1R4PB

Shiga toxin type 2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Shiga Toxin Type 2 (Stx2) from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords shiga-like toxin type II A subunit
total genus 22
structure length 70
sequence length 70
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2003-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1r4pB00
1R4QB 1C4QA 2BOSA 1R4PB 1DM0B 3MXGA 1D1IA 1CZWA 2XSCA 1CQFA 1C48A 1CZGA 4ULLA 1D1KA 2C5CA 1QNUA 1BOSA 1QOHA 4M1UB 4P2CB 2GA4B
chains in the Genus database with same CATH superfamily
1XNQQ 4KJOA 5HGQA 3LWEA 3H3VC 3CKIB 4DAMA 4DV2Q 1V43A 4FF2A 3VDYA 4XQJA 4B3SL 2D9UA 2KBNA 1STNA 4A3DH 2K5NA 4X62L 1XJVA 1I6VC 3KBGA 3RUZA 1PH2A 1G6ZA 5IT9L 2KCTA 3K58A 2D5DA 4A3CH 3QB3A 4IJLA 1XMQQ 2EY5A 2Z6KA 4DV3Q 1HNWL 3D6WA 4DV0Q 5EBCA 1SFOB 4A75A 3CAMA 3RZOB 3J81E 4IFDJ 2JA7B 2JP1A 4LJZC 4GNXB 2DJGC 1RDPD 4B3TL 4KMUC 4LUZA 1U4LA 5H1SE 3CRKC 2OT2A 3FKIH 3MEHA 1TY0A 4RWSC 4A3MG 2PZWA 1G2SA 4RA8A 3AMUA 5IGCA 2PZTA 3A7AB 2YV5A 3PO3G 4BA1I 5IWAL 1S5BD 2RHQB 2F0KA 4HCSA 1JOQA 1EOTA 5AFWA 1SNMA 3S2DB 4B3RQ 2K5QA 4ABNA 1YHBA 1PFNA 1O7ZA 3H0GH 1TS2A 3TP6A 3CCRA 3BU2A 2ENBA 2CWPA 4X3KA 1CZWA 1L0WA 4BA2I 2WFWA 3EROA 2L5TA 2X69A 4DV5L 5IP9G 5C3WA 4BBSB 3HGBA 2X6GA 1C8CA 5JAVA 4HN7A 1VQ8A 2ID0A 1I3QB 4A3CG 4WJ3M 1M1KC 2PO4A 4MTNA 3RN2A 1MI2A 2PI2A 2WAQG 1IKMA 1VQJA 1Q86C 1Y1WH 1RTOA 3DLLA 4A3JG 4DV4Q 4L63B 2WV6D 2HDLA 1TY2A 2Z9HA 3BYYB 5IYDH 3S15B 2FXQA 3HOUH 4BY7H 4YWMA 5KYLA 1VS0A 1JWSD 3PO2B 5IP9H 2HCCA 5E4XA 1GXDC 1TWAH 4TKOB 1QNKA 5C5LA 1HH2P 1PZJD 1Q7YC 3GTGH 2E2JB 1IBMQ 2R92B 4P2CB 4KKUA 3MXUA 4XQQA 1E24A 3M3YH 5C3EB 1FYCA 1STGA 5IP7H 1HR0L 2A73B 3CRLC 1CHPD 3F8TA 1DM0B 4JOIA 3S16B 2RA4A 1N32Q 1I50H 4BBRG 3K6OA 2A69C 1RKNA 1ESFA 3H6MA 1DXMA 1XNRL 1FL0A 4OWWB 3WWVA 4OONA 1U4MA 5T1IA 1Q82C 4ZRZA 4C3HG 3Q8DA 4GKKL 3K0YA 3D3RA 2KHSA 2O4XA 4KK7A 5FJ8H 3J80i 1NJIC 1M4VA 1B9NA 2I5LX 2A6ED 5CV8A 3J81L 1PRTD 4B9WA 1K9MC 1RIPA 4H02A 2B2VA 4RGNA 2C5CA 3SGIA 4RMFA 5BN3A 2NVQH 1QNUA 4J15A 4IFDI 1JC7A 1XXGA 5FKAC 1H95A 3TSSA 2F0DA 5EPKA 1NR4A 1VQIA 4R4QA 1LTGD 2G9DA 1GHKA 2XSCA 1N33Q 5DLQE 4YHHQ 1EEID 3FEWX 4OWTB 4DR3Q 1X9NA 5ELDA 5CV7A 4JI7L 2JA6G 5CORA 1RD9D 5CYUA 4IUUA 1U9RA 2ICIA 1LM0A 2R7FA 3DWQA 1JMCA 3LNNA 2ZTDA 3NBIA 4KN7C 3UI2A 3I4MB 3DM3A 3KUPA 1ENAA 4C3HB 3OTOQ 2NTTA 3P7JA 1YJ9A 3C1FA 4A3IB 4LK1C 1TKWB 4HJ9A 1SE3A 2KEDA 5CMDA 2WP8J 2R6GA 4N9TA 3JAML 3GTGB 4V190 4A3KH 3X3MA 4KD4A 4GOPA 1PH4A 2MJ8A 3KYHC 3C1EA 2F3IA 3OHXC 4LFBL 1IXRA 2F0UA 3E3XA 4IZ8A 2DGYA 3OPOA 2A8VA 4YWKA 5I4DA 4PQXA 3ULPA 1VQCA 1Y8PB 3CMAA 4FXDA 1U5KA 4GOPB 1QCBD 1O78A 1PH5A 4WORA 1ML0D 3HOXB 3A74A 2IX0A 2HD3A 2K03A 1Q8IA 2RF4A 1ILPA 5JJLA 4A3DG 2XGTA 1YNND 4DR4L 1LT3D 2HHHL 1HFNA 1X55A 1XNQL 2TSSA 1WFQA 3K81C 2NZOA 4QQBX 5IGGA 2K1BA 3IAYA 4ZYSA 4A3GG 1XTCD 3A8IE 4X3TA 3PIO3 1B8AA 2F52A 4HJ8A 4DR1L 2E2HH 2JEBI 1C9OA 1E2ZA 4OO1I 3VR3A 5EPLA 2PNHA 4DV0L 4L5QA 2OTLA 1LV9A 1KLGD 3KJOA 4APVA 4JI0Q 2EXDA 3ZJYC 4BBRH 1FNVA 1KD1C 2BH2A 3MZ5A 2IJ0A 2FMCA 4BY1H 2EYLA 3T13A 4NB3A 3M4QA 5HGTA 4KHPL 4AYBE 2ZJQA 1N34L 2F0JA 3G7LA 1A8VA 4OGQC 1EIFA 3NEMA 4NXNL 3MHBA 2EYHA 1VQNA 2F03A 3IFDA 4DK0A 4DNIA 1I6HH 3HEJA 5A2QE 1QILA 2CKZB 1Y1WG 4CKBA 5I9PA 4PZ7A 4DK3C 3L2PA 3VA7A 4NMZA 1V1PB 1CTMA 3U50C 2IT1A 5JVG3 4ZUJA 2B8GA 1B7YB 3S9WA 1B3QA 2Z4IA 2RHSB 3SHLA 4DV5Q 3S1RH 1GUGA 4EX5A 3L7ZC 3LWUA 2F3VA 2F0FA 1SMXA 1I4QA 3TP5A 3RZDB 3PSIA 2I0QA 4EQ5A 3I2ZA 2KVMA 5C4HA 5KEEA 2QDBA 2F0OA 2JA5H 3I4MG 3KFUA 4KD3A 3DUZA 5M5WH 5C3EG 4DV4L 1K3BC 5IYDG 4RCNA 1RL2A 5C4XG 5J3BA 4QGUA 1BXTA 4C2MH 3CU7A 1AP0A 1W2BA 3QO2A 4IN3A 1N8RC 5JJKA 2V4DA 2UUAQ 2A6HC 1J5EQ 1ILQA 1O7YA 1HPCA 4UAIA 4I7ZC 2EYOA 4WJ4A 1K28A 1KDAA 4FP5D 4XIGS 1R4PB 2VL6A 4QB4A 1AN8A 3A8JE 1HR0Q 4M8AA 3TN2A 1DGSA 1SN8A 3A55A 2YYZA 3A56A 1GJXA 1F9QA 3GTJH 3CF5A 4Y7NB 4DV7L 2K6AA 3P1HA 2GVBA 1VQ7A 2R7ZH 3U9SA 2PYKA 3QIAA 1S4ZA 3T53B 1YHQA 1SBBB 3K8AA 5C0XG 3LX0A 5KNDA 2B63G 2DN8A 4K0KL 1VQKA 5ELEA 2PW5A 2E76C 2KECA 2L9HA 4DUZQ 2PI2E 3GTOH 1Q90A 1PTOH 1BO0A 1X3EA 1JR0D 1PH1A 5FO9B 1L0XB 2JK8A 2K5DA 2L1BA 1AZPA 4XQNA 1LUZA 2R7DA 3TDQA 4A3EG 4JI1Q 1F2MA 2R93B 4AQYQ 2D2CC 3PO2G 3L9AX 3NP8A 3PUYA 4R4OA 1PZID 1NE3A 2QEJC 2XIWA 1CFMA 5E7NA 1X3GA 1VQEA 1Z7TA 2DY8A 1G8ZD 1STHA 1SSOA 2UXBL 3HOVH 1LT6D 5KGUA 2WAQE 1SNPA 3JC66 1VQ9A 1F2YA 2SNSA 1WCMH 2YTXA 1JT8A 1A63A 1CKOA 4RHRA 4HIKA 1O7LA 3NWTA 1VQGA 1EIYB 4Q0FA 1WD1A 4IOAA 1WOCA 4C1NK 3VA5A 2M2LA 3ULJA 2BA1A 3NBHB 1FNUA 1TS5A 2K7VA 1Z6HA 2NVQB 1B2TA 1NUCA 2KCCA 1BKBA 3K5OA 2HT1A 3OTOL 3M4PA 2CH4W 3OIPA 4EQNA 1EY0A 1IKLA 1L1OA 4K8JA 1VQ4A 4AH6A 3F1ZA 2NVYB 2G5DA 3FMCA 3RLFA 4HMJA 5C4ZA 2O5JC 2E2HB 2JJQA 2LSSA 2RSOA 1PZKD 3PUZA 1LTTD 1Y1VG 2JN4A 2HDMA 3K7UC 1E1TA 2IW3A 1HZCA 3S17B 4LFBQ 1G2TA 3OOCA 4ODGA 3ER0A 5IT9E 1ZKOA 1OXVA 2NN6G 5M5YH 4J6HA 4CDEC 4A3MB 4FYDA 4IUQA 3KBXA 3K5MA 1QZGA 2B2WA 4JI3L 1SXTA 2UXDQ 4HIMA 3GTMH 3PCOB 3AFPA 2FFKB 4DUYQ 4C1NI 1EY5A 2EOTA 1SEBD 1A3VA 4OO1G 1BCPC 1SDFA 4PMCA 4ZAIA 2HHHQ 4F87A 3C46A 4HIDA 2M00A 2PMZE 3GO5A 5JVH3 1S5CD 5IODA 4A3FH 2P5ZX 1U4PA 1HCZA 3O13A 2BDNA 3Q24A 1VF7A 4EQOA 1OTCA 3DWAA 4IPCA 1IBLL 2RBMA 4DU9A 3MWYW 1EY7A 5IT9c 2B2UC 1KRTA 3D4WA 3M4OH 1Q46A 1UWVA 3FHWA 3MFGA 4A3IH 4JPBW 4HIOA 1HA6A 1SYCA 1VQMA 2WKDA 3E0EA 4LAAA 3TEHB 1JORA 1J9OA 2ALYB 2NTSA 1BR9A 5M5XH 2PW7A 4IPGA 5LMUL 1HNXQ 1EQRA 2HCIA 4IFDH 5DAUA 3RMHA 2EZVA 4DK1A 3CCJA 1WTWA 4PZ6A 1PH9A 1JJGA 3QR8A 3GTPB 5EKIA 2C9OA 3AU7A 4NXNQ 1K83H 1JICA 5G3LF 3SE0A 2XWBB 1FGBD 3TZDA 2IPKD 4K2KA 1GOZA 5EKKA 1SJHD 1L0YB 5EPJA 1QG7A 4L5TA 2FMMA 2XN9C 3I3CA 4LFCL 3CC2A 3S1QB 2JXMB 1QOHA 4K5XA 3I90A 3MXPA 3HOYG 4OHJA 1RCVD 4N8X1 1EY8A 2EYFA 4P75A 1R4QB 1S40A 3STBD 2F0SA 5GADC 1MSHA 2PPBC 1KABA 1PYSB 3HOUG 3WDNA 4L8JA 3L0OA 3TRZA 4UP9A 5CR3A 4RAUC 5E4WC 4YIJA 3MEFA 1UE7A 3NELA 2R93H 1C0AA 1TWGH 5JEAG 5I6YA 1EFWA 3KF6B 2DUDA 1TWCH 1MJCA 5M5YB 2NVTH 1TWHB 3T1HQ 2F0LA 3S2DH 4FXKC 1PRTF 1G91A 3HOZB 4PMBA 4P74A 4KHVA 1PFBA 1DJRD 3BZKA 4X64L 1IW7D 1D1KA 3E6ZX 1KXLA 3GTJB 4EVOA 5C44H 2NVYH 4A3KG 2B2VC 1RJTA 4B9XA 1U0LA 3QG1A 4DV7Q 1TQOA 4DAYA 2Q2TA 2GA4B 2UXCQ 4OXPA 4A4IA 1WTXA 3S1RB 4HSVA 5G3LD 4LF6L 1GVPA 3P75A 5CV5A 4I65A 1VDZA 5CBAE 1SYDA 3NK9A 3V2TA 2B63B 4DUZL 3UE0A 4K5WA 4JK1C 3TS2A 2QW7A 3JAME 3CCSA 1YNJC 1WTHA 2EYJA 2VS1A 4LF9L 1TXYA 3J7AF 3SK8A 1F9SA 3T1YQ 1MHWC 5LMNL 2B39A 1RTNA 2N3SA 3HS0C 3RZOH 4AQYL 1VMPA 5FOBB 1SR3A 5NUCA 1EZ8A 3C2PA 5FO7B 4B3MQ 2SDFA 2EYPA 3CP0A 2EVBA 1XMOQ 2H5XA 1EWHA 3BVMA 4RCOA 2K01A 3M7GA 1PXUA 4DR2Q 4AIMA 2E5LQ 1IW7C 5GAEC 3RZDH 2DNCA 1H9MA 4ZQ3A 1JWMD 1D6EC 2UXBQ 3OSOA 2UU9Q 2PZUA 5EBDA 1HFGA 1Q8KA 2ATWA 3PUXA 4POFA 3MC0B 5ELNA 4Y7NH 1VQ6A 2HUGA 3K57A 1WJJA 3PGZA 5KYIA 3S1QH 5LMNW 2XRQD 3HOWH 2WIIB 4JC0A 2K4KA 2DJFC 4KI0A 4DAYB 5A35A 3CCLA 5I2XA 2VQEL 1PH7A 2A68C 3IFTA 1SMYD 1VCIA 2F0NA 4YCVA 1L1OB 4YY3L 4JI6L 3DM1A 3I4LA 4OO1H 3CMEA 3P20A 2HQEA 1C4QA 2F0WA 3H15A 4X65L 2J0TD 3KF8B 2WINB 2QEXA 2L0CA 2OQKA 1VQHA 2OXPA 3T4AC 4LF7Q 3UDXA 4ULLA 1VQAA 1SAPA 2JA5B 2ZT9C 1PVOA 1DD2A 1QVGA 1NMGA 1BUVT 1TWFH 2MNAA 3KJPA 2ICEC 1Y8OB 3PUWA 5IIFA 3CCUA 2K28A 4N8FA 3I4MH 1LYLA 3VR6A 1PH8A 3LGJA 5FK9C 3NWSA 1PH3A 4UHVA 5M5WB 4I7AA 4A76A 4DUYL 2B63H 2R92G 1II3A 4JCVE 4KY5A 4LF8Q 1HHVA 1DYQA 1C48A 3M4OB 2ZXPA 5DNFA 4DAVA 1B53A 4A3LH 1F9RA 4GN5A 1QE6A 3TBIB 1VQ5A 4IURA 1T9HA 2EJMA 5GAGC 5HY6A 1UE6A 3G6EA 1EU3A 5C4XH 4K8IA 3URYA 1LABA 3GTMB 1EYGA 1IBKL 4A3FB 2K5HA 1BCPD 3PV0A 3QWNA 1XPOA 5LHY1 4XT3B 3S24A 5IGBA 3CCEA 3GTPH 1NNXA 3HOXH 3S1NB 3HG9A 3D4RA 2SEBD 2UUCL 4JI5L 5CV9A 2GVAA 2Z6BA 4P73A 1SNDA 2OEOA 4KN4C 1EWIA 2Q8RE 5D3IB 1X3PA 3D0FA 4B3TQ 2AUJD 3M4YA 5LMUQ 3BVGA 2MP1A 2F0TA 2J7ZA 3FRPB 3S2HH 5CBEE 5L37A 1EY4A 1JE4A 3VR2A 1EFID 3HP3A 4C3JG 2R93G 3KDFA 4CKCA 1XPUA 5IWAQ 1LTID 3GP7A 3ULLA 4G7OC 3PIPA 4TRDA 4E6IA 2ZXRA 3S17H 2HIVA 1I4RA 5C4JB 5FLMH 1V1OA 4FVMA 2QA4A 4B3RL 5IP7G 1EOVA 4LFCQ 3EQLC 