1H9MA

Two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
141
structure length
141
Chain Sequence
MKISARNVFKGTVSALKEGAVNAEVDILLGGGDKLAAVVTLESARSLQLAAGKEVVAVVKAPWVLLMTDSSGYRLSARNILTGTVKTIETGAVNAEVTLALQGGTEITSMVTKEAVAELGLKPGASASAVIKASNVILGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDENUM-BINDING-PROTEIN
publication title Two Crystal Structures of the Cytoplasmic Molybdate-Binding Protein Modg Suggest a Novel Cooperative Binding Mechanism and Provide Insights Into Ligand-Binding Specificity
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Binding protein
total genus 28
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9mA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9mA01
1O78A 1OXTA 3FMCA 3FPPA 3D31A 3H94A 1OXVA 2PCFB 4DNRB 1E2VA 3VR4A 1PMRA 1Y69U 1H9MA 2A69C 4IQZA 1BDOA 1IYVA 4JK1C 4LJZC 1H9SA 2D62A 3KLRA 2EVBA 3IFTA 2AWOA 2JEAI 5KNCA 4DNTB 3A8KE 2A6EC 3CRKC 1OXXK 2E75C 3TZUA 1H9RA 1Q12A 3A8JE 1IW7D 3PUYA 3VA7A 1K8MA 1GUNA 2D2CC 4KKTA 3OPOA 3PUZA 4KN7C 4IFDG 3AB9A 2QF7A 4KI0A 1DD2A 1ONLA 4OO1G 2E76C 3DXJC 1A6XA 1B9MA 2B8FA 2BA1A 1TKWB 3CRLC 3D4RA 4I7ZC 3IKJA 4HR7B 1VF7A 1VDZA 5C0XG 1HQMC 2DNCA 1I6VC 2LMCB 3I4LA 4L8JA 3NE5B 1B9NA 4DK1A 1FYCA 5BN3A 1H9KA 2D5DA 1GHJA 3OOCA 4BA1I 5K36G 4TKOB 2E74C 2A68C 4PV1C 4DK0A 3PUWA 4KN4C 1Q90A 2CW0C 3RLFA 1GUTA 2EJFC 2K33A 2A6HD 4H44C 2IT1A 2ZT9C 5JEAG 1VCIA 2NN6G 3M7NA 1QJOA 5KNBA 1ZKOA 2BE5D 2PNRC 4RCNA 3T51B 1CFMA 4XTCS 4G7OC 3LWUA 1Z7TA 4KKUA 3QIAA 4XIGS 1GJXA 2AUKA 1OXUA 1O7LA 1LACA 3VR3A 3VR5A 5JEAH 4OGQC 2JEBI 3PUXA 3VR6A 1TU2B 3QG1A 3T56B 3OW7A 1H9JA 2YYZA 3MXUA 1K8OA 2AUJD 3I73A 1Z6HA 2O5JC 3W3AA 4JBWA 1FR3A 2A69D 3ND9A 3SDZA 3VR2A 1HCZA 2JE6I 3PV0A 2KA7A 5BN5A 1E2WA 1V43A 2K32A 4BA2I 4IFDH 2DNEA 4OO1H 1GUOA 1HPCA 1G291 3LNNA 2EJMA 4KKSA 1GHKA 1Y8NB 1ZYRC 2KCCA 3GQBA 3EQLC 2V4DA 1IW7C 2A6ED 1GUSA 5C0XH 1HTPA 2BDOA 2R6GA 3MFYA 4LK1C 2JXMB 2Q8IB 1CI3M 1Q1EA 3QJYA 1E2ZA 5K36H 4H0LC 3A8IE 3BDOA 2L5TA 5BN4A 4H13C 3P20A 2DN8A 1GUGA 4G7ZC 2NN6H 2PPBC 2EDGA 3WDNA 3SE0A 3U9SA 3M4YA 4GZYC 4KMUC 3A7LA 1YNJC 3GD7A 1CTMA 3A7AB 3HGBA 1Y8PB 1Q1BA 1DCZA 2K7VA 1VF5C 1LABA 2BA0A 1T5EA 4TQUS 1YNNC 2A6HC 3PUVA 2A68D 3BG3A 1Y8OB 2NN6I 1H9SB 1V8QA 4G7HC 1IYUA 3T53B 3ND8A 3N6RA 1OXSC 2BE5C 2B8GA 3I72A 2O5IC 4KHZA 5KNDA 1DXMA 1EWHA 3L7ZC 3M85A 1SMYC 5A35A 2EJGC 2F1MA
chains in the Genus database with same CATH superfamily
1PV4A 3GTQH 1WTRA 2PZTA 1TWGH 2F3VA 2NBFA 2ZTEA 4IQZA 2K5NA 3S1MB 4LJZC 3PO3H 2D62A 1EYAA 4GKJL 1SXTA 1E0BA 3E0EA 1S72A 3W2DA 5C4XH 2WAQE 1HNXL 1SMXA 5M3MG 2L55A 3T4AC 4ZRZA 4ODGA 2MGSA 1LT4D 1WOCA 2JYOA 3DXJC 1H95A 3HP3A 1B9MA 3L3OC 4PZ8A 4I7ZC 1JJCB 2JP1A 1TWFB 4MHEA 4A3IG 4A3MG 2HDLA 3E6ZX 1TR5A 4K2LA 1JC7A 4TKOB 1D7QA 1MHWC 1XNQL 4DV0Q 3V2TA 4GOPC 1PH3A 5M5YB 4X3TA 4EQPA 3D6WA 2IY5B 2EY6A 1EIGA 4EQOA 2PNRC 4BBRH 1BNZA 2RHQB 1VQJA 1LM0A 3BVZA 1XMQL 2PZWA 1NR2A 4DR1L 1GJXA 2TSSA 4B9WA 3CCLA 1SE8A 2JEBI 3RUZA 1S3OA 3HOYB 4A3BG 4ID6A 4FNFA 4XYQA 3RZDH 2K04A 3VR2A 4WORA 1LLRD 4GKKQ 2DGYA 2F0QA 2FXQA 3I90A 4JI8Q 4LF5Q 3FP9A 4ZYSA 4PZ6A 4YHHQ 4LK1C 1SLJA 2X6LA 1IBMQ 1E2ZA 4YCWA 2K5QA 2P5ZX 2B63G 4BY7G 2I0QA 1HHVA 5IWAL 1I3QB 3L9AX 4H13C 1EY5A 4EQ5A 4NDXA 1GUGA 3NSWA 4DAVA 2PYKA 3BU2A 2RSNA 3R8BA 5I9OA 3L2PA 4HCEA 1SNQA 4DA2A 4AIMA 1B50A 2K7VA 1WVLA 1VF5C 5CR3A 4OIJA 5FLXL 4PMWA 3BYYB 1EU4A 2NN6I 1SJED 2IJ0A 1DYQA 3MXNB 4NMZA 4YY3L 4DUYL 2ZM6Q 1G8ZD 4R4QA 3UDXA 2F1MA 2IHFA 3FPPA 2VXWA 5IOCA 3FMCA 4WRDA 1KIXA 1V1QA 1QUQB 1CSQA 4DXFA 1CHQD 3HOWG 4DR3L 2H4OA 1K9MC 4RFBA 2E2JB 4DNTB 3S2HH 3SXHA 1L1OA 5IE8A 3JAME 4HIDA 5DM73 4DUZQ 4DR2L 1H9RA 3A8JE 5EPLA 3DWPA 4HJ9A 1SBBB 5IGEA 3HOXB 2K01A 2SEBD 4XT1B 4FXDA 2E76C 1F9PA 3HZXA 2IPKD 2D0PA 2R93G 4QIWB 5FOBB 1QILA 4BBSB 3AYHB 3GTOB 4JYAQ 5ELCA 4DK1A 1SSOA 4L63B 4C1NK 1X54A 5FO9B 1Q46A 2JA7H 1BCPD 4TRDA 4WFN3 1J5EL 3QO2A 2KHSA 2YTVA 1QOHA 1OXUA 4R4CA 5LMNQ 3K58A 3DM1A 4HJ7A 1STBA 2F0KA 3S15B 1KNEA 1N9WA 5IIFA 3PCOB 1X3EA 1IHZA 2O5JC 5F2DA 1WCMB 3S17B 3S9WA 2NVQH 3MEFA 4A3MB 4OL7A 3RN5A 2ZJPA 1BOSA 1ZYRC 1VQ9A 1VQDA 2KJXA 3CCMA 4R4TA 3CCQA 2UXDQ 3KLSX 3CW2C 3NTIA 3HOUG 5M9OA 5BR8L 4QUCA 1Q86C 3TP5A 2WB1E 3SK6A 2ICIA 4G7ZC 3H3VI 1Y1WH 4JI0L 1CKOA 4KHPQ 1II3A 2B2UC 5I2XA 2EYJA 5IGCA 2QDBA 4A3KH 2RVLA 1CTMA 2K5DA 4KLKA 3DWQA 3G6JB 1Y8OB 3J7AV 3GDEA 1W2BA 1AZPA 1FJGL 1D6EC 1L0XB 5L37A 4QGUA 1PTOC 4KHZA 2IX1A 2B39A 3OTOQ 2WKDA 2L0CA 4MTNA 3RLNA 3K5MA 5C4ZA 2B63B 3I70A 4BY7B 3CC2A 2PCFB 3K59A 2K05A 2Z6KA 4C3JG 2L15A 1YJWA 1STGA 4Z9CB 5CMDA 4GS3A 2NTSA 2N8NA 3NELA 2N3SA 3TN2A 3QOJA 4ME5A 5JVH3 1TS3A 3W5OA 1HA5A 1QNUA 2C35B 3AFQA 1SMYD 1UE7A 1WTPA 1DD2A 1STEA 1SR3A 4KJOA 3NWSA 3GP7A 1SAPA 4DV6L 5AJ3Q 4JV5L 5CV5A 3P1HA 4IUQA 4CJ0B 2F0GA 3E9IA 5A2QL 5LMUQ 4PV1C 1L0YB 4Y7NB 2FFKB 4H44C 1B8AA 2KEDA 2MP1A 4GNXB 4BS9A 2XVSA 3HOZG 3H09A 2K5HA 4CDCC 5IYBH 1HNXQ 3VR3A 3J80E 1YJNA 4QUFA 3CCRA 4DKAC 3ND9A 5M3MH 2PW5A 2KA7A 5IT9L 3RMHA 5KYLA 3K5NA 1DM0B 2UUAL 5JOBA 2PNHA 1Y1VG 1A15A 1K3RA 2JA6B 4DV4Q 4A3IH 2R6GA 1MI2A 1KD1C 2JXMB 3RNUA 2L5TA 5IY0A 5C0XI 3AQQA 4K5WA 2BH2A 1F2YA 2EDGA 3TS2A 2B3GA 3MC0B 4IJHA 1YITA 3PO2B 1PYSB 1JJGA 1YHBA 3PUVA 4A3BH 2AMCB 1JWUD 1OXSC 1PYWD 1SYBA 4IUNA 3RZOH 3C2PA 5IGBA 1FGBD 3M85A 1XTCD 3GV6A 5DEHA 3TP8A 1IYJB 1PH7A 1KAAA 3DEOA 3R93A 5IWAQ 2R92B 2PQAB 3LX0A 1VQHA 2NVTH 2HQEA 1I6HH 1KLGD 3I7FA 2RBMA 2EYMA 3DHQA 3KLRA 4R8IA 2EVBA 1B44D 2PW7A 1EYCA 4GN3B 3CAMA 1DOLA 1V1OA 3VYUA 1W6KA 3PUYA 2YTXA 5D65A 5J3BA 2HHHL 4DUYQ 4IOCA 3CU7A 1XX8A 4JI7L 3AB9A 2CQOA 4X64L 4IFDJ 2B2YA 1FNVA 3GTMB 5M5WH 1TWHB 1PH1A 3OWFA 5C44B 3SK8A 5IP7G 1L0WA 4C3JB 1L2FA 4A3LH 4IUUA 3VYRA 4BBRG 1VQ6A 3SK5A 2SOBA 4LF6L 1BVSA 2K33A 4AYBG 5KRUA 2C5CA 2NN6G 3NEMA 1KDCA 2AWNA 3HOWH 4KJNA 1HTLD 2VL6A 3J81c 1NAPA 3CQZH 3PUXA 5CV7A 3ULJA 4IJLA 2YYZA 3CMEA 3I73A 4ZKBB 3FKIG 4LF7Q 4OWWB 3SHLA 1WTOA 1RTOA 2WP8J 4X66L 1HNZL 5JPMC 1SRUA 3NUCA 4A76A 3O13A 1PVOA 4A3FH 2CCZA 2R93H 5ELBA 5EPKA 1R4QB 5JJKA 1J5EQ 2AKWB 1F9RA 4EVOA 3CXCA 1SNOA 4L5QA 2F03A 1WD0A 1OTCA 3ULPA 3UE0A 5JJZA 2IX0A 3UDGA 3D3RA 4GZYC 2K4KA 1C9OA 4X3SA 1HFGA 3HOVG 2I5LX 1K8AC 3T1YL 1I50H 5HGTA 1TWAB 4E6IA 1S5ED 1V8QA 3ND8A 4DR6L 2F0TA 2QCPX 1MSGA 1Y1VB 4RKBA 2M00A 2O5IC 4JI1Q 1TWCB 2LS01 3HG9A 1K8GA 4FF3A 2EXZA 4ZK9B 4LF9Q 3STBC 1ENCA 1T5XD 3QWNA 1TT2A 5BR8Q 4JVZA 4B3SL 3FHWA 4O2DA 4FP5D 1RL2A 4A93B 4JI0Q 4UDUC 3HOUH 4HMJA 4GOPA 3AMUA 5C3WA 3V05A 3G4SA 1V9PA 4R4IA 5CV6A 3GTQB 2UXBL 1VQOA 4FXGC 1FJGQ 1UE6A 1TWGB 3OPOA 2ZJQA 1HNWL 4KN7C 5CBEE 3CF5A 3PO3B 4BXXG 3QB3A 1JE4A 4AQYL 2RKSA 2F4IA 3I4LA 5JPNC 3GV3A 1LTID 1WD1A 2EZVA 1SFOH 5C4XB 1WTQA 3TP7A 4LFAL 1HZ9A 2IT1A 4O42A 2NZHA 5FLXE 3PF4A 1PTOD 2BCOA 3PIP3 1GXDC 4J8QA 3TQYA 2EY2A 1WJJA 5KIXA 4ALPA 1D5ZC 3CPWA 1IL2A 2F4VL 4DK6C 4XQNA 2EXDA 4DV6Q 3F2UA 2IX3A 4BBRB 1JCKB 2EJMA 3JAMc 4V0BA 1QE6A 3DLLA 4HJAA 4AYBB 3MWYW 1A8VA 1ILQA 3J7YW 2NVYH 4TSSA 2Z9HA 5BN4A 3RZDB 4FF4A 4O0AA 3ER0A 4OX9L 5C5MA 1NE3A 1JWSD 2WIIB 2LXKA 2EOTA 3F2CA 3HOZH 4RGNA 3T13A 2BA0A 1NY4A 4A3GH 4K0KL 1YZ6A 2UUAQ 4GNXC 1NMFA 2E8GA 1QZGA 1JE5A 2E2DC 1EWHA 1I94Q 1LT6D 1SMYC 1EQVA 1P8LA 4RGTA 3X3NA 2NYZD 2VZAA 2SDFA 1HZCA 4UHVA 1H9SA 3WOFA 1TQOA 2D0OA 3J7A5 3K7AH 2JEAI 4B3RL 1RDPD 3A8KE 2Q2IA 4C1NI 1CQFA 1XMOL 4HJ8A 3K6OA 1GUNA 1UE5A 4B3ML 3OMCA 3CMAA 1EWCA 3BJUA 2OWOA 1DJRD 4NP5A 1A6XA 2B8FA 2JN4A 4QY7A 4BWGB 4LF8L 5IYCH 5C0XG 3S2HB 3OOCA 2N88A 4C56C 4R8NA 4KN4C 5M3FG 4N9PA 5IYBG 1BBWA 1N36Q 4RCNA 3N52A 4FF1A 4XTCS 1YHQA 4KKUA 1N8RC 2ZXRA 2E5LQ 2HHHQ 1NJIC 1E24A 4KD3A 2B2UA 1ET9A 2IWHA 3KBXA 3TREA 4KY6A 3A5ZB 1O80A 2JA7B 1Q8IA 1XPUA 2UXCL 2KCNA 5TSSA 2L11A 3KK7A 5ELDA 4GLXA 1G291 4CKBA 3Q22A 1EZ8A 2NZOA 3E3XA 4LF6Q 1WTWA 4LFBL 5IP7H 2NZ1D 2LKVA 3KOJA 1PH4A 1Q1EA 4HEDA 3A8IE 1UEAB 2MO1A 4JI5L 3VDYA 4B3TL 2KBNA 1F9QA 2NVQB 1XWEA 1B4OA 4PZ7A 2NN6H 3HKZG 2QEJC 5J1ZA 3U9SA 2VUMG 4UP9A 3GD7A 2F0NA 1T5EA 1D8LA 1WI5A 3BYTB 1BR9A 2A6HC 2CH4A 2HUGA 1HNZQ 1JORA 3FKIH 1QNKA 3KF8B 1Y1WB 1VMPA 4JI6L 5GAHC 5EKIA 4JG2A 1MSHA 3VYSA 4A3KB 4P71A 4QCLA 3M7GA 3J80c 4QMGA 1UNSA 2A74C 1ILPA 1XXGA 3M4QA 1GM5A 1M1KC 4CKEA 2A69C 1EY4A 1PRTB 2KEEA 1GKHA 5KEEA 3KYHC 2EYLA 3M9BA 3KF6A 4HMIA 2K1BA 2B2TC 3T1YQ 3A0JA 1RTNA 1PDQA 4DR6Q 3HOVH 5FK9C 4F88A 2PI2E 4P73A 5E4XA 1IBKL 1KLUD 4A3LG 2WAQG 2XRQD 4KI0A 1SNDA 2GN5A 1PHJA 1FNUA 1K0RA 3LGJA 2HDMA 3I3CA 1X3FA 4IUPA 1NCVA 1FGUA 1AP0A 4DV3L 1M4VA 3MVVA 2VQEL 4I7AA 1XTDA 2F3IA 2A68C 4NXMQ 1DZ1A 