2KCMA

Solution nmr structure of the n-terminal ob-domain of so_1732 from shewanella oneidensis. northeast structural genomics consortium target sor210a.
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
MKGKVVSYLAAKKYGFIQGDDGESYFLHFSELLDKKDEGKLVKGSMVHFDPTPTPKGLAAKAISLPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleic acid binding protein
molecule keywords Cold shock domain family protein
publication title Solution NMR structure of the N-terminal OB-domain of SO_1732 from Shewanella oneidensis. Northeast Structural Genomics Consortium Target SoR210A.
rcsb
source organism Shewanella oneidensis
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2kcmA00
1YHQA 1B7YB 2ZJRA 1X54A 4DV4L 2UU9L 4A3EH 4JI2L 2KCMA 5FLXc 1J5EQ 1E7ZA 3TRZA 4A3GH 4O2DA 1TWHH 4IPGA 3MEFA 4DAYB 3TS2A 3GTOH 4DV1Q 1SMXA 1P8LA 4DV2Q 1RL2A 2EXDA 1NJIC 3J81c 1X55A 4P72A 4DV0L 1X3FA 2B3GA 1C7YA 1KIXA 5IYCH 1CSQA 3S16H 2UXCQ 2UXDL 3GD7A 3CCSA 1A0IA 3FKIG 4A75A 3RN5A 1K83H 2KBNA 3J80c 1VQAA 2QEXA 5IYDG 3S1MH 4DR7Q 5IT9c 2ZM6L 2CCZA 2JA6H 1CKNB 1FGUA 2IT1A 4GN5A 2YYZA 4HJ8A 2AMCB 1MJEA 4JOIA 3J80i 1N34Q 1E3PA 2K50A 4A3JH 2I0QA 5IP9H 1NBWA 1Y1WH 2QA4A 4BBSG 3HOUH 4LUOA 2VY3A 1PH6A 3CCEA 1C9OA 1Q46A 1K0RA 2JA5H 4B3RQ 1IBLL 2F4VQ 1TWAH 3NEMA 1XNQQ 1XMQQ 2NVQH 1PH5A 4APVA 1VQKA 2BA0A 5IWAL 3A5ZB 5M5WH 2WB1E 3FHWA 3G4SA 1OXVA 4R4CA 3M7NA 2E2IH 1LM0A 4XTCS 1N33Q 3CQZH 1WOCA 1VQGA 2D0OA 3BZKA 3E9HA 4ME3A 5IE8A 2Q2UA 4OWWB 3CCRA 4LUZA 5AJ3Q 1HH2P 1KHIA 1PYBA 3PUVA 3PO3G 3S24A 4JI4Q 2PQAB 4DR1Q 1C0AA 3PGZA 1VQBA 1SE8A 4JI3L 5BR8Q 3WWVA 1XPRA 3ER0A 4A3FH 4P74A 4R4OA 4AYBE 2BH8A 4C2MH 1UE1A 2C35B 5IP7G 1FVIA 4R4TA 2H5XA 4UP8A 4BY1G 3L2PA 4B3MQ 4L5SA 4LF4L 2ZTCA 3FKIH 4AIMA 2WB1G 3KF8B 4GLXA 1Q1EA 5LMNW 1HNZQ 2E5LQ 3H0GG 4OONA 4JI6L 1FJGL 4GKJL 2WP8J 4LF7Q 5IYDH 4LUVA 2ZJPA 4LFBQ 5M3MG 3CMAA 3VDYA 5GQOA 4LFAL 1HNXL 2LSSA 2R7FA 4LWCA 1IXRA 3CCUA 4QGUA 4DNIA 4KHPL 4BBSH 1U5KA 3CAMA 2D62A 3RLOA 3HKZE 3A0JA 4YY3L 4JI1Q 4LF8Q 2IHEA 4DV3L 1HR0W 1VQOA 3H3VH 1NMFA 4FDBA 4JCVE 4IOCA 2IX0A 1Z47A 3FP9A 5GAEC 4JYAL 3KDFB 2RCNA 1SROA 3D0FA 4BBRG 4DUZQ 3S1RH 1XPUA 1SRUA 1UE6A 3M3YH 4LNQA 2Y0SE 1I3QH 2OQ0A 4PZ8A 4UP9A 3CPFA 4YCWA 4LF6Q 2IX1A 1HZ9A 3KJOA 4DV5L 4P73A 4DV7Q 1WI5A 3HKSA 4BA1I 1N32Q 4IPDA 1GM5A 1K8AC 5C4JH 5JJIA 5HY6A 4P71A 1Q81C 3HFZB 3PUYA 4IJHA 2UUAQ 1QUQB 1P16A 1N36L 3UE0A 3H3VI 1XJVA 1K73C 4NXML 1VQEA 3RLFA 1GVPA 1K8GA 1Q8KA 3PO3H 2K14A 2R6GA 4DR2Q 4JI8Q 4C3HH 2HHHQ 2K75A 1PH7A 1E22A 1I50H 2MFIA 5IP7H 4A3MG 1KQSA 2UUCL 2F3IA 3UE1A 3UDIA 4DUYQ 4B3TQ 4OX9L 3GTPH 2E8GA 4GLAC 2VQFQ 4BY1H 3M9BA 1QZHA 2MQHA 2ZTEA 3ERSX 4OWTB 2NVXH 3H0GH 4LF5Q 2YU9H 1L1OB 5DLQE 1TWCH 2V1CC 4IO9A 1EYGA 4LF9Q 5M3MH 3RNUA 3ULLA 1OXSC 4IJLA 3W1BA 4DR5L 3OTOL 2VL6A 4DV6Q 1PH2A 4QY7A 4GNXA 1G51A 3EBEA 5GADC 3S14H 5H1SE 4DKAC 2N8NA 3GTJH 1UE7A 2MO0A 4DR3L 1V43A 1A8VA 1VQFA 4HIKA 1WFQA 2MO1A 4BBRH 2R93G 3AFPA 1WYDA 4Y7NH 3S1QH 4DR4L 4P75A 3M85A 3BZCA 1L1OA 3U4VA 4IPCA 5HGQA 4YHHQ 3H15A 1TWGH 2UUBL 3CC7A 1D8LA 1FL0A 2VQEQ 4A3IG 3S2DH 4IFDG 2BH2A 1L2FA 4X66Q 4A3FG 1J5EL 4IFDJ 3ULJA 3JAMc 4BY7G 1IYJB 1Z9FA 1Y1VG 4DV1L 4HIMA 4X65Q 3PUWA 4DV2L 3OW2A 1Q82C 1VQ7A 4B3SQ 1RIPA 3RZOH 5JEAG 3J81i 1W2BA 1EOVA 4A3KG 1Q86C 3GTGH 5JEAJ 3JAMi 1EIYB 2YTVA 5M5YH 1I94Q 1VQDA 1MJCA 1OXUA 1A63A 4AQYQ 1MKHA 1W3SA 3U58A 4A3MH 4DR7L 2N3SA 4C3JH 1Q1BA 4R1JA 4NPSA 4RG1A 1BKBA 3PF5A 1QVFA 4GKKQ 3ICEA 3SGIA 1I5FA 3CD6A 2OQKA 2Z6KC 1N34L 3PCOB 1VQ5A 4L5RC 4BA2I 2HT1A 1D7QA 1PH9A 2PI2E 4K0KQ 1YJNA 3HOXH 3CP0A 2R7DA 4GOPB 1B8AA 2F4VL 1Q7YC 1XNQL 2JEBI 4BXXG 3TEHB 3CPWA 1XMQL 3T1YQ 4DAMA 4A3DG 3KOJA 3G6EA 1XMOQ 3TS0A 3KJPA 4MTNA 1NMGA 3K0XA 3HOZG 2R93H 4GOPA 4JG2A 1J6QA 1N33L 4ALPA 1HNWQ 3BU2A 1CKMA 4A3IH 3AFQA 2KHJA 5AJ3L 1L1OC 1A62A 4YWMA 4JI5Q 1TXYA 3NELA 1SFOH 3CCLA 4JI0Q 4BY7H 4JI4L 4UP7A 4DR1L 3PF4A 1Y1VH 5BR8L 1N8RC 5C4XG 5LMUQ 2OTJA 2ES2A 3STBD 5LMNQ 4A3KH 3A5UA 2OTLA 4R4QA 2LXKA 3J7ZC 3S17H 1VQJA 2HIVA 4B3ML 3NBHB 2R92G 2Q2TA 2E5LL 1HNZL 2E2JH 1IL2A 4JI3Q 1YVCA 4JBKA 3S2HH 3PIPA 1UWVA 4LF7L 4WJ4A 4IFDI 4LFBL 3I56A 2NVTH 1HZAA 4JI7Q 4DR6Q 1X3GA 2GVBA 1VQ9A 1AE3A 1VQMA 3M4OH 5ELNA 1QVGA 1GKHA 1HR0Q 4LF4Q 3HOVG 3M4PA 1YI2A 4JI6Q 4JV5Q 5M3FG 2XGTA 3EIVA 1S72A 4JI1L 2UXBQ 4LF8L 4XIGS 2JE6I 1M1KC 4KI0A 1EUJA 2XTIA 4L5TA 3RZDH 4MNOA 4DUZL 3BJUA 4NXNQ 4BXXH 4Y52H 4A3DH 4LF6L 3U4ZA 1LUZA 2EQSA 3UDFA 1VQ6A 3T1HQ 1PH4A 1UE5A 2ALYB 2JK8A 4DV7L 3UDGA 1YITA 3HOYG 3PO2G 1X65A 2N49A 2AKWB 1JJGA 3M4QA 1N32L 3HOZH 3KF6B 3K8AA 2NN6G 4JBJA 1YBYA 2B29A 4PZ6A 4UPAA 3CCMA 1IBKQ 1OTCA 2JJQA 2UUAL 4GN4B 1G6PA 3K80C 4TQUS 2I5HA 2YTXA 1WCMG 2JQOA 2HIXA 4JBWA 5C0XG 3G48A 1S40A 3D31A 2CQOA 2ATWA 5JJLA 1JJCB 1YNXA 4EX5A 5C0XJ 3PUZA 2VNUD 3KF6A 4A4IA 1AH9A 4GNXB 4DR2L 4JI8L 5C4XH 2DGYA 1GO3E 1YEZA 1OXXK 3UDXA 4TVAB 3I4NG 3S15H 4DK3C 4B3TL 4DUYL 1XNRQ 2R92H 2VQFL 3HOXG 3GTKH 4HJAA 1VQHA 4LF5L 3GTLH 1X9NA 3KYHC 3U50C 3CF5A 3JC66 1NE3A 3GTMH 1PVOA 2FXQA 4LF9L 2VS1A 2CKZB 3F1ZA 3I55A 1K9MC 2KENA 3W1GA 1GD7A 4RMFA 1X6OA 2VW9A 4DV6L 1VQCA 1KC8C 2PI2A 1SR3A 3CCQA 2K52A 3F2BA 5M3FH 2Q2IA 4LFCQ 4H02A 3G71A 1IBMQ 4X64Q 1OXTA 2NVYH 3MXNB 3AQQA 2AWOA 5E7NA 1PHJA 1DGSA 2NZHA 1VQLA 4IPHA 1BVSA 1EQQA 3GO5A 2ASBA 2KHIA 5C3EG 4X62Q 4YHHL 2JA7G 3STBC 5J3BA 3HOYH 4GKJQ 5GAHC 3PO2H 2R7ZG 4X6AH 3CMEA 4YWKA 4DV4Q 4X66L 1KRSA 2UU9Q 1NTGA 4JI2Q 3CC4A 4HJ9A 2YV5A 4GN3B 5EAYA 2VUMG 4OO1G 5JJKA 2N78A 2UXCL 4B3SL 4X65L 4A3CG 1LTLA 1YHBA 1KRTA 3AYHB 1YIJA 3KFUA 1UEBA 1WCMH 2UUBQ 2RF4A 2WFWA 3I4MG 4DV0Q 3PSIA 3NENA 2NZOA 3F2DA 1I94L 1PFSA 4GS3A 1VQNA 4AQYL 2UXDQ 4HJ5A 3DM3A 3I4NH 1VQPA 1KAWA 2PNHA 3GDEA 5ELOA 2JA8G 2ZM6Q 5K36G 2NN6I 4GKKL 1AE2A 4KHZA 4AH6A 3DLLA 1XPOA 3E9IA 2YTYA 4B3RL 5FLMG 3TQYA 4YWLA 3A74A 4DK6C 2JEAI 4K0KL 1EIFA 3K81C 1U0LA 4DPGA 5M5XH 4HIDA 5C0XI 3HOVH 4A93G 2ZTDA 3CC2A 1V1QA 3CCJA 3S1NH 4QQBX 4OXPA 5IY0A 1IBLQ 1JB7A 1XTDA 2DUDA 3T1YL 1XMOL 4A3BG 4JC0A 1CKNA 4GNXC 2L15A 5IWAQ 5GROA 1EWIA 2CWPA 1NY4A 1VQ8A 5C3EH 3L0OA 1QZGA 1R9TH 4LW1A 2B63G 2JA7H 2MNAA 4KLKA 4IOAA 1HNWL 2WAQE 1VCIA 3CCVA 3RR5A 1E24A 4PG3A 2R7ZH 1YZ6A 1EQRA 1JMCA 3J7A5 2A8VA 1MIUA 2ZJQA 3PUXA 4JI5L 2VUMH 4QL5A 4JI0L 3HOWG 3EN2A 1YJ9A 4A3CH 3B6YA 2AHOB 1PV4A 5LMUL 1WJJA 4WJ3M 1CSPA 5LMNL 1VQ4A 3I4MH 3E0EA 3IRBA 1BBUA 3KLWA 1KL9A 4EQ5A 1PA6A 2K5HA 3Q8DA 1H95A 2RHQB 5FJ8G 1KXLA 3CW2C 3K7AH 1FJGQ 4R4IA 2GVAA 4L5QA 5C44G 3K7UC 4JBMA 4UY8C 2JA8H 3I7FA 4JI7L 4DR6L 4OO1I 2WAQG 4JOIC 4LFAQ 1HNXQ 1HR0L 1T9HA 3I4OA 3F8TA 5FLMH 4JV5L 1B70B 2PQAA 1JJ2A 2I5MX 1E1OA 4NB3A 4A93H 4KHPQ 5IYBG 1ASYA 1JE5A 1HZCA 2UXBL 2RHSB 1YHAA 4YCUA 4YY3Q 2Z0SA 3J81j 2KCTA 4A3LG 4DV3Q 1TWFH 5GAGC 4NXNL 4OWXB 2K5NA 2PMZE 3I2ZA 4A76A 4JYAQ 3W5OA 1X3EA 2VZAA 4PZ7A 4A3BH 3T1HL 3L7ZC 4HIOA 1HZBA 2IY5B 4DV5Q 4AYBG 4C3IH 2F52A 1KD1C 1ASZA 4DR4Q 1E1TA 4A3EG 1PH8A 1IBKL 1EFWA 3ZJYC 3F2CA 2B63H 4A3GG 4J15A 1G291 2CWAA 2A1AA 1V9PA 2EIFA 3ULPA 1SN8A 1N36Q 2HHHL 4GOPC 2D0PA 1SLJA 1PH1A 2CFMA 2K5VA 1VS0A 3KDFA 1CKOA 5IYCG 4NXMQ 3HOWH 2A19A 4MZ9A 2QGQA 1CUKA 3PV0A 4QIWE 1PH3A 1O7IA 1S3OA 1N9WA 2Z6KA 2Q2HA 1L0WA 1LYLA 2JA9A 4POFA 3RLNA 3HKZG 4QJFA 2OCEA 2IHFA 2UUCQ 1XNRL 2JA6G 1PYSB 4OX9Q 2K4KA 1M90C 1VQIA 1HJPA 1X56A 2I5LX 5FJ8H 3AEVA 2AWNA 3LGJA 2OWOA 1QUQA 4A3JG 4PMWA 5C44H 5IP9G 3TREA 1Y1WG 1QVCA 2Y0SG 3GTQH 3HOUG 1K3RA 1Q12A 2ID0A 4GLVB 4DR5Q 4LFCL 4O0AA 3OTOQ 2JA5G 3OYYA 1BBWA 3CXCA 2E2HH 3PIOA 1I6HH 2BA1A 5IYBH 2LXJA 4X64L 4HJ7A 1IBML 4YCVA 1JT8A 4A3LH 4DR3Q 3RN2A 2VQEL 2GN5A 2HQLA 1YJWA 4X62L 4POGA 1IZ6A 1Y14B
chains in the Genus database with same CATH superfamily
4IZ8A 4N9PA 5I2YA 2KCCA 2H1EA 3SVMA 2ZJRA 2UU9L 4P2CB 1O7YA 5G3LF 4DAYB 1K3BC 4FXGC 3GTOH 4DV2Q 1RL2A 2EXDA 1CHQD 1D2BA 3V05A 1NJIC 3J81c 1C7YA 3H3VC 5IYCH 1FNWA 5BN3A 4KKUA 3NWTA 5AFWA 4PV1C 1DOKA 1CKNB 4GN5A 2AMCB 2X6GA 3QG1A 1LTGD 1HFGA 1K28A 5IP9H 5KYIA 2QA4A 4BBSG 3HOUH 2VY3A 1PH6A 1XNQQ 1XMQQ 1QNKA 1L0YB 1V1PA 3FHWA 3NE5B 3FVQA 4RA8A 4QB4A 1JOQA 5FO9B 1GHJA 1ZKOA 2IX3A 2D0OA 3BZKA 3E9HA 4ME3A 4QUFA 3MC0B 4IUPA 4IUNA 1CQFA 2A6HC 1Y1VB 1U4MA 3BDLA 1H9RA 3PO3G 3S24A 2PQAB 3PGZA 4CGYB 1XPRA 4P74A 4AYBE 1LO5D 2C35B 1FVIA 2VXWA 3KF8B 2E75C 5LMNW 1TS5A 1FD7D 2RQXA 5IYDH 4GKJL 4LUVA 5M3MG 3VDYA 1HNXL 4O1NA 2X69A 4LWCA 5FLXL 3CCUA 2PZTA 4FF3A 4DNIA 2ZXPA 3E0JA 4ZK9B 1WTXA 2F0VA 4YY3L 2E76C 3NQTA 2IHEA 2IX0A 2RCNA 1SROA 3D0FA 3NUCA 1SMYD 1SRUA 1UE6A 4O42A 4UP9A 3NWSA 3CPFA 2XWBB 3CU7A 3J80L 4HSVA 3HKSA 5HY6A 1Q81C 4H44C 3T51B 1B3AA 1G8ZD 1K8OA 1TVXA 1VQEA 3RLFA 1K8GA 1Q8KA 5ELCA 4JI8Q 3NTIA 3P75A 1E22A 2MFIA 4A3MG 2UUCL 2RDHA 4OX9L 2VQFQ 1QZHA 2ZTEA 5CGKA 3GQBA 1EFID 4TKOB 1T5XD 2CH4W 2LMCB 3RNUA 1NUCA 5C44B 2A68D 1WTWA 4DR5L 2A6ED 1PH2A 4QY7A 1G51A 3S14H 4KV6A 4FNFA 1BR9A 1ESRA 4NMZA 2E2HB 1A2UA 3A54A 1ENCA 2B2YC 5C3WA 4IN3A 2MO1A 3A8JE 1WYDA 3G7LA 1X3QA 3VR4A 1I4PA 3M85A 4IPCA 5HGQA 5KGUA 1RKNA 5L37A 3CC7A 4A3IG 5CORA 1LV9A 4X66Q 1VF7A 4V190 4A3EB 1IYJB 1VQ7A 2PYKA 4HIMA 1AN8A 4DV2L 3J81i 1W2BA 3AMUA 3T56B 1Q86C 3JAMi 1EIYB 4U673 1I94Q 1VQDA 2R3ZA 2NB0A 4KD3A 2NTSA 4N8FA 1ZYRC 1TIID 2PMZB 2MPMA 1NNXA 3ICEA 3SGIA 2JA6B 2V4DA 3PCOB 4BA2I 3S1NB 3L9AX 2PI2E 4IUTA 3HOXH 2N55A 5CV4A 2IWHA 1XNQL 1CM9A 2JA5B 3TEHB 1XMQL 4V0BA 4R8NA 4A3DG 4DAMA 4G7HC 3G6EA 1CHPD 2NVQB 1JR0D 1JWSD 