4QUFA

Crystal structure of chromodomain of rhino with h3k9me3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
EEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords RE36324p
publication title Transgenerationally inherited piRNAs trigger piRNA biogenesis by changing the chromatin of piRNA clusters and inducing precursor processing.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 13
structure length 57
sequence length 57
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4qufA00
3I90A 2FHTA 3LWEA 2L1BA 1BBXC 4IUTA 2B2WC 2HCIA 4NW2A 5E4WC 1PFBA 1ILPA 1LV9A 3P7JA 1M8AA 1X3QA 3KUPA 5CORA 5EPJA 2SDFA 1F2LA 2VXWA 4XDXA 2KUMA 1G6ZA 1DZ1A 1ILQA 2FMMA 2K04A 1NR4A 5T1IA 1HRJA 1HUNA 1DOMA 1O7YA 4OIJA 1E0BA 1PLFA 4X3KA 2B2YA 1PDQA 2B2UA 4RWSC 3FDTA 4X3TA 2XIWA 1IL8A 2L4NA 5EPLA 1CA6A 2B2YC 4XT1B 1VMPA 1EIGA 1AZQA 3N52A 3G7LA 2K05A 1XYIA 1XX8A 1RTOA 2MJ8A 2NWGA 1ML0D 4MN3A 1EL0A 5EQ0A 5EPKA 1C8CA 1SAPA 4RA8A 1HFNA 1NAPA 1PFMA 1X3PA 1O80A 2DY7A 2RVLA 2EPBA 2L11A 1AP0A 1KNAA 5DNFA 1GUWA 2MGSA 1F9RA 2B2TA 4HEDA 1B3AA 1O7ZA 1U4LA 4IUPA 5EJWA 1BO0A 3GV3A 3I3CA 4QUCA 3F2UA 2HDMA 3MWYW 3TN2A 1QNKA 4IUVA 2MPMA 2B2TC 1JE4A 2DY8A 2EE1A 3ONAB 1JICA 4U68A 3UI2A 4DN4M 1WTPA 5AFWA 2L9HA 2B2VA 1HA6A 2N88A 4HSVA 3IFDA 3GV6A 4R9WA 2NZ1D 5EKIA 2RSOA 3KBXA 4CJ1B 4X3SA 1WTVA 2B2UC 1F9SA 1WTXA 1QG7A 1PFNA 1KNEA 2KVMA 1HUMA 1QE6A 1IKMA 1WTQA 2CVRA 2K1BA 1EQTA 3Q6SA 5E4XA 1G2TA 1WD1A 4HAEA 4XT3B 1NCVA 1Q3LA 2KECA 1EIHA 4ZK9B 5CBEE 1IKLA 1DOKA 5CMDA 3FPUB 1DOLA 3I91A 4HCSA 1DONA 1WTWA 2FJ2A 1TVXA 2JP1A 2X69A 3DEOA 1WVLA 2JYOA 2X6LA 4IUQA 1G2SA 3I8ZA 1EOTA 3HP3A 4CJ0B 5JJZA 2M2LA 4IUUA 3IL8A 1J9OA 2IL8A 4LMQD 3TZDA 4MHEA 1B50A 3H91A 2L12A 1WD0A 3QO2A 1B2TA 2HCCA 2FINB 1F9QA 2H1EA 4R8IA 1SSOA 2KEEA 2B2VC 3MTSA 1ICWA 5COYA 1ESRA 1G91A 5D65A 2EOTA 3DM1A 4ZKCB 3D6WA 1WTOA 2X6GA 3R93A 2Q8TA 1AZPA 5CBAE 2D9UA 2R3ZA 1F9PA 1MSGA 2K01A 2NYZD 2RA4A 1B53A 1NR2A 4O42A 2N55A 1RODA 1X32A 4UAIA 1S4ZA 4X3UA 5D14A 2KEDA 1SDFA 1VMCA 1U4RA 4IURA 4ZAIA 2J7ZA 1CA5A 1MGSA 2FFKB 1U4PA 2BDNA 5T1GA 4CJ2C 1J8IA 1HHVA 1B4OA 1U4MA 4QUFA 2Q8RE 1RTNA 2MP1A 2RSNA 2K03A 2HDLA 3SVMA 1A15A 4ZKBB 1MSHA 1RHPA 1RJTA 4RAUC 1CM9A 2HUGA 3DEPA 4OIKA 4ZLTF 1BNZA 1MI2A 1WTRA 2KOLA 2K28A 2B2WA 1HFGA 1BF4A 1ZXTA
chains in the Genus database with same CATH superfamily
1HZAA 2JA5G 3TS0A 3ULLA 1OTCA 1KAWA 2DN8A 4KY5A 3I4LA 1E2ZA 2RCNA 2K04A 4QIWB 2CW0D 4LFBQ 2V4DA 4GN4B 4DAVA 3CKIB 2A68D 2VNUD 3A54A 4K6LA 2PNHA 2CKZB 3BG3A 1NUCA 3I7FA 1QWYA 4FVMA 2YV5A 1YNXA 1PTOF 3HOVG 4C3JB 3K8AA 4A3CG 1PFMA 3A7AB 1VQKA 2F0OA 1A3UA 2EPBA 2SOBA 4YWKA 2MNAA 4HIOA 4L6TB 1VQEA 2SNSA 4APVA 4EGVA 4Y7NH 2JXMB 4OEMB 4K6DA 3U9SA 3STBD 1ESFA 3UI2A 4KY7A 4C3HB 2NVTH 4U673 3HRZC 1C4QA 4JI5L 2RSOA 1L2FA 1A3TA 1HTPA 3RZOB 2B2UC 4LJZC 1F2YA 2F0SA 3Q22A 4XQJA 2F0MA 2TSSA 3D0FA 1CSQA 2M00A 2UXCQ 3AFPA 4PMCA 5E4XA 1HTLD 5FLXE 2OEOA 4YIJA 1I4HA 2HQLA 3H09A 4LF7L 2WFWA 1Q90A 1FJGL 1WI5A 1WTHA 3Q0AA 5JJZA 3J81j 3IL8A 1D5XC 5ELBA 2CFMA 4HJ5A 1EZ6A 2N78A 2OTJA 5LHY1 2H1EA 4CDCC 2A5HA 2JA8B 5COYA 3S1NH 4YWLA 4POGA 1YZ6A 3KDFA 1SNPA 1Y8OB 1Z6HA 1MSGA 5HGQA 2EY1A 2XTIA 2N55A 3CMAA 5M3FG 1XMOL 2HT1A 3LGJA 4JI8L 1MGSA 2MO0A 1YJNA 1CK1A 3J80L 5M5XH 2PMZB 3G48A 1P8LA 2RSNA 4R4IA 5AJ3L 1YNND 1RJTA 1UEBA 1YBYA 2EYLA 1SNMA 1EYGA 2I5LX 4K8JA 3T16A 3MAQA 3JC66 4HMJA 5IOCA 2F4IA 5A35A 2HCIA 3OHXC 4NW2A 1QUQB 4P72A 4HTHA 5EPJA 1TQOA 3TP6A 1DZ1A 2KCNA 2Q2HA 3WOEA 2UUCL 1PYBA 3GTGB 3RLNA 1I50B 1CQVA 5DLQE 3H94A 1N36Q 4A3BH 1IHZA 1LABA 1R4QB 1BR9A 3G7LA 1L1OB 5KYLA 3NELA 5CV7A 1EZ8A 1HZ9A 4ABNA 5HURA 3T1YQ 2JA9A 2PW7A 1Q82C 3GTLB 1KL9A 1FNWA 2MPMA 4J1MA 5EKKA 1HNXL 2WACA 2GVAA 1VQOA 1PYSB 3RNUA 2JA7G 1WTVA 2IY5B 2A6ED 1WTXA 1WJJA 3S1RH 2PZWA 1GKHA 4X62L 1NMFA 1LT3D 3TS2A 3U9OA 4YHHL 1PFSA 2K1BA 1Q46A 4A3EB 4C2MH 2DNCA 2LFNA 3HZXA 3K7AB 5G3LD 4GOPB 4XTCS 3M7NA 1K28A 3F2BA 1QOHA 1WVLA 3DEOA 3NBHA 4MZ9A 1SLJA 1EOTA 3TBIB 1H95A 1PZJD 3QOLA 3TZDA 2PO4A 3T4AC 1B2TA 3I4MB 3HGBA 4C3IG 1IBLQ 3V05A 4BWGB 1G91A 4G7OC 2IX0A 4A3FG 4L63B 5IYDH 3ICEA 3S14B 1S4ZA 4BY7G 3OWEB 3S2DH 4EX5A 4K14A 1Z9FA 1RHPA 1CT1D 1PTOB 3GDEA 5C6AA 3UE0A 5IYCH 1TU2B 5FO7B 1LTLA 2XN9C 5LL6S 2Q8IB 4DXGA 1T5XD 4YWMA 3M4OH 2JA5H 2XWBB 1Q81C 2MUYA 4NP5A 5FK9C 1A3VA 2B63G 3S1QH 1EUJA 4DR5L 5BN3A 3MXUA 5JVH3 4LF7Q 3JAMi 1FJGQ 4TVAB 2Z9HA 2OQKA 1N32L 1C9OA 4HN7A 2RCFA 3OMGA 1PRTF 1K73C 1E0BA 4CGYB 2UXBL 4B9WA 4ME3A 5M3MH 1VQ7A 5FOBB 2A74C 3HOYB 1NNXA 3QR8A 5HY6A 4KV6A 2F0HA 1AZQA 4EVOA 4G7HC 2K7VA 3U58A 1TWFB 1RDPD 3HOVH 4CKEA 4JK1C 1XMQL 3K5NA 2MHVA 4RH6A 3KFUA 2NZHA 1I4PA 1AP0A 1EYAA 2IX1A 1BO0A 3QJYA 1SROA 3M4PA 4OO1I 3DXJC 3PF5A 2B2VA 1D1IA 1U9RA 4DU9A 1FGUA 2NZ1D 1SNDA 3M85A 5BR8L 4JBWA 3KK7A 2XSCA 2JA6B 2C9OA 2KVMA 1I4RA 2E2IH 2JN4A 3QIAA 4V0BA 2ZXPA 2RF4A 1WTQA 1D1KA 2LY7A 1HQRD 1Q3LA 5M9OA 4ZUIA 4HJ9A 1IKLA 4HSPA 2LS01 5K5PA 5IYBH 1SE2A 3H3VC 3IKJA 4DXFA 2EQSA 2WINB 3J81L 3SHLA 4AQYL 4IPCA 2WKDA 3V2TA 4OX9Q 4JI0Q 1SN8A 2L12A 4GS3A 1B8AA 4K2KA 5ISRA 1GD7A 1AZPA 5ELFA 1VQNA 3DHQA 2R3ZA 5M3FH 1JWSD 3OWFA 4JI4Q 3S17B 1EEFD 1H9SB 2J7ZA 1HNXQ 1IBKL 5T1GA 4JVZA 1EYCA 4R1JA 2HQEA 1M1KC 1EY8A 1VQCA 2MP1A 3P1HA 2G9HD 5KNBA 3T1HL 2K03A 4HJAA 1QVFA 5L37A 1MSHA 1YEZA 1T9HA 1WCMG 4OIKA 2K5NA 2Y0SG 3DWQA 3CD6A 4KHPQ 4N9PA 1K3RA 1XPOA 4YHHQ 1S5DD 1I94L 3LWEA 2QKIC 4NPSA 3K81C 2R93B 2NVYH 1VQ8A 4K0KQ 5C3EB 1DD2A 4JI1Q 1KIXA 2Y0SE 4XDXA 2JSOA 2KUMA 4RGMA 1TT2A 2K50A 2ALYB 4IJLA 1PH1A 5F2DA 3CCEA 4KN7C 1STNA 1TIID 2VUMH 2I5HA 1E1OA 2A1AA 5DEHA 3VR4A 2AQ2B 1DXMA 1IYJB 4AYBB 4LWCA 2L55A 4DV0L 4DR2L 4K8IA 4TSSA 3HS0C 4OELB 4BA2I 2WB1B 1PTOD 1CKOA 1CUKA 1I3QH 4HIDA 4NMZA 3J7ZC 4JV5L 1BCPF 3U4ZA 3SGIA 4DF7A 1VCIA 4L5RC 4F88A 4NB3A 1QB5D 1CI3M 3GV3A 1JE4A 2QILA 1GUNA 2VQEQ 5I2XA 1HR0L 2JA7H 4HSVA 3VYSA 1IYVA 3F8TA 4IPDA 4BBSG 2CCZA 5C4HA 2N3SA 4DA2A 1N32Q 2B3GA 3P75A 4LFCQ 4I7ZC 3CCVA 1NCVA 1D2BA 1MJEA 4DK6C 3PUWA 1VQ6A 2UXBQ 3RZDB 3GTJH 3J81c 1SNOA 1JWUD 3VDYA 2X6LA 3HOWG 3ER0A 1QZGA 2EYJA 2IX3A 1PMRA 1YHAA 4C3IH 1CKMA 1SNQA 3S2HB 2WAQB 3MTSA 3OIQA 1WTOA 3D6WA 4A3FH 1FVIA 3EN2A 1PRTB 3PSIA 5EAYA 3J7A5 4BY7H 3KLSA 1HCZA 1S5FD 4A3IH 3KYHC 2UUAQ 2NTSA 4LF8Q 3BDOA 2E2HH 4G7ZC 3HOZB 4LUVA 1K83B 4L5QA 3FRPB 4JPBW 4ZKBB 2K5VA 4QIWE 4LFBL 2NN6G 1G51A 2KOLA 3FVQA 2PPBC 1V1PB 3K0YA 1EY0A 3UDIA 3E0JA 2C35B 4QGUA 2B63H 3C1EA 4O2DA 3H3VH 4OGQC 4A93B 1V1OA 2HHHQ 1IBMQ 3S24A 1G6ZA 5IT9L 4AQYQ 1R9TB 4C3HG 5KNDA 3MFYA 2NN6I 3C3LA 2EY5A 2KQ3A 2E8GA 4OO1H 4L5SA 1BDOA 2B29A 1YHBA 1G291 1XPRA 2NWGA 4MN3A 3Q23A 4DUYQ 3F1ZA 3HKZB 2ZT9C 4P74A 1Z47A 1SAPA 3VR5A 1EY7A 1LYLA 1ASYA 3M3YH 5I2YA 2PI2E 1ZYRC 1YNJC 2R7ZB 2LMCB 1AW7A 3DUZA 1K8OA 1CZWA 2ZTEA 1EQRA 1TR5A 4PQXA 2M9VA 1OXSC 3KOJA 2DY8A 2JK8A 1VQIA 3L2PA 1DM0B 2NVXH 1RD9D 2RDGA 1BBUA 3BZDB 2HIVA 3PQIA 3RMHA 3BZCA 4YCVA 4J6HA 4A3BG 1X3GA 4CJ1B 5IWAQ 2EY6A 2KCMA 2KHJA 1QG7A 5K36G 1LTGD 3PCOB 3G4SA 3PO3B 1EQTA 4JOIA 3IFTA 4A3KB 3FHWA 3H0GG 4ZK9B 5CMDA 1S5CD 4HCSA 1NTGA 3CMEA 1TVXA 5E3FA 3PO2G 1KC8C 1KLGD 4DV0Q 2R7DA 1TS5A 2QEXA 1WD0A 1CTMA 1XTDA 2PI2A 2G5DA 2PMZE 3BZKA 3OW2A 4QL5A 4CKCA 2D9UA 4TKOB 3S15H 1A63A 4RKBA 1EQVA 1B53A 2BA0A 4G57A 1RODA 4A3DH 5IP9G 2O5JC 4IURA 3FKIB 5CV9A 5E1FA 3I4NB 1SE3A 4FXDA 1U4MA 1HR0Q 1PH9A 3TP8A 1RTNA 1S72A 1CHQD 3SVMA 1MKHA 1JT8A 2AUKA 1WCMH 5M5YH 2HUGA 1BNZA 3C1FA 4RCNA 3M4QA 1BCPB 1PH5A 4B3RL 3CRKC 1ENCA 1CQFA 3GTQH 4LUOA 4XYQA 1LV9A 1LT5D 4UHVA 3KUPA 5IT9c 3J80E 4PNYA 2AHOB 4FO2A 1Y1VB 3CHBD 1HUNA 1HRJA 1PRTD 4BBRH 4KK7A 2XGTA 3TQYA 4DR4Q 3L7ZC 4QY7A 5C44B 1EFWA 4XIGS 5BN5A 2L4NA 1KDBA 2F0UA 3T53B 4XT1B 3BVZA 4DR1Q 3SEBA 2Z6KC 4A3EG 2E2DC 1LLRD 3BDCA 1EL0A 3PUXA 2E76C 2F0JA 1TY0A 1I4QA 3CXCA 4WRDA 3GTKB 2VZAA 5C4ZA 1CFMA 4BY1H 1V8QA 2KBNA 1JJ2A 1K8GA 1VQFA 1OO9B 4IUVA 3I4MG 5KIXA 3ITPA 1O7IA 2CH4A 1WTPA 3SK8A 1GO3E 1SMYD 1N9WA 4Y7NB 5J1ZA 5M3MG 3IFDA 2TMPA 1L1OA 3BYTB 4BBSH 3UDFA 2NVTB 1KNEA 4G4KA 4K5VA 4C1NK 4EQ5A 4LF6Q 3EBEA 1IBLL 2CH4W 2F0WA 1WD1A 3VYTA 1UE6A 4NDXA 4XT3B 4WJ3M 1K8MA 2F0IA 2ASBA 3HOWH 1QVGA 1EOVA 4IUQA 2E75C 4CJ0B 3KJPA 2L0CA 4A3MH 4IUUA 1KQSA 4QJFA 4YY3L 3QO2A 3IRBA 3QG1A 4CHTB 2KEEA 4DV6Q 3MEFA 2V1CC 4JCVE 2UUBQ 3E6ZX 4ZKCB 3AFQA 1JB7A 5JJIA 2UU9Q 5D14A 3MZ5A 3B6YA 4X3UA 4GOPA 1EY4A 1U4RA 3S16H 1J8IA 1VQ4A 2F0NA 1AEXA 4CJ2C 1EY9A 1B4OA 5IYBG 1GHKA 1HPCA 3HOYG 5C4XB 3NHHA 4PMWA 4FF4A 1I5FA 1LM0A 2PNRC 5JVG3 2NN6H 4R4OA 4C3JH 1WTRA 5M5XB 3URYA 3BVGA 3BU2A 2GN5A 4RGNA 2QDBA 4LW1A 