1CKNB 1GUTA 2OCEA 4HJ5A 1X55A 4ZAIA 3M7NA 4F8MA 2M2LA 3T51B 2UXBQ 2F0SA 2F52A 3QIAA 1EOTA 2RDHA 3EIVA 3VR5A 5J39A 5JEAH 1GUWA 3STBD 1HNWQ 1HRJA 1PRTF 2I46A 1HH2P 4NXNL 1CZWA 4A3FG 3R2IA 2UU9L 4A3CG 2J0TD 4DV7Q 2JE6I 4DR4Q 1V43A 1FVIA 1S5BD 3NBIA 4PMBA 4BXXH 2Y0SE 4DV2L 3TP6A 1Q81C 1X56A 2AQ2B 5HGQA 3H3VH 4LFAQ 4ABNA 2VS1A 4MN3A 2CHBD 5I6YA 1QVGA 4DAYB 1CI3M 5T1IA 1ASZA 5M3MB 4KY5A 1SE4A 1HUNA 2A73B 3PGZA 4K5XA 4L5SA 2PPBC 3SE0A 2E2HH 3SK4A 1E1TA 4KMUC 3PMFA 3GTGH 3S14H 4S3SA 3ICEA 1Y8PB 5K5PA 1PH6A 4A3IB 5I4DA 1EY8A 4K8IA 1K3BC 1V1PB 1KDAA 1VQ5A 4FO2A 1EIHA 1X3QA 5JAVA 3I4NG 1IKLA 1RD9D 2FHTA 1A2TA 4DV1Q 1A3UA 2J7ZA 3ERQA 4UP8A 4PQXA 1BBXC 4LF4L 5A35A 1FNWA 4U68A 3MA2B 3H94A 4DNRB 3URYA 1EQTA 4A3BB 4X65L 1JOKA 4GLVB 3MXNA 1VQKA 3NBHB 1OO9B 2O2LD 5GAEC 3RZOB 4KK7A 5C3EG 3ONAB 4BY1G 3JC66 2A6EC 4CJ1B 3J81L 4R9WA 1RODA 2F0FA 1J6QA 3LWEA 2CH4W 5D3DA 4KKTA 4CGYB 2NVTB 1QUQA 5NUCA 1I6HB 1CA6A 2EYPA 1U0LA 4QQBX 2R7FA 2BA1A 2UUBL 1VF7A 2FINB 3U4VA 2A8VA 1QCBD 3NE5B 1B9NA 1ICWA 1GHJA 3B6YA 1SYCA 5K36G 1TS5A 2QKIC 3E0JA 1KXLA 1Q3LA 2KECA 3F1ZA 3M4OH 5ELNA 1J9OA 4B3RQ 1NNXA 3PF5A 5M5WB 1XMOQ 4G7OC 1Z7TA 4LMQD 1EQRA 2AUKA 4ILWA 4RHRA 4QF4A 2MO0A 1JB7A 3OW7A 1B70B 2MFIA 1WYDA 1EFID 4LF8Q 1AW7A 2X6GA 3PQIA 3OW2A 2GA4B 2RDGA 3HOWB 4A75A 4JC0A 4KKSA 4ZKCB 4P72A 1HA6A 2DY7A 1EY6A 2QILA 1RHPA 1IW7C 2V4DA 5C0XH 2K6AA 3CQZB 4GKJQ 4J6HA 1F2ZA 2NTTA 2OQ0A 1A63A 1D1KA 2OT2A 5D3IB 5M3FH 2DN8A 3S1RH 2KENA 4A3GG 1YHAA 2KQ3A 3OIPA 2ZJRA 3UE1A 2A19A 4A3DG 2WB1G 2BOSA 3GTPH 4AH6A 4A3FB 2R93B 1C0AA 3OYYA 4KV6A 2K50A 3MZ5A 1AE3A 1IYUA 4UP7A 1XNQQ 3M3YH 2BE5C 4JOIC 5FLXc 1DXMA 4ME3A 5IYDG 4ZUIA 4M1UB 1K0SA 4X3KA 1U4MA 4JI3L 4LFCL 3RLOA 2B2VC 4JI5Q 1XMQQ 2RSOA 1W3SA 4DR1Q 1QVFA 1Y69U 1I50B 3X3MA 1H9MA 1G6ZA 2Q8TA 1JR0D 2CWPA 1B7YB 4F87A 4FF2A 2F0PA 1C48A 3EBEA 4K5VA 4R4OA 1C7YA 1RF2D 3GTLH 1UWVA 4JBMA 1ESFA 3TZUA 4OXPA 2VUMH 3U50C 1Q12A 5EKKA 5IYCG 4YCUA 2Q2TA 1XNRL 5EAYA 1JOOA 3HOUB 4GN5A 1EZ6A 3IKJA 3ITPA 3K0XA 3MXGA 1BO0A 1I6VC 3KBGA 3JAML 2MJ8A 3S16H 2D5DA 4JCVE 4FXKC 5HY6A 2E2IH 4YWMA 2A6HD 4N8X1 2QDLA 5DLQE 3BZCA 3OSOA 1RIPA 2MNAA 4ZCKA 1E7ZA 2VQFL 5I6WA 1CFMA 2SNSA 5C4JH 1E1OA 4N9TA 1BUVT 4YY3Q 2R7ZG 3EROA 3EN2A 1U4RA 2N49A 1N32L 3VR6A 4DXGA 1TU2B 1SFOB 2VY3A 3T56B 2R7DA 1BQQT 1PRTC 2RHSB 2EIFA 3W3AA 2A69D 3CKIB 2VNUD 1HCZA 4RGMA 5ISRA 2K5WA 3H0GG 5COYA 3HKSA 4GNXA 4DR3Q 4K6DA 4CBVA 2PMZB 1NUCA 3J81j 3E9HA 2F0IA 1AZQA 1EUJA 4C3IH 1HTPA 3MFYA 4IUVA 4DR2Q 2QEXA 5JJLA 1S5FD 2NVXH 3D0FA 3NPPA 4X3UA 1YI2A 1X3PA 2F3WA 1EY7A 4DN4M 5KGUA 2LSSA 1HUMA 1TS2A 1EIYB 4MTKA 3G71A 1EYDA 4NXNQ 1MBYA 1YIJA 5E1FA 4DV0L 2HCCA 1Q1BA 4ZQ3A 3GTJH 1K83H 2NVYB 3S1QH 1IZ6A 1CM9A 2A68D 3IL8A 2RCFA 2VB3X 5G3LF 3AEVA 4DV2Q 4JPBW 5I9PA 2B8GA 3I72A 4A3CH 4XDXA 1TVXA 1SNPA 2JSOA 3NK9A 3HRZC 2B2WC 2XRSD 2PI2A 3PIPA 3HOZB 3ZYYX 3PIO3 2NWGA 4RHSA 2KCTA 4A3GB 1E2VA 1JICA 4GKKL 2Q8RE 3KJPA 1Q8KA 2AWOA 1YNND 5KNCA 1NTGA 3A56A 4YHHL 4UAIA 1ZXTA 3MAQA 1W6JA 1IBML 3S1NH 3VA7A 4OWXB 1TXYA 1VQCA 4GN4B 4PNYA 4LF4Q 2PQAA 1SJHD 3NQIA 1E3PA 3I4MH 2TMPA 3CRLC 1SYFA 2EYFA 2EYOA 3K7AB 3I4NH 5M5XH 1PLFA 5IP9H 1S5CD 3S2DH 1VQ4A 2EY5A 4A3EH 2CW0C 2G5DA 5JEAG 1O7IA 3QR8A 3I56A 4PMCA 4Q5VA 2HD3A 2JA8G 2R3ZA 4XIGS 3CCJA 5C3EH 4BY1H 1VQBA 2R61A 1A3VA 1PFSA 1Z9FA 5BN5A 3H6MA 4WJ3M 1MGSA 1GUOA 1X9NA 4DUZL 2A5HA 4WJWA 3EQLC 2A6ED 2Q2HA 2F0OA 4U673 5FJ8G 3J80L 3TS0A 4OEMB 3QJYA 5K36H 3FRPB 4OO1I 3W1GA 1SN8A 1M90C 5IGGA 4JYAL 4DR5L 5CORA 1SEBD 3I2ZA 4O1NA 3A7LA 4B9XA 1PH5A 2B2TA 4JV5Q 1RKNA 2QGQA 1SE3A 4R1JA 4JW0A 3FPUB 1VQFA 3KLSA 3ULLA 2OQKA 2X69A 3C1FA 5CC4A 5LMNL 4LW1A 4C2MH 4CKCA 3K57A 2KOLA 3UDFA 4CDEC 1O78A 2PQEA 1CZGA 2B29A 2NB0A 4QIWE 5ELOA 3HOYG 1WTVA 2RQXA 4HIKA 1JOQA 2DJFC 3U9OA 2MUYA 2DUDA 2Z4HA 4RAUC 4JI4L 1EEFD 3NENA 1VMCA 3FKIB 4QB4A 4XXEA 1U4LA 3I91A 2I07B 2ID0A 1YJ9A 4JI2L 4A3DH 4APVA 5GROA 1IL8A 1I4PA 1IW7D 1SE2A 3V96A 4Y52H 1CSPA 3EVQA 3A5UA 2QF7A 1CA5A 1G6PA 3FEWX 3DWAA 4JI3Q 4HIMA 5IYDH 2ENBA 4UY8C 4KD4A 3Q23A 3UDIA 3HOVB 1D5XC 4YWKA 3UI2A 5J22A 3OTOL 1VCIA 5FO7B 1EIFA 3VA5A 3C3LA 2BE5D 4RKLA 1QB5D 4RGOS 4RA8A 1HQRD 3K0YA 1XNRQ 3I55A 1PZID 3QG1A 2LY7A 3GTKH 3J7ZC 4K14A 1Z6HA 4TVAB 1MJEA 1B1ZA 3TBIB 1E2WA 2K5VA 4ZLTF 4IPDA 4CHTB 1G91A 2F0MA 4IURA 4KHVA 1DGSA 1JB3A 3HOXG 1SROA 4IFDI 4OONA 1LTBD 1PFBA 3J81E 3R3OA 3T1HL 4A3JH 5AJ3L 1EQQA 1YBYA 2Z0SA 1C4QA 4BBSG 3TRZA 4JI7Q 3H91A 1N32Q 4X64Q 3WDNA 4CJ2C 1I4QA 3A55A 5LMUL 2BH8A 2R7ZH 1WFQA 3CCSA 4TQUS 4OIKA 1NSNS 2F0HA 1LT3D 1DONA 5ELFA 4K8JA 1VQ7A 1O7YA 4C3HH 2PZUA 1L1OB 3AFPA 3H0GH 4JBJA 2OEOA 2E2HB 2EJGC 4P2CB 3GTGB 3DEPA 3S14B 1OXVA 1B3QA 2DY8A 3C1EA 1PMRA 1WCMG 1JJ2A 4DR7L 1BDOA 1PRTD 2XGTA 3U58A 2ALYB 1GD7A 5LL6S 2SNMA 1AFPA 1Q82C 4DPGA 4DV4L 1FD7D 1JWMD 3CRKC 1OXXK 4ULLA 2N55A 2ATWA 4X66Q 5A2QE 1GO3E 1SNMA 3OMGA 1RJTA 5E4WC 1R9TH 3NXWA 1ONLA 1TY2A 4I65A 1PTOH 1ENFA 1I4GA 5C0XJ 2EPBA 1DOMA 5BN3A 3KLWA 4BA1I 2YU9H 2E74C 1YVCA 3PUWA 2ZXOA 1E22A 1D5MC 2BDNA 2EJFC 2ZT9C 4F7XA 1N33L 1RCVD 3GO5A 1QJOA 1U5KA 5IT9E 4X62L 3WOEA 1VQGA 3CPFA 1B3AA 2Z8LA 2GVBA 1MIUA 2JK8A 3MXUA 2DJGC 2CFMA 2EYHA 3M4OB 3G48A 2L12A 1KC8C 4B3SQ 5EBCA 2VW9A 4C3IG 3PV0A 1Z47A 2I5MX 2JA5H 3K7UC 2WFWA 1HPCA 1KNAA 3LNNA 1TIID 3OIQA 4HN7A 4QL5A 4JOIA 3GQBA 2YV5A 1NR4A 3TDQA 3DMUA 3G7LA 1ZEQX 2HCIA 2B2VA 3NWTA 1VQ8A 1PXUA 3FDTA 4HSVA 2LFNA 1WTXA 4KY7A 1Y14B 2JA8H 3CCUA 4AQYQ 3NHHA 1A2UA 1KRSA 3W1BA 1LABA 1YNNC 3FVQA 3CC7A 4POGA 3BG3A 3CHBD 2H5XA 3S1MH 3T16A 4G7HC 2A1AA 3T53B 2CW0D 3WWVA 4MIUA 5M3FB 1TY0A 3S1RB 3K81C 4YCVA 2VB2X 1VS0A 5FLMH 1KL9A 3BVGA 3L7ZC 2KVMA 3GTPB 2AHOB 4DF7A 4LF7L 3J81i 3DUZA 5FJ8H 4CDFC 4G57A 1IYVA 3KJOA 4DR5Q 1YNJD 2F4VQ 2PMZE 4M8AA 3M3YB 1B2TA 1STAA 5KYIA 5FO8B 1SYDA 3KF8A 1TWFH 2JA6G 3I4MG 1ASYA 1K28A 2M9VA 4XYOA 3ERSX 5LL6X 2CQAA 1U4PA 2D2CC 1F2MA 3BS1A 5M5YH 1LO5D 5IP9G 2XN9C 1PA6A 2OTJA 4RWSC 1GVPA 4OO1G 2EQSA 1FL0A 2UUCL 4A3EG 4RMFA 1XJVA 1X6OA 4OX9Q 1HQMC 2L4NA 3HKZB 2OF1A 2LMCB 3Q0AA 3GTLB 3PO2G 1PZJD 4LNQA 5ELEA 2IL8A 5LMNW 5CV8A 1PH8A 1H9KA 2XWBB 2VUMB 3BVMA 4JI4Q 3HOYH 1ICFB 2ZTCA 5CYUA 1Q90A 4JI1L 4XQQA 1TS4A 1BCPB 4K0KQ 2KHJA 2IHEA 4HIOA 1F77A 4UPAA 4JI2Q 4LF9L 3I4OA 4YIJA 1C8CA 1HJPA 3LWUA 1EFWA 1U9RA 4HTHA 3Q8DA 3HFZB 2R92G 1IBLL 4IALA 1S4ZA 1VQIA 3S16B 3MXPA 3SR1A 2YTYA 2E2IB 4B08A 1KDBA 4HCSA 1CKNA 1I3QH 1FR3A 2NUCA 3M4PA 3SDZA 2HT1A 5EPJA 1I5FA 1NBWA 1VQMA 1T9HA 5C4JB 3F2BA 5EGTA 2C9OA 4DV5L 1N34L 2Y0SG 1GUSA 2B2WA 2BDOA 3AU7A 1PYBA 4IOAA 2G9HD 3CC4A 4L5TA 1HXYD 4B3MQ 1PH2A 3BZDB 3OHXC 1O7ZA 5C44G 2WAQB 3C46A 4K6LA 1G2SA 4X6AH 2MQHA 2JQOA 2V1CC 2K52A 1LTTD 3MEHA 4C3IB 1BCPF 1STHA 3SVMA 3CD6A 4DAYA 3U4ZA 2E2JH 1J8IA 1LTAD 2NVXB 3CCVA 2F0WA 2D9UA 2JA9A 2Z1CA 1B53A 2LXJA 3SGIA 3A54A 3RN2A 1I4XA 5EQ0A 3T1HQ 3EJIA 3VR4A 3GTJB 1K83B 1KABA 3S1QB 4EQNA 1BKBA 2RA4A 3ZJYC 3HOXH 1V1PA 2F0JA 2O4XA 3D8GA 1AH9A 2FMMA 5C5LA 1LTLA 4IZ8A 4BBSH 2UXCQ 5D14A 3GTOH 4H7BA 2E75C 3HS0C 4NKLA 3JAMi 1LT5D 4POFA 2GVAA 4LFBQ 2WKCA 5H1SE 4IFDG 2CWAA 4LAAA 3E5SA 5LHY1 4B3TQ 4HR7B 2JJQA 4YWLA 3NBHA 2DNCA 3H3VC 1R4PB 3EA6A 4L8JA 3RD4A 1FYCA 3S15H 4DR7Q 3S1NB 4AYBE 4P74A 1CK1A 3RLFA 5EBDA 4NB3A 5EJWA 1WCMH 3S17H 1WTHA 3A74A 1D1IA 1I94L 1HR0L 3I4MB 1L1OC 4A3MH 5G3LD 1EYGA 3CCEA 2ES2A 3I4NB 1QZHA 2F0LA 5M5XB 1ET6A 2Q2UA 1YEZA 4OGQC 3KDFB 4JI6Q 2MPMA 4H02A 3S2DB 3PIOA 4A93G 3BDLA 4A3EB 1QWYA 3VYTA 3TMEA 4BA2I 1MJCA 2K32A 1CUKA 4ZUJA 4FYDA 2OTLA 2XNAC 5C6AA 1Y8NB 1GHKA 4A4IA 4A3JG 5C3EB 1X3GA 4BY1B 1JT8A 2G9DA 4FVMA 1N33Q 3PO3G 2XIWA 3NTKA 3BDOA 4X62Q 1I4HA 1STNA 2AQ3B 1YNXA 5GQOA 1A0IA 4DAMA 1AE2A 1IBKQ 1SYGA 1A3TA 3IAYA 2Z6BA 4BY7H 2B63H 4IUTA 4Q0FA 5AFWA 4C3HG 4DU9A 5C4XG 4L6TB 3MHBA 4DV3Q 1N36L 3HEJA 2VQEQ 4MNOA 1CT1D 2HIVA 5JVG3 4GOPB 1VQNA 3KUPA 5CGKA 2Y0SB 2E5LL 2F0EA 4KTAA 2J4XA 1S40A 4EGVA 1LTSD 4QJFA 5I2YA 1OXTA 5E3FA 1KRTA 3Q24A 3D31A 5C3XA 4OELB 1M8AA 5T1GA 1BF4A 4MZ9A 1VQEA 2KCMA 1KTKA 1KQSA 3IFTA 2RF4A 2UU9Q 3J7AF 4C2MB 2K03A 1KAWA 5C4HA 1P16A 1EWIA 3TEHB 1UE1A 1GOZA 1EY0A 2ZXPA 2ZTDA 4XQJA 5EKLA 1K8MA 4Y7NH 3PUZA 5DNFA 1ENAA 1G2TA 2L1BA 4CDDC 5CV4A 1TKWB 4LUZA 4EX5A 3S24A 1EL0A 4A3DB 2WB1B 4GLAC 3K80C 5IGDA 2Z6KC 3NQTA 3EFXD 5GADC 3SEBA 3IRBA 4DK0A 1AN8A 4JI8L 4LF5L 1XPRA 1EU3A 1I4RA 1SDFA 5KNBA 1ZKOA 3KDFA 1LUZA 3F8TA 3R2TA 1O7LA 1LACA 2XSCA 5JJIA 5DM63 2JA6H 1QVCA 2JA5G 4IPGA 3KFUA 1H9JA 2UUCQ 1QG7A 3J80i 4JBWA 2H1EA 4LUVA 4K2KA 2K14A 2QA4A 3NTHA 2DNEA 4X65Q 2HQLA 4OO1H 1HZBA 3TSSA 2CVRA 1ML0D 