVF A;  2F4V Q;  1JQY D;  5GAH C;  1TR5 A;  1SJH D;  4ZYS A;  1SE2 A;  2RA4 A;  1TWG H;  1WTW A;  2Q2U A;  1S5E D;  3M7N A;  5JPN C;  2CH4 W;  1SRO A;  2ZM6 Q;  4G7H C;  1P16 A;  5IE8 A;  1UEA B;  4QGU A;  1A63 A;  2DJF C;  2B39 A;  5ELD A;  5KRU A;  1A15 A;  1GUT A;  1KTK A;  2L9H A;  4X65 Q;  4QF4 A;  1GUW A;  4GNX A;  2UUA L;  2JEA I;  2Z0S A;  4RKB A;  3H91 A;  2RSO A;  4WOR A;  2MJ8 A;  3E5S A;  3KJO A;  2R93 G;  2IY5 B;  3H3V I;  4K5X A;  1RL2 A;  3EIV A;  3BYY B;  3RLF A;  4CDF C;  4YWK A;  5AJ3 L;  1HNX L;  1ENC A;  1ICF B;  4XT3 B;  3MXU A;  1VQG A;  2BA0 A;  3PUW A;  5CV5 A;  2XWJ B;  2Z6K A;  1H95 A;  3D3R A;  3UDX A;  4DK0 A;  1T5E A;  1FNW A;  4IAL A;  2WAQ G;  1X3P A;  2FMM A;  2KCN A;  1WTX A;  1PHJ A;  3J7A F;  2C35 B;  1SMY D;  1AZP A;  3C46 A;  3A7A B;  5C3W A;  4DAM A;  4X62 L;  1EQQ A;  1GD7 A;  2LY7 A;  1VQ4 A;  3R3O A;  2WKD A;  3GTQ H;  4R4Q A;  2L5T A;  1PH2 A;  1SBB B;  4LNQ A;  3CCU A;  4GOP B;  3VA5 A;  2X6L A;  4KD3 A;  1CHP D;  1YNN D;  3T1Y Q;  3NWS A;  4MNO A;  1R4Q B;  1V1P B;  4BY1 G;  1SDF A;  5K36 G;  4IUN A;  4DV0 L;  2AHO B;  3PIP A;  3QO2 A;  2PZU A;  2R93 H;  1BNZ A;  4YCV A;  5EPK A;  4K0K L;  1OXX K;  1GUO A;  4DAP A;  2NBF A;  3CQZ B;  2QDL A;  1TVX A;  2LKV A;  5JOB A;  1IBK L;  4HID A;  2JQO A;  1D5X C;  3QWN A;  3GV6 A;  4LF6 L;  2B2T A;  1K3R A;  1J8I A;  5JAV A;  3JAM c;  1O7Z A;  2A6E D;  2Q8R E;  5M5X H;  4QB4 A;  3RZO H;  1FNV A;  2K03 A;  2L1B A;  4C3I B;  4OO1 G;  3PQI A;  1VQB A;  3HG9 A;  4GOP A;  2CHB D;  1SSO A;  1LAB A;  3KF6 B;  3B6Y A;  2RCF A;  1V1P A;  1GVP A;  2Z8L A;  4WJW A;  3PCO B;  5BR8 Q;  4EQN A;  5DM6 3;  1IL2 A;  4MTN A;  1I6H B;  4C1N I;  4ZRZ A;  3HKZ B;  4OWX B;  1LTR D;  4L5R C;  2A8V A;  4N8X 1;  2C5C A;  4X66 L;  3W2D A;  1OXV A;  4P75 A;  3VR3 A;  4G57 A;  1GUN A;  1PFM A;  5C0X G;  1ICW A;  2OQ0 A;  2I46 A;  3VYU A;  2GVA A;  1XMO L;  5JEA G;  2B2W C;  2KOL A;  1JOK A;  2NWG A;  5EKL A;  4LF4 Q;  3EQL C;  3QOL A;  4FXD A;  3BZD B;  2A73 B;  1EIF A;  2DY7 A;  1U5K A;  2EJM A;  2R6G A;  1CKN B;  2RHS B;  1EY5 A;  5CV9 A;  2L0C A;  3H0G G;  3WOF A;  3FEW X;  2BH2 A;  2G9D A;  1EQV A;  3KF6 A;  5EQ0 A;  3I4M G;  1UWV A;  1CT1 D;  1JCK B;  5M5Y H;  2CWP A;  1HTP A;  3NWT A;  1EEI D;  4DF7 A;  4XYQ A;  1UUP A;  2XRQ D;  4DK3 C;  3M4O H;  1DCZ A;  1O7L A;  2YU9 B;  1Y1W G;  4K8I A;  1B44 D;  4GN4 B;  4RH6 A;  1S40 A;  2P5Z X;  4KY6 A;  3TS0 A;  1PTO D;  1WTH A;  2ICI A;  1TY0 A;  2UU9 Q;  4A76 A;  2HIV A;  3I70 A;  4UP7 A;  4JI1 Q;  1PH9 A;  5C0X H;  4B9W A;  5JEA H;  3RUZ A;  2AUJ D;  5IYC G;  3J81 c;  2XIW A;  4FDB A;  4HJ9 A;  1W2B A;  2ZJP A;  2KCT A;  3NEL A;  4IFD G;  1I3Q H;  2K4K A;  3I2Z A;  1JOR A;  1A3V A;  1S72 A;  2VY3 A;  1A3U A;  1SYG A;  4FF3 A;  2X6G A;  3BVM A;  4X64 Q;  1XNR L;  3BJU A;  3M9B A;  4A93 G;  4L5S A;  4LWC A;  2EXZ A;  4K6L A;  1I4R A;  3LWE A;  3GTM B;  1TWC H;  1G2S A;  2WB1 G;  3D6W A;  3I4M H;  4DR1 Q;  4KY5 A;  4CJ2 C;  1K73 C;  1VQF A;  4JBJ A;  4LFC Q;  5DAU A;  3R2T A;  3WDN A;  3FPP A;  1VS0 A;  1SE8 A;  1HJP A;  4G4K A;  2ICE C;  4DUZ L;  2OTJ A;  5C4X B;  2F0H A;  1YIT A;  1NNX A;  1Y1W H;  1I4H A;  2K33 A;  2UXC Q;  4KKS A;  4IN3 A;  2E74 C;  3KLS A;  1T5X D;  2WII B;  1Q81 C;  1NBW A;  5M3F H;  5C3E B;  3HOV H;  2LMC B;  2XVS A;  