4KHPL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
125
structure length
125
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4khpL00
1LUZA 3J7ZC 2NZHA 3VDYA 1Y1VH 4OO1G 4PZ6A 3T1YQ 4RMFA 1KHIA 3J80i 4DR3L 1XNQQ 1WI5A 4A93H 2IT1A 5GADC 4JOIA 3KF6A 2A8VA 3I4OA 1PH1A 3F8TA 3CCUA 1I50H 4O2DA 2I5HA 5HY6A 1L2FA 4JYAL 5M3MH 1KD1C 2ATWA 2Y0SE 3S14H 4UP7A 2QA4A 1NTGA 1UE1A 4X66L 1IYJB 2UUCL 4JI3Q 2JE6I 4IPGA 4LUZA 5C0XI 3UE0A 4DR1L 2A19A 4MZ9A 1YVCA 1YJ9A 3K80C 4IPHA 4HIDA 1M1KC 4C3IH 1IBLQ 1A8VA 1BKBA 1NY4A 1EFWA 1UE7A 1XPOA 4KHPQ 3EN2A 4A3DG 2QEXA 3TS2A 4UP8A 3UE1A 1SE8A 2F4VL 5JEAG 3GTMH 3PO2H 4YWMA 5LMNQ 4R4TA 3HOWH 3PV0A 4GLAC 4LFCL 1K8AC 1A63A 1N33L 4LFCQ 2R6GA 3PO3H 1VS0A 1Q12A 1S72A 3GDEA 1X3GA 1N34L 3U58A 1CSPA 5M5XH 5C3EG 4DV4Q 2XTIA 4AYBG 1X54A 1VQ8A 1K83H 5FJ8G 2IX0A 2JJQA 4GKKQ 5E7NA 4RG1A 2CQOA 4OWTB 3E9HA 2OCEA 1HR0L 1MJCA 3H0GH 3RLFA 1IBKQ 1HR0Q 1VQOA 4LWCA 1S40A 1NMFA 4H02A 1JJ2A 1G291 3I4MH 1P16A 1O7IA 2E2JH 2UXBQ 1N36Q 3ZJYC 3ULLA 3T1HL 1HJPA 4LNQA 3JC66 3NELA 2JA5H 3HOVG 1VCIA 2E5LL 2K5HA 4A3MH 2VQFL 1XPUA 1SMXA 5K36G 4R4QA 3CC4A 1IXRA 3CCMA 4DV0L 1CKNA 3A0JA 1NE3A 4NXMQ 2JA6H 4IFDJ 4Y52H 1DGSA 1OXXK 1E1TA 2MNAA 1IBML 1VQ7A 1UE5A 3JAMi 1YHQA 1VQHA 4OWWB 3KJOA 3PUVA 2HT1A 4IOAA 3K7UC 3CCSA 1X55A 4DR6Q 2D62A 4BBSG 2ES2A 1YHBA 3CMAA 3CPWA 3HOUG 4XTCS 3ER0A 2VY3A 2IHEA 2YU9H 4DV7L 4BBRH 2NVXH 4A3IG 1FVIA 4YWKA 3AEVA 4JI8Q 2K52A 2AWNA 2AHOB 3STBC 4A4IA 4ALPA 2NVQH 1E7ZA 1Q1EA 4OWXB 3HOXH 1Y14B 1Q8KA 5IE8A 4LFBL 2KBNA 3G4SA 1KRTA 1GM5A 4DV6Q 2OWOA 3GTPH 3TEHB 3ULPA 3NBHB 4GOPA 1ASZA 3FHWA 2DUDA 5FLMG 1PH9A 3F2CA 2EIFA 3BJUA 4A3CG 1UEBA 4O0AA 4OXPA 4YWLA 3RN5A 1HNXQ 4JI1L 3A5UA 2YTYA 1OXUA 2A1AA 2UUBQ 4JI1Q 4QGUA 3B6YA 4GNXB 3A5ZB 1RIPA 4LF9L 4X65L 1N32Q 3UDGA 2NN6I 4MNOA 4X65Q 4DUZL 4YY3L 4HJAA 1JMCA 3OTOL 1Y1WG 3HOYG 4DR7L 4LF4L 2WP8J 4IPCA 2MFIA 4GKJL 2UUAQ 1EIFA 4LF4Q 1VQMA 4A3DH 4IFDG 4DV2L 1NMGA 4Y7NH 4AQYL 1Z9FA 4IJHA 5GQOA 3HOZG 4APVA 4DV2Q 4AQYQ 1EOVA 2N49A 4FDBA 1X56A 2UXDL 3STBD 4WJ4A 3K8AA 4B3ML 4IJLA 1PH7A 1WFQA 1XMQL 2Q2UA 3H15A 4B3MQ 1W3SA 1XMQQ 1VQ6A 3GTQH 2HIVA 3HKZG 1Z47A 1FGUA 3G71A 1C9OA 1CKMA 4A3KG 3M4OH 4HJ8A 3T1YL 2CKZB 3M7NA 1V9PA 1XNQL 1PH6A 5IYDH 5C3EH 1VQKA 4B3TL 1A0IA 3AYHB 4P72A 4NXNL 3G6EA 4B3TQ 5FJ8H 4NXNQ 1FJGQ 1PH4A 3FKIG 4P73A 3F2DA 4AH6A 2N3SA 4R4IA 2R7ZG 2RHSB 2NZOA 4TVAB 1B7YB 4DV5L 2R7FA 4DAYB 1L1OB 4JI3L 1QVCA 2KHJA 1J6QA 1SRUA 3I2ZA 4TQUS 5M3FG 4DV5Q 2E5LQ 1MKHA 4LF7L 1G6PA 4JI5Q 3OYYA 1KIXA 1IBLL 4QQBX 1YBYA 4LF7Q 2E8GA 4A3FG 4JI7Q 4DR4Q 2K5VA 1SROA 3S1NH 4KHPL 3AQQA 4AYBE 1UWVA 1Q7YC 1K0RA 2VNUD 3HFZB 3J81c 1PYBA 3UDIA 1VQCA 1KXLA 2E2HH 3HOVH 1YHAA 4GNXC 4WJ3M 2PQAB 3A74A 1WJJA 3LGJA 5LMNL 3J80c 2GVBA 4P74A 3M3YH 4A3GG 2BA1A 2K50A 2WB1E 1GVPA 5FLXc 2C35B 3U4VA 3CMEA 4POGA 4GN4B 2IY5B 4DK3C 5C44G 1T9HA 3E9IA 4MTNA 3PGZA 3CF5A 4DV4L 1Q1BA 4JBWA 1HNZQ 1D7QA 4X64Q 1OXVA 4BBSH 1IZ6A 1GO3E 2ZM6Q 3CP0A 1QZGA 2N78A 4LF6L 1TWFH 1YJWA 4BY1G 3I4NG 4GKKL 3HOUH 4KI0A 3MXNB 1PH3A 4LF6Q 4HIMA 1B8AA 1VQPA 2R92G 2WAQG 4LF8L 4A3LG 2MO1A 4DPGA 1IBKL 5C4XG 3FP9A 1I94L 4LF8Q 4GNXA 1QUQA 2OQKA 1I94Q 2CFMA 3M4PA 5AJ3Q 1WCMG 2UU9L 4C3JH 3S1MH 5IYBG 2V1CC 2UU9Q 4L5RC 5IP7G 1A62A 3KYHC 4JI2Q 2CWAA 1TXYA 4HJ5A 3CXCA 1N36L 2UXBL 2BH8A 3Q8DA 3AFQA 5FLMH 4YHHL 4KLKA 4POFA 1ASYA 1WOCA 5EAYA 4YHHQ 2JA8G 1GKHA 4JI6L 3CCRA 1PYSB 1L1OC 4DV3Q 2F52A 2VZAA 1CKOA 4JI6Q 3H3VH 1RL2A 3RLNA 4NXML 1YI2A 4DV1Q 5JJLA 1X9NA 1MIUA 4HJ9A 1V1QA 1X65A 2Q2TA 1TWCH 4GN5A 1JB7A 2NVYH 3GTGH 1I6HH 2R93G 3CCJA 1HZAA 1Y1WH 3HOYH 1HNWQ 3CCLA 4BA1I 1HZCA 4DR6L 1VQFA 3KFUA 4K0KQ 1XJVA 4LF5L 1YEZA 4LFAQ 3W1BA 3RNUA 3J7A5 3SGIA 3HOZH 4LF5Q 1TWGH 5IYCG 3D31A 1LM0A 1VQNA 2KCTA 4PZ7A 3KF6B 2JEBI 2ZJQA 4JI8L 2PI2E 5C0XJ 3IRBA 2PNHA 2K75A 3CQZH 4QL5A 2UXCQ 1SR3A 3WWVA 2IHFA 4GLXA 4JBKA 1L1OA 2EXDA 2LXKA 2RF4A 1VQGA 3KF8B 4DAMA 5HGQA 4JBMA 1IL2A 4DV6L 4A3KH 2NVTH 2JA7G 2E2IH 2JEAI 3CCVA 1YJNA 4X62Q 3BU2A 1JE5A 1X3EA 2VS1A 4GS3A 1E1OA 2N8NA 2PMZE 1V43A 3PUWA 3JAMc 1HNXL 3S15H 2VUMG 3FKIH 2PQAA 4R1JA 2OTJA 2UUBL 4L5QA 2AWOA 2KCMA 2ASBA 2RHQB 1GD7A 3CPFA 4HIKA 3OW2A 5GROA 1N32L 2Q2HA 1I5FA 5M3FH 4P75A 3RR5A 2K4KA 1KL9A 3L2PA 3TQYA 3M85A 4A3FH 3ULJA 3DLLA 2UUAL 1KQSA 1HH2P 5IP9G 4UP9A 1KC8C 4C2MH 3I4MG 1UE6A 3M4QA 1SLJA 4DNIA 1HR0W 4QJFA 2I5LX 2VQEL 1WYDA 2HHHQ 2IX1A 4P71A 1G51A 2ALYB 2Z6KC 3PIOA 2CWPA 2VQEQ 1TWHH 5LMUQ 2WFWA 4DUYQ 3GTKH 3CW2C 4A3GH 4B3RL 3PUYA 3ICEA 1PFSA 4A3EG 2HQLA 1PV4A 1XMOQ 2MO0A 4B3RQ 2I5MX 5H1SE 4IOCA 3K0XA 4K0KL 2JA6G 3I55A 2YTVA 4NB3A 5ELOA 5IWAQ 1Q82C 5C0XG 3AFPA 1P8LA 2F3IA 1S3OA 1PH2A 2B63G 1EUJA 2K14A 1J5EL 4JC0A 4DR5L 4LUOA 2ZJPA 1FJGL 3I4NH 1KAWA 2JK8A 4DR5Q 1J5EQ 4PMWA 4L5SA 1XNRL 2R92H 3TREA 4A3LH 4KHZA 1XNRQ 5JJIA 1VQ4A 1NJIC 4BXXG 1N8RC 4L5TA 5C4XH 1VQDA 1U5KA 1R9TH 2BH2A 1BVSA 4ME3A 2MQHA 4JI5L 1QVFA 1WCMH 1CKNB 3MEFA 3KJPA 1PH8A 4IPDA 5BR8Q 4JI7L 4DR4L 5IP7H 2FXQA 3UDXA 4GN3B 2CCZA 3F1ZA 1E24A 1I3QH 2YTXA 3L7ZC 4C3HH 2ZJRA 1SFOH 3GD7A 1W2BA 4YCUA 2YV5A 3PUXA 1L0WA 4IFDI 4JV5Q 1AH9A 3KDFB 5IT9c 2JA8H 4B3SL 1CSQA 4A3JG 4BY7G 1QVGA 2WAQE 4BA2I 4B3SQ 1EQQA 4DR3Q 2ZTDA 3S24A 3PF5A 1Q86C 1OXTA 3KOJA 3J81j 3I56A 1JT8A 1JJGA 1C7YA 2R93H 4LUVA 1E22A 4DK6C 4JYAQ 1AE3A 1HNZL 4X64L 1XTDA 1OTCA 3M9BA 2VW9A 4OO1I 2H5XA 3U50C 4X66Q 3K7AH 2ZM6L 2UUCQ 2R7DA 4DR1Q 2AKWB 3W1GA 4GOPB 3S17H 5IYCH 2BA0A 3E0EA 2I0QA 3I7FA 4A3IH 3RLOA 2KHIA 4UPAA 5AJ3L 4J15A 4PZ8A 2F4VQ 2VL6A 4A3BG 4NPSA 4JI2L 2Y0SG 1N33Q 2JA7H 2QGQA 2LSSA 1M90C 2AMCB 4GLVB 1K73C 5IYDG 3CAMA 5M5YH 1N34Q 3S2DH 1Y1VG 1BBUA 4DV3L 4A3CH 4JBJA 1CUKA 2VUMH 1TWAH 4QY7A 1YZ6A 4A93G 2OQ0A 4DV1L 5GAEC 3BZCA 1KRSA 1Q81C 1EYGA 3S1QH 4JG2A 2EQSA 3EIVA 5M3MG 1HNWL 3PF4A 2GVAA 4YCWA 1QZHA 2WB1G 5GAGC 2RCNA 1X6OA 3HKSA 3CD6A 2K5NA 3EBEA 1AE2A 1B70B 2JA9A 5IP9H 4EQ5A 4HJ7A 4LFAL 3W5OA 2ZTCA 1NBWA 4JI4L 3BZKA 3NENA 3CC2A 3RZOH 1EIYB 5C4JH 1LYLA 4JI4Q 3T1HQ 2ZTEA 1H95A 2XGTA 2UXCL 1VQ9A 3PO2G 2LXJA 4A3EH 3HOWG 4PG3A 2VQFQ 5DLQE 2OTLA 2KENA 4DV0Q 4GOPC 4X62L 4R4CA 3PO3G 2NN6G 1SN8A 1U0LA 3ERSX 3UDFA 5LMNW 1IBMQ 3S2HH 1K8GA 2B63H 3KDFA 4A75A 4YCVA 3F2BA 1XPRA 2D0OA 1YITA 5IY0A 5GAHC 1MJEA 3GTLH 2R7ZH 4BXXH 4DR2L 4R4OA 1EWIA 5J3BA 3HKZE 4DV7Q 4DR2Q 3D0FA 3H0GG 4XIGS 1OXSC 4A76A 2Q2IA 3PSIA 2L15A 2DGYA 1PA6A 4JI0L 3TRZA 2Z0SA 4JI0Q 4IO9A 1VQLA 1JJCB 4LFBQ 2B29A 2HHHL 2PI2A 3PCOB 3GTJH 4A3JH 4BY7H 1C0AA 1PVOA 3CC7A 5LMUL 4DUYL 1VQ5A 1D8LA 2HIXA 1K9MC 2JA5G 1E3PA 1EQRA 1XMOL 5ELNA 4A3MG 1HZ9A 1YIJA 2B3GA 3GTOH 4OONA 1PHJA 3K81C 1QUQB 4QIWE 3U4ZA 1FL0A 1PH5A 2ID0A 5IWAL 4HIOA 1K3RA 5C44H 3TS0A 4DKAC 3PUZA 4LF9Q 2D0PA 1BBWA 5JEAJ 4DUZQ 4JOIC 4YY3Q 1VQIA 1X3FA 4LW1A 3OTOQ 4UY8C 4DR7Q 1VQAA 4BY1H 3CCEA 4GKJQ 3S1RH 4AIMA 3PIPA 1VQBA 3GO5A 5M5WH 3H3VI 3NEMA 3RN2A 3L0OA 3G48A 1VQEA 3CCQA 1VQJA 1N9WA 4BBRG 3RZDH 1LTLA 1HZBA 4OX9L 5BR8L 4A3BH 2UXDQ 2Z6KA 4OX9Q 5IYBH 4EX5A 1Q46A 3S16H 5JJKA 2GN5A 3J81i 3HOXG 3KLWA 1YNXA 3DM3A 4X6AH 2JQOA 2YYZA 4JCVE 4JV5L
chains in the Genus database with same CATH superfamily
1CHPD 2Z6BA 3BZDB 3VDYA 4PZ6A 1MHWC 1XNQQ 1WI5A 1E0BA 1PMRA 4G57A 1G2TA 4ZUJA 4JW0A 3CCUA 1I50H 1SYCA 2I5HA 5M3MH 1EFID 2SNSA 5FO9B 2QA4A 1NTGA 4X66L 1W6KA 4M8AA 5CGKA 2KHSA 2JE6I 5C5MA 3K80C 4IPHA 1M1KC 1EFWA 1UE7A 1XPOA 4RHSA 4EVOA 2QEXA 3TS2A 4UP8A 4X3UA 3ITPA 5C3XA 1Q90A 5JEAG 1Y8OB 4LFCL 1K8AC 3WOEA 1II3A 2F0WA 3I4MB 1JICA 2R6GA 2NN6H 1EWHA 1VS0A 3IFTA 1S72A 1X3GA 1X32A 4ZCKA 3U58A 4DV4Q 1LTTD 4KKUA 1DXMA 1X54A 5FJ8G 1ENFA 4GKKQ 4RG1A 1RCVD 5IT9L 1HR0L 1NUCA 1VQOA 4LWCA 1JJ2A 1G291 3I4MH 1P16A 1O7IA 2UXBQ 4LAAA 2OT2A 3ZJYC 3T1HL 1V1PA 1HJPA 4K6DA 2NVQB 2JA5H 1LO5D 4G7OC 2Q8RE 1XPUA 2B2YA 4R4QA 2FMMA 3CC4A 1IXRA 3GQBA 3P20A 1NR2A 1T5EA 1E1TA 1FNWA 2M9VA 2XSCA 4RA8A 4A3JB 1VQ7A 4BY7B 2C5CA 1SNMA 5I6WA 4KMUC 3KJOA 2HT1A 4R9WA 4I7AA 1X55A 4DR6Q 2D62A 5IGCA 3Q22A 3CMAA 3CPWA 3HOUG 4XTCS 4DV7L 1FVIA 4YWKA 2NVQH 1HFNA 4KD4A 2WKCA 3HOXH 4C3JG 2KBNA 3G4SA 1M4VA 2B2UA 3ULPA 3NBHB 4IURA 3FHWA 2DUDA 5FLMG 4KV6A 1UEBA 4O0AA 2Y0SB 1SBBB 4JI1L 3A5UA 1HNXQ 2OXPA 4RHRA 2A1AA 4RKBA 4DNTB 2HQEA 3B6YA 4GNXB 1PTOH 3A5ZB 4RGOS 5CV8A 1O7LA 2Q8IB 4IUQA 3S9WA 4YY3L 3OTOL 4HSPA 2ENBA 4GKJL 4V190 1PXUA 1ENAA 4B9WA 4IFDG 4DV2L 5GQOA 1EOVA 5JEAH 2WB1B 4WJ4A 2QDBA 5EQ0A 5J39A 1W3SA 4C3IB 5D65A 2HIVA 1Z47A 4KKSA 2CKZB 3T1YL 3GTMB 1A0IA 4P72A 3HOWB 4B3TQ 5FJ8H 1L0YB 1ET9A 1PZKD 4FXKC 4R4IA 3H09A 4DAYB 1L1OB 2KHJA 1SRUA 5M3FG 4DV5Q 1MKHA 2DNCA 2L55A 1FNUA 2F3VA 3DEPA 4LF7Q 3EFXD 1SROA 2EY2A 4AYBE 1K0RA 1PYBA 4NW2A 5J1ZA 2E2HH 1YHAA 4WJ3M 3A74A 2F0FA 3FPUB 3I4LA 3FVQA 3TBIB 3DWPA 2E2DC 1WTWA 3T16A 2G9DA 1PTOD 2AQ3B 5ELCA 4DK3C 3E9IA 4MTNA 1Q1BA 1EOTA 1HNZQ 1TS2A 3AU7A 5T1GA 1OXVA 3F2UA 4IUTA 1IZ6A 1GO3E 3BYYB 1A15A 1HQMC 3HOUH 4LF6Q 4ULLA 2WAQG 1I6HB 5JPMC 4DPGA 1IBKL 1AP0A 3FP9A 4LF8Q 2BE5C 1I94Q 4C3JH 2EJMA 1TWGB 4L63B 4HJ5A 1PZJD 1I4PA 4B9XA 4C1NI 4P2CB 3AFQA 4BBRB 5FLMH 4YHHL 3CQZB 2JA8G 5BN3A 4HMIA 5A35A 4DV1Q 3D4WA 1MIUA 2EY1A 4HJ9A 2F0NA 3IL8A 4Q5VA 1I6HH 1KLGD 2R93G 2IWHA 3CCJA 1YNNC 4BA1I 1VQFA 3U9OA 5LL6S 1YEZA 4LFAQ 4IFDH 1TWGH 1LM0A 2A73B 3KF6B 2PI2E 2CHBD 3CQZH 4EGVA 2PZUA 5COYA 4GLXA 2LXKA 3KF8B 5DM63 2F3WA 4DAVA 2SEBD 1B4OA 3J81E 3DUZA 2JA7G 1JE5A 1X3EA 1V43A 4MIUA 1ILQA 3JAMc 2L11A 2AWOA 5FLXE 5M3FH 