1EEID 2F0HA 3BDCA 4JG2A 5CV6A 5ISRA 3QOLA 4ALPA 3H94A 1HNWQ 2E2IB 3C1EA 4X3UA 3DWPA 3X3NA 1L1OC 1A62A 4YWMA 4RKLA 1CK1A 5JEAH 3STBD 1FNVA 2DJFC 2OTLA 4R4QA 1BO0A 2LXKA 2B2UC 3S17H 1VQJA 1SNDA 2HIVA 4N9TA 3J81E 2R92G 2E2JH 3SK5A 4JBKA 4CKEA 3E6ZX 2F0JA 1VQMA 2PZUA 1ESFA 1HR0Q 1A3VA 1VMCA 4JI6Q 2XNAC 3TDQA 5K36H 5A2QE 4ZUJA 5IGBA 3R3OA 1UNSA 4BBSB 4ZUIA 4KD4A 1B44D 2E74C 4K5VA 3WDNA 1PZJD 3GV3A 5FO7B 2EQSA 4C3IB 3MWYW 2JK8A 3PO2G 1GHKA 3M4QA 1S5FD 1EIGA 3K8AA 4JBJA 4UPAA 4PZ6A 1LACA 4B9XA 1OTCA 1F77A 1U4RA 5C4JB 1XYIA 1WCMG 1WTHA 2HIXA 2IPKD 3G48A 1PLFA 4EX5A 4ZCKA 2VNUD 4A4IA 1BXTA 4I65A 4JI8L 4GNXB 3PO3B 5C4XH 2DGYA 2HD3A 1GO3E 3KBGA 1H9SA 5LHY1 4TVAB 4DK3C 1MD2D 2VQFL 1F9RA 3KYHC 3JC66 1QNUA 1NE3A 2VS1A 2NVXB 2CKZB 3F1ZA 1QILA 1TWCB 1SNPA 4K8IA 5CV7A 5IGEA 2VW9A 1GD7A 1SYCA 3CCQA 4IUQA 5M3FH 4F7XA 2DNEA 1U4PA 3MXPA 2NZHA 5IGGA 4IPHA 1BVSA 1EQQA 2KHIA 5J3BA 4GZYC 4X6AH 2R7ZG 1CI3M 1TWHB 1KRSA 2D2CC 1NTGA 4K2LA 2NN6H 4X66L 4HJ9A 4OO1G 1E2WA 2EJFC 1YHBA 4K5WA 4CDDC 1YIJA 2O2LD 5DM73 4DV0Q 2NZOA 1I94L 3HKZB 3D6WA 1ZEQX 3DM3A 1SJED 2PNHA 3BVZA 5ELOA 2JA8G 4CDCC 1SYGA 2NN6I 4ZYSA 4A3MB 1IW7C 2P5ZX 1AE2A 5I2XA 3TQYA 4YWLA 1EIFA 3K81C 1U0LA 4DPGA 4HIDA 4A93G 4RAUC 2ZTDA 5EKKA 5IY0A 2FJ2A 2KUMA 4A3BG 4F8MA 4K6LA 1JICA 2CWPA 1NY4A 1YNJD 1X32A 5C3EH 3S9WA 3SK6A 1QZGA 1R9TH 4LW1A 2B63G 2JA7H 1HNWL 5D14A 1LTAD 1VCIA 3RR5A 4TSSA 1EQRA 1ICWA 2A8VA 1PTOH 1SEBD 3HZXA 3VA7A 1Y8NB 1YJ9A 2JN4A 1PV4A 2EOTA 1SFOB 2G9DA 3IRBA 3KLWA 1KL9A 4EQ5A 2A69C 2K5HA 3Q8DA 4UDUC 2HCIA 3MHBA 1DXMA 4HR7B 3A55A 1YNNC 1HR0L 1T9HA 5FLMH 3URYA 5JPNC 1E1OA 1NSNS 4KHVA 4RHRA 3NSWA 1HZCA 1F9SA 4DU9A 2GA4B 3J81j 4DV3Q 3EFXD 5K5PA 3HP3A 3N6RA 3I2ZA 3QWNA 1M8AA 1X3EA 3BG3A 4PZ7A 3RZDB 1HTPA 3CHBD 3C3LA 4HIOA 2IY5B 2ICEC 4A3DB 3MAQA 1ASZA 1E1TA 3ZJYC 4QCLA 1I4RA 1STGA 5C5LA 1W6KA 2ZXRA 1VS0A 3KDFA 5IYCG 3I3CA 2QW7A 2Z6KA 4BY1B 2JA9A 4POFA 3RLNA 2WACA 4QJFA 2A6HD 3NP8A 5KNDA 2YU9B 1O78A 2R92B 3MFGA 2QILA 2AWNA 2OWOA 1V8QA 4HCSA 5I6WA 5IP9G 3GTLB 2Y0SG 3HOUG 2ID0A 4CBVA 3ND9A 4O0AA 1BBWA 3GTJB 4HJ7A 2Z8LA 2FFKB 1EYAA 1JT8A 2EY1A 4Y7NB 3RN2A 2XIWA 2I07B 2VQEL 1LTTD 1AZPA 1L0XB 4DR4Q 1IZ6A 2F0QA 1EOTA 3K58A 2X6LA 1EU3A 3PO2B 2KCMA 2NUCA 1M4VA 4TRDA 1E7ZA 3TRZA 4A3GH 4O2DA 3RZOB 5J1ZA 3MEFA 2BCOA 1SMXA 1T5EA 5M5YB 1X55A 4DV0L 1X3FA 4MN3A 1CSQA 4E6IA 2UXCQ 4CJ2C 2QEXA 5IYDG 3S1MH 4IURA 1FGUA 2IT1A 1XTCD 3TZUA 1E3PA 2K50A 3CRKC 1CQVA 4A3JH 1NBWA 1C9OA 1PFMA 2IJ0A 4B3RQ 2F1MA 2NTTA 1TWAH 2A74C 5E3FA 3NEMA 2AUJD 2G5DA 4JPBW 3PMFA 2QDBA 4ME5A 1VQKA 2BA0A 2R93B 3A5ZB 2WB1E 3R2TA 1A6XA 3G4SA 1OXVA 2A73B 3T4AC 1LM0A 1CZGA 1N33Q 3CQZH 3FEWX 2VB3X 1VQGA 5IE8A 2K33A 4HMJA 5EBCA 4OWWB 4BY7B 3CCRA 2R7ZB 3K5NA 4EQPA 4LUZA 5AJ3Q 1HH2P 1PYBA 3PUVA 2CHBD 4JI4Q 4DR1Q 4JI3L 3FDTA 4A3FH 3VYSA 2BH8A 3S2HB 3FKIH 2E5LQ 1Q1EA 4IQZA 2WP8J 3TP5A 4LFBQ 5GQOA 2JA8B 1QE6A 2B39A 3CAMA 3VR6A 4A93B 4DV3L 1HR0W 1B9MA 4UAIA 1VQOA 4JCVE 4C1NI 4RH6A 5KEEA 3S1RH 4NW2A 1XPUA 2XSCA 1H9KA 2Y0SE 1I3QH 2OQ0A 4PZ8A 4YCWA 1STAA 1HZ9A 3KJOA 3OWEB 4A3BB 1WI5A 3MXGA 4OELB 4P71A 4S3SA 3HFZB 3PUYA 4ID6A 4U68A 4IJHA 1STHA 5A2QL 2UUAQ 2B63B 4CJ0B 1B50A 2B2VA 4DNTB 2K32A 1IKLA 1QG7A 3KUPA 1BCPF 2K14A 1JC7A 4DR2Q 2G9HD 4C3HH 1PH7A 3N52A 5IP7H 1KQSA 5JOBA 2TSSA 3UDIA 4CKBA 3KK7A 3M9BA 2MQHA 3GTMB 4K8JA 4OWTB 5IGDA 3H0GH 1L1OB 1Z7TA 2EXZA 5A35A 4LF9Q 4IJLA 4RWSC 3GTQB 2B8GA 4KN4C 2XWJB 5H1SE 1D1IA 3Q6SA 1EYDA 1V43A 1JCKB 1VQFA 3KBXA 3AFPA 4DR4L 4P75A 3H15A 3U4VA 4YHHQ 1TWGH 2BDOA 2UUBL 3S2DH 1D8LA 1FL0A 2QDLA 2WKDA 2BH2A 3UI2A 1I4QA 4IFDJ 3ULJA 3JAMc 5CV8A 4B3SQ 4OGQC 4X65Q 5FO8B 2DNCA 4HEDA 3OW2A 1RIPA 5JEAG 1BBXC 1QJOA 3GTOB 3GTGH 4KJNA 4K5XA 3I4NB 1MJCA 1GUSA 1C48A 4C3JH 2MJ8A 3CKIB 4NPSA 4RG1A 1QVFA 4GKKQ 4CDEC 1I5FA 3CD6A 3NQIA 1VQ5A 4L5RC 4ZRZA 4K0KQ 1WTPA 1SE2A 3P7JA 1YJNA 2KEDA 1B8AA 1Q7YC 1MHWC 1QOHA 3L3OC 3CPWA 5JVG3 5HGTA 4KMUC 1LT5D 4QIWB 1N33L 5NUCA 5E4WC 3Q23A 1CKMA 2KEEA 3FPPA 1B9NA 5AJ3L 1SYEA 1G2SA 1TXYA 3CCLA 4JI0Q 4JI4L 4UP7A 3SK8A 4DR1L 1Y1VH 5JAVA 3PF4A 2PW5A 1N8RC 4Q0FA 5LMUQ 5C4XG 3NTHA 1HUNA 1NR4A 4A3KH 3J7ZC 2O5JC 3VYUA 1RHPA 3K7AB 3NBHB 1S5DD 4XT1B 2E5LL 4H13C 3TN2A 3PIPA 4WJ4A 1ILPA 4LFBL 1F9QA 2Z1CA 4DR6Q 3FMCA 1LTBD 1AP0A 1BCPB 1KDBA 2EY5A 4LF4Q 3HG9A 3M4PA 3HS0C 4DAVA 5M3FG 3EA6A 3HRZC 2XGTA 2J4XA 1Q90A 2UXBQ 3KLRA 3J7AF 1FGBD 2XTIA 1OO9B 1IW7D 2SNSA 5IT9L 5JPMC 1WTOA 1LUZA 1UE5A 2ALYB 2EJMA 4YIJA 3UDGA 2K6AA 1YITA 2AKWB 3X3MA 3CRLC 4FYDA 2NN6G 1DZ1A 1F2LA 3CCMA 1RF2D 3T13A 2JJQA 5CBEE 1S5BD 2UUAL 4GN4B 1G6PA 3K80C 5C4ZA 3HOWB 1EZ6A 1S40A 5G3LD 2CQOA 1JJCB 3W2DA 5C0XJ 3HGBA 4DR2L 2EY2A 1OXXK 4EQNA 3Q0AA 1I4GA 2A5HA 2E2DC 2L12A 1JORA 1X9NA 1O7ZA 2FXQA 2SOBA 4LF9L 2KQ3A 3I55A 1K9MC 2KENA 3W1GA 4RMFA 1VQCA 4LFCQ 1F9PA 1S5ED 2K52A 2XRQD 4K6DA 4RGOS 4H02A 3MFYA 2MUYA 3MXNB 1OXTA 2NVYH 1YNND 1VQLA 2C9OA 2Z4IA 2FHTA 2ASBA 1EQVA 3DXJC 4OIKA 5C3EG 2F0IA 4XYOA 4AYBB 4ZKBB 4YHHL 1IHZA 5CYUA 2JA7G 3HOYH 3QB3A 5GAHC 3OIQA 3H91A 3DHQA 3CC4A 3TSSA 2WINB 5EAYA 5T1IA 5I9OA 1AW7A 5JJKA 3GV6A 1HTLD 3E5SA 3IKJA 1D1KA 4B3SL 4X65L 3GP7A 3KLSX 4BS9A 3PSIA 3NENA 2KCNA 2LS01 2EDGA 1PFSA 1MBYA 1SAPA 2OEOA 4FXKC 1KAWA 3GDEA 1HFNA 4GKKL 3SDZA 4DK1A 1Y69U 4KHZA 3WOEA 4AH6A 3E9IA 2YTYA 5FLMG 1A2TA 4DAYA 3W3AA 2JEAI 1MSHA 4K0KL 4B9WA 5M5XH 5JVH3 1BDOA 1XWEA 3S1NH 4QQBX 2M00A 1JB7A 5KNBA 3M4YA 2DUDA 4MHEA 1CKNA 1EY9A 5IWAQ 1S5CD 2K01A 4NP5A 1RDPD 3L0OA 1DM0B 3C2PA 2WAQE 3CCVA 3J7A5 1MIUA 2VUMH 4JI0L 3I90A 1LT3D 4A3CH 3I8ZA 2AHOB 5LMUL 1WJJA 5IGCA 3JAME 3I4MH 2K5DA 1BBUA 2Z9HA 4DNRB 1B2TA 1ENFA 1PA6A 1EIHA 1RD9D 3D4RA 2B2WA 3CW2C 2E2JB 4L5QA 4DR6L 5COYA 5M9OA 1UEAB 4JOIC 4LFAQ 3I4OA 3F8TA 5I9PA 3R8BA 2PQAA 4XXEA 1JJ2A 4NB3A 4KHPQ 4M1UB 1SXTA 1JE5A 2UXBL 1HHVA 1G6ZA 2RHSB 1CT1D 1DOLA 1PTOF 3KF8A 1VMPA 2JXMB 2OXPA 1I4HA 2KOLA 4FF2A 3U9SA 4DV5Q 4C3IH 2F52A 4H0LC 1EFWA 2RKSA 3F2CA 2JSOA 4G7ZC 4A3GG 3TP7A 3ULPA 1SN8A 3M7GA 1N36Q 2D0PA 1KDAA 1SLJA 1PH1A 3T53B 2K5VA 1CKOA 2A19A 4MZ9A 5HURA 1CUKA 4PMBA 3A7AB 4UHVA 3RUZA 5C4XB 3TMEA 4NDXA 2OCEA 2IHFA 4L63B 2K4KA 1M90C 1HJPA 1X56A 5FJ8H 4FP5D 5M3MB 3EJIA 2KVMA 4A3JG 3DMUA 3TREA 1QVCA 5CR3A 1K3RA 1Q12A 5E4XA 1STEA 1IKMA 4LFCL 3OYYA 1BOSA 3PIOA 1CZWA 1I6HH 2QCPX 5IYBH 2LXJA 1V1OA 1TKWB 5M3FB 4PQXA 4YCVA 1D5MC 2GN5A 4PMCA 2HQLA 2HDMA 1YJWA 4POGA 1WTRA 1QB5D 2Q8TA 5KRUA 2HQEA 5LL6S 1YHQA 1B3QA 1B7YB 1BCPC 1EY4A 1G2TA 4KKSA 1TWHH 3TS2A 4KKTA 4DV1Q 3VR2A 4P72A 2B3GA 4EGVA 1KIXA 1TY2A 3D8GA 3S16H 1A3UA 2F0KA 3OHXC 3GD7A 3CCSA 3FKIG 4A75A 3RN5A 1K83H 2MP1A 4HJ8A 1IYUA 3J80i 1N34Q 2LFNA 2I0QA 1CFMA 2CVRA 2EYHA 1Y1WH 1VDZA 4LUOA 5ELEA 4R8IA 1SBBB 3CCEA 1WTQA 3VYRA 1Q46A 1SMYC 1Y8OB 1B53A 3A8IE 3MXUA 3BDOA 1LABA 1WTVA 1AEXA 5IWAL 5M5WH 1KABA 3PIP3 3M7NA 4XTCS 4A3IB 1WOCA 5C3EB 3V2TA 1KHIA 1PTOB 1LT6D 4RGNA 1SE8A 5BR8Q 3WWVA 4C3HG 3ER0A 4C2MH 4R4OA 1UE1A 5IP7G 1JWMD 1LLRD 4L8JA 2H5XA 2DJGC 2ZTCA 4GLXA 1HNZQ 2WB1G 3H0GG 4OONA 4JI6L 4LF7Q 3OIPA 3M4OB 2ZJPA 2A6EC 3CMAA 1EQTA 4LFAL 3TP6A 2LSSA 2DN8A 4QGUA 4KHPL 1U5KA 3K5OA 3A0JA 4JI1Q 4LF8Q 4ZAIA 3QJYA 3H3VH 1NMFA 3AU7A 2RSNA 3FP9A 5GAEC 2F0WA 3S15H 5CBAE 1JB3A 2K03A 4DUZQ 3M3YH 2AQ2B 4KY7A 4FVMA 4LF6Q 2R61A 1C8CA 4DV5L 4P73A 1GJXA 5JJZA 1U9RA 2IL8A 2EYPA 3NXWA 3R2IA 1QUQB 2BE5C 1N36L 3H3VI 1II3A 1SNQA 1XJVA 4ILWA 1J8IA 2SDFA 1BF4A 1GVPA 4M8AA 2R6GA 5FKAC 2HHHQ 2K75A 1I50H 4KY6A 4C3JG 4B3TQ 3UE1A 3GTPH 1LT4D 4GLAC 4BY1H 3MEHA 2YU9H 5DLQE 4IO9A 1EYGA 1SDFA 1OXSC 3ULLA 1NCVA 4DV6Q 4GNXA 3EBEA 4KN7C 5ELFA 2F0SA 2RDGA 2N8NA 3GTJH 1PMRA 4HCEA 1UE7A 2J0TD 2MO0A 1A8VA 2XRSD 1H9MA 4WRDA 4C56C 4HIKA 4BBRH 3S1QH 4Y7NH 1DYQA 4EQOA 1Z6HA 1L2FA 4CHTB 4QUCA 1WCMB 1Y1VG 2B2TA 4DV1L 3PUWA 1GXDC 1TS2A 3RZOH 4A3GB 4DXGA 1EOVA 1TQOA 4A3KG 1CA5A 1QWYA 2YTVA 5M5YH 1MKHA 1NAPA 5ELDA 1W3SA 1Q1BA 4WFN3 3SE0A 1V1PB 3PF5A 3K57A 4XQNA 2Z6KC 1N34L 1UAPA 1DD2A 2ZXOA 2HT1A 1DOMA 4G7OC 2L55A 4A3JB 3CP0A 2R7DA 1Q8IA 2HUGA 5CC4A 5TSSA 3MTSA 4RKBA 1SYDA 1TWAB 1SNCA 3T1YQ 3KOJA 4RGMA 1XMOQ 3IAYA 3BVMA 3TS0A 1Q3LA 3IFTA 2R93H 4GOPA 3SXHA 1S4ZA 3BU2A 2CH4A 3VR3A 4IFDH 4Q5VA 1TU2B 1ENAA 4BY7H 2CW0C 2PQEA 5BR8L 1BNZA 2WV6D 3A5UA 2NZ1D 4IUUA 2Q2TA 1HNZL 1TS4A 3S2HH 1UWVA 4J1MA 4LF7L 4OEMB 1BQQT 5FK9C 3FKIB 2HDLA 4IFDI 2H4OA 1HPCA 1HZAA 4JI7Q 2NVTH 2F0GA 1ZYRD 2GVBA 1AE3A 1VQ9A 5ELNA 1EU4A 1GKHA 4HTHA 3J81L 2EPBA 4JV5Q 3JAML 1S72A 1TWFB 4JI1L 4LF8L 4XIGS 1SNOA 1HA5A 2JE6I 1M1KC 4KI0A 1EUJA 5BN5A 4L5TA 1LTRD 4DUZL 4BXXH 4NXNQ 5DEHA 4LF6L 3U4ZA 3UDFA 1VQ6A 3S1RB 2WKCA 1PH4A 1AZQA 3HOYG 1X65A 2N49A 4J6HA 3BYYB 3HOZH 3QOJA 1YBYA 1IBKQ 5DM63 2ICIA 2RSOA 3K5MA 4TQUS 3FRPB 2YTXA 3LWEA 3D31A 2ATWA 5JJLA 1YNXA 3PIO3 2K05A 1R4PB 3R93A 3KF6A 1O80A 2KJXA 2WIIB 4ULLA 3QIAA 1YEZA 4LMQD 2L5TA 1ILQA 3LX0A 2Q8IB 4B3TL 1GUOA 1VF5C 2F0PA 1EZ8A 3HOXG 3GTKH 2LY7A 3DWQA 3U50C 4XQQA 3GTMH 2WB1B 1IYVA 4DGZA 3H0GB 1PTOC 4DV6L 3HOVH 3F2BA 2Q2IA 3MVVA 2K1BA 3G71A 1IBMQ 4X64Q 1F2MA 2K5WA 3AQQA 2LKVA 1PHJA 2Z4HA 1LTID 3GO5A 4RCNA 2D5DA 2D9UA 4X62Q 4I7ZC 3CMEA 1RTNA 4YWKA 3D4WA 4DV4Q 2F3VA 4JI2Q 4ABNA 3S2DB 2VUMG 1EL0A 3D6CA 2N78A 2UXCL 4A3CG 1LTLA 1KRTA 3AYHB 1UEBA 2WFWA 3I4MG 2F4IA 5C0XH 1I6VC 3F2DA 2F0DA 4GS3A 3GTGB 2B2VC 1VQNA 4WJWA 2UXDQ 4IUVA 4HJ5A 3I4NH 2ZM6Q 5K36G 4F87A 1TY0A 5D65A 4C3JB 1HQRD 3SK4A 4BWGB 2Y0SB 3HOUB 4B3RL 