1R4PB

Shiga toxin type 2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords shiga-like toxin type II A subunit
publication title Structure of Shiga Toxin Type 2 (Stx2) from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 22
structure length 70
sequence length 70
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2003-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1r4pB00
1R4PB 1CZWA 2GA4B 1C4QA 2XSCA 1D1IA 1DM0B 4P2CB 4M1UB 1C48A 1D1KA 2C5CA 1QNUA 2BOSA 1CQFA 3MXGA 4ULLA 1QOHA 1R4QB 1BOSA 1CZGA
chains in the Genus database with same CATH superfamily
1DOLA 3NK9A 1I6VC 3WWVA 5IP7G 1Y1WH 2ENBA 5IT9c 2K14A 3OMCA 4OHJA 4A3MG 4GOPB 5LMUL 1P8LA 2L15A 3QJYA 1TWGH 5ELOA 3T16A 5AJ3Q 1WTXA 3PSIA 1HXYD 2R7FA 3U9SA 3VA7A 1EYGA 5FLXE 2K28A 1RHPA 2RHSB 2QDLA 3CMEA 2CH4W 1O7YA 2JA8B 1GJXA 2RA4A 3J81E 3EROA 1NMGA 1X54A 4JOIC 2I5HA 1PFNA 1I5FA 5E3FA 2VUMH 3C3LA 1E2ZA 4B3SQ 1VQDA 1L0XB 4U68A 3S1QH 3I91A 2F0MA 1C48A 3ERSX 2XVSA 1GD7A 4DXFA 5DAUA 2QCPX 5M3FB 4LF4L 5KNBA 1BCPF 1XNQQ 4ODGA 3PMFA 1PH1A 2UUCL 2F52A 1VQHA 5T1IA 3CCVA 4DUZQ 5M5YH 3TZUA 2ZTEA 4OIKA 4X3SA 2Z9HA 3EQLC 1QNKA 3PO2H 1SLJA 5LMNW 4DV3Q 1ILQA 4MIUA 5FLXL 5LMNL 1JB3A 2F4IA 3NSWA 4J8QA 1GVPA 3B6YA 1DONA 4JYAQ 3MXPA 4DR6L 2TMPA 3K6OA 3O13A 3LWEA 3C1FA 5JJKA 2JA7B 3CF5A 4PZ8A 4LFAL 5LL6S 4DR5L 2F1MA 2HQEA 2I5MX 3GTMB 4IFDI 2UU9L 3HP3A 2C9OA 2QEJC 1TS4A 3X3MA 4A3GH 2DN8A 1EY6A 1YJ9A 1PZID 2L5TA 4B08A 4UP8A 1N34Q 3PUZA 1VQJA 5GAEC 2A6ED 4C3JG 4DGZA 4RAUC 2EE1A 3KDFA 4JI8L 1BVSA 4KHVA 3UE1A 3E3XA 1W6JA 3PGZA 2K05A 1CQFA 1U4LA 1L1OC 2QDBA 1JICA 5M3MG 5T1GA 3CCJA 1YNJC 1WTRA 2VB2X 1Z9FA 1HQMC 2BH8A 4C3IH 1Q82C 3A8KE 1F2MA 4BY1G 1HH2P 5CV8A 4KY6A 4DXGA 3QG1A 1C0AA 4BXXG 4EQNA 3E9IA 5KNDA 1DOMA 2E76C 4BBRB 4JI2L 2EJGC 2R92H 4JI4Q 1WCMG 3J7AV 1VF5C 2PYKA 3TN2A 5BN5A 4UP7A 2J4XA 5C3WA 3T13A 3K0YA 3S1MB 2NTSA 2YTVA 4K5WA 1STHA 4K5XA 4OX9L 4QMGA 2KCCA 3K81C 1Q3LA 3RR5A 2QW7A 2A68C 1GHKA 1G8ZD 3TDQA 4DV0Q 1TWCB 3SR1A 1SYEA 3NTKA 4JOIA 4PZ6A 2Z4HA 1VQOA 1I4GA 2BH2A 5K5PA 1GKHA 1I50B 1KLUD 3F1ZA 4LUZA 3K5LA 4BY7G 1H9JA 3CD6A 1FGBD 1PTOD 1TWFH 5GAHC 3DXJC 1PV4A 4O0AA 4GN5A 1GUWA 3UE0A 3CP0A 4APVA 3KOJA 1PH9A 1EY9A 3IL8A 2HHHL 2KENA 4ZQ3A 2A5HA 2K52A 4KMUC 1BCPC 4LUVA 3KF8A 2PPBC 2E2JB 1XPUA 1SMYD 3S2DB 1CI3M 4AQYL 5KYLA 1PRTF 5IODA 4C2MB 3CCLA 4L5RC 1CSQA 4L6TB 4DUZL 3GTKH 1BQQT 3PV0A 4K14A 4RFBA 1Y69U 4OEMB 4WRDA 4KJOA 2JA6H 1M4VA 1G6ZA 4DV3L 4WFN3 1PRTD 3GTJB 3Q6SA 3MXGA 2P5ZX 3HOYB 1R9TH 5JPMC 3NBHA 1N36Q 3AQQA 1MD2D 4CDFC 1LTLA 5IYCG 4MZ9A 4A3EH 2WAQE 2A69C 4DK1A 4F87A 1G91A 2UXDQ 3OTOQ 1TWHB 1TY0A 2CHBD 4B3RQ 1L1OA 2IPKD 2IW3A 5JJIA 4DU9A 1BDOA 2Q2HA 2VQEL 3EA6A 1Y1WG 2IX0A 1X9NA 1X65A 1I94Q 1JMCA 2XNAC 4FVMA 3AYHB 3GD7A 2UUAQ 4A3DG 2I0QA 4KHPL 3ND9A 4IUTA 1Q90A 3NEMA 4DV6Q 2K33A 2ATWA 1WTOA 5GADC 1MJEA 2CCZA 2Z6KC 1CK1A 2E2DC 2F0FA 4A3IG 3C1EA 3P20A 4CHTB 1EWCA 4DR3Q 3HOUG 1OXVA 2B2TA 3HKZG 3U9OA 2UUBQ 2VUMG 1TVXA 2AWNA 2HIXA 3ULPA 1GUTA 1Q8KA 5FOBB 3TRZA 4L5QA 3J80E 4DPGA 4DAYB 5ELFA 5ELCA 3RN5A 4L5SA 4A3DB 4A3JH 4MHEA 4JI1Q 3GTQB 5IIFA 4CKBA 3NWSA 1TWAB 2ZJQA 3ULJA 1EOVA 5FLMH 3DEPA 4XQNA 3AFQA 1V1OA 1F9RA 1QG7A 4IPDA 1EY5A 4RH6A 1UNSA 5ELDA 3VYRA 3PO2G 1PHJA 5A2QL 2I46A 4KD4A 4X65Q 3HOUB 1XNRQ 1SBBB 1U0LA 2FFKB 2ICEC 3NUCA 4C3HG 4Q0FA 4JV5L 4X6AH 1S5ED 4DV0L 3QWNA 1LACA 3HOWH 3H0GH 1Y1VH 2DGYA 2VXWA 2YU9B 4FF2A 2R93G 2X69A 4A3FG 5DEHA 1ILPA 4P73A 2DY8A 4H7BA 5IGFA 2KCTA 1EYAA 1VQBA 1RCVD 1EOTA 5CMDA 3BG3A 2AQ1B 1UEBA 1KLGD 1IW7C 1JR0D 5DLQE 3K57A 4N9PA 1VQNA 1YJNA 1Q1EA 3IFDA 1HR0W 5CV6A 2KEEA 1SXTA 4KI0A 3AEVA 1VMCA 5C0XG 1JOQA 1K3RA 1Y8NB 3NTHA 4DAMA 4IN3A 2WIIB 1XMOL 4EGVA 3U58A 4AIMA 1HPCA 3GTOB 3T1HL 1YIJA 1PH3A 5G3LD 5BN4A 2F0SA 5EBDA 3SXHA 2JA8H 3L7ZC 1K3BC 4KKSA 3VDYA 4QL5A 1SYFA 5IYBH 4LFBL 2VS1A 2PQAB 3GTPB 2XRSD 4K2KA 3A5ZB 1YHBA 2F0IA 3SEBA 4HN7A 1IYUA 2SEBD 3S1NB 5M3FH 5E4WC 3NXWA 1YJWA 4A3LH 2FJ2A 1TR5A 2X6LA 1ASYA 3KK7A 4DAVA 4GKJL 3A8JE 2EY1A 5C6AA 3BYTB 4FXGC 1ENFA 2Z6KA 4GN3B 2O4XA 1B70B 2E8GA 5C0XI 3VR6A 1QJOA 4LUOA 3I72A 4H13C 3I4NH 1QVGA 2K75A 2JA7H 1Q12A 2SOBA 2A6HD 1FNUA 4OXPA 3S14B 3GTMH 3S17B 2N78A 2PW7A 1PA6A 2ICIA 1XMQQ 1IL2A 3RLNA 1K9MC 4DKAC 1K8MA 4DR3L 3K80C 3NELA 3JAML 5DM63 1EQQA 1KDBA 2BE5C 5D3DA 2JXMB 2EYOA 2KJXA 4LF7L 1QOHA 5EKLA 3OHXC 1E7ZA 2F3WA 4JI1L 1YVCA 2VB3X 3MFYA 4CKEA 4A76A 3DMUA 4WJWA 2OT2A 3H09A 1F9PA 1SYCA 2SNMA 4GZYC 1DCZA 3IAYA 3Q8DA 4O2DA 1I4QA 5D14A 3UI2A 1S4ZA 4HCSA 4X65L 2IT1A 4GLXA 2R3ZA 2D62A 5C4JB 1STBA 1YNXA 3MZ5A 3M7NA 4P75A 2CW0C 4BBRH 4O1NA 4HJ5A 1PMRA 4JG2A 3K5NA 4HMIA 1MSHA 3MHBA 3I3CA 4O42A 4LF4Q 3G71A 1E2WA 1HZAA 1S5BD 5FKAC 4PMWA 2XWBB 2UUCQ 2GVBA 4KN7C 3BZKA 3TP8A 5JEAH 1A2TA 1QUQB 3EBEA 4MNOA 1XWEA 4EQOA 1WOCA 1ESFA 5K36G 4XT3B 5LMNQ 1XTDA 5FK9C 2RVLA 1NCVA 1TS5A 1TWCH 2DUDA 1XJVA 3CCQA 3C46A 2HT1A 4YWMA 2WINB 4DR6Q 1GUOA 4FP5D 1JWUD 1JC7A 2Z6BA 4LFAQ 3CC2A 1I50H 5AFWA 1RODA 1LTBD 4DR5Q 4ID6A 2UU9Q 5J3BA 1N33L 5C4XG 4JC0A 1NNXA 1VQFA 2K6AA 1I4RA 1VF7A 3UDFA 2Y0SG 2Z4IA 4IURA 4FNFA 5HY6A 1PFBA 3OW7A 1BR9A 5CYUA 4RG1A 4A3JG 1LV9A 3I4MG 3PIP3 1IKMA 1B53A 1OTCA 1TT2A 1DZ1A 1VDZA 4FYDA 4YIJA 3VYTA 5FLMG 2VQFL 2NN6H 3NBHB 3VYSA 1LT6D 3A55A 3CQZH 3SVMA 4L63B 4IJLA 2NVTB 2KCNA 1JJCB 4G7HC 1LTAD 5HURA 1QCBD 2A19A 1CKMA 2CWPA 2RDGA 4DAYA 1A8VA 3VR4A 3HOYH 3T56B 5KGUA 1Y1VG 3I4MB 1RTOA 2AHOB 4TSSA 1ET6A 4A93H 3T1YL 2YV5A 5FLXc 1SN8A 4TKOB 3KBGA 1AH9A 3OWFA 3HOXB 1QVCA 1Q1BA 2SDFA 4IZ8A 1ESRA 2K03A 1B9MA 4XXEA 2PI2A 4OX9Q 5GAGC 4JBWA 2K7VA 1WTWA 1CKNB 1KAWA 4FXKC 3OW2A 3GTGB 2F3IA 1EEID 4JBMA 1AZQA 1EQRA 3GV6A 1VQLA 5JVG3 2WFWA 4DA2A 2JK8A 4YHHL 1BO0A 2IWHA 2K5DA 1KRTA 5IYBG 2VW9A 2AQ3B 1RD9D 4P71A 3HGBA 5J39A 3F2BA 3Q23A 3S24A 1HTPA 4IFDG 1BNZA 1TS3A 1HNXL 1CZWA 3N6RA 4IUPA 2HHHQ 1IL8A 2X6GA 2NVXB 4ZCKA 2R7ZH 2NBFA 3BVMA 2PI2E 4CKCA 4EX5A 4Y7NB 4A3MB 4BS9A 3P7JA 3RUZA 3S9WA 1TWAH 2VNUD 2KBNA 4AQYQ 1RF2D 4L5TA 2RSNA 4R4OA 3L2PA 4HJ7A 4IALA 5IGGA 4HIKA 5C44H 1RDPD 1TY2A 1BCPB 4AYBG 2B29A 2PQAA 1XPRA 5KNCA 1I4HA 4R4CA 5C4HA 2NVYB 2KEDA 5CGKA 1KIXA 5IT9E 3T53B 1HA5A 2JA5G 3MC0B 1WTVA 1NY4A 3TBIB 3J81L 2YU9H 3BVZA 2E2IB 3MXNB 2E5LL 2PMZE 3RD4A 4ZK9B 5EPLA 3H3VH 2PQEA 4CJ1B 1R4QB 4OGQC 4AYBB 5L37A 5I6WA 3PIPA 1R4PB 4FO2A 1N32L 2ZM6L 2A73B 2XGTA 1E1TA 2VQEQ 3FKIH 4IUVA 1EYCA 3STBD 1PYSB 2BDOA 2M00A 1J6QA 1ET9A 2FMCA 1STYA 4KHPQ 1QILA 3KYHC 3S2HH 1IYVA 1ML0D 1Y8OB 1IHZA 1NTGA 3I73A 4QGUA 1KHIA 1HFNA 1DYQA 1VQ4A 1PH8A 2YYZA 4KTAA 1DM0B 3HEJA 4DK0A 2H5XA 2LXJA 2FMMA 3GTPH 1B1ZA 1D1KA 2B2YC 2ID0A 3E9HA 4C3JB 1LLRD 5FO8B 4ZUJA 1PFSA 3SK6A 3K5OA 1EY0A 2F0GA 3RZOB 1LABA 1DXMA 5M3MB 1STGA 1WTQA 2L4NA 5I4DA 3RLOA 5LL6X 1IXRA 1CHPD 5IY0A 3DHQA 4JI0L 4A3KH 1EY4A 1F2ZA 4BY1B 4JPBW 4ZYSA 4R9WA 2E2HH 1I4PA 4JV5Q 4IJHA 5GROA 4KKTA 4IO9A 5M9OA 2XWJB 2VZAA 2EPBA 1PZKD 2UXCQ 3BU2A 1PTOF 2B39A 1X3GA 1SE3A 2EY2A 3OMGA 2QA4A 1WCMB 3S17H 1QUQA 2K32A 4QUCA 3BS1A 5C3EH 2O5IC 4A3CH 1Y8PB 1SNQA 4M1UB 4BWGB 2IHEA 1D8LA 2WB1G 3SK4A 4LW1A 3GO5A 2F0LA 2ZXPA 2DY7A 4B3ML 4DUYL 3OPOA 1VQMA 3A5UA 3I8ZA 1HR0Q 4K8IA 1XMOQ 2NN6G 5IYDH 1IKLA 5IP9H 2WKCA 3J7YW 2B63H 3PO3G 3T1HQ 3M3YB 3H91A 1J5EQ 4A3BG 5CC4A 4BY7B 5ELEA 1W3SA 3PIO3 1SNMA 3AU7A 1PRTB 1DOKA 3K7UC 4LFBQ 2LMCB 1F9QA 3P75A 1VQGA 1HNZL 1ASZA 4GS3A 2EDGA 3LX0A 4RGMA 4LJZC 1SNPA 3FP9A 1FR3A 1E1OA 1QE6A 4BBSG 2MFIA 3CMAA 1I6HB 2A6EC 3VR5A 2ZJPA 5CV5A 5ELNA 3PUVA 1KNAA 5BR8L 4LMQD 4GKJQ 3J81i 4WJ4A 2AQ2B 3CCSA 3G48A 4J15A 4N9TA 4JI7L 1T9HA 3MEHA 1HUNA 4POGA 2MO0A 1Q81C 2NB0A 1DD2A 2I07B 1UE6A 1VQKA 2M2LA 2M9VA 1K73C 2ZXOA 4KHZA 4G4KA 5IWAQ 4J1MA 3CCEA 2CKZB 2NN6I 2MPMA 3FPPA 4YWKA 5JEAJ 2L0CA 1XX8A 1TXYA 1RKNA 2GA4B 4HJAA 4BBSB 1VQEA 2B2YA 1CKOA 1PYWD 1U9RA 2LSSA 4RCOA 1SFOB 1WFQA 1IBKL 5IGBA 4BA2I 1HCZA 1JE5A 2F0QA 3I55A 3KJOA 2ZT9C 5JOBA 1CKNA 4IOCA 3QB3A 3ULLA 3KUPA 3URYA 1GOZA 2TSSA 1EY7A 3QO2A 3HOVH 1Y1WB 2R7ZG 2AWOA 4X66L 2KQ3A 4OO1H 3CXCA 2DNEA 1TS2A 1XTCD 