4P75A 2HUGA 2QF7A 2J7ZA 1JOQA 3DLLA 2UUAL 5FOBB 1HH2P 2BDOA 4BS9A 3T56B 3P7JA 3V2TA 5IGFA 4P71A 2Z6KC 1LT5D 3PIOA 5LMUQ 4DUYQ 2K5QA 2IPKD 4B3RL 4CDCC 4OHJA 4A3EG 1SFOB 2JA6G 2YTVA 4NB3A 1WTOA 1PTOC 4K8JA 5C0XG 3AFPA 1S3OA 1PH2A 1EUJA 1TT2A 1J5EL 1DCZA 2ZJPA 4ZYSA 2EVBA 4L5SA 1D2BA 3TREA 5JJIA 4KHZA 1VQ4A 4BXXG 2MUYA 2HCIA 2PCFB 1LTBD 2PW5A 4JI5L 4N8X1 4JPBW 4IPDA 2XWBB 4DR4L 1RF2D 2FXQA 1TWFB 2CCZA 1SFOH 1I3QH 3L7ZC 3GD7A 4A3IB 3A8KE 2JA8H 1FGBD 1H9JA 5LL6X 1QVGA 4BA2I 3S1MB 2TSSA 3S24A 4G4KA 3J81j 3I56A 4IUUA 3MEHA 1JT8A 3D3RA 1JJGA 2IW3A 2R93H 4MTKA 4DK6C 1BO0A 4X64L 1XTDA 1BCPB 3TP5A 4X66Q 2FMCA 2WKDA 2NYZD 1I4QA 1J8IA 5EPKA 4J6HA 2NVYB 4A3IH 4F7XA 1KAAA 3HOYB 5AJ3L 1TS4A 2XRSD 5I4DA 1U4PA 2JA7H 3MFGA 2F0HA 1ZYRC 1A3TA 2J4XA 5JOBA 5M5YH 2I46A 1CUKA 1SYGA 2K01A 2RKSA 3HKZB 2AQ2B 4A3KB 1F9QA 2RDGA 4JG2A 1SYFA 3EIVA 1SE2A 1HNWL 1G8ZD 1ZEQX 2LMCB 4YCWA 3S15B 3FKIB 2K5NA 1AE2A 1B70B 4EQ5A 5DM73 3W5OA 2WIIB 1SE4A 1NBWA 3IAYA 4JI4Q 1LYLA 2IL8A 3KLSA 2ZTEA 4ZRZA 2IX3A 2XGTA 3T1HQ 2K1BA 2UXCL 2KEDA 4A3FB 3PO2G 4A3EH 4JVZA 4DAYA 1XX8A 3NPPA 5FO8B 1JCKB 5E3FA 5IT9E 3PO3G 5C0XH 1U0LA 3QG1A 3S2HH 1E2VA 4MHEA 4HCSA 4KTAA 3GTKB 4A75A 4YCVA 1EEID 5IY0A 4RAUC 1HQRD 4BXXH 3BDOA 4DV7Q 1PYWD 2K05A 3WOFA 1WTHA 3QO2A 1D5MC 1OO9B 1OXSC 2KUMA 4BY1B 2DNEA 3S1RB 3KBGA 1D5XC 1EQTA 1NSNS 2B29A 3EJIA 1CFMA 1R9TB 3T51B 1D8LA 3T13A 2HIXA 1K9MC 1BCPD 2DY8A 4A3MG 1HZ9A 2B3GA 3MA2B 4OONA 1PH5A 5EBCA 1BF4A 2CVRA 3PUZA 2EYOA 3DWQA 5JEAJ 4JOIC 3SVMA 5KGUA 4YY3Q 4XQNA 1VQIA 4LW1A 3OTOQ 4BY1H 1SNCA 4GKJQ 3S1RH 3PIPA 2F0SA 3NEMA 3S14B 3FRPB 1VQEA 1N9WA 3JAML 4OX9Q 1V1OA 2A69C 3S16H 1B3AA 1VDZA 1YNXA 3MC0B 2YYZA 2XN9C 1B50A 4JV5L 1GOZA 2NZHA 3HEJA 4OO1G 3T1YQ 1KHIA 4DR3L 3PO2B 4CHTB 4JOIA 3KF6A 3I4OA 4EQOA 1PH1A 3F8TA 2QEJC 3D4DA 5K5PA 3AMUA 4M1UB 3S14H 1CTMA 1DOKA 3L3OC 3RUZA 2XWJB 4IPGA 4LUZA 1W6JA 5CV6A 2EY5A 1QNKA 4HIDA 1NY4A 2LS01 3EN2A 4A3DG 1CZWA 2F4VL 3PO2H 3FEWX 4GLAC 1A63A 3PO3H 5I2XA 1Q12A 3EA6A 2FJ2A 3RZOB 1N34L 5C4JB 3VR6A 5C3EG 4A3MB 1CA5A 2NB0A 2XTIA 3R3OA 4AYBG 1EY9A 1K83H 2PQEA 5E7NA 1KDAA 1RKNA 2F0UA 1XXGA 3E9HA 2OCEA 1MJCA 5J22A 3RLFA 1IBKQ 1M8AA 1S40A 1NMFA 4ME5A 1D6EC 1B44D 5FLXL 2E2JH 4NP5A 5JAVA 1RTOA 4LNQA 3QB3A 3TSSA 2B2WC 3NELA 1U9RA 1QILA 4A3MH 3R93A 2B8GA 1S5DD 1NE3A 4IFDJ 5BN4A 3GTPB 1DGSA 1OXXK 1ICFB 1AW7A 3JAMi 1H9SB 1YHQA 3MFYA 1VQHA 1PFBA 3I90A 4IUNA 4BBSG 2ES2A 3GTOB 1MSHA 2VY3A 4PMBA 3AEVA 2B2WA 1VMPA 1Q1EA 2Z8LA 3PQIA 4OWXB 5CV7A 1Q8KA 1WTVA 4LFBL 4Y7NB 3TDQA 1QWYA 1KRTA 4ABNA 2A5HA 3GTPH 2M00A 5KNDA 1B1ZA 1SEBD 4TRDA 2EIFA 4A3CG 4OXPA 3RN5A 4YWLA 2YTYA 3GTQB 4QGUA 3TP7A 2JSOA 1A3UA 3UDGA 2NN6I 4DUZL 4X65Q 4F8MA 4IPCA 2KVMA 2XVSA 1EIFA 2UUAQ 4LF4Q 1I50B 4A3DH 2B8FA 4Y7NH 3HOZG 4AQYL 4IJHA 1JC7A 5M3MB 4APVA 2F03A 5CMDA 1MSGA 1GXDC 1X56A 2UXDL 1K8MA 1EY5A 2KCNA 5G3LF 4YIJA 3NP8A 1WFQA 4B3MQ 1XMQQ 4IZ8A 2BOSA 1VQ6A 3GTQH 2G9HD 1ILPA 1CKMA 5IYDH 1V9PA 5C3EH 3AYHB 2K5WA 3C3LA 4NXNQ 3VYUA 3F2DA 2NTTA 4C1NK 2R7ZG 1O7ZA 4TVAB 1B7YB 2L0CA 3VYSA 2E5LL 1J6QA 1G91A 4JI5Q 1PFMA 3WDNA 4KD3A 1KIXA 4QQBX 2E8GA 4DR4Q 4XXEA 3S1NH 4KHPL 5IGBA 4NMZA 4QUFA 1SNPA 1KXLA 3LGJA 3I3CA 2O4XA 1EU3A 3J80c 3CU7A 2GVBA 4A3GG 2BA1A 4CJ1B 4RGMA 1GVPA 4QUCA 3U4VA 1VF7A 3KLSX 4POGA 1LTSD 3CF5A 2JA5B 1D7QA 4JBWA 4X64Q 2DJFC 3K5OA 4UHVA 4BBSH 1BCPF 4RGNA 4OL7A 1HFGA 4KY6A 4KI0A 3MXNB 1B8AA 4UDUC 3HZXA 3GTGB 2D9UA 3HGBA 4DK1A 4I65A 3VR2A 2CFMA 3M4PA 5AJ3Q 2V1CC 2UU9Q 4L5RC 3HOZB 3KYHC 4QB4A 3CXCA 2BH8A 2H4OA 1JQYD 3PIP3 2F52A 2VZAA 1CKOA 3E0JA 4OEMB 1IKLA 1TY2A 1IW7C 3EROA 3RLNA 3HOXB 1STGA 4JI6Q 5JJLA 2K7VA 4Z9CB 1X65A 4GN5A 1ZXTA 2LY7A 3AB9A 4QCLA 3GTGH 1HZAA 1HNWQ 3CCLA 1F2ZA 2A6HC 4PNYA 5KYLA 3W1BA 3HOZH 3SGIA 4LF5Q 1PTOB 2KCTA 2JEBI 3SK4A 2ZJQA 5C0XJ 2PNHA 2BE5D 2N88A 2UXCQ 5DNFA 1HHVA 2RF4A 4RKLA 4CBVA 3VYTA 1E2WA 3R2IA 4DAMA 1LV9A 4JBMA 4C2MB 4FYDA 2E2IH 3VR3A 3BU2A 4ZLTF 4GS3A 1E1OA 1D1KA 2N8NA 1TWHB 3PUWA 3K5LA 5IGEA 2QKIC 2EYPA 4QMGA 4R1JA 2OTJA 4L5QA 3I73A 3C2PA 4HIKA 3C1EA 1X3PA 5GROA 3OW2A 1I5FA 5AFWA 3RR5A 1YNND 4KN4C 1O80A 2OF1A 1KQSA 2B2VC 5IP9G 4UP9A 4C2MH 5BN5A 1SLJA 1HR0W 2DJGC 1G51A 2ALYB 3MXPA 2VQEQ 1QG7A 2EY6A 1TWHH 4A3GH 3CW2C 3MWYW 1KABA 1PV4A 5H1SE 4IOCA 3K0XA 1U4LA 1ZKOA 3I72A 3I55A 2E2HB 5ELOA 1NAPA 2EE1A 4KK7A 1QJOA 1P8LA 1ENCA 3EQLC 2B63G 1PRTB 2EJFC 4DR5L 4PMWA 2B2VA 1XNRL 3MXGA 1HTLD 4DN4M 1WD1A 4OGQC 1FYCA 1NJIC 1U5KA 2BH2A 5A2QL 1QVFA 1AFPA 1CKNB 5FKAC 2KA7A 3HP3A 1H9SA 1SE3A 2F0EA 3OMCA 4GN3B 3HOUB 2YTXA 1LTAD 1W2BA 3NK9A 4IFDI 4JV5Q 1TQOA 1CSQA 4N9PA 1FD7D 4B3SQ 4DR3Q 5JVH3 1AZQA 4C3JB 3PF5A 2D5DA 1OXTA 3KOJA 2PZTA 1G2SA 1E22A 4ILWA 3V96A 1OTCA 3U50C 3JAME 3K7AH 2R7DA 3W1GA 3FMCA 2BA0A 1LTRD 1Q8IA 3I7FA 5CC4A 4UPAA 2F4VQ 4NPSA 4HAEA 2LFNA 2QGQA 4RH6A 2MJ8A 2F0QA 2ICIA 4GLVB 1LABA 4U68A 1N34Q 4RGTA 1Y1VG 3S2DH 4K2KA 4QY7A 2F0DA 3I70A 2OQ0A 4A93G 4K5WA 1EY0A 3NBIA 1EYGA 2H1EA 3ONAB 3PF4A 1QZHA 3J80L 4K0KL 3HKSA 5IP9H 2JA9A 4GZYC 1F77A 5I6YA 2ZTCA 4EQNA 1BR9A 3BZKA 3CC2A 5M3FB 1H95A 1SJHD 1GUTA 1B3QA 4IUVA 2F0PA 1Z7TA 1PRTD 3HRZC 5DLQE 3VR4A 1ZYRD 2KQ3A 1WD0A 4GOPC 4R4CA 2K04A 1SN8A 3UDFA 3NXWA 1GUNA 1K8GA 2B63H 1JOOA 3F2BA 4X3TA 1JORA 1HXYD 3GTLH 4DR2L 3NWTA 5J3BA 1B2TA 3NTIA 5CORA 3OIPA 2E75C 3FDTA 3H0GG 4A76A 2F0LA 1PA6A 3TRZA 5JPNC 3GV3A 2Z0SA 1HTPA 4JI0Q 4LFBQ 1JJCB 2WAQB 2HHHL 2PI2A 3PCOB 1SAPA 1H9KA 3GTJH 1SDFA 3MXNA 1QB5D 3A7LA 3CC7A 1E3PA 5C3WA 5IOCA 1I3QB 3K81C 2CW0D 3U4ZA 5IWAL 1K3RA 2JA8B 1ML0D 1ICWA 1BBWA 4DUZQ 2VB3X 3K57A 1CM9A 1X3FA 1WTRA 3E5SA 3BG3A 3CCEA 1NR4A 4JK1C 2HDLA 3H3VI 3RN2A 3L0OA 2R93B 1TY0A 2F0IA 5KIXA 2QW7A 1BOSA 4X3SA 2UXDQ 4KJNA 2Z6KA 1T5XD 5FO7B 4EX5A 2GN5A 1F2LA 3KLWA 4FF3A 1AZPA 1LUZA 3J7ZC 5CV5A 2JXMB 1Y1VH 3J80i 1MBYA 4A93H 3D6CA 1PFNA 5GADC 4G7ZC 1SJED 2RDHA 2JA7B 1GUOA 1L2FA 2L4NA 2ATWA 2Y0SE 1F2YA 1Q3LA 1UE1A 3N52A 5M5YB 5M5XB 1IYJB 2UUCL 5C0XI 4DR1L 2MGSA 4MZ9A 1YVCA 3Q0AA 1SNDA 1A8VA 1BKBA 2KOLA 1DD2A 4KHPQ 2K28A 3A7AB 4C56C 3H0GB 1SE8A 2JN4A 3H91A 1TS3A 4YWMA 2A69D 4HR7B 4RFBA 1N33L 3P1HA 5KNBA 1PRTC 4LFCQ 3G7LA 5C4ZA 3GDEA 2EOTA 2Z1CA 4HEDA 1CSPA 2PZWA 5EPLA 5M5XH 4A3EB 1VQ8A 2JA6B 3NTHA 2JJQA 2CQOA 4FP5D 1MI2A 3S2HB 3H0GH 1HR0Q 3TMEA 4H02A 1A6XA 4F88A 2YU9B 2MPMA 3D8GA 1LT4D 2ZXPA 4NKLA 3BVMA 4CDEC 2O5IC 1VCIA 4QIWB 1Y8NB 5K36G 1EL0A 4DV0L 3CCMA 1CKNA 1GHJA 2JA6H 2WV6D 5CV9A 2MNAA 2BDNA 2CW0C 4NDXA 1UE5A 3LWEA 1QCBD 1YNJC 4IOAA 4S3SA 3CCSA 2MHVA 5ELEA 5I9OA 1TIID 2IHEA 2YU9H 1PTOF 2NVXH 4FO2A 5EKIA 2K52A 4A4IA 3STBC 4K6LA 1TKWB 4K5XA 5IE8A 4TKOB 1MGSA 2KJXA 2ZXOA 1GM5A 2EYMA 2OWOA 4R8IA 1ASZA 1H9RA 1JOKA 3KBXA 3F2CA 1XWEA 4HMJA 4O42A 4PMCA 3S16B 2EYHA 4CJ2C 4HSVA 4JI1Q 2K33A 3IFDA 1RIPA 3NE5B 4ZK9B 1Y1WG 3K5MA 3QIAA 2WP8J 2EPBA 3EVQA 1SNQA 2PYKA 1NMGA 1Z9FA 4QF4A 4DV2Q 2EYJA 3SE0A 1I4XA 2IJ0A 2N49A 4FDBA 4DFAA 1NCVA 1PH7A 1S5CD 3K59A 1FGUA 2A6ED 1C9OA 2F0VA 4HJ8A 3M7NA 2L5TA 1PH6A 2HD3A 1LT3D 4FF2A 1VQKA 1XYIA 4B3TL 1UAPA 2PW7A 3G6EA 5ELBA 1AEXA 1KNEA 1PRTF 4FVMA 5EKKA 3J7YW 3PO3B 1Y8PB 2RHSB 2NZOA 4DV5L 4JI3L 4TQUS 4LF7L 1RD9D 1IBLL 5ISRA 1YBYA 3HG9A 1K83B 2K5VA 1SSOA 2VNUD 3SK5A 1A2UA 3HFZB 4IQZA 3UDIA 1VQCA 3K5NA 1WJJA 5LMNL 1HPCA 1BXTA 5HGTA 3R2TA 5K36H 2WACA 2K50A 2O2LD 3U9SA 2E2JB 4LMQD 2C35B 2RBMA 4GN4B 2IY5B 5C44G 1T9HA 3PGZA 5A2QE 5EPJA 4LF6L 2N78A 3I4NG 1YJWA 1D1IA 3P75A 4HIMA 1VQPA 2R92G 4K8IA 4LF8L 4A3LG 2MO1A 2G5DA 5C4XG 1I94L 1KNAA 5IYBG 1A62A 1VMCA 1TU2B 1N36L 1CZGA 3Q8DA 4C3HG 3VA5A 1EY4A 1ASYA 1B9NA 5EAYA 4YHHQ 3MVVA 1PYSB 2AUJD 1RL2A 1TR5A 4DU9A 4NXML 1YI2A 2ZT9C 2EJGC 1X9NA 2I07B 1EEFD 1TWCH 5F2DA 4KJOA 1Y1WH 1BQQT 1NNXA 4K0KQ 1XJVA 3RNUA 1L0XB 2MP1A 4CDDC 3ND9A 5IYCG 2N55A 3D31A 1K3BC 1IHZA 4PZ7A 4B08A 4JI8L 3IRBA 1UEAB 2K75A 2KCCA 3NQTA 4QL5A 2E74C 1PDQA 3PMFA 4FNFA 5HGQA 1IL2A 1TVXA 3VR5A 4A3DB 3RD4A 4DV6L 2F0MA 2NVTH 4H13C 2JEAI 3CCVA 1YJNA 2A6EC 4OO1H 1KDCA 1R4QB 2PMZE 4WJWA 3A54A 2SOBA 3J80E 4DXGA 1IW7D 2PQAA 2AUKA 1A3VA 2UUBL 5KYIA 2ASBA 1STEA 3CPFA 3TZDA 1KTKA 1N32L 2Q2HA 5C3EB 5C4HA 2A6HD 3TP8A 3L2PA 4AYBB 3NHHA 1AN8A 3TQYA 3M85A 2R92B 3I4MG 3NQIA 1I6VC 1UE6A 1FR3A 5C4XB 4DNIA 1WYDA 3OPOA 2HHHQ 2IX1A 1HA6A 2CWPA 4DGZA 2HQLA 4C3HB 3S1NB 2MO0A 5JVG3 4B3RQ 3TZUA 4IALA 5IWAQ 2VXWA 2X69A 3I91A 1EY8A 4ZQ3A 1JE4A 3A55A 4BWGB 2K14A 1FJGL 3I4NH 3IKJA 1KAWA 2JK8A 1J5EQ 4O1NA 3QJYA 2R92H 4A3LH 1N8RC 4L5TA 5C4XH 1VQDA 3X3NA 4ME3A 2MQHA 5C6AA 3LNNA 3KJPA 4JI7L 4BBSB 2BCOA 3UDXA 3S17B 2QCPX 4C3HH 1E24A 3I8ZA 2YV5A 1L0WA 1IKMA 1AH9A 4RWSC 4ZAIA 1SYEA 4A3JG 4BY7G 4HN7A 5LHY1 3O13A 2ZTDA 4F87A 4H7BA 1C7YA 3A8IE 1I4RA 4LUVA 3M9BA 2VW9A 1EIGA 2ZM6L 2UUCQ 1EYCA 2K5DA 3MAQA 4DR1Q 4GOPB 4UAIA 3S17H 5IYCH 4XQQA 2EYLA 3S1QB 3RLOA 2A68D 5IGGA 4J15A 1LT6D 4PZ8A 2ICEC 4JI2L 4N9TA 2Y0SG 1N33Q 2LSSA 1BNZA 3W3AA 4K14A 2AMCB 1M90C 3C1FA 1K73C 3NUCA 3CAMA 2B39A 4H44C 5I9PA 1BBUA 4DV3L 2GA4B 4JBJA 4A3CH 1DONA 1YZ6A 2B2YC 3L9AX 4IUPA 1Q81C 1HRJA 2E2IB 2HDMA 3S1QH 1CQFA 4KN7C 3OWFA 5CYUA 1DJRD 1U4RA 3UI2A 2K03A 2GVAA 2WB1G 3SXHA 2RCNA 1X6OA 5GAGC 3CD6A 3NSWA 4XYQA 1S5ED 2R7ZB 3Q6SA 4C3IG 4G7HC 3D4RA 3NENA 4JI4L 1STAA 2NZ1D 4V0BA 3SK8A 3VA7A 5JJZA 3BYTB 3SDZA 1VQ9A 2LXJA 3HOWG 3MTSA 2OTLA 2KENA 2X6GA 1EZ8A 2B2UC 4DV0Q 4CDFC 4FF1A 4X62L 3LWUA 1RDPD 5L37A 2JYOA 4DK0A 3ERSX 4OIKA 3KDFA 4A3GB 1O78A 