1R4PB

Shiga toxin type 2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords shiga-like toxin type II A subunit
publication title Structure of Shiga Toxin Type 2 (Stx2) from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
total genus 22
structure length 70
sequence length 70
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2003-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1r4pB00
1CZGA 4P2CB 1QOHA 1C4QA 1CZWA 2BOSA 1QNUA 1CQFA 1D1KA 1DM0B 4ULLA 2C5CA 2GA4B 1C48A 1D1IA 1R4QB 2XSCA 1R4PB 1BOSA 4M1UB 3MXGA
chains in the Genus database with same CATH superfamily
4A3MG 1KL9A 2CH4A 5I9OA 5M9OA 4KK7A 4XYOA 2JA8G 4R4QA 3GV3A 4BY7B 1B44D 3CCQA 2YTYA 1I5FA 1EQVA 3NELA 2JA7B 1RL2A 1I4HA 5EJWA 3Q22A 5CR3A 3J81c 4P73A 1PTOH 3NTHA 1EU4A 2PMZB 4C3JH 4LFAQ 4MN3A 1IZ6A 3RN5A 1BKBA 1CZWA 2E2DC 3QG1A 4X3KA 3I4LA 1T9HA 3KYHC 2PZUA 2FMMA 4OWXB 4LFCL 4LW1A 4XXEA 3S1NB 1JJGA 5J22A 5GAHC 4RFBA 2K01A 1W3SA 3GTLB 1HR0W 4A76A 3CC7A 1CA5A 2AHOB 1IBML 4BA2I 4CDCC 1JWMD 2RBMA 3PO3G 1CKNB 2WAQG 3C1EA 4DR7L 3BZDB 4R4TA 3UDXA 2JJQA 1Q8IA 2SOBA 4Q0FA 1QVGA 4DK6C 1CUKA 3KF8A 3A5UA 1U9RA 2Z6KC 2LXJA 2EYLA 3IAYA 1UEAB 4XYQA 1HZBA 2VQEQ 4IN3A 3STBC 2DY7A 4A3CG 3EFXD 2F3IA 2IJ0A 5C4JH 4YHHQ 3I91A 1B9NA 2KHSA 3I72A 3S9WA 3M4OH 2A6ED 1EWHA 5JAVA 5JJIA 4YY3L 5EKIA 1T5EA 1N32Q 4MIUA 2A6HD 4PMBA 1N8RC 1S5BD 4QJFA 1IBLL 2WB1G 2RHSB 4JYAL 3D4WA 1SFOH 5M3MG 2BDOA 3K5MA 2A8VA 4IUPA 1SAPA 1ICFB 1IKMA 3S2HH 4JI6Q 1RF2D 1CTMA 1TR5A 3HEJA 2XIWA 4Y7NB 2RKSA 2NVQB 3K5LA 2PPBC 5IYDH 2K05A 3K7UC 4A3DH 1PH7A 2HHHL 2UUBQ 3HKZB 2PQAB 3V05A 4DUZL 2TSSA 5KNCA 1U0LA 3PF5A 2A6EC 4MZ9A 2F4IA 2Z0SA 4O0AA 4NDXA 5LL6X 2IY5B 1E0BA 1ET9A 2A6HC 5AJ3Q 3HFZB 4GN4B 1IL2A 3PO2B 1KRTA 2KHIA 4DV6Q 2XNAC 4IFDI 5ELCA 2WINB 2K5HA 3X3NA 4LMQD 1SE4A 2B2YA 4OHJA 1HFGA 4ZK9B 4HAEA 1UE6A 1G2TA 2KECA 1EFWA 1IKLA 1A2UA 1PXUA 1VQKA 2AWOA 2O5JC 1E2WA 3DEOA 1STBA 1SMYD 4OL7A 1H9JA 3T51B 2PNHA 1FNUA 3EVQA 4FDBA 3QOJA 4DU9A 2LKVA 3K5OA 1PH4A 2EYJA 3HKSA 1HQRD 1VQIA 3A54A 5CORA 4QUCA 5ELFA 3FVQA 4DV7Q 2F0DA 2K5NA 4X65L 3T1HL 2F4VL 1NTGA 5KEEA 4Y52H 1Q7YC 2EXDA 3I4NG 2F0QA 1DOLA 2DNEA 4K0KL 4JC0A 4RGNA 2VZAA 2F0NA 2ZXOA 5C0XG 3HOUH 1W6JA 1SNOA 4U673 3TN2A 2X6GA 2R93G 4N9PA 1TWCH 3KF6A 5L37A 1EEFD 4HIKA 2R92G 5C44G 2ZTEA 2KVMA 3NBHB 4K6DA 1SMYC 5CV8A 3FPUB 3I55A 4B3TL 1UE5A 4KN7C 4QF4A 5DAUA 4XQQA 1OXUA 3JAME 1JOOA 4KKUA 2A19A 3E3XA 2IHFA 1VQGA 4IUTA 4IPGA 5GQOA 5GAGC 3P75A 4I7AA 4A3IG 4LF4Q 2UXDL 4LF7Q 1VQMA 1DOMA 5C0XJ 1BBXC 3OTOL 1STNA 5IE8A 1EYCA 4KMUC 4JI4L 1DD2A 1K28A 1DXMA 1JE5A 3GTMH 1CT1D 4X62Q 3RZDB 2NVTH 4C3IB 1QUQA 4DAYB 3AQQA 1K8MA 4CDFC 2F0LA 3BJUA 1V1PB 2JA7H 4ZRZA 2EZVA 3J80E 1AZPA 2OTLA 2DJGC 3DM3A 4DAVA 2PO4A 1UAPA 1ESFA 2CW0D 3BZCA 3E0EA 3Q0AA 1G8ZD 1MGSA 1QCBD 1IW7D 1R9TB 5CV5A 1YZ6A 2L15A 3ERSX 5F2DA 5KYLA 1C7YA 4WJ4A 2R61A 4K2LA 2K03A 3M9BA 3S1RB 3NE5B 1KHIA 3MAQA 3I4NB 1O78A 5FK9C 2UU9L 1SE2A 4ID6A 5KNDA 4ZCKA 1S72A 2JEAI 1I6HH 1JQYD 4MNOA 4FF2A 1X32A 5IWAL 5EBDA 3RLNA 1ILQA 1C4QA 4DR1Q 1VQNA 1D5MC 4H44C 4DR5Q 4JYAQ 4JV5Q 1MSGA 1QVFA 3GTKB 2CW0C 3H3VI 1TWGB 5K36H 2AKWB 4BY1B 3IFTA 3EIVA 5IP9H 2PQEA 3KBGA 4JBJA 1XNQL 1F2LA 2K50A 3A7AB 5C4HA 1VQLA 3R8BA 2F0EA 4C3JG 4OX9L 2EYHA 2PI2A 4NXNL 3G71A 2KENA 3QR8A 4DV3L 1S40A 1PH6A 3DEPA 4NMZA 1SBBB 3TZDA 1I50H 1WTWA 3SE0A 4A3MH 1WTOA 1CKOA 4H02A 2GA4B 1V1QA 1F2MA 2JA8H 4C2MB 1IL8A 1PZKD 1ILPA 1ASZA 4NXMQ 3MXNA 1CHPD 4LJZC 3PSIA 1SNCA 4P75A 2EDGA 3DWAA 4KV6A 3CCEA 3S17B 1LTSD 3BVZA 4AIMA 1ENAA 1LT6D 4Y7NH 2NVQH 1UNSA 5LMNL 1JC7A 1HQMC 3DMUA 1YJWA 4A93B 1GKHA 5C3WA 2PZWA 1MIUA 2K5DA 2B2WC 1Z6HA 4JI3Q 1E2VA 1XNRQ 1F2YA 1N36Q 1N33L 1ET6A 3I4OA 4DR3L 1BBUA 3SXHA 4IZ8A 2JN4A 1JOKA 4X65Q 2F0PA 1C9OA 2L9HA 4I7ZC 4PZ8A 1S4ZA 2VW9A 1N34Q 4LF9L 1IHZA 2MO1A 4BBSB 3U9OA 3PO3H 3LWEA 4NKLA 4L5QA 5IYBH 1GUGA 1HZ9A 1H9MA 3TP8A 2UUAL 3G6EA 2NVXB 4GKJQ 4O42A 1FGBD 2HDMA 4HCSA 2GVAA 3H0GB 4DA2A 5EKKA 2LMCB 2K5QA 1E22A 5FO7B 1LACA 3CCSA 3TREA 3T1YL 1TKWB 3PIOA 3U9SA 1Y8OB 1PA6A 3WOFA 4XIGS 1EQRA 2X69A 5IYDG 2G9HD 1FVIA 3TMEA 4KY5A 4A3BB 5M3FB 1Y1WG 1DOKA 4K14A 4A3CH 2CQAA 4HN7A 2M2LA 1SE8A 2HQEA 5I9PA 2OTJA 3MA2B 2B2UA 2IX0A 2N55A 4HIMA 4LF6L 4GNXA 4JI4Q 5BR8Q 2F03A 1NSNS 5ISRA 3IKJA 5D3DA 3FP9A 1UE7A 3CRKC 3T4AC 2O2LD 5I2YA 5JJZA 2E2HB 4DKAC 2L55A 3HOVB 3R2TA 4CDDC 1TVXA 2JA6B 2B39A 1I6VC 4XTCS 3R93A 5M3MH 2LFNA 5FO9B 1PZJD 4PZ6A 1PDQA 1K3RA 3HOWB 4L63B 4XQNA 3U4VA 3VDYA 3VA5A 1ENFA 2ASBA 5IP7H 4L6TB 4FXDA 1YNXA 4CJ0B 1ASYA 1YHBA 3OMCA 4DGZA 3GTPH 3EA6A 4QQBX 2KCCA 1NMFA 1QZHA 1ONLA 4RMFA 1CZGA 1RJTA 1FD7D 1I4GA 1UWVA 2MUYA 1ESRA 2V4DA 4PMCA 4N8FA 1EY6A 3LX0A 4CBVA 1LTGD 2JA9A 2ATWA 1D8LA 3S1QB 2Q2IA 1VQOA 1NAPA 4XT1B 1HR0Q 2DN8A 3HOYB 1PTOF 1TWAB 3MEHA 5IWAQ 1JORA 1B50A 5M5XH 1RHPA 1PRTF 3M4PA 3BZKA 3NHHA 2QF7A 2WACA 3FHWA 2CQOA 1M8AA 1X9NA 1O7ZA 2VQEL 5EPKA 2EVBA 3TBIB 3E5SA 1VF7A 1Y1WB 2OEOA 2AQ2B 1G6ZA 4YHHL 1R9TH 2N3SA 2EQSA 2O4XA 2PZTA 2NZOA 4EVOA 4GLAC 3J7A5 3M3YB 3KDFA 1R4QB 2PW5A 3D6WA 4DV3Q 2IX1A 4BA1I 3S1RH 3S15H 4AQYQ 3UDFA 4YWMA 1EFID 3I4NH 2KCNA 4C1NI 1N32L 5TSSA 3CCUA 3A55A 1OTCA 3URYA 2AWNA 3W2DA 2DGYA 4BY7G 5C0XH 2WKCA 4UY8C 1HNZL 1VQEA 2R93H 2RSNA 2R92H 1CM9A 2EYPA 1EY4A 2VXWA 3PQIA 3NPPA 4PQXA 4BY1H 1Y14B 4B3SQ 4R4IA 5FLXL 3DXJC 2UUBL 3CHBD 3LGJA 4CJ1B 4K8IA 2UXCQ 1F9RA 4LUVA 4A75A 1QWYA 3G7LA 4A3IH 1NR4A 3CRLC 2XN9C 2JXMB 2L0CA 4UPAA 3BG3A 1KQSA 3K81C 4FP5D 3NUCA 3OWFA 3GD7A 4QMGA 5C4ZA 1GUTA 5AJ3L 2KBNA 4OGQC 1VQFA 2ES2A 4DV6L 3RMHA 4RHRA 4P74A 4C2MH 1KXLA 1CQVA 2NN6G 3QJYA 4JI2Q 4B9WA 2AQ3B 3KLSX 4B3RQ 3SK5A 5HGTA 4TSSA 5BN4A 1H95A 2KQ3A 1WTHA 2E74C 2R3ZA 4ME5A 2B2VC 4G57A 1YITA 3ZJYC 1NE3A 2A68D 2JE6I 3M4YA 3S17H 1YNNC 4R4OA 4JI0Q 2MPMA 2C5CA 4G7HC 3PV0A 1H9SB 4DV5Q 4DV7L 3MXUA 2IW3A 2RA4A 5GROA 1WD1A 4GKKQ 1SNPA 4IUVA 4BBRB 3DWPA 2L1BA 3WOEA 3K0XA 2YV5A 3S16B 1KABA 2DJFC 1YNJD 3HOZB 4BBSH 2AUJD 3KFUA 1VQAA 1GUSA 3AB9A 2A68C 4RCNA 2NVXH 1LV9A 1TWFB 4V190 5JVH3 1GM5A 3ULJA 1PFSA 3PF4A 1AN8A 4ZAIA 2MP1A 3GDEA 3SK8A 4ZLTF 3MFYA 2I0QA 3DHQA 1A3VA 1Z47A 4DK0A 5IODA 5KNBA 4LF4L 4LF7L 3HKZG 4A3BH 1A15A 5IGCA 5M3FH 3TRZA 1ZXTA 5KGUA 1YNJC 2L5TA 4PZ7A 4X62L 1P16A 2CVRA 2Q2HA 3O13A 1EWCA 1KNEA 1DJRD 2ALYB 2WKDA 4EQNA 1U4LA 3PO2G 4JI8L 1J8IA 1SJED 2E2HH 1II3A 3NBIA 5EAYA 5IYBG 3HOVH 1UE1A 3GTQB 1A62A 2B3GA 2JA6H 3Q23A 1HNXQ 1BXTA 2L12A 3R3OA 4EX5A 4ZKBB 4DUYQ 3HOWH 3CCVA 1HTPA 1TS5A 2MHVA 1SYBA 3CC4A 2VUMB 1QB5D 3BYTB 4K5VA 5HURA 2YTXA 1RD9D 2QDBA 1R4PB 4M8AA 2EJGC 4L5RC 1G2SA 1X56A 2F1MA 2XGTA 4YWKA 1XXGA 3DM1A 1K8OA 4JG2A 2F0HA 4DV4L 2MJ8A 5I6WA 1WCMG 1QVCA 3I8ZA 1OXXK 4DR1L 2K52A 2Q2UA 4DR5L 4JV5L 1HCZA 2RDGA 4N9TA 5LMUQ 1HNZQ 1LTID 4POGA 1K83B 1Y1VB 1D5ZC 2EXZA 5C4XB 1C8CA 3T16A 4K2KA 4YCUA 1Z7TA 4IJLA 2FFKB 5IP7G 3HG9A 1LTAD 2ZXRA 1EY0A 4XDXA 1S5CD 4ME3A 1Y1WH 1HJPA 5H1SE 4B08A 3MXPA 5FOBB 3N52A 1A8VA 4PG3A 1XYIA 1LT5D 1D5XC 3A74A 2BH8A 4IUQA 4J15A 2FHTA 4C1NK 2HDLA 4HMJA 4RAUC 5LMNW 3PUVA 3W1BA 2PNRC 4C3IG 1EYAA 1WFQA 1BCPF 1Q90A 1CKNA 3KLWA 3G4SA 3GTOB 2B8FA 3I70A 1DZ1A 4DR4Q 4NXML 1AZQA 2M00A 2BOSA 3N6RA 1VQ7A 4OO1H 1A6XA 5FLMG 4A3GB 2F0JA 4GN3B 1AE2A 2ICIA 3T53B 1NR2A 4TRDA 2K4KA 4HJ9A 3L3OC 1CA6A 1S5FD 1LTRD 3H91A 1Y8NB 5IGBA 4JI3L 3J7AF 1XNRL 1N36L 3AFQA 4J8QA 1EIGA 3K0YA 4A3EB 3DWQA 4F88A 2YU9H 2J0TD 2QDLA 2RDFA 3A0JA 4JBKA 1N34L 1FNWA 3TEHB 1JWSD 1D2BA 4FF4A 3TP5A 2BA0A 5IGDA 3K80C 1WCMB 1AW7A 4YWLA 3SDZA 4KHVA 4GKJL 1QJOA 4P71A 1G291 3W1GA 3IRBA 1B3QA 3PMFA 2OCEA 3CMEA 3CCJA 4C3HB 2KCMA 5I2XA 3B6YA 3RD4A 1VQ9A 2UUCQ 4KKSA 3TZUA 2N88A 4A3KG 3AEVA 2HUGA 3FKIB 3AFPA 4BY1G 3VYRA 5GADC 1MJEA 3ITPA 4X66Q 1EQQA 4DK1A 1Q1EA 1M1KC 1L1OB 2PQAA 3I73A 2H4OA 3FEWX 3LWUA 1AEXA 4GLXA 1X54A 4A3FB 3ULLA 2L4NA 5D3IB 1F77A 4BBRH 5BR8L 4GOPB 1PYBA 5J39A 4ZUIA 3S16H 2FXQA 1QOHA 2D9UA 1VQ5A 4LNQA 1XMOQ 2NUCA 1L0XB 4EGVA 3HOZH 3JAMc 1NBWA 2BE5D 5FLXE 4BY7H 4CGYB 4JI8Q 3D31A 3ERQA 3OOCA 4IALA 1GHKA 2IX3A 2CWPA 