1R4PB

Shiga toxin type 2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords shiga-like toxin type II A subunit
publication title Structure of Shiga Toxin Type 2 (Stx2) from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 22
structure length 70
sequence length 70
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2003-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1r4pB00
3MXGA 2C5CA 2GA4B 1CZWA 2XSCA 1CZGA 1C48A 4P2CB 1R4PB 1D1KA 1R4QB 1D1IA 1DM0B 1CQFA 1QOHA 2BOSA 1QNUA 4M1UB 1BOSA 1C4QA 4ULLA
chains in the Genus database with same CATH superfamily
2F0MA 2J4XA 1W2BA 4JI1Q 1K83H 4K2KA 2ICEC 2L4NA 2Z1CA 2VB2X 2B3GA 3HKZB 3LNNA 4OELB 1XNQQ 4KN4C 4LUZA 1QE6A 1EL0A 4FF1A 1I3QB 3BS1A 1SJHD 4Y7NH 1I6HH 2C35B 2ZTEA 1QUQA 1HTPA 4A3BB 4A3MG 4HJ9A 3G48A 4KD3A 3IFDA 4BBRB 5AFWA 4DR5Q 3I72A 3LWEA 4DR4L 4KHPQ 1FD7D 3S9WA 1PZKD 1KD1C 1VQ9A 3J81c 2NTTA 1PZID 4A3JB 1J6QA 2O5IC 1BUVT 4BY7B 4O1NA 3VA5A 4A3GB 4P71A 4XDXA 3WOFA 2KCMA 1QNUA 1O7IA 1KNAA 1N8RC 4IZ8A 3NBIA 4LF8Q 5E4XA 4DGZA 4JI4Q 3PIPA 2Q2IA 1PRTC 1AP0A 4IOCA 3CXCA 2B2YC 2K1BA 1EZ8A 4BXXG 3F2CA 3WWVA 3R2TA 4C2MB 1TWFH 4FF4A 4LJZC 1R9TB 1GKHA 4CKCA 3S14B 1F77A 1CKMA 1NBWA 3E0EA 4RAUC 5EPLA 3L3OC 1LUZA 3O13A 1JMCA 2B8GA 3CCSA 5CGKA 4GOPC 3S15H 5E1FA 2KBNA 2PZWA 3V2TA 1OO9B 5I6WA 2K03A 3LGJA 2GA4B 4YWKA 1QB5D 1MJCA 4C3HB 1WD1A 3G4SA 4QQBX 1WTQA 2TSSA 4KJOA 3PQIA 1U4MA 4P72A 4HMIA 3JC66 1PH9A 3ND9A 3HKZG 2VUMH 1EY7A 3CCQA 3NXWA 1OXUA 3KLSA 2EJFC 4FF2A 2O5JC 5GAGC 3S1QH 1AN8A 5JPNC 1XMQQ 2WAQE 4LUOA 1YJ9A 1SYBA 4KJNA 1O7YA 1T5EA 1TS2A 4QIWE 4GOPB 5M5YH 2RBMA 1EYCA 5FLMG 3KBGA 1E2VA 4A3BG 1IXRA 4BBRG 2XWBB 2QDBA 3A8KE 3HP3A 5C44B 3PIOA 2YTYA 5LMNQ 1EWIA 2EZVA 1BDOA 3P7JA 1N32Q 2CKZB 5T1IA 3D0FA 3HEJA 1WVLA 4BY7G 2NB0A 3NHHA 4HEDA 4H13C 1EOTA 4A3GG 4GN5A 3S24A 4L5TA 4N8FA 5JPMC 3JAME 2AQ3B 4L8JA 1O80A 1Y1VB 3EFXD 1SYGA 4GNXB 3VDYA 1WTPA 3H6MA 1XTCD 3GO5A 5EPKA 5IP7G 3DM1A 4RWSC 3BDOA 1QVFA 2BCOA 2X69A 3FPPA 3L2PA 4ULLA 4O42A 1PMRA 4AYBG 1MBYA 2SDFA 2B29A 1Q82C 4F87A 4OO1I 1FL0A 1FJGQ 3GTQB 2Z6BA 3H15A 2EY2A 3NBHA 4Y7NB 3CCJA 3M7NA 1I6HB 1XX8A 4ZRZA 2BA1A 2ENBA 5C0XJ 3SK4A 1I94Q 4NP5A 1WTRA 3VYTA 1W6KA 4DK1A 4ZYSA 5LL6S 3D4WA 5DEHA 2ZTDA 4OX9L 4JCVE 4C3HG 1HNWL 1F9RA 3F1ZA 3OWFA 4QL5A 5IGGA 4U673 1WCMG 1GXDC 1VQEA 1L2FA 1D2BA 1EFWA 1LV9A 1H9RA 2ICIA 1TXYA 1STHA 4K0KL 4LF7Q 3K57A 4IUUA 1MSGA 4KD4A 3HOXH 1VQBA 2NZOA 2CH4A 3PMFA 3HOYB 1J8IA 3PUWA 3SDZA 5DAUA 2F4IA 2HT1A 2G9DA 3Q0AA 4DV6Q 2B39A 5IT9E 1Z7TA 1CA5A 5FO9B 4JI2Q 1TWFB 3CCLA 3V05A 5IGBA 2E2DC 3E0JA 3I4LA 3A74A 4CKBA 2F0PA 2UUBQ 4ZKBB 2XRSD 2EYOA 2EYPA 4HSVA 3GTPH 2PW7A 3X3MA 3CMAA 3S15B 1ENCA 3MFYA 4IUQA 1J5EL 1KIXA 3PO2H 4CDEC 4K14A 1HUNA 2E5LQ 2BE5C 2A5HA 2R7ZG 4FP5D 4L6TB 4A93H 1GO3E 2WB1E 2JEBI 1SLJA 2L9HA 1EU4A 2Q8IB 2KVMA 5KEEA 1BXTA 3RNUA 1A2TA 2NWGA 3OSOA 2ZJQA 1NSNS 3A5UA 2QCPX 1TWGB 4KY5A 1PYSB 1HJPA 4OO1H 3K7UC 2ZTCA 2VUMB 1S3OA 1JC7A 2IT1A 4JI6L 4IPCA 2D9UA 4BS9A 2C5CA 4TQUS 4DR7Q 2AQ2B 4EQ5A 3U9OA 1GUWA 2L5TA 2A69C 1CKOA 4AQYL 2K14A 4YWMA 4WFN3 1YZ6A 1AZQA 3DEOA 2F1MA 4DR3L 2A68C 4G4KA 1Z9FA 2OEOA 2F0LA 1WOCA 2VB3X 4TVAB 1B3AA 3GTMB 2TMPA 1SFOH 1EIYB 1EU3A 2RSNA 2HIXA 3CD6A 4NXNQ 1VQPA 2F4VQ 4B3TQ 4WJ3M 1X3GA 4B9WA 3HOUH 3S2DB 5IT9c 3J81i 1ENFA 2MJ8A 1F2YA 2PQEA 4E6IA 1C7YA 2PW5A 4DR6Q 2VXWA 3H0GH 5EBCA 2K5QA 2VS1A 2VNUD 1PXUA 2UXBL 3RN5A 4JI0Q 3F2UA 4I7ZC 2UU9L 2RF4A 5CC4A 1IYJB 2UUCQ 2QGQA 4V190 1B70B 4GLXA 4LFBQ 1JT8A 4U68A 3ER0A 3P1HA 4DAYA 4HIKA 3A8IE 1TWAB 1CHPD 4O2DA 3VYSA 2ALYB 4RG1A 5BN5A 4PNYA 4RHRA 1B3QA 2MNAA 5IGEA 3VYRA 2PCFB 3KBXA 3T1YL 2F0SA 1VQ4A 2ZM6L 3HOWH 1HR0L 2JA5H 5IP9H 4CDDC 5HGTA 4V0BA 4OEMB 5IGDA 1B1ZA 3HOXB 5COYA 4K5XA 1AW7A 1XNRL 1JR0D 1XTDA 2OQKA 2NVQH 4A3IB 4M1UB 2VUMG 2RCNA 3KOJA 3RUZA 2IHFA 5LMUQ 2EY6A 4JI5Q 3M9BA 3J7AV 1D7QA 5FLXL 3UI2A 4XYQA 3A7LA 4FVMA 1CSPA 4J8QA 1BBXC 4UPAA 3MFGA 2EYFA 1STGA 3W1BA 1SN8A 4ILWA 1E1OA 3GTPB 3ICEA 4J15A 4K5WA 1OTCA 1L0YB 3PO2B 3J80c 2K5HA 2B2TC 1I50H 4IPHA 1L0XB 1KXLA 1A8VA 1CSQA 2WP8J 4IURA 3OTOQ 1KRTA 4DV7Q 1G6ZA 1PFNA 1MGSA 4A3IH 5M3FB 2AWOA 3DWAA 1PH2A 4PMCA 2QA4A 1NTGA 1Q8IA 1S5CD 2B2VA 2EE1A 1OXSC 2KJXA 2ZXPA 3HKSA 1IW7C 1DOLA 3I7FA 2F3IA 3KF8A 3PUVA 4X3UA 2K7VA 1FNVA 5IYDH 4B3SQ 3UDGA 4JV5Q 1GUSA 1E22A 2OXPA 2RQXA 1DZ1A 1KLGD 4IQZA 1VQMA 2WKDA 1Q7YC 3FKIB 1MSHA 3VYUA 3V96A 5C5MA 1JJGA 4CHTB 4DUZQ 4DV3Q 2XVSA 3BG3A 2N8NA 3Q22A 4HTHA 5FJ8H 5FO7B 3UE1A 2EJGC 2XIWA 1SFOB 3TRZA 4A3JH 2QKIC 4ZCKA 5C4ZA 1ZYRD 1MIUA 1PTOD 2MUYA 5AJ3Q 2Y0SB 3BZCA 2LS01 5J39A 1IYUA 1CT1D 4IFDJ 2K50A 5M9OA 2R93H 4DK3C 1SROA 4A3LH 1YNNC 4K6LA 2K5VA 2K5NA 2WAQB 3H0GB 4A3KH 1PH4A 2OCEA 3HOXG 1KQSA 4DUYL 2JA6B 3R93A 3GTGH 4QIWB 4PMWA 3S16H 2F0TA 1X32A 3S14H 3TS0A 4RCOA 1VS0A 1E3PA 5FO8B 4BBSH 1LO5D 2FMCA 3TEHB 3SK5A 4GLVB 1S5DD 5KYIA 4HAEA 4NPSA 4DKAC 3FP9A 2MPMA 2CQAA 1JOOA 2KUMA 5EKKA 1YNXA 3J81j 2F0HA 1ZYRC 3A54A 1PTOC 4HMJA 4NDXA 1HNZQ 3NK9A 3RZOH 4HIMA 1H9SB 1AZPA 1X54A 2LY7A 3KJOA 4XXEA 1M8AA 3RR5A 4DNTB 3PO2G 2SEBD 3K80C 1B4OA 1STBA 4A3EH 1Y14B 1UE1A 4K6DA 4A4IA 1I5FA 1KL9A 2CVRA 4IJHA 1JWUD 3FMCA 1LTAD 3CF5A 4A93G 5JVH3 2Z6KA 1A3TA 1PH8A 1TWCB 5EJWA 5C0XG 1MD2D 2CW0C 3PV0A 2B2VC 5M3FG 1Q8KA 3CPWA 2IX1A 4LF9Q 4RGMA 3A8JE 3S1RB 1KTKA 3KF6A 3PUXA 4HIOA 1SNCA 3BVMA 3Q23A 1ASZA 2GVAA 4OO1G 1Q1EA 5GADC 4LF6L 3FHWA 2RDHA 4DAMA 3AYHB 2RDGA 1S5FD 1RTOA 3U4ZA 4DR2L 4PQXA 4DV2Q 2LSSA 1K8OA 3M85A 3QB3A 4OGQC 4AIMA 1D6EC 1PH6A 1EWHA 2XTIA 1ZEQX 1BCPC 3CCVA 5C44H 3T1HQ 2RCFA 1G2TA 4QUCA 3I4MB 2DUDA 4JI1L 1L0WA 1N33Q 4R4OA 2Q8TA 1XNQL 1IBLQ 3ERQA 2R3ZA 2Y0SG 1I50B 1CQFA 4RMFA 4JBMA 1AEXA 5CORA 4R4TA 4IOAA 3HOUG 1IBKQ 5JJZA 1F9PA 1Y1VH 2SOBA 3D31A 2PO4A 5C3EH 3H0GG 1WI5A 1S72A 4Z9CB 3HG9A 4FYDA 1IZ6A 3KF8B 1O7LA 2Q2TA 4DR5L 2IHEA 3GTQH 1L1OA 4KHPL 2LKVA 2YTXA 2A74C 3Q8DA 1HHVA 2V1CC 3GQBA 3I70A 4JBJA 2RSOA 1ML0D 2OF1A 4N8X1 2N49A 2QILA 1WTWA 4APVA 4OONA 2DN8A 2ES2A 3ULPA 4QGUA 1S5BD 2JXMB 2AQ1B 1N9WA 1TQOA 2L0CA 4LF8L 4WJ4A 4JI4L 2I5HA 3IFTA 3PUZA 1YJNA 4OXPA 2EYJA 4QY7A 2Z6KC 4EQNA 5FOBB 4RHSA 3FVQA 1G8ZD 3E6ZX 3HOWG 4B3RQ 1Z6HA 3OPOA 2R93B 1B2TA 2JA5G 4DAVA 5IP9G 1LTGD 1WTHA 3KK7A 1B9NA 3HOYH 3RLNA 4OWWB 3URYA 2NVTH 4A3KB 4QB4A 1VQHA 1CHQD 2NUCA 3GTGB 3S16B 3S2HH 1DXMA 5TSSA 2CWAA 2KEEA 2F3WA 1X56A 5EAYA 1RKNA 4BBSB 4FNFA 3UDFA 1EIFA 1ET9A 1EYAA 5KGUA 1N34Q 3D6WA 2RHQB 4ME5A 5BN4A 3RZOB 3MTSA 5IYCH 4DV5Q 2AMCB 5LL6X 2VQFQ 1SNQA 1B53A 3J7AF 5E3FA 3CAMA 4A3EB 3K6OA 4L5RC 1XMQL 2JN4A 1EIGA 3NELA 3J80i 2EY5A 2E2JB 3ULLA 4X62Q 3PIP3 5M3MH 1ET6A 1TIID 4QCLA 2E2IB 3K5OA 4A3IG 1X6OA 1VF7A 1TWGH 2NVYB 4DV0Q 1PRTB 1L1OC 2AHOB 5JJIA 1YHBA 3MXNA 5ELCA 5LHY1 2H1EA 3TSSA 1S40A 1C8CA 2QEXA 5LMNL 5D14A 3VR3A 1D1KA 3U50C 1N32L 1D1IA 2DGYA 2XWJB 1PH5A 1JE5A 5IYDG 4DXFA 4X65Q 1UAPA 4C3IH 2C9OA 1TY2A 4A3CH 1VCIA 3GTMH 1Y1WH 4UAIA 1J9OA 3H09A 3L0OA 5ELNA 2PNHA 1PH7A 3I4OA 5FJ8G 4X3TA 5JEAJ 4A3JG 3S2DH 4RCNA 5EQ0A 3J7ZC 2NVXH 1IKMA 2MQHA 1PFBA 1FJGL 1CK1A 2D62A 2F0GA 4JYAQ 3TMEA 2ZXRA 4TRDA 4XYOA 1BVSA 2MO1A 1SYDA 4R4CA 2R7FA 5C0XI 2R93G 1Q90A 3BVZA 2BOSA 2HCCA 4A3LG 5G3LF 5M5WH 5T1GA 5C3EB 1I94L 1L1OB 4A3KG 2JK8A 4IUTA 1IYVA 1JOKA 1EYGA 3MXGA 1HRJA 4PG3A 1VQAA 1SE2A 2A73B 4XQNA 1U5KA 2Q2UA 1DOMA 5E4WC 3PO3B 3T53B 1JWSD 2SNMA 1QUQB 4YCWA 3T56B 3NWSA 1B9MA 3OHXC 3K5LA 4RKBA 2ZJPA 2D2CC 1NE3A 4DXGA 4BBSG 1TWAH 1VQGA 3NTIA 4G7HC 3PIO3 1DM0B 2MP1A 2P5ZX 3D4RA 4EQOA 1XPRA 1S5ED 1RJTA 2AKWB 3Q24A 4GKJQ 2UUAQ 4LF7L 1U0LA 1JOQA 4YCVA 3I4NH 2KHSA 1KNEA 2RKSA 2K01A 5D3IB 1AH9A 3TBIB 1RDPD 1HA6A 2K32A 4A3EG 4KY6A 3A56A 4C3JH 4DV6L 1I4GA 2YYZA 5KRUA 3OMGA 1XXGA 4ABNA 2E2HB 3VA7A 4JI2L 3TQYA 2UUBL 3CC2A 2EIFA 1EIHA 1SDFA 5JEAH 2UXCQ 2JA9A 3NENA 2L1BA 2NVTB 1Q3LA 4LF4Q 1DD2A 1UE6A 3SK8A 2N78A 4QUFA 4X6AH 2OTJA 4GKKQ 1BBWA 4KMUC 4IALA 3S2HB 1H9MA 1O7ZA 4L5QA 1VQKA 2BDNA 4JPBW 3JAMc 3KUPA 2OT2A 3VR6A 3EBEA 2DNEA 2BH2A 4K5VA 5IGCA 4CJ0B 5I6YA 2VQEQ 3MHBA 1HR0W 2VY3A 