1H9MA

Two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
141
structure length
141
Chain Sequence
b'MKISARNVFKGTVSALKEGAVNAEVDILLGGGDKLAAVVTLESARSLQLAAGKEVVAVVKAPWVLLMTDSSGYRLSARNILTGTVKTIETGAVNAEVTLALQGGTEITSMVTKEAVAELGLKPGASASAVIKASNVILGVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDENUM-BINDING-PROTEIN
publication title Two Crystal Structures of the Cytoplasmic Molybdate-Binding Protein Modg Suggest a Novel Cooperative Binding Mechanism and Provide Insights Into Ligand-Binding Specificity
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Binding protein
total genus 28
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9mA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9mA01
1G291 2K32A 1GUOA 3D4RA 1OXTA 4G7HC 1IW7C 1GJXA 1BDOA 2O5IC 4DK1A 3I73A 2L5TA 1H9SB 2JEBI 2A6ED 3GD7A 2A6HC 4IFDH 3L7ZC 2BA0A 1DCZA 1PMRA 1VF5C 2E75C 3LWUA 5A35A 3IKJA 2D5DA 3OPOA 3QJYA 2IT1A 1HTPA 1O78A 2F1MA 1B9MA 5KNDA 3MXUA 3PUVA 3ND8A 3SDZA 4IFDG 1GUGA 2AUKA 1FR3A 1Y8OB 3LNNA 1Z6HA 2EJFC 3WDNA 3EQLC 4LJZC 3MFYA 4GZYC 4I7ZC 3GQBA 1ZYRC 1K8MA 4KMUC 4TQUS 1DXMA 3A8JE 3OW7A 5JEAH 2A69C 1LACA 1V43A 2JE6I 3AB9A 4L8JA 4OO1H 3M4YA 5KNCA 5K36H 3FMCA 4G7ZC 1HCZA 3A7LA 4KN7C 4HR7B 3VR6A 2JEAI 4KN4C 2QF7A 5JEAG 1HQMC 1Z7TA 1TKWB 5BN3A 1OXSC 3KLRA 4DNRB 1EWHA 4OO1G 4TKOB 4DNTB 5K36G 4KI0A 2Q8IB 2B8GA 3A8KE 1H9SA 1OXUA 2D2CC 2BA1A 3U9SA 3NE5B 1GUTA 1ONLA 1OXXK 2K7VA 1GHJA 1VDZA 3T51B 3VR2A 2A68D 2LMCB 2NN6I 4PV1C 1H9RA 4DK0A 2BE5C 2EVBA 1YNJC 2R6GA 3PUWA 4BA1I 2CW0C 3CRLC 5BN5A 3DXJC 1TU2B 2EJMA 3RLFA 4JBWA 1HPCA 1GUNA 1CI3M 4KKTA 1B9NA 2DNEA 4BA2I 1H9JA 4LK1C 4XIGS 1QJOA 2A6EC 1IW7D 2EDGA 2ZT9C 5BN4A 2E74C 5C0XH 3CRKC 1YNNC 1I6VC 4RCNA 1VCIA 3PUZA 1CTMA 1FYCA 1H9KA 2E76C 4OGQC 1E2VA 2A6HD 2PCFB 3N6RA 3HGBA 2NN6H 5C0XG 4XTCS 2KA7A 3BG3A 1Q90A 5KNBA 1VF7A 3VR3A 3M85A 3I72A 1H9MA 3SE0A 3PUYA 3A8IE 3VR4A 2PPBC 1CFMA 1O7LA 2NN6G 3H94A 3W3AA 2BE5D 4KKUA 3T53B 3M7NA 1Y8NB 1LABA 1Y69U 1Q12A 3D31A 2D62A 1Q1EA 2AUJD 3VA7A 1ZKOA 3QIAA 1E2WA 4IQZA 4KKSA 3BDOA 2PNRC 2A69D 1Q1BA 1A6XA 3P20A 1DD2A 4G7OC 2AWOA 2EJGC 1OXVA 3OOCA 2V4DA 4JK1C 3PUXA 4KHZA 3A7AB 2YYZA 1GUSA 2BDOA 1IYVA 4H44C 1E2ZA 2K33A 1IYUA 2DN8A 3I4LA 1GHKA 2O5JC 1K8OA 2A68C 3VR5A 2B8FA 3ND9A 4H0LC 3TZUA 3T56B 3PV0A 2JXMB 1Y8PB 1SMYC 1V8QA 2KCCA 4H13C 3IFTA 3QG1A 2DNCA 1T5EA 3FPPA
chains in the Genus database with same CATH superfamily
1ET6A 1G291 4A3JH 1GUOA 4RWSC 4MNOA 1W2BA 1SYGA 1AW7A 1R9TB 4JOIA 1C9OA 1QNUA 2A6HC 2N49A 3L7ZC 2E75C 3SGIA 2J0TD 3ICEA 1TWGH 1W3SA 2AQ3B 2EY5A 1XTDA 3DWPA 4Y7NH 4AQYQ 1SNDA 2PO4A 3PUVA 3UE1A 2HT1A 2RHQB 3LNNA 5IP7G 1QB5D 1U5KA 1B44D 4YWMA 3ULJA 4C3IG 1GKHA 1AP0A 1HUNA 2XWJB 1K83H 3NQIA 4V0BA 4QL5A 3J81i 2PI2E 1LT5D 1STGA 1TY0A 1EOVA 2K14A 4JCVE 3J80L 3J81j 2HHHL 4OWWB 4G7ZC 2EQSA 2PQAA 3M4OH 4PQXA 1HA6A 5BN3A 4DNRB 3H0GB 1N33L 3PCOB 1PTOH 3PIO3 3K81C 4RG1A 4GLVB 3U9SA 4FDBA 2FFKB 3ER0A 2LMCB 4X3TA 2JJQA 4DV1L 4C1NI 1NY4A 1VQIA 4BA1I 1GD7A 2A19A 4A3EH 2CCZA 3TRZA 4DUZL 4ZK9B 3FEWX 3AMUA 5ELOA 4X6AH 3HOVH 1STHA 1YBYA 2D9UA 3MXNB 2NVQH 1PRTC 4ZRZA 4ZUIA 2RDGA 1SE3A 4A3IH 1CKNB 1H9MA 4BBRH 1B4OA 3GTKH 5I6WA 1X3QA 2F0IA 3BVGA 1KAAA 1WVLA 1JB7A 2F4IA 3NBHA 1PYSB 2CWAA 1MHWC 5KRUA 2Z6KA 2IY5B 2AQ2B 3SEBA 3U4ZA 1PV4A 1SFOB 4LFBL 4YIJA 4J8QA 3S1QB 1UAPA 3OTOL 1ASYA 1HNXL 3S24A 1KC8C 3NPPA 4DV3Q 1XPRA 1PZKD 2NYZD 3IL8A 4A3GG 5IGGA 3HOYG 1X32A 2KCCA 2WP8J 4GKJQ 4FXGC 4JI3Q 4DA2A 2RSNA 1D1IA 3I90A 4DR1L 3TDQA 1QOHA 4NXMQ 2UUCQ 3G6JB 4CDDC 1HJPA 3ND8A 1K0RA 1GUGA 1I4HA 2NWGA 4R8IA 1Y8OB 2F3IA 4C3JG 1PH8A 4B3SQ 3KLSX 1K3BC 1KNEA 4O42A 3A54A 2M2LA 2R7DA 4MHEA 4C2MB 5CMDA 5GAHC 4QCLA 3BYYB 2UUAQ 4DV2L 3MAQA 1YVCA 5FKAC 1YJWA 4DR7L 2UXBL 3M4QA 2A1AA 1LT6D 2B63B 2UXDL 1YHAA 2KCTA 2IJ0A 4LF9L 2B2UA 3T16A 4TKOB 2Z4IA 3S16H 4JV5Q 4J1MA 4XXEA 3BJUA 4DV6Q 1F9QA 3AQQA 3DHQA 1GHJA 3T51B 2I5HA 4XDXA 2RCFA 1CKMA 1L0XB 3K0YA 3HOXB 1O7IA 4JG2A 1VS0A 4DV0L 2WIIB 4JBWA 3K5LA 1CI3M 3HOUG 2DGYA 1XMOL 3T1HQ 3GTLB 5BR8Q 2A6EC 2ZT9C 2RQXA 4BS9A 2B2VA 1J8IA 2F4VL 5FLMH 1F9RA 1ET9A 4ID6A 1CTMA 4OL7A 1CA6A 1RD9D 2QA4A 1I4QA 5EAYA 3S2DH 4K0KQ 2PCFB 4XYQA 4Y52H 2Q2HA 1Q90A 1X6OA 4LUZA 4XQJA 1FJGL 5NUCA 1NMFA 3H15A 5EKKA 5IYBH 3I4MG 3T53B 1HUMA 3L3OC 3E0JA 5C3EG 1ZKOA 2OT2A 2R7ZG 1Y1WB 4DU9A 1A3TA 2A74C 1HTLD 5COYA 1I50B 1XWEA 1L1OB 4OWTB 3ERSX 4QF4A 2F52A 2R3ZA 1E2ZA 5IGDA 2K4KA 4F87A 1JOKA 3BVMA 1WD0A 2F3VA 2FHTA 4P75A 5KGUA 3CPWA 4BWGB 3PV0A 2XN9C 1SMYC 1D7QA 3CC7A 2DNCA 3PUWA 4QIWB 3JAML 2L0CA 2Q2IA 4JI5Q 1W6KA 5IWAQ 4LF6Q 1VQ9A 1QZGA 2Y0SG 5CV6A 3MVVA 2YU9B 1NE3A 2BA0A 5FO8B 5EPJA 5JVG3 5IP7H 3GTQH 4OXPA 2JA8B 4CGYB 5H1SE 2N55A 1Q46A 5GROA 1FD7D 1YHBA 4RGMA 2DUDA 3E6ZX 2FXQA 2DY7A 2OWOA 1BCPD 3FKIB 1EU3A 3P7JA 5C4XB 3CPFA 3BDCA 3BVZA 3G7LA 2K5NA 3QO2A 2UUBQ 2C5CA 3CC2A 3HG9A 3URYA 1HQMC 4A3KG 1OXSC 1SDFA 1LTTD 3EN2A 1DJRD 1WTXA 4DR2L 3I3CA 1VQAA 2K7VA 4B3TQ 3PO2G 3UDIA 2MJ8A 4MN3A 3HKSA 2UU9Q 1TU2B 4X62L 1FNUA 4JI1L 5C4HA 4A3BG 1L0YB 4XT1B 4LK1C 3K5MA 5EBDA 1K9MC 1UE5A 1STNA 4GOPC 1XNQL 2K5WA 3W2DA 3J7AF 4LAAA 1VF7A 1ZEQX 1LT3D 3L9AX 3MXGA 4HIDA 4J15A 4B3MQ 4X3SA 1VQEA 2PYKA 1RDPD 5L37A 1DOKA 2JYOA 1ZYRD 5G3LD 4OWXB 4NXNQ 2LXJA 2E5LL 4L63B 4CKEA 1EUJA 4IUVA 2Z1CA 3CW2C 3NQTA 1BBXC 3OMGA 3G48A 3TN2A 3HOYH 4A3GH 2ZJPA 4U673 3HKZE 3I4LA 2P5ZX 1B50A 1BVSA 2B8FA 1EZ8A 3GDEA 1TWFH 1O80A 1XX8A 3QG1A 4YY3L 1S5ED 1EIYB 4GS3A 1RODA 2CW0D 1VQ7A 4B3RL 1C0AA 4DR4Q 5JPNC 1TWCH 4X65Q 4AYBB 4DUYQ 5EKIA 3J80E 1VQFA 2QILA 1SN8A 3TP7A 4ULLA 3V05A 4JI4L 2K5HA 1LTLA 3IKJA 4C3JH 1A0IA 1VQJA 2Z0SA 1X65A 1I6HB 2KHJA 4LW1A 3OWEB 2N8NA 4UPAA 4HIKA 1V43A 1K8AC 1FVIA 2WB1E 2L11A 2Z6BA 2NZ1D 4QMGA 1GXDC 1TKWB 3CCQA 1NCVA 3UDFA 1JCKB 1VQCA 1CUKA 1B1ZA 1STAA 1EY0A 1WTPA 2F0EA 1GUTA 2IX0A 3I4NB 3TP6A 1JB3A 2DY8A 3BYTB 3NTHA 2WAQB 3RZDB 4DK0A 3S17H 3LGJA 3SK4A 3PIPA 4N9PA 2DJFC 4JI0Q 3MEFA 1HH2P 4A75A 5IE8A 2LY7A 5M5WB 1PXUA 2OQKA 5C5LA 3CC4A 3S2HH 1UUPA 3T1YQ 3OHXC 1YHQA 5IYDG 4PNYA 3I4MH 3DWQA 4DN4M 5C3EH 1I4RA 2R7ZH 5FO9B 1XNRQ 1MBYA 1HRJA 2E2HH 2PNHA 1A15A 4DAPA 2NVYB 4IZ8A 3GTPB 2IWHA 2IW3A 1QUQB 1RJTA 2E2IH 4DAMA 2D0OA 2NZHA 4P74A 3TMEA 1S40A 4BBSG 1SR3A 4DK3C 3HP3A 4N9TA 1IBKQ 3DWAA 2MP1A 2KBNA 3R8BA 3MZ5A 4A3LH 3CQZH 3ND9A 3RD4A 4A3FG 5IGCA 4Q5VA 4KHPQ 5M5YH 3HOZG 1PLFA 3NEMA 1Y14B 5FOBB 1PH7A 2F0FA 5BN4A 4K2KA 2KHIA 5D14A 2QDBA 5CBEE 1X3FA 2KJXA 1STEA 4R9WA 5CV9A 2YTVA 4JPBW 1EZ6A 2F0LA 3IFDA 1UEBA 1YNND 3GV3A 5DM73 3PF5A 1QE6A 1NMGA 4LFCL 3OPOA 3S14B 3BS1A 4DR5L 4TVAB 3NWSA 2IX1A 3KDFA 1FR3A 3NP8A 2VQEQ 2AKWB 1UNSA 4FF2A 1YI2A 1K8MA 2BOSA 3K7AB 1V1OA 1E3PA 4DAYB 2J4XA 4A3KH 1VQ6A 1Y1VB 4HJ9A 5KNCA 1WI5A 4AYBE 5M3MG 4ZCKA 4K8JA 1BCPB 2WKDA 3PO2H 4UAIA 1PH3A 3P75A 1B3AA 4JI7Q 4DKAC 1C4QA 3A8KE 1H9SA 4LF4L 2BA1A 1S5BD 3VR2A 3STBC 1U4MA 4A3BH 4PV1C 1ILPA 5IOCA 2QW7A 3VYUA 1YNJC 2R6GA 4H7BA 1RTOA 3RLOA 2EYOA 4FF4A 1DGSA 2DNEA 5KYIA 1PFSA 4V190 1QJOA 1VQ8A 2K28A 2JN4A 4JW0A 4CDEC 1TWHH 3GTMH 1TWAB 2CWPA 1TS4A 5EBCA 4GNXB 4PZ8A 3IAYA 2JA7B 3BG3A 3R93A 1ENCA 4ZYSA 2ICEC 3NENA 2XNAC 2L4NA 3PUYA 2XRSD 2R92G 2WAQE 2Q8RE 4IUUA 3RNUA 1XPOA 4XT3B 4Z9CB 5C4ZA 2D62A 3KJOA 5CC4A 4ILWA 3JAME 1VMCA 5ELEA 4RKLA 2KVMA 3J80c 3HEJA 2A69D 2ZTEA 4DV4L 1N32Q 1TWGB 4Y7NB 2JA6H 1IBMQ 3SK8A 4N8FA 1KDCA 2B39A 4C3HG 3Q23A 1EY7A 1L1OC 2RVLA 1BCPF 1K83B 2PW7A 1JJCB 1V8QA 3BDLA 4H13C 3PO3B 1T5EA 1I94Q 3X3NA 1XMQL 2PQAB 1VQKA 2F0PA 1KRTA 4JI2Q 3M4OB 4I65A 5KEEA 3DM1A 5GQOA 3VA5A 1PTOB 1KXLA 2PI2A 2VY3A 5E4XA 4LWCA 2ZM6L 5LMNL 3K5NA 4J6HA 4RH6A 5CYUA 3CU7A 1FNWA 4LNQA 1O78A 5KNDA 4IJLA 2GVAA 1PDQA 3EIVA 3KF8A 4IUNA 5CV7A 4UP7A 1VQGA 3P1HA 4IURA 3I4OA 1NSNS 3EVQA 4BXXG 2LFNA 1BBWA 3C1FA 3FHWA 3HOVB 1HNZQ 1HNXQ 2QDLA 2VB2X 2SDFA 3FMCA 2X69A 3O13A 3KOJA 4KN4C 2O4XA 4BBRB 2CHBD 3GTKB 1JORA 2LS01 2MNAA 2OQ0A 2UXCL 3OYYA 1PHJA 3KLWA 2I46A 2PMZB 4DR3L 1CA5A 5BN5A 2RDHA 5TSSA 3S15H 1SAPA 1J5EL 4RAUC 2L15A 1JC7A 2I0QA 4GOPA 4LFAL 3GTGH 5IYDH 5AJ3L 1B3QA 1JJGA 1RL2A 2RCNA 1H9KA 2LKVA 2A6HD 1IKMA 3N6RA 5C0XG 5EQ0A 4BY1G 1SBBB 1PTOF 1F2ZA 2O2LD 4HEDA 4MZ9A 1T9HA 2AHOB 4IUPA 4LF5L 3W3AA 3MTSA 4QGUA 3HKZG 5D65A 1NR4A 4L6TB 2ENBA 3NUCA 4ZUJA 4K14A 4X64L 4DNIA 3H3VC 4G7OC 1LUZA 1NTGA 3A7AB 4A3FH 2PW5A 4QJFA 4NPSA 4RA8A 3HOZH 2F0UA 4UDUC 3NELA 3VR5A 3DEOA 4QUFA 4JBMA 4CDCC 4WJWA 1Y8PB 3UDGA 1LLRD 1JWSD 4CDFC 4A4IA 3S1NH 1IW7C 4NMZA 1IKLA 1IL8A 2O5IC 4XYOA 3ONAB 3S16B 1EY4A 1HZCA 5F2DA 5JOBA 4HJ5A 5I9PA 