2Z8LA 4PNYA 4LF7Q 2B2VC 1TWGB 3HOZH 1EFID 3M9BA 4UPAA 1ZEQX 2ZTDA 2EYLA 1PVOA 2K50A 1HZ9A 1H9RA 2B3GA 2MO1A 5ISRA 5C44G 1O7IA 5EGTA 5H1SE 2NVQH 2RCNA 3CRKC 1E2VA 1X3EA 4FF1A 2OEOA 3KF6A 4UHVA 1KQSA 1SR3A 4A3IB 1XXGA 4I65A 2K1BA 2EYJA 1SJED 2IL8A 1OO9B 3HKZB 4PV1C 1YNND 3FDTA 4NB3A 2VUMB 4GNXB 1K8OA 4LF9Q 1PTOC 2PCFB 3VR3A 5I9OA 5FJ8H 3TS0A 1JOKA 1E24A 4HSPA 3L0OA 1PH5A 2JYOA 5C5MA 2UXCL 4QJFA 3PUWA 1FJGL 1SROA 3CPWA 3HZXA 4R1JA 3MWYW 4RGOS 1IBLL 1LTID 4B3TL 3H6MA 3NWTA 3EN2A 2AUKA 3NE5B 4N8FA 1KNEA 3J80L 4GN4B 1PH4A 1SMYC 4UDUC 4PMCA 2XRQD 4C1NI 2N8NA 2MNAA 5IGDA 4A3GG 3PO2B 3FKIG 3SGIA 1X3QA 2RDHA 4H02A 1STNA 4LFCL 1Q46A 1AW7A 1IYJB 2AUJD 2Z1CA 4C3HB 4NW2A 4DR7Q 4X64L 5G3LF 3MXNA 2QGQA 3IKJA 2H1EA 2JQOA 1Z47A 2L11A 3A54A 5J22A 1HR0L 1HZBA 1JT8A 3K7AB 1PRTC 2MJ8A 1ICWA 3JAMc 4DV7L 2R93B 4A3FB 1BF4A 2WKDA 3A7LA 1N33Q 4NXNL 2IHFA 1J5EL 4A3GB 4C3IG 3DUZA 5NUCA 2GN5A 2K01A 1A0IA 1VQAA 4TVAB 4HMJA 3KJPA 3C2PA 1K83B 3EVQA 4XIGS 3JC66 3VA5A 5IP7H 1KDAA 3H3VI 5IE8A 4Y7NH 3CC7A 4A3MH 1L0WA 1KD1C 2R92G 1U5KA 4YCWA 2K4KA 1GXDC 2VQFQ 1PH6A 1VQ8A 2LFNA 4C3IB 4OWTB 2LY7A 4AYBE 3KLSA 4MTNA 2NVYH 4JK1C 4NXMQ 3W2DA 1XPOA 1YI2A 1BBWA 1SMXA 4DV4L 5IWAL 5ELBA 1SRUA 3R8BA 3T1YQ 4X3UA 4LK1C 2WP8J 5C3EG 2VY3A 2HDLA 2RF4A 5BN3A 1CZGA 1EUJA 2MP1A 5FO7B 2OTLA 3CC4A 2D0PA 3KLRA 1PH2A 3D4DA 3MA2B 1XYIA 2K5VA 1SNDA 1S72A 4DF7A 5KRUA 2F0PA 1SNCA 4E6IA 4JI6Q 4JI5L 2MHVA 4GLVB 3SHLA 2L12A 4NKLA 3ONAB 1ZYRD 1PYBA 1TQOA 3A56A 4DR4L 3MTSA 3CW2C 5IP9G 2B63G 3G7LA 1DJRD 1D2BA 2NZOA 1JWSD 2KHJA 1KXLA 4HJ8A 2PW5A 4GNXC 4YHHQ 1B4OA 2EVBA 5EKIA 3D6WA 4LF8L 2OWOA 4IOAA 1NE3A 4L8JA 2KUMA 2JA6G 1HNXQ 4A75A 3HKSA 3UDIA 1CT1D 1UE7A 2QILA 2XN9C 4C3JH 3K5MA 2ZXRA 4KKUA 4S3SA 4LF9L 4MN3A 4OELB 2PZTA 2HDMA 1ENAA 5M5XB 2N55A 3RNUA 4ME3A 2L1BA 3M4YA 4A3EG 1B7YB 3RZOH 3SK8A 3J7ZC 1S3OA 1B8AA 2R7DA 5IGEA 5M3MH 2XSCA 4ZKCB 2EY6A 2OQ0A 1K28A 4F7XA 3S16B 4RA8A 3S1MH 2NWGA 1G2SA 1AZPA 3J80i 5M5WB 2QF7A 3S1RB 3OWEB 1YZ6A 3WDNA 2R61A 4BXXH 4UP9A 3BVGA 2F0KA 1R9TB 2WAQG 1CA6A 1ENCA 3CHBD 4DR7L 2A1AA 1CTMA 4HCEA 1WCMH 2K5QA 1ONLA 2E5LQ 3DEOA 5CBEE 4DV2L 2V1CC 2OXPA 3DM1A 1S40A 4B9WA 2PO4A 5E7NA 3PF4A 4NDXA 2GVAA 3Q0AA 1Y14B 1N32Q 3U50C 2ZM6Q 1M90C 1GUSA 3HOVG 3R2TA 3WOFA 3AB9A 3GDEA 3MAQA 3A7AB 4YCVA 5GQOA 4DK3C 2NUCA 4R8NA 5COYA 3VR2A 2E2JH 4KN4C 3S2DH 4R4TA 3BJUA 3M4OB 4K6LA 5EPKA 4H44C 5FO9B 4HR7B 1QB5D 4C2MH 4BY7H 1UEAB 1UE1A 2Q2TA 1HNWL 2AKWB 2KECA 2A6HC 2R6GA 2CWAA 3MEFA 2O5JC 5C4XB 5JPNC 3I7FA 5E4XA 1STAA 4OL7A 5EPJA 5FJ8G 2CH4A 4UY8C 2Y0SB 3GTJH 3HRZC 4P72A 2RSOA 3M85A 4NXML 4DR2L 3HOWG 3H0GG 4XQQA 4EVOA 2Q8RE 3CPFA 5HGTA 4A3JB 1I6HH 1W2BA 4R8IA 3H15A 3PQIA 3KLWA 1M1KC 3E6ZX 1HQRD 1WI5A 1TWHH 2H4OA 1O7LA 3A0JA 4PQXA 1KDCA 2F0VA 5CBAE 1CUKA 3IFTA 3PCOB 4OO1I 4JI0Q 1FNWA 3W3AA 2RHQB 3J81c 4GNXA 3NTIA 4JI6L 5IOCA 1G291 5C3XA 1UE5A 2EYHA 4KV6A 3TEHB 3J81j 3K0XA 1Y1VB 2F0NA 3JAMi 1SFOH 2EXZA 5IYCH 3FPUB 1A63A 5CV9A 4LF5L 2JA9A 5C5LA 1A6XA 4KK7A 3UDGA 2QEXA 2JA8G 1PLFA 2EXDA 2Q8TA 1H9SA 4XDXA 1UAPA 4F88A 1Z6HA 3NQTA 1JCKB 2ZTCA 3KF6B 3K58A 4DUYQ 4B3MQ 2F0HA 2OF1A 3RN2A 3HKZE 2OQKA 4QB4A 3VYUA 1QZHA 3D0FA 3I2ZA 3MXUA 5M3FG 4A3DH 2KOLA 3K8AA 4A3LG 5JJLA 4LF6L 1O7ZA 3GTQH 3AMUA 3NP8A 4GKKL 2A68D 2EQSA 4A3IH 3ICEA 2B2UC 1MIUA 1X3FA 4HTHA 3TZDA 4JW0A 3J7AF 3HOUH 3U4VA 2JSOA 1NUCA 4ZRZA 1E3PA 2FXQA 1HNZQ 2EJMA 2HUGA 3CCMA 5LHY1 4Q5VA 3I4NG 1FGUA 3RLFA 2JA7G 1H9MA 2EYFA 2RBMA 4JI3L 2C35B 2Q2UA 4PMBA 1ZXTA 1EFWA 1SJHD 4IPGA 2D5DA 5BR8Q 2XTIA 1WYDA 4JI7Q 1KC8C 2RDFA 3I70A 4QQBX 4B9XA 3M4QA 1BCPD 1LUZA 1JE4A 4XYQA 4LAAA 3NQIA 1VQ6A 2F4VL 2MUYA 5EQ0A 4RMFA 4ALPA 4C3HH 1SE4A 1JOOA 3F2CA 3I4NB 2IX3A 1NR4A 5KIXA 2JA5B 2EZVA 3K7AH 1A3VA 1PXUA 2RCFA 4OWXB 2SNSA 1IBKQ 3D4RA 2R93H 4A3FH 4ULLA 3GTOH 3SK5A 5IT9L 1HA6A 4DV5L 4HIDA 1TU2B 1MI2A 2YTYA 2ES2A 4G57A 3GV3A 2NZHA 4P2CB 5D3IB 1FL0A 1K83H 4K0KL 3FHWA 2EYMA 4CBVA 2JE6I 4X66Q 1SYBA 2A69D 3PF5A 4HIMA 3E5SA 4DAPA 4BBRG 1ICFB 1K0SA 3V96A 5C0XH 3S1NH 1MGSA 4HJ9A 4RGTA 3M7GA 5JEAG 3W1BA 1HHVA 1B3AA 4XT1B 1EU4A 2AMCB 2IX1A 3W5OA 1NMFA 1U4MA 1NSNS 4ZUIA 4DV1L 2N49A 1F9SA 1WJJA 3KLSX 3WOEA 1II3A 1KL9A 2BA0A 3G6JB 1J8IA 2L55A 1GM5A 1SE2A 3GQBA 3X3NA 3MFGA 4YWLA 2QKIC 4C1NK 4PG3A 2F0UA 3LWUA 4LNQA 1FD7D 2UXBQ 4IUQA 3W1GA 1MBYA 2B2TC 1Q7YC 1FJGQ 1AE3A 4B3TQ 1IBLQ 3S14H 4IFDJ 1PTOB 3ITPA 3GTLB 1OXTA 4ZLTF 4GOPC 1IZ6A 4KD3A 2BA1A 2HIVA 1D5XC 4LFCQ 2JEAI 3RZDB 1O78A 4DN4M 4V190 2B2UA 1RIPA 3SDZA 4WJ3M 3E0EA 1E0BA 4X64Q 1I3QB 4G7ZC 1WD0A 2YTXA 1YHQA 2NTTA 3LGJA 1BOSA 4DR1Q 5EKKA 4X3TA 3N52A 3TP6A 5AJ3L 1HTLD 4FF3A 1X3PA 3ZYYX 4DV7Q 1JJ2A 1D1IA 2XIWA 1KAAA 4NXNQ 1IBMQ 1EU3A 1RTNA 1GUGA 3UDXA 2ALYB 1WTHA 1TIID 2WB1B 3A8IE 1KRSA 4MTKA 4JCVE 1M8AA 5C4JH 4Z9CB 2B2WC 3HOYG 1G6PA 4B3SL 3AFPA 3S15B 4U673 1CHQD 5M5XH 3FRPB 3PUXA 1UWVA 4A93G 4J6HA 3ND8A 2N88A 3STBC 1XNQL 3G4SA 4QCLA 4BA1I 2G9HD 3CQZB 3PO3B 1IW7D 4N8X1 3S16H 4A3BB 5E1FA 1SDFA 4HEDA 3OIPA 3BYYB 3D6CA 5M5WH 1N8RC 3S1RH 1JJGA 1SYDA 3CU7A 3NBIA 3R93A 1EQVA 3TP7A 1S5CD 1W6KA 4JYAL 4DV4Q 1AEXA 3J80c 4YCUA 2JP1A 4X62Q 4A93B 5EBCA 2HD3A 2ASBA 4DNTB 2KVMA 1FNVA 2NZ1D 1A3TA 1OXXK 1AN8A 1EEFD 4C56C 4POFA 1OXSC 3R2IA 2WV6D 2E74C 4ZAIA 4DNRB 4JI5Q 4K2LA 2CQAA 5K36H 4ABNA 1N34L 3RMHA 1D7QA 1Q8IA 2JEBI 3D4WA 1QWYA 4QIWB 5DNFA 1BXTA 1G51A 2Y0SE 1VQ7A 4DR4Q 5CORA 1A62A 4F8MA 5A2QE 2IY5B 4K5VA 2EYPA 1U4RA 3M4OH 2F0OA 2K5WA 1V1PB 3EIVA 4V0BA 3T51B 3OIQA 2HCIA 3OOCA 5C4XH 2B8GA 2NVTH 1U4PA 4LF8Q 4EQPA 3F2UA 3QOJA 1C7YA 3D31A 5C4ZA 1FVIA 2CVRA 2ZJRA 1BUVT 4GOPA 1HRJA 1LT3D 4UAIA 3EJIA 4RKLA 5TSSA 5I6YA 3I4LA 1C4QA 2R7ZB 2RQXA 3NPPA 3S1QB 5D65A 4IQZA 3I4MH 1H9KA 1EYDA 4FDBA 1C8CA 1DGSA 4JI4L 3I56A 3ERQA 3HS0C 1QZGA 4JBKA 1CM9A 1UUPA 2UXBL 1FYCA 4CJ2C 1QNUA 2BOSA 1YBYA 5C44B 1X56A 1LTRD 2PNRC 5M5YB 3TP5A 3OYYA 3HOXH 1EWIA 2BE5D 4QUFA 2A8VA 2Z0SA 4KLKA 1PZJD 2KA7A 2BDNA 1X55A 4IPCA 1H9SB 1HJPA 4CDDC 1YITA 4KY5A 3K59A 1AE2A 3GTGH 4R4QA 5J1ZA 1HZCA 4K8JA 1A2UA 3TSSA 3PIOA 2B2WA 3NENA 4KY7A 4DR1L 4DV2Q 4RHSA 1G2TA 2KHIA 5I2XA 1A15A 1CQVA 1VQIA 4M8AA 1IBML 1L0YB 3DWQA 1B2TA 2CW0D 4RKBA 4ILWA 3FKIB 2KHSA 2OTJA 1PH7A 2D9UA 3CRLC 4OWWB 2F03A 1MJCA 3TQYA 2NVXH 3HFZB 2WACA 2L9HA 3Q24A 2PMZB 4CJ0B 4EQ5A 2CQOA 4KJNA 3S2HB 3HG9A 2F0DA 1VQPA 1PDQA 3EFXD 2MGSA 3F2DA 3LNNA 3Q22A 1MHWC 3D8GA 1VQ9A 2CFMA 2K5NA 1HNWQ 3V2TA 2LKVA 1P16A 4A3KG 2VL6A 2JN4A 1LYLA 1S5DD 4IFDH 3P1HA 1LT4D 3BDOA 1CA5A 1VQCA 4IUUA 4CGYB 3DM3A 3L3OC 2LXKA 5EJWA 4DR2Q 3L9AX 1CSPA 4HAEA 4RGNA 1WVLA 1N36L 3ZJYC 3BDLA 2E2IH 4X62L 2R92B 1JORA 4FF4A 5KYIA 1BBUA 1CFMA 4HSVA 3IRBA 3JAME 3TS2A 1SNOA 3M4PA 2UXDL 4NPSA 3OTOL 4A3CG 2FINB 5CV7A 2EOTA 2B2VA 4B3RL 1T5XD 2D2CC 2DJGC 4R4IA 2Q8IB 5CR3A 1JWMD 5EAYA 4A3KB 1JQYD 4TQUS 1EIGA 1K0RA 2OCEA 4YY3Q 1NJIC 1H95A 4GLAC 2E2HB 1HFGA 1L2FA 4NP5A 1Z7TA 2PZWA 1I94L 1AP0A 2G9DA 1HUMA 2A74C 4OIJA 4RHRA 5JVH3 2JA5H 3KDFB 4JBJA 1S5FD 2UUAL 1YNNC 3I4OA 2JJQA 1SSOA 1VQ5A 5IYDG 4DV6L 2DNCA 4LF5Q 4X3KA 4WORA 3KFUA 5C3EB 2EY5A 2I5LX 1BKBA 4CDCC 1J9OA 2F0WA 5JAVA 1WD1A 3J7A5 1TWFB 3TMEA 5F2DA 4FXDA 2F0TA 4I7AA 2UUBL 3DLLA 1SE8A 2B8FA 3FMCA 3A74A 3I90A 2F0JA 4Y52H 1YHAA 4P74A 1E22A 3NHHA 2F3VA 4K6DA 5LMUQ 3FEWX 1D5ZC 4IUNA 1T5EA 1EL0A 4LF6Q 2B63B 1K8GA 3ER0A 1EZ8A 1X32A 4QY7A 4GKKQ 3QR8A 2HQLA 5HGQA 5DM73 4DNIA 3BZCA 4TRDA 2E75C 3DWPA 2K5HA 3GTKB 2C5CA 1XNRL 1RJTA 1KABA 3E0JA 1LTGD 5C0XJ 2JA6B 4CDEC 1K8AC 3OSOA 5JJZA 4BY1H 3H3VC 1VMPA 1F77A 2IJ0A 1Q86C 4PZ7A 1C9OA 1EWHA 5A35A 1STEA 2KCMA 3DWAA 4JI3Q 2PNHA 4A4IA 1KTKA 1V8QA 5I9PA 2EIFA 2Q2IA 4A3EB 1EY8A 1O80A 1PTOH 5IGCA 3GTLH 1YEZA 1JB7A 1D6EC 4RCNA 1V43A 1SAPA 2FHTA 1V1QA 1SEBD 3CCUA 4DFAA 2D0OA 1MKHA 3RZDH 2F4VQ 2MQHA 1EIFA 1F2YA 4OO1G 4HIOA 1EIYB 3F8TA 4ZKBB 2WB1E 1I3QH 5I2YA 2WAQB 1RL2A 1LM0A 3HOZG 1GUNA 2RKSA 1B3QA 1GHJA 1N9WA 3D3RA 3KF8B 3R3OA 2DJFC 4JVZA 4NMZA 3G6EA 1A3UA 1EQTA 3T4AC 3CAMA 4RWSC 1B9NA 4DK6C 3M3YH 3V05A 4DV5Q 4H0LC 2EJFC 1BBXC 1D5MC 4K0KQ 2K04A 4JI8Q 3HOVB 1LO5D 4AH6A 3S15H 2BCOA 1EIHA 3MVVA 1VCIA 2N3SA 2LS01 1EZ6A 4IPHA 1SYGA 3BZDB 3CKIB 3HOZB 4XQJA 1LTTD 1NR2A 1V1PA 5KEEA 3PO3H 1ZYRC 2NVQB 1OXUA 4QF4A 3H94A 3HOXG 4A3BH 1I4XA 4DV1Q 4I7ZC 3PUYA 4OONA 2PZUA 3KBXA 1X6OA 1PFMA 4XYOA 3TREA 3GP7A 1L1OB 4LWCA 4YY3L 3FVQA 1NAPA 1WTPA 1V9PA 3CCRA 4JI2Q 5CV4A 1B44D 2V4DA 3SE0A 3HOWB 4QIWE 1AFPA 3H0GB 1NBWA 4BBSH 3QOLA 1YNJD 2O2LD 1F2LA 1ZKOA 1LT5D 3BDCA 1TKWB 4ME5A 3QIAA 1B50A 4G7OC 1MSGA 4XTCS 2NYZD 1VS0A 2F0EA 2J7ZA 1XMQL 3U4ZA 2G5DA 2J0TD 1GO3E 1LTSD 2HCCA 1QVFA