5EBC A;  1PYW D;  4HED A;  1OXT A;  4P2C B;  4FP5 D;  4OGQ C;  2K6A A;  4IFD H;  1H9S B;  3HOW G;  3KLW A;  1MGS A;  1S5B D;  4R4I A;  2F1M A;  3T13 A;  5KIX A;  3CC7 A;  4RFB A;  4O42 A;  1YJ9 A;  1HQR D;  4A3M B;  3E0J A;  4JK1 C;  3TP6 A;  4A93 H;  3PO3 B;  3IAY A;  3CXC A;  2BDN A;  4TVA B;  4KTA A;  1N32 Q;  1Y1V H;  3D8G A;  1J5E L;  3A7L A;  1X56 A;  2GA4 B;  4BXX H;  2F3V A;  2LXK A;  1SFO H;  3QJY A;  5FJ8 H;  1PYB A;  1VMP A;  4LUV A;  4F88 A;  1BR9 A;  2KBN A;  4JI3 Q;  3FKI B;  1QIL A;  1WJJ A;  1SMX A;  1X6O A;  3GV3 A;  2JA6 B;  4B3R L;  4AQY L;  2F0G A;  3I55 A;  1EOT A;  3LWU A;  4UP8 A;  1BBU A;  5G3L D;  2RBM A;  2NZH A;  3J81 L;  2E2D C;  1G6Z A;  1UE7 A;  2K5W A;  4QMG A;  1IYU A;  2B63 B;  1H9S A;  2HD3 A;  1XXG A;  4BY7 B;  1VQM A;  2E8G A;  1F9R A;  3OYY A;  4IPC A;  3TN2 A;  3S1R H;  1Q86 C;  3HOW H;  5IWA L;  2IW3 A;  1QCB D;  3IL8 A;  1Z47 A;  1NR4 A;  4A3L G;  5FLM H;  3OMG A;  3SE0 A;  4OO1 I;  1MHW C;  4A3K H;  3T1H Q;  1JWU D;  1L0X B;  3D0F A;  3TQY A;  2AQ3 B;  1RTO A;  1BCP B;  5LMN W;  1VQ6 A;  4HN7 A;  4WRD A;  1JOO A;  1E2V A;  4K8J A;  5JJI A;  4J15 A;  1GHJ A;  1KLG D;  1TXY A;  2DN8 A;  4Y7N B;  1L1O B;  3SK6 A;  2NN6 G;  4GKJ L;  3V96 A;  4QCL A;  4LFA L;  1EZ6 A;  3GTO B;  3RN2 A;  3BG3 A;  4QL5 A;  1EFW A;  3KYH C;  1I4Q A;  1FGB D;  3G6J B;  3I4N H;  1H9R A;  3E0E A;  1TWA B;  2XSC A;  4PZ8 A;  5C4J B;  4MTK A;  1HPC A;  4IUU A;  2IWH A;  4Q5V A;  1WTO A;  4CKB A;  1HXY D;  2VXW A;  5EKI A;  4DV1 L;  5A35 A;  3A8J E;  3CCM A;  2LSS A;  1WVL A;  2KJX A;  5C6A A;  4PZ6 A;  3KLR A;  4ZAI A;  4U67 3;  5E7N A;  2B2Y C;  4C3H B;  3R93 A;  2Q2I A;  1TWF B;  2YTX A;  4OX9 L;  2R3Z A;  1D8L A;  1J6Q A;  4A3G H;  1L1O A;  3STB C;  3GTG H;  1EZ8 A;  1QZH A;  1CZW A;  2K01 A;  3K7U C;  4OXP A;  2ZTC A;  4EQP A;  5I6W A;  4CKC A;  1BUV T;  1L2F A;  2NN6 H;  2ENB A;  1MJE A;  3HOY G;  1PVO A;  2HIX A;  1TII D;  1Q3L A;  4FF1 A;  1PYS B;  2WKC A;  3A55 A;  2OWO A;  5EJW A;  2KHS A;  4GN3 B;  1H9J A;  4IFD I;  1A6X A;  1ASZ A;  4A3J H;  3ULL A;  5IIF A;  5FO8 B;  2NVT B;  2FJ2 A;  3VA7 A;  1AP0 A;  1RKN A;  1U0L A;  1J9O A;  1N34 L;  1IBM L;  2OT2 A;  1I4G A;  4K5V A;  3S1N B;  4JI5 Q;  1VF7 A;  3OW2 A;  4N8F A;  4B3T Q;  1U4L A;  1N8R C;  2IX3 A;  4JVZ A;  3RR5 A;  3PO2 G;  2D5D A;  4NMZ A;  1BDO A;  4OIJ A;  2HCC A;  2GVB A;  5BN5 A;  1STA A;  1YNJ D;  2DY8 A;  4JI0 Q;  2F0E A;  4YWL A;  4IUR A;  2EYF A;  3M3Y H;  3PIP 3;  4WJ4 A;  3HRZ C;  2ASB A;  2WAQ E;  2JA7 G;  1K28 A;  4J8Q A;  3ITP A;  1EIY B;  1GHK A;  4UHV A;  2RDH A;  5HY6 A;  5IT9 L;  3PUY A;  1SE4 A;  2IL8 A;  3NHH A;  3HOY H;  2MFI A;  2PNH A;  3PF5 A;  1V1Q A;  5CBA E;  3TP8 A;  1NAP A;  1V43 A;  5J39 A;  4DV7 Q;  1QUQ B;  1V9P A;  4KN4 C;  2VS1 A;  4PZ7 A;  1HZB A;  4V0B A;  4B3M L;  4A3D G;  2NZO A;  4GKK L;  2PW7 A;  4JBW A;  2NVY H;  4GS3 A;  2WV6 D;  3OOC A;  3TEH B;  1GXD C;  1XTC D;  3A8I E;  3OTO Q;  5I9O A;  3NQI A;  3PO2 H;  3R2I A;  2DJG C;  3MXG A;  4LFB Q;  4POF A;  1EIH A;  4A3C G;  3MWY W;  1E22 A;  2ZJR A;  2QIL A;  1X55 A;  3H3V H;  1IBL Q;  2RDF A;  1KAB A;  3K8A A;  2MPM A;  4KD4 A;  2N78 A;  1BVS A;  4JI8 L;  3CPW A;  3CRK C;  2VQE Q;  2UXB Q;  2JYO A;  3VR6 A;  2EJG C;  3S17 B;  5DEH A;  1DON A;  2JA7 H;  3A8K E;  5EBD A;  1C8C A;  