2F0NA

Crystal structure of staphylococcal nuclease mutant l25i/i72l
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKIMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKLEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 39
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0nA00
2OF1A 4QF4A 4EQNA 1EY7A 1EZ8A 3PMFA 2EYMA 3EVQA 4ID6A 4LAAA 1A2TA 3R3OA 5C5MA 5IOCA 5KGUA 2NUCA 2QDBA 1EYCA 4MIUA 1SNDA 1TQOA 4G57A 3TP8A 5I9OA 3C1EA 4ODGA 4DGZA 3ITPA 2OXPA 4QB4A 5IGDA 3EJIA 2EXZA 4K14A 1KABA 4KY7A 1STGA 3QB3A 4KJNA 1A3UA 4WORA 5CR3A 5E3FA 4RKBA 4B9WA 1STBA 3EROA 4NKLA 5KYLA 3S9WA 2EY5A 1NUCA 5JAVA 4KHVA 3D4DA 4HMJA 4KV6A 4J1MA 3SHLA 5J1ZA 3P1HA 2F0DA 4NDXA 2KQ3A 3SR1A 5C3WA 4ZUJA 4F7XA 2EY1A 2F3VA 3D8GA 5NUCA 4IUNA 2F0SA 4RKLA 5ISRA 3BDLA 2F0OA 5IGFA 1STHA 3DMUA 3H6MA 2PYKA 5C4HA 3V2TA 1EY5A 5IODA 3NUCA 2OEOA 1A3VA 1STNA 4K5VA 2F0HA 3TP5A 2ENBA 1EY0A 4NP5A 2KHSA 1F2MA 4N9TA 3HEJA 2HQEA 4DFAA 2EYLA 4WRDA 4K5XA 4PMCA 4NMZA 1RKNA 4E6IA 5CV7A 4IZ8A 3SK5A 4EVOA 5IIFA 1STYA 2EY2A 2SNMA 4B9XA 4H7BA 4PMBA 3TP6A 1EY4A 5HURA 3QOLA 4HTHA 4K2LA 1EQVA 3HZXA 3TMEA 5DAUA 3E5SA 4KD4A 3T13A 5J22A 1AEXA 2PZWA 1TT2A 3MHBA 1SYEA 1A3TA 4KTAA 1JOQA 2EYPA 4DU9A 2F0IA 4DF7A 5CV6A 2SOBA 2F0QA 2EYOA 3LX0A 3OMCA 1SYCA 3NK9A 1KDAA 3T16A 5IGCA 4KJOA 2PZTA 3P75A 5CV4A 4KY6A 1STAA 1ENAA 4ME5A 3OWFA 4KY5A 3SXHA 3SK8A 2O4XA 5C3XA 1A2UA 1SYBA 4K2KA 4K5WA 1SNCA 4R8NA 5K5PA 5M9OA 4I65A 2F0EA 3D6CA 4OL7A 3BDCA 5I6WA 5IGGA 1SNPA 1SNOA 2F0WA 2RBMA 2F0KA 3ERQA 3MEHA 1EYAA 3OMGA 5JOBA 2F0TA 4IALA 2LKVA 4K8JA 2F0PA 5CC4A 4N9PA 4F8MA 5KEEA 1JOKA 3C1FA 1ENCA 1EYDA 2F0NA 1JOOA 3OSOA 4K6DA 4TRDA 3TP7A 5C4ZA 1EY9A 1TR5A 2F3WA 5HGTA 5F2DA 5EGTA 3QOJA 3NXWA 1U9RA 1NSNS 2EY6A 2EYFA 4PNYA 2RDFA 5DEHA 1EZ6A 1SYDA 2PQEA 2PZUA 1SNQA 1II3A 1KAAA 2EYJA 2F0LA 3MZ5A 3NHHA 3SK4A 1EY6A 4QMGA 1SYFA 1IHZA 4K8IA 2WACA 5KIXA 5CV9A 1KDBA 5IGBA 3MVVA 3D4WA 5KRUA 4HMIA 5CGKA 3NQTA 2F0VA 2F0MA 3SK6A 1SYGA 5KYIA 1SNMA 1F2ZA 2F0JA 4S3SA 5C5LA 5C6AA 2EYHA 5E1FA 2F0FA 1JORA 2M00A 3DHQA 4ZQ3A 5EKLA 5I6YA 5J39A 3U9OA 1F2YA 5EKKA 5CV8A 5CV5A 3MXPA 2PW7A 4EQOA 5IGEA 5I9PA 3NP8A 4EQPA 2PW5A 2F0UA 1EY8A 2RKSA 4KD3A 4YIJA 3RUZA 3VA5A 4ZUIA 1KDCA 2F0GA 2SNSA 4J6HA
chains in the Genus database with same CATH superfamily
4BXXH 4A3GH 4EQNA 4BBSB 1MJCA 2YTYA 1HTPA 2E2JH 2NBFA 4MIUA 2Z9HA 2N88A 3LWUA 4JI7Q 4ZKBB 5JJKA 3CCJA 4B9WA 3O13A 1AZPA 3I4MG 4HAEA 4HJ5A 2KCNA 3CHBD 2WAQE 3NEMA 5J1ZA 2AUJD 4TQUS 1JICA 1HPCA 2MUYA 3I3CA 1E1OA 3KLRA 1SEBD 4B3TL 2VQEQ 5M3MG 4KLKA 5C44H 4DN4M 4YCWA 3RN5A 1SLJA 1KLUD 1PRTC 1PTOB 4IURA 2BA1A 3UE1A 3T1HQ 4A3MH 4RFBA 4DXFA 5CBAE 2L15A 2L9HA 1HUMA 3GO5A 5C0XH 2B8FA 2CW0C 2IT1A 1Q8KA 3ONAB 1PH4A 4BY7H 4WJ3M 1ZEQX 2F0IA 3K58A 4DV7L 2D9UA 3FHWA 1Y1VG 4IFDJ 5A2QE 1T5XD 2ZXOA 2PZTA 3K7AH 3KBXA 4DAYB 1ENAA 1H9JA 2Q8IB 4UP8A 4XTCS 3X3NA 4A3KG 2DJFC 1NMFA 4IOCA 3J7AF 4A3EB 4IALA 3CCMA 4GKKL 4OO1G 1EWHA 5LMNW 5DM63 1J5EQ 3PCOB 3PUWA 4EGVA 1N34L 3I4NH 1EYDA 2JEBI 4XIGS 1VF5C 4RGTA 2VQFL 5EPKA 1B8AA 1VDZA 3M4OB 1HZAA 2E2HB 2JA5B 2RDFA 1I4QA 5T1GA 1H9MA 5IP9G 4G4KA 2I46A 2E2IH 4JI3Q 4A75A 4R1JA 2WB1B 3PF5A 2UUAQ 5CGKA 5CORA 4HSVA 2WV6D 5C6AA 4JV5Q 3KJPA 2L1BA 3BJUA 5E1FA 2M00A 5EKLA 4X65L 1PTOC 3PO3G 3QIAA 3OTOL 2HQLA 3S16B 3RZDB 2F0UA 4KD3A 4DV5L 2IX0A 1L0WA 2OF1A 4OHJA 4BY1G 2B63H 2MHVA 3GD7A 1V1QA 3STBC 3K7UC 1ZYRD 5EBDA 3CW2C 4C3IB 1U5KA 3D4DA 3RLOA 2WIIB 1XPOA 2WFWA 2E5LQ 5EPJA 3SR1A 5C3WA 1XYIA 3AU7A 1ONLA 3CQZH 4IUNA 2A6HD 4DV0Q 4L63B 4GNXB 2K5NA 3ULLA 2N78A 4M1UB 1WTWA 3BG3A 1VQDA 4FXKC 3HEJA 3QG1A 4DXGA 4A3IB 1N9WA 3E3XA 1LABA 4H7BA 1CQFA 1HA5A 1HNZL 4K2LA 3LGJA 1K83B 2HDMA 5I4DA 3U9SA 5FLXc 5J22A 2JA7G 4C3JG 1K8GA 1O78A 1DD2A 2LMCB 3S15H 3NK9A 1OO9B 3RNUA 3T1YL 4KN7C 1FGUA 4DR3L 1PH1A 1DZ1A 4IUPA 4A3FH 3A0JA 4I65A 1DJRD 3NPPA 3A74A 1B3QA 1DXMA 4LF9Q 1IYJB 1A62A 3HOUB 2KVMA 3FKIG 1CK1A 3W1GA 5AJ3Q 1ZXTA 1E0BA 3TS2A 5LMUQ 2UXCL 3E9HA 3L9AX 1YZ6A 3PIOA 4X64L 2QF7A 3F2DA 1TXYA 2Q2UA 1SYDA 4FXDA 2H1EA 5GAGC 4P72A 1B1ZA 2KCMA 1F9SA 2ZTDA 1VQBA 2B29A 3DWQA 3S24A 4GNXC 1SYGA 4KI0A 4JI1L 4ZAIA 3J7ZC 3B6YA 1VF7A 1LT4D 2ZM6L 5EKKA 1AFPA 1KAWA 2KA7A 1VQFA 1VQCA 1EY8A 4B3SQ 2F03A 3K5OA 1TS4A 4ZUIA 3Q23A 5G3LF 3RLNA 3PF4A 3R3OA 5ELFA 2F1MA 2JEAI 4R4OA 4A93H 5E3FA 1A3UA 1F9PA 3HOYG 3KBGA 4JOIA 2H4OA 4JYAQ 1N32Q 3NBHA 3JAML 1MIUA 1T5EA 3PO2B 1K3RA 2LY7A 3SHLA 3H3VC 5HGQA 1XMQL 2ES2A 4F7XA 1E24A 2KCTA 1PH6A 3NWSA 1X56A 2A19A 4P71A 2K52A 5ELDA 1Y8NB 1EEID 3DMUA 1XNQQ 1KTKA 4OONA 5IODA 1S4ZA 1NR4A 3HOZB 3KK7A 5C4JB 4AYBG 3KF6B 1SRUA 2NTTA 3F2CA 5IYCG 2BE5C 1NE3A 2NN6I 3RZOH 3R93A 1Y1WH 5M5XB 4DV6L 1IW7D 5M5YH 4A3JG 1RTOA 2UXBL 3T16A 3IFTA 4DNTB 2KBNA 4OX9L 5M3MH 3BDCA 1EOVA 2NVQH 3K6OA 3K5MA 1IZ6A 1IBKQ 3GTQH 4H13C 4BBRH 5CC4A 2CFMA 1X3EA 2ATWA 1FYCA 4N8FA 4G7OC 1IKLA 3A8KE 3N6RA 1QUQA 4QCLA 4X6AH 2MGSA 5JPNC 2Y0SB 4B3RL 5M5WB 4K8IA 1PFSA 2QGQA 4JOIC 1Y1VH 4ZLTF 3SDZA 2B2WC 5EPLA 2F0MA 1HTLD 5C4XB 3GQBA 1QE6A 5C5LA 1VQLA 3U9OA 4EQOA 4DAVA 1BCPF 4JBMA 1ZYRC 4OO1H 5AFWA 4WJ4A 1TWFB 1FJGL 2E76C 1RL2A 1EY7A 5C5MA 2OTJA 1HFNA 2Z4HA 1YEZA 3BZDB 1CHQD 1B2TA 3WWVA 2JYOA 1K8AC 2P5ZX 2ZJQA 5IP9H 5JEAG 1STBA 2IPKD 1S5FD 4KHZA 2UUBQ 4KKSA 3DWAA 1L1OA 4KV6A 4JBJA 2A6HC 4R4CA 1HNWQ 3X3MA 4UP9A 2JXMB 1C8CA 1PFMA 3SVMA 4IUTA 3PO3H 1XMOQ 5D14A 4HJ8A 1HUNA 1A3VA 5TSSA 1PFNA 4HJAA 2O2LD 4PZ6A 4YHHQ 4N9TA 3G7LA 4DV1L 4DK3C 1S5ED 5BN3A 4QY7A 2QKIC 5IIFA 2YU9H 1FNVA 4PMBA 3TP6A 2O5JC 1EY4A 3S14H 1HZBA 1ZKOA 3HKZE 4LF7Q 4KHPL 3S2DB 4KD4A 3T13A 3H09A 3IL8A 5JJZA 1JOQA 1WD1A 1K8OA 5ELOA 4PQXA 1OXSC 2MQHA 4K0KQ 5G3LD 1KRTA 5C3EB 4JI5L 4K2KA 5BR8Q 2K05A 4BBSG 4JW0A 2NVTB 1EFWA 1EQQA 2F0EA 2NN6G 2C5CA 4QUCA 1TS2A 4CDEC 2XRQD 4GKJL 3GTMB 1W6KA 4QIWB 5KEEA 3CCEA 1R4QB 3NENA 1GHJA 2A8VA 4YWMA 5IWAQ 2YYZA 5F2DA 4UY8C 1LT6D 2CKZB 2R93B 1I6VC 2OWOA 5ELCA 2EYJA 2CW0D 5IY0A 2UU9L 1D5MC 2JA7H 4C3JH 4Y7NB 3GTPH 1JJ2A 1PZKD 2A74C 4HMIA 3HOWB 3NQTA 4KKTA 2F0FA 4JPBW 4HIDA 2AWNA 3S17B 1EYGA 1MHWC 1XJVA 4IUQA 2K4KA 1N8RC 4RG1A 2GN5A 2K28A 3H3VI 3FKIH 3A54A 1CA6A 3I55A 2RF4A 2EIFA 1TWGB 2B3GA 4OXPA 3S1RH 2VY3A 1I4PA 4YWKA 5FLXE 1Q3LA 2N49A 2X6LA 4KJNA 4DUYL 2A69D 5BN5A 3S1MB 1C4QA 5JAVA 1W3SA 3AYHB 2Q2IA 4J1MA 4PG3A 2KQ3A 3A55A 2KCCA 1SAPA 1UE5A 4LWCA 4A3EG 3K81C 2ZTEA 1KL9A 2N8NA 3IRBA 3K5NA 3S1QH 1RCVD 1PTOD 3H6MA 4JK1C 5C4HA 2PCFB 2QA4A 4P75A 2IX3A 1KNEA 2XIWA 1JQYD 2D2CC 2KHSA 2KUMA 2JA5G 2LFNA 2B2TA 4JC0A 3R8BA 1NMGA 4DR1Q 1RJTA 2GA4B 3UDXA 5COYA 4LF4L 3STBD 2EY2A 1IW7C 4X3UA 2WB1G 1G2SA 1TWAH 2B2YC 1VQ7A 1B70B 1TY2A 4A3BB 1CUKA 1BCPD 3UDIA 1LO5D 2R7ZB 3L7ZC 1SMYC 4DR7L 1STAA 2AKWB 4ME5A 3KLSA 1BNZA 4LNQA 5GAHC 1LTGD 1H9SA 1P16A 3MXGA 4K5WA 1WTQA 3H0GH 5IGGA 1Z7TA 2E8GA 3J81L 4C3HH 1R9TH 2QILA 3U58A 3KYHC 1ET9A 4K6DA 4C3IG 2JA6B 1EQRA 2R7DA 3KLWA 2JA8H 4H0LC 3MWYW 4PZ7A 5JPMC 2K5VA 5IYCH 3E0EA 4DPGA 1EZ6A 4J8QA 1QNUA 4NB3A 1II3A 1QZHA 3GTOB 1JMCA 5JEAJ 2IJ0A 4APVA 4X3KA 1HR0L 2WACA 3TZDA 5KIXA 1C7YA 4A3DB 1CZGA 2RCFA 3OIQA 1UUPA 1WCMB 3CCQA 1GUGA 3M3YB 1YI2A 1D7QA 3DHQA 1G291 1GM5A 2NVXB 1PZJD 4R4TA 4X62L 2MO1A 1GOZA 5HY6A 4A3IG 1IL2A 4LF6Q 3TP8A 3RUZA 1KDCA 3I2ZA 2BH2A 4CDDC 5IOCA 3PMFA 3DLLA 4JI2L 1LUZA 1MBYA 1DOKA 3DWPA 2RSOA 3FEWX 4DR2L 1LYLA 1LLRD 1PA6A 4K14A 4KY7A 2TSSA 4B3TQ 3P20A 4WORA 3IAYA 1QVFA 2WKDA 4FP5D 5DM73 2ZT9C 4IPGA 1ASZA 3MA2B 4CKBA 1TIID 4BS9A 2G9HD 1VQ9A 3HOUG 2F3VA 1TY0A 2XTIA 4BWGB 2K5WA 3D6WA 4RKLA 2D0OA 1SJED 4DK6C 3VR5A 3J7YW 3FVQA 3D31A 2JK8A 3TP5A 2Z6KC 2L11A 1Y69U 3MXNA 2OT2A 3JAMc 1VQNA 1SROA 5IP7G 4DNIA 2PQAB 3E9IA 3CU7A 1EQVA 3HZXA 4GLVB 3TMEA 3K59A 4LF5L 5JEAH 4LF8Q 4UHVA 4DR5L 2PZWA 4LJZC 3MXNB 1DCZA 4XYQA 2NVYB 1Q8IA 1QZGA 2PPBC 3MTSA 1N34Q 3ERSX 3W2DA 3GTGH 1NCVA 4U68A 1SFOH 1TKWB 2J4XA 2R3ZA 1YNJD 3OWFA 2WP8J 3CC7A 1XNRQ 4DUZL 3MEHA 5K36G 2EQSA 2LKVA 2HIXA 2Z0SA 4DAYA 4DV3L 2R92B 2AWOA 3DM3A 2RSNA 3PO2G 2HT1A 3DUZA 2UUCQ 3QOJA 3SE0A 1AN8A 3NXWA 4P73A 4X66Q 3HOXG 1PYWD 2D5DA 2K6AA 3PIPA 4DR4L 1SSOA 1C9OA 1CSQA 1QJOA 2BE5D 1PH9A 4GLAC 1I94L 1EY6A 4OEMB 1IL8A 5FOBB 1J9OA 1BCPB 1IBLL 1JCKB 3H94A 1RD9D 2B63B 3D4WA 2BA0A 4ULLA 1OXVA 2QW7A 3NTKA 3HOZG 3ER0A 2A6ED 3LWEA 3K0XA 2YV5A 5IGEA 1ICFB 2NN6H 4JI7L 2JQOA 3G48A 4PV1C 4DV2Q 4EQ5A 2EJFC 1K8MA 3CRKC 1JWUD 1V43A 2XRSD 2M9VA 1PMRA 5EQ0A 1YNXA 1D2BA 1V1PB 2QDBA 2JJQA 2A69C 3GV6A 2CH4W 1KD1C 1OTCA 1ESFA 1STGA 2K03A 4XDXA 5CR3A 4LW1A 1U4MA 3Q8DA 4NKLA 2I07B 4JI4Q 1NNXA 1VQMA 2VQEL 1WTOA 3DEPA 3BVMA 4NDXA 1WTRA 1D6EC 1K0RA 