4KHPL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
125
structure length
125
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4khpL00
2B63G 1U0LA 3ZJYC 1IBKL 2HHHQ 2OTLA 4OWWB 3PGZA 3I7FA 1N32L 1W3SA 1GO3E 3GD7A 3FHWA 4JV5Q 4JI3L 4DR3L 3GTQH 4LF9Q 3PO3G 4A3BH 1FVIA 3M4QA 3RLOA 1GKHA 1GD7A 1J5EL 3F1ZA 4B3RL 3CCUA 3S17H 1OTCA 2H5XA 1CKMA 4BBSG 1PV4A 2RCNA 2VY3A 2JA7H 4B3TQ 5IT9c 4LFBQ 4DAYB 2BA0A 2C35B 4GLAC 1VQ8A 4A3JH 2JEAI 1CSQA 2OWOA 4C3JH 5IP9G 4X65Q 4TQUS 4DV0L 1WFQA 4A3MH 4DV3Q 1VQPA 1M1KC 2VUMG 4MNOA 1NBWA 1SN8A 1WI5A 4X64L 4PG3A 1Q7YC 4RMFA 1PH8A 4JI8L 4JOIC 5HGQA 1L1OA 4YY3L 4GNXA 3S2HH 5IE8A 1L2FA 2Z0SA 1CKNA 2VQEL 1I94Q 5ELNA 4DV5L 3HKZG 4APVA 1VQMA 1JJGA 2Y0SG 2JA8H 2VQFL 4WJ3M 3CQZH 4A3BG 1Q86C 4IPGA 4YHHL 1YITA 1C0AA 1X3GA 1GVPA 4GLXA 1G291 1HNZL 4JI1Q 2A19A 1I5FA 3L2PA 1QZGA 4IJLA 3H3VH 1S40A 4R4IA 1K8AC 3L0OA 2VS1A 3ICEA 5ELOA 1HZCA 4KHPQ 4HJ7A 3HOYH 5LMNQ 2UXCL 4JBMA 1WCMH 4DKAC 4EX5A 4OWTB 2PQAA 1XMQL 4B3SQ 4IPCA 2ASBA 5FJ8H 1B7YB 3U4VA 4JI2Q 3K81C 4DR1L 4DR4L 1N9WA 1H95A 3T1YQ 3GTMH 3H15A 2PI2E 3EN2A 1IYJB 4FDBA 3B6YA 1AE2A 4YCWA 1YJWA 5J3BA 1IBKQ 2K5NA 1B70B 3W1GA 4NPSA 4L5SA 1RL2A 1Y1WH 2Q2TA 2UUAL 1N32Q 4P73A 5GAHC 3CAMA 3JC66 5JEAJ 4JI3Q 2IHFA 2L15A 3CCEA 1SR3A 1PH2A 3OW2A 1J5EQ 1YJ9A 4B3RQ 1KQSA 4BA1I 4GNXC 3MXNB 1L1OC 2WB1G 4DR7L 4QIWE 2K75A 4LNQA 4LF8L 4LUVA 2JA7G 3FP9A 3E9IA 1MKHA 3UE1A 1KD1C 1AE3A 3GTPH 1OXSC 2B29A 2R7ZG 3S14H 5JEAG 1VQ9A 1QZHA 2K5HA 3FKIG 4DV6L 2NVYH 3TQYA 2JEBI 4DUYL 4IPDA 4A3EH 1IBML 2PI2A 2PMZE 1OXUA 4X64Q 4DK6C 1N33L 2MO0A 3PO2H 3BZCA 1V9PA 4JI8Q 4YY3Q 3AQQA 4R4TA 4JI5L 2NVTH 1HZAA 1IZ6A 2LXJA 1P8LA 2VQEQ 3D31A 4IJHA 4DV5Q 3M9BA 3HOZG 5LMNW 1TXYA 4LWCA 4OWXB 4X66L 2VQFQ 1JB7A 1KRTA 4DV4L 4GN5A 2A8VA 2R6GA 4YHHQ 2WFWA 4DPGA 4GLVB 2ZJRA 1PH9A 1V1QA 2AWOA 3ERSX 3GTOH 4LF4L 5M3MH 1HR0L 1QVFA 1Y1VG 4HJ9A 2VW9A 1K0RA 3H0GG 1XMOL 4LF5L 4A3GH 3DLLA 3CCQA 4O2DA 1E1TA 3I2ZA 1X55A 2UXCQ 4AIMA 2R93H 3PO3H 1TWCH 2LXKA 2JA9A 4GKJL 1Q46A 3E9HA 1Z47A 1FL0A 5FLMH 2HT1A 1W2BA 1VQFA 3CPWA 4DR1Q 4DR4Q 3Q8DA 1TWFH 1I3QH 1RIPA 2ID0A 3I4MG 2OTJA 1K3RA 4OX9L 4DNIA 4QY7A 4YWLA 2VNUD 2UUAQ 5IYDH 3CP0A 5IP9H 4JI7L 1VQHA 1IBLL 1X9NA 2VUMH 3U4ZA 3J7A5 1WOCA 4DR6L 2HQLA 1E24A 2OCEA 3J7ZC 4DR5L 1HZBA 4DR7Q 3CCJA 4A3GG 2YTXA 4LF8Q 2BA1A 4A3KG 3HFZB 4X6AH 1QUQB 1Q8KA 2IX0A 3W5OA 4A3LG 4A3LH 1N8RC 2R93G 1JJ2A 2I5MX 1XNQL 2R7FA 4DV1L 4A3FG 3UDGA 1BBUA 2WP8J 3RLNA 4HJ5A 3BJUA 2RF4A 5FLMG 4DV6Q 4GOPA 2QEXA 1T9HA 2FXQA 1IXRA 1IBMQ 1YHAA 3KLWA 3MEFA 1PH5A 1BVSA 1N33Q 3PF4A 4LFAL 1I50H 4A3DG 1KAWA 2UXBL 2IHEA 1VQ6A 1KXLA 1I6HH 5IYCG 4A93G 1R9TH 4JI5Q 4MTNA 5IYDG 5IP7H 1EOVA 2YV5A 4DR2L 3UE0A 4NXNL 1EQQA 1E7ZA 1PH4A 3OTOL 4UP8A 4X66Q 1J6QA 4DV4Q 2Q2IA 4AH6A 1IL2A 2EXDA 2NZOA 1UWVA 4JI0L 1HZ9A 1OXTA 1SMXA 2A1AA 4A75A 1HR0Q 4LF4Q 3K7AH 2ZTEA 3G6EA 1HNXL 4Y52H 1XMOQ 3UDIA 3J81c 4LF5Q 1PYBA 5C0XI 1L0WA 4UP9A 3K80C 2K50A 4DK3C 1MIUA 3JAMc 5M5YH 3AEVA 3S1MH 3G71A 4GKJQ 3M4PA 2Z6KC 2ZTCA 5GQOA 1ASYA 4POGA 4YCUA 2CKZB 1NMFA 3F2BA 1NJIC 3STBC 5BR8L 3HKZE 4A4IA 5C3EH 2Y0SE 1TWAH 3AFPA 1X6OA 1YIJA 2ALYB 2QA4A 2V1CC 3M85A 3W1BA 4HIOA 5IP7G 3KDFA 4JC0A 4OX9Q 3S1QH 1G6PA 3J81i 2MFIA 3PIPA 1VQGA 4GOPC 3FKIH 4DV2L 1KC8C 4TVAB 2RHSB 3JAMi 1IBLQ 4JI7Q 2ZM6L 4DR6Q 5M3FG 3E0EA 3WWVA 4HJAA 4NXML 1N34L 1V43A 4DR5Q 3KF6B 1XPOA 1YEZA 1YHBA 4EQ5A 3CMAA 3CCMA 4BXXG 4IFDI 1C9OA 1N36L 3TREA 2JK8A 5C4XG 1E1OA 2Q2HA 2GVBA 3HOZH 2D0PA 1FGUA 1KRSA 2VZAA 4DR3Q 1SLJA 1VQOA 2YU9H 3S2DH 2GVAA 1XNQQ 2AHOB 4DV1Q 1D8LA 2K5VA 1X54A 1EIYB 3GTGH 3PUVA 2D62A 3GTKH 3RZOH 2NN6I 2KBNA 2JA5H 4B3ML 1A62A 2BH2A 1Y1VH 3KYHC 4A3CH 4HJ8A 3ULJA 5C3EG 3H0GH 4O0AA 4LFAQ 1Q82C 1HR0W 2UXBQ 1YZ6A 1K83H 2E2HH 3CD6A 2JA6G 4IPHA 1VQCA 4JYAL 3SGIA 4DR2Q 3HKSA 3PUXA 4DV0Q 4NXNQ 3OTOQ 2WB1E 2R7DA 2CWAA 3PV0A 1VQ7A 1X56A 1EIFA 1E22A 4JI0Q 1Z9FA 4IO9A 1LTLA 2QGQA 1XTDA 1Q81C 4BA2I 1FJGL 1NE3A 3I4MH 2KHJA 1PHJA 1HNXQ 1M90C 4DUZL 1SRUA 2ES2A 3HOVG 2WAQG 5C0XG 2MQHA 3S16H 3ULLA 1K9MC 3TEHB 4UY8C 3NBHB 4LFCL 4DV7L 1YI2A 3G48A 5GAGC 1VQNA 2NVXH 1HNZQ 2EIFA 3K7UC 2JA5G 1NY4A 4Y7NH 4A3CG 5FLXc 1VQEA 2UU9L 1SROA 3GO5A 1EYGA 5BR8Q 4GOPB 3VDYA 4A3KH 5C44G 1MJCA 5IYBG 4IFDJ 2ZJPA 4OONA 4PZ6A 2E5LL 4A3FH 1BBWA 2YYZA 2OQKA 3HOWG 1XMQQ 4DV2Q 3AYHB 3A0JA 2ZM6Q 3IRBA 2ATWA 1JE5A 2MNAA 3EBEA 1UE5A 4NXMQ 4BY7G 3U58A 1JMCA 4A3DH 3OYYA 2E2IH 5JJLA 1Y14B 3S15H 1VQ5A 4LUZA 4X62L 5GAEC 3CW2C 3NELA 5IYCH 1N36Q 3M7NA 4A93H 4IFDG 2DGYA 4A76A 2KCMA 4MZ9A 1VCIA 1GM5A 4GNXB 3RZDH 1HNWL 1L1OB 4HIKA 4A3IH 2CWPA 4JI4L 5JJIA 1VS0A 3RNUA 4QL5A 1K73C 4GKKL 1CKNB 2R92G 1CSPA 3PIOA 3S1RH 2Z6KA 2MO1A 1XNRL 1PH3A 2IT1A 1VQIA 4POFA 3I4NG 2NN6G 4AYBG 4B3MQ 2UUBL 4R4OA 4JI1L 3CCRA 2ZTDA 5AJ3L 1PH1A 3BZKA 4OXPA 1YJNA 2E2JH 4L5RC 2IX1A 3PCOB 4JYAQ 2K4KA 2OQ0A 1D7QA 1PH7A 1OXXK 1PFSA 1VQJA 2N8NA 4JG2A 4L5TA 4DUYQ 1XJVA 4OO1I 1VQDA 3U50C 1UEBA 1A0IA 5K36G 2PQAB 5E7NA 3M4OH 5LMUL 1OXVA 1LYLA 4GS3A 1FJGQ 4XTCS 4R4QA 5EAYA 1Q12A 4DUZQ 3T1HL 3GTLH 4A3IG 3I4OA 1YHQA 5IY0A 4BY1G 5GROA 4DV7Q 4LFCQ 2F4VL 5JJKA 3HOXG 3TS0A 4P75A 5M5WH 5M3FH 2ZJQA 4WJ4A 1X3FA 2DUDA 1VQBA 4NB3A 4HIDA 4R1JA 3F2CA 2JJQA 4BXXH 3CC7A 1C7YA 4J15A 2UU9Q 4JI6L 1XPRA 3H3VI 2K52A 2JQOA 2HIVA 3PSIA 4YWMA 5C4XH 3ULPA 2R7ZH 2HIXA 4UP7A 3A74A 1YBYA 4P71A 2E5LQ 4P74A 2F3IA 3CC2A 1UE7A 1Q1EA 4QGUA 4JBJA 4LF6L 3DM3A 3KOJA 2CCZA 4GN4B 4H02A 1EWIA 2AMCB 2CQOA 2B3GA 4X62Q 3CCVA 2JA6H 3LGJA 4QJFA 5H1SE 2LSSA 1HNWQ 3NEMA 4JI4Q 4GKKQ 4UPAA 1JT8A 2VL6A 3EIVA 3UDFA 1XNRQ 2RHQB 3J81j 1EFWA 2KCTA 2I0QA 4IOCA 2Q2UA 2UUBQ 4PMWA 4C3HH 1S3OA 5AJ3Q 1QUQA 4KI0A 2I5LX 2AWNA 3HOVH 1KHIA 4C2MH 2NVQH 1EUJA 5IWAL 1UE6A 1O7IA 3RR5A 3F2DA 2XTIA 4DAMA 1S72A 3CC4A 2JE6I 4AQYL 4K0KL 3KF8B 4KLKA 2UUCL 4GN3B 4ALPA 4A3JG 1PVOA 4OO1G 3A5UA 4A3MG 1LM0A 3RLFA 3TS2A 2UXDL 3KJPA 1E3PA 4L5QA 5LMUQ 5C44H 4C3IH 5IYBH 4R4CA 5C0XJ 3T1HQ 1LUZA 4ME3A 3HOWH 3CPFA 4LF7L 2F4VQ 4KHZA 1TWGH 1CUKA 2JA8G 5GADC 1SE8A 4YWKA 1AH9A 4RG1A 2YTYA 4BY7H 1PH6A 1NTGA 1QVCA 2K14A 1QVGA 4HIMA 5C4JH 3I55A 1XPUA 3CCSA 4JI6Q 3HOUH 2PNHA 1ASZA 5M5XH 4XIGS 3BU2A 2HHHL 2IY5B 4IOAA 3PF5A 2R92H 1HJPA 1YVCA 4JV5L 3CF5A 1P16A 3HOYG 1VQAA 4LF9L 4LF6Q 1WYDA 5HY6A 1WCMG 3GTJH 3I4NH 1A63A 1VQKA 3S1NH 3L7ZC 5FJ8G 2WAQE 1A8VA 3AFQA 3PUWA 3J80c 2CFMA 1EQRA 2F52A 1PYSB 4PZ7A 1TWHH 1WJJA 1K8GA 4BBRH 1SFOH 4B3TL 2KENA 4LFBL 1BKBA 3K8AA 1Y1WG 2N3SA 2GN5A 4X65L 2EQSA 1X65A 4DV3L 1N34Q 3TRZA 3KF6A 2D0OA 2XGTA 3G4SA 1NMGA 1KIXA 3A5ZB 1YNXA 4JBWA 1HH2P 3RN5A 3CCLA 3HOUG 3J80i 2B63H 3NENA 4LUOA 2BH8A 2NZHA 3K0XA 3RN2A 2N49A 5IWAQ 1I94L 4P72A 4BY1H 2N78A 3CXCA 3STBD 4AQYQ 1UE1A 3HOXH 1PA6A 4JBKA 4K0KQ 1KL9A 4PZ8A 3KJOA 2UUCQ 3UDXA 2I5HA 3ER0A 1JJCB 4QQBX 3S24A 1VQLA 4LW1A 4A3EG 1U5KA 2UXDQ 4BBSH 3F8TA 3PO2G 2E8GA 4BBRG 3I56A 1B8AA 2YTVA 3M3YH 4KHPL 2AKWB 4JOIA 3PUZA 1CKOA 5LMNL 1MJEA 4LF7Q 4AYBE 3PUYA 3KDFB 3D0FA 3GDEA 1G51A 4JCVE 5DLQE 4B3SL 3CMEA 2KHIA 1DGSA 1VQ4A 4JI2L 3KFUA 1X3EA 3T1YL 1Q1BA 4YCVA 5M3MG
chains in the Genus database with same CATH superfamily
4RGNA 1IBKL 4H44C 2RBMA 2PZUA 4JW0A 1W3SA 4JV5Q 4JI3L 2F0SA 4QUFA 1BCPB 1CK1A 3M4QA 4DK1A 2PQEA 2F0QA 2O5JC 2H5XA 1MGSA 2NZ1D 1PV4A 2VY3A 2E2JB 2E74C 2JA7H 3M4YA 4TSSA 2BA0A 3H3VC 1CSQA 5EJWA 2VUMG 2O4XA 3M4OB 1WI5A 1JR0D 1I4QA 1U4RA 4JI8L 2L4NA 1GHJA 1WTHA 1I94Q 2K03A 2IL8A 4APVA 1H9SA 2Y0SG 5M5WB 5M3FB 4WJ3M 4NMZA 2KA7A 1AP0A 3CQZH 4Q5VA 1IKMA 1DJRD 3K5OA 1EIHA 4DNRB 2OEOA 2HDMA 2B2YA 3D8GA 5KIXA 1QZGA 4EQOA 4R4IA 4Z9CB 4F8MA 2VS1A 4J6HA 3Q24A 2B2VA 2UXCL 3OPOA 2PQAA 3DEPA 4B3SQ 4OIJA 4IPCA 2Z4IA 1G2SA 1H95A 3H15A 3J7YW 1IYJB 2F3VA 2K6AA 1YJWA 5J3BA 1TT2A 1N32Q 4P73A 2ZXRA 3DWPA 5JEAJ 4ZCKA 3CCEA 5C5LA 5KNDA 4GNXC 4K14A 4LNQA 3GTPH 3FRPB 4MHEA 3A7AB 2R7ZG 1FNUA 1S5CD 3BS1A 1TU2B 1VQ9A 3K5MA 3DUZA 2Z9HA 3FKIG 2NVYH 1ENCA 3TQYA 4RCOA 1DCZA 1DXMA 4MN3A 2PI2A 2PMZE 3I90A 4DK6C 1M4VA 3BZCA 2OF1A 4YY3Q 2NVTH 3HOWB 3I70A 3CHBD 3T4AC 1TXYA 1JB7A 4X66L 3OHXC 5KYIA 5J22A 2WFWA 1KDBA 3EVQA 5JVH3 5M5XB 4A3GH 2PYKA 1EQVA 4O2DA 3I2ZA 3MAQA 3PO3H 1AEXA 1TWCH 1PTOH 3I4NB 1JC7A 1Q46A 4AYBB 3U9SA 2HT1A 4DR4Q 1TWHB 1I4XA 3BYTB 4OX9L 1LACA 4YWLA 1G6ZA 4NP5A 2K32A 1IBLL 4KKUA 3U4ZA 2WKDA 2HQLA 4A3GG 4KJOA 2BA1A 1SJHD 4N9PA 3HOXB 4B08A 1Y8NB 1IL8A 1J8IA 4GOPA 1I4RA 3EFXD 2QEXA 3NTIA 1VF5C 5EGTA 3KLWA 4A3DG 1JWUD 1N33Q 4LFAL 1I50H 2EXZA 2UXBL 2IHEA 2MPMA 4HCEA 1A3VA 1EOVA 3UE0A 1EQQA 1RF2D 1PH4A 3QO2A 2BE5D 5FO7B 1CZWA 2A68D 2F0FA 1SMXA 3G6EA 3UDIA 3J81c 4LF5Q 2PZWA 2CW0D 2PW5A 3K80C 4DK3C 1MIUA 3NTKA 3VYUA 1Q3LA 2K1BA 2EPBA 1F9QA 1EY4A 1ZXTA 5ELDA 1NMFA 2I07B 1HCZA 3PIO3 1NJIC 5C3EH 1EY5A 2H4OA 3S1QH 2V1CC 5D65A 3KDFA 4A3JB 4CKCA 2MFIA 5EPKA 1YNNC 4DV2L 4F7XA 4A3MB 3JAMi 1MHWC 3OMGA 3WWVA 2QEJC 4WFN3 1MBYA 4EQ5A 3FPPA 4IFDI 1C9OA 3VA7A 3TREA 2JK8A 2GVBA 3HOZH 2C5CA 3S2DH 4FO2A 4DV1Q 2K5VA 1X54A 2E76C 3PUVA 3GTKH 3SDZA 2JA5H 4B3ML 1A62A 1Y1VH 1FGBD 5C3EG 1HHVA 1YZ6A 4CKBA 1K83H 3HOYB 3HRZC 1GXDC 1STNA 4IO9A 1LTLA 2QGQA 1XTDA 1NE3A 1PHJA 4C3HG 1ENAA 3X3NA 2ES2A 5C0XG 4RGOS 2LKVA 2DY7A 4PNYA 3NBHB 4LFCL 3A56A 1F9PA 1HNZQ 3K7UC 2JA5G 2ZXPA 1SROA 1H9RA 5BR8Q 3VDYA 4A3KH 5C44G 3MA2B 4PMCA 5IYBG 1D6EC 4RGMA 4A3FH 4HSVA 1XMQQ 3R3OA 2ZM6Q 2EYPA 1EZ8A 4H13C 3IRBA 4A3EB 2ATWA 3EBEA 4NXMQ 4BY7G 4CDDC 2G9DA 2XSCA 5DNFA 