2RCNA 3SDZA 3Q22A 1NCVA 3S1MH 4DPGA 4PG3A 4DN4M 5FJ8G 2E8GA 1H9SB 2K14A 5EGTA 1JJCB 2BA0A 4GLXA 1CKMA 2CVRA 1FR3A 3AYHB 4MNOA 2E75C 2E2DC 2IHFA 1KC8C 4YWLA 1WYDA 3HOWG 1B70B 2O2LD 2JA5G 1A15A 3I8ZA 1KTKA 5JEAH 3K59A 4G7ZC 1PHJA 4K6DA 1LTSD 4ZCKA 1J8IA 2NZ1D 5BR8L 4QJFA 3QJYA 2A69D 3GV6A 3EFXD 2Q2UA 2QILA 4XYQA 3J7AV 2F4VL 4A3MH 2YTYA 4Q5VA 3Q0AA 1D5XC 2VUMG 1JOOA 3OMGA 2BE5D 1CI3M 2CW0D 1N36Q 4JI2L 4CKEA 4A3JB 2MPMA 2UXCL 1I50B 3EA6A 1SE4A 4HAEA 2A19A 1HA5A 3I55A 2CFMA 4CHTB 1SE2A 2JQOA 2OQ0A 4LUOA 3S16H 2H4OA 3OWEB 4LF9Q 2PNRC 4JVZA 2LXJA 1YNXA 3U4ZA 1W6KA 3CQZH 3NENA 3KLWA 5D3DA 1YBYA 1CA5A 2K50A 4LWCA 3WOFA 1VQFA 1NAPA 4QIWE 5LL6S 2KUMA 4B3ML 4XTCS 1OO9B 1XMOL 1G291 1CZGA 3VR4A 2CQAA 5FLXc 2I5MX 3OIQA 2V1CC 2CQOA 5C4JH 2NN6H 1PA6A 1V8QA 1L1OC 3BVZA 1Q3LA 2K33A 3SEBA 4QUFA 1VQPA 2UU9L 2BE5C 3FDTA 2CW0C 4X66L 3H91A 1YNNC 1N33L 4R9WA 2F0HA 1X6OA 2EYMA 2ZJPA 2XWJB 3MXGA 4DR3L 3DMUA 4DV6Q 4JI7Q 3R93A 3PMFA 1NSNS 3EN2A 4MTKA 4O1NA 1YJWA 2RSNA 4ME5A 3U58A 1GHJA 1FNWA 1OXSC 2FHTA 3BZCA 2VUMB 1PDQA 2QGQA 1B50A 1SLJA 2LY7A 2HQLA 2N49A 3FVQA 5AJ3Q 1H9RA 1BQQT 4IALA 1CT1D 4PZ8A 4NW2A 1JOKA 3BYTB 5CGKA 3GD7A 4CJ2C 1GO3E 5EQ0A 1AH9A 3MA2B 4K14A 4H13C 4DR6Q 2OTJA 3L3OC 1K73C 4X65Q 2MO1A 5F2DA 1Q1BA 1HJPA 4XT1B 1PRTB 1JB7A 2A68D 1K0RA 1JB3A 1X56A 2XNAC 3F2CA 4A3EB 2SOBA 2MUYA 1I94Q 3GDEA 2ZTCA 3BDCA 4IQZA 2ZTEA 4TQUS 2B3GA 3PIOA 4PV1C 3TZUA 3CC7A 2KA7A 1MIUA 4BWGB 4POGA 1AE2A 2RVLA 4CJ0B 1H9KA 1XYIA 2Z4HA 4CDDC 2KCNA 1GM5A 3ICEA 4DR7L 3AEVA 1WTQA 1UEBA 4KKSA 1ASYA 2DNEA 1EWCA 2EJGC 4DV2L 4HSPA 2AUKA 1IYUA 2J4XA 1SYFA 1D5ZC 1Q12A 3VYRA 1PYWD 2HIXA 4DR4Q 4BS9A 1I4XA 4Z9CB 3J81i 1K0SA 4K6LA 3CW2C 1S5DD 1X3FA 2H1EA 1TS3A 2EPBA 2AQ2B 2B2TC 2KQ3A 5IYBH 1XMQL 1E1OA 4DV3L 1HNWQ 3GTQB 3GTOB 1BDOA 5C0XJ 1PTOD 2D62A 1IBKQ 4P71A 4XXEA 1B44D 4FF3A 1AEXA 1ET9A 4L5SA 3RNUA 5FLXL 4OX9L 1DZ1A 2XTIA 3CQZB 4UP7A 3TREA 4A3BB 1AW7A 5KRUA 4DNRB 2UUCQ 3EVQA 4JI5Q 2YTVA 3HOZG 4BY1B 1B1ZA 4O2DA 2IX3A 3J81j 3K5LA 4BY7G 3Q6SA 3KF8A 4QMGA 1BBUA 3GTQH 4KHPQ 1DONA 3A8KE 1JE5A 1WVLA 3VYSA 1TS4A 1N34Q 3NUCA 2B2YA 4DXGA 2JA7H 1CHQD 5JJIA 2VB2X 4HJ7A 1STEA 1O80A 4IO9A 5D14A 4GNXA 3RLNA 4C3HH 1I4PA 1ZEQX 3EIVA 3U4VA 5M9OA 1P8LA 2R7ZG 1YEZA 1EZ6A 1Z47A 1ZXTA 2RCFA 3M7NA 1DOMA 3JAMi 4GS3A 4RGTA 1Y1VH 2MO0A 4K2LA 4LUVA 1CSQA 1I4HA 2Q2IA 2AKWB 2NVXB 3HOYH 1TWGB 1JJ2A 1CK1A 1NR2A 5IYCG 1I6HB 4RG1A 3N52A 1R9TH 4IUVA 2UUBL 3KF6A 4X3SA 3MVVA 1K8MA 1J6QA 1LO5D 4ZLTF 3IRBA 4QUCA 1MKHA 1SNQA 3UDFA 1C7YA 2JA7G 1Q81C 1ONLA 5BR8Q 3GV3A 4A3EH 1IHZA 4XDXA 3CCQA 5EJWA 1N32L 3K80C 4ALPA 4ZUIA 3S1MB 3UE1A 1BOSA 1L2FA 3J80c 1STYA 3DEOA 2MGSA 1Z9FA 2G9HD 2F4VQ 3I4OA 2B2UA 2K75A 2X6LA 4A3JH 3A54A 1E2WA 3D6CA 1FD7D 4JI2Q 3SXHA 3BJUA 4A93G 1UE1A 1TU2B 3E9HA 1TWCB 3HRZC 4A3KB 1ASZA 2Q8IB 2AQ1B 1XWEA 2VUMH 3SVMA 4K0KQ 2KCMA 1S5FD 1RF2D 4AYBB 3S14H 4H7BA 1VMCA 2N55A 4JYAQ 2NVTB 4OWXB 1KRSA 2AQ3B 4BY1G 2IX1A 2R92H 1OXUA 2EQSA 5J22A 1Y69U 4KY6A 4HCEA 4OEMB 2PMZB 2LFNA 2IWHA 1KNEA 4YHHL 3GTLB 3I4NH 1KIXA 1SYEA 2L11A 4IUNA 1STAA 3UDIA 1LTLA 3M3YB 1E0BA 2RQXA 1QVCA 3I4NG 2EDGA 3SK6A 1D1IA 1K8OA 2JEAI 3HOVB 1G51A 2NB0A 1WI5A 1GUOA 4KLKA 3MXNB 1EU4A 2Q8TA 2RKSA 4R4IA 5K5PA 2K05A 2R61A 3NTIA 2QF7A 2VY3A 2AWOA 4G57A 2M9VA 3E5SA 4HJ5A 4JW0A 1ICFB 1TWFB 2B8FA 3NPPA 3NSWA 1V1PA 4LF4Q 5EAYA 4ILWA 3KOJA 1F2LA 2A6EC 5COYA 2KHIA 1BNZA 2Y0SG 5J1ZA 3I56A 3KK7A 2A1AA 5M5XB 5BN5A 3FKIB 1XX8A 2ZXOA 1PFSA 3HOXG 3I7FA 4JV5Q 3JAMc 2EY2A 1CUKA 4RGOS 1DOLA 1G6PA 3BDLA 1KAAA 4QF4A 3E9IA 2QKIC 4P72A 2AHOB 5E1FA 3S15H 1HNZL 5C3EH 3HOWB 2NZHA 3OW7A 3ND9A 1HXYD 3V05A 4RKBA 2UXDL 2L55A 3R8BA 1H9JA 3NQTA 5C6AA 3WOEA 1D8LA 4MZ9A 2F0IA 3E0JA 1IYVA 1O7IA 1CA6A 2NVXH 1EY6A 3HOUB 3W5OA 3Q23A 4HMIA 2JA9A 4DR1Q 1GD7A 1Y1VB 4JOIC 1M90C 4KHZA 1F2ZA 2PQAB 3I4NB 3BDOA 2CH4A 5C0XH 1GUSA 4F8MA 4DR5L 4FO2A 5GROA 1QJOA 4BBSH 4DKAC 4X6AH 4ME3A 3S14B 4NXML 1I3QH 3PUVA 4JI0L 1PTOB 2VW9A 4A93H 1E7ZA 2XVSA 1PV4A 2N8NA 5IE8A 1K3RA 1EQQA 4OX9Q 1KL9A 4R4CA 5TSSA 4U68A 5CV4A 4C3IH 5IOCA 3K7AB 2IY5B 2CWAA 2IL8A 4GNXC 3NTHA 3T56B 4BY7B 1HTPA 1MBYA 1EQVA 1CKNA 4IUPA 4UY8C 4C3IG 3J81c 5I2YA 1N9WA 4DV1L 4JI4Q 2B2YC 4GKJQ 1GUNA 2D0OA 3OW2A 2E2JH 1HZ9A 3I91A 4X3UA 3F2DA 4WFN3 2Y0SB 1LTAD 1JWUD 4CDFC 3J7ZC 3H09A 1S3OA 1HUNA 3QOJA 2ZM6Q 4JBWA 2I5HA 1A6XA 2EE1A 5M3FG 5LL6X 3EJIA 4OELB 1RHPA 1YJNA 2R3ZA 2JSOA 1YZ6A 1UAPA 1P16A 2WB1B 1WTRA 1KNAA 4CJ1B 1A3TA 1VQLA 3PO3H 3H0GB 1YNJD 1HZAA 5C44G 3HKZB 4FF4A 1X65A 3CCVA 1TWHH 2Z0SA 4R1JA 3OMCA 4QL5A 4S3SA 1T5XD 1A62A 4J8QA 1FJGQ 3J80L 4CDCC 3PF4A 2UUBQ 2UUAL 3W2DA 3VYTA 1J5EL 2NBFA 1F77A 4ZKCB 1R9TB 1IZ6A 2JYOA 3F2BA 2AMCB 4OL7A 1UE5A 1EIGA 1WTVA 1AZQA 3PO3B 4L5RC 3HOYB 2E74C 5I6WA 1FGUA 2NN6I 1DCZA 4IPDA 2FJ2A 4RFBA 2A6HD 1IYJB 4LW1A 3A5ZB 1KLUD 4YCWA 4EQPA 4PMWA 1SRUA 2OWOA 3TS0A 4HTHA 4X64Q 4QIWB 1KHIA 2F0VA 1WTPA 3ITPA 2WKCA 1EEFD 1YITA 1YIJA 3C3LA 4OIKA 1CQFA 3DEPA 2CCZA 3DXJC 4MIUA 2WAQB 2Z8LA 3FPPA 4Y52H 1SFOH 1K83B 4FNFA 1ESRA 5C44B 1LT4D 3IKJA 4JI8L 4A3GB 1NBWA 4UPAA 4DAPA 2BH8A 2WB1G 4IJHA 1PYBA 1CM9A 3ERQA 1ENCA 3K5NA 4C2MB 4A3FG 4JI1L 3SK4A 1TVXA 2F0EA 5I9OA 3V96A 3ND8A 3CCMA 1W6JA 1EYDA 4JYAL 5KNCA 5IGDA 4LFAQ 3J7YW 5JEAJ 3G71A 4IFDG 1OXTA 4GN3B 1HZBA 1HQRD 3R2TA 2PQAA 4CBVA 4V0BA 4KTAA 5FO8B 1WTOA 3ERSX 4C3IB 1YI2A 4GZYC 5M3MH 3R2IA 4TVAB 2N88A 4WJWA 3RLOA 2E2IH 2YU9B 1XTDA 4BBSG 3IL8A 1ZYRD 3T16A 1TR5A 4JBKA 3SR1A 4RHSA 2Z1CA 3KLRA 2JA6H 1JQYD 1QZHA 2E5LL 3CPFA 1SYBA 3J80E 2KENA 2I07B 1I5FA 3T51B 4NKLA 2EY1A 4U673 1V1QA 3NQIA 3N6RA 3BZDB 4J1MA 4QCLA 1BBWA 4XYOA 3H0GG 4LF5L 1V9PA 2VQFL 2EIFA 1PFMA 4C3JB 3GTKH 1ET6A 4OIJA 4BBRB 3F2UA 4GOPC 4B08A 1Q1EA 5M3FB 2MQHA 3HFZB 4LF4L 2VQEQ 3TP8A 4O42A 3HKZE 5JPMC 3NE5B 1QUQB 3CPWA 4YY3Q 2RDFA 4UP8A 2KJXA 3D8GA 5K36H 4KV6A 4JBMA 2F4IA 3CHBD 3A5UA 5M3MG 2LMCB 2NUCA 4BXXG 3TP7A 1AE3A 3HKZG 3OYYA 3RN5A 4A93B 2K04A 1SYGA 1NY4A 3G4SA 1X32A 2VXWA 1CSPA 4F88A 4JV5L 4LF7L 3R3OA 1X54A 1D7QA 3D31A 3PQIA 4H0LC 4JI3Q 1WD0A 4DXFA 2RDGA 4GLVB 1HR0W 3K0XA 1K8GA 5DEHA 1LTRD 3M9BA 1HNZQ 3A7LA 5K36G 4DA2A 1AFPA 5C3XA 1H9SA 2DY7A 5T1GA 4DK6C 1PTOF 3FPUB 2PQEA 2BOSA 1EIHA 4B3SQ 1MSGA 1TT2A 3W3AA 4ID6A 1S72A 1MD2D 4N9PA 1IBLQ 3OWFA 4JBJA 4X62Q 1EYCA 2L15A 2WACA 3K7AH 4DR5Q 3KLSA 2WB1E 1D2BA 1S5ED 2Z6KC 3HOVG 3KDFB 1XPRA 4NXMQ 3H94A 1T5EA 1BBXC 2F1MA 2A74C 1W3SA 4HEDA 1HNXL 1A2TA 1LT5D 5DM73 1E2VA 4G7HC 3I73A 1ICWA 2O5IC 1MJEA 1KAWA 4EGVA 2K5WA 1TIID 1PMRA 3MFYA 2OCEA 4AYBG 5ELBA 3FP9A 2EXZA 5JJZA 1STBA 1PLFA 2BDOA 4LMQD 2JA8B 4DV1Q 1B3AA 4JI4L 4M1UB 4GKJL 3EBEA 4QY7A 2EY6A 1KDBA 4IPHA 4A3LG 1HRJA 1VQDA 1BCPB 2QDLA 3I70A 4R8IA 2ZM6L 1RODA 5A2QL 2TMPA 1BVSA 2A5HA 2EJFC 3PO2H 4R8NA 3CC4A 5GQOA 3MXNA 1TWAB 2JA8G 1B9MA 4C56C 1WCMG 4RKLA 4TSSA 1I4GA 2KEEA 3SK5A 3CXCA 1LACA 4MHEA 3H3VH 3NHHA 3W1GA 1CQVA 1MGSA 1Y1WB 3W1BA 1FJGL 1HQMC 3PIP3 3STBC 4KJNA 2IHEA 1NTGA 2B2WC 2B2TA 5IYCH 2NYZD 3ZYYX 1LLRD 3U9OA 2RDHA 3T1HL 2F3WA 2K32A 4FXGC 5ELCA 2F0QA 1EQTA 3M85A 1IBML 2FINB 1D5MC 1IL8A 2LXKA 2JA8H 1QB5D 2SNMA 3AFQA 1GUWA 1DOKA 4A3IG 1VQOA 3H3VI 2GN5A 5IGFA 2B29A 5CV6A 4CGYB 3B6YA 1QUQA 1NMFA 1SJED 1E3PA 5KIXA 1VQBA 2MHVA 4KKTA 4YCUA 1XNRQ 2XRSD 5C0XI 5FLXE 2BCOA 2VB3X 1BCPF 3I72A 5J39A 1PRTC 3MAQA 1FVIA 4LF6Q 4IOCA 2F0PA 3S2HB 4MN3A 5ISRA 4GLAC 3ONAB 3GTKB 2ES2A 3A0JA 1SNCA 1EYAA 1WCMB 2L12A 4DNTB 4GKKQ 1E22A 3AB9A 1N36L 5BN4A 2N78A 4JI8Q 2VZAA 2C35B 1YVCA 1QWYA 5IYBG 3T1YL 3BS1A 1IL2A 1GKHA 1YHAA 4LNQA 5LMNQ 4A3GH 5DM63 1SROA 4GN4B 4HJAA 2R7ZB 4DGZA 4HR7B 1PH6A 3GQBA 1B4OA 4NDXA 1UNSA 4A3DB 2JA6B 3MTSA 1GUTA 4BXXH 5E3FA 1ENFA 5ELFA 4LFAL 4A3BG 3VYUA 1UUPA 2MFIA 3GTLH 2E2IB 1HUMA 2OF1A 4DR2L 3G6JB 3UDGA 3NTKA 2VNUD 1SE8A 1U4RA 5C4XB 2ZJRA 2ASBA 3J7A5 4JG2A 5HURA 5JOBA 3DHQA 1Y8NB 3TMEA 1K8AC 1BF4A 3BG3A 5GAHC 4FDBA 5JPNC 1A0IA 1Y14B 3QOLA 3G48A 3X3NA 4K5VA 1KDCA 4IUTA 4X66Q 4DFAA 1X3QA 3CD6A 1OXXK 2K52A 1ZYRC 3DWPA 4PNYA 4DV6L 4O0AA 5CC4A 3D4DA 2Q2HA 4LF5Q 1EUJA 1SNOA 4ZKBB 4KY7A 2VQFQ 4JI6Q 3S1NH 5M3FH 1HTLD 2KOLA 2NWGA 4ZK9B 1CKNB 4F7XA 4G4KA 5AJ3L 1PTOC 4UDUC 4NP5A 4C3JH 1LTBD 3AQQA 4DF7A 1VF5C 1A3UA 1SMYC 2LS01 2Y0SE 4NPSA 2JE6I 1QVFA 4L6TB 1F9PA 4DR6L 1EY9A 1A2UA 4R4TA 5IGEA 3TQYA 5ELOA 3RR5A 3RD4A 3NBHA 5KNBA 3PF5A 4FF1A 5EKLA 2KHJA 5C5MA 4A3BH 2CHBD 3HKSA 2F0GA 2QCPX 1EL0A 2F0MA 4RGMA 3NXWA 4WRDA 1KQSA 2L4NA 3HZXA 2AWNA 1M8AA 3FKIG 3KLSX 1I94L 1JCKB 5D65A 5FLMG 1UEAB 4H44C 2LKVA 2YU9H 5M3MB 4LF8L 2I46A 3HOZH 2D0PA 5IY0A 2PCFB 4DR7Q 2K5VA 4RH6A 3VR5A