1V1PA 4X3SA 5C44G 1CM9A 4KN7C 3D4DA 1G291 4ALPA 1D5MC 3HKZE 4IPDA 5GAHC 2EXDA 1H95A 4J1MA 3ZYYX 2GN5A 5C0XH 1QG7A 2QEJC 1A15A 1PRTF 4DR7L 3SK6A 4LFAQ 4NW2A 2G5DA 5M3FH 4B3MQ 1GUTA 3A55A 2HHHQ 1Q12A 1Y1VG 5M3MB 4HJ7A 2RDFA 1FGBD 3MXNB 1KLUD 5C3EG 1ESRA 1PH1A 3F2DA 2IY5B 5IWAQ 4NXMQ 3GTKB 1BF4A 3FDTA 2UXDQ 2BA0A 4HIDA 3S1NB 4R1JA 4NXNL 2F4VL 1QCBD 4B3TL 2ASBA 2ZJRA 4TSSA 3DEPA 4KKUA 3FKIH 2F0IA 5IT9L 3C46A 4DR6L 4C3IB 5CV5A 3NTHA 1GUGA 1M4VA 3OW2A 2A1AA 3K0YA 4JI0L 1Y1WB 5CBAE 3C2PA 1C4QA 1EY6A 1E0BA 2KCNA 1HUMA 2VL6A 1IL2A 3TZDA 2GVBA 1SNMA 2LFNA 3I8ZA 2UUCL 3S17B 3ITPA 2NVXB 2B2TA 4AYBE 1IHZA 4LFBL 4YIJA 4ZQ3A 3MZ5A 4KHZA 4M8AA 2M00A 3K8AA 5JVG3 3OOCA 4RA8A 4POGA 4C56C 1K0SA 4MHEA 5ELOA 2JA6H 1PYBA 2K28A 5M5WB 5K5PA 4DAPA 3HOYG 4BY1B 4JI6Q 2J0TD 3EJIA 4P73A 1Q81C 1CQVA 1HZAA 3J7A5 3CC4A 3NBHB 5JJKA 1CUKA 4K8JA 5JAVA 4L5SA 2KENA 4OWTB 3VR2A 4K2LA 3KLWA 4UP8A 1IKLA 5EKIA 3K59A 2EDGA 1X3FA 1EY9A 1P16A 1SSOA 1MJEA 2F0DA 4CDFC 5FLXE 3BVGA 1LTSD 4DV4Q 1DGSA 4GN4B 1H9KA 1VQ5A 2IX0A 1Q1BA 2PI2E 5IYCG 1XWEA 1KRSA 3I90A 4KV6A 5BR8Q 3I4NB 4GLAC 1HFGA 1NAPA 4DV1Q 1FR3A 2PQAA 4I65A 3T16A 3AFQA 1TWCH 5J22A 1B7YB 4JI5L 5LMUL 2XRQD 4S3SA 4PMBA 4C3JB 2F0FA 4YHHQ 1PA6A 5M3MG 1K28A 2R6GA 3S1RH 4XQJA 1VQJA 4QMGA 3M4YA 1DJRD 1V1QA 1LTBD 4LWCA 1YIJA 3H3VC 1WTOA 3HS0C 4R4QA 5CV6A 4X64Q 1O78A 1VQLA 3PSIA 1IBMQ 2LMCB 5CV8A 3J80L 3STBD 3OTOL 3AB9A 4DV7L 1CZGA 3NWTA 2KOLA 4X66Q 1V1PB 3T4AC 3BU2A 5C4XB 3R8BA 4YY3Q 3U4VA 5C5LA 4C3IG 1K8GA 2KECA 5D65A 2JA8H 4GN3B 3I4MH 4A3CG 4G7OC 1Y1WG 1LTID 4RFBA 4IUPA 1ASYA 1SMYD 1N36Q 1XPUA 4LF5Q 4R8IA 2XGTA 4OIKA 2M2LA 2NZ1D 1VQDA 2LXJA 3C1FA 3KFUA 4JVZA 3K5NA 2EYHA 4B3SL 3DWPA 1HTLD 3LWUA 1MI2A 2VZAA 4KK7A 3A0JA 2XSCA 5A2QL 1QZGA 4JV5L 1FVIA 2X6GA 2EPBA 2EQSA 2ATWA 1STAA 4PZ8A 5FLXc 4DUZL 3HOZH 4DV3L 2RA4A 5KIXA 4JOIC 3TREA 2FFKB 4IFDI 4JC0A 2F0EA 1EQVA 1TS5A 4JG2A 5AJ3L 4HCSA 1JB3A 1GHJA 1LTLA 1DOKA 2FXQA 4K8IA 4L63B 4NKLA 2QDLA 2PZTA 3SR1A 4MZ9A 3M7GA 3CCMA 3R3OA 3I91A 1Y69U 3GTOB 4IN3A 4H44C 3K81C 1EY8A 1AFPA 4R8NA 4ZUIA 2FJ2A 1YITA 1HNXQ 3I4NG 1LT5D 3IRBA 3SHLA 1ICWA 1VF5C 4C3JG 3A5ZB 2JA7H 5ELEA 1LYLA 4KY7A 4MTNA 1JWMD 5EBDA 1RF2D 2AUJD 5CR3A 2HUGA 4I7AA 5DM73 1HNZL 3F8TA 5JEAG 4KTAA 2PPBC 1WTXA 1SE8A 3DXJC 2ID0A 5EKLA 4HJAA 1GM5A 1QOHA 4DAYB 2Z9HA 2ZXOA 1EEFD 1LT6D 4UY8C 1GUNA 2HDMA 3LX0A 3NTKA 4ODGA 1JB7A 1RIPA 3CCEA 1IL8A 1D8LA 1Q86C 1C48A 2Q8RE 3JAMi 4LF9L 4B08A 2K04A 4CGYB 2K4KA 1GOZA 3K7AH 1XMOQ 2AWNA 4JI3Q 3TP7A 3RD4A 3QO2A 1E2ZA 2OWOA 1KHIA 2IX3A 4RGNA 2E2JH 3MEHA 2N88A 3TZUA 1DYQA 2E2IH 4DV2L 4KI0A 1F2ZA 4DUYQ 4H7BA 4A3MB 1VDZA 2NVYH 4LFCQ 4LMQD 1X55A 3QOJA 3QOLA 3GDEA 3T1HL 4IFDH 3MC0B 3W3AA 4JI7Q 1K9MC 1VQNA 3S1MB 2B2UA 2KEDA 1EQRA 1N33L 2O2LD 4G57A 3BYTB 4N9PA 3GTLB 1BR9A 1IBLL 1VQFA 1U9RA 3RZDH 3EIVA 1X9NA 2XNAC 1E7ZA 2JSOA 2IW3A 4F7XA 1IBKL 3CC7A 1A2UA 4YWLA 5L37A 5J3BA 1PTOB 2A6HD 5D3DA 2FHTA 3CRLC 3FKIG 3GV6A 4JI8Q 5I9PA 2MHVA 2PI2A 4H0LC 2JA8B 1TS3A 3OYYA 1Y8NB 3OW7A 1AE3A 1CA6A 2A6ED 2KQ3A 2EOTA 2PMZE 2BDOA 3DLLA 1K73C 1EUJA 1ZXTA 2DY7A 2L15A 4UP9A 5LMNW 1KDCA 4F88A 4DR1Q 1H9JA 3G71A 2I07B 1TVXA 2WAQG 4LK1C 1WJJA 2JA6G 2HD3A 1ZKOA 1I6VC 5GROA 3PO3H 2H5XA 2JP1A 3HOZB 3A7AB 3I56A 1X65A 1VQ6A 2F3VA 1HPCA 3M4PA 1NMGA 1FGUA 1RODA 3D3RA 5ELDA 4AH6A 3E9IA 2CCZA 1FNUA 1SYFA 4RKLA 3J81L 3W2DA 4O0AA 4JBWA 4B3RL 4IUVA 1EOVA 2A6EC 3MEFA 3MXUA 1BCPB 1GVPA 4CKEA 4GNXA 2JE6I 2WB1B 3AEVA 2WIIB 3D6CA 1C0AA 2YTVA 1LT4D 1YJWA 2EY1A 5FK9C 1PFMA 1G91A 4EVOA 1QILA 2I5LX 2MO0A 1PRTD 3DMUA 1UE5A 4LAAA 2E2HH 2DJFC 1I4PA 1F2LA 3M3YH 4IPGA 2JA7B 3R2IA 3I3CA 5FKAC 1LT3D 1W3SA 2D0PA 5HY6A 3T13A 3HOVH 3ND8A 1N34L 2B2UC 3NQIA 1QVGA 5JJLA 1A63A 1STNA 4DV5L 1QVCA 1Y8OB 3J7YW 1UEAB 2WINB 2VQFL 5C3WA 3P20A 1K0RA 3QJYA 2CHBD 3AFPA 4QJFA 1LABA 5K36H 4X62L 5CMDA 1JQYD 4DR4Q 3N52A 5KYLA 2JA8G 3I4MG 4AYBB 4PZ7A 4DV0L 4PZ6A 1ILPA 3U9SA 3K7AB 4PV1C 3W5OA 4IUNA 1R4QB 3MVVA 1EQTA 3UDXA 2F0NA 3KLRA 2IWHA 1G51A 2YV5A 3IKJA 2I46A 1B50A 4X65L 3KF6B 2B2WA 3ERSX 5I2XA 3BZKA 4EX5A 4BA2I 1XJVA 3GTKH 1PVOA 2E74C 3S1NH 4LNQA 3HOZG 1SYCA 1PTOF 4BWGB 1WCMB 5ELBA 3HZXA 2V4DA 1M1KC 1CI3M 1SRUA 1P8LA 1OXVA 4JYAL 2VW9A 4GNXC 2Y0SE 3PGZA 1KABA 3RZDB 5CV7A 4H02A 3BDCA 4QF4A 4Q0FA 3WOEA 1K3RA 3KJPA 1EYDA 4DPGA 4HJ8A 1BQQT 2K5DA 1LACA 2WB1G 2PZUA 1SAPA 2KHIA 5DLQE 3CCUA 2CQOA 1RCVD 2IJ0A 1VQOA 1TWHB 4A3FH 3S17H 1PV4A 4DA2A 1SBBB 1GHKA 3CPFA 1STEA 3SGIA 1EWCA 5H1SE 3FPUB 3OIPA 5I4DA 3QIAA 4BA1I 2JA7G 4N9TA 1QJOA 3CRKC 3QWNA 4C1NK 5IYBH 3ONAB 3RLFA 1Y8PB 4A3DH 4BY1H 4DNIA 5M5XH 1KAAA 1X3EA 4GKJL 2UUAL 3H3VI 3AU7A 3PF5A 1VMPA 5ELFA 3TP6A 2R7ZB 2F0OA 1BCPF 2YU9B 4GS3A 1YEZA 2HIVA 3CU7A 1B8AA 4DFAA 4MIUA 1VMCA 1SE4A 5IGFA 2NN6I 5J1ZA 1Q46A 2O4XA 1PLFA 5C3XA 1G2SA 4IO9A 1K83B 4FO2A 3PCOB 3X3NA 2UXCL 2K33A 4KLKA 3OWEB 4LF4L 3M4OH 2RVLA 3H94A 2BH8A 1VQIA 2EYMA 3SE0A 2F0QA 4GKKL 2D5DA 4J6HA 5KNBA 2B2WC 3H91A 4KHVA 3M3YB 2G9HD 4WJWA 3EVQA 2CFMA 2VQEL 2I0QA 3JAML 1W6JA 2Z0SA 3HOVB 1A3UA 2F0WA 1D5ZC 4EGVA 1GJXA 1RHPA 4IFDG 1K8MA 3TS2A 2K75A 2B63H 2MGSA 4CBVA 2E5LL 2M9VA 2F0JA 1HZBA 1JJ2A 3KLSX 2BE5D 5C4XH 4R4IA 1V43A 5DNFA 1U4RA 1Z47A 4LFAL 3KYHC 5EGTA 4B3ML 5JOBA 3ZJYC 1F2MA 2HHHL 1U4LA 3RLOA 5IOCA 4OX9Q 1QZHA 1TU2B 3DHQA 1HNWQ 3Q6SA 1SNOA 1DCZA 3AMUA 1GD7A 4WORA 1EY4A 2R7DA 3D8GA 2JQOA 5IWAL 4NXML 2WFWA 2WKCA 5BN3A 2JYOA 2UXDL 1YBYA 4K0KQ 3G6EA 2HCIA 2ZT9C 3RN2A 1DONA 1X3PA 2JEAI 1QNKA 1F9QA 2JJQA 1QWYA 4A76A 5KNCA 2SNSA 2A69D 4FXDA 1YVCA 3H3VH 4POFA 5EPJA 4ZUJA 2H4OA 4DNRB 3VR4A 3M4QA 2A68D 4JW0A 1BNZA 3PO3G 4A75A 3OIQA 5I9OA 1KAWA 4CJ2C 4P2CB 2NN6H 3MAQA 5IY0A 1BO0A 2AUKA 1PFSA 1J5EQ 4XQQA 1FNWA 4GZYC 2NZHA 2K05A 2L11A 3GTOH 1M90C 3NSWA 2LXKA 1TR5A 4IJLA 3AQQA 3S1QB 2K52A 3MWYW 1NJIC 4A3FB 3CHBD 1HCZA 2R92H 5A35A 1HZCA 3HFZB 4G7ZC 1LLRD 1SMXA 1YHQA 1A6XA 2IPKD 5GQOA 5M5YB 2DY8A 1A0IA 2QW7A 1CFMA 2OQ0A 4FXKC 2N55A 4P75A 3FEWX 4ID6A 1E24A 3BJUA 4A3DB 5IIFA 4DV4L 5M5XB 2CWPA 3DWQA 3HOVG 4ME3A 2MFIA 3CMEA 4P74A 5BR8L 4AQYQ 4C1NI 4JOIA 2FINB 3E9HA 4DV1L 3K5MA 1XPOA 1CZWA 1KDBA 4DR3Q 1JCKB 4TKOB 5HURA 1YNJD 3GP7A 1V8QA 5IODA 1SXTA 4R9WA 5CBEE 5K36G 1NMFA 4YCUA 4YHHL 3PF4A 3C1EA 1V9PA 1B44D 2PMZB 2F0VA 3UDIA 2OTLA 4HCEA 3J80E 1LM0A 2KCTA 3BDLA 1VQCA 1ICFB 1ENAA 4X3KA 2KCCA 1HH2P 3NP8A 4DK0A 3TN2A 1HFNA 4OHJA 3OMCA 4MN3A 3M4OB 4UDUC 4X64L 4DF7A 4WRDA 2J7ZA 4LUVA 1IBML 2UXBQ 4A3MH 1EY0A 2UU9Q 2K6AA 3NPPA 4FF3A 4NB3A 2L12A 3GTJH 1CKNA 4X66L 4XTCS 1UE7A 4YY3L 2EJMA 4RGOS 1H9SA 3WDNA 1PZJD 3S1MH 4F8MA 5A2QE 1MKHA 1II3A 1ONLA 1UNSA 1YNJC 3L7ZC 1N36L 3GTLH 1AE2A 5HGQA 2B63B 4LF5L 3SEBA 3IL8A 3I55A 4DU9A 1UUPA 4NMZA 1PTOH 4OIJA 1F9SA 3CQZH 1WD0A 1TY0A 4UP7A 1PDQA 2Q2HA 3G7LA 3NUCA 5CV4A 3K58A 3T1YQ 2A8VA 2XN9C 1TS4A 4ZAIA 3GV3A 1FYCA 1E1TA 2B8FA 3I2ZA 4BXXH 1I4HA 1WFQA 1SNPA 2ZM6Q 2F0KA 1SYEA 2KHJA 4XT3B 3TP5A 4B9XA 2K5WA 1HR0Q 3CW2C 4A3FG 1IW7D 3NEMA 3EN2A 4JBKA 3EA6A 3I73A 3EROA 3IAYA 2NYZD 3KDFA 3MXPA 1NCVA 3T51B 1XNRQ 1JJCB 5IYBG 5C4JH 1SR3A 5CYUA 4A3DG 4BY1G 3STBC 1K3BC 5E7NA 1PH3A 1YI2A 3SXHA 4HSPA 1I4QA 1U4PA 4JK1C 3CP0A 1HNXL 4A93B 3G6JB 2E75C 3E3XA 1MHWC 1V1OA 4MTKA 1SMYC 5CV9A 1TKWB 2RHSB 3HGBA 3B6YA 2I5MX 1NY4A 4UHVA 1D5XC 4OWXB 5C4HA 1YNND 3N6RA 4MNOA 3C3LA 4RGTA 1I3QH 2NBFA 5I2YA 1JICA 1HQMC 2L55A 3E5SA 2Z4HA 2DNCA 2HDLA 1JORA 3U58A 4OL7A 4EQPA 5FLMH 2R92B 4DN4M 4A3BH 1T9HA 1BBUA 1K8AC 4BBRH 2F0UA 3NQTA 4Y52H 1RD9D 4LW1A 1HZ9A 4XIGS 1G6PA 5F2DA 3P75A 3HRZC 1OXXK 3TP8A 2EXZA 4DK6C 4BY7H 4CJ1B 4Q5VA 4A3GH 1C9OA 1XMOL 3QG1A 4HN7A 2NTSA 2PNRC 4JI3L 2R61A 2B63G 3HOUB 1NR2A 3MA2B 3BZDB 3FRPB 4CDCC 3CKIB 1YHAA 5IP7H 5C4XG 1LTTD 2HQEA 1UWVA 2CW0D 4LFCL 1NR4A 1SEBD 3GD7A 1RL2A 2PQAB 2IL8A 4C2MH 5KNDA 1SNDA 1R9TH 4JI7L 4HJ5A 1I4RA 1S4ZA 1A62A 1LTRD 1UEBA 1OXTA 1SE3A 3EQLC 1E2WA 5IE8A 1CKNB 5G3LD 1CTMA 1A3VA 1PYWD 5C6AA 1NUCA 2CH4W 3CCRA 3GTJB 1GUOA 4C3HH 1R4PB 4JI8L 1EFID 4FDBA 1XYIA 2F03A 1X3QA 4ZK9B 2EVBA 1WCMH 1BCPD 1TT2A 2EYLA 3HOWB 3L9AX 3ULJA 3RMHA 3VR5A 1EQQA 2NN6G 2JA5B 1RTNA 1I4XA 3QR8A 1SJED 2Z4IA 3DM3A 2HQLA 2N3SA 4DR1L 1VQ7A 1HXYD 3UE0A 3CQZB 2PYKA 4KKSA 3F2BA 2E8GA 3NE5B 1NNXA 2WACA 3J81E 1HA5A 1TWHH 1PHJA 3TDQA 5DM63 2NVQB 4ZKCB 1EEID 5GAEC 2B2YA 3KDFB 1JE4A 2R92G 3PUYA 3SVMA 2QF7A 1STYA 1EY5A 4GOPA 2Z8LA 4RH6A 1VQ8A 3W1GA 1HQRD 1T5XD 3BYYB 1KDAA 2X6LA 2WV6D 1KC8C 4LF6Q 1ILQA 2E76C 5C4JB 4KKTA 1BKBA 1ESFA 2R7ZH 1WYDA 4DR2Q 3DUZA 2YU9H 2KA7A 2A6HC 4XT1B 2A19A 2FMMA 4HR7B 1EZ6A 4ZLTF 1BOSA 5ISRA 5NUCA 1WTVA 2D0OA 2DJGC 2F52A 4FXGC 3K0XA
