4HEDA

Zebrafish chemokine cxl1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
PGVCFKVLTTKEPKANIKRCYNLPKTNNCLKCVLFVDASNRMKCIDPNASWLAERLYRLKEKGVTCRGEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural insight into the evolution of a new chemokine family from zebrafish.
pubmed doi rcsb
source organism Danio rerio
molecule tags Signaling protein
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hedA00
4MN3A 2N55A 2FINB 1WTPA 2DY7A 1PFBA 5E4XA 1VMCA 1B3AA 1HUMA 1X32A 1RJTA 4IUTA 4HCSA 5EKIA 2HDLA 4U68A 3KBXA 1B50A 2IL8A 2MPMA 2X69A 1G2SA 2K04A 2VXWA 4HAEA 4ZLTF 1WVLA 1O7ZA 2KEDA 1MI2A 1KNEA 5CBAE 1E0BA 1EQTA 1JICA 1NCVA 2JP1A 1RTNA 1JE4A 1KNAA 4HEDA 2DY8A 4IUVA 4XT3B 4RWSC 2MGSA 5CBEE 5AFWA 1GUWA 1ICWA 2BDNA 1CM9A 1X3QA 2RSNA 3GV3A 2MP1A 5JJZA 1RTOA 3F2UA 3TZDA 1J8IA 1PFNA 2B2TA 1AP0A 1SAPA 2XIWA 4XDXA 5COYA 1DONA 3MWYW 1TVXA 1AZPA 2L11A 4X3UA 1B2TA 2FJ2A 2X6LA 1VMPA 2J7ZA 1WTVA 5EPKA 1XX8A 1DOLA 1Q3LA 4OIJA 2RSOA 5EQ0A 2B2TC 2SDFA 1EL0A 1HUNA 1PLFA 4HSVA 2KOLA 2Q8RE 4MHEA 1G2TA 1PFMA 4X3SA 2L1BA 1WTQA 1O7YA 2FMMA 5E4WC 1HFGA 3SVMA 3N52A 1F9SA 1BBXC 4CJ1B 1IKLA 1B4OA 2B2UA 2B2WC 1G6ZA 3GV6A 1F9RA 2K03A 1S4ZA 5T1GA 4DN4M 3FDTA 4ZKBB 1F9QA 4LMQD 5DNFA 2NYZD 3I91A 4IUQA 2B2UC 1ESRA 2N88A 3HP3A 4X3KA 3TN2A 4CJ2C 1QG7A 2K01A 4ZAIA 2K05A 1G91A 2CVRA 1F9PA 4ZK9B 1WTOA 1C8CA 4QUCA 1NR4A 5D65A 1BF4A 2B2WA 4QUFA 2KUMA 2H1EA 1A15A 1MSHA 3DEOA 3IL8A 2NZ1D 2HDMA 3IFDA 5EPLA 2K28A 1O80A 3I90A 2L4NA 1RHPA 1BO0A 2RA4A 2B2YC 1CA6A 1WD1A 1IKMA 2L12A 4IURA 3LWEA 3DEPA 3UI2A 1B53A 1RODA 3DM1A 3I3CA 1CA5A 1ML0D 1U4LA 2R3ZA 2EPBA 4O42A 1XYIA 2NWGA 4NW2A 4X3TA 1ILQA 3D6WA 4RA8A 3MTSA 4CJ0B 3KUPA 1ILPA 4RAUC 3QO2A 4IUPA 1WTRA 1X3PA 1U4MA 1WTXA 2KECA 2B2VC 3G7LA 1BNZA 1EIGA 2RVLA 2X6GA 3R93A 1J9OA 1EOTA 3H91A 2B2YA 2K1BA 3Q6SA 1WTWA 1DZ1A 1DOKA 1HA6A 1QNKA 5T1IA 5EJWA 3P7JA 3FPUB 1HFNA 1HHVA 1SSOA 1WD0A 2HCCA 5D14A 5EPJA 5CORA 1EIHA 2HCIA 2Q8TA 4UAIA 5CMDA 4XT1B 1F2LA 4ZKCB 1MGSA 2FFKB 4R8IA 1NAPA 4OIKA 2HUGA 2MJ8A 2JYOA 4IUUA 2B2VA 2EE1A 2KEEA 3I8ZA 1NR2A 1QE6A 1HRJA 2FHTA 2KVMA 1AZQA 1IL8A 1MSGA 2D9UA 1M8AA 1DOMA 1U4RA 3ONAB 4R9WA 1U4PA 1ZXTA 2EOTA 2M2LA 2L9HA 1PDQA 1SDFA 1LV9A
chains in the Genus database with same CATH superfamily
2Z8LA 1N8RC 1YNNC 1HUMA 4JI7L 2QEXA 3C46A 1PTOC 1P8LA 3RLOA 4V190 1K9MC 3PF5A 1IW7C 1E0BA 3S16H 3AQQA 4DV5L 3ULJA 2R93G 2B63H 2RSNA 2EYOA 3CCEA 4JI2Q 3D8GA 2Z0SA 5COYA 4GS3A 2M00A 1R9TH 1XTDA 2D0PA 2PMZB 4KN7C 4LFBL 1Q3LA 2DGYA 5LMNQ 1Q12A 4B3MQ 2FMMA 1GUNA 4OO1H 1SRUA 2B2UA 5IT9E 5ELOA 5J3BA 3S17H 3VYTA 2K5QA 1SYGA 2AQ1B 4A4IA 2EDGA 3PUYA 3S2HB 2A74C 4V0BA 2AUJD 1VQ9A 4ZAIA 3I56A 4Y7NB 5BN5A 2HD3A 1EY9A 4A3CH 2F0SA 2F0WA 1TQOA 1SNPA 1JJGA 2Y0SB 1EQQA 1K83B 3T51B 1Y1VH 1TS5A 2ENBA 4C3IB 1IBLQ 2V1CC 3ERQA 1VQPA 2RQXA 5IWAL 4KMUC 3VDYA 3DHQA 4CDEC 1K73C 1WTXA 1LTSD 2K4KA 4DAMA 1KL9A 3HOYG 2JA5B 1ENCA 3H91A 4IN3A 5I9OA 4JI4Q 3TMEA 1PRTB 3L0OA 5EPJA 2OXPA 2E76C 3GTGH 5M5YH 1RL2A 1F2LA 2A6ED 1PTOB 3NBIA 4K5XA 4ME3A 1I4HA 4E6IA 2JA6G 2ZJRA 2PQAA 1NR2A 1LT4D 3NTHA 4MTNA 4EX5A 2N49A 3CAMA 3I7FA 4A3EB 3KLWA 2EVBA 4DV4L 3S15H 1MD2D 4MN3A 4DV6L 3D0FA 2FINB 5C3EB 4ME5A 4P75A 2SOBA 1U9RA 3KYHC 1JWSD 1EWIA 5JPMC 1I6HH 1HNWL 1XMQQ 1AN8A 4AQYQ 1XPUA 4IUVA 2ES2A 4GOPC 4JBKA 3ITPA 1X3QA 3DWPA 5GROA 1D6EC 2BH8A 4DAYA 3CMAA 1KAWA 5CV9A 3FKIB 2F3VA 1B70B 2A69C 1GO3E 4R4IA 4LFBQ 3A5ZB 3FMCA 5JEAJ 5I2YA 1I4PA 1XX8A 1DOLA 4FYDA 1H9RA 5EQ0A 4POFA 1CI3M 5BR8Q 4MHEA 5FKAC 4DUZL 1STAA 4LF6Q 4GOPA 3K81C 4N8FA 1UAPA 3K5OA 4X66Q 2ZT9C 1H95A 2R61A 4FF3A 2F0JA 2NZHA 3F1ZA 1JMCA 1PYBA 3E3XA 1GD7A 1EWHA 5I6WA 4X3KA 4A3FG 3BU2A 5BN3A 3CC7A 4GN4B 3PCOB 4YWKA 3F2DA 2GVBA 1FD7D 5E3FA 3Q8DA 3C1FA 1NNXA 3EJIA 3CQZB 1F77A 2PQAB 4YHHL 4Q5VA 1X65A 2VQFL 4G57A 2IW3A 3HFZB 3HOZB 1JJ2A 1ET9A 3PO3G 4PQXA 1U4LA 1PH5A 2K5NA 5IWAQ 2CW0C 4O0AA 3R3OA 1S5DD 5K36H 2I0QA 2R6GA 3STBD 4BA2I 1NBWA 3L3OC 5GAEC 3Q22A 1BNZA 3EIVA 4A3JB 5C4XH 1JOQA 3MEFA 3F2BA 1HZCA 3D4RA 3CC4A 4BXXH 4DAYB 3TREA 1CSPA 2NBFA 4TKOB 3RD4A 5IGCA 3I4NB 1MKHA 5J39A 4GKJL 1TWGB 3KBGA 4JI1L 4JI6Q 3NEMA 2F4VQ 2UUCQ 3HOXH 4DAVA 4UPAA 2VL6A 2RF4A 2WB1G 4BY7H 1EFID 3I73A 2EY2A 2WP8J 1U4RA 2VNUD 4R9WA 5AJ3Q 2IJ0A 2M2LA 3S1NH 1CSQA 2BH2A 1B3AA 3HS0C 1X32A 4J8QA 5C3WA 1B50A 1SROA 1G2SA 2K04A 4ABNA 2JA8G 3D4DA 2I5MX 3FVQA 3R8BA 4RGTA 3FHWA 1B9MA 4HEDA 5EAYA 4RFBA 1NY4A 4IZ8A 4H0LC 5ELEA 1N33Q 2ZJPA 3MEHA 3Q24A 4DUYQ 2NVTH 3GP7A 4XDXA 3S16B 4DR4Q 4IOCA 2MHVA 3SK8A 5LMNW 1G6PA 2X6LA 1F2MA 1WTVA 2B63B 4JYAL 1YVCA 2WINB 4HSVA 1S5BD 4LF8L 1R9TB 5E1FA 2NN6G 2ZTEA 4XIGS 2O2LD 1HZ9A 1YIJA 3W2DA 4K2KA 3TRZA 3TP7A 1VQCA 4A3BB 4KI0A 3I4MH 5M9OA 4C3JG 3NQTA 1GKHA 2N88A 1BCPF 4HMJA 4N9PA 5GQOA 4LF7Q 4WFN3 3S17B 1H9KA 1YITA 2AKWB 4GKKQ 2R92G 2WAQB 4DA2A 4CDDC 2EJMA 1HR0L 4A3KG 2K28A 3GTOH 2JXMB 2RA4A 4DR6Q 1N34Q 2R3ZA 3CCUA 1Y8PB 1BR9A 1FNVA 1JB7A 1DD2A 1NTGA 1WTRA 1K28A 3PO2H 2YV5A 4N9TA 1E1OA 1STEA 2Z4HA 3NUCA 3I4LA 3GTJH 4WJ4A 2VY3A 1DYQA 2DNCA 1MIUA 2MO1A 3KLRA 4X6AH 1E22A 4WORA 2NVQH 2MO0A 3T1YQ 4IUUA 3L7ZC 5LHY1 1KIXA 3CCVA 1N32Q 3BJUA 1T5XD 1BBWA 1TIID 1KDCA 2FHTA 5M5YB 1W2BA 4L6TB 2Z1CA 3CW2C 2HHHQ 1PH2A 4B3SL 1VQMA 3K0YA 4KKUA 4B3TL 1TY0A 2MUYA 1CM9A 4QY7A 3GV3A 5L37A 1I6HB 1W6JA 1PFNA 1UNSA 1EYGA 3MAQA 5EGTA 2L11A 3VR4A 4LF9L 1XNRQ 2QGQA 4IPHA 1SEBD 1TWFH 1Y8OB 1WCMB 2Y0SG 3MZ5A 1FJGL 2VZAA 2YU9H 3SVMA 4JK1C 4C3HB 5D3DA 1VF5C 1B4OA 4C3IG 2UXDQ 4B3RL 5DM73 3FDTA 4RHRA 1OO9B 4ZKBB 3ICEA 3LGJA 1WTHA 1LM0A 3G4SA 3CF5A 3OIQA 1GUTA 1WI5A 4KKSA 1YJ9A 1DGSA 2CVRA 1WTOA 3AMUA 3E6ZX 2F0EA 2JA5G 3GTKB 3MFGA 5IOCA 1QJOA 4G7ZC 4PMBA 2ZM6Q 1VQ8A 3VR5A 3HOUG 4N8X1 2O5IC 3SHLA 1N36L 1VS0A 1SYCA 2M9VA 3DM3A 3NELA 5IP9G 2L12A 3SDZA 3T1HL 1CA5A 3CCLA 1KXLA 4DV1L 1XYIA 3OMCA 2NVYH 5IYBH 1EY8A 5KNBA 3QO2A 1CHPD 4LK1C 2D5DA 2CH4A 5FJ8H 4H44C 4A3GB 1E2WA 4ILWA 3UDIA 5C3EG 1QWYA 3AB9A 1STBA 3Q6SA 5DLQE 1QOHA 1I6VC 2QDLA 4CKCA 3NTKA 2Z9HA 3H0GG 3J7A5 3SXHA 4NXNQ 4KN4C 1MGSA 5HY6A 2G9DA 3EQLC 1G8ZD 3HEJA 4JI5L 3KLSA 3FKIG 5J22A 4R4OA 3D6CA 3HOXB 4ODGA 3EN2A 4FXGC 2KENA 2EYPA 1SMYC 5DAUA 1XXGA 1JE5A 3S1NB 2KEDA 1ZKOA 4C2MH 1SNOA 1PH3A 2E2HH 4XT3B 1CKNA 2MGSA 3DXJC 2OTJA 4RG1A 4WRDA 4NXML 2D0OA 5M3FH 1AP0A 4LFCL 5C4ZA 2F0MA 4BA1I 2XIWA 2CQAA 3QWNA 1L1OC 1X3FA 1YHAA 1NJIC 2Q2UA 3BDOA 4X65L 3DLLA 2EJGC 4YCUA 5E7NA 2WV6D 2A6HC 3HOZG 3KJPA 5C0XJ 1S4ZA 3U4VA 3MXGA 3T13A 3CCJA 3S1RH 2PW7A 4F88A 2IT1A 1VQOA 4OGQC 2KHIA 3AFQA 1C7YA 4FO2A 4C56C 3S24A 5M5WH 1C4QA 4LUOA 1G91A 4AH6A 3I4MB 4OL7A 1Q82C 2B3GA 3JC66 4QUCA 4A3JG 2F0IA 1ZEQX 5IP7H 4JI0Q 4JI8Q 1VQHA 2G9HD 3I4NG 4JPBW 1JB3A 5IYDH 3E9IA 4Q0FA 4AYBE 3C3LA 3H94A 2UUBQ 4DK3C 4DR1L 4CKBA 2DN8A 2MFIA 1QVFA 1DM0B 3HOVH 1BCPD 2UXBQ 3NTIA 3M7NA 2B2VC 2SEBD 1EIGA 1EUJA 1VQIA 4YIJA 1A3TA 4YCWA 1CKNB 1VQ4A 5KIXA 1A8VA 2NVXH 3PO2B 5EJWA 1HNXL 4KHVA 5FLMH 3RR5A 2UU9L 5JAVA 2XSCA 3W1BA 4UDUC 1A6XA 1LTAD 3VR3A 1HCZA 2VS1A 1Q86C 3GTJB 4H7BA 3J81c 4LAAA 2RDGA 3M4PA 2B2VA 1Q46A 4A93B 1TWHB 4KY6A 1B44D 1IL8A 2GA4B 4GLVB 1BDOA 4CHTB 3ONAB 2NVQB 1TXYA 3E0EA 4HIDA 1Y14B 2CH4W 1PZJD 4IUTA 2BOSA 3WOFA 1B1ZA 4RH6A 2EYJA 5C44B 3OWEB 2JE6I 1E2ZA 2EY6A 1STHA 2GN5A 1IKMA 3LWUA 3ZJYC 1EQTA 1XMOQ 2CCZA 1ET6A 4A3BG 1EOVA 1EU4A 1VF7A 1XPRA 1JOKA 5I2XA 2BDNA 2I5HA 1PVOA 1I94L 2EZVA 2EY5A 3E0JA 1JORA 3OWFA 4DV7L 4R4TA 2FJ2A 5CV6A 2WAQG 4LNQA 1FR3A 1T9HA 1PRTC 5IYCG 1EL0A 3SR1A 4EQNA 4FXDA 1BUVT 4A3CG 1TU2B 1TWFB 1G6ZA 4LWCA 3J80c 1EIYB 3TP6A 2BA1A 3RMHA 3JAMc 4FF2A 1DJRD 2YU9B 1UE5A 1KHIA 3X3NA 1PH7A 2B2UC 3TN2A 1M90C 3HP3A 3KF6A 4KLKA 4HJ8A 1Q1BA 1SE2A 1NR4A 2RCNA 4OX9Q 5IGGA 4NDXA 2AHOB 1SN8A 3TQYA 5EPLA 2XWJB 1QB5D 2E8GA 1LO5D 4ZUJA 4IFDI 4JW0A 2HQLA 5HURA 2PO4A 4F87A 2JSOA 3KDFA 3I55A 2PI2E 3KLSX 1J5EL 2R7ZB 3MTSA 3T53B 1B9NA 2HT1A 1EZ8A 2KECA 3NK9A 5ELDA 3M3YB 2NVYB 3OTOQ 4A3DH 1HNXQ 5CGKA 1IYUA 2PMZE 1WD0A 2NB0A 5D14A 1STGA 1JC7A 3C1EA 5FO7B 3S1QB 2FFKB 3OW2A 4H13C 4HCEA 1PTOF 1GUOA 3DUZA 4JV5L 5M5XH 2DJGC 1M8AA 2IX1A 5D3IB 4DV3L 4LFAL 4M1UB 1KLGD 2LMCB 1WTPA 1PH4A 1EYAA 1WCMG 1EYDA 2BCOA 4HTHA 4K6DA 5C6AA 1X3GA 2R93H 3KFUA 2BDOA 1HZAA 4C3HG 2AMCB 2VXWA 3KF6B 5ELBA 5KEEA 2YTYA 4R1JA 2UUAL 2E2JH 3RN2A 2YYZA 3CRKC 1EFWA 4BY1B 4QL5A 1RF2D 3OW7A 1IYJB 4LF5L 5JEAG 2E2HB 1TVXA 2E5LQ 4X3UA 2KHSA 4O1NA 1HTLD 2J7ZA 1QVGA 1EY7A 5M3FB 1G2TA 2AUKA 2KOLA 4JI7Q 1D5MC 3KDFB 1C48A 4DNRB 3L9AX 3OSOA 5IT9c 1HXYD 3T4AC 1UE7A 4DV5Q 3CC2A 4LMQD 2ICEC 2RDHA 1STYA 3NPPA 3O13A 1LTLA 