4DK6C 4DXFA 5C0XI 1V1QA 1MSGA 5KNCA 2K7VA 1WD1A 1IBLQ 1XTDA 3T1YL 1XMOL 4JC0A 1ET9A 3NPPA 5GROA 4C3IG 1VQ8A 5IOCA 3V96A 4KLKA 4IOAA 2L9HA 5C6AA 1E24A 3WOFA 1YZ6A 1JMCA 2NBFA 2RCFA 2PCFB 1JOOA 1HCZA 4JK1C 2PNRC 3C1FA 1KNAA 3B6YA 4L6TB 5BN4A 1CSPA 1RODA 3E0EA 1ZXTA 1PZID 5I4DA 3EVQA 3J7YW 1BCPD 3ERQA 2DY8A 5CV5A 4A3KB 2PPBC 1H95A 1PRTC 1PDQA 5FJ8G 4DFAA 3K7AH 1FJGQ 2GVAA 4UY8C 1E2ZA 4MIUA 2EYJA 2F03A 4JI7L 1XXGA 2F0LA 2WAQG 3KLSA 1TT2A 2B2YA 4JV5L 2I5MX 5IYBG 2EY6A 1YHAA 4YCUA 2Z0SA 2DY7A 5GAGC 1GUGA 4NXNL 2K5NA 2PMZE 4JYAQ 5EGTA 4LJZC 3L7ZC 3P1HA 1HZBA 1H9SB 1NR2A 5IGFA 1IBKL 1AFPA 1G291 2CWAA 1V9PA 3OMGA 1HUMA 3HOWH 4NXMQ 4DN4M 4FF1A 1O7IA 1L0WA 4MTKA 5E1FA 4G4KA 3HKZG 4H7BA 1SYFA 1PYSB 1JWUD 1VQIA 4RHSA 1G91A 3RD4A 2I5LX 3FPUB 1PZKD 5EQ0A 4PMWA 2A69D 5C44H 2O5IC 1Y1WG 2PZWA 4WORA 4X3KA 3S14B 4FF4A 2CQAA 3OTOQ 3CXCA 2E2HH 4K2KA 4ODGA 5C3XA 1IBML 4X64L 4A3LH 4DR3Q 2NVYB 4X62L 1A3TA 1ICFB 1L1OA 2QF7A 1DCZA 5IIFA 1FR3A 1X54A 4DV4L 4JI2L 4A3EH 3HOYB 5FLXc 1WVLA 1RTOA 1J5EQ 5EJWA 2B2UA 1B4OA 3I4LA 4IPGA 3K59A 2O4XA 4F88A 1P8LA 2FINB 4HAEA 4J8QA 4OHJA 1HA6A 1SSOA 2UXDL 1A0IA 2BOSA 2KBNA 1GOZA 3J80c 1VQAA 2BE5D 2HCCA 2BDNA 4DR7Q 3NTKA 5J22A 5IT9c 2ZM6L 1KLUD 3MZ5A 2CCZA 2JA6H 2YYZA 2K28A 4KJOA 1MJEA 3NHHA 4JOIA 2OF1A 3HOXB 3ONAB 3D4DA 3TP8A 4IALA 5M5XB 1K0RA 2JA5H 5F2DA 1FYCA 1IBLL 2F4VQ 4HSPA 2NVQH 1PH5A 4APVA 2RDFA 4DF7A 4DA2A 4R4CA 2E2IH 5EKIA 4KK7A 3TZDA 1ONLA 2RVLA 3C46A 2Q2UA 1R4QB 2M9VA 5CMDA 2L0CA 3DEOA 3K6OA 3ND8A 1STBA 5C4HA 2VUMB 5C5MA 1C0AA 1VQBA 3S17B 3T16A 4ZKCB 3I70A 5ELBA 1STNA 3I4MB 4R4TA 4UP8A 3L2PA 4BY1G 4B3MQ 4L5SA 4AIMA 4LF4L 3IL8A 1FJGL 2EYFA 2R7FA 1STYA 2RA4A 1IXRA 1CA6A 2PW7A 1EY8A 1PFBA 1HQMC 1SE3A 4BBSH 2D62A 2EYOA 3RLOA 3HKZE 4C1NK 3OMCA 5KYLA 2QKIC 4CKCA 2QEJC 1ET6A 4FDBA 3NBHA 4IOCA 1Z47A 4JYAL 3KDFB 4BBRG 4LNQA 2IX1A 3A7LA 5T1GA 4DV7Q 1I4XA 4BA1I 1PFNA 1N32Q 4IPDA 1GM5A 1K8AC 5C4JH 5JJIA 2FMCA 4XQJA 3OPOA 2SEBD 1P16A 2VB2X 3A8KE 3UE0A 4B08A 1K73C 4NXML 3PO3H 2FMMA 3DM1A 4HN7A 1D6EC 2K5QA 5FOBB 1A15A 2F3IA 4DUYQ 1SYBA 3BVGA 2E8GA 3ERSX 1O7LA 2CW0D 2ZT9C 4XYQA 2NVXH 4LF5Q 1XX8A 1TWCH 2V1CC 5M3MH 4XDXA 3H6MA 3W1BA 1HXYD 1ML0D 2B2WC 3OTOL 2K04A 2VL6A 2WAQB 1EY7A 1H9JA 5GADC 4DKAC 2B8FA 1EY0A 3OOCA 3A56A 1BUVT 1I6HB 4DR3L 5EPKA 1JQYD 1WFQA 2R93G 3QO2A 2Z6BA 3BZCA 2F0MA 2VQEQ 4IFDG 2PO4A 4FO2A 4A3FG 1J5EL 4LK1C 1EWHA 1RCVD 4BY7G 1Z9FA 2AUKA 2I46A 1Q82C 3BS1A 1KAAA 3MXNA 1Y8PB 5CV9A 5JEAJ 2L4NA 1OXUA 1A63A 4AQYQ 3S16B 4JVZA 3OWFA 3U9OA 3U58A 4DR7L 4A3MH 2N3SA 1K83B 3BYTB 4R1JA 1PRTF 1BKBA 3DEPA 1KTKA 2OQKA 3ZYYX 2F0FA 1D7QA 1PH9A 5KIXA 5EKLA 1Y1WB 4GOPB 2F4VL 2JEBI 4BXXG 1E2VA 4PNYA 3LNNA 1GUNA 5IODA 1CTMA 3KJPA 4MTNA 4JW0A 1R9TB 2ENBA 1PTOD 1NMGA 3K0XA 2JA7B 3HOZG 4G57A 5M5WB 4FXDA 1J6QA 2KA7A 2EZVA 1C4QA 4A3IH 4KY5A 3AFQA 3IFDA 2KHJA 3K5LA 2EVBA 4JI5Q 1SFOH 3NELA 5DAUA 3K0YA 1F2ZA 5FLXE 4ZLTF 2OTJA 2ES2A 5LMNQ 3HEJA 2A68C 4C2MB 4B3ML 1EWCA 5EBDA 1IL2A 4JI3Q 1YVCA 1F2YA 3H09A 3I56A 3J80E 1X3GA 3PQIA 5IT9E 1KLGD 3M4OH 1QVGA 3HOVG 1YI2A 1SJHD 3EIVA 1D5XC 1JOKA 2F0TA 3E3XA 3RZDH 4MNOA 3EROA 3BJUA 3ITPA 4Y52H 4A3DH 5J39A 3S15B 3T1HQ 3M3YB 4QMGA 4DV7L 3J7AV 1JJGA 1TS3A 1N32L 3KF6B 1QCBD 2B29A 3BZDB 2NWGA 2JYOA 2EJGC 2I5HA 2JQOA 1JE4A 3Q24A 4JBWA 2MGSA 5C0XG 3PUZA 1AH9A 2EYLA 2RBMA 1GUWA 2TMPA 3UDXA 3I4NG 4DUYL 3D3RA 4RFBA 2F3WA 4K14A 4DK0A 1XNRQ 2R92H 3I73A 1I50B 2IW3A 4HJAA 3GTPB 1VQHA 4LF5L 2F0NA 1KDCA 3GTLH 3CF5A 1PVOA 4XT3B 1SE4A 1KC8C 1X6OA 4ZQ3A 2PI2A 1SR3A 1PRTD 1FNUA 4CDFC 3LWUA 1PRTB 2XN9C 3QR8A 2AWOA 2JP1A 2Q8RE 1DGSA 5E7NA 1HRJA 4QF4A 4N8X1 4BBRB 1IL8A 3STBC 3S1QB 2F0OA 3PO2H 5D3DA 2UU9Q 2YV5A 4GN3B 2L1BA 3I91A 1EY5A 3KFUA 2UUBQ 1WCMH 2RF4A 1SNMA 1LTSD 3AB9A 3S1MB 4AQYL 2J7ZA 1VQPA 1U4LA 4OIJA 2M2LA 1XPOA 3DLLA 1D5ZC 1EEFD 3A74A 3CC2A 3CCJA 1PYWD 4OXPA 2C5CA 2OT2A 2AQ1B 1E0BA 2SNMA 4Z9CB 2EYMA 4GNXC 2L15A 1EWIA 3CQZB 2KECA 3SHLA 2MNAA 2R7ZH 4PG3A 4R9WA 3EQLC 3DWAA 2ZJQA 3PUXA 4OO1H 4JI5L 2EE1A 4QL5A 3HOWG 3EN2A 4A3FB 1EYCA 2F0UA 3MA2B 5EPJA 3VA5A 4WJ3M 3VR5A 4RCOA 5LMNL 1VQ4A 4I7AA 3VYTA 2AQ3B 2N88A 1DJRD 2B2TC 2RHQB 1KXLA 1GUTA 4R4IA 2JA8H 5C44G 4GKJQ 3K7UC 3TBIB 1J9OA 4JBMA 3I7FA 4X3SA 4OO1I 1K8MA 1HNXQ 3O13A 2NVTB 1B70B 2NYZD 1B1ZA 3P20A 4A93H 1MI2A 4HMIA 1ASYA 1EY6A 4YY3Q 5I6YA 2KCTA 4A3LG 1K0SA 1TWFH 1I3QB 3G6JB 4OWXB 4A76A 3W5OA 4CJ1B 2VZAA 4A3BH 3T1HL 1X3PA 1UUPA 3Q22A 4AYBG 1KD1C 1TR5A 4A3EG 5LL6X 1PH8A 4EVOA 1KNEA 2B63H 3HOZB 3OW7A 4NKLA 4J15A 4RGTA 2A1AA 1DONA 2EIFA 2HHHL 5EPLA 4GOPC 2CFMA 4C3HB 4KTAA 1WD0A 4LAAA 2KHSA 2QGQA 3PV0A 4QIWE 1PH3A 1S3OA 1N9WA 2Q2HA 1LYLA 1XNRL 2JA6G 3OSOA 2UUCQ 1MGSA 4OX9Q 1PXUA 2MHVA 1RJTA 2F0EA 3I72A 5D3IB 3AEVA 5DNFA 3NK9A 3LGJA 3GTKB 1QUQA 3NBIA 1W6JA 3GTQH 4GLVB 1YNJC 3DUZA 4DR5Q 2JA5G 3F2UA 4X3TA 3SR1A 3HOVB 2BA1A 2L11A 4DAPA 4OL7A 3SEBA 3RMHA 1TWGB 2XVSA 1Y14B
chains in the Genus database with same CATH topology
1YHQA 1B7YB 2ZJRA 1X54A 4DV4L 2UU9L 4A3EH 4JI2L 2KCMA 5FLXc 1J5EQ 1E7ZA 3TRZA 4A3GH 4O2DA 1TWHH 4IPGA 3MEFA 4DAYB 3TS2A 3GTOH 4DV1Q 1SMXA 1P8LA 4DV2Q 1RL2A 2EXDA 1NJIC 3J81c 1X55A 4P72A 4DV0L 1X3FA 2B3GA 1C7YA 1KIXA 5IYCH 1CSQA 3S16H 2UXCQ 2UXDL 3GD7A 3CCSA 1A0IA 3FKIG 4A75A 3RN5A 1K83H 2KBNA 3J80c 1VQAA 2QEXA 5IYDG 3S1MH 4DR7Q 5IT9c 2ZM6L 2CCZA 2JA6H 1CKNB 1FGUA 2IT1A 4GN5A 2YYZA 4HJ8A 2AMCB 1MJEA 4JOIA 3J80i 1N34Q 1E3PA 2K50A 4A3JH 2I0QA 5IP9H 1NBWA 1Y1WH 2QA4A 4BBSG 3HOUH 4LUOA 2VY3A 1PH6A 3CCEA 1C9OA 1Q46A 1K0RA 2JA5H 4B3RQ 1IBLL 2F4VQ 1TWAH 3NEMA 1XNQQ 1XMQQ 2NVQH 1PH5A 4APVA 1VQKA 2BA0A 5IWAL 3A5ZB 5M5WH 2WB1E 3FHWA 3G4SA 1OXVA 4R4CA 3M7NA 2E2IH 1LM0A 4XTCS 1N33Q 3CQZH 1WOCA 1VQGA 2D0OA 3BZKA 3E9HA 4ME3A 5IE8A 2Q2UA 4OWWB 3CCRA 4LUZA 5AJ3Q 1HH2P 1KHIA 1PYBA 3PUVA 3PO3G 3S24A 4JI4Q 2PQAB 4DR1Q 1C0AA 3PGZA 1VQBA 1SE8A 4JI3L 5BR8Q 3WWVA 1XPRA 3ER0A 4A3FH 4P74A 4R4OA 4AYBE 2BH8A 4C2MH 1UE1A 2C35B 5IP7G 1FVIA 4R4TA 2H5XA 4UP8A 4BY1G 3L2PA 4B3MQ 4L5SA 4LF4L 2ZTCA 3FKIH 4AIMA 2WB1G 3KF8B 4GLXA 1Q1EA 5LMNW 1HNZQ 2E5LQ 3H0GG 4OONA 4JI6L 1FJGL 4GKJL 2WP8J 4LF7Q 5IYDH 4LUVA 2ZJPA 4LFBQ 5M3MG 3CMAA 3VDYA 5GQOA 4LFAL 1HNXL 2LSSA 2R7FA 4LWCA 1IXRA 3CCUA 4QGUA 4DNIA 4KHPL 4BBSH 1U5KA 3CAMA 2D62A 3RLOA 3HKZE 3A0JA 4YY3L 4JI1Q 4LF8Q 2IHEA 4DV3L 1HR0W 1VQOA 3H3VH 1NMFA 4FDBA 4JCVE 4IOCA 2IX0A 1Z47A 3FP9A 5GAEC 4JYAL 3KDFB 2RCNA 1SROA 3D0FA 4BBRG 4DUZQ 3S1RH 1XPUA 1SRUA 1UE6A 3M3YH 4LNQA 2Y0SE 1I3QH 2OQ0A 4PZ8A 4UP9A 3CPFA 4YCWA 4LF6Q 2IX1A 1HZ9A 3KJOA 4DV5L 4P73A 4DV7Q 1WI5A 3HKSA 4BA1I 1N32Q 4IPDA 1GM5A 1K8AC 5C4JH 5JJIA 5HY6A 4P71A 1Q81C 3HFZB 3PUYA 4IJHA 2UUAQ 1QUQB 1P16A 1N36L 3UE0A 3H3VI 1XJVA 1K73C 4NXML 1VQEA 3RLFA 1GVPA 1K8GA 1Q8KA 3PO3H 2K14A 2R6GA 4DR2Q 4JI8Q 4C3HH 2HHHQ 2K75A 1PH7A 1E22A 1I50H 2MFIA 5IP7H 4A3MG 1KQSA 2UUCL 2F3IA 3UE1A 3UDIA 4DUYQ 4B3TQ 4OX9L 3GTPH 2E8GA 4GLAC 2VQFQ 4BY1H 3M9BA 1QZHA 2MQHA 2ZTEA 3ERSX 4OWTB 2NVXH 3H0GH 4LF5Q 2YU9H 1L1OB 5DLQE 1TWCH 2V1CC 4IO9A 1EYGA 4LF9Q 5M3MH 3RNUA 3ULLA 1OXSC 4IJLA 3W1BA 4DR5L 3OTOL 2VL6A 4DV6Q 1PH2A 4QY7A 4GNXA 1G51A 3EBEA 5GADC 3S14H 5H1SE 4DKAC 2N8NA 3GTJH 1UE7A 2MO0A 4DR3L 1V43A 1A8VA 1VQFA 4HIKA 1WFQA 2MO1A 4BBRH 2R93G 3AFPA 1WYDA 4Y7NH 3S1QH 4DR4L 4P75A 3M85A 3BZCA 1L1OA 3U4VA 4IPCA 5HGQA 4YHHQ 3H15A 1TWGH 2UUBL 3CC7A 1D8LA 1FL0A 2VQEQ 4A3IG 3S2DH 4IFDG 2BH2A 1L2FA 4X66Q 4A3FG 1J5EL 4IFDJ 3ULJA 3JAMc 4BY7G 1IYJB 1Z9FA 1Y1VG 4DV1L 4HIMA 4X65Q 3PUWA 4DV2L 3OW2A 1Q82C 1VQ7A 4B3SQ 1RIPA 3RZOH 5JEAG 3J81i 1W2BA 1EOVA 4A3KG 1Q86C 3GTGH 5JEAJ 3JAMi 1EIYB 2YTVA 5M5YH 1I94Q 1VQDA 1MJCA 1OXUA 1A63A 4AQYQ 1MKHA 1W3SA 3U58A 4A3MH 4DR7L 2N3SA 4C3JH 1Q1BA 4R1JA 4NPSA 4RG1A 1BKBA 3PF5A 1QVFA 4GKKQ 3ICEA 3SGIA 1I5FA 3CD6A 2OQKA 2Z6KC 1N34L 3PCOB 1VQ5A 4L5RC 4BA2I 2HT1A 1D7QA 1PH9A 2PI2E 4K0KQ 1YJNA 3HOXH 3CP0A 2R7DA 4GOPB 1B8AA 2F4VL 1Q7YC 1XNQL 2JEBI 4BXXG 3TEHB 3CPWA 1XMQL 3T1YQ 4DAMA 4A3DG 3KOJA 3G6EA 1XMOQ 3TS0A 3KJPA 4MTNA 1NMGA 3K0XA 3HOZG 2R93H 4GOPA 4JG2A 1J6QA 1N33L 4ALPA 1HNWQ 3BU2A 1CKMA 4A3IH 3AFQA 2KHJA 5AJ3L 1L1OC 1A62A 4YWMA 4JI5Q 1TXYA 3NELA 1SFOH 3CCLA 4JI0Q 4BY7H 4JI4L 4UP7A 4DR1L 3PF4A 1Y1VH 5BR8L 1N8RC 5C4XG 5LMUQ 2OTJA 2ES2A 3STBD 5LMNQ 4A3KH 3A5UA 2OTLA 4R4QA 2LXKA 3J7ZC 3S17H 1VQJA 2HIVA 4B3ML 3NBHB 2R92G 2Q2TA 2E5LL 1HNZL 2E2JH 1IL2A 4JI3Q 1YVCA 4JBKA 3S2HH 3PIPA 1UWVA 4LF7L 4WJ4A 4IFDI 4LFBL 3I56A 2NVTH 1HZAA 4JI7Q 4DR6Q 1X3GA 2GVBA 1VQ9A 1AE3A 1VQMA 3M4OH 5ELNA 1QVGA 1GKHA 1HR0Q 4LF4Q 3HOVG 3M4PA 1YI2A 4JI6Q 4JV5Q 5M3FG 2XGTA 3EIVA 1S72A 4JI1L 2UXBQ 4LF8L 4XIGS 2JE6I 1M1KC 4KI0A 1EUJA 2XTIA 4L5TA 3RZDH 4MNOA 4DUZL 3BJUA 4NXNQ 4BXXH 4Y52H 4A3DH 4LF6L 3U4ZA 1LUZA 2EQSA 3UDFA 1VQ6A 3T1HQ 1PH4A 1UE5A 2ALYB 2JK8A 4DV7L 3UDGA 1YITA 3HOYG 3PO2G 1X65A 2N49A 2AKWB 1JJGA 3M4QA 1N32L 3HOZH 3KF6B 3K8AA 2NN6G 4JBJA 1YBYA 2B29A 4PZ6A 4UPAA 3CCMA 1IBKQ 1OTCA 2JJQA 2UUAL 4GN4B 1G6PA 3K80C 4TQUS 2I5HA 2YTXA 1WCMG 2JQOA 2HIXA 4JBWA 5C0XG 3G48A 1S40A 3D31A 2CQOA 2ATWA 5JJLA 1JJCB 1YNXA 4EX5A 5C0XJ 3PUZA 2VNUD 3KF6A 4A4IA 1AH9A 4GNXB 4DR2L 4JI8L 5C4XH 2DGYA 1GO3E 1YEZA 1OXXK 3UDXA 4TVAB 3I4NG 3S15H 4DK3C 4B3TL 4DUYL 1XNRQ 2R92H 2VQFL 3HOXG 3GTKH 4HJAA 1VQHA 4LF5L 3GTLH 1X9NA 3KYHC 3U50C 3CF5A 3JC66 1NE3A 3GTMH 1PVOA 2FXQA 4LF9L 2VS1A 2CKZB 3F1ZA 3I55A 1K9MC 2KENA 3W1GA 1GD7A 4RMFA 1X6OA 2VW9A 4DV6L 1VQCA 