2KCMA

Solution nmr structure of the n-terminal ob-domain of so_1732 from shewanella oneidensis. northeast structural genomics consortium target sor210a.
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
MKGKVVSYLAAKKYGFIQGDDGESYFLHFSELLDKKDEGKLVKGSMVHFDPTPTPKGLAAKAISLPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold shock domain family protein
publication title Solution NMR structure of the N-terminal OB-domain of SO_1732 from Shewanella oneidensis. Northeast Structural Genomics Consortium Target SoR210A.
rcsb
source organism Shewanella oneidensis
molecule tags Nucleic acid binding protein
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2kcmA00
1OTCA 2UXCL 1HH2P 1CKMA 2FXQA 1QZGA 1OXSC 2CWPA 3HFZB 2JQOA 1Z47A 1A62A 1B8AA 3PIPA 1BVSA 2LSSA 4LF9L 2EXDA 1B7YB 4OO1I 3CCUA 1N9WA 2VUMH 1YEZA 1X3FA 4IPHA 3CMEA 3PUYA 1L1OA 3FKIG 4LUZA 3CXCA 1KHIA 4DV6L 4DV7L 1CKNB 1YI2A 4BY7G 5JJLA 5M5WH 3NBHB 2ATWA 4FDBA 4DR6L 1PH7A 2XGTA 4LWCA 1D7QA 4ME3A 3I4OA 3KF6A 4JOIC 3RLOA 5FLMG 1U0LA 2RCNA 2ZM6L 2ALYB 1M1KC 4GKKL 4QY7A 1HJPA 3A74A 1XPOA 2IT1A 5C4JH 3F2DA 3KLWA 1QZHA 1E3PA 2R93G 2AKWB 4LW1A 3ZJYC 4DK3C 4L5RC 4PG3A 1YHBA 3I55A 2K5NA 4BY7H 2YYZA 1HZCA 1VQFA 1XNQQ 4JC0A 4GLXA 4B3TL 2IHFA 5FLXc 1V1QA 4DV1Q 1HR0Q 1SN8A 1I50H 1P8LA 3GO5A 4OWTB 5AJ3L 3T1YL 2KHJA 1O7IA 3CMAA 1K8GA 2QGQA 2R7FA 4LF6Q 3HOWG 3I4NH 4LFBL 4JCVE 1VQDA 2VZAA 1WCMH 4JBMA 1JE5A 5H1SE 2ZJPA 3CAMA 3CQZH 3KYHC 5C3EG 4PZ8A 5GROA 2I5HA 3RNUA 1VQ5A 3HOXH 3NENA 1VQ4A 2BH2A 4LF4L 4AQYQ 1YJNA 4A3IG 2WP8J 3NEMA 3TS2A 4BBSG 2Z0SA 1AE2A 1SROA 1UE7A 1Y1WH 4IO9A 5IYCG 4POGA 4LUOA 3BZCA 1NY4A 3U4VA 1PH6A 1PHJA 1X3EA 1SR3A 2UUCQ 3HOUH 1N34Q 4A3GH 2RHSB 4DV3Q 1PYSB 2ID0A 1GD7A 2HT1A 3HOYG 4JI4Q 2B63G 2Y0SE 1EWIA 1MKHA 3E9HA 4JBKA 3S17H 2UUAQ 1N8RC 4BBRH 4DAYB 1VQCA 4OX9Q 5LMUL 3GTLH 1NMGA 3HKZE 2JA6H 1IYJB 1I94L 5GAGC 1MJCA 4DV5Q 3L2PA 3VDYA 3AEVA 4UP8A 1TXYA 1OXVA 4AYBG 2XTIA 3L7ZC 3CCMA 4JV5Q 4GLVB 3CC4A 4DR3L 2Q2UA 2OTJA 1RL2A 2JA8G 4NB3A 4P73A 5LMNW 2YU9H 3F8TA 2R7DA 4O2DA 5E7NA 1KL9A 2Q2TA 4DKAC 4IOCA 4DUZQ 2K50A 2NZHA 5FJ8H 5IYDH 4MTNA 4YCWA 2CKZB 4A75A 1LTLA 2JA5G 2JA7G 3PUWA 1XNQL 4R4IA 3NELA 1OXUA 1A8VA 2K52A 2MO1A 3AFQA 3FHWA 1E22A 3H0GH 1HR0L 1N33L 2VNUD 2K4KA 4A3JH 3GTKH 1C9OA 1EOVA 5IT9c 4EQ5A 4DV4Q 4A3DG 1BKBA 1PA6A 1VQLA 4R4QA 4KHPQ 3PV0A 4K0KL 4JOIA 2K5VA 4YCUA 1Y1VH 1NMFA 3CCSA 4AQYL 3W1BA 3ERSX 4KHZA 4POFA 2OTLA 1YBYA 3U4ZA 2AHOB 1PH8A 1I3QH 3F1ZA 1B70B 1FGUA 5GAHC 1PV4A 4JI7L 2BH8A 2Y0SG 4HIMA 1JT8A 4BA1I 5IP7H 2N3SA 4X62L 3BJUA 4X64L 3J80c 2MQHA 2OQ0A 2V1CC 1YJ9A 3RZDH 1KQSA 3GTGH 4DR7Q 4ALPA 2D62A 2OCEA 3W5OA 1A63A 3K81C 1VQAA 2NVQH 4DUYQ 1YIJA 2VUMG 4B3RL 5JEAJ 1K3RA 4B3SL 4WJ3M 4IPGA 2GVBA 3GD7A 1XJVA 1X9NA 4JI2Q 2UUAL 5BR8Q 4OWWB 5HY6A 1FJGQ 4GKJQ 4YY3L 2K75A 2I5LX 1X65A 1KRTA 4GN4B 4YHHQ 1HZAA 1ASYA 2VQEQ 2L15A 3G4SA 4JI0Q 2RHQB 4DV0Q 3RZOH 2UXDL 1CUKA 3PUZA 4LUVA 4DR1L 3M4OH 2UU9L 4JV5L 2E2IH 2UUBL 2RF4A 5IP9G 1HNXQ 1XNRL 4JYAL 1HNWQ 4LNQA 4AH6A 2E2HH 1KAWA 2E2JH 2OQKA 5IWAQ 3ULPA 1S72A 1UE5A 3I4NG 4DR4L 1NTGA 2CCZA 1MJEA 3HOVH 3MEFA 3HOZH 2IY5B 1EFWA 1WFQA 3EIVA 1AH9A 3AFPA 3HKSA 4L5QA 2PI2E 4MNOA 4YWLA 1HZBA 2PQAA 3KFUA 3HOXG 3CCVA 4HIDA 1T9HA 4A4IA 3SGIA 5IE8A 4IPCA 3K8AA 3RLNA 4DV4L 5M3MG 1VQHA 2WAQG 3E0EA 3STBC 1Y1WG 3PO3H 3PUVA 1Q1BA 1I94Q 5HGQA 4AYBE 3I7FA 2PNHA 3G71A 3T1HQ 1QUQB 2N78A 1PH5A 1YITA 4PZ7A 5IYBH 3HOUG 4LF5Q 4X65Q 2VW9A 1K8AC 1IBLQ 1XMQL 1WOCA 4A3GG 4AIMA 4HJ9A 2R92G 2GN5A 4JI8L 2UXBL 1IBML 1CKNA 1CSPA 2R7ZG 3J80i 3S1NH 5J3BA 4NXMQ 3ULLA 4A3KG 1VQ8A 3OTOL 4DR7L 4QGUA 1YHAA 1X6OA 1CSQA 4BBRG 1IBKQ 3F2CA 2JA6G 1A0IA 4C2MH 1HZ9A 4P75A 4DPGA 1I5FA 1KD1C 1HNZQ 4LF8L 1NJIC 4IFDI 5C0XJ 3M4PA 4LFAQ 3CC2A 3KDFB 4XTCS 4C3IH 2JEAI 4OO1G 1S3OA 4DV0L 1WJJA 3UDGA 4GNXB 2ZTEA 5JJKA 2WB1E 3D31A 5FJ8G 5IYDG 3CCJA 2D0PA 4IPDA 2CQOA 4DR5Q 1XMOQ 5C4XH 5GADC 1DGSA 3FKIH 4UPAA 4YWMA 3TS0A 1UE6A 2D0OA 4A3JG 2A8VA 4L5TA 4JI1Q 5FLMH 4JI3Q 4LFCQ 3DLLA 3H3VI 3PO2H 2JE6I 5GQOA 3PGZA 1TWHH 3I2ZA 3LGJA 3JAMc 2NVTH 1N32L 4C3JH 3EN2A 1Y1VG 4DV2Q 1JJCB 4HJ7A 4OWXB 3AQQA 4P71A 3S2HH 1E7ZA 3CF5A 2K14A 3S1RH 2MNAA 1Q82C 1VQ6A 2JK8A 2AWNA 4QL5A 1L2FA 4RG1A 4GLAC 2AMCB 5IP7G 5JEAG 1ASZA 2E8GA 3ER0A 1VS0A 3U58A 1XPRA 1VQ9A 4DV1L 4HJ8A 3A5ZB 1K9MC 1TWCH 1XPUA 3I4MG 1P16A 1U5KA 5K36G 4LF6L 4HIKA 4A76A 4DK6C 1HR0W 1FVIA 2YTXA 4A3EH 4RMFA 4A3BH 1M90C 5M5XH 1EIFA 4H02A 4GOPB 2GVAA 3CD6A 1YJWA 3J7A5 4YCVA 3UDXA 2E5LQ 2HHHQ 4B3MQ 2MFIA 3CC7A 1IBKL 1L0WA 1N36Q 1KRSA 1K73C 3M7NA 1LYLA 1J5EQ 1VQPA 1VQJA 3G6EA 1JJ2A 2WB1G 2NN6I 5C0XI 4DR2Q 4LF9Q 1BBWA 2WAQE 3K80C 5M3FH 3J81c 1PYBA 2QEXA 3ULJA 4PZ6A 3CCEA 2F4VQ 3S15H 4DV6Q 2ZJRA 3E9IA 1VCIA 3UE1A 1C7YA 1LM0A 3K7AH 2B3GA 1N34L 4DR6Q 4DV3L 1W2BA 2ZM6Q 3HOVG 3HOZG 4DR5L 1X55A 2NVYH 2YTVA 4JI4L 1OXTA 3CP0A 4IFDJ 3IRBA 4Y52H 4BXXH 1UE1A 4LFCL 4JI1L 1VQMA 4OX9L 2HIVA 3TREA 2PI2A 4PMWA 3RR5A 2IHEA 4A3LH 5AJ3Q 4DV5L 3T1YQ 1QVFA 3STBD 4GNXC 5M5YH 3PO3G 5IY0A 2KENA 1TWAH 4P72A 2JA7H 3GTQH 4LFBQ 1S40A 3CPWA 4DAMA 2K5HA 3JC66 5IYBG 3H3VH 1PH2A 5EAYA 4JI5Q 3S14H 1V9PA 3CCRA 4LF4Q 4DUZL 1TWFH 4BA2I 1WCMG 2Z6KC 1VQGA 4OXPA 3BU2A 1K0RA 3KOJA 2LXJA 4YWKA 1Q8KA 1WYDA 5ELNA 4A3FH 1L1OB 1YZ6A 4KI0A 4HIOA 4A93H 1E1TA 1G6PA 1Q46A 5C0XG 1KC8C 1J6QA 4A3MH 1YHQA 1YNXA 3PCOB 1PH3A 3KF6B 3S1QH 1V43A 2LXKA 3H15A 2E5LL 4BY1H 1N32Q 4IJHA 4A3CH 3FP9A 1WI5A 5DLQE 2KBNA 1N36L 1KXLA 4TQUS 1QVCA 1J5EL 1C0AA 1R9TH 2YV5A 3MXNB 3GDEA 4DR2L 4R4OA 3J81i 4O0AA 5LMUQ 2F4VL 5C4XG 1IL2A 4JI6Q 2EIFA 3UE0A 3TRZA 4GOPC 1VQOA 3CCLA 4GS3A 1OXXK 1EYGA 4KHPL 5C44H 1PFSA 2DUDA 4MZ9A 4GN3B 5LMNQ 4DR3Q 2ASBA 3S1MH 2ZTCA 2CFMA 3PO2G 1QVGA 4DUYL 2HQLA 1GM5A 1H95A 1UEBA 4JI2L 5BR8L 1FJGL 1QUQA 1W3SA 2A1AA 2A19A 4GKJL 5IP9H 3D0FA 4LF7Q 1SLJA 4YHHL 1SFOH 1VQNA 3TQYA 2VQEL 4JI0L 2IX1A 2DGYA 2KCTA 4WJ4A 1JMCA 1SE8A 4X66Q 1K83H 2WFWA 1CKOA 3GTMH 3K7UC 1HNXL 1VQIA 1HNWL 4IJLA 4K0KQ 1I6HH 2C35B 1D8LA 3H0GG 4UP7A 1IXRA 3CW2C 3WWVA 3GTOH 3BZKA 4JI5L 2QA4A 1E1OA 5IWAL 4P74A 4A3BG 4A3EG 5M3MH 4DNIA 2CWAA 3RN2A 1EUJA 4QQBX 3S2DH 3I56A 3K0XA 4JI7Q 2R93H 3KDFA 4IOAA 4NXNQ 1TWGH 1Q86C 2I0QA 1Z9FA 2Q2IA 1SRUA 4X62Q 4X64Q 4GNXA 2VY3A 4R1JA 1FL0A 4C3HH 4EX5A 2VQFQ 5ELOA 1Q7YC 1VQKA 1Q1EA 5M3FG 1GO3E 2AWOA 2N49A 2R92H 4B3RQ 3HOWH 1X56A 4L5SA 4B3SQ 2R7ZH 3S24A 4XIGS 2N8NA 3F2BA 3T1HL 4A3KH 1E24A 1UWVA 4JG2A 4APVA 2F3IA 1AE3A 4YY3Q 3KJOA 3PF5A 5C3EH 1L1OC 4X65L 1PH1A 1IBLL 3EBEA 4LF5L 2Z6KA 1YVCA 3GTPH 4IFDG 1EQRA 1Y14B 1Q12A 3M4QA 4UP9A 4A3IH 3OW2A 4UY8C 1JB7A 2NVXH 4JI6L 4BBSH 2UXDQ 1X54A 3Q8DA 4DR1Q 4TVAB 4NXML 2YTYA 2UU9Q 3RLFA 5LMNL 4Y7NH 5IYCH 2UUBQ 1VQ7A 4JYAQ 2MO0A 1XNRQ 4BXXG 2UXCQ 2VL6A 3UDIA 1PVOA 2KCMA 2ES2A 3PIOA 2BA0A 3AYHB 2F52A 3PUXA 2ZJQA 4A3LG 1JJGA 1SMXA 1GVPA 1HNZL 1BBUA 4DR4Q 3OYYA 4LFAL 1NE3A 5GAEC 4LF7L 3HOYH 1EIYB 4J15A 2B63H 2B29A 1PH4A 4DV7Q 1MIUA 1NBWA 3M85A 3RN5A 3GTJH 3DM3A 4JBJA 4X66L 4GOPA 4GKKQ 4HJ5A 1XMOL 4NPSA 4OONA 4QIWE 3PF4A 2UUCL 3U50C 3B6YA 4KLKA 3TEHB 3CPFA 1Q81C 4A3FG 4A93G 3J81j 2OWOA 2JA8H 4A3MG 2Q2HA 3G48A 2I5MX 4R4CA 4JI3L 1GKHA 3A5UA 3KJPA 2EQSA 3JAMi 3A0JA 4B3TQ 4BY1G 4GN5A 1XMQQ 1X3GA 4A3CG 1N33Q 4X6AH 4NXNL 2NZOA 2PMZE 4JI8Q 1IBMQ 3M3YH 2UXBQ 4DV2L 2JA5H 2JA9A 5JJIA 3M9BA 3OTOQ 4HJAA 3W1GA 2KHIA 3I4MH 2VQFL 3HKZG 1RIPA 4R4TA 3L0OA 2H5XA 3KF8B 2R6GA 1XTDA 1G51A 2IX0A 1EQQA 4A3DH 3S16H 4LF8Q 2HIXA 5C44G 3ICEA 2VS1A 1VQEA 2NN6G 2PQAB 3PSIA 2BA1A 2JEBI 1IZ6A 1G291 2ZTDA 1PH9A 4JBWA 2JJQA 3J7ZC 3CCQA 1VQBA 1KIXA 2HHHL 4B3ML 3UDFA 4QJFA 1LUZA
chains in the Genus database with same CATH superfamily
2RCFA 2UXCL 1STHA 2F3VA 5JAVA 1B8AA 1TWFB 2ENBA 1GUGA 4LF9L 1B7YB 1WVLA 3MHBA 1D5MC 3CCUA 2VUMH 1MBYA 4IPHA 3CMEA 1I94Q 1CKNB 1D5XC 4BY7G 5M5WH 1PH7A 4ME3A 3KF6A 2LMCB 5BN5A 3F2DA 3VYSA 2R93G 2K28A 4DK3C 4F8MA 4K6LA 1YHBA 5JPNC 1AEXA 2K5NA 1R9TB 1HZCA 1BUVT 3MXNA 2D9UA 1CFMA 5C5LA 4QF4A 3OOCA 4DU9A 2B2TC 4KD4A 3CMAA 1QG7A 3T53B 4LFBL 4JCVE 1K3BC 3KYHC 5CBEE 3NE5B 4PZ8A 3RNUA 3OWEB 5IGFA 3HOXH 1GUSA 1KLUD 4RGTA 4DNRB 4H13C 1YJNA 2PCFB 3NEMA 4BBSG 1Y1WH 2HCIA 5IYCG 1TS2A 1E2WA 1LT3D 3MXGA 4LUOA 5C3XA 3FPUB 4V0BA 3E3XA 1K83B 2RHSB 4DV3Q 1GD7A 3RMHA 1RF2D 3E9HA 1SNOA 2CVRA 2KCNA 1ET6A 2LFNA 3K0YA 2A6EC 3D3RA 3GTLH 4DK0A 3HKZE 2JA6H 1I4GA 2PMZB 2F1MA 1I4HA 3GV3A 4ZQ3A 4E6IA 4I7AA 4AYBG 1LTRD 2XTIA 2QEJC 4MIUA 3CCMA 3CC4A 4DR3L 1RL2A 4NB3A 4P73A 2XNAC 3HG9A 4N8X1 2R7DA 2EVBA 3FMCA 4DKAC 3D4WA 2K50A 4A75A 4YCWA 2JA7G 5C3EB 2XVSA 2MO1A 3AFQA 3FHWA 4J1MA 4A3BB 3NHHA 2K4KA 3GTKH 1C9OA 5IODA 2MP1A 4K2KA 4DV4Q 4QMGA 5E3FA 1BKBA 5L37A 4Y7NB 1VQLA 3FDTA 3GP7A 4JOIA 4RKBA 2IJ0A 1HTPA 3CCSA 1NMFA 3W1BA 2OTLA 3U4ZA 3Q0AA 1ENAA 2BE5C 1PH8A 2EZVA 1B70B 2BH8A 4RWSC 4BA1I 1O7YA 1FNUA 1FR3A 1EQVA 1M8AA 2ICEC 5BN3A 1S5CD 1LT4D 2NVQH 4DUYQ 2JA8B 4YY3L 4QUCA 2K75A 4L6TB 1AN8A 1X65A 1KRTA 4X3TA 4GN4B 1ASYA 2L15A 3G4SA 2F0DA 2UXDL 4LUVA 4DR1L 2D5DA 1JQYD 3FEWX 4JYAL 1CTMA 1HNWQ 2H4OA 3KF8A 5CC4A 1EZ8A 1PTOB 3FPPA 3DXJC 5IWAQ 3ULPA 3I4NG 2A5HA 3HOVH 2Q8TA 4KN7C 1EFWA 5J1ZA 3JAME 2PI2E 4A93B 1HZBA 1JR0D 5IE8A 2LS01 1K8OA 1VQHA 3E0EA 2Y0SB 3CKIB 1Y8OB 1H9SB 3G71A 3I73A 2A74C 3VA5A 5KIXA 2SEBD 3HOUG 3D4DA 2VW9A 1K8AC 4A3GG 4ZKBB 4HJ9A 2F0TA 4XT1B 4JI8L 1EZ6A 1CSPA 3S1NH 3J80i 3ULLA 1OO9B 3FVQA 4OEMB 3OTOL 1SBBB 1SYCA 1G2TA 3A7AB 3DWQA 5EGTA 1WTQA 1KD1C 3I8ZA 5C0XJ 