2KCCA 2ZM6L 2FMCA 2N78A 3PO2H 1CKMA 5IODA 4OHJA 4HAEA 2HIXA 1MKHA 2Q8IB 3GTKB 1PFMA 1LYLA 1VQLA 4L5RC 3P20A 5GAGC 3IFDA 4PG3A 1EY9A 1IBLQ 1IKMA 4FDBA 4RH6A 3P7JA 4RG1A 3K5OA 1YNJC 4NXML 1JMCA 3RR5A 4DFAA 2UUBQ 1HFNA 1LTRD 3HGBA 3PSIA 1DCZA 3OWEB 2R92H 5FLMG 1BCPC 1H9SB 4N8FA 4JBKA 2F0VA 1ZYRD 4WJ4A 4V190 4A3JB 5IT9c 3N6RA 3L0OA 2CKZB 4OWTB 4DV5Q 1N34Q 2I5HA 1LTGD 2R7ZB 1X65A 1JQYD 2JA7G 4DV7L 5CV9A 3NP8A 4DR4L 3D4DA 1A62A 1ESRA 3BDCA 4JK1C 3QOLA 4DGZA 4C3HB 5HURA 4IN3A 3GTMH 3TZDA 3P75A 4IO9A 1TWHH 2EY1A 3DM3A 5C44H 3H0GB 1X32A 4J1MA 1SNCA 2L9HA 4C3JH 4DNIA 2WV6D 1EOVA 1UAPA 1VQPA 1Q7YC 5CBAE 1PZKD 2XTIA 2IW3A 5IGFA 4NW2A 1STYA 3D4RA 1VDZA 4HSPA 1DOKA 1G51A 1VQAA 5DAUA 1EEID 4G4KA 2EE1A 3K8AA 2KHIA 2PO4A 1KHIA 1IXRA 1R9TB 4DV1L 1Y1WG 2UXDL 5JEAJ 2QW7A 3F2DA 4A3KG 1PTOB 3D6CA 3Q6SA 3D4WA 2Z4IA 1PFNA 4IPHA 4KHPL 2ICEC 1HZAA 3K5LA 4XT3B 2YU9B 1BXTA 2B2YC 4LFCQ 1K8OA 2AUJD 3CP0A 4LUOA 1F2LA 2RCNA 4IFDH 3H15A 1CHPD 3MTSA 4J15A 4DK3C 4P75A 5E7NA 1AEXA 2ASBA 1NMGA 1SYEA 4NPSA 1HR0Q 1TWAH 4H0LC 1BBUA 3HKZE 1Y1VH 4LWCA 1TWCH 2F0DA 2WINB 2JA5B 1MD2D 1S5DD 3M4YA 1HR0W 1UEBA 2XWJB 2MHVA 1XPOA 1PH9A 2WACA 2KUMA 3A7AB 4DAPA 4IPCA 2AQ1B 5FKAC 1K73C 1D2BA 2FJ2A 3MFGA 2F0UA 3G6EA 4A93H 3BZKA 1F9SA 1PTOF 3KF6B 1LV9A 1UUPA 4RCOA 5KNDA 1CQVA 1XYIA 2OXPA 2K75A 2RDFA 2K28A 2JA8B 3I8ZA 2VQFQ
chains in the Genus database with same CATH topology
1WTRA 2PZTA 2F3VA 2NBFA 4IQZA 3S1MB 4LJZC 2D62A 1EYAA 1SXTA 1E0BA 3W2DA 2L55A 3T4AC 4ZRZA 4ODGA 2MGSA 1LT4D 2JYOA 3DXJC 3HP3A 1B9MA 3L3OC 4I7ZC 2JP1A 1TWFB 4MHEA 2HDLA 3E6ZX 1TR5A 4K2LA 1JC7A 4TKOB 3V2TA 5M5YB 4X3TA 4EQPA 3D6WA 2EY6A 1EIGA 4EQOA 2PNRC 1BNZA 3BVZA 2PZWA 1NR2A 1GJXA 2TSSA 4B9WA 2JEBI 3RUZA 3HOYB 4ID6A 4FNFA 4XYQA 2K04A 3VR2A 4WORA 1LLRD 2F0QA 3I90A 4ZYSA 4LK1C 2X6LA 1E2ZA 2K5QA 1HHVA 1I3QB 3L9AX 4H13C 1EY5A 4NDXA 1GUGA 3NSWA 4DAVA 2PYKA 2RSNA 3R8BA 5I9OA 4HCEA 1SNQA 4DA2A 1B50A 2K7VA 1WVLA 1VF5C 5CR3A 4OIJA 5FLXL 4PMWA 3BYYB 1EU4A 2NN6I 1SJED 2IJ0A 1DYQA 4NMZA 1G8ZD 2F1MA 3FPPA 2VXWA 5IOCA 3FMCA 4WRDA 4DXFA 1CHQD 2H4OA 4RFBA 2E2JB 4DNTB 3SXHA 3JAME 5DM73 1H9RA 3A8JE 5EPLA 3DWPA 1SBBB 5IGEA 3HOXB 2K01A 2SEBD 4XT1B 4FXDA 2E76C 1F9PA 3HZXA 2IPKD 4QIWB 5FOBB 1QILA 4BBSB 3GTOB 5ELCA 4DK1A 1SSOA 4L63B 4C1NK 5FO9B 1BCPD 4TRDA 4WFN3 3QO2A 2KHSA 1QOHA 1OXUA 3K58A 3DM1A 1STBA 2F0KA 3S15B 1KNEA 5IIFA 1IHZA 2O5JC 5F2DA 1WCMB 3S17B 3S9WA 4A3MB 4OL7A 1BOSA 1ZYRC 2KJXA 3KLSX 3NTIA 5M9OA 4QUCA 3TP5A 3SK6A 4G7ZC 2ICIA 1II3A 2B2UC 5I2XA 2EYJA 5IGCA 2QDBA 2RVLA 1CTMA 2K5DA 3DWQA 3G6JB 1Y8OB 3J7AV 1AZPA 2IX1A 1D6EC 1L0XB 1PTOC 4KHZA 2B39A 2WKDA 2L0CA 3K5MA 5C4ZA 2B63B 3I70A 4BY7B 2PCFB 3K59A 2K05A 4C3JG 1STGA 4Z9CB 5CMDA 2NTSA 3TN2A 3QOJA 4ME5A 5JVH3 1TS3A 1HA5A 1QNUA 1SMYD 1WTPA 1DD2A 1STEA 4KJOA 3NWSA 3GP7A 1SAPA 5CV5A 3P1HA 4IUQA 4CJ0B 2F0GA 5A2QL 4PV1C 1L0YB 4Y7NB 2FFKB 4H44C 2KEDA 2MP1A 4BS9A 2XVSA 3H09A 3VR3A 3J80E 4QUFA 3ND9A 2PW5A 2KA7A 5IT9L 3RMHA 5KYLA 3K5NA 1DM0B 5JOBA 1A15A 2JA6B 2R6GA 1MI2A 2JXMB 2L5TA 5C0XI 4K5WA 1F2YA 2EDGA 3MC0B 3PO2B 3PUVA 1JWUD 1OXSC 1PYWD 1SYBA 4IUNA 3C2PA 5IGBA 1FGBD 3M85A 1XTCD 3GV6A 5DEHA 3TP8A 1KAAA 3DEOA 3R93A 2R92B 3LX0A 2HQEA 1KLGD 2RBMA 2EYMA 3DHQA 3KLRA 4R8IA 2EVBA 1B44D 2PW7A 1EYCA 1DOLA 1V1OA 3VYUA 1W6KA 3PUYA 5D65A 3CU7A 1XX8A 3AB9A 4IFDJ 2B2YA 1FNVA 3GTMB 1TWHB 3OWFA 5C44B 3SK8A 4C3JB 4IUUA 3VYRA 3SK5A 2SOBA 2K33A 5KRUA 2C5CA 2NN6G 1KDCA 2AWNA 4KJNA 1HTLD 1NAPA 3PUXA 5CV7A 2YYZA 3I73A 4ZKBB 3SHLA 1WTOA 1RTOA 2WP8J 5JPMC 3NUCA 3O13A 5ELBA 5EPKA 1R4QB 1F9RA 4EVOA 1SNOA 2F03A 1WD0A 5JJZA 2IX0A 3D3RA 4GZYC 4X3SA 1HFGA 5HGTA 1TWAB 4E6IA 1S5ED 1V8QA 3ND8A 2F0TA 2QCPX 4RKBA 1MSGA 1Y1VB 2M00A 2O5IC 1TWCB 2LS01 3HG9A 4FF3A 2EXZA 4ZK9B 1ENCA 1T5XD 3QWNA 1TT2A 4FP5D 4A93B 4UDUC 4HMJA 3AMUA 5C3WA 3V05A 5CV6A 3GTQB 4FXGC 1TWGB 3OPOA 4KN7C 5CBEE 3PO3B 3QB3A 1JE4A 2RKSA 2F4IA 3I4LA 5JPNC 3GV3A 1LTID 1WD1A 2EZVA 5C4XB 1WTQA 3TP7A 2IT1A 4O42A 5FLXE 1PTOD 2BCOA 3PIP3 1GXDC 4J8QA 2EY2A 5KIXA 1D5ZC 4XQNA 3F2UA 2IX3A 4BBRB 1JCKB 2EJMA 4V0BA 1QE6A 4AYBB 3MWYW 1ILQA 3J7YW 4TSSA 5BN4A 3RZDB 4FF4A 5C5MA 1JWSD 2WIIB 2EOTA 4RGNA 3T13A 2BA0A 2E2DC 1EWHA 1LT6D 1SMYC 1EQVA 4RGTA 3X3NA 2NYZD 2SDFA 1H9SA 3WOFA 1TQOA 2JEAI 1RDPD 3A8KE 4C1NI 1CQFA 3K6OA 1GUNA 3OMCA 1EWCA 1DJRD 4NP5A 1A6XA 2B8FA 4BWGB 5C0XG 3S2HB 3OOCA 2N88A 4C56C 4R8NA 4KN4C 4N9PA 4RCNA 3N52A 4FF1A 4XTCS 4KKUA 2ZXRA 4KD3A 2B2UA 1ET9A 2IWHA 3KBXA 4KY6A 1O80A 2JA7B 1Q8IA 2KCNA 5TSSA 2L11A 3KK7A 5ELDA 1G291 4CKBA 3Q22A 1EZ8A 1WTWA 2NZ1D 2LKVA 1Q1EA 4HEDA 3A8IE 1UEAB 2NVQB 1F9QA 1XWEA 1B4OA 2NN6H 2QEJC 5J1ZA 3U9SA 3GD7A 2F0NA 1T5EA 3BYTB 1BR9A 2A6HC 2HUGA 1JORA 1QNKA 1Y1WB 1VMPA 5EKIA 1MSHA 3VYSA 4A3KB 4QCLA 3M7GA 4QMGA 1UNSA 2A74C 1ILPA 1XXGA 4CKEA 2A69C 1EY4A 1PRTB 2KEEA 5KEEA 2EYLA 4HMIA 2K1BA 2B2TC 1RTNA 1PDQA 5FK9C 4F88A 5E4XA 1KLUD 2XRQD 4KI0A 1SNDA 1FNUA 2HDMA 3I3CA 4IUPA 1NCVA 1AP0A 1M4VA 3MVVA 2A68C 1DZ1A 1GUTA 4ZAIA 3M7NA 4F8MA 2M2LA 3T51B 2F0SA 3QIAA 1EOTA 2RDHA 3VR5A 5J39A 5JEAH 1GUWA 1HRJA 1PRTF 2I46A 1CZWA 3R2IA 2J0TD 2JE6I 1V43A 1S5BD 3NBIA 4PMBA 3TP6A 2AQ2B 4ABNA 4MN3A 2CHBD 5I6YA 1CI3M 5T1IA 5M3MB 4KY5A 1SE4A 1HUNA 2A73B 4K5XA 2PPBC 3SE0A 3SK4A 4KMUC 3PMFA 4S3SA 1Y8PB 5K5PA 4A3IB 5I4DA 1EY8A 4K8IA 1V1PB 1KDAA 1EIHA 4FO2A 1X3QA 5JAVA 1IKLA 1RD9D 2FHTA 1A2TA 1A3UA 2J7ZA 3ERQA 1BBXC 4PQXA 5A35A 1FNWA 4U68A 3MA2B 3H94A 4DNRB 3URYA 1EQTA 4A3BB 1JOKA 3MXNA 3RZOB 1OO9B 2O2LD 4KK7A 3ONAB 2A6EC 4CJ1B 3J81L 4R9WA 1RODA 2F0FA 3LWEA 5D3DA 4KKTA 4CGYB 2NVTB 5NUCA 1I6HB 1CA6A 2EYPA 2BA1A 1VF7A 2FINB 1QCBD 3NE5B 1B9NA 1ICWA 1GHJA 1SYCA 5K36G 1TS5A 2QKIC 3E0JA 1Q3LA 2KECA 1J9OA 5M5WB 4G7OC 1Z7TA 4LMQD 2AUKA 4ILWA 4RHRA 4QF4A 3OW7A 1EFID 1AW7A 2X6GA 2GA4B 2RDGA 3HOWB 4ZKCB 4KKSA 1HA6A 2DY7A 1EY6A 2QILA 1RHPA 1IW7C 2V4DA 5C0XH 2K6AA 3CQZB 4J6HA 1F2ZA 2NTTA 1D1KA 2OT2A 5D3IB 2DN8A 2KQ3A 3OIPA 2BOSA 4A3FB 2R93B 4KV6A 3MZ5A 1IYUA 2BE5C 1DXMA 4ZUIA 4M1UB 4X3KA 1U4MA 2B2VC 2RSOA 1Y69U 1I50B 3X3MA 1H9MA 1G6ZA 2Q8TA 1JR0D 4F87A 4FF2A 2F0PA 1C48A 4K5VA 1RF2D 1ESFA 3TZUA 1Q12A 5EKKA 1JOOA 3HOUB 1EZ6A 3IKJA 3ITPA 3MXGA 1BO0A 1I6VC 3KBGA 3JAML 2MJ8A 2D5DA 4FXKC 2A6HD 3OSOA 5I6WA 1CFMA 2SNSA 4N9TA 1BUVT 3EROA 1U4RA 3VR6A 4DXGA 1TU2B 1SFOB 3T56B 1BQQT 1PRTC 3W3AA 2A69D 3CKIB 2VNUD 1HCZA 4RGMA 5ISRA 2K5WA 5COYA 4K6DA 4CBVA 2PMZB 1NUCA 2F0IA 1AZQA 1HTPA 3MFYA 4IUVA 1S5FD 3NPPA 4X3UA 1X3PA 2F3WA 1EY7A 4DN4M 5KGUA 1HUMA 1TS2A 1EYDA 1MBYA 5E1FA 2HCCA 1Q1BA 4ZQ3A 2NVYB 1CM9A 2A68D 3IL8A 2VB3X 5G3LF 5I9PA 2B8GA 3I72A 4XDXA 1TVXA 1SNPA 2JSOA 3NK9A 3HRZC 2B2WC 2XRSD 3HOZB 3ZYYX 3PIO3 2NWGA 4RHSA 4A3GB 1E2VA 1JICA 2Q8RE 2AWOA 1YNND 5KNCA 3A56A 4UAIA 1ZXTA 3MAQA 1W6JA 3VA7A 4PNYA 1SJHD 3NQIA 2TMPA 3CRLC 1SYFA 2EYFA 2EYOA 3K7AB 1PLFA 1S5CD 2EY5A 2CW0C 5JEAG 4PMCA 4Q5VA 2R3ZA 4XIGS 2R61A 1A3VA 5BN5A 3H6MA 1MGSA 1GUOA 2A5HA 4WJWA 3EQLC 2A6ED 2F0OA 4U673 3J80L 3QJYA 5K36H 3FRPB 4OO1I 5IGGA 5CORA 1SEBD 4O1NA 3A7LA 4B9XA 2B2TA 1RKNA 1SE3A 3FPUB 3KLSA 2X69A 3C1FA 5CC4A 4CKCA 3K57A 2KOLA 1O78A 2PQEA 1CZGA 2NB0A 1WTVA 2RQXA 1JOQA 3U9OA 2MUYA 2Z4HA 4RAUC 1EEFD 1VMCA 3FKIB 4QB4A 4XXEA 1U4LA 3I91A 2I07B 2ID0A 1IL8A 1I4PA 1IW7D 1SE2A 3V96A 3EVQA 2QF7A 1CA5A 3FEWX 3DWAA 2ENBA 4KD4A 3Q23A 3HOVB 1D5XC 3UI2A 5J22A 1VCIA 5FO7B 3VA5A 3C3LA 2BE5D 4RKLA 1QB5D 4RGOS 4RA8A 1HQRD 3K0YA 1PZID 3QG1A 2LY7A 4K14A 1Z6HA 1B1ZA 3TBIB 1E2WA 4ZLTF 4CHTB 1G91A 2F0MA 4IURA 4KHVA 1JB3A 4IFDI 1LTBD 1PFBA 3J81E 3R3OA 1C4QA 3H91A 3WDNA 4CJ2C 1I4QA 3A55A 4TQUS 4OIKA 1NSNS 2F0HA 1LT3D 1DONA 5ELFA 4K8JA 1O7YA 2PZUA 2E2HB 2OEOA 2EJGC 4P2CB 3GTGB 3DEPA 3S14B 1OXVA 2DY8A 3C1EA 1PMRA 1BDOA 1PRTD 5LL6S 2SNMA 1AFPA 1FD7D 1JWMD 3CRKC 1OXXK 4ULLA 2N55A 5A2QE 1SNMA 3OMGA 1RJTA 5E4WC 3NXWA 1ONLA 1TY2A 4I65A 1PTOH 1ENFA 1I4GA 5C0XJ 2EPBA 1DOMA 5BN3A 4BA1I 2E74C 3PUWA 2ZXOA 1D5MC 2BDNA 2EJFC 2ZT9C 4F7XA 1RCVD 3GO5A 1QJOA 5IT9E 3WOEA 1B3AA 2Z8LA 3MXUA 2EYHA 3M4OB 2L12A 5EBCA 4C3IG 3PV0A 1Z47A 1HPCA 1KNAA 3LNNA 1TIID 3OIQA 4HN7A 3GQBA 1NR4A 3TDQA 3DMUA 3G7LA 1ZEQX 2HCIA 2B2VA 3NWTA 1PXUA 3FDTA 4HSVA 2LFNA 1WTXA 4KY7A 3NHHA 1A2UA 1LABA 1YNNC 3FVQA 3BG3A 3CHBD 3T16A 4G7HC 3T53B 2CW0D 4MIUA 5M3FB 1TY0A 3S1RB 2VB2X 3L7ZC 3BVGA 2KVMA 3GTPB 4DF7A 3DUZA 4G57A 1IYVA 1YNJD 4M8AA 3M3YB 1B2TA 1STAA 5KYIA 5FO8B 1SYDA 3KF8A 2M9VA 4XYOA 5LL6X 2CQAA 1U4PA 2D2CC 1F2MA 3BS1A 1LO5D 2XN9C 4RWSC 4OO1G 1HQMC 2L4NA 3HKZB 2OF1A 2LMCB 3Q0AA 3GTLB 1PZJD 5ELEA 2IL8A 5CV8A 