1H9MA

Two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
141
structure length
141
Chain Sequence
MKISARNVFKGTVSALKEGAVNAEVDILLGGGDKLAAVVTLESARSLQLAAGKEVVAVVKAPWVLLMTDSSGYRLSARNILTGTVKTIETGAVNAEVTLALQGGTEITSMVTKEAVAELGLKPGASASAVIKASNVILGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Crystal Structures of the Cytoplasmic Molybdate-Binding Protein Modg Suggest a Novel Cooperative Binding Mechanism and Provide Insights Into Ligand-Binding Specificity
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Binding protein
molecule keywords MOLYBDENUM-BINDING-PROTEIN
total genus 28
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9mA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9mA01
1FR3A 1K8MA 2B8FA 4H44C 3D4RA 4GZYC 3RLFA 3T53B 1OXTA 1OXXK 2BE5C 1YNJC 4KHZA 1YNNC 1PMRA 1CI3M 3VR5A 1E2WA 2NN6I 3ND9A 3VR3A 1TU2B 5C0XH 4DNTB 3WDNA 3A8IE 1Q90A 2O5JC 1HCZA 2BE5D 2PCFB 4H13C 1EWHA 4DK1A 5KNBA 3SE0A 2EDGA 2A69D 1E2VA 1G291 2NN6G 3MXUA 3H94A 1OXUA 3IKJA 2JEAI 1H9JA 2L5TA 1IW7D 1CFMA 3OOCA 1T5EA 2A6HC 5C0XG 4PV1C 1O7LA 4KN7C 4LK1C 3VR4A 5K36G 3T56B 2A69C 2R6GA 1GHJA 1OXVA 1H9SA 2BA1A 3VR2A 3P20A 1Q12A 5JEAG 3NE5B 2CW0C 4L8JA 3OW7A 4G7OC 3A8JE 4KN4C 3M85A 3VA7A 2B8GA 5KNDA 2IT1A 1VDZA 2Q8IB 3CRKC 4JBWA 4BA2I 3PUZA 1IYUA 3GQBA 1HTPA 5A35A 4BA1I 3CRLC 2A6EC 2D2CC 1Z7TA 3L7ZC 1BDOA 2ZT9C 1Y8PB 3I72A 3A7LA 2EJGC 2YYZA 3BG3A 1A6XA 4TKOB 3BDOA 3KLRA 4KKTA 1GUTA 2A68D 2A6ED 3FMCA 4LJZC 3PUVA 4XIGS 1GUSA 2A6HD 1I6VC 2AWOA 3SDZA 3PUXA 3VR6A 3LWUA 2EJFC 2E74C 3MFYA 2JE6I 2LMCB 1H9KA 4OGQC 1Y69U 3HGBA 4JK1C 2D62A 2EVBA 4IFDH 1OXSC 4DK0A 4KMUC 2JEBI 2PPBC 2O5IC 3A7AB 3OPOA 2D5DA 2DNCA 2PNRC 3U9SA 1VCIA 3QG1A 1VF5C 2DN8A 4IQZA 5BN4A 1DD2A 5JEAH 3QJYA 3FPPA 2V4DA 1HPCA 2KA7A 3IFTA 2NN6H 3A8KE 2K33A 3DXJC 3N6RA 4RCNA 1DCZA 2QF7A 3PUWA 1LACA 1Y8OB 4IFDG 4XTCS 5K36H 5KNCA 2DNEA 2F1MA 2JXMB 3I73A 3M7NA 1IW7C 1H9MA 5BN3A 1B9MA 1HQMC 2AUJD 3GD7A 1Q1BA 1GHKA 1VF7A 2K32A 1H9RA 4KKSA 3T51B 5BN5A 2K7VA 4TQUS 3M4YA 3I4LA 3D31A 1V8QA 3PUYA 1LABA 1B9NA 1H9SB 1Q1EA 1ZKOA 3AB9A 4H0LC 2BA0A 1Y8NB 3PV0A 3TZUA 4OO1G 4OO1H 1K8OA 1ZYRC 4G7HC 2KCCA 1IYVA 1SMYC 2AUKA 3QIAA 1DXMA 3W3AA 3LNNA 1O78A 1GUGA 1Z6HA 2A68C 3EQLC 4G7ZC 1CTMA 1V43A 1ONLA 1GJXA 2E75C 1E2ZA 2E76C 3ND8A 1FYCA 1QJOA 4DNRB 1TKWB 4I7ZC 4KI0A 2BDOA 2EJMA 1GUOA 1GUNA 4HR7B 4KKUA
chains in the Genus database with same CATH superfamily
2KJXA 4CGYB 5IGBA 2B8FA 1QVCA 3T1HQ 2QEXA 1YNNC 3PIO3 4A3JG 2F0VA 2RBMA 1VQHA 4K5WA 1U5KA 1KAWA 1UE5A 3KBGA 2O5JC 2EYPA 2K5QA 4RGNA 4BY7B 4LFCQ 1G291 1VQ8A 2PZUA 1K0SA 4F88A 1VQ5A 2JEAI 3GO5A 4WORA 2F52A 5FLMH 4OWXB 3VR4A 2D0PA 4PMWA 1CKNB 5CV6A 1Q12A 4A3BH 4JG2A 2G9HD 4KN4C 1QUQA 3K57A 3LX0A 4HJ8A 4BXXG 3J80L 3GTMH 2CHBD 3NEMA 3PF5A 3A5UA 2K4KA 3NQTA 4JC0A 4QL5A 4HCSA 1GUTA 3FMCA 3P7JA 4JI8L 2B2UC 2F0UA 4DV6Q 4GKJL 1J8IA 4B08A 3VDYA 1RDPD 2I5MX 1QZHA 1EY0A 2F0WA 2K5DA 2JA6H 1B7YB 1EQTA 3OWFA 3SK5A 4GNXB 2R3ZA 2EY6A 3TN2A 1VQLA 3S1QH 1GUWA 1A0IA 2FJ2A 1M1KC 1BCPD 1V1QA 2YU9B 5M5WB 4OHJA 2GVBA 4X64Q 3I73A 1A3VA 3NWTA 2IJ0A 4FNFA 3V2TA 4OIKA 1VF7A 3MEFA 1ICWA 2JA5H 4L5SA 3EFXD 3PUYA 1YHBA 2NYZD 5M5YB 1OTCA 2F0SA 4UP7A 2R93G 4XQNA 1D7QA 2VL6A 2E8GA 2EIFA 3GDEA 5GAGC 4G7ZC 4U673 1NJIC 2B2VA 4HSVA 4I7ZC 4NPSA 2MNAA 2F0PA 5C3EG 1X32A 1VMCA 3HKZG 4EGVA 3JAMc 3K5NA 4GZYC 4UAIA 4QIWE 2XNAC 4A3LG 4J1MA 2UXBQ 1KQSA 2TSSA 2EYMA 2F0EA 2AQ2B 2PO4A 1WTQA 5C0XH 1V1PB 3RZDB 1SYFA 5ELFA 1VQ6A 2Y0SG 3DEPA 3FKIG 4OEMB 1E2VA 1Q82C 2B63G 4EQNA 4BBRH 5E3FA 2H5XA 4JV5L 4DAVA 1EZ6A 2ICEC 2X6GA 2D9UA 2OTJA 3CQZB 5AJ3L 1T9HA 4XQQA 1FNVA 3P1HA 5JJIA 2VY3A 4L8JA 3UE0A 4N9TA 1Q8KA 3VA7A 2Q8IB 3EJIA 3CCSA 1CKOA 1JB7A 3U9OA 1W6KA 2K5HA 3MHBA 1WTPA 4NDXA 1Z7TA 2HQEA 5C44B 1W3SA 3AYHB 2ID0A 3K59A 1K9MC 4DK6C 1X6OA 1EIGA 3A54A 1UE7A 1MKHA 4HIDA 4LJZC 5AFWA 4A3KG 2WB1E 1PA6A 4DXGA 3F2UA 5EBDA 4ZAIA 1VQAA 2KCNA 2KHSA 4OGQC 3HGBA 1Q46A 1T5XD 2L11A 2A73B 1PTOD 2Y0SB 3FKIB 1N9WA 5C44H 1XNQQ 2LFNA 2DNCA 3Q23A 3RZDH 3GTQB 3TQYA 5C3XA 2CWPA 5I9OA 3S14H 3DXJC 1SRUA 3GTJB 3KDFB 5KGUA 4R4TA 1HTLD 5C4JH 3S1NH 1TWHH 3H15A 5NUCA 2E2IB 3F1ZA 4UHVA 1R9TB 2QGQA 3M4YA 1NE3A 5BR8Q 3DWQA 1H9SB 4CHTB 5IGFA 2F0IA 4DV4Q 4OO1H 4JBMA 4PZ8A 3Q6SA 5LMNL 4CKCA 1RTOA 3S17B 1GXDC 1HNXL 1VQ7A 3G7LA 4KY7A 3HOWG 3UI2A 2O4XA 1SJED 5M5XB 1VQCA 2NZHA 4R4IA 1OO9B 2E76C 3EBEA 2OF1A 2MO0A 5LMUQ 1PFSA 1QCBD 4DV4L 4ABNA 2YU9H 3D4RA 3I90A 4DV1L 3QO2A 4ZKBB 4RGMA 4JI7Q 2QA4A 4CJ1B 1Q90A 3A55A 2JYOA 5C0XJ 5HY6A 5JOBA 4JI5Q 5C4ZA 4KK7A 2Z6BA 1HZAA 2CFMA 1ICFB 1SE2A 3PCOB 1CFMA 3ULJA 1S40A 4UDUC 1R9TH 4L6TB 3TSSA 1PH4A 4K8JA 2ZJPA 4J8QA 4TVAB 2EYJA 4G7OC 2A19A 5ELOA 5KNDA 1VDZA 4K6DA 1B3QA 1AEXA 3MZ5A 5I6YA 1IBLL 1S3OA 3GTMB 4BS9A 1JR0D 2DJGC 3HOWH 4C3JB 1BDOA 4IUNA 5DLQE 3CXCA 3GTGH 3I4NH 2F4IA 5JPNC 5DAUA 4DV7L 4APVA 3H09A 3N52A 1RD9D 1NAPA 5EQ0A 5C3WA 1PH8A 4RH6A 5JJKA 2Z6KA 4FF1A 4DFAA 3CHBD 3LWUA 2JA6G 1BOSA 4DR7Q 2HDLA 4JK1C 4HMJA 3U58A 2UXBL 3LWEA 1U4LA 2PNRC 5J39A 4V0BA 4A93G 5BN4A 5M9OA 1U9RA 4HTHA 2K6AA 1F9SA 1I3QH 1BF4A 4XTCS 1Z47A 2AHOB 2MQHA 3NBIA 4A4IA 3Q0AA 3J81j 3CW2C 2AUJD 1JT8A 1SMXA 2K04A 4ZUIA 1MIUA 4K0KL 4DAYA 4KJOA 1RL2A 3VA5A 2PNHA 1XMOL 3BU2A 2PZTA 2BA0A 1EYGA 2F0NA 4G7HC 5FJ8G 3GTQH 4R8NA 3MTSA 5IWAL 1X9NA 2B2WC 4QCLA 2WFWA 1N34L 1EYAA 1NTGA 3LNNA 4UY8C 5DNFA 4DR4Q 1CKNA 4C3HH 1CTMA 2E75C 3H0GG 4GOPC 4V190 2Q2HA 1GUOA 4JYAQ 4KKUA 2UUAQ 3TP8A 5ELEA 3TP6A 3H3VH 3K6OA 2Z8LA 5IGGA 5CMDA 4JOIA 4JCVE 5HGTA 2CW0D 4PZ7A 3F2CA 1VQKA 2NN6G 2LY7A 1F2MA 1VQBA 2H4OA 1IW7D 1T5EA 4P73A 3C3LA 4B3SL 3J7YW 1KDCA 4EX5A 3FRPB 1I3QB 2OWOA 3PO3H 1YIJA 3M4OB 3A8JE 3S16H 3CPFA 1HTPA 4DR3L 4Q5VA 4JI8Q 5LMNQ 1N8RC 2RHSB 1IXRA 2F0OA 1L1OB 4DV0Q 1MGSA 1CK1A 1UE1A 2C5CA 1PH1A 3PO3G 1VQDA 5IP7G 3GTLB 2JQOA 4YWLA 2IW3A 3RZOB 5JJLA 5DM73 1E0BA 1RHPA 1PRTD 3CP0A 1CA6A 4NP5A 2XWJB 1O7ZA 1EU4A 2UU9Q 1TWFB 1WD1A 2AWOA 2SNMA 1DONA 2LMCB 4WRDA 4IFDH 3HKZB 1HHVA 3NUCA 2VQEL 3K7AH 3FDTA 3OPOA 4N8FA 3TZDA 2QILA 3HG9A 5C3EH 3M4QA 4HJ5A 1BBXC 3IFDA 4LFCL 1HNZQ 1ENAA 4QUFA 2DNEA 4OWWB 2Y0SE 4IALA 1WD0A 1WVLA 2NVXH 5ELNA 4X62L 1A62A 5M5WH 1SYEA 1L2FA 3ITPA 2K7VA 3L9AX 3VYUA 5C4XH 1V8QA 1SJHD 3QWNA 1F9QA 4JBKA 3ER0A 1WFQA 1XNRL 3MVVA 5EPLA 2WAQE 2EYFA 4NMZA 4C1NI 2G5DA 4PQXA 3ERSX 4GN4B 3HOUB 4H7BA 1UAPA 5C4XG 1FNWA 4CJ2C 2E2DC 3HOXG 2K50A 3TP7A 4R4OA 3HOZH 1MBYA 2HCIA 1YI2A 1SYGA 1KRSA 2NBFA 1ET6A 4R8IA 3D8GA 2VQEQ 4IPHA 3PO2G 2UXDL 1BQQT 3WDNA 5CORA 4DK1A 2ZXOA 1W2BA 3KF6A 5COYA 3CF5A 1GOZA 2E2JH 4IJLA 5LL6X 5CR3A 5EKLA 2WIIB 3A0JA 3HZXA 3KF8B 1K0RA 2DGYA 3RUZA 1J5EQ 2JK8A 5JPMC 5FJ8H 1N33Q 1NNXA 2RVLA 4PZ6A 4ZUJA 3CCMA 5BR8L 1U4PA 2HCCA 4OL7A 3PIPA 3FKIH 3H0GH 4F7XA 4DV3L 3BZDB 5CV9A 4BBSH 2KCMA 2Z4IA 2N8NA 3MXNB 4GNXC 3J81c 4DV5L 5IYDG 3J80c 1EOTA 3HKZE 3W1BA 3SK8A 2VQFQ 1M8AA 4FXDA 3KLRA 4L5RC 5LHY1 2RDGA 1MSHA 1TWCH 2WKCA 2E2IH 1EIFA 4X64L 1GUSA 3S1NB 2N88A 1E7ZA 2LXJA 5IYBG 5EBCA 4FF3A 3TREA 2R7ZH 3L2PA 3U9SA 1Q3LA 3QG1A 1VF5C 4NKLA 4ULLA 3KLWA 4QGUA 2JA5G 3J7A5 3TS2A 1DCZA 2UUCL 3U4ZA 1FGBD 3HRZC 3M7NA 1QB5D 4YWMA 3UDGA 3JC66 1CM9A 2K32A 2R61A 1QILA 5FO9B 1Q1EA 2ZM6L 4J6HA 2WV6D 1SE4A 5IGDA 3RN5A 2IX1A 1I50B 4ODGA 1SNCA 2CQAA 3OMGA 2A5HA 1EY4A 2EY2A 3Q24A 4C3HG 4GOPA 3S2DB 2UXDQ 1E2ZA 4BY7G 4FYDA 1KDAA 1UE6A 1TS2A 5IP9G 1K8MA 2B2TC 1OXTA 4RKBA 1YNJC 1D5MC 2RCFA 2ZTEA 3NTHA 4CDFC 4AYBB 3UDIA 4RGTA 1PTOF 3PIOA 3E3XA 3Q22A 1NUCA 3T1HL 3NSWA 3MXUA 1Y1VB 3FPUB 1PYSB 4GS3A 3GTGB 4E6IA 2JA8G 1TY0A 2J0TD 3RLOA 1DOLA 1PYWD 4ZRZA 3HKSA 3NE5B 2UUBQ 3SVMA 1CZWA 2LS01 1I94Q 3M4OH 1UNSA 2ZXPA 4OX9Q 2R93B 4A3KH 3CRLC 3JAMi 4B3RL 4X3TA 1Y8PB 5M5XH 1ASZA 1IKMA 2ATWA 1JE4A 2K28A 2VW9A 1DJRD 4XIGS 1CA5A 3BZCA 3J7AV 2HHHQ 2ZTCA 4RHRA 3TDQA 1CKMA 3D3RA 1SYBA 3RLNA 2I07B 4X6AH 1IHZA 1I4PA 2F0JA 3ERQA 1SSOA 1JOQA 1X3EA 2E5LL 3F8TA 4RCNA 2KA7A 3E0EA 3DHQA 3I4OA 4C3HB 5JJZA 3S2HB 1LACA 2NVYB 5KNCA 3BDLA 1JQYD 4FDBA 3MC0B 1AW7A 4DK3C 1TT2A 4A3IG 5BN5A 1HNXQ 4HJAA 5IYCH 1KLUD 1QWYA 1DM0B 3PV0A 1Y8NB 2K5VA 2YTVA 1TWAB 2B29A 1ZYRC 1RF2D 3J7AF 3DWPA 4A3GH 1VQGA 3DLLA 1VQJA 2Q8TA 1FGUA 1W6JA 1IBKL 2LSSA 5C4JB 1YZ6A 5JAVA 3WOEA 5IYBH 1GJXA 1FYCA 2R92G 3R2IA 4RAUC 2F3WA 3CMAA 2QCPX 4OO1I 3SHLA 1EQRA 1PMRA 4LUZA 2MFIA 2N78A 3A8IE 4RG1A 4FO2A 5ELDA 5J22A 3VYRA 1IL8A 4A3EH 1BBWA 5C0XG 2A6HC 1EY9A 2R6GA 1EOVA 4M1UB 1GKHA 2RSOA 1DOMA 1EFID 4RWSC 3E9IA 4LAAA 5KYIA 5H1SE 4R9WA 3HOUG 1KAAA 2M2LA 4G4KA 4P72A 2Z0SA 2KENA 2UU9L 