4QUFA

Crystal structure of chromodomain of rhino with h3k9me3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
b'EEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RE36324p
publication title Transgenerationally inherited piRNAs trigger piRNA biogenesis by changing the chromatin of piRNA clusters and inducing precursor processing.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein binding
total genus 13
structure length 57
sequence length 57
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4qufA00
1X3PA 1QE6A 2FHTA 1BO0A 2SDFA 3R93A 1NAPA 1VMPA 2B2UA 2Q8RE 3IL8A 3I90A 1VMCA 1BF4A 4RAUC 1G2TA 2L12A 1LV9A 1G6ZA 1PFNA 2D9UA 4HCSA 4X3SA 1ICWA 2VXWA 2B2YC 4ZKCB 1NR2A 2B2WA 1J8IA 3GV6A 2KOLA 2X69A 3H91A 2FINB 2IL8A 1AZQA 1G91A 2K01A 4R8IA 3I3CA 1RODA 5COYA 2K28A 2KUMA 2K05A 1WTOA 1JE4A 4IUUA 1A15A 2L11A 2EE1A 1HUMA 1RTNA 1SDFA 2CVRA 1HA6A 1U4LA 2XIWA 3DEOA 3FPUB 5AFWA 2KVMA 5E4WC 4ZKBB 1WTWA 4X3TA 4O42A 1DOLA 4XT3B 1ZXTA 1GUWA 2FFKB 4RWSC 2B2TC 2L1BA 4HEDA 3QO2A 1WTQA 1BNZA 4DN4M 3MWYW 1B2TA 2X6LA 3IFDA 1B50A 2NYZD 4OIJA 1O7ZA 1SSOA 1U4RA 4IUQA 2RSOA 5CBEE 1Q3LA 2L4NA 3D6WA 2DY7A 1C8CA 1EIHA 1B3AA 1MSHA 2BDNA 1PFMA 3KUPA 4NW2A 1AP0A 2K03A 4XDXA 5CORA 2KECA 4HSVA 4ZAIA 1IKMA 2NWGA 4HAEA 1WD1A 1ILPA 1QG7A 2L9HA 4QUFA 1JICA 5D14A 1RJTA 2J7ZA 3DEPA 2H1EA 5T1GA 4CJ2C 4ZK9B 3DM1A 3Q6SA 1KNAA 5DNFA 5EJWA 1XYIA 2B2YA 2B2VC 1PDQA 4IUVA 2MGSA 1F2LA 1BBXC 2JP1A 1EIGA 2KEEA 3LWEA 4XT1B 4QUCA 1HFGA 1WTVA 1F9SA 1RHPA 1MGSA 1WTXA 1WTRA 1O7YA 5EQ0A 3KBXA 2RVLA 5E4XA 2RSNA 3F2UA 3GV3A 1DZ1A 3P7JA 4U68A 5JJZA 1EOTA 1U4MA 1HFNA 3TZDA 5EPKA 1MI2A 2MJ8A 3I91A 2RA4A 2EPBA 1DOKA 1ESRA 2B2TA 3ONAB 2MPMA 1U4PA 2B2UC 1J9OA 1F9RA 3HP3A 1MSGA 2HUGA 2K1BA 2N55A 2KEDA 3TN2A 1IKLA 3N52A 4IUTA 1KNEA 1ILQA 2M2LA 1DOMA 2Q8TA 1WTPA 1X32A 1CM9A 2FMMA 1G2SA 2B2WC 2NZ1D 1TVXA 2X6GA 1XX8A 2HCIA 1ML0D 1PFBA 2EOTA 4IURA 4MN3A 4X3KA 5EPJA 4CJ0B 1DONA 4LMQD 1F9QA 1O80A 2JYOA 2HCCA 4R9WA 4IUPA 5T1IA 1HHVA 2MP1A 3MTSA 4MHEA 5CBAE 1WVLA 1QNKA 2B2VA 3I8ZA 3FDTA 4OIKA 2HDLA 1SAPA 1HUNA 1M8AA 1F9PA 1S4ZA 1RTOA 4X3UA 4CJ1B 2R3ZA 3G7LA 2N88A 4UAIA 1CA6A 2HDMA 1B53A 3UI2A 1WD0A 1X3QA 1B4OA 5CMDA 1PLFA 5D65A 5EPLA 2DY8A 1IL8A 1NCVA 4RA8A 2K04A 1EQTA 3SVMA 1AZPA 1HRJA 1E0BA 1CA5A 2FJ2A 5EKIA 4ZLTF 1EL0A 1NR4A
chains in the Genus database with same CATH superfamily
3A54A 3FP9A 5EKLA 2UUCL 4M8AA 3CC2A 2AHOB 1GHJA 4G7ZC 5DM63 5C3XA 2CHBD 3SXHA 2DN8A 4Y52H 1SMYD 2D9UA 2ID0A 2QDLA 1XTCD 4A3BG 3ERQA 1J5EQ 2A8VA 2K01A 1HZ9A 4BY7G 1II3A 1CHQD 3T13A 2C9OA 2YTVA 1HUMA 4POGA 1SYGA 3CCLA 1KLGD 2WACA 2V1CC 3NWTA 4JBJA 4DFAA 3GP7A 4A3KG 3QO2A 2X6LA 5GAGC 1HA5A 1I6VC 2RSOA 2PZWA 3S1QH 2LFNA 3JAML 4JI2Q 3NQTA 2D2CC 2VS1A 4R4OA 3KYHC 4R4CA 2GN5A 1D5MC 4DR1Q 1I4HA 4QUFA 4A93B 4GOPA 2K5NA 3RLOA 5M5XH 4F87A 1ENAA 1EUJA 2B2YA 2WP8J 5EGTA 1U9RA 4DK0A 4F7XA 1G8ZD 2M9VA 1WTXA 4DGZA 1YZ6A 2IHEA 1WTRA 1XMQQ 3I4NH 2PNHA 5AJ3L 3HGBA 2SNMA 1SRUA 2JA6G 4KY6A 5EPKA 5M5WB 1M90C 2ES2A 4HIMA 2F1MA 1J9OA 1I94Q 3FKIB 1IKLA 3H3VI 4DR4Q 1XNRQ 3AU7A 1G2SA 1PXUA 2EYLA 2CKZB 2CFMA 4K5XA 1VQFA 3QOJA 4RGOS 4I7ZC 2R7FA 4X3KA 1VQLA 2LY7A 3OOCA 1B9MA 4R9WA 3NTIA 1I5FA 1HZBA 2A1AA 2RBMA 1TIID 1I3QH 5CBAE 1JC7A 3CCUA 3S2DH 4KHPL 1PH2A 3CCVA 5KYLA 4X65L 3I4OA 5IT9E 5EBDA 3J80E 1VQIA 1UE6A 2ATWA 5IWAL 4H13C 3S2HB 2A74C 4A3FB 2EY2A 4EVOA 4DV3Q 2D5DA 2FHTA 3TSSA 2SDFA 1SLJA 4GKKL 3RZOH 2B63B 2AWNA 3U58A 1AE3A 1Y1VH 1X55A 3FVQA 4JG2A 4N9PA 2YU9H 1B9NA 3MXGA 4R4QA 1BUVT 3RD4A 1G91A 4OL7A 5M3MG 1TWCB 2EIFA 1N32L 1OXXK 4K2LA 3TRZA 5M3FH 4GNXB 1RF2D 3E0JA 1O7IA 1JMCA 3S1RB 1BXTA 1A15A 3NELA 1JJCB 4XYOA 1DOLA 4JI3Q 3S14H 4HN7A 5CYUA 1IBKL 3NP8A 2NYZD 4OIJA 3URYA 2JA8G 5LL6X 1QUQA 2D0PA 4I65A 4LK1C 4JI4L 1T5XD 3MHBA 2EYMA 3PO3G 3FHWA 2RDFA 4NPSA 1LYLA 3PCOB 2XSCA 2LMCB 5D14A 4UY8C 2KQ3A 1STAA 2AKWB 1TY2A 1SNCA 2OF1A 4QY7A 3H94A 5FLMG 2DJGC 4C3JB 1KABA 1OXUA 2E74C 4A3KH 3ULPA 4R4IA 1NNXA 1FGUA 1QOHA 4B3RL 4GZYC 2F0OA 1TWFH 1GO3E 2NBFA 3TQYA 2D0OA 1H9KA 1K3BC 4IJHA 3NWSA 2B2UC 3TN2A 1EOVA 3N52A 1KNEA 2JXMB 2A6HC 2Z4HA 3HOYH 1TVXA 1SNQA 4AYBG 5LMNL 3EROA 1KRTA 1BCPF 2AMCB 3BYYB 5IP7G 1PYSB 2DJFC 1RKNA 3EJIA 5KRUA 2MP1A 3KF8A 3HOXG 1D6EC 2JA6H 3CPWA 2NVYB 4QQBX 1YEZA 4JW0A 1F9PA 3VA5A 4X3UA 2F3VA 4JBWA 3NEMA 1FNUA 4ME5A 4X66Q 2XN9C 3RR5A 1STYA 1E0BA 1HNWL 4LFAL 2FJ2A 2JP1A 1XMOL 1UEBA 2ZJQA 2VQFQ 2QA4A 3K81C 4KY5A 1EEID 1KTKA 3IL8A 3KJPA 1J6QA 1G2TA 4L5QA 1X56A 2L12A 2R92B 2EXDA 4CKEA 4EQ5A 1LTAD 4LFBQ 3HZXA 3AFQA 3KDFB 5JPMC 1K0SA 4AQYL 2KENA 2LXJA 4LF7L 3P75A 4DXGA 1WTOA 1A0IA 4IUUA 4OXPA 4HIKA 1UWVA 1X3EA 1AEXA 3VYUA 4O1NA 4M1UB 2ZTEA 1BNZA 4DN4M 4QL5A 3OMCA 1BCPD 2WAQG 2YYZA 1Q3LA 3MXNB 1MSHA 3ZJYC 5M3MH 3I4MH 1W6JA 1E24A 4A3JG 5JVH3 2DGYA 3J81i 3PGZA 2MHVA 2VNUD 4HJAA 2A19A 4IO9A 4FXGC 4UP8A 1B44D 1T9HA 1UE5A 1N9WA 4C3IB 1VQJA 5IGCA 1HFGA 4B3MQ 1WTVA 5CV5A 4IFDJ 2RVLA 5IGDA 2JA8H 3J7AV 3GV3A 4A3GG 5ELFA 4JBKA 1G51A 1KLUD 4KMUC 1EOTA 3CU7A 3D4WA 1JB3A 5KNDA 4LWCA 2EPBA 3H09A 5HURA 2XRQD 3PO3H 4F88A 3HOWG 1C0AA 1F2MA 1LM0A 2KEDA 5CV7A 1JOKA 3CMEA 4IUTA 3K7UC 1SYBA 2O2LD 1VQNA 3LX0A 1I3QB 3S15H 2R6GA 4J8QA 1DONA 1XPRA 4GNXC 2RHSB 1IYVA 4OEMB 1A63A 1TR5A 3DWAA 2QGQA 1VCIA 4DV7L 1S5BD 4KTAA 4XIGS 5J39A 2ZXPA 4PG3A 4UAIA 1CKNA 1QVGA 4XQQA 3PO2G 1A6XA 5ELBA 4DK6C 4C1NK 2NZOA 5BR8Q 5IYCG 4IFDG 3M3YB 4HJ9A 5IGGA 1Y1VB 2F0PA 2YU9B 3SDZA 4K0KQ 1ONLA 1PYBA 4UHVA 1N36Q 1R4PB 1Q12A 3M4QA 3SHLA 2R7ZH 2UXDL 5M3FB 3D8GA 2B2WA 3GV6A 3GD7A 5C4HA 1PH7A 5FO7B 2F0VA 2FXQA 3VDYA 3J7ZC 5COYA 1EYAA 1VQKA 2DNCA 1K8OA 2KCNA 4DV6L 3S14B 4OHJA 4HIDA 2IY5B 3KOJA 1HA6A 2P5ZX 3DEOA 4WORA 1PTOF 4O42A 1HZAA 1ZXTA 4H0LC 1ASZA 1SYCA 2EJFC 2JE6I 2ZXRA 1C9OA 4O2DA 2AQ3B 4YHHQ 3NXWA 3FPPA 2L4NA 2PZTA 1Y14B 2B63G 3IRBA 2KECA 1N34Q 2JA7G 3D4RA 1E3PA 5GADC 1SE8A 2RF4A 2QF7A 1QWYA 2CH4W 4UP7A 2E2JH 5LMUL 1YNNC 4FYDA 1EYGA 5C3WA 4IFDI 3BJUA 4J6HA 4AH6A 4A3IG 2EYPA 2AUJD 5JVG3 5NUCA 2A6ED 1TWFB 4XYQA 1LTLA 4DXFA 1PRTD 1DGSA 2BDOA 3QG1A 5L37A 2UUAL 3I73A 2HHHL 2IHFA 3A0JA 1B70B 3J7AF 2WB1E 4RKBA 4ZQ3A 1H9MA 1IW7C 3D0FA 4WJ4A 2RA4A 3D4DA 5IT9c 3MVVA 2N78A 3J80c 1L1OB 1MJCA 3NBHB 1HH2P 4GKJL 1UUPA 2M2LA 4DR5L 2I46A 1LTGD 1X32A 2F03A 4JOIC 3VR6A 3AEVA 1EY9A 1GVPA 4XTCS 4NXNL 1I4XA 4KLKA 4MN3A 1DYQA 1O7LA 4C3JG 5JPNC 2L15A 2BOSA 4C3HB 4MHEA 2ZM6L 1UE1A 4YY3Q 1STNA 3V2TA 1TXYA 1LACA 1EIFA 3J81L 4LF4L 3G7LA 2NVTB 4OWXB 1STEA 4ID6A 1PLFA 2RCFA 5D65A 3S1MH 3CF5A 4RA8A 1B1ZA 3CRKC 3GTGH 2AQ2B 3E6ZX 2YTYA 3QB3A 3R93A 2Z1CA 2F0HA 1VMPA 1HTPA 2E2IB 5CGKA 1X3FA 3EN2A 4APVA 4OO1H 1IXRA 2VXWA 1EQVA 2JN4A 1WFQA 4P75A 3JAMi 3TS0A 4OX9L 2VB2X 3I3CA 2ICEC 3I2ZA 3PV0A 4FVMA 3LNNA 2FMCA 1UEAB 2XIWA 1N33L 4X62L 1SN8A 3CRLC 3K6OA 4X3TA 1FVIA 1GUWA 2XGTA 1EU4A 2L1BA 2N3SA 3A7AB 3HFZB 2CWPA 4JI7L 4KK7A 4LFCL 3OW2A 4K5VA 2Y0SG 3K5NA 2F0WA 4XDXA 2A5HA 3GTPH 4XXEA 3MXPA 2R93B 3OSOA 2HD3A 2L9HA 4PMCA 4GOPB 2HT1A 2IW3A 2H1EA 2F0QA 3DM1A 3PF5A 4RCOA 4JI0Q 3X3MA 1S5FD 1PDQA 1I4GA 3OHXC 4RGNA 4LUVA 1F2YA 4DR3Q 3BDLA 1SNPA 1TWAH 1MGSA 2EJMA 4PMBA 3SK6A 3S1NH 2KCTA 1FJGQ 4MNOA 2F3WA 3F2UA 4DUZL 1YVCA 4RGTA 1Q7YC 5C4ZA 1GM5A 5IE8A 4PQXA 1L0XB 3H0GH 1HNZL 2OTLA 2E5LL 3NPPA 5GAHC 1CM9A 3STBD 1SNOA 1EYCA 2X6GA 3HOUH 2CCZA 2JK8A 1YBYA 2HCIA 4FF1A 4C3IG 4Y7NH 4JV5Q 4P2CB 4LF5Q 1LABA 1SXTA 1Y1WG 5K36H 2PQEA 1LTRD 1M8AA 4UP9A 4WFN3 1VS0A 3F2DA 1P8LA 5C3EB 2C35B 1NJIC 1SFOH 2F4IA 2Z6BA 2EYOA 5DLQE 5KIXA 3MFGA 3P20A 4JI8Q 2DY8A 2NZHA 2PQAA 4K8JA 4QGUA 3GTMH 5JOBA 5H1SE 4C2MH 1WCMB 4ZLTF 2XTIA 2R7ZB 4AIMA 2NB0A 2VW9A 2XRSD 3PIP3 2DNEA 4B9WA 3L0OA 1LT6D 1IYJB 1OO9B 4ZKCB 5I9OA 1I50H 4IPHA 1PFSA 1SR3A 4HMJA 1TU2B 1VQPA 2NTTA 1NBWA 5KEEA 2Q2HA 3KBGA 3OIQA 3CCQA 4DU9A 5M9OA 4JYAL 1U0LA 2ZTCA 3E9HA 3HKZG 2KHSA 3EVQA 4DUYL 2H5XA 5C5MA 4YCWA 4IQZA 1L1OC 1V1PA 4K6DA 1R9TH 1B3QA 3PUWA 1B50A 1O7ZA 1QUQB 5M5YH 3S16B 1C8CA 1R4QB 3KUPA 4HMIA 5C6AA 1VQCA 3C2PA 3SK4A 4FXKC 2K03A 2IX1A 2E2JB 1K73C 1TWHB 1CZWA 3GTLB 3S17H 2CW0D 1K8GA 4H7BA 4DR7Q 1JORA 5FJ8G 1XMQL 3Q6SA 2KBNA 1HTLD 5DAUA 2NVXH 2EVBA 4FNFA 3BVGA 1QVCA 4BBRG 4N9TA 3PUXA 1CQFA 1ZYRD 4HJ5A 1MD2D 4JI6Q 3W3AA 2R61A 5LHY1 2OTJA 3A5ZB 5JJZA 1U4MA 2CWAA 4LUZA 2PPBC 1OTCA 4H02A 1QILA 2I5LX 4JI5L 5HY6A 2B2TA 1PZID 4LF6Q 2R7DA 5FLXL 1W3SA 3UDFA 1EY7A 2DUDA 3KK7A 3OTOQ 4P72A 2UU9L 1PFBA 5EPJA 3TP6A 3J81E 2OWOA 5A2QL 1Q46A 5BN5A 3GTOB 3R8BA 2KHJA 1SJHD 4BY1H 3GTQH 1GHKA 4WRDA 4A3MH 1KRSA 3KF8B 1QNKA 2B2VA 4A3EB 4A76A 2UUCQ 4GLVB 3D31A 