chains in the Genus database with same CATH topology
1DOLA 3NK9A 1I6VC 2ENBA 3OMCA 4OHJA 3QJYA 3T16A 1WTXA 3U9SA 1HXYD 3VA7A 5FLXE 2K28A 1RHPA 1O7YA 2JA8B 1GJXA 2RA4A 3J81E 3EROA 1PFNA 5E3FA 3C3LA 1E2ZA 1L0XB 4U68A 3I91A 2F0MA 1C48A 2XVSA 4DXFA 5DAUA 2QCPX 5M3FB 5KNBA 1BCPF 4ODGA 3PMFA 5T1IA 3TZUA 4OIKA 4X3SA 3EQLC 1QNKA 1ILQA 4MIUA 5FLXL 1JB3A 2F4IA 3NSWA 4J8QA 1DONA 3MXPA 2TMPA 3K6OA 3O13A 3LWEA 3C1FA 2JA7B 5LL6S 2F1MA 2HQEA 3GTMB 4IFDI 3HP3A 2C9OA 2QEJC 1TS4A 3X3MA 2DN8A 1EY6A 1PZID 2L5TA 4B08A 3PUZA 2A6ED 4C3JG 4DGZA 4RAUC 2EE1A 4KHVA 1W6JA 2K05A 1CQFA 1U4LA 2QDBA 1JICA 5T1GA 1YNJC 1WTRA 2VB2X 1HQMC 3A8KE 1F2MA 5CV8A 4KY6A 4DXGA 3QG1A 4EQNA 5KNDA 1DOMA 2E76C 4BBRB 2EJGC 3J7AV 1VF5C 2PYKA 3TN2A 5BN5A 2J4XA 5C3WA 3T13A 3K0YA 3S1MB 2NTSA 4K5WA 1STHA 4K5XA 4QMGA 2KCCA 1Q3LA 2A68C 1GHKA 1G8ZD 3TDQA 1TWCB 3SR1A 1SYEA 3NTKA 2Z4HA 1I4GA 5K5PA 1I50B 1KLUD 3K5LA 1H9JA 1FGBD 1PTOD 3DXJC 1GUWA 1EY9A 3IL8A 4ZQ3A 2A5HA 4KMUC 1BCPC 3KF8A 2PPBC 2E2JB 1SMYD 3S2DB 1CI3M 5KYLA 1PRTF 5IODA 4C2MB 4L6TB 1BQQT 3PV0A 4K14A 4RFBA 1Y69U 4WRDA 4KJOA 1M4VA 1G6ZA 4WFN3 1PRTD 3GTJB 3Q6SA 3MXGA 3HOYB 5JPMC 3NBHA 1MD2D 2A69C 4DK1A 4F87A 1G91A 1TWHB 1TY0A 2CHBD 2IPKD 2IW3A 4DU9A 1BDOA 3EA6A 2IX0A 2XNAC 4FVMA 3GD7A 3ND9A 4IUTA 1Q90A 2K33A 1WTOA 1CK1A 2E2DC 2F0FA 3C1EA 3P20A 4CHTB 1EWCA 1OXVA 2B2TA 3U9OA 1TVXA 2AWNA 1GUTA 5FOBB 3J80E 5ELFA 5ELCA 4A3DB 4MHEA 3GTQB 5IIFA 4CKBA 3NWSA 1TWAB 3DEPA 4XQNA 1V1OA 1F9RA 1QG7A 1EY5A 4RH6A 1UNSA 5ELDA 3VYRA 5A2QL 2I46A 4KD4A 3HOUB 1SBBB 2ICEC 2FFKB 3NUCA 4C3HG 4Q0FA 1S5ED 3QWNA 1LACA 2VXWA 2YU9B 4FF2A 2X69A 5DEHA 1ILPA 2DY8A 4H7BA 5IGFA 1EYAA 1RCVD 1EOTA 5CMDA 3BG3A 2AQ1B 1KLGD 1IW7C 1JR0D 3K57A 4N9PA 1Q1EA 3IFDA 5CV6A 2KEEA 1SXTA 4KI0A 1VMCA 5C0XG 1JOQA 1Y8NB 3NTHA 4IN3A 2WIIB 4EGVA 1HPCA 3GTOB 5G3LD 5BN4A 2F0SA 5EBDA 3SXHA 3L7ZC 4KKSA 1SYFA 3GTPB 2XRSD 4K2KA 2F0IA 3SEBA 4HN7A 1IYUA 2SEBD 3S1NB 5E4WC 3NXWA 2FJ2A 1TR5A 2X6LA 3KK7A 4DAVA 3A8JE 2EY1A 5C6AA 3BYTB 4FXGC 1ENFA 2O4XA 5C0XI 3VR6A 1QJOA 3I72A 4H13C 1Q12A 2SOBA 2A6HD 1FNUA 3S14B 3S17B 2PW7A 2ICIA 1K8MA 3JAML 5DM63 1KDBA 2BE5C 5D3DA 2JXMB 2EYOA 2KJXA 1QOHA 5EKLA 3OHXC 2F3WA 2VB3X 3MFYA 4CKEA 3DMUA 4WJWA 2OT2A 3H09A 1F9PA 1SYCA 2SNMA 4GZYC 1DCZA 3IAYA 1I4QA 5D14A 3UI2A 1S4ZA 4HCSA 2IT1A 2R3ZA 2D62A 5C4JB 1STBA 3MZ5A 3M7NA 2CW0C 4O1NA 1PMRA 3K5NA 4HMIA 1MSHA 3MHBA 3I3CA 4O42A 1E2WA 5FKAC 1S5BD 4PMWA 2XWBB 4KN7C 3TP8A 5JEAH 1A2TA 1XWEA 4EQOA 1ESFA 5K36G 4XT3B 5FK9C 2RVLA 1NCVA 1TS5A 3C46A 2WINB 1GUOA 4FP5D 1JWUD 1JC7A 5AFWA 1RODA 1LTBD 4ID6A 2K6AA 1I4RA 1VF7A 2Z4IA 4IURA 4FNFA 1PFBA 3OW7A 1BR9A 5CYUA 1LV9A 3PIP3 1IKMA 1B53A 1TT2A 1DZ1A 1VDZA 4FYDA 4YIJA 3VYTA 2NN6H 3VYSA 1LT6D 3A55A 3SVMA 4L63B 2NVTB 2KCNA 4G7HC 1LTAD 5HURA 1QCBD 2RDGA 4DAYA 3VR4A 3T56B 5KGUA 3I4MB 1RTOA 4TSSA 1ET6A 4TKOB 3KBGA 3OWFA 3HOXB 1Q1BA 2SDFA 4IZ8A 1ESRA 2K03A 1B9MA 4XXEA 4JBWA 2K7VA 1WTWA 4FXKC 3GTGB 1EEID 1AZQA 3GV6A 5JVG3 4DA2A 1BO0A 2IWHA 2K5DA 2AQ3B 1RD9D 5J39A 3HGBA 3Q23A 1HTPA 4IFDG 1BNZA 1TS3A 1CZWA 3N6RA 4IUPA 1IL8A 2X6GA 2NVXB 2NBFA 3BVMA 4CKCA 4Y7NB 4A3MB 4BS9A 3P7JA 3RUZA 3S9WA 2VNUD 1RF2D 2RSNA 4IALA 5IGGA 1RDPD 1TY2A 1BCPB 5KNCA 1I4HA 5C4HA 2NVYB 2KEDA 5CGKA 5IT9E 3T53B 1HA5A 3MC0B 1WTVA 3TBIB 3J81L 3BVZA 2E2IB 3RD4A 4ZK9B 5EPLA 2PQEA 4CJ1B 1R4QB 4OGQC 4AYBB 5I6WA 1R4PB 4FO2A 2A73B 4IUVA 1EYCA 2BDOA 2M00A 1ET9A 2FMCA 1STYA 1QILA 1IYVA 1ML0D 1Y8OB 1IHZA 3I73A 1HFNA 1DYQA 2YYZA 4KTAA 1DM0B 3HEJA 4DK0A 2FMMA 1B1ZA 1D1KA 2B2YC 2ID0A 4C3JB 1LLRD 5FO8B 4ZUJA 3SK6A 3K5OA 1EY0A 2F0GA 3RZOB 1LABA 1DXMA 5M3MB 1STGA 1WTQA 2L4NA 5I4DA 5LL6X 1CHPD 3DHQA 1EY4A 1F2ZA 4BY1B 4ZYSA 4R9WA 1I4PA 4KKTA 5M9OA 2XWJB 2EPBA 1PZKD 1PTOF 2B39A 1SE3A 2EY2A 3OMGA 1WCMB 2K32A 4QUCA 3BS1A 2O5IC 1Y8PB 1SNQA 4M1UB 4BWGB 3SK4A 3GO5A 2F0LA 2ZXPA 2DY7A 3OPOA 3I8ZA 4K8IA 2NN6G 1IKLA 3J7YW 2WKCA 3M3YB 3H91A 5CC4A 4BY7B 5ELEA 3PIO3 1SNMA 3AU7A 1PRTB 1DOKA 2LMCB 1F9QA 3P75A 2EDGA 3LX0A 4RGMA 4LJZC 1SNPA 1FR3A 1QE6A 1I6HB 2A6EC 3VR5A 5CV5A 3PUVA 1KNAA 4LMQD 2AQ2B 4N9TA 3MEHA 1HUNA 2NB0A 1DD2A 2I07B 2M2LA 2M9VA 2ZXOA 4KHZA 4G4KA 4J1MA 2NN6I 2MPMA 3FPPA 5JEAJ 2L0CA 1XX8A 1RKNA 2GA4B 4BBSB 2B2YA 1PYWD 1U9RA 4RCOA 1SFOB 5IGBA 4BA2I 1HCZA 2F0QA 2ZT9C 5JOBA 3QB3A 3KUPA 3URYA 1GOZA 2TSSA 1EY7A 3QO2A 1Y1WB 2AWOA 4OO1H 2KQ3A 2DNEA 1TS2A 1XTCD 2Z8LA 4PNYA 2B2VC 1TWGB 1EFID 1ZEQX 2EYLA 1H9RA 5ISRA 5EGTA 3CRKC 1E2VA 4FF1A 2OEOA 4A3IB 1XXGA 4I65A 2K1BA 2EYJA 1SJED 2IL8A 1OO9B 3HKZB 4PV1C 1YNND 3FDTA 2VUMB 1K8OA 1PTOC 2PCFB 3VR3A 5I9OA 1JOKA 4HSPA 2JYOA 5C5MA 3PUWA 3HZXA 4RGOS 3MWYW 1LTID 3H6MA 3NWTA 2AUKA 3NE5B 1KNEA 3J80L 1SMYC 4UDUC 4PMCA 2XRQD 4C1NI 5IGDA 3PO2B 1X3QA 2RDHA 1STNA 1AW7A 2AUJD 2Z1CA 4C3HB 4NW2A 5G3LF 3MXNA 3IKJA 2H1EA 1Z47A 2L11A 3A54A 5J22A 3K7AB 1PRTC 2MJ8A 1ICWA 2R93B 4A3FB 1BF4A 2WKDA 3A7LA 4A3GB 4C3IG 3DUZA 5NUCA 2K01A 4HMJA 3C2PA 1K83B 3EVQA 4XIGS 3VA5A 1KDAA 1GXDC 2LFNA 4C3IB 2LY7A 3KLSA 4JK1C 3W2DA 5ELBA 3R8BA 4X3UA 4LK1C 2WP8J 2HDLA 5BN3A 1CZGA 5FO7B 2MP1A 3KLRA 3D4DA 3MA2B 1XYIA 1SNDA 4DF7A 5KRUA 2F0PA 1SNCA 4E6IA 2MHVA 3SHLA 2L12A 4NKLA 3ONAB 1ZYRD 1TQOA 3A56A 3MTSA 1D2BA 3G7LA 1DJRD 1JWSD 2PW5A 1B4OA 2EVBA 5EKIA 3D6WA 4L8JA 2KUMA 1CT1D 2QILA 2XN9C 3K5MA 2ZXRA 4KKUA 4S3SA 4MN3A 2PZTA 2HDMA 1ENAA 5M5XB 2N55A 2L1BA 3M4YA 3SK8A 5IGEA 2XSCA 4ZKCB 2EY6A 4F7XA 3S16B 4RA8A 2NWGA 1G2SA 1AZPA 5M5WB 2QF7A 3S1RB 3OWEB 3WDNA 2R61A 3BVGA 2F0KA 1R9TB 1CA6A 1ENCA 3CHBD 4HCEA 1CTMA 2K5QA 1ONLA 3DEOA 5CBEE 2OXPA 3DM1A 4B9WA 2PO4A 4NDXA 3Q0AA 1GUSA 3R2TA 3WOFA 3AB9A 3MAQA 3A7AB 2NUCA 4R8NA 5COYA 3VR2A 4KN4C 3M4OB 4K6LA 5EPKA 4H44C 5FO9B 4HR7B 1QB5D 1UEAB 2R6GA 2KECA 2A6HC 5C4XB 2O5JC 5JPNC 5E4XA 1STAA 4OL7A 5EPJA 2Y0SB 3HRZC 2RSOA 3M85A 4XQQA 4EVOA 2Q8RE 5HGTA 4A3JB 4R8IA 3E6ZX 1HQRD 2H4OA 1O7LA 4PQXA 1KDCA 2F0VA 5CBAE 3IFTA 4OO1I 1FNWA 3W3AA 3NTIA 5IOCA 1G291 5C3XA 2EYHA 4KV6A 1Y1VB 2F0NA 2EXZA 3FPUB 5CV9A 5C5LA 1A6XA 4KK7A 1PLFA 2Q8TA 1H9SA 4XDXA 1UAPA 4F88A 1Z6HA 3NQTA 1JCKB 3K58A 2F0HA 2OF1A 4QB4A 3VYUA 3MXUA 2KOLA 1O7ZA 3AMUA 3NP8A 2A68D 2B2UC 3TZDA 4HTHA 3J7AF 2JSOA 1NUCA 4ZRZA 2EJMA 2HUGA 5LHY1 4Q5VA 3RLFA 1H9MA 2EYFA 2RBMA 4PMBA 1ZXTA 1SJHD 2D5DA 2RDFA 3I70A 4B9XA 1BCPD 1JE4A 4XYQA 4LAAA 3NQIA 2MUYA 5EQ0A 1SE4A 1JOOA 3I4NB 2IX3A 1NR4A 5KIXA 2JA5B 2EZVA 1A3VA 1PXUA 2SNSA 3D4RA 4ULLA 3SK5A 5IT9L 1HA6A 1TU2B 1MI2A 4G57A 3GV3A 4P2CB 5D3IB 2EYMA 4CBVA 2JE6I 1SYBA 2A69D 3E5SA 4DAPA 3V96A 5C0XH 1MGSA 4RGTA 3M7GA 5JEAG 1HHVA 1B3AA 4XT1B 1EU4A 2IX1A 1U4MA 1NSNS 4ZUIA 1F9SA 3KLSX 3WOEA 1II3A 2BA0A 3G6JB 1J8IA 2L55A 1SE2A 3GQBA 3X3NA 3MFGA 2QKIC 4C1NK 2F0UA 3LWUA 1FD7D 4IUQA 1MBYA 2B2TC 4IFDJ 1PTOB 3ITPA 3GTLB 1OXTA 4ZLTF 4KD3A 2BA1A 1D5XC 2JEAI 3RZDB 1O78A 4DN4M 4V190 2B2UA 3SDZA 1E0BA 1I3QB 4G7ZC 1WD0A 2NTTA 1BOSA 5EKKA 4X3TA 3N52A 3TP6A 1HTLD 4FF3A 1X3PA 3ZYYX 1D1IA 2XIWA 1KAAA 1EU3A 1RTNA 1GUGA 1TIID 2WB1B 3A8IE 1M8AA 4Z9CB 2B2WC 3S15B 4U673 1CHQD 3FRPB 3PUXA 4J6HA 3ND8A 2N88A 4QCLA 4BA1I 2G9HD 3CQZB 3PO3B 1IW7D 4A3BB 5E1FA 1SDFA 4HEDA 3OIPA 3BYYB 3D6CA 1SYDA 3CU7A 3NBIA 3R93A 1EQVA 3TP7A 1S5CD 1W6KA 1AEXA 2JP1A 4A93B 5EBCA 4DNTB 2KVMA 1FNVA 2NZ1D 1A3TA 1OXXK 1AN8A 1EEFD 4C56C 1OXSC 3R2IA 2WV6D 2E74C 4ZAIA 4DNRB 4K2LA 2CQAA 5K36H 4ABNA 3RMHA 1Q8IA 2JEBI 3D4WA 1QWYA 4QIWB 5DNFA 1BXTA 5CORA 4F8MA 5A2QE 4K5VA 2EYPA 1U4RA 2F0OA 2K5WA 1V1PB 4V0BA 3T51B 3OIQA 2HCIA 3OOCA 