3K58A 1N32L 3G4SA 2EJGC 3S17H 4BBRB 3BDOA 3MXGA 1S5BD 2IL8A 1DGSA 1NBWA 1XX8A 2JA7G 4A93B 1KHIA 3PUVA 4OXPA 2VUMH 3G6EA 3VR6A 5JVH3 2JSOA 3CCLA 2JA9A 4HMIA 1K83H 5IT9E 1IBMQ 1OXSC 5DEHA 4FXKC 4JI6L 3W1GA 2DN8A 3GTJH 3I4MH 4MHEA 4CJ0B 5I4DA 3UDFA 1E24A 2ENBA 1KC8C 3CCEA 4A3JB 4X65L 3EA6A 3OIQA 1AH9A 3NTKA 1SE8A 2NTTA 4IUUA 1N36L 4C56C 3HOWB 1AP0A 3TP5A 1WOCA 2QEJC 3BZKA 5LL6S 1HQMC 4OIJA 3HS0C 2MJ8A 4RFBA 5K5PA 3RN2A 2UXCQ 4IN3A 1Y1WG 4QQBX 4JPBW 4POGA 1KNEA 5D14A 4JI4L 2KOLA 4IOAA 1K28A 1XYIA 4UP9A 4OWTB 5C5LA 2UUAL 1XJVA 5IE8A 1JWSD 1SMYC 3QIAA 4JI1L 2R93H 1SAPA 4O0AA 1QVFA 3UDXA 4LF9Q 1XWEA 1TVXA 2P5ZX 2QKIC 1N36Q 1EL0A 2BDOA 1I94L 2EPBA 4DA2A 1I4RA 2PW7A 4DV2Q 1U4MA 2RDFA 3GV6A 3T53B 1YJWA 1XMOQ 3HFZB 2I5HA 4GLXA 2HQLA 1QNUA 4A3FB 2NN6I 4EVOA 2PZWA 2PCFB 4LFAQ 4A3GB 1UEAB 1BR9A 4A3FG 4GOPB 2EDGA 2MPMA 4S3SA 4BY1B 2L5TA 5A2QL 3M3YH 3HOYB 3VR2A 3P20A 4FF4A 4A3CG 4GN3B 4A3EG 1MHWC 3PUZA 2XRSD 2YV5A 4XT3B 2R7ZB 4IJHA 1V9PA 2AKWB 2F3VA 4X3SA 2A6EC 2XWBB 1LTTD 2JN4A 4ZYSA 3S14B 1WTXA 3NPPA 4CDCC 3PIP3 5C0XI 4KKTA 2B2WA 1TY2A 1B44D 1VQFA 4LW1A 2HDMA 3MAQA 3GTPB 3SDZA 1SE3A 2EJFC 2E74C 4QY7A 1SYDA 4GKKQ 4ILWA 1LTRD 1VQEA 1L1OC 1WCMB 1V1PA 2F0DA 1TR5A 3KJPA 4R1JA 3AFQA 3AEVA 4A3GG 1LT6D 2OXPA 3J81L 2ZXRA 4IQZA 4DR5L 1DD2A 4B9WA 1RIPA 4JI2L 3S24A 2OCEA 5CBEE 4LNQA 3CU7A 1MD2D 1YVCA 1IW7C 3GD7A 4A3BG 1X3GA 4DN4M 1SMYD 3P75A 1LO5D 3KUPA 4IPDA 2F0LA 4A3MG 1AZQA 1NMGA 2BH8A 4P74A 1DYQA 1O80A 4OO1G 4H0LC 3TZUA 1J6QA 1B2TA 5G3LF 3NTIA 1WI5A 1JWUD 3MEHA 1EIHA 1E3PA 5LMNW 1DXMA 4DV5Q 3G71A 4X3KA 3S1MB 4NXNL 2GA4B 1JOKA 1O78A 1EYCA 1PRTF 4NB3A 4QB4A 1HXYD 2IPKD 2R92H 2PQEA 5EJWA 2F4VL 1RCVD 1HFGA 2MGSA 4IUQA 4WFN3 1FR3A 5E4WC 4X66L 2AWNA 3AU7A 1KL9A 3RLFA 4C2MB 2RF4A 2SEBD 1K73C 1STYA 3FHWA 2KECA 1F2LA 2I5LX 1S5CD 4YCUA 3S1RB 1X56A 2VB2X 5KNBA 1CUKA 3SE0A 5EPKA 2SOBA 3K81C 1S5FD 3QR8A 2F0GA 4YY3Q 2JA7H 4QJFA 1O7LA 5CC4A 3HOZB 3I56A 3G48A 4A75A 5K36G 2A74C 5EGTA 1HR0Q 1A3UA 1KRTA 4LUOA 4MTKA 3F2DA 5CV4A 3GTKB 2WAQG 2N55A 3OW7A 1YITA 2OT2A 4LMQD 1IZ6A 1I6HB 5C4HA 1KDBA 1G51A 5A35A 3DM3A 5EKIA 1KTKA 3U4VA 3DEOA 1XMQL 2UUBL 2ES2A 5CBAE 5GAHC 2L12A 5IYCG 3I4NG 2XSCA 4IURA 1HZBA 2XIWA 4OELB 2KUMA 4C3JH 3H3VC 5C5MA 4BY7H 4DR5Q 1C9OA 3PO2B 1JICA 2NVTH 4DUZL 1K83B 4RKLA 4X65Q 4GKKL 4Y52H 2L4NA 3GTKH 2K03A 3BS1A 2PPBC 5KYLA 3W2DA 3VYSA 2I0QA 5J3BA 1VCIA 4IO9A 1QOHA 1HNWL 1X55A 2B63H 1QVGA 4KHVA 5K36H 2WB1B 2F1MA 2NB0A 1NCVA 3CPWA 2VB3X 1X3QA 2Q2IA 2Z9HA 4PMCA 4DR2L 1Q1BA 1H9RA 1V1OA 3ONAB 1FL0A 1B9NA 3CCQA 1EQQA 3AB9A 1K8OA 4C3IH 1LM0A 1B70B 1S72A 2CQOA 4LF5Q 2XN9C 2AUKA 1K8GA 4KHPL 1VMPA 1WTVA 1BO0A 1AN8A 3NXWA 2A68C 3EQLC 4P2CB 1STEA 3K8AA 4HEDA 2VNUD 1PZID 4JI0L 2NVXB 2K14A 3EVQA 5ELCA 1YHAA 3IL8A 4CDDC 1S4ZA 4CDEC 3BVZA 4LFBQ 2NVQH 4O2DA 3I7FA 4QF4A 4PMBA 3B6YA 3NK9A 3K7AB 1STNA 2BE5D 4PG3A 1XMQQ 1XPUA 4DUZQ 4LF8L 3DUZA 4TSSA 5IOCA 4KV6A 2Z1CA 1LV9A 2IHFA 2L15A 1Y14B 4LUVA 1HR0L 1OXVA 2BA1A 2QW7A 4DAYB 4L63B 4C2MH 5FO8B 3OTOQ 4RGOS 2EXDA 4A3DG 2K52A 4YY3L 1I6HH 1YEZA 4IUPA 2CKZB 1IYUA 3PF4A 4ME3A 1PZKD 2QDBA 2J4XA 3GQBA 2EYLA 3C2PA 4L5QA 3TMEA 2D2CC 2NVYH 1N34Q 1IL2A 1Y1VG 3T4AC 2SDFA 3WOFA 4ZK9B 1X54A 1A6XA 2RA4A 2HIVA 1NR2A 1M4VA 2A6ED 1LTBD 3KFUA 4RCOA 2HD3A 3MFYA 4Y7NH 2PW5A 2EYHA 4IPCA 2E5LQ 3SK6A 1CHPD 3CCUA 1EY8A 5C3EB 1PHJA 2EYOA 4DUYQ 4DXFA 3NBHA 3H0GB 3RMHA 3U50C 2V4DA 1HPCA 4B9XA 4AQYQ 4BY1H 1PH6A 1SBBB 1KD1C 4P75A 1ESRA 3T1YQ 2EZVA 2RCNA 3H3VI 4POFA 4A3FH 4NXNQ 1LTLA 1STGA 2NVTB 1JE5A 1BCPB 3D31A 4B3TL 4R4CA 5IYDH 1EYDA 2KCTA 4HJ9A 4C3JG 3X3MA 4G57A 3I4MG 4A3LH 2KCCA 3EN2A 1YNJD 2OTLA 4DAMA 3BYTB 2B63B 2Q2TA 4ZLTF 5D3IB 1QJOA 1Q81C 1EQVA 4IUTA 1BCPC 5FO7B 2Q2UA 1KIXA 1HRJA 3HOZG 1XXGA 2K5NA 4KHZA 5TSSA 1JJCB 1KNAA 5FLXL 3CD6A 1TQOA 4BXXH 2JA5B 1CI3M 1O7IA 5CV5A 3V96A 3I2ZA 2R7FA 3H6MA 2CCZA 4BBSG 2X6LA 1Q8IA 4XT1B 1SROA 2E2HB 3R2TA 4H13C 1CZGA 2JA7B 2RKSA 3R3OA 3NBHB 3HOUH 2FMMA 3S1RH 1Y1VH 5FLMG 3OHXC 1EU3A 1TWHB 3AMUA 1GHJA 3CC7A 1B53A 4DV1Q 4DV0L 4JI3L 4A3IH 5J1ZA 4FP5D 2PMZB 2VXWA 4BBRG 1E22A 2KHJA 4K6LA 3J80i 5C4XB 1SNMA 5KIXA 4YCWA 1WJJA 2WAQB 4WJ4A 5FLXc 3D6WA 2E2HH 4DAPA 3NELA 1VQNA 1EFWA 2J7ZA 1LTAD 2NZOA 4QUCA 2BCOA 4YHHQ 2EQSA 2WP8J 1C0AA 3RR5A 4WJ3M 4HCEA 1ILQA 2MP1A 1TWFH 3CC4A 3PUXA 2DY8A 3FEWX 2KHIA 4KD4A 4TRDA 2FHTA 1HZ9A 1Y69U 2L9HA 1SFOB 2D62A 4CBVA 2GN5A 2B2YA 4DK0A 2K75A 3X3NA 1YNND 4M8AA 3O13A 2VUMG 5IP7H 2YTXA 2KVMA 3KF6B 1A3TA 4L5TA 1BCPF 4NW2A 3N6RA 4ME5A 3URYA 2V1CC 2DJFC 2M00A 4CKEA 3CKIB 3C1EA 4HSPA 2R92B 3CAMA 3R8BA 2EY1A 1C48A 1F9RA 2EXZA 3PO3B 4ID6A 4C3IG 4K5XA 4HIMA 4JI0Q 5D65A 1K8AC 4DV3Q 1ZEQX 1CQFA 4JI6Q 1PFNA 4C1NK 4AIMA 2R7DA 1VQOA 3TEHB 1TKWB 1G91A 4A3JH 2EJMA 4LF5L 1PH9A 4DV6L 4GKJQ 1J5EL 3D6CA 2K1BA 5M3MG 5EAYA 1X65A 1SNDA 1I4QA 2C9OA 2F0FA 3E9HA 3K7UC 3VR5A 4ZCKA 2CH4A 2F3IA 4H02A 4DR2Q 4DNTB 5M5YH 1IBML 1JMCA 1LTSD 2LXKA 3TS0A 3TBIB 5T1IA 1TXYA 1OXUA 4HIKA 2WACA 1EEID 1L0YB 2D0OA 2B39A 3KDFA 3KOJA 1HR0W 4KD3A 1GO3E 2CW0C 4X3UA 4IFDJ 3A56A 1PVOA 1HJPA 1AE2A 2EY5A 2PI2A 1D2BA 3CCVA 5HURA 2HT1A 3L7ZC 2PI2E 3A7LA 3RD4A 3BYYB 1QE6A 4A3EB 4F87A 1YBYA 3C46A 3PSIA 4LF6L 2CWAA 2L55A 3I70A 4X62Q 3HOYG 4LF7Q 3I91A 1PTOH 4A76A 1D8LA 3J81i 2B2VC 2MO1A 4R4QA 5E7NA 1CHQD 4K14A 4AQYL 4A3DH 1VQ4A 1LT4D 2EVBA 4AYBE 3KK7A 5F2DA 3OMCA 2FFKB 2FINB 1R4PB 5FOBB 3S2HH 4X66Q 4DR1Q 1GD7A 5E4XA 4K2KA 3FP9A 4FVMA 4EQPA 4YHHL 3RZOH 4ZQ3A 3A8KE 3SK4A 1R4QB 1UWVA 1GVPA 3IRBA 4FXGC 4IFDG 1MSGA 1PRTB 1F2ZA 2Z4HA 2IY5B 1II3A 1VS0A 1BKBA 2M9VA 4WJWA 2NZ1D 1EY7A 1J9OA 2DY7A 1HQRD 4KY6A 3ICEA 4JVZA 5DM63 5M3FH 1PZJD 3HOXH 2K01A 4DR3Q 2JA8B 2AQ1B 4DF7A 3G6JB 1G8ZD 1P8LA 4DNRB 2A1AA 1CQVA 5IT9c 3PO2H 2I46A 4KI0A 1TS5A 5M3FG 4IFDI 4IZ8A 2N3SA 3VYTA 2PQAB 4JI3Q 2F0MA 1X3PA 2BE5C 1D6EC 5IT9L 3MFGA 3DM1A 2O2LD 4JW0A 1E2WA 3S1QB 3QOJA 3QOLA 3E6ZX 2AQ3B 3CCJA 4PNYA 1SYCA 2HHHL 1I4XA 1BXTA 5IODA 5CGKA 1SN8A 1STBA 4JI2Q 3L0OA 2QDLA 1S5DD 5FLXE 4I65A 4LF6Q 4B3MQ 3T56B 1PH7A 1XNRQ 3LGJA 1SDFA 3J7ZC 4UP8A 3J80E 4K0KQ 4MTNA 3GP7A 1RKNA 2YTYA 4B3TQ 4DR4L 3A74A 1JWMD 4QMGA 3QB3A 3KYHC 4KHPQ 1FNUA 4KLKA 3I4MB 4RA8A 3S2DH 4QIWB 3DWAA 2YYZA 4TKOB 2JA8H 3KF8A 1STHA 4A3BB 3F2BA 4IUVA 5CV7A 3M3YB 4DUYL 1SLJA 3PQIA 1I6VC 1SR3A 3OYYA 3T16A 4XQJA 1XPOA 1HUMA 2JE6I 4Q0FA 1YJ9A 1BNZA 1MI2A 1CSPA 3KLSA 3KJOA 3T1YL 2JEBI 4A3MH 1PDQA 5HGQA 1JCKB 3AFPA 1LTID 1D1KA 1MJEA 1B8AA 1FD7D 1WCMG 2KBNA 3QJYA 3E0JA 1JB3A 5ISRA 1EIYB 5KEEA 3I4NB 1TS4A 1IBLQ 4LFAL 4O42A 1SNOA 3CQZH 2EOTA 1U0LA 2BDNA 4LF4L 2VS1A 4KKSA 4TQUS 4A3MB 1I5FA 1P16A 4B3ML 2ZTDA 2L0CA 2ZJQA 1TWAH 3STBC 1LT5D 2ALYB 4UPAA 5GROA 1STAA 1D5XC 2LKVA 1HUNA 3W3AA 1D5ZC 2RDHA 1PH2A 2BOSA 3AQQA 3GV3A 1SEBD 1QUQB 1QNKA 2B2UA 5JVG3 2WKDA 1RTNA 2UUCQ 4HR7B 4P71A 5IIFA 4A3CH 5L37A 2SNSA 1HA6A 4GLAC 1OXXK 4LFBL 2VQFL 1WTHA 1E1TA 5D3DA 3VR3A 1TU2B 4DU9A 3T13A 3K80C 2XTIA 4JYAL 1ML0D 3DMUA 2A69D 1FVIA 2K5WA 4YCVA 5I2XA 1H9JA 1RJTA 2EE1A 5JEAJ 1A2TA 1ENFA 4A93H 2A69C 5LMUL 2BH2A 3BDCA 2DUDA 4HIOA 1H9SA 1N33L 1N32Q 1JC7A 2F0QA 1ENCA 3BVGA 3M85A 1VQPA 2B8GA 1CSQA 1EY6A 1SNPA 4EQ5A 2K05A 3CRKC 1FJGQ 2F0KA 1HA5A 1PLFA 3I8ZA 1KLGD 1EWIA 2MUYA 2KQ3A 1JJ2A 1PTOC 3KBXA 4C3IB 4DR1L 3UE1A 1WTOA 1Z9FA 3I72A 3FVQA 1HNWQ 3SXHA 4LWCA 2G9DA 1Q7YC 3W5OA 2A68D 3KLSX 1ASYA 4F8MA 1G6ZA 4LF7L 5IGEA 1H9KA 4BY1G 4DR7L 1HH2P 1VQIA 1PTOB 4HN7A 3SEBA 4AYBG 2O5IC 4DKAC 3MA2B 3A7AB 4RHSA 3NHHA 4DR6Q 3ULLA 2RSNA 3BVMA 4XDXA 3NWSA 2VZAA 4KJNA 2KEDA 1UEBA 1Y8OB 3EIVA 2JXMB 2ASBA 1XPRA 4XYQA 5I2YA 1EUJA 1H9MA 2RQXA 5EKKA 1TIID 1IBKQ 4Z9CB 3S9WA 1GHKA 3T51B 3JAME 1A15A 2F0HA 3HEJA 5AJ3Q 3ZYYX 3CC2A 4GLVB 1TS3A 5CV8A 1HNZL 5GQOA 2X69A 1LABA 4A3DB 3MWYW 1ZKOA 3E5SA 3NENA 4JV5Q 5A2QE 4DR6L 5IY0A 1JJGA 1MJCA 4RMFA 2C35B 1O7YA 1GUGA 1BUVT 1XTDA 1C7YA 3OIPA 3NQIA 3ND8A 2PYKA 4KY5A 2XGTA 1ZXTA 2MHVA 4J15A 2VUMB 1GUNA 1B3AA 1TWGB 3R93A 1WTRA 3S16B 1F77A 4DPGA 1I4GA 3K5LA 1Q86C 4JI7L 1AE3A 1SFOH 1PYBA 3STBD 1E1OA 1SNQA 3ND9A 5ELBA 5CYUA 1HCZA 2N49A 1LLRD 1EWHA 3OWEB 1I50H 5GAEC 1AFPA 1L1OA 1FJGL 5FK9C 3IKJA 4XYOA 5FKAC 4OONA 3GTOB 3D4WA 1TWGH 2WINB 4LK1C 1TWCB 3S15H 4EQOA 1LT3D 4B3RQ 2B2YC 1PFMA 2Q8RE 3SR1A 5JEAG 1G6PA 1LUZA 4LF9L 1H95A 1B1ZA 5IGCA 3K5MA 1NMFA 3L3OC 2PMZE 4JI1Q 1VQMA 1WCMH 1K3RA 3EROA 2ZT9C 1EWCA 3ZJYC 1EY5A 2ZJRA 3D4DA 3IAYA 1F9PA 4JI4Q 5E1FA 3BG3A 4N9PA 5C6AA 1KABA 1PFBA 4B3SQ 2GVAA 3HP3A 2XRQD 4OX9L 2A8VA 5EPJA 1L0WA 1XNQL 2IX0A 2AMCB 2JJQA 4MN3A 4ZKCB 2FXQA 4LF8Q 1U4RA 2ICIA 