4HEDA

Zebrafish chemokine cxl1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
PGVCFKVLTTKEPKANIKRCYNLPKTNNCLKCVLFVDASNRMKCIDPNASWLAERLYRLKEKGVTCRGEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural insight into the evolution of a new chemokine family from zebrafish.
pubmed doi rcsb
source organism Danio rerio
molecule tags Signaling protein
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hedA00
4MN3A 2FFKB 1JE4A 3UI2A 3DEOA 2Q8RE 1DOLA 2RA4A 2B2YA 3Q6SA 1ML0D 1DOMA 1B3AA 1F9PA 1Q3LA 1EOTA 2L11A 4XT1B 4ZK9B 2RSNA 4IUUA 4OIKA 1DONA 1DZ1A 1J9OA 2K1BA 2MGSA 1ZXTA 1WTWA 5CORA 1QE6A 2FHTA 1WTRA 4LMQD 1B50A 1KNEA 2B2UA 1RHPA 2N88A 2NWGA 5DNFA 1HFNA 2EPBA 2B2YC 4XDXA 1PFMA 1RODA 1WD0A 1BF4A 1ESRA 2SDFA 4R9WA 2IL8A 2L1BA 4RAUC 5E4XA 5EPJA 1B4OA 1LV9A 2L9HA 2XIWA 3I91A 1O80A 1X32A 2MPMA 4QUFA 3IL8A 4ZKBB 2B2VC 3MWYW 2NYZD 1BBXC 1U4PA 2FMMA 3QO2A 1SSOA 5AFWA 3R93A 1HA6A 1QG7A 2KEDA 1GUWA 4XT3B 3KBXA 4IUQA 4CJ2C 5EQ0A 2R3ZA 5EJWA 2HCIA 4ZLTF 1KNAA 1VMCA 3I90A 3N52A 2HDLA 1SAPA 5EPKA 1G91A 1BO0A 4IUVA 1NR4A 2CVRA 1O7ZA 3KUPA 1O7YA 2KECA 4ZKCB 1SDFA 1IKLA 1CM9A 4MHEA 2B2VA 3F2UA 2Q8TA 1S4ZA 1JICA 1X3PA 3I8ZA 1EL0A 5CBEE 2KOLA 4X3SA 1WTVA 4RWSC 3MTSA 5CBAE 1ICWA 1HUMA 3FDTA 1PLFA 2N55A 3HP3A 1XX8A 4IURA 1EIGA 5E4WC 1E0BA 3D6WA 1C8CA 4CJ1B 3SVMA 1G2TA 1WD1A 3G7LA 1M8AA 2K04A 2MJ8A 4ZAIA 1G2SA 2K28A 3DEPA 2DY7A 1PFBA 1QNKA 1ILQA 1MI2A 2B2WC 4RA8A 3TZDA 1HFGA 5D65A 4NW2A 3TN2A 2X69A 2X6LA 4CJ0B 1AZPA 2D9UA 1F9QA 2EE1A 1XYIA 2RVLA 3DM1A 1NCVA 1WTPA 4X3TA 1BNZA 5EKIA 1PDQA 1WTXA 1MSHA 3H91A 2J7ZA 2VXWA 4X3KA 2K05A 5EPLA 5T1GA 1WTQA 4IUPA 2K01A 5CMDA 1NAPA 2B2TA 2MP1A 4X3UA 1AP0A 2B2WA 2JP1A 1HHVA 1F9SA 4DN4M 1WVLA 1EQTA 1U4MA 4QUCA 5T1IA 1U4RA 1WTOA 1HUNA 2FINB 2L4NA 1ILPA 1RTOA 1TVXA 2HCCA 2NZ1D 1A15A 3GV3A 5D14A 3IFDA 3ONAB 2DY8A 1CA6A 3P7JA 1RTNA 3LWEA 4IUTA 2B2TC 2EOTA 1CA5A 1F9RA 2KUMA 1U4LA 2RSOA 2K03A 1X3QA 5COYA 2H1EA 4HEDA 1IKMA 1MGSA 4HAEA 2M2LA 1B53A 3I3CA 1HRJA 4HSVA 1F2LA 1B2TA 4OIJA 2HDMA 3FPUB 1RJTA 2KVMA 1AZQA 1G6ZA 5JJZA 1DOKA 1VMPA 2HUGA 2L12A 4R8IA 2KEEA 4U68A 1NR2A 4HCSA 2BDNA 4O42A 2X6GA 1J8IA 1MSGA 1EIHA 1IL8A 2JYOA 4UAIA 2FJ2A 2B2UC 1PFNA 3GV6A
chains in the Genus database with same CATH superfamily
2FFKB 2WB1B 1LT6D 1GOZA 1E2WA 1PRTC 2N3SA 3DHQA 2UU9L 3VR2A 3GTQH 1B7YB 2F52A 1F9PA 3PGZA 5C4HA 4IUUA 3G48A 3AQQA 2JJQA 3DWAA 3SXHA 2O5JC 4KY6A 4A3KH 2Z1CA 3PIO3 1XTDA 3HOXB 1XJVA 1BF4A 4XDXA 3SK6A 4LF4Q 1R4QB 3I2ZA 3PIOA 4A3EH 5J3BA 4QUFA 1KABA 4XYOA 5C5LA 4GLXA 1BBXC 1JWUD 3SGIA 4DK6C 5D3DA 1W6KA 2DNCA 1NY4A 4PV1C 1CHQD 1I50B 3RMHA 1JJ2A 1PTOH 2F0HA 4A3LG 4QCLA 3JAME 1CM9A 4LF5Q 1VQ6A 2EYOA 2UUAQ 4BWGB 2NVQB 1SNPA 5ISRA 5CBEE 1ICWA 3HKZG 2D0OA 1N34L 3D8GA 3NP8A 5IT9E 3H0GB 4L5QA 1XNRL 1M8AA 4ZAIA 5CGKA 2KCMA 1Q82C 4X64Q 1A8VA 4JI7L 1JOQA 2D5DA 4ODGA 3TP8A 2PZTA 1A2TA 4X6AH 3GTLH 2R92H 4JI3L 2JA5G 1WJJA 2AUKA 4FXDA 3DM1A 4GOPC 1LTSD 4X3TA 2EDGA 2RF4A 3S1NH 1JQYD 2IHFA 5EPLA 4GNXA 1M4VA 2F0PA 2K01A 1Q8KA 3FKIG 2QEXA 1YNNC 1SYCA 3A8KE 4DNTB 1F9SA 4DN4M 4HIMA 5LMNL 4DV1L 3PO3H 3EQLC 2HIVA 2QCPX 2JA6G 1TWAH 1HUNA 4A3GG 4YWKA 4JI1Q 5D14A 2UXCL 1DCZA 4BY7H 4CDFC 1AH9A 4KY7A 2M00A 1KDAA 1X56A 3PUYA 3PUVA 4O0AA 4PMCA 2EXDA 3BG3A 1G6ZA 1WYDA 4O42A 4PG3A 2EYJA 3H6MA 4UAIA 2WKCA 2ZTEA 2F0GA 5C4XH 2ALYB 4UP7A 2CW0D 1STYA 1STEA 2PI2E 2B29A 1VQ4A 3K5OA 3Q6SA 3UE1A 2NN6H 4UPAA 3KJOA 4C3IH 3J7AF 4DR5Q 5FLXc 2J4XA 3UDXA 1K8AC 3K0YA 4DXGA 2QILA 3R2TA 4L5RC 4DR7Q 3D3RA 5FLMG 4NXNQ 2A69D 3CF5A 2PQAA 4IFDH 2CQOA 4QJFA 2K6AA 1LV9A 2XWBB 4YWLA 3BU2A 1SNQA 3I4MG 2B2VC 5BR8L 5I9OA 3PO2G 2SEBD 1A3TA 4CJ2C 3Q0AA 3JAMc 2YU9H 1M1KC 2HQLA 2KENA 4XYQA 4DV5L 4F8MA 4DR1L 3D6CA 1PH6A 2Q8TA 2XGTA 4A3KG 1CKOA 3X3MA 4LFAL 1Q12A 1YHBA 3RLFA 4A3EG 4R4OA 1C9OA 1S5BD 2H5XA 1JJGA 2R7ZH 1TU2B 5C6AA 2R7DA 1CUKA 1WD1A 5BN4A 3KF6B 4ZCKA 2DJFC 2EY6A 3PV0A 3PF4A 1ONLA 2NZOA 2RHQB 3NELA 3CMAA 1SNCA 3VDYA 3TZDA 3CCLA 5D65A 3H0GG 4LF7L 5C3EH 1F2ZA 4JI5Q 2AQ2B 1KDCA 1QCBD 3WOEA 4I7AA 5M5XH 1GUTA 3WOFA 2K05A 1J6QA 4RFBA 5JJLA 1FJGL 4NXMQ 4KHVA 1D5MC 4C1NI 1Z47A 1VQGA 4A76A 4DV3L 3H94A 4FF4A 3OWEB 1UE5A 2PMZE 3GTOB 3UE0A 4YCWA 1AW7A 4P74A 2UXDL 5GADC 5CV8A 3PCOB 1KLUD 3UDGA 2RKSA 3CW2C 2OTJA 2JA8H 2FXQA 4QIWE 2KBNA 1N9WA 3SK8A 2UUBQ 3KF6A 4A93H 2F0QA 4N8FA 3PQIA 3TP7A 3DEOA 4X62L 1XPOA 1I3QH 4A3IG 2Z6KA 2A8VA 1M90C 3PO3G 4A3DB 1SLJA 4HJAA 1IBLL 3A74A 1KDBA 1B3QA 1ZXTA 1HQRD 4BY7G 2M9VA 1SE3A 2N49A 3OIPA 2ASBA 2B2YC 2EJGC 1TWCH 2QDLA 4DUZQ 1KC8C 1U9RA 1QUQB 3TMEA 1O80A 1Z9FA 2SNSA 3NQIA 5IE8A 4JK1C 3OW2A 3TBIB 1QJOA 5ELCA 4K0KQ 4WORA 3UDFA 4GS3A 1QG7A 5C4XG 3L9AX 2IX3A 4UDUC 5EPKA 2F4VQ 1T5EA 1RCVD 3OMCA 2EXZA 1B1ZA 1WCMG 3EVQA 3PMFA 3J7AV 4GKJL 1PTOC 1NNXA 1O78A 3C1EA 3BZKA 2Y0SE 3CCRA 3OHXC 1FR3A 2CQAA 3FEWX 1YNJC 5EAYA 4X66L 5CBAE 4OO1H 5E7NA 4ZUIA 3AYHB 1STBA 5JVH3 2E2JH 1OO9B 3SK5A 2WIIB 3TQYA 4IFDG 3AFQA 2CH4W 1XPUA 5CV6A 1G2TA 1GVPA 3V96A 3FRPB 2VQEL 4KY5A 3T53B 1VQFA 5FO9B 4TKOB 2BE5C 2NZHA 1ILQA 2F4IA 5KYIA 2PCFB 1X55A 4OX9L 2B8GA 3MVVA 3J81c 1VDZA 4AYBE 3S16B 1X6OA 5I6WA 2OWOA 4YIJA 1XMOL 4C2MB 1Y14B 4DV6Q 1AP0A 2E5LL 3GTJH 2O2LD 3RZOH 1LLRD 2FINB 2R7ZG 3GV3A 1D2BA 1X3FA 1L1OA 2E2IH 3LWEA 1ENAA 1YJWA 3S1QB 2WAQG 5C3EG 3HOUB 1BVSA 4G57A 1E2ZA 1G8ZD 4RGNA 4Y52H 2KHIA 1MBYA 1EQQA 1AN8A 5EBCA 5FJ8H 1R9TH 3BJUA 1NUCA 3S17B 2G9HD 4ZK9B 4OIKA 2MO0A 4WRDA 5TSSA 3G6JB 4LJZC 1PMRA 5C0XI 4OHJA 3CCSA 1B50A 2HIXA 4HIKA 2Q2IA 3STBD 1JB3A 1SEBD 4XXEA 1VQ8A 5E4XA 2JA8G 4O2DA 1GHKA 1CKNB 3A5ZB 3S1MB 1HNXQ 4B3MQ 4A93G 3S24A 5AFWA 1CI3M 3GTGB 2B63H 4XT3B 1UAPA 3HGBA 2R3ZA 3HS0C 1KNAA 2PZWA 3T56B 1VQCA 1SN8A 1D8LA 2VQFQ 4LFBQ 2A6EC 2NVYB 1DD2A 1LABA 4P71A 1VQ5A 3FMCA 3I8ZA 4GZYC 2ZJPA 3MXUA 5LMNW 4JI8L 1PRTB 1IYJB 4OXPA 4BBRB 1BXTA 1FVIA 4CJ1B 4JBJA 4RKLA 4JI6Q 1LTID 4RA8A 2D62A 2JK8A 5GAHC 3BS1A 3RZDB 2J0TD 4S3SA 2F03A 1NCVA 4R8NA 5C0XJ 1CKNA 4X3KA 2VXWA 1FL0A 5M9OA 3HOYH 5LL6X 4EVOA 4H13C 4OO1G 1JMCA 1CQVA 4DV0Q 3RN2A 1HR0Q 1KAAA 5BN5A 3S15B 4C3JB 1K28A 2R93G 2IY5B 4DR4Q 2F3VA 2B2TC 2KCTA 2KUMA 2TMPA 5LMNQ 4DV1Q 4DA2A 1SJHD 4DR3Q 2UXCQ 2RDFA 4V190 5IGBA 1RJTA 3BVGA 4BY1H 1QVFA 4R8IA 2N78A 1MSGA 4JOIC 4BBSH 1CZWA 4JI2L 1SYDA 1JE4A 1Q1BA 1I94L 1N36L 3M9BA 1TY0A 4NDXA 4AH6A 4B3TQ 4LW1A 3JAMi 4XT1B 4GOPB 1EU3A 3RUZA 1ZYRD 3LNNA 3BDLA 1YEZA 4DUYQ 4LFCQ 1HCZA 3GP7A 3IFTA 4LAAA 3J7ZC 5M3FH 1G291 3W1GA 2PZUA 3OTOL 1SMXA 3NENA 3I91A 1X32A 1G6PA 2E75C 1Q86C 4A3FH 1I4PA 5CV5A 5FJ8G 3G6EA 1IBMQ 3GO5A 1LTBD 1VQOA 2OT2A 1YVCA 3OYYA 1D6EC 4CDDC 4JI0L 4F87A 1IW7C 2RCFA 4IFDJ 1S4ZA 3PUZA 3OMGA 5M5YH 3RN5A 3MAQA 1Y8OB 2PQEA 3PF5A 3NXWA 1C7YA 4IURA 2QA4A 5E4WC 4TRDA 3SR1A 1L0XB 1FNVA 3D6WA 4DV4L 3H3VI 5I2YA 4GOPA 4QB4A 2RDHA 1G2SA 4ZUJA 1SNDA 3CQZH 5ELBA 1XMQL 2B63G 4LF6L 4JI4Q 4LWCA 2X6LA 3J7A5 2I0QA 4J15A 2L0CA 3NTIA 3HKZB 4DNIA 1S5DD 4K5VA 3A56A 3KLSX 4CKEA 4YWMA 5EGTA 2SNMA 1A3VA 2E2HH 2WP8J 4B3SQ 1TT2A 2K5DA 1UE1A 4M1UB 1TVXA 2NZ1D 1A15A 5I2XA 2JA5B 3S2DH 1SMYD 1JOKA 3OOCA 4BXXG 4IUTA 4Y7NB 3S2HB 5IY0A 1F9RA 3N6RA 2NVXH 3S1RH 4GN4B 3FKIB 1TS4A 1IKMA 2Y0SG 4YCUA 1NJIC 2PPBC 4DV2L 3E5SA 4L5TA 2JA6B 5C4JB 4HN7A 3TZUA 4EQNA 3MC0B 5KRUA 2E8GA 3T1YQ 1YZ6A 3BVMA 3I73A 4JCVE 1EY8A 4CHTB 1VQKA 3T16A 1CSQA 4I65A 1N32L 1TQOA 1SBBB 2JA9A 4AYBG 1YI2A 2EPBA 4UP9A 2Q8IB 1SE8A 3RLOA 3U9OA 2ZM6Q 3HEJA 1B4OA 1HZ9A 4BY1G 3GD7A 4MIUA 4ZKBB 2I46A 2O5IC 3FVQA 4A3MG 5HGTA 3K80C 4KKUA 4PZ7A 2RQXA 2Z9HA 1IXRA 1H9MA 2CVRA 4ZKCB 5IP9H 1U0LA 4HJ7A 2WKDA 4B9XA 2KQ3A 1IZ6A 4FF1A 4JVZA 5FLXE 3I4MB 4X65L 1HUMA 3RLNA 1XNQQ 3PO2B 1HNWL 5JJKA 4GKJQ 5M3FG 2MFIA 3CCVA 4XTCS 3O13A 1STNA 3GTQB 2RHSB 1SYGA 2TSSA 4A3FG 3MXNB 3ZYYX 3J80L 2EYFA 3IKJA 3A54A 4A3KB 3K8AA 2X69A 1EQRA 1H9RA 2NVTH 4B08A 2C9OA 3T1HQ 1WTPA 4A3EB 1BUVT 1EY4A 1Q90A 2A19A 3P1HA 2WINB 4YHHL 4OX9Q 4JV5L 3WWVA 2IPKD 5C0XH 1U4MA 3BZDB 1NSNS 3E0JA 2HHHL 4A3CG 1PTOB 2D0PA 1C4QA 1CA5A 3I4NG 4LF8L 1E3PA 2Z8LA 3K57A 2H1EA 1MGSA 4YCVA 1KL9A 2Q2TA 3FPUB 3NSWA 4E6IA 1AZQA 1QNUA 1BCPC 1TKWB 2H4OA 2MO1A 2GVAA 1PFNA 3MXNA 2A68D 5IODA 3HG9A 2B2YA 1JC7A 4GKKL 5CV4A 3U58A 4KTAA 1C0AA 4B3RL 5F2DA 3NQTA 3E9HA 3CC4A 2UUCL 5GROA 3NTHA 1RHPA 2NWGA 3S1NB 1I4QA 4PZ6A 2F3IA 1RF2D 3M3YH 2SDFA 2KA7A 4A3IB 2XIWA 4QL5A 3PO3B 2MPMA 1TWAB 4DR6Q 3SDZA 2BA1A 5HY6A 2JA7H 4WFN3 2KJXA 4BY7B 3TSSA 3I56A 3TP5A 2L15A 1N33L 5LMUQ 2I07B 2PW5A 3C2PA 2JQOA 3K5MA 3GTKB 4AQYL 2E76C 1YJNA 1DJRD 5C4XB 1XX8A 1EIGA 1FGBD 1TIID 1S72A 1C8CA 1EWHA 