1KC8C 2PI2A 1SR3A 3CCQA 2K52A 3F2BA 5M3FH 2Q2IA 4LFCQ 4H02A 3G71A 1IBMQ 4X64Q 1OXTA 2NVYH 3MXNB 3AQQA 2AWOA 5E7NA 1PHJA 1DGSA 2NZHA 1VQLA 4IPHA 1BVSA 1EQQA 3GO5A 2ASBA 2KHIA 5C3EG 4X62Q 4YHHL 2JA7G 3STBC 5J3BA 3HOYH 4GKJQ 5GAHC 3PO2H 2R7ZG 4X6AH 3CMEA 4YWKA 4DV4Q 4X66L 1KRSA 2UU9Q 1NTGA 4JI2Q 3CC4A 4HJ9A 2YV5A 4GN3B 5EAYA 2VUMG 4OO1G 5JJKA 2N78A 2UXCL 4B3SL 4X65L 4A3CG 1LTLA 1YHBA 1KRTA 3AYHB 1YIJA 3KFUA 1UEBA 1WCMH 2UUBQ 2RF4A 2WFWA 3I4MG 4DV0Q 3PSIA 3NENA 2NZOA 3F2DA 1I94L 1PFSA 4GS3A 1VQNA 4AQYL 2UXDQ 4HJ5A 3DM3A 3I4NH 1VQPA 1KAWA 2PNHA 3GDEA 5ELOA 2JA8G 2ZM6Q 5K36G 2NN6I 4GKKL 1AE2A 4KHZA 4AH6A 3DLLA 1XPOA 3E9IA 2YTYA 4B3RL 5FLMG 3TQYA 4YWLA 3A74A 4DK6C 2JEAI 4K0KL 1EIFA 3K81C 1U0LA 4DPGA 5M5XH 4HIDA 5C0XI 3HOVH 4A93G 2ZTDA 3CC2A 1V1QA 3CCJA 3S1NH 4QQBX 4OXPA 5IY0A 1IBLQ 1JB7A 1XTDA 2DUDA 3T1YL 1XMOL 4A3BG 4JC0A 1CKNA 4GNXC 2L15A 5IWAQ 5GROA 1EWIA 2CWPA 1NY4A 1VQ8A 5C3EH 3L0OA 1QZGA 1R9TH 4LW1A 2B63G 2JA7H 2MNAA 4KLKA 4IOAA 1HNWL 2WAQE 1VCIA 3CCVA 3RR5A 1E24A 4PG3A 2R7ZH 1YZ6A 1EQRA 1JMCA 3J7A5 2A8VA 1MIUA 2ZJQA 3PUXA 4JI5L 2VUMH 4QL5A 4JI0L 3HOWG 3EN2A 1YJ9A 4A3CH 3B6YA 2AHOB 1PV4A 5LMUL 1WJJA 4WJ3M 1CSPA 5LMNL 1VQ4A 3I4MH 3E0EA 3IRBA 1BBUA 3KLWA 1KL9A 4EQ5A 1PA6A 2K5HA 3Q8DA 1H95A 2RHQB 5FJ8G 1KXLA 3CW2C 3K7AH 1FJGQ 4R4IA 2GVAA 4L5QA 5C44G 3K7UC 4JBMA 4UY8C 2JA8H 3I7FA 4JI7L 4DR6L 4OO1I 2WAQG 4JOIC 4LFAQ 1HNXQ 1HR0L 1T9HA 3I4OA 3F8TA 5FLMH 4JV5L 1B70B 2PQAA 1JJ2A 2I5MX 1E1OA 4NB3A 4A93H 4KHPQ 5IYBG 1ASYA 1JE5A 1HZCA 2UXBL 2RHSB 1YHAA 4YCUA 4YY3Q 2Z0SA 3J81j 2KCTA 4A3LG 4DV3Q 1TWFH 5GAGC 4NXNL 4OWXB 2K5NA 2PMZE 3I2ZA 4A76A 4JYAQ 3W5OA 1X3EA 2VZAA 4PZ7A 4A3BH 3T1HL 3L7ZC 4HIOA 1HZBA 2IY5B 4DV5Q 4AYBG 4C3IH 2F52A 1KD1C 1ASZA 4DR4Q 1E1TA 4A3EG 1PH8A 1IBKL 1EFWA 3ZJYC 3F2CA 2B63H 4A3GG 4J15A 1G291 2CWAA 2A1AA 1V9PA 2EIFA 3ULPA 1SN8A 1N36Q 2HHHL 4GOPC 2D0PA 1SLJA 1PH1A 2CFMA 2K5VA 1VS0A 3KDFA 1CKOA 5IYCG 4NXMQ 3HOWH 2A19A 4MZ9A 2QGQA 1CUKA 3PV0A 4QIWE 1PH3A 1O7IA 1S3OA 1N9WA 2Z6KA 2Q2HA 1L0WA 1LYLA 2JA9A 4POFA 3RLNA 3HKZG 4QJFA 2OCEA 2IHFA 2UUCQ 1XNRL 2JA6G 1PYSB 4OX9Q 2K4KA 1M90C 1VQIA 1HJPA 1X56A 2I5LX 5FJ8H 3AEVA 2AWNA 3LGJA 2OWOA 1QUQA 4A3JG 4PMWA 5C44H 5IP9G 3TREA 1Y1WG 1QVCA 2Y0SG 3GTQH 3HOUG 1K3RA 1Q12A 2ID0A 4GLVB 4DR5Q 4LFCL 4O0AA 3OTOQ 2JA5G 3OYYA 1BBWA 3CXCA 2E2HH 3PIOA 1I6HH 2BA1A 5IYBH 2LXJA 4X64L 4HJ7A 1IBML 4YCVA 1JT8A 4A3LH 4DR3Q 3RN2A 2VQEL 2GN5A 2HQLA 1YJWA 4X62L 4POGA 1IZ6A 1Y14B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ A;  1B7Y B;  2ZJR A;  1X54 A;  4DV4 L;  2UU9 L;  4A3E H;  4JI2 L;  2KCM A;  5FLX c;  1J5E Q;  1E7Z A;  3TRZ A;  4A3G H;  4O2D A;  1TWH H;  4IPG A;  3MEF A;  4DAY B;  3TS2 A;  3GTO H;  4DV1 Q;  1SMX A;  1P8L A;  4DV2 Q;  1RL2 A;  2EXD A;  1NJI C;  3J81 c;  1X55 A;  4P72 A;  4DV0 L;  1X3F A;  2B3G A;  1C7Y A;  1KIX A;  5IYC H;  1CSQ A;  3S16 H;  2UXC Q;  2UXD L;  3GD7 A;  3CCS A;  1A0I A;  3FKI G;  4A75 A;  3RN5 A;  1K83 H;  2KBN A;  3J80 c;  1VQA A;  2QEX A;  5IYD G;  3S1M H;  4DR7 Q;  5IT9 c;  2ZM6 L;  2CCZ A;  2JA6 H;  1CKN B;  1FGU A;  2IT1 A;  4GN5 A;  2YYZ A;  4HJ8 A;  2AMC B;  1MJE A;  4JOI A;  3J80 i;  1N34 Q;  1E3P A;  2K50 A;  4A3J H;  2I0Q A;  5IP9 H;  1NBW A;  1Y1W H;  2QA4 A;  4BBS G;  3HOU H;  4LUO A;  2VY3 A;  1PH6 A;  3CCE A;  1C9O A;  1Q46 A;  1K0R A;  2JA5 H;  4B3R Q;  1IBL L;  2F4V Q;  1TWA H;  3NEM A;  1XNQ Q;  1XMQ Q;  2NVQ H;  1PH5 A;  4APV A;  1VQK A;  2BA0 A;  5IWA L;  3A5Z B;  5M5W H;  2WB1 E;  3FHW A;  3G4S A;  1OXV A;  4R4C A;  3M7N A;  2E2I H;  1LM0 A;  4XTC S;  1N33 Q;  3CQZ H;  1WOC A;  1VQG A;  2D0O A;  3BZK A;  3E9H A;  4ME3 A;  5IE8 A;  2Q2U A;  4OWW B;  3CCR A;  4LUZ A;  5AJ3 Q;  1HH2 P;  1KHI A;  1PYB A;  3PUV A;  3PO3 G;  3S24 A;  4JI4 Q;  2PQA B;  4DR1 Q;  1C0A A;  3PGZ A;  1VQB A;  1SE8 A;  4JI3 L;  5BR8 Q;  3WWV A;  1XPR A;  3ER0 A;  4A3F H;  4P74 A;  4R4O A;  4AYB E;  2BH8 A;  4C2M H;  1UE1 A;  2C35 B;  5IP7 G;  1FVI A;  4R4T A;  2H5X A;  4UP8 A;  4BY1 G;  3L2P A;  4B3M Q;  4L5S A;  4LF4 L;  2ZTC A;  3FKI H;  4AIM A;  2WB1 G;  3KF8 B;  4GLX A;  1Q1E A;  5LMN W;  1HNZ Q;  2E5L Q;  3H0G G;  4OON A;  4JI6 L;  1FJG L;  4GKJ L;  2WP8 J;  4LF7 Q;  5IYD H;  4LUV A;  2ZJP A;  4LFB Q;  5M3M G;  3CMA A;  3VDY A;  5GQO A;  4LFA L;  1HNX L;  2LSS A;  2R7F A;  4LWC A;  1IXR A;  3CCU A;  4QGU A;  4DNI A;  4KHP L;  4BBS H;  1U5K A;  3CAM A;  2D62 A;  3RLO A;  3HKZ E;  3A0J A;  4YY3 L;  4JI1 Q;  4LF8 Q;  2IHE A;  4DV3 L;  1HR0 W;  1VQO A;  3H3V H;  1NMF A;  4FDB A;  4JCV E;  4IOC A;  2IX0 A;  1Z47 A;  3FP9 A;  5GAE C;  4JYA L;  3KDF B;  2RCN A;  1SRO A;  3D0F A;  4BBR G;  4DUZ Q;  3S1R H;  1XPU A;  1SRU A;  1UE6 A;  3M3Y H;  4LNQ A;  2Y0S E;  1I3Q H;  2OQ0 A;  4PZ8 A;  4UP9 A;  3CPF A;  4YCW A;  4LF6 Q;  2IX1 A;  1HZ9 A;  3KJO A;  4DV5 L;  4P73 A;  4DV7 Q;  1WI5 A;  3HKS A;  4BA1 I;  1N32 Q;  4IPD A;  1GM5 A;  1K8A C;  5C4J H;  5JJI A;  5HY6 A;  4P71 A;  1Q81 C;  3HFZ B;  3PUY A;  4IJH A;  2UUA Q;  1QUQ B;  1P16 A;  1N36 L;  3UE0 A;  3H3V I;  1XJV A;  1K73 C;  4NXM L;  1VQE A;  3RLF A;  1GVP A;  1K8G A;  1Q8K A;  3PO3 H;  2K14 A;  2R6G A;  4DR2 Q;  4JI8 Q;  4C3H H;  2HHH Q;  2K75 A;  1PH7 A;  1E22 A;  1I50 H;  2MFI A;  5IP7 H;  4A3M G;  1KQS A;  2UUC L;  2F3I A;  3UE1 A;  3UDI A;  4DUY Q;  4B3T Q;  4OX9 L;  3GTP H;  2E8G A;  4GLA C;  2VQF Q;  4BY1 H;  3M9B A;  1QZH A;  2MQH A;  2ZTE A;  3ERS X;  4OWT B;  2NVX H;  3H0G H;  4LF5 Q;  2YU9 H;  1L1O B;  5DLQ E;  1TWC H;  2V1C C;  4IO9 A;  1EYG A;  4LF9 Q;  5M3M H;  3RNU A;  3ULL A;  1OXS C;  4IJL A;  3W1B A;  4DR5 L;  3OTO L;  2VL6 A;  4DV6 Q;  1PH2 A;  4QY7 A;  4GNX A;  1G51 A;  3EBE A;  5GAD C;  3S14 H;  5H1S E;  4DKA C;  2N8N A;  3GTJ H;  1UE7 A;  2MO0 A;  4DR3 L;  1V43 A;  1A8V A;  1VQF A;  4HIK A;  1WFQ A;  2MO1 A;  4BBR H;  2R93 G;  3AFP A;  1WYD A;  4Y7N H;  3S1Q H;  4DR4 L;  4P75 A;  3M85 A;  3BZC A;  1L1O A;  3U4V A;  4IPC A;  5HGQ A;  4YHH Q;  3H15 A;  1TWG H;  2UUB L;  3CC7 A;  1D8L A;  1FL0 A;  2VQE Q;  4A3I G;  3S2D H;  4IFD G;  2BH2 A;  1L2F A;  4X66 Q;  4A3F G;  1J5E L;  4IFD J;  3ULJ A;  3JAM c;  4BY7 G;  1IYJ B;  1Z9F A;  1Y1V G;  4DV1 L;  4HIM A;  4X65 Q;  3PUW A;  4DV2 L;  3OW2 A;  1Q82 C;  1VQ7 A;  4B3S Q;  1RIP A;  3RZO H;  5JEA G;  3J81 i;  1W2B A;  1EOV A;  4A3K G;  1Q86 C;  3GTG H;  5JEA J;  3JAM i;  1EIY B;  2YTV A;  5M5Y H;  1I94 Q;  1VQD A;  1MJC A;  1OXU A;  1A63 A;  4AQY Q;  1MKH A;  1W3S A;  3U58 A;  4A3M H;  4DR7 L;  2N3S A;  4C3J H;  1Q1B A;  4R1J A;  4NPS A;  4RG1 A;  1BKB A;  3PF5 A;  1QVF A;  4GKK Q;  3ICE A;  3SGI A;  1I5F A;  3CD6 A;  2OQK A;  2Z6K C;  1N34 L;  3PCO B;  1VQ5 A;  4L5R C;  4BA2 I;  2HT1 A;  1D7Q A;  1PH9 A;  2PI2 E;  4K0K Q;  1YJN A;  3HOX H;  3CP0 A;  2R7D A;  4GOP B;  1B8A A;  2F4V L;  1Q7Y C;  1XNQ L;  2JEB I;  4BXX G;  3TEH B;  3CPW A;  1XMQ L;  3T1Y Q;  4DAM A;  4A3D G;  3KOJ A;  3G6E A;  1XMO Q;  3TS0 A;  3KJP A;  4MTN A;  1NMG A;  3K0X A;  3HOZ G;  2R93 H;  4GOP A;  4JG2 A;  1J6Q A;  1N33 L;  4ALP A;  1HNW Q;  3BU2 A;  1CKM A;  4A3I H;  3AFQ A;  2KHJ A;  5AJ3 L;  1L1O C;  1A62 A;  4YWM A;  4JI5 Q;  1TXY A;  3NEL A;  1SFO H;  3CCL A;  4JI0 Q;  4BY7 H;  4JI4 L;  4UP7 A;  4DR1 L;  3PF4 A;  1Y1V H;  5BR8 L;  1N8R C;  5C4X G;  5LMU Q;  2OTJ A;  2ES2 A;  3STB D;  5LMN Q;  4A3K H;  3A5U A;  2OTL A;  4R4Q A;  2LXK A;  3J7Z C;  3S17 H;  1VQJ A;  2HIV A;  4B3M L;  3NBH B;  2R92 G;  2Q2T A;  2E5L L;  1HNZ L;  2E2J H;  1IL2 A;  4JI3 Q;  1YVC A;  4JBK A;  3S2H H;  3PIP A;  1UWV A;  4LF7 L;  4WJ4 A;  4IFD I;  4LFB L;  3I56 A;  2NVT H;  1HZA A;  4JI7 Q;  4DR6 Q;  1X3G A;  2GVB A;  1VQ9 A;  1AE3 A;  1VQM A;  3M4O H;  5ELN A;  1QVG A;  1GKH A;  1HR0 Q;  4LF4 Q;  3HOV G;  3M4P A;  1YI2 A;  4JI6 Q;  4JV5 Q;  5M3F G;  2XGT A;  3EIV A;  1S72 A;  4JI1 L;  2UXB Q;  4LF8 L;  4XIG S;  2JE6 I;  1M1K C;  4KI0 A;  1EUJ A;  2XTI A;  4L5T A;  3RZD H;  4MNO A;  4DUZ L;  3BJU A;  4NXN Q;  4BXX H;  4Y52 H;  4A3D H;  4LF6 L;  3U4Z A;  1LUZ A;  2EQS A;  3UDF A;  1VQ6 A;  3T1H Q;  1PH4 A;  1UE5 A;  2ALY B;  2JK8 A;  4DV7 L;  3UDG A;  1YIT A;  3HOY G;  3PO2 G;  1X65 A;  2N49 A;  2AKW B;  1JJG A;  3M4Q A;  1N32 L;  3HOZ H;  3KF6 B;  3K8A A;  2NN6 G;  4JBJ A;  1YBY A;  2B29 A;  4PZ6 A;  4UPA A;  3CCM A;  1IBK Q;  1OTC A;  2JJQ A;  2UUA L;  4GN4 B;  1G6P A;  3K80 C;  4TQU S;  2I5H A;  2YTX A;  1WCM G;  2JQO A;  2HIX A;  4JBW A;  5C0X G;  3G48 A;  1S40 A;  3D31 A;  2CQO A;  2ATW A;  5JJL A;  1JJC B;  1YNX A;  4EX5 A;  5C0X J;  3PUZ A;  2VNU D;  3KF6 A;  4A4I A;  1AH9 A;  4GNX B;  4DR2 L;  4JI8 L;  5C4X H;  2DGY A;  1GO3 E;  1YEZ A;  1OXX K;  3UDX A;  4TVA B;  3I4N G;  3S15 H;  4DK3 C;  4B3T L;  4DUY L;  1XNR Q;  2R92 H;  2VQF L;  3HOX G;  3GTK H;  4HJA A;  1VQH A;  4LF5 L;  3GTL H;  1X9N A;  3KYH C;  3U50 C;  3CF5 A;  3JC6 6;  1NE3 A;  3GTM H;  1PVO A;  2FXQ A;  4LF9 L;  2VS1 A;  2CKZ B;  3F1Z A;  3I55 A;  1K9M C;  2KEN A;  3W1G A;  1GD7 A;  4RMF A;  1X6O A;  2VW9 A;  4DV6 L;  1VQC A;  1KC8 C;  2PI2 A;  1SR3 A;  3CCQ A;  2K52 A;  3F2B A;  5M3F H;  2Q2I A;  4LFC Q;  4H02 A;  3G71 A;  1IBM Q;  4X64 Q;  1OXT A;  2NVY H;  3MXN B;  3AQQ A;  2AWO A;  5E7N A;  1PHJ A;  1DGS A;  2NZH A;  1VQL A;  4IPH A;  