1YITA 5GAHC 1JWUD 4LK1C 1MJEA 2R7ZH 3DWAA 2Z9HA 1GJXA 1STBA 1JB3A 4XIGS 1SYDA 1C8CA 2Q2IA 3PSIA 3BDCA 4IO9A 3BVGA 4DA2A 1IYVA 4HTHA 1D5ZC 4A3JH 4BY7H 1K8OA 1C0AA 1PVOA 1EQRA 1XMOL 1YIJA 3Q23A 5E4WC 1QUQB 5FK9C 4DAPA 4EQPA 2D0PA 3T53B 5EKLA 2SDFA 4WRDA 4UY8C 1VQAA 4CKEA 5D3IB 4AIMA 5IIFA 1VQBA 3GO5A 4IN3A 1Y69U 2TMPA 3E3XA 2LKVA 3G48A 5KEEA 4OX9L 4BBRG 1LTLA 2A68C 5BR8L 1LTGD 3K7AB 1Q46A 4CGYB 1IL8A 3DM3A 2Z4HA 4JCVE 2DN8A 2A74C 4RMFA 2IT1A 2R3ZA 2A8VA 4O2DA 3OMGA 5HY6A 1DYQA 2F0OA 4JYAL 1B9MA 1KD1C 5C5LA 4UP7A 3S2DB 1J9OA 4MN3A 4JI3Q 2RQXA 3ND8A 3UE0A 2FFKB 2A19A 2PPBC 1YJ9A 1IBLQ 4C3IH 3M7GA 5KRUA 4L6TB 4CKCA 5KNCA 3UE1A 3GTMH 3FPPA 5LMNQ 1PZID 4R4TA 1EY7A 3HOWH 3PV0A 2RA4A 1BBXC 2XNAC 2RCFA 1WTQA 2IX0A 5DEHA 4LJZC 4OWTB 3GV6A 1K28A 3DEOA 2B63B 1DZ1A 2XRQD 1ET6A 3GTLB 1WTXA 2Z4IA 2CH4W 1N36Q 1EYAA 5E4XA 3ULLA 2EYFA 3JC66 5TSSA 3HOVG 5NUCA 4WORA 1C48A 2K5HA 2VQFL 2FINB 3OIQA 1SMXA 4NXMQ 3A0JA 4Y52H 3R8BA 1UNSA 1IBML 3GTJB 5I2YA 4OWWB 3PUVA 3SR1A 1LTID 3D6WA 3K7UC 1QE6A 2NWGA 2F4IA 2P5ZX 2F0KA 1YHBA 1CHQD 1IYUA 3X3MA 3ER0A 1A2TA 4XT1B 4BBRH 4A3IG 1HUNA 1S4ZA 4JI8Q 2AWNA 2AHOB 4ALPA 1E7ZA 4KHVA 1Y14B 1F9SA 1G6ZA 4DV6Q 3TEHB 4GOPA 2D2CC 2EXZA 1PH9A 2VB2X 3BJUA 4CKBA 5ELFA 1QOHA 4WFN3 1OXUA 2UUBQ 3M4OB 1S5FD 4LF9L 4X65L 1Y1VB 1N32Q 1SXTA 4MNOA 4HJAA 1YNJD 4A93B 1JMCA 3HOYG 2DY7A 4DR7L 2KECA 4LF4L 1CQVA 2MFIA 4FXGC 2FHTA 5HURA 1VQMA 3K58A 4K5VA 1FNVA 1Z6HA 5E1FA 3M4YA 4RCOA 4AQYQ 3TN2A 5CBAE 1K0SA 3STBD 3K8AA 4X3KA 1F2MA 4IJLA 4B3ML 1XMQL 2Q2UA 3H15A 2QDLA 1EZ6A 3MHBA 2X6LA 2RSOA 2K6AA 3HKZG 4CJ0B 3G71A 3OW7A 1ONLA 4A3KG 3M4OH 3HOVB 1XNQL 4NXNL 3M3YB 1FJGQ 1PH4A 3FKIG 4P73A 4AH6A 2N3SA 5ELDA 5CBEE 2R7FA 1JR0D 3C46A 1QVCA 3DM1A 1G6PA 3I2ZA 1XTCD 1STNA 2E5LQ 3OYYA 1DOMA 3DXJC 4JI7Q 1HUMA 3H6MA 4A3FG 2OEOA 1EU4A 3AQQA 1UWVA 1Q7YC 3J81c 5CR3A 2NTSA 4H0LC 3HOVH 4GNXC 2QILA 2PQAB 5IODA 4P74A 4KY7A 2EZVA 3M3YH 2AQ1B 2WB1E 4J1MA 3BDLA 5FLXc 4XQJA 3CMEA 4OELB 3RMHA 4DV4L 1KDBA 3NBHA 1I4GA 2K32A 4R8NA 2ZM6Q 3CP0A 1QZGA 2NUCA 1TWFH 4GKKL 4BY1G 1PH3A 3V05A 5M9OA 1RHPA 5D14A 4GNXA 1QUQA 3BVZA 2OQKA 4KKTA 2UU9L 1WCMG 3S1MH 2RVLA 3N6RA 3QWNA 5IP7G 4JI2Q 1LLRD 2CWAA 2PMZB 1TXYA 4XDXA 4FXDA 2UXBL 2NVXB 4KLKA 4POFA 3VYRA 1WOCA 1TS5A 1GKHA 4JI6L 3CCRA 3G6JB 1L1OC 4DV3Q 1EIHA 3H3VH 1PLFA 3OSOA 5T1IA 1V1QA 2Q2TA 1JB7A 2NVYH 4DF7A 4ZUIA 3J7AF 5G3LD 3HOYH 1CK1A 1HZCA 4DR6L 2F0JA 3KFUA 4LF5L 3J7A5 1O7YA 2C9OA 1SMYD 1VQNA 4ODGA 2EDGA 2Q8TA 1SR3A 3WWVA 2IHFA 4JBKA 1L1OA 2EXDA 4OIJA 1VQGA 3T4AC 5IGDA 4TSSA 1ESRA 4XYOA 4A3KH 1CA6A 3DHQA 4X62Q 1UUPA 2VS1A 4DNRB 1CT1D 1JWMD 1VF5C 1HNXL 3S15H 2VUMG 3FKIH 2KCMA 4XT3B 2RHQB 3H94A 1GD7A 1JWSD 2K4KA 1GUSA 1KL9A 1BDOA 4RCNA 4A3FH 2F0TA 3ULJA 4I7ZC 3GP7A 1KC8C 1LACA 3M4QA 1MD2D 4QJFA 2I5LX 2VQEL 1SNOA 1WCMB 2WFWA 3GTKH 5D3DA 3PUYA 3E6ZX 1PFSA 3ICEA 1SYBA 1XMOQ 2I5MX 2RSNA 4DXFA 3SHLA 1Q82C 2RDFA 2F3IA 3LX0A 3MZ5A 1C4QA 4JC0A 4LUOA 1DM0B 1V1PB 4DR5Q 3J7AV 1XNRQ 3CRLC 3HS0C 1R9TH 1BVSA 1WCMH 3MEFA 1PH8A 3OOCA 5BR8Q 3ZYYX 1U4MA 5IP7H 2L12A 3F1ZA 3KLRA 2ZJRA 4YCUA 3PUXA 2J0TD 3K6OA 3KDFB 5IT9c 4B3SL 4Q0FA 1GUGA 2WAQE 1EQQA 4K2LA 1Q86C 2M2LA 1S5BD 3KF8A 4ID6A 3CRKC 4JYAQ 1WTPA 1AE3A 1HNZL 3CKIB 2VUMB 1TWAB 4OO1I 2H5XA 2KEEA 2AKWB 1RTNA 1EWCA 1TWCB 3E0EA 2I0QA 1EYDA 4N8FA 1SMYC 4ZKCB 2KHIA 3KUPA 1Y1WB 1WVLA 1V8QA 1BUVT 2VL6A 4A3BG 3KK7A 5IYDG 2V4DA 4E6IA 2VUMH 1B53A 1R4PB 1TWAH 1E2ZA 4DV1L 5GAEC 3PIO3 3TP6A 3BZCA 1KRSA 2NVTB 2CH4A 3J81L 2F0GA 2EQSA 2PO4A 5M3MG 3A8JE 1GHKA 3MXUA 1ESFA 1F9PA 2HCCA 2WINB 3EBEA 4HJ7A 4LFAL 3URYA 4L8JA 3NWSA 4KY5A 4J8QA 5EBDA 3SK6A 4U673 3RZOH 1EY6A 1EIYB 5C4JH 1X3QA 3ERQA 4FF4A 1BCPC 4PG3A 2VQFQ 5CV4A 2L1BA 3H3VC 4PV1C 1H9MA 2NN6G 3QOLA 5LMNW 1IBMQ 1RJTA 1XPRA 2ZXRA 2JP1A 2SNMA 1I4HA 2D0OA 3DMUA 2F1MA 5C44B 1QNUA 4R4OA 1EWIA 2R61A 3HKZE 4DR2Q 3BS1A 1RODA 3D0FA 1GUWA 5EGTA 3I4NB 4JI0L 2L15A 2DGYA 3QOJA 3NTKA 4PQXA 3A56A 5M5WB 1VQLA 5EJWA 4ZKBB 2B2TC 3OHXC 3RZDB 1CI3M 5LMUL 4DUYL 2E76C 1VQ5A 4A3BB 3OWEB 2JA5G 2O5JC 5ELNA 1EQVA 2CQAA 1F9RA 3GTOH 2L9HA 1PHJA 4QIWE 1FL0A 1HA5A 2ID0A 4HIOA 3K0YA 5C44H 2PNRC 4DKAC 3TS0A 4LF9Q 3SEBA 3Q24A 1STYA 5DAUA 4HCEA 1KLUD 4DR7Q 2XIWA 3QR8A 5M5WH 3W2DA 2B2TA 3CCQA 1VQJA 3RZDH 1STHA 1HZBA 4A3BH 5IYBH 5JJKA 2NBFA 3CHBD 3J81i 3HOXG 4X6AH 1DOLA 2JQOA 1HCZA
chains in the Genus database with same CATH topology
1LUZA 3J7ZC 2NZHA 3VDYA 1Y1VH 4OO1G 4PZ6A 3T1YQ 4RMFA 1KHIA 3J80i 4DR3L 1XNQQ 1WI5A 4A93H 2IT1A 5GADC 4JOIA 3KF6A 2A8VA 3I4OA 1PH1A 3F8TA 3CCUA 1I50H 4O2DA 2I5HA 5HY6A 1L2FA 4JYAL 5M3MH 1KD1C 2ATWA 2Y0SE 3S14H 4UP7A 2QA4A 1NTGA 1UE1A 4X66L 1IYJB 2UUCL 4JI3Q 2JE6I 4IPGA 4LUZA 5C0XI 3UE0A 4DR1L 2A19A 4MZ9A 1YVCA 1YJ9A 3K80C 4IPHA 4HIDA 1M1KC 4C3IH 1IBLQ 1A8VA 1BKBA 1NY4A 1EFWA 1UE7A 1XPOA 4KHPQ 3EN2A 4A3DG 2QEXA 3TS2A 4UP8A 3UE1A 1SE8A 2F4VL 5JEAG 3GTMH 3PO2H 4YWMA 5LMNQ 4R4TA 3HOWH 3PV0A 4GLAC 4LFCL 1K8AC 1A63A 1N33L 4LFCQ 2R6GA 3PO3H 1VS0A 1Q12A 1S72A 3GDEA 1X3GA 1N34L 3U58A 1CSPA 5M5XH 5C3EG 4DV4Q 2XTIA 4AYBG 1X54A 1VQ8A 1K83H 5FJ8G 2IX0A 2JJQA 4GKKQ 5E7NA 4RG1A 2CQOA 4OWTB 3E9HA 2OCEA 1HR0L 1MJCA 3H0GH 3RLFA 1IBKQ 1HR0Q 1VQOA 4LWCA 1S40A 1NMFA 4H02A 1JJ2A 1G291 3I4MH 1P16A 1O7IA 2E2JH 2UXBQ 1N36Q 3ZJYC 3ULLA 3T1HL 1HJPA 4LNQA 3JC66 3NELA 2JA5H 3HOVG 1VCIA 2E5LL 2K5HA 4A3MH 2VQFL 1XPUA 1SMXA 5K36G 4R4QA 3CC4A 1IXRA 3CCMA 4DV0L 1CKNA 3A0JA 1NE3A 4NXMQ 2JA6H 4IFDJ 4Y52H 1DGSA 1OXXK 1E1TA 2MNAA 1IBML 1VQ7A 1UE5A 3JAMi 1YHQA 1VQHA 4OWWB 3KJOA 3PUVA 2HT1A 4IOAA 3K7UC 3CCSA 1X55A 4DR6Q 2D62A 4BBSG 2ES2A 1YHBA 3CMAA 3CPWA 3HOUG 4XTCS 3ER0A 2VY3A 2IHEA 2YU9H 4DV7L 4BBRH 2NVXH 4A3IG 1FVIA 4YWKA 3AEVA 4JI8Q 2K52A 2AWNA 2AHOB 3STBC 4A4IA 4ALPA 2NVQH 1E7ZA 1Q1EA 4OWXB 3HOXH 1Y14B 1Q8KA 5IE8A 4LFBL 2KBNA 3G4SA 1KRTA 1GM5A 4DV6Q 2OWOA 3GTPH 3TEHB 3ULPA 3NBHB 4GOPA 1ASZA 3FHWA 2DUDA 5FLMG 1PH9A 3F2CA 2EIFA 3BJUA 4A3CG 1UEBA 4O0AA 4OXPA 4YWLA 3RN5A 1HNXQ 4JI1L 3A5UA 2YTYA 1OXUA 2A1AA 2UUBQ 4JI1Q 4QGUA 3B6YA 4GNXB 3A5ZB 1RIPA 4LF9L 4X65L 1N32Q 3UDGA 2NN6I 4MNOA 4X65Q 4DUZL 4YY3L 4HJAA 1JMCA 3OTOL 1Y1WG 3HOYG 4DR7L 4LF4L 2WP8J 4IPCA 2MFIA 4GKJL 2UUAQ 1EIFA 4LF4Q 1VQMA 4A3DH 4IFDG 4DV2L 1NMGA 4Y7NH 4AQYL 1Z9FA 4IJHA 5GQOA 3HOZG 4APVA 4DV2Q 4AQYQ 1EOVA 2N49A 4FDBA 1X56A 2UXDL 3STBD 4WJ4A 3K8AA 4B3ML 4IJLA 1PH7A 1WFQA 1XMQL 2Q2UA 3H15A 4B3MQ 1W3SA 1XMQQ 1VQ6A 3GTQH 2HIVA 3HKZG 1Z47A 1FGUA 3G71A 1C9OA 1CKMA 4A3KG 3M4OH 4HJ8A 3T1YL 2CKZB 3M7NA 1V9PA 1XNQL 1PH6A 5IYDH 5C3EH 1VQKA 4B3TL 1A0IA 3AYHB 4P72A 4NXNL 3G6EA 4B3TQ 5FJ8H 4NXNQ 1FJGQ 1PH4A 3FKIG 4P73A 3F2DA 4AH6A 2N3SA 4R4IA 2R7ZG 2RHSB 2NZOA 4TVAB 1B7YB 4DV5L 2R7FA 4DAYB 1L1OB 4JI3L 1QVCA 2KHJA 1J6QA 1SRUA 3I2ZA 4TQUS 5M3FG 4DV5Q 2E5LQ 1MKHA 4LF7L 1G6PA 4JI5Q 3OYYA 1KIXA 1IBLL 4QQBX 1YBYA 4LF7Q 2E8GA 4A3FG 4JI7Q 4DR4Q 2K5VA 1SROA 3S1NH 4KHPL 3AQQA 4AYBE 1UWVA 1Q7YC 1K0RA 2VNUD 3HFZB 3J81c 1PYBA 3UDIA 1VQCA 1KXLA 2E2HH 3HOVH 1YHAA 4GNXC 4WJ3M 2PQAB 3A74A 1WJJA 3LGJA 5LMNL 3J80c 2GVBA 4P74A 3M3YH 4A3GG 2BA1A 2K50A 2WB1E 1GVPA 5FLXc 2C35B 3U4VA 3CMEA 4POGA 4GN4B 2IY5B 4DK3C 5C44G 1T9HA 3E9IA 4MTNA 3PGZA 3CF5A 4DV4L 1Q1BA 4JBWA 1HNZQ 1D7QA 4X64Q 1OXVA 4BBSH 1IZ6A 1GO3E 2ZM6Q 3CP0A 1QZGA 2N78A 4LF6L 1TWFH 1YJWA 4BY1G 3I4NG 4GKKL 3HOUH 4KI0A 3MXNB 1PH3A 4LF6Q 4HIMA 1B8AA 1VQPA 2R92G 2WAQG 4LF8L 4A3LG 2MO1A 4DPGA 1IBKL 5C4XG 3FP9A 1I94L 4LF8Q 4GNXA 1QUQA 2OQKA 1I94Q 2CFMA 3M4PA 5AJ3Q 1WCMG 2UU9L 4C3JH 3S1MH 5IYBG 2V1CC 2UU9Q 4L5RC 5IP7G 1A62A 3KYHC 4JI2Q 2CWAA 1TXYA 4HJ5A 3CXCA 1N36L 2UXBL 2BH8A 3Q8DA 3AFQA 5FLMH 4YHHL 4KLKA 4POFA 1ASYA 1WOCA 5EAYA 4YHHQ 2JA8G 1GKHA 4JI6L 3CCRA 1PYSB 1L1OC 4DV3Q 2F52A 2VZAA 1CKOA 4JI6Q 3H3VH 1RL2A 3RLNA 4NXML 1YI2A 4DV1Q 5JJLA 1X9NA 1MIUA 4HJ9A 1V1QA 1X65A 2Q2TA 1TWCH 4GN5A 1JB7A 2NVYH 3GTGH 1I6HH 2R93G 3CCJA 1HZAA 1Y1WH 3HOYH 1HNWQ 3CCLA 4BA1I 1HZCA 4DR6L 1VQFA 3KFUA 4K0KQ 1XJVA 4LF5L 1YEZA 4LFAQ 3W1BA 3RNUA 3J7A5 3SGIA 3HOZH 4LF5Q 1TWGH 5IYCG 3D31A 1LM0A 1VQNA 2KCTA 4PZ7A 3KF6B 2JEBI 2ZJQA 4JI8L 2PI2E 5C0XJ 3IRBA 2PNHA 2K75A 3CQZH 4QL5A 2UXCQ 1SR3A 3WWVA 2IHFA 4GLXA 4JBKA 1L1OA 2EXDA 2LXKA 2RF4A 1VQGA 3KF8B 4DAMA 5HGQA 4JBMA 1IL2A 4DV6L 4A3KH 2NVTH 2JA7G 2E2IH 2JEAI 3CCVA 1YJNA 4X62Q 3BU2A 1JE5A 1X3EA 2VS1A 4GS3A 1E1OA 2N8NA 2PMZE 1V43A 3PUWA 3JAMc 1HNXL 3S15H 2VUMG 3FKIH 2PQAA 4R1JA 2OTJA 2UUBL 4L5QA 2AWOA 2KCMA 2ASBA 2RHQB 1GD7A 3CPFA 4HIKA 3OW2A 5GROA 1N32L 2Q2HA 1I5FA 5M3FH 4P75A 3RR5A 2K4KA 1KL9A 3L2PA 3TQYA 3M85A 4A3FH 3ULJA 3DLLA 2UUAL 1KQSA 1HH2P 5IP9G 4UP9A 1KC8C 4C2MH 3I4MG 1UE6A 3M4QA 1SLJA 4DNIA 1HR0W 4QJFA 2I5LX 2VQEL 1WYDA 2HHHQ 2IX1A 4P71A 1G51A 2ALYB 2Z6KC 3PIOA 2CWPA 2VQEQ 1TWHH 5LMUQ 2WFWA 4DUYQ 3GTKH 3CW2C 4A3GH 4B3RL 3PUYA 3ICEA 1PFSA 4A3EG 2HQLA 1PV4A 1XMOQ 2MO0A 4B3RQ 2I5MX 5H1SE 4IOCA 3K0XA 4K0KL 2JA6G 3I55A 2YTVA 4NB3A 5ELOA 5IWAQ 1Q82C 5C0XG 3AFPA 1P8LA 2F3IA 1S3OA 1PH2A 2B63G 1EUJA 2K14A 1J5EL 4JC0A 4DR5L 4LUOA 2ZJPA 1FJGL 3I4NH 1KAWA 2JK8A 4DR5Q 1J5EQ 4PMWA 4L5SA 1XNRL 2R92H 3TREA 4A3LH 4KHZA 1XNRQ 5JJIA 1VQ4A 1NJIC 4BXXG 1N8RC 4L5TA 5C4XH 1VQDA 1U5KA 1R9TH 2BH2A 1BVSA 4ME3A 2MQHA 4JI5L 1QVFA 1WCMH 1CKNB 3MEFA 3KJPA 1PH8A 4IPDA 5BR8Q 4JI7L 4DR4L 5IP7H 2FXQA 3UDXA 4GN3B 2CCZA 3F1ZA 1E24A 1I3QH 2YTXA 3L7ZC 4C3HH 2ZJRA 1SFOH 3GD7A 1W2BA 4YCUA 2YV5A 3PUXA 1L0WA 4IFDI 4JV5Q 