4HEDA

Zebrafish chemokine cxl1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
PGVCFKVLTTKEPKANIKRCYNLPKTNNCLKCVLFVDASNRMKCIDPNASWLAERLYRLKEKGVTCRGEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Uncharacterized protein
publication title Structural insight into the evolution of a new chemokine family from zebrafish.
pubmed doi rcsb
source organism Danio rerio
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hedA00
1JE4A 2HCIA 4ZKCB 5T1GA 1U4PA 2X69A 3KBXA 1ESRA 4X3SA 4ZK9B 2K1BA 1SSOA 2KOLA 1WVLA 2FFKB 1HRJA 2RSNA 2EOTA 5EJWA 2HCCA 2B2WA 2FHTA 1HUMA 3DEPA 2K04A 2MP1A 4MN3A 4QUFA 3MTSA 1QE6A 1DOMA 1NAPA 1F9QA 3MWYW 4IUTA 3FDTA 1IKLA 1MGSA 1MSHA 5EKIA 1IL8A 4X3TA 4QUCA 4XT3B 5T1IA 1VMPA 3ONAB 2FINB 2N88A 1MSGA 1U4MA 3FPUB 1NR2A 3UI2A 1NR4A 2B2VC 2DY7A 3G7LA 1CA5A 4ZKBB 5AFWA 1J8IA 2KVMA 2FJ2A 1RTOA 4MHEA 3Q6SA 1U4RA 1F9RA 1HA6A 4X3KA 1PLFA 4OIJA 3I3CA 3IL8A 2JYOA 1XYIA 4X3UA 2NZ1D 2L9HA 2NWGA 5E4XA 3TZDA 1EQTA 1WTQA 5COYA 5D14A 1TVXA 1PFMA 2B2TC 1ILQA 3R93A 1X3QA 1J9OA 2D9UA 1B4OA 4OIKA 3I90A 4RWSC 1G2TA 4CJ2C 3I91A 1EOTA 2B2WC 2B2YA 2FMMA 2J7ZA 2B2UA 3N52A 5CORA 5EPLA 1EL0A 3KUPA 1G6ZA 1GUWA 5D65A 1XX8A 1BNZA 3GV3A 1BO0A 1S4ZA 2HUGA 4UAIA 1BF4A 1EIHA 1DOKA 4U68A 1B3AA 4LMQD 2JP1A 1QNKA 2KEEA 2MGSA 3DM1A 1X32A 3LWEA 1SAPA 1WTRA 1PDQA 3TN2A 4ZLTF 1BBXC 1C8CA 1PFBA 1DONA 4IUUA 1WD1A 2XIWA 1F2LA 1QG7A 2NYZD 4HCSA 1AZQA 1CM9A 3QO2A 1MI2A 2K01A 1A15A 1WTOA 1O7ZA 1VMCA 2MJ8A 2N55A 4ZAIA 1RHPA 2HDLA 1U4LA 1CA6A 3P7JA 4IUQA 5EQ0A 1Q3LA 3D6WA 1WTWA 1DZ1A 2B2VA 2Q8TA 5CBAE 1B2TA 1B53A 4O42A 2M2LA 1F9PA 1KNAA 1X3PA 2CVRA 2X6LA 1PFNA 4HSVA 1ILPA 1DOLA 2EE1A 2K28A 2R3ZA 1LV9A 2EPBA 2BDNA 2RVLA 1B50A 2SDFA 2DY8A 4RAUC 1IKMA 1ZXTA 1WTPA 5EPKA 1HHVA 1ICWA 2B2TA 4NW2A 5CMDA 2L1BA 1G2SA 1HFNA 1WTVA 1O7YA 2K03A 2K05A 1ML0D 1AZPA 3F2UA 1RJTA 2MPMA 1KNEA 2L4NA 3DEOA 4DN4M 2Q8RE 4IUVA 1M8AA 4HEDA 1NCVA 4IURA 1E0BA 4R9WA 4XDXA 1RODA 2L11A 5E4WC 5DNFA 2HDMA 1HFGA 5JJZA 2L12A 3H91A 1F9SA 3IFDA 4R8IA 1WTXA 2IL8A 2KEDA 2KECA 2KUMA 5EPJA 4HAEA 1AP0A 2B2YC 4CJ1B 2RA4A 4XT1B 2B2UC 3SVMA 2VXWA 2H1EA 3I8ZA 1WD0A 4RA8A 2X6GA 1SDFA 1JICA 1O80A 5CBEE 4IUPA 1G91A 4CJ0B 1RTNA 1EIGA 2RSOA 1HUNA 3HP3A 3GV6A
chains in the Genus database with same CATH superfamily
1VQJA 4N8X1 2WACA 2MFIA 1L1OC 3FVQA 3KBXA 2G9HD 3M4OH 1JMCA 3QWNA 4RGTA 4UY8C 4MN3A 4EX5A 2JA5B 4IUTA 4JI8L 3KJOA 1JWSD 3M3YH 3J80L 4L8JA 4JBKA 1YNXA 2SOBA 5H1SE 3EA6A 3I4LA 4XT3B 4DR1L 3NWSA 2O2LD 1SNQA 2UXCL 5EBDA 4YY3Q 5C44G 4J6HA 1VQNA 3X3MA 1FYCA 4K8IA 1E2WA 3TP7A 4B3TQ 4BA2I 1HNXQ 4H13C 4QIWE 1PYWD 4BS9A 4NXMQ 2D0PA 3CKIB 4EQPA 3U4VA 2K5VA 1VQ5A 2GVBA 4HIOA 4K0KQ 4RWSC 1YJ9A 4XQQA 3UDGA 1S5BD 2A6HC 3U9OA 3N52A 1EL0A 1BQQT 1QZGA 4I65A 4KD4A 3T53B 1F2YA 1GUOA 2K7VA 2KHJA 4A93H 2KEEA 1FVIA 2LFNA 1BXTA 1PDQA 1VQIA 4A3IH 4GN3B 2F0FA 2R7ZB 3J81j 4BXXG 3VYUA 2K4KA 1X9NA 2NYZD 5J39A 1CM9A 2BE5D 4HMIA 2K01A 3NBIA 4UPAA 3ULPA 1VMCA 5IT9L 5IP7G 4QGUA 2D5DA 4YHHQ 4HCEA 4ALPA 4JI3L 1PYBA 3ERSX 1K3BC 4FXDA 2Q8TA 3SEBA 4XTCS 2OTJA 3E5SA 4GOPC 1CTMA 4FXGC 4A3DB 3LWUA 2XN9C 4DAYB 1D8LA 3H94A 3CMAA 1ONLA 4DR6L 2B8GA 2R7FA 2RBMA 2YTXA 1E1OA 3W1GA 2ZJPA 3HEJA 4ULLA 2NVYB 4K5XA 3TBIB 3BYTB 4QQBX 1FD7D 4DN4M 1E22A 3HZXA 2B63H 3RR5A 1I5FA 3E0JA 3H3VH 1UUPA 5AJ3L 3GDEA 3OYYA 3G6EA 1M90C 4POGA 4DV1L 4CDEC 1CQFA 4O2DA 2C35B 1EY7A 2VW9A 3KDFB 3I2ZA 3VDYA 3JAML 4B3SQ 2R93G 4ZK9B 3F2CA 3Q24A 5EJWA 4CKEA 1JB7A 4L5SA 1Y14B 1QB5D 4P2CB 1Y1WG 3M3YB 3K0YA 2XTIA 3HRZC 1IL2A 1PH8A 4A3GH 2MP1A 3KYHC 2PNHA 1PXUA 4FXKC 3S1RH 4BY1G 1KABA 5JAVA 1SNCA 4X3TA 1SYGA 5IYBH 5JJKA 2IX3A 5I2YA 5DEHA 1A0IA 3RZOH 3S2HH 1J8IA 2EVBA 5I6WA 1STBA 3FMCA 1VQ8A 1GHKA 1AW7A 4LF7Q 5E4XA 4JI4Q 3A5UA 3H0GG 5GADC 5IYDH 1I6VC 2B2WC 2L15A 1YNJD 2PZTA 4A93B 2IT1A 1G6ZA 5C4HA 3RN5A 1DYQA 1TS3A 1XX8A 2WFWA 3PF4A 3CCVA 4A3IB 1CZGA 1F2ZA 3C1EA 1R9TH 3GTMH 1PZJD 1EY6A 2EYFA 1A8VA 2NTSA 4PNYA 1PFBA 5HY6A 4ZUIA 2F0VA 3PSIA 3CHBD 3HOWH 4B3TL 1HNXL 5K36G 4NXML 2PI2E 2EDGA 1VQPA 1Q3LA 3D6WA 2N78A 1WTWA 5LMNQ 1DXMA 1EY8A 2WAQE 4O42A 2L55A 2XGTA 4HSVA 3EIVA 2F4VQ 1EFWA 1B3QA 2EPBA 4EQOA 4DFAA 5IYCG 2NN6G 3BVMA 4C1NI 2F4IA 3U4ZA 2K03A 2B63B 2G9DA 4IUVA 2PQAA 4KHZA 1G8ZD 1MD2D 2EY5A 3S15B 2JK8A 2RHSB 4DR2Q 3K80C 4JC0A 4GNXC 1TS4A 1SR3A 3NEMA 1Q86C 5C4XH 1HCZA 1VQ4A 2OT2A 3NXWA 3MFGA 1G91A 3LGJA 1FNWA 1UWVA 1JE4A 1VF5C 3I56A 3A56A 4A3GB 1AN8A 5LMUQ 4LFCQ 3S1RB 3TRZA 2RSNA 2VUMG 1SE3A 4JI0L 3A7LA 2K04A 1LT4D 4A3CH 4JI5L 1XPOA 1IKLA 4KD3A 1NMFA 3RZOB 3S2HB 2CH4W 4A3MH 3T1YQ 5IODA 4KKTA 1NR2A 2TMPA 1NR4A 3G7LA 3UI2A 3K57A 3PO3H 2ENBA 1U9RA 5CV5A 4TRDA 1B9MA 4L6TB 5KYIA 2Q2UA 3AEVA 3S14H 1CHPD 4G7HC 4IOAA 1GUGA 5D14A 2KENA 3TSSA 2HHHQ 2ICIA 1ILQA 1X3QA 1QVGA 3I7FA 1E3PA 2F0HA 3KUPA 1R9TB 5IGEA 1EIYB 3S2DH 1H9MA 2AMCB 1EIFA 1SYEA 3FEWX 2N3SA 1XTDA 4G57A 2B8FA 4H02A 3SR1A 1HQMC 3UDFA 3HOWB 4LF6L 2JA7H 2H5XA 3A8IE 1STHA 3BDLA 4ZQ3A 3QB3A 1AH9A 1KC8C 4P71A 1A15A 1E2VA 2VQFQ 3L7ZC 4LF7L 2MNAA 4JI4L 3A74A 4ZAIA 4X64L 5JEAG 2B3GA 3J81L 4JG2A 3CPWA 2WB1G 2X6LA 1N36Q 4A3BH 2K28A 5C3EH 1Q81C 3HOZH 2EIFA 2K5QA 4ILWA 2AWNA 1XNQL 1JQYD 1V1PB 1A62A 1ICWA 4A3KH 1SMXA 4GN5A 3V2TA 3HOUG 2IHFA 3TP6A 2NB0A 5M3FH 1MKHA 1LO5D 5BN3A 3DEOA 3SDZA 2Q8RE 1K83H 3NPPA 4IURA 4QL5A 2DJGC 1LTRD 4HJ9A 3H3VI 4DAPA 3HOVB 4OO1G 5BN5A 5C4XB 3PUYA 3H91A 4KY7A 2O4XA 5CV6A 2F0LA 1RKNA 5LMNL 1CZWA 1QNUA 2JA6G 1SN8A 2JJQA 2X6GA 2F4VL 1A3UA 2IWHA 3GTOH 2IJ0A 2MUYA 4NPSA 3K7AH 2BDOA 2DNEA 2A1AA 3CCMA 2YU9H 3VA5A 2F0TA 3R2IA 1FL0A 1S5CD 3QR8A 1RDPD 4Y52H 2B2WA 1S3OA 1E1TA 3LNNA 3UE1A 4A3MB 1Q7YC 5DAUA 4DV3L 2PQEA 1MSHA 4C3HB 4CKCA 1IYUA 1VQKA 3PO3B 2EYOA 4DR2L 5D3IB 1R4PB 3BZCA 3ONAB 2A69D 2WKCA 3S14B 1NMGA 5JJLA 3PO2G 1RTOA 4MHEA 3J80E 4FF1A 3I4OA 1CK1A 2L9HA 2K32A 4DPGA 3MXNA 3I4MH 3PGZA 3RZDH 5LMUL 3K0XA 1SE2A 1K8OA 1XTCD 4LFCL 1PTOC 2QEXA 1I50H 1QCBD 4MIUA 3S2DB 1W6KA 3I91A 2JN4A 2H4OA 3EN2A 5J3BA 1HXYD 4BY7G 2JA7B 5G3LD 4LMQD 2MGSA 3T1YL 3OHXC 3LWEA 5IE8A 2KJXA 1PYSB 3J7A5 1RF2D 3K5LA 4I7ZC 3C2PA 4G4KA 3E9IA 1ASZA 1IYVA 4QJFA 1Z9FA 2ZJRA 1O7ZA 3TREA 4DR4L 4GNXA 2IHEA 3GTJH 1BBUA 4L63B 1U4LA 1EYCA 3Q23A 2VZAA 1ZKOA 2ZTEA 5C3EB 4A3BB 3CCQA 3HOZB 1B53A 3KDFA 1GKHA 2IX0A 2K50A 2R92B 1B44D 3JC66 4A3KB 4DKAC 5FK9C 1KL9A 5FJ8G 5M3FB 1F2MA 1K83B 2ALYB 2L1BA 1N34Q 3TP5A 5IP9G 4ZUJA 3I70A 4PG3A 1AEXA 3CP0A 1IBMQ 2EYJA 4NXNQ 3IFDA 1X6OA 3H09A 4LF4L 2D0OA 4JYAL 1W3SA 3GTOB 4F88A 2NTTA 1XJVA 1QWYA 2YU9B 4QY7A 1N36L 1PRTC 2I07B 3W2DA 2K52A 3DWAA 4G7ZC 1XMOL 3PMFA 4JVZA 5T1GA 1KRTA 2K1BA 1WVLA 5C3WA 2EOTA 3PIP3 4A3FH 4EGVA 4R4TA 1EWCA 4IPGA 3MHBA 2UUCL 3CW2C 3FDTA 1MGSA 4IN3A 1V9PA 3JAME 2VY3A 3T1HQ 3QG1A 1YJWA 2ZT9C 4AQYQ 1UE6A 2HIXA 3FPUB 3S1NH 3M4QA 3KK7A 1JOOA 2OWOA 4F87A 3K7UC 1OXVA 3I4MB 5NUCA 1LTGD 3RZDB 4DR5Q 1VQ7A 3STBC 2A68C 2EJMA 5COYA 1XNRQ 4H0LC 2M9VA 1CUKA 3FKIB 1J9OA 1EU4A 2JA5G 4C56C 2F0DA 1TWHB 1HZBA 2FMMA 5D65A 4QF4A 3T16A 3VR5A 1TWGH 2HD3A 4PZ8A 1EIHA 1QOHA 4BBRH 2CWPA 4MZ9A 4U673 2WV6D 4DV7L 1PH1A 2A74C 1WTHA 5I6YA 4LF5L 1Q1EA 2MJ8A 1CKNA 4TSSA 2WAQB 3VA7A 2HQLA 2KCNA 3HFZB 4WFN3 3NUCA 2BH2A 1D2BA 1EQRA 3O13A 1IW7D 4G7OC 1JCKB 1VF7A 2A5HA 4RAUC 3HG9A 2F3IA 2R7ZG 1KAWA 2P5ZX 4JPBW 4LF9Q 2F0UA 2B2TA 1YBYA 4B3RQ 2R7DA 3KJPA 1CQVA 3M9BA 2NZHA 5C0XJ 4AYBG 5JEAJ 4C3JH 4KY5A 2L4NA 1S72A 5EAYA 1RODA 1BUVT 2CQOA 3GQBA 5GAEC 1UEAB 2PO4A 4DGZA 2C9OA 2KUMA 4HAEA 1IHZA 4ODGA 4ZCKA 4A3DG 3MA2B 5CV8A 2CW0C 4RGOS 5CBEE 4IUPA 1YZ6A 3E0EA 3NELA 4RCOA 1NY4A 2HCIA 2UXBQ 4C3IH 4A3FB 1CSPA 3MXUA 1Y8OB 3S17B 2FFKB 4J1MA 2IPKD 1C48A 1NSNS 3AMUA 1A3TA 5CR3A 2EYMA 1SROA 3CC2A 4POFA 1LTSD 1HH2P 4JI7Q 2QDBA 2I5MX 3S1NB 3KBGA 3N6RA 3S1MB 4B3MQ 4JBWA 1TIID 2PW7A 1Y1VG 2FINB 1MSGA 2I5HA 4NXNL 5GQOA 5ELFA 1Q1BA 3CU7A 3K5OA 4R1JA 4CDDC 2PNRC 2I5LX 1L0WA 1FJGQ 1PLFA 1I3QH 4WJWA 1ZYRD 2D62A 2JYOA 4K6LA 1GM5A 1PH4A 2FMCA 1W2BA 1TVXA 3NE5B 1JR0D 4K6DA 4OIKA 4K2KA 1TWGB 2B2YA 1YEZA 1C7YA 4XQJA 3T51B 4BBRB 2HUGA 2L5TA 4GS3A 1OTCA 4AQYL 2ID0A 1X32A 2XSCA 1S5FD 5E7NA 4LFAQ 2K75A 4YWMA 1BBXC 1EY5A 1DONA 1WCMH 4LUVA 1A63A 4HCSA 1K8GA 4FYDA 4DR5L 2RDGA 4MTKA 1SNMA 2N55A 1PH6A 1XNRL 1X3FA 2F0MA 4RHSA 2V4DA 3M7GA 4A93G 1VQCA 1BKBA 1D5MC 3S9WA 2BA1A 2M2LA 1LTLA 4OWXB 5J1ZA 1PMRA 2A6ED 2LKVA 1X65A 2JQOA 2XWBB 4AH6A 4X65Q 1BBWA 1LTAD 2NBFA 2F0OA 4DV4Q 1TWFH 2CFMA 4IFDJ 5FLMG 1EQQA 1MIUA 3J81E 2GN5A 5FLXE 4M1UB 4C3JB 2B39A 3GTKH 4BBSG 1KNEA 5M3MH 3OMCA 2K5NA 4L5QA 3KF6B 2PMZE 1DGSA 5BR8Q 1PZKD 