2A8VA 2ALYB 1PRTD 1HTPA 2CQAA 2L1BA 4OX9L 1JWUD 2WB1G 1Z6HA 4CHTB 3SXHA 1S5DD 1BUVT 2K05A 4KJOA 1N34Q 3T4AC 1V1PB 3A55A 4RCOA 5M3MH 3A0JA 1Q81C 1KABA 4FVMA 1HFGA 1LACA 2JE6I 5JJLA 3S2DB 3KF6B 3QWNA 4AIMA 2Q2UA 1S72A 2MPMA 5K36G 2Q8IB 2ZXRA 4GN4B 2F0DA 5DAUA 3J80i 1IXRA 1X3EA 4JYAL 2FMMA 2K04A 2F0VA 3W1GA 2KECA 1ONLA 2HDMA 1H9RA 1WFQA 4GKKQ 1BF4A 3NXWA 1K0SA 3JAMc 3KLSA 1A3VA 2K75A 1B9NA 2KUMA 2VQFQ 1TT2A 3DUZA 3MXPA 4GN3B 2HCCA 2SOBA 1I4PA 3U50C 4F8MA 5C0XI 1PZID 2KCNA 2R92H 4PG3A 1WCMG 3MXNA 5C5MA 3SE0A 1D1KA 2CKZB 1JOOA 4DV5Q 1L2FA 4AH6A 1CKNA 1LABA 3SR1A 1Y69U 2IPKD 1DM0B 3LX0A 5E3FA 2FINB 4JI6L 4L5TA 5EKLA 3AEVA 5GADC 1QILA 3UDXA 1A6XA 3GTQB 4C3HH 3M3YH 3ULLA 3TS0A 2F0OA 4X62Q 3KYHC 1CK1A 2JA5B 4H44C 3WOFA 2DN8A 2VS1A 1EWIA 1K8OA 2A68C 1SMXA 3D6WA 3F2CA 1KHIA 1EYGA 1I5FA 2ZXOA 3KBXA 3FVQA 2VUMG 3TZDA 4JBJA 3PIOA 2H1EA 2A6ED 4OONA 1A2TA 3J7YW 2MO0A 5A35A 5J22A 5C6AA 2D5DA 4R8NA 4AYBG 3OMCA 5HURA 4IFDG 4IPCA 4IOAA 1M4VA 3EQLC 4X3UA 5I6YA 2ASBA 3BZDB 2F03A 4JI8Q 3B6YA 5JVH3 2N3SA 1G6PA 4RKBA 4KN7C 4DV3L 2NZOA 3C2PA 1VQDA 3Q8DA 3KLRA 3K59A 5LL6X 1CT1D 4EX5A 4GKJL 2XRQD 3GO5A 1QWYA 2D2CC 4JI3L 4C3IH 4PMBA 4LF8L 2NN6I 4DV7Q 4HCSA 1EIHA 3CRLC 1SMYD 2K5QA 1D5MC 1TR5A 1AFPA 3DEPA 4NXML 4KKTA 4FF3A 2UUCL 3K0XA 3L0OA 5C0XH 1PYWD 5C44G 4BY1H 3HOYB 4A3GB 2WAQG 3KK7A 1I6VC 4B3SL 4A93G 4RFBA 2G5DA 2ZTCA 3K57A 3GV6A 1TWFB 3VYTA 4RGNA 5FJ8G 1SNMA 2UUAL 2OEOA 1VQNA 2NUCA 1K28A 4ZLTF 5IT9L 4FXDA 4CJ1B 2KCMA 1TWCB 1HZ9A 4YHHQ 4NW2A 3GTOH 2F0GA 3I2ZA 5C3WA 4KLKA 4DV6L 3BU2A 4C3JB 3Q24A 1LM0A 5C3XA 2MO1A 1G2SA 3OOCA 2RKSA 4LF7L 3H3VI 2MFIA 4E6IA 3OW2A 1EL0A 1L1OA 4DF7A 1HR0Q 3T1HL 3CCLA 4HJ8A 1JE5A 5BR8L 3G6EA 4U68A 1MD2D 2A5HA 2EYMA 5DEHA 3IFTA 1ESRA 1E1OA 4K0KL 1SNCA 4A3CG 1XYIA 1HNWQ 2FMCA 5M3FG 4X66Q 1F9SA 1D2BA 2EYPA 3U9OA 3SK5A 1UWVA 1E22A 1JR0D 3JAMi 1YIJA 1Q8KA 1DCZA 1PMRA 4TSSA 2BDNA 2Z8LA 3TEHB 3S17B 1SNPA 3CCSA 1B9MA 1PTOC 4N8X1 4IFDI 1DZ1A 1LYLA 4MTKA 1LV9A 2HQLA 4KY5A 1J6QA 4JC0A 4RMFA 2EXZA 4EQ5A 3MA2B 4I7AA 1U0LA 4OELB 5C4JH 1ICFB 2G9DA 3A8JE 2ES2A 3S2HB 4ZQ3A 4HSVA 1IBLQ 2R93G 5K36H 5A2QL 4ZAIA 1M1KC 3I4MB 5FLXL 1H95A 2ZTDA 5ELBA 1BXTA 3CCMA 4HMJA 5C3EB 4KV6A 3CP0A 1LTGD 4JI5L 2R7ZB 2HCIA 5IWAL 4LF6L 2XGTA 1BQQT 2E2HB 3K80C 1E0BA 2K6AA 4B9WA 2E2IB 4LUVA 3RLFA 3HOWG 4QIWE 4KY7A 1H9JA 4P2CB 5EPLA 1MIUA 5M5XH 1D6EC 1SE4A 4L5SA 2BCOA 1WCMH 5I2XA 2N88A 3CQZB 3E3XA 3KBGA 4XTCS 2EYFA 4FF1A 3S1MH 5M5YB 1PYBA 2Y0SB 4O2DA 1KDAA 2YTYA 2NVXH 4JBKA 2ATWA 4DGZA 3TREA 3HOUH 2UUBL 1TY2A 4KKUA 2AUJD 2B3GA 2JA7G 1PH5A 2B2YA 3RZOH 3BDOA 4B3TL 1S5FD 4B9XA 2G9HD 1LTSD 3D6CA 3OSOA 2EJGC 2Z4HA 1PRTF 4A3MG 1WTQA 1ZXTA 2OXPA 1IYUA 3E9IA 4QB4A 4WJ3M 3W1BA 2K5VA 4K8IA 4H0LC 2CFMA 3F1ZA 2VUMH 4A3KB 5CORA 2E2JH 4QQBX 2NVTH 3PO2B 2EIFA 3S1RH 2SNMA 4DK1A 1H9SB 3CXCA 1A8VA 3WOEA 2H5XA 1NR2A 4IFDH 4B3ML 3PO3G 4L5RC 4OO1I 4BY7G 4P73A 4A3BB 4ME5A 2IT1A 4PZ7A 4NXNL 1AN8A 1A63A 1KD1C 5D3IB 3MWYW 1I4XA 1LO5D 3Q6SA 3D4WA 4A3DG 4KTAA 3CHBD 2K50A 1GOZA 2J7ZA 4RGOS 3GTMB 1TWHB 1WD1A 3H91A 3K8AA 1I3QH 1QG7A 3PF4A 3A5ZB 2M9VA 2VXWA 1YJ9A 2QEJC 3RN2A 4DNTB 4IPDA 3EFXD 5EJWA 5GAEC 1OXUA 2YV5A 4R1JA 5LMUQ 4DR4L 1WTRA 1HR0W 4X65L 2VL6A 4DUYL 2F0MA 3RMHA 1OTCA 4DK6C 4R4CA 4KK7A 2HUGA 5LMNQ 1RCVD 3K5OA 4BBRG 5C44H 1YEZA 3V2TA 4A93H 4IUQA 2YTXA 3TBIB 2JA6B 1LTBD 1QVFA 1C8CA 1RIPA 1VQPA 2E74C 5FJ8H 4M1UB 2IL8A 1EYDA 4OIKA 5KNBA 1PH9A 4DR6L 3M85A 1CM9A 1HZAA 4WRDA 1B70B 3I8ZA 2EYLA 1O7LA 1IHZA 5J39A 2XWBB 1Q12A 3H0GG 5IYCG 4K5VA 3CMAA 3D0FA 1AE2A 1N36L 4UP9A 1VQOA 4DFAA 5J3BA 1EWCA 1DD2A 2N78A 2IHEA 1S4ZA 4HTHA 1OXVA 1QUQA 1VQ4A 2KHSA 1Q3LA 2OTLA 4JI0L 2K33A 1FGUA 2HHHQ 2A73B 5AJ3Q 4HCEA 4A3CH 3TZUA 3ERQA 3STBD 5M3FH 4A3JB 4KD3A 2K5DA 1N33Q 1YNJD 4FXKC 3EA6A 1OXTA 2JQOA 1BDOA 4DV1Q 2I07B 2CVRA 1ML0D 3CCRA 1VMPA 2QEXA 1T5XD 2K03A 1Q86C 1QVGA 1DONA 4UY8C 1B2TA 4K6DA 1MSHA 2F0HA 4DUZQ 1E1TA 1TS2A 3H6MA 3VYRA 3E5SA 1TIID 1C7YA 3S15B 4ODGA 2EJFC 3J81L 5I2YA 4GZYC 5ELFA 5E1FA 2R93H 1IYJB 3GTGB 2AWNA 1IBKL 2EY1A 3X3MA 3A5UA 1D5XC 3MFGA 4IPGA 4IN3A 1KNAA 3CF5A 4UP8A 1MJEA 2PZTA 4KHPL 4DAYA 1FGBD 3VDYA 2I5LX 2KENA 1K8GA 4HSPA 4KI0A 4EQNA 5IP9G 4KY6A 1SEBD 3FPUB 1VDZA 3HOWH 1TS3A 4QUCA 4A3EB 1WTVA 4RHRA 2KQ3A 3K58A 1U4PA 4G57A 5LHY1 1EY9A 3PQIA 4LFBQ 4HIMA 2OTJA 2L55A 3D3RA 3OTOQ 3T13A 1EU4A 4A3FB 1QCBD 2NVQB 3CRKC 3HOZB 1PVOA 4HN7A 1N8RC 2E76C 2MGSA 4A3IB 1SYEA 3TSSA 1MSGA 2GA4B 3D4DA 4DR1Q 2EOTA 2LXKA 3KUPA 3V96A 1PH4A 2B63G 3S1NB 1LTRD 3H94A 5G3LF 3NBHB 1Y8NB 4JYAQ 4JI7L 2D0PA 3NSWA 1EQRA 4A3MH 2F0JA 2PNRC 2EZVA 4YCWA 1XXGA 4POFA 1VQBA 5T1IA 4LMQD 3MEHA 5IGEA 3HOXG 3TS2A 3DLLA 2BDOA 3OIPA 2RF4A 1U4LA 1TXYA 3R2IA 4DV2Q 3J7A5 1YZ6A 3CCEA 4DR7Q 2UXBQ 2VB3X 5M3MB 4EVOA 2UXDQ 5JJZA 1RTNA 2X6GA 4LF9Q 5LMNW 3FPPA 2JA5G 4X3KA 3GTJH 4C1NK 3PO3H 1V1QA 4BBSH 4BY7H 4QY7A 2QGQA 2B2YC 1NUCA 1M8AA 5A2QE 1B7YB 4JI6Q 5FLXE 3FDTA 4DV0Q 1O7ZA 1HHVA 1XMOQ 3G4SA 4A3DH 4R4QA 2SNSA 4CJ2C 1Y1WG 1Z47A 2AUKA 3TP5A 3WDNA 2F4VQ 1JOQA 1N32L 2JK8A 3ITPA 3NBIA 4YCUA 1IBML 1DXMA 1SYDA 1DOMA 3RR5A 1FJGQ 4PMWA 3KJPA 1UEAB 2JSOA 3HRZC 1EOTA 1X54A 1HCZA 4IO9A 1CKOA 2R92B 1SROA 4YCVA 1JJ2A 3CKIB 1P8LA 1R9TH 2HIVA 1I94L 1IL2A 1SXTA 4JI2L 3N52A 5CV4A 1EY5A 3QOLA 4R4TA 1IZ6A 3AFQA 2EJMA 3NK9A 3SHLA 4C3HB 5JJIA 1GUNA 3M3YB 2JA8G 3NHHA 3R3OA 4IALA 1IW7D 3PMFA 1AZQA 2JA9A 1Q82C 1E7ZA 1KTKA 1A3UA 1EQQA 3ZJYC 3FKIG 3SVMA 1KL9A 3QOJA 3ULPA 5C4XG 1WTWA 1HNZL 5E4WC 2XTIA 3H0GH 5IYCH 3A8IE 2NN6G 3I56A 1KDBA 2L9HA 1EY6A 1SE2A 1A62A 3M4PA 1SE8A 4A76A 1X56A 4HJ7A 4GLAC 4LF8Q 4KKSA 4AQYL 5EGTA 1STYA 1EFID 4OIJA 3P20A 4ABNA 3MC0B 5KYLA 3HFZB 2VW9A 4HJAA 1FNVA 2V4DA 2V1CC 4KJNA 4KHZA 2BH2A 1E24A 3BZCA 2OCEA 2XSCA 2O5JC 3CD6A 1I4GA 3EROA 2PMZE 4NP5A 5DNFA 1AEXA 1JWMD 3QB3A 2K32A 4DR2Q 2EPBA 4HIOA 1ESFA 2NTSA 1AZPA 1GJXA 1SNQA 3C46A 1LT4D 1KLUD 3Q22A 2MHVA 2XVSA 1MKHA 4OEMB 4C3IB 5CV8A 1SYFA 4JI1Q 3G71A 1GM5A 4F7XA 3QJYA 4ZKCB 1UE7A 3Q0AA 3SDZA 1PH6A 5IT9c 1WJJA 1SFOH 4LJZC 4LF7Q 1XNQQ 3S1QH 4BY1B 3I91A 1U4RA 2HDLA 2KEEA 5E7NA 1BO0A 5EPKA 5C0XJ 4L8JA 1V1PA 1MJCA 2R61A 4HR7B 1MGSA 5IP9H 2R7FA 5JEAG 3HKZB 3KF6A 2C9OA 3LWEA 1D5ZC 1EFWA 3CCJA 2E5LQ 2CQOA 1AH9A 2WACA 3NE5B 1JT8A 1YITA 1GVPA 4BXXH 3GTOB 2A68D 2RA4A 1G51A 4CKCA 4XQNA 1ILQA 1D8LA 5IGFA 1A2UA 1TQOA 4GLXA 1VQHA 5HY6A 2B2TA 4C2MH 4F88A 3I7FA 2CH4W 4YY3Q 3F2DA 1N34L 3D8GA 4B3RQ 3TQYA 2B63H 1G91A 2KA7A 1W6JA 1RHPA 4ZKBB 1WTHA 5HGTA 2PPBC 2F0KA 1SNOA 2EY2A 1BCPC 1J9OA 5ISRA 2TMPA 1F2LA 2EE1A 4JVZA 5AFWA 4JI4Q 5JJKA 4APVA 4A3LG 2B2WC 2E8GA 4P71A 1VQMA 2WB1B 4IQZA 3HOXH 4NKLA 3I4NG 3PIP3 3KFUA 4NB3A 4GKKL 1SSOA 3GTLH 3MHBA 5FLXc 1DOLA 1GUSA 2QCPX 4CBVA 3RN5A 3DM3A 3CAMA 4WORA 1GHKA 1V9PA 3DMUA 2VQFL 4PZ6A 2JA5H 1MI2A 3T56B 1HZBA 4C56C 1JMCA 5C4JB 2KEDA 5IIFA 3J81E 4K5XA 2Q2TA 4GNXC 1K73C 1R4QB 2EY6A 2WINB 5CGKA 1CQVA 3AYHB 3WWVA 2E2DC 4JV5L 4DV5L 4JOIC 3GD7A 1Y1WH 3LWUA 5T1GA 1X3PA 5CV5A 2OF1A 1KLGD 1KRSA 1I50H 2MQHA 4GN5A 3AFPA 3MXUA 3F8TA 3U58A 1FL0A 3MFYA 1ZYRC 1XTCD 2RDFA 5M5XB 4KMUC 1PFMA 1AE3A 4YWKA 2L12A 1P16A 1WCMB 5HGQA 3AB9A 2KOLA 3M4YA 4ME3A 3GP7A 1EIGA 3I55A 2IHFA 3VR6A 2JEAI 3S1MB 1SLJA 2C35B 2NVXB 3SK6A 1EWHA 1F77A 5J1ZA 4OO1G 1GO3E 4KHVA 1CQFA 2YU9H 3HOUB 1G6ZA 1Z9FA 2MUYA 1EQTA 3FRPB 2JA8H 4KD4A 4EQOA 2ZJRA 3RZOB 2CW0C 3DXJC 4FYDA 5ELNA 1SRUA 1PRTB 3J7AV 2F0WA 3UE0A 3FKIH 1UE6A 1L0WA 2SEBD 5C4XH 1M90C 2F0SA 1FYCA 1TVXA 1X9NA 1EIFA 1LTID 1S3OA 2NN6H 2QKIC 4JI8L 4LUOA 2VUMB 2JA6G 1GUWA 3I72A 1EEID 1Y1VG 3J7ZC 3VR4A 1PTOD 3E0EA 2E2JB 2XIWA 1CFMA 1SYCA 4K6LA 4EGVA 2NVTB 3S1RB 1EYCA 2X6LA 1X3GA 4LFCQ 5JEAJ 1LTAD 1PH2A 4DR5Q 3F2BA 4HMIA 1EEFD 2NTTA 4IFDJ 1OO9B 3CMEA 4DV7L 5DLQE 2Z6KC 4JK1C 4R4IA 2YYZA 5I9OA 1HFNA 5JAVA 1CHQD 4EQPA 1RKNA 1S5CD 3ZYYX 1I3QB 3OIQA 2K52A 2QF7A 3S9WA 4LF4Q 4DR6Q 4G7HC 1HQRD 3H3VH 2ID0A 3FP9A 3I73A 2L5TA 1XPUA 2JEBI 4A3JG 5ELDA 1ENFA 4O0AA 3KDFB 3HS0C 4RGTA 1VF5C 5JPMC 2VNUD 4O1NA 5GAGC 2WFWA 1F2MA 4YHHL 1N36Q 2RBMA 2UU9L 3W5OA 3NTIA 5C44B 5IGBA 3K6OA 1KIXA 4CKBA 1N9WA 4A93B 1X55A 4DAVA 3K7UC 4I7ZC 1VQ5A 1C48A 4TQUS 4S3SA 1CZWA 4IOCA 4RHSA 5JEAH 4K5WA 3U4VA 4DPGA 1HR0L 2CH4A 5FK9C 3M9BA 1NBWA 2WV6D 2ICIA 2B2UC 1HNWL 1JICA 4X66L 5CBAE 4XQQA 4DV4Q 5LL6S 1STBA 3HZXA 2EVBA 2HQEA 1Q8IA 2Z9HA 1PFNA 2LSSA 3F2UA 1PH1A 1BKBA 1SYBA 5KIXA 4BA2I 3JC66 1EY8A 1PZJD 1I6HH 1ASZA 1YNNC 4B08A 1VCIA 2EXDA 4A3EG 2F0TA 2B2VC 2Q8TA 3PUZA 4OGQC 3UI2A 1XMQQ 1B8AA 3HGBA 5M3FB 2B29A 2FJ2A 1QNKA 1O7YA 2HIXA 3VR3A 