3HG9A 4LW1A 3UI2A 2PCFB 2C5CA 1WD0A 5CMDA 4TKOB 1A3VA 4U673 4LUOA 3HRZC 2LKVA 3Q22A 4DR6L 1IBMQ 4JI1L 4BXXH 2VY3A 3T4AC 2UXBL 5ELNA 2VUMB 1EU3A 4OWWB 1TKWB 4GOPC 1Y8OB 1WI5A 1HZCA 1PFNA 2B39A 2B2YC 5ELOA 1IHZA 1AZQA 1ET9A 2PZUA 3D6CA 3PQIA 3BDCA 4C3HG 2OT2A 5E3FA 4FF3A 2PYKA 1LT4D 2BE5D 5CC4A 3VYSA 3PIPA 1SDFA 1MIUA 1JQYD 2A68C 2NUCA 2F0LA 4WJ3M 1VQ4A 5HGQA 1UAPA 1B2TA 3D3RA 2OCEA 1UE7A 3O13A 1Q86C 3HOVG 3G71A 2K52A 3TBIB 3M85A 2DY7A 5D3DA 3RZDH 1Y8PB 1PA6A 3NHHA 3MFYA 4HSVA 4PZ7A 1K83H 1WD1A 1HXYD 4GS3A 5AJ3Q 2JA5H 1S5CD 5TSSA 4NXML 2EXZA 5EJWA 2JA9A 4AYBE 3HOZB 1TWAB 1SYFA 4B3SL 1BVSA 2UUBQ 3S1NB 3KF6A 4A3DH 1LUZA 4ZCKA 1TT2A 4XT1B 1PH6A 4KD4A 4NP5A 2F4VL 1ENFA 5E4XA 3CP0A 4A3BH 2XVSA 1DOKA 1SJED 2RCNA 5IGBA 4DV5L 4BY7H 5FJ8H 3HOUB 1YJWA 1X54A 3Q23A 3H3VH 2R93G 3PUVA 4RG1A 3RN2A 2Z4IA 5C4JB 1RCVD 4X65Q 4I7AA 4DAVA 5C5LA 5FK9C 4CJ0B 5IYBG 5T1IA 1D1KA 4LF8L 5IWAQ 2K50A 3R3OA 3GDEA 1GUTA 3I8ZA 4GKKQ 1SAPA 2CQOA 2OQ0A 5BN3A 4CJ1B 4B3TL 1CKNB 5I6YA 4DV2L 3NTKA 4K2KA 1X3QA 1CSQA 3BYTB 5FKAC 1SMYC 3E3XA 1STGA 3A8JE 1JT8A 1N32Q 3VR5A 3I72A 3K58A 3P1HA 1YHQA 2WAQE 4DAYA 2CW0C 1BF4A 1QCBD 4RHSA 1X3GA 4DK1A 4X3SA 1ICWA 4V0BA 4YWMA 4LJZC 4BBSB 3H91A 2QKIC 1VQGA 1PTOH 3QJYA 1YNJD 1IBKQ 1RODA 4IZ8A 2WKCA 3CQZB 2F0SA 4ME3A 2K5QA 5CV6A 3CCJA 2LSSA 1KL9A 4JI4Q 2JQOA 4HJ8A 3LWUA 5CV9A 2A69D 1D1IA 5C0XJ 2EY5A 5C4XG 1CFMA 1DJRD 2WB1B 2A73B 2XNAC 1U4RA 4IUQA 2PI2A 1Z7TA 5C44G 4CDFC 5CORA 2ALYB 4ZAIA 1IKMA 4Q0FA 1M1KC 4HAEA 1YNXA 2QILA 4B3ML 4B3RQ 5CV4A 1RJTA 2QEJC 4DV0L 4YWKA 3VA7A 3A74A 3V05A 1GUSA 2F52A 2EYHA 2K5DA 3KFUA 2ZTDA 3F2CA 2AWOA 1VF7A 3LWEA 3JAME 1K9MC 2ENBA 3S1QB 4DV1Q 1K0RA 1TS4A 2E75C 3HOVH 1BCPB 4EQNA 3P7JA 4LNQA 5LMNQ 2MJ8A 2XWBB 5M5XB 3SK5A 4DAPA 1GD7A 2KA7A 3TP5A 5A2QE 3X3NA 5C0XG 2I0QA 1NMFA 4BWGB 4CHTB 2F0FA 3GTQB 3I4NB 3OPOA 4A3MB 2GA4B 3K80C 4DR2L 4IUPA 2BE5C 1HNWQ 4LFAQ 1XMOQ 3BVMA 1PVOA 1RTOA 4CGYB 2NVQH 1STHA 4GNXA 1JWUD 2HIVA 1A3TA 1K28A 2OEOA 1NCVA 3OWEB 4QIWE 5F2DA 4A93G 2F0JA 5ISRA 1X3PA 3SEBA 5FLMH 1X6OA 3HKSA 4AQYQ 5IYBH 1ENCA 4E6IA 4LF7Q 3NK9A 3I90A 2LXKA 1S5ED 3S2DB 1G6ZA 2K4KA 1PMRA 5FOBB 3VR2A 1VQ8A 4YCUA 2O4XA 3K8AA 3TREA 1B8AA 5I4DA 2PW5A 2K28A 1FNVA 3K57A 5C0XI 4DV4Q 4POFA 1N8RC 1NSNS 2CVRA 3J7YW 3FKIG 3RZOB 1WTWA 4C56C 4MTKA 1JWMD 3Q0AA 2M00A 2WKDA 3A56A 5IP7H 4HIOA 2EYFA 3W2DA 3D6WA 2JA5B 4NW2A 3HOXH 3EA6A 4YWLA 1GOZA 4A3DB 1GUGA 1SE3A 2G5DA 4IUVA 3J81c 2MGSA 1CSPA 1XTDA 5C4XH 4CKCA 3PIO3 4A3FG 2IWHA 4A3BB 4K8IA 1TWGH 2YTXA 3VYTA 3DHQA 4FO2A 5C44H 4BY7B 1HR0Q 5GQOA 3AB9A 1A8VA 1O78A 1VQAA 1L0YB 5IYDG 4DV7Q 3ERSX 5ELEA 1E22A 4A3KB 1JJ2A 1QNUA 2B2WC 1VQ7A 1HNXL 1PRTB 4JC0A 4TQUS 1Q81C 2NN6G 3RNUA 3K5LA 1HR0W 1PZKD 1LLRD 4CKBA 3QWNA 4A3JH 3EBEA 2A69C 1IBLL 4HJ7A 3HOYB 4PZ6A 1EYDA 1VQOA 2UXDQ 2PQAB 5C0XH 4IOCA 3SVMA 3BS1A 1CI3M 2OXPA 5KGUA 2RDGA 3OW7A 3T1HL 4DV6Q 1PTOD 1PTOB 2JA6B 4KN4C 2ICIA 2Y0SE 3L9AX 3ZYYX 1LV9A 2L0CA 3MXNA 4A3GH 3KLSX 3HOWH 3AQQA 3R2IA 1JE4A 1PH9A 1BCPC 4OWTB 3U4ZA 2KJXA 4A93H 4PMWA 3GQBA 1V1PB 3TS2A 2NN6I 4ZUIA 1XJVA 1EZ8A 2QW7A 2QEXA 3CCSA 5J1ZA 1DCZA 1L0WA 4MIUA 2UUAQ 1EY0A 4ZK9B 5I6WA 3PO2H 1FJGL 4HSPA 5DNFA 1SNMA 1RD9D 5IYCH 4IFDH 3W5OA 1IZ6A 3CCRA 4RFBA 1YITA 5M3MB 3I4MB 4DR5Q 3KBXA 4BA2I 1E1OA 1NTGA 1CK1A 4U68A 4X6AH 4L6TB 4NXNQ 1YI2A 2R92G 3UE1A 2MPMA 3C1EA 4A3CG 4JCVE 3BU2A 2MO0A 4KY7A 2HUGA 5GROA 3PIOA 2ZM6Q 1XNQQ 1ILQA 4K6LA 1C48A 3NE5B 1FR3A 3T51B 2PMZE 4LF4Q 2WINB 5JEAJ 2JA8B 1D5ZC 4K14A 3E0EA 1QZHA 4IURA 3S2HH 4DNIA 1O80A 4LF9Q 3MTSA 1M4VA 1SEBD 2IJ0A 3J7A5 4JI8L 2Q2IA 2VQEL 3PO3B 3FDTA 2HDLA 4IALA 2B63H 3ND8A 1F77A 2JA7H 1RL2A 3A8IE 3HKZE 2F0DA 1TWCH 1B4OA 3MXUA 3S15B 1AZPA 4OX9Q 4A3IH 3NQIA 2G9DA 3S1RH 4KV6A 4R1JA 4RMFA 3G48A 3VR3A 5D3IB 5EKKA 2Z6KA 2ZXOA 3I4NG 4RAUC 1VQBA 1ZKOA 4HCSA 5DM73 1KDBA 1NE3A 5I2XA 4N8X1 2QDBA 2X69A 1EWIA 4JI7Q 5GAEC 4LFCQ 1YIJA 1BR9A 5JEAG 1CQVA 4OONA 3DWQA 2L11A 1GJXA 3JAMc 4X64Q 1U4LA 4ZKBB 3A8KE 1D8LA 3H6MA 1J5EL 4KJOA 3HOXB 1E2WA 2L55A 3SR1A 5IOCA 4C3JH 3ND9A 1SSOA 4NB3A 1E7ZA 4P73A 1MBYA 1RDPD 1EEFD 3HS0C 2A6EC 3DUZA 1JICA 1PRTC 3MEHA 4IN3A 3CC7A 1VDZA 3RMHA 4NMZA 1XYIA 3QIAA 2Q8IB 3TP7A 1PV4A 4DF7A 1TWGB 4JI2L 4QUCA 1EY6A 3UDXA 3SE0A 2E5LQ 4ZRZA 1K8MA 1O7YA 5J22A 4DR1L 1Y1VG 4EGVA 2CQAA 3T1YQ 4L5SA 3OTOL 3I91A 5M3FG 1H9RA 1ET6A 3CD6A 2NVYH 2ZJPA 1PTOC 2JSOA 1HPCA 1DOMA 4QF4A 2Q8TA 2B3GA 2I5HA 3K7AH 1I6HH 2WAQB 2EOTA 2UXCQ 1AE2A 1LTID 2LS01 4DA2A 4A3JB 2A6HD 1I94L 1S40A 3I70A 3C46A 3RUZA 5IY0A 4DR4L 1XNRL 4V190 4O0AA 2K7VA 1IBML 3UE0A 2R92H 1MJEA 4A3CH 1VQ5A 3SGIA 2K32A 3A7LA 4G57A 2EY1A 4BS9A 3I56A 4G4KA 3GTKH 5JJIA 3T16A 4CDCC 1NR4A 1A3UA 4A3GB 1KXLA 4JYAQ 1SYEA 4DAYB 4DPGA 1JOOA 1EIYB 3TDQA 3HOWB 5ELDA 2XWJB 4DUYQ 2KOLA 2FINB 3S1MB 4P74A 1PHJA 4DV3L 2K33A 2SEBD 1A2UA 1KD1C 3GTGB 2ASBA 4JPBW 4EQPA 2E2HH 3HOYG 1YJNA 4YCVA 3CHBD 3FPUB 4FP5D 1I4RA 1FNWA 2B2TC 3NUCA 4L5TA 1CUKA 4C3IH 3OWFA 1S3OA 1EFWA 1C4QA 1CT1D 5CBEE 1ZEQX 3B6YA 4OGQC 3CPFA 4RHRA 3EFXD 1Y1WH 5IGEA 1QZGA 3IFTA 2UUBL 3PO2B 1AP0A 1WYDA 2L5TA 1TS5A 1QG7A 1YJ9A 1XPOA 4JI3L 1E1TA 5JEAH 5T1GA 1KNAA 4CDEC 1Z47A 2B2VC 1F2ZA 1VF5C 1PH1A 4JI5Q 1PH4A 3GTJH 4ULLA 1F2LA 3NBIA 4B08A 4BA1I 1EY4A 4CBVA 1TQOA 4RGMA 3L2PA 3MZ5A 1SE4A 3BZKA 1Q1EA 3GTPB 1H9SA 1DXMA 3U9OA 3G6JB 1HFNA 5FO9B 3TZDA 2UU9Q 2JJQA 5EBCA 1V9PA 3STBC 4EX5A 1ESFA 3C3LA 2MO1A 1F9RA 1PH5A 1MSGA 1KAAA 2N55A 1TY0A 3L7ZC 2F0GA 3TZUA 2Q2TA 2RKSA 1JJGA 4QIWB 3FRPB 1VQEA 2GVAA 4XQJA 4A3LG 4JK1C 2KCCA 3AFPA 1ML0D 2F0NA 1S72A 1QB5D 1F9QA 1HHVA 2EY6A 2HCCA 3M3YH 2QCPX 2JA7B 2K75A 1AFPA 3H0GB 4DR6Q 3MEFA 1CKMA 1GKHA 3F2BA 4JI1Q 2AUKA 3I4MG 2UXBQ 1S4ZA 4FDBA 1NMGA 2R3ZA 4ZUJA 3GO5A 3T53B 3WOFA 1LT3D 4A3IB 2Z0SA 2HQEA 1CHPD 2K04A 1HRJA 4Y7NB 4KHPQ 4PNYA 3BDOA 4BBRH 1NAPA 5G3LF 2B2UA 1FD7D 2BA1A 2BH8A 1VMCA 3H15A 4KKUA 2G9HD 1H9JA 1EQQA 1AW7A 4H44C 5K5PA 4X66L 1WTHA 1SFOB 3IKJA 2E76C 2VL6A 3BZDB 2RDHA 1E2VA 2SOBA 3GTMB 1DM0B 3KJOA 3PUZA 2VQFL 2KUMA 4PV1C 4C2MB 3VR4A 4OELB 1X9NA 3ULLA 5E4WC 2I5MX 4LFBL 3PUYA 1A62A 1VQ9A 2IX0A 3ER0A 2V4DA 1WTQA 4NXMQ 1I50B 4B3SQ 5CR3A 3WDNA 3RN5A 1LTTD 1EIHA 1B3AA 3NTHA 2IT1A 2OQKA 2F4VQ 5A35A 4CJ2C 2J7ZA 1ZYRC 3G6EA 4GN3B 4DV1L 5KYIA 3UDGA 2RHQB 5C3EG 4JBMA 3MC0B 2WV6D 1VQHA 1R9TB 1BDOA 2F0TA 2KEEA 4DV5Q 4WJWA 3CXCA 5M5YB 1TS3A 4FF4A 4GN4B 1Y8NB 1YNND 1L2FA 3LGJA 1WCMG 4P71A 5G3LD 1PZJD 2R7ZG 4HTHA 4IPDA 2F0IA 3S17B 2EJGC 3V96A 2KHIA 3A55A 4A75A 4S3SA 1Z9FA 1H95A 3KLSA 4C3HH 4LF8Q 1ESRA 1FYCA 3K0XA 2NVXB 1U4PA 3K7AB 1I6HB 1I4QA 4KHZA 1VQMA 4NKLA 4R8NA 4DK3C 1WJJA 4KD3A 2NVTH 5E1FA 1IW7D 3CC4A 4IPGA 2F0EA 4B3TQ 3L3OC 4DV2Q 4DKAC 1XX8A 4DNRB 2ZJRA 2B29A 2Y0SB 4LMQD 4FF2A 1WVLA 3BG3A 5FLXE 4GLAC 2E2IH 2PI2E 4OIKA 1HUNA 1CA6A 3GTKB 1Z6HA 4QB4A 3DXJC 1Q1BA 1IL8A 1UNSA 3NSWA 4QMGA 3A5UA 4A3LH 2RQXA 4RH6A 5J3BA 4BY1B 2JEAI 1BO0A 2Q8RE 1EWCA 1G6PA 1LO5D 5LMNW 2IX3A 2IPKD 1I4PA 4G7HC 4DV4L 1NR2A 4UPAA 5BR8L 1HCZA 2E2HB 4FXDA 3FMCA 4ALPA 2H4OA 2GVBA 1C7YA 4F8MA 2K05A 4K0KL 3JC66 2R93H 1N36L 3I55A 3W1GA 5AFWA 3QR8A 1V8QA 4J15A 2FFKB 2ZT9C 1Y1WB 4DV0Q 5FO8B 2K5WA 3Q24A 1BBUA 3CCEA 1HQMC 5ELCA 5JJKA 2F0KA 4YIJA 4C1NI 1QVFA 2NWGA 4KKSA 4A3EG 3GTJB 1G291 2PMZB 2F0UA 4KJNA 3C1FA 4G7OC 1EY8A 4YHHL 2WIIB 5I2YA 2HIXA 3PSIA 1BBXC 1HR0L 1XPUA 2K6AA 5IODA 2BA0A 1N34L 3ICEA 3RZDB 2EZVA 3TMEA 1IL2A 4R4TA 3J80i 4IPCA 3I4LA 4OO1G 1K83B 2TSSA 2E2DC 2VUMG 1DZ1A 1D7QA 3M4OH 5JJLA 3K0YA 3WWVA 1BOSA 1MI2A 1V43A 2EQSA 3I7FA 4Z9CB 3ONAB 4DR2Q 1VQDA 3HKZB 3AMUA 3CMAA 1TS2A 2N8NA 3G4SA 2B8FA 3K59A 1WTPA 1CTMA 1JR0D 1VQ6A 5C3EH 3E5SA 5DEHA 1PRTF 2FMMA 4TSSA 1EFID 3J81j 1SNDA 3Q8DA 3EQLC 4UDUC 1IYUA 2JYOA 3U9SA 1WCMH 1SMXA 2VB3X 3BZCA 1K3RA 2N88A 5HGTA 2KCMA 4MZ9A 4XQNA 4IUNA 3ITPA 4A4IA 4BBRB 2K5HA 4YY3L 1EL0A 1X65A 1CKOA 1QE6A 1RIPA 2E8GA 1EY5A 3HOZG 5IP9G 1YNJC 2F0MA 3K5MA 2PO4A 4OO1I 1AN8A 4Q5VA 4MTNA 1D5XC 2Q2UA 4JOIA 1J8IA 3MAQA 3H0GG 3KDFA 3S16H 1NY4A 3EIVA 2K14A 1TWHH 1PH3A 3GTLH 1V1OA 2EE1A 3HOUG 2KVMA 2F3IA 3RLNA 4XT3B 5IIFA 3KLWA 2MNAA 4HEDA 5CV8A 4TRDA 3F8TA 1A2TA 3MWYW 4NDXA 4KHVA 1ICFB 3QOLA 3RLFA 2WFWA 3T56B 1PFMA 5K36G 2BH2A 3OYYA 4ILWA 2BCOA 1Y69U 5KNCA 4LAAA 2MQHA 3N6RA 2VZAA 4KKTA 4GN5A 4DNTB 3DLLA 1EIGA 3VYRA 4B9XA 3U4VA 1KHIA 1RHPA 5LMUQ 2RSNA 2Z9HA 1XNQL 1JE5A 4JI0L 3GTOH 3FEWX 1FGBD 1EWHA 1HNXQ 4RKLA 4K5WA 4ODGA 3BVZA 3NENA 4A3EH 1LTSD 3HP3A 1JCKB 2HHHQ 4DR3L 4BBSG 4DAMA 2B8GA 1Q82C 3HEJA 4LF9L 3IAYA 1QJOA 5M5WH 3R2TA 4J1MA 3CCMA 3FKIH 1KDCA 1IBLQ 3HOVB 2EYJA 3CAMA 4QJFA 3CKIB 4L63B 4GKJQ 1SBBB 3CW2C 2VUMH 2N49A 4HCEA 2J0TD 2WB1G 3T1HQ 5IGFA 1K8AC 3TP8A 2HDMA 3U50C 1B53A 1P16A 1E2ZA 1U5KA 2EDGA 3OMGA 5EPLA 3M4PA 3UDIA 4QCLA 1EQTA 1JB7A 1SROA 3TEHB 5E7NA 4L8JA 1KQSA 4JV5L 4LF5L 2I07B 1GXDC 4IOAA 2CH4A 5IT9L 5KNBA 3J80L 1OXTA 4A3FH 2O5IC 3WOEA 4GLXA 1BBWA 3S9WA 2NVQB 3PF4A 2TMPA 4IJLA 4X64L 3S24A 2IL8A 1XWEA 1JWSD 1HQRD 2PNRC 4R8IA 4N8FA 1Q90A 2PW7A 4JVZA 3DWPA 1KDAA 5IYDH 1RTNA 2MFIA 1KC8C 3M4YA 3SK8A 4RWSC 5IP9H 3HOZH 1Q8IA 1LTBD 3IFDA 1LT5D 1PYWD 4BY1G 5JAVA 2HQLA 1BQQT 4HR7B 2NN6H 4A3MG 1ASYA 1DD2A 3PMFA 2NTSA 3K5OA 2A68D 3KLRA 2BDNA 4X62Q 1N33Q 2K5VA 1B7YB 2JEBI 4KN7C 1EZ6A 3W1BA 1ILPA 1YHAA 1OXVA 3DEPA 1KAWA 4AYBB 4ABNA 1WOCA 2J4XA 3T1YL 1YHBA 4BXXG 2YV5A 5LL6S 1MKHA 3E9IA 3H3VC 3M4OB 1F9SA 3M7NA 1XXGA 5FLXc 5EQ0A 5C4JH 1S5DD 1H9SB 4DR7L 2D62A 2Z8LA 1BKBA 1NUCA 1KIXA 1SE2A 1OXSC 4PZ8A 2AQ1B 1MHWC 3MA2B 2O5JC 1L1OA 5I9PA 2UXCL 2K1BA 2Z6KC 3NBHA 4DUZQ 1GUNA 2VQEQ 4JI6L 2MUYA 4L5RC 1SYDA 1W6KA 5C4XB 2NZ1D 3KF6B 1CZGA 4CDDC 1HNZQ 1STBA 1V1QA 5C44B 1PH8A 4LF6L 4KI0A 1GUOA 1EQRA 3AYHB 3M9BA 3ULJA 1HJPA 1W2BA 3M7GA 1T5EA 4TVAB 3F1ZA 2SNSA 2JA5G 3OIPA 4BBSH 1JOQA 1D2BA 1Q8KA 1FL0A 1AH9A 4ZYSA 3DM3A 3DMUA 4EQOA 5BN4A 4A3DG 1CA5A 5EAYA 4RCNA 5EKIA 3CQZH