3CD6A 4IPHA 1WCMB 2E74C 1E1TA 4KLKA 5K5PA 2K5WA 5C44H 1IYUA 4Z9CB 1V43A 4NB3A 2JEBI 3EA6A 4GLAC 1H95A 2EE1A 3VA5A 2IW3A 5IP9G 5A2QL 3DM3A 1PDQA 1FNWA 5M5WH 4DK3C 1PYBA 3I4LA 3W2DA 5CMDA 2CKZB 1PH5A 4QQBX 3VR3A 5T1IA 4U673 1ENFA 5FO8B 2UXBL 1ENCA 3J7YW 2YTVA 1SFOH 3QB3A 5AJ3L 1D5XC 4HR7B 3ND9A 5M3MH 1CSPA 1WI5A 1GUOA 3L2PA 1KHIA 1EFWA 2EZVA 1EY7A 4Q5VA 4KMUC 1HH2P 1HRJA 4JBMA 1Q46A 5FOBB 1A3UA 3J81E 2XVSA 4DU9A 2EQSA 3NK9A 5ELEA 2R7ZB 1LACA 1K9MC 1IL8A 1VQAA 1VF7A 2MQHA 1SE2A 5IP7H 3I7FA 1V9PA 5C0XG 4FO2A 4FF2A 4CDEC 5ELFA 4R1JA 2WAQB 5C3EB 2K5QA 5CV9A 3W5OA 4DV7L 1I94Q 3P75A 1N36Q 2B2UA 4K6LA 5A35A 5M5XB 1I4RA 3K5NA 3H3VH 2NUCA 4IALA 2R92G 1NMFA 4OELB 3AMUA 4YY3Q 4K5WA 4KKSA 3HOVH 2L9HA 3K7AH 3CKIB 2YYZA 5C4ZA 2WFWA 4C3HH 1DXMA 4JPBW 4K8IA 1HNZL 1HA6A 2KEDA 3DWPA 2HCIA 3OTOQ 4WJ3M 4DXFA 2AQ3B 3EROA 2HD3A 2JA8B 1IBKQ 2FMCA 3EBEA 3FHWA 1LYLA 2ZT9C 2MNAA 4G4KA 3EIVA 3ULJA 2KOLA 1GKHA 4A93B 1UE7A 1CK1A 1VQBA 1I3QB 5ELOA 2ICIA 4JG2A 3G7LA 3CCMA 1XWEA 2K28A 2VNUD 2NBFA 3HOZH 3X3NA 3GQBA 4GNXC 2JA7G 1MI2A 3SHLA 1K0SA 4NW2A 2NN6G 2A6HC 1X3EA 4C3IG 1TWCB 1XYIA 3D4DA 3I72A 4WJWA 1I6HH 1HZCA 5EKIA 1PH3A 1Q7YC 4GN5A 2JEAI 3M4PA 1W3SA 2F0JA 2F0EA 2B2TA 4X3UA 2B2WA 2JP1A 2PNRC 1W6JA 2CFMA 1HHVA 1VQIA 5FKAC 2EIFA 3RNUA 4F7XA 4KKTA 1EOVA 5KEEA 3MFYA 4JYAQ 4LF4L 2DY8A 4OWWB 3MHBA 3FP9A 4B9WA 3MEHA 5C44G 1PH8A 3A55A 3NPPA 1VF5C 4DK0A 3S14H 1K8MA 4J1MA 1QUQA 4KHZA 1CT1D 3MXPA 1K73C 2E2JB 1PRTF 2KEEA 4P72A 1NR2A 2R93B 2XNAC 2DNEA 3KLWA 4RH6A 1PRTD 3KK7A 5ELDA 2XRQD 1EZ6A 5JPNC 4LF5L 1J5EQ 5KYLA 1SJED 2F0IA 1X3GA 5I9PA 2BH2A 1J9OA 2K1BA 3TDQA 4LF9L 2MGSA 3VYTA 1CFMA 1WTRA 2PI2A 1STGA 1GUSA 5M3MG 3BZCA 2F0VA 5I6YA 3S1QH 1Y1WH 1PFMA 1E7ZA 5JAVA 1WD0A 1ASYA 3HOUH 2IL8A 4QMGA 1LTTD 2F0TA 3GTJB 1BQQT 5DM73 1BR9A 3FPPA 2YV5A 2ZXOA 2NYZD 1YJ9A 4A75A 5EQ0A 3TS0A 5EJWA 1Q81C 5H1SE 3OWFA 1VS0A 4A4IA 1G91A 2Z4HA 3KUPA 4DKAC 3AFPA 1QVGA 2UU9Q 4KJOA 2BDOA 3TRZA 2QDBA 4R4CA 4JI1L 4DF7A 3J80c 2DJGC 3CCEA 1RDPD 2N55A 2PMZB 1SYFA 3T51B 4KJNA 1R9TB 4N9PA 1H9JA 1EZ8A 3HOVG 1JORA 5IYBH 4FF3A 4X65Q 1O7LA 2Z4IA 4C3HG 4IN3A 4TQUS 1QILA 1PFBA 1V1QA 1QNKA 4L6TB 4K6DA 3NTKA 5IWAL 4QIWB 4CJ0B 2C5CA 4J8QA 1V1OA 1F9QA 1LM0A 1PH4A 2KCCA 4XQJA 2NVYH 1BNZA 3DWQA 1I4GA 3H91A 1K83H 3SE0A 1LTLA 1YNND 5JEAJ 3HKZE 3SK4A 2B63B 2JXMB 1WVLA 4KHPL 1YBYA 1EY5A 2XRSD 3F8TA 2BA0A 1EQVA 4OONA 1ILPA 1LT4D 2HCCA 2VB3X 4DR7L 4RHRA 1CA6A 4NXNL 4EQPA 3HOZG 1KLGD 1N34Q 1VQNA 1PYWD 2K03A 1XNRQ 1X3QA 2DN8A 1NTGA 3I3CA 4JI7Q 2AKWB 3IRBA 1GXDC 4CKCA 2WV6D 3T4AC 3M4OH 4LF8Q 4JI3Q 1TWGH 3NE5B 2F1MA 2JE6I 4UP8A 2R6GA 2CW0C 3F2DA 4C3JH 1D1IA 1B3AA 1X54A 2Y0SB 1T5XD 4PMWA 1TWFH 3GTPH 2B8FA 1KNEA 4Q0FA 1L0WA 5IYDH 1SYBA 4NKLA 4B3RQ 2RDGA 3S9WA 3H3VC 3HOYB 1O7IA 4R4TA 4RAUC 3L7ZC 2A69C 2KHJA 1G51A 4XIGS 1PVOA 1EEID 2C35B 3L0OA 1PH7A 4OL7A 2F0SA 1EFID 1JT8A 4JI5L 2HQEA 1X9NA 1ZKOA 1Q1EA 1Z6HA 3BDCA 4ZLTF 1VQ9A 3GTMH 4AYBB 5IT9L 4DAPA 2WB1E 1NR4A 3EFXD 2KECA 4GLVB 4NXML 2K5NA 1FNUA 1BCPB 3F2UA 1RKNA 2JN4A 4BY1B 4UHVA 1A0IA 4CGYB 1JCKB 3W1BA 1B8AA 3MTSA 1TS5A 1ET9A 4A3MB 1Y1WG 4BBSB 1AFPA 1PH9A 3V2TA 4IPDA 3U4VA 3SVMA 1GD7A 4QF4A 3CP0A 3CHBD 1HFGA 5I4DA 1EYAA 4HTHA 3KFUA 2UUBL 5BR8Q 2VB2X 2I5LX 5M3FB 1L1OC 2J7ZA 4O1NA 4LK1C 1CHPD 1UEAB 3IAYA 2VUMH 1NAPA 5DLQE 2K5VA 2LFNA 4CDCC 4DV5Q 4HJ5A 4A3FB 4H7BA 4DR1Q 2NTTA 1KTKA 3K6OA 1Y1VH 5DEHA 1PV4A 1U4RA 2ICEC 4FVMA 2L4NA 2GVBA 2IWHA 4L8JA 4RGOS 4LFAQ 5HGQA 5IYBG 1F2MA 1HTLD 1AE2A 1MHWC 4AIMA 4DUZL 5C5MA 1PA6A 2XSCA 2UXBQ 2D2CC 5M5YB 4A3BH 1NBWA 4IQZA 1B53A 4K0KL 1JR0D 1E2VA 1EY9A 1W2BA 4LF7Q 3NHHA 2JYOA 2F4VL 5IGEA 1R4PB 4A3JH 3GV6A 4FNFA 4MN3A 3KDFB 2Z0SA 1PZKD 2WACA 3CQZB 2VZAA 1D1KA 2QW7A 3I4NB 1PH2A 1X65A 4LNQA 1FJGQ 2RSNA 3VR6A 1EIYB 1DZ1A 3S2HH 2BCOA 3NWSA 1QOHA 2FHTA 5CORA 4DV3Q 3PUWA 4HMJA 1RODA 1UE6A 1II3A 1GHJA 4K2LA 2QKIC 3PSIA 3QOLA 4G7HC 2UXDQ 2E2HB 2G9DA 4DV7Q 4DFAA 2JA6H 4A3GH 2NB0A 1XXGA 3QWNA 3HOYG 2FMMA 3S2DB 1S5ED 3MZ5A 3KLRA 1EWIA 2B3GA 1I6VC 1VQPA 2NVXB 1PTOF 3N52A 1K8OA 3S1RB 4DV6L 4N9TA 1BO0A 1O7ZA 1PTOD 4X62Q 1EYCA 4PMBA 3K7UC 3HRZC 2B2VA 4ME3A 4NMZA 1UNSA 5IYDG 1GM5A 1YNJD 5IGGA 1VCIA 1IBLQ 3URYA 2ZXRA 1WTVA 1MJCA 3KDFA 4ILWA 1BDOA 2R61A 4RG1A 3A7AB 1TWHB 1HQMC 3HOWH 4BBSG 3R2IA 1Z7TA 1VQMA 1OXTA 2F0DA 4IUNA 4KN4C 2YTXA 5JVG3 3J81i 5FLMH 4FYDA 2F0OA 2XWJB 1VQEA 1WTHA 2EVBA 5CV7A 5KNBA 3HOXH 4HMIA 1D5ZC 4IUPA 3DMUA 1B70B 3CRKC 2MP1A 1QVCA 3KOJA 2K7VA 3AB9A 4QUCA 2LSSA 2MHVA 3VA7A 5FK9C 5JEAH 2ZJQA 2EY1A 4GN3B 2IX1A 4X66Q 3ONAB 1OXVA 1LUZA 3U50C 1K3RA 3LX0A 4POFA 1WFQA 3M4YA 5GQOA 3TREA 3F2BA 1A2UA 4H02A 1I50H 1HNXL 4B3ML 1ICFB 4HAEA 1TR5A 2VQEQ 4HSVA 5IGDA 4ID6A 2NVQH 3PUXA 1EIHA 1GUGA 2EY2A 3Q22A 1J8IA 2VUMG 2ENBA 3QO2A 4GNXB 4P75A 4DNRB 2VQFL 4LFBL 1DOLA 3CCUA 1XMOQ 2LY7A 1Y1VG 3H0GH 3NWTA 2GN5A 4WJ4A 2NVTB 1UUPA 1WTWA 1QE6A 1QB5D 2LS01 2G5DA 1Y69U 4ULLA 2E5LQ 3F2CA 2WAQE 4L63B 4QY7A 3G4SA 3HZXA 4DPGA 3J80i 4A3BG 3STBC 2JSOA 4LF9Q 4JI6L 4KI0A 1BBUA 5EPJA 3ER0A 5BN3A 2A5HA 3ULPA 3H15A 2KCNA 5J22A 3ERSX 2ZTDA 4A3JG 1YNXA 1DM0B 1L2FA 4DAVA 2F0FA 4QGUA 2OTLA 1SAPA 3GTLB 2R92B 2A6ED 2K14A 1SDFA 3KF8B 4IO9A 3BYTB 1TY2A 4DV0L 1HR0L 4H0LC 2LXKA 3CPFA 1EL0A 4K8JA 2F0UA 4DR4L 3FDTA 4PZ8A 1OXSC 5K36H 4A3IH 3VYSA 2PQAB 2RBMA 2DGYA 1ASZA 4DR3L 1ZEQX 3A5UA 5KNCA 1XPRA 3G71A 3D4WA 4APVA 2EY5A 3GDEA 2RVLA 3CCJA 4JBKA 3J81j 3M3YB 1WTXA 1MSHA 1JJCB 3E9IA 1Q8IA 1WTQA 3TS2A 5JJIA 1S5FD 5IWAQ 2DUDA 3GTKH 4B3TL 1H9KA 1F2YA 2JA7B 1SE4A 4K2KA 4HJ9A 4JC0A 1RTOA 2HT1A 3HOWG 4DUYL 4LFCL 3SEBA 4C3IB 4JI8Q 3KF8A 1WCMH 3P7JA 4HJ8A 2WB1G 4KHPQ 5ELNA 3ND8A 3JC66 4ME5A 1P8LA 4HEDA 1TS3A 4MTKA 2KHSA 3LGJA 4G7OC 4CKBA 2K4KA 1CZGA 4PQXA 1IBML 1KXLA 4KK7A 3HOXG 2CHBD 2FJ2A 3QJYA 1SRUA 3OSOA 4DR2L 3D4RA 4EQOA 1B9MA 2PNHA 5C44B 1HZAA 2PO4A 1SNMA 5JEAG 2YU9B 2K5HA 3HKSA 1OXXK 1EWCA 1HJPA 1V1PB 2A74C 2CWPA 4ZRZA 3ULLA 3VYUA 4RHSA 1EEFD 1ZYRC 1STAA 3B6YA 5M5WB 1RD9D 3E0EA 2F0LA 3A7LA 2A73B 5IT9c 4JI4L 3ITPA 3MXGA 3CU7A 1EY6A 1CKMA 1XTCD 1SSOA 1SFOB 3CAMA 4RKBA 4FP5D 1VQLA 3M85A 2OQKA 3I90A 5M3MB 3GTOH 4JI2Q 4C1NK 1IW7D 4IPCA 1O7YA 4P73A 3TEHB 5LHY1 4B3SL 1JICA 2LKVA 2ATWA 3RR5A 4X3SA 1PZJD 1NMGA 4XQQA 4R4QA 1LTRD 3D31A 5JPMC 4MZ9A 3Q24A 1HZBA 1KRSA 4ZQ3A 2CWAA 1V1PA 2K04A 3QOJA 4KN7C 4UY8C 3OIQA 2A1AA 3UDIA 4A3DH 1IL2A 3TN2A 1QZHA 3HFZB 1MKHA 5DAUA 1FGUA 5IGFA 3T1YL 3HOVB 3A8IE 3K7AB 4IOCA 2BH8A 4C56C 3E6ZX 4C3HB 3KJPA 1S5CD 4JI0Q 3DXJC 3J80E 3ZJYC 1T9HA 1EQTA 5K36G 4MNOA 2SOBA 3K81C 3M7NA 1HXYD 5J1ZA 4OGQC 3C3LA 1RTNA 1SMYC 4V0BA 1JOOA 2ZM6L 4MTNA 4RCNA 4DV4Q 2RSOA 1KAWA 4LUOA 1B9NA 2EYMA 1VQHA 2V4DA 4HCEA 1PYSB 1HPCA 1NE3A 2E2DC 1LO5D 1OXUA 1JWSD 5JOBA 1BOSA 2EYLA 2GA4B 1XMQQ 1SR3A 4LF6Q 1WOCA 2F0NA 4P2CB 2BDNA 4BA1I 2X6GA 2ES2A 4IPGA 1MJEA 3UI2A 4G7ZC 3HOZB 1ESFA 2MUYA 2F3WA 1ML0D 1Q3LA 2ZXPA 1MD2D 1XNQL 3AU7A 2K33A 1I6HB 1L1OB 2IX0A 4JOIA 4IJLA 2Q2HA 5EBDA 2B39A 3R3OA 3QR8A 4ZYSA 4M8AA 4PNYA 3Q8DA 1YITA 1E24A 2AUJD 1TS2A 3S16H 2L1BA 1VQDA 5KNDA 4C2MH 2K52A 2K75A 2R93H 1Y8NB 3IL8A 3MA2B 1U4PA 4FXKC 3T1HL 3CXCA 3KBXA 1KIXA 4HIDA 4DV2Q 3RD4A 2UUAL 3MEFA 3U9SA 5C3XA 2HDLA 5D3IB 1SXTA 1KQSA 4IUVA 3S14B 3T13A 2PW7A 2EYPA 2LMCB 5IIFA 4BS9A 3NUCA 3EJIA 2O4XA 5CR3A 2QEJC 2BOSA 4RWSC 4X64L 1V8QA 1N32Q 1P16A 3CRLC 1PHJA 1E0BA 3CMEA 2AWNA 3RZOB 4RCOA 4R4IA 1YIJA 2MJ8A 5IP7G 2L55A 4EGVA 4POGA 2E2IB 2DY7A 3TP6A 3S17H 2RCNA 1LTGD 1Y1WB 1TXYA 1BBWA 5IYCH 3CPWA 4HIOA 3VYRA 4LUVA 5GAEC 4LUZA 2F0KA 2EJMA 3S1MH 1SNOA 3H09A 2OXPA 3K0XA 1I4HA 5E3FA 4TVAB 3GTGH 1HNWQ 5A2QE 2F0WA 4KD4A 3I4OA 1IYVA 4A3DG 1BCPF 2EJFC 4DR6L 4ALPA 2Z6BA 1S3OA 3OPOA 1BCPD 2KVMA 5IOCA 5JJZA 1A6XA 4HCSA 2B2UC 3KYHC 2IT1A 3U4ZA 2K50A 4NPSA 3BVZA 3DLLA 4DR5L 2Q8RE 4BBRH 1CTMA 5LMUL 3V05A 2A68C 3KBGA 1DOMA 1F77A 4YHHQ 1HR0W 1DONA 4FXGC 4K14A 4JV5Q 3BDOA 3VR5A 1LT3D 2CH4A 4LMQD 1JB7A 3R8BA 5DNFA 3OW7A 1K83B 2HHHQ 3RZDH 2Z6KC 4IZ8A 1ESRA 4R9WA 3A0JA 4KV6A 4RGTA 3K59A 5FLXL 1LTAD 1AE3A 2NTSA 1STHA 5IGCA 4OWXB 4BXXH 3R93A 4DK1A 1VQ7A 1IHZA 3S15H 3WDNA 3NEMA 4L5SA 3I55A 4EX5A 2I5HA 3CC7A 2VS1A 2QGQA 1SROA 5HURA 1YHQA 1EYDA 1VQJA 1Y8PB 3AEVA 5CC4A 3M7GA 1GO3E 1X3PA 2NN6I 4N8X1 4F88A 5J39A 1PXUA 4GKKQ 3M4OB 1TWGB 2ID0A 1PLFA 3ICEA 3JAML 3HP3A 2UUCQ 3K58A 3NBHB 1EIFA 2N8NA 1KD1C 1B44D 1PFSA 1DGSA 3D0FA 2PYKA 4NP5A 1EYGA 3DEPA 4IFDI 3P20A 2K32A 1TWFB 5LL6S 3GTPB 2B2WC 4KD3A 4EQ5A 2Q2UA 2AMCB 1AZPA 2D9UA 5C3WA 1N8RC 1D7QA 2XN9C 1JWMD 1PH1A 2OEOA 3VR4A 2VW9A 5T1GA 3CCQA 4J6HA 2AQ1B 4IOAA 3HOUG 4DAYB 4A3MH 1N33Q 1U5KA 1GUNA 1EU4A 1L0YB 1WTOA 3L3OC 2IJ0A 1BKBA 4DAMA 4AQYQ 3GTMB 5EKKA 3IFDA 1HTPA 1YHAA 4YY3L 1C48A 1U4LA 4RMFA 1K3BC 1I5FA 5COYA 2M2LA 4XQNA 1F2LA 1B2TA 5E1FA 3NBHA 1VMPA 3F1ZA 4U68A 5IYCG 1GJXA 1SYEA 1OTCA 2RA4A 1IBKL 3W3AA 2L11A 1EOTA 4A3LH 2QF7A 3M4QA 1FD7D 1H9SB 4OWTB 5GAGC 4DR2Q 2ZTCA 1I4XA 2N88A 4DAYA 1HFNA 2ZJRA 2VUMB 4FDBA 1E1OA 1A63A 2L5TA 1EUJA 1KRTA 5AJ3Q 2P5ZX 1Y1VB 4DGZA 4A3CH 3QG1A 3MWYW 4H44C 3DUZA 1E22A 2EYHA 4HSPA 1GUWA 4IUQA 4JW0A 4BBRG 3I4NH 1VMCA 1QWYA 5KIXA 5DM63 4RGMA 3E3XA 2JA5H 4A3BB 4Y7NH 2OF1A 1IKLA 4MHEA 1K0RA 2VY3A 1HA5A 3FKIH 3KLSA 1RL2A 4JYAL 4A3JB 2OQ0A 4ABNA 1S40A 5L37A 2YTYA 3QIAA 5C4JH 1LT5D 1UEBA 1H9SA 5FO7B 1DYQA 2V1CC 4TSSA 4I7ZC 4JBWA 1PZID 4OEMB 4C3JG 2A6HD 4BA2I 3Q23A 3K5LA 1A62A 1HNZQ 3NBIA 1JE5A 1FYCA 3A8JE 2CCZA 1J5EL 4A3GB 2VL6A 3C46A 1K8GA 1EY0A 1UWVA 3ERQA 1AEXA 3EN2A 3J81L 1TWHH 5KGUA 3I70A 2LXJA 5CYUA 2BE5D 4CBVA 2I5MX 3LWUA 4OO1I 2EOTA 3CC2A 3BYYB 2IHEA 2R7FA 1QZGA 2AHOB 3C1FA 2AWOA 4K5XA 3PIP3 4IJHA 1CQFA 5G3LF 4OIJA 2HDMA 5NUCA 2OCEA 1ET6A 3PIPA 1DOKA 2HUGA 1RIPA 2L12A 5G3LD 2XTIA 3MFGA 3I4MH 1MIUA 3HOWB 3PO2H 2F0MA 5EKLA