chains in the Genus database with same CATH topology
4KJOA 3LWEA 3H3VC 3CKIB 1V43A 4FF2A 4XQJA 2D9UA 1STNA 1I6VC 3KBGA 3RUZA 1G6ZA 5IT9L 3K58A 2D5DA 3QB3A 2EY5A 3D6WA 5EBCA 1SFOB 3RZOB 3J81E 4IFDJ 2JA7B 2JP1A 4LJZC 1RDPD 4KMUC 1U4LA 3CRKC 2OT2A 3MEHA 1TY0A 4RWSC 2PZWA 1G2SA 4RA8A 3AMUA 5IGCA 2PZTA 3A7AB 4BA1I 1S5BD 2F0KA 4HCSA 1JOQA 1EOTA 5AFWA 1SNMA 3S2DB 2K5QA 4ABNA 1PFNA 1O7ZA 1TS2A 3TP6A 2ENBA 4X3KA 1CZWA 4BA2I 3EROA 2L5TA 2X69A 5C3WA 4BBSB 3HGBA 2X6GA 1C8CA 5JAVA 4HN7A 2ID0A 1I3QB 2PO4A 1MI2A 1IKMA 1RTOA 4L63B 2WV6D 2HDLA 1TY2A 3BYYB 3S15B 5KYLA 1JWSD 3PO2B 2HCCA 5E4XA 1GXDC 4TKOB 5C5LA 1QNKA 1PZJD 2E2JB 2R92B 4P2CB 4KKUA 3MXUA 4XQQA 5C3EB 1FYCA 1STGA 2A73B 3CRLC 1CHPD 1DM0B 3S16B 2RA4A 3K6OA 2A69C 1RKNA 1ESFA 3H6MA 1DXMA 1U4MA 5T1IA 4ZRZA 4C3HG 3K0YA 3D3RA 2KHSA 2O4XA 4KK7A 1M4VA 1B9NA 2A6ED 5CV8A 3J81L 1PRTD 4B9WA 2B2VA 4RGNA 2C5CA 5BN3A 1QNUA 4IFDI 1JC7A 1XXGA 5FKAC 3TSSA 2F0DA 5EPKA 1NR4A 1LTGD 2G9DA 1GHKA 2XSCA 1EEID 3FEWX 5ELDA 5CV7A 5CORA 1RD9D 5CYUA 4IUUA 1U9RA 2ICIA 3DWQA 3LNNA 3NBIA 4KN7C 3UI2A 3I4MB 3KUPA 1ENAA 4C3HB 2NTTA 3P7JA 3C1FA 4A3IB 4LK1C 1TKWB 1SE3A 2KEDA 5CMDA 2WP8J 2R6GA 4N9TA 3JAML 3GTGB 4V190 3X3MA 4KD4A 2MJ8A 3C1EA 3OHXC 2F0UA 4IZ8A 3OPOA 5I4DA 4PQXA 1Y8PB 4FXDA 1QCBD 1O78A 4WORA 1ML0D 3HOXB 2IX0A 2K03A 1Q8IA 1ILPA 1YNND 1LT3D 1HFNA 2TSSA 5IGGA 2K1BA 3IAYA 4ZYSA 1XTCD 3A8IE 4X3TA 3PIO3 2JEBI 1E2ZA 4OO1I 3VR3A 5EPLA 1LV9A 1KLGD 1FNVA 3MZ5A 2IJ0A 2FMCA 2EYLA 3T13A 5HGTA 2F0JA 3G7LA 4OGQC 3MHBA 2EYHA 2F03A 3IFDA 4DK0A 3HEJA 5A2QE 1QILA 4CKBA 5I9PA 3VA7A 4NMZA 1V1PB 1CTMA 2IT1A 5JVG3 4ZUJA 2B8GA 3S9WA 2Z4IA 3SHLA 1GUGA 3L7ZC 3LWUA 2F3VA 2F0FA 1I4QA 3TP5A 3RZDB 5C4HA 2KVMA 5KEEA 2QDBA 2F0OA 4KD3A 3DUZA 4RCNA 1BXTA 3CU7A 1AP0A 3QO2A 4IN3A 2V4DA 2A6HC 1ILQA 1O7YA 1HPCA 4UAIA 4I7ZC 2EYOA 1KDAA 4FP5D 4XIGS 1R4PB 4QB4A 1AN8A 3A8JE 4M8AA 3TN2A 3A55A 2YYZA 3A56A 1GJXA 1F9QA 4Y7NB 2K6AA 3P1HA 3U9SA 2PYKA 3QIAA 1S4ZA 3T53B 1SBBB 5C0XG 3LX0A 5KNDA 2DN8A 5ELEA 2PW5A 2E76C 2KECA 2L9HA 1Q90A 1PTOH 1BO0A 1JR0D 5FO9B 1L0XB 2K5DA 1AZPA 2L1BA 4XQNA 3TDQA 1F2MA 2R93B 2D2CC 3L9AX 3NP8A 3PUYA 1PZID 2QEJC 2XIWA 1CFMA 1Z7TA 2DY8A 1G8ZD 1STHA 1SSOA 1LT6D 5KGUA 1SNPA 1F2YA 2SNSA 4RHRA 1O7LA 3NWTA 4Q0FA 1WD1A 4C1NK 3VA5A 2M2LA 2BA1A 1FNUA 1TS5A 2K7VA 1Z6HA 2NVQB 1B2TA 1NUCA 2KCCA 3K5OA 3OIPA 4EQNA 1EY0A 1IKLA 4K8JA 2NVYB 3FMCA 3RLFA 4HMJA 5C4ZA 2O5JC 2E2HB 2RSOA 3PUZA 1PZKD 1LTTD 2HDMA 3S17B 2IW3A 1G2TA 3OOCA 4ODGA 5IT9E 1ZKOA 1OXVA 2NN6G 4J6HA 4A3MB 4FYDA 4IUQA 3KBXA 3K5MA 2B2WA 1SXTA 2FFKB 4C1NI 1EY5A 2EOTA 1SEBD 1A3VA 4OO1G 1BCPC 1SDFA 4PMCA 4ZAIA 4F87A 3C46A 2M00A 3GO5A 5JVH3 1S5CD 5IODA 1U4PA 1HCZA 3O13A 2BDNA 3Q24A 1VF7A 4EQOA 3DWAA 2RBMA 4DU9A 3MWYW 1EY7A 2B2UC 3D4WA 3MFGA 1HA6A 1SYCA 2WKDA 4LAAA 1JORA 1J9OA 2NTSA 1BR9A 2PW7A 2HCIA 4IFDH 5DAUA 3RMHA 1WTWA 4DK1A 2EZVA 3GTPB 5EKIA 2C9OA 3AU7A 1JICA 5G3LF 3SE0A 2XWBB 1FGBD 3TZDA 2IPKD 4K2KA 1GOZA 5EKKA 1SJHD 1L0YB 5EPJA 1QG7A 2FMMA 2XN9C 3I3CA 3S1QB 2JXMB 1QOHA 4K5XA 3I90A 3MXPA 4OHJA 1RCVD 1EY8A 2EYFA 1R4QB 2F0SA 1MSHA 2PPBC 1KABA 3WDNA 4L8JA 5CR3A 4RAUC 5E4WC 4YIJA 5JEAG 5I6YA 5M5YB 1TWHB 2F0LA 4FXKC 1PRTF 1G91A 3HOZB 4PMBA 4KHVA 1PFBA 1DJRD 1IW7D 1D1KA 3E6ZX 3GTJB 4EVOA 2B2VC 1RJTA 4B9XA 3QG1A 1TQOA 4DAYA 2GA4B 1WTXA 3S1RB 4HSVA 5G3LD 3P75A 5CV5A 4I65A 1VDZA 5CBAE 1SYDA 3NK9A 3V2TA 2B63B 4K5WA 4JK1C 3JAME 1YNJC 2EYJA 3J7AF 3SK8A 1F9SA 2B39A 1RTNA 3HS0C 1VMPA 5FOBB 5NUCA 1EZ8A 3C2PA 5FO7B 2SDFA 2EYPA 2EVBA 1EWHA 3BVMA 4RCOA 2K01A 3M7GA 1PXUA 1IW7C 2DNCA 1H9MA 4ZQ3A 1JWMD 1D6EC 3OSOA 2PZUA 5EBDA 1HFGA 3PUXA 3MC0B 2HUGA 3K57A 5KYIA 2XRQD 2WIIB 4KI0A 5A35A 5I2XA 2A68C 3IFTA 1SMYD 1VCIA 2F0NA 3DM1A 3I4LA 4OO1H 3P20A 2HQEA 1C4QA 2F0WA 2J0TD 2WINB 2L0CA 2OXPA 3T4AC 4ULLA 1SAPA 2JA5B 2ZT9C 1DD2A 1BUVT 2ICEC 1Y8OB 3PUWA 5IIFA 2K28A 3VR6A 5FK9C 3NWSA 5M5WB 1II3A 4KY5A 1HHVA 1DYQA 1C48A 3M4OB 2ZXPA 5DNFA 4DAVA 1B53A 1F9RA 1QE6A 3TBIB 4IURA 2EJMA 1EU3A 4K8IA 3URYA 1LABA 3GTMB 4A3FB 1BCPD 3PV0A 3QWNA 5LHY1 4XT3B 5IGBA 3S1NB 3HG9A 3D4RA 2SEBD 5CV9A 1SNDA 2OEOA 4KN4C 2Q8RE 5D3IB 1X3PA 2AUJD 3M4YA 3BVGA 2MP1A 2F0TA 2J7ZA 3FRPB 5CBEE 1EY4A 1JE4A 3VR2A 1EFID 3HP3A 4C3JG 4CKCA 1LTID 3GP7A 4G7OC 4TRDA 4E6IA 2ZXRA 1I4RA 5C4JB 1V1OA 4FVMA 3EQLC 3Q22A 3SDZA 1NCVA 4DN4M 1H9SB 5EGTA 2BA0A 2CVRA 1FR3A 2E75C 2E2DC 2O2LD 1A15A 3I8ZA 1KTKA 5JEAH 3K59A 4G7ZC 4K6DA 1LTSD 1J8IA 2NZ1D 3QJYA 2A69D 3GV6A 3EFXD 2QILA 4XYQA 3J7AV 4Q5VA 3Q0AA 1D5XC 1JOOA 3OMGA 2BE5D 1CI3M 2CW0D 4CKEA 4A3JB 2MPMA 1I50B 3EA6A 1SE4A 4HAEA 1HA5A 4CHTB 1SE2A 2H4OA 3OWEB 2PNRC 1W6KA 5D3DA 1CA5A 3WOFA 1NAPA 5LL6S 2KUMA 4XTCS 1OO9B 1G291 1CZGA 3VR4A 2CQAA 3OIQA 2NN6H 1V8QA 3BVZA 3SEBA 1Q3LA 2K33A 4QUFA 2BE5C 3FDTA 2CW0C 3H91A 1YNNC 4R9WA 2F0HA 2EYMA 2XWJB 3MXGA 3DMUA 3R93A 3PMFA 1NSNS 4O1NA 2RSNA 4ME5A 1GHJA 1FNWA 1OXSC 2FHTA 2VUMB 1PDQA 1B50A 2LY7A 3FVQA 1H9RA 1BQQT 4IALA 1CT1D 4NW2A 1JOKA 3BYTB 5CGKA 3GD7A 4CJ2C 5EQ0A 3MA2B 4K14A 4H13C 3L3OC 5F2DA 1Q1BA 4XT1B 1PRTB 2A68D 1JB3A 2XNAC 4A3EB 2SOBA 2MUYA 3BDCA 4IQZA 4TQUS 4PV1C 3TZUA 2KA7A 4BWGB 2RVLA 4CJ0B 1H9KA 1XYIA 2Z4HA 2KCNA 1WTQA 4KKSA 2DNEA 1EWCA 2EJGC 4HSPA 2AUKA 1IYUA 2J4XA 1SYFA 1D5ZC 1Q12A 3VYRA 1PYWD 4BS9A 1I4XA 4Z9CB 4K6LA 1S5DD 2H1EA 1TS3A 2EPBA 2AQ2B 2B2TC 2KQ3A 3GTQB 3GTOB 1BDOA 5C0XJ 1PTOD 2D62A 4XXEA 1B44D 4FF3A 1AEXA 1ET9A 5FLXL 1DZ1A 3CQZB 4A3BB 1AW7A 5KRUA 4DNRB 3EVQA 4BY1B 1B1ZA 2IX3A 3K5LA 3Q6SA 3KF8A 4QMGA 1DONA 3A8KE 1WVLA 3VYSA 1TS4A 3NUCA 2B2YA 4DXGA 1CHQD 2VB2X 1STEA 1O80A 5D14A 1I4PA 1ZEQX 5M9OA 1ZXTA 1EZ6A 1Z47A 3M7NA 1DOMA 4RGTA 4K2LA 1I4HA 2NVXB 1TWGB 1CK1A 1NR2A 1I6HB 3N52A 4IUVA 4X3SA 3MVVA 1K8MA 1LO5D 4ZLTF 4QUCA 1SNQA 1ONLA 3GV3A 1IHZA 4XDXA 5EJWA 4ZUIA 3S1MB 1BOSA 1STYA 3DEOA 2MGSA 2G9HD 2B2UA 2X6LA 3A54A 1E2WA 3D6CA 1FD7D 3SXHA 1TU2B 3HRZC 1TWCB 4A3KB 2Q8IB 2AQ1B 1XWEA 3SVMA 1S5FD 1RF2D 4AYBB 4H7BA 1VMCA 2N55A 2NVTB 2AQ3B 2IX1A 1OXUA 5J22A 1Y69U 4KY6A 4HCEA 2PMZB 2LFNA 2IWHA 1KNEA 3GTLB 1SYEA 2L11A 4IUNA 1STAA 3M3YB 1E0BA 2RQXA 2EDGA 3SK6A 1D1IA 1K8OA 2JEAI 3HOVB 2NB0A 1GUOA 1EU4A 5K5PA 2RKSA 2Q8TA 2K05A 2R61A 3NTIA 2QF7A 2AWOA 4G57A 2M9VA 3E5SA 1TWFB 2B8FA 3NPPA 3NSWA 1V1PA 4ILWA 1F2LA 2A6EC 5COYA 1BNZA 5J1ZA 3KK7A 5M5XB 5BN5A 3FKIB 1XX8A 2ZXOA 2EY2A 4RGOS 1DOLA 3BDLA 1KAAA 4QF4A 2QKIC 5E1FA 3HOWB 3OW7A 3ND9A 1HXYD 3V05A 4RKBA 2L55A 3R8BA 1H9JA 3NQTA 5C6AA 3WOEA 2F0IA 3E0JA 1IYVA 1CA6A 1EY6A 3HOUB 3Q23A 4HMIA 1Y1VB 4KHZA 1F2ZA 3I4NB 3BDOA 5C0XH 1GUSA 4F8MA 4FO2A 1QJOA 3S14B 3PUVA 1PTOB 2XVSA 5TSSA 4U68A 5CV4A 5IOCA 3K7AB 2IL8A 3NTHA 3T56B 4BY7B 1HTPA 1MBYA 1EQVA 4IUPA 4C3IG 5I2YA 2B2YC 1GUNA 3I91A 4X3UA 4WFN3 2Y0SB 1LTAD 1JWUD 3H09A 1HUNA 3QOJA 4JBWA 1A6XA 2EE1A 5LL6X 3EJIA 1RHPA 2R3ZA 2JSOA 1UAPA 2WB1B 1WTRA 1KNAA 4CJ1B 1A3TA 3H0GB 1YNJD 3HKZB 4FF4A 3OMCA 4S3SA 1T5XD 4J8QA 3J80L 3W2DA 3VYTA 2NBFA 1F77A 4ZKCB 1R9TB 2JYOA 4OL7A 1EIGA 1WTVA 1AZQA 3PO3B 3HOYB 2E74C 5I6WA 2NN6I 1DCZA 2FJ2A 4RFBA 2A6HD 1KLUD 4EQPA 4PMWA 4HTHA 4QIWB 2F0VA 1WTPA 3ITPA 2WKCA 1EEFD 3C3LA 4OIKA 1CQFA 3DEPA 3DXJC 4MIUA 2WAQB 2Z8LA 3FPPA 1K83B 4FNFA 1ESRA 5C44B 1LT4D 3IKJA 4A3GB 4DAPA 1CM9A 3ERQA 1ENCA 3K5NA 4C2MB 3SK4A 1TVXA 2F0EA 5I9OA 3V96A 3ND8A 1W6JA 1EYDA 5KNCA 5IGDA 3J7YW 5JEAJ 4IFDG 1OXTA 1HQRD 3R2TA 4CBVA 4V0BA 4KTAA 5FO8B 1WTOA 4C3IB 4GZYC 3R2IA 4WJWA 2N88A 2YU9B 3IL8A 1ZYRD 3T16A 1TR5A 3SR1A 4RHSA 2Z1CA 3KLRA 1JQYD 1SYBA 