3HOVG 1HXYD 3VYSA 1IBLL 4H02A 1ICWA 3J81c 1EYAA 1VQLA 2ZXPA 3NWTA 1JQYD 4NDXA 1JE4A 2ZM6Q 3E9HA 4A3IG 3I4NH 3D31A 1F9PA 2F0QA 1Q7YC 3RZDH 3PSIA 2IX3A 2PZWA 2RHSB 1BBUA 4UHVA 3M7GA 2WKCA 1Q1BA 5M5WH 1CHPD 2B2TC 3RLNA 3TP8A 4DXGA 1QVCA 5M9OA 2EYHA 1KAWA 1NAPA 5IY0A 2DJGC 3H09A 2R93B 2TSSA 1UE1A 1NNXA 4MIUA 1G8ZD 4K2LA 5DM63 1F2YA 1R4PB 2F0NA 4PMCA 1SJHD 1BNZA 1IYVA 1II3A 3D4RA 3IRBA 2I5MX 4L5QA 2UXCQ 4HAEA 2H4OA 3BZKA 2NVYH 4DR3Q 3GTPH 2EYJA 1PFBA 5FO7B 4G4KA 1HA5A 3KF8B 5ELCA 3HOWB 1J5EQ 3EJIA 3NTKA 2F1MA 1WYDA 1G2TA 3CCUA 2M00A 4LFAQ 1K3RA 3A56A 2Y0SE 1TS5A 1B53A 3GQBA 2NB0A 5K5PA 2BH8A 1EQVA 3T1YL 1WTOA 3OW7A 2A69C 1PA6A 3PGZA 4OO1H 4LF5Q 1CSQA 3A7LA 5IODA 1YJNA 1Z7TA 5CR3A 1CZGA 4FNFA 1XNRL 1RF2D 4R4OA 2B8GA 2ZJQA 1OXXK 4FP5D 4IPHA 5D3DA 4X64Q 2PQEA 3R2TA 4Q0FA 2RSOA 3S14H 2BE5C 4WJ4A 2AQ1B 2GN5A 5I4DA 4A3MB 4GOPB 4ALPA 4FO2A 4IJHA 1HPCA 2F3WA 2NBFA 4XIGS 1BR9A 2EDGA 3K7AH 4TRDA 4RCNA 3AU7A 3C3LA 1Y1VH 2PZUA 1E2VA 1CSPA 3EBEA 2JP1A 1YNXA 2AMCB 5FLMG 2K01A 4WFN3 3I70A 1U9RA 3QR8A 3GTJB 4BBSB 2BE5D 2B2WA 5IT9E 3M7NA 4BY7B 1Q1EA 3VA7A 4MTNA 1ENAA 3QIAA 5LMUL 1NJIC 4OX9Q 1E2WA 2K1BA 3A74A 4DXFA 5IYBG 1KQSA 3RUZA 1DYQA 4A3DB 4CJ0B 3C1EA 2AWOA 1WOCA 4P72A 3CCVA 3PUXA 1XJVA 2VQEL 2VZAA 3L2PA 2HD3A 1TWAH 4OHJA 1SJED 4YWLA 4POGA 4M8AA 3OWFA 4IUTA 4GNXA 2JXMB 1BOSA 2JA7H 1QZHA 2GVBA
chains in the Genus database with same CATH topology
1ET6A 1G291 1GUOA 4RWSC 1SYGA 1AW7A 1R9TB 1QNUA 2A6HC 3L7ZC 2E75C 2J0TD 2AQ3B 2EY5A 3DWPA 1SNDA 2PO4A 3PUVA 3LNNA 1QB5D 1B44D 4C3IG 1AP0A 1HUNA 2XWJB 3NQIA 4V0BA 1LT5D 1STGA 1TY0A 3J80L 4G7ZC 4PQXA 1HA6A 5BN3A 4DNRB 3H0GB 1PTOH 3PIO3 3U9SA 2FFKB 2LMCB 4X3TA 4C1NI 4BA1I 4ZK9B 3FEWX 3AMUA 1STHA 2D9UA 1PRTC 4ZRZA 4ZUIA 2RDGA 1SE3A 1H9MA 1B4OA 5I6WA 1X3QA 2F0IA 3BVGA 1KAAA 1WVLA 2F4IA 3NBHA 5KRUA 2AQ2B 3SEBA 1SFOB 4YIJA 4J8QA 3S1QB 1UAPA 3NPPA 1PZKD 2NYZD 3IL8A 5IGGA 1X32A 2KCCA 2WP8J 4FXGC 4DA2A 2RSNA 1D1IA 3I90A 3TDQA 1QOHA 3G6JB 3ND8A 1GUGA 1I4HA 2NWGA 4R8IA 1Y8OB 4C3JG 3KLSX 1KNEA 4O42A 3A54A 2M2LA 4C2MB 4MHEA 5CMDA 4QCLA 3BYYB 3MAQA 5FKAC 2B63B 1LT6D 2IJ0A 2B2UA 3T16A 4TKOB 2Z4IA 4J1MA 4XXEA 1F9QA 3DHQA 3T51B 1GHJA 4XDXA 1L0XB 3K0YA 3HOXB 2WIIB 4JBWA 3K5LA 1CI3M 3GTLB 2A6EC 2ZT9C 2RQXA 4BS9A 2B2VA 1J8IA 1F9RA 1ET9A 4ID6A 1CTMA 4OL7A 1CA6A 1RD9D 1I4QA 2PCFB 4XYQA 1Q90A 4XQJA 5NUCA 5EKKA 3T53B 1HUMA 3L3OC 3E0JA 1ZKOA 2OT2A 1Y1WB 4DU9A 1A3TA 2A74C 1HTLD 5COYA 1I50B 1XWEA 4QF4A 2R3ZA 1E2ZA 5IGDA 4F87A 1JOKA 3BVMA 1WD0A 2F3VA 2FHTA 5KGUA 4BWGB 3PV0A 2XN9C 1SMYC 2DNCA 3PUWA 4QIWB 3JAML 2L0CA 1W6KA 5CV6A 3MVVA 2YU9B 2BA0A 5FO8B 5EPJA 5JVG3 2JA8B 4CGYB 2N55A 1FD7D 4RGMA 3E6ZX 2DY7A 1BCPD 3FKIB 1EU3A 3P7JA 5C4XB 3BDCA 3BVZA 3G7LA 3QO2A 2C5CA 3HG9A 3URYA 1HQMC 1SDFA 1OXSC 1LTTD 1DJRD 1WTXA 3I3CA 2K7VA 2MJ8A 4MN3A 1TU2B 1FNUA 5C4HA 1L0YB 4XT1B 4LK1C 3K5MA 5EBDA 1STNA 2K5WA 3W2DA 3J7AF 4LAAA 1VF7A 1ZEQX 1LT3D 3L9AX 3MXGA 4X3SA 2PYKA 1RDPD 1DOKA 2JYOA 1ZYRD 5G3LD 4L63B 4CKEA 4IUVA 2Z1CA 3NQTA 1BBXC 3OMGA 3TN2A 4U673 3I4LA 1B50A 2B8FA 1EZ8A 1O80A 1XX8A 3QG1A 1S5ED 1RODA 2CW0D 5JPNC 4AYBB 5EKIA 3J80E 2QILA 3TP7A 4ULLA 3V05A 3IKJA 1I6HB 3OWEB 1V43A 2L11A 2NZ1D 4QMGA 1GXDC 1TKWB 1NCVA 1JCKB 1B1ZA 1STAA 1EY0A 1WTPA 2F0EA 1GUTA 2IX0A 3I4NB 3TP6A 1JB3A 2DY8A 3BYTB 3NTHA 2WAQB 3RZDB 4DK0A 3SK4A 4N9PA 2LY7A 5M5WB 1PXUA 5C5LA 1UUPA 3OHXC 4PNYA 3DWQA 4DN4M 1I4RA 5FO9B 1MBYA 1HRJA 1A15A 4DAPA 2NVYB 4IZ8A 3GTPB 2IWHA 2IW3A 1RJTA 3TMEA 3HP3A 4N9TA 3DWAA 2MP1A 3R8BA 3MZ5A 3ND9A 3RD4A 5IGCA 4Q5VA 1PLFA 5FOBB 2F0FA 5BN4A 4K2KA 5D14A 2QDBA 5CBEE 2KJXA 1STEA 4R9WA 5CV9A 1EZ6A 2F0LA 3IFDA 1YNND 3GV3A 5DM73 1QE6A 3OPOA 3S14B 3BS1A 2IX1A 3NWSA 1FR3A 3NP8A 1UNSA 4FF2A 1K8MA 2BOSA 3K7AB 1V1OA 2J4XA 1Y1VB 5KNCA 4K8JA 1BCPB 2WKDA 4UAIA 3P75A 1B3AA 1C4QA 3A8KE 1H9SA 2BA1A 1S5BD 3VR2A 1U4MA 4PV1C 1ILPA 5IOCA 3VYUA 1YNJC 2R6GA 4H7BA 1RTOA 2EYOA 4FF4A 2DNEA 5KYIA 4V190 1QJOA 2K28A 1TWAB 1TS4A 5EBCA 3IAYA 2JA7B 3BG3A 3R93A 1ENCA 4ZYSA 2ICEC 2XNAC 2L4NA 3PUYA 2XRSD 2Q8RE 4IUUA 4XT3B 4Z9CB 5C4ZA 2D62A 5CC4A 4ILWA 3JAME 1VMCA 5ELEA 4RKLA 2KVMA 3HEJA 2A69D 1TWGB 4Y7NB 3SK8A 1KDCA 2B39A 4C3HG 3Q23A 1EY7A 2RVLA 1BCPF 1K83B 2PW7A 1V8QA 3BDLA 4H13C 3PO3B 1T5EA 3X3NA 2F0PA 3M4OB 4I65A 5KEEA 3DM1A 3VA5A 1PTOB 5E4XA 3K5NA 4J6HA 4RH6A 5CYUA 3CU7A 1FNWA 1O78A 5KNDA 1PDQA 3KF8A 4IUNA 5CV7A 3P1HA 4IURA 1NSNS 3EVQA 2LFNA 3C1FA 3HOVB 2VB2X 2SDFA 3FMCA 2X69A 3O13A 4KN4C 2O4XA 4BBRB 2CHBD 3GTKB 1JORA 2LS01 2I46A 2PMZB 1CA5A 5BN5A 2RDHA 5TSSA 1SAPA 4RAUC 1JC7A 1H9KA 2LKVA 2A6HD 1IKMA 3N6RA 5C0XG 5EQ0A 1SBBB 1PTOF 1F2ZA 2O2LD 4HEDA 4IUPA 3W3AA 3MTSA 5D65A 1NR4A 4L6TB 2ENBA 3NUCA 4ZUJA 4K14A 3H3VC 4G7OC 3A7AB 2PW5A 4RA8A 2F0UA 4UDUC 3VR5A 3DEOA 4QUFA 4WJWA 1Y8PB 1LLRD 1JWSD 1IW7C 4NMZA 1IKLA 1IL8A 2O5IC 4XYOA 3ONAB 3S16B 1EY4A 5F2DA 5JOBA 5I9PA 1PRTD 1HTPA 2CQAA 2L1BA 1JWUD 1Z6HA 4CHTB 3SXHA 1S5DD 1BUVT 2K05A 4KJOA 3T4AC 1V1PB 3A55A 4RCOA 1KABA 4FVMA 1HFGA 1LACA 2JE6I 3S2DB 3QWNA 2MPMA 5K36G 2Q8IB 2ZXRA 2F0DA 5DAUA 2FMMA 2K04A 2F0VA 2KECA 1ONLA 2HDMA 1H9RA 1BF4A 3NXWA 3KLSA 1A3VA 1B9NA 2KUMA 1TT2A 3DUZA 3MXPA 2HCCA 2SOBA 1I4PA 4F8MA 5C0XI 1PZID 2KCNA 3MXNA 5C5MA 3SE0A 1D1KA 1JOOA 3SR1A 1LABA 1Y69U 2IPKD 1DM0B 3LX0A 5E3FA 2FINB 5EKLA 1QILA 1A6XA 3GTQB 2F0OA 1CK1A 2JA5B 4H44C 3WOFA 2DN8A 1K8OA 2A68C 3D6WA 2ZXOA 3KBXA 3FVQA 3TZDA 2H1EA 2A6ED 1A2TA 3J7YW 5A35A 5J22A 5C6AA 2D5DA 4R8NA 5HURA 3OMCA 4IFDG 1M4VA 3EQLC 4X3UA 5I6YA 3BZDB 2F03A 5JVH3 4RKBA 4KN7C 3C2PA 3KLRA 3K59A 5LL6X 1CT1D 2XRQD 3GO5A 1QWYA 2D2CC 4PMBA 2NN6I 4HCSA 1EIHA 3CRLC 1SMYD 2K5QA 1D5MC 1TR5A 1AFPA 3DEPA 4FF3A 4KKTA 5C0XH 1PYWD 4A3GB 3HOYB 3KK7A 1I6VC 4RFBA 3K57A 3GV6A 1TWFB 3VYTA 4RGNA 1SNMA 2OEOA 2NUCA 4ZLTF 5IT9L 4FXDA 4CJ1B 1TWCB 4NW2A 2F0GA 5C3WA 4C3JB 3Q24A 5C3XA 1G2SA 3OOCA 2RKSA 4E6IA 1EL0A 4DF7A 4U68A 1MD2D 2A5HA 2EYMA 5DEHA 3IFTA 1ESRA 1SNCA 1XYIA 2FMCA 1F9SA 1D2BA 2EYPA 3U9OA 3SK5A 1JR0D 1DCZA 1PMRA 4TSSA 2BDNA 2Z8LA 3S17B 1SNPA 1B9MA 1PTOC 4IFDI 1DZ1A 1LV9A 4KY5A 2EXZA 3MA2B 2G9DA 3A8JE 3S2HB 4ZQ3A 4HSVA 5K36H 5A2QL 4ZAIA 3I4MB 5FLXL 5ELBA 1BXTA 4HMJA 5C3EB 4KV6A 1LTGD 2R7ZB 2HCIA 1BQQT 2E2HB 1E0BA 2K6AA 4B9WA 2E2IB 3RLFA 4KY7A 1H9JA 4P2CB 5EPLA 1D6EC 1SE4A 2BCOA 5I2XA 2N88A 3CQZB 3KBGA 4XTCS 2EYFA 4FF1A 5M5YB 2Y0SB 1KDAA 4DGZA 1TY2A 4KKUA 2AUJD 2B2YA 3BDOA 1S5FD 4B9XA 2G9HD 1LTSD 3D6CA 3OSOA 2EJGC 2Z4HA 1PRTF 1WTQA 1ZXTA 2OXPA 1IYUA 4QB4A 4K8IA 4H0LC 4A3KB 5CORA 3PO2B 2SNMA 4DK1A 1H9SB 3WOEA 1NR2A 4IFDH 4OO1I 4A3BB 4ME5A 2IT1A 1AN8A 5D3IB 3MWYW 1I4XA 1LO5D 3Q6SA 3D4WA 4KTAA 3CHBD 1GOZA 2J7ZA 4RGOS 3GTMB 1TWHB 1WD1A 3H91A 1QG7A 2M9VA 2VXWA 2QEJC 4DNTB 5EJWA 3EFXD 1OXUA 1WTRA 2F0MA 3RMHA 4KK7A 2HUGA 1RCVD 3K5OA 3V2TA 4IUQA 3TBIB 2JA6B 1LTBD 1C8CA 2E74C 4M1UB 2IL8A 1EYDA 4OIKA 5KNBA 3M85A 1CM9A 4WRDA 3I8ZA 2EYLA 1O7LA 1IHZA 5J39A 2XWBB 1Q12A 4K5VA 4DFAA 1EWCA 1DD2A 1S4ZA 4HTHA 1OXVA 2KHSA 1Q3LA 2K33A 2A73B 4HCEA 3TZUA 3ERQA 4A3JB 4KD3A 2K5DA 1YNJD 4FXKC 3EA6A 1OXTA 1BDOA 2I07B 2CVRA 1ML0D 1VMPA 1T5XD 2K03A 1DONA 1B2TA 4K6DA 1MSHA 2F0HA 1TS2A 3H6MA 3VYRA 3E5SA 1TIID 3S15B 4ODGA 2EJFC 3J81L 5I2YA 4GZYC 5ELFA 5E1FA 3GTGB 2AWNA 2EY1A 3X3MA 1D5XC 3MFGA 4IN3A 1KNAA 2PZTA 4DAYA 1FGBD 4HSPA 4KI0A 4EQNA 4KY6A 1SEBD 3FPUB 1VDZA 1TS3A 4QUCA 4A3EB 1WTVA 4RHRA 2KQ3A 3K58A 1U4PA 4G57A 5LHY1 1EY9A 2L55A 3D3RA 3T13A 1EU4A 4A3FB 1QCBD 2NVQB 3CRKC 3HOZB 4HN7A 2E76C 2MGSA 4A3IB 1SYEA 3TSSA 1MSGA 2GA4B 3D4DA 2EOTA 3KUPA 3V96A 3S1NB 1LTRD 3H94A 5G3LF 1Y8NB 3NSWA 2F0JA 2PNRC 2EZVA 1XXGA 5T1IA 4LMQD 3MEHA 5IGEA 2BDOA 3OIPA 1U4LA 3R2IA 2VB3X 5M3MB 4EVOA 5JJZA 1RTNA 2X6GA 3FPPA 4X3KA 4C1NK 2B2YC 1NUCA 1M8AA 5A2QE 5FLXE 3FDTA 1HHVA 1O7ZA 2SNSA 4CJ2C 1Z47A 2AUKA 3TP5A 3WDNA 1JOQA 3ITPA 3NBIA 1DXMA 1SYDA 1DOMA 4PMWA 1UEAB 2JSOA 3HRZC 1EOTA 1HCZA 2R92B 3CKIB 1SXTA 3N52A 5CV4A 1EY5A 3QOLA 3NK9A 2EJMA 3SHLA 4C3HB 1GUNA 3M3YB 3NHHA 3R3OA 4IALA 1IW7D 3PMFA 1AZQA 1KTKA 1A3UA 3SVMA 3QOJA 1WTWA 5E4WC 3A8IE 2NN6G 1KDBA 2L9HA 1EY6A 1SE2A 4KKSA 5EGTA 1STYA 1EFID 4OIJA 3P20A 4ABNA 3MC0B 5KYLA 1FNVA 2V4DA 4KJNA 4KHZA 2XSCA 2O5JC 1I4GA 3EROA 4NP5A 5DNFA 1AEXA 1JWMD 3QB3A 2K32A 2EPBA 1ESFA 2NTSA 1AZPA 1GJXA 1SNQA 3C46A 1LT4D 1KLUD 3Q22A 2MHVA 2XVSA 4C3IB 5CV8A 1SYFA 4F7XA 3QJYA 4ZKCB 3Q0AA 3SDZA 4LJZC 4BY1B 3I91A 1U4RA 2HDLA 2KEEA 1BO0A 5EPKA 5C0XJ 4L8JA 1V1PA 2R61A 4HR7B 1MGSA 5JEAG 3HKZB 2C9OA 3LWEA 1D5ZC 2WACA 3NE5B 3GTOB 2A68D 2RA4A 4CKCA 4XQNA 1ILQA 5IGFA 1A2UA 1TQOA 