1H9MA

Two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
141
structure length
141
Chain Sequence
MKISARNVFKGTVSALKEGAVNAEVDILLGGGDKLAAVVTLESARSLQLAAGKEVVAVVKAPWVLLMTDSSGYRLSARNILTGTVKTIETGAVNAEVTLALQGGTEITSMVTKEAVAELGLKPGASASAVIKASNVILGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Binding protein
molecule keywords MOLYBDENUM-BINDING-PROTEIN
publication title Two Crystal Structures of the Cytoplasmic Molybdate-Binding Protein Modg Suggest a Novel Cooperative Binding Mechanism and Provide Insights Into Ligand-Binding Specificity
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 28
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9mA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9mA01
1B9NA 4XIGS 3WDNA 4OO1H 1H9KA 1A6XA 1DXMA 2KCCA 3CRKC 4BA1I 5BN3A 1Q90A 3I4LA 1H9JA 4KKUA 1E2ZA 1Z7TA 1HQMC 2AWOA 4G7OC 4RCNA 4LJZC 1Q1BA 4DK0A 1FYCA 3L7ZC 3QJYA 1GUOA 4DK1A 3P20A 1V43A 2BA1A 2NN6I 4LK1C 3VR3A 4I7ZC 4G7ZC 2B8FA 3D4RA 2DNCA 1I6VC 5C0XH 3A8IE 3GD7A 2NN6G 4KKTA 5KNDA 4BA2I 3PV0A 2AUKA 2E76C 2A6EC 2QF7A 5K36H 1ONLA 2K33A 2BDOA 4L8JA 1PMRA 4KN7C 3SE0A 3TZUA 1VDZA 2JXMB 1Q1EA 1GUTA 1TKWB 1CTMA 3KLRA 1DCZA 4OGQC 1YNJC 1B9MA 2B8GA 3AB9A 3IKJA 1OXVA 1K8MA 1GJXA 2JEAI 2DN8A 3PUWA 3VA7A 1IYVA 3LNNA 3SDZA 4KHZA 4G7HC 1OXXK 2F1MA 3A7AB 1EWHA 1HPCA 3T53B 1E2VA 3MXUA 1Y8PB 5JEAG 1CI3M 1GUSA 4JK1C 3DXJC 3ND9A 4IFDG 1Y8NB 1GHJA 3PUXA 1HCZA 1T5EA 3ND8A 2A6ED 1H9SA 4GZYC 1CFMA 3PUYA 1H9SB 2AUJD 1VCIA 2L5TA 4DNTB 1IW7C 2R6GA 4KMUC 3D31A 3I72A 1OXSC 3M4YA 2A69D 5A35A 2O5JC 3M7NA 1K8OA 4H44C 3FMCA 2ZT9C 3GQBA 1Y69U 2A69C 1V8QA 2D2CC 3W3AA 1O78A 1ZKOA 3LWUA 3IFTA 2NN6H 3BG3A 3QIAA 3VR4A 5BN5A 3I73A 5KNCA 4OO1G 1VF7A 2K7VA 1VF5C 2LMCB 2PCFB 1E2WA 2PNRC 1IYUA 3QG1A 1YNNC 2IT1A 1Z6HA 2EJGC 2O5IC 1IW7D 2EDGA 2Q8IB 4KN4C 1DD2A 2DNEA 3FPPA 3EQLC 3NE5B 3M85A 1GUNA 1OXTA 2BE5D 3PUVA 3T56B 3VR2A 4PV1C 1HTPA 2A68C 1ZYRC 5JEAH 2BE5C 5C0XG 2D62A 4IFDH 2A6HD 3A8JE 4KKSA 3RLFA 2E75C 3VR6A 5BN4A 3A8KE 1H9MA 1H9RA 3A7LA 5KNBA 2KA7A 5K36G 1LACA 4JBWA 2K32A 2EJFC 3PUZA 3H94A 1GHKA 3U9SA 3OW7A 2A6HC 4XTCS 2PPBC 1Y8OB 2EJMA 1O7LA 2JE6I 2YYZA 2JEBI 1LABA 4DNRB 3BDOA 1SMYC 3OOCA 2V4DA 1OXUA 3MFYA 3VR5A 1G291 4TKOB 3T51B 2BA0A 4IQZA 4H0LC 3OPOA 3HGBA 2D5DA 1FR3A 1GUGA 1Q12A 3CRLC 1BDOA 1TU2B 2EVBA 3N6RA 4KI0A 2A68D 4TQUS 2CW0C 2E74C 1QJOA 4H13C 4HR7B
chains in the Genus database with same CATH superfamily
1B9NA 5LMNW 2D9UA 4XXEA 1WTHA 1X6OA 2PW5A 5GQOA 4HIKA 4HIMA 1WTWA 2E5LL 5HY6A 1Q1BA 5JVH3 1EQQA 2NN6I 3CAMA 4L6TB 3TS2A 4KV6A 5ELDA 5M3FG 3EFXD 2K5VA 3TQYA 2OT2A 5C3EB 3GD7A 4YY3Q 5JJZA 4DU9A 5KIXA 4RH6A 2R7ZB 5IIFA 3HOYG 2B2YA 3BVZA 2ATWA 1FVIA 4F8MA 3MTSA 4FVMA 1CKNB 5CMDA 5C3EH 2R7ZH 1IYVA 1U4LA 2B2UC 1LTTD 1SYEA 5H1SE 4HJ7A 3MXGA 4JK1C 4GKJL 3MA2B 2A6ED 1VQLA 4JI5Q 2E2JB 1VQOA 1VCIA 4E6IA 4C3IB 3CCEA 4DN4M 4XQQA 2E2HB 3NP8A 1HQRD 4RFBA 1K28A 4HJ8A 1BBWA 3DEOA 2E2JH 3KF6A 3HOYB 4C3IH 2RVLA 2E2HH 1QZGA 3J81c 3F2CA 3T1HQ 1ESRA 1C0AA 3TS0A 2L12A 5KNCA 4OO1G 2HDLA 3HOYH 2R7FA 4LFBL 1UNSA 5K5PA 4OIKA 1IYJB 1W6JA 1WTQA 1L0YB 4B3SQ 1GUNA 3PUVA 1K3BC 4J15A 4HJAA 1ENAA 1HA5A 1LT6D 2YV5A 3BS1A 1DZ1A 2A6HD 3WOFA 3VR6A 3NPPA 5KNBA 4MN3A 1PXUA 3OW7A 4DXFA 2UXCL 1MKHA 2EJMA 2VQFL 2EYFA 4J6HA 4JC0A 5C6AA 2F3VA 1AW7A 3D4WA 1XNQL 1QOHA 4DV2L 4NXNQ 4KHVA 4NXML 1YEZA 1Q12A 3GTJB 1RKNA 4YHHQ 1AP0A 3VYRA 1LTSD 1LUZA 4H13C 3CC7A 3RZOB 3CQZB 3I7FA 4OO1H 5AJ3Q 2K28A 1B50A 3GTJH 3DWPA 1ET9A 1SMYD 1B3QA 3RZOH 2K14A 3CQZH 1VQDA 3GTMH 4FNFA 3OYYA 1SMXA 1PH1A 3S2HB 2AQ2B 2JA8G 4V0BA 3CF5A 4U68A 4X3SA 2M9VA 1I50B 2GVAA 2E76C 2L55A 2K33A 4IPDA 3S2HH 3CD6A 5CORA 1B9MA 1GVPA 3AB9A 1I50H 1SSOA 2K4KA 3Q22A 1FNUA 4DV1Q 3GTQB 4NKLA 4HMJA 1X9NA 1NCVA 4K14A 4TRDA 1QNKA 1EFID 1TWHB 2AQ1B 3CXCA 4LF6Q 1GUSA 2K04A 1GHJA 3AEVA 3GTQH 1VQGA 1ZXTA 3PUXA 1JICA 1I4XA 1FJGQ 3MEHA 1BXTA 2E8GA 5IYBH 2B2TA 2WAQG 1TWHH 1IW7C 2JA8B 2K75A 3NELA 3OMGA 3PIOA 1C7YA 4J8QA 2JP1A 3HOVG 2MUYA 2RSNA 5J3BA 1LTLA 2F0UA 5GADC 3ULJA 4KJOA 3VA5A 1M8AA 2JA8H 1SXTA 2B63G 3LWUA 4DR3Q 3IFTA 2RBMA 4JI6Q 1M4VA 4M8AA 1VF5C 4OWXB 2ZM6Q 3NK9A 1IYUA 4HIOA 3D3RA 1P16A 1Z6HA 3Q23A 1NAPA 1AZPA 1G8ZD 4ILWA 3X3MA 4JI8L 1FGUA 3S16B 4ZKCB 2IX0A 2MO1A 3M4OB 3RLOA 2E75C 1VQ7A 3S24A 2K52A 4IJLA 3HOVB 4YWLA 3U9SA 1RDPD 2I5LX 3GV3A 5IYDG 3S16H 2AWNA 4DNRB 4JI7Q 1LTBD 3M4OH 2B63B 1AEXA 3HOVH 3PO3G 3BYTB 1G6PA 2BA0A 2JA6G 5LL6X 3OPOA 1JB7A 2JJQA 3CCVA 1FR3A 1SNPA 3UE0A 2EVBA 3F2UA 2B63H 4AYBB 2E74C 5KYIA 2NZHA 2XWJB 3FP9A 4JV5Q 4XIGS 3QOJA 1H9KA 2N78A 3VDYA 4JI2Q 4IFDJ 2KCCA 2OTJA 1L0WA 3I4LA 4JBKA 1B4OA 4G7OC 4DK0A 1KRSA 5M5WB 4R4QA 2H4OA 2A1AA 5CBAE 1JT8A 2NB0A 3D4RA 2KENA 3U50C 4HJ5A 2CQOA 1BO0A 1J9OA 5M5WH 3K5NA 2HQLA 3PO3B 3A74A 2IWHA 2JA6B 2JXMB 1EYDA 1IL8A 1CTMA 5IYDH 3KLRA 3SXHA 5C5LA 1EOVA 1NR4A 4QCLA 2R3ZA 2JA6H 1NY4A 2VY3A 2R61A 3GTLB 4DR6Q 2C5CA 4UP9A 4M1UB 4CDDC 3H0GB 1TWAB 4CDFC 5JEAG 1KLUD 3K8AA 3GTLH 1T5EA 4ALPA 1KRTA 4K8IA 3H0GH 1TWAH 2JYOA 4QJFA 4LF4L 3W1GA 3R93A 4H44C 4FF3A 3W1BA 3HKSA 3GQBA 4X3KA 4HCEA 3ULPA 5I6WA 4FXGC 2C35B 2D2CC 1CKMA 4L5TA 5KYLA 1UWVA 4GOPC 2WIIB 2PZWA 1HNWL 2K7VA 2NTSA 3K6OA 2PNRC 4A76A 2QILA 1V1PA 3P1HA 1ET6A 1EY6A 1SR3A 3KDFA 4NW2A 5EQ0A 2ZJQA 2EDGA 1EU4A 1BCPD 1N8RC 5KRUA 3QOLA 5C0XI 1WTRA 5JPNC 1JOKA 1JR0D 2LKVA 4PZ7A 1RF2D 5JEAH 3GTPB 1NMGA 2HIXA 4LAAA 1DONA 4O2DA 4TVAB 1CQFA 1IBML 1VQ4A 2F0PA 3PIPA 3GTPH 1BVSA 3HOUG 4DR7L 2F0DA 3BZKA 4IQZA 3E0EA 4PMCA 4ABNA 3GP7A 1EIHA 3CMAA 1V1OA 2ICIA 4U673 4BBSG 4H02A 2OQ0A 1LT5D 4A3KG 1UEAB 4C2MB 3WDNA 1KD1C 2IHFA 3A56A 2JA9A 3M9BA 4X66Q 1Z7TA 1JC7A 1HQMC 4C2MH 4DV6L 1XWEA 1K0SA 4AQYQ 4JG2A 2JQOA 1VQHA 1X3PA 1N32Q 1Q81C 1SE3A 1BKBA 2BDNA 2CCZA 3MVVA 4FDBA 4HAEA 2QDBA 2ALYB 3HOUB 1D6EC 2KHSA 3PV0A 1D2BA 1MGSA 4DGZA 1QVFA 4YCWA 1RTNA 4JI4Q 2NVQB 1EU3A 2B8GA 3HOUH 1FNWA 1NSNS 5C4ZA 2WFWA 4BBSB 4A3KB 1XTDA 2EY6A 4G7HC 4B3TQ 3UE1A 2NVQH 4GOPA 4HSPA 3PIO3 1GM5A 4BBSH 3N52A 4A3KH 1ENFA 1T5XD 2GVBA 1I6HB 1RIPA 1JJCB 2QW7A 4CBVA 4KHPQ 1QILA 5FK9C 3K5LA 4KK7A 1QNUA 1S5BD 3H15A 4RGTA 1BNZA 1WFQA 1I6HH 3JAML 4OEMB 1QE6A 3MFGA 2HIVA 5GROA 1J5EQ 3W3AA 4RA8A 4DF7A 1ZKOA 1XX8A 3R2TA 2LMCB 3ULLA 1E2WA 3BDCA 4L5QA 4ZAIA 2Q8RE 1YNNC 2X6LA 1HNXQ 3FEWX 1V1PB 3J81j 1N34L 2MFIA 2H1EA 3FPPA 4F88A 1II3A 1GD7A 3L0OA 3C3LA 4LF9Q 2MJ8A 1HTPA 1LTAD 2XRSD 2NYZD 1B70B 3STBC 1OO9B 2KHIA 3H94A 4DR1Q 5LMUQ 1O7LA 1RTOA 1ZEQX 2PQAA 4RKLA 1SNCA 2UXBL 2VQEQ 3M4PA 3Q6SA 1X3EA 2AHOB 1TR5A 4C1NK 2CH4A 4C3HG 5IGGA 1Q82C 2RHQB 4CHTB 1IBKL 3NQTA 3HOXG 1F77A 1TWGB 2H5XA 1V43A 1IXRA 1TWGH 3DM1A 2DNCA 4IUTA 3PO2B 2AUKA 1HR0L 4BY7G 1PMRA 4LUVA 3I2ZA 3K7AB 4O1NA 1IBLL 1HFNA 4DA2A 3G6EA 3S17B 2F0LA 2EPBA 2KCNA 2NBFA 3PO2H 1SROA 2EXDA 2JEAI 1PYWD 1EY4A 1CSQA 3K7AH 3GO5A 3EIVA 1F2ZA 4OX9L 3S17H 2F1MA 1I4GA 3HOXB 4JI0L 5BR8L 3J80L 1IKMA 4GOPB 3DXJC 4JBJA 4JOIA 4LFAQ 1VQJA 4KLKA 2L0CA 2NVTB 1PZJD 3HOXH 1CFMA 2L5TA 5EPKA 2YTVA 2UU9Q 1O7ZA 1CHPD 3DM3A 3FMCA 3AQQA 2NVTH 5M5YB 5COYA 2IX1A 1SJED 1B53A 4BY7B 2C9OA 1E1TA 2JA7G 2OTLA 1NBWA 4ZUJA 4LUZA 1I4PA 1YNND 4LNQA 3QIAA 5M5YH 4POGA 4ZCKA 5IWAL 4BY7H 1XYIA 3TRZA 3T4AC 1VMPA 3NXWA 5I2YA 2AMCB 3K80C 2F0JA 1PH4A 2B2YC 5EKLA 4WJ4A 2HQEA 4DV0Q 1Y1WG 3I4MG 4HMIA 2EZVA 2A68C 4QB4A 1WTOA 3STBD 2HCCA 4KKSA 2VB2X 1EEID 4TSSA 4DV3Q 1EL0A 1V9PA 1TXYA 2K5QA 2JEBI 2EY5A 2Z9HA 4WJ3M 2JA7B 2PQAB 1LV9A 1HFGA 3T51B 1A2UA 3MXPA 2WKDA 3A54A 4ODGA 4IN3A 4QY7A 4IUUA 4GKKQ 1R4QB 5CV5A 1QUQA 2ENBA 2F4IA 2FMCA 1AE2A 2QKIC 3OTOL 2Y0SE 2RDFA 5BN3A 1O7YA 1Y1WB 3I4MB 5IOCA 4IFDI 3FKIB 1PTOC 1JWSD 4DR4L 1NUCA 3UI2A 2ICEC 1CA6A 4L63B 3T1YQ 1Y1WH 3I4MH 3FKIH 4DAPA 2V1CC 4G7ZC 1I6VC 2A74C 3SGIA 4PMBA 4K5XA 5ELOA 1ONLA 3MWYW 3P7JA 1K8AC 2CWAA 4B3RL 2G9DA 1PH6A 2YTYA 3I91A 4DPGA 4ZQ3A 1S72A 3U4VA 2HT1A 4A3CG 3NHHA 4H7BA 1RD9D 4RAUC 1HPCA 1R4PB 1DM0B 4DV5Q 1EYCA 1Y8NB 1EWCA 4N8FA 4C3IG 2O2LD 3ND8A 3C2PA 1DOKA 1A63A 3KFUA 4G4KA 3I4NG 4ULLA 3M7NA 4LMQD 3IFDA 5DEHA 3X3NA 1STEA 1F9QA 3L9AX 1HTLD 4R8IA 2IY5B 1F9SA 4R4OA 4IUQA 3I70A 4X64Q 4B9WA 3SK8A 2ZJRA 2CFMA 3MEFA 4FXKC 4ZLTF 5CV9A 3QB3A 4YY3L 1JJ2A 2DJFC 3TEHB 5C44H 4DV4Q 5E3FA 1WTVA 2X6GA 1I5FA 1MD2D 2IT1A 5GAEC 5TSSA 2PNHA 1TWCB 3GDEA 3J81L 1T9HA 3K58A 1K73C 4A3CH 1LTGD 5EGTA 4LF5Q 1OXTA 2OXPA 4I65A 2R93G 3J80i 3AU7A 2ES2A 3ERSX 3RNUA 2F0SA 2FJ2A 1TWCH 3A8JE 3I4NB 1A3TA 5M5XB 5K36G 1G51A 3CKIB 5CV7A 1BOSA 4BXXG 4XTCS 1Y8OB 3S14B 3NBHA 4A3BB 4JI5L 3ICEA 4K5WA 2R92G 3I4NH 5M5XH 2N88A 