3A56A 2EY1A 3MEFA 1YNND 4CJ2C 2SDFA 5IGFA 5FO9B 3AFQA 1EQTA 2OEOA 3NTHA 1UE7A 4EX5A 1B3AA 2DN8A 5T1IA 1PH7A 2F3IA 4HJ9A 1JWMD 5LMNQ 3S15B 2HD3A 2ZXPA 4WFN3 3NSWA 3T1YQ 3VR6A 2Y0SG 4DR3Q 2SNMA 1BCPC 1WFQA 4NXNQ 4GNXA 1X3PA 3DXJC 3KJOA 4IFDH 2RHQB 5C4XG 3PGZA 2YTXA 4JG2A 1I50B 4MHEA 2SOBA 4OIJA 1UNSA 3BYTB 1WTVA 1F9QA 3G6JB 1X3GA 3JC66 3VYRA 4A3EH 3MFGA 2O4XA 2TMPA 1SYBA 1SN8A 1X3QA 2XWJB 1M90C 1X6OA 1DONA 2KJXA 1LM0A 2F0PA 1VQHA 4N8X1 2JA5H 1KXLA 3H91A 4JI3L 1LTRD 1IBMQ 4HIOA 2UUAL 2PQEA 1PZID 2L4NA 2QDLA 3EN2A 3SK4A 4JV5L 2L5TA 2CQOA 2BCOA 4C1NI 3BZCA 2NZHA 2DY8A 3A8JE 2HCCA 3RZDH 3CC2A 3HG9A 3VR3A 3BYYB 2EYHA 3Q0AA 4A93B 3L3OC 2L55A 2ASBA 1X3FA 4IPDA 2MNAA 5LL6S 1XTCD 2D62A 1FR3A 3FPUB 4J6HA 1S3OA 1B7YB 2ZXRA 1MGSA 4C3IH 1XMQQ 1W2BA 4RGOS 1KQSA 2L0CA 2F4VQ 1VQ4A 4ODGA 2E5LL 3PUYA 3ITPA 4LFBQ 5JVG3 2EXZA 1AE2A 1G6ZA 4ME3A 3S9WA 4C56C 5KYLA 2OTLA 4RCNA 1O80A 1RTNA 5C3EG 4DV0L 2HHHQ 3P1HA 5JVH3 4IPCA 1E2WA 3I7FA 2DGYA 1O7ZA 4RGNA 1NR2A 1WTPA 5NUCA 3PUXA 2VNUD 2EXDA 3U4ZA 1CHPD 1Y1WB 4A3IH 1MSGA 4L5SA 1Y8PB 2R93G 5M5YB 2NB0A 1N33Q 4U673 2N3SA 4QL5A 2ZTCA 3QWNA 4WRDA 3G71A 3M9BA 3KDFA 1Q82C 3M85A 4LUVA 2B2WA 4IJHA 4JBWA 3Q24A 5IT9L 4NXMQ 3NWTA 5M3MB 2MFIA 3HOWG 2NVQB 3C46A 1SR3A 5BN4A 3KF6A 1A3TA 1YNJC 2WINB 4KTAA 3HGBA 4BBRB 3J80L 1MJEA 4FF1A 3H3VH 3K57A 3KDFB 1SE2A 2K75A 3PUVA 3TN2A 4LF9L 1XX8A 3ND8A 3MC0B 1XWEA 5AJ3L 3HOUH 3CCSA 2M2LA 5LMUL 1K73C 4HEDA 2K01A 1SNPA 2O5IC 1G6PA 3KFUA 1B50A 3CC4A 1N36Q 3S1NH 4K8JA 4N9PA 2CVRA 3C1FA 1ENCA 3OWEB 1HRJA 3OSOA 1AP0A 4ZRZA 4TRDA 1R4PB 2DJGC 1QWYA 3I4MH 2AQ2B 5IP7H 4LUOA 3NE5B 4F88A 2EYFA 5DEHA 5LHY1 1HHVA 3CP0A 4RCOA 5I2YA 3MZ5A 1PXUA 1KAAA 2ZJRA 2RHSB 1IHZA 2A6EC 1K3BC 1Q86C 3GTLH 1OXUA 3J81c 4B3SL 1SMYD 4DR6Q 2AUKA 4R8IA 3CAMA 1AH9A 1DYQA 5J39A 1TWHH 2NYZD 4YCVA 4C1NK 5CV8A 2IWHA 3VYUA 4XXEA 1F77A 4EQPA 4O42A 3GDEA 1PH3A 4QF4A 3UDFA 5M3FB 5KYIA 1N32L 3JAME 1O7YA 4FF2A 2CH4A 4KMUC 3PO2H 4A3BG 5I9OA 3HOXH 2EE1A 3EJIA 2R7ZG 4BA2I 1J6QA 1I6HB 4YY3Q 1V8QA 2VUMB 1RF2D 1YNNC 1XNQL 4HMJA 4AH6A 2F0DA 2K33A 4AQYQ 4A3KH 1H95A 5CBEE 1B4OA 1A8VA 2GVBA 1YHQA 1K9MC 5C4JH 3CXCA 4IPHA 3WOFA 1HXYD 4WJWA 3BDLA 5D65A 1I4XA 1WJJA 4KKUA 1G2TA 2JA6G 1E22A 1EY5A 1O7IA 2ZJPA 3HOVB 2ENBA 1PV4A 2K5HA 1RODA 4DFAA 2EYLA 1I4HA 2Q2HA 5IYBG 3PSIA 4K5XA 5M5XH 4B08A 4B9XA 1K0SA 3I91A 2CWPA 2B2VC 4A3DG 5FO8B 1WCMG 5CMDA 3FPPA 1GXDC 1I4RA 2QEJC 3U4VA 4JI6L 3VDYA 3LX0A 3BS1A 4RA8A 1IBKL 3VA7A 2HCIA 2V4DA 1TU2B 2KEDA 4IQZA 5I6WA 4BY1H 5E4WC 2PI2A 5JOBA 4DA2A 4AYBE 1WYDA 2K32A 1L0XB 3RLFA 3D0FA 3SEBA 2PMZE 1GUSA 4JI0Q 3M7NA 4XYOA 1EY9A 2C9OA 3TS0A 3WOEA 1BQQT 3IFDA 1BBUA 1TS5A 1NTGA 1SNQA 2GVAA 4GN4B 3SGIA 4HCEA 1BXTA 3F8TA 4LFCQ 2IX1A 1CKNB 1U4LA 1KNAA 4S3SA 4HR7B 4ZK9B 2XVSA 1WD0A 1TWFH 1CZWA 1QG7A 2XGTA 2K7VA 4V0BA 1PLFA 3S2HH 2B2YA 4DUYQ 1M4VA 1YJWA 1J8IA 4PZ8A 5KGUA 5E7NA 2VW9A 2IY5B 5FK9C 1T9HA 3GTKB 2UXDQ 2UUBL 1CSPA 1HNWL 4FF4A 1CA5A 4FXGC 3UI2A 5KNBA 3TEHB 3NQIA 1QNKA 4RHRA 1XMOL 4GN3B 4Q5VA 4H02A 3CKIB 1Q46A 5LL6X 1MSHA 1I3QH 4YHHL 1HR0W 1FNWA 4R9WA 2F0SA 1LTTD 1XPRA 2VB3X 2EVBA 2R92G 3AFPA 3MXUA 1A0IA 1HQRD 3V2TA 1TWCB 1G91A 5D3IB 2I5HA 4NP5A 1UE6A 5KNCA 3DM1A 5GAEC 3S2DH 4PMCA 4NMZA 4A76A 2PNRC 1GO3E 4IZ8A 1I4GA 4GLXA 2LXJA 2FMCA 1G51A 4C2MH 3CD6A 1A6XA 2B63G 2JP1A 1VQGA 3H0GB 4LFAL 5EAYA 4C3HB 1GUOA 1SYEA 1RDPD 5BR8L 4B3MQ 2NVTH 2RDGA 3KF8B 3TRZA 1GUTA 1BKBA 2VS1A 2JA8B 3C3LA 3HKZB 1LTBD 1D5XC 1PYBA 3GTMH 4DK0A 4CHTB 4ALPA 3D6CA 3GV3A 5IWAL 1HJPA 1UEBA 2F0TA 1WI5A 1B53A 4OELB 1JWSD 3CMAA 1UWVA 3OPOA 2F0NA 4ZKCB 2FFKB 5C4ZA 3HOYH 3CMEA 4CDFC 3TZUA 5EGTA 5DLQE 2G9DA 3AB9A 3PIO3 4POGA 3FDTA 1EEFD 2PZUA 4LUZA 2F0LA 4DV4Q 3I72A 1VQIA 3D4RA 1HNXQ 4ZYSA 2F0VA 2Z6KA 3WDNA 3DEOA 1DM0B 3P7JA 4KN4C 4L8JA 1NBWA 1X55A 3K80C 3MXPA 3N52A 4RWSC 2MPMA 3MFYA 1EUJA 1QVCA 2BOSA 4JI8L 5KNDA 1HFGA 4LAAA 4RMFA 2E2DC 1QVGA 2NUCA 1KRSA 1TQOA 3S1MH 4PMWA 1LTID 4DGZA 3UDGA 2N55A 2XNAC 4QB4A 5D3DA 4A3JH 4A3GB 4CJ0B 3CPWA 1JR0D 4A4IA 2E2JB 2DY7A 2FJ2A 5JJLA 1GVPA 1NUCA 3I73A 4KHVA 1X65A 2KHJA 4G7ZC 4CGYB 4HSPA 2VZAA 1S40A 3NBIA 1SE3A 1JE5A 3RMHA 4DR1L 2PYKA 4I7ZC 3ZYYX 1F2MA 4TVAB 2VXWA 4FVMA 4IUVA 1A63A 3GTGB 2A68D 1WTHA 3HRZC 5C44B 2AQ1B 4A3BH 1STYA 1GD7A 2R7ZH 4I7AA 3ICEA 4A3MB 5I2XA 3E5SA 3OYYA 1AEXA 1LT3D 4A93G 3GTJH 2EYOA 3J81E 3CCLA 1JB7A 5ELBA 5CV4A 2PQAA 4JCVE 1W6JA 2V1CC 3F1ZA 4BY7B 1VQJA 1SNCA 4DV7Q 2K50A 4ABNA 2JA6H 1DGSA 2RBMA 2NZOA 5A2QL 3K7AB 1Q12A 4CDCC 5IT9c 1WOCA 2AMCB 1M8AA 2HIVA 3GTOH 3TP7A 1JJGA 4NPSA 3J80c 2WB1E 5DNFA 1NSNS 1X32A 4GKKQ 4GOPB 4A3DH 3BVGA 2HUGA 1WCMH 2PO4A 1PH5A 3I4NB 3M3YH 2PNHA 2DUDA 2VQFQ 3HFZB 4O1NA 4UAIA 1YJ9A 2NVXH 1YITA 1STEA 2HDLA 5IGBA 1Y1WG 5KRUA 1BO0A 4LF6L 2Q2TA 3FMCA 3W1BA 4OGQC 3J81j 1F2ZA 2E2IB 4GS3A 4UDUC 4ZQ3A 2JA9A 4CKCA 1D1IA 1E2ZA 2YTVA 5CV5A 2PW7A 5ELEA 1WTXA 1ESRA 5I9PA 2PW5A 3EIVA 5GQOA 2B2UC 3E6ZX 5IGDA 4ID6A 4X65Q 1HZCA 3OW7A 1SNDA 3OTOQ 4BBRG 4DV5Q 4QGUA 1L2FA 2FMMA 1P8LA 3QB3A 3A5UA 2I0QA 3T56B 1GUNA 3HKSA 2OQKA 3TSSA 1LTSD 4QJFA 2Q8RE 4DAPA 3Q6SA 1V1PA 3HP3A 2A73B 4BBSH 2AQ3B 2MJ8A 3D3RA 2QEXA 1GUWA 5ISRA 1NY4A 3A8IE 2F52A 1EIYB 2F0HA 4YWLA 5FJ8G 3CQZB 1VS0A 3Q22A 4H44C 4GOPC 4LF8L 2CWAA 2ID0A 2NVYH 4HTHA 1MI2A 1ML0D 1SMXA 1ET6A 1XNRL 1AW7A 5CV6A 1F9RA 3AQQA 2F0QA 3T1HL 1PTOH 1MD2D 1JC7A 3QR8A 1HNZQ 2WAQB 4KJOA 1DOLA 4Q0FA 1O7LA 3VYTA 4KK7A 1A2UA 5M3FG 5M9OA 2R92H 1SBBB 4DNRB 4OL7A 4O2DA 2UUCL 3ERQA 3VYSA 4X66L 1LV9A 2D0PA 3CCUA 1YIJA 3ULPA 1LTAD 5E4XA 1D1KA 2XN9C 1JOKA 2MO0A 4A3FB 1C0AA 2A5HA 2Z8LA 2VUMG 1KHIA 1RHPA 1EIFA 2EY6A 1OXTA 1JE4A 4PNYA 5IE8A 2BDOA 1WVLA 1VQEA 2UXCQ 4IUUA 1J5EL 1BBWA 4X64Q 2K5QA 1CTMA 1QOHA 4DV2L 4G7HC 1ILPA 3HOVG 3M4OH 2JSOA 4V190 2E2HH 3M4QA 4BA1I 4O0AA 3ZJYC 3E0JA 4JI1Q 2F0GA 1FL0A 4A3CG 2R6GA 4JI4L 4L5TA 1EFID 2ZM6Q 4RHSA 4IOAA 1Y14B 1ENFA 1B9MA 2KHIA 1JB3A 3CF5A 5ELNA 3S16H 2EY5A 2Q8TA 5EBCA 3VR4A 5FLMG 4A3LG 4MZ9A 4ILWA 1YHAA 3M4YA 5LMNL 3OIPA 2EJGC 2F0OA 5A35A 1IYVA 4GN5A 2J7ZA 2A68C 2EJMA 4K5VA 2K5DA 4F87A 4NXNL 4OWWB 1EY0A 4OWTB 1Q81C 2VB2X 1DOMA 3RR5A 3W3AA 1SDFA 4P74A 3EBEA 3MAQA 1RKNA 1KIXA 4EVOA 1VMCA 4HIKA 1I50H 1CKOA 1LTLA 3OOCA 4Y52H 1CKMA 4GZYC 1Q7YC 1FVIA 4XQQA 3S1NB 3L2PA 4DU9A 5L37A 3JAMi 3RZOB 1TVXA 1BR9A 1KDAA 3P75A 3I4MB 1I5FA 3QJYA 4KY5A 4DV6Q 3SK8A 3F2BA 3J80i 2L12A 4R8NA 1K83H 4HCSA 4TKOB 3VR2A 1IBML 2UXBQ 1SNOA 2F0KA 3OMGA 1EU4A 1EYAA 3EA6A 2J0TD 1EIGA 4LK1C 3GTLB 3H15A 2Y0SE 4OX9Q 2F3WA 3GTQB 3TQYA 2NTSA 1VMPA 1TWHB 2CQAA 2XSCA 1Y8OB 5FKAC 3CCVA 4JVZA 3ND9A 3KLSX 4QMGA 3M4PA 4UP7A 1VQPA 3AMUA 1SXTA 1KDBA 2RA4A 2ICEC 1FNUA 1PRTF 1GJXA 3T53B 3W5OA 3HOXB 1XPUA 1H9RA 1RIPA 2EOTA 3LNNA 5C0XI 4B3RQ 1IKMA 1VQKA 4L5RC 1Y1VB 3FP9A 2Z4IA 2F4VL 1JT8A 3NP8A 2B2VA 4LFBL 2JN4A 4FNFA 3NBHB 1B9NA 3H0GG 4A3KB 1CQVA 3EVQA 1A2TA 4C3HG 1VQOA 2HHHL 2FINB 2OXPA 1BF4A 3GP7A 1U0LA 1ASYA 1FJGQ 2JA8G 4RKBA 3HKZG 3EROA 4DK1A 2X69A 1H9KA 1S5BD 4ZCKA 1M1KC 1N33L 5K36H 3D8GA 1EWIA 1VQAA 2KENA 4OIKA 1STHA 3U50C 4JYAL 3AEVA 2BDNA 1EOTA 1FGBD 2R7FA 5IT9E 4NXML 4JI6Q 3K5LA 3BDOA 4CJ1B 2HQEA 3K8AA 3PO3B 4CKEA 1OXXK 2CCZA 3J80E 5EKIA 2I5MX 2PI2E 1EWCA 1AE3A 3I8ZA 1S5CD 4RGMA 4X3TA 4BY1B 1BVSA 1SE4A 5DAUA 4DV1Q 4FO2A 1PTOF 2YU9B 2IW3A 3HOZH 1YBYA 5IYDG 1B44D 1UAPA 4HIMA 3S14B 3OMCA 4YCUA 5IGCA 1N36L 1XTDA 4KHPQ 1PFBA 1YVCA 4QIWE 1HCZA 4CBVA 4FDBA 1VQ8A 1Q90A 1QUQB 2A1AA 1E7ZA 5FJ8H 4IFDI 2EDGA 4BXXG 4A3GG 4F8MA 4JI5Q 5J3BA 1JOOA 3F2UA 2K14A 3KUPA 5GROA 1TR5A 5HGTA 2ICIA 1YHBA 1UEAB 3UE0A 2I5LX 4GKJQ 3BU2A 3S2HB 4DR6L 1NJIC 2E75C 2NZ1D 3PIP3 3EQLC 3I70A 2OCEA 5CV9A 2K1BA 1PH8A 2B39A 3BZKA 1L0YB 3SK6A 3GTPB 1SNMA 2JA7B 4C3JB 1Z6HA 2Z6BA 2UU9Q 2WKCA 4J15A 2NWGA 2BH8A 5I6YA 5M3FH 1F2YA 4XT3B 2AHOB 1E3PA 5C44G 1LT5D 1K28A 5M5WH 1JORA 1CKNA 4AIMA 4A3MG 1EZ8A 3A5ZB 1I6HH 2EYMA 1L1OB 4YY3L 5C4XH 1I3QB 2DNEA 3V96A 2VUMH 1FD7D 2IL8A 3FKIB 1F2LA 4R4QA 4AQYL 1ICWA 2CHBD 5EJWA 1KABA 1Q1EA 5C0XG 2IHEA 1ILQA 3QO2A 4BY7G 3V05A 3S1RB 2ALYB 4OWXB 1E1TA 2RDHA 4ZUJA 4K6LA 5FLXL 3HOVH 4JBKA 2XWBB 4C2MB 1Q1BA 1BDOA 2EPBA 2KECA 4LFAQ 1MKHA 3NUCA 1HH2P 4A3CH 3TDQA 1Z47A 3I4NG 3S1QB 1VCIA 4XT1B 3TBIB 1KLGD 4QQBX 4E6IA 5CV7A 1G8ZD 2Z1CA 2JE6I 3CCRA 2EZVA 2F4IA 1PRTD 3R2IA 3A7LA 5HURA 3QOLA 3TREA 3C2PA 3MHBA 1TT2A 2LS01 3NTIA 3CRLC 3G6EA 3BVZA 4LF4Q 5FLMH 1TWAB 4A3LH 3HOYB 1UE1A 1PDQA 3SXHA 4JI0L 5C3XA 2VL6A 5GADC 4FF3A 4LF7L 4M8AA 1L1OC 2F0WA 4XQJA 1BBXC 4DR7Q 1V9PA 3KF8A 4MN3A 5FO7B 2QCPX 2DNCA 3RD4A 4K0KL 1Z9FA 2LXKA 1QILA 4HJ7A 1CFMA 3K0YA 1E2VA 4HN7A 4LFCL 1R9TB 4XQNA 1U9RA 5C3EH 1LACA 1A15A 4AYBB 4L6TB 1QB5D 1TS3A 4MNOA 2PMZB 1VQ6A 1BOSA 1SYFA 1EL0A 1BUVT 4DKAC 1X54A 4IFDG 2MP1A 4X3SA 3MVVA 4JI8Q 2E74C 2R93H 1D5ZC 4L5QA 2FHTA 4A3JB 1HR0Q 1C48A 4IN3A 1SE8A 2UXDL 1IXRA 3GTKH 1SJHD 1S5DD 1VQ5A 3IKJA 1KC8C 2RKSA 4Y7NH 3VA5A 2SNSA 3J81i 1QCBD 1XXGA 4POFA 3HOWH 1HQMC 5JJIA 1EYCA 1X9NA 4G57A 4X62Q 3C1EA 1S72A 1EIHA 3T4AC 4DAMA 1PVOA 3S17H 3CPFA 3OW2A 3URYA 1CM9A 2WAQG 4JI2Q 2LSSA 2KOLA 4DR2Q 4FYDA 3R2TA 1TWCH 1TWGH 4RAUC 3I56A 1IYUA 1YJNA 4LMQD 4A3FG 2R61A 3J7A5 2KEEA 1D8LA 3M7GA 1STNA 3GTJB 1U4PA 1V1OA 2RQXA 3SK5A 4B3ML 1PH2A 3I4LA 2H5XA 4P2CB 1H9SB 1AZQA 1HZ9A 2FXQA 1CT1D 4IJLA 4OO1I 2EYPA 4DF7A 5H1SE 3FRPB 4MTNA 1SYCA 2B2UA 4Z9CB 4NW2A 2RCNA 1NAPA 4KY6A 4LF5Q 4DR5Q 2IHFA 3A7AB 4RH6A 5K5PA 2B8GA 1EU3A 3OHXC 3L0OA 1GKHA 3KOJA 1SFOB 1PHJA 4MTKA 4DV4L 1U4RA 3J7AV 1GHKA 4UPAA 4DUZQ 2X6GA 2K04A 3RN2A 1HNXL 1PRTB 2OQ0A 4IO9A 4R4IA 5C0XJ 3NHHA 4TSSA 4DV3Q 2B2TC 3EFXD 3HS0C 2SEBD 3PV0A 2C35B 5IYDH 3G4SA 4DR4Q 3PUZA 1JJCB 4QUFA 2G5DA 3NELA 3PQIA 4GOPA 2F0JA 1PYSB 3ULJA 1I94Q 1HA6A 3T51B 1IBLQ 5CYUA 1CI3M 5IYBH 3I4OA 4YIJA 2RVLA 3I90A