3H3VI 4A3GG 1SXTA 2EIFA 4UP8A 4DR5L 3S14B 4TSSA 5K36G 1A15A 1BQQT 4L5QA 4PMCA 2A73B 2EQSA 3U50C 1QZHA 3J81j 4Y52H 2A8VA 3HKZE 3BDLA 1NMFA 5BN4A 3VYSA 1PH1A 2VB3X 1Q7YC 2UXCL 1X3PA 3HOWB 1YEZA 3NE5B 3HOXG 3G7LA 4I7ZC 1SR3A 2WIIB 5A35A 3IFTA 5FOBB 3S1MB 1T5EA 4I65A 4FVMA 3NP8A 4EQOA 1UE1A 4A3IB 3P7JA 2JA6H 1LYLA 2B8GA 4RKLA 4GLXA 3GTMH 2NVXB 1II3A 4OIKA 1KQSA 4U673 4OXPA 2PYKA 4NPSA 3M85A 4XQQA 3BVZA 1D7QA 3GTLB 4IFDH 1GM5A 2L9HA 1I3QH 4FXKC 5E4XA 4KJNA 4HCSA 1LUZA 2IX3A 1VQEA 1JCKB 1PZID 4BBSH 3KK7A 4KHZA 1K3BC 3R2IA 2C5CA 1WFQA 4GLAC 3LX0A 1Q90A 1Y1WB 1J8IA 3TP8A 3MWYW 3I4MG 4DV4Q 1ZYRD 5C5LA 1VMPA 2PZWA 4R8NA 4DV6Q 5I9PA 1LTGD 2Q8RE 1PH6A 4HJAA 5E4WC 4APVA 1HNWQ 4DXFA 2CKZB 4L8JA 3PUWA 4K6LA 4C1NI 1F9RA 4DN4M 4P71A 4EVOA 3A56A 2VW9A 1TY2A 2NYZD 4G4KA 2XN9C 3A8JE 4HR7B 1M1KC 5A2QL 1ASYA 2ZXOA 5FLXc 3W1GA 4RKBA 4JI3L 5ELCA 2F4IA 1O7LA 2A19A 4KTAA 4ZYSA 3F2CA 4DR5Q 2AQ2B 1BF4A 4JBMA 1V1QA 2N78A 2OCEA 4DUZQ 2HDMA 4YWLA 2XWBB 3P20A 3MC0B 4GN3B 3BZKA 2CHBD 3WDNA 2CFMA 3DM1A 3I3CA 1HNZL 4HIKA 2K5DA 1RCVD 2EPBA 4NW2A 4A93G 1OXSC 4GN5A 2EYFA 4J15A 1ESFA 1EQVA 1TT2A 2K7VA 3S9WA 1E7ZA 2RDFA 1EY5A 1X9NA 3EBEA 2H5XA 2O4XA 1D1IA 1H9MA 1EOTA 1L2FA 4B08A 1EWCA 1D2BA 2KHJA 4A75A 1DOKA 2K75A 1QNKA 5JVH3 2VQFQ 4YHHQ 4HJ7A 4YY3L 5C44G 4IO9A 1NMGA 2F52A 2F0NA 3A7AB 4JCVE 3FEWX 3H3VH 3CRLC 1V43A 1HTPA 5F2DA 5HGQA 1Y1VB 2K50A 1I50H 4NKLA 1Q1EA 1VCIA 2OT2A 3K8AA 1U4PA 2Z6BA 1LT6D 2JA8H 1Y69U 4G7HC 5M5XB 1VQAA 2R7FA 1TS3A 5LMUL 3U58A 1J6QA 4GKJQ 1SLJA 3R2TA 3G48A 4JI1Q 2DY8A 1SE3A 1YNND 5IIFA 4LUZA 1BCPB 1PTOD 3NBHA 3GTGB 1IW7D 1DONA 2EY1A 3EROA 3Q0AA 2NN6H 3CMEA 3MXPA 4DV2L 2JJQA 5DEHA 1SNCA 1D5XC 2P5ZX 3RUZA 4CBVA 4QJFA 3VA5A 4PZ8A 2E2IH 2ZTDA 3PUZA 4C3JH 2VQEL 1BBUA 4DKAC 3S15B 4RGMA 4DR2L 2MQHA 2K03A 1YI2A 3MFYA 1EYCA 3NENA 2R92H 3I91A 2R7ZG 4A3MH 5C4JH 4IPGA 4HJ9A 4MTKA 1KC8C 3M4OH 3GD7A 1KD1C 5IYBG 1QILA 4JYAQ 5D65A 4PV1C 4K8JA 3SEBA 2IY5B 4LF8Q 1O80A 3I90A 1CK1A 4QMGA 3MXNA 1VQ6A 3PUXA 1O78A 4TVAB 2EJFC 1TWAH 4PMWA 4A3LG 1EEID 4KHPL 1ILQA 4WJWA 1HJPA 3D6WA 3K7AH 1W3SA 3UE1A 1UEAB 2WKDA 2KA7A 1AW7A 3BVGA 2XRSD 2ICIA 1C9OA 2A6EC 4KD3A 4ZCKA 1DZ1A 4DGZA 2DNEA 5H1SE 3H6MA 3MXUA 1LT3D 1HHVA 1HR0Q 1IBML 2J4XA 3NBHB 1X56A 2PNRC 2Q8TA 2TMPA 4CDFC 4XT1B 4L63B 1V9PA 4BY1G 1RKNA 1SE4A 5GAHC 3B6YA 4JG2A 4DR7L 3TS0A 4JVZA 1PYSB 3GTMB 1EY4A 5CC4A 1G51A 1JT8A 4A3EG 4ALPA 1A2UA 3BZDB 1TS2A 4DU9A 1ZXTA 2QW7A 4OIJA 4X64L 5M3FG 5DM63 3TP5A 1RJTA 2F0QA 2HDLA 3UE0A 3KBXA 3LNNA 3HZXA 5C3XA 1YJWA 2MPMA 1WVLA 1BXTA 1O7ZA 1YHQA 1JR0D 1KRSA 1RTNA 1BBXC 4Y7NH 3PMFA 5C4XB 1SYDA 4DXGA 2FXQA 1K8MA 1KABA 3F2UA 3DMUA 2YTVA 4BBSB 2J0TD 2N3SA 1FL0A 1PYWD 1EY0A 3MXNB 4K8IA 2KQ3A 4C3IH 3HGBA 3GTPH 2PW5A 3RZDH 3H09A 1YJNA 4F7XA 4AIMA 4BY7B 3J81i 4X3SA 5KRUA 1K8AC 2JEBI 4B3SQ 5C0XG 2A69D 3I70A 4CJ1B 2B2WC 2F0GA 4B3TQ 3TZUA 1F9QA 5CV4A 4X62L 4DV0L 1Q81C 3GDEA 1HQMC 5IYDG 4POGA 1VQGA 1QZGA 1ESRA 4CJ2C 2MNAA 4YWMA 3HOWG 3HOUH 2K05A 4LF9Q 5IGEA 1XNQL 2QF7A 3CKIB 5IP9H 1PTOH 2B2WA 3I4OA 4B9WA 2IHFA 2XTIA 2NVTB 4A3IG 1DCZA 1FJGQ 1BKBA 1IBKL 4DPGA 4S3SA 5IY0A 3STBC 4B3RQ 3EVQA 4JBWA 1SFOH 1SYEA 1K8OA 1DXMA 4O42A 5FLMG 4TQUS 5JVG3 2L0CA 3A55A 4DR3L 5JJLA 3J7AV 3V96A 4K0KL 1UE6A 5CV5A 3H0GH 1J9OA 4AYBB 3CU7A 2CW0D 3J80i 1HA6A 1CQVA 1LACA 1HFNA 1SSOA 1LTBD 3M4QA 1N36Q 2E75C 2HCIA 1A0IA 2F0DA 2K52A 1U0LA 3T1HQ 1NAPA 3MA2B 3C2PA 1D8LA 4DV1Q 2LFNA 2CWAA 3UDXA 5A2QE 2HQEA 1WYDA 1Y1WG 3GTOB 4DR7Q 1I4QA 2D9UA 1Q8IA 5CV7A 3R93A 5JJIA 3U4ZA 1SNQA 5LMNL 2WB1E 3CPFA 4B3ML 1I50B 4H02A 2LKVA 4UHVA 2JA8B 3MVVA 1D5ZC 2L55A 2NTSA 5JPNC 1JE4A 3D3RA 4K2LA 2K5WA 2QDBA 1STNA 3SK5A 1Z9FA 2MP1A 3K7UC 1CKMA 2B2TA 4IUNA 4JI5Q 2NZOA 1O7IA 2PI2A 3CQZH 3NHHA 2LS01 1IYVA 2KCNA 1SNDA 2PZUA 2B63G 3HOZH 4DK0A 1HUNA 2SDFA 4UP9A 3V05A 1O7YA 1HZBA 1HFGA 2I46A 2A68D 4PG3A 3A74A 3SK4A 4MNOA 3CCRA 3GTQH 4QIWE 1IBLL 2E2IB 4A3JH 2F1MA 4NXMQ 4OO1G 1W6KA 4LFCQ 2VUMH 3DWQA 4DF7A 1YNJD 3PIP3 4JOIA 4A3MB 3ND9A 4X65Q 4IJHA 5C4JB 4JI4L 4HIMA 3M4OB 2KBNA 5FO8B 1CZGA 3ER0A 1BO0A 2F0VA 1V8QA 1L0YB 3U9OA 4IURA 3BYTB 1U5KA 3LWEA 3UI2A 4ULLA 4XXEA 3VYUA 2EXDA 1Y1VG 3CD6A 3KUPA 1ILPA 3AYHB 3J7YW 3NWSA 1UWVA 1GUGA 4KV6A 4JBJA 1NE3A 1S40A 1HR0W 3K7AB 2XRQD 4I7AA 1EZ6A 2Z4IA 5M3MH 1QVCA 5CYUA 2BE5D 3BVMA 1A62A 1XMQL 3CCSA 5JOBA 4UAIA 4L5RC 2QA4A 4AQYL 3PUVA 1JJCB 4DR1Q 3V2TA 2LXKA 2F03A 2JA7H 4EQ5A 2LSSA 1KTKA 2H4OA 3ND8A 1DOMA 1NUCA 2VB2X 2GVAA 4OELB 3L2PA 2IWHA 2B29A 3RLFA 2EOTA 4KY7A 2D62A 4NP5A 4A3BH 5BR8L 2PPBC 3QR8A 4U68A 4LF6L 4R4CA 1N9WA 4IPDA 4G7OC 4X66L 2UU9Q 1TR5A 1LABA 3K6OA 1PRTF 3D4WA 3PIO3 4FF4A 2N8NA 4BBRH 1GUWA 1M4VA 3Q23A 1RTOA 5IYCH 1SMXA 5G3LF 1VQFA 1FVIA 4B9XA 2LY7A 3BDCA 1A63A 2LXJA 3GQBA 4QCLA 2RHQB 2Q2TA 1UEBA 3H15A 1H9SA 3GTPB 3RZDB 3RZOH 1EEFD 2Y0SE 3G6EA 2QKIC 5DNFA 1I94Q 1ENAA 1FNWA 3EA6A 2AWNA 1PHJA 1AE3A 3OMGA 4C2MB 4DV7Q 3K80C 2IHEA 2F0LA 1CUKA 3VYRA 1CQFA 4IOAA 1MSHA 2OWOA 3HOUB 2ZXRA 3IFDA 3DWAA 3IKJA 4RMFA 1RHPA 3FPPA 4P74A 2B2YC 1WD1A 3A0JA 5GADC 4JI6L 1F2YA 1QNUA 2F4VL 2UUCL 1IL2A 1QCBD 4FDBA 4FP5D 4RAUC 2OTLA 2ZJQA 1SFOB 5AJ3L 5KNDA 2X6GA 3S1RB 3SGIA 1SJED 2B2YA 2K1BA 4ZQ3A 4PNYA 3HKZB 4IALA 4IJLA 1D1KA 5M5WB 4IFDG 3H0GB 2F0OA 5ISRA 1ENFA 5C4XG 1VQDA 4QF4A 4BXXG 2A1AA 1N33L 4QGUA 3HOYH 1J5EQ 1WCMH 4BBSG 1VQBA 4DUYL 2PNHA 1AZQA 3HG9A 4DR4L 4C3HH 4YCVA 1CZWA 2AQ3B 3VA7A 1H9SB 2F3WA 1KRTA 1SDFA 3URYA 1S72A 4RGOS 1GOZA 1EQRA 1RDPD 1VMCA 3HOVB 2Q8IB 4BY7G 2I07B 5KGUA 1PXUA 3ERSX 2IL8A 2NN6I 3QIAA 1G291 3CP0A 1Q8KA 3I2ZA 5JEAH 1MHWC 2JP1A 1I4XA 4CGYB 4IFDJ 5I4DA 3GTKH 4IQZA 1SMYD 4JV5Q 1EIFA 4MIUA 1PA6A 4LF7L 4F8MA 1ONLA 2CWPA 1AZPA 5FLXE 5NUCA 2NUCA 4GKKL 4DV3Q 1EU3A 4LFAQ 3A54A 2V4DA 4DAPA 4ZUIA 3CPWA 1YBYA 3A7LA 4GNXC 1IZ6A 1IKLA 1JQYD 3GV6A 2UUAQ 3PF4A 4DR6L 2I5LX 2KCMA 1JWUD 1N34L 4A3GH 5ELFA 1SNMA 4GZYC 4IUQA 3GTQB 2A6HD 4LF5Q 4XQNA 3J81L 3K0XA 4PZ6A 4UP7A 1SE8A 4GNXA 3CCQA 3QOLA 4L5SA 4DFAA 4AYBG 2OQKA 2VUMB 4LUVA 4RCNA 4LW1A 3U9SA 1CA6A 1AE2A 1BCPC 4A3FH 3BS1A 1OXVA 3T1YL 1B8AA 4X3TA 1N32L 4GOPB 1L0XB 4IUPA 1UUPA 1R4PB 5EKKA 3FP9A 1H9JA 3MHBA 1A3UA 3PO3H 2HHHL 3P75A 5T1IA 3FPUB 3PO2G 1GVPA 3TEHB 2RHSB 3BYYB 3W5OA 2A5HA 2ZTCA 2CQOA 4R8IA 3J7ZC 1XTCD 5M3MB 2IX0A 3N6RA 4RCOA 2KEEA 3CCMA 1HRJA 4QB4A 2EXZA 3J80L 2UXCQ 3JAML 1A2TA 2A68C 1IHZA 5J1ZA 2DUDA 1XNRL 1AFPA 4K14A 4IPCA 3J7AF 2DY7A 2JA7B 1I5FA 3UDGA 1IXRA 1HH2P 1CHQD 4XYQA 4UY8C 2PQEA 2RKSA 5CBAE 1YNJC 2UXDL 1K0RA 4A3DB 3VR6A 5CBEE 4RWSC 1FGBD 4GNXB 1B7YB 1ICWA 3IRBA 5IGDA 2Q2HA 4CKEA 3D31A 3BZCA 3I72A 2C35B 1EY6A 5C5MA 4BBRB 5HGTA 1VQLA 2SNSA 2F0PA 1S3OA 5CR3A 2Z6KC 2RSOA 4A3MG 3BG3A 2ZM6L 4HIOA 1FGUA 1TWCH 4P73A 1X54A 2ID0A 1WJJA 1SYFA 3N52A 5KYIA 2WAQE 1SYBA 1X6OA 1V1OA 5TSSA 5T1GA 5IGFA 2HIVA 1GXDC 1PRTD 3QJYA 3CHBD 3OYYA 4OWWB 2R93B 1Z47A 2B39A 3K57A 1VQ7A 2F0HA 2Z6KA 1LTTD 3TDQA 4P72A 2AWOA 3SK6A 2K01A 3RZOB 2BE5C 2EYMA 4O2DA 5G3LD 2E2JB 2OEOA 4HN7A 3RNUA 3A5UA 4ZK9B 1LLRD 1FYCA 1C8CA 1SJHD 1C0AA 2QEJC 4KY5A 2F0FA 4QUFA 1PV4A 1HPCA 2YTXA 3IL8A 3DEOA 2NZ1D 1KAAA 4KK7A 4P2CB 3S2DH 4A93H 3OIPA 1TWHH 4WJ3M 3RLNA 4R4QA 4NXNL 3UDFA 4BS9A 3DEPA 4EQPA 3CXCA 2PZTA 3K59A 1PH8A 5C4HA 2ZXPA 1CKOA 4DK6C 2ALYB 2OQ0A 1K8GA 1ASZA 4A3KH 4MZ9A 5C44H 4JI3Q 1F2ZA 1TKWB 2TSSA 3E5SA 1X55A 3ZYYX 5C0XI 2HCCA 2JQOA 5CORA 1OXXK 1EIHA 5FJ8G 5CMDA 1CT1D 4ZKCB 1HNZQ 1BVSA 2HUGA 2MJ8A 1VDZA 2JYOA 3PQIA 2EE1A 3A8KE 3I8ZA 4OHJA 5IT9L 2EYLA 4KJOA 2XGTA 2Q2IA 1RD9D 4RHSA 1MSGA 2E74C 3X3MA 5IE8A 4EGVA 4L5TA 1E1TA 2K32A 3HKSA 1PDQA 1GJXA 3HOYB 2N55A 1VQ5A 1FNUA 1PFBA 1E3PA 2OF1A 4YY3Q 1YZ6A 2X69A 4HAEA 1MBYA 1MI2A 1NCVA 1AH9A 1S5ED 5AFWA 2JA6B 1A3VA 4LJZC 2EYHA 1JWMD 5JJZA 2JK8A 4BWGB 5LL6X 5JJKA 5KNCA 1AEXA 1I4RA 2R7DA 1CFMA 3K5MA 5IGBA 1Y8NB 3KF8A 3GO5A 3NSWA 1YHBA 3QB3A 1OTCA 2HIXA 2WKCA 2XNAC 1PFMA 3G6JB 2L1BA 4JI0L 5LMUQ 4JI8L 1SBBB 3WWVA 2F3IA 2R7ZH 2JN4A 3IAYA 4HMIA 3S2HH 3F8TA 1QUQA 1I3QB 1LTRD 2UUBL 5FK9C 3T16A 2K5VA 3M3YH 4XYOA 3VR2A 5K5PA 2ASBA 5EBDA 1YNXA 3H3VC 1XJVA 2L5TA 1HA5A 1E2VA 2UXBL 2L15A 1F9PA 1K83H 4DV2Q 2RBMA 3S1QH 4OWXB 4DNTB 2KUMA 5EKLA 2H1EA 4A3LH 1I4GA 3HKZG 1Z7TA 3NXWA 3K58A 2XVSA 2VQEQ 3OPOA 3RN5A 4DR2Q 1OXUA 1B53A 2RCFA 5IP7G 1S5FD 1XWEA 2BA0A 2JA5H 4LF4L 3PGZA 4KD4A 4RA8A 4DK1A 4A3FB 1KLUD 4FF1A 4QQBX 3QOJA 3NQIA 3ULPA 1P16A 1R4QB 4XTCS 1HQRD 1WTWA 3TBIB 3HOVG 4BY1H 5EBCA 3A8IE 1V1PA 1TS4A 3KJOA 1XMOL 2ATWA 4A3EH 3PO3B 3KF8B 4FNFA 4K5VA 5FO9B 4OWTB 3J81E 4KHPQ 3PSIA 4OO1I 5C3EH 2KVMA 1VQNA 2NTTA 3TS2A 1VQJA 2D2CC 3AEVA 3FRPB 1Z6HA 4XQJA 1QUQB 3KOJA 1QG7A 3K5NA 2JEAI 5EKIA 1BOSA 5FLXL 4DNIA 3AFPA 1IBMQ 3JAMi 4J1MA 2K6AA 1CTMA 2KCCA 3M7GA 2PCFB 4ZLTF 4OEMB 1KNEA 1JICA 2IPKD 3FKIH 1KNAA 3OOCA 1ZYRC 3ULLA 4C1NK 1L1OA 3PIPA 3TZDA 3S14H 2WB1B 3EFXD 1S5CD 3OHXC 4JI2L 1SAPA 2K33A 1VQKA 5C0XH 5IODA 1B2TA 1B3QA 1KDBA 3G71A 4M8AA 5EPKA 2C9OA 3P1HA 4X64Q 3E9HA 1L0WA 2B2TC 4OX9L 4CDCC 1PFSA 1PLFA 2VUMG 3M9BA 1WTQA 1OXTA 2JA9A 1F9SA 1MJCA 4OONA 2K14A 4KKTA 3HOWH 3T56B 1RIPA 1TWCB 3J80E 3JAME 3S1MH 2WFWA 2K5HA 4NMZA 2FMCA 2QILA 5GAGC 2KCTA 4A3IH 1KDAA 2F0KA 2G5DA 1V1PB 1GUSA 1NSNS 3OTOL 3W3AA 1K0SA 4ID6A 5CV8A 4QIWB 1GHJA 3HRZC 3TSSA 2O5JC 2E2DC 2KJXA 4ZRZA 2L4NA 2WACA 4JOIC 3WOEA 1E24A 1RODA 1PMRA 5M3MG 3GTLH 4A76A 1ML0D 1X3EA 2QCPX 3S2DB 4X62Q 2NWGA 4DV0Q 4LF4Q 4C3JB 1JOOA 4CJ0B 4RGNA 1PZKD 1U4MA 1PH9A 1ICFB 3QG1A 2RVLA 1XNQQ 3I4NH 2DJFC 4PZ7A 2R92B 1LT5D 3PIOA 1TWGH 4HJ5A 2JA7G 1L1OB 4Z9CB 2SNMA 1K3RA 4A3KB 1WOCA 1XPOA 1Y1WH 3NWTA 1IBKQ 1GHKA 4TRDA 5ELNA 4A3DG 2F0TA 1LTID 4K5WA 4NB3A 2B8FA 1QE6A 3AU7A 2F0UA 4DR3Q 1MJEA 5I6YA 3M4YA 4BBRG 5KYLA 4J6HA 3K5LA 2E5LL 1TWAB 3PV0A 4JC0A 4K0KQ 3SE0A 4HSPA 5LL6S 1LV9A