chains in the Genus database with same CATH topology
2FFKB 2WB1B 1LT6D 1GOZA 1E2WA 1PRTC 3DHQA 3VR2A 1F9PA 5C4HA 4IUUA 3DWAA 3SXHA 2O5JC 4KY6A 2Z1CA 3PIO3 3HOXB 1BF4A 4XDXA 3SK6A 1R4QB 4QUFA 1KABA 4XYOA 5C5LA 1BBXC 1JWUD 5D3DA 1W6KA 2DNCA 4PV1C 1CHQD 1I50B 3RMHA 1PTOH 2F0HA 4QCLA 3JAME 1CM9A 2EYOA 4BWGB 2NVQB 1SNPA 5ISRA 5CBEE 1ICWA 3D8GA 3NP8A 5IT9E 3H0GB 1M8AA 4ZAIA 5CGKA 1JOQA 2D5DA 4ODGA 3TP8A 2PZTA 1A2TA 2AUKA 4FXDA 3DM1A 1LTSD 4X3TA 2EDGA 1JQYD 5EPLA 1M4VA 2F0PA 2K01A 1YNNC 1SYCA 3A8KE 4DNTB 1F9SA 4DN4M 3EQLC 2QCPX 1HUNA 5D14A 1DCZA 4KY7A 2M00A 1KDAA 3PUYA 3PUVA 4PMCA 3BG3A 1G6ZA 4O42A 2EYJA 3H6MA 4UAIA 2WKCA 2F0GA 2CW0D 1STYA 1STEA 3K5OA 3Q6SA 2NN6H 3J7AF 2J4XA 3K0YA 4DXGA 2QILA 3R2TA 3D3RA 2A69D 4IFDH 2K6AA 1LV9A 2XWBB 1SNQA 2B2VC 5I9OA 2SEBD 1A3TA 4CJ2C 3Q0AA 4XYQA 4F8MA 3D6CA 2Q8TA 3X3MA 1Q12A 3RLFA 1S5BD 1TU2B 5C6AA 1WD1A 5BN4A 2EY6A 3PV0A 1ONLA 1SNCA 3TZDA 5D65A 1F2ZA 2AQ2B 1KDCA 1QCBD 3WOEA 1GUTA 3WOFA 2K05A 4RFBA 4KHVA 1D5MC 4C1NI 1Z47A 3H94A 4FF4A 3OWEB 3GTOB 1AW7A 5CV8A 1KLUD 2RKSA 3SK8A 2F0QA 3TP7A 3DEOA 4A3DB 1KDBA 1ZXTA 1HQRD 2M9VA 1SE3A 3OIPA 2B2YC 2EJGC 1U9RA 3TMEA 1O80A 2SNSA 3NQIA 4JK1C 3TBIB 1QJOA 5ELCA 4WORA 1QG7A 3L9AX 2IX3A 4UDUC 5EPKA 1T5EA 1RCVD 3OMCA 2EXZA 1B1ZA 3EVQA 3PMFA 3J7AV 1PTOC 1O78A 3C1EA 3OHXC 1FR3A 2CQAA 3FEWX 1YNJC 5CBAE 4OO1H 4ZUIA 1STBA 5JVH3 1OO9B 3SK5A 2WIIB 4IFDG 5CV6A 1G2TA 3V96A 3FRPB 4KY5A 3T53B 5FO9B 4TKOB 2BE5C 1ILQA 2F4IA 5KYIA 2PCFB 2B8GA 3MVVA 1VDZA 3S16B 5I6WA 4YIJA 4C2MB 1AP0A 2O2LD 1LLRD 2FINB 3GV3A 1D2BA 3LWEA 1ENAA 3S1QB 3HOUB 4G57A 1E2ZA 1G8ZD 4RGNA 1MBYA 1AN8A 5EBCA 1NUCA 3S17B 2G9HD 4ZK9B 4OIKA 4WRDA 5TSSA 3G6JB 4LJZC 1PMRA 5C0XI 4OHJA 1B50A 1JB3A 1SEBD 4XXEA 5E4XA 1GHKA 3S1MB 5AFWA 1CI3M 3GTGB 4XT3B 1UAPA 3HGBA 2R3ZA 3HS0C 1KNAA 2PZWA 3T56B 2A6EC 2NVYB 1DD2A 1LABA 3FMCA 3I8ZA 4GZYC 3MXUA 1PRTB 4BBRB 1BXTA 4CJ1B 4RKLA 1LTID 4RA8A 2D62A 3BS1A 3RZDB 2J0TD 4S3SA 2F03A 1NCVA 4R8NA 5C0XJ 4X3KA 2VXWA 5M9OA 5LL6X 4EVOA 4H13C 4OO1G 1CQVA 1KAAA 5BN5A 3S15B 4C3JB 2F3VA 2B2TC 2KUMA 2TMPA 4DA2A 1SJHD 2RDFA 4V190 5IGBA 1RJTA 3BVGA 4R8IA 1MSGA 1CZWA 1SYDA 1JE4A 1Q1BA 1TY0A 4NDXA 4XT1B 1EU3A 3RUZA 1ZYRD 3LNNA 3BDLA 1HCZA 3GP7A 3IFTA 4LAAA 1G291 2PZUA 3I91A 1X32A 2E75C 1I4PA 5CV5A 3GO5A 1LTBD 2OT2A 1D6EC 4F87A 1IW7C 4IFDJ 1S4ZA 3PUZA 3OMGA 3MAQA 1Y8OB 2PQEA 3NXWA 4IURA 5E4WC 4TRDA 3SR1A 1FNVA 1L0XB 3D6WA 5I2YA 4QB4A 2RDHA 1G2SA 4ZUJA 1SNDA 5ELBA 2X6LA 2L0CA 3NTIA 3HKZB 1S5DD 4K5VA 3A56A 3KLSX 4CKEA 5EGTA 2SNMA 1A3VA 2WP8J 1TT2A 2K5DA 4M1UB 1TVXA 2NZ1D 1A15A 5I2XA 2JA5B 1SMYD 1JOKA 3OOCA 4IUTA 4Y7NB 3S2HB 1F9RA 3N6RA 3FKIB 1TS4A 1IKMA 2PPBC 3E5SA 2JA6B 5C4JB 4HN7A 3TZUA 4EQNA 3MC0B 5KRUA 3BVMA 3I73A 1EY8A 4CHTB 3T16A 4I65A 1TQOA 1SBBB 2EPBA 2Q8IB 3U9OA 3HEJA 1B4OA 3GD7A 4MIUA 4ZKBB 2I46A 2O5IC 3FVQA 5HGTA 4KKUA 2RQXA 1H9MA 2CVRA 4ZKCB 2WKDA 4B9XA 2KQ3A 4FF1A 5FLXE 3I4MB 1HUMA 3PO2B 4XTCS 3O13A 1STNA 3GTQB 1SYGA 2TSSA 3ZYYX 3J80L 2EYFA 3IKJA 3A54A 4A3KB 2X69A 1H9RA 4B08A 2C9OA 1WTPA 4A3EB 1BUVT 1EY4A 1Q90A 3P1HA 2WINB 2IPKD 5C0XH 1U4MA 3BZDB 1NSNS 3E0JA 1PTOB 1C4QA 1CA5A 2Z8LA 3K57A 2H1EA 1MGSA 3FPUB 3NSWA 4E6IA 1AZQA 1QNUA 1BCPC 1TKWB 2H4OA 1PFNA 3MXNA 2A68D 5IODA 3HG9A 2B2YA 1JC7A 5CV4A 4KTAA 5F2DA 3NQTA 3NTHA 1RHPA 2NWGA 3S1NB 1I4QA 1RF2D 2SDFA 2KA7A 4A3IB 2XIWA 3PO3B 2MPMA 1TWAB 3SDZA 2BA1A 4WFN3 2KJXA 4BY7B 3TSSA 3TP5A 2I07B 2PW5A 3C2PA 3K5MA 3GTKB 2E76C 1DJRD 5C4XB 1XX8A 1EIGA 1FGBD 1TIID 1C8CA 1EWHA 1WCMB 2E74C 5K5PA 2K5WA 1IYUA 4Z9CB 1V43A 2JEBI 3EA6A 2EE1A 3VA5A 2IW3A 5A2QL 1PDQA 1FNWA 3I4LA 5CMDA 3W2DA 3VR3A 5T1IA 4U673 1ENFA 5FO8B 1ENCA 3J7YW 3QB3A 1D5XC 4HR7B 3ND9A 1GUOA 2EZVA 1EY7A 4Q5VA 4KMUC 1HRJA 5FOBB 1A3UA 3J81E 2XVSA 4DU9A 3NK9A 5ELEA 2R7ZB 1LACA 1IL8A 1VF7A 1SE2A 5C0XG 4FO2A 4FF2A 5ELFA 2WAQB 5C3EB 2K5QA 5CV9A 3P75A 2B2UA 4K6LA 5A35A 5M5XB 1I4RA 3K5NA 2NUCA 4IALA 3AMUA 4K5WA 4KKSA 2L9HA 3CKIB 2YYZA 5C4ZA 1DXMA 4K8IA 1HA6A 2KEDA 3DWPA 2HCIA 4DXFA 2AQ3B 3EROA 2JA8B 2FMCA 2ZT9C 4G4KA 2KOLA 4A93B 1CK1A 1I3QB 2ICIA 3G7LA 1XWEA 2K28A 2VNUD 2NBFA 3X3NA 3GQBA 1MI2A 3SHLA 4NW2A 2NN6G 2A6HC 4C3IG 1TWCB 1XYIA 3D4DA 3I72A 4WJWA 5EKIA 2JEAI 2F0JA 2F0EA 2B2TA 4X3UA 2B2WA 2JP1A 2PNRC 1W6JA 1HHVA 5FKAC 4F7XA 4KKTA 5KEEA 3MFYA 2DY8A 3MHBA 4B9WA 3MEHA 3A55A 4DK0A 1VF5C 3NPPA 1K8MA 4J1MA 4KHZA 1CT1D 3MXPA 2E2JB 1PRTF 2KEEA 1NR2A 2R93B 2XNAC 2DNEA 4RH6A 1PRTD 3KK7A 5ELDA 2XRQD 1EZ6A 5JPNC 5KYLA 1SJED 2F0IA 5I9PA 1J9OA 2K1BA 3TDQA 2MGSA 3VYTA 1CFMA 1WTRA 1STGA 1GUSA 2F0VA 5I6YA 1PFMA 5JAVA 1WD0A 2IL8A 4QMGA 1LTTD 2F0TA 3GTJB 1BQQT 5DM73 1BR9A 3FPPA 2ZXOA 2NYZD 5EQ0A 5EJWA 3OWFA 1G91A 2Z4HA 3KUPA 4KJOA 2BDOA 2QDBA 4DF7A 1RDPD 2N55A 2PMZB 1SYFA 3T51B 4KJNA 1R9TB 4N9PA 1H9JA 1EZ8A 1JORA 4FF3A 1O7LA 2Z4IA 4C3HG 4IN3A 4TQUS 1QILA 1PFBA 4L6TB 1QNKA 4K6DA 3NTKA 4QIWB 4CJ0B 2C5CA 4J8QA 1V1OA 1F9QA 2KCCA 4XQJA 1BNZA 3DWQA 1I4GA 3H91A 3SE0A 1YNND 5JEAJ 3SK4A 2B63B 2JXMB 1WVLA 1EY5A 2XRSD 2BA0A 1EQVA 1ILPA 1LT4D 2HCCA 2VB3X 4RHRA 1CA6A 4EQPA 1KLGD 1PYWD 2K03A 1X3QA 2DN8A 3I3CA 1GXDC 4CKCA 2WV6D 3T4AC 3NE5B 2F1MA 2JE6I 2R6GA 2CW0C 1D1IA 1B3AA 2Y0SB 1T5XD 4PMWA 2B8FA 1KNEA 4Q0FA 1SYBA 4NKLA 2RDGA 3S9WA 3H3VC 3HOYB 4RAUC 3L7ZC 2A69C 4XIGS 1EEID 4OL7A 2F0SA 1EFID 2HQEA 1ZKOA 1Q1EA 1Z6HA 3BDCA 4ZLTF 4AYBB 5IT9L 4DAPA 1NR4A 3EFXD 2KECA 1FNUA 1BCPB 3F2UA 1RKNA 4BY1B 4CGYB 1JCKB 3MTSA 1TS5A 1ET9A 4A3MB 4BBSB 1AFPA 3V2TA 3SVMA 4QF4A 3CHBD 1HFGA 5I4DA 1EYAA 4HTHA 2VB2X 5M3FB 2J7ZA 4LK1C 4O1NA 1CHPD 1UEAB 3IAYA 1NAPA 2LFNA 4A3FB 4H7BA 2NTTA 1KTKA 3K6OA 5DEHA 1U4RA 2ICEC 4FVMA 2L4NA 2IWHA 4L8JA 4RGOS 1F2MA 1HTLD 5C5MA 2XSCA 2D2CC 5M5YB 4IQZA 1B53A 1JR0D 1E2VA 1EY9A 3NHHA 2JYOA 5IGEA 1R4PB 3GV6A 4FNFA 4MN3A 1PZKD 2WACA 3CQZB 1D1KA 3I4NB 2RSNA 3VR6A 1DZ1A 2BCOA 3NWSA 1QOHA 2FHTA 5CORA 3PUWA 4HMJA 1RODA 1II3A 1GHJA 4K2LA 2QKIC 3QOLA 4G7HC 2E2HB 2G9DA 4DFAA 2NB0A 1XXGA 3QWNA 2FMMA 3S2DB 1S5ED 3MZ5A 3KLRA 1I6VC 2NVXB 1PTOF 3N52A 1K8OA 3S1RB 4N9TA 1BO0A 1O7ZA 1PTOD 1EYCA 4PMBA 3HRZC 2B2VA 4NMZA 1UNSA 1YNJD 5IGGA 1VCIA 3URYA 2ZXRA 1WTVA 4ILWA 1BDOA 2R61A 3A7AB 1TWHB 1HQMC 3R2IA 1Z7TA 1OXTA 2F0DA 4IUNA 4KN4C 5JVG3 4FYDA 2F0OA 2XWJB 5KNBA 2EVBA 5CV7A 4HMIA 1D5ZC 4IUPA 3DMUA 3CRKC 2MP1A 2K7VA 3AB9A 4QUCA 2MHVA 3VA7A 5FK9C 5JEAH 2EY1A 2IX1A 3ONAB 1OXVA 3LX0A 3M4YA 1A2UA 4HAEA 1TR5A 4HSVA 5IGDA 4ID6A 3PUXA 1EIHA 1GUGA 2EY2A 3Q22A 1J8IA 2ENBA 3QO2A 4DNRB 1DOLA 2LY7A 3NWTA 2NVTB 1UUPA 1WTWA 1QE6A 1QB5D 2LS01 1Y69U 4ULLA 4L63B 3HZXA 2JSOA 4KI0A 5EPJA 5BN3A 2A5HA 2KCNA 5J22A 1DM0B 4DAVA 2F0FA 1SAPA 3GTLB 2R92B 2A6ED 1SDFA 3BYTB 1TY2A 4H0LC 1EL0A 4K8JA 2F0UA 3FDTA 1OXSC 5K36H 3VYSA 2RBMA 1ZEQX 5KNCA 3D4WA 2EY5A 2RVLA 3M3YB 1WTXA 1MSHA 1Q8IA 1WTQA 1S5FD 1H9KA 1F2YA 2JA7B 1SE4A 4K2KA 1RTOA 3SEBA 4C3IB 3KF8A 3P7JA 3ND8A 4ME5A 4HEDA 1TS3A 2KHSA 4G7OC 4CKBA 1CZGA 4PQXA 4KK7A 2CHBD 2FJ2A 3QJYA 3OSOA 3D4RA 4EQOA 1B9MA 5C44B 2PO4A 1SNMA 5JEAG 2YU9B 1OXXK 1EWCA 1V1PB 2A74C 4ZRZA 3VYUA 4RHSA 1EEFD 1ZYRC 1STAA 5M5WB 1RD9D 2F0LA 3A7LA 2A73B 3ITPA 3MXGA 3CU7A 1EY6A 1XTCD 1SSOA 1SFOB 4RKBA 4FP5D 3M85A 3I90A 5M3MB 4C1NK 1IW7D 1O7YA 5LHY1 1JICA 2LKVA 4X3SA 1PZJD 4XQQA 1LTRD 3D31A 5JPMC 3Q24A 4ZQ3A 1V1PA 2K04A 3QOJA 4KN7C 3OIQA 3TN2A 5DAUA 5IGFA 3HOVB 3A8IE 3K7AB 4C56C 3E6ZX 