2AKWB 1Q86C 1LTID 1WVLA 1CT1D 2KOLA 2B2TC 1NE3A 3S14H 1D1IA 4A3BH 2VB3X 3N6RA 1QUQB 3PF4A 1AZQA 1X3QA 3T1HL 1TWFB 2R93B 4A75A 2ZJPA 2EY2A 4KKUA 2N8NA 1YJWA 1UAPA 1CK1A 3M4QA 4OELB 4YCUA 1BUVT 1CUKA 4DFAA 1TWFH 4ZK9B 2R93H 1D1KA 1ILQA 1JOOA 4B3SL 1YZ6A 1QCBD 4RMFA 2Q2UA 2G5DA 2R92B 4BA2I 2OF1A 1P8LA 5K36H 1J6QA 3TZUA 2PZUA 2KEEA 4BXXH 3LWEA 4A3IG 2EIFA 1TKWB 4DUZQ 1SLJA 4MNOA 4J1MA 1ICWA 1Q7YC 2R92H 2KECA 3GTMB 2O4XA 1VQ9A 5IYBG 4DNIA 2DN8A 1GJXA 1YJ9A 2F0VA 4OL7A 4OONA 3FVQA 5IP7G 1HZCA 4EVOA 1HR0W 4P71A 4NXNL 1KXLA 2J4XA 1Y8PB 1EY9A 1XMQQ 2SOBA 3KF8A 3ND9A 4IFDG 5IT9E 5LHY1 3NWTA 4YHHL 5CV8A 1EQRA 4FO2A 4X65Q 1HRJA 3PUYA 1BBXC 3GV6A 3OMCA 1MSHA 5AJ3L 4WJWA 4C56C 4XYQA 1G2SA 2D0PA 4A3EG 2B2VA 5CV4A 1LT4D 5CC4A 4IALA 2LSSA 4K8JA 1F9PA 4DR2Q 3S1RB 4GN4B 5NUCA 4A3IB 5DM63 1LTRD 3EROA 3BG3A 3S1RH 2QGQA 1EZ6A 4A3IH 4JI1Q 5FO9B 4FF4A 2I5MX 4HIDA 2UUCQ 2MP1A 1S3OA 1TS2A 1KTKA 2EYMA 4JCVE 5IP7H 3NEMA 4DV1L 4GLXA 1R9TB 3OIQA 1STYA 1WJJA 2L9HA 3D0FA 1ZYRC 1X54A 2DY8A 4IFDH 2IJ0A 4A3EB 3KF6B 3A7LA 4LF6L 2SDFA 4JBWA 1I4RA 4IO9A 1R9TH 2E2IB 1VQEA 4IPCA 4O0AA 1FJGL 3K0YA 4X3UA 5JJKA 3K7UC 1PTOB 1JWMD 3NBHB 4A3EH 2E2IH 1JE5A 4AYBG 1SE8A 1PTOH 1TU2B 3EA6A 4TQUS 1SNOA 2CW0C 1KNEA 4GN3B 4HR7B 4ZYSA 4DR5Q 4DR3L 4JI6L 2MO0A 2ZM6L 2Z8LA 4ID6A 4RCNA 1WI5A 3VYSA 3NWSA 1VQCA 1HZBA 4K6DA 1SDFA 3QJYA 3CCQA 2PZTA 2VNUD 1SN8A 4IUPA 3CPWA 2UUBQ 2KUMA 2PMZE 1FNVA 1EIYB 1VDZA 2PO4A 1OXVA 4UP7A 1XPOA 4JI7L 5IGDA 3H0GG 1JCKB 5IT9c 1UE6A 4HN7A 3BDLA 1PH7A 3T53B 1E2VA 3H09A 3R8BA 1I94Q 3L3OC 1SFOB 5CV6A 1PHJA 3MXNA 4N9PA 2LY7A 4JV5L 2AUJD 4FXDA 4FP5D 2NTTA 2R6GA 4IPHA 1EY8A 5KGUA 4UAIA 5IP9G 1SFOH 5LL6S 1QG7A 4JI2L 2AQ3B 1EWIA 1RHPA 2ID0A 1PTOF 3FHWA 4JBMA 2OWOA 1QVGA 4P75A 1SYFA 1SYDA 3KUPA 1Z47A 1BF4A 3SVMA 1TS5A 1GO3E 1EY5A 4NPSA 2F3IA 1IW7D 4YWMA 3SR1A 2EQSA 3K5MA 1N33Q 4LWCA 2Q8TA 3OSOA 1PZKD 3CU7A 5M3MG 2VXWA 4PV1C 1AE3A 4DR6L 1MJEA 1H9RA 3NENA 2ZXPA 5EAYA 1LACA 1K3RA 3S1QB 3LGJA 3T16A 3J7ZC 2L1BA 2PQEA 1S5CD 2FINB 2RDHA 3HKZG 3TP5A 5IP9H 3QR8A 3PCOB 4R4IA 2V4DA 4CGYB 2FXQA 3E9IA 1HH2P 4RG1A 4H0LC 3S1QH 2NZOA 5FLMH 3HGBA 2F0OA 3HZXA 3TREA 5EBDA 4KY6A 2Z1CA 1WYDA 1XNRQ 1K0RA 4N9TA 3PMFA 2RQXA 4LF8Q 2RCNA 5M3MB 4BA1I 1A3VA 5JPMC 3OIPA 3KK7A 3OWEB 4RKBA 1STHA 5M3MH 1F2YA 1YHBA 2IPKD 3WOEA 2B8FA 2CHBD 3HKZB 5KNDA 3ZJYC 1XMOQ 4KN7C 3KBGA 3FDTA 3NTKA 2FMMA 1E7ZA 3IL8A 3GTOB 5JOBA 1L1OA 4BWGB 3URYA 2HCIA 3PF5A 3GTOH 2WB1E 3SHLA 1VQNA 4B3ML 4RGMA 5EKKA 2I46A 3H3VI 3MXNB 5LMNQ 4ME5A 1OXSC 3M4YA 3M3YB 1JE4A 1IHZA 1K8OA 5C5MA 4WFN3 2R7DA 4QIWB 1HUNA 1A0IA 2ZXOA 3C46A 1V8QA 4AQYL 1X65A 5A2QE 1S40A 1MHWC 3M3YH 1N32L 2D0OA 4BBRG 2F0NA 1BQQT 4F87A 2VZAA 2PCFB 4Y52H 2HHHQ 1KAAA 1PFBA 2K6AA 5FJ8G 1U4RA 1I4HA 1KL9A 2ZTCA 4JI4L 4R4CA 3NE5B 1STNA 4JYAQ 4CJ2C 1NMFA 2IHEA 4EQPA 5E4WC 3VR2A 5I2XA 3GTGB 4PNYA 4XQJA 4B3TL 4L5SA 4X62Q 5T1GA 4DUYQ 1SAPA 2XWBB 3G48A 3UDGA 1IKLA 2K32A 3HP3A 3PUZA 2EYJA 3GTGH 4RHRA 1RJTA 3LX0A 3CCLA 2M2LA 4GS3A 2KJXA 5AFWA 4KHPL 4JOIC 1M90C 1JMCA 4N8X1 1STGA 4BBRB 1G291 1EY7A 1KABA 1PH3A 3DHQA 2OQKA 2F0IA 2A8VA 5D65A 5JJLA 1GUGA 3KDFB 4EGVA 1BDOA 4BY1G 2PYKA 1WTPA 1J5EL 4BBRH 1LLRD 1QJOA 2A19A 2F0KA 2WAQE 3HOWG 3QO2A 1B7YB 1N9WA 4XYOA 3S2DH 1KHIA 5FJ8H 1HNZQ 2WKCA 3S9WA 1E2ZA 3MC0B 3ER0A 1X55A 1HNXL 4LJZC 5DLQE 2N55A 1CQVA 3MAQA 3CCSA 3CC2A 1FYCA 1Q8IA 2IW3A 4L5RC 2BA1A 3PO2G 4LF9L 2EYLA 4JPBW 3SEBA 1N36Q 4CJ1B 4ZKBB 1VMCA 2QF7A 3I90A 2BDOA 3A0JA 2QA4A 4DK6C 1Q1EA 1GUTA 4ZRZA 1DCZA 3HFZB 3QWNA 1Q46A 2B2WA 4DR1L 1A3UA 5LMUL 4JI3Q 1K8MA 4BY1B 1JORA 2F0QA 5IODA 1L1OB 2RDGA 5CR3A 5T1IA 2RSOA 3RUZA 2VQEL 5HGQA 3HOWB 1EWHA 5EPLA 2K03A 4BY1H 3MHBA 4A3MB 3UDXA 3GTKB 4DXGA 2F4VL 3HOWH 3RN2A 1D5ZC 3I8ZA 4HEDA 4LFCQ 3OHXC 3I72A 4HTHA 4A3MH 4PZ6A 1SYGA 2K1BA 3GTKH 2MPMA 5IY0A 1PVOA 1PYSB 4ME3A 1EQTA 1SRUA 5IGEA 1LM0A 5JAVA 3I3CA 4A3FG 2EY1A 3L2PA 4DAYA 2JSOA 3BZCA 3W5OA 2UXDQ 5CBEE 1S5FD 1XJVA 5BN5A 2JN4A 3A55A 3SK5A 2TMPA 3R2IA 3T13A 2O5IC 1PRTC 1EUJA 3M85A 1X56A 2K5NA 2UUAQ 3KLSX 2F0TA 2EXZA 1K8GA 1JOQA 1Y14B 3RLFA 5C4HA 1AFPA 4LFAL 4A3FB 3HOZG 3F1ZA 2BOSA 4LF7Q 1GOZA 2UU9L 5FLXE 1D7QA 1B3AA 4A3FH 2D5DA 2KCTA 2J7ZA 4UPAA 1CKNA 3NTIA 3C1EA 1I4QA 3FKIG 1DOMA 3PIP3 3AFQA 1DXMA 3TDQA 4O42A 1H9JA 1VQAA 2YU9B 2DUDA 2EYPA 2AWOA 3TP6A 1O7IA 5FO7B 3PGZA 1W2BA 1LYLA 3L7ZC 1Q3LA 1GUOA 4PMWA 1ASYA 3P20A 4EX5A 4LK1C 3D8GA 2YU9H 5DM73 3JAMi 3HOZB 3A8IE 4DV0L 1VQ8A 3H3VH 3J7YW 3K57A 2A6EC 2F0EA 3TP7A 3TMEA 5EKIA 5E4XA 5I6YA 5IYCG 3HOZH 4DV3L 3IKJA 5IGFA 1H95A 1J8IA 3VA7A 4PQXA 5D3DA 3OTOQ 5G3LF 1Q8KA 2HDMA 3G4SA 4P72A 2Z6KA 3H91A 1EIGA 1EY0A 4LW1A 1CZWA 4K0KQ 4GKKL 2NZ1D 1LO5D 3E9HA 3NSWA 1H9SA 5C0XJ 4A3GG 3Q8DA 4DV7Q 1A15A 4RGOS 1G6ZA 1UE5A 1W6KA 2KCMA 3CP0A 5C44G 3RLNA 1UE1A 2ZT9C 1Y69U 1C8CA 1D5XC 4RGNA 5EJWA 2F52A 2K50A 3ERQA 3HS0C 1O78A 3T1YL 3CC4A 1B1ZA 3E3XA 1QWYA 2EYOA 1VF7A 3RMHA 2E5LQ 2P5ZX 5IYCH 2DNEA 1VQ5A 1O80A 2VW9A 4A3GB 3J7A5 3PSIA 2K05A 1ML0D 3A8KE 5C44B 4DAVA 4A3BG 1HA6A 2KA7A 4DV5L 4A3GH 2EJFC 2YYZA 5FLXc 1SMYC 1SE2A 1MIUA 1WTXA 2NWGA 1EZ8A 1XTCD 4TKOB 2MQHA 4RWSC 1PLFA 3F8TA 3CRLC 3R3OA 4KI0A 4GKJQ 2A68D 1PFMA 4XT1B 2B2VC 3KBXA 2KVMA 3K59A 1YIJA 4X64L 2N3SA 5E7NA 5HGTA 5JJIA 4DV4L 3TSSA 3OWFA 1A8VA 2K01A 1PFNA 1ILPA 4IUVA 1DYQA 1U5KA 1EQVA 3VR3A 1CA5A 4IZ8A 5D14A 4PG3A 4LF5L 1YVCA 2LXJA 4LFBQ 4K2LA 1SE4A 2EE1A 5M3FB 2XIWA 1GUWA 1TY2A 1X3GA 3TZDA 1PTOD 3AFPA 1U9RA 5M3FH 3LNNA 4QUFA 5J39A 4X6AH 4ZUIA 4JVZA 3CCRA 1VQKA 1RL2A 2UXCQ 2VQFQ 3U9OA 4GZYC 1H9SB 2VL6A 4DNTB 1XNQQ 1ICFB 1PRTB 1B2TA 4DV2Q 1F2MA 4NXMQ 3Q0AA 2WB1G 3IRBA 2HD3A 3NQIA 5I9PA 3J7AF 3K81C 3TN2A 2F0WA 3I73A 1D8LA 2WINB 3QG1A 2VS1A 4Y7NB 1JWUD 2EJGC 1C9OA 1ASZA 1WD1A 4DUZL 3TP8A 3A5ZB 5FO8B 5ISRA 3G6JB 4Z9CB 4Y7NH 4P74A 1HUMA 4HSVA 4APVA 1FD7D 3KJOA 4P73A 2BH2A 1YJNA 3NBIA 4UP8A 1DJRD 4A3LG 1WOCA 1XMQL 1H9MA 4YCVA 3SK4A 2B2UA 5EBCA 2ZTEA 1GHKA 1U4MA 2QCPX 2WB1B 4EQNA 1TY0A 2Z0SA 2PPBC 4X65L 1LABA 4MIUA 4IPGA 1SYBA 2I5HA 1EOTA 1VQBA 1NR2A 2SNMA 4DR2L 1Z9FA 3AYHB 4RHSA 1G2TA 2SNSA 3S1NB 3FPUB 2DGYA 1EYGA 5CYUA 4A3DG 1WD0A 3O13A 3S1NH 4JI1L 2IL8A 1PRTF 2MGSA 2UUCL 3S1MB 1UEBA 1E0BA 2CQAA 1GXDC 3HG9A 1NJIC 1SNMA 2NN6G 4KKTA 3S1MH 4A3LH 3UDIA 2Q2TA 4NMZA 1B8AA 1KLGD 4OGQC 1YNJC 3KJPA 1I3QB 4JI8Q 1YITA 3EBEA 2XNAC 1OXXK 2QEJC 3J81i 3Q24A 1PYBA 5KEEA 4A3DB 2F3WA 2CKZB 4CDEC 1I3QH 3U4ZA 1E3PA 1HCZA 3E5SA 5M9OA 4QL5A 4EQOA 4YWKA 4DR5L 4A3DH 2ASBA 5IT9L 1HZAA 3D31A 1BCPC 5A35A 2O5JC 3PQIA 5EPJA 3CCJA 4FYDA 2WAQB 1PA6A 1DOLA 2BH8A 2A69C 1PDQA 4MHEA 2B39A 3RD4A 3WWVA 4NP5A 4HCSA 4R8NA 4RCOA 3FRPB 3E0JA 2F0GA 4P2CB 5CGKA 2K5WA 4B08A 4A4IA 2NN6H 5J1ZA 4GNXC 1G91A 2DY7A 1M1KC 2UUBL 1UUPA 3DEPA 1W3SA 2TSSA 4XDXA 1KDAA 3KF8B 4AIMA 3RZDB 1U0LA 1IZ6A 1BR9A 2F0FA 4S3SA 2X69A 3T56B 4KTAA 2XTIA 4OHJA 3RZDH 1LT3D 3K0XA 1L1OC 3DMUA 1PV4A 1MSGA 3F2BA 5FLMG 1I94L 1F9RA 4UHVA 4R4TA 3OOCA 2N49A 2JA5G 1OXUA 2B29A 2MHVA 3MFYA 3W2DA 4WRDA 1E22A 1PH9A 4DAMA 1VQFA 1ZYRD 4XT3B 1KC8C 1OTCA 1TS4A 1XXGA 5HURA 1STBA 1MI2A 4K2KA 3PO3H 4C1NI 4LF4Q 1TQOA 2PI2E 3NUCA 1CM9A 1Q90A 4F7XA 5DNFA 3EVQA 3ITPA 1F2LA 4DK1A 5ELFA 1N33L 1ESFA 1FL0A 1HHVA 2XN9C 1BBUA 1HNWQ 2CW0D 2JA5B 1HJPA 1YNJD 4FF2A 4L8JA 3SE0A 4IJHA 4A93G 1HZ9A 3H6MA 2JA5H 1VS0A 3PUWA 4KHZA 2VUMG 1MBYA 1UE7A 1YI2A 2QEXA 3CHBD 1QVCA 1CI3M 3SK6A 4GNXA 5GAGC 5FKAC 1ENCA 4K5VA 2JK8A 4BS9A 1IBMQ 1XNRL 1C48A 2ZTDA 1IL2A 1STAA 4DR7Q 1CKOA 3JAME 2Y0SG 1Y1VG 4LF8L 2A69D 4JW0A 5D3IB 2XVSA 1YNXA 3H3VC 4A93B 4NDXA 4QQBX 3DWQA 4R1JA 3KOJA 2VUMB 2WP8J 1XMOL 4A93H 4DV6Q 3JC66 2Q8IB 1DD2A 2A5HA 3D4DA 4KN4C 2Z4HA 2NVXB 2I07B 2WACA 1PZID 2VUMH 4B3MQ 2DJGC 1U4PA 3BVGA 3I55A 1SNQA 4G57A 2B2WC 4X3TA 4X66L 2NVXH 4EQ5A 2Y0SB 1Y1VB 2D62A 1PH8A 1CSPA 3V96A 3TBIB 3DLLA 1KIXA 4DK3C 1SBBB 1Y1VH 5ELBA 4DKAC 5LMNL 2K5DA 2J0TD 4OIJA 3MZ5A 5I9OA 5ELNA 2E2DC 4CKBA 1NTGA 4KD3A 2XSCA 4QUCA 1PH5A 2I0QA 1D5MC 5JEAJ 3EN2A 1KDCA 5C3XA 3J7AV 4QGUA 4QF4A 2HHHL 1CHQD 1PFSA 5G3LD 3F2DA 2GN5A 2Q2IA 2CWPA 2KBNA 1KAWA 2SEBD 4CKEA 4JYAL 4FF1A 5IGCA 1XPUA 3S2DB 2L4NA 4X62L 2Z4IA 1N34Q 1FGBD 4DUYL 3RR5A 2L15A 1AN8A 1BCPB 4YIJA 1L2FA 3J80E 3SDZA 1NNXA 2HUGA 3A5UA 2MNAA 4HJ9A 4A3MG 1YHAA 5F2DA 5C4JB 3DWAA 1VQ6A 4KY7A 3JAMc 4GNXB 3K5OA 4V190 5GAHC 1YBYA 1RCVD 2UXBQ 1EIFA 3BZDB 5C4JH 5IGBA 4KMUC 3EJIA 3G71A 1HNZL 4MTNA 4CJ0B 1XPRA 3IAYA 4AYBE 4LUOA 1E1OA 1EYAA 3CCMA 3B6YA 1SNDA 1JB3A 1AH9A 4CDCC 1QB5D 5ELCA 2RCFA 4IURA 3VYTA 3OW2A 2RA4A 1IBKQ 5IE8A 4IUNA 3VR4A 