chains in the Genus database with same CATH topology
2F0MA 2J4XA 4K2KA 2ICEC 2L4NA 2Z1CA 2VB2X 3HKZB 3LNNA 4KN4C 1QE6A 1EL0A 4FF1A 1I3QB 3BS1A 1SJHD 1HTPA 4A3BB 4KD3A 3IFDA 4BBRB 5AFWA 3I72A 3LWEA 1FD7D 3S9WA 1PZKD 2NTTA 1PZID 4A3JB 2O5IC 1BUVT 4BY7B 4O1NA 3VA5A 4A3GB 4XDXA 3WOFA 1QNUA 1KNAA 4IZ8A 3NBIA 5E4XA 4DGZA 1PRTC 1AP0A 2B2YC 2K1BA 1EZ8A 3R2TA 4C2MB 4FF4A 4LJZC 1R9TB 3S14B 4CKCA 1F77A 5EPLA 4RAUC 3L3OC 3O13A 2B8GA 5CGKA 5E1FA 2PZWA 3V2TA 1OO9B 5I6WA 2K03A 2GA4B 1QB5D 4C3HB 1WD1A 1WTQA 2TSSA 4KJOA 1U4MA 4HMIA 3ND9A 1EY7A 3NXWA 1OXUA 3KLSA 2EJFC 4FF2A 2O5JC 1AN8A 5JPNC 1SYBA 4KJNA 1O7YA 1T5EA 1TS2A 2RBMA 1EYCA 3KBGA 1E2VA 2XWBB 2QDBA 3A8KE 3HP3A 5C44B 2EZVA 1BDOA 3P7JA 5T1IA 3HEJA 1WVLA 2NB0A 3NHHA 4HEDA 4H13C 1EOTA 5JPMC 3JAME 2AQ3B 4L8JA 1O80A 1Y1VB 3EFXD 1SYGA 1WTPA 3H6MA 1XTCD 3GO5A 5EPKA 3DM1A 4RWSC 3BDOA 2BCOA 2X69A 3FPPA 4ULLA 4O42A 1PMRA 1MBYA 2SDFA 4F87A 4OO1I 3GTQB 2EY2A 3NBHA 4Y7NB 3M7NA 1I6HB 1XX8A 4ZRZA 2BA1A 2ENBA 5C0XJ 3SK4A 4NP5A 1WTRA 3VYTA 4DK1A 1W6KA 4ZYSA 5LL6S 3D4WA 5DEHA 4C3HG 1F9RA 3OWFA 5IGGA 4U673 1GXDC 1D2BA 1LV9A 1H9RA 2ICIA 1STHA 3K57A 4IUUA 1MSGA 4KD4A 3PMFA 3HOYB 1J8IA 3PUWA 3SDZA 5DAUA 2F4IA 2G9DA 3Q0AA 2B39A 5IT9E 1Z7TA 1CA5A 5FO9B 1TWFB 3V05A 5IGBA 2E2DC 3E0JA 3I4LA 4CKBA 2F0PA 4ZKBB 2XRSD 2EYOA 2EYPA 4HSVA 2PW7A 3X3MA 3S15B 1ENCA 3MFYA 4IUQA 4K14A 1HUNA 2BE5C 2A5HA 4FP5D 4L6TB 2JEBI 2L9HA 1EU4A 2Q8IB 2KVMA 5KEEA 1BXTA 1A2TA 2NWGA 3OSOA 1NSNS 2QCPX 1TWGB 4KY5A 4OO1H 2VUMB 1JC7A 2IT1A 2D9UA 4BS9A 2C5CA 4TQUS 2AQ2B 3U9OA 1GUWA 2L5TA 2A69C 4WFN3 1AZQA 3DEOA 2F1MA 2A68C 4G4KA 2F0LA 2OEOA 2VB3X 1B3AA 3GTMB 2TMPA 1EU3A 2RSNA 4B9WA 3S2DB 1ENFA 2MJ8A 1F2YA 2PQEA 4E6IA 2PW5A 2VXWA 5EBCA 2VNUD 2K5QA 1PXUA 3F2UA 4I7ZC 5CC4A 4V190 4U68A 3P1HA 4DAYA 3A8IE 1TWAB 1CHPD 3VYSA 5BN5A 4PNYA 4RHRA 5IGEA 3VYRA 2PCFB 3KBXA 2F0SA 5HGTA 4V0BA 5IGDA 1B1ZA 3HOXB 5COYA 4K5XA 1AW7A 1JR0D 4A3IB 4M1UB 3RUZA 2EY6A 3J7AV 5FLXL 3UI2A 4XYQA 3A7LA 4FVMA 4J8QA 1BBXC 3MFGA 2EYFA 1STGA 4ILWA 3GTPB 4K5WA 1L0YB 3PO2B 2B2TC 1L0XB 2WP8J 4IURA 1G6ZA 1PFNA 1MGSA 5M3FB 2AWOA 3DWAA 4PMCA 1Q8IA 1S5CD 2B2VA 2EE1A 1OXSC 2KJXA 2ZXPA 1IW7C 1DOLA 3KF8A 3PUVA 4X3UA 2K7VA 1FNVA 1GUSA 2OXPA 2RQXA 1DZ1A 1KLGD 4IQZA 2WKDA 3FKIB 1MSHA 3VYUA 3V96A 5C5MA 4CHTB 2XVSA 3BG3A 3Q22A 4HTHA 5FO7B 2EJGC 2XIWA 1SFOB 2QKIC 5C4ZA 1ZYRD 2MUYA 1PTOD 2Y0SB 5J39A 2LS01 1IYUA 1CT1D 4IFDJ 5M9OA 1YNNC 4K6LA 2WAQB 3H0GB 2JA6B 3R93A 4QIWB 4PMWA 2F0TA 1X32A 4RCOA 5FO8B 1LO5D 2FMCA 3SK5A 1S5DD 5KYIA 4HAEA 2MPMA 2CQAA 1JOOA 2KUMA 5EKKA 2F0HA 1ZYRC 3A54A 1PTOC 4HMJA 4NDXA 3NK9A 1H9SB 1AZPA 2LY7A 4XXEA 1M8AA 4DNTB 2SEBD 1B4OA 1STBA 4K6DA 2CVRA 1JWUD 3FMCA 1LTAD 5JVH3 1A3TA 1TWCB 5EJWA 5C0XG 1MD2D 2CW0C 3PV0A 2B2VC 2IX1A 4RGMA 3A8JE 3S1RB 1KTKA 3PUXA 1SNCA 3BVMA 3Q23A 4OO1G 1Q1EA 2RDHA 2RDGA 1S5FD 1RTOA 4PQXA 1K8OA 3M85A 3QB3A 4OGQC 1D6EC 1EWHA 1ZEQX 1BCPC 1G2TA 4QUCA 3I4MB 2Q8TA 3ERQA 2R3ZA 1I50B 1CQFA 1AEXA 5CORA 5JJZA 1F9PA 2SOBA 3D31A 2PO4A 4Z9CB 3HG9A 4FYDA 1O7LA 2LKVA 2A74C 1HHVA 3GQBA 3I70A 2RSOA 1ML0D 2OF1A 2QILA 1WTWA 2DN8A 1S5BD 2JXMB 2AQ1B 1TQOA 2L0CA 3IFTA 3PUZA 2EYJA 4EQNA 5FOBB 4RHSA 3FVQA 1G8ZD 3E6ZX 1Z6HA 3OPOA 2R93B 1B2TA 4DAVA 1LTGD 3KK7A 1B9NA 3URYA 4A3KB 4QB4A 1CHQD 2NUCA 3GTGB 3S16B 1DXMA 5TSSA 2KEEA 2F3WA 1RKNA 4BBSB 4FNFA 1ET9A 1EYAA 5KGUA 3D6WA 4ME5A 5BN4A 3RZOB 3MTSA 5LL6X 1SNQA 1B53A 3J7AF 5E3FA 4A3EB 3K6OA 1EIGA 2EY5A 2E2JB 3PIP3 1TIID 1ET6A 4QCLA 2E2IB 3K5OA 1VF7A 2NVYB 1PRTB 5LHY1 3MXNA 5ELCA 2H1EA 3TSSA 1C8CA 5D14A 3VR3A 1D1KA 1D1IA 2XWJB 4DXFA 1UAPA 2C9OA 1TY2A 1VCIA 4UAIA 1J9OA 3H09A 4X3TA 5JEAJ 4RCNA 5EQ0A 1IKMA 1PFBA 1CK1A 2D62A 2F0GA 3TMEA 2ZXRA 4TRDA 4XYOA 1SYDA 5C0XI 1Q90A 3BVZA 2BOSA 2HCCA 5G3LF 5T1GA 5C3EB 4IUTA 1IYVA 1JOKA 1HRJA 3MXGA 1SE2A 2A73B 4XQNA 1DOMA 5E4WC 3PO3B 3T53B 3T56B 1JWSD 2SNMA 3K5LA 3NWSA 1B9MA 3OHXC 4RKBA 2D2CC 4DXGA 3NTIA 4G7HC 3PIO3 1DM0B 2MP1A 3D4RA 4EQOA 1S5ED 1RJTA 3Q24A 1JOQA 2KHSA 1KNEA 2RKSA 2K01A 5D3IB 3TBIB 1RDPD 1HA6A 2K32A 4KY6A 3A56A 1I4GA 2YYZA 5KRUA 3OMGA 1XXGA 4ABNA 2E2HB 3VA7A 1EIHA 1SDFA 5JEAH 2L1BA 2NVTB 1Q3LA 1DD2A 3SK8A 4QUFA 4KMUC 4IALA 3S2HB 1H9MA 1O7ZA 2BDNA 3KUPA 2OT2A 3VR6A 2DNEA 4K5VA 5IGCA 4CJ0B 5I6YA 3MHBA 1V1PA 4X3SA 1CM9A 4KN7C 3D4DA 1G291 1D5MC 4J1MA 3ZYYX 5C0XH 1QG7A 2QEJC 1A15A 1PRTF 3SK6A 4NW2A 1GUTA 3A55A 1Q12A 5M3MB 2RDFA 1FGBD 1KLUD 1ESRA 3GTKB 1BF4A 3FDTA 2BA0A 3S1NB 1QCBD 4TSSA 3DEPA 4KKUA 2F0IA 5IT9L 3C46A 4C3IB 5CV5A 3NTHA 1GUGA 1M4VA 3K0YA 1Y1WB 5CBAE 3C2PA 1C4QA 1EY6A 1E0BA 2KCNA 1HUMA 3TZDA 3I8ZA 1SNMA 2LFNA 3S17B 3ITPA 2NVXB 2B2TA 1IHZA 4YIJA 4ZQ3A 3MZ5A 4KHZA 4M8AA 2M00A 5JVG3 3OOCA 4RA8A 4C56C 4MHEA 2K28A 5M5WB 5K5PA 4DAPA 4BY1B 2J0TD 3EJIA 1CQVA 4K8JA 5JAVA 3VR2A 4K2LA 1IKLA 5EKIA 3K59A 2EDGA 1EY9A 1SSOA 2F0DA 5FLXE 3BVGA 1LTSD 1H9KA 2IX0A 1Q1BA 1XWEA 4KV6A 3I90A 3I4NB 1HFGA 1NAPA 1FR3A 4I65A 3T16A 5J22A 2XRQD 4S3SA 4PMBA 4C3JB 2F0FA 2R6GA 4XQJA 4QMGA 3M4YA 1DJRD 1LTBD 3H3VC 1WTOA 3HS0C 5CV6A 1O78A 2LMCB 5CV8A 3J80L 3AB9A 1CZGA 3NWTA 2KOLA 5C4XB 1V1PB 3T4AC 3R8BA 5C5LA 4C3IG 2KECA 5D65A 4G7OC 1LTID 4RFBA 4IUPA 1SMYD 4R8IA 4OIKA 2M2LA 2NZ1D 3C1FA 3K5NA 2EYHA 3DWPA 1HTLD 3LWUA 1MI2A 4KK7A 2XSCA 5A2QL 2X6GA 2EPBA 1STAA 2RA4A 5KIXA 2FFKB 4IFDI 2F0EA 1EQVA 1TS5A 4HCSA 1JB3A 1GHJA 1DOKA 4K8IA 4L63B 4NKLA 2PZTA 3SR1A 3M7GA 3R3OA 3I91A 1Y69U 3GTOB 4IN3A 4H44C 1EY8A 1AFPA 4R8NA 4ZUIA 2FJ2A 1LT5D 3SHLA 1ICWA 1VF5C 4C3JG 5ELEA 4KY7A 1JWMD 5EBDA 1RF2D 2AUJD 5CR3A 2HUGA 5DM73 5JEAG 4KTAA 2PPBC 1WTXA 3DXJC 2ID0A 5EKLA 1QOHA 2ZXOA 1EEFD 1LT6D 1GUNA 2HDMA 3LX0A 3NTKA 4ODGA 1IL8A 1C48A 2Q8RE 4B08A 2K04A 4CGYB 1GOZA 2AWNA 3TP7A 3RD4A 3QO2A 1E2ZA 2IX3A 4RGNA 3MEHA 2N88A 3TZUA 1DYQA 4KI0A 1F2ZA 4H7BA 4A3MB 1VDZA 4LMQD 3QOJA 3QOLA 4IFDH 3MC0B 3W3AA 3S1MB 2B2UA 2KEDA 2O2LD 4G57A 3BYTB 4N9PA 3GTLB 1BR9A 1U9RA 2XNAC 2JSOA 2IW3A 4F7XA 1A2UA 1PTOB 2A6HD 5D3DA 2FHTA 3CRLC 3GV6A 5I9PA 2MHVA 4H0LC 2JA8B 1TS3A 1Y8NB 3OW7A 1CA6A 2A6ED 2KQ3A 2EOTA 2BDOA 1ZXTA 2DY7A 1KDCA 4F88A 1H9JA 2I07B 1TVXA 4LK1C 1ZKOA 1I6VC 2JP1A 3HOZB 3A7AB 2F3VA 1HPCA 1RODA 3D3RA 5ELDA 1SYFA 1FNUA 4RKLA 3J81L 3W2DA 4JBWA 4IUVA 2A6EC 3MXUA 1BCPB 4CKEA 2JE6I 2WB1B 2WIIB 3D6CA 1LT4D 2EY1A 5FK9C 1PFMA 1G91A 4EVOA 1QILA 1PRTD 3DMUA 4LAAA 1I4PA 1F2LA 2JA7B 3R2IA 3I3CA 5FKAC 1LT3D 3T13A 3ND8A 2B2UC 3NQIA 1STNA 1Y8OB 3J7YW 1UEAB 2WINB 5C3WA 3P20A 3QJYA 2CHBD 1LABA 5K36H 5CMDA 1JQYD 3N52A 5KYLA 4AYBB 1ILPA 3U9SA 3K7AB 4PV1C 4IUNA 1R4QB 3MVVA 1EQTA 2F0NA 3KLRA 2IWHA 3IKJA 2I46A 1B50A 2B2WA 5I2XA 4BA2I 2E74C 1SYCA 1PTOF 4BWGB 1WCMB 5ELBA 3HZXA 2V4DA 1CI3M 1OXVA 1KABA 3RZDB 5CV7A 4QF4A 3BDCA 4Q0FA 3WOEA 1EYDA 1BQQT 2K5DA 1LACA 2PZUA 1SAPA 1RCVD 2IJ0A 1TWHB 4DA2A 1SBBB 1GHKA 1STEA 1EWCA 3FPUB 3OIPA 5I4DA 3QIAA 4BA1I 4N9TA 1QJOA 3CRKC 3QWNA 4C1NK 3ONAB 3RLFA 1Y8PB 1KAAA 3AU7A 2R7ZB 1VMPA 5ELFA 3TP6A 2F0OA 1BCPF 2YU9B 3CU7A 4DFAA 4MIUA 1VMCA 1SE4A 5IGFA 2NN6I 5J1ZA 2O4XA 1PLFA 5C3XA 1G2SA 1K83B 4FO2A 3X3NA 2K33A 3OWEB 2RVLA 3H94A 2EYMA 3SE0A 2F0QA 2D5DA 4J6HA 5KNBA 2B2WC 3H91A 4KHVA 3M3YB 2G9HD 4WJWA 3EVQA 3JAML 1W6JA 3HOVB 1A3UA 2F0WA 1D5ZC 4EGVA 1GJXA 1RHPA 4IFDG 1K8MA 2MGSA 4CBVA 2M9VA 2F0JA 3KLSX 2BE5D 1V43A 5DNFA 1U4RA 1Z47A 5EGTA 5JOBA 1F2MA 1U4LA 5IOCA 1TU2B 3DHQA 3Q6SA 1SNOA 1DCZA 3AMUA 4WORA 1EY4A 3D8GA 2WKCA 5BN3A 2JYOA 2HCIA 2ZT9C 1DONA 1X3PA 2JEAI 1QNKA 1F9QA 1QWYA 5KNCA 2SNSA 