2B2TA 4F88A 3D8GA 1G91A 2KA7A 1W6JA 1RHPA 4ZKBB 5HGTA 2PPBC 2F0KA 1SNOA 2EY2A 1BCPC 1J9OA 5ISRA 2TMPA 1F2LA 2EE1A 5AFWA 2B2WC 2WB1B 4IQZA 4NKLA 3PIP3 1SSOA 3MHBA 1DOLA 1GUSA 2QCPX 4CBVA 4WORA 1GHKA 3DMUA 1MI2A 3T56B 4C56C 5C4JB 2KEDA 5IIFA 3J81E 4K5XA 1R4QB 2EY6A 2WINB 5CGKA 1CQVA 2E2DC 3GD7A 3LWUA 5T1GA 1X3PA 5CV5A 2OF1A 1KLGD 3MXUA 3MFYA 1ZYRC 1XTCD 2RDFA 5M5XB 4KMUC 1PFMA 2L12A 1WCMB 3AB9A 2KOLA 3M4YA 3GP7A 1EIGA 2JEAI 3VR6A 3S1MB 2NVXB 3SK6A 1EWHA 1F77A 5J1ZA 4OO1G 4KHVA 1CQFA 3HOUB 1G6ZA 2MUYA 1EQTA 3FRPB 4KD4A 4EQOA 3RZOB 2CW0C 3DXJC 4FYDA 1PRTB 3J7AV 2F0WA 2SEBD 2F0SA 1FYCA 1TVXA 2NN6H 1LTID 2QKIC 2VUMB 1GUWA 3I72A 1EEID 3VR4A 1PTOD 2E2JB 2XIWA 1CFMA 1SYCA 4K6LA 4EGVA 2NVTB 3S1RB 1EYCA 2X6LA 5JEAJ 1LTAD 4HMIA 1EEFD 2NTTA 4IFDJ 1OO9B 4JK1C 2YYZA 5I9OA 1HFNA 5JAVA 1CHQD 4EQPA 1RKNA 1S5CD 3ZYYX 1I3QB 3OIQA 2QF7A 3S9WA 4G7HC 1HQRD 2ID0A 3I73A 2L5TA 2JEBI 5ELDA 1ENFA 3HS0C 4RGTA 1VF5C 5JPMC 2VNUD 4O1NA 1F2MA 2RBMA 3NTIA 5C44B 5IGBA 3K6OA 4CKBA 4A93B 4DAVA 4I7ZC 1C48A 4TQUS 4S3SA 1CZWA 4RHSA 5JEAH 4K5WA 5FK9C 2WV6D 2ICIA 2B2UC 1JICA 5CBAE 4XQQA 5LL6S 1STBA 3HZXA 2EVBA 2HQEA 1Q8IA 1PFNA 3F2UA 1SYBA 5KIXA 4BA2I 1EY8A 1PZJD 1YNNC 4B08A 1VCIA 2F0TA 2B2VC 2Q8TA 3PUZA 4OGQC 3UI2A 3HGBA 5M3FB 2FJ2A 1QNKA 1O7YA 3VR3A 1HXYD 3VYSA 1ICWA 1EYAA 2ZXPA 3NWTA 1JQYD 4NDXA 1JE4A 3D31A 1F9PA 2F0QA 2IX3A 2PZWA 3M7GA 2WKCA 1Q1BA 1CHPD 2B2TC 3TP8A 4DXGA 5M9OA 2EYHA 1NAPA 3H09A 2R93B 2TSSA 4MIUA 1G8ZD 4K2LA 5DM63 1F2YA 1R4PB 2F0NA 4PMCA 1SJHD 1BNZA 1IYVA 1II3A 3D4RA 4HAEA 2H4OA 2EYJA 1PFBA 5FO7B 4G4KA 1HA5A 5ELCA 3HOWB 3EJIA 3NTKA 2F1MA 1G2TA 2M00A 3A56A 1TS5A 1B53A 3GQBA 2NB0A 5K5PA 1EQVA 1WTOA 3OW7A 2A69C 4OO1H 3A7LA 5IODA 1Z7TA 5CR3A 1CZGA 4FNFA 1RF2D 2B8GA 1OXXK 4FP5D 5D3DA 2PQEA 3R2TA 4Q0FA 2RSOA 2BE5C 2AQ1B 4A3MB 5I4DA 4FO2A 1HPCA 2F3WA 2NBFA 4XIGS 1BR9A 2EDGA 4TRDA 4RCNA 3AU7A 3C3LA 2PZUA 1E2VA 2JP1A 2K01A 4WFN3 3I70A 1U9RA 3GTJB 4BBSB 2BE5D 2B2WA 5IT9E 3M7NA 4BY7B 1Q1EA 3VA7A 1ENAA 3QIAA 1E2WA 2K1BA 4DXFA 3RUZA 1DYQA 4A3DB 4CJ0B 3C1EA 2AWOA 3PUXA 4OHJA 1SJED 4M8AA 3OWFA 4IUTA 2JXMB 1BOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G29 1;  2K32 A;  1GUO A;  3D4R A;  1OXT A;  4G7H C;  1IW7 C;  1GJX A;  1BDO A;  2O5I C;  4DK1 A;  3I73 A;  2L5T A;  1H9S B;  2JEB I;  2A6E D;  3GD7 A;  2A6H C;  4IFD H;  3L7Z C;  2BA0 A;  1DCZ A;  1PMR A;  1VF5 C;  2E75 C;  3LWU A;  5A35 A;  3IKJ A;  2D5D A;  3OPO A;  3QJY A;  2IT1 A;  1HTP A;  1O78 A;  2F1M A;  1B9M A;  5KND A;  3MXU A;  3PUV A;  3ND8 A;  3SDZ A;  4IFD G;  1GUG A;  2AUK A;  1FR3 A;  1Y8O B;  3LNN A;  1Z6H A;  2EJF C;  3WDN A;  3EQL C;  4LJZ C;  3MFY A;  4GZY C;  4I7Z C;  3GQB A;  1ZYR C;  1K8M A;  4KMU C;  4TQU S;  1DXM A;  3A8J E;  3OW7 A;  5JEA H;  2A69 C;  1LAC A;  1V43 A;  2JE6 I;  3AB9 A;  4L8J A;  4OO1 H;  3M4Y A;  5KNC A;  5K36 H;  3FMC A;  4G7Z C;  1HCZ A;  3A7L A;  4KN7 C;  4HR7 B;  3VR6 A;  2JEA I;  4KN4 C;  2QF7 A;  5JEA G;  1HQM C;  1Z7T A;  1TKW B;  5BN3 A;  1OXS C;  3KLR A;  4DNR B;  1EWH A;  4OO1 G;  4TKO B;  4DNT B;  5K36 G;  4KI0 A;  2Q8I B;  2B8G A;  3A8K E;  1H9S A;  1OXU A;  2D2C C;  2BA1 A;  3U9S A;  3NE5 B;  1GUT A;  1ONL A;  1OXX K;  2K7V A;  1GHJ A;  1VDZ A;  3T51 B;  3VR2 A;  2A68 D;  2LMC B;  2NN6 I;  4PV1 C;  1H9R A;  4DK0 A;  2BE5 C;  2EVB A;  1YNJ C;  2R6G A;  3PUW A;  4BA1 I;  2CW0 C;  3CRL C;  5BN5 A;  3DXJ C;  1TU2 B;  2EJM A;  3RLF A;  4JBW A;  1HPC A;  1GUN A;  1CI3 M;  4KKT A;  1B9N A;  2DNE A;  4BA2 I;  1H9J A;  4LK1 C;  4XIG S;  1QJO A;  2A6E C;  1IW7 D;  2EDG A;  2ZT9 C;  5BN4 A;  2E74 C;  5C0X H;  3CRK C;  1YNN C;  1I6V C;  4RCN A;  1VCI A;  3PUZ A;  1CTM A;  1FYC A;  1H9K A;  2E76 C;  4OGQ C;  1E2V A;  2A6H D;  2PCF B;  3N6R A;  3HGB A;  2NN6 H;  5C0X G;  4XTC S;  2KA7 A;  3BG3 A;  1Q90 A;  5KNB A;  1VF7 A;  3VR3 A;  3M85 A;  3I72 A;  1H9M A;  3SE0 A;  3PUY A;  3A8I E;  3VR4 A;  2PPB C;  1CFM A;  1O7L A;  2NN6 G;  3H94 A;  3W3A A;  2BE5 D;  4KKU A;  3T53 B;  3M7N A;  1Y8N B;  1LAB A;  1Y69 U;  1Q12 A;  3D31 A;  2D62 A;  1Q1E A;  2AUJ D;  3VA7 A;  1ZKO A;  3QIA A;  1E2W A;  4IQZ A;  4KKS A;  3BDO A;  2PNR C;  2A69 D;  1Q1B A;  1A6X A;  3P20 A;  1DD2 A;  4G7O C;  2AWO A;  2EJG C;  1OXV A;  3OOC A;  2V4D A;  4JK1 C;  3PUX A;  4KHZ A;  3A7A B;  2YYZ A;  1GUS A;  2BDO A;  1IYV A;  4H44 C;  1E2Z A;  2K33 A;  1IYU A;  2DN8 A;  3I4L A;  1GHK A;  2O5J C;  1K8O A;  2A68 C;  3VR5 A;  2B8F A;  3ND9 A;  4H0L C;  3TZU A;  3T56 B;  3PV0 A;  2JXM B;  1Y8P B;  1SMY C;  1V8Q A;  2KCC A;  4H13 C;  3IFT A;  3QG1 A;  2DNC A;  1T5E A;  3FPP A; 
#chains in the Genus database with same CATH topology
 1ET6 A;  1G29 1;  4A3J H;  1GUO A;  4RWS C;  4MNO A;  1W2B A;  1SYG A;  1AW7 A;  1R9T B;  4JOI A;  1C9O A;  1QNU A;  2A6H C;  2N49 A;  3L7Z C;  2E75 C;  3SGI A;  2J0T D;  3ICE A;  1TWG H;  1W3S A;  2AQ3 B;  2EY5 A;  1XTD A;  3DWP A;  4Y7N H;  4AQY Q;  1SND A;  2PO4 A;  3PUV A;  3UE1 A;  2HT1 A;  2RHQ B;  3LNN A;  5IP7 G;  1QB5 D;  1U5K A;  1B44 D;  4YWM A;  3ULJ A;  4C3I G;  1GKH A;  1AP0 A;  1HUN A;  2XWJ B;  1K83 H;  3NQI A;  4V0B A;  4QL5 A;  3J81 i;  2PI2 E;  1LT5 D;  1STG A;  1TY0 A;  1EOV A;  2K14 A;  4JCV E;  3J80 L;  3J81 j;  2HHH L;  4OWW B;  4G7Z C;  2EQS A;  2PQA A;  3M4O H;  4PQX A;  1HA6 A;  5BN3 A;  4DNR B;  3H0G B;  1N33 L;  3PCO B;  1PTO H;  3PIO 3;  3K81 C;  4RG1 A;  4GLV B;  3U9S A;  4FDB A;  2FFK B;  3ER0 A;  2LMC B;  4X3T A;  2JJQ A;  4DV1 L;  4C1N I;  1NY4 A;  1VQI A;  4BA1 I;  1GD7 A;  2A19 A;  4A3E H;  2CCZ A;  3TRZ A;  4DUZ L;  4ZK9 B;  3FEW X;  3AMU A;  5ELO A;  4X6A H;  3HOV H;  1STH A;  1YBY A;  2D9U A;  3MXN B;  2NVQ H;  1PRT C;  4ZRZ A;  4ZUI A;  2RDG A;  1SE3 A;  4A3I H;  1CKN B;  1H9M A;  4BBR H;  1B4O A;  3GTK H;  5I6W A;  1X3Q A;  2F0I A;  3BVG A;  1KAA A;  1WVL A;  1JB7 A;  2F4I A;  3NBH A;  1PYS B;  2CWA A;  1MHW C;  5KRU A;  2Z6K A;  2IY5 B;  2AQ2 B;  3SEB A;  3U4Z A;  1PV4 A;  1SFO B;  4LFB L;  4YIJ A;  4J8Q A;  3S1Q B;  1UAP A;  3OTO L;  1ASY A;  1HNX L;  3S24 A;  1KC8 C;  3NPP A;  4DV3 Q;  1XPR A;  1PZK D;  2NYZ D;  3IL8 A;  4A3G G;  5IGG A;  3HOY G;  1X32 A;  2KCC A;  2WP8 J;  4GKJ Q;  4FXG C;  4JI3 Q;  4DA2 A;  2RSN A;  1D1I A;  3I90 A;  4DR1 L;  3TDQ A;  1QOH A;  4NXM Q;  2UUC Q;  3G6J B;  4CDD C;  1HJP A;  3ND8 A;  1K0R A;  1GUG A;  1I4H A;  2NWG A;  4R8I A;  1Y8O B;  2F3I A;  4C3J G;  1PH8 A;  4B3S Q;  3KLS X;  1K3B C;  1KNE A;  4O42 A;  3A54 A;  2M2L A;  2R7D A;  4MHE A;  4C2M B;  5CMD A;  5GAH C;  4QCL A;  3BYY B;  2UUA Q;  4DV2 L;  3MAQ A;  1YVC A;  5FKA C;  1YJW A;  4DR7 L;  2UXB L;  3M4Q A;  2A1A A;  1LT6 D;  2B63 B;  2UXD L;  1YHA A;  2KCT A;  2IJ0 A;  4LF9 L;  2B2U A;  3T16 A;  4TKO B;  2Z4I A;  3S16 H;  4JV5 Q;  4J1M A;  4XXE A;  3BJU A;  4DV6 Q;  1F9Q A;  3AQQ A;  3DHQ A;  1GHJ A;  3T51 B;  2I5H A;  4XDX A;  2RCF A;  1CKM A;  1L0X B;  3K0Y A;  3HOX B;  1O7I A;  4JG2 A;  1VS0 A;  4DV0 L;  2WII B;  4JBW A;  3K5L A;  1CI3 M;  3HOU G;  2DGY A;  1XMO L;  3T1H Q;  3GTL B;  5BR8 Q;  2A6E C;  2ZT9 C;  2RQX A;  4BS9 A;  2B2V A;  1J8I A;  2F4V L;  5FLM H;  1F9R A;  1ET9 A;  4ID6 A;  1CTM A;  4OL7 A;  1CA6 A;  1RD9 D;  2QA4 A;  1I4Q A;  5EAY A;  3S2D H;  4K0K Q;  2PCF B;  4XYQ A;  4Y52 H;  2Q2H A;  1Q90 A;  1X6O A;  4LUZ A;  4XQJ A;  1FJG L;  5NUC A;  1NMF A;  3H15 A;  5EKK A;  5IYB H;  3I4M G;  3T53 B;  1HUM A;  3L3O C;  3E0J A;  5C3E G;  1ZKO A;  2OT2 A;  2R7Z G;  1Y1W B;  4DU9 A;  1A3T A;  2A74 C;  1HTL D;  5COY A;  1I50 B;  1XWE A;  1L1O B;  4OWT B;  3ERS X;  4QF4 A;  2F52 A;  2R3Z A;  1E2Z A;  5IGD A;  2K4K A;  4F87 A;  1JOK A;  3BVM A;  1WD0 A;  2F3V A;  2FHT A;  4P75 A;  5KGU A;  3CPW A;  4BWG B;  3PV0 A;  2XN9 C;  1SMY C;  1D7Q A;  3CC7 A;  2DNC A;  3PUW A;  4QIW B;  3JAM L;  2L0C A;  2Q2I A;  4JI5 Q;  1W6K A;  5IWA Q;  4LF6 Q;  1VQ9 A;  1QZG A;  2Y0S G;  5CV6 A;  3MVV A;  2YU9 B;  1NE3 A;  2BA0 A;  5FO8 B;  5EPJ A;  5JVG 3;  5IP7 H;  3GTQ H;  4OXP A;  2JA8 B;  4CGY B;  5H1S E;  2N55 A;  1Q46 A;  5GRO A;  1FD7 D;  1YHB A;  4RGM A;  2DUD A;  3E6Z X;  2FXQ A;  2DY7 A;  2OWO A;  1BCP D;  3FKI B;  1EU3 A;  3P7J A;  5C4X B;  3CPF A;  3BDC A;  3BVZ A;  3G7L A;  2K5N A;  3QO2 A;  2UUB Q;  2C5C A;  3CC2 A;  3HG9 A;  3URY A;  1HQM C;  4A3K G;  1OXS C;  1SDF A;  1LTT D;  3EN2 A;  1DJR D;  1WTX A;  4DR2 L;  3I3C A;  1VQA A;  2K7V A;  4B3T Q;  3PO2 G;  3UDI A;  2MJ8 A;  4MN3 