5IYCH 4A93H 4DN4M 4GNXB 4A3IH 1VS0A 1CKNB 1IW7C 2NUCA 1XNRL 1DYQA 3CU7A 1PFNA 3GTOB 2NN6G 2HDLA 3CCRA 2HUGA 5AJ3L 2E2JH 1TY0A 5KNCA 4L5RC 3NQTA 2OQ0A 4L6TB 4CJ1B 1D7QA 4JG2A 4DUYQ 1XX8A 2OT2A 1GUNA 1PTOF 2M2LA 5E7NA 4ZQ3A 3M4OH 4R4QA 1Q12A 4DUZQ 3T1HL 3GTLH 4A3IG 5IY0A 4BY1G 5GROA 1PYWD 4K5WA 2VUMB 2VXWA 2A74C 5M5WH 5M3FH 1M8AA 1X3FA 1BNZA 4WJWA 4R1JA 4BXXH 4XXEA 3H3VI 2JQOA 1G8ZD 2F0IA 2HIVA 4YWMA 2Y0SB 3A74A 4P71A 4Q0FA 5CBAE 1SYBA 1PTOD 1R4QB 2Z1CA 3NSWA 5C4ZA 2CCZA 2E2DC 1EYDA 1HPCA 4ABNA 3K5NA 3X3MA 3CCVA 4ZAIA 1TR5A 5H1SE 4JI4Q 4UAIA 2Z4HA 4B9WA 5JAVA 1KDCA 3UDFA 2RHQB 3J81j 1F9SA 5D3IB 2Q2UA 2NYZD 2L12A 4PMWA 1BR9A 1CHQD 1Y69U 5IWAL 1O7IA 2XTIA 4DAMA 1S72A 3KF8B 4KLKA 5EKKA 2UUCL 1V1PB 2Q8IB 2FFKB 1QE6A 3T16A 3TS2A 1WD1A 4I7ZC 1R4PB 5F2DA 2R7ZB 4R4CA 2CH4A 3HOWH 3FKIB 4LF7L 2N55A 2F4VQ 5GADC 4CBVA 1PH6A 2DJFC 1QVCA 2KCCA 2N88A 2J0TD 1XPUA 2HD3A 4IFDH 3Q0AA 5M5XH 3KLSX 3H91A 3J81E 3BDCA 1V1OA 4IURA 3ZYYX 4LF9L 3GTGB 4LF6Q 3GTJH 1WCMG 3I4NH 1A63A 5DEHA 3RZOB 3TBIB 2WAQE 1A8VA 3FDTA 4K6DA 1BCPC 2F52A 3NTHA 1H9MA 1TWHH 4KN7C 4O1NA 2LS01 4BBRH 4B3TL 2QDLA 4LFBL 2SDFA 1BKBA 1Y1WG 2EQSA 3KF6A 3TP8A 2XGTA 1CHPD 1KIXA 4JPBW 1PZID 1HH2P 1EOTA 2B2UA 1DD2A 4AQYQ 3HOXH 4JBKA 2TMPA 4M1UB 3ER0A 1JJCB 4LW1A 4A3GB 1U5KA 2UXDQ 3PQIA 4BBRG 4KHPL 1STHA 1CKOA 2A6HC 1UEAB 3ITPA 1G51A 4JCVE 2R3ZA 4NDXA 4A3DB 3NE5B 3GQBA 4YCVA 5M3MG 1HRJA 4V0BA 3ZJYC 4RWSC 4OWWB 2M9VA 1HTPA 1EQTA 1TS3A 1Z6HA 3RLOA 1GKHA 4KKSA 3EQLC 5HGTA 1BCPF 5CV6A 1XTCD 2F0UA 5G3LD 2EYMA 3E6ZX 1HQMC 2NBFA 4A3JH 2JEAI 4A3MH 3C46A 4DV3Q 1ENFA 3P1HA 3KK7A 2BCOA 1BF4A 3NWTA 1PH8A 4JOIC 5EBCA 5IE8A 4EVOA 3GV3A 2VQEL 2LMCB 4DV5L 2RCFA 3HKZG 1Y8PB 1VQMA 5EKIA 1BCPD 1Q86C 1C0AA 1GVPA 4GLXA 1KDAA 1HNZL 1G2TA 1SNQA 2A19A 2KQ3A 2EY2A 1I5FA 1DM0B 1JOOA 4ZYSA 3H3VH 4RFBA 3T56B 3L0OA 3ICEA 5ELOA 4HJ7A 3CKIB 3D4DA 2PCFB 3ERQA 3OIQA 5LMNQ 3HOYH 1EWHA 1ET9A 4JBMA 4QF4A 4OWTB 1XMQL 2ZXOA 5FJ8H 1B7YB 3U4VA 5C3EB 3J80L 2K5QA 3K81C 1N9WA 1FYCA 1NUCA 1AE2A 5JJZA 3HGBA 2UUAL 2K01A 3JC66 1U4LA 2L15A 3M7GA 1PH2A 1J5EQ 4DAVA 4B3RQ 5I2XA 3MXNB 1L1OC 4C3HB 4DR7L 3D4WA 2K75A 4QIWE 1UUPA 5I6WA 3FP9A 4C2MB 3E9IA 3UE1A 1AE3A 2XN9C 1OXSC 1ESFA 4ULLA 3JAME 4GZYC 2KCNA 2K5HA 2JA5B 4HCSA 4DUYL 2JEBI 4A3EH 3LWEA 1IBML 3GV6A 1OXUA 2CQAA 4X64Q 5C44B 2KOLA 3AQQA 5AFWA 1STEA 2F0TA 4R4TA 4JI5L 2DJGC 1P8LA 1ESRA 3D31A 3URYA 1QCBD 1A3TA 1TWGB 1B9MA 2VQFQ 2EE1A 1YNJC 2RVLA 5E3FA 4DV4L 2A8VA 2F03A 4YHHQ 4BY7B 1HA6A 4ODGA 2ZJRA 2O2LD 2AWOA 2B39A 3ERSX 3GTOH 4LF4L 1HR0L 1K0RA 4F87A 3DLLA 2SOBA 3HS0C 1C4QA 4AIMA 2R93H 2LXKA 4GKJL 2JA9A 2KVMA 2LFNA 4XQJA 5FLMH 1W2BA 2X6LA 3F2UA 4DR1Q 3NHHA 4C1NK 2ID0A 3I4MG 3BVMA 2OTJA 1K3RA 5IT9L 4DNIA 4QY7A 4C56C 1E0BA 4KV6A 2VUMH 1X9NA 3J7A5 1HFGA 4DR6L 2EY1A 1SBBB 3J7ZC 1HZBA 2EYFA 1EEFD 2B63B 2YTXA 4A3IB 4LF8Q 1PRTC 3C3LA 4BY1B 1Q8KA 2R93G 1ML0D 2I5MX 1RTNA 1XNQL 3UDGA 1BBUA 2WP8J 1QB5D 4XYOA 4HJ5A 5FLMG 4DV6Q 2F0LA 5FLXE 3MEFA 3P7JA 1PH5A 5JPMC 2L5TA 4HTHA 1U9RA 4MTNA 4DR2L 1RCVD 1A15A 4NXNL 3QOJA 1E7ZA 3OTOL 4UP8A 1J6QA 2Q2IA 3BVZA 1UWVA 4JI0L 5A35A 2A1AA 4DXGA 3GTLB 1GUSA 4KD4A 1XMOQ 5C0XI 5M5YH 3G71A 1D5MC 3M4PA 2ZTCA 5I2YA 4X3KA 1GUGA 4TKOB 1SYCA 3F2BA 2NB0A 5C3XA 2F3WA 3SE0A 4JVZA 1X6OA 4KN4C 2R7ZH 3W1BA 1QNKA 3J81i 1SYGA 1VQGA 1KC8C 3FKIH 4JI7Q 4TVAB 4LAAA 3LX0A 3E0EA 4HJAA 5E4XA 1V43A 4DR5Q 2JSOA 2TSSA 3S2HB 1N36L 2EOTA 3NXWA 5ISRA 1VQOA 1PFMA 1SLJA 1ZEQX 1EIYB 3GTGH 3RZOH 2NN6I 2KBNA 3KYHC 1HR0W 1Q82C 1UNSA 4RKBA 3NK9A 4CJ0B 4JYAL 3A8IE 3SGIA 5ELFA 1RDPD 3PUXA 4DV0Q 1WCMB 1I6VC 2WB1E 3PV0A 1EIFA 1E22A 5A2QE 3DWAA 1Q81C 4BA2I 1B3QA 1TS2A 4X3UA 1HNXQ 2V4DA 4IUUA 1Y1WB 3KBXA 1D1IA 3ULLA 3S16H 1HXYD 4DV7L 3G48A 4FP5D 2EIFA 3SK8A 3QB3A 3OOCA 1VQEA 3GO5A 4GOPB 4K2KA 1MJCA 4C3IG 3I72A 4IFDJ 3S14B 4J1MA 4OONA 3GTJB 1BBWA 2KJXA 1JE5A 1SSOA 1VMPA 1PXUA 3U58A 1JMCA 3HG9A 3OYYA 4A3DH 1CFMA 5JJLA 4BBRB 4X62L 1D1KA 3M7NA 3BVGA 4MZ9A 1VCIA 5JJIA 1L1OB 4CDEC 1S4ZA 2CWPA 2P5ZX 4HIKA 3RNUA 1Q8IA 2R92G 1CSPA 2CHBD 2Z6KA 1NAPA 3K0YA 5M3MB 2UUBL 4ZUIA 5I9PA 2QKIC 1EY9A 4OELB 5FKAC 4HSPA 4OXPA 2RA4A 4H0LC 1YJNA 2KHSA 3JAML 3PCOB 5BN5A 1OXXK 2N8NA 2KEEA 3SK4A 4DU9A 1C8CA 1A0IA 3QG1A 2B2TA 1ILPA 1TWFB 5LMUL 1I3QB 3T51B 1FJGQ 4XTCS 3MZ5A 1ILQA 1W6KA 2FINB 4N8X1 4XYQA 1T5XD 3TS0A 2JP1A 1XXGA 2DUDA 4NB3A 2J7ZA 4G4KA 4J15A 2UU9Q 3A7LA 5I6YA 1EYCA 2B2UC 3O13A 3HKZB 2E5LQ 1WTXA 2F3IA 3HZXA 1UE7A 1OO9B 4GN4B 1DOLA 4KY7A 2AMCB 1W6JA 3BZDB 1B53A 2CQOA 1I6HB 1R9TB 4LJZC 4QJFA 4U673 5IIFA 1EFID 1HNWQ 2M00A 4GKKQ 4UPAA 5K5PA 1PRTB 3IFTA 3I4LA 5M9OA 2K05A 2LY7A 1JOQA 2I0QA 2A69C 1D2BA 4C3HH 1TVXA 2I5LX 2AWNA 1EZ6A 5C0XH 2CH4W 2IWHA 4C2MH 1UE6A 3F2DA 3S1MB 4K0KL 4GN3B 1PVOA 3A5UA 3V96A 5FLXL 5C4HA 3KJPA 5C44H 3FPUB 5IYBH 3G6JB 1JCKB 4ME3A 4HMJA 1TWGH 2JA8G 3QJYA 3W2DA 4RG1A 4BY7H 2K28A 3MVVA 4HIMA 1SJED 4JI6Q 3BU2A 3VR4A 2YU9B 4DNTB 3PF5A 4JV5L 1B1ZA 1P16A 1VQAA 5KRUA 4FF1A 1SE3A 2L55A 5KNBA 1O80A 2NN6H 3SXHA 3S1NH 1Y8OB 2CFMA 3VYRA 2E2HB 1WJJA 2XWJB 1K8GA 4QUCA 1BBXC 1WTWA 1X65A 1N34Q 1PZJD 2BOSA 4DFAA 3TRZA 2D0OA 1NMGA 4EQNA 3A5ZB 1YNXA 3I4MB 2B63H 4P2CB 4LUOA 1WVLA 3RN2A 1I94L 4BY1H 1ONLA 1ZYRC 3DHQA 3KJOA 3UDXA 3S24A 1YNND 2J4XA 4RAUC 1A6XA 3PO2G 1KNAA 2R93B 1RJTA 4EQPA 4AYBE 3N52A 4RKLA 1JWSD 3D0FA 4IQZA 5DLQE 4B3SL 4LK1C 2KHIA 1HFNA 1VQ4A 4JK1C 3KFUA 5T1IA 1EU3A 3S15B 1Q1BA 3A54A 5ELEA 5HURA 2B63G 2HCIA 1D5XC 2MGSA 2BDNA 3NBHA 4ZKBB 3RZDB 2HHHQ 2OTLA 3PGZA 3I7FA 1N32L 5D14A 2XRSD 1GO3E 2EJFC 3FHWA 3S1RB 3GTQH 4K6LA 3NQIA 2A73B 1FVIA 1CQFA 1GD7A 2MJ8A 3CCUA 2XVSA 2F0PA 2F0DA 3KLSA 1OTCA 3S17H 1CA5A 1BUVT 5IGBA 1T5EA 4K5XA 1WTRA 3MXGA 4O42A 1GJXA 4DAYB 1QILA 2C35B 4GLAC 4DV0L 5IP9G 4X65Q 1VQPA 1M1KC 1WFQA 3TDQA 1IKLA 1LLRD 2ICIA 4MNOA 1NBWA 1DONA 2DNEA 5CC4A 4LMQD 1Q7YC 5HGQA 4GNXA 4YY3L 3S2HH 3NWSA 1L2FA 2Z0SA 1TS5A 1CKNA 4NW2A 2MP1A 2EVBA 3TP5A 2B2WC 1YITA 1FNWA 5TSSA 1G291 2KEDA 1SNPA 1S40A 2F0KA 1K8AC 5M5YB 1MD2D 1BQQT 3ND8A 4IUPA 3FEWX 1WCMH 4DKAC 4EX5A 1WTVA 2ASBA 4JI2Q 4DR4L 3I73A 3NP8A 4MTKA 3T1YQ 3GTMH 1IW7D 3EN2A 4FDBA 2MUYA 5KGUA 3B6YA 4YCWA 1IBKQ 3QWNA 4L5SA 1RL2A 1Y1WH 4QIWB 5IGFA 2Q2TA 4JI3Q 1SE4A 1LV9A 3OW2A 1YJ9A 3L3OC 1Q90A 4KK7A 1MKHA 5CR3A 3S14H 2RSNA 5JEAG 5CYUA 5J1ZA 1ZKOA 2IX3A 1QZHA 5CORA 3T13A 2B2YC 5LHY1 3SHLA 1EYAA 5LL6S 4C3IB 1N33L 2MO0A 1STYA 4JI8Q 4G7ZC 4KD3A 2B2VC 1HZAA 1IZ6A 1EWCA 5I4DA 3SK6A 3E5SA 1KRTA 4DPGA 4GLVB 1PH9A 5C4JB 2JN4A 5M3MH 1QVFA 4HJ9A 2VW9A 3S16B 3H0GG 4LF5L 1NR4A 4ZRZA 3CCQA 2XRQD 1V1PA 2R92B 3MXPA 2UXCQ 5E4WC 3VYSA 5CV5A 3W3AA 2PW7A 3E9HA 4DAPA 1E2ZA 1FL0A 1Z47A 1VQFA 3CPWA 1TWFH 1I3QH 1RIPA 4DF7A 5BN4A 1SYDA 4IUQA 2VNUD 2L1BA 5IYDH 3I8ZA 3CP0A 1VQHA 2K5WA 1SNDA 1NSNS 4RA8A 1CA6A 4FNFA 4XT1B 3V05A 4X6AH 3HFZB 1QUQB 2IX0A 4A3LH 1N8RC 1JJ2A 1G91A 2R7FA 1SMYC 4DV1L 3RLNA 1PZKD 3BJUA 3UI2A 1T9HA 2FXQA 1IXRA 1JOKA 1YHAA 3WDNA 3PF4A 4V190 1KAWA 1KXLA 3M3YB 1I6HH 1R9TH 5IYDG 5IP7H 2H1EA 3D3RA 4X66Q 3C1FA 4AH6A 1IL2A 1L0XB 1HZ9A 1OXTA 4A75A 1VDZA 1L0WA 4A3LG 2K50A 2EYJA 3FMCA 3AEVA 3S1MH 1FD7D 2L0CA 5JPNC 4XQNA 1ASYA 1FNVA 2Z6KC 5GQOA 4ZLTF 2WV6D 3QIAA 1SDFA 3IFDA 2CKZB 5IGGA 2D2CC 3STBC 5BR8L 3U9OA 4A4IA 3T53B 2Y0SE 1AZPA 1TWAH 3AFPA 1PLFA 4G7OC 4KMUC 2F0HA 1YIJA 2QA4A 4OX9Q 5IP7G 2F0MA 4CDCC 2RDFA 3PIPA 4GOPC 4OL7A 1IBLQ 2ZM6L 4RH6A 3DM1A 4NXML 1N34L 2KECA 3MC0B 4PMBA 5CV8A 5IODA 1YEZA 1YHBA 1I4GA 1GOZA 3TZUA 3BDOA 5C4XG 1E1OA 3IAYA 2VZAA 1FGUA 1KRSA 2EY5A 4ZKCB 4DR3Q 2A6EC 2YU9H 2JA8B 2Q8TA 1D8LA 3MHBA 2EDGA 2D62A 3QR8A 4TRDA 4A3CH 2A6HD 4HJ8A 4O0AA 4LFAQ 2UXBQ 1GUOA 2PMZB 2E2HH 2K7VA 2JA6G 4IPHA 3K58A 2R7DA 1X56A 3A8KE 4XT3B 1Z9FA 4YIJA 3TMEA 2KHJA 3VR5A 3I4MH 5CBEE 2NTSA 4DUZL 2K04A 3HOVG 2WAQG 4MIUA 3J7AV 4UY8C 3A55A 1SNOA 1VQNA 1LTSD 4KY5A 1KLUD 4N8FA 1PMRA 1NY4A 4RHRA 4A3CG 1AN8A 2AQ3B 1EYGA 1F2ZA 5IOCA 1CT1D 4R8IA 3WOEA 2ZJPA 4PZ6A 2RSOA 2OQKA 4DV2Q 3S1NB 3I91A 3AYHB 5KYLA 2MNAA 1CQVA 1UE5A 3PO2B 1Y14B 3S15H 4LUZA 1I4PA 2DGYA 4A76A 3I3CA 5DM63 3RZDH 1S5ED 4JI4L 4QL5A 5T1GA 1JB3A 4S3SA 1WD0A 2RDGA 3S1RH 1H9SB 3MXNA 1RD9D 4B3MQ 4R4OA 3J81L 1SNMA 2IX1A 2WKCA 1VQJA 1PFSA 1XJVA 3MTSA 1LTAD 4OHJA 3U50C 1QJOA 4F88A 2F0WA 2EYHA 2PQAB 2F0VA 1KNEA 4GS3A 3TN2A 2JYOA 1STGA 2SEBD 3I4OA 2F0NA 1YHQA 4L63B 1XWEA 1KAAA 2KUMA 2F4VL 1MSGA 4LFCQ 5JJKA 3D6WA 5EKLA 4UDUC 4WJ4A 3VR6A 1V8QA 1C7YA 4QB4A 1XPRA 2FMCA 3IL8A 3ND9A 3PSIA 1LT4D 2HIXA 5L37A 3GTQB 1EY6A 4IZ8A 4P74A 4DXFA 3MWYW 1F2MA 3K6OA 1Q1EA 4JBJA 1TKWB 4LF6L 4KKTA 4WORA 3S17B 4OO1H 1PFBA 2QCPX 1YNJD 3OSOA 2B3GA 3VA5A 1O7ZA 4QMGA 1H9JA 1STBA 3NEMA 4R9WA 1JT8A 3EIVA 1QG7A 1XNRQ 4N9TA 2L11A 1EFWA 1PRTF 3K7AB 3QOLA 1TY2A 1S3OA 5AJ3Q 2I46A 2G5DA 1EUJA 2ENBA 2JA7G 3DMUA 3RR5A 3CC4A 4AQYL 1LT6D 3SK5A 5JVG3 1RODA 4ALPA 4OO1G 4I65A 3RLFA 2NWGA 2UXDL 4L5QA 4C3IH 1FR3A 4KY6A 4UHVA 3T1HQ 4ILWA 1LUZA 3E0JA 3CPFA 3TP6A 1E2WA 2QILA 5IGCA 3HP3A 2EY6A 1PRTD 1K3BC 1SE8A 2SNSA 1AH9A 3GTMB 5FO9B 1NTGA 1UAPA 3LNNA 1QVGA 4IUTA 5C4JH 3CCSA 3HOUH 2PNHA 2F4IA 1DZ1A 1EEID 2BE5C 4RGTA 2A68C 2IY5B 3A8JE 2R92H 3CF5A 5E1FA 3MEHA 3RMHA 2CW0C 1VQKA 2DNCA 3L7ZC 3J80c 3AFQA 3H0GB 1EU4A 2X69A 1EQRA 3R93A 1EIGA 4PZ7A 1B4OA 3VR3A 2PNRC 2KENA 1IYVA 3MFGA 2N3SA 4CHTB 4DV3L 2FJ2A 2IJ0A 1TQOA 3BG3A 4C1NI 3G4SA 2F0JA 3HOUG 4JBWA 3RN5A 4OGQC 1GUWA 2BH8A 2NZHA 