5A2QL 3CW2C 3D6CA 4POFA 1N36L 1EEFD 2B3GA 4PZ8A 3EQLC 1E24A 4JI3L 2F4VQ 2RHSB 1DGSA 1KNAA 5C0XG 2BE5C 1HR0Q 1WCMG 5FOBB 1KQSA 2LS01 2RKSA 3G7LA 1IBLQ 3RN5A 4CKCA 1K83B 2Z6KC 2CVRA 3BJUA 1JJGA 2NUCA 3CPFA 3VR5A 4OX9Q 4LFCL 2K5HA 1BCPF 1K83H 4JI0Q 2NVYB 5BR8Q 3E6ZX 2F0HA 1S5ED 2LXKA 2CH4W 4OXPA 3D6WA 3BYYB 2NVYH 3HEJA 2UXDL 3M7GA 1JQYD 4C3HB 1A6XA 3CRKC 4UDUC 5DAUA 2Z6BA 2WV6D 1HXYD 4NB3A 1C4QA 1WCMB 3V2TA 3P75A 4OWTB 4C3HH 4I7ZC 4KY5A 5J22A 2M00A 2UUAL 2XGTA 1L0XB 4GLVB 5IWAQ 5C0XH 1WCMH 1S4ZA 1RODA 3VYUA 5L37A 1SYCA 3ZYYX 2ZXRA 4IOAA 2QDLA 3J80c 3CCUA 1TS3A 4A3JG 3U58A 2GA4B 3HRZC 4MZ9A 4OO1I 2KHJA 1YHQA 2EYHA 2YTXA 2LFNA 4LF7L 5C4XG 3A7AB 2G9HD 3C1FA 3MXUA 4UY8C 4R9WA 1SEBD 3I56A 2A73B 1A62A 3HKZE 4C3JG 4B9XA 1MJCA 4KD4A 2KEDA 3KLWA 2PI2A 2FHTA 1SJHD 2L11A 1PH2A 2RF4A 3V05A 4XQNA 2XRQD 1V1QA 1TVXA 3UDFA 5JVG3 4A3JB 1GKHA 1A2TA 1VQIA 3AMUA 4K6LA 2OCEA 3NTHA 1VQPA 3ONAB 1EFWA 1K9MC 1X3FA 2F03A 3J81E 1VQMA 5C4XB 4DR4Q 1S5DD 4A3JH 1KDBA 2JA7H 4GN5A 2OEOA 2BE5D 5C4XH 3CMEA 2Q2HA 5I4DA 2BCOA 2F0MA 4WORA 4MTKA 4QIWE 3BU2A 5C3WA 4C3JB 4Q5VA 4I7AA 1CZGA 5E1FA 5BN4A 1QZHA 4K0KL 4IOCA 4KJNA 4B3RQ 3S15B 4QMGA 2PW7A 4DAYB 4Q0FA 2A6HC 2KQ3A 2JE6I 5C3EG 4C3JH 3I4OA 3KYHC 3BDOA 4AH6A 4DV7L 1X32A 1PRTD 3KLSA 2EOTA 3DUZA 5ELEA 4OWWB 2R7ZG 3S15H 1TIID 4GLAC 1TT2A 2IX3A 2PMZB 3BVMA 5FLXL 2FFKB 1B44D
chains in the Genus database with same CATH topology
1B9NA 2D9UA 4XXEA 2PW5A 1WTWA 1Q1BA 5JVH3 2NN6I 4L6TB 4KV6A 5ELDA 3EFXD 2OT2A 5C3EB 3GD7A 5JJZA 4DU9A 5KIXA 4RH6A 2R7ZB 5IIFA 2B2YA 3BVZA 4F8MA 3MTSA 4FVMA 5CMDA 1IYVA 1U4LA 2B2UC 1LTTD 1SYEA 3MXGA 4JK1C 3MA2B 2A6ED 2E2JB 1VCIA 4E6IA 4C3IB 4DN4M 4XQQA 2E2HB 3NP8A 1HQRD 4RFBA 3DEOA 3HOYB 2RVLA 1ESRA 2L12A 5KNCA 4OO1G 2HDLA 1UNSA 5K5PA 4OIKA 1W6JA 1WTQA 1L0YB 1GUNA 3PUVA 1ENAA 1HA5A 1LT6D 3BS1A 1DZ1A 2A6HD 3WOFA 3VR6A 3NPPA 5KNBA 4MN3A 1PXUA 3OW7A 4DXFA 2EJMA 2EYFA 4J6HA 5C6AA 2F3VA 1AW7A 3D4WA 1QOHA 4KHVA 1Q12A 3GTJB 1RKNA 1AP0A 3VYRA 1LTSD 4H13C 3RZOB 3CQZB 4OO1H 2K28A 1B50A 3DWPA 1ET9A 1SMYD 4FNFA 3S2HB 2AQ2B 4V0BA 4U68A 4X3SA 2M9VA 1I50B 2E76C 2L55A 2K33A 5CORA 1B9MA 3AB9A 1SSOA 3Q22A 1FNUA 3GTQB 4NKLA 4HMJA 1NCVA 4K14A 4TRDA 1QNKA 1EFID 1TWHB 2AQ1B 1GUSA 2K04A 1GHJA 1ZXTA 3PUXA 1JICA 1I4XA 3MEHA 1BXTA 2B2TA 1IW7C 2JA8B 3OMGA 4J8QA 2JP1A 2MUYA 2RSNA 2F0UA 4KJOA 3VA5A 1M8AA 1SXTA 3LWUA 3IFTA 2RBMA 1M4VA 4M8AA 1VF5C 3NK9A 1IYUA 3D3RA 1Z6HA 3Q23A 1NAPA 1AZPA 1G8ZD 4ILWA 3X3MA 3S16B 4ZKCB 2IX0A 3M4OB 2E75C 3HOVB 3U9SA 1RDPD 3GV3A 2AWNA 4DNRB 1LTBD 2B63B 1AEXA 3BYTB 2BA0A 5LL6X 3OPOA 1FR3A 1SNPA 2EVBA 3F2UA 4AYBB 2E74C 5KYIA 2XWJB 4XIGS 3QOJA 1H9KA 4IFDJ 2KCCA 3I4LA 1B4OA 4G7OC 4DK0A 5M5WB 2H4OA 5CBAE 2NB0A 3D4RA 1BO0A 1J9OA 3K5NA 3PO3B 2IWHA 2JA6B 2JXMB 1EYDA 1IL8A 1CTMA 3KLRA 3SXHA 5C5LA 1NR4A 4QCLA 2R3ZA 2R61A 3GTLB 2C5CA 4M1UB 3H0GB 1TWAB 5JEAG 1KLUD 1T5EA 4K8IA 2JYOA 3R93A 4H44C 4FF3A 3GQBA 4X3KA 4HCEA 5I6WA 4FXGC 2D2CC 5KYLA 2WIIB 2PZWA 2K7VA 2NTSA 3K6OA 2PNRC 2QILA 1V1PA 3P1HA 1ET6A 1EY6A 4NW2A 5EQ0A 2EDGA 1EU4A 1BCPD 5KRUA 3QOLA 5C0XI 1WTRA 5JPNC 1JOKA 1JR0D 2LKVA 1RF2D 5JEAH 3GTPB 4LAAA 1DONA 1CQFA 2F0PA 2F0DA 4IQZA 4PMCA 4ABNA 3GP7A 1EIHA 1V1OA 2ICIA 4U673 1LT5D 1UEAB 4C2MB 3WDNA 3A56A 1Z7TA 1JC7A 1HQMC 1XWEA 1X3PA 1SE3A 2BDNA 3MVVA 4HAEA 2QDBA 3HOUB 1D6EC 2KHSA 3PV0A 1D2BA 1MGSA 4DGZA 1RTNA 2NVQB 1EU3A 2B8GA 1FNWA 1NSNS 5C4ZA 4BBSB 4A3KB 2EY6A 4G7HC 4HSPA 3PIO3 3N52A 1ENFA 1T5XD 1I6HB 4CBVA 1QILA 5FK9C 3K5LA 4KK7A 1QNUA 1S5BD 4RGTA 1BNZA 3JAML 1QE6A 3MFGA 3W3AA 4RA8A 4DF7A 1ZKOA 1XX8A 3R2TA 2LMCB 1E2WA 3BDCA 4ZAIA 2Q8RE 1YNNC 2X6LA 3FEWX 1V1PB 2H1EA 3FPPA 4F88A 1II3A 3C3LA 2MJ8A 1HTPA 1LTAD 2XRSD 2NYZD 1OO9B 3H94A 1O7LA 1RTOA 1ZEQX 4RKLA 1SNCA 3Q6SA 1TR5A 4C1NK 4C3HG 5IGGA 4CHTB 3NQTA 1F77A 1TWGB 1V43A 3DM1A 2DNCA 4IUTA 3PO2B 2AUKA 1PMRA 3K7AB 4O1NA 1HFNA 4DA2A 3S17B 2F0LA 2EPBA 2KCNA 2NBFA 2JEAI 1PYWD 1EY4A 3GO5A 1F2ZA 2F1MA 1I4GA 3HOXB 3J80L 1IKMA 3DXJC 2L0CA 2NVTB 1PZJD 1CFMA 2L5TA 5EPKA 1O7ZA 1CHPD 3FMCA 5M5YB 5COYA 2IX1A 1SJED 1B53A 4BY7B 2C9OA 4ZUJA 1I4PA 1YNND 3QIAA 1XYIA 3T4AC 1VMPA 3NXWA 5I2YA 2F0JA 2B2YC 5EKLA 2HQEA 4HMIA 2EZVA 2A68C 4QB4A 1WTOA 2HCCA 4KKSA 2VB2X 1EEID 4TSSA 1EL0A 2K5QA 2JEBI 2EY5A 2JA7B 1HFGA 1LV9A 3T51B 1A2UA 3MXPA 2WKDA 3A54A 4ODGA 4IN3A 4IUUA 1R4QB 5CV5A 2ENBA 2F4IA 2FMCA 2QKIC 2RDFA 5BN3A 1O7YA 1Y1WB 3I4MB 5IOCA 4IFDI 3FKIB 1PTOC 1JWSD 1NUCA 3UI2A 2ICEC 1CA6A 4L63B 4DAPA 4G7ZC 1I6VC 2A74C 4PMBA 4K5XA 1ONLA 3MWYW 3P7JA 2G9DA 3I91A 4ZQ3A 3NHHA 4H7BA 1RD9D 4RAUC 1HPCA 1R4PB 1DM0B 1EYCA 1Y8NB 1EWCA 4C3IG 2O2LD 3ND8A 3C2PA 1DOKA 4G4KA 4ULLA 3M7NA 4LMQD 3IFDA 5DEHA 3X3NA 1STEA 1F9QA 3L9AX 1HTLD 4R8IA 1F9SA 4IUQA 3I70A 4B9WA 3SK8A 4FXKC 4ZLTF 5CV9A 3QB3A 5E3FA 1WTVA 2X6GA 1MD2D 2IT1A 5TSSA 1TWCB 3J81L 3K58A 1LTGD 5EGTA 1OXTA 2OXPA 4I65A 3AU7A 2F0SA 2FJ2A 3A8JE 3I4NB 1A3TA 5M5XB 5K36G 3CKIB 5CV7A 1BOSA 4XTCS 1Y8OB 3S14B 3NBHA 4A3BB 4K5WA 2N88A 1LTID 1WVLA 1CT1D 2KOLA 2B2TC 1D1IA 2VB3X 3N6RA 1AZQA 1X3QA 1TWFB 2R93B 2EY2A 4KKUA 1UAPA 1CK1A 1BUVT 4DFAA 4ZK9B 1D1KA 1ILQA 1JOOA 1QCBD 2R92B 4BA2I 2OF1A 5K36H 3TZUA 2PZUA 2KEEA 3LWEA 1TKWB 4J1MA 1ICWA 2KECA 3GTMB 2O4XA 1GJXA 2DN8A 2F0VA 4OL7A 3FVQA 4EVOA 2J4XA 1Y8PB 1EY9A 2SOBA 3KF8A 3ND9A 4IFDG 5IT9E 5LHY1 3NWTA 5CV8A 4FO2A 1HRJA 3PUYA 1BBXC 3GV6A 3OMCA 1MSHA 4WJWA 4C56C 4XYQA 1G2SA 2B2VA 5CV4A 1LT4D 5CC4A 4IALA 4K8JA 1F9PA 3S1RB 5NUCA 4A3IB 5DM63 1LTRD 3EROA 3BG3A 1EZ6A 5FO9B 4FF4A 2MP1A 1TS2A 1KTKA 2EYMA 1R9TB 3OIQA 1STYA 2L9HA 1ZYRC 2DY8A 4IFDH 2IJ0A 4A3EB 3A7LA 2SDFA 4JBWA 1I4RA 2E2IB 3K0YA 4X3UA 1PTOB 1JWMD 1PTOH 1TU2B 3EA6A 4TQUS 1SNOA 2CW0C 1KNEA 4HR7B 4ZYSA 2Z8LA 4ID6A 4RCNA 3VYSA 3NWSA 4K6DA 1SDFA 3QJYA 2PZTA 2VNUD 4IUPA 2KUMA 1FNVA 1VDZA 2PO4A 1OXVA 5IGDA 1JCKB 4HN7A 3BDLA 3T53B 1E2VA 3H09A 3R8BA 3L3OC 1SFOB 5CV6A 3MXNA 4N9PA 2LY7A 2AUJD 4FXDA 4FP5D 2NTTA 2R6GA 1EY8A 5KGUA 4UAIA 5LL6S 1QG7A 2AQ3B 1RHPA 2ID0A 1PTOF 1SYFA 1SYDA 3KUPA 1Z47A 1BF4A 3SVMA 1TS5A 1EY5A 1IW7D 3SR1A 3K5MA 2Q8TA 3OSOA 1PZKD 3CU7A 2VXWA 4PV1C 1H9RA 2ZXPA 1LACA 3S1QB 3T16A 2L1BA 2PQEA 1S5CD 2FINB 2RDHA 3TP5A 2V4DA 4CGYB 4H0LC 3HGBA 2F0OA 3HZXA 5EBDA 4KY6A 2Z1CA 4N9TA 3PMFA 2RQXA 5M3MB 4BA1I 1A3VA 5JPMC 3OIPA 3KK7A 3OWEB 4RKBA 1STHA 1F2YA 2IPKD 3WOEA 2B8FA 2CHBD 3HKZB 5KNDA 4KN7C 3KBGA 3FDTA 3NTKA 2FMMA 3IL8A 3GTOB 5JOBA 4BWGB 3URYA 2HCIA 3SHLA 4RGMA 5EKKA 2I46A 4ME5A 1OXSC 3M4YA 3M3YB 1JE4A 1IHZA 1K8OA 5C5MA 4WFN3 4QIWB 1HUNA 2ZXOA 3C46A 1V8QA 5A2QE 2F0NA 1BQQT 4F87A 2PCFB 1KAAA 1PFBA 2K6AA 1U4RA 1I4HA 3NE5B 1STNA 4CJ2C 4EQPA 5E4WC 3VR2A 5I2XA 3GTGB 4PNYA 4XQJA 5T1GA 1SAPA 2XWBB 1IKLA 2K32A 3HP3A 3PUZA 2EYJA 4RHRA 1RJTA 3LX0A 2M2LA 2KJXA 5AFWA 1STGA 4BBRB 1G291 1EY7A 1KABA 3DHQA 2F0IA 5D65A 1GUGA 4EGVA 1BDOA 2PYKA 1WTPA 1LLRD 1QJOA 2F0KA 3QO2A 4XYOA 2WKCA 3S9WA 1E2ZA 3MC0B 4LJZC 2N55A 1CQVA 3MAQA 1FYCA 1Q8IA 2IW3A 2BA1A 2EYLA 3SEBA 4CJ1B 4ZKBB 1VMCA 2QF7A 3I90A 2BDOA 1Q1EA 1GUTA 4ZRZA 1DCZA 3QWNA 2B2WA 1A3UA 4BY1B 1JORA 1K8MA 2F0QA 5IODA 2RDGA 5CR3A 5T1IA 2RSOA 3RUZA 3HOWB 1EWHA 5EPLA 2K03A 3MHBA 4A3MB 3GTKB 4DXGA 1D5ZC 3I8ZA 4HEDA 3OHXC 3I72A 4HTHA 1SYGA 2K1BA 2MPMA 1EQTA 5JAVA 5IGEA 3I3CA 2EY1A 4DAYA 2JSOA 5CBEE 1S5FD 5BN5A 3A55A 3SK5A 2TMPA 3R2IA 3T13A 2O5IC 1PRTC 3M85A 3KLSX 2F0TA 2EXZA 1JOQA 3RLFA 5C4HA 1AFPA 4A3FB 2BOSA 1GOZA 5FLXE 1B3AA 2D5DA 2J7ZA 3NTIA 3C1EA 1I4QA 1DOMA 3PIP3 1DXMA 3TDQA 4O42A 1H9JA 2YU9B 2EYPA 2AWOA 3TP6A 5FO7B 3L7ZC 1Q3LA 1GUOA 4PMWA 3P20A 4LK1C 3D8GA 5DM73 3HOZB 3A8IE 3J7YW 3K57A 2A6EC 2F0EA 3TP7A 3TMEA 5EKIA 5E4XA 5I6YA 3IKJA 5IGFA 1J8IA 3VA7A 4PQXA 5D3DA 5G3LF 2HDMA 3H91A 1EIGA 1EY0A 1CZWA 2NZ1D 1LO5D 3NSWA 1H9SA 5C0XJ 1A15A 4RGOS 1G6ZA 1W6KA 2ZT9C 1Y69U 1C8CA 1D5XC 4RGNA 5EJWA 3ERQA 3HS0C 1O78A 1B1ZA 1QWYA 2EYOA 1VF7A 3RMHA 2DNEA 1O80A 4A3GB 2K05A 1ML0D 3A8KE 5C44B 4DAVA 1HA6A 2KA7A 2EJFC 2YYZA 1SMYC 1SE2A 1WTXA 2NWGA 1EZ8A 1XTCD 4TKOB 4RWSC 1PLFA 3CRLC 3R3OA 4KI0A 2A68D 1PFMA 4XT1B 2B2VC 3KBXA 2KVMA 3K59A 5HGTA 3TSSA 3OWFA 2K01A 1PFNA 1ILPA 4IUVA 1DYQA 1EQVA 3VR3A 1CA5A 4IZ8A 5D14A 4K2LA 1SE4A 2EE1A 5M3FB 2XIWA 1GUWA 1TY2A 3TZDA 1PTOD 1U9RA 3LNNA 4QUFA 5J39A 4ZUIA 3U9OA 4GZYC 1H9SB 4DNTB 1PRTB 1B2TA 1F2MA 3Q0AA 3NQIA 5I9PA 3J7AF 3TN2A 2F0WA 3I73A 2WINB 3QG1A 4Y7NB 1JWUD 2EJGC 1WD1A 3TP8A 5FO8B 5ISRA 3G6JB 4Z9CB 1HUMA 4HSVA 1FD7D 3NBIA 1DJRD 1H9MA 3SK4A 2B2UA 5EBCA 1GHKA 1U4MA 2QCPX 2WB1B 4EQNA 1TY0A 2PPBC 1LABA 4MIUA 1SYBA 1EOTA 1NR2A 2SNMA 4RHSA 