1AH9A 3KDFB 5IT9c 2JA8H 4B3SL 1CSQA 4A3JG 4BY7G 1QVGA 2WAQE 4BA2I 4B3SQ 1EQQA 4DR3Q 2ZTDA 3S24A 3PF5A 1Q86C 1OXTA 3KOJA 3J81j 3I56A 1JT8A 1JJGA 1C7YA 2R93H 4LUVA 1E22A 4DK6C 4JYAQ 1AE3A 1HNZL 4X64L 1XTDA 1OTCA 3M9BA 2VW9A 4OO1I 2H5XA 3U50C 4X66Q 3K7AH 2ZM6L 2UUCQ 2R7DA 4DR1Q 2AKWB 3W1GA 4GOPB 3S17H 5IYCH 2BA0A 3E0EA 2I0QA 3I7FA 4A3IH 3RLOA 2KHIA 4UPAA 5AJ3L 4J15A 4PZ8A 2F4VQ 2VL6A 4A3BG 4NPSA 4JI2L 2Y0SG 1N33Q 2JA7H 2QGQA 2LSSA 1M90C 2AMCB 4GLVB 1K73C 5IYDG 3CAMA 5M5YH 1N34Q 3S2DH 1Y1VG 1BBUA 4DV3L 4A3CH 4JBJA 1CUKA 2VUMH 1TWAH 4QY7A 1YZ6A 4A93G 2OQ0A 4DV1L 5GAEC 3BZCA 1KRSA 1Q81C 1EYGA 3S1QH 4JG2A 2EQSA 3EIVA 5M3MG 1HNWL 3PF4A 2GVAA 4YCWA 1QZHA 2WB1G 5GAGC 2RCNA 1X6OA 3HKSA 3CD6A 2K5NA 3EBEA 1AE2A 1B70B 2JA9A 5IP9H 4EQ5A 4HJ7A 4LFAL 3W5OA 2ZTCA 1NBWA 4JI4L 3BZKA 3NENA 3CC2A 3RZOH 1EIYB 5C4JH 1LYLA 4JI4Q 3T1HQ 2ZTEA 1H95A 2XGTA 2UXCL 1VQ9A 3PO2G 2LXJA 4A3EH 3HOWG 4PG3A 2VQFQ 5DLQE 2OTLA 2KENA 4DV0Q 4GOPC 4X62L 4R4CA 3PO3G 2NN6G 1SN8A 1U0LA 3ERSX 3UDFA 5LMNW 1IBMQ 3S2HH 1K8GA 2B63H 3KDFA 4A75A 4YCVA 3F2BA 1XPRA 2D0OA 1YITA 5IY0A 5GAHC 1MJEA 3GTLH 2R7ZH 4BXXH 4DR2L 4R4OA 1EWIA 5J3BA 3HKZE 4DV7Q 4DR2Q 3D0FA 3H0GG 4XIGS 1OXSC 4A76A 2Q2IA 3PSIA 2L15A 2DGYA 1PA6A 4JI0L 3TRZA 2Z0SA 4JI0Q 4IO9A 1VQLA 1JJCB 4LFBQ 2B29A 2HHHL 2PI2A 3PCOB 3GTJH 4A3JH 4BY7H 1C0AA 1PVOA 3CC7A 5LMUL 4DUYL 1VQ5A 1D8LA 2HIXA 1K9MC 2JA5G 1E3PA 1EQRA 1XMOL 5ELNA 4A3MG 1HZ9A 1YIJA 2B3GA 3GTOH 4OONA 1PHJA 3K81C 1QUQB 4QIWE 3U4ZA 1FL0A 1PH5A 2ID0A 5IWAL 4HIOA 1K3RA 5C44H 3TS0A 4DKAC 3PUZA 4LF9Q 2D0PA 1BBWA 5JEAJ 4DUZQ 4JOIC 4YY3Q 1VQIA 1X3FA 4LW1A 3OTOQ 4UY8C 4DR7Q 1VQAA 4BY1H 3CCEA 4GKJQ 3S1RH 4AIMA 3PIPA 1VQBA 3GO5A 5M5WH 3H3VI 3NEMA 3RN2A 3L0OA 3G48A 1VQEA 3CCQA 1VQJA 1N9WA 4BBRG 3RZDH 1LTLA 1HZBA 4OX9L 5BR8L 4A3BH 2UXDQ 2Z6KA 4OX9Q 5IYBH 4EX5A 1Q46A 3S16H 5JJKA 2GN5A 3J81i 3HOXG 3KLWA 1YNXA 3DM3A 4X6AH 2JQOA 2YYZA 4JCVE 4JV5L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LUZ A;  3J7Z C;  2NZH A;  3VDY A;  1Y1V H;  4OO1 G;  4PZ6 A;  3T1Y Q;  4RMF A;  1KHI A;  3J80 i;  4DR3 L;  1XNQ Q;  1WI5 A;  4A93 H;  2IT1 A;  5GAD C;  4JOI A;  3KF6 A;  2A8V A;  3I4O A;  1PH1 A;  3F8T A;  3CCU A;  1I50 H;  4O2D A;  2I5H A;  5HY6 A;  1L2F A;  4JYA L;  5M3M H;  1KD1 C;  2ATW A;  2Y0S E;  3S14 H;  4UP7 A;  2QA4 A;  1NTG A;  1UE1 A;  4X66 L;  1IYJ B;  2UUC L;  4JI3 Q;  2JE6 I;  4IPG A;  4LUZ A;  5C0X I;  3UE0 A;  4DR1 L;  2A19 A;  4MZ9 A;  1YVC A;  1YJ9 A;  3K80 C;  4IPH A;  4HID A;  1M1K C;  4C3I H;  1IBL Q;  1A8V A;  1BKB A;  1NY4 A;  1EFW A;  1UE7 A;  1XPO A;  4KHP Q;  3EN2 A;  4A3D G;  2QEX A;  3TS2 A;  4UP8 A;  3UE1 A;  1SE8 A;  2F4V L;  5JEA G;  3GTM H;  3PO2 H;  4YWM A;  5LMN Q;  4R4T A;  3HOW H;  3PV0 A;  4GLA C;  4LFC L;  1K8A C;  1A63 A;  1N33 L;  4LFC Q;  2R6G A;  3PO3 H;  1VS0 A;  1Q12 A;  1S72 A;  3GDE A;  1X3G A;  1N34 L;  3U58 A;  1CSP A;  5M5X H;  5C3E G;  4DV4 Q;  2XTI A;  4AYB G;  1X54 A;  1VQ8 A;  1K83 H;  5FJ8 G;  2IX0 A;  2JJQ A;  4GKK Q;  5E7N A;  4RG1 A;  2CQO A;  4OWT B;  3E9H A;  2OCE A;  1HR0 L;  1MJC A;  3H0G H;  3RLF A;  1IBK Q;  1HR0 Q;  1VQO A;  4LWC A;  1S40 A;  1NMF A;  4H02 A;  1JJ2 A;  1G29 1;  3I4M H;  1P16 A;  1O7I A;  2E2J H;  2UXB Q;  1N36 Q;  3ZJY C;  3ULL A;  3T1H L;  1HJP A;  4LNQ A;  3JC6 6;  3NEL A;  2JA5 H;  3HOV G;  1VCI A;  2E5L L;  2K5H A;  4A3M H;  2VQF L;  1XPU A;  1SMX A;  5K36 G;  4R4Q A;  3CC4 A;  1IXR A;  3CCM A;  4DV0 L;  1CKN A;  3A0J A;  1NE3 A;  4NXM Q;  2JA6 H;  4IFD J;  4Y52 H;  1DGS A;  1OXX K;  1E1T A;  2MNA A;  1IBM L;  1VQ7 A;  1UE5 A;  3JAM i;  1YHQ A;  1VQH A;  4OWW B;  3KJO A;  3PUV A;  2HT1 A;  4IOA A;  3K7U C;  3CCS A;  1X55 A;  4DR6 Q;  2D62 A;  4BBS G;  2ES2 A;  1YHB A;  3CMA A;  3CPW A;  3HOU G;  4XTC S;  3ER0 A;  2VY3 A;  2IHE A;  2YU9 H;  4DV7 L;  4BBR H;  2NVX H;  4A3I G;  1FVI A;  4YWK A;  3AEV A;  4JI8 Q;  2K52 A;  2AWN A;  2AHO B;  3STB C;  4A4I A;  4ALP A;  2NVQ H;  1E7Z A;  1Q1E A;  4OWX B;  3HOX H;  1Y14 B;  1Q8K A;  5IE8 A;  4LFB L;  2KBN A;  3G4S A;  1KRT A;  1GM5 A;  4DV6 Q;  2OWO A;  3GTP H;  3TEH B;  3ULP A;  3NBH B;  4GOP A;  1ASZ A;  3FHW A;  2DUD A;  5FLM G;  1PH9 A;  3F2C A;  2EIF A;  3BJU A;  4A3C G;  1UEB A;  4O0A A;  4OXP A;  4YWL A;  3RN5 A;  1HNX Q;  4JI1 L;  3A5U A;  2YTY A;  1OXU A;  2A1A A;  2UUB Q;  4JI1 Q;  4QGU A;  3B6Y A;  4GNX B;  3A5Z B;  1RIP A;  4LF9 L;  4X65 L;  1N32 Q;  3UDG A;  2NN6 I;  4MNO A;  4X65 Q;  4DUZ L;  4YY3 L;  4HJA A;  1JMC A;  3OTO L;  1Y1W G;  3HOY G;  4DR7 L;  4LF4 L;  2WP8 J;  4IPC A;  2MFI A;  4GKJ L;  2UUA Q;  1EIF A;  4LF4 Q;  1VQM A;  4A3D H;  4IFD G;  4DV2 L;  1NMG A;  4Y7N H;  4AQY L;  1Z9F A;  4IJH A;  5GQO A;  3HOZ G;  4APV A;  4DV2 Q;  4AQY Q;  1EOV A;  2N49 A;  4FDB A;  1X56 A;  2UXD L;  3STB D;  4WJ4 A;  3K8A A;  4B3M L;  4IJL A;  1PH7 A;  1WFQ A;  1XMQ L;  2Q2U A;  3H15 A;  4B3M Q;  1W3S A;  1XMQ Q;  1VQ6 A;  3GTQ H;  2HIV A;  3HKZ G;  1Z47 A;  1FGU A;  3G71 A;  1C9O A;  1CKM A;  4A3K G;  3M4O H;  4HJ8 A;  3T1Y L;  2CKZ B;  3M7N A;  1V9P A;  1XNQ L;  1PH6 A;  5IYD H;  5C3E H;  1VQK A;  4B3T L;  1A0I A;  3AYH B;  4P72 A;  4NXN L;  3G6E A;  4B3T Q;  5FJ8 H;  4NXN Q;  1FJG Q;  1PH4 A;  3FKI G;  4P73 A;  3F2D A;  4AH6 A;  2N3S A;  4R4I A;  2R7Z G;  2RHS B;  2NZO A;  4TVA B;  1B7Y B;  4DV5 L;  2R7F A;  4DAY B;  1L1O B;  4JI3 L;  1QVC A;  2KHJ A;  1J6Q A;  1SRU A;  3I2Z A;  4TQU S;  5M3F G;  4DV5 Q;  2E5L Q;  1MKH A;  4LF7 L;  1G6P A;  4JI5 Q;  3OYY A;  1KIX A;  1IBL L;  4QQB X;  1YBY A;  4LF7 Q;  2E8G A;  4A3F G;  4JI7 Q;  4DR4 Q;  2K5V A;  1SRO A;  3S1N H;  4KHP L;  3AQQ A;  4AYB E;  1UWV A;  1Q7Y C;  1K0R A;  2VNU D;  3HFZ B;  3J81 c;  1PYB A;  3UDI A;  1VQC A;  1KXL A;  2E2H H;  3HOV H;  1YHA A;  4GNX C;  4WJ3 M;  2PQA B;  3A74 A;  1WJJ A;  3LGJ A;  5LMN L;  3J80 c;  2GVB A;  4P74 A;  3M3Y H;  4A3G G;  2BA1 A;  2K50 A;  2WB1 E;  1GVP A;  5FLX c;  2C35 B;  3U4V A;  3CME A;  4POG A;  4GN4 B;  2IY5 B;  4DK3 C;  5C44 G;  1T9H A;  3E9I A;  4MTN A;  3PGZ A;  3CF5 A;  4DV4 L;  1Q1B A;  4JBW A;  1HNZ Q;  1D7Q A;  4X64 Q;  1OXV A;  4BBS H;  1IZ6 A;  1GO3 E;  2ZM6 Q;  3CP0 A;  1QZG A;  2N78 A;  4LF6 L;  1TWF H;  1YJW A;  4BY1 G;  3I4N G;  4GKK L;  3HOU H;  4KI0 A;  3MXN B;  1PH3 A;  4LF6 Q;  4HIM A;  1B8A A;  1VQP A;  2R92 G;  2WAQ G;  4LF8 L;  4A3L G;  2MO1 A;  4DPG A;  1IBK L;  5C4X G;  3FP9 A;  1I94 L;  4LF8 Q;  4GNX A;  1QUQ A;  2OQK A;  1I94 Q;  2CFM A;  3M4P A;  5AJ3 Q;  1WCM G;  2UU9 L;  4C3J H;  3S1M H;  5IYB G;  2V1C C;  2UU9 Q;  4L5R C;  5IP7 G;  1A62 A;  3KYH C;  4JI2 Q;  2CWA A;  1TXY A;  4HJ5 A;  3CXC A;  1N36 L;  2UXB L;  2BH8 A;  3Q8D A;  3AFQ A;  5FLM H;  4YHH L;  4KLK A;  4POF A;  1ASY A;  1WOC A;  5EAY A;  4YHH Q;  2JA8 G;  1GKH A;  4JI6 L;  3CCR A;  1PYS B;  1L1O C;  4DV3 Q;  2F52 A;  2VZA A;  1CKO A;  4JI6 Q;  3H3V H;  1RL2 A;  3RLN A;  4NXM L;  1YI2 A;  4DV1 Q;  5JJL A;  1X9N A;  1MIU A;  4HJ9 A;  1V1Q A;  1X65 A;  2Q2T A;  1TWC H;  4GN5 A;  1JB7 A;  2NVY H;  3GTG H;  1I6H H;  2R93 G;  3CCJ A;  1HZA A;  1Y1W H;  3HOY H;  1HNW Q;  3CCL A;  4BA1 I;  1HZC A;  4DR6 L;  1VQF A;  3KFU A;  4K0K Q;  1XJV A;  4LF5 L;  1YEZ A;  4LFA Q;  3W1B A;  3RNU A;  3J7A 5;  3SGI A;  3HOZ H;  4LF5 Q;  1TWG H;  5IYC G;  3D31 A;  1LM0 A;  1VQN A;  2KCT A;  4PZ7 A;  3KF6 B;  2JEB I;  2ZJQ A;  4JI8 L;  2PI2 E;  5C0X J;  3IRB A;  2PNH A;  2K75 A;  3CQZ H;  4QL5 A;  2UXC Q;  1SR3 A;  3WWV A;  2IHF A;  4GLX A;  4JBK A;  1L1O A;  2EXD A;  2LXK A;  2RF4 A;  1VQG A;  3KF8 B;  4DAM A;  5HGQ A;  4JBM A;  1IL2 A;  4DV6 L;  4A3K H;  2NVT H;  2JA7 G;  2E2I H;  2JEA I;  3CCV A;  1YJN A;  4X62 Q;  3BU2 A;  1JE5 A;  1X3E A;  2VS1 A;  4GS3 A;  1E1O A;  2N8N A;  2PMZ E;  1V43 A;  3PUW A;  3JAM c;  1HNX L;  3S15 H;  2VUM G;  3FKI H;  2PQA A;  4R1J A;  2OTJ A;  2UUB L;  4L5Q A;  2AWO A;  2KCM A;  2ASB A;  2RHQ B;  1GD7 A;  3CPF A;  4HIK A;  3OW2 A;  5GRO A;  1N32 L;  2Q2H A;  1I5F A;  5M3F H;  4P75 A;  3RR5 A;  2K4K A;  1KL9 A;  3L2P A;  3TQY A;  3M85 A;  4A3F H;  3ULJ A;  3DLL A;  2UUA L;  1KQS A;  1HH2 P;  5IP9 G;  4UP9 A;  1KC8 C;  4C2M H;  3I4M G;  1UE6 A;  3M4Q A;  1SLJ A;  4DNI A;  1HR0 W;  4QJF A;  2I5L X;  2VQE L;  1WYD A;  2HHH Q;  2IX1 A;  4P71 A;  1G51 A;  2ALY B;  2Z6K C;  3PIO A;  2CWP A;  2VQE Q;  1TWH H;  5LMU Q;  2WFW A;  4DUY Q;  3GTK H;  3CW2 C;  4A3G H;  4B3R L;  3PUY A;  3ICE A;  1PFS A;  4A3E G;  2HQL A;  1PV4 A;  1XMO Q;  2MO0 A;  4B3R Q;  2I5M X;  5H1S E;  4IOC A;  3K0X A;  4K0K L;  2JA6 G;  3I55 A;  2YTV A;  4NB3 A;  5ELO A;  5IWA Q;  1Q82 C;  5C0X G;  3AFP A;  1P8L A;  2F3I A;  1S3O A;  1PH2 A;  2B63 G;  1EUJ A;  2K14 A;  1J5E L;  4JC0 A;  4DR5 L;  4LUO A;  2ZJP A;  1FJG L;  3I4N H;  1KAW A;  2JK8 A;  4DR5 Q;  1J5E Q;  4PMW A;  4L5S A;  1XNR L;  2R92 H;  3TRE A;  4A3L H;  4KHZ A;  1XNR Q;  5JJI A;  1VQ4 A;  1NJI C;  4BXX G;  1N8R C;  4L5T A;  5C4X H;  1VQD A;  1U5K A;  1R9T H;  2BH2 A;  1BVS A;  4ME3 A;  2MQH A;  4JI5 L;  1QVF A;  1WCM H;  1CKN B;  3MEF A;  3KJP A;  1PH8 A;  4IPD A;  5BR8 Q;  4JI7 L;  4DR4 L;  5IP7 H;  2FXQ A;  3UDX A;  4GN3 B;  2CCZ A;  3F1Z A;  1E24 A;  1I3Q H;  2YTX A;  3L7Z C;  4C3H H;  2ZJR A;  1SFO H;  3GD7 A;  1W2B A;  