A;  3HKS A;  2UU9 Q;  1TU2 B;  4X62 L;  1FNU A;  4JI1 L;  5C4H A;  4A3B G;  1L0Y B;  4XT1 B;  4LK1 C;  3K5M A;  5EBD A;  1K9M C;  1UE5 A;  1STN A;  4GOP C;  1XNQ L;  2K5W A;  3W2D A;  3J7A F;  4LAA A;  1VF7 A;  1ZEQ X;  1LT3 D;  3L9A X;  3MXG A;  4HID A;  4J15 A;  4B3M Q;  4X3S A;  1VQE A;  2PYK A;  1RDP D;  5L37 A;  1DOK A;  2JYO A;  1ZYR D;  5G3L D;  4OWX B;  4NXN Q;  2LXJ A;  2E5L L;  4L63 B;  4CKE A;  1EUJ A;  4IUV A;  2Z1C A;  3CW2 C;  3NQT A;  1BBX C;  3OMG A;  3G48 A;  3TN2 A;  3HOY H;  4A3G H;  2ZJP A;  4U67 3;  3HKZ E;  3I4L A;  2P5Z X;  1B50 A;  1BVS A;  2B8F A;  1EZ8 A;  3GDE A;  1TWF H;  1O80 A;  1XX8 A;  3QG1 A;  4YY3 L;  1S5E D;  1EIY B;  4GS3 A;  1ROD A;  2CW0 D;  1VQ7 A;  4B3R L;  1C0A A;  4DR4 Q;  5JPN C;  1TWC H;  4X65 Q;  4AYB B;  4DUY Q;  5EKI A;  3J80 E;  1VQF A;  2QIL A;  1SN8 A;  3TP7 A;  4ULL A;  3V05 A;  4JI4 L;  2K5H A;  1LTL A;  3IKJ A;  4C3J H;  1A0I A;  1VQJ A;  2Z0S A;  1X65 A;  1I6H B;  2KHJ A;  4LW1 A;  3OWE B;  2N8N A;  4UPA A;  4HIK A;  1V43 A;  1K8A C;  1FVI A;  2WB1 E;  2L11 A;  2Z6B A;  2NZ1 D;  4QMG A;  1GXD C;  1TKW B;  3CCQ A;  1NCV A;  3UDF A;  1JCK B;  1VQC A;  1CUK A;  1B1Z A;  1STA A;  1EY0 A;  1WTP A;  2F0E A;  1GUT A;  2IX0 A;  3I4N B;  3TP6 A;  1JB3 A;  2DY8 A;  3BYT B;  3NTH A;  2WAQ B;  3RZD B;  4DK0 A;  3S17 H;  3LGJ A;  3SK4 A;  3PIP A;  4N9P A;  2DJF C;  4JI0 Q;  3MEF A;  1HH2 P;  4A75 A;  5IE8 A;  2LY7 A;  5M5W B;  1PXU A;  2OQK A;  5C5L A;  3CC4 A;  3S2H H;  1UUP A;  3T1Y Q;  3OHX C;  1YHQ A;  5IYD G;  4PNY A;  3I4M H;  3DWQ A;  4DN4 M;  5C3E H;  1I4R A;  2R7Z H;  5FO9 B;  1XNR Q;  1MBY A;  1HRJ A;  2E2H H;  2PNH A;  1A15 A;  4DAP A;  2NVY B;  4IZ8 A;  3GTP B;  2IWH A;  2IW3 A;  1QUQ B;  1RJT A;  2E2I H;  4DAM A;  2D0O A;  2NZH A;  4P74 A;  3TME A;  1S40 A;  4BBS G;  1SR3 A;  4DK3 C;  3HP3 A;  4N9T A;  1IBK Q;  3DWA A;  2MP1 A;  2KBN A;  3R8B A;  3MZ5 A;  4A3L H;  3CQZ H;  3ND9 A;  3RD4 A;  4A3F G;  5IGC A;  4Q5V A;  4KHP Q;  5M5Y H;  3HOZ G;  1PLF A;  3NEM A;  1Y14 B;  5FOB B;  1PH7 A;  2F0F A;  5BN4 A;  4K2K A;  2KHI A;  5D14 A;  2QDB A;  5CBE E;  1X3F A;  2KJX A;  1STE A;  4R9W A;  5CV9 A;  2YTV A;  4JPB W;  1EZ6 A;  2F0L A;  3IFD A;  1UEB A;  1YNN D;  3GV3 A;  5DM7 3;  3PF5 A;  1QE6 A;  1NMG A;  4LFC L;  3OPO A;  3S14 B;  3BS1 A;  4DR5 L;  4TVA B;  3NWS A;  2IX1 A;  3KDF A;  1FR3 A;  3NP8 A;  2VQE Q;  2AKW B;  1UNS A;  4FF2 A;  1YI2 A;  1K8M A;  2BOS A;  3K7A B;  1V1O A;  1E3P A;  4DAY B;  2J4X A;  4A3K H;  1VQ6 A;  1Y1V B;  4HJ9 A;  5KNC A;  1WI5 A;  4AYB E;  5M3M G;  4ZCK A;  4K8J A;  1BCP B;  2WKD A;  3PO2 H;  4UAI A;  1PH3 A;  3P75 A;  1B3A A;  4JI7 Q;  4DKA C;  1C4Q A;  3A8K E;  1H9S A;  4LF4 L;  2BA1 A;  1S5B D;  3VR2 A;  3STB C;  1U4M A;  4A3B H;  4PV1 C;  1ILP A;  5IOC A;  2QW7 A;  3VYU A;  1YNJ C;  2R6G A;  4H7B A;  1RTO A;  3RLO A;  2EYO A;  4FF4 A;  1DGS A;  2DNE A;  5KYI A;  1PFS A;  4V19 0;  1QJO A;  1VQ8 A;  2K28 A;  2JN4 A;  4JW0 A;  4CDE C;  1TWH H;  3GTM H;  1TWA B;  2CWP A;  1TS4 A;  5EBC A;  4GNX B;  4PZ8 A;  3IAY A;  2JA7 B;  3BG3 A;  3R93 A;  1ENC A;  4ZYS A;  2ICE C;  3NEN A;  2XNA C;  2L4N A;  3PUY A;  2XRS D;  2R92 G;  2WAQ E;  2Q8R E;  4IUU A;  3RNU A;  1XPO A;  4XT3 B;  4Z9C B;  5C4Z A;  2D62 A;  3KJO A;  5CC4 A;  4ILW A;  3JAM E;  1VMC A;  5ELE A;  4RKL A;  2KVM A;  3J80 c;  3HEJ A;  2A69 D;  2ZTE A;  4DV4 L;  1N32 Q;  1TWG B;  4Y7N B;  2JA6 H;  1IBM Q;  3SK8 A;  4N8F A;  1KDC A;  2B39 A;  4C3H G;  3Q23 A;  1EY7 A;  1L1O C;  2RVL A;  1BCP F;  1K83 B;  2PW7 A;  1JJC B;  1V8Q A;  3BDL A;  4H13 C;  3PO3 B;  1T5E A;  1I94 Q;  3X3N A;  1XMQ L;  2PQA B;  1VQK A;  2F0P A;  1KRT A;  4JI2 Q;  3M4O B;  4I65 A;  5KEE A;  3DM1 A;  5GQO A;  3VA5 A;  1PTO B;  1KXL A;  2PI2 A;  2VY3 A;  5E4X A;  4LWC A;  2ZM6 L;  5LMN L;  3K5N A;  4J6H A;  4RH6 A;  5CYU A;  3CU7 A;  1FNW A;  4LNQ A;  1O78 A;  5KND A;  4IJL A;  2GVA A;  1PDQ A;  3EIV A;  3KF8 A;  4IUN A;  5CV7 A;  4UP7 A;  1VQG A;  3P1H A;  4IUR A;  3I4O A;  1NSN S;  3EVQ A;  4BXX G;  2LFN A;  1BBW A;  3C1F A;  3FHW A;  3HOV B;  1HNZ Q;  1HNX Q;  2QDL A;  2VB2 X;  2SDF A;  3FMC A;  2X69 A;  3O13 A;  3KOJ A;  4KN4 C;  2O4X A;  4BBR B;  2CHB D;  3GTK B;  1JOR A;  2LS0 1;  2MNA A;  2OQ0 A;  2UXC L;  3OYY A;  1PHJ A;  3KLW A;  2I46 A;  2PMZ B;  4DR3 L;  1CA5 A;  5BN5 A;  2RDH A;  5TSS A;  3S15 H;  1SAP A;  1J5E L;  4RAU C;  2L15 A;  1JC7 A;  2I0Q A;  4GOP A;  4LFA L;  3GTG H;  5IYD H;  5AJ3 L;  1B3Q A;  1JJG A;  1RL2 A;  2RCN A;  1H9K A;  2LKV A;  2A6H D;  1IKM A;  3N6R A;  5C0X G;  5EQ0 A;  4BY1 G;  1SBB B;  1PTO F;  1F2Z A;  2O2L D;  4HED A;  4MZ9 A;  1T9H A;  2AHO B;  4IUP A;  4LF5 L;  3W3A A;  3MTS A;  4QGU A;  3HKZ G;  5D65 A;  1NR4 A;  4L6T B;  2ENB A;  3NUC A;  4ZUJ A;  4K14 A;  4X64 L;  4DNI A;  3H3V C;  4G7O C;  1LUZ A;  1NTG A;  3A7A B;  4A3F H;  2PW5 A;  4QJF A;  4NPS A;  4RA8 A;  3HOZ H;  2F0U A;  4UDU C;  3NEL A;  3VR5 A;  3DEO A;  4QUF A;  4JBM A;  4CDC C;  4WJW A;  1Y8P B;  3UDG A;  1LLR D;  1JWS D;  4CDF C;  4A4I A;  3S1N H;  1IW7 C;  4NMZ A;  1IKL A;  1IL8 A;  2O5I C;  4XYO A;  3ONA B;  3S16 B;  1EY4 A;  1HZC A;  5F2D A;  5JOB A;  4HJ5 A;  5I9P A;  2A8V A;  2ALY B;  1PRT D;  1HTP A;  2CQA A;  2L1B A;  4OX9 L;  1JWU D;  2WB1 G;  1Z6H A;  4CHT B;  3SXH A;  1S5D D;  1BUV T;  2K05 A;  4KJO A;  1N34 Q;  3T4A C;  1V1P B;  3A55 A;  4RCO A;  5M3M H;  3A0J A;  1Q81 C;  1KAB A;  4FVM A;  1HFG A;  1LAC A;  2JE6 I;  5JJL A;  3S2D B;  3KF6 B;  3QWN A;  4AIM A;  2Q2U A;  1S72 A;  2MPM A;  5K36 G;  2Q8I B;  2ZXR A;  4GN4 B;  2F0D A;  5DAU A;  3J80 i;  1IXR A;  1X3E A;  4JYA L;  2FMM A;  2K04 A;  2F0V A;  3W1G A;  2KEC A;  1ONL A;  2HDM A;  1H9R A;  1WFQ A;  4GKK Q;  1BF4 A;  3NXW A;  1K0S A;  3JAM c;  3KLS A;  1A3V A;  2K75 A;  1B9N A;  2KUM A;  2VQF Q;  1TT2 A;  3DUZ A;  3MXP A;  4GN3 B;  2HCC A;  2SOB A;  1I4P A;  3U50 C;  4F8M A;  5C0X I;  1PZI D;  2KCN A;  2R92 H;  4PG3 A;  1WCM G;  3MXN A;  5C5M A;  3SE0 A;  1D1K A;  2CKZ B;  1JOO A;  4DV5 Q;  1L2F A;  4AH6 A;  1CKN A;  1LAB A;  3SR1 A;  1Y69 U;  2IPK D;  1DM0 B;  3LX0 A;  5E3F A;  2FIN B;  4JI6 L;  4L5T A;  5EKL A;  3AEV A;  5GAD C;  1QIL A;  3UDX A;  1A6X A;  3GTQ B;  4C3H H;  3M3Y H;  3ULL A;  3TS0 A;  2F0O A;  4X62 Q;  3KYH C;  1CK1 A;  2JA5 B;  4H44 C;  3WOF A;  2DN8 A;  2VS1 A;  1EWI A;  1K8O A;  2A68 C;  1SMX A;  3D6W A;  3F2C A;  1KHI A;  1EYG A;  1I5F A;  2ZXO A;  3KBX A;  3FVQ A;  2VUM G;  3TZD A;  4JBJ A;  3PIO A;  2H1E A;  2A6E D;  4OON A;  1A2T A;  3J7Y W;  2MO0 A;  5A35 A;  5J22 A;  5C6A A;  2D5D A;  4R8N A;  4AYB G;  3OMC A;  5HUR A;  4IFD G;  4IPC A;  4IOA A;  1M4V A;  3EQL C;  4X3U A;  5I6Y A;  2ASB A;  3BZD B;  2F03 A;  4JI8 Q;  3B6Y A;  5JVH 3;  2N3S A;  1G6P A;  4RKB A;  4KN7 C;  4DV3 L;  2NZO A;  3C2P A;  1VQD A;  3Q8D A;  3KLR A;  3K59 A;  5LL6 X;  1CT1 D;  4EX5 A;  4GKJ L;  2XRQ D;  3GO5 A;  1QWY A;  2D2C C;  4JI3 L;  4C3I H;  4PMB A;  4LF8 L;  2NN6 I;  4DV7 Q;  4HCS A;  1EIH A;  3CRL C;  1SMY D;  2K5Q A;  1D5M C;  1TR5 A;  1AFP A;  3DEP A;  4NXM L;  4KKT A;  4FF3 A;  2UUC L;  3K0X A;  3L0O A;  5C0X H;  1PYW D;  5C44 G;  4BY1 H;  3HOY B;  4A3G B;  2WAQ G;  3KK7 A;  1I6V C;  4B3S L;  4A93 G;  4RFB A;  2G5D A;  2ZTC A;  3K57 A;  3GV6 A;  1TWF B;  3VYT A;  4RGN A;  5FJ8 G;  1SNM A;  2UUA L;  2OEO A;  1VQN A;  2NUC A;  1K28 A;  4ZLT F;  5IT9 L;  4FXD A;  4CJ1 B;  2KCM A;  1TWC B;  1HZ9 A;  4YHH Q;  4NW2 A;  3GTO H;  2F0G A;  3I2Z A;  5C3W A;  4KLK A;  4DV6 L;  3BU2 A;  4C3J B;  3Q24 A;  1LM0 A;  5C3X A;  2MO1 A;  1G2S A;  3OOC A;  2RKS A;  4LF7 L;  3H3V I;  2MFI A;  4E6I A;  3OW2 A;  1EL0 A;  1L1O A;  4DF7 A;  1HR0 Q;  3T1H L;  3CCL A;  4HJ8 A;  1JE5 A;  5BR8 L;  3G6E A;  4U68 A;  1MD2 D;  2A5H A;  2EYM A;  5DEH A;  3IFT A;  1ESR A;  1E1O A;  4K0K L;  1SNC A;  4A3C G;  1XYI A;  1HNW Q;  2FMC A;  5M3F G;  4X66 Q;  1F9S A;  1D2B A;  2EYP A;  3U9O A;  3SK5 A;  1UWV A;  1E22 A;  1JR0 D;  3JAM i;  1YIJ A;  1Q8K A;  1DCZ A;  1PMR A;  4TSS A;  2BDN A;  2Z8L A;  3TEH B;  3S17 B;  1SNP A;  3CCS A;  1B9M A;  1PTO C;  4N8X 1;  4IFD I;  1DZ1 A;  1LYL A;  4MTK A;  1LV9 A;  2HQL A;  4KY5 A;  1J6Q A;  4JC0 A;  4RMF A;  2EXZ A;  4EQ5 A;  3MA2 B;  4I7A A;  1U0L A;  4OEL B;  5C4J H;  1ICF B;  2G9D A;  3A8J E;  2ES2 A;  3S2H B;  4ZQ3 A;  4HSV A;  1IBL Q;  2R93 G;  5K36 H;  5A2Q L;  4ZAI