3M7GA 2IX3A 2NVQB 3CMEA 2JA6B 1G2SA 4KMUC 1JOOA 3HOXB 5IWAQ 5M3FB 1RODA 4DGZA 4BBSB 3Q8DA 3MXPA 3PMFA 1EEFD 1QZGA 4JBWA 3FPPA 3IFTA 3RNUA 2NN6H 2K33A 1CT1D 2QF7A 3M4PA 4JBJA 2NUCA 4K8IA 5BN3A 1D1IA 3ULPA 3M9BA 3OSOA 3CCRA 4HAEA 3HOVH 4Y7NB 4I7AA 2OQKA 4KTAA 3I4LA 1ESFA 2ZM6Q 4GN5A 4A3IB 4MNOA 4K2LA 3JAML 4IOCA 1PH3A 2E2JB 1B50A 1IYVA 3I3CA 2R7ZG 3NP8A 2H1EA 1DZ1A 5G3LD 3I55A 3GTLH 3K0YA 1IKLA 1Z6HA 1JORA 3H91A 1KXLA 1ONLA 3K0XA 4YIJA 4JOIC 3A5ZB 3MXNA 1A8VA 1V43A 1ET9A 3HOYH 3J81E 4H44C 1A2UA 1NSNS 1WYDA 2FMCA 3D0FA 4DV7Q 2XVSA 3WWVA 1HZCA 3PGZA 4FF2A 4A3KB 4CKBA 1NY4A 4O1NA 3C1FA 3H94A 2B2TA 3OOCA 4PV1C 4BWGB 4HJ7A 2IHEA 4KN7C 3HOVB 1M90C 1YJNA 2IWHA 1XTCD 5T1GA 1SXTA 3TRZA 4DNIA 5GADC 1Y1WH 1C8CA 2F0TA 4DV2L 5IP9H 1C4QA 2CH4W 1B4OA 4BA2I 1ZYRD 2IT1A 5C44G 1DOKA 3K5OA 2F03A 2KEEA 1EZ8A 1IYJB 2PQAA 1QG7A 4BA1I 1G2TA 1LTGD 1VQ9A 3S1MH 3V05A 1HFNA 1BBUA 1WTWA 3S15B 2HIXA 1A63A 2JP1A 2A6HD 3GTOH 4K5VA 2UXCL 4JI5L 3BJUA 1PRTC 3SGIA 1S5ED 2NWGA 4LF4Q 2OEOA 2Z6KC 4NXMQ 4IPGA 5M3MB 5I6WA 1GM5A 1YNXA 2HUGA 1PH5A 2D5DA 1X3FA 2CVRA 1ILPA 5JEAH 4NXML 1UUPA 1I4HA 3PUWA 1PXUA 3GTPH 1PV4A 2F4VQ 1BVSA 5KRUA 1B9MA 1F2YA 1LYLA 3OTOL 2OQ0A 5I9PA 5M3MH 4GNXA 1Y1WB 3OW2A 2L1BA 4MIUA 4ALPA 1K3BC 1NR4A 1L0XB 3HOVG 4N8X1 2WB1G 1YHQA 4YWKA 1AZPA 4AH6A 4MZ9A 2RHQB 2B3GA 2NTSA 4XXEA 2TMPA 4U68A
chains in the Genus database with same CATH topology
2KJXA 4CGYB 5IGBA 2B8FA 1YNNC 3PIO3 2F0VA 2RBMA 4K5WA 3KBGA 2O5JC 2EYPA 2K5QA 4RGNA 4BY7B 1G291 2PZUA 4F88A 2JEAI 3GO5A 4WORA 3VR4A 4PMWA 5CV6A 1Q12A 2G9HD 4KN4C 3K57A 3LX0A 3J80L 2CHBD 3NQTA 4HCSA 1GUTA 3FMCA 3P7JA 2B2UC 2F0UA 1J8IA 4B08A 1RDPD 1EY0A 2F0WA 2K5DA 1EQTA 3OWFA 3SK5A 2R3ZA 2EY6A 3TN2A 1GUWA 2FJ2A 1BCPD 2YU9B 5M5WB 4OHJA 3I73A 1A3VA 3NWTA 2IJ0A 4FNFA 3V2TA 4OIKA 1VF7A 1ICWA 3EFXD 3PUYA 2NYZD 5M5YB 2F0SA 4XQNA 4G7ZC 4U673 2B2VA 4HSVA 4I7ZC 2F0PA 1X32A 1VMCA 4EGVA 3K5NA 4GZYC 4UAIA 2XNAC 4J1MA 2TSSA 1WTQA 2EYMA 2F0EA 2AQ2B 2PO4A 5C0XH 1V1PB 3RZDB 1SYFA 5ELFA 3DEPA 1E2VA 4EQNA 5E3FA 4DAVA 1EZ6A 2ICEC 2X6GA 2D9UA 3CQZB 4XQQA 1FNVA 3P1HA 4L8JA 4N9TA 3VA7A 2Q8IB 3EJIA 3U9OA 1W6KA 3MHBA 1WTPA 4NDXA 1Z7TA 2HQEA 5C44B 2ID0A 3K59A 1EIGA 3A54A 4LJZC 5AFWA 4DXGA 3F2UA 5EBDA 4ZAIA 2KCNA 2KHSA 4OGQC 3HGBA 1T5XD 2L11A 2A73B 1PTOD 2Y0SB 3FKIB 2LFNA 2DNCA 3Q23A 3GTQB 5C3XA 5I9OA 3DXJC 3GTJB 5KGUA 1HTLD 5NUCA 2E2IB 1R9TB 3M4YA 3DWQA 1H9SB 4CHTB 5IGFA 2F0IA 4OO1H 3Q6SA 4CKCA 1RTOA 3S17B 1GXDC 3G7LA 4KY7A 3UI2A 2O4XA 1SJED 5M5XB 1OO9B 2E76C 2OF1A 1QCBD 4ABNA 3D4RA 3I90A 3QO2A 4ZKBB 4RGMA 4CJ1B 1Q90A 3A55A 2JYOA 5C0XJ 5JOBA 5C4ZA 4KK7A 1SE2A 1CFMA 4UDUC 4L6TB 3TSSA 4K8JA 4J8QA 2EYJA 4G7OC 5KNDA 1VDZA 4K6DA 1AEXA 3MZ5A 5I6YA 3GTMB 4BS9A 1JR0D 4C3JB 1BDOA 4IUNA 2F4IA 5JPNC 5DAUA 3H09A 3N52A 1RD9D 1NAPA 5EQ0A 5C3WA 4RH6A 4FF1A 4DFAA 3CHBD 3LWUA 1BOSA 2HDLA 4JK1C 4HMJA 3LWEA 1U4LA 2PNRC 5J39A 4V0BA 5BN4A 5M9OA 1U9RA 4HTHA 2K6AA 1F9SA 1BF4A 4XTCS 1Z47A 3NBIA 3Q0AA 2AUJD 2K04A 4ZUIA 4DAYA 4KJOA 3VA5A 2PZTA 2BA0A 2F0NA 4G7HC 4R8NA 3MTSA 2B2WC 4QCLA 1EYAA 3LNNA 5DNFA 1CTMA 2E75C 4V190 1GUOA 4KKUA 3TP8A 5ELEA 3TP6A 3K6OA 2Z8LA 5IGGA 5CMDA 5HGTA 2CW0D 2NN6G 2LY7A 1F2MA 2H4OA 1IW7D 1T5EA 3C3LA 3J7YW 1KDCA 3FRPB 1I3QB 3M4OB 3A8JE 1HTPA 4Q5VA 2F0OA 1MGSA 1CK1A 2C5CA 3GTLB 2IW3A 3RZOB 5DM73 1E0BA 1RHPA 1PRTD 1CA6A 4NP5A 2XWJB 1O7ZA 1EU4A 1TWFB 1WD1A 2AWOA 2SNMA 1DONA 2LMCB 4WRDA 4IFDH 3HKZB 1HHVA 3NUCA 3FDTA 3OPOA 3TZDA 2QILA 3HG9A 1BBXC 3IFDA 1ENAA 4QUFA 2DNEA 4IALA 1WD0A 1WVLA 1SYEA 3ITPA 2K7VA 3L9AX 3VYUA 1V8QA 1SJHD 3QWNA 1F9QA 3MVVA 5EPLA 2EYFA 4NMZA 4C1NI 4PQXA 3HOUB 4H7BA 1UAPA 1FNWA 4CJ2C 2E2DC 3TP7A 1MBYA 2HCIA 1SYGA 2NBFA 1ET6A 4R8IA 3D8GA 1BQQT 3WDNA 5CORA 4DK1A 2ZXOA 5COYA 1GOZA 5LL6X 5CR3A 5EKLA 2WIIB 3HZXA 3RUZA 5JPMC 2RVLA 4ZUJA 1U4PA 2HCCA 4OL7A 4F7XA 3BZDB 5CV9A 2Z4IA 1EOTA 3SK8A 1M8AA 4FXDA 3KLRA 5LHY1 2RDGA 1MSHA 2WKCA 1GUSA 3S1NB 2N88A 5EBCA 4FF3A 3U9SA 1Q3LA 3QG1A 1VF5C 4NKLA 4ULLA 1DCZA 1FGBD 3HRZC 3M7NA 1QB5D 1CM9A 2K32A 2R61A 1QILA 5FO9B 1Q1EA 4J6HA 2WV6D 1SE4A 5IGDA 2IX1A 1I50B 3OMGA 1SNCA 2CQAA 4ODGA 2A5HA 1EY4A 2EY2A 3Q24A 4C3HG 3S2DB 1E2ZA 4FYDA 1KDAA 1TS2A 1K8MA 2B2TC 1OXTA 4RKBA 1YNJC 1D5MC 3NTHA 4AYBB 4RGTA 1PTOF 3Q22A 1NUCA 3NSWA 3MXUA 1Y1VB 3FPUB 3GTGB 4E6IA 1TY0A 2J0TD 1DOLA 1PYWD 4ZRZA 3NE5B 3SVMA 1CZWA 2LS01 1UNSA 2ZXPA 2R93B 3CRLC 4X3TA 1Y8PB 1IKMA 1JE4A 2K28A 1DJRD 4XIGS 1CA5A 3J7AV 4RHRA 3TDQA 3D3RA 1SYBA 2I07B 1IHZA 1I4PA 2F0JA 3ERQA 1SSOA 1JOQA 4RCNA 2KA7A 3DHQA 4C3HB 5JJZA 3S2HB 1LACA 2NVYB 5KNCA 3BDLA 1JQYD 3MC0B 1AW7A 1TT2A 5BN5A 1KLUD 1QWYA 1DM0B 3PV0A 1Y8NB 1TWAB 3J7AF 1ZYRC 1RF2D 3DWPA 2Q8TA 1W6JA 5C4JB 5JAVA 3WOEA 1GJXA 1FYCA 3R2IA 4RAUC 2F3WA 2QCPX 4OO1I 3SHLA 1PMRA 3A8IE 4FO2A 5ELDA 5J22A 3VYRA 1IL8A 5C0XG 2A6HC 1EY9A 2R6GA 4M1UB 2RSOA 1DOMA 1EFID 4RWSC 5KYIA 4LAAA 4R9WA 1KAAA 2M2LA 4G4KA 3K58A 2EJGC 4BBRB 3BDOA 3MXGA 1S5BD 2IL8A 1XX8A 4A93B 3PUVA 3VR6A 5JVH3 2JSOA 4HMIA 5IT9E 1OXSC 5DEHA 4FXKC 2DN8A 4MHEA 4CJ0B 5I4DA 2ENBA 4A3JB 3EA6A 3OIQA 3NTKA 2NTTA 4IUUA 3HOWB 4C56C 1AP0A 3TP5A 2QEJC 5LL6S 1HQMC 3HS0C 4OIJA 2MJ8A 4RFBA 5K5PA 4IN3A 1KNEA 5D14A 2KOLA 1XYIA 5C5LA 1JWSD 1SMYC 3QIAA 1SAPA 1XWEA 1TVXA 2QKIC 1EL0A 2BDOA 2EPBA 4DA2A 1I4RA 2PW7A 1U4MA 2RDFA 3GV6A 3T53B 1QNUA 4A3FB 2NN6I 4EVOA 2PZWA 2PCFB 4A3GB 1UEAB 1BR9A 2EDGA 2MPMA 4S3SA 4BY1B 2L5TA 5A2QL 3HOYB 3VR2A 3P20A 4FF4A 3PUZA 2XRSD 4XT3B 2R7ZB 2F3VA 4X3SA 2A6EC 2XWBB 1LTTD 4ZYSA 3S14B 1WTXA 3NPPA 3PIP3 5C0XI 4KKTA 2B2WA 1TY2A 1B44D 2HDMA 3MAQA 3GTPB 3SDZA 1SE3A 2EJFC 2E74C 1SYDA 4ILWA 1LTRD 1WCMB 1V1PA 2F0DA 1TR5A 1LT6D 2OXPA 3J81L 2ZXRA 4IQZA 1DD2A 4B9WA 5CBEE 3CU7A 1MD2D 1IW7C 3GD7A 4DN4M 1SMYD 3P75A 1LO5D 3KUPA 2F0LA 1AZQA 1DYQA 1O80A 4OO1G 4H0LC 3TZUA 1B2TA 5G3LF 3NTIA 1JWUD 3MEHA 1EIHA 1DXMA 3S1MB 4X3KA 2GA4B 1JOKA 1O78A 1EYCA 1PRTF 4QB4A 1HXYD 2IPKD 2PQEA 5EJWA 4WFN3 1RCVD 1HFGA 2MGSA 4IUQA 1FR3A 5E4WC 2AWNA 3AU7A 3RLFA 4C2MB 2SEBD 1STYA 2KECA 1F2LA 1S5CD 3S1RB 2VB2X 5KNBA 3SE0A 5EPKA 2SOBA 1S5FD 2F0GA 1O7LA 5CC4A 3HOZB 5K36G 2A74C 5EGTA 1A3UA 5CV4A 3GTKB 2N55A 3OW7A 2OT2A 4LMQD 1I6HB 5C4HA 1KDBA 5A35A 5EKIA 1KTKA 3DEOA 5CBAE 2L12A 2XSCA 4IURA 3H3VC 2XIWA 2KUMA 5C5MA 3PO2B 1JICA 1K83B 4RKLA 2L4NA 2K03A 3BS1A 2PPBC 5KYLA 3W2DA 3VYSA 1VCIA 1QOHA 4KHVA 5K36H 2WB1B 2F1MA 2NB0A 1NCVA 2VB3X 1X3QA 4PMCA 1Q1BA 1H9RA 1V1OA 3ONAB 1B9NA 3AB9A 1K8OA 2XN9C 2AUKA 1VMPA 1WTVA 1BO0A 1AN8A 3NXWA 2A68C 3EQLC 4P2CB 1STEA 4HEDA 2VNUD 1PZID 2NVXB 3EVQA 5ELCA 3IL8A 1S4ZA 3BVZA 4QF4A 4PMBA 3NK9A 3K7AB 1STNA 2BE5D 3DUZA 4TSSA 5IOCA 4KV6A 2Z1CA 1LV9A 1OXVA 2BA1A 4L63B 5FO8B 4RGOS 4IUPA 1IYUA 1PZKD 2QDBA 2J4XA 3GQBA 2EYLA 3C2PA 3TMEA 2D2CC 3T4AC 2SDFA 3WOFA 4ZK9B 1A6XA 2RA4A 1NR2A 1M4VA 2A6ED 1LTBD 4RCOA 3MFYA 2PW5A 2EYHA 3SK6A 1CHPD 1EY8A 5C3EB 2EYOA 4DXFA 3NBHA 3H0GB 3RMHA 2V4DA 1HPCA 4B9XA 1SBBB 1ESRA 2EZVA 1STGA 2NVTB 1BCPB 3D31A 1EYDA 4C3JG 3X3MA 4G57A 2KCCA 1YNJD 3BYTB 2B63B 4ZLTF 5D3IB 1QJOA 1EQVA 4IUTA 1BCPC 5FO7B 1HRJA 1XXGA 4KHZA 5TSSA 1KNAA 2JA5B 5FLXL 1TQOA 1CI3M 5CV5A 3V96A 3H6MA 2X6LA 1Q8IA 4XT1B 2E2HB 3R2TA 4H13C 1CZGA 2JA7B 2RKSA 3R3OA 2FMMA 3OHXC 1EU3A 1TWHB 3AMUA 1GHJA 1B53A 5J1ZA 4FP5D 2PMZB 2VXWA 4K6LA 5C4XB 1SNMA 5KIXA 2WAQB 3D6WA 4DAPA 2J7ZA 1LTAD 4QUCA 2BCOA 2WP8J 4HCEA 1ILQA 2MP1A 3PUXA 2DY8A 3FEWX 4KD4A 4TRDA 2FHTA 1Y69U 2L9HA 1SFOB 2D62A 4CBVA 2B2YA 4DK0A 3X3NA 1YNND 4M8AA 3O13A 2KVMA 1A3TA 1BCPF 3N6RA 4NW2A 4ME5A 3URYA 2M00A 4CKEA 3CKIB 3C1EA 4HSPA 2R92B 3R8BA 2EY1A 1C48A 1F9RA 2EXZA 3PO3B 4ID6A 4C3IG 4K5XA 5D65A 1ZEQX 1CQFA 1PFNA 4C1NK 1TKWB 1G91A 2EJMA 3D6CA 2K1BA 1SNDA 1I4QA 2C9OA 2F0FA 3VR5A 4DNTB 1LTSD 3TBIB 5T1IA 1OXUA 2WACA 1EEID 1L0YB 2B39A 4KD3A 2CW0C 4X3UA 4IFDJ 3A56A 2EY5A 1D2BA 5HURA 3L7ZC 3A7LA 3RD4A 3BYYB 1QE6A 4A3EB 4F87A 3C46A 2L55A 3I70A 3I91A 1PTOH 2B2VC 1CHQD 4K14A 1LT4D 2EVBA 3KK7A 5F2DA 3OMCA 2FFKB 2FINB 1R4PB 5FOBB 5E4XA 4K2KA 4FVMA 4EQPA 4ZQ3A 3A8KE 3SK4A 1R4QB 4FXGC 4IFDG 1MSGA 1PRTB 1F2ZA 2Z4HA 1II3A 2M9VA 4WJWA 2NZ1D 1EY7A 1J9OA 2DY7A 1HQRD 4KY6A 5DM63 1PZJD 2K01A 2JA8B 2AQ1B 4DF7A 3G6JB 1G8ZD 4DNRB 1CQVA 2I46A 4KI0A 1TS5A 4IFDI 4IZ8A 3VYTA 2F0MA 1X3PA 2BE5C 1D6EC 5IT9L 3MFGA 3DM1A 2O2LD 1E2WA 3S1QB 3QOJA 3QOLA 3E6ZX 2AQ3B 4PNYA 1SYCA 1I4XA 1BXTA 5IODA 5CGKA 1STBA 1S5DD 5FLXE 4I65A 3T56B 1SDFA 3J80E 3GP7A 1RKNA 1JWMD 4QMGA 3QB3A 1FNUA 3I4MB 4RA8A 4QIWB 3DWAA 2YYZA 4TKOB 3KF8A 1STHA 4A3BB 4IUVA 5CV7A 3M3YB 1I6VC 3T16A 4XQJA 