2A69D 4FXDA 5EPJA 4ZUJA 2H4OA 4DNRB 3VR4A 2A68D 1BNZA 3OIQA 5I9OA 4CJ2C 4P2CB 2NN6H 3MAQA 1BO0A 2AUKA 4XQQA 1FNWA 4GZYC 2K05A 2L11A 3NSWA 1TR5A 3S1QB 3MWYW 4A3FB 3CHBD 1HCZA 5A35A 4G7ZC 1LLRD 1A6XA 2IPKD 5M5YB 2DY8A 1CFMA 4FXKC 2N55A 3FEWX 4ID6A 4A3DB 5IIFA 5M5XB 3DWQA 4C1NI 2FINB 3K5MA 1CZWA 1KDBA 1JCKB 4TKOB 5HURA 1YNJD 3GP7A 1V8QA 5IODA 1SXTA 4R9WA 5CBEE 5K36G 3C1EA 1B44D 2PMZB 2F0VA 4HCEA 3J80E 3BDLA 1ENAA 4X3KA 2KCCA 3NP8A 4DK0A 3TN2A 1HFNA 4OHJA 3OMCA 4MN3A 3M4OB 4UDUC 4DF7A 4WRDA 2J7ZA 1EY0A 2K6AA 3NPPA 4FF3A 2L12A 4XTCS 2EJMA 4RGOS 1H9SA 3WDNA 1PZJD 4F8MA 5A2QE 1II3A 1ONLA 1UNSA 1YNJC 3L7ZC 2B63B 3SEBA 3IL8A 4DU9A 1UUPA 4NMZA 1PTOH 4OIJA 1F9SA 1WD0A 1TY0A 1PDQA 3G7LA 3NUCA 5CV4A 3K58A 2XN9C 1TS4A 4ZAIA 3GV3A 1FYCA 2B8FA 1I4HA 1SNPA 2F0KA 1SYEA 4XT3B 3TP5A 4B9XA 2K5WA 1IW7D 3EA6A 3I73A 3EROA 3IAYA 2NYZD 3MXPA 1NCVA 3T51B 5CYUA 3SXHA 4HSPA 1I4QA 1U4PA 4JK1C 4A93B 3G6JB 2E75C 1V1OA 1SMYC 5CV9A 1TKWB 3HGBA 1D5XC 5C4HA 1YNND 3N6RA 3C3LA 4RGTA 5I2YA 2NBFA 1JICA 1HQMC 2L55A 3E5SA 2Z4HA 2DNCA 2HDLA 1JORA 4OL7A 4EQPA 2R92B 4DN4M 2F0UA 3NQTA 1RD9D 4XIGS 5F2DA 3P75A 3HRZC 1OXXK 3TP8A 2EXZA 4CJ1B 4Q5VA 3QG1A 4HN7A 2NTSA 2PNRC 2R61A 3HOUB 1NR2A 3MA2B 3BZDB 3FRPB 3CKIB 1LTTD 2HQEA 2CW0D 1NR4A 1SEBD 3GD7A 2IL8A 5KNDA 1SNDA 1I4RA 1S4ZA 1LTRD 1OXTA 1SE3A 3EQLC 1E2WA 5G3LD 1CTMA 1A3VA 1PYWD 5C6AA 1NUCA 3GTJB 1GUOA 1R4PB 1EFID 1XYIA 2F03A 1X3QA 4ZK9B 2EVBA 1BCPD 1TT2A 2EYLA 3HOWB 3L9AX 3RMHA 3VR5A 2NN6G 2JA5B 1RTNA 1I4XA 1SJED 2Z4IA 1HXYD 3CQZB 2PYKA 4KKSA 3NE5B 2WACA 3J81E 1HA5A 3TDQA 5DM63 2NVQB 4ZKCB 1EEID 2B2YA 1JE4A 3PUYA 3SVMA 2QF7A 1STYA 1EY5A 2Z8LA 4RH6A 1HQRD 1T5XD 3BYYB 1KDAA 2X6LA 2WV6D 1ILQA 2E76C 5C4JB 4KKTA 1ESFA 3DUZA 2KA7A 2A6HC 4XT1B 2FMMA 4HR7B 1EZ6A 4ZLTF 1BOSA 5ISRA 5NUCA 1WTVA 4FXGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXG A;  2C5C A;  2GA4 B;  1CZW A;  2XSC A;  1CZG A;  1C48 A;  4P2C B;  1R4P B;  1D1K A;  1R4Q B;  1D1I A;  1DM0 B;  1CQF A;  1QOH A;  2BOS A;  1QNU A;  4M1U B;  1BOS A;  1C4Q A;  4ULL A; 
#chains in the Genus database with same CATH topology
 2F0M A;  2J4X A;  1W2B A;  4JI1 Q;  1K83 H;  4K2K A;  2ICE C;  2L4N A;  2Z1C A;  2VB2 X;  2B3G A;  3HKZ B;  3LNN A;  4OEL B;  1XNQ Q;  4KN4 C;  4LUZ A;  1QE6 A;  1EL0 A;  4FF1 A;  1I3Q B;  3BS1 A;  1SJH D;  4Y7N H;  1I6H H;  2C35 B;  2ZTE A;  1QUQ A;  1HTP A;  4A3B B;  4A3M G;  4HJ9 A;  3G48 A;  4KD3 A;  3IFD A;  4BBR B;  5AFW A;  4DR5 Q;  3I72 A;  3LWE A;  4DR4 L;  4KHP Q;  1FD7 D;  3S9W A;  1PZK D;  1KD1 C;  1VQ9 A;  3J81 c;  2NTT A;  1PZI D;  4A3J B;  1J6Q A;  2O5I C;  1BUV T;  4BY7 B;  4O1N A;  3VA5 A;  4A3G B;  4P71 A;  4XDX A;  3WOF A;  2KCM A;  1QNU A;  1O7I A;  1KNA A;  1N8R C;  4IZ8 A;  3NBI A;  4LF8 Q;  5E4X A;  4DGZ A;  4JI4 Q;  3PIP A;  2Q2I A;  1PRT C;  1AP0 A;  4IOC A;  3CXC A;  2B2Y C;  2K1B A;  1EZ8 A;  4BXX G;  3F2C A;  3WWV A;  3R2T A;  4C2M B;  1TWF H;  4FF4 A;  4LJZ C;  1R9T B;  1GKH A;  4CKC A;  3S14 B;  1F77 A;  1CKM A;  1NBW A;  3E0E A;  4RAU C;  5EPL A;  3L3O C;  1LUZ A;  3O13 A;  1JMC A;  2B8G A;  3CCS A;  5CGK A;  4GOP C;  3S15 H;  5E1F A;  2KBN A;  2PZW A;  3V2T A;  1OO9 B;  5I6W A;  2K03 A;  3LGJ A;  2GA4 B;  4YWK A;  1QB5 D;  1MJC A;  4C3H B;  1WD1 A;  3G4S A;  4QQB X;  1WTQ A;  2TSS A;  4KJO A;  3PQI A;  1U4M A;  4P72 A;  4HMI A;  3JC6 6;  1PH9 A;  3ND9 A;  3HKZ G;  2VUM H;  1EY7 A;  3CCQ A;  3NXW A;  1OXU A;  3KLS A;  2EJF C;  4FF2 A;  2O5J C;  5GAG C;  3S1Q H;  1AN8 A;  5JPN C;  1XMQ Q;  2WAQ E;  4LUO A;  1YJ9 A;  1SYB A;  4KJN A;  1O7Y A;  1T5E A;  1TS2 A;  4QIW E;  4GOP B;  5M5Y H;  2RBM A;  1EYC A;  5FLM G;  3KBG A;  1E2V A;  4A3B G;  1IXR A;  4BBR G;  2XWB B;  2QDB A;  3A8K E;  3HP3 A;  5C44 B;  3PIO A;  2YTY A;  5LMN Q;  1EWI A;  2EZV A;  1BDO A;  3P7J A;  1N32 Q;  2CKZ B;  5T1I A;  3D0F A;  3HEJ A;  1WVL A;  4BY7 G;  2NB0 A;  3NHH A;  4HED A;  4H13 C;  1EOT A;  4A3G G;  4GN5 A;  3S24 A;  4L5T A;  4N8F A;  5JPM C;  3JAM E;  2AQ3 B;  4L8J A;  1O80 A;  1Y1V B;  3EFX D;  1SYG A;  4GNX B;  3VDY A;  1WTP A;  3H6M A;  1XTC D;  3GO5 A;  5EPK A;  5IP7 G;  3DM1 A;  4RWS C;  3BDO A;  1QVF A;  2BCO A;  2X69 A;  3FPP A;  3L2P A;  4ULL A;  4O42 A;  1PMR A;  4AYB G;  1MBY A;  2SDF A;  2B29 A;  1Q82 C;  4F87 A;  4OO1 I;  1FL0 A;  1FJG Q;  3GTQ B;  2Z6B A;  3H15 A;  2EY2 A;  3NBH A;  4Y7N B;  3CCJ A;  3M7N A;  1I6H B;  1XX8 A;  4ZRZ A;  2BA1 A;  2ENB A;  5C0X J;  3SK4 A;  1I94 Q;  4NP5 A;  1WTR A;  3VYT A;  1W6K A;  4DK1 A;  4ZYS A;  5LL6 S;  3D4W A;  5DEH A;  2ZTD A;  4OX9 L;  4JCV E;  4C3H G;  1HNW L;  1F9R A;  3F1Z A;  3OWF A;  4QL5 A;  5IGG A;  4U67 3;  1WCM G;  1GXD C;  1VQE A;  1L2F A;  1D2B A;  1EFW A;  1LV9 A;  1H9R A;  2ICI A;  1TXY A;  1STH A;  4K0K L;  4LF7 Q;  3K57 A;  4IUU A;  1MSG A;  4KD4 A;  3HOX H;  1VQB A;  2NZO A;  2CH4 A;  3PMF A;  3HOY B;  1J8I A;  3PUW A;  3SDZ A;  5DAU A;  2F4I A;  2HT1 A;  2G9D A;  3Q0A A;  4DV6 Q;  2B39 A;  5IT9 E;  1Z7T A;  1CA5 A;  5FO9 B;  4JI2 Q;  1TWF B;  3CCL A;  3V05 A;  5IGB A;  2E2D C;  3E0J A;  3I4L A;  3A74 A;  4CKB A;  2F0P A;  2UUB Q;  4ZKB B;  2XRS D;  2EYO A;  2EYP A;  4HSV A;  3GTP H;  2PW7 A;  3X3M A;  3CMA A;  3S15 B;  1ENC A;  3MFY A;  4IUQ A;  1J5E L;  1KIX A;  3PO2 H;  4CDE C;  4K14 A;  1HUN A;  2E5L Q;  2BE5 C;  2A5H A;  2R7Z G;  4FP5 D;  4L6T B;  4A93 H;  1GO3 E;  2WB1 E;  2JEB I;  1SLJ A;  2L9H A;  1EU4 A;  2Q8I B;  2KVM A;  5KEE A;  1BXT A;  3RNU A;  1A2T A;  2NWG A;  3OSO A;  2ZJQ A;  1NSN S;  3A5U A;  2QCP X;  1TWG B;  4KY5 A;  1PYS B;  1HJP A;  4OO1 H;  3K7U C;  2ZTC A;  2VUM B;  1S3O A;  1JC7 A;  2IT1 A;  4JI6 L;  4IPC A;  2D9U A;  4BS9 A;  2C5C A;  4TQU S;  4DR7 Q;  2AQ2 B;  4EQ5 A;  3U9O A;  1GUW A;  2L5T A;  2A69 C;  1CKO A;  4AQY L;  2K14 A;  4YWM A;  4WFN 3;  1YZ6 A;  1AZQ A;  3DEO A;  2F1M A;  4DR3 L;  2A68 C;  4G4K A;  1Z9F A;  2OEO A;  2F0L A;  1WOC A;  2VB3 X;  4TVA B;  1B3A A;  3GTM B;  2TMP A;  1SFO H;  1EIY B;  1EU3 A;  2RSN A;  2HIX A;  3CD6 A;  4NXN Q;  1VQP A;  2F4V Q;  4B3T Q;  4WJ3 M;  1X3G A;  4B9W A;  3HOU H;  3S2D B;  5IT9 c;  3J81 i;  1ENF A;  2MJ8 A;  1F2Y A;  2PQE A;  4E6I A;  1C7Y A;  2PW5 A;  4DR6 Q;  2VXW A;  3H0G H;  5EBC A;  2K5Q A;  2VS1 A;  2VNU D;  1PXU A;  2UXB L;  3RN5 A;  4JI0 Q;  3F2U A;  4I7Z C;  2UU9 L;  2RF4 A;  5CC4 A;  1IYJ B;  2UUC Q;  2QGQ A;  4V19 0;  1B70 B;  4GLX A;  4LFB Q;  1JT8 A;  4U68 A;  3ER0 A;  3P1H A;  4DAY A;  4HIK A;  3A8I E;  1TWA B;  1CHP D;  4O2D A;  3VYS A;  2ALY B;  4RG1 A;  5BN5 A;  4PNY A;  4RHR A;  1B3Q A;  2MNA A;  5IGE A;  3VYR A;  2PCF B;  3KBX A;  3T1Y L;  2F0S A;  1VQ4 A;  2ZM6 L;  3HOW H;  1HR0 L;  2JA5 H;  5IP9 H;  4CDD C;  5HGT A;  4V0B A;  4OEM B;  5IGD A;  1B1Z A;  3HOX B;  5COY A;  4K5X A;  1AW7 A;  1XNR L;  1JR0 D;  1XTD A;  2OQK A;  2NVQ H;  4A3I B;  4M1U B;  2VUM G;  2RCN A;  3KOJ A;  3RUZ A;  2IHF A;  5LMU Q;  2EY6 A;  4JI5 Q;  3M9B A;  3J7A V;  1D7Q A;  5FLX L;  3UI2 A;  4XYQ A;  3A7L A;  4FVM A;  1CSP A;  4J8Q A;  1BBX C;  4UPA A;  3MFG A;  2EYF A;  1STG A;  3W1B A;  1SN8 A;  4ILW A;  1E1O A;  3GTP B;  3ICE A;  4J15 A;  4K5W A;  1OTC A;  1L0Y B;  3PO2 B;  3J80 c;  2K5H A;  2B2T C;  1I50 H;  4IPH A;  1L0X B;  1KXL A;  1A8V A;  1CSQ A;  2WP8 J;  4IUR A;  3OTO Q;  1KRT A;  4DV7 Q;  1G6Z A;  1PFN A;  1MGS A;  4A3I H;  5M3F B;  2AWO A;  3DWA A;  1PH2 A;  4PMC A;  2QA4 A;  1NTG A;  1Q8I A;  1S5C D;  2B2V A;  2EE1 A;  1OXS C;  2KJX A;  2ZXP A;  3HKS A;  1IW7 C;  1DOL A;  3I7F A;  2F3I A;  3KF8 A;  3PUV A;  4X3U A;  2K7V A;  1FNV A;  5IYD H;  4B3S Q;  3UDG A;  4JV5 Q;  1GUS A;  1E22 A;  2OXP A;  2RQX A;  1DZ1 A;  1KLG D;  4IQZ A;  1VQM A;  2WKD A;  1Q7Y C;  3FKI B;  1MSH A;  3VYU A;  3V96 A;  5C5M A;  1JJG A;  4CHT B;  4DUZ Q;  4DV3 Q;  2XVS A;  3BG3 A;  2N8N A;  3Q22 A;  4HTH A;  5FJ8 H;  5FO7 B;  3UE1 A;  2EJG C;  2XIW A;  1SFO B;  3TRZ A;  4A3J