1G2TA 2SNSA 3S1NB 3FPUB 5CYUA 1WD0A 3O13A 2IL8A 1PRTF 2MGSA 3S1MB 1E0BA 2CQAA 1GXDC 3HG9A 1SNMA 2NN6G 4KKTA 4NMZA 1KLGD 4OGQC 1YNJC 1I3QB 2XNAC 1OXXK 2QEJC 3Q24A 5KEEA 4A3DB 2F3WA 1HCZA 3E5SA 5M9OA 4EQOA 5IT9L 3D31A 1BCPC 5A35A 2O5JC 5EPJA 4FYDA 2WAQB 1DOLA 3RD4A 2A69C 1PDQA 4MHEA 2B39A 4NP5A 4HCSA 4R8NA 4RCOA 3FRPB 3E0JA 2F0GA 4P2CB 5CGKA 2K5WA 4B08A 2NN6H 5J1ZA 1G91A 2DY7A 1UUPA 3DEPA 2TSSA 4XDXA 1KDAA 3RZDB 1BR9A 2F0FA 4S3SA 2X69A 3T56B 4KTAA 4OHJA 1LT3D 3DMUA 1MSGA 1F9RA 3OOCA 1OXUA 2MHVA 3MFYA 3W2DA 4WRDA 4XT3B 1ZYRD 1TS4A 1XXGA 5HURA 1STBA 1MI2A 4K2KA 4C1NI 1TQOA 3NUCA 1CM9A 1Q90A 4F7XA 5DNFA 3EVQA 3ITPA 1F2LA 4DK1A 5ELFA 1ESFA 1HHVA 2XN9C 2CW0D 2JA5B 1YNJD 4FF2A 4L8JA 3SE0A 3H6MA 3PUWA 4KHZA 1MBYA 3CHBD 1CI3M 3SK6A 5FKAC 1ENCA 4K5VA 4BS9A 1C48A 1STAA 3JAME 2A69D 5D3IB 2XVSA 3H3VC 4A93B 4NDXA 3DWQA 2VUMB 2WP8J 2Q8IB 1DD2A 2A5HA 3D4DA 4KN4C 2Z4HA 2NVXB 2I07B 2WACA 1PZID 1U4PA 3BVGA 1SNQA 4G57A 2B2WC 4X3TA 2Y0SB 1Y1VB 2D62A 3V96A 3TBIB 1SBBB 5ELBA 2K5DA 2J0TD 4OIJA 3MZ5A 5I9OA 2E2DC 4CKBA 4KD3A 2XSCA 4QUCA 1D5MC 5JEAJ 1KDCA 5C3XA 3J7AV 4QF4A 1CHQD 5G3LD 2SEBD 4CKEA 4FF1A 5IGCA 3S2DB 2L4NA 2Z4IA 1FGBD 1AN8A 1BCPB 4YIJA 3J80E 3SDZA 2HUGA 5F2DA 5C4JB 3DWAA 4KY7A 3K5OA 4V190 1RCVD 3BZDB 5IGBA 4KMUC 3EJIA 4CJ0B 3IAYA 1EYAA 1SNDA 1JB3A 1QB5D 5ELCA 4IURA 3VYTA 2RA4A 4IUNA 3VR4A 5A2QL 3D6CA 1EEFD 3EQLC 1KNAA 5C0XG 2BE5C 5FOBB 2LS01 2RKSA 3G7LA 4CKCA 1K83B 2CVRA 2NUCA 3VR5A 1BCPF 2NVYB 3E6ZX 2F0HA 1S5ED 3D6WA 3BYYB 3HEJA 3M7GA 1JQYD 4C3HB 1A6XA 3CRKC 4UDUC 5DAUA 2WV6D 1HXYD 1C4QA 1WCMB 3V2TA 3P75A 4I7ZC 4KY5A 5J22A 2M00A 1L0XB 5C0XH 1S4ZA 1RODA 3VYUA 1SYCA 3ZYYX 2ZXRA 1TS3A 2GA4B 3HRZC 4OO1I 2EYHA 2LFNA 3A7AB 2G9HD 3C1FA 3MXUA 4R9WA 1SEBD 2A73B 4C3JG 4B9XA 4KD4A 2KEDA 2FHTA 1SJHD 2L11A 3V05A 4XQNA 2XRQD 1TVXA 5JVG3 4A3JB 1A2TA 3AMUA 4K6LA 3NTHA 3ONAB 2F03A 3J81E 5C4XB 1S5DD 1KDBA 2OEOA 2BE5D 5I4DA 2BCOA 2F0MA 4WORA 5C3WA 4C3JB 4Q5VA 1CZGA 5E1FA 5BN4A 4KJNA 3S15B 4QMGA 2PW7A 4Q0FA 2A6HC 2KQ3A 2JE6I 3BDOA 1X32A 1PRTD 3KLSA 2EOTA 3DUZA 5ELEA 1TIID 1TT2A 2IX3A 2PMZB 3BVMA 5FLXL 2FFKB 1B44D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9N A;  4XIG S;  3WDN A;  4OO1 H;  1H9K A;  1A6X A;  1DXM A;  2KCC A;  3CRK C;  4BA1 I;  5BN3 A;  1Q90 A;  3I4L A;  1H9J A;  4KKU A;  1E2Z A;  1Z7T A;  1HQM C;  2AWO A;  4G7O C;  4RCN A;  4LJZ C;  1Q1B A;  4DK0 A;  1FYC A;  3L7Z C;  3QJY A;  1GUO A;  4DK1 A;  3P20 A;  1V43 A;  2BA1 A;  2NN6 I;  4LK1 C;  3VR3 A;  4I7Z C;  4G7Z C;  2B8F A;  3D4R A;  2DNC A;  1I6V C;  5C0X H;  3A8I E;  3GD7 A;  2NN6 G;  4KKT A;  5KND A;  4BA2 I;  3PV0 A;  2AUK A;  2E76 C;  2A6E C;  2QF7 A;  5K36 H;  1ONL A;  2K33 A;  2BDO A;  4L8J A;  1PMR A;  4KN7 C;  3SE0 A;  3TZU A;  1VDZ A;  2JXM B;  1Q1E A;  1GUT A;  1TKW B;  1CTM A;  3KLR A;  1DCZ A;  4OGQ C;  1YNJ C;  1B9M A;  2B8G A;  3AB9 A;  3IKJ A;  1OXV A;  1K8M A;  1GJX A;  2JEA I;  2DN8 A;  3PUW A;  3VA7 A;  1IYV A;  3LNN A;  3SDZ A;  4KHZ A;  4G7H C;  1OXX K;  2F1M A;  3A7A B;  1EWH A;  1HPC A;  3T53 B;  1E2V A;  3MXU A;  1Y8P B;  5JEA G;  1CI3 M;  1GUS A;  4JK1 C;  3DXJ C;  3ND9 A;  4IFD G;  1Y8N B;  1GHJ A;  3PUX A;  1HCZ A;  1T5E A;  3ND8 A;  2A6E D;  1H9S A;  4GZY C;  1CFM A;  3PUY A;  1H9S B;  2AUJ D;  1VCI A;  2L5T A;  4DNT B;  1IW7 C;  2R6G A;  4KMU C;  3D31 A;  3I72 A;  1OXS C;  3M4Y A;  2A69 D;  5A35 A;  2O5J C;  3M7N A;  1K8O A;  4H44 C;  3FMC A;  2ZT9 C;  3GQB A;  1Y69 U;  2A69 C;  1V8Q A;  2D2C C;  3W3A A;  1O78 A;  1ZKO A;  3LWU A;  3IFT A;  2NN6 H;  3BG3 A;  3QIA A;  3VR4 A;  5BN5 A;  3I73 A;  5KNC A;  4OO1 G;  1VF7 A;  2K7V A;  1VF5 C;  2LMC B;  2PCF B;  1E2W A;  2PNR C;  1IYU A;  3QG1 A;  1YNN C;  2IT1 A;  1Z6H A;  2EJG C;  2O5I C;  1IW7 D;  2EDG A;  2Q8I B;  4KN4 C;  1DD2 A;  2DNE A;  3FPP A;  3EQL C;  3NE5 B;  3M85 A;  1GUN A;  1OXT A;  2BE5 D;  3PUV A;  3T56 B;  3VR2 A;  4PV1 C;  1HTP A;  2A68 C;  1ZYR C;  5JEA H;  2BE5 C;  5C0X G;  2D62 A;  4IFD H;  2A6H D;  3A8J E;  4KKS A;  3RLF A;  2E75 C;  3VR6 A;  5BN4 A;  3A8K E;  1H9M A;  1H9R A;  3A7L A;  5KNB A;  2KA7 A;  5K36 G;  1LAC A;  4JBW A;  2K32 A;  2EJF C;  3PUZ A;  3H94 A;  1GHK A;  3U9S A;  3OW7 A;  2A6H C;  4XTC S;  2PPB C;  1Y8O B;  2EJM A;  1O7L A;  2JE6 I;  2YYZ A;  2JEB I;  1LAB A;  4DNR B;  3BDO A;  1SMY C;  3OOC A;  2V4D A;  1OXU A;  3MFY A;  3VR5 A;  1G29 1;  4TKO B;  3T51 B;  2BA0 A;  4IQZ A;  4H0L C;  3OPO A;  3HGB A;  2D5D A;  1FR3 A;  1GUG A;  1Q12 A;  3CRL C;  1BDO A;  1TU2 B;  2EVB A;  3N6R A;  4KI0 A;  2A68 D;  4TQU S;  2CW0 C;  2E74 C;  1QJO A;  4H13 C;  4HR7 B; 
#chains in the Genus database with same CATH topology
 1B9N A;  5LMN W;  2D9U A;  4XXE A;  1WTH A;  1X6O A;  2PW5 A;  5GQO A;  4HIK A;  4HIM A;  1WTW A;  2E5L L;  5HY6 A;  1Q1B A;  5JVH 3;  1EQQ A;  2NN6 I;  3CAM A;  4L6T B;  3TS2 A;  4KV6 A;  5ELD A;  5M3F G;  3EFX D;  2K5V A;  3TQY A;  2OT2 A;  5C3E B;  3GD7 A;  4YY3 Q;  5JJZ A;  4DU9 A;  5KIX A;  4RH6 A;  2R7Z B;  5IIF A;  3HOY G;  2B2Y A;  3BVZ A;  2ATW A;  1FVI A;  4F8M A;  3MTS A;  4FVM A;  1CKN B;  5CMD A;  5C3E H;  2R7Z H;  1IYV A;  1U4L A;  2B2U C;  1LTT D;  1SYE A;  5H1S E;  4HJ7 A;  3MXG A;  4JK1 C;  4GKJ L;  3MA2 B;  2A6E D;  1VQL A;  4JI5 Q;  2E2J B;  1VQO A;  1VCI A;  4E6I A;  4C3I B;  3CCE A;  4DN4 M;  4XQQ A;  2E2H B;  3NP8 A;  1HQR D;  4RFB A;  1K28 A;  4HJ8 A;  1BBW A;  3DEO A;  2E2J H;  3KF6 A;  3HOY B;  4C3I H;  2RVL A;  2E2H H;  1QZG A;  3J81 c;  3F2C A;  3T1H Q;  1ESR A;  1C0A A;  3TS0 A;  2L12 A;  5KNC A;  4OO1 G;  2HDL A;  3HOY H;  2R7F A;  4LFB L;  1UNS A;  5K5P A;  4OIK A;  1IYJ B;  1W6J A;  1WTQ A;  1L0Y B;  4B3S Q;  1GUN A;  3PUV A;  1K3B C;  4J15 A;  4HJA A;  1ENA A;  1HA5 A;  1LT6 D;  2YV5 A;  3BS1 A;  1DZ1 A;  2A6H D;  3WOF A;  3VR6 A;  3NPP A;  5KNB A;  4MN3 A;  1PXU A;  3OW7 A;  4DXF A;  2UXC L;  1MKH A;  2EJM A;  2VQF L;  2EYF A;  4J6H A;  4JC0 A;  5C6A A;  2F3V A;  1AW7 A;  3D4W A;  1XNQ L;  1QOH A;  4DV2 L;  4NXN Q;  4KHV A;  4NXM L;  1YEZ A;  1Q12 A;  3GTJ B;  1RKN A;  4YHH Q;  1AP0 A;  3VYR A;  1LTS D;  1LUZ A;  4H13 C;  3CC7 A;  3RZO B;  3CQZ B;  3I7F A;  4OO1 H;  5AJ3 Q;  2K28 A;  1B50 A;  3GTJ H;  3DWP A;  1ET9 A;  1SMY D;  1B3Q A;  3RZO H;  2K14 A;  3CQZ H;  1VQD A;  3GTM H;  4FNF A;  3OYY A;  1SMX A;  1PH1 A;  3S2H B;  2AQ2 B;  2JA8 G;  4V0B A;  3CF5 A;  4U68 A;  4X3S A;  2M9V A;  1I50 B;  2GVA A;  2E76 C;  2L55 A;  2K33 A;  4IPD A;  3S2H H;  3CD6 A;  5COR A;  1B9M A;  1GVP A;  3AB9 A;  1I50 H;  1SSO A;  2K4K A;  3Q22 A;  1FNU A;  4DV1 Q;  3GTQ B;  4NKL A;  4HMJ A;  1X9N A;  1NCV A;  4K14 A;  4TRD A;  1QNK A;  1EFI D;  1TWH B;  2AQ1 B;  3CXC A;  4LF6 Q;  1GUS A;  2K04 A;  1GHJ A;  3AEV A;  3GTQ H;  1VQG A;  1ZXT A;  3PUX A;  1JIC A;  1I4X A;  1FJG Q;  3MEH A;  1BXT A;  2E8G A;  5IYB H;  2B2T A;  2WAQ G;  1TWH H;  1IW7 C;  2JA8 B;  2K75 A;  3NEL A;  3OMG A;  3PIO A;  1C7Y A;  4J8Q A;  2JP1 A;  3HOV G;  2MUY A;  2RSN A;  5J3B A;  1LTL A;  2F0U A;  5GAD C;  3ULJ A;  4KJO A;  3VA5 A;  1M8A A;  2JA8 H;  1SXT A;  2B63 G;  3LWU A;  4DR3 Q;  3IFT A;  2RBM A;  4JI6 Q;  1M4V A;  4M8A A;  1VF5 C;  4OWX B;  2ZM6 Q;  3NK9 A;  1IYU A;  4HIO A;  3D3R A;  1P16 A;  1Z6H A;  3Q23 A;  1NAP A;  1AZP A;  1G8Z D;  4ILW A;  3X3M A;  4JI8 L;  1FGU A;  3S16 B;  4ZKC B;  2IX0 A;  2MO1 A;  3M4O B;  3RLO A;  2E75 C;  1VQ7 A;  3S24 A;  2K52 A;  4IJL A;  3HOV B;  4YWL A;  3U9S A;  1RDP D;  2I5L X;  3GV3 A;  5IYD G;  3S16 H;  2AWN A;  4DNR B;  4JI7 Q;  1LTB D;  3M4O H;  2B63 B;  1AEX A;  3HOV H;  3PO3 G;  3BYT B;  1G6P A;  2BA0 A;  2JA6 G;  5LL6 X;  3OPO A;  1JB7 A;  2JJQ A;  3CCV A;  1FR3 A;  1SNP A;  3UE0 A;  2EVB A;  3F2U A;  2B63 H;  4AYB B;  2E74 C;  5KYI A;  2NZH A;  2XWJ B;  3FP9 A;  4JV5 Q;  4XIG S;  3QOJ A;  1H9K A;  2N78 A;  3VDY A;  4JI2 Q;  4IFD J;  2KCC A;  2OTJ A;  1L0W A;  3I4L A;  4JBK A;  1B4O A;  4G7O C;  4DK0 A;  1KRS A;  5M5W B;  4R4Q A;  2H4O A;  2A1A A;  5CBA E;  1JT8 A;  2NB0 A;  3D4R A;  2KEN A;  3U50 C;  4HJ5 A;  2CQO A;  1BO0 A;  1J9O A;  5M5W H;  3K5N A;  2HQL A;  3PO3 B;  3A74 A;  2IWH A;  2JA6 B;  2JXM B;  1EYD A;  1IL8 A;  1CTM A;  5IYD H;  3KLR A;  3SXH A;  5C5L A;  1EOV A;  1NR4 A;  4QCL A;  2R3Z A;  2JA6 H;  1NY4 A;  2VY3 A;  2R61 A;  3GTL B;  4DR6 Q;  2C5C A;  4UP9 A;  4M1U B;  4CDD C;  3H0G B;  1TWA B;  4CDF C;  5JEA G;  1KLU D;  3K8A A;  3GTL H;  1T5E A;  4ALP A;  