1X9NA 1B9NA 4JBJA 4QCLA 5GAEC 1PH4A 2CWAA 1W2BA 4C3HH 2KHSA 1IW7C 3NPPA 1EFID 4LNQA 3RZOH 1F77A 4EQOA 5KGUA 3I55A 3NTKA 4A3GB 3MHBA 4K2LA 1TWCH 1BCPD 1BUVT 1HFNA 2G9DA 1X3PA 4ZYSA 1E3PA 2OQ0A 4GKKQ 4A3JB 4QMGA 3KJOA 3R2IA 1GUWA 2MGSA 5I6WA 4IQZA 4DNIA 4DK3C 1M4VA 1PH2A 3I56A 4GZYC 3RLFA 1W6JA 5JOBA 5GROA 2VUMG 4JYAQ 4B3RQ 4B3SL 3RN2A 4X3SA 2BDOA 4CKBA 3ND9A 1D8LA 1F9SA 1HNWQ 5K36H 1PFNA 2F0DA 5KNCA 4JI0L 1VQDA 1HUMA 1QE6A 1TWAB 4OX9L 1IKMA 3A7LA 1LT4D 1OXTA 1G2TA 2QEJC 3S1RB 3H0GH 4HIKA 5CBEE 2ID0A 5CV8A 4POFA 2X69A 2JYOA 3PO2H 3G71A 4JI4L 1IYUA 4C2MB 5KEEA 1J9OA 1HNZQ 4WJWA 4JI7L 1NBWA 4LF5Q 4NKLA 2HCCA 4JBKA 5FO9B 1SSOA 4DV3L 1GUOA 3CCSA 3L3OC 4HJ8A 4JW0A 2R92G 4KHPL 2NUCA 1AFPA 4UAIA 5IP9H 3GTGH 1AH9A 3NK9A 4N9TA 3J81E 1N33Q 4K0KL 5I4DA 1FNVA 4JI1L 3G6JB 1TWGB 5IP7H 5JJLA 2HDLA 1UAPA 4KKTA 3I72A 3S2DB 2WB1G 5HGTA 4F87A 4XQNA 3DWPA 1WYDA 2K28A 3T51B 5I6YA 1SMXA 1TKWB 3A8JE 3GTMH 1I4XA 1PYWD 4Y52H 4AYBE 1H9SA 2K5QA 3CCMA 4B9XA 1AE3A 2B8FA 3UE1A 3M4OB 2VS1A 2WB1E 1JR0D 5T1IA 1LT6D 2PYKA 4A3IG 1PH6A 3D4RA 1X65A 1N34L 4YY3Q 4PZ6A 3A5ZB 3LX0A 1C48A 2O4XA 2PQAA 3A5UA 1V9PA 5CV4A 2EJMA 2VY3A 3LNNA 3P20A 4A3EH 1Q1BA 3PIP3 2VQEL 4IOAA 3K7AH 5EQ0A 3CCUA 3KF6B 2EYOA 2L11A 2E2JB 1S3OA 4J15A 4FNFA 5LMUQ 4LFCL 4GLAC 3I4MH 4X6AH 4HMIA 3D8GA 2R61A 3ZYYX 5AFWA 1KXLA 5J22A 1LTRD 5IGGA 2K75A 3S14H 5GADC 4OO1G 5LMNW 3PIOA 1Q7YC 1H9MA 3HOZG 1E2WA 4DPGA 2WAQE 4HAEA 1FYCA 4KTAA 1PH7A 1DYQA 2E2IB 1D6EC 5GAHC 4QF4A 1PTOH 4X64L 1WTWA 4IFDG 5C0XI 1QNUA 4DK1A 3CC4A 3HOXB 3HOUG 2ZTCA 2LSSA 5E7NA 1GM5A 2UUAL 2A69D 4LF8L 2ZJRA 1SBBB 3PUYA 1CSPA 4Q0FA 1EIFA 2AQ1B 2DJGC 2Z1CA 2Z4IA 2ZXRA 2B2VC 3CAMA 3E0EA 3J7AV 3H15A 5D3IB 3DM1A 2Q8TA 1UUPA 1JORA 1BXTA 3PMFA 2ENBA 4IFDI 4KJOA 1QCBD 3CC2A 1VQLA 2KHIA 5IIFA 4DAPA 4QUFA 3CCJA 3HOYH 1SYEA 2HHHL 1IBML 4B3SQ 5JJKA 1JCKB 3CPFA 5JPMC 1TWFH 1MD2D 1MI2A 1E24A 3Q24A 4OWXB 1TS2A 1BF4A 1X6OA 2NB0A 2HD3A 2FHTA 4A76A 2R7ZG 1GUGA 1SYBA 4UP8A 1HQMC 3W1BA 1STAA 1QJOA 2NZOA 2QGQA 4DUYL 1GXDC 2Z8LA 2PW5A 3HKZE 4A3DG 2FMMA 2J0TD 4JI7Q 4RMFA 2AKWB 1O7YA 2MO1A 4Z9CB 4DV2Q 2B2YA 4M8AA 1PDQA 4YCUA 3X3MA 1IXRA 4DV3Q 1SR3A 1JOQA 2JJQA 1CA6A 3C2PA 1V1PA 2B2YC 1Z7TA 3ZJYC 2K5WA 5GQOA 2CWPA 2MJ8A 1X3EA 4MIUA 4DGZA 3OMCA 1KDCA 5IT9E 4H13C 2KA7A 2EXDA 4RA8A 4H0LC 5IWAL 3DM3A 3FEWX 1B9MA 2VB3X 1SEBD 4CDEC 1CHPD 2CW0C 5CGKA 2A68C 3GTOB 1Y1WB 5EJWA 4IUPA 4KKSA 4Q5VA 2D5DA 4TRDA 3E9HA 1S5BD 3ULPA 4BBRG 4U68A 4CDDC 5ELEA 1HA6A 1KLUD 2SEBD 1DGSA 1UNSA 1ASZA 4FF2A 3OIPA 3S17H 2JA7B 1HA5A 2EYFA 1AN8A 4GN3B 1YIJA 1ENAA 1DCZA 1LUZA 3E3XA 3A56A 2YU9B 1D7QA 3QOJA 4GLVB 1N34Q 4PG3A 4BY1G 1L0YB 3STBC 1A2TA 5C4JH 2EJGC 3S1MB 3CCQA 5EBCA 3U50C 3I8ZA 5J3BA 1HZBA 3F2CA 2FMCA 3J80i 4GNXA 4MHEA 2FINB 1F9QA 4XQQA 4BXXG 4GNXC 2QW7A 4AIMA 2R92H 1ZKOA 4ZUJA 1TWHH 3MXNB 5CBAE 1W3SA 1NSNS 2F0TA 1SDFA 4A3FB 3RR5A 1EY5A 1NY4A 2A19A 3K59A 1PHJA 2ATWA 1Y69U 4DNRB 2RKSA 5FLMG 4O0AA 2CHBD 2I5MX 4A3MG 2H5XA 4DR4L 5IY0A 1BOSA 1G8ZD 2RDHA 3W5OA 2KCTA 1ZXTA 1JOKA 2BOSA 3I90A 1U5KA 4DR1L 1STEA 3P7JA 2XRSD 1X3QA 4X64Q 3CQZH 1J5EL 3EJIA 3UDGA 2B63B 1NR4A 3DWAA 1YNNC 3X3NA 2LXJA 3CF5A 4HCEA 4BS9A 4OIJA 1PLFA 1P16A 1EWHA 4LF9L 1FR3A 4C3JG 3N52A 4RGOS 4ZQ3A 2F3IA 1B70B 3OTOQ 3CCRA 3SE0A 5EBDA 1O80A 3F2DA 2RVLA 2RHSB 5M5WH 3HFZB 2NBFA 1K8AC 2B2TA 4DV7Q 3GD7A 1B3AA 1O7ZA 4DV5Q 2A73B 4LF6L 3GTPH 3M7GA 4X65Q 3N6RA 1R4PB 3MWYW 2ZTDA 1ET9A 2B2TC 3S2HH 1RF2D 5FO8B 4DN4M 3U4VA 5C0XH 3GV6A 3GQBA 4GKJQ 1SFOB 2NVXB 3PGZA 4OHJA 1X56A 4KN4C 4H44C 3D31A 3K5LA 1GOZA 3FP9A 5DM73 4UY8C 3HOZH 1K83H 3BJUA 4DUZQ 1CZGA 4ULLA 4DV6L 3EVQA 2UUBL 1A6XA 3FPUB 4DFAA 4IFDH 2UU9L 1KABA 3V96A 2ICIA 5FJ8H 3HOUH 3K58A 4DR7Q 2M2LA 2JA8G 2WV6D 4E6IA 1YVCA 2A6EC 3BYYB 4ID6A 4GN5A 4K5WA 4A93H 3CPWA 1RL2A 3RLOA 1LO5D 3CC7A 3D4DA 4UP9A 1R9TH 1F9PA 4S3SA 3AMUA 2UXDL 4JI3L 3KLRA 3PIPA 2E5LQ 4DV4Q 3A0JA 1OXVA 4PZ8A 4KJNA 1K0RA 3S15B 2XVSA 4JOIC 2CQOA 3K5OA 2Z4HA 3MEHA 1HH2P 3NBIA 1D5MC 1EU3A 4A3GG 4F7XA 1EY6A 3A55A 2YTVA 1I6HB 4HIMA 1BQQT 1WCMB 2OCEA 1PH3A 2R7ZH 3I4OA 3NWTA 4P73A 2L1BA 5E4WC 1O78A 1PFBA 2RHQB 3ERSX 4GLXA 1XNRL 2SDFA 2LKVA 2CQAA 5H1SE 2F4VL 1O7LA 4NXMQ 4GKKL 5IP7G 1X54A 2J4XA 3PIO3 4BA1I 1V43A 4JI6Q 1ZEQX 2K05A 2XNAC 1ET6A 1XYIA 4JYAL 3JAML 1PZID 3M9BA 1HNWL 4IO9A 5JAVA 1EWCA 3PUVA 4XYOA 2Q2IA 1YJ9A 1EYDA 1HXYD 2PZUA 3OOCA 4QUCA 1EIYB 2EE1A 1JICA 3Q8DA 3WOFA 1KRSA 3J81i 1W6KA 4RHSA 1WOCA 1H9KA 3TP5A 2F0QA 2OWOA 3KBXA 4EQNA 4JC0A 1HNZL 3VR2A 4LF5L 1FGBD 4DR6L 3NE5B 1QUQA 1J5EQ 5J39A 4BBSB 1GUTA 3LWUA 2QCPX 4UDUC 4FF3A 1Q8KA 4LF9Q 4IZ8A 1N33L 2IL8A 4LMQD 2K6AA 3W2DA 2F03A 2NVQH 5IE8A 4FXGC 4BXXH 3PF4A 5CV6A 4PMBA 5EKLA 5I9PA 1KTKA 1Q1EA 1Y1VH 2EOTA 1L1OC 4H02A 2RA4A 4YCWA 3CW2C 2FXQA 4OL7A 1EEID 5C44H 1CA5A 2C5CA 1U4PA 3NWSA 5IGBA 2RDFA 2PCFB 4DAYB 2K5DA 5FLMH 2QA4A 3S16B 4RAUC 1GJXA 3TREA 1VF5C 1CKNB 3NENA 3GTKH 1X3FA 2IW3A 3HKSA 3VYRA 4DR3L 1GVPA 4R4TA 4OXPA 1G6PA 1YHQA 1BBXC 4IUTA 4RGTA 4P2CB 3OYYA 2EJFC 3S1NB 1Q8IA 1F2LA 3MVVA 1J6QA 3NQTA 4FF1A 4GOPC 1OXXK 1VQBA 3I2ZA 3CCLA 4DKAC 2O5IC 5ELCA 2B2UA 5LMUL 1LTID 2EIFA 1STYA 3OPOA 2UXDQ 1XX8A 1JJCB 3JAMc 3WWVA 1STHA 4JI3Q 1A0IA 3HOXG 1KDAA 1K3BC 4WJ4A 1TWCB 1OXUA 3T56B 3F2UA 2F0LA 3SK5A 2F0FA 2JA6G 4R9WA 2VL6A 1C0AA 3SK6A 1PTOC 1ENFA 2Q2TA 4J8QA 1IZ6A 1XNRQ 3KF6A 4A3BB 2ZJPA 2CVRA 2Z6BA 3Q6SA 2F4VQ 5C4XH 5ELNA 2QF7A 3A8IE 1XPUA 1QVCA 2MQHA 1STBA 1DONA 2FJ2A 4FYDA 1Q12A 2BE5D 5TSSA 3EQLC 3CRLC 4EQPA 1G2SA 3H0GB 3HP3A 5A2QL 2JA8H 4IPHA 4JG2A 3KF8B 5D3DA 4CBVA 4F8MA 3PO2B 4DV1L 4FDBA 4KD3A 1XWEA 5CR3A 1SNCA 2JQOA 1X55A 3NSWA 1T5EA 2IT1A 4O42A 1X32A 1XNQQ 4H7BA 2FFKB 2F0GA 4IJHA 2I07B 2LXKA 3T13A 2OT2A 5NUCA 2XRQD 2VQFL 4A3GH 3HG9A 2K14A 5KRUA 2A8VA 1A15A 1BKBA 3J7AF 1CM9A 4FP5D 3NEMA 5JEAH 1SYGA 4DR6Q 4MTNA 4DV2L 2R93G 4A3JH 4LFAL 2XWJB 3VYUA 5C3EG 3C46A 1VQHA 2AWOA 1Y1WG 1UE1A 5LL6X 2PQEA 2R7FA 1M8AA 1IL2A 3GTMB 4UPAA 1I50H 2B8GA 4OONA 1E7ZA 1SRUA 1ZYRD 1YNJD 2L5TA 2A6HD 4PZ7A 4X3KA 4AYBG 4B08A 5I9OA 2YTYA 2K5HA 4RWSC 2XIWA 3FPPA 1TWAH 1MIUA 2JE6I 1VQ9A 1U0LA 4N8FA 2EZVA 4M1UB 1LTTD 2F0PA 3QWNA 3GTLH 2E74C 2YYZA 2Z0SA 4B3ML 1HJPA 2JA5B 5KYIA 2L15A 3PV0A 2HIXA 3S1QB 1QNKA 1BBWA 3VR6A 1SYCA 3ONAB 3RD4A 5FLXL 4DR3Q 1JE5A 4A3LG 4I65A 1A2UA 1JJGA 3KLWA 4DNTB 5C3WA 1A8VA 5M3MB 4XXEA 2P5ZX 4FXKC 1VF7A 4ZCKA 2YTXA 3KDFB 1VQMA 1JOOA 1TWGH 2ICEC 2KECA 1UE5A 3HOVB 3J80c 3I73A 1YI2A 1DOKA 4LF4L 1BVSA 2ES2A 2GA4B 3DMUA 4JI5Q 4KY6A 2WAQG 1B50A 1LACA 1AE2A 4O1NA 4RCOA 5C0XG 1HZCA 1SXTA 1WFQA 2R6GA 1PH8A 1JWMD 3AEVA 1ESRA 1I4GA 4IALA 2IJ0A 3R93A 1EWIA 1KRTA 1VQPA 3AU7A 4AH6A 2OTLA 3NUCA 4JI2L 2RBMA 1F2MA 2BDNA 1RIPA 1E22A 1TXYA 5FJ8G 3MC0B 4R8NA 3AYHB 1PVOA 2AQ3B 2JEBI 5ELDA 4A4IA 2OXPA 2ZJQA 4HJ7A 1UWVA 3OSOA 4RKLA 5IODA 4OWTB 2B2WA 3TRZA 2WKCA 4B3TL 3H3VI 3MXNA 3QB3A 3MXGA 3SDZA 4A93G 3G6EA 1XMOQ 4A3CH 1B3QA 4JI8Q 2E2JH 2B2WC 4LK1C 1ILPA 1VDZA 5C5LA 2F52A 2VW9A 5C0XJ 3OTOL 5AJ3Q 4RG1A 2VXWA 3W1GA 4LAAA 5BN4A 5M3FB 3TZUA 3K80C 1DOMA 1PA6A 2OF1A 1SYDA 4C1NI 4DAMA 1LTBD 4DV1Q 2I46A 5GAGC 1M90C 3VR3A 4DV7L 4DV5L 3FDTA 1IL8A 4X65L 5CV5A 3HKZG 1VMPA 1KD1C 1EIGA 3EIVA 3NQIA 4KKUA 4IFDJ 3CU7A 1RTOA 2BH2A 5IGDA 1ML0D 4IPGA 2PZTA 4ALPA 4GKJL 1NAPA 3HOXH 2DY7A 2UUCQ 2D0OA 1PRTC 3D4WA 2B39A 1KNAA 4HEDA 4LUZA 5DAUA 2VQFQ 4DUZL 3VA5A 5FLXc 4WFN3 2NVYB 3TN2A 3A74A 2AWNA 3ND8A 1NJIC 1HR0W 3NBHB 2L9HA 1E2VA 2JA6H 4L8JA 4LFAQ 1JC7A 2IWHA 2WP8J 4DR7L 2VUMB 3PO3G 2IHFA 5C3XA 4KI0A 3TEHB 2EXZA 3GO5A 3TSSA 4A3KG 5LMNL 2F0VA 3O13A 4HR7B 3L0OA 2AMCB 1DOLA 1I3QB 4RHRA 3I91A 3K7UC 1SMYC 1SE4A 1VQGA 2E5LL 4DV4L 5IGEA 3WDNA 5C4JB 2SNMA 3W3AA 4X62Q 4I7AA 2PQAB 5CYUA 3MXPA 2DJFC 5D65A 1PZKD 2K33A 4KHVA 4B3MQ 3FKIG 5DNFA 1UEAB 3I4NG 2R92B 2BH8A 1MBYA 4KLKA 4ZAIA 1TWHB 2N8NA 5IGFA 4QQBX 2Q8RE 4IOCA 2KJXA 2EY2A 2I0QA 1IW7D 2F0KA 4NXML 3DEPA 2MFIA 1MHWC 3OW7A 3GTJB 4R4CA 4MNOA 2R93H 1HFGA 5C3EH 1JB3A 3GTOH 1Y1WH 4TQUS 3I70A 1Y1VG 4LF4Q 2F3VA 4C3IB 4JI6L 1VS0A 1PV4A 2RQXA 5CORA 2O2LD 4CDFC 4NXNL 5C44G 3TP7A 1C7YA 3CQZB 4BY7B 1II3A 2F3WA 4RFBA 4A3IB 1QZHA 3D3RA 4X3TA 5JPNC 3R8BA 5EPLA 2H4OA 2E2HB 2IPKD 3DLLA 3EA6A 4DR5Q 2YU9H 3H6MA 1YITA 1C8CA 1FNUA 4JI2Q 3S1MH 4DK0A 1XTCD 4IN3A 2JEAI 1F9RA 2EYMA 1U4LA 1FL0A 4ODGA 3D6CA 2D0PA 2HDMA 4UP7A 5M5WB 2ZM6L 1Y14B 2WIIB 3RN5A 1EQQA 1H9RA 4A3LH 3GTPB 4B3TQ 3TMEA 2IHEA 1XMQQ 3JAME 2EYPA 4X66L 1BCPC 1S5ED 1TS3A 3RZDH 1UE7A 4ILWA 2BE5C 3TDQA 1RKNA 5G3LF 1ONLA 2D2CC 3M3YB 1TY2A 1L0WA 1V1QA 1Y8PB 4C56C 5BR8Q 4K5XA 3MA2B 1DJRD 4OWWB 3HOUB 1NE3A 1SJED 2KENA 5DM63 1ICWA 3AB9A 2DUDA 2ZXOA 3MFGA 2BA1A 4IUNA 1Q86C 2EVBA 1KHIA 1NR2A 4MTKA 3ERQA 2KEDA 3K5MA 1K9MC 5C4XG 1H9JA 2KCCA 4P71A 1D5ZC 2F1MA 3K6OA 4ZRZA 1JQYD 3NP8A 1SJHD 3EROA 3R3OA 5LMNQ 3E9IA 2NTTA 5C5MA 2Q2UA 1K0SA 2K52A 2AUJD 4KHZA 1IBKQ 3K57A 3ULJA 2A6HC 3T1HQ 3L9AX 2UXCL 4DAYA 1ILQA 1B7YB 5IGCA 4A3DB 1SFOH 1VQJA 1I94Q 1CKNA 2DNEA 3SXHA 3GP7A 4GNXB 1KAAA 3EFXD 1VQ5A 2EYHA 3PUZA 5JEAG 4L5TA 4A75A 4KD4A 1L0XB 2VB2X 1Y8NB 3VA7A 5M5YB 2Y0SB 4A3JG 1YJWA 5EPKA 1PXUA 1XJVA 1EU4A 4KMUC 3NXWA 1XXGA 4JBMA 3I3CA 3BVMA 3GTQB 3KBGA 1SE8A 1VQAA 5FKAC 1QILA 3SK4A 4DR2Q 1N8RC 4N8X1 1I6VC 1E1TA 2N88A 4BBRB 2D62A 5EKIA 1ICFB 2QDLA 1F2ZA 1JMCA 1GUSA 3PO3H 4JV5Q 4PV1C 1LTSD 4A3KH 3UDXA 3SR1A 1RCVD 4NXNQ 1B1ZA 3K0XA 1EIHA 2N49A 3NTHA 5JEAJ 2DGYA 2JP1A 1FD7D 2EDGA 1XNQL 1LTAD 1I6HH 1STGA 4BY1B 3NTIA 4R4QA 1MJCA 3H91A 2K4KA 2K32A 3A8KE 3AQQA 1B44D 4R8IA 4V190 1N36L 4ME5A 2NVQB 3BS1A 3IAYA 2X6GA 3CP0A 1NMGA 3FKIH 3HEJA 3I4NH 2K01A 2NYZD 3J7YW 3KLSX 2F0EA 5IYDG 5A2QE 3BDLA 1VMCA 5EGTA 2ZM6Q 1GHJA 3R2TA 5CC4A 1HHVA 4P75A 3T1YL 2A69C 3FMCA 5ELOA 1A62A 3KF8A 3E5SA 1SYFA 2Z6KA 3S9WA 4X66Q 3M4YA 1S40A 4ZLTF 3HOWB 5IYCG 2GVBA 4WORA 3RUZA 4A3MB 2BCOA 1TS4A 4QB4A