2LSSA 4JI7Q 2EY5A 4MTNA 3SVMA 1E3PA 5DLQE 1PMRA 2ZJPA 1HFNA 1HUNA 3QIAA 2LXKA 1PLFA 4A93G 2E2IB 3G6JB 3FMCA 4HIDA 1EIFA 2LY7A 3F8TA 3HOXG 2KHJA 3NTKA 4UP8A 1EYGA 2VQFQ 1JB7A 4H7BA 2B2WA 2WB1E 3S1NH 1YJNA 1EEID 4U68A 3J80c 4K6LA 3Q8DA 3GTLH 3GTGB 5IT9L 2RSOA 4JPBW 3J81i 2QA4A 3VR5A 4DV4Q 2EY2A 4JK1C 4BBSG 1HR0L 2NN6H 5IGGA 3S14B 4R9WA 3PIO3 2AMCB 5ELBA 4WORA 2EIFA 1KLGD 1EIYB 3H0GG 3NBHA 4ZKCB 4A3KB 4J1MA 1SR3A 1I94Q 1EY5A 5ELOA 3GTJB 1IW7C 4OEMB 4A3LG 4NB3A 4LF8Q 3GQBA 2F0KA 1SE3A 4RCOA 3H94A 4HSPA 2CWAA 3DUZA 4RGOS 5FKAC 4A3BG 2RCFA 5M3FG 4AYBB 1KAWA 4EQOA 5FJ8G 3PCOB 2MNAA 4AQYL 3BDLA 3OW7A 4EQPA 3J81L 2N49A 5JPNC 1WTXA 2N78A 1PFMA 4H13C 2BH2A 4DAYA 1TIID 4LWCA 2UXBQ 2NWGA 2A73B 5IOCA 1KC8C 1PV4A 3NWSA 3HOVG 1MSHA 3K7AB 2JA6G 4WJWA 2HQLA 3LNNA 5DNFA 1EY7A 4FNFA 1V1PA 4KI0A 4IO9A 1EL0A 3RR5A 1D7QA 1JICA 4OXPA 5T1GA 2K5VA 3SR1A 4RWSC 3KJOA 3CQZB 4B3SL 3HOWG 5C4XH 2NBFA 2EJMA 2EYOA 4X3UA 3CMAA 4IUUA 5IGEA 2OWOA 2UXCL 5JEAG 3PIPA 1FGUA 1GHJA 1AH9A 5M5WB 1TWHB 3HOXB 4RH6A 3CXCA 1NMGA 5C3EB 4AYBE 3BDOA 4R8NA 1WVLA 2OQKA 2K28A 5BN5A 1IYVA 4MTKA 3F2CA 3PO2H 2D5DA 2NVYB 4DNIA 2Z9HA 4JI2L 5JEAJ 1S5ED 4B3RL 1STHA 2L11A 2XVSA 2F0VA 3HOYG 2JA5B 4DAMA 1RIPA 4A3GH 2HCCA 3MC0B 1STYA 5E4XA 3NTIA 3CF5A 4JI0L 4QY7A 1NJIC 4X3SA 1AP0A 1BOSA 2ID0A 5KYIA 3PUZA 1QZGA 4JI1Q 4DV5L 3J7AV 1J9OA 1U5KA 5C0XI 4GKKL 1KDBA 4GOPC 1JCKB 2JYOA 1GVPA 2JEBI 5BN3A 2I07B 2F3WA 2WIIB 2JQOA 1Q3LA 1DYQA 1ICWA 1M4VA 1PTOB 4RKLA 2EJFC 2R7FA 2VB2X 1WCMH 4DR2Q 2K14A 1PRTB 2D0PA 3T13A 1TS4A 4OO1G 1IXRA 1WTPA 2ZXPA 1SNMA 2EYMA 5K5PA 1UUPA 1AE3A 1WYDA 3I4MB 3CP0A 1NNXA 3R2IA 2CHBD 1GO3E 1FYCA 4S3SA 1I3QB 4H0LC 3KLSA 1KLUD 2A5HA 4PNYA 2F0MA 3M4QA 3K59A 4LF5Q 5I6YA 2FJ2A 1O7LA 2XWBB 4A3FH 5CMDA 4HJ8A 5DM63 2BCOA 3E0JA 1E1TA 4FXKC 4K8JA 3NEMA 1I4RA 4PMWA 4B3MQ 1STEA 2R7DA 3RZDH 4C3IH 4KD3A 2F0FA 4DF7A 1WTVA 4ZUJA 2K7VA 1J5EQ 3OWEB 3NWTA 5JJKA 3PGZA 2D62A 1HNXL 2F0GA 1RCVD 5FLMH 2RHQB 5C4JB 4IOCA 4TKOB 4DUYL 1U4PA 3L9AX 3RN2A 2OQ0A 1E1OA 1IYJB 1X3GA 1V9PA 4CKBA 2R7ZG 1E24A 2B2VA 3M4OB 1WJJA 1K3BC 1A3TA 2KCTA 4BS9A 1BNZA 3MTSA 2BDNA 2FMCA 5IYCH 2OF1A 3JAMi 3QOLA 2E2IH 3VR4A 1MJCA 1AFPA 1JR0D 1EWIA 1HPCA 1FL0A 1JT8A 1MD2D 1C48A 5G3LD 3P7JA 4BBRG 5IY0A 1CKMA 1EY9A 4KLKA 4WFN3 4HSVA 2DNCA 4AH6A 3GTGH 2F0IA 3FDTA 1A0IA 1JJ2A 2Q8TA 1ML0D 3HOZG 1I4PA 2F0UA 4WJ3M 2NZHA 1KDCA 1PVOA 4B9XA 5LMUL 2MGSA 2I46A 1K8AC 5C5MA 5LHY1 2HCIA 2EY1A 4A3KH 3EBEA 2E5LL 3GTKH 4X6AH 1TWGH 1X3PA 1B3AA 4QGUA 2XTIA 3J80i 1TY2A 1G6PA 3CCRA 4JVZA 1QG7A 1BDOA 1TXYA 1B2TA 1ZYRD 4FF1A 2NYZD 3VR2A 2BA1A 4HJAA 1VQCA 1KRSA 1B53A 2NB0A 1MI2A 1WOCA 3GV6A 1F9SA 3HRZC 1V1OA 3F1ZA 3CCMA 1XJVA 4OWTB 4DXFA 1MKHA 1CK1A 4DR4L 2B2TC 4IFDG 1PFBA 2K04A 1GXDC 1TU2B 1B1ZA 1SDFA 1PTOD 4KHZA 3NK9A 4BXXG 4KHPQ 3GP7A 2P5ZX 3K7AH 1VCIA 4K5XA 4HMIA 1PRTD 1RTOA 4FYDA 4DR6Q 4LAAA 2NTSA 1PH1A 3K57A 2CCZA 1XMQQ 3NQTA 2R7ZB 1SYDA 2QKIC 1ZYRC 1UEBA 3S2DB 4TQUS 4G7ZC 2LS01 2MO0A 4JBMA 1F9PA 1O80A 1OXVA 2VUMG 1IYUA 5IT9E 4A93H 4IFDJ 1LT3D 2DUDA 2Y0SB 3HOUB 5M5WH 1TWHH 3HOXH 3FRPB 4RG1A 4DFAA 1B70B 2E76C 2RVLA 2Z4HA 1HXYD 3S24A 5E3FA 4DV2Q 3SK6A 3EQLC 3GO5A 1EU3A 3EJIA 4LFBQ 1STGA 4DNTB 2HD3A 3C3LA 3KF8B 4KKTA 1VS0A 5D65A 1PRTC 2NVYH 4CDEC 2ZM6L 4A3JG 3OHXC 4APVA 4E6IA 2TMPA 1LM0A 2QILA 3Q24A 2UUCL 3W3AA 3H0GH 4O1NA 4JI5Q 1RKNA 1Y1VG 5HY6A 1TY0A 3K5NA 4X66L 3GTMB 5C4XG 1BF4A 2NVTB 4A3LH 5EPJA 1U4MA 4GLVB 2RCNA 1XTCD 4UP7A 2XRQD 3MFGA 4ALPA 2X6LA 1X55A 1RODA 2M9VA 1TQOA 5CC4A 3U58A 3ND9A 1EUJA 5E4WC 4TVAB 5FJ8H 1Q8KA 2Y0SE 3ICEA 4OO1I 1YEZA 3OSOA 1Y8PB 5A2QL 3L0OA 4NP5A 5M5YB 3OMGA 3UDIA 2B63B 1XMOL 3U4ZA 1B9MA 1BBWA 3AMUA 1PH5A 3F2UA 3KJPA 3UDGA 5KIXA 5EGTA 1VQJA 2C9OA 3QB3A 3AYHB 4JI7L 2EYFA 4A3GG 1IBKQ 2F0SA 5CBAE 2R6GA 3I4MH 1SYGA 3STBD 1CHQD 3J7YW 2CH4W 3M7NA 4QCLA 3RNUA 5JEAH 5ELEA 1GOZA 4MHEA 1I3QH 1SROA 3BDCA 3CW2C 1C0AA 1I6HB 1KD1C 1H9SA 2B8GA 2E8GA 1W6KA 1GUOA 4DV0Q 2VQFL 3D4DA 3RZOB 1X65A 2EPBA 1S3OA 2ICEC 2KEEA 1BCPB 4A3EG 5FO8B 5CBEE 3KUPA 4HR7B 1K8GA 3TP7A 4JCVE 3M7GA 4IJHA 4A3JB 1KNAA 2D2CC 1VQPA 3Q6SA 4IPHA 3S1QH 1H9RA 1I4QA 2VB3X 2Q2TA 2PMZE 3HOYH 4JOIC 1M90C 1MHWC 4KD4A 2A74C 1TWAH 2ENBA 4C3HG 3CC2A 3A7LA 1I94L 4DAPA 3S1MB 4P2CB 1PFNA 2E5LQ 4LF8L 1HZCA 1I50B 3FKIG 1FJGQ 3ZYYX 4A3MB 3D4RA 5KRUA 1W2BA 5HGQA 4X64Q 3OIQA 4YIJA 3I3CA 2JA8B 1Q86C 1YI2A 1EOTA 1LYLA 1VDZA 3MVVA 4YCVA 4A3FG 2E2JB 2AQ1B 3M3YH 3SHLA 3KF6B 1JB3A 5CV4A 3I7FA 3E6ZX 3TDQA 2SEBD 2UXBL 3H09A 3X3MA 2A1AA 1SNQA 1H9KA 3VA7A 1CI3M 2SDFA 4XT3B 3D6CA 1HNWQ 2ZJQA 3RUZA 1HA5A 2WFWA 4IPCA 2KEDA 1VQHA 1SJHD 1EYDA 5E1FA 1F2ZA 2MQHA 2QGQA 4NW2A 2Z1CA 4F7XA 1LT4D 3P20A 3H15A 4POFA 4DV1Q 1VQ6A 2CFMA 4GS3A 1QUQB 3MXGA 4RGMA 1X3EA 5IYCG 3CD6A 3PO3B 4IOAA 2I5HA 2WAQB 1BO0A 4QB4A 2NN6I 3VR6A 3C2PA 4RA8A 3K58A 3KBXA 4HIOA 1CFMA 2AUKA 2HIXA 1ZEQX 2JK8A 2Z6BA 4QIWB 3NSWA 4ODGA 3OPOA 5AFWA 3H6MA 4PV1C 5EBCA 2Q8RE 3A8JE 3HZXA 2ZM6Q 1JOQA 3E9HA 1SSOA 2I5LX 3HKZE 3WDNA 3UE0A 1Y69U 1NUCA 1EQTA 3F2DA 2GVBA 1HHVA 1KDAA 3UE1A 2R7ZH 1JJCB 4L8JA 4P72A 3S2DH 1D1KA 5JJLA 1EZ8A 2QW7A 2K1BA 1PYWD 4JI1L 3UI2A 3OYYA 5EQ0A 1E2ZA 5IIFA 1U4RA 4UAIA 4DN4M 3HS0C 1J6QA 1JWUD 2WB1B 3W5OA 1TS2A 4AYBG 2WAQE 5M3MB 3FPPA 4G4KA 1GUNA 5E7NA 3BU2A 1BCPD 1OO9B 2N8NA 4QIWE 4IUNA 4X3TA 4DR2L 4Q5VA 1L0WA 3RLFA 2JSOA 2KA7A 2K32A 2GN5A 3GTPB 4R1JA 3C1FA 1TWFH 3A56A 3PIP3 2KOLA 4LFCQ 1EIHA 3SEBA 3V2TA 1Z9FA 4N8X1 2J4XA 5I4DA 1XPOA 4LF5L 3E9IA 4A4IA 4J6HA 4QUFA 1IBMQ 1FR3A 4F8MA 1G51A 1SNDA 2B2YC 5FLXc 1BCPC 1BQQT 4CJ2C 2G5DA 4C56C 1CSPA 4OELB 4DR7Q 5M5XB 3MXNB 5C3EG 4B3ML 2F52A 5M5YH 2XWJB 2BE5C 2B63H 1SYCA 1KAAA 2K33A 4QL5A 3CU7A 1YHAA 1KTKA 3J81j 3MHBA 4FVMA 4UDUC 5CV9A 1J5EL 4IFDH 4UP9A 4HTHA 1PH9A 2IL8A 5C3XA 4BXXH 1T5XD 3MZ5A 4LUZA 3GTQH 4FF3A 4DK3C 5JPMC 3L2PA 2JA5G 4RHSA 5EPLA 1GD7A 1P8LA 2D0OA 4V0BA 4ULLA 3C46A 4OWWB 3S15B 2PI2E 1HA6A 1PHJA 2CKZB 1L1OA 1MBYA 2YTVA 2VUMH 4F87A 2ZT9C 3NXWA 4YY3Q 2Q8IB 3RZOH 1WTQA 2R93B 3KOJA 1IBLQ 4GOPA 4WRDA 2NTTA 3BS1A 2R92B 4XQJA 5C44B 3M85A 3L7ZC 1EZ6A 3I2ZA 3PUYA 2K5WA 1E7ZA 1LUZA 3V96A 1K9MC 2F0TA 1SMXA 4A3JH 4RKBA 1V43A 1PYSB 3HGBA 1JMCA 5JOBA 1ZKOA 1Q81C 4A3IB 4LUOA 1ENCA 2HHHQ 4GZYC 2EE1A 4R4CA 4LF6Q 4DUZQ 4M1UB 2PCFB 3MEFA 1VF5C 1K83H 1Y1VH 3I4MG 3S1MH 1CSQA 5A2QE 4GNXB 3OW2A 1VQBA 1HUMA 1DONA 2V1CC 2K75A 2SNSA 1BR9A 3IL8A 4IQZA 1K0RA 1BVSA 1S5DD 4BWGB 2E2JH 3NENA 1YVCA 3NP8A 4KJOA 1XX8A 4YCWA 2B29A 3BVMA 3ONAB 1B8AA 4KHPL 3GTOH 1KIXA 1SN8A 3D0FA 1Q1BA 1SLJA 1PH8A 4DR6L 1QE6A 3H3VC 4KJNA 1Q82C 1XMQL 1TT2A 3CPFA 3MWYW 1D1IA 4FO2A 1B7YB 2VY3A 4O2DA 1L1OC 2VL6A 3P1HA 3T1HQ 2F4VQ 1PH2A 3EN2A 1TS3A 3KK7A 5COYA 1NY4A 1WTRA 3A5ZB 2FINB 4K0KQ 2H1EA 4DV2L 2DY8A 4NPSA 1RTNA 3QWNA 4RGTA 4LFBL 3BYYB 1XPUA 4G7OC 4HJ5A 1LLRD 4A3EH 3TQYA 3AU7A 4EQ5A 1G91A 5CYUA 5DEHA 2K6AA 4B3TQ 3EROA 2PYKA 5CV7A 4C3JB 1YIJA 3F2BA 4A3DG 4I65A 1VQ8A 4JI5L 2E75C 1YBYA 4C3HH 2UXDQ 1HRJA 4CKEA 1BUVT 1HZAA 4GN5A 3TSSA 3H3VH 4JW0A 1HTLD 1SEBD 3OTOQ 1CQFA 3KDFB 2H5XA 3FKIH 5G3LF 1EOVA 1FNVA 4FXGC 2QEXA 3U50C 2KUMA 1XPRA 4CKCA 4IPDA 3SK4A 2HIVA 1DCZA 1A3UA 1HH2P 1PH3A 2F0WA 2EOTA 2YYZA 1L0YB 4OONA 5C6AA 3VYUA 1LO5D 4K5WA 4KTAA 4DPGA 2ZTDA 2MFIA 1SRUA 2RDHA 4ZQ3A 1YHQA 4LFAL 3A8IE 3J7ZC 5JVG3 1QNKA 2QEJC 2B2TA 4DNRB 1GJXA 1Q46A 2RF4A 1IBKL 2ZTCA 2VS1A 3ER0A 1GUWA 1L2FA 1STAA 1V8QA 4L5TA 2WV6D 2OT2A 2C35B 5J3BA 2JP1A 5EKLA 5D14A 5LL6S 3T56B 3D3RA 4DV0L 2UU9Q 3K8AA 2Y0SG 4HCEA 3HOUG 2Z8LA 3IFDA 4HJ7A 3RLOA 1SFOB 3CPWA 1XTDA 2I5MX 3WWVA 3S2HB 1K73C 1WI5A 3TS2A 2ZJRA 2SNMA 1F9QA 1D6EC 5J1ZA 3CKIB 4ABNA 1XNQQ 4JBWA 2F0OA 1SXTA 5C5LA 4A3DB 1LTLA 3S14H 3DLLA 1LTTD 1X6OA 2IPKD 1YJ9A 2XRSD 3VR3A 1LABA 4OX9Q 5GAEC 2IT1A 2F3VA 2O5IC 1N9WA 4NXNQ 2B2UC 4IURA 1VQ4A 4OIKA 4GNXC 3HP3A 4R8IA 1FJGL 3ULPA 2G9DA 3JAML 4X64L 4UHVA 3I56A 3JC66 1I4XA 1SYFA 3GTJH 2PW7A 2HT1A 3PUXA 1X3QA 2VNUD 5A35A 1K0SA 2A69D 1X3FA 1EY8A 3VYTA 4Z9CB 1JE4A 5NUCA 5C44H 4JI6L 2JA7G 2KJXA 2B63G 5CGKA 1WD0A 3SGIA 1OXSC 2J7ZA 1HNWL 4OIJA 5LMNQ 4KY7A 1VQDA 1YNND 3QO2A 3J80L 5DM73 2WP8J 1VMPA 3A8KE 3BVGA 1O7YA 5IGFA 2YU9B 3CQZH 5ELDA 1N33Q 4ILWA 4DR3Q 4DV1L 2NZ1D 2A69C 1QNUA 2RQXA 1XWEA 1DGSA 2IHEA 5CV6A 4CHTB 4LF9Q 1B4OA 1SYEA 3G48A 1NCVA 2XSCA 3I90A 4L5SA 4LK1C 1TWCB 1QILA 2UUAQ 1VMCA 1Q12A 3CAMA 3D8GA 5C3EH 3KLRA 3TS0A 2QCPX 4KY6A 1PTOC 1A63A 1OXTA 3OIPA 4DXGA 4HEDA 3CCLA 5K36G 4KN4C 2EY6A 2Z6KA 5ELNA 5IP9G 3T1YQ 3PUWA 5T1IA 1DM0B 2IWHA 1RDPD 3VYSA 3NQIA 5IT9c 3ND8A 2JA5H 2OXPA 4JOIA 3K6OA 1A2TA 1LTBD 2Z4IA 3TP6A 1PZID 4ZYSA 3J81E 1O7IA