2B8GA 1U4PA 4EQPA 3F2UA 3QOJA 3D31A 5C4ZA 2CVRA 1BUVT 1HRJA 1LT3D 4UAIA 3EJIA 4RKLA 5TSSA 5I6YA 3I4LA 1C4QA 2R7ZB 2RQXA 3NPPA 3S1QB 5D65A 4IQZA 1H9KA 1EYDA 1C8CA 3ERQA 3HS0C 1CM9A 1UUPA 1FYCA 4CJ2C 1QNUA 2BOSA 5C44B 1LTRD 2PNRC 5M5YB 3TP5A 2BE5D 4QUFA 1PZJD 2KA7A 2BDNA 1H9SB 4KY5A 3K59A 5J1ZA 4K8JA 1A2UA 3TSSA 2B2WA 4KY7A 4RHSA 1G2TA 5I2XA 1A15A 1CQVA 4M8AA 1L0YB 3DWQA 1B2TA 2CW0D 4RKBA 4ILWA 3FKIB 2KHSA 2D9UA 3CRLC 2F03A 2WACA 2L9HA 3Q24A 2PMZB 4CJ0B 4KJNA 3S2HB 3HG9A 2F0DA 1PDQA 3EFXD 2MGSA 3Q22A 3LNNA 3D8GA 3V2TA 2LKVA 1S5DD 4IFDH 3P1HA 1LT4D 3BDOA 1CA5A 4IUUA 4CGYB 3L3OC 5EJWA 3L9AX 4HAEA 4RGNA 1WVLA 3BDLA 1JORA 2R92B 4FF4A 5KYIA 4HSVA 1CFMA 3JAME 1SNOA 2FINB 5CV7A 2EOTA 2B2VA 1T5XD 2D2CC 2Q8IB 5CR3A 1JWMD 4A3KB 1JQYD 4TQUS 1EIGA 2E2HB 1HFGA 4NP5A 1Z7TA 2PZWA 1AP0A 2G9DA 1HUMA 2A74C 4OIJA 4RHRA 5JVH3 1S5FD 1YNNC 1SSOA 2DNCA 4X3KA 4WORA 5C3EB 2EY5A 1J9OA 2F0WA 5JAVA 1WD1A 1TWFB 3TMEA 5F2DA 4FXDA 2F0TA 2B8FA 3FMCA 3I90A 2F0JA 3NHHA 2F3VA 4K6DA 3FEWX 1D5ZC 4IUNA 1T5EA 1EL0A 2B63B 1EZ8A 1X32A 5DM73 4TRDA 2E75C 3DWPA 3GTKB 2C5CA 1RJTA 1KABA 3E0JA 1LTGD 5C0XJ 2JA6B 3OSOA 5JJZA 3H3VC 1VMPA 1F77A 2IJ0A 1EWHA 5A35A 1STEA 3DWAA 1KTKA 1V8QA 5I9PA 4A3EB 1EY8A 1O80A 1PTOH 5IGCA 1D6EC 4RCNA 1V43A 1SAPA 2FHTA 1SEBD 4DFAA 1F2YA 4OO1G 4ZKBB 5I2YA 2WAQB 1GUNA 2RKSA 3D3RA 1GHJA 4NMZA 3R3OA 1A3UA 1EQTA 3T4AC 4RWSC 1B9NA 3V05A 4H0LC 2EJFC 1BBXC 1D5MC 2K04A 3HOVB 1LO5D 2BCOA 1EIHA 3MVVA 1VCIA 2LS01 1EZ6A 1SYGA 3BZDB 3CKIB 3HOZB 4XQJA 1LTTD 1NR2A 1V1PA 5KEEA 1ZYRC 2NVQB 1OXUA 4QF4A 3H94A 1I4XA 4I7ZC 3PUYA 2PZUA 3KBXA 1PFMA 4XYOA 3GP7A 3FVQA 1NAPA 1WTPA 5CV4A 1B44D 2V4DA 3SE0A 3HOWB 1AFPA 3H0GB 3QOLA 1YNJD 2O2LD 1F2LA 1ZKOA 1LT5D 3BDCA 1TKWB 4ME5A 3QIAA 1B50A 4G7OC 1MSGA 4XTCS 2NYZD 2F0EA 2J7ZA 2J0TD 1LTSD 2HCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4P B;  1CZW A;  2GA4 B;  1C4Q A;  2XSC A;  1D1I A;  1DM0 B;  4P2C B;  4M1U B;  1C48 A;  1D1K A;  2C5C A;  1QNU A;  2BOS A;  1CQF A;  3MXG A;  4ULL A;  1QOH A;  1R4Q B;  1BOS A;  1CZG A; 
#chains in the Genus database with same CATH topology
 1DOL A;  3NK9 A;  1I6V C;  3WWV A;  5IP7 G;  1Y1W H;  2ENB A;  5IT9 c;  2K14 A;  3OMC A;  4OHJ A;  4A3M G;  4GOP B;  5LMU L;  1P8L A;  2L15 A;  3QJY A;  1TWG H;  5ELO A;  3T16 A;  5AJ3 Q;  1WTX A;  3PSI A;  1HXY D;  2R7F A;  3U9S A;  3VA7 A;  1EYG A;  5FLX E;  2K28 A;  1RHP A;  2RHS B;  2QDL A;  3CME A;  2CH4 W;  1O7Y A;  2JA8 B;  1GJX A;  2RA4 A;  3J81 E;  3ERO A;  1NMG A;  1X54 A;  4JOI C;  2I5H A;  1PFN A;  1I5F A;  5E3F A;  2VUM H;  3C3L A;  1E2Z A;  4B3S Q;  1VQD A;  1L0X B;  4U68 A;  3S1Q H;  3I91 A;  2F0M A;  1C48 A;  3ERS X;  2XVS A;  1GD7 A;  4DXF A;  5DAU A;  2QCP X;  5M3F B;  4LF4 L;  5KNB A;  1BCP F;  1XNQ Q;  4ODG A;  3PMF A;  1PH1 A;  2UUC L;  2F52 A;  1VQH A;  5T1I A;  3CCV A;  4DUZ Q;  5M5Y H;  3TZU A;  2ZTE A;  4OIK A;  4X3S A;  2Z9H A;  3EQL C;  1QNK A;  3PO2 H;  1SLJ A;  5LMN W;  4DV3 Q;  1ILQ A;  4MIU A;  5FLX L;  5LMN L;  1JB3 A;  2F4I A;  3NSW A;  4J8Q A;  1GVP A;  3B6Y A;  1DON A;  4JYA Q;  3MXP A;  4DR6 L;  2TMP A;  3K6O A;  3O13 A;  3LWE A;  3C1F A;  5JJK A;  2JA7 B;  3CF5 A;  4PZ8 A;  4LFA L;  5LL6 S;  4DR5 L;  2F1M A;  2HQE A;  2I5M X;  3GTM B;  4IFD I;  2UU9 L;  3HP3 A;  2C9O A;  2QEJ C;  1TS4 A;  3X3M A;  4A3G H;  2DN8 A;  1EY6 A;  1YJ9 A;  1PZI D;  2L5T A;  4B08 A;  4UP8 A;  1N34 Q;  3PUZ A;  1VQJ A;  5GAE C;  2A6E D;  4C3J G;  4DGZ A;  4RAU C;  2EE1 A;  3KDF A;  4JI8 L;  1BVS A;  4KHV A;  3UE1 A;  3E3X A;  1W6J A;  3PGZ A;  2K05 A;  1CQF A;  1U4L A;  1L1O C;  2QDB A;  1JIC A;  5M3M G;  5T1G A;  3CCJ A;  1YNJ C;  1WTR A;  2VB2 X;  1Z9F A;  1HQM C;  2BH8 A;  4C3I H;  1Q82 C;  3A8K E;  1F2M A;  4BY1 G;  1HH2 P;  5CV8 A;  4KY6 A;  4DXG A;  3QG1 A;  1C0A A;  4BXX G;  4EQN A;  3E9I A;  5KND A;  1DOM A;  2E76 C;  4BBR B;  4JI2 L;  2EJG C;  2R92 H;  4JI4 Q;  1WCM G;  3J7A V;  1VF5 C;  2PYK A;  3TN2 A;  5BN5 A;  4UP7 A;  2J4X A;  5C3W A;  3T13 A;  3K0Y A;  3S1M B;  2NTS A;  2YTV A;  4K5W A;  1STH A;  4K5X A;  4OX9 L;  4QMG A;  2KCC A;  3K81 C;  1Q3L A;  3RR5 A;  2QW7 A;  2A68 C;  1GHK A;  1G8Z D;  3TDQ A;  4DV0 Q;  1TWC B;  3SR1 A;  1SYE A;  3NTK A;  4JOI A;  4PZ6 A;  2Z4H A;  1VQO A;  1I4G A;  2BH2 A;  5K5P A;  1GKH A;  1I50 B;  1KLU D;  3F1Z A;  4LUZ A;  3K5L A;  4BY7 G;  1H9J A;  3CD6 A;  1FGB D;  1PTO D;  1TWF H;  5GAH C;  3DXJ C;  1PV4 A;  4O0A A;  4GN5 A;  1GUW A;  3UE0 A;  3CP0 A;  4APV A;  3KOJ A;  1PH9 A;  1EY9 A;  3IL8 A;  2HHH L;  2KEN A;  4ZQ3 A;  2A5H A;  2K52 A;  4KMU C;  1BCP C;  4LUV A;  3KF8 A;  2PPB C;  2E2J B;  1XPU A;  1SMY D;  3S2D B;  1CI3 M;  4AQY L;  5KYL A;  1PRT F;  5IOD A;  4C2M B;  3CCL A;  4L5R C;  1CSQ A;  4L6T B;  4DUZ L;  3GTK H;  1BQQ T;  3PV0 A;  4K14 A;  4RFB A;  1Y69 U;  4OEM B;  4WRD A;  4KJO A;  2JA6 H;  1M4V A;  1G6Z A;  4DV3 L;  4WFN 3;  1PRT D;  3GTJ B;  3Q6S A;  3MXG A;  2P5Z X;  3HOY B;  1R9T H;  5JPM C;  3NBH A;  1N36 Q;  3AQQ A;  1MD2 D;  4CDF C;  1LTL A;  5IYC G;  4MZ9 A;  4A3E H;  2WAQ E;  2A69 C;  4DK1 A;  4F87 A;  1G91 A;  2UXD Q;  3OTO Q;  1TWH B;  1TY0 A;  2CHB D;  4B3R Q;  1L1O A;  2IPK D;  2IW3 A;  5JJI A;  4DU9 A;  1BDO A;  2Q2H A;  2VQE L;  3EA6 A;  1Y1W G;  2IX0 A;  1X9N A;  1X65 A;  1I94 Q;  1JMC A;  2XNA C;  4FVM A;  3AYH B;  3GD7 A;  2UUA Q;  4A3D G;  2I0Q A;  4KHP L;  3ND9 A;  4IUT A;  1Q90 A;  3NEM A;  4DV6 Q;  2K33 A;  2ATW A;  1WTO A;  5GAD C;  1MJE A;  2CCZ A;  2Z6K C;  1CK1 A;  2E2D C;  2F0F A;  4A3I G;  3C1E A;  3P20 A;  4CHT B;  1EWC A;  4DR3 Q;  3HOU G;  1OXV A;  2B2T A;  3HKZ G;  3U9O A;  2UUB Q;  2VUM G;  1TVX A;  2AWN A;  2HIX A;  3ULP A;  1GUT A;  1Q8K A;  5FOB B;  3TRZ A;  4L5Q A;  3J80 E;  4DPG A;  4DAY B;  5ELF A;  5ELC A;  3RN5 A;  4L5S A;  4A3D B;  4A3J H;  4MHE A;  4JI1 Q;  3GTQ B;  5IIF A;  4CKB A;  3NWS A;  1TWA B;  2ZJQ A;  3ULJ A;  1EOV A;  5FLM H;  3DEP A;  4XQN A;  3AFQ A;  1V1O A;  1F9R A;  1QG7 A;  4IPD A;  1EY5 A;  4RH6 A;  1UNS A;  5ELD A;  3VYR A;  3PO2 G;  1PHJ A;  5A2Q L;  2I46 A;  4KD4 A;  4X65 Q;  3HOU B;  1XNR Q;  1SBB B;  1U0L A;  2FFK B;  2ICE C;  3NUC A;  4C3H G;  4Q0F A;  4JV5 L;  4X6A H;  1S5E D;  4DV0 L;  3QWN A;  1LAC A;  3HOW H;  3H0G H;  1Y1V H;  2DGY A;  2VXW A;  2YU9 B;  4FF2 A;  2R93 G;  2X69 A;  4A3F G;  5DEH A;  1ILP A;  4P73 A;  2DY8 A;  4H7B A;  5IGF A;  2KCT A;  1EYA A;  1VQB A;  1RCV D;  1EOT A;  5CMD A;  3BG3 A;  2AQ1 B;  1UEB A;  1KLG D;  1IW7 C;  1JR0 D;  5DLQ E;  3K57 A;  4N9P A;  1VQN A;  1YJN A;  1Q1E A;  3IFD A;  1HR0 W;  5CV6 A;  2KEE A;  1SXT A;  4KI0 A;  3AEV A;  1VMC A;  5C0X G;  1JOQ A;  1K3R A;  1Y8N B;  3NTH A;  4DAM A;  4IN3 A;  2WII B;  1XMO L;  4EGV A;  3U58 A;  4AIM A;  1HPC A;  3GTO B;  3T1H L;  1YIJ A;  1PH3 A;  5G3L D;  5BN4 A;  2F0S A;  5EBD A;  3SXH A;  2JA8 H;  3L7Z C;  1K3B C;  4KKS A;  3VDY A;  4QL5 A;  1SYF A;  5IYB H;  4LFB L;  2VS1 A;  2PQA B;  3GTP B;  2XRS D;  4K2K A;  3A5Z B;  1YHB A;  2F0I A;  3SEB A;  4HN7 A;  1IYU A;  2SEB D;  3S1N B;  5M3F H;  5E4W C;  3NXW A;  1YJW A;  4A3L H;  2FJ2 A;  1TR5 A;  2X6L A;  1ASY A;  3KK7 A;  4DAV A;  4GKJ L;  3A8J E;  2EY1 A;  5C6A A;  3BYT B;  4FXG C;  1ENF A;  2Z6K A;  4GN3 B;  2O4X A;  1B70 B;  2E8G A;  5C0X I;  3VR6 A;  1QJO A;  4LUO A;  3I72 A;  4H13 C;  3I4N H;  1QVG A;  2K75 A;  2JA7 H;  1Q12 A;  2SOB A;  2A6H D;  1FNU A;  4OXP A;  3S14 B;  3GTM H;  3S17 B;  2N78 A;  2PW7 A;  1PA6 A;  2ICI A;  1XMQ Q;  1IL2 A;  3RLN A;  1K9M C;  4DKA C;  1K8M A;  4DR3 L;  3K80 C;  3NEL A;  3JAM L;  5DM6 3;  1EQQ A;  1KDB A;  2BE5 C;  5D3D A;  2JXM B;  2EYO A;  2KJX A;  4LF7 L;  1QOH A;  5EKL A;  3OHX C;  1E7Z A;  2F3W A;  4JI1 L;  1YVC A;  2VB3 X;  3MFY A;  4CKE A;  4A76 A;  3DMU A;  4WJW A;  2OT2 A;  3H09 A;  1F9P A;  1SYC A;  2SNM A;  4GZY C;  1DCZ A;  3IAY A;  3Q8D A;  4O2D A;  1I4Q A;  5D14 A;  3UI2 A;  1S4Z A;  4HCS