chains in the Genus database with same CATH topology
2DN8A 4KY5A 3I4LA 1E2ZA 2K04A 4QIWB 2CW0D 2V4DA 4DAVA 3CKIB 2A68D 2VNUD 3A54A 4K6LA 3BG3A 1NUCA 1QWYA 4FVMA 1PTOF 4C3JB 1PFMA 3A7AB 2F0OA 1A3UA 2EPBA 2SOBA 4L6TB 4EGVA 2SNSA 2JXMB 4K6DA 3U9SA 1ESFA 3UI2A 4KY7A 4C3HB 4U673 3HRZC 1C4QA 2RSOA 1A3TA 1HTPA 3RZOB 2B2UC 4LJZC 1F2YA 2F0SA 3Q22A 4XQJA 2F0MA 2TSSA 2M00A 4PMCA 5E4XA 1HTLD 5FLXE 2OEOA 4YIJA 1I4HA 3H09A 1Q90A 3Q0AA 5JJZA 3IL8A 1D5XC 5ELBA 1EZ6A 5LHY1 2H1EA 2JA8B 2A5HA 5COYA 1SNPA 1Y8OB 1Z6HA 1MSGA 2EY1A 2N55A 1MGSA 1CK1A 3J80L 2PMZB 2RSNA 1YNND 1RJTA 2EYLA 1SNMA 4K8JA 3T16A 3MAQA 4HMJA 5IOCA 2F4IA 5A35A 2HCIA 3OHXC 4NW2A 4HTHA 5EPJA 1TQOA 3TP6A 1DZ1A 2KCNA 3WOEA 3GTGB 1I50B 1CQVA 3H94A 1IHZA 1LABA 1R4QB 1BR9A 3G7LA 5KYLA 5CV7A 1EZ8A 4ABNA 5HURA 2PW7A 3GTLB 1FNWA 2MPMA 4J1MA 5EKKA 2WACA 1WTVA 2A6ED 1WTXA 2PZWA 1LT3D 3U9OA 2K1BA 4A3EB 2DNCA 2LFNA 3HZXA 3K7AB 5G3LD 4XTCS 3M7NA 1QOHA 1WVLA 3DEOA 3NBHA 1EOTA 3TBIB 1PZJD 3QOLA 3TZDA 2PO4A 3T4AC 1B2TA 3I4MB 3HGBA 4C3IG 3V05A 4BWGB 1G91A 4G7OC 2IX0A 4L63B 3S14B 1S4ZA 3OWEB 4K14A 1RHPA 1CT1D 1PTOB 5C6AA 1TU2B 5FO7B 2XN9C 5LL6S 2Q8IB 4DXGA 1T5XD 2XWBB 2MUYA 4NP5A 5FK9C 1A3VA 5BN3A 3MXUA 5JVH3 4HN7A 3OMGA 1PRTF 1E0BA 4CGYB 4B9WA 5FOBB 2A74C 3HOYB 4KV6A 2F0HA 1AZQA 4EVOA 4G7HC 2K7VA 1TWFB 1RDPD 4CKEA 4JK1C 3K5NA 2MHVA 4RH6A 1I4PA 1AP0A 1EYAA 2IX1A 1BO0A 3QJYA 4OO1I 3DXJC 2B2VA 1D1IA 1U9RA 4DU9A 2NZ1D 1SNDA 3M85A 4JBWA 3KK7A 2XSCA 2JA6B 2C9OA 2KVMA 1I4RA 3QIAA 4V0BA 2ZXPA 1WTQA 1D1KA 2LY7A 1HQRD 1Q3LA 5M9OA 4ZUIA 1IKLA 4HSPA 2LS01 5K5PA 1SE2A 3H3VC 3IKJA 4DXFA 2WINB 3J81L 3SHLA 2WKDA 3V2TA 2L12A 4K2KA 5ISRA 1AZPA 5ELFA 3DHQA 2R3ZA 1JWSD 3OWFA 3S17B 1EEFD 1H9SB 2J7ZA 5T1GA 1EYCA 2HQEA 1EY8A 2MP1A 3P1HA 2G9HD 5KNBA 2K03A 1MSHA 4OIKA 3DWQA 4N9PA 1S5DD 3LWEA 2QKIC 2R93B 5C3EB 1DD2A 4XDXA 2JSOA 2KUMA 4RGMA 1TT2A 5F2DA 4KN7C 1STNA 1TIID 5DEHA 3VR4A 2AQ2B 1DXMA 4AYBB 2L55A 4K8IA 4TSSA 3HS0C 4BA2I 2WB1B 1PTOD 4NMZA 1BCPF 4DF7A 1VCIA 4F88A 1QB5D 1CI3M 3GV3A 1JE4A 2QILA 1GUNA 5I2XA 4HSVA 3VYSA 1IYVA 5C4HA 4DA2A 3P75A 4I7ZC 1NCVA 1D2BA 3PUWA 3RZDB 1SNOA 1JWUD 2X6LA 2EYJA 2IX3A 1PMRA 1SNQA 3S2HB 2WAQB 3MTSA 3OIQA 1WTOA 3D6WA 1PRTB 3KLSA 1HCZA 1S5FD 2NTSA 3BDOA 4G7ZC 3HOZB 1K83B 3FRPB 4ZKBB 2NN6G 2KOLA 3FVQA 2PPBC 1V1PB 3K0YA 1EY0A 3E0JA 3C1EA 4A93B 4OGQC 1V1OA 1G6ZA 5IT9L 1R9TB 4C3HG 5KNDA 3MFYA 2NN6I 3C3LA 2EY5A 2KQ3A 4OO1H 1BDOA 1G291 2NWGA 4MN3A 3Q23A 3HKZB 2ZT9C 1Z47A 1SAPA 3VR5A 1EY7A 5I2YA 1ZYRC 1YNJC 2R7ZB 2LMCB 1AW7A 3DUZA 1K8OA 1CZWA 1TR5A 4PQXA 2M9VA 1OXSC 2DY8A 1DM0B 1RD9D 2RDGA 3BZDB 3RMHA 4J6HA 4CJ1B 2EY6A 1QG7A 5K36G 1LTGD 3PO3B 1EQTA 3IFTA 4A3KB 4ZK9B 5CMDA 1S5CD 4HCSA 1TVXA 5E3FA 1KLGD 1TS5A 1WD0A 1CTMA 4CKCA 2D9UA 4TKOB 4RKBA 1EQVA 1B53A 2BA0A 4G57A 1RODA 2O5JC 4IURA 3FKIB 5CV9A 5E1FA 3I4NB 1SE3A 4FXDA 1U4MA 3TP8A 1RTNA 1CHQD 3SVMA 2AUKA 2HUGA 1BNZA 3C1FA 4RCNA 1BCPB 3CRKC 1ENCA 1CQFA 4XYQA 1LV9A 1LT5D 3KUPA 3J80E 4PNYA 4FO2A 1Y1VB 3CHBD 1HUNA 1HRJA 1PRTD 4KK7A 3L7ZC 5C44B 4XIGS 5BN5A 2L4NA 1KDBA 2F0UA 3T53B 4XT1B 3BVZA 3SEBA 2E2DC 1LLRD 3BDCA 1EL0A 3PUXA 2E76C 2F0JA 1TY0A 1I4QA 4WRDA 3GTKB 5C4ZA 1CFMA 1V8QA 4IUVA 1OO9B 5KIXA 3ITPA 1WTPA 3SK8A 1SMYD 4Y7NB 5J1ZA 3IFDA 2TMPA 3BYTB 2NVTB 1KNEA 4G4KA 4K5VA 4C1NK 2F0WA 1WD1A 3VYTA 4XT3B 4NDXA 1K8MA 2F0IA 4IUQA 2E75C 4CJ0B 2L0CA 4IUUA 3QO2A 3QG1A 4CHTB 2KEEA 3E6ZX 4ZKCB 5D14A 3MZ5A 4X3UA 1EY4A 1U4RA 1J8IA 2F0NA 1AEXA 4CJ2C 1EY9A 1B4OA 1GHKA 1HPCA 5C4XB 3NHHA 4PMWA 4FF4A 2PNRC 5JVG3 2NN6H 1WTRA 5M5XB 3URYA 3BVGA 4RGNA 2QDBA 1B9NA 4QCLA 2KHSA 1IW7C 3NPPA 1EFID 1F77A 4EQOA 5KGUA 3NTKA 4A3GB 3MHBA 4K2LA 1BCPD 1BUVT 1HFNA 2G9DA 1X3PA 4ZYSA 4A3JB 4QMGA 3R2IA 1GUWA 2MGSA 5I6WA 4IQZA 1M4VA 4GZYC 3RLFA 1W6JA 5JOBA 4X3SA 4CKBA 2BDOA 3ND9A 1F9SA 5K36H 1PFNA 2F0DA 5KNCA 1HUMA 1QE6A 1TWAB 1IKMA 3A7LA 1LT4D 1OXTA 1G2TA 2QEJC 3S1RB 5CBEE 2ID0A 5CV8A 2X69A 2JYOA 1IYUA 4C2MB 5KEEA 1J9OA 4WJWA 4NKLA 2HCCA 5FO9B 1SSOA 1GUOA 3L3OC 2NUCA 1AFPA 4UAIA 3NK9A 4N9TA 3J81E 5I4DA 1FNVA 3G6JB 1TWGB 2HDLA 1UAPA 4KKTA 3I72A 3S2DB 5HGTA 4F87A 4XQNA 3DWPA 2K28A 3T51B 5I6YA 1TKWB 3A8JE 1I4XA 1PYWD 1H9SA 2K5QA 4B9XA 2B8FA 3M4OB 1JR0D 5T1IA 1LT6D 2PYKA 3D4RA 3LX0A 1C48A 2O4XA 5CV4A 2EJMA 3LNNA 3P20A 1Q1BA 3PIP3 5EQ0A 2EYOA 2L11A 2E2JB 4FNFA 4HMIA 3D8GA 2R61A 3ZYYX 5AFWA 5J22A 1LTRD 5IGGA 4OO1G 1H9MA 1E2WA 4HAEA 1FYCA 4KTAA 1DYQA 2E2IB 1D6EC 4QF4A 1PTOH 1WTWA 4IFDG 5C0XI 4DK1A 1QNUA 3HOXB 2A69D 1SBBB 3PUYA 4Q0FA 2AQ1B 2Z1CA 2ZXRA 2Z4IA 2B2VC 3J7AV 5D3IB 3DM1A 2Q8TA 1UUPA 1JORA 1BXTA 3PMFA 2ENBA 4IFDI 4KJOA 1QCBD 5IIFA 4QUFA 4DAPA 1SYEA 1JCKB 5JPMC 1MD2D 1MI2A 3Q24A 1TS2A 1BF4A 2NB0A 2FHTA 1GUGA 1SYBA 1HQMC 1STAA 1QJOA 1GXDC 2Z8LA 2PW5A 2FMMA 2J0TD 1O7YA 4Z9CB 2B2YA 4M8AA 1PDQA 3X3MA 1JOQA 1CA6A 3C2PA 1V1PA 2B2YC 1Z7TA 2K5WA 2MJ8A 4MIUA 4DGZA 3OMCA 1KDCA 5IT9E 4H13C 2KA7A 4RA8A 4H0LC 3FEWX 1B9MA 2VB3X 1SEBD 1CHPD 2CW0C 5CGKA 2A68C 3GTOB 1Y1WB 5EJWA 4IUPA 4KKSA 4Q5VA 2D5DA 4TRDA 1S5BD 4U68A 5ELEA 1HA6A 1KLUD 2SEBD 1UNSA 4FF2A 3OIPA 2JA7B 1HA5A 2EYFA 1AN8A 1ENAA 1DCZA 3A56A 2YU9B 3QOJA 1L0YB 1A2TA 2EJGC 3S1MB 5EBCA 3I8ZA 2FMCA 4MHEA 2FINB 1F9QA 4XQQA 1ZKOA 4ZUJA 5CBAE 1NSNS 2F0TA 1SDFA 4A3FB 1EY5A 3K59A 1Y69U 4DNRB 2RKSA 2CHBD 1BOSA 1G8ZD 2RDHA 1ZXTA 1JOKA 2BOSA 3I90A 1STEA 3P7JA 2XRSD 1X3QA 3EJIA 2B63B 1NR4A 3DWAA 1YNNC 3X3NA 4HCEA 4BS9A 4OIJA 1PLFA 1EWHA 1FR3A 4C3JG 3N52A 4RGOS 4ZQ3A 3SE0A 5EBDA 1O80A 2RVLA 2NBFA 2B2TA 3GD7A 1B3AA 1O7ZA 2A73B 3M7GA 3MWYW 1R4PB 3N6RA 1ET9A 2B2TC 1RF2D 5FO8B 4DN4M 5C0XH 3GV6A 3GQBA 1SFOB 2NVXB 4OHJA 4KN4C 4H44C 3D31A 3K5LA 1GOZA 5DM73 1CZGA 4ULLA 3EVQA 1A6XA 3FPUB 4DFAA 4IFDH 1KABA 3V96A 2ICIA 3K58A 2M2LA 2WV6D 4E6IA 2A6EC 3BYYB 4ID6A 4K5WA 1LO5D 3D4DA 1F9PA 4S3SA 3AMUA 3KLRA 1OXVA 4KJNA 3S15B 2XVSA 3K5OA 2Z4HA 3MEHA 3NBIA 1D5MC 1EU3A 4F7XA 1EY6A 3A55A 1I6HB 1BQQT 1WCMB 3NWTA 2L1BA 5E4WC 1O78A 1PFBA 2SDFA 2LKVA 2CQAA 1O7LA 2J4XA 3PIO3 4BA1I 1V43A 1ZEQX 2K05A 2XNAC 1ET6A 1XYIA 3JAML 1PZID 5JAVA 1EWCA 3PUVA 4XYOA 1EYDA 1HXYD 2PZUA 3OOCA 4QUCA 2EE1A 1JICA 3WOFA 1W6KA 4RHSA 1H9KA 3TP5A 2F0QA 3KBXA 4EQNA 3VR2A 1FGBD 3NE5B 5J39A 4BBSB 1GUTA 3LWUA 2QCPX 4UDUC 4FF3A 4IZ8A 2IL8A 4LMQD 2K6AA 3W2DA 2F03A 4FXGC 5CV6A 4PMBA 5EKLA 5I9PA 1KTKA 1Q1EA 2EOTA 2RA4A 4OL7A 1EEID 1CA5A 2C5CA 1U4PA 3NWSA 5IGBA 2RDFA 2PCFB 2K5DA 3S16B 4RAUC 1GJXA 1VF5C 2IW3A 3VYRA 1BBXC 4IUTA 4RGTA 4P2CB 2EJFC 3S1NB 1Q8IA 1F2LA 3MVVA 3NQTA 4FF1A 1OXXK 2O5IC 5ELCA 2B2UA 1LTID 1STYA 3OPOA 1XX8A 1STHA 1KDAA 1TWCB 1OXUA 3T56B 3F2UA 2F0LA 3SK5A 2F0FA 4R9WA 3SK6A 1PTOC 1ENFA 4J8QA 4A3BB 2CVRA 3Q6SA 2QF7A 3A8IE 1STBA 1DONA 2FJ2A 4FYDA 5TSSA 1Q12A 2BE5D 3EQLC 3CRLC 4EQPA 1G2SA 3H0GB 3HP3A 5A2QL 5D3DA 4CBVA 4F8MA 3PO2B 4KD3A 1XWEA 5CR3A 1SNCA 3NSWA 1T5EA 2IT1A 4O42A 1X32A 4H7BA 2FFKB 2F0GA 2I07B 3T13A 2OT2A 5NUCA 2XRQD 3HG9A 5KRUA 1A15A 3J7AF 1CM9A 4FP5D 5JEAH 1SYGA 2XWJB 3VYUA 3C46A 2AWOA 5LL6X 2PQEA 1M8AA 3GTMB 2B8GA 1ZYRD 1YNJD 2L5TA 2A6HD 4X3KA 4B08A 5I9OA 4RWSC 2XIWA 3FPPA 2JE6I 2EZVA 4M1UB 1LTTD 2F0PA 3QWNA 2E74C 2YYZA 2JA5B 5KYIA 3PV0A 3S1QB 1QNKA 3VR6A 1SYCA 3ONAB 3RD4A 5FLXL 4I65A 1A2UA 4DNTB 5C3WA 5M3MB 4XXEA 4FXKC 1VF7A 1JOOA 2ICEC 2KECA 3HOVB 3I73A 1DOKA 2GA4B 