3M4PA 3A8JE 1X3PA 1I4QA 3WOFA 2EYFA 1ESRA 1LTID 1WJJA 4IUQA 5D3IB 4XT3B 2WKDA 3CQZB 3CCJA 4IPDA 1DGSA 2QCPX 3D4RA 2L1BA 1LTAD 5M3MB 2WAQB 5E1FA 2D2CC 4JI1Q 3PO2H 3DLLA 1DCZA 3PGZA 1TWHH 3JAMc 1WTHA 3LGJA 2R93B 3ITPA 4YIJA 5CV5A 1BXTA 5FLXL 1IW7C 1Y1VG 1JJCB 2K5DA 3S2HH 2R92B 1Q82C 2JK8A 4QL5A 4RG1A 1ASZA 4BBRB 1HQMC 5BN4A 2E8GA 5FO9B 3Q6SA 1XPUA 3VR5A 3I4MG 4G7OC 2F0SA 1U5KA 2NVXB 2YTXA 1D1KA 4HSVA 1EIFA 1H9MA 1B50A 4L63B 2HHHQ 1DD2A 2G5DA 1IBKL 1L0WA 4ULLA 1K73C 1LYLA 1J5EQ 5C0XI 4KMUC 4LF9Q 3J81c 1WD0A 1DOMA 3OWFA 3K7AH 1DJRD 4XYQA 1N34L 2B2UA 4I65A 3HOZG 4DR5L 1X55A 2X6LA 4JI4L 4K8IA 1U4MA 4IFDJ 3IRBA 1J8IA 4BXXH 1I3QB 1ML0D 4N8FA 4PMWA 3SR1A 4DV5L 5ELFA 2IL8A 3PO3G 5IY0A 1RCVD 4LFBQ 2JA7H 3GTQH 1MI2A 4UHVA 5IT9L 4CGYB 1ZYRC 4OL7A 5D65A 1O7ZA 4JI5Q 3S14H 2SNMA 1TR5A 1SAPA 4IUPA 5M9OA 2I07B 5IGCA 1LTSD 2LXJA 1G6PA 1E1TA 3RZOB 1BCPD 1YHQA 4A3MH 2WB1B 3M4OB 1VF7A 1V43A 2LXKA 3NTIA 3NXWA 3AB9A 3IFDA 2E2HB 1LTBD 5LL6S 1QVCA 1JORA 1VF5C 1PZJD 5FOBB 1RJTA 3M4YA 1K8MA 2EIFA 3CCLA 4KHPL 1OXXK 5I6YA 2DUDA 3TP7A 4DR3Q 4WORA 1A3TA 1RKNA 3P75A 3W3AA 1IKMA 4ZLTF 1RHPA 2PO4A 4JI2L 1QUQA 4UAIA 1SLJA 4YHHL 1SFOH 2R61A 3I4NB 1BR9A 4WJ4A 4B9XA 1JMCA 4NKLA 1D5ZC 2MJ8A 3TDQA 2WFWA 1CKOA 3GTMH 2E75C 4RA8A 3CHBD 1VQIA 3QWNA 1VDZA 3H0GG 2F0VA 5KNCA 4DNIA 4LMQD 4QQBX 3I56A 4MN3A 1ONLA 1JWUD 1XWEA 3K0XA 4RGNA 3X3MA 5I2YA 4NXNQ 1TWGH 3NPPA 2AQ3B 1Z9FA 4Q0FA 4GNXA 1A15A 2VY3A 1FL0A 5CMDA 1Q7YC 5C4XB 3TN2A 1VQKA 2N49A 4L5SA 3S17B 1E24A 3A55A 4APVA 1AE3A 4YY3Q 3PF5A 4DAVA 4LF5L 4X65L 1PH1A 4OIKA 1EQRA 4C3JB 2K5QA 4A3IH 3OW2A 2UXDQ 4DR1Q 2YTYA 5LMNL 1SNQA 1EWHA 4JYAQ 1HRJA 3WOEA 1PVOA 4ME5A 1A2TA 1BO0A 2F52A 3S1RB 2XRSD 1BBUA 1IYUA 4LF7L 3HOYH 4Z9CB 4J15A 1SYGA 2B29A 3RN5A 5M5XB 4QIWE 3PF4A 1QNKA 3B6YA 2B2WA 3CPFA 4K8JA 4RKLA 4R4CA 4JI3L 3A5UA 3JAMi 1STYA 5M3FB 3QIAA 4B3TQ 4BY1G 3S15B 1N33Q 1RTOA 2NZOA 4JI8Q 2KEDA 1C48A 5IGEA 2JA5H 3OTOQ 4HJAA 2H1EA 3EFXD 3IFTA 3I4MH 4FF2A 1ZXTA 1XTDA 3SEBA 3Q22A 3OW7A 1BNZA 5JVH3 4DF7A 5C44G 1DXMA 4XQJA 3CU7A 3LWEA 2KOLA 2VS1A 2PQAB 3PSIA 2JEBI 2ZTDA 1PH9A 2EOTA 1TWAB 5ELBA 3A56A 2JJQA 3CCQA 1HA5A 1TS4A 1XYIA 1HH2P 2FXQA 1F9RA 2E2JB 1OXSC 3HP3A 1GOZA 4XQQA 3PIPA 3LWUA 2WACA 1KDBA 1N9WA 2OF1A 1EFID 1YEZA 2B2YC 3CXCA 4LUZA 1KHIA 3NWSA 1Y8PB 4DV7L 5JJLA 2ATWA 2XGTA 1D7QA 4R8IA 1SE2A 1M1KC 3PO3B 4QY7A 3NSWA 4DXGA 2IT1A 4X3UA 5C4JH 1HFNA 2AKWB 4PG3A 1JE4A 1VQFA 3HKZB 1XNQQ 3SK4A 2IHFA 4HEDA 1V1QA 1HR0Q 1I50H 4OWTB 3GTGH 4FYDA 1G2SA 1K28A 2R7FA 1EU3A 1ICWA 1PTOD 5D3DA 2XWBB 2JYOA 1RD9D 4RFBA 2ZJPA 4JBMA 3A7LA 3S1MB 4K5VA 4CJ0B 4XDXA 5C3EG 5GROA 4ZKCB 2I5HA 2BH2A 2BDNA 4LF4L 2Z8LA 4AQYQ 2WP8J 4FVMA 1CZGA 4ZRZA 1UE7A 4IO9A 2PW7A 1PH6A 1ENCA 1KNEA 5ELEA 1X3EA 1SR3A 2HUGA 2UUCQ 1N34Q 1TS5A 1PYSB 3TP6A 1I6HB 4K2LA 4JI4Q 1MKHA 1UNSA 5KGUA 3G7LA 2UUAQ 1D6EC 1B3QA 4DAYB 2XWJB 2NVTB 5GAGC 1MJCA 4DV5Q 3EQLC 3VDYA 1TXYA 1DONA 4GLVB 2JA8G 4OO1H 2YU9H 4O2DA 2B8GA 3BYYB 1JICA 3G6JB 3HOWB 2V4DA 4MTNA 2CKZB 1LTLA 5EKIA 4BS9A 1I4RA 3MFGA 3GTPB 2K52A 3SK8A 3H0GH 2RDHA 2VNUD 1E22A 1ZKOA 4ZCKA 4A3JH 2KCCA 2F4IA 1CZWA 2I46A 1S5BD 5E4WC 4HMIA 4ODGA 3N52A 2EYHA 1BCPB 1DZ1A 2AUJD 1IL8A 1SNDA 5CBAE 3R2IA 4JI7L 5GAHC 2Y0SG 2TSSA 1C4QA 3IAYA 2QKIC 1TU2B 5IP7H 4NDXA 4X62L 3J80c 1YJ9A 2OQ0A 3GTJB 4N9TA 4DR7Q 3RZDH 4KHPQ 2A68D 3W5OA 2NVYB 1VQAA 2N88A 1YIJA 4B3RL 1K3RA 4B3SL 2F0JA 4WJ3M 1X9NA 1DYQA 4JI2Q 2I5LX 4YHHQ 3MAQA 2KUMA 2PZWA 2RHQB 3SE0A 3A8IE 1CUKA 1ENFA 3PUZA 3M3YB 3MWYW 1JWSD 4JV5L 5IP9G 1SYDA 1XNRL 2JP1A 1RODA 3DEOA 4AH6A 1S72A 1STBA 2F0IA 3S16B 1UE5A 2OXPA 4A3DB 2CCZA 3MEFA 2N55A 2CH4A 3P20A 3KFUA 1B53A 1U4RA 4LJZC 3SGIA 3S1QB 1FGBD 3K8AA 4BY1B 2QW7A 5M3MG 1CA6A 3CRKC 2WAQG 3URYA 3I7FA 2PNHA 3OMCA 3HGBA 5KNDA 1YITA 2RSOA 1WTPA 2NYZD 4LF5Q 3NK9A 1UEAB 1V1PB 4X65Q 2Z9HA 2VUMB 2R92G 1CKNA 5M5WB 5C44B 1EY9A 1VQ8A 2F0QA 3VYUA 1X6OA 1E0BA 4BBRG 1BCPC 2RVLA 5C0XH 3F2CA 5C4ZA 1EIGA 4G7ZC 1HQRD 1NJIC 4K5XA 4IN3A 1CQFA 3BVZA 2JEAI 4C3IH 4DV0L 5DAUA 3UDGA 1S4ZA 1U9RA 2ZTEA 5FJ8G 2QF7A 5IYDG 2D0PA 5C6AA 2CQOA 3T4AC 4BWGB 3HOXB 4YWMA 3TS0A 1SNPA 1EY6A 4RGOS 2D0OA 2ICIA 4LFCQ 3S2DB 4JI3Q 3H3VI 2JE6I 1Y1WB 1PZID 2EDGA 1B44D 3I2ZA 3TBIB 2XIWA 4CDFC 1BOSA 1KABA 2GA4B 5G3LD 4C3HB 3K58A 4KK7A 2K7VA 1GXDC 1XTCD 2R7ZB 2F0NA 2MNAA 4A3KB 2F3WA 3D6CA 1PYWD 5JEAG 3ER0A 1VS0A 4HCEA 1XPRA 2JA6B 3GTLB 4DV1L 3BYTB 3MFYA 2C5CA 1P16A 5K36G 1HR0W 4JVZA 4I7ZC 1FVIA 4A3BH 4A3EH 3CD6A 1YJWA 3MC0B 2L55A 2L4NA 2K32A 1N36Q 2Z6BA 1LABA 3J7AF 1ESFA 1VQJA 2CW0D 1CK1A 4S3SA 2WB1G 2A6HD 2NN6I 1XX8A 1G6ZA 3K80C 2F4VQ 3ULJA 3E9IA 5FKAC 1VCIA 1C7YA 2DNEA 3NP8A 4IFDH 4CKCA 3T56B 4JW0A 3M7GA 1OXTA 5EPJA 1PFMA 2B39A 1F9QA 2K01A 1WTVA 1HFGA 1UE1A 2O4XA 1G8ZD 1VQMA 2PYKA 3RR5A 5I4DA 2KENA 3CPWA 4O42A 3NWTA 5IYBG 3JC66 2NVQB 4KKSA 5IGBA 2F0OA 3EJIA 3OIQA 1D1IA 4LF4Q 4DUZL 3ONAB 5KYLA 3KOJA 2VB3X 4YWKA 1Q8KA 4A3FH 4QUFA 1L1OB 4A93H 5KNBA 1GUNA 2F0WA 1YNXA 1EY5A 1LV9A 3H15A 2E5LL 4A3CH 2JN4A 4R9WA 4RHSA 2K03A 3PIP3 2WIIB 1C0AA 4H7BA 2YV5A 3HOVB 4DR2L 4R4OA 5ELCA 5C4XG 4JI6Q 4GS3A 3ND9A 3HRZC 3I90A 2CFMA 1QVGA 4RH6A 2HQLA 2J4XA 3I70A 1H9SA 4C3JG 3J7YW 3QR8A 1FJGL 1W3SA 2A19A 5IP9H 2L9HA 1UUPA 1CA5A 2PZTA 4JI0L 3TZUA 2DGYA 1GJXA 3S1NB 1WCMB 4X66Q 1QNUA 3K5OA 5FO7B 1HNXL 3Q24A 4BY7H 1D8LA 3R2TA 4UP7A 3WWVA 4QCLA 3BZKA 4FF4A 1W6KA 4WRDA 3EA6A 5M3MH 1K0SA 3QO2A 4JI7Q 2R93H 4X62Q 1SRUA 2EY6A 2VQFQ 5CV4A 5ELOA 1PTOC 5M3FG 1GO3E 2AWOA 2R92H 4B3RQ 4B3SQ 2O5IC 3T1HL 4XYOA 3OHXC 3P7JA 5DM73 1SDFA 2F3IA 3MTSA 1L1OC 1IBLL 3PQIA 1H9KA 1V1OA 3RD4A 4UY8C 2KHSA 2NVXH 4BBSH 1X54A 4NXML 2E74C 1AFPA 2DNCA 3PMFA 3RLFA 5IYCH 1XNRQ 3S2HB 2UXCQ 3UDIA 4KD3A 2ES2A 3PIOA 4A3LG 2AQ2B 1SMXA 1SJED 3KLSA 4JPBW 2AUKA 4PMCA 4KTAA 1EIHA 1PH4A 1NBWA 3VR2A 3M85A 1SMYC 5COYA 3VYRA 2EPBA 3C3LA 2JXMB 1HA6A 3NTHA 2WKCA 3VA7A 4HJ5A 1XMOL 4NPSA 1A6XA 4KKTA 5ELDA 2Q2HA 2I5MX 3KJPA 1GKHA 5FLXE 4V190 1X3GA 4FF3A 4X6AH 3K7AB 2PMZE 4HMJA 4DV2L 5I6WA 2KHIA 2BDOA 3HKZG 4R4TA 2H5XA 1G51A 2K6AA 2HIXA 1RDPD 2FMCA 4KKUA 2NN6G 4ZAIA 2PNRC 4K14A 3U9OA 3GTQB 1YNJD 5JJZA 1VQBA 3CRLC 3UDFA 4QJFA 1LUZA 4CDDC 1OTCA 1QZGA 3HFZB 2JQOA 1Z47A 3DHQA 3S9WA 3S14B 2A68C 1A62A 2K05A 4DK1A 1BVSA 4RCNA 1XXGA 5F2DA 1X3FA 1Q86C 3I4LA 1YI2A 3NBHB 3FRPB 5EKLA 4FDBA 2L12A 2RDFA 3RLOA 2QILA 1U0LA 3OIPA 4GKKL 1HJPA 3A74A 1CQVA 1QZHA 2EYPA 1E3PA 4LW1A 3ZJYC 4L5RC 1PZKD 2YYZA 1A3VA 4GLXA 5FLXc 4DV1Q 1SN8A 1P8LA 3SK5A 3T1YL 3BG3A 3P1HA 1K8GA 2KHJA 3I4NH 4TSSA 5A2QL 3HOWG 5IT9E 1AP0A 1GUOA 1VQDA 2VZAA 3NBHA 1JE5A 5H1SE 3TP8A 1Q90A 1QWYA 1VQ5A 3NENA 1VQ4A 1FNWA 3TS2A 4ZUJA 3BVMA 1SFOB 3BZCA 1NY4A 2NWGA 2ZT9C 1CHQD 4EQPA 3HOUH 5CGKA 1TY0A 3GTMB 2F0EA 4A3GH 1B9NA 3FKIB 2HT1A 5IGGA 3K5NA 1SYBA 2B63G 2Y0SE 1EWIA 4JBKA 3VYTA 4CKEA 3S17H 1N8RC 2PW5A 1VQCA 3V05A 5LMUL 1EYDA 4DAPA 4J8QA 4RGMA 1Q3LA 1I94L 3L2PA 2IW3A 1TWGB 1F2LA 3L7ZC 1Y8NB 1BBXC 1KLGD 3F8TA 1JB3A 5EBCA 4DUZQ 4IOCA 2NZHA 4G7HC 4R4IA 3NELA 1OXUA 1A8VA 3U9SA 4A3IB 2KQ3A 2B2YA 1EOVA 2B2VC 5C3WA 5IT9c 4A3DG 1JWMD 3PV0A 4YCUA 3UI2A 1Y1VH 4POFA 1YBYA 2AHOB 1AZQA 5EQ0A 2VB2X 4DN4M 3HOYB 2HDLA 2AQ1B 1NCVA 3AMUA 4HTHA 3KUPA 4HIMA 1JT8A 1FYCA 2FINB 3MXPA 1KQSA 1EY7A 4X3SA 1IKLA 3WDNA 4KN4C 2OCEA 4PV1C 2RA4A 2M2LA 2VUMG 1CT1D 5JEAJ 5JVG3 1E2VA 4IPGA 2GVBA 1XJVA 3OPOA 1FJGQ 4OWWB 3ZYYX 5TSSA 5HGTA 4IUVA 1MD2D 1S5ED 4JI0Q 2CW0C 4CDEC 2A6HC 2UU9L 2E2IH 1F9PA 2UUBL 2RF4A 1HNXQ 4U673 4LNQA 1JC7A 2ZXOA 3KBGA 1M4VA 1KAWA 5KRUA 2E2JH 4DR4L 1NTGA 2MGSA 1MJEA 3HOZH 1JCKB 2EYLA 3HKSA 4L5QA 1U4LA 4YWLA 1EL0A 2PQAA 3HOXG 4HIDA 4A4IA 4IPCA 4DV4L 3RLNA 3SXHA 4LAAA 3J80L 5ISRA 1Y1WG 3PO3H 4AYBE 3T1HQ 5CR3A 2N78A 1EYCA 1O80A 5EBDA 3H09A 5JPMC 4C3HG 1IBLQ 4IALA 1PRTD 1IBML 2R7ZG 3T16A 4NXMQ 1VMCA 4A3KG 4QGUA 3NBIA 1CSQA 4RCOA 1IBKQ 2JA6G 5C4JB 4C2MH 4P75A 4DPGA 4LF8L 2J0TD 2KJXA 1EY8A 4DXFA 2C9OA 5CV9A 1TVXA 2JSOA 4WFN3 3GTGB 2R3ZA 3KDFB 4XTCS 3X3NA 1S3OA 2EY1A 1NR4A 3MZ5A 1C8CA 2WB1E 2SOBA 3E0JA 4DR5Q 1XMOQ 2F0HA 5GADC 4UPAA 3GTOB 2DJFC 1SMYD 4L5TA 1PTOF 4HR7B 2XSCA 1N32L 1I4XA 2NVTH 3C1FA 2KEEA 4DV2Q 4HJ7A 3H3VC 4OWXB 3AQQA 1JOOA 3CF5A 1HUNA 2K14A 4PQXA 1VQ6A 2BOSA 4M1UB 1FD7D 3BDOA 4FNFA 2AMCB 4GLAC 4DAYA 3U58A 1VQ9A 1NAPA 3F2UA 1K9MC 1PLFA 1TWCH 1MSGA 5EJWA 3A8KE 4LF6L 4DK6C 1WD1A 2Q8RE 2HD3A 4GOPB 2K33A 4YCVA 4G57A 3PIO3 1EY0A 3CC7A 2YU9B 3TMEA 1NUCA 4KY6A 3M7NA 1VMPA 3VR6A 4QB4A 3ERQA 2B63B 2QEXA 5LHY1 2ZJRA 3NTKA 4EGVA 3UE1A 1H9RA 3N6RA 2B3GA 4M8AA 1W2BA 3HOVG 5KEEA 2NVYH 1UAPA 1PXUA 4J6HA 1F77A 2NZ1D 3R93A 5D14A 4JI1L 4OX9L 1JOKA 2PI2A 4C56C 2M9VA 3DWPA 3MVVA 2IHEA 3T1YQ 1QVFA 3STBD 2J7ZA 4B9WA 5M5YH 3NQTA 3BVGA 1ET9A 3RZDB 1S40A 2CH4W 5JOBA 4XXEA 5CORA 3OSOA 4NP5A 5EAYA 3TSSA 1V9PA 3CCRA 3K57A 1NSNS 1TWFH 4BA2I 1L0YB 1WCMG 2Z6KC 1VQGA 1K0RA 1O78A 5ELNA 4KI0A 2F0FA 3V2TA 1Q46A 3DWAA 1J6QA 1V8QA 3S1QH 3KF6B 4BY1H 5FK9C 3GQBA 3FP9A 2PZUA 2NBFA 1CHPD 1SJHD 1TY2A 1STAA 2K5WA 5DLQE 4TQUS 1KXLA 2K1BA 1J5EL 1EEID 2E76C 1R9TH 1B3AA 2FJ2A 3MXNB 5LMUQ 2RQXA 2F0LA 1X3QA 3C46A 1IL2A 1LTGD 4GOPC 4G4KA 4KV6A 5C44H 5LMNQ 4GN3B 3RUZA 2ASBA 2ZTCA 2ZXRA 3PO2G 3L3OC 2Z4IA 2EY5A 3E6ZX 1YNJC 4F88A 5BR8L 4GKJL 2A1AA 3K59A 1WTOA 4LF7Q 5E4XA 1V1PA 2PPBC 1I4PA 1VQNA 5DEHA 2VQEL 2IX1A 4FXGC 1SE8A 2BCOA 4OGQC 1K83H 2MUYA 3K7UC 1D2BA 2KA7A 4IJLA 2LKVA 4OHJA 4JI5L 1E1OA 4P74A 4CDCC 1EUJA 1NNXA 3S2DH 1SYFA 4C3IB 4IOAA 2F0PA 4C3HH 