4C3HB 1S5CD 3DXJC 3J80E 1EQTA 5K36G 2SOBA 3M7NA 1HXYD 5J1ZA 4OGQC 3C3LA 1RTNA 1SMYC 4V0BA 1JOOA 4RCNA 2RSOA 1B9NA 2EYMA 4HCEA 2V4DA 2E2DC 1HPCA 1LO5D 1JWSD 1OXUA 5JOBA 1BOSA 2EYLA 2GA4B 2F0NA 4P2CB 2BDNA 4BA1I 2X6GA 3UI2A 4G7ZC 3HOZB 1ESFA 2MUYA 2F3WA 1ML0D 1Q3LA 2ZXPA 1MD2D 3AU7A 2K33A 1I6HB 2IX0A 5EBDA 2B39A 3R3OA 4ZYSA 4M8AA 4PNYA 2AUJD 1TS2A 2L1BA 5KNDA 1Y8NB 3IL8A 3MA2B 1U4PA 4FXKC 3KBXA 3RD4A 3U9SA 5C3XA 2HDLA 5D3IB 1SXTA 4IUVA 3S14B 3T13A 2PW7A 2EYPA 2LMCB 5IIFA 4BS9A 3NUCA 3EJIA 2O4XA 5CR3A 2QEJC 2BOSA 4RWSC 1V8QA 3CRLC 1E0BA 2AWNA 3RZOB 4RCOA 2MJ8A 2L55A 4EGVA 2E2IB 2DY7A 3TP6A 1LTGD 1Y1WB 3VYRA 2F0KA 2EJMA 1SNOA 3H09A 2OXPA 5E3FA 1I4HA 5A2QE 2F0WA 4KD4A 1IYVA 1BCPF 2EJFC 3OPOA 1BCPD 2KVMA 5IOCA 5JJZA 1A6XA 4HCSA 2B2UC 2IT1A 3BVZA 2Q8RE 1CTMA 3V05A 2A68C 3KBGA 1DOMA 1F77A 1DONA 4FXGC 4K14A 3BDOA 3VR5A 1LT3D 4LMQD 3R8BA 5DNFA 3OW7A 1K83B 4IZ8A 1ESRA 4R9WA 4KV6A 4RGTA 3K59A 5FLXL 1LTAD 2NTSA 1STHA 5IGCA 3R93A 4DK1A 1IHZA 3WDNA 5HURA 1EYDA 1Y8PB 5CC4A 3M7GA 4F88A 1X3PA 2NN6I 5J39A 3M4OB 1PXUA 1TWGB 2ID0A 1PLFA 3JAML 3HP3A 3K58A 1B44D 2PYKA 4NP5A 3DEPA 4IFDI 3P20A 2K32A 1TWFB 5LL6S 3GTPB 2B2WC 4KD3A 1AZPA 2D9UA 5C3WA 2XN9C 1JWMD 2OEOA 3VR4A 5T1GA 4J6HA 2AQ1B 1GUNA 1EU4A 1L0YB 1WTOA 3L3OC 2IJ0A 3GTMB 5EKKA 3IFDA 1HTPA 1C48A 1U4LA 5COYA 2M2LA 4XQNA 1F2LA 1B2TA 5E1FA 3NBHA 1VMPA 4U68A 1GJXA 1SYEA 2RA4A 3W3AA 2L11A 1EOTA 2QF7A 1FD7D 1H9SB 1I4XA 2N88A 4DAYA 1HFNA 2VUMB 2L5TA 1Y1VB 4DGZA 3QG1A 3MWYW 4H44C 3DUZA 4HSPA 2EYHA 1GUWA 4IUQA 1VMCA 1QWYA 5KIXA 5DM63 4RGMA 4A3BB 2OF1A 1IKLA 4MHEA 1HA5A 3KLSA 4A3JB 4ABNA 3QIAA 1LT5D 1H9SA 5FO7B 1DYQA 4TSSA 4I7ZC 4JBWA 1PZID 4C3JG 2A6HD 4BA2I 3Q23A 3K5LA 3NBIA 1FYCA 3A8JE 4A3GB 3C46A 1EY0A 3ERQA 1AEXA 3J81L 5KGUA 3I70A 5CYUA 2BE5D 4CBVA 3LWUA 4OO1I 2EOTA 3BYYB 3C1FA 2AWOA 4K5XA 3PIP3 1CQFA 5G3LF 4OIJA 2HDMA 5NUCA 1ET6A 1DOKA 2HUGA 2L12A 5G3LD 3MFGA 3HOWB 2F0MA 5EKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN3 A;  2FFK B;  1JE4 A;  3UI2 A;  3DEO A;  2Q8R E;  1DOL A;  2RA4 A;  2B2Y A;  3Q6S A;  1ML0 D;  1DOM A;  1B3A A;  1F9P A;  1Q3L A;  1EOT A;  2L11 A;  4XT1 B;  4ZK9 B;  2RSN A;  4IUU A;  4OIK A;  1DON A;  1DZ1 A;  1J9O A;  2K1B A;  2MGS A;  1ZXT A;  1WTW A;  5COR A;  1QE6 A;  2FHT A;  1WTR A;  4LMQ D;  1B50 A;  1KNE A;  2B2U A;  1RHP A;  2N88 A;  2NWG A;  5DNF A;  1HFN A;  2EPB A;  2B2Y C;  4XDX A;  1PFM A;  1ROD A;  1WD0 A;  1BF4 A;  1ESR A;  2SDF A;  4R9W A;  2IL8 A;  2L1B A;  4RAU C;  5E4X A;  5EPJ A;  1B4O A;  1LV9 A;  2L9H A;  2XIW A;  3I91 A;  1O80 A;  1X32 A;  2MPM A;  4QUF A;  3IL8 A;  4ZKB B;  2B2V C;  3MWY W;  2NYZ D;  1BBX C;  1U4P A;  2FMM A;  3QO2 A;  1SSO A;  5AFW A;  3R93 A;  1HA6 A;  1QG7 A;  2KED A;  1GUW A;  4XT3 B;  3KBX A;  4IUQ A;  4CJ2 C;  5EQ0 A;  2R3Z A;  5EJW A;  2HCI A;  4ZLT F;  1KNA A;  1VMC A;  3I90 A;  3N52 A;  2HDL A;  1SAP A;  5EPK A;  1G91 A;  1BO0 A;  4IUV A;  1NR4 A;  2CVR A;  1O7Z A;  3KUP A;  1O7Y A;  2KEC A;  4ZKC B;  1SDF A;  1IKL A;  1CM9 A;  4MHE A;  2B2V A;  3F2U A;  2Q8T A;  1S4Z A;  1JIC A;  1X3P A;  3I8Z A;  1EL0 A;  5CBE E;  2KOL A;  4X3S A;  1WTV A;  4RWS C;  3MTS A;  5CBA E;  1ICW A;  1HUM A;  3FDT A;  1PLF A;  2N55 A;  3HP3 A;  1XX8 A;  4IUR A;  1EIG A;  5E4W C;  1E0B A;  3D6W A;  1C8C A;  4CJ1 B;  3SVM A;  1G2T A;  1WD1 A;  3G7L A;  1M8A A;  2K04 A;  2MJ8 A;  4ZAI A;  1G2S A;  2K28 A;  3DEP A;  2DY7 A;  1PFB A;  1QNK A;  1ILQ A;  1MI2 A;  2B2W C;  4RA8 A;  3TZD A;  1HFG A;  5D65 A;  4NW2 A;  3TN2 A;  2X69 A;  2X6L A;  4CJ0 B;  1AZP A;  2D9U A;  1F9Q A;  2EE1 A;  1XYI A;  2RVL A;  3DM1 A;  1NCV A;  1WTP A;  4X3T A;  1BNZ A;  5EKI A;  1PDQ A;  1WTX A;  1MSH A;  3H91 A;  2J7Z A;  2VXW A;  4X3K A;  2K05 A;  5EPL A;  5T1G A;  1WTQ A;  4IUP A;  2K01 A;  5CMD A;  1NAP A;  2B2T A;  2MP1 A;  4X3U A;  1AP0 A;  2B2W A;  2JP1 A;  1HHV A;  1F9S A;  4DN4 M;  1WVL A;  1EQT A;  1U4M A;  4QUC A;  5T1I A;  1U4R A;  1WTO A;  1HUN A;  2FIN B;  2L4N A;  1ILP A;  1RTO A;  1TVX A;  2HCC A;  2NZ1 D;  1A15 A;  3GV3 A;  5D14 A;  3IFD A;  3ONA B;  2DY8 A;  1CA6 A;  3P7J A;  1RTN A;  3LWE A;  4IUT A;  2B2T C;  2EOT A;  1CA5 A;  1F9R A;  2KUM A;  1U4L A;  2RSO A;  2K03 A;  1X3Q A;  5COY A;  2H1E A;  4HED A;  1IKM A;  1MGS A;  4HAE A;  2M2L A;  1B53 A;  3I3C A;  1HRJ A;  4HSV A;  1F2L A;  1B2T A;  4OIJ A;  2HDM A;  3FPU B;  1RJT A;  2KVM A;  1AZQ A;  1G6Z A;  5JJZ A;  1DOK A;  1VMP A;  2HUG A;  2L12 A;  4R8I A;  2KEE A;  4U68 A;  1NR2 A;  4HCS A;  2BDN A;  4O42 A;  2X6G A;  1J8I A;  1MSG A;  1EIH A;  1IL8 A;  2JYO A;  4UAI A;  2FJ2 A;  2B2U C;  1PFN A;  3GV6 A; 
#chains in the Genus database with same CATH topology
 2FFK B;  2WB1 B;  1LT6 D;  1GOZ A;  1E2W A;  1PRT C;  2N3S A;  3DHQ A;  2UU9 L;  3VR2 A;  3GTQ H;  1B7Y B;  2F52 A;  1F9P A;  3PGZ A;  5C4H A;  4IUU A;  3G48 A;  3AQQ A;  2JJQ A;  3DWA A;  3SXH A;  2O5J C;  4KY6 A;  4A3K H;  2Z1C A;  3PIO 3;  1XTD A;  3HOX B;  1XJV A;  1BF4 A;  4XDX A;  3SK6 A;  4LF4 Q;  1R4Q B;  3I2Z A;  3PIO A;  4A3E H;  5J3B A;  4QUF A;  1KAB A;  4XYO A;  5C5L A;  4GLX A;  1BBX C;  1JWU D;  3SGI A;  4DK6 C;  5D3D A;  1W6K A;  2DNC A;  1NY4 A;  4PV1 C;  1CHQ D;  1I50 B;  3RMH A;  1JJ2 A;  1PTO H;  2F0H A;  4A3L G;  4QCL A;  3JAM E;  1CM9 A;  4LF5 Q;  1VQ6 A;  2EYO A;  2UUA Q;  4BWG B;  2NVQ B;  1SNP A;  5ISR A;  5CBE E;  1ICW A;  3HKZ G;  2D0O A;  1N34 L;  3D8G A;  3NP8 A;  5IT9 E;  3H0G B;  4L5Q A;  1XNR L;  1M8A A;  4ZAI A;  5CGK A;  2KCM A;  1Q82 C;  4X64 Q;  1A8V A;  4JI7 L;  1JOQ A;  2D5D A;  4ODG A;  3TP8 A;  2PZT A;  1A2T A;  4X6A H;  3GTL H;  2R92 H;  4JI3 L;  2JA5 G;  1WJJ A;  2AUK A;  4FXD A;  3DM1 A;  4GOP C;  1LTS D;  4X3T A;  2EDG A;  2RF4 A;  3S1N H;  1JQY D;  2IHF A;  5EPL A;  4GNX A;  1M4V A;  2F0P A;  2K01 A;  1Q8K A;  3FKI G;  2QEX A;  1YNN C;  1SYC A;  3A8K E;  4DNT B;  1F9S A;  4DN4 M;  4HIM A;  5LMN L;  4DV1 L;  3PO3 H;  3EQL C;  2HIV A;  2QCP X;  2JA6 G;  1TWA H;  1HUN A;  4A3G G;  4YWK A;  4JI1 Q;  5D14 A;  2UXC L;  1DCZ A;  4BY7 H;  4CDF C;  1AH9 A;  4KY7 A;  2M00 A;  1KDA A;  1X56 A;  3PUY A;  3PUV A;  4O0A A;  4PMC A;  2EXD A;  3BG3 A;  1G6Z A;  1WYD A;  4O42 A;  4PG3 A;  2EYJ A;  3H6M A;  4UAI A;  2WKC A;  2ZTE A;  2F0G A;  5C4X H;  2ALY B;  4UP7 A;  2CW0 D;  1STY A;  1STE A;  2PI2 E;  2B29 A;  1VQ4 A;  3K5O A;  3Q6S A;  3UE1 A;  2NN6 H;  4UPA A;  3KJO A;  4C3I H;  3J7A F;  4DR5 Q;  5FLX c;  2J4X A;  3UDX A;  1K8A C;  3K0Y A;  4DXG A;  2QIL A;  3R2T A;  4L5R C;  4DR7 Q;  3D3R A;  5FLM G;  4NXN Q;  2A69 D;  3CF5 A;  2PQA A;  4IFD H;  2CQO A;  4QJF A;  2K6A A;  1LV9 A;  2XWB B;  4YWL A;  3BU2 A;  1SNQ A;  3I4M G;  2B2V C;  5BR8 L;  5I9O A;  3PO2 G;  2SEB D;  1A3T A;  4CJ2 C;  3Q0A A;  3JAM c;  2YU9 H;  1M1K C;  2HQL A;  2KEN A;  4XYQ A;  4DV5 L;  4F8M A;  4DR1 L;  3D6C A;  1PH6 A;  2Q8T A;  2XGT A;  4A3K G;  1CKO A;  3X3M A;  4LFA L;  1Q12 A;  1YHB A;  3RLF A;  4A3E G;  4R4O A;  1C9O A;  1S5B D;  2H5X A;  1JJG A;  2R7Z H;  1TU2 B;  5C6A A;  2R7D A;  1CUK A;  1WD1 A;  5BN4 A;  3KF6 B;  4ZCK A;  2DJF C;  2EY6 A;  3PV0 A;  3PF4 A;  1ONL A;  2NZO A;  2RHQ B;  3NEL A;  3CMA A;  1SNC A;  3VDY A;  3TZD A;  3CCL A;  5D65 A;  3H0G G;  4LF7 L;  5C3E H;  1F2Z A;  4JI5 Q;  2AQ2 B;  1KDC A;  1QCB D;  3WOE A;  4I7A A;  5M5X H;  1GUT A;  3WOF A;  2K05 A;  1J6Q A;  4RFB A;  5JJL A;  1FJG L;  4NXM Q;  4KHV A;  1D5M C;  4C1N I;  1Z47 A;  1VQG A;  4A76 A;  4DV3 L;  3H94 A;  4FF4 A;  3OWE B;  1UE5 A;  2PMZ E;  3GTO B;  3UE0 A;  4YCW A;  1AW7 A;  4P74 A;  2UXD L;  5GAD C;  5CV8 A;  3PCO B;  1KLU D;  3UDG A;  2RKS A;  3CW2 C;  2OTJ A;  2JA8 H;  2FXQ A;  4QIW E;  2KBN A;  1N9W A;  3SK8 A;  2UUB Q;  3KF6 A;  4A93 H;  2F0Q A;  4N8F A;  3PQI A;  3TP7 A;  3DEO A;  4X62 L;  1XPO A;  1I3Q H;  4A3I G;  2Z6K A;  2A8V A;  1M90 C;  3PO3 G;  4A3D B;  1SLJ A;  4HJA A;  1IBL L;  3A74 A;  1KDB A;  1B3Q A;  1ZXT A;  1HQR D;  4BY7 G;  2M9V A;  1SE3 A;  2N49 A;  3OIP A;  2ASB A;  2B2Y C;  2EJG C;  1TWC H;  2QDL A;  4DUZ Q;  1KC8 C;  1U9R A;  1QUQ B;  3TME A;  1O80 A;  1Z9F A;  2SNS A;  3NQI A;  5IE8 A;  4JK1 C;  3OW2 A;  3TBI B;  1QJO A;  5ELC A;  4K0K Q;  4WOR A;  3UDF A;  4GS3 A;  1QG7 A;  5C4X G;  3L9A X;  2IX3 A;  4UDU C;  5EPK A;  2F4V Q;  1T5E A;  1RCV D;  3OMC A;  2EXZ A;  1B1Z A;  1WCM G;  3EVQ A;  3PMF A;  3J7A V;  4GKJ L;  1PTO C;  1NNX A;  1O78 A;  3C1E A;  3BZK A;  2Y0S