H;  2QKI C;  4ZCK A;  5C4Z A;  1ZYR D;  1MIU A;  1PTO D;  2MUY A;  5AJ3 Q;  2Y0S B;  3BZC A;  2LS0 1;  5J39 A;  1IYU A;  1CT1 D;  4IFD J;  2K50 A;  5M9O A;  2R93 H;  4DK3 C;  1SRO A;  4A3L H;  1YNN C;  4K6L A;  2K5V A;  2K5N A;  2WAQ B;  3H0G B;  4A3K H;  1PH4 A;  2OCE A;  3HOX G;  1KQS A;  4DUY L;  2JA6 B;  3R93 A;  3GTG H;  4QIW B;  4PMW A;  3S16 H;  2F0T A;  1X32 A;  3S14 H;  3TS0 A;  4RCO A;  1VS0 A;  1E3P A;  5FO8 B;  4BBS H;  1LO5 D;  2FMC A;  3TEH B;  3SK5 A;  4GLV B;  1S5D D;  5KYI A;  4HAE A;  4NPS A;  4DKA C;  3FP9 A;  2MPM A;  2CQA A;  1JOO A;  2KUM A;  5EKK A;  1YNX A;  3J81 j;  2F0H A;  1ZYR C;  3A54 A;  1PTO C;  4HMJ A;  4NDX A;  1HNZ Q;  3NK9 A;  3RZO H;  4HIM A;  1H9S B;  1AZP A;  1X54 A;  2LY7 A;  3KJO A;  4XXE A;  1M8A A;  3RR5 A;  4DNT B;  3PO2 G;  2SEB D;  3K80 C;  1B4O A;  1STB A;  4A3E H;  1Y14 B;  1UE1 A;  4K6D A;  4A4I A;  1I5F A;  1KL9 A;  2CVR A;  4IJH A;  1JWU D;  3FMC A;  1LTA D;  3CF5 A;  4A93 G;  5JVH 3;  2Z6K A;  1A3T A;  1PH8 A;  1TWC B;  5EJW A;  5C0X G;  1MD2 D;  2CW0 C;  3PV0 A;  2B2V C;  5M3F G;  1Q8K A;  3CPW A;  2IX1 A;  4LF9 Q;  4RGM A;  3A8J E;  3S1R B;  1KTK A;  3KF6 A;  3PUX A;  4HIO A;  1SNC A;  3BVM A;  3Q23 A;  1ASZ A;  2GVA A;  4OO1 G;  1Q1E A;  5GAD C;  4LF6 L;  3FHW A;  2RDH A;  4DAM A;  3AYH B;  2RDG A;  1S5F D;  1RTO A;  3U4Z A;  4DR2 L;  4PQX A;  4DV2 Q;  2LSS A;  1K8O A;  3M85 A;  3QB3 A;  4OGQ C;  4AIM A;  1D6E C;  1PH6 A;  1EWH A;  2XTI A;  1ZEQ X;  1BCP C;  3CCV A;  5C44 H;  3T1H Q;  2RCF A;  1G2T A;  4QUC A;  3I4M B;  2DUD A;  4JI1 L;  1L0W A;  1N33 Q;  4R4O A;  2Q8T A;  1XNQ L;  1IBL Q;  3ERQ A;  2R3Z A;  2Y0S G;  1I50 B;  1CQF A;  4RMF A;  4JBM A;  1AEX A;  5COR A;  4R4T A;  4IOA A;  3HOU G;  1IBK Q;  5JJZ A;  1F9P A;  1Y1V H;  2SOB A;  3D31 A;  2PO4 A;  5C3E H;  3H0G G;  1WI5 A;  1S72 A;  4Z9C B;  3HG9 A;  4FYD A;  1IZ6 A;  3KF8 B;  1O7L A;  2Q2T A;  4DR5 L;  2IHE A;  3GTQ H;  1L1O A;  4KHP L;  2LKV A;  2YTX A;  2A74 C;  3Q8D A;  1HHV A;  2V1C C;  3GQB A;  3I70 A;  4JBJ A;  2RSO A;  1ML0 D;  2OF1 A;  4N8X 1;  2N49 A;  2QIL A;  1WTW A;  4APV A;  4OON A;  2DN8 A;  2ES2 A;  3ULP A;  4QGU A;  1S5B D;  2JXM B;  2AQ1 B;  1N9W A;  1TQO A;  2L0C A;  4LF8 L;  4WJ4 A;  4JI4 L;  2I5H A;  3IFT A;  3PUZ A;  1YJN A;  4OXP A;  2EYJ A;  4QY7 A;  2Z6K C;  4EQN A;  5FOB B;  4RHS A;  3FVQ A;  1G8Z D;  3E6Z X;  3HOW G;  4B3R Q;  1Z6H A;  3OPO A;  2R93 B;  1B2T A;  2JA5 G;  4DAV A;  5IP9 G;  1LTG D;  1WTH A;  3KK7 A;  1B9N A;  3HOY H;  3RLN A;  4OWW B;  3URY A;  2NVT H;  4A3K B;  4QB4 A;  1VQH A;  1CHQ D;  2NUC A;  3GTG B;  3S16 B;  3S2H H;  1DXM A;  5TSS A;  2CWA A;  2KEE A;  2F3W A;  1X56 A;  5EAY A;  1RKN A;  4BBS B;  4FNF A;  3UDF A;  1EIF A;  1ET9 A;  1EYA A;  5KGU A;  1N34 Q;  3D6W A;  2RHQ B;  4ME5 A;  5BN4 A;  3RZO B;  3MTS A;  5IYC H;  4DV5 Q;  2AMC B;  5LL6 X;  2VQF Q;  1SNQ A;  1B53 A;  3J7A F;  5E3F A;  3CAM A;  4A3E B;  3K6O A;  4L5R C;  1XMQ L;  2JN4 A;  1EIG A;  3NEL A;  3J80 i;  2EY5 A;  2E2J B;  3ULL A;  4X62 Q;  3PIP 3;  5M3M H;  1ET6 A;  1TII D;  4QCL A;  2E2I B;  3K5O A;  4A3I G;  1X6O A;  1VF7 A;  1TWG H;  2NVY B;  4DV0 Q;  1PRT B;  1L1O C;  2AHO B;  5JJI A;  1YHB A;  3MXN A;  5ELC A;  5LHY 1;  2H1E A;  3TSS A;  1S40 A;  1C8C A;  2QEX A;  5LMN L;  5D14 A;  3VR3 A;  1D1K A;  3U50 C;  1N32 L;  1D1I A;  2DGY A;  2XWJ B;  1PH5 A;  1JE5 A;  5IYD G;  4DXF A;  4X65 Q;  1UAP A;  4C3I H;  2C9O A;  1TY2 A;  4A3C H;  1VCI A;  3GTM H;  1Y1W H;  4UAI A;  1J9O A;  3H09 A;  3L0O A;  5ELN A;  2PNH A;  1PH7 A;  3I4O A;  5FJ8 G;  4X3T A;  5JEA J;  4A3J G;  3S2D H;  4RCN A;  5EQ0 A;  3J7Z C;  2NVX H;  1IKM A;  2MQH A;  1PFB A;  1FJG L;  1CK1 A;  2D62 A;  2F0G A;  4JYA Q;  3TME A;  2ZXR A;  4TRD A;  4XYO A;  1BVS A;  2MO1 A;  1SYD A;  4R4C A;  2R7F A;  5C0X I;  2R93 G;  1Q90 A;  3BVZ A;  2BOS A;  2HCC A;  4A3L G;  5G3L F;  5M5W H;  5T1G A;  5C3E B;  1I94 L;  1L1O B;  4A3K G;  2JK8 A;  4IUT A;  1IYV A;  1JOK A;  1EYG A;  3MXG A;  1HRJ A;  4PG3 A;  1VQA A;  1SE2 A;  2A73 B;  4XQN A;  1U5K A;  2Q2U A;  1DOM A;  5E4W C;  3PO3 B;  3T53 B;  1JWS D;  2SNM A;  1QUQ B;  4YCW A;  3T56 B;  3NWS A;  1B9M A;  3OHX C;  3K5L A;  4RKB A;  2ZJP A;  2D2C C;  1NE3 A;  4DXG A;  4BBS G;  1TWA H;  1VQG A;  3NTI A;  4G7H C;  3PIO 3;  1DM0 B;  2MP1 A;  2P5Z X;  3D4R A;  4EQO A;  1XPR A;  1S5E D;  1RJT A;  2AKW B;  3Q24 A;  4GKJ Q;  2UUA Q;  4LF7 L;  1U0L A;  1JOQ A;  4YCV A;  3I4N H;  2KHS A;  1KNE A;  2RKS A;  2K01 A;  5D3I B;  1AH9 A;  3TBI B;  1RDP D;  1HA6 A;  2K32 A;  4A3E G;  4KY6 A;  3A56 A;  4C3J H;  4DV6 L;  1I4G A;  2YYZ A;  5KRU A;  3OMG A;  1XXG A;  4ABN A;  2E2H B;  3VA7 A;  4JI2 L;  3TQY A;  2UUB L;  3CC2 A;  2EIF A;  1EIH A;  1SDF A;  5JEA H;  2UXC Q;  2JA9 A;  3NEN A;  2L1B A;  2NVT B;  1Q3L A;  4LF4 Q;  1DD2 A;  1UE6 A;  3SK8 A;  2N78 A;  4QUF A;  4X6A H;  2OTJ A;  4GKK Q;  1BBW A;  4KMU C;  4IAL A;  3S2H B;  1H9M A;  1O7Z A;  4L5Q A;  1VQK A;  2BDN A;  4JPB W;  3JAM c;  3KUP A;  2OT2 A;  3VR6 A;  3EBE A;  2DNE A;  2BH2 A;  4K5V A;  5IGC A;  4CJ0 B;  5I6Y A;  2VQE Q;  3MHB A;  1HR0 W;  2VY3 A;  1V1P A;  4X3S A;  5C44 G;  1CM9 A;  4KN7 C;  3D4D A;  1G29 1;  4ALP A;  1D5M C;  3HKZ E;  4IPD A;  5GAH C;  2EXD A;  1H95 A;  4J1M A;  3ZYY X;  2GN5 A;  5C0X H;  1QG7 A;  2QEJ C;  1A15 A;  1PRT F;  4DR7 L;  3SK6 A;  4LFA Q;  4NW2 A;  2G5D A;  5M3F H;  4B3M Q;  1GUT A;  3A55 A;  2HHH Q;  1Q12 A;  1Y1V G;  5M3M B;  4HJ7 A;  2RDF A;  1FGB D;  3MXN B;  1KLU D;  5C3E G;  1ESR A;  1PH1 A;  3F2D A;  2IY5 B;  5IWA Q;  4NXM Q;  3GTK B;  1BF4 A;  3FDT A;  2UXD Q;  2BA0 A;  4HID A;  3S1N B;  4R1J A;  4NXN L;  2F4V L;  1QCB D;  4B3T L;  2ASB A;  2ZJR A;  4TSS A;  3DEP A;  4KKU A;  3FKI H;  2F0I A;  5IT9 L;  3C46 A;  4DR6 L;  4C3I B;  5CV5 A;  3NTH A;  1GUG A;  1M4V A;  3OW2 A;  2A1A A;  3K0Y A;  4JI0 L;  1Y1W B;  5CBA E;  3C2P A;  1C4Q A;  1EY6 A;  1E0B A;  2KCN A;  1HUM A;  2VL6 A;  1IL2 A;  3TZD A;  2GVB A;  1SNM A;  2LFN A;  3I8Z A;  2UUC L;  3S17 B;  3ITP A;  2NVX B;  2B2T A;  4AYB E;  1IHZ A;  4LFB L;  4YIJ A;  4ZQ3 A;  3MZ5 A;  4KHZ A;  4M8A A;  2M00 A;  3K8A A;  5JVG 3;  3OOC A;  4RA8 A;  4POG A;  4C56 C;  1K0S A;  4MHE A;  5ELO A;  2JA6 H;  1PYB A;  2K28 A;  5M5W B;  5K5P A;  4DAP A;  3HOY G;  4BY1 B;  4JI6 Q;  2J0T D;  3EJI A;  4P73 A;  1Q81 C;  1CQV A;  1HZA A;  3J7A 5;  3CC4 A;  3NBH B;  5JJK A;  1CUK A;  4K8J A;  5JAV A;  4L5S A;  2KEN A;  4OWT B;  3VR2 A;  4K2L A;  3KLW A;  4UP8 A;  1IKL A;  5EKI A;  3K59 A;  2EDG A;  1X3F A;  1EY9 A;  1P16 A;  1SSO A;  1MJE A;  2F0D A;  4CDF C;  5FLX E;  3BVG A;  1LTS D;  4DV4 Q;  1DGS A;  4GN4 B;  1H9K A;  1VQ5 A;  2IX0 A;  1Q1B A;  2PI2 E;  5IYC G;  1XWE A;  1KRS A;  3I90 A;  4KV6 A;  5BR8 Q;  3I4N B;  4GLA C;  1HFG A;  1NAP A;  4DV1 Q;  1FR3 A;  2PQA A;  4I65 A;  3T16 A;  3AFQ A;  1TWC H;  5J22 A;  1B7Y B;  4JI5 L;  5LMU L;  2XRQ D;  4S3S A;  4PMB A;  4C3J B;  2F0F A;  4YHH Q;  1PA6 A;  5M3M G;  1K28 A;  2R6G A;  3S1R H;  4XQJ A;  1VQJ A;  4QMG A;  3M4Y A;  1DJR D;  1V1Q A;  1LTB D;  4LWC A;  1YIJ A;  3H3V C;  1WTO A;  3HS0 C;  4R4Q A;  5CV6 A;  4X64 Q;  1O78 A;  1VQL A;  3PSI A;  1IBM Q;  2LMC B;  5CV8 A;  3J80 L;  3STB D;  3OTO L;  3AB9 A;  4DV7 L;  1CZG A;  3NWT A;  2KOL A;  4X66 Q;  1V1P B;  3T4A C;  3BU2 A;  5C4X B;  3R8B A;  4YY3 Q;  3U4V A;  5C5L A;  4C3I G;  1K8G A;  2KEC A;  5D65 A;  2JA8 H;  4GN3 B;  3I4M H;  4A3C G;  4G7O C;  1Y1W G;  1LTI D;  4RFB A;  4IUP A;  1ASY A;  1SMY D;  1N36 Q;  1XPU A;  4LF5 Q;  4R8I A;  2XGT A;  4OIK A;  2M2L A;  2NZ1 D;  1VQD A;  2LXJ A;  3C1F A;  3KFU A;  4JVZ A;  3K5N A;  2EYH A;  4B3S L;  3DWP A;  1HTL D;  3LWU A;  1MI2 A;  2VZA A;  4KK7 A;  3A0J A;  2XSC A;  5A2Q L;  1QZG A;  4JV5 L;  1FVI A;  2X6G A;  2EPB A;  2EQS A;  2ATW A;  1STA A;  4PZ8 A;  5FLX c;  4DUZ L;  3HOZ H;  4DV3 L;  