chains in the Genus database with same CATH topology
2Z8LA 1YNNC 1HUMA 3C46A 1PTOC 4V190 1IW7C 1E0BA 2RSNA 2EYOA 3D8GA 5COYA 2M00A 2PMZB 4KN7C 1Q3LA 1Q12A 2FMMA 1GUNA 4OO1H 2B2UA 5IT9E 3VYTA 2K5QA 1SYGA 2AQ1B 2EDGA 3PUYA 3S2HB 2A74C 4V0BA 2AUJD 4ZAIA 4Y7NB 5BN5A 1EY9A 2F0SA 2F0WA 1TQOA 1SNPA 2Y0SB 1K83B 3T51B 1TS5A 2ENBA 4C3IB 3ERQA 2RQXA 4KMUC 3DHQA 1WTXA 1LTSD 2JA5B 1ENCA 3H91A 4IN3A 5I9OA 3TMEA 1PRTB 5EPJA 2OXPA 2E76C 1F2LA 2A6ED 1PTOB 3NBIA 4K5XA 1I4HA 4E6IA 1NR2A 1LT4D 3NTHA 4A3EB 2EVBA 1MD2D 4MN3A 2FINB 5C3EB 4ME5A 2SOBA 1U9RA 1JWSD 5JPMC 1AN8A 4IUVA 3ITPA 1X3QA 3DWPA 1D6EC 4DAYA 5CV9A 3FKIB 2F3VA 2A69C 3FMCA 5JEAJ 5I2YA 1I4PA 1XX8A 1DOLA 4FYDA 1H9RA 5EQ0A 1CI3M 4MHEA 5FKAC 1STAA 1UAPA 3K5OA 2ZT9C 2R61A 4FF3A 2F0JA 1EWHA 5I6WA 4X3KA 5BN3A 1FD7D 5E3FA 3C1FA 3EJIA 3CQZB 1F77A 4Q5VA 4G57A 2IW3A 3HOZB 1ET9A 4PQXA 1U4LA 2CW0C 3R3OA 1S5DD 5K36H 2R6GA 4BA2I 3L3OC 3Q22A 1BNZA 4A3JB 1JOQA 3D4RA 2NBFA 4TKOB 3RD4A 5IGCA 3I4NB 5J39A 1TWGB 3KBGA 4DAVA 1EFID 3I73A 2EY2A 2WP8J 1U4RA 2VNUD 4R9WA 2IJ0A 2M2LA 1B3AA 3HS0C 1X32A 4J8QA 5C3WA 1B50A 1G2SA 2K04A 4ABNA 3D4DA 3FVQA 3R8BA 4RGTA 1B9MA 4HEDA 4RFBA 4IZ8A 4H0LC 5ELEA 3MEHA 3Q24A 3GP7A 4XDXA 3S16B 2MHVA 3SK8A 2X6LA 1F2MA 1WTVA 2B63B 2WINB 4HSVA 1S5BD 1R9TB 5E1FA 2NN6G 4XIGS 2O2LD 3W2DA 4K2KA 3TP7A 4A3BB 4KI0A 5M9OA 4C3JG 3NQTA 4HMJA 2N88A 1BCPF 4N9PA 3S17B 4WFN3 1H9KA 2WAQB 4DA2A 2EJMA 2K28A 2JXMB 2RA4A 2R3ZA 1Y8PB 1BR9A 1FNVA 1DD2A 1WTRA 4N9TA 1STEA 2Z4HA 3NUCA 3I4LA 1DYQA 2DNCA 3KLRA 4WORA 4IUUA 3L7ZC 5LHY1 1T5XD 1TIID 1KDCA 2FHTA 5M5YB 4L6TB 2Z1CA 3K0YA 4KKUA 1TY0A 2MUYA 1CM9A 3GV3A 1I6HB 1W6JA 1PFNA 1UNSA 3MAQA 5EGTA 2L11A 3VR4A 1SEBD 1Y8OB 1WCMB 3MZ5A 3SVMA 4JK1C 4C3HB 5D3DA 1VF5C 1B4OA 4C3IG 5DM73 3FDTA 4RHRA 1OO9B 4ZKBB 3OIQA 1GUTA 4KKSA 2CVRA 1WTOA 3AMUA 3E6ZX 2F0EA 3GTKB 3MFGA 5IOCA 1QJOA 4G7ZC 4PMBA 3VR5A 2O5IC 3SHLA 1SYCA 2M9VA 2L12A 3SDZA 1CA5A 1XYIA 3OMCA 1EY8A 5KNBA 3QO2A 1CHPD 4LK1C 2D5DA 4A3GB 4H44C 1E2WA 4ILWA 1QWYA 3AB9A 1STBA 3Q6SA 1QOHA 1I6VC 4CKCA 3NTKA 3SXHA 4KN4C 1MGSA 2G9DA 3EQLC 1G8ZD 3HEJA 3KLSA 5J22A 3D6CA 3HOXB 4ODGA 4FXGC 2EYPA 1SMYC 5DAUA 1XXGA 3S1NB 2KEDA 1ZKOA 1SNOA 4XT3B 2MGSA 3DXJC 4WRDA 1AP0A 5C4ZA 2F0MA 4BA1I 2XIWA 2CQAA 3QWNA 3BDOA 2EJGC 2WV6D 2A6HC 5C0XJ 1S4ZA 3MXGA 3T13A 2PW7A 4F88A 2IT1A 4OGQC 4FO2A 4C56C 1C4QA 1G91A 3I4MB 4OL7A 4QUCA 2F0IA 1ZEQX 2G9HD 1JB3A 4Q0FA 3C3LA 3H94A 4CKBA 2DN8A 1DM0B 1BCPD 3NTIA 3M7NA 2B2VC 2SEBD 1EIGA 4YIJA 1A3TA 5KIXA 3PO2B 5EJWA 4KHVA 5JAVA 2XSCA 1A6XA 4UDUC 1LTAD 3VR3A 1HCZA 3GTJB 4H7BA 4LAAA 2RDGA 2B2VA 4A93B 1TWHB 4KY6A 1B44D 1IL8A 2GA4B 1BDOA 4CHTB 3ONAB 2NVQB 1PZJD 4IUTA 2BOSA 3WOFA 1B1ZA 4RH6A 2EYJA 5C44B 3OWEB 2JE6I 1E2ZA 2EY6A 1STHA 1IKMA 3LWUA 1EQTA 1ET6A 1EU4A 1VF7A 1JOKA 5I2XA 2BDNA 2EZVA 2EY5A 3E0JA 1JORA 3OWFA 2FJ2A 5CV6A 1FR3A 1PRTC 1EL0A 3SR1A 4EQNA 4FXDA 1BUVT 1G6ZA 1TU2B 1TWFB 3TP6A 2BA1A 3RMHA 4FF2A 1DJRD 2YU9B 3X3NA 2B2UC 3TN2A 3HP3A 1Q1BA 1SE2A 1NR4A 5IGGA 4NDXA 5EPLA 2XWJB 1QB5D 1LO5D 4ZUJA 4IFDI 5HURA 2PO4A 4F87A 2JSOA 3KLSX 2R7ZB 3MTSA 3T53B 1B9NA 1EZ8A 2KECA 3NK9A 5ELDA 3M3YB 2NVYB 5CGKA 1IYUA 1WD0A 2NB0A 5D14A 1STGA 1JC7A 3C1EA 5FO7B 3S1QB 2FFKB 4H13C 4HCEA 1PTOF 1GUOA 3DUZA 1M8AA 2IX1A 5D3IB 4M1UB 1KLGD 2LMCB 1WTPA 1EYAA 1EYDA 2BCOA 4HTHA 4K6DA 5C6AA 2BDOA 4C3HG 2VXWA 5ELBA 5KEEA 2YYZA 3CRKC 4BY1B 1RF2D 3OW7A 5JEAG 2E2HB 1TVXA 4X3UA 2KHSA 4O1NA 1HTLD 2J7ZA 1EY7A 5M3FB 1G2TA 2AUKA 2KOLA 1D5MC 1C48A 4DNRB 3L9AX 3OSOA 1HXYD 3T4AC 4LMQD 2ICEC 2RDHA 1STYA 3NPPA 3O13A 1SXTA 3S14B 4TSSA 5K36G 1A15A 1BQQT 4PMCA 2A73B 3BDLA 5BN4A 3VYSA 2VB3X 1X3PA 3HOWB 3NE5B 3G7LA 4I7ZC 2WIIB 5A35A 3IFTA 5FOBB 3S1MB 1T5EA 4I65A 4FVMA 3NP8A 4EQOA 4A3IB 3P7JA 2B8GA 4RKLA 2NVXB 1II3A 4OIKA 4U673 2PYKA 3M85A 4XQQA 3BVZA 3GTLB 4IFDH 2L9HA 4FXKC 5E4XA 4KJNA 4HCSA 2IX3A 1JCKB 1PZID 3KK7A 4KHZA 3R2IA 2C5CA 3LX0A 1Q90A 1Y1WB 1J8IA 3TP8A 3MWYW 1ZYRD 5C5LA 1VMPA 2PZWA 4R8NA 5I9PA 1LTGD 2Q8RE 5E4WC 4DXFA 4L8JA 3PUWA 4K6LA 4C1NI 1F9RA 4DN4M 4EVOA 3A56A 1TY2A 2NYZD 4G4KA 2XN9C 3A8JE 4HR7B 5A2QL 2ZXOA 4RKBA 5ELCA 2F4IA 1O7LA 4KTAA 4ZYSA 2AQ2B 1BF4A 2HDMA 2XWBB 3MC0B 3P20A 2CHBD 3WDNA 3DM1A 3I3CA 2K5DA 1RCVD 2EPBA 4NW2A 1OXSC 2EYFA 1ESFA 1EQVA 1TT2A 2K7VA 3S9WA 2RDFA 1EY5A 2O4XA 1D1IA 1H9MA 4B08A 1EOTA 1D2BA 1EWCA 1DOKA 5JVH3 1QNKA 2F0NA 3A7AB 3FEWX 3CRLC 1V43A 1HTPA 5F2DA 1Y1VB 4NKLA 1Q1EA 1VCIA 2OT2A 1U4PA 1LT6D 1Y69U 4G7HC 5M5XB 1TS3A 3R2TA 2DY8A 1SE3A 1YNND 5IIFA 1BCPB 1PTOD 3NBHA 3GTGB 1IW7D 1DONA 2EY1A 3EROA 3Q0AA 2NN6H 3MXPA 5DEHA 1SNCA 1D5XC 3RUZA 4CBVA 3VA5A 3PUZA 3S15B 4RGMA 2K03A 3MFYA 1EYCA 3I91A 3GD7A 1QILA 5D65A 4PV1C 4K8JA 3SEBA 1O80A 3I90A 1CK1A 4QMGA 3MXNA 3PUXA 1O78A 2EJFC 4PMWA 1EEID 1ILQA 4WJWA 3D6WA 1UEAB 2WKDA 2KA7A 1AW7A 3BVGA 2XRSD 2ICIA 2A6EC 4KD3A 1DZ1A 4DGZA 2DNEA 3H6MA 3MXUA 1LT3D 1HHVA 2J4XA 2PNRC 2Q8TA 2TMPA 4XT1B 4L63B 1RKNA 1SE4A 3GTMB 1EY4A 5CC4A 1A2UA 3BZDB 1TS2A 4DU9A 1ZXTA 4OIJA 5DM63 3TP5A 1RJTA 2F0QA 2HDLA 3KBXA 3LNNA 3HZXA 5C3XA 2MPMA 1WVLA 1BXTA 1O7ZA 1JR0D 1RTNA 1BBXC 5C4XB 3PMFA 1SYDA 4DXGA 1K8MA 1KABA 3F2UA 3DMUA 4BBSB 2J0TD 1PYWD 1EY0A 4K8IA 2KQ3A 3HGBA 2PW5A 3H09A 4F7XA 4BY7B 4X3SA 5KRUA 2JEBI 5C0XG 2A69D 3I70A 4CJ1B 2B2WC 2F0GA 3TZUA 1F9QA 5CV4A 1HQMC 1ESRA 4CJ2C 2K05A 5IGEA 2QF7A 3CKIB 1PTOH 2B2WA 4B9WA 2NVTB 1DCZA 4S3SA 3EVQA 4JBWA 1SYEA 1K8OA 1DXMA 4O42A 4TQUS 5JVG3 2L0CA 3A55A 3J7AV 3V96A 5CV5A 1J9OA 4AYBB 3CU7A 2CW0D 1HA6A 1CQVA 1LACA 1HFNA 1SSOA 1LTBD 2E75C 2HCIA 2F0DA 1NAPA 3MA2B 3C2PA 2LFNA 5A2QE 2HQEA 3GTOB 1I4QA 2D9UA 1Q8IA 5CV7A 3R93A 1SNQA 1I50B 2LKVA 2JA8B 3MVVA 1D5ZC 2L55A 2NTSA 5JPNC 1JE4A 3D3RA 4K2LA 2K5WA 2QDBA 1STNA 3SK5A 2MP1A 2B2TA 4IUNA 3NHHA 2LS01 1IYVA 2KCNA 1SNDA 2PZUA 4DK0A 1HUNA 2SDFA 3V05A 1O7YA 1HFGA 2I46A 2A68D 3SK4A 2E2IB 2F1MA 4OO1G 1W6KA 3DWQA 4DF7A 1YNJD 3PIP3 4A3MB 3ND9A 5C4JB 3M4OB 5FO8B 1CZGA 1BO0A 2F0VA 1V8QA 1L0YB 3U9OA 4IURA 3BYTB 3LWEA 3UI2A 4ULLA 4XXEA 3VYUA 3KUPA 1ILPA 3J7YW 3NWSA 1GUGA 4KV6A 3K7AB 2XRQD 1EZ6A 2Z4IA 5CYUA 2BE5D 3BVMA 5JOBA 4UAIA 3PUVA 3V2TA 2F03A 1KTKA 2H4OA 3ND8A 1DOMA 1NUCA 2VB2X 2IWHA 3RLFA 2EOTA 4KY7A 2D62A 4NP5A 2PPBC 4U68A 4G7OC 1TR5A 1LABA 3K6OA 1PRTF 3D4WA 3PIO3 4FF4A 1GUWA 1M4VA 3Q23A 1RTOA 5G3LF 4B9XA 2LY7A 3BDCA 3GQBA 4QCLA 1H9SA 3GTPB 3RZDB 1EEFD 2QKIC 5DNFA 1ENAA 1FNWA 3EA6A 2AWNA 3OMGA 4C2MB 2F0LA 3VYRA 1CQFA 1MSHA 3HOUB 2ZXRA 3IFDA 3DWAA 3IKJA 1RHPA 3FPPA 2B2YC 1WD1A 1F2YA 1QNUA 1QCBD 4FP5D 4RAUC 1SFOB 5KNDA 2X6GA 3S1RB 1SJED 2B2YA 2K1BA 4ZQ3A 4PNYA 3HKZB 4IALA 1D1KA 5M5WB 4IFDG 3H0GB 2F0OA 5ISRA 1ENFA 4QF4A 1AZQA 3HG9A 3VA7A 1CZWA 2AQ3B 1H9SB 2F3WA 1SDFA 3URYA 4RGOS 1GOZA 1RDPD 1VMCA 3HOVB 2Q8IB 2I07B 5KGUA 1PXUA 2IL8A 2NN6I 3QIAA 1G291 5JEAH 2JP1A 1I4XA 4CGYB 4IFDJ 5I4DA 4IQZA 1SMYD 4MIUA 4F8MA 1ONLA 1AZPA 5FLXE 5NUCA 2NUCA 1EU3A 3A54A 2V4DA 4DAPA 4ZUIA 3A7LA 1IKLA 1JQYD 3GV6A 1JWUD 5ELFA 1SNMA 4GZYC 4IUQA 3GTQB 2A6HD 4XQNA 3J81L 3QOLA 4DFAA 2VUMB 4RCNA 3U9SA 1CA6A 1BCPC 3BS1A 1OXVA 4X3TA 1L0XB 4IUPA 1UUPA 1R4PB 5EKKA 1H9JA 3MHBA 1A3UA 3P75A 5T1IA 3FPUB 3BYYB 2A5HA 4R8IA 1XTCD 5M3MB 2IX0A 3N6RA 4RCOA 2KEEA 1HRJA 4QB4A 2EXZA 3J80L 3JAML 1A2TA 2A68C 1IHZA 5J1ZA 1AFPA 4K14A 3J7AF 2DY7A 2JA7B 1CHQD 4XYQA 2PQEA 2RKSA 5CBAE 1YNJC 4A3DB 3VR6A 5CBEE 4RWSC 