1E2Z A;  1TU2 B;  1VMC A;  2CVR A;  1CQF A;  5ELE A;  3S1Q H;  2R7Z H;  2EXD A;  1PXU A;  1LTL A;  3MXN B;  1TS4 A;  3ICE A;  2A6H C;  4JPB W;  3GTL H;  4DR4 Q;  4DR7 L;  2PMZ E;  1AEX A;  1SYC A;  3RZD H;  2B2T C;  4A3I B;  2UUC Q;  3I8Z A;  5ELF A;  3WOE A;  1HH2 P;  4ZCK A;  2RKS A;  3FP9 A;  4UDU C;  1B53 A;  1DM0 B;  2RQX A;  4DV5 Q;  1A8V A;  3KDF A;  3W1G A;  1I6V C;  1X32 A;  4LF5 Q;  4XIG S;  1PMR A;  1N33 Q;  2E2H B;  3MFG A;  4C2M H;  4GOP C;  2PYK A;  5C4Z A;  2EIF A;  5ELB A;  4A3F H;  4TRD A;  5CV4 A;  4IJL A;  2EYJ A;  4A3C H;  1VQL A;  2F4V L;  5EKK A;  3E9H A;  1FYC A;  2Y0S E;  3OHX C;  4IQZ A;  4IUQ A;  5EAY A;  1SYE A;  3K81 C;  1EQR A;  3J81 E;  4DUY Q;  3CCL A;  1WI5 A;  1Q12 A;  1Y8O B;  3EBE A;  2A5H A;  2D0P A;  3JAM i;  4P73 A;  3S2D H;  3MXN A;  4IO9 A;  1E1T A;  1PFS A;  4L5T A;  4XQN A;  2GN5 A;  3GTP H;  2F0N A;  1NMF A;  4X65 L;  5C3X A;  1BCP D;  1PTO B;  2HDM A;  4P74 A;  3T56 B;  3VYT A;  3E3X A;  4LF8 Q;  4KN7 C;  4NB3 A;  4LF9 Q;  3CCV A;  1K8M A;  1RIP A;  2J0T D;  3KLS X;  4PQX A;  3DM1 A;  3VYS A;  1AE2 A;  3EN2 A;  3F1Z A;  4KY7 A;  4IUV A;  4L8J A;  4KLK A;  3E6Z X;  3MEH A;  1SAP A;  4DR5 Q;  1YI2 A;  3SK5 A;  1K3B C;  4X6A H;  1VQH A;  1W6J A;  3VR4 A;  2EY6 A;  4HCE A;  2PPB C;  4R4O A;  2EDG A;  1D2B A;  4BA1 I;  1STH A;  2CKZ B;  4ZUI A;  4C3J H;  1X3E A;  1MD2 D;  1GUS A;  1CSP A;  1EY7 A;  5IGD A;  3Q6S A;  4JI6 Q;  2D0O A;  2AWO A;  2B8G A;  5H1S E;  1DOL A;  1CZG A;  3T1Y L;  3RLN A;  2WB1 E;  3J80 L;  1TWG B;  3CPF A;  1BKB A;  3HOU G;  1EL0 A;  5LL6 S;  5JPM C;  4CKE A;  3X3M A;  2X69 A;  1SNQ A;  1Y8N B;  1YEZ A;  5IP9 H;  3TRZ A;  5JJL A;  3NK9 A;  3PIO A;  4H0L C;  4RHR A;  2L55 A;  3OIQ A;  3AQQ A;  4L63 B;  4NXN L;  4PNY A;  2K7V A;  3C2P A;  2IX0 A;  1KHI A;  5CMD A;  3J81 i;  3GTK H;  2DGY A;  4KHV A;  2RCN A;  5DM7 3;  2JA5 H;  4I65 A;  5FK9 C;  2VW9 A;  4NXM Q;  4RKL A;  4LK1 C;  3SK8 A;  4EVO A;  2O2L D;  4DKA C;  4O1N A;  3CW2 C;  5C44 G;  5LMN Q;  2SDF A;  1H9M A;  2K75 A;  2K04 A;  1SNP A;  2I07 B;  1MJC A;  2NUC A;  2FMC A;  2B2U A;  2WIN B;  5EGT A;  3Q8D A;  1XWE A;  3HOU H;  2UXD Q;  3GTQ B;  1U4R A;  5GAG C;  1Q46 A;  1LO5 D;  1QVC A;  4HMI A;  2MQH A;  2PI2 E;  5LHY 1;  2I5H A;  4C3I G;  2Q2T A;  2KHJ A;  4HTH A;  4RAU C;  3CCR A;  3K5O A;  3KK7 A;  4IUT A;  4LF4 L;  1LUZ A;  3P20 A;  2JA8 G;  4A3B G;  3H15 A;  1HR0 L;  3CHB D;  2CQA A;  2BE5 D;  4CJ1 B;  2CW0 D;  4HJA A;  5IT9 E;  2R93 B;  4PV1 C;  2L4N A;  3K7A H;  3HKZ G;  2L11 A;  2OCE A;  1HHV A;  1XPU A;  4JCV E;  4QY7 A;  1Q1E A;  5D14 A;  4DA2 A;  2XTI A;  3HFZ B;  5C44 H;  5HGQ A;  2K28 A;  5EPJ A;  1H9K A;  1LTI D;  2WAQ B;  4M1U B;  4N9T A;  3P1H A;  1ZXT A;  1PA6 A;  4J1M A;  3HZX A;  5M5X B;  3M4Q A;  3RZO B;  1HUM A;  2YV5 A;  3HP3 A;  3SHL A;  1LT5 D;  3OPO A;  3DUZ A;  2UU9 L;  3W5O A;  2E2J H;  5NUC A;  1EUJ A;  1I50 H;  4JI1 L;  5FOB B;  4BY1 H;  4DN4 M;  4G7Z C;  3CCJ A;  2EYO A;  5K36 H;  3EA6 A;  4TSS A;  1ENF A;  4DK6 C;  2Z4I A;  3A5U A;  4LW1 A;  1PFN A;  2F0V A;  4RCN A;  2JA8 H;  4A3B H;  3AFP A;  4DR3 L;  3PUZ A;  3RNU A;  5M3M B;  1NY4 A;  5BN4 A;  2H4O A;  4RGT A;  2EPB A;  2H1E A;  2OTL A;  1VQE A;  1R9T H;  1PRT F;  4DR1 L;  2DUD A;  1B3Q A;  4DV6 Q;  4LFC L;  3M4Y A;  3O13 A;  3I72 A;  3F2C