1KRT A;  4K8I A;  3H0G H;  1TWA H;  2JYO A;  4QJF A;  4LF4 L;  3W1G A;  3R93 A;  4H44 C;  4FF3 A;  3W1B A;  3HKS A;  3GQB A;  4X3K A;  4HCE A;  3ULP A;  5I6W A;  4FXG C;  2C35 B;  2D2C C;  1CKM A;  4L5T A;  5KYL A;  1UWV A;  4GOP C;  2WII B;  2PZW A;  1HNW L;  2K7V A;  2NTS A;  3K6O A;  2PNR C;  4A76 A;  2QIL A;  1V1P A;  3P1H A;  1ET6 A;  1EY6 A;  1SR3 A;  3KDF A;  4NW2 A;  5EQ0 A;  2ZJQ A;  2EDG A;  1EU4 A;  1BCP D;  1N8R C;  5KRU A;  3QOL A;  5C0X I;  1WTR A;  5JPN C;  1JOK A;  1JR0 D;  2LKV A;  4PZ7 A;  1RF2 D;  5JEA H;  3GTP B;  1NMG A;  2HIX A;  4LAA A;  1DON A;  4O2D A;  4TVA B;  1CQF A;  1IBM L;  1VQ4 A;  2F0P A;  3PIP A;  3GTP H;  1BVS A;  3HOU G;  4DR7 L;  2F0D A;  3BZK A;  4IQZ A;  3E0E A;  4PMC A;  4ABN A;  3GP7 A;  1EIH A;  3CMA A;  1V1O A;  2ICI A;  4U67 3;  4BBS G;  4H02 A;  2OQ0 A;  1LT5 D;  4A3K G;  1UEA B;  4C2M B;  3WDN A;  1KD1 C;  2IHF A;  3A56 A;  2JA9 A;  3M9B A;  4X66 Q;  1Z7T A;  1JC7 A;  1HQM C;  4C2M H;  4DV6 L;  1XWE A;  1K0S A;  4AQY Q;  4JG2 A;  2JQO A;  1VQH A;  1X3P A;  1N32 Q;  1Q81 C;  1SE3 A;  1BKB A;  2BDN A;  2CCZ A;  3MVV A;  4FDB A;  4HAE A;  2QDB A;  2ALY B;  3HOU B;  1D6E C;  2KHS A;  3PV0 A;  1D2B A;  1MGS A;  4DGZ A;  1QVF A;  4YCW A;  1RTN A;  4JI4 Q;  2NVQ B;  1EU3 A;  2B8G A;  3HOU H;  1FNW A;  1NSN S;  5C4Z A;  2WFW A;  4BBS B;  4A3K B;  1XTD A;  2EY6 A;  4G7H C;  4B3T Q;  3UE1 A;  2NVQ H;  4GOP A;  4HSP A;  3PIO 3;  1GM5 A;  4BBS H;  3N52 A;  4A3K H;  1ENF A;  1T5X D;  2GVB A;  1I6H B;  1RIP A;  1JJC B;  2QW7 A;  4CBV A;  4KHP Q;  1QIL A;  5FK9 C;  3K5L A;  4KK7 A;  1QNU A;  1S5B D;  3H15 A;  4RGT A;  1BNZ A;  1WFQ A;  1I6H H;  3JAM L;  4OEM B;  1QE6 A;  3MFG A;  2HIV A;  5GRO A;  1J5E Q;  3W3A A;  4RA8 A;  4DF7 A;  1ZKO A;  1XX8 A;  3R2T A;  2LMC B;  3ULL A;  1E2W A;  3BDC A;  4L5Q A;  4ZAI A;  2Q8R E;  1YNN C;  2X6L A;  1HNX Q;  3FEW X;  1V1P B;  3J81 j;  1N34 L;  2MFI A;  2H1E A;  3FPP A;  4F88 A;  1II3 A;  1GD7 A;  3L0O A;  3C3L A;  4LF9 Q;  2MJ8 A;  1HTP A;  1LTA D;  2XRS D;  2NYZ D;  1B70 B;  3STB C;  1OO9 B;  2KHI A;  3H94 A;  4DR1 Q;  5LMU Q;  1O7L A;  1RTO A;  1ZEQ X;  2PQA A;  4RKL A;  1SNC A;  2UXB L;  2VQE Q;  3M4P A;  3Q6S A;  1X3E A;  2AHO B;  1TR5 A;  4C1N K;  2CH4 A;  4C3H G;  5IGG A;  1Q82 C;  2RHQ B;  4CHT B;  1IBK L;  3NQT A;  3HOX G;  1F77 A;  1TWG B;  2H5X A;  1V43 A;  1IXR A;  1TWG H;  3DM1 A;  2DNC A;  4IUT A;  3PO2 B;  2AUK A;  1HR0 L;  4BY7 G;  1PMR A;  4LUV A;  3I2Z A;  3K7A B;  4O1N A;  1IBL L;  1HFN A;  4DA2 A;  3G6E A;  3S17 B;  2F0L A;  2EPB A;  2KCN A;  2NBF A;  3PO2 H;  1SRO A;  2EXD A;  2JEA I;  1PYW D;  1EY4 A;  1CSQ A;  3K7A H;  3GO5 A;  3EIV A;  1F2Z A;  4OX9 L;  3S17 H;  2F1M A;  1I4G A;  3HOX B;  4JI0 L;  5BR8 L;  3J80 L;  1IKM A;  4GOP B;  3DXJ C;  4JBJ A;  4JOI A;  4LFA Q;  1VQJ A;  4KLK A;  2L0C A;  2NVT B;  1PZJ D;  3HOX H;  1CFM A;  2L5T A;  5EPK A;  2YTV A;  2UU9 Q;  1O7Z A;  1CHP D;  3DM3 A;  3FMC A;  3AQQ A;  2NVT H;  5M5Y B;  5COY A;  2IX1 A;  1SJE D;  1B53 A;  4BY7 B;  2C9O A;  1E1T A;  2JA7 G;  2OTL A;  1NBW A;  4ZUJ A;  4LUZ A;  1I4P A;  1YNN D;  4LNQ A;  3QIA A;  5M5Y H;  4POG A;  4ZCK A;  5IWA L;  4BY7 H;  1XYI A;  3TRZ A;  3T4A C;  1VMP A;  3NXW A;  5I2Y A;  2AMC B;  3K80 C;  2F0J A;  1PH4 A;  2B2Y C;  5EKL A;  4WJ4 A;  2HQE A;  4DV0 Q;  1Y1W G;  3I4M G;  4HMI A;  2EZV A;  2A68 C;  4QB4 A;  1WTO A;  3STB D;  2HCC A;  4KKS A;  2VB2 X;  1EEI D;  4TSS A;  4DV3 Q;  1EL0 A;  1V9P A;  1TXY A;  2K5Q A;  2JEB I;  2EY5 A;  2Z9H A;  4WJ3 M;  2JA7 B;  2PQA B;  1LV9 A;  1HFG A;  3T51 B;  1A2U A;  3MXP A;  2WKD A;  3A54 A;  4ODG A;  4IN3 A;  4QY7 A;  4IUU A;  4GKK Q;  1R4Q B;  5CV5 A;  1QUQ A;  2ENB A;  2F4I A;  2FMC A;  1AE2 A;  2QKI C;  3OTO L;  2Y0S E;  2RDF A;  5BN3 A;  1O7Y A;  1Y1W B;  3I4M B;  5IOC A;  4IFD I;  3FKI B;  1PTO C;  1JWS D;  4DR4 L;  1NUC A;  3UI2 A;  2ICE C;  1CA6 A;  4L63 B;  3T1Y Q;  1Y1W H;  3I4M H;  3FKI H;  4DAP A;  2V1C C;  4G7Z C;  1I6V C;  2A74 C;  3SGI A;  4PMB A;  4K5X A;  5ELO A;  1ONL A;  3MWY W;  3P7J A;  1K8A C;  2CWA A;  4B3R L;  2G9D A;  1PH6 A;  2YTY A;  3I91 A;  4DPG A;  4ZQ3 A;  1S72 A;  3U4V A;  2HT1 A;  4A3C G;  3NHH A;  4H7B A;  1RD9 D;  4RAU C;  1HPC A;  1R4P B;  1DM0 B;  4DV5 Q;  1EYC A;  1Y8N B;  1EWC A;  4N8F A;  4C3I G;  2O2L D;  3ND8 A;  3C2P A;  1DOK A;  1A63 A;  3KFU A;  4G4K A;  3I4N G;  4ULL A;  3M7N A;  4LMQ D;  3IFD A;  5DEH A;  3X3N A;  1STE A;  1F9Q A;  3L9A X;  1HTL D;  4R8I A;  2IY5 B;  1F9S A;  4R4O A;  4IUQ A;  3I70 A;  4X64 Q;  4B9W A;  3SK8 A;  2ZJR A;  2CFM A;  3MEF A;  4FXK C;  4ZLT F;  5CV9 A;  3QB3 A;  4YY3 L;  1JJ2 A;  2DJF C;  3TEH B;  5C44 H;  4DV4 Q;  5E3F A;  1WTV A;  2X6G A;  1I5F A;  1MD2 D;  2IT1 A;  5GAE C;  5TSS A;  2PNH A;  1TWC B;  3GDE A;  3J81 L;  1T9H A;  3K58 A;  1K73 C;  4A3C H;  1LTG D;  5EGT A;  4LF5 Q;  1OXT A;  2OXP A;  4I65 A;  2R93 G;  3J80 i;  3AU7 A;  2ES2 A;  3ERS X;  3RNU A;  2F0S A;  2FJ2 A;  1TWC H;  3A8J E;  3I4N B;  1A3T A;  5M5X B;  5K36 G;  1G51 A;  3CKI B;  5CV7 A;  1BOS A;  4BXX G;  4XTC S;  1Y8O B;  3S14 B;  3NBH A;  4A3B B;  4JI5 L;  3ICE A;  4K5W A;  2R92 G;  3I4N H;  5M5X H;  2N88 A;  2AKW B;  1Q86 C;  1LTI D;  1WVL A;  1CT1 D;  2KOL A;  2B2T C;  1NE3 A;  3S14 H;  1D1I A;  4A3B H;  2VB3 X;  3N6R A;  1QUQ B;  3PF4 A;  1AZQ A;  1X3Q A;  3T1H L;  1TWF B;  2R93 B;  4A75 A;  2ZJP A;  2EY2 A;  4KKU A;  2N8N A;  1YJW A;  1UAP A;  1CK1 A;  3M4Q A;  4OEL B;  4YCU A;  1BUV T;  1CUK A;  4DFA A;  1TWF H;  4ZK9 B;  2R93 H;  1D1K A;  1ILQ A;  1JOO A;  4B3S L;  1YZ6 A;  1QCB D;  4RMF A;  2Q2U A;  2G5D A;  2R92 B;  4BA2 I;  2OF1 A;  1P8L A;  5K36 H;  1J6Q A;  3TZU A;  2PZU A;  2KEE A;  4BXX H;  3LWE A;  4A3I G;  2EIF A;  1TKW B;  4DUZ Q;  1SLJ A;  4MNO A;  4J1M A;  1ICW A;  1Q7Y C;  2R92 H;  2KEC A;  3GTM B;  2O4X A;  1VQ9 A;  5IYB G;  4DNI A;  2DN8 A;  1GJX A;  1YJ9 A;  2F0V A;  4OL7 A;  4OON A;  3FVQ A;  5IP7 G;  1HZC A;  4EVO A;  1HR0 W;  4P71 A;  4NXN L;  1KXL A;  2J4X A;  1Y8P B;  1EY9 A;  1XMQ Q;  2SOB A;  3KF8 A;  3ND9 A;  4IFD G;  5IT9 E;  5LHY 1;  3NWT A;  4YHH L;  5CV8 A;  1EQR A;  4FO2 A;  4X65 Q;  1HRJ A;  3PUY A;  1BBX C;  3GV6 A;  3OMC A;  1MSH A;  5AJ3 L;  4WJW A;  4C56 C;  4XYQ A;  1G2S A;  2D0P A;  4A3E G;  2B2V A;  5CV4 A;  1LT4 D;  5CC4 A;  4IAL A;  2LSS A;  4K8J A;  1F9P A;  4DR2 Q;  3S1R B;  4GN4 B;  5NUC A;  4A3I B;  5DM6 3;  1LTR D;  3ERO A;  3BG3 A;  3S1R H;  2QGQ A;  1EZ6 A;  4A3I H;  4JI1 Q;  5FO9 B;  4FF4 A;  2I5M X;  4HID A;  2UUC Q;  2MP1 A;  1S3O A;  1TS2 A;  1KTK A;  2EYM A;  4JCV E;  5IP7 H;  3NEM A;  4DV1 L;  4GLX A;  1R9T B;  3OIQ A;  1STY A;  1WJJ A;  2L9H A;  3D0F A;  1ZYR C;  1X54 A;  2DY8 A;  4IFD H;  2IJ0 A;  4A3E B;  3KF6 B;  3A7L A;  4LF6 L;  2SDF A;  4JBW A;  1I4R A;  4IO9 A;  1R9T H;  2E2I B;  1VQE A;  4IPC A;  4O0A A;  1FJG L;  3K0Y A;  4X3U A;  5JJK A;  3K7U C;  1PTO B;  1JWM D;  3NBH B;  4A3E H;  2E2I H;  1JE5 A;  4AYB G;  1SE8 A;  1PTO H;  1TU2 B;  3EA6 A;  4TQU S;  1SNO A;  2CW0 C;  1KNE A;  4GN3 B;  4HR7 B;  4ZYS A;  4DR5 Q;  4DR3 L;  4JI6 L;  2MO0 A;  2ZM6 L;  2Z8L A;  4ID6 A;  4RCN A;  1WI5 A;  3VYS A;  3NWS A;  1VQC A;  1HZB A;  4K6D A;  1SDF A;  3QJY A;  3CCQ A;  2PZT A;  2VNU D;  1SN8 A;  4IUP A;  3CPW A;  2UUB Q;  2KUM A;  2PMZ E;  1FNV A;  1EIY B;  1VDZ A;  2PO4 A;  1OXV A;  4UP7 A;  1XPO A;  4JI7 L;  5IGD A;  3H0G G;  1JCK B;  5IT9 c;  1UE6 A;  4HN7 A;  3BDL A;  1PH7 A;  3T53 B;  1E2V A;  3H09 A;  3R8B A;  1I94 Q;  3L3O C;  1SFO B;  5CV6 A;  1PHJ A;  3MXN A;  4N9P A;  2LY7 A;  4JV5 L;  2AUJ D;  4FXD A;  4FP5 D;  2NTT A;  2R6G A;  4IPH A;  1EY8 A;  5KGU A;  4UAI A;  5IP9 G;  1SFO H;  5LL6 S;  1QG7 A;  4JI2 L;  2AQ3 B;  1EWI A;  1RHP A;  2ID0 A;  1PTO F;  3FHW A;  4JBM A;  2OWO A;  1QVG A;  4P75 A;  1SYF A;  1SYD A;  3KUP A;  1Z47 A;  1BF4 A;  3SVM A;  1TS5 A;  1GO3 E;  1EY5 A;  4NPS A;  2F3I A;  1IW7 D;  4YWM A;  3SR1 A;  2EQS A;  3K5M A;  1N33 Q;  4LWC A;  2Q8T A;  3OSO A;  1PZK D;  3CU7 A;  5M3M G;  2VXW A;  4PV1 C;  1AE3 A;  4DR6 L;  1MJE A;  1H9R A;  3NEN A;  2ZXP A;  5EAY A;  1LAC A;  1K3R A;  3S1Q B;  3LGJ A;  3T16 A;  3J7Z C;  2L1B A;  2PQE A;  1S5C D;  2FIN B;  2RDH A;  3HKZ G;  3TP5 A;  5IP9 H;  3QR8 A;  3PCO B;  4R4I A;  2V4D A;  4CGY B;  2FXQ A;  3E9I A;  1HH2 P;  4RG1 A;  4H0L C;  3S1Q H;  2NZO A;  5FLM H;  3HGB A;  2F0O