1FGBD 1ICWA 5IGDA 4CKEA 3D31A 3I72A 1EY6A 5C5MA 4BBRB 5HGTA 2SNSA 2F0PA 5CR3A 2RSOA 3BG3A 2ID0A 1SYFA 3N52A 5KYIA 1SYBA 1V1OA 5TSSA 5T1GA 5IGFA 1GXDC 1PRTD 3QJYA 3CHBD 2R93B 1Z47A 2B39A 3K57A 2F0HA 1LTTD 3TDQA 3RZOB 2AWOA 3SK6A 2K01A 2BE5C 2EYMA 5G3LD 2E2JB 2OEOA 4HN7A 4ZK9B 1LLRD 1FYCA 1C8CA 1SJHD 2QEJC 4KY5A 2F0FA 4QUFA 1HPCA 3DEOA 3IL8A 2NZ1D 1KAAA 4KK7A 4P2CB 3OIPA 4BS9A 3DEPA 4EQPA 2PZTA 3K59A 5C4HA 2ZXPA 1F2ZA 1TKWB 2TSSA 3E5SA 3ZYYX 5C0XI 2HCCA 5CORA 1OXXK 1EIHA 5CMDA 1CT1D 4ZKCB 2HUGA 2MJ8A 1VDZA 2JYOA 2EE1A 3A8KE 3I8ZA 4OHJA 5IT9L 2EYLA 4KJOA 4RHSA 1RD9D 1MSGA 2E74C 3X3MA 4EGVA 2K32A 1PDQA 1GJXA 3HOYB 2N55A 1FNUA 1PFBA 2OF1A 2X69A 4HAEA 1MBYA 1MI2A 1NCVA 1S5ED 5AFWA 2JA6B 1A3VA 4LJZC 2EYHA 1JWMD 5JJZA 4BWGB 5LL6X 5KNCA 1AEXA 1I4RA 1CFMA 3K5MA 5IGBA 1Y8NB 3KF8A 3GO5A 3NSWA 3QB3A 2WKCA 2XNAC 3G6JB 1PFMA 2L1BA 1SBBB 3IAYA 4HMIA 1I3QB 1LTRD 5FK9C 3T16A 4XYOA 3VR2A 5K5PA 5EBDA 3H3VC 2L5TA 1HA5A 1E2VA 1F9PA 2RBMA 4DNTB 2KUMA 5EKLA 2H1EA 1I4GA 1Z7TA 3NXWA 3K58A 2XVSA 3OPOA 1OXUA 1B53A 1S5FD 1XWEA 2BA0A 4KD4A 4RA8A 4DK1A 4A3FB 1KLUD 4FF1A 3QOJA 3NQIA 1R4QB 4XTCS 1HQRD 1WTWA 3TBIB 5EBCA 3A8IE 1V1PA 1TS4A 3PO3B 4FNFA 4K5VA 5FO9B 3J81E 4OO1I 2KVMA 2NTTA 2D2CC 3FRPB 1Z6HA 4XQJA 1QG7A 3K5NA 2JEAI 5EKIA 1BOSA 5FLXL 4J1MA 2K6AA 1CTMA 2KCCA 3M7GA 2PCFB 4ZLTF 1KNEA 1JICA 2IPKD 1KNAA 3OOCA 1ZYRC 4C1NK 3TZDA 2WB1B 3EFXD 1S5CD 3OHXC 1SAPA 2K33A 5C0XH 5IODA 1B2TA 1KDBA 4M8AA 5EPKA 2C9OA 3P1HA 2B2TC 1PLFA 1WTQA 1OXTA 1F9SA 4KKTA 3T56B 1TWCB 3J80E 3JAME 4NMZA 2FMCA 2QILA 1KDAA 2F0KA 1V1PB 1GUSA 1NSNS 3W3AA 4ID6A 5CV8A 4QIWB 1GHJA 3HRZC 3TSSA 2O5JC 2E2DC 2KJXA 4ZRZA 2L4NA 2WACA 3WOEA 1RODA 1PMRA 1ML0D 2QCPX 3S2DB 2NWGA 4C3JB 1JOOA 4CJ0B 4RGNA 1PZKD 1U4MA 3QG1A 2RVLA 2R92B 1LT5D 4Z9CB 2SNMA 4A3KB 3NWTA 1GHKA 4TRDA 2F0TA 1LTID 4K5WA 2B8FA 1QE6A 3AU7A 2F0UA 5I6YA 3M4YA 5KYLA 4J6HA 3K5LA 1TWAB 3PV0A 3SE0A 4HSPA 5LL6S 1LV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN3 A;  2N55 A;  2FIN B;  1WTP A;  2DY7 A;  1PFB A;  5E4X A;  1VMC A;  1B3A A;  1HUM A;  1X32 A;  1RJT A;  4IUT A;  4HCS A;  5EKI A;  2HDL A;  4U68 A;  3KBX A;  1B50 A;  2IL8 A;  2MPM A;  2X69 A;  1G2S A;  2K04 A;  2VXW A;  4HAE A;  4ZLT F;  1WVL A;  1O7Z A;  2KED A;  1MI2 A;  1KNE A;  5CBA E;  1E0B A;  1EQT A;  1JIC A;  1NCV A;  2JP1 A;  1RTN A;  1JE4 A;  1KNA A;  4HED A;  2DY8 A;  4IUV A;  4XT3 B;  4RWS C;  2MGS A;  5CBE E;  5AFW A;  1GUW A;  1ICW A;  2BDN A;  1CM9 A;  1X3Q A;  2RSN A;  3GV3 A;  2MP1 A;  5JJZ A;  1RTO A;  3F2U A;  3TZD A;  1J8I A;  1PFN A;  2B2T A;  1AP0 A;  1SAP A;  2XIW A;  4XDX A;  5COY A;  1DON A;  3MWY W;  1TVX A;  1AZP A;  2L11 A;  4X3U A;  1B2T A;  2FJ2 A;  2X6L A;  1VMP A;  2J7Z A;  1WTV A;  5EPK A;  1XX8 A;  1DOL A;  1Q3L A;  4OIJ A;  2RSO A;  5EQ0 A;  2B2T C;  2SDF A;  1EL0 A;  1HUN A;  1PLF A;  4HSV A;  2KOL A;  2Q8R E;  4MHE A;  1G2T A;  1PFM A;  4X3S A;  2L1B A;  1WTQ A;  1O7Y A;  2FMM A;  5E4W C;  1HFG A;  3SVM A;  3N52 A;  1F9S A;  1BBX C;  4CJ1 B;  1IKL A;  1B4O A;  2B2U A;  2B2W C;  1G6Z A;  3GV6 A;  1F9R A;  2K03 A;  1S4Z A;  5T1G A;  4DN4 M;  3FDT A;  4ZKB B;  1F9Q A;  4LMQ D;  5DNF A;  2NYZ D;  3I91 A;  4IUQ A;  2B2U C;  1ESR A;  2N88 A;  3HP3 A;  4X3K A;  3TN2 A;  4CJ2 C;  1QG7 A;  2K01 A;  4ZAI A;  2K05 A;  1G91 A;  2CVR A;  1F9P A;  4ZK9 B;  1WTO A;  1C8C A;  4QUC A;  1NR4 A;  5D65 A;  1BF4 A;  2B2W A;  4QUF A;  2KUM A;  2H1E A;  1A15 A;  1MSH A;  3DEO A;  3IL8 A;  2NZ1 D;  2HDM A;  3IFD A;  5EPL A;  2K28 A;  1O80 A;  3I90 A;  2L4N A;  1RHP A;  1BO0 A;  2RA4 A;  2B2Y C;  1CA6 A;  1WD1 A;  1IKM A;  2L12 A;  4IUR A;  3LWE A;  3DEP A;  3UI2 A;  1B53 A;  1ROD A;  3DM1 A;  3I3C A;  1CA5 A;  1ML0 D;  1U4L A;  2R3Z A;  2EPB A;  4O42 A;  1XYI A;  2NWG A;  4NW2 A;  4X3T A;  1ILQ A;  3D6W A;  4RA8 A;  3MTS A;  4CJ0 B;  3KUP A;  1ILP A;  4RAU C;  3QO2 A;  4IUP A;  1WTR A;  1X3P A;  1U4M A;  1WTX A;  2KEC A;  2B2V C;  3G7L A;  1BNZ A;  1EIG A;  2RVL A;  2X6G A;  3R93 A;  1J9O A;  1EOT A;  3H91 A;  2B2Y A;  2K1B A;  3Q6S A;  1WTW A;  1DZ1 A;  1DOK A;  1HA6 A;  1QNK A;  5T1I A;  5EJW A;  3P7J A;  3FPU B;  1HFN A;  1HHV A;  1SSO A;  1WD0 A;  2HCC A;  5D14 A;  5EPJ A;  5COR A;  1EIH A;  2HCI A;  2Q8T A;  4UAI A;  5CMD A;  4XT1 B;  1F2L A;  4ZKC B;  1MGS A;  2FFK B;  4R8I A;  1NAP A;  4OIK A;  2HUG A;  2MJ8 A;  2JYO A;  4IUU A;  2B2V A;  2EE1 A;  2KEE A;  3I8Z A;  1NR2 A;  1QE6 A;  1HRJ A;  2FHT A;  2KVM A;  1AZQ A;  1IL8 A;  1MSG A;  2D9U A;  1M8A A;  1DOM A;  1U4R A;  3ONA B;  4R9W A;  1U4P A;  1ZXT A;  2EOT A;  2M2L A;  2L9H A;  1PDQ A;  1SDF A;  1LV9 A; 
#chains in the Genus database with same CATH topology
 2Z8L A;  1N8R C;  1YNN C;  1HUM A;  4JI7 L;  2QEX A;  3C46 A;  1PTO C;  1P8L A;  3RLO A;  4V19 0;  1K9M C;  3PF5 A;  1IW7 C;  1E0B A;  3S16 H;  3AQQ A;  4DV5 L;  3ULJ A;  2R93 G;  2B63 H;  2RSN A;  2EYO A;  3CCE A;  4JI2 Q;  3D8G A;  2Z0S A;  5COY A;  4GS3 A;  2M00 A;  1R9T H;  1XTD A;  2D0P A;  2PMZ B;  4KN7 C;  4LFB L;  1Q3L A;  2DGY A;  5LMN Q;  1Q12 A;  4B3M Q;  2FMM A;  1GUN A;  4OO1 H;  1SRU A;  2B2U A;  5IT9 E;  5ELO A;  5J3B A;  3S17 H;  3VYT A;  2K5Q A;  1SYG A;  2AQ1 B;  4A4I A;  2EDG A;  3PUY A;  3S2H B;  2A74 C;  4V0B A;  2AUJ D;  1VQ9 A;  4ZAI A;  3I56 A;  4Y7N B;  5BN5 A;  2HD3 A;  1EY9 A;  4A3C H;  2F0S A;  2F0W A;  1TQO A;  1SNP A;  1JJG A;  2Y0S B;  1EQQ A;  1K83 B;  3T51 B;  1Y1V H;  1TS5 A;  2ENB A;  4C3I B;  1IBL Q;  2V1C C;  3ERQ A;  1VQP A;  2RQX A;  5IWA L;  4KMU C;  3VDY A;  3DHQ A;  4CDE C;  1K73 C;  1WTX A;  1LTS D;  2K4K A;  4DAM A;  1KL9 A;  3HOY G;  2JA5 B;  1ENC A;  3H91 A;  4IN3 A;  5I9O A;  4JI4 Q;  3TME A;  1PRT B;  3L0O A;  5EPJ A;  2OXP A;  2E76 C;  3GTG H;  5M5Y H;  1RL2 A;  1F2L A;  2A6E D;  1PTO B;  3NBI A;  4K5X A;  4ME3 A;  1I4H A;  4E6I A;  2JA6 G;  2ZJR A;  2PQA A;  1NR2 A;  1LT4 D;  3NTH A;  4MTN A;  4EX5 A;  2N49 A;  3CAM A;  3I7F A;  4A3E B;  3KLW A;  2EVB A;  4DV4 L;  3S15 H;  1MD2 D;  4MN3 A;  4DV6 L;  3D0F A;  2FIN B;  5C3E B;  4ME5 A;  4P75 A;  2SOB A;  1U9R A;  3KYH C;  1JWS D;  1EWI A;  5JPM C;  1I6H H;  1HNW L;  1XMQ Q;  1AN8 A;  4AQY Q;  1XPU A;  4IUV A;  2ES2 A;  4GOP C;  4JBK A;  3ITP A;  1X3Q A;  3DWP A;  5GRO A;  1D6E C;  2BH8 A;  4DAY A;  3CMA A;  1KAW A;  5CV9 A;  3FKI B;  2F3V A;  1B70 B;  2A69 C;  1GO3 E;  4R4I A;  4LFB Q;  3A5Z B;  3FMC A;  5JEA J;  5I2Y A;  1I4P A;  1XX8 A;  1DOL A;  4FYD A;  1H9R A;  5EQ0 A;  4POF A;  1CI3 M;  5BR8 Q;  4MHE A;  5FKA C;  4DUZ L;  1STA A;  4LF6 Q;  4GOP A;  3K81 C;  4N8F A;  1UAP A;  3K5O A;  4X66 Q;  2ZT9 C;  1H95 A;  2R61 A;  4FF3 A;  2F0J A;  2NZH A;  3F1Z A;  1JMC A;  1PYB A;  3E3X A;  1GD7 A;  1EWH A;  5I6W A;  4X3K A;  4A3F G;  3BU2 A;  5BN3 A;  3CC7 A;  4GN4 B;  3PCO B;  4YWK A;  3F2D A;  2GVB A;  1FD7 D;  5E3F A;  3Q8D A;  3C1F A;  1NNX A;  3EJI A;  3CQZ B;  1F77 A;  2PQA B;  4YHH L;  4Q5V A;  1X65 A;  2VQF L;  4G57 A;  2IW3 A;  3HFZ B;  3HOZ B;  1JJ2 A;  1ET9 A;  3PO3 G;  4PQX A;  1U4L A;  1PH5 A;  2K5N A;  5IWA Q;  2CW0 C;  4O0A A;  3R3O A;  1S5D D;  5K36 H;  2I0Q A;  2R6G A;  3STB D;  4BA2 I;  1NBW A;  3L3O C;  5GAE C;  3Q22 A;  1BNZ A;  3EIV A;  4A3J B;  5C4X H;  1JOQ A;  3MEF A;  3F2B A;  1HZC A;  3D4R A;  3CC4 A;  4BXX H;  4DAY B;  3TRE A;  1CSP A;  2NBF A;  4TKO B;  3RD4 A;  5IGC A;  3I4N B;  1MKH A;  5J39 A;  4GKJ L;  1TWG B;  3KBG A;  4JI1 L;  4JI6 Q;  3NEM A;  2F4V Q;  2UUC Q;  3HOX H;  4DAV A;  4UPA A;  2VL6 A;  2RF4 A;  2WB1 G;  4BY7 H;  1EFI D;  3I73 A;  2EY2 A;  2WP8 J;  1U4R A;  2VNU D;  4R9W A;  5AJ3 Q;  2IJ0 A;  2M2L A;  3S1N H;  1CSQ A;  2BH2 A;  1B3A A;  3HS0 C;  1X32 A;  4J8Q A;  5C3W A;  1B50 A;  1SRO A;  1G2S A;  2K04 A;  4ABN A;  2JA8 G;  3D4D A;  2I5M X;  3FVQ A;  3R8B A;  4RGT A;  3FHW A;  1B9M A;  4HED A;  5EAY A;  4RFB A;  1NY4 A;  4IZ8 A;  4H0L C;  5ELE A;  1N33 Q;  2ZJP A;  3MEH A;  3Q24 A;  4DUY Q;  2NVT H;  3GP7 A;  4XDX A;  3S16 B;  4DR4 Q;  4IOC A;  2MHV A;  3SK8 A;  5LMN W;  1G6P A;  2X6L A;  1F2M A;  1WTV A;  2B63 B;  4JYA L;  1YVC A;  2WIN B;  4HSV A;  1S5B D;  4LF8 L;  1R9T B;  5E1F A;  2NN6 G;  2ZTE A;  4XIG S;  2O2L D;  1HZ9 A;  1YIJ A;  3W2D A;  4K2K A;  3TRZ A;  3TP7 A;  1VQC A;  4A3B B;  4KI0 A;  3I4M H;  5M9O A;  4C3J G;  3NQT A;  1GKH A;  2N88 A;  1BCP F;  4HMJ A;  4N9P A;  5GQO A;  4LF7 Q;  4WFN 3;  3S17 B;  1H9K A;  1YIT A;  2AKW B;  4GKK