4YCU A;  2YV5 A;  3PUX A;  1L0W A;  4IFD I;  4JV5 Q;  1AH9 A;  3KDF B;  5IT9 c;  2JA8 H;  4B3S L;  1CSQ A;  4A3J G;  4BY7 G;  1QVG A;  2WAQ E;  4BA2 I;  4B3S Q;  1EQQ A;  4DR3 Q;  2ZTD A;  3S24 A;  3PF5 A;  1Q86 C;  1OXT A;  3KOJ A;  3J81 j;  3I56 A;  1JT8 A;  1JJG A;  1C7Y A;  2R93 H;  4LUV A;  1E22 A;  4DK6 C;  4JYA Q;  1AE3 A;  1HNZ L;  4X64 L;  1XTD A;  1OTC A;  3M9B A;  2VW9 A;  4OO1 I;  2H5X A;  3U50 C;  4X66 Q;  3K7A H;  2ZM6 L;  2UUC Q;  2R7D A;  4DR1 Q;  2AKW B;  3W1G A;  4GOP B;  3S17 H;  5IYC H;  2BA0 A;  3E0E A;  2I0Q A;  3I7F A;  4A3I H;  3RLO A;  2KHI A;  4UPA A;  5AJ3 L;  4J15 A;  4PZ8 A;  2F4V Q;  2VL6 A;  4A3B G;  4NPS A;  4JI2 L;  2Y0S G;  1N33 Q;  2JA7 H;  2QGQ A;  2LSS A;  1M90 C;  2AMC B;  4GLV B;  1K73 C;  5IYD G;  3CAM A;  5M5Y H;  1N34 Q;  3S2D H;  1Y1V G;  1BBU A;  4DV3 L;  4A3C H;  4JBJ A;  1CUK A;  2VUM H;  1TWA H;  4QY7 A;  1YZ6 A;  4A93 G;  2OQ0 A;  4DV1 L;  5GAE C;  3BZC A;  1KRS A;  1Q81 C;  1EYG A;  3S1Q H;  4JG2 A;  2EQS A;  3EIV A;  5M3M G;  1HNW L;  3PF4 A;  2GVA A;  4YCW A;  1QZH A;  2WB1 G;  5GAG C;  2RCN A;  1X6O A;  3HKS A;  3CD6 A;  2K5N A;  3EBE A;  1AE2 A;  1B70 B;  2JA9 A;  5IP9 H;  4EQ5 A;  4HJ7 A;  4LFA L;  3W5O A;  2ZTC A;  1NBW A;  4JI4 L;  3BZK A;  3NEN A;  3CC2 A;  3RZO H;  1EIY B;  5C4J H;  1LYL A;  4JI4 Q;  3T1H Q;  2ZTE A;  1H95 A;  2XGT A;  2UXC L;  1VQ9 A;  3PO2 G;  2LXJ A;  4A3E H;  3HOW G;  4PG3 A;  2VQF Q;  5DLQ E;  2OTL A;  2KEN A;  4DV0 Q;  4GOP C;  4X62 L;  4R4C A;  3PO3 G;  2NN6 G;  1SN8 A;  1U0L A;  3ERS X;  3UDF A;  5LMN W;  1IBM Q;  3S2H H;  1K8G A;  2B63 H;  3KDF A;  4A75 A;  4YCV A;  3F2B A;  1XPR A;  2D0O A;  1YIT A;  5IY0 A;  5GAH C;  1MJE A;  3GTL H;  2R7Z H;  4BXX H;  4DR2 L;  4R4O A;  1EWI A;  5J3B A;  3HKZ E;  4DV7 Q;  4DR2 Q;  3D0F A;  3H0G G;  4XIG S;  1OXS C;  4A76 A;  2Q2I A;  3PSI A;  2L15 A;  2DGY A;  1PA6 A;  4JI0 L;  3TRZ A;  2Z0S A;  4JI0 Q;  4IO9 A;  1VQL A;  1JJC B;  4LFB Q;  2B29 A;  2HHH L;  2PI2 A;  3PCO B;  3GTJ H;  4A3J H;  4BY7 H;  1C0A A;  1PVO A;  3CC7 A;  5LMU L;  4DUY L;  1VQ5 A;  1D8L A;  2HIX A;  1K9M C;  2JA5 G;  1E3P A;  1EQR A;  1XMO L;  5ELN A;  4A3M G;  1HZ9 A;  1YIJ A;  2B3G A;  3GTO H;  4OON A;  1PHJ A;  3K81 C;  1QUQ B;  4QIW E;  3U4Z A;  1FL0 A;  1PH5 A;  2ID0 A;  5IWA L;  4HIO A;  1K3R A;  5C44 H;  3TS0 A;  4DKA C;  3PUZ A;  4LF9 Q;  2D0P A;  1BBW A;  5JEA J;  4DUZ Q;  4JOI C;  4YY3 Q;  1VQI A;  1X3F A;  4LW1 A;  3OTO Q;  4UY8 C;  4DR7 Q;  1VQA A;  4BY1 H;  3CCE A;  4GKJ Q;  3S1R H;  4AIM A;  3PIP A;  1VQB A;  3GO5 A;  5M5W H;  3H3V I;  3NEM A;  3RN2 A;  3L0O A;  3G48 A;  1VQE A;  3CCQ A;  1VQJ A;  1N9W A;  4BBR G;  3RZD H;  1LTL A;  1HZB A;  4OX9 L;  5BR8 L;  4A3B H;  2UXD Q;  2Z6K A;  4OX9 Q;  5IYB H;  4EX5 A;  1Q46 A;  3S16 H;  5JJK A;  2GN5 A;  3J81 i;  3HOX G;  3KLW A;  1YNX A;  3DM3 A;  4X6A H;  2JQO A;  2YYZ A;  4JCV E;  4JV5 L; 
#chains in the Genus database with same CATH topology
 1CHP D;  2Z6B A;  3BZD B;  3VDY A;  4PZ6 A;  1MHW C;  1XNQ Q;  1WI5 A;  1E0B A;  1PMR A;  4G57 A;  1G2T A;  4ZUJ A;  4JW0 A;  3CCU A;  1I50 H;  1SYC A;  2I5H A;  5M3M H;  1EFI D;  2SNS A;  5FO9 B;  2QA4 A;  1NTG A;  4X66 L;  1W6K A;  4M8A A;  5CGK A;  2KHS A;  2JE6 I;  5C5M A;  3K80 C;  4IPH A;  1M1K C;  1EFW A;  1UE7 A;  1XPO A;  4RHS A;  4EVO A;  2QEX A;  3TS2 A;  4UP8 A;  4X3U A;  3ITP A;  5C3X A;  1Q90 A;  5JEA G;  1Y8O B;  4LFC L;  1K8A C;  3WOE A;  1II3 A;  2F0W A;  3I4M B;  1JIC A;  2R6G A;  2NN6 H;  1EWH A;  1VS0 A;  3IFT A;  1S72 A;  1X3G A;  1X32 A;  4ZCK A;  3U58 A;  4DV4 Q;  1LTT D;  4KKU A;  1DXM A;  1X54 A;  5FJ8 G;  1ENF A;  4GKK Q;  4RG1 A;  1RCV D;  5IT9 L;  1HR0 L;  1NUC A;  1VQO A;  4LWC A;  1JJ2 A;  1G29 1;  3I4M H;  1P16 A;  1O7I A;  2UXB Q;  4LAA A;  2OT2 A;  3ZJY C;  3T1H L;  1V1P A;  1HJP A;  4K6D A;  2NVQ B;  2JA5 H;  1LO5 D;  4G7O C;  2Q8R E;  1XPU A;  2B2Y A;  4R4Q A;  2FMM A;  3CC4 A;  1IXR A;  3GQB A;  3P20 A;  1NR2 A;  1T5E A;  1E1T A;  1FNW A;  2M9V A;  2XSC A;  4RA8 A;  4A3J B;  1VQ7 A;  4BY7 B;  2C5C A;  1SNM A;  5I6W A;  4KMU C;  3KJO A;  2HT1 A;  4R9W A;  4I7A A;  1X55 A;  4DR6 Q;  2D62 A;  5IGC A;  3Q22 A;  3CMA A;  3CPW A;  3HOU G;  4XTC S;  4DV7 L;  1FVI A;  4YWK A;  2NVQ H;  1HFN A;  4KD4 A;  2WKC A;  3HOX H;  4C3J G;  2KBN A;  3G4S A;  1M4V A;  2B2U A;  3ULP A;  3NBH B;  4IUR A;  3FHW A;  2DUD A;  5FLM G;  4KV6 A;  1UEB A;  4O0A A;  2Y0S B;  1SBB B;  4JI1 L;  3A5U A;  1HNX Q;  2OXP A;  4RHR A;  2A1A A;  4RKB A;  4DNT B;  2HQE A;  3B6Y A;  4GNX B;  1PTO H;  3A5Z B;  4RGO S;  5CV8 A;  1O7L A;  2Q8I B;  4IUQ A;  3S9W A;  4YY3 L;  3OTO L;  4HSP A;  2ENB A;  4GKJ L;  4V19 0;  1PXU A;  1ENA A;  4B9W A;  4IFD G;  4DV2 L;  5GQO A;  1EOV A;  5JEA H;  2WB1 B;  4WJ4 A;  2QDB A;  5EQ0 A;  5J39 A;  1W3S A;  4C3I B;  5D65 A;  2HIV A;  1Z47 A;  4KKS A;  2CKZ B;  3T1Y L;  3GTM B;  1A0I A;  4P72 A;  3HOW B;  4B3T Q;  5FJ8 H;  1L0Y B;  1ET9 A;  1PZK D;  4FXK C;  4R4I A;  3H09 A;  4DAY B;  1L1O B;  2KHJ A;  1SRU A;  5M3F G;  4DV5 Q;  1MKH A;  2DNC A;  2L55 A;  1FNU A;  2F3V A;  3DEP A;  4LF7 Q;  3EFX D;  1SRO A;  2EY2 A;  4AYB E;  1K0R A;  1PYB A;  4NW2 A;  5J1Z A;  2E2H H;  1YHA A;  4WJ3 M;  3A74 A;  2F0F A;  3FPU B;  3I4L A;  3FVQ A;  3TBI B;  3DWP A;  2E2D C;  1WTW A;  3T16 A;  2G9D A;  1PTO D;  2AQ3 B;  5ELC A;  4DK3 C;  3E9I A;  4MTN A;  1Q1B A;  1EOT A;  1HNZ Q;  1TS2 A;  3AU7 A;  5T1G A;  1OXV A;  3F2U A;  4IUT A;  1IZ6 A;  1GO3 E;  3BYY B;  1A15 A;  1HQM C;  3HOU H;  4LF6 Q;  4ULL A;  2WAQ G;  1I6H B;  5JPM C;  4DPG A;  1IBK L;  1AP0 A;  3FP9 A;  4LF8 Q;  2BE5 C;  1I94 Q;  4C3J H;  2EJM A;  1TWG B;  4L63 B;  4HJ5 A;  1PZJ D;  1I4P A;  4B9X A;  4C1N I;  4P2C B;  3AFQ A;  4BBR B;  5FLM H;  4YHH L;  3CQZ B;  2JA8 G;  5BN3 A;  4HMI A;  5A35 A;  4DV1 Q;  3D4W A;  1MIU A;  2EY1 A;  4HJ9 A;  2F0N A;  3IL8 A;  4Q5V A;  1I6H H;  1KLG D;  2R93 G;  2IWH A;  3CCJ A;  1YNN C;  4BA1 I;  1VQF A;  3U9O A;  5LL6 S;  1YEZ A;  4LFA Q;  4IFD H;  1TWG H;  1LM0 A;  2A73 B;  3KF6 B;  2PI2 E;  2CHB D;  3CQZ H;  4EGV A;  2PZU A;  5COY A;  4GLX A;  2LXK A;  3KF8 B;  5DM6 3;  2F3W A;  4DAV A;  2SEB D;  1B4O A;  3J81 E;  3DUZ A;  2JA7 G;  1JE5 A;  1X3E A;  1V43 A;  4MIU A;  1ILQ A;  3JAM c;  2L11 A;  2AWO A;  5FLX E;  5M3F H;  4P75 A;  2HUG A;  2QF7 A;  2J7Z A;  1JOQ A;  3DLL A;  2UUA L;  5FOB B;  1HH2 P;  2BDO A;  4BS9 A;  3T56 B;  3P7J A;  3V2T A;  5IGF A;  4P71 A;  2Z6K C;  1LT5 D;  3PIO A;  5LMU Q;  4DUY Q;  2K5Q A;  2IPK D;  4B3R L;  4CDC C;  4OHJ A;  4A3E G;  1SFO B;  2JA6 G;  2YTV A;  4NB3 A;  1WTO A;  1PTO C;  4K8J A;  5C0X G;  3AFP A;  1S3O A;  1PH2 A;  1EUJ A;  1TT2 A;  1J5E L;  1DCZ A;  2ZJP A;  4ZYS A;  2EVB A;  4L5S A;  1D2B A;  3TRE A;  5JJI A;  4KHZ A;  1VQ4 A;  4BXX G;  2MUY A;  2HCI A;  2PCF B;  1LTB D;  2PW5 A;  4JI5 L;  4N8X 1;  4JPB W;  4IPD A;  2XWB B;  4DR4 L;  1RF2 D;  2FXQ A;  1TWF B;  2CCZ A;  1SFO H;  1I3Q H;  3L7Z C;  3GD7 A;  4A3I B;  3A8K E;  2JA8 H;  1FGB D;  1H9J A;  5LL6 X;  1QVG A;  4BA2 I;  3S1M B;  2TSS A;  3S24 A;  4G4K A;  3J81 j;  3I56 A;  4IUU A;  3MEH A;  1JT8 A;  3D3R A;  1JJG A;  2IW3 A;  2R93 H;  4MTK A;  4DK6 C;  1BO0 A;  4X64 L;  1XTD A;  1BCP B;  3TP5 A;  4X66 Q;  2FMC A;  2WKD A;  2NYZ D;  1I4Q A;  1J8I A;  5EPK A;  4J6H A;  2NVY B;  4A3I H;  4F7X A;  1KAA A;  3HOY B;  5AJ3 L;  1TS4 A;  2XRS D;  5I4D A;  1U4P A;  2JA7 H;  3MFG A;  2F0H A;  1ZYR C;  1A3T A;  2J4X A;  5JOB A;  5M5Y H;  2I46 A;  1CUK A;  1SYG A;  2K01 A;  2RKS A;  3HKZ B;  2AQ2 B;  4A3K B;  1F9Q A;  2RDG A;  4JG2 A;  1SYF A;  3EIV A;  1SE2 A;  1HNW L;  1G8Z D;  1ZEQ X;  2LMC B;  4YCW A;  3S15 B;  3FKI B;  2K5N A;  1AE2 A;  1B70 B;  4EQ5 A;  5DM7 3;  3W5O A;  2WII B;  1SE4 A;  1NBW A;  3IAY A;  4JI4 Q;  1LYL A;  2IL8 A;  3KLS A;  2ZTE A;  4ZRZ A;  2IX3 A;  2XGT A;  3T1H Q;  2K1B A;  2UXC L;  2KED A;  4A3F B;  3PO2 G;  4A3E H;  4JVZ A;  4DAY A;  1XX8 A;  3NPP A;  5FO8 B;  1JCK B;  5E3F A;  5IT9 E;  3PO3 G;  5C0X H;  1U0L A;  3QG1 A;  3S2H H;  1E2V A;  4MHE A;  4HCS A;  4KTA A;  3GTK B;  4A75 A;  4YCV A;  1EEI D;  5IY0 A;  4RAU C;  1HQR D;  4BXX H;  3BDO A;  4DV7 Q;  1PYW D;  2K05 A;  3WOF A;  1WTH A;  3QO2 A;  1D5M C;  1OO9 B;  1OXS C;  2KUM A;  4BY1 B;  2DNE A;  3S1R B;  3KBG A;  1D5X C;  1EQT A;  1NSN S;  2B29 A;  3EJI A;  1CFM A;  1R9T B;  3T51 B;  1D8L A;  3T13 A;  2HIX A;  1K9M C;  1BCP D;  2DY8 A;  4A3M G;  1HZ9 A;  2B3G A;  3MA2 B;  4OON A;  1PH5 A;  5EBC A;  1BF4 A;  2CVR A;  3PUZ A;  2EYO A;  3DWQ A;  5JEA J;  4JOI C;  3SVM A;  5KGU A;  4YY3 Q;  4XQN A;  1VQI A;  4LW1 A;  3OTO Q;  4BY1 H;  1SNC A;  4GKJ Q;  3S1R H;  3PIP A;  2F0S A;  3NEM A;  3S14 B;  3FRP B;  1VQE A;  1N9W A;  3JAM L;  4OX9 Q;  1V1O A;  2A69 C;  3S16 H;  1B3A A;  1VDZ A;  1YNX A;  3MC0 B;  2YYZ A;  2XN9 C;  1B50 A;  4JV5 L;  1GOZ A;  2NZH A;  3HEJ A;  4OO1 G;  3T1Y Q;  1KHI A;  4DR3 L;  3PO2 B;  4CHT B;  4JOI A;  3KF6 A;  3I4O A;  4EQO A;  1PH1 A;  3F8T A;  2QEJ C;  3D4D A;  5K5P A;  3AMU A;  4M1U B;  3S14 H;  1CTM A;  1DOK A;  3L3O C;  3RUZ A;  2XWJ B;  4IPG A;  4LUZ A;  1W6J A;  5CV6 A;  2EY5 A;  1QNK A;  4HID A;  1NY4 A;  2LS0 1;  3EN2 A;  4A3D G;  