3OMGA 4ILWA 1SXTA 2R7ZH 3S24A 3F2BA 2N8NA 2LY7A 4A3KH 1UWVA 3DEPA 3KJOA 2HQEA 5C3EH 3E5SA 1KTKA 4F87A 3M4QA 4UP9A 1STGA 3Q8DA 4H44C 2UU9Q 1CM9A 4Y7NH 1U4PA 2UUBQ 1VQ7A 4BXXG 2VL6A 3NUCA 3AYHB 1JJGA 1GVPA 1YNND 1HNZL 4DR4Q 3H6MA 4LFAL 5GAEC 2CQAA 1B1ZA 3H91A 5G3LF 4KJOA 4DV7Q 3GTKB 2EJMA 4ABNA 1HPCA 3JAML 4A3EB 1QILA 3DM3A 1RTNA 4NW2A 4OONA 3DMUA 3U50C 1Q81C 3W2DA 2RBMA 4ZYSA 3J81j 2OWOA 2JA8H 4A3MG 5C4HA 3AU7A 2EXZA 1BDOA 1HHVA 1BF4A 4NXNL 1IBMQ 5JJIA 3QB3A 5HURA 2F03A 1PRTB 1IYVA 3KF8B 2R6GA 1PTOH 1EQQA 1E2ZA 4LF8Q 2WINB 2WV6D 4F7XA 5AFWA 2G9HD 1LACA 1VQEA 2BA1A 3J81L 1IZ6A 1G291 4JBWA 4FP5D 1KIXA 4B3ML 3I91A 1Y69U 1CKMA 2CWPA 2LSSA 5J39A 2EXDA 4OO1I 4K5WA 4CKBA 1PFNA 3HS0C 4A3FB 1N32Q 4DV6L 2QDLA 3PUYA 1L1OA 3FKIG 2G9DA 1AH9A 3EROA 1AZPA 1KAAA 1QCBD 2A69C 1G91A 3MEHA 1B2TA 4DR6L 2F0UA 4LWCA 1SNMA 3I4OA 5FLMG 4JOIC 2ZM6L 2RCNA 2ALYB 1IHZA 4KY7A 1XPOA 4IUTA 3KLWA 1S5FD 2Z4HA 3I55A 4JC0A 3I72A 4B3TL 5DNFA 1SEBD 5AJ3L 3GO5A 5JJKA 1N33L 1O7IA 1AW7A 4LF6Q 2QGQA 2TMPA 1WCMH 3KLSX 3CAMA 3CQZH 2OEOA 4A3IG 5CV8A 2Z0SA 1AE2A 1DM0B 1SROA 3J81E 4POGA 3U4VA 2RDGA 1PHJA 2O5JC 3H94A 4EQOA 2DJGC 4QIWB 1PRTC 4JK1C 1W6JA 4MHEA 2ID0A 3HOYG 4BY7B 1ILQA 1II3A 1S5DD 4H0LC 1NR2A 2DY7A 4ZK9B 1LT5D 3PO2B 1KDAA 2NUCA 4BBRH 3D8GA 1KDCA 1TWHB 4OX9Q 1NMGA 4PMBA 1IYJB 2NTSA 2NB0A 4KY5A 3AEVA 4UP8A 1OXVA 4ZUIA 4JV5Q 2Q2UA 2OTJA 3LNNA 5NUCA 5LMNW 4IZ8A 2Q8IB 5E7NA 1ILPA 1GHKA 1KL9A 3BDCA 1A2UA 2Q2TA 3BS1A 1LTTD 1TKWB 5FJ8H 5IYDH 2JA5G 3PUWA 1XNQL 4FF1A 5FO8B 3VR4A 1HR0L 1B4OA 1MGSA 4BBSB 2DY8A 4EQ5A 1PA6A 4R4QA 4WJWA 4K0KL 1GUTA 1WTXA 2K5VA 1F2YA 5IGDA 4AQYL 3ERSX 4KHZA 1ICFB 2F0KA 4B08A 1I3QH 3F1ZA 1PV4A 1FGUA 2SDFA 5EPKA 2N3SA 4EVOA 3BJUA 5JEAH 4X64L 2MQHA 2V1CC 4XQNA 2UUCL 4ALPA 2D62A 1A63A 3K81C 1EWCA 2FMMA 4NMZA 5K36H 4AYBB 1JOQA 3GD7A 2UUAL 5BR8Q 4GKJQ 5HY6A 4TKOB 1TQOA 1KNAA 1F9SA 1LO5D 3I3CA 4IUNA 4U68A 1HZAA 1Z7TA 1F2MA 2VQEQ 2HDMA 4DV0Q 3RZOH 5CV6A 3M4OH 2JA7B 3R3OA 3GV6A 1X32A 1T5EA 2EYMA 5EKKA 1F2ZA 3C1EA 2E2HH 2OQKA 2VXWA 4DNTB 2IY5B 1WFQA 3EIVA 4OELB 1QB5D 3AFPA 4MNOA 4A3MB 3CCVA 1T9HA 2IPKD 4O1NA 2XN9C 3STBC 1DOKA 4CBVA 3PUVA 1Q1BA 5KYIA 3DUZA 5HGQA 1PH5A 1QUQB 1BCPF 3QOJA 3MA2B 4CJ2C 1T5XD 4PZ7A 5IYBH 3R8BA 3ND8A 4N9PA 4OIJA 1XMQL 1WOCA 4AIMA 2P5ZX 1WTRA 2GN5A 1LLRD 2UXBL 3D6WA 2KVMA 5J3BA 1A3UA 2B2UC 4DR7L 1YHAA 3T13A 2B2VA 2A6ED 1A0IA 1SE4A 1HZ9A 2IWHA 1I5FA 1HNZQ 4IFDI 1GUWA 1EQTA 4LFAQ 3CC2A 5IIFA 1QJOA 4RHRA 4TRDA 1R4PB 5J22A 3QJYA 4OO1G 3QG1A 1ZEQX 3DM1A 4GNXB 1R4QB 1Z6HA 3D31A 5C4XH 3FKIH 2EYOA 1UE6A 1J9OA 4A3JG 5I9PA 3SVMA 2A8VA 4HSPA 5T1IA 3VR3A 5FLMH 5GQOA 2EJGC 4C3JH 3NQIA 1PMRA 1EYAA 3EN2A 4IUUA 3HOUB 2O2LD 4A3GB 4HN7A 4P71A 2EE1A 1E7ZA 4GZYC 2BE5D 3S1RH 2FFKB 4R8NA 2AWNA 1L2FA 5IP7G 3EVQA 1HTLD 5A2QE 1SSOA 4HJ8A 3A5ZB 4HIKA 4A76A 2A73B 4RMFA 1M90C 5M5XH 3J7A5 4H02A 2GVAA 3UDXA 2E5LQ 4B3MQ 2FHTA 2MFIA 5T1GA 4RAUC 1KRSA 3KLRA 5A35A 1LT6D 2CHBD 5K5PA 1VQPA 3BZDB 3G6EA 1JJ2A 4DR2Q 1I6VC 1BBWA 2WAQE 5LL6X 5M3FH 1SE3A 1PYBA 3QOLA 5EPLA 4PZ6A 3CCEA 3S15H 4DV6Q 2X69A 1LM0A 4CJ1B 1EY4A 4DR6Q 1EOTA 2RSNA 2ZM6Q 4DV3L 4DFAA 1STNA 2YTVA 1Y1VB 2DN8A 3CP0A 3TP5A 1PFBA 1EEFD 3T51B 4Y52H 2A69D 4LFCL 2HIVA 3TREA 1SNCA 4A3LH 5AJ3Q 1YNNC 3LX0A 1TT2A 2MPMA 4GNXC 2JA5B 2PQEA 1TWAH 4L8JA 4P72A 3I4MB 4DAMA 2K5HA 3H3VH 4DA2A 1PH2A 4PNYA 2OT2A 4X3KA 3SK6A 4K6DA 4OXPA 3BU2A 1WYDA 1YZ6A 4HIOA 5C0XG 3K5LA 1KC8C 3SDZA 1BQQT 5CYUA 2E2IB 3PCOB 1PH3A 4IJHA 3IL8A 1WI5A 2KBNA 2ZXPA 1N36L 4C3IG 4Q5VA 3HOZB 1MSHA 5C5MA 3GDEA 3J81i 5CV7A 4O0AA 4KJNA 1PDQA 2F4VL 2RKSA 1O7LA 3UE0A 3TRZA 1VQOA 1CI3M 4MTKA 1EYGA 1TS3A 1PFSA 5IOCA 4FXKC 4MZ9A 3S1MH 2B8FA 2B2WC 2EJFC 2NN6H 2X6GA 4DUYL 1GM5A 1H95A 3V96A 4FO2A 1UEBA 4C1NI 3D0FA 2KECA 1IW7D 4C1NK 1QE6A 2F0MA 3O13A 1I50B 3TQYA 2MHVA 2KCTA 3IKJA 1HUMA 1HNWL 4K0KQ 1I6HH 2C35B 3GTOH 1IXRA 3CW2C 4C2MB 1PRTF 2QA4A 5IWAL 1TIID 4A3BG 4A3EG 2CWAA 3RN2A 2EY2A 4EQNA 2Z1CA 3KDFA 3J80E 2I0QA 2Q2IA 2L0CA 4X64Q 4R1JA 4HCSA 4EX5A 2IX3A 1WTWA 1Q1EA 3HOWH 1X56A 4XIGS 5I2XA 4JG2A 4HAEA 3K6OA 4ID6A 3K5MA 3EBEA 1GHJA 1YVCA 2Z6KA 3GTPH 4IQZA 4IFDG 1Y14B 1MHWC 1Q12A 4DGZA 3Q23A 1JB7A 4JI6L 2QDBA 5I9OA 4TVAB 3MXUA 4IURA 2L11A 1EU4A 2MO0A 3A54A 2KCMA 3TZDA 2BA0A 3PUXA 2ZJQA 2EYJA 4CHTB 3OYYA 2M00A 1NE3A 1EIYB 1FNVA 3H0GB 2B63H 1TWCB 4A3JB 1MIUA 1ZYRD 4UDUC 1L0XB 3GTJH 4X66L 4JBJA 3HEJA 4GOPA 4KHVA 4GKKQ 2XRQD 1QOHA 3HZXA 4KLKA 3TEHB 4A3FG 2NTTA 4A93G 3KK7A 3G48A 4P2CB 5DM63 2EQSA 3SHLA 3A0JA 2L5TA 4GN5A 1XMQQ 4A3CG 3L9AX 2SNSA 1STEA 1DOLA 2UXBQ 3M3YH 2JA9A 1SYEA 2B2TA 3M9BA 3W1GA 1HCZA 2VQFL 3BDLA 4FXDA 1RIPA 3L0OA 3KBXA 2IX0A 4A3DH 3S16H 2K04A 3ICEA 2E2DC 2F0GA 4LK1C 3C2PA 1Q8IA 5M5YB 3J7AV 1HXYD 1B9MA 3J7ZC 2HCCA 2HHHL 1H9JA
chains in the Genus database with same CATH topology
1OTCA 2UXCL 1HH2P 1CKMA 2FXQA 1QZGA 1OXSC 2CWPA 3HFZB 2JQOA 1Z47A 1A62A 1B8AA 3PIPA 1BVSA 2LSSA 4LF9L 2EXDA 1B7YB 4OO1I 3CCUA 1N9WA 2VUMH 1YEZA 1X3FA 4IPHA 3CMEA 3PUYA 1L1OA 3FKIG 4LUZA 3CXCA 1KHIA 4DV6L 4DV7L 1CKNB 1YI2A 4BY7G 5JJLA 5M5WH 3NBHB 2ATWA 4FDBA 4DR6L 1PH7A 2XGTA 4LWCA 1D7QA 4ME3A 3I4OA 3KF6A 4JOIC 3RLOA 5FLMG 1U0LA 2RCNA 2ZM6L 2ALYB 1M1KC 4GKKL 4QY7A 1HJPA 3A74A 1XPOA 2IT1A 5C4JH 3F2DA 3KLWA 1QZHA 1E3PA 2R93G 2AKWB 4LW1A 3ZJYC 4DK3C 4L5RC 4PG3A 1YHBA 3I55A 2K5NA 4BY7H 2YYZA 1HZCA 1VQFA 1XNQQ 4JC0A 4GLXA 4B3TL 2IHFA 5FLXc 1V1QA 4DV1Q 1HR0Q 1SN8A 1I50H 1P8LA 3GO5A 4OWTB 5AJ3L 3T1YL 2KHJA 1O7IA 3CMAA 1K8GA 2QGQA 2R7FA 4LF6Q 3HOWG 3I4NH 4LFBL 4JCVE 1VQDA 2VZAA 1WCMH 4JBMA 1JE5A 5H1SE 2ZJPA 3CAMA 3CQZH 3KYHC 5C3EG 4PZ8A 5GROA 2I5HA 3RNUA 1VQ5A 3HOXH 3NENA 1VQ4A 2BH2A 4LF4L 4AQYQ 1YJNA 4A3IG 2WP8J 3NEMA 3TS2A 4BBSG 2Z0SA 1AE2A 1SROA 1UE7A 1Y1WH 4IO9A 5IYCG 4POGA 4LUOA 3BZCA 1NY4A 3U4VA 1PH6A 1PHJA 1X3EA 1SR3A 2UUCQ 3HOUH 1N34Q 4A3GH 2RHSB 4DV3Q 1PYSB 2ID0A 1GD7A 2HT1A 3HOYG 4JI4Q 2B63G 2Y0SE 1EWIA 1MKHA 3E9HA 4JBKA 3S17H 2UUAQ 1N8RC 4BBRH 4DAYB 1VQCA 4OX9Q 5LMUL 3GTLH 1NMGA 3HKZE 2JA6H 1IYJB 1I94L 5GAGC 1MJCA 4DV5Q 3L2PA 3VDYA 3AEVA 4UP8A 1TXYA 1OXVA 4AYBG 2XTIA 3L7ZC 3CCMA 4JV5Q 4GLVB 3CC4A 4DR3L 2Q2UA 2OTJA 1RL2A 2JA8G 4NB3A 4P73A 5LMNW 2YU9H 3F8TA 2R7DA 4O2DA 5E7NA 1KL9A 2Q2TA 4DKAC 4IOCA 4DUZQ 2K50A 2NZHA 5FJ8H 5IYDH 4MTNA 4YCWA 2CKZB 4A75A 1LTLA 2JA5G 2JA7G 3PUWA 1XNQL 4R4IA 3NELA 1OXUA 1A8VA 2K52A 2MO1A 3AFQA 3FHWA 1E22A 3H0GH 1HR0L 1N33L 2VNUD 2K4KA 4A3JH 3GTKH 1C9OA 1EOVA 5IT9c 4EQ5A 4DV4Q 4A3DG 1BKBA 1PA6A 1VQLA 4R4QA 4KHPQ 3PV0A 4K0KL 4JOIA 2K5VA 4YCUA 1Y1VH 1NMFA 3CCSA 4AQYL 3W1BA 3ERSX 4KHZA 4POFA 2OTLA 1YBYA 3U4ZA 2AHOB 1PH8A 1I3QH 3F1ZA 1B70B 1FGUA 5GAHC 1PV4A 4JI7L 2BH8A 2Y0SG 4HIMA 1JT8A 4BA1I 5IP7H 2N3SA 4X62L 3BJUA 4X64L 3J80c 2MQHA 2OQ0A 2V1CC 1YJ9A 3RZDH 1KQSA 3GTGH 4DR7Q 4ALPA 2D62A 2OCEA 3W5OA 1A63A 3K81C 1VQAA 2NVQH 4DUYQ 1YIJA 2VUMG 4B3RL 5JEAJ 1K3RA 4B3SL 4WJ3M 4IPGA 2GVBA 3GD7A 1XJVA 1X9NA 4JI2Q 2UUAL 5BR8Q 4OWWB 5HY6A 1FJGQ 4GKJQ 4YY3L 2K75A 2I5LX 1X65A 1KRTA 4GN4B 4YHHQ 1HZAA 1ASYA 2VQEQ 2L15A 3G4SA 4JI0Q 2RHQB 4DV0Q 3RZOH 2UXDL 1CUKA 3PUZA 4LUVA 4DR1L 3M4OH 2UU9L 4JV5L 2E2IH 2UUBL 2RF4A 5IP9G 1HNXQ 1XNRL 4JYAL 1HNWQ 4LNQA 4AH6A 2E2HH 1KAWA 2E2JH 2OQKA 5IWAQ 3ULPA 1S72A 1UE5A 3I4NG 4DR4L 1NTGA 2CCZA 1MJEA 3HOVH 3MEFA 3HOZH 2IY5B 1EFWA 1WFQA 3EIVA 1AH9A 3AFPA 3HKSA 4L5QA 2PI2E 4MNOA 4YWLA 1HZBA 2PQAA 3KFUA 3HOXG 3CCVA 4HIDA 1T9HA 4A4IA 3SGIA 5IE8A 4IPCA 3K8AA 3RLNA 4DV4L 5M3MG 1VQHA 2WAQG 3E0EA 3STBC 1Y1WG 3PO3H 3PUVA 1Q1BA 1I94Q 5HGQA 4AYBE 3I7FA 2PNHA 3G71A 3T1HQ 1QUQB 2N78A 1PH5A 1YITA 4PZ7A 5IYBH 3HOUG 4LF5Q 4X65Q 2VW9A 1K8AC 1IBLQ 1XMQL 1WOCA 4A3GG 4AIMA 4HJ9A 2R92G 2GN5A 4JI8L 2UXBL 1IBML 1CKNA 1CSPA 2R7ZG 3J80i 3S1NH 5J3BA 4NXMQ 3ULLA 4A3KG 1VQ8A 3OTOL 4DR7L 4QGUA 1YHAA 1X6OA 1CSQA 4BBRG 1IBKQ 3F2CA 2JA6G 1A0IA 4C2MH 1HZ9A 4P75A 4DPGA 1I5FA 1KD1C 1HNZQ 4LF8L 1NJIC 4IFDI 5C0XJ 3M4PA 4LFAQ 3CC2A 3KDFB 4XTCS 4C3IH 2JEAI 4OO1G 1S3OA 4DV0L 1WJJA 3UDGA 4GNXB 2ZTEA 5JJKA 2WB1E 3D31A 5FJ8G 5IYDG 3CCJA 2D0PA 4IPDA 2CQOA 4DR5Q 1XMOQ 5C4XH 5GADC 1DGSA 3FKIH 4UPAA 4YWMA 3TS0A 1UE6A 2D0OA 4A3JG 2A8VA 4L5TA 4JI1Q 5FLMH 4JI3Q 4LFCQ 3DLLA 3H3VI 3PO2H 2JE6I 5GQOA 3PGZA 1TWHH 3I2ZA 3LGJA 3JAMc 2NVTH 1N32L 4C3JH 3EN2A 1Y1VG 4DV2Q 1JJCB 4HJ7A 4OWXB 3AQQA 4P71A 3S2HH 1E7ZA 3CF5A 2K14A 3S1RH 2MNAA 1Q82C 1VQ6A 2JK8A 2AWNA 4QL5A 1L2FA 4RG1A 4GLAC 2AMCB 5IP7G 5JEAG 1ASZA 2E8GA 3ER0A 1VS0A 3U58A 1XPRA 1VQ9A 4DV1L 4HJ8A 3A5ZB 1K9MC 1TWCH 1XPUA 3I4MG 1P16A 1U5KA 5K36G 4LF6L 4HIKA 4A76A 4DK6C 1HR0W 1FVIA 2YTXA 4A3EH 4RMFA 4A3BH 1M90C 5M5XH 1EIFA 4H02A 4GOPB 2GVAA 3CD6A 1YJWA 3J7A5 4YCVA 3UDXA 2E5LQ 2HHHQ 4B3MQ 2MFIA 3CC7A 1IBKL 1L0WA 1N36Q 1KRSA 1K73C 3M7NA 1LYLA 1J5EQ 1VQPA 1VQJA 3G6EA 1JJ2A 2WB1G 2NN6I 5C0XI 4DR2Q 4LF9Q 1BBWA 2WAQE 3K80C 5M3FH 3J81c 1PYBA 2QEXA 3ULJA 4PZ6A 3CCEA 2F4VQ 3S15H 4DV6Q 2ZJRA 3E9IA 1VCIA 3UE1A 1C7YA 1LM0A 3K7AH 2B3GA 1N34L 4DR6Q 4DV3L 1W2BA 2ZM6Q 3HOVG 3HOZG 4DR5L 1X55A 2NVYH 2YTVA 4JI4L 1OXTA 3CP0A 4IFDJ 3IRBA 4Y52H 4BXXH 1UE1A 4LFCL 4JI1L 1VQMA 4OX9L 2HIVA 3TREA 2PI2A 4PMWA 3RR5A 2IHEA 4A3LH 5AJ3Q 4DV5L 3T1YQ 1QVFA 3STBD 4GNXC 5M5YH 3PO3G 5IY0A 2KENA 1TWAH 4P72A 2JA7H 3GTQH 4LFBQ 1S40A 3CPWA 4DAMA 2K5HA 3JC66 5IYBG 3H3VH 1PH2A 5EAYA 4JI5Q 3S14H 1V9PA 3CCRA 4LF4Q 4DUZL 1TWFH 4BA2I 1WCMG 2Z6KC 1VQGA 4OXPA 3BU2A 1K0RA 3KOJA 2LXJA 4YWKA 1Q8KA 1WYDA 5ELNA 4A3FH 1L1OB 1YZ6A 4KI0A 4HIOA 4A93H 1E1TA 