5JOBA 3SK4A 3QOJA 4RMFA 1I4QA 3I8ZA 1QVFA 2ZJQA 4C3IB 3J80c 4WRDA 5GROA 3ND8A 3P75A 3GV6A 5ELDA 3MFYA 3F2BA 4ZKCB 1IBLL 1IXRA 3K59A 2B63G 4BXXH 3J80i 1J6QA 5GAHC 1SNOA 1YHAA 5IP7H 2ZXOA 1XMQQ 2RDFA 1X56A 1TWCH 4O0AA 4APVA 3C1FA 1YI2A 2N88A 1U4MA 1GJXA 3ZJYC 1I3QB 1FNUA 1Z7TA 2GA4B 3M4OB 4A3GG 1BCPF 3A0JA 2J0TD 1Q90A 1SYDA 5IY0A 2BH8A 5DM63 1Q8IA 1LTTD 5M5WH 2ES2A 5G3LF 5IYBG 4HIDA 1G2TA 1EOTA 1ET9A 1OXSC 1SNPA 1STAA 4NMZA 4DV5Q 3BG3A 1TS5A 2ASBA 1HTPA 2QEJC 5CC4A 3CRLC 4B3ML 2PZUA 1KQSA 1QJOA 5C6AA 2ZM6Q 1HR0L 4KJOA 3KFUA 4DUYQ 4ABNA 3M85A 4RKLA 5IYDG 1KDAA 1FJGL 1L2FA 4OWWB 4HIMA 3EJIA 1Y8PB 3M4YA 1IZ6A 1GOZA 3MXGA 3Q0AA 1Y1WH 5EQ0A 1E2ZA 3WOEA 2B2VA 5CBAE 2LXJA 1TWFB 2CVRA 4LNQA 2WINB 2OQ0A 2EE1A 1H9RA 2BDNA 4JOIA 2OXPA 4DNRB 3NTHA 5IGDA 3HOWG 3J7ZC 5C5LA 2Z0SA 3GTKB 1LT5D 4YY3L 5M3MB 1HFNA 3MAQA 1O7YA 1Y69U 2CWAA 3NENA 2DUDA 2Y0SB 1PHJA 2UU9Q 1E24A 4A3EG 3JAMc 3URYA 5JJZA 1K0SA 3H0GH 1F9SA 4K0KL 1J5EQ 4RG1A 3S1QH 3ICEA 3BS1A 1WFQA 3JAMi 1FNVA 1WI5A 2Z8LA 3EBEA 4KLKA 1VQEA 1M4VA 3T4AC 4P72A 4X65L 3H6MA 3HP3A 2K33A 3CC7A 3CCSA 4DV4L 5FOBB 2HQEA 1DM0B 1ZEQX 3A55A 2HCCA 3TS0A 4H44C 1TWCB 1SBBB 1NTGA 1NAPA 5KNDA 4CDCC 1Z47A 1AE2A 4C1NK 3HOVG 1QVCA 5C4XG 2L0CA 4X62Q 5D3DA 4YHHL 2LMCB 3B6YA 5IOCA 3BYYB 5BR8L 3K58A 4LF8Q 1LUZA 2UUBQ 4ME5A 2Z9HA 1U4RA 3QOLA 1LACA 3OTOQ 5M5WB 4A3CG 2M00A 1A2UA 2NN6H 1B7YB 2UXDQ 3G48A 4KY6A 1FR3A 3S24A 4A3JH 2BA0A 4A3MG 4F7XA 2F0WA 3UE0A 4C3HG 3P20A 3CXCA 4O1NA 3RLNA 3PO3G 1GUWA 1H9JA 3MXPA 3GV3A 4CGYB 1DOKA 1XMQL 1F77A 4M8AA 4RGMA 1SE4A 5GAGC 5LHY1 1GHJA 1H9SA 2BE5C 4IJHA 1AZQA 3D6CA 1X54A 4PZ7A 1ICFB 2E5LQ 3J7AF 4B3SL 1B1ZA 3PIO3 1RHPA 1TT2A 4RKBA 1VQHA 3P7JA 4PMWA 4XYQA 2MO0A 1DZ1A 2ZTCA 4FF4A 2PCFB 2YYZA 3U50C 4J8QA 4PMBA 4LJZC 2VQEQ 2JA7G 3D8GA 2OQKA 3GTMB 1A3VA 4YIJA 2O5JC 2R6GA 2BCOA 2SDFA 1PV4A 3LX0A 4PV1C 3W3AA 1PH5A 2NUCA 5EPKA 1HHVA 4FDBA 1X3GA 2A8VA 3D4WA 1AZPA 4DU9A 1HNWQ 4L5RC 5BN4A 3H0GB 1VQ6A 2A73B 4A3BG 5C3EG 5E4WC 4DV0Q 1KDCA 1HFGA 3HOZG 1Q46A 3I73A 1I6HH 1Z6HA 5EPJA 4OONA 1AP0A 2LSSA 3KLRA 3VR4A 3G71A 2R92G 2H1EA 1DCZA 4CHTB 4A3KG 1EYDA 1EEFD 1JICA 2Q2TA 2O5IC 1SMYD 1EY0A 2WKDA 2RSOA 5M3FG 3HOYH 3FHWA 4OHJA 1C9OA 1LT3D 1SSOA 2KOLA 3H3VC 3STBD 1N9WA 1D5XC 3KF8B 4P74A 1MJEA 1ET6A 1EYAA 1A2TA 5EKIA 3OSOA 1K8MA 3TQYA 4CBVA 5C0XH 3CCJA 3CCRA 2NZOA 5JEAH 5JJIA 1N33Q 1XWEA 4KN4C 3ZYYX 1CA5A 2EXZA 4X66Q 1KDBA 2QKIC 4KKSA 2KVMA 4HIKA 2E75C 3KOJA 1OO9B 3Q6SA 3IL8A 4A3JB 3TMEA 4A75A 1NE3A 4JI6Q 4JV5Q 2B2TC 3HOUH 1Y8NB 2Z6KC 4QMGA 5KRUA 1GD7A 3NTIA 5IWAQ 4AYBE 1YNJC 1HA5A 3DMUA 1AFPA 2VL6A 2QCPX 4KHVA 1BF4A 1LT6D 4OO1H 3PUVA 3SK8A 4X62L 5KGUA 3TZUA 1B8AA 5ELOA 3SK5A 3NQIA 4DV2Q 4GLXA 3OW7A 4QIWB 3J81c 5FLXc 3I4MG 3KF6A 2QW7A 2UUBL 1NJIC 4UP8A 4DAMA 4N9TA 3OTOL 3HKZE 2YTVA 1KHIA 3FKIG 3J81i 1KLUD 1VQBA 2KA7A 4A4IA 4FNFA 3DHQA 1RIPA 2XVSA 4K14A 4DAYA 2EY1A 1SJHD 3ITPA 3ULJA 1ILPA 3OIPA 3NTKA 1B50A 2JA8H 1WTPA 1JE5A 3BZDB 1LM0A 4V190 1BDOA 1T5XD 4NW2A 5JVH3 4I7AA 4RHRA 3F2UA 2CCZA 4ME3A 3SXHA 2E5LL 1JOQA 1K3RA 2HHHL 5CV7A 2HDMA 1R4QB 2IL8A 4JI2Q 4OXPA 1QUQB 3AYHB 2B2YC 1H95A 2VXWA 2VQEL 3HOYB 3MZ5A 5M5YH 5IT9E 4BY7H 1EZ8A 1HUNA 1I4GA 1UE5A 1XPUA 1CKMA 3CQZH 1ESRA 4GZYC 4B9WA 1OXUA 2FHTA 1L0YB 1HUMA 4IFDH 4Y7NH 2VB3X 3MWYW 4IJLA 2VQFL 3M4PA 5C4JH 3X3NA 4FO2A 4DR7Q 5M5XH 2QF7A 4R4IA 3K7AB 1HQRD 2NVXH 1JWUD 2DNCA 4A3FG 4IQZA 1L0XB 3AFPA 2XWJB 4L5TA 1LYLA 1BR9A 1V1OA 2NVQH 3HOXH 2F0JA 2NVTH 3HGBA 2B2UA 1XPRA 2RKSA 2A6HD 5ELNA 1BNZA 5K5PA 4DK0A 1JJGA 1B3AA 2KBNA 2JP1A 3HKSA 3GTQH 2K5HA 3U58A 1N33L 1YNNC 3HS0C 5KNBA 2AWOA 1PA6A 1DJRD 3CCLA 4PQXA 1I50B 3NHHA 1CHQD 4JI8Q 3FPPA 1B9NA 4HMJA 3EROA 1PH7A 2IY5B 3T13A 4JV5L 2KCCA 4ZYSA 5TSSA 2UXCQ 4BBRG 1KNAA 3OPOA 2JA8B 4RFBA 1E7ZA 1ESFA 5C4ZA 4DAVA 1SNDA 1HNZQ 3I55A 3A8JE 3OWEB 2QA4A 4K5VA 3GTJB 1L1OB 1GUTA 4IALA 2PW5A 4GN4B 4KJNA 4XDXA 3AQQA 2RCFA 3NBHB 2JA5H 2LS01 5M5YB 2PQAB 3TEHB 4BY7B 2F52A 5CGKA 1JC7A 2N49A 1T5EA 3CQZB 1I4PA 4HTHA 5A2QL 1PVOA 5F2DA 1JJCB 4C3JG 2E2JH 4QB4A 2Z6KA 4CKBA 1YVCA 4Y7NB 3CD6A 1CI3M 2OEOA 1UE7A 3CCEA 5EBCA 3DEPA 1D5ZC 5JPNC 5M9OA 1SEBD 3K6OA 5C4JB 2V1CC 3GTGH 5KNCA 5C0XI 5M5XB 2CKZB 2A69C 2NVXB 4HSPA 1X3EA 1HR0W 2B2VC 2YV5A 4JI2L 4C3IG 4DK1A 2F0PA 4RH6A 4JOIC 3D0FA 4ZRZA 4X3UA 4A3LH 2NWGA 2NVQB 3HOXB 2NVTB 1NUCA 3PUWA 1TWAH 4YCWA 1BCPC 3K81C 5FO7B 1JORA 1N34L 5AJ3Q 3FRPB 4DXGA 3AB9A 3RLOA 1M1KC 1K28A 3C3LA 4DV1Q 4UHVA 5CORA 2E2HH 3TS2A 4CDFC 3S16H 1IBML 3GTQB 1WOCA 4OO1I 4K5WA 5KIXA 2EZVA 1NNXA 2AQ1B 4GOPB 3TP8A 3I4NH 2F0IA 3UDXA 4IO9A 1MBYA 2LXKA 3AU7A 1GUSA 5C3XA 1D7QA 2XIWA 2F0QA 1QG7A 4OL7A 5L37A 1MI2A 1MHWC 3VR2A 4B9XA 2ATWA 3VYRA 4DR3Q 5DM73 1YIJA 1SYBA 3ERQA 1F9PA 1V1PA 1PFNA 1DOLA 4HR7B 3T1HL 4NB3A 1TKWB 1Y1VH 2XRSD 4LUZA 1S40A 3L2PA 5JVG3 1UNSA 3D3RA 1ENAA 4Z9CB 1P16A 5C5MA 2ZXPA 3QIAA 1TY2A 1ML0D 2UUAQ 1RJTA 1VQGA 5E1FA 1EOVA 4HEDA 3D4RA 4NP5A 4EVOA 2SNMA 1O78A 3A5ZB 2E2IH 3SVMA 3W5OA 3IAYA 3BU2A 4A3IG 1WD0A 2E2JB 4DV6Q 3GTLH 1K0RA 3D31A 5M3MG 3KLSX 4N8FA 4R4OA 5C44H 4TVAB 1HNZL 3IKJA 1PH2A 4IFDI 3GTGB 2EXDA 2Y0SG 3F2DA 1QE6A 1AE3A 4NDXA 4YWKA 4EQNA 2PYKA 3OOCA 3RMHA 5ELBA 2E76C 3OWFA 4ZKBB 1CSQA 4JCVE 4DNIA 2VNUD 3DWPA 4X3KA 1TWAB 3ND9A 4OIJA 2JSOA 1EY9A 5FLMH 1RCVD 4AYBB 4LF9L 4JBMA 4MTNA 2E2HB 4B3RL 3S16B 3I90A 4BBSH 2QILA 4CJ2C 3TDQA 3MXNB 2KCMA 4KHPQ 3I4NB 1C0AA 1G291 4U68A 2F3VA 2WB1E 2KQ3A 3CMEA 3EFXD 3RN2A 5LL6S 1U5KA 3HKZB 4JI0Q 4ID6A 1YHBA 1II3A 3QO2A 4JI5Q 1QILA 2UXBL 2A19A 1QUQA 2JEAI 5FKAC 3BDCA 5I2XA 1U0LA 2Q2IA 1B2TA 4WORA 3S15H 1CFMA 1TXYA 2F0GA 3PIOA 4GNXB 1Y1VB 1IW7C 4JI7L 1SFOH 5IT9c 4XYOA 3DWQA 2WIIB 1JWMD 1WCMB 1ASYA 1TS2A 5HGQA 4NKLA 1QZHA 1G2SA 2RDHA 3I72A 1GO3E 3UDIA 1KIXA 2HT1A 2R93H 4KK7A 1IYJB 2E2IB 1CT1D 5FO9B 3NP8A 3VR6A 3WWVA 3J7AV 4DR3L 2SEBD 5LMNW 2EY6A 3GTLB 4A76A 4CJ1B 4LF6Q 4XT1B 4BY1H 4OX9Q 2HIVA 5IGFA 5C44B 1BOSA 1KTKA 1S5DD 1U4PA 4IOCA 4LFAL 3RNUA 3BJUA 4X64Q 2WP8J 4LK1C 1K9MC 2UUAL 1LTID 1F9QA 4XQNA 1G51A 4YWLA 1DD2A 1SYCA 3DXJC 2PZWA 5T1IA 2BOSA 1XNQQ 1PTOH 2F0NA 4WJ3M 1C4QA 5HGTA 5AFWA 1SJED 3M7NA 4IUNA 3CF5A 4YCVA 1UAPA 4DV6L 1ZYRC 4PMCA 1H9KA 1SE8A 1EEID 4XIGS 3TZDA 1WTQA 3F8TA 2F3WA 4C2MH 4BBSB 1PFMA 4HJAA 3PUXA 1EZ6A 1IBKQ 1VS0A 1PTOD 2N8NA 4LWCA 3EQLC 5K36H 1VDZA 2AUKA 4PZ6A 4AIMA 4A3EH 5CYUA 1VQ9A 2CH4A 1QNKA 4LFBQ 2PI2A 1EU3A 1L1OA 3CRKC 3TN2A 5CV4A 1PH3A 5IGCA 4A3JG 3QJYA 3SK6A 1V8QA 4IPCA 4DF7A 3NBHA 4KKUA 5IYCH 4DV3Q 1WTOA 1GXDC 4JK1C 1CKOA 2HDLA 3VYTA 1VQDA 4FF3A 1CA6A 1V43A 3K5NA 1SFOB 1GUNA 2A6EC 4IPDA 1CKNB 3HOVH 2FXQA 4KHPL 1HJPA 2JA9A 2R3ZA 4OEMB 2B29A 1STEA 4P73A 2JXMB 2LY7A 4Q5VA 3RLFA 2YTYA 5CMDA 3L9AX 2R93B 5I9OA 2MPMA 4GKKQ 4KI0A 1Y1WB 3A8KE 4TQUS 1LLRD 1E0BA 2VUMH 1JJ2A 4BY1B 1K73C 4F8MA 5DNFA 4R8IA 4X6AH 2F0KA 2KECA 4C3HH 3CCUA 2B2UC 3ER0A 3NK9A 3L3OC 4DV5L 1NBWA 1OXTA 1LTBD 3AFQA 5JPMC 1RTNA 1PRTD 3KLWA 2F0SA 3IFTA 4DK3C 1I4HA 2AQ2B 4R8NA 1MJCA 2ZM6L 4DR4Q 2X69A 5IGGA 2TSSA 1HRJA 3E6ZX 4DUYL 1EFID 3F1ZA 3KLSA 4RGNA 2EY2A 5A2QE 4GOPA 3PUZA 4KTAA 2ICEC 1PTOB 3U9SA 3S1QB 2F1MA 1XXGA 1K8AC 2RQXA 2RF4A 3HOYG 3GP7A 3G4SA 4OX9L 2FJ2A 1YNND 4C2MB 2PPBC 1HA6A 4JI1Q 3I3CA 2NZ1D 4V0BA 3MEHA 2A68D 1KXLA 3WDNA 5C0XG 2D9UA 4LF4Q 4UP7A 4A3EB 3EVQA 4JYAQ 2J7ZA 5EPLA 5FLXL 3PIPA 1EWHA 4HJ8A 2UU9L 3VYSA 3ULLA 3RUZA 4BA1I 1XMOQ 2EJFC 2F0EA 3NSWA 3R3OA 1J5EL 1SAPA 1WTRA 2MQHA 2R92H 1PZID 4QCLA 2KCTA 5FO8B 3RD4A 1N32Q 1ENFA 3IRBA 2UUCQ 4DXFA 4LW1A 3OMGA 4DA2A 1YHQA 2AHOB 4B08A 3K5MA 4GKJQ 4JBJA 5IIFA 1TR5A 1IBKL 3E9HA 1N8RC 1X3PA 4N9PA 4K2LA 5IGBA 1T9HA 3PF5A 1FGUA 2RHQB 2DY8A 2KHIA 3SGIA 2EJGC 4OGQC 4LFBL 1PRTB 3A7AB 2JA6H 4LF8L 3PV0A 1HZAA 3CAMA 1BVSA 2C5CA 4MNOA 2E74C 1D1KA 1KLGD 5KYLA 1Q12A 3GTPH 2VUMB 1M8AA 2DJFC 1STGA 4FP5D 2UXDL 5ELCA 2K6AA 1I4XA 3OW2A 3MVVA 3Q22A 2JA8G 2DN8A 4DV7Q 4P75A 2ZTDA 1O80A 4CJ0B 2CW0D 2JE6I 3DM3A 2IW3A 2R61A 4LF5Q 4OWTB 5EGTA 4X3SA 3J7YW 2OCEA 3PO2H 4GLVB 4J15A 4EQ5A 2EYPA 1BCPD 2PMZB 4GKKL 1I6HB 4TKOB 1KAAA 2WAQG 3FKIH 3BZKA 4QUCA 1TWHH 1B70B 1VMPA 5I4DA 2Z4IA 2EYHA 1JB3A 2G5DA 2K5DA 2F03A 4DUZQ 5ELEA 3MEFA 3K8AA 1HZCA 1F9RA 5I9PA 1FGBD 1GVPA 4IFDG 1EWIA 1XYIA 1EQTA 2I46A 1TU2B 3P1HA 1B4OA 4LAAA 3R8BA 1EUJA 1HNWL 1Q8KA 1I94Q 1G6PA 1BO0A 2WB1B 4XXEA 3C46A 4DV0L 1VQAA 1I4RA 3DM1A 4IPHA 4ZLTF 1A6XA 4K8JA 2Z4HA 1SYFA 3DLLA 5E3FA 1F2LA 3NWTA 5EKLA 1VQLA 3HOUB 3HOXG 5ISRA 1WYDA 5FJ8H 4OELB 2K5WA 4JI1L 3T56B 2NN6I 1RL2A 4YCUA 1EYGA 5CV9A 4WJ4A 1YJNA 4UP9A 4FF2A 5IP9H 2Y0SE 1D1IA 1O7IA 3E3XA 2J4XA 3A54A 1LV9A 1SRUA 2JA6B 1HPCA 1ZXTA 1VQOA 3W1BA 3GTPB 4X66L 3H15A 2Q8IB 2KHSA 2Z6BA 1WTVA 2MHVA 2Q2HA 2K05A 1N32L 3S17H 1NCVA 1BCPB 4UDUC 4R9WA 4RCNA 4DR1Q 2L11A 4JI6L 5DLQE 4GKJL 2L12A 4HN7A 2XRQD 5IWAL 2RCNA 1UEBA 2EQSA 2KEDA 3PCOB 1WTXA 3BDOA 2K14A 1P8LA 1STNA 2QDLA 3L0OA 2D2CC 4GLAC 4RA8A 3S1MH 1SMYC 2SNSA 1SDFA 4S3SA 3DUZA 3PO2B 2OF1A 2AUJD 4DV2L 1ENCA 1UE1A 1TQOA 1SLJA 3MC0B 4QUFA 1VQMA 4BWGB 3MTSA 2ZXRA 1DOMA 4HJ5A 4KMUC 1KRSA 1IL8A 5KEEA 3V96A 3OIQA 1V1QA 4IZ8A 1WJJA 4R4CA 2DGYA 4JW0A 3VR3A 3G6JB 2DY7A 1YITA 1EY4A 3FP9A 3SE0A 5A35A 2QGQA 3R2TA 2VS1A 1PTOF 1O7LA 2CQAA 1HTLD 2EYLA 4JI3Q 5EKKA 3R93A 4DNTB 5LL6X 3PQIA 2XNAC 2IX1A 2CHBD 4H7BA 1KD1C 1VQFA 1S4ZA 4UAIA 1D6EC 4HJ7A 1VCIA 3GD7A 4DK6C 4DR6Q 1HZ9A 4A3LG 1IBLQ 2VB2X 1C8CA 1X55A 4DUZL 4IUUA 1WD1A 4LUOA 2AKWB 1PH9A 1JOKA 1JT8A 2R7ZH 3SHLA 4FVMA 1PFSA 4Q0FA 1H9SB 4IUQA 1STYA 3D4DA 1W6JA 1SXTA 3I4NG 3CPFA 3NQTA 4KV6A 1I94L 2RVLA 1LABA 1IKMA 1S5ED 4DR7L 4A3DH 2GVAA 2E2DC 3BVZA 3HKZG 4E6IA 4R4QA 1Q82C 3WOFA 1TY0A 2AQ3B 5HURA 4KN7C 2NVYH 2Z1CA 5J22A 2OTLA 2JEBI 1RD9D 1PRTF 2E8GA 1EQVA 2I0QA 1HR0Q 2RA4A 3Q8DA 1OXXK 3CC4A 1WCMG 3V05A 1EIGA 3GO5A 3BVGA 3KF8A 2MO1A