1CZW A;  2F4V L;  3PO2 H;  3FEW X;  4GLA C;  1A63 A;  3PO3 H;  5I2X A;  1Q12 A;  3EA6 A;  2FJ2 A;  3RZO B;  1N34 L;  5C4J B;  3VR6 A;  5C3E G;  4A3M B;  1CA5 A;  2NB0 A;  2XTI A;  3R3O A;  4AYB G;  1EY9 A;  1K83 H;  2PQE A;  5E7N A;  1KDA A;  1RKN A;  2F0U A;  1XXG A;  3E9H A;  2OCE A;  1MJC A;  5J22 A;  3RLF A;  1IBK Q;  1M8A A;  1S40 A;  1NMF A;  4ME5 A;  1D6E C;  1B44 D;  5FLX L;  2E2J H;  4NP5 A;  5JAV A;  1RTO A;  4LNQ A;  3QB3 A;  3TSS A;  2B2W C;  3NEL A;  1U9R A;  1QIL A;  4A3M H;  3R93 A;  2B8G A;  1S5D D;  1NE3 A;  4IFD J;  5BN4 A;  3GTP B;  1DGS A;  1OXX K;  1ICF B;  1AW7 A;  3JAM i;  1H9S B;  1YHQ A;  3MFY A;  1VQH A;  1PFB A;  3I90 A;  4IUN A;  4BBS G;  2ES2 A;  3GTO B;  1MSH A;  2VY3 A;  4PMB A;  3AEV A;  2B2W A;  1VMP A;  1Q1E A;  2Z8L A;  3PQI A;  4OWX B;  5CV7 A;  1Q8K A;  1WTV A;  4LFB L;  4Y7N B;  3TDQ A;  1QWY A;  1KRT A;  4ABN A;  2A5H A;  3GTP H;  2M00 A;  5KND A;  1B1Z A;  1SEB D;  4TRD A;  2EIF A;  4A3C G;  4OXP A;  3RN5 A;  4YWL A;  2YTY A;  3GTQ B;  4QGU A;  3TP7 A;  2JSO A;  1A3U A;  3UDG A;  2NN6 I;  4DUZ L;  4X65 Q;  4F8M A;  4IPC A;  2KVM A;  2XVS A;  1EIF A;  2UUA Q;  4LF4 Q;  1I50 B;  4A3D H;  2B8F A;  4Y7N H;  3HOZ G;  4AQY L;  4IJH A;  1JC7 A;  5M3M B;  4APV A;  2F03 A;  5CMD A;  1MSG A;  1GXD C;  1X56 A;  2UXD L;  1K8M A;  1EY5 A;  2KCN A;  5G3L F;  4YIJ A;  3NP8 A;  1WFQ A;  4B3M Q;  1XMQ Q;  4IZ8 A;  2BOS A;  1VQ6 A;  3GTQ H;  2G9H D;  1ILP A;  1CKM A;  5IYD H;  1V9P A;  5C3E H;  3AYH B;  2K5W A;  3C3L A;  4NXN Q;  3VYU A;  3F2D A;  2NTT A;  4C1N K;  2R7Z G;  1O7Z A;  4TVA B;  1B7Y B;  2L0C A;  3VYS A;  2E5L L;  1J6Q A;  1G91 A;  4JI5 Q;  1PFM A;  3WDN A;  4KD3 A;  1KIX A;  4QQB X;  2E8G A;  4DR4 Q;  4XXE A;  3S1N H;  4KHP L;  5IGB A;  4NMZ A;  4QUF A;  1SNP A;  1KXL A;  3LGJ A;  3I3C A;  2O4X A;  1EU3 A;  3J80 c;  3CU7 A;  2GVB A;  4A3G G;  2BA1 A;  4CJ1 B;  4RGM A;  1GVP A;  4QUC A;  3U4V A;  1VF7 A;  3KLS X;  4POG A;  1LTS D;  3CF5 A;  2JA5 B;  1D7Q A;  4JBW A;  4X64 Q;  2DJF C;  3K5O A;  4UHV A;  4BBS H;  1BCP F;  4RGN A;  4OL7 A;  1HFG A;  4KY6 A;  4KI0 A;  3MXN B;  1B8A A;  4UDU C;  3HZX A;  3GTG B;  2D9U A;  3HGB A;  4DK1 A;  4I65 A;  3VR2 A;  2CFM A;  3M4P A;  5AJ3 Q;  2V1C C;  2UU9 Q;  4L5R C;  3HOZ B;  3KYH C;  4QB4 A;  3CXC A;  2BH8 A;  2H4O A;  1JQY D;  3PIP 3;  2F52 A;  2VZA A;  1CKO A;  3E0J A;  4OEM B;  1IKL A;  1TY2 A;  1IW7 C;  3ERO A;  3RLN A;  3HOX B;  1STG A;  4JI6 Q;  5JJL A;  2K7V A;  4Z9C B;  1X65 A;  4GN5 A;  1ZXT A;  2LY7 A;  3AB9 A;  4QCL A;  3GTG H;  1HZA A;  1HNW Q;  3CCL A;  1F2Z A;  2A6H C;  4PNY A;  5KYL A;  3W1B A;  3HOZ H;  3SGI A;  4LF5 Q;  1PTO B;  2KCT A;  2JEB I;  3SK4 A;  2ZJQ A;  5C0X J;  2PNH A;  2BE5 D;  2N88 A;  2UXC Q;  5DNF A;  1HHV A;  2RF4 A;  4RKL A;  4CBV A;  3VYT A;  1E2W A;  3R2I A;  4DAM A;  1LV9 A;  4JBM A;  4C2M B;  4FYD A;  2E2I H;  3VR3 A;  3BU2 A;  4ZLT F;  4GS3 A;  1E1O A;  1D1K A;  2N8N A;  1TWH B;  3PUW A;  3K5L A;  5IGE A;  2QKI C;  2EYP A;  4QMG A;  4R1J A;  2OTJ A;  4L5Q A;  3I73 A;  3C2P A;  4HIK A;  3C1E A;  1X3P A;  5GRO A;  3OW2 A;  1I5F A;  5AFW A;  3RR5 A;  1YNN D;  4KN4 C;  1O80 A;  2OF1 A;  1KQS A;  2B2V C;  5IP9 G;  4UP9 A;  4C2M H;  5BN5 A;  1SLJ A;  1HR0 W;  2DJG C;  1G51 A;  2ALY B;  3MXP A;  2VQE Q;  1QG7 A;  2EY6 A;  1TWH H;  4A3G H;  3CW2 C;  3MWY W;  1KAB A;  1PV4 A;  5H1S E;  4IOC A;  3K0X A;  1U4L A;  1ZKO A;  3I72 A;  3I55 A;  2E2H B;  5ELO A;  1NAP A;  2EE1 A;  4KK7 A;  1QJO A;  1P8L A;  1ENC A;  3EQL C;  2B63 G;  1PRT B;  2EJF C;  4DR5 L;  4PMW A;  2B2V A;  1XNR L;  3MXG A;  1HTL D;  4DN4 M;  1WD1 A;  4OGQ C;  1FYC A;  1NJI C;  1U5K A;  2BH2 A;  5A2Q L;  1QVF A;  1AFP A;  1CKN B;  5FKA C;  2KA7 A;  3HP3 A;  1H9S A;  1SE3 A;  2F0E A;  3OMC A;  4GN3 B;  3HOU B;  2YTX A;  1LTA D;  1W2B A;  3NK9 A;  4IFD I;  4JV5 Q;  1TQO A;  1CSQ A;  4N9P A;  1FD7 D;  4B3S Q;  4DR3 Q;  5JVH 3;  1AZQ A;  4C3J B;  3PF5 A;  2D5D A;  1OXT A;  3KOJ A;  2PZT A;  1G2S A;  1E22 A;  4ILW A;  3V96 A;  1OTC A;  3U50 C;  3JAM E;  3K7A H;  2R7D A;  3W1G A;  3FMC A;  2BA0 A;  1LTR D;  1Q8I A;  3I7F A;  5CC4 A;  4UPA A;  2F4V Q;  4NPS A;  4HAE A;  2LFN A;  2QGQ A;  4RH6 A;  2MJ8 A;  2F0Q A;  2ICI A;  4GLV B;  1LAB A;  4U68 A;  1N34 Q;  4RGT A;  1Y1V G;  3S2D H;  4K2K A;  4QY7 A;  2F0D A;  3I70 A;  2OQ0 A;  4A93 G;  4K5W A;  1EY0 A;  3NBI A;  1EYG A;  2H1E A;  3ONA B;  3PF4 A;  1QZH A;  3J80 L;  4K0K L;  3HKS A;  5IP9 H;  2JA9 A;  4GZY C;  1F77 A;  5I6Y A;  2ZTC A;  4EQN A;  1BR9 A;  3BZK A;  3CC2 A;  5M3F B;  1H95 A;  1SJH D;  1GUT A;  1B3Q A;  4IUV A;  2F0P A;  1Z7T A;  1PRT D;  3HRZ C;  5DLQ E;  3VR4 A;  1ZYR D;  2KQ3 A;  1WD0 A;  4GOP C;  4R4C A;  2K04 A;  1SN8 A;  3UDF A;  3NXW A;  1GUN A;  1K8G A;  2B63 H;  1JOO A;  3F2B A;  4X3T A;  1JOR A;  1HXY D;  3GTL H;  4DR2 L;  3NWT A;  5J3B A;  1B2T A;  3NTI A;  5COR A;  3OIP A;  2E75 C;  3FDT A;  3H0G G;  4A76 A;  2F0L A;  1PA6 A;  3TRZ A;  5JPN C;  3GV3 A;  2Z0S A;  1HTP A;  4JI0 Q;  4LFB Q;  1JJC B;  2WAQ B;  2HHH L;  2PI2 A;  3PCO B;  1SAP A;  1H9K A;  3GTJ H;  1SDF A;  3MXN A;  1QB5 D;  3A7L A;  3CC7 A;  1E3P A;  5C3W A;  5IOC A;  1I3Q B;  3K81 C;  2CW0 D;  3U4Z A;  5IWA L;  1K3R A;  2JA8 B;  1ML0 D;  1ICW A;  1BBW A;  4DUZ Q;  2VB3 X;  3K57 A;  1CM9 A;  1X3F A;  1WTR A;  3E5S A;  3BG3 A;  3CCE A;  1NR4 A;  4JK1 C;  2HDL A;  3H3V I;  3RN2 A;  3L0O A;  2R93 B;  1TY0 A;  2F0I A;  5KIX A;  2QW7 A;  1BOS A;  4X3S A;  2UXD Q;  4KJN A;  2Z6K A;  1T5X D;  5FO7 B;  4EX5 A;  2GN5 A;  1F2L A;  3KLW A;  4FF3 A;  1AZP A;  1LUZ A;  3J7Z C;  5CV5 A;  2JXM B;  1Y1V H;  3J80 i;  1MBY A;  4A93 H;  3D6C A;  1PFN A;  5GAD C;  4G7Z C;  1SJE D;  2RDH A;  2JA7 B;  1GUO A;  1L2F A;  2L4N A;  2ATW A;  2Y0S E;  1F2Y A;  1Q3L A;  1UE1 A;  3N52 A;  5M5Y B;  5M5X B;  1IYJ B;  2UUC L;  5C0X I;  4DR1 L;  2MGS A;  4MZ9 A;  1YVC A;  3Q0A A;  1SND A;  1A8V A;  1BKB A;  2KOL A;  1DD2 A;  4KHP Q;  2K28 A;  3A7A B;  4C56 C;  3H0G B;  1SE8 A;  2JN4 A;  3H91 A;  1TS3 A;  4YWM A;  2A69 D;  4HR7 B;  4RFB A;  1N33 L;  3P1H A;  5KNB A;  1PRT C;  4LFC Q;  3G7L A;  5C4Z A;  3GDE A;  2EOT A;  2Z1C A;  4HED A;  1CSP A;  2PZW A;  5EPL A;  5M5X H;  4A3E B;  1VQ8 A;  2JA6 B;  3NTH A;  2JJQ A;  2CQO A;  4FP5 D;  1MI2 A;  3S2H B;  3H0G H;  1HR0 Q;  3TME A;  4H02 A;  1A6X A;  4F88 A;  2YU9 B;  2MPM A;  3D8G A;  1LT4 D;  2ZXP A;  4NKL A;  3BVM A;  4CDE C;  2O5I C;  1VCI A;  4QIW B;  1Y8N B;  5K36 G;  1EL0 A;  4DV0 L;  3CCM A;  1CKN A;  1GHJ A;  2JA6 H;  2WV6 D;  5CV9 A;  2MNA A;  2BDN A;  2CW0 C;  4NDX A;  1UE5 A;  3LWE A;  1QCB D;  1YNJ C;  4IOA A;  4S3S A;  3CCS A;  2MHV A;  5ELE A;  5I9O A;  1TII D;  2IHE A;  2YU9 H;  1PTO F;  2NVX H;  4FO2 A;  5EKI A;  2K52 A;  4A4I A;  3STB C;  4K6L A;  1TKW B;  4K5X A;  5IE8 A;  4TKO B;  1MGS A;  2KJX A;  2ZXO A;  1GM5 A;  2EYM A;  2OWO A;  4R8I A;  1ASZ A;  1H9R A;  1JOK A;  3KBX A;  3F2C A;  1XWE A;  4HMJ A;  4O42 A;  4PMC A;  3S16 B;  2EYH A;  4CJ2 C;  4HSV A;  4JI1 Q;  2K33 A;  3IFD A;  1RIP A;  3NE5 B;  4ZK9 B;  1Y1W G;  3K5M A;  3QIA A;  2WP8 J;  2EPB A;  3EVQ A;  1SNQ A;  2PYK A;  1NMG A;  1Z9F A;  4QF4 A;  4DV2 Q;  2EYJ A;  3SE0 A;  1I4X A;  2IJ0 A;  2N49 A;  4FDB A;  4DFA A;  1NCV A;  1PH7 A;  1S5C D;  3K59 A;  1FGU A;  2A6E D;  1C9O A;  2F0V A;  4HJ8 A;  3M7N A;  2L5T A;  1PH6 A;  2HD3 A;  1LT3 D;  4FF2 A;  1VQK A;  1XYI A;  4B3T L;  1UAP A;  2PW7 A;  3G6E A;  5ELB A;  1AEX A;  1KNE A;  1PRT F;  4FVM A;  5EKK A;  3J7Y W;  3PO3 B;  1Y8P B;  2RHS B;  2NZO A;  4DV5 L;  4JI3 L;  4TQU S;  4LF7 L;  1RD9 D;  1IBL L;  5ISR A;  1YBY A;  3HG9 A;  1K83 B;  2K5V A;  1SSO A;  2VNU D;  3SK5 A;  1A2U A;  3HFZ B;  4IQZ A;  3UDI A;  1VQC A;  3K5N A;  1WJJ A;  5LMN L;  1HPC A;  1BXT A;  5HGT A;  3R2T A;  5K36 H;  2WAC A;  2K50 A;  2O2L D;  3U9S A;  2E2J B;  4LMQ D;  2C35 B;  2RBM A;  4GN4 B;  2IY5 B;  5C44 G;  1T9H A;  3PGZ A;  5A2Q E;  5EPJ A;  4LF6 L;  2N78 A;  3I4N G;  1YJW A;  1D1I A;  3P75 A;  4HIM A;  1VQP A;  2R92 G;  4K8I A;  4LF8 L;  4A3L G;  2MO1 A;  2G5D A;  5C4X G;  1I94 L;  1KNA A;  5IYB G;  1A62 A;  1VMC A;  1TU2 B;  1N36 L;  1CZG A;  3Q8D A;  4C3H G;  3VA5 A;  1EY4 A;  1ASY A;  1B9N A;  5EAY A;  4YHH Q;  3MVV A;  1PYS B;  2AUJ D;  1RL2 A;  1TR5 A;  4DU9 A;  4NXM L;  1YI2 A;  2ZT9 C;  2EJG C;  1X9N A;  2I07 B;  1EEF D;  1TWC H;  5F2D A;  4KJO A;  1Y1W H;  1BQQ T;  1NNX A;  4K0K Q;  1XJV A;  3RNU A;  1L0X B;  2MP1 A;  4CDD C;  3ND9 A;  5IYC G;  2N55 A;  3D31 A;  1K3B C;  1IHZ A;  4PZ7 A;  4B08 A;  4JI8 L;  3IRB A;  1UEA B;  2K75 A;  2KCC A;  3NQT A;  4QL5 A;  2E74 C;  1PDQ A;  3PMF A;  4FNF A;  5HGQ A;  1IL2 A;  1TVX A;  3VR5 A;  4A3D B;  3RD4 A;  4DV6 L;  2F0M A;  2NVT H;  4H13 C;  2JEA I;  3CCV A;  1YJN A;  2A6E C;  4OO1 H;  1KDC A;  1R4Q B;  2PMZ E;  4WJW A;  3A54 A;  2SOB A;  3J80 E;  4DXG A;  1IW7 D;  2PQA A;  2AUK A;  1A3V A;  2UUB L;  5KYI A;  2ASB A;  1STE A;  3CPF A;  3TZD A;  1KTK A;  1N32 L;  2Q2H A;  5C3E B;  5C4H A;  2A6H D;  3TP8 A;  3L2P A;  4AYB B;  3NHH A;  1AN8 A;  3TQY A;  3M85 A;  2R92 B;  3I4M G;  3NQI A;  1I6V C;  1UE6 A;  1FR3 A;  5C4X B;  4DNI A;  1WYD A;  3OPO A;  2HHH