3DMUA 4KY6A 1B50A 1LACA 4O1NA 4RCOA 5C0XG 1SXTA 2R6GA 1JWMD 1ESRA 1I4GA 4IALA 2IJ0A 3R93A 3AU7A 3NUCA 2RBMA 1F2MA 2BDNA 3MC0B 4R8NA 2AQ3B 2JEBI 5ELDA 2OXPA 3OSOA 4RKLA 5IODA 2B2WA 2WKCA 3MXNA 3QB3A 3MXGA 3SDZA 2B2WC 4LK1C 1ILPA 1VDZA 5C5LA 5C0XJ 2VXWA 4LAAA 5BN4A 5M3FB 3TZUA 1DOMA 2OF1A 1SYDA 4C1NI 1LTBD 2I46A 3VR3A 3FDTA 1IL8A 5CV5A 1VMPA 1EIGA 3NQIA 4KKUA 4IFDJ 3CU7A 1RTOA 5IGDA 1ML0D 2PZTA 1NAPA 2DY7A 1PRTC 3D4WA 2B39A 1KNAA 4HEDA 5DAUA 3VA5A 4WFN3 3TN2A 2NVYB 2AWNA 3ND8A 2L9HA 1E2VA 4L8JA 1JC7A 2IWHA 2WP8J 2VUMB 5C3XA 4KI0A 2EXZA 3GO5A 3TSSA 2F0VA 3O13A 4HR7B 1DOLA 1I3QB 4RHRA 3I91A 1SMYC 1SE4A 5IGEA 3WDNA 5C4JB 2SNMA 3W3AA 5CYUA 3MXPA 5D65A 1PZKD 2K33A 4KHVA 5DNFA 1UEAB 2R92B 1MBYA 4ZAIA 1TWHB 5IGFA 2Q8RE 2KJXA 2EY2A 1IW7D 2F0KA 3DEPA 3OW7A 3GTJB 1HFGA 1JB3A 4TQUS 3I70A 2F3VA 4C3IB 2RQXA 5CORA 2O2LD 3TP7A 3CQZB 4BY7B 1II3A 2F3WA 4RFBA 4A3IB 3D3RA 4X3TA 5JPNC 3R8BA 5EPLA 2H4OA 2E2HB 2IPKD 3EA6A 3H6MA 1C8CA 1FNUA 4DK0A 1XTCD 4IN3A 2JEAI 1F9RA 2EYMA 1U4LA 4ODGA 3D6CA 2HDMA 5M5WB 2WIIB 1H9RA 3GTPB 3TMEA 3JAME 2EYPA 1BCPC 1S5ED 1TS3A 4ILWA 2BE5C 3TDQA 1RKNA 5G3LF 1ONLA 2D2CC 3M3YB 1TY2A 1Y8PB 4C56C 4K5XA 3MA2B 1DJRD 3HOUB 1SJED 5DM63 1ICWA 3AB9A 2ZXOA 3MFGA 2BA1A 4IUNA 2EVBA 1NR2A 3ERQA 2KEDA 3K5MA 1H9JA 2KCCA 1D5ZC 2F1MA 3K6OA 4ZRZA 1JQYD 3NP8A 1SJHD 3EROA 3R3OA 2NTTA 5C5MA 2AUJD 4KHZA 3K57A 2A6HC 3L9AX 4DAYA 1ILQA 5IGCA 4A3DB 2DNEA 3SXHA 3GP7A 1KAAA 3EFXD 2EYHA 3PUZA 5JEAG 4KD4A 1L0XB 2VB2X 1Y8NB 3VA7A 5M5YB 2Y0SB 5EPKA 1PXUA 1EU4A 4KMUC 3NXWA 1XXGA 3I3CA 3BVMA 3GTQB 3KBGA 5FKAC 1QILA 3SK4A 1I6VC 2N88A 4BBRB 2D62A 5EKIA 1F2ZA 1GUSA 4PV1C 1LTSD 3SR1A 1RCVD 1B1ZA 1EIHA 5JEAJ 3NTHA 2JP1A 1FD7D 2EDGA 1LTAD 1STGA 4BY1B 3NTIA 3H91A 2K32A 3A8KE 1B44D 4R8IA 4V190 4ME5A 2NVQB 3BS1A 3IAYA 2X6GA 3HEJA 2K01A 2NYZD 3J7YW 3KLSX 2F0EA 5A2QE 3BDLA 1VMCA 5EGTA 1GHJA 3R2TA 5CC4A 1HHVA 2A69C 3FMCA 3KF8A 3E5SA 1SYFA 3S9WA 3M4YA 4ZLTF 3HOWB 4WORA 3RUZA 4A3MB 2BCOA 1TS4A 4QB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I90 A;  2FHT A;  3LWE A;  2L1B A;  1BBX C;  4IUT A;  2B2W C;  2HCI A;  4NW2 A;  5E4W C;  1PFB A;  1ILP A;  1LV9 A;  3P7J A;  1M8A A;  1X3Q A;  3KUP A;  5COR A;  5EPJ A;  2SDF A;  1F2L A;  2VXW A;  4XDX A;  2KUM A;  1G6Z A;  1DZ1 A;  1ILQ A;  2FMM A;  2K04 A;  1NR4 A;  5T1I A;  1HRJ A;  1HUN A;  1DOM A;  1O7Y A;  4OIJ A;  1E0B A;  1PLF A;  4X3K A;  2B2Y A;  1PDQ A;  2B2U A;  4RWS C;  3FDT A;  4X3T A;  2XIW A;  1IL8 A;  2L4N A;  5EPL A;  1CA6 A;  2B2Y C;  4XT1 B;  1VMP A;  1EIG A;  1AZQ A;  3N52 A;  3G7L A;  2K05 A;  1XYI A;  1XX8 A;  1RTO A;  2MJ8 A;  2NWG A;  1ML0 D;  4MN3 A;  1EL0 A;  5EQ0 A;  5EPK A;  1C8C A;  1SAP A;  4RA8 A;  1HFN A;  1NAP A;  1PFM A;  1X3P A;  1O80 A;  2DY7 A;  2RVL A;  2EPB A;  2L11 A;  1AP0 A;  1KNA A;  5DNF A;  1GUW A;  2MGS A;  1F9R A;  2B2T A;  4HED A;  1B3A A;  1O7Z A;  1U4L A;  4IUP A;  5EJW A;  1BO0 A;  3GV3 A;  3I3C A;  4QUC A;  3F2U A;  2HDM A;  3MWY W;  3TN2 A;  1QNK A;  4IUV A;  2MPM A;  2B2T C;  1JE4 A;  2DY8 A;  2EE1 A;  3ONA B;  1JIC A;  4U68 A;  3UI2 A;  4DN4 M;  1WTP A;  5AFW A;  2L9H A;  2B2V A;  1HA6 A;  2N88 A;  4HSV A;  3IFD A;  3GV6 A;  4R9W A;  2NZ1 D;  5EKI A;  2RSO A;  3KBX A;  4CJ1 B;  4X3S A;  1WTV A;  2B2U C;  1F9S A;  1WTX A;  1QG7 A;  1PFN A;  1KNE A;  2KVM A;  1HUM A;  1QE6 A;  1IKM A;  1WTQ A;  2CVR A;  2K1B A;  1EQT A;  3Q6S A;  5E4X A;  1G2T A;  1WD1 A;  4HAE A;  4XT3 B;  1NCV A;  1Q3L A;  2KEC A;  1EIH A;  4ZK9 B;  5CBE E;  1IKL A;  1DOK A;  5CMD A;  3FPU B;  1DOL A;  3I91 A;  4HCS A;  1DON A;  1WTW A;  2FJ2 A;  1TVX A;  2JP1 A;  2X69 A;  3DEO A;  1WVL A;  2JYO A;  2X6L A;  4IUQ A;  1G2S A;  3I8Z A;  1EOT A;  3HP3 A;  4CJ0 B;  5JJZ A;  2M2L A;  4IUU A;  3IL8 A;  1J9O A;  2IL8 A;  4LMQ D;  3TZD A;  4MHE A;  1B50 A;  3H91 A;  2L12 A;  1WD0 A;  3QO2 A;  1B2T A;  2HCC A;  2FIN B;  1F9Q A;  2H1E A;  4R8I A;  1SSO A;  2KEE A;  2B2V C;  3MTS A;  1ICW A;  5COY A;  1ESR A;  1G91 A;  5D65 A;  2EOT A;  3DM1 A;  4ZKC B;  3D6W A;  1WTO A;  2X6G A;  3R93 A;  2Q8T A;  1AZP A;  5CBA E;  2D9U A;  2R3Z A;  1F9P A;  1MSG A;  2K01 A;  2NYZ D;  2RA4 A;  1B53 A;  1NR2 A;  4O42 A;  2N55 A;  1ROD A;  1X32 A;  4UAI A;  1S4Z A;  4X3U A;  5D14 A;  2KED A;  1SDF A;  1VMC A;  1U4R A;  4IUR A;  4ZAI A;  2J7Z A;  1CA5 A;  1MGS A;  2FFK B;  1U4P A;  2BDN A;  5T1G A;  4CJ2 C;  1J8I A;  1HHV A;  1B4O A;  1U4M A;  4QUF A;  2Q8R E;  1RTN A;  2MP1 A;  2RSN A;  2K03 A;  2HDL A;  3SVM A;  1A15 A;  4ZKB B;  1MSH A;  1RHP A;  1RJT A;  4RAU C;  1CM9 A;  2HUG A;  3DEP A;  4OIK A;  4ZLT F;  1BNZ A;  1MI2 A;  1WTR A;  2KOL A;  2K28 A;  2B2W A;  1HFG A;  1BF4 A;  1ZXT A; 
#chains in the Genus database with same CATH topology
 1HZA A;  2JA5 G;  3TS0 A;  3ULL A;  1OTC A;  1KAW A;  2DN8 A;  4KY5 A;  3I4L A;  1E2Z A;  2RCN A;  2K04 A;  4QIW B;  2CW0 D;  4LFB Q;  2V4D A;  4GN4 B;  4DAV A;  3CKI B;  2A68 D;  2VNU D;  3A54 A;  4K6L A;  2PNH A;  2CKZ B;  3BG3 A;  1NUC A;  3I7F A;  1QWY A;  4FVM A;  2YV5 A;  1YNX A;  1PTO F;  3HOV G;  4C3J B;  3K8A A;  4A3C G;  1PFM A;  3A7A B;  1VQK A;  2F0O A;  1A3U A;  2EPB A;  2SOB A;  4YWK A;  2MNA A;  4HIO A;  4L6T B;  1VQE A;  2SNS A;  4APV A;  4EGV A;  4Y7N H;  2JXM B;  4OEM B;  4K6D A;  3U9S A;  3STB D;  1ESF A;  3UI2 A;  4KY7 A;  4C3H B;  2NVT H;  4U67 3;  3HRZ C;  1C4Q A;  4JI5 L;  2RSO A;  1L2F A;  1A3T A;  1HTP A;  3RZO B;  2B2U C;  4LJZ C;  1F2Y A;  2F0S A;  3Q22 A;  4XQJ A;  2F0M A;  2TSS A;  3D0F A;  1CSQ A;  2M00 A;  2UXC Q;  3AFP A;  4PMC A;  5E4X A;  1HTL D;  5FLX E;  2OEO A;  4YIJ A;  1I4H A;  2HQL A;  3H09 A;  4LF7 L;  2WFW A;  1Q90 A;  1FJG L;  1WI5 A;  1WTH A;  3Q0A A;  5JJZ A;  3J81 j;  3IL8 A;  1D5X C;  5ELB A;  2CFM A;  4HJ5 A;  1EZ6 A;  2N78 A;  2OTJ A;  5LHY 1;  2H1E A;  4CDC C;  2A5H A;  2JA8 B;  5COY A;  3S1N H;  4YWL A;  4POG A;  1YZ6 A;  3KDF A;  1SNP A;  1Y8O B;  1Z6H A;  1MSG A;  5HGQ A;  2EY1 A;  2XTI A;  2N55 A;  3CMA A;  5M3F G;  1XMO L;  2HT1 A;  3LGJ A;  4JI8 L;  1MGS A;  2MO0 A;  1YJN A;  1CK1 A;  3J80 L;  5M5X H;  2PMZ B;  3G48 A;  1P8L A;  2RSN A;  4R4I A;  5AJ3 L;  1YNN D;  1RJT A;  1UEB A;  1YBY A;  2EYL A;  1SNM A;  1EYG A;  2I5L X;  4K8J A;  3T16 A;  3MAQ A;  3JC6 6;  4HMJ A;  5IOC A;  2F4I A;  5A35 A;  2HCI A;  3OHX C;  4NW2 A;  1QUQ B;  4P72 A;  4HTH A;  5EPJ A;  1TQO A;  3TP6 A;  1DZ1 A;  2KCN A;  2Q2H A;  3WOE A;  2UUC L;  1PYB A;  3GTG B;  3RLN A;  1I50 B;  1CQV A;  5DLQ E;  3H94 A;  1N36 Q;  4A3B H;  1IHZ A;  1LAB A;  1R4Q B;  1BR9 A;  3G7L A;  1L1O B;  5KYL A;  3NEL A;  5CV7 A;  1EZ8 A;  1HZ9 A;  4ABN A;  5HUR A;  3T1Y Q;  2JA9 A;  2PW7 A;  1Q82 C;  3GTL B;  1KL9 A;  1FNW A;  2MPM A;  4J1M A;  5EKK A;  1HNX L;  2WAC A;  2GVA A;  1VQO A;  1PYS B;  3RNU A;  2JA7 G;  1WTV A;  2IY5 B;  2A6E D;  1WTX A;  1WJJ A;  3S1R H;  2PZW A;  1GKH A;  4X62 L;  1NMF A;  1LT3 D;  3TS2 A;  3U9O A;  4YHH L;  1PFS A;  2K1B A;  1Q46 A;  4A3E B;  4C2M H;  2DNC A;  2LFN A;  3HZX A;  3K7A B;  5G3L D;  4GOP B;  4XTC S;  3M7N A;  1K28 A;  3F2B A;  1QOH A;  1WVL A;  3DEO A;  3NBH A;  4MZ9 A;  1SLJ A;  1EOT A;  3TBI B;  1H95 A;  1PZJ D;  3QOL A;  3TZD A;  2PO4 A;  3T4A C;  1B2T A;  3I4M B;  3HGB A;  4C3I G;  1IBL Q;  3V05 A;  4BWG B;  1G91 A;  4G7O C;  2IX0 A;  4A3F G;  4L63 B;  5IYD H;  3ICE A;  3S14 B;  1S4Z A;  4BY7 G;  3OWE B;  3S2D H;  4EX5 A;  4K14 A;  1Z9F A;  1RHP A;  1CT1 D;  1PTO B;  3GDE A;  5C6A A;  3UE0 A;  5IYC H;  1TU2 B;  5FO7 B;  1LTL A;  2XN9 C;  5LL6 S;  2Q8I B;  4DXG A;  1T5X D;  4YWM A;  3M4O H;  2JA5 H;  2XWB B;  1Q81 C;  2MUY A;  4NP5 A;  5FK9 C;  1A3V A;  2B63 G;  3S1Q H;  1EUJ A;  4DR5 L;  5BN3 A;  3MXU A;  5JVH 3;  4LF7 Q;  3JAM i;  1FJG Q;  4TVA B;  2Z9H A;  2OQK A;  1N32 L;  1C9O A;  4HN7 A;  2RCF A;  3OMG A;  1PRT F;  1K73 C;  1E0B A;  4CGY B;  2UXB L;  4B9W A;  4ME3 A;  5M3M H;  1VQ7 A;  5FOB B;  2A74 C;  3HOY B;  1NNX A;  3QR8 A;  5HY6 A;  4KV6 A;  2F0H A;  1AZQ A;  4EVO A;  4G7H C;  2K7V A;  3U58 A;  1TWF B;  1RDP D;  3HOV H;  4CKE A;  4JK1 C;  1XMQ L;  3K5N A;  2MHV A;  4RH6 A;  3KFU A;  2NZH A;  1I4P A;  1AP0 A;  1EYA A;  2IX1 A;  1BO0 A;  3QJY A;  1SRO A;  3M4P A;  4OO1 I;  3DXJ C;  3PF5 A;  2B2V A;  1D1I A;  1U9R A;  4DU9 A;  1FGU A;  2NZ1 D;  1SND A;  3M85 A;  5BR8 L;  4JBW A;  3KK7 A;  2XSC A;  2JA6 B;  2C9O A;  2KVM A;  1I4R A;  2E2I H;  2JN4 A;  3QIA A;  4V0B A;  2ZXP A;  2RF4 A;  