5IWAQ 1A2UA 2N78A 2NVXB 1KL9A 2UUCQ 1S5BD 4DGZA 1A3UA 1H9KA 2D5DA 4Y7NB 2I5HA 1HUNA 4CGYB 4BBSH 3F8TA 3KBGA 1B8AA 4B9XA 2YTVA 3M3YH 4JOIA 3PUZA 5LMNL 4LF7Q 1EL0A 3PUYA 3KDFB 3GDEA 2IW3A 1AW7A 2DY8A 3CMEA 2E2IB 1F9RA 1X3EA 5FO8B 2PZTA 1VQLA 1BO0A 1U0LA 3TP7A 4RCNA 3GD7A 4DR3L 4H7BA 5C3WA 4LF9Q 3PO3G 2WACA 4A3BH 1J5EL 2EZVA 4B3RL 3F1ZA 3AMUA 1BOSA 1CKMA 2B8FA 2FMMA 4BBSG 4BWGB 2EYLA 1KTKA 2RCNA 3Q6SA 1ET6A 4DA2A 5DM73 2NTTA 4B3TQ 5IT9c 4LFBQ 3OW7A 1VQ8A 5I9OA 4C3JH 2CVRA 2OWOA 4TQUS 4FF3A 2B8GA 3SVMA 2R61A 1SN8A 1LTID 4X64L 4PG3A 1NNXA 4RMFA 4KTAA 2XIWA 3DEOA 1L1OA 4K8IA 5IGDA 1K28A 4KHVA 1LTBD 2IPKD 5ELNA 1QNUA 1JJGA 2JA8H 2VQFL 4HMIA 5EQ0A 4A3BG 4CJ2C 1QWYA 4IPGA 2DN8A 4YHHL 1X3GA 3OWEB 4JI1Q 3L2PA 4IJLA 5BN3A 1JICA 5ELCA 4HAEA 3VR2A 5C4XB 3DWQA 4DK0A 2RDHA 1HZCA 4KHPQ 2MHVA 2Z8LA 4C3JG 1F2YA 1LO5D 2RKSA 1MI2A 4DR1L 1TWAB 1ICFB 1HUMA 1STAA 2PI2E 4IN3A 2JA6B 4FF2A 3H6MA 2WINB 2K5NA 1B70B 3W1GA 4NPSA 3HEJA 5GAHC 3CAMA 2IHFA 1SR3A 1KQSA 4BA1I 2WB1G 4LF8L 4LUVA 2WAQB 3HOVB 1VMCA 5EBDA 2NVQB 1KD1C 4IUVA 2B29A 5J39A 1LT5D 1EY0A 4RHSA 2E75C 3RD4A 3CRKC 4DV6L 4K2LA 4IPDA 1LTRD 3PO2H 1PTOC 1V9PA 4XDXA 2LXJA 2VQEQ 1NR2A 4IJHA 4DV5Q 3M9BA 1K8MA 3HOZG 5LMNW 4LWCA 4PQXA 4OWXB 4GN5A 2R6GA 2QDBA 4WRDA 1V1QA 1Z7TA 3PIP3 3G7LA 1CI3M 1Y1VG 1XMOL 4OEMB 1E1TA 2XWBB 1X55A 1O7LA 1LTGD 3KLRA 3LWUA 3VYTA 4KJNA 3Q8DA 2AQ2B 1SFOB 3R2TA 2PO4A 2A69D 1B3AA 2UUAQ 2VB3X 1O7YA 5IP9H 4JI7L 1JWMD 3AU7A 2QW7A 1WOCA 3K57A 5CV7A 5A2QL 4K8JA 1GUTA 1E24A 2OCEA 2QF7A 5KEEA 4DR5L 5NUCA 4DR7Q 3CCJA 2F1MA 2D9UA 4A3KG 1HQRD 1MSHA 3MXUA 3W5OA 3S9WA 1SEBD 4A3FG 2HCCA 2RF4A 2VB2X 1U4PA 2FHTA 4NKLA 1IBMQ 1TIID 1BVSA 3J80E 1VQ6A 4IALA 3EROA 3RUZA 2A5HA 5IYCG 4A93G 4JI5Q 2YV5A 2F0GA 2HQEA 1B9NA 4DV4Q 2EJMA 2EXDA 2NZOA 1B44D 4LF4Q 1HR0Q 3K7AH 2ZTEA 1HNXL 5EPJA 1DOKA 4Y52H 1PYBA 4ME5A 4XQQA 1CZGA 2WIIB 4UP9A 5D3DA 3JAMc 1RKNA 1GHKA 3MFYA 3NUCA 4GKJQ 4M8AA 4POGA 2JXMB 4YCUA 3J7AF 3HKZE 1KABA 2RQXA 2JA7B 1B2TA 1PDQA 2ALYB 3H94A 3M85A 4HIOA 5JEAH 4JC0A 1G6PA 5CMDA 2RHSB 4IUNA 1K8OA 4DR6Q 5M3FG 2GA4B 1RTOA 3KF6B 1ZYRD 1XPOA 3CCMA 4BXXG 1IYUA 3CMAA 4X3SA 1XYIA 2Q2HA 3Q22A 2D0PA 3C2PA 1NCVA 5LL6X 2GVAA 5DAUA 2AHOB 3CQZB 4ID6A 1XNQQ 3H09A 2K33A 4CKEA 1CM9A 1II3A 2BH2A 3EJIA 3ULJA 3H0GH 1HTLD 4DAYA 2AUJD 5ELBA 3CD6A 1VQCA 4DR2Q 3HKSA 5IT9E 5CGKA 4NXNQ 3OTOQ 2CWAA 1VQ7A 3D4RA 4JI0Q 5JOBA 1FJGL 1M90C 1F77A 4G57A 1SRUA 2MQHA 1K9MC 1DOMA 3TEHB 1YI2A 5GAGC 2NVXH 1HA5A 3OMCA 3OWFA 4G7HC 3PMFA 3HOUB 4Y7NH 1SXTA 1VF7A 5FLXc 2UU9L 1SYFA 1SNCA 2ZT9C 3KF8A 3P20A 1WTQA 1J9OA 3GTPB 3EA6A 2E5LL 1S5FD 2YYZA 3HOWG 2NVYB 1U4MA 3A0JA 4FXGC 3D6CA 2AUKA 2E2IH 2L9HA 5K36H 1VQ5A 1D5ZC 5GAEC 3CW2C 3NELA 1N36Q 4IFDG 4FXDA 2NVTB 2KCMA 1GM5A 1HNWL 4GKKL 1K73C 3N6RA 4I7AA 3TSSA 3PIOA 2MO1A 1PH3A 2IT1A 1VQIA 2K5DA 4POFA 3I4NG 4AYBG 4JI1L 2F0EA 2ZTDA 1PH1A 4HR7B 3BZKA 4BS9A 3R2IA 3IKJA 3V2TA 4JYAQ 2K4KA 3PO3B 1F2LA 1TWCB 5EPLA 1PTOB 4R8NA 1PH7A 4L5TA 4OO1I 5CV4A 1VQDA 5G3LF 3BDLA 4K5VA 1UEBA 4BBSB 5K36G 2ICEC 5CV9A 1WTOA 3Q23A 1JE4A 1OXVA 1E2VA 1LYLA 4U68A 5EAYA 1BDOA 1TS4A 1AFPA 3SR1A 4DV7Q 5FK9C 3HOXG 4P75A 2ZJQA 4ZK9B 1VQBA 3ONAB 3WOFA 4HIDA 3CRLC 4J8QA 2JJQA 3F2CA 3CC7A 1AZQA 4JI6L 2K52A 5C4XH 3ULPA 4HN7A 1X3PA 4UP7A 2C9OA 1YBYA 3FVQA 4L8JA 3C1EA 4A3BB 3CC2A 4QGUA 1RHPA 3DM3A 3KOJA 4H02A 1EWIA 4ZUJA 4CDFC 1X3QA 1SE2A 1I50B 2OXPA 4X62Q 1KLGD 2JA6H 3LGJA 1S5DD 2LSSA 4C3JB 2PPBC 3K59A 3KUPA 2AQ1B 2VL6A 2B2TC 3GP7A 2EJGC 4QCLA 2KCTA 3L9AX 2XNAC 4IOCA 2UUBQ 1A2TA 1I4HA 1QUQA 4KI0A 3K5LA 3HOVH 1KHIA 2NVQH 4FYDA 3BYYB 1JQYD 1BXTA 2JE6I 3DXJC 4A3JG 2X6GA 4A3MG 1LM0A 1QOHA 4FF4A 2WB1B 5FOBB 1E3PA 5LMUQ 3OIPA 3S1QB 5C0XJ 1CTMA 1L0YB 4KHZA 5IGEA 1CUKA 4YWKA 2YTYA 2SNMA 2K14A 4E6IA 1SMYD 3I55A 1ICWA 4EGVA 5C6AA 1ASZA 2Z6BA 4XIGS 3E3XA 3NBIA 3HOZB 2HHHL 4IOAA 3S2DB 1HJPA 1SYEA 1YVCA 3HOYG 1WYDA 5HY6A 1K0SA 3GTKB 3NPPA 1Y1VB 5FJ8G 3TZDA 1LTTD 3PUWA 1IHZA 4FVMA 1PYSB 1K83B 2EYOA 1SFOH 3R8BA 4FXKC 4OIKA 1EY8A 2BDOA 3K8AA 1WTPA 5COYA 2GN5A 4X65L 3SEBA 1O78A 3CCLA 1EY7A 1SAPA 3J80i 3NENA 3K0XA 2N49A 4P72A 1X32A 3CXCA 3STBD 1UE1A 1PA6A 4K0KQ 4PZ8A 2G9HD 5C5MA 1LABA 4QQBX 1JORA 4A3EG 2O5IC 1LT3D 2Q8RE 4A3KB 1B50A 2E8GA 3I56A 2F0OA 2AKWB 4PV1C 4A3FB 3AB9A 1MJEA 4X3TA 1DGSA 2B2WA 4JI2L 2A6ED 3T1YL 1C48A 3P75A 4HEDA 4A93B
chains in the Genus database with same CATH topology
2B63G 1U0LA 3ZJYC 1IBKL 2HHHQ 2OTLA 4OWWB 3PGZA 3I7FA 1N32L 1W3SA 1GO3E 3GD7A 3FHWA 4JV5Q 4JI3L 4DR3L 3GTQH 4LF9Q 3PO3G 4A3BH 1FVIA 3M4QA 3RLOA 1GKHA 1GD7A 1J5EL 3F1ZA 4B3RL 3CCUA 3S17H 1OTCA 2H5XA 1CKMA 4BBSG 1PV4A 2RCNA 2VY3A 2JA7H 4B3TQ 5IT9c 4LFBQ 4DAYB 2BA0A 2C35B 4GLAC 1VQ8A 4A3JH 2JEAI 1CSQA 2OWOA 4C3JH 5IP9G 4X65Q 4TQUS 4DV0L 1WFQA 4A3MH 4DV3Q 1VQPA 1M1KC 2VUMG 4MNOA 1NBWA 1SN8A 1WI5A 4X64L 4PG3A 1Q7YC 4RMFA 1PH8A 4JI8L 4JOIC 5HGQA 1L1OA 4YY3L 4GNXA 3S2HH 5IE8A 1L2FA 2Z0SA 1CKNA 2VQEL 1I94Q 5ELNA 4DV5L 3HKZG 4APVA 1VQMA 1JJGA 2Y0SG 2JA8H 2VQFL 4WJ3M 3CQZH 4A3BG 1Q86C 4IPGA 4YHHL 1YITA 1C0AA 1X3GA 1GVPA 4GLXA 1G291 1HNZL 4JI1Q 2A19A 1I5FA 3L2PA 1QZGA 4IJLA 3H3VH 1S40A 4R4IA 1K8AC 3L0OA 2VS1A 3ICEA 5ELOA 1HZCA 4KHPQ 4HJ7A 3HOYH 5LMNQ 2UXCL 4JBMA 1WCMH 4DKAC 4EX5A 4OWTB 2PQAA 1XMQL 4B3SQ 4IPCA 2ASBA 5FJ8H 1B7YB 3U4VA 4JI2Q 3K81C 4DR1L 4DR4L 1N9WA 1H95A 3T1YQ 3GTMH 3H15A 2PI2E 3EN2A 1IYJB 4FDBA 3B6YA 1AE2A 4YCWA 1YJWA 5J3BA 1IBKQ 2K5NA 1B70B 3W1GA 4NPSA 4L5SA 1RL2A 1Y1WH 2Q2TA 2UUAL 1N32Q 4P73A 5GAHC 3CAMA 3JC66 5JEAJ 4JI3Q 2IHFA 2L15A 3CCEA 1SR3A 1PH2A 3OW2A 1J5EQ 1YJ9A 4B3RQ 1KQSA 4BA1I 4GNXC 3MXNB 1L1OC 2WB1G 4DR7L 4QIWE 2K75A 4LNQA 4LF8L 4LUVA 2JA7G 3FP9A 3E9IA 1MKHA 3UE1A 1KD1C 1AE3A 3GTPH 1OXSC 2B29A 2R7ZG 3S14H 5JEAG 1VQ9A 1QZHA 2K5HA 3FKIG 4DV6L 2NVYH 3TQYA 2JEBI 4DUYL 4IPDA 4A3EH 1IBML 2PI2A 2PMZE 1OXUA 4X64Q 4DK6C 1N33L 2MO0A 3PO2H 3BZCA 1V9PA 4JI8Q 4YY3Q 3AQQA 4R4TA 4JI5L 2NVTH 1HZAA 1IZ6A 2LXJA 1P8LA 2VQEQ 3D31A 4IJHA 4DV5Q 3M9BA 3HOZG 5LMNW 1TXYA 4LWCA 4OWXB 4X66L 2VQFQ 1JB7A 1KRTA 4DV4L 4GN5A 2A8VA 2R6GA 4YHHQ 2WFWA 4DPGA 4GLVB 2ZJRA 1PH9A 1V1QA 2AWOA 3ERSX 3GTOH 4LF4L 5M3MH 1HR0L 1QVFA 1Y1VG 4HJ9A 2VW9A 1K0RA 3H0GG 1XMOL 4LF5L 4A3GH 3DLLA 3CCQA 4O2DA 1E1TA 3I2ZA 1X55A 2UXCQ 4AIMA 2R93H 3PO3H 1TWCH 2LXKA 2JA9A 4GKJL 1Q46A 3E9HA 1Z47A 1FL0A 5FLMH 2HT1A 1W2BA 1VQFA 3CPWA 4DR1Q 4DR4Q 3Q8DA 1TWFH 1I3QH 1RIPA 2ID0A 3I4MG 2OTJA 1K3RA 4OX9L 4DNIA 4QY7A 4YWLA 2VNUD 2UUAQ 5IYDH 3CP0A 5IP9H 4JI7L 1VQHA 1IBLL 1X9NA 2VUMH 3U4ZA 3J7A5 1WOCA 4DR6L 2HQLA 1E24A 2OCEA 3J7ZC 4DR5L 1HZBA 4DR7Q 3CCJA 4A3GG 2YTXA 4LF8Q 2BA1A 4A3KG 3HFZB 4X6AH 1QUQB 1Q8KA 2IX0A 3W5OA 4A3LG 4A3LH 1N8RC 2R93G 1JJ2A 2I5MX 1XNQL 2R7FA 4DV1L 4A3FG 3UDGA 1BBUA 2WP8J 3RLNA 4HJ5A 3BJUA 2RF4A 5FLMG 4DV6Q 4GOPA 2QEXA 1T9HA 2FXQA 1IXRA 1IBMQ 1YHAA 3KLWA 3MEFA 1PH5A 1BVSA 1N33Q 3PF4A 4LFAL 1I50H 4A3DG 1KAWA 2UXBL 2IHEA 1VQ6A 1KXLA 1I6HH 5IYCG 4A93G 1R9TH 4JI5Q 4MTNA 5IYDG 5IP7H 1EOVA 2YV5A 4DR2L 3UE0A 4NXNL 1EQQA 1E7ZA 1PH4A 3OTOL 4UP8A 4X66Q 1J6QA 4DV4Q 2Q2IA 4AH6A 1IL2A 2EXDA 2NZOA 1UWVA 4JI0L 1HZ9A 1OXTA 1SMXA 2A1AA 4A75A 1HR0Q 4LF4Q 3K7AH 2ZTEA 3G6EA 1HNXL 4Y52H 1XMOQ 3UDIA 3J81c 4LF5Q 1PYBA 5C0XI 1L0WA 4UP9A 3K80C 2K50A 4DK3C 1MIUA 3JAMc 5M5YH 3AEVA 3S1MH 3G71A 4GKJQ 3M4PA 2Z6KC 2ZTCA 5GQOA 1ASYA 4POGA 4YCUA 2CKZB 1NMFA 3F2BA 1NJIC 3STBC 5BR8L 3HKZE 4A4IA 5C3EH 2Y0SE 1TWAH 3AFPA 1X6OA 1YIJA 2ALYB 2QA4A 2V1CC 3M85A 3W1BA 4HIOA 5IP7G 3KDFA 4JC0A 4OX9Q 3S1QH 1G6PA 3J81i 2MFIA 3PIPA 1VQGA 4GOPC 3FKIH 4DV2L 1KC8C 4TVAB 2RHSB 3JAMi 1IBLQ 4JI7Q 2ZM6L 4DR6Q 5M3FG 3E0EA 3WWVA 4HJAA 4NXML 1N34L 1V43A 4DR5Q 3KF6B 1XPOA 1YEZA 1YHBA 4EQ5A 3CMAA 3CCMA 4BXXG 4IFDI 1C9OA 1N36L 3TREA 2JK8A 5C4XG 1E1OA 2Q2HA 2GVBA 3HOZH 2D0PA 1FGUA 1KRSA 2VZAA 4DR3Q 1SLJA 1VQOA 2YU9H 3S2DH 2GVAA 1XNQQ 2AHOB 4DV1Q 1D8LA 2K5VA 1X54A 1EIYB 3GTGH 3PUVA 2D62A 3GTKH 3RZOH 2NN6I 2KBNA 2JA5H 4B3ML 1A62A 2BH2A 1Y1VH 3KYHC 4A3CH 4HJ8A 3ULJA 5C3EG 3H0GH 4O0AA 4LFAQ 1Q82C 1HR0W 2UXBQ 1YZ6A 1K83H 2E2HH 3CD6A 2JA6G 4IPHA 1VQCA 4JYAL 3SGIA 4DR2Q 3HKSA 3PUXA 4DV0Q 4NXNQ 3OTOQ 2WB1E 2R7DA 2CWAA 3PV0A 1VQ7A 1X56A 1EIFA 1E22A 4JI0Q 1Z9FA 4IO9A 1LTLA 2QGQA 1XTDA 1Q81C 4BA2I 1FJGL 1NE3A 3I4MH 2KHJA 1PHJA 1HNXQ 1M90C 4DUZL 1SRUA 2ES2A 3HOVG 2WAQG 5C0XG 2MQHA 3S16H 3ULLA 1K9MC 3TEHB 4UY8C 3NBHB 4LFCL 4DV7L 1YI2A 3G48A 5GAGC 1VQNA 2NVXH 1HNZQ 2EIFA 3K7UC 2JA5G 1NY4A 4Y7NH 4A3CG 5FLXc 1VQEA 2UU9L 1SROA 3GO5A 1EYGA 5BR8Q 4GOPB 3VDYA 4A3KH 5C44G 1MJCA 5IYBG 4IFDJ 2ZJPA 4OONA 4PZ6A 2E5LL 4A3FH 1BBWA 2YYZA 2OQKA 3HOWG 1XMQQ 4DV2Q 3AYHB 3A0JA 2ZM6Q 3IRBA 2ATWA 1JE5A 2MNAA 3EBEA 1UE5A 4NXMQ 4BY7G 3U58A 1JMCA 4A3DH 3OYYA 2E2IH 5JJLA 1Y14B 3S15H 1VQ5A 4LUZA 4X62L 5GAEC 3CW2C 3NELA 5IYCH 1N36Q 3M7NA 4A93H 4IFDG 2DGYA 4A76A 2KCMA 4MZ9A 1VCIA 1GM5A 4GNXB 3RZDH 1HNWL 1L1OB 4HIKA 4A3IH 2CWPA 4JI4L 5JJIA 1VS0A 3RNUA 4QL5A 1K73C 4GKKL 1CKNB 2R92G 1CSPA 3PIOA 3S1RH 2Z6KA 2MO1A 1XNRL 1PH3A 2IT1A 1VQIA 4POFA 3I4NG 2NN6G 4AYBG 4B3MQ 2UUBL 4R4OA 4JI1L 3CCRA 2ZTDA 5AJ3L 1PH1A 3BZKA 4OXPA 1YJNA 2E2JH 4L5RC 2IX1A 3PCOB 4JYAQ 2K4KA 2OQ0A 1D7QA 1PH7A 1OXXK 1PFSA 1VQJA 2N8NA 4JG2A 4L5TA 4DUYQ 1XJVA 4OO1I 1VQDA 3U50C 1UEBA 1A0IA 5K36G 2PQAB 5E7NA 3M4OH 5LMUL 1OXVA 1LYLA 4GS3A 1FJGQ 4XTCS 4R4QA 5EAYA 1Q12A 4DUZQ 3T1HL 3GTLH 4A3IG 3I4OA 1YHQA 5IY0A 4BY1G 5GROA 4DV7Q 4LFCQ 