3J80E 2I07B 3T51B 4NKLA 2EY1A 4U673 3NQIA 3N6RA 3BZDB 4J1MA 4QCLA 4XYOA 1PFMA 4C3JB 1ET6A 4OIJA 4BBRB 3F2UA 4B08A 1Q1EA 5M3FB 3TP8A 4O42A 5JPMC 3NE5B 2RDFA 2KJXA 3D8GA 5K36H 4KV6A 2F4IA 3CHBD 2LMCB 2NUCA 3TP7A 4A93B 2K04A 1SYGA 1X32A 2VXWA 4F88A 3R3OA 3D31A 4H0LC 1WD0A 4DXFA 2RDGA 5DEHA 1LTRD 3A7LA 5K36G 4DA2A 1AFPA 5C3XA 1H9SA 2DY7A 5T1GA 1PTOF 3FPUB 2PQEA 2BOSA 1EIHA 1MSGA 1TT2A 3W3AA 4ID6A 1MD2D 4N9PA 3OWFA 1EYCA 2WACA 3KLSA 1D2BA 1S5ED 3H94A 1T5EA 1BBXC 2F1MA 2A74C 4HEDA 1A2TA 1LT5D 5DM73 1E2VA 4G7HC 3I73A 1ICWA 2O5IC 4EGVA 2K5WA 1TIID 1PMRA 3MFYA 5ELBA 2EXZA 5JJZA 1STBA 1PLFA 2BDOA 4LMQD 2JA8B 1B3AA 4M1UB 2EY6A 1KDBA 1HRJA 1BCPB 3I70A 4R8IA 1RODA 5A2QL 2TMPA 2A5HA 2EJFC 4R8NA 3MXNA 1TWAB 1B9MA 4C56C 4RKLA 4TSSA 1I4GA 2KEEA 3SK5A 1LACA 4MHEA 3NHHA 1CQVA 1MGSA 1Y1WB 1HQMC 3PIP3 4KJNA 2B2TA 2B2WC 2NYZD 3ZYYX 1LLRD 3U9OA 2RDHA 2F3WA 2K32A 4FXGC 5ELCA 2F0QA 1EQTA 3M85A 2FINB 1D5MC 1IL8A 1QB5D 2SNMA 1GUWA 1DOKA 5IGFA 5CV6A 4CGYB 1SJED 5KIXA 2MHVA 4KKTA 2XRSD 5C0XI 5FLXE 2BCOA 3MAQA 2VB3X 1BCPF 3I72A 1PRTC 5J39A 3S2HB 2F0PA 4MN3A 5ISRA 3GTKB 3ONAB 1SNCA 1EYAA 1WCMB 2L12A 4DNTB 3AB9A 5BN4A 1QWYA 3BS1A 5DM63 2R7ZB 4DGZA 4HR7B 3GQBA 1B4OA 4NDXA 1UNSA 4A3DB 2JA6B 3MTSA 1GUTA 5E3FA 1ENFA 5ELFA 3VYUA 1UUPA 2E2IB 1HUMA 2OF1A 3G6JB 3NTKA 2VNUD 1U4RA 5C4XB 5HURA 5JOBA 3DHQA 1Y8NB 3TMEA 1BF4A 3BG3A 5JPNC 3QOLA 3X3NA 4K5VA 1KDCA 4IUTA 4DFAA 1X3QA 1OXXK 1ZYRC 3DWPA 4PNYA 5CC4A 3D4DA 1SNOA 4ZKBB 4KY7A 1HTLD 2KOLA 2NWGA 4ZK9B 4F7XA 4G4KA 1PTOC 4UDUC 4NP5A 1LTBD 4DF7A 1VF5C 1A3UA 1SMYC 2LS01 2JE6I 4L6TB 1F9PA 1EY9A 1A2UA 5IGEA 5KNBA 3RD4A 3NBHA 4FF1A 5EKLA 5C5MA 2CHBD 2F0GA 2QCPX 1EL0A 4RGMA 2F0MA 3NXWA 4WRDA 2L4NA 3HZXA 2AWNA 1M8AA 3KLSX 1JCKB 5D65A 1UEAB 4H44C 2LKVA 5M3MB 2I46A 2PCFB 4RH6A 3VR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4Q B;  1C4Q A;  2BOS A;  1R4P B;  1DM0 B;  3MXG A;  1D1I A;  1CZW A;  2XSC A;  1CQF A;  1C48 A;  1CZG A;  4ULL A;  1D1K A;  2C5C A;  1QNU A;  1BOS A;  1QOH A;  4M1U B;  4P2C B;  2GA4 B; 
#chains in the Genus database with same CATH topology
 1XNQ Q;  4KJO A;  5HGQ A;  3LWE A;  3H3V C;  3CKI B;  4DAM A;  4DV2 Q;  1V43 A;  4FF2 A;  3VDY A;  4XQJ A;  4B3S L;  2D9U A;  2KBN A;  1STN A;  4A3D H;  2K5N A;  4X62 L;  1XJV A;  1I6V C;  3KBG A;  3RUZ A;  1PH2 A;  1G6Z A;  5IT9 L;  2KCT A;  3K58 A;  2D5D A;  4A3C H;  3QB3 A;  4IJL A;  1XMQ Q;  2EY5 A;  2Z6K A;  4DV3 Q;  1HNW L;  3D6W A;  4DV0 Q;  5EBC A;  1SFO B;  4A75 A;  3CAM A;  3RZO B;  3J81 E;  4IFD J;  2JA7 B;  2JP1 A;  4LJZ C;  4GNX B;  2DJG C;  1RDP D;  4B3T L;  4KMU C;  4LUZ A;  1U4L A;  5H1S E;  3CRK C;  2OT2 A;  3FKI H;  3MEH A;  1TY0 A;  4RWS C;  4A3M G;  2PZW A;  1G2S A;  4RA8 A;  3AMU A;  5IGC A;  2PZT A;  3A7A B;  2YV5 A;  3PO3 G;  4BA1 I;  5IWA L;  1S5B D;  2RHQ B;  2F0K A;  4HCS A;  1JOQ A;  1EOT A;  5AFW A;  1SNM A;  3S2D B;  4B3R Q;  2K5Q A;  4ABN A;  1YHB A;  1PFN A;  1O7Z A;  3H0G H;  1TS2 A;  3TP6 A;  3CCR A;  3BU2 A;  2ENB A;  2CWP A;  4X3K A;  1CZW A;  1L0W A;  4BA2 I;  2WFW A;  3ERO A;  2L5T A;  2X69 A;  4DV5 L;  5IP9 G;  5C3W A;  4BBS B;  3HGB A;  2X6G A;  1C8C A;  5JAV A;  4HN7 A;  1VQ8 A;  2ID0 A;  1I3Q B;  4A3C G;  4WJ3 M;  1M1K C;  2PO4 A;  4MTN A;  3RN2 A;  1MI2 A;  2PI2 A;  2WAQ G;  1IKM A;  1VQJ A;  1Q86 C;  1Y1W H;  1RTO A;  3DLL A;  4A3J G;  4DV4 Q;  4L63 B;  2WV6 D;  2HDL A;  1TY2 A;  2Z9H A;  3BYY B;  5IYD H;  3S15 B;  2FXQ A;  3HOU H;  4BY7 H;  4YWM A;  5KYL A;  1VS0 A;  1JWS D;  3PO2 B;  5IP9 H;  2HCC A;  5E4X A;  1GXD C;  1TWA H;  4TKO B;  1QNK A;  5C5L A;  1HH2 P;  1PZJ D;  1Q7Y C;  3GTG H;  2E2J B;  1IBM Q;  2R92 B;  4P2C B;  4KKU A;  3MXU A;  4XQQ A;  1E24 A;  3M3Y H;  5C3E B;  1FYC A;  1STG A;  5IP7 H;  1HR0 L;  2A73 B;  3CRL C;  1CHP D;  3F8T A;  1DM0 B;  4JOI A;  3S16 B;  2RA4 A;  1N32 Q;  1I50 H;  4BBR G;  3K6O A;  2A69 C;  1RKN A;  1ESF A;  3H6M A;  1DXM A;  1XNR L;  1FL0 A;  4OWW B;  3WWV A;  4OON A;  1U4M A;  5T1I A;  1Q82 C;  4ZRZ A;  4C3H G;  3Q8D A;  4GKK L;  3K0Y A;  3D3R A;  2KHS A;  2O4X A;  4KK7 A;  5FJ8 H;  3J80 i;  1NJI C;  1M4V A;  1B9N A;  2I5L X;  2A6E D;  5CV8 A;  3J81 L;  1PRT D;  4B9W A;  1K9M C;  1RIP A;  4H02 A;  2B2V A;  4RGN A;  2C5C A;  3SGI A;  4RMF A;  5BN3 A;  2NVQ H;  1QNU A;  4J15 A;  4IFD I;  1JC7 A;  1XXG A;  5FKA C;  1H95 A;  3TSS A;  2F0D A;  5EPK A;  1NR4 A;  1VQI A;  4R4Q A;  1LTG D;  2G9D A;  1GHK A;  2XSC A;  1N33 Q;  5DLQ E;  4YHH Q;  1EEI D;  3FEW X;  4OWT B;  4DR3 Q;  1X9N A;  5ELD A;  5CV7 A;  4JI7 L;  2JA6 G;  5COR A;  1RD9 D;  5CYU A;  4IUU A;  1U9R A;  2ICI A;  1LM0 A;  2R7F A;  3DWQ A;  1JMC A;  3LNN A;  2ZTD A;  3NBI A;  4KN7 C;  3UI2 A;  3I4M B;  3DM3 A;  3KUP A;  1ENA A;  4C3H B;  3OTO Q;  2NTT A;  3P7J A;  1YJ9 A;  3C1F A;  4A3I B;  4LK1 C;  1TKW B;  4HJ9 A;  1SE3 A;  2KED A;  5CMD A;  2WP8 J;  2R6G A;  4N9T A;  3JAM L;  3GTG B;  4V19 0;  4A3K H;  3X3M A;  4KD4 A;  4GOP A;  1PH4 A;  2MJ8 A;  3KYH C;  3C1E A;  2F3I A;  3OHX C;  4LFB L;  1IXR A;  2F0U A;  3E3X A;  4IZ8 A;  2DGY A;  3OPO A;  2A8V A;  4YWK A;  5I4D A;  4PQX A;  3ULP A;  1VQC A;  1Y8P B;  3CMA A;  4FXD A;  1U5K A;  4GOP B;  1QCB D;  1O78 A;  1PH5 A;  4WOR A;  1ML0 D;  3HOX B;  3A74 A;  2IX0 A;  2HD3 A;  2K03 A;  1Q8I A;  2RF4 A;  1ILP A;  5JJL A;  4A3D G;  2XGT A;  1YNN D;  4DR4 L;  1LT3 D;  2HHH L;  1HFN A;  1X55 A;  1XNQ L;  2TSS A;  1WFQ A;  3K81 C;  2NZO A;  4QQB X;  5IGG A;  2K1B A;  3IAY A;  4ZYS A;  4A3G G;  1XTC D;  3A8I E;  4X3T A;  3PIO 3;  1B8A A;  2F52 A;  4HJ8 A;  4DR1 L;  2E2H H;  2JEB I;  1C9O A;  1E2Z A;  4OO1 I;  3VR3 A;  5EPL A;  2PNH A;  4DV0 L;  4L5Q A;  2OTL A;  1LV9 A;  1KLG D;  3KJO A;  4APV A;  4JI0 Q;  2EXD A;  3ZJY C;  4BBR H;  1FNV A;  1KD1 C;  2BH2 A;  3MZ5 A;  2IJ0 A;  2FMC A;  4BY1 H;  2EYL A;  3T13 A;  4NB3 A;  3M4Q A;  5HGT A;  4KHP L;  4AYB E;  2ZJQ A;  1N34 L;  2F0J A;  3G7L A;  1A8V A;  4OGQ C;  1EIF A;  3NEM A;  4NXN L;  3MHB A;  2EYH A;  1VQN A;  2F03 A;  3IFD A;  4DK0 A;  4DNI A;  1I6H H;  3HEJ A;  5A2Q E;  1QIL A;  2CKZ B;  1Y1W G;  4CKB A;  5I9P A;  4PZ7 A;  4DK3 C;  3L2P A;  3VA7 A;  4NMZ A;  1V1P B;  1CTM A;  3U50 C;  2IT1 A;  5JVG 3;  4ZUJ A;  2B8G A;  1B7Y B;  3S9W A;  1B3Q A;  2Z4I A;  2RHS B;  3SHL A;  4DV5 Q;  3S1R H;  1GUG A;  4EX5 A;  3L7Z C;  3LWU A;  2F3V A;  2F0F A;  1SMX A;  1I4Q A;  3TP5 A;  3RZD B;  3PSI A;  2I0Q A;  4EQ5 A;  3I2Z A;  2KVM A;  5C4H A;  5KEE A;  2QDB A;  2F0O A;  2JA5 H;  3I4M G;  3KFU A;  4KD3 A;  3DUZ A;  5M5W H;  5C3E G;  4DV4 L;  1K3B C;  5IYD G;  4RCN A;  1RL2 A;  5C4X G;  5J3B A;  4QGU A;  1BXT A;  4C2M H;  3CU7 A;  1AP0 A;  1W2B A;  3QO2 A;  4IN3 A;  1N8R C;  5JJK A;  2V4D A;  2UUA Q;  2A6H C;  1J5E Q;  1ILQ A;  1O7Y A;  1HPC A;  4UAI A;  4I7Z C;  2EYO A;  4WJ4 A;  1K28 A;  1KDA A;  4FP5 D;  4XIG S;  1R4P B;  2VL6 A;  4QB4 A;  1AN8 A;  3A8J E;  1HR0 Q;  4M8A A;  3TN2 A;  1DGS A;  1SN8 A;  3A55 A;  2YYZ A;  3A56 A;  1GJX A;  1F9Q A;  3GTJ H;  3CF5 A;  4Y7N B;  4DV7 L;  2K6A A;  3P1H A;  2GVB A;  1VQ7 A;  2R7Z H;  3U9S A;  2PYK A;  3QIA A;  1S4Z A;  3T53 B;  1YHQ A;  1SBB B;  3K8A A;  5C0X G;  3LX0 A;  5KND A;  2B63 G;  2DN8 A;  4K0K L;  1VQK A;  5ELE A;  2PW5 A;  2E76 C;  2KEC A;  2L9H A;  4DUZ Q;  2PI2 E;  3GTO H;  1Q90 A;  1PTO H;  1BO0 A;  1X3E A;  1JR0 D;  1PH1 A;  5FO9 B;  1L0X B;  2JK8 A;  2K5D A;  2L1B A;  1AZP A;  4XQN A;  1LUZ A;  2R7D A;  3TDQ A;  4A3E G;  4JI1 Q;  1F2M A;  2R93 B;  4AQY Q;  2D2C C;  3PO2 G;  3L9A X;  3NP8 A;  3PUY A;  4R4O A;  1PZI D;  1NE3 A;  2QEJ C;  2XIW A;  1CFM A;  5E7N A;  1X3G A;  1VQE A;  1Z7T A;  2DY8 A;  1G8Z D;  1STH A;  1SSO A;  2UXB L;  3HOV H;  1LT6 D;  5KGU A;  2WAQ E;  1SNP A;  3JC6 6;  1VQ9 A;  1F2Y A;  2SNS A;  1WCM H;  2YTX A;  1JT8 A;  1A63 A;  1CKO A;  4RHR A;  4HIK A;  1O7L A;  3NWT A;  1VQG A;  1EIY B;  4Q0F A;  1WD1 A;  4IOA A;  1WOC