1WTQ A;  1D1K A;  2LY7 A;  1HQR D;  1Q3L A;  5M9O A;  4ZUI A;  4HJ9 A;  1IKL A;  4HSP A;  2LS0 1;  5K5P A;  5IYB H;  1SE2 A;  3H3V C;  3IKJ A;  4DXF A;  2EQS A;  2WIN B;  3J81 L;  3SHL A;  4AQY L;  4IPC A;  2WKD A;  3V2T A;  4OX9 Q;  4JI0 Q;  1SN8 A;  2L12 A;  4GS3 A;  1B8A A;  4K2K A;  5ISR A;  1GD7 A;  1AZP A;  5ELF A;  1VQN A;  3DHQ A;  2R3Z A;  5M3F H;  1JWS D;  3OWF A;  4JI4 Q;  3S17 B;  1EEF D;  1H9S B;  2J7Z A;  1HNX Q;  1IBK L;  5T1G A;  4JVZ A;  1EYC A;  4R1J A;  2HQE A;  1M1K C;  1EY8 A;  1VQC A;  2MP1 A;  3P1H A;  2G9H D;  5KNB A;  3T1H L;  2K03 A;  4HJA A;  1QVF A;  5L37 A;  1MSH A;  1YEZ A;  1T9H A;  1WCM G;  4OIK A;  2K5N A;  2Y0S G;  3DWQ A;  3CD6 A;  4KHP Q;  4N9P A;  1K3R A;  1XPO A;  4YHH Q;  1S5D D;  1I94 L;  3LWE A;  2QKI C;  4NPS A;  3K81 C;  2R93 B;  2NVY H;  1VQ8 A;  4K0K Q;  5C3E B;  1DD2 A;  4JI1 Q;  1KIX A;  2Y0S E;  4XDX A;  2JSO A;  2KUM A;  4RGM A;  1TT2 A;  2K50 A;  2ALY B;  4IJL A;  1PH1 A;  5F2D A;  3CCE A;  4KN7 C;  1STN A;  1TII D;  2VUM H;  2I5H A;  1E1O A;  2A1A A;  5DEH A;  3VR4 A;  2AQ2 B;  1DXM A;  1IYJ B;  4AYB B;  4LWC A;  2L55 A;  4DV0 L;  4DR2 L;  4K8I A;  4TSS A;  3HS0 C;  4OEL B;  4BA2 I;  2WB1 B;  1PTO D;  1CKO A;  1CUK A;  1I3Q H;  4HID A;  4NMZ A;  3J7Z C;  4JV5 L;  1BCP F;  3U4Z A;  3SGI A;  4DF7 A;  1VCI A;  4L5R C;  4F88 A;  4NB3 A;  1QB5 D;  1CI3 M;  3GV3 A;  1JE4 A;  2QIL A;  1GUN A;  2VQE Q;  5I2X A;  1HR0 L;  2JA7 H;  4HSV A;  3VYS A;  1IYV A;  3F8T A;  4IPD A;  4BBS G;  2CCZ A;  5C4H A;  2N3S A;  4DA2 A;  1N32 Q;  2B3G A;  3P75 A;  4LFC Q;  4I7Z C;  3CCV A;  1NCV A;  1D2B A;  1MJE A;  4DK6 C;  3PUW A;  1VQ6 A;  2UXB Q;  3RZD B;  3GTJ H;  3J81 c;  1SNO A;  1JWU D;  3VDY A;  2X6L A;  3HOW G;  3ER0 A;  1QZG A;  2EYJ A;  2IX3 A;  1PMR A;  1YHA A;  4C3I H;  1CKM A;  1SNQ A;  3S2H B;  2WAQ B;  3MTS A;  3OIQ A;  1WTO A;  3D6W A;  4A3F H;  1FVI A;  3EN2 A;  1PRT B;  3PSI A;  5EAY A;  3J7A 5;  4BY7 H;  3KLS A;  1HCZ A;  1S5F D;  4A3I H;  3KYH C;  2UUA Q;  2NTS A;  4LF8 Q;  3BDO A;  2E2H H;  4G7Z C;  3HOZ B;  4LUV A;  1K83 B;  4L5Q A;  3FRP B;  4JPB W;  4ZKB B;  2K5V A;  4QIW E;  4LFB L;  2NN6 G;  1G51 A;  2KOL A;  3FVQ A;  2PPB C;  1V1P B;  3K0Y A;  1EY0 A;  3UDI A;  3E0J A;  2C35 B;  4QGU A;  2B63 H;  3C1E A;  4O2D A;  3H3V H;  4OGQ C;  4A93 B;  1V1O A;  2HHH Q;  1IBM Q;  3S24 A;  1G6Z A;  5IT9 L;  4AQY Q;  1R9T B;  4C3H G;  5KND A;  3MFY A;  2NN6 I;  3C3L A;  2EY5 A;  2KQ3 A;  2E8G A;  4OO1 H;  4L5S A;  1BDO A;  2B29 A;  1YHB A;  1G29 1;  1XPR A;  2NWG A;  4MN3 A;  3Q23 A;  4DUY Q;  3F1Z A;  3HKZ B;  2ZT9 C;  4P74 A;  1Z47 A;  1SAP A;  3VR5 A;  1EY7 A;  1LYL A;  1ASY A;  3M3Y H;  5I2Y A;  2PI2 E;  1ZYR C;  1YNJ C;  2R7Z B;  2LMC B;  1AW7 A;  3DUZ A;  1K8O A;  1CZW A;  2ZTE A;  1EQR A;  1TR5 A;  4PQX A;  2M9V A;  1OXS C;  3KOJ A;  2DY8 A;  2JK8 A;  1VQI A;  3L2P A;  1DM0 B;  2NVX H;  1RD9 D;  2RDG A;  1BBU A;  3BZD B;  2HIV A;  3PQI A;  3RMH A;  3BZC A;  4YCV A;  4J6H A;  4A3B G;  1X3G A;  4CJ1 B;  5IWA Q;  2EY6 A;  2KCM A;  2KHJ A;  1QG7 A;  5K36 G;  1LTG D;  3PCO B;  3G4S A;  3PO3 B;  1EQT A;  4JOI A;  3IFT A;  4A3K B;  3FHW A;  3H0G G;  4ZK9 B;  5CMD A;  1S5C D;  4HCS A;  1NTG A;  3CME A;  1TVX A;  5E3F A;  3PO2 G;  1KC8 C;  1KLG D;  4DV0 Q;  2R7D A;  1TS5 A;  2QEX A;  1WD0 A;  1CTM A;  1XTD A;  2PI2 A;  2G5D A;  2PMZ E;  3BZK A;  3OW2 A;  4QL5 A;  4CKC A;  2D9U A;  4TKO B;  3S15 H;  1A63 A;  4RKB A;  1EQV A;  1B53 A;  2BA0 A;  4G57 A;  1ROD A;  4A3D H;  5IP9 G;  2O5J C;  4IUR A;  3FKI B;  5CV9 A;  5E1F A;  3I4N B;  1SE3 A;  4FXD A;  1U4M A;  1HR0 Q;  1PH9 A;  3TP8 A;  1RTN A;  1S72 A;  1CHQ D;  3SVM A;  1MKH A;  1JT8 A;  2AUK A;  1WCM H;  5M5Y H;  2HUG A;  1BNZ A;  3C1F A;  4RCN A;  3M4Q A;  1BCP B;  1PH5 A;  4B3R L;  3CRK C;  1ENC A;  1CQF A;  3GTQ H;  4LUO A;  4XYQ A;  1LV9 A;  1LT5 D;  4UHV A;  3KUP A;  5IT9 c;  3J80 E;  4PNY A;  2AHO B;  4FO2 A;  1Y1V B;  3CHB D;  1HUN A;  1HRJ A;  1PRT D;  4BBR H;  4KK7 A;  2XGT A;  3TQY A;  4DR4 Q;  3L7Z C;  4QY7 A;  5C44 B;  1EFW A;  4XIG S;  5BN5 A;  2L4N A;  1KDB A;  2F0U A;  3T53 B;  4XT1 B;  3BVZ A;  4DR1 Q;  3SEB A;  2Z6K C;  4A3E G;  2E2D C;  1LLR D;  3BDC A;  1EL0 A;  3PUX A;  2E76 C;  2F0J A;  1TY0 A;  1I4Q A;  3CXC A;  4WRD A;  3GTK B;  2VZA A;  5C4Z A;  1CFM A;  4BY1 H;  1V8Q A;  2KBN A;  1JJ2 A;  1K8G A;  1VQF A;  1OO9 B;  4IUV A;  3I4M G;  5KIX A;  3ITP A;  1O7I A;  2CH4 A;  1WTP A;  3SK8 A;  1GO3 E;  1SMY D;  1N9W A;  4Y7N B;  5J1Z A;  5M3M G;  3IFD A;  2TMP A;  1L1O A;  3BYT B;  4BBS H;  3UDF A;  2NVT B;  1KNE A;  4G4K A;  4K5V A;  4C1N K;  4EQ5 A;  4LF6 Q;  3EBE A;  1IBL L;  2CH4 W;  2F0W A;  1WD1 A;  3VYT A;  1UE6 A;  4NDX A;  4XT3 B;  4WJ3 M;  1K8M A;  2F0I A;  2ASB A;  3HOW H;  1QVG A;  1EOV A;  4IUQ A;  2E75 C;  4CJ0 B;  3KJP A;  2L0C A;  4A3M H;  4IUU A;  1KQS A;  4QJF A;  4YY3 L;  3QO2 A;  3IRB A;  3QG1 A;  4CHT B;  2KEE A;  4DV6 Q;  3MEF A;  2V1C C;  4JCV E;  2UUB Q;  3E6Z X;  4ZKC B;  3AFQ A;  1JB7 A;  5JJI A;  2UU9 Q;  5D14 A;  3MZ5 A;  3B6Y A;  4X3U A;  4GOP A;  1EY4 A;  1U4R A;  3S16 H;  1J8I A;  1VQ4 A;  2F0N A;  1AEX A;  4CJ2 C;  1EY9 A;  1B4O A;  5IYB G;  1GHK A;  1HPC A;  3HOY G;  5C4X B;  3NHH A;  4PMW A;  4FF4 A;  1I5F A;  1LM0 A;  2PNR C;  5JVG 3;  2NN6 H;  4R4O A;  4C3J H;  1WTR A;  5M5X B;  3URY A;  3BVG A;  3BU2 A;  2GN5 A;  4RGN A;  2QDB A;  4LW1 A;  1X9N A;  1B9N A;  4JBJ A;  4QCL A;  5GAE C;  1PH4 A;  2CWA A;  1W2B A;  4C3H H;  2KHS A;  1IW7 C;  3NPP A;  1EFI D;  4LNQ A;  3RZO H;  1F77 A;  4EQO A;  5KGU A;  3I55 A;  3NTK A;  4A3G B;  3MHB A;  4K2L A;  1TWC H;  1BCP D;  1BUV T;  1HFN A;  2G9D A;  1X3P A;  4ZYS A;  1E3P A;  2OQ0 A;  4GKK Q;  4A3J B;  4QMG A;  3KJO A;  3R2I A;  1GUW A;  2MGS A;  5I6W A;  4IQZ A;  4DNI A;  4DK3 C;  1M4V A;  1PH2 A;  3I56 A;  4GZY C;  3RLF A;  1W6J A;  5JOB A;  5GRO A;  2VUM G;  4JYA Q;  4B3R Q;  4B3S L;  3RN2 A;  4X3S A;  2BDO A;  4CKB A;  3ND9 A;  1D8L A;  1F9S A;  1HNW Q;  5K36 H;  1PFN A;  2F0D A;  5KNC A;  4JI0 L;  1VQD A;  1HUM A;  1QE6 A;  1TWA B;  4OX9 L;  1IKM A;  3A7L A;  1LT4 D;  1OXT A;  1G2T A;  2QEJ C;  3S1R B;  3H0G H;  4HIK A;  5CBE E;  2ID0 A;  5CV8 A;  4POF A;  2X69 A;  2JYO A;  3PO2 H;  3G71 A;  4JI4 L;  1IYU A;  4C2M B;  5KEE A;  1J9O A;  1HNZ Q;  4WJW A;  4JI7 L;  1NBW A;  4LF5 Q;  4NKL A;  2HCC A;  4JBK A;  5FO9 B;  1SSO A;  4DV3 L;  1GUO A;  3CCS A;  3L3O C;  4HJ8 A;  4JW0 A;  2R92 G;  4KHP L;  2NUC A;  1AFP A;  4UAI A;  5IP9 H;  3GTG H;  1AH9 A;  3NK9 A;  4N9T A;  3J81 E;  1N33 Q;  4K0K L;  5I4D A;  1FNV A;  4JI1 L;  3G6J B;  1TWG B;  5IP7 H;  5JJL A;  2HDL A;  1UAP A;  4KKT A;  3I72 A;  3S2D B;  2WB1 G;  5HGT A;  4F87 A;  4XQN A;  3DWP A;  1WYD A;  2K28 A;  3T51 B;  5I6Y A;  1SMX A;  1TKW B;  3A8J E;  3GTM H;  1I4X A;  1PYW D;  4Y52 H;  4AYB E;  1H9S A;  2K5Q A;  3CCM A;  4B9X A;  1AE3 A;  2B8F A;  3UE1 A;  3M4O B;  2VS1 A;  2WB1 E;  1JR0 D;  5T1I A;  1LT6 D;  2PYK A;  4A3I G;  1PH6 A;  3D4R A;  1X65 A;  1N34 L;  4YY3 Q;  4PZ6 A;  3A5Z B;  3LX0 A;  1C48 A;  2O4X A;  2PQA A;  3A5U A;  1V9P A;  5CV4 A;  2EJM A;  2VY3 A;  3LNN A;  3P20 A;  4A3E H;  1Q1B A;  3PIP 3;  2VQE L;  4IOA A;  3K7A H;  5EQ0 A;  3CCU A;  3KF6 B;  2EYO A;  2L11 A;  2E2J B;  1S3O A;  4J15 A;  4FNF A;  5LMU Q;  4LFC L;  4GLA C;  3I4M H;  4X6A H;  4HMI A;  3D8G A;  2R61 A;  3ZYY X;  5AFW A;  1KXL A;  5J22 A;  1LTR D;  5IGG A;  2K75 A;  3S14 H;  5GAD C;  4OO1 G;  5LMN W;  3PIO A;  1Q7Y C;  1H9M A;  3HOZ G;  1E2W A;  4DPG A;  2WAQ E;  4HAE A;  1FYC A;  4KTA A;  1PH7 A;  1DYQ A;  2E2I B;  1D6E C;  5GAH C;  4QF4 A;  1PTO H;  4X64 L;  1WTW A;  4IFD G;  5C0X I;  1QNU A;  4DK1 A;  3CC4 A;  3HOX B;  3HOU G;  2ZTC A;  2LSS A;  5E7N A;  1GM5 A;  2UUA L;  2A69 D;  4LF8 L;  2ZJR A;  1SBB B;  3PUY A;  1CSP A;  4Q0F A;  1EIF A;  2AQ1 B;  2DJG C;  2Z1C A;  2Z4I A;  2ZXR A;  2B2V C;  3CAM A;  3E0E A;  3J7A V;  3H15 A;  5D3I B;  3DM1 A;  2Q8T A;  1UUP A;  1JOR A;  1BXT A;  3PMF A;  2ENB A;  4IFD I;  4KJO A;  1QCB D;  3CC2 A;  1VQL A;  2KHI A;  5IIF A;  4DAP A;  4QUF A;  3CCJ A;  3HOY H;  1SYE A;  2HHH L;  1IBM L;  4B3S Q;  5JJK A;  1JCK B;  3CPF A;  5JPM C;  1TWF H;  1MD2 D;  1MI2 A;  1E24 A;  3Q24 A;  4OWX B;  1TS2 A;  1BF4 A;  1X6O A;  2NB0 A;  2HD3 A;  2FHT A;  4A76 A;  2R7Z G;  1GUG A;  1SYB A;  4UP8 A;  1HQM C;  3W1B A;  1STA A;  1QJO A;  