2F4VL 5JJKA 3HOXG 3TS0A 4P75A 5M5WH 5M3FH 2ZJQA 4WJ4A 1X3FA 2DUDA 1VQBA 4NB3A 4HIDA 4R1JA 3F2CA 2JJQA 4BXXH 3CC7A 1C7YA 4J15A 2UU9Q 4JI6L 1XPRA 3H3VI 2K52A 2JQOA 2HIVA 3PSIA 4YWMA 5C4XH 3ULPA 2R7ZH 2HIXA 4UP7A 3A74A 1YBYA 4P71A 2E5LQ 4P74A 2F3IA 3CC2A 1UE7A 1Q1EA 4QGUA 4JBJA 4LF6L 3DM3A 3KOJA 2CCZA 4GN4B 4H02A 1EWIA 2AMCB 2CQOA 2B3GA 4X62Q 3CCVA 2JA6H 3LGJA 4QJFA 5H1SE 2LSSA 1HNWQ 3NEMA 4JI4Q 4GKKQ 4UPAA 1JT8A 2VL6A 3EIVA 3UDFA 1XNRQ 2RHQB 3J81j 1EFWA 2KCTA 2I0QA 4IOCA 2Q2UA 2UUBQ 4PMWA 4C3HH 1S3OA 5AJ3Q 1QUQA 4KI0A 2I5LX 2AWNA 3HOVH 1KHIA 4C2MH 2NVQH 1EUJA 5IWAL 1UE6A 1O7IA 3RR5A 3F2DA 2XTIA 4DAMA 1S72A 3CC4A 2JE6I 4AQYL 4K0KL 3KF8B 4KLKA 2UUCL 4GN3B 4ALPA 4A3JG 1PVOA 4OO1G 3A5UA 4A3MG 1LM0A 3RLFA 3TS2A 2UXDL 3KJPA 1E3PA 4L5QA 5LMUQ 5C44H 4C3IH 5IYBH 4R4CA 5C0XJ 3T1HQ 1LUZA 4ME3A 3HOWH 3CPFA 4LF7L 2F4VQ 4KHZA 1TWGH 1CUKA 2JA8G 5GADC 1SE8A 4YWKA 1AH9A 4RG1A 2YTYA 4BY7H 1PH6A 1NTGA 1QVCA 2K14A 1QVGA 4HIMA 5C4JH 3I55A 1XPUA 3CCSA 4JI6Q 3HOUH 2PNHA 1ASZA 5M5XH 4XIGS 3BU2A 2HHHL 2IY5B 4IOAA 3PF5A 2R92H 1HJPA 1YVCA 4JV5L 3CF5A 1P16A 3HOYG 1VQAA 4LF9L 4LF6Q 1WYDA 5HY6A 1WCMG 3GTJH 3I4NH 1A63A 1VQKA 3S1NH 3L7ZC 5FJ8G 2WAQE 1A8VA 3AFQA 3PUWA 3J80c 2CFMA 1EQRA 2F52A 1PYSB 4PZ7A 1TWHH 1WJJA 1K8GA 4BBRH 1SFOH 4B3TL 2KENA 4LFBL 1BKBA 3K8AA 1Y1WG 2N3SA 2GN5A 4X65L 2EQSA 1X65A 4DV3L 1N34Q 3TRZA 3KF6A 2D0OA 2XGTA 3G4SA 1NMGA 1KIXA 3A5ZB 1YNXA 4JBWA 1HH2P 3RN5A 3CCLA 3HOUG 3J80i 2B63H 3NENA 4LUOA 2BH8A 2NZHA 3K0XA 3RN2A 2N49A 5IWAQ 1I94L 4P72A 4BY1H 2N78A 3CXCA 3STBD 4AQYQ 1UE1A 3HOXH 1PA6A 4JBKA 4K0KQ 1KL9A 4PZ8A 3KJOA 2UUCQ 3UDXA 2I5HA 3ER0A 1JJCB 4QQBX 3S24A 1VQLA 4LW1A 4A3EG 1U5KA 2UXDQ 4BBSH 3F8TA 3PO2G 2E8GA 4BBRG 3I56A 1B8AA 2YTVA 3M3YH 4KHPL 2AKWB 4JOIA 3PUZA 1CKOA 5LMNL 1MJEA 4LF7Q 4AYBE 3PUYA 3KDFB 3D0FA 3GDEA 1G51A 4JCVE 5DLQE 4B3SL 3CMEA 2KHIA 1DGSA 1VQ4A 4JI2L 3KFUA 1X3EA 3T1YL 1Q1BA 4YCVA 5M3MG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B63 G;  1U0L A;  3ZJY C;  1IBK L;  2HHH Q;  2OTL A;  4OWW B;  3PGZ A;  3I7F A;  1N32 L;  1W3S A;  1GO3 E;  3GD7 A;  3FHW A;  4JV5 Q;  4JI3 L;  4DR3 L;  3GTQ H;  4LF9 Q;  3PO3 G;  4A3B H;  1FVI A;  3M4Q A;  3RLO A;  1GKH A;  1GD7 A;  1J5E L;  3F1Z A;  4B3R L;  3CCU A;  3S17 H;  1OTC A;  2H5X A;  1CKM A;  4BBS G;  1PV4 A;  2RCN A;  2VY3 A;  2JA7 H;  4B3T Q;  5IT9 c;  4LFB Q;  4DAY B;  2BA0 A;  2C35 B;  4GLA C;  1VQ8 A;  4A3J H;  2JEA I;  1CSQ A;  2OWO A;  4C3J H;  5IP9 G;  4X65 Q;  4TQU S;  4DV0 L;  1WFQ A;  4A3M H;  4DV3 Q;  1VQP A;  1M1K C;  2VUM G;  4MNO A;  1NBW A;  1SN8 A;  1WI5 A;  4X64 L;  4PG3 A;  1Q7Y C;  4RMF A;  1PH8 A;  4JI8 L;  4JOI C;  5HGQ A;  1L1O A;  4YY3 L;  4GNX A;  3S2H H;  5IE8 A;  1L2F A;  2Z0S A;  1CKN A;  2VQE L;  1I94 Q;  5ELN A;  4DV5 L;  3HKZ G;  4APV A;  1VQM A;  1JJG A;  2Y0S G;  2JA8 H;  2VQF L;  4WJ3 M;  3CQZ H;  4A3B G;  1Q86 C;  4IPG A;  4YHH L;  1YIT A;  1C0A A;  1X3G A;  1GVP A;  4GLX A;  1G29 1;  1HNZ L;  4JI1 Q;  2A19 A;  1I5F A;  3L2P A;  1QZG A;  4IJL A;  3H3V H;  1S40 A;  4R4I A;  1K8A C;  3L0O A;  2VS1 A;  3ICE A;  5ELO A;  1HZC A;  4KHP Q;  4HJ7 A;  3HOY H;  5LMN Q;  2UXC L;  4JBM A;  1WCM H;  4DKA C;  4EX5 A;  4OWT B;  2PQA A;  1XMQ L;  4B3S Q;  4IPC A;  2ASB A;  5FJ8 H;  1B7Y B;  3U4V A;  4JI2 Q;  3K81 C;  4DR1 L;  4DR4 L;  1N9W A;  1H95 A;  3T1Y Q;  3GTM H;  3H15 A;  2PI2 E;  3EN2 A;  1IYJ B;  4FDB A;  3B6Y A;  1AE2 A;  4YCW A;  1YJW A;  5J3B A;  1IBK Q;  2K5N A;  1B70 B;  3W1G A;  4NPS A;  4L5S A;  1RL2 A;  1Y1W H;  2Q2T A;  2UUA L;  1N32 Q;  4P73 A;  5GAH C;  3CAM A;  3JC6 6;  5JEA J;  4JI3 Q;  2IHF A;  2L15 A;  3CCE A;  1SR3 A;  1PH2 A;  3OW2 A;  1J5E Q;  1YJ9 A;  4B3R Q;  1KQS A;  4BA1 I;  4GNX C;  3MXN B;  1L1O C;  2WB1 G;  4DR7 L;  4QIW E;  2K75 A;  4LNQ A;  4LF8 L;  4LUV A;  2JA7 G;  3FP9 A;  3E9I A;  1MKH A;  3UE1 A;  1KD1 C;  1AE3 A;  3GTP H;  1OXS C;  2B29 A;  2R7Z G;  3S14 H;  5JEA G;  1VQ9 A;  1QZH A;  2K5H A;  3FKI G;  4DV6 L;  2NVY H;  3TQY A;  2JEB I;  4DUY L;  4IPD A;  4A3E H;  1IBM L;  2PI2 A;  2PMZ E;  1OXU A;  4X64 Q;  4DK6 C;  1N33 L;  2MO0 A;  3PO2 H;  3BZC A;  1V9P A;  4JI8 Q;  4YY3 Q;  3AQQ A;  4R4T A;  4JI5 L;  2NVT H;  1HZA A;  1IZ6 A;  2LXJ A;  1P8L A;  2VQE Q;  3D31 A;  4IJH A;  4DV5 Q;  3M9B A;  3HOZ G;  5LMN W;  1TXY A;  4LWC A;  4OWX B;  4X66 L;  2VQF Q;  1JB7 A;  1KRT A;  4DV4 L;  4GN5 A;  2A8V A;  2R6G A;  4YHH Q;  2WFW A;  4DPG A;  4GLV B;  2ZJR A;  1PH9 A;  1V1Q A;  2AWO A;  3ERS X;  3GTO H;  4LF4 L;  5M3M H;  1HR0 L;  1QVF A;  1Y1V G;  4HJ9 A;  2VW9 A;  1K0R A;  3H0G G;  1XMO L;  4LF5 L;  4A3G H;  3DLL A;  3CCQ A;  4O2D A;  1E1T A;  3I2Z A;  1X55 A;  2UXC Q;  4AIM A;  2R93 H;  3PO3 H;  1TWC H;  2LXK A;  2JA9 A;  4GKJ L;  1Q46 A;  3E9H A;  1Z47 A;  1FL0 A;  5FLM H;  2HT1 A;  1W2B A;  1VQF A;  3CPW A;  4DR1 Q;  4DR4 Q;  3Q8D A;  1TWF H;  1I3Q H;  1RIP A;  2ID0 A;  3I4M G;  2OTJ A;  1K3R A;  4OX9 L;  4DNI A;  4QY7 A;  4YWL A;  2VNU D;  2UUA Q;  5IYD H;  3CP0 A;  5IP9 H;  4JI7 L;  1VQH A;  1IBL L;  1X9N A;  2VUM H;  3U4Z A;  3J7A 5;  1WOC A;  4DR6 L;  2HQL A;  1E24 A;  2OCE A;  3J7Z C;  4DR5 L;  1HZB A;  4DR7 Q;  3CCJ A;  4A3G G;  2YTX A;  4LF8 Q;  2BA1 A;  4A3K G;  3HFZ B;  4X6A H;  1QUQ B;  1Q8K A;  2IX0 A;  3W5O A;  4A3L G;  4A3L H;  1N8R C;  2R93 G;  1JJ2 A;  2I5M X;  1XNQ L;  2R7F A;  4DV1 L;  4A3F G;  3UDG A;  1BBU A;  2WP8 J;  3RLN A;  4HJ5 A;  3BJU A;  2RF4 A;  5FLM G;  4DV6 Q;  4GOP A;  2QEX A;  1T9H A;  2FXQ A;  1IXR A;  1IBM Q;  1YHA A;  3KLW A;  3MEF A;  1PH5 A;  1BVS A;  1N33 Q;  3PF4 A;  4LFA L;  1I50 H;  4A3D G;  1KAW A;  2UXB L;  2IHE A;  1VQ6 A;  1KXL A;  1I6H H;  5IYC G;  4A93 G;  1R9T H;  4JI5 Q;  4MTN A;  5IYD G;  5IP7 H;  1EOV A;  2YV5 A;  4DR2 L;  3UE0 A;  4NXN L;  1EQQ A;  1E7Z A;  1PH4 A;  3OTO L;  4UP8 A;  4X66 Q;  1J6Q A;  4DV4 Q;  2Q2I A;  4AH6 A;  1IL2 A;  2EXD A;  2NZO A;  1UWV A;  4JI0 L;  1HZ9 A;  1OXT A;  1SMX A;  2A1A A;  4A75 A;  1HR0 Q;  4LF4 Q;  3K7A H;  2ZTE A;  3G6E A;  1HNX L;  4Y52 H;  1XMO Q;  3UDI A;  3J81 c;  4LF5 Q;  1PYB A;  5C0X I;  1L0W A;  4UP9 A;  3K80 C;  2K50 A;  4DK3 C;  1MIU A;  3JAM c;  5M5Y H;  3AEV A;  3S1M H;  3G71 A;  4GKJ Q;  3M4P A;  2Z6K C;  2ZTC A;  5GQO A;  1ASY A;  4POG A;  4YCU A;  2CKZ B;  1NMF A;  3F2B A;  1NJI C;  3STB C;  5BR8 L;  3HKZ E;  4A4I A;  5C3E H;  2Y0S E;  1TWA H;  3AFP A;  1X6O A;  1YIJ A;  2ALY B;  2QA4 A;  2V1C C;  3M85 A;  3W1B A;  4HIO A;  5IP7 G;  3KDF A;  4JC0 A;  4OX9 Q;  3S1Q H;  1G6P A;  3J81 i;  2MFI A;  3PIP A;  1VQG A;  4GOP C;  3FKI H;  4DV2 L;  1KC8 C;  4TVA B;  2RHS B;  3JAM i;  1IBL Q;  4JI7 Q;  2ZM6 L;  4DR6 Q;  5M3F G;  3E0E A;  3WWV A;  4HJA A;  4NXM L;  1N34 L;  1V43 A;  4DR5 Q;  3KF6 B;  1XPO A;  1YEZ A;  1YHB A;  4EQ5 A;  3CMA A;  3CCM A;  4BXX G;  4IFD I;  1C9O A;  1N36 L;  3TRE A;  2JK8 A;  5C4X G;  1E1O A;  2Q2H A;  2GVB A;  3HOZ H;  2D0P A;  1FGU A;  1KRS A;  2VZA A;  4DR3 Q;  1SLJ A;  1VQO A;  2YU9 H;  3S2D H;  2GVA A;  1XNQ Q;  2AHO B;  4DV1 Q;  1D8L A;  2K5V A;  1X54 A;  1EIY B;  3GTG H;  3PUV A;  2D62 A;  3GTK H;  3RZO H;  2NN6 I;  2KBN A;  2JA5 H;  4B3M L;  1A62 A;  2BH2 A;  1Y1V H;  3KYH C;  4A3C H;  4HJ8 A;  3ULJ A;  5C3E G;  3H0G H;  4O0A A;  4LFA Q;  1Q82 C;  1HR0 W;  2UXB Q;  1YZ6 A;  1K83 H;  2E2H H;  3CD6 A;  2JA6 G;  4IPH A;  1VQC A;  4JYA L;  3SGI A;  4DR2 Q;  3HKS A;  3PUX A;  4DV0 Q;  4NXN Q;  3OTO Q;  2WB1 E;  2R7D A;  2CWA A;  3PV0 A;  1VQ7 A;  1X56 A;  1EIF A;  1E22 A;  4JI0 Q;  1Z9F A;  4IO9 A;  1LTL A;  2QGQ A;  1XTD A;  1Q81 C;  4BA2 I;  1FJG L;  1NE3 A;  3I4M H;  2KHJ A;  1PHJ A;  1HNX Q;  1M90 C;  4DUZ L;  1SRU A;  2ES2 A;  3HOV G;  2WAQ G;  5C0X G;  2MQH A;  3S16 H;  3ULL A;  1K9M C;  3TEH B;  4UY8 C;  3NBH B;  4LFC L;  4DV7 L;  1YI2 A;  3G48 A;  5GAG C;  1VQN A;  2NVX H;  1HNZ Q;  2EIF A;  3K7U C;  2JA5 G;  1NY4 A;  4Y7N H;  4A3C G;  5FLX c;  1VQE A;  2UU9 L;  1SRO A;  3GO5 A;  1EYG A;  5BR8 Q;  4GOP B;  3VDY A;  4A3K H;  5C44 G;  1MJC A;  5IYB G;  4IFD J;  2ZJP A;  4OON A;  4PZ6 A;  2E5L L;  4A3F H;  1BBW A;  2YYZ A;  2OQK A;  3HOW G;  1XMQ Q;  4DV2 Q;  3AYH B;  3A0J A;  2ZM6 Q;  3IRB A;  2ATW A;  1JE5 A;  2MNA A;  3EBE A;  1UE5 A;  4NXM Q;  4BY7 G;  3U58 A;  1JMC A;  4A3D H;  3OYY A;  2E2I H;  5JJL A;  1Y14 B;  3S15 H;  1VQ5 A;  4LUZ A;  4X62 L;  5GAE C;  3CW2 C;  3NEL A;  5IYC H;  1N36 Q;  3M7N A;  4A93 H;  4IFD G;  2DGY A;  4A76 A;  2KCM A;  4MZ9 A;  1VCI A;  1GM5 A;  4GNX B;  3RZD H;  1HNW L;  1L1O B;  4HIK A;  4A3I H;  2CWP A;  4JI4 L;  5JJI A;  1VS0 A;  3RNU A;  4QL5 A;  1K73 C;  4GKK L;  1CKN B;  2R92 G;  1CSP A;  3PIO A;  3S1R H;  2Z6K A;  2MO1 A;  1XNR L;  1PH3 A;  2IT1 A;  1VQI A;  4POF A;  3I4N G;  2NN6 G;  4AYB G;  4B3M Q;  2UUB L;  4R4O A;  4JI1 L;  3CCR A;  2ZTD A;  5AJ3 L;  1PH1 A;  3BZK A;  4OXP A;  1YJN A;  2E2J H;  4L5R C;  2IX1 A;  3PCO B;  4JYA Q;  2K4K A;  2OQ0 A;  1D7Q A;  1PH7 A;  1OXX K;  1PFS A;  1VQJ A;  2N8N A;  4JG2 A;  4L5T A;  4DUY Q;  1XJV A;  4OO1 I;  1VQD A;  3U50 C;  1UEB A;  1A0I A;  5K36 G;  2PQA B;  5E7N A;  3M4O H;  5LMU L;  1OXV A;  1LYL A;  4GS3 A;  1FJG Q;  4XTC S;  4R4Q A;  5EAY A;  1Q12 A;  4DUZ Q;  3T1H L;  3GTL H;  4A3I G;  3I4O A;  