A;  1V1O A;  2EY5 A;  4DV0 Q;  4OO1 H;  1DZ1 A;  1O7I A;  4CDD C;  1DYQ A;  3ULJ A;  2B3G A;  1UE1 A;  3P7J A;  2UXC L;  5C5L A;  1ESR A;  1B3A A;  2O4X A;  5M5Y B;  1OXS C;  2ZT9 C;  2PMZ B;  5T1I A;  1BCP C;  3D4R A;  4BBR G;  1HRJ A;  1UE5 A;  3QOJ A;  4ZLT F;  3M4O B;  3S9W A;  1KC8 C;  2MP1 A;  1HA6 A;  3PGZ A;  2F3I A;  3UE1 A;  3QG1 A;  4ZKC B;  1NCV A;  3K58 A;  1L1O C;  1YNX A;  3U4V A;  5L37 A;  1VDZ A;  2ZXR A;  1GM5 A;  2A69 C;  2HCI A;  1JJG A;  1S5F D;  3U9O A;  5LMU L;  2VB3 X;  1HQM C;  1CKN A;  1N32 L;  2ZTD A;  1ILQ A;  3U50 C;  2QGQ A;  1I3Q B;  3ZYY X;  3H09 A;  3L0O A;  4F7X A;  4YY3 Q;  2Y0S B;  4CDE C;  5ELO A;  1I5F A;  1KAW A;  3H0G H;  2EJF C;  3MA2 B;  1E2W A;  2AQ1 B;  4JI3 L;  1IW7 C;  2ATW A;  1JMC A;  4LMQ D;  3DHQ A;  1TWC B;  1CFM A;  3I4M B;  4A3M G;  4R4C A;  1DOM A;  3PO3 G;  1F9P A;  3J7Y W;  4HJ7 A;  5CBE E;  4BBR H;  3K5N A;  3GO5 A;  1MBY A;  3EFX D;  2SNM A;  3GTM H;  3A74 A;  2JE6 I;  3K80 C;  1Y1W B;  4YCW A;  4GLA C;  2N3S A;  4KHZ A;  3ERO A;  1LAC A;  3CU7 A;  2UUB Q;  5M3F B;  4APV A;  2AQ2 B;  1F9Q A;  2E5L Q;  3HOV B;  1V8Q A;  2ZXO A;  5IYC H;  1YHQ A;  3J80 E;  3M4P A;  3NSW A;  1XTD A;  2D9U A;  4FF2 A;  2R92 G;  5COR A;  1S3O A;  1CUK A;  1B8A A;  4R8I A;  3FDT A;  3BDL A;  5E4W C;  4YWM A;  3P75 A;  3URY A;  5AFW A;  4BBS B;  4BY7 G;  5GAE C;  4HIK A;  1K83 H;  3TZU A;  1XX8 A;  4A93 B;  4R9W A;  5KND A;  4BS9 A;  3CME A;  3NEN A;  5FLX c;  1CKO A;  1Y1V B;  3DEO A;  2EYP A;  1SMY C;  4R1J A;  3K0Y A;  1FR3 A;  1SFO B;  1YJN A;  1G2T A;  2LS0 1;  3G4S A;  2HT1 A;  2PQA B;  3OSO A;  4DV4 Q;  1BO0 A;  2NVX H;  3MFY A;  1YNN C;  5HUR A;  1CI3 M;  2E2I H;  1UEB A;  4UY8 C;  1XNR Q;  1KIX A;  2B8F A;  1ONL A;  4HMJ A;  3C3L A;  1M1K C;  1KD1 C;  1EWI A;  1SN8 A;  4WFN 3;  4DAV A;  3S1R B;  2R92 H;  3G48 A;  3HOX G;  3EJI A;  2Q8I B;  3HOW B;  2AUK A;  3SVM A;  1LV9 A;  3VR2 A;  1KAA A;  4DUZ Q;  3T16 A;  4C1N K;  3ULP A;  4FNF A;  1HFN A;  4A3K B;  1LTS D;  1QZG A;  4HJ8 A;  4J6H A;  4DXF A;  5J1Z A;  1SEB D;  2A6E C;  1B9N A;  1TS5 A;  2PQA A;  3FPU B;  1BBW A;  1SXT A;  1IHZ A;  1VCI A;  1C48 A;  1E0B A;  4C3H G;  1SR3 A;  1YHB A;  2F4I A;  1B7Y B;  2E75 C;  4AYB G;  2PO4 A;  4BA2 I;  5JVH 3;  1PH1 A;  3H94 A;  5IT9 c;  4DNT B;  4YHH L;  2A68 D;  2JSO A;  4WJ3 M;  4JI5 L;  3I4N B;  4EQO A;  3ERQ A;  1VQA A;  4RGO S;  1KQS A;  1GOZ A;  4B3T L;  1Q7Y C;  1NTG A;  1K0S A;  4EQ5 A;  3X3N A;  4DV2 L;  2F0T A;  1SYB A;  3G71 A;  3TME A;  5CR3 A;  4FF4 A;  4GN5 A;  3M7G A;  1D7Q A;  4DAY B;  4DU9 A;  3HOX H;  4A3L H;  5I2Y A;  2LFN A;  5FLX L;  4PMB A;  4ID6 A;  2YTV A;  3KF8 B;  1Z9F A;  2K5N A;  4FYD A;  3G6E A;  1CTM A;  2K5D A;  3PIO 3;  1N9W A;  1RCV D;  2M9V A;  2L15 A;  3OIP A;  4HR7 B;  3S2H H;  2VUM G;  2BA1 A;  4ZQ3 A;  1YVC A;  2H5X A;  2VL6 A;  1KLU D;  2J4X A;  3MHB A;  1LTB D;  3NXW A;  4KKT A;  3SXH A;  2SEB D;  4A3G B;  3ND9 A;  3T51 B;  4DV7 L;  2Z6B A;  1U9R A;  3GTG B;  1LTA D;  1BBX C;  1CHQ D;  1TWF H;  1SNC A;  1K8A C;  3NPP A;  1PLF A;  4QUC A;  1DOK A;  3I91 A;  3WWV A;  2KCC A;  2QA4 A;  2F0J A;  1HCZ A;  2N8N A;  4PMC A;  3RD4 A;  3ZJY C;  1Y14 B;  1FJG Q;  3RN5 A;  4HCS A;  4X3K A;  1C0A A;  2I5L X;  1PTO C;  1F2L A;  4A3J B;  4LFB L;  3D6C A;  5IOD A;  2HHH Q;  2CCZ A;  3HGB