Q;  2R92 G;  2WAQ B;  4DA2 A;  4CDD C;  2EJM A;  1HR0 L;  4A3K G;  2K28 A;  3GTO H;  2JXM B;  2RA4 A;  4DR6 Q;  1N34 Q;  2R3Z A;  3CCU A;  1Y8P B;  1BR9 A;  1FNV A;  1JB7 A;  1DD2 A;  1NTG A;  1WTR A;  1K28 A;  3PO2 H;  2YV5 A;  4N9T A;  1E1O A;  1STE A;  2Z4H A;  3NUC A;  3I4L A;  3GTJ H;  4WJ4 A;  2VY3 A;  1DYQ A;  2DNC A;  1MIU A;  2MO1 A;  3KLR A;  4X6A H;  1E22 A;  4WOR A;  2NVQ H;  2MO0 A;  3T1Y Q;  4IUU A;  3L7Z C;  5LHY 1;  1KIX A;  3CCV A;  1N32 Q;  3BJU A;  1T5X D;  1BBW A;  1TII D;  1KDC A;  2FHT A;  5M5Y B;  1W2B A;  4L6T B;  2Z1C A;  3CW2 C;  2HHH Q;  1PH2 A;  4B3S L;  1VQM A;  3K0Y A;  4KKU A;  4B3T L;  1TY0 A;  2MUY A;  1CM9 A;  4QY7 A;  3GV3 A;  5L37 A;  1I6H B;  1W6J A;  1PFN A;  1UNS A;  1EYG A;  3MAQ A;  5EGT A;  2L11 A;  3VR4 A;  4LF9 L;  1XNR Q;  2QGQ A;  4IPH A;  1SEB D;  1TWF H;  1Y8O B;  1WCM B;  2Y0S G;  3MZ5 A;  1FJG L;  2VZA A;  2YU9 H;  3SVM A;  4JK1 C;  4C3H B;  5D3D A;  1VF5 C;  1B4O A;  4C3I G;  2UXD Q;  4B3R L;  5DM7 3;  3FDT A;  4RHR A;  1OO9 B;  4ZKB B;  3ICE A;  3LGJ A;  1WTH A;  1LM0 A;  3G4S A;  3CF5 A;  3OIQ A;  1GUT A;  1WI5 A;  4KKS A;  1YJ9 A;  1DGS A;  2CVR A;  1WTO A;  3AMU A;  3E6Z X;  2F0E A;  2JA5 G;  3GTK B;  3MFG A;  5IOC A;  1QJO A;  4G7Z C;  4PMB A;  2ZM6 Q;  1VQ8 A;  3VR5 A;  3HOU G;  4N8X 1;  2O5I C;  3SHL A;  1N36 L;  1VS0 A;  1SYC A;  2M9V A;  3DM3 A;  3NEL A;  5IP9 G;  2L12 A;  3SDZ A;  3T1H L;  1CA5 A;  3CCL A;  1KXL A;  4DV1 L;  1XYI A;  3OMC A;  2NVY H;  5IYB H;  1EY8 A;  5KNB A;  3QO2 A;  1CHP D;  4LK1 C;  2D5D A;  2CH4 A;  5FJ8 H;  4H44 C;  4A3G B;  1E2W A;  4ILW A;  3UDI A;  5C3E G;  1QWY A;  3AB9 A;  1STB A;  3Q6S A;  5DLQ E;  1QOH A;  1I6V C;  2QDL A;  4CKC A;  3NTK A;  2Z9H A;  3H0G G;  3J7A 5;  3SXH A;  4NXN Q;  4KN4 C;  1MGS A;  5HY6 A;  2G9D A;  3EQL C;  1G8Z D;  3HEJ A;  4JI5 L;  3KLS A;  3FKI G;  5J22 A;  4R4O A;  3D6C A;  3HOX B;  4ODG A;  3EN2 A;  4FXG C;  2KEN A;  2EYP A;  1SMY C;  5DAU A;  1XXG A;  1JE5 A;  3S1N B;  2KED A;  1ZKO A;  4C2M H;  1SNO A;  1PH3 A;  2E2H H;  4XT3 B;  1CKN A;  2MGS A;  3DXJ C;  2OTJ A;  4RG1 A;  4WRD A;  4NXM L;  2D0O A;  5M3F H;  1AP0 A;  4LFC L;  5C4Z A;  2F0M A;  4BA1 I;  2XIW A;  2CQA A;  3QWN A;  1L1O C;  1X3F A;  1YHA A;  1NJI C;  2Q2U A;  3BDO A;  4X65 L;  3DLL A;  2EJG C;  4YCU A;  5E7N A;  2WV6 D;  2A6H C;  3HOZ G;  3KJP A;  5C0X J;  1S4Z A;  3U4V A;  3MXG A;  3T13 A;  3CCJ A;  3S1R H;  2PW7 A;  4F88 A;  2IT1 A;  1VQO A;  4OGQ C;  2KHI A;  3AFQ A;  1C7Y A;  4FO2 A;  4C56 C;  3S24 A;  5M5W H;  1C4Q A;  4LUO A;  1G91 A;  4AH6 A;  3I4M B;  4OL7 A;  1Q82 C;  2B3G A;  3JC6 6;  4QUC A;  4A3J G;  2F0I A;  1ZEQ X;  5IP7 H;  4JI0 Q;  4JI8 Q;  1VQH A;  2G9H D;  3I4N G;  4JPB W;  1JB3 A;  5IYD H;  3E9I A;  4Q0F A;  4AYB E;  3C3L A;  3H94 A;  2UUB Q;  4DK3 C;  4DR1 L;  4CKB A;  2DN8 A;  2MFI A;  1QVF A;  1DM0 B;  3HOV H;  1BCP D;  2UXB Q;  3NTI A;  3M7N A;  2B2V C;  2SEB D;  1EIG A;  1EUJ A;  1VQI A;  4YIJ A;  1A3T A;  4YCW A;  1CKN B;  1VQ4 A;  5KIX A;  1A8V A;  2NVX H;  3PO2 B;  5EJW A;  1HNX L;  4KHV A;  5FLM H;  3RR5 A;  2UU9 L;  5JAV A;  2XSC A;  3W1B A;  4UDU C;  1A6X A;  1LTA D;  3VR3 A;  1HCZ A;  2VS1 A;  1Q86 C;  3GTJ B;  4H7B A;  3J81 c;  4LAA A;  2RDG A;  3M4P A;  2B2V A;  1Q46 A;  4A93 B;  1TWH B;  4KY6 A;  1B44 D;  1IL8 A;  2GA4 B;  4GLV B;  1BDO A;  4CHT B;  3ONA B;  2NVQ B;  1TXY A;  3E0E A;  4HID A;  1Y14 B;  2CH4 W;  1PZJ D;  4IUT A;  2BOS A;  3WOF A;  1B1Z A;  4RH6 A;  2EYJ A;  5C44 B;  3OWE B;  2JE6 I;  1E2Z A;  2EY6 A;  1STH A;  2GN5 A;  1IKM A;  3LWU A;  3ZJY C;  1EQT A;  1XMO Q;  2CCZ A;  1ET6 A;  4A3B G;  1EOV A;  1EU4 A;  1VF7 A;  1XPR A;  1JOK A;  5I2X A;  2BDN A;  2I5H A;  1PVO A;  1I94 L;  2EZV A;  2EY5 A;  3E0J A;  1JOR A;  3OWF A;  4DV7 L;  4R4T A;  2FJ2 A;  5CV6 A;  2WAQ G;  4LNQ A;  1FR3 A;  1T9H A;  1PRT C;  5IYC G;  1EL0 A;  3SR1 A;  4EQN A;  4FXD A;  1BUV T;  4A3C G;  1TU2 B;  1TWF B;  1G6Z A;  4LWC A;  3J80 c;  1EIY B;  3TP6 A;  2BA1 A;  3RMH A;  3JAM c;  4FF2 A;  1DJR D;  2YU9 B;  1UE5 A;  1KHI A;  3X3N A;  1PH7 A;  2B2U C;  3TN2 A;  1M90 C;  3HP3 A;  3KF6 A;  4KLK A;  4HJ8 A;  1Q1B A;  1SE2 A;  1NR4 A;  2RCN A;  4OX9 Q;  5IGG A;  4NDX A;  2AHO B;  1SN8 A;  3TQY A;  5EPL A;  2XWJ B;  1QB5 D;  2E8G A;  1LO5 D;  4ZUJ A;  4IFD I;  4JW0 A;  2HQL A;  5HUR A;  2PO4 A;  4F87 A;  2JSO A;  3KDF A;  3I55 A;  2PI2 E;  3KLS X;  1J5E L;  2R7Z B;  3MTS A;  3T53 B;  1B9N A;  2HT1 A;  1EZ8 A;  2KEC A;  3NK9 A;  5ELD A;  3M3Y B;  2NVY B;  3OTO Q;  4A3D H;  1HNX Q;  5CGK A;  1IYU A;  2PMZ E;  1WD0 A;  2NB0 A;  5D14 A;  1STG A;  1JC7 A;  3C1E A;  5FO7 B;  3S1Q B;  2FFK B;  3OW2 A;  4H13 C;  4HCE A;  1PTO F;  1GUO A;  3DUZ A;  4JV5 L;  5M5X H;  2DJG C;  1M8A A;  2IX1 A;  5D3I B;  4DV3 L;  4LFA L;  4M1U B;  1KLG D;  2LMC B;  1WTP A;  1PH4 A;  1EYA A;  1WCM G;  1EYD A;  2BCO A;  4HTH A;  4K6D A;  5C6A A;  1X3G A;  2R93 H;  3KFU A;  2BDO A;  1HZA A;  4C3H G;  2AMC B;  2VXW A;  3KF6 B;  5ELB A;  5KEE A;  2YTY A;  4R1J A;  2UUA L;  2E2J H;  3RN2 A;  2YYZ A;  3CRK C;  1EFW A;  4BY1 B;  4QL5 A;  1RF2 D;  3OW7 A;  1IYJ B;  4LF5 L;  5JEA G;  2E2H B;  1TVX A;  2E5L Q;  4X3U A;  2KHS A;  4O1N A;  1HTL D;  2J7Z A;  1QVG A;  1EY7 A;  5M3F B;  1G2T A;  2AUK A;  2KOL A;  4JI7 Q;  1D5M C;  3KDF B;  1C48 A;  4DNR B;  3L9A X;  3OSO A;  5IT9 c;  1HXY D;  3T4A C;  1UE7 A;  4DV5 Q;  3CC2 A;  4LMQ D;  2ICE C;  2RDH A;  1STY A;  3NPP A;  3O13 A;  1LTL A;  3H3V I;  4A3G G;  1SXT A;  2EIF A;  4UP8 A;  4DR5 L;  3S14 B;  4TSS A;  5K36 G;  1A15 A;  1BQQ T;  4L5Q A;  4PMC A;  2A73 B;  2EQS A;  3U50 C;  1QZH A;  3J81 j;  4Y52 H;  2A8V A;  3HKZ E;  3BDL A;  1NMF A;  5BN4 A;  3VYS A;  1PH1 A;  2VB3 X;  1Q7Y C;  2UXC L;  1X3P A;  3HOW B;  1YEZ A;  3NE5 B;  3HOX G;  3G7L A;  4I7Z C;  1SR3 A;  2WII B;  5A35 A;  3IFT A;  5FOB B;  3S1M B;  1T5E A;  4I65 A;  4FVM A;  3NP8 A;  4EQO A;  1UE1 A;  4A3I B;  3P7J A;  2JA6 H;  1LYL A;  2B8G A;  4RKL A;  4GLX A;  3GTM H;  2NVX B;  1II3 A;  4OIK A;  1KQS A;  4U67 3;  4OXP A;  2PYK A;  4NPS A;  3M85 A;  4XQQ A;  3BVZ A;  1D7Q A;  3GTL B;  4IFD H;  1GM5 A;  2L9H A;  1I3Q H;  4FXK C;  5E4X A;  4KJN A;  4HCS A;  1LUZ A;  2IX3 A;  1VQE A;  1JCK B;  1PZI D;  4BBS H;  3KK7 A;  4KHZ A;  1K3B C;  3R2I A;  2C5C A;  1WFQ A;  4GLA C;  3LX0 A;  1Q90 A;  1Y1W B;  1J8I A;  3TP8 A;  3MWY W;  3I4M G;  4DV4 Q;  1ZYR D;  5C5L A;  1VMP A;  2PZW A;  4R8N A;  4DV6 Q;  5I9P A;  1LTG D;  2Q8R E;  1PH6 A;  4HJA A;  5E4W C;  4APV A;  1HNW Q;  4DXF A;  2CKZ B;  4L8J A;  3PUW A;  4K6L A;  4C1N I;  1F9R A;  4DN4 M;  4P71 A;  4EVO A;  3A56 A;  2VW9 A;  1TY2 A;  2NYZ D;  4G4K A;  2XN9 C;  3A8J E;  4HR7 B;  1M1K C;  5A2Q L;  1ASY A;  2ZXO A;  5FLX c;  3W1G A;  4RKB A;  4JI3 L;  5ELC A;  2F4I A;  1O7L A;  2A19 A;  4KTA A;  4ZYS A;  3F2C A;  4DR5 Q;  2AQ2 B;  1BF4 A;  4JBM A;  1V1Q A;  2N78 A;  2OCE A;  4DUZ Q;  2HDM A;  4YWL A;  2XWB B;  3P20 A;  3MC0 B;  4GN3 B;  3BZK A;  2CHB D;  3WDN A;  2CFM A;  3DM1 A;  3I3C A;  1HNZ L;  4HIK A;  2K5D A;  1RCV D;  2EPB A;  4NW2 A;  4A93 G;  1OXS C;  4GN5 A;  2EYF A;  4J15 A;  1ESF A;  1EQV A;  1TT2 A;  2K7V A;  3S9W A;  1E7Z A;  2RDF A;  1EY5 A;  1X9N A;  3EBE A;  2H5X A;  2O4X A;  1D1I A;  1H9M A;  1EOT A;  1L2F A;  4B08 A;  1EWC A;  1D2B A;  2KHJ A;  4A75 A;  1DOK A;  2K75 A;  1QNK A;  5JVH 3;  2VQF Q;  4YHH Q;  4HJ7 A;  4YY3 L;  5C44 G;  4IO9 A;  1NMG A;  2F52 A;  2F0N A;  3A7A B;  4JCV E;  3FEW X;  3H3V H;  3CRL C;  1V43 A;  1HTP A;  5F2D A;  5HGQ A;  1Y1V B;  2K50 A;  1I50 H;  4NKL A;  1Q1E A;  1VCI A;  2OT2 A;  3K8A A;  1U4P A;  2Z6B A;  1LT6 D;  2JA8 H;  1Y69 U;  4G7H C;  5M5X B;  1VQA A;  2R7F A;  1TS3 A;  5LMU L;  3U58 A;  1J6Q A;  4GKJ Q;  1SLJ A;  3R2T A;  3G48 A;  4JI1 Q;  2DY8 A;  1SE3 A;  1YNN D;  5IIF A;  4LUZ A;  1BCP B;  1PTO D;  3NBH A;  3GTG B;  1IW7 D;  1DON A;  2EY1 A;  3ERO A;  3Q0A A;  2NN6 H;  3CME A;  3MXP A;  4DV2 L;  2JJQ A;  5DEH A;  1SNC A;  1D5X C;  2P5Z X;  3RUZ A;  4CBV A;  4QJF A;  3VA5 A;  4PZ8 A;  2E2I H;  2ZTD A;  3PUZ A;  4C3J H;  2VQE L;  1BBU A;  4DKA C;  3S15 B;  4RGM A;  4DR2 L;  2MQH A;  2K03 A;  1YI2 A;  3MFY A;  1EYC A;  3NEN A;  2R92 H;  3I91 A;  2R7Z G;  4A3M H;  5C4J H;  4IPG A;  4HJ9 A;  4MTK A;  1KC8 C;  3M4O H;  3GD7 A;  1KD1 C;  5IYB G;  1QIL A;  4JYA Q;  5D65 A;  4PV1 C;  4K8J A;  3SEB A;  2IY5 