A;  3HZX A;  3TRE A;  5EBD A;  4KY6 A;  2Z1C A;  1WYD A;  1XNR Q;  1K0R A;  4N9T A;  3PMF A;  2RQX A;  4LF8 Q;  2RCN A;  5M3M B;  4BA1 I;  1A3V A;  5JPM C;  3OIP A;  3KK7 A;  3OWE B;  4RKB A;  1STH A;  5M3M H;  1F2Y A;  1YHB A;  2IPK D;  3WOE A;  2B8F A;  2CHB D;  3HKZ B;  5KND A;  3ZJY C;  1XMO Q;  4KN7 C;  3KBG A;  3FDT A;  3NTK A;  2FMM A;  1E7Z A;  3IL8 A;  3GTO B;  5JOB A;  1L1O A;  4BWG B;  3URY A;  2HCI A;  3PF5 A;  3GTO H;  2WB1 E;  3SHL A;  1VQN A;  4B3M L;  4RGM A;  5EKK A;  2I46 A;  3H3V I;  3MXN B;  5LMN Q;  4ME5 A;  1OXS C;  3M4Y A;  3M3Y B;  1JE4 A;  1IHZ A;  1K8O A;  5C5M A;  4WFN 3;  2R7D A;  4QIW B;  1HUN A;  1A0I A;  2ZXO A;  3C46 A;  1V8Q A;  4AQY L;  1X65 A;  5A2Q E;  1S40 A;  1MHW C;  3M3Y H;  1N32 L;  2D0O A;  4BBR G;  2F0N A;  1BQQ T;  4F87 A;  2VZA A;  2PCF B;  4Y52 H;  2HHH Q;  1KAA A;  1PFB A;  2K6A A;  5FJ8 G;  1U4R A;  1I4H A;  1KL9 A;  2ZTC A;  4JI4 L;  4R4C A;  3NE5 B;  1STN A;  4JYA Q;  4CJ2 C;  1NMF A;  2IHE A;  4EQP A;  5E4W C;  3VR2 A;  5I2X A;  3GTG B;  4PNY A;  4XQJ A;  4B3T L;  4L5S A;  4X62 Q;  5T1G A;  4DUY Q;  1SAP A;  2XWB B;  3G48 A;  3UDG A;  1IKL A;  2K32 A;  3HP3 A;  3PUZ A;  2EYJ A;  3GTG H;  4RHR A;  1RJT A;  3LX0 A;  3CCL A;  2M2L A;  4GS3 A;  2KJX A;  5AFW A;  4KHP L;  4JOI C;  1M90 C;  1JMC A;  4N8X 1;  1STG A;  4BBR B;  1G29 1;  1EY7 A;  1KAB A;  1PH3 A;  3DHQ A;  2OQK A;  2F0I A;  2A8V A;  5D65 A;  5JJL A;  1GUG A;  3KDF B;  4EGV A;  1BDO A;  4BY1 G;  2PYK A;  1WTP A;  1J5E L;  4BBR H;  1LLR D;  1QJO A;  2A19 A;  2F0K A;  2WAQ E;  3HOW G;  3QO2 A;  1B7Y B;  1N9W A;  4XYO A;  3S2D H;  1KHI A;  5FJ8 H;  1HNZ Q;  2WKC A;  3S9W A;  1E2Z A;  3MC0 B;  3ER0 A;  1X55 A;  1HNX L;  4LJZ C;  5DLQ E;  2N55 A;  1CQV A;  3MAQ A;  3CCS A;  3CC2 A;  1FYC A;  1Q8I A;  2IW3 A;  4L5R C;  2BA1 A;  3PO2 G;  4LF9 L;  2EYL A;  4JPB W;  3SEB A;  1N36 Q;  4CJ1 B;  4ZKB B;  1VMC A;  2QF7 A;  3I90 A;  2BDO A;  3A0J A;  2QA4 A;  4DK6 C;  1Q1E A;  1GUT A;  4ZRZ A;  1DCZ A;  3HFZ B;  3QWN A;  1Q46 A;  2B2W A;  4DR1 L;  1A3U A;  5LMU L;  4JI3 Q;  1K8M A;  4BY1 B;  1JOR A;  2F0Q A;  5IOD A;  1L1O B;  2RDG A;  5CR3 A;  5T1I A;  2RSO A;  3RUZ A;  2VQE L;  5HGQ A;  3HOW B;  1EWH A;  5EPL A;  2K03 A;  4BY1 H;  3MHB A;  4A3M B;  3UDX A;  3GTK B;  4DXG A;  2F4V L;  3HOW H;  3RN2 A;  1D5Z C;  3I8Z A;  4HED A;  4LFC Q;  3OHX C;  3I72 A;  4HTH A;  4A3M H;  4PZ6 A;  1SYG A;  2K1B A;  3GTK H;  2MPM A;  5IY0 A;  1PVO A;  1PYS B;  4ME3 A;  1EQT A;  1SRU A;  5IGE A;  1LM0 A;  5JAV A;  3I3C A;  4A3F G;  2EY1 A;  3L2P A;  4DAY A;  2JSO A;  3BZC A;  3W5O A;  2UXD Q;  5CBE E;  1S5F D;  1XJV A;  5BN5 A;  2JN4 A;  3A55 A;  3SK5 A;  2TMP A;  3R2I A;  3T13 A;  2O5I C;  1PRT C;  1EUJ A;  3M85 A;  1X56 A;  2K5N A;  2UUA Q;  3KLS X;  2F0T A;  2EXZ A;  1K8G A;  1JOQ A;  1Y14 B;  3RLF A;  5C4H A;  1AFP A;  4LFA L;  4A3F B;  3HOZ G;  3F1Z A;  2BOS A;  4LF7 Q;  1GOZ A;  2UU9 L;  5FLX E;  1D7Q A;  1B3A A;  4A3F H;  2D5D A;  2KCT A;  2J7Z A;  4UPA A;  1CKN A;  3NTI A;  3C1E A;  1I4Q A;  3FKI G;  1DOM A;  3PIP 3;  3AFQ A;  1DXM A;  3TDQ A;  4O42 A;  1H9J A;  1VQA A;  2YU9 B;  2DUD A;  2EYP A;  2AWO A;  3TP6 A;  1O7I A;  5FO7 B;  3PGZ A;  1W2B A;  1LYL A;  3L7Z C;  1Q3L A;  1GUO A;  4PMW A;  1ASY A;  3P20 A;  4EX5 A;  4LK1 C;  3D8G A;  2YU9 H;  5DM7 3;  3JAM i;  3HOZ B;  3A8I E;  4DV0 L;  1VQ8 A;  3H3V H;  3J7Y W;  3K57 A;  2A6E C;  2F0E A;  3TP7 A;  3TME A;  5EKI A;  5E4X A;  5I6Y A;  5IYC G;  3HOZ H;  4DV3 L;  3IKJ A;  5IGF A;  1H95 A;  1J8I A;  3VA7 A;  4PQX A;  5D3D A;  3OTO Q;  5G3L F;  1Q8K A;  2HDM A;  3G4S A;  4P72 A;  2Z6K A;  3H91 A;  1EIG A;  1EY0 A;  4LW1 A;  1CZW A;  4K0K Q;  4GKK L;  2NZ1 D;  1LO5 D;  3E9H A;  3NSW A;  1H9S A;  5C0X J;  4A3G G;  3Q8D A;  4DV7 Q;  1A15 A;  4RGO S;  1G6Z A;  1UE5 A;  1W6K A;  2KCM A;  3CP0 A;  5C44 G;  3RLN A;  1UE1 A;  2ZT9 C;  1Y69 U;  1C8C A;  1D5X C;  4RGN A;  5EJW A;  2F52 A;  2K50 A;  3ERQ A;  3HS0 C;  1O78 A;  3T1Y L;  3CC4 A;  1B1Z A;  3E3X A;  1QWY A;  2EYO A;  1VF7 A;  3RMH A;  2E5L Q;  2P5Z X;  5IYC H;  2DNE A;  1VQ5 A;  1O80 A;  2VW9 A;  4A3G B;  3J7A 5;  3PSI A;  2K05 A;  1ML0 D;  3A8K E;  5C44 B;  4DAV A;  4A3B G;  1HA6 A;  2KA7 A;  4DV5 L;  4A3G H;  2EJF C;  2YYZ A;  5FLX c;  1SMY C;  1SE2 A;  1MIU A;  1WTX A;  2NWG A;  1EZ8 A;  1XTC D;  4TKO B;  2MQH A;  4RWS C;  1PLF A;  3F8T A;  3CRL C;  3R3O A;  4KI0 A;  4GKJ Q;  2A68 D;  1PFM A;  4XT1 B;  2B2V C;  3KBX A;  2KVM A;  3K59 A;  1YIJ A;  4X64 L;  2N3S A;  5E7N A;  5HGT A;  5JJI A;  4DV4 L;  3TSS A;  3OWF A;  1A8V A;  2K01 A;  1PFN A;  1ILP A;  4IUV A;  1DYQ A;  1U5K A;  1EQV A;  3VR3 A;  1CA5 A;  4IZ8 A;  5D14 A;  4PG3 A;  4LF5 L;  1YVC A;  2LXJ A;  4LFB Q;  4K2L A;  1SE4 A;  2EE1 A;  5M3F B;  2XIW A;  1GUW A;  1TY2 A;  1X3G A;  3TZD A;  1PTO D;  3AFP A;  1U9R A;  5M3F H;  3LNN A;  4QUF A;  5J39 A;  4X6A H;  4ZUI A;  4JVZ A;  3CCR A;  1VQK A;  1RL2 A;  2UXC Q;  2VQF Q;  3U9O A;  4GZY C;  1H9S B;  2VL6 A;  4DNT B;  1XNQ Q;  1ICF B;  1PRT B;  1B2T A;  4DV2 Q;  1F2M A;  4NXM Q;  3Q0A A;  2WB1 G;  3IRB A;  2HD3 A;  3NQI A;  5I9P A;  3J7A F;  3K81 C;  3TN2 A;  2F0W A;  3I73 A;  1D8L A;  2WIN B;  3QG1 A;  2VS1 A;  4Y7N B;  1JWU D;  2EJG C;  1C9O A;  1ASZ A;  1WD1 A;  4DUZ L;  3TP8 A;  3A5Z B;  5FO8 B;  5ISR A;  3G6J B;  4Z9C B;  4Y7N H;  4P74 A;  1HUM A;  4HSV A;  4APV A;  1FD7 D;  3KJO A;  4P73 A;  2BH2 A;  1YJN A;  3NBI A;  4UP8 A;  1DJR D;  4A3L G;  1WOC A;  1XMQ L;  1H9M A;  4YCV A;  3SK4 A;  2B2U A;  5EBC A;  2ZTE A;  1GHK A;  1U4M A;  2QCP X;  2WB1 B;  4EQN A;  1TY0 A;  2Z0S A;  2PPB C;  4X65 L;  1LAB A;  4MIU A;  4IPG A;  1SYB A;  2I5H A;  1EOT A;  1VQB A;  1NR2 A;  2SNM A;  4DR2 L;  1Z9F A;  3AYH B;  4RHS A;  1G2T A;  2SNS A;  3S1N B;  3FPU B;  2DGY A;  1EYG A;  5CYU A;  4A3D G;  1WD0 A;  3O13 A;  3S1N H;  4JI1 L;  2IL8 A;  1PRT F;  2MGS A;  2UUC L;  3S1M B;  1UEB A;  1E0B A;  2CQA A;  1GXD C;  3HG9 A;  1NJI C;  1SNM A;  2NN6 G;  4KKT A;  3S1M H;  4A3L H;  3UDI A;  2Q2T A;  4NMZ A;  1B8A A;  1KLG D;  4OGQ C;  1YNJ C;  3KJP A;  1I3Q B;  4JI8 Q;  1YIT A;  3EBE A;  2XNA C;  1OXX K;  2QEJ C;  3J81 i;  3Q24 A;  1PYB A;  5KEE A;  4A3D B;  2F3W A;  2CKZ B;  4CDE C;  1I3Q H;  3U4Z A;  1E3P A;  1HCZ A;  3E5S A;  5M9O A;  4QL5 A;  4EQO A;  4YWK A;  4DR5 L;  4A3D H;  2ASB A;  5IT9 L;  1HZA A;  3D31 A;  1BCP C;  5A35 A;  2O5J C;  3PQI A;  5EPJ A;  3CCJ A;  4FYD A;  2WAQ B;  1PA6 A;  1DOL A;  2BH8 A;  2A69 C;  1PDQ A;  4MHE A;  2B39 A;  3RD4 A;  3WWV A;  4NP5 A;  4HCS A;  4R8N A;  4RCO A;  3FRP B;  3E0J A;  2F0G A;  4P2C B;  5CGK A;  2K5W A;  4B08 A;  4A4I A;  2NN6 H;  5J1Z A;  4GNX C;  1G91 A;  2DY7 A;  1M1K C;  2UUB L;  1UUP A;  3DEP A;  1W3S A;  2TSS A;  4XDX A;  1KDA A;  3KF8 B;  4AIM A;  3RZD B;  1U0L A;  1IZ6 A;  1BR9 A;  2F0F A;  4S3S A;  2X69 A;  3T56 B;  4KTA A;  2XTI A;  4OHJ A;  3RZD H;  1LT3 D;  3K0X A;  1L1O C;  3DMU A;  1PV4 A;  1MSG A;  3F2B A;  5FLM G;  1I94 L;  1F9R A;  4UHV A;  4R4T A;  3OOC A;  2N49 A;  2JA5 G;  1OXU A;  2B29 A;  2MHV A;  3MFY A;  3W2D A;  4WRD A;  1E22 A;  1PH9 A;  4DAM A;  1VQF A;  1ZYR D;  4XT3 B;  1KC8 C;  1OTC A;  1TS4 A;  1XXG A;  5HUR A;  1STB A;  1MI2 A;  4K2K A;  3PO3 H;  4C1N I;  4LF4 Q;  1TQO A;  2PI2 E;  3NUC A;  1CM9 A;  1Q90 A;  4F7X A;  5DNF A;  3EVQ A;  3ITP A;  1F2L A;  4DK1 A;  5ELF A;  1N33 L;  1ESF A;  1FL0 A;  1HHV A;  2XN9 C;  1BBU A;  1HNW Q;  2CW0 D;  2JA5 B;  1HJP A;  1YNJ D;  4FF2 A;  4L8J A;  3SE0 A;  4IJH A;  4A93 G;  1HZ9 A;  3H6M A;  2JA5 H;  1VS0 A;  3PUW A;  4KHZ A;  2VUM G;  1MBY A;  1UE7 A;  1YI2 A;  2QEX A;  3CHB D;  1QVC A;  1CI3 M;  3SK6 A;  4GNX A;  5GAG C;  5FKA C;  1ENC A;  4K5V A;  2JK8 A;  4BS9 A;  1IBM Q;  1XNR L;  1C48 A;  2ZTD A;  1IL2 A;  1STA A;  4DR7 Q;  1CKO A;  3JAM E;  2Y0S G;  1Y1V G;  4LF8 L;  2A69 D;  4JW0 A;  5D3I B;  2XVS A;  1YNX A;  3H3V C;  4A93 B;  4NDX A;  4QQB X;  3DWQ A;  4R1J A;  3KOJ A;  2VUM B;  2WP8 J;  1XMO L;  4A93 H;  4DV6 Q;  3JC6 6;  2Q8I B;  1DD2 A;  2A5H A;  3D4D A;  4KN4 C;  2Z4H A;  2NVX B;  2I07 B;  2WAC A;  1PZI D;  2VUM H;  4B3M Q;  2DJG C;  1U4P A;  3BVG A;  3I55 A;  1SNQ A;  4G57 A;  2B2W C;  4X3T A;  4X66 L;  2NVX H;  4EQ5 A;  2Y0S B;  1Y1V B;  2D62 A;  1PH8 A;  1CSP A;  3V96 A;  3TBI B;  3DLL A;  1KIX A;  4DK3 C;  1SBB B;  1Y1V H;  5ELB A;  4DKA C;  5LMN L;  