E;  3CCR A;  3OHX C;  1FR3 A;  2CQA A;  3FEW X;  1YNJ C;  5EAY A;  4X66 L;  5CBA E;  4OO1 H;  5E7N A;  4ZUI A;  3AYH B;  1STB A;  5JVH 3;  2E2J H;  1OO9 B;  3SK5 A;  2WII B;  3TQY A;  4IFD G;  3AFQ A;  2CH4 W;  1XPU A;  5CV6 A;  1G2T A;  1GVP A;  3V96 A;  3FRP B;  2VQE L;  4KY5 A;  3T53 B;  1VQF A;  5FO9 B;  4TKO B;  2BE5 C;  2NZH A;  1ILQ A;  2F4I A;  5KYI A;  2PCF B;  1X55 A;  4OX9 L;  2B8G A;  3MVV A;  3J81 c;  1VDZ A;  4AYB E;  3S16 B;  1X6O A;  5I6W A;  2OWO A;  4YIJ A;  1XMO L;  4C2M B;  1Y14 B;  4DV6 Q;  1AP0 A;  2E5L L;  3GTJ H;  2O2L D;  3RZO H;  1LLR D;  2FIN B;  2R7Z G;  3GV3 A;  1D2B A;  1X3F A;  1L1O A;  2E2I H;  3LWE A;  1ENA A;  1YJW A;  3S1Q B;  2WAQ G;  5C3E G;  3HOU B;  1BVS A;  4G57 A;  1E2Z A;  1G8Z D;  4RGN A;  4Y52 H;  2KHI A;  1MBY A;  1EQQ A;  1AN8 A;  5EBC A;  5FJ8 H;  1R9T H;  3BJU A;  1NUC A;  3S17 B;  2G9H D;  4ZK9 B;  4OIK A;  2MO0 A;  4WRD A;  5TSS A;  3G6J B;  4LJZ C;  1PMR A;  5C0X I;  4OHJ A;  3CCS A;  1B50 A;  2HIX A;  4HIK A;  2Q2I A;  3STB D;  1JB3 A;  1SEB D;  4XXE A;  1VQ8 A;  5E4X A;  2JA8 G;  4O2D A;  1GHK A;  1CKN B;  3A5Z B;  3S1M B;  1HNX Q;  4B3M Q;  4A93 G;  3S24 A;  5AFW A;  1CI3 M;  3GTG B;  2B63 H;  4XT3 B;  1UAP A;  3HGB A;  2R3Z A;  3HS0 C;  1KNA A;  2PZW A;  3T56 B;  1VQC A;  1SN8 A;  1D8L A;  2VQF Q;  4LFB Q;  2A6E C;  2NVY B;  1DD2 A;  1LAB A;  4P71 A;  1VQ5 A;  3FMC A;  3I8Z A;  4GZY C;  2ZJP A;  3MXU A;  5LMN W;  4JI8 L;  1PRT B;  1IYJ B;  4OXP A;  4BBR B;  1BXT A;  1FVI A;  4CJ1 B;  4JBJ A;  4RKL A;  4JI6 Q;  1LTI D;  4RA8 A;  2D62 A;  2JK8 A;  5GAH C;  3BS1 A;  3RZD B;  2J0T D;  4S3S A;  2F03 A;  1NCV A;  4R8N A;  5C0X J;  1CKN A;  4X3K A;  2VXW A;  1FL0 A;  5M9O A;  3HOY H;  5LL6 X;  4EVO A;  4H13 C;  4OO1 G;  1JMC A;  1CQV A;  4DV0 Q;  3RN2 A;  1HR0 Q;  1KAA A;  5BN5 A;  3S15 B;  4C3J B;  1K28 A;  2R93 G;  2IY5 B;  4DR4 Q;  2F3V A;  2B2T C;  2KCT A;  2KUM A;  2TMP A;  5LMN Q;  4DV1 Q;  4DA2 A;  1SJH D;  4DR3 Q;  2UXC Q;  2RDF A;  4V19 0;  5IGB A;  1RJT A;  3BVG A;  4BY1 H;  1QVF A;  4R8I A;  2N78 A;  1MSG A;  4JOI C;  4BBS H;  1CZW A;  4JI2 L;  1SYD A;  1JE4 A;  1Q1B A;  1I94 L;  1N36 L;  3M9B A;  1TY0 A;  4NDX A;  4AH6 A;  4B3T Q;  4LW1 A;  3JAM i;  4XT1 B;  4GOP B;  1EU3 A;  3RUZ A;  1ZYR D;  3LNN A;  3BDL A;  1YEZ A;  4DUY Q;  4LFC Q;  1HCZ A;  3GP7 A;  3IFT A;  4LAA A;  3J7Z C;  5M3F H;  1G29 1;  3W1G A;  2PZU A;  3OTO L;  1SMX A;  3NEN A;  3I91 A;  1X32 A;  1G6P A;  2E75 C;  1Q86 C;  4A3F H;  1I4P A;  5CV5 A;  5FJ8 G;  3G6E A;  1IBM Q;  3GO5 A;  1LTB D;  1VQO A;  2OT2 A;  1YVC A;  3OYY A;  1D6E C;  4CDD C;  4JI0 L;  4F87 A;  1IW7 C;  2RCF A;  4IFD J;  1S4Z A;  3PUZ A;  3OMG A;  5M5Y H;  3RN5 A;  3MAQ A;  1Y8O B;  2PQE A;  3PF5 A;  3NXW A;  1C7Y A;  4IUR A;  2QA4 A;  5E4W C;  4TRD A;  3SR1 A;  1L0X B;  1FNV A;  3D6W A;  4DV4 L;  3H3V I;  5I2Y A;  4GOP A;  4QB4 A;  2RDH A;  1G2S A;  4ZUJ A;  1SND A;  3CQZ H;  5ELB A;  1XMQ L;  2B63 G;  4LF6 L;  4JI4 Q;  4LWC A;  2X6L A;  3J7A 5;  2I0Q A;  4J15 A;  2L0C A;  3NTI A;  3HKZ B;  4DNI A;  1S5D D;  4K5V A;  3A56 A;  3KLS X;  4CKE A;  4YWM A;  5EGT A;  2SNM A;  1A3V A;  2E2H H;  2WP8 J;  4B3S Q;  1TT2 A;  2K5D A;  1UE1 A;  4M1U B;  1TVX A;  2NZ1 D;  1A15 A;  5I2X A;  2JA5 B;  3S2D H;  1SMY D;  1JOK A;  3OOC A;  4BXX G;  4IUT A;  4Y7N B;  3S2H B;  5IY0 A;  1F9R A;  3N6R A;  2NVX H;  3S1R H;  4GN4 B;  3FKI B;  1TS4 A;  1IKM A;  2Y0S G;  4YCU A;  1NJI C;  2PPB C;  4DV2 L;  3E5S A;  4L5T A;  2JA6 B;  5C4J B;  4HN7 A;  3TZU A;  4EQN A;  3MC0 B;  5KRU A;  2E8G A;  3T1Y Q;  1YZ6 A;  3BVM A;  3I73 A;  4JCV E;  1EY8 A;  4CHT B;  1VQK A;  3T16 A;  1CSQ A;  4I65 A;  1N32 L;  1TQO A;  1SBB B;  2JA9 A;  4AYB G;  1YI2 A;  2EPB A;  4UP9 A;  2Q8I B;  1SE8 A;  3RLO A;  3U9O A;  2ZM6 Q;  3HEJ A;  1B4O A;  1HZ9 A;  4BY1 G;  3GD7 A;  4MIU A;  4ZKB B;  2I46 A;  2O5I C;  3FVQ A;  4A3M G;  5HGT A;  3K80 C;  4KKU A;  4PZ7 A;  2RQX A;  2Z9H A;  1IXR A;  1H9M A;  2CVR A;  4ZKC B;  5IP9 H;  1U0L A;  4HJ7 A;  2WKD A;  4B9X A;  2KQ3 A;  1IZ6 A;  4FF1 A;  4JVZ A;  5FLX E;  3I4M B;  4X65 L;  1HUM A;  3RLN A;  1XNQ Q;  3PO2 B;  1HNW L;  5JJK A;  4GKJ Q;  5M3F G;  2MFI A;  3CCV A;  4XTC S;  3O13 A;  1STN A;  3GTQ B;  2RHS B;  1SYG A;  2TSS A;  4A3F G;  3MXN B;  3ZYY X;  3J80 L;  2EYF A;  3IKJ A;  3A54 A;  4A3K B;  3K8A A;  2X69 A;  1EQR A;  1H9R A;  2NVT H;  4B08 A;  2C9O A;  3T1H Q;  1WTP A;  4A3E B;  1BUV T;  1EY4 A;  1Q90 A;  2A19 A;  3P1H A;  2WIN B;  4YHH L;  4OX9 Q;  4JV5 L;  3WWV A;  2IPK D;  5C0X H;  1U4M A;  3BZD B;  1NSN S;  3E0J A;  2HHH L;  4A3C G;  1PTO B;  2D0P A;  1C4Q A;  1CA5 A;  3I4N G;  4LF8 L;  1E3P A;  2Z8L A;  3K57 A;  2H1E A;  1MGS A;  4YCV A;  1KL9 A;  2Q2T A;  3FPU B;  3NSW A;  4E6I A;  1AZQ A;  1QNU A;  1BCP C;  1TKW B;  2H4O A;  2MO1 A;  2GVA A;  1PFN A;  3MXN A;  2A68 D;  5IOD A;  3HG9 A;  2B2Y A;  1JC7 A;  4GKK L;  5CV4 A;  3U58 A;  4KTA A;  1C0A A;  4B3R L;  5F2D A;  3NQT A;  3E9H A;  3CC4 A;  2UUC L;  5GRO A;  3NTH A;  1RHP A;  2NWG A;  3S1N B;  1I4Q A;  4PZ6 A;  2F3I A;  1RF2 D;  3M3Y H;  2SDF A;  2KA7 A;  4A3I B;  2XIW A;  4QL5 A;  3PO3 B;  2MPM A;  1TWA B;  4DR6 Q;  3SDZ A;  2BA1 A;  5HY6 A;  2JA7 H;  4WFN 3;  2KJX A;  4BY7 B;  3TSS A;  3I56 A;  3TP5 A;  2L15 A;  1N33 L;  5LMU Q;  2I07 B;  2PW5 A;  3C2P A;  2JQO A;  3K5M A;  3GTK B;  4AQY L;  2E76 C;  1YJN A;  1DJR D;  5C4X B;  1XX8 A;  1EIG A;  1FGB D;  1TII D;  1S72 A;  1C8C A;  1EWH A;  3CD6 A;  4IPH A;  1WCM B;  2E74 C;  1E1T A;  4KLK A;  5K5P A;  2K5W A;  5C44 H;  1IYU A;  4Z9C B;  1V43 A;  4NB3 A;  2JEB I;  3EA6 A;  4GLA C;  1H95 A;  2EE1 A;  3VA5 A;  2IW3 A;  5IP9 G;  5A2Q L;  3DM3 A;  1PDQ A;  1FNW A;  5M5W H;  4DK3 C;  1PYB A;  3I4L A;  3W2D A;  5CMD A;  2CKZ B;  1PH5 A;  4QQB X;  3VR3 A;  5T1I A;  4U67 3;  1ENF A;  5FO8 B;  2UXB L;  1ENC A;  3J7Y W;  2YTV A;  1SFO H;  3QB3 A;  5AJ3 L;  1D5X C;  4HR7 B;  3ND9 A;  5M3M H;  1CSP A;  1WI5 A;  1GUO A;  3L2P A;  1KHI A;  1EFW A;  2EZV A;  1EY7 A;  4Q5V A;  4KMU C;  1HH2 P;  1HRJ A;  4JBM A;  1Q46 A;  5FOB B;  1A3U A;  3J81 E;  2XVS A;  4DU9 A;  2EQS A;  3NK9 A;  5ELE A;  2R7Z B;  1LAC A;  1K9M C;  1IL8 A;  1VQA A;  1VF7 A;  2MQH A;  1SE2 A;  5IP7 H;  3I7F A;  1V9P A;  5C0X G;  4FO2 A;  4FF2 A;  4CDE C;  5ELF A;  4R1J A;  2WAQ B;  5C3E B;  2K5Q A;  5CV9 A;  3W5O A;  4DV7 L;  1I94 Q;  3P75 A;  1N36 Q;  2B2U A;  4K6L A;  5A35 A;  5M5X B;  1I4R A;  3K5N A;  3H3V H;  2NUC A;  4IAL A;  2R92 G;  1NMF A;  4OEL B;  3AMU A;  4YY3 Q;  4K5W A;  4KKS A;  3HOV H;  2L9H A;  3K7A H;  3CKI B;  2YYZ A;  5C4Z A;  2WFW A;  4C3H H;  1DXM A;  4JPB W;  4K8I A;  1HNZ L;  1HA6 A;  2KED A;  3DWP A;  2HCI A;  3OTO Q;  4WJ3 M;  4DXF A;  2AQ3 B;  3ERO A;  2HD3 A;  2JA8 B;  1IBK Q;  2FMC A;  3EBE A;  3FHW A;  1LYL A;  2ZT9 C;  2MNA A;  4G4K A;  3EIV A;  3ULJ A;  2KOL A;  1GKH A;  4A93 B;  1UE7 A;  1CK1 A;  1VQB A;  1I3Q B;  5ELO A;  2ICI A;  4JG2 A;  3G7L A;  3CCM A;  1XWE A;  2K28 A;  2VNU D;  2NBF A;  3HOZ H;  3X3N A;  3GQB A;  4GNX C;  2JA7 G;  1MI2 A;  3SHL A;  1K0S A;  4NW2 A;  2NN6 G;  2A6H C;  1X3E A;  4C3I G;  1TWC B;  1XYI A;  3D4D A;  3I72 A;  4WJW A;  1I6H H;  1HZC A;  5EKI A;  1PH3 A;  1Q7Y C;  4GN5 A;  2JEA I;  3M4P A;  1W3S A;  2F0J A;  2F0E A;  2B2T A;  4X3U A;  2B2W A;  2JP1 A;  2PNR C;  1W6J A;  2CFM A;  1HHV A;  1VQI A;  5FKA C;  2EIF A;  3RNU A;  4F7X A;  4KKT A;  1EOV A;  5KEE A;  3MFY A;  4JYA Q;  4LF4 L;  2DY8 A;  4OWW B;  3MHB A;  3FP9 A;  4B9W A;  3MEH A;  5C44 G;  1PH8 A;  3A55 A;  3NPP A;  1VF5 C;  4DK0 A;  3S14 H;  1K8M A;  4J1M A;  1QUQ A;  4KHZ A;  1CT1 D;  3MXP A;  1K73 C;  2E2J B;  1PRT F;  2KEE A;  4P72 A;  1NR2 A;  2R93 B;  2XNA C;  2DNE A;  3KLW A;  4RH6 A;  1PRT D;  3KK7 A;  5ELD A;  2XRQ D;  1EZ6 A;  5JPN C;  4LF5 L;  1J5E Q;  5KYL A;  1SJE D;  2F0I A;  1X3G A;  5I9P A;  2BH2 A;  1J9O A;  2K1B A;  3TDQ A;  4LF9 L;  2MGS A;  3VYT A;  1CFM A;  1WTR A;  2PI2 A;  1STG A;  1GUS A;  5M3M G;  3BZC A;  2F0V A;  5I6Y A;  3S1Q H;  1Y1W H;  1PFM A;  1E7Z A;  5JAV A;  1WD0 A;  1ASY A;  3HOU H;  2IL8 A;  4QMG A;  1LTT D;  2F0T A;  3GTJ B;  1BQQ T;  5DM7 3;  1BR9 A;  3FPP A;  2YV5 A;  2ZXO A;  2NYZ D;  1YJ9 A;  4A75 A;  5EQ0 A;  3TS0 A;  5EJW A;  1Q81 C;  5H1S E;  3OWF A;  1VS0 A;  4A4I A;  1G91 A;  2Z4H A;  3KUP A;  4DKA C;  3AFP A;  1QVG A;  2UU9 Q;  4KJO A;  2BDO