1BVS A;  1EQQ A;  3GO5 A;  2ASB A;  2KHI A;  5C3E G;  4X62 Q;  4YHH L;  2JA7 G;  3STB C;  5J3B A;  3HOY H;  4GKJ Q;  5GAH C;  3PO2 H;  2R7Z G;  4X6A H;  3CME A;  4YWK A;  4DV4 Q;  4X66 L;  1KRS A;  2UU9 Q;  1NTG A;  4JI2 Q;  3CC4 A;  4HJ9 A;  2YV5 A;  4GN3 B;  5EAY A;  2VUM G;  4OO1 G;  5JJK A;  2N78 A;  2UXC L;  4B3S L;  4X65 L;  4A3C G;  1LTL A;  1YHB A;  1KRT A;  3AYH B;  1YIJ A;  3KFU A;  1UEB A;  1WCM H;  2UUB Q;  2RF4 A;  2WFW A;  3I4M G;  4DV0 Q;  3PSI A;  3NEN A;  2NZO A;  3F2D A;  1I94 L;  1PFS A;  4GS3 A;  1VQN A;  4AQY L;  2UXD Q;  4HJ5 A;  3DM3 A;  3I4N H;  1VQP A;  1KAW A;  2PNH A;  3GDE A;  5ELO A;  2JA8 G;  2ZM6 Q;  5K36 G;  2NN6 I;  4GKK L;  1AE2 A;  4KHZ A;  4AH6 A;  3DLL A;  1XPO A;  3E9I A;  2YTY A;  4B3R L;  5FLM G;  3TQY A;  4YWL A;  3A74 A;  4DK6 C;  2JEA I;  4K0K L;  1EIF A;  3K81 C;  1U0L A;  4DPG A;  5M5X H;  4HID A;  5C0X I;  3HOV H;  4A93 G;  2ZTD A;  3CC2 A;  1V1Q A;  3CCJ A;  3S1N H;  4QQB X;  4OXP A;  5IY0 A;  1IBL Q;  1JB7 A;  1XTD A;  2DUD A;  3T1Y L;  1XMO L;  4A3B G;  4JC0 A;  1CKN A;  4GNX C;  2L15 A;  5IWA Q;  5GRO A;  1EWI A;  2CWP A;  1NY4 A;  1VQ8 A;  5C3E H;  3L0O A;  1QZG A;  1R9T H;  4LW1 A;  2B63 G;  2JA7 H;  2MNA A;  4KLK A;  4IOA A;  1HNW L;  2WAQ E;  1VCI A;  3CCV A;  3RR5 A;  1E24 A;  4PG3 A;  2R7Z H;  1YZ6 A;  1EQR A;  1JMC A;  3J7A 5;  2A8V A;  1MIU A;  2ZJQ A;  3PUX A;  4JI5 L;  2VUM H;  4QL5 A;  4JI0 L;  3HOW G;  3EN2 A;  1YJ9 A;  4A3C H;  3B6Y A;  2AHO B;  1PV4 A;  5LMU L;  1WJJ A;  4WJ3 M;  1CSP A;  5LMN L;  1VQ4 A;  3I4M H;  3E0E A;  3IRB A;  1BBU A;  3KLW A;  1KL9 A;  4EQ5 A;  1PA6 A;  2K5H A;  3Q8D A;  1H95 A;  2RHQ B;  5FJ8 G;  1KXL A;  3CW2 C;  3K7A H;  1FJG Q;  4R4I A;  2GVA A;  4L5Q A;  5C44 G;  3K7U C;  4JBM A;  4UY8 C;  2JA8 H;  3I7F A;  4JI7 L;  4DR6 L;  4OO1 I;  2WAQ G;  4JOI C;  4LFA Q;  1HNX Q;  1HR0 L;  1T9H A;  3I4O A;  3F8T A;  5FLM H;  4JV5 L;  1B70 B;  2PQA A;  1JJ2 A;  2I5M X;  1E1O A;  4NB3 A;  4A93 H;  4KHP Q;  5IYB G;  1ASY A;  1JE5 A;  1HZC A;  2UXB L;  2RHS B;  1YHA A;  4YCU A;  4YY3 Q;  2Z0S A;  3J81 j;  2KCT A;  4A3L G;  4DV3 Q;  1TWF H;  5GAG C;  4NXN L;  4OWX B;  2K5N A;  2PMZ E;  3I2Z A;  4A76 A;  4JYA Q;  3W5O A;  1X3E A;  2VZA A;  4PZ7 A;  4A3B H;  3T1H L;  3L7Z C;  4HIO A;  1HZB A;  2IY5 B;  4DV5 Q;  4AYB G;  4C3I H;  2F52 A;  1KD1 C;  1ASZ A;  4DR4 Q;  1E1T A;  4A3E G;  1PH8 A;  1IBK L;  1EFW A;  3ZJY C;  3F2C A;  2B63 H;  4A3G G;  4J15 A;  1G29 1;  2CWA A;  2A1A A;  1V9P A;  2EIF A;  3ULP A;  1SN8 A;  1N36 Q;  2HHH L;  4GOP C;  2D0P A;  1SLJ A;  1PH1 A;  2CFM A;  2K5V A;  1VS0 A;  3KDF A;  1CKO A;  5IYC G;  4NXM Q;  3HOW H;  2A19 A;  4MZ9 A;  2QGQ A;  1CUK A;  3PV0 A;  4QIW E;  1PH3 A;  1O7I A;  1S3O A;  1N9W A;  2Z6K A;  2Q2H A;  1L0W A;  1LYL A;  2JA9 A;  4POF A;  3RLN A;  3HKZ G;  4QJF A;  2OCE A;  2IHF A;  2UUC Q;  1XNR L;  2JA6 G;  1PYS B;  4OX9 Q;  2K4K A;  1M90 C;  1VQI A;  1HJP A;  1X56 A;  2I5L X;  5FJ8 H;  3AEV A;  2AWN A;  3LGJ A;  2OWO A;  1QUQ A;  4A3J G;  4PMW A;  5C44 H;  5IP9 G;  3TRE A;  1Y1W G;  1QVC A;  2Y0S G;  3GTQ H;  3HOU G;  1K3R A;  1Q12 A;  2ID0 A;  4GLV B;  4DR5 Q;  4LFC L;  4O0A A;  3OTO Q;  2JA5 G;  3OYY A;  1BBW A;  3CXC A;  2E2H H;  3PIO A;  1I6H H;  2BA1 A;  5IYB H;  2LXJ A;  4X64 L;  4HJ7 A;  1IBM L;  4YCV A;  1JT8 A;  4A3L H;  4DR3 Q;  3RN2 A;  2VQE L;  2GN5 A;  2HQL A;  1YJW A;  4X62 L;  4POG A;  1IZ6 A;  1Y14 B; 
#chains in the Genus database with same CATH topology
 4IZ8 A;  4N9P A;  5I2Y A;  2KCC A;  2H1E A;  3SVM A;  2ZJR A;  2UU9 L;  4P2C B;  1O7Y A;  5G3L F;  4DAY B;  1K3B C;  4FXG C;  3GTO H;  4DV2 Q;  1RL2 A;  2EXD A;  1CHQ D;  1D2B A;  3V05 A;  1NJI C;  3J81 c;  1C7Y A;  3H3V C;  5IYC H;  1FNW A;  5BN3 A;  4KKU A;  3NWT A;  5AFW A;  4PV1 C;  1DOK A;  1CKN B;  4GN5 A;  2AMC B;  2X6G A;  3QG1 A;  1LTG D;  1HFG A;  1K28 A;  5IP9 H;  5KYI A;  2QA4 A;  4BBS G;  3HOU H;  2VY3 A;  1PH6 A;  1XNQ Q;  1XMQ Q;  1QNK A;  1L0Y B;  1V1P A;  3FHW A;  3NE5 B;  3FVQ A;  4RA8 A;  4QB4 A;  1JOQ A;  5FO9 B;  1GHJ A;  1ZKO A;  2IX3 A;  2D0O A;  3BZK A;  3E9H A;  4ME3 A;  4QUF A;  3MC0 B;  4IUP A;  4IUN A;  1CQF A;  2A6H C;  1Y1V B;  1U4M A;  3BDL A;  1H9R A;  3PO3 G;  3S24 A;  2PQA B;  3PGZ A;  4CGY B;  1XPR A;  4P74 A;  4AYB E;  1LO5 D;  2C35 B;  1FVI A;  2VXW A;  3KF8 B;  2E75 C;  5LMN W;  1TS5 A;  1FD7 D;  2RQX A;  5IYD H;  4GKJ L;  4LUV A;  5M3M G;  3VDY A;  1HNX L;  4O1N A;  2X69 A;  4LWC A;  5FLX L;  3CCU A;  2PZT A;  4FF3 A;  4DNI A;  2ZXP A;  3E0J A;  4ZK9 B;  1WTX A;  2F0V A;  4YY3 L;  2E76 C;  3NQT A;  2IHE A;  2IX0 A;  2RCN A;  1SRO A;  3D0F A;  3NUC A;  1SMY D;  1SRU A;  1UE6 A;  4O42 A;  4UP9 A;  3NWS A;  3CPF A;  2XWB B;  3CU7 A;  3J80 L;  4HSV A;  3HKS A;  5HY6 A;  1Q81 C;  4H44 C;  3T51 B;  1B3A A;  1G8Z D;  1K8O A;  1TVX A;  1VQE A;  3RLF A;  1K8G A;  1Q8K A;  5ELC A;  4JI8 Q;  3NTI A;  3P75 A;  1E22 A;  2MFI A;  4A3M G;  2UUC L;  2RDH A;  4OX9 L;  2VQF Q;  1QZH A;  2ZTE A;  5CGK A;  3GQB A;  1EFI D;  4TKO B;  1T5X D;  2CH4 W;  2LMC B;  3RNU A;  1NUC A;  5C44 B;  2A68 D;  1WTW A;  4DR5 L;  2A6E D;  1PH2 A;  4QY7 A;  1G51 A;  3S14 H;  4KV6 A;  4FNF A;  1BR9 A;  1ESR A;  4NMZ A;  2E2H B;  1A2U A;  3A54 A;  1ENC A;  2B2Y C;  5C3W A;  4IN3 A;  2MO1 A;  3A8J E;  1WYD A;  3G7L A;  1X3Q A;  3VR4 A;  1I4P A;  3M85 A;  4IPC A;  5HGQ A;  5KGU A;  1RKN A;  5L37 A;  3CC7 A;  4A3I G;  5COR A;  1LV9 A;  4X66 Q;  1VF7 A;  4V19 0;  4A3E B;  1IYJ B;  1VQ7 A;  2PYK A;  4HIM A;  1AN8 A;  4DV2 L;  3J81 i;  1W2B A;  3AMU A;  3T56 B;  1Q86 C;  3JAM i;  1EIY B;  4U67 3;  1I94 Q;  1VQD A;  2R3Z A;  2NB0 A;  4KD3 A;  2NTS A;  4N8F A;  1ZYR C;  1TII D;  2PMZ B;  2MPM A;  1NNX A;  3ICE A;  3SGI A;  2JA6 B;  2V4D A;  3PCO B;  4BA2 I;  3S1N B;  3L9A X;  2PI2 E;  4IUT A;  3HOX H;  2N55 A;  5CV4 A;  2IWH A;  1XNQ L;  1CM9 A;  2JA5 B;  3TEH B;  1XMQ L;  4V0B A;  4R8N A;  4A3D G;  4DAM A;  4G7H C;  3G6E A;  1CHP D;  2NVQ B;  1JR0 D;  1JWS D;  1EEI D;  2F0H A;  3BDC A;  4JG2 A;  5CV6 A;  5ISR A;  3QOL A;  4ALP A;  3H94 A;  1HNW Q;  2E2I B;  3C1E A;  4X3U A;  3DWP A;  3X3N A;  1L1O C;  1A62 A;  4YWM A;  4RKL A;  1CK1 A;  5JEA H;  3STB D;  1FNV A;  2DJF C;  2OTL A;  4R4Q A;  1BO0 A;  2LXK A;  2B2U C;  3S17 H;  1VQJ A;  1SND A;  2HIV A;  4N9T A;  3J81 E;  2R92 G;  2E2J H;  3SK5 A;  4JBK A;  4CKE A;  3E6Z X;  2F0J A;  1VQM A;  2PZU A;  1ESF A;  1HR0 Q;  1A3V A;  1VMC A;  4JI6 Q;  2XNA C;  3TDQ A;  5K36 H;  5A2Q E;  4ZUJ A;  5IGB A;  3R3O A;  1UNS A;  4BBS B;  4ZUI A;  4KD4 A;  1B44 D;  2E74 C;  4K5V A;  3WDN A;  1PZJ D;  3GV3 A;  5FO7 B;  2EQS A;  4C3I B;  3MWY W;  2JK8 A;  3PO2 G;  1GHK A;  3M4Q A;  1S5F D;  1EIG A;  3K8A A;  4JBJ A;  4UPA A;  4PZ6 A;  1LAC A;  4B9X A;  1OTC A;  1F77 A;  1U4R A;  5C4J B;  1XYI A;  1WCM G;  1WTH A;  2HIX A;  2IPK D;  3G48 A;  1PLF A;  4EX5 A;  4ZCK A;  2VNU D;  4A4I A;  1BXT A;  4I65 A;  4JI8 L;  4GNX B;  3PO3 B;  5C4X H;  2DGY A;  2HD3 A;  1GO3 E;  3KBG A;  1H9S A;  5LHY 1;  4TVA B;  4DK3 C;  1MD2 D;  2VQF L;  1F9R A;  3KYH C;  3JC6 6;  1QNU A;  1NE3 A;  2VS1 A;  2NVX B;  2CKZ B;  3F1Z A;  1QIL A;  1TWC B;  1SNP A;  4K8I A;  5CV7 A;  5IGE A;  2VW9 A;  1GD7 A;  1SYC A;  3CCQ A;  4IUQ A;  5M3F H;  4F7X A;  2DNE A;  1U4P A;  3MXP A;  2NZH A;  5IGG A;  4IPH A;  1BVS A;  1EQQ A;  2KHI A;  5J3B A;  4GZY C;  4X6A H;  2R7Z G;  1CI3 M;  1TWH B;  1KRS A;  2D2C C;  1NTG A;  4K2L A;  2NN6 H;  4X66 L;  4HJ9 A;  4OO1 G;  1E2W A;  2EJF C;  1YHB A;  4K5W A;  4CDD C;  1YIJ A;  2O2L D;  5DM7 3;  4DV0 Q;  2NZO A;  1I94 L;  3HKZ B;  3D6W A;  1ZEQ X;  3DM3 A;  1SJE D;  2PNH A;  3BVZ A;  5ELO A;  2JA8 G;  4CDC C;  1SYG A;  2NN6 I;  4ZYS A;  4A3M B;  1IW7 C;  2P5Z X;  1AE2 A;  5I2X A;  3TQY A;  4YWL A;  1EIF A;  3K81 C;  1U0L A;  4DPG A;  4HID A;  4A93 G;  4RAU C;  2ZTD A;  5EKK A;  5IY0 A;  2FJ2 A;  2KUM A;  4A3B G;  4F8M A;  4K6L A;  1JIC A;  2CWP A;  1NY4 A;  1YNJ D;  1X32 A;  5C3E H;  3S9W A;  3SK6 A;  1QZG A;  1R9T H;  4LW1 A;  2B63 G;  2JA7 H;  1HNW L;  5D14 A;  1LTA D;  1VCI A;  3RR5 A;  4TSS A;  1EQR A;  1ICW A;  2A8V A;  1PTO H;  1SEB D;  3HZX A;  3VA7 A;  1Y8N B;  1YJ9 A;  2JN4 A;  1PV4 A;  2EOT A;  1SFO B;  2G9D A;  3IRB A;  3KLW A;  1KL9 A;  4EQ5 A;  2A69 C;  2K5H A;  3Q8D A;  4UDU C;  2HCI A;  3MHB A;  1DXM A;  4HR7 B;  3A55 A;  1YNN C;  1HR0 L;  1T9H A;  5FLM H;  3URY A;  5JPN C;  1E1O A;  1NSN S;  4KHV A;  4RHR A;  3NSW A;  1HZC A;  1F9S A;  4DU9 A;  2GA4 B;  3J81 j;  4DV3 Q;  3EFX D;  5K5P A;  3HP3 A;  3N6R A;  3I2Z A;  3QWN A;  1M8A A;  1X3E A;  3BG3 A;  4PZ7 A;  3RZD B;  1HTP A;  3CHB D;  3C3L A;  4HIO A;  2IY5 B;  2ICE C;  4A3D B;  3MAQ A;  1ASZ A;  1E1T A;  3ZJY C;  4QCL A;  1I4R A;  1STG A;  5C5L A;  1W6K A;  2ZXR A;  1VS0 A;  3KDF A;  5IYC G;  3I3C A;  2QW7 A;  2Z6K A;  4BY1 B;  2JA9 A;  4POF A;  3RLN A;  2WAC A;  4QJF A;  2A6H D;  3NP8 A;  5KND A;  2YU9 B;  1O78 A;  2R92 B;  3MFG A;  2QIL A;  2AWN A;  2OWO A;  1V8Q A;  4HCS A;  5I6W A;  5IP9 G;  3GTL B;  2Y0S G;  3HOU G;  2ID0 A;  4CBV A;  3ND9 A;  4O0A A;  1BBW A;  3GTJ B;  4HJ7 A;  2Z8L A;  2FFK B;  1EYA A;  1JT8 A;  2EY1 A;  4Y7N B;  3RN2 A;  2XIW A;  