chains in the Genus database with same CATH topology
5I9OA 5M9OA 4KK7A 4XYOA 3GV3A 4BY7B 1B44D 1EQVA 2JA7B 1I4HA 5EJWA 3Q22A 5CR3A 1PTOH 3NTHA 1EU4A 2PMZB 4MN3A 1CZWA 2E2DC 3QG1A 4X3KA 3I4LA 2PZUA 2FMMA 4XXEA 3S1NB 5J22A 4RFBA 2K01A 3GTLB 1CA5A 4BA2I 1JWMD 2RBMA 3C1EA 3BZDB 1Q8IA 2SOBA 4Q0FA 3KF8A 1U9RA 2EYLA 3IAYA 1UEAB 4XYQA 4IN3A 2DY7A 3EFXD 2IJ0A 3I91A 1B9NA 2KHSA 3I72A 3S9WA 2A6ED 1EWHA 5JAVA 5EKIA 1T5EA 4MIUA 2A6HD 4PMBA 1S5BD 3D4WA 2BDOA 3K5MA 4IUPA 1SAPA 1IKMA 1RF2D 1CTMA 1TR5A 3HEJA 2XIWA 4Y7NB 2RKSA 2NVQB 3K5LA 2PPBC 2K05A 3HKZB 3V05A 2TSSA 5KNCA 2A6EC 2F4IA 4NDXA 5LL6X 1E0BA 1ET9A 2A6HC 3PO2B 2XNAC 4IFDI 5ELCA 2WINB 3X3NA 4LMQD 1SE4A 2B2YA 4OHJA 1HFGA 4ZK9B 4HAEA 1G2TA 2KECA 1IKLA 1A2UA 1PXUA 2AWOA 2O5JC 1E2WA 3DEOA 1STBA 1SMYD 4OL7A 1H9JA 3T51B 1FNUA 3EVQA 3QOJA 4DU9A 2LKVA 3K5OA 2EYJA 1HQRD 3A54A 5CORA 4QUCA 5ELFA 3FVQA 2F0DA 5KEEA 2F0QA 1DOLA 2DNEA 4RGNA 2F0NA 2ZXOA 5C0XG 1W6JA 1SNOA 4U673 3TN2A 2X6GA 4N9PA 1EEFD 2KVMA 4K6DA 5CV8A 1SMYC 3FPUB 4KN7C 4QF4A 5DAUA 4XQQA 1OXUA 3JAME 1JOOA 4KKUA 4IUTA 3P75A 1DOMA 5C0XJ 1BBXC 1STNA 1DD2A 1EYCA 4KMUC 1DXMA 1CT1D 3RZDB 4C3IB 1K8MA 2F0LA 1V1PB 4ZRZA 2EZVA 3J80E 1AZPA 4DAVA 2PO4A 1UAPA 1ESFA 2CW0D 3Q0AA 1G8ZD 1MGSA 1QCBD 1IW7D 1R9TB 5CV5A 5F2DA 5KYLA 2R61A 4K2LA 2K03A 3S1RB 3NE5B 3MAQA 3I4NB 1O78A 5FK9C 1SE2A 4ID6A 5KNDA 2JEAI 1JQYD 4FF2A 1X32A 5EBDA 1ILQA 1C4QA 1D5MC 4H44C 1MSGA 3GTKB 2CW0C 1TWGB 5K36H 4BY1B 3IFTA 2PQEA 3KBGA 1F2LA 3A7AB 5C4HA 3R8BA 2F0EA 4C3JG 2EYHA 3DEPA 4NMZA 1SBBB 3TZDA 1WTWA 3SE0A 1WTOA 2GA4B 1F2MA 4C2MB 1IL8A 1PZKD 1ILPA 3MXNA 1CHPD 4LJZC 1SNCA 2EDGA 3DWAA 4KV6A 3S17B 1LTSD 3BVZA 1ENAA 1LT6D 1UNSA 1JC7A 1HQMC 3DMUA 4A93B 5C3WA 2PZWA 2K5DA 2B2WC 1Z6HA 1E2VA 1F2YA 1ET6A 3SXHA 4IZ8A 1JOKA 2F0PA 2L9HA 4I7ZC 1S4ZA 1IHZA 4BBSB 3U9OA 3LWEA 4NKLA 1GUGA 3TP8A 1H9MA 2NVXB 4O42A 1FGBD 2HDMA 4HCSA 3H0GB 4DA2A 5EKKA 2LMCB 2K5QA 5FO7B 1LACA 1TKWB 3U9SA 1Y8OB 3WOFA 4XIGS 2X69A 2G9HD 3TMEA 4KY5A 4A3BB 5M3FB 1DOKA 4K14A 2CQAA 4HN7A 2M2LA 2HQEA 5I9PA 3MA2B 2B2UA 2IX0A 2N55A 2F03A 1NSNS 5ISRA 3IKJA 5D3DA 3CRKC 3T4AC 2O2LD 5I2YA 5JJZA 2E2HB 2L55A 3HOVB 3R2TA 1TVXA 2JA6B 2B39A 1I6VC 4XTCS 3R93A 2LFNA 5FO9B 1PZJD 1PDQA 3HOWB 4L63B 4XQNA 3VA5A 1ENFA 4L6TB 4FXDA 4CJ0B 3OMCA 4DGZA 3EA6A 2KCCA 1ONLA 1CZGA 1RJTA 1FD7D 1I4GA 2MUYA 1ESRA 2V4DA 4PMCA 1EY6A 3LX0A 4CBVA 1LTGD 3S1QB 1NAPA 4XT1B 2DN8A 3HOYB 1PTOF 1TWAB 3MEHA 1JORA 1B50A 1RHPA 1PRTF 3NHHA 2QF7A 2WACA 1M8AA 1O7ZA 5EPKA 2EVBA 3TBIB 3E5SA 1VF7A 1Y1WB 2OEOA 2AQ2B 1G6ZA 2O4XA 2PZTA 3M3YB 4EVOA 1R4QB 2PW5A 3D6WA 2IX1A 4BA1I 1EFID 2KCNA 4C1NI 5TSSA 3A55A 3URYA 2AWNA 3W2DA 5C0XH 2WKCA 2RSNA 1CM9A 2EYPA 1EY4A 2VXWA 3NPPA 4PQXA 5FLXL 3DXJC 3CHBD 4CJ1B 4K8IA 1F9RA 1QWYA 3G7LA 1NR4A 3CRLC 2XN9C 2JXMB 2L0CA 3BG3A 4FP5D 3NUCA 3OWFA 3GD7A 4QMGA 5C4ZA 1GUTA 4OGQC 3RMHA 4RHRA 1CQVA 2NN6G 3QJYA 4B9WA 2AQ3B 3KLSX 3SK5A 5HGTA 4TSSA 5BN4A 2KQ3A 2E74C 2R3ZA 4ME5A 2B2VC 4G57A 2A68D 2JE6I 3M4YA 1YNNC 2MPMA 2C5CA 4G7HC 3PV0A 1H9SB 3MXUA 2IW3A 2RA4A 1WD1A 1SNPA 4IUVA 4BBRB 3DWPA 2L1BA 3WOEA 3S16B 1KABA 1YNJD 3HOZB 2AUJD 1GUSA 3AB9A 2A68C 4RCNA 1LV9A 1TWFB 4V190 5JVH3 1AN8A 4ZAIA 2MP1A 3SK8A 4ZLTF 3MFYA 3DHQA 1A3VA 1Z47A 4DK0A 5IODA 5KNBA 1A15A 5IGCA 1ZXTA 5KGUA 1YNJC 2L5TA 2CVRA 3O13A 1EWCA 1KNEA 1DJRD 2WKDA 4EQNA 1U4LA 1J8IA 1SJED 1II3A 3NBIA 3GTQB 3Q23A 1BXTA 2L12A 3R3OA 4ZKBB 1HTPA 1TS5A 2MHVA 1SYBA 2VUMB 1QB5D 3BYTB 4K5VA 5HURA 1RD9D 2QDBA 1R4PB 4M8AA 2EJGC 1G2SA 2F1MA 1XXGA 3DM1A 1K8OA 2F0HA 2MJ8A 5I6WA 3I8ZA 1OXXK 1HCZA 2RDGA 4N9TA 1LTID 1K83B 1Y1VB 1D5ZC 2EXZA 5C4XB 1C8CA 3T16A 4K2KA 1Z7TA 2FFKB 3HG9A 1LTAD 2ZXRA 1EY0A 4XDXA 1S5CD 4B08A 3MXPA 5FOBB 3N52A 1XYIA 1LT5D 1D5XC 4IUQA 2FHTA 4C1NK 2HDLA 4HMJA 4RAUC 3PUVA 2PNRC 4C3IG 1EYAA 1BCPF 1Q90A 3GTOB 2B8FA 3I70A 1DZ1A 1AZQA 2M00A 2BOSA 3N6RA 4OO1H 1A6XA 4A3GB 2F0JA 2ICIA 3T53B 1NR2A 4TRDA 3L3OC 1CA6A 1S5FD 1LTRD 3H91A 1Y8NB 5IGBA 3J7AF 4J8QA 1EIGA 3K0YA 4A3EB 3DWQA 4F88A 2J0TD 2RDFA 1FNWA 1JWSD 1D2BA 4FF4A 3TP5A 2BA0A 5IGDA 1WCMB 1AW7A 3SDZA 4KHVA 1QJOA 1G291 3PMFA 4C3HB 5I2XA 3RD4A 4KKSA 3TZUA 2N88A 2HUGA 3FKIB 3VYRA 3ITPA 4DK1A 1Q1EA 3I73A 2H4OA 3FEWX 3LWUA 1AEXA 4A3FB 2L4NA 5D3IB 1F77A 5J39A 4ZUIA 1QOHA 2D9UA 2NUCA 1L0XB 4EGVA 2BE5D 5FLXE 4CGYB 3D31A 3ERQA 3OOCA 4IALA 1GHKA 2IX3A 2EY5A 3SVMA 1PMRA 1HFNA 1HUNA 3QIAA 1PLFA 2E2IB 3G6JB 3FMCA 2LY7A 3NTKA 4H7BA 2B2WA 1EEID 4U68A 4K6LA 3GTGB 5IT9L 2RSOA 3VR5A 2EY2A 4JK1C 2NN6H 5IGGA 3S14B 4R9WA 3PIO3 5ELBA 4WORA 1KLGD 3NBHA 4ZKCB 4A3KB 4J1MA 1EY5A 3GTJB 1IW7C 3GQBA 2F0KA 1SE3A 4RCOA 3H94A 4HSPA 3DUZA 4RGOS 5FKAC 4AYBB 4EQOA 3BDLA 3OW7A 4EQPA 3J81L 1WTXA 5JPNC 1PFMA 4H13C 4DAYA 1TIID 2NWGA 2A73B 5IOCA 3NWSA 1MSHA 3K7AB 4WJWA 3LNNA 5DNFA 1EY7A 4FNFA 1V1PA 4KI0A 1EL0A 1JICA 5T1GA 3SR1A 4RWSC 3CQZB 2NBFA 2EJMA 2EYOA 4X3UA 4IUUA 5IGEA 5JEAG 1GHJA 5M5WB 1TWHB 3HOXB 4RH6A 5C3EB 3BDOA 4R8NA 1WVLA 2K28A 5BN5A 1IYVA 2D5DA 2NVYB 5JEAJ 1S5ED 1STHA 2L11A 2XVSA 2F0VA 2JA5B 2HCCA 3MC0B 1STYA 5E4XA 3NTIA 4X3SA 1AP0A 1BOSA 2ID0A 5KYIA 3PUZA 3J7AV 1J9OA 5C0XI 1KDBA 1JCKB 2JYOA 2JEBI 5BN3A 2I07B 2F3WA 2WIIB 1Q3LA 1DYQA 1ICWA 1M4VA 1PTOB 4RKLA 2EJFC 2VB2X 1PRTB 3T13A 1TS4A 4OO1G 1WTPA 2ZXPA 1SNMA 2EYMA 5K5PA 1UUPA 3I4MB 3R2IA 2CHBD 1FYCA 4S3SA 1I3QB 4H0LC 3KLSA 1KLUD 2A5HA 4PNYA 2F0MA 3K59A 5I6YA 2FJ2A 1O7LA 2XWBB 5CMDA 5DM63 2BCOA 3E0JA 4FXKC 4K8JA 1I4RA 4PMWA 1STEA 4KD3A 2F0FA 4DF7A 1WTVA 4ZUJA 2K7VA 3OWEB 3NWTA 2D62A 2F0GA 1RCVD 5C4JB 4TKOB 1U4PA 3L9AX 4CKBA 3M4OB 2B2VA 1A3TA 4BS9A 1BNZA 3MTSA 2BDNA 2FMCA 2OF1A 3QOLA 3VR4A 1AFPA 1JR0D 1HPCA 1MD2D 1C48A 5G3LD 3P7JA 1EY9A 4WFN3 4HSVA 2DNCA 2F0IA 3FDTA 2Q8TA 1ML0D 1I4PA 2F0UA 1KDCA 4B9XA 2MGSA 2I46A 5C5MA 5LHY1 2HCIA 2EY1A 1X3PA 1B3AA 1TY2A 1QG7A 1BDOA 1B2TA 1ZYRD 4FF1A 2NYZD 3VR2A 2BA1A 1B53A 2NB0A 1MI2A 3GV6A 1F9SA 3HRZC 1V1OA 4DXFA 1CK1A 2B2TC 4IFDG 1PFBA 2K04A 1GXDC 1TU2B 1B1ZA 1SDFA 1PTOD 4KHZA 3NK9A 3GP7A 1VCIA 4K5XA 4HMIA 1PRTD 1RTOA 4FYDA 4LAAA 2NTSA 3K57A 3NQTA 2R7ZB 1SYDA 2QKIC 1ZYRC 3S2DB 4TQUS 4G7ZC 2LS01 1F9PA 1O80A 1OXVA 1IYUA 5IT9E 4IFDJ 1LT3D 2Y0SB 3HOUB 3FRPB 4DFAA 2RVLA 2E76C 2Z4HA 1HXYD 5E3FA 3SK6A 3EQLC 3GO5A 1EU3A 3EJIA 1STGA 4DNTB 3C3LA 4KKTA 5D65A 1PRTC 3OHXC 4E6IA 2TMPA 2QILA 3Q24A 3W3AA 4O1NA 1RKNA 3GTMB 1TY0A 3K5NA 1BF4A 2NVTB 5EPJA 1U4MA 1XTCD 2XRQD 3MFGA 2X6LA 1RODA 2M9VA 1TQOA 5CC4A 3ND9A 5E4WC 4OO1I 3OSOA 1Y8PB 5A2QL 4NP5A 5M5YB 3OMGA 2B63B 1B9MA 3AMUA 3F2UA 5KIXA 5EGTA 2C9OA 3QB3A 2EYFA 2F0SA 5CBAE 2R6GA 1SYGA 1CHQD 3J7YW 3M7NA 4QCLA 5JEAH 5ELEA 1GOZA 4MHEA 3BDCA 1I6HB 1H9SA 2B8GA 1W6KA 1GUOA 3D4DA 3RZOB 2EPBA 2ICEC 2KEEA 1BCPB 5FO8B 5CBEE 3KUPA 4HR7B 3TP7A 3M7GA 4A3JB 1KNAA 2D2CC 3Q6SA 1H9RA 1I4QA 2VB3X 4KD4A 2A74C 2ENBA 4C3HG 3A7LA 4DAPA 3S1MB 4P2CB 1PFNA 1I50B 3ZYYX 4A3MB 3D4RA 5KRUA 3OIQA 4YIJA 3I3CA 2JA8B 1EOTA 1VDZA 3MVVA 2E2JB 2AQ1B 3SHLA 1JB3A 5CV4A 3E6ZX 3TDQA 2SEBD 3H09A 3X3MA 1SNQA 1H9KA 3VA7A 1CI3M 2SDFA 4XT3B 3D6CA 3RUZA 1HA5A 2KEDA 1SJHD 1EYDA 5E1FA 1F2ZA 4NW2A 2Z1CA 4F7XA 1LT4D 3P20A 3MXGA 4RGMA 3PO3B 2WAQB 1BO0A 4QB4A 2NN6I 3VR6A 3C2PA 4RA8A 3K58A 3KBXA 1CFMA 2AUKA 1ZEQX 4QIWB 3NSWA 4ODGA 3OPOA 5AFWA 3H6MA 4PV1C 5EBCA 2Q8RE 3A8JE 3HZXA 1JOQA 1SSOA 3WDNA 1Y69U 1NUCA 1EQTA 1HHVA 1KDAA 4L8JA 1D1KA 1EZ8A 2K1BA 1PYWD 3UI2A 5EQ0A 1E2ZA 5IIFA 1U4RA 4UAIA 4DN4M 3HS0C 1JWUD 2WB1B 1TS2A 5M3MB 3FPPA 4G4KA 1GUNA 1BCPD 