chains in the Genus database with same CATH topology
4EQNA 4BBSB 1HTPA 2NBFA 4MIUA 2N88A 3LWUA 4ZKBB 4B9WA 3O13A 1AZPA 4HAEA 2KCNA 3CHBD 5J1ZA 2AUJD 4TQUS 1JICA 1HPCA 2MUYA 3I3CA 3KLRA 1SEBD 4DN4M 1KLUD 1PRTC 1PTOB 4IURA 2BA1A 4RFBA 4DXFA 5CBAE 2L9HA 1HUMA 3GO5A 5C0XH 2B8FA 2CW0C 2IT1A 3ONAB 1ZEQX 2F0IA 3K58A 2D9UA 4IFDJ 5A2QE 1T5XD 2ZXOA 2PZTA 3KBXA 1ENAA 1H9JA 2Q8IB 4XTCS 3X3NA 3J7AF 4A3EB 4IALA 4OO1G 1EWHA 5DM63 3PUWA 4EGVA 1EYDA 2JEBI 4XIGS 1VF5C 4RGTA 5EPKA 1VDZA 3M4OB 2E2HB 2JA5B 2RDFA 1I4QA 5T1GA 1H9MA 4G4KA 2I46A 2WB1B 5CGKA 5CORA 4HSVA 2WV6D 5C6AA 2L1BA 5E1FA 2M00A 5EKLA 1PTOC 3QIAA 3S16B 3RZDB 2F0UA 4KD3A 2IX0A 2OF1A 4OHJA 2MHVA 3GD7A 1ZYRD 5EBDA 4C3IB 3D4DA 2WIIB 5EPJA 3SR1A 5C3WA 1XYIA 3AU7A 1ONLA 4IUNA 2A6HD 4L63B 4M1UB 1WTWA 3BG3A 4FXKC 3HEJA 3QG1A 4DXGA 4A3IB 1LABA 4H7BA 1CQFA 1HA5A 4K2LA 1K83B 2HDMA 5I4DA 3U9SA 5J22A 4C3JG 1O78A 1DD2A 2LMCB 3NK9A 1OO9B 4KN7C 1DZ1A 4IUPA 4I65A 1DJRD 3NPPA 1DXMA 3HOUB 2KVMA 1CK1A 1ZXTA 1E0BA 3L9AX 2QF7A 1SYDA 4FXDA 2H1EA 1B1ZA 1F9SA 3DWQA 1SYGA 4KI0A 4ZAIA 1VF7A 1LT4D 5EKKA 1AFPA 2KA7A 1EY8A 2F03A 3K5OA 1TS4A 4ZUIA 3Q23A 5G3LF 3R3OA 5ELFA 2F1MA 2JEAI 5E3FA 1A3UA 1F9PA 3KBGA 2H4OA 3NBHA 3JAML 1T5EA 3PO2B 2LY7A 3SHLA 3H3VC 4F7XA 3NWSA 5ELDA 1Y8NB 1EEID 3DMUA 1KTKA 5IODA 1S4ZA 1NR4A 3HOZB 3KK7A 5C4JB 2NTTA 2BE5C 2NN6I 3R93A 5M5XB 1IW7D 1RTOA 3T16A 3IFTA 4DNTB 3BDCA 3K6OA 3K5MA 4H13C 5CC4A 1FYCA 4G7OC 1IKLA 3A8KE 3N6RA 4QCLA 2MGSA 5JPNC 2Y0SB 5M5WB 4K8IA 4ZLTF 3SDZA 2B2WC 5EPLA 2F0MA 1HTLD 5C4XB 3GQBA 1QE6A 5C5LA 3U9OA 4EQOA 4DAVA 1BCPF 1ZYRC 4OO1H 5AFWA 1TWFB 2E76C 1EY7A 5C5MA 1HFNA 2Z4HA 3BZDB 1CHQD 1B2TA 2JYOA 5JEAG 1STBA 2IPKD 1S5FD 4KHZA 4KKSA 3DWAA 4KV6A 2A6HC 3X3MA 2JXMB 1C8CA 1PFMA 3SVMA 4IUTA 5D14A 1HUNA 1A3VA 5TSSA 1PFNA 2O2LD 4N9TA 3G7LA 1S5ED 5BN3A 2QKIC 5IIFA 1FNVA 4PMBA 3TP6A 2O5JC 1EY4A 1ZKOA 3S2DB 4KD4A 3T13A 3H09A 3IL8A 5JJZA 1JOQA 1WD1A 1K8OA 4PQXA 1OXSC 5G3LD 5C3EB 4K2KA 2NVTB 2K05A 2F0EA 2NN6G 2C5CA 4QUCA 1TS2A 2XRQD 3GTMB 1W6KA 4QIWB 5KEEA 1R4QB 1GHJA 2YYZA 5F2DA 1LT6D 2R93B 1I6VC 5ELCA 2EYJA 2CW0D 1D5MC 4Y7NB 1PZKD 2A74C 4HMIA 3HOWB 3NQTA 4KKTA 2F0FA 2AWNA 3S17B 4IUQA 2K28A 3A54A 1CA6A 1TWGB 1I4PA 5FLXE 1Q3LA 2X6LA 4KJNA 2A69D 5BN5A 3S1MB 1C4QA 5JAVA 4J1MA 2KQ3A 3A55A 2KCCA 1SAPA 3K5NA 1RCVD 1PTOD 3H6MA 4JK1C 5C4HA 2PCFB 2IX3A 1KNEA 2XIWA 1JQYD 2D2CC 2KHSA 2KUMA 2LFNA 2B2TA 3R8BA 1RJTA 2GA4B 5COYA 2EY2A 1IW7C 4X3UA 1G2SA 2B2YC 1TY2A 4A3BB 1BCPD 1LO5D 2R7ZB 3L7ZC 1SMYC 1STAA 4ME5A 3KLSA 1BNZA 1LTGD 1H9SA 3MXGA 4K5WA 1WTQA 5IGGA 1Z7TA 3J81L 2QILA 1ET9A 4K6DA 4C3IG 2JA6B 4H0LC 3MWYW 5JPMC 1EZ6A 4J8QA 1QNUA 1II3A 3GTOB 5JEAJ 2IJ0A 4X3KA 2WACA 3TZDA 5KIXA 4A3DB 1CZGA 3OIQA 1UUPA 1WCMB 1GUGA 3M3YB 3DHQA 1G291 2NVXB 1PZJD 1GOZA 3TP8A 3RUZA 1KDCA 5IOCA 3PMFA 1MBYA 1DOKA 3DWPA 2RSOA 3FEWX 1LLRD 4K14A 4KY7A 2TSSA 3IAYA 3P20A 4WORA 2WKDA 4FP5D 5DM73 2ZT9C 3MA2B 4CKBA 1TIID 4BS9A 2G9HD 2F3VA 1TY0A 4BWGB 2K5WA 3D6WA 4RKLA 1SJED 3VR5A 3J7YW 3FVQA 3D31A 3TP5A 2L11A 1Y69U 3MXNA 2OT2A 3CU7A 1EQVA 3HZXA 3TMEA 3K59A 5JEAH 2PZWA 4LJZC 1DCZA 4XYQA 2NVYB 1Q8IA 2PPBC 3MTSA 3W2DA 1NCVA 4U68A 1TKWB 2J4XA 2R3ZA 1YNJD 3OWFA 2WP8J 3MEHA 5K36G 2LKVA 4DAYA 2R92B 2AWOA 2RSNA 3DUZA 3QOJA 3SE0A 1AN8A 3NXWA 1PYWD 2D5DA 2K6AA 1SSOA 1QJOA 2BE5D 1EY6A 1IL8A 5FOBB 1J9OA 1BCPB 1JCKB 3H94A 1RD9D 2B63B 3D4WA 2BA0A 4ULLA 1OXVA 3NTKA 2A6ED 3LWEA 5IGEA 2NN6H 4PV1C 2EJFC 1K8MA 3CRKC 1JWUD 1V43A 2XRSD 2M9VA 1PMRA 5EQ0A 1D2BA 1V1PB 2QDBA 2A69C 3GV6A 1ESFA 1STGA 2K03A 4XDXA 5CR3A 1U4MA 4NKLA 2I07B 1WTOA 3DEPA 3BVMA 4NDXA 1WTRA 1D6EC 3A56A 2EY1A 1YNND 4CJ2C 2SDFA 5IGFA 5FO9B 1EQTA 2OEOA 3NTHA 1B3AA 2DN8A 5T1IA 1JWMD 3S15B 2ZXPA 4WFN3 3NSWA 3VR6A 2SNMA 1BCPC 1X3PA 3DXJC 4IFDH 1I50B 4MHEA 2SOBA 4OIJA 1UNSA 3BYTB 1WTVA 1F9QA 3G6JB 3VYRA 3MFGA 2O4XA 2TMPA 1SYBA 1X3QA 2XWJB 1DONA 2KJXA 2F0PA 3H91A 1LTRD 2PQEA 1PZID 2L4NA 3SK4A 2L5TA 2BCOA 4C1NI 2DY8A 3A8JE 2HCCA 3HG9A 3VR3A 3BYYB 2EYHA 3Q0AA 4A93B 3L3OC 2L55A 5LL6S 1XTCD 2D62A 1FR3A 3FPUB 4J6HA 2ZXRA 1MGSA 4RGOS 2L0CA 4ODGA 3PUYA 3ITPA 5JVG3 2EXZA 1G6ZA 3S9WA 4C56C 5KYLA 4RCNA 1O80A 1RTNA 3P1HA 5JVH3 1E2WA 1O7ZA 4RGNA 1NR2A 1WTPA 5NUCA 3PUXA 2VNUD 1CHPD 1Y1WB 1MSGA 1Y8PB 5M5YB 2NB0A 4U673 3QWNA 4WRDA 3M85A 2B2WA 4JBWA 3Q24A 5IT9L 3NWTA 5M3MB 2NVQB 3C46A 5BN4A 1A3TA 1YNJC 2WINB 4KTAA 3HGBA 4BBRB 3J80L 4FF1A 3K57A 1SE2A 3PUVA 3TN2A 1XX8A 3ND8A 3MC0B 1XWEA 2M2LA 4HEDA 2K01A 1SNPA 2O5IC 1B50A 4K8JA 4N9PA 2CVRA 3C1FA 1ENCA 3OWEB 1HRJA 3OSOA 1AP0A 4ZRZA 4TRDA 1R4PB 1QWYA 2AQ2B 3NE5B 4F88A 2EYFA 5DEHA 5LHY1 1HHVA 4RCOA 5I2YA 3MZ5A 1PXUA 1KAAA 1IHZA 2A6EC 1OXUA 1SMYD 2AUKA 4R8IA 1DYQA 5J39A 2NYZD 4C1NK 5CV8A 2IWHA 3VYUA 4XXEA 1F77A 4EQPA 4O42A 4QF4A 5M3FB 5KYIA 3JAME 1O7YA 4FF2A 4KMUC 5I9OA 2EE1A 3EJIA 4BA2I 1I6HB 1V8QA 2VUMB 1RF2D 1YNNC 4HMJA 2F0DA 2K33A 5CBEE 1B4OA 3WOFA 1HXYD 4WJWA 3BDLA 5D65A 1I4XA 4KKUA 1G2TA 1EY5A 3HOVB 2ENBA 1RODA 4DFAA 2EYLA 1I4HA 4K5XA 4B08A 4B9XA 3I91A 2B2VC 5FO8B 5CMDA 3FPPA 1GXDC 1I4RA 2QEJC 3LX0A 3BS1A 4RA8A 3VA7A 2HCIA 2V4DA 1TU2B 2KEDA 4IQZA 5I6WA 5E4WC 5JOBA 4DA2A 2K32A 1L0XB 3RLFA 3SEBA 3M7NA 1GUSA 4XYOA 1EY9A 2C9OA 3WOEA 1BQQT 3IFDA 1TS5A 1SNQA 4HCEA 1BXTA 2IX1A 1U4LA 1KNAA 4S3SA 4HR7B 4ZK9B 2XVSA 1WD0A 1CZWA 1QG7A 2K7VA 4V0BA 1PLFA 2B2YA 1M4VA 1J8IA 5KGUA 5FK9C 3GTKB 4FF4A 1CA5A 4FXGC 3UI2A 5KNBA 3NQIA 1QNKA 4RHRA 4Q5VA 3CKIB 5LL6X 1MSHA 1FNWA 4R9WA 2F0SA 1LTTD 2VB3X 2EVBA 3MXUA 1HQRD 3V2TA 1TWCB 1G91A 5D3IB 4NP5A 5KNCA 3DM1A 4PMCA 4NMZA 2PNRC 4IZ8A 1I4GA 2FMCA 1A6XA 2JP1A 3H0GB 4C3HB 1GUOA 1SYEA 1RDPD 2RDGA 1GUTA 2JA8B 3C3LA 3HKZB 1LTBD 1D5XC 4DK0A 4CHTB 3D6CA 3GV3A 2F0TA 1B53A 1JWSD 3OPOA 2F0NA 4ZKCB 2FFKB 5C4ZA 3TZUA 5EGTA 2G9DA 3AB9A 3PIO3 3FDTA 1EEFD 2PZUA 2F0LA 3I72A 3D4RA 4ZYSA 2F0VA 3WDNA 3DEOA 1DM0B 3P7JA 4KN4C 4L8JA 3MXPA 3N52A 4RWSC 2MPMA 3MFYA 2BOSA 5KNDA 1HFGA 4LAAA 2E2DC 2NUCA 1TQOA 4PMWA 1LTID 4DGZA 2N55A 2XNAC 4QB4A 5D3DA 4A3GB 4CJ0B 1JR0D 2E2JB 2DY7A 2FJ2A 1NUCA 3I73A 4KHVA 4G7ZC 4CGYB 4HSPA 3NBIA 1SE3A 3RMHA 2PYKA 4I7ZC 3ZYYX 1F2MA 2VXWA 4FVMA 4IUVA 3GTGB 2A68D 3HRZC 5C44B 2AQ1B 1STYA 4A3MB 5I2XA 3E5SA 1AEXA 1LT3D 2EYOA 3J81E 5ELBA 5CV4A 1W6JA 4BY7B 1SNCA 4ABNA 2RBMA 5A2QL 3K7AB 1Q12A 1M8AA 3TP7A 5DNFA 1NSNS 1X32A 3BVGA 2HUGA 2PO4A 3I4NB 4O1NA 4UAIA 1STEA 2HDLA 5IGBA 5KRUA 1BO0A 3FMCA 4OGQC 1F2ZA 2E2IB 4UDUC 4ZQ3A 4CKCA 1D1IA 1E2ZA 5CV5A 5ELEA 2PW7A 1WTXA 1ESRA 5I9PA 2PW5A 2B2UC 3E6ZX 5IGDA 4ID6A 3OW7A 1SNDA 2FMMA 3QB3A 3T56B 1GUNA 3TSSA 1LTSD 2Q8RE 4DAPA 3Q6SA 1V1PA 3HP3A 2A73B 2AQ3B 2MJ8A 3D3RA 1GUWA 5ISRA 3A8IE 2F0HA 3CQZB 3Q22A 4H44C 2ID0A 4HTHA 1MI2A 1ML0D 1ET6A 1AW7A 5CV6A 1F9RA 2F0QA 1PTOH 1MD2D 1JC7A 2WAQB 4KJOA 1DOLA 4Q0FA 1O7LA 3VYTA 4KK7A 1A2UA 5M9OA 1SBBB 4DNRB 4OL7A 3ERQA 3VYSA 1LV9A 5E4XA 1LTAD 1D1KA 2XN9C 1JOKA 4A3FB 2A5HA 2Z8LA 1RHPA 2EY6A 1OXTA 1JE4A 4PNYA 2BDOA 1WVLA 4IUUA 2K5QA 1CTMA 1QOHA 4G7HC 1ILPA 2JSOA 4V190 4BA1I 3E0JA 2F0GA 2R6GA 1EFID 4RHSA 1ENFA 1B9MA 1JB3A 2EY5A 2Q8TA 5EBCA 3VR4A 4ILWA 3M4YA 2EJGC 3OIPA 2F0OA 5A35A 1IYVA 2J7ZA 2A68C 2EJMA 4K5VA 2K5DA 4F87A 1EY0A 2VB2X 1DOMA 3W3AA 1SDFA 3MAQA 1RKNA 4EVOA 1VMCA 3OOCA 4GZYC 4XQQA 3S1NB 4DU9A 3RZOB 1TVXA 1BR9A 1KDAA 3P75A 3I4MB 3QJYA 4KY5A 3SK8A 2L12A 4R8NA 4HCSA 4TKOB 3VR2A 1SNOA 2F0KA 3OMGA 1EU4A 1EYAA 3EA6A 2J0TD 1EIGA 4LK1C 3GTLB 2F3WA 3GTQB 