chains in the Genus database with same CATH topology
3A54A 5EKLA 4M8AA 1GHJA 4G7ZC 5DM63 5C3XA 2CHBD 3SXHA 2DN8A 1SMYD 2D9UA 2ID0A 1XTCD 3ERQA 2K01A 1II3A 1CHQD 3T13A 2C9OA 1HUMA 1SYGA 1KLGD 2WACA 3NWTA 4DFAA 3GP7A 3QO2A 2X6LA 1HA5A 1I6VC 2RSOA 2PZWA 2LFNA 3JAML 3NQTA 2D2CC 1D5MC 1I4HA 4QUFA 4A93B 4F87A 1ENAA 2B2YA 2WP8J 5EGTA 1U9RA 4DK0A 4F7XA 1G8ZD 2M9VA 1WTXA 4DGZA 1WTRA 3HGBA 2SNMA 4KY6A 5EPKA 5M5WB 2F1MA 1J9OA 3FKIB 1IKLA 3AU7A 1G2SA 1PXUA 2EYLA 4K5XA 3QOJA 4RGOS 4I7ZC 4X3KA 2LY7A 3OOCA 1B9MA 4R9WA 3NTIA 2RBMA 1TIID 5CBAE 1JC7A 5KYLA 5IT9E 5EBDA 3J80E 4H13C 3S2HB 2A74C 4A3FB 2EY2A 4EVOA 2D5DA 2FHTA 3TSSA 2SDFA 2B63B 2AWNA 3FVQA 4N9PA 1B9NA 3MXGA 1BUVT 3RD4A 1G91A 4OL7A 1TWCB 1OXXK 4K2LA 1RF2D 3E0JA 3S1RB 1BXTA 1A15A 4XYOA 1DOLA 4HN7A 5CYUA 3NP8A 2NYZD 4OIJA 3URYA 5LL6X 4I65A 4LK1C 1T5XD 3MHBA 2EYMA 2RDFA 2XSCA 2LMCB 5D14A 2KQ3A 1STAA 1TY2A 1SNCA 2OF1A 3H94A 4C3JB 1KABA 1OXUA 2E74C 1QOHA 4GZYC 2F0OA 2NBFA 1H9KA 3NWSA 2B2UC 3TN2A 3N52A 1KNEA 2JXMB 2A6HC 2Z4HA 1TVXA 1SNQA 3EROA 1BCPF 3BYYB 1RKNA 3EJIA 5KRUA 2MP1A 3KF8A 1D6EC 2NVYB 1F9PA 3VA5A 4X3UA 2F3VA 4JBWA 1FNUA 4ME5A 2XN9C 1STYA 1E0BA 2FJ2A 2JP1A 4KY5A 1EEID 1KTKA 3IL8A 1G2TA 2L12A 2R92B 4CKEA 1LTAD 3HZXA 5JPMC 3P75A 4DXGA 1WTOA 4IUUA 1AEXA 3VYUA 4O1NA 4M1UB 1BNZA 4DN4M 3OMCA 1BCPD 2YYZA 1Q3LA 1MSHA 1W6JA 5JVH3 2MHVA 2VNUD 4FXGC 1B44D 4C3IB 5IGCA 1HFGA 1WTVA 5CV5A 4IFDJ 2RVLA 5IGDA 3J7AV 3GV3A 5ELFA 4KMUC 1KLUD 1EOTA 3CU7A 3D4WA 1JB3A 5KNDA 2EPBA 3H09A 5HURA 2XRQD 4F88A 1F2MA 2KEDA 5CV7A 1JOKA 4IUTA 1SYBA 2O2LD 3LX0A 1I3QB 2R6GA 4J8QA 1DONA 1IYVA 1TR5A 3DWAA 1VCIA 1S5BD 4KTAA 4XIGS 5J39A 2ZXPA 4UAIA 4XQQA 1A6XA 5ELBA 4C1NK 4IFDG 3M3YB 5IGGA 1Y1VB 2F0PA 2YU9B 3SDZA 1ONLA 1R4PB 1Q12A 3SHLA 5M3FB 3D8GA 2B2WA 3GV6A 3GD7A 5C4HA 5FO7B 2F0VA 5COYA 1EYAA 2DNCA 1K8OA 2KCNA 3S14B 4OHJA 1HA6A 3DEOA 4WORA 1PTOF 4O42A 1ZXTA 4H0LC 1SYCA 2EJFC 2JE6I 2ZXRA 2AQ3B 3NXWA 3FPPA 2L4NA 2PZTA 2KECA 3D4RA 2QF7A 1QWYA 4FYDA 1YNNC 5C3WA 4IFDI 4J6HA 2EYPA 2AUJD 5JVG3 5NUCA 2A6ED 1TWFB 4XYQA 4DXFA 1PRTD 2BDOA 3QG1A 3I73A 3J7AF 4RKBA 4ZQ3A 1H9MA 1IW7C 2RA4A 3D4DA 3MVVA 1UUPA 2M2LA 2I46A 1LTGD 1X32A 2F03A 3VR6A 1EY9A 4XTCS 1I4XA 4MN3A 1DYQA 1O7LA 4C3JG 5JPNC 2BOSA 4C3HB 4MHEA 1STNA 3V2TA 1LACA 3J81L 3G7LA 2NVTB 1STEA 4ID6A 1PLFA 5D65A 4RA8A 1B1ZA 3CRKC 2AQ2B 3E6ZX 3QB3A 3R93A 2Z1CA 2F0HA 1VMPA 1HTPA 2E2IB 5CGKA 4OO1H 2VXWA 1EQVA 2VB2X 3I3CA 2ICEC 3PV0A 4FVMA 3LNNA 2FMCA 1UEAB 2XIWA 3CRLC 3K6OA 4X3TA 1GUWA 1EU4A 2L1BA 3A7AB 4KK7A 4K5VA 3K5NA 2F0WA 4XDXA 2A5HA 4XXEA 3MXPA 2R93B 3OSOA 2L9HA 4PMCA 2IW3A 2H1EA 2F0QA 3DM1A 4RCOA 3X3MA 1S5FD 1PDQA 1I4GA 3OHXC 4RGNA 1F2YA 3BDLA 1SNPA 4PMBA 1MGSA 2EJMA 3SK6A 2F3WA 3F2UA 4RGTA 5C4ZA 4PQXA 1L0XB 3NPPA 1CM9A 1SNOA 1EYCA 2X6GA 2HCIA 4FF1A 4C3IG 4P2CB 1LABA 1SXTA 5K36H 2PQEA 1LTRD 1M8AA 4WFN3 5C3EB 2F4IA 2EYOA 5KIXA 3MFGA 3P20A 2DY8A 4K8JA 5JOBA 1WCMB 4ZLTF 2R7ZB 2NB0A 2XRSD 3PIP3 2DNEA 4B9WA 1LT6D 1OO9B 4ZKCB 5I9OA 4HMJA 1TU2B 2NTTA 5KEEA 3KBGA 3OIQA 4DU9A 5M9OA 2KHSA 3EVQA 5C5MA 4IQZA 1V1PA 4K6DA 3PUWA 1B50A 1O7ZA 3S16B 1C8CA 1R4QB 3KUPA 4HMIA 5C6AA 3C2PA 3SK4A 4FXKC 2K03A 2IX1A 2E2JB 1TWHB 1CZWA 3GTLB 2CW0D 4H7BA 1JORA 3Q6SA 1HTLD 5DAUA 2EVBA 4FNFA 3BVGA 4N9TA 3PUXA 1CQFA 1ZYRD 1MD2D 3W3AA 2R61A 5LHY1 5JJZA 1U4MA 2PPBC 1QILA 2B2TA 1PZID 5FLXL 1EY7A 3KK7A 1PFBA 5EPJA 3TP6A 3J81E 5A2QL 5BN5A 3GTOB 3R8BA 1SJHD 1GHKA 4WRDA 1QNKA 2B2VA 4A3EB 3D31A 3HG9A 3UI2A 2PCFB 2C5CA 1WD0A 5CMDA 4TKOB 1A3VA 4U673 3HRZC 2LKVA 3Q22A 3T4AC 2VUMB 1EU3A 1TKWB 1Y8OB 1PFNA 2B39A 2B2YC 1IHZA 1AZQA 1ET9A 2PZUA 3D6CA 3BDCA 4C3HG 2OT2A 5E3FA 4FF3A 2PYKA 1LT4D 2BE5D 5CC4A 3VYSA 1SDFA 1JQYD 2A68C 2NUCA 2F0LA 1UAPA 1B2TA 3D3RA 3O13A 3TBIB 3M85A 2DY7A 5D3DA 1Y8PB 3NHHA 3MFYA 4HSVA 1WD1A 1HXYD 1S5CD 5TSSA 2EXZA 5EJWA 3HOZB 1TWAB 1SYFA 3S1NB 1TT2A 4XT1B 4KD4A 4NP5A 1ENFA 5E4XA 2XVSA 1DOKA 1SJED 5IGBA 3HOUB 3Q23A 3PUVA 2Z4IA 5C4JB 1RCVD 4DAVA 5C5LA 5FK9C 4CJ0B 5T1IA 1D1KA 3R3OA 1GUTA 3I8ZA 1SAPA 5BN3A 4CJ1B 5I6YA 3NTKA 4K2KA 1X3QA 3BYTB 5FKAC 1SMYC 1STGA 3A8JE 3VR5A 3I72A 3K58A 3P1HA 4DAYA 2CW0C 1BF4A 1QCBD 4RHSA 4DK1A 4X3SA 1ICWA 4V0BA 4LJZC 4BBSB 3H91A 2QKIC 1PTOH 3QJYA 1YNJD 1RODA 4IZ8A 2WKCA 3CQZB 2F0SA 2K5QA 5CV6A 3LWUA 5CV9A 2A69D 1D1IA 5C0XJ 2EY5A 1CFMA 1DJRD 2WB1B 2A73B 2XNAC 1U4RA 4IUQA 1Z7TA 5CORA 4ZAIA 1IKMA 4Q0FA 4HAEA 2QILA 5CV4A 1RJTA 2QEJC 3VA7A 3V05A 1GUSA 2K5DA 2EYHA 2AWOA 1VF7A 3LWEA 3JAME 2ENBA 3S1QB 1TS4A 2E75C 1BCPB 4EQNA 3P7JA 2MJ8A 2XWBB 5M5XB 3SK5A 4DAPA 2KA7A 3TP5A 5A2QE 3X3NA 5C0XG 4BWGB 4CHTB 2F0FA 3GTQB 3I4NB 3OPOA 4A3MB 2GA4B 4IUPA 2BE5C 3BVMA 1RTOA 4CGYB 1STHA 1JWUD 1A3TA 2OEOA 1NCVA 3OWEB 5F2DA 2F0JA 5ISRA 1X3PA 3SEBA 1ENCA 4E6IA 3NK9A 3I90A 1S5ED 3S2DB 1G6ZA 1PMRA 5FOBB 3VR2A 2O4XA 5I4DA 2PW5A 2K28A 1FNVA 3K57A 5C0XI 1NSNS 2CVRA 3J7YW 3RZOB 1WTWA 4C56C 1JWMD 3Q0AA 2M00A 2WKDA 3A56A 2EYFA 3W2DA 3D6WA 2JA5B 4NW2A 3EA6A 1GOZA 4A3DB 1GUGA 1SE3A 4IUVA 2MGSA 4CKCA 3PIO3 4A3BB 2IWHA 4K8IA 3VYTA 3DHQA 4FO2A 4BY7B 3AB9A 1O78A 1L0YB 5ELEA 4A3KB 1QNUA 2B2WC 1PRTB 4TQUS 2NN6G 3K5LA 1PZKD 1LLRD 4CKBA 3QWNA 2A69C 3HOYB 1EYDA 5C0XH 3SVMA 3BS1A 1CI3M 2OXPA 5KGUA 2RDGA 3OW7A 1PTOD 1PTOB 2JA6B 4KN4C 2ICIA 3L9AX 3ZYYX 1LV9A 2L0CA 3MXNA 3KLSX 3R2IA 1JE4A 1BCPC 2KJXA 4PMWA 3GQBA 1V1PB 2NN6I 4ZUIA 1EZ8A 5J1ZA 1DCZA 4MIUA 1EY0A 4ZK9B 5I6WA 5DNFA 4HSPA 1SNMA 1RD9D 4IFDH 4RFBA 5M3MB 3I4MB 3KBXA 4BA2I 1CK1A 4U68A 4L6TB 2MPMA 3C1EA 4KY7A 2HUGA 1ILQA 4K6LA 1C48A 3NE5B 1FR3A 3T51B 2WINB 5JEAJ 2JA8B 1D5ZC 4K14A 4IURA 1O80A 3MTSA 1M4VA 1SEBD 2IJ0A 3PO3B 3FDTA 2HDLA 4IALA 3ND8A 1F77A 3A8IE 2F0DA 1B4OA 3MXUA 3S15B 1AZPA 3NQIA 2G9DA 4KV6A 3VR3A 5D3IB 5EKKA 2ZXOA 4RAUC 1ZKOA 4HCSA 5DM73 1KDBA 5I2XA 2QDBA 2X69A 1BR9A 5JEAG 1CQVA 3DWQA 2L11A 1GJXA 1U4LA 4ZKBB 3A8KE 3H6MA 4KJOA 3HOXB 1E2WA 2L55A 3SR1A 5IOCA 3ND9A 1SSOA 1MBYA 1RDPD 1EEFD 3HS0C 2A6EC 3DUZA 1JICA 1PRTC 3MEHA 4IN3A 1VDZA 3RMHA 4NMZA 1XYIA 3QIAA 2Q8IB 3TP7A 4DF7A 1TWGB 4QUCA 1EY6A 3SE0A 4ZRZA 1K8MA 1O7YA 5J22A 4EGVA 2CQAA 3I91A 1H9RA 1ET6A 1PTOC 2JSOA 1HPCA 1DOMA 4QF4A 2Q8TA 2WAQB 2EOTA 1LTID 2LS01 4DA2A 4A3JB 2A6HD 3I70A 3C46A 3RUZA 4V190 2K7VA 2K32A 3A7LA 4G57A 2EY1A 4BS9A 4G4KA 3T16A 1NR4A 1A3UA 4A3GB 1SYEA 1JOOA 3TDQA 3HOWB 5ELDA 2XWJB 2KOLA 2FINB 3S1MB 2K33A 2SEBD 1A2UA 3GTGB 4EQPA 3CHBD 3FPUB 4FP5D 1I4RA 1FNWA 2B2TC 3NUCA 3OWFA 1C4QA 1CT1D 5CBEE 1ZEQX 4OGQC 4RHRA 3EFXD 1AP0A 5IGEA 3PO2B 3IFTA 2L5TA 1TS5A 1QG7A 5JEAH 5T1GA 1KNAA 1Z47A 2B2VC 1F2ZA 1VF5C 4ULLA 1F2LA 3NBIA 4B08A 4BA1I 1EY4A 4CBVA 1TQOA 4RGMA 3MZ5A 1SE4A 1Q1EA 3GTPB 1H9SA 1DXMA 3U9OA 3G6JB 1HFNA 5FO9B 3TZDA 5EBCA 1ESFA 3C3LA 1F9RA 1MSGA 1KAAA 2N55A 1TY0A 3L7ZC 2F0GA 3TZUA 2RKSA 4QIWB 3FRPB 4XQJA 4JK1C 2KCCA 1ML0D 2F0NA 1QB5D 1F9QA 1HHVA 2EY6A 2HCCA 2QCPX 2JA7B 1AFPA 3H0GB 2AUKA 1S4ZA 2R3ZA 4ZUJA 3GO5A 3T53B 3WOFA 1LT3D 4A3IB 2HQEA 1CHPD 2K04A 1HRJA 4Y7NB 4PNYA 3BDOA 1NAPA 5G3LF 2B2UA 1FD7D 2BA1A 1VMCA 4KKUA 2G9HD 1H9JA 1AW7A 4H44C 5K5PA 1SFOB 3IKJA 2E76C 3BZDB 2RDHA 1E2VA 2SOBA 3GTMB 1DM0B 3PUZA 2KUMA 4PV1C 4C2MB 3VR4A 5E4WC 3PUYA 2IX0A 2V4DA 1WTQA 1I50B 5CR3A 3WDNA 1LTTD 1EIHA 1B3AA 3NTHA 2IT1A 5A35A 4CJ2C 2J7ZA 1ZYRC 5KYIA 3MC0B 2WV6D 1R9TB 