chains in the Genus database with same CATH topology
2WACA 3KBXA 3FVQA 2G9HD 3QWNA 4RGTA 4MN3A 2JA5B 4IUTA 1JWSD 3J80L 4L8JA 2SOBA 3EA6A 3I4LA 4XT3B 3NWSA 2O2LD 1SNQA 5EBDA 4J6HA 3X3MA 1FYCA 4K8IA 1E2WA 3TP7A 4BA2I 4H13C 1PYWD 4BS9A 3CKIB 4EQPA 4RWSC 4XQQA 1S5BD 2A6HC 3U9OA 3N52A 1EL0A 1BQQT 4I65A 4KD4A 3T53B 1F2YA 1GUOA 2K7VA 2KEEA 2LFNA 1BXTA 1PDQA 2F0FA 2R7ZB 3VYUA 2NYZD 5J39A 1CM9A 2BE5D 4HMIA 2K01A 3NBIA 1VMCA 5IT9L 2D5DA 4HCEA 4FXDA 2Q8TA 3SEBA 4XTCS 3E5SA 1CTMA 4FXGC 4A3DB 3LWUA 2XN9C 3H94A 1ONLA 2B8GA 2RBMA 3HEJA 4ULLA 2NVYB 4K5XA 3TBIB 3BYTB 1FD7D 4DN4M 3HZXA 3E0JA 1UUPA 1CQFA 1EY7A 3JAML 4ZK9B 3Q24A 5EJWA 4CKEA 1QB5D 4P2CB 3M3YB 3K0YA 3HRZC 2MP1A 1PXUA 4FXKC 1KABA 5JAVA 1SNCA 4X3TA 1SYGA 2IX3A 5I2YA 5DEHA 1J8IA 2EVBA 5I6WA 1STBA 3FMCA 1GHKA 1AW7A 5E4XA 1I6VC 2B2WC 1YNJD 2PZTA 4A93B 2IT1A 1G6ZA 5C4HA 1DYQA 1TS3A 1XX8A 4A3IB 1CZGA 1F2ZA 3C1EA 1PZJD 1EY6A 2EYFA 2NTSA 4PNYA 1PFBA 4ZUIA 2F0VA 3CHBD 5K36G 2EDGA 1Q3LA 3D6WA 1WTWA 1DXMA 1EY8A 4O42A 2L55A 4HSVA 2EPBA 4EQOA 4DFAA 2NN6G 3BVMA 4C1NI 2F4IA 2K03A 2B63B 2G9DA 4IUVA 4KHZA 1G8ZD 1MD2D 2EY5A 3S15B 1TS4A 1HCZA 2OT2A 3NXWA 3MFGA 1G91A 1FNWA 1JE4A 1VF5C 3A56A 4A3GB 1AN8A 3S1RB 2RSNA 1SE3A 3A7LA 2K04A 1LT4D 1IKLA 4KD3A 3RZOB 3S2HB 5IODA 4KKTA 1NR2A 2TMPA 1NR4A 3G7LA 3UI2A 3K57A 2ENBA 1U9RA 5CV5A 4TRDA 1B9MA 4L6TB 5KYIA 1CHPD 4G7HC 1GUGA 5D14A 3TSSA 2ICIA 1ILQA 1X3QA 2F0HA 3KUPA 1R9TB 5IGEA 1H9MA 1SYEA 3FEWX 4G57A 2B8FA 3SR1A 1HQMC 3HOWB 3A8IE 1STHA 3BDLA 4ZQ3A 3QB3A 1A15A 1E2VA 3L7ZC 4ZAIA 5JEAG 3J81L 2X6LA 2K28A 2K5QA 4ILWA 2AWNA 1JQYD 1V1PB 1ICWA 3V2TA 3TP6A 2NB0A 1LO5D 5BN3A 3DEOA 3SDZA 2Q8RE 3NPPA 4IURA 1LTRD 4OO1G 4DAPA 3HOVB 5BN5A 5C4XB 3PUYA 3H91A 4KY7A 2O4XA 5CV6A 2F0LA 1RKNA 1CZWA 1QNUA 2X6GA 1A3UA 2IWHA 2IJ0A 2MUYA 2BDOA 2DNEA 3VA5A 2F0TA 3R2IA 1S5CD 1RDPD 2B2WA 3LNNA 4A3MB 5DAUA 2PQEA 4C3HB 1MSHA 4CKCA 1IYUA 3PO3B 2EYOA 5D3IB 1R4PB 3ONAB 2A69D 2WKCA 3S14B 1RTOA 4MHEA 3J80E 4FF1A 1CK1A 2L9HA 2K32A 3MXNA 1K8OA 1SE2A 1XTCD 1PTOC 1QCBD 4MIUA 3S2DB 1W6KA 3I91A 2H4OA 1HXYD 2JA7B 5G3LD 4LMQD 2MGSA 3OHXC 3LWEA 2KJXA 1RF2D 3K5LA 4I7ZC 3C2PA 4G4KA 1IYVA 1O7ZA 4L63B 1U4LA 1EYCA 3Q23A 1ZKOA 5C3EB 4A3BB 3HOZB 1B53A 2IX0A 2R92B 1B44D 4A3KB 5FK9C 5M3FB 1F2MA 1K83B 2L1BA 3TP5A 4ZUJA 3I70A 1AEXA 2EYJA 3IFDA 3H09A 3GTOB 4F88A 2NTTA 2YU9B 1QWYA 1PRTC 2I07B 3W2DA 3DWAA 4G7ZC 3PMFA 5T1GA 2K1BA 1WVLA 5C3WA 2EOTA 3PIP3 4EGVA 1EWCA 3MHBA 3FDTA 1MGSA 4IN3A 3JAME 3QG1A 2ZT9C 3FPUB 3KK7A 1JOOA 4F87A 1OXVA 3I4MB 5NUCA 1LTGD 3RZDB 2A68C 2EJMA 5COYA 4H0LC 2M9VA 3FKIB 1J9OA 1EU4A 4C56C 2F0DA 1TWHB 2FMMA 5D65A 4QF4A 3T16A 3VR5A 1EIHA 1QOHA 4U673 2WV6D 2A74C 5I6YA 1Q1EA 2MJ8A 4TSSA 2WAQB 3VA7A 2KCNA 4WFN3 3NUCA 1D2BA 3O13A 1IW7D 4G7OC 1JCKB 1VF7A 2A5HA 4RAUC 3HG9A 2F0UA 2B2TA 1CQVA 5C0XJ 5JEAJ 4KY5A 2L4NA 1RODA 1BUVT 3GQBA 1UEAB 2PO4A 4DGZA 2C9OA 2KUMA 4HAEA 1IHZA 4ODGA 3MA2B 5CV8A 2CW0C 4RGOS 5CBEE 4IUPA 4RCOA 2HCIA 4A3FB 3MXUA 1Y8OB 3S17B 2FFKB 4J1MA 2IPKD 1C48A 1NSNS 3AMUA 1A3TA 5CR3A 2EYMA 1LTSD 2QDBA 3S1NB 3KBGA 3N6RA 3S1MB 4JBWA 1TIID 2PW7A 2FINB 1MSGA 5ELFA 1Q1BA 3CU7A 3K5OA 2PNRC 1PLFA 4WJWA 1ZYRD 2D62A 2JYOA 4K6LA 2FMCA 1TVXA 3NE5B 1JR0D 4K6DA 4OIKA 4K2KA 1TWGB 2B2YA 4XQJA 3T51B 4BBRB 2HUGA 2L5TA 2ID0A 1X32A 2XSCA 1S5FD 1BBXC 1EY5A 1DONA 4HCSA 4FYDA 2RDGA 1SNMA 2N55A 2F0MA 4RHSA 2V4DA 3M7GA 1D5MC 3S9WA 2BA1A 2M2LA 5J1ZA 1PMRA 2A6ED 2LKVA 2XWBB 1LTAD 2NBFA 2F0OA 4IFDJ 3J81E 5FLXE 4C3JB 4M1UB 2B39A 1KNEA 3OMCA 1PZKD 5JOBA 3SK4A 3QOJA 1I4QA 3I8ZA 4C3IB 4WRDA 3ND8A 3P75A 3GV6A 5ELDA 3MFYA 4ZKCB 3K59A 1SNOA 2ZXOA 2RDFA 3C1FA 2N88A 1U4MA 1GJXA 1I3QB 1FNUA 1Z7TA 2GA4B 3M4OB 1BCPF 2J0TD 1Q90A 1SYDA 5DM63 1Q8IA 1LTTD 5G3LF 1G2TA 1EOTA 1ET9A 1OXSC 1SNPA 1STAA 4NMZA 3BG3A 1TS5A 1HTPA 2QEJC 5CC4A 3CRLC 2PZUA 1QJOA 5C6AA 4KJOA 4ABNA 3M85A 4RKLA 1KDAA 3EJIA 1Y8PB 3M4YA 1GOZA 3MXGA 3Q0AA 5EQ0A 1E2ZA 3WOEA 2B2VA 5CBAE 1TWFB 2CVRA 2WINB 2EE1A 1H9RA 2BDNA 2OXPA 5IGDA 3NTHA 4DNRB 5C5LA 3GTKB 1LT5D 5M3MB 1HFNA 3MAQA 1O7YA 1Y69U 2Y0SB 3URYA 5JJZA 1F9SA 3BS1A 1FNVA 2Z8LA 3T4AC 1M4VA 3H6MA 3HP3A 2K33A 5FOBB 2HQEA 1DM0B 1ZEQX 3A55A 2HCCA 4H44C 1TWCB 1SBBB 1NAPA 5KNDA 1Z47A 4C1NK 2L0CA 5D3DA 2LMCB 5IOCA 3BYYB 3K58A 4ME5A 1U4RA 3QOLA 1LACA 5M5WB 2M00A 1A2UA 2NN6H 4KY6A 1FR3A 2BA0A 4F7XA 2F0WA 4C3HG 3P20A 4O1NA 1GUWA 1H9JA 3MXPA 3GV3A 4CGYB 1DOKA 1F77A 4M8AA 4RGMA 1SE4A 5LHY1 1GHJA 1H9SA 2BE5C 1AZQA 3D6CA 3J7AF 1B1ZA 3PIO3 1RHPA 1TT2A 4RKBA 3P7JA 4PMWA 4XYQA 1DZ1A 4FF4A 2PCFB 2YYZA 4J8QA 4PMBA 4LJZC 3D8GA 3GTMB 1A3VA 4YIJA 2O5JC 2R6GA 2BCOA 2SDFA 3LX0A 4PV1C 3W3AA 2NUCA 5EPKA 1HHVA 3D4WA 1AZPA 4DU9A 5BN4A 3H0GB 2A73B 5E4WC 1KDCA 1HFGA 3I73A 1Z6HA 5EPJA 1AP0A 3KLRA 3VR4A 2H1EA 1DCZA 4CHTB 1EYDA 1EEFD 1JICA 2O5IC 1SMYD 1EY0A 2WKDA 2RSOA 4OHJA 1LT3D 1SSOA 2KOLA 3H3VC 1D5XC 1ET6A 1EYAA 1A2TA 5EKIA 3OSOA 1K8MA 4CBVA 5C0XH 5JEAH 1XWEA 4KN4C 3ZYYX 1CA5A 2EXZA 1KDBA 2QKIC 4KKSA 2KVMA 2E75C 1OO9B 3Q6SA 3IL8A 4A3JB 3TMEA 2B2TC 1Y8NB 4QMGA 5KRUA 3NTIA 1YNJC 1HA5A 3DMUA 1AFPA 2QCPX 4KHVA 1BF4A 1LT6D 4OO1H 3PUVA 3SK8A 5KGUA 3TZUA 3SK5A 3NQIA 3OW7A 4QIWB 4N9TA 1KLUD 2KA7A 4FNFA 3DHQA 2XVSA 4K14A 4DAYA 2EY1A 1SJHD 3ITPA 1ILPA 3OIPA 3NTKA 1B50A 1WTPA 3BZDB 4V190 1BDOA 1T5XD 4NW2A 5JVH3 4RHRA 3F2UA 3SXHA 1JOQA 5CV7A 2HDMA 1R4QB 2IL8A 2B2YC 2VXWA 3HOYB 3MZ5A 5IT9E 1EZ8A 1HUNA 1I4GA 1ESRA 4GZYC 4B9WA 1OXUA 2FHTA 1L0YB 1HUMA 4IFDH 2VB3X 3MWYW 3X3NA 4FO2A 2QF7A 3K7AB 1HQRD 1JWUD 2DNCA 4IQZA 1L0XB 2XWJB 1BR9A 1V1OA 2F0JA 3HGBA 2B2UA 2RKSA 2A6HD 1BNZA 5K5PA 4DK0A 1B3AA 2JP1A 1YNNC 3HS0C 5KNBA 2AWOA 1DJRD 4PQXA 1I50B 3NHHA 1CHQD 3FPPA 1B9NA 4HMJA 3EROA 3T13A 2KCCA 4ZYSA 5TSSA 1KNAA 3OPOA 2JA8B 4RFBA 1ESFA 5C4ZA 4DAVA 1SNDA 3A8JE 3OWEB 4K5VA 3GTJB 1GUTA 4IALA 2PW5A 4KJNA 4XDXA 2LS01 5M5YB 4BY7B 5CGKA 1JC7A 1T5EA 3CQZB 1I4PA 4HTHA 5A2QL 5F2DA 4C3JG 4QB4A 4CKBA 4Y7NB 1CI3M 2OEOA 5EBCA 3DEPA 1D5ZC 5JPNC 5M9OA 1SEBD 3K6OA 5C4JB 5KNCA 5C0XI 5M5XB 2A69C 2NVXB 4HSPA 2B2VC 4C3IG 4DK1A 2F0PA 4RH6A 4ZRZA 4X3UA 2NWGA 2NVQB 3HOXB 2NVTB 1NUCA 3PUWA 1BCPC 5FO7B 1JORA 3FRPB 4DXGA 3AB9A 3C3LA 5CORA 3GTQB 4OO1I 4K5WA 5KIXA 2EZVA 2AQ1B 3TP8A 2F0IA 1MBYA 3AU7A 1GUSA 5C3XA 2XIWA 2F0QA 1QG7A 4OL7A 1MI2A 3VR2A 4B9XA 3VYRA 5DM73 1SYBA 3ERQA 1F9PA 1V1PA 1PFNA 1DOLA 4HR7B 1TKWB 2XRSD 5JVG3 1UNSA 3D3RA 1ENAA 4Z9CB 5C5MA 2ZXPA 3QIAA 1TY2A 1ML0D 1RJTA 5E1FA 4HEDA 3D4RA 4NP5A 4EVOA 2SNMA 1O78A 3SVMA 3IAYA 1WD0A 2E2JB 3D31A 3KLSX 3IKJA 4IFDI 3GTGB 1QE6A 4NDXA 4EQNA 2PYKA 3OOCA 3RMHA 5ELBA 2E76C 3OWFA 4ZKBB 2VNUD 3DWPA 4X3KA 1TWAB 3ND9A 4OIJA 2JSOA 1EY9A 1RCVD 4AYBB 2E2HB 3S16B 3I90A 4CJ2C 2QILA 3TDQA 3I4NB 1G291 4U68A 2F3VA 2KQ3A 3EFXD 5LL6S 3HKZB 4ID6A 1II3A 3QO2A 1QILA 2JEAI 5FKAC 3BDCA 5I2XA 1B2TA 4WORA 1CFMA 2F0GA 1Y1VB 1IW7C 4XYOA 3DWQA 2WIIB 1JWMD 1WCMB 1TS2A 4NKLA 1G2SA 2RDHA 3I72A 4KK7A 2E2IB 1CT1D 5FO9B 3NP8A 3VR6A 3J7AV 2SEBD 2EY6A 3GTLB 4CJ1B 4XT1B 5IGFA 5C44B 1BOSA 1KTKA 1S5DD 1U4PA 2WP8J 4LK1C 1LTID 1F9QA 4XQNA 1DD2A 1SYCA 3DXJC 2PZWA 5T1IA 2BOSA 1PTOH 2F0NA 1C4QA 5HGTA 5AFWA 1SJED 3M7NA 4IUNA 1UAPA 1ZYRC 4PMCA 1H9KA 1EEID 4XIGS 3TZDA 1WTQA 4BBSB 2F3WA 1PFMA 3PUXA 1EZ6A 1PTOD 3EQLC 5K36H 1VDZA 2AUKA 5CYUA 1QNKA 1EU3A 3CRKC 3TN2A 5CV4A 5IGCA 3QJYA 3SK6A 1V8QA 4DF7A 3NBHA 4KKUA 