A;  4X65 L;  2IT1 A;  4GLX A;  2R3Z A;  2D62 A;  5C4J B;  1STB A;  1YNX A;  3MZ5 A;  3M7N A;  4P75 A;  2CW0 C;  4BBR H;  4O1N A;  4HJ5 A;  1PMR A;  4JG2 A;  3K5N A;  4HMI A;  1MSH A;  3MHB A;  3I3C A;  4O42 A;  4LF4 Q;  3G71 A;  1E2W A;  1HZA A;  1S5B D;  5FKA C;  4PMW A;  2XWB B;  2UUC Q;  2GVB A;  4KN7 C;  3BZK A;  3TP8 A;  5JEA H;  1A2T A;  1QUQ B;  3EBE A;  4MNO A;  1XWE A;  4EQO A;  1WOC A;  1ESF A;  5K36 G;  4XT3 B;  5LMN Q;  1XTD A;  5FK9 C;  2RVL A;  1NCV A;  1TS5 A;  1TWC H;  2DUD A;  1XJV A;  3CCQ A;  3C46 A;  2HT1 A;  4YWM A;  2WIN B;  4DR6 Q;  1GUO A;  4FP5 D;  1JWU D;  1JC7 A;  2Z6B A;  4LFA Q;  3CC2 A;  1I50 H;  5AFW A;  1ROD A;  1LTB D;  4DR5 Q;  4ID6 A;  2UU9 Q;  5J3B A;  1N33 L;  5C4X G;  4JC0 A;  1NNX A;  1VQF A;  2K6A A;  1I4R A;  1VF7 A;  3UDF A;  2Y0S G;  2Z4I A;  4IUR A;  4FNF A;  5HY6 A;  1PFB A;  3OW7 A;  1BR9 A;  5CYU A;  4RG1 A;  4A3J G;  1LV9 A;  3I4M G;  3PIP 3;  1IKM A;  1B53 A;  1OTC A;  1TT2 A;  1DZ1 A;  1VDZ A;  4FYD A;  4YIJ A;  3VYT A;  5FLM G;  2VQF L;  2NN6 H;  3NBH B;  3VYS A;  1LT6 D;  3A55 A;  3CQZ H;  3SVM A;  4L63 B;  4IJL A;  2NVT B;  2KCN A;  1JJC B;  4G7H C;  1LTA D;  5HUR A;  1QCB D;  2A19 A;  1CKM A;  2CWP A;  2RDG A;  4DAY A;  1A8V A;  3VR4 A;  3HOY H;  3T56 B;  5KGU A;  1Y1V G;  3I4M B;  1RTO A;  2AHO B;  4TSS A;  1ET6 A;  4A93 H;  3T1Y L;  2YV5 A;  5FLX c;  1SN8 A;  4TKO B;  3KBG A;  1AH9 A;  3OWF A;  3HOX B;  1QVC A;  1Q1B A;  2SDF A;  4IZ8 A;  1ESR A;  2K03 A;  1B9M A;  4XXE A;  2PI2 A;  4OX9 Q;  5GAG C;  4JBW A;  2K7V A;  1WTW A;  1CKN B;  1KAW A;  4FXK C;  3OW2 A;  3GTG B;  2F3I A;  1EEI D;  4JBM A;  1AZQ A;  1EQR A;  3GV6 A;  1VQL A;  5JVG 3;  2WFW A;  4DA2 A;  2JK8 A;  4YHH L;  1BO0 A;  2IWH A;  2K5D A;  1KRT A;  5IYB G;  2VW9 A;  2AQ3 B;  1RD9 D;  4P71 A;  3HGB A;  5J39 A;  3F2B A;  3Q23 A;  3S24 A;  1HTP A;  4IFD G;  1BNZ A;  1TS3 A;  1HNX L;  1CZW A;  3N6R A;  4IUP A;  2HHH Q;  1IL8 A;  2X6G A;  2NVX B;  4ZCK A;  2R7Z H;  2NBF A;  3BVM A;  2PI2 E;  4CKC A;  4EX5 A;  4Y7N B;  4A3M B;  4BS9 A;  3P7J A;  3RUZ A;  3S9W A;  1TWA H;  2VNU D;  2KBN A;  4AQY Q;  1RF2 D;  4L5T A;  2RSN A;  4R4O A;  3L2P A;  4HJ7 A;  4IAL A;  5IGG A;  4HIK A;  5C44 H;  1RDP D;  1TY2 A;  1BCP B;  4AYB G;  2B29 A;  2PQA A;  1XPR A;  5KNC A;  1I4H A;  4R4C A;  5C4H A;  2NVY B;  2KED A;  5CGK A;  1KIX A;  5IT9 E;  3T53 B;  1HA5 A;  2JA5 G;  3MC0 B;  1WTV A;  1NY4 A;  3TBI B;  3J81 L;  2YU9 H;  3BVZ A;  2E2I B;  3MXN B;  2E5L L;  2PMZ E;  3RD4 A;  4ZK9 B;  5EPL A;  3H3V H;  2PQE A;  4CJ1 B;  1R4Q B;  4OGQ C;  4AYB B;  5L37 A;  5I6W A;  3PIP A;  1R4P B;  4FO2 A;  1N32 L;  2ZM6 L;  2A73 B;  2XGT A;  1E1T A;  2VQE Q;  3FKI H;  4IUV A;  1EYC A;  3STB D;  1PYS B;  2BDO A;  2M00 A;  1J6Q A;  1ET9 A;  2FMC A;  1STY A;  4KHP Q;  1QIL A;  3KYH C;  3S2H H;  1IYV A;  1ML0 D;  1Y8O B;  1IHZ A;  1NTG A;  3I73 A;  4QGU A;  1KHI A;  1HFN A;  1DYQ A;  1VQ4 A;  1PH8 A;  2YYZ A;  4KTA A;  1DM0 B;  3HEJ A;  4DK0 A;  2H5X A;  2LXJ A;  2FMM A;  3GTP H;  1B1Z A;  1D1K A;  2B2Y C;  2ID0 A;  3E9H A;  4C3J B;  1LLR D;  5FO8 B;  4ZUJ A;  1PFS A;  3SK6 A;  3K5O A;  1EY0 A;  2F0G A;  3RZO B;  1LAB A;  1DXM A;  5M3M B;  1STG A;  1WTQ A;  2L4N A;  5I4D A;  3RLO A;  5LL6 X;  1IXR A;  1CHP D;  5IY0 A;  3DHQ A;  4JI0 L;  4A3K H;  1EY4 A;  1F2Z A;  4BY1 B;  4JPB W;  4ZYS A;  4R9W A;  2E2H H;  1I4P A;  4JV5 Q;  4IJH A;  5GRO A;  4KKT A;  4IO9 A;  5M9O A;  2XWJ B;  2VZA A;  2EPB A;  1PZK D;  2UXC Q;  3BU2 A;  1PTO F;  2B39 A;  1X3G A;  1SE3 A;  2EY2 A;  3OMG A;  2QA4 A;  1WCM B;  3S17 H;  1QUQ A;  2K32 A;  4QUC A;  3BS1 A;  5C3E H;  2O5I C;  4A3C H;  1Y8P B;  1SNQ A;  4M1U B;  4BWG B;  2IHE A;  1D8L A;  2WB1 G;  3SK4 A;  4LW1 A;  3GO5 A;  2F0L A;  2ZXP A;  2DY7 A;  4B3M L;  4DUY L;  3OPO A;  1VQM A;  3A5U A;  3I8Z A;  1HR0 Q;  4K8I A;  1XMO Q;  2NN6 G;  5IYD H;  1IKL A;  5IP9 H;  2WKC A;  3J7Y W;  2B63 H;  3PO3 G;  3T1H Q;  3M3Y B;  3H91 A;  1J5E Q;  4A3B G;  5CC4 A;  4BY7 B;  5ELE A;  1W3S A;  3PIO 3;  1SNM A;  3AU7 A;  1PRT B;  1DOK A;  3K7U C;  4LFB Q;  2LMC B;  1F9Q A;  3P75 A;  1VQG A;  1HNZ L;  1ASZ A;  4GS3 A;  2EDG A;  3LX0 A;  4RGM A;  4LJZ C;  1SNP A;  3FP9 A;  1FR3 A;  1E1O A;  1QE6 A;  4BBS G;  2MFI A;  3CMA A;  1I6H B;  2A6E C;  3VR5 A;  2ZJP A;  5CV5 A;  5ELN A;  3PUV A;  1KNA A;  5BR8 L;  4LMQ D;  4GKJ Q;  3J81 i;  4WJ4 A;  2AQ2 B;  3CCS A;  3G48 A;  4J15 A;  4N9T A;  4JI7 L;  1T9H A;  3MEH A;  1HUN A;  4POG A;  2MO0 A;  1Q81 C;  2NB0 A;  1DD2 A;  2I07 B;  1UE6 A;  1VQK A;  2M2L A;  2M9V A;  1K73 C;  2ZXO A;  4KHZ A;  4G4K A;  5IWA Q;  4J1M A;  3CCE A;  2CKZ B;  2NN6 I;  2MPM A;  3FPP A;  4YWK A;  5JEA J;  2L0C A;  1XX8 A;  1TXY A;  1RKN A;  2GA4 B;  4HJA A;  4BBS B;  1VQE A;  2B2Y A;  1CKO A;  1PYW D;  1U9R A;  2LSS A;  4RCO A;  1SFO B;  1WFQ A;  1IBK L;  5IGB A;  4BA2 I;  1HCZ A;  1JE5 A;  2F0Q A;  3I55 A;  3KJO A;  2ZT9 C;  5JOB A;  1CKN A;  4IOC A;  3QB3 A;  3ULL A;  3KUP A;  3URY A;  1GOZ A;  2TSS A;  1EY7 A;  3QO2 A;  3HOV H;  1Y1W B;  2R7Z G;  2AWO A;  4X66 L;  2KQ3 A;  4OO1 H;  3CXC A;  2DNE A;  1TS2 A;  1XTC D;  2Z8L A;  4PNY A;  4LF7 Q;  2B2V C;  1TWG B;  3HOZ H;  1EFI D;  3M9B A;  4UPA A;  1ZEQ X;  2ZTD A;  2EYL A;  1PVO A;  2K50 A;  1HZ9 A;  1H9R A;  2B3G A;  2MO1 A;  5ISR A;  5C44 G;  1O7I A;  5EGT A;  5H1S E;  2NVQ H;  2RCN A;  3CRK C;  1E2V A;  1X3E A;  4FF1 A;  2OEO A;  3KF6 A;  4UHV A;  1KQS A;  1SR3 A;  4A3I B;  1XXG A;  4I65 A;  2K1B A;  2EYJ A;  1SJE D;  2IL8 A;  1OO9 B;  3HKZ B;  4PV1 C;  1YNN D;  3FDT A;  4NB3 A;  2VUM B;  4GNX B;  1K8O A;  4LF9 Q;  1PTO C;  2PCF B;  3VR3 A;  5I9O A;  5FJ8 H;  3TS0 A;  1JOK A;  1E24 A;  4HSP A;  3L0O A;  1PH5 A;  2JYO A;  5C5M A;  2UXC L;  4QJF A;  3PUW A;  1FJG L;  1SRO A;  3CPW A;  3HZX A;  4R1J A;  3MWY W;  4RGO S;  1IBL L;  1LTI D;  4B3T L;  3H6M A;  3NWT A;  3EN2 A;  2AUK A;  3NE5 B;  4N8F A;  1KNE A;  3J80 L;  4GN4 B;  1PH4 A;  1SMY C;  4UDU C;  4PMC A;  2XRQ D;  4C1N I;  2N8N A;  2MNA A;  5IGD A;  4A3G G;  3PO2 B;  3FKI G;  3SGI A;  1X3Q A;  2RDH A;  4H02 A;  1STN A;  4LFC L;  1Q46 A;  1AW7 A;  1IYJ B;  2AUJ D;  2Z1C A;  4C3H B;  4NW2 A;  4DR7 Q;  4X64 L;  5G3L F;  3MXN A;  2QGQ A;  3IKJ A;  2H1E A;  2JQO A;  1Z47 A;  2L11 A;  3A54 A;  5J22 A;  1HR0 L;  1HZB A;  1JT8 A;  3K7A B;  1PRT C;  2MJ8 A;  1ICW A;  3JAM c;  4DV7 L;  2R93 B;  4A3F B;  1BF4 A;  2WKD A;  3A7L A;  1N33 Q;  4NXN L;  2IHF A;  1J5E L;  4A3G B;  4C3I G;  3DUZ A;  5NUC A;  2GN5 A;  2K01 A;  1A0I A;  1VQA A;  4TVA B;  4HMJ A;  3KJP A;  3C2P A;  1K83 B;  3EVQ A;  4XIG S;  3JC6 6;  3VA5 A;  5IP7 H;  1KDA A;  3H3V I;  5IE8 A;  4Y7N H;  3CC7 A;  4A3M H;  1L0W A;  1KD1 C;  2R92 G;  1U5K A;  4YCW A;  2K4K A;  1GXD C;  2VQF Q;  1PH6 A;  1VQ8 A;  2LFN A;  4C3I B;  4OWT B;  2LY7 A;  4AYB E;  3KLS A;  4MTN A;  2NVY H;  4JK1 C;  4NXM Q;  3W2D A;  1XPO A;  1YI2 A;  1BBW A;  1SMX A;  4DV4 L;  5IWA L;  5ELB A;  1SRU A;  3R8B A;  3T1Y Q;  4X3U A;  4LK1 C;  2WP8 J;  5C3E G;  2VY3 A;  2HDL A;  2RF4 A;  5BN3 A;  1CZG A;  1EUJ A;  2MP1 A;  5FO7 B;  2OTL A;  3CC4 A;  2D0P A;  3KLR A;  1PH2 A;  3D4D A;  3MA2 B;  1XYI A;  2K5V A;  1SND A;  1S72 A;  4DF7 A;  5KRU A;  2F0P A;  1SNC A;  4E6I A;  4JI6 Q;  4JI5 L;  2MHV A;  4GLV B;  3SHL A;  2L12 A;  4NKL A;  3ONA B;  1ZYR D;  1PYB A;  1TQO A;  3A56 A;  4DR4 L;  3MTS A;  3CW2 C;  5IP9 G;  2B63 G;  3G7L A;  1DJR D;  1D2B A;  2NZO A;  1JWS D;  2KHJ A;  1KXL A;  4HJ8 A;  2PW5 A;  4GNX C;  4YHH Q;  1B4O A;  2EVB A;  5EKI A;  3D6W A;  4LF8 L;  2OWO A;  4IOA A;  1NE3 A;  4L8J A;  2KUM A;  2JA6 G;  1HNX Q;  4A75 A;  3HKS A;  3UDI A;  1CT1 D;  1UE7 A;  2QIL A;  2XN9 C;  4C3J H;  3K5M A;  2ZXR A;  4KKU A;  4S3S A;  4LF9 L;  4MN3 A;  4OEL B;  2PZT A;  2HDM A;  1ENA A;  5M5X B;  2N55 A;  3RNU A;  4ME3 A;  2L1B A;  3M4Y A;  4A3E G;  1B7Y B;  