1YHQ A;  5IY0 A;  4BY1 G;  5GRO A;  4DV7 Q;  4LFC Q;  2F4V L;  5JJK A;  3HOX G;  3TS0 A;  4P75 A;  5M5W H;  5M3F H;  2ZJQ A;  4WJ4 A;  1X3F A;  2DUD A;  1VQB A;  4NB3 A;  4HID A;  4R1J A;  3F2C A;  2JJQ A;  4BXX H;  3CC7 A;  1C7Y A;  4J15 A;  2UU9 Q;  4JI6 L;  1XPR A;  3H3V I;  2K52 A;  2JQO A;  2HIV A;  3PSI A;  4YWM A;  5C4X H;  3ULP A;  2R7Z H;  2HIX A;  4UP7 A;  3A74 A;  1YBY A;  4P71 A;  2E5L Q;  4P74 A;  2F3I A;  3CC2 A;  1UE7 A;  1Q1E A;  4QGU A;  4JBJ A;  4LF6 L;  3DM3 A;  3KOJ A;  2CCZ A;  4GN4 B;  4H02 A;  1EWI A;  2AMC B;  2CQO A;  2B3G A;  4X62 Q;  3CCV A;  2JA6 H;  3LGJ A;  4QJF A;  5H1S E;  2LSS A;  1HNW Q;  3NEM A;  4JI4 Q;  4GKK Q;  4UPA A;  1JT8 A;  2VL6 A;  3EIV A;  3UDF A;  1XNR Q;  2RHQ B;  3J81 j;  1EFW A;  2KCT A;  2I0Q A;  4IOC A;  2Q2U A;  2UUB Q;  4PMW A;  4C3H H;  1S3O A;  5AJ3 Q;  1QUQ A;  4KI0 A;  2I5L X;  2AWN A;  3HOV H;  1KHI A;  4C2M H;  2NVQ H;  1EUJ A;  5IWA L;  1UE6 A;  1O7I A;  3RR5 A;  3F2D A;  2XTI A;  4DAM A;  1S72 A;  3CC4 A;  2JE6 I;  4AQY L;  4K0K L;  3KF8 B;  4KLK A;  2UUC L;  4GN3 B;  4ALP A;  4A3J G;  1PVO A;  4OO1 G;  3A5U A;  4A3M G;  1LM0 A;  3RLF A;  3TS2 A;  2UXD L;  3KJP A;  1E3P A;  4L5Q A;  5LMU Q;  5C44 H;  4C3I H;  5IYB H;  4R4C A;  5C0X J;  3T1H Q;  1LUZ A;  4ME3 A;  3HOW H;  3CPF A;  4LF7 L;  2F4V Q;  4KHZ A;  1TWG H;  1CUK A;  2JA8 G;  5GAD C;  1SE8 A;  4YWK A;  1AH9 A;  4RG1 A;  2YTY A;  4BY7 H;  1PH6 A;  1NTG A;  1QVC A;  2K14 A;  1QVG A;  4HIM A;  5C4J H;  3I55 A;  1XPU A;  3CCS A;  4JI6 Q;  3HOU H;  2PNH A;  1ASZ A;  5M5X H;  4XIG S;  3BU2 A;  2HHH L;  2IY5 B;  4IOA A;  3PF5 A;  2R92 H;  1HJP A;  1YVC A;  4JV5 L;  3CF5 A;  1P16 A;  3HOY G;  1VQA A;  4LF9 L;  4LF6 Q;  1WYD A;  5HY6 A;  1WCM G;  3GTJ H;  3I4N H;  1A63 A;  1VQK A;  3S1N H;  3L7Z C;  5FJ8 G;  2WAQ E;  1A8V A;  3AFQ A;  3PUW A;  3J80 c;  2CFM A;  1EQR A;  2F52 A;  1PYS B;  4PZ7 A;  1TWH H;  1WJJ A;  1K8G A;  4BBR H;  1SFO H;  4B3T L;  2KEN A;  4LFB L;  1BKB A;  3K8A A;  1Y1W G;  2N3S A;  2GN5 A;  4X65 L;  2EQS A;  1X65 A;  4DV3 L;  1N34 Q;  3TRZ A;  3KF6 A;  2D0O A;  2XGT A;  3G4S A;  1NMG A;  1KIX A;  3A5Z B;  1YNX A;  4JBW A;  1HH2 P;  3RN5 A;  3CCL A;  3HOU G;  3J80 i;  2B63 H;  3NEN A;  4LUO A;  2BH8 A;  2NZH A;  3K0X A;  3RN2 A;  2N49 A;  5IWA Q;  1I94 L;  4P72 A;  4BY1 H;  2N78 A;  3CXC A;  3STB D;  4AQY Q;  1UE1 A;  3HOX H;  1PA6 A;  4JBK A;  4K0K Q;  1KL9 A;  4PZ8 A;  3KJO A;  2UUC Q;  3UDX A;  2I5H A;  3ER0 A;  1JJC B;  4QQB X;  3S24 A;  1VQL A;  4LW1 A;  4A3E G;  1U5K A;  2UXD Q;  4BBS H;  3F8T A;  3PO2 G;  2E8G A;  4BBR G;  3I56 A;  1B8A A;  2YTV A;  3M3Y H;  4KHP L;  2AKW B;  4JOI A;  3PUZ A;  1CKO A;  5LMN L;  1MJE A;  4LF7 Q;  4AYB E;  3PUY A;  3KDF B;  3D0F A;  3GDE A;  1G51 A;  4JCV E;  5DLQ E;  4B3S L;  3CME A;  2KHI A;  1DGS A;  1VQ4 A;  4JI2 L;  3KFU A;  1X3E A;  3T1Y L;  1Q1B A;  4YCV A;  5M3M G; 
#chains in the Genus database with same CATH topology
 4RGN A;  1IBK L;  4H44 C;  2RBM A;  2PZU A;  4JW0 A;  1W3S A;  4JV5 Q;  4JI3 L;  2F0S A;  4QUF A;  1BCP B;  1CK1 A;  3M4Q A;  4DK1 A;  2PQE A;  2F0Q A;  2O5J C;  2H5X A;  1MGS A;  2NZ1 D;  1PV4 A;  2VY3 A;  2E2J B;  2E74 C;  2JA7 H;  3M4Y A;  4TSS A;  2BA0 A;  3H3V C;  1CSQ A;  5EJW A;  2VUM G;  2O4X A;  3M4O B;  1WI5 A;  1JR0 D;  1I4Q A;  1U4R A;  4JI8 L;  2L4N A;  1GHJ A;  1WTH A;  1I94 Q;  2K03 A;  2IL8 A;  4APV A;  1H9S A;  2Y0S G;  5M5W B;  5M3F B;  4WJ3 M;  4NMZ A;  2KA7 A;  1AP0 A;  3CQZ H;  4Q5V A;  1IKM A;  1DJR D;  3K5O A;  1EIH A;  4DNR B;  2OEO A;  2HDM A;  2B2Y A;  3D8G A;  5KIX A;  1QZG A;  4EQO A;  4R4I A;  4Z9C B;  4F8M A;  2VS1 A;  4J6H A;  3Q24 A;  2B2V A;  2UXC L;  3OPO A;  2PQA A;  3DEP A;  4B3S Q;  4OIJ A;  4IPC A;  2Z4I A;  1G2S A;  1H95 A;  3H15 A;  3J7Y W;  1IYJ B;  2F3V A;  2K6A A;  1YJW A;  5J3B A;  1TT2 A;  1N32 Q;  4P73 A;  2ZXR A;  3DWP A;  5JEA J;  4ZCK A;  3CCE A;  5C5L A;  5KND A;  4GNX C;  4K14 A;  4LNQ A;  3GTP H;  3FRP B;  4MHE A;  3A7A B;  2R7Z G;  1FNU A;  1S5C D;  3BS1 A;  1TU2 B;  1VQ9 A;  3K5M A;  3DUZ A;  2Z9H A;  3FKI G;  2NVY H;  1ENC A;  3TQY A;  4RCO A;  1DCZ A;  1DXM A;  4MN3 A;  2PI2 A;  2PMZ E;  3I90 A;  4DK6 C;  1M4V A;  3BZC A;  2OF1 A;  4YY3 Q;  2NVT H;  3HOW B;  3I70 A;  3CHB D;  3T4A C;  1TXY A;  1JB7 A;  4X66 L;  3OHX C;  5KYI A;  5J22 A;  2WFW A;  1KDB A;  3EVQ A;  5JVH 3;  5M5X B;  4A3G H;  2PYK A;  1EQV A;  4O2D A;  3I2Z A;  3MAQ A;  3PO3 H;  1AEX A;  1TWC H;  1PTO H;  3I4N B;  1JC7 A;  1Q46 A;  4AYB B;  3U9S A;  2HT1 A;  4DR4 Q;  1TWH B;  1I4X A;  3BYT B;  4OX9 L;  1LAC A;  4YWL A;  1G6Z A;  4NP5 A;  2K32 A;  1IBL L;  4KKU A;  3U4Z A;  2WKD A;  2HQL A;  4A3G G;  4KJO A;  2BA1 A;  1SJH D;  4N9P A;  3HOX B;  4B08 A;  1Y8N B;  1IL8 A;  1J8I A;  4GOP A;  1I4R A;  3EFX D;  2QEX A;  3NTI A;  1VF5 C;  5EGT A;  3KLW A;  4A3D G;  1JWU D;  1N33 Q;  4LFA L;  1I50 H;  2EXZ A;  2UXB L;  2IHE A;  2MPM A;  4HCE A;  1A3V A;  1EOV A;  3UE0 A;  1EQQ A;  1RF2 D;  1PH4 A;  3QO2 A;  2BE5 D;  5FO7 B;  1CZW A;  2A68 D;  2F0F A;  1SMX A;  3G6E A;  3UDI A;  3J81 c;  4LF5 Q;  2PZW A;  2CW0 D;  2PW5 A;  3K80 C;  4DK3 C;  1MIU A;  3NTK A;  3VYU A;  1Q3L A;  2K1B A;  2EPB A;  1F9Q A;  1EY4 A;  1ZXT A;  5ELD A;  1NMF A;  2I07 B;  1HCZ A;  3PIO 3;  1NJI C;  5C3E H;  1EY5 A;  2H4O A;  3S1Q H;  2V1C C;  5D65 A;  3KDF A;  4A3J B;  4CKC A;  2MFI A;  5EPK A;  1YNN C;  4DV2 L;  4F7X A;  4A3M B;  3JAM i;  1MHW C;  3OMG A;  3WWV A;  2QEJ C;  4WFN 3;  1MBY A;  4EQ5 A;  3FPP A;  4IFD I;  1C9O A;  3VA7 A;  3TRE A;  2JK8 A;  2GVB A;  3HOZ H;  2C5C A;  3S2D H;  4FO2 A;  4DV1 Q;  2K5V A;  1X54 A;  2E76 C;  3PUV A;  3GTK H;  3SDZ A;  2JA5 H;  4B3M L;  1A62 A;  1Y1V H;  1FGB D;  5C3E G;  1HHV A;  1YZ6 A;  4CKB A;  1K83 H;  3HOY B;  3HRZ C;  1GXD C;  1STN A;  4IO9 A;  1LTL A;  2QGQ A;  1XTD A;  1NE3 A;  1PHJ A;  4C3H G;  1ENA A;  3X3N A;  2ES2 A;  5C0X G;  4RGO S;  2LKV A;  2DY7 A;  4PNY A;  3NBH B;  4LFC L;  3A56 A;  1F9P A;  1HNZ Q;  3K7U C;  2JA5 G;  2ZXP A;  1SRO A;  1H9R A;  5BR8 Q;  3VDY A;  4A3K H;  5C44 G;  3MA2 B;  4PMC A;  5IYB G;  1D6E C;  4RGM A;  4A3F H;  4HSV A;  1XMQ Q;  3R3O A;  2ZM6 Q;  2EYP A;  1EZ8 A;  4H13 C;  3IRB A;  4A3E B;  2ATW A;  3EBE A;  4NXM Q;  4BY7 G;  4CDD C;  2G9D A;  2XSC A;  5DNF A;  5IYC H;  4A93 H;  4DN4 M;  4GNX B;  4A3I H;  1VS0 A;  1CKN B;  1IW7 C;  2NUC A;  1XNR L;  1DYQ A;  3CU7 A;  1PFN A;  3GTO B;  2NN6 G;  2HDL A;  3CCR A;  2HUG A;  5AJ3 L;  2E2J H;  1TY0 A;  5KNC A;  4L5R C;  3NQT A;  2OQ0 A;  4L6T B;  4CJ1 B;  1D7Q A;  4JG2 A;  4DUY Q;  1XX8 A;  2OT2 A;  1GUN A;  1PTO F;  2M2L A;  5E7N A;  4ZQ3 A;  3M4O H;  4R4Q A;  1Q12 A;  4DUZ Q;  3T1H L;  3GTL H;  4A3I G;  5IY0 A;  4BY1 G;  5GRO A;  1PYW D;  4K5W A;  2VUM B;  2VXW A;  2A74 C;  5M5W H;  5M3F H;  1M8A A;  1X3F A;  1BNZ A;  4WJW A;  4R1J A;  4BXX H;  4XXE A;  3H3V I;  2JQO A;  1G8Z D;  2F0I A;  2HIV A;  4YWM A;  2Y0S B;  3A74 A;  4P71 A;  4Q0F A;  5CBA E;  1SYB A;  1PTO D;  1R4Q B;  2Z1C A;  3NSW A;  5C4Z A;  2CCZ A;  2E2D C;  1EYD A;  1HPC A;  4ABN A;  3K5N A;  3X3M A;  3CCV A;  4ZAI A;  1TR5 A;  5H1S E;  4JI4 Q;  4UAI A;  2Z4H A;  4B9W A;  5JAV A;  1KDC A;  3UDF A;  2RHQ B;  3J81 j;  1F9S A;  5D3I B;  2Q2U A;  2NYZ D;  2L12 A;  4PMW A;  1BR9 A;  1CHQ D;  1Y69 U;  5IWA L;  1O7I A;  2XTI A;  4DAM A;  1S72 A;  3KF8 B;  4KLK A;  5EKK A;  2UUC L;  1V1P B;  2Q8I B;  2FFK B;  1QE6 A;  3T16 A;  3TS2 A;  1WD1 A;  4I7Z C;  1R4P B;  5F2D A;  2R7Z B;  4R4C A;  2CH4 A;  3HOW H;  3FKI B;  4LF7 L;  2N55 A;  2F4V Q;  5GAD C;  4CBV A;  1PH6 A;  2DJF C;  1QVC A;  2KCC A;  2N88 A;  2J0T D;  1XPU A;  2HD3 A;  4IFD H;  3Q0A A;  5M5X H;  3KLS X;  3H91 A;  3J81 E;  3BDC A;  1V1O A;  4IUR A;  3ZYY X;  4LF9 L;  3GTG B;  4LF6 Q;  3GTJ H;  1WCM G;  3I4N H;  1A63 A;  5DEH A;  3RZO B;  3TBI B;  2WAQ E;  1A8V A;  3FDT A;  4K6D A;  1BCP C;  2F52 A;  3NTH A;  1H9M A;  1TWH H;  4KN7 C;  4O1N A;  2LS0 1;  4BBR H;  4B3T L;  2QDL A;  4LFB L;  2SDF A;  1BKB A;  1Y1W G;  2EQS A;  3KF6 A;  3TP8 A;  2XGT A;  1CHP D;  1KIX A;  4JPB W;  1PZI D;  1HH2 P;  1EOT A;  2B2U A;  1DD2 A;  4AQY Q;  3HOX H;  4JBK A;  2TMP A;  4M1U B;  3ER0 A;  1JJC B;  4LW1 A;  4A3G B;  1U5K A;  2UXD Q;  3PQI A;  4BBR G;  4KHP L;  1STH A;  1CKO A;  2A6H C;  1UEA B;  3ITP A;  1G51 A;  4JCV E;  2R3Z A;  4NDX A;  4A3D B;  3NE5 B;  3GQB A;  4YCV A;  5M3M G;  1HRJ A;  4V0B A;  3ZJY C;  4RWS C;  4OWW B;  2M9V A;  1HTP A;  1EQT A;  1TS3 A;  1Z6H A;  3RLO A;  1GKH A;  4KKS A;  3EQL C;  5HGT A;  1BCP F;  5CV6 A;  1XTC D;  2F0U A;  5G3L D;  2EYM A;  3E6Z X;  1HQM C;  2NBF A;  4A3J H;  2JEA I;  4A3M H;  3C46 A;  4DV3 Q;  1ENF A;  3P1H A;  3KK7 A;  2BCO A;  1BF4 A;  3NWT A;  1PH8 A;  4JOI C;  5EBC A;  5IE8 A;  4EVO A;  3GV3 A;  2VQE L;  2LMC B;  4DV5 L;  2RCF A;  3HKZ G;  1Y8P B;  1VQM A;  5EKI A;  1BCP D;  1Q86 C;  1C0A A;  1GVP A;  4GLX A;  1KDA A;  1HNZ L;  1G2T A;  1SNQ A;  2A19 A;  2KQ3 A;  2EY2 A;  1I5F A;  1DM0 B;  1JOO A;  4ZYS A;  3H3V H;  4RFB A;  3T56 B;  3L0O A;  3ICE A;  5ELO A;  4HJ7 A;  3CKI B;  3D4D A;  2PCF B;  3ERQ A;  3OIQ A;  5LMN Q;  3HOY H;  1EWH A;  1ET9 A;  4JBM A;  4QF4 A;  4OWT B;  