1WTOA 1GXDC 4JK1C 2HDLA 3VYTA 4FF3A 1CA6A 1V43A 3K5NA 1SFOB 1GUNA 2A6EC 2R3ZA 1STEA 2JXMB 2LY7A 4Q5VA 3RLFA 5CMDA 3L9AX 2R93B 5I9OA 2MPMA 4KI0A 1Y1WB 3A8KE 4TQUS 1LLRD 1E0BA 4BY1B 4F8MA 5DNFA 4R8IA 2F0KA 2KECA 2B2UC 3NK9A 3L3OC 1OXTA 1LTBD 5JPMC 1RTNA 1PRTD 2F0SA 3IFTA 1I4HA 2AQ2B 4R8NA 2X69A 5IGGA 2TSSA 1HRJA 3E6ZX 1EFID 3KLSA 4RGNA 2EY2A 5A2QE 3PUZA 4KTAA 2ICEC 1PTOB 3U9SA 3S1QB 2F1MA 1XXGA 2RQXA 3GP7A 2FJ2A 1YNND 4C2MB 2PPBC 1HA6A 3I3CA 2NZ1D 4V0BA 3MEHA 2A68D 3WDNA 5C0XG 2D9UA 4A3EB 3EVQA 2J7ZA 5EPLA 5FLXL 1EWHA 3VYSA 3RUZA 4BA1I 2EJFC 2F0EA 3NSWA 3R3OA 1SAPA 1WTRA 1PZID 4QCLA 5FO8B 3RD4A 1ENFA 4DXFA 3OMGA 4DA2A 4B08A 3K5MA 5IIFA 1TR5A 1X3PA 4N9PA 4K2LA 5IGBA 2DY8A 2EJGC 4OGQC 1PRTB 3A7AB 3PV0A 2C5CA 2E74C 1D1KA 1KLGD 5KYLA 1Q12A 2VUMB 1M8AA 1STGA 4FP5D 5ELCA 2K6AA 1I4XA 3MVVA 3Q22A 2DN8A 1O80A 4CJ0B 2CW0D 2JE6I 2IW3A 2R61A 5EGTA 4X3SA 3J7YW 2EYPA 1BCPD 2PMZB 1I6HB 4TKOB 1KAAA 4QUCA 1VMPA 5I4DA 2Z4IA 2EYHA 1JB3A 2K5DA 2F03A 5ELEA 1F9RA 5I9PA 1FGBD 4IFDG 1XYIA 1EQTA 2I46A 1TU2B 3P1HA 1B4OA 4LAAA 3R8BA 1BO0A 2WB1B 4XXEA 3C46A 1I4RA 3DM1A 4ZLTF 1A6XA 4K8JA 2Z4HA 1SYFA 5E3FA 1F2LA 3NWTA 5EKLA 3HOUB 5ISRA 2K5WA 3T56B 2NN6I 5CV9A 4FF2A 1D1IA 2J4XA 3A54A 1LV9A 2JA6B 1HPCA 1ZXTA 3GTPB 2Q8IB 2KHSA 1WTVA 2MHVA 2K05A 1NCVA 1BCPB 4UDUC 4R9WA 4RCNA 2L11A 2L12A 4HN7A 2XRQD 1WTXA 2KEDA 3BDOA 1STNA 2D2CC 4RA8A 1SMYC 2SNSA 1SDFA 4S3SA 3DUZA 3PO2B 2OF1A 2AUJD 1ENCA 1TQOA 3MC0B 4QUFA 4BWGB 3MTSA 2ZXRA 1DOMA 4KMUC 5KEEA 1IL8A 3V96A 3OIQA 4IZ8A 3VR3A 3G6JB 2DY7A 1EY4A 3SE0A 5A35A 3R2TA 1PTOF 1O7LA 2CQAA 1HTLD 2EYLA 5EKKA 3R93A 4DNTB 5LL6X 2XNAC 2IX1A 2CHBD 4H7BA 1S4ZA 4UAIA 1D6EC 1VCIA 3GD7A 2VB2X 1C8CA 4IUUA 1WD1A 1JOKA 3SHLA 4FVMA 4Q0FA 1H9SB 4IUQA 1STYA 3D4DA 1W6JA 1SXTA 3NQTA 4KV6A 2RVLA 1LABA 1IKMA 1S5ED 2E2DC 3BVZA 4E6IA 3WOFA 1TY0A 2AQ3B 5HURA 4KN7C 2Z1CA 5J22A 2JEBI 1RD9D 1PRTF 1EQVA 2RA4A 1OXXK 3V05A 1EIGA 3GO5A 3BVGA 3KF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JE4 A;  2HCI A;  4ZKC B;  5T1G A;  1U4P A;  2X69 A;  3KBX A;  1ESR A;  4X3S A;  4ZK9 B;  2K1B A;  1SSO A;  2KOL A;  1WVL A;  2FFK B;  1HRJ A;  2RSN A;  2EOT A;  5EJW A;  2HCC A;  2B2W A;  2FHT A;  1HUM A;  3DEP A;  2K04 A;  2MP1 A;  4MN3 A;  4QUF A;  3MTS A;  1QE6 A;  1DOM A;  1NAP A;  1F9Q A;  3MWY W;  4IUT A;  3FDT A;  1IKL A;  1MGS A;  1MSH A;  5EKI A;  1IL8 A;  4X3T A;  4QUC A;  4XT3 B;  5T1I A;  1VMP A;  3ONA B;  2FIN B;  2N88 A;  1MSG A;  1U4M A;  3FPU B;  1NR2 A;  3UI2 A;  1NR4 A;  2B2V C;  2DY7 A;  3G7L A;  1CA5 A;  4ZKB B;  5AFW A;  1J8I A;  2KVM A;  2FJ2 A;  1RTO A;  4MHE A;  3Q6S A;  1U4R A;  1F9R A;  1HA6 A;  4X3K A;  1PLF A;  4OIJ A;  3I3C A;  3IL8 A;  2JYO A;  1XYI A;  4X3U A;  2NZ1 D;  2L9H A;  2NWG A;  5E4X A;  3TZD A;  1EQT A;  1WTQ A;  5COY A;  5D14 A;  1TVX A;  1PFM A;  2B2T C;  1ILQ A;  3R93 A;  1X3Q A;  1J9O A;  2D9U A;  1B4O A;  4OIK A;  3I90 A;  4RWS C;  1G2T A;  4CJ2 C;  3I91 A;  1EOT A;  2B2W C;  2B2Y A;  2FMM A;  2J7Z A;  2B2U A;  3N52 A;  5COR A;  5EPL A;  1EL0 A;  3KUP A;  1G6Z A;  1GUW A;  5D65 A;  1XX8 A;  1BNZ A;  3GV3 A;  1BO0 A;  1S4Z A;  2HUG A;  4UAI A;  1BF4 A;  1EIH A;  1DOK A;  4U68 A;  1B3A A;  4LMQ D;  2JP1 A;  1QNK A;  2KEE A;  2MGS A;  3DM1 A;  1X32 A;  3LWE A;  1SAP A;  1WTR A;  1PDQ A;  3TN2 A;  4ZLT F;  1BBX C;  1C8C A;  1PFB A;  1DON A;  4IUU A;  1WD1 A;  2XIW A;  1F2L A;  1QG7 A;  2NYZ D;  4HCS A;  1AZQ A;  1CM9 A;  3QO2 A;  1MI2 A;  2K01 A;  1A15 A;  1WTO A;  1O7Z A;  1VMC A;  2MJ8 A;  2N55 A;  4ZAI A;  1RHP A;  2HDL A;  1U4L A;  1CA6 A;  3P7J A;  4IUQ A;  5EQ0 A;  1Q3L A;  3D6W A;  1WTW A;  1DZ1 A;  2B2V A;  2Q8T A;  5CBA E;  1B2T A;  1B53 A;  4O42 A;  2M2L A;  1F9P A;  1KNA A;  1X3P A;  2CVR A;  2X6L A;  1PFN A;  4HSV A;  1ILP A;  1DOL A;  2EE1 A;  2K28 A;  2R3Z A;  1LV9 A;  2EPB A;  2BDN A;  2RVL A;  1B50 A;  2SDF A;  2DY8 A;  4RAU C;  1IKM A;  1ZXT A;  1WTP A;  5EPK A;  1HHV A;  1ICW A;  2B2T A;  4NW2 A;  5CMD A;  2L1B A;  1G2S A;  1HFN A;  1WTV A;  1O7Y A;  2K03 A;  2K05 A;  1ML0 D;  1AZP A;  3F2U A;  1RJT A;  2MPM A;  1KNE A;  2L4N A;  3DEO A;  4DN4 M;  2Q8R E;  4IUV A;  1M8A A;  4HED A;  1NCV A;  4IUR A;  1E0B A;  4R9W A;  4XDX A;  1ROD A;  2L11 A;  5E4W C;  5DNF A;  2HDM A;  1HFG A;  5JJZ A;  2L12 A;  3H91 A;  1F9S A;  3IFD A;  4R8I A;  1WTX A;  2IL8 A;  2KED A;  2KEC A;  2KUM A;  5EPJ A;  4HAE A;  1AP0 A;  2B2Y C;  4CJ1 B;  2RA4 A;  4XT1 B;  2B2U C;  3SVM A;  2VXW A;  2H1E A;  3I8Z A;  1WD0 A;  4RA8 A;  2X6G A;  1SDF A;  1JIC A;  1O80 A;  5CBE E;  4IUP A;  1G91 A;  4CJ0 B;  1RTN A;  1EIG A;  2RSO A;  1HUN A;  3HP3 A;  3GV6 A; 
#chains in the Genus database with same CATH topology
 1VQJ A;  4N8X 1;  2WAC A;  2MFI A;  1L1O C;  3FVQ A;  3KBX A;  2G9H D;  3M4O H;  1JMC A;  3QWN A;  4RGT A;  4UY8 C;  4MN3 A;  4EX5 A;  2JA5 B;  4IUT A;  4JI8 L;  3KJO A;  1JWS D;  3M3Y H;  3J80 L;  4L8J A;  4JBK A;  1YNX A;  2SOB A;  5H1S E;  3EA6 A;  3I4L A;  4XT3 B;  4DR1 L;  3NWS A;  2O2L D;  1SNQ A;  2UXC L;  5EBD A;  4YY3 Q;  5C44 G;  4J6H A;  1VQN A;  3X3M A;  1FYC A;  4K8I A;  1E2W A;  3TP7 A;  4B3T Q;  4BA2 I;  1HNX Q;  4H13 C;  4QIW E;  1PYW D;  4BS9 A;  4NXM Q;  2D0P A;  3CKI B;  4EQP A;  3U4V A;  2K5V A;  1VQ5 A;  2GVB A;  4HIO A;  4K0K Q;  4RWS C;  1YJ9 A;  4XQQ A;  3UDG A;  1S5B D;  2A6H C;  3U9O A;  3N52 A;  1EL0 A;  1BQQ T;  1QZG A;  4I65 A;  4KD4 A;  3T53 B;  1F2Y A;  1GUO A;  2K7V A;  2KHJ A;  4A93 H;  2KEE A;  1FVI A;  2LFN A;  1BXT A;  1PDQ A;  1VQI A;  4A3I H;  4GN3 B;  2F0F A;  2R7Z B;  3J81 j;  4BXX G;  3VYU A;  2K4K A;  1X9N A;  2NYZ D;  5J39 A;  1CM9 A;  2BE5 D;  4HMI A;  2K01 A;  3NBI A;  4UPA A;  3ULP A;  1VMC A;  5IT9 L;  5IP7 G;  4QGU A;  2D5D A;  4YHH Q;  4HCE A;  4ALP A;  4JI3 L;  1PYB A;  3ERS X;  1K3B C;  4FXD A;  2Q8T A;  3SEB A;  4XTC S;  2OTJ A;  3E5S A;  4GOP C;  1CTM A;  4FXG C;  4A3D B;  3LWU A;  2XN9 C;  4DAY B;  1D8L A;  3H94 A;  3CMA A;  1ONL A;  4DR6 L;  2B8G A;  2R7F A;  2RBM A;  2YTX A;  1E1O A;  3W1G A;  2ZJP A;  3HEJ A;  4ULL A;  2NVY B;  4K5X A;  3TBI B;  3BYT B;  4QQB X;  1FD7 D;  4DN4 M;  1E22 A;  3HZX A;  2B63 H;  3RR5 A;  1I5F A;  3E0J A;  3H3V H;  1UUP A;  5AJ3 L;  3GDE A;  3OYY A;  3G6E A;  1M90 C;  4POG A;  4DV1 L;  4CDE C;  1CQF A;  4O2D A;  2C35 B;  1EY7 A;  2VW9 A;  3KDF B;  3I2Z A;  3VDY A;  3JAM L;  4B3S Q;  2R93 G;  4ZK9 B;  3F2C A;  3Q24 A;  5EJW A;  4CKE A;  1JB7 A;  4L5S A;  1Y14 B;  1QB5 D;  4P2C B;  1Y1W G;  3M3Y B;  3K0Y A;  2XTI A;  3HRZ C;  1IL2 A;  1PH8 A;  4A3G H;  2MP1 A;  3KYH C;  2PNH A;  1PXU A;  4FXK C;  3S1R H;  4BY1 G;  1KAB A;  5JAV A;  1SNC A;  4X3T A;  1SYG A;  5IYB H;  5JJK A;  2IX3 A;  5I2Y A;  5DEH A;  1A0I A;  3RZO H;  3S2H H;  1J8I A;  2EVB A;  5I6W A;  1STB A;  3FMC A;  1VQ8 A;  1GHK A;  1AW7 A;  4LF7 Q;  5E4X A;  4JI4 Q;  3A5U A;  3H0G G;  5GAD C;  5IYD H;  1I6V C;  2B2W C;  2L15 A;  1YNJ D;  2PZT A;  4A93 B;  2IT1 A;  1G6Z A;  5C4H A;  3RN5 A;  1DYQ A;  1TS3 A;  1XX8 A;  2WFW A;  3PF4 A;  3CCV A;  4A3I B;  1CZG A;  1F2Z A;  3C1E A;  1R9T H;  3GTM H;  1PZJ D;  1EY6 A;  2EYF A;  1A8V A;  2NTS A;  4PNY A;  1PFB A;  5HY6 A;  4ZUI A;  2F0V A;  3PSI A;  3CHB D;  3HOW H;  4B3T L;  1HNX L;  5K36 G;  4NXM L;  2PI2 E;  2EDG A;  1VQP A;  1Q3L A;  3D6W A;  2N78 A;  1WTW A;  5LMN Q;  1DXM A;  1EY8 A;  2WAQ E;  4O42 A;  2L55 A;  2XGT A;  4HSV A;  3EIV A;  2F4V Q;  1EFW A;  1B3Q A;  2EPB A;  4EQO A;  4DFA A;  5IYC G;  2NN6 G;  3BVM A;  4C1N I;  2F4I A;  3U4Z A;  2K03 A;  2B63 B;  2G9D A;  4IUV A;  2PQA A;  4KHZ A;  1G8Z D;  1MD2 D;  2EY5 A;  3S15 B;  2JK8 A;  2RHS B;  4DR2 Q;  3K80 C;  4JC0 A;  4GNX C;  1TS4 A;  1SR3 A;  3NEM A;  1Q86 C;  5C4X H;  1HCZ A;  1VQ4 A;  2OT2 A;  3NXW A;  3MFG A;  1G91 A;  3LGJ A;  1FNW A;  1UWV A;  1JE4 A;  1VF5 C;  3I56 A;  3A56 A;  4A3G B;  1AN8 A;  5LMU Q;  4LFC Q;  3S1R B;  3TRZ A;  2RSN A;  2VUM G;  1SE3 A;  4JI0 L;  3A7L A;  2K04 A;  1LT4 D;  4A3C H;  4JI5 L;  1XPO A;  1IKL A;  4KD3 A;  1NMF A;  3RZO B;  3S2H B;  2CH4 W;  4A3M H;  3T1Y Q;  5IOD A;  4KKT A;  1NR2 A;  2TMP A;  1NR4 A;  3G7L A;  3UI2 A;  3K57 A;  3PO3 H;  2ENB A;  1U9R A;  5CV5 A;  4TRD A;  1B9M A;  4L6T B;  5KYI A;  2Q2U A;  3AEV A;  3S14 H;  1CHP D;  4G7H C;  4IOA A;  1GUG A;  5D14 A;  2KEN A;  3TSS A;  2HHH Q;  2ICI A;  1ILQ A;  1X3Q A;  1QVG A;  3I7F A;  1E3P A;  2F0H A;  3KUP A;  1R9T B;  5IGE A;  1EIY