2NTSA 1VMPA 1TWHB 2CQAA 2XSCA 1Y8OB 5FKAC 3ND9A 3KLSX 4QMGA 3AMUA 1SXTA 1KDBA 2RA4A 2ICEC 1FNUA 1PRTF 1GJXA 3T53B 3HOXB 1H9RA 2EOTA 3LNNA 5C0XI 1IKMA 1Y1VB 2Z4IA 3NP8A 2B2VA 4FNFA 1B9NA 4A3KB 1CQVA 3EVQA 1A2TA 4C3HG 2FINB 2OXPA 1BF4A 3GP7A 4RKBA 3EROA 4DK1A 2X69A 1H9KA 1S5BD 5K36H 3D8GA 4OIKA 1STHA 2BDNA 1EOTA 1FGBD 5IT9E 3K5LA 3BDOA 4CJ1B 2HQEA 3PO3B 4CKEA 1OXXK 3J80E 5EKIA 1EWCA 3I8ZA 1S5CD 4RGMA 4X3TA 4BY1B 1SE4A 5DAUA 4FO2A 1PTOF 2YU9B 2IW3A 1B44D 1UAPA 3S14B 3OMCA 5IGCA 1PFBA 1HCZA 4CBVA 1Q90A 4IFDI 2EDGA 4F8MA 1JOOA 3F2UA 3KUPA 1TR5A 5HGTA 2ICIA 1UEAB 3S2HB 2E75C 2NZ1D 3PIP3 3EQLC 3I70A 5CV9A 2K1BA 2B39A 3SK6A 1L0YB 3GTPB 1SNMA 2JA7B 4C3JB 1Z6HA 2WKCA 2NWGA 5I6YA 1F2YA 4XT3B 1LT5D 1JORA 1EZ8A 2EYMA 1I3QB 2DNEA 3V96A 1FD7D 2IL8A 3FKIB 1F2LA 1ICWA 2CHBD 5EJWA 1KABA 1Q1EA 5C0XG 1ILQA 3QO2A 3V05A 3S1RB 2RDHA 4ZUJA 4K6LA 5FLXL 2XWBB 4C2MB 1Q1BA 1BDOA 2EPBA 2KECA 3NUCA 3TDQA 1Z47A 3S1QB 1VCIA 4XT1B 3TBIB 1KLGD 4E6IA 5CV7A 1G8ZD 2Z1CA 2JE6I 2EZVA 2F4IA 1PRTD 3R2IA 3A7LA 5HURA 3QOLA 3C2PA 3MHBA 1TT2A 2LS01 3NTIA 3CRLC 3BVZA 1TWAB 3HOYB 1PDQA 3SXHA 5C3XA 4FF3A 4M8AA 2F0WA 4XQJA 1BBXC 3KF8A 4MN3A 5FO7B 2QCPX 2DNCA 3RD4A 1QILA 1CFMA 3K0YA 1E2VA 4HN7A 1R9TB 4XQNA 1U9RA 1LACA 1A15A 4AYBB 4L6TB 1QB5D 1TS3A 2PMZB 1BOSA 1SYFA 1EL0A 1BUVT 4IFDG 2MP1A 4X3SA 3MVVA 2E74C 1D5ZC 4A3JB 2FHTA 1C48A 4IN3A 1SJHD 1S5DD 3IKJA 2RKSA 3VA5A 2SNSA 1QCBD 1XXGA 1HQMC 1EYCA 4G57A 3C1EA 1EIHA 3T4AC 3URYA 1CM9A 2KOLA 4FYDA 3R2TA 4RAUC 1IYUA 4LMQD 2R61A 2KEEA 3M7GA 1STNA 3GTJB 1U4PA 1V1OA 2RQXA 3SK5A 3I4LA 4P2CB 1H9SB 1AZQA 4OO1I 1CT1D 2EYPA 4DF7A 3FRPB 1SYCA 2B2UA 4Z9CB 4NW2A 1NAPA 4KY6A 3A7AB 4RH6A 5K5PA 2B8GA 1EU3A 3OHXC 1SFOB 3J7AV 1U4RA 1GHKA 2X6GA 2K04A 1PRTB 5C0XJ 3NHHA 4TSSA 2B2TC 3EFXD 3HS0C 2SEBD 3PV0A 3PUZA 4QUFA 2F0JA 1HA6A 3T51B 5CYUA 1CI3M 4YIJA 2RVLA 3I90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OF1 A;  4QF4 A;  4EQN A;  1EY7 A;  1EZ8 A;  3PMF A;  2EYM A;  3EVQ A;  4ID6 A;  4LAA A;  1A2T A;  3R3O A;  5C5M A;  5IOC A;  5KGU A;  2NUC A;  2QDB A;  1EYC A;  4MIU A;  1SND A;  1TQO A;  4G57 A;  3TP8 A;  5I9O A;  3C1E A;  4ODG A;  4DGZ A;  3ITP A;  2OXP A;  4QB4 A;  5IGD A;  3EJI A;  2EXZ A;  4K14 A;  1KAB A;  4KY7 A;  1STG A;  3QB3 A;  4KJN A;  1A3U A;  4WOR A;  5CR3 A;  5E3F A;  4RKB A;  4B9W A;  1STB A;  3ERO A;  4NKL A;  5KYL A;  3S9W A;  2EY5 A;  1NUC A;  5JAV A;  4KHV A;  3D4D A;  4HMJ A;  4KV6 A;  4J1M A;  3SHL A;  5J1Z A;  3P1H A;  2F0D A;  4NDX A;  2KQ3 A;  3SR1 A;  5C3W A;  4ZUJ A;  4F7X A;  2EY1 A;  2F3V A;  3D8G A;  5NUC A;  4IUN A;  2F0S A;  4RKL A;  5ISR A;  3BDL A;  2F0O A;  5IGF A;  1STH A;  3DMU A;  3H6M A;  2PYK A;  5C4H A;  3V2T A;  1EY5 A;  5IOD A;  3NUC A;  2OEO A;  1A3V A;  1STN A;  4K5V A;  2F0H A;  3TP5 A;  2ENB A;  1EY0 A;  4NP5 A;  2KHS A;  1F2M A;  4N9T A;  3HEJ A;  2HQE A;  4DFA A;  2EYL A;  4WRD A;  4K5X A;  4PMC A;  4NMZ A;  1RKN A;  4E6I A;  5CV7 A;  4IZ8 A;  3SK5 A;  4EVO A;  5IIF A;  1STY A;  2EY2 A;  2SNM A;  4B9X A;  4H7B A;  4PMB A;  3TP6 A;  1EY4 A;  5HUR A;  3QOL A;  4HTH A;  4K2L A;  1EQV A;  3HZX A;  3TME A;  5DAU A;  3E5S A;  4KD4 A;  3T13 A;  5J22 A;  1AEX A;  2PZW A;  1TT2 A;  3MHB A;  1SYE A;  1A3T A;  4KTA A;  1JOQ A;  2EYP A;  4DU9 A;  2F0I A;  4DF7 A;  5CV6 A;  2SOB A;  2F0Q A;  2EYO A;  3LX0 A;  3OMC A;  1SYC A;  3NK9 A;  1KDA A;  3T16 A;  5IGC A;  4KJO A;  2PZT A;  3P75 A;  5CV4 A;  4KY6 A;  1STA A;  1ENA A;  4ME5 A;  3OWF A;  4KY5 A;  3SXH A;  3SK8 A;  2O4X A;  5C3X A;  1A2U A;  1SYB A;  4K2K A;  4K5W A;  1SNC A;  4R8N A;  5K5P A;  5M9O A;  4I65 A;  2F0E A;  3D6C A;  4OL7 A;  3BDC A;  5I6W A;  5IGG A;  1SNP A;  1SNO A;  2F0W A;  2RBM A;  2F0K A;  3ERQ A;  3MEH A;  1EYA A;  3OMG A;  5JOB A;  2F0T A;  4IAL A;  2LKV A;  4K8J A;  2F0P A;  5CC4 A;  4N9P A;  4F8M A;  5KEE A;  1JOK A;  3C1F A;  1ENC A;  1EYD A;  2F0N A;  1JOO A;  3OSO A;  4K6D A;  4TRD A;  3TP7 A;  5C4Z A;  1EY9 A;  1TR5 A;  2F3W A;  5HGT A;  5F2D A;  5EGT A;  3QOJ A;  3NXW A;  1U9R A;  1NSN S;  2EY6 A;  2EYF A;  4PNY A;  2RDF A;  5DEH A;  1EZ6 A;  1SYD A;  2PQE A;  2PZU A;  1SNQ A;  1II3 A;  1KAA A;  2EYJ A;  2F0L A;  3MZ5 A;  3NHH A;  3SK4 A;  1EY6 A;  4QMG A;  1SYF A;  1IHZ A;  4K8I A;  2WAC A;  5KIX A;  5CV9 A;  1KDB A;  5IGB A;  3MVV A;  3D4W A;  5KRU A;  4HMI A;  5CGK A;  3NQT A;  2F0V A;  2F0M A;  3SK6 A;  1SYG A;  5KYI A;  1SNM A;  1F2Z A;  2F0J A;  4S3S A;  5C5L A;  5C6A A;  2EYH A;  5E1F A;  2F0F A;  1JOR A;  2M00 A;  3DHQ A;  4ZQ3 A;  5EKL A;  5I6Y A;  5J39 A;  3U9O A;  1F2Y A;  5EKK A;  5CV8 A;  5CV5 A;  3MXP A;  2PW7 A;  4EQO A;  5IGE A;  5I9P A;  3NP8 A;  4EQP A;  2PW5 A;  2F0U A;  1EY8 A;  2RKS A;  4KD3 A;  4YIJ A;  3RUZ A;  3VA5 A;  4ZUI A;  1KDC A;  2F0G A;  2SNS A;  4J6H A; 
#chains in the Genus database with same CATH topology
 4BXX H;  4A3G H;  4EQN A;  4BBS B;  1MJC A;  2YTY A;  1HTP A;  2E2J H;  2NBF A;  4MIU A;  2Z9H A;  2N88 A;  3LWU A;  4JI7 Q;  4ZKB B;  5JJK A;  3CCJ A;  4B9W A;  3O13 A;  1AZP A;  3I4M G;  4HAE A;  4HJ5 A;  2KCN A;  3CHB D;  2WAQ E;  3NEM A;  5J1Z A;  2AUJ D;  4TQU S;  1JIC A;  1HPC A;  2MUY A;  3I3C A;  1E1O A;  3KLR A;  1SEB D;  4B3T L;  2VQE Q;  5M3M G;  4KLK A;  5C44 H;  4DN4 M;  4YCW A;  3RN5 A;  1SLJ A;  1KLU D;  1PRT C;  1PTO B;  4IUR A;  2BA1 A;  3UE1 A;  3T1H Q;  4A3M H;  4RFB A;  4DXF A;  5CBA E;  2L15 A;  2L9H A;  1HUM A;  3GO5 A;  5C0X H;  2B8F A;  2CW0 C;  2IT1 A;  1Q8K A;  3ONA B;  1PH4 A;  4BY7 H;  4WJ3 M;  1ZEQ X;  2F0I A;  3K58 A;  4DV7 L;  2D9U A;  3FHW A;  1Y1V G;  4IFD J;  5A2Q E;  1T5X D;  2ZXO A;  2PZT A;  3K7A H;  3KBX A;  4DAY B;  1ENA A;  1H9J A;  2Q8I B;  4UP8 A;  4XTC S;  3X3N A;  4A3K G;  2DJF C;  1NMF A;  4IOC A;  3J7A F;  4A3E B;  4IAL A;  3CCM A;  4GKK L;  4OO1 G;  1EWH A;  5LMN W;  5DM6 3;  1J5E Q;  3PCO B;  3PUW A;  4EGV A;  1N34 L;  3I4N H;  1EYD A;  2JEB I;  4XIG S;  1VF5 C;  4RGT A;  2VQF L;  5EPK A;  1B8A A;  1VDZ A;  3M4O B;  1HZA A;  2E2H B;  2JA5 B;  2RDF A;  1I4Q A;  5T1G A;  1H9M A;  5IP9 G;  4G4K A;  2I46 A;  2E2I H;  4JI3 Q;  4A75 A;  4R1J A;  2WB1 B;  3PF5 A;  2UUA Q;  5CGK A;  5COR A;  4HSV A;  2WV6 D;  5C6A A;  4JV5 Q;  3KJP A;  2L1B A;  3BJU A;  5E1F A;  2M00 A;  5EKL A;  4X65 L;  1PTO C;  3PO3 G;  3QIA A;  3OTO L;  2HQL A;  3S16 B;  3RZD B;  2F0U A;  4KD3 A;  4DV5 L;  2IX0 A;  1L0W A;  2OF1 A;  4OHJ A;  4BY1 G;  2B63 H;  2MHV A;  3GD7 A;  1V1Q A;  3STB C;  3K7U C;  1ZYR D;  5EBD A;  3CW2 C;  4C3I B;  1U5K A;  3D4D A;  3RLO A;  2WII B;  1XPO A;  2WFW A;  2E5L Q;  5EPJ A;  3SR1 A;  5C3W A;  1XYI A;  3AU7 A;  1ONL A;  3CQZ H;  4IUN A;  2A6H D;  4DV0 Q;  4L63 B;  4GNX B;  2K5N A;  3ULL A;  2N78 A;  4M1U B;  1WTW A;  3BG3 A;  1VQD A;  4FXK C;  3HEJ A;  3QG1 A;  4DXG A;  4A3I B;  1N9W A;  3E3X A;  1LAB A;  4H7B A;  1CQF A;  1HA5 A;  1HNZ L;  4K2L A;  3LGJ A;  1K83 B;  2HDM A;  5I4D A;  3U9S A;  5FLX c;  5J22 A;  2JA7 G;  4C3J G;  1K8G A;  1O78 A;  1DD2 A;  2LMC B;  3S15 H;  3NK9 A;  1OO9 B;  3RNU A;  3T1Y L;  4KN7 C;  1FGU A;  4DR3 L;  1PH1 A;  1DZ1 A;  4IUP A;  4A3F H;  3A0J A;  4I65 A;  1DJR D;  3NPP A;  3A74 A;  1B3Q A;  1DXM A;  4LF9 Q;  1IYJ B;  1A62 A;  3HOU B;  2KVM A;  3FKI G;  1CK1 A;  3W1G A;  5AJ3 Q;  1ZXT A;  1E0B A;  3TS2 A;  5LMU Q;  2UXC L;  3E9H A;  3L9A X;  1YZ6 A;  3PIO A;  4X64 L;  2QF7 A;  3F2D A;  1TXY A;  2Q2U A;  1SYD A;  4FXD A;  2H1E A;  5GAG C;  4P72 A;  1B1Z A;  2KCM A;  1F9S A;  2ZTD A;  1VQB A;  2B29 A;  3DWQ A;  3S24 A;  4GNX C;  1SYG A;  4KI0 A;  4JI1 L;  4ZAI A;  3J7Z C;  3B6Y A;  1VF7 A;  1LT4 D;  2ZM6 L;  5EKK A;  1AFP A;  1KAW A;  2KA7 A;  1VQF A;  1VQC A;  1EY8 A;  4B3S Q;  2F03 A;  3K5O A;  1TS4 A;  4ZUI A;  3Q23 A;  5G3L F;  3RLN A;  3PF4 A;  3R3O A;  5ELF A;  2F1M A;  2JEA I;  4R4O A;  4A93 H;  5E3F A;  1A3U A;  1F9P A;  3HOY G;  3KBG A;  4JOI A;  2H4O A;  4JYA Q;  1N32 Q;  3NBH A;  3JAM L;  1MIU A;  1T5E A;  3PO2 B;  1K3R A;  2LY7 A;  3SHL A;  3H3V C;  5HGQ A;  1XMQ L;  2ES2 A;  4F7X A;  1E24 A;  2KCT A;  1PH6 A;  3NWS A;  1X56 A;  2A19 A;  4P71 A;  2K52 A;  5ELD A;  1Y8N B;  1EEI D;  3DMU A;  1XNQ Q;  1KTK A;  4OON A;  5IOD A;  1S4Z A;  1NR4 A;  3HOZ B;  3KK7 A;  5C4J B;  4AYB G;  3KF6 B;  1SRU A;  2NTT A;  3F2C A;  5IYC G;  2BE5 C;  1NE3 A;  2NN6 I;  3RZO H;  3R93 A;  1Y1W H;  5M5X B;  4DV6 L;  1IW7 D;  5M5Y H;  4A3J G;  1RTO A;  2UXB L;  3T16 A;  3IFT A;  4DNT B;  2KBN A;  4OX9 