1H9KA 2XWBB 2VUMB 3BVMA 5CYUA 1Q90A 4XQQA 1TS4A 1BCPB 1F77A 4YIJA 1C8CA 3LWUA 1U9RA 4HTHA 4IALA 1S4ZA 3S16B 3MXPA 3SR1A 2E2IB 4B08A 1KDBA 4HCSA 2NUCA 1FR3A 3SDZA 5EPJA 5C4JB 5EGTA 2C9OA 1GUSA 2B2WA 2BDOA 3AU7A 2G9HD 1HXYD 3BZDB 3OHXC 1O7ZA 2WAQB 3C46A 4K6LA 1G2SA 1LTTD 3MEHA 4C3IB 1BCPF 1STHA 3SVMA 4DAYA 1J8IA 1LTAD 2NVXB 2F0WA 2D9UA 2Z1CA 1B53A 3A54A 1I4XA 5EQ0A 3EJIA 3VR4A 3GTJB 1K83B 1KABA 3S1QB 4EQNA 2RA4A 1V1PA 2F0JA 2O4XA 3D8GA 2FMMA 5C5LA 4IZ8A 5D14A 4H7BA 2E75C 3HS0C 4NKLA 1LT5D 2WKCA 4IFDG 4LAAA 3E5SA 5LHY1 4HR7B 3NBHA 2DNCA 3H3VC 1R4PB 3EA6A 4L8JA 3RD4A 1FYCA 3S1NB 1CK1A 3RLFA 5EBDA 5EJWA 1D1IA 3I4MB 5G3LD 3I4NB 2F0LA 5M5XB 1ET6A 4OGQC 2MPMA 3S2DB 3BDLA 4A3EB 1QWYA 3VYTA 3TMEA 4BA2I 2K32A 4ZUJA 4FYDA 2XNAC 5C6AA 1Y8NB 1GHKA 5C3EB 4BY1B 2G9DA 4FVMA 2XIWA 3NTKA 3BDOA 1I4HA 1STNA 2AQ3B 1SYGA 1A3TA 3IAYA 4IUTA 4Q0FA 5AFWA 4C3HG 4DU9A 4L6TB 3MHBA 3HEJA 1CT1D 5JVG3 3KUPA 5CGKA 2Y0SB 2F0EA 4KTAA 2J4XA 4EGVA 1LTSD 5I2YA 1OXTA 5E3FA 3Q24A 3D31A 5C3XA 1M8AA 5T1GA 1BF4A 1KTKA 3IFTA 3J7AF 4C2MB 2K03A 5C4HA 1GOZA 1EY0A 2ZXPA 4XQJA 5EKLA 1K8MA 3PUZA 5DNFA 1ENAA 1G2TA 2L1BA 5CV4A 1TKWB 1EL0A 4A3DB 2WB1B 5IGDA 3NQTA 3EFXD 3SEBA 4DK0A 1AN8A 1EU3A 1I4RA 1SDFA 5KNBA 1ZKOA 3R2TA 1O7LA 1LACA 2XSCA 5DM63 1H9JA 1QG7A 4JBWA 2H1EA 4K2KA 3NTHA 2DNEA 4OO1H 3TSSA 2CVRA 1ML0D 2KCCA 2FMCA 5IODA 4OHJA 4HAEA 2Q8IB 3GTKB 1PFMA 3P20A 3IFDA 1EY9A 1IKMA 4RH6A 3P7JA 3K5OA 1YNJC 4DFAA 1HFNA 1LTRD 3HGBA 1DCZA 3OWEB 1BCPC 1H9SB 2F0VA 1ZYRD 4V190 4A3JB 3N6RA 1LTGD 2R7ZB 1JQYD 5CV9A 3NP8A 3D4DA 1ESRA 3BDCA 4JK1C 3QOLA 4DGZA 4C3HB 5HURA 4IN3A 3TZDA 3P75A 2EY1A 3H0GB 1X32A 4J1MA 1SNCA 2L9HA 2WV6D 1UAPA 5CBAE 1PZKD 2IW3A 5IGFA 4NW2A 1STYA 3D4RA 1VDZA 4HSPA 1DOKA 5DAUA 1EEID 4G4KA 2EE1A 2PO4A 1R9TB 5JEAJ 1PTOB 3D6CA 3Q6SA 3D4WA 2Z4IA 1PFNA 2ICEC 3K5LA 4XT3B 2YU9B 1BXTA 2B2YC 1K8OA 2AUJD 1F2LA 4IFDH 1CHPD 3MTSA 1AEXA 1SYEA 4H0LC 2F0DA 2WINB 2JA5B 1MD2D 1S5DD 3M4YA 2XWJB 2MHVA 2WACA 2KUMA 3A7AB 4DAPA 2AQ1B 5FKAC 1D2BA 2FJ2A 3MFGA 2F0UA 1F9SA 1PTOF 1LV9A 1UUPA 5KNDA 4RCOA 1CQVA 1XYIA 2OXPA 2RDFA 2K28A 2JA8B 3I8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O78 A;  1OXT A;  3FMC A;  3FPP A;  3D31 A;  3H94 A;  1OXV A;  2PCF B;  4DNR B;  1E2V A;  3VR4 A;  1PMR A;  1Y69 U;  1H9M A;  2A69 C;  4IQZ A;  1BDO A;  1IYV A;  4JK1 C;  4LJZ C;  1H9S A;  2D62 A;  3KLR A;  2EVB A;  3IFT A;  2AWO A;  2JEA I;  5KNC A;  4DNT B;  3A8K E;  2A6E C;  3CRK C;  1OXX K;  2E75 C;  3TZU A;  1H9R A;  1Q12 A;  3A8J E;  1IW7 D;  3PUY A;  3VA7 A;  1K8M A;  1GUN A;  2D2C C;  4KKT A;  3OPO A;  3PUZ A;  4KN7 C;  4IFD G;  3AB9 A;  2QF7 A;  4KI0 A;  1DD2 A;  1ONL A;  4OO1 G;  2E76 C;  3DXJ C;  1A6X A;  1B9M A;  2B8F A;  2BA1 A;  1TKW B;  3CRL C;  3D4R A;  4I7Z C;  3IKJ A;  4HR7 B;  1VF7 A;  1VDZ A;  5C0X G;  1HQM C;  2DNC A;  1I6V C;  2LMC B;  3I4L A;  4L8J A;  3NE5 B;  1B9N A;  4DK1 A;  1FYC A;  5BN3 A;  1H9K A;  2D5D A;  1GHJ A;  3OOC A;  4BA1 I;  5K36 G;  4TKO B;  2E74 C;  2A68 C;  4PV1 C;  4DK0 A;  3PUW A;  4KN4 C;  1Q90 A;  2CW0 C;  3RLF A;  1GUT A;  2EJF C;  2K33 A;  2A6H D;  4H44 C;  2IT1 A;  2ZT9 C;  5JEA G;  1VCI A;  2NN6 G;  3M7N A;  1QJO A;  5KNB A;  1ZKO A;  2BE5 D;  2PNR C;  4RCN A;  3T51 B;  1CFM A;  4XTC S;  4G7O C;  3LWU A;  1Z7T A;  4KKU A;  3QIA A;  4XIG S;  1GJX A;  2AUK A;  1OXU A;  1O7L A;  1LAC A;  3VR3 A;  3VR5 A;  5JEA H;  4OGQ C;  2JEB I;  3PUX A;  3VR6 A;  1TU2 B;  3QG1 A;  3T56 B;  3OW7 A;  1H9J A;  2YYZ A;  3MXU A;  1K8O A;  2AUJ D;  3I73 A;  1Z6H A;  2O5J C;  3W3A A;  4JBW A;  1FR3 A;  2A69 D;  3ND9 A;  3SDZ A;  3VR2 A;  1HCZ A;  2JE6 I;  3PV0 A;  2KA7 A;  5BN5 A;  1E2W A;  1V43 A;  2K32 A;  4BA2 I;  4IFD H;  2DNE A;  4OO1 H;  1GUO A;  1HPC A;  1G29 1;  3LNN A;  2EJM A;  4KKS A;  1GHK A;  1Y8N B;  1ZYR C;  2KCC A;  3GQB A;  3EQL C;  2V4D A;  1IW7 C;  2A6E D;  1GUS A;  5C0X H;  1HTP A;  2BDO A;  2R6G A;  3MFY A;  4LK1 C;  2JXM B;  2Q8I B;  1CI3 M;  1Q1E A;  3QJY A;  1E2Z A;  5K36 H;  4H0L C;  3A8I E;  3BDO A;  2L5T A;  5BN4 A;  4H13 C;  3P20 A;  2DN8 A;  1GUG A;  4G7Z C;  2NN6 H;  2PPB C;  2EDG A;  3WDN A;  3SE0 A;  3U9S A;  3M4Y A;  4GZY C;  4KMU C;  3A7L A;  1YNJ C;  3GD7 A;  1CTM A;  3A7A B;  3HGB A;  1Y8P B;  1Q1B A;  1DCZ A;  2K7V A;  1VF5 C;  1LAB A;  2BA0 A;  1T5E A;  4TQU S;  1YNN C;  2A6H C;  3PUV A;  2A68 D;  3BG3 A;  1Y8O B;  2NN6 I;  1H9S B;  1V8Q A;  4G7H C;  1IYU A;  3T53 B;  3ND8 A;  3N6R A;  1OXS C;  2BE5 C;  2B8G A;  3I72 A;  2O5I C;  4KHZ A;  5KND A;  1DXM A;  1EWH A;  3L7Z C;  3M85 A;  1SMY C;  5A35 A;  2EJG C;  2F1M A; 
#chains in the Genus database with same CATH topology
 1PV4 A;  3GTQ H;  1WTR A;  2PZT A;  1TWG H;  2F3V A;  2NBF A;  2ZTE A;  4IQZ A;  2K5N A;  3S1M B;  4LJZ C;  3PO3 H;  2D62 A;  1EYA A;  4GKJ L;  1SXT A;  1E0B A;  3E0E A;  1S72 A;  3W2D A;  5C4X H;  2WAQ E;  1HNX L;  1SMX A;  5M3M G;  2L55 A;  3T4A C;  4ZRZ A;  4ODG A;  2MGS A;  1LT4 D;  1WOC A;  2JYO A;  3DXJ C;  1H95 A;  3HP3 A;  1B9M A;  3L3O C;  4PZ8 A;  4I7Z C;  1JJC B;  2JP1 A;  1TWF B;  4MHE A;  4A3I G;  4A3M G;  2HDL A;  3E6Z X;  1TR5 A;  4K2L A;  1JC7 A;  4TKO B;  1D7Q A;  1MHW C;  1XNQ L;  4DV0 Q;  3V2T A;  4GOP C;  1PH3 A;  5M5Y B;  4X3T A;  4EQP A;  3D6W A;  2IY5 B;  2EY6 A;  1EIG A;  4EQO A;  2PNR C;  4BBR H;  1BNZ A;  2RHQ B;  1VQJ A;  1LM0 A;  3BVZ A;  1XMQ L;  2PZW A;  1NR2 A;  4DR1 L;  1GJX A;  2TSS A;  4B9W A;  3CCL A;  1SE8 A;  2JEB I;  3RUZ A;  1S3O A;  3HOY B;  4A3B G;  4ID6 A;  4FNF A;  4XYQ A;  3RZD H;  2K04 A;  3VR2 A;  4WOR A;  1LLR D;  4GKK Q;  2DGY A;  2F0Q A;  2FXQ A;  3I90 A;  4JI8 Q;  4LF5 Q;  3FP9 A;  4ZYS A;  4PZ6 A;  4YHH Q;  4LK1 C;  1SLJ A;  2X6L A;  1IBM Q;  1E2Z A;  4YCW A;  2K5Q A;  2P5Z X;  2B63 G;  4BY7 G;  2I0Q A;  1HHV A;  5IWA L;  1I3Q B;  3L9A X;  4H13 C;  1EY5 A;  4EQ5 A;  4NDX A;  1GUG A;  3NSW A;  4DAV A;  2PYK A;  3BU2 A;  2RSN A;  3R8B A;  5I9O A;  3L2P A;  4HCE A;  1SNQ A;  4DA2 A;  4AIM A;  1B50 A;  2K7V A;  1WVL A;  1VF5 C;  5CR3 A;  4OIJ A;  5FLX L;  4PMW A;  3BYY B;  1EU4 A;  2NN6 I;  1SJE D;  2IJ0 A;  1DYQ A;  3MXN B;  4NMZ A;  4YY3 L;  4DUY L;  2ZM6 Q;  1G8Z D;  4R4Q A;  3UDX A;  2F1M A;  2IHF A;  3FPP A;  2VXW A;  5IOC A;  3FMC A;  4WRD A;  1KIX A;  1V1Q A;  1QUQ B;  1CSQ A;  4DXF A;  1CHQ D;  3HOW G;  4DR3 L;  2H4O A;  1K9M C;  4RFB A;  2E2J B;  4DNT B;  3S2H H;  3SXH A;  1L1O A;  5IE8 A;  3JAM E;  4HID A;  5DM7 3;  4DUZ Q;  4DR2 L;  1H9R A;  3A8J E;  5EPL A;  3DWP A;  4HJ9 A;  1SBB B;  5IGE A;  3HOX B;  2K01 A;  2SEB D;  4XT1 B;  4FXD A;  2E76 C;  1F9P A;  3HZX A;  2IPK D;  2D0P A;  2R93 G;  4QIW B;  5FOB B;  1QIL A;  4BBS B;  3AYH B;  3GTO B;  4JYA Q;  5ELC A;  4DK1 A;  1SSO A;  4L63 B;  4C1N K;  1X54 A;  5FO9 B;  1Q46 A;  2JA7 H;  1BCP D;  4TRD A;  4WFN 3;  1J5E L;  3QO2 A;  2KHS A;  2YTV A;  1QOH A;  1OXU A;  4R4C A;  5LMN Q;  3K58 A;  3DM1 A;  4HJ7 A;  1STB A;  2F0K A;  3S15 B;  1KNE A;  1N9W A;  5IIF A;  3PCO B;  1X3E A;  1IHZ A;  2O5J C;  5F2D A;  1WCM B;  3S17 B;  3S9W A;  2NVQ H;  3MEF A;  4A3M B;  4OL7 A;  3RN5 A;  2ZJP A;  1BOS A;  1ZYR C;  1VQ9 A;  1VQD A;  2KJX A;  3CCM A;  4R4T A;  3CCQ A;  2UXD Q;  3KLS X;  3CW2 C;  3NTI A;  3HOU G;  5M9O A;  5BR8 L;  4QUC A;  1Q86 C;  3TP5 A;  2WB1 E;  3SK6 A;  2ICI A;  4G7Z C;  3H3V I;  1Y1W H;  4JI0 L;  1CKO A;  4KHP Q;  1II3 A;  2B2U C;  5I2X A;  2EYJ A;  5IGC A;  2QDB A;  4A3K H;  2RVL A;  1CTM A;  2K5D A;  4KLK A;  3DWQ A;  3G6J B;  1Y8O B;  3J7A V;  3GDE A;  1W2B A;  1AZP A;  1FJG L;  1D6E C;  1L0X B;  5L37 A;  4QGU A;  1PTO C;  4KHZ A;  2IX1 A;  2B39 A;  3OTO Q;  2WKD A;  2L0C A;  4MTN A;  3RLN A;  3K5M A;  5C4Z A;  2B63 B;  3I70 A;  4BY7 B;  3CC2 A;  2PCF B;  3K59 A;  2K05 A;  2Z6K A;  4C3J G;  2L15 A;  1YJW A;  1STG A;  4Z9C B;  5CMD A;  4GS3 A;  2NTS A;  2N8N A;  3NEL A;  2N3S A;  3TN2 A;  3QOJ A;  4ME5 A;  5JVH 3;  1TS3 A;  3W5O A;  1HA5 A;  1QNU A;  2C35 B;  3AFQ A;  1SMY D;  1UE7 A;  1WTP A;  1DD2 A;  1STE A;  1SR3 A;  4KJO A;  3NWS A;  3GP7 A;  1SAP A;  4DV6 L;  5AJ3 Q;  4JV5 L;  5CV5 A;  3P1H A;  4IUQ A;  4CJ0 B;  2F0G A;  3E9I A;  5A2Q L;  5LMU Q;  4PV1 C;  1L0Y B;  4Y7N B;  2FFK B;  4H44 C;  1B8A A;  2KED A;  2MP1 A;  4GNX B;  4BS9 A;  2XVS A;  3HOZ G;  3H09 A;  2K5H A;  4CDC C;  5IYB H;  1HNX Q;  3VR3 A;  3J80 E;  1YJN A;  4QUF A;  3CCR A;  4DKA C;  3ND9 A;  5M3M H;  2PW5 A;  2KA7 A;  5IT9 