A;  4C1N K;  3VA5 A;  2M2L A;  3ULJ A;  2BA1 A;  3NBH B;  1FNU A;  1TS5 A;  2K7V A;  1Z6H A;  2NVQ B;  1B2T A;  1NUC A;  2KCC A;  1BKB A;  3K5O A;  2HT1 A;  3OTO L;  3M4P A;  2CH4 W;  3OIP A;  4EQN A;  1EY0 A;  1IKL A;  1L1O A;  4K8J A;  1VQ4 A;  4AH6 A;  3F1Z A;  2NVY B;  2G5D A;  3FMC A;  3RLF A;  4HMJ A;  5C4Z A;  2O5J C;  2E2H B;  2JJQ A;  2LSS A;  2RSO A;  1PZK D;  3PUZ A;  1LTT D;  1Y1V G;  2JN4 A;  2HDM A;  3K7U C;  1E1T A;  2IW3 A;  1HZC A;  3S17 B;  4LFB Q;  1G2T A;  3OOC A;  4ODG A;  3ER0 A;  5IT9 E;  1ZKO A;  1OXV A;  2NN6 G;  5M5Y H;  4J6H A;  4CDE C;  4A3M B;  4FYD A;  4IUQ A;  3KBX A;  3K5M A;  1QZG A;  2B2W A;  4JI3 L;  1SXT A;  2UXD Q;  4HIM A;  3GTM H;  3PCO B;  3AFP A;  2FFK B;  4DUY Q;  4C1N I;  1EY5 A;  2EOT A;  1SEB D;  1A3V A;  4OO1 G;  1BCP C;  1SDF A;  4PMC A;  4ZAI A;  2HHH Q;  4F87 A;  3C46 A;  4HID A;  2M00 A;  2PMZ E;  3GO5 A;  5JVH 3;  1S5C D;  5IOD A;  4A3F H;  2P5Z X;  1U4P A;  1HCZ A;  3O13 A;  2BDN A;  3Q24 A;  1VF7 A;  4EQO A;  1OTC A;  3DWA A;  4IPC A;  1IBL L;  2RBM A;  4DU9 A;  3MWY W;  1EY7 A;  5IT9 c;  2B2U C;  1KRT A;  3D4W A;  3M4O H;  1Q46 A;  1UWV A;  3FHW A;  3MFG A;  4A3I H;  4JPB W;  4HIO A;  1HA6 A;  1SYC A;  1VQM A;  2WKD A;  3E0E A;  4LAA A;  3TEH B;  1JOR A;  1J9O A;  2ALY B;  2NTS A;  1BR9 A;  5M5X H;  2PW7 A;  4IPG A;  5LMU L;  1HNX Q;  1EQR A;  2HCI A;  4IFD H;  5DAU A;  3RMH A;  2EZV A;  4DK1 A;  3CCJ A;  1WTW A;  4PZ6 A;  1PH9 A;  1JJG A;  3QR8 A;  3GTP B;  5EKI A;  2C9O A;  3AU7 A;  4NXN Q;  1K83 H;  1JIC A;  5G3L F;  3SE0 A;  2XWB B;  1FGB D;  3TZD A;  2IPK D;  4K2K A;  1GOZ A;  5EKK A;  1SJH D;  1L0Y B;  5EPJ A;  1QG7 A;  4L5T A;  2FMM A;  2XN9 C;  3I3C A;  4LFC L;  3CC2 A;  3S1Q B;  2JXM B;  1QOH A;  4K5X A;  3I90 A;  3MXP A;  3HOY G;  4OHJ A;  1RCV D;  4N8X 1;  1EY8 A;  2EYF A;  4P75 A;  1R4Q B;  1S40 A;  3STB D;  2F0S A;  5GAD C;  1MSH A;  2PPB C;  1KAB A;  1PYS B;  3HOU G;  3WDN A;  4L8J A;  3L0O A;  3TRZ A;  4UP9 A;  5CR3 A;  4RAU C;  5E4W C;  4YIJ A;  3MEF A;  1UE7 A;  3NEL A;  2R93 H;  1C0A A;  1TWG H;  5JEA G;  5I6Y A;  1EFW A;  3KF6 B;  2DUD A;  1TWC H;  1MJC A;  5M5Y B;  2NVT H;  1TWH B;  3T1H Q;  2F0L A;  3S2D H;  4FXK C;  1PRT F;  1G91 A;  3HOZ B;  4PMB A;  4P74 A;  4KHV A;  1PFB A;  1DJR D;  3BZK A;  4X64 L;  1IW7 D;  1D1K A;  3E6Z X;  1KXL A;  3GTJ B;  4EVO A;  5C44 H;  2NVY H;  4A3K G;  2B2V C;  1RJT A;  4B9X A;  1U0L A;  3QG1 A;  4DV7 Q;  1TQO A;  4DAY A;  2Q2T A;  2GA4 B;  2UXC Q;  4OXP A;  4A4I A;  1WTX A;  3S1R B;  4HSV A;  5G3L D;  4LF6 L;  1GVP A;  3P75 A;  5CV5 A;  4I65 A;  1VDZ A;  5CBA E;  1SYD A;  3NK9 A;  3V2T A;  2B63 B;  4DUZ L;  3UE0 A;  4K5W A;  4JK1 C;  3TS2 A;  2QW7 A;  3JAM E;  3CCS A;  1YNJ C;  1WTH A;  2EYJ A;  2VS1 A;  4LF9 L;  1TXY A;  3J7A F;  3SK8 A;  1F9S A;  3T1Y Q;  1MHW C;  5LMN L;  2B39 A;  1RTN A;  2N3S A;  3HS0 C;  3RZO H;  4AQY L;  1VMP A;  5FOB B;  1SR3 A;  5NUC A;  1EZ8 A;  3C2P A;  5FO7 B;  4B3M Q;  2SDF A;  2EYP A;  3CP0 A;  2EVB A;  1XMO Q;  2H5X A;  1EWH A;  3BVM A;  4RCO A;  2K01 A;  3M7G A;  1PXU A;  4DR2 Q;  4AIM A;  2E5L Q;  1IW7 C;  5GAE C;  3RZD H;  2DNC A;  1H9M A;  4ZQ3 A;  1JWM D;  1D6E C;  2UXB Q;  3OSO A;  2UU9 Q;  2PZU A;  5EBD A;  1HFG A;  1Q8K A;  2ATW A;  3PUX A;  4POF A;  3MC0 B;  5ELN A;  4Y7N H;  1VQ6 A;  2HUG A;  3K57 A;  1WJJ A;  3PGZ A;  5KYI A;  3S1Q H;  5LMN W;  2XRQ D;  3HOW H;  2WII B;  4JC0 A;  2K4K A;  2DJF C;  4KI0 A;  4DAY B;  5A35 A;  3CCL A;  5I2X A;  2VQE L;  1PH7 A;  2A68 C;  3IFT A;  1SMY D;  1VCI A;  2F0N A;  4YCV A;  1L1O B;  4YY3 L;  4JI6 L;  3DM1 A;  3I4L A;  4OO1 H;  3CME A;  3P20 A;  2HQE A;  1C4Q A;  2F0W A;  3H15 A;  4X65 L;  2J0T D;  3KF8 B;  2WIN B;  2QEX A;  2L0C A;  2OQK A;  1VQH A;  2OXP A;  3T4A C;  4LF7 Q;  3UDX A;  4ULL A;  1VQA A;  1SAP A;  2JA5 B;  2ZT9 C;  1PVO A;  1DD2 A;  1QVG A;  1NMG A;  1BUV T;  1TWF H;  2MNA A;  3KJP A;  2ICE C;  1Y8O B;  3PUW A;  5IIF A;  3CCU A;  2K28 A;  4N8F A;  3I4M H;  1LYL A;  3VR6 A;  1PH8 A;  3LGJ A;  5FK9 C;  3NWS A;  1PH3 A;  4UHV A;  5M5W B;  4I7A A;  4A76 A;  4DUY L;  2B63 H;  2R92 G;  1II3 A;  4JCV E;  4KY5 A;  4LF8 Q;  1HHV A;  1DYQ A;  1C48 A;  3M4O B;  2ZXP A;  5DNF A;  4DAV A;  1B53 A;  4A3L H;  1F9R A;  4GN5 A;  1QE6 A;  3TBI B;  1VQ5 A;  4IUR A;  1T9H A;  2EJM A;  5GAG C;  5HY6 A;  1UE6 A;  3G6E A;  1EU3 A;  5C4X H;  4K8I A;  3URY A;  1LAB A;  3GTM B;  1EYG A;  1IBK L;  4A3F B;  2K5H A;  1BCP D;  3PV0 A;  3QWN A;  1XPO A;  5LHY 1;  4XT3 B;  3S24 A;  5IGB A;  3CCE A;  3GTP H;  1NNX A;  3HOX H;  3S1N B;  3HG9 A;  3D4R A;  2SEB D;  2UUC L;  4JI5 L;  5CV9 A;  2GVA A;  2Z6B A;  4P73 A;  1SND A;  2OEO A;  4KN4 C;  1EWI A;  2Q8R E;  5D3I B;  1X3P A;  3D0F A;  4B3T Q;  2AUJ D;  3M4Y A;  5LMU Q;  3BVG A;  2MP1 A;  2F0T A;  2J7Z A;  3FRP B;  3S2H H;  5CBE E;  5L37 A;  1EY4 A;  1JE4 A;  3VR2 A;  1EFI D;  3HP3 A;  4C3J G;  2R93 G;  3KDF A;  4CKC A;  1XPU A;  5IWA Q;  1LTI D;  3GP7 A;  3ULL A;  4G7O C;  3PIP A;  4TRD A;  4E6I A;  2ZXR A;  3S17 H;  2HIV A;  1I4R A;  5C4J B;  5FLM H;  1V1O A;  4FVM A;  2QA4 A;  4B3R L;  5IP7 G;  1EOV A;  4LFC Q;  3EQL C;  2RCN A;  3SDZ A;  3Q22 A;  1NCV A;  3S1M H;  4DPG A;  4PG3 A;  4DN4 M;  5FJ8 G;  2E8G A;  1H9S B;  2K14 A;  5EGT A;  1JJC B;  2BA0 A;  4GLX A;  1CKM A;  2CVR A;  1FR3 A;  3AYH B;  4MNO A;  2E75 C;  2E2D C;  2IHF A;  1KC8 C;  4YWL A;  1WYD A;  3HOW G;  1B70 B;  2O2L D;  2JA5 G;  1A15 A;  3I8Z A;  1KTK A;  5JEA H;  3K59 A;  4G7Z C;  1PHJ A;  4K6D A;  1LTS D;  4ZCK A;  1J8I A;  2NZ1 D;  5BR8 L;  4QJF A;  3QJY A;  2A69 D;  3GV6 A;  3EFX D;  2Q2U A;  2QIL A;  4XYQ A;  3J7A V;  2F4V L;  4A3M H;  2YTY A;  4Q5V A;  3Q0A A;  1D5X C;  2VUM G;  1JOO A;  3OMG A;  2BE5 D;  1CI3 M;  2CW0 D;  1N36 Q;  4JI2 L;  4CKE A;  4A3J B;  2MPM A;  2UXC L;  1I50 B;  3EA6 A;  1SE4 A;  4HAE A;  2A19 A;  1HA5 A;  3I55 A;  2CFM A;  4CHT B;  1SE2 A;  2JQO A;  2OQ0 A;  4LUO A;  3S16 H;  2H4O A;  3OWE B;  4LF9 Q;  2PNR C;  4JVZ A;  2LXJ A;  1YNX A;  3U4Z A;  1W6K A;  3CQZ H;  3NEN A;  3KLW A;  5D3D A;  1YBY A;  1CA5 A;  2K50 A;  4LWC A;  3WOF A;  1VQF A;  1NAP A;  4QIW E;  5LL6 S;  2KUM A;  4B3M L;  4XTC S;  1OO9 B;  1XMO L;  1G29 1;  1CZG A;  3VR4 A;  2CQA A;  5FLX c;  2I5M X;  3OIQ A;  2V1C C;  2CQO A;  5C4J H;  2NN6 H;  1PA6 A;  1V8Q A;  1L1O C;  3BVZ A;  1Q3L A;  2K33 A;  3SEB A;  4QUF A;  1VQP A;  2UU9 L;  2BE5 C;  3FDT A;  2CW0 C;  4X66 L;  3H91 A;  1YNN C;  1N33 L;  4R9W A;  2F0H A;  1X6O A;  2EYM A;  2ZJP A;  2XWJ B;  3MXG A;  4DR3 L;  3DMU A;  4DV6 Q;  4JI7 Q;  3R93 A;  3PMF A;  1NSN S;  3EN2 A;  4MTK A;  4O1N A;  1YJW A;  2RSN A;  4ME5 A;  3U58 A;  1GHJ A;  1FNW A;  1OXS C;  2FHT A;  3BZC A;  2VUM B;  1PDQ A;  2QGQ A;  1B50 A;  1SLJ A;  2LY7 A;  2HQL A;  2N49 A;  3FVQ A;  5AJ3 Q;  1H9R A;  1BQQ T;  4IAL A;  1CT1 D;  4PZ8 A;  4NW2 A;  1JOK A;  3BYT B;  5CGK A;  3GD7 A;  4CJ2 C;  1GO3 E;  5EQ0 A;  1AH9 A;  3MA2 B;  4K14 A;  4H13 C;  4DR6 Q;  2OTJ A;  3L3O C;  1K73 C;  4X65 Q;  2MO1 A;  5F2D A;  1Q1B A;  1HJP A;  4XT1 B;  1PRT B;  1JB7 A;  2A68 D;  1K0R A;  1JB3 A;  1X56 A;  2XNA C;  3F2C A;  4A3E B;  2SOB A;  2MUY A;  1I94 Q;  3GDE A;  2ZTC A;  3BDC A;  4IQZ A;  2ZTE A;  4TQU S;  2B3G A;  3PIO A;  4PV1 C;  3TZU A;  3CC7 A;  2KA7 A;  1MIU A;  4BWG B;  4POG A;  1AE2 A;  2RVL A;  4CJ0 B;  1H9K A;  1XYI A;  2Z4H A;  4CDD C;  2KCN A;  1GM5 A;  3ICE A;  4DR7 L;  3AEV A;  1WTQ A;  1UEB A;  4KKS A;  1ASY A;  2DNE A;  1EWC A;  2EJG C;  4DV2 L;  4HSP A;  2AUK A;  1IYU A;  2J4X A;  1SYF A;  1D5Z C;  1Q12 A;  3VYR A;  1PYW D;  2HIX A;  4DR4 Q;  4BS9 A;  1I4X A;  4Z9C B;  3J81 i;  1K0S A;  4K6L A;  3CW2 C;  1S5D D;  1X3F A;  2H1E A;  1TS3 A;  2EPB A;  2AQ2 B;  2B2T C;  2KQ3 A;  5IYB H;  1XMQ L;  1E1O A;  4DV3 L;  1HNW Q;  3GTQ B;  3GTO B;  1BDO A;  5C0X J;  1PTO D;  2D62 A;  1IBK Q;  