B;  4LF8 Q;  1O80 A;  3I90 A;  1CK1 A;  4QMG A;  3MXN A;  1VQ6 A;  3PUX A;  1O78 A;  4TVA B;  2EJF C;  1TWA H;  4PMW A;  4A3L G;  1EEI D;  4KHP L;  1ILQ A;  4WJW A;  1HJP A;  3D6W A;  3K7A H;  1W3S A;  3UE1 A;  1UEA B;  2WKD A;  2KA7 A;  1AW7 A;  3BVG A;  2XRS D;  2ICI A;  1C9O A;  2A6E C;  4KD3 A;  4ZCK A;  1DZ1 A;  4DGZ A;  2DNE A;  5H1S E;  3H6M A;  3MXU A;  1LT3 D;  1HHV A;  1HR0 Q;  1IBM L;  2J4X A;  3NBH B;  1X56 A;  2PNR C;  2Q8T A;  2TMP A;  4CDF C;  4XT1 B;  4L63 B;  1V9P A;  4BY1 G;  1RKN A;  1SE4 A;  5GAH C;  3B6Y A;  4JG2 A;  4DR7 L;  3TS0 A;  4JVZ A;  1PYS B;  3GTM B;  1EY4 A;  5CC4 A;  1G51 A;  1JT8 A;  4A3E G;  4ALP A;  1A2U A;  3BZD B;  1TS2 A;  4DU9 A;  1ZXT A;  2QW7 A;  4OIJ A;  4X64 L;  5M3F G;  5DM6 3;  3TP5 A;  1RJT A;  2F0Q A;  2HDL A;  3UE0 A;  3KBX A;  3LNN A;  3HZX A;  5C3X A;  1YJW A;  2MPM A;  1WVL A;  1BXT A;  1O7Z A;  1YHQ A;  1JR0 D;  1KRS A;  1RTN A;  1BBX C;  4Y7N H;  3PMF A;  5C4X B;  1SYD A;  4DXG A;  2FXQ A;  1K8M A;  1KAB A;  3F2U A;  3DMU A;  2YTV A;  4BBS B;  2J0T D;  2N3S A;  1FL0 A;  1PYW D;  1EY0 A;  3MXN B;  4K8I A;  2KQ3 A;  4C3I H;  3HGB A;  3GTP H;  2PW5 A;  3RZD H;  3H09 A;  1YJN A;  4F7X A;  4AIM A;  4BY7 B;  3J81 i;  4X3S A;  5KRU A;  1K8A C;  2JEB I;  4B3S Q;  5C0X G;  2A69 D;  3I70 A;  4CJ1 B;  2B2W C;  2F0G A;  4B3T Q;  3TZU A;  1F9Q A;  5CV4 A;  4X62 L;  4DV0 L;  1Q81 C;  3GDE A;  1HQM C;  5IYD G;  4POG A;  1VQG A;  1QZG A;  1ESR A;  4CJ2 C;  2MNA A;  4YWM A;  3HOW G;  3HOU H;  2K05 A;  4LF9 Q;  5IGE A;  1XNQ L;  2QF7 A;  3CKI B;  5IP9 H;  1PTO H;  2B2W A;  3I4O A;  4B9W A;  2IHF A;  2XTI A;  2NVT B;  4A3I G;  1DCZ A;  1FJG Q;  1BKB A;  1IBK L;  4DPG A;  4S3S A;  5IY0 A;  3STB C;  4B3R Q;  3EVQ A;  4JBW A;  1SFO H;  1SYE A;  1K8O A;  1DXM A;  4O42 A;  5FLM G;  4TQU S;  5JVG 3;  2L0C A;  3A55 A;  4DR3 L;  5JJL A;  3J7A V;  3V96 A;  4K0K L;  1UE6 A;  5CV5 A;  3H0G H;  1J9O A;  4AYB B;  3CU7 A;  2CW0 D;  3J80 i;  1HA6 A;  1CQV A;  1LAC A;  1HFN A;  1SSO A;  1LTB D;  3M4Q A;  1N36 Q;  2E75 C;  2HCI A;  1A0I A;  2F0D A;  2K52 A;  1U0L A;  3T1H Q;  1NAP A;  3MA2 B;  3C2P A;  1D8L A;  4DV1 Q;  2LFN A;  2CWA A;  3UDX A;  5A2Q E;  2HQE A;  1WYD A;  1Y1W G;  3GTO B;  4DR7 Q;  1I4Q A;  2D9U A;  1Q8I A;  5CV7 A;  3R93 A;  5JJI A;  3U4Z A;  1SNQ A;  5LMN L;  2WB1 E;  3CPF A;  4B3M L;  1I50 B;  4H02 A;  2LKV A;  4UHV A;  2JA8 B;  3MVV A;  1D5Z C;  2L55 A;  2NTS A;  5JPN C;  1JE4 A;  3D3R A;  4K2L A;  2K5W A;  2QDB A;  1STN A;  3SK5 A;  1Z9F A;  2MP1 A;  3K7U C;  1CKM A;  2B2T A;  4IUN A;  4JI5 Q;  2NZO A;  1O7I A;  2PI2 A;  3CQZ H;  3NHH A;  2LS0 1;  1IYV A;  2KCN A;  1SND A;  2PZU A;  2B63 G;  3HOZ H;  4DK0 A;  1HUN A;  2SDF A;  4UP9 A;  3V05 A;  1O7Y A;  1HZB A;  1HFG A;  2I46 A;  2A68 D;  4PG3 A;  3A74 A;  3SK4 A;  4MNO A;  3CCR A;  3GTQ H;  4QIW E;  1IBL L;  2E2I B;  4A3J H;  2F1M A;  4NXM Q;  4OO1 G;  1W6K A;  4LFC Q;  2VUM H;  3DWQ A;  4DF7 A;  1YNJ D;  3PIP 3;  4JOI A;  4A3M B;  3ND9 A;  4X65 Q;  4IJH A;  5C4J B;  4JI4 L;  4HIM A;  3M4O B;  2KBN A;  5FO8 B;  1CZG A;  3ER0 A;  1BO0 A;  2F0V A;  1V8Q A;  1L0Y B;  3U9O A;  4IUR A;  3BYT B;  1U5K A;  3LWE A;  3UI2 A;  4ULL A;  4XXE A;  3VYU A;  2EXD A;  1Y1V G;  3CD6 A;  3KUP A;  1ILP A;  3AYH B;  3J7Y W;  3NWS A;  1UWV A;  1GUG A;  4KV6 A;  4JBJ A;  1NE3 A;  1S40 A;  1HR0 W;  3K7A B;  2XRQ D;  4I7A A;  1EZ6 A;  2Z4I A;  5M3M H;  1QVC A;  5CYU A;  2BE5 D;  3BVM A;  1A62 A;  1XMQ L;  3CCS A;  5JOB A;  4UAI A;  4L5R C;  2QA4 A;  4AQY L;  3PUV A;  1JJC B;  4DR1 Q;  3V2T A;  2LXK A;  2F03 A;  2JA7 H;  4EQ5 A;  2LSS A;  1KTK A;  2H4O A;  3ND8 A;  1DOM A;  1NUC A;  2VB2 X;  2GVA A;  4OEL B;  3L2P A;  2IWH A;  2B29 A;  3RLF A;  2EOT A;  4KY7 A;  2D62 A;  4NP5 A;  4A3B H;  5BR8 L;  2PPB C;  3QR8 A;  4U68 A;  4LF6 L;  4R4C A;  1N9W A;  4IPD A;  4G7O C;  4X66 L;  2UU9 Q;  1TR5 A;  1LAB A;  3K6O A;  1PRT F;  3D4W A;  3PIO 3;  4FF4 A;  2N8N A;  4BBR H;  1GUW A;  1M4V A;  3Q23 A;  1RTO A;  5IYC H;  1SMX A;  5G3L F;  1VQF A;  1FVI A;  4B9X A;  2LY7 A;  3BDC A;  1A63 A;  2LXJ A;  3GQB A;  4QCL A;  2RHQ B;  2Q2T A;  1UEB A;  3H15 A;  1H9S A;  3GTP B;  3RZD B;  3RZO H;  1EEF D;  2Y0S E;  3G6E A;  2QKI C;  5DNF A;  1I94 Q;  1ENA A;  1FNW A;  3EA6 A;  2AWN A;  1PHJ A;  1AE3 A;  3OMG A;  4C2M B;  4DV7 Q;  3K80 C;  2IHE A;  2F0L A;  1CUK A;  3VYR A;  1CQF A;  4IOA A;  1MSH A;  2OWO A;  3HOU B;  2ZXR A;  3IFD A;  3DWA A;  3IKJ A;  4RMF A;  1RHP A;  3FPP A;  4P74 A;  2B2Y C;  1WD1 A;  3A0J A;  5GAD C;  4JI6 L;  1F2Y A;  1QNU A;  2F4V L;  2UUC L;  1IL2 A;  1QCB D;  4FDB A;  4FP5 D;  4RAU C;  2OTL A;  2ZJQ A;  1SFO B;  5AJ3 L;  5KND A;  2X6G A;  3S1R B;  3SGI A;  1SJE D;  2B2Y A;  2K1B A;  4ZQ3 A;  4PNY A;  3HKZ B;  4IAL A;  4IJL A;  1D1K A;  5M5W B;  4IFD G;  3H0G B;  2F0O A;  5ISR A;  1ENF A;  5C4X G;  1VQD A;  4QF4 A;  4BXX G;  2A1A A;  1N33 L;  4QGU A;  3HOY H;  1J5E Q;  1WCM H;  4BBS G;  1VQB A;  4DUY L;  2PNH A;  1AZQ A;  3HG9 A;  4DR4 L;  4C3H H;  4YCV A;  1CZW A;  2AQ3 B;  3VA7 A;  1H9S B;  2F3W A;  1KRT A;  1SDF A;  3URY A;  1S72 A;  4RGO S;  1GOZ A;  1EQR A;  1RDP D;  1VMC A;  3HOV B;  2Q8I B;  4BY7 G;  2I07 B;  5KGU A;  1PXU A;  3ERS X;  2IL8 A;  2NN6 I;  3QIA A;  1G29 1;  3CP0 A;  1Q8K A;  3I2Z A;  5JEA H;  1MHW C;  2JP1 A;  1I4X A;  4CGY B;  4IFD J;  5I4D A;  3GTK H;  4IQZ A;  1SMY D;  4JV5 Q;  1EIF A;  4MIU A;  1PA6 A;  4LF7 L;  4F8M A;  1ONL A;  2CWP A;  1AZP A;  5FLX E;  5NUC A;  2NUC A;  4GKK L;  4DV3 Q;  1EU3 A;  4LFA Q;  3A54 A;  2V4D A;  4DAP A;  4ZUI A;  3CPW A;  1YBY A;  3A7L A;  4GNX C;  1IZ6 A;  1IKL A;  1JQY D;  3GV6 A;  2UUA Q;  3PF4 A;  4DR6 L;  2I5L X;  2KCM A;  1JWU D;  1N34 L;  4A3G H;  5ELF A;  1SNM A;  4GZY C;  4IUQ A;  3GTQ B;  2A6H D;  4LF5 Q;  4XQN A;  3J81 L;  3K0X A;  4PZ6 A;  4UP7 A;  1SE8 A;  4GNX A;  3CCQ A;  3QOL A;  4L5S A;  4DFA A;  4AYB G;  2OQK A;  2VUM B;  4LUV A;  4RCN A;  4LW1 A;  3U9S A;  1CA6 A;  1AE2 A;  1BCP C;  4A3F H;  3BS1 A;  1OXV A;  3T1Y L;  1B8A A;  4X3T A;  1N32 L;  4GOP B;  1L0X B;  4IUP A;  1UUP A;  1R4P B;  5EKK A;  3FP9 A;  1H9J A;  3MHB A;  1A3U A;  3PO3 H;  2HHH L;  3P75 A;  5T1I A;  3FPU B;  3PO2 G;  1GVP A;  3TEH B;  2RHS B;  3BYY B;  3W5O A;  2A5H A;  2ZTC A;  2CQO A;  4R8I A;  3J7Z C;  1XTC D;  5M3M B;  2IX0 A;  3N6R A;  4RCO A;  2KEE A;  3CCM A;  1HRJ A;  4QB4 A;  2EXZ A;  3J80 L;  2UXC Q;  3JAM L;  1A2T A;  2A68 C;  1IHZ A;  5J1Z A;  2DUD A;  1XNR L;  1AFP A;  4K14 A;  4IPC A;  3J7A F;  2DY7 A;  2JA7 B;  1I5F A;  3UDG A;  1IXR A;  1HH2 P;  1CHQ D;  4XYQ A;  4UY8 C;  2PQE A;  2RKS A;  5CBA E;  1YNJ C;  2UXD L;  1K0R A;  4A3D B;  3VR6 A;  5CBE E;  4RWS C;  1FGB D;  4GNX B;  1B7Y B;  1ICW A;  3IRB A;  5IGD A;  2Q2H A;  4CKE A;  3D31 A;  3BZC A;  3I72 A;  2C35 B;  1EY6 A;  5C5M A;  4BBR B;  5HGT A;  1VQL A;  2SNS A;  2F0P A;  1S3O A;  5CR3 A;  2Z6K C;  2RSO A;  4A3M G;  3BG3 A;  2ZM6 L;  4HIO A;  1FGU A;  1TWC H;  4P73 A;  1X54 A;  2ID0 A;  1WJJ A;  1SYF A;  3N52 A;  5KYI A;  2WAQ E;  1SYB A;  1X6O A;  1V1O A;  5TSS A;  5T1G A;  5IGF A;  2HIV A;  1GXD C;  1PRT D;  3QJY A;  3CHB D;  3OYY A;  4OWW B;  2R93 B;  1Z47 A;  2B39 A;  3K57 A;  1VQ7 A;  2F0H A;  2Z6K A;  1LTT D;  3TDQ A;  4P72 A;  2AWO A;  3SK6 A;  2K01 A;  3RZO B;  2BE5 C;  2EYM A;  4O2D A;  5G3L D;  2E2J B;  2OEO A;  4HN7 A;  3RNU A;  3A5U A;  4ZK9 B;  1LLR D;  1FYC A;  1C8C A;  1SJH D;  1C0A A;  2QEJ C;  4KY5 A;  2F0F A;  4QUF A;  1PV4 A;  1HPC A;  2YTX A;  3IL8 A;  3DEO A;  2NZ1 D;  1KAA A;  4KK7 A;  4P2C B;  3S2D H;  4A93 H;  3OIP A;  1TWH H;  4WJ3 M;  3RLN A;  4R4Q A;  4NXN L;  3UDF A;  4BS9 A;  3DEP A;  4EQP A;  3CXC A;  2PZT A;  3K59 A;  1PH8 A;  5C4H A;  2ZXP A;  1CKO A;  4DK6 C;  2ALY B;  2OQ0 A;  1K8G A;  1ASZ A;  4A3K H;  4MZ9 A;  5C44 H;  4JI3 Q;  1F2Z A;  1TKW B;  2TSS A;  3E5S A;  1X55 A;  3ZYY X;  5C0X I;  2HCC A;  2JQO A;  5COR A;  1OXX K;  1EIH A;  5FJ8 G;  5CMD A;  1CT1 D;  4ZKC B;  1HNZ Q;  1BVS A;  2HUG A;  2MJ8 A;  1VDZ A;  2JYO A;  3PQI A;  2EE1 A;  3A8K E;  3I8Z A;  4OHJ A;  5IT9 L;  2EYL A;  4KJO A;  2XGT A;  2Q2I A;  1RD9 D;  4RHS A;  1MSG A;  2E74 C;  3X3M A;  5IE8 A;  4EGV A;  4L5T A;  1E1T A;  2K32 A;  3HKS A;  1PDQ A;  1GJX A;  3HOY B;  2N55 A;  1VQ5 A;  1FNU A;  1PFB A;  1E3P A;  2OF1 A;  4YY3 Q;  1YZ6 A;  2X69 A;  4HAE A;  1MBY A;  1MI2 A;  1NCV