1HUMA 2JE6I 4Q0FA 1BNZA 1MI2A 3KLSA 2JEBI 1PDQA 1JCKB 1LTID 1D1KA 1FD7D 3QJYA 3E0JA 1JB3A 5ISRA 5KEEA 3I4NB 1TS4A 4O42A 1SNOA 2EOTA 2BDNA 4KKSA 4TQUS 4A3MB 2L0CA 1LT5D 1STAA 1D5XC 2LKVA 1HUNA 3W3AA 1D5ZC 2RDHA 2BOSA 3GV3A 1SEBD 2B2UA 1QNKA 5JVG3 2WKDA 1RTNA 4HR7B 5IIFA 2SNSA 1HA6A 1OXXK 5D3DA 3VR3A 1TU2B 4DU9A 3T13A 1ML0D 3DMUA 2A69D 2K5WA 5I2XA 1H9JA 1RJTA 2EE1A 5JEAJ 1A2TA 1ENFA 2A69C 3BDCA 1H9SA 1JC7A 2F0QA 1ENCA 3BVGA 3M85A 2B8GA 1EY6A 1SNPA 2K05A 3CRKC 2F0KA 1HA5A 1PLFA 3I8ZA 1KLGD 2MUYA 2KQ3A 1PTOC 3KBXA 4C3IB 1WTOA 3I72A 3FVQA 3SXHA 2G9DA 2A68D 3KLSX 4F8MA 1G6ZA 5IGEA 1H9KA 1PTOB 4HN7A 3SEBA 2O5IC 3MA2B 3A7AB 4RHSA 3NHHA 2RSNA 3BVMA 4XDXA 3NWSA 4KJNA 2KEDA 1Y8OB 2JXMB 4XYQA 5I2YA 1H9MA 2RQXA 5EKKA 1TIID 4Z9CB 3S9WA 1GHKA 3T51B 3JAME 1A15A 2F0HA 3HEJA 3ZYYX 5CV8A 1TS3A 2X69A 1LABA 4A3DB 3MWYW 1ZKOA 3E5SA 5A2QE 1O7YA 1GUGA 1BUVT 3OIPA 3NQIA 3ND8A 2PYKA 4KY5A 1ZXTA 2MHVA 2VUMB 1GUNA 1B3AA 1TWGB 3R93A 1WTRA 3S16B 1F77A 3K5LA 1I4GA 1SNQA 3ND9A 5ELBA 5CYUA 1HCZA 1LLRD 1EWHA 3OWEB 1AFPA 5FK9C 3IKJA 4XYOA 5FKAC 3GTOB 3D4WA 2WINB 4LK1C 1TWCB 4EQOA 1LT3D 2B2YC 1PFMA 2Q8RE 5JEAG 3SR1A 1B1ZA 5IGCA 3K5MA 3L3OC 3EROA 2ZT9C 1EWCA 1EY5A 3D4DA 3IAYA 1F9PA 5E1FA 3BG3A 4N9PA 5C6AA 1KABA 1PFBA 3HP3A 2XRQD 5EPJA 2IX0A 4MN3A 4ZKCB 1U4RA 2ICIA 3M7GA 2IX3A 2NVQB 2JA6B 1G2SA 4KMUC 1JOOA 3HOXB 5M3FB 1RODA 4DGZA 4BBSB 3MXPA 3PMFA 1EEFD 3FPPA 4JBWA 3IFTA 2NN6H 2K33A 1CT1D 2QF7A 2NUCA 4K8IA 5BN3A 1D1IA 3OSOA 4HAEA 4Y7NB 4KTAA 3I4LA 1ESFA 4A3IB 4K2LA 3JAML 2E2JB 1B50A 1IYVA 3I3CA 3NP8A 2H1EA 1DZ1A 5G3LD 3K0YA 1IKLA 1Z6HA 1JORA 3H91A 1ONLA 4YIJA 3MXNA 1V43A 1ET9A 3J81E 4H44C 1A2UA 1NSNS 2FMCA 2XVSA 4FF2A 4A3KB 4CKBA 4O1NA 3C1FA 3H94A 2B2TA 3OOCA 4PV1C 4BWGB 4KN7C 3HOVB 2IWHA 1XTCD 5T1GA 1SXTA 1C8CA 2F0TA 1C4QA 1B4OA 4BA2I 1ZYRD 2IT1A 1DOKA 3K5OA 2F03A 2KEEA 1EZ8A 1QG7A 4BA1I 1G2TA 1LTGD 3V05A 1HFNA 1WTWA 3S15B 2JP1A 2A6HD 4K5VA 1PRTC 1S5ED 2NWGA 2OEOA 5M3MB 5I6WA 2HUGA 2D5DA 2CVRA 1ILPA 5JEAH 1UUPA 1I4HA 3PUWA 1PXUA 5KRUA 1B9MA 1F2YA 5I9PA 1Y1WB 2L1BA 4MIUA 1NR4A 1L0XB 1AZPA 2NTSA 4XXEA 2TMPA 4U68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FR3 A;  1K8M A;  2B8F A;  4H44 C;  3D4R A;  4GZY C;  3RLF A;  3T53 B;  1OXT A;  1OXX K;  2BE5 C;  1YNJ C;  4KHZ A;  1YNN C;  1PMR A;  1CI3 M;  3VR5 A;  1E2W A;  2NN6 I;  3ND9 A;  3VR3 A;  1TU2 B;  5C0X H;  4DNT B;  3WDN A;  3A8I E;  1Q90 A;  2O5J C;  1HCZ A;  2BE5 D;  2PCF B;  4H13 C;  1EWH A;  4DK1 A;  5KNB A;  3SE0 A;  2EDG A;  2A69 D;  1E2V A;  1G29 1;  2NN6 G;  3MXU A;  3H94 A;  1OXU A;  3IKJ A;  2JEA I;  1H9J A;  2L5T A;  1IW7 D;  1CFM A;  3OOC A;  1T5E A;  2A6H C;  5C0X G;  4PV1 C;  1O7L A;  4KN7 C;  4LK1 C;  3VR4 A;  5K36 G;  3T56 B;  2A69 C;  2R6G A;  1GHJ A;  1OXV A;  1H9S A;  2BA1 A;  3VR2 A;  3P20 A;  1Q12 A;  5JEA G;  3NE5 B;  2CW0 C;  4L8J A;  3OW7 A;  4G7O C;  3A8J E;  4KN4 C;  3M85 A;  3VA7 A;  2B8G A;  5KND A;  2IT1 A;  1VDZ A;  2Q8I B;  3CRK C;  4JBW A;  4BA2 I;  3PUZ A;  1IYU A;  3GQB A;  1HTP A;  5A35 A;  4BA1 I;  3CRL C;  2A6E C;  2D2C C;  1Z7T A;  3L7Z C;  1BDO A;  2ZT9 C;  1Y8P B;  3I72 A;  3A7L A;  2EJG C;  2YYZ A;  3BG3 A;  1A6X A;  4TKO B;  3BDO A;  3KLR A;  4KKT A;  1GUT A;  2A68 D;  2A6E D;  3FMC A;  4LJZ C;  3PUV A;  4XIG S;  1GUS A;  2A6H D;  1I6V C;  2AWO A;  3SDZ A;  3PUX A;  3VR6 A;  3LWU A;  2EJF C;  2E74 C;  3MFY A;  2JE6 I;  2LMC B;  1H9K A;  4OGQ C;  1Y69 U;  3HGB A;  4JK1 C;  2D62 A;  2EVB A;  4IFD H;  1OXS C;  4DK0 A;  4KMU C;  2JEB I;  2PPB C;  2O5I C;  3A7A B;  3OPO A;  2D5D A;  2DNC A;  2PNR C;  3U9S A;  1VCI A;  3QG1 A;  1VF5 C;  2DN8 A;  4IQZ A;  5BN4 A;  1DD2 A;  5JEA H;  3QJY A;  3FPP A;  2V4D A;  1HPC A;  2KA7 A;  3IFT A;  2NN6 H;  3A8K E;  2K33 A;  3DXJ C;  3N6R A;  4RCN A;  1DCZ A;  2QF7 A;  3PUW A;  1LAC A;  1Y8O B;  4IFD G;  4XTC S;  5K36 H;  5KNC A;  2DNE A;  2F1M A;  2JXM B;  3I73 A;  3M7N A;  1IW7 C;  1H9M A;  5BN3 A;  1B9M A;  1HQM C;  2AUJ D;  3GD7 A;  1Q1B A;  1GHK A;  1VF7 A;  2K32 A;  1H9R A;  4KKS A;  3T51 B;  5BN5 A;  2K7V A;  4TQU S;  3M4Y A;  3I4L A;  3D31 A;  1V8Q A;  3PUY A;  1LAB A;  1B9N A;  1H9S B;  1Q1E A;  1ZKO A;  3AB9 A;  4H0L C;  2BA0 A;  1Y8N B;  3PV0 A;  3TZU A;  4OO1 G;  4OO1 H;  1K8O A;  1ZYR C;  4G7H C;  2KCC A;  1IYV A;  1SMY C;  2AUK A;  3QIA A;  1DXM A;  3W3A A;  3LNN A;  1O78 A;  1GUG A;  1Z6H A;  2A68 C;  3EQL C;  4G7Z C;  1CTM A;  1V43 A;  1ONL A;  1GJX A;  2E75 C;  1E2Z A;  2E76 C;  3ND8 A;  1FYC A;  1QJO A;  4DNR B;  1TKW B;  4I7Z C;  4KI0 A;  2BDO A;  2EJM A;  1GUO A;  1GUN A;  4HR7 B;  4KKU A; 
#chains in the Genus database with same CATH topology
 2KJX A;  4CGY B;  5IGB A;  2B8F A;  1QVC A;  3T1H Q;  2QEX A;  1YNN C;  3PIO 3;  4A3J G;  2F0V A;  2RBM A;  1VQH A;  4K5W A;  1U5K A;  1KAW A;  1UE5 A;  3KBG A;  2O5J C;  2EYP A;  2K5Q A;  4RGN A;  4BY7 B;  4LFC Q;  1G29 1;  1VQ8 A;  2PZU A;  1K0S A;  4F88 A;  1VQ5 A;  2JEA I;  3GO5 A;  4WOR A;  2F52 A;  5FLM H;  4OWX B;  3VR4 A;  2D0P A;  4PMW A;  1CKN B;  5CV6 A;  1Q12 A;  4A3B H;  4JG2 A;  2G9H D;  4KN4 C;  1QUQ A;  3K57 A;  3LX0 A;  4HJ8 A;  4BXX G;  3J80 L;  3GTM H;  2CHB D;  3NEM A;  3PF5 A;  3A5U A;  2K4K A;  3NQT A;  4JC0 A;  4QL5 A;  4HCS A;  1GUT A;  3FMC A;  3P7J A;  4JI8 L;  2B2U C;  2F0U A;  4DV6 Q;  4GKJ L;  1J8I A;  4B08 A;  3VDY A;  1RDP D;  2I5M X;  1QZH A;  1EY0 A;  2F0W A;  2K5D A;  2JA6 H;  1B7Y B;  1EQT A;  3OWF A;  3SK5 A;  4GNX B;  2R3Z A;  2EY6 A;  3TN2 A;  1VQL A;  3S1Q H;  1GUW A;  1A0I A;  2FJ2 A;  1M1K C;  1BCP D;  1V1Q A;  2YU9 B;  5M5W B;  4OHJ A;  2GVB A;  4X64 Q;  3I73 A;  1A3V A;  3NWT A;  2IJ0 A;  4FNF A;  3V2T A;  4OIK A;  1VF7 A;  3MEF A;  1ICW A;  2JA5 H;  4L5S A;  3EFX D;  3PUY A;  1YHB A;  2NYZ D;  5M5Y B;  1OTC A;  2F0S A;  4UP7 A;  2R93 G;  4XQN A;  1D7Q A;  2VL6 A;  2E8G A;  2EIF A;  3GDE A;  5GAG C;  4G7Z C;  4U67 3;  1NJI C;  2B2V A;  4HSV A;  4I7Z C;  4NPS A;  2MNA A;  2F0P A;  5C3E G;  1X32 A;  1VMC A;  3HKZ G;  4EGV A;  3JAM c;  3K5N A;  4GZY C;  4UAI A;  4QIW E;  2XNA C;  4A3L G;  4J1M A;  2UXB Q;  1KQS A;  2TSS A;  2EYM A;  2F0E A;  2AQ2 B;  2PO4 A;  1WTQ A;  5C0X H;  1V1P B;  3RZD B;  1SYF A;  5ELF A;  1VQ6 A;  2Y0S G;  3DEP A;  3FKI G;  4OEM B;  1E2V A;  1Q82 C;  2B63 G;  4EQN A;  4BBR H;  5E3F A;  2H5X A;  4JV5 L;  4DAV A;  1EZ6 A;  2ICE C;  2X6G A;  2D9U A;  2OTJ A;  3CQZ B;  5AJ3 L;  1T9H A;  4XQQ A;  1FNV A;  3P1H A;  5JJI A;  2VY3 A;  4L8J A;  3UE0 A;  4N9T A;  1Q8K A;  3VA7 A;  2Q8I B;  3EJI A;  3CCS A;  1CKO A;  1JB7 A;  3U9O A;  1W6K A;  2K5H A;  3MHB A;  1WTP A;  4NDX A;  1Z7T A;  2HQE A;  5C44 B;  1W3S A;  3AYH B;  2ID0 A;  3K59 A;  1K9M C;  4DK6 C;  1X6O A;  1EIG A;  3A54 A;  1UE7 A;  1MKH A;  4HID A;  4LJZ C;  5AFW A;  4A3K G;  2WB1 E;  1PA6 A;  4DXG A;  3F2U A;  5EBD A;  4ZAI A;  1VQA A;  2KCN A;  2KHS A;  4OGQ C;  3HGB A;  1Q46 A;  1T5X D;  2L11 A;  2A73 B;  1PTO D;  2Y0S B;  3FKI B;  1N9W A;  5C44 H;  1XNQ Q;  2LFN A;  2DNC A;  3Q23 A;  3RZD H;  3GTQ B;  3TQY A;  5C3X A;  2CWP A;  5I9O A;  3S14 H;  3DXJ C;  1SRU A;  3GTJ B;  3KDF B;  5KGU A;  4R4T A;  1HTL D;  5C4J H;  3S1N H;  1TWH H;  3H15 A;  5NUC A;  2E2I B;  3F1Z A;  4UHV A;  1R9T B;  2QGQ A;  3M4Y A;  1NE3 A;  5BR8 Q;  3DWQ A;  1H9S B;  4CHT B;  5IGF A;  2F0I A;  4DV4 Q;  4OO1 H;  4JBM A;  4PZ8 A;  3Q6S A;  5LMN L;  4CKC A;  1RTO A;  3S17 B;  1GXD C;  1HNX L;  1VQ7 A;  3G7L A;  4KY7 A;  3HOW G;  3UI2 A;  2O4X A;  1SJE D;  5M5X B;  1VQC A;  2NZH A;  4R4I A;  1OO9 B;  2E76 C;  3EBE A;  2OF1 A;  2MO0 A;  5LMU Q;  1PFS A;  1QCB D;  4DV4 L;  4ABN A;  2YU9 H;  3D4R A;  3I90 A;  4DV1 L;  3QO2 A;  4ZKB B;  4RGM A;  4JI7 Q;  2QA4 A;  4CJ1 B;  1Q90 A;  3A55 A;  2JYO A;  5C0X J;  5HY6 A;  5JOB A;  4JI5 Q;  5C4Z A;  4KK7 A;  2Z6B A;  1HZA A;  2CFM A;  1ICF B;  1SE2 A;  3PCO B;  1CFM A;  3ULJ A;  1S40 A;  4UDU C;  1R9T H;  4L6T B;  3TSS A;  1PH4 A;  4K8J A;  2ZJP A;  4J8Q A;  4TVA B;  2EYJ A;  4G7O C;  2A19 A;  5ELO A;  5KND A;  1VDZ A;  4K6D A;  1B3Q A;  1AEX A;  3MZ5 A;  5I6Y A;  1IBL L;  1S3O A;  3GTM B;  4BS9 A;  1JR0 D;  2DJG C;  3HOW H;  4C3J B;  1BDO A;  4IUN A;  5DLQ E;  3CXC A;  3GTG H;  3I4N H;  2F4I A;  5JPN C;  5DAU A;  4DV7 L;  4APV A;  3H09 A;  3N52 A;  1RD9 D;  1NAP A;  5EQ0 A;  5C3W A;  1PH8 A;  4RH6 A;  5JJK A;  2Z6K A;  4FF1 A;  4DFA A;  3CHB D;  3LWU A;  2JA6 G;  1BOS A;  4DR7 Q;  2HDL