A;  3AU7 A;  1GUG A;  4JV5 Q;  2A74 C;  3SDZ A;  4XDX A;  1AZQ A;  2QKI C;  3A5Z B;  3KF8 A;  1RDP D;  2HQE A;  2PZT A;  3AB9 A;  3S14 H;  1F9S A;  4CJ0 B;  3CCS A;  4PG3 A;  1PZI D;  1KDA A;  3S1M B;  2QW7 A;  4ULL A;  5M5W H;  4LFA Q;  1XMQ L;  4RA8 A;  5GAD C;  2QEX A;  3DWP A;  3AFQ A;  2VUM H;  4X3U A;  4CGY B;  3KOJ A;  1UAP A;  4R4T A;  1B70 B;  3CMA A;  2BH8 A;  4DR4 L;  2FIN B;  1W6K A;  1HFG A;  1X65 A;  3CAM A;  1XNQ Q;  1VQ8 A;  2C9O A;  1JR0 D;  1STB A;  2F0W A;  1STG A;  3HOY B;  3PF4 A;  3V05 A;  2QDB A;  1NR2 A;  2F0U A;  4LF5 L;  5IYB G;  1N33 L;  3NEM A;  1X3G A;  4KKU A;  5IGG A;  1STN A;  1QNK A;  4LF7 Q;  2B2U C;  2F0I A;  2R7D A;  2WAC A;  4OEM B;  2NVY B;  4YCU A;  1UNS A;  2HQL A;  1NMG A;  2Q2H A;  2ALY B;  3K5L A;  2KUM A;  2QEJ C;  4DUY L;  1C9O A;  5IGC A;  1WCM G;  2YYZ A;  2DNE A;  1M90 C;  1K0R A;  4GLV B;  2PW5 A;  3KUP A;  1NE3 A;  2VQF Q;  2NVQ H;  2KA7 A;  4B9X A;  3FMC A;  1ROD A;  1RF2 D;  1Q82 C;  3NUC A;  1JIC A;  5IYD G;  3L2P A;  4LF9 L;  2JA7 B;  1N36 Q;  3I3C A;  1QUQ A;  3S1Q B;  2K1B A;  3MVV A;  3T4A C;  2R7Z B;  1EY0 A;  1TWH H;  1SRU A;  1SND A;  4L5Q A;  3GTL B;  4XQQ A;  4DR5 L;  2IPK D;  3RZD B;  4A3D H;  3HEJ A;  3J80 c;  4QQB X;  4A3E G;  1TS2 A;  1OXU A;  3TP7 A;  3EVQ A;  2F0P A;  3BU2 A;  4GLX A;  2HUG A;  4ILW A;  4OHJ A;  4K6D A;  4JI2 Q;  1I94 Q;  4POG A;  1VQI A;  2O5I C;  1LM0 A;  1QOH A;  4C2M B;  4A3F B;  2D2C C;  2F0O A;  1HZ9 A;  2F3W A;  4XT1 B;  2J7Z A;  1ENA A;  2F0M A;  4JI6 L;  3VYR A;  1WCM H;  2MNA A;  1ESF A;  3VR5 A;  3OW7 A;  1EWC A;  4FO2 A;  4ZK9 B;  3J7A 5;  1B50 A;  3I90 A;  1E1O A;  2ZM6 L;  1QE6 A;  4OL7 A;  4B3M Q;  3S15 H;  3MAQ A;  2MO1 A;  2N88 A;  1U4P A;  3IRB A;  1ILP A;  5KEE A;  1F2Z A;  1JB7 A;  3S2D B;  4RHS A;  5J3B A;  5LL6 X;  3GTP B;  5JVG 3;  3HOZ G;  2O5J C;  1AH9 A;  3T53 B;  1C4Q A;  2R7F A;  5FO7 B;  4JG2 A;  3I7F A;  3AMU A;  4OWT B;  1IZ6 A;  1QJO A;  5DNF A;  1Y69 U;  4MIU A;  3UDG A;  1LYL A;  5TSS A;  5I4D A;  4A3E H;  1Z6H A;  3PUV A;  3FHW A;  4K14 A;  1SLJ A;  3FRP B;  1TKW B;  3GTJ H;  4NXM L;  1VQN A;  1HUN A;  4MHE A;  1A0I A;  4ZUJ A;  4IJH A;  5DLQ E;  3CCQ A;  5CGK A;  1E24 A;  2JJQ A;  5LMN L;  4DR2 Q;  2Z1C A;  1EWH A;  2NTS A;  4X3T A;  3BVG A;  1QVG A;  1DXM A;  4JI7 Q;  3S16 H;  2F0D A;  4C3J B;  3BVZ A;  1YIJ A;  1QWY A;  4RWS C;  1CA5 A;  3LX0 A;  5C5M A;  4GNX B;  4JI4 Q;  4KHP Q;  4OIK A;  2UXD L;  4XYO A;  4QIW E;  4DPG A;  1MSG A;  2F03 A;  3BYT B;  1ASY A;  3HOZ H;  1Q8I A;  4CBV A;  2A1A A;  1K8O A;  4P72 A;  5FLX E;  1ML0 D;  2IHE A;  5KYL A;  4R8N A;  5EPL A;  1FL0 A;  2IX1 A;  2EY1 A;  3QB3 A;  4DR6 Q;  2JEB I;  4HIO A;  5A2Q L;  1MSH A;  2KEE A;  5IOC A;  3UDF A;  1F2Y A;  1HA5 A;  1CKM A;  4U68 A;  2RSN A;  2MHV A;  3J7A V;  1IYV A;  3J81 j;  1G91 A;  1HNW Q;  1S5C D;  4FXG C;  4JYA Q;  3GTK B;  1A2U A;  4JBM A;  3CP0 A;  2JA5 B;  5T1G A;  3OWF A;  3ER0 A;  2N49 A;  4RMF A;  4RG1 A;  3M85 A;  2I5M X;  1YNJ C;  1KRS A;  3MXP A;  3OMC A;  2ZTE A;  4K2L A;  4O2D A;  3DXJ C;  3DWQ A;  2NTT A;  5BR8 L;  1HNZ Q;  2V1C C; 
#chains in the Genus database with same CATH homology