B;  3S2D H;  1H9M A;  2AMC B;  1EIF A;  1SYE A;  3FEW X;  2N3S A;  1XTD A;  4G57 A;  2B8F A;  4H02 A;  3SR1 A;  1HQM C;  3UDF A;  3HOW B;  4LF6 L;  2JA7 H;  2H5X A;  3A8I E;  1STH A;  3BDL A;  4ZQ3 A;  3QB3 A;  1AH9 A;  1KC8 C;  4P71 A;  1A15 A;  1E2V A;  2VQF Q;  3L7Z C;  4LF7 L;  2MNA A;  4JI4 L;  3A74 A;  4ZAI A;  4X64 L;  5JEA G;  2B3G A;  3J81 L;  4JG2 A;  3CPW A;  2WB1 G;  2X6L A;  1N36 Q;  4A3B H;  2K28 A;  5C3E H;  1Q81 C;  3HOZ H;  2EIF A;  2K5Q A;  4ILW A;  2AWN A;  1XNQ L;  1JQY D;  1V1P B;  1A62 A;  1ICW A;  4A3K H;  1SMX A;  4GN5 A;  3V2T A;  3HOU G;  2IHF A;  3TP6 A;  2NB0 A;  5M3F H;  1MKH A;  1LO5 D;  5BN3 A;  3DEO A;  3SDZ A;  2Q8R E;  1K83 H;  3NPP A;  4IUR A;  4QL5 A;  2DJG C;  1LTR D;  4HJ9 A;  3H3V I;  4DAP A;  3HOV B;  4OO1 G;  5BN5 A;  5C4X B;  3PUY A;  3H91 A;  4KY7 A;  2O4X A;  5CV6 A;  2F0L A;  1RKN A;  5LMN L;  1CZW A;  1QNU A;  2JA6 G;  1SN8 A;  2JJQ A;  2X6G A;  2F4V L;  1A3U A;  2IWH A;  3GTO H;  2IJ0 A;  2MUY A;  4NPS A;  3K7A H;  2BDO A;  2DNE A;  2A1A A;  3CCM A;  2YU9 H;  3VA5 A;  2F0T A;  3R2I A;  1FL0 A;  1S5C D;  3QR8 A;  1RDP D;  4Y52 H;  2B2W A;  1S3O A;  1E1T A;  3LNN A;  3UE1 A;  4A3M B;  1Q7Y C;  5DAU A;  4DV3 L;  2PQE A;  1MSH A;  4C3H B;  4CKC A;  1IYU A;  1VQK A;  3PO3 B;  2EYO A;  4DR2 L;  5D3I B;  1R4P B;  3BZC A;  3ONA B;  2A69 D;  2WKC A;  3S14 B;  1NMG A;  5JJL A;  3PO2 G;  1RTO A;  4MHE A;  3J80 E;  4FF1 A;  3I4O A;  1CK1 A;  2L9H A;  2K32 A;  4DPG A;  3MXN A;  3I4M H;  3PGZ A;  3RZD H;  5LMU L;  3K0X A;  1SE2 A;  1K8O A;  1XTC D;  4LFC L;  1PTO C;  2QEX A;  1I50 H;  1QCB D;  4MIU A;  3S2D B;  1W6K A;  3I91 A;  2JN4 A;  2H4O A;  3EN2 A;  5J3B A;  1HXY D;  4BY7 G;  2JA7 B;  5G3L D;  4LMQ D;  2MGS A;  3T1Y L;  3OHX C;  3LWE A;  5IE8 A;  2KJX A;  1PYS B;  3J7A 5;  1RF2 D;  3K5L A;  4I7Z C;  3C2P A;  4G4K A;  3E9I A;  1ASZ A;  1IYV A;  4QJF A;  1Z9F A;  2ZJR A;  1O7Z A;  3TRE A;  4DR4 L;  4GNX A;  2IHE A;  3GTJ H;  1BBU A;  4L63 B;  1U4L A;  1EYC A;  3Q23 A;  2VZA A;  1ZKO A;  2ZTE A;  5C3E B;  4A3B B;  3CCQ A;  3HOZ B;  1B53 A;  3KDF A;  1GKH A;  2IX0 A;  2K50 A;  2R92 B;  1B44 D;  3JC6 6;  4A3K B;  4DKA C;  5FK9 C;  1KL9 A;  5FJ8 G;  5M3F B;  1F2M A;  1K83 B;  2ALY B;  2L1B A;  1N34 Q;  3TP5 A;  5IP9 G;  4ZUJ A;  3I70 A;  4PG3 A;  1AEX A;  3CP0 A;  1IBM Q;  2EYJ A;  4NXN Q;  3IFD A;  1X6O A;  3H09 A;  4LF4 L;  2D0O A;  4JYA L;  1W3S A;  3GTO B;  4F88 A;  2NTT A;  1XJV A;  1QWY A;  2YU9 B;  4QY7 A;  1N36 L;  1PRT C;  2I07 B;  3W2D A;  2K52 A;  3DWA A;  4G7Z C;  1XMO L;  3PMF A;  4JVZ A;  5T1G A;  1KRT A;  2K1B A;  1WVL A;  5C3W A;  2EOT A;  3PIP 3;  4A3F H;  4EGV A;  4R4T A;  1EWC A;  4IPG A;  3MHB A;  2UUC L;  3CW2 C;  3FDT A;  1MGS A;  4IN3 A;  1V9P A;  3JAM E;  2VY3 A;  3T1H Q;  3QG1 A;  1YJW A;  2ZT9 C;  4AQY Q;  1UE6 A;  2HIX A;  3FPU B;  3S1N H;  3M4Q A;  3KK7 A;  1JOO A;  2OWO A;  4F87 A;  3K7U C;  1OXV A;  3I4M B;  5NUC A;  1LTG D;  3RZD B;  4DR5 Q;  1VQ7 A;  3STB C;  2A68 C;  2EJM A;  5COY A;  1XNR Q;  4H0L C;  2M9V A;  1CUK A;  3FKI B;  1J9O A;  1EU4 A;  2JA5 G;  4C56 C;  2F0D A;  1TWH B;  1HZB A;  2FMM A;  5D65 A;  4QF4 A;  3T16 A;  3VR5 A;  1TWG H;  2HD3 A;  4PZ8 A;  1EIH A;  1QOH A;  4BBR H;  2CWP A;  4MZ9 A;  4U67 3;  2WV6 D;  4DV7 L;  1PH1 A;  2A74 C;  1WTH A;  5I6Y A;  4LF5 L;  1Q1E A;  2MJ8 A;  1CKN A;  4TSS A;  2WAQ B;  3VA7 A;  2HQL A;  2KCN A;  3HFZ B;  4WFN 3;  3NUC A;  2BH2 A;  1D2B A;  1EQR A;  3O13 A;  1IW7 D;  4G7O C;  1JCK B;  1VF7 A;  2A5H A;  4RAU C;  3HG9 A;  2F3I A;  2R7Z G;  1KAW A;  2P5Z X;  4JPB W;  4LF9 Q;  2F0U A;  2B2T A;  1YBY A;  4B3R Q;  2R7D A;  3KJP A;  1CQV A;  3M9B A;  2NZH A;  5C0X J;  4AYB G;  5JEA J;  4C3J H;  4KY5 A;  2L4N A;  1S72 A;  5EAY A;  1ROD A;  1BUV T;  2CQO A;  3GQB A;  5GAE C;  1UEA B;  2PO4 A;  4DGZ A;  2C9O A;  2KUM A;  4HAE A;  1IHZ A;  4ODG A;  4ZCK A;  4A3D G;  3MA2 B;  5CV8 A;  2CW0 C;  4RGO S;  5CBE E;  4IUP A;  1YZ6 A;  3E0E A;  3NEL A;  4RCO A;  1NY4 A;  2HCI A;  2UXB Q;  4C3I H;  4A3F B;  1CSP A;  3MXU A;  1Y8O B;  3S17 B;  2FFK B;  4J1M A;  2IPK D;  1C48 A;  1NSN S;  3AMU A;  1A3T A;  5CR3 A;  2EYM A;  1SRO A;  3CC2 A;  4POF A;  1LTS D;  1HH2 P;  4JI7 Q;  2QDB A;  2I5M X;  3S1N B;  3KBG A;  3N6R A;  3S1M B;  4B3M Q;  4JBW A;  1TII D;  2PW7 A;  1Y1V G;  2FIN B;  1MSG A;  2I5H A;  4NXN L;  5GQO A;  5ELF A;  1Q1B A;  3CU7 A;  3K5O A;  4R1J A;  4CDD C;  2PNR C;  2I5L X;  1L0W A;  1FJG Q;  1PLF A;  1I3Q H;  4WJW A;  1ZYR D;  2D62 A;  2JYO A;  4K6L A;  1GM5 A;  1PH4 A;  2FMC A;  1W2B A;  1TVX A;  3NE5 B;  1JR0 D;  4K6D A;  4OIK A;  4K2K A;  1TWG B;  2B2Y A;  1YEZ A;  1C7Y A;  4XQJ A;  3T51 B;  4BBR B;  2HUG A;  2L5T A;  4GS3 A;  1OTC A;  4AQY L;  2ID0 A;  1X32 A;  2XSC A;  1S5F D;  5E7N A;  4LFA Q;  2K75 A;  4YWM A;  1BBX C;  1EY5 A;  1DON A;  1WCM H;  4LUV A;  1A63 A;  4HCS A;  1K8G A;  4FYD A;  4DR5 L;  2RDG A;  4MTK A;  1SNM A;  2N55 A;  1PH6 A;  1XNR L;  1X3F A;  2F0M A;  4RHS A;  2V4D A;  3M7G A;  4A93 G;  1VQC A;  1BKB A;  1D5M C;  3S9W A;  2BA1 A;  2M2L A;  1LTL A;  4OWX B;  5J1Z A;  1PMR A;  2A6E D;  2LKV A;  1X65 A;  2JQO A;  2XWB B;  4AH6 A;  4X65 Q;  1BBW A;  1LTA D;  2NBF A;  2F0O A;  4DV4 Q;  1TWF H;  2CFM A;  4IFD J;  5FLM G;  1EQQ A;  1MIU A;  3J81 E;  2GN5 A;  5FLX E;  4M1U B;  4C3J B;  2B39 A;  3GTK H;  4BBS G;  1KNE A;  5M3M H;  3OMC A;  2K5N A;  4L5Q A;  3KF6 B;  2PMZ E;  1DGS A;  5BR8 Q;  1PZK D;  5JOB A;  3SK4 A;  3QOJ A;  4RMF A;  1I4Q A;  3I8Z A;  1QVF A;  2ZJQ A;  4C3I B;  3J80 c;  4WRD A;  5GRO A;  3ND8 A;  3P75 A;  3GV6 A;  5ELD A;  3MFY A;  3F2B A;  4ZKC B;  1IBL L;  1IXR A;  3K59 A;  2B63 G;  4BXX H;  3J80 i;  1J6Q A;  5GAH C;  1SNO A;  1YHA A;  5IP7 H;  2ZXO A;  1XMQ Q;  2RDF A;  1X56 A;  1TWC H;  4O0A A;  4APV A;  3C1F A;  1YI2 A;  2N88 A;  1U4M A;  1GJX A;  3ZJY C;  1I3Q B;  1FNU A;  1Z7T A;  2GA4 B;  3M4O B;  4A3G G;  1BCP F;  3A0J A;  2J0T D;  1Q90 A;  1SYD A;  5IY0 A;  2BH8 A;  5DM6 3;  1Q8I A;  1LTT D;  5M5W H;  2ES2 A;  5G3L F;  5IYB G;  4HID A;  1G2T A;  1EOT A;  1ET9 A;  1OXS C;  1SNP A;  1STA A;  4NMZ A;  4DV5 Q;  3BG3 A;  1TS5 A;  2ASB A;  1HTP A;  2QEJ C;  5CC4 A;  3CRL C;  4B3M L;  2PZU A;  1KQS A;  1QJO A;  5C6A A;  2ZM6 Q;  1HR0 L;  4KJO A;  3KFU A;  4DUY Q;  4ABN A;  3M85 A;  4RKL A;  5IYD G;  1KDA A;  1FJG L;  1L2F A;  4OWW B;  4HIM A;  3EJI A;  1Y8P B;  3M4Y A;  1IZ6 A;  1GOZ A;  3MXG A;  3Q0A A;  1Y1W H;  5EQ0 A;  1E2Z A;  3WOE A;  2B2V A;  5CBA E;  2LXJ A;  1TWF B;  2CVR A;  4LNQ A;  2WIN B;  2OQ0 A;  2EE1 A;  1H9R A;  2BDN A;  4JOI A;  2OXP A;  4DNR B;  3NTH A;  5IGD A;  3HOW G;  3J7Z C;  5C5L A;  2Z0S A;  3GTK B;  1LT5 D;  4YY3 L;  5M3M B;  1HFN A;  3MAQ A;  1O7Y A;  1Y69 U;  2CWA A;  3NEN A;  2DUD A;  2Y0S B;  1PHJ A;  2UU9 Q;  1E24 A;  4A3E G;  3JAM c;  3URY A;  5JJZ A;  1K0S A;  3H0G H;  1F9S A;  4K0K L;  1J5E Q;  4RG1 A;  3S1Q H;  3ICE A;  3BS1 A;  1WFQ A;  3JAM i;  1FNV A;  1WI5 A;  2Z8L A;  3EBE A;  4KLK A;  1VQE A;  1M4V A;  3T4A C;  4P72 A;  4X65 L;  3H6M A;  3HP3 A;  2K33 A;  3CC7 A;  3CCS A;  4DV4 L;  5FOB B;  2HQE A;  1DM0 B;  1ZEQ X;  3A55 A;  2HCC A;  3TS0 A;  4H44 C;  1TWC B;  1SBB B;  1NTG A;  1NAP A;  5KND A;  4CDC C;  1Z47 A;  1AE2 A;  4C1N K;  3HOV G;  1QVC A;  5C4X G;  2L0C A;  4X62 Q;  5D3D A;  4YHH L;  2LMC B;  3B6Y A;  5IOC A;  3BYY B;  5BR8 L;  3K58 A;  4LF8 Q;  1LUZ A;  2UUB Q;  4ME5 A;  2Z9H A;  1U4R A;  3QOL A;  1LAC A;  3OTO Q;  5M5W B;  4A3C G;  2M00 A;  1A2U A;  2NN6 H;  1B7Y B;  2UXD Q;  3G48 A;  4KY6 A;  1FR3 A;  3S24 A;  4A3J H;  2BA0 A;  4A3M G;  4F7X A;  2F0W A;  3UE0 A;  4C3H G;  3P20 A;  3CXC A;  4O1N A;  3RLN A;  3PO3 G;  1GUW A;  1H9J A;  3MXP A;  3GV3 A;  4CGY B;  1DOK A;  1XMQ L;  1F77 A;  4M8A A;  4RGM A;  1SE4 A;  5GAG C;  5LHY 1;  1GHJ A;  1H9S A;  2BE5 C;  4IJH A;  1AZQ A;  3D6C A;  1X54 A;  4PZ7 A;  1ICF B;  2E5L Q;  3J7A F;  4B3S L;  1B1Z A;  3PIO 3;  1RHP A;  1TT2 A;  4RKB A;  1VQH A;  3P7J A;  4PMW A;  4XYQ A;  2MO0 A;  1DZ1 A;  2ZTC A;  4FF4 A;  2PCF B;  2YYZ A;  3U50 C;  4J8Q A;  4PMB A;  4LJZ C;  2VQE Q;  2JA7 G;  3D8G A;  2OQK A;  3GTM B;  1A3V A;  4YIJ A;  2O5J C;  2R6G A;  2BCO A;  2SDF A;  1PV4 A;  3LX0 A;  4PV1 C;  3W3A A;  1PH5 A;  2NUC A;  5EPK A;  1HHV A;  4FDB A;  1X3G A;  2A8V A;  3D4W A;  1AZP A;  4DU9 A;  1HNW Q;  4L5R C;  5BN4 A;  3H0G B;  1VQ6 A;  