A;  3TRZ A;  2QDB A;  4R4C A;  4JI1 L;  4DF7 A;  3J80 c;  2DJG C;  3CCE A;  1RDP D;  2N55 A;  2PMZ B;  1SYF A;  3T51 B;  4KJN A;  1R9T B;  4N9P A;  1H9J A;  1EZ8 A;  3HOV G;  1JOR A;  5IYB H;  4FF3 A;  4X65 Q;  1O7L A;  2Z4I A;  4C3H G;  4IN3 A;  4TQU S;  1QIL A;  1PFB A;  1V1Q A;  1QNK A;  4L6T B;  4K6D A;  3NTK A;  5IWA L;  4QIW B;  4CJ0 B;  2C5C A;  4J8Q A;  1V1O A;  1F9Q A;  1LM0 A;  1PH4 A;  2KCC A;  4XQJ A;  2NVY H;  1BNZ A;  3DWQ A;  1I4G A;  3H91 A;  1K83 H;  3SE0 A;  1LTL A;  1YNN D;  5JEA J;  3HKZ E;  3SK4 A;  2B63 B;  2JXM B;  1WVL A;  4KHP L;  1YBY A;  1EY5 A;  2XRS D;  3F8T A;  2BA0 A;  1EQV A;  4OON A;  1ILP A;  1LT4 D;  2HCC A;  2VB3 X;  4DR7 L;  4RHR A;  1CA6 A;  4NXN L;  4EQP A;  3HOZ G;  1KLG D;  1N34 Q;  1VQN A;  1PYW D;  2K03 A;  1XNR Q;  1X3Q A;  2DN8 A;  1NTG A;  3I3C A;  4JI7 Q;  2AKW B;  3IRB A;  1GXD C;  4CKC A;  2WV6 D;  3T4A C;  3M4O H;  4LF8 Q;  4JI3 Q;  1TWG H;  3NE5 B;  2F1M A;  2JE6 I;  4UP8 A;  2R6G A;  2CW0 C;  3F2D A;  4C3J H;  1D1I A;  1B3A A;  1X54 A;  2Y0S B;  1T5X D;  4PMW A;  1TWF H;  3GTP H;  2B8F A;  1KNE A;  4Q0F A;  1L0W A;  5IYD H;  1SYB A;  4NKL A;  4B3R Q;  2RDG A;  3S9W A;  3H3V C;  3HOY B;  1O7I A;  4R4T A;  4RAU C;  3L7Z C;  2A69 C;  2KHJ A;  1G51 A;  4XIG S;  1PVO A;  1EEI D;  2C35 B;  3L0O A;  1PH7 A;  4OL7 A;  2F0S A;  1EFI D;  1JT8 A;  4JI5 L;  2HQE A;  1X9N A;  1ZKO A;  1Q1E A;  1Z6H A;  3BDC A;  4ZLT F;  1VQ9 A;  3GTM H;  4AYB B;  5IT9 L;  4DAP A;  2WB1 E;  1NR4 A;  3EFX D;  2KEC A;  4GLV B;  4NXM L;  2K5N A;  1FNU A;  1BCP B;  3F2U A;  1RKN A;  2JN4 A;  4BY1 B;  4UHV A;  1A0I A;  4CGY B;  1JCK B;  3W1B A;  1B8A A;  3MTS A;  1TS5 A;  1ET9 A;  4A3M B;  1Y1W G;  4BBS B;  1AFP A;  1PH9 A;  3V2T A;  4IPD A;  3U4V A;  3SVM A;  1GD7 A;  4QF4 A;  3CP0 A;  3CHB D;  1HFG A;  5I4D A;  1EYA A;  4HTH A;  3KFU A;  2UUB L;  5BR8 Q;  2VB2 X;  2I5L X;  5M3F B;  1L1O C;  2J7Z A;  4O1N A;  4LK1 C;  1CHP D;  1UEA B;  3IAY A;  2VUM H;  1NAP A;  5DLQ E;  2K5V A;  2LFN A;  4CDC C;  4DV5 Q;  4HJ5 A;  4A3F B;  4H7B A;  4DR1 Q;  2NTT A;  1KTK A;  3K6O A;  1Y1V H;  5DEH A;  1PV4 A;  1U4R A;  2ICE C;  4FVM A;  2L4N A;  2GVB A;  2IWH A;  4L8J A;  4RGO S;  4LFA Q;  5HGQ A;  5IYB G;  1F2M A;  1HTL D;  1AE2 A;  1MHW C;  4AIM A;  4DUZ L;  5C5M A;  1PA6 A;  2XSC A;  2UXB Q;  2D2C C;  5M5Y B;  4A3B H;  1NBW A;  4IQZ A;  1B53 A;  4K0K L;  1JR0 D;  1E2V A;  1EY9 A;  1W2B A;  4LF7 Q;  3NHH A;  2JYO A;  2F4V L;  5IGE A;  1R4P B;  4A3J H;  3GV6 A;  4FNF A;  4MN3 A;  3KDF B;  2Z0S A;  1PZK D;  2WAC A;  3CQZ B;  2VZA A;  1D1K A;  2QW7 A;  3I4N B;  1PH2 A;  1X65 A;  4LNQ A;  1FJG Q;  2RSN A;  3VR6 A;  1EIY B;  1DZ1 A;  3S2H H;  2BCO A;  3NWS A;  1QOH A;  2FHT A;  5COR A;  4DV3 Q;  3PUW A;  4HMJ A;  1ROD A;  1UE6 A;  1II3 A;  1GHJ A;  4K2L A;  2QKI C;  3PSI A;  3QOL A;  4G7H C;  2UXD Q;  2E2H B;  2G9D A;  4DV7 Q;  4DFA A;  2JA6 H;  4A3G H;  2NB0 A;  1XXG A;  3QWN A;  3HOY G;  2FMM A;  3S2D B;  1S5E D;  3MZ5 A;  3KLR A;  1EWI A;  2B3G A;  1I6V C;  1VQP A;  2NVX B;  1PTO F;  3N52 A;  1K8O A;  3S1R B;  4DV6 L;  4N9T A;  1BO0 A;  1O7Z A;  1PTO D;  4X62 Q;  1EYC A;  4PMB A;  3K7U C;  3HRZ C;  2B2V A;  4ME3 A;  4NMZ A;  1UNS A;  5IYD G;  1GM5 A;  1YNJ D;  5IGG A;  1VCI A;  1IBL Q;  3URY A;  2ZXR A;  1WTV A;  1MJC A;  3KDF A;  4ILW A;  1BDO A;  2R61 A;  4RG1 A;  3A7A B;  1TWH B;  1HQM C;  3HOW H;  4BBS G;  3R2I A;  1Z7T A;  1VQM A;  1OXT A;  2F0D A;  4IUN A;  4KN4 C;  2YTX A;  5JVG 3;  3J81 i;  5FLM H;  4FYD A;  2F0O A;  2XWJ B;  1VQE A;  1WTH A;  2EVB A;  5CV7 A;  5KNB A;  3HOX H;  4HMI A;  1D5Z C;  4IUP A;  3DMU A;  1B70 B;  3CRK C;  2MP1 A;  1QVC A;  3KOJ A;  2K7V A;  3AB9 A;  4QUC A;  2LSS A;  2MHV A;  3VA7 A;  5FK9 C;  5JEA H;  2ZJQ A;  2EY1 A;  4GN3 B;  2IX1 A;  4X66 Q;  3ONA B;  1OXV A;  1LUZ A;  3U50 C;  1K3R A;  3LX0 A;  4POF A;  1WFQ A;  3M4Y A;  5GQO A;  3TRE A;  3F2B A;  1A2U A;  4H02 A;  1I50 H;  1HNX L;  4B3M L;  1ICF B;  4HAE A;  1TR5 A;  2VQE Q;  4HSV A;  5IGD A;  4ID6 A;  2NVQ H;  3PUX A;  1EIH A;  1GUG A;  2EY2 A;  3Q22 A;  1J8I A;  2VUM G;  2ENB A;  3QO2 A;  4GNX B;  4P75 A;  4DNR B;  2VQF L;  4LFB L;  1DOL A;  3CCU A;  1XMO Q;  2LY7 A;  1Y1V G;  3H0G H;  3NWT A;  2GN5 A;  4WJ4 A;  2NVT B;  1UUP A;  1WTW A;  1QE6 A;  1QB5 D;  2LS0 1;  2G5D A;  1Y69 U;  4ULL A;  2E5L Q;  3F2C A;  2WAQ E;  4L63 B;  4QY7 A;  3G4S A;  3HZX A;  4DPG A;  3J80 i;  4A3B G;  3STB C;  2JSO A;  4LF9 Q;  4JI6 L;  4KI0 A;  1BBU A;  5EPJ A;  3ER0 A;  5BN3 A;  2A5H A;  3ULP A;  3H15 A;  2KCN A;  5J22 A;  3ERS X;  2ZTD A;  4A3J G;  1YNX A;  1DM0 B;  1L2F A;  4DAV A;  2F0F A;  4QGU A;  2OTL A;  1SAP A;  3GTL B;  2R92 B;  2A6E D;  2K14 A;  1SDF A;  3KF8 B;  4IO9 A;  3BYT B;  1TY2 A;  4DV0 L;  1HR0 L;  4H0L C;  2LXK A;  3CPF A;  1EL0 A;  4K8J A;  2F0U A;  4DR4 L;  3FDT A;  4PZ8 A;  1OXS C;  5K36 H;  4A3I H;  3VYS A;  2PQA B;  2RBM A;  2DGY A;  1ASZ A;  4DR3 L;  1ZEQ X;  3A5U A;  5KNC A;  1XPR A;  3G71 A;  3D4W A;  4APV A;  2EY5 A;  3GDE A;  2RVL A;  3CCJ A;  4JBK A;  3J81 j;  3M3Y B;  1WTX A;  1MSH A;  1JJC B;  3E9I A;  1Q8I A;  1WTQ A;  3TS2 A;  5JJI A;  1S5F D;  5IWA Q;  2DUD A;  3GTK H;  4B3T L;  1H9K A;  1F2Y A;  2JA7 B;  1SE4 A;  4K2K A;  4HJ9 A;  4JC0 A;  1RTO A;  2HT1 A;  3HOW G;  4DUY L;  4LFC L;  3SEB A;  4C3I B;  4JI8 Q;  3KF8 A;  1WCM H;  3P7J A;  4HJ8 A;  2WB1 G;  4KHP Q;  5ELN A;  3ND8 A;  3JC6 6;  4ME5 A;  1P8L A;  4HED A;  1TS3 A;  4MTK A;  2KHS A;  3LGJ A;  4G7O C;  4CKB A;  2K4K A;  1CZG A;  4PQX A;  1IBM L;  1KXL A;  4KK7 A;  3HOX G;  2CHB D;  2FJ2 A;  3QJY A;  1SRU A;  3OSO A;  4DR2 L;  3D4R A;  4EQO A;  1B9M A;  2PNH A;  5C44 B;  1HZA A;  2PO4 A;  1SNM A;  5JEA G;  2YU9 B;  2K5H A;  3HKS A;  1OXX K;  1EWC A;  1HJP A;  1V1P B;  2A74 C;  2CWP A;  4ZRZ A;  3ULL A;  3VYU A;  4RHS A;  1EEF D;  1ZYR C;  1STA A;  3B6Y A;  5M5W B;  1RD9 D;  3E0E A;  2F0L A;  3A7L A;  2A73 B;  5IT9 c;  4JI4 L;  3ITP A;  3MXG A;  3CU7 A;  1EY6 A;  1CKM A;  1XTC D;  1SSO A;  1SFO B;  3CAM A;  4RKB A;  4FP5 D;  1VQL A;  3M85 A;  2OQK A;  3I90 A;  5M3M B;  3GTO H;  4JI2 Q;  4C1N K;  1IW7 D;  4IPC A;  1O7Y A;  4P73 A;  3TEH B;  5LHY 1;  4B3S L;  1JIC A;  2LKV A;  2ATW A;  3RR5 A;  4X3S A;  1PZJ D;  1NMG A;  4XQQ A;  4R4Q A;  1LTR D;  3D31 A;  5JPM C;  4MZ9 A;  3Q24 A;  1HZB A;  1KRS A;  4ZQ3 A;  2CWA A;  1V1P A;  2K04 A;  3QOJ A;  4KN7 C;  4UY8 C;  3OIQ A;  2A1A A;  3UDI A;  4A3D H;  1IL2 A;  3TN2 A;  1QZH A;  3HFZ B;  1MKH A;  5DAU A;  1FGU A;  5IGF A;  3T1Y L;  3HOV B;  3A8I E;  3K7A B;  4IOC A;  2BH8 A;  4C56 C;  3E6Z X;  4C3H B;  3KJP A;  1S5C D;  4JI0 Q;  3DXJ C;  3J80 E;  3ZJY C;  1T9H A;  1EQT A;  5K36 G;  4MNO A;  2SOB A;  3K81 C;  3M7N A;  1HXY D;  5J1Z A;  4OGQ C;  3C3L A;  1RTN A;  1SMY C;  4V0B A;  1JOO A;  2ZM6 L;  4MTN A;  4RCN A;  4DV4 Q;  2RSO A;  1KAW A;  4LUO A;  1B9N A;  2EYM A;  1VQH A;  2V4D A;  4HCE A;  1PYS B;  1HPC A;  1NE3 A;  2E2D C;  1LO5 D;  1OXU A;  1JWS D;  5JOB A;  1BOS A;  2EYL A;  2GA4 B;  1XMQ Q;  1SR3 A;  4LF6 Q;  1WOC A;  2F0N A;  4P2C B;  2BDN A;  4BA1 I;  2X6G A;  2ES2 A;  4IPG A;  1MJE A;  3UI2 A;  4G7Z C;  3HOZ B;  1ESF A;  2MUY A;  2F3W A;  1ML0 D;  1Q3L A;  2ZXP A;  1MD2 D;  1XNQ L;  3AU7 A;  2K33 A;  1I6H B;  1L1O B;  2IX0 A;  4JOI A;  4IJL A;  2Q2H A;  5EBD A;  2B39 A;  3R3O A;  3QR8 A;  4ZYS A;  4M8A A;  4PNY A;  3Q8D A;  1YIT A;  1E24 A;  2AUJ D;  1TS2 A;  3S16 H;  2L1B A;  1VQD A;  5KND A;  4C2M H;  2K52 A;  2K75 A;  2R93 H;  1Y8N B;  3IL8 A;  3MA2 B;  1U4P A;  4FXK C;  3T1H L;  3CXC A;  3KBX A;  1KIX A;  4HID A;  4DV2 Q;  3RD4 A;  2UUA L;  3MEF A;  3U9S A;  5C3X A;  2HDL A;  5D3I B;  1SXT A;  1KQS A;  4IUV A;  3S14 B;  3T13 A;  2PW7 A;  2EYP A;  2LMC B;  5IIF A;  4BS9 A;  3NUC A;  3EJI A;  2O4X A;  5CR3 A;  2QEJ C;  2BOS A;  4RWS C;  4X64 L;  1V8Q A;  1N32 Q;  1P16 A;  3CRL C;  1PHJ A;  1E0B A;  3CME A;  2AWN A;  3RZO B;  4RCO A;  4R4I A;  1YIJ A;  2MJ8 A;  5IP7 G;  2L55 A;  4EGV A;  4POG A;  2E2I B;  2DY7 A;  3TP6 A;  3S17 H;  2RCN A;  1LTG D;  1Y1W B;  1TXY A;  1BBW A;  5IYC H;  3CPW A;  4HIO A;  3VYR A;  4LUV A;  5GAE C;  4LUZ A;  2F0K A;  2EJM A;  3S1M H;  1SNO A;  3H09 A;  2OXP A;  3K0X A;  1I4H A;  5E3F A;  4TVA B;  3GTG H;  1HNW Q;  5A2Q E;  2F0W A;  4KD4 A;  3I4O A;  1IYV A;  4A3D G;  1BCP F;  2EJF C;  4DR6 L;  4ALP A;  2Z6B A;  1S3O