1G6PA 1Q46A 5C0XG 1KC8C 1J6QA 4A3MH 1YHQA 1YNXA 3PCOB 1PH3A 3KF6B 3S1QH 1V43A 2LXKA 3H15A 2E5LL 4BY1H 1N32Q 4IJHA 4A3CH 3FP9A 1WI5A 5DLQE 2KBNA 1N36L 1KXLA 4TQUS 1QVCA 1J5EL 1C0AA 1R9TH 2YV5A 3MXNB 3GDEA 4DR2L 4R4OA 3J81i 4O0AA 5LMUQ 2F4VL 5C4XG 1IL2A 4JI6Q 2EIFA 3UE0A 3TRZA 4GOPC 1VQOA 3CCLA 4GS3A 1OXXK 1EYGA 4KHPL 5C44H 1PFSA 2DUDA 4MZ9A 4GN3B 5LMNQ 4DR3Q 2ASBA 3S1MH 2ZTCA 2CFMA 3PO2G 1QVGA 4DUYL 2HQLA 1GM5A 1H95A 1UEBA 4JI2L 5BR8L 1FJGL 1QUQA 1W3SA 2A1AA 2A19A 4GKJL 5IP9H 3D0FA 4LF7Q 1SLJA 4YHHL 1SFOH 1VQNA 3TQYA 2VQEL 4JI0L 2IX1A 2DGYA 2KCTA 4WJ4A 1JMCA 1SE8A 4X66Q 1K83H 2WFWA 1CKOA 3GTMH 3K7UC 1HNXL 1VQIA 1HNWL 4IJLA 4K0KQ 1I6HH 2C35B 1D8LA 3H0GG 4UP7A 1IXRA 3CW2C 3WWVA 3GTOH 3BZKA 4JI5L 2QA4A 1E1OA 5IWAL 4P74A 4A3BG 4A3EG 5M3MH 4DNIA 2CWAA 3RN2A 1EUJA 4QQBX 3S2DH 3I56A 3K0XA 4JI7Q 2R93H 3KDFA 4IOAA 4NXNQ 1TWGH 1Q86C 2I0QA 1Z9FA 2Q2IA 1SRUA 4X62Q 4X64Q 4GNXA 2VY3A 4R1JA 1FL0A 4C3HH 4EX5A 2VQFQ 5ELOA 1Q7YC 1VQKA 1Q1EA 5M3FG 1GO3E 2AWOA 2N49A 2R92H 4B3RQ 3HOWH 1X56A 4L5SA 4B3SQ 2R7ZH 3S24A 4XIGS 2N8NA 3F2BA 3T1HL 4A3KH 1E24A 1UWVA 4JG2A 4APVA 2F3IA 1AE3A 4YY3Q 3KJOA 3PF5A 5C3EH 1L1OC 4X65L 1PH1A 1IBLL 3EBEA 4LF5L 2Z6KA 1YVCA 3GTPH 4IFDG 1EQRA 1Y14B 1Q12A 3M4QA 4UP9A 4A3IH 3OW2A 4UY8C 1JB7A 2NVXH 4JI6L 4BBSH 2UXDQ 1X54A 3Q8DA 4DR1Q 4TVAB 4NXML 2YTYA 2UU9Q 3RLFA 5LMNL 4Y7NH 5IYCH 2UUBQ 1VQ7A 4JYAQ 2MO0A 1XNRQ 4BXXG 2UXCQ 2VL6A 3UDIA 1PVOA 2KCMA 2ES2A 3PIOA 2BA0A 3AYHB 2F52A 3PUXA 2ZJQA 4A3LG 1JJGA 1SMXA 1GVPA 1HNZL 1BBUA 4DR4Q 3OYYA 4LFAL 1NE3A 5GAEC 4LF7L 3HOYH 1EIYB 4J15A 2B63H 2B29A 1PH4A 4DV7Q 1MIUA 1NBWA 3M85A 3RN5A 3GTJH 3DM3A 4JBJA 4X66L 4GOPA 4GKKQ 4HJ5A 1XMOL 4NPSA 4OONA 4QIWE 3PF4A 2UUCL 3U50C 3B6YA 4KLKA 3TEHB 3CPFA 1Q81C 4A3FG 4A93G 3J81j 2OWOA 2JA8H 4A3MG 2Q2HA 3G48A 2I5MX 4R4CA 4JI3L 1GKHA 3A5UA 3KJPA 2EQSA 3JAMi 3A0JA 4B3TQ 4BY1G 4GN5A 1XMQQ 1X3GA 4A3CG 1N33Q 4X6AH 4NXNL 2NZOA 2PMZE 4JI8Q 1IBMQ 3M3YH 2UXBQ 4DV2L 2JA5H 2JA9A 5JJIA 3M9BA 3OTOQ 4HJAA 3W1GA 2KHIA 3I4MH 2VQFL 3HKZG 1RIPA 4R4TA 3L0OA 2H5XA 3KF8B 2R6GA 1XTDA 1G51A 2IX0A 1EQQA 4A3DH 3S16H 4LF8Q 2HIXA 5C44G 3ICEA 2VS1A 1VQEA 2NN6G 2PQAB 3PSIA 2BA1A 2JEBI 1IZ6A 1G291 2ZTDA 1PH9A 4JBWA 2JJQA 3J7ZC 3CCQA 1VQBA 1KIXA 2HHHL 4B3ML 3UDFA 4QJFA 1LUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTC A;  2UXC L;  1HH2 P;  1CKM A;  2FXQ A;  1QZG A;  1OXS C;  2CWP A;  3HFZ B;  2JQO A;  1Z47 A;  1A62 A;  1B8A A;  3PIP A;  1BVS A;  2LSS A;  4LF9 L;  2EXD A;  1B7Y B;  4OO1 I;  3CCU A;  1N9W A;  2VUM H;  1YEZ A;  1X3F A;  4IPH A;  3CME A;  3PUY A;  1L1O A;  3FKI G;  4LUZ A;  3CXC A;  1KHI A;  4DV6 L;  4DV7 L;  1CKN B;  1YI2 A;  4BY7 G;  5JJL A;  5M5W H;  3NBH B;  2ATW A;  4FDB A;  4DR6 L;  1PH7 A;  2XGT A;  4LWC A;  1D7Q A;  4ME3 A;  3I4O A;  3KF6 A;  4JOI C;  3RLO A;  5FLM G;  1U0L A;  2RCN A;  2ZM6 L;  2ALY B;  1M1K C;  4GKK L;  4QY7 A;  1HJP A;  3A74 A;  1XPO A;  2IT1 A;  5C4J H;  3F2D A;  3KLW A;  1QZH A;  1E3P A;  2R93 G;  2AKW B;  4LW1 A;  3ZJY C;  4DK3 C;  4L5R C;  4PG3 A;  1YHB A;  3I55 A;  2K5N A;  4BY7 H;  2YYZ A;  1HZC A;  1VQF A;  1XNQ Q;  4JC0 A;  4GLX A;  4B3T L;  2IHF A;  5FLX c;  1V1Q A;  4DV1 Q;  1HR0 Q;  1SN8 A;  1I50 H;  1P8L A;  3GO5 A;  4OWT B;  5AJ3 L;  3T1Y L;  2KHJ A;  1O7I A;  3CMA A;  1K8G A;  2QGQ A;  2R7F A;  4LF6 Q;  3HOW G;  3I4N H;  4LFB L;  4JCV E;  1VQD A;  2VZA A;  1WCM H;  4JBM A;  1JE5 A;  5H1S E;  2ZJP A;  3CAM A;  3CQZ H;  3KYH C;  5C3E G;  4PZ8 A;  5GRO A;  2I5H A;  3RNU A;  1VQ5 A;  3HOX H;  3NEN A;  1VQ4 A;  2BH2 A;  4LF4 L;  4AQY Q;  1YJN A;  4A3I G;  2WP8 J;  3NEM A;  3TS2 A;  4BBS G;  2Z0S A;  1AE2 A;  1SRO A;  1UE7 A;  1Y1W H;  4IO9 A;  5IYC G;  4POG A;  4LUO A;  3BZC A;  1NY4 A;  3U4V A;  1PH6 A;  1PHJ A;  1X3E A;  1SR3 A;  2UUC Q;  3HOU H;  1N34 Q;  4A3G H;  2RHS B;  4DV3 Q;  1PYS B;  2ID0 A;  1GD7 A;  2HT1 A;  3HOY G;  4JI4 Q;  2B63 G;  2Y0S E;  1EWI A;  1MKH A;  3E9H A;  4JBK A;  3S17 H;  2UUA Q;  1N8R C;  4BBR H;  4DAY B;  1VQC A;  4OX9 Q;  5LMU L;  3GTL H;  1NMG A;  3HKZ E;  2JA6 H;  1IYJ B;  1I94 L;  5GAG C;  1MJC A;  4DV5 Q;  3L2P A;  3VDY A;  3AEV A;  4UP8 A;  1TXY A;  1OXV A;  4AYB G;  2XTI A;  3L7Z C;  3CCM A;  4JV5 Q;  4GLV B;  3CC4 A;  4DR3 L;  2Q2U A;  2OTJ A;  1RL2 A;  2JA8 G;  4NB3 A;  4P73 A;  5LMN W;  2YU9 H;  3F8T A;  2R7D A;  4O2D A;  5E7N A;  1KL9 A;  2Q2T A;  4DKA C;  4IOC A;  4DUZ Q;  2K50 A;  2NZH A;  5FJ8 H;  5IYD H;  4MTN A;  4YCW A;  2CKZ B;  4A75 A;  1LTL A;  2JA5 G;  2JA7 G;  3PUW A;  1XNQ L;  4R4I A;  3NEL A;  1OXU A;  1A8V A;  2K52 A;  2MO1 A;  3AFQ A;  3FHW A;  1E22 A;  3H0G H;  1HR0 L;  1N33 L;  2VNU D;  2K4K A;  4A3J H;  3GTK H;  1C9O A;  1EOV A;  5IT9 c;  4EQ5 A;  4DV4 Q;  4A3D G;  1BKB A;  1PA6 A;  1VQL A;  4R4Q A;  4KHP Q;  3PV0 A;  4K0K L;  4JOI A;  2K5V A;  4YCU A;  1Y1V H;  1NMF A;  3CCS A;  4AQY L;  3W1B A;  3ERS X;  4KHZ A;  4POF A;  2OTL A;  1YBY A;  3U4Z A;  2AHO B;  1PH8 A;  1I3Q H;  3F1Z A;  1B70 B;  1FGU A;  5GAH C;  1PV4 A;  4JI7 L;  2BH8 A;  2Y0S G;  4HIM A;  1JT8 A;  4BA1 I;  5IP7 H;  2N3S A;  4X62 L;  3BJU A;  4X64 L;  3J80 c;  2MQH A;  2OQ0 A;  2V1C C;  1YJ9 A;  3RZD H;  1KQS A;  3GTG H;  4DR7 Q;  4ALP A;  2D62 A;  2OCE A;  3W5O A;  1A63 A;  3K81 C;  1VQA A;  2NVQ H;  4DUY Q;  1YIJ A;  2VUM G;  4B3R L;  5JEA J;  1K3R A;  4B3S L;  4WJ3 M;  4IPG A;  2GVB A;  3GD7 A;  1XJV A;  1X9N A;  4JI2 Q;  2UUA L;  5BR8 Q;  4OWW B;  5HY6 A;  1FJG Q;  4GKJ Q;  4YY3 L;  2K75 A;  2I5L X;  1X65 A;  1KRT A;  4GN4 B;  4YHH Q;  1HZA A;  1ASY A;  2VQE Q;  2L15 A;  3G4S A;  4JI0 Q;  2RHQ B;  4DV0 Q;  3RZO H;  2UXD L;  1CUK A;  3PUZ A;  4LUV A;  4DR1 L;  3M4O H;  2UU9 L;  4JV5 L;  2E2I H;  2UUB L;  2RF4 A;  5IP9 G;  1HNX Q;  1XNR L;  4JYA L;  1HNW Q;  4LNQ A;  4AH6 A;  2E2H H;  1KAW A;  2E2J H;  2OQK A;  5IWA Q;  3ULP A;  1S72 A;  1UE5 A;  3I4N G;  4DR4 L;  1NTG A;  2CCZ A;  1MJE A;  3HOV H;  3MEF A;  3HOZ H;  2IY5 B;  1EFW A;  1WFQ A;  3EIV A;  1AH9 A;  3AFP A;  3HKS A;  4L5Q A;  2PI2 E;  4MNO A;  4YWL A;  1HZB A;  2PQA A;  3KFU A;  3HOX G;  3CCV A;  4HID A;  1T9H A;  4A4I A;  3SGI A;  5IE8 A;  4IPC A;  3K8A A;  3RLN A;  4DV4 L;  5M3M G;  1VQH A;  2WAQ G;  3E0E A;  3STB C;  1Y1W G;  3PO3 H;  3PUV A;  1Q1B A;  1I94 Q;  5HGQ A;  4AYB E;  3I7F A;  2PNH A;  3G71 A;  3T1H Q;  1QUQ B;  2N78 A;  1PH5 A;  1YIT A;  4PZ7 A;  5IYB H;  3HOU G;  4LF5 Q;  4X65 Q;  2VW9 A;  1K8A C;  1IBL Q;  1XMQ L;  1WOC A;  4A3G G;  4AIM A;  4HJ9 A;  2R92 G;  2GN5 A;  4JI8 L;  2UXB L;  1IBM L;  1CKN A;  1CSP A;  2R7Z G;  3J80 i;  3S1N H;  5J3B A;  4NXM Q;  3ULL A;  4A3K G;  1VQ8 A;  3OTO L;  4DR7 L;  4QGU A;  1YHA A;  1X6O A;  1CSQ A;  4BBR G;  1IBK Q;  3F2C A;  2JA6 G;  1A0I A;  4C2M H;  1HZ9 A;  4P75 A;  4DPG A;  1I5F A;  1KD1 C;  1HNZ Q;  4LF8 L;  1NJI C;  4IFD I;  5C0X J;  3M4P A;  4LFA Q;  3CC2 A;  3KDF B;  4XTC S;  4C3I H;  2JEA I;  4OO1 G;  1S3O A;  4DV0 L;  1WJJ A;  3UDG A;  4GNX B;  2ZTE A;  5JJK A;  2WB1 E;  3D31 A;  5FJ8 G;  5IYD G;  3CCJ A;  2D0P A;  4IPD A;  2CQO A;  4DR5 Q;  1XMO Q;  5C4X H;  5GAD C;  1DGS A;  3FKI H;  4UPA A;  4YWM A;  3TS0 A;  1UE6 A;  2D0O A;  4A3J G;  2A8V A;  4L5T A;  4JI1 Q;  5FLM H;  4JI3 Q;  4LFC Q;  3DLL A;  3H3V I;  3PO2 H;  2JE6 I;  5GQO A;  3PGZ A;  1TWH H;  3I2Z A;  3LGJ A;  3JAM c;  2NVT H;  1N32 L;  4C3J H;  3EN2 A;  1Y1V G;  4DV2 Q;  1JJC B;  4HJ7 A;  4OWX B;  3AQQ A;  4P71 A;  3S2H H;  1E7Z A;  3CF5 A;  2K14 A;  3S1R H;  2MNA A;  1Q82 C;  1VQ6 A;  2JK8 A;  2AWN A;  4QL5 A;  1L2F A;  4RG1 A;  4GLA C;  2AMC B;  5IP7 G;  5JEA G;  1ASZ A;  2E8G A;  3ER0 A;  1VS0 A;  3U58 A;  1XPR A;  1VQ9 A;  4DV1 L;  4HJ8 A;  3A5Z B;  1K9M C;  1TWC H;  1XPU A;  3I4M G;  1P16 A;  1U5K A;  5K36 G;  4LF6 L;  4HIK A;  4A76 A;  4DK6 C;  1HR0 W;  1FVI A;  2YTX A;  4A3E H;  4RMF A;  4A3B H;  1M90 C;  5M5X H;  1EIF A;  4H02 A;  4GOP B;  2GVA A;  3CD6 A;  1YJW A;  3J7A 5;  4YCV A;  3UDX A;  2E5L Q;  2HHH Q;  4B3M Q;  2MFI A;  3CC7 A;  1IBK L;  1L0W A;  1N36 Q;  1KRS A;  1K73 C;  3M7N A;  1LYL A;  1J5E Q;  1VQP A;  1VQJ A;  3G6E A;  1JJ2 A;  2WB1 G;  2NN6 I;  5C0X I;  4DR2 Q;  4LF9 Q;  1BBW A;  2WAQ E;  3K80 C;  5M3F H;  3J81 c;  1PYB A;  2QEX A;  3ULJ A;  4PZ6 A;  3CCE A;  2F4V Q;  3S15 H;  4DV6 Q;  2ZJR A;  3E9I A;  1VCI A;  3UE1 A;  1C7Y A;  1LM0 A;  3K7A H;  2B3G A;  1N34 L;  4DR6 Q;  4DV3 L;  1W2B A;  2ZM6 Q;  3HOV G;  3HOZ G;  4DR5 L;  1X55 A;  2NVY H;  2YTV A;  4JI4 L;  1OXT A;  3CP0 A;  4IFD J;  3IRB A;  4Y52 H;  4BXX H;  1UE1 A;  4LFC L;  4JI1 L;  1VQM A;  4OX9 L;  2HIV A;  3TRE A;  2PI2 A;  4PMW A;  3RR5 A;  2IHE A;  4A3L H;  5AJ3 Q;  4DV5 L;  3T1Y Q;  1QVF A;  3STB D;  4GNX C;  5M5Y H;  3PO3 G;  5IY0 A;  2KEN A;  1TWA H;  4P72 A;  2JA7 H;  3GTQ H;  4LFB Q;  1S40 A;  3CPW A;  4DAM A;  2K5H A;  3JC6 6;  5IYB G;  3H3V H;  1PH2 A;  5EAY A;  4JI5 Q;  3S14 H;  1V9P A;  3CCR A;  4LF4 Q;  4DUZ L;  1TWF H;  4BA2 I;  1WCM G;  2Z6K C;  1VQG A;  4OXP A;  3BU2 A;  1K0R A;  3KOJ A;  2LXJ A;  4YWK A;  1Q8K A;  1WYD A;  5ELN A;  4A3F H;  1L1O B;  1YZ6 A;  4KI0 A;  4HIO A;  4A93 H;  1E1T A;  1G6P A;  1Q46 A;  5C0X G;  1KC8 C;  1J6Q A;  4A3M H;  1YHQ A;  1YNX A;  3PCO B;  1PH3 A;  3KF6 B;  3S1Q H;  1V43 A;  2LXK A;  3H15 A;  2E5L L;  4BY1 H;  1N32 Q;  4IJH A;  4A3C H;  