L;  3RMH A;  5KYL A;  3K5N A;  1DM0 B;  2UUA L;  5JOB A;  2PNH A;  1Y1V G;  1A15 A;  1K3R A;  2JA6 B;  4DV4 Q;  4A3I H;  2R6G A;  1MI2 A;  1KD1 C;  2JXM B;  3RNU A;  2L5T A;  5IY0 A;  5C0X I;  3AQQ A;  4K5W A;  2BH2 A;  1F2Y A;  2EDG A;  3TS2 A;  2B3G A;  3MC0 B;  4IJH A;  1YIT A;  3PO2 B;  1PYS B;  1JJG A;  1YHB A;  3PUV A;  4A3B H;  2AMC B;  1JWU D;  1OXS C;  1PYW D;  1SYB A;  4IUN A;  3RZO H;  3C2P A;  5IGB A;  1FGB D;  3M85 A;  1XTC D;  3GV6 A;  5DEH A;  3TP8 A;  1IYJ B;  1PH7 A;  1KAA A;  3DEO A;  3R93 A;  5IWA Q;  2R92 B;  2PQA B;  3LX0 A;  1VQH A;  2NVT H;  2HQE A;  1I6H H;  1KLG D;  3I7F A;  2RBM A;  2EYM A;  3DHQ A;  3KLR A;  4R8I A;  2EVB A;  1B44 D;  2PW7 A;  1EYC A;  4GN3 B;  3CAM A;  1DOL A;  1V1O A;  3VYU A;  1W6K A;  3PUY A;  2YTX A;  5D65 A;  5J3B A;  2HHH L;  4DUY Q;  4IOC A;  3CU7 A;  1XX8 A;  4JI7 L;  3AB9 A;  2CQO A;  4X64 L;  4IFD J;  2B2Y A;  1FNV A;  3GTM B;  5M5W H;  1TWH B;  1PH1 A;  3OWF A;  5C44 B;  3SK8 A;  5IP7 G;  1L0W A;  4C3J B;  1L2F A;  4A3L H;  4IUU A;  3VYR A;  4BBR G;  1VQ6 A;  3SK5 A;  2SOB A;  4LF6 L;  1BVS A;  2K33 A;  4AYB G;  5KRU A;  2C5C A;  2NN6 G;  3NEM A;  1KDC A;  2AWN A;  3HOW H;  4KJN A;  1HTL D;  2VL6 A;  3J81 c;  1NAP A;  3CQZ H;  3PUX A;  5CV7 A;  3ULJ A;  4IJL A;  2YYZ A;  3CME A;  3I73 A;  4ZKB B;  3FKI G;  4LF7 Q;  4OWW B;  3SHL A;  1WTO A;  1RTO A;  2WP8 J;  4X66 L;  1HNZ L;  5JPM C;  1SRU A;  3NUC A;  4A76 A;  3O13 A;  1PVO A;  4A3F H;  2CCZ A;  2R93 H;  5ELB A;  5EPK A;  1R4Q B;  5JJK A;  1J5E Q;  2AKW B;  1F9R A;  4EVO A;  3CXC A;  1SNO A;  4L5Q A;  2F03 A;  1WD0 A;  1OTC A;  3ULP A;  3UE0 A;  5JJZ A;  2IX0 A;  3UDG A;  3D3R A;  4GZY C;  2K4K A;  1C9O A;  4X3S A;  1HFG A;  3HOV G;  2I5L X;  1K8A C;  3T1Y L;  1I50 H;  5HGT A;  1TWA B;  4E6I A;  1S5E D;  1V8Q A;  3ND8 A;  4DR6 L;  2F0T A;  2QCP X;  1MSG A;  1Y1V B;  4RKB A;  2M00 A;  2O5I C;  4JI1 Q;  1TWC B;  2LS0 1;  3HG9 A;  1K8G A;  4FF3 A;  2EXZ A;  4ZK9 B;  4LF9 Q;  3STB C;  1ENC A;  1T5X D;  3QWN A;  1TT2 A;  5BR8 Q;  4JVZ A;  4B3S L;  3FHW A;  4O2D A;  4FP5 D;  1RL2 A;  4A93 B;  4JI0 Q;  4UDU C;  3HOU H;  4HMJ A;  4GOP A;  3AMU A;  5C3W A;  3V05 A;  3G4S A;  1V9P A;  4R4I A;  5CV6 A;  3GTQ B;  2UXB L;  1VQO A;  4FXG C;  1FJG Q;  1UE6 A;  1TWG B;  3OPO A;  2ZJQ A;  1HNW L;  4KN7 C;  5CBE E;  3CF5 A;  3PO3 B;  4BXX G;  3QB3 A;  1JE4 A;  4AQY L;  2RKS A;  2F4I A;  3I4L A;  5JPN C;  3GV3 A;  1LTI D;  1WD1 A;  2EZV A;  1SFO H;  5C4X B;  1WTQ A;  3TP7 A;  4LFA L;  1HZ9 A;  2IT1 A;  4O42 A;  2NZH A;  5FLX E;  3PF4 A;  1PTO D;  2BCO A;  3PIP 3;  1GXD C;  4J8Q A;  3TQY A;  2EY2 A;  1WJJ A;  5KIX A;  4ALP A;  1D5Z C;  3CPW A;  1IL2 A;  2F4V L;  4DK6 C;  4XQN A;  2EXD A;  4DV6 Q;  3F2U A;  2IX3 A;  4BBR B;  1JCK B;  2EJM A;  3JAM c;  4V0B A;  1QE6 A;  3DLL A;  4HJA A;  4AYB B;  3MWY W;  1A8V A;  1ILQ A;  3J7Y W;  2NVY H;  4TSS A;  2Z9H A;  5BN4 A;  3RZD B;  4FF4 A;  4O0A A;  3ER0 A;  4OX9 L;  5C5M A;  1NE3 A;  1JWS D;  2WII B;  2LXK A;  2EOT A;  3F2C A;  3HOZ H;  4RGN A;  3T13 A;  2BA0 A;  1NY4 A;  4A3G H;  4K0K L;  1YZ6 A;  2UUA Q;  4GNX C;  1NMF A;  2E8G A;  1QZG A;  1JE5 A;  2E2D C;  1EWH A;  1I94 Q;  1LT6 D;  1SMY C;  1EQV A;  1P8L A;  4RGT A;  3X3N A;  2NYZ D;  2VZA A;  2SDF A;  1HZC A;  4UHV A;  1H9S A;  3WOF A;  1TQO A;  2D0O A;  3J7A 5;  3K7A H;  2JEA I;  4B3R L;  1RDP D;  3A8K E;  2Q2I A;  4C1N I;  1CQF A;  1XMO L;  4HJ8 A;  3K6O A;  1GUN A;  1UE5 A;  4B3M L;  3OMC A;  3CMA A;  1EWC A;  3BJU A;  2OWO A;  1DJR D;  4NP5 A;  1A6X A;  2B8F A;  2JN4 A;  4QY7 A;  4BWG B;  4LF8 L;  5IYC H;  5C0X G;  3S2H B;  3OOC A;  2N88 A;  4C56 C;  4R8N A;  4KN4 C;  5M3F G;  4N9P A;  5IYB G;  1BBW A;  1N36 Q;  4RCN A;  3N52 A;  4FF1 A;  4XTC S;  1YHQ A;  4KKU A;  1N8R C;  2ZXR A;  2E5L Q;  2HHH Q;  1NJI C;  1E24 A;  4KD3 A;  2B2U A;  1ET9 A;  2IWH A;  3KBX A;  3TRE A;  4KY6 A;  3A5Z B;  1O80 A;  2JA7 B;  1Q8I A;  1XPU A;  2UXC L;  2KCN A;  5TSS A;  2L11 A;  3KK7 A;  5ELD A;  4GLX A;  1G29 1;  4CKB A;  3Q22 A;  1EZ8 A;  2NZO A;  3E3X A;  4LF6 Q;  1WTW A;  4LFB L;  5IP7 H;  2NZ1 D;  2LKV A;  3KOJ A;  1PH4 A;  1Q1E A;  4HED A;  3A8I E;  1UEA B;  2MO1 A;  4JI5 L;  3VDY A;  4B3T L;  2KBN A;  1F9Q A;  2NVQ B;  1XWE A;  1B4O A;  4PZ7 A;  2NN6 H;  3HKZ G;  2QEJ C;  5J1Z A;  3U9S A;  2VUM G;  4UP9 A;  3GD7 A;  2F0N A;  1T5E A;  1D8L A;  1WI5 A;  3BYT B;  1BR9 A;  2A6H C;  2CH4 A;  2HUG A;  1HNZ Q;  1JOR A;  3FKI H;  1QNK A;  3KF8 B;  1Y1W B;  1VMP A;  4JI6 L;  5GAH C;  5EKI A;  4JG2 A;  1MSH A;  3VYS A;  4A3K B;  4P71 A;  4QCL A;  3M7G A;  3J80 c;  4QMG A;  1UNS A;  2A74 C;  1ILP A;  1XXG A;  3M4Q A;  1GM5 A;  1M1K C;  4CKE A;  2A69 C;  1EY4 A;  1PRT B;  2KEE A;  1GKH A;  5KEE A;  3KYH C;  2EYL A;  3M9B A;  3KF6 A;  4HMI A;  2K1B A;  2B2T C;  3T1Y Q;  3A0J A;  1RTN A;  1PDQ A;  4DR6 Q;  3HOV H;  5FK9 C;  4F88 A;  2PI2 E;  4P73 A;  5E4X A;  1IBK L;  1KLU D;  4A3L G;  2WAQ G;  2XRQ D;  4KI0 A;  1SND A;  2GN5 A;  1PHJ A;  1FNU A;  1K0R A;  3LGJ A;  2HDM A;  3I3C A;  1X3F A;  4IUP A;  1NCV A;  1FGU A;  1AP0 A;  4DV3 L;  1M4V A;  3MVV A;  2VQE L;  4I7A A;  1XTD A;  2F3I A;  2A68 C;  4NXM Q;  1DZ1 A;  1CKN B;  1GUT A;  2OCE A;  4HJ5 A;  1X55 A;  4ZAI A;  3M7N A;  4F8M A;  2M2L A;  3T51 B;  2UXB Q;  2F0S A;  2F52 A;  3QIA A;  1EOT A;  2RDH A;  3EIV A;  3VR5 A;  5J39 A;  5JEA H;  1GUW A;  3STB D;  1HNW Q;  1HRJ A;  1PRT F;  2I46 A;  1HH2 P;  4NXN L;  1CZW A;  4A3F G;  3R2I A;  2UU9 L;  4A3C G;  2J0T D;  4DV7 Q;  2JE6 I;  4DR4 Q;  1V43 A;  1FVI A;  1S5B D;  3NBI A;  4PMB A;  4BXX H;  2Y0S E;  4DV2 L;  3TP6 A;  1Q81 C;  1X56 A;  2AQ2 B;  5HGQ A;  3H3V H;  4LFA Q;  4ABN A;  2VS1 A;  4MN3 A;  2CHB D;  5I6Y A;  1QVG A;  4DAY B;  1CI3 M;  5T1I A;  1ASZ A;  5M3M B;  4KY5 A;  1SE4 A;  1HUN A;  2A73 B;  3PGZ A;  4K5X A;  4L5S A;  2PPB C;  3SE0 A;  2E2H H;  3SK4 A;  1E1T A;  4KMU C;  3PMF A;  3GTG H;  3S14 H;  4S3S A;  3ICE A;  1Y8P B;  5K5P A;  1PH6 A;  4A3I B;  5I4D A;  1EY8 A;  4K8I A;  1K3B C;  1V1P B;  1KDA A;  1VQ5 A;  4FO2 A;  1EIH A;  1X3Q A;  5JAV A;  3I4N G;  1IKL A;  1RD9 D;  2FHT A;  1A2T A;  4DV1 Q;  1A3U A;  2J7Z A;  3ERQ A;  4UP8 A;  4PQX A;  1BBX C;  4LF4 L;  5A35 A;  1FNW A;  4U68 A;  3MA2 B;  3H94 A;  4DNR B;  3URY A;  1EQT A;  4A3B B;  4X65 L;  1JOK A;  4GLV B;  3MXN A;  1VQK A;  3NBH B;  1OO9 B;  2O2L D;  5GAE C;  3RZO B;  4KK7 A;  5C3E G;  3ONA B;  4BY1 G;  3JC6 6;  2A6E C;  4CJ1 B;  3J81 L;  4R9W A;  1ROD A;  2F0F A;  1J6Q A;  3LWE A;  2CH4 W;  5D3D A;  4KKT A;  4CGY B;  2NVT B;  1QUQ A;  5NUC A;  1I6H B;  1CA6 A;  2EYP A;  1U0L A;  4QQB X;  2R7F A;  2BA1 A;  2UUB L;  1VF7 A;  2FIN B;  3U4V A;  2A8V A;  1QCB D;  3NE5 B;  1B9N A;  1ICW A;  1GHJ A;  3B6Y A;  1SYC A;  5K36 G;  1TS5 A;  2QKI C;  3E0J A;  1KXL A;  1Q3L A;  2KEC A;  3F1Z A;  3M4O H;  5ELN A;  1J9O A;  4B3R Q;  1NNX A;  3PF5 A;  5M5W B;  1XMO Q;  4G7O C;  1Z7T A;  4LMQ D;  1EQR A;  2AUK A;  4ILW A;  4RHR A;  4QF4 A;  2MO0 A;  1JB7 A;  3OW7 A;  1B70 B;  2MFI A;  1WYD A;  1EFI D;  4LF8 Q;  1AW7 A;  2X6G A;  3PQI A;  3OW2 A;  2GA4 B;  2RDG A;  3HOW B;  4A75 A;  4JC0 A;  4KKS A;  4ZKC B;  4P72 A;  1HA6 A;  2DY7 A;  1EY6 A;  2QIL A;  1RHP A;  1IW7 C;  2V4D A;  5C0X H;  2K6A A;  3CQZ B;  4GKJ Q;  4J6H A;  1F2Z A;  2NTT A;  2OQ0 A;  1A63 A;  1D1K A;  2OT2 A;  5D3I B;  5M3F H;  2DN8 A;  3S1R H;  2KEN A;  4A3G G;  1YHA A;  2KQ3 A;  3OIP A;  2ZJR A;  3UE1 A;  2A19 A;  4A3D G;  2WB1 G;  2BOS A;  3GTP H;  4AH6 A;  4A3F B;  2R93 B;  1C0A A;  3OYY A;  4KV6 A;  2K50 A;  3MZ5 A;  1AE3 A;  1IYU A;  4UP7 A;  1XNQ Q;  3M3Y H;  2BE5 C;  4JOI C;  5FLX c;  1DXM A;  4ME3 A;  5IYD G;  4ZUI A;  4M1U B;  1K0S A;  4X3K A;  1U4M A;  4JI3 L;  4LFC L;  3RLO A;  2B2V C;  4JI5 Q;  1XMQ Q;  2RSO A;  1W3S A;  4DR1 Q;  1QVF A;  1Y69 U;  1I50 B;  3X3M A;  1H9M A;  1G6Z A;  2Q8T A;  1JR0 D;  2CWP A;  1B7Y B;  4F87 A;  4FF2 A;  2F0P A;  1C48 A;  3EBE A;  4K5V A;  4R4O A;  1C7Y A;  1RF2 D;  3GTL H;  1UWV A;  4JBM A;  1ESF A;  3TZU A;  4OXP A;  2VUM H;  3U50 C;  1Q12 A;  5EKK A;  5IYC G;  4YCU A;  2Q2T A;  1XNR L;  5EAY A;  1JOO A;  3HOU B;  4GN5 A;  1EZ6 A;  3IKJ A;  3ITP A;  3K0X A;  3MXG A;  1BO0 A;  1I6V C;  3KBG A;  3JAM L;  2MJ8 A;  3S16 H;  2D5D A;  4JCV E;  4FXK C;  5HY6 A;  2E2I H;  4YWM A;  2A6H D;  4N8X 1;  2QDL A;  5DLQ E;  3BZC A;  3OSO A;  