1BDOA 2F0TA 2KEEA 4WJWA 5M5YB 1TS3A 4FF4A 1Y8NB 1YNND 5G3LD 1PZJD 4HTHA 2F0IA 3S17B 2EJGC 3V96A 3A55A 4S3SA 3KLSA 1ESRA 1FYCA 2NVXB 1U4PA 3K7AB 1I6HB 1I4QA 4KHZA 4NKLA 4R8NA 4KD3A 5E1FA 1IW7D 2F0EA 3L3OC 1XX8A 4DNRB 2Y0SB 4LMQD 4FF2A 1WVLA 3BG3A 5FLXE 4OIKA 1HUNA 1CA6A 3GTKB 1Z6HA 4QB4A 3DXJC 1Q1BA 1IL8A 1UNSA 3NSWA 4QMGA 2RQXA 4RH6A 4BY1B 2JEAI 1BO0A 2Q8RE 1EWCA 1LO5D 2IX3A 2IPKD 1I4PA 4G7HC 1NR2A 1HCZA 2E2HB 4FXDA 3FMCA 2H4OA 4F8MA 2K05A 5AFWA 1V8QA 2FFKB 2ZT9C 1Y1WB 5FO8B 2K5WA 3Q24A 1HQMC 5ELCA 2F0KA 4YIJA 4C1NI 2NWGA 4KKSA 3GTJB 1G291 2PMZB 2F0UA 4KJNA 3C1FA 4G7OC 1EY8A 2WIIB 5I2YA 1BBXC 2K6AA 5IODA 2BA0A 3RZDB 2EZVA 3TMEA 3I4LA 4OO1G 1K83B 2TSSA 2E2DC 1DZ1A 3K0YA 1BOSA 1MI2A 1V43A 4Z9CB 3ONAB 3AMUA 3HKZB 1TS2A 2B8FA 3K59A 1WTPA 1CTMA 1JR0D 3E5SA 5DEHA 1PRTF 2FMMA 4TSSA 1EFID 1SNDA 3EQLC 4UDUC 1IYUA 2JYOA 3U9SA 2VB3X 2N88A 5HGTA 4XQNA 4IUNA 3ITPA 4BBRB 1EL0A 1QE6A 1EY5A 1YNJC 2F0MA 3K5MA 2PO4A 4OO1I 1AN8A 4Q5VA 1D5XC 1J8IA 3MAQA 1V1OA 2EE1A 2KVMA 4XT3B 5IIFA 4HEDA 5CV8A 4TRDA 1A2TA 3MWYW 4NDXA 4KHVA 3QOLA 3RLFA 3T56B 1PFMA 5K36G 4ILWA 2BCOA 1Y69U 5KNCA 4LAAA 3N6RA 4KKTA 4DNTB 1EIGA 3VYRA 4B9XA 1RHPA 2RSNA 3FEWX 1FGBD 1EWHA 4RKLA 4K5WA 4ODGA 3BVZA 1LTSD 3HP3A 1JCKB 2B8GA 3HEJA 3IAYA 1QJOA 3R2TA 4J1MA 1KDCA 3HOVB 2EYJA 3CKIB 4L63B 1SBBB 4HCEA 2J0TD 5IGFA 3TP8A 2HDMA 1B53A 1E2ZA 3OMGA 2EDGA 5EPLA 4QCLA 1EQTA 4L8JA 2I07B 1GXDC 5IT9L 5KNBA 3J80L 1OXTA 2O5IC 3WOEA 3S9WA 2NVQB 2TMPA 2IL8A 1XWEA 1JWSD 1HQRD 2PNRC 4R8IA 1Q90A 2PW7A 3DWPA 1KDAA 1RTNA 3M4YA 3SK8A 4RWSC 1Q8IA 1LTBD 3IFDA 1LT5D 1PYWD 5JAVA 1BQQT 4HR7B 2NN6H 1DD2A 3PMFA 2NTSA 3K5OA 2A68D 3KLRA 2BDNA 2JEBI 4KN7C 1EZ6A 1ILPA 1OXVA 3DEPA 4AYBB 4ABNA 2J4XA 5LL6S 3H3VC 3M4OB 1F9SA 3M7NA 1XXGA 5EQ0A 1S5DD 1H9SB 2D62A 2Z8LA 1NUCA 1SE2A 1OXSC 2AQ1B 3MA2B 2O5JC 5I9PA 2K1BA 3NBHA 1GUNA 2MUYA 1SYDA 1W6KA 5C4XB 2NZ1D 1CZGA 1STBA 5C44B 4KI0A 1GUOA 3M7GA 1T5EA 2SNSA 3OIPA 1JOQA 1D2BA 4ZYSA 3DMUA 4EQOA 5BN4A 1CA5A 4RCNA 5EKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3P A;  1QE6 A;  2FHT A;  1BO0 A;  2SDF A;  3R93 A;  1NAP A;  1VMP A;  2B2U A;  2Q8R E;  3IL8 A;  3I90 A;  1VMC A;  1BF4 A;  4RAU C;  1G2T A;  2L12 A;  1LV9 A;  1G6Z A;  1PFN A;  2D9U A;  4HCS A;  4X3S A;  1ICW A;  2VXW A;  2B2Y C;  4ZKC B;  1NR2 A;  2B2W A;  1J8I A;  3GV6 A;  2KOL A;  2X69 A;  3H91 A;  2FIN B;  2IL8 A;  1AZQ A;  1G91 A;  2K01 A;  4R8I A;  3I3C A;  1ROD A;  5COY A;  2K28 A;  2KUM A;  2K05 A;  1WTO A;  1JE4 A;  4IUU A;  1A15 A;  2L11 A;  2EE1 A;  1HUM A;  1RTN A;  1SDF A;  2CVR A;  1HA6 A;  1U4L A;  2XIW A;  3DEO A;  3FPU B;  5AFW A;  2KVM A;  5E4W C;  4ZKB B;  1WTW A;  4X3T A;  4O42 A;  1DOL A;  4XT3 B;  1ZXT A;  1GUW A;  2FFK B;  4RWS C;  2B2T C;  2L1B A;  4HED A;  3QO2 A;  1WTQ A;  1BNZ A;  4DN4 M;  3MWY W;  1B2T A;  2X6L A;  3IFD A;  1B50 A;  2NYZ D;  4OIJ A;  1O7Z A;  1SSO A;  1U4R A;  4IUQ A;  2RSO A;  5CBE E;  1Q3L A;  2L4N A;  3D6W A;  2DY7 A;  1C8C A;  1EIH A;  1B3A A;  1MSH A;  2BDN A;  1PFM A;  3KUP A;  4NW2 A;  1AP0 A;  2K03 A;  4XDX A;  5COR A;  2KEC A;  4HSV A;  4ZAI A;  1IKM A;  2NWG A;  4HAE A;  1WD1 A;  1ILP A;  1QG7 A;  2L9H A;  4QUF A;  1JIC A;  5D14 A;  1RJT A;  2J7Z A;  3DEP A;  2H1E A;  5T1G A;  4CJ2 C;  4ZK9 B;  3DM1 A;  3Q6S A;  1KNA A;  5DNF A;  5EJW A;  1XYI A;  2B2Y A;  2B2V C;  1PDQ A;  4IUV A;  2MGS A;  1F2L A;  1BBX C;  2JP1 A;  1EIG A;  2KEE A;  3LWE A;  4XT1 B;  4QUC A;  1HFG A;  1WTV A;  1F9S A;  1RHP A;  1MGS A;  1WTX A;  1WTR A;  1O7Y A;  5EQ0 A;  3KBX A;  2RVL A;  5E4X A;  2RSN A;  3F2U A;  3GV3 A;  1DZ1 A;  3P7J A;  4U68 A;  5JJZ A;  1EOT A;  1U4M A;  1HFN A;  3TZD A;  5EPK A;  1MI2 A;  2MJ8 A;  3I91 A;  2RA4 A;  2EPB A;  1DOK A;  1ESR A;  2B2T A;  3ONA B;  2MPM A;  1U4P A;  2B2U C;  1J9O A;  1F9R A;  3HP3 A;  1MSG A;  2HUG A;  2K1B A;  2N55 A;  2KED A;  3TN2 A;  1IKL A;  3N52 A;  4IUT A;  1KNE A;  1ILQ A;  2M2L A;  1DOM A;  2Q8T A;  1WTP A;  1X32 A;  1CM9 A;  2FMM A;  1G2S A;  2B2W C;  2NZ1 D;  1TVX A;  2X6G A;  1XX8 A;  2HCI A;  1ML0 D;  1PFB A;  2EOT A;  4IUR A;  4MN3 A;  4X3K A;  5EPJ A;  4CJ0 B;  1DON A;  4LMQ D;  1F9Q A;  1O80 A;  2JYO A;  2HCC A;  4R9W A;  4IUP A;  5T1I A;  1HHV A;  2MP1 A;  3MTS A;  4MHE A;  5CBA E;  1WVL A;  1QNK A;  2B2V A;  3I8Z A;  3FDT A;  4OIK A;  2HDL A;  1SAP A;  1HUN A;  1M8A A;  1F9P A;  1S4Z A;  1RTO A;  4X3U A;  4CJ1 B;  2R3Z A;  3G7L A;  2N88 A;  4UAI A;  1CA6 A;  2HDM A;  1B53 A;  3UI2 A;  1WD0 A;  1X3Q A;  1B4O A;  5CMD A;  1PLF A;  5D65 A;  5EPL A;  2DY8 A;  1IL8 A;  1NCV A;  4RA8 A;  2K04 A;  1EQT A;  3SVM A;  1AZP A;  1HRJ A;  1E0B A;  1CA5 A;  2FJ2 A;  5EKI A;  4ZLT F;  1EL0 A;  1NR4 A; 
#chains in the Genus database with same CATH topology
 3A54 A;  3FP9 A;  5EKL A;  2UUC L;  4M8A A;  3CC2 A;  2AHO B;  1GHJ A;  4G7Z C;  5DM6 3;  5C3X A;  2CHB D;  3SXH A;  2DN8 A;  4Y52 H;  1SMY D;  2D9U A;  2ID0 A;  2QDL A;  1XTC D;  4A3B G;  3ERQ A;  1J5E Q;  2A8V A;  2K01 A;  1HZ9 A;  4BY7 G;  1II3 A;  1CHQ D;  3T13 A;  2C9O A;  2YTV A;  1HUM A;  4POG A;  1SYG A;  3CCL A;  1KLG D;  2WAC A;  2V1C C;  3NWT A;  4JBJ A;  4DFA A;  3GP7 A;  4A3K G;  3QO2 A;  2X6L A;  5GAG C;  1HA5 A;  1I6V C;  2RSO A;  2PZW A;  3S1Q H;  2LFN A;  3JAM L;  4JI2 Q;  3NQT A;  2D2C C;  2VS1 A;  4R4O A;  3KYH C;  4R4C A;  2GN5 A;  1D5M C;  4DR1 Q;  1I4H A;  4QUF A;  4A93 B;  4GOP A;  2K5N A;  3RLO A;  5M5X H;  4F87 A;  1ENA A;  1EUJ A;  2B2Y A;  2WP8 J;  5EGT A;  1U9R A;  4DK0 A;  4F7X A;  1G8Z D;  2M9V A;  1WTX A;  4DGZ A;  1YZ6 A;  2IHE A;  1WTR A;  1XMQ Q;  3I4N H;  2PNH A;  5AJ3 L;  3HGB A;  2SNM A;  1SRU A;  2JA6 G;  4KY6 A;  5EPK A;  5M5W B;  1M90 C;  2ES2 A;  4HIM A;  2F1M A;  1J9O A;  1I94 Q;  3FKI B;  1IKL A;  3H3V I;  4DR4 Q;  1XNR Q;  3AU7 A;  1G2S A;  1PXU A;  2EYL A;  2CKZ B;  2CFM A;  4K5X A;  1VQF A;  3QOJ A;  4RGO S;  4I7Z C;  2R7F A;  4X3K A;  1VQL A;  2LY7 A;  3OOC A;  1B9M A;  4R9W A;  3NTI A;  1I5F A;  1HZB A;  2A1A A;  2RBM A;  1TII D;  1I3Q H;  5CBA E;  1JC7 A;  3CCU A;  3S2D H;  4KHP L;  1PH2 A;  3CCV A;  5KYL A;  4X65 L;  3I4O A;  5IT9 E;  5EBD A;  3J80 E;  1VQI A;  1UE6 A;  2ATW A;  5IWA L;  4H13 C;  3S2H B;  2A74 C;  4A3F B;  2EY2 A;  4EVO A;  4DV3 Q;  2D5D A;  2FHT A;  3TSS A;  2SDF A;  1SLJ A;  4GKK L;  3RZO H;  2B63 B;  2AWN A;  3U58 A;  1AE3 A;  1Y1V H;  1X55 A;  3FVQ A;  4JG2 A;  4N9P A;  2YU9 H;  1B9N A;  3MXG A;  4R4Q A;  1BUV T;  3RD4 A;  1G91 A;  4OL7 A;  5M3M G;  1TWC B;  2EIF A;  1N32 L;  1OXX K;  4K2L A;  3TRZ A;  5M3F H;  4GNX B;  1RF2 D;  3E0J A;  1O7I A;  1JMC A;  3S1R B;  1BXT A;  1A15 A;  3NEL A;  1JJC B;  4XYO A;  1DOL A;  4JI3 Q;  3S14 H;  4HN7 A;  5CYU A;  1IBK L;  3NP8 A;  2NYZ D;  4OIJ A;  3URY A;  2JA8 G;  5LL6 X;  1QUQ A;  2D0P A;  4I65 A;  4LK1 C;  4JI4 L;  1T5X D;  3MHB A;  2EYM A;  3PO3 G;  3FHW A;  2RDF A;  4NPS A;  1LYL A;  3PCO B;  2XSC A;  2LMC B;  5D14 A;  4UY8 C;  2KQ3 A;  1STA A;  2AKW B;  1TY2 A;  1SNC A;  2OF1 A;  4QY7 A;  3H94 A;  5FLM G;  2DJG C;  4C3J B;  1KAB A;  1OXU A;  2E74 C;  4A3K H;  3ULP A;  4R4I A;  1NNX A;  1FGU A;  1QOH A;  4B3R L;  4GZY C;  2F0O A;  1TWF H;  1GO3 E;  2NBF A;  3TQY A;  2D0O A;  1H9K A;  1K3B C;  4IJH A;  3NWS A;  2B2U C;  3TN2 A;  1EOV A;  3N52 A;  1KNE A;  2JXM B;  2A6H C;  2Z4H A;  3HOY H;  1TVX A;  1SNQ A;  4AYB G;  5LMN L;  3ERO A;  1KRT A;  1BCP F;  2AMC B;  3BYY B;  5IP7 G;  1PYS B;  2DJF C;  1RKN A;  3EJI A;  5KRU A;  2MP1 A;  3KF8 A;  3HOX G;  1D6E C;  2JA6 H;  3CPW A;  2NVY B;  4QQB X;  1YEZ A;  4JW0 A;  1F9P A;  3VA5 A;  4X3U A;  2F3V A;  4JBW A;  3NEM A;  1FNU A;  4ME5 A;  4X66 Q;  2XN9 C;  3RR5 A;  1STY A;  1E0B A;  1HNW L;  4LFA L;  2FJ2 A;  2JP1 A;  1XMO L;  1UEB A;  2ZJQ A;  2VQF Q;  2QA4 A;  3K81 C;  4KY5 A;  1EEI D;  1KTK A;  3IL8 A;  3KJP A;  1J6Q A;  1G2T A;  4L5Q A;  1X56 A;  2L12 A;  2R92 B;  2EXD A;  4CKE A;  4EQ5 A;  1LTA D;  4LFB Q;  3HZX A;  3AFQ A;  3KDF B;  5JPM C;  1K0S A;  4AQY L;  2KEN A;  2LXJ A;  4LF7 L;  3P75 A;  4DXG A;  1WTO A;  1A0I A;  4IUU A;  4OXP A;  4HIK A;  1UWV A;  1X3E A;  1AEX A;  3VYU A;  4O1N A;  4M1U B;  2ZTE A;  1BNZ A;  4DN4 M;  4QL5 A;  3OMC A;  1BCP D;  2WAQ G;  2YYZ A;  1Q3L A;  3MXN B;  1MSH A;  3ZJY C;  5M3M H;  3I4M H;  1W6J A;  1E24 A;  4A3J G;  5JVH 3;  2DGY A;  3J81 i;  3PGZ A;  2MHV A;  2VNU D;  4HJA A;  2A19 A;  4IO9 A;  4FXG C;  4UP8 A;  1B44 D;  1T9H A;  1UE5 A;  