2I07 B;  2VQE L;  1LTT D;  1AZP A;  1L0X B;  4DR4 Q;  1IZ6 A;  2F0Q A;  1EOT A;  3K58 A;  2X6L A;  1EU3 A;  3PO2 B;  2KCM A;  2NUC A;  1M4V A;  4TRD A;  1E7Z A;  3TRZ A;  4A3G H;  4O2D A;  3RZO B;  5J1Z A;  3MEF A;  2BCO A;  1SMX A;  1T5E A;  5M5Y B;  1X55 A;  4DV0 L;  1X3F A;  4MN3 A;  1CSQ A;  4E6I A;  2UXC Q;  4CJ2 C;  2QEX A;  5IYD G;  3S1M H;  4IUR A;  1FGU A;  2IT1 A;  1XTC D;  3TZU A;  1E3P A;  2K50 A;  3CRK C;  1CQV A;  4A3J H;  1NBW A;  1C9O A;  1PFM A;  2IJ0 A;  4B3R Q;  2F1M A;  2NTT A;  1TWA H;  2A74 C;  5E3F A;  3NEM A;  2AUJ D;  2G5D A;  4JPB W;  3PMF A;  2QDB A;  4ME5 A;  1VQK A;  2BA0 A;  2R93 B;  3A5Z B;  2WB1 E;  3R2T A;  1A6X A;  3G4S A;  1OXV A;  2A73 B;  3T4A C;  1LM0 A;  1CZG A;  1N33 Q;  3CQZ H;  3FEW X;  2VB3 X;  1VQG A;  5IE8 A;  2K33 A;  4HMJ A;  5EBC A;  4OWW B;  4BY7 B;  3CCR A;  2R7Z B;  3K5N A;  4EQP A;  4LUZ A;  5AJ3 Q;  1HH2 P;  1PYB A;  3PUV A;  2CHB D;  4JI4 Q;  4DR1 Q;  4JI3 L;  3FDT A;  4A3F H;  3VYS A;  2BH8 A;  3S2H B;  3FKI H;  2E5L Q;  1Q1E A;  4IQZ A;  2WP8 J;  3TP5 A;  4LFB Q;  5GQO A;  2JA8 B;  1QE6 A;  2B39 A;  3CAM A;  3VR6 A;  4A93 B;  4DV3 L;  1HR0 W;  1B9M A;  4UAI A;  1VQO A;  4JCV E;  4C1N I;  4RH6 A;  5KEE A;  3S1R H;  4NW2 A;  1XPU A;  2XSC A;  1H9K A;  2Y0S E;  1I3Q H;  2OQ0 A;  4PZ8 A;  4YCW A;  1STA A;  1HZ9 A;  3KJO A;  3OWE B;  4A3B B;  1WI5 A;  3MXG A;  4OEL B;  4P71 A;  4S3S A;  3HFZ B;  3PUY A;  4ID6 A;  4U68 A;  4IJH A;  1STH A;  5A2Q L;  2UUA Q;  2B63 B;  4CJ0 B;  1B50 A;  2B2V A;  4DNT B;  2K32 A;  1IKL A;  1QG7 A;  3KUP A;  1BCP F;  2K14 A;  1JC7 A;  4DR2 Q;  2G9H D;  4C3H H;  1PH7 A;  3N52 A;  5IP7 H;  1KQS A;  5JOB A;  2TSS A;  3UDI A;  4CKB A;  3KK7 A;  3M9B A;  2MQH A;  3GTM B;  4K8J A;  4OWT B;  5IGD A;  3H0G H;  1L1O B;  1Z7T A;  2EXZ A;  5A35 A;  4LF9 Q;  4IJL A;  4RWS C;  3GTQ B;  2B8G A;  4KN4 C;  2XWJ B;  5H1S E;  1D1I A;  3Q6S A;  1EYD A;  1V43 A;  1JCK B;  1VQF A;  3KBX A;  3AFP A;  4DR4 L;  4P75 A;  3H15 A;  3U4V A;  4YHH Q;  1TWG H;  2BDO A;  2UUB L;  3S2D H;  1D8L A;  1FL0 A;  2QDL A;  2WKD A;  2BH2 A;  3UI2 A;  1I4Q A;  4IFD J;  3ULJ A;  3JAM c;  5CV8 A;  4B3S Q;  4OGQ C;  4X65 Q;  5FO8 B;  2DNC A;  4HED A;  3OW2 A;  1RIP A;  5JEA G;  1BBX C;  1QJO A;  3GTO B;  3GTG H;  4KJN A;  4K5X A;  3I4N B;  1MJC A;  1GUS A;  1C48 A;  4C3J H;  2MJ8 A;  3CKI B;  4NPS A;  4RG1 A;  1QVF A;  4GKK Q;  4CDE C;  1I5F A;  3CD6 A;  3NQI A;  1VQ5 A;  4L5R C;  4ZRZ A;  4K0K Q;  1WTP A;  1SE2 A;  3P7J A;  1YJN A;  2KED A;  1B8A A;  1Q7Y C;  1MHW C;  1QOH A;  3L3O C;  3CPW A;  5JVG 3;  5HGT A;  4KMU C;  1LT5 D;  4QIW B;  1N33 L;  5NUC A;  5E4W C;  3Q23 A;  1CKM A;  2KEE A;  3FPP A;  1B9N A;  5AJ3 L;  1SYE A;  1G2S A;  1TXY A;  3CCL A;  4JI0 Q;  4JI4 L;  4UP7 A;  3SK8 A;  4DR1 L;  1Y1V H;  5JAV A;  3PF4 A;  2PW5 A;  1N8R C;  4Q0F A;  5LMU Q;  5C4X G;  3NTH A;  1HUN A;  1NR4 A;  4A3K H;  3J7Z C;  2O5J C;  3VYU A;  1RHP A;  3K7A B;  3NBH B;  1S5D D;  4XT1 B;  2E5L L;  4H13 C;  3TN2 A;  3PIP A;  4WJ4 A;  1ILP A;  4LFB L;  1F9Q A;  2Z1C A;  4DR6 Q;  3FMC A;  1LTB D;  1AP0 A;  1BCP B;  1KDB A;  2EY5 A;  4LF4 Q;  3HG9 A;  3M4P A;  3HS0 C;  4DAV A;  5M3F G;  3EA6 A;  3HRZ C;  2XGT A;  2J4X A;  1Q90 A;  2UXB Q;  3KLR A;  3J7A F;  1FGB D;  2XTI A;  1OO9 B;  1IW7 D;  2SNS A;  5IT9 L;  5JPM C;  1WTO A;  1LUZ A;  1UE5 A;  2ALY B;  2EJM A;  4YIJ A;  3UDG A;  2K6A A;  1YIT A;  2AKW B;  3X3M A;  3CRL C;  4FYD A;  2NN6 G;  1DZ1 A;  1F2L A;  3CCM A;  1RF2 D;  3T13 A;  2JJQ A;  5CBE E;  1S5B D;  2UUA L;  4GN4 B;  1G6P A;  3K80 C;  5C4Z A;  3HOW B;  1EZ6 A;  1S40 A;  5G3L D;  2CQO A;  1JJC B;  3W2D A;  5C0X J;  3HGB A;  4DR2 L;  2EY2 A;  1OXX K;  4EQN A;  3Q0A A;  1I4G A;  2A5H A;  2E2D C;  2L12 A;  1JOR A;  1X9N A;  1O7Z A;  2FXQ A;  2SOB A;  4LF9 L;  2KQ3 A;  3I55 A;  1K9M C;  2KEN A;  3W1G A;  4RMF A;  1VQC A;  4LFC Q;  1F9P A;  1S5E D;  2K52 A;  2XRQ D;  4K6D A;  4RGO S;  4H02 A;  3MFY A;  2MUY A;  3MXN B;  1OXT A;  2NVY H;  1YNN D;  1VQL A;  2C9O A;  2Z4I A;  2FHT A;  2ASB A;  1EQV A;  3DXJ C;  4OIK A;  5C3E G;  2F0I A;  4XYO A;  4AYB B;  4ZKB B;  4YHH L;  1IHZ A;  5CYU A;  2JA7 G;  3HOY H;  3QB3 A;  5GAH C;  3OIQ A;  3H91 A;  3DHQ A;  3CC4 A;  3TSS A;  2WIN B;  5EAY A;  5T1I A;  5I9O A;  1AW7 A;  5JJK A;  3GV6 A;  1HTL D;  3E5S A;  3IKJ A;  1D1K A;  4B3S L;  4X65 L;  3GP7 A;  3KLS X;  4BS9 A;  3PSI A;  3NEN A;  2KCN A;  2LS0 1;  2EDG A;  1PFS A;  1MBY A;  1SAP A;  2OEO A;  4FXK C;  1KAW A;  3GDE A;  1HFN A;  4GKK L;  3SDZ A;  4DK1 A;  1Y69 U;  4KHZ A;  3WOE A;  4AH6 A;  3E9I A;  2YTY A;  5FLM G;  1A2T A;  4DAY A;  3W3A A;  2JEA I;  1MSH A;  4K0K L;  4B9W A;  5M5X H;  5JVH 3;  1BDO A;  1XWE A;  3S1N H;  4QQB X;  2M00 A;  1JB7 A;  5KNB A;  3M4Y A;  2DUD A;  4MHE A;  1CKN A;  1EY9 A;  5IWA Q;  1S5C D;  2K01 A;  4NP5 A;  1RDP D;  3L0O A;  1DM0 B;  3C2P A;  2WAQ E;  3CCV A;  3J7A 5;  1MIU A;  2VUM H;  4JI0 L;  3I90 A;  1LT3 D;  4A3C H;  3I8Z A;  2AHO B;  5LMU L;  1WJJ A;  5IGC A;  3JAM E;  3I4M H;  2K5D A;  1BBU A;  2Z9H A;  4DNR B;  1B2T A;  1ENF A;  1PA6 A;  1EIH A;  1RD9 D;  3D4R A;  2B2W A;  3CW2 C;  2E2J B;  4L5Q A;  4DR6 L;  5COY A;  5M9O A;  1UEA B;  4JOI C;  4LFA Q;  3I4O A;  3F8T A;  5I9P A;  3R8B A;  2PQA A;  4XXE A;  1JJ2 A;  4NB3 A;  4KHP Q;  4M1U B;  1SXT A;  1JE5 A;  2UXB L;  1HHV A;  1G6Z A;  2RHS B;  1CT1 D;  1DOL A;  1PTO F;  3KF8 A;  1VMP A;  2JXM B;  2OXP A;  1I4H A;  2KOL A;  4FF2 A;  3U9S A;  4DV5 Q;  4C3I H;  2F52 A;  4H0L C;  1EFW A;  2RKS A;  3F2C A;  2JSO A;  4G7Z C;  4A3G G;  3TP7 A;  3ULP A;  1SN8 A;  3M7G A;  1N36 Q;  2D0P A;  1KDA A;  1SLJ A;  1PH1 A;  3T53 B;  2K5V A;  1CKO A;  2A19 A;  4MZ9 A;  5HUR A;  1CUK A;  4PMB A;  3A7A B;  4UHV A;  3RUZ A;  5C4X B;  3TME A;  4NDX A;  2OCE A;  2IHF A;  4L63 B;  2K4K A;  1M90 C;  1HJP A;  1X56 A;  5FJ8 H;  4FP5 D;  5M3M B;  3EJI A;  2KVM A;  4A3J G;  3DMU A;  3TRE A;  1QVC A;  5CR3 A;  1K3R A;  1Q12 A;  5E4X A;  1STE A;  1IKM A;  4LFC L;  3OYY A;  1BOS A;  3PIO A;  1CZW A;  1I6H H;  2QCP X;  5IYB H;  2LXJ A;  1V1O A;  1TKW B;  5M3F B;  4PQX A;  4YCV A;  1D5M C;  2GN5 A;  4PMC A;  2HQL A;  2HDM A;  1YJW A;  4POG A;  1WTR A;  1QB5 D;  2Q8T A;  5KRU A;  2HQE A;  5LL6 S;  1YHQ A;  1B3Q A;  1B7Y B;  1BCP C;  1EY4 A;  1G2T A;  4KKS A;  1TWH H;  3TS2 A;  4KKT A;  4DV1 Q;  3VR2 A;  4P72 A;  2B3G A;  4EGV A;  1KIX A;  1TY2 A;  3D8G A;  3S16 H;  1A3U A;  2F0K A;  3OHX C;  3GD7 A;  3CCS A;  3FKI G;  4A75 A;  3RN5 A;  1K83 H;  2MP1 A;  4HJ8 A;  1IYU A;  3J80 i;  1N34 Q;  2LFN A;  2I0Q A;  1CFM A;  2CVR A;  2EYH A;  1Y1W H;  1VDZ A;  4LUO A;  5ELE A;  4R8I A;  1SBB B;  3CCE A;  1WTQ A;  3VYR A;  1Q46 A;  1SMY C;  1Y8O B;  1B53 A;  3A8I E;  3MXU A;  3BDO A;  1LAB A;  1WTV A;  1AEX A;  5IWA L;  5M5W H;  1KAB A;  3PIP 3;  3M7N A;  4XTC S;  4A3I B;  1WOC A;  5C3E B;  3V2T A;  1KHI A;  1PTO B;  1LT6 D;  4RGN A;  1SE8 A;  5BR8 Q;  3WWV A;  4C3H G;  3ER0 A;  4C2M H;  4R4O A;  1UE1 A;  5IP7 G;  1JWM D;  1LLR D;  4L8J A;  2H5X A;  2DJG C;  2ZTC A;  4GLX A;  1HNZ Q;  2WB1 G;  3H0G G;  4OON A;  4JI6 L;  4LF7 Q;  3OIP A;  3M4O B;  2ZJP A;  2A6E C;  3CMA A;  1EQT A;  4LFA L;  3TP6 A;  2LSS A;  2DN8 A;  4QGU A;  4KHP L;  1U5K A;  3K5O A;  3A0J A;  4JI1 Q;  4LF8 Q;  4ZAI A;  3QJY A;  3H3V H;  1NMF A;  3AU7 A;  2RSN A;  3FP9 A;  5GAE C;  2F0W A;  3S15 H;  5CBA E;  1JB3 A;  2K03 A;  4DUZ Q;  3M3Y H;  2AQ2 B;  4KY7 A;  4FVM A;  4LF6 Q;  2R61 A;  1C8C A;  4DV5 L;  4P73 A;  1GJX A;  5JJZ A;  1U9R A;  2IL8 A;  2EYP A;  3NXW A;  3R2I A;  1QUQ B;  2BE5 C;  1N36 L;  3H3V I;  1II3 A;  1SNQ A;  1XJV A;  4ILW A;  1J8I A;  2SDF A;  1BF4 A;  1GVP A;  4M8A A;  2R6G A;  5FKA C;  2HHH Q;  2K75 A;  1I50 H;  4KY6 A;  4C3J G;  4B3T Q;  3UE1 A;  3GTP H;  1LT4 D;  4GLA C;  4BY1 H;  3MEH A;  2YU9 H;  5DLQ E;  4IO9 A;  1EYG A;  1SDF A;  1OXS C;  3ULL A;  1NCV A;  4DV6 Q;  4GNX A;  3EBE A;  4KN7 C;  5ELF A;  2F0S A;  2RDG A;  2N8N A;  3GTJ H;  1PMR A;  4HCE A;  1UE7 A;  2J0T D;  2MO0 A;  1A8V A;  2XRS D;  1H9M A;  4WRD A;  4C56 C;  4HIK A;  4BBR H;  3S1Q H;  4Y7N H;  1DYQ A;  4EQO A;  1Z6H A;  1L2F A;  4CHT B;  4QUC A;  1WCM B;  1Y1V G;  2B2T A;  4DV1 L;  3PUW A;  1GXD C;  1TS2 A;  3RZO H;  4A3G B;  4DXG A;  1EOV A;  1TQO A;  4A3K G;  1CA5 A;  1QWY A;  2YTV A;  5M5Y H;  1MKH A;  1NAP A;  5ELD A;  1W3S A;  1Q1B A;  4WFN 3;  3SE0 A;  1V1P B;  3PF5 A;  3K57 A;  4XQN A;  2Z6K C;  1N34 L;  1UAP A;  1DD2 A;  2ZXO A;  2HT1 A;  1DOM A;  4G7O C;  2L55 A;  4A3J B;  3CP0 A;  2R7D A;  1Q8I A;  2HUG A;  5CC4 A;  5TSS A;  3MTS A;  4RKB A;  1SYD A;  1TWA B;  1SNC A;  3T1Y Q;  3KOJ A;  4RGM A;  1XMO Q;  3IAY A;  3BVM A;  3TS0 A;  1Q3L A;  3IFT A;  2R93 H;  4GOP A;  3SXH A;  1S4Z A;  3BU2 A;  2CH4 A;  3VR3 A;  4IFD H;  4Q5V A;  1TU2 B;  1ENA A;  4BY7 H;  2CW0 C;  2PQE A;  5BR8 L;  1BNZ A;  2WV6 D;  3A5U A;  2NZ1 D;  4IUU A;  2Q2T A;  1HNZ L;  1TS4 A;  3S2H H;  1UWV A;  4J1M A;  4LF7 L;  4OEM B;  1BQQ T;  5FK9 C;  3FKI B;  2HDL A;  4IFD I;  2H4O A;  1HPC A;  1HZA A;  4JI7 Q;  2NVT H;  2F0G A;  1ZYR D;  2GVB A;  1AE3 A;  1VQ9 A;  5ELN A;  1EU4 A;  1GKH A;  4HTH A;  3J81 L;  2EPB A;  4JV5 Q;  3JAM