1OO9B 4IUNA 4X3TA 4Q5VA 3RLFA 2JSOA 2KA7A 2K32A 3GTPB 3C1FA 3A56A 3PIP3 2KOLA 1EIHA 3SEBA 3V2TA 2J4XA 5I4DA 4J6HA 4QUFA 1FR3A 4F8MA 1SNDA 2B2YC 1BCPC 1BQQT 4CJ2C 4C56C 5M5XB 2XWJB 2BE5C 1SYCA 1KAAA 2K33A 3CU7A 1KTKA 3MHBA 4FVMA 4UDUC 5CV9A 4IFDH 4HTHA 2IL8A 5C3XA 1T5XD 3MZ5A 4FF3A 5JPMC 4RHSA 5EPLA 4V0BA 4ULLA 3C46A 3S15B 1HA6A 1MBYA 4F87A 2ZT9C 3NXWA 2Q8IB 1WTQA 2R93B 4WRDA 2NTTA 3BS1A 2R92B 4XQJA 5C44B 3M85A 3L7ZC 1EZ6A 3PUYA 2K5WA 3V96A 2F0TA 4RKBA 1V43A 3HGBA 5JOBA 1ZKOA 4A3IB 4GZYC 1ENCA 2EE1A 4M1UB 2PCFB 1VF5C 5A2QE 1DONA 1HUMA 2SNSA 1BR9A 3IL8A 4IQZA 1S5DD 4BWGB 3NP8A 4KJOA 1XX8A 3BVMA 3ONAB 1Q1BA 1QE6A 3H3VC 4KJNA 1TT2A 3MWYW 1D1IA 4FO2A 3P1HA 1TS3A 3KK7A 5COYA 1WTRA 2FINB 2H1EA 2DY8A 1RTNA 3QWNA 4RGTA 3BYYB 4G7OC 1LLRD 3AU7A 1G91A 5CYUA 5DEHA 2K6AA 3EROA 2PYKA 5CV7A 4C3JB 4I65A 2E75C 1HRJA 4CKEA 1BUVT 3TSSA 1HTLD 1SEBD 1CQFA 5G3LF 1FNVA 4FXGC 2KUMA 4CKCA 3SK4A 1DCZA 1A3UA 2F0WA 2EOTA 2YYZA 1L0YB 5C6AA 3VYUA 1LO5D 4K5WA 4KTAA 2RDHA 4ZQ3A 3A8IE 5JVG3 1QNKA 2QEJC 2B2TA 4DNRB 1GJXA 1GUWA 1STAA 1V8QA 2WV6D 2OT2A 2JP1A 5EKLA 5D14A 5LL6S 3T56B 3D3RA 4HCEA 2Z8LA 3IFDA 1SFOB 3S2HB 2SNMA 1F9QA 1D6EC 5J1ZA 3CKIB 4ABNA 4A3DB 4JBWA 2F0OA 1SXTA 5C5LA 1LTTD 2IPKD 2XRSD 3VR3A 1LABA 2IT1A 2F3VA 2O5IC 2B2UC 4IURA 4OIKA 3HP3A 4R8IA 2G9DA 3JAML 1I4XA 1SYFA 2PW7A 3PUXA 1X3QA 2VNUD 5A35A 2A69D 1EY8A 3VYTA 4Z9CB 1JE4A 5NUCA 2KJXA 5CGKA 1WD0A 1OXSC 2J7ZA 4OIJA 4KY7A 1YNND 3QO2A 3J80L 5DM73 2WP8J 1VMPA 3A8KE 3BVGA 1O7YA 5IGFA 2YU9B 5ELDA 4ILWA 2NZ1D 2A69C 1QNUA 2RQXA 1XWEA 5CV6A 4CHTB 1B4OA 1SYEA 1NCVA 2XSCA 3I90A 4LK1C 1TWCB 1QILA 1VMCA 1Q12A 3D8GA 3KLRA 2QCPX 4KY6A 1PTOC 1OXTA 3OIPA 4DXGA 4HEDA 5K36G 4KN4C 2EY6A 3PUWA 5T1IA 1DM0B 2IWHA 1RDPD 3VYSA 3NQIA 3ND8A 2OXPA 3K6OA 1A2TA 1LTBD 2Z4IA 3TP6A 1PZID 4ZYSA 3J81E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZG A;  4P2C B;  1QOH A;  1C4Q A;  1CZW A;  2BOS A;  1QNU A;  1CQF A;  1D1K A;  1DM0 B;  4ULL A;  2C5C A;  2GA4 B;  1C48 A;  1D1I A;  1R4Q B;  2XSC A;  1R4P B;  1BOS A;  4M1U B;  3MXG A; 
#chains in the Genus database with same CATH topology
 4A3M G;  1KL9 A;  2CH4 A;  5I9O A;  5M9O A;  4KK7 A;  4XYO A;  2JA8 G;  4R4Q A;  3GV3 A;  4BY7 B;  1B44 D;  3CCQ A;  2YTY A;  1I5F A;  1EQV A;  3NEL A;  2JA7 B;  1RL2 A;  1I4H A;  5EJW A;  3Q22 A;  5CR3 A;  3J81 c;  4P73 A;  1PTO H;  3NTH A;  1EU4 A;  2PMZ B;  4C3J H;  4LFA Q;  4MN3 A;  1IZ6 A;  3RN5 A;  1BKB A;  1CZW A;  2E2D C;  3QG1 A;  4X3K A;  3I4L A;  1T9H A;  3KYH C;  2PZU A;  2FMM A;  4OWX B;  4LFC L;  4LW1 A;  4XXE A;  3S1N B;  1JJG A;  5J22 A;  5GAH C;  4RFB A;  2K01 A;  1W3S A;  3GTL B;  1HR0 W;  4A76 A;  3CC7 A;  1CA5 A;  2AHO B;  1IBM L;  4BA2 I;  4CDC C;  1JWM D;  2RBM A;  3PO3 G;  1CKN B;  2WAQ G;  3C1E A;  4DR7 L;  3BZD B;  4R4T A;  3UDX A;  2JJQ A;  1Q8I A;  2SOB A;  4Q0F A;  1QVG A;  4DK6 C;  1CUK A;  3KF8 A;  3A5U A;  1U9R A;  2Z6K C;  2LXJ A;  2EYL A;  3IAY A;  1UEA B;  4XYQ A;  1HZB A;  2VQE Q;  4IN3 A;  3STB C;  2DY7 A;  4A3C G;  3EFX D;  2F3I A;  2IJ0 A;  5C4J H;  4YHH Q;  3I91 A;  1B9N A;  2KHS A;  3I72 A;  3S9W A;  3M4O H;  2A6E D;  1EWH A;  5JAV A;  5JJI A;  4YY3 L;  5EKI A;  1T5E A;  1N32 Q;  4MIU A;  2A6H D;  4PMB A;  1N8R C;  1S5B D;  4QJF A;  1IBL L;  2WB1 G;  2RHS B;  4JYA L;  3D4W A;  1SFO H;  5M3M G;  2BDO A;  3K5M A;  2A8V A;  4IUP A;  1SAP A;  1ICF B;  1IKM A;  3S2H H;  4JI6 Q;  1RF2 D;  1CTM A;  1TR5 A;  3HEJ A;  2XIW A;  4Y7N B;  2RKS A;  2NVQ B;  3K5L A;  2PPB C;  5IYD H;  2K05 A;  3K7U C;  4A3D H;  1PH7 A;  2HHH L;  2UUB Q;  3HKZ B;  2PQA B;  3V05 A;  4DUZ L;  2TSS A;  5KNC A;  1U0L A;  3PF5 A;  2A6E C;  4MZ9 A;  2F4I A;  2Z0S A;  4O0A A;  4NDX A;  5LL6 X;  2IY5 B;  1E0B A;  1ET9 A;  2A6H C;  5AJ3 Q;  3HFZ B;  4GN4 B;  1IL2 A;  3PO2 B;  1KRT A;  2KHI A;  4DV6 Q;  2XNA C;  4IFD I;  5ELC A;  2WIN B;  2K5H A;  3X3N A;  4LMQ D;  1SE4 A;  2B2Y A;  4OHJ A;  1HFG A;  4ZK9 B;  4HAE A;  1UE6 A;  1G2T A;  2KEC A;  1EFW A;  1IKL A;  1A2U A;  1PXU A;  1VQK A;  2AWO A;  2O5J C;  1E2W A;  3DEO A;  1STB A;  1SMY D;  4OL7 A;  1H9J A;  3T51 B;  2PNH A;  1FNU A;  3EVQ A;  4FDB A;  3QOJ A;  4DU9 A;  2LKV A;  3K5O A;  1PH4 A;  2EYJ A;  3HKS A;  1HQR D;  1VQI A;  3A54 A;  5COR A;  4QUC A;  5ELF A;  3FVQ A;  4DV7 Q;  2F0D A;  2K5N A;  4X65 L;  3T1H L;  2F4V L;  1NTG A;  5KEE A;  4Y52 H;  1Q7Y C;  2EXD A;  3I4N G;  2F0Q A;  1DOL A;  2DNE A;  4K0K L;  4JC0 A;  4RGN A;  2VZA A;  2F0N A;  2ZXO A;  5C0X G;  3HOU H;  1W6J A;  1SNO A;  4U67 3;  3TN2 A;  2X6G A;  2R93 G;  4N9P A;  1TWC H;  3KF6 A;  5L37 A;  1EEF D;  4HIK A;  2R92 G;  5C44 G;  2ZTE A;  2KVM A;  3NBH B;  4K6D A;  1SMY C;  5CV8 A;  3FPU B;  3I55 A;  4B3T L;  1UE5 A;  4KN7 C;  4QF4 A;  5DAU A;  4XQQ A;  1OXU A;  3JAM E;  1JOO A;  4KKU A;  2A19 A;  3E3X A;  2IHF A;  1VQG A;  4IUT A;  4IPG A;  5GQO A;  5GAG C;  3P75 A;  4I7A A;  4A3I G;  4LF4 Q;  2UXD L;  4LF7 Q;  1VQM A;  1DOM A;  5C0X J;  1BBX C;  3OTO L;  1STN A;  5IE8 A;  1EYC A;  4KMU C;  4JI4 L;  1DD2 A;  1K28 A;  1DXM A;  1JE5 A;  3GTM H;  1CT1 D;  4X62 Q;  3RZD B;  2NVT H;  4C3I B;  1QUQ A;  4DAY B;  3AQQ A;  1K8M A;  4CDF C;  2F0L A;  3BJU A;  1V1P B;  2JA7 H;  4ZRZ A;  2EZV A;  3J80 E;  1AZP A;  2OTL A;  2DJG C;  3DM3 A;  4DAV A;  2PO4 A;  1UAP A;  1ESF A;  2CW0 D;  3BZC A;  3E0E A;  3Q0A A;  1G8Z D;  1MGS A;  1QCB D;  1IW7 D;  1R9T B;  5CV5 A;  1YZ6 A;  2L15 A;  3ERS X;  5F2D A;  5KYL A;  1C7Y A;  4WJ4 A;  2R61 A;  4K2L A;  2K03 A;  3M9B A;  3S1R B;  3NE5 B;  1KHI A;  3MAQ A;  3I4N B;  1O78 A;  5FK9 C;  2UU9 L;  1SE2 A;  4ID6 A;  5KND A;  4ZCK A;  1S72 A;  2JEA I;  1I6H H;  1JQY D;  4MNO A;  4FF2 A;  1X32 A;  5IWA L;  5EBD A;  3RLN A;  1ILQ A;  1C4Q A;  4DR1 Q;  1VQN A;  1D5M C;  4H44 C;  4DR5 Q;  4JYA Q;  4JV5 Q;  1MSG A;  1QVF A;  3GTK B;  2CW0 C;  3H3V I;  1TWG B;  5K36 H;  2AKW B;  4BY1 B;  3IFT A;  3EIV A;  5IP9 H;  2PQE A;  3KBG A;  4JBJ A;  1XNQ L;  1F2L A;  2K50 A;  3A7A B;  5C4H A;  1VQL A;  3R8B A;  2F0E A;  4C3J G;  4OX9 L;  2EYH A;  2PI2 A;  4NXN L;  3G71 A;  2KEN A;  3QR8 A;  4DV3 L;  1S40 A;  1PH6 A;  3DEP A;  4NMZ A;  1SBB B;  3TZD A;  1I50 H;  1WTW A;  3SE0 A;  4A3M H;  1WTO A;  1CKO A;  4H02 A;  2GA4 B;  1V1Q A;  1F2M A;  2JA8 H;  4C2M B;  1IL8 A;  1PZK D;  1ILP A;  1ASZ A;  4NXM Q;  3MXN A;  1CHP D;  4LJZ C;  3PSI A;  1SNC A;  4P75 A;  2EDG A;  3DWA A;  4KV6 A;  3CCE A;  3S17 B;  1LTS D;  3BVZ A;  4AIM A;  1ENA A;  1LT6 D;  4Y7N H;  2NVQ H;  1UNS A;  5LMN L;  1JC7 A;  1HQM C;  3DMU A;  1YJW A;  4A93 B;  1GKH A;  5C3W A;  2PZW A;  1MIU A;  2K5D A;  2B2W C;  1Z6H A;  4JI3 Q;  1E2V A;  1XNR Q;  1F2Y A;  1N36 Q;  1N33 L;  1ET6 A;  3I4O A;  4DR3 L;  1BBU A;  3SXH A;  4IZ8 A;  2JN4 A;  1JOK A;  4X65 Q;  2F0P A;  1C9O A;  2L9H A;  4I7Z C;  4PZ8 A;  1S4Z A;  2VW9 A;  1N34 Q;  4LF9 L;  1IHZ A;  2MO1 A;  4BBS B;  3U9O A;  3PO3 H;  3LWE A;  4NKL A;  4L5Q A;  5IYB H;  1GUG A;  1HZ9 A;  1H9M A;  3TP8 A;  2UUA L;  3G6E A;  2NVX B;  4GKJ Q;  4O42 A;  1FGB D;  2HDM A;  4HCS A;  2GVA A;  3H0G B;  4DA2 A;  5EKK A;  2LMC B;  2K5Q A;  1E22 A;  5FO7 B;  1LAC A;  3CCS A;  3TRE A;  3T1Y L;  1TKW B;  3PIO A;  3U9S A;  1Y8O B;  1PA6 A;  3WOF A;  4XIG S;  1EQR A;  2X69 A;  5IYD G;  2G9H D;  1FVI A;  3TME A;  4KY5 A;  4A3B B;  5M3F B;  1Y1W G;  1DOK A;  4K14 A;  4A3C H;  2CQA A;  4HN7 A;  2M2L A;  1SE8 A;  2HQE A;  5I9P A;  2OTJ A;  3MA2 B;  2B2U A;  2IX0 A;  2N55 A;  4HIM A;  4LF6 L;  4GNX A;  4JI4 Q;  5BR8 Q;  2F03 A;  1NSN S;  5ISR A;  3IKJ A;  5D3D A;  3FP9 A;  1UE7 A;  3CRK C;  3T4A C;  2O2L D;  5I2Y A;  5JJZ A;  2E2H B;  4DKA C;  2L55 A;  3HOV B;  3R2T A;  4CDD C;  1TVX A;  2JA6 B;  2B39 A;  1I6V C;  4XTC S;  3R93 A;  5M3M H;  2LFN A;  5FO9 B;  1PZJ D;  4PZ6 A;  1PDQ A;  1K3R A;  3HOW B;  4L63 B;  4XQN A;  3U4V A;  3VDY A;  3VA5 A;  1ENF A;  2ASB A;  5IP7 H;  4L6T B;  4FXD A;  