1N9W A;  4C3I B;  1VQJ A;  5IGC A;  1HFG A;  4B3M Q;  1WTV A;  5CV5 A;  4IFD J;  2RVL A;  5IGD A;  2JA8 H;  3J7A V;  3GV3 A;  4A3G G;  5ELF A;  4JBK A;  1G51 A;  1KLU D;  4KMU C;  1EOT A;  3CU7 A;  3D4W A;  1JB3 A;  5KND A;  4LWC A;  2EPB A;  3H09 A;  5HUR A;  2XRQ D;  3PO3 H;  4F88 A;  3HOW G;  1C0A A;  1F2M A;  1LM0 A;  2KED A;  5CV7 A;  1JOK A;  3CME A;  4IUT A;  3K7U C;  1SYB A;  2O2L D;  1VQN A;  3LX0 A;  1I3Q B;  3S15 H;  2R6G A;  4J8Q A;  1DON A;  1XPR A;  4GNX C;  2RHS B;  1IYV A;  4OEM B;  1A63 A;  1TR5 A;  3DWA A;  2QGQ A;  1VCI A;  4DV7 L;  1S5B D;  4KTA A;  4XIG S;  5J39 A;  2ZXP A;  4PG3 A;  4UAI A;  1CKN A;  1QVG A;  4XQQ A;  3PO2 G;  1A6X A;  5ELB A;  4DK6 C;  4C1N K;  2NZO A;  5BR8 Q;  5IYC G;  4IFD G;  3M3Y B;  4HJ9 A;  5IGG A;  1Y1V B;  2F0P A;  2YU9 B;  3SDZ A;  4K0K Q;  1ONL A;  1PYB A;  4UHV A;  1N36 Q;  1R4P B;  1Q12 A;  3M4Q A;  3SHL A;  2R7Z H;  2UXD L;  5M3F B;  3D8G A;  2B2W A;  3GV6 A;  3GD7 A;  5C4H A;  1PH7 A;  5FO7 B;  2F0V A;  2FXQ A;  3VDY A;  3J7Z C;  5COY A;  1EYA A;  1VQK A;  2DNC A;  1K8O A;  2KCN A;  4DV6 L;  3S14 B;  4OHJ A;  4HID A;  2IY5 B;  3KOJ A;  1HA6 A;  2P5Z X;  3DEO A;  4WOR A;  1PTO F;  4O42 A;  1HZA A;  1ZXT A;  4H0L C;  1ASZ A;  1SYC A;  2EJF C;  2JE6 I;  2ZXR A;  1C9O A;  4O2D A;  2AQ3 B;  4YHH Q;  3NXW A;  3FPP A;  2L4N A;  2PZT A;  1Y14 B;  2B63 G;  3IRB A;  2KEC A;  1N34 Q;  2JA7 G;  3D4R A;  1E3P A;  5GAD C;  1SE8 A;  2RF4 A;  2QF7 A;  1QWY A;  2CH4 W;  4UP7 A;  2E2J H;  5LMU L;  1YNN C;  4FYD A;  1EYG A;  5C3W A;  4IFD I;  3BJU A;  4J6H A;  4AH6 A;  4A3I G;  2EYP A;  2AUJ D;  5JVG 3;  5NUC A;  2A6E D;  1TWF B;  4XYQ A;  1LTL A;  4DXF A;  1PRT D;  1DGS A;  2BDO A;  3QG1 A;  5L37 A;  2UUA L;  3I73 A;  2HHH L;  2IHF A;  3A0J A;  1B70 B;  3J7A F;  2WB1 E;  4RKB A;  4ZQ3 A;  1H9M A;  1IW7 C;  3D0F A;  4WJ4 A;  2RA4 A;  3D4D A;  5IT9 c;  3MVV A;  2N78 A;  3J80 c;  1L1O B;  1MJC A;  3NBH B;  1HH2 P;  4GKJ L;  1UUP A;  2M2L A;  4DR5 L;  2I46 A;  1LTG D;  1X32 A;  2F03 A;  4JOI C;  3VR6 A;  3AEV A;  1EY9 A;  1GVP A;  4XTC S;  4NXN L;  1I4X A;  4KLK A;  4MN3 A;  1DYQ A;  1O7L A;  4C3J G;  5JPN C;  2L15 A;  2BOS A;  4C3H B;  4MHE A;  2ZM6 L;  1UE1 A;  4YY3 Q;  1STN A;  3V2T A;  1TXY A;  1LAC A;  1EIF A;  3J81 L;  4LF4 L;  3G7L A;  2NVT B;  4OWX B;  1STE A;  4ID6 A;  1PLF A;  2RCF A;  5D65 A;  3S1M H;  3CF5 A;  4RA8 A;  1B1Z A;  3CRK C;  3GTG H;  2AQ2 B;  3E6Z X;  2YTY A;  3QB3 A;  3R93 A;  2Z1C A;  2F0H A;  1VMP A;  1HTP A;  2E2I B;  5CGK A;  1X3F A;  3EN2 A;  4APV A;  4OO1 H;  1IXR A;  2VXW A;  1EQV A;  2JN4 A;  1WFQ A;  4P75 A;  3JAM i;  3TS0 A;  4OX9 L;  2VB2 X;  3I3C A;  2ICE C;  3I2Z A;  3PV0 A;  4FVM A;  3LNN A;  2FMC A;  1UEA B;  2XIW A;  1N33 L;  4X62 L;  1SN8 A;  3CRL C;  3K6O A;  4X3T A;  1FVI A;  1GUW A;  2XGT A;  1EU4 A;  2L1B A;  2N3S A;  3A7A B;  3HFZ B;  2CWP A;  4JI7 L;  4KK7 A;  4LFC L;  3OW2 A;  4K5V A;  2Y0S G;  3K5N A;  2F0W A;  4XDX A;  2A5H A;  3GTP H;  4XXE A;  3MXP A;  2R93 B;  3OSO A;  2HD3 A;  2L9H A;  4PMC A;  4GOP B;  2HT1 A;  2IW3 A;  2H1E A;  2F0Q A;  3DM1 A;  3PF5 A;  4RCO A;  4JI0 Q;  3X3M A;  1S5F D;  1PDQ A;  1I4G A;  3OHX C;  4RGN A;  4LUV A;  1F2Y A;  4DR3 Q;  3BDL A;  1SNP A;  1TWA H;  1MGS A;  2EJM A;  4PMB A;  3SK6 A;  3S1N H;  2KCT A;  1FJG Q;  4MNO A;  2F3W A;  3F2U A;  4DUZ L;  1YVC A;  4RGT A;  1Q7Y C;  5C4Z A;  1GM5 A;  5IE8 A;  4PQX A;  1L0X B;  3H0G H;  1HNZ L;  2OTL A;  2E5L L;  3NPP A;  5GAH C;  1CM9 A;  3STB D;  1SNO A;  1EYC A;  2X6G A;  3HOU H;  2CCZ A;  2JK8 A;  1YBY A;  2HCI A;  4FF1 A;  4C3I G;  4Y7N H;  4JV5 Q;  4P2C B;  4LF5 Q;  1LAB A;  1SXT A;  1Y1W G;  5K36 H;  2PQE A;  1LTR D;  1M8A A;  4UP9 A;  4WFN 3;  1VS0 A;  3F2D A;  1P8L A;  5C3E B;  2C35 B;  1NJI C;  1SFO H;  2F4I A;  2Z6B A;  2EYO A;  5DLQ E;  5KIX A;  3MFG A;  3P20 A;  4JI8 Q;  2DY8 A;  2NZH A;  2PQA A;  4K8J A;  4QGU A;  3GTM H;  5JOB A;  5H1S E;  4C2M H;  1WCM B;  4ZLT F;  2XTI A;  2R7Z B;  4AIM A;  2NB0 A;  2VW9 A;  2XRS D;  3PIP 3;  2DNE A;  4B9W A;  3L0O A;  1LT6 D;  1IYJ B;  1OO9 B;  4ZKC B;  5I9O A;  1I50 H;  4IPH A;  1PFS A;  1SR3 A;  4HMJ A;  1TU2 B;  1VQP A;  2NTT A;  1NBW A;  5KEE A;  2Q2H A;  3KBG A;  3OIQ A;  3CCQ A;  4DU9 A;  5M9O A;  4JYA L;  1U0L A;  2ZTC A;  3E9H A;  3HKZ G;  2KHS A;  3EVQ A;  4DUY L;  2H5X A;  5C5M A;  4YCW A;  4IQZ A;  1L1O C;  1V1P A;  4K6D A;  1R9T H;  1B3Q A;  3PUW A;  1B50 A;  1O7Z A;  1QUQ B;  5M5Y H;  3S16 B;  1C8C A;  1R4Q B;  3KUP A;  4HMI A;  5C6A A;  1VQC A;  3C2P A;  3SK4 A;  4FXK C;  2K03 A;  2IX1 A;  2E2J B;  1K73 C;  1TWH B;  1CZW A;  3GTL B;  3S17 H;  2CW0 D;  1K8G A;  4H7B A;  4DR7 Q;  1JOR A;  5FJ8 G;  1XMQ L;  3Q6S A;  2KBN A;  1HTL D;  5DAU A;  2NVX H;  2EVB A;  4FNF A;  3BVG A;  1QVC A;  4BBR G;  4N9T A;  3PUX A;  1CQF A;  1ZYR D;  4HJ5 A;  1MD2 D;  4JI6 Q;  3W3A A;  2R61 A;  5LHY 1;  2OTJ A;  3A5Z B;  5JJZ A;  1U4M A;  2CWA A;  4LUZ A;  2PPB C;  1OTC A;  4H02 A;  1QIL A;  2I5L X;  4JI5 L;  5HY6 A;  2B2T A;  1PZI D;  4LF6 Q;  2R7D A;  5FLX L;  1W3S A;  3UDF A;  1EY7 A;  2DUD A;  3KK7 A;  3OTO Q;  4P72 A;  2UU9 L;  1PFB A;  5EPJ A;  3TP6 A;  3J81 E;  2OWO A;  5A2Q L;  1Q46 A;  5BN5 A;  3GTO B;  3R8B A;  2KHJ A;  1SJH D;  4BY1 H;  3GTQ H;  1GHK A;  4WRD A;  4A3M H;  1KRS A;  3KF8 B;  1QNK A;  2B2V A;  4A3E B;  4A76 A;  2UUC Q;  4GLV B;  3D31 A;  3HG9 A;  4LW1 A;  3UI2 A;  2PCF B;  2C5C A;  1WD0 A;  5CMD A;  4TKO B;  1A3V A;  4U67 3;  4LUO A;  3HRZ C;  2LKV A;  3Q22 A;  4DR6 L;  1IBM Q;  4JI1 L;  4BXX H;  2VY3 A;  3T4A C;  2UXB L;  5ELN A;  2VUM B;  1EU3 A;  4OWW B;  1TKW B;  4GOP C;  1Y8O B;  1WI5 A;  1HZC A;  1PFN A;  2B39 A;  2B2Y C;  5ELO A;  1IHZ A;  1AZQ A;  1ET9 A;  2PZU A;  3D6C A;  3PQI A;  3BDC A;  4C3H G;  2OT2 A;  5E3F A;  4FF3 A;  2PYK A;  1LT4 D;  2BE5 D;  5CC4 A;  3VYS A;  3PIP A;  1SDF A;  1MIU A;  1JQY D;  2A68 C;  2NUC A;  2F0L A;  4WJ3 M;  1VQ4 A;  5HGQ A;  1UAP A;  1B2T A;  3D3R A;  2OCE A;  1UE7 A;  3O13 A;  1Q86 C;  3HOV G;  3G71 A;  2K52 A;  3TBI B;  3M85 A;  2DY7 A;  5D3D A;  3RZD H;  1Y8P B;  1PA6 A;  3NHH A;  3MFY A;  4HSV A;  4PZ7 A;  1K83 H;  1WD1 A;  1HXY D;  4GS3 A;  5AJ3 Q;  2JA5 H;  1S5C D;  5TSS A;  4NXM L;  2EXZ A;  5EJW A;  2JA9 A;  4AYB E;  3HOZ B;  1TWA B;  1SYF A;  4B3S L;  1BVS A;  2UUB Q;  3S1N B;  3KF6 A;  4A3D H;  1LUZ A;  4ZCK A;  1TT2 A;  4XT1 B;  1PH6 A;  4KD4 A;  4NP5 A;  2F4V L;  1ENF A;  5E4X A;  3CP0 A;  4A3B H;  2XVS A;  1DOK A;  1SJE D;  2RCN A;  5IGB A;  4DV5 L;  4BY7 H;  5FJ8 H;  3HOU B;  1YJW A;  1X54 A;  3Q23 A;  3H3V H;  2R93 G;  3PUV A;  4RG1 A;  3RN2 A;  2Z4I A;  5C4J B;  1RCV D;  4X65 Q;  4I7A A;  4DAV A;  5C5L A;  5FK9 C;  4CJ0 B;  5IYB G;  5T1I A;  1D1K A;  4LF8 L;  5IWA Q;  2K50 A;  3R3O A;  3GDE A;  1GUT A;  3I8Z A;  4GKK Q;  1SAP A;  2CQO A;  2OQ0 A;  5BN3 A;  4CJ1 B;  4B3T L;  1CKN B;  5I6Y A;  4DV2 L;  3NTK A;  4K2K A;  1X3Q A;  1CSQ A;  3BYT B;  5FKA C;  1SMY C;  3E3X A;  1STG A;  3A8J E;  1JT8 A;  1N32 Q;  3VR5 A;  3I72 A;  3K58 A;  3P1H A;  1YHQ A;  2WAQ E;  4DAY A;  2CW0 C;  1BF4 A;  1QCB D;  4RHS A;  1X3G A;  4DK1 A;  4X3S A;  1ICW A;  4V0B A;  4YWM A;  4LJZ C;  4BBS B;  3H91 A;  2QKI C;  1VQG A;  1PTO H;  3QJY A;  1YNJ D;  1IBK Q;  1ROD A;  4IZ8 A;  2WKC A;  3CQZ B;  2F0S A;  4ME3 A;  2K5Q A;  5CV6 A;  3CCJ A;  2LSS A;  1KL9 A;  4JI4 Q;  2JQO A;  4HJ8 A;  3LWU A;  5CV9 A;  2A69 D;  1D1I A;  5C0X J;  2EY5 A;  5C4X G;  1CFM A;  1DJR D;  2WB1 B;  2A73 B;  2XNA C;  1U4R A;  4IUQ A;  2PI2 A;  1Z7T A;  5C44 G;  4CDF C;  5COR A;  2ALY B;  4ZAI A;  1IKM A;  4Q0F A;  1M1K C;  4HAE A;  1YNX A;  2QIL A;  4B3M L;  4B3R Q;  5CV4 A;  1RJT A;  2QEJ C;  4DV0 L;  4YWK A;  3VA7 A;  3A74 A;  3V05 A;  1GUS A;  2F52 A;  2EYH A;  2K5D A;  3KFU A;  2ZTD A;  3F2C A;  2AWO A;  1VF7 A;  3LWE A;  3JAM E;  1K9M C;  2ENB A;  3S1Q B;  4DV1 Q;  1K0R A;  1TS4 A;  2E75 C;  3HOV H;  1BCP B;  4EQN A;  3P7J A;  4LNQ A;  5LMN Q;  2MJ8 A;  2XWB B;  5M5X B;  3SK5 A;  4DAP A;  1GD7 A;  2KA7 A;  3TP5 A;  5A2Q E;  3X3N A;  5C0X G;  2I0Q A;  1NMF A;  4BWG B;  4CHT B;  2F0F A;  3GTQ B;  3I4N B;  3OPO A;  4A3M B;  2GA4 B;  3K80 C;  4DR2 L;  4IUP A;  2BE5 C;  1HNW Q;  4LFA Q;  1XMO Q;  3BVM A;  1PVO A;  1RTO A;  4CGY B;  2NVQ H;  1STH A;  4GNX A;  1JWU D;  2HIV A;  1A3T A;  1K28 A;  2OEO A;  1NCV A;  3OWE B;  4QIW E;  5F2D A;  4A93 G;  2F0J