L;  1S72 A;  1TWF B;  4JI1 L;  4LF8 L;  4XIG S;  1SNO A;  1HA5 A;  2JE6 I;  1M1K C;  4KI0 A;  1EUJ A;  5BN5 A;  4L5T A;  1LTR D;  4DUZ L;  4BXX H;  4NXN Q;  5DEH A;  4LF6 L;  3U4Z A;  3UDF A;  1VQ6 A;  3S1R B;  2WKC A;  1PH4 A;  1AZQ A;  3HOY G;  1X65 A;  2N49 A;  4J6H A;  3BYY B;  3HOZ H;  3QOJ A;  1YBY A;  1IBK Q;  5DM6 3;  2ICI A;  2RSO A;  3K5M A;  4TQU S;  3FRP B;  2YTX A;  3LWE A;  3D31 A;  2ATW A;  5JJL A;  1YNX A;  3PIO 3;  2K05 A;  1R4P B;  3R93 A;  3KF6 A;  1O80 A;  2KJX A;  2WII B;  4ULL A;  3QIA A;  1YEZ A;  4LMQ D;  2L5T A;  1ILQ A;  3LX0 A;  2Q8I B;  4B3T L;  1GUO A;  1VF5 C;  2F0P A;  1EZ8 A;  3HOX G;  3GTK H;  2LY7 A;  3DWQ A;  3U50 C;  4XQQ A;  3GTM H;  2WB1 B;  1IYV A;  4DGZ A;  3H0G B;  1PTO C;  4DV6 L;  3HOV H;  3F2B A;  2Q2I A;  3MVV A;  2K1B A;  3G71 A;  1IBM Q;  4X64 Q;  1F2M A;  2K5W A;  3AQQ A;  2LKV A;  1PHJ A;  2Z4H A;  1LTI D;  3GO5 A;  4RCN A;  2D5D A;  2D9U A;  4X62 Q;  4I7Z C;  3CME A;  1RTN A;  4YWK A;  3D4W A;  4DV4 Q;  2F3V A;  4JI2 Q;  4ABN A;  3S2D B;  2VUM G;  1EL0 A;  3D6C A;  2N78 A;  2UXC L;  4A3C G;  1LTL A;  1KRT A;  3AYH B;  1UEB A;  2WFW A;  3I4M G;  2F4I A;  5C0X H;  1I6V C;  3F2D A;  2F0D A;  4GS3 A;  3GTG B;  2B2V C;  1VQN A;  4WJW A;  2UXD Q;  4IUV A;  4HJ5 A;  3I4N H;  2ZM6 Q;  5K36 G;  4F87 A;  1TY0 A;  5D65 A;  4C3J B;  1HQR D;  3SK4 A;  4BWG B;  2Y0S B;  3HOU B;  4B3R L;  4DK6 C;  4DXF A;  5C0X I;  1V1Q A;  1MSG A;  5KNC A;  2K7V A;  1WD1 A;  1IBL Q;  1XTD A;  3T1Y L;  1XMO L;  4JC0 A;  1ET9 A;  3NPP A;  5GRO A;  4C3I G;  1VQ8 A;  5IOC A;  3V96 A;  4KLK A;  4IOA A;  2L9H A;  5C6A A;  1E24 A;  3WOF A;  1YZ6 A;  1JMC A;  2NBF A;  2RCF A;  2PCF B;  1JOO A;  1HCZ A;  4JK1 C;  2PNR C;  3C1F A;  1KNA A;  3B6Y A;  4L6T B;  5BN4 A;  1CSP A;  1ROD A;  3E0E A;  1ZXT A;  1PZI D;  5I4D A;  3EVQ A;  3J7Y W;  1BCP D;  3ERQ A;  2DY8 A;  5CV5 A;  4A3K B;  2PPB C;  1H95 A;  1PRT C;  1PDQ A;  5FJ8 G;  4DFA A;  3K7A H;  1FJG Q;  2GVA A;  4UY8 C;  1E2Z A;  4MIU A;  2EYJ A;  2F03 A;  4JI7 L;  1XXG A;  2F0L A;  2WAQ G;  3KLS A;  1TT2 A;  2B2Y A;  4JV5 L;  2I5M X;  5IYB G;  2EY6 A;  1YHA A;  4YCU A;  2Z0S A;  2DY7 A;  5GAG C;  1GUG A;  4NXN L;  2K5N A;  2PMZ E;  4JYA Q;  5EGT A;  4LJZ C;  3L7Z C;  3P1H A;  1HZB A;  1H9S B;  1NR2 A;  5IGF A;  1IBK L;  1AFP A;  1G29 1;  2CWA A;  1V9P A;  3OMG A;  1HUM A;  3HOW H;  4NXM Q;  4DN4 M;  4FF1 A;  1O7I A;  1L0W A;  4MTK A;  5E1F A;  4G4K A;  3HKZ G;  4H7B A;  1SYF A;  1PYS B;  1JWU D;  1VQI A;  4RHS A;  1G91 A;  3RD4 A;  2I5L X;  3FPU B;  1PZK D;  5EQ0 A;  4PMW A;  2A69 D;  5C44 H;  2O5I C;  1Y1W G;  2PZW A;  4WOR A;  4X3K A;  3S14 B;  4FF4 A;  2CQA A;  3OTO Q;  3CXC A;  2E2H H;  4K2K A;  4ODG A;  5C3X A;  1IBM L;  4X64 L;  4A3L H;  4DR3 Q;  2NVY B;  4X62 L;  1A3T A;  1ICF B;  1L1O A;  2QF7 A;  1DCZ A;  5IIF A;  1FR3 A;  1X54 A;  4DV4 L;  4JI2 L;  4A3E H;  3HOY B;  5FLX c;  1WVL A;  1RTO A;  1J5E Q;  5EJW A;  2B2U A;  1B4O A;  3I4L A;  4IPG A;  3K59 A;  2O4X A;  4F88 A;  1P8L A;  2FIN B;  4HAE A;  4J8Q A;  4OHJ A;  1HA6 A;  1SSO A;  2UXD L;  1A0I A;  2BOS A;  2KBN A;  1GOZ A;  3J80 c;  1VQA A;  2BE5 D;  2HCC A;  2BDN A;  4DR7 Q;  3NTK A;  5J22 A;  5IT9 c;  2ZM6 L;  1KLU D;  3MZ5 A;  2CCZ A;  2JA6 H;  2YYZ A;  2K28 A;  4KJO A;  1MJE A;  3NHH A;  4JOI A;  2OF1 A;  3HOX B;  3ONA B;  3D4D A;  3TP8 A;  4IAL A;  5M5X B;  1K0R A;  2JA5 H;  5F2D A;  1FYC A;  1IBL L;  2F4V Q;  4HSP A;  2NVQ H;  1PH5 A;  4APV A;  2RDF A;  4DF7 A;  4DA2 A;  4R4C A;  2E2I H;  5EKI A;  4KK7 A;  3TZD A;  1ONL A;  2RVL A;  3C46 A;  2Q2U A;  1R4Q B;  2M9V A;  5CMD A;  2L0C A;  3DEO A;  3K6O A;  3ND8 A;  1STB A;  5C4H A;  2VUM B;  5C5M A;  1C0A A;  1VQB A;  3S17 B;  3T16 A;  4ZKC B;  3I70 A;  5ELB A;  1STN A;  3I4M B;  4R4T A;  4UP8 A;  3L2P A;  4BY1 G;  4B3M Q;  4L5S A;  4AIM A;  4LF4 L;  3IL8 A;  1FJG L;  2EYF A;  2R7F A;  1STY A;  2RA4 A;  1IXR A;  1CA6 A;  2PW7 A;  1EY8 A;  1PFB A;  1HQM C;  1SE3 A;  4BBS H;  2D62 A;  2EYO A;  3RLO A;  3HKZ E;  4C1N K;  3OMC A;  5KYL A;  2QKI C;  4CKC A;  2QEJ C;  1ET6 A;  4FDB A;  3NBH A;  4IOC A;  1Z47 A;  4JYA L;  3KDF B;  4BBR G;  4LNQ A;  2IX1 A;  3A7L A;  5T1G A;  4DV7 Q;  1I4X A;  4BA1 I;  1PFN A;  1N32 Q;  4IPD A;  1GM5 A;  1K8A C;  5C4J H;  5JJI A;  2FMC A;  4XQJ A;  3OPO A;  2SEB D;  1P16 A;  2VB2 X;  3A8K E;  3UE0 A;  4B08 A;  1K73 C;  4NXM L;  3PO3 H;  2FMM A;  3DM1 A;  4HN7 A;  1D6E C;  2K5Q A;  5FOB B;  1A15 A;  2F3I A;  4DUY Q;  1SYB A;  3BVG A;  2E8G A;  3ERS X;  1O7L A;  2CW0 D;  2ZT9 C;  4XYQ A;  2NVX H;  4LF5 Q;  1XX8 A;  1TWC H;  2V1C C;  5M3M H;  4XDX A;  3H6M A;  3W1B A;  1HXY D;  1ML0 D;  2B2W C;  3OTO L;  2K04 A;  2VL6 A;  2WAQ B;  1EY7 A;  1H9J A;  5GAD C;  4DKA C;  2B8F A;  1EY0 A;  3OOC A;  3A56 A;  1BUV T;  1I6H B;  4DR3 L;  5EPK A;  1JQY D;  1WFQ A;  2R93 G;  3QO2 A;  2Z6B A;  3BZC A;  2F0M A;  2VQE Q;  4IFD G;  2PO4 A;  4FO2 A;  4A3F G;  1J5E L;  4LK1 C;  1EWH A;  1RCV D;  4BY7 G;  1Z9F A;  2AUK A;  2I46 A;  1Q82 C;  3BS1 A;  1KAA A;  3MXN A;  1Y8P B;  5CV9 A;  5JEA J;  2L4N A;  1OXU A;  1A63 A;  4AQY Q;  3S16 B;  4JVZ A;  3OWF A;  3U9O A;  3U58 A;  4DR7 L;  4A3M H;  2N3S A;  1K83 B;  3BYT B;  4R1J A;  1PRT F;  1BKB A;  3DEP A;  1KTK A;  2OQK A;  3ZYY X;  2F0F A;  1D7Q A;  1PH9 A;  5KIX A;  5EKL A;  1Y1W B;  4GOP B;  2F4V L;  2JEB I;  4BXX G;  1E2V A;  4PNY A;  3LNN A;  1GUN A;  5IOD A;  1CTM A;  3KJP A;  4MTN A;  4JW0 A;  1R9T B;  2ENB A;  1PTO D;  1NMG A;  3K0X A;  2JA7 B;  3HOZ G;  4G57 A;  5M5W B;  4FXD A;  1J6Q A;  2KA7 A;  2EZV A;  1C4Q A;  4A3I H;  4KY5 A;  3AFQ A;  3IFD A;  2KHJ A;  3K5L A;  2EVB A;  4JI5 Q;  1SFO H;  3NEL A;  5DAU A;  3K0Y A;  1F2Z A;  5FLX E;  4ZLT F;  2OTJ A;  2ES2 A;  5LMN Q;  3HEJ A;  2A68 C;  4C2M B;  4B3M L;  1EWC A;  5EBD A;  1IL2 A;  4JI3 Q;  1YVC A;  1F2Y A;  3H09 A;  3I56 A;  3J80 E;  1X3G A;  3PQI A;  5IT9 E;  1KLG D;  3M4O H;  1QVG A;  3HOV G;  1YI2 A;  1SJH D;  3EIV A;  1D5X C;  1JOK A;  2F0T A;  3E3X A;  3RZD H;  4MNO A;  3ERO A;  3BJU A;  3ITP A;  4Y52 H;  4A3D H;  5J39 A;  3S15 B;  3T1H Q;  3M3Y B;  4QMG A;  4DV7 L;  3J7A V;  1JJG A;  1TS3 A;  1N32 L;  3KF6 B;  1QCB D;  2B29 A;  3BZD B;  2NWG A;  2JYO A;  2EJG C;  2I5H A;  2JQO A;  1JE4 A;  3Q24 A;  4JBW A;  2MGS A;  5C0X G;  3PUZ A;  1AH9 A;  2EYL A;  2RBM A;  1GUW A;  2TMP A;  3UDX A;  3I4N G;  4DUY L;  3D3R A;  4RFB A;  2F3W A;  4K14 A;  4DK0 A;  1XNR Q;  2R92 H;  3I73 A;  1I50 B;  2IW3 A;  4HJA A;  3GTP B;  1VQH A;  4LF5 L;  2F0N A;  1KDC A;  3GTL H;  3CF5 A;  1PVO A;  4XT3 B;  1SE4 A;  1KC8 C;  1X6O A;  4ZQ3 A;  2PI2 A;  1SR3 A;  1PRT D;  1FNU A;  4CDF C;  3LWU A;  1PRT B;  2XN9 C;  3QR8 A;  2AWO A;  2JP1 A;  2Q8R E;  1DGS A;  5E7N A;  1HRJ A;  4QF4 A;  4N8X 1;  4BBR B;  1IL8 A;  3STB C;  3S1Q B;  2F0O A;  3PO2 H;  5D3D A;  2UU9 Q;  2YV5 A;  4GN3 B;  2L1B A;  3I91 A;  1EY5 A;  3KFU A;  2UUB Q;  1WCM H;  2RF4 A;  1SNM A;  1LTS D;  3AB9 A;  3S1M B;  4AQY L;  2J7Z A;  1VQP A;  1U4L A;  4OIJ A;  2M2L A;  1XPO A;  3DLL A;  1D5Z C;  1EEF D;  3A74 A;  3CC2 A;  3CCJ A;  1PYW D;  4OXP A;  2C5C A;  2OT2 A;  2AQ1 B;  1E0B A;  2SNM A;  4Z9C B;  2EYM A;  4GNX C;  2L15 A;  1EWI A;  3CQZ B;  2KEC A;  3SHL A;  2MNA A;  2R7Z H;  4PG3 A;  4R9W A;  3EQL C;  3DWA A;  2ZJQ A;  3PUX A;  4OO1 H;  4JI5 L;  2EE1 A;  4QL5 A;  3HOW G;  3EN2 A;  4A3F B;  1EYC A;  2F0U A;  3MA2 B;  5EPJ A;  3VA5 A;  4WJ3 M;  3VR5 A;  4RCO A;  5LMN L;  1VQ4 A;  4I7A A;  3VYT A;  2AQ3 B;  2N88 A;  1DJR D;  2B2T C;  2RHQ B;  1KXL A;  1GUT A;  4R4I A;  2JA8 H;  5C44 G;  4GKJ Q;  3K7U C;  3TBI B;  1J9O A;  4JBM A;  3I7F A;  4X3S A;  4OO1 I;  1K8M A;  1HNX Q;  3O13 A;  2NVT B;  1B70 B;  2NYZ D;  1B1Z A;  3P20 A;  4A93 H;  1MI2 A;  4HMI A;  1ASY A;  1EY6 A;  4YY3 Q;  5I6Y A;  2KCT A;  4A3L G;  1K0S A;  1TWF H;  1I3Q B;  3G6J B;  4OWX B;  4A76 A;  3W5O A;  4CJ1 B;  2VZA A;  4A3B H;  3T1H L;  1X3P A;  1UUP A;  3Q22 A;  4AYB G;  1KD1 C;  1TR5 A;  4A3E G;  5LL6 X;  1PH8 A;  4EVO A;  1KNE A;  2B63 H;  3HOZ B;  3OW7 A;  4NKL A;  4J15 A;  4RGT A;  2A1A A;  1DON A;  2EIF A;  2HHH L;  5EPL A;  4GOP C;  2CFM A;  4C3H B;  4KTA A;  1WD0 A;  4LAA A;  2KHS A;  2QGQ A;  3PV0 A;  4QIW E;  1PH3 A;  1S3O A;  1N9W A;  2Q2H A;  1LYL A;  1XNR L;  2JA6 G;  3OSO A;  2UUC Q;  1MGS A;  4OX9 Q;  1PXU A;  2MHV A;  1RJT A;  2F0E A;  3I72 A;  5D3I B;  3AEV A;  5DNF A;  3NK9 A;  3LGJ A;  3GTK B;  1QUQ A;  3NBI A;  1W6J A;  3GTQ H;  4GLV B;  1YNJ C;  3DUZ A;  4DR5 Q;  2JA5 G;  3F2U A;  4X3T A;  3SR1 A;  3HOV B;  2BA1 A;  2L11 A;  4DAP A;  4OL7 A;  3SEB A;  3RMH A;  1TWG B;  2XVS A;  1Y14 B; 
#chains in the Genus database with same CATH homology