2A73 B;  4A3B G;  5C3E G;  5E4W C;  4DV0 Q;  1KDC A;  1HFG A;  3HOZ G;  1Q46 A;  3I73 A;  1I6H H;  1Z6H A;  5EPJ A;  4OON A;  1AP0 A;  2LSS A;  3KLR A;  3VR4 A;  3G71 A;  2R92 G;  2H1E A;  1DCZ A;  4CHT B;  4A3K G;  1EYD A;  1EEF D;  1JIC A;  2Q2T A;  2O5I C;  1SMY D;  1EY0 A;  2WKD A;  2RSO A;  5M3F G;  3HOY H;  3FHW A;  4OHJ A;  1C9O A;  1LT3 D;  1SSO A;  2KOL A;  3H3V C;  3STB D;  1N9W A;  1D5X C;  3KF8 B;  4P74 A;  1MJE A;  1ET6 A;  1EYA A;  1A2T A;  5EKI A;  3OSO A;  1K8M A;  3TQY A;  4CBV A;  5C0X H;  3CCJ A;  3CCR A;  2NZO A;  5JEA H;  5JJI A;  1N33 Q;  1XWE A;  4KN4 C;  3ZYY X;  1CA5 A;  2EXZ A;  4X66 Q;  1KDB A;  2QKI C;  4KKS A;  2KVM A;  4HIK A;  2E75 C;  3KOJ A;  1OO9 B;  3Q6S A;  3IL8 A;  4A3J B;  3TME A;  4A75 A;  1NE3 A;  4JI6 Q;  4JV5 Q;  2B2T C;  3HOU H;  1Y8N B;  2Z6K C;  4QMG A;  5KRU A;  1GD7 A;  3NTI A;  5IWA Q;  4AYB E;  1YNJ C;  1HA5 A;  3DMU A;  1AFP A;  2VL6 A;  2QCP X;  4KHV A;  1BF4 A;  1LT6 D;  4OO1 H;  3PUV A;  3SK8 A;  4X62 L;  5KGU A;  3TZU A;  1B8A A;  5ELO A;  3SK5 A;  3NQI A;  4DV2 Q;  4GLX A;  3OW7 A;  4QIW B;  3J81 c;  5FLX c;  3I4M G;  3KF6 A;  2QW7 A;  2UUB L;  1NJI C;  4UP8 A;  4DAM A;  4N9T A;  3OTO L;  3HKZ E;  2YTV A;  1KHI A;  3FKI G;  3J81 i;  1KLU D;  1VQB A;  2KA7 A;  4A4I A;  4FNF A;  3DHQ A;  1RIP A;  2XVS A;  4K14 A;  4DAY A;  2EY1 A;  1SJH D;  3ITP A;  3ULJ A;  1ILP A;  3OIP A;  3NTK A;  1B50 A;  2JA8 H;  1WTP A;  1JE5 A;  3BZD B;  1LM0 A;  4V19 0;  1BDO A;  1T5X D;  4NW2 A;  5JVH 3;  4I7A A;  4RHR A;  3F2U A;  2CCZ A;  4ME3 A;  3SXH A;  2E5L L;  1JOQ A;  1K3R A;  2HHH L;  5CV7 A;  2HDM A;  1R4Q B;  2IL8 A;  4JI2 Q;  4OXP A;  1QUQ B;  3AYH B;  2B2Y C;  1H95 A;  2VXW A;  2VQE L;  3HOY B;  3MZ5 A;  5M5Y H;  5IT9 E;  4BY7 H;  1EZ8 A;  1HUN A;  1I4G A;  1UE5 A;  1XPU A;  1CKM A;  3CQZ H;  1ESR A;  4GZY C;  4B9W A;  1OXU A;  2FHT A;  1L0Y B;  1HUM A;  4IFD H;  4Y7N H;  2VB3 X;  3MWY W;  4IJL A;  2VQF L;  3M4P A;  5C4J H;  3X3N A;  4FO2 A;  4DR7 Q;  5M5X H;  2QF7 A;  4R4I A;  3K7A B;  1HQR D;  2NVX H;  1JWU D;  2DNC A;  4A3F G;  4IQZ A;  1L0X B;  3AFP A;  2XWJ B;  4L5T A;  1LYL A;  1BR9 A;  1V1O A;  2NVQ H;  3HOX H;  2F0J A;  2NVT H;  3HGB A;  2B2U A;  1XPR A;  2RKS A;  2A6H D;  5ELN A;  1BNZ A;  5K5P A;  4DK0 A;  1JJG A;  1B3A A;  2KBN A;  2JP1 A;  3HKS A;  3GTQ H;  2K5H A;  3U58 A;  1N33 L;  1YNN C;  3HS0 C;  5KNB A;  2AWO A;  1PA6 A;  1DJR D;  3CCL A;  4PQX A;  1I50 B;  3NHH A;  1CHQ D;  4JI8 Q;  3FPP A;  1B9N A;  4HMJ A;  3ERO A;  1PH7 A;  2IY5 B;  3T13 A;  4JV5 L;  2KCC A;  4ZYS A;  5TSS A;  2UXC Q;  4BBR G;  1KNA A;  3OPO A;  2JA8 B;  4RFB A;  1E7Z A;  1ESF A;  5C4Z A;  4DAV A;  1SND A;  1HNZ Q;  3I55 A;  3A8J E;  3OWE B;  2QA4 A;  4K5V A;  3GTJ B;  1L1O B;  1GUT A;  4IAL A;  2PW5 A;  4GN4 B;  4KJN A;  4XDX A;  3AQQ A;  2RCF A;  3NBH B;  2JA5 H;  2LS0 1;  5M5Y B;  2PQA B;  3TEH B;  4BY7 B;  2F52 A;  5CGK A;  1JC7 A;  2N49 A;  1T5E A;  3CQZ B;  1I4P A;  4HTH A;  5A2Q L;  1PVO A;  5F2D A;  1JJC B;  4C3J G;  2E2J H;  4QB4 A;  2Z6K A;  4CKB A;  1YVC A;  4Y7N B;  3CD6 A;  1CI3 M;  2OEO A;  1UE7 A;  3CCE A;  5EBC A;  3DEP A;  1D5Z C;  5JPN C;  5M9O A;  1SEB D;  3K6O A;  5C4J B;  2V1C C;  3GTG H;  5KNC A;  5C0X I;  5M5X B;  2CKZ B;  2A69 C;  2NVX B;  4HSP A;  1X3E A;  1HR0 W;  2B2V C;  2YV5 A;  4JI2 L;  4C3I G;  4DK1 A;  2F0P A;  4RH6 A;  4JOI C;  3D0F A;  4ZRZ A;  4X3U A;  4A3L H;  2NWG A;  2NVQ B;  3HOX B;  2NVT B;  1NUC A;  3PUW A;  1TWA H;  4YCW A;  1BCP C;  3K81 C;  5FO7 B;  1JOR A;  1N34 L;  5AJ3 Q;  3FRP B;  4DXG A;  3AB9 A;  3RLO A;  1M1K C;  1K28 A;  3C3L A;  4DV1 Q;  4UHV A;  5COR A;  2E2H H;  3TS2 A;  4CDF C;  3S16 H;  1IBM L;  3GTQ B;  1WOC A;  4OO1 I;  4K5W A;  5KIX A;  2EZV A;  1NNX A;  2AQ1 B;  4GOP B;  3TP8 A;  3I4N H;  2F0I A;  3UDX A;  4IO9 A;  1MBY A;  2LXK A;  3AU7 A;  1GUS A;  5C3X A;  1D7Q A;  2XIW A;  2F0Q A;  1QG7 A;  4OL7 A;  5L37 A;  1MI2 A;  1MHW C;  3VR2 A;  4B9X A;  2ATW A;  3VYR A;  4DR3 Q;  5DM7 3;  1YIJ A;  1SYB A;  3ERQ A;  1F9P A;  1V1P A;  1PFN A;  1DOL A;  4HR7 B;  3T1H L;  4NB3 A;  1TKW B;  1Y1V H;  2XRS D;  4LUZ A;  1S40 A;  3L2P A;  5JVG 3;  1UNS A;  3D3R A;  1ENA A;  4Z9C B;  1P16 A;  5C5M A;  2ZXP A;  3QIA A;  1TY2 A;  1ML0 D;  2UUA Q;  1RJT A;  1VQG A;  5E1F A;  1EOV A;  4HED A;  3D4R A;  4NP5 A;  4EVO A;  2SNM A;  1O78 A;  3A5Z B;  2E2I H;  3SVM A;  3W5O A;  3IAY A;  3BU2 A;  4A3I G;  1WD0 A;  2E2J B;  4DV6 Q;  3GTL H;  1K0R A;  3D31 A;  5M3M G;  3KLS X;  4N8F A;  4R4O A;  5C44 H;  4TVA B;  1HNZ L;  3IKJ A;  1PH2 A;  4IFD I;  3GTG B;  2EXD A;  2Y0S G;  3F2D A;  1QE6 A;  1AE3 A;  4NDX A;  4YWK A;  4EQN A;  2PYK A;  3OOC A;  3RMH A;  5ELB A;  2E76 C;  3OWF A;  4ZKB B;  1CSQ A;  4JCV E;  4DNI A;  2VNU D;  3DWP A;  4X3K A;  1TWA B;  3ND9 A;  4OIJ A;  2JSO A;  1EY9 A;  5FLM H;  1RCV D;  4AYB B;  4LF9 L;  4JBM A;  4MTN A;  2E2H B;  4B3R L;  3S16 B;  3I90 A;  4BBS H;  2QIL A;  4CJ2 C;  3TDQ A;  3MXN B;  2KCM A;  4KHP Q;  3I4N B;  1C0A A;  1G29 1;  4U68 A;  2F3V A;  2WB1 E;  2KQ3 A;  3CME A;  3EFX D;  3RN2 A;  5LL6 S;  1U5K A;  3HKZ B;  4JI0 Q;  4ID6 A;  1YHB A;  1II3 A;  3QO2 A;  4JI5 Q;  1QIL A;  2UXB L;  2A19 A;  1QUQ A;  2JEA I;  5FKA C;  3BDC A;  5I2X A;  1U0L A;  2Q2I A;  1B2T A;  4WOR A;  3S15 H;  1CFM A;  1TXY A;  2F0G A;  3PIO A;  4GNX B;  1Y1V B;  1IW7 C;  4JI7 L;  1SFO H;  5IT9 c;  4XYO A;  3DWQ A;  2WII B;  1JWM D;  1WCM B;  1ASY A;  1TS2 A;  5HGQ A;  4NKL A;  1QZH A;  1G2S A;  2RDH A;  3I72 A;  1GO3 E;  3UDI A;  1KIX A;  2HT1 A;  2R93 H;  4KK7 A;  1IYJ B;  2E2I B;  1CT1 D;  5FO9 B;  3NP8 A;  3VR6 A;  3WWV A;  3J7A V;  4DR3 L;  2SEB D;  5LMN W;  2EY6 A;  3GTL B;  4A76 A;  4CJ1 B;  4LF6 Q;  4XT1 B;  4BY1 H;  4OX9 Q;  2HIV A;  5IGF A;  5C44 B;  1BOS A;  1KTK A;  1S5D D;  1U4P A;  4IOC A;  4LFA L;  3RNU A;  3BJU A;  4X64 Q;  2WP8 J;  4LK1 C;  1K9M C;  2UUA L;  1LTI D;  1F9Q A;  4XQN A;  1G51 A;  4YWL A;  1DD2 A;  1SYC A;  3DXJ C;  2PZW A;  5T1I A;  2BOS A;  1XNQ Q;  1PTO H;  2F0N A;  4WJ3 M;  1C4Q A;  5HGT A;  5AFW A;  1SJE D;  3M7N A;  4IUN A;  3CF5 A;  4YCV A;  1UAP A;  4DV6 L;  1ZYR C;  4PMC A;  1H9K A;  1SE8 A;  1EEI D;  4XIG S;  3TZD A;  1WTQ A;  3F8T A;  2F3W A;  4C2M H;  4BBS B;  1PFM A;  4HJA A;  3PUX A;  1EZ6 A;  1IBK Q;  1VS0 A;  1PTO D;  2N8N A;  4LWC A;  3EQL C;  5K36 H;  1VDZ A;  2AUK A;  4PZ6 A;  4AIM A;  4A3E H;  5CYU A;  1VQ9 A;  2CH4 A;  1QNK A;  4LFB Q;  2PI2 A;  1EU3 A;  1L1O A;  3CRK C;  3TN2 A;  5CV4 A;  1PH3 A;  5IGC A;  4A3J G;  3QJY A;  3SK6 A;  1V8Q A;  4IPC A;  4DF7 A;  3NBH A;  4KKU A;  5IYC H;  4DV3 Q;  1WTO A;  1GXD C;  4JK1 C;  1CKO A;  2HDL A;  3VYT A;  1VQD A;  4FF3 A;  1CA6 A;  1V43 A;  3K5N A;  1SFO B;  1GUN A;  2A6E C;  4IPD A;  1CKN B;  3HOV H;  2FXQ A;  4KHP L;  1HJP A;  2JA9 A;  2R3Z A;  4OEM B;  2B29 A;  1STE A;  4P73 A;  2JXM B;  2LY7 A;  4Q5V A;  3RLF A;  2YTY A;  5CMD A;  3L9A X;  2R93 B;  5I9O A;  2MPM A;  4GKK Q;  4KI0 A;  1Y1W B;  3A8K E;  4TQU S;  1LLR D;  1E0B A;  2VUM H;  1JJ2 A;  4BY1 B;  1K73 C;  4F8M A;  5DNF A;  4R8I A;  4X6A H;  2F0K A;  2KEC A;  4C3H H;  3CCU A;  2B2U C;  3ER0 A;  3NK9 A;  3L3O C;  4DV5 L;  1NBW A;  1OXT A;  1LTB D;  3AFQ A;  5JPM C;  1RTN A;  1PRT D;  3KLW A;  2F0S A;  3IFT A;  4DK3 C;  1I4H A;  2AQ2 B;  4R8N A;  1MJC A;  2ZM6 L;  4DR4 Q;  2X69 A;  5IGG A;  2TSS A;  1HRJ A;  3E6Z X;  4DUY L;  1EFI D;  3F1Z A;  3KLS A;  4RGN A;  2EY2 A;  5A2Q E;  4GOP A;  3PUZ A;  4KTA A;  2ICE C;  1PTO B;  3U9S A;  3S1Q B;  2F1M A;  1XXG A;  1K8A C;  2RQX A;  2RF4 A;  3HOY G;  3GP7 A;  3G4S A;  4OX9 L;  2FJ2 A;  1YNN D;  4C2M B;  2PPB C;  1HA6 A;  4JI1 Q;  3I3C A;  2NZ1 D;  4V0B A;  3MEH A;  2A68 D;  1KXL A;  3WDN A;  5C0X G;  2D9U A;  4LF4 Q;  4UP7 A;  4A3E B;  3EVQ A;  4JYA Q;  2J7Z A;  5EPL A;  5FLX L;  3PIP A;  1EWH A;  4HJ8 A;  2UU9 L;  3VYS A;  3ULL A;  3RUZ A;  4BA1 I;  1XMO Q;  2EJF C;  2F0E A;  3NSW A;  3R3O A;  1J5E L;  1SAP A;  1WTR A;  2MQH A;  2R92 H;  1PZI D;  4QCL A;  2KCT A;  5FO8 B;  3RD4 A;  1N32 Q;  1ENF A;  3IRB A;  2UUC Q;  4DXF A;  4LW1 A;  3OMG A;  4DA2 A;  1YHQ A;  2AHO B;  4B08 A;  3K5M A;  4GKJ Q;  4JBJ A;  5IIF A;  1TR5 A;  1IBK L;  3E9H A;  1N8R C;  1X3P A;  4N9P A;  4K2L A;  5IGB A;  1T9H A;  3PF5 A;  1FGU A;  2RHQ B;  2DY8 A;  2KHI A;  3SGI A;  2EJG C;  4OGQ C;  4LFB L;  1PRT B;  3A7A B;  2JA6 H;  