L;  5M3M H;  3BDC A;  1EOV A;  2NVQ H;  3K6O A;  3K5M A;  1IZ6 A;  1IBK Q;  3GTQ H;  4H13 C;  4BBR H;  5CC4 A;  2CFM A;  1X3E A;  2ATW A;  1FYC A;  4N8F A;  4G7O C;  1IKL A;  3A8K E;  3N6R A;  1QUQ A;  4QCL A;  4X6A H;  2MGS A;  5JPN C;  2Y0S B;  4B3R L;  5M5W B;  4K8I A;  1PFS A;  2QGQ A;  4JOI C;  1Y1V H;  4ZLT F;  3SDZ A;  2B2W C;  5EPL A;  2F0M A;  1HTL D;  5C4X B;  3GQB A;  1QE6 A;  5C5L A;  1VQL A;  3U9O A;  4EQO A;  4DAV A;  1BCP F;  4JBM A;  1ZYR C;  4OO1 H;  5AFW A;  4WJ4 A;  1TWF B;  1FJG L;  2E76 C;  1RL2 A;  1EY7 A;  5C5M A;  2OTJ A;  1HFN A;  2Z4H A;  1YEZ A;  3BZD B;  1CHQ D;  1B2T A;  3WWV A;  2JYO A;  1K8A C;  2P5Z X;  2ZJQ A;  5IP9 H;  5JEA G;  1STB A;  2IPK D;  1S5F D;  4KHZ A;  2UUB Q;  4KKS A;  3DWA A;  1L1O A;  4KV6 A;  4JBJ A;  2A6H C;  4R4C A;  1HNW Q;  3X3M A;  4UP9 A;  2JXM B;  1C8C A;  1PFM A;  3SVM A;  4IUT A;  3PO3 H;  1XMO Q;  5D14 A;  4HJ8 A;  1HUN A;  1A3V A;  5TSS A;  1PFN A;  4HJA A;  2O2L D;  4PZ6 A;  4YHH Q;  4N9T A;  3G7L A;  4DV1 L;  4DK3 C;  1S5E D;  5BN3 A;  4QY7 A;  2QKI C;  5IIF A;  2YU9 H;  1FNV A;  4PMB A;  3TP6 A;  2O5J C;  1EY4 A;  3S14 H;  1HZB A;  1ZKO A;  3HKZ E;  4LF7 Q;  4KHP L;  3S2D B;  4KD4 A;  3T13 A;  3H09 A;  3IL8 A;  5JJZ A;  1JOQ A;  1WD1 A;  1K8O A;  5ELO A;  4PQX A;  1OXS C;  2MQH A;  4K0K Q;  5G3L D;  1KRT A;  5C3E B;  4JI5 L;  4K2K A;  5BR8 Q;  2K05 A;  4BBS G;  4JW0 A;  2NVT B;  1EFW A;  1EQQ A;  2F0E A;  2NN6 G;  2C5C A;  4QUC A;  1TS2 A;  4CDE C;  2XRQ D;  4GKJ L;  3GTM B;  1W6K A;  4QIW B;  5KEE A;  3CCE A;  1R4Q B;  3NEN A;  1GHJ A;  2A8V A;  4YWM A;  5IWA Q;  2YYZ A;  5F2D A;  4UY8 C;  1LT6 D;  2CKZ B;  2R93 B;  1I6V C;  2OWO A;  5ELC A;  2EYJ A;  2CW0 D;  5IY0 A;  2UU9 L;  1D5M C;  2JA7 H;  4C3J H;  4Y7N B;  3GTP H;  1JJ2 A;  1PZK D;  2A74 C;  4HMI A;  3HOW B;  3NQT A;  4KKT A;  2F0F A;  4JPB W;  4HID A;  2AWN A;  3S17 B;  1EYG A;  1MHW C;  1XJV A;  4IUQ A;  2K4K A;  1N8R C;  4RG1 A;  2GN5 A;  2K28 A;  3H3V I;  3FKI H;  3A54 A;  1CA6 A;  3I55 A;  2RF4 A;  2EIF A;  1TWG B;  2B3G A;  4OXP A;  3S1R H;  2VY3 A;  1I4P A;  4YWK A;  5FLX E;  1Q3L A;  2N49 A;  2X6L A;  4KJN A;  4DUY L;  2A69 D;  5BN5 A;  3S1M B;  1C4Q A;  5JAV A;  1W3S A;  3AYH B;  2Q2I A;  4J1M A;  4PG3 A;  2KQ3 A;  3A55 A;  2KCC A;  1SAP A;  1UE5 A;  4LWC A;  4A3E G;  3K81 C;  2ZTE A;  1KL9 A;  2N8N A;  3IRB A;  3K5N A;  3S1Q H;  1RCV D;  1PTO D;  3H6M A;  4JK1 C;  5C4H A;  2PCF B;  2QA4 A;  4P75 A;  2IX3 A;  1KNE A;  2XIW A;  1JQY D;  2D2C C;  2KHS A;  2KUM A;  2JA5 G;  2LFN A;  2B2T A;  4JC0 A;  3R8B A;  1NMG A;  4DR1 Q;  1RJT A;  2GA4 B;  3UDX A;  5COY A;  4LF4 L;  3STB D;  2EY2 A;  1IW7 C;  4X3U A;  2WB1 G;  1G2S A;  1TWA H;  2B2Y C;  1VQ7 A;  1B70 B;  1TY2 A;  4A3B B;  1CUK A;  1BCP D;  3UDI A;  1LO5 D;  2R7Z B;  3L7Z C;  1SMY C;  4DR7 L;  1STA A;  2AKW B;  4ME5 A;  3KLS A;  1BNZ A;  4LNQ A;  5GAH C;  1LTG D;  1H9S A;  1P16 A;  3MXG A;  4K5W A;  1WTQ A;  3H0G H;  5IGG A;  1Z7T A;  2E8G A;  3J81 L;  4C3H H;  1R9T H;  2QIL A;  3U58 A;  3KYH C;  1ET9 A;  4K6D A;  4C3I G;  2JA6 B;  1EQR A;  2R7D A;  3KLW A;  2JA8 H;  4H0L C;  3MWY W;  4PZ7 A;  5JPM C;  2K5V A;  5IYC H;  3E0E A;  4DPG A;  1EZ6 A;  4J8Q A;  1QNU A;  4NB3 A;  1II3 A;  1QZH A;  3GTO B;  1JMC A;  5JEA J;  2IJ0 A;  4APV A;  4X3K A;  1HR0 L;  2WAC A;  3TZD A;  5KIX A;  1C7Y A;  4A3D B;  1CZG A;  2RCF A;  3OIQ A;  1UUP A;  1WCM B;  3CCQ A;  1GUG A;  3M3Y B;  1YI2 A;  1D7Q A;  3DHQ A;  1G29 1;  1GM5 A;  2NVX B;  1PZJ D;  4R4T A;  4X62 L;  2MO1 A;  1GOZ A;  5HY6 A;  4A3I G;  1IL2 A;  4LF6 Q;  3TP8 A;  3RUZ A;  1KDC A;  3I2Z A;  2BH2 A;  4CDD C;  5IOC A;  3PMF A;  3DLL A;  4JI2 L;  1LUZ A;  1MBY A;  1DOK A;  3DWP A;  2RSO A;  3FEW X;  4DR2 L;  1LYL A;  1LLR D;  1PA6 A;  4K14 A;  4KY7 A;  2TSS A;  4B3T Q;  3P20 A;  4WOR A;  3IAY A;  1QVF A;  2WKD A;  4FP5 D;  5DM7 3;  2ZT9 C;  4IPG A;  1ASZ A;  3MA2 B;  4CKB A;  1TII D;  4BS9 A;  2G9H D;  1VQ9 A;  3HOU G;  2F3V A;  1TY0 A;  2XTI A;  4BWG B;  2K5W A;  3D6W A;  4RKL A;  2D0O A;  1SJE D;  4DK6 C;  3VR5 A;  3J7Y W;  3FVQ A;  3D31 A;  2JK8 A;  3TP5 A;  2Z6K C;  2L11 A;  1Y69 U;  3MXN A;  2OT2 A;  3JAM c;  1VQN A;  1SRO A;  5IP7 G;  4DNI A;  2PQA B;  3E9I A;  3CU7 A;  1EQV A;  3HZX A;  4GLV B;  3TME A;  3K59 A;  4LF5 L;  5JEA H;  4LF8 Q;  4UHV A;  4DR5 L;  2PZW A;  4LJZ C;  3MXN B;  1DCZ A;  4XYQ A;  2NVY B;  1Q8I A;  1QZG A;  2PPB C;  3MTS A;  1N34 Q;  3ERS X;  3W2D A;  3GTG H;  1NCV A;  4U68 A;  1SFO H;  1TKW B;  2J4X A;  2R3Z A;  1YNJ D;  3OWF A;  2WP8 J;  3CC7 A;  1XNR Q;  4DUZ L;  3MEH A;  5K36 G;  2EQS A;  2LKV A;  2HIX A;  2Z0S A;  4DAY A;  4DV3 L;  2R92 B;  2AWO A;  3DM3 A;  2RSN A;  3PO2 G;  2HT1 A;  3DUZ A;  2UUC Q;  3QOJ A;  3SE0 A;  1AN8 A;  3NXW A;  4P73 A;  4X66 Q;  3HOX G;  1PYW D;  2D5D A;  2K6A A;  3PIP A;  4DR4 L;  1SSO A;  1C9O A;  1CSQ A;  1QJO A;  2BE5 D;  1PH9 A;  4GLA C;  1I94 L;  1EY6 A;  4OEM B;  1IL8 A;  5FOB B;  1J9O A;  1BCP B;  1IBL L;  1JCK B;  3H94 A;  1RD9 D;  2B63 B;  3D4W A;  2BA0 A;  4ULL A;  1OXV A;  2QW7 A;  3NTK A;  3HOZ G;  3ER0 A;  2A6E D;  3LWE A;  3K0X A;  2YV5 A;  5IGE A;  1ICF B;  2NN6 H;  4JI7 L;  2JQO A;  3G48 A;  4PV1 C;  4DV2 Q;  4EQ5 A;  2EJF C;  1K8M A;  3CRK C;  1JWU D;  1V43 A;  2XRS D;  2M9V A;  1PMR A;  5EQ0 A;  1YNX A;  1D2B A;  1V1P B;  2QDB A;  2JJQ A;  2A69 C;  3GV6 A;  2CH4 W;  1KD1 C;  1OTC A;  1ESF A;  1STG A;  2K03 A;  4XDX A;  5CR3 A;  4LW1 A;  1U4M A;  3Q8D A;  4NKL A;  2I07 B;  4JI4 Q;  1NNX A;  1VQM A;  2VQE L;  1WTO A;  3DEP A;  3BVM A;  4NDX A;  1WTR A;  1D6E C;  1K0R A;  3A56 A;  2EY1 A;  3MEF A;  1YNN D;  4CJ2 C;  2SDF A;  5IGF A;  5FO9 B;  3AFQ A;  1EQT A;  2OEO A;  3NTH A;  1UE7 A;  4EX5 A;  1B3A A;  2DN8 A;  5T1I A;  1PH7 A;  2F3I A;  4HJ9 A;  1JWM D;  5LMN Q;  3S15 B;  2HD3 A;  2ZXP A;  4WFN 3;  3NSW A;  3T1Y Q;  3VR6 A;  2Y0S G;  4DR3 Q;  2SNM A;  1BCP C;  1WFQ A;  4NXN Q;  4GNX A;  1X3P A;  3DXJ C;  3KJO A;  4IFD H;  2RHQ B;  5C4X G;  3PGZ A;  2YTX A;  4JG2 A;  1I50 B;  4MHE A;  2SOB A;  4OIJ A;  1UNS A;  3BYT B;  1WTV A;  1F9Q A;  3G6J B;  1X3G A;  3JC6 6;  3VYR A;  4A3E H;  3MFG A;  2O4X A;  2TMP A;  1SYB A;  1SN8 A;  1X3Q A;  2XWJ B;  1M90 C;  1X6O A;  1DON A;  2KJX A;  1LM0 A;  2F0P A;  1VQH A;  4N8X 1;  2JA5 H;  1KXL A;  3H91 A;  4JI3 L;  1LTR D;  1IBM Q;  4HIO A;  2UUA L;  2PQE A;  1PZI D;  2L4N A;  2QDL A;  3EN2 A;  3SK4 A;  4JV5 L;  2L5T A;  2CQO A;  2BCO A;  4C1N I;  3BZC A;  2NZH A;  2DY8 A;  3A8J E;  2HCC A;  3RZD H;  3CC2 A;  3HG9 A;  3VR3 A;  3BYY B;  2EYH A;  3Q0A A;  4A93 B;  3L3O C;  2L55 A;  2ASB A;  1X3F A;  4IPD A;  2MNA A;  5LL6 S;  1XTC D;  2D62 A;  1FR3 A;  3FPU B;  4J6H A;  1S3O A;  1B7Y B;  2ZXR A;  1MGS A;  4C3I H;  1XMQ Q;  1W2B A;  4RGO S;  1KQS A;  2L0C A;  2F4V Q;  1VQ4 A;  4ODG A;  2E5L L;  3PUY A;  3ITP A;  4LFB Q;  5JVG 3;  2EXZ A;  1AE2 A;  1G6Z A;  4ME3 A;  3S9W A;  4C56 C;  5KYL A;  2OTL A;  4RCN A;  1O80 A;  1RTN A;  5C3E G;  4DV0 L;  2HHH Q;  3P1H A;  5JVH 3;  4IPC A;  1E2W A;  3I7F A;  2DGY A;  1O7Z A;  4RGN A;  1NR2 A;  1WTP A;  5NUC A;  3PUX A;  2VNU D;  2EXD A;  3U4Z A;  1CHP D;  1Y1W B;  4A3I H;  1MSG A;  4L5S A;  1Y8P B;  2R93 G;  5M5Y B;  2NB0 A;  1N33 Q;  4U67 3;  2N3S A;  4QL5 A;  2ZTC A;  3QWN A;  4WRD A;  3G71 A;  3M9B A;  3KDF A;  1Q82 C;  3M85 A;  4LUV A;  2B2W A;  4IJH A;  4JBW A;  3Q24 A;  5IT9 L;  4NXM Q;  3NWT A;  5M3M B;  2MFI A;  3HOW G;  2NVQ B;  3C46 A;  1SR3 A;  5BN4 A;  3KF6 A;  1A3T A;  1YNJ C;  2WIN B;  4KTA A;  3HGB A;  4BBR B;  3J80 L;  1MJE A;  4FF1 A;  3H3V H;  3K57 A;  3KDF B;  1SE2 A;  2K75 A;  3PUV A;  3TN2 A;  4LF9 L;  1XX8 A;  3ND8 A;  3MC0 B;  1XWE A;  5AJ3 L;  3HOU H;  3CCS A;  2M2L A;  5LMU L;  1K73 C;  4HED A;  2K01 A;  1SNP A;  2O5I C;  1G6P A;  3KFU A;  1B50 A;  3CC4 A;  1N36 Q;  3S1N H;  4K8J A;  4N9P A;  2CVR A;  3C1F A;  1ENC A;  3OWE B;  1HRJ A;  3OSO A;  1AP0 A;  4ZRZ A;  4TRD A;  1R4P B;  2DJG C;  1QWY A;  3I4M H;  2AQ2 B;  5IP7 H;  4LUO A;  3NE5 B;  4F88 A;  2EYF A;  5DEH A;  5LHY 1;  1HHV A;  3CP0 A;  4RCO A;  5I2Y A;  3MZ5 A;  1PXU A;  1KAA A;  2ZJR A;  2RHS B;  1IHZ A;  2A6E C;  1K3B C;  1Q86 C;  3GTL H;  1OXU A;  3J81 c;  4B3S L;  1SMY D;  4DR6 Q;  2AUK A;  4R8I A;  3CAM A;  1AH9 A;  1DYQ A;  5J39 A;  1TWH H;  2NYZ D;  4YCV A;  4C1N K;  5CV8 A;  2IWH A;  3VYU A;  4XXE A;  1F77 A;  4EQP A;  4O42 A;  3GDE A;  