3RZO H;  3SK8 A;  3J7Z C;  1S3O A;  1B8A A;  2R7D A;  5IGE A;  5M3M H;  2XSC A;  4ZKC B;  2EY6 A;  2OQ0 A;  1K28 A;  4F7X A;  3S16 B;  4RA8 A;  3S1M H;  2NWG A;  1G2S A;  1AZP A;  3J80 i;  5M5W B;  2QF7 A;  3S1R B;  3OWE B;  1YZ6 A;  3WDN A;  2R61 A;  4BXX H;  4UP9 A;  3BVG A;  2F0K A;  1R9T B;  2WAQ G;  1CA6 A;  1ENC A;  3CHB D;  4DR7 L;  2A1A A;  1CTM A;  4HCE A;  1WCM H;  2K5Q A;  1ONL A;  2E5L Q;  3DEO A;  5CBE E;  4DV2 L;  2V1C C;  2OXP A;  3DM1 A;  1S40 A;  4B9W A;  2PO4 A;  5E7N A;  3PF4 A;  4NDX A;  2GVA A;  3Q0A A;  1Y14 B;  1N32 Q;  3U50 C;  2ZM6 Q;  1M90 C;  1GUS A;  3HOV G;  3R2T A;  3WOF A;  3AB9 A;  3GDE A;  3MAQ A;  3A7A B;  4YCV A;  5GQO A;  4DK3 C;  2NUC A;  4R8N A;  5COY A;  3VR2 A;  2E2J H;  4KN4 C;  3S2D H;  4R4T A;  3BJU A;  3M4O B;  4K6L A;  5EPK A;  4H44 C;  5FO9 B;  4HR7 B;  1QB5 D;  4C2M H;  4BY7 H;  1UEA B;  1UE1 A;  2Q2T A;  1HNW L;  2AKW B;  2KEC A;  2A6H C;  2R6G A;  2CWA A;  3MEF A;  2O5J C;  5C4X B;  5JPN C;  3I7F A;  5E4X A;  1STA A;  4OL7 A;  5EPJ A;  5FJ8 G;  2CH4 A;  4UY8 C;  2Y0S B;  3GTJ H;  3HRZ C;  4P72 A;  2RSO A;  3M85 A;  4NXM L;  4DR2 L;  3HOW G;  3H0G G;  4XQQ A;  4EVO A;  2Q8R E;  3CPF A;  5HGT A;  4A3J B;  1I6H H;  1W2B A;  4R8I A;  3H15 A;  3PQI A;  3KLW A;  1M1K C;  3E6Z X;  1HQR D;  1WI5 A;  1TWH H;  2H4O A;  1O7L A;  3A0J A;  4PQX A;  1KDC A;  2F0V A;  5CBA E;  1CUK A;  3IFT A;  3PCO B;  4OO1 I;  4JI0 Q;  1FNW A;  3W3A A;  2RHQ B;  3J81 c;  4GNX A;  3NTI A;  4JI6 L;  5IOC A;  1G29 1;  5C3X A;  1UE5 A;  2EYH A;  4KV6 A;  3TEH B;  3J81 j;  3K0X A;  1Y1V B;  2F0N A;  3JAM i;  1SFO H;  2EXZ A;  5IYC H;  3FPU B;  1A63 A;  5CV9 A;  4LF5 L;  2JA9 A;  5C5L A;  1A6X A;  4KK7 A;  3UDG A;  2QEX A;  2JA8 G;  1PLF A;  2EXD A;  2Q8T A;  1H9S A;  4XDX A;  1UAP A;  4F88 A;  1Z6H A;  3NQT A;  1JCK B;  2ZTC A;  3KF6 B;  3K58 A;  4DUY Q;  4B3M Q;  2F0H A;  2OF1 A;  3RN2 A;  3HKZ E;  2OQK A;  4QB4 A;  3VYU A;  1QZH A;  3D0F A;  3I2Z A;  3MXU A;  5M3F G;  4A3D H;  2KOL A;  3K8A A;  4A3L G;  5JJL A;  4LF6 L;  1O7Z A;  3GTQ H;  3AMU A;  3NP8 A;  4GKK L;  2A68 D;  2EQS A;  4A3I H;  3ICE A;  2B2U C;  1MIU A;  1X3F A;  4HTH A;  3TZD A;  4JW0 A;  3J7A F;  3HOU H;  3U4V A;  2JSO A;  1NUC A;  4ZRZ A;  1E3P A;  2FXQ A;  1HNZ Q;  2EJM A;  2HUG A;  3CCM A;  5LHY 1;  4Q5V A;  3I4N G;  1FGU A;  3RLF A;  2JA7 G;  1H9M A;  2EYF A;  2RBM A;  4JI3 L;  2C35 B;  2Q2U A;  4PMB A;  1ZXT A;  1EFW A;  1SJH D;  4IPG A;  2D5D A;  5BR8 Q;  2XTI A;  1WYD A;  4JI7 Q;  1KC8 C;  2RDF A;  3I70 A;  4QQB X;  4B9X A;  3M4Q A;  1BCP D;  1LUZ A;  1JE4 A;  4XYQ A;  4LAA A;  3NQI A;  1VQ6 A;  2F4V L;  2MUY A;  5EQ0 A;  4RMF A;  4ALP A;  4C3H H;  1SE4 A;  1JOO A;  3F2C A;  3I4N B;  2IX3 A;  1NR4 A;  5KIX A;  2JA5 B;  2EZV A;  3K7A H;  1A3V A;  1PXU A;  2RCF A;  4OWX B;  2SNS A;  1IBK Q;  3D4R A;  2R93 H;  4A3F H;  4ULL A;  3GTO H;  3SK5 A;  5IT9 L;  1HA6 A;  4DV5 L;  4HID A;  1TU2 B;  1MI2 A;  2YTY A;  2ES2 A;  4G57 A;  3GV3 A;  2NZH A;  4P2C B;  5D3I B;  1FL0 A;  1K83 H;  4K0K L;  3FHW A;  2EYM A;  4CBV A;  2JE6 I;  4X66 Q;  1SYB A;  2A69 D;  3PF5 A;  4HIM A;  3E5S A;  4DAP A;  4BBR G;  1ICF B;  1K0S A;  3V96 A;  5C0X H;  3S1N H;  1MGS A;  4HJ9 A;  4RGT A;  3M7G A;  5JEA G;  3W1B A;  1HHV A;  1B3A A;  4XT1 B;  1EU4 A;  2AMC B;  2IX1 A;  3W5O A;  1NMF A;  1U4M A;  1NSN S;  4ZUI A;  4DV1 L;  2N49 A;  1F9S A;  1WJJ A;  3KLS X;  3WOE A;  1II3 A;  1KL9 A;  2BA0 A;  3G6J B;  1J8I A;  2L55 A;  1GM5 A;  1SE2 A;  3GQB A;  3X3N A;  3MFG A;  4YWL A;  2QKI C;  4C1N K;  4PG3 A;  2F0U A;  3LWU A;  4LNQ A;  1FD7 D;  2UXB Q;  4IUQ A;  3W1G A;  1MBY A;  2B2T C;  1Q7Y C;  1FJG Q;  1AE3 A;  4B3T Q;  1IBL Q;  3S14 H;  4IFD J;  1PTO B;  3ITP A;  3GTL B;  1OXT A;  4ZLT F;  4GOP C;  1IZ6 A;  4KD3 A;  2BA1 A;  2HIV A;  1D5X C;  4LFC Q;  2JEA I;  3RZD B;  1O78 A;  4DN4 M;  4V19 0;  2B2U A;  1RIP A;  3SDZ A;  4WJ3 M;  3E0E A;  1E0B A;  4X64 Q;  1I3Q B;  4G7Z C;  1WD0 A;  2YTX A;  1YHQ A;  2NTT A;  3LGJ A;  1BOS A;  4DR1 Q;  5EKK A;  4X3T A;  3N52 A;  3TP6 A;  5AJ3 L;  1HTL D;  4FF3 A;  1X3P A;  3ZYY X;  4DV7 Q;  1JJ2 A;  1D1I A;  2XIW A;  1KAA A;  4NXN Q;  1IBM Q;  1EU3 A;  1RTN A;  1GUG A;  3UDX A;  2ALY B;  1WTH A;  1TII D;  2WB1 B;  3A8I E;  1KRS A;  4MTK A;  4JCV E;  1M8A A;  5C4J H;  4Z9C B;  2B2W C;  3HOY G;  1G6P A;  4B3S L;  3AFP A;  3S15 B;  4U67 3;  1CHQ D;  5M5X H;  3FRP B;  3PUX A;  1UWV A;  4A93 G;  4J6H A;  3ND8 A;  2N88 A;  3STB C;  1XNQ L;  3G4S A;  4QCL A;  4BA1 I;  2G9H D;  3CQZ B;  3PO3 B;  1IW7 D;  4N8X 1;  3S16 H;  4A3B B;  5E1F A;  1SDF A;  4HED A;  3OIP A;  3BYY B;  3D6C A;  5M5W H;  1N8R C;  3S1R H;  1JJG A;  1SYD A;  3CU7 A;  3NBI A;  3R93 A;  1EQV A;  3TP7 A;  1S5C D;  1W6K A;  4JYA L;  4DV4 Q;  1AEX A;  3J80 c;  4YCU A;  2JP1 A;  4X62 Q;  4A93 B;  5EBC A;  2HD3 A;  2ASB A;  4DNT B;  2KVM A;  1FNV A;  2NZ1 D;  1A3T A;  1OXX K;  1AN8 A;  1EEF D;  4C56 C;  4POF A;  1OXS C;  3R2I A;  2WV6 D;  2E74 C;  4ZAI A;  4DNR B;  4JI5 Q;  4K2L A;  2CQA A;  5K36 H;  4ABN A;  1N34 L;  3RMH A;  1D7Q A;  1Q8I A;  2JEB I;  3D4W A;  1QWY A;  4QIW B;  5DNF A;  1BXT A;  1G51 A;  2Y0S E;  1VQ7 A;  4DR4 Q;  5COR A;  1A62 A;  4F8M A;  5A2Q E;  2IY5 B;  4K5V A;  2EYP A;  1U4R A;  3M4O H;  2F0O A;  2K5W A;  1V1P B;  3EIV A;  4V0B A;  3T51 B;  3OIQ A;  2HCI A;  3OOC A;  5C4X H;  2B8G A;  2NVT H;  1U4P A;  4LF8 Q;  4EQP A;  3F2U A;  3QOJ A;  1C7Y A;  3D31 A;  5C4Z A;  1FVI A;  2CVR A;  2ZJR A;  1BUV T;  4GOP A;  1HRJ A;  1LT3 D;  4UAI A;  3EJI A;  4RKL A;  5TSS A;  5I6Y A;  3I4L A;  1C4Q A;  2R7Z B;  2RQX A;  3NPP A;  3S1Q B;  5D65 A;  4IQZ A;  3I4M H;  1H9K A;  1EYD A;  4FDB A;  1C8C A;  1DGS A;  4JI4 L;  3I56 A;  3ERQ A;  3HS0 C;  1QZG A;  4JBK A;  1CM9 A;  1UUP A;  2UXB L;  1FYC A;  4CJ2 C;  1QNU A;  2BOS A;  1YBY A;  5C44 B;  1X56 A;  1LTR D;  2PNR C;  5M5Y B;  3TP5 A;  3OYY A;  3HOX H;  1EWI A;  2BE5 D;  4QUF A;  2A8V A;  2Z0S A;  4KLK A;  1PZJ D;  2KA7 A;  2BDN A;  1X55 A;  4IPC A;  1H9S B;  1HJP A;  4CDD C;  1YIT A;  4KY5 A;  3K59 A;  1AE2 A;  3GTG H;  4R4Q A;  5J1Z A;  1HZC A;  4K8J A;  1A2U A;  3TSS A;  3PIO A;  2B2W A;  3NEN A;  4KY7 A;  4DR1 L;  4DV2 Q;  4RHS A;  1G2T A;  2KHI A;  5I2X A;  1A15 A;  1CQV A;  1VQI A;  4M8A A;  1IBM L;  1L0Y B;  3DWQ A;  1B2T A;  2CW0 D;  4RKB A;  4ILW A;  3FKI B;  2KHS A;  2OTJ A;  1PH7 A;  2D9U A;  3CRL C;  4OWW B;  2F03 A;  1MJC A;  3TQY A;  2NVX H;  3HFZ B;  2WAC A;  2L9H A;  3Q24 A;  2PMZ B;  4CJ0 B;  4EQ5 A;  2CQO A;  4KJN A;  3S2H B;  3HG9 A;  2F0D A;  1VQP A;  1PDQ A;  3EFX D;  2MGS A;  3F2D A;  3LNN A;  3Q22 A;  1MHW C;  3D8G A;  1VQ9 A;  2CFM A;  2K5N A;  1HNW Q;  3V2T A;  2LKV A;  1P16 A;  4A3K G;  2VL6 A;  2JN4 A;  1LYL A;  1S5D D;  4IFD H;  3P1H A;  1LT4 D;  3BDO A;  1CA5 A;  1VQC A;  4IUU A;  4CGY B;  3DM3 A;  3L3O C;  2LXK A;  5EJW A;  4DR2 Q;  3L9A X;  1CSP A;  4HAE A;  4RGN A;  1WVL A;  1N36 L;  3ZJY C;  3BDL A;  2E2I H;  4X62 L;  2R92 B;  1JOR A;  4FF4 A;  5KYI A;  1BBU A;  1CFM A;  4HSV A;  3IRB A;  3JAM E;  3TS2 A;  1SNO A;  3M4P A;  2UXD L;  4NPS A;  3OTO L;  4A3C G;  2FIN B;  5CV7 A;  2EOT A;  2B2V A;  4B3R L;  1T5X D;  2D2C C;  2DJG C;  4R4I A;  2Q8I B;  5CR3 A;  1JWM D;  5EAY A;  4A3K B;  1JQY D;  4TQU S;  1EIG A;  1K0R A;  2OCE A;  4YY3 Q;  1NJI C;  1H95 A;  4GLA C;  2E2H B;  1HFG A;  1L2F A;  4NP5 A;  1Z7T A;  2PZW A;  1I94 L;  1AP0 A;  2G9D A;  1HUM A;  2A74 C;  4OIJ A;  4RHR A;  5JVH 3;  2JA5 H;  3KDF B;  4JBJ A;  1S5F D;  2UUA L;  1YNN C;  3I4O A;  2JJQ A;  1SSO A;  1VQ5 A;  5IYD G;  4DV6 L;  2DNC A;  4LF5 Q;  4X3K A;  4WOR A;  3KFU A;  5C3E B;  2EY5 A;  2I5L X;  1BKB A;  4CDC C;  1J9O A;  2F0W A;  5JAV A;  1WD1 A;  3J7A 5;  1TWF B;  3TME A;  5F2D A;  4FXD A;  2F0T A;  4I7A A;  2UUB L;  3DLL A;  1SE8 A;  2B8F A;  3FMC A;  3A74 A;  3I90 A;  2F0J A;  4Y52 