1RIP A;  2MNA A;  4ZCK A;  1E7Z A;  2VQF L;  5I6W A;  1CFM A;  2SNS A;  5C4J H;  1E1O A;  4N9T A;  1BUV T;  4YY3 Q;  2R7Z G;  3ERO A;  3EN2 A;  1U4R A;  2N49 A;  1N32 L;  3VR6 A;  4DXG A;  1TU2 B;  1SFO B;  2VY3 A;  3T56 B;  2R7D A;  1BQQ T;  1PRT C;  2RHS B;  2EIF A;  3W3A A;  2A69 D;  3CKI B;  2VNU D;  1HCZ A;  4RGM A;  5ISR A;  2K5W A;  3H0G G;  5COY A;  3HKS A;  4GNX A;  4DR3 Q;  4K6D A;  4CBV A;  2PMZ B;  1NUC A;  3J81 j;  3E9H A;  2F0I A;  1AZQ A;  1EUJ A;  4C3I H;  1HTP A;  3MFY A;  4IUV A;  4DR2 Q;  2QEX A;  5JJL A;  1S5F D;  2NVX H;  3D0F A;  3NPP A;  4X3U A;  1YI2 A;  1X3P A;  2F3W A;  1EY7 A;  4DN4 M;  5KGU A;  2LSS A;  1HUM A;  1TS2 A;  1EIY B;  4MTK A;  3G71 A;  1EYD A;  4NXN Q;  1MBY A;  1YIJ A;  5E1F A;  4DV0 L;  2HCC A;  1Q1B A;  4ZQ3 A;  3GTJ H;  1K83 H;  2NVY B;  3S1Q H;  1IZ6 A;  1CM9 A;  2A68 D;  3IL8 A;  2RCF A;  2VB3 X;  5G3L F;  3AEV A;  4DV2 Q;  4JPB W;  5I9P A;  2B8G A;  3I72 A;  4A3C H;  4XDX A;  1TVX A;  1SNP A;  2JSO A;  3NK9 A;  3HRZ C;  2B2W C;  2XRS D;  2PI2 A;  3PIP A;  3HOZ B;  3ZYY X;  3PIO 3;  2NWG A;  4RHS A;  2KCT A;  4A3G B;  1E2V A;  1JIC A;  4GKK L;  2Q8R E;  3KJP A;  1Q8K A;  2AWO A;  1YNN D;  5KNC A;  1NTG A;  3A56 A;  4YHH L;  4UAI A;  1ZXT A;  3MAQ A;  1W6J A;  1IBM L;  3S1N H;  3VA7 A;  4OWX B;  1TXY A;  1VQC A;  4GN4 B;  4PNY A;  4LF4 Q;  2PQA A;  1SJH D;  3NQI A;  1E3P A;  3I4M H;  2TMP A;  3CRL C;  1SYF A;  2EYF A;  2EYO A;  3K7A B;  3I4N H;  5M5X H;  1PLF A;  5IP9 H;  1S5C D;  3S2D H;  1VQ4 A;  2EY5 A;  4A3E H;  2CW0 C;  2G5D A;  5JEA G;  1O7I A;  3QR8 A;  3I56 A;  4PMC A;  4Q5V A;  2HD3 A;  2JA8 G;  2R3Z A;  4XIG S;  3CCJ A;  5C3E H;  4BY1 H;  1VQB A;  2R61 A;  1A3V A;  1PFS A;  1Z9F A;  5BN5 A;  3H6M A;  4WJ3 M;  1MGS A;  1GUO A;  1X9N A;  4DUZ L;  2A5H A;  4WJW A;  3EQL C;  2A6E D;  2Q2H A;  2F0O A;  4U67 3;  5FJ8 G;  3J80 L;  3TS0 A;  4OEM B;  3QJY A;  5K36 H;  3FRP B;  4OO1 I;  3W1G A;  1SN8 A;  1M90 C;  5IGG A;  4JYA L;  4DR5 L;  5COR A;  1SEB D;  3I2Z A;  4O1N A;  3A7L A;  4B9X A;  1PH5 A;  2B2T A;  4JV5 Q;  1RKN A;  2QGQ A;  1SE3 A;  4R1J A;  4JW0 A;  3FPU B;  1VQF A;  3KLS A;  3ULL A;  2OQK A;  2X69 A;  3C1F A;  5CC4 A;  5LMN L;  4LW1 A;  4C2M H;  4CKC A;  3K57 A;  2KOL A;  3UDF A;  4CDE C;  1O78 A;  2PQE A;  1CZG A;  2B29 A;  2NB0 A;  4QIW E;  5ELO A;  3HOY G;  1WTV A;  2RQX A;  4HIK A;  1JOQ A;  2DJF C;  3U9O A;  2MUY A;  2DUD A;  2Z4H A;  4RAU C;  4JI4 L;  1EEF D;  3NEN A;  1VMC A;  3FKI B;  4QB4 A;  4XXE A;  1U4L A;  3I91 A;  2I07 B;  2ID0 A;  1YJ9 A;  4JI2 L;  4A3D H;  4APV A;  5GRO A;  1IL8 A;  1I4P A;  1IW7 D;  1SE2 A;  3V96 A;  4Y52 H;  1CSP A;  3EVQ A;  3A5U A;  2QF7 A;  1CA5 A;  1G6P A;  3FEW X;  3DWA A;  4JI3 Q;  4HIM A;  5IYD H;  2ENB A;  4UY8 C;  4KD4 A;  3Q23 A;  3UDI A;  3HOV B;  1D5X C;  4YWK A;  3UI2 A;  5J22 A;  3OTO L;  1VCI A;  5FO7 B;  1EIF A;  3VA5 A;  3C3L A;  2BE5 D;  4RKL A;  1QB5 D;  4RGO S;  4RA8 A;  1HQR D;  3K0Y A;  1XNR Q;  3I55 A;  1PZI D;  3QG1 A;  2LY7 A;  3GTK H;  3J7Z C;  4K14 A;  1Z6H A;  4TVA B;  1MJE A;  1B1Z A;  3TBI B;  1E2W A;  2K5V A;  4ZLT F;  4IPD A;  4CHT B;  1G91 A;  2F0M A;  4IUR A;  4KHV A;  1DGS A;  1JB3 A;  3HOX G;  1SRO A;  4IFD I;  4OON A;  1LTB D;  1PFB A;  3J81 E;  3R3O A;  3T1H L;  4A3J H;  5AJ3 L;  1EQQ A;  1YBY A;  2Z0S A;  1C4Q A;  4BBS G;  3TRZ A;  4JI7 Q;  3H91 A;  1N32 Q;  4X64 Q;  3WDN A;  4CJ2 C;  1I4Q A;  3A55 A;  5LMU L;  2BH8 A;  2R7Z H;  1WFQ A;  3CCS A;  4TQU S;  4OIK A;  1NSN S;  2F0H A;  1LT3 D;  1DON A;  5ELF A;  4K8J A;  1VQ7 A;  1O7Y A;  4C3H H;  2PZU A;  1L1O B;  3AFP A;  3H0G H;  4JBJ A;  2OEO A;  2E2H B;  2EJG C;  4P2C B;  3GTG B;  3DEP A;  3S14 B;  1OXV A;  1B3Q A;  2DY8 A;  3C1E A;  1PMR A;  1WCM G;  1JJ2 A;  4DR7 L;  1BDO A;  1PRT D;  2XGT A;  3U58 A;  2ALY B;  1GD7 A;  5LL6 S;  2SNM A;  1AFP A;  1Q82 C;  4DPG A;  4DV4 L;  1FD7 D;  1JWM D;  3CRK C;  1OXX K;  4ULL A;  2N55 A;  2ATW A;  4X66 Q;  5A2Q E;  1GO3 E;  1SNM A;  3OMG A;  1RJT A;  5E4W C;  1R9T H;  3NXW A;  1ONL A;  1TY2 A;  4I65 A;  1PTO H;  1ENF A;  1I4G A;  5C0X J;  2EPB A;  1DOM A;  5BN3 A;  3KLW A;  4BA1 I;  2YU9 H;  2E74 C;  1YVC A;  3PUW A;  2ZXO A;  1E22 A;  1D5M C;  2BDN A;  2EJF C;  2ZT9 C;  4F7X A;  1N33 L;  1RCV D;  3GO5 A;  1QJO A;  1U5K A;  5IT9 E;  4X62 L;  3WOE A;  1VQG A;  3CPF A;  1B3A A;  2Z8L A;  2GVB A;  1MIU A;  2JK8 A;  3MXU A;  2DJG C;  2CFM A;  2EYH A;  3M4O B;  3G48 A;  2L12 A;  1KC8 C;  4B3S Q;  5EBC A;  2VW9 A;  4C3I G;  3PV0 A;  1Z47 A;  2I5M X;  2JA5 H;  3K7U C;  2WFW A;  1HPC A;  1KNA A;  3LNN A;  1TII D;  3OIQ A;  4HN7 A;  4QL5 A;  4JOI A;  3GQB A;  2YV5 A;  1NR4 A;  3TDQ A;  3DMU A;  3G7L A;  1ZEQ X;  2HCI A;  2B2V A;  3NWT A;  1VQ8 A;  1PXU A;  3FDT A;  4HSV A;  2LFN A;  1WTX A;  4KY7 A;  1Y14 B;  2JA8 H;  3CCU A;  4AQY Q;  3NHH A;  1A2U A;  1KRS A;  3W1B A;  1LAB A;  1YNN C;  3FVQ A;  3CC7 A;  4POG A;  3BG3 A;  3CHB D;  2H5X A;  3S1M H;  3T16 A;  4G7H C;  2A1A A;  3T53 B;  2CW0 D;  3WWV A;  4MIU A;  5M3F B;  1TY0 A;  3S1R B;  3K81 C;  4YCV A;  2VB2 X;  1VS0 A;  5FLM H;  1KL9 A;  3BVG A;  3L7Z C;  2KVM A;  3GTP B;  2AHO B;  4DF7 A;  4LF7 L;  3J81 i;  3DUZ A;  5FJ8 H;  4CDF C;  4G57 A;  1IYV A;  3KJO A;  4DR5 Q;  1YNJ D;  2F4V Q;  2PMZ E;  4M8A A;  3M3Y B;  1B2T A;  1STA A;  5KYI A;  5FO8 B;  1SYD A;  3KF8 A;  1TWF H;  2JA6 G;  3I4M G;  1ASY A;  1K28 A;  2M9V A;  4XYO A;  3ERS X;  5LL6 X;  2CQA A;  1U4P A;  2D2C C;  1F2M A;  3BS1 A;  5M5Y H;  1LO5 D;  5IP9 G;  2XN9 C;  1PA6 A;  2OTJ A;  4RWS C;  1GVP A;  4OO1 G;  2EQS A;  1FL0 A;  2UUC L;  4A3E G;  4RMF A;  1XJV A;  1X6O A;  4OX9 Q;  1HQM C;  2L4N A;  3HKZ B;  2OF1 A;  2LMC B;  3Q0A A;  3GTL B;  3PO2 G;  1PZJ D;  4LNQ A;  5ELE A;  2IL8 A;  5LMN W;  5CV8 A;  1PH8 A;  1H9K A;  2XWB B;  2VUM B;  3BVM A;  4JI4 Q;  3HOY H;  1ICF B;  2ZTC A;  5CYU A;  1Q90 A;  4JI1 L;  4XQQ A;  1TS4 A;  1BCP B;  4K0K Q;  2KHJ A;  2IHE A;  4HIO A;  1F77 A;  4UPA A;  4JI2 Q;  4LF9 L;  3I4O A;  4YIJ A;  1C8C A;  1HJP A;  3LWU A;  1EFW A;  1U9R A;  4HTH A;  3Q8D A;  3HFZ B;  2R92 G;  1IBL L;  4IAL A;  1S4Z A;  1VQI A;  3S16 B;  3MXP A;  3SR1 A;  2YTY A;  2E2I B;  4B08 A;  1KDB A;  4HCS A;  1CKN A;  1I3Q H;  1FR3 A;  2NUC A;  3M4P A;  3SDZ A;  2HT1 A;  5EPJ A;  1I5F A;  1NBW A;  1VQM A;  1T9H A;  5C4J B;  3F2B A;  5EGT A;  2C9O A;  4DV5 L;  1N34 L;  2Y0S G;  1GUS A;  2B2W A;  2BDO A;  3AU7 A;  1PYB A;  4IOA A;  2G9H D;  3CC4 A;  4L5T A;  1HXY D;  4B3M Q;  1PH2 A;  3BZD B;  3OHX C;  1O7Z A;  5C44 G;  2WAQ B;  3C46 A;  4K6L A;  1G2S A;  4X6A H;  2MQH A;  2JQO A;  2V1C C;  2K52 A;  1LTT D;  3MEH A;  4C3I B;  1BCP F;  1STH A;  3SVM A;  3CD6 A;  4DAY A;  3U4Z A;  2E2J H;  1J8I A;  1LTA D;  2NVX B;  3CCV A;  2F0W A;  2D9U A;  2JA9 A;  2Z1C A;  1B53 A;  2LXJ A;  3SGI A;  3A54 A;  3RN2 A;  1I4X A;  5EQ0 A;  3T1H Q;  3EJI A;  3VR4 A;  3GTJ B;  1K83 B;  1KAB A;  3S1Q B;  4EQN A;  1BKB A;  2RA4 A;  3ZJY C;  3HOX H;  1V1P A;  2F0J A;  2O4X A;  3D8G A;  1AH9 A;  2FMM A;  5C5L A;  1LTL A;  4IZ8 A;  4BBS H;  2UXC Q;  5D14 A;  3GTO H;  4H7B A;  2E75 C;  3HS0 C;  4NKL A;  3JAM i;  1LT5 D;  4POF A;  2GVA A;  4LFB Q;  2WKC A;  5H1S E;  4IFD G;  2CWA A;  4LAA A;  3E5S A;  5LHY 1;  4B3T Q;  4HR7 B;  2JJQ A;  4YWL A;  3NBH A;  2DNC A;  3H3V C;  1R4P B;  3EA6 A;  4L8J A;  3RD4 A;  1FYC A;  3S15 H;  4DR7 Q;  3S1N B;  4AYB E;  4P74 A;  1CK1 A;  3RLF A;  5EBD A;  4NB3 A;  5EJW A;  1WCM H;  3S17 H;  1WTH A;  3A74 A;  1D1I A;  1I94 L;  1HR0 L;  3I4M B;  1L1O C;  4A3M H;  5G3L D;  1EYG A;  3CCE A;  2ES2 A;  3I4N B;  1QZH A;  2F0L A;  5M5X B;  1ET6 A;  2Q2U A;  1YEZ A;  4OGQ C;  3KDF B;  4JI6 Q;  2MPM A;  4H02 A;  3S2D B;  3PIO A;  4A93 G;  3BDL A;  4A3E B;  1QWY A;  3VYT A;  3TME A;  4BA2 I;  1MJC A;  2K32 A;  1CUK A;  4ZUJ A;  4FYD A;  2OTL A;  2XNA C;  5C6A A;  1Y8N B;  1GHK A;  4A4I A;  4A3J G;  5C3E B;  1X3G A;  4BY1 B;  1JT8 A;  2G9D A;  4FVM A;  1N33 Q;  3PO3 G;  2XIW A;  3NTK A;  3BDO A;  4X62 Q;  1I4H A;  1STN A;  2AQ3 B;  1YNX A;  5GQO A;  1A0I A;  4DAM A;  1AE2 A;  1IBK Q;  1SYG A;  1A3T A;  3IAY A;  2Z6B A;  4BY7 H;  2B63 H;  4IUT A;  4Q0F A;  5AFW A;  4C3H G;  4DU9 A;  5C4X G;  4L6T B;  3MHB A;  4DV3 Q;  1N36 L;  3HEJ A;  2VQE Q;  4MNO A;  1CT1 D;  2HIV A;  5JVG 3;  4GOP B;  1VQN A;  3KUP A;  5CGK A;  2Y0S B;  2E5L L;  2F0E A;  