A;  1AH9 A;  1S5E D;  5AFW A;  2JA6 B;  1A3V A;  4LJZ C;  2EYH A;  1JWM D;  5JJZ A;  2JK8 A;  4BWG B;  5LL6 X;  5JJK A;  5KNC A;  1AEX A;  1I4R A;  2R7D A;  1CFM A;  3K5M A;  5IGB A;  1Y8N B;  3KF8 A;  3GO5 A;  3NSW A;  1YHB A;  3QB3 A;  1OTC A;  2HIX A;  2WKC A;  2XNA C;  1PFM A;  3G6J B;  2L1B A;  4JI0 L;  5LMU Q;  4JI8 L;  1SBB B;  3WWV A;  2F3I A;  2R7Z H;  2JN4 A;  3IAY A;  4HMI A;  3S2H H;  3F8T A;  1QUQ A;  1I3Q B;  1LTR D;  2UUB L;  5FK9 C;  3T16 A;  2K5V A;  3M3Y H;  4XYO A;  3VR2 A;  5K5P A;  2ASB A;  5EBD A;  1YNX A;  3H3V C;  1XJV A;  2L5T A;  1HA5 A;  1E2V A;  2UXB L;  2L15 A;  1F9P A;  1K83 H;  4DV2 Q;  2RBM A;  3S1Q H;  4OWX B;  4DNT B;  2KUM A;  5EKL A;  2H1E A;  4A3L H;  1I4G A;  3HKZ G;  1Z7T A;  3NXW A;  3K58 A;  2XVS A;  2VQE Q;  3OPO A;  3RN5 A;  4DR2 Q;  1OXU A;  1B53 A;  2RCF A;  5IP7 G;  1S5F D;  1XWE A;  2BA0 A;  2JA5 H;  4LF4 L;  3PGZ A;  4KD4 A;  4RA8 A;  4DK1 A;  4A3F B;  1KLU D;  4FF1 A;  4QQB X;  3QOJ A;  3NQI A;  3ULP A;  1P16 A;  1R4Q B;  4XTC S;  1HQR D;  1WTW A;  3TBI B;  3HOV G;  4BY1 H;  5EBC A;  3A8I E;  1V1P A;  1TS4 A;  3KJO A;  1XMO L;  2ATW A;  4A3E H;  3PO3 B;  3KF8 B;  4FNF A;  4K5V A;  5FO9 B;  4OWT B;  3J81 E;  4KHP Q;  3PSI A;  4OO1 I;  5C3E H;  2KVM A;  1VQN A;  2NTT A;  3TS2 A;  1VQJ A;  2D2C C;  3AEV A;  3FRP B;  1Z6H A;  4XQJ A;  1QUQ B;  3KOJ A;  1QG7 A;  3K5N A;  2JEA I;  5EKI A;  1BOS A;  5FLX L;  4DNI A;  3AFP A;  1IBM Q;  3JAM i;  4J1M A;  2K6A A;  1CTM A;  2KCC A;  3M7G A;  2PCF B;  4ZLT F;  4OEM B;  1KNE A;  1JIC A;  2IPK D;  3FKI H;  1KNA A;  3OOC A;  1ZYR C;  3ULL A;  4C1N K;  1L1O A;  3PIP A;  3TZD A;  3S14 H;  2WB1 B;  3EFX D;  1S5C D;  3OHX C;  4JI2 L;  1SAP A;  2K33 A;  1VQK A;  5C0X H;  5IOD A;  1B2T A;  1B3Q A;  1KDB A;  3G71 A;  4M8A A;  5EPK A;  2C9O A;  3P1H A;  4X64 Q;  3E9H A;  1L0W A;  2B2T C;  4OX9 L;  4CDC C;  1PFS A;  1PLF A;  2VUM G;  3M9B A;  1WTQ A;  1OXT A;  2JA9 A;  1F9S A;  1MJC A;  4OON A;  2K14 A;  4KKT A;  3HOW H;  3T56 B;  1RIP A;  1TWC B;  3J80 E;  3JAM E;  3S1M H;  2WFW A;  2K5H A;  4NMZ A;  2FMC A;  2QIL A;  5GAG C;  2KCT A;  4A3I H;  1KDA A;  2F0K A;  2G5D A;  1V1P B;  1GUS A;  1NSN S;  3OTO L;  3W3A A;  1K0S A;  4ID6 A;  5CV8 A;  4QIW B;  1GHJ A;  3HRZ C;  3TSS A;  2O5J C;  2E2D C;  2KJX A;  4ZRZ A;  2L4N A;  2WAC A;  4JOI C;  3WOE A;  1E24 A;  1ROD A;  1PMR A;  5M3M G;  3GTL H;  4A76 A;  1ML0 D;  1X3E A;  2QCP X;  3S2D B;  4X62 Q;  2NWG A;  4DV0 Q;  4LF4 Q;  4C3J B;  1JOO A;  4CJ0 B;  4RGN A;  1PZK D;  1U4M A;  1PH9 A;  1ICF B;  3QG1 A;  2RVL A;  1XNQ Q;  3I4N H;  2DJF C;  4PZ7 A;  2R92 B;  1LT5 D;  3PIO A;  1TWG H;  4HJ5 A;  2JA7 G;  1L1O B;  4Z9C B;  2SNM A;  1K3R A;  4A3K B;  1WOC A;  1XPO A;  1Y1W H;  3NWT A;  1IBK Q;  1GHK A;  4TRD A;  5ELN A;  4A3D G;  2F0T A;  1LTI D;  4K5W A;  4NB3 A;  2B8F A;  1QE6 A;  3AU7 A;  2F0U A;  4DR3 Q;  1MJE A;  5I6Y A;  3M4Y A;  4BBR G;  5KYL A;  4J6H A;  3K5L A;  2E5L L;  1TWA B;  3PV0 A;  4JC0 A;  4K0K Q;  3SE0 A;  4HSP A;  5LL6 S;  1LV9 A; 
#chains in the Genus database with same CATH homology
 2Z8L A;  1YNN C;  1HUM A;  3C46 A;  1PTO C;  4V19 0;  1IW7 C;  1E0B A;  2RSN A;  2EYO A;  3D8G A;  5COY A;  2M00 A;  2PMZ B;  4KN7 C;  1Q3L A;  1Q12 A;  2FMM A;  1GUN A;  4OO1 H;  2B2U A;  5IT9 E;  3VYT A;  2K5Q A;  1SYG A;  2AQ1 B;  2EDG A;  3PUY A;  3S2H B;  2A74 C;  4V0B A;  2AUJ D;  4ZAI A;  4Y7N B;  5BN5 A;  1EY9 A;  2F0S A;  2F0W A;  1TQO A;  1SNP A;  2Y0S B;  1K83 B;  3T51 B;  1TS5 A;  2ENB A;  4C3I B;  3ERQ A;  2RQX A;  4KMU C;  3DHQ A;  1WTX A;  1LTS D;  2JA5 B;  1ENC A;  3H91 A;  4IN3 A;  5I9O A;  3TME A;  1PRT B;  5EPJ A;  2OXP A;  2E76 C;  1F2L A;  2A6E D;  1PTO B;  3NBI A;  4K5X A;  1I4H A;  4E6I A;  1NR2 A;  1LT4 D;  3NTH A;  4A3E B;  2EVB A;  1MD2 D;  4MN3 A;  2FIN B;  5C3E B;  4ME5 A;  2SOB A;  1U9R A;  1JWS D;  5JPM C;  1AN8 A;  4IUV A;  3ITP A;  1X3Q A;  3DWP A;  1D6E C;  4DAY A;  5CV9 A;  3FKI B;  2F3V A;  2A69 C;  3FMC A;  5JEA J;  5I2Y A;  1I4P A;  1XX8 A;  1DOL A;  4FYD A;  1H9R A;  5EQ0 A;  1CI3 M;  4MHE A;  5FKA C;  1STA A;  1UAP A;  3K5O A;  2ZT9 C;  2R61 A;  4FF3 A;  2F0J A;  1EWH A;  5I6W A;  4X3K A;  5BN3 A;  1FD7 D;  5E3F A;  3C1F A;  3EJI A;  3CQZ B;  1F77 A;  4Q5V A;  4G57 A;  2IW3 A;  3HOZ B;  1ET9 A;  4PQX A;  1U4L A;  2CW0 C;  3R3O A;  1S5D D;  5K36 H;  2R6G A;  4BA2 I;  3L3O C;  3Q22 A;  1BNZ A;  4A3J B;  1JOQ A;  3D4R A;  2NBF A;  4TKO B;  3RD4 A;  5IGC A;  3I4N B;  5J39 A;  1TWG B;  3KBG A;  4DAV A;  1EFI D;  3I73 A;  2EY2 A;  2WP8 J;  1U4R A;  2VNU D;  4R9W A;  2IJ0 A;  2M2L A;  1B3A A;  3HS0 C;  1X32 A;  4J8Q A;  5C3W A;  1B50 A;  1G2S A;  2K04 A;  4ABN A;  3D4D A;  3FVQ A;  3R8B A;  4RGT A;  1B9M A;  4HED A;  4RFB A;  4IZ8 A;  4H0L C;  5ELE A;  3MEH A;  3Q24 A;  3GP7 A;  4XDX A;  3S16 B;  2MHV A;  3SK8 A;  2X6L A;  1F2M A;  1WTV A;  2B63 B;  2WIN B;  4HSV A;  1S5B D;  1R9T B;  5E1F A;  2NN6 G;  4XIG S;  2O2L D;  3W2D A;  4K2K A;  3TP7 A;  4A3B B;  4KI0 A;  5M9O A;  4C3J G;  3NQT A;  4HMJ A;  2N88 A;  1BCP F;  4N9P A;  3S17 B;  4WFN 3;  1H9K A;  2WAQ B;  4DA2 A;  2EJM A;  2K28 A;  2JXM B;  2RA4 A;  2R3Z A;  1Y8P B;  1BR9 A;  1FNV A;  1DD2 A;  1WTR A;  4N9T A;  1STE A;  2Z4H A;  3NUC A;  3I4L A;  1DYQ A;  2DNC A;  3KLR A;  4WOR A;  4IUU A;  3L7Z C;  5LHY 1;  1T5X D;  1TII D;  1KDC A;  2FHT A;  5M5Y B;  4L6T B;  2Z1C A;  3K0Y A;  4KKU A;  1TY0 A;  2MUY A;  1CM9 A;  3GV3 A;  1I6H B;  1W6J A;  1PFN A;  1UNS A;  3MAQ A;  5EGT A;  2L11 A;  3VR4 A;  1SEB D;  1Y8O B;  1WCM B;  3MZ5 A;  3SVM A;  4JK1 C;  4C3H B;  5D3D A;  1VF5 C;  1B4O A;  4C3I G;  5DM7 3;  3FDT A;  4RHR A;  1OO9 B;  4ZKB B;  3OIQ A;  1GUT A;  4KKS A;  2CVR A;  1WTO A;  3AMU A;  3E6Z X;  2F0E A;  3GTK B;  3MFG A;  5IOC A;  1QJO A;  4G7Z C;  4PMB A;  3VR5 A;  2O5I C;  3SHL A;  1SYC A;  2M9V A;  2L12 A;  3SDZ A;  1CA5 A;  1XYI A;  3OMC A;  1EY8 A;  5KNB A;  3QO2 A;  1CHP D;  4LK1 C;  2D5D A;  4A3G B;  4H44 C;  1E2W A;  4ILW A;  1QWY A;  3AB9 A;  1STB A;  3Q6S A;  1QOH A;  1I6V C;  4CKC A;  3NTK A;  3SXH A;  4KN4 C;  1MGS A;  2G9D A;  3EQL C;  1G8Z D;  3HEJ A;  3KLS A;  5J22 A;  3D6C A;  3HOX B;  4ODG A;  4FXG C;  2EYP A;  1SMY C;  5DAU A;  1XXG A;  3S1N B;  2KED A;  1ZKO A;  1SNO A;  4XT3 B;  2MGS A;  3DXJ C;  4WRD A;  1AP0 A;  5C4Z A;  2F0M A;  4BA1 I;  2XIW A;  2CQA A;  3QWN A;  3BDO A;  2EJG C;  2WV6 D;  2A6H C;  5C0X J;  1S4Z A;  3MXG A;  3T13 A;  2PW7 A;  4F88 A;  2IT1 A;  4OGQ C;  4FO2 A;  4C56 C;  1C4Q A;  1G91 A;  3I4M B;  4OL7 A;  4QUC A;  2F0I A;  1ZEQ X;  2G9H D;  1JB3 A;  4Q0F A;  3C3L A;  3H94 A;  4CKB A;  2DN8 A;  1DM0 B;  1BCP D;  3NTI A;  3M7N A;  2B2V C;  2SEB D;  1EIG A;  4YIJ A;  1A3T A;  5KIX A;  3PO2 B;  5EJW A;  4KHV A;  5JAV A;  2XSC A;  1A6X A;  4UDU C;  1LTA D;  3VR3 A;  1HCZ A;  3GTJ B;  4H7B A;  4LAA A;  2RDG A;  2B2V A;  4A93 B;  1TWH B;  4KY6 A;  1B44 D;  1IL8 A;  2GA4 B;  1BDO A;  4CHT B;  3ONA B;  2NVQ B;  1PZJ D;  4IUT A;  2BOS A;  3WOF A;  1B1Z A;  4RH6 A;  2EYJ A;  5C44 B;  3OWE B;  2JE6 I;  1E2Z A;  2EY6 A;  1STH A;  1IKM A;  3LWU A;  1EQT A;  1ET6 A;  1EU4 A;  1VF7 A;  1JOK A;  5I2X A;  2BDN A;  2EZV A;  2EY5 A;  3E0J A;  1JOR A;  3OWF A;  2FJ2 A;  5CV6 A;  1FR3 A;  1PRT C;  1EL0 A;  3SR1 A;  4EQN A;  4FXD A;  1BUV T;  1G6Z A;  1TU2 B;  1TWF B;  3TP6 A;  2BA1 A;  3RMH A;  4FF2 A;  1DJR D;  2YU9 B;  3X3N A;  2B2U C;  3TN2 A;  3HP3 A;  1Q1B A;  1SE2 A;  1NR4 A;  5IGG A;  4NDX A;  5EPL A;  2XWJ B;  1QB5 D;  1LO5 D;  4ZUJ A;  4IFD I;  5HUR A;  2PO4 A;  4F87 A;  2JSO A;  3KLS X;  2R7Z B;  3MTS A;  3T53 B;  1B9N A;  1EZ8 A;  2KEC A;  3NK9 A;  5ELD A;  3M3Y B;  2NVY B;  5CGK A;  1IYU A;  1WD0 A;  2NB0 A;  5D14 A;  1STG A;  1JC7 A;  3C1E A;  5FO7 B;  3S1Q B;  2FFK B;  4H13 C;  4HCE A;  1PTO F;  1GUO A;  3DUZ A;  1M8A A;  2IX1 A;  5D3I B;  4M1U B;  1KLG D;  2LMC B;  1WTP A;  1EYA A;  1EYD A;  2BCO A;  4HTH A;  4K6D A;  5C6A A;  2BDO A;  4C3H G;  2VXW A;  5ELB A;  5KEE A;  2YYZ A;  3CRK C;  4BY1 B;  1RF2 D;  3OW7 A;  5JEA G;  2E2H B;  1TVX A;  4X3U A;  2KHS A;  4O1N A;  1HTL D;  2J7Z A;  1EY7 A;  5M3F B;  1G2T A;  2AUK A;  2KOL A;  1D5M C;  1C48 A;  4DNR B;  3L9A X;  3OSO A;  1HXY D;  3T4A C;  4LMQ D;  2ICE C;  2RDH A;  1STY A;  3NPP A;  3O13 A;  1SXT A;  3S14 B;  4TSS A;  5K36 G;  1A15 A;  1BQQ T;  4PMC A;  2A73 B;  3BDL A;  5BN4 