2RA4 A;  5KIX A;  4JOI C;  3TRE A;  2FFK B;  4IFD I;  4JC0 A;  2F0E A;  1EQV A;  1TS5 A;  4JG2 A;  5AJ3 L;  4HCS A;  1JB3 A;  1GHJ A;  1LTL A;  1DOK A;  2FXQ A;  4K8I A;  4L63 B;  4NKL A;  2QDL A;  2PZT A;  3SR1 A;  4MZ9 A;  3M7G A;  3CCM A;  3R3O A;  3I91 A;  1Y69 U;  3GTO B;  4IN3 A;  4H44 C;  3K81 C;  1EY8 A;  1AFP A;  4R8N A;  4ZUI A;  2FJ2 A;  1YIT A;  1HNX Q;  3I4N G;  1LT5 D;  3IRB A;  3SHL A;  1ICW A;  1VF5 C;  4C3J G;  3A5Z B;  2JA7 H;  5ELE A;  1LYL A;  4KY7 A;  4MTN A;  1JWM D;  5EBD A;  1RF2 D;  2AUJ D;  5CR3 A;  2HUG A;  4I7A A;  5DM7 3;  1HNZ L;  3F8T A;  5JEA G;  4KTA A;  2PPB C;  1WTX A;  1SE8 A;  3DXJ C;  2ID0 A;  5EKL A;  4HJA A;  1GM5 A;  1QOH A;  4DAY B;  2Z9H A;  2ZXO A;  1EEF D;  1LT6 D;  4UY8 C;  1GUN A;  2HDM A;  3LX0 A;  3NTK A;  4ODG A;  1JB7 A;  1RIP A;  3CCE A;  1IL8 A;  1D8L A;  1Q86 C;  1C48 A;  2Q8R E;  3JAM i;  4LF9 L;  4B08 A;  2K04 A;  4CGY B;  2K4K A;  1GOZ A;  3K7A H;  1XMO Q;  2AWN A;  4JI3 Q;  3TP7 A;  3RD4 A;  3QO2 A;  1E2Z A;  2OWO A;  1KHI A;  2IX3 A;  4RGN A;  2E2J H;  3MEH A;  2N88 A;  3TZU A;  1DYQ A;  2E2I H;  4DV2 L;  4KI0 A;  1F2Z A;  4DUY Q;  4H7B A;  4A3M B;  1VDZ A;  2NVY H;  4LFC Q;  4LMQ D;  1X55 A;  3QOJ A;  3QOL A;  3GDE A;  3T1H L;  4IFD H;  3MC0 B;  3W3A A;  4JI7 Q;  1K9M C;  1VQN A;  3S1M B;  2B2U A;  2KED A;  1EQR A;  1N33 L;  2O2L D;  4G57 A;  3BYT B;  4N9P A;  3GTL B;  1BR9 A;  1IBL L;  1VQF A;  1U9R A;  3RZD H;  3EIV A;  1X9N A;  2XNA C;  1E7Z A;  2JSO A;  2IW3 A;  4F7X A;  1IBK L;  3CC7 A;  1A2U A;  4YWL A;  5L37 A;  5J3B A;  1PTO B;  2A6H D;  5D3D A;  2FHT A;  3CRL C;  3FKI G;  3GV6 A;  4JI8 Q;  5I9P A;  2MHV A;  2PI2 A;  4H0L C;  2JA8 B;  1TS3 A;  3OYY A;  1Y8N B;  3OW7 A;  1AE3 A;  1CA6 A;  2A6E D;  2KQ3 A;  2EOT A;  2PMZ E;  2BDO A;  3DLL A;  1K73 C;  1EUJ A;  1ZXT A;  2DY7 A;  2L15 A;  4UP9 A;  5LMN W;  1KDC A;  4F88 A;  4DR1 Q;  1H9J A;  3G71 A;  2I07 B;  1TVX A;  2WAQ G;  4LK1 C;  1WJJ A;  2JA6 G;  2HD3 A;  1ZKO A;  1I6V C;  5GRO A;  3PO3 H;  2H5X A;  2JP1 A;  3HOZ B;  3A7A B;  3I56 A;  1X65 A;  1VQ6 A;  2F3V A;  1HPC A;  3M4P A;  1NMG A;  1FGU A;  1ROD A;  3D3R A;  5ELD A;  4AH6 A;  3E9I A;  2CCZ A;  1FNU A;  1SYF A;  4RKL A;  3J81 L;  3W2D A;  4O0A A;  4JBW A;  4B3R L;  4IUV A;  1EOV A;  2A6E C;  3MEF A;  3MXU A;  1BCP B;  1GVP A;  4CKE A;  4GNX A;  2JE6 I;  2WB1 B;  3AEV A;  2WII B;  3D6C A;  1C0A A;  2YTV A;  1LT4 D;  1YJW A;  2EY1 A;  5FK9 C;  1PFM A;  1G91 A;  4EVO A;  1QIL A;  2I5L X;  2MO0 A;  1PRT D;  3DMU A;  1UE5 A;  4LAA A;  2E2H H;  2DJF C;  1I4P A;  1F2L A;  3M3Y H;  4IPG A;  2JA7 B;  3R2I A;  3I3C A;  5FKA C;  1LT3 D;  1W3S A;  2D0P A;  5HY6 A;  3T13 A;  3HOV H;  3ND8 A;  1N34 L;  2B2U C;  3NQI A;  1QVG A;  5JJL A;  1A63 A;  1STN A;  4DV5 L;  1QVC A;  1Y8O B;  3J7Y W;  1UEA B;  2WIN B;  2VQF L;  5C3W A;  3P20 A;  1K0R A;  3QJY A;  2CHB D;  3AFP A;  4QJF A;  1LAB A;  5K36 H;  4X62 L;  5CMD A;  1JQY D;  4DR4 Q;  3N52 A;  5KYL A;  2JA8 G;  3I4M G;  4AYB B;  4PZ7 A;  4DV0 L;  4PZ6 A;  1ILP A;  3U9S A;  3K7A B;  4PV1 C;  3W5O A;  4IUN A;  1R4Q B;  3MVV A;  1EQT A;  3UDX A;  2F0N A;  3KLR A;  2IWH A;  1G51 A;  2YV5 A;  3IKJ A;  2I46 A;  1B50 A;  4X65 L;  3KF6 B;  2B2W A;  3ERS X;  5I2X A;  3BZK A;  4EX5 A;  4BA2 I;  1XJV A;  3GTK H;  1PVO A;  2E74 C;  3S1N H;  4LNQ A;  3HOZ G;  1SYC A;  1PTO F;  4BWG B;  1WCM B;  5ELB A;  3HZX A;  2V4D A;  1M1K C;  1CI3 M;  1SRU A;  1P8L A;  1OXV A;  4JYA L;  2VW9 A;  4GNX C;  2Y0S E;  3PGZ A;  1KAB A;  3RZD B;  5CV7 A;  4H02 A;  3BDC A;  4QF4 A;  4Q0F A;  3WOE A;  1K3R A;  3KJP A;  1EYD A;  4DPG A;  4HJ8 A;  1BQQ T;  2K5D A;  1LAC A;  2WB1 G;  2PZU A;  1SAP A;  2KHI A;  5DLQ E;  3CCU A;  2CQO A;  1RCV D;  2IJ0 A;  1VQO A;  1TWH B;  4A3F H;  3S17 H;  1PV4 A;  4DA2 A;  1SBB B;  1GHK A;  3CPF A;  1STE A;  3SGI A;  1EWC A;  5H1S E;  3FPU B;  3OIP A;  5I4D A;  3QIA A;  4BA1 I;  2JA7 G;  4N9T A;  1QJO A;  3CRK C;  3QWN A;  4C1N K;  5IYB H;  3ONA B;  3RLF A;  1Y8P B;  4A3D H;  4BY1 H;  4DNI A;  5M5X H;  1KAA A;  1X3E A;  4GKJ L;  2UUA L;  3H3V I;  3AU7 A;  3PF5 A;  1VMP A;  5ELF A;  3TP6 A;  2R7Z B;  2F0O A;  1BCP F;  2YU9 B;  4GS3 A;  1YEZ A;  2HIV A;  3CU7 A;  1B8A A;  4DFA A;  4MIU A;  1VMC A;  1SE4 A;  5IGF A;  2NN6 I;  5J1Z A;  1Q46 A;  2O4X A;  1PLF A;  5C3X A;  1G2S A;  4IO9 A;  1K83 B;  4FO2 A;  3PCO B;  3X3N A;  2UXC L;  2K33 A;  4KLK A;  3OWE B;  4LF4 L;  3M4O H;  2RVL A;  3H94 A;  2BH8 A;  1VQI A;  2EYM A;  3SE0 A;  2F0Q A;  4GKK L;  2D5D A;  4J6H A;  5KNB A;  2B2W C;  3H91 A;  4KHV A;  3M3Y B;  2G9H D;  4WJW A;  3EVQ A;  2CFM A;  2VQE L;  2I0Q A;  3JAM L;  1W6J A;  2Z0S A;  3HOV B;  1A3U A;  2F0W A;  1D5Z C;  4EGV A;  1GJX A;  1RHP A;  4IFD G;  1K8M A;  3TS2 A;  2K75 A;  2B63 H;  2MGS A;  4CBV A;  2E5L L;  2M9V A;  2F0J A;  1HZB A;  1JJ2 A;  3KLS X;  2BE5 D;  5C4X H;  4R4I A;  1V43 A;  5DNF A;  1U4R A;  1Z47 A;  4LFA L;  3KYH C;  5EGT A;  4B3M L;  5JOB A;  3ZJY C;  1F2M A;  2HHH L;  1U4L A;  3RLO A;  5IOC A;  4OX9 Q;  1QZH A;  1TU2 B;  3DHQ A;  1HNW Q;  3Q6S A;  1SNO A;  1DCZ A;  3AMU A;  1GD7 A;  4WOR A;  1EY4 A;  2R7D A;  3D8G A;  2JQO A;  5IWA L;  4NXM L;  2WFW A;  2WKC A;  5BN3 A;  2JYO A;  2UXD L;  1YBY A;  4K0K Q;  3G6E A;  2HCI A;  2ZT9 C;  3RN2 A;  1DON A;  1X3P A;  2JEA I;  1QNK A;  1F9Q A;  2JJQ A;  1QWY A;  4A76 A;  5KNC A;  2SNS A;  2A69 D;  4FXD A;  1YVC A;  3H3V H;  4POF A;  5EPJ A;  4ZUJ A;  2H4O A;  4DNR B;  3VR4 A;  3M4Q A;  2A68 D;  4JW0 A;  1BNZ A;  3PO3 G;  4A75 A;  3OIQ A;  5I9O A;  1KAW A;  4CJ2 C;  4P2C B;  2NN6 H;  3MAQ A;  5IY0 A;  1BO0 A;  2AUK A;  1PFS A;  1J5E Q;  4XQQ A;  1FNW A;  4GZY C;  2NZH A;  2K05 A;  2L11 A;  3GTO H;  1M90 C;  3NSW A;  2LXK A;  1TR5 A;  4IJL A;  3AQQ A;  3S1Q B;  2K52 A;  3MWY W;  1NJI C;  4A3F B;  3CHB D;  1HCZ A;  2R92 H;  5A35 A;  1HZC A;  3HFZ B;  4G7Z C;  1LLR D;  1SMX A;  1YHQ A;  1A6X A;  2IPK D;  5GQO A;  5M5Y B;  2DY8 A;  1A0I A;  2QW7 A;  1CFM A;  2OQ0 A;  4FXK C;  2N55 A;  4P75 A;  3FEW X;  4ID6 A;  1E24 A;  3BJU A;  4A3D B;  5IIF A;  4DV4 L;  5M5X B;  2CWP A;  3DWQ A;  3HOV G;  4ME3 A;  2MFI A;  3CME A;  4P74 A;  5BR8 L;  4AQY Q;  4C1N I;  4JOI A;  2FIN B;  3E9H A;  4DV1 L;  3K5M A;  1XPO A;  1CZW A;  1KDB A;  4DR3 Q;  1JCK B;  4TKO B;  5HUR A;  1YNJ D;  3GP7 A;  1V8Q A;  5IOD A;  1SXT A;  4R9W A;  5CBE E;  5K36 G;  1NMF A;  4YCU A;  4YHH L;  3PF4 A;  3C1E A;  1V9P A;  1B44 D;  2PMZ B;  2F0V A;  3UDI A;  2OTL A;  4HCE A;  3J80 E;  1LM0 A;  2KCT A;  3BDL A;  1VQC A;  1ICF B;  1ENA A;  4X3K A;  2KCC A;  1HH2 P;  3NP8 A;  4DK0 A;  3TN2 A;  1HFN A;  4OHJ A;  3OMC A;  4MN3 A;  3M4O B;  4UDU C;  4X64 L;  4DF7 A;  4WRD A;  2J7Z A;  4LUV A;  1IBM L;  2UXB Q;  4A3M H;  1EY0 A;  2UU9 Q;  2K6A A;  3NPP A;  4FF3 A;  4NB3 A;  2L12 A;  3GTJ H;  1CKN A;  4X66 L;  4XTC S;  1UE7 A;  4YY3 L;  2EJM A;  4RGO S;  1H9S A;  3WDN A;  1PZJ D;  3S1M H;  4F8M A;  5A2Q E;  1MKH A;  1II3 A;  1ONL A;  1UNS A;  1YNJ C;  3L7Z C;  1N36 L;  3GTL H;  1AE2 A;  5HGQ A;  2B63 B;  4LF5 L;  3SEB A;  3IL8 A;  3I55 A;  4DU9 A;  1UUP A;  4NMZ A;  1PTO H;  4OIJ A;  1F9S A;  3CQZ H;  1WD0 A;  1TY0 A;  4UP7 A;  1PDQ A;  2Q2H A;  3G7L A;  3NUC A;  5CV4 A;  3K58 A;  3T1Y Q;  2A8V A;  2XN9 C;  1TS4 A;  4ZAI A;  3GV3 A;  1FYC A;  1E1T A;  2B8F A;  3I2Z A;  4BXX H;  1I4H A;  1WFQ A;  1SNP A;  2ZM6 Q;  2F0K A;  1SYE A;  2KHJ A;  4XT3 B;  3TP5 A;  4B9X A;  2K5W A;  1HR0 Q;  3CW2 C;  4A3F G;  1IW7 D;  3NEM A;  3EN2 A;  4JBK A;  3EA6 A;  3I73 A;  3ERO A;  3IAY A;  2NYZ D;  3KDF A;  3MXP A;  1NCV A;  3T51 B;  1XNR Q;  1JJC B;  5IYB G;  5C4J H;  1SR3 A;  5CYU A;  4A3D G;  4BY1 G;  3STB C;  1K3B C;  5E7N A;  1PH3 A;  1YI2 A;  3SXH A;  4HSP A;  1I4Q A;  1U4P A;  4JK1 C;  3CP0 A;  1HNX L;  4A93 B;  3G6J B;  2E75 C;  3E3X A;  1MHW C;  1V1O A;  4MTK A;  1SMY C;  5CV9 