1PH3 A;  4QF4 A;  3UDF A;  5M3F B;  5KYI A;  1N32 L;  3JAM E;  1O7Y A;  4FF2 A;  2CH4 A;  4KMU C;  3PO2 H;  4A3B G;  5I9O A;  3HOX H;  2EE1 A;  3EJI A;  2R7Z G;  4BA2 I;  1J6Q A;  1I6H B;  4YY3 Q;  1V8Q A;  2VUM B;  1RF2 D;  1YNN C;  1XNQ L;  4HMJ A;  4AH6 A;  2F0D A;  2K33 A;  4AQY Q;  4A3K H;  1H95 A;  5CBE E;  1B4O A;  1A8V A;  2GVB A;  1YHQ A;  1K9M C;  5C4J H;  3CXC A;  4IPH A;  3WOF A;  1HXY D;  4WJW A;  3BDL A;  5D65 A;  1I4X A;  1WJJ A;  4KKU A;  1G2T A;  2JA6 G;  1E22 A;  1EY5 A;  1O7I A;  2ZJP A;  3HOV B;  2ENB A;  1PV4 A;  2K5H A;  1ROD A;  4DFA A;  2EYL A;  1I4H A;  2Q2H A;  5IYB G;  3PSI A;  4K5X A;  5M5X H;  4B08 A;  4B9X A;  1K0S A;  3I91 A;  2CWP A;  2B2V C;  4A3D G;  5FO8 B;  1WCM G;  5CMD A;  3FPP A;  1GXD C;  1I4R A;  2QEJ C;  3U4V A;  4JI6 L;  3VDY A;  3LX0 A;  3BS1 A;  4RA8 A;  1IBK L;  3VA7 A;  2HCI A;  2V4D A;  1TU2 B;  2KED A;  4IQZ A;  5I6W A;  4BY1 H;  5E4W C;  2PI2 A;  5JOB A;  4DA2 A;  4AYB E;  1WYD A;  2K32 A;  1L0X B;  3RLF A;  3D0F A;  3SEB A;  2PMZ E;  1GUS A;  4JI0 Q;  3M7N A;  4XYO A;  1EY9 A;  2C9O A;  3TS0 A;  3WOE A;  1BQQ T;  3IFD A;  1BBU A;  1TS5 A;  1NTG A;  1SNQ A;  2GVA A;  4GN4 B;  3SGI A;  4HCE A;  1BXT A;  3F8T A;  4LFC Q;  2IX1 A;  1CKN B;  1U4L A;  1KNA A;  4S3S A;  4HR7 B;  4ZK9 B;  2XVS A;  1WD0 A;  1TWF H;  1CZW A;  1QG7 A;  2XGT A;  2K7V A;  4V0B A;  1PLF A;  3S2H H;  2B2Y A;  4DUY Q;  1M4V A;  1YJW A;  1J8I A;  4PZ8 A;  5KGU A;  5E7N A;  2VW9 A;  2IY5 B;  5FK9 C;  1T9H A;  3GTK B;  2UXD Q;  2UUB L;  1CSP A;  1HNW L;  4FF4 A;  1CA5 A;  4FXG C;  3UI2 A;  5KNB A;  3TEH B;  3NQI A;  1QNK A;  4RHR A;  1XMO L;  4GN3 B;  4Q5V A;  4H02 A;  3CKI B;  1Q46 A;  5LL6 X;  1MSH A;  1I3Q H;  4YHH L;  1HR0 W;  1FNW A;  4R9W A;  2F0S A;  1LTT D;  1XPR A;  2VB3 X;  2EVB A;  2R92 G;  3AFP A;  3MXU A;  1A0I A;  1HQR D;  3V2T A;  1TWC B;  1G91 A;  5D3I B;  2I5H A;  4NP5 A;  1UE6 A;  5KNC A;  3DM1 A;  5GAE C;  3S2D H;  4PMC A;  4NMZ A;  4A76 A;  2PNR C;  1GO3 E;  4IZ8 A;  1I4G A;  4GLX A;  2LXJ A;  2FMC A;  1G51 A;  4C2M H;  3CD6 A;  1A6X A;  2B63 G;  2JP1 A;  1VQG A;  3H0G B;  4LFA L;  5EAY A;  4C3H B;  1GUO A;  1SYE A;  1RDP D;  5BR8 L;  4B3M Q;  2NVT H;  2RDG A;  3KF8 B;  3TRZ A;  1GUT A;  1BKB A;  2VS1 A;  2JA8 B;  3C3L A;  3HKZ B;  1LTB D;  1D5X C;  1PYB A;  3GTM H;  4DK0 A;  4CHT B;  4ALP A;  3D6C A;  3GV3 A;  5IWA L;  1HJP A;  1UEB A;  2F0T A;  1WI5 A;  1B53 A;  4OEL B;  1JWS D;  3CMA A;  1UWV A;  3OPO A;  2F0N A;  4ZKC B;  2FFK B;  5C4Z A;  3HOY H;  3CME A;  4CDF C;  3TZU A;  5EGT A;  5DLQ E;  2G9D A;  3AB9 A;  3PIO 3;  4POG A;  3FDT A;  1EEF D;  2PZU A;  4LUZ A;  2F0L A;  4DV4 Q;  3I72 A;  1VQI A;  3D4R A;  1HNX Q;  4ZYS A;  2F0V A;  2Z6K A;  3WDN A;  3DEO A;  1DM0 B;  3P7J A;  4KN4 C;  4L8J A;  1NBW A;  1X55 A;  3K80 C;  3MXP A;  3N52 A;  4RWS C;  2MPM A;  3MFY A;  1EUJ A;  1QVC A;  2BOS A;  4JI8 L;  5KND A;  1HFG A;  4LAA A;  4RMF A;  2E2D C;  1QVG A;  2NUC A;  1KRS A;  1TQO A;  3S1M H;  4PMW A;  1LTI D;  4DGZ A;  3UDG A;  2N55 A;  2XNA C;  4QB4 A;  5D3D A;  4A3J H;  4A3G B;  4CJ0 B;  3CPW A;  1JR0 D;  4A4I A;  2E2J B;  2DY7 A;  2FJ2 A;  5JJL A;  1GVP A;  1NUC A;  3I73 A;  4KHV A;  1X65 A;  2KHJ A;  4G7Z C;  4CGY B;  4HSP A;  2VZA A;  1S40 A;  3NBI A;  1SE3 A;  1JE5 A;  3RMH A;  4DR1 L;  2PYK A;  4I7Z C;  3ZYY X;  1F2M A;  4TVA B;  2VXW A;  4FVM A;  4IUV A;  1A63 A;  3GTG B;  2A68 D;  1WTH A;  3HRZ C;  5C44 B;  2AQ1 B;  4A3B H;  1STY A;  1GD7 A;  2R7Z H;  4I7A A;  3ICE A;  4A3M B;  5I2X A;  3E5S A;  3OYY A;  1AEX A;  1LT3 D;  4A93 G;  3GTJ H;  2EYO A;  3J81 E;  3CCL A;  1JB7 A;  5ELB A;  5CV4 A;  2PQA A;  4JCV E;  1W6J A;  2V1C C;  3F1Z A;  4BY7 B;  1VQJ A;  1SNC A;  4DV7 Q;  2K50 A;  4ABN A;  2JA6 H;  1DGS A;  2RBM A;  2NZO A;  5A2Q L;  3K7A B;  1Q12 A;  4CDC C;  5IT9 c;  1WOC A;  2AMC B;  1M8A A;  2HIV A;  3GTO H;  3TP7 A;  1JJG A;  4NPS A;  3J80 c;  2WB1 E;  5DNF A;  1NSN S;  1X32 A;  4GKK Q;  4GOP B;  4A3D H;  3BVG A;  2HUG A;  1WCM H;  2PO4 A;  1PH5 A;  3I4N B;  3M3Y H;  2PNH A;  2DUD A;  2VQF Q;  3HFZ B;  4O1N A;  4UAI A;  1YJ9 A;  2NVX H;  1YIT A;  1STE A;  2HDL A;  5IGB A;  1Y1W G;  5KRU A;  1BO0 A;  4LF6 L;  2Q2T A;  3FMC A;  3W1B A;  4OGQ C;  3J81 j;  1F2Z A;  2E2I B;  4GS3 A;  4UDU C;  4ZQ3 A;  2JA9 A;  4CKC A;  1D1I A;  1E2Z A;  2YTV A;  5CV5 A;  2PW7 A;  5ELE A;  1WTX A;  1ESR A;  5I9P A;  2PW5 A;  3EIV A;  5GQO A;  2B2U C;  3E6Z X;  5IGD A;  4ID6 A;  4X65 Q;  1HZC A;  3OW7 A;  1SND A;  3OTO Q;  4BBR G;  4DV5 Q;  4QGU A;  1L2F A;  2FMM A;  1P8L A;  3QB3 A;  3A5U A;  2I0Q A;  3T56 B;  1GUN A;  3HKS A;  2OQK A;  3TSS A;  1LTS D;  4QJF A;  2Q8R E;  4DAP A;  3Q6S A;  1V1P A;  3HP3 A;  2A73 B;  4BBS H;  2AQ3 B;  2MJ8 A;  3D3R A;  2QEX A;  1GUW A;  5ISR A;  1NY4 A;  3A8I E;  2F52 A;  1EIY B;  2F0H A;  4YWL A;  5FJ8 G;  3CQZ B;  1VS0 A;  3Q22 A;  4H44 C;  4GOP C;  4LF8 L;  2CWA A;  2ID0 A;  2NVY H;  4HTH A;  1MI2 A;  1ML0 D;  1SMX A;  1ET6 A;  1XNR L;  1AW7 A;  5CV6 A;  1F9R A;  3AQQ A;  2F0Q A;  3T1H L;  1PTO H;  1MD2 D;  1JC7 A;  3QR8 A;  1HNZ Q;  2WAQ B;  4KJO A;  1DOL A;  4Q0F A;  1O7L A;  3VYT A;  4KK7 A;  1A2U A;  5M3F G;  5M9O A;  2R92 H;  1SBB B;  4DNR B;  4OL7 A;  4O2D A;  2UUC L;  3ERQ A;  3VYS A;  4X66 L;  1LV9 A;  2D0P A;  3CCU A;  1YIJ A;  3ULP A;  1LTA D;  5E4X A;  1D1K A;  2XN9 C;  1JOK A;  2MO0 A;  4A3F B;  1C0A A;  2A5H A;  2Z8L A;  2VUM G;  1KHI A;  1RHP A;  1EIF A;  2EY6 A;  1OXT A;  1JE4 A;  4PNY A;  5IE8 A;  2BDO A;  1WVL A;  1VQE A;  2UXC Q;  4IUU A;  1J5E L;  1BBW A;  4X64 Q;  2K5Q A;  1CTM A;  1QOH A;  4DV2 L;  4G7H C;  1ILP A;  3HOV G;  3M4O H;  2JSO A;  4V19 0;  2E2H H;  3M4Q A;  4BA1 I;  4O0A A;  3ZJY C;  3E0J A;  4JI1 Q;  2F0G A;  1FL0 A;  4A3C G;  2R6G A;  4JI4 L;  4L5T A;  1EFI D;  2ZM6 Q;  4RHS A;  4IOA A;  1Y14 B;  1ENF A;  1B9M A;  2KHI A;  1JB3 A;  3CF5 A;  5ELN A;  3S16 H;  2EY5 A;  2Q8T A;  5EBC A;  3VR4 A;  5FLM G;  4A3L G;  4MZ9 A;  4ILW A;  1YHA A;  3M4Y A;  5LMN L;  3OIP A;  2EJG C;  2F0O A;  5A35 A;  1IYV A;  4GN5 A;  2J7Z A;  2A68 C;  2EJM A;  4K5V A;  2K5D A;  4F87 A;  4NXN L;  4OWW B;  1EY0 A;  4OWT B;  1Q81 C;  2VB2 X;  1DOM A;  3RR5 A;  3W3A A;  1SDF A;  4P74 A;  3EBE A;  3MAQ A;  1RKN A;  1KIX A;  4EVO A;  1VMC A;  4HIK A;  1I50 H;  1CKO A;  1LTL A;  3OOC A;  4Y52 H;  1CKM A;  4GZY C;  1Q7Y C;  1FVI A;  4XQQ A;  3S1N B;  3L2P A;  4DU9 A;  5L37 A;  3JAM i;  3RZO B;  1TVX A;  1BR9 A;  1KDA A;  3P75 A;  3I4M B;  1I5F A;  3QJY A;  4KY5 A;  4DV6 Q;  3SK8 A;  3F2B A;  3J80 i;  2L12 A;  4R8N A;  1K83 H;  4HCS A;  4TKO B;  3VR2 A;  1IBM L;  2UXB Q;  1SNO A;  2F0K A;  3OMG A;  1EU4 A;  1EYA A;  3EA6 A;  2J0T D;  1EIG A;  4LK1 C;  3GTL B;  3H15 A;  2Y0S E;  4OX9 Q;  2F3W A;  3GTQ B;  3TQY A;  2NTS A;  1VMP A;  1TWH B;  2CQA A;  2XSC A;  1Y8O B;  5FKA C;  3CCV A;  4JVZ A;  3ND9 A;  3KLS X;  4QMG A;  3M4P A;  4UP7 A;  1VQP A;  3AMU A;  1SXT A;  1KDB A;  2RA4 A;  2ICE C;  1FNU A;  1PRT F;  1GJX A;  3T53 B;  3W5O A;  3HOX B;  1XPU A;  1H9R A;  1RIP A;  2EOT A;  3LNN A;  5C0X I;  4B3R Q;  1IKM A;  1VQK A;  4L5R C;  1Y1V B;  3FP9 A;  2Z4I A;  2F4V L;  1JT8 A;  3NP8 A;  2B2V A;  4LFB L;  2JN4 A;  4FNF A;  3NBH B;  1B9N A;  3H0G G;  4A3K B;  1CQV A;  3EVQ A;  1A2T A;  4C3H G;  1VQO A;  2HHH L;  2FIN B;  2OXP A;  1BF4 A;  3GP7 A;  1U0L A;  1ASY A;  1FJG Q;  2JA8 G;  4RKB A;  3HKZ G;  3ERO A;  4DK1 A;  2X69 A;  1H9K A;  1S5B D;  4ZCK A;  1M1K C;  1N33 L;  5K36 H;  3D8G A;  1EWI A;  1VQA A;  2KEN A;  4OIK A;  1STH A;  3U50 C;  4JYA L;  3AEV A;  2BDN A;  1EOT A;  1FGB D;  2R7F A;  5IT9 E;  4NXM L;  4JI6 Q;  3K5L A;  3BDO A;  4CJ1 B;  2HQE A;  3K8A A;  3PO3 B;  4CKE A;  1OXX K;  2CCZ A;  3J80 E;  5EKI A;  2I5M X;  2PI2 E;  1EWC A;  1AE3 A;  3I8Z A;  1S5C D;  4RGM A;  4X3T A;  4BY1 B;  1BVS A;  1SE4 A;  5DAU A;  4DV1 Q;  4FO2 A;  1PTO F;  2YU9 B;  2IW3 A;  3HOZ H;  1YBY A;  5IYD G;  1B44 D;  1UAP A;  4HIM A;  3S14 B;  3OMC A;  4YCU A;  5IGC A;  1N36 L;  1XTD A;  4KHP Q;  1PFB A;  1YVC A;  4QIW E;  1HCZ A;  4CBV A;  4FDB A;  1VQ8 A;  1Q90 A;  1QUQ B;  2A1A A;  1E7Z A;  5FJ8 H;  4IFD I;  2EDG A;  4BXX G;  4A3G G;  4F8M A;  4JI5 Q;  5J3B A;  1JOO A;  3F2U A;  2K14 A;  3KUP A;  5GRO A;  1TR5 A;  5HGT A;  2ICI A;  1YHB A;  1UEA B;  3UE0 A;  2I5L X;  4GKJ Q;  3BU2 A;  3S2H B;  4DR6 L;  1NJI C;  2E75 C;  2NZ1 D;  3PIP 3;  3EQL C;  3I70 