2NZO A;  2QGQ A;  4DUY L;  1GXD C;  2Z8L A;  2PW5 A;  3HKZ E;  4A3D G;  2FMM A;  2J0T D;  4JI7 Q;  4RMF A;  2AKW B;  1O7Y A;  2MO1 A;  4Z9C B;  4DV2 Q;  2B2Y A;  4M8A A;  1PDQ A;  4YCU A;  3X3M A;  1IXR A;  4DV3 Q;  1SR3 A;  1JOQ A;  2JJQ A;  1CA6 A;  3C2P A;  1V1P A;  2B2Y C;  1Z7T A;  3ZJY C;  2K5W A;  5GQO A;  2CWP A;  2MJ8 A;  1X3E A;  4MIU A;  4DGZ A;  3OMC A;  1KDC A;  5IT9 E;  4H13 C;  2KA7 A;  2EXD A;  4RA8 A;  4H0L C;  5IWA L;  3DM3 A;  3FEW X;  1B9M A;  2VB3 X;  1SEB D;  4CDE C;  1CHP D;  2CW0 C;  5CGK A;  2A68 C;  3GTO B;  1Y1W B;  5EJW A;  4IUP A;  4KKS A;  4Q5V A;  2D5D A;  4TRD A;  3E9H A;  1S5B D;  3ULP A;  4BBR G;  4U68 A;  4CDD C;  5ELE A;  1HA6 A;  1KLU D;  2SEB D;  1DGS A;  1UNS A;  1ASZ A;  4FF2 A;  3OIP A;  3S17 H;  2JA7 B;  1HA5 A;  2EYF A;  1AN8 A;  4GN3 B;  1YIJ A;  1ENA A;  1DCZ A;  1LUZ A;  3E3X A;  3A56 A;  2YU9 B;  1D7Q A;  3QOJ A;  4GLV B;  1N34 Q;  4PG3 A;  4BY1 G;  1L0Y B;  3STB C;  1A2T A;  5C4J H;  2EJG C;  3S1M B;  3CCQ A;  5EBC A;  3U50 C;  3I8Z A;  5J3B A;  1HZB A;  3F2C A;  2FMC A;  3J80 i;  4GNX A;  4MHE A;  2FIN B;  1F9Q A;  4XQQ A;  4BXX G;  4GNX C;  2QW7 A;  4AIM A;  2R92 H;  1ZKO A;  4ZUJ A;  1TWH H;  3MXN B;  5CBA E;  1W3S A;  1NSN S;  2F0T A;  1SDF A;  4A3F B;  3RR5 A;  1EY5 A;  1NY4 A;  2A19 A;  3K59 A;  1PHJ A;  2ATW A;  1Y69 U;  4DNR B;  2RKS A;  5FLM G;  4O0A A;  2CHB D;  2I5M X;  4A3M G;  2H5X A;  4DR4 L;  5IY0 A;  1BOS A;  1G8Z D;  2RDH A;  3W5O A;  2KCT A;  1ZXT A;  1JOK A;  2BOS A;  3I90 A;  1U5K A;  4DR1 L;  1STE A;  3P7J A;  2XRS D;  1X3Q A;  4X64 Q;  3CQZ H;  1J5E L;  3EJI A;  3UDG A;  2B63 B;  1NR4 A;  3DWA A;  1YNN C;  3X3N A;  2LXJ A;  3CF5 A;  4HCE A;  4BS9 A;  4OIJ A;  1PLF A;  1P16 A;  1EWH A;  4LF9 L;  1FR3 A;  4C3J G;  3N52 A;  4RGO S;  4ZQ3 A;  2F3I A;  1B70 B;  3OTO Q;  3CCR A;  3SE0 A;  5EBD A;  1O80 A;  3F2D A;  2RVL A;  2RHS B;  5M5W H;  3HFZ B;  2NBF A;  1K8A C;  2B2T A;  4DV7 Q;  3GD7 A;  1B3A A;  1O7Z A;  4DV5 Q;  2A73 B;  4LF6 L;  3GTP H;  3M7G A;  4X65 Q;  3N6R A;  1R4P B;  3MWY W;  2ZTD A;  1ET9 A;  2B2T C;  3S2H H;  1RF2 D;  5FO8 B;  4DN4 M;  3U4V A;  5C0X H;  3GV6 A;  3GQB A;  4GKJ Q;  1SFO B;  2NVX B;  3PGZ A;  4OHJ A;  1X56 A;  4KN4 C;  4H44 C;  3D31 A;  3K5L A;  1GOZ A;  3FP9 A;  5DM7 3;  4UY8 C;  3HOZ H;  1K83 H;  3BJU A;  4DUZ Q;  1CZG A;  4ULL A;  4DV6 L;  3EVQ A;  2UUB L;  1A6X A;  3FPU B;  4DFA A;  4IFD H;  2UU9 L;  1KAB A;  3V96 A;  2ICI A;  5FJ8 H;  3HOU H;  3K58 A;  4DR7 Q;  2M2L A;  2JA8 G;  2WV6 D;  4E6I A;  1YVC A;  2A6E C;  3BYY B;  4ID6 A;  4GN5 A;  4K5W A;  4A93 H;  3CPW A;  1RL2 A;  3RLO A;  1LO5 D;  3CC7 A;  3D4D A;  4UP9 A;  1R9T H;  1F9P A;  4S3S A;  3AMU A;  2UXD L;  4JI3 L;  3KLR A;  3PIP A;  2E5L Q;  4DV4 Q;  3A0J A;  1OXV A;  4PZ8 A;  4KJN A;  1K0R A;  3S15 B;  2XVS A;  4JOI C;  2CQO A;  3K5O A;  2Z4H A;  3MEH A;  1HH2 P;  3NBI A;  1D5M C;  1EU3 A;  4A3G G;  4F7X A;  1EY6 A;  3A55 A;  2YTV A;  1I6H B;  4HIM A;  1BQQ T;  1WCM B;  2OCE A;  1PH3 A;  2R7Z H;  3I4O A;  3NWT A;  4P73 A;  2L1B A;  5E4W C;  1O78 A;  1PFB A;  2RHQ B;  3ERS X;  4GLX A;  1XNR L;  2SDF A;  2LKV A;  2CQA A;  5H1S E;  2F4V L;  1O7L A;  4NXM Q;  4GKK L;  5IP7 G;  1X54 A;  2J4X A;  3PIO 3;  4BA1 I;  1V43 A;  4JI6 Q;  1ZEQ X;  2K05 A;  2XNA C;  1ET6 A;  1XYI A;  4JYA L;  3JAM L;  1PZI D;  3M9B A;  1HNW L;  4IO9 A;  5JAV A;  1EWC A;  3PUV A;  4XYO A;  2Q2I A;  1YJ9 A;  1EYD A;  1HXY D;  2PZU A;  3OOC A;  4QUC A;  1EIY B;  2EE1 A;  1JIC A;  3Q8D A;  3WOF A;  1KRS A;  3J81 i;  1W6K A;  4RHS A;  1WOC A;  1H9K A;  3TP5 A;  2F0Q A;  2OWO A;  3KBX A;  4EQN A;  4JC0 A;  1HNZ L;  3VR2 A;  4LF5 L;  1FGB D;  4DR6 L;  3NE5 B;  1QUQ A;  1J5E Q;  5J39 A;  4BBS B;  1GUT A;  3LWU A;  2QCP X;  4UDU C;  4FF3 A;  1Q8K A;  4LF9 Q;  4IZ8 A;  1N33 L;  2IL8 A;  4LMQ D;  2K6A A;  3W2D A;  2F03 A;  2NVQ H;  5IE8 A;  4FXG C;  4BXX H;  3PF4 A;  5CV6 A;  4PMB A;  5EKL A;  5I9P A;  1KTK A;  1Q1E A;  1Y1V H;  2EOT A;  1L1O C;  4H02 A;  2RA4 A;  4YCW A;  3CW2 C;  2FXQ A;  4OL7 A;  1EEI D;  5C44 H;  1CA5 A;  2C5C A;  1U4P A;  3NWS A;  5IGB A;  2RDF A;  2PCF B;  4DAY B;  2K5D A;  5FLM H;  2QA4 A;  3S16 B;  4RAU C;  1GJX A;  3TRE A;  1VF5 C;  1CKN B;  3NEN A;  3GTK H;  1X3F A;  2IW3 A;  3HKS A;  3VYR A;  4DR3 L;  1GVP A;  4R4T A;  4OXP A;  1G6P A;  1YHQ A;  1BBX C;  4IUT A;  4RGT A;  4P2C B;  3OYY A;  2EJF C;  3S1N B;  1Q8I A;  1F2L A;  3MVV A;  1J6Q A;  3NQT A;  4FF1 A;  4GOP C;  1OXX K;  1VQB A;  3I2Z A;  3CCL A;  4DKA C;  2O5I C;  5ELC A;  2B2U A;  5LMU L;  1LTI D;  2EIF A;  1STY A;  3OPO A;  2UXD Q;  1XX8 A;  1JJC B;  3JAM c;  3WWV A;  1STH A;  4JI3 Q;  1A0I A;  3HOX G;  1KDA A;  1K3B C;  4WJ4 A;  1TWC B;  1OXU A;  3T56 B;  3F2U A;  2F0L A;  3SK5 A;  2F0F A;  2JA6 G;  4R9W A;  2VL6 A;  1C0A A;  3SK6 A;  1PTO C;  1ENF A;  2Q2T A;  4J8Q A;  1IZ6 A;  1XNR Q;  3KF6 A;  4A3B B;  2ZJP A;  2CVR A;  2Z6B A;  3Q6S A;  2F4V Q;  5C4X H;  5ELN A;  2QF7 A;  3A8I E;  1XPU A;  1QVC A;  2MQH A;  1STB A;  1DON A;  2FJ2 A;  4FYD A;  1Q12 A;  2BE5 D;  5TSS A;  3EQL C;  3CRL C;  4EQP A;  1G2S A;  3H0G B;  3HP3 A;  5A2Q L;  2JA8 H;  4IPH A;  4JG2 A;  3KF8 B;  5D3D A;  4CBV A;  4F8M A;  3PO2 B;  4DV1 L;  4FDB A;  4KD3 A;  1XWE A;  5CR3 A;  1SNC A;  2JQO A;  1X55 A;  3NSW A;  1T5E A;  2IT1 A;  4O42 A;  1X32 A;  1XNQ Q;  4H7B A;  2FFK B;  2F0G A;  4IJH A;  2I07 B;  2LXK A;  3T13 A;  2OT2 A;  5NUC A;  2XRQ D;  2VQF L;  4A3G H;  3HG9 A;  2K14 A;  5KRU A;  2A8V A;  1A15 A;  1BKB A;  3J7A F;  1CM9 A;  4FP5 D;  3NEM A;  5JEA H;  1SYG A;  4DR6 Q;  4MTN A;  4DV2 L;  2R93 G;  4A3J H;  4LFA L;  2XWJ B;  3VYU A;  5C3E G;  3C46 A;  1VQH A;  2AWO A;  1Y1W G;  1UE1 A;  5LL6 X;  2PQE A;  2R7F A;  1M8A A;  1IL2 A;  3GTM B;  4UPA A;  1I50 H;  2B8G A;  4OON A;  1E7Z A;  1SRU A;  1ZYR D;  1YNJ D;  2L5T A;  2A6H D;  4PZ7 A;  4X3K A;  4AYB G;  4B08 A;  5I9O A;  2YTY A;  2K5H A;  4RWS C;  2XIW A;  3FPP A;  1TWA H;  1MIU A;  2JE6 I;  1VQ9 A;  1U0L A;  4N8F A;  2EZV A;  4M1U B;  1LTT D;  2F0P A;  3QWN A;  3GTL H;  2E74 C;  2YYZ A;  2Z0S A;  4B3M L;  1HJP A;  2JA5 B;  5KYI A;  2L15 A;  3PV0 A;  2HIX A;  3S1Q B;  1QNK A;  1BBW A;  3VR6 A;  1SYC A;  3ONA B;  3RD4 A;  5FLX L;  4DR3 Q;  1JE5 A;  4A3L G;  4I65 A;  1A2U A;  1JJG A;  3KLW A;  4DNT B;  5C3W A;  1A8V A;  5M3M B;  4XXE A;  2P5Z X;  4FXK C;  1VF7 A;  4ZCK A;  2YTX A;  3KDF B;  1VQM A;  1JOO A;  1TWG H;  2ICE C;  2KEC A;  1UE5 A;  3HOV B;  3J80 c;  3I73 A;  1YI2 A;  1DOK A;  4LF4 L;  1BVS A;  2ES2 A;  2GA4 B;  3DMU A;  4JI5 Q;  4KY6 A;  2WAQ G;  1B50 A;  1LAC A;  1AE2 A;  4O1N A;  4RCO A;  5C0X G;  1HZC A;  1SXT A;  1WFQ A;  2R6G A;  1PH8 A;  1JWM D;  3AEV A;  1ESR A;  1I4G A;  4IAL A;  2IJ0 A;  3R93 A;  1EWI A;  1KRT A;  1VQP A;  3AU7 A;  4AH6 A;  2OTL A;  3NUC A;  4JI2 L;  2RBM A;  1F2M A;  2BDN A;  1RIP A;  1E22 A;  1TXY A;  5FJ8 G;  3MC0 B;  4R8N A;  3AYH B;  1PVO A;  2AQ3 B;  2JEB I;  5ELD A;  4A4I A;  2OXP A;  2ZJQ A;  4HJ7 A;  1UWV A;  3OSO A;  4RKL A;  5IOD A;  4OWT B;  2B2W A;  3TRZ A;  2WKC A;  4B3T L;  3H3V I;  3MXN A;  3QB3 A;  3MXG A;  3SDZ A;  4A93 G;  3G6E A;  1XMO Q;  4A3C H;  1B3Q A;  4JI8 Q;  2E2J H;  2B2W C;  4LK1 C;  1ILP A;  1VDZ A;  5C5L A;  2F52 A;  2VW9 A;  5C0X J;  3OTO L;  5AJ3 Q;  4RG1 A;  2VXW A;  3W1G A;  4LAA A;  5BN4 A;  5M3F B;  3TZU A;  3K80 C;  1DOM A;  1PA6 A;  2OF1 A;  1SYD A;  4C1N I;  4DAM A;  1LTB D;  4DV1 Q;  2I46 A;  5GAG C;  1M90 C;  3VR3 A;  4DV7 L;  4DV5 L;  3FDT A;  1IL8 A;  4X65 L;  5CV5 A;  3HKZ G;  1VMP A;  1KD1 C;  1EIG A;  3EIV A;  3NQI A;  4KKU A;  4IFD J;  3CU7 A;  1RTO A;  2BH2 A;  5IGD A;  1ML0 D;  4IPG A;  2PZT A;  4ALP A;  4GKJ L;  1NAP A;  3HOX H;  2DY7 A;  2UUC Q;  2D0O A;  1PRT C;  3D4W A;  2B39 A;  1KNA A;  4HED A;  4LUZ A;  5DAU A;  2VQF Q;  4DUZ L;  3VA5 A;  5FLX c;  4WFN 3;  2NVY B;  3TN2 A;  3A74 A;  2AWN A;  3ND8 A;  1NJI C;  1HR0 W;  3NBH B;  2L9H A;  1E2V A;  2JA6 H;  4L8J A;  4LFA Q;  1JC7 A;  2IWH A;  2WP8 J;  4DR7 L;  2VUM B;  3PO3 G;  2IHF A;  5C3X A;  4KI0 A;  3TEH B;  2EXZ A;  3GO5 A;  3TSS A;  4A3K G;  5LMN L;  2F0V A;  3O13 A;  4HR7 B;  3L0O A;  2AMC B;  1DOL A;  1I3Q B;  4RHR A;  3I91 A;  3K7U C;  1SMY C;  1SE4 A;  1VQG A;  2E5L L;  4DV4 L;  5IGE A;  3WDN A;  5C4J B;  2SNM A;  3W3A A;  4X62 Q;  4I7A A;  2PQA B;  5CYU A;  3MXP A;  2DJF C;  5D65 A;  1PZK D;  