4P71 A;  4XXE A;  1B44 D;  4FF3 A;  1AEX A;  1ET9 A;  4L5S A;  3RNU A;  5FLX L;  4OX9 L;  1DZ1 A;  2XTI A;  3CQZ B;  4UP7 A;  3TRE A;  4A3B B;  1AW7 A;  5KRU A;  4DNR B;  2UUC Q;  3EVQ A;  4JI5 Q;  2YTV A;  3HOZ G;  4BY1 B;  1B1Z A;  4O2D A;  2IX3 A;  3J81 j;  3K5L A;  4BY7 G;  3Q6S A;  3KF8 A;  4QMG A;  1BBU A;  3GTQ H;  4KHP Q;  1DON A;  3A8K E;  1JE5 A;  1WVL A;  3VYS A;  1TS4 A;  1N34 Q;  3NUC A;  2B2Y A;  4DXG A;  2JA7 H;  1CHQ D;  5JJI A;  2VB2 X;  4HJ7 A;  1STE A;  1O80 A;  4IO9 A;  5D14 A;  4GNX A;  3RLN A;  4C3H H;  1I4P A;  1ZEQ X;  3EIV A;  3U4V A;  5M9O A;  1P8L A;  2R7Z G;  1YEZ A;  1EZ6 A;  1Z47 A;  1ZXT A;  2RCF A;  3M7N A;  1DOM A;  3JAM i;  4GS3 A;  4RGT A;  1Y1V H;  2MO0 A;  4K2L A;  4LUV A;  1CSQ A;  1I4H A;  2Q2I A;  2AKW B;  2NVX B;  3HOY H;  1TWG B;  1JJ2 A;  1CK1 A;  1NR2 A;  5IYC G;  1I6H B;  4RG1 A;  3N52 A;  1R9T H;  4IUV A;  2UUB L;  3KF6 A;  4X3S A;  3MVV A;  1K8M A;  1J6Q A;  1LO5 D;  4ZLT F;  3IRB A;  4QUC A;  1MKH A;  1SNQ A;  3UDF A;  1C7Y A;  2JA7 G;  1Q81 C;  1ONL A;  5BR8 Q;  3GV3 A;  4A3E H;  1IHZ A;  4XDX A;  3CCQ A;  5EJW A;  1N32 L;  3K80 C;  4ALP A;  4ZUI A;  3S1M B;  3UE1 A;  1BOS A;  1L2F A;  3J80 c;  1STY A;  3DEO A;  2MGS A;  1Z9F A;  2G9H D;  2F4V Q;  3I4O A;  2B2U A;  2K75 A;  2X6L A;  4A3J H;  3A54 A;  1E2W A;  3D6C A;  1FD7 D;  4JI2 Q;  3SXH A;  3BJU A;  4A93 G;  1UE1 A;  1TU2 B;  3E9H A;  1TWC B;  3HRZ C;  4A3K B;  1ASZ A;  2Q8I B;  2AQ1 B;  1XWE A;  2VUM H;  3SVM A;  4K0K Q;  2KCM A;  1S5F D;  1RF2 D;  4AYB B;  3S14 H;  4H7B A;  1VMC A;  2N55 A;  4JYA Q;  2NVT B;  4OWX B;  1KRS A;  2AQ3 B;  4BY1 G;  2IX1 A;  2R92 H;  1OXU A;  2EQS A;  5J22 A;  1Y69 U;  4KY6 A;  4HCE A;  4OEM B;  2PMZ B;  2LFN A;  2IWH A;  1KNE A;  4YHH L;  3GTL B;  3I4N H;  1KIX A;  1SYE A;  2L11 A;  4IUN A;  1STA A;  3UDI A;  1LTL A;  3M3Y B;  1E0B A;  2RQX A;  1QVC A;  3I4N G;  2EDG A;  3SK6 A;  1D1I A;  1K8O A;  2JEA I;  3HOV B;  1G51 A;  2NB0 A;  1WI5 A;  1GUO A;  4KLK A;  3MXN B;  1EU4 A;  2Q8T A;  2RKS A;  4R4I A;  5K5P A;  2K05 A;  2R61 A;  3NTI A;  2QF7 A;  2VY3 A;  2AWO A;  4G57 A;  2M9V A;  3E5S A;  4HJ5 A;  4JW0 A;  1ICF B;  1TWF B;  2B8F A;  3NPP A;  3NSW A;  1V1P A;  4LF4 Q;  5EAY A;  4ILW A;  3KOJ A;  1F2L A;  2A6E C;  5COY A;  2KHI A;  1BNZ A;  2Y0S G;  5J1Z A;  3I56 A;  3KK7 A;  2A1A A;  5M5X B;  5BN5 A;  3FKI B;  1XX8 A;  2ZXO A;  1PFS A;  3HOX G;  3I7F A;  4JV5 Q;  3JAM c;  2EY2 A;  1CUK A;  4RGO S;  1DOL A;  1G6P A;  3BDL A;  1KAA A;  4QF4 A;  3E9I A;  2QKI C;  4P72 A;  2AHO B;  5E1F A;  3S15 H;  1HNZ L;  5C3E H;  3HOW B;  2NZH A;  3OW7 A;  3ND9 A;  1HXY D;  3V05 A;  4RKB A;  2UXD L;  2L55 A;  3R8B A;  1H9J A;  3NQT A;  5C6A A;  3WOE A;  1D8L A;  4MZ9 A;  2F0I A;  3E0J A;  1IYV A;  1O7I A;  1CA6 A;  2NVX H;  1EY6 A;  3HOU B;  3W5O A;  3Q23 A;  4HMI A;  2JA9 A;  4DR1 Q;  1GD7 A;  1Y1V B;  4JOI C;  1M90 C;  4KHZ A;  1F2Z A;  2PQA B;  3I4N B;  3BDO A;  2CH4 A;  5C0X H;  1GUS A;  4F8M A;  4DR5 L;  4FO2 A;  5GRO A;  1QJO A;  4BBS H;  4DKA C;  4X6A H;  4ME3 A;  3S14 B;  4NXM L;  1I3Q H;  3PUV A;  4JI0 L;  1PTO B;  2VW9 A;  4A93 H;  1E7Z A;  2XVS A;  1PV4 A;  2N8N A;  5IE8 A;  1K3R A;  1EQQ A;  4OX9 Q;  1KL9 A;  4R4C A;  5TSS A;  4U68 A;  5CV4 A;  4C3I H;  5IOC A;  3K7A B;  2IY5 B;  2CWA A;  2IL8 A;  4GNX C;  3NTH A;  3T56 B;  4BY7 B;  1HTP A;  1MBY A;  1EQV A;  1CKN A;  4IUP A;  4UY8 C;  4C3I G;  3J81 c;  5I2Y A;  1N9W A;  4DV1 L;  4JI4 Q;  2B2Y C;  4GKJ Q;  1GUN A;  2D0O A;  3OW2 A;  2E2J H;  1HZ9 A;  3I91 A;  4X3U A;  3F2D A;  4WFN 3;  2Y0S B;  1LTA D;  1JWU D;  4CDF C;  3J7Z C;  3H09 A;  1S3O A;  1HUN A;  3QOJ A;  2ZM6 Q;  4JBW A;  2I5H A;  1A6X A;  2EE1 A;  5M3F G;  5LL6 X;  3EJI A;  4OEL B;  1RHP A;  1YJN A;  2R3Z A;  2JSO A;  1YZ6 A;  1UAP A;  1P16 A;  2WB1 B;  1WTR A;  1KNA A;  4CJ1 B;  1A3T A;  1VQL A;  3PO3 H;  3H0G B;  1YNJ D;  1HZA A;  5C44 G;  3HKZ B;  4FF4 A;  1X65 A;  3CCV A;  1TWH H;  2Z0S A;  4R1J A;  3OMC A;  4QL5 A;  4S3S A;  1T5X D;  1A62 A;  4J8Q A;  1FJG Q;  3J80 L;  4CDC C;  3PF4 A;  2UUB Q;  2UUA L;  3W2D A;  3VYT A;  1J5E L;  2NBF A;  1F77 A;  4ZKC B;  1R9T B;  1IZ6 A;  2JYO A;  3F2B A;  2AMC B;  4OL7 A;  1UE5 A;  1EIG A;  1WTV A;  1AZQ A;  3PO3 B;  4L5R C;  3HOY B;  2E74 C;  5I6W A;  1FGU A;  2NN6 I;  1DCZ A;  4IPD A;  2FJ2 A;  4RFB A;  2A6H D;  1IYJ B;  4LW1 A;  3A5Z B;  1KLU D;  4YCW A;  4EQP A;  4PMW A;  1SRU A;  2OWO A;  3TS0 A;  4HTH A;  4X64 Q;  4QIW B;  1KHI A;  2F0V A;  1WTP A;  3ITP A;  2WKC A;  1EEF D;  1YIT A;  1YIJ A;  3C3L A;  4OIK A;  1CQF A;  3DEP A;  2CCZ A;  3DXJ C;  4MIU A;  2WAQ B;  2Z8L A;  3FPP A;  4Y52 H;  1SFO H;  1K83 B;  4FNF A;  1ESR A;  5C44 B;  1LT4 D;  3IKJ A;  4JI8 L;  4A3G B;  1NBW A;  4UPA A;  4DAP A;  2BH8 A;  2WB1 G;  4IJH A;  1PYB A;  1CM9 A;  3ERQ A;  1ENC A;  3K5N A;  4C2M B;  4A3F G;  4JI1 L;  3SK4 A;  1TVX A;  2F0E A;  5I9O A;  3V96 A;  3ND8 A;  3CCM A;  1W6J A;  1EYD A;  4JYA L;  5KNC A;  5IGD A;  4LFA Q;  3J7Y W;  5JEA J;  3G71 A;  4IFD G;  1OXT A;  4GN3 B;  1HZB A;  1HQR D;  3R2T A;  2PQA A;  4CBV A;  4V0B A;  4KTA A;  5FO8 B;  1WTO A;  3ERS X;  4C3I B;  1YI2 A;  4GZY C;  5M3M H;  3R2I A;  4TVA B;  2N88 A;  4WJW A;  3RLO A;  2E2I H;  2YU9 B;  1XTD A;  4BBS G;  3IL8 A;  1ZYR D;  3T16 A;  1TR5 A;  4JBK A;  3SR1 A;  4RHS A;  2Z1C A;  3KLR A;  2JA6 H;  1JQY D;  1QZH A;  2E5L L;  3CPF A;  1SYB A;  3J80 E;  2KEN A;  2I07 B;  1I5F A;  3T51 B;  4NKL A;  2EY1 A;  4U67 3;  1V1Q A;  3NQI A;  3N6R A;  3BZD B;  4J1M A;  4QCL A;  1BBW A;  4XYO A;  3H0G G;  4LF5 L;  1V9P A;  2VQF L;  2EIF A;  1PFM A;  4C3J B;  3GTK H;  1ET6 A;  4OIJ A;  4BBR B;  3F2U A;  4GOP C;  4B08 A;  1Q1E A;  5M3F B;  2MQH A;  3HFZ B;  4LF4 L;  2VQE Q;  3TP8 A;  4O42 A;  3HKZ E;  5JPM C;  3NE5 B;  1QUQ B;  3CPW A;  4YY3 Q;  2RDF A;  4UP8 A;  2KJX A;  3D8G A;  5K36 H;  4KV6 A;  4JBM A;  2F4I A;  3CHB D;  3A5U A;  5M3M G;  2LMC B;  2NUC A;  4BXX G;  3TP7 A;  1AE3 A;  3HKZ G;  3OYY A;  3RN5 A;  4A93 B;  2K04 A;  1SYG A;  1NY4 A;  3G4S A;  1X32 A;  2VXW A;  1CSP A;  4F88 A;  4JV5 L;  4LF7 L;  3R3O A;  1X54 A;  1D7Q A;  3D31 A;  3PQI A;  4H0L C;  4JI3 Q;  1WD0 A;  4DXF A;  2RDG A;  4GLV B;  1HR0 W;  3K0X A;  1K8G A;  5DEH A;  1LTR D;  3M9B A;  1HNZ Q;  3A7L A;  5K36 G;  4DA2 A;  1AFP A;  5C3X A;  1H9S A;  2DY7 A;  5T1G A;  4DK6 C;  1PTO F;  3FPU B;  2PQE A;  2BOS A;  1EIH A;  4B3S Q;  1MSG A;  1TT2 A;  3W3A A;  4ID6 A;  1S72 A;  1MD2 D;  4N9P A;  1IBL Q;  3OWF A;  4JBJ A;  4X62 Q;  1EYC A;  2L15 A;  2WAC A;  3K7A H;  4DR5 Q;  3KLS A;  2WB1 E;  1D2B A;  1S5E D;  2Z6K C;  3HOV G;  3KDF B;  1XPR A;  4NXM Q;  3H94 A;  1T5E A;  1BBX C;  2F1M A;  2A74 C;  1W3S A;  4HED A;  1HNX L;  1A2T A;  1LT5 D;  5DM7 3;  1E2V A;  4G7H C;  3I73 A;  1ICW A;  2O5I C;  1MJE A;  1KAW A;  4EGV A;  2K5W A;  1TII D;  1PMR A;  3MFY A;  2OCE A;  4AYB G;  5ELB A;  3FP9 A;  2EXZ A;  5JJZ A;  1STB A;  1PLF A;  2BDO A;  4LMQ D;  2JA8 B;  4DV1 Q;  1B3A A;  4JI4 L;  4M1U B;  4GKJ L;  3EBE A;  4QY7 A;  2EY6 A;  1KDB A;  4IPH A;  4A3L G;  1HRJ A;  1VQD A;  1BCP B;  2QDL A;  3I70 A;  4R8I A;  2ZM6 L;  1ROD A;  5A2Q L;  2TMP A;  1BVS A;  2A5H A;  2EJF C;  3PO2 H;  4R8N A;  3CC4 A;  5GQO A;  3MXN A;  1TWA B;  2JA8 G;  1B9M A;  4C56 C;  1WCM G;  4RKL A;  4TSS A;  1I4G A;  2KEE A;  3SK5 A;  3CXC A;  1LAC A;  4MHE A;  3H3V H;  3NHH A;  3W1G A;  1CQV A;  1MGS A;  1Y1W B;  3W1B A;  1FJG L;  1HQM C;  3PIP 3;  3STB C;  4KJN A;  2IHE A;  1NTG A;  2B2W C;  2B2T A;  5IYC H;  2NYZ D;  3ZYY X;  1LLR D;  3U9O A;  2RDH A;  3T1H L;  2F3W A;  2K32 A;  4FXG C;  5ELC A;  2F0Q A;  1EQT A;  3M85 A;  1IBM L;  2FIN B;  1D5M C;  1IL8 A;  2LXK A;  2JA8 H;  1QB5 D;  2SNM A;  3AFQ A;  1GUW A;  1DOK A;  4A3I G;  1VQO A;  3H3V I;  2GN5 A;  5IGF A;  2B29 A;  5CV6 A;  4CGY B;  3B6Y A;  1QUQ A;  1NMF A;  