A;  2OCE A;  5CV9 A;  2K1B A;  1PH8 A;  2B39 A;  3BZK A;  1L0Y B;  3SK6 A;  3GTP B;  1SNM A;  2JA7 B;  4C3J B;  1Z6H A;  2Z6B A;  2UU9 Q;  2WKC A;  4J15 A;  2NWG A;  2BH8 A;  5I6Y A;  5M3F H;  1F2Y A;  4XT3 B;  2AHO B;  1E3P A;  5C44 G;  1LT5 D;  1K28 A;  5M5W H;  1JOR A;  1CKN A;  4AIM A;  4A3M G;  1EZ8 A;  3A5Z B;  1I6H H;  2EYM A;  1L1O B;  4YY3 L;  5C4X H;  1I3Q B;  2DNE A;  3V96 A;  2VUM H;  1FD7 D;  2IL8 A;  3FKI B;  1F2L A;  4R4Q A;  4AQY L;  1ICW A;  2CHB D;  5EJW A;  1KAB A;  1Q1E A;  5C0X G;  2IHE A;  1ILQ A;  3QO2 A;  4BY7 G;  3V05 A;  3S1R B;  2ALY B;  4OWX B;  1E1T A;  2RDH A;  4ZUJ A;  4K6L A;  5FLX L;  3HOV H;  4JBK A;  2XWB B;  4C2M B;  1Q1B A;  1BDO A;  2EPB A;  2KEC A;  4LFA Q;  1MKH A;  3NUC A;  1HH2 P;  4A3C H;  3TDQ A;  1Z47 A;  3I4N G;  3S1Q B;  1VCI A;  4XT1 B;  3TBI B;  1KLG D;  4QQB X;  4E6I A;  5CV7 A;  1G8Z D;  2Z1C A;  2JE6 I;  3CCR A;  2EZV A;  2F4I A;  1PRT D;  3R2I A;  3A7L A;  5HUR A;  3QOL A;  3TRE A;  3C2P A;  3MHB A;  1TT2 A;  2LS0 1;  3NTI A;  3CRL C;  3G6E A;  3BVZ A;  4LF4 Q;  5FLM H;  1TWA B;  4A3L H;  3HOY B;  1UE1 A;  1PDQ A;  3SXH A;  4JI0 L;  5C3X A;  2VL6 A;  5GAD C;  4FF3 A;  4LF7 L;  4M8A A;  1L1O C;  2F0W A;  4XQJ A;  1BBX C;  4DR7 Q;  1V9P A;  3KF8 A;  4MN3 A;  5FO7 B;  2QCP X;  2DNC A;  3RD4 A;  4K0K L;  1Z9F A;  2LXK A;  1QIL A;  4HJ7 A;  1CFM A;  3K0Y A;  1E2V A;  4HN7 A;  4LFC L;  1R9T B;  4XQN A;  1U9R A;  5C3E H;  1LAC A;  1A15 A;  4AYB B;  4L6T B;  1QB5 D;  1TS3 A;  4MNO A;  2PMZ B;  1VQ6 A;  1BOS A;  1SYF A;  1EL0 A;  1BUV T;  4DKA C;  1X54 A;  4IFD G;  2MP1 A;  4X3S A;  3MVV A;  4JI8 Q;  2E74 C;  2R93 H;  1D5Z C;  4L5Q A;  2FHT A;  4A3J B;  1HR0 Q;  1C48 A;  4IN3 A;  1SE8 A;  2UXD L;  1IXR A;  3GTK H;  1SJH D;  1S5D D;  1VQ5 A;  3IKJ A;  1KC8 C;  2RKS A;  4Y7N H;  3VA5 A;  2SNS A;  3J81 i;  1QCB D;  1XXG A;  4POF A;  3HOW H;  1HQM C;  5JJI A;  1EYC A;  1X9N A;  4G57 A;  4X62 Q;  3C1E A;  1S72 A;  1EIH A;  3T4A C;  4DAM A;  1PVO A;  3S17 H;  3CPF A;  3OW2 A;  3URY A;  1CM9 A;  2WAQ G;  4JI2 Q;  2LSS A;  2KOL A;  4DR2 Q;  4FYD A;  3R2T A;  1TWC H;  1TWG H;  4RAU C;  3I56 A;  1IYU A;  1YJN A;  4LMQ D;  4A3F G;  2R61 A;  3J7A 5;  2KEE A;  1D8L A;  3M7G A;  1STN A;  3GTJ B;  1U4P A;  1V1O A;  2RQX A;  3SK5 A;  4B3M L;  1PH2 A;  3I4L A;  2H5X A;  4P2C B;  1H9S B;  1AZQ A;  1HZ9 A;  2FXQ A;  1CT1 D;  4IJL A;  4OO1 I;  2EYP A;  4DF7 A;  5H1S E;  3FRP B;  4MTN A;  1SYC A;  2B2U A;  4Z9C B;  4NW2 A;  2RCN A;  1NAP A;  4KY6 A;  4LF5 Q;  4DR5 Q;  2IHF A;  3A7A B;  4RH6 A;  5K5P A;  2B8G A;  1EU3 A;  3OHX C;  3L0O A;  1GKH A;  3KOJ A;  1SFO B;  1PHJ A;  4MTK A;  4DV4 L;  1U4R A;  3J7A V;  1GHK A;  4UPA A;  4DUZ Q;  2X6G A;  2K04 A;  3RN2 A;  1HNX L;  1PRT B;  2OQ0 A;  4IO9 A;  4R4I A;  5C0X J;  3NHH A;  4TSS A;  4DV3 Q;  2B2T C;  3EFX D;  3HS0 C;  2SEB D;  3PV0 A;  2C35 B;  5IYD H;  3G4S A;  4DR4 Q;  3PUZ A;  1JJC B;  4QUF A;  2G5D A;  3NEL A;  3PQI A;  4GOP A;  2F0J A;  1PYS B;  3ULJ A;  1I94 Q;  1HA6 A;  3T51 B;  1IBL Q;  5CYU A;  1CI3 M;  5IYB H;  3I4O A;  4YIJ A;  2RVL A;  3I90 A; 
#chains in the Genus database with same CATH homology
 4EQN A;  4BBS B;  1HTP A;  2NBF A;  4MIU A;  2N88 A;  3LWU A;  4ZKB B;  4B9W A;  3O13 A;  1AZP A;  4HAE A;  2KCN A;  3CHB D;  5J1Z A;  2AUJ D;  4TQU S;  1JIC A;  1HPC A;  2MUY A;  3I3C A;  3KLR A;  1SEB D;  4DN4 M;  1KLU D;  1PRT C;  1PTO B;  4IUR A;  2BA1 A;  4RFB A;  4DXF A;  5CBA E;  2L9H A;  1HUM A;  3GO5 A;  5C0X H;  2B8F A;  2CW0 C;  2IT1 A;  3ONA B;  1ZEQ X;  2F0I A;  3K58 A;  2D9U A;  4IFD J;  5A2Q E;  1T5X D;  2ZXO A;  2PZT A;  3KBX A;  1ENA A;  1H9J A;  2Q8I B;  4XTC S;  3X3N A;  3J7A F;  4A3E B;  4IAL A;  4OO1 G;  1EWH A;  5DM6 3;  3PUW A;  4EGV A;  1EYD A;  2JEB I;  4XIG S;  1VF5 C;  4RGT A;  5EPK A;  1VDZ A;  3M4O B;  2E2H B;  2JA5 B;  2RDF A;  1I4Q A;  5T1G A;  1H9M A;  4G4K A;  2I46 A;  2WB1 B;  5CGK A;  5COR A;  4HSV A;  2WV6 D;  5C6A A;  2L1B A;  5E1F A;  2M00 A;  5EKL A;  1PTO C;  3QIA A;  3S16 B;  3RZD B;  2F0U A;  4KD3 A;  2IX0 A;  2OF1 A;  4OHJ A;  2MHV A;  3GD7 A;  1ZYR D;  5EBD A;  4C3I B;  3D4D A;  2WII B;  5EPJ A;  3SR1 A;  5C3W A;  1XYI A;  3AU7 A;  1ONL A;  4IUN A;  2A6H D;  4L63 B;  4M1U B;  1WTW A;  3BG3 A;  4FXK C;  3HEJ A;  3QG1 A;  4DXG A;  4A3I B;  1LAB A;  4H7B A;  1CQF A;  1HA5 A;  4K2L A;  1K83 B;  2HDM A;  5I4D A;  3U9S A;  5J22 A;  4C3J G;  1O78 A;  1DD2 A;  2LMC B;  3NK9 A;  1OO9 B;  4KN7 C;  1DZ1 A;  4IUP A;  4I65 A;  1DJR D;  3NPP A;  1DXM A;  3HOU B;  2KVM A;  1CK1 A;  1ZXT A;  1E0B A;  3L9A X;  2QF7 A;  1SYD A;  4FXD A;  2H1E A;  1B1Z A;  1F9S A;  3DWQ A;  1SYG A;  4KI0 A;  4ZAI A;  1VF7 A;  1LT4 D;  5EKK A;  1AFP A;  2KA7 A;  1EY8 A;  2F03 A;  3K5O A;  1TS4 A;  4ZUI A;  3Q23 A;  5G3L F;  3R3O A;  5ELF A;  2F1M A;  2JEA I;  5E3F A;  1A3U A;  1F9P A;  3KBG A;  2H4O A;  3NBH A;  3JAM L;  1T5E A;  3PO2 B;  2LY7 A;  3SHL A;  3H3V C;  4F7X A;  3NWS A;  5ELD A;  1Y8N B;  1EEI D;  3DMU A;  1KTK A;  5IOD A;  1S4Z A;  1NR4 A;  3HOZ B;  3KK7 A;  5C4J B;  2NTT A;  2BE5 C;  2NN6 I;  3R93 A;  5M5X B;  1IW7 D;  1RTO A;  3T16 A;  3IFT A;  4DNT B;  3BDC A;  3K6O A;  3K5M A;  4H13 C;  5CC4 A;  1FYC A;  4G7O C;  1IKL A;  3A8K E;  3N6R A;  4QCL A;  2MGS A;  5JPN C;  2Y0S B;  5M5W B;  4K8I A;  4ZLT F;  3SDZ A;  2B2W C;  5EPL A;  2F0M A;  1HTL D;  5C4X B;  3GQB A;  1QE6 A;  5C5L A;  3U9O A;  4EQO A;  4DAV A;  1BCP F;  1ZYR C;  4OO1 H;  5AFW A;  1TWF B;  2E76 C;  1EY7 A;  5C5M A;  1HFN A;  2Z4H A;  3BZD B;  1CHQ D;  1B2T A;  2JYO A;  5JEA G;  1STB A;  2IPK D;  1S5F D;  4KHZ A;  4KKS A;  3DWA A;  4KV6 A;  2A6H C;  3X3M A;  2JXM B;  1C8C A;  1PFM A;  3SVM A;  4IUT A;  5D14 A;  1HUN A;  1A3V A;  5TSS A;  1PFN A;  2O2L D;  4N9T A;  3G7L A;  1S5E D;  5BN3 A;  2QKI C;  5IIF A;  1FNV A;  4PMB A;  3TP6 A;  2O5J C;  1EY4 A;  1ZKO A;  3S2D B;  4KD4 A;  3T13 A;  3H09 A;  3IL8 A;  5JJZ A;  1JOQ A;  1WD1 A;  1K8O A;  4PQX A;  1OXS C;  5G3L D;  5C3E B;  4K2K A;  2NVT B;  2K05 A;  2F0E A;  2NN6 G;  2C5C A;  4QUC A;  1TS2 A;  2XRQ D;  3GTM B;  1W6K A;  4QIW B;  5KEE A;  1R4Q B;  1GHJ A;  2YYZ A;  5F2D A;  1LT6 D;  2R93 B;  1I6V C;  5ELC A;  2EYJ A;  2CW0 D;  1D5M C;  4Y7N B;  1PZK D;  2A74 C;  4HMI A;  3HOW B;  3NQT A;  4KKT A;  2F0F A;  2AWN A;  3S17 B;  4IUQ A;  2K28 A;  3A54 A;  1CA6 A;  1TWG B;  1I4P A;  5FLX E;  1Q3L A;  2X6L A;  4KJN A;  2A69 D;  5BN5 A;  3S1M B;  1C4Q A;  5JAV A;  4J1M A;  2KQ3 A;  3A55 A;  2KCC A;  1SAP A;  3K5N A;  1RCV D;  1PTO D;  3H6M A;  4JK1 C;  5C4H A;  2PCF B;  2IX3 A;  1KNE A;  2XIW A;  1JQY D;  2D2C C;  2KHS A;  2KUM A;  2LFN A;  2B2T A;  3R8B A;  1RJT A;  2GA4 B;  5COY A;  2EY2 A;  1IW7 C;  4X3U A;  1G2S A;  2B2Y C;  1TY2 A;  4A3B B;  1BCP D;  1LO5 D;  2R7Z B;  3L7Z C;  1SMY C;  1STA A;  4ME5 A;  3KLS A;  1BNZ A;  1LTG D;  1H9S A;  3MXG A;  4K5W A;  1WTQ A;  5IGG A;  1Z7T A;  3J81 L;  2QIL A;  1ET9 A;  4K6D A;  4C3I G;  2JA6 B;  4H0L C;  3MWY W;  5JPM C;  1EZ6 A;  4J8Q A;  1QNU A;  1II3 A;  3GTO B;  5JEA J;  2IJ0 A;  4X3K A;  2WAC A;  3TZD A;  5KIX A;  4A3D B;  1CZG A;  3OIQ A;  1UUP A;  1WCM B;  1GUG A;  3M3Y B;  3DHQ A;  1G29 1;  2NVX B;  1PZJ D;  1GOZ A;  3TP8 A;  3RUZ A;  1KDC A;  5IOC A;  3PMF A;  1MBY A;  1DOK A;  3DWP A;  2RSO A;  3FEW X;  1LLR D;  4K14 A;  4KY7 A;  2TSS A;  3IAY A;  3P20 A;  4WOR A;  2WKD A;  4FP5 D;  5DM7 3;  2ZT9 C;  3MA2 B;  4CKB A;  1TII D;  4BS9 A;  2G9H D;  2F3V A;  1TY0 A;  4BWG B;  2K5W A;  3D6W A;  4RKL A;  1SJE D;  3VR5 A;  3J7Y W;  3FVQ A;  3D31 A;  3TP5 A;  2L11 A;  1Y69 U;  3MXN A;  2OT2 A;  3CU7 A;  1EQV A;  3HZX A;  3TME A;  3K59 A;  5JEA H;  2PZW A;  4LJZ C;  1DCZ A;  4XYQ A;  2NVY B;  1Q8I A;  2PPB C;  3MTS A;  3W2D A;  1NCV A;  4U68 A;  1TKW B;  2J4X A;  2R3Z A;  1YNJ D;  3OWF A;  2WP8 J;  3MEH A;  5K36 G;  2LKV A;  4DAY A;  2R92 B;  2AWO A;  2RSN A;  3DUZ A;  3QOJ A;  3SE0 A;  1AN8 A;  3NXW A;  1PYW D;  2D5D A;  2K6A A;  1SSO A;  1QJO A;  2BE5 D;  1EY6 A;  1IL8 A;  5FOB B;  1J9O A;  1BCP B;  1JCK B;  3H94 A;  1RD9 D;  2B63 B;  3D4W A;  2BA0 A;  4ULL A;  1OXV A;  3NTK A;  2A6E D;  3LWE A;  5IGE A;  2NN6 H;  4PV1 C;  2EJF C;  1K8M A;  3CRK C;  1JWU D;  1V43 A;  2XRS D;  2M9V A;  1PMR A;  5EQ0 A;  1D2B A;  1V1P B;  2QDB A;  2A69 C;  3GV6 A;  1ESF A;  1STG A;  2K03 A;  4XDX A;  5CR3 A;  1U4M A;  4NKL A;  2I07 B;  1WTO A;  3DEP A;  3BVM A;  4NDX A;  1WTR A;  1D6E C;  3A56 A;  2EY1 A;  1YNN D;  4CJ2 C;  2SDF A;  5IGF A;  5FO9 B;  1EQT A;  2OEO A;  3NTH A;  1B3A A;  2DN8 A;  5T1I A;  1JWM D;  3S15 B;  2ZXP A;  4WFN 3;  3NSW A;  3VR6 A;  2SNM A;  1BCP C;  1X3P A;  3DXJ C;  4IFD H;  1I50 B;  4MHE A;  2SOB A;  4OIJ A;  1UNS A;  3BYT B;  1WTV A;  1F9Q A;  3G6J B;  3VYR A;  3MFG A;  2O4X A;  2TMP A;  1SYB A;  1X3Q A;  2XWJ B;  1DON A;  2KJX A;  2F0P A;  3H91 A;  1LTR D;  2PQE A;  1PZI D;  2L4N A;  3SK4 A;  2L5T A;  2BCO A;  4C1N I;  2DY8 A;  3A8J E;  2HCC A;  3HG9 A;  3VR3 A;  3BYY B;  2EYH A;  3Q0A A;  4A93 B;  3L3O C;  2L55 A;  5LL6 S;  1XTC D;  2D62 A;  1FR3 A;  3FPU B;  4J6H A;  2ZXR A;  1MGS A;  4RGO S;  2L0C A;  4ODG A;  3PUY A;  3ITP A;  5JVG 3;  2EXZ A;  1G6Z A;  3S9W A;  4C56 C;  5KYL A;  4RCN A;  1O80 A;  1RTN A;  3P1H A;  5JVH 3;  1E2W A;  1O7Z A;  4RGN A;  1NR2 A;  1WTP A;  5NUC A;  3PUX A;  2VNU D;  1CHP D;  1Y1W B;  1MSG A;  1Y8P B;  5M5Y B;  2NB0 A;  4U67 3;  3QWN A;  4WRD A;  3M85 A;  2B2W A;  4JBW A;  3Q24 A;  5IT9 L;  3NWT A;  5M3M B;  2NVQ B;  3C46 A;  5BN4 A;  1A3T A;  1YNJ C;  2WIN B;  4KTA A;  3HGB A;  4BBR B;  3J80 L;  4FF1 A;  3K57 A;  1SE2 A;  3PUV A;  3TN2 A;  1XX8 A;  3ND8 A;  3MC0 B;  1XWE A;  2M2L A;  4HED A;  2K01 A;  1SNP A;  2O5I C;  1B50 A;  4K8J A;  4N9P A;  2CVR A;  3C1F A;  1ENC A;  3OWE B;  1HRJ A;  3OSO A;  1AP0 A;  4ZRZ A;  4TRD A;  1R4P B;  1QWY A;  2AQ2 B;  3NE5 B;  4F88 A;  2EYF A;  5DEH A;  5LHY 1;  1HHV A;  4RCO A;  5I2Y A;  3MZ5 A;  1PXU A;  1KAA A;  1IHZ A;  2A6E C;  1OXU A;  1SMY D;  2AUK A;  4R8I A;  1DYQ A;  5J39 A;  2NYZ D;  4C1N K;  5CV8 A;  2IWH A;  3VYU A;  4XXE A;  1F77 A;  4EQP A;  4O42 A;  4QF4 A;  5M3F B;  5KYI A;  3JAM E;  1O7Y A;  4FF2 A;  4KMU C;  5I9O A;  2EE1 A;  3EJI A;  4BA2 I;  1I6H B;  1V8Q A;  2VUM B;  1RF2 D;  1YNN C;  4HMJ A;  2F0D A;  2K33 A;  5CBE E;  1B4O A;  3WOF A;  1HXY D;  4WJW A;  3BDL A;  5D65 A;  1I4X A;  4KKU A;  1G2T A;  1EY5 A;  3HOV B;  2ENB A;  1ROD A;  4DFA A;  2EYL A;  1I4H A;  4K5X A;  4B08 A;  4B9X A;  3I91 A;  2B2V C;  5FO8 B;  5CMD A;  3FPP A;  1GXD C;  1I4R A;  2QEJ C;  3LX0 A;  3BS1 A;  4RA8 A;  3VA7 A;  2HCI A;  2V4D A;  1TU2 B;  2KED A;  4IQZ A;  5I6W A;  5E4W C;  5JOB A;  4DA2 A;  2K32 A;  1L0X B;  3RLF A;  3SEB A;  3M7N A;  1GUS A;  4XYO A;  1EY9 A;  2C9O A;  3WOE A;  1BQQ T;  3IFD A;  1TS5 A;  1SNQ A;  4HCE A;  1BXT A;  2IX1 A;  1U4L A;  1KNA A;  4S3S A;  4HR7 B;  4ZK9 B;  2XVS A;  1WD0 A;  1CZW A;  1QG7 A;  2K7V A;  4V0B A;  1PLF A;  2B2Y A;  1M4V A;  1J8I A;  5KGU A;  5FK9 C;  3GTK B;  4FF4 A;  1CA5 A;  4FXG C;  3UI2 A;  5KNB A;  3NQI A;  1QNK A;  4RHR A;  4Q5V A;  3CKI B;  5LL6 X;  1MSH A;  1FNW A;  4R9W A;  2F0S A;  1LTT D;  2VB3 X;  2EVB A;  3MXU A;  1HQR D;  3V2T A;  1TWC B;  1G91 A;  5D3I B;  4NP5 A;  5KNC A;  3DM1 A;  4PMC A;  4NMZ A;  2PNR C;  4IZ8 A;  1I4G A;  2FMC A;  1A6X A;  2JP1 A;  3H0G B;  4C3H B;  1GUO A;  1SYE A;  1RDP D;  2RDG A;  1GUT A;  2JA8 B;  3C3L A;  3HKZ B;  1LTB D;  1D5X C;  4DK0 A;  4CHT B;  3D6C A;  3GV3 A;  2F0T A;  1B53 A;  1JWS D;  3OPO A;  2F0N A;  4ZKC B;  2FFK B;  5C4Z A;  3TZU A;  5EGT A;  2G9D A;  3AB9 A;  3PIO 3;  3FDT A;  1EEF D;  2PZU A;  2F0L A;  3I72 A;  3D4R A;  4ZYS A;  2F0V A;  3WDN A;  3DEO A;  1DM0 B;  3P7J A;  4KN4 C;  4L8J A;  3MXP A;  3N52 A;  4RWS C;  2MPM A;  3MFY A;  2BOS A;  5KND A;  1HFG A;  4LAA A;  2E2D C;  2NUC A;  1TQO A;  4PMW A;  1LTI D;  4DGZ A;  2N55 A;  2XNA C;  4QB4 A;  5D3D A;  4A3G B;  4CJ0 B;  1JR0 D;  2E2J B;  2DY7 A;  2FJ2 A;  1NUC A;  3I73 A;  4KHV A;  4G7Z C;  4CGY B;  4HSP A;  3NBI A;  1SE3 A;  3RMH A;  2PYK A;  4I7Z C;  3ZYY X;  1F2M A;  2VXW A;  4FVM A;  4IUV A;  3GTG B;  2A68 D;  3HRZ C;  5C44 B;  2AQ1 B;  1STY A;  4A3M B;  5I2X A;  3E5S A;  1AEX A;  1LT3 D;  2EYO A;  3J81 E;  5ELB A;  5CV4 A;  1W6J A;  4BY7 B;  1SNC A;  4ABN A;  2RBM A;  5A2Q L;  3K7A B;  1Q12 A;  1M8A A;  3TP7 A;  5DNF A;  1NSN S;  1X32 A;  3BVG A;  2HUG A;  2PO4 A;  3I4N B;  4O1N A;  4UAI A;  1STE A;  2HDL A;  5IGB A;  5KRU A;  1BO0 A;  3FMC A;  4OGQ C;  1F2Z A;  2E2I B;  4UDU C;  4ZQ3 A;  4CKC A;  1D1I A;  1E2Z A;  5CV5 A;  5ELE A;  2PW7 A;  1WTX A;  1ESR A;  5I9P A;  2PW5 A;  2B2U C;  3E6Z X;  5IGD A;  4ID6 A;  3OW7 A;  1SND A;  2FMM A;  3QB3 A;  3T56 B;  1GUN A;  3TSS A;  1LTS D;  2Q8R E;  4DAP A;  3Q6S A;  1V1P A;  3HP3 A;  2A73 B;  2AQ3 B;  2MJ8 A;  3D3R A;  1GUW A;  5ISR A;  3A8I E;  2F0H A;  3CQZ B;  3Q22 A;  4H44 C;  2ID0 A;  4HTH A;  1MI2 A;  1ML0 D;  1ET6 A;  1AW7 A;  5CV6 A;  1F9R A;  2F0Q A;  1PTO H;  1MD2 D;  1JC7 A;  2WAQ B;  4KJO A;  1DOL A;  4Q0F A;  1O7L A;  3VYT A;  4KK7 A;  1A2U A;  5M9O A;  1SBB B;  4DNR B;  4OL7 A;  3ERQ A;  3VYS A;  1LV9 A;  5E4X A;  1LTA D;  1D1K A;  2XN9 C;  1JOK A;  4A3F B;  2A5H A;  2Z8L A;  1RHP A;  2EY6 A;  1OXT A;  1JE4 A;  4PNY A;  2BDO A;  1WVL A;  4IUU A;  2K5Q A;  1CTM A;  1QOH A;  4G7H C;  1ILP A;  2JSO A;  4V19 0;  4BA1 I;  3E0J A;  2F0G A;  2R6G A;  1EFI D;  4RHS A;  1ENF A;  1B9M A;  1JB3 A;  2EY5 A;  2Q8T A;  5EBC A;  3VR4 A;  4ILW A;  3M4Y A;  2EJG C;  3OIP A;  2F0O A;  5A35 A;  1IYV A;  2J7Z A;  2A68 C;  2EJM A;  4K5V A;  2K5D A;  4F87 A;  1EY0 A;  2VB2 X;  1DOM A;  3W3A A;  1SDF A;  3MAQ A;  1RKN A;  4EVO A;  1VMC A;  3OOC A;  4GZY C;  4XQQ A;  3S1N B;  4DU9 A;  3RZO B;  1TVX A;  1BR9 A;  1KDA A;  3P75 A;  3I4M B;  3QJY A;  4KY5 A;  3SK8 A;  2L12 A;  4R8N A;  4HCS A;  4TKO B;  3VR2 A;  1SNO A;  2F0K A;  3OMG A;  1EU4 A;  1EYA A;  3EA6 A;  2J0T D;  1EIG A;  4LK1 C;  3GTL B;  2F3W A;  3GTQ B;  2NTS A;  1VMP A;  1TWH B;  2CQA A;  2XSC A;  1Y8O B;  5FKA C;  3ND9 A;  3KLS X;  4QMG A;  3AMU A;  1SXT A;  1KDB A;  2RA4 A;  2ICE C;  1FNU A;  1PRT F;  1GJX A;  3T53 B;  3HOX B;  1H9R A;  2EOT A;  3LNN A;  5C0X I;  1IKM A;  1Y1V B;  2Z4I A;  3NP8 A;  2B2V A;  4FNF A;  1B9N A;  4A3K B;  1CQV A;  3EVQ A;  1A2T A;  4C3H G;  2FIN B;  2OXP A;  1BF4 A;  3GP7 A;  4RKB A;  3ERO A;  4DK1 A;  2X69 A;  1H9K A;  1S5B D;  5K36 H;  3D8G A;  4OIK A;  1STH A;  2BDN A;  1EOT A;  1FGB D;  5IT9 E;  3K5L A;  3BDO A;  4CJ1 B;  2HQE A;  3PO3 B;  4CKE A;  1OXX K;  3J80 E;  5EKI A;  1EWC A;  3I8Z A;  1S5C D;  4RGM A;  4X3T A;  4BY1 B;  1SE4 A;  5DAU A;  4FO2 A;  1PTO F;  2YU9 B;  2IW3 A;  1B44 D;  1UAP A;  3S14 B;  3OMC A;  5IGC A;  1PFB A;  1HCZ A;  4CBV A;  1Q90 A;  4IFD I;  2EDG A;  4F8M A;  1JOO A;  3F2U A;  3KUP A;  1TR5 A;  5HGT A;  2ICI A;  1UEA B;  3S2H B;  2E75 C;  2NZ1 D;  3PIP 3;  3EQL C;  3I70 A;  5CV9 A;  2K1B A;  2B39 A;  3SK6 A;  1L0Y B;  3GTP B;  1SNM A;  2JA7 B;  4C3J B;  1Z6H A;  2WKC A;  2NWG A;  5I6Y A;  1F2Y A;  4XT3 B;  1LT5 D;  1JOR A;  1EZ8 A;  2EYM A;  1I3Q B;  2DNE A;  3V96 A;  1FD7 D;  2IL8 A;  3FKI B;  1F2L A;  1ICW A;  2CHB D;  5EJW A;  1KAB A;  1Q1E A;  5C0X G;  1ILQ A;  3QO2 A;  3V05 A;  3S1R B;  2RDH A;  4ZUJ A;  4K6L A;  5FLX L;  2XWB B;  4C2M B;  1Q1B A;  1BDO A;  2EPB A;  2KEC A;  3NUC A;  3TDQ A;  1Z47 A;  3S1Q B;  1VCI A;  4XT1 B;  3TBI B;  1KLG D;  4E6I A;  5CV7 A;  1G8Z D;  2Z1C A;  2JE6 I;  2EZV A;  2F4I A;  1PRT D;  3R2I A;  3A7L A;  5HUR A;  3QOL A;  3C2P A;  3MHB A;  1TT2 A;  2LS0 1;  3NTI A;  3CRL C;  3BVZ A;  1TWA B;  3HOY B;  1PDQ A;  3SXH A;  5C3X A;  4FF3 A;  4M8A A;  2F0W A;  4XQJ A;  1BBX C;  3KF8 A;  4MN3 A;  5FO7 B;  2QCP X;  2DNC A;  3RD4 A;  1QIL A;  1CFM A;  3K0Y A;  1E2V A;  4HN7 A;  1R9T B;  4XQN A;  1U9R A;  1LAC A;  1A15 A;  4AYB B;  4L6T B;  1QB5 D;  1TS3 A;  2PMZ B;  1BOS A;  1SYF A;  1EL0 A;  1BUV T;  4IFD G;  2MP1 A;  4X3S A;  3MVV A;  2E74 C;  1D5Z C;  4A3J B;  2FHT A;  1C48 A;  4IN3 A;  1SJH D;  1S5D D;  3IKJ A;  2RKS A;  3VA5 A;  2SNS A;  1QCB D;  1XXG A;  1HQM C;  1EYC A;  4G57 A;  3C1E A;  1EIH A;  3T4A C;  3URY A;  1CM9 A;  2KOL A;  4FYD A;  3R2T A;  4RAU C;  1IYU A;  4LMQ D;  2R61 A;  2KEE A;  3M7G A;  1STN A;  3GTJ B;  1U4P A;  1V1O A;  2RQX A;  3SK5 A;  3I4L A;  4P2C B;  1H9S B;  1AZQ A;  4OO1 I;  1CT1 D;  2EYP A;  4DF7 A;  3FRP B;  1SYC A;  2B2U A;  4Z9C B;  4NW2 A;  1NAP A;  4KY6 A;  3A7A B;  4RH6 A;  5K5P A;  2B8G A;  1EU3 A;  3OHX C;  1SFO B;  3J7A V;  1U4R A;  1GHK A;  2X6G A;  2K04 A;  1PRT B;  5C0X J;  3NHH A;  4TSS A;  2B2T C;  3EFX D;  3HS0 C;  2SEB D;  3PV0 A;  3PUZ A;  4QUF A;  2F0J A;  1HA6 A;  3T51 B;  5CYU A;  1CI3 M;  4YIJ A;  2RVL A;  3I90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...