A;  5ISR A;  1X3P A;  3SEB A;  5FLM H;  1X6O A;  3HKS A;  4AQY Q;  5IYB H;  1ENC A;  4E6I A;  4LF7 Q;  3NK9 A;  3I90 A;  2LXK A;  1S5E D;  3S2D B;  1G6Z A;  2K4K A;  1PMR A;  5FOB B;  3VR2 A;  1VQ8 A;  4YCU A;  2O4X A;  3K8A A;  3TRE A;  1B8A A;  5I4D A;  2PW5 A;  2K28 A;  1FNV A;  3K57 A;  5C0X I;  4DV4 Q;  4POF A;  1N8R C;  1NSN S;  2CVR A;  3J7Y W;  3FKI G;  3RZO B;  1WTW A;  4C56 C;  4MTK A;  1JWM D;  3Q0A A;  2M00 A;  2WKD A;  3A56 A;  5IP7 H;  4HIO A;  2EYF A;  3W2D A;  3D6W A;  2JA5 B;  4NW2 A;  3HOX H;  3EA6 A;  4YWL A;  1GOZ A;  4A3D B;  1GUG A;  1SE3 A;  2G5D A;  4IUV A;  3J81 c;  2MGS A;  1CSP A;  1XTD A;  5C4X H;  4CKC A;  3PIO 3;  4A3F G;  2IWH A;  4A3B B;  4K8I A;  1TWG H;  2YTX A;  3VYT A;  3DHQ A;  4FO2 A;  5C44 H;  4BY7 B;  1HR0 Q;  5GQO A;  3AB9 A;  1A8V A;  1O78 A;  1VQA A;  1L0Y B;  5IYD G;  4DV7 Q;  3ERS X;  5ELE A;  1E22 A;  4A3K B;  1JJ2 A;  1QNU A;  2B2W C;  1VQ7 A;  1HNX L;  1PRT B;  4JC0 A;  4TQU S;  1Q81 C;  2NN6 G;  3RNU A;  3K5L A;  1HR0 W;  1PZK D;  1LLR D;  4CKB A;  3QWN A;  4A3J H;  3EBE A;  2A69 C;  1IBL L;  4HJ7 A;  3HOY B;  4PZ6 A;  1EYD A;  1VQO A;  2UXD Q;  2PQA B;  5C0X H;  4IOC A;  3SVM A;  3BS1 A;  1CI3 M;  2OXP A;  5KGU A;  2RDG A;  3OW7 A;  3T1H L;  4DV6 Q;  1PTO D;  1PTO B;  2JA6 B;  4KN4 C;  2ICI A;  2Y0S E;  3L9A X;  3ZYY X;  1LV9 A;  2L0C A;  3MXN A;  4A3G H;  3KLS X;  3HOW H;  3AQQ A;  3R2I A;  1JE4 A;  1PH9 A;  1BCP C;  4OWT B;  3U4Z A;  2KJX A;  4A93 H;  4PMW A;  3GQB A;  1V1P B;  3TS2 A;  2NN6 I;  4ZUI A;  1XJV A;  1EZ8 A;  2QW7 A;  2QEX A;  3CCS A;  5J1Z A;  1DCZ A;  1L0W A;  4MIU A;  2UUA Q;  1EY0 A;  4ZK9 B;  5I6W A;  3PO2 H;  1FJG L;  4HSP A;  5DNF A;  1SNM A;  1RD9 D;  5IYC H;  4IFD H;  3W5O A;  1IZ6 A;  3CCR A;  4RFB A;  1YIT A;  5M3M B;  3I4M B;  4DR5 Q;  3KBX A;  4BA2 I;  1E1O A;  1NTG A;  1CK1 A;  4U68 A;  4X6A H;  4L6T B;  4NXN Q;  1YI2 A;  2R92 G;  3UE1 A;  2MPM A;  3C1E A;  4A3C G;  4JCV E;  3BU2 A;  2MO0 A;  4KY7 A;  2HUG A;  5GRO A;  3PIO A;  2ZM6 Q;  1XNQ Q;  1ILQ A;  4K6L A;  1C48 A;  3NE5 B;  1FR3 A;  3T51 B;  2PMZ E;  4LF4 Q;  2WIN B;  5JEA J;  2JA8 B;  1D5Z C;  4K14 A;  3E0E A;  1QZH A;  4IUR A;  3S2H H;  4DNI A;  1O80 A;  4LF9 Q;  3MTS A;  1M4V A;  1SEB D;  2IJ0 A;  3J7A 5;  4JI8 L;  2Q2I A;  2VQE L;  3PO3 B;  3FDT A;  2HDL A;  4IAL A;  2B63 H;  3ND8 A;  1F77 A;  2JA7 H;  1RL2 A;  3A8I E;  3HKZ E;  2F0D A;  1TWC H;  1B4O A;  3MXU A;  3S15 B;  1AZP A;  4OX9 Q;  4A3I H;  3NQI A;  2G9D A;  3S1R H;  4KV6 A;  4R1J A;  4RMF A;  3G48 A;  3VR3 A;  5D3I B;  5EKK A;  2Z6K A;  2ZXO A;  3I4N G;  4RAU C;  1VQB A;  1ZKO A;  4HCS A;  5DM7 3;  1KDB A;  1NE3 A;  5I2X A;  4N8X 1;  2QDB A;  2X69 A;  1EWI A;  4JI7 Q;  5GAE C;  4LFC Q;  1YIJ A;  1BR9 A;  5JEA G;  1CQV A;  4OON A;  3DWQ A;  2L11 A;  1GJX A;  3JAM c;  4X64 Q;  1U4L A;  4ZKB B;  3A8K E;  1D8L A;  3H6M A;  1J5E L;  4KJO A;  3HOX B;  1E2W A;  2L55 A;  3SR1 A;  5IOC A;  4C3J H;  3ND9 A;  1SSO A;  4NB3 A;  1E7Z A;  4P73 A;  1MBY A;  1RDP D;  1EEF D;  3HS0 C;  2A6E C;  3DUZ A;  1JIC A;  1PRT C;  3MEH A;  4IN3 A;  3CC7 A;  1VDZ A;  3RMH A;  4NMZ A;  1XYI A;  3QIA A;  2Q8I B;  3TP7 A;  1PV4 A;  4DF7 A;  1TWG B;  4JI2 L;  4QUC A;  1EY6 A;  3UDX A;  3SE0 A;  2E5L Q;  4ZRZ A;  1K8M A;  1O7Y A;  5J22 A;  4DR1 L;  1Y1V G;  4EGV A;  2CQA A;  3T1Y Q;  4L5S A;  3OTO L;  3I91 A;  5M3F G;  1H9R A;  1ET6 A;  3CD6 A;  2NVY H;  2ZJP A;  1PTO C;  2JSO A;  1HPC A;  1DOM A;  4QF4 A;  2Q8T A;  2B3G A;  2I5H A;  3K7A H;  1I6H H;  2WAQ B;  2EOT A;  2UXC Q;  1AE2 A;  1LTI D;  2LS0 1;  4DA2 A;  4A3J B;  2A6H D;  1I94 L;  1S40 A;  3I70 A;  3C46 A;  3RUZ A;  5IY0 A;  4DR4 L;  1XNR L;  4V19 0;  4O0A A;  2K7V A;  1IBM L;  3UE0 A;  2R92 H;  1MJE A;  4A3C H;  1VQ5 A;  3SGI A;  2K32 A;  3A7L A;  4G57 A;  2EY1 A;  4BS9 A;  3I56 A;  4G4K A;  3GTK H;  5JJI A;  3T16 A;  4CDC C;  1NR4 A;  1A3U A;  4A3G B;  1KXL A;  4JYA Q;  1SYE A;  4DAY B;  4DPG A;  1JOO A;  1EIY B;  3TDQ A;  3HOW B;  5ELD A;  2XWJ B;  4DUY Q;  2KOL A;  2FIN B;  3S1M B;  4P74 A;  1PHJ A;  4DV3 L;  2K33 A;  2SEB D;  1A2U A;  1KD1 C;  3GTG B;  2ASB A;  4JPB W;  4EQP A;  2E2H H;  3HOY G;  1YJN A;  4YCV A;  3CHB D;  3FPU B;  4FP5 D;  1I4R A;  1FNW A;  2B2T C;  3NUC A;  4L5T A;  1CUK A;  4C3I H;  3OWF A;  1S3O A;  1EFW A;  1C4Q A;  1CT1 D;  5CBE E;  1ZEQ X;  3B6Y A;  4OGQ C;  3CPF A;  4RHR A;  3EFX D;  1Y1W H;  5IGE A;  1QZG A;  3IFT A;  2UUB L;  3PO2 B;  1AP0 A;  1WYD A;  2L5T A;  1TS5 A;  1QG7 A;  1YJ9 A;  1XPO A;  4JI3 L;  1E1T A;  5JEA H;  5T1G A;  1KNA A;  4CDE C;  1Z47 A;  2B2V C;  1F2Z A;  1VF5 C;  1PH1 A;  4JI5 Q;  1PH4 A;  3GTJ H;  4ULL A;  1F2L A;  3NBI A;  4B08 A;  4BA1 I;  1EY4 A;  4CBV A;  1TQO A;  4RGM A;  3L2P A;  3MZ5 A;  1SE4 A;  3BZK A;  1Q1E A;  3GTP B;  1H9S A;  1DXM A;  3U9O A;  3G6J B;  1HFN A;  5FO9 B;  3TZD A;  2UU9 Q;  2JJQ A;  5EBC A;  1V9P A;  3STB C;  4EX5 A;  1ESF A;  3C3L A;  2MO1 A;  1F9R A;  1PH5 A;  1MSG A;  1KAA A;  2N55 A;  1TY0 A;  3L7Z C;  2F0G A;  3TZU A;  2Q2T A;  2RKS A;  1JJG A;  4QIW B;  3FRP B;  1VQE A;  2GVA A;  4XQJ A;  4A3L G;  4JK1 C;  2KCC A;  3AFP A;  1ML0 D;  2F0N A;  1S72 A;  1QB5 D;  1F9Q A;  1HHV A;  2EY6 A;  2HCC A;  3M3Y H;  2QCP X;  2JA7 B;  2K75 A;  1AFP A;  3H0G B;  4DR6 Q;  3MEF A;  1CKM A;  1GKH A;  3F2B A;  4JI1 Q;  2AUK A;  3I4M G;  2UXB Q;  1S4Z A;  4FDB A;  1NMG A;  2R3Z A;  4ZUJ A;  3GO5 A;  3T53 B;  3WOF A;  1LT3 D;  4A3I B;  2Z0S A;  2HQE A;  1CHP D;  2K04 A;  1HRJ A;  4Y7N B;  4KHP Q;  4PNY A;  3BDO A;  4BBR H;  1NAP A;  5G3L F;  2B2U A;  1FD7 D;  2BA1 A;  2BH8 A;  1VMC A;  3H15 A;  4KKU A;  2G9H D;  1H9J A;  1EQQ A;  1AW7 A;  4H44 C;  5K5P A;  4X66 L;  1WTH A;  1SFO B;  3IKJ A;  2E76 C;  2VL6 A;  3BZD B;  2RDH A;  1E2V A;  2SOB A;  3GTM B;  1DM0 B;  3KJO A;  3PUZ A;  2VQF L;  2KUM A;  4PV1 C;  4C2M B;  3VR4 A;  4OEL B;  1X9N A;  3ULL A;  5E4W C;  2I5M X;  4LFB L;  3PUY A;  1A62 A;  1VQ9 A;  2IX0 A;  3ER0 A;  2V4D A;  1WTQ A;  4NXM Q;  1I50 B;  4B3S Q;  5CR3 A;  3WDN A;  3RN5 A;  1LTT D;  1EIH A;  1B3A A;  3NTH A;  2IT1 A;  2OQK A;  2F4V Q;  5A35 A;  4CJ2 C;  2J7Z A;  1ZYR C;  3G6E A;  4GN3 B;  4DV1 L;  5KYI A;  3UDG A;  2RHQ B;  5C3E G;  4JBM A;  3MC0 B;  2WV6 D;  1VQH A;  1R9T B;  1BDO A;  2F0T A;  2KEE A;  4DV5 Q;  4WJW A;  3CXC A;  5M5Y B;  1TS3 A;  4FF4 A;  4GN4 B;  1Y8N B;  1YNN D;  1L2F A;  3LGJ A;  1WCM G;  4P71 A;  5G3L D;  1PZJ D;  2R7Z G;  4HTH A;  4IPD A;  2F0I A;  3S17 B;  2EJG C;  3V96 A;  2KHI A;  3A55 A;  4A75 A;  4S3S A;  1Z9F A;  1H95 A;  3KLS A;  4C3H H;  4LF8 Q;  1ESR A;  1FYC A;  3K0X A;  2NVX B;  1U4P A;  3K7A B;  1I6H B;  1I4Q A;  4KHZ A;  1VQM A;  4NKL A;  4R8N A;  4DK3 C;  1WJJ A;  4KD3 A;  2NVT H;  5E1F A;  1IW7 D;  3CC4 A;  4IPG A;  2F0E A;  4B3T Q;  3L3O C;  4DV2 Q;  4DKA C;  1XX8 A;  4DNR B;  2ZJR A;  2B29 A;  2Y0S B;  4LMQ D;  4FF2 A;  1WVL A;  3BG3 A;  5FLX E;  4GLA C;  2E2I H;  2PI2 E;  4OIK A;  1HUN A;  1CA6 A;  3GTK B;  1Z6H A;  4QB4 A;  3DXJ C;  1Q1B A;  1IL8 A;  1UNS A;  3NSW A;  4QMG A;  3A5U A;  4A3L H;  2RQX A;  4RH6 A;  5J3B A;  4BY1 B;  2JEA I;  1BO0 A;  2Q8R E;  1EWC A;  1G6P A;  1LO5 D;  5LMN W;  2IX3 A;  2IPK D;  1I4P A;  4G7H C;  4DV4 L;  1NR2 A;  4UPA A;  5BR8 L;  1HCZ A;  2E2H B;  4FXD A;  3FMC A;  4ALP A;  2H4O A;  2GVB A;  1C7Y A;  4F8M A;  2K05 A;  4K0K L;  3JC6 6;  2R93 H;  1N36 L;  3I55 A;  3W1G A;  5AFW A;  3QR8 A;  1V8Q A;  4J15 A;  2FFK B;  2ZT9 C;  1Y1W B;  4DV0 Q;  5FO8 B;  2K5W A;  3Q24 A;  1BBU A;  3CCE A;  1HQM C;  5ELC A;  5JJK A;  2F0K A;  4YIJ A;  4C1N I;  1QVF A;  2NWG A;  4KKS A;  4A3E G;  3GTJ B;  1G29 1;  2PMZ B;  2F0U A;  4KJN A;  3C1F A;  4G7O C;  1EY8 A;  4YHH L;  2WII B;  5I2Y A;  2HIX A;  3PSI A;  1BBX C;  1HR0 L;  1XPU A;  2K6A A;  5IOD A;  2BA0 A;  1N34 L;  3ICE A;  3RZD B;  2EZV A;  3TME A;  1IL2 A;  4R4T A;  3J80 i;  4IPC A;  3I4L A;  4OO1 G;  1K83 B;  2TSS A;  2E2D C;  2VUM G;  1DZ1 A;  1D7Q A;  3M4O H;  5JJL A;  3K0Y A;  3WWV A;  1BOS A;  1MI2 A;  1V43 A;  2EQS A;  3I7F A;  4Z9C B;  3ONA B;  4DR2 Q;  1VQD A;  3HKZ B;  3AMU A;  3CMA A;  1TS2 A;  2N8N A;  3G4S A;  2B8F A;  3K59 A;  1WTP A;  1CTM A;  1JR0 D;  1VQ6 A;  5C3E H;  3E5S A;  5DEH A;  1PRT F;  2FMM A;  4TSS A;  1EFI D;  3J81 j;  1SND A;  3Q8D A;  3EQL C;  4UDU C;  1IYU A;  2JYO A;  3U9S A;  1WCM H;  1SMX A;  2VB3 X;  3BZC A;  1K3R A;  2N88 