3FP9 A;  1WI5 A;  5DLQ E;  2KBN A;  1N36 L;  1KXL A;  4TQU S;  1QVC A;  1J5E L;  1C0A A;  1R9T H;  2YV5 A;  3MXN B;  3GDE A;  4DR2 L;  4R4O A;  3J81 i;  4O0A A;  5LMU Q;  2F4V L;  5C4X G;  1IL2 A;  4JI6 Q;  2EIF A;  3UE0 A;  3TRZ A;  4GOP C;  1VQO A;  3CCL A;  4GS3 A;  1OXX K;  1EYG A;  4KHP L;  5C44 H;  1PFS A;  2DUD A;  4MZ9 A;  4GN3 B;  5LMN Q;  4DR3 Q;  2ASB A;  3S1M H;  2ZTC A;  2CFM A;  3PO2 G;  1QVG A;  4DUY L;  2HQL A;  1GM5 A;  1H95 A;  1UEB A;  4JI2 L;  5BR8 L;  1FJG L;  1QUQ A;  1W3S A;  2A1A A;  2A19 A;  4GKJ L;  5IP9 H;  3D0F A;  4LF7 Q;  1SLJ A;  4YHH L;  1SFO H;  1VQN A;  3TQY A;  2VQE L;  4JI0 L;  2IX1 A;  2DGY A;  2KCT A;  4WJ4 A;  1JMC A;  1SE8 A;  4X66 Q;  1K83 H;  2WFW A;  1CKO A;  3GTM H;  3K7U C;  1HNX L;  1VQI A;  1HNW L;  4IJL A;  4K0K Q;  1I6H H;  2C35 B;  1D8L A;  3H0G G;  4UP7 A;  1IXR A;  3CW2 C;  3WWV A;  3GTO H;  3BZK A;  4JI5 L;  2QA4 A;  1E1O A;  5IWA L;  4P74 A;  4A3B G;  4A3E G;  5M3M H;  4DNI A;  2CWA A;  3RN2 A;  1EUJ A;  4QQB X;  3S2D H;  3I56 A;  3K0X A;  4JI7 Q;  2R93 H;  3KDF A;  4IOA A;  4NXN Q;  1TWG H;  1Q86 C;  2I0Q A;  1Z9F A;  2Q2I A;  1SRU A;  4X62 Q;  4X64 Q;  4GNX A;  2VY3 A;  4R1J A;  1FL0 A;  4C3H H;  4EX5 A;  2VQF Q;  5ELO A;  1Q7Y C;  1VQK A;  1Q1E A;  5M3F G;  1GO3 E;  2AWO A;  2N49 A;  2R92 H;  4B3R Q;  3HOW H;  1X56 A;  4L5S A;  4B3S Q;  2R7Z H;  3S24 A;  4XIG S;  2N8N A;  3F2B A;  3T1H L;  4A3K H;  1E24 A;  1UWV A;  4JG2 A;  4APV A;  2F3I A;  1AE3 A;  4YY3 Q;  3KJO A;  3PF5 A;  5C3E H;  1L1O C;  4X65 L;  1PH1 A;  1IBL L;  3EBE A;  4LF5 L;  2Z6K A;  1YVC A;  3GTP H;  4IFD G;  1EQR A;  1Y14 B;  1Q12 A;  3M4Q A;  4UP9 A;  4A3I H;  3OW2 A;  4UY8 C;  1JB7 A;  2NVX H;  4JI6 L;  4BBS H;  2UXD Q;  1X54 A;  3Q8D A;  4DR1 Q;  4TVA B;  4NXM L;  2YTY A;  2UU9 Q;  3RLF A;  5LMN L;  4Y7N H;  5IYC H;  2UUB Q;  1VQ7 A;  4JYA Q;  2MO0 A;  1XNR Q;  4BXX G;  2UXC Q;  2VL6 A;  3UDI A;  1PVO A;  2KCM A;  2ES2 A;  3PIO A;  2BA0 A;  3AYH B;  2F52 A;  3PUX A;  2ZJQ A;  4A3L G;  1JJG A;  1SMX A;  1GVP A;  1HNZ L;  1BBU A;  4DR4 Q;  3OYY A;  4LFA L;  1NE3 A;  5GAE C;  4LF7 L;  3HOY H;  1EIY B;  4J15 A;  2B63 H;  2B29 A;  1PH4 A;  4DV7 Q;  1MIU A;  1NBW A;  3M85 A;  3RN5 A;  3GTJ H;  3DM3 A;  4JBJ A;  4X66 L;  4GOP A;  4GKK Q;  4HJ5 A;  1XMO L;  4NPS A;  4OON A;  4QIW E;  3PF4 A;  2UUC L;  3U50 C;  3B6Y A;  4KLK A;  3TEH B;  3CPF A;  1Q81 C;  4A3F G;  4A93 G;  3J81 j;  2OWO A;  2JA8 H;  4A3M G;  2Q2H A;  3G48 A;  2I5M X;  4R4C A;  4JI3 L;  1GKH A;  3A5U A;  3KJP A;  2EQS A;  3JAM i;  3A0J A;  4B3T Q;  4BY1 G;  4GN5 A;  1XMQ Q;  1X3G A;  4A3C G;  1N33 Q;  4X6A H;  4NXN L;  2NZO A;  2PMZ E;  4JI8 Q;  1IBM Q;  3M3Y H;  2UXB Q;  4DV2 L;  2JA5 H;  2JA9 A;  5JJI A;  3M9B A;  3OTO Q;  4HJA A;  3W1G A;  2KHI A;  3I4M H;  2VQF L;  3HKZ G;  1RIP A;  4R4T A;  3L0O A;  2H5X A;  3KF8 B;  2R6G A;  1XTD A;  1G51 A;  2IX0 A;  1EQQ A;  4A3D H;  3S16 H;  4LF8 Q;  2HIX A;  5C44 G;  3ICE A;  2VS1 A;  1VQE A;  2NN6 G;  2PQA B;  3PSI A;  2BA1 A;  2JEB I;  1IZ6 A;  1G29 1;  2ZTD A;  1PH9 A;  4JBW A;  2JJQ A;  3J7Z C;  3CCQ A;  1VQB A;  1KIX A;  2HHH L;  4B3M L;  3UDF A;  4QJF A;  1LUZ A; 
#chains in the Genus database with same CATH topology
 2RCF A;  2UXC L;  1STH A;  2F3V A;  5JAV A;  1B8A A;  1TWF B;  2ENB A;  1GUG A;  4LF9 L;  1B7Y B;  1WVL A;  3MHB A;  1D5M C;  3CCU A;  2VUM H;  1MBY A;  4IPH A;  3CME A;  1I94 Q;  1CKN B;  1D5X C;  4BY7 G;  5M5W H;  1PH7 A;  4ME3 A;  3KF6 A;  2LMC B;  5BN5 A;  3F2D A;  3VYS A;  2R93 G;  2K28 A;  4DK3 C;  4F8M A;  4K6L A;  1YHB A;  5JPN C;  1AEX A;  2K5N A;  1R9T B;  1HZC A;  1BUV T;  3MXN A;  2D9U A;  1CFM A;  5C5L A;  4QF4 A;  3OOC A;  4DU9 A;  2B2T C;  4KD4 A;  3CMA A;  1QG7 A;  3T53 B;  4LFB L;  4JCV E;  1K3B C;  3KYH C;  5CBE E;  3NE5 B;  4PZ8 A;  3RNU A;  3OWE B;  5IGF A;  3HOX H;  1GUS A;  1KLU D;  4RGT A;  4DNR B;  4H13 C;  1YJN A;  2PCF B;  3NEM A;  4BBS G;  1Y1W H;  2HCI A;  5IYC G;  1TS2 A;  1E2W A;  1LT3 D;  3MXG A;  4LUO A;  5C3X A;  3FPU B;  4V0B A;  3E3X A;  1K83 B;  2RHS B;  4DV3 Q;  1GD7 A;  3RMH A;  1RF2 D;  3E9H A;  1SNO A;  2CVR A;  2KCN A;  1ET6 A;  2LFN A;  3K0Y A;  2A6E C;  3D3R A;  3GTL H;  4DK0 A;  3HKZ E;  2JA6 H;  1I4G A;  2PMZ B;  2F1M A;  1I4H A;  3GV3 A;  4ZQ3 A;  4E6I A;  4I7A A;  4AYB G;  1LTR D;  2XTI A;  2QEJ C;  4MIU A;  3CCM A;  3CC4 A;  4DR3 L;  1RL2 A;  4NB3 A;  4P73 A;  2XNA C;  3HG9 A;  4N8X 1;  2R7D A;  2EVB A;  3FMC A;  4DKA C;  3D4W A;  2K50 A;  4A75 A;  4YCW A;  2JA7 G;  5C3E B;  2XVS A;  2MO1 A;  3AFQ A;  3FHW A;  4J1M A;  4A3B B;  3NHH A;  2K4K A;  3GTK H;  1C9O A;  5IOD A;  2MP1 A;  4K2K A;  4DV4 Q;  4QMG A;  5E3F A;  1BKB A;  5L37 A;  4Y7N B;  1VQL A;  3FDT A;  3GP7 A;  4JOI A;  4RKB A;  2IJ0 A;  1HTP A;  3CCS A;  1NMF A;  3W1B A;  2OTL A;  3U4Z A;  3Q0A A;  1ENA A;  2BE5 C;  1PH8 A;  2EZV A;  1B70 B;  2BH8 A;  4RWS C;  4BA1 I;  1O7Y A;  1FNU A;  1FR3 A;  1EQV A;  1M8A A;  2ICE C;  5BN3 A;  1S5C D;  1LT4 D;  2NVQ H;  4DUY Q;  2JA8 B;  4YY3 L;  4QUC A;  2K75 A;  4L6T B;  1AN8 A;  1X65 A;  1KRT A;  4X3T A;  4GN4 B;  1ASY A;  2L15 A;  3G4S A;  2F0D A;  2UXD L;  4LUV A;  4DR1 L;  2D5D A;  1JQY D;  3FEW X;  4JYA L;  1CTM A;  1HNW Q;  2H4O A;  3KF8 A;  5CC4 A;  1EZ8 A;  1PTO B;  3FPP A;  3DXJ C;  5IWA Q;  3ULP A;  3I4N G;  2A5H A;  3HOV H;  2Q8T A;  4KN7 C;  1EFW A;  5J1Z A;  3JAM E;  2PI2 E;  4A93 B;  1HZB A;  1JR0 D;  5IE8 A;  2LS0 1;  1K8O A;  1VQH A;  3E0E A;  2Y0S B;  3CKI B;  1Y8O B;  1H9S B;  3G71 A;  3I73 A;  2A74 C;  3VA5 A;  5KIX A;  2SEB D;  3HOU G;  3D4D A;  2VW9 A;  1K8A C;  4A3G G;  4ZKB B;  4HJ9 A;  2F0T A;  4XT1 B;  4JI8 L;  1EZ6 A;  1CSP A;  3S1N H;  3J80 i;  3ULL A;  1OO9 B;  3FVQ A;  4OEM B;  3OTO L;  1SBB B;  1SYC A;  1G2T A;  3A7A B;  3DWQ A;  5EGT A;  1WTQ A;  1KD1 C;  3I8Z A;  5C0X J;  3M4P A;  3A8J E;  1X3P A;  1I4Q A;  3WOF A;  2EYF A;  1ESR A;  1LTI D;  1WJJ A;  4IUQ A;  5D3I B;  4XT3 B;  2WKD A;  3CQZ B;  3CCJ A;  4IPD A;  1DGS A;  2QCP X;  3D4R A;  2L1B A;  1LTA D;  5M3M B;  2WAQ B;  5E1F A;  2D2C C;  4JI1 Q;  3PO2 H;  3DLL A;  1DCZ A;  3PGZ A;  1TWH H;  3JAM c;  1WTH A;  3LGJ A;  2R93 B;  3ITP A;  4YIJ A;  5CV5 A;  1BXT A;  5FLX L;  1IW7 C;  1Y1V G;  1JJC B;  2K5D A;  3S2H H;  2R92 B;  1Q82 C;  2JK8 A;  4QL5 A;  4RG1 A;  1ASZ A;  4BBR B;  1HQM C;  5BN4 A;  2E8G A;  5FO9 B;  3Q6S A;  1XPU A;  3VR5 A;  3I4M G;  4G7O C;  2F0S A;  1U5K A;  2NVX B;  2YTX A;  1D1K A;  4HSV A;  1EIF A;  1H9M A;  1B50 A;  4L63 B;  2HHH Q;  1DD2 A;  2G5D A;  1IBK L;  1L0W A;  4ULL A;  1K73 C;  1LYL A;  1J5E Q;  5C0X I;  4KMU C;  4LF9 Q;  3J81 c;  1WD0 A;  1DOM A;  3OWF A;  3K7A H;  1DJR D;  4XYQ A;  1N34 L;  2B2U A;  4I65 A;  3HOZ G;  4DR5 L;  1X55 A;  2X6L A;  4JI4 L;  4K8I A;  1U4M A;  4IFD J;  3IRB A;  1J8I A;  4BXX H;  1I3Q B;  1ML0 D;  4N8F A;  4PMW A;  3SR1 A;  4DV5 L;  5ELF A;  2IL8 A;  3PO3 G;  5IY0 A;  1RCV D;  4LFB Q;  2JA7 H;  3GTQ H;  1MI2 A;  4UHV A;  5IT9 L;  4CGY B;  1ZYR C;  4OL7 A;  5D65 A;  1O7Z A;  4JI5 Q;  3S14 H;  2SNM A;  1TR5 A;  1SAP A;  4IUP A;  5M9O A;  2I07 B;  5IGC A;  1LTS D;  2LXJ A;  1G6P A;  1E1T A;  3RZO B;  1BCP D;  1YHQ A;  4A3M H;  2WB1 B;  3M4O B;  1VF7 A;  1V43 A;  2LXK A;  3NTI A;  3NXW A;  3AB9 A;  3IFD A;  2E2H B;  1LTB D;  5LL6 S;  1QVC A;  1JOR A;  1VF5 C;  1PZJ D;  5FOB B;  1RJT A;  3M4Y A;  1K8M A;  2EIF A;  3CCL A;  4KHP L;  1OXX K;  5I6Y A;  2DUD A;  3TP7 A;  4DR3 Q;  4WOR A;  1A3T A;  1RKN A;  3P75 A;  3W3A A;  1IKM A;  4ZLT F;  1RHP A;  2PO4 A;  4JI2 L;  1QUQ A;  4UAI A;  1SLJ A;  4YHH L;  1SFO H;  2R61 A;  3I4N B;  1BR9 A;  4WJ4 A;  4B9X A;  1JMC A;  4NKL A;  1D5Z C;  2MJ8 A;  3TDQ A;  2WFW A;  1CKO A;  3GTM H;  2E75 C;  4RA8 A;  3CHB D;  1VQI A;  3QWN A;  1VDZ A;  3H0G G;  2F0V A;  5KNC A;  4DNI A;  4LMQ D;  4QQB X;  3I56 A;  4MN3 A;  1ONL A;  1JWU D;  1XWE A;  3K0X A;  4RGN A;  3X3M A;  5I2Y A;  4NXN Q;  1TWG H;  3NPP A;  2AQ3 B;  1Z9F A;  4Q0F A;  4GNX A;  1A15 A;  2VY3 A;  1FL0 A;  5CMD A;  1Q7Y C;  5C4X B;  3TN2 A;  1VQK A;  2N49 A;  4L5S A;  3S17 B;  1E24 A;  3A55 A;  4APV A;  1AE3 A;  4YY3 Q;  3PF5 A;  4DAV A;  4LF5 L;  4X65 L;  1PH1 A;  4OIK A;  1EQR A;  4C3J B;  2K5Q A;  4A3I H;  3OW2 A;  2UXD Q;  4DR1 Q;  2YTY A;  5LMN L;  1SNQ A;  1EWH A;  4JYA Q;  1HRJ A;  3WOE A;  1PVO A;  4ME5 A;  1A2T A;  1BO0 A;  2F52 A;  3S1R B;  2XRS D;  1BBU A;  1IYU A;  4LF7 L;  3HOY H;  4Z9C B;  4J15 A;  1SYG A;  2B29 A;  3RN5 A;  5M5X B;  4QIW E;  3PF4 A;  1QNK A;  3B6Y A;  2B2W A;  3CPF A;  4K8J A;  4RKL A;  4R4C A;  4JI3 L;  3A5U A;  3JAM i;  1STY A;  5M3F B;  3QIA A;  4B3T Q;  4BY1 G;  3S15 B;  1N33 Q;  1RTO A;  2NZO A;  4JI8 Q;  2KED A;  1C48 A;  5IGE A;  2JA5 H;  3OTO Q;  4HJA A;  2H1E A;  3EFX D;  3IFT A;  3I4M H;  4FF2 A;  1ZXT A;  1XTD A;  3SEB A;  3Q22 A;  3OW7 A;  1BNZ A;  5JVH 3;  4DF7 A;  5C44 G;  1DXM A;  4XQJ A;  3CU7 A;  3LWE A;  2KOL A;  2VS1 A;  2PQA B;  3PSI A;  2JEB I;  2ZTD A;  1PH9 A;  2EOT A;  1TWA B;  5ELB A;  3A56 A;  2JJQ A;  3CCQ A;  1HA5 A;  1TS4 A;  1XYI A;  1HH2 P;  2FXQ A;  1F9R A;  2E2J B;  1OXS C;  3HP3 A;  1GOZ A;  4XQQ A;  3PIP A;  3LWU A;  2WAC A;  1KDB A;  1N9W A;  2OF1 A;  1EFI D;  1YEZ A;  2B2Y C;  3CXC A;  4LUZ A;  1KHI A;  