A;  4JK1 C;  4HMJ A;  3U58 A;  2UXB L;  3LWE A;  1U4L A;  2PNR C;  5J39 A;  4V0B A;  4A93 G;  5BN4 A;  5M9O A;  1U9R A;  4HTH A;  2K6A A;  1F9S A;  1I3Q H;  1BF4 A;  4XTC S;  1Z47 A;  2AHO B;  2MQH A;  3NBI A;  4A4I A;  3Q0A A;  3J81 j;  3CW2 C;  2AUJ D;  1JT8 A;  1SMX A;  2K04 A;  4ZUI A;  1MIU A;  4K0K L;  4DAY A;  4KJO A;  1RL2 A;  3VA5 A;  2PNH A;  1XMO L;  3BU2 A;  2PZT A;  2BA0 A;  1EYG A;  2F0N A;  4G7H C;  5FJ8 G;  3GTQ H;  4R8N A;  3MTS A;  5IWA L;  1X9N A;  2B2W C;  4QCL A;  2WFW A;  1N34 L;  1EYA A;  1NTG A;  3LNN A;  4UY8 C;  5DNF A;  4DR4 Q;  1CKN A;  4C3H H;  1CTM A;  2E75 C;  3H0G G;  4GOP C;  4V19 0;  2Q2H A;  1GUO A;  4JYA Q;  4KKU A;  2UUA Q;  3TP8 A;  5ELE A;  3TP6 A;  3H3V H;  3K6O A;  2Z8L A;  5IGG A;  5CMD A;  4JOI A;  4JCV E;  5HGT A;  2CW0 D;  4PZ7 A;  3F2C A;  1VQK A;  2NN6 G;  2LY7 A;  1F2M A;  1VQB A;  2H4O A;  1IW7 D;  1T5E A;  4P73 A;  3C3L A;  4B3S L;  3J7Y W;  1KDC A;  4EX5 A;  3FRP B;  1I3Q B;  2OWO A;  3PO3 H;  1YIJ A;  3M4O B;  3A8J E;  3S16 H;  3CPF A;  1HTP A;  4DR3 L;  4Q5V A;  4JI8 Q;  5LMN Q;  1N8R C;  2RHS B;  1IXR A;  2F0O A;  1L1O B;  4DV0 Q;  1MGS A;  1CK1 A;  1UE1 A;  2C5C A;  1PH1 A;  3PO3 G;  1VQD A;  5IP7 G;  3GTL B;  2JQO A;  4YWL A;  2IW3 A;  3RZO B;  5JJL A;  5DM7 3;  1E0B A;  1RHP A;  1PRT D;  3CP0 A;  1CA6 A;  4NP5 A;  2XWJ B;  1O7Z A;  1EU4 A;  2UU9 Q;  1TWF B;  1WD1 A;  2AWO A;  2SNM A;  1DON A;  2LMC B;  4WRD A;  4IFD H;  3HKZ B;  1HHV A;  3NUC A;  2VQE L;  3K7A H;  3FDT A;  3OPO A;  4N8F A;  3TZD A;  2QIL A;  3HG9 A;  5C3E H;  3M4Q A;  4HJ5 A;  1BBX C;  3IFD A;  4LFC L;  1HNZ Q;  1ENA A;  4QUF A;  2DNE A;  4OWW B;  2Y0S E;  4IAL A;  1WD0 A;  1WVL A;  2NVX H;  5ELN A;  4X62 L;  1A62 A;  5M5W H;  1SYE A;  1L2F A;  3ITP A;  2K7V A;  3L9A X;  3VYU A;  5C4X H;  1V8Q A;  1SJH D;  3QWN A;  1F9Q A;  4JBK A;  3ER0 A;  1WFQ A;  1XNR L;  3MVV A;  5EPL A;  2WAQ E;  2EYF A;  4NMZ A;  4C1N I;  2G5D A;  4PQX A;  3ERS X;  4GN4 B;  3HOU B;  4H7B A;  1UAP A;  5C4X G;  1FNW A;  4CJ2 C;  2E2D C;  3HOX G;  2K50 A;  3TP7 A;  4R4O A;  3HOZ H;  1MBY A;  2HCI A;  1YI2 A;  1SYG A;  1KRS A;  2NBF A;  1ET6 A;  4R8I A;  3D8G A;  2VQE Q;  4IPH A;  3PO2 G;  2UXD L;  1BQQ T;  3WDN A;  5COR A;  4DK1 A;  2ZXO A;  1W2B A;  3KF6 A;  5COY A;  3CF5 A;  1GOZ A;  2E2J H;  4IJL A;  5LL6 X;  5CR3 A;  5EKL A;  2WII B;  3A0J A;  3HZX A;  3KF8 B;  1K0R A;  2DGY A;  3RUZ A;  1J5E Q;  2JK8 A;  5JPM C;  5FJ8 H;  1N33 Q;  1NNX A;  2RVL A;  4PZ6 A;  4ZUJ A;  3CCM A;  5BR8 L;  1U4P A;  2HCC A;  4OL7 A;  3PIP A;  3FKI H;  3H0G H;  4F7X A;  4DV3 L;  3BZD B;  5CV9 A;  4BBS H;  2KCM A;  2Z4I A;  2N8N A;  3MXN B;  4GNX C;  3J81 c;  4DV5 L;  5IYD G;  3J80 c;  1EOT A;  3HKZ E;  3W1B A;  3SK8 A;  2VQF Q;  1M8A A;  4FXD A;  3KLR A;  4L5R C;  5LHY 1;  2RDG A;  1MSH A;  1TWC H;  2WKC A;  2E2I H;  1EIF A;  4X64 L;  1GUS A;  3S1N B;  2N88 A;  1E7Z A;  2LXJ A;  5IYB G;  5EBC A;  4FF3 A;  3TRE A;  2R7Z H;  3L2P A;  3U9S A;  1Q3L A;  3QG1 A;  1VF5 C;  4NKL A;  4ULL A;  3KLW A;  4QGU A;  2JA5 G;  3J7A 5;  3TS2 A;  1DCZ A;  2UUC L;  3U4Z A;  1FGB D;  3HRZ C;  3M7N A;  1QB5 D;  4YWM A;  3UDG A;  3JC6 6;  1CM9 A;  2K32 A;  2R61 A;  1QIL A;  5FO9 B;  1Q1E A;  2ZM6 L;  4J6H A;  2WV6 D;  1SE4 A;  5IGD A;  3RN5 A;  2IX1 A;  1I50 B;  4ODG A;  1SNC A;  2CQA A;  3OMG A;  2A5H A;  1EY4 A;  2EY2 A;  3Q24 A;  4C3H G;  4GOP A;  3S2D B;  2UXD Q;  1E2Z A;  4BY7 G;  4FYD A;  1KDA A;  1UE6 A;  1TS2 A;  5IP9 G;  1K8M A;  2B2T C;  1OXT A;  4RKB A;  1YNJ C;  1D5M C;  2RCF A;  2ZTE A;  3NTH A;  4CDF C;  4AYB B;  3UDI A;  4RGT A;  1PTO F;  3PIO A;  3E3X A;  3Q22 A;  1NUC A;  3T1H L;  3NSW A;  3MXU A;  1Y1V B;  3FPU B;  1PYS B;  4GS3 A;  3GTG B;  4E6I A;  2JA8 G;  1TY0 A;  2J0T D;  3RLO A;  1DOL A;  1PYW D;  4ZRZ A;  3HKS A;  3NE5 B;  2UUB Q;  3SVM A;  1CZW A;  2LS0 1;  1I94 Q;  3M4O H;  1UNS A;  2ZXP A;  4OX9 Q;  2R93 B;  4A3K H;  3CRL C;  3JAM i;  4B3R L;  4X3T A;  1Y8P B;  5M5X H;  1ASZ A;  1IKM A;  2ATW A;  1JE4 A;  2K28 A;  2VW9 A;  1DJR D;  4XIG S;  1CA5 A;  3BZC A;  3J7A V;  2HHH Q;  2ZTC A;  4RHR A;  3TDQ A;  1CKM A;  3D3R A;  1SYB A;  3RLN A;  2I07 B;  4X6A H;  1IHZ A;  1I4P A;  2F0J A;  3ERQ A;  1SSO A;  1JOQ A;  1X3E A;  2E5L L;  3F8T A;  4RCN A;  2KA7 A;  3E0E A;  3DHQ A;  3I4O A;  4C3H B;  5JJZ A;  3S2H B;  1LAC A;  2NVY B;  5KNC A;  3BDL A;  1JQY D;  4FDB A;  3MC0 B;  1AW7 A;  4DK3 C;  1TT2 A;  4A3I G;  5BN5 A;  1HNX Q;  4HJA A;  5IYC H;  1KLU D;  1QWY A;  1DM0 B;  3PV0 A;  1Y8N B;  2K5V A;  2YTV A;  1TWA B;  2B29 A;  1ZYR C;  1RF2 D;  3J7A F;  3DWP A;  4A3G H;  1VQG A;  3DLL A;  1VQJ A;  2Q8T A;  1FGU A;  1W6J A;  1IBK L;  2LSS A;  5C4J B;  1YZ6 A;  5JAV A;  3WOE A;  5IYB H;  1GJX A;  1FYC A;  2R92 G;  3R2I A;  4RAU C;  2F3W A;  3CMA A;  2QCP X;  4OO1 I;  3SHL A;  1EQR A;  1PMR A;  4LUZ A;  2MFI A;  2N78 A;  3A8I E;  4RG1 A;  4FO2 A;  5ELD A;  5J22 A;  3VYR A;  1IL8 A;  4A3E H;  1BBW A;  5C0X G;  2A6H C;  1EY9 A;  2R6G A;  1EOV A;  4M1U B;  1GKH A;  2RSO A;  1DOM A;  1EFI D;  4RWS C;  3E9I A;  4LAA A;  5KYI A;  5H1S E;  4R9W A;  3HOU G;  1KAA A;  2M2L A;  4G4K A;  4P72 A;  2Z0S A;  2KEN A;  2UU9 L;  3K58 A;  1N32 L;  3G4S A;  2EJG C;  3S17 H;  4BBR B;  3BDO A;  3MXG A;  1S5B D;  2IL8 A;  1DGS A;  1NBW A;  1XX8 A;  2JA7 G;  4A93 B;  1KHI A;  3PUV A;  4OXP A;  2VUM H;  3G6E A;  3VR6 A;  5JVH 3;  2JSO A;  3CCL A;  2JA9 A;  4HMI A;  1K83 H;  5IT9 E;  1IBM Q;  1OXS C;  5DEH A;  4FXK C;  4JI6 L;  3W1G A;  2DN8 A;  3GTJ H;  3I4M H;  4MHE A;  4CJ0 B;  5I4D A;  3UDF A;  1E24 A;  2ENB A;  1KC8 C;  3CCE A;  4A3J B;  4X65 L;  3EA6 A;  3OIQ A;  1AH9 A;  3NTK A;  1SE8 A;  2NTT A;  4IUU A;  1N36 L;  4C56 C;  3HOW B;  1AP0 A;  3TP5 A;  1WOC A;  2QEJ C;  3BZK A;  5LL6 S;  1HQM C;  4OIJ A;  3HS0 C;  2MJ8 A;  4RFB A;  5K5P A;  3RN2 A;  2UXC Q;  4IN3 A;  1Y1W G;  4QQB X;  4JPB W;  4POG A;  1KNE A;  5D14 A;  4JI4 L;  2KOL A;  4IOA A;  1K28 A;  1XYI A;  4UP9 A;  4OWT B;  5C5L A;  2UUA L;  1XJV A;  5IE8 A;  1JWS D;  1SMY C;  3QIA A;  4JI1 L;  2R93 H;  1SAP A;  4O0A A;  1QVF A;  3UDX A;  4LF9 Q;  1XWE A;  1TVX A;  2P5Z X;  2QKI C;  1N36 Q;  1EL0 A;  2BDO A;  1I94 L;  2EPB A;  4DA2 A;  1I4R A;  2PW7 A;  4DV2 Q;  1U4M A;  2RDF A;  3GV6 A;  3T53 B;  1YJW A;  1XMO Q;  3HFZ B;  2I5H A;  4GLX A;  2HQL A;  1QNU A;  4A3F B;  2NN6 I;  4EVO A;  2PZW A;  2PCF B;  4LFA Q;  4A3G B;  1UEA B;  1BR9 A;  4A3F G;  4GOP B;  2EDG A;  2MPM A;  4S3S A;  4BY1 B;  2L5T A;  5A2Q L;  3M3Y H;  3HOY B;  3VR2 A;  3P20 A;  4FF4 A;  4A3C G;  4GN3 B;  4A3E G;  1MHW C;  3PUZ A;  2XRS D;  2YV5 A;  4XT3 B;  2R7Z B;  4IJH A;  1V9P A;  2AKW B;  2F3V A;  4X3S A;  2A6E C;  2XWB B;  1LTT D;  2JN4 A;  4ZYS A;  3S14 B;  1WTX A;  3NPP A;  4CDC C;  3PIP 3;  5C0X I;  4KKT A;  2B2W A;  1TY2 A;  1B44 D;  1VQF A;  4LW1 A;  2HDM A;  3MAQ A;  3GTP B;  3SDZ A;  1SE3 A;  2EJF C;  2E74 C;  4QY7 A;  1SYD A;  4GKK Q;  4ILW A;  1LTR D;  1VQE A;  1L1O C;  1WCM B;  1V1P A;  2F0D A;  1TR5 A;  3KJP A;  4R1J A;  3AFQ A;  3AEV A;  4A3G G;  1LT6 D;  2OXP A;  3J81 L;  2ZXR A;  4IQZ A;  4DR5 L;  1DD2 A;  4B9W A;  1RIP A;  4JI2 L;  3S24 A;  2OCE A;  5CBE E;  4LNQ A;  3CU7 A;  1MD2 D;  1YVC A;  1IW7 C;  3GD7 A;  4A3B G;  1X3G A;  4DN4 M;  1SMY D;  3P75 A;  1LO5 D;  3KUP A;  4IPD A;  2F0L A;  4A3M G;  1AZQ A;  1NMG A;  2BH8 A;  4P74 A;  1DYQ A;  1O80 A;  4OO1 G;  4H0L C;  3TZU A;  1J6Q A;  1B2T A;  5G3L F;  3NTI A;  1WI5 A;  1JWU D;  3MEH A;  1EIH A;  1E3P A;  5LMN W;  1DXM A;  4DV5 Q;  3G71 A;  4X3K A;  3S1M B;  4NXN L;  2GA4 B;  1JOK A;  1O78 A;  1EYC A;  1PRT F;  4NB3 A;  4QB4 A;  1HXY D;  2IPK D;  2R92 H;  2PQE A;  5EJW A;  2F4V L;  1RCV D;  1HFG A;  2MGS A;  4IUQ A;  4WFN 3;  1FR3 A;  5E4W C;  4X66 L;  2AWN A;  3AU7 A;  1KL9 A;  3RLF A;  4C2M B;  2RF4 A;  2SEB D;  1K73 C;  1STY A;  3FHW A;  2KEC A;  1F2L A;  2I5L X;  1S5C D;  4YCU A;  3S1R B;  1X56 A;  2VB2 X;  5KNB A;  1CUK A;  3SE0 A;  5EPK A;  2SOB A;  3K81 C;  1S5F D;  3QR8 A;  2F0G A;  4YY3 Q;  2JA7 H;  4QJF A;  1O7L A;  5CC4 A;  3HOZ B;  3I56 A;  3G48 A;  4A75 A;  5K36 G;  2A74 C;  5EGT A;  1HR0 Q;  1A3U A;  1KRT A;  4LUO A;  4MTK A;  3F2D A;  5CV4 A;  3GTK B;  2WAQ G;  2N55 A;  3OW7 A;  1YIT A;  2OT2 A;  4LMQ D;  1IZ6 A;  1I6H B;  5C4H A;  1KDB A;  1G51 A;  5A35 A;  3DM3 A;  5EKI A;  1KTK A;  3U4V A;  3DEO A;  