H;  1YHA A;  4P74 A;  1E22 A;  3NHH A;  2F3V A;  4K6D A;  5LMU Q;  3FEW X;  1D5Z C;  4IUN A;  1T5E A;  1EL0 A;  4LF6 Q;  2B63 B;  1K8G A;  3ER0 A;  1EZ8 A;  1X32 A;  4QY7 A;  4GKK Q;  3QR8 A;  2HQL A;  5HGQ A;  5DM7 3;  4DNI A;  3BZC A;  4TRD A;  2E75 C;  3DWP A;  2K5H A;  3GTK B;  2C5C A;  1XNR L;  1RJT A;  1KAB A;  3E0J A;  1LTG D;  5C0X J;  2JA6 B;  4CDE C;  1K8A C;  3OSO A;  5JJZ A;  4BY1 H;  3H3V C;  1VMP A;  1F77 A;  2IJ0 A;  1Q86 C;  4PZ7 A;  1C9O A;  1EWH A;  5A35 A;  1STE A;  2KCM A;  3DWA A;  4JI3 Q;  2PNH A;  4A4I A;  1KTK A;  1V8Q A;  5I9P A;  2EIF A;  2Q2I A;  4A3E B;  1EY8 A;  1O80 A;  1PTO H;  5IGC A;  3GTL H;  1YEZ A;  1JB7 A;  1D6E C;  4RCN A;  1V43 A;  1SAP A;  2FHT A;  1V1Q A;  1SEB D;  3CCU A;  4DFA A;  2D0O A;  1MKH A;  3RZD H;  2F4V Q;  2MQH A;  1EIF A;  1F2Y A;  4OO1 G;  4HIO A;  1EIY B;  3F8T A;  4ZKB B;  2WB1 E;  1I3Q H;  5I2Y A;  2WAQ B;  1RL2 A;  1LM0 A;  3HOZ G;  1GUN A;  2RKS A;  1B3Q A;  1GHJ A;  1N9W A;  3D3R A;  3KF8 B;  3R3O A;  2DJF C;  4JVZ A;  4NMZ A;  3G6E A;  1A3U A;  1EQT A;  3T4A C;  3CAM A;  4RWS C;  1B9N A;  4DK6 C;  3M3Y H;  3V05 A;  4DV5 Q;  4H0L C;  2EJF C;  1BBX C;  1D5M C;  4K0K Q;  2K04 A;  4JI8 Q;  3HOV B;  1LO5 D;  4AH6 A;  3S15 H;  2BCO A;  1EIH A;  3MVV A;  1VCI A;  2N3S A;  2LS0 1;  1EZ6 A;  4IPH A;  1SYG A;  3BZD B;  3CKI B;  3HOZ B;  4XQJ A;  1LTT D;  1NR2 A;  1V1P A;  5KEE A;  3PO3 H;  1ZYR C;  2NVQ B;  1OXU A;  4QF4 A;  3H94 A;  3HOX G;  4A3B H;  1I4X A;  4DV1 Q;  4I7Z C;  3PUY A;  4OON A;  2PZU A;  3KBX A;  1X6O A;  1PFM A;  4XYO A;  3TRE A;  3GP7 A;  1L1O B;  4LWC A;  4YY3 L;  3FVQ A;  1NAP A;  1WTP A;  1V9P A;  3CCR A;  4JI2 Q;  5CV4 A;  1B44 D;  2V4D A;  3SE0 A;  3HOW B;  4QIW E;  1AFP A;  3H0G B;  1NBW A;  4BBS H;  3QOL A;  1YNJ D;  2O2L D;  1F2L A;  1ZKO A;  1LT5 D;  3BDC A;  1TKW B;  4ME5 A;  3QIA A;  1B50 A;  4G7O C;  1MSG A;  4XTC S;  2NYZ D;  1VS0 A;  2F0E A;  2J7Z A;  1XMQ L;  3U4Z A;  2G5D A;  2J0T D;  1GO3 E;  1LTS D;  2HCC A;  1QVF A; 
#chains in the Genus database with same CATH homology
 1DOL A;  3NK9 A;  1I6V C;  2ENB A;  3OMC A;  4OHJ A;  3QJY A;  3T16 A;  1WTX A;  3U9S A;  1HXY D;  3VA7 A;  5FLX E;  2K28 A;  1RHP A;  1O7Y A;  2JA8 B;  1GJX A;  2RA4 A;  3J81 E;  3ERO A;  1PFN A;  5E3F A;  3C3L A;  1E2Z A;  1L0X B;  4U68 A;  3I91 A;  2F0M A;  1C48 A;  2XVS A;  4DXF A;  5DAU A;  2QCP X;  5M3F B;  5KNB A;  1BCP F;  4ODG A;  3PMF A;  5T1I A;  3TZU A;  4OIK A;  4X3S A;  3EQL C;  1QNK A;  1ILQ A;  4MIU A;  5FLX L;  1JB3 A;  2F4I A;  3NSW A;  4J8Q A;  1DON A;  3MXP A;  2TMP A;  3K6O A;  3O13 A;  3LWE A;  3C1F A;  2JA7 B;  5LL6 S;  2F1M A;  2HQE A;  3GTM B;  4IFD I;  3HP3 A;  2C9O A;  2QEJ C;  1TS4 A;  3X3M A;  2DN8 A;  1EY6 A;  1PZI D;  2L5T A;  4B08 A;  3PUZ A;  2A6E D;  4C3J G;  4DGZ A;  4RAU C;  2EE1 A;  4KHV A;  1W6J A;  2K05 A;  1CQF A;  1U4L A;  2QDB A;  1JIC A;  5T1G A;  1YNJ C;  1WTR A;  2VB2 X;  1HQM C;  3A8K E;  1F2M A;  5CV8 A;  4KY6 A;  4DXG A;  3QG1 A;  4EQN A;  5KND A;  1DOM A;  2E76 C;  4BBR B;  2EJG C;  3J7A V;  1VF5 C;  2PYK A;  3TN2 A;  5BN5 A;  2J4X A;  5C3W A;  3T13 A;  3K0Y A;  3S1M B;  2NTS A;  4K5W A;  1STH A;  4K5X A;  4QMG A;  2KCC A;  1Q3L A;  2A68 C;  1GHK A;  1G8Z D;  3TDQ A;  1TWC B;  3SR1 A;  1SYE A;  3NTK A;  2Z4H A;  1I4G A;  5K5P A;  1I50 B;  1KLU D;  3K5L A;  1H9J A;  1FGB D;  1PTO D;  3DXJ C;  1GUW A;  1EY9 A;  3IL8 A;  4ZQ3 A;  2A5H A;  4KMU C;  1BCP C;  3KF8 A;  2PPB C;  2E2J B;  1SMY D;  3S2D B;  1CI3 M;  5KYL A;  1PRT F;  5IOD A;  4C2M B;  4L6T B;  1BQQ T;  3PV0 A;  4K14 A;  4RFB A;  1Y69 U;  4WRD A;  4KJO A;  1M4V A;  1G6Z A;  4WFN 3;  1PRT D;  3GTJ B;  3Q6S A;  3MXG A;  3HOY B;  5JPM C;  3NBH A;  1MD2 D;  2A69 C;  4DK1 A;  4F87 A;  1G91 A;  1TWH B;  1TY0 A;  2CHB D;  2IPK D;  2IW3 A;  4DU9 A;  1BDO A;  3EA6 A;  2IX0 A;  2XNA C;  4FVM A;  3GD7 A;  3ND9 A;  4IUT A;  1Q90 A;  2K33 A;  1WTO A;  1CK1 A;  2E2D C;  2F0F A;  3C1E A;  3P20 A;  4CHT B;  1EWC A;  1OXV A;  2B2T A;  3U9O A;  1TVX A;  2AWN A;  1GUT A;  5FOB B;  3J80 E;  5ELF A;  5ELC A;  4A3D B;  4MHE A;  3GTQ B;  5IIF A;  4CKB A;  3NWS A;  1TWA B;  3DEP A;  4XQN A;  1V1O A;  1F9R A;  1QG7 A;  1EY5 A;  4RH6 A;  1UNS A;  5ELD A;  3VYR A;  5A2Q L;  2I46 A;  4KD4 A;  3HOU B;  1SBB B;  2ICE C;  2FFK B;  3NUC A;  4C3H G;  4Q0F A;  1S5E D;  3QWN A;  1LAC A;  2VXW A;  2YU9 B;  4FF2 A;  2X69 A;  5DEH A;  1ILP A;  2DY8 A;  4H7B A;  5IGF A;  1EYA A;  1RCV D;  1EOT A;  5CMD A;  3BG3 A;  2AQ1 B;  1KLG D;  1IW7 C;  1JR0 D;  3K57 A;  4N9P A;  1Q1E A;  3IFD A;  5CV6 A;  2KEE A;  1SXT A;  4KI0 A;  1VMC A;  5C0X G;  1JOQ A;  1Y8N B;  3NTH A;  4IN3 A;  2WII B;  4EGV A;  1HPC A;  3GTO B;  5G3L D;  5BN4 A;  2F0S A;  5EBD A;  3SXH A;  3L7Z C;  4KKS A;  1SYF A;  3GTP B;  2XRS D;  4K2K A;  2F0I A;  3SEB A;  4HN7 A;  1IYU A;  2SEB D;  3S1N B;  5E4W C;  3NXW A;  2FJ2 A;  1TR5 A;  2X6L A;  3KK7 A;  4DAV A;  3A8J E;  2EY1 A;  5C6A A;  3BYT B;  4FXG C;  1ENF A;  2O4X A;  5C0X I;  3VR6 A;  1QJO A;  3I72 A;  4H13 C;  1Q12 A;  2SOB A;  2A6H D;  1FNU A;  3S14 B;  3S17 B;  2PW7 A;  2ICI A;  1K8M A;  3JAM L;  5DM6 3;  1KDB A;  2BE5 C;  5D3D A;  2JXM B;  2EYO A;  2KJX A;  1QOH A;  5EKL A;  3OHX C;  2F3W A;  2VB3 X;  3MFY A;  4CKE A;  3DMU A;  4WJW A;  2OT2 A;  3H09 A;  1F9P A;  1SYC A;  2SNM A;  4GZY C;  1DCZ A;  3IAY A;  1I4Q A;  5D14 A;  3UI2 A;  1S4Z A;  4HCS A;  2IT1 A;  2R3Z A;  2D62 A;  5C4J B;  1STB A;  3MZ5 A;  3M7N A;  2CW0 C;  4O1N A;  1PMR A;  3K5N A;  4HMI A;  1MSH A;  3MHB A;  3I3C A;  4O42 A;  1E2W A;  5FKA C;  1S5B D;  4PMW A;  2XWB B;  4KN7 C;  3TP8 A;  5JEA H;  1A2T A;  1XWE A;  4EQO A;  1ESF A;  5K36 G;  4XT3 B;  5FK9 C;  2RVL A;  1NCV A;  1TS5 A;  3C46 A;  2WIN B;  1GUO A;  4FP5 D;  1JWU D;  1JC7 A;  5AFW A;  1ROD A;  1LTB D;  4ID6 A;  2K6A A;  1I4R A;  1VF7 A;  2Z4I A;  4IUR A;  4FNF A;  1PFB A;  3OW7 A;  1BR9 A;  5CYU A;  1LV9 A;  3PIP 3;  1IKM A;  1B53 A;  1TT2 A;  1DZ1 A;  1VDZ A;  4FYD A;  4YIJ A;  3VYT A;  2NN6 H;  3VYS A;  1LT6 D;  3A55 A;  3SVM A;  4L63 B;  2NVT B;  2KCN A;  4G7H C;  1LTA D;  5HUR A;  1QCB D;  2RDG A;  4DAY A;  3VR4 A;  3T56 B;  5KGU A;  3I4M B;  1RTO A;  4TSS A;  1ET6 A;  4TKO B;  3KBG A;  3OWF A;  3HOX B;  1Q1B A;  2SDF A;  4IZ8 A;  1ESR A;  2K03 A;  1B9M A;  4XXE A;  4JBW A;  2K7V A;  1WTW A;  4FXK C;  3GTG B;  1EEI D;  1AZQ A;  3GV6 A;  5JVG 3;  4DA2 A;  1BO0 A;  2IWH A;  2K5D A;  2AQ3 B;  1RD9 D;  5J39 A;  3HGB A;  3Q23 A;  1HTP A;  4IFD G;  1BNZ A;  1TS3 A;  1CZW A;  3N6R A;  4IUP A;  1IL8 A;  2X6G A;  2NVX B;  2NBF A;  3BVM A;  4CKC A;  4Y7N B;  4A3M B;  4BS9 A;  3P7J A;  3RUZ A;  3S9W A;  2VNU D;  1RF2 D;  2RSN A;  4IAL A;  5IGG A;  1RDP D;  1TY2 A;  1BCP B;  5KNC A;  1I4H A;  5C4H A;  2NVY B;  2KED A;  5CGK A;  5IT9 E;  3T53 B;  1HA5 A;  3MC0 B;  1WTV A;  3TBI B;  3J81 L;  3BVZ A;  2E2I B;  3RD4 A;  4ZK9 B;  5EPL A;  2PQE A;  4CJ1 B;  1R4Q B;  4OGQ C;  4AYB B;  5I6W A;  1R4P B;  4FO2 A;  2A73 B;  4IUV A;  1EYC A;  2BDO A;  2M00 A;  1ET9 A;  2FMC A;  1STY A;  1QIL A;  1IYV A;  1ML0 D;  1Y8O B;  1IHZ A;  3I73 A;  1HFN A;  1DYQ A;  2YYZ A;  4KTA A;  1DM0 B;  3HEJ A;  4DK0 A;  2FMM A;  1B1Z A;  1D1K A;  2B2Y C;  2ID0 A;  4C3J B;  1LLR D;  5FO8 B;  4ZUJ A;  3SK6 A;  3K5O A;  1EY0 A;  2F0G A;  3RZO B;  1LAB A;  1DXM A;  5M3M B;  1STG A;  1WTQ A;  2L4N A;  5I4D A;  5LL6 X;  1CHP D;  3DHQ A;  1EY4 A;  1F2Z A;  4BY1 B;  4ZYS A;  4R9W A;  1I4P A;  4KKT A;  5M9O A;  2XWJ B;  2EPB A;  1PZK D;  1PTO F;  2B39 A;  1SE3 A;  2EY2 A;  3OMG A;  1WCM B;  2K32 A;  4QUC A;  3BS1 A;  2O5I C;  1Y8P B;  1SNQ A;  4M1U B;  4BWG B;  3SK4 A;  3GO5 A;  2F0L A;  2ZXP A;  2DY7 A;  3OPO A;  3I8Z A;  4K8I A;  2NN6 G;  1IKL A;  3J7Y W;  2WKC A;  3M3Y B;  3H91 A;  5CC4 A;  4BY7 B;  5ELE A;  3PIO 3;  1SNM A;  3AU7 A;  1PRT B;  1DOK A;  2LMC B;  