4LF8 L;  3PV0 A;  1HZA A;  3CAM A;  1BVS A;  2C5C A;  4MNO A;  2E74 C;  1D1K A;  1KLG D;  5KYL A;  1Q12 A;  3GTP H;  2VUM B;  1M8A A;  2DJF C;  1STG A;  4FP5 D;  2UXD L;  5ELC A;  2K6A A;  1I4X A;  3OW2 A;  3MVV A;  3Q22 A;  2JA8 G;  2DN8 A;  4DV7 Q;  4P75 A;  2ZTD A;  1O80 A;  4CJ0 B;  2CW0 D;  2JE6 I;  3DM3 A;  2IW3 A;  2R61 A;  4LF5 Q;  4OWT B;  5EGT A;  4X3S A;  3J7Y W;  2OCE A;  3PO2 H;  4GLV B;  4J15 A;  4EQ5 A;  2EYP A;  1BCP D;  2PMZ B;  4GKK L;  1I6H B;  4TKO B;  1KAA A;  2WAQ G;  3FKI H;  3BZK A;  4QUC A;  1TWH H;  1B70 B;  1VMP A;  5I4D A;  2Z4I A;  2EYH A;  1JB3 A;  2G5D A;  2K5D A;  2F03 A;  4DUZ Q;  5ELE A;  3MEF A;  3K8A A;  1HZC A;  1F9R A;  5I9P A;  1FGB D;  1GVP A;  4IFD G;  1EWI A;  1XYI A;  1EQT A;  2I46 A;  1TU2 B;  3P1H A;  1B4O A;  4LAA A;  3R8B A;  1EUJ A;  1HNW L;  1Q8K A;  1I94 Q;  1G6P A;  1BO0 A;  2WB1 B;  4XXE A;  3C46 A;  4DV0 L;  1VQA A;  1I4R A;  3DM1 A;  4IPH A;  4ZLT F;  1A6X A;  4K8J A;  2Z4H A;  1SYF A;  3DLL A;  5E3F A;  1F2L A;  3NWT A;  5EKL A;  1VQL A;  3HOU B;  3HOX G;  5ISR A;  1WYD A;  5FJ8 H;  4OEL B;  2K5W A;  4JI1 L;  3T56 B;  2NN6 I;  1RL2 A;  4YCU A;  1EYG A;  5CV9 A;  4WJ4 A;  1YJN A;  4UP9 A;  4FF2 A;  5IP9 H;  2Y0S E;  1D1I A;  1O7I A;  3E3X A;  2J4X A;  3A54 A;  1LV9 A;  1SRU A;  2JA6 B;  1HPC A;  1ZXT A;  1VQO A;  3W1B A;  3GTP B;  4X66 L;  3H15 A;  2Q8I B;  2KHS A;  2Z6B A;  1WTV A;  2MHV A;  2Q2H A;  2K05 A;  1N32 L;  3S17 H;  1NCV A;  1BCP B;  4UDU C;  4R9W A;  4RCN A;  4DR1 Q;  2L11 A;  4JI6 L;  5DLQ E;  4GKJ L;  2L12 A;  4HN7 A;  2XRQ D;  5IWA L;  2RCN A;  1UEB A;  2EQS A;  2KED A;  3PCO B;  1WTX A;  3BDO A;  2K14 A;  1P8L A;  1STN A;  2QDL A;  3L0O A;  2D2C C;  4GLA C;  4RA8 A;  3S1M H;  1SMY C;  2SNS A;  1SDF A;  4S3S A;  3DUZ A;  3PO2 B;  2OF1 A;  2AUJ D;  4DV2 L;  1ENC A;  1UE1 A;  1TQO A;  1SLJ A;  3MC0 B;  4QUF A;  1VQM A;  4BWG B;  3MTS A;  2ZXR A;  1DOM A;  4HJ5 A;  4KMU C;  1KRS A;  1IL8 A;  5KEE A;  3V96 A;  3OIQ A;  1V1Q A;  4IZ8 A;  1WJJ A;  4R4C A;  2DGY A;  4JW0 A;  3VR3 A;  3G6J B;  2DY7 A;  1YIT A;  1EY4 A;  3FP9 A;  3SE0 A;  5A35 A;  2QGQ A;  3R2T A;  2VS1 A;  1PTO F;  1O7L A;  2CQA A;  1HTL D;  2EYL A;  4JI3 Q;  5EKK A;  3R93 A;  4DNT B;  5LL6 X;  3PQI A;  2XNA C;  2IX1 A;  2CHB D;  4H7B A;  1KD1 C;  1VQF A;  1S4Z A;  4UAI A;  1D6E C;  4HJ7 A;  1VCI A;  3GD7 A;  4DK6 C;  4DR6 Q;  1HZ9 A;  4A3L G;  1IBL Q;  2VB2 X;  1C8C A;  1X55 A;  4DUZ L;  4IUU A;  1WD1 A;  4LUO A;  2AKW B;  1PH9 A;  1JOK A;  1JT8 A;  2R7Z H;  3SHL A;  4FVM A;  1PFS A;  4Q0F A;  1H9S B;  4IUQ A;  1STY A;  3D4D A;  1W6J A;  1SXT A;  3I4N G;  3CPF A;  3NQT A;  4KV6 A;  1I94 L;  2RVL A;  1LAB A;  1IKM A;  1S5E D;  4DR7 L;  4A3D H;  2GVA A;  2E2D C;  3BVZ A;  3HKZ G;  4E6I A;  4R4Q A;  1Q82 C;  3WOF A;  1TY0 A;  2AQ3 B;  5HUR A;  4KN7 C;  2NVY H;  2Z1C A;  5J22 A;  2OTL A;  2JEB I;  1RD9 D;  1PRT F;  2E8G A;  1EQV A;  2I0Q A;  1HR0 Q;  2RA4 A;  3Q8D A;  1OXX K;  3CC4 A;  1WCM G;  3V05 A;  1EIG A;  3GO5 A;  3BVG A;  3KF8 A;  2MO1 A; 
#chains in the Genus database with same CATH homology
 2WAC A;  3KBX A;  3FVQ A;  2G9H D;  3QWN A;  4RGT A;  4MN3 A;  2JA5 B;  4IUT A;  1JWS D;  3J80 L;  4L8J A;  2SOB A;  3EA6 A;  3I4L A;  4XT3 B;  3NWS A;  2O2L D;  1SNQ A;  5EBD A;  4J6H A;  3X3M A;  1FYC A;  4K8I A;  1E2W A;  3TP7 A;  4BA2 I;  4H13 C;  1PYW D;  4BS9 A;  3CKI B;  4EQP A;  4RWS C;  4XQQ A;  1S5B D;  2A6H C;  3U9O A;  3N52 A;  1EL0 A;  1BQQ T;  4I65 A;  4KD4 A;  3T53 B;  1F2Y A;  1GUO A;  2K7V A;  2KEE A;  2LFN A;  1BXT A;  1PDQ A;  2F0F A;  2R7Z B;  3VYU A;  2NYZ D;  5J39 A;  1CM9 A;  2BE5 D;  4HMI A;  2K01 A;  3NBI A;  1VMC A;  5IT9 L;  2D5D A;  4HCE A;  4FXD A;  2Q8T A;  3SEB A;  4XTC S;  3E5S A;  1CTM A;  4FXG C;  4A3D B;  3LWU A;  2XN9 C;  3H94 A;  1ONL A;  2B8G A;  2RBM A;  3HEJ A;  4ULL A;  2NVY B;  4K5X A;  3TBI B;  3BYT B;  1FD7 D;  4DN4 M;  3HZX A;  3E0J A;  1UUP A;  1CQF A;  1EY7 A;  3JAM L;  4ZK9 B;  3Q24 A;  5EJW A;  4CKE A;  1QB5 D;  4P2C B;  3M3Y B;  3K0Y A;  3HRZ C;  2MP1 A;  1PXU A;  4FXK C;  1KAB A;  5JAV A;  1SNC A;  4X3T A;  1SYG A;  2IX3 A;  5I2Y A;  5DEH A;  1J8I A;  2EVB A;  5I6W A;  1STB A;  3FMC A;  1GHK A;  1AW7 A;  5E4X A;  1I6V C;  2B2W C;  1YNJ D;  2PZT A;  4A93 B;  2IT1 A;  1G6Z A;  5C4H A;  1DYQ A;  1TS3 A;  1XX8 A;  4A3I B;  1CZG A;  1F2Z A;  3C1E A;  1PZJ D;  1EY6 A;  2EYF A;  2NTS A;  4PNY A;  1PFB A;  4ZUI A;  2F0V A;  3CHB D;  5K36 G;  2EDG A;  1Q3L A;  3D6W A;  1WTW A;  1DXM A;  1EY8 A;  4O42 A;  2L55 A;  4HSV A;  2EPB A;  4EQO A;  4DFA A;  2NN6 G;  3BVM A;  4C1N I;  2F4I A;  2K03 A;  2B63 B;  2G9D A;  4IUV A;  4KHZ A;  1G8Z D;  1MD2 D;  2EY5 A;  3S15 B;  1TS4 A;  1HCZ A;  2OT2 A;  3NXW A;  3MFG A;  1G91 A;  1FNW A;  1JE4 A;  1VF5 C;  3A56 A;  4A3G B;  1AN8 A;  3S1R B;  2RSN A;  1SE3 A;  3A7L A;  2K04 A;  1LT4 D;  1IKL A;  4KD3 A;  3RZO B;  3S2H B;  5IOD A;  4KKT A;  1NR2 A;  2TMP A;  1NR4 A;  3G7L A;  3UI2 A;  3K57 A;  2ENB A;  1U9R A;  5CV5 A;  4TRD A;  1B9M A;  4L6T B;  5KYI A;  1CHP D;  4G7H C;  1GUG A;  5D14 A;  3TSS A;  2ICI A;  1ILQ A;  1X3Q A;  2F0H A;  3KUP A;  1R9T B;  5IGE A;  1H9M A;  1SYE A;  3FEW X;  4G57 A;  2B8F A;  3SR1 A;  1HQM C;  3HOW B;  3A8I E;  1STH A;  3BDL A;  4ZQ3 A;  3QB3 A;  1A15 A;  1E2V A;  3L7Z C;  4ZAI A;  5JEA G;  3J81 L;  2X6L A;  2K28 A;  2K5Q A;  4ILW A;  2AWN A;  1JQY D;  1V1P B;  1ICW A;  3V2T A;  3TP6 A;  2NB0 A;  1LO5 D;  5BN3 A;  3DEO A;  3SDZ A;  2Q8R E;  3NPP A;  4IUR A;  1LTR D;  4OO1 G;  4DAP A;  3HOV B;  5BN5 A;  5C4X B;  3PUY A;  3H91 A;  4KY7 A;  2O4X A;  5CV6 A;  2F0L A;  1RKN A;  1CZW A;  1QNU A;  2X6G A;  1A3U A;  2IWH A;  2IJ0 A;  2MUY A;  2BDO A;  2DNE A;  3VA5 A;  2F0T A;  3R2I A;  1S5C D;  1RDP D;  2B2W A;  3LNN A;  4A3M B;  5DAU A;  2PQE A;  4C3H B;  1MSH A;  4CKC A;  1IYU A;  3PO3 B;  2EYO A;  5D3I B;  1R4P B;  3ONA B;  2A69 D;  2WKC A;  3S14 B;  1RTO A;  4MHE A;  3J80 E;  4FF1 A;  1CK1 A;  2L9H A;  2K32 A;  3MXN A;  1K8O A;  1SE2 A;  1XTC D;  1PTO C;  1QCB D;  4MIU A;  3S2D B;  1W6K A;  3I91 A;  2H4O A;  1HXY D;  2JA7 B;  5G3L D;  4LMQ D;  2MGS A;  3OHX C;  3LWE A;  2KJX A;  1RF2 D;  3K5L A;  4I7Z C;  3C2P A;  4G4K A;  1IYV A;  1O7Z A;  4L63 B;  1U4L A;  1EYC A;  3Q23 A;  1ZKO A;  5C3E B;  4A3B B;  3HOZ B;  1B53 A;  2IX0 A;  2R92 B;  1B44 D;  4A3K B;  5FK9 C;  5M3F B;  1F2M A;  1K83 B;  2L1B A;  3TP5 A;  4ZUJ A;  3I70 A;  1AEX A;  2EYJ A;  3IFD A;  3H09 A;  3GTO B;  4F88 A;  2NTT A;  2YU9 B;  1QWY A;  1PRT C;  2I07 B;  3W2D A;  3DWA A;  4G7Z C;  3PMF A;  5T1G A;  2K1B A;  1WVL A;  5C3W A;  2EOT A;  3PIP 3;  4EGV A;  1EWC A;  3MHB A;  3FDT A;  1MGS A;  4IN3 A;  3JAM E;  3QG1 A;  2ZT9 C;  3FPU B;  3KK7 A;  1JOO A;  4F87 A;  1OXV A;  3I4M B;  5NUC A;  1LTG D;  3RZD B;  2A68 C;  2EJM A;  5COY A;  4H0L C;  2M9V A;  3FKI B;  1J9O A;  1EU4 A;  4C56 C;  2F0D A;  1TWH B;  2FMM A;  5D65 A;  4QF4 A;  3T16 A;  3VR5 A;  1EIH A;  1QOH A;  4U67 3;  2WV6 D;  2A74 C;  5I6Y A;  1Q1E A;  2MJ8 A;  4TSS A;  2WAQ B;  3VA7 A;  2KCN A;  4WFN 3;  3NUC A;  1D2B A;  3O13 A;  1IW7 D;  4G7O C;  1JCK B;  1VF7 A;  2A5H A;  4RAU C;  3HG9 A;  2F0U A;  2B2T A;  1CQV A;  5C0X J;  5JEA J;  4KY5 A;  2L4N A;  1ROD A;  1BUV T;  3GQB A;  1UEA B;  2PO4 A;  4DGZ A;  2C9O A;  2KUM A;  4HAE A;  1IHZ A;  4ODG A;  3MA2 B;  5CV8 A;  2CW0 C;  4RGO S;  5CBE E;  4IUP A;  4RCO A;  2HCI A;  4A3F B;  3MXU A;  1Y8O B;  3S17 B;  2FFK B;  4J1M A;  2IPK D;  1C48 A;  1NSN S;  3AMU A;  1A3T A;  5CR3 A;  2EYM A;  1LTS D;  2QDB A;  3S1N B;  3KBG A;  3N6R A;  3S1M B;  4JBW A;  1TII D;  2PW7 A;  2FIN B;  1MSG A;  5ELF A;  1Q1B A;  3CU7 A;  3K5O A;  2PNR C;  1PLF A;  4WJW A;  1ZYR D;  2D62 A;  2JYO A;  4K6L A;  2FMC A;  1TVX A;  3NE5 B;  1JR0 D;  4K6D A;  4OIK A;  4K2K A;  1TWG B;  2B2Y A;  4XQJ A;  3T51 B;  4BBR B;  2HUG A;  2L5T A;  2ID0 A;  1X32 A;  2XSC A;  1S5F D;  1BBX C;  1EY5 A;  1DON A;  4HCS A;  4FYD A;  2RDG A;  1SNM A;  2N55 A;  2F0M A;  4RHS A;  2V4D A;  3M7G A;  1D5M C;  3S9W A;  2BA1 A;  2M2L A;  5J1Z A;  1PMR A;  2A6E D;  2LKV A;  2XWB B;  1LTA D;  2NBF A;  2F0O A;  4IFD J;  3J81 E;  5FLX E;  4C3J B;  4M1U B;  2B39 A;  1KNE A;  3OMC A;  1PZK D;  5JOB A;  3SK4 A;  3QOJ A;  1I4Q A;  3I8Z A;  4C3I B;  4WRD A;  3ND8 A;  3P75 A;  3GV6 A;  5ELD A;  3MFY A;  4ZKC B;  3K59 A;  1SNO A;  2ZXO A;  2RDF