2K5D A;  2J0T D;  4OIJ A;  3MZ5 A;  5I9O A;  5ELN A;  2E2D C;  4CKB A;  1NTG A;  4KD3 A;  2XSC A;  4QUC A;  1PH5 A;  2I0Q A;  1D5M C;  5JEA J;  3EN2 A;  1KDC A;  5C3X A;  3J7A V;  4QGU A;  4QF4 A;  2HHH L;  1CHQ D;  1PFS A;  5G3L D;  3F2D A;  2GN5 A;  2Q2I A;  2CWP A;  2KBN A;  1KAW A;  2SEB D;  4CKE A;  4JYA L;  4FF1 A;  5IGC A;  1XPU A;  3S2D B;  2L4N A;  4X62 L;  2Z4I A;  1N34 Q;  1FGB D;  4DUY L;  3RR5 A;  2L15 A;  1AN8 A;  1BCP B;  4YIJ A;  1L2F A;  3J80 E;  3SDZ A;  1NNX A;  2HUG A;  3A5U A;  2MNA A;  4HJ9 A;  4A3M G;  1YHA A;  5F2D A;  5C4J B;  3DWA A;  1VQ6 A;  4KY7 A;  3JAM c;  4GNX B;  3K5O A;  4V19 0;  5GAH C;  1YBY A;  1RCV D;  2UXB Q;  1EIF A;  3BZD B;  5C4J H;  5IGB A;  4KMU C;  3EJI A;  3G71 A;  1HNZ L;  4MTN A;  4CJ0 B;  1XPR A;  3IAY A;  4AYB E;  4LUO A;  1E1O A;  1EYA A;  3CCM A;  3B6Y A;  1SND A;  1JB3 A;  1AH9 A;  4CDC C;  1QB5 D;  5ELC A;  2RCF A;  4IUR A;  3VYT A;  3OW2 A;  2RA4 A;  1IBK Q;  5IE8 A;  4IUN A;  3VR4 A;  5A2Q L;  3CW2 C;  3D6C A;  4POF A;  1N36 L;  1EEF D;  2B3G A;  4PZ8 A;  3EQL C;  1E24 A;  4JI3 L;  2F4V Q;  2RHS B;  1DGS A;  1KNA A;  5C0X G;  2BE5 C;  1HR0 Q;  1WCM G;  5FOB B;  1KQS A;  2LS0 1;  2RKS A;  3G7L A;  1IBL Q;  3RN5 A;  4CKC A;  1K83 B;  2Z6K C;  2CVR A;  3BJU A;  1JJG A;  2NUC A;  3CPF A;  3VR5 A;  4OX9 Q;  4LFC L;  2K5H A;  1BCP F;  1K83 H;  4JI0 Q;  2NVY B;  5BR8 Q;  3E6Z X;  2F0H A;  1S5E D;  2LXK A;  2CH4 W;  4OXP A;  3D6W A;  3BYY B;  2NVY H;  3HEJ A;  2UXD L;  3M7G A;  1JQY D;  4C3H B;  1A6X A;  3CRK C;  4UDU C;  5DAU A;  2Z6B A;  2WV6 D;  1HXY D;  4NB3 A;  1C4Q A;  1WCM B;  3V2T A;  3P75 A;  4OWT B;  4C3H H;  4I7Z C;  4KY5 A;  5J22 A;  2M00 A;  2UUA L;  2XGT A;  1L0X B;  4GLV B;  5IWA Q;  5C0X H;  1WCM H;  1S4Z A;  1ROD A;  3VYU A;  5L37 A;  1SYC A;  3ZYY X;  2ZXR A;  4IOA A;  2QDL A;  3J80 c;  3CCU A;  1TS3 A;  4A3J G;  3U58 A;  2GA4 B;  3HRZ C;  4MZ9 A;  4OO1 I;  2KHJ A;  1YHQ A;  2EYH A;  2YTX A;  2LFN A;  4LF7 L;  5C4X G;  3A7A B;  2G9H D;  3C1F A;  3MXU A;  4UY8 C;  4R9W A;  1SEB D;  3I56 A;  2A73 B;  1A62 A;  3HKZ E;  4C3J G;  4B9X A;  1MJC A;  4KD4 A;  2KED A;  3KLW A;  2PI2 A;  2FHT A;  1SJH D;  2L11 A;  1PH2 A;  2RF4 A;  3V05 A;  4XQN A;  2XRQ D;  1V1Q A;  1TVX A;  3UDF A;  5JVG 3;  4A3J B;  1GKH A;  1A2T A;  1VQI A;  3AMU A;  4K6L A;  2OCE A;  3NTH A;  1VQP A;  3ONA B;  1EFW A;  1K9M C;  1X3F A;  2F03 A;  3J81 E;  1VQM A;  5C4X B;  4DR4 Q;  1S5D D;  4A3J H;  1KDB A;  2JA7 H;  4GN5 A;  2OEO A;  2BE5 D;  5C4X H;  3CME A;  2Q2H A;  5I4D A;  2BCO A;  2F0M A;  4WOR A;  4MTK A;  4QIW E;  3BU2 A;  5C3W A;  4C3J B;  4Q5V A;  4I7A A;  1CZG A;  5E1F A;  5BN4 A;  1QZH A;  4K0K L;  4IOC A;  4KJN A;  4B3R Q;  3S15 B;  4QMG A;  2PW7 A;  4DAY B;  4Q0F A;  2A6H C;  2KQ3 A;  2JE6 I;  5C3E G;  4C3J H;  3I4O A;  3KYH C;  3BDO A;  4AH6 A;  4DV7 L;  1X32 A;  1PRT D;  3KLS A;  2EOT A;  3DUZ A;  5ELE A;  4OWW B;  2R7Z G;  3S15 H;  1TII D;  4GLA C;  1TT2 A;  2IX3 A;  2PMZ B;  3BVM A;  5FLX L;  2FFK B;  1B44 D; 
#chains in the Genus database with same CATH homology
 1B9N A;  2D9U A;  4XXE A;  2PW5 A;  1WTW A;  1Q1B A;  5JVH 3;  2NN6 I;  4L6T B;  4KV6 A;  5ELD A;  3EFX D;  2OT2 A;  5C3E B;  3GD7 A;  5JJZ A;  4DU9 A;  5KIX A;  4RH6 A;  2R7Z B;  5IIF A;  2B2Y A;  3BVZ A;  4F8M A;  3MTS A;  4FVM A;  5CMD A;  1IYV A;  1U4L A;  2B2U C;  1LTT D;  1SYE A;  3MXG A;  4JK1 C;  3MA2 B;  2A6E D;  2E2J B;  1VCI A;  4E6I A;  4C3I B;  4DN4 M;  4XQQ A;  2E2H B;  3NP8 A;  1HQR D;  4RFB A;  3DEO A;  3HOY B;  2RVL A;  1ESR A;  2L12 A;  5KNC A;  4OO1 G;  2HDL A;  1UNS A;  5K5P A;  4OIK A;  1W6J A;  1WTQ A;  1L0Y B;  1GUN A;  3PUV A;  1ENA A;  1HA5 A;  1LT6 D;  3BS1 A;  1DZ1 A;  2A6H D;  3WOF A;  3VR6 A;  3NPP A;  5KNB A;  4MN3 A;  1PXU A;  3OW7 A;  4DXF A;  2EJM A;  2EYF A;  4J6H A;  5C6A A;  2F3V A;  1AW7 A;  3D4W A;  1QOH A;  4KHV A;  1Q12 A;  3GTJ B;  1RKN A;  1AP0 A;  3VYR A;  1LTS D;  4H13 C;  3RZO B;  3CQZ B;  4OO1 H;  2K28 A;  1B50 A;  3DWP A;  1ET9 A;  1SMY D;  4FNF A;  3S2H B;  2AQ2 B;  4V0B A;  4U68 A;  4X3S A;  2M9V A;  1I50 B;  2E76 C;  2L55 A;  2K33 A;  5COR A;  1B9M A;  3AB9 A;  1SSO A;  3Q22 A;  1FNU A;  3GTQ B;  4NKL A;  4HMJ A;  1NCV A;  4K14 A;  4TRD A;  1QNK A;  1EFI D;  1TWH B;  2AQ1 B;  1GUS A;  2K04 A;  1GHJ A;  1ZXT A;  3PUX A;  1JIC A;  1I4X A;  3MEH A;  1BXT A;  2B2T A;  1IW7 C;  2JA8 B;  3OMG A;  4J8Q A;  2JP1 A;  2MUY A;  2RSN A;  2F0U A;  4KJO A;  3VA5 A;  1M8A A;  1SXT A;  3LWU A;  3IFT A;  2RBM A;  1M4V A;  4M8A A;  1VF5 C;  3NK9 A;  1IYU A;  3D3R A;  1Z6H A;  3Q23 A;  1NAP A;  1AZP A;  1G8Z D;  4ILW A;  3X3M A;  3S16 B;  4ZKC B;  2IX0 A;  3M4O B;  2E75 C;  3HOV B;  3U9S A;  1RDP D;  3GV3 A;  2AWN A;  4DNR B;  1LTB D;  2B63 B;  1AEX A;  3BYT B;  2BA0 A;  5LL6 X;  3OPO A;  1FR3 A;  1SNP A;  2EVB A;  3F2U A;  4AYB B;  2E74 C;  5KYI A;  2XWJ B;  4XIG S;  3QOJ A;  1H9K A;  4IFD J;  2KCC A;  3I4L A;  1B4O A;  4G7O C;  4DK0 A;  5M5W B;  2H4O A;  5CBA E;  2NB0 A;  3D4R A;  1BO0 A;  1J9O A;  3K5N A;  3PO3 B;  2IWH A;  2JA6 B;  2JXM B;  1EYD A;  1IL8 A;  1CTM A;  3KLR A;  3SXH A;  5C5L A;  1NR4 A;  4QCL A;  2R3Z A;  2R61 A;  3GTL B;  2C5C A;  4M1U B;  3H0G B;  1TWA B;  5JEA G;  1KLU D;  1T5E A;  4K8I A;  2JYO A;  3R93 A;  4H44 C;  4FF3 A;  3GQB A;  4X3K A;  4HCE A;  5I6W A;  4FXG C;  2D2C C;  5KYL A;  2WII B;  2PZW A;  2K7V A;  2NTS A;  3K6O A;  2PNR C;  2QIL A;  1V1P A;  3P1H A;  1ET6 A;  1EY6 A;  4NW2 A;  5EQ0 A;  2EDG A;  1EU4 A;  1BCP D;  5KRU A;  3QOL A;  5C0X I;  1WTR A;  5JPN C;  1JOK A;  1JR0 D;  2LKV A;  1RF2 D;  5JEA H;  3GTP B;  4LAA A;  1DON A;  1CQF A;  2F0P A;  2F0D A;  4IQZ A;  4PMC A;  4ABN A;  3GP7 A;  1EIH A;  1V1O A;  2ICI A;  4U67 3;  1LT5 D;  1UEA B;  4C2M B;  3WDN A;  3A56 A;  1Z7T A;  1JC7 A;  1HQM C;  1XWE A;  1X3P A;  1SE3 A;  2BDN A;  3MVV A;  4HAE A;  2QDB A;  3HOU B;  1D6E C;  2KHS A;  3PV0 A;  1D2B A;  1MGS A;  4DGZ A;  1RTN A;  2NVQ B;  1EU3 A;  2B8G A;  1FNW A;  1NSN S;  5C4Z A;  4BBS B;  4A3K B;  2EY6 A;  4G7H C;  4HSP A;  3PIO 3;  3N52 A;  1ENF A;  1T5X D;  1I6H B;  4CBV A;  1QIL A;  5FK9 C;  3K5L A;  4KK7 A;  1QNU A;  1S5B D;  4RGT A;  1BNZ A;  3JAM L;  1QE6 A;  3MFG A;  3W3A A;  4RA8 A;  4DF7 A;  1ZKO A;  1XX8 A;  3R2T A;  2LMC B;  1E2W A;  3BDC A;  4ZAI A;  2Q8R E;  1YNN C;  2X6L A;  3FEW X;  1V1P B;  2H1E A;  3FPP A;  4F88 A;  1II3 A;  3C3L A;  2MJ8 A;  1HTP A;  1LTA D;  2XRS D;  2NYZ D;  1OO9 B;  3H94 A;  1O7L A;  1RTO A;  1ZEQ X;  4RKL A;  1SNC A;  3Q6S A;  1TR5 A;  4C1N K;  4C3H G;  5IGG A;  4CHT B;  3NQT A;  1F77 A;  1TWG B;  1V43 A;  3DM1 A;  2DNC A;  4IUT A;  3PO2 B;  2AUK A;  1PMR A;  3K7A B;  4O1N A;  1HFN A;  4DA2 A;  3S17 B;  2F0L A;  2EPB A;  2KCN A;  2NBF A;  2JEA I;  1PYW D;  1EY4 A;  3GO5 A;  1F2Z A;  2F1M A;  1I4G A;  3HOX B;  3J80 L;  1IKM A;  3DXJ C;  2L0C A;  2NVT B;  1PZJ D;  1CFM A;  2L5T A;  5EPK A;  1O7Z A;  1CHP D;  3FMC A;  5M5Y B;  5COY A;  2IX1 A;  1SJE D;  1B53 A;  4BY7 B;  2C9O A;  4ZUJ A;  1I4P A;  1YNN D;  3QIA A;  1XYI A;  3T4A C;  1VMP A;  3NXW A;  5I2Y A;  2F0J A;  2B2Y C;  5EKL A;  2HQE A;  4HMI A;  2EZV A;  2A68 C;  4QB4 A;  1WTO A;  2HCC A;  4KKS A;  2VB2 X;  1EEI D;  4TSS A;  1EL0 A;  2K5Q A;  2JEB I;  2EY5 A;  2JA7 B;  1HFG A;  1LV9 A;  3T51 B;  1A2U A;  3MXP A;  2WKD A;  3A54 A;  4ODG A;  4IN3 A;  4IUU A;  1R4Q B;  5CV5 A;  2ENB A;  2F4I A;  2FMC A;  2QKI C;  2RDF A;  5BN3 A;  1O7Y A;  1Y1W B;  3I4M B;  5IOC A;  4IFD I;  3FKI B;  1PTO C;  1JWS D;  1NUC A;  3UI2 A;  2ICE C;  1CA6 A;  4L63 B;  4DAP A;  4G7Z C;  1I6V C;  2A74 C;  4PMB A;  4K5X A;  1ONL A;  3MWY W;  3P7J A;  2G9D A;  3I91 A;  4ZQ3 A;  3NHH A;  4H7B A;  1RD9 D;  4RAU C;  1HPC A;  1R4P B;  1DM0 B;  1EYC A;  1Y8N B;  1EWC A;  4C3I G;  2O2L D;  3ND8 A;  3C2P A;  1DOK A;  4G4K A;  4ULL A;  3M7N A;  4LMQ D;  3IFD A;  5DEH A;  3X3N A;  1STE A;  1F9Q A;  3L9A X;  1HTL D;  4R8I A;  1F9S A;  4IUQ A;  3I70 A;  4B9W A;  3SK8 A;  4FXK C;  4ZLT F;  5CV9 A;  3QB3 A;  5E3F A;  1WTV A;  2X6G A;  1MD2 D;  2IT1 A;  5TSS A;  1TWC B;  3J81 L;  3K58 A;  1LTG D;  5EGT A;  1OXT A;  2OXP A;  4I65 A;  3AU7 A;  2F0S A;  2FJ2 A;  3A8J E;  3I4N B;  1A3T A;  5M5X B;  5K36 G;  3CKI B;  5CV7 A;  1BOS A;  4XTC S;  1Y8O B;  3S14 B;  3NBH A;  4A3B B;  4K5W A;  2N88 A;  1LTI D;  1WVL A;  1CT1 D;  2KOL A;  2B2T C;  1D1I