Q;  2IX1 A;  1HA6 A;  2CWP A;  4DGZ A;  2HQL A;  4C3H B;  3S1N B;  2MO0 A;  5JVG 3;  4B3R Q;  3TZU A;  4IAL A;  5IWA Q;  2VXW A;  2X69 A;  3I91 A;  1EY8 A;  4ZQ3 A;  1JE4 A;  3A55 A;  4BWG B;  2K14 A;  1FJG L;  3I4N H;  3IKJ A;  1KAW A;  2JK8 A;  1J5E Q;  4O1N A;  3QJY A;  2R92 H;  4A3L H;  1N8R C;  4L5T A;  5C4X H;  1VQD A;  3X3N A;  4ME3 A;  2MQH A;  5C6A A;  3LNN A;  3KJP A;  4JI7 L;  4BBS B;  2BCO A;  3UDX A;  3S17 B;  2QCP X;  4C3H H;  1E24 A;  3I8Z A;  2YV5 A;  1L0W A;  1IKM A;  1AH9 A;  4RWS C;  4ZAI A;  1SYE A;  4A3J G;  4BY7 G;  4HN7 A;  5LHY 1;  3O13 A;  2ZTD A;  4F87 A;  4H7B A;  1C7Y A;  3A8I E;  1I4R A;  4LUV A;  3M9B A;  2VW9 A;  1EIG A;  2ZM6 L;  2UUC Q;  1EYC A;  2K5D A;  3MAQ A;  4DR1 Q;  4GOP B;  4UAI A;  3S17 H;  5IYC H;  4XQQ A;  2EYL A;  3S1Q B;  3RLO A;  2A68 D;  5IGG A;  4J15 A;  1LT6 D;  4PZ8 A;  2ICE C;  4JI2 L;  4N9T A;  2Y0S G;  1N33 Q;  2LSS A;  1BNZ A;  3W3A A;  4K14 A;  2AMC B;  1M90 C;  3C1F A;  1K73 C;  3NUC A;  3CAM A;  2B39 A;  4H44 C;  5I9P A;  1BBU A;  4DV3 L;  2GA4 B;  4JBJ A;  4A3C H;  1DON A;  1YZ6 A;  2B2Y C;  3L9A X;  4IUP A;  1Q81 C;  1HRJ A;  2E2I B;  2HDM A;  3S1Q H;  1CQF A;  4KN7 C;  3OWF A;  5CYU A;  1DJR D;  1U4R A;  3UI2 A;  2K03 A;  2GVA A;  2WB1 G;  3SXH A;  2RCN A;  1X6O A;  5GAG C;  3CD6 A;  3NSW A;  4XYQ A;  1S5E D;  2R7Z B;  3Q6S A;  4C3I G;  4G7H C;  3D4R A;  3NEN A;  4JI4 L;  1STA A;  2NZ1 D;  4V0B A;  3SK8 A;  3VA7 A;  5JJZ A;  3BYT B;  3SDZ A;  1VQ9 A;  2LXJ A;  3HOW G;  3MTS A;  2OTL A;  2KEN A;  2X6G A;  1EZ8 A;  2B2U C;  4DV0 Q;  4CDF C;  4FF1 A;  4X62 L;  3LWU A;  1RDP D;  5L37 A;  2JYO A;  4DK0 A;  3ERS X;  4OIK A;  3KDF A;  4A3G B;  1O78 A;  1YIT A;  5GAH C;  1JWU D;  4LK1 C;  1MJE A;  2R7Z H;  3DWA A;  2Z9H A;  1GJX A;  1STB A;  1JB3 A;  4XIG S;  1SYD A;  1C8C A;  2Q2I A;  3PSI A;  3BDC A;  4IO9 A;  3BVG A;  4DA2 A;  1IYV A;  4HTH A;  1D5Z C;  4A3J H;  4BY7 H;  1K8O A;  1C0A A;  1PVO A;  1EQR A;  1XMO L;  1YIJ A;  3Q23 A;  5E4W C;  1QUQ B;  5FK9 C;  4DAP A;  4EQP A;  2D0P A;  3T53 B;  5EKL A;  2SDF A;  4WRD A;  4UY8 C;  1VQA A;  4CKE A;  5D3I B;  4AIM A;  5IIF A;  1VQB A;  3GO5 A;  4IN3 A;  1Y69 U;  2TMP A;  3E3X A;  2LKV A;  3G48 A;  5KEE A;  4OX9 L;  4BBR G;  1LTL A;  2A68 C;  5BR8 L;  1LTG D;  3K7A B;  1Q46 A;  4CGY B;  1IL8 A;  3DM3 A;  2Z4H A;  4JCV E;  2DN8 A;  2A74 C;  4RMF A;  2IT1 A;  2R3Z A;  2A8V A;  4O2D A;  3OMG A;  5HY6 A;  1DYQ A;  2F0O A;  4JYA L;  1B9M A;  1KD1 C;  5C5L A;  4UP7 A;  3S2D B;  1J9O A;  4MN3 A;  4JI3 Q;  2RQX A;  3ND8 A;  3UE0 A;  2FFK B;  2A19 A;  2PPB C;  1YJ9 A;  1IBL Q;  4C3I H;  3M7G A;  5KRU A;  4L6T B;  4CKC A;  5KNC A;  3UE1 A;  3GTM H;  3FPP A;  5LMN Q;  1PZI D;  4R4T A;  1EY7 A;  3HOW H;  3PV0 A;  2RA4 A;  1BBX C;  2XNA C;  2RCF A;  1WTQ A;  2IX0 A;  5DEH A;  4LJZ C;  4OWT B;  3GV6 A;  1K28 A;  3DEO A;  2B63 B;  1DZ1 A;  2XRQ D;  1ET6 A;  3GTL B;  1WTX A;  2Z4I A;  2CH4 W;  1N36 Q;  1EYA A;  5E4X A;  3ULL A;  2EYF A;  3JC6 6;  5TSS A;  3HOV G;  5NUC A;  4WOR A;  1C48 A;  2K5H A;  2VQF L;  2FIN B;  3OIQ A;  1SMX A;  4NXM Q;  3A0J A;  4Y52 H;  3R8B A;  1UNS A;  1IBM L;  3GTJ B;  5I2Y A;  4OWW B;  3PUV A;  3SR1 A;  1LTI D;  3D6W A;  3K7U C;  1QE6 A;  2NWG A;  2F4I A;  2P5Z X;  2F0K A;  1YHB A;  1CHQ D;  1IYU A;  3X3M A;  3ER0 A;  1A2T A;  4XT1 B;  4BBR H;  4A3I G;  1HUN A;  1S4Z A;  4JI8 Q;  2AWN A;  2AHO B;  4ALP A;  1E7Z A;  4KHV A;  1Y14 B;  1F9S A;  1G6Z A;  4DV6 Q;  3TEH B;  4GOP A;  2D2C C;  2EXZ A;  1PH9 A;  2VB2 X;  3BJU A;  4CKB A;  5ELF A;  1QOH A;  4WFN 3;  1OXU A;  2UUB Q;  3M4O B;  1S5F D;  4LF9 L;  4X65 L;  1Y1V B;  1N32 Q;  1SXT A;  4MNO A;  4HJA A;  1YNJ D;  4A93 B;  1JMC A;  3HOY G;  2DY7 A;  4DR7 L;  2KEC A;  4LF4 L;  1CQV A;  2MFI A;  4FXG C;  2FHT A;  5HUR A;  1VQM A;  3K58 A;  4K5V A;  1FNV A;  1Z6H A;  5E1F A;  3M4Y A;  4RCO A;  4AQY Q;  3TN2 A;  5CBA E;  1K0S A;  3STB D;  3K8A A;  4X3K A;  1F2M A;  4IJL A;  4B3M L;  1XMQ L;  2Q2U A;  3H15 A;  2QDL A;  1EZ6 A;  3MHB A;  2X6L A;  2RSO A;  2K6A A;  3HKZ G;  4CJ0 B;  3G71 A;  3OW7 A;  1ONL A;  4A3K G;  3M4O H;  3HOV B;  1XNQ L;  4NXN L;  3M3Y B;  1FJG Q;  1PH4 A;  3FKI G;  4P73 A;  4AH6 A;  2N3S A;  5ELD A;  5CBE E;  2R7F A;  1JR0 D;  3C46 A;  1QVC A;  3DM1 A;  1G6P A;  3I2Z A;  1XTC D;  1STN A;  2E5L Q;  3OYY A;  1DOM A;  3DXJ C;  4JI7 Q;  1HUM A;  3H6M A;  4A3F G;  2OEO A;  1EU4 A;  3AQQ A;  1UWV A;  1Q7Y C;  3J81 c;  5CR3 A;  2NTS A;  4H0L C;  3HOV H;  4GNX C;  2QIL A;  2PQA B;  5IOD A;  4P74 A;  4KY7 A;  2EZV A;  3M3Y H;  2AQ1 B;  2WB1 E;  4J1M A;  3BDL A;  5FLX c;  4XQJ A;  3CME A;  4OEL B;  3RMH A;  4DV4 L;  1KDB A;  3NBH A;  1I4G A;  2K32 A;  4R8N A;  2ZM6 Q;  3CP0 A;  1QZG A;  2NUC A;  1TWF H;  4GKK L;  4BY1 G;  1PH3 A;  3V05 A;  5M9O A;  1RHP A;  5D14 A;  4GNX A;  1QUQ A;  3BVZ A;  2OQK A;  4KKT A;  2UU9 L;  1WCM G;  3S1M H;  2RVL A;  3N6R A;  3QWN A;  5IP7 G;  4JI2 Q;  1LLR D;  2CWA A;  2PMZ B;  1TXY A;  4XDX A;  4FXD A;  2UXB L;  2NVX B;  4KLK A;  4POF A;  3VYR A;  1WOC A;  1TS5 A;  1GKH A;  4JI6 L;  3CCR A;  3G6J B;  1L1O C;  4DV3 Q;  1EIH A;  3H3V H;  1PLF A;  3OSO A;  5T1I A;  1V1Q A;  2Q2T A;  1JB7 A;  2NVY H;  4DF7 A;  4ZUI A;  3J7A F;  5G3L D;  3HOY H;  1CK1 A;  1HZC A;  4DR6 L;  2F0J A;  3KFU A;  4LF5 L;  3J7A 5;  1O7Y A;  2C9O A;  1SMY D;  1VQN A;  4ODG A;  2EDG A;  2Q8T A;  1SR3 A;  3WWV A;  2IHF A;  4JBK A;  1L1O A;  2EXD A;  4OIJ A;  1VQG A;  3T4A C;  5IGD A;  4TSS A;  1ESR A;  4XYO A;  4A3K H;  1CA6 A;  3DHQ A;  4X62 Q;  1UUP A;  2VS1 A;  4DNR B;  1CT1 D;  1JWM D;  1VF5 C;  1HNX L;  3S15 H;  2VUM G;  3FKI H;  2KCM A;  4XT3 B;  2RHQ B;  3H94 A;  1GD7 A;  1JWS D;  2K4K A;  1GUS A;  1KL9 A;  1BDO A;  4RCN A;  4A3F H;  2F0T A;  3ULJ A;  4I7Z C;  3GP7 A;  1KC8 C;  1LAC A;  3M4Q A;  1MD2 D;  4QJF A;  2I5L X;  2VQE L;  1SNO A;  1WCM B;  2WFW A;  3GTK H;  5D3D A;  3PUY A;  3E6Z X;  1PFS A;  3ICE A;  1SYB A;  1XMO Q;  2I5M X;  2RSN A;  4DXF A;  3SHL A;  1Q82 C;  2RDF A;  2F3I A;  3LX0 A;  3MZ5 A;  1C4Q A;  4JC0 A;  4LUO A;  1DM0 B;  1V1P B;  4DR5 Q;  3J7A V;  1XNR Q;  3CRL C;  3HS0 C;  1R9T H;  1BVS A;  1WCM H;  3MEF A;  1PH8 A;  3OOC A;  5BR8 Q;  3ZYY X;  1U4M A;  5IP7 H;  2L12 A;  3F1Z A;  3KLR A;  2ZJR A;  4YCU A;  3PUX A;  2J0T D;  3K6O A;  3KDF B;  5IT9 c;  4B3S L;  4Q0F A;  1GUG A;  2WAQ E;  1EQQ A;  4K2L A;  1Q86 C;  2M2L A;  1S5B D;  3KF8 A;  4ID6 A;  3CRK C;  4JYA Q;  1WTP A;  1AE3 A;  1HNZ L;  3CKI B;  2VUM B;  1TWA B;  4OO1 I;  2H5X A;  2KEE A;  2AKW B;  1RTN A;  1EWC A;  1TWC B;  3E0E A;  2I0Q A;  1EYD A;  4N8F A;  1SMY C;  4ZKC B;  2KHI A;  3KUP A;  1Y1W B;  1WVL A;  1V8Q A;  1BUV T;  2VL6 A;  4A3B G;  3KK7 A;  5IYD G;  2V4D A;  4E6I A;  2VUM H;  1B53 A;  1R4P B;  1TWA H;  1E2Z A;  4DV1 L;  5GAE C;  3PIO 3;  3TP6 A;  3BZC A;  1KRS A;  2NVT B;  2CH4 A;  3J81 L;  2F0G A;  2EQS A;  2PO4 A;  5M3M G;  3A8J E;  1GHK A;  3MXU A;  1ESF A;  1F9P A;  2HCC A;  2WIN B;  3EBE A;  4HJ7 A;  4LFA L;  3URY A;  4L8J A;  3NWS A;  4KY5 A;  4J8Q A;  5EBD A;  3SK6 A;  4U67 3;  3RZO H;  1EY6 A;  1EIY B;  5C4J H;  1X3Q A;  3ERQ A;  4FF4 A;  1BCP C;  4PG3 A;  2VQF Q;  5CV4 A;  2L1B A;  3H3V C;  4PV1 C;  1H9M A;  2NN6 G;  3QOL A;  5LMN W;  1IBM Q;  1RJT A;  1XPR A;  2ZXR A;  2JP1 A;  2SNM A;  1I4H A;  2D0O A;  3DMU A;  2F1M A;  5C44 B;  1QNU A;  4R4O A;  1EWI A;  2R61 A;  3HKZ E;  4DR2 Q;  3BS1 A;  1ROD A;  3D0F A;  1GUW A;  5EGT A;  3I4N B;  4JI0 L;  2L15 A;  2DGY A;  3QOJ A;  3NTK A;  4PQX A;  3A56 A;  5M5W B;  1VQL A;  5EJW A;  4ZKB B;  2B2T C;  3OHX C;  3RZD B;  1CI3 M;  5LMU L;  4DUY L;  2E76 C;  1VQ5 A;  4A3B B;  3OWE B;  2JA5 G;  2O5J C;  5ELN A;  1EQV A;  2CQA A;  1F9R A;  3GTO H;  2L9H A;  1PHJ A;  4QIW E;  1FL0 A;  1HA5 A;  2ID0 A;  4HIO A;  3K0Y A;  5C44 H;  2PNR C;  4DKA C;  3TS0 A;  4LF9 Q;  3SEB A;  3Q24 A;  1STY A;  5DAU A;  4HCE A;  1KLU D;  4DR7 Q;  2XIW A;  3QR8 A;  5M5W H;  3W2D A;  2B2T A;  3CCQ A;  1VQJ A;  3RZD H;  1STH A;  1HZB A;  4A3B H;  5IYB H;  5JJK A;  2NBF A;  3CHB D;  3J81 i;  3HOX G;  4X6A H;  1DOL A;  2JQO A;  1HCZ A; 
#chains in the Genus database with same CATH homology