4KTA A;  2J4X A;  1S40 A;  4EGV A;  1LTS D;  4QJF A;  5I2Y A;  1OXT A;  5E3F A;  1KRT A;  3Q24 A;  3D31 A;  5C3X A;  4OEL B;  1M8A A;  5T1G A;  1BF4 A;  4MZ9 A;  1VQE A;  2KCM A;  1KTK A;  1KQS A;  3IFT A;  2RF4 A;  2UU9 Q;  3J7A F;  4C2M B;  2K03 A;  1KAW A;  5C4H A;  1P16 A;  1EWI A;  3TEH B;  1UE1 A;  1GOZ A;  1EY0 A;  2ZXP A;  2ZTD A;  4XQJ A;  5EKL A;  1K8M A;  4Y7N H;  3PUZ A;  5DNF A;  1ENA A;  1G2T A;  2L1B A;  4CDD C;  5CV4 A;  1TKW B;  4LUZ A;  4EX5 A;  3S24 A;  1EL0 A;  4A3D B;  2WB1 B;  4GLA C;  3K80 C;  5IGD A;  2Z6K C;  3NQT A;  3EFX D;  5GAD C;  3SEB A;  3IRB A;  4DK0 A;  1AN8 A;  4JI8 L;  4LF5 L;  1XPR A;  1EU3 A;  1I4R A;  1SDF A;  5KNB A;  1ZKO A;  3KDF A;  1LUZ A;  3F8T A;  3R2T A;  1O7L A;  1LAC A;  2XSC A;  5JJI A;  5DM6 3;  2JA6 H;  1QVC A;  2JA5 G;  4IPG A;  3KFU A;  1H9J A;  2UUC Q;  1QG7 A;  3J80 i;  4JBW A;  2H1E A;  4LUV A;  4K2K A;  2K14 A;  2QA4 A;  3NTH A;  2DNE A;  4X65 Q;  2HQL A;  4OO1 H;  1HZB A;  3TSS A;  2CVR A;  1ML0 D;  2KCC A;  2ZM6 L;  2FMC A;  2N78 A;  3PO2 H;  1CKM A;  5IOD A;  4OHJ A;  4HAE A;  2HIX A;  1MKH A;  2Q8I B;  3GTK B;  1PFM A;  1LYL A;  1VQL A;  4L5R C;  3P20 A;  5GAG C;  3IFD A;  4PG3 A;  1EY9 A;  1IBL Q;  1IKM A;  4FDB A;  4RH6 A;  3P7J A;  4RG1 A;  3K5O A;  1YNJ C;  4NXM L;  1JMC A;  3RR5 A;  4DFA A;  2UUB Q;  1HFN A;  1LTR D;  3HGB A;  3PSI A;  1DCZ A;  3OWE B;  2R92 H;  5FLM G;  1BCP C;  1H9S B;  4N8F A;  4JBK A;  2F0V A;  1ZYR D;  4WJ4 A;  4V19 0;  4A3J B;  5IT9 c;  3N6R A;  3L0O A;  2CKZ B;  4OWT B;  4DV5 Q;  1N34 Q;  2I5H A;  1LTG D;  2R7Z B;  1X65 A;  1JQY D;  2JA7 G;  4DV7 L;  5CV9 A;  3NP8 A;  4DR4 L;  3D4D A;  1A62 A;  1ESR A;  3BDC A;  4JK1 C;  3QOL A;  4DGZ A;  4C3H B;  5HUR A;  4IN3 A;  3GTM H;  3TZD A;  3P75 A;  4IO9 A;  1TWH H;  2EY1 A;  3DM3 A;  5C44 H;  3H0G B;  1X32 A;  4J1M A;  1SNC A;  2L9H A;  4C3J H;  4DNI A;  2WV6 D;  1EOV A;  1UAP A;  1VQP A;  1Q7Y C;  5CBA E;  1PZK D;  2XTI A;  2IW3 A;  5IGF A;  4NW2 A;  1STY A;  3D4R A;  1VDZ A;  4HSP A;  1DOK A;  1G51 A;  1VQA A;  5DAU A;  1EEI D;  4G4K A;  2EE1 A;  3K8A A;  2KHI A;  2PO4 A;  1KHI A;  1IXR A;  1R9T B;  4DV1 L;  1Y1W G;  2UXD L;  5JEA J;  2QW7 A;  3F2D A;  4A3K G;  1PTO B;  3D6C A;  3Q6S A;  3D4W A;  2Z4I A;  1PFN A;  4IPH A;  4KHP L;  2ICE C;  1HZA A;  3K5L A;  4XT3 B;  2YU9 B;  1BXT A;  2B2Y C;  4LFC Q;  1K8O A;  2AUJ D;  3CP0 A;  4LUO A;  1F2L A;  2RCN A;  4IFD H;  3H15 A;  1CHP D;  3MTS A;  4J15 A;  4DK3 C;  4P75 A;  5E7N A;  1AEX A;  2ASB A;  1NMG A;  1SYE A;  4NPS A;  1HR0 Q;  1TWA H;  4H0L C;  1BBU A;  3HKZ E;  1Y1V H;  4LWC A;  1TWC H;  2F0D A;  2WIN B;  2JA5 B;  1MD2 D;  1S5D D;  3M4Y A;  1HR0 W;  1UEB A;  2XWJ B;  2MHV A;  1XPO A;  1PH9 A;  2WAC A;  2KUM A;  3A7A B;  4DAP A;  4IPC A;  2AQ1 B;  5FKA C;  1K73 C;  1D2B A;  2FJ2 A;  3MFG A;  2F0U A;  3G6E A;  4A93 H;  3BZK A;  1F9S A;  1PTO F;  3KF6 B;  1LV9 A;  1UUP A;  4RCO A;  5KND A;  1CQV A;  1XYI A;  2OXP A;  2K75 A;  2RDF A;  2K28 A;  2JA8 B;  3I8Z A;  2VQF Q; 
#chains in the Genus database with same CATH homology
 1WTR A;  2PZT A;  2F3V A;  2NBF A;  4IQZ A;  3S1M B;  4LJZ C;  2D62 A;  1EYA A;  1SXT A;  1E0B A;  3W2D A;  2L55 A;  3T4A C;  4ZRZ A;  4ODG A;  2MGS A;  1LT4 D;  2JYO A;  3DXJ C;  3HP3 A;  1B9M A;  3L3O C;  4I7Z C;  2JP1 A;  1TWF B;  4MHE A;  2HDL A;  3E6Z X;  1TR5 A;  4K2L A;  1JC7 A;  4TKO B;  3V2T A;  5M5Y B;  4X3T A;  4EQP A;  3D6W A;  2EY6 A;  1EIG A;  4EQO A;  2PNR C;  1BNZ A;  3BVZ A;  2PZW A;  1NR2 A;  1GJX A;  2TSS A;  4B9W A;  2JEB I;  3RUZ A;  3HOY B;  4ID6 A;  4FNF A;  4XYQ A;  2K04 A;  3VR2 A;  4WOR A;  1LLR D;  2F0Q A;  3I90 A;  4ZYS A;  4LK1 C;  2X6L A;  1E2Z A;  2K5Q A;  1HHV A;  1I3Q B;  3L9A X;  4H13 C;  1EY5 A;  4NDX A;  1GUG A;  3NSW A;  4DAV A;  2PYK A;  2RSN A;  3R8B A;  5I9O A;  4HCE A;  1SNQ A;  4DA2 A;  1B50 A;  2K7V A;  1WVL A;  1VF5 C;  5CR3 A;  4OIJ A;  5FLX L;  4PMW A;  3BYY B;  1EU4 A;  2NN6 I;  1SJE D;  2IJ0 A;  1DYQ A;  4NMZ A;  1G8Z D;  2F1M A;  3FPP A;  2VXW A;  5IOC A;  3FMC A;  4WRD A;  4DXF A;  1CHQ D;  2H4O A;  4RFB A;  2E2J B;  4DNT B;  3SXH A;  3JAM E;  5DM7 3;  1H9R A;  3A8J E;  5EPL A;  3DWP A;  1SBB B;  5IGE A;  3HOX B;  2K01 A;  2SEB D;  4XT1 B;  4FXD A;  2E76 C;  1F9P A;  3HZX A;  2IPK D;  4QIW B;  5FOB B;  1QIL A;  4BBS B;  3GTO B;  5ELC A;  4DK1 A;  1SSO A;  4L63 B;  4C1N K;  5FO9 B;  1BCP D;  4TRD A;  4WFN 3;  3QO2 A;  2KHS A;  1QOH A;  1OXU A;  3K58 A;  3DM1 A;  1STB A;  2F0K A;  3S15 B;  1KNE A;  5IIF A;  1IHZ A;  2O5J C;  5F2D A;  1WCM B;  3S17 B;  3S9W A;  4A3M B;  4OL7 A;  1BOS A;  1ZYR C;  2KJX A;  3KLS X;  3NTI A;  5M9O A;  4QUC A;  3TP5 A;  3SK6 A;  4G7Z C;  2ICI A;  1II3 A;  2B2U C;  5I2X A;  2EYJ A;  5IGC A;  2QDB A;  2RVL A;  1CTM A;  2K5D A;  3DWQ A;  3G6J B;  1Y8O B;  3J7A V;  1AZP A;  2IX1 A;  1D6E C;  1L0X B;  1PTO C;  4KHZ A;  2B39 A;  2WKD A;  2L0C A;  3K5M A;  5C4Z A;  2B63 B;  3I70 A;  4BY7 B;  2PCF B;  3K59 A;  2K05 A;  4C3J G;  1STG A;  4Z9C B;  5CMD A;  2NTS A;  3TN2 A;  3QOJ A;  4ME5 A;  5JVH 3;  1TS3 A;  1HA5 A;  1QNU A;  1SMY D;  1WTP A;  1DD2 A;  1STE A;  4KJO A;  3NWS A;  3GP7 A;  1SAP A;  5CV5 A;  3P1H A;  4IUQ A;  4CJ0 B;  2F0G A;  5A2Q L;  4PV1 C;  1L0Y B;  4Y7N B;  2FFK B;  4H44 C;  2KED A;  2MP1 A;  4BS9 A;  2XVS A;  3H09 A;  3VR3 A;  3J80 E;  4QUF A;  3ND9 A;  2PW5 A;  2KA7 A;  5IT9 L;  3RMH A;  5KYL A;  3K5N A;  1DM0 B;  5JOB A;  1A15 A;  2JA6 B;  2R6G A;  1MI2 A;  2JXM B;  2L5T A;  5C0X I;  4K5W A;  1F2Y A;  2EDG A;  3MC0 B;  3PO2 B;  3PUV A;  1JWU D;  1OXS C;  1PYW D;  1SYB A;  4IUN A;  3C2P A;  5IGB A;  1FGB D;  3M85 A;  1XTC D;  3GV6 A;  5DEH A;  3TP8 A;  1KAA A;  3DEO A;  3R93 A;  2R92 B;  3LX0 A;  2HQE A;  1KLG D;  2RBM A;  2EYM A;  3DHQ A;  3KLR A;  4R8I A;  2EVB A;  1B44 D;  2PW7 A;  1EYC A;  1DOL A;  1V1O A;  3VYU A;  1W6K A;  3PUY A;  5D65 A;  3CU7 A;  1XX8 A;  3AB9 A;  4IFD J;  2B2Y A;  1FNV A;  3GTM B;  1TWH B;  3OWF A;  5C44 B;  3SK8 A;  4C3J B;  4IUU A;  3VYR A;  3SK5 A;  2SOB A;  2K33 A;  5KRU A;  2C5C A;  2NN6 G;  1KDC A;  2AWN A;  4KJN A;  1HTL D;  1NAP A;  3PUX A;  5CV7 A;  2YYZ A;  3I73 A;  4ZKB B;  3SHL A;  1WTO A;  1RTO A;  2WP8 J;  5JPM C;  3NUC A;  3O13 A;  5ELB A;  5EPK A;  1R4Q B;  1F9R A;  4EVO A;  1SNO A;  2F03 A;  1WD0 A;  5JJZ A;  2IX0 A;  3D3R A;  4GZY C;  4X3S A;  1HFG A;  5HGT A;  1TWA B;  4E6I A;  1S5E D;  1V8Q A;  3ND8 A;  2F0T A;  2QCP X;  4RKB A;  1MSG A;  1Y1V B;  2M00 A;  2O5I C;  1TWC B;  2LS0 1;  3HG9 A;  4FF3 A;  2EXZ A;  4ZK9 B;  1ENC A;  1T5X D;  3QWN A;  1TT2 A;  4FP5 D;  4A93 B;  4UDU C;  4HMJ A;  3AMU A;  5C3W A;  3V05 A;  5CV6 A;  3GTQ B;  4FXG C;  1TWG B;  3OPO A;  4KN7 C;  5CBE E;  3PO3 B;  3QB3 A;  1JE4 A;  2RKS A;  2F4I A;  3I4L A;  5JPN C;  3GV3 A;  1LTI D;  1WD1 A;  2EZV A;  5C4X B;  1WTQ A;  3TP7 A;  2IT1 A;  4O42 A;  5FLX E;  1PTO D;  2BCO A;  3PIP 3;  1GXD C;  4J8Q A;  2EY2 A;  5KIX A;  1D5Z C;  4XQN A;  3F2U A;  2IX3 A;  4BBR B;  1JCK B;  2EJM A;  4V0B A;  1QE6 A;  4AYB B;  3MWY W;  1ILQ A;  3J7Y W;  4TSS A;  5BN4 A;  3RZD B;  4FF4 A;  5C5M A;  1JWS D;  2WII B;  2EOT A;  4RGN A;  3T13 A;  2BA0 A;  2E2D C;  1EWH A;  1LT6 D;  1SMY C;  1EQV A;  4RGT A;  3X3N A;  2NYZ D;  2SDF A;  1H9S A;  3WOF A;  1TQO A;  2JEA I;  1RDP D;  3A8K E;  4C1N I;  1CQF A;  3K6O A;  1GUN A;  3OMC A;  1EWC A;  1DJR D;  4NP5 A;  1A6X A;  2B8F A;  4BWG B;  5C0X G;  3S2H B;  3OOC A;  2N88 A;  4C56 C;  4R8N A;  4KN4 C;  4N9P A;  4RCN A;  3N52 A;  4FF1 A;  4XTC S;  4KKU A;  2ZXR A;  4KD3 A;  2B2U A;  1ET9 A;  2IWH A;  3KBX A;  4KY6 A;  1O80 A;  2JA7 B;  1Q8I A;  2KCN A;  5TSS A;  2L11 A;  3KK7 A;  5ELD A;  1G29 1;  4CKB A;  3Q22 A;  1EZ8 A;  1WTW A;  2NZ1 D;  2LKV A;  1Q1E A;  4HED A;  3A8I E;  1UEA B;  2NVQ B;  1F9Q A;  1XWE A;  1B4O A;  2NN6 H;  2QEJ C;  5J1Z A;  3U9S A;  3GD7 A;  2F0N A;  1T5E A;  3BYT B;  1BR9 A;  2A6H C;  2HUG A;  1JOR A;  1QNK A;  1Y1W B;  1VMP A;  5EKI A;  1MSH A;  3VYS A;  4A3K B;  4QCL A;  3M7G A;  4QMG A;  1UNS A;  2A74 C;  1ILP A;  1XXG A;  4CKE A;  2A69 C;  1EY4 A;  1PRT B;  2KEE A;  5KEE A;  2EYL A;  4HMI A;  2K1B A;  2B2T C;  1RTN A;  1PDQ A;  5FK9 C;  4F88 A;  5E4X A;  1KLU D;  2XRQ D;  4KI0 A;  1SND A;  1FNU A;  2HDM A;  3I3C A;  4IUP A;  1NCV A;  1AP0 A;  1M4V A;  3MVV A;  2A68 C;  1DZ1 A;  1GUT A;  4ZAI A;  3M7N A;  