A;  3OPO A;  1BCP D;  2KVM A;  5IOC A;  5JJZ A;  1A6X A;  4HCS A;  2B2U C;  3KYH C;  2IT1 A;  3U4Z A;  2K50 A;  4NPS A;  3BVZ A;  3DLL A;  4DR5 L;  2Q8R E;  4BBR H;  1CTM A;  5LMU L;  3V05 A;  2A68 C;  3KBG A;  1DOM A;  1F77 A;  4YHH Q;  1HR0 W;  1DON A;  4FXG C;  4K14 A;  4JV5 Q;  3BDO A;  3VR5 A;  1LT3 D;  2CH4 A;  4LMQ D;  1JB7 A;  3R8B A;  5DNF A;  3OW7 A;  1K83 B;  2HHH Q;  3RZD H;  2Z6K C;  4IZ8 A;  1ESR A;  4R9W A;  3A0J A;  4KV6 A;  4RGT A;  3K59 A;  5FLX L;  1LTA D;  1AE3 A;  2NTS A;  1STH A;  5IGC A;  4OWX B;  4BXX H;  3R93 A;  4DK1 A;  1VQ7 A;  1IHZ A;  3S15 H;  3WDN A;  3NEM A;  4L5S A;  3I55 A;  4EX5 A;  2I5H A;  3CC7 A;  2VS1 A;  2QGQ A;  1SRO A;  5HUR A;  1YHQ A;  1EYD A;  1VQJ A;  1Y8P B;  3AEV A;  5CC4 A;  3M7G A;  1GO3 E;  1X3P A;  2NN6 I;  4N8X 1;  4F88 A;  5J39 A;  1PXU A;  4GKK Q;  3M4O B;  1TWG B;  2ID0 A;  1PLF A;  3ICE A;  3JAM L;  3HP3 A;  2UUC Q;  3K58 A;  3NBH B;  1EIF A;  2N8N A;  1KD1 C;  1B44 D;  1PFS A;  1DGS A;  3D0F A;  2PYK A;  4NP5 A;  1EYG A;  3DEP A;  4IFD I;  3P20 A;  2K32 A;  1TWF B;  5LL6 S;  3GTP B;  2B2W C;  4KD3 A;  4EQ5 A;  2Q2U A;  2AMC B;  1AZP A;  2D9U A;  5C3W A;  1N8R C;  1D7Q A;  2XN9 C;  1JWM D;  1PH1 A;  2OEO A;  3VR4 A;  2VW9 A;  5T1G A;  3CCQ A;  4J6H A;  2AQ1 B;  4IOA A;  3HOU G;  4DAY B;  4A3M H;  1N33 Q;  1U5K A;  1GUN A;  1EU4 A;  1L0Y B;  1WTO A;  3L3O C;  2IJ0 A;  1BKB A;  4DAM A;  4AQY Q;  3GTM B;  5EKK A;  3IFD A;  1HTP A;  1YHA A;  4YY3 L;  1C48 A;  1U4L A;  4RMF A;  1K3B C;  1I5F A;  5COY A;  2M2L A;  4XQN A;  1F2L A;  1B2T A;  5E1F A;  3NBH A;  1VMP A;  3F1Z A;  4U68 A;  5IYC G;  1GJX A;  1SYE A;  1OTC A;  2RA4 A;  1IBK L;  3W3A A;  2L11 A;  1EOT A;  4A3L H;  2QF7 A;  3M4Q A;  1FD7 D;  1H9S B;  4OWT B;  5GAG C;  4DR2 Q;  2ZTC A;  1I4X A;  2N88 A;  4DAY A;  1HFN A;  2ZJR A;  2VUM B;  4FDB A;  1E1O A;  1A63 A;  2L5T A;  1EUJ A;  1KRT A;  5AJ3 Q;  2P5Z X;  1Y1V B;  4DGZ A;  4A3C H;  3QG1 A;  3MWY W;  4H44 C;  3DUZ A;  1E22 A;  2EYH A;  4HSP A;  1GUW A;  4IUQ A;  4JW0 A;  4BBR G;  3I4N H;  1VMC A;  1QWY A;  5KIX A;  5DM6 3;  4RGM A;  3E3X A;  2JA5 H;  4A3B B;  4Y7N H;  2OF1 A;  1IKL A;  4MHE A;  1K0R A;  2VY3 A;  1HA5 A;  3FKI H;  3KLS A;  1RL2 A;  4JYA L;  4A3J B;  2OQ0 A;  4ABN A;  1S40 A;  5L37 A;  2YTY A;  3QIA A;  5C4J H;  1LT5 D;  1UEB A;  1H9S A;  5FO7 B;  1DYQ A;  2V1C C;  4TSS A;  4I7Z C;  4JBW A;  1PZI D;  4OEM B;  4C3J G;  2A6H D;  4BA2 I;  3Q23 A;  3K5L A;  1A62 A;  1HNZ Q;  3NBI A;  1JE5 A;  1FYC A;  3A8J E;  2CCZ A;  1J5E L;  4A3G B;  2VL6 A;  3C46 A;  1K8G A;  1EY0 A;  1UWV A;  3ERQ A;  1AEX A;  3EN2 A;  3J81 L;  1TWH H;  5KGU A;  3I70 A;  2LXJ A;  5CYU A;  2BE5 D;  4CBV A;  2I5M X;  3LWU A;  4OO1 I;  2EOT A;  3CC2 A;  3BYY B;  2IHE A;  2R7F A;  1QZG A;  2AHO B;  3C1F A;  2AWO A;  4K5X A;  3PIP 3;  4IJH A;  1CQF A;  5G3L F;  4OIJ A;  2HDM A;  5NUC A;  2OCE A;  1ET6 A;  3PIP A;  1DOK A;  2HUG A;  1RIP A;  2L12 A;  5G3L D;  2XTI A;  3MFG A;  3I4M H;  1MIU A;  3HOW B;  3PO2 H;  2F0M A;  5EKL A; 
#chains in the Genus database with same CATH homology
 2FFK B;  2WB1 B;  1LT6 D;  1GOZ A;  1E2W A;  1PRT C;  3DHQ A;  3VR2 A;  1F9P A;  5C4H A;  4IUU A;  3DWA A;  3SXH A;  2O5J C;  4KY6 A;  2Z1C A;  3PIO 3;  3HOX B;  1BF4 A;  4XDX A;  3SK6 A;  1R4Q B;  4QUF A;  1KAB A;  4XYO A;  5C5L A;  1BBX C;  1JWU D;  5D3D A;  1W6K A;  2DNC A;  4PV1 C;  1CHQ D;  1I50 B;  3RMH A;  1PTO H;  2F0H A;  4QCL A;  3JAM E;  1CM9 A;  2EYO A;  4BWG B;  2NVQ B;  1SNP A;  5ISR A;  5CBE E;  1ICW A;  3D8G A;  3NP8 A;  5IT9 E;  3H0G B;  1M8A A;  4ZAI A;  5CGK A;  1JOQ A;  2D5D A;  4ODG A;  3TP8 A;  2PZT A;  1A2T A;  2AUK A;  4FXD A;  3DM1 A;  1LTS D;  4X3T A;  2EDG A;  1JQY D;  5EPL A;  1M4V A;  2F0P A;  2K01 A;  1YNN C;  1SYC A;  3A8K E;  4DNT B;  1F9S A;  4DN4 M;  3EQL C;  2QCP X;  1HUN A;  5D14 A;  1DCZ A;  4KY7 A;  2M00 A;  1KDA A;  3PUY A;  3PUV A;  4PMC A;  3BG3 A;  1G6Z A;  4O42 A;  2EYJ A;  3H6M A;  4UAI A;  2WKC A;  2F0G A;  2CW0 D;  1STY A;  1STE A;  3K5O A;  3Q6S A;  2NN6 H;  3J7A F;  2J4X A;  3K0Y A;  4DXG A;  2QIL A;  3R2T A;  3D3R A;  2A69 D;  4IFD H;  2K6A A;  1LV9 A;  2XWB B;  1SNQ A;  2B2V C;  5I9O A;  2SEB D;  1A3T A;  4CJ2 C;  3Q0A A;  4XYQ A;  4F8M A;  3D6C A;  2Q8T A;  3X3M A;  1Q12 A;  3RLF A;  1S5B D;  1TU2 B;  5C6A A;  1WD1 A;  5BN4 A;  2EY6 A;  3PV0 A;  1ONL A;  1SNC A;  3TZD A;  5D65 A;  1F2Z A;  2AQ2 B;  1KDC A;  1QCB D;  3WOE A;  1GUT A;  3WOF A;  2K05 A;  4RFB A;  4KHV A;  1D5M C;  4C1N I;  1Z47 A;  3H94 A;  4FF4 A;  3OWE B;  3GTO B;  1AW7 A;  5CV8 A;  1KLU D;  2RKS A;  3SK8 A;  2F0Q A;  3TP7 A;  3DEO A;  4A3D B;  1KDB A;  1ZXT A;  1HQR D;  2M9V A;  1SE3 A;  3OIP A;  2B2Y C;  2EJG C;  1U9R A;  3TME A;  1O80 A;  2SNS A;  3NQI A;  4JK1 C;  3TBI B;  1QJO A;  5ELC A;  4WOR A;  1QG7 A;  3L9A X;  2IX3 A;  4UDU C;  5EPK A;  1T5E A;  1RCV D;  3OMC A;  2EXZ A;  1B1Z A;  3EVQ A;  3PMF A;  3J7A V;  1PTO C;  1O78 A;  3C1E A;  3OHX C;  1FR3 A;  2CQA A;  3FEW X;  1YNJ C;  5CBA E;  4OO1 H;  4ZUI A;  1STB A;  5JVH 3;  1OO9 B;  3SK5 A;  2WII B;  4IFD G;  5CV6 A;  1G2T A;  3V96 A;  3FRP B;  4KY5 A;  3T53 B;  5FO9 B;  4TKO B;  2BE5 C;  1ILQ A;  2F4I A;  5KYI A;  2PCF B;  2B8G A;  3MVV A;  1VDZ A;  3S16 B;  5I6W A;  4YIJ A;  4C2M B;  1AP0 A;  2O2L D;  1LLR D;  2FIN B;  3GV3 A;  1D2B A;  3LWE A;  1ENA A;  3S1Q B;  3HOU B;  4G57 A;  1E2Z A;  1G8Z D;  4RGN A;  1MBY A;  1AN8 A;  5EBC A;  1NUC A;  3S17 B;  2G9H D;  4ZK9 B;  4OIK A;  4WRD A;  5TSS A;  3G6J B;  4LJZ C;  1PMR A;  5C0X I;  4OHJ A;  1B50 A;  1JB3 A;  1SEB D;  4XXE A;  5E4X A;  1GHK A;  3S1M B;  5AFW A;  1CI3 M;  3GTG B;  4XT3 B;  1UAP A;  3HGB A;  2R3Z A;  3HS0 C;  1KNA A;  2PZW A;  3T56 B;  2A6E C;  2NVY B;  1DD2 A;  1LAB A;  3FMC A;  3I8Z A;  4GZY C;  3MXU A;  1PRT B;  4BBR B;  1BXT A;  4CJ1 B;  4RKL A;  1LTI D;  4RA8 A;  2D62 A;  3BS1 A;  3RZD B;  2J0T D;  4S3S A;  2F03 A;  1NCV A;  4R8N A;  5C0X J;  4X3K A;  2VXW A;  5M9O A;  5LL6 X;  4EVO A;  4H13 C;  4OO1 G;  1CQV A;  1KAA A;  5BN5 A;  3S15 B;  4C3J B;  2F3V A;  2B2T C;  2KUM A;  2TMP A;  4DA2 A;  1SJH D;  2RDF A;  4V19 0;  5IGB A;  1RJT A;  3BVG A;  4R8I A;  1MSG A;  1CZW A;  1SYD A;  1JE4 A;  1Q1B A;  1TY0 A;  4NDX A;  4XT1 B;  1EU3 A;  3RUZ A;  1ZYR D;  3LNN A;  3BDL A;  1HCZ A;  3GP7 A;  3IFT A;  4LAA A;  1G29 1;  2PZU A;  3I91 A;  1X32 A;  2E75 C;  1I4P A;  5CV5 A;  3GO5 A;  1LTB D;  2OT2 A;  1D6E C;  4F87 A;  1IW7 C;  4IFD J;  1S4Z A;  3PUZ A;  3OMG A;  3MAQ A;  1Y8O B;  2PQE A;  3NXW A;  4IUR A;  5E4W C;  4TRD A;  3SR1 A;  1FNV A;  1L0X B;  3D6W A;  5I2Y A;  4QB4 A;  2RDH A;  1G2S A;  4ZUJ A;  1SND A;  5ELB A;  2X6L A;  2L0C A;  3NTI A;  3HKZ B;  1S5D D;  4K5V A;  3A56 A;  3KLS X;  4CKE A;  5EGT A;  2SNM A;  1A3V A;  2WP8 J;  1TT2 A;  2K5D A;  4M1U B;  1TVX A;  2NZ1 D;  1A15 A;  5I2X A;  2JA5 B;  1SMY D;  1JOK A;  3OOC A;  4IUT A;  4Y7N B;  3S2H B;  1F9R A;  3N6R A;  3FKI B;  1TS4 A;  1IKM A;  2PPB C;  3E5S A;  2JA6 B;  5C4J B;  4HN7 A;  3TZU A;  4EQN A;  3MC0 B;  5KRU A;  3BVM A;  3I73 A;  1EY8 A;  4CHT B;  3T16 A;  4I65 A;  1TQO A;  1SBB B;  2EPB A;  2Q8I B;  3U9O A;  3HEJ A;  1B4O A;  3GD7 A;  4MIU A;  4ZKB B;  2I46 A;  2O5I C;  3FVQ A;  5HGT A;  4KKU A;  2RQX A;  1H9M A;  2CVR A;  4ZKC B;  2WKD A;  4B9X A;  2KQ3 A;  4FF1 A;  5FLX E;  3I4M B;  1HUM A;  3PO2 B;  4XTC S;  3O13 A;  1STN A;  3GTQ B;  1SYG A;  2TSS A;  3ZYY X;  3J80 L;  2EYF A;  3IKJ A;  3A54 A;  4A3K B;  2X69 A;  1H9R A;  4B08 A;  2C9O A;  1WTP A;  4A3E B;  1BUV T;  1EY4 A;  1Q90 A;  3P1H A;  2WIN B;  2IPK D;  5C0X H;  1U4M A;  3BZD B;  1NSN S;  3E0J A;  1PTO B;  1C4Q A;  1CA5 A;  2Z8L A;  3K57 A;  2H1E A;  1MGS A;  3FPU B;  3NSW A;  4E6I A;  1AZQ A;  1QNU A;  1BCP C;  1TKW B;  2H4O A;  1PFN A;  3MXN A;  2A68 D;  5IOD A;  3HG9 A;  2B2Y A;  1JC7 A;  5CV4 A;  4KTA A;  5F2D A;  3NQT A;  3NTH A;  1RHP A;  2NWG A;  3S1N B;  1I4Q A;  1RF2 D;  2SDF A;  2KA7 A;  4A3I B;  2XIW A;  3PO3 B;  2MPM A;  1TWA B;  3SDZ A;  2BA1 A;  4WFN 3;  2KJX A;  4BY7 B;  3TSS A;  3TP5 A;  2I07 B;  2PW5 A;  3C2P A;  3K5M A;  3GTK B;  2E76 C;  1DJR D;  5C4X B;  1XX8 A;  1EIG A;  1FGB D;  1TII D;  1C8C A;  1EWH A;  1WCM B;  2E74 C;  5K5P A;  2K5W A;  1IYU A;  4Z9C B;  1V43 A;  2JEB I;  3EA6 A;  2EE1 A;  3VA5 A;  2IW3 A;  5A2Q L;  1PDQ A;  1FNW A;  3I4L A;  5CMD A;  3W2D