A;  1TKW B;  2RHS B;  3HGB A;  3B6Y A;  2I5M X;  1NY4 A;  4UHV A;  1D5X C;  4OWX B;  5C4H A;  1YNN D;  3N6R A;  4MNO A;  3C3L A;  4RGT A;  1I3Q H;  2NBF A;  5I2Y A;  1JIC A;  1HQM C;  2L55 A;  3E5S A;  2Z4H A;  2DNC A;  2HDL A;  1JOR A;  3U58 A;  4OL7 A;  4EQP A;  5FLM H;  2R92 B;  4DN4 M;  4A3B H;  1T9H A;  1BBU A;  1K8A C;  4BBR H;  2F0U A;  3NQT A;  4Y52 H;  1RD9 D;  4LW1 A;  1HZ9 A;  4XIG S;  1G6P A;  5F2D A;  3P75 A;  3HRZ C;  1OXX K;  3TP8 A;  2EXZ A;  4DK6 C;  4BY7 H;  4CJ1 B;  4Q5V A;  4A3G H;  1C9O A;  1XMO L;  3QG1 A;  4HN7 A;  2NTS A;  2PNR C;  4JI3 L;  2R61 A;  2B63 G;  3HOU B;  1NR2 A;  3MA2 B;  3BZD B;  3FRP B;  4CDC C;  3CKI B;  1YHA A;  5IP7 H;  5C4X G;  1LTT D;  2HQE A;  1UWV A;  2CW0 D;  4LFC L;  1NR4 A;  1SEB D;  3GD7 A;  1RL2 A;  2PQA B;  2IL8 A;  4C2M H;  5KND A;  1SND A;  1R9T H;  4JI7 L;  4HJ5 A;  1I4R A;  1S4Z A;  1A62 A;  1LTR D;  1UEB A;  1OXT A;  1SE3 A;  3EQL C;  1E2W A;  5IE8 A;  1CKN B;  5G3L D;  1CTM A;  1A3V A;  1PYW D;  5C6A A;  1NUC A;  2CH4 W;  3CCR A;  3GTJ B;  1GUO A;  4C3H H;  1R4P B;  4JI8 L;  1EFI D;  4FDB A;  1XYI A;  2F03 A;  1X3Q A;  4ZK9 B;  2EVB A;  1WCM H;  1BCP D;  1TT2 A;  2EYL A;  3HOW B;  3L9A X;  3ULJ A;  3RMH A;  3VR5 A;  1EQQ A;  2NN6 G;  2JA5 B;  1RTN A;  1I4X A;  3QR8 A;  1SJE D;  2Z4I A;  3DM3 A;  2HQL A;  2N3S A;  4DR1 L;  1VQ7 A;  1HXY D;  3UE0 A;  3CQZ B;  2PYK A;  4KKS A;  3F2B A;  2E8G A;  3NE5 B;  1NNX A;  2WAC A;  3J81 E;  1HA5 A;  1TWH H;  1PHJ A;  3TDQ A;  5DM6 3;  2NVQ B;  4ZKC B;  1EEI D;  5GAE C;  2B2Y A;  3KDF B;  1JE4 A;  2R92 G;  3PUY A;  3SVM A;  2QF7 A;  1STY A;  1EY5 A;  4GOP A;  2Z8L A;  4RH6 A;  1VQ8 A;  3W1G A;  1HQR D;  1T5X D;  3BYY B;  1KDA A;  2X6L A;  2WV6 D;  1KC8 C;  4LF6 Q;  1ILQ A;  2E76 C;  5C4J B;  4KKT A;  1BKB A;  1ESF A;  2R7Z H;  1WYD A;  4DR2 Q;  3DUZ A;  2YU9 H;  2KA7 A;  2A6H C;  4XT1 B;  2A19 A;  2FMM A;  4HR7 B;  1EZ6 A;  4ZLT F;  1BOS A;  5ISR A;  5NUC A;  1WTV A;  2D0O A;  2DJG C;  2F52 A;  4FXG C;  3K0X A; 
#chains in the Genus database with same CATH homology
 2F0M A;  2J4X A;  4K2K A;  2ICE C;  2L4N A;  2Z1C A;  2VB2 X;  3HKZ B;  3LNN A;  4KN4 C;  1QE6 A;  1EL0 A;  4FF1 A;  1I3Q B;  3BS1 A;  1SJH D;  1HTP A;  4A3B B;  4KD3 A;  3IFD A;  4BBR B;  5AFW A;  3I72 A;  3LWE A;  1FD7 D;  3S9W A;  1PZK D;  2NTT A;  1PZI D;  4A3J B;  2O5I C;  1BUV T;  4BY7 B;  4O1N A;  3VA5 A;  4A3G B;  4XDX A;  3WOF A;  1QNU A;  1KNA A;  4IZ8 A;  3NBI A;  5E4X A;  4DGZ A;  1PRT C;  1AP0 A;  2B2Y C;  2K1B A;  1EZ8 A;  3R2T A;  4C2M B;  4FF4 A;  4LJZ C;  1R9T B;  3S14 B;  4CKC A;  1F77 A;  5EPL A;  4RAU C;  3L3O C;  3O13 A;  2B8G A;  5CGK A;  5E1F A;  2PZW A;  3V2T A;  1OO9 B;  5I6W A;  2K03 A;  2GA4 B;  1QB5 D;  4C3H B;  1WD1 A;  1WTQ A;  2TSS A;  4KJO A;  1U4M A;  4HMI A;  3ND9 A;  1EY7 A;  3NXW A;  1OXU A;  3KLS A;  2EJF C;  4FF2 A;  2O5J C;  1AN8 A;  5JPN C;  1SYB A;  4KJN A;  1O7Y A;  1T5E A;  1TS2 A;  2RBM A;  1EYC A;  3KBG A;  1E2V A;  2XWB B;  2QDB A;  3A8K E;  3HP3 A;  5C44 B;  2EZV A;  1BDO A;  3P7J A;  5T1I A;  3HEJ A;  1WVL A;  2NB0 A;  3NHH A;  4HED A;  4H13 C;  1EOT A;  5JPM C;  3JAM E;  2AQ3 B;  4L8J A;  1O80 A;  1Y1V B;  3EFX D;  1SYG A;  1WTP A;  3H6M A;  1XTC D;  3GO5 A;  5EPK A;  3DM1 A;  4RWS C;  3BDO A;  2BCO A;  2X69 A;  3FPP A;  4ULL A;  4O42 A;  1PMR A;  1MBY A;  2SDF A;  4F87 A;  4OO1 I;  3GTQ B;  2EY2 A;  3NBH A;  4Y7N B;  3M7N A;  1I6H B;  1XX8 A;  4ZRZ A;  2BA1 A;  2ENB A;  5C0X J;  3SK4 A;  4NP5 A;  1WTR A;  3VYT A;  4DK1 A;  1W6K A;  4ZYS A;  5LL6 S;  3D4W A;  5DEH A;  4C3H G;  1F9R A;  3OWF A;  5IGG A;  4U67 3;  1GXD C;  1D2B A;  1LV9 A;  1H9R A;  2ICI A;  1STH A;  3K57 A;  4IUU A;  1MSG A;  4KD4 A;  3PMF A;  3HOY B;  1J8I A;  3PUW A;  3SDZ A;  5DAU A;  2F4I A;  2G9D A;  3Q0A A;  2B39 A;  5IT9 E;  1Z7T A;  1CA5 A;  5FO9 B;  1TWF B;  3V05 A;  5IGB A;  2E2D C;  3E0J A;  3I4L A;  4CKB A;  2F0P A;  4ZKB B;  2XRS D;  2EYO A;  2EYP A;  4HSV A;  2PW7 A;  3X3M A;  3S15 B;  1ENC A;  3MFY A;  4IUQ A;  4K14 A;  1HUN A;  2BE5 C;  2A5H A;  4FP5 D;  4L6T B;  2JEB I;  2L9H A;  1EU4 A;  2Q8I B;  2KVM A;  5KEE A;  1BXT A;  1A2T A;  2NWG A;  3OSO A;  1NSN S;  2QCP X;  1TWG B;  4KY5 A;  4OO1 H;  2VUM B;  1JC7 A;  2IT1 A;  2D9U A;  4BS9 A;  2C5C A;  4TQU S;  2AQ2 B;  3U9O A;  1GUW A;  2L5T A;  2A69 C;  4WFN 3;  1AZQ A;  3DEO A;  2F1M A;  2A68 C;  4G4K A;  2F0L A;  2OEO A;  2VB3 X;  1B3A A;  3GTM B;  2TMP A;  1EU3 A;  2RSN A;  4B9W A;  3S2D B;  1ENF A;  2MJ8 A;  1F2Y A;  2PQE A;  4E6I A;  2PW5 A;  2VXW A;  5EBC A;  2VNU D;  2K5Q A;  1PXU A;  3F2U A;  4I7Z C;  5CC4 A;  4V19 0;  4U68 A;  3P1H A;  4DAY A;  3A8I E;  1TWA B;  1CHP D;  3VYS A;  5BN5 A;  4PNY A;  4RHR A;  5IGE A;  3VYR A;  2PCF B;  3KBX A;  2F0S A;  5HGT A;  4V0B A;  5IGD A;  1B1Z A;  3HOX B;  5COY A;  4K5X A;  1AW7 A;  1JR0 D;  4A3I B;  4M1U B;  3RUZ A;  2EY6 A;  3J7A V;  5FLX L;  3UI2 A;  4XYQ A;  3A7L A;  4FVM A;  4J8Q A;  1BBX C;  3MFG A;  2EYF A;  1STG A;  4ILW A;  3GTP B;  4K5W A;  1L0Y B;  3PO2 B;  2B2T C;  1L0X B;  2WP8 J;  4IUR A;  1G6Z A;  1PFN A;  1MGS A;  5M3F B;  2AWO A;  3DWA A;  4PMC A;  1Q8I A;  1S5C D;  2B2V A;  2EE1 A;  1OXS C;  2KJX A;  2ZXP A;  1IW7 C;  1DOL A;  3KF8 A;  3PUV A;  4X3U A;  2K7V A;  1FNV A;  1GUS A;  2OXP A;  2RQX A;  1DZ1 A;  1KLG D;  4IQZ A;  2WKD A;  3FKI B;  1MSH A;  3VYU A;  3V96 A;  5C5M A;  4CHT B;  2XVS A;  3BG3 A;  3Q22 A;  4HTH A;  5FO7 B;  2EJG C;  2XIW A;  1SFO B;  2QKI C;  5C4Z A;  1ZYR D;  2MUY A;  1PTO D;  2Y0S B;  5J39 A;  2LS0 1;  1IYU A;  1CT1 D;  4IFD J;  5M9O A;  1YNN C;  4K6L A;  2WAQ B;  3H0G B;  2JA6 B;  3R93 A;  4QIW B;  4PMW A;  2F0T A;  1X32 A;  4RCO A;  5FO8 B;  1LO5 D;  2FMC A;  3SK5 A;  1S5D D;  5KYI A;  4HAE A;  2MPM A;  2CQA A;  1JOO A;  2KUM A;  5EKK A;  2F0H A;  1ZYR C;  3A54 A;  1PTO C;  4HMJ A;  4NDX A;  3NK9 A;  1H9S B;  1AZP A;  2LY7 A;  4XXE A;  1M8A A;  4DNT B;  2SEB D;  1B4O A;  1STB A;  4K6D A;  2CVR A;  1JWU D;  3FMC A;  1LTA D;  5JVH 3;  1A3T A;  1TWC B;  5EJW A;  5C0X G;  1MD2 D;  2CW0 C;  3PV0 A;  2B2V C;  2IX1 A;  4RGM A;  3A8J E;  3S1R B;  1KTK A;  3PUX A;  1SNC A;  3BVM A;  3Q23 A;  4OO1 G;  1Q1E A;  2RDH A;  2RDG A;  1S5F D;  1RTO A;  4PQX A;  1K8O A;  3M85 A;  3QB3 A;  4OGQ C;  1D6E C;  1EWH A;  1ZEQ X;  1BCP C;  1G2T A;  4QUC A;  3I4M B;  2Q8T A;  3ERQ A;  2R3Z A;  1I50 B;  1CQF A;  1AEX A;  5COR A;  5JJZ A;  1F9P A;  2SOB A;  3D31 A;  2PO4 A;  4Z9C B;  3HG9 A;  4FYD A;  1O7L A;  2LKV A;  2A74 C;  1HHV A;  3GQB A;  3I70 A;  2RSO A;  1ML0 D;  2OF1 A;  2QIL A;  1WTW A;  2DN8 A;  1S5B D;  2JXM B;  2AQ1 B;  1TQO A;  2L0C A;  3IFT A;  3PUZ A;  2EYJ A;  4EQN A;  5FOB B;  4RHS A;  3FVQ A;  1G8Z D;  3E6Z X;  1Z6H A;  3OPO A;  2R93 B;  1B2T A;  4DAV A;  1LTG D;  3KK7 A;  1B9N A;  3URY A;  4A3K B;  4QB4 A;  1CHQ D;  2NUC A;  3GTG B;  3S16 B;  1DXM A;  5TSS A;  2KEE A;  2F3W A;  1RKN A;  4BBS B;  4FNF A;  1ET9 A;  1EYA A;  5KGU A;  3D6W A;  4ME5 A;  5BN4 A;  3RZO B;  3MTS A;  5LL6 X;  1SNQ A;  1B53 A;  3J7A F;  5E3F A;  4A3E B;  3K6O A;  1EIG A;  2EY5 A;  2E2J B;  3PIP 3;  1TII D;  1ET6 A;  4QCL A;  2E2I B;  3K5O A;  1VF7 A;  2NVY B;  1PRT B;  5LHY 1;  3MXN A;  5ELC A;  2H1E A;  3TSS A;  1C8C A;  5D14 A;  3VR3 A;  1D1K A;  1D1I A;  2XWJ B;  4DXF A;  1UAP A;  2C9O A;  1TY2 A;  1VCI A;  4UAI A;  1J9O A;  3H09 A;  4X3T A;  5JEA J;  4RCN A;  5EQ0 A;  1IKM A;  1PFB A;  1CK1 A;  2D62 A;  2F0G A;  3TME A;  2ZXR A;  4TRD A;  4XYO A;  1SYD A;  5C0X I;  1Q90 A;  3BVZ A;  2BOS A;  2HCC A;  5G3L F;  5T1G A;  5C3E B;  4IUT A;  1IYV A;  1JOK A;  1HRJ A;  3MXG A;  1SE2 A;  2A73 B;  4XQN A;  1DOM A;  5E4W C;  3PO3 B;  3T53 B;  3T56 B;  1JWS D;  2SNM A;  3K5L A;  3NWS A;  1B9M A;  3OHX C;  4RKB A;  2D2C C;  4DXG A;  3NTI A;  4G7H C;  3PIO 3;  1DM0 B;  2MP1 A;  3D4R A;  4EQO A;  1S5E D;  