1SJE D;  1E3P A;  5KIX A;  1VQB A;  2MHV A;  4KKT A;  4YCU A;  1XNR Q;  2XRS D;  5C0X I;  5FLX E;  2BCO A;  2VB3 X;  1BCP F;  3I72 A;  5J39 A;  1PRT C;  3MAQ A;  1FVI A;  4LF6 Q;  4IOC A;  2F0P A;  3S2H B;  4MN3 A;  5ISR A;  4GLA C;  3ONA B;  3GTK B;  2ES2 A;  3A0J A;  1SNC A;  1EYA A;  1WCM B;  2L12 A;  4DNT B;  4GKK Q;  1E22 A;  3AB9 A;  1N36 L;  5BN4 A;  2N78 A;  4JI8 Q;  2VZA A;  2C35 B;  1YVC A;  1QWY A;  5IYB G;  3T1Y L;  3BS1 A;  1IL2 A;  1GKH A;  1YHA A;  4LNQ A;  5LMN Q;  4A3G H;  5DM6 3;  1SRO A;  4GN4 B;  4HJA A;  2R7Z B;  4DGZ A;  4HR7 B;  1PH6 A;  3GQB A;  1B4O A;  4NDX A;  1UNS A;  4A3D B;  2JA6 B;  3MTS A;  1GUT A;  4BXX H;  5E3F A;  1ENF A;  5ELF A;  4LFA L;  4A3B G;  3VYU A;  1UUP A;  2MFI A;  3GTL H;  2E2I B;  1HUM A;  2OF1 A;  4DR2 L;  3G6J B;  3UDG A;  3NTK A;  2VNU D;  1SE8 A;  1U4R A;  5C4X B;  2ZJR A;  2ASB A;  3J7A 5;  4JG2 A;  5HUR A;  5JOB A;  3DHQ A;  1Y8N B;  3TME A;  1K8A C;  1BF4 A;  3BG3 A;  5GAH C;  4FDB A;  5JPN C;  1A0I A;  1Y14 B;  3QOL A;  3G48 A;  3X3N A;  4K5V A;  1KDC A;  4IUT A;  4X66 Q;  4DFA A;  1X3Q A;  3CD6 A;  1OXX K;  2K52 A;  1ZYR C;  3DWP A;  4PNY A;  4DV6 L;  4O0A A;  5CC4 A;  3D4D A;  2Q2H A;  4LF5 Q;  1EUJ A;  1SNO A;  4ZKB B;  4KY7 A;  2VQF Q;  4JI6 Q;  3S1N H;  5M3F H;  1HTL D;  2KOL A;  2NWG A;  4ZK9 B;  1CKN B;  4F7X A;  4G4K A;  5AJ3 L;  1PTO C;  4UDU C;  4NP5 A;  4C3J H;  1LTB D;  3AQQ A;  4DF7 A;  1VF5 C;  1A3U A;  1SMY C;  2LS0 1;  2Y0S E;  4NPS A;  2JE6 I;  1QVF A;  4L6T B;  1F9P A;  4DR6 L;  1EY9 A;  1A2U A;  4R4T A;  5IGE A;  3TQY A;  5ELO A;  3RR5 A;  3RD4 A;  3NBH A;  5KNB A;  3PF5 A;  4FF1 A;  5EKL A;  2KHJ A;  5C5M A;  4A3B H;  2CHB D;  3HKS A;  2F0G A;  2QCP X;  1EL0 A;  2F0M A;  4RGM A;  3NXW A;  4WRD A;  1KQS A;  2L4N A;  3HZX A;  2AWN A;  1M8A A;  3FKI G;  3KLS X;  1I94 L;  1JCK B;  5D65 A;  5FLM G;  1UEA B;  4H44 C;  2LKV A;  2YU9 H;  5M3M B;  4LF8 L;  2I46 A;  3HOZ H;  2D0P A;  5IY0 A;  2PCF B;  4DR7 Q;  2K5V A;  4RH6 A;  3VR5 A; 
#chains in the Genus database with same CATH homology
 4KJO A;  3LWE A;  3H3V C;  3CKI B;  1V43 A;  4FF2 A;  4XQJ A;  2D9U A;  1STN A;  1I6V C;  3KBG A;  3RUZ A;  1G6Z A;  5IT9 L;  3K58 A;  2D5D A;  3QB3 A;  2EY5 A;  3D6W A;  5EBC A;  1SFO B;  3RZO B;  3J81 E;  4IFD J;  2JA7 B;  2JP1 A;  4LJZ C;  1RDP D;  4KMU C;  1U4L A;  3CRK C;  2OT2 A;  3MEH A;  1TY0 A;  4RWS C;  2PZW A;  1G2S A;  4RA8 A;  3AMU A;  5IGC A;  2PZT A;  3A7A B;  4BA1 I;  1S5B D;  2F0K A;  4HCS A;  1JOQ A;  1EOT A;  5AFW A;  1SNM A;  3S2D B;  2K5Q A;  4ABN A;  1PFN A;  1O7Z A;  1TS2 A;  3TP6 A;  2ENB A;  4X3K A;  1CZW A;  4BA2 I;  3ERO A;  2L5T A;  2X69 A;  5C3W A;  4BBS B;  3HGB A;  2X6G A;  1C8C A;  5JAV A;  4HN7 A;  2ID0 A;  1I3Q B;  2PO4 A;  1MI2 A;  1IKM A;  1RTO A;  4L63 B;  2WV6 D;  2HDL A;  1TY2 A;  3BYY B;  3S15 B;  5KYL A;  1JWS D;  3PO2 B;  2HCC A;  5E4X A;  1GXD C;  4TKO B;  5C5L A;  1QNK A;  1PZJ D;  2E2J B;  2R92 B;  4P2C B;  4KKU A;  3MXU A;  4XQQ A;  5C3E B;  1FYC A;  1STG A;  2A73 B;  3CRL C;  1CHP D;  1DM0 B;  3S16 B;  2RA4 A;  3K6O A;  2A69 C;  1RKN A;  1ESF A;  3H6M A;  1DXM A;  1U4M A;  5T1I A;  4ZRZ A;  4C3H G;  3K0Y A;  3D3R A;  2KHS A;  2O4X A;  4KK7 A;  1M4V A;  1B9N A;  2A6E D;  5CV8 A;  3J81 L;  1PRT D;  4B9W A;  2B2V A;  4RGN A;  2C5C A;  5BN3 A;  1QNU A;  4IFD I;  1JC7 A;  1XXG A;  5FKA C;  3TSS A;  2F0D A;  5EPK A;  1NR4 A;  1LTG D;  2G9D A;  1GHK A;  2XSC A;  1EEI D;  3FEW X;  5ELD A;  5CV7 A;  5COR A;  1RD9 D;  5CYU A;  4IUU A;  1U9R A;  2ICI A;  3DWQ A;  3LNN A;  3NBI A;  4KN7 C;  3UI2 A;  3I4M B;  3KUP A;  1ENA A;  4C3H B;  2NTT A;  3P7J A;  3C1F A;  4A3I B;  4LK1 C;  1TKW B;  1SE3 A;  2KED A;  5CMD A;  2WP8 J;  2R6G A;  4N9T A;  3JAM L;  3GTG B;  4V19 0;  3X3M A;  4KD4 A;  2MJ8 A;  3C1E A;  3OHX C;  2F0U A;  4IZ8 A;  3OPO A;  5I4D A;  4PQX A;  1Y8P B;  4FXD A;  1QCB D;  1O78 A;  4WOR A;  1ML0 D;  3HOX B;  2IX0 A;  2K03 A;  1Q8I A;  1ILP A;  1YNN D;  1LT3 D;  1HFN A;  2TSS A;  5IGG A;  2K1B A;  3IAY A;  4ZYS A;  1XTC D;  3A8I E;  4X3T A;  3PIO 3;  2JEB I;  1E2Z A;  4OO1 I;  3VR3 A;  5EPL A;  1LV9 A;  1KLG D;  1FNV A;  3MZ5 A;  2IJ0 A;  2FMC A;  2EYL A;  3T13 A;  5HGT A;  2F0J A;  3G7L A;  4OGQ C;  3MHB A;  2EYH A;  2F03 A;  3IFD A;  4DK0 A;  3HEJ A;  5A2Q E;  1QIL A;  4CKB A;  5I9P A;  3VA7 A;  4NMZ A;  1V1P B;  1CTM A;  2IT1 A;  5JVG 3;  4ZUJ A;  2B8G A;  3S9W A;  2Z4I A;  3SHL A;  1GUG A;  3L7Z C;  3LWU A;  2F3V A;  2F0F A;  1I4Q A;  3TP5 A;  3RZD B;  5C4H A;  2KVM A;  5KEE A;  2QDB A;  2F0O A;  4KD3 A;  3DUZ A;  4RCN A;  1BXT A;  3CU7 A;  1AP0 A;  3QO2 A;  4IN3 A;  2V4D A;  2A6H C;  1ILQ A;  1O7Y A;  1HPC A;  4UAI A;  4I7Z C;  2EYO A;  1KDA A;  4FP5 D;  4XIG S;  1R4P B;  4QB4 A;  1AN8 A;  3A8J E;  4M8A A;  3TN2 A;  3A55 A;  2YYZ A;  3A56 A;  1GJX A;  1F9Q A;  4Y7N B;  2K6A A;  3P1H A;  3U9S A;  2PYK A;  3QIA A;  1S4Z A;  3T53 B;  1SBB B;  5C0X G;  3LX0 A;  5KND A;  2DN8 A;  5ELE A;  2PW5 A;  2E76 C;  2KEC A;  2L9H A;  1Q90 A;  1PTO H;  1BO0 A;  1JR0 D;  5FO9 B;  1L0X B;  2K5D A;  1AZP A;  2L1B A;  4XQN A;  3TDQ A;  1F2M A;  2R93 B;  2D2C C;  3L9A X;  3NP8 A;  3PUY A;  1PZI D;  2QEJ C;  2XIW A;  1CFM A;  1Z7T A;  2DY8 A;  1G8Z D;  1STH A;  1SSO A;  1LT6 D;  5KGU A;  1SNP A;  1F2Y A;  2SNS A;  4RHR A;  1O7L A;  3NWT A;  4Q0F A;  1WD1 A;  4C1N K;  3VA5 A;  2M2L A;  2BA1 A;  1FNU A;  1TS5 A;  2K7V A;  1Z6H A;  2NVQ B;  1B2T A;  1NUC A;  2KCC A;  3K5O A;  3OIP A;  4EQN A;  1EY0 A;  1IKL A;  4K8J A;  2NVY B;  3FMC A;  3RLF A;  4HMJ A;  5C4Z A;  2O5J C;  2E2H B;  2RSO A;  3PUZ A;  1PZK D;  1LTT D;  2HDM A;  3S17 B;  2IW3 A;  1G2T A;  3OOC A;  4ODG A;  5IT9 E;  1ZKO A;  1OXV A;  2NN6 G;  4J6H A;  4A3M B;  4FYD A;  4IUQ A;  3KBX A;  3K5M A;  2B2W A;  1SXT A;  2FFK B;  4C1N I;  1EY5 A;  2EOT A;  1SEB D;  1A3V A;  4OO1 G;  1BCP C;  1SDF A;  4PMC A;  4ZAI A;  4F87 A;  3C46 A;  2M00 A;  3GO5 A;  5JVH 3;  1S5C D;  5IOD A;  1U4P A;  1HCZ A;  3O13 A;  2BDN A;  3Q24 A;  1VF7 A;  4EQO A;  3DWA A;  2RBM A;  4DU9 A;  3MWY W;  1EY7 A;  2B2U C;  3D4W A;  3MFG A;  1HA6 A;  1SYC A;  2WKD A;  4LAA A;  1JOR A;  1J9O A;  2NTS A;  1BR9 A;  2PW7 A;  2HCI A;  4IFD H;  5DAU A;  3RMH A;  1WTW A;  4DK1 A;  2EZV A;  3GTP B;  5EKI A;  2C9O A;  3AU7 A;  1JIC A;  5G3L F;  3SE0 A;  2XWB B;  1FGB D;  3TZD A;  2IPK D;  4K2K A;  1GOZ A;  5EKK A;  1SJH D;  1L0Y B;  5EPJ A;  1QG7 A;  2FMM A;  2XN9 C;  3I3C A;  3S1Q B;  2JXM B;  1QOH A;  4K5X A;  3I90 A;  3MXP A;  4OHJ A;  1RCV D;  1EY8 A;  2EYF A;  1R4Q B;  2F0S A;  1MSH A;  2PPB C;  1KAB A;  3WDN A;  4L8J A;  5CR3 A;  4RAU C;  5E4W C;  4YIJ A;  5JEA G;  5I6Y A;  5M5Y B;  1TWH B;  2F0L A;  4FXK C;  1PRT F;  1G91 A;  3HOZ B;  4PMB A;  4KHV A;  1PFB A;  1DJR D;  1IW7 D;  1D1K A;  3E6Z X;  3GTJ B;  4EVO A;  2B2V C;  1RJT A;  4B9X A;  3QG1 A;  1TQO A;  4DAY A;  2GA4 B;  1WTX A;  3S1R B;  4HSV A;  5G3L D;  3P75 A;  5CV5 A;  4I65 A;  1VDZ A;  5CBA E;  1SYD A;  3NK9 A;  3V2T A;  2B63 B;  4K5W A;  4JK1 C;  3JAM E;  1YNJ C;  2EYJ A;  3J7A F;  3SK8 A;  1F9S A;  2B39 A;  1RTN A;  3HS0 C;  1VMP A;  5FOB B;  5NUC A;  1EZ8 A;  3C2P A;  5FO7 B;  2SDF A;  2EYP A;  2EVB A;  1EWH A;  3BVM A;  4RCO A;  2K01 A;  3M7G A;  1PXU A;  1IW7 C;  2DNC A;  1H9M A;  4ZQ3 A;  1JWM D;  1D6E C;  3OSO A;  2PZU A;  5EBD A;  1HFG A;  3PUX A;  3MC0 B;  2HUG A;  3K57 A;  5KYI A;  2XRQ D;  2WII B;  4KI0 A;  5A35 A;  5I2X A;  2A68 C;  3IFT A;  1SMY D;  1VCI A;  2F0N A;  3DM1 A;  3I4L A;  4OO1 H;  3P20 A;  2HQE A;  1C4Q A;  2F0W A;  2J0T D;  2WIN B;  2L0C A;  2OXP A;  3T4A C;  4ULL A;  1SAP A;  2JA5 B;  2ZT9 C;  1DD2 A;  1BUV T;  2ICE C;  1Y8O B;  3PUW A;  5IIF A;  2K28 A;  3VR6 A;  5FK9 C;  3NWS A;  5M5W B;  1II3 A;  4KY5 A;  1HHV A;  1DYQ A;  1C48 A;  3M4O B;  2ZXP A;  5DNF A;  4DAV A;  1B53 A;  1F9R A;  1QE6 A;  3TBI