A;  3VR3 A;  5T1I A;  4U67 3;  1ENF A;  5FO8 B;  1ENC A;  3J7Y W;  3QB3 A;  1D5X C;  4HR7 B;  3ND9 A;  1GUO A;  2EZV A;  1EY7 A;  4Q5V A;  4KMU C;  1HRJ A;  5FOB B;  1A3U A;  3J81 E;  2XVS A;  4DU9 A;  3NK9 A;  5ELE A;  2R7Z B;  1LAC A;  1IL8 A;  1VF7 A;  1SE2 A;  5C0X G;  4FO2 A;  4FF2 A;  5ELF A;  2WAQ B;  5C3E B;  2K5Q A;  5CV9 A;  3P75 A;  2B2U A;  4K6L A;  5A35 A;  5M5X B;  1I4R A;  3K5N A;  2NUC A;  4IAL A;  3AMU A;  4K5W A;  4KKS A;  2L9H A;  3CKI B;  2YYZ A;  5C4Z A;  1DXM A;  4K8I A;  1HA6 A;  2KED A;  3DWP A;  2HCI A;  4DXF A;  2AQ3 B;  3ERO A;  2JA8 B;  2FMC A;  2ZT9 C;  4G4K A;  2KOL A;  4A93 B;  1CK1 A;  1I3Q B;  2ICI A;  3G7L A;  1XWE A;  2K28 A;  2VNU D;  2NBF A;  3X3N A;  3GQB A;  1MI2 A;  3SHL A;  4NW2 A;  2NN6 G;  2A6H C;  4C3I G;  1TWC B;  1XYI A;  3D4D A;  3I72 A;  4WJW A;  5EKI A;  2JEA I;  2F0J A;  2F0E A;  2B2T A;  4X3U A;  2B2W A;  2JP1 A;  2PNR C;  1W6J A;  1HHV A;  5FKA C;  4F7X A;  4KKT A;  5KEE A;  3MFY A;  2DY8 A;  3MHB A;  4B9W A;  3MEH A;  3A55 A;  4DK0 A;  1VF5 C;  3NPP A;  1K8M A;  4J1M A;  4KHZ A;  1CT1 D;  3MXP A;  2E2J B;  1PRT F;  2KEE A;  1NR2 A;  2R93 B;  2XNA C;  2DNE A;  4RH6 A;  1PRT D;  3KK7 A;  5ELD A;  2XRQ D;  1EZ6 A;  5JPN C;  5KYL A;  1SJE D;  2F0I A;  5I9P A;  1J9O A;  2K1B A;  3TDQ A;  2MGS A;  3VYT A;  1CFM A;  1WTR A;  1STG A;  1GUS A;  2F0V A;  5I6Y A;  1PFM A;  5JAV A;  1WD0 A;  2IL8 A;  4QMG A;  1LTT D;  2F0T A;  3GTJ B;  1BQQ T;  5DM7 3;  1BR9 A;  3FPP A;  2ZXO A;  2NYZ D;  5EQ0 A;  5EJW A;  3OWF A;  1G91 A;  2Z4H A;  3KUP A;  4KJO A;  2BDO A;  2QDB A;  4DF7 A;  1RDP D;  2N55 A;  2PMZ B;  1SYF A;  3T51 B;  4KJN A;  1R9T B;  4N9P A;  1H9J A;  1EZ8 A;  1JOR A;  4FF3 A;  1O7L A;  2Z4I A;  4C3H G;  4IN3 A;  4TQU S;  1QIL A;  1PFB A;  4L6T B;  1QNK A;  4K6D A;  3NTK A;  4QIW B;  4CJ0 B;  2C5C A;  4J8Q A;  1V1O A;  1F9Q A;  2KCC A;  4XQJ A;  1BNZ A;  3DWQ A;  1I4G A;  3H91 A;  3SE0 A;  1YNN D;  5JEA J;  3SK4 A;  2B63 B;  2JXM B;  1WVL A;  1EY5 A;  2XRS D;  2BA0 A;  1EQV A;  1ILP A;  1LT4 D;  2HCC A;  2VB3 X;  4RHR A;  1CA6 A;  4EQP A;  1KLG D;  1PYW D;  2K03 A;  1X3Q A;  2DN8 A;  3I3C A;  1GXD C;  4CKC A;  2WV6 D;  3T4A C;  3NE5 B;  2F1M A;  2JE6 I;  2R6G A;  2CW0 C;  1D1I A;  1B3A A;  2Y0S B;  1T5X D;  4PMW A;  2B8F A;  1KNE A;  4Q0F A;  1SYB A;  4NKL A;  2RDG A;  3S9W A;  3H3V C;  3HOY B;  4RAU C;  3L7Z C;  2A69 C;  4XIG S;  1EEI D;  4OL7 A;  2F0S A;  1EFI D;  2HQE A;  1ZKO A;  1Q1E A;  1Z6H A;  3BDC A;  4ZLT F;  4AYB B;  5IT9 L;  4DAP A;  1NR4 A;  3EFX D;  2KEC A;  1FNU A;  1BCP B;  3F2U A;  1RKN A;  4BY1 B;  4CGY B;  1JCK B;  3MTS A;  1TS5 A;  1ET9 A;  4A3M B;  4BBS B;  1AFP A;  3V2T A;  3SVM A;  4QF4 A;  3CHB D;  1HFG A;  5I4D A;  1EYA A;  4HTH A;  2VB2 X;  5M3F B;  2J7Z A;  4LK1 C;  4O1N A;  1CHP D;  1UEA B;  3IAY A;  1NAP A;  2LFN A;  4A3F B;  4H7B A;  2NTT A;  1KTK A;  3K6O A;  5DEH A;  1U4R A;  2ICE C;  4FVM A;  2L4N A;  2IWH A;  4L8J A;  4RGO S;  1F2M A;  1HTL D;  5C5M A;  2XSC A;  2D2C C;  5M5Y B;  4IQZ A;  1B53 A;  1JR0 D;  1E2V A;  1EY9 A;  3NHH A;  2JYO A;  5IGE A;  1R4P B;  3GV6 A;  4FNF A;  4MN3 A;  1PZK D;  2WAC A;  3CQZ B;  1D1K A;  3I4N B;  2RSN A;  3VR6 A;  1DZ1 A;  2BCO A;  3NWS A;  1QOH A;  2FHT A;  5COR A;  3PUW A;  4HMJ A;  1ROD A;  1II3 A;  1GHJ A;  4K2L A;  2QKI C;  3QOL A;  4G7H C;  2E2H B;  2G9D A;  4DFA A;  2NB0 A;  1XXG A;  3QWN A;  2FMM A;  3S2D B;  1S5E D;  3MZ5 A;  3KLR A;  1I6V C;  2NVX B;  1PTO F;  3N52 A;  1K8O A;  3S1R B;  4N9T A;  1BO0 A;  1O7Z A;  1PTO D;  1EYC A;  4PMB A;  3HRZ C;  2B2V A;  4NMZ A;  1UNS A;  1YNJ D;  5IGG A;  1VCI A;  3URY A;  2ZXR A;  1WTV A;  4ILW A;  1BDO A;  2R61 A;  3A7A B;  1TWH B;  1HQM C;  3R2I A;  1Z7T A;  1OXT A;  2F0D A;  4IUN A;  4KN4 C;  5JVG 3;  4FYD A;  2F0O A;  2XWJ B;  5KNB A;  2EVB A;  5CV7 A;  4HMI A;  1D5Z C;  4IUP A;  3DMU A;  3CRK C;  2MP1 A;  2K7V A;  3AB9 A;  4QUC A;  2MHV A;  3VA7 A;  5FK9 C;  5JEA H;  2EY1 A;  2IX1 A;  3ONA B;  1OXV A;  3LX0 A;  3M4Y A;  1A2U A;  4HAE A;  1TR5 A;  4HSV A;  5IGD A;  4ID6 A;  3PUX A;  1EIH A;  1GUG A;  2EY2 A;  3Q22 A;  1J8I A;  2ENB A;  3QO2 A;  4DNR B;  1DOL A;  2LY7 A;  3NWT A;  2NVT B;  1UUP A;  1WTW A;  1QE6 A;  1QB5 D;  2LS0 1;  1Y69 U;  4ULL A;  4L63 B;  3HZX A;  2JSO A;  4KI0 A;  5EPJ A;  5BN3 A;  2A5H A;  2KCN A;  5J22 A;  1DM0 B;  4DAV A;  2F0F A;  1SAP A;  3GTL B;  2R92 B;  2A6E D;  1SDF A;  3BYT B;  1TY2 A;  4H0L C;  1EL0 A;  4K8J A;  2F0U A;  3FDT A;  1OXS C;  5K36 H;  3VYS A;  2RBM A;  1ZEQ X;  5KNC A;  3D4W A;  2EY5 A;  2RVL A;  3M3Y B;  1WTX A;  1MSH A;  1Q8I A;  1WTQ A;  1S5F D;  1H9K A;  1F2Y A;  2JA7 B;  1SE4 A;  4K2K A;  1RTO A;  3SEB A;  4C3I B;  3KF8 A;  3P7J A;  3ND8 A;  4ME5 A;  4HED A;  1TS3 A;  2KHS A;  4G7O C;  4CKB A;  1CZG A;  4PQX A;  4KK7 A;  2CHB D;  2FJ2 A;  3QJY A;  3OSO A;  3D4R A;  4EQO A;  1B9M A;  5C44 B;  2PO4 A;  1SNM A;  5JEA G;  2YU9 B;  1OXX K;  1EWC A;  1V1P B;  2A74 C;  4ZRZ A;  3VYU A;  4RHS A;  1EEF D;  1ZYR C;  1STA A;  5M5W B;  1RD9 D;  2F0L A;  3A7L A;  2A73 B;  3ITP A;  3MXG A;  3CU7 A;  1EY6 A;  1XTC D;  1SSO A;  1SFO B;  4RKB A;  4FP5 D;  3M85 A;  3I90 A;  5M3M B;  4C1N K;  1IW7 D;  1O7Y A;  5LHY 1;  1JIC A;  2LKV A;  4X3S A;  1PZJ D;  4XQQ A;  1LTR D;  3D31 A;  5JPM C;  3Q24 A;  4ZQ3 A;  1V1P A;  2K04 A;  3QOJ A;  4KN7 C;  3OIQ A;  3TN2 A;  5DAU A;  5IGF A;  3HOV B;  3A8I E;  3K7A B;  4C56 C;  3E6Z X;  4C3H B;  1S5C D;  3DXJ C;  3J80 E;  1EQT A;  5K36 G;  2SOB A;  3M7N A;  1HXY D;  5J1Z A;  4OGQ C;  3C3L A;  1RTN A;  1SMY C;  4V0B A;  1JOO A;  4RCN A;  2RSO A;  1B9N A;  2EYM A;  4HCE A;  2V4D A;  2E2D C;  1HPC A;  1LO5 D;  1JWS D;  1OXU A;  5JOB A;  1BOS A;  2EYL A;  2GA4 B;  2F0N A;  4P2C B;  2BDN A;  4BA1 I;  2X6G A;  3UI2 A;  4G7Z C;  3HOZ B;  1ESF A;  2MUY A;  2F3W A;  1ML0 D;  1Q3L A;  2ZXP A;  1MD2 D;  3AU7 A;  2K33 A;  1I6H B;  2IX0 A;  5EBD A;  2B39 A;  3R3O A;  4ZYS A;  4M8A A;  4PNY A;  2AUJ D;  1TS2 A;  2L1B A;  5KND A;  1Y8N B;  3IL8 A;  3MA2 B;  1U4P A;  4FXK C;  3KBX A;  3RD4 A;  3U9S A;  5C3X A;  2HDL A;  5D3I B;  1SXT A;  4IUV A;  3S14 B;  3T13 A;  2PW7 A;  2EYP A;  2LMC B;  5IIF A;  4BS9 A;  3NUC A;  3EJI A;  2O4X A;  5CR3 A;  2QEJ C;  2BOS A;  4RWS C;  1V8Q A;  3CRL C;  1E0B A;  2AWN A;  3RZO B;  4RCO A;  2MJ8 A;  2L55 A;  4EGV A;  2E2I B;  2DY7 A;  3TP6 A;  1LTG D;  1Y1W B;  3VYR A;  2F0K A;  2EJM A;  1SNO A;  3H09 A;  2OXP A;  5E3F A;  1I4H A;  5A2Q E;  2F0W A;  4KD4 A;  1IYV A;  1BCP F;  2EJF C;  3OPO A;  1BCP D;  2KVM A;  5IOC A;  5JJZ A;  1A6X A;  4HCS A;  2B2U C;  2IT1 A;  3BVZ A;  2Q8R E;  1CTM A;  3V05 A;  2A68 C;  3KBG A;  1DOM A;  1F77 A;  1DON A;  4FXG C;  4K14 A;  3BDO A;  3VR5 A;  1LT3 D;  4LMQ D;  3R8B A;  5DNF A;  3OW7 A;  1K83 B;  4IZ8 A;  1ESR A;  4R9W A;  4KV6 A;  4RGT A;  3K59 A;  5FLX L;  1LTA D;  2NTS A;  1STH A;  5IGC A;  3R93 A;  4DK1 A;  1IHZ A;  3WDN A;  5HUR A;  1EYD A;  1Y8P B;  5CC4 A;  3M7G A;  4F88 A;  1X3P A;  2NN6 I;  5J39 A;  3M4O B;  1PXU A;  1TWG B;  2ID0 A;  1PLF A;  3JAM L;  3HP3 A;  3K58 A;  1B44 D;  2PYK A;  4NP5 A;  3DEP A;  4IFD I;  3P20 A;  2K32 A;  1TWF B;  5LL6 S;  3GTP B;  2B2W C;  4KD3 A;  1AZP A;  2D9U A;  5C3W A;  2XN9 C;  1JWM D;  2OEO A;  3VR4 A;  5T1G A;  4J6H A;  2AQ1 B;  1GUN A;  1EU4 A;  1L0Y B;  1WTO A;  3L3O C;  2IJ0 A;  3GTM B;  5EKK A;  3IFD A;  1HTP A;  1C48 A;  1U4L A;  5COY A;  2M2L A;  4XQN A;  1F2L A;  1B2T A;  5E1F A;  3NBH A;  1VMP A;  4U68 A;  1GJX A;  1SYE A;  2RA4 A;  3W3A A;  2L11 A;  1EOT A;  2QF7 A;  1FD7 D;  1H9S B;  1I4X A;  2N88 A;  4DAY A;  1HFN A;  2VUM B;  2L5T A;  1Y1V B;  4DGZ A;  3QG1 A;  3MWY W;  4H44 C;  3DUZ A;  4HSP A;  2EYH A;  1GUW A;  4IUQ A;  1VMC A;  1QWY A;  5KIX A;  5DM6 3;  4RGM A;  4A3B B;  2OF1 A;  1IKL A;  4MHE A;  1HA5 A;  3KLS A;  4A3J B;  4ABN A;  3QIA A;  1LT5 D;  1H9S A;  5FO7 B;  1DYQ A;  4TSS A;  4I7Z C;  4JBW A;  1PZI D;  4C3J G;  2A6H D;  4BA2 I;  3Q23 A;  3K5L A;  3NBI A;  1FYC A;  3A8J E;  4A3G B;  3C46 A;  1EY0 A;  3ERQ A;  1AEX A;  3J81 L;  5KGU A;  3I70 A;  5CYU A;  2BE5 D;  4CBV A;  3LWU A;  4OO1 I;  2EOT A;  3BYY B;  3C1F A;  2AWO A;  4K5X A;  3PIP 3;  1CQF A;  5G3L F;  4OIJ A;  2HDM A;  5NUC A;  1ET6 A;  1DOK A;  2HUG A;  2L12 A;  5G3L D;  3MFG A;  3HOW B;  2F0M A;  5EKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...