 3U50 C;  1JJC B;  3E0E A;  2CQO A;  2QGQ A;  1XMQ Q;  2K14 A;  4B3S Q;  3L0O A;  4YY3 Q;  4PMW A;  4DR2 L;  2ZJQ A;  1E3P A;  4PZ8 A;  1KRT A;  2XGT A;  1FGU A;  2A19 A;  5GRO A;  5ELO A;  1I5F A;  1KAW A;  1PH3 A;  3H0G H;  4JI7 L;  4JI3 L;  4A3I H;  4AH6 A;  5C0X J;  2ATW A;  4DV1 L;  2CWA A;  3CCM A;  4TQU S;  5JEA J;  2LSS A;  1JMC A;  3KFU A;  4PZ6 A;  1JJ2 A;  1GO3 E;  1CSQ A;  1EOV A;  4DV3 Q;  4JI4 L;  3TS2 A;  4KHP L;  5E7N A;  2E2H H;  4A3M G;  2B29 A;  1HZC A;  4R4C A;  3PO3 G;  2Q2I A;  4JOI A;  4HJ7 A;  1T9H A;  2YTX A;  3CF5 A;  4OX9 L;  4BBR H;  3GO5 A;  1G6P A;  4GKK Q;  1D8L A;  1J6Q A;  5IYD H;  1XJV A;  4A3G H;  3GTM H;  1G51 A;  3A74 A;  4DV6 L;  2JE6 I;  1L1O A;  3STB C;  3GTG H;  1QZH A;  3K80 C;  2CFM A;  3K7U C;  4OXP A;  4YCW A;  2ZTC A;  4GLA C;  1G29 1;  1YHA A;  2N3S A;  4KHZ A;  2UUB Q;  2K5H A;  4DR6 L;  1L2F A;  1MJE A;  3HOY G;  1PVO A;  4APV A;  2HIX A;  2E5L Q;  3BZC A;  1PYS B;  5IYC H;  1YHQ A;  2OWO A;  2NN6 I;  3M4P A;  1HZA A;  5M3M G;  1XTD A;  3CQZ H;  4GN3 B;  2R92 G;  2UUA Q;  4IFD I;  1S3O A;  1ASZ A;  1CUK A;  1B8A A;  4A3J H;  4NXN Q;  1HNW L;  4JI8 Q;  2AMC B;  3ULL A;  2FXQ A;  3NBH B;  1VQ9 A;  4YWM A;  4JYA L;  1U0L A;  3DM3 A;  1N34 L;  1IBM L;  4BY7 G;  5GAE C;  4HIK A;  2VZA A;  1K83 H;  5AJ3 Q;  1HNX Q;  1A62 A;  3CME A;  4AYB E;  3NEN A;  5FLX c;  1CKO A;  4JI5 Q;  3OW2 A;  4C3I H;  4B3T Q;  1N8R C;  2YTY A;  3RR5 A;  3PO2 G;  1AE3 A;  4UPA A;  4R1J A;  4IFD J;  2RF4 A;  5IP9 G;  3AYH B;  1HNZ L;  1YJN A;  3W1B A;  2GVB A;  4DR7 Q;  3G4S A;  3RLO A;  4JI0 Q;  2HT1 A;  4B3S L;  4IPD A;  4YY3 L;  2PQA B;  4DV4 Q;  1I6H H;  4YWL A;  1C7Y A;  4X64 L;  4A75 A;  3M3Y H;  1EYG A;  1PH6 A;  4QJF A;  2NVX H;  3GD7 A;  2EQS A;  3AEV A;  1VQ5 A;  4WJ4 A;  4X62 Q;  3SGI A;  1PH4 A;  2WAQ E;  3I56 A;  2ASB A;  2JA7 G;  4IOA A;  1EIY B;  1VQC A;  5HY6 A;  1OTC A;  2K52 A;  2E2I H;  2JA5 G;  1UEB A;  4UY8 C;  1XNR Q;  1GKH A;  1KIX A;  3PUY A;  3HOY H;  2MFI A;  4MZ9 A;  2PNH A;  3PF5 A;  3PSI A;  4DV3 L;  1E7Z A;  1M1K C;  1V1Q A;  1KD1 C;  1YJW A;  3J7Z C;  1EWI A;  1SN8 A;  1VQP A;  3F8T A;  1V43 A;  5M3M H;  1QVF A;  2OQK A;  4DV7 Q;  1QUQ B;  2F4V Q;  1V9P A;  5GAH C;  2R92 H;  2KEN A;  3G48 A;  2VS1 A;  4PZ7 A;  1HZB A;  3HOX G;  4B3M L;  4A3D G;  2NZO A;  4GKK L;  3CC4 A;  1TWG H;  2Y0S G;  2Q2U A;  4JBW A;  2NVY H;  3M7N A;  1HR0 Q;  3LGJ A;  4GS3 A;  2ID0 A;  1SRO A;  4DUZ Q;  3ULP A;  3F2D A;  3TEH B;  2ZM6 Q;  4K0K Q;  1P16 A;  5IE8 A;  1K9M C;  2UUB L;  1A63 A;  4QGU A;  3OTO Q;  4HJ8 A;  1WYD A;  5IP7 G;  1QZG A;  2E5L L;  1IBK Q;  3PO2 H;  3STB D;  4X65 Q;  4LFB Q;  4POF A;  1YZ6 A;  4LF6 Q;  4A3C G;  3JC6 6;  2PQA A;  1E22 A;  1BBW A;  2ZJR A;  4GNX A;  1VCI A;  2UUA L;  2JEA I;  1X55 A;  3H3V H;  1IBL Q;  1SR3 A;  1YHB A;  2Z0S A;  3K8A A;  1PH5 A;  1B7Y B;  2N78 A;  3CD6 A;  4AYB G;  1BVS A;  4JI8 L;  3KJO A;  3CPW A;  2VQE Q;  2R93 G;  2UXB Q;  2IY5 B;  5C4X G;  3H3V I;  4BA2 I;  1RL2 A;  1WOC A;  3EIV A;  3RLF A;  2YU9 H;  4UP9 A;  4YWK A;  2JA7 H;  1PH1 A;  5IT9 c;  5AJ3 L;  1DGS A;  1X54 A;  3S24 A;  1HNX L;  4YHH L;  4WJ3 M;  3S1Q H;  4JI5 L;  3VDY A;  3TRE A;  1VQG A;  2BA0 A;  3PUX A;  3PUW A;  5C3E G;  1VQA A;  1KQS A;  4B3T L;  4HIM A;  2Z6K A;  2EXD A;  1Q7Y C;  2R7Z H;  1N32 L;  1LTL A;  1NTG A;  3MXN B;  3UDX A;  4EQ5 A;  5M3F G;  3ICE A;  4IPH A;  3GTL H;  4DV2 L;  3HOV G;  2WFW A;  1KXL A;  4DR4 Q;  4DR7 L;  2PMZ E;  