A;  1M1K C;  3I4M B;  5FLX L;  1H95 A;  2ZTD A;  5ELB A;  1BXT A;  3CCM A;  4HMJ A;  5C3E B;  4KV6 A;  3CP0 A;  1LTG D;  4JI5 L;  2R7Z B;  2HCI A;  5IWA L;  4LF6 L;  2XGT A;  1BQQ T;  2E2H B;  3K80 C;  1E0B A;  2K6A A;  4B9W A;  2E2I B;  4LUV A;  3RLF A;  3HOW G;  4QIW E;  4KY7 A;  1H9J A;  4P2C B;  5EPL A;  1MIU A;  5M5X H;  1D6E C;  1SE4 A;  4L5S A;  2BCO A;  1WCM H;  5I2X A;  2N88 A;  3CQZ B;  3E3X A;  3KBG A;  4XTC S;  2EYF A;  4FF1 A;  3S1M H;  5M5Y B;  1PYB A;  2Y0S B;  4O2D A;  1KDA A;  2YTY A;  2NVX H;  4JBK A;  2ATW A;  4DGZ A;  3TRE A;  3HOU H;  2UUB L;  1TY2 A;  4KKU A;  2AUJ D;  2B3G A;  2JA7 G;  1PH5 A;  2B2Y A;  3RZO H;  3BDO A;  4B3T L;  1S5F D;  4B9X A;  2G9H D;  1LTS D;  3D6C A;  3OSO A;  2EJG C;  2Z4H A;  1PRT F;  4A3M G;  1WTQ A;  1ZXT A;  2OXP A;  1IYU A;  3E9I A;  4QB4 A;  4WJ3 M;  3W1B A;  2K5V A;  4K8I A;  4H0L C;  2CFM A;  3F1Z A;  2VUM H;  4A3K B;  5COR A;  2E2J H;  4QQB X;  2NVT H;  3PO2 B;  2EIF A;  3S1R H;  2SNM A;  4DK1 A;  1H9S B;  3CXC A;  1A8V A;  3WOE A;  2H5X A;  1NR2 A;  4IFD H;  4B3M L;  3PO3 G;  4L5R C;  4OO1 I;  4BY7 G;  4P73 A;  4A3B B;  4ME5 A;  2IT1 A;  4PZ7 A;  4NXN L;  1AN8 A;  1A63 A;  1KD1 C;  5D3I B;  3MWY W;  1I4X A;  1LO5 D;  3Q6S A;  3D4W A;  4A3D G;  4KTA A;  3CHB D;  2K50 A;  1GOZ A;  2J7Z A;  4RGO S;  3GTM B;  1TWH B;  1WD1 A;  3H91 A;  3K8A A;  1I3Q H;  1QG7 A;  3PF4 A;  3A5Z B;  2M9V A;  2VXW A;  1YJ9 A;  2QEJ C;  3RN2 A;  4DNT B;  4IPD A;  3EFX D;  5EJW A;  5GAE C;  1OXU A;  2YV5 A;  4R1J A;  5LMU Q;  4DR4 L;  1WTR A;  1HR0 W;  4X65 L;  2VL6 A;  4DUY L;  2F0M A;  3RMH A;  1OTC A;  4DK6 C;  4R4C A;  4KK7 A;  2HUG A;  5LMN Q;  1RCV D;  3K5O A;  4BBR G;  5C44 H;  1YEZ A;  3V2T A;  4A93 H;  4IUQ A;  2YTX A;  3TBI B;  2JA6 B;  1LTB D;  1QVF A;  1C8C A;  1RIP A;  1VQP A;  2E74 C;  5FJ8 H;  4M1U B;  2IL8 A;  1EYD A;  4OIK A;  5KNB A;  1PH9 A;  4DR6 L;  3M85 A;  1CM9 A;  1HZA A;  4WRD A;  1B70 B;  3I8Z A;  2EYL A;  1O7L A;  1IHZ A;  5J39 A;  2XWB B;  1Q12 A;  3H0G G;  5IYC G;  4K5V A;  3CMA A;  3D0F A;  1AE2 A;  1N36 L;  4UP9 A;  1VQO A;  4DFA A;  5J3B A;  1EWC A;  1DD2 A;  2N78 A;  2IHE A;  1S4Z A;  4HTH A;  1OXV A;  1QUQ A;  1VQ4 A;  2KHS A;  1Q3L A;  2OTL A;  4JI0 L;  2K33 A;  1FGU A;  2HHH Q;  2A73 B;  5AJ3 Q;  4HCE A;  4A3C H;  3TZU A;  3ERQ A;  3STB D;  5M3F H;  4A3J B;  4KD3 A;  2K5D A;  1N33 Q;  1YNJ D;  4FXK C;  3EA6 A;  1OXT A;  2JQO A;  1BDO A;  4DV1 Q;  2I07 B;  2CVR A;  1ML0 D;  3CCR A;  1VMP A;  2QEX A;  1T5X D;  2K03 A;  1Q86 C;  1QVG A;  1DON A;  4UY8 C;  1B2T A;  4K6D A;  1MSH A;  2F0H A;  4DUZ Q;  1E1T A;  1TS2 A;  3H6M A;  3VYR A;  3E5S A;  1TII D;  1C7Y A;  3S15 B;  4ODG A;  2EJF C;  3J81 L;  5I2Y A;  4GZY C;  5ELF A;  5E1F A;  2R93 H;  1IYJ B;  3GTG B;  2AWN A;  1IBK L;  2EY1 A;  3X3M A;  3A5U A;  1D5X C;  3MFG A;  4IPG A;  4IN3 A;  1KNA A;  3CF5 A;  4UP8 A;  1MJE A;  2PZT A;  4KHP L;  4DAY A;  1FGB D;  3VDY A;  2I5L X;  2KEN A;  1K8G A;  4HSP A;  4KI0 A;  4EQN A;  5IP9 G;  4KY6 A;  1SEB D;  3FPU B;  1VDZ A;  3HOW H;  1TS3 A;  4QUC A;  4A3E B;  1WTV A;  4RHR A;  2KQ3 A;  3K58 A;  1U4P A;  4G57 A;  5LHY 1;  1EY9 A;  3PQI A;  4LFB Q;  4HIM A;  2OTJ A;  2L55 A;  3D3R A;  3OTO Q;  3T13 A;  1EU4 A;  4A3F B;  1QCB D;  2NVQ B;  3CRK C;  3HOZ B;  1PVO A;  4HN7 A;  1N8R C;  2E76 C;  2MGS A;  4A3I B;  1SYE A;  3TSS A;  1MSG A;  2GA4 B;  3D4D A;  4DR1 Q;  2EOT A;  2LXK A;  3KUP A;  3V96 A;  1PH4 A;  2B63 G;  3S1N B;  1LTR D;  3H94 A;  5G3L F;  3NBH B;  1Y8N B;  4JYA Q;  4JI7 L;  2D0P A;  3NSW A;  1EQR A;  4A3M H;  2F0J A;  2PNR C;  2EZV A;  4YCW A;  1XXG A;  4POF A;  1VQB A;  5T1I A;  4LMQ D;  3MEH A;  5IGE A;  3HOX G;  3TS2 A;  3DLL A;  2BDO A;  3OIP A;  2RF4 A;  1U4L A;  1TXY A;  3R2I A;  4DV2 Q;  3J7A 5;  1YZ6 A;  3CCE A;  4DR7 Q;  2UXB Q;  2VB3 X;  5M3M B;  4EVO A;  2UXD Q;  5JJZ A;  1RTN A;  2X6G A;  4LF9 Q;  5LMN W;  3FPP A;  2JA5 G;  4X3K A;  3GTJ H;  4C1N K;  3PO3 H;  1V1Q A;  4BBS H;  4BY7 H;  4QY7 A;  2QGQ A;  2B2Y C;  1NUC A;  1M8A A;  5A2Q E;  1B7Y B;  4JI6 Q;  5FLX E;  3FDT A;  4DV0 Q;  1O7Z A;  1HHV A;  1XMO Q;  3G4S A;  4A3D H;  4R4Q A;  2SNS A;  4CJ2 C;  1Y1W G;  1Z47 A;  2AUK A;  3TP5 A;  3WDN A;  2F4V Q;  1JOQ A;  1N32 L;  2JK8 A;  3ITP A;  3NBI A;  4YCU A;  1IBM L;  1DXM A;  1SYD A;  1DOM A;  3RR5 A;  1FJG Q;  4PMW A;  3KJP A;  1UEA B;  2JSO A;  3HRZ C;  1EOT A;  1X54 A;  1HCZ A;  4IO9 A;  1CKO A;  2R92 B;  1SRO A;  4YCV A;  1JJ2 A;  3CKI B;  1P8L A;  1R9T H;  2HIV A;  1I94 L;  1IL2 A;  1SXT A;  4JI2 L;  3N52 A;  5CV4 A;  1EY5 A;  3QOL A;  4R4T A;  1IZ6 A;  3AFQ A;  2EJM A;  3NK9 A;  3SHL A;  4C3H B;  5JJI A;  1GUN A;  3M3Y B;  2JA8 G;  3NHH A;  3R3O A;  4IAL A;  1IW7 D;  3PMF A;  1AZQ A;  2JA9 A;  1Q82 C;  1E7Z A;  1KTK A;  1A3U A;  1EQQ A;  3ZJY C;  3FKI G;  3SVM A;  1KL9 A;  3QOJ A;  3ULP A;  5C4X G;  1WTW A;  1HNZ L;  5E4W C;  2XTI A;  3H0G H;  5IYC H;  3A8I E;  2NN6 G;  3I56 A;  1KDB A;  2L9H A;  1EY6 A;  1SE2 A;  1A62 A;  3M4P A;  1SE8 A;  4A76 A;  1X56 A;  4HJ7 A;  4GLA C;  4LF8 Q;  4KKS A;  4AQY L;  5EGT A;  1STY A;  1EFI D;  4OIJ A;  3P20 A;  4ABN A;  3MC0 B;  5KYL A;  3HFZ B;  2VW9 A;  4HJA A;  1FNV A;  2V4D A;  2V1C C;  4KJN A;  4KHZ A;  2BH2 A;  1E24 A;  3BZC A;  2OCE A;  2XSC A;  2O5J C;  3CD6 A;  1I4G A;  3ERO A;  2PMZ E;  4NP5 A;  5DNF A;  1AEX A;  1JWM D;  3QB3 A;  2K32 A;  4DR2 Q;  2EPB A;  4HIO A;  1ESF A;  2NTS A;  1AZP A;  1GJX A;  1SNQ A;  3C46 A;  1LT4 D;  1KLU D;  3Q22 A;  2MHV A;  2XVS A;  1MKH A;  4OEM B;  4C3I B;  5CV8 A;  1SYF A;  4JI1 Q;  3G71 A;  1GM5 A;  4F7X A;  3QJY A;  4ZKC B;  1UE7 A;  3Q0A A;  3SDZ A;  1PH6 A;  5IT9 c;  1WJJ A;  1SFO H;  4LJZ C;  4LF7 Q;  1XNQ Q;  3S1Q H;  4BY1 B;  3I91 A;  1U4R A;  2HDL A;  2KEE A;  5E7N A;  1BO0 A;  5EPK A;  5C0X J;  4L8J A;  1V1P A;  1MJC A;  2R61 A;  4HR7 B;  1MGS A;  5IP9 H;  2R7F A;  5JEA G;  3HKZ B;  3KF6 A;  2C9O A;  3LWE A;  1D5Z C;  1EFW A;  3CCJ A;  2E5L Q;  2CQO A;  1AH9 A;  2WAC A;  3NE5 B;  1JT8 A;  1YIT A;  1GVP A;  4BXX H;  3GTO B;  2A68 D;  2RA4 A;  1G51 A;  4CKC A;  4XQN A;  1ILQ A;  1D8L A;  5IGF A;  1A2U A;  1TQO A;  4GLX A;  1VQH A;  5HY6 A;  2B2T A;  4C2M H;  4F88 A;  3I7F A;  2CH4 W;  4YY3 Q;  3F2D A;  1N34 L;  3D8G A;  4B3R Q;  3TQY A;  2B63 H;  1G91 A;  2KA7 A;  1W6J A;  1RHP A;  4ZKB B;  1WTH A;  5HGT A;  2PPB C;  2F0K A;  1SNO A;  2EY2 A;  1BCP C;  1J9O A;  5ISR A;  2TMP A;  1F2L A;  2EE1 A;  4JVZ A;  5AFW A;  4JI4 Q;  5JJK A;  4APV A;  4A3L G;  2B2W C;  2E8G A;  4P71 A;  1VQM A;  2WB1 B;  4IQZ A;  3HOX H;  4NKL A;  3I4N G;  3PIP 3;  3KFU A;  4NB3 A;  4GKK L;  1SSO A;  3GTL H;  3MHB A;  5FLX c;  1DOL A;  1GUS A;  2QCP X;  4CBV A;  3RN5 A;  3DM3 A;  3CAM A;  4WOR A;  1GHK A;  1V9P A;  3DMU A;  2VQF L;  4PZ6 A;  2JA5 H;  1MI2 A;  3T56 B;  1HZB A;  4C56 C;  1JMC A;  5C4J B;  2KED A;  5IIF A;  3J81 E;  4K5X A;  2Q2T A;  4GNX C;  1K73 C;  1R4Q B;  2EY6 A;  2WIN B;  5CGK A;  1CQV A;  3AYH B;  3WWV A;  2E2D C;  4JV5 L;  4DV5 L;  4JOI C;  3GD7 A;  1Y1W H;  3LWU A;  5T1G A;  1X3P A;  5CV5 A;  2OF1 A;  1KLG D;  1KRS A;  1I50 H;  2MQH A;  4GN5 A;  3AFP A;  3MXU A;  3F8T A;  3U58 A;  1FL0 A;  3MFY A;  1ZYR C;  1XTC D;  2RDF A;  5M5X B;  4KMU C;  1PFM A;  1AE3 A;  4YWK A;  2L12 A;  1P16 A;  1WCM B;  5HGQ A;  3AB9 A;  2KOL A;  3M4Y A;  4ME3 A;  3GP7 A;  1EIG A;  3I55 A;  2IHF A;  3VR6 A;  2JEA I;  3S1M B;  1SLJ A;  2C35 B;  2NVX B;  3SK6 A;  1EWH A;  1F77 A;  5J1Z A;  4OO1 G;  1GO3 E;  4KHV A;  1CQF A;  2YU9 H;  3HOU B;  1G6Z A;  1Z9F A;  2MUY A;  1EQT A;  3FRP B;  2JA8 H;  4KD4 A;  4EQO A;  2ZJR A;  3RZO B;  2CW0 C;  3DXJ C;  4FYD A;  5ELN A;  1SRU A;  1PRT B;  3J7A V;  2F0W A;  3UE0 A;  3FKI H;  1UE6 A;  1L0W A;  2SEB D;  5C4X H;  1M90 C;  2F0S A;  1FYC A;  1TVX A;  1X9N A;  1EIF A;  1LTI D;  1S3O A;  2NN6 H;  2QKI C;  4JI8 L;  4LUO A;  2VUM B;  2JA6 G;  1GUW A;  3I72 A;  1EEI D;  1Y1V G;  3J7Z C;  3VR4 A;  1PTO D;  3E0E A;  2E2J B;  2XIW A;  1CFM A;  1SYC A;  4K6L A;  4EGV A;  2NVT B;  3S1R B;  1EYC A;  2X6L A;  1X3G A;  4LFC Q;  5JEA J;  1LTA D;  1PH2 A;  4DR5 Q;  3F2B A;  4HMI A;  1EEF D;  2NTT A;  4IFD J;  1OO9 B;  3CME A;  4DV7 L;  5DLQ E;  2Z6K C;  4JK1 C;  4R4I A;  2YYZ A;  5I9O A;  1HFN A;  5JAV A;  1CHQ D;  4EQP A;  1RKN A;  1S5C D;  3ZYY X;  1I3Q B;  3OIQ A;  2K52 A;  2QF7 A;  3S9W A;  4LF4 Q;  