1YNX A;  4CJ0 B;  1ASY A;  1YHB A;  3OMC A;  4DGZ A;  3GTP H;  3EA6 A;  4QQB X;  2KCC A;  1NMF A;  1QZH A;  1ONL A;  4RMF A;  1CZG A;  1RJT A;  1FD7 D;  1I4G A;  1UWV A;  2MUY A;  1ESR A;  2V4D A;  4PMC A;  4N8F A;  1EY6 A;  3LX0 A;  4CBV A;  1LTG D;  2JA9 A;  2ATW A;  1D8L A;  3S1Q B;  2Q2I A;  1VQO A;  1NAP A;  4XT1 B;  1HR0 Q;  2DN8 A;  3HOY B;  1PTO F;  1TWA B;  3MEH A;  5IWA Q;  1JOR A;  1B50 A;  5M5X H;  1RHP A;  1PRT F;  3M4P A;  3BZK A;  3NHH A;  2QF7 A;  2WAC A;  3FHW A;  2CQO A;  1M8A A;  1X9N A;  1O7Z A;  2VQE L;  5EPK A;  2EVB A;  3TBI B;  3E5S A;  1VF7 A;  1Y1W B;  2OEO A;  2AQ2 B;  1G6Z A;  4YHH L;  1R9T H;  2N3S A;  2EQS A;  2O4X A;  2PZT A;  2NZO A;  4EVO A;  4GLA C;  3J7A 5;  3M3Y B;  3KDF A;  1R4Q B;  2PW5 A;  3D6W A;  4DV3 Q;  2IX1 A;  4BA1 I;  3S1R H;  3S15 H;  4AQY Q;  3UDF A;  4YWM A;  1EFI D;  3I4N H;  2KCN A;  4C1N I;  1N32 L;  5TSS A;  3CCU A;  3A55 A;  1OTC A;  3URY A;  2AWN A;  3W2D A;  2DGY A;  4BY7 G;  5C0X H;  2WKC A;  4UY8 C;  1HNZ L;  1VQE A;  2R93 H;  2RSN A;  2R92 H;  1CM9 A;  2EYP A;  1EY4 A;  2VXW A;  3PQI A;  3NPP A;  4PQX A;  4BY1 H;  1Y14 B;  4B3S Q;  4R4I A;  5FLX L;  3DXJ C;  2UUB L;  3CHB D;  3LGJ A;  4CJ1 B;  4K8I A;  2UXC Q;  1F9R A;  4LUV A;  4A75 A;  1QWY A;  3G7L A;  4A3I H;  1NR4 A;  3CRL C;  2XN9 C;  2JXM B;  2L0C A;  4UPA A;  3BG3 A;  1KQS A;  3K81 C;  4FP5 D;  3NUC A;  3OWF A;  3GD7 A;  4QMG A;  5C4Z A;  1GUT A;  5AJ3 L;  2KBN A;  4OGQ C;  1VQF A;  2ES2 A;  4DV6 L;  3RMH A;  4RHR A;  4P74 A;  4C2M H;  1KXL A;  1CQV A;  2NN6 G;  3QJY A;  4JI2 Q;  4B9W A;  2AQ3 B;  3KLS X;  4B3R Q;  3SK5 A;  5HGT A;  4TSS A;  5BN4 A;  1H95 A;  2KQ3 A;  1WTH A;  2E74 C;  2R3Z A;  4ME5 A;  2B2V C;  4G57 A;  1YIT A;  3ZJY C;  1NE3 A;  2A68 D;  2JE6 I;  3M4Y A;  3S17 H;  1YNN C;  4R4O A;  4JI0 Q;  2MPM A;  2C5C A;  4G7H C;  3PV0 A;  1H9S B;  4DV5 Q;  4DV7 L;  3MXU A;  2IW3 A;  2RA4 A;  5GRO A;  1WD1 A;  4GKK Q;  1SNP A;  4IUV A;  4BBR B;  3DWP A;  2L1B A;  3WOE A;  3K0X A;  2YV5 A;  3S16 B;  1KAB A;  2DJF C;  1YNJ D;  3HOZ B;  4BBS H;  2AUJ D;  3KFU A;  1VQA A;  1GUS A;  3AB9 A;  2A68 C;  4RCN A;  2NVX H;  1LV9 A;  1TWF B;  4V19 0;  5JVH 3;  1GM5 A;  3ULJ A;  1PFS A;  3PF4 A;  1AN8 A;  4ZAI A;  2MP1 A;  3GDE A;  3SK8 A;  4ZLT F;  3MFY A;  2I0Q A;  3DHQ A;  1A3V A;  1Z47 A;  4DK0 A;  5IOD A;  5KNB A;  4LF4 L;  4LF7 L;  3HKZ G;  4A3B H;  1A15 A;  5IGC A;  5M3F H;  3TRZ A;  1ZXT A;  5KGU A;  1YNJ C;  2L5T A;  4PZ7 A;  4X62 L;  1P16 A;  2CVR A;  2Q2H A;  3O13 A;  1EWC A;  1KNE A;  1DJR D;  2ALY B;  2WKD A;  4EQN A;  1U4L A;  3PO2 G;  4JI8 L;  1J8I A;  1SJE D;  2E2H H;  1II3 A;  3NBI A;  5EAY A;  5IYB G;  3HOV H;  1UE1 A;  3GTQ B;  1A62 A;  2B3G A;  2JA6 H;  3Q23 A;  1HNX Q;  1BXT A;  2L12 A;  3R3O A;  4EX5 A;  4ZKB B;  4DUY Q;  3HOW H;  3CCV A;  1HTP A;  1TS5 A;  2MHV A;  1SYB A;  3CC4 A;  2VUM B;  1QB5 D;  3BYT B;  4K5V A;  5HUR A;  2YTX A;  1RD9 D;  2QDB A;  1R4P B;  4M8A A;  2EJG C;  4L5R C;  1G2S A;  1X56 A;  2F1M A;  2XGT A;  4YWK A;  1XXG A;  3DM1 A;  1K8O A;  4JG2 A;  2F0H A;  4DV4 L;  2MJ8 A;  5I6W A;  1WCM G;  1QVC A;  3I8Z A;  1OXX K;  4DR1 L;  2K52 A;  2Q2U A;  4DR5 L;  4JV5 L;  1HCZ A;  2RDG A;  4N9T A;  5LMU Q;  1HNZ Q;  1LTI D;  4POG A;  1K83 B;  1Y1V B;  1D5Z C;  2EXZ A;  5C4X B;  1C8C A;  3T16 A;  4K2K A;  4YCU A;  1Z7T A;  4IJL A;  2FFK B;  5IP7 G;  3HG9 A;  1LTA D;  2ZXR A;  1EY0 A;  4XDX A;  1S5C D;  4ME3 A;  1Y1W H;  1HJP A;  5H1S E;  4B08 A;  3MXP A;  5FOB B;  3N52 A;  1A8V A;  4PG3 A;  1XYI A;  1LT5 D;  1D5X C;  3A74 A;  2BH8 A;  4IUQ A;  4J15 A;  2FHT A;  4C1N K;  2HDL A;  4HMJ A;  4RAU C;  5LMN W;  3PUV A;  3W1B A;  2PNR C;  4C3I G;  1EYA A;  1WFQ A;  1BCP F;  1Q90 A;  1CKN A;  3KLW A;  3G4S A;  3GTO B;  2B8F A;  3I70 A;  1DZ1 A;  4DR4 Q;  4NXM L;  1AZQ A;  2M00 A;  2BOS A;  3N6R A;  1VQ7 A;  4OO1 H;  1A6X A;  5FLM G;  4A3G B;  2F0J A;  4GN3 B;  1AE2 A;  2ICI A;  3T53 B;  1NR2 A;  4TRD A;  2K4K A;  4HJ9 A;  3L3O C;  1CA6 A;  1S5F D;  1LTR D;  3H91 A;  1Y8N B;  5IGB A;  4JI3 L;  3J7A F;  1XNR L;  1N36 L;  3AFQ A;  4J8Q A;  1EIG A;  3K0Y A;  4A3E B;  3DWQ A;  4F88 A;  2YU9 H;  2J0T D;  2QDL A;  2RDF A;  3A0J A;  4JBK A;  1N34 L;  1FNW A;  3TEH B;  1JWS D;  1D2B A;  4FF4 A;  3TP5 A;  2BA0 A;  5IGD A;  3K80 C;  1WCM B;  1AW7 A;  4YWL A;  3SDZ A;  4KHV A;  4GKJ L;  1QJO A;  4P71 A;  1G29 1;  3W1G A;  3IRB A;  1B3Q A;  3PMF A;  2OCE A;  3CME A;  3CCJ A;  4C3H B;  2KCM A;  5I2X A;  3B6Y A;  3RD4 A;  1VQ9 A;  2UUC Q;  4KKS A;  3TZU A;  2N88 A;  4A3K G;  3AEV A;  2HUG A;  3FKI B;  3AFP A;  4BY1 G;  3VYR A;  5GAD C;  1MJE A;  3ITP A;  4X66 Q;  1EQQ A;  4DK1 A;  1Q1E A;  1M1K C;  1L1O B;  2PQA A;  3I73 A;  2H4O A;  3FEW X;  3LWU A;  1AEX A;  4GLX A;  1X54 A;  4A3F B;  3ULL A;  2L4N A;  5D3I B;  1F77 A;  4BBR H;  5BR8 L;  4GOP B;  1PYB A;  5J39 A;  4ZUI A;  3S16 H;  2FXQ A;  1QOH A;  2D9U A;  1VQ5 A;  4LNQ A;  1XMO Q;  2NUC A;  1L0X B;  4EGV A;  3HOZ H;  3JAM c;  1NBW A;  2BE5 D;  5FLX E;  4BY7 H;  4CGY B;  4JI8 Q;  3D31 A;  3ERQ A;  3OOC A;  4IAL A;  1GHK A;  2IX3 A;  2CWP A;  2LSS A;  4JI7 Q;  2EY5 A;  4MTN A;  3SVM A;  1E3P A;  5DLQ E;  1PMR A;  2ZJP A;  1HFN A;  1HUN A;  3QIA A;  2LXK A;  1PLF A;  4A93 G;  2E2I B;  3G6J B;  3FMC A;  4HID A;  1EIF A;  2LY7 A;  3F8T A;  3HOX G;  2KHJ A;  3NTK A;  4UP8 A;  1EYG A;  2VQF Q;  1JB7 A;  4H7B A;  2B2W A;  2WB1 E;  3S1N H;  1YJN A;  1EEI D;  4U68 A;  3J80 c;  4K6L A;  3Q8D A;  3GTL H;  3GTG B;  5IT9 L;  2RSO A;  4JPB W;  3J81 i;  2QA4 A;  3VR5 A;  4DV4 Q;  2EY2 A;  4JK1 C;  4BBS G;  1HR0 L;  2NN6 H;  5IGG A;  3S14 B;  4R9W A;  3PIO 3;  2AMC B;  5ELB A;  4WOR A;  2EIF A;  1KLG D;  1EIY B;  3H0G G;  3NBH A;  4ZKC B;  4A3K B;  4J1M A;  1SR3 A;  1I94 Q;  1EY5 A;  5ELO A;  3GTJ B;  1IW7 C;  4OEM B;  4A3L G;  4NB3 A;  4LF8 Q;  3GQB A;  2F0K A;  1SE3 A;  4RCO A;  3H94 A;  4HSP A;  2CWA A;  3DUZ A;  4RGO S;  5FKA C;  4A3B G;  2RCF A;  5M3F G;  4AYB B;  1KAW A;  4EQO A;  5FJ8 G;  3PCO B;  2MNA A;  4AQY L;  3BDL A;  3OW7 A;  4EQP A;  3J81 L;  2N49 A;  5JPN C;  1WTX A;  2N78 A;  1PFM A;  4H13 C;  2BH2 A;  4DAY A;  1TII D;  4LWC A;  2UXB Q;  2NWG A;  2A73 B;  5IOC A;  1KC8 C;  1PV4 A;  3NWS A;  3HOV G;  1MSH A;  3K7A B;  2JA6 G;  4WJW A;  2HQL A;  3LNN A;  5DNF A;  1EY7 A;  4FNF A;  1V1P A;  4KI0 A;  4IO9 A;  1EL0 A;  3RR5 A;  1D7Q A;  1JIC A;  4OXP A;  5T1G A;  2K5V A;  3SR1 A;  4RWS C;  3KJO A;  3CQZ B;  4B3S L;  3HOW G;  5C4X H;  2NBF A;  2EJM A;  2EYO A;  4X3U A;  3CMA A;  4IUU A;  5IGE A;  2OWO A;  2UXC L;  5JEA G;  3PIP A;  1FGU A;  1GHJ A;  1AH9 A;  5M5W B;  1TWH B;  3HOX B;  4RH6 A;  3CXC A;  1NMG A;  5C3E B;  4AYB E;  3BDO A;  4R8N A;  1WVL A;  2OQK A;  2K28 A;  5BN5 A;  1IYV A;  4MTK A;  3F2C A;  3PO2 H;  2D5D A;  2NVY B;  4DNI A;  2Z9H A;  4JI2 L;  5JEA J;  1S5E D;  4B3R L;  1STH A;  2L11 A;  2XVS A;  2F0V A;  3HOY G;  2JA5 B;  4DAM A;  1RIP A;  4A3G H;  2HCC A;  3MC0 B;  1STY A;  5E4X A;  3NTI A;  3CF5 A;  4JI0 L;  4QY7 A;  1NJI C;  4X3S A;  1AP0 A;  1BOS A;  2ID0 A;  5KYI A;  3PUZ A;  1QZG A;  4JI1 Q;  4DV5 L;  3J7A V;  1J9O A;  1U5K A;  5C0X I;  4GKK L;  1KDB A;  4GOP C;  1JCK B;  2JYO A;  1GVP A;  2JEB I;  5BN3 A;  2I07 B;  2F3W A;  2WII B;  2JQO A;  1Q3L A;  1DYQ A;  1ICW A;  1M4V A;  1PTO B;  4RKL A;  2EJF C;  2R7F A;  2VB2 X;  1WCM H;  4DR2 Q;  2K14 A;  1PRT B;  2D0P A;  3T13 A;  1TS4 A;  4OO1 G;  1IXR A;  1WTP A;  2ZXP A;  1SNM A;  2EYM A;  5K5P A;  1UUP A;  1AE3 A;  1WYD A;  3I4M B;  3CP0 A;  1NNX A;  3R2I A;  2CHB D;  1GO3 E;  1FYC A;  4S3S A;  1I3Q B;  4H0L C;  3KLS A;  1KLU D;  2A5H A;  4PNY A;  2F0M A;  3M4Q A;  3K59 A;  4LF5 Q;  5I6Y A;  2FJ2 A;  1O7L A;  2XWB B;  4A3F H;  5CMD A;  4HJ8 A;  5DM6 3;  2BCO A;  3E0J A;  1E1T A;  4FXK C;  4K8J A;  3NEM A;  1I4R A;  4PMW A;  4B3M Q;  1STE A;  2R7D