2WAQ G;  3G71 A;  3RZD H;  1PHJ A;  2C35 B;  5ELN A;  4GN5 A;  2UUC Q;  4DV4 L;  1D7Q A;  4DAY B;  4X66 Q;  3HOX H;  1NJI C;  1FVI A;  1HH2 P;  4A3L H;  3FP9 A;  4DAM A;  4X62 L;  1EQQ A;  2YTV A;  4DV5 Q;  2K50 A;  4DR3 Q;  1GD7 A;  3KF8 B;  1A8V A;  1Z9F A;  2K5N A;  3KDF A;  3W1G A;  1VQ4 A;  1XMO Q;  4BBS G;  3G6E A;  4XIG S;  4LF5 Q;  1N33 Q;  3GTQ H;  4C2M H;  4R4Q A;  3CCE A;  4OON A;  1PH2 A;  1K8G A;  4GOP C;  4A3F H;  1N9W A;  2EIF A;  3S2H H;  2L15 A;  5IP7 H;  4LNQ A;  3CCU A;  2VUM G;  1PH7 A;  2BA1 A;  1Y1V G;  4GOP B;  1YVC A;  4IJL A;  2H5X A;  3K0X A;  2VL6 A;  3T1Y Q;  4BXX G;  4MNO A;  4KI0 A;  4BY1 G;  4A3C H;  1VQL A;  5FJ8 G;  4DV7 L;  2F4V L;  5K36 G;  3FKI G;  4DV0 L;  3E9H A;  2AHO B;  2RHQ B;  3PIP A;  2Y0S E;  2JA6 G;  1TWF H;  5EAY A;  1K8A C;  2R93 H;  3K81 C;  1EQR A;  5C4X H;  4DUY Q;  3CCL A;  1WI5 A;  1Q12 A;  3T1H L;  3EBE A;  3WWV A;  2QA4 A;  2D0P A;  3JAM i;  4YCV A;  2N8N A;  4P73 A;  3ZJY C;  1FJG Q;  1OXX K;  1Y14 B;  3S2D H;  4K0K L;  4IO9 A;  3RN5 A;  1VQK A;  1E1T A;  1PFS A;  4L5T A;  5GQO A;  2GN5 A;  2JA9 A;  5C3E H;  3E9I A;  1X9N A;  3GTP H;  1C0A A;  1NMF A;  1IBK L;  2I5L X;  4HID A;  2B63 G;  2JQO A;  3ERS X;  4X65 L;  4LFB L;  4LF6 L;  2HHH Q;  2CCZ A;  4P74 A;  1K3R A;  4JV5 Q;  4LF8 Q;  4LF9 Q;  4NB3 A;  3A5Z B;  3CCV A;  1RIP A;  3S14 H;  3JAM c;  3U4Z A;  5M5X H;  3CCS A;  3RZO H;  2AWN A;  4PG3 A;  1AE2 A;  3EN2 A;  3F1Z A;  4A3M H;  4OO1 G;  1VQB A;  3PO3 H;  4KLK A;  5M5W H;  4BBS H;  4LFA Q;  4GOP A;  1XMQ L;  5FLM G;  5GAD C;  2QEX A;  4DR5 Q;  3UDI A;  3KF6 B;  1YI2 A;  2JK8 A;  3AFQ A;  3B6Y A;  3HKS A;  4NPS A;  1GVP A;  5LMU Q;  4A3K G;  3PCO B;  5BR8 Q;  1VQH A;  2VUM H;  4X6A H;  3KOJ A;  1IL2 A;  4MTN A;  4R4T A;  1B70 B;  3CMA A;  2BH8 A;  4DR4 L;  4OWX B;  4R4O A;  4L5R C;  2A8V A;  1X65 A;  4BA1 I;  2CKZ B;  3CAM A;  3FKI H;  1XNQ Q;  4C3J H;  1VQ8 A;  1MKH A;  4X66 L;  1X3E A;  2JA6 H;  1OXV A;  4P75 A;  1CSP A;  3PF4 A;  5C0X G;  1WFQ A;  2OQ0 A;  1XMO L;  1VQ7 A;  2GVA A;  2D0O A;  3L7Z C;  5JEA G;  4JI6 Q;  4LF5 L;  2AWO A;  5IYB G;  1N33 L;  5H1S E;  5JJK A;  3GDE A;  3UE0 A;  3NEM A;  1X3G A;  4LF4 Q;  3I4N G;  2B63 H;  3T1Y L;  3RLN A;  2WB1 E;  4BY7 H;  1EIF A;  1U5K A;  2R6G A;  4LF7 Q;  1CKN B;  2R7D A;  2RHS B;  3CPF A;  1BKB A;  4YCU A;  3HOU G;  2HQL A;  1NMG A;  2Q2H A;  2ALY B;  3H0G G;  2BH2 A;  4DUY L;  1YEZ A;  5IP9 H;  3TRZ A;  1C9O A;  1W3S A;  3KF6 A;  4DNI A;  5JJL A;  3F2B A;  3I4M G;  2LXJ A;  1UWV A;  3PIO A;  1WCM G;  1FJG L;  2YYZ A;  5M5Y H;  2CWP A;  3AQQ A;  1M90 C;  4NXN L;  1K0R A;  3PV0 A;  1IXR A;  4GLV B;  1NE3 A;  2VQF Q;  2IX0 A;  1KHI A;  4DK3 C;  3J81 i;  2NVQ H;  2HHH L;  2DGY A;  3GTK H;  3M4O H;  3J80 i;  4JOI C;  2RCN A;  1Y1W G;  1Q82 C;  1S40 A;  5IYD G;  4GN4 B;  3L2P A;  2D62 A;  2JA5 H;  4LF9 L;  4A3G G;  4JV5 L;  2VW9 A;  4NXM Q;  1N36 Q;  3TS0 A;  4AIM A;  4Y7N H;  1QUQ A;  2F52 A;  4LUZ A;  2UU9 Q;  1J5E Q;  4A76 A;  2HIV A;  4UP7 A;  4LUO A;  4DKA C;  4JI1 Q;  1PH9 A;  3GTO H;  3CW2 C;  5C44 G;  1XPO A;  5LMN Q;  1TWH H;  1SRU A;  4L5Q A;  4JI0 L;  5C0X I;  5IYC G;  4DR5 L;  3J81 c;  2K75 A;  4FDB A;  4HJ9 A;  1W2B A;  2ZJP A;  2KCT A;  1TWA H;  3NEL A;  3J80 c;  1I3Q H;  2K4K A;  4A3E G;  4IFD G;  4QQB X;  3I2Z A;  2KCM A;  