B;  4IUR A;  2EJM A;  1EU3 A;  4K8I A;  3URY A;  1LAB A;  3GTM B;  4A3F B;  1BCP D;  3PV0 A;  3QWN A;  5LHY 1;  4XT3 B;  5IGB A;  3S1N B;  3HG9 A;  3D4R A;  2SEB D;  5CV9 A;  1SND A;  2OEO A;  4KN4 C;  2Q8R E;  5D3I B;  1X3P A;  2AUJ D;  3M4Y A;  3BVG A;  2MP1 A;  2F0T A;  2J7Z A;  3FRP B;  5CBE E;  1EY4 A;  1JE4 A;  3VR2 A;  1EFI D;  3HP3 A;  4C3J G;  4CKC A;  1LTI D;  3GP7 A;  4G7O C;  4TRD A;  4E6I A;  2ZXR A;  1I4R A;  5C4J B;  1V1O A;  4FVM A;  3EQL C;  3Q22 A;  3SDZ A;  1NCV A;  4DN4 M;  1H9S B;  5EGT A;  2BA0 A;  2CVR A;  1FR3 A;  2E75 C;  2E2D C;  2O2L D;  1A15 A;  3I8Z A;  1KTK A;  5JEA H;  3K59 A;  4G7Z C;  4K6D A;  1LTS D;  1J8I A;  2NZ1 D;  3QJY A;  2A69 D;  3GV6 A;  3EFX D;  2QIL A;  4XYQ A;  3J7A V;  4Q5V A;  3Q0A A;  1D5X C;  1JOO A;  3OMG A;  2BE5 D;  1CI3 M;  2CW0 D;  4CKE A;  4A3J B;  2MPM A;  1I50 B;  3EA6 A;  1SE4 A;  4HAE A;  1HA5 A;  4CHT B;  1SE2 A;  2H4O A;  3OWE B;  2PNR C;  1W6K A;  5D3D A;  1CA5 A;  3WOF A;  1NAP A;  5LL6 S;  2KUM A;  4XTC S;  1OO9 B;  1G29 1;  1CZG A;  3VR4 A;  2CQA A;  3OIQ A;  2NN6 H;  1V8Q A;  3BVZ A;  3SEB A;  1Q3L A;  2K33 A;  4QUF A;  2BE5 C;  3FDT A;  2CW0 C;  3H91 A;  1YNN C;  4R9W A;  2F0H A;  2EYM A;  2XWJ B;  3MXG A;  3DMU A;  3R93 A;  3PMF A;  1NSN S;  4O1N A;  2RSN A;  4ME5 A;  1GHJ A;  1FNW A;  1OXS C;  2FHT A;  2VUM B;  1PDQ A;  1B50 A;  2LY7 A;  3FVQ A;  1H9R A;  1BQQ T;  4IAL A;  1CT1 D;  4NW2 A;  1JOK A;  3BYT B;  5CGK A;  3GD7 A;  4CJ2 C;  5EQ0 A;  3MA2 B;  4K14 A;  4H13 C;  3L3O C;  5F2D A;  1Q1B A;  4XT1 B;  1PRT B;  2A68 D;  1JB3 A;  2XNA C;  4A3E B;  2SOB A;  2MUY A;  3BDC A;  4IQZ A;  4TQU S;  4PV1 C;  3TZU A;  2KA7 A;  4BWG B;  2RVL A;  4CJ0 B;  1H9K A;  1XYI A;  2Z4H A;  2KCN A;  1WTQ A;  4KKS A;  2DNE A;  1EWC A;  2EJG C;  4HSP A;  2AUK A;  1IYU A;  2J4X A;  1SYF A;  1D5Z C;  1Q12 A;  3VYR A;  1PYW D;  4BS9 A;  1I4X A;  4Z9C B;  4K6L A;  1S5D D;  2H1E A;  1TS3 A;  2EPB A;  2AQ2 B;  2B2T C;  2KQ3 A;  3GTQ B;  3GTO B;  1BDO A;  5C0X J;  1PTO D;  2D62 A;  4XXE A;  1B44 D;  4FF3 A;  1AEX A;  1ET9 A;  5FLX L;  1DZ1 A;  3CQZ B;  4A3B B;  1AW7 A;  5KRU A;  4DNR B;  3EVQ A;  4BY1 B;  1B1Z A;  2IX3 A;  3K5L A;  3Q6S A;  3KF8 A;  4QMG A;  1DON A;  3A8K E;  1WVL A;  3VYS A;  1TS4 A;  3NUC A;  2B2Y A;  4DXG A;  1CHQ D;  2VB2 X;  1STE A;  1O80 A;  5D14 A;  1I4P A;  1ZEQ X;  5M9O A;  1ZXT A;  1EZ6 A;  1Z47 A;  3M7N A;  1DOM A;  4RGT A;  4K2L A;  1I4H A;  2NVX B;  1TWG B;  1CK1 A;  1NR2 A;  1I6H B;  3N52 A;  4IUV A;  4X3S A;  3MVV A;  1K8M A;  1LO5 D;  4ZLT F;  4QUC A;  1SNQ A;  1ONL A;  3GV3 A;  1IHZ A;  4XDX A;  5EJW A;  4ZUI A;  3S1M B;  1BOS A;  1STY A;  3DEO A;  2MGS A;  2G9H D;  2B2U A;  2X6L A;  3A54 A;  1E2W A;  3D6C A;  1FD7 D;  3SXH A;  1TU2 B;  3HRZ C;  1TWC B;  4A3K B;  2Q8I B;  2AQ1 B;  1XWE A;  3SVM A;  1S5F D;  1RF2 D;  4AYB B;  4H7B A;  1VMC A;  2N55 A;  2NVT B;  2AQ3 B;  2IX1 A;  1OXU A;  5J22 A;  1Y69 U;  4KY6 A;  4HCE A;  2PMZ B;  2LFN A;  2IWH A;  1KNE A;  3GTL B;  1SYE A;  2L11 A;  4IUN A;  1STA A;  3M3Y B;  1E0B A;  2RQX A;  2EDG A;  3SK6 A;  1D1I A;  1K8O A;  2JEA I;  3HOV B;  2NB0 A;  1GUO A;  1EU4 A;  5K5P A;  2RKS A;  2Q8T A;  2K05 A;  2R61 A;  3NTI A;  2QF7 A;  2AWO A;  4G57 A;  2M9V A;  3E5S A;  1TWF B;  2B8F A;  3NPP A;  3NSW A;  1V1P A;  4ILW A;  1F2L A;  2A6E C;  5COY A;  1BNZ A;  5J1Z A;  3KK7 A;  5M5X B;  5BN5 A;  3FKI B;  1XX8 A;  2ZXO A;  2EY2 A;  4RGO S;  1DOL A;  3BDL A;  1KAA A;  4QF4 A;  2QKI C;  5E1F A;  3HOW B;  3OW7 A;  3ND9 A;  1HXY D;  3V05 A;  4RKB A;  2L55 A;  3R8B A;  1H9J A;  3NQT A;  5C6A A;  3WOE A;  2F0I A;  3E0J A;  1IYV A;  1CA6 A;  1EY6 A;  3HOU B;  3Q23 A;  4HMI A;  1Y1V B;  4KHZ A;  1F2Z A;  3I4N B;  3BDO A;  5C0X H;  1GUS A;  4F8M A;  4FO2 A;  1QJO A;  3S14 B;  3PUV A;  1PTO B;  2XVS A;  5TSS A;  4U68 A;  5CV4 A;  5IOC A;  3K7A B;  2IL8 A;  3NTH A;  3T56 B;  4BY7 B;  1HTP A;  1MBY A;  1EQV A;  4IUP A;  4C3I G;  5I2Y A;  2B2Y C;  1GUN A;  3I91 A;  4X3U A;  4WFN 3;  2Y0S B;  1LTA D;  1JWU D;  3H09 A;  1HUN A;  3QOJ A;  4JBW A;  1A6X A;  2EE1 A;  5LL6 X;  3EJI A;  1RHP A;  2R3Z A;  2JSO A;  1UAP A;  2WB1 B;  1WTR A;  1KNA A;  4CJ1 B;  1A3T A;  3H0G B;  1YNJ D;  3HKZ B;  4FF4 A;  3OMC A;  4S3S A;  1T5X D;  4J8Q A;  3J80 L;  3W2D A;  3VYT A;  2NBF A;  1F77 A;  4ZKC B;  1R9T B;  2JYO A;  4OL7 A;  1EIG A;  1WTV A;  1AZQ A;  3PO3 B;  3HOY B;  2E74 C;  5I6W A;  2NN6 I;  1DCZ A;  2FJ2 A;  4RFB A;  2A6H D;  1KLU D;  4EQP A;  4PMW A;  4HTH A;  4QIW B;  2F0V A;  1WTP A;  3ITP A;  2WKC A;  1EEF D;  3C3L A;  4OIK A;  1CQF A;  3DEP A;  3DXJ C;  4MIU A;  2WAQ B;  2Z8L A;  3FPP A;  1K83 B;  4FNF A;  1ESR A;  5C44 B;  1LT4 D;  3IKJ A;  4A3G B;  4DAP A;  1CM9 A;  3ERQ A;  1ENC A;  3K5N A;  4C2M B;  3SK4 A;  1TVX A;  2F0E A;  5I9O A;  3V96 A;  3ND8 A;  1W6J A;  1EYD A;  5KNC A;  5IGD A;  3J7Y W;  5JEA J;  4IFD G;  1OXT A;  1HQR D;  3R2T A;  4CBV A;  4V0B A;  4KTA A;  5FO8 B;  1WTO A;  4C3I B;  4GZY C;  3R2I A;  4WJW A;  2N88 A;  2YU9 B;  3IL8 A;  1ZYR D;  3T16 A;  1TR5 A;  3SR1 A;  4RHS A;  2Z1C A;  3KLR A;  1JQY D;  1SYB A;  3J80 E;  2I07 B;  3T51 B;  4NKL A;  2EY1 A;  4U67 3;  3NQI A;  3N6R A;  3BZD B;  4J1M A;  4QCL A;  4XYO A;  1PFM A;  4C3J B;  1ET6 A;  4OIJ A;  4BBR B;  3F2U A;  4B08 A;  1Q1E A;  5M3F B;  3TP8 A;  4O42 A;  5JPM C;  3NE5 B;  2RDF A;  2KJX A;  3D8G A;  5K36 H;  4KV6 A;  2F4I A;  3CHB D;  2LMC B;  2NUC A;  3TP7 A;  4A93 B;  2K04 A;  1SYG A;  1X32 A;  2VXW A;  4F88 A;  3R3O A;  3D31 A;  4H0L C;  1WD0 A;  4DXF A;  2RDG A;  5DEH A;  1LTR D;  3A7L A;  5K36 G;  4DA2 A;  1AFP A;  5C3X A;  1H9S A;  2DY7 A;  5T1G A;  1PTO F;  3FPU B;  2PQE A;  2BOS A;  1EIH A;  1MSG A;  1TT2 A;  3W3A A;  4ID6 A;  1MD2 D;  4N9P A;  3OWF A;  1EYC A;  2WAC A;  3KLS A;  1D2B A;  1S5E D;  3H94 A;  1T5E A;  1BBX C;  2F1M A;  2A74 C;  4HED A;  1A2T A;  1LT5 D;  5DM7 3;  1E2V A;  4G7H C;  3I73 A;  1ICW A;  2O5I C;  4EGV A;  2K5W A;  1TII D;  1PMR A;  3MFY A;  5ELB A;  2EXZ A;  5JJZ A;  1STB A;  1PLF A;  2BDO A;  4LMQ D;  2JA8 B;  1B3A A;  4M1U B;  2EY6 A;  1KDB A;  1HRJ A;  1BCP B;  3I70 A;  4R8I A;  1ROD A;  5A2Q L;  2TMP A;  2A5H A;  2EJF C;  4R8N A;  3MXN A;  1TWA B;  1B9M A;  4C56 C;  4RKL A;  4TSS A;  1I4G A;  2KEE A;  3SK5 A;  1LAC A;  4MHE A;  3NHH A;  1CQV A;  1MGS A;  1Y1W B;  1HQM C;  3PIP 3;  4KJN A;  2B2T A;  2B2W C;  2NYZ D;  3ZYY X;  1LLR D;  3U9O A;  2RDH A;  2F3W A;  2K32 A;  4FXG C;  5ELC A;  2F0Q A;  1EQT A;  3M85 A;  2FIN B;  1D5M C;  1IL8 A;  1QB5 D;  2SNM A;  1GUW A;  1DOK A;  5IGF A;  5CV6 A;  4CGY B;  1SJE D;  5KIX A;  2MHV A;  4KKT A;  2XRS D;  5C0X I;  5FLX E;  2BCO A;  3MAQ A;  2VB3 X;  1BCP F;  3I72 A;  1PRT C;  5J39 A;  3S2H B;  2F0P A;  4MN3 A;  5ISR A;  3GTK B;  3ONA B;  1SNC A;  1EYA A;  1WCM B;  2L12 A;  4DNT B;  3AB9 A;  5BN4 A;  1QWY A;  3BS1 A;  5DM6 3;  2R7Z B;  4DGZ A;  4HR7 B;  3GQB A;  1B4O A;  4NDX A;  1UNS A;  4A3D B;  2JA6 B;  3MTS A;  1GUT A;  5E3F A;  1ENF A;  5ELF A;  3VYU A;  1UUP A;  2E2I B;  1HUM A;  2OF1 A;  3G6J B;  3NTK A;  2VNU D;  1U4R A;  5C4X B;  5HUR A;  5JOB A;  3DHQ A;  1Y8N B;  3TME A;  1BF4 A;  3BG3 A;  5JPN C;  3QOL A;  3X3N A;  4K5V A;  1KDC A;  4IUT A;  4DFA A;  1X3Q A;  1OXX K;  1ZYR C;  3DWP A;  4PNY A;  5CC4 A;  3D4D A;  1SNO A;  4ZKB B;  4KY7 A;  1HTL D;  2KOL A;  2NWG A;  4ZK9 B;  4F7X A;  4G4K A;  1PTO C;  4UDU C;  4NP5 A;  1LTB D;  4DF7 A;  1VF5 C;  1A3U A;  1SMY C;  2LS0 1;  2JE6 I;  4L6T B;  1F9P A;  1EY9 A;  1A2U A;  5IGE A;  5KNB A;  3RD4 A;  3NBH A;  4FF1 A;  5EKL A;  5C5M A;  2CHB D;  2F0G A;  2QCP X;  1EL0 A;  4RGM A;  2F0M A;  3NXW A;  4WRD A;  2L4N A;  3HZX A;  2AWN A;  1M8A A;  3KLS X;  1JCK B;  5D65 A;  1UEA B;  4H44 C;  2LKV A;  5M3M B;  2I46 A;  2PCF B;  4RH6 A;  3VR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...