2K33 A;  4KHV A;  4B3M Q;  3FKI G;  5DNF A;  1UEA B;  3I4N G;  2R92 B;  2BH8 A;  1MBY A;  4KLK A;  4ZAI A;  1TWH B;  2N8N A;  5IGF A;  4QQB X;  2Q8R E;  4IOC A;  2KJX A;  2EY2 A;  2I0Q A;  1IW7 D;  2F0K A;  4NXM L;  3DEP A;  2MFI A;  1MHW C;  3OW7 A;  3GTJ B;  4R4C A;  4MNO A;  2R93 H;  1HFG A;  5C3E H;  1JB3 A;  3GTO H;  1Y1W H;  4TQU S;  3I70 A;  1Y1V G;  4LF4 Q;  2F3V A;  4C3I B;  4JI6 L;  1VS0 A;  1PV4 A;  2RQX A;  5COR A;  2O2L D;  4CDF C;  4NXN L;  5C44 G;  3TP7 A;  1C7Y A;  3CQZ B;  4BY7 B;  1II3 A;  2F3W A;  4RFB A;  4A3I B;  1QZH A;  3D3R A;  4X3T A;  5JPN C;  3R8B A;  5EPL A;  2H4O A;  2E2H B;  2IPK D;  3DLL A;  3EA6 A;  4DR5 Q;  2YU9 H;  3H6M A;  1YIT A;  1C8C A;  1FNU A;  4JI2 Q;  3S1M H;  4DK0 A;  1XTC D;  4IN3 A;  2JEA I;  1F9R A;  2EYM A;  1U4L A;  1FL0 A;  4ODG A;  3D6C A;  2D0P A;  2HDM A;  4UP7 A;  5M5W B;  2ZM6 L;  1Y14 B;  2WII B;  3RN5 A;  1EQQ A;  1H9R A;  4A3L H;  3GTP B;  4B3T Q;  3TME A;  2IHE A;  1XMQ Q;  3JAM E;  2EYP A;  4X66 L;  1BCP C;  1S5E D;  1TS3 A;  3RZD H;  1UE7 A;  4ILW A;  2BE5 C;  3TDQ A;  1RKN A;  5G3L F;  1ONL A;  2D2C C;  3M3Y B;  1TY2 A;  1L0W A;  1V1Q A;  1Y8P B;  4C56 C;  5BR8 Q;  4K5X A;  3MA2 B;  1DJR D;  4OWW B;  3HOU B;  1NE3 A;  1SJE D;  2KEN A;  5DM6 3;  1ICW A;  3AB9 A;  2DUD A;  2ZXO A;  3MFG A;  2BA1 A;  4IUN A;  1Q86 C;  2EVB A;  1KHI A;  1NR2 A;  4MTK A;  3ERQ A;  2KED A;  3K5M A;  1K9M C;  5C4X G;  1H9J A;  2KCC A;  4P71 A;  1D5Z C;  2F1M A;  3K6O A;  4ZRZ A;  1JQY D;  3NP8 A;  1SJH D;  3ERO A;  3R3O A;  5LMN Q;  3E9I A;  2NTT A;  5C5M A;  2Q2U A;  1K0S A;  2K52 A;  2AUJ D;  4KHZ A;  1IBK Q;  3K57 A;  3ULJ A;  2A6H C;  3T1H Q;  3L9A X;  2UXC L;  4DAY A;  1ILQ A;  1B7Y B;  5IGC A;  4A3D B;  1SFO H;  1VQJ A;  1I94 Q;  1CKN A;  2DNE A;  3SXH A;  3GP7 A;  4GNX B;  1KAA A;  3EFX D;  1VQ5 A;  2EYH A;  3PUZ A;  5JEA G;  4L5T A;  4A75 A;  4KD4 A;  1L0X B;  2VB2 X;  1Y8N B;  3VA7 A;  5M5Y B;  2Y0S B;  4A3J G;  1YJW A;  5EPK A;  1PXU A;  1XJV A;  1EU4 A;  4KMU C;  3NXW A;  1XXG A;  4JBM A;  3I3C A;  3BVM A;  3GTQ B;  3KBG A;  1SE8 A;  1VQA A;  5FKA C;  1QIL A;  3SK4 A;  4DR2 Q;  1N8R C;  4N8X 1;  1I6V C;  1E1T A;  2N88 A;  4BBR B;  2D62 A;  5EKI A;  1ICF B;  2QDL A;  1F2Z A;  1JMC A;  1GUS A;  3PO3 H;  4JV5 Q;  4PV1 C;  1LTS D;  4A3K H;  3UDX A;  3SR1 A;  1RCV D;  4NXN Q;  1B1Z A;  3K0X A;  1EIH A;  2N49 A;  3NTH A;  5JEA J;  2DGY A;  2JP1 A;  1FD7 D;  2EDG A;  1XNQ L;  1LTA D;  1I6H H;  1STG A;  4BY1 B;  3NTI A;  4R4Q A;  1MJC A;  3H91 A;  2K4K A;  2K32 A;  3A8K E;  3AQQ A;  1B44 D;  4R8I A;  4V19 0;  1N36 L;  4ME5 A;  2NVQ B;  3BS1 A;  3IAY A;  2X6G A;  3CP0 A;  1NMG A;  3FKI H;  3HEJ A;  3I4N H;  2K01 A;  2NYZ D;  3J7Y W;  3KLS X;  2F0E A;  5IYD G;  5A2Q E;  3BDL A;  1VMC A;  5EGT A;  2ZM6 Q;  1GHJ A;  3R2T A;  5CC4 A;  1HHV A;  4P75 A;  3T1Y L;  2A69 C;  3FMC A;  5ELO A;  1A62 A;  3KF8 A;  3E5S A;  1SYF A;  2Z6K A;  3S9W A;  4X66 Q;  3M4Y A;  1S40 A;  4ZLT F;  3HOW B;  5IYC G;  2GVB A;  4WOR A;  3RUZ A;  4A3M B;  2BCO A;  1TS4 A;  4QB4 A; 
#chains in the Genus database with same CATH homology
 2DN8 A;  4KY5 A;  3I4L A;  1E2Z A;  2K04 A;  4QIW B;  2CW0 D;  2V4D A;  4DAV A;  3CKI B;  2A68 D;  2VNU D;  3A54 A;  4K6L A;  3BG3 A;  1NUC A;  1QWY A;  4FVM A;  1PTO F;  4C3J B;  1PFM A;  3A7A B;  2F0O A;  1A3U A;  2EPB A;  2SOB A;  4L6T B;  4EGV A;  2SNS A;  2JXM B;  4K6D A;  3U9S A;  1ESF A;  3UI2 A;  4KY7 A;  4C3H B;  4U67 3;  3HRZ C;  1C4Q A;  2RSO A;  1A3T A;  1HTP A;  3RZO B;  2B2U C;  4LJZ C;  1F2Y A;  2F0S A;  3Q22 A;  4XQJ A;  2F0M A;  2TSS A;  2M00 A;  4PMC A;  5E4X A;  1HTL D;  5FLX E;  2OEO A;  4YIJ A;  1I4H A;  3H09 A;  1Q90 A;  3Q0A A;  5JJZ A;  3IL8 A;  1D5X C;  5ELB A;  1EZ6 A;  5LHY 1;  2H1E A;  2JA8 B;  2A5H A;  5COY A;  1SNP A;  1Y8O B;  1Z6H A;  1MSG A;  2EY1 A;  2N55 A;  1MGS A;  1CK1 A;  3J80 L;  2PMZ B;  2RSN A;  1YNN D;  1RJT A;  2EYL A;  1SNM A;  4K8J A;  3T16 A;  3MAQ A;  4HMJ A;  5IOC A;  2F4I A;  5A35 A;  2HCI A;  3OHX C;  4NW2 A;  4HTH A;  5EPJ A;  1TQO A;  3TP6 A;  1DZ1 A;  2KCN A;  3WOE A;  3GTG B;  1I50 B;  1CQV A;  3H94 A;  1IHZ A;  1LAB A;  1R4Q B;  1BR9 A;  3G7L A;  5KYL A;  5CV7 A;  1EZ8 A;  4ABN A;  5HUR A;  2PW7 A;  3GTL B;  1FNW A;  2MPM A;  4J1M A;  5EKK A;  2WAC A;  1WTV A;  2A6E D;  1WTX A;  2PZW A;  1LT3 D;  3U9O A;  2K1B A;  4A3E B;  2DNC A;  2LFN A;  3HZX A;  3K7A B;  5G3L D;  4XTC S;  3M7N A;  1QOH A;  1WVL A;  3DEO A;  3NBH A;  1EOT A;  3TBI B;  1PZJ D;  3QOL A;  3TZD A;  2PO4 A;  3T4A C;  1B2T A;  3I4M B;  3HGB A;  4C3I G;  3V05 A;  4BWG B;  1G91 A;  4G7O C;  2IX0 A;  4L63 B;  3S14 B;  1S4Z A;  3OWE B;  4K14 A;  1RHP A;  1CT1 D;  1PTO B;  5C6A A;  1TU2 B;  5FO7 B;  2XN9 C;  5LL6 S;  2Q8I B;  4DXG A;  1T5X D;  2XWB B;  2MUY A;  4NP5 A;  5FK9 C;  1A3V A;  5BN3 A;  3MXU A;  5JVH 3;  4HN7 A;  3OMG A;  1PRT F;  1E0B A;  4CGY B;  4B9W A;  5FOB B;  2A74 C;  3HOY B;  4KV6 A;  2F0H A;  1AZQ A;  4EVO A;  4G7H C;  2K7V A;  1TWF B;  1RDP D;  4CKE A;  4JK1 C;  3K5N A;  2MHV A;  4RH6 A;  1I4P A;  1AP0 A;  1EYA A;  2IX1 A;  1BO0 A;  3QJY A;  4OO1 I;  3DXJ C;  2B2V A;  1D1I A;  1U9R A;  4DU9 A;  2NZ1 D;  1SND A;  3M85 A;  4JBW A;  3KK7 A;  2XSC A;  2JA6 B;  2C9O A;  2KVM A;  1I4R A;  3QIA A;  4V0B A;  2ZXP A;  1WTQ A;  1D1K A;  2LY7 A;  1HQR D;  1Q3L A;  5M9O A;  4ZUI A;  1IKL A;  4HSP A;  2LS0 1;  5K5P A;  1SE2 A;  3H3V C;  3IKJ A;  4DXF A;  2WIN B;  3J81 L;  3SHL A;  2WKD A;  3V2T A;  2L12 A;  4K2K A;  5ISR A;  1AZP A;  5ELF A;  3DHQ A;  2R3Z A;  1JWS D;  3OWF A;  3S17 B;  1EEF D;  1H9S B;  2J7Z A;  5T1G A;  1EYC A;  2HQE A;  1EY8 A;  2MP1 A;  3P1H A;  2G9H D;  5KNB A;  2K03 A;  1MSH A;  4OIK A;  3DWQ A;  4N9P A;  1S5D D;  3LWE A;  2QKI C;  2R93 B;  5C3E B;  1DD2 A;  4XDX A;  2JSO A;  2KUM A;  4RGM A;  1TT2 A;  5F2D A;  4KN7 C;  1STN A;  1TII D;  5DEH A;  3VR4 A;  2AQ2 B;  1DXM A;  4AYB B;  2L55 A;  4K8I A;  4TSS A;  3HS0 C;  4BA2 I;  2WB1 B;  1PTO D;  4NMZ A;  1BCP F;  4DF7 A;  1VCI A;  4F88 A;  1QB5 D;  1CI3 M;  3GV3 A;  1JE4 A;  2QIL A;  1GUN A;  5I2X A;  4HSV A;  3VYS A;  1IYV A;  5C4H A;  4DA2 A;  3P75 A;  4I7Z C;  1NCV A;  1D2B A;  3PUW A;  3RZD B;  1SNO A;  1JWU D;  2X6L A;  2EYJ A;  2IX3 A;  1PMR A;  1SNQ A;  3S2H B;  2WAQ B;  3MTS A;  3OIQ A;  1WTO A;  3D6W A;  1PRT B;  3KLS A;  1HCZ A;  1S5F D;  2NTS A;  3BDO A;  4G7Z C;  3HOZ B;  1K83 B;  3FRP B;  4ZKB B;  2NN6 G;  2KOL A;  3FVQ A;  2PPB C;  1V1P B;  3K0Y A;  1EY0 A;  3E0J A;  3C1E A;  4A93 B;  4OGQ C;  1V1O A;  1G6Z A;  5IT9 L;  1R9T B;  4C3H G;  5KND A;  3MFY A;  2NN6 I;  3C3L A;  2EY5 A;  2KQ3 A;  4OO1 H;  1BDO A;  1G29 1;  2NWG A;  4MN3 A;  3Q23 A;  3HKZ B;  2ZT9 C;  1Z47 A;  1SAP A;  3VR5 A;  1EY7 A;  5I2Y A;  1ZYR C;  1YNJ C;  2R7Z B;  2LMC B;  1AW7 A;  3DUZ A;  1K8O A;  1CZW A;  1TR5 A;  4PQX A;  2M9V A;  1OXS C;  2DY8 A;  1DM0 B;  1RD9 D;  2RDG A;  3BZD B;  3RMH A;  4J6H A;  4CJ1 B;  2EY6 A;  1QG7 A;  5K36 G;  1LTG D;  3PO3 B;  1EQT A;  3IFT A;  4A3K B;  4ZK9 B;  5CMD A;  1S5C D;  4HCS A;  1TVX A;  5E3F A;  1KLG D;  1TS5 A;  1WD0 A;  1CTM A;  4CKC A;  2D9U A;  4TKO B;  4RKB A;  1EQV A;  1B53 A;  2BA0 A;  4G57 A;  1ROD A;  2O5J C;  4IUR A;  3FKI B;  5CV9 A;  5E1F A;  3I4N B;  1SE3 A;  4FXD A;  1U4M A;  3TP8 A;  1RTN A;  1CHQ D;  3SVM A;  2AUK A;  2HUG A;  1BNZ A;  3C1F A;  4RCN A;  1BCP B;  3CRK C;  1ENC A;  1CQF A;  4XYQ A;  1LV9 A;  1LT5 D;  3KUP A;  3J80 E;  4PNY A;  4FO2 A;  1Y1V B;  3CHB D;  1HUN A;  1HRJ A;  1PRT D;  4KK7 A;  3L7Z C;  5C44 B;  4XIG S;  5BN5 A;  2L4N A;  1KDB A;  2F0U A;  3T53 B;  4XT1 B;  3BVZ A;  3SEB A;  2E2D C;  1LLR D;  3BDC A;  1EL0 A;  3PUX A;  2E76 C;  2F0J A;  1TY0 A;  1I4Q A;  4WRD A;  3GTK B;  5C4Z A;  1CFM A;  1V8Q A;  4IUV A;  1OO9 B;  5KIX A;  3ITP A;  1WTP A;  3SK8 A;  1SMY D;  4Y7N B;  5J1Z A;  3IFD A;  2TMP A;  3BYT B;  2NVT B;  1KNE A;  4G4K A;  4K5V A;  4C1N K;  2F0W A;  1WD1 A;  3VYT A;  4XT3 B;  4NDX A;  1K8M A;  2F0I A;  4IUQ A;  2E75 C;  4CJ0 B;  2L0C A;  4IUU A;  3QO2 A;  3QG1 A;  4CHT B;  2KEE A;  3E6Z X;  4ZKC B;  5D14 A;  3MZ5 A;  4X3U A;  1EY4 A;  1U4R A;  1J8I A;  2F0N A;  1AEX A;  4CJ2 C;  1EY9 A;  1B4O A;  1GHK A;  1HPC A;  5C4X B;  3NHH A;  4PMW A;  4FF4 A;  2PNR C;  5JVG 3;  2NN6 H;  1WTR A;  5M5X B;  3URY A;  3BVG A;  4RGN A;  2QDB A;  1B9N A;  4QCL A;  2KHS A;  1IW7 C;  3NPP A;  1EFI