1X3F A;  1MJC A;  1OXU A;  1S72 A;  2VY3 A;  4B3R Q;  4AQY Q;  4A3J G;  3BU2 A;  5C4J H;  4GLX A;  1VQO A;  4X64 Q;  3Q8D A;  1XNR L;  3BJU A;  1XNQ L;  4JI2 Q;  1VQD A;  3M9B A;  2MO0 A;  1I94 Q;  4L5S A;  3HOU H;  4A93 G;  4LWC A;  4POG A;  2UXD Q;  1VQI A;  1LM0 A;  1Q1B A;  1Q46 A;  5GAG C;  1QVC A;  4O0A A;  2MQH A;  2PI2 E;  2I0Q A;  1HZ9 A;  1TWC H;  2I5H A;  3I4O A;  4JI6 L;  2WB1 G;  3I4M H;  2Q2T A;  1WCM H;  4DR1 Q;  2MNA A;  4C3H H;  2KHJ A;  2PI2 A;  1VQF A;  1K73 C;  3CCR A;  1JT8 A;  4JBJ A;  4LFC Q;  4LF4 L;  1LUZ A;  4P71 A;  2JA8 G;  4A3B G;  3J7A 5;  4A3D H;  1VS0 A;  3U58 A;  3H15 A;  1SE8 A;  1HR0 L;  1HJP A;  4H02 A;  4EX5 A;  5IWA Q;  3A0J A;  4DUZ L;  1E1O A;  4HJA A;  2OTJ A;  4LF7 L;  2ZM6 L;  1YIT A;  4B3M Q;  3S15 H;  2WP8 J;  1Y1W H;  3K7A H;  2UXC Q;  3HKZ G;  2MO1 A;  3OTO L;  3IRB A;  3DLL A;  1JB7 A;  3D31 A;  1P8L A;  4HJ5 A;  2OCE A;  1NBW A;  1Q81 C;  5M3F H;  1XPU A;  5J3B A;  4JCV E;  4QY7 A;  1Q1E A;  3HOV H;  3HOZ G;  1AH9 A;  2XTI A;  3HFZ B;  5C44 H;  2R7F A;  4OWW B;  5HGQ A;  4JG2 A;  3I7F A;  4ALP A;  4OWT B;  1PV4 A;  1IZ6 A;  1IBL L;  1OXT A;  2VQE L;  2UXB L;  1UE6 A;  1Q8K A;  3UDG A;  1LYL A;  4A3E H;  3HOW G;  3KLW A;  3PUV A;  2NVT H;  3FHW A;  4R4I A;  2VQF L;  1PA6 A;  3CC7 A;  1YJ9 A;  4GKJ Q;  1XPR A;  1SLJ A;  1YBY A;  3M4Q A;  3GTJ H;  2YV5 A;  4NXM L;  3KJP A;  1VQN A;  1N36 L;  4A93 H;  3CXC A;  1A0I A;  4TVA B;  3S1N H;  1N32 Q;  1Y1V H;  1H95 A;  2UU9 L;  4IJH A;  5DLQ E;  3W5O A;  3CCQ A;  1J5E L;  2E2J H;  1EUJ A;  1I50 H;  1X56 A;  4JI1 L;  4YHH Q;  4BY1 H;  1E24 A;  1JE5 A;  2LXK A;  2JJQ A;  5LMN L;  4DR2 Q;  4BXX H;  3CCJ A;  1SFO H;  5FJ8 H;  1QVG A;  1PYB A;  4LUV A;  3S1M H;  2UUC L;  4DK6 C;  2KBN A;  3A5U A;  3CC2 A;  4JI7 Q;  4LW1 A;  4DV2 Q;  4JI3 Q;  3S16 H;  2K5V A;  1MIU A;  1VQJ A;  1WJJ A;  1SMX A;  1X6O A;  1YIJ A;  2JA8 H;  3AFP A;  5IY0 A;  4DV5 L;  1HR0 W;  4DV1 Q;  4DR3 L;  4A3B H;  4B3R L;  4AQY L;  4GNX C;  3I55 A;  3PUZ A;  3RNU A;  2KHI A;  4GNX B;  4JI2 L;  1I94 L;  4UP8 A;  4JI4 Q;  4KHP Q;  1BBU A;  1NY4 A;  2UXD L;  4QIW E;  4DPG A;  2NZH A;  2OTL A;  1VQE A;  1R9T H;  4JBK A;  1ASY A;  4A4I A;  4OX9 Q;  3HOZ H;  1UE7 A;  2A1A A;  2AKW B;  4P72 A;  4DR1 L;  2R7Z G;  1VQM A;  2DUD A;  2E8G A;  2IT1 A;  2IHE A;  3OYY A;  4IPC A;  4DV6 Q;  3S1R H;  2Z6K C;  4LFC L;  1Q86 C;  4A3I G;  3F2C A;  1FL0 A;  2IX1 A;  3HOW H;  4IPG A;  5IWA L;  4DV0 Q;  2ES2 A;  2JEB I;  4DR6 Q;  1O7I A;  4HIO A;  3HKZ E;  2IHF A;  1PH8 A;  3ULJ A;  2B3G A;  1UE1 A;  1Z47 A;  4A3L G;  5FLM H;  2UXC L;  4Y52 H;  4OO1 I;  3UDF A;  4A3K H;  1OXS C;  3T1H Q;  1CKM A;  3D0F A;  3TQY A;  4BBR G;  3J81 j;  4A3F G;  1HNW Q;  5LMN W;  1UE5 A;  3MEF A;  4XTC S;  3KDF B;  4LF8 L;  4ME3 A;  1VQ6 A;  3BZK A;  1KC8 C;  1KL9 A;  4JYA Q;  5JJI A;  4JBM A;  3CP0 A;  4J15 A;  3PGZ A;  2F3I A;  1IYJ B;  1N34 Q;  3UE1 A;  1IBM Q;  4JC0 A;  1L1O C;  1TXY A;  1YNX A;  3U4V A;  3ER0 A;  2N49 A;  4RMF A;  1L1O B;  4RG1 A;  3M85 A;  1GM5 A;  2I5M X;  2NN6 G;  4GKJ L;  1KRS A;  2ZTE A;  4O2D A;  4LFA L;  5IYB H;  3S17 H;  2VNU D;  3RN2 A;  1JJG A;  4QL5 A;  4IOC A;  1EFW A;  3KYH C;  5LMU L;  1CKN A;  5BR8 L;  1HNZ Q;  1L0W A;  2V1C C;  2ZTD A;  3I4N H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...