A;  3VYS A;  2VB3 X;  1X3P A;  3HOW B;  3NE5 B;  3G7L A;  4I7Z C;  2WII B;  5A35 A;  3IFT A;  5FOB B;  3S1M B;  1T5E A;  4I65 A;  4FVM A;  3NP8 A;  4EQO A;  4A3I B;  3P7J A;  2B8G A;  4RKL A;  2NVX B;  1II3 A;  4OIK A;  4U67 3;  2PYK A;  3M85 A;  4XQQ A;  3BVZ A;  3GTL B;  4IFD H;  2L9H A;  4FXK C;  5E4X A;  4KJN A;  4HCS A;  2IX3 A;  1JCK B;  1PZI D;  3KK7 A;  4KHZ A;  3R2I A;  2C5C A;  3LX0 A;  1Q90 A;  1Y1W B;  1J8I A;  3TP8 A;  3MWY W;  1ZYR D;  5C5L A;  1VMP A;  2PZW A;  4R8N A;  5I9P A;  1LTG D;  2Q8R E;  5E4W C;  4DXF A;  4L8J A;  3PUW A;  4K6L A;  4C1N I;  1F9R A;  4DN4 M;  4EVO A;  3A56 A;  1TY2 A;  2NYZ D;  4G4K A;  2XN9 C;  3A8J E;  4HR7 B;  5A2Q L;  2ZXO A;  4RKB A;  5ELC A;  2F4I A;  1O7L A;  4KTA A;  4ZYS A;  2AQ2 B;  1BF4 A;  2HDM A;  2XWB B;  3MC0 B;  3P20 A;  2CHB D;  3WDN A;  3DM1 A;  3I3C A;  2K5D A;  1RCV D;  2EPB A;  4NW2 A;  1OXS C;  2EYF A;  1ESF A;  1EQV A;  1TT2 A;  2K7V A;  3S9W A;  2RDF A;  1EY5 A;  2O4X A;  1D1I A;  1H9M A;  4B08 A;  1EOT A;  1D2B A;  1EWC A;  1DOK A;  5JVH 3;  1QNK A;  2F0N A;  3A7A B;  3FEW X;  3CRL C;  1V43 A;  1HTP A;  5F2D A;  1Y1V B;  4NKL A;  1Q1E A;  1VCI A;  2OT2 A;  1U4P A;  1LT6 D;  1Y69 U;  4G7H C;  5M5X B;  1TS3 A;  3R2T A;  2DY8 A;  1SE3 A;  1YNN D;  5IIF A;  1BCP B;  1PTO D;  3NBH A;  3GTG B;  1IW7 D;  1DON A;  2EY1 A;  3ERO A;  3Q0A A;  2NN6 H;  3MXP A;  5DEH A;  1SNC A;  1D5X C;  3RUZ A;  4CBV A;  3VA5 A;  3PUZ A;  3S15 B;  4RGM A;  2K03 A;  3MFY A;  1EYC A;  3I91 A;  3GD7 A;  1QIL A;  5D65 A;  4PV1 C;  4K8J A;  3SEB A;  1O80 A;  3I90 A;  1CK1 A;  4QMG A;  3MXN A;  3PUX A;  1O78 A;  2EJF C;  4PMW A;  1EEI D;  1ILQ A;  4WJW A;  3D6W A;  1UEA B;  2WKD A;  2KA7 A;  1AW7 A;  3BVG A;  2XRS D;  2ICI A;  2A6E C;  4KD3 A;  1DZ1 A;  4DGZ A;  2DNE A;  3H6M A;  3MXU A;  1LT3 D;  1HHV A;  2J4X A;  2PNR C;  2Q8T A;  2TMP A;  4XT1 B;  4L63 B;  1RKN A;  1SE4 A;  3GTM B;  1EY4 A;  5CC4 A;  1A2U A;  3BZD B;  1TS2 A;  4DU9 A;  1ZXT A;  4OIJ A;  5DM6 3;  3TP5 A;  1RJT A;  2F0Q A;  2HDL A;  3KBX A;  3LNN A;  3HZX A;  5C3X A;  2MPM A;  1WVL A;  1BXT A;  1O7Z A;  1JR0 D;  1RTN A;  1BBX C;  5C4X B;  3PMF A;  1SYD A;  4DXG A;  1K8M A;  1KAB A;  3F2U A;  3DMU A;  4BBS B;  2J0T D;  1PYW D;  1EY0 A;  4K8I A;  2KQ3 A;  3HGB A;  2PW5 A;  3H09 A;  4F7X A;  4BY7 B;  4X3S A;  5KRU A;  2JEB I;  5C0X G;  2A69 D;  3I70 A;  4CJ1 B;  2B2W C;  2F0G A;  3TZU A;  1F9Q A;  5CV4 A;  1HQM C;  1ESR A;  4CJ2 C;  2K05 A;  5IGE A;  2QF7 A;  3CKI B;  1PTO H;  2B2W A;  4B9W A;  2NVT B;  1DCZ A;  4S3S A;  3EVQ A;  4JBW A;  1SYE A;  1K8O A;  1DXM A;  4O42 A;  4TQU S;  5JVG 3;  2L0C A;  3A55 A;  3J7A V;  3V96 A;  5CV5 A;  1J9O A;  4AYB B;  3CU7 A;  2CW0 D;  1HA6 A;  1CQV A;  1LAC A;  1HFN A;  1SSO A;  1LTB D;  2E75 C;  2HCI A;  2F0D A;  1NAP A;  3MA2 B;  3C2P A;  2LFN A;  5A2Q E;  2HQE A;  3GTO B;  1I4Q A;  2D9U A;  1Q8I A;  5CV7 A;  3R93 A;  1SNQ A;  1I50 B;  2LKV A;  2JA8 B;  3MVV A;  1D5Z C;  2L55 A;  2NTS A;  5JPN C;  1JE4 A;  3D3R A;  4K2L A;  2K5W A;  2QDB A;  1STN A;  3SK5 A;  2MP1 A;  2B2T A;  4IUN A;  3NHH A;  2LS0 1;  1IYV A;  2KCN A;  1SND A;  2PZU A;  4DK0 A;  1HUN A;  2SDF A;  3V05 A;  1O7Y A;  1HFG A;  2I46 A;  2A68 D;  3SK4 A;  2E2I B;  2F1M A;  4OO1 G;  1W6K A;  3DWQ A;  4DF7 A;  1YNJ D;  3PIP 3;  4A3M B;  3ND9 A;  5C4J B;  3M4O B;  5FO8 B;  1CZG A;  1BO0 A;  2F0V A;  1V8Q A;  1L0Y B;  3U9O A;  4IUR A;  3BYT B;  3LWE A;  3UI2 A;  4ULL A;  4XXE A;  3VYU A;  3KUP A;  1ILP A;  3J7Y W;  3NWS A;  1GUG A;  4KV6 A;  3K7A B;  2XRQ D;  1EZ6 A;  2Z4I A;  5CYU A;  2BE5 D;  3BVM A;  5JOB A;  4UAI A;  3PUV A;  3V2T A;  2F03 A;  1KTK A;  2H4O A;  3ND8 A;  1DOM A;  1NUC A;  2VB2 X;  2IWH A;  3RLF A;  2EOT A;  4KY7 A;  2D62 A;  4NP5 A;  2PPB C;  4U68 A;  4G7O C;  1TR5 A;  1LAB A;  3K6O A;  1PRT F;  3D4W A;  3PIO 3;  4FF4 A;  1GUW A;  1M4V A;  3Q23 A;  1RTO A;  5G3L F;  4B9X A;  2LY7 A;  3BDC A;  3GQB A;  4QCL A;  1H9S A;  3GTP B;  3RZD B;  1EEF D;  2QKI C;  5DNF A;  1ENA A;  1FNW A;  3EA6 A;  2AWN A;  3OMG A;  4C2M B;  2F0L A;  3VYR A;  1CQF A;  1MSH A;  3HOU B;  2ZXR A;  3IFD A;  3DWA A;  3IKJ A;  1RHP A;  3FPP A;  2B2Y C;  1WD1 A;  1F2Y A;  1QNU A;  1QCB D;  4FP5 D;  4RAU C;  1SFO B;  5KND A;  2X6G A;  3S1R B;  1SJE D;  2B2Y A;  2K1B A;  4ZQ3 A;  4PNY A;  3HKZ B;  4IAL A;  1D1K A;  5M5W B;  4IFD G;  3H0G B;  2F0O A;  5ISR A;  1ENF A;  4QF4 A;  1AZQ A;  3HG9 A;  3VA7 A;  1CZW A;  2AQ3 B;  1H9S B;  2F3W A;  1SDF A;  3URY A;  4RGO S;  1GOZ A;  1RDP D;  1VMC A;  3HOV B;  2Q8I B;  2I07 B;  5KGU A;  1PXU A;  2IL8 A;  2NN6 I;  3QIA A;  1G29 1;  5JEA H;  2JP1 A;  1I4X A;  4CGY B;  4IFD J;  5I4D A;  4IQZ A;  1SMY D;  4MIU A;  4F8M A;  1ONL A;  1AZP A;  5FLX E;  5NUC A;  2NUC A;  1EU3 A;  3A54 A;  2V4D A;  4DAP A;  4ZUI A;  3A7L A;  1IKL A;  1JQY D;  3GV6 A;  1JWU D;  5ELF A;  1SNM A;  4GZY C;  4IUQ A;  3GTQ B;  2A6H D;  4XQN A;  3J81 L;  3QOL A;  4DFA A;  2VUM B;  4RCN A;  3U9S A;  1CA6 A;  1BCP C;  3BS1 A;  1OXV A;  4X3T A;  1L0X B;  4IUP A;  1UUP A;  1R4P B;  5EKK A;  1H9J A;  3MHB A;  1A3U A;  3P75 A;  5T1I A;  3FPU B;  3BYY B;  2A5H A;  4R8I A;  1XTC D;  5M3M B;  2IX0 A;  3N6R A;  4RCO A;  2KEE A;  1HRJ A;  4QB4 A;  2EXZ A;  3J80 L;  3JAM L;  1A2T A;  2A68 C;  1IHZ A;  5J1Z A;  1AFP A;  4K14 A;  3J7A F;  2DY7 A;  2JA7 B;  1CHQ D;  4XYQ A;  2PQE A;  2RKS A;  5CBA E;  1YNJ C;  4A3D B;  3VR6 A;  5CBE E;  4RWS C;  1FGB D;  1ICW A;  5IGD A;  4CKE A;  3D31 A;  3I72 A;  1EY6 A;  5C5M A;  4BBR B;  5HGT A;  2SNS A;  2F0P A;  5CR3 A;  2RSO A;  3BG3 A;  2ID0 A;  1SYF A;  3N52 A;  5KYI A;  1SYB A;  1V1O A;  5TSS A;  5T1G A;  5IGF A;  1GXD C;  1PRT D;  3QJY A;  3CHB D;  2R93 B;  1Z47 A;  2B39 A;  3K57 A;  2F0H A;  1LTT D;  3TDQ A;  3RZO B;  2AWO A;  3SK6 A;  2K01 A;  2BE5 C;  2EYM A;  5G3L D;  2E2J B;  2OEO A;  4HN7 A;  4ZK9 B;  1LLR D;  1FYC A;  1C8C A;  1SJH D;  2QEJ C;  4KY5 A;  2F0F A;  4QUF A;  1HPC A;  3DEO A;  3IL8 A;  2NZ1 D;  1KAA A;  4KK7 A;  4P2C B;  3OIP A;  4BS9 A;  3DEP A;  4EQP A;  2PZT A;  3K59 A;  5C4H A;  2ZXP A;  1F2Z A;  1TKW B;  2TSS A;  3E5S A;  3ZYY X;  5C0X I;  2HCC A;  5COR A;  1OXX K;  1EIH A;  5CMD A;  1CT1 D;  4ZKC B;  2HUG A;  2MJ8 A;  1VDZ A;  2JYO A;  2EE1 A;  3A8K E;  3I8Z A;  4OHJ A;  5IT9 L;  2EYL A;  4KJO A;  4RHS A;  1RD9 D;  1MSG A;  2E74 C;  3X3M A;  4EGV A;  2K32 A;  1PDQ A;  1GJX A;  3HOY B;  2N55 A;  1FNU A;  1PFB A;  2OF1 A;  2X69 A;  4HAE A;  1MBY A;  1MI2 A;  1NCV A;  1S5E D;  5AFW A;  2JA6 B;  1A3V A;  4LJZ C;  2EYH A;  1JWM D;  5JJZ A;  4BWG B;  5LL6 X;  5KNC A;  1AEX A;  1I4R A;  1CFM A;  3K5M A;  5IGB A;  1Y8N B;  3KF8 A;  3GO5 A;  3NSW A;  3QB3 A;  2WKC A;  2XNA C;  3G6J B;  1PFM A;  2L1B A;  1SBB B;  3IAY A;  4HMI A;  1I3Q B;  1LTR D;  5FK9 C;  3T16 A;  4XYO A;  3VR2 A;  5K5P A;  5EBD A;  3H3V C;  2L5T A;  1HA5 A;  1E2V A;  1F9P A;  2RBM A;  4DNT B;  2KUM A;  5EKL A;  2H1E A;  1I4G A;  1Z7T A;  3NXW A;  3K58 A;  2XVS A;  3OPO A;  1OXU A;  1B53 A;  1S5F D;  1XWE A;  2BA0 A;  4KD4 A;  4RA8 A;  4DK1 A;  4A3F B;  1KLU D;  4FF1 A;  3QOJ A;  3NQI A;  1R4Q B;  4XTC S;  1HQR D;  1WTW A;  3TBI B;  5EBC A;  3A8I E;  1V1P A;  1TS4 A;  3PO3 B;  4FNF A;  4K5V A;  5FO9 B;  3J81 E;  4OO1 I;  2KVM A;  2NTT A;  2D2C C;  3FRP B;  1Z6H A;  4XQJ A;  1QG7 A;  3K5N A;  2JEA I;  5EKI A;  1BOS A;  5FLX L;  4J1M A;  2K6A A;  1CTM A;  2KCC A;  3M7G A;  2PCF B;  4ZLT F;  1KNE A;  1JIC A;  2IPK D;  1KNA A;  3OOC A;  1ZYR C;  4C1N K;  3TZD A;  2WB1 B;  3EFX D;  1S5C D;  3OHX C;  1SAP A;  2K33 A;  5C0X H;  5IOD A;  1B2T A;  1KDB A;  4M8A A;  5EPK A;  2C9O A;  3P1H A;  2B2T C;  1PLF A;  1WTQ A;  1OXT A;  1F9S A;  4KKT A;  3T56 B;  1TWC B;  3J80 E;  3JAM E;  4NMZ A;  2FMC A;  2QIL A;  1KDA A;  2F0K A;  1V1P B;  1GUS A;  1NSN S;  3W3A A;  4ID6 A;  5CV8 A;  4QIW B;  1GHJ A;  3HRZ C;  3TSS A;  2O5J C;  2E2D C;  2KJX A;  4ZRZ A;  2L4N A;  2WAC A;  3WOE A;  1ROD A;  1PMR A;  1ML0 D;  2QCP X;  3S2D B;  2NWG A;  4C3J B;  1JOO A;  4CJ0 B;  4RGN A;  1PZK D;  1U4M A;  3QG1 A;  2RVL A;  2R92 B;  1LT5 D;  4Z9C B;  2SNM A;  4A3K B;  3NWT A;  1GHK A;  4TRD A;  2F0T A;  1LTI D;  4K5W A;  2B8F A;  1QE6 A;  3AU7 A;  2F0U A;  5I6Y A;  3M4Y A;  5KYL A;  4J6H A;  3K5L A;  1TWA B;  3PV0 A;  3SE0 A;  4HSP A;  5LL6 S;  1LV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...