 1LUZ A;  3J7Z C;  2NZH A;  3VDY A;  1Y1V H;  4OO1 G;  4PZ6 A;  3T1Y Q;  4RMF A;  1KHI A;  3J80 i;  4DR3 L;  1XNQ Q;  1WI5 A;  4A93 H;  2IT1 A;  5GAD C;  4JOI A;  3KF6 A;  2A8V A;  3I4O A;  1PH1 A;  3F8T A;  3CCU A;  1I50 H;  4O2D A;  2I5H A;  5HY6 A;  1L2F A;  4JYA L;  5M3M H;  1KD1 C;  2ATW A;  2Y0S E;  3S14 H;  4UP7 A;  2QA4 A;  1NTG A;  1UE1 A;  4X66 L;  1IYJ B;  2UUC L;  4JI3 Q;  2JE6 I;  4IPG A;  4LUZ A;  5C0X I;  3UE0 A;  4DR1 L;  2A19 A;  4MZ9 A;  1YVC A;  1YJ9 A;  3K80 C;  4IPH A;  4HID A;  1M1K C;  4C3I H;  1IBL Q;  1A8V A;  1BKB A;  1NY4 A;  1EFW A;  1UE7 A;  1XPO A;  4KHP Q;  3EN2 A;  4A3D G;  2QEX A;  3TS2 A;  4UP8 A;  3UE1 A;  1SE8 A;  2F4V L;  5JEA G;  3GTM H;  3PO2 H;  4YWM A;  5LMN Q;  4R4T A;  3HOW H;  3PV0 A;  4GLA C;  4LFC L;  1K8A C;  1A63 A;  1N33 L;  4LFC Q;  2R6G A;  3PO3 H;  1VS0 A;  1Q12 A;  1S72 A;  3GDE A;  1X3G A;  1N34 L;  3U58 A;  1CSP A;  5M5X H;  5C3E G;  4DV4 Q;  2XTI A;  4AYB G;  1X54 A;  1VQ8 A;  1K83 H;  5FJ8 G;  2IX0 A;  2JJQ A;  4GKK Q;  5E7N A;  4RG1 A;  2CQO A;  4OWT B;  3E9H A;  2OCE A;  1HR0 L;  1MJC A;  3H0G H;  3RLF A;  1IBK Q;  1HR0 Q;  1VQO A;  4LWC A;  1S40 A;  1NMF A;  4H02 A;  1JJ2 A;  1G29 1;  3I4M H;  1P16 A;  1O7I A;  2E2J H;  2UXB Q;  1N36 Q;  3ZJY C;  3ULL A;  3T1H L;  1HJP A;  4LNQ A;  3JC6 6;  3NEL A;  2JA5 H;  3HOV G;  1VCI A;  2E5L L;  2K5H A;  4A3M H;  2VQF L;  1XPU A;  1SMX A;  5K36 G;  4R4Q A;  3CC4 A;  1IXR A;  3CCM A;  4DV0 L;  1CKN A;  3A0J A;  1NE3 A;  4NXM Q;  2JA6 H;  4IFD J;  4Y52 H;  1DGS A;  1OXX K;  1E1T A;  2MNA A;  1IBM L;  1VQ7 A;  1UE5 A;  3JAM i;  1YHQ A;  1VQH A;  4OWW B;  3KJO A;  3PUV A;  2HT1 A;  4IOA A;  3K7U C;  3CCS A;  1X55 A;  4DR6 Q;  2D62 A;  4BBS G;  2ES2 A;  1YHB A;  3CMA A;  3CPW A;  3HOU G;  4XTC S;  3ER0 A;  2VY3 A;  2IHE A;  2YU9 H;  4DV7 L;  4BBR H;  2NVX H;  4A3I G;  1FVI A;  4YWK A;  3AEV A;  4JI8 Q;  2K52 A;  2AWN A;  2AHO B;  3STB C;  4A4I A;  4ALP A;  2NVQ H;  1E7Z A;  1Q1E A;  4OWX B;  3HOX H;  1Y14 B;  1Q8K A;  5IE8 A;  4LFB L;  2KBN A;  3G4S A;  1KRT A;  1GM5 A;  4DV6 Q;  2OWO A;  3GTP H;  3TEH B;  3ULP A;  3NBH B;  4GOP A;  1ASZ A;  3FHW A;  2DUD A;  5FLM G;  1PH9 A;  3F2C A;  2EIF A;  3BJU A;  4A3C G;  1UEB A;  4O0A A;  4OXP A;  4YWL A;  3RN5 A;  1HNX Q;  4JI1 L;  3A5U A;  2YTY A;  1OXU A;  2A1A A;  2UUB Q;  4JI1 Q;  4QGU A;  3B6Y A;  4GNX B;  3A5Z B;  1RIP A;  4LF9 L;  4X65 L;  1N32 Q;  3UDG A;  2NN6 I;  4MNO A;  4X65 Q;  4DUZ L;  4YY3 L;  4HJA A;  1JMC A;  3OTO L;  1Y1W G;  3HOY G;  4DR7 L;  4LF4 L;  2WP8 J;  4IPC A;  2MFI A;  4GKJ L;  2UUA Q;  1EIF A;  4LF4 Q;  1VQM A;  4A3D H;  4IFD G;  4DV2 L;  1NMG A;  4Y7N H;  4AQY L;  1Z9F A;  4IJH A;  5GQO A;  3HOZ G;  4APV A;  4DV2 Q;  4AQY Q;  1EOV A;  2N49 A;  4FDB A;  1X56 A;  2UXD L;  3STB D;  4WJ4 A;  3K8A A;  4B3M L;  4IJL A;  1PH7 A;  1WFQ A;  1XMQ L;  2Q2U A;  3H15 A;  4B3M Q;  1W3S A;  1XMQ Q;  1VQ6 A;  3GTQ H;  2HIV A;  3HKZ G;  1Z47 A;  1FGU A;  3G71 A;  1C9O A;  1CKM A;  4A3K G;  3M4O H;  4HJ8 A;  3T1Y L;  2CKZ B;  3M7N A;  1V9P A;  1XNQ L;  1PH6 A;  5IYD H;  5C3E H;  1VQK A;  4B3T L;  1A0I A;  3AYH B;  4P72 A;  4NXN L;  3G6E A;  4B3T Q;  5FJ8 H;  4NXN Q;  1FJG Q;  1PH4 A;  3FKI G;  4P73 A;  3F2D A;  4AH6 A;  2N3S A;  4R4I A;  2R7Z G;  2RHS B;  2NZO A;  4TVA B;  1B7Y B;  4DV5 L;  2R7F A;  4DAY B;  1L1O B;  4JI3 L;  1QVC A;  2KHJ A;  1J6Q A;  1SRU A;  3I2Z A;  4TQU S;  5M3F G;  4DV5 Q;  2E5L Q;  1MKH A;  4LF7 L;  1G6P A;  4JI5 Q;  3OYY A;  1KIX A;  1IBL L;  4QQB X;  1YBY A;  4LF7 Q;  2E8G A;  4A3F G;  4JI7 Q;  4DR4 Q;  2K5V A;  1SRO A;  3S1N H;  4KHP L;  3AQQ A;  4AYB E;  1UWV A;  1Q7Y C;  1K0R A;  2VNU D;  3HFZ B;  3J81 c;  1PYB A;  3UDI A;  1VQC A;  1KXL A;  2E2H H;  3HOV H;  1YHA A;  4GNX C;  4WJ3 M;  2PQA B;  3A74 A;  1WJJ A;  3LGJ A;  5LMN L;  3J80 c;  2GVB A;  4P74 A;  3M3Y H;  4A3G G;  2BA1 A;  2K50 A;  2WB1 E;  1GVP A;  5FLX c;  2C35 B;  3U4V A;  3CME A;  4POG A;  4GN4 B;  2IY5 B;  4DK3 C;  5C44 G;  1T9H A;  3E9I A;  4MTN A;  3PGZ A;  3CF5 A;  4DV4 L;  1Q1B A;  4JBW A;  1HNZ Q;  1D7Q A;  4X64 Q;  1OXV A;  4BBS H;  1IZ6 A;  1GO3 E;  2ZM6 Q;  3CP0 A;  1QZG A;  2N78 A;  4LF6 L;  1TWF H;  1YJW A;  4BY1 G;  3I4N G;  4GKK L;  3HOU H;  4KI0 A;  3MXN B;  1PH3 A;  4LF6 Q;  4HIM A;  1B8A A;  1VQP A;  2R92 G;  2WAQ G;  4LF8 L;  4A3L G;  2MO1 A;  4DPG A;  1IBK L;  5C4X G;  3FP9 A;  1I94 L;  4LF8 Q;  4GNX A;  1QUQ A;  2OQK A;  1I94 Q;  2CFM A;  3M4P A;  5AJ3 Q;  1WCM G;  2UU9 L;  4C3J H;  3S1M H;  5IYB G;  2V1C C;  2UU9 Q;  4L5R C;  5IP7 G;  1A62 A;  3KYH C;  4JI2 Q;  2CWA A;  1TXY A;  4HJ5 A;  3CXC A;  1N36 L;  2UXB L;  2BH8 A;  3Q8D A;  3AFQ A;  5FLM H;  4YHH L;  4KLK A;  4POF A;  1ASY A;  1WOC A;  5EAY A;  4YHH Q;  2JA8 G;  1GKH A;  4JI6 L;  3CCR A;  1PYS B;  1L1O C;  4DV3 Q;  2F52 A;  2VZA A;  1CKO A;  4JI6 Q;  3H3V H;  1RL2 A;  3RLN A;  4NXM L;  1YI2 A;  4DV1 Q;  5JJL A;  1X9N A;  1MIU A;  4HJ9 A;  1V1Q A;  1X65 A;  2Q2T A;  1TWC H;  4GN5 A;  1JB7 A;  2NVY H;  3GTG H;  1I6H H;  2R93 G;  3CCJ A;  1HZA A;  1Y1W H;  3HOY H;  1HNW Q;  3CCL A;  4BA1 I;  1HZC A;  4DR6 L;  1VQF A;  3KFU A;  4K0K Q;  1XJV A;  4LF5 L;  1YEZ A;  4LFA Q;  3W1B A;  3RNU A;  3J7A 5;  3SGI A;  3HOZ H;  4LF5 Q;  1TWG H;  5IYC G;  3D31 A;  1LM0 A;  1VQN A;  2KCT A;  4PZ7 A;  3KF6 B;  2JEB I;  2ZJQ A;  4JI8 L;  2PI2 E;  5C0X J;  3IRB A;  2PNH A;  2K75 A;  3CQZ H;  4QL5 A;  2UXC Q;  1SR3 A;  3WWV A;  2IHF A;  4GLX A;  4JBK A;  1L1O A;  2EXD A;  2LXK A;  2RF4 A;  1VQG A;  3KF8 B;  4DAM A;  5HGQ A;  4JBM A;  1IL2 A;  4DV6 L;  4A3K H;  2NVT H;  2JA7 G;  2E2I H;  2JEA I;  3CCV A;  1YJN A;  4X62 Q;  3BU2 A;  1JE5 A;  1X3E A;  2VS1 A;  4GS3 A;  1E1O A;  2N8N A;  2PMZ E;  1V43 A;  3PUW A;  3JAM c;  1HNX L;  3S15 H;  2VUM G;  3FKI H;  2PQA A;  4R1J A;  2OTJ A;  2UUB L;  4L5Q A;  2AWO A;  2KCM A;  2ASB A;  2RHQ B;  1GD7 A;  3CPF A;  4HIK A;  3OW2 A;  5GRO A;  1N32 L;  2Q2H A;  1I5F A;  5M3F H;  4P75 A;  3RR5 A;  2K4K A;  1KL9 A;  3L2P A;  3TQY A;  3M85 A;  4A3F H;  3ULJ A;  3DLL A;  2UUA L;  1KQS A;  1HH2 P;  5IP9 G;  4UP9 A;  1KC8 C;  4C2M H;  3I4M G;  1UE6 A;  3M4Q A;  1SLJ A;  4DNI A;  1HR0 W;  4QJF A;  2I5L X;  2VQE L;  1WYD A;  2HHH Q;  2IX1 A;  4P71 A;  1G51 A;  2ALY B;  2Z6K C;  3PIO A;  2CWP A;  2VQE Q;  1TWH H;  5LMU Q;  2WFW A;  4DUY Q;  3GTK H;  3CW2 C;  4A3G H;  4B3R L;  3PUY A;  3ICE A;  1PFS A;  4A3E G;  2HQL A;  1PV4 A;  1XMO Q;  2MO0 A;  4B3R Q;  2I5M X;  5H1S E;  4IOC A;  3K0X A;  4K0K L;  2JA6 G;  3I55 A;  2YTV A;  4NB3 A;  5ELO A;  5IWA Q;  1Q82 C;  5C0X G;  3AFP A;  1P8L A;  2F3I A;  1S3O A;  1PH2 A;  2B63 G;  1EUJ A;  2K14 A;  1J5E L;  4JC0 A;  4DR5 L;  4LUO A;  2ZJP A;  1FJG L;  3I4N H;  1KAW A;  2JK8 A;  4DR5 Q;  1J5E Q;  4PMW A;  4L5S A;  1XNR L;  2R92 H;  3TRE A;  4A3L H;  4KHZ A;  1XNR Q;  5JJI A;  1VQ4 A;  1NJI C;  4BXX G;  1N8R C;  4L5T A;  5C4X H;  1VQD A;  1U5K A;  1R9T H;  2BH2 A;  1BVS A;  4ME3 A;  2MQH A;  4JI5 L;  1QVF A;  1WCM H;  1CKN B;  3MEF A;  3KJP A;  1PH8 A;  4IPD A;  5BR8 Q;  4JI7 L;  4DR4 L;  5IP7 H;  2FXQ A;  3UDX A;  4GN3 B;  2CCZ A;  3F1Z A;  1E24 A;  1I3Q H;  2YTX A;  3L7Z C;  4C3H H;  2ZJR A;  1SFO H;  3GD7 A;  1W2B A;  4YCU A;  2YV5 A;  3PUX A;  1L0W A;  4IFD I;  4JV5 Q;  1AH9 A;  3KDF B;  5IT9 c;  2JA8 H;  4B3S L;  1CSQ A;  4A3J G;  4BY7 G;  1QVG A;  2WAQ E;  4BA2 I;  4B3S Q;  1EQQ A;  4DR3 Q;  2ZTD A;  3S24 A;  3PF5 A;  1Q86 C;  1OXT A;  3KOJ A;  3J81 j;  3I56 A;  1JT8 A;  1JJG A;  1C7Y A;  2R93 H;  4LUV A;  1E22 A;  4DK6 C;  4JYA Q;  1AE3 A;  1HNZ L;  4X64 L;  1XTD A;  1OTC A;  3M9B A;  2VW9 A;  4OO1 I;  2H5X A;  3U50 C;  4X66 Q;  3K7A H;  2ZM6 L;  2UUC Q;  2R7D A;  4DR1 Q;  2AKW B;  3W1G A;  4GOP B;  3S17 H;  5IYC H;  2BA0 A;  3E0E A;  2I0Q A;  3I7F A;  4A3I H;  3RLO A;  2KHI A;  4UPA A;  5AJ3 L;  4J15 A;  4PZ8 A;  2F4V Q;  2VL6 A;  4A3B G;  4NPS A;  4JI2 L;  2Y0S G;  1N33 Q;  2JA7 H;  2QGQ A;  2LSS A;  1M90 C;  2AMC B;  4GLV B;  1K73 C;  5IYD G;  3CAM A;  5M5Y H;  1N34 Q;  3S2D H;  1Y1V G;  1BBU A;  4DV3 L;  4A3C H;  4JBJ A;  1CUK A;  2VUM H;  1TWA H;  4QY7 A;  1YZ6 A;  4A93 G;  2OQ0 A;  4DV1 L;  5GAE C;  3BZC A;  1KRS A;  1Q81 C;  1EYG A;  3S1Q H;  4JG2 A;  2EQS A;  3EIV A;  5M3M G;  1HNW L;  3PF4 A;  2GVA A;  4YCW A;  1QZH A;  2WB1 G;  5GAG C;  2RCN A;  1X6O A;  3HKS A;  3CD6 A;  2K5N A;  3EBE A;  1AE2 A;  1B70 B;  2JA9 A;  5IP9 H;  4EQ5 A;  4HJ7 A;  4LFA L;  3W5O A;  2ZTC A;  1NBW A;  4JI4 L;  3BZK A;  3NEN A;  3CC2 A;  3RZO H;  1EIY B;  5C4J H;  1LYL A;  4JI4 Q;  3T1H Q;  2ZTE A;  1H95 A;  2XGT A;  2UXC L;  1VQ9 A;  3PO2 G;  2LXJ A;  4A3E H;  3HOW G;  4PG3 A;  2VQF Q;  5DLQ E;  2OTL A;  2KEN A;  4DV0 Q;  4GOP C;  4X62 L;  4R4C A;  3PO3 G;  2NN6 G;  1SN8 A;  1U0L A;  3ERS X;  3UDF A;  5LMN W;  1IBM Q;  3S2H H;  1K8G A;  2B63 H;  3KDF A;  4A75 A;  4YCV A;  3F2B A;  1XPR A;  2D0O A;  1YIT A;  5IY0 A;  5GAH C;  1MJE A;  3GTL H;  2R7Z H;  4BXX H;  4DR2 L;  4R4O A;  1EWI A;  5J3B A;  3HKZ E;  4DV7 Q;  4DR2 Q;  3D0F A;  3H0G G;  4XIG S;  1OXS C;  4A76 A;  2Q2I A;  3PSI A;  2L15 A;  2DGY A;  1PA6 A;  4JI0 L;  3TRZ A;  2Z0S A;  4JI0 Q;  4IO9 A;  1VQL A;  1JJC B;  4LFB Q;  2B29 A;  2HHH L;  2PI2 A;  3PCO B;  3GTJ H;  4A3J H;  4BY7 H;  1C0A A;  1PVO A;  3CC7 A;  5LMU L;  4DUY L;  1VQ5 A;  1D8L A;  2HIX A;  1K9M C;  2JA5 G;  1E3P A;  1EQR A;  1XMO L;  5ELN A;  4A3M G;  1HZ9 A;  1YIJ A;  2B3G A;  3GTO H;  4OON A;  1PHJ A;  3K81 C;  1QUQ B;  4QIW E;  3U4Z A;  1FL0 A;  1PH5 A;  2ID0 A;  5IWA L;  4HIO A;  1K3R A;  5C44 H;  3TS0 A;  4DKA C;  3PUZ A;  4LF9 Q;  2D0P A;  1BBW A;  5JEA J;  4DUZ Q;  4JOI C;  4YY3 Q;  1VQI A;  1X3F A;  4LW1 A;  3OTO Q;  4UY8 C;  4DR7 Q;  1VQA A;  4BY1 H;  3CCE A;  4GKJ Q;  3S1R H;  4AIM A;  3PIP A;  1VQB A;  3GO5 A;  5M5W H;  3H3V I;  3NEM A;  3RN2 A;  3L0O A;  3G48 A;  1VQE A;  3CCQ A;  1VQJ A;  1N9W A;  4BBR G;  3RZD H;  1LTL A;  1HZB A;  4OX9 L;  5BR8 L;  4A3B H;  2UXD Q;  2Z6K A;  4OX9 Q;  5IYB H;  4EX5 A;  1Q46 A;  3S16 H;  5JJK A;  2GN5 A;  3J81 i;  3HOX G;  3KLW A;  1YNX A;  3DM3 A;  4X6A H;  2JQO A;  2YYZ A;  4JCV E;  4JV5 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...