3NWS A;  1Y8P B;  4DV7 L;  5JJL A;  2ATW A;  2XGT A;  1D7Q A;  4R8I A;  1SE2 A;  1M1K C;  3PO3 B;  4QY7 A;  3NSW A;  4DXG A;  2IT1 A;  4X3U A;  5C4J H;  1HFN A;  2AKW B;  4PG3 A;  1JE4 A;  1VQF A;  3HKZ B;  1XNQ Q;  3SK4 A;  2IHF A;  4HED A;  1V1Q A;  1HR0 Q;  1I50 H;  4OWT B;  3GTG H;  4FYD A;  1G2S A;  1K28 A;  2R7F A;  1EU3 A;  1ICW A;  1PTO D;  5D3D A;  2XWB B;  2JYO A;  1RD9 D;  4RFB A;  2ZJP A;  4JBM A;  3A7L A;  3S1M B;  4K5V A;  4CJ0 B;  4XDX A;  5C3E G;  5GRO A;  4ZKC B;  2I5H A;  2BH2 A;  2BDN A;  4LF4 L;  2Z8L A;  4AQY Q;  2WP8 J;  4FVM A;  1CZG A;  4ZRZ A;  1UE7 A;  4IO9 A;  2PW7 A;  1PH6 A;  1ENC A;  1KNE A;  5ELE A;  1X3E A;  1SR3 A;  2HUG A;  2UUC Q;  1N34 Q;  1TS5 A;  1PYS B;  3TP6 A;  1I6H B;  4K2L A;  4JI4 Q;  1MKH A;  1UNS A;  5KGU A;  3G7L A;  2UUA Q;  1D6E C;  1B3Q A;  4DAY B;  2XWJ B;  2NVT B;  5GAG C;  1MJC A;  4DV5 Q;  3EQL C;  3VDY A;  1TXY A;  1DON A;  4GLV B;  2JA8 G;  4OO1 H;  2YU9 H;  4O2D A;  2B8G A;  3BYY B;  1JIC A;  3G6J B;  3HOW B;  2V4D A;  4MTN A;  2CKZ B;  1LTL A;  5EKI A;  4BS9 A;  1I4R A;  3MFG A;  3GTP B;  2K52 A;  3SK8 A;  3H0G H;  2RDH A;  2VNU D;  1E22 A;  1ZKO A;  4ZCK A;  4A3J H;  2KCC A;  2F4I A;  1CZW A;  2I46 A;  1S5B D;  5E4W C;  4HMI A;  4ODG A;  3N52 A;  2EYH A;  1BCP B;  1DZ1 A;  2AUJ D;  1IL8 A;  1SND A;  5CBA E;  3R2I A;  4JI7 L;  5GAH C;  2Y0S G;  2TSS A;  1C4Q A;  3IAY A;  2QKI C;  1TU2 B;  5IP7 H;  4NDX A;  4X62 L;  3J80 c;  1YJ9 A;  2OQ0 A;  3GTJ B;  4N9T A;  4DR7 Q;  3RZD H;  4KHP Q;  2A68 D;  3W5O A;  2NVY B;  1VQA A;  2N88 A;  1YIJ A;  4B3R L;  1K3R A;  4B3S L;  2F0J A;  4WJ3 M;  1X9N A;  1DYQ A;  4JI2 Q;  2I5L X;  4YHH Q;  3MAQ A;  2KUM A;  2PZW A;  2RHQ B;  3SE0 A;  3A8I E;  1CUK A;  1ENF A;  3PUZ A;  3M3Y B;  3MWY W;  1JWS D;  4JV5 L;  5IP9 G;  1SYD A;  1XNR L;  2JP1 A;  1ROD A;  3DEO A;  4AH6 A;  1S72 A;  1STB A;  2F0I A;  3S16 B;  1UE5 A;  2OXP A;  4A3D B;  2CCZ A;  3MEF A;  2N55 A;  2CH4 A;  3P20 A;  3KFU A;  1B53 A;  1U4R A;  4LJZ C;  3SGI A;  3S1Q B;  1FGB D;  3K8A A;  4BY1 B;  2QW7 A;  5M3M G;  1CA6 A;  3CRK C;  2WAQ G;  3URY A;  3I7F A;  2PNH A;  3OMC A;  3HGB A;  5KND A;  1YIT A;  2RSO A;  1WTP A;  2NYZ D;  4LF5 Q;  3NK9 A;  1UEA B;  1V1P B;  4X65 Q;  2Z9H A;  2VUM B;  2R92 G;  1CKN A;  5M5W B;  5C44 B;  1EY9 A;  1VQ8 A;  2F0Q A;  3VYU A;  1X6O A;  1E0B A;  4BBR G;  1BCP C;  2RVL A;  5C0X H;  3F2C A;  5C4Z A;  1EIG A;  4G7Z C;  1HQR D;  1NJI C;  4K5X A;  4IN3 A;  1CQF A;  3BVZ A;  2JEA I;  4C3I H;  4DV0 L;  5DAU A;  3UDG A;  1S4Z A;  1U9R A;  2ZTE A;  5FJ8 G;  2QF7 A;  5IYD G;  2D0P A;  5C6A A;  2CQO A;  3T4A C;  4BWG B;  3HOX B;  4YWM A;  3TS0 A;  1SNP A;  1EY6 A;  4RGO S;  2D0O A;  2ICI A;  4LFC Q;  3S2D B;  4JI3 Q;  3H3V I;  2JE6 I;  1Y1W B;  1PZI D;  2EDG A;  1B44 D;  3I2Z A;  3TBI B;  2XIW A;  4CDF C;  1BOS A;  1KAB A;  2GA4 B;  5G3L D;  4C3H B;  3K58 A;  4KK7 A;  2K7V A;  1GXD C;  1XTC D;  2R7Z B;  2F0N A;  2MNA A;  4A3K B;  2F3W A;  3D6C A;  1PYW D;  5JEA G;  3ER0 A;  1VS0 A;  4HCE A;  1XPR A;  2JA6 B;  3GTL B;  4DV1 L;  3BYT B;  3MFY A;  2C5C A;  1P16 A;  5K36 G;  1HR0 W;  4JVZ A;  4I7Z C;  1FVI A;  4A3B H;  4A3E H;  3CD6 A;  1YJW A;  3MC0 B;  2L55 A;  2L4N A;  2K32 A;  1N36 Q;  2Z6B A;  1LAB A;  3J7A F;  1ESF A;  1VQJ A;  2CW0 D;  1CK1 A;  4S3S A;  2WB1 G;  2A6H D;  2NN6 I;  1XX8 A;  1G6Z A;  3K80 C;  2F4V Q;  3ULJ A;  3E9I A;  5FKA C;  1VCI A;  1C7Y A;  2DNE A;  3NP8 A;  4IFD H;  4CKC A;  3T56 B;  4JW0 A;  3M7G A;  1OXT A;  5EPJ A;  1PFM A;  2B39 A;  1F9Q A;  2K01 A;  1WTV A;  1HFG A;  1UE1 A;  2O4X A;  1G8Z D;  1VQM A;  2PYK A;  3RR5 A;  5I4D A;  2KEN A;  3CPW A;  4O42 A;  3NWT A;  5IYB G;  3JC6 6;  2NVQ B;  4KKS A;  5IGB A;  2F0O A;  3EJI A;  3OIQ A;  1D1I A;  4LF4 Q;  4DUZ L;  3ONA B;  5KYL A;  3KOJ A;  2VB3 X;  4YWK A;  1Q8K A;  4A3F H;  4QUF A;  1L1O B;  4A93 H;  5KNB A;  1GUN A;  2F0W A;  1YNX A;  1EY5 A;  1LV9 A;  3H15 A;  2E5L L;  4A3C H;  2JN4 A;  4R9W A;  4RHS A;  2K03 A;  3PIP 3;  2WII B;  1C0A A;  4H7B A;  2YV5 A;  3HOV B;  4DR2 L;  4R4O A;  5ELC A;  5C4X G;  4JI6 Q;  4GS3 A;  3ND9 A;  3HRZ C;  3I90 A;  2CFM A;  1QVG A;  4RH6 A;  2HQL A;  2J4X A;  3I70 A;  1H9S A;  4C3J G;  3J7Y W;  3QR8 A;  1FJG L;  1W3S A;  2A19 A;  5IP9 H;  2L9H A;  1UUP A;  1CA5 A;  2PZT A;  4JI0 L;  3TZU A;  2DGY A;  1GJX A;  3S1N B;  1WCM B;  4X66 Q;  1QNU A;  3K5O A;  5FO7 B;  1HNX L;  3Q24 A;  4BY7 H;  1D8L A;  3R2T A;  4UP7 A;  3WWV A;  4QCL A;  3BZK A;  4FF4 A;  1W6K A;  4WRD A;  3EA6 A;  5M3M H;  1K0S A;  3QO2 A;  4JI7 Q;  2R93 H;  4X62 Q;  1SRU A;  2EY6 A;  2VQF Q;  5CV4 A;  5ELO A;  1PTO C;  5M3F G;  1GO3 E;  2AWO A;  2R92 H;  4B3R Q;  4B3S Q;  2O5I C;  3T1H L;  4XYO A;  3OHX C;  3P7J A;  5DM7 3;  1SDF A;  2F3I A;  3MTS A;  1L1O C;  1IBL L;  3PQI A;  1H9K A;  1V1O A;  3RD4 A;  4UY8 C;  2KHS A;  2NVX H;  4BBS H;  1X54 A;  4NXM L;  2E74 C;  1AFP A;  2DNC A;  3PMF A;  3RLF A;  5IYC H;  1XNR Q;  3S2H B;  2UXC Q;  3UDI A;  4KD3 A;  2ES2 A;  3PIO A;  4A3L G;  2AQ2 B;  1SMX A;  1SJE D;  3KLS A;  4JPB W;  2AUK A;  4PMC A;  4KTA A;  1EIH A;  1PH4 A;  1NBW A;  3VR2 A;  3M85 A;  1SMY C;  5COY A;  3VYR A;  2EPB A;  3C3L A;  2JXM B;  1HA6 A;  3NTH A;  2WKC A;  3VA7 A;  4HJ5 A;  1XMO L;  4NPS A;  1A6X A;  4KKT A;  5ELD A;  2Q2H A;  2I5M X;  3KJP A;  1GKH A;  5FLX E;  4V19 0;  1X3G A;  4FF3 A;  4X6A H;  3K7A B;  2PMZ E;  4HMJ A;  4DV2 L;  5I6W A;  2KHI A;  2BDO A;  3HKZ G;  4R4T A;  2H5X A;  1G51 A;  2K6A A;  2HIX A;  1RDP D;  2FMC A;  4KKU A;  2NN6 G;  4ZAI A;  2PNR C;  4K14 A;  3U9O A;  3GTQ B;  1YNJ D;  5JJZ A;  1VQB A;  3CRL C;  3UDF A;  4QJF A;  1LUZ A;  4CDD C;  1OTC A;  1QZG A;  3HFZ B;  2JQO A;  1Z47 A;  3DHQ A;  3S9W A;  3S14 B;  2A68 C;  1A62 A;  2K05 A;  4DK1 A;  1BVS A;  4RCN A;  1XXG A;  5F2D A;  1X3F A;  1Q86 C;  3I4L A;  1YI2 A;  3NBH B;  3FRP B;  5EKL A;  4FDB A;  2L12 A;  2RDF A;  3RLO A;  2QIL A;  1U0L A;  3OIP A;  4GKK L;  1HJP A;  3A74 A;  1CQV A;  1QZH A;  2EYP A;  1E3P A;  4LW1 A;  3ZJY C;  4L5R C;  1PZK D;  2YYZ A;  1A3V A;  4GLX A;  5FLX c;  4DV1 Q;  1SN8 A;  1P8L A;  3SK5 A;  3T1Y L;  3BG3 A;  3P1H A;  1K8G A;  2KHJ A;  3I4N H;  4TSS A;  5A2Q L;  3HOW G;  5IT9 E;  1AP0 A;  1GUO A;  1VQD A;  2VZA A;  3NBH A;  1JE5 A;  5H1S E;  3TP8 A;  1Q90 A;  1QWY A;  1VQ5 A;  3NEN A;  1VQ4 A;  1FNW A;  3TS2 A;  4ZUJ A;  3BVM A;  1SFO B;  3BZC A;  1NY4 A;  2NWG A;  2ZT9 C;  1CHQ D;  4EQP A;  3HOU H;  5CGK A;  1TY0 A;  3GTM B;  2F0E A;  4A3G H;  1B9N A;  3FKI B;  2HT1 A;  5IGG A;  3K5N A;  1SYB A;  2B63 G;  2Y0S E;  1EWI A;  4JBK A;  3VYT A;  4CKE A;  3S17 H;  1N8R C;  2PW5 A;  1VQC A;  3V05 A;  5LMU L;  1EYD A;  4DAP A;  4J8Q A;  4RGM A;  1Q3L A;  1I94 L;  3L2P A;  2IW3 A;  1TWG B;  1F2L A;  3L7Z C;  1Y8N B;  1BBX C;  1KLG D;  3F8T A;  1JB3 A;  5EBC A;  4DUZ Q;  4IOC A;  2NZH A;  4G7H C;  4R4I A;  3NEL A;  1OXU A;  1A8V A;  3U9S A;  4A3I B;  2KQ3 A;  2B2Y A;  1EOV A;  2B2V C;  5C3W A;  5IT9 c;  4A3D G;  1JWM D;  3PV0 A;  4YCU A;  3UI2 A;  1Y1V H;  4POF A;  1YBY A;  2AHO B;  1AZQ A;  5EQ0 A;  2VB2 X;  4DN4 M;  3HOY B;  2HDL A;  2AQ1 B;  1NCV A;  3AMU A;  4HTH A;  3KUP A;  4HIM A;  1JT8 A;  1FYC A;  2FIN B;  3MXP A;  1KQS A;  1EY7 A;  4X3S A;  1IKL A;  3WDN A;  4KN4 C;  2OCE A;  4PV1 C;  2RA4 A;  2M2L A;  2VUM G;  1CT1 D;  5JEA J;  5JVG 3;  1E2V A;  4IPG A;  2GVB A;  1XJV A;  3OPO A;  1FJG Q;  4OWW B;  3ZYY X;  5TSS A;  5HGT A;  4IUV A;  1MD2 D;  1S5E D;  4JI0 Q;  2CW0 C;  4CDE C;  2A6H C;  2UU9 L;  2E2I H;  1F9P A;  2UUB L;  2RF4 A;  1HNX Q;  4U67 3;  4LNQ A;  1JC7 A;  2ZXO A;  3KBG A;  1M4V A;  1KAW A;  5KRU A;  2E2J H;  4DR4 L;  1NTG A;  2MGS A;  1MJE A;  3HOZ H;  1JCK B;  2EYL A;  3HKS A;  4L5Q A;  1U4L A;  4YWL A;  1EL0 A;  2PQA A;  3HOX G;  4HID A;  4A4I A;  4IPC A;  4DV4 L;  3RLN A;  3SXH A;  4LAA A;  3J80 L;  5ISR A;  1Y1W G;  3PO3 H;  4AYB E;  3T1H Q;  5CR3 A;  2N78 A;  1EYC A;  1O80 A;  5EBD A;  3H09 A;  5JPM C;  4C3H G;  1IBL Q;  4IAL A;  1PRT D;  1IBM L;  2R7Z G;  3T16 A;  4NXM Q;  1VMC A;  4A3K G;  4QGU A;  3NBI A;  1CSQ A;  4RCO A;  1IBK Q;  2JA6 G;  5C4J B;  4C2M H;  4P75 A;  4DPG A;  4LF8 L;  2J0T D;  2KJX A;  1EY8 A;  4DXF A;  2C9O A;  5CV9 A;  1TVX A;  2JSO A;  4WFN 3;  3GTG B;  2R3Z A;  3KDF B;  4XTC S;  3X3N A;  1S3O A;  2EY1 A;  1NR4 A;  3MZ5 A;  1C8C A;  2WB1 E;  2SOB A;  3E0J A;  4DR5 Q;  1XMO Q;  2F0H A;  5GAD C;  4UPA A;  3GTO B;  2DJF C;  1SMY D;  4L5T A;  1PTO F;  4HR7 B;  2XSC A;  1N32 L;  1I4X A;  2NVT H;  3C1F A;  2KEE A;  4DV2 Q;  4HJ7 A;  3H3V C;  4OWX B;  3AQQ A;  1JOO A;  3CF5 A;  1HUN A;  2K14 A;  4PQX A;  1VQ6 A;  2BOS A;  4M1U B;  1FD7 D;  3BDO A;  4FNF A;  2AMC B;  4GLA C;  4DAY A;  3U58 A;  1VQ9 A;  1NAP A;  3F2U A;  1K9M C;  1PLF A;  1TWC H;  1MSG A;  5EJW A;  3A8K E;  4LF6 L;  4DK6 C;  1WD1 A;  2Q8R E;  2HD3 A;  4GOP B;  2K33 A;  4YCV A;  4G57 A;  3PIO 3;  1EY0 A;  3CC7 A;  2YU9 B;  3TME A;  1NUC A;  4KY6 A;  3M7N A;  1VMP A;  3VR6 A;  4QB4 A;  3ERQ A;  2B63 B;  2QEX A;  5LHY 1;  2ZJR A;  3NTK A;  4EGV A;  3UE1 A;  1H9R A;  3N6R A;  2B3G A;  4M8A A;  1W2B A;  3HOV G;  5KEE A;  2NVY H;  1UAP A;  1PXU A;  4J6H A;  1F77 A;  2NZ1 D;  3R93 A;  5D14 A;  4JI1 L;  4OX9 L;  1JOK A;  2PI2 A;  