D;  1F77 A;  4EQO A;  5KGU A;  3NTK A;  4A3G B;  3MHB A;  4K2L A;  1BCP D;  1BUV T;  1HFN A;  2G9D A;  1X3P A;  4ZYS A;  4A3J B;  4QMG A;  3R2I A;  1GUW A;  2MGS A;  5I6W A;  4IQZ A;  1M4V A;  4GZY C;  3RLF A;  1W6J A;  5JOB A;  4X3S A;  4CKB A;  2BDO A;  3ND9 A;  1F9S A;  5K36 H;  1PFN A;  2F0D A;  5KNC A;  1HUM A;  1QE6 A;  1TWA B;  1IKM A;  3A7L A;  1LT4 D;  1OXT A;  1G2T A;  2QEJ C;  3S1R B;  5CBE E;  2ID0 A;  5CV8 A;  2X69 A;  2JYO A;  1IYU A;  4C2M B;  5KEE A;  1J9O A;  4WJW A;  4NKL A;  2HCC A;  5FO9 B;  1SSO A;  1GUO A;  3L3O C;  2NUC A;  1AFP A;  4UAI A;  3NK9 A;  4N9T A;  3J81 E;  5I4D A;  1FNV A;  3G6J B;  1TWG B;  2HDL A;  1UAP A;  4KKT A;  3I72 A;  3S2D B;  5HGT A;  4F87 A;  4XQN A;  3DWP A;  2K28 A;  3T51 B;  5I6Y A;  1TKW B;  3A8J E;  1I4X A;  1PYW D;  1H9S A;  2K5Q A;  4B9X A;  2B8F A;  3M4O B;  1JR0 D;  5T1I A;  1LT6 D;  2PYK A;  3D4R A;  3LX0 A;  1C48 A;  2O4X A;  5CV4 A;  2EJM A;  3LNN A;  3P20 A;  1Q1B A;  3PIP 3;  5EQ0 A;  2EYO A;  2L11 A;  2E2J B;  4FNF A;  4HMI A;  3D8G A;  2R61 A;  3ZYY X;  5AFW A;  5J22 A;  1LTR D;  5IGG A;  4OO1 G;  1H9M A;  1E2W A;  4HAE A;  1FYC A;  4KTA A;  1DYQ A;  2E2I B;  1D6E C;  4QF4 A;  1PTO H;  1WTW A;  4IFD G;  5C0X I;  4DK1 A;  1QNU A;  3HOX B;  2A69 D;  1SBB B;  3PUY A;  4Q0F A;  2AQ1 B;  2Z1C A;  2ZXR A;  2Z4I A;  2B2V C;  3J7A V;  5D3I B;  3DM1 A;  2Q8T A;  1UUP A;  1JOR A;  1BXT A;  3PMF A;  2ENB A;  4IFD I;  4KJO A;  1QCB D;  5IIF A;  4QUF A;  4DAP A;  1SYE A;  1JCK B;  5JPM C;  1MD2 D;  1MI2 A;  3Q24 A;  1TS2 A;  1BF4 A;  2NB0 A;  2FHT A;  1GUG A;  1SYB A;  1HQM C;  1STA A;  1QJO A;  1GXD C;  2Z8L A;  2PW5 A;  2FMM A;  2J0T D;  1O7Y A;  4Z9C B;  2B2Y A;  4M8A A;  1PDQ A;  3X3M A;  1JOQ A;  1CA6 A;  3C2P A;  1V1P A;  2B2Y C;  1Z7T A;  2K5W A;  2MJ8 A;  4MIU A;  4DGZ A;  3OMC A;  1KDC A;  5IT9 E;  4H13 C;  2KA7 A;  4RA8 A;  4H0L C;  3FEW X;  1B9M A;  2VB3 X;  1SEB D;  1CHP D;  2CW0 C;  5CGK A;  2A68 C;  3GTO B;  1Y1W B;  5EJW A;  4IUP A;  4KKS A;  4Q5V A;  2D5D A;  4TRD A;  1S5B D;  4U68 A;  5ELE A;  1HA6 A;  1KLU D;  2SEB D;  1UNS A;  4FF2 A;  3OIP A;  2JA7 B;  1HA5 A;  2EYF A;  1AN8 A;  1ENA A;  1DCZ A;  3A56 A;  2YU9 B;  3QOJ A;  1L0Y B;  1A2T A;  2EJG C;  3S1M B;  5EBC A;  3I8Z A;  2FMC A;  4MHE A;  2FIN B;  1F9Q A;  4XQQ A;  1ZKO A;  4ZUJ A;  5CBA E;  1NSN S;  2F0T A;  1SDF A;  4A3F B;  1EY5 A;  3K59 A;  1Y69 U;  4DNR B;  2RKS A;  2CHB D;  1BOS A;  1G8Z D;  2RDH A;  1ZXT A;  1JOK A;  2BOS A;  3I90 A;  1STE A;  3P7J A;  2XRS D;  1X3Q A;  3EJI A;  2B63 B;  1NR4 A;  3DWA A;  1YNN C;  3X3N A;  4HCE A;  4BS9 A;  4OIJ A;  1PLF A;  1EWH A;  1FR3 A;  4C3J G;  3N52 A;  4RGO S;  4ZQ3 A;  3SE0 A;  5EBD A;  1O80 A;  2RVL A;  2NBF A;  2B2T A;  3GD7 A;  1B3A A;  1O7Z A;  2A73 B;  3M7G A;  3MWY W;  1R4P B;  3N6R A;  1ET9 A;  2B2T C;  1RF2 D;  5FO8 B;  4DN4 M;  5C0X H;  3GV6 A;  3GQB A;  1SFO B;  2NVX B;  4OHJ A;  4KN4 C;  4H44 C;  3D31 A;  3K5L A;  1GOZ A;  5DM7 3;  1CZG A;  4ULL A;  3EVQ A;  1A6X A;  3FPU B;  4DFA A;  4IFD H;  1KAB A;  3V96 A;  2ICI A;  3K58 A;  2M2L A;  2WV6 D;  4E6I A;  2A6E C;  3BYY B;  4ID6 A;  4K5W A;  1LO5 D;  3D4D A;  1F9P A;  4S3S A;  3AMU A;  3KLR A;  1OXV A;  4KJN A;  3S15 B;  2XVS A;  3K5O A;  2Z4H A;  3MEH A;  3NBI A;  1D5M C;  1EU3 A;  4F7X A;  1EY6 A;  3A55 A;  1I6H B;  1BQQ T;  1WCM B;  3NWT A;  2L1B A;  5E4W C;  1O78 A;  1PFB A;  2SDF A;  2LKV A;  2CQA A;  1O7L A;  2J4X A;  3PIO 3;  4BA1 I;  1V43 A;  1ZEQ X;  2K05 A;  2XNA C;  1ET6 A;  1XYI A;  3JAM L;  1PZI D;  5JAV A;  1EWC A;  3PUV A;  4XYO A;  1EYD A;  1HXY D;  2PZU A;  3OOC A;  4QUC A;  2EE1 A;  1JIC A;  3WOF A;  1W6K A;  4RHS A;  1H9K A;  3TP5 A;  2F0Q A;  3KBX A;  4EQN A;  3VR2 A;  1FGB D;  3NE5 B;  5J39 A;  4BBS B;  1GUT A;  3LWU A;  2QCP X;  4UDU C;  4FF3 A;  4IZ8 A;  2IL8 A;  4LMQ D;  2K6A A;  3W2D A;  2F03 A;  4FXG C;  5CV6 A;  4PMB A;  5EKL A;  5I9P A;  1KTK A;  1Q1E A;  2EOT A;  2RA4 A;  4OL7 A;  1EEI D;  1CA5 A;  2C5C A;  1U4P A;  3NWS A;  5IGB A;  2RDF A;  2PCF B;  2K5D A;  3S16 B;  4RAU C;  1GJX A;  1VF5 C;  2IW3 A;  3VYR A;  1BBX C;  4IUT A;  4RGT A;  4P2C B;  2EJF C;  3S1N B;  1Q8I A;  1F2L A;  3MVV A;  3NQT A;  4FF1 A;  1OXX K;  2O5I C;  5ELC A;  2B2U A;  1LTI D;  1STY A;  3OPO A;  1XX8 A;  1STH A;  1KDA A;  1TWC B;  1OXU A;  3T56 B;  3F2U A;  2F0L A;  3SK5 A;  2F0F A;  4R9W A;  3SK6 A;  1PTO C;  1ENF A;  4J8Q A;  4A3B B;  2CVR A;  3Q6S A;  2QF7 A;  3A8I E;  1STB A;  1DON A;  2FJ2 A;  4FYD A;  5TSS A;  1Q12 A;  2BE5 D;  3EQL C;  3CRL C;  4EQP A;  1G2S A;  3H0G B;  3HP3 A;  5A2Q L;  5D3D A;  4CBV A;  4F8M A;  3PO2 B;  4KD3 A;  1XWE A;  5CR3 A;  1SNC A;  3NSW A;  1T5E A;  2IT1 A;  4O42 A;  1X32 A;  4H7B A;  2FFK B;  2F0G A;  2I07 B;  3T13 A;  2OT2 A;  5NUC A;  2XRQ D;  3HG9 A;  5KRU A;  1A15 A;  3J7A F;  1CM9 A;  4FP5 D;  5JEA H;  1SYG A;  2XWJ B;  3VYU A;  3C46 A;  2AWO A;  5LL6 X;  2PQE A;  1M8A A;  3GTM B;  2B8G A;  1ZYR D;  1YNJ D;  2L5T A;  2A6H D;  4X3K A;  4B08 A;  5I9O A;  4RWS C;  2XIW A;  3FPP A;  2JE6 I;  2EZV A;  4M1U B;  1LTT D;  2F0P A;  3QWN A;  2E74 C;  2YYZ A;  2JA5 B;  5KYI A;  3PV0 A;  3S1Q B;  1QNK A;  3VR6 A;  1SYC A;  3ONA B;  3RD4 A;  5FLX L;  4I65 A;  1A2U A;  4DNT B;  5C3W A;  5M3M B;  4XXE A;  4FXK C;  1VF7 A;  1JOO A;  2ICE C;  2KEC A;  3HOV B;  3I73 A;  1DOK A;  2GA4 B;  3DMU A;  4KY6 A;  1B50 A;  1LAC A;  4O1N A;  4RCO A;  5C0X G;  1SXT A;  2R6G A;  1JWM D;  1ESR A;  1I4G A;  4IAL A;  2IJ0 A;  3R93 A;  3AU7 A;  3NUC A;  2RBM A;  1F2M A;  2BDN A;  3MC0 B;  4R8N A;  2AQ3 B;  2JEB I;  5ELD A;  2OXP A;  3OSO A;  4RKL A;  5IOD A;  2B2W A;  2WKC A;  3MXN A;  3QB3 A;  3MXG A;  3SDZ A;  2B2W C;  4LK1 C;  1ILP A;  1VDZ A;  5C5L A;  5C0X J;  2VXW A;  4LAA A;  5BN4 A;  5M3F B;  3TZU A;  1DOM A;  2OF1 A;  1SYD A;  4C1N I;  1LTB D;  2I46 A;  3VR3 A;  3FDT A;  1IL8 A;  5CV5 A;  1VMP A;  1EIG A;  3NQI A;  4KKU A;  4IFD J;  3CU7 A;  1RTO A;  5IGD A;  1ML0 D;  2PZT A;  1NAP A;  2DY7 A;  1PRT C;  3D4W A;  2B39 A;  1KNA A;  4HED A;  5DAU A;  3VA5 A;  4WFN 3;  3TN2 A;  2NVY B;  2AWN A;  3ND8 A;  2L9H A;  1E2V A;  4L8J A;  1JC7 A;  2IWH A;  2WP8 J;  2VUM B;  5C3X A;  4KI0 A;  2EXZ A;  3GO5 A;  3TSS A;  2F0V A;  3O13 A;  4HR7 B;  1DOL A;  1I3Q B;  4RHR A;  3I91 A;  1SMY C;  1SE4 A;  5IGE A;  3WDN A;  5C4J B;  2SNM A;  3W3A A;  5CYU A;  3MXP A;  5D65 A;  1PZK D;  2K33 A;  4KHV A;  5DNF A;  1UEA B;  2R92 B;  1MBY A;  4ZAI A;  1TWH B;  5IGF A;  2Q8R E;  2KJX A;  2EY2 A;  1IW7 D;  2F0K A;  3DEP A;  3OW7 A;  3GTJ B;  1HFG A;  1JB3 A;  4TQU S;  3I70 A;  2F3V A;  4C3I B;  2RQX A;  5COR A;  2O2L D;  3TP7 A;  3CQZ B;  4BY7 B;  1II3 A;  2F3W A;  4RFB A;  4A3I B;  3D3R A;  4X3T A;  5JPN C;  3R8B A;  5EPL A;  2H4O A;  2E2H B;  2IPK D;  3EA6 A;  3H6M A;  1C8C A;  1FNU A;  4DK0 A;  1XTC D;  4IN3 A;  2JEA I;  1F9R A;  2EYM A;  1U4L A;  4ODG A;  3D6C A;  2HDM A;  5M5W B;  2WII B;  1H9R A;  3GTP B;  3TME A;  3JAM E;  2EYP A;  1BCP C;  1S5E D;  1TS3 A;  4ILW A;  2BE5 C;  3TDQ A;  1RKN A;  5G3L F;  1ONL A;  2D2C C;  3M3Y B;  1TY2 A;  1Y8P B;  4C56 C;  4K5X A;  3MA2 B;  1DJR D;  3HOU B;  1SJE D;  5DM6 3;  1ICW A;  3AB9 A;  2ZXO A;  3MFG A;  2BA1 A;  4IUN A;  2EVB A;  1NR2 A;  3ERQ A;  2KED A;  3K5M A;  1H9J A;  2KCC A;  1D5Z C;  2F1M A;  3K6O A;  4ZRZ A;  1JQY D;  3NP8 A;  1SJH D;  3ERO A;  3R3O A;  2NTT A;  5C5M A;  2AUJ D;  4KHZ A;  3K57 A;  2A6H C;  3L9A X;  4DAY A;  1ILQ A;  5IGC A;  4A3D B;  2DNE A;  3SXH A;  3GP7 A;  1KAA A;  3EFX D;  2EYH A;  3PUZ A;  5JEA G;  4KD4 A;  1L0X B;  2VB2 X;  1Y8N B;  3VA7 A;  5M5Y B;  2Y0S B;  5EPK A;  1PXU A;  1EU4 A;  4KMU C;  3NXW A;  1XXG A;  3I3C A;  3BVM A;  3GTQ B;  3KBG A;  5FKA C;  1QIL A;  3SK4 A;  1I6V C;  2N88 A;  4BBR B;  2D62 A;  5EKI A;  1F2Z A;  1GUS A;  4PV1 C;  1LTS D;  3SR1 A;  1RCV D;  1B1Z A;  1EIH A;  5JEA J;  3NTH A;  2JP1 A;  1FD7 D;  2EDG A;  1LTA D;  1STG A;  4BY1 B;  3NTI A;  3H91 A;  2K32 A;  3A8K E;  1B44 D;  4R8I A;  4V19 0;  4ME5 A;  2NVQ B;  3BS1 A;  3IAY A;  2X6G A;  3HEJ A;  2K01 A;  2NYZ D;  3J7Y W;  3KLS X;  2F0E A;  5A2Q E;  3BDL A;  1VMC A;  5EGT A;  1GHJ A;  3R2T A;  5CC4 A;  1HHV A;  2A69 C;  3FMC A;  3KF8 A;  3E5S A;  1SYF A;  3S9W A;  3M4Y A;  4ZLT F;  3HOW B;  4WOR A;  3RUZ A;  4A3M B;  2BCO A;  1TS4 A;  4QB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...