A;  3RZD H;  4C3I H;  4KD3 A;  2F0F A;  4DF7 A;  1WTV A;  4ZUJ A;  2K7V A;  1J5E Q;  3OWE B;  3NWT A;  5JJK A;  3PGZ A;  2D62 A;  1HNX L;  2F0G A;  1RCV D;  5FLM H;  2RHQ B;  5C4J B;  4IOC A;  4TKO B;  4DUY L;  1U4P A;  3L9A X;  3RN2 A;  2OQ0 A;  1E1O A;  1IYJ B;  1X3G A;  1V9P A;  4CKB A;  2R7Z G;  1E24 A;  2B2V A;  3M4O B;  1WJJ A;  1K3B C;  1A3T A;  2KCT A;  4BS9 A;  1BNZ A;  3MTS A;  2BDN A;  2FMC A;  5IYC H;  2OF1 A;  3JAM i;  3QOL A;  2E2I H;  3VR4 A;  1MJC A;  1AFP A;  1JR0 D;  1EWI A;  1HPC A;  1FL0 A;  1JT8 A;  1MD2 D;  1C48 A;  5G3L D;  3P7J A;  4BBR G;  5IY0 A;  1CKM A;  1EY9 A;  4KLK A;  4WFN 3;  4HSV A;  2DNC A;  4AH6 A;  3GTG H;  2F0I A;  3FDT A;  1A0I A;  1JJ2 A;  2Q8T A;  1ML0 D;  3HOZ G;  1I4P A;  2F0U A;  4WJ3 M;  2NZH A;  1KDC A;  1PVO A;  4B9X A;  5LMU L;  2MGS A;  2I46 A;  1K8A C;  5C5M A;  5LHY 1;  2HCI A;  2EY1 A;  4A3K H;  3EBE A;  2E5L L;  3GTK H;  4X6A H;  1TWG H;  1X3P A;  1B3A A;  4QGU A;  2XTI A;  3J80 i;  1TY2 A;  1G6P A;  3CCR A;  4JVZ A;  1QG7 A;  1BDO A;  1TXY A;  1B2T A;  1ZYR D;  4FF1 A;  2NYZ D;  3VR2 A;  2BA1 A;  4HJA A;  1VQC A;  1KRS A;  1B53 A;  2NB0 A;  1MI2 A;  1WOC A;  3GV6 A;  1F9S A;  3HRZ C;  1V1O A;  3F1Z A;  3CCM A;  1XJV A;  4OWT B;  4DXF A;  1MKH A;  1CK1 A;  4DR4 L;  2B2T C;  4IFD G;  1PFB A;  2K04 A;  1GXD C;  1TU2 B;  1B1Z A;  1SDF A;  1PTO D;  4KHZ A;  3NK9 A;  4BXX G;  4KHP Q;  3GP7 A;  2P5Z X;  3K7A H;  1VCI A;  4K5X A;  4HMI A;  1PRT D;  1RTO A;  4FYD A;  4DR6 Q;  4LAA A;  2NTS A;  1PH1 A;  3K57 A;  2CCZ A;  1XMQ Q;  3NQT A;  2R7Z B;  1SYD A;  2QKI C;  1ZYR C;  1UEB A;  3S2D B;  4TQU S;  4G7Z C;  2LS0 1;  2MO0 A;  4JBM A;  1F9P A;  1O80 A;  1OXV A;  2VUM G;  1IYU A;  5IT9 E;  4A93 H;  4IFD J;  1LT3 D;  2DUD A;  2Y0S B;  3HOU B;  5M5W H;  1TWH H;  3HOX H;  3FRP B;  4RG1 A;  4DFA A;  1B70 B;  2E76 C;  2RVL A;  2Z4H A;  1HXY D;  3S24 A;  5E3F A;  4DV2 Q;  3SK6 A;  3EQL C;  3GO5 A;  1EU3 A;  3EJI A;  4LFB Q;  1STG A;  4DNT B;  2HD3 A;  3C3L A;  3KF8 B;  4KKT A;  1VS0 A;  5D65 A;  1PRT C;  2NVY H;  4CDE C;  2ZM6 L;  4A3J G;  3OHX C;  4APV A;  4E6I A;  2TMP A;  1LM0 A;  2QIL A;  3Q24 A;  2UUC L;  3W3A A;  3H0G H;  4O1N A;  4JI5 Q;  1RKN A;  1Y1V G;  5HY6 A;  1TY0 A;  3K5N A;  4X66 L;  3GTM B;  5C4X G;  1BF4 A;  2NVT B;  4A3L H;  5EPJ A;  1U4M A;  4GLV B;  2RCN A;  1XTC D;  4UP7 A;  2XRQ D;  3MFG A;  4ALP A;  2X6L A;  1X55 A;  1ROD A;  2M9V A;  1TQO A;  5CC4 A;  3U58 A;  3ND9 A;  1EUJ A;  5E4W C;  4TVA B;  5FJ8 H;  1Q8K A;  2Y0S E;  3ICE A;  4OO1 I;  1YEZ A;  3OSO A;  1Y8P B;  5A2Q L;  3L0O A;  4NP5 A;  5M5Y B;  3OMG A;  3UDI A;  2B63 B;  1XMO L;  3U4Z A;  1B9M A;  1BBW A;  3AMU A;  1PH5 A;  3F2U A;  3KJP A;  3UDG A;  5KIX A;  5EGT A;  1VQJ A;  2C9O A;  3QB3 A;  3AYH B;  4JI7 L;  2EYF A;  4A3G G;  1IBK Q;  2F0S A;  5CBA E;  2R6G A;  3I4M H;  1SYG A;  3STB D;  1CHQ D;  3J7Y W;  2CH4 W;  3M7N A;  4QCL A;  3RNU A;  5JEA H;  5ELE A;  1GOZ A;  4MHE A;  1I3Q H;  1SRO A;  3BDC A;  3CW2 C;  1C0A A;  1I6H B;  1KD1 C;  1H9S A;  2B8G A;  2E8G A;  1W6K A;  1GUO A;  4DV0 Q;  2VQF L;  3D4D A;  3RZO B;  1X65 A;  2EPB A;  1S3O A;  2ICE C;  2KEE A;  1BCP B;  4A3E G;  5FO8 B;  5CBE E;  3KUP A;  4HR7 B;  1K8G A;  3TP7 A;  4JCV E;  3M7G A;  4IJH A;  4A3J B;  1KNA A;  2D2C C;  1VQP A;  3Q6S A;  4IPH A;  3S1Q H;  1H9R A;  1I4Q A;  2VB3 X;  2Q2T A;  2PMZ E;  3HOY H;  4JOI C;  1M90 C;  1MHW C;  4KD4 A;  2A74 C;  1TWA H;  2ENB A;  4C3H G;  3CC2 A;  3A7L A;  1I94 L;  4DAP A;  3S1M B;  4P2C B;  1PFN A;  2E5L Q;  4LF8 L;  1HZC A;  1I50 B;  3FKI G;  1FJG Q;  3ZYY X;  4A3M B;  3D4R A;  5KRU A;  1W2B A;  5HGQ A;  4X64 Q;  3OIQ A;  4YIJ A;  3I3C A;  2JA8 B;  1Q86 C;  1YI2 A;  1EOT A;  1LYL A;  1VDZ A;  3MVV A;  4YCV A;  4A3F G;  2E2J B;  2AQ1 B;  3M3Y H;  3SHL A;  3KF6 B;  1JB3 A;  5CV4 A;  3I7F A;  3E6Z X;  3TDQ A;  2SEB D;  2UXB L;  3H09 A;  3X3M A;  2A1A A;  1SNQ A;  1H9K A;  3VA7 A;  1CI3 M;  2SDF A;  4XT3 B;  3D6C A;  1HNW Q;  2ZJQ A;  3RUZ A;  1HA5 A;  2WFW A;  4IPC A;  2KED A;  1VQH A;  1SJH D;  1EYD A;  5E1F A;  1F2Z A;  2MQH A;  2QGQ A;  4NW2 A;  2Z1C A;  4F7X A;  1LT4 D;  3P20 A;  3H15 A;  4POF A;  4DV1 Q;  1VQ6 A;  2CFM A;  4GS3 A;  1QUQ B;  3MXG A;  4RGM A;  1X3E A;  5IYC G;  3CD6 A;  3PO3 B;  4IOA A;  2I5H A;  2WAQ B;  1BO0 A;  4QB4 A;  2NN6 I;  3VR6 A;  3C2P A;  4RA8 A;  3K58 A;  3KBX A;  4HIO A;  1CFM A;  2AUK A;  2HIX A;  1ZEQ X;  2JK8 A;  2Z6B A;  4QIW B;  3NSW A;  4ODG A;  3OPO A;  5AFW A;  3H6M A;  4PV1 C;  5EBC A;  2Q8R E;  3A8J E;  3HZX A;  2ZM6 Q;  1JOQ A;  3E9H A;  1SSO A;  2I5L X;  3HKZ E;  3WDN A;  3UE0 A;  1Y69 U;  1NUC A;  1EQT A;  3F2D A;  2GVB A;  1HHV A;  1KDA A;  3UE1 A;  2R7Z H;  1JJC B;  4L8J A;  4P72 A;  3S2D H;  1D1K A;  5JJL A;  1EZ8 A;  2QW7 A;  2K1B A;  1PYW D;  4JI1 L;  3UI2 A;  3OYY A;  5EQ0 A;  1E2Z A;  5IIF A;  1U4R A;  4UAI A;  4DN4 M;  3HS0 C;  1J6Q A;  1JWU D;  2WB1 B;  3W5O A;  1TS2 A;  4AYB G;  2WAQ E;  5M3M B;  3FPP A;  4G4K A;  1GUN A;  5E7N A;  3BU2 A;  1BCP D;  1OO9 B;  2N8N A;  4QIW E;  4IUN A;  4X3T A;  4DR2 L;  4Q5V A;  1L0W A;  3RLF A;  2JSO A;  2KA7 A;  2K32 A;  2GN5 A;  3GTP B;  4R1J A;  3C1F A;  1TWF H;  3A56 A;  3PIP 3;  2KOL A;  4LFC Q;  1EIH A;  3SEB A;  3V2T A;  1Z9F A;  4N8X 1;  2J4X A;  5I4D A;  1XPO A;  4LF5 L;  3E9I A;  4A4I A;  4J6H A;  4QUF A;  1IBM Q;  1FR3 A;  4F8M A;  1G51 A;  1SND A;  2B2Y C;  5FLX c;  1BCP C;  1BQQ T;  4CJ2 C;  2G5D A;  4C56 C;  1CSP A;  4OEL B;  4DR7 Q;  5M5X B;  3MXN B;  5C3E G;  4B3M L;  2F52 A;  5M5Y H;  2XWJ B;  2BE5 C;  2B63 H;  1SYC A;  1KAA A;  2K33 A;  4QL5 A;  3CU7 A;  1YHA A;  1KTK A;  3J81 j;  3MHB A;  4FVM A;  4UDU C;  5CV9 A;  1J5E L;  4IFD H;  4UP9 A;  4HTH A;  1PH9 A;  2IL8 A;  5C3X A;  4BXX H;  1T5X D;  3MZ5 A;  4LUZ A;  3GTQ H;  4FF3 A;  4DK3 C;  5JPM C;  3L2P A;  2JA5 G;  4RHS A;  5EPL A;  1GD7 A;  1P8L A;  2D0O A;  4V0B A;  4ULL A;  3C46 A;  4OWW B;  3S15 B;  2PI2 E;  1HA6 A;  1PHJ A;  2CKZ B;  1L1O A;  1MBY A;  2YTV A;  2VUM H;  4F87 A;  2ZT9 C;  3NXW A;  4YY3 Q;  2Q8I B;  3RZO H;  1WTQ A;  2R93 B;  3KOJ A;  1IBL Q;  4GOP A;  4WRD A;  2NTT A;  3BS1 A;  2R92 B;  4XQJ A;  5C44 B;  3M85 A;  3L7Z C;  1EZ6 A;  3I2Z A;  3PUY A;  2K5W A;  1E7Z A;  1LUZ A;  3V96 A;  1K9M C;  2F0T A;  1SMX A;  4A3J H;  4RKB A;  1V43 A;  1PYS B;  3HGB A;  1JMC A;  5JOB A;  1ZKO A;  1Q81 C;  4A3I B;  4LUO A;  1ENC A;  2HHH Q;  4GZY C;  2EE1 A;  4R4C A;  4LF6 Q;  4DUZ Q;  4M1U B;  2PCF B;  3MEF A;  1VF5 C;  1K83 H;  1Y1V H;  3I4M G;  3S1M H;  1CSQ A;  5A2Q E;  4GNX B;  3OW2 A;  1VQB A;  1HUM A;  1DON A;  2V1C C;  2K75 A;  2SNS A;  1BR9 A;  3IL8 A;  4IQZ A;  1K0R A;  1BVS A;  1S5D D;  4BWG B;  2E2J H;  3NEN A;  1YVC A;  3NP8 A;  4KJO A;  1XX8 A;  4YCW A;  2B29 A;  3BVM A;  3ONA B;  1B8A A;  4KHP L;  3GTO H;  1KIX A;  1SN8 A;  3D0F A;  1Q1B A;  1SLJ A;  1PH8 A;  4DR6 L;  1QE6 A;  3H3V C;  4KJN A;  1Q82 C;  1XMQ L;  1TT2 A;  3CPF A;  3MWY W;  1D1I A;  4FO2 A;  1B7Y B;  2VY3 A;  4O2D A;  1L1O C;  2VL6 A;  3P1H A;  3T1H Q;  2F4V Q;  1PH2 A;  3EN2 A;  1TS3 A;  3KK7 A;  5COY A;  1NY4 A;  1WTR A;  3A5Z B;  2FIN B;  4K0K Q;  2H1E A;  4DV2 L;  2DY8 A;  4NPS A;  1RTN A;  3QWN A;  4RGT A;  4LFB L;  3BYY B;  1XPU A;  4G7O C;  4HJ5 A;  1LLR D;  4A3E H;  3TQY A;  3AU7 A;  4EQ5 A;  1G91 A;  5CYU A;  5DEH A;  2K6A A;  4B3T Q;  3ERO A;  2PYK A;  5CV7 A;  4C3J B;  1YIJ A;  3F2B A;  4A3D G;  4I65 A;  1VQ8 A;  4JI5 L;  2E75 C;  1YBY A;  4C3H H;  2UXD Q;  1HRJ A;  4CKE A;  1BUV T;  1HZA A;  4GN5 A;  3TSS A;  3H3V H;  4JW0 A;  1HTL D;  1SEB D;  3OTO Q;  1CQF A;  3KDF B;  2H5X A;  3FKI H;  5G3L F;  1EOV A;  1FNV A;  4FXG C;  2QEX A;  3U50 C;  2KUM A;  1XPR A;  4CKC A;  4IPD A;  3SK4 A;  2HIV A;  1DCZ A;  1A3U A;  1HH2 P;  1PH3 A;  2F0W A;  2EOT A;  2YYZ A;  1L0Y B;  4OON A;  5C6A A;  3VYU A;  1LO5 D;  4K5W A;  4KTA