4C56 C;  2M9V A;  3DWP A;  3MVV A;  2IHE A;  3T1Y Q;  1QVF A;  3STB D;  2J7Z A;  4B9W A;  5M5Y H;  3NQT A;  3BVG A;  1ET9 A;  3RZD B;  1S40 A;  2CH4 W;  5JOB A;  4XXE A;  5COR A;  3OSO A;  4NP5 A;  5EAY A;  3TSS A;  1V9P A;  3CCR A;  3K57 A;  1NSN S;  1TWF H;  4BA2 I;  1L0Y B;  1WCM G;  2Z6K C;  1VQG A;  1K0R A;  1O78 A;  5ELN A;  4KI0 A;  2F0F A;  3V2T A;  1Q46 A;  3DWA A;  1J6Q A;  1V8Q A;  3S1Q H;  3KF6 B;  4BY1 H;  5FK9 C;  3GQB A;  3FP9 A;  2PZU A;  2NBF A;  1CHP D;  1SJH D;  1TY2 A;  1STA A;  2K5W A;  5DLQ E;  4TQU S;  1KXL A;  2K1B A;  1J5E L;  1EEI D;  2E76 C;  1R9T H;  1B3A A;  2FJ2 A;  3MXN B;  5LMU Q;  2RQX A;  2F0L A;  1X3Q A;  3C46 A;  1IL2 A;  1LTG D;  4GOP C;  4G4K A;  4KV6 A;  5C44 H;  5LMN Q;  4GN3 B;  3RUZ A;  2ASB A;  2ZTC A;  2ZXR A;  3PO2 G;  3L3O C;  2Z4I A;  2EY5 A;  3E6Z X;  1YNJ C;  4F88 A;  5BR8 L;  4GKJ L;  2A1A A;  3K59 A;  1WTO A;  4LF7 Q;  5E4X A;  1V1P A;  2PPB C;  1I4P A;  1VQN A;  5DEH A;  2VQE L;  2IX1 A;  4FXG C;  1SE8 A;  2BCO A;  4OGQ C;  1K83 H;  2MUY A;  3K7U C;  1D2B A;  2KA7 A;  4IJL A;  2LKV A;  4OHJ A;  4JI5 L;  1E1O A;  4P74 A;  4CDC C;  1EUJ A;  1NNX A;  3S2D H;  1SYF A;  4C3I B;  4IOA A;  2F0P A;  4C3H H;  3OMG A;  4ILW A;  1SXT A;  2R7Z H;  3S24 A;  3F2B A;  2N8N A;  2LY7 A;  4A3K H;  1UWV A;  3DEP A;  3KJO A;  2HQE A;  5C3E H;  3E5S A;  1KTK A;  4F87 A;  3M4Q A;  4UP9 A;  1STG A;  3Q8D A;  4H44 C;  2UU9 Q;  1CM9 A;  4Y7N H;  1U4P A;  2UUB Q;  1VQ7 A;  4BXX G;  2VL6 A;  3NUC A;  3AYH B;  1JJG A;  1GVP A;  1YNN D;  1HNZ L;  4DR4 Q;  3H6M A;  4LFA L;  5GAE C;  2CQA A;  1B1Z A;  3H91 A;  5G3L F;  4KJO A;  4DV7 Q;  3GTK B;  2EJM A;  4ABN A;  1HPC A;  3JAM L;  4A3E B;  1QIL A;  3DM3 A;  1RTN A;  4NW2 A;  4OON A;  3DMU A;  3U50 C;  1Q81 C;  3W2D A;  2RBM A;  4ZYS A;  3J81 j;  2OWO A;  2JA8 H;  4A3M G;  5C4H A;  3AU7 A;  2EXZ A;  1BDO A;  1HHV A;  1BF4 A;  4NXN L;  1IBM Q;  5JJI A;  3QB3 A;  5HUR A;  2F03 A;  1PRT B;  1IYV A;  3KF8 B;  2R6G A;  1PTO H;  1EQQ A;  1E2Z A;  4LF8 Q;  2WIN B;  2WV6 D;  4F7X A;  5AFW A;  2G9H D;  1LAC A;  1VQE A;  2BA1 A;  3J81 L;  1IZ6 A;  1G29 1;  4JBW A;  4FP5 D;  1KIX A;  4B3M L;  3I91 A;  1Y69 U;  1CKM A;  2CWP A;  2LSS A;  5J39 A;  2EXD A;  4OO1 I;  4K5W A;  4CKB A;  1PFN A;  3HS0 C;  4A3F B;  1N32 Q;  4DV6 L;  2QDL A;  3PUY A;  1L1O A;  3FKI G;  2G9D A;  1AH9 A;  3ERO A;  1AZP A;  1KAA A;  1QCB D;  2A69 C;  1G91 A;  3MEH A;  1B2T A;  4DR6 L;  2F0U A;  4LWC A;  1SNM A;  3I4O A;  5FLM G;  4JOI C;  2ZM6 L;  2RCN A;  2ALY B;  1IHZ A;  4KY7 A;  1XPO A;  4IUT A;  3KLW A;  1S5F D;  2Z4H A;  3I55 A;  4JC0 A;  3I72 A;  4B3T L;  5DNF A;  1SEB D;  5AJ3 L;  3GO5 A;  5JJK A;  1N33 L;  1O7I A;  1AW7 A;  4LF6 Q;  2QGQ A;  2TMP A;  1WCM H;  3KLS X;  3CAM A;  3CQZ H;  2OEO A;  4A3I G;  5CV8 A;  2Z0S A;  1AE2 A;  1DM0 B;  1SRO A;  3J81 E;  4POG A;  3U4V A;  2RDG A;  1PHJ A;  2O5J C;  3H94 A;  4EQO A;  2DJG C;  4QIW B;  1PRT C;  4JK1 C;  1W6J A;  4MHE A;  2ID0 A;  3HOY G;  4BY7 B;  1ILQ A;  1II3 A;  1S5D D;  4H0L C;  1NR2 A;  2DY7 A;  4ZK9 B;  1LT5 D;  3PO2 B;  1KDA A;  2NUC A;  4BBR H;  3D8G A;  1KDC A;  1TWH B;  4OX9 Q;  1NMG A;  4PMB A;  1IYJ B;  2NTS A;  2NB0 A;  4KY5 A;  3AEV A;  4UP8 A;  1OXV A;  4ZUI A;  4JV5 Q;  2Q2U A;  2OTJ A;  3LNN A;  5NUC A;  5LMN W;  4IZ8 A;  2Q8I B;  5E7N A;  1ILP A;  1GHK A;  1KL9 A;  3BDC A;  1A2U A;  2Q2T A;  3BS1 A;  1LTT D;  1TKW B;  5FJ8 H;  5IYD H;  2JA5 G;  3PUW A;  1XNQ L;  4FF1 A;  5FO8 B;  3VR4 A;  1HR0 L;  1B4O A;  1MGS A;  4BBS B;  2DY8 A;  4EQ5 A;  1PA6 A;  4R4Q A;  4WJW A;  4K0K L;  1GUT A;  1WTX A;  2K5V A;  1F2Y A;  5IGD A;  4AQY L;  3ERS X;  4KHZ A;  1ICF B;  2F0K A;  4B08 A;  1I3Q H;  3F1Z A;  1PV4 A;  1FGU A;  2SDF A;  5EPK A;  2N3S A;  4EVO A;  3BJU A;  5JEA H;  4X64 L;  2MQH A;  2V1C C;  4XQN A;  2UUC L;  4ALP A;  2D62 A;  1A63 A;  3K81 C;  1EWC A;  2FMM A;  4NMZ A;  5K36 H;  4AYB B;  1JOQ A;  3GD7 A;  2UUA L;  5BR8 Q;  4GKJ Q;  5HY6 A;  4TKO B;  1TQO A;  1KNA A;  1F9S A;  1LO5 D;  3I3C A;  4IUN A;  4U68 A;  1HZA A;  1Z7T A;  1F2M A;  2VQE Q;  2HDM A;  4DV0 Q;  3RZO H;  5CV6 A;  3M4O H;  2JA7 B;  3R3O A;  3GV6 A;  1X32 A;  1T5E A;  2EYM A;  5EKK A;  1F2Z A;  3C1E A;  2E2H H;  2OQK A;  2VXW A;  4DNT B;  2IY5 B;  1WFQ A;  3EIV A;  4OEL B;  1QB5 D;  3AFP A;  4MNO A;  4A3M B;  3CCV A;  1T9H A;  2IPK D;  4O1N A;  2XN9 C;  3STB C;  1DOK A;  4CBV A;  3PUV A;  1Q1B A;  5KYI A;  3DUZ A;  5HGQ A;  1PH5 A;  1QUQ B;  1BCP F;  3QOJ A;  3MA2 B;  4CJ2 C;  1T5X D;  4PZ7 A;  5IYB H;  3R8B A;  3ND8 A;  4N9P A;  4OIJ A;  1XMQ L;  1WOC A;  4AIM A;  2P5Z X;  1WTR A;  2GN5 A;  1LLR D;  2UXB L;  3D6W A;  2KVM A;  5J3B A;  1A3U A;  2B2U C;  4DR7 L;  1YHA A;  3T13 A;  2B2V A;  2A6E D;  1A0I A;  1SE4 A;  1HZ9 A;  2IWH A;  1I5F A;  1HNZ Q;  4IFD I;  1GUW A;  1EQT A;  4LFA Q;  3CC2 A;  5IIF A;  1QJO A;  4RHR A;  4TRD A;  1R4P B;  5J22 A;  3QJY A;  4OO1 G;  3QG1 A;  1ZEQ X;  3DM1 A;  4GNX B;  1R4Q B;  1Z6H A;  3D31 A;  5C4X H;  3FKI H;  2EYO A;  1UE6 A;  1J9O A;  4A3J G;  5I9P A;  3SVM A;  2A8V A;  4HSP A;  5T1I A;  3VR3 A;  5FLM H;  5GQO A;  2EJG C;  4C3J H;  3NQI A;  1PMR A;  1EYA A;  3EN2 A;  4IUU A;  3HOU B;  2O2L D;  4A3G B;  4HN7 A;  4P71 A;  2EE1 A;  1E7Z A;  4GZY C;  2BE5 D;  3S1R H;  2FFK B;  4R8N A;  2AWN A;  1L2F A;  5IP7 G;  3EVQ A;  1HTL D;  5A2Q E;  1SSO A;  4HJ8 A;  3A5Z B;  4HIK A;  4A76 A;  2A73 B;  4RMF A;  1M90 C;  5M5X H;  3J7A 5;  4H02 A;  2GVA A;  3UDX A;  2E5L Q;  4B3M Q;  2FHT A;  2MFI A;  5T1G A;  4RAU C;  1KRS A;  3KLR A;  5A35 A;  1LT6 D;  2CHB D;  5K5P A;  1VQP A;  3BZD B;  3G6E A;  1JJ2 A;  4DR2 Q;  1I6V C;  1BBW A;  2WAQ E;  5LL6 X;  5M3F H;  1SE3 A;  1PYB A;  3QOL A;  5EPL A;  4PZ6 A;  3CCE A;  3S15 H;  4DV6 Q;  2X69 A;  1LM0 A;  4CJ1 B;  1EY4 A;  4DR6 Q;  1EOT A;  2RSN A;  2ZM6 Q;  4DV3 L;  4DFA A;  1STN A;  2YTV A;  1Y1V B;  2DN8 A;  3CP0 A;  3TP5 A;  1PFB A;  1EEF D;  3T51 B;  4Y52 H;  2A69 D;  4LFC L;  2HIV A;  3TRE A;  1SNC A;  4A3L H;  5AJ3 Q;  1YNN C;  3LX0 A;  1TT2 A;  2MPM A;  4GNX C;  2JA5 B;  2PQE A;  1TWA H;  4L8J A;  4P72 A;  3I4M B;  4DAM A;  2K5H A;  3H3V H;  4DA2 A;  1PH2 A;  4PNY A;  2OT2 A;  4X3K A;  3SK6 A;  4K6D A;  4OXP A;  3BU2 A;  1WYD A;  1YZ6 A;  4HIO A;  5C0X G;  3K5L A;  1KC8 C;  3SDZ A;  1BQQ T;  5CYU A;  2E2I B;  3PCO B;  1PH3 A;  4IJH A;  3IL8 A;  1WI5 A;  2KBN A;  2ZXP A;  1N36 L;  4C3I G;  4Q5V A;  3HOZ B;  1MSH A;  5C5M A;  3GDE A;  3J81 i;  5CV7 A;  4O0A A;  4KJN A;  1PDQ A;  2F4V L;  2RKS A;  1O7L A;  3UE0 A;  3TRZ A;  1VQO A;  1CI3 M;  4MTK A;  1EYG A;  1TS3 A;  1PFS A;  5IOC A;  4FXK C;  4MZ9 A;  3S1M H;  2B8F A;  2B2W C;  2EJF C;  2NN6 H;  2X6G A;  4DUY L;  1GM5 A;  1H95 A;  3V96 A;  4FO2 A;  1UEB A;  4C1N I;  3D0F A;  2KEC A;  1IW7 D;  4C1N K;  1QE6 A;  2F0M A;  3O13 A;  1I50 B;  3TQY A;  2MHV A;  2KCT A;  3IKJ A;  1HUM A;  1HNW L;  4K0K Q;  1I6H H;  2C35 B;  3GTO H;  1IXR A;  3CW2 C;  4C2M B;  1PRT F;  2QA4 A;  5IWA L;  1TII D;  4A3B G;  4A3E G;  2CWA A;  3RN2 A;  2EY2 A;  4EQN A;  2Z1C A;  3KDF A;  3J80 E;  2I0Q A;  2Q2I A;  2L0C A;  4X64 Q;  4R1J A;  4HCS A;  4EX5 A;  2IX3 A;  1WTW A;  1Q1E A;  3HOW H;  1X56 A;  4XIG S;  5I2X A;  4JG2 A;  4HAE A;  3K6O A;  4ID6 A;  3K5M A;  3EBE A;  1GHJ A;  1YVC A;  2Z6K A;  3GTP H;  4IQZ A;  4IFD G;  1Y14 B;  1MHW C;  1Q12 A;  4DGZ A;  3Q23 A;  1JB7 A;  4JI6 L;  2QDB A;  5I9O A;  4TVA B;  3MXU A;  4IUR A;  2L11 A;  1EU4 A;  2MO0 A;  3A54 A;  2KCM A;  3TZD A;  2BA0 A;  3PUX A;  2ZJQ A;  2EYJ A;  4CHT B;  3OYY A;  2M00 A;  1NE3 A;  1EIY B;  1FNV A;  3H0G B;  2B63 H;  1TWC B;  4A3J B;  1MIU A;  1ZYR D;  4UDU C;  1L0X B;  3GTJ H;  4X66 L;  4JBJ A;  3HEJ A;  4GOP A;  4KHV A;  4GKK Q;  2XRQ D;  1QOH A;  3HZX A;  4KLK A;  3TEH B;  4A3F G;  2NTT A;  4A93 G;  3KK7 A;  3G48 A;  4P2C B;  5DM6 3;  2EQS A;  3SHL A;  3A0J A;  2L5T A;  4GN5 A;  1XMQ Q;  4A3C G;  3L9A X;  2SNS A;  1STE A;  1DOL A;  2UXB Q;  3M3Y H;  2JA9 A;  1SYE A;  2B2T A;  3M9B A;  3W1G A;  1HCZ A;  2VQF L;  3BDL A;  4FXD A;  1RIP A;  3L0O A;  3KBX A;  2IX0 A;  4A3D H;  3S16 H;  2K04 A;  3ICE A;  2E2D C;  2F0G A;  4LK1 C;  3C2P A;  1Q8I A;  5M5Y B;  3J7A V;  1HXY D;  1B9M A;  3J7Z C;  2HCC A;  2HHH L;  1H9J A; 
#chains in the Genus database with same CATH homology