A;  5HGT A;  2KCM A;  4MZ9 A;  4XQN A;  4IUN A;  3ITP A;  4A4I A;  4BBR B;  2K5H A;  4YY3 L;  1EL0 A;  1X65 A;  1CKO A;  1QE6 A;  1RIP A;  2E8G A;  1EY5 A;  3HOZ G;  5IP9 G;  1YNJ C;  2F0M A;  3K5M A;  2PO4 A;  4OO1 I;  1AN8 A;  4Q5V A;  4MTN A;  1D5X C;  2Q2U A;  4JOI A;  1J8I A;  3MAQ A;  3H0G G;  3KDF A;  3S16 H;  1NY4 A;  3EIV A;  2K14 A;  1TWH H;  1PH3 A;  3GTL H;  1V1O A;  2EE1 A;  3HOU G;  2KVM A;  2F3I A;  3RLN A;  4XT3 B;  5IIF A;  3KLW A;  2MNA A;  4HED A;  5CV8 A;  4TRD A;  3F8T A;  1A2T A;  3MWY W;  4NDX A;  4KHV A;  1ICF B;  3QOL A;  3RLF A;  2WFW A;  3T56 B;  1PFM A;  5K36 G;  2BH2 A;  3OYY A;  4ILW A;  2BCO A;  1Y69 U;  5KNC A;  4LAA A;  2MQH A;  3N6R A;  2VZA A;  4KKT A;  4GN5 A;  4DNT B;  3DLL A;  1EIG A;  3VYR A;  4B9X A;  3U4V A;  1KHI A;  1RHP A;  5LMU Q;  2RSN A;  2Z9H A;  1XNQ L;  1JE5 A;  4JI0 L;  3GTO H;  3FEW X;  1FGB D;  1EWH A;  1HNX Q;  4RKL A;  4K5W A;  4ODG A;  3BVZ A;  3NEN A;  4A3E H;  1LTS D;  3HP3 A;  1JCK B;  2HHH Q;  4DR3 L;  4BBS G;  4DAM A;  2B8G A;  1Q82 C;  3HEJ A;  4LF9 L;  3IAY A;  1QJO A;  5M5W H;  3R2T A;  4J1M A;  3CCM A;  3FKI H;  1KDC A;  1IBL Q;  3HOV B;  2EYJ A;  3CAM A;  4QJF A;  3CKI B;  4L63 B;  4GKJ Q;  1SBB B;  3CW2 C;  2VUM H;  2N49 A;  4HCE A;  2J0T D;  2WB1 G;  3T1H Q;  5IGF A;  1K8A C;  3TP8 A;  2HDM A;  3U50 C;  1B53 A;  1P16 A;  1E2Z A;  1U5K A;  2EDG A;  3OMG A;  5EPL A;  3M4P A;  3UDI A;  4QCL A;  1EQT A;  1JB7 A;  1SRO A;  3TEH B;  5E7N A;  4L8J A;  1KQS A;  4JV5 L;  4LF5 L;  2I07 B;  1GXD C;  4IOA A;  2CH4 A;  5IT9 L;  5KNB A;  3J80 L;  1OXT A;  4A3F H;  2O5I C;  3WOE A;  4GLX A;  1BBW A;  3S9W A;  2NVQ B;  3PF4 A;  2TMP A;  4IJL A;  4X64 L;  3S24 A;  2IL8 A;  1XWE A;  1JWS D;  1HQR D;  2PNR C;  4R8I A;  4N8F A;  1Q90 A;  2PW7 A;  4JVZ A;  3DWP A;  1KDA A;  5IYD H;  1RTN A;  2MFI A;  1KC8 C;  3M4Y A;  3SK8 A;  4RWS C;  5IP9 H;  3HOZ H;  1Q8I A;  1LTB D;  3IFD A;  1LT5 D;  1PYW D;  4BY1 G;  5JAV A;  2HQL A;  1BQQ T;  4HR7 B;  2NN6 H;  4A3M G;  1ASY A;  1DD2 A;  3PMF A;  2NTS A;  3K5O A;  2A68 D;  3KLR A;  2BDN A;  4X62 Q;  1N33 Q;  2K5V A;  1B7Y B;  2JEB I;  4KN7 C;  1EZ6 A;  3W1B A;  1ILP A;  1YHA A;  1OXV A;  3DEP A;  1KAW A;  4AYB B;  4ABN A;  1WOC A;  2J4X A;  3T1Y L;  1YHB A;  4BXX G;  2YV5 A;  5LL6 S;  1MKH A;  3E9I A;  3H3V C;  3M4O B;  1F9S A;  3M7N A;  1XXG A;  5FLX c;  5EQ0 A;  5C4J H;  1S5D D;  1H9S B;  4DR7 L;  2D62 A;  2Z8L A;  1BKB A;  1NUC A;  1KIX A;  1SE2 A;  1OXS C;  4PZ8 A;  2AQ1 B;  1MHW C;  3MA2 B;  2O5J C;  1L1O A;  5I9P A;  2UXC L;  2K1B A;  2Z6K C;  3NBH A;  4DUZ Q;  1GUN A;  2VQE Q;  4JI6 L;  2MUY A;  4L5R C;  1SYD A;  1W6K A;  5C4X B;  2NZ1 D;  3KF6 B;  1CZG A;  4CDD C;  1HNZ Q;  1STB A;  1V1Q A;  5C44 B;  1PH8 A;  4LF6 L;  4KI0 A;  1GUO A;  1EQR A;  3AYH B;  3M9B A;  3ULJ A;  1HJP A;  1W2B A;  3M7G A;  1T5E A;  4TVA B;  3F1Z A;  2SNS A;  2JA5 G;  3OIP A;  4BBS H;  1JOQ A;  1D2B A;  1Q8K A;  1FL0 A;  1AH9 A;  4ZYS A;  3DM3 A;  3DMU A;  4EQO A;  5BN4 A;  4A3D G;  1CA5 A;  5EAY A;  4RCN A;  5EKI A;  3CQZ H; 
#chains in the Genus database with same CATH homology
 3A54 A;  5EKL A;  4M8A A;  1GHJ A;  4G7Z C;  5DM6 3;  5C3X A;  2CHB D;  3SXH A;  2DN8 A;  1SMY D;  2D9U A;  2ID0 A;  1XTC D;  3ERQ A;  2K01 A;  1II3 A;  1CHQ D;  3T13 A;  2C9O A;  1HUM A;  1SYG A;  1KLG D;  2WAC A;  3NWT A;  4DFA A;  3GP7 A;  3QO2 A;  2X6L A;  1HA5 A;  1I6V C;  2RSO A;  2PZW A;  2LFN A;  3JAM L;  3NQT A;  2D2C C;  1D5M C;  1I4H A;  4QUF A;  4A93 B;  4F87 A;  1ENA A;  2B2Y A;  2WP8 J;  5EGT A;  1U9R A;  4DK0 A;  4F7X A;  1G8Z D;  2M9V A;  1WTX A;  4DGZ A;  1WTR A;  3HGB A;  2SNM A;  4KY6 A;  5EPK A;  5M5W B;  2F1M A;  1J9O A;  3FKI B;  1IKL A;  3AU7 A;  1G2S A;  1PXU A;  2EYL A;  4K5X A;  3QOJ A;  4RGO S;  4I7Z C;  4X3K A;  2LY7 A;  3OOC A;  1B9M A;  4R9W A;  3NTI A;  2RBM A;  1TII D;  5CBA E;  1JC7 A;  5KYL A;  5IT9 E;  5EBD A;  3J80 E;  4H13 C;  3S2H B;  2A74 C;  4A3F B;  2EY2 A;  4EVO A;  2D5D A;  2FHT A;  3TSS A;  2SDF A;  2B63 B;  2AWN A;  3FVQ A;  4N9P A;  1B9N A;  3MXG A;  1BUV T;  3RD4 A;  1G91 A;  4OL7 A;  1TWC B;  1OXX K;  4K2L A;  1RF2 D;  3E0J A;  3S1R B;  1BXT A;  1A15 A;  4XYO A;  1DOL A;  4HN7 A;  5CYU A;  3NP8 A;  2NYZ D;  4OIJ A;  3URY A;  5LL6 X;  4I65 A;  4LK1 C;  1T5X D;  3MHB A;  2EYM A;  2RDF A;  2XSC A;  2LMC B;  5D14 A;  2KQ3 A;  1STA A;  1TY2 A;  1SNC A;  2OF1 A;  3H94 A;  4C3J B;  1KAB A;  1OXU A;  2E74 C;  1QOH A;  4GZY C;  2F0O A;  2NBF A;  1H9K A;  3NWS A;  2B2U C;  3TN2 A;  3N52 A;  1KNE A;  2JXM B;  2A6H C;  2Z4H A;  1TVX A;  1SNQ A;  3ERO A;  1BCP F;  3BYY B;  1RKN A;  3EJI A;  5KRU A;  2MP1 A;  3KF8 A;  1D6E C;  2NVY B;  1F9P A;  3VA5 A;  4X3U A;  2F3V A;  4JBW A;  1FNU A;  4ME5 A;  2XN9 C;  1STY A;  1E0B A;  2FJ2 A;  2JP1 A;  4KY5 A;  1EEI D;  1KTK A;  3IL8 A;  1G2T A;  2L12 A;  2R92 B;  4CKE A;  1LTA D;  3HZX A;  5JPM C;  3P75 A;  4DXG A;  1WTO A;  4IUU A;  1AEX A;  3VYU A;  4O1N A;  4M1U B;  1BNZ A;  4DN4 M;  3OMC A;  1BCP D;  2YYZ A;  1Q3L A;  1MSH A;  1W6J A;  5JVH 3;  2MHV A;  2VNU D;  4FXG C;  1B44 D;  4C3I B;  5IGC A;  1HFG A;  1WTV A;  5CV5 A;  4IFD J;  2RVL A;  5IGD A;  3J7A V;  3GV3 A;  5ELF A;  4KMU C;  1KLU D;  1EOT A;  3CU7 A;  3D4W A;  1JB3 A;  5KND A;  2EPB A;  3H09 A;  5HUR A;  2XRQ D;  4F88 A;  1F2M A;  2KED A;  5CV7 A;  1JOK A;  4IUT A;  1SYB A;  2O2L D;  3LX0 A;  1I3Q B;  2R6G A;  4J8Q A;  1DON A;  1IYV A;  1TR5 A;  3DWA A;  1VCI A;  1S5B D;  4KTA A;  4XIG S;  5J39 A;  2ZXP A;  4UAI A;  4XQQ A;  1A6X A;  5ELB A;  4C1N K;  4IFD G;  3M3Y B;  5IGG A;  1Y1V B;  2F0P A;  2YU9 B;  3SDZ A;  1ONL A;  1R4P B;  1Q12 A;  3SHL A;  5M3F B;  3D8G A;  2B2W A;  3GV6 A;  3GD7 A;  5C4H A;  5FO7 B;  2F0V A;  5COY A;  1EYA A;  2DNC A;  1K8O A;  2KCN A;  3S14 B;  4OHJ A;  1HA6 A;  3DEO A;  4WOR A;  1PTO F;  4O42 A;  1ZXT A;  4H0L C;  1SYC A;  2EJF C;  2JE6 I;  2ZXR A;  2AQ3 B;  3NXW A;  3FPP A;  2L4N A;  2PZT A;  2KEC A;  3D4R A;  2QF7 A;  1QWY A;  4FYD A;  1YNN C;  5C3W A;  4IFD I;  4J6H A;  2EYP A;  2AUJ D;  5JVG 3;  5NUC A;  2A6E D;  1TWF B;  4XYQ A;  4DXF A;  1PRT D;  2BDO A;  3QG1 A;  3I73 A;  3J7A F;  4RKB A;  4ZQ3 A;  1H9M A;  1IW7 C;  2RA4 A;  3D4D A;  3MVV A;  1UUP A;  2M2L A;  2I46 A;  1LTG D;  1X32 A;  2F03 A;  3VR6 A;  1EY9 A;  4XTC S;  1I4X A;  4MN3 A;  1DYQ A;  1O7L A;  4C3J G;  5JPN C;  2BOS A;  4C3H B;  4MHE A;  1STN A;  3V2T A;  1LAC A;  3J81 L;  3G7L A;  2NVT B;  1STE A;  4ID6 A;  1PLF A;  5D65 A;  4RA8 A;  1B1Z A;  3CRK C;  2AQ2 B;  3E6Z X;  3QB3 A;  3R93 A;  2Z1C A;  2F0H A;  1VMP A;  1HTP A;  2E2I B;  5CGK A;  4OO1 H;  2VXW A;  1EQV A;  2VB2 X;  3I3C A;  2ICE C;  3PV0 A;  4FVM A;  3LNN A;  2FMC A;  1UEA B;  2XIW A;  3CRL C;  3K6O A;  4X3T A;  1GUW A;  1EU4 A;  2L1B A;  3A7A B;  4KK7 A;  4K5V A;  3K5N A;  2F0W A;  4XDX A;  2A5H A;  4XXE A;  3MXP A;  2R93 B;  3OSO A;  2L9H A;  4PMC A;  2IW3 A;  2H1E A;  2F0Q A;  3DM1 A;  4RCO A;  3X3M A;  1S5F D;  1PDQ A;  1I4G A;  3OHX C;  4RGN A;  1F2Y A;  3BDL A;  1SNP A;  4PMB A;  1MGS A;  2EJM A;  3SK6 A;  2F3W A;  3F2U A;  4RGT A;  5C4Z A;  4PQX A;  1L0X B;  3NPP A;  1CM9 A;  1SNO A;  1EYC A;  2X6G A;  2HCI A;  4FF1 A;  4C3I G;  4P2C B;  1LAB A;  1SXT A;  5K36 H;  2PQE A;  1LTR D;  1M8A A;  4WFN 3;  5C3E B;  2F4I A;  2EYO A;  5KIX A;  3MFG A;  3P20 A;  2DY8 A;  4K8J A;  5JOB A;  1WCM B;  4ZLT F;  2R7Z B;  2NB0 A;  2XRS D;  3PIP 3;  2DNE A;  4B9W A;  1LT6 D;  1OO9 B;  4ZKC B;  5I9O A;  4HMJ A;  1TU2 B;  2NTT A;  5KEE A;  3KBG A;  3OIQ A;  4DU9 A;  5M9O A;  2KHS A;  3EVQ A;  5C5M A;  4IQZ A;  1V1P A;  4K6D A;  3PUW A;  1B50 A;  1O7Z A;  3S16 B;  1C8C A;  1R4Q B;  3KUP A;  4HMI A;  5C6A A;  3C2P A;  3SK4 A;  4FXK C;  2K03 A;  2IX1 A;  2E2J B;  1TWH B;  1CZW A;  3GTL B;  2CW0 D;  4H7B A;  1JOR A;  3Q6S A;  1HTL D;  5DAU A;  2EVB A;  4FNF A;  3BVG A;  4N9T A;  3PUX A;  1CQF A;  1ZYR D;  1MD2 D;  3W3A A;  2R61 A;  5LHY 1;  5JJZ A;  1U4M A;  2PPB C;  1QIL A;  2B2T A;  1PZI D;  5FLX L;  1EY7 A;  3KK7 A;  1PFB A;  5EPJ A;  3TP6 A;  3J81 E;  5A2Q L;  5BN5 A;  3GTO B;  3R8B A;  1SJH D;  1GHK A;  4WRD A;  1QNK A;  2B2V A;  4A3E B;  3D31 A;  3HG9 A;  3UI2 A;  2PCF B;  2C5C A;  1WD0 A;  5CMD A;  4TKO B;  1A3V A;  4U67 3;  3HRZ C;  2LKV A;  3Q22 A;  3T4A C;  2VUM B;  1EU3 A;  1TKW B;  1Y8O B;  1PFN A;  2B39 A;  2B2Y C;  1IHZ A;  1AZQ A;  1ET9 A;  