1XMQ L;  2ZXO A;  5FJ8 H;  1B7Y B;  3U4V A;  5C3E B;  3J80 L;  2K5Q A;  3K81 C;  1N9W A;  1FYC A;  1NUC A;  1AE2 A;  5JJZ A;  3HGB A;  2UUA L;  2K01 A;  3JC6 6;  1U4L A;  2L15 A;  3M7G A;  1PH2 A;  1J5E Q;  4DAV A;  4B3R Q;  5I2X A;  3MXN B;  1L1O C;  4C3H B;  4DR7 L;  3D4W A;  2K75 A;  4QIW E;  1UUP A;  5I6W A;  3FP9 A;  4C2M B;  3E9I A;  3UE1 A;  1AE3 A;  2XN9 C;  1OXS C;  1ESF A;  4ULL A;  3JAM E;  4GZY C;  2KCN A;  2K5H A;  2JA5 B;  4HCS A;  4DUY L;  2JEB I;  4A3E H;  3LWE A;  1IBM L;  3GV6 A;  1OXU A;  2CQA A;  4X64 Q;  5C44 B;  2KOL A;  3AQQ A;  5AFW A;  1STE A;  2F0T A;  4R4T A;  4JI5 L;  2DJG C;  1P8L A;  1ESR A;  3D31 A;  3URY A;  1QCB D;  1A3T A;  1TWG B;  1B9M A;  2VQF Q;  2EE1 A;  1YNJ C;  2RVL A;  5E3F A;  4DV4 L;  2A8V A;  2F03 A;  4YHH Q;  4BY7 B;  1HA6 A;  4ODG A;  2ZJR A;  2O2L D;  2AWO A;  2B39 A;  3ERS X;  3GTO H;  4LF4 L;  1HR0 L;  1K0R A;  4F87 A;  3DLL A;  2SOB A;  3HS0 C;  1C4Q A;  4AIM A;  2R93 H;  2LXK A;  4GKJ L;  2JA9 A;  2KVM A;  2LFN A;  4XQJ A;  5FLM H;  1W2B A;  2X6L A;  3F2U A;  4DR1 Q;  3NHH A;  4C1N K;  2ID0 A;  3I4M G;  3BVM A;  2OTJ A;  1K3R A;  5IT9 L;  4DNI A;  4QY7 A;  4C56 C;  1E0B A;  4KV6 A;  2VUM H;  1X9N A;  3J7A 5;  1HFG A;  4DR6 L;  2EY1 A;  1SBB B;  3J7Z C;  1HZB A;  2EYF A;  1EEF D;  2B63 B;  2YTX A;  4A3I B;  4LF8 Q;  1PRT C;  3C3L A;  4BY1 B;  1Q8K A;  2R93 G;  1ML0 D;  2I5M X;  1RTN A;  1XNQ L;  3UDG A;  1BBU A;  2WP8 J;  1QB5 D;  4XYO A;  4HJ5 A;  5FLM G;  4DV6 Q;  2F0L A;  5FLX E;  3MEF A;  3P7J A;  1PH5 A;  5JPM C;  2L5T A;  4HTH A;  1U9R A;  4MTN A;  4DR2 L;  1RCV D;  1A15 A;  4NXN L;  3QOJ A;  1E7Z A;  3OTO L;  4UP8 A;  1J6Q A;  2Q2I A;  3BVZ A;  1UWV A;  4JI0 L;  5A35 A;  2A1A A;  4DXG A;  3GTL B;  1GUS A;  4KD4 A;  1XMO Q;  5C0X I;  5M5Y H;  3G71 A;  1D5M C;  3M4P A;  2ZTC A;  5I2Y A;  4X3K A;  1GUG A;  4TKO B;  1SYC A;  3F2B A;  2NB0 A;  5C3X A;  2F3W A;  3SE0 A;  4JVZ A;  1X6O A;  4KN4 C;  2R7Z H;  3W1B A;  1QNK A;  3J81 i;  1SYG A;  1VQG A;  1KC8 C;  3FKI H;  4JI7 Q;  4TVA B;  4LAA A;  3LX0 A;  3E0E A;  4HJA A;  5E4X A;  1V43 A;  4DR5 Q;  2JSO A;  2TSS A;  3S2H B;  1N36 L;  2EOT A;  3NXW A;  5ISR A;  1VQO A;  1PFM A;  1SLJ A;  1ZEQ X;  1EIY B;  3GTG H;  3RZO H;  2NN6 I;  2KBN A;  3KYH C;  1HR0 W;  1Q82 C;  1UNS A;  4RKB A;  3NK9 A;  4CJ0 B;  4JYA L;  3A8I E;  3SGI A;  5ELF A;  1RDP D;  3PUX A;  4DV0 Q;  1WCM B;  1I6V C;  2WB1 E;  3PV0 A;  1EIF A;  1E22 A;  5A2Q E;  3DWA A;  1Q81 C;  4BA2 I;  1B3Q A;  1TS2 A;  4X3U A;  1HNX Q;  2V4D A;  4IUU A;  1Y1W B;  3KBX A;  1D1I A;  3ULL A;  3S16 H;  1HXY D;  4DV7 L;  3G48 A;  4FP5 D;  2EIF A;  3SK8 A;  3QB3 A;  3OOC A;  1VQE A;  3GO5 A;  4GOP B;  4K2K A;  1MJC A;  4C3I G;  3I72 A;  4IFD J;  3S14 B;  4J1M A;  4OON A;  3GTJ B;  1BBW A;  2KJX A;  1JE5 A;  1SSO A;  1VMP A;  1PXU A;  3U58 A;  1JMC A;  3HG9 A;  3OYY A;  4A3D H;  1CFM A;  5JJL A;  4BBR B;  4X62 L;  1D1K A;  3M7N A;  3BVG A;  4MZ9 A;  1VCI A;  5JJI A;  1L1O B;  4CDE C;  1S4Z A;  2CWP A;  2P5Z X;  4HIK A;  3RNU A;  1Q8I A;  2R92 G;  1CSP A;  2CHB D;  2Z6K A;  1NAP A;  3K0Y A;  5M3M B;  2UUB L;  4ZUI A;  5I9P A;  2QKI C;  1EY9 A;  4OEL B;  5FKA C;  4HSP A;  4OXP A;  2RA4 A;  4H0L C;  1YJN A;  2KHS A;  3JAM L;  3PCO B;  5BN5 A;  1OXX K;  2N8N A;  2KEE A;  3SK4 A;  4DU9 A;  1C8C A;  1A0I A;  3QG1 A;  2B2T A;  1ILP A;  1TWF B;  5LMU L;  1I3Q B;  3T51 B;  1FJG Q;  4XTC S;  3MZ5 A;  1ILQ A;  1W6K A;  2FIN B;  4N8X 1;  4XYQ A;  1T5X D;  3TS0 A;  2JP1 A;  1XXG A;  2DUD A;  4NB3 A;  2J7Z A;  4G4K A;  4J15 A;  2UU9 Q;  3A7L A;  5I6Y A;  1EYC A;  2B2U C;  3O13 A;  3HKZ B;  2E5L Q;  1WTX A;  2F3I A;  3HZX A;  1UE7 A;  1OO9 B;  4GN4 B;  1DOL A;  4KY7 A;  2AMC B;  1W6J A;  3BZD B;  1B53 A;  2CQO A;  1I6H B;  1R9T B;  4LJZ C;  4QJF A;  4U67 3;  5IIF A;  1EFI D;  1HNW Q;  2M00 A;  4GKK Q;  4UPA A;  5K5P A;  1PRT B;  3IFT A;  3I4L A;  5M9O A;  2K05 A;  2LY7 A;  1JOQ A;  2I0Q A;  2A69 C;  1D2B A;  4C3H H;  1TVX A;  2I5L X;  2AWN A;  1EZ6 A;  5C0X H;  2CH4 W;  2IWH A;  4C2M H;  1UE6 A;  3F2D A;  3S1M B;  4K0K L;  4GN3 B;  1PVO A;  3A5U A;  3V96 A;  5FLX L;  5C4H A;  3KJP A;  5C44 H;  3FPU B;  5IYB H;  3G6J B;  1JCK B;  4ME3 A;  4HMJ A;  1TWG H;  2JA8 G;  3QJY A;  3W2D A;  4RG1 A;  4BY7 H;  2K28 A;  3MVV A;  4HIM A;  1SJE D;  4JI6 Q;  3BU2 A;  3VR4 A;  2YU9 B;  4DNT B;  3PF5 A;  4JV5 L;  1B1Z A;  1P16 A;  1VQA A;  5KRU A;  4FF1 A;  1SE3 A;  2L55 A;  5KNB A;  1O80 A;  2NN6 H;  3SXH A;  3S1N H;  1Y8O B;  2CFM A;  3VYR A;  2E2H B;  1WJJ A;  2XWJ B;  1K8G A;  4QUC A;  1BBX C;  1WTW A;  1X65 A;  1N34 Q;  1PZJ D;  2BOS A;  4DFA A;  3TRZ A;  2D0O A;  1NMG A;  4EQN A;  3A5Z B;  1YNX A;  3I4M B;  2B63 H;  4P2C B;  4LUO A;  1WVL A;  3RN2 A;  1I94 L;  4BY1 H;  1ONL A;  1ZYR C;  3DHQ A;  3KJO A;  3UDX A;  3S24 A;  1YNN D;  2J4X A;  4RAU C;  1A6X A;  3PO2 G;  1KNA A;  2R93 B;  1RJT A;  4EQP A;  4AYB E;  3N52 A;  4RKL A;  1JWS D;  3D0F A;  4IQZ A;  5DLQ E;  4B3S L;  4LK1 C;  2KHI A;  1HFN A;  1VQ4 A;  4JK1 C;  3KFU A;  5T1I A;  1EU3 A;  3S15 B;  1Q1B A;  3A54 A;  5ELE A;  5HUR A;  2B63 G;  2HCI A;  1D5X C;  2MGS A;  2BDN A;  3NBH A;  4ZKB B;  3RZD B;  2HHH Q;  2OTL A;  3PGZ A;  3I7F A;  1N32 L;  5D14 A;  2XRS D;  1GO3 E;  2EJF C;  3FHW A;  3S1R B;  3GTQ H;  4K6L A;  3NQI A;  2A73 B;  1FVI A;  1CQF A;  1GD7 A;  2MJ8 A;  3CCU A;  2XVS A;  2F0P A;  2F0D A;  3KLS A;  1OTC A;  3S17 H;  1CA5 A;  1BUV T;  5IGB A;  1T5E A;  4K5X A;  1WTR A;  3MXG A;  4O42 A;  1GJX A;  4DAY B;  1QIL A;  2C35 B;  4GLA C;  4DV0 L;  5IP9 G;  4X65 Q;  1VQP A;  1M1K C;  1WFQ A;  3TDQ A;  1IKL A;  1LLR D;  2ICI A;  4MNO A;  1NBW A;  1DON A;  2DNE A;  5CC4 A;  4LMQ D;  1Q7Y C;  5HGQ A;  4GNX A;  4YY3 L;  3S2H H;  3NWS A;  1L2F A;  2Z0S A;  1TS5 A;  1CKN A;  4NW2 A;  2MP1 A;  2EVB A;  3TP5 A;  2B2W C;  1YIT A;  1FNW A;  5TSS A;  1G29 1;  2KED A;  1SNP A;  1S40 A;  2F0K A;  1K8A C;  5M5Y B;  1MD2 D;  1BQQ T;  3ND8 A;  4IUP A;  3FEW X;  1WCM H;  4DKA C;  4EX5 A;  1WTV A;  2ASB A;  4JI2 Q;  4DR4 L;  3I73 A;  3NP8 A;  4MTK A;  3T1Y Q;  3GTM H;  1IW7 D;  3EN2 A;  4FDB A;  2MUY A;  5KGU A;  3B6Y A;  4YCW A;  1IBK Q;  3QWN A;  4L5S A;  1RL2 A;  1Y1W H;  4QIW B;  5IGF A;  2Q2T A;  4JI3 Q;  1SE4 A;  1LV9 A;  3OW2 A;  1YJ9 A;  3L3O C;  1Q90 A;  4KK7 A;  1MKH A;  5CR3 A;  3S14 H;  2RSN A;  5JEA G;  5CYU A;  5J1Z A;  1ZKO A;  2IX3 A;  1QZH A;  5COR A;  3T13 A;  2B2Y C;  5LHY 1;  3SHL A;  1EYA A;  5LL6 S;  4C3I B;  1N33 L;  2MO0 A;  1STY A;  4JI8 Q;  4G7Z C;  4KD3 A;  2B2V C;  1HZA A;  1IZ6 A;  1EWC A;  5I4D A;  3SK6 A;  3E5S A;  1KRT A;  4DPG A;  4GLV B;  1PH9 A;  5C4J B;  2JN4 A;  5M3M H;  1QVF A;  4HJ9 A;  2VW9 A;  3S16 B;  3H0G G;  4LF5 L;  1NR4 A;  4ZRZ A;  3CCQ A;  2XRQ D;  1V1P A;  2R92 B;  3MXP A;  2UXC Q;  5E4W C;  3VYS A;  5CV5 A;  3W3A A;  2PW7 A;  3E9H A;  4DAP A;  1E2Z A;  1FL0 A;  1Z47 A;  1VQF A;  3CPW A;  1TWF H;  1I3Q H;  1RIP A;  4DF7 A;  5BN4 A;  1SYD A;  4IUQ A;  2VNU D;  2L1B A;  5IYD H;  3I8Z A;  3CP0 A;  1VQH A;  2K5W A;  1SND A;  1NSN S;  4RA8 A;  1CA6 A;  4FNF A;  4XT1 B;  3V05 A;  4X6A H;  3HFZ B;  1QUQ B;  2IX0 A;  4A3L H;  1N8R C;  1JJ2 A;  1G91 A;  2R7F A;  1SMY C;  4DV1 L;  3RLN A;  1PZK D;  3BJU A;  3UI2 A;  1T9H A;  2FXQ A;  1IXR A;  1JOK A;  1YHA A;  3WDN A;  3PF4 A;  4V19 0;  1KAW A;  1KXL A;  3M3Y B;  1I6H H;  1R9T H;  5IYD G;  5IP7 H;  2H1E A;  3D3R A;  4X66 Q;  3C1F A;  4AH6 A;  1IL2 A;  1L0X B;  1HZ9 A;  1OXT A;  4A75 A;  1VDZ A;  1L0W A;  4A3L G;  2K50 A;  2EYJ A;  3FMC A;  3AEV A;  3S1M H;  1FD7 D;  2L0C A;  5JPN C;  4XQN A;  1ASY A;  1FNV A;  2Z6K C;  5GQO A;  4ZLT F;  2WV6 D;  3QIA A;  1SDF A;  3IFD A;  2CKZ B;  5IGG A;  2D2C C;  3STB C;  5BR8 L;  3U9O A;  4A4I A;  3T53 B;  2Y0S E;  1AZP A;  1TWA H;  3AFP A;  1PLF A;  4G7O C;  4KMU C;  2F0H A;  1YIJ A;  2QA4 A;  4OX9 Q;  5IP7 G;  2F0M A;  4CDC C;  2RDF A;  3PIP A;  4GOP C;  4OL7 A;  1IBL Q;  2ZM6 L;  4RH6 A;  3DM1 A;  4NXM L;  1N34 L;  2KEC A;  3MC0 B;  4PMB A;  5CV8 A;  5IOD A;  1YEZ A;  1YHB A;  1I4G A;  1GOZ A;  3TZU A;  3BDO A;  5C4X G;  1E1O A;  3IAY A;  2VZA A;  1FGU A;  1KRS A;  2EY5 A;  4ZKC B;  4DR3 Q;  2A6E C;  2YU9 H;  2JA8 B;  2Q8T A;  1D8L A;  3MHB A;  2EDG A;  2D62 A;  3QR8 A;  4TRD A;  4A3C H;  2A6H D;  4HJ8 A;  4O0A A;  4LFA Q;  2UXB Q;  1GUO A;  2PMZ B;  2E2H H;  2K7V A;  2JA6 G;  4IPH A;  3K58 A;  2R7D A;  1X56 A;  3A8K E;  4XT3 B;  1Z9F A;  4YIJ A;  3TME A;  2KHJ A;  3VR5 A;  3I4M H;  5CBE E;  2NTS A;  4DUZ L;  2K04 A;  3HOV G;  2WAQ G;  4MIU A;  3J7A V;  4UY8 C;  3A55 A;  1SNO A;  1VQN A;  1LTS D;  4KY5 A;  1KLU D;  4N8F A;  1PMR A;  1NY4 A;  4RHR A;  4A3C G;  1AN8 A;  2AQ3 B;  1EYG A;  1F2Z A;  5IOC A;  1CT1 D;  4R8I A;  3WOE A;  2ZJP A;  4PZ6 A;  2RSO A;  2OQK A;  4DV2 Q;  3S1N B;  3I91 A;  3AYH B;  5KYL A;  2MNA A;  1CQV A;  1UE5 A;  3PO2 B;  1Y14 B;  3S15 H;  4LUZ A;  1I4P A;  2DGY A;  4A76 A;  3I3C A;  5DM6 3;  3RZD H;  1S5E D;  4JI4 L;  4QL5 A;  5T1G A;  1JB3 A;  4S3S A;  1WD0 A;  2RDG A;  3S1R H;  1H9S B;  3MXN A;  1RD9 D;  4B3M Q;  4R4O A;  3J81 L;  1SNM A;  2IX1 A;  2WKC A;  1VQJ A;  1PFS A;  1XJV A;  3MTS A;  1LTA D;  4OHJ A;  3U50 C;  1QJO A;  4F88 A;  2F0W A;  2EYH A;  2PQA B;  2F0V A;  1KNE A;  4GS3 A;  3TN2 A;  2JYO A;  1STG A;  2SEB D;  3I4O A;  2F0N A;  1YHQ A;  4L63 B;  1XWE A;  1KAA A;  2KUM A;  2F4V L;  1MSG A;  4LFC Q;  5JJK A;  3D6W A;  5EKL A;  4UDU C;  4WJ4 A;  3VR6 A;  1V8Q A;  1C7Y A;  4QB4 A;  1XPR A;  2FMC A;  3IL8 A;  3ND9 A;  3PSI A;  1LT4 D;  2HIX A;  5L37 A;  3GTQ B;  1EY6 A;  4IZ8 A;  4P74 A;  4DXF A;  3MWY W;  1F2M A;  3K6O A;  1Q1E A;  4JBJ A;  1TKW B;  4LF6 L;  4KKT A;  4WOR A;  3S17 B;  4OO1 H;  1PFB A;  2QCP X;  1YNJ D;  3OSO A;  2B3G A;  3VA5 A;  1O7Z A;  4QMG A;  1H9J A;  1STB A;  3NEM A;  4R9W A;  1JT8 A;  3EIV A;  1QG7 A;  1XNR Q;  4N9T A;  2L11 A;  1EFW A;  1PRT F;  3K7A B;  3QOL A;  1TY2 A;  1S3O A;  5AJ3 Q;  2I46 A;  2G5D A;  1EUJ A;  2ENB A;  2JA7 G;  3DMU A;  3RR5 A;  3CC4 A;  4AQY L;  1LT6 D;  3SK5 A;  5JVG 3;  1ROD A;  4ALP A;  4OO1 G;  4I65 A;  3RLF A;  2NWG A;  2UXD L;  4L5Q A;  4C3I H;  1FR3 A;  4KY6 A;  4UHV A;  3T1H Q;  4ILW A;  1LUZ A;  3E0J A;  3CPF A;  3TP6 A;  1E2W A;  2QIL A;  5IGC A;  3HP3 A;  2EY6 A;  1PRT D;  1K3B C;  1SE8 A;  2SNS A;  1AH9 A;  3GTM B;  5FO9 B;  1NTG A;  1UAP A;  3LNN A;  1QVG A;  4IUT A;  5C4J H;  3CCS A;  3HOU H;  2PNH A;  2F4I A;  1DZ1 A;  1EEI D;  2BE5 C;  4RGT A;  2A68 C;  2IY5 B;  3A8J E;  2R92 H;  3CF5 A;  5E1F A;  3MEH A;  3RMH A;  2CW0 C;  1VQK A;  2DNC A;  3L7Z C;  3J80 c;  3AFQ A;  3H0G B;  1EU4 A;  2X69 A;  1EQR A;  3R93 A;  1EIG A;  4PZ7 A;  1B4O A;  3VR3 A;  2PNR C;  2KEN A;  1IYV A;  3MFG A;  2N3S A;  4CHT B;  4DV3 L;  2FJ2 A;  2IJ0 A;  1TQO A;  3BG3 A;  4C1N I;  3G4S A;  2F0J A;  3HOU G;  4JBW A;  3RN5 A;  4OGQ C;  1GUW A;  2BH8 A;  2NZH A;  5IWA Q;  1A2U A;  2N78 A;  2NVX B;  1KL9 A;  2UUC Q;  1S5B D;  4DGZ A;  1A3U A;  1H9K A;  2D5D A;  4Y7N B;  2I5H A;  1HUN A;  4CGY B;  4BBS H;  3F8T A;  3KBG A;  1B8A A;  4B9X A;  2YTV A;  3M3Y H;  4JOI A;  3PUZ A;  5LMN L;  4LF7 Q;  1EL0 A;  3PUY A;  3KDF B;  3GDE A;  2IW3 A;  1AW7 A;  2DY8 A;  3CME A;  2E2I B;  1F9R A;  1X3E A;  5FO8 B;  2PZT A;  1VQL A;  1BO0 A;  1U0L A;  3TP7 A;  4RCN A;  3GD7 A;  4DR3 L;  4H7B A;  5C3W A;  4LF9 Q;  3PO3 G;  2WAC A;  4A3B H;  1J5E L;  2EZV A;  4B3R L;  3F1Z A;  3AMU A;  1BOS A;  1CKM A;  2B8F A;  2FMM A;  4BBS G;  4BWG B;  2EYL A;  1KTK A;  2RCN A;  3Q6S A;  1ET6 A;  4DA2 A;  5DM7 3;  2NTT A;  4B3T Q;  5IT9 c;  4LFB Q;  3OW7 A;  1VQ8 A;  5I9O A;  4C3J H;  2CVR A;  2OWO A;  4TQU S;  4FF3 A;  2B8G A;  3SVM A;  2R61 A;  1SN8 A;  1LTI D;  4X64 L;  4PG3 A;  1NNX A;  4RMF A;  4KTA A;  2XIW A;  3DEO A;  1L1O A;  4K8I A;  5IGD A;  1K28 A;  4KHV A;  1LTB D;  2IPK D;  5ELN A;  1QNU A;  1JJG A;  2JA8 H;  2VQF L;  4HMI A;  5EQ0 A;  4A3B G;  4CJ2 C;  1QWY A;  4IPG A;  2DN8 A;  4YHH L;  1X3G A;  3OWE B;  4JI1 Q;  3L2P A;  4IJL A;  5BN3 A;  1JIC A;  5ELC A;  4HAE A;  3VR2 A;  5C4X B;  3DWQ A;  4DK0 A;  2RDH A;  1HZC A;  4KHP Q;  2MHV A;  2Z8L A;  4C3J G;  1F2Y A;  1LO5 D;  2RKS A;  1MI2 A;  4DR1 L;  1TWA B;  1ICF B;  1HUM A;  1STA A;  2PI2 E;  4IN3 A;  2JA6 B;  4FF2 A;  3H6M A;  2WIN B;  2K5N A;  1B70 B;  3W1G A;  4NPS A;  3HEJ A;  5GAH C;  3CAM A;  2IHF A;  1SR3 A;  1KQS A;  4BA1 I;  2WB1 G;  4LF8 L;  4LUV A;  2WAQ B;  3HOV B;  1VMC A;  5EBD A;  2NVQ B;  1KD1 C;  4IUV A;  2B29 A;  5J39 A;  1LT5 D;  1EY0 A;  4RHS A;  2E75 C;  3RD4 A;  3CRK C;  4DV6 L;  4K2L A;  4IPD A;  1LTR D;  3PO2 H;  1PTO C;  1V9P A;  4XDX A;  2LXJ A;  2VQE Q;  1NR2 A;  4IJH A;  4DV5 Q;  3M9B A;  1K8M A;  3HOZ G;  5LMN W;  4LWC A;  4PQX A;  4OWX B;  4GN5 A;  2R6G A;  2QDB A;  4WRD A;  1V1Q A;  1Z7T A;  3PIP 3;  3G7L A;  1CI3 M;  1Y1V G;  1XMO L;  4OEM B;  1E1T A;  2XWB B;  1X55 A;  1O7L A;  1LTG D;  3KLR A;  3LWU A;  3VYT A;  4KJN A;  3Q8D A;  2AQ2 B;  1SFO B;  3R2T A;  2PO4 A;  2A69 D;  1B3A A;  2UUA Q;  2VB3 X;  1O7Y A;  5IP9 H;  4JI7 L;  1JWM D;  3AU7 A;  2QW7 A;  1WOC A;  3K57 A;  5CV7 A;  5A2Q L;  4K8J A;  1GUT A;  1E24 A;  2OCE A;  2QF7 A;  5KEE A;  4DR5 L;  5NUC A;  4DR7 Q;  3CCJ A;  2F1M A;  2D9U A;  4A3K G;  1HQR D;  1MSH A;  3MXU A;  3W5O A;  3S9W A;  1SEB D;  4A3F G;  2HCC A;  2RF4 A;  2VB2 X;  1U4P A;  2FHT A;  4NKL A;  1IBM Q;  1TII D;  1BVS A;  3J80 E;  1VQ6 A;  4IAL A;  3ERO A;  3RUZ A;  2A5H A;  5IYC G;  4A93 G;  4JI5 Q;  2YV5 A;  2F0G A;  2HQE A;  1B9N A;  4DV4 Q;  2EJM A;  2EXD A;  2NZO A;  1B44 D;  4LF4 Q;  1HR0 Q;  3K7A H;  2ZTE A;  1HNX L;  5EPJ A;  1DOK A;  4Y52 H;  1PYB A;  4ME5 A;  4XQQ A;  1CZG A;  2WII B;  4UP9 A;  5D3D A;  3JAM c;  1RKN A;  1GHK A;  3MFY A;  3NUC A;  4GKJ Q;  4M8A A;  4POG A;  2JXM B;  4YCU A;  3J7A F;  3HKZ E;  1KAB A;  2RQX A;  2JA7 B;  1B2T A;  1PDQ A;  2ALY B;  3H94 A;  3M85 A;  4HIO A;  5JEA H;  4JC0 A;  1G6P A;  5CMD A;  2RHS B;  4IUN A;  1K8O A;  4DR6 Q;  5M3F G;  2GA4 B;  1RTO A;  3KF6 B;  1ZYR D;  1XPO A;  3CCM A;  4BXX G;  1IYU A;  3CMA A;  4X3S A;  1XYI A;  2Q2H A;  3Q22 A;  2D0P A;  3C2P A;  1NCV A;  5LL6 X;  2GVA A;  5DAU A;  2AHO B;  3CQZ B;  4ID6 A;  1XNQ Q;  3H09 A;  2K33 A;  4CKE A;  1CM9 A;  1II3 A;  2BH2 A;  3EJI A;  3ULJ A;  3H0G H;  1HTL D;  4DAY A;  2AUJ D;  5ELB A;  3CD6 A;  1VQC A;  4DR2 Q;  3HKS A;  5IT9 E;  5CGK A;  4NXN Q;  3OTO Q;  2CWA A;  1VQ7 A;  3D4R A;  4JI0 Q;  5JOB A;  1FJG L;  1M90 C;  1F77 A;  4G57 A;  1SRU A;  2MQH A;  1K9M C;  1DOM A;  3TEH B;  1YI2 A;  5GAG C;  2NVX H;  1HA5 A;  3OMC A;  3OWF A;  4G7H C;  3PMF A;  3HOU B;  4Y7N H;  1SXT A;  1VF7 A;  5FLX c;  2UU9 L;  1SYF A;  1SNC A;  2ZT9 C;  3KF8 A;  3P20 A;  1WTQ A;  1J9O A;  3GTP B;  3EA6 A;  2E5L L;  1S5F D;  2YYZ A;  3HOW G;  2NVY B;  1U4M A;  3A0J A;  4FXG C;  3D6C A;  2AUK A;  2E2I H;  2L9H A;  5K36 H;  1VQ5 A;  1D5Z C;  5GAE C;  3CW2 C;  3NEL A;  1N36 Q;  4IFD G;  4FXD A;  2NVT B;  2KCM A;  1GM5 A;  1HNW L;  4GKK L;  1K73 C;  3N6R A;  4I7A A;  3TSS A;  3PIO A;  2MO1 A;  1PH3 A;  2IT1 A;  1VQI A;  2K5D A;  4POF A;  3I4N G;  4AYB G;  4JI1 L;  2F0E A;  2ZTD A;  1PH1 A;  4HR7 B;  3BZK A;  4BS9 A;  3R2I A;  3IKJ A;  3V2T A;  4JYA Q;  2K4K A;  3PO3 B;  1F2L A;  1TWC B;  5EPL A;  1PTO B;  4R8N A;  1PH7 A;  4L5T A;  4OO1 I;  5CV4 A;  1VQD A;  5G3L F;  3BDL A;  4K5V A;  1UEB A;  4BBS B;  5K36 G;  2ICE C;  5CV9 A;  1WTO A;  3Q23 A;  1JE4 A;  1OXV A;  1E2V A;  1LYL A;  4U68 A;  5EAY A;  1BDO A;  1TS4 A;  1AFP A;  3SR1 A;  4DV7 Q;  5FK9 C;  3HOX G;  4P75 A;  2ZJQ A;  4ZK9 B;  1VQB A;  3ONA B;  3WOF A;  4HID A;  3CRL C;  4J8Q A;  2JJQ A;  3F2C A;  3CC7 A;  1AZQ A;  4JI6 L;  2K52 A;  5C4X H;  3ULP A;  4HN7 A;  1X3P A;  4UP7 A;  2C9O A;  1YBY A;  3FVQ A;  4L8J A;  3C1E A;  4A3B B;  3CC2 A;  4QGU A;  1RHP A;  3DM3 A;  3KOJ A;  4H02 A;  1EWI A;  4ZUJ A;  4CDF C;  1X3Q A;  1SE2 A;  1I50 B;  2OXP A;  4X62 Q;  1KLG D;  2JA6 H;  3LGJ A;  1S5D D;  2LSS A;  4C3J B;  2PPB C;  3K59 A;  3KUP A;  2AQ1 B;  2VL6 A;  2B2T C;  3GP7 A;  2EJG C;  4QCL A;  2KCT A;  3L9A X;  2XNA C;  4IOC A;  2UUB Q;  1A2T A;  1I4H A;  1QUQ A;  4KI0 A;  3K5L A;  3HOV H;  1KHI A;  2NVQ H;  4FYD A;  3BYY B;  1JQY D;  1BXT A;  2JE6 I;  3DXJ C;  4A3J G;  2X6G A;  4A3M G;  1LM0 A;  1QOH A;  4FF4 A;  2WB1 B;  5FOB B;  1E3P A;  5LMU Q;  3OIP A;  3S1Q B;  5C0X J;  1CTM A;  1L0Y B;  4KHZ A;  5IGE A;  1CUK A;  4YWK A;  2YTY A;  2SNM A;  2K14 A;  4E6I A;  1SMY D;  3I55 A;  1ICW A;  4EGV A;  5C6A A;  1ASZ A;  2Z6B A;  4XIG S;  3E3X A;  3NBI A;  3HOZ B;  2HHH L;  4IOA A;  3S2D B;  1HJP A;  1SYE A;  1YVC A;  3HOY G;  1WYD A;  5HY6 A;  1K0S A;  3GTK B;  3NPP A;  1Y1V B;  5FJ8 G;  3TZD A;  1LTT D;  3PUW A;  1IHZ A;  4FVM A;  1PYS B;  1K83 B;  2EYO A;  1SFO H;  3R8B A;  4FXK C;  4OIK A;  1EY8 A;  2BDO A;  3K8A A;  1WTP A;  5COY A;  2GN5 A;  4X65 L;  3SEB A;  1O78 A;  3CCL A;  1EY7 A;  1SAP A;  3J80 i;  3NEN A;  3K0X A;  2N49 A;  4P72 A;  1X32 A;  3CXC A;  3STB D;  1UE1 A;  1PA6 A;  4K0K Q;  4PZ8 A;  2G9H D;  5C5M A;  1LAB A;  4QQB X;  1JOR A;  4A3E G;  2O5I C;  1LT3 D;  2Q8R E;  4A3K B;  1B50 A;  2E8G A;  3I56 A;  2F0O A;  2AKW B;  4PV1 C;  4A3F B;  3AB9 A;  1MJE A;  4X3T A;  1DGS A;  2B2W A;  4JI2 L;  2A6E D;  3T1Y L;  1C48 A;  3P75 A;  4HED A;  4A93 B; 
#chains in the Genus database with same CATH homology