A;  4DPG A;  2ZTD A;  2MFI A;  1SRU A;  2RDH A;  4ZQ3 A;  1YHQ A;  4LFA L;  3A8I E;  3J7Z C;  5JVG 3;  1QNK A;  2QEJ C;  2B2T A;  4DNR B;  1GJX A;  1Q46 A;  2RF4 A;  1IBK L;  2ZTC A;  2VS1 A;  3ER0 A;  1GUW A;  1L2F A;  1STA A;  1V8Q A;  4L5T A;  2WV6 D;  2OT2 A;  2C35 B;  5J3B A;  2JP1 A;  5EKL A;  5D14 A;  5LL6 S;  3T56 B;  3D3R A;  4DV0 L;  2UU9 Q;  3K8A A;  2Y0S G;  4HCE A;  3HOU G;  2Z8L A;  3IFD A;  4HJ7 A;  3RLO A;  1SFO B;  3CPW A;  1XTD A;  2I5M X;  3WWV A;  3S2H B;  1K73 C;  1WI5 A;  3TS2 A;  2ZJR A;  2SNM A;  1F9Q A;  1D6E C;  5J1Z A;  3CKI B;  4ABN A;  1XNQ Q;  4JBW A;  2F0O A;  1SXT A;  5C5L A;  4A3D B;  1LTL A;  3S14 H;  3DLL A;  1LTT D;  1X6O A;  2IPK D;  1YJ9 A;  2XRS D;  3VR3 A;  1LAB A;  4OX9 Q;  5GAE C;  2IT1 A;  2F3V A;  2O5I C;  1N9W A;  4NXN Q;  2B2U C;  4IUR A;  1VQ4 A;  4OIK A;  4GNX C;  3HP3 A;  4R8I A;  1FJG L;  3ULP A;  2G9D A;  3JAM L;  4X64 L;  4UHV A;  3I56 A;  3JC6 6;  1I4X A;  1SYF A;  3GTJ H;  2PW7 A;  2HT1 A;  3PUX A;  1X3Q A;  2VNU D;  5A35 A;  1K0S A;  2A69 D;  1X3F A;  1EY8 A;  3VYT A;  4Z9C B;  1JE4 A;  5NUC A;  5C44 H;  4JI6 L;  2JA7 G;  2KJX A;  2B63 G;  5CGK A;  1WD0 A;  3SGI A;  1OXS C;  2J7Z A;  1HNW L;  4OIJ A;  5LMN Q;  4KY7 A;  1VQD A;  1YNN D;  3QO2 A;  3J80 L;  5DM7 3;  2WP8 J;  1VMP A;  3A8K E;  3BVG A;  1O7Y A;  5IGF A;  2YU9 B;  3CQZ H;  5ELD A;  1N33 Q;  4ILW A;  4DR3 Q;  4DV1 L;  2NZ1 D;  2A69 C;  1QNU A;  2RQX A;  1XWE A;  1DGS A;  2IHE A;  5CV6 A;  4CHT B;  4LF9 Q;  1B4O A;  1SYE A;  3G48 A;  1NCV A;  2XSC A;  3I90 A;  4L5S A;  4LK1 C;  1TWC B;  1QIL A;  2UUA Q;  1VMC A;  1Q12 A;  3CAM A;  3D8G A;  5C3E H;  3KLR A;  3TS0 A;  2QCP X;  4KY6 A;  1PTO C;  1A63 A;  1OXT A;  3OIP A;  4DXG A;  4HED A;  3CCL A;  5K36 G;  4KN4 C;  2EY6 A;  2Z6K A;  5ELN A;  5IP9 G;  3T1Y Q;  3PUW A;  5T1I A;  1DM0 B;  2IWH A;  1RDP D;  3VYS A;  3NQI A;  5IT9 c;  3ND8 A;  2JA5 H;  2OXP A;  4JOI A;  3K6O A;  1A2T A;  1LTB D;  2Z4I A;  3TP6 A;  1PZI D;  4ZYS A;  3J81 E;  1O7I A; 
#chains in the Genus database with same CATH homology
 5I9O A;  5M9O A;  4KK7 A;  4XYO A;  3GV3 A;  4BY7 B;  1B44 D;  1EQV A;  2JA7 B;  1I4H A;  5EJW A;  3Q22 A;  5CR3 A;  1PTO H;  3NTH A;  1EU4 A;  2PMZ B;  4MN3 A;  1CZW A;  2E2D C;  3QG1 A;  4X3K A;  3I4L A;  2PZU A;  2FMM A;  4XXE A;  3S1N B;  5J22 A;  4RFB A;  2K01 A;  3GTL B;  1CA5 A;  4BA2 I;  1JWM D;  2RBM A;  3C1E A;  3BZD B;  1Q8I A;  2SOB A;  4Q0F A;  3KF8 A;  1U9R A;  2EYL A;  3IAY A;  1UEA B;  4XYQ A;  4IN3 A;  2DY7 A;  3EFX D;  2IJ0 A;  3I91 A;  1B9N A;  2KHS A;  3I72 A;  3S9W A;  2A6E D;  1EWH A;  5JAV A;  5EKI A;  1T5E A;  4MIU A;  2A6H D;  4PMB A;  1S5B D;  3D4W A;  2BDO A;  3K5M A;  4IUP A;  1SAP A;  1IKM A;  1RF2 D;  1CTM A;  1TR5 A;  3HEJ A;  2XIW A;  4Y7N B;  2RKS A;  2NVQ B;  3K5L A;  2PPB C;  2K05 A;  3HKZ B;  3V05 A;  2TSS A;  5KNC A;  2A6E C;  2F4I A;  4NDX A;  5LL6 X;  1E0B A;  1ET9 A;  2A6H C;  3PO2 B;  2XNA C;  4IFD I;  5ELC A;  2WIN B;  3X3N A;  4LMQ D;  1SE4 A;  2B2Y A;  4OHJ A;  1HFG A;  4ZK9 B;  4HAE A;  1G2T A;  2KEC A;  1IKL A;  1A2U A;  1PXU A;  2AWO A;  2O5J C;  1E2W A;  3DEO A;  1STB A;  1SMY D;  4OL7 A;  1H9J A;  3T51 B;  1FNU A;  3EVQ A;  3QOJ A;  4DU9 A;  2LKV A;  3K5O A;  2EYJ A;  1HQR D;  3A54 A;  5COR A;  4QUC A;  5ELF A;  3FVQ A;  2F0D A;  5KEE A;  2F0Q A;  1DOL A;  2DNE A;  4RGN A;  2F0N A;  2ZXO A;  5C0X G;  1W6J A;  1SNO A;  4U67 3;  3TN2 A;  2X6G A;  4N9P A;  1EEF D;  2KVM A;  4K6D A;  5CV8 A;  1SMY C;  3FPU B;  4KN7 C;  4QF4 A;  5DAU A;  4XQQ A;  1OXU A;  3JAM E;  1JOO A;  4KKU A;  4IUT A;  3P75 A;  1DOM A;  5C0X J;  1BBX C;  1STN A;  1DD2 A;  1EYC A;  4KMU C;  1DXM A;  1CT1 D;  3RZD B;  4C3I B;  1K8M A;  2F0L A;  1V1P B;  4ZRZ A;  2EZV A;  3J80 E;  1AZP A;  4DAV A;  2PO4 A;  1UAP A;  1ESF A;  2CW0 D;  3Q0A A;  1G8Z D;  1MGS A;  1QCB D;  1IW7 D;  1R9T B;  5CV5 A;  5F2D A;  5KYL A;  2R61 A;  4K2L A;  2K03 A;  3S1R B;  3NE5 B;  3MAQ A;  3I4N B;  1O78 A;  5FK9 C;  1SE2 A;  4ID6 A;  5KND A;  2JEA I;  1JQY D;  4FF2 A;  1X32 A;  5EBD A;  1ILQ A;  1C4Q A;  1D5M C;  4H44 C;  1MSG A;  3GTK B;  2CW0 C;  1TWG B;  5K36 H;  4BY1 B;  3IFT A;  2PQE A;  3KBG A;  1F2L A;  3A7A B;  5C4H A;  3R8B A;  2F0E A;  4C3J G;  2EYH A;  3DEP A;  4NMZ A;  1SBB B;  3TZD A;  1WTW A;  3SE0 A;  1WTO A;  2GA4 B;  1F2M A;  4C2M B;  1IL8 A;  1PZK D;  1ILP A;  3MXN A;  1CHP D;  4LJZ C;  1SNC A;  2EDG A;  3DWA A;  4KV6 A;  3S17 B;  1LTS D;  3BVZ A;  1ENA A;  1LT6 D;  1UNS A;  1JC7 A;  1HQM C;  3DMU A;  4A93 B;  5C3W A;  2PZW A;  2K5D A;  2B2W C;  1Z6H A;  1E2V A;  1F2Y A;  1ET6 A;  3SXH A;  4IZ8 A;  1JOK A;  2F0P A;  2L9H A;  4I7Z C;  1S4Z A;  1IHZ A;  4BBS B;  3U9O A;  3LWE A;  4NKL A;  1GUG A;  3TP8 A;  1H9M A;  2NVX B;  4O42 A;  1FGB D;  2HDM A;  4HCS A;  3H0G B;  4DA2 A;  5EKK A;  2LMC B;  2K5Q A;  5FO7 B;  1LAC A;  1TKW B;  3U9S A;  1Y8O B;  3WOF A;  4XIG S;  2X69 A;  2G9H D;  3TME A;  4KY5 A;  4A3B B;  5M3F B;  1DOK A;  4K14 A;  2CQA A;  4HN7 A;  2M2L A;  2HQE A;  5I9P A;  3MA2 B;  2B2U A;  2IX0 A;  2N55 A;  2F03 A;  1NSN S;  5ISR A;  3IKJ A;  5D3D A;  3CRK C;  3T4A C;  2O2L D;  5I2Y A;  5JJZ A;  2E2H B;  2L55 A;  3HOV B;  3R2T A;  1TVX A;  2JA6 B;  2B39 A;  1I6V C;  4XTC S;  3R93 A;  2LFN A;  5FO9 B;  1PZJ D;  1PDQ A;  3HOW B;  4L63 B;  4XQN A;  3VA5 A;  1ENF A;  4L6T B;  4FXD A;  4CJ0 B;  3OMC A;  4DGZ A;  3EA6 A;  2KCC A;  1ONL A;  1CZG A;  1RJT A;  1FD7 D;  1I4G A;  2MUY A;  1ESR A;  2V4D A;  4PMC A;  1EY6 A;  3LX0 A;  4CBV A;  1LTG D;  3S1Q B;  1NAP A;  4XT1 B;  2DN8 A;  3HOY B;  1PTO F;  1TWA B;  3MEH A;  1JOR A;  1B50 A;  1RHP A;  1PRT F;  3NHH A;  2QF7 A;  2WAC A;  1M8A A;  1O7Z A;  5EPK A;  2EVB A;  3TBI B;  3E5S A;  1VF7 A;  1Y1W B;  2OEO A;  2AQ2 B;  1G6Z A;  2O4X A;  2PZT A;  3M3Y B;  4EVO A;  1R4Q B;  2PW5 A;  3D6W A;  2IX1 A;  4BA1 I;  1EFI D;  2KCN A;  4C1N I;  5TSS A;  3A55 A;  3URY A;  2AWN A;  3W2D A;  5C0X H;  2WKC A;  2RSN A;  1CM9 A;  2EYP A;  1EY4 A;  2VXW A;  3NPP A;  4PQX A;  5FLX L;  3DXJ C;  3CHB D;  4CJ1 B;  4K8I A;  1F9R A;  1QWY A;  3G7L A;  1NR4 A;  3CRL C;  2XN9 C;  2JXM B;  2L0C A;  3BG3 A;  4FP5 D;  3NUC A;  3OWF A;  3GD7 A;  4QMG A;  5C4Z A;  1GUT A;  4OGQ C;  3RMH A;  4RHR A;  1CQV A;  2NN6 G;  3QJY A;  4B9W A;  2AQ3 B;  3KLS X;  3SK5 A;  5HGT A;  4TSS A;  5BN4 A;  2KQ3 A;  2E74 C;  2R3Z A;  4ME5 A;  2B2V C;  4G57 A;  2A68 D;  2JE6 I;  3M4Y A;  1YNN C;  2MPM A;  2C5C A;  4G7H C;  3PV0 A;  1H9S B;  3MXU A;  2IW3 A;  2RA4 A;  1WD1 A;  1SNP A;  4IUV A;  4BBR B;  3DWP A;  2L1B A;  3WOE A;  3S16 B;  1KAB A;  1YNJ D;  3HOZ B;  2AUJ D;  1GUS A;  3AB9 A;  2A68 C;  4RCN A;  1LV9 A;  1TWF B;  4V19 0;  5JVH 3;  1AN8 A;  4ZAI A;  2MP1 A;  3SK8 A;  4ZLT F;  3MFY A;  3DHQ A;  1A3V A;  1Z47 A;  4DK0 A;  5IOD A;  5KNB A;  1A15 A;  5IGC A;  1ZXT A;  5KGU A;  1YNJ C;  2L5T A;  2CVR A;  3O13 A;  1EWC A;  1KNE A;  1DJR D;  2WKD A;  4EQN A;  1U4L A;  1J8I A;  1SJE D;  1II3 A;  3NBI A;  3GTQ B;  3Q23 A;  1BXT A;  2L12 A;  3R3O A;  4ZKB B;  1HTP A;  1TS5 A;  2MHV A;  1SYB A;  2VUM B;  1QB5 D;  3BYT B;  4K5V A;  5HUR A;  1RD9 D;  2QDB A;  1R4P B;  4M8A A;  2EJG C;  1G2S A;  2F1M A;  1XXG A;  3DM1 A;  1K8O A;  2F0H A;  2MJ8 A;  5I6W A;  3I8Z A;  1OXX K;  1HCZ A;  2RDG A;  4N9T A;  1LTI D;  1K83 B;  1Y1V B;  1D5Z C;  2EXZ A;  5C4X B;  1C8C A;  3T16 A;  4K2K A;  1Z7T A;  2FFK B;  3HG9 A;  1LTA D;  2ZXR A;  1EY0 A;  4XDX A;  1S5C D;  4B08 A;  3MXP A;  5FOB B;  3N52 A;  1XYI A;  1LT5 D;  1D5X C;  4IUQ A;  2FHT A;  4C1N K;  2HDL A;  4HMJ A;  4RAU C;  3PUV A;  2PNR C;  4C3I G;  1EYA A;  1BCP F;  1Q90 A;  3GTO B;  2B8F A;  3I70 A;  1DZ1 A;  1AZQ A;  2M00 A;  2BOS A;  3N6R A;  4OO1 H;  1A6X A;  4A3G B;  2F0J A;  2ICI A;  3T53 B;  1NR2 A;  4TRD A;  3L3O C;  1CA6 A;  1S5F D;  1LTR D;  3H91 A;  1Y8N B;  5IGB A;  3J7A F;  