1XMQ L;  2UUB L;  2ES2 A;  5CBA E;  5GAH C;  2L12 A;  5IYC G;  3I4N G;  2XSC A;  4IUR A;  1HZB A;  2XIW A;  4OEL B;  2KUM A;  4C3J H;  3H3V C;  5C5M A;  4BY7 H;  4DR5 Q;  1C9O A;  3PO2 B;  1JIC A;  2NVT H;  4DUZ L;  1K83 B;  4RKL A;  4X65 Q;  4GKK L;  4Y52 H;  2L4N A;  3GTK H;  2K03 A;  3BS1 A;  2PPB C;  5KYL A;  3W2D A;  3VYS A;  2I0Q A;  5J3B A;  1VCI A;  4IO9 A;  1QOH A;  1HNW L;  1X55 A;  2B63 H;  1QVG A;  4KHV A;  5K36 H;  2WB1 B;  2F1M A;  2NB0 A;  1NCV A;  3CPW A;  2VB3 X;  1X3Q A;  2Q2I A;  2Z9H A;  4PMC A;  4DR2 L;  1Q1B A;  1H9R A;  1V1O A;  3ONA B;  1FL0 A;  1B9N A;  3CCQ A;  1EQQ A;  3AB9 A;  1K8O A;  4C3I H;  1LM0 A;  1B70 B;  1S72 A;  2CQO A;  4LF5 Q;  2XN9 C;  2AUK A;  1K8G A;  4KHP L;  1VMP A;  1WTV A;  1BO0 A;  1AN8 A;  3NXW A;  2A68 C;  3EQL C;  4P2C B;  1STE A;  3K8A A;  4HED A;  2VNU D;  1PZI D;  4JI0 L;  2NVX B;  2K14 A;  3EVQ A;  5ELC A;  1YHA A;  3IL8 A;  4CDD C;  1S4Z A;  4CDE C;  3BVZ A;  4LFB Q;  2NVQ H;  4O2D A;  3I7F A;  4QF4 A;  4PMB A;  3B6Y A;  3NK9 A;  3K7A B;  1STN A;  2BE5 D;  4PG3 A;  1XMQ Q;  1XPU A;  4DUZ Q;  4LF8 L;  3DUZ A;  4TSS A;  5IOC A;  4KV6 A;  2Z1C A;  1LV9 A;  2IHF A;  2L15 A;  1Y14 B;  4LUV A;  1HR0 L;  1OXV A;  2BA1 A;  2QW7 A;  4DAY B;  4L63 B;  4C2M H;  5FO8 B;  3OTO Q;  4RGO S;  2EXD A;  4A3D G;  2K52 A;  4YY3 L;  1I6H H;  1YEZ A;  4IUP A;  2CKZ B;  1IYU A;  3PF4 A;  4ME3 A;  1PZK D;  2QDB A;  2J4X A;  3GQB A;  2EYL A;  3C2P A;  4L5Q A;  3TME A;  2D2C C;  2NVY H;  1N34 Q;  1IL2 A;  1Y1V G;  3T4A C;  2SDF A;  3WOF A;  4ZK9 B;  1X54 A;  1A6X A;  2RA4 A;  2HIV A;  1NR2 A;  1M4V A;  2A6E D;  1LTB D;  3KFU A;  4RCO A;  2HD3 A;  3MFY A;  4Y7N H;  2PW5 A;  2EYH A;  4IPC A;  2E5L Q;  3SK6 A;  1CHP D;  3CCU A;  1EY8 A;  5C3E B;  1PHJ A;  2EYO A;  4DUY Q;  4DXF A;  3NBH A;  3H0G B;  3RMH A;  3U50 C;  2V4D A;  1HPC A;  4B9X A;  4AQY Q;  4BY1 H;  1PH6 A;  1SBB B;  1KD1 C;  4P75 A;  1ESR A;  3T1Y Q;  2EZV A;  2RCN A;  3H3V I;  4POF A;  4A3F H;  4NXN Q;  1LTL A;  1STG A;  2NVT B;  1JE5 A;  1BCP B;  3D31 A;  4B3T L;  4R4C A;  5IYD H;  1EYD A;  2KCT A;  4HJ9 A;  4C3J G;  3X3M A;  4G57 A;  3I4M G;  4A3L H;  2KCC A;  3EN2 A;  1YNJ D;  2OTL A;  4DAM A;  3BYT B;  2B63 B;  2Q2T A;  4ZLT F;  5D3I B;  1QJO A;  1Q81 C;  1EQV A;  4IUT A;  1BCP C;  5FO7 B;  2Q2U A;  1KIX A;  1HRJ A;  3HOZ G;  1XXG A;  2K5N A;  4KHZ A;  5TSS A;  1JJC B;  1KNA A;  5FLX L;  3CD6 A;  1TQO A;  4BXX H;  2JA5 B;  1CI3 M;  1O7I A;  5CV5 A;  3V96 A;  3I2Z A;  2R7F A;  3H6M A;  2CCZ A;  4BBS G;  2X6L A;  1Q8I A;  4XT1 B;  1SRO A;  2E2H B;  3R2T A;  4H13 C;  1CZG A;  2JA7 B;  2RKS A;  3R3O A;  3NBH B;  3HOU H;  2FMM A;  3S1R H;  1Y1V H;  5FLM G;  3OHX C;  1EU3 A;  1TWH B;  3AMU A;  1GHJ A;  3CC7 A;  1B53 A;  4DV1 Q;  4DV0 L;  4JI3 L;  4A3I H;  5J1Z A;  4FP5 D;  2PMZ B;  2VXW A;  4BBR G;  1E22 A;  2KHJ A;  4K6L A;  3J80 i;  5C4X B;  1SNM A;  5KIX A;  4YCW A;  1WJJ A;  2WAQ B;  4WJ4 A;  5FLX c;  3D6W A;  2E2H H;  4DAP A;  3NEL A;  1VQN A;  1EFW A;  2J7Z A;  1LTA D;  2NZO A;  4QUC A;  2BCO A;  4YHH Q;  2EQS A;  2WP8 J;  1C0A A;  3RR5 A;  4WJ3 M;  4HCE A;  1ILQ A;  2MP1 A;  1TWF H;  3CC4 A;  3PUX A;  2DY8 A;  3FEW X;  2KHI A;  4KD4 A;  4TRD A;  2FHT A;  1HZ9 A;  1Y69 U;  2L9H A;  1SFO B;  2D62 A;  4CBV A;  2GN5 A;  2B2Y A;  4DK0 A;  2K75 A;  3X3N A;  1YNN D;  4M8A A;  3O13 A;  2VUM G;  5IP7 H;  2YTX A;  2KVM A;  3KF6 B;  1A3T A;  4L5T A;  1BCP F;  4NW2 A;  3N6R A;  4ME5 A;  3URY A;  2V1C C;  2DJF C;  2M00 A;  4CKE A;  3CKI B;  3C1E A;  4HSP A;  2R92 B;  3CAM A;  3R8B A;  2EY1 A;  1C48 A;  1F9R A;  2EXZ A;  3PO3 B;  4ID6 A;  4C3I G;  4K5X A;  4HIM A;  4JI0 Q;  5D65 A;  1K8A C;  4DV3 Q;  1ZEQ X;  1CQF A;  4JI6 Q;  1PFN A;  4C1N K;  4AIM A;  2R7D A;  1VQO A;  3TEH B;  1TKW B;  1G91 A;  4A3J H;  2EJM A;  4LF5 L;  1PH9 A;  4DV6 L;  4GKJ Q;  1J5E L;  3D6C A;  2K1B A;  5M3M G;  5EAY A;  1X65 A;  1SND A;  1I4Q A;  2C9O A;  2F0F A;  3E9H A;  3K7U C;  3VR5 A;  4ZCK A;  2CH4 A;  2F3I A;  4H02 A;  4DR2 Q;  4DNT B;  5M5Y H;  1IBM L;  1JMC A;  1LTS D;  2LXK A;  3TS0 A;  3TBI B;  5T1I A;  1TXY A;  1OXU A;  4HIK A;  2WAC A;  1EEI D;  1L0Y B;  2D0O A;  2B39 A;  3KDF A;  3KOJ A;  1HR0 W;  4KD3 A;  1GO3 E;  2CW0 C;  4X3U A;  4IFD J;  3A56 A;  1PVO A;  1HJP A;  1AE2 A;  2EY5 A;  2PI2 A;  1D2B A;  3CCV A;  5HUR A;  2HT1 A;  3L7Z C;  2PI2 E;  3A7L A;  3RD4 A;  3BYY B;  1QE6 A;  4A3E B;  4F87 A;  1YBY A;  3C46 A;  3PSI A;  4LF6 L;  2CWA A;  2L55 A;  3I70 A;  4X62 Q;  3HOY G;  4LF7 Q;  3I91 A;  1PTO H;  4A76 A;  1D8L A;  3J81 i;  2B2V C;  2MO1 A;  4R4Q A;  5E7N A;  1CHQ D;  4K14 A;  4AQY L;  4A3D H;  1VQ4 A;  1LT4 D;  2EVB A;  4AYB E;  3KK7 A;  5F2D A;  3OMC A;  2FFK B;  2FIN B;  1R4P B;  5FOB B;  3S2H H;  4X66 Q;  4DR1 Q;  1GD7 A;  5E4X A;  4K2K A;  3FP9 A;  4FVM A;  4EQP A;  4YHH L;  3RZO H;  4ZQ3 A;  3A8K E;  3SK4 A;  1R4Q B;  1UWV A;  1GVP A;  3IRB A;  4FXG C;  4IFD G;  1MSG A;  1PRT B;  1F2Z A;  2Z4H A;  2IY5 B;  1II3 A;  1VS0 A;  1BKB A;  2M9V A;  4WJW A;  2NZ1 D;  1EY7 A;  1J9O A;  2DY7 A;  1HQR D;  4KY6 A;  3ICE A;  4JVZ A;  5DM6 3;  5M3F H;  1PZJ D;  3HOX H;  2K01 A;  4DR3 Q;  2JA8 B;  2AQ1 B;  4DF7 A;  3G6J B;  1G8Z D;  1P8L A;  4DNR B;  2A1A A;  1CQV A;  5IT9 c;  3PO2 H;  2I46 A;  4KI0 A;  1TS5 A;  5M3F G;  4IFD I;  4IZ8 A;  2N3S A;  3VYT A;  2PQA B;  4JI3 Q;  2F0M A;  1X3P A;  2BE5 C;  1D6E C;  5IT9 L;  3MFG A;  3DM1 A;  2O2L D;  4JW0 A;  1E2W A;  3S1Q B;  3QOJ A;  3QOL A;  3E6Z X;  2AQ3 B;  3CCJ A;  4PNY A;  1SYC A;  2HHH L;  1I4X A;  1BXT A;  5IOD A;  5CGK A;  1SN8 A;  1STB A;  4JI2 Q;  3L0O A;  2QDL A;  1S5D D;  5FLX E;  4I65 A;  4LF6 Q;  4B3M Q;  3T56 B;  1PH7 A;  1XNR Q;  3LGJ A;  1SDF A;  3J7Z C;  4UP8 A;  3J80 E;  4K0K Q;  4MTN A;  3GP7 A;  1RKN A;  2YTY A;  4B3T Q;  4DR4 L;  3A74 A;  1JWM D;  4QMG A;  3QB3 A;  3KYH C;  4KHP Q;  1FNU A;  4KLK A;  3I4M B;  4RA8 A;  3S2D H;  4QIW B;  3DWA A;  2YYZ A;  4TKO B;  2JA8 H;  3KF8 A;  1STH A;  4A3B B;  3F2B A;  4IUV A;  5CV7 A;  3M3Y B;  4DUY L;  1SLJ A;  3PQI A;  1I6V C;  1SR3 A;  3OYY A;  3T16 A;  4XQJ A;  1XPO A;  1HUM A;  2JE6 I;  4Q0F A;  1YJ9 A;  1BNZ A;  1MI2 A;  1CSP A;  3KLS A;  3KJO A;  3T1Y L;  2JEB I;  4A3M H;  1PDQ A;  5HGQ A;  1JCK B;  3AFP A;  1LTI D;  1D1K A;  1MJE A;  1B8A A;  1FD7 D;  1WCM G;  2KBN A;  3QJY A;  3E0J A;  1JB3 A;  5ISR A;  1EIY B;  5KEE A;  3I4N B;  1TS4 A;  1IBL Q;  4LFA L;  4O42 A;  1SNO A;  3CQZ H;  2EOT A;  1U0L A;  2BDN A;  4LF4 L;  2VS1 A;  4KKS A;  4TQU S;  4A3M B;  1I5F A;  1P16 A;  4B3M L;  2ZTD A;  2L0C A;  2ZJQ A;  1TWA H;  3STB C;  1LT5 D;  2ALY B;  4UPA A;  5GRO A;  1STA A;  1D5X C;  2LKV A;  1HUN A;  3W3A A;  1D5Z C;  2RDH A;  1PH2 A;  2BOS A;  3AQQ A;  3GV3 A;  1SEB D;  1QUQ B;  1QNK A;  2B2U A;  5JVG 3;  2WKD A;  1RTN A;  2UUC Q;  4HR7 B;  4P71 A;  5IIF A;  4A3C H;  5L37 A;  2SNS A;  1HA6 A;  4GLA C;  1OXX K;  4LFB L;  2VQF L;  1WTH A;  1E1T A;  5D3D A;  3VR3 A;  1TU2 B;  4DU9 A;  3T13 A;  3K80 C;  2XTI A;  4JYA L;  1ML0 D;  3DMU A;  2A69 D;  1FVI A;  2K5W A;  4YCV A;  5I2X A;  1H9J A;  1RJT A;  2EE1 A;  5JEA J;  1A2T A;  1ENF A;  4A93 H;  2A69 C;  5LMU L;  2BH2 A;  3BDC A;  2DUD A;  4HIO A;  1H9S A;  1N33 L;  1N32 Q;  1JC7 A;  2F0Q A;  1ENC A;  3BVG A;  3M85 A;  1VQP A;  2B8G A;  1CSQ A;  1EY6 A;  1SNP A;  4EQ5 A;  2K05 A;  3CRK C;  1FJG Q;  2F0K A;  1HA5 A;  1PLF A;  3I8Z A;  1KLG D;  1EWI A;  2MUY A;  2KQ3 A;  1JJ2 A;  1PTO C;  3KBX A;  4C3I B;  4DR1 L;  3UE1 A;  1WTO A;  1Z9F A;  3I72 A;  3FVQ A;  1HNW Q;  3SXH A;  4LWC A;  2G9D A;  1Q7Y C;  3W5O A;  2A68 D;  3KLS X;  1ASY A;  4F8M A;  1G6Z A;  4LF7 L;  5IGE A;  1H9K A;  4BY1 G;  4DR7 L;  1HH2 P;  1VQI A;  1PTO B;  4HN7 A;  3SEB A;  4AYB G;  2O5I C;  4DKA C;  3MA2 B;  3A7A B;  4RHS A;  3NHH A;  4DR6 Q;  3ULL A;  2RSN A;  3BVM A;  4XDX A;  3NWS A;  2VZA A;  4KJN A;  2KED A;  1UEB A;  1Y8O B;  3EIV A;  2JXM B;  2ASB A;  1XPR A;  4XYQ A;  5I2Y A;  1EUJ A;  1H9M A;  2RQX A;  5EKK A;  1TII D;  1IBK Q;  4Z9C B;  3S9W A;  1GHK A;  3T51 B;  3JAM E;  1A15 A;  2F0H A;  3HEJ A;  5AJ3 Q;  3ZYY X;  3CC2 A;  4GLV B;  1TS3 A;  5CV8 A;  1HNZ L;  5GQO A;  2X69 A;  1LAB A;  4A3D B;  3MWY W;  1ZKO A;  3E5S A;  3NEN A;  4JV5 Q;  5A2Q E;  4DR6 L;  5IY0 A;  1JJG A;  1MJC A;  4RMF A;  2C35 B;  1O7Y A;  1GUG A;  1BUV T;  1XTD A;  1C7Y A;  3OIP A;  