4F8M A;  2M2L A;  3T51 B;  2F0S A;  3QIA A;  1EOT A;  2RDH A;  3VR5 A;  5J39 A;  5JEA H;  1GUW A;  1HRJ A;  1PRT F;  2I46 A;  1CZW A;  3R2I A;  2J0T D;  2JE6 I;  1V43 A;  1S5B D;  3NBI A;  4PMB A;  3TP6 A;  2AQ2 B;  4ABN A;  4MN3 A;  2CHB D;  5I6Y A;  1CI3 M;  5T1I A;  5M3M B;  4KY5 A;  1SE4 A;  1HUN A;  2A73 B;  4K5X A;  2PPB C;  3SE0 A;  3SK4 A;  4KMU C;  3PMF A;  4S3S A;  1Y8P B;  5K5P A;  4A3I B;  5I4D A;  1EY8 A;  4K8I A;  1V1P B;  1KDA A;  1EIH A;  4FO2 A;  1X3Q A;  5JAV A;  1IKL A;  1RD9 D;  2FHT A;  1A2T A;  1A3U A;  2J7Z A;  3ERQ A;  1BBX C;  4PQX A;  5A35 A;  1FNW A;  4U68 A;  3MA2 B;  3H94 A;  4DNR B;  3URY A;  1EQT A;  4A3B B;  1JOK A;  3MXN A;  3RZO B;  1OO9 B;  2O2L D;  4KK7 A;  3ONA B;  2A6E C;  4CJ1 B;  3J81 L;  4R9W A;  1ROD A;  2F0F A;  3LWE A;  5D3D A;  4KKT A;  4CGY B;  2NVT B;  5NUC A;  1I6H B;  1CA6 A;  2EYP A;  2BA1 A;  1VF7 A;  2FIN B;  1QCB D;  3NE5 B;  1B9N A;  1ICW A;  1GHJ A;  1SYC A;  5K36 G;  1TS5 A;  2QKI C;  3E0J A;  1Q3L A;  2KEC A;  1J9O A;  5M5W B;  4G7O C;  1Z7T A;  4LMQ D;  2AUK A;  4ILW A;  4RHR A;  4QF4 A;  3OW7 A;  1EFI D;  1AW7 A;  2X6G A;  2GA4 B;  2RDG A;  3HOW B;  4ZKC B;  4KKS A;  1HA6 A;  2DY7 A;  1EY6 A;  2QIL A;  1RHP A;  1IW7 C;  2V4D A;  5C0X H;  2K6A A;  3CQZ B;  4J6H A;  1F2Z A;  2NTT A;  1D1K A;  2OT2 A;  5D3I B;  2DN8 A;  2KQ3 A;  3OIP A;  2BOS A;  4A3F B;  2R93 B;  4KV6 A;  3MZ5 A;  1IYU A;  2BE5 C;  1DXM A;  4ZUI A;  4M1U B;  4X3K A;  1U4M A;  2B2V C;  2RSO A;  1Y69 U;  1I50 B;  3X3M A;  1H9M A;  1G6Z A;  2Q8T A;  1JR0 D;  4F87 A;  4FF2 A;  2F0P A;  1C48 A;  4K5V A;  1RF2 D;  1ESF A;  3TZU A;  1Q12 A;  5EKK A;  1JOO A;  3HOU B;  1EZ6 A;  3IKJ A;  3ITP A;  3MXG A;  1BO0 A;  1I6V C;  3KBG A;  3JAM L;  2MJ8 A;  2D5D A;  4FXK C;  2A6H D;  3OSO A;  5I6W A;  1CFM A;  2SNS A;  4N9T A;  1BUV T;  3ERO A;  1U4R A;  3VR6 A;  4DXG A;  1TU2 B;  1SFO B;  3T56 B;  1BQQ T;  1PRT C;  3W3A A;  2A69 D;  3CKI B;  2VNU D;  1HCZ A;  4RGM A;  5ISR A;  2K5W A;  5COY A;  4K6D A;  4CBV A;  2PMZ B;  1NUC A;  2F0I A;  1AZQ A;  1HTP A;  3MFY A;  4IUV A;  1S5F D;  3NPP A;  4X3U A;  1X3P A;  2F3W A;  1EY7 A;  4DN4 M;  5KGU A;  1HUM A;  1TS2 A;  1EYD A;  1MBY A;  5E1F A;  2HCC A;  1Q1B A;  4ZQ3 A;  2NVY B;  1CM9 A;  2A68 D;  3IL8 A;  2VB3 X;  5G3L F;  5I9P A;  2B8G A;  3I72 A;  4XDX A;  1TVX A;  1SNP A;  2JSO A;  3NK9 A;  3HRZ C;  2B2W C;  2XRS D;  3HOZ B;  3ZYY X;  3PIO 3;  2NWG A;  4RHS A;  4A3G B;  1E2V A;  1JIC A;  2Q8R E;  2AWO A;  1YNN D;  5KNC A;  3A56 A;  4UAI A;  1ZXT A;  3MAQ A;  1W6J A;  3VA7 A;  4PNY A;  1SJH D;  3NQI A;  2TMP A;  3CRL C;  1SYF A;  2EYF A;  2EYO A;  3K7A B;  1PLF A;  1S5C D;  2EY5 A;  2CW0 C;  5JEA G;  4PMC A;  4Q5V A;  2R3Z A;  4XIG S;  2R61 A;  1A3V A;  5BN5 A;  3H6M A;  1MGS A;  1GUO A;  2A5H A;  4WJW A;  3EQL C;  2A6E D;  2F0O A;  4U67 3;  3J80 L;  3QJY A;  5K36 H;  3FRP B;  4OO1 I;  5IGG A;  5COR A;  1SEB D;  4O1N A;  3A7L A;  4B9X A;  2B2T A;  1RKN A;  1SE3 A;  3FPU B;  3KLS A;  2X69 A;  3C1F A;  5CC4 A;  4CKC A;  3K57 A;  2KOL A;  1O78 A;  2PQE A;  1CZG A;  2NB0 A;  1WTV A;  2RQX A;  1JOQ A;  3U9O A;  2MUY A;  2Z4H A;  4RAU C;  1EEF D;  1VMC A;  3FKI B;  4QB4 A;  4XXE A;  1U4L A;  3I91 A;  2I07 B;  2ID0 A;  1IL8 A;  1I4P A;  1IW7 D;  1SE2 A;  3V96 A;  3EVQ A;  2QF7 A;  1CA5 A;  3FEW X;  3DWA A;  2ENB A;  4KD4 A;  3Q23 A;  3HOV B;  1D5X C;  3UI2 A;  5J22 A;  1VCI A;  5FO7 B;  3VA5 A;  3C3L A;  2BE5 D;  4RKL A;  1QB5 D;  4RGO S;  4RA8 A;  1HQR D;  3K0Y A;  1PZI D;  3QG1 A;  2LY7 A;  4K14 A;  1Z6H A;  1B1Z A;  3TBI B;  1E2W A;  4ZLT F;  4CHT B;  1G91 A;  2F0M A;  4IUR A;  4KHV A;  1JB3 A;  4IFD I;  1LTB D;  1PFB A;  3J81 E;  3R3O A;  1C4Q A;  3H91 A;  3WDN A;  4CJ2 C;  1I4Q A;  3A55 A;  4TQU S;  4OIK A;  1NSN S;  2F0H A;  1LT3 D;  1DON A;  5ELF A;  4K8J A;  1O7Y A;  2PZU A;  2E2H B;  2OEO A;  2EJG C;  4P2C B;  3GTG B;  3DEP A;  3S14 B;  1OXV A;  2DY8 A;  3C1E A;  1PMR A;  1BDO A;  1PRT D;  5LL6 S;  2SNM A;  1AFP A;  1FD7 D;  1JWM D;  3CRK C;  1OXX K;  4ULL A;  2N55 A;  5A2Q E;  1SNM A;  3OMG A;  1RJT A;  5E4W C;  3NXW A;  1ONL A;  1TY2 A;  4I65 A;  1PTO H;  1ENF A;  1I4G A;  5C0X J;  2EPB A;  1DOM A;  5BN3 A;  4BA1 I;  2E74 C;  3PUW A;  2ZXO A;  1D5M C;  2BDN A;  2EJF C;  2ZT9 C;  4F7X A;  1RCV D;  3GO5 A;  1QJO A;  5IT9 E;  3WOE A;  1B3A A;  2Z8L A;  3MXU A;  2EYH A;  3M4O B;  2L12 A;  5EBC A;  4C3I G;  3PV0 A;  1Z47 A;  1HPC A;  1KNA A;  3LNN A;  1TII D;  3OIQ A;  4HN7 A;  3GQB A;  1NR4 A;  3TDQ A;  3DMU A;  3G7L A;  1ZEQ X;  2HCI A;  2B2V A;  3NWT A;  1PXU A;  3FDT A;  4HSV A;  2LFN A;  1WTX A;  4KY7 A;  3NHH A;  1A2U A;  1LAB A;  1YNN C;  3FVQ A;  3BG3 A;  3CHB D;  3T16 A;  4G7H C;  3T53 B;  2CW0 D;  4MIU A;  5M3F B;  1TY0 A;  3S1R B;  2VB2 X;  3L7Z C;  3BVG A;  2KVM A;  3GTP B;  4DF7 A;  3DUZ A;  4G57 A;  1IYV A;  1YNJ D;  4M8A A;  3M3Y B;  1B2T A;  1STA A;  5KYI A;  5FO8 B;  1SYD A;  3KF8 A;  2M9V A;  4XYO A;  5LL6 X;  2CQA A;  1U4P A;  2D2C C;  1F2M A;  3BS1 A;  1LO5 D;  2XN9 C;  4RWS C;  4OO1 G;  1HQM C;  2L4N A;  3HKZ B;  2OF1 A;  2LMC B;  3Q0A A;  3GTL B;  1PZJ D;  5ELE A;  2IL8 A;  5CV8 A;  1H9K A;  2XWB B;  2VUM B;  3BVM A;  5CYU A;  1Q90 A;  4XQQ A;  1TS4 A;  1BCP B;  1F77 A;  4YIJ A;  1C8C A;  3LWU A;  1U9R A;  4HTH A;  4IAL A;  1S4Z A;  3S16 B;  3MXP A;  3SR1 A;  2E2I B;  4B08 A;  1KDB A;  4HCS A;  2NUC A;  1FR3 A;  3SDZ A;  5EPJ A;  5C4J B;  5EGT A;  2C9O A;  1GUS A;  2B2W A;  2BDO A;  3AU7 A;  2G9H D;  1HXY D;  3BZD B;  3OHX C;  1O7Z A;  2WAQ B;  3C46 A;  4K6L A;  1G2S A;  1LTT D;  3MEH A;  4C3I B;  1BCP F;  1STH A;  3SVM A;  4DAY A;  1J8I A;  1LTA D;  2NVX B;  2F0W A;  2D9U A;  2Z1C A;  1B53 A;  3A54 A;  1I4X A;  5EQ0 A;  3EJI A;  3VR4 A;  3GTJ B;  1K83 B;  1KAB A;  3S1Q B;  4EQN A;  2RA4 A;  1V1P A;  2F0J A;  2O4X A;  3D8G A;  2FMM A;  5C5L A;  4IZ8 A;  5D14 A;  4H7B A;  2E75 C;  3HS0 C;  4NKL A;  1LT5 D;  2WKC A;  4IFD G;  4LAA A;  3E5S A;  5LHY 1;  4HR7 B;  3NBH A;  2DNC A;  3H3V C;  1R4P B;  3EA6 A;  4L8J A;  3RD4 A;  1FYC A;  3S1N B;  1CK1 A;  3RLF A;  5EBD A;  5EJW A;  1D1I A;  3I4M B;  5G3L D;  3I4N B;  2F0L A;  5M5X B;  1ET6 A;  4OGQ C;  2MPM A;  3S2D B;  3BDL A;  4A3E B;  1QWY A;  3VYT A;  3TME A;  4BA2 I;  2K32 A;  4ZUJ A;  4FYD A;  2XNA C;  5C6A A;  1Y8N B;  1GHK A;  5C3E B;  4BY1 B;  2G9D A;  4FVM A;  2XIW A;  3NTK A;  3BDO A;  1I4H A;  1STN A;  2AQ3 B;  1SYG A;  1A3T A;  3IAY A;  4IUT A;  4Q0F A;  5AFW A;  4C3H G;  4DU9 A;  4L6T B;  3MHB A;  3HEJ A;  1CT1 D;  5JVG 3;  3KUP A;  5CGK A;  2Y0S B;  2F0E A;  4KTA A;  2J4X A;  4EGV A;  1LTS D;  5I2Y A;  1OXT A;  5E3F A;  3Q24 A;  3D31 A;  5C3X A;  1M8A A;  5T1G A;  1BF4 A;  1KTK A;  3IFT A;  3J7A F;  4C2M B;  2K03 A;  5C4H A;  1GOZ A;  1EY0 A;  2ZXP A;  4XQJ A;  5EKL A;  1K8M A;  3PUZ A;  5DNF A;  1ENA A;  1G2T A;  2L1B A;  5CV4 A;  1TKW B;  1EL0 A;  4A3D B;  2WB1 B;  5IGD A;  3NQT A;  3EFX D;  3SEB A;  4DK0 A;  1AN8 A;  1EU3 A;  1I4R A;  1SDF A;  5KNB A;  1ZKO A;  3R2T A;  1O7L A;  1LAC A;  2XSC A;  5DM6 3;  1H9J A;  1QG7 A;  4JBW A;  2H1E A;  4K2K A;  3NTH A;  2DNE A;  4OO1 H;  3TSS A;  2CVR A;  1ML0 D;  2KCC A;  2FMC A;  5IOD A;  4OHJ A;  4HAE A;  2Q8I B;  3GTK B;  1PFM A;  3P20 A;  3IFD A;  1EY9 A;  1IKM A;  4RH6 A;  3P7J A;  3K5O A;  1YNJ C;  4DFA A;  1HFN A;  1LTR D;  3HGB A;  1DCZ A;  3OWE B;  1BCP C;  1H9S B;  2F0V A;  1ZYR D;  4V19 0;  4A3J B;  3N6R A;  1LTG D;  2R7Z B;  1JQY D;  5CV9 A;  3NP8 A;  3D4D A;  1ESR A;  3BDC A;  4JK1 C;  3QOL A;  4DGZ A;  4C3H B;  5HUR A;  4IN3 A;  3TZD A;  3P75 A;  2EY1 A;  3H0G B;  1X32 A;  4J1M A;  1SNC A;  2L9H A;  2WV6 D;  1UAP A;  5CBA E;  1PZK D;  2IW3 A;  5IGF A;  4NW2 A;  1STY A;  3D4R A;  1VDZ A;  4HSP A;  1DOK A;  5DAU A;  1EEI D;  4G4K A;  2EE1 A;  2PO4 A;  1R9T B;  5JEA J;  1PTO B;  3D6C A;  3Q6S A;  3D4W A;  2Z4I A;  1PFN A;  2ICE C;  3K5L A;  4XT3 B;  2YU9 B;  1BXT A;  2B2Y C;  1K8O A;  2AUJ D;  1F2L A;  4IFD H;  1CHP D;  3MTS A;  1AEX A;  1SYE A;  4H0L C;  2F0D A;  2WIN B;  2JA5 B;  1MD2 D;  1S5D D;  3M4Y A;  2XWJ B;  2MHV A;  2WAC A;  2KUM A;  3A7A B;  4DAP A;  2AQ1 B;  5FKA C;  1D2B A;  2FJ2 A;  3MFG A;  2F0U A;  1F9S A;  1PTO F;  1LV9 A;  1UUP A;  5KND A;  4RCO A;  1CQV A;  1XYI A;  2OXP A;  2RDF A;  2K28 A;  2JA8 B;  3I8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...