 2B63 G;  1U0L A;  3ZJY C;  1IBK L;  2HHH Q;  2OTL A;  4OWW B;  3PGZ A;  3I7F A;  1N32 L;  1W3S A;  1GO3 E;  3GD7 A;  3FHW A;  4JV5 Q;  4JI3 L;  4DR3 L;  3GTQ H;  4LF9 Q;  3PO3 G;  4A3B H;  1FVI A;  3M4Q A;  3RLO A;  1GKH A;  1GD7 A;  1J5E L;  3F1Z A;  4B3R L;  3CCU A;  3S17 H;  1OTC A;  2H5X A;  1CKM A;  4BBS G;  1PV4 A;  2RCN A;  2VY3 A;  2JA7 H;  4B3T Q;  5IT9 c;  4LFB Q;  4DAY B;  2BA0 A;  2C35 B;  4GLA C;  1VQ8 A;  4A3J H;  2JEA I;  1CSQ A;  2OWO A;  4C3J H;  5IP9 G;  4X65 Q;  4TQU S;  4DV0 L;  1WFQ A;  4A3M H;  4DV3 Q;  1VQP A;  1M1K C;  2VUM G;  4MNO A;  1NBW A;  1SN8 A;  1WI5 A;  4X64 L;  4PG3 A;  1Q7Y C;  4RMF A;  1PH8 A;  4JI8 L;  4JOI C;  5HGQ A;  1L1O A;  4YY3 L;  4GNX A;  3S2H H;  5IE8 A;  1L2F A;  2Z0S A;  1CKN A;  2VQE L;  1I94 Q;  5ELN A;  4DV5 L;  3HKZ G;  4APV A;  1VQM A;  1JJG A;  2Y0S G;  2JA8 H;  2VQF L;  4WJ3 M;  3CQZ H;  4A3B G;  1Q86 C;  4IPG A;  4YHH L;  1YIT A;  1C0A A;  1X3G A;  1GVP A;  4GLX A;  1G29 1;  1HNZ L;  4JI1 Q;  2A19 A;  1I5F A;  3L2P A;  1QZG A;  4IJL A;  3H3V H;  1S40 A;  4R4I A;  1K8A C;  3L0O A;  2VS1 A;  3ICE A;  5ELO A;  1HZC A;  4KHP Q;  4HJ7 A;  3HOY H;  5LMN Q;  2UXC L;  4JBM A;  1WCM H;  4DKA C;  4EX5 A;  4OWT B;  2PQA A;  1XMQ L;  4B3S Q;  4IPC A;  2ASB A;  5FJ8 H;  1B7Y B;  3U4V A;  4JI2 Q;  3K81 C;  4DR1 L;  4DR4 L;  1N9W A;  1H95 A;  3T1Y Q;  3GTM H;  3H15 A;  2PI2 E;  3EN2 A;  1IYJ B;  4FDB A;  3B6Y A;  1AE2 A;  4YCW A;  1YJW A;  5J3B A;  1IBK Q;  2K5N A;  1B70 B;  3W1G A;  4NPS A;  4L5S A;  1RL2 A;  1Y1W H;  2Q2T A;  2UUA L;  1N32 Q;  4P73 A;  5GAH C;  3CAM A;  3JC6 6;  5JEA J;  4JI3 Q;  2IHF A;  2L15 A;  3CCE A;  1SR3 A;  1PH2 A;  3OW2 A;  1J5E Q;  1YJ9 A;  4B3R Q;  1KQS A;  4BA1 I;  4GNX C;  3MXN B;  1L1O C;  2WB1 G;  4DR7 L;  4QIW E;  2K75 A;  4LNQ A;  4LF8 L;  4LUV A;  2JA7 G;  3FP9 A;  3E9I A;  1MKH A;  3UE1 A;  1KD1 C;  1AE3 A;  3GTP H;  1OXS C;  2B29 A;  2R7Z G;  3S14 H;  5JEA G;  1VQ9 A;  1QZH A;  2K5H A;  3FKI G;  4DV6 L;  2NVY H;  3TQY A;  2JEB I;  4DUY L;  4IPD A;  4A3E H;  1IBM L;  2PI2 A;  2PMZ E;  1OXU A;  4X64 Q;  4DK6 C;  1N33 L;  2MO0 A;  3PO2 H;  3BZC A;  1V9P A;  4JI8 Q;  4YY3 Q;  3AQQ A;  4R4T A;  4JI5 L;  2NVT H;  1HZA A;  1IZ6 A;  2LXJ A;  1P8L A;  2VQE Q;  3D31 A;  4IJH A;  4DV5 Q;  3M9B A;  3HOZ G;  5LMN W;  1TXY A;  4LWC A;  4OWX B;  4X66 L;  2VQF Q;  1JB7 A;  1KRT A;  4DV4 L;  4GN5 A;  2A8V A;  2R6G A;  4YHH Q;  2WFW A;  4DPG A;  4GLV B;  2ZJR A;  1PH9 A;  1V1Q A;  2AWO A;  3ERS X;  3GTO H;  4LF4 L;  5M3M H;  1HR0 L;  1QVF A;  1Y1V G;  4HJ9 A;  2VW9 A;  1K0R A;  3H0G G;  1XMO L;  4LF5 L;  4A3G H;  3DLL A;  3CCQ A;  4O2D A;  1E1T A;  3I2Z A;  1X55 A;  2UXC Q;  4AIM A;  2R93 H;  3PO3 H;  1TWC H;  2LXK A;  2JA9 A;  4GKJ L;  1Q46 A;  3E9H A;  1Z47 A;  1FL0 A;  5FLM H;  2HT1 A;  1W2B A;  1VQF A;  3CPW A;  4DR1 Q;  4DR4 Q;  3Q8D A;  1TWF H;  1I3Q H;  1RIP A;  2ID0 A;  3I4M G;  2OTJ A;  1K3R A;  4OX9 L;  4DNI A;  4QY7 A;  4YWL A;  2VNU D;  2UUA Q;  5IYD H;  3CP0 A;  5IP9 H;  4JI7 L;  1VQH A;  1IBL L;  1X9N A;  2VUM H;  3U4Z A;  3J7A 5;  1WOC A;  4DR6 L;  2HQL A;  1E24 A;  2OCE A;  3J7Z C;  4DR5 L;  1HZB A;  4DR7 Q;  3CCJ A;  4A3G G;  2YTX A;  4LF8 Q;  2BA1 A;  4A3K G;  3HFZ B;  4X6A H;  1QUQ B;  1Q8K A;  2IX0 A;  3W5O A;  4A3L G;  4A3L H;  1N8R C;  2R93 G;  1JJ2 A;  2I5M X;  1XNQ L;  2R7F A;  4DV1 L;  4A3F G;  3UDG A;  1BBU A;  2WP8 J;  3RLN A;  4HJ5 A;  3BJU A;  2RF4 A;  5FLM G;  4DV6 Q;  4GOP A;  2QEX A;  1T9H A;  2FXQ A;  1IXR A;  1IBM Q;  1YHA A;  3KLW A;  3MEF A;  1PH5 A;  1BVS A;  1N33 Q;  3PF4 A;  4LFA L;  1I50 H;  4A3D G;  1KAW A;  2UXB L;  2IHE A;  1VQ6 A;  1KXL A;  1I6H H;  5IYC G;  4A93 G;  1R9T H;  4JI5 Q;  4MTN A;  5IYD G;  5IP7 H;  1EOV A;  2YV5 A;  4DR2 L;  3UE0 A;  4NXN L;  1EQQ A;  1E7Z A;  1PH4 A;  3OTO L;  4UP8 A;  4X66 Q;  1J6Q A;  4DV4 Q;  2Q2I A;  4AH6 A;  1IL2 A;  2EXD A;  2NZO A;  1UWV A;  4JI0 L;  1HZ9 A;  1OXT A;  1SMX A;  2A1A A;  4A75 A;  1HR0 Q;  4LF4 Q;  3K7A H;  2ZTE A;  3G6E A;  1HNX L;  4Y52 H;  1XMO Q;  3UDI A;  3J81 c;  4LF5 Q;  1PYB A;  5C0X I;  1L0W A;  4UP9 A;  3K80 C;  2K50 A;  4DK3 C;  1MIU A;  3JAM c;  5M5Y H;  3AEV A;  3S1M H;  3G71 A;  4GKJ Q;  3M4P A;  2Z6K C;  2ZTC A;  5GQO A;  1ASY A;  4POG A;  4YCU A;  2CKZ B;  1NMF A;  3F2B A;  1NJI C;  3STB C;  5BR8 L;  3HKZ E;  4A4I A;  5C3E H;  2Y0S E;  1TWA H;  3AFP A;  1X6O A;  1YIJ A;  2ALY B;  2QA4 A;  2V1C C;  3M85 A;  3W1B A;  4HIO A;  5IP7 G;  3KDF A;  4JC0 A;  4OX9 Q;  3S1Q H;  1G6P A;  3J81 i;  2MFI A;  3PIP A;  1VQG A;  4GOP C;  3FKI H;  4DV2 L;  1KC8 C;  4TVA B;  2RHS B;  3JAM i;  1IBL Q;  4JI7 Q;  2ZM6 L;  4DR6 Q;  5M3F G;  3E0E A;  3WWV A;  4HJA A;  4NXM L;  1N34 L;  1V43 A;  4DR5 Q;  3KF6 B;  1XPO A;  1YEZ A;  1YHB A;  4EQ5 A;  3CMA A;  3CCM A;  4BXX G;  4IFD I;  1C9O A;  1N36 L;  3TRE A;  2JK8 A;  5C4X G;  1E1O A;  2Q2H A;  2GVB A;  3HOZ H;  2D0P A;  1FGU A;  1KRS A;  2VZA A;  4DR3 Q;  1SLJ A;  1VQO A;  2YU9 H;  3S2D H;  2GVA A;  1XNQ Q;  2AHO B;  4DV1 Q;  1D8L A;  2K5V A;  1X54 A;  1EIY B;  3GTG H;  3PUV A;  2D62 A;  3GTK H;  3RZO H;  2NN6 I;  2KBN A;  2JA5 H;  4B3M L;  1A62 A;  2BH2 A;  1Y1V H;  3KYH C;  4A3C H;  4HJ8 A;  3ULJ A;  5C3E G;  3H0G H;  4O0A A;  4LFA Q;  1Q82 C;  1HR0 W;  2UXB Q;  1YZ6 A;  1K83 H;  2E2H H;  3CD6 A;  2JA6 G;  4IPH A;  1VQC A;  4JYA L;  3SGI A;  4DR2 Q;  3HKS A;  3PUX A;  4DV0 Q;  4NXN Q;  3OTO Q;  2WB1 E;  2R7D A;  2CWA A;  3PV0 A;  1VQ7 A;  1X56 A;  1EIF A;  1E22 A;  4JI0 Q;  1Z9F A;  4IO9 A;  1LTL A;  2QGQ A;  1XTD A;  1Q81 C;  4BA2 I;  1FJG L;  1NE3 A;  3I4M H;  2KHJ A;  1PHJ A;  1HNX Q;  1M90 C;  4DUZ L;  1SRU A;  2ES2 A;  3HOV G;  2WAQ G;  5C0X G;  2MQH A;  3S16 H;  3ULL A;  1K9M C;  3TEH B;  4UY8 C;  3NBH B;  4LFC L;  4DV7 L;  1YI2 A;  3G48 A;  5GAG C;  1VQN A;  2NVX H;  1HNZ Q;  2EIF A;  3K7U C;  2JA5 G;  1NY4 A;  4Y7N H;  4A3C G;  5FLX c;  1VQE A;  2UU9 L;  1SRO A;  3GO5 A;  1EYG A;  5BR8 Q;  4GOP B;  3VDY A;  4A3K H;  5C44 G;  1MJC A;  5IYB G;  4IFD J;  2ZJP A;  4OON A;  4PZ6 A;  2E5L L;  4A3F H;  1BBW A;  2YYZ A;  2OQK A;  3HOW G;  1XMQ Q;  4DV2 Q;  3AYH B;  3A0J A;  2ZM6 Q;  3IRB A;  2ATW A;  1JE5 A;  2MNA A;  3EBE A;  1UE5 A;  4NXM Q;  4BY7 G;  3U58 A;  1JMC A;  4A3D H;  3OYY A;  2E2I H;  5JJL A;  1Y14 B;  3S15 H;  1VQ5 A;  4LUZ A;  4X62 L;  5GAE C;  3CW2 C;  3NEL A;  5IYC H;  1N36 Q;  3M7N A;  4A93 H;  4IFD G;  2DGY A;  4A76 A;  2KCM A;  4MZ9 A;  1VCI A;  1GM5 A;  4GNX B;  3RZD H;  1HNW L;  1L1O B;  4HIK A;  4A3I H;  2CWP A;  4JI4 L;  5JJI A;  1VS0 A;  3RNU A;  4QL5 A;  1K73 C;  4GKK L;  1CKN B;  2R92 G;  1CSP A;  3PIO A;  3S1R H;  2Z6K A;  2MO1 A;  1XNR L;  1PH3 A;  2IT1 A;  1VQI A;  4POF A;  3I4N G;  2NN6 G;  4AYB G;  4B3M Q;  2UUB L;  4R4O A;  4JI1 L;  3CCR A;  2ZTD A;  5AJ3 L;  1PH1 A;  3BZK A;  4OXP A;  1YJN A;  2E2J H;  4L5R C;  2IX1 A;  3PCO B;  4JYA Q;  2K4K A;  2OQ0 A;  1D7Q A;  1PH7 A;  1OXX K;  1PFS A;  1VQJ A;  2N8N A;  4JG2 A;  4L5T A;  4DUY Q;  1XJV A;  4OO1 I;  1VQD A;  3U50 C;  1UEB A;  1A0I A;  5K36 G;  2PQA B;  5E7N A;  3M4O H;  5LMU L;  1OXV A;  1LYL A;  4GS3 A;  1FJG Q;  4XTC S;  4R4Q A;  5EAY A;  1Q12 A;  4DUZ Q;  3T1H L;  3GTL H;  4A3I G;  3I4O A;  1YHQ A;  5IY0 A;  4BY1 G;  5GRO A;  4DV7 Q;  4LFC Q;  2F4V L;  5JJK A;  3HOX G;  3TS0 A;  4P75 A;  5M5W H;  5M3F H;  2ZJQ A;  4WJ4 A;  1X3F A;  2DUD A;  1VQB A;  4NB3 A;  4HID A;  4R1J A;  3F2C A;  2JJQ A;  4BXX H;  3CC7 A;  1C7Y A;  4J15 A;  2UU9 Q;  4JI6 L;  1XPR A;  3H3V I;  2K52 A;  2JQO A;  2HIV A;  3PSI A;  4YWM A;  5C4X H;  3ULP A;  2R7Z H;  2HIX A;  4UP7 A;  3A74 A;  1YBY A;  4P71 A;  2E5L Q;  4P74 A;  2F3I A;  3CC2 A;  1UE7 A;  1Q1E A;  4QGU A;  4JBJ A;  4LF6 L;  3DM3 A;  3KOJ A;  2CCZ A;  4GN4 B;  4H02 A;  1EWI A;  2AMC B;  2CQO A;  2B3G A;  4X62 Q;  3CCV A;  2JA6 H;  3LGJ A;  4QJF A;  5H1S E;  2LSS A;  1HNW Q;  3NEM A;  4JI4 Q;  4GKK Q;  4UPA A;  1JT8 A;  2VL6 A;  3EIV A;  3UDF A;  1XNR Q;  2RHQ B;  3J81 j;  1EFW A;  2KCT A;  2I0Q A;  4IOC A;  2Q2U A;  2UUB Q;  4PMW A;  4C3H H;  1S3O A;  5AJ3 Q;  1QUQ A;  4KI0 A;  2I5L X;  2AWN A;  3HOV H;  1KHI A;  4C2M H;  2NVQ H;  1EUJ A;  5IWA L;  1UE6 A;  1O7I A;  3RR5 A;  3F2D A;  2XTI A;  4DAM A;  1S72 A;  3CC4 A;  2JE6 I;  4AQY L;  4K0K L;  3KF8 B;  4KLK A;  2UUC L;  4GN3 B;  4ALP A;  4A3J G;  1PVO A;  4OO1 G;  3A5U A;  4A3M G;  1LM0 A;  3RLF A;  3TS2 A;  2UXD L;  3KJP A;  1E3P A;  4L5Q A;  5LMU Q;  5C44 H;  4C3I H;  5IYB H;  4R4C A;  5C0X J;  3T1H Q;  1LUZ A;  4ME3 A;  3HOW H;  3CPF A;  4LF7 L;  2F4V Q;  4KHZ A;  1TWG H;  1CUK A;  2JA8 G;  5GAD C;  1SE8 A;  4YWK A;  1AH9 A;  4RG1 A;  2YTY A;  4BY7 H;  1PH6 A;  1NTG A;  1QVC A;  2K14 A;  1QVG A;  4HIM A;  5C4J H;  3I55 A;  1XPU A;  3CCS A;  4JI6 Q;  3HOU H;  2PNH A;  1ASZ A;  5M5X H;  4XIG S;  3BU2 A;  2HHH L;  2IY5 B;  4IOA A;  3PF5 A;  2R92 H;  1HJP A;  1YVC A;  4JV5 L;  3CF5 A;  1P16 A;  3HOY G;  1VQA A;  4LF9 L;  4LF6 Q;  1WYD A;  5HY6 A;  1WCM G;  3GTJ H;  3I4N H;  1A63 A;  1VQK A;  3S1N H;  3L7Z C;  5FJ8 G;  2WAQ E;  1A8V A;  3AFQ A;  3PUW A;  3J80 c;  2CFM A;  1EQR A;  2F52 A;  1PYS B;  4PZ7 A;  1TWH H;  1WJJ A;  1K8G A;  4BBR H;  1SFO H;  4B3T L;  2KEN A;  4LFB L;  1BKB A;  3K8A A;  1Y1W G;  2N3S A;  2GN5 A;  4X65 L;  2EQS A;  1X65 A;  4DV3 L;  1N34 Q;  3TRZ A;  3KF6 A;  2D0O A;  2XGT A;  3G4S A;  1NMG A;  1KIX A;  3A5Z B;  1YNX A;  4JBW A;  1HH2 P;  3RN5 A;  3CCL A;  3HOU G;  3J80 i;  2B63 H;  3NEN A;  4LUO A;  2BH8 A;  2NZH A;  3K0X A;  3RN2 A;  2N49 A;  5IWA Q;  1I94 L;  4P72 A;  4BY1 H;  2N78 A;  3CXC A;  3STB D;  4AQY Q;  1UE1 A;  3HOX H;  1PA6 A;  4JBK A;  4K0K Q;  1KL9 A;  4PZ8 A;  3KJO A;  2UUC Q;  3UDX A;  2I5H A;  3ER0 A;  1JJC B;  4QQB X;  3S24 A;  1VQL A;  4LW1 A;  4A3E G;  1U5K A;  2UXD Q;  4BBS H;  3F8T A;  3PO2 G;  2E8G A;  4BBR G;  3I56 A;  1B8A A;  2YTV A;  3M3Y H;  4KHP L;  2AKW B;  4JOI A;  3PUZ A;  1CKO A;  5LMN L;  1MJE A;  4LF7 Q;  4AYB E;  3PUY A;  3KDF B;  3D0F A;  3GDE A;  1G51 A;  4JCV E;  5DLQ E;  4B3S L;  3CME A;  2KHI A;  1DGS A;  1VQ4 A;  4JI2 L;  3KFU A;  1X3E A;  3T1Y L;  1Q1B A;  4YCV A;  5M3M G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...