3NQI A;  3ND8 A;  2PYK A;  4KY5 A;  2XGT A;  1ZXT A;  2MHV A;  4J15 A;  2VUM B;  1GUN A;  1B3A A;  1TWG B;  3R93 A;  1WTR A;  3S16 B;  1F77 A;  4DPG A;  1I4G A;  3K5L A;  1Q86 C;  4JI7 L;  1AE3 A;  1SFO H;  1PYB A;  3STB D;  1E1O A;  1SNQ A;  3ND9 A;  5ELB A;  5CYU A;  1HCZ A;  2N49 A;  1LLR D;  1EWH A;  3OWE B;  1I50 H;  5GAE C;  1AFP A;  1L1O A;  1FJG L;  5FK9 C;  3IKJ A;  4XYO A;  5FKA C;  4OON A;  3GTO B;  3D4W A;  1TWG H;  2WIN B;  4LK1 C;  1TWC B;  3S15 H;  4EQO A;  1LT3 D;  4B3R Q;  2B2Y C;  1PFM A;  2Q8R E;  3SR1 A;  5JEA G;  1G6P A;  1LUZ A;  4LF9 L;  1H95 A;  1B1Z A;  5IGC A;  3K5M A;  1NMF A;  3L3O C;  2PMZ E;  4JI1 Q;  1VQM A;  1WCM H;  1K3R A;  3ERO A;  2ZT9 C;  1EWC A;  3ZJY C;  1EY5 A;  2ZJR A;  3D4D A;  3IAY A;  1F9P A;  4JI4 Q;  5E1F A;  3BG3 A;  4N9P A;  5C6A A;  1KAB A;  1PFB A;  4B3S Q;  2GVA A;  3HP3 A;  2XRQ D;  4OX9 L;  2A8V A;  5EPJ A;  1L0W A;  1XNQ L;  2IX0 A;  2AMC B;  2JJQ A;  4MN3 A;  4ZKC B;  2FXQ A;  4LF8 Q;  1U4R A;  2ICI A;  3M7G A;  2IX3 A;  2NVQ B;  3CME A;  2JA6 B;  1G2S A;  4KMU C;  1JOO A;  3HOX B;  5IWA Q;  5M3F B;  1ROD A;  4DGZ A;  4BBS B;  3Q8D A;  3MXP A;  3PMF A;  1EEF D;  1QZG A;  4JBW A;  3FPP A;  3IFT A;  3RNU A;  2NN6 H;  2K33 A;  1CT1 D;  2QF7 A;  3M4P A;  4JBJ A;  2NUC A;  4K8I A;  5BN3 A;  1D1I A;  3ULP A;  3M9B A;  3OSO A;  3CCR A;  4HAE A;  3HOV H;  4Y7N B;  4I7A A;  2OQK A;  4KTA A;  3I4L A;  1ESF A;  2ZM6 Q;  4GN5 A;  4A3I B;  4MNO A;  4K2L A;  3JAM L;  4IOC A;  1PH3 A;  2E2J B;  1B50 A;  1IYV A;  3I3C A;  2R7Z G;  3NP8 A;  2H1E A;  1DZ1 A;  5G3L D;  3I55 A;  3GTL H;  3K0Y A;  1IKL A;  1Z6H A;  1JOR A;  3H91 A;  1KXL A;  1ONL A;  3K0X A;  4YIJ A;  4JOI C;  3A5Z B;  3MXN A;  1A8V A;  1V43 A;  1ET9 A;  3HOY H;  3J81 E;  4H44 C;  1A2U A;  1NSN S;  1WYD A;  2FMC A;  3D0F A;  4DV7 Q;  2XVS A;  3WWV A;  1HZC A;  3PGZ A;  4FF2 A;  4A3K B;  4CKB A;  1NY4 A;  4O1N A;  3C1F A;  3H94 A;  2B2T A;  3OOC A;  4PV1 C;  4BWG B;  4HJ7 A;  2IHE A;  4KN7 C;  3HOV B;  1M90 C;  1YJN A;  2IWH A;  1XTC D;  5T1G A;  1SXT A;  3TRZ A;  4DNI A;  5GAD C;  1Y1W H;  1C8C A;  2F0T A;  4DV2 L;  5IP9 H;  1C4Q A;  2CH4 W;  1B4O A;  4BA2 I;  1ZYR D;  2IT1 A;  5C44 G;  1DOK A;  3K5O A;  2F03 A;  2KEE A;  1EZ8 A;  1IYJ B;  2PQA A;  1QG7 A;  4BA1 I;  1G2T A;  1LTG D;  1VQ9 A;  3S1M H;  3V05 A;  1HFN A;  1BBU A;  1WTW A;  3S15 B;  2HIX A;  1A63 A;  2JP1 A;  2A6H D;  3GTO H;  4K5V A;  2UXC L;  4JI5 L;  3BJU A;  1PRT C;  3SGI A;  1S5E D;  2NWG A;  4LF4 Q;  2OEO A;  2Z6K C;  4NXM Q;  4IPG A;  5M3M B;  5I6W A;  1GM5 A;  1YNX A;  2HUG A;  1PH5 A;  2D5D A;  1X3F A;  2CVR A;  1ILP A;  5JEA H;  4NXM L;  1UUP A;  1I4H A;  3PUW A;  1PXU A;  3GTP H;  1PV4 A;  2F4V Q;  1BVS A;  5KRU A;  1B9M A;  1F2Y A;  1LYL A;  3OTO L;  2OQ0 A;  5I9P A;  5M3M H;  4GNX A;  1Y1W B;  3OW2 A;  2L1B A;  4MIU A;  4ALP A;  1K3B C;  1NR4 A;  1L0X B;  3HOV G;  4N8X 1;  2WB1 G;  1YHQ A;  4YWK A;  1AZP A;  4AH6 A;  4MZ9 A;  2RHQ B;  2B3G A;  2NTS A;  4XXE A;  2TMP A;  4U68 A; 
#chains in the Genus database with same CATH homology
 2KJX A;  4CGY B;  5IGB A;  2B8F A;  1YNN C;  3PIO 3;  2F0V A;  2RBM A;  4K5W A;  3KBG A;  2O5J C;  2EYP A;  2K5Q A;  4RGN A;  4BY7 B;  1G29 1;  2PZU A;  4F88 A;  2JEA I;  3GO5 A;  4WOR A;  3VR4 A;  4PMW A;  5CV6 A;  1Q12 A;  2G9H D;  4KN4 C;  3K57 A;  3LX0 A;  3J80 L;  2CHB D;  3NQT A;  4HCS A;  1GUT A;  3FMC A;  3P7J A;  2B2U C;  2F0U A;  1J8I A;  4B08 A;  1RDP D;  1EY0 A;  2F0W A;  2K5D A;  1EQT A;  3OWF A;  3SK5 A;  2R3Z A;  2EY6 A;  3TN2 A;  1GUW A;  2FJ2 A;  1BCP D;  2YU9 B;  5M5W B;  4OHJ A;  3I73 A;  1A3V A;  3NWT A;  2IJ0 A;  4FNF A;  3V2T A;  4OIK A;  1VF7 A;  1ICW A;  3EFX D;  3PUY A;  2NYZ D;  5M5Y B;  2F0S A;  4XQN A;  4G7Z C;  4U67 3;  2B2V A;  4HSV A;  4I7Z C;  2F0P A;  1X32 A;  1VMC A;  4EGV A;  3K5N A;  4GZY C;  4UAI A;  2XNA C;  4J1M A;  2TSS A;  1WTQ A;  2EYM A;  2F0E A;  2AQ2 B;  2PO4 A;  5C0X H;  1V1P B;  3RZD B;  1SYF A;  5ELF A;  3DEP A;  1E2V A;  4EQN A;  5E3F A;  4DAV A;  1EZ6 A;  2ICE C;  2X6G A;  2D9U A;  3CQZ B;  4XQQ A;  1FNV A;  3P1H A;  4L8J A;  4N9T A;  3VA7 A;  2Q8I B;  3EJI A;  3U9O A;  1W6K A;  3MHB A;  1WTP A;  4NDX A;  1Z7T A;  2HQE A;  5C44 B;  2ID0 A;  3K59 A;  1EIG A;  3A54 A;  4LJZ C;  5AFW A;  4DXG A;  3F2U A;  5EBD A;  4ZAI A;  2KCN A;  2KHS A;  4OGQ C;  3HGB A;  1T5X D;  2L11 A;  2A73 B;  1PTO D;  2Y0S B;  3FKI B;  2LFN A;  2DNC A;  3Q23 A;  3GTQ B;  5C3X A;  5I9O A;  3DXJ C;  3GTJ B;  5KGU A;  1HTL D;  5NUC A;  2E2I B;  1R9T B;  3M4Y A;  3DWQ A;  1H9S B;  4CHT B;  5IGF A;  2F0I A;  4OO1 H;  3Q6S A;  4CKC A;  1RTO A;  3S17 B;  1GXD C;  3G7L A;  4KY7 A;  3UI2 A;  2O4X A;  1SJE D;  5M5X B;  1OO9 B;  2E76 C;  2OF1 A;  1QCB D;  4ABN A;  3D4R A;  3I90 A;  3QO2 A;  4ZKB B;  4RGM A;  4CJ1 B;  1Q90 A;  3A55 A;  2JYO A;  5C0X J;  5JOB A;  5C4Z A;  4KK7 A;  1SE2 A;  1CFM A;  4UDU C;  4L6T B;  3TSS A;  4K8J A;  4J8Q A;  2EYJ A;  4G7O C;  5KND A;  1VDZ A;  4K6D A;  1AEX A;  3MZ5 A;  5I6Y A;  3GTM B;  4BS9 A;  1JR0 D;  4C3J B;  1BDO A;  4IUN A;  2F4I A;  5JPN C;  5DAU A;  3H09 A;  3N52 A;  1RD9 D;  1NAP A;  5EQ0 A;  5C3W A;  4RH6 A;  4FF1 A;  4DFA A;  3CHB D;  3LWU A;  1BOS A;  2HDL A;  4JK1 C;  4HMJ A;  3LWE A;  1U4L A;  2PNR C;  5J39 A;  4V0B A;  5BN4 A;  5M9O A;  1U9R A;  4HTH A;  2K6A A;  1F9S A;  1BF4 A;  4XTC S;  1Z47 A;  3NBI A;  3Q0A A;  2AUJ D;  2K04 A;  4ZUI A;  4DAY A;  4KJO A;  3VA5 A;  2PZT A;  2BA0 A;  2F0N A;  4G7H C;  4R8N A;  3MTS A;  2B2W C;  4QCL A;  1EYA A;  3LNN A;  5DNF A;  1CTM A;  2E75 C;  4V19 0;  1GUO A;  4KKU A;  3TP8 A;  5ELE A;  3TP6 A;  3K6O A;  2Z8L A;  5IGG A;  5CMD A;  5HGT A;  2CW0 D;  2NN6 G;  2LY7 A;  1F2M A;  2H4O A;  1IW7 D;  1T5E A;  3C3L A;  3J7Y W;  1KDC A;  3FRP B;  1I3Q B;  3M4O B;  3A8J E;  1HTP A;  4Q5V A;  2F0O A;  1MGS A;  1CK1 A;  2C5C A;  3GTL B;  2IW3 A;  3RZO B;  5DM7 3;  1E0B A;  1RHP A;  1PRT D;  1CA6 A;  4NP5 A;  2XWJ B;  1O7Z A;  1EU4 A;  1TWF B;  1WD1 A;  2AWO A;  2SNM A;  1DON A;  2LMC B;  4WRD A;  4IFD H;  3HKZ B;  1HHV A;  3NUC A;  3FDT A;  3OPO A;  3TZD A;  2QIL A;  3HG9 A;  1BBX C;  3IFD A;  1ENA A;  4QUF A;  2DNE A;  4IAL A;  1WD0 A;  1WVL A;  1SYE A;  3ITP A;  2K7V A;  3L9A X;  3VYU A;  1V8Q A;  1SJH D;  3QWN A;  1F9Q A;  3MVV A;  5EPL A;  2EYF A;  4NMZ A;  4C1N I;  4PQX A;  3HOU B;  4H7B A;  1UAP A;  1FNW A;  4CJ2 C;  2E2D C;  3TP7 A;  1MBY A;  2HCI A;  1SYG A;  2NBF A;  1ET6 A;  4R8I A;  3D8G A;  1BQQ T;  3WDN A;  5COR A;  4DK1 A;  2ZXO A;  5COY A;  1GOZ A;  5LL6 X;  5CR3 A;  5EKL A;  2WII B;  3HZX A;  3RUZ A;  5JPM C;  2RVL A;  4ZUJ A;  1U4P A;  2HCC A;  4OL7 A;  4F7X A;  3BZD B;  5CV9 A;  2Z4I A;  1EOT A;  3SK8 A;  1M8A A;  4FXD A;  3KLR A;  5LHY 1;  2RDG A;  1MSH A;  2WKC A;  1GUS A;  3S1N B;  2N88 A;  5EBC A;  4FF3 A;  3U9S A;  1Q3L A;  3QG1 A;  1VF5 C;  4NKL A;  4ULL A;  1DCZ A;  1FGB D;  3HRZ C;  3M7N A;  1QB5 D;  1CM9 A;  2K32 A;  2R61 A;  1QIL A;  5FO9 B;  1Q1E A;  4J6H A;  2WV6 D;  1SE4 A;  5IGD A;  2IX1 A;  1I50 B;  3OMG A;  1SNC A;  2CQA A;  4ODG A;  2A5H A;  1EY4 A;  2EY2 A;  3Q24 A;  4C3H G;  3S2D B;  1E2Z A;  4FYD A;  1KDA A;  1TS2 A;  1K8M A;  2B2T C;  1OXT A;  4RKB A;  1YNJ C;  1D5M C;  3NTH A;  4AYB B;  4RGT A;  1PTO F;  3Q22 A;  1NUC A;  3NSW A;  3MXU A;  1Y1V B;  3FPU B;  3GTG B;  4E6I A;  1TY0 A;  2J0T D;  1DOL A;  1PYW D;  4ZRZ A;  3NE5 B;  3SVM A;  1CZW A;  2LS0 1;  1UNS A;  2ZXP A;  2R93 B;  3CRL C;  4X3T A;  1Y8P B;  1IKM A;  1JE4 A;  2K28 A;  1DJR D;  4XIG S;  1CA5 A;  3J7A V;  4RHR A;  3TDQ A;  3D3R A;  1SYB A;  2I07 B;  1IHZ A;  1I4P A;  2F0J A;  3ERQ A;  1SSO A;  1JOQ A;  4RCN A;  2KA7 A;  3DHQ A;  4C3H B;  5JJZ A;  3S2H B;  1LAC A;  2NVY B;  5KNC A;  3BDL A;  1JQY D;  3MC0 B;  1AW7 A;  1TT2 A;  5BN5 A;  1KLU D;  1QWY A;  1DM0 B;  3PV0 A;  1Y8N B;  1TWA B;  3J7A F;  1ZYR C;  1RF2 D;  3DWP A;  2Q8T A;  1W6J A;  5C4J B;  5JAV A;  3WOE A;  1GJX A;  1FYC A;  3R2I A;  4RAU C;  2F3W A;  2QCP X;  4OO1 I;  3SHL A;  1PMR A;  3A8I E;  4FO2 A;  5ELD A;  5J22 A;  3VYR A;  1IL8 A;  5C0X G;  2A6H C;  1EY9 A;  2R6G A;  4M1U B;  2RSO A;  1DOM A;  1EFI D;  4RWS C;  5KYI A;  4LAA A;  4R9W A;  1KAA A;  2M2L A;  4G4K A;  3K58 A;  2EJG C;  4BBR B;  3BDO A;  3MXG A;  1S5B D;  2IL8 A;  1XX8 A;  4A93 B;  3PUV A;  3VR6 A;  5JVH 3;  2JSO A;  4HMI A;  5IT9 E;  1OXS