A;  2VB3 X;  3N6R A;  1AZQ A;  1X3Q A;  1TWF B;  2R93 B;  2EY2 A;  4KKU A;  1UAP A;  1CK1 A;  1BUV T;  4DFA A;  4ZK9 B;  1D1K A;  1ILQ A;  1JOO A;  1QCB D;  2R92 B;  4BA2 I;  2OF1 A;  5K36 H;  3TZU A;  2PZU A;  2KEE A;  3LWE A;  1TKW B;  4J1M A;  1ICW A;  2KEC A;  3GTM B;  2O4X A;  1GJX A;  2DN8 A;  2F0V A;  4OL7 A;  3FVQ A;  4EVO A;  2J4X A;  1Y8P B;  1EY9 A;  2SOB A;  3KF8 A;  3ND9 A;  4IFD G;  5IT9 E;  5LHY 1;  3NWT A;  5CV8 A;  4FO2 A;  1HRJ A;  3PUY A;  1BBX C;  3GV6 A;  3OMC A;  1MSH A;  4WJW A;  4C56 C;  4XYQ A;  1G2S A;  2B2V A;  5CV4 A;  1LT4 D;  5CC4 A;  4IAL A;  4K8J A;  1F9P A;  3S1R B;  5NUC A;  4A3I B;  5DM6 3;  1LTR D;  3ERO A;  3BG3 A;  1EZ6 A;  5FO9 B;  4FF4 A;  2MP1 A;  1TS2 A;  1KTK A;  2EYM A;  1R9T B;  3OIQ A;  1STY A;  2L9H A;  1ZYR C;  2DY8 A;  4IFD H;  2IJ0 A;  4A3E B;  3A7L A;  2SDF A;  4JBW A;  1I4R A;  2E2I B;  3K0Y A;  4X3U A;  1PTO B;  1JWM D;  1PTO H;  1TU2 B;  3EA6 A;  4TQU S;  1SNO A;  2CW0 C;  1KNE A;  4HR7 B;  4ZYS A;  2Z8L A;  4ID6 A;  4RCN A;  3VYS A;  3NWS A;  4K6D A;  1SDF A;  3QJY A;  2PZT A;  2VNU D;  4IUP A;  2KUM A;  1FNV A;  1VDZ A;  2PO4 A;  1OXV A;  5IGD A;  1JCK B;  4HN7 A;  3BDL A;  3T53 B;  1E2V A;  3H09 A;  3R8B A;  3L3O C;  1SFO B;  5CV6 A;  3MXN A;  4N9P A;  2LY7 A;  2AUJ D;  4FXD A;  4FP5 D;  2NTT A;  2R6G A;  1EY8 A;  5KGU A;  4UAI A;  5LL6 S;  1QG7 A;  2AQ3 B;  1RHP A;  2ID0 A;  1PTO F;  1SYF A;  1SYD A;  3KUP A;  1Z47 A;  1BF4 A;  3SVM A;  1TS5 A;  1EY5 A;  1IW7 D;  3SR1 A;  3K5M A;  2Q8T A;  3OSO A;  1PZK D;  3CU7 A;  2VXW A;  4PV1 C;  1H9R A;  2ZXP A;  1LAC A;  3S1Q B;  3T16 A;  2L1B A;  2PQE A;  1S5C D;  2FIN B;  2RDH A;  3TP5 A;  2V4D A;  4CGY B;  4H0L C;  3HGB A;  2F0O A;  3HZX A;  5EBD A;  4KY6 A;  2Z1C A;  4N9T A;  3PMF A;  2RQX A;  5M3M B;  4BA1 I;  1A3V A;  5JPM C;  3OIP A;  3KK7 A;  3OWE B;  4RKB A;  1STH A;  1F2Y A;  2IPK D;  3WOE A;  2B8F A;  2CHB D;  3HKZ B;  5KND A;  4KN7 C;  3KBG A;  3FDT A;  3NTK A;  2FMM A;  3IL8 A;  3GTO B;  5JOB A;  4BWG B;  3URY A;  2HCI A;  3SHL A;  4RGM A;  5EKK A;  2I46 A;  4ME5 A;  1OXS C;  3M4Y A;  3M3Y B;  1JE4 A;  1IHZ A;  1K8O A;  5C5M A;  4WFN 3;  4QIW B;  1HUN A;  2ZXO A;  3C46 A;  1V8Q A;  5A2Q E;  2F0N A;  1BQQ T;  4F87 A;  2PCF B;  1KAA A;  1PFB A;  2K6A A;  1U4R A;  1I4H A;  3NE5 B;  1STN A;  4CJ2 C;  4EQP A;  5E4W C;  3VR2 A;  5I2X A;  3GTG B;  4PNY A;  4XQJ A;  5T1G A;  1SAP A;  2XWB B;  1IKL A;  2K32 A;  3HP3 A;  3PUZ A;  2EYJ A;  4RHR A;  1RJT A;  3LX0 A;  2M2L A;  2KJX A;  5AFW A;  1STG A;  4BBR B;  1G29 1;  1EY7 A;  1KAB A;  3DHQ A;  2F0I A;  5D65 A;  1GUG A;  4EGV A;  1BDO A;  2PYK A;  1WTP A;  1LLR D;  1QJO A;  2F0K A;  3QO2 A;  4XYO A;  2WKC A;  3S9W A;  1E2Z A;  3MC0 B;  4LJZ C;  2N55 A;  1CQV A;  3MAQ A;  1FYC A;  1Q8I A;  2IW3 A;  2BA1 A;  2EYL A;  3SEB A;  4CJ1 B;  4ZKB B;  1VMC A;  2QF7 A;  3I90 A;  2BDO A;  1Q1E A;  1GUT A;  4ZRZ A;  1DCZ A;  3QWN A;  2B2W A;  1A3U A;  4BY1 B;  1JOR A;  1K8M A;  2F0Q A;  5IOD A;  2RDG A;  5CR3 A;  5T1I A;  2RSO A;  3RUZ A;  3HOW B;  1EWH A;  5EPL A;  2K03 A;  3MHB A;  4A3M B;  3GTK B;  4DXG A;  1D5Z C;  3I8Z A;  4HED A;  3OHX C;  3I72 A;  4HTH A;  1SYG A;  2K1B A;  2MPM A;  1EQT A;  5JAV A;  5IGE A;  3I3C A;  2EY1 A;  4DAY A;  2JSO A;  5CBE E;  1S5F D;  5BN5 A;  3A55 A;  3SK5 A;  2TMP A;  3R2I A;  3T13 A;  2O5I C;  1PRT C;  3M85 A;  3KLS X;  2F0T A;  2EXZ A;  1JOQ A;  3RLF A;  5C4H A;  1AFP A;  4A3F B;  2BOS A;  1GOZ A;  5FLX E;  1B3A A;  2D5D A;  2J7Z A;  3NTI A;  3C1E A;  1I4Q A;  1DOM A;  3PIP 3;  1DXM A;  3TDQ A;  4O42 A;  1H9J A;  2YU9 B;  2EYP A;  2AWO A;  3TP6 A;  5FO7 B;  3L7Z C;  1Q3L A;  1GUO A;  4PMW A;  3P20 A;  4LK1 C;  3D8G A;  5DM7 3;  3HOZ B;  3A8I E;  3J7Y W;  3K57 A;  2A6E C;  2F0E A;  3TP7 A;  3TME A;  5EKI A;  5E4X A;  5I6Y A;  3IKJ A;  5IGF A;  1J8I A;  3VA7 A;  4PQX A;  5D3D A;  5G3L F;  2HDM A;  3H91 A;  1EIG A;  1EY0 A;  1CZW A;  2NZ1 D;  1LO5 D;  3NSW A;  1H9S A;  5C0X J;  1A15 A;  4RGO S;  1G6Z A;  1W6K A;  2ZT9 C;  1Y69 U;  1C8C A;  1D5X C;  4RGN A;  5EJW A;  3ERQ A;  3HS0 C;  1O78 A;  1B1Z A;  1QWY A;  2EYO A;  1VF7 A;  3RMH A;  2DNE A;  1O80 A;  4A3G B;  2K05 A;  1ML0 D;  3A8K E;  5C44 B;  4DAV A;  1HA6 A;  2KA7 A;  2EJF C;  2YYZ A;  1SMY C;  1SE2 A;  1WTX A;  2NWG A;  1EZ8 A;  1XTC D;  4TKO B;  4RWS C;  1PLF A;  3CRL C;  3R3O A;  4KI0 A;  2A68 D;  1PFM A;  4XT1 B;  2B2V C;  3KBX A;  2KVM A;  3K59 A;  5HGT A;  3TSS A;  3OWF A;  2K01 A;  1PFN A;  1ILP A;  4IUV A;  1DYQ A;  1EQV A;  3VR3 A;  1CA5 A;  4IZ8 A;  5D14 A;  4K2L A;  1SE4 A;  2EE1 A;  5M3F B;  2XIW A;  1GUW A;  1TY2 A;  3TZD A;  1PTO D;  1U9R A;  3LNN A;  4QUF A;  5J39 A;  4ZUI A;  3U9O A;  4GZY C;  1H9S B;  4DNT B;  1PRT B;  1B2T A;  1F2M A;  3Q0A A;  3NQI A;  5I9P A;  3J7A F;  3TN2 A;  2F0W A;  3I73 A;  2WIN B;  3QG1 A;  4Y7N B;  1JWU D;  2EJG C;  1WD1 A;  3TP8 A;  5FO8 B;  5ISR A;  3G6J B;  4Z9C B;  1HUM A;  4HSV A;  1FD7 D;  3NBI A;  1DJR D;  1H9M A;  3SK4 A;  2B2U A;  5EBC A;  1GHK A;  1U4M A;  2QCP X;  2WB1 B;  4EQN A;  1TY0 A;  2PPB C;  1LAB A;  4MIU A;  1SYB A;  1EOT A;  1NR2 A;  2SNM A;  4RHS A;  1G2T A;  2SNS A;  3S1N B;  3FPU B;  5CYU A;  1WD0 A;  3O13 A;  2IL8 A;  1PRT F;  2MGS A;  3S1M B;  1E0B A;  2CQA A;  1GXD C;  3HG9 A;  1SNM A;  2NN6 G;  4KKT A;  4NMZ A;  1KLG D;  4OGQ C;  1YNJ C;  1I3Q B;  2XNA C;  1OXX K;  2QEJ C;  3Q24 A;  5KEE A;  4A3D B;  2F3W A;  1HCZ A;  3E5S A;  5M9O A;  4EQO A;  5IT9 L;  3D31 A;  1BCP C;  5A35 A;  2O5J C;  5EPJ A;  4FYD A;  2WAQ B;  1DOL A;  3RD4 A;  2A69 C;  1PDQ A;  4MHE A;  2B39 A;  4NP5 A;  4HCS A;  4R8N A;  4RCO A;  3FRP B;  3E0J A;  2F0G A;  4P2C B;  5CGK A;  2K5W A;  4B08 A;  2NN6 H;  5J1Z A;  1G91 A;  2DY7 A;  1UUP A;  3DEP A;  2TSS A;  4XDX A;  1KDA A;  3RZD B;  1BR9 A;  2F0F A;  4S3S A;  2X69 A;  3T56 B;  4KTA A;  4OHJ A;  1LT3 D;  3DMU A;  1MSG A;  1F9R A;  3OOC A;  1OXU A;  2MHV A;  3MFY A;  3W2D A;  4WRD A;  4XT3 B;  1ZYR D;  1TS4 A;  1XXG A;  5HUR A;  1STB A;  1MI2 A;  4K2K A;  4C1N I;  1TQO A;  3NUC A;  1CM9 A;  1Q90 A;  4F7X A;  5DNF A;  3EVQ A;  3ITP A;  1F2L A;  4DK1 A;  5ELF A;  1ESF A;  1HHV A;  2XN9 C;  2CW0 D;  2JA5 B;  1YNJ D;  4FF2 A;  4L8J A;  3SE0 A;  3H6M A;  3PUW A;  4KHZ A;  1MBY A;  3CHB D;  1CI3 M;  3SK6 A;  5FKA C;  1ENC A;  4K5V A;  4BS9 A;  1C48 A;  1STA A;  3JAM E;  2A69 D;  5D3I B;  2XVS A;  3H3V C;  4A93 B;  4NDX A;  3DWQ A;  2VUM B;  2WP8 J;  2Q8I B;  1DD2 A;  2A5H A;  3D4D A;  4KN4 C;  2Z4H A;  2NVX B;  2I07 B;  2WAC A;  1PZI D;  1U4P A;  3BVG A;  1SNQ A;  4G57 A;  2B2W C;  4X3T A;  2Y0S B;  1Y1V B;  2D62 A;  3V96 A;  3TBI B;  1SBB B;  5ELB A;  2K5D A;  2J0T D;  4OIJ A;  3MZ5 A;  5I9O A;  2E2D C;  4CKB A;  4KD3 A;  2XSC A;  4QUC A;  1D5M C;  5JEA J;  1KDC A;  5C3X A;  3J7A V;  4QF4 A;  1CHQ D;  5G3L D;  2SEB D;  4CKE A;  4FF1 A;  5IGC A;  3S2D B;  2L4N A;  2Z4I A;  1FGB D;  1AN8 A;  1BCP B;  4YIJ A;  3J80 E;  3SDZ A;  2HUG A;  5F2D A;  5C4J B;  3DWA A;  4KY7 A;  3K5O A;  4V19 0;  1RCV D;  3BZD B;  5IGB A;  4KMU C;  3EJI A;  4CJ0 B;  3IAY A;  1EYA A;  1SND A;  1JB3 A;  1QB5 D;  5ELC A;  4IUR A;  3VYT A;  2RA4 A;  4IUN A;  3VR4 A;  5A2Q L;  3D6C A;  1EEF D;  3EQL C;  1KNA A;  5C0X G;  2BE5 C;  5FOB B;  2LS0 1;  2RKS A;  3G7L A;  4CKC A;  1K83 B;  2CVR A;  2NUC A;  3VR5 A;  1BCP F;  2NVY B;  3E6Z X;  2F0H A;  1S5E D;  3D6W A;  3BYY B;  3HEJ A;  3M7G A;  1JQY D;  4C3H B;  1A6X A;  3CRK C;  4UDU C;  5DAU A;  2WV6 D;  1HXY D;  1C4Q A;  1WCM B;  3V2T A;  3P75 A;  4I7Z C;  4KY5 A;  5J22 A;  2M00 A;  1L0X B;  5C0X H;  1S4Z A;  1ROD A;  3VYU A;  1SYC A;  3ZYY X;  2ZXR A;  1TS3 A;  2GA4 B;  3HRZ C;  4OO1 I;  2EYH A;  2LFN A;  3A7A B;  2G9H D;  3C1F A;  3MXU A;  4R9W A;  1SEB D;  2A73 B;  4C3J G;  4B9X A;  4KD4 A;  2KED A;  2FHT A;  1SJH D;  2L11 A;  3V05 A;  4XQN A;  2XRQ D;  1TVX A;  5JVG 3;  4A3J B;  1A2T A;  3AMU A;  4K6L A;  3NTH A;  3ONA B;  2F03 A;  3J81 E;  5C4X B;  1S5D D;  1KDB A;  2OEO A;  2BE5 D;  5I4D A;  2BCO A;  2F0M A;  4WOR A;  5C3W A;  4C3J B;  4Q5V A;  1CZG A;  5E1F A;  5BN4 A;  4KJN A;  3S15 B;  4QMG A;  2PW7 A;  4Q0F A;  2A6H C;  2KQ3 A;  2JE6 I;  3BDO A;  1X32 A;  1PRT D;  3KLS A;  2EOT A;  3DUZ A;  5ELE A;  1TII D;  1TT2 A;  2IX3 A;  2PMZ B;  3BVM A;  5FLX L;  2FFK B;  1B44 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...