4DR6 Q;  4G7H C;  1HQR D;  3H3V H;  2ID0 A;  3FP9 A;  3I73 A;  2L5T A;  1XPU A;  2JEB I;  4A3J G;  5ELD A;  1ENF A;  4O0A A;  3KDF B;  3HS0 C;  4RGT A;  1VF5 C;  5JPM C;  2VNU D;  4O1N A;  5GAG C;  2WFW A;  1F2M A;  4YHH L;  1N36 Q;  2RBM A;  2UU9 L;  3W5O A;  3NTI A;  5C44 B;  5IGB A;  3K6O A;  1KIX A;  4CKB A;  1N9W A;  4A93 B;  1X55 A;  4DAV A;  3K7U C;  4I7Z C;  1VQ5 A;  1C48 A;  4TQU S;  4S3S A;  1CZW A;  4IOC A;  4RHS A;  5JEA H;  4K5W A;  3U4V A;  4DPG A;  1HR0 L;  2CH4 A;  5FK9 C;  3M9B A;  1NBW A;  2WV6 D;  2ICI A;  2B2U C;  1HNW L;  1JIC A;  4X66 L;  5CBA E;  4XQQ A;  4DV4 Q;  5LL6 S;  1STB A;  3HZX A;  2EVB A;  2HQE A;  1Q8I A;  2Z9H A;  1PFN A;  2LSS A;  3F2U A;  1PH1 A;  1BKB A;  1SYB A;  5KIX A;  4BA2 I;  3JC6 6;  1EY8 A;  1PZJ D;  1I6H H;  1ASZ A;  1YNN C;  4B08 A;  1VCI A;  2EXD A;  4A3E G;  2F0T A;  2B2V C;  2Q8T A;  3PUZ A;  4OGQ C;  3UI2 A;  1XMQ Q;  1B8A A;  3HGB A;  5M3F B;  2B29 A;  2FJ2 A;  1QNK A;  1O7Y A;  2HIX A;  3VR3 A;  3HOV G;  1HXY D;  3VYS A;  1IBL L;  4H02 A;  1ICW A;  3J81 c;  1EYA A;  1VQL A;  2ZXP A;  3NWT A;  1JQY D;  4NDX A;  1JE4 A;  2ZM6 Q;  3E9H A;  4A3I G;  3I4N H;  3D31 A;  1F9P A;  2F0Q A;  1Q7Y C;  3RZD H;  3PSI A;  2IX3 A;  2PZW A;  2RHS B;  1BBU A;  4UHV A;  3M7G A;  2WKC A;  1Q1B A;  5M5W H;  1CHP D;  2B2T C;  3RLN A;  3TP8 A;  4DXG A;  1QVC A;  5M9O A;  2EYH A;  1KAW A;  1NAP A;  5IY0 A;  2DJG C;  3H09 A;  2R93 B;  2TSS A;  1UE1 A;  1NNX A;  4MIU A;  1G8Z D;  4K2L A;  5DM6 3;  1F2Y A;  1R4P B;  2F0N A;  4PMC A;  1SJH D;  1BNZ A;  1IYV A;  1II3 A;  3D4R A;  3IRB A;  2I5M X;  4L5Q A;  2UXC Q;  4HAE A;  2H4O A;  3BZK A;  2NVY H;  4DR3 Q;  3GTP H;  2EYJ A;  1PFB A;  5FO7 B;  4G4K A;  1HA5 A;  3KF8 B;  5ELC A;  3HOW B;  1J5E Q;  3EJI A;  3NTK A;  2F1M A;  1WYD A;  1G2T A;  3CCU A;  2M00 A;  4LFA Q;  1K3R A;  3A56 A;  2Y0S E;  1TS5 A;  1B53 A;  3GQB A;  2NB0 A;  5K5P A;  2BH8 A;  1EQV A;  3T1Y L;  1WTO A;  3OW7 A;  2A69 C;  1PA6 A;  3PGZ A;  4OO1 H;  4LF5 Q;  1CSQ A;  3A7L A;  5IOD A;  1YJN A;  1Z7T A;  5CR3 A;  1CZG A;  4FNF A;  1XNR L;  1RF2 D;  4R4O A;  2B8G A;  2ZJQ A;  1OXX K;  4FP5 D;  4IPH A;  5D3D A;  4X64 Q;  2PQE A;  3R2T A;  4Q0F A;  2RSO A;  3S14 H;  2BE5 C;  4WJ4 A;  2AQ1 B;  2GN5 A;  5I4D A;  4A3M B;  4GOP B;  4ALP A;  4FO2 A;  4IJH A;  1HPC A;  2F3W A;  2NBF A;  4XIG S;  1BR9 A;  2EDG A;  3K7A H;  4TRD A;  4RCN A;  3AU7 A;  3C3L A;  1Y1V H;  2PZU A;  1E2V A;  1CSP A;  3EBE A;  2JP1 A;  1YNX A;  2AMC B;  5FLM G;  2K01 A;  4WFN 3;  3I70 A;  1U9R A;  3QR8 A;  3GTJ B;  4BBS B;  2BE5 D;  2B2W A;  5IT9 E;  3M7N A;  4BY7 B;  1Q1E A;  3VA7 A;  4MTN A;  1ENA A;  3QIA A;  5LMU L;  1NJI C;  4OX9 Q;  1E2W A;  2K1B A;  3A74 A;  4DXF A;  5IYB G;  1KQS A;  3RUZ A;  1DYQ A;  4A3D B;  4CJ0 B;  3C1E A;  2AWO A;  1WOC A;  4P72 A;  3CCV A;  3PUX A;  1XJV A;  2VQE L;  2VZA A;  3L2P A;  2HD3 A;  1TWA H;  4OHJ A;  1SJE D;  4YWL A;  4POG A;  4M8A A;  3OWF A;  4IUT A;  4GNX A;  2JXM B;  1BOS A;  2JA7 H;  1QZH A;  2GVB A; 
#chains in the Genus database with same CATH homology
 1ET6 A;  1G29 1;  1GUO A;  4RWS C;  1SYG A;  1AW7 A;  1R9T B;  1QNU A;  2A6H C;  3L7Z C;  2E75 C;  2J0T D;  2AQ3 B;  2EY5 A;  3DWP A;  1SND A;  2PO4 A;  3PUV A;  3LNN A;  1QB5 D;  1B44 D;  4C3I G;  1AP0 A;  1HUN A;  2XWJ B;  3NQI A;  4V0B A;  1LT5 D;  1STG A;  1TY0 A;  3J80 L;  4G7Z C;  4PQX A;  1HA6 A;  5BN3 A;  4DNR B;  3H0G B;  1PTO H;  3PIO 3;  3U9S A;  2FFK B;  2LMC B;  4X3T A;  4C1N I;  4BA1 I;  4ZK9 B;  3FEW X;  3AMU A;  1STH A;  2D9U A;  1PRT C;  4ZRZ A;  4ZUI A;  2RDG A;  1SE3 A;  1H9M A;  1B4O A;  5I6W A;  1X3Q A;  2F0I A;  3BVG A;  1KAA A;  1WVL A;  2F4I A;  3NBH A;  5KRU A;  2AQ2 B;  3SEB A;  1SFO B;  4YIJ A;  4J8Q A;  3S1Q B;  1UAP A;  3NPP A;  1PZK D;  2NYZ D;  3IL8 A;  5IGG A;  1X32 A;  2KCC A;  2WP8 J;  4FXG C;  4DA2 A;  2RSN A;  1D1I A;  3I90 A;  3TDQ A;  1QOH A;  3G6J B;  3ND8 A;  1GUG A;  1I4H A;  2NWG A;  4R8I A;  1Y8O B;  4C3J G;  3KLS X;  1KNE A;  4O42 A;  3A54 A;  2M2L A;  4C2M B;  4MHE A;  5CMD A;  4QCL A;  3BYY B;  3MAQ A;  5FKA C;  2B63 B;  1LT6 D;  2IJ0 A;  2B2U A;  3T16 A;  4TKO B;  2Z4I A;  4J1M A;  4XXE A;  1F9Q A;  3DHQ A;  3T51 B;  1GHJ A;  4XDX A;  1L0X B;  3K0Y A;  3HOX B;  2WII B;  4JBW A;  3K5L A;  1CI3 M;  3GTL B;  2A6E C;  2ZT9 C;  2RQX A;  4BS9 A;  2B2V A;  1J8I A;  1F9R A;  1ET9 A;  4ID6 A;  1CTM A;  4OL7 A;  1CA6 A;  1RD9 D;  1I4Q A;  2PCF B;  4XYQ A;  1Q90 A;  4XQJ A;  5NUC A;  5EKK A;  3T53 B;  1HUM A;  3L3O C;  3E0J A;  1ZKO A;  2OT2 A;  1Y1W B;  4DU9 A;  1A3T A;  2A74 C;  1HTL D;  5COY A;  1I50 B;  1XWE A;  4QF4 A;  2R3Z A;  1E2Z A;  5IGD A;  4F87 A;  1JOK A;  3BVM A;  1WD0 A;  2F3V A;  2FHT A;  5KGU A;  4BWG B;  3PV0 A;  2XN9 C;  1SMY C;  2DNC A;  3PUW A;  4QIW B;  3JAM L;  2L0C A;  1W6K A;  5CV6 A;  3MVV A;  2YU9 B;  2BA0 A;  5FO8 B;  5EPJ A;  5JVG 3;  2JA8 B;  4CGY B;  2N55 A;  1FD7 D;  4RGM A;  3E6Z X;  2DY7 A;  1BCP D;  3FKI B;  1EU3 A;  3P7J A;  5C4X B;  3BDC A;  3BVZ A;  3G7L A;  3QO2 A;  2C5C A;  3HG9 A;  3URY A;  1HQM C;  1SDF A;  1OXS C;  1LTT D;  1DJR D;  1WTX A;  3I3C A;  2K7V A;  2MJ8 A;  4MN3 A;  1TU2 B;  1FNU A;  5C4H A;  1L0Y B;  4XT1 B;  4LK1 C;  3K5M A;  5EBD A;  1STN A;  2K5W A;  3W2D A;  3J7A F;  4LAA A;  1VF7 A;  1ZEQ X;  1LT3 D;  3L9A X;  3MXG A;  4X3S A;  2PYK A;  1RDP D;  1DOK A;  2JYO A;  1ZYR D;  5G3L D;  4L63 B;  4CKE A;  4IUV A;  2Z1C A;  3NQT A;  1BBX C;  3OMG A;  3TN2 A;  4U67 3;  3I4L A;  1B50 A;  2B8F A;  1EZ8 A;  1O80 A;  1XX8 A;  3QG1 A;  1S5E D;  1ROD A;  2CW0 D;  5JPN C;  4AYB B;  5EKI A;  3J80 E;  2QIL A;  3TP7 A;  4ULL A;  3V05 A;  3IKJ A;  1I6H B;  3OWE B;  1V43 A;  2L11 A;  2NZ1 D;  4QMG A;  1GXD C;  1TKW B;  1NCV A;  1JCK B;  1B1Z A;  1STA A;  1EY0 A;  1WTP A;  2F0E A;  1GUT A;  2IX0 A;  3I4N B;  3TP6 A;  1JB3 A;  2DY8 A;  3BYT B;  3NTH A;  2WAQ B;  3RZD B;  4DK0 A;  3SK4 A;  4N9P A;  2LY7 A;  5M5W B;  1PXU A;  5C5L A;  1UUP A;  3OHX C;  4PNY A;  3DWQ A;  4DN4 M;  1I4R A;  5FO9 B;  1MBY A;  1HRJ A;  1A15 A;  4DAP A;  2NVY B;  4IZ8 A;  3GTP B;  2IWH A;  2IW3 A;  1RJT A;  3TME A;  3HP3 A;  4N9T A;  3DWA A;  2MP1 A;  3R8B A;  3MZ5 A;  3ND9 A;  3RD4 A;  5IGC A;  4Q5V A;  1PLF A;  5FOB B;  2F0F A;  5BN4 A;  4K2K A;  5D14 A;  2QDB A;  5CBE E;  2KJX A;  1STE A;  4R9W A;  5CV9 A;  1EZ6 A;  2F0L A;  3IFD A;  1YNN D;  3GV3 A;  5DM7 3;  1QE6 A;  3OPO A;  3S14 B;  3BS1 A;  2IX1 A;  3NWS A;  1FR3 A;  3NP8 A;  1UNS A;  4FF2 A;  1K8M A;  2BOS A;  3K7A B;  1V1O A;  2J4X A;  1Y1V B;  5KNC A;  4K8J A;  1BCP B;  2WKD A;  4UAI A;  3P75 A;  1B3A A;  1C4Q A;  3A8K E;  1H9S A;  2BA1 A;  1S5B D;  3VR2 A;  1U4M A;  4PV1 C;  1ILP A;  5IOC A;  3VYU A;  1YNJ C;  2R6G A;  4H7B A;  1RTO A;  2EYO A;  4FF4 A;  2DNE A;  5KYI A;  4V19 0;  1QJO A;  2K28 A;  1TWA B;  1TS4 A;  5EBC A;  3IAY A;  2JA7 B;  3BG3 A;  3R93 A;  1ENC A;  4ZYS A;  2ICE C;  2XNA C;  2L4N A;  3PUY A;  2XRS D;  2Q8R E;  4IUU A;  4XT3 B;  4Z9C B;  5C4Z A;  2D62 A;  5CC4 A;  4ILW A;  3JAM E;  1VMC A;  5ELE A;  4RKL A;  2KVM A;  3HEJ A;  2A69 D;  1TWG B;  4Y7N B;  3SK8 A;  1KDC A;  2B39 A;  4C3H G;  3Q23 A;  1EY7 A;  2RVL A;  1BCP F;  1K83 B;  2PW7 A;  1V8Q A;  3BDL A;  4H13 C;  3PO3 B;  1T5E A;  3X3N A;  2F0P A;  3M4O B;  4I65 A;  5KEE A;  3DM1 A;  3VA5 A;  1PTO B;  5E4X A;  3K5N A;  4J6H A;  4RH6 A;  5CYU A;  3CU7 A;  1FNW A;  1O78 A;  5KND A;  1PDQ A;  3KF8 A;  4IUN A;  5CV7 A;  3P1H A;  4IUR A;  1NSN S;  3EVQ A;  2LFN A;  3C1F A;  3HOV B;  2VB2 X;  2SDF A;  3FMC A;  2X69 A;  3O13 A;  4KN4 C;  2O4X A;  4BBR B;  2CHB D;  3GTK B;  1JOR A;  2LS0 1;  2I46 A;  2PMZ B;  1CA5 A;  5BN5 A;  2RDH A;  5TSS A;  1SAP A;  4RAU C;  1JC7 A;  1H9K A;  2LKV A;  2A6H D;  1IKM A;  3N6R A;  5C0X G;  5EQ0 A;  1SBB B;  1PTO F;  1F2Z A;  2O2L D;  4HED A;  4IUP A;  3W3A A;  3MTS A;  5D65 A;  1NR4 A;  4L6T B;  2ENB A;  3NUC A;  4ZUJ A;  4K14 A;  3H3V C;  4G7O C;  3A7A B;  2PW5 A;  4RA8 A;  2F0U A;  4UDU C;  3VR5 A;  3DEO A;  4QUF A;  4WJW A;  1Y8P B;  1LLR D;  1JWS D;  1IW7 C;  4NMZ A;  1IKL A;  1IL8 A;  2O5I C;  4XYO A;  3ONA B;  3S16 B;  1EY4 A;  5F2D A;  5JOB A;  5I9P A;  1PRT D;  1HTP A;  2CQA A;  2L1B A;  1JWU D;  1Z6H A;  4CHT B;  3SXH A;  1S5D D;  1BUV T;  2K05 A;  4KJO A;  3T4A C;  1V1P B;  3A55 A;  4RCO A;  1KAB A;  4FVM A;  1HFG A;  1LAC A;  2JE6 I;  