C;  5DEH A;  4FXK C;  2DN8 A;  4MHE A;  4CJ0 B;  5I4D A;  2ENB A;  4A3J B;  3EA6 A;  3OIQ A;  3NTK A;  2NTT A;  4IUU A;  3HOW B;  4C56 C;  1AP0 A;  3TP5 A;  2QEJ C;  5LL6 S;  1HQM C;  3HS0 C;  4OIJ A;  2MJ8 A;  4RFB A;  5K5P A;  4IN3 A;  1KNE A;  5D14 A;  2KOL A;  1XYI A;  5C5L A;  1JWS D;  1SMY C;  3QIA A;  1SAP A;  1XWE A;  1TVX A;  2QKI C;  1EL0 A;  2BDO A;  2EPB A;  4DA2 A;  1I4R A;  2PW7 A;  1U4M A;  2RDF A;  3GV6 A;  3T53 B;  1QNU A;  4A3F B;  2NN6 I;  4EVO A;  2PZW A;  2PCF B;  4A3G B;  1UEA B;  1BR9 A;  2EDG A;  2MPM A;  4S3S A;  4BY1 B;  2L5T A;  5A2Q L;  3HOY B;  3VR2 A;  3P20 A;  4FF4 A;  3PUZ A;  2XRS D;  4XT3 B;  2R7Z B;  2F3V A;  4X3S A;  2A6E C;  2XWB B;  1LTT D;  4ZYS A;  3S14 B;  1WTX A;  3NPP A;  3PIP 3;  5C0X I;  4KKT A;  2B2W A;  1TY2 A;  1B44 D;  2HDM A;  3MAQ A;  3GTP B;  3SDZ A;  1SE3 A;  2EJF C;  2E74 C;  1SYD A;  4ILW A;  1LTR D;  1WCM B;  1V1P A;  2F0D A;  1TR5 A;  1LT6 D;  2OXP A;  3J81 L;  2ZXR A;  4IQZ A;  1DD2 A;  4B9W A;  5CBE E;  3CU7 A;  1MD2 D;  1IW7 C;  3GD7 A;  4DN4 M;  1SMY D;  3P75 A;  1LO5 D;  3KUP A;  2F0L A;  1AZQ A;  1DYQ A;  1O80 A;  4OO1 G;  4H0L C;  3TZU A;  1B2T A;  5G3L F;  3NTI A;  1JWU D;  3MEH A;  1EIH A;  1DXM A;  3S1M B;  4X3K A;  2GA4 B;  1JOK A;  1O78 A;  1EYC A;  1PRT F;  4QB4 A;  1HXY D;  2IPK D;  2PQE A;  5EJW A;  4WFN 3;  1RCV D;  1HFG A;  2MGS A;  4IUQ A;  1FR3 A;  5E4W C;  2AWN A;  3AU7 A;  3RLF A;  4C2M B;  2SEB D;  1STY A;  2KEC A;  1F2L A;  1S5C D;  3S1R B;  2VB2 X;  5KNB A;  3SE0 A;  5EPK A;  2SOB A;  1S5F D;  2F0G A;  1O7L A;  5CC4 A;  3HOZ B;  5K36 G;  2A74 C;  5EGT A;  1A3U A;  5CV4 A;  3GTK B;  2N55 A;  3OW7 A;  2OT2 A;  4LMQ D;  1I6H B;  5C4H A;  1KDB A;  5A35 A;  5EKI A;  1KTK A;  3DEO A;  5CBA E;  2L12 A;  2XSC A;  4IUR A;  3H3V C;  2XIW A;  2KUM A;  5C5M A;  3PO2 B;  1JIC A;  1K83 B;  4RKL A;  2L4N A;  2K03 A;  3BS1 A;  2PPB C;  5KYL A;  3W2D A;  3VYS A;  1VCI A;  1QOH A;  4KHV A;  5K36 H;  2WB1 B;  2F1M A;  2NB0 A;  1NCV A;  2VB3 X;  1X3Q A;  4PMC A;  1Q1B A;  1H9R A;  1V1O A;  3ONA B;  1B9N A;  3AB9 A;  1K8O A;  2XN9 C;  2AUK A;  1VMP A;  1WTV A;  1BO0 A;  1AN8 A;  3NXW A;  2A68 C;  3EQL C;  4P2C B;  1STE A;  4HED A;  2VNU D;  1PZI D;  2NVX B;  3EVQ A;  5ELC A;  3IL8 A;  1S4Z A;  3BVZ A;  4QF4 A;  4PMB A;  3NK9 A;  3K7A B;  1STN A;  2BE5 D;  3DUZ A;  4TSS A;  5IOC A;  4KV6 A;  2Z1C A;  1LV9 A;  1OXV A;  2BA1 A;  4L63 B;  5FO8 B;  4RGO S;  4IUP A;  1IYU A;  1PZK D;  2QDB A;  2J4X A;  3GQB A;  2EYL A;  3C2P A;  3TME A;  2D2C C;  3T4A C;  2SDF A;  3WOF A;  4ZK9 B;  1A6X A;  2RA4 A;  1NR2 A;  1M4V A;  2A6E D;  1LTB D;  4RCO A;  3MFY A;  2PW5 A;  2EYH A;  3SK6 A;  1CHP D;  1EY8 A;  5C3E B;  2EYO A;  4DXF A;  3NBH A;  3H0G B;  3RMH A;  2V4D A;  1HPC A;  4B9X A;  1SBB B;  1ESR A;  2EZV A;  1STG A;  2NVT B;  1BCP B;  3D31 A;  1EYD A;  4C3J G;  3X3M A;  4G57 A;  2KCC A;  1YNJ D;  3BYT B;  2B63 B;  4ZLT F;  5D3I B;  1QJO A;  1EQV A;  4IUT A;  1BCP C;  5FO7 B;  1HRJ A;  1XXG A;  4KHZ A;  5TSS A;  1KNA A;  2JA5 B;  5FLX L;  1TQO A;  1CI3 M;  5CV5 A;  3V96 A;  3H6M A;  2X6L A;  1Q8I A;  4XT1 B;  2E2H B;  3R2T A;  4H13 C;  1CZG A;  2JA7 B;  2RKS A;  3R3O A;  2FMM A;  3OHX C;  1EU3 A;  1TWH B;  3AMU A;  1GHJ A;  1B53 A;  5J1Z A;  4FP5 D;  2PMZ B;  2VXW A;  4K6L A;  5C4X B;  1SNM A;  5KIX A;  2WAQ B;  3D6W A;  4DAP A;  2J7Z A;  1LTA D;  4QUC A;  2BCO A;  2WP8 J;  4HCE A;  1ILQ A;  2MP1 A;  3PUX A;  2DY8 A;  3FEW X;  4KD4 A;  4TRD A;  2FHT A;  1Y69 U;  2L9H A;  1SFO B;  2D62 A;  4CBV A;  2B2Y A;  4DK0 A;  3X3N A;  1YNN D;  4M8A A;  3O13 A;  2KVM A;  1A3T A;  1BCP F;  3N6R A;  4NW2 A;  4ME5 A;  3URY A;  2M00 A;  4CKE A;  3CKI B;  3C1E A;  4HSP A;  2R92 B;  3R8B A;  2EY1 A;  1C48 A;  1F9R A;  2EXZ A;  3PO3 B;  4ID6 A;  4C3I G;  4K5X A;  5D65 A;  1ZEQ X;  1CQF A;  1PFN A;  4C1N K;  1TKW B;  1G91 A;  2EJM A;  3D6C A;  2K1B A;  1SND A;  1I4Q A;  2C9O A;  2F0F A;  3VR5 A;  4DNT B;  1LTS D;  3TBI B;  5T1I A;  1OXU A;  2WAC A;  1EEI D;  1L0Y B;  2B39 A;  4KD3 A;  2CW0 C;  4X3U A;  4IFD J;  3A56 A;  2EY5 A;  1D2B A;  5HUR A;  3L7Z C;  3A7L A;  3RD4 A;  3BYY B;  1QE6 A;  4A3E B;  4F87 A;  3C46 A;  2L55 A;  3I70 A;  3I91 A;  1PTO H;  2B2V C;  1CHQ D;  4K14 A;  1LT4 D;  2EVB A;  3KK7 A;  5F2D A;  3OMC A;  2FFK B;  2FIN B;  1R4P B;  5FOB B;  5E4X A;  4K2K A;  4FVM A;  4EQP A;  4ZQ3 A;  3A8K E;  3SK4 A;  1R4Q B;  4FXG C;  4IFD G;  1MSG A;  1PRT B;  1F2Z A;  2Z4H A;  1II3 A;  2M9V A;  4WJW A;  2NZ1 D;  1EY7 A;  1J9O A;  2DY7 A;  1HQR D;  4KY6 A;  5DM6 3;  1PZJ D;  2K01 A;  2JA8 B;  2AQ1 B;  4DF7 A;  3G6J B;  1G8Z D;  4DNR B;  1CQV A;  2I46 A;  4KI0 A;  1TS5 A;  4IFD I;  4IZ8 A;  3VYT A;  2F0M A;  1X3P A;  2BE5 C;  1D6E C;  5IT9 L;  3MFG A;  3DM1 A;  2O2L D;  1E2W A;  3S1Q B;  3QOJ A;  3QOL A;  3E6Z X;  2AQ3 B;  4PNY A;  1SYC A;  1I4X A;  1BXT A;  5IOD A;  5CGK A;  1STB A;  1S5D D;  5FLX E;  4I65 A;  3T56 B;  1SDF A;  3J80 E;  3GP7 A;  1RKN A;  1JWM D;  4QMG A;  3QB3 A;  1FNU A;  3I4M B;  4RA8 A;  4QIW B;  3DWA A;  2YYZ A;  4TKO B;  3KF8 A;  1STH A;  4A3B B;  4IUV A;  5CV7 A;  3M3Y B;  1I6V C;  3T16 A;  4XQJ A;  1HUM A;  2JE6 I;  4Q0F A;  1BNZ A;  1MI2 A;  3KLS A;  2JEB I;  1PDQ A;  1JCK B;  1LTI D;  1D1K A;  1FD7 D;  3QJY A;  3E0J A;  1JB3 A;  5ISR A;  5KEE A;  3I4N B;  1TS4 A;  4O42 A;  1SNO A;  2EOT A;  2BDN A;  4KKS A;  4TQU S;  4A3M B;  2L0C A;  1LT5 D;  1STA A;  1D5X C;  2LKV A;  1HUN A;  3W3A A;  1D5Z C;  2RDH A;  2BOS A;  3GV3 A;  1SEB D;  2B2U A;  1QNK A;  5JVG 3;  2WKD A;  1RTN A;  4HR7 B;  5IIF A;  2SNS A;  1HA6 A;  1OXX K;  5D3D A;  3VR3 A;  1TU2 B;  4DU9 A;  3T13 A;  1ML0 D;  3DMU A;  2A69 D;  2K5W A;  5I2X A;  1H9J A;  1RJT A;  2EE1 A;  5JEA J;  1A2T A;  1ENF A;  2A69 C;  3BDC A;  1H9S A;  1JC7 A;  2F0Q A;  1ENC A;  3BVG A;  3M85 A;  2B8G A;  1EY6 A;  1SNP A;  2K05 A;  3CRK C;  2F0K A;  1HA5 A;  1PLF A;  3I8Z A;  1KLG D;  2MUY A;  2KQ3 A;  1PTO C;  3KBX A;  4C3I B;  1WTO A;  3I72 A;  3FVQ A;  3SXH A;  2G9D A;  2A68 D;  3KLS X;  4F8M A;  1G6Z A;  5IGE A;  1H9K A;  1PTO B;  4HN7 A;  3SEB A;  2O5I C;  3MA2 B;  3A7A B;  4RHS A;  3NHH A;  2RSN A;  3BVM A;  4XDX A;  3NWS A;  4KJN A;  2KED A;  1Y8O B;  2JXM B;  4XYQ A;  5I2Y A;  1H9M A;  2RQX A;  5EKK A;  1TII D;  4Z9C B;  3S9W A;  1GHK A;  3T51 B;  3JAM E;  1A15 A;  2F0H A;  3HEJ A;  3ZYY X;  5CV8 A;  1TS3 A;  2X69 A;  1LAB A;  4A3D B;  3MWY W;  1ZKO A;  3E5S A;  5A2Q E;  1O7Y A;  1GUG A;  1BUV T;  3OIP A;  3NQI A;  3ND8 A;  2PYK A;  4KY5 A;  1ZXT A;  2MHV A;  2VUM B;  1GUN A;  1B3A A;  1TWG B;  3R93 A;  1WTR A;  3S16 B;  1F77 A;  3K5L A;  1I4G A;  1SNQ A;  3ND9 A;  5ELB A;  5CYU A;  1HCZ A;  1LLR D;  1EWH A;  3OWE B;  1AFP A;  5FK9 C;  3IKJ A;  4XYO A;  5FKA C;  3GTO B;  3D4W A;  2WIN B;  4LK1 C;  1TWC B;  4EQO A;  1LT3 D;  2B2Y C;  1PFM A;  2Q8R E;  5JEA G;  3SR1 A;  1B1Z A;  5IGC A;  3K5M A;  3L3O C;  3ERO A;  2ZT9 C;  1EWC A;  1EY5 A;  3D4D A;  3IAY A;  1F9P A;  5E1F A;  3BG3 A;  4N9P A;  5C6A A;  1KAB A;  1PFB A;  3HP3 A;  2XRQ D;  5EPJ A;  2IX0 A;  4MN3 A;  4ZKC B;  1U4R A;  2ICI A;  3M7G A;  2IX3 A;  2NVQ B;  2JA6 B;  1G2S A;  4KMU C;  1JOO A;  3HOX B;  5M3F B;  1ROD A;  4DGZ A;  4BBS B;  3MXP A;  3PMF A;  1EEF D;  3FPP A;  4JBW A;  3IFT A;  2NN6 H;  2K33 A;  1CT1 D;  2QF7 A;  2NUC A;  4K8I A;  5BN3 A;  1D1I A;  3OSO A;  4HAE A;  4Y7N B;  4KTA A;  3I4L A;  1ESF A;  4A3I B;  4K2L A;  3JAM L;  2E2J B;  1B50 A;  1IYV A;  3I3C A;  3NP8 A;  2H1E A;  1DZ1 A;  5G3L D;  3K0Y A;  1IKL A;  1Z6H A;  1JOR A;  3H91 A;  1ONL A;  4YIJ A;  3MXN A;  1V43 A;  1ET9 A;  3J81 E;  4H44 C;  1A2U A;  1NSN S;  2FMC A;  2XVS A;  4FF2 A;  4A3K B;  4CKB A;  4O1N A;  3C1F A;  3H94 A;  2B2T A;  3OOC A;  4PV1 C;  4BWG B;  4KN7 C;  3HOV B;  2IWH A;  1XTC D;  5T1G A;  1SXT A;  1C8C A;  2F0T A;  1C4Q A;  1B4O A;  4BA2 I;  1ZYR D;  2IT1 A;  1DOK A;  3K5O A;  2F03 A;  2KEE A;  1EZ8 A;  1QG7 A;  4BA1 I;  1G2T A;  1LTG D;  3V05 A;  1HFN A;  1WTW A;  3S15 B;  2JP1 A;  2A6H D;  4K5V A;  1PRT C;  1S5E D;  2NWG A;  2OEO A;  5M3M B;  5I6W A;  2HUG A;  2D5D A;  2CVR A;  1ILP A;  5JEA H;  1UUP A;  1I4H A;  3PUW A;  1PXU A;  5KRU A;  1B9M A;  1F2Y A;  5I9P A;  1Y1W B;  2L1B A;  4MIU A;  1NR4 A;  1L0X B;  1AZP A;  2NTS A;  4XXE A;  2TMP A;  4U68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...