1RJT A;  3Q24 A;  1JOQ A;  2KHS A;  1KNE A;  2RKS A;  2K01 A;  5D3I B;  3TBI B;  1RDP D;  1HA6 A;  2K32 A;  4KY6 A;  3A56 A;  1I4G A;  2YYZ A;  5KRU A;  3OMG A;  1XXG A;  4ABN A;  2E2H B;  3VA7 A;  1EIH A;  1SDF A;  5JEA H;  2L1B A;  2NVT B;  1Q3L A;  1DD2 A;  3SK8 A;  4QUF A;  4KMU C;  4IAL A;  3S2H B;  1H9M A;  1O7Z A;  2BDN A;  3KUP A;  2OT2 A;  3VR6 A;  2DNE A;  4K5V A;  5IGC A;  4CJ0 B;  5I6Y A;  3MHB A;  1V1P A;  4X3S A;  1CM9 A;  4KN7 C;  3D4D A;  1G29 1;  1D5M C;  4J1M A;  3ZYY X;  5C0X H;  1QG7 A;  2QEJ C;  1A15 A;  1PRT F;  3SK6 A;  4NW2 A;  1GUT A;  3A55 A;  1Q12 A;  5M3M B;  2RDF A;  1FGB D;  1KLU D;  1ESR A;  3GTK B;  1BF4 A;  3FDT A;  2BA0 A;  3S1N B;  1QCB D;  4TSS A;  3DEP A;  4KKU A;  2F0I A;  5IT9 L;  3C46 A;  4C3I B;  5CV5 A;  3NTH A;  1GUG A;  1M4V A;  3K0Y A;  1Y1W B;  5CBA E;  3C2P A;  1C4Q A;  1EY6 A;  1E0B A;  2KCN A;  1HUM A;  3TZD A;  3I8Z A;  1SNM A;  2LFN A;  3S17 B;  3ITP A;  2NVX B;  2B2T A;  1IHZ A;  4YIJ A;  4ZQ3 A;  3MZ5 A;  4KHZ A;  4M8A A;  2M00 A;  5JVG 3;  3OOC A;  4RA8 A;  4C56 C;  4MHE A;  2K28 A;  5M5W B;  5K5P A;  4DAP A;  4BY1 B;  2J0T D;  3EJI A;  1CQV A;  4K8J A;  5JAV A;  3VR2 A;  4K2L A;  1IKL A;  5EKI A;  3K59 A;  2EDG A;  1EY9 A;  1SSO A;  2F0D A;  5FLX E;  3BVG A;  1LTS D;  1H9K A;  2IX0 A;  1Q1B A;  1XWE A;  4KV6 A;  3I90 A;  3I4N B;  1HFG A;  1NAP A;  1FR3 A;  4I65 A;  3T16 A;  5J22 A;  2XRQ D;  4S3S A;  4PMB A;  4C3J B;  2F0F A;  2R6G A;  4XQJ A;  4QMG A;  3M4Y A;  1DJR D;  1LTB D;  3H3V C;  1WTO A;  3HS0 C;  5CV6 A;  1O78 A;  2LMC B;  5CV8 A;  3J80 L;  3AB9 A;  1CZG A;  3NWT A;  2KOL A;  5C4X B;  1V1P B;  3T4A C;  3R8B A;  5C5L A;  4C3I G;  2KEC A;  5D65 A;  4G7O C;  1LTI D;  4RFB A;  4IUP A;  1SMY D;  4R8I A;  4OIK A;  2M2L A;  2NZ1 D;  3C1F A;  3K5N A;  2EYH A;  3DWP A;  1HTL D;  3LWU A;  1MI2 A;  4KK7 A;  2XSC A;  5A2Q L;  2X6G A;  2EPB A;  1STA A;  2RA4 A;  5KIX A;  2FFK B;  4IFD I;  2F0E A;  1EQV A;  1TS5 A;  4HCS A;  1JB3 A;  1GHJ A;  1DOK A;  4K8I A;  4L63 B;  4NKL A;  2PZT A;  3SR1 A;  3M7G A;  3R3O A;  3I91 A;  1Y69 U;  3GTO B;  4IN3 A;  4H44 C;  1EY8 A;  1AFP A;  4R8N A;  4ZUI A;  2FJ2 A;  1LT5 D;  3SHL A;  1ICW A;  1VF5 C;  4C3J G;  5ELE A;  4KY7 A;  1JWM D;  5EBD A;  1RF2 D;  2AUJ D;  5CR3 A;  2HUG A;  5DM7 3;  5JEA G;  4KTA A;  2PPB C;  1WTX A;  3DXJ C;  2ID0 A;  5EKL A;  1QOH A;  2ZXO A;  1EEF D;  1LT6 D;  1GUN A;  2HDM A;  3LX0 A;  3NTK A;  4ODG A;  1IL8 A;  1C48 A;  2Q8R E;  4B08 A;  2K04 A;  4CGY B;  1GOZ A;  2AWN A;  3TP7 A;  3RD4 A;  3QO2 A;  1E2Z A;  2IX3 A;  4RGN A;  3MEH A;  2N88 A;  3TZU A;  1DYQ A;  4KI0 A;  1F2Z A;  4H7B A;  4A3M B;  1VDZ A;  4LMQ D;  3QOJ A;  3QOL A;  4IFD H;  3MC0 B;  3W3A A;  3S1M B;  2B2U A;  2KED A;  2O2L D;  4G57 A;  3BYT B;  4N9P A;  3GTL B;  1BR9 A;  1U9R A;  2XNA C;  2JSO A;  2IW3 A;  4F7X A;  1A2U A;  1PTO B;  2A6H D;  5D3D A;  2FHT A;  3CRL C;  3GV6 A;  5I9P A;  2MHV A;  4H0L C;  2JA8 B;  1TS3 A;  1Y8N B;  3OW7 A;  1CA6 A;  2A6E D;  2KQ3 A;  2EOT A;  2BDO A;  1ZXT A;  2DY7 A;  1KDC A;  4F88 A;  1H9J A;  2I07 B;  1TVX A;  4LK1 C;  1ZKO A;  1I6V C;  2JP1 A;  3HOZ B;  3A7A B;  2F3V A;  1HPC A;  1ROD A;  3D3R A;  5ELD A;  1SYF A;  1FNU A;  4RKL A;  3J81 L;  3W2D A;  4JBW A;  4IUV A;  2A6E C;  3MXU A;  1BCP B;  4CKE A;  2JE6 I;  2WB1 B;  2WII B;  3D6C A;  1LT4 D;  2EY1 A;  5FK9 C;  1PFM A;  1G91 A;  4EVO A;  1QIL A;  1PRT D;  3DMU A;  4LAA A;  1I4P A;  1F2L A;  2JA7 B;  3R2I A;  3I3C A;  5FKA C;  1LT3 D;  3T13 A;  3ND8 A;  2B2U C;  3NQI A;  1STN A;  1Y8O B;  3J7Y W;  1UEA B;  2WIN B;  5C3W A;  3P20 A;  3QJY A;  2CHB D;  1LAB A;  5K36 H;  5CMD A;  1JQY D;  3N52 A;  5KYL A;  4AYB B;  1ILP A;  3U9S A;  3K7A B;  4PV1 C;  4IUN A;  1R4Q B;  3MVV A;  1EQT A;  2F0N A;  3KLR A;  2IWH A;  3IKJ A;  2I46 A;  1B50 A;  2B2W A;  5I2X A;  4BA2 I;  2E74 C;  1SYC A;  1PTO F;  4BWG B;  1WCM B;  5ELB A;  3HZX A;  2V4D A;  1CI3 M;  1OXV A;  1KAB A;  3RZD B;  5CV7 A;  4QF4 A;  3BDC A;  4Q0F A;  3WOE A;  1EYD A;  1BQQ T;  2K5D A;  1LAC A;  2PZU A;  1SAP A;  1RCV D;  2IJ0 A;  1TWH B;  4DA2 A;  1SBB B;  1GHK A;  1STE A;  1EWC A;  3FPU B;  3OIP A;  5I4D A;  3QIA A;  4BA1 I;  4N9T A;  1QJO A;  3CRK C;  3QWN A;  4C1N K;  3ONA B;  3RLF A;  1Y8P B;  1KAA A;  3AU7 A;  2R7Z B;  1VMP A;  5ELF A;  3TP6 A;  2F0O A;  1BCP F;  2YU9 B;  3CU7 A;  4DFA A;  4MIU A;  1VMC A;  1SE4 A;  5IGF A;  2NN6 I;  5J1Z A;  2O4X A;  1PLF A;  5C3X A;  1G2S A;  1K83 B;  4FO2 A;  3X3N A;  2K33 A;  3OWE B;  2RVL A;  3H94 A;  2EYM A;  3SE0 A;  2F0Q A;  2D5D A;  4J6H A;  5KNB A;  2B2W C;  3H91 A;  4KHV A;  3M3Y B;  2G9H D;  4WJW A;  3EVQ A;  3JAM L;  1W6J A;  3HOV B;  1A3U A;  2F0W A;  1D5Z C;  4EGV A;  1GJX A;  1RHP A;  4IFD G;  1K8M A;  2MGS A;  4CBV A;  2M9V A;  2F0J A;  3KLS X;  2BE5 D;  1V43 A;  5DNF A;  1U4R A;  1Z47 A;  5EGT A;  5JOB A;  1F2M A;  1U4L A;  5IOC A;  1TU2 B;  3DHQ A;  3Q6S A;  1SNO A;  1DCZ A;  3AMU A;  4WOR A;  1EY4 A;  3D8G A;  2WKC A;  5BN3 A;  2JYO A;  2HCI A;  2ZT9 C;  1DON A;  1X3P A;  2JEA I;  1QNK A;  1F9Q A;  1QWY A;  5KNC A;  2SNS A;  2A69 D;  4FXD A;  5EPJ A;  4ZUJ A;  2H4O A;  4DNR B;  3VR4 A;  2A68 D;  1BNZ A;  3OIQ A;  5I9O A;  4CJ2 C;  4P2C B;  2NN6 H;  3MAQ A;  1BO0 A;  2AUK A;  4XQQ A;  1FNW A;  4GZY C;  2K05 A;  2L11 A;  3NSW A;  1TR5 A;  3S1Q B;  3MWY W;  4A3F B;  3CHB D;  1HCZ A;  5A35 A;  4G7Z C;  1LLR D;  1A6X A;  2IPK D;  5M5Y B;  2DY8 A;  1CFM A;  4FXK C;  2N55 A;  3FEW X;  4ID6 A;  4A3D B;  5IIF A;  5M5X B;  3DWQ A;  4C1N I;  2FIN B;  3K5M A;  1CZW A;  1KDB A;  1JCK B;  4TKO B;  5HUR A;  1YNJ D;  3GP7 A;  1V8Q A;  5IOD A;  1SXT A;  4R9W A;  5CBE E;  5K36 G;  3C1E A;  1B44 D;  2PMZ B;  2F0V A;  4HCE A;  3J80 E;  3BDL A;  1ENA A;  4X3K A;  2KCC A;  3NP8 A;  4DK0 A;  3TN2 A;  1HFN A;  4OHJ A;  3OMC A;  4MN3 A;  3M4O B;  4UDU C;  4DF7 A;  4WRD A;  2J7Z A;  1EY0 A;  2K6A A;  3NPP A;  4FF3 A;  2L12 A;  4XTC S;  2EJM A;  4RGO S;  1H9S A;  3WDN A;  1PZJ D;  4F8M A;  5A2Q E;  1II3 A;  1ONL A;  1UNS A;  1YNJ C;  3L7Z C;  2B63 B;  3SEB A;  3IL8 A;  4DU9 A;  1UUP A;  4NMZ A;  1PTO H;  4OIJ A;  1F9S A;  1WD0 A;  1TY0 A;  1PDQ A;  3G7L A;  3NUC A;  5CV4 A;  3K58 A;  2XN9 C;  1TS4 A;  4ZAI A;  3GV3 A;  1FYC A;  2B8F A;  1I4H A;  1SNP A;  2F0K A;  1SYE A;  4XT3 B;  3TP5 A;  4B9X A;  2K5W A;  1IW7 D;  3EA6 A;  3I73 A;  3ERO A;  3IAY A;  2NYZ D;  3MXP A;  1NCV A;  3T51 B;  5CYU A;  3SXH A;  4HSP A;  1I4Q A;  1U4P A;  4JK1 C;  4A93 B;  3G6J B;  2E75 C;  1V1O A;  1SMY C;  5CV9 A;  1TKW B;  3HGB A;  1D5X C;  5C4H A;  1YNN D;  3N6R A;  3C3L A;  4RGT A;  5I2Y A;  2NBF A;  1JIC A;  1HQM C;  2L55 A;  3E5S A;  2Z4H A;  2DNC A;  2HDL A;  1JOR A;  4OL7 A;  4EQP A;  2R92 B;  4DN4 M;  2F0U A;  3NQT A;  1RD9 D;  4XIG S;  5F2D A;  3P75 A;  3HRZ C;  1OXX K;  3TP8 A;  2EXZ A;  4CJ1 B;  4Q5V A;  3QG1 A;  4HN7 A;  2NTS A;  2PNR C;  2R61 A;  3HOU B;  1NR2 A;  3MA2 B;  3BZD B;  3FRP B;  3CKI B;  1LTT D;  2HQE A;  2CW0 D;  1NR4 A;  1SEB D;  3GD7 A;  2IL8 A;  5KND A;  1SND A;  1I4R A;  1S4Z A;  1LTR D;  1OXT A;  1SE3 A;  3EQL C;  1E2W A;  5G3L D;  1CTM A;  1A3V A;  1PYW D;  5C6A A;  1NUC A;  3GTJ B;  1GUO A;  1R4P B;  1EFI D;  1XYI A;  2F03 A;  1X3Q A;  4ZK9 B;  2EVB A;  1BCP D;  1TT2 A;  2EYL A;  3HOW B;  3L9A X;  3RMH A;  3VR5 A;  2NN6 G;  2JA5 B;  1RTN A;  1I4X A;  1SJE D;  2Z4I A;  1HXY D;  3CQZ B;  2PYK A;  4KKS A;  3NE5 B;  2WAC A;  3J81 E;  1HA5 A;  3TDQ A;  5DM6 3;  2NVQ B;  4ZKC B;  1EEI D;  2B2Y A;  1JE4 A;  3PUY A;  3SVM A;  2QF7 A;  1STY A;  1EY5 A;  2Z8L A;  4RH6 A;  1HQR D;  1T5X D;  3BYY B;  1KDA A;  2X6L A;  2WV6 D;  1ILQ A;  2E76 C;  5C4J B;  4KKT A;  1ESF A;  3DUZ A;  2KA7 A;  2A6H C;  4XT1 B;  2FMM A;  4HR7 B;  1EZ6 A;  4ZLT F;  1BOS A;  5ISR A;  5NUC A;  1WTV A;  4FXG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...