A;  3C1F A;  2N88 A;  1U4M A;  1GJX A;  1I3Q B;  1FNU A;  1Z7T A;  2GA4 B;  3M4O B;  1BCP F;  2J0T D;  1Q90 A;  1SYD A;  5DM6 3;  1Q8I A;  1LTT D;  5G3L F;  1G2T A;  1EOT A;  1ET9 A;  1OXS C;  1SNP A;  1STA A;  4NMZ A;  3BG3 A;  1TS5 A;  1HTP A;  2QEJ C;  5CC4 A;  3CRL C;  2PZU A;  1QJO A;  5C6A A;  4KJO A;  4ABN A;  3M85 A;  4RKL A;  1KDA A;  3EJI A;  1Y8P B;  3M4Y A;  1GOZ A;  3MXG A;  3Q0A A;  5EQ0 A;  1E2Z A;  3WOE A;  2B2V A;  5CBA E;  1TWF B;  2CVR A;  2WIN B;  2EE1 A;  1H9R A;  2BDN A;  2OXP A;  5IGD A;  3NTH A;  4DNR B;  5C5L A;  3GTK B;  1LT5 D;  5M3M B;  1HFN A;  3MAQ A;  1O7Y A;  1Y69 U;  2Y0S B;  3URY A;  5JJZ A;  1F9S A;  3BS1 A;  1FNV A;  2Z8L A;  3T4A C;  1M4V A;  3H6M A;  3HP3 A;  2K33 A;  5FOB B;  2HQE A;  1DM0 B;  1ZEQ X;  3A55 A;  2HCC A;  4H44 C;  1TWC B;  1SBB B;  1NAP A;  5KND A;  1Z47 A;  4C1N K;  2L0C A;  5D3D A;  2LMC B;  5IOC A;  3BYY B;  3K58 A;  4ME5 A;  1U4R A;  3QOL A;  1LAC A;  5M5W B;  2M00 A;  1A2U A;  2NN6 H;  4KY6 A;  1FR3 A;  2BA0 A;  4F7X A;  2F0W A;  4C3H G;  3P20 A;  4O1N A;  1GUW A;  1H9J A;  3MXP A;  3GV3 A;  4CGY B;  1DOK A;  1F77 A;  4M8A A;  4RGM A;  1SE4 A;  5LHY 1;  1GHJ A;  1H9S A;  2BE5 C;  1AZQ A;  3D6C A;  3J7A F;  1B1Z A;  3PIO 3;  1RHP A;  1TT2 A;  4RKB A;  3P7J A;  4PMW A;  4XYQ A;  1DZ1 A;  4FF4 A;  2PCF B;  2YYZ A;  4J8Q A;  4PMB A;  4LJZ C;  3D8G A;  3GTM B;  1A3V A;  4YIJ A;  2O5J C;  2R6G A;  2BCO A;  2SDF A;  3LX0 A;  4PV1 C;  3W3A A;  2NUC A;  5EPK A;  1HHV A;  3D4W A;  1AZP A;  4DU9 A;  5BN4 A;  3H0G B;  2A73 B;  5E4W C;  1KDC A;  1HFG A;  3I73 A;  1Z6H A;  5EPJ A;  1AP0 A;  3KLR A;  3VR4 A;  2H1E A;  1DCZ A;  4CHT B;  1EYD A;  1EEF D;  1JIC A;  2O5I C;  1SMY D;  1EY0 A;  2WKD A;  2RSO A;  4OHJ A;  1LT3 D;  1SSO A;  2KOL A;  3H3V C;  1D5X C;  1ET6 A;  1EYA A;  1A2T A;  5EKI A;  3OSO A;  1K8M A;  4CBV A;  5C0X H;  5JEA H;  1XWE A;  4KN4 C;  3ZYY X;  1CA5 A;  2EXZ A;  1KDB A;  2QKI C;  4KKS A;  2KVM A;  2E75 C;  1OO9 B;  3Q6S A;  3IL8 A;  4A3J B;  3TME A;  2B2T C;  1Y8N B;  4QMG A;  5KRU A;  3NTI A;  1YNJ C;  1HA5 A;  3DMU A;  1AFP A;  2QCP X;  4KHV A;  1BF4 A;  1LT6 D;  4OO1 H;  3PUV A;  3SK8 A;  5KGU A;  3TZU A;  3SK5 A;  3NQI A;  3OW7 A;  4QIW B;  4N9T A;  1KLU D;  2KA7 A;  4FNF A;  3DHQ A;  2XVS A;  4K14 A;  4DAY A;  2EY1 A;  1SJH D;  3ITP A;  1ILP A;  3OIP A;  3NTK A;  1B50 A;  1WTP A;  3BZD B;  4V19 0;  1BDO A;  1T5X D;  4NW2 A;  5JVH 3;  4RHR A;  3F2U A;  3SXH A;  1JOQ A;  5CV7 A;  2HDM A;  1R4Q B;  2IL8 A;  2B2Y C;  2VXW A;  3HOY B;  3MZ5 A;  5IT9 E;  1EZ8 A;  1HUN A;  1I4G A;  1ESR A;  4GZY C;  4B9W A;  1OXU A;  2FHT A;  1L0Y B;  1HUM A;  4IFD H;  2VB3 X;  3MWY W;  3X3N A;  4FO2 A;  2QF7 A;  3K7A B;  1HQR D;  1JWU D;  2DNC A;  4IQZ A;  1L0X B;  2XWJ B;  1BR9 A;  1V1O A;  2F0J A;  3HGB A;  2B2U A;  2RKS A;  2A6H D;  1BNZ A;  5K5P A;  4DK0 A;  1B3A A;  2JP1 A;  1YNN C;  3HS0 C;  5KNB A;  2AWO A;  1DJR D;  4PQX A;  1I50 B;  3NHH A;  1CHQ D;  3FPP A;  1B9N A;  4HMJ A;  3ERO A;  3T13 A;  2KCC A;  4ZYS A;  5TSS A;  1KNA A;  3OPO A;  2JA8 B;  4RFB A;  1ESF A;  5C4Z A;  4DAV A;  1SND A;  3A8J E;  3OWE B;  4K5V A;  3GTJ B;  1GUT A;  4IAL A;  2PW5 A;  4KJN A;  4XDX A;  2LS0 1;  5M5Y B;  4BY7 B;  5CGK A;  1JC7 A;  1T5E A;  3CQZ B;  1I4P A;  4HTH A;  5A2Q L;  5F2D A;  4C3J G;  4QB4 A;  4CKB A;  4Y7N B;  1CI3 M;  2OEO A;  5EBC A;  3DEP A;  1D5Z C;  5JPN C;  5M9O A;  1SEB D;  3K6O A;  5C4J B;  5KNC A;  5C0X I;  5M5X B;  2A69 C;  2NVX B;  4HSP A;  2B2V C;  4C3I G;  4DK1 A;  2F0P A;  4RH6 A;  4ZRZ A;  4X3U A;  2NWG A;  2NVQ B;  3HOX B;  2NVT B;  1NUC A;  3PUW A;  1BCP C;  5FO7 B;  1JOR A;  3FRP B;  4DXG A;  3AB9 A;  3C3L A;  5COR A;  3GTQ B;  4OO1 I;  4K5W A;  5KIX A;  2EZV A;  2AQ1 B;  3TP8 A;  2F0I A;  1MBY A;  3AU7 A;  1GUS A;  5C3X A;  2XIW A;  2F0Q A;  1QG7 A;  4OL7 A;  1MI2 A;  3VR2 A;  4B9X A;  3VYR A;  5DM7 3;  1SYB A;  3ERQ A;  1F9P A;  1V1P A;  1PFN A;  1DOL A;  4HR7 B;  1TKW B;  2XRS D;  5JVG 3;  1UNS A;  3D3R A;  1ENA A;  4Z9C B;  5C5M A;  2ZXP A;  3QIA A;  1TY2 A;  1ML0 D;  1RJT A;  5E1F A;  4HED A;  3D4R A;  4NP5 A;  4EVO A;  2SNM A;  1O78 A;  3SVM A;  3IAY A;  1WD0 A;  2E2J B;  3D31 A;  3KLS X;  3IKJ A;  4IFD I;  3GTG B;  1QE6 A;  4NDX A;  4EQN A;  2PYK A;  3OOC A;  3RMH A;  5ELB A;  2E76 C;  3OWF A;  4ZKB B;  2VNU D;  3DWP A;  4X3K A;  1TWA B;  3ND9 A;  4OIJ A;  2JSO A;  1EY9 A;  1RCV D;  4AYB B;  2E2H B;  3S16 B;  3I90 A;  4CJ2 C;  2QIL A;  3TDQ A;  3I4N B;  1G29 1;  4U68 A;  2F3V A;  2KQ3 A;  3EFX D;  5LL6 S;  3HKZ B;  4ID6 A;  1II3 A;  3QO2 A;  1QIL A;  2JEA I;  5FKA C;  3BDC A;  5I2X A;  1B2T A;  4WOR A;  1CFM A;  2F0G A;  1Y1V B;  1IW7 C;  4XYO A;  3DWQ A;  2WII B;  1JWM D;  1WCM B;  1TS2 A;  4NKL A;  1G2S A;  2RDH A;  3I72 A;  4KK7 A;  2E2I B;  1CT1 D;  5FO9 B;  3NP8 A;  3VR6 A;  3J7A V;  2SEB D;  2EY6 A;  3GTL B;  4CJ1 B;  4XT1 B;  5IGF A;  5C44 B;  1BOS A;  1KTK A;  1S5D D;  1U4P A;  2WP8 J;  4LK1 C;  1LTI D;  1F9Q A;  4XQN A;  1DD2 A;  1SYC A;  3DXJ C;  2PZW A;  5T1I A;  2BOS A;  1PTO H;  2F0N A;  1C4Q A;  5HGT A;  5AFW A;  1SJE D;  3M7N A;  4IUN A;  1UAP A;  1ZYR C;  4PMC A;  1H9K A;  1EEI D;  4XIG S;  3TZD A;  1WTQ A;  4BBS B;  2F3W A;  1PFM A;  3PUX A;  1EZ6 A;  1PTO D;  3EQL C;  5K36 H;  1VDZ A;  2AUK A;  5CYU A;  1QNK A;  1EU3 A;  3CRK C;  3TN2 A;  5CV4 A;  5IGC A;  3QJY A;  3SK6 A;  1V8Q A;  4DF7 A;  3NBH A;  4KKU A;  1WTO A;  1GXD C;  4JK1 C;  2HDL A;  3VYT A;  4FF3 A;  1CA6 A;  1V43 A;  3K5N A;  1SFO B;  1GUN A;  2A6E C;  2R3Z A;  1STE A;  2JXM B;  2LY7 A;  4Q5V A;  3RLF A;  5CMD A;  3L9A X;  2R93 B;  5I9O A;  2MPM A;  4KI0 A;  1Y1W B;  3A8K E;  4TQU S;  1LLR D;  1E0B A;  4BY1 B;  4F8M A;  5DNF A;  4R8I A;  2F0K A;  2KEC A;  2B2U C;  3NK9 A;  3L3O C;  1OXT A;  1LTB D;  5JPM C;  1RTN A;  1PRT D;  2F0S A;  3IFT A;  1I4H A;  2AQ2 B;  4R8N A;  2X69 A;  5IGG A;  2TSS A;  1HRJ A;  3E6Z X;  1EFI D;  3KLS A;  4RGN A;  2EY2 A;  5A2Q E;  3PUZ A;  4KTA A;  2ICE C;  1PTO B;  3U9S A;  3S1Q B;  2F1M A;  1XXG A;  2RQX A;  3GP7 A;  2FJ2 A;  1YNN D;  4C2M B;  2PPB C;  1HA6 A;  3I3C A;  2NZ1 D;  4V0B A;  3MEH A;  2A68 D;  3WDN A;  5C0X G;  2D9U A;  4A3E B;  3EVQ A;  2J7Z A;  5EPL A;  5FLX L;  1EWH A;  3VYS A;  3RUZ A;  4BA1 I;  2EJF C;  2F0E A;  3NSW A;  3R3O A;  1SAP A;  1WTR A;  1PZI D;  4QCL A;  5FO8 B;  3RD4 A;  1ENF A;  4DXF A;  3OMG A;  4DA2 A;  4B08 A;  3K5M A;  5IIF A;  1TR5 A;  1X3P A;  4N9P A;  4K2L A;  5IGB A;  2DY8 A;  2EJG C;  4OGQ C;  1PRT B;  3A7A B;  3PV0 A;  2C5C A;  2E74 C;  1D1K A;  1KLG D;  5KYL A;  1Q12 A;  2VUM B;  1M8A A;  1STG A;  4FP5 D;  5ELC A;  2K6A A;  1I4X A;  3MVV A;  3Q22 A;  2DN8 A;  1O80 A;  4CJ0 B;  2CW0 D;  2JE6 I;  2IW3 A;  2R61 A;  5EGT A;  4X3S A;  3J7Y W;  2EYP A;  1BCP D;  2PMZ B;  1I6H B;  4TKO B;  1KAA A;  4QUC A;  1VMP A;  5I4D A;  2Z4I A;  2EYH A;  1JB3 A;  2K5D A;  2F03 A;  5ELE A;  1F9R A;  5I9P A;  1FGB D;  4IFD G;  1XYI A;  1EQT A;  2I46 A;  1TU2 B;  3P1H A;  1B4O A;  4LAA A;  3R8B A;  1BO0 A;  2WB1 B;  4XXE A;  3C46 A;  1I4R A;  3DM1 A;  4ZLT F;  1A6X A;  4K8J A;  2Z4H A;  1SYF A;  5E3F A;  1F2L A;  3NWT A;  5EKL A;  3HOU B;  5ISR A;  2K5W A;  3T56 B;  2NN6 I;  5CV9 A;  4FF2 A;  1D1I A;  2J4X A;  3A54 A;  1LV9 A;  2JA6 B;  1HPC A;  1ZXT A;  3GTP B;  2Q8I B;  2KHS A;  1WTV A;  2MHV A;  2K05 A;  1NCV A;  1BCP B;  4UDU C;  4R9W A;  4RCN A;  2L11 A;  2L12 A;  4HN7 A;  2XRQ D;  1WTX A;  2KED A;  3BDO A;  1STN A;  2D2C C;  4RA8 A;  1SMY C;  2SNS A;  1SDF A;  4S3S A;  3DUZ A;  3PO2 B;  2OF1 A;  2AUJ D;  1ENC A;  1TQO A;  3MC0 B;  4QUF A;  4BWG B;  3MTS A;  2ZXR A;  1DOM A;  4KMU C;  5KEE A;  1IL8 A;  3V96 A;  3OIQ A;  4IZ8 A;  3VR3 A;  3G6J B;  2DY7 A;  1EY4 A;  3SE0 A;  5A35 A;  3R2T A;  1PTO F;  1O7L A;  2CQA A;  1HTL D;  2EYL A;  5EKK A;  3R93 A;  4DNT B;  5LL6 X;  2XNA C;  2IX1 A;  2CHB D;  4H7B A;  1S4Z A;  4UAI A;  1D6E C;  1VCI A;  3GD7 A;  2VB2 X;  1C8C A;  4IUU A;  1WD1 A;  1JOK A;  3SHL A;  4FVM A;  4Q0F A;  1H9S B;  4IUQ A;  1STY A;  3D4D A;  1W6J A;  1SXT A;  3NQT A;  4KV6 A;  2RVL A;  1LAB A;  1IKM A;  1S5E D;  2E2D C;  3BVZ A;  4E6I A;  3WOF A;  1TY0 A;  2AQ3 B;  5HUR A;  4KN7 C;  2Z1C A;  5J22 A;  2JEB I;  1RD9 D;  1PRT F;  1EQV A;  2RA4 A;  1OXX K;  3V05 A;  1EIG A;  3GO5 A;  3BVG A;  3KF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...