4J8Q A;  1EIG A;  3K0Y A;  4A3E B;  3DWQ A;  4F88 A;  2J0T D;  2RDF A;  1FNW A;  1JWS D;  1D2B A;  4FF4 A;  3TP5 A;  2BA0 A;  5IGD A;  1WCM B;  1AW7 A;  3SDZ A;  4KHV A;  1QJO A;  1G29 1;  3PMF A;  4C3H B;  5I2X A;  3RD4 A;  4KKS A;  3TZU A;  2N88 A;  2HUG A;  3FKI B;  3VYR A;  3ITP A;  4DK1 A;  1Q1E A;  3I73 A;  2H4O A;  3FEW X;  3LWU A;  1AEX A;  4A3F B;  2L4N A;  5D3I B;  1F77 A;  5J39 A;  4ZUI A;  1QOH A;  2D9U A;  2NUC A;  1L0X B;  4EGV A;  2BE5 D;  5FLX E;  4CGY B;  3D31 A;  3ERQ A;  3OOC A;  4IAL A;  1GHK A;  2IX3 A;  2EY5 A;  3SVM A;  1PMR A;  1HFN A;  1HUN A;  3QIA A;  1PLF A;  2E2I B;  3G6J B;  3FMC A;  2LY7 A;  3NTK A;  4H7B A;  2B2W A;  1EEI D;  4U68 A;  4K6L A;  3GTG B;  5IT9 L;  2RSO A;  3VR5 A;  2EY2 A;  4JK1 C;  2NN6 H;  5IGG A;  3S14 B;  4R9W A;  3PIO 3;  5ELB A;  4WOR A;  1KLG D;  3NBH A;  4ZKC B;  4A3K B;  4J1M A;  1EY5 A;  3GTJ B;  1IW7 C;  3GQB A;  2F0K A;  1SE3 A;  4RCO A;  3H94 A;  4HSP A;  3DUZ A;  4RGO S;  5FKA C;  4AYB B;  4EQO A;  3BDL A;  3OW7 A;  4EQP A;  3J81 L;  1WTX A;  5JPN C;  1PFM A;  4H13 C;  4DAY A;  1TII D;  2NWG A;  2A73 B;  5IOC A;  3NWS A;  1MSH A;  3K7A B;  4WJW A;  3LNN A;  5DNF A;  1EY7 A;  4FNF A;  1V1P A;  4KI0 A;  1EL0 A;  1JIC A;  5T1G A;  3SR1 A;  4RWS C;  3CQZ B;  2NBF A;  2EJM A;  2EYO A;  4X3U A;  4IUU A;  5IGE A;  5JEA G;  1GHJ A;  5M5W B;  1TWH B;  3HOX B;  4RH6 A;  5C3E B;  3BDO A;  4R8N A;  1WVL A;  2K28 A;  5BN5 A;  1IYV A;  2D5D A;  2NVY B;  5JEA J;  1S5E D;  1STH A;  2L11 A;  2XVS A;  2F0V A;  2JA5 B;  2HCC A;  3MC0 B;  1STY A;  5E4X A;  3NTI A;  4X3S A;  1AP0 A;  1BOS A;  2ID0 A;  5KYI A;  3PUZ A;  3J7A V;  1J9O A;  5C0X I;  1KDB A;  1JCK B;  2JYO A;  2JEB I;  5BN3 A;  2I07 B;  2F3W A;  2WII B;  1Q3L A;  1DYQ A;  1ICW A;  1M4V A;  1PTO B;  4RKL A;  2EJF C;  2VB2 X;  1PRT B;  3T13 A;  1TS4 A;  4OO1 G;  1WTP A;  2ZXP A;  1SNM A;  2EYM A;  5K5P A;  1UUP A;  3I4M B;  3R2I A;  2CHB D;  1FYC A;  4S3S A;  1I3Q B;  4H0L C;  3KLS A;  1KLU D;  2A5H A;  4PNY A;  2F0M A;  3K59 A;  5I6Y A;  2FJ2 A;  1O7L A;  2XWB B;  5CMD A;  5DM6 3;  2BCO A;  3E0J A;  4FXK C;  4K8J A;  1I4R A;  4PMW A;  1STE A;  4KD3 A;  2F0F A;  4DF7 A;  1WTV A;  4ZUJ A;  2K7V A;  3OWE B;  3NWT A;  2D62 A;  2F0G A;  1RCV D;  5C4J B;  4TKO B;  1U4P A;  3L9A X;  4CKB A;  3M4O B;  2B2V A;  1A3T A;  4BS9 A;  1BNZ A;  3MTS A;  2BDN A;  2FMC A;  2OF1 A;  3QOL A;  3VR4 A;  1AFP A;  1JR0 D;  1HPC A;  1MD2 D;  1C48 A;  5G3L D;  3P7J A;  1EY9 A;  4WFN 3;  4HSV A;  2DNC A;  2F0I A;  3FDT A;  2Q8T A;  1ML0 D;  1I4P A;  2F0U A;  1KDC A;  4B9X A;  2MGS A;  2I46 A;  5C5M A;  5LHY 1;  2HCI A;  2EY1 A;  1X3P A;  1B3A A;  1TY2 A;  1QG7 A;  1BDO A;  1B2T A;  1ZYR D;  4FF1 A;  2NYZ D;  3VR2 A;  2BA1 A;  1B53 A;  2NB0 A;  1MI2 A;  3GV6 A;  1F9S A;  3HRZ C;  1V1O A;  4DXF A;  1CK1 A;  2B2T C;  4IFD G;  1PFB A;  2K04 A;  1GXD C;  1TU2 B;  1B1Z A;  1SDF A;  1PTO D;  4KHZ A;  3NK9 A;  3GP7 A;  1VCI A;  4K5X A;  4HMI A;  1PRT D;  1RTO A;  4FYD A;  4LAA A;  2NTS A;  3K57 A;  3NQT A;  2R7Z B;  1SYD A;  2QKI C;  1ZYR C;  3S2D B;  4TQU S;  4G7Z C;  2LS0 1;  1F9P A;  1O80 A;  1OXV A;  1IYU A;  5IT9 E;  4IFD J;  1LT3 D;  2Y0S B;  3HOU B;  3FRP B;  4DFA A;  2RVL A;  2E76 C;  2Z4H A;  1HXY D;  5E3F A;  3SK6 A;  3EQL C;  3GO5 A;  1EU3 A;  3EJI A;  1STG A;  4DNT B;  3C3L A;  4KKT A;  5D65 A;  1PRT C;  3OHX C;  4E6I A;  2TMP A;  2QIL A;  3Q24 A;  3W3A A;  4O1N A;  1RKN A;  3GTM B;  1TY0 A;  3K5N A;  1BF4 A;  2NVT B;  5EPJ A;  1U4M A;  1XTC D;  2XRQ D;  3MFG A;  2X6L A;  1ROD A;  2M9V A;  1TQO A;  5CC4 A;  3ND9 A;  5E4W C;  4OO1 I;  3OSO A;  1Y8P B;  5A2Q L;  4NP5 A;  5M5Y B;  3OMG A;  2B63 B;  1B9M A;  3AMU A;  3F2U A;  5KIX A;  5EGT A;  2C9O A;  3QB3 A;  2EYF A;  2F0S A;  5CBA E;  2R6G A;  1SYG A;  1CHQ D;  3J7Y W;  3M7N A;  4QCL A;  5JEA H;  5ELE A;  1GOZ A;  4MHE A;  3BDC A;  1I6H B;  1H9S A;  2B8G A;  1W6K A;  1GUO A;  3D4D A;  3RZO B;  2EPB A;  2ICE C;  2KEE A;  1BCP B;  5FO8 B;  5CBE E;  3KUP A;  4HR7 B;  3TP7 A;  3M7G A;  4A3J B;  1KNA A;  2D2C C;  3Q6S A;  1H9R A;  1I4Q A;  2VB3 X;  4KD4 A;  2A74 C;  2ENB A;  4C3H G;  3A7L A;  4DAP A;  3S1M B;  4P2C B;  1PFN A;  1I50 B;  3ZYY X;  4A3M B;  3D4R A;  5KRU A;  3OIQ A;  4YIJ A;  3I3C A;  2JA8 B;  1EOT A;  1VDZ A;  3MVV A;  2E2J B;  2AQ1 B;  3SHL A;  1JB3 A;  5CV4 A;  3E6Z X;  3TDQ A;  2SEB D;  3H09 A;  3X3M A;  1SNQ A;  1H9K A;  3VA7 A;  1CI3 M;  2SDF A;  4XT3 B;  3D6C A;  3RUZ A;  1HA5 A;  2KED A;  1SJH D;  1EYD A;  5E1F A;  1F2Z A;  4NW2 A;  2Z1C A;  4F7X A;  1LT4 D;  3P20 A;  3MXG A;  4RGM A;  3PO3 B;  2WAQ B;  1BO0 A;  4QB4 A;  2NN6 I;  3VR6 A;  3C2P A;  4RA8 A;  3K58 A;  3KBX A;  1CFM A;  2AUK A;  1ZEQ X;  4QIW B;  3NSW A;  4ODG A;  3OPO A;  5AFW A;  3H6M A;  4PV1 C;  5EBC A;  2Q8R E;  3A8J E;  3HZX A;  1JOQ A;  1SSO A;  3WDN A;  1Y69 U;  1NUC A;  1EQT A;  1HHV A;  1KDA A;  4L8J A;  1D1K A;  1EZ8 A;  2K1B A;  1PYW D;  3UI2 A;  5EQ0 A;  1E2Z A;  5IIF A;  1U4R A;  4UAI A;  4DN4 M;  3HS0 C;  1JWU D;  2WB1 B;  1TS2 A;  5M3M B;  3FPP A;  4G4K A;  1GUN A;  1BCP D;  1OO9 B;  4IUN A;  4X3T A;  4Q5V A;  3RLF A;  2JSO A;  2KA7 A;  2K32 A;  3GTP B;  3C1F A;  3A56 A;  3PIP 3;  2KOL A;  1EIH A;  3SEB A;  3V2T A;  2J4X A;  5I4D A;  4J6H A;  4QUF A;  1FR3 A;  4F8M A;  1SND A;  2B2Y C;  1BCP C;  1BQQ T;  4CJ2 C;  4C56 C;  5M5X B;  2XWJ B;  2BE5 C;  1SYC A;  1KAA A;  2K33 A;  3CU7 A;  1KTK A;  3MHB A;  4FVM A;  4UDU C;  5CV9 A;  4IFD H;  4HTH A;  2IL8 A;  5C3X A;  1T5X D;  3MZ5 A;  4FF3 A;  5JPM C;  4RHS A;  5EPL A;  4V0B A;  4ULL A;  3C46 A;  3S15 B;  1HA6 A;  1MBY A;  4F87 A;  2ZT9 C;  3NXW A;  2Q8I B;  1WTQ A;  2R93 B;  4WRD A;  2NTT A;  3BS1 A;  2R92 B;  4XQJ A;  5C44 B;  3M85 A;  3L7Z C;  1EZ6 A;  3PUY A;  2K5W A;  3V96 A;  2F0T A;  4RKB A;  1V43 A;  3HGB A;  5JOB A;  1ZKO A;  4A3I B;  4GZY C;  1ENC A;  2EE1 A;  4M1U B;  2PCF B;  1VF5 C;  5A2Q E;  1DON A;  1HUM A;  2SNS A;  1BR9 A;  3IL8 A;  4IQZ A;  1S5D D;  4BWG B;  3NP8 A;  4KJO A;  1XX8 A;  3BVM A;  3ONA B;  1Q1B A;  1QE6 A;  3H3V C;  4KJN A;  1TT2 A;  3MWY W;  1D1I A;  4FO2 A;  3P1H A;  1TS3 A;  3KK7 A;  5COY A;  1WTR A;  2FIN B;  2H1E A;  2DY8 A;  1RTN A;  3QWN A;  4RGT A;  3BYY B;  4G7O C;  1LLR D;  3AU7 A;  1G91 A;  5CYU A;  5DEH A;  2K6A A;  3ERO A;  2PYK A;  5CV7 A;  4C3J B;  4I65 A;  2E75 C;  1HRJ A;  4CKE A;  1BUV T;  3TSS A;  1HTL D;  1SEB D;  1CQF A;  5G3L F;  1FNV A;  4FXG C;  2KUM A;  4CKC A;  3SK4 A;  1DCZ A;  1A3U A;  2F0W A;  2EOT A;  2YYZ A;  1L0Y B;  5C6A A;  3VYU A;  1LO5 D;  4K5W A;  4KTA A;  2RDH A;  4ZQ3 A;  3A8I E;  5JVG 3;  1QNK A;  2QEJ C;  2B2T A;  4DNR B;  1GJX A;  1GUW A;  1STA A;  1V8Q A;  2WV6 D;  2OT2 A;  2JP1 A;  5EKL A;  5D14 A;  5LL6 S;  3T56 B;  3D3R A;  4HCE A;  2Z8L A;  3IFD A;  1SFO B;  3S2H B;  2SNM A;  1F9Q A;  1D6E C;  5J1Z A;  3CKI B;  4ABN A;  4A3D B;  4JBW A;  2F0O A;  1SXT A;  5C5L A;  1LTT D;  2IPK D;  2XRS D;  3VR3 A;  1LAB A;  2IT1 A;  2F3V A;  2O5I C;  2B2U C;  4IUR A;  4OIK A;  3HP3 A;  4R8I A;  2G9D A;  3JAM L;  1I4X A;  1SYF A;  2PW7 A;  3PUX A;  1X3Q A;  2VNU D;  5A35 A;  2A69 D;  1EY8 A;  3VYT A;  4Z9C B;  1JE4 A;  5NUC A;  2KJX A;  5CGK A;  1WD0 A;  1OXS C;  2J7Z A;  4OIJ A;  4KY7 A;  1YNN D;  3QO2 A;  3J80 L;  5DM7 3;  2WP8 J;  1VMP A;  3A8K E;  3BVG A;  1O7Y A;  5IGF A;  2YU9 B;  5ELD A;  4ILW A;  2NZ1 D;  2A69 C;  1QNU A;  2RQX A;  1XWE A;  5CV6 A;  4CHT B;  1B4O A;  1SYE A;  1NCV A;  2XSC A;  3I90 A;  4LK1 C;  1TWC B;  1QIL A;  1VMC A;  1Q12 A;  3D8G A;  3KLR A;  2QCP X;  4KY6 A;  1PTO C;  1OXT A;  3OIP A;  4DXG A;  4HED A;  5K36 G;  4KN4 C;  2EY6 A;  3PUW A;  5T1I A;  1DM0 B;  2IWH A;  1RDP D;  3VYS A;  3NQI A;  3ND8 A;  2OXP A;  3K6O A;  1A2T A;  1LTB D;  2Z4I A;  3TP6 A;  1PZI D;  4ZYS A;  3J81 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...