 1OTC A;  2UXC L;  1HH2 P;  1CKM A;  2FXQ A;  1QZG A;  1OXS C;  2CWP A;  3HFZ B;  2JQO A;  1Z47 A;  1A62 A;  1B8A A;  3PIP A;  1BVS A;  2LSS A;  4LF9 L;  2EXD A;  1B7Y B;  4OO1 I;  3CCU A;  1N9W A;  2VUM H;  1YEZ A;  1X3F A;  4IPH A;  3CME A;  3PUY A;  1L1O A;  3FKI G;  4LUZ A;  3CXC A;  1KHI A;  4DV6 L;  4DV7 L;  1CKN B;  1YI2 A;  4BY7 G;  5JJL A;  5M5W H;  3NBH B;  2ATW A;  4FDB A;  4DR6 L;  1PH7 A;  2XGT A;  4LWC A;  1D7Q A;  4ME3 A;  3I4O A;  3KF6 A;  4JOI C;  3RLO A;  5FLM G;  1U0L A;  2RCN A;  2ZM6 L;  2ALY B;  1M1K C;  4GKK L;  4QY7 A;  1HJP A;  3A74 A;  1XPO A;  2IT1 A;  5C4J H;  3F2D A;  3KLW A;  1QZH A;  1E3P A;  2R93 G;  2AKW B;  4LW1 A;  3ZJY C;  4DK3 C;  4L5R C;  4PG3 A;  1YHB A;  3I55 A;  2K5N A;  4BY7 H;  2YYZ A;  1HZC A;  1VQF A;  1XNQ Q;  4JC0 A;  4GLX A;  4B3T L;  2IHF A;  5FLX c;  1V1Q A;  4DV1 Q;  1HR0 Q;  1SN8 A;  1I50 H;  1P8L A;  3GO5 A;  4OWT B;  5AJ3 L;  3T1Y L;  2KHJ A;  1O7I A;  3CMA A;  1K8G A;  2QGQ A;  2R7F A;  4LF6 Q;  3HOW G;  3I4N H;  4LFB L;  4JCV E;  1VQD A;  2VZA A;  1WCM H;  4JBM A;  1JE5 A;  5H1S E;  2ZJP A;  3CAM A;  3CQZ H;  3KYH C;  5C3E G;  4PZ8 A;  5GRO A;  2I5H A;  3RNU A;  1VQ5 A;  3HOX H;  3NEN A;  1VQ4 A;  2BH2 A;  4LF4 L;  4AQY Q;  1YJN A;  4A3I G;  2WP8 J;  3NEM A;  3TS2 A;  4BBS G;  2Z0S A;  1AE2 A;  1SRO A;  1UE7 A;  1Y1W H;  4IO9 A;  5IYC G;  4POG A;  4LUO A;  3BZC A;  1NY4 A;  3U4V A;  1PH6 A;  1PHJ A;  1X3E A;  1SR3 A;  2UUC Q;  3HOU H;  1N34 Q;  4A3G H;  2RHS B;  4DV3 Q;  1PYS B;  2ID0 A;  1GD7 A;  2HT1 A;  3HOY G;  4JI4 Q;  2B63 G;  2Y0S E;  1EWI A;  1MKH A;  3E9H A;  4JBK A;  3S17 H;  2UUA Q;  1N8R C;  4BBR H;  4DAY B;  1VQC A;  4OX9 Q;  5LMU L;  3GTL H;  1NMG A;  3HKZ E;  2JA6 H;  1IYJ B;  1I94 L;  5GAG C;  1MJC A;  4DV5 Q;  3L2P A;  3VDY A;  3AEV A;  4UP8 A;  1TXY A;  1OXV A;  4AYB G;  2XTI A;  3L7Z C;  3CCM A;  4JV5 Q;  4GLV B;  3CC4 A;  4DR3 L;  2Q2U A;  2OTJ A;  1RL2 A;  2JA8 G;  4NB3 A;  4P73 A;  5LMN W;  2YU9 H;  3F8T A;  2R7D A;  4O2D A;  5E7N A;  1KL9 A;  2Q2T A;  4DKA C;  4IOC A;  4DUZ Q;  2K50 A;  2NZH A;  5FJ8 H;  5IYD H;  4MTN A;  4YCW A;  2CKZ B;  4A75 A;  1LTL A;  2JA5 G;  2JA7 G;  3PUW A;  1XNQ L;  4R4I A;  3NEL A;  1OXU A;  1A8V A;  2K52 A;  2MO1 A;  3AFQ A;  3FHW A;  1E22 A;  3H0G H;  1HR0 L;  1N33 L;  2VNU D;  2K4K A;  4A3J H;  3GTK H;  1C9O A;  1EOV A;  5IT9 c;  4EQ5 A;  4DV4 Q;  4A3D G;  1BKB A;  1PA6 A;  1VQL A;  4R4Q A;  4KHP Q;  3PV0 A;  4K0K L;  4JOI A;  2K5V A;  4YCU A;  1Y1V H;  1NMF A;  3CCS A;  4AQY L;  3W1B A;  3ERS X;  4KHZ A;  4POF A;  2OTL A;  1YBY A;  3U4Z A;  2AHO B;  1PH8 A;  1I3Q H;  3F1Z A;  1B70 B;  1FGU A;  5GAH C;  1PV4 A;  4JI7 L;  2BH8 A;  2Y0S G;  4HIM A;  1JT8 A;  4BA1 I;  5IP7 H;  2N3S A;  4X62 L;  3BJU A;  4X64 L;  3J80 c;  2MQH A;  2OQ0 A;  2V1C C;  1YJ9 A;  3RZD H;  1KQS A;  3GTG H;  4DR7 Q;  4ALP A;  2D62 A;  2OCE A;  3W5O A;  1A63 A;  3K81 C;  1VQA A;  2NVQ H;  4DUY Q;  1YIJ A;  2VUM G;  4B3R L;  5JEA J;  1K3R A;  4B3S L;  4WJ3 M;  4IPG A;  2GVB A;  3GD7 A;  1XJV A;  1X9N A;  4JI2 Q;  2UUA L;  5BR8 Q;  4OWW B;  5HY6 A;  1FJG Q;  4GKJ Q;  4YY3 L;  2K75 A;  2I5L X;  1X65 A;  1KRT A;  4GN4 B;  4YHH Q;  1HZA A;  1ASY A;  2VQE Q;  2L15 A;  3G4S A;  4JI0 Q;  2RHQ B;  4DV0 Q;  3RZO H;  2UXD L;  1CUK A;  3PUZ A;  4LUV A;  4DR1 L;  3M4O H;  2UU9 L;  4JV5 L;  2E2I H;  2UUB L;  2RF4 A;  5IP9 G;  1HNX Q;  1XNR L;  4JYA L;  1HNW Q;  4LNQ A;  4AH6 A;  2E2H H;  1KAW A;  2E2J H;  2OQK A;  5IWA Q;  3ULP A;  1S72 A;  1UE5 A;  3I4N G;  4DR4 L;  1NTG A;  2CCZ A;  1MJE A;  3HOV H;  3MEF A;  3HOZ H;  2IY5 B;  1EFW A;  1WFQ A;  3EIV A;  1AH9 A;  3AFP A;  3HKS A;  4L5Q A;  2PI2 E;  4MNO A;  4YWL A;  1HZB A;  2PQA A;  3KFU A;  3HOX G;  3CCV A;  4HID A;  1T9H A;  4A4I A;  3SGI A;  5IE8 A;  4IPC A;  3K8A A;  3RLN A;  4DV4 L;  5M3M G;  1VQH A;  2WAQ G;  3E0E A;  3STB C;  1Y1W G;  3PO3 H;  3PUV A;  1Q1B A;  1I94 Q;  5HGQ A;  4AYB E;  3I7F A;  2PNH A;  3G71 A;  3T1H Q;  1QUQ B;  2N78 A;  1PH5 A;  1YIT A;  4PZ7 A;  5IYB H;  3HOU G;  4LF5 Q;  4X65 Q;  2VW9 A;  1K8A C;  1IBL Q;  1XMQ L;  1WOC A;  4A3G G;  4AIM A;  4HJ9 A;  2R92 G;  2GN5 A;  4JI8 L;  2UXB L;  1IBM L;  1CKN A;  1CSP A;  2R7Z G;  3J80 i;  3S1N H;  5J3B A;  4NXM Q;  3ULL A;  4A3K G;  1VQ8 A;  3OTO L;  4DR7 L;  4QGU A;  1YHA A;  1X6O A;  1CSQ A;  4BBR G;  1IBK Q;  3F2C A;  2JA6 G;  1A0I A;  4C2M H;  1HZ9 A;  4P75 A;  4DPG A;  1I5F A;  1KD1 C;  1HNZ Q;  4LF8 L;  1NJI C;  4IFD I;  5C0X J;  3M4P A;  4LFA Q;  3CC2 A;  3KDF B;  4XTC S;  4C3I H;  2JEA I;  4OO1 G;  1S3O A;  4DV0 L;  1WJJ A;  3UDG A;  4GNX B;  2ZTE A;  5JJK A;  2WB1 E;  3D31 A;  5FJ8 G;  5IYD G;  3CCJ A;  2D0P A;  4IPD A;  2CQO A;  4DR5 Q;  1XMO Q;  5C4X H;  5GAD C;  1DGS A;  3FKI H;  4UPA A;  4YWM A;  3TS0 A;  1UE6 A;  2D0O A;  4A3J G;  2A8V A;  4L5T A;  4JI1 Q;  5FLM H;  4JI3 Q;  4LFC Q;  3DLL A;  3H3V I;  3PO2 H;  2JE6 I;  5GQO A;  3PGZ A;  1TWH H;  3I2Z A;  3LGJ A;  3JAM c;  2NVT H;  1N32 L;  4C3J H;  3EN2 A;  1Y1V G;  4DV2 Q;  1JJC B;  4HJ7 A;  4OWX B;  3AQQ A;  4P71 A;  3S2H H;  1E7Z A;  3CF5 A;  2K14 A;  3S1R H;  2MNA A;  1Q82 C;  1VQ6 A;  2JK8 A;  2AWN A;  4QL5 A;  1L2F A;  4RG1 A;  4GLA C;  2AMC B;  5IP7 G;  5JEA G;  1ASZ A;  2E8G A;  3ER0 A;  1VS0 A;  3U58 A;  1XPR A;  1VQ9 A;  4DV1 L;  4HJ8 A;  3A5Z B;  1K9M C;  1TWC H;  1XPU A;  3I4M G;  1P16 A;  1U5K A;  5K36 G;  4LF6 L;  4HIK A;  4A76 A;  4DK6 C;  1HR0 W;  1FVI A;  2YTX A;  4A3E H;  4RMF A;  4A3B H;  1M90 C;  5M5X H;  1EIF A;  4H02 A;  4GOP B;  2GVA A;  3CD6 A;  1YJW A;  3J7A 5;  4YCV A;  3UDX A;  2E5L Q;  2HHH Q;  4B3M Q;  2MFI A;  3CC7 A;  1IBK L;  1L0W A;  1N36 Q;  1KRS A;  1K73 C;  3M7N A;  1LYL A;  1J5E Q;  1VQP A;  1VQJ A;  3G6E A;  1JJ2 A;  2WB1 G;  2NN6 I;  5C0X I;  4DR2 Q;  4LF9 Q;  1BBW A;  2WAQ E;  3K80 C;  5M3F H;  3J81 c;  1PYB A;  2QEX A;  3ULJ A;  4PZ6 A;  3CCE A;  2F4V Q;  3S15 H;  4DV6 Q;  2ZJR A;  3E9I A;  1VCI A;  3UE1 A;  1C7Y A;  1LM0 A;  3K7A H;  2B3G A;  1N34 L;  4DR6 Q;  4DV3 L;  1W2B A;  2ZM6 Q;  3HOV G;  3HOZ G;  4DR5 L;  1X55 A;  2NVY H;  2YTV A;  4JI4 L;  1OXT A;  3CP0 A;  4IFD J;  3IRB A;  4Y52 H;  4BXX H;  1UE1 A;  4LFC L;  4JI1 L;  1VQM A;  4OX9 L;  2HIV A;  3TRE A;  2PI2 A;  4PMW A;  3RR5 A;  2IHE A;  4A3L H;  5AJ3 Q;  4DV5 L;  3T1Y Q;  1QVF A;  3STB D;  4GNX C;  5M5Y H;  3PO3 G;  5IY0 A;  2KEN A;  1TWA H;  4P72 A;  2JA7 H;  3GTQ H;  4LFB Q;  1S40 A;  3CPW A;  4DAM A;  2K5H A;  3JC6 6;  5IYB G;  3H3V H;  1PH2 A;  5EAY A;  4JI5 Q;  3S14 H;  1V9P A;  3CCR A;  4LF4 Q;  4DUZ L;  1TWF H;  4BA2 I;  1WCM G;  2Z6K C;  1VQG A;  4OXP A;  3BU2 A;  1K0R A;  3KOJ A;  2LXJ A;  4YWK A;  1Q8K A;  1WYD A;  5ELN A;  4A3F H;  1L1O B;  1YZ6 A;  4KI0 A;  4HIO A;  4A93 H;  1E1T A;  1G6P A;  1Q46 A;  5C0X G;  1KC8 C;  1J6Q A;  4A3M H;  1YHQ A;  1YNX A;  3PCO B;  1PH3 A;  3KF6 B;  3S1Q H;  1V43 A;  2LXK A;  3H15 A;  2E5L L;  4BY1 H;  1N32 Q;  4IJH A;  4A3C H;  3FP9 A;  1WI5 A;  5DLQ E;  2KBN A;  1N36 L;  1KXL A;  4TQU S;  1QVC A;  1J5E L;  1C0A A;  1R9T H;  2YV5 A;  3MXN B;  3GDE A;  4DR2 L;  4R4O A;  3J81 i;  4O0A A;  5LMU Q;  2F4V L;  5C4X G;  1IL2 A;  4JI6 Q;  2EIF A;  3UE0 A;  3TRZ A;  4GOP C;  1VQO A;  3CCL A;  4GS3 A;  1OXX K;  1EYG A;  4KHP L;  5C44 H;  1PFS A;  2DUD A;  4MZ9 A;  4GN3 B;  5LMN Q;  4DR3 Q;  2ASB A;  3S1M H;  2ZTC A;  2CFM A;  3PO2 G;  1QVG A;  4DUY L;  2HQL A;  1GM5 A;  1H95 A;  1UEB A;  4JI2 L;  5BR8 L;  1FJG L;  1QUQ A;  1W3S A;  2A1A A;  2A19 A;  4GKJ L;  5IP9 H;  3D0F A;  4LF7 Q;  1SLJ A;  4YHH L;  1SFO H;  1VQN A;  3TQY A;  2VQE L;  4JI0 L;  2IX1 A;  2DGY A;  2KCT A;  4WJ4 A;  1JMC A;  1SE8 A;  4X66 Q;  1K83 H;  2WFW A;  1CKO A;  3GTM H;  3K7U C;  1HNX L;  1VQI A;  1HNW L;  4IJL A;  4K0K Q;  1I6H H;  2C35 B;  1D8L A;  3H0G G;  4UP7 A;  1IXR A;  3CW2 C;  3WWV A;  3GTO H;  3BZK A;  4JI5 L;  2QA4 A;  1E1O A;  5IWA L;  4P74 A;  4A3B G;  4A3E G;  5M3M H;  4DNI A;  2CWA A;  3RN2 A;  1EUJ A;  4QQB X;  3S2D H;  3I56 A;  3K0X A;  4JI7 Q;  2R93 H;  3KDF A;  4IOA A;  4NXN Q;  1TWG H;  1Q86 C;  2I0Q A;  1Z9F A;  2Q2I A;  1SRU A;  4X62 Q;  4X64 Q;  4GNX A;  2VY3 A;  4R1J A;  1FL0 A;  4C3H H;  4EX5 A;  2VQF Q;  5ELO A;  1Q7Y C;  1VQK A;  1Q1E A;  5M3F G;  1GO3 E;  2AWO A;  2N49 A;  2R92 H;  4B3R Q;  3HOW H;  1X56 A;  4L5S A;  4B3S Q;  2R7Z H;  3S24 A;  4XIG S;  2N8N A;  3F2B A;  3T1H L;  4A3K H;  1E24 A;  1UWV A;  4JG2 A;  4APV A;  2F3I A;  1AE3 A;  4YY3 Q;  3KJO A;  3PF5 A;  5C3E H;  1L1O C;  4X65 L;  1PH1 A;  1IBL L;  3EBE A;  4LF5 L;  2Z6K A;  1YVC A;  3GTP H;  4IFD G;  1EQR A;  1Y14 B;  1Q12 A;  3M4Q A;  4UP9 A;  4A3I H;  3OW2 A;  4UY8 C;  1JB7 A;  2NVX H;  4JI6 L;  4BBS H;  2UXD Q;  1X54 A;  3Q8D A;  4DR1 Q;  4TVA B;  4NXM L;  2YTY A;  2UU9 Q;  3RLF A;  5LMN L;  4Y7N H;  5IYC H;  2UUB Q;  1VQ7 A;  4JYA Q;  2MO0 A;  1XNR Q;  4BXX G;  2UXC Q;  2VL6 A;  3UDI A;  1PVO A;  2KCM A;  2ES2 A;  3PIO A;  2BA0 A;  3AYH B;  2F52 A;  3PUX A;  2ZJQ A;  4A3L G;  1JJG A;  1SMX A;  1GVP A;  1HNZ L;  1BBU A;  4DR4 Q;  3OYY A;  4LFA L;  1NE3 A;  5GAE C;  4LF7 L;  3HOY H;  1EIY B;  4J15 A;  2B63 H;  2B29 A;  1PH4 A;  4DV7 Q;  1MIU A;  1NBW A;  3M85 A;  3RN5 A;  3GTJ H;  3DM3 A;  4JBJ A;  4X66 L;  4GOP A;  4GKK Q;  4HJ5 A;  1XMO L;  4NPS A;  4OON A;  4QIW E;  3PF4 A;  2UUC L;  3U50 C;  3B6Y A;  4KLK A;  3TEH B;  3CPF A;  1Q81 C;  4A3F G;  4A93 G;  3J81 j;  2OWO A;  2JA8 H;  4A3M G;  2Q2H A;  3G48 A;  2I5M X;  4R4C A;  4JI3 L;  1GKH A;  3A5U A;  3KJP A;  2EQS A;  3JAM i;  3A0J A;  4B3T Q;  4BY1 G;  4GN5 A;  1XMQ Q;  1X3G A;  4A3C G;  1N33 Q;  4X6A H;  4NXN L;  2NZO A;  2PMZ E;  4JI8 Q;  1IBM Q;  3M3Y H;  2UXB Q;  4DV2 L;  2JA5 H;  2JA9 A;  5JJI A;  3M9B A;  3OTO Q;  4HJA A;  3W1G A;  2KHI A;  3I4M H;  2VQF L;  3HKZ G;  1RIP A;  4R4T A;  3L0O A;  2H5X A;  3KF8 B;  2R6G A;  1XTD A;  1G51 A;  2IX0 A;  1EQQ A;  4A3D H;  3S16 H;  4LF8 Q;  2HIX A;  5C44 G;  3ICE A;  2VS1 A;  1VQE A;  2NN6 G;  2PQA B;  3PSI A;  2BA1 A;  2JEB I;  1IZ6 A;  1G29 1;  2ZTD A;  1PH9 A;  4JBW A;  2JJQ A;  3J7Z C;  3CCQ A;  1VQB A;  1KIX A;  2HHH L;  4B3M L;  3UDF A;  4QJF A;  1LUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...