2PZU A;  3D6C A;  3BDC A;  4C3H G;  2OT2 A;  5E3F A;  4FF3 A;  2PYK A;  1LT4 D;  2BE5 D;  5CC4 A;  3VYS A;  1SDF A;  1JQY D;  2A68 C;  2NUC A;  2F0L A;  1UAP A;  1B2T A;  3D3R A;  3O13 A;  3TBI B;  3M85 A;  2DY7 A;  5D3D A;  1Y8P B;  3NHH A;  3MFY A;  4HSV A;  1WD1 A;  1HXY D;  1S5C D;  5TSS A;  2EXZ A;  5EJW A;  3HOZ B;  1TWA B;  1SYF A;  3S1N B;  1TT2 A;  4XT1 B;  4KD4 A;  4NP5 A;  1ENF A;  5E4X A;  2XVS A;  1DOK A;  1SJE D;  5IGB A;  3HOU B;  3Q23 A;  3PUV A;  2Z4I A;  5C4J B;  1RCV D;  4DAV A;  5C5L A;  5FK9 C;  4CJ0 B;  5T1I A;  1D1K A;  3R3O A;  1GUT A;  3I8Z A;  1SAP A;  5BN3 A;  4CJ1 B;  5I6Y A;  3NTK A;  4K2K A;  1X3Q A;  3BYT B;  5FKA C;  1SMY C;  1STG A;  3A8J E;  3VR5 A;  3I72 A;  3K58 A;  3P1H A;  4DAY A;  2CW0 C;  1BF4 A;  1QCB D;  4RHS A;  4DK1 A;  4X3S A;  1ICW A;  4V0B A;  4LJZ C;  4BBS B;  3H91 A;  2QKI C;  1PTO H;  3QJY A;  1YNJ D;  1ROD A;  4IZ8 A;  2WKC A;  3CQZ B;  2F0S A;  2K5Q A;  5CV6 A;  3LWU A;  5CV9 A;  2A69 D;  1D1I A;  5C0X J;  2EY5 A;  1CFM A;  1DJR D;  2WB1 B;  2A73 B;  2XNA C;  1U4R A;  4IUQ A;  1Z7T A;  5COR A;  4ZAI A;  1IKM A;  4Q0F A;  4HAE A;  2QIL A;  5CV4 A;  1RJT A;  2QEJ C;  3VA7 A;  3V05 A;  1GUS A;  2K5D A;  2EYH A;  2AWO A;  1VF7 A;  3LWE A;  3JAM E;  2ENB A;  3S1Q B;  1TS4 A;  2E75 C;  1BCP B;  4EQN A;  3P7J A;  2MJ8 A;  2XWB B;  5M5X B;  3SK5 A;  4DAP A;  2KA7 A;  3TP5 A;  5A2Q E;  3X3N A;  5C0X G;  4BWG B;  4CHT B;  2F0F A;  3GTQ B;  3I4N B;  3OPO A;  4A3M B;  2GA4 B;  4IUP A;  2BE5 C;  3BVM A;  1RTO A;  4CGY B;  1STH A;  1JWU D;  1A3T A;  2OEO A;  1NCV A;  3OWE B;  5F2D A;  2F0J A;  5ISR A;  1X3P A;  3SEB A;  1ENC A;  4E6I A;  3NK9 A;  3I90 A;  1S5E D;  3S2D B;  1G6Z A;  1PMR A;  5FOB B;  3VR2 A;  2O4X A;  5I4D A;  2PW5 A;  2K28 A;  1FNV A;  3K57 A;  5C0X I;  1NSN S;  2CVR A;  3J7Y W;  3RZO B;  1WTW A;  4C56 C;  1JWM D;  3Q0A A;  2M00 A;  2WKD A;  3A56 A;  2EYF A;  3W2D A;  3D6W A;  2JA5 B;  4NW2 A;  3EA6 A;  1GOZ A;  4A3D B;  1GUG A;  1SE3 A;  4IUV A;  2MGS A;  4CKC A;  3PIO 3;  4A3B B;  2IWH A;  4K8I A;  3VYT A;  3DHQ A;  4FO2 A;  4BY7 B;  3AB9 A;  1O78 A;  1L0Y B;  5ELE A;  4A3K B;  1QNU A;  2B2W C;  1PRT B;  4TQU S;  2NN6 G;  3K5L A;  1PZK D;  1LLR D;  4CKB A;  3QWN A;  2A69 C;  3HOY B;  1EYD A;  5C0X H;  3SVM A;  3BS1 A;  1CI3 M;  2OXP A;  5KGU A;  2RDG A;  3OW7 A;  1PTO D;  1PTO B;  2JA6 B;  4KN4 C;  2ICI A;  3L9A X;  3ZYY X;  1LV9 A;  2L0C A;  3MXN A;  3KLS X;  3R2I A;  1JE4 A;  1BCP C;  2KJX A;  4PMW A;  3GQB A;  1V1P B;  2NN6 I;  4ZUI A;  1EZ8 A;  5J1Z A;  1DCZ A;  4MIU A;  1EY0 A;  4ZK9 B;  5I6W A;  5DNF A;  4HSP A;  1SNM A;  1RD9 D;  4IFD H;  4RFB A;  5M3M B;  3I4M B;  3KBX A;  4BA2 I;  1CK1 A;  4U68 A;  4L6T B;  2MPM A;  3C1E A;  4KY7 A;  2HUG A;  1ILQ A;  4K6L A;  1C48 A;  3NE5 B;  1FR3 A;  3T51 B;  2WIN B;  5JEA J;  2JA8 B;  1D5Z C;  4K14 A;  4IUR A;  1O80 A;  3MTS A;  1M4V A;  1SEB D;  2IJ0 A;  3PO3 B;  3FDT A;  2HDL A;  4IAL A;  3ND8 A;  1F77 A;  3A8I E;  2F0D A;  1B4O A;  3MXU A;  3S15 B;  1AZP A;  3NQI A;  2G9D A;  4KV6 A;  3VR3 A;  5D3I B;  5EKK A;  2ZXO A;  4RAU C;  1ZKO A;  4HCS A;  5DM7 3;  1KDB A;  5I2X A;  2QDB A;  2X69 A;  1BR9 A;  5JEA G;  1CQV A;  3DWQ A;  2L11 A;  1GJX A;  1U4L A;  4ZKB B;  3A8K E;  3H6M A;  4KJO A;  3HOX B;  1E2W A;  2L55 A;  3SR1 A;  5IOC A;  3ND9 A;  1SSO A;  1MBY A;  1RDP D;  1EEF D;  3HS0 C;  2A6E C;  3DUZ A;  1JIC A;  1PRT C;  3MEH A;  4IN3 A;  1VDZ A;  3RMH A;  4NMZ A;  1XYI A;  3QIA A;  2Q8I B;  3TP7 A;  4DF7 A;  1TWG B;  4QUC A;  1EY6 A;  3SE0 A;  4ZRZ A;  1K8M A;  1O7Y A;  5J22 A;  4EGV A;  2CQA A;  3I91 A;  1H9R A;  1ET6 A;  1PTO C;  2JSO A;  1HPC A;  1DOM A;  4QF4 A;  2Q8T A;  2WAQ B;  2EOT A;  1LTI D;  2LS0 1;  4DA2 A;  4A3J B;  2A6H D;  3I70 A;  3C46 A;  3RUZ A;  4V19 0;  2K7V A;  2K32 A;  3A7L A;  4G57 A;  2EY1 A;  4BS9 A;  4G4K A;  3T16 A;  1NR4 A;  1A3U A;  4A3G B;  1SYE A;  1JOO A;  3TDQ A;  3HOW B;  5ELD A;  2XWJ B;  2KOL A;  2FIN B;  3S1M B;  2K33 A;  2SEB D;  1A2U A;  3GTG B;  4EQP A;  3CHB D;  3FPU B;  4FP5 D;  1I4R A;  1FNW A;  2B2T C;  3NUC A;  3OWF A;  1C4Q A;  1CT1 D;  5CBE E;  1ZEQ X;  4OGQ C;  4RHR A;  3EFX D;  1AP0 A;  5IGE A;  3PO2 B;  3IFT A;  2L5T A;  1TS5 A;  1QG7 A;  5JEA H;  5T1G A;  1KNA A;  1Z47 A;  2B2V C;  1F2Z A;  1VF5 C;  4ULL A;  1F2L A;  3NBI A;  4B08 A;  4BA1 I;  1EY4 A;  4CBV A;  1TQO A;  4RGM A;  3MZ5 A;  1SE4 A;  1Q1E A;  3GTP B;  1H9S A;  1DXM A;  3U9O A;  3G6J B;  1HFN A;  5FO9 B;  3TZD A;  5EBC A;  1ESF A;  3C3L A;  1F9R A;  1MSG A;  1KAA A;  2N55 A;  1TY0 A;  3L7Z C;  2F0G A;  3TZU A;  2RKS A;  4QIW B;  3FRP B;  4XQJ A;  4JK1 C;  2KCC A;  1ML0 D;  2F0N A;  1QB5 D;  1F9Q A;  1HHV A;  2EY6 A;  2HCC A;  2QCP X;  2JA7 B;  1AFP A;  3H0G B;  2AUK A;  1S4Z A;  2R3Z A;  4ZUJ A;  3GO5 A;  3T53 B;  3WOF A;  1LT3 D;  4A3I B;  2HQE A;  1CHP D;  2K04 A;  1HRJ A;  4Y7N B;  4PNY A;  3BDO A;  1NAP A;  5G3L F;  2B2U A;  1FD7 D;  2BA1 A;  1VMC A;  4KKU A;  2G9H D;  1H9J A;  1AW7 A;  4H44 C;  5K5P A;  1SFO B;  3IKJ A;  2E76 C;  3BZD B;  2RDH A;  1E2V A;  2SOB A;  3GTM B;  1DM0 B;  3PUZ A;  2KUM A;  4PV1 C;  4C2M B;  3VR4 A;  5E4W C;  3PUY A;  2IX0 A;  2V4D A;  1WTQ A;  1I50 B;  5CR3 A;  3WDN A;  1LTT D;  1EIH A;  1B3A A;  3NTH A;  2IT1 A;  5A35 A;  4CJ2 C;  2J7Z A;  1ZYR C;  5KYI A;  3MC0 B;  2WV6 D;  1R9T B;  1BDO A;  2F0T A;  2KEE A;  4WJW A;  5M5Y B;  1TS3 A;  4FF4 A;  1Y8N B;  1YNN D;  5G3L D;  1PZJ D;  4HTH A;  2F0I A;  3S17 B;  2EJG C;  3V96 A;  3A55 A;  4S3S A;  3KLS A;  1ESR A;  1FYC A;  2NVX B;  1U4P A;  3K7A B;  1I6H B;  1I4Q A;  4KHZ A;  4NKL A;  4R8N A;  4KD3 A;  5E1F A;  1IW7 D;  2F0E A;  3L3O C;  1XX8 A;  4DNR B;  2Y0S B;  4LMQ D;  4FF2 A;  1WVL A;  3BG3 A;  5FLX E;  4OIK A;  1HUN A;  1CA6 A;  3GTK B;  1Z6H A;  4QB4 A;  3DXJ C;  1Q1B A;  1IL8 A;  1UNS A;  3NSW A;  4QMG A;  2RQX A;  4RH6 A;  4BY1 B;  2JEA I;  1BO0 A;  2Q8R E;  1EWC A;  1LO5 D;  2IX3 A;  2IPK D;  1I4P A;  4G7H C;  1NR2 A;  1HCZ A;  2E2H B;  4FXD A;  3FMC A;  2H4O A;  4F8M A;  2K05 A;  5AFW A;  1V8Q A;  2FFK B;  2ZT9 C;  1Y1W B;  5FO8 B;  2K5W A;  3Q24 A;  1HQM C;  5ELC A;  2F0K A;  4YIJ A;  4C1N I;  2NWG A;  4KKS A;  3GTJ B;  1G29 1;  2PMZ B;  2F0U A;  4KJN A;  3C1F A;  4G7O C;  1EY8 A;  2WII B;  5I2Y A;  1BBX C;  2K6A A;  5IOD A;  2BA0 A;  3RZD B;  2EZV A;  3TME A;  3I4L A;  4OO1 G;  1K83 B;  2TSS A;  2E2D C;  1DZ1 A;  3K0Y A;  1BOS A;  1MI2 A;  1V43 A;  4Z9C B;  3ONA B;  3AMU A;  3HKZ B;  1TS2 A;  2B8F A;  3K59 A;  1WTP A;  1CTM A;  1JR0 D;  3E5S A;  5DEH A;  1PRT F;  2FMM A;  4TSS A;  1EFI D;  1SND A;  3EQL C;  4UDU C;  1IYU A;  2JYO A;  3U9S A;  2VB3 X;  2N88 A;  5HGT A;  4XQN A;  4IUN A;  3ITP A;  4BBR B;  1EL0 A;  1QE6 A;  1EY5 A;  1YNJ C;  2F0M A;  3K5M A;  2PO4 A;  4OO1 I;  1AN8 A;  4Q5V A;  1D5X C;  1J8I A;  3MAQ A;  1V1O A;  2EE1 A;  2KVM A;  4XT3 B;  5IIF A;  4HED A;  5CV8 A;  4TRD A;  1A2T A;  3MWY W;  4NDX A;  4KHV A;  3QOL A;  3RLF A;  3T56 B;  1PFM A;  5K36 G;  4ILW A;  2BCO A;  1Y69 U;  5KNC A;  4LAA A;  3N6R A;  4KKT A;  4DNT B;  1EIG A;  3VYR A;  4B9X A;  1RHP A;  2RSN A;  3FEW X;  1FGB D;  1EWH A;  4RKL A;  4K5W A;  4ODG A;  3BVZ A;  1LTS D;  3HP3 A;  1JCK B;  2B8G A;  3HEJ A;  3IAY A;  1QJO A;  3R2T A;  4J1M A;  1KDC A;  3HOV B;  2EYJ A;  3CKI B;  4L63 B;  1SBB B;  4HCE A;  2J0T D;  5IGF A;  3TP8 A;  2HDM A;  1B53 A;  1E2Z A;  3OMG A;  2EDG A;  5EPL A;  4QCL A;  1EQT A;  4L8J A;  2I07 B;  1GXD C;  5IT9 L;  5KNB A;  3J80 L;  1OXT A;  2O5I C;  3WOE A;  3S9W A;  2NVQ B;  2TMP A;  2IL8 A;  1XWE A;  1JWS D;  1HQR D;  2PNR C;  4R8I A;  1Q90 A;  2PW7 A;  3DWP A;  1KDA A;  1RTN A;  3M4Y A;  3SK8 A;  4RWS C;  1Q8I A;  1LTB D;  3IFD A;  1LT5 D;  1PYW D;  5JAV A;  1BQQ T;  4HR7 B;  2NN6 H;  1DD2 A;  3PMF A;  2NTS A;  3K5O A;  2A68 D;  3KLR A;  2BDN A;  2JEB I;  4KN7 C;  1EZ6 A;  1ILP A;  1OXV A;  3DEP A;  4AYB B;  4ABN A;  2J4X A;  5LL6 S;  3H3V C;  3M4O B;  1F9S A;  3M7N A;  1XXG A;  5EQ0 A;  1S5D D;  1H9S B;  2D62 A;  2Z8L A;  1NUC A;  1SE2 A;  1OXS C;  2AQ1 B;  3MA2 B;  2O5J C;  5I9P A;  2K1B A;  3NBH A;  1GUN A;  2MUY A;  1SYD A;  1W6K A;  5C4X B;  2NZ1 D;  1CZG A;  1STB A;  5C44 B;  4KI0 A;  1GUO A;  3M7G A;  1T5E A;  2SNS A;  3OIP A;  1JOQ A;  1D2B A;  4ZYS A;  3DMU A;  4EQO A;  5BN4 A;  1CA5 A;  4RCN A;  5EKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...