1F9Q A;  3P75 A;  2EDG A;  3LX0 A;  4RGM A;  4LJZ C;  1SNP A;  1FR3 A;  1QE6 A;  1I6H B;  2A6E C;  3VR5 A;  5CV5 A;  3PUV A;  1KNA A;  4LMQ D;  2AQ2 B;  4N9T A;  3MEH A;  1HUN A;  2NB0 A;  1DD2 A;  2I07 B;  2M2L A;  2M9V A;  2ZXO A;  4KHZ A;  4G4K A;  4J1M A;  2NN6 I;  2MPM A;  3FPP A;  5JEA J;  2L0C A;  1XX8 A;  1RKN A;  2GA4 B;  4BBS B;  2B2Y A;  1PYW D;  1U9R A;  4RCO A;  1SFO B;  5IGB A;  4BA2 I;  1HCZ A;  2F0Q A;  2ZT9 C;  5JOB A;  3QB3 A;  3KUP A;  3URY A;  1GOZ A;  2TSS A;  1EY7 A;  3QO2 A;  1Y1W B;  2AWO A;  4OO1 H;  2KQ3 A;  2DNE A;  1TS2 A;  1XTC D;  2Z8L A;  4PNY A;  2B2V C;  1TWG B;  1EFI D;  1ZEQ X;  2EYL A;  1H9R A;  5ISR A;  5EGT A;  3CRK C;  1E2V A;  4FF1 A;  2OEO A;  4A3I B;  1XXG A;  4I65 A;  2K1B A;  2EYJ A;  1SJE D;  2IL8 A;  1OO9 B;  3HKZ B;  4PV1 C;  1YNN D;  3FDT A;  2VUM B;  1K8O A;  1PTO C;  2PCF B;  3VR3 A;  5I9O A;  1JOK A;  4HSP A;  2JYO A;  5C5M A;  3PUW A;  3HZX A;  4RGO S;  3MWY W;  1LTI D;  3H6M A;  3NWT A;  2AUK A;  3NE5 B;  1KNE A;  3J80 L;  1SMY C;  4UDU C;  4PMC A;  2XRQ D;  4C1N I;  5IGD A;  3PO2 B;  1X3Q A;  2RDH A;  1STN A;  1AW7 A;  2AUJ D;  2Z1C A;  4C3H B;  4NW2 A;  5G3L F;  3MXN A;  3IKJ A;  2H1E A;  1Z47 A;  2L11 A;  3A54 A;  5J22 A;  3K7A B;  1PRT C;  2MJ8 A;  1ICW A;  2R93 B;  4A3F B;  1BF4 A;  2WKD A;  3A7L A;  4A3G B;  4C3I G;  3DUZ A;  5NUC A;  2K01 A;  4HMJ A;  3C2P A;  1K83 B;  3EVQ A;  4XIG S;  3VA5 A;  1KDA A;  1GXD C;  2LFN A;  4C3I B;  2LY7 A;  3KLS A;  4JK1 C;  3W2D A;  5ELB A;  3R8B A;  4X3U A;  4LK1 C;  2WP8 J;  2HDL A;  5BN3 A;  1CZG A;  5FO7 B;  2MP1 A;  3KLR A;  3D4D A;  3MA2 B;  1XYI A;  1SND A;  4DF7 A;  5KRU A;  2F0P A;  1SNC A;  4E6I A;  2MHV A;  3SHL A;  2L12 A;  4NKL A;  3ONA B;  1ZYR D;  1TQO A;  3A56 A;  3MTS A;  1D2B A;  3G7L A;  1DJR D;  1JWS D;  2PW5 A;  1B4O A;  2EVB A;  5EKI A;  3D6W A;  4L8J A;  2KUM A;  1CT1 D;  2QIL A;  2XN9 C;  3K5M A;  2ZXR A;  4KKU A;  4S3S A;  4MN3 A;  2PZT A;  2HDM A;  1ENA A;  5M5X B;  2N55 A;  2L1B A;  3M4Y A;  3SK8 A;  5IGE A;  2XSC A;  4ZKC B;  2EY6 A;  4F7X A;  3S16 B;  4RA8 A;  2NWG A;  1G2S A;  1AZP A;  5M5W B;  2QF7 A;  3S1R B;  3OWE B;  3WDN A;  2R61 A;  3BVG A;  2F0K A;  1R9T B;  1CA6 A;  1ENC A;  3CHB D;  4HCE A;  1CTM A;  2K5Q A;  1ONL A;  3DEO A;  5CBE E;  2OXP A;  3DM1 A;  4B9W A;  2PO4 A;  4NDX A;  3Q0A A;  1GUS A;  3R2T A;  3WOF A;  3AB9 A;  3MAQ A;  3A7A B;  2NUC A;  4R8N A;  5COY A;  3VR2 A;  4KN4 C;  3M4O B;  4K6L A;  5EPK A;  4H44 C;  5FO9 B;  4HR7 B;  1QB5 D;  1UEA B;  2R6G A;  2KEC A;  2A6H C;  5C4X B;  2O5J C;  5JPN C;  5E4X A;  1STA A;  4OL7 A;  5EPJ A;  2Y0S B;  3HRZ C;  2RSO A;  3M85 A;  4XQQ A;  4EVO A;  2Q8R E;  5HGT A;  4A3J B;  4R8I A;  3E6Z X;  1HQR D;  2H4O A;  1O7L A;  4PQX A;  1KDC A;  2F0V A;  5CBA E;  3IFT A;  4OO1 I;  1FNW A;  3W3A A;  3NTI A;  5IOC A;  1G29 1;  5C3X A;  2EYH A;  4KV6 A;  1Y1V B;  2F0N A;  2EXZ A;  3FPU B;  5CV9 A;  5C5L A;  1A6X A;  4KK7 A;  1PLF A;  2Q8T A;  1H9S A;  4XDX A;  1UAP A;  4F88 A;  1Z6H A;  3NQT A;  1JCK B;  3K58 A;  2F0H A;  2OF1 A;  4QB4 A;  3VYU A;  3MXU A;  2KOL A;  1O7Z A;  3AMU A;  3NP8 A;  2A68 D;  2B2U C;  3TZD A;  4HTH A;  3J7A F;  2JSO A;  1NUC A;  4ZRZ A;  2EJM A;  2HUG A;  5LHY 1;  4Q5V A;  3RLF A;  1H9M A;  2EYF A;  2RBM A;  4PMB A;  1ZXT A;  1SJH D;  2D5D A;  2RDF A;  3I70 A;  4B9X A;  1BCP D;  1JE4 A;  4XYQ A;  4LAA A;  3NQI A;  2MUY A;  5EQ0 A;  1SE4 A;  1JOO A;  3I4N B;  2IX3 A;  1NR4 A;  5KIX A;  2JA5 B;  2EZV A;  1A3V A;  1PXU A;  2SNS A;  3D4R A;  4ULL A;  3SK5 A;  5IT9 L;  1HA6 A;  1TU2 B;  1MI2 A;  4G57 A;  3GV3 A;  4P2C B;  5D3I B;  2EYM A;  4CBV A;  2JE6 I;  1SYB A;  2A69 D;  3E5S A;  4DAP A;  3V96 A;  5C0X H;  1MGS A;  4RGT A;  3M7G A;  5JEA G;  1HHV A;  1B3A A;  4XT1 B;  1EU4 A;  2IX1 A;  1U4M A;  1NSN S;  4ZUI A;  1F9S A;  3KLS X;  3WOE A;  1II3 A;  2BA0 A;  3G6J B;  1J8I A;  2L55 A;  1SE2 A;  3GQB A;  3X3N A;  3MFG A;  2QKI C;  4C1N K;  2F0U A;  3LWU A;  1FD7 D;  4IUQ A;  1MBY A;  2B2T C;  4IFD J;  1PTO B;  3ITP A;  3GTL B;  1OXT A;  4ZLT F;  4KD3 A;  2BA1 A;  1D5X C;  2JEA I;  3RZD B;  1O78 A;  4DN4 M;  4V19 0;  2B2U A;  3SDZ A;  1E0B A;  1I3Q B;  4G7Z C;  1WD0 A;  2NTT A;  1BOS A;  5EKK A;  4X3T A;  3N52 A;  3TP6 A;  1HTL D;  4FF3 A;  1X3P A;  3ZYY X;  1D1I A;  2XIW A;  1KAA A;  1EU3 A;  1RTN A;  1GUG A;  1TII D;  2WB1 B;  3A8I E;  1M8A A;  4Z9C B;  2B2W C;  3S15 B;  4U67 3;  1CHQ D;  3FRP B;  3PUX A;  4J6H A;  3ND8 A;  2N88 A;  4QCL A;  4BA1 I;  2G9H D;  3CQZ B;  3PO3 B;  1IW7 D;  4A3B B;  5E1F A;  1SDF A;  4HED A;  3OIP A;  3BYY B;  3D6C A;  1SYD A;  3CU7 A;  3NBI A;  3R93 A;  1EQV A;  3TP7 A;  1S5C D;  1W6K A;  1AEX A;  2JP1 A;  4A93 B;  5EBC A;  4DNT B;  2KVM A;  1FNV A;  2NZ1 D;  1A3T A;  1OXX K;  1AN8 A;  1EEF D;  4C56 C;  1OXS C;  3R2I A;  2WV6 D;  2E74 C;  4ZAI A;  4DNR B;  4K2L A;  2CQA A;  5K36 H;  4ABN A;  3RMH A;  1Q8I A;  2JEB I;  3D4W A;  1QWY A;  4QIW B;  5DNF A;  1BXT A;  5COR A;  4F8M A;  5A2Q E;  4K5V A;  2EYP A;  1U4R A;  2F0O A;  2K5W A;  1V1P B;  4V0B A;  3T51 B;  3OIQ A;  2HCI A;  3OOC A;  2B8G A;  1U4P A;  4EQP A;  3F2U A;  3QOJ A;  3D31 A;  5C4Z A;  2CVR A;  1BUV T;  1HRJ A;  1LT3 D;  4UAI A;  3EJI A;  4RKL A;  5TSS A;  5I6Y A;  3I4L A;  1C4Q A;  2R7Z B;  2RQX A;  3NPP A;  3S1Q B;  5D65 A;  4IQZ A;  1H9K A;  1EYD A;  1C8C A;  3ERQ A;  3HS0 C;  1CM9 A;  1UUP A;  1FYC A;  4CJ2 C;  1QNU A;  2BOS A;  5C44 B;  1LTR D;  2PNR C;  5M5Y B;  3TP5 A;  2BE5 D;  4QUF A;  1PZJ D;  2KA7 A;  2BDN A;  1H9S B;  4KY5 A;  3K59 A;  5J1Z A;  4K8J A;  1A2U A;  3TSS A;  2B2W A;  4KY7 A;  4RHS A;  1G2T A;  5I2X A;  1A15 A;  1CQV A;  4M8A A;  1L0Y B;  3DWQ A;  1B2T A;  2CW0 D;  4RKB A;  4ILW A;  3FKI B;  2KHS A;  2D9U A;  3CRL C;  2F03 A;  2WAC A;  2L9H A;  3Q24 A;  2PMZ B;  4CJ0 B;  4KJN A;  3S2H B;  3HG9 A;  2F0D A;  1PDQ A;  3EFX D;  2MGS A;  3Q22 A;  3LNN A;  3D8G A;  3V2T A;  2LKV A;  1S5D D;  4IFD H;  3P1H A;  1LT4 D;  3BDO A;  1CA5 A;  4IUU A;  4CGY B;  3L3O C;  5EJW A;  3L9A X;  4HAE A;  4RGN A;  1WVL A;  3BDL A;  1JOR A;  2R92 B;  4FF4 A;  5KYI A;  4HSV A;  1CFM A;  3JAM E;  1SNO A;  2FIN B;  5CV7 A;  2EOT A;  2B2V A;  1T5X D;  2D2C C;  2Q8I B;  5CR3 A;  1JWM D;  4A3K B;  1JQY D;  4TQU S;  1EIG A;  2E2H B;  1HFG A;  4NP5 A;  1Z7T A;  2PZW A;  1AP0 A;  2G9D A;  1HUM A;  2A74 C;  4OIJ A;  4RHR A;  5JVH 3;  1S5F D;  1YNN C;  1SSO A;  2DNC A;  4X3K A;  4WOR A;  5C3E B;  2EY5 A;  1J9O A;  2F0W A;  5JAV A;  1WD1 A;  1TWF B;  3TME A;  5F2D A;  4FXD A;  2F0T A;  2B8F A;  3FMC A;  3I90 A;  2F0J A;  3NHH A;  2F3V A;  4K6D A;  3FEW X;  1D5Z C;  4IUN A;  1T5E A;  1EL0 A;  2B63 B;  1EZ8 A;  1X32 A;  5DM7 3;  4TRD A;  2E75 C;  3DWP A;  3GTK B;  2C5C A;  1RJT A;  1KAB A;  3E0J A;  1LTG D;  5C0X J;  2JA6 B;  3OSO A;  5JJZ A;  3H3V C;  1VMP A;  1F77 A;  2IJ0 A;  1EWH A;  5A35 A;  1STE A;  3DWA A;  1KTK A;  1V8Q A;  5I9P A;  4A3E B;  1EY8 A;  1O80 A;  1PTO H;  5IGC A;  1D6E C;  4RCN A;  1V43 A;  1SAP A;  2FHT A;  1SEB D;  4DFA A;  1F2Y A;  4OO1 G;  4ZKB B;  5I2Y A;  2WAQ B;  1GUN A;  2RKS A;  3D3R A;  1GHJ A;  4NMZ A;  3R3O A;  1A3U A;  1EQT A;  3T4A C;  4RWS C;  1B9N A;  3V05 A;  4H0L C;  2EJF C;  1BBX C;  1D5M C;  2K04 A;  3HOV B;  1LO5 D;  2BCO A;  1EIH A;  3MVV A;  1VCI A;  2LS0 1;  1EZ6 A;  1SYG A;  3BZD B;  3CKI B;  3HOZ B;  4XQJ A;  1LTT D;  1NR2 A;  1V1P A;  5KEE A;  1ZYR C;  2NVQ B;  1OXU A;  4QF4 A;  3H94 A;  1I4X A;  4I7Z C;  3PUY A;  2PZU A;  3KBX A;  1PFM A;  4XYO A;  3GP7 A;  3FVQ A;  1NAP A;  1WTP A;  5CV4 A;  1B44 D;  2V4D A;  3SE0 A;  3HOW B;  1AFP A;  3H0G B;  3QOL A;  1YNJ D;  2O2L D;  1F2L A;  1ZKO A;  1LT5 D;  3BDC A;  1TKW B;  4ME5 A;  3QIA A;  1B50 A;  4G7O C;  1MSG A;  4XTC S;  2NYZ D;  2F0E A;  2J7Z A;  2J0T D;  1LTS D;  2HCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...