3S2D B;  3QWN A;  2MPM A;  5K36 G;  2Q8I B;  2ZXR A;  2F0D A;  5DAU A;  2FMM A;  2K04 A;  2F0V A;  2KEC A;  1ONL A;  2HDM A;  1H9R A;  1BF4 A;  3NXW A;  3KLS A;  1A3V A;  1B9N A;  2KUM A;  1TT2 A;  3DUZ A;  3MXP A;  2HCC A;  2SOB A;  1I4P A;  4F8M A;  5C0X I;  1PZI D;  2KCN A;  3MXN A;  5C5M A;  3SE0 A;  1D1K A;  1JOO A;  3SR1 A;  1LAB A;  1Y69 U;  2IPK D;  1DM0 B;  3LX0 A;  5E3F A;  2FIN B;  5EKL A;  1QIL A;  1A6X A;  3GTQ B;  2F0O A;  1CK1 A;  2JA5 B;  4H44 C;  3WOF A;  2DN8 A;  1K8O A;  2A68 C;  3D6W A;  2ZXO A;  3KBX A;  3FVQ A;  3TZD A;  2H1E A;  2A6E D;  1A2T A;  3J7Y W;  5A35 A;  5J22 A;  5C6A A;  2D5D A;  4R8N A;  5HUR A;  3OMC A;  4IFD G;  1M4V A;  3EQL C;  4X3U A;  5I6Y A;  3BZD B;  2F03 A;  5JVH 3;  4RKB A;  4KN7 C;  3C2P A;  3KLR A;  3K59 A;  5LL6 X;  1CT1 D;  2XRQ D;  3GO5 A;  1QWY A;  2D2C C;  4PMB A;  2NN6 I;  4HCS A;  1EIH A;  3CRL C;  1SMY D;  2K5Q A;  1D5M C;  1TR5 A;  1AFP A;  3DEP A;  4FF3 A;  4KKT A;  5C0X H;  1PYW D;  4A3G B;  3HOY B;  3KK7 A;  1I6V C;  4RFB A;  3K57 A;  3GV6 A;  1TWF B;  3VYT A;  4RGN A;  1SNM A;  2OEO A;  2NUC A;  4ZLT F;  5IT9 L;  4FXD A;  4CJ1 B;  1TWC B;  4NW2 A;  2F0G A;  5C3W A;  4C3J B;  3Q24 A;  5C3X A;  1G2S A;  3OOC A;  2RKS A;  4E6I A;  1EL0 A;  4DF7 A;  4U68 A;  1MD2 D;  2A5H A;  2EYM A;  5DEH A;  3IFT A;  1ESR A;  1SNC A;  1XYI A;  2FMC A;  1F9S A;  1D2B A;  2EYP A;  3U9O A;  3SK5 A;  1JR0 D;  1DCZ A;  1PMR A;  4TSS A;  2BDN A;  2Z8L A;  3S17 B;  1SNP A;  1B9M A;  1PTO C;  4IFD I;  1DZ1 A;  1LV9 A;  4KY5 A;  2EXZ A;  3MA2 B;  2G9D A;  3A8J E;  3S2H B;  4ZQ3 A;  4HSV A;  5K36 H;  5A2Q L;  4ZAI A;  3I4M B;  5FLX L;  5ELB A;  1BXT A;  4HMJ A;  5C3E B;  4KV6 A;  1LTG D;  2R7Z B;  2HCI A;  1BQQ T;  2E2H B;  1E0B A;  2K6A A;  4B9W A;  2E2I B;  3RLF A;  4KY7 A;  1H9J A;  4P2C B;  5EPL A;  1D6E C;  1SE4 A;  2BCO A;  5I2X A;  2N88 A;  3CQZ B;  3KBG A;  4XTC S;  2EYF A;  4FF1 A;  5M5Y B;  2Y0S B;  1KDA A;  4DGZ A;  1TY2 A;  4KKU A;  2AUJ D;  2B2Y A;  3BDO A;  1S5F D;  4B9X A;  2G9H D;  1LTS D;  3D6C A;  3OSO A;  2EJG C;  2Z4H A;  1PRT F;  1WTQ A;  1ZXT A;  2OXP A;  1IYU A;  4QB4 A;  4K8I A;  4H0L C;  4A3K B;  5COR A;  3PO2 B;  2SNM A;  4DK1 A;  1H9S B;  3WOE A;  1NR2 A;  4IFD H;  4OO1 I;  4A3B B;  4ME5 A;  2IT1 A;  1AN8 A;  5D3I B;  3MWY W;  1I4X A;  1LO5 D;  3Q6S A;  3D4W A;  4KTA A;  3CHB D;  1GOZ A;  2J7Z A;  4RGO S;  3GTM B;  1TWH B;  1WD1 A;  3H91 A;  1QG7 A;  2M9V A;  2VXW A;  2QEJ C;  4DNT B;  5EJW A;  3EFX D;  1OXU A;  1WTR A;  2F0M A;  3RMH A;  4KK7 A;  2HUG A;  1RCV D;  3K5O A;  3V2T A;  4IUQ A;  3TBI B;  2JA6 B;  1LTB D;  1C8C A;  2E74 C;  4M1U B;  2IL8 A;  1EYD A;  4OIK A;  5KNB A;  3M85 A;  1CM9 A;  4WRD A;  3I8Z A;  2EYL A;  1O7L A;  1IHZ A;  5J39 A;  2XWB B;  1Q12 A;  4K5V A;  4DFA A;  1EWC A;  1DD2 A;  1S4Z A;  4HTH A;  1OXV A;  2KHS A;  1Q3L A;  2K33 A;  2A73 B;  4HCE A;  3TZU A;  3ERQ A;  4A3J B;  4KD3 A;  2K5D A;  1YNJ D;  4FXK C;  3EA6 A;  1OXT A;  1BDO A;  2I07 B;  2CVR A;  1ML0 D;  1VMP A;  1T5X D;  2K03 A;  1DON A;  1B2T A;  4K6D A;  1MSH A;  2F0H A;  1TS2 A;  3H6M A;  3VYR A;  3E5S A;  1TII D;  3S15 B;  4ODG A;  2EJF C;  3J81 L;  5I2Y A;  4GZY C;  5ELF A;  5E1F A;  3GTG B;  2AWN A;  2EY1 A;  3X3M A;  1D5X C;  3MFG A;  4IN3 A;  1KNA A;  2PZT A;  4DAY A;  1FGB D;  4HSP A;  4KI0 A;  4EQN A;  4KY6 A;  1SEB D;  3FPU B;  1VDZ A;  1TS3 A;  4QUC A;  4A3E B;  1WTV A;  4RHR A;  2KQ3 A;  3K58 A;  1U4P A;  4G57 A;  5LHY 1;  1EY9 A;  2L55 A;  3D3R A;  3T13 A;  1EU4 A;  4A3F B;  1QCB D;  2NVQ B;  3CRK C;  3HOZ B;  4HN7 A;  2E76 C;  2MGS A;  4A3I B;  1SYE A;  3TSS A;  1MSG A;  2GA4 B;  3D4D A;  2EOT A;  3KUP A;  3V96 A;  3S1N B;  1LTR D;  3H94 A;  5G3L F;  1Y8N B;  3NSW A;  2F0J A;  2PNR C;  2EZV A;  1XXG A;  5T1I A;  4LMQ D;  3MEH A;  5IGE A;  2BDO A;  3OIP A;  1U4L A;  3R2I A;  2VB3 X;  5M3M B;  4EVO A;  5JJZ A;  1RTN A;  2X6G A;  3FPP A;  4X3K A;  4C1N K;  2B2Y C;  1NUC A;  1M8A A;  5A2Q E;  5FLX E;  3FDT A;  1HHV A;  1O7Z A;  2SNS A;  4CJ2 C;  1Z47 A;  2AUK A;  3TP5 A;  3WDN A;  1JOQ A;  3ITP A;  3NBI A;  1DXM A;  1SYD A;  1DOM A;  4PMW A;  1UEA B;  2JSO A;  3HRZ C;  1EOT A;  1HCZ A;  2R92 B;  3CKI B;  1SXT A;  3N52 A;  5CV4 A;  1EY5 A;  3QOL A;  3NK9 A;  2EJM A;  3SHL A;  4C3H B;  1GUN A;  3M3Y B;  3NHH A;  3R3O A;  4IAL A;  1IW7 D;  3PMF A;  1AZQ A;  1KTK A;  1A3U A;  3SVM A;  3QOJ A;  1WTW A;  5E4W C;  3A8I E;  2NN6 G;  1KDB A;  2L9H A;  1EY6 A;  1SE2 A;  4KKS A;  5EGT A;  1STY A;  1EFI D;  4OIJ A;  3P20 A;  4ABN A;  3MC0 B;  5KYL A;  1FNV A;  2V4D A;  4KJN A;  4KHZ A;  2XSC A;  2O5J C;  1I4G A;  3ERO A;  4NP5 A;  5DNF A;  1AEX A;  1JWM D;  3QB3 A;  2K32 A;  2EPB A;  1ESF A;  2NTS A;  1AZP A;  1GJX A;  1SNQ A;  3C46 A;  1LT4 D;  1KLU D;  3Q22 A;  2MHV A;  2XVS A;  4C3I B;  5CV8 A;  1SYF A;  4F7X A;  3QJY A;  4ZKC B;  3Q0A A;  3SDZ A;  4LJZ C;  4BY1 B;  3I91 A;  1U4R A;  2HDL A;  2KEE A;  1BO0 A;  5EPK A;  5C0X J;  4L8J A;  1V1P A;  2R61 A;  4HR7 B;  1MGS A;  5JEA G;  3HKZ B;  2C9O A;  3LWE A;  1D5Z C;  2WAC A;  3NE5 B;  3GTO B;  2A68 D;  2RA4 A;  4CKC A;  4XQN A;  1ILQ A;  5IGF A;  1A2U A;  1TQO A;  2B2T A;  4F88 A;  3D8G A;  1G91 A;  2KA7 A;  1W6J A;  1RHP A;  4ZKB B;  5HGT A;  2PPB C;  2F0K A;  1SNO A;  2EY2 A;  1BCP C;  1J9O A;  5ISR A;  2TMP A;  1F2L A;  2EE1 A;  5AFW A;  2B2W C;  2WB1 B;  4IQZ A;  4NKL A;  3PIP 3;  1SSO A;  3MHB A;  1DOL A;  1GUS A;  2QCP X;  4CBV A;  4WOR A;  1GHK A;  3DMU A;  1MI2 A;  3T56 B;  4C56 C;  5C4J B;  2KED A;  5IIF A;  3J81 E;  4K5X A;  1R4Q B;  2EY6 A;  2WIN B;  5CGK A;  1CQV A;  2E2D C;  3GD7 A;  3LWU A;  5T1G A;  1X3P A;  5CV5 A;  2OF1 A;  1KLG D;  3MXU A;  3MFY A;  1ZYR C;  1XTC D;  2RDF A;  5M5X B;  4KMU C;  1PFM A;  2L12 A;  1WCM B;  3AB9 A;  2KOL A;  3M4Y A;  3GP7 A;  1EIG A;  2JEA I;  3VR6 A;  3S1M B;  2NVX B;  3SK6 A;  1EWH A;  1F77 A;  5J1Z A;  4OO1 G;  4KHV A;  1CQF A;  3HOU B;  1G6Z A;  2MUY A;  1EQT A;  3FRP B;  4KD4 A;  4EQO A;  3RZO B;  2CW0 C;  3DXJ C;  4FYD A;  1PRT B;  3J7A V;  2F0W A;  2SEB D;  2F0S A;  1FYC A;  1TVX A;  2NN6 H;  1LTI D;  2QKI C;  2VUM B;  1GUW A;  3I72 A;  1EEI D;  3VR4 A;  1PTO D;  2E2J B;  2XIW A;  1CFM A;  1SYC A;  4K6L A;  4EGV A;  2NVT B;  3S1R B;  1EYC A;  2X6L A;  5JEA J;  1LTA D;  4HMI A;  1EEF D;  2NTT A;  4IFD J;  1OO9 B;  4JK1 C;  2YYZ A;  5I9O A;  1HFN A;  5JAV A;  1CHQ D;  4EQP A;  1RKN A;  1S5C D;  3ZYY X;  1I3Q B;  3OIQ A;  2QF7 A;  3S9W A;  4G7H C;  1HQR D;  2ID0 A;  3I73 A;  2L5T A;  2JEB I;  5ELD A;  1ENF A;  3HS0 C;  4RGT A;  1VF5 C;  5JPM C;  2VNU D;  4O1N A;  1F2M A;  2RBM A;  3NTI A;  5C44 B;  5IGB A;  3K6O A;  4CKB A;  4A93 B;  4DAV A;  4I7Z C;  1C48 A;  4TQU S;  4S3S A;  1CZW A;  4RHS A;  5JEA H;  4K5W A;  5FK9 C;  2WV6 D;  2ICI A;  2B2U C;  1JIC A;  5CBA E;  4XQQ A;  5LL6 S;  1STB A;  3HZX A;  2EVB A;  2HQE A;  1Q8I A;  1PFN A;  3F2U A;  1SYB A;  5KIX A;  4BA2 I;  1EY8 A;  1PZJ D;  1YNN C;  4B08 A;  1VCI A;  2F0T A;  2B2V C;  2Q8T A;  3PUZ A;  4OGQ C;  3UI2 A;  3HGB A;  5M3F B;  2FJ2 A;  1QNK A;  1O7Y A;  3VR3 A;  1HXY D;  3VYS A;  1ICW A;  1EYA A;  2ZXP A;  3NWT A;  1JQY D;  4NDX A;  1JE4 A;  3D31 A;  1F9P A;  2F0Q A;  2IX3 A;  2PZW A;  3M7G A;  2WKC A;  1Q1B A;  1CHP D;  2B2T C;  3TP8 A;  4DXG A;  5M9O A;  2EYH A;  1NAP A;  3H09 A;  2R93 B;  2TSS A;  4MIU A;  1G8Z D;  4K2L A;  5DM6 3;  1F2Y A;  1R4P B;  2F0N A;  4PMC A;  1SJH D;  1BNZ A;  1IYV A;  1II3 A;  3D4R A;  4HAE A;  2H4O A;  2EYJ A;  1PFB A;  5FO7 B;  4G4K A;  1HA5 A;  5ELC A;  3HOW B;  3EJI A;  3NTK A;  2F1M A;  1G2T A;  2M00 A;  3A56 A;  1TS5 A;  1B53 A;  3GQB A;  2NB0 A;  5K5P A;  1EQV A;  1WTO A;  3OW7 A;  2A69 C;  4OO1 H;  3A7L A;  5IOD A;  1Z7T A;  5CR3 A;  1CZG A;  4FNF A;  1RF2 D;  2B8G A;  1OXX K;  4FP5 D;  5D3D A;  2PQE A;  3R2T A;  4Q0F A;  2RSO A;  2BE5 C;  2AQ1 B;  4A3M B;  5I4D A;  4FO2 A;  1HPC A;  2F3W A;  2NBF A;  4XIG S;  1BR9 A;  2EDG A;  4TRD A;  4RCN A;  3AU7 A;  3C3L A;  2PZU A;  1E2V A;  2JP1 A;  2K01 A;  4WFN 3;  3I70 A;  1U9R A;  3GTJ B;  4BBS B;  2BE5 D;  2B2W A;  5IT9 E;  3M7N A;  4BY7 B;  1Q1E A;  3VA7 A;  1ENA A;  3QIA A;  1E2W A;  2K1B A;  4DXF A;  3RUZ A;  1DYQ A;  4A3D B;  4CJ0 B;  3C1E A;  2AWO A;  3PUX A;  4OHJ A;  1SJE D;  4M8A A;  3OWF A;  4IUT A;  2JXM B;  1BOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...