 1YHQ A;  1B7Y B;  2ZJR A;  1X54 A;  4DV4 L;  2UU9 L;  4A3E H;  4JI2 L;  2KCM A;  5FLX c;  1J5E Q;  1E7Z A;  3TRZ A;  4A3G H;  4O2D A;  1TWH H;  4IPG A;  3MEF A;  4DAY B;  3TS2 A;  3GTO H;  4DV1 Q;  1SMX A;  1P8L A;  4DV2 Q;  1RL2 A;  2EXD A;  1NJI C;  3J81 c;  1X55 A;  4P72 A;  4DV0 L;  1X3F A;  2B3G A;  1C7Y A;  1KIX A;  5IYC H;  1CSQ A;  3S16 H;  2UXC Q;  2UXD L;  3GD7 A;  3CCS A;  1A0I A;  3FKI G;  4A75 A;  3RN5 A;  1K83 H;  2KBN A;  3J80 c;  1VQA A;  2QEX A;  5IYD G;  3S1M H;  4DR7 Q;  5IT9 c;  2ZM6 L;  2CCZ A;  2JA6 H;  1CKN B;  1FGU A;  2IT1 A;  4GN5 A;  2YYZ A;  4HJ8 A;  2AMC B;  1MJE A;  4JOI A;  3J80 i;  1N34 Q;  1E3P A;  2K50 A;  4A3J H;  2I0Q A;  5IP9 H;  1NBW A;  1Y1W H;  2QA4 A;  4BBS G;  3HOU H;  4LUO A;  2VY3 A;  1PH6 A;  3CCE A;  1C9O A;  1Q46 A;  1K0R A;  2JA5 H;  4B3R Q;  1IBL L;  2F4V Q;  1TWA H;  3NEM A;  1XNQ Q;  1XMQ Q;  2NVQ H;  1PH5 A;  4APV A;  1VQK A;  2BA0 A;  5IWA L;  3A5Z B;  5M5W H;  2WB1 E;  3FHW A;  3G4S A;  1OXV A;  4R4C A;  3M7N A;  2E2I H;  1LM0 A;  4XTC S;  1N33 Q;  3CQZ H;  1WOC A;  1VQG A;  2D0O A;  3BZK A;  3E9H A;  4ME3 A;  5IE8 A;  2Q2U A;  4OWW B;  3CCR A;  4LUZ A;  5AJ3 Q;  1HH2 P;  1KHI A;  1PYB A;  3PUV A;  3PO3 G;  3S24 A;  4JI4 Q;  2PQA B;  4DR1 Q;  1C0A A;  3PGZ A;  1VQB A;  1SE8 A;  4JI3 L;  5BR8 Q;  3WWV A;  1XPR A;  3ER0 A;  4A3F H;  4P74 A;  4R4O A;  4AYB E;  2BH8 A;  4C2M H;  1UE1 A;  2C35 B;  5IP7 G;  1FVI A;  4R4T A;  2H5X A;  4UP8 A;  4BY1 G;  3L2P A;  4B3M Q;  4L5S A;  4LF4 L;  2ZTC A;  3FKI H;  4AIM A;  2WB1 G;  3KF8 B;  4GLX A;  1Q1E A;  5LMN W;  1HNZ Q;  2E5L Q;  3H0G G;  4OON A;  4JI6 L;  1FJG L;  4GKJ L;  2WP8 J;  4LF7 Q;  5IYD H;  4LUV A;  2ZJP A;  4LFB Q;  5M3M G;  3CMA A;  3VDY A;  5GQO A;  4LFA L;  1HNX L;  2LSS A;  2R7F A;  4LWC A;  1IXR A;  3CCU A;  4QGU A;  4DNI A;  4KHP L;  4BBS H;  1U5K A;  3CAM A;  2D62 A;  3RLO A;  3HKZ E;  3A0J A;  4YY3 L;  4JI1 Q;  4LF8 Q;  2IHE A;  4DV3 L;  1HR0 W;  1VQO A;  3H3V H;  1NMF A;  4FDB A;  4JCV E;  4IOC A;  2IX0 A;  1Z47 A;  3FP9 A;  5GAE C;  4JYA L;  3KDF B;  2RCN A;  1SRO A;  3D0F A;  4BBR G;  4DUZ Q;  3S1R H;  1XPU A;  1SRU A;  1UE6 A;  3M3Y H;  4LNQ A;  2Y0S E;  1I3Q H;  2OQ0 A;  4PZ8 A;  4UP9 A;  3CPF A;  4YCW A;  4LF6 Q;  2IX1 A;  1HZ9 A;  3KJO A;  4DV5 L;  4P73 A;  4DV7 Q;  1WI5 A;  3HKS A;  4BA1 I;  1N32 Q;  4IPD A;  1GM5 A;  1K8A C;  5C4J H;  5JJI A;  5HY6 A;  4P71 A;  1Q81 C;  3HFZ B;  3PUY A;  4IJH A;  2UUA Q;  1QUQ B;  1P16 A;  1N36 L;  3UE0 A;  3H3V I;  1XJV A;  1K73 C;  4NXM L;  1VQE A;  3RLF A;  1GVP A;  1K8G A;  1Q8K A;  3PO3 H;  2K14 A;  2R6G A;  4DR2 Q;  4JI8 Q;  4C3H H;  2HHH Q;  2K75 A;  1PH7 A;  1E22 A;  1I50 H;  2MFI A;  5IP7 H;  4A3M G;  1KQS A;  2UUC L;  2F3I A;  3UE1 A;  3UDI A;  4DUY Q;  4B3T Q;  4OX9 L;  3GTP H;  2E8G A;  4GLA C;  2VQF Q;  4BY1 H;  3M9B A;  1QZH A;  2MQH A;  2ZTE A;  3ERS X;  4OWT B;  2NVX H;  3H0G H;  4LF5 Q;  2YU9 H;  1L1O B;  5DLQ E;  1TWC H;  2V1C C;  4IO9 A;  1EYG A;  4LF9 Q;  5M3M H;  3RNU A;  3ULL A;  1OXS C;  4IJL A;  3W1B A;  4DR5 L;  3OTO L;  2VL6 A;  4DV6 Q;  1PH2 A;  4QY7 A;  4GNX A;  1G51 A;  3EBE A;  5GAD C;  3S14 H;  5H1S E;  4DKA C;  2N8N A;  3GTJ H;  1UE7 A;  2MO0 A;  4DR3 L;  1V43 A;  1A8V A;  1VQF A;  4HIK A;  1WFQ A;  2MO1 A;  4BBR H;  2R93 G;  3AFP A;  1WYD A;  4Y7N H;  3S1Q H;  4DR4 L;  4P75 A;  3M85 A;  3BZC A;  1L1O A;  3U4V A;  4IPC A;  5HGQ A;  4YHH Q;  3H15 A;  1TWG H;  2UUB L;  3CC7 A;  1D8L A;  1FL0 A;  2VQE Q;  4A3I G;  3S2D H;  4IFD G;  2BH2 A;  1L2F A;  4X66 Q;  4A3F G;  1J5E L;  4IFD J;  3ULJ A;  3JAM c;  4BY7 G;  1IYJ B;  1Z9F A;  1Y1V G;  4DV1 L;  4HIM A;  4X65 Q;  3PUW A;  4DV2 L;  3OW2 A;  1Q82 C;  1VQ7 A;  4B3S Q;  1RIP A;  3RZO H;  5JEA G;  3J81 i;  1W2B A;  1EOV A;  4A3K G;  1Q86 C;  3GTG H;  5JEA J;  3JAM i;  1EIY B;  2YTV A;  5M5Y H;  1I94 Q;  1VQD A;  1MJC A;  1OXU A;  1A63 A;  4AQY Q;  1MKH A;  1W3S A;  3U58 A;  4A3M H;  4DR7 L;  2N3S A;  4C3J H;  1Q1B A;  4R1J A;  4NPS A;  4RG1 A;  1BKB A;  3PF5 A;  1QVF A;  4GKK Q;  3ICE A;  3SGI A;  1I5F A;  3CD6 A;  2OQK A;  2Z6K C;  1N34 L;  3PCO B;  1VQ5 A;  4L5R C;  4BA2 I;  2HT1 A;  1D7Q A;  1PH9 A;  2PI2 E;  4K0K Q;  1YJN A;  3HOX H;  3CP0 A;  2R7D A;  4GOP B;  1B8A A;  2F4V L;  1Q7Y C;  1XNQ L;  2JEB I;  4BXX G;  3TEH B;  3CPW A;  1XMQ L;  3T1Y Q;  4DAM A;  4A3D G;  3KOJ A;  3G6E A;  1XMO Q;  3TS0 A;  3KJP A;  4MTN A;  1NMG A;  3K0X A;  3HOZ G;  2R93 H;  4GOP A;  4JG2 A;  1J6Q A;  1N33 L;  4ALP A;  1HNW Q;  3BU2 A;  1CKM A;  4A3I H;  3AFQ A;  2KHJ A;  5AJ3 L;  1L1O C;  1A62 A;  4YWM A;  4JI5 Q;  1TXY A;  3NEL A;  1SFO H;  3CCL A;  4JI0 Q;  4BY7 H;  4JI4 L;  4UP7 A;  4DR1 L;  3PF4 A;  1Y1V H;  5BR8 L;  1N8R C;  5C4X G;  5LMU Q;  2OTJ A;  2ES2 A;  3STB D;  5LMN Q;  4A3K H;  3A5U A;  2OTL A;  4R4Q A;  2LXK A;  3J7Z C;  3S17 H;  1VQJ A;  2HIV A;  4B3M L;  3NBH B;  2R92 G;  2Q2T A;  2E5L L;  1HNZ L;  2E2J H;  1IL2 A;  4JI3 Q;  1YVC A;  4JBK A;  3S2H H;  3PIP A;  1UWV A;  4LF7 L;  4WJ4 A;  4IFD I;  4LFB L;  3I56 A;  2NVT H;  1HZA A;  4JI7 Q;  4DR6 Q;  1X3G A;  2GVB A;  1VQ9 A;  1AE3 A;  1VQM A;  3M4O H;  5ELN A;  1QVG A;  1GKH A;  1HR0 Q;  4LF4 Q;  3HOV G;  3M4P A;  1YI2 A;  4JI6 Q;  4JV5 Q;  5M3F G;  2XGT A;  3EIV A;  1S72 A;  4JI1 L;  2UXB Q;  4LF8 L;  4XIG S;  2JE6 I;  1M1K C;  4KI0 A;  1EUJ A;  2XTI A;  4L5T A;  3RZD H;  4MNO A;  4DUZ L;  3BJU A;  4NXN Q;  4BXX H;  4Y52 H;  4A3D H;  4LF6 L;  3U4Z A;  1LUZ A;  2EQS A;  3UDF A;  1VQ6 A;  3T1H Q;  1PH4 A;  1UE5 A;  2ALY B;  2JK8 A;  4DV7 L;  3UDG A;  1YIT A;  3HOY G;  3PO2 G;  1X65 A;  2N49 A;  2AKW B;  1JJG A;  3M4Q A;  1N32 L;  3HOZ H;  3KF6 B;  3K8A A;  2NN6 G;  4JBJ A;  1YBY A;  2B29 A;  4PZ6 A;  4UPA A;  3CCM A;  1IBK Q;  1OTC A;  2JJQ A;  2UUA L;  4GN4 B;  1G6P A;  3K80 C;  4TQU S;  2I5H A;  2YTX A;  1WCM G;  2JQO A;  2HIX A;  4JBW A;  5C0X G;  3G48 A;  1S40 A;  3D31 A;  2CQO A;  2ATW A;  5JJL A;  1JJC B;  1YNX A;  4EX5 A;  5C0X J;  3PUZ A;  2VNU D;  3KF6 A;  4A4I A;  1AH9 A;  4GNX B;  4DR2 L;  4JI8 L;  5C4X H;  2DGY A;  1GO3 E;  1YEZ A;  1OXX K;  3UDX A;  4TVA B;  3I4N G;  3S15 H;  4DK3 C;  4B3T L;  4DUY L;  1XNR Q;  2R92 H;  2VQF L;  3HOX G;  3GTK H;  4HJA A;  1VQH A;  4LF5 L;  3GTL H;  1X9N A;  3KYH C;  3U50 C;  3CF5 A;  3JC6 6;  1NE3 A;  3GTM H;  1PVO A;  2FXQ A;  4LF9 L;  2VS1 A;  2CKZ B;  3F1Z A;  3I55 A;  1K9M C;  2KEN A;  3W1G A;  1GD7 A;  4RMF A;  1X6O A;  2VW9 A;  4DV6 L;  1VQC A;  1KC8 C;  2PI2 A;  1SR3 A;  3CCQ A;  2K52 A;  3F2B A;  5M3F H;  2Q2I A;  4LFC Q;  4H02 A;  3G71 A;  1IBM Q;  4X64 Q;  1OXT A;  2NVY H;  3MXN B;  3AQQ A;  2AWO A;  5E7N A;  1PHJ A;  1DGS A;  2NZH A;  1VQL A;  4IPH A;  1BVS A;  1EQQ A;  3GO5 A;  2ASB A;  2KHI A;  5C3E G;  4X62 Q;  4YHH L;  2JA7 G;  3STB C;  5J3B A;  3HOY H;  4GKJ Q;  5GAH C;  3PO2 H;  2R7Z G;  4X6A H;  3CME A;  4YWK A;  4DV4 Q;  4X66 L;  1KRS A;  2UU9 Q;  1NTG A;  4JI2 Q;  3CC4 A;  4HJ9 A;  2YV5 A;  4GN3 B;  5EAY A;  2VUM G;  4OO1 G;  5JJK A;  2N78 A;  2UXC L;  4B3S L;  4X65 L;  4A3C G;  1LTL A;  1YHB A;  1KRT A;  3AYH B;  1YIJ A;  3KFU A;  1UEB A;  1WCM H;  2UUB Q;  2RF4 A;  2WFW A;  3I4M G;  4DV0 Q;  3PSI A;  3NEN A;  2NZO A;  3F2D A;  1I94 L;  1PFS A;  4GS3 A;  1VQN A;  4AQY L;  2UXD Q;  4HJ5 A;  3DM3 A;  3I4N H;  1VQP A;  1KAW A;  2PNH A;  3GDE A;  5ELO A;  2JA8 G;  2ZM6 Q;  5K36 G;  2NN6 I;  4GKK L;  1AE2 A;  4KHZ A;  4AH6 A;  3DLL A;  1XPO A;  3E9I A;  2YTY A;  4B3R L;  5FLM G;  3TQY A;  4YWL A;  3A74 A;  4DK6 C;  2JEA I;  4K0K L;  1EIF A;  3K81 C;  1U0L A;  4DPG A;  5M5X H;  4HID A;  5C0X I;  3HOV H;  4A93 G;  2ZTD A;  3CC2 A;  1V1Q A;  3CCJ A;  3S1N H;  4QQB X;  4OXP A;  5IY0 A;  1IBL Q;  1JB7 A;  1XTD A;  2DUD A;  3T1Y L;  1XMO L;  4A3B G;  4JC0 A;  1CKN A;  4GNX C;  2L15 A;  5IWA Q;  5GRO A;  1EWI A;  2CWP A;  1NY4 A;  1VQ8 A;  5C3E H;  3L0O A;  1QZG A;  1R9T H;  4LW1 A;  2B63 G;  2JA7 H;  2MNA A;  4KLK A;  4IOA A;  1HNW L;  2WAQ E;  1VCI A;  3CCV A;  3RR5 A;  1E24 A;  4PG3 A;  2R7Z H;  1YZ6 A;  1EQR A;  1JMC A;  3J7A 5;  2A8V A;  1MIU A;  2ZJQ A;  3PUX A;  4JI5 L;  2VUM H;  4QL5 A;  4JI0 L;  3HOW G;  3EN2 A;  1YJ9 A;  4A3C H;  3B6Y A;  2AHO B;  1PV4 A;  5LMU L;  1WJJ A;  4WJ3 M;  1CSP A;  5LMN L;  1VQ4 A;  3I4M H;  3E0E A;  3IRB A;  1BBU A;  3KLW A;  1KL9 A;  4EQ5 A;  1PA6 A;  2K5H A;  3Q8D A;  1H95 A;  2RHQ B;  5FJ8 G;  1KXL A;  3CW2 C;  3K7A H;  1FJG Q;  4R4I A;  2GVA A;  4L5Q A;  5C44 G;  3K7U C;  4JBM A;  4UY8 C;  2JA8 H;  3I7F A;  4JI7 L;  4DR6 L;  4OO1 I;  2WAQ G;  4JOI C;  4LFA Q;  1HNX Q;  1HR0 L;  1T9H A;  3I4O A;  3F8T A;  5FLM H;  4JV5 L;  1B70 B;  2PQA A;  1JJ2 A;  2I5M X;  1E1O A;  4NB3 A;  4A93 H;  4KHP Q;  5IYB G;  1ASY A;  1JE5 A;  1HZC A;  2UXB L;  2RHS B;  1YHA A;  4YCU A;  4YY3 Q;  2Z0S A;  3J81 j;  2KCT A;  4A3L G;  4DV3 Q;  1TWF H;  5GAG C;  4NXN L;  4OWX B;  2K5N A;  2PMZ E;  3I2Z A;  4A76 A;  4JYA Q;  3W5O A;  1X3E A;  2VZA A;  4PZ7 A;  4A3B H;  3T1H L;  3L7Z C;  4HIO A;  1HZB A;  2IY5 B;  4DV5 Q;  4AYB G;  4C3I H;  2F52 A;  1KD1 C;  1ASZ A;  4DR4 Q;  1E1T A;  4A3E G;  1PH8 A;  1IBK L;  1EFW A;  3ZJY C;  3F2C A;  2B63 H;  4A3G G;  4J15 A;  1G29 1;  2CWA A;  2A1A A;  1V9P A;  2EIF A;  3ULP A;  1SN8 A;  1N36 Q;  2HHH L;  4GOP C;  2D0P A;  1SLJ A;  1PH1 A;  2CFM A;  2K5V A;  1VS0 A;  3KDF A;  1CKO A;  5IYC G;  4NXM Q;  3HOW H;  2A19 A;  4MZ9 A;  2QGQ A;  1CUK A;  3PV0 A;  4QIW E;  1PH3 A;  1O7I A;  1S3O A;  1N9W A;  2Z6K A;  2Q2H A;  1L0W A;  1LYL A;  2JA9 A;  4POF A;  3RLN A;  3HKZ G;  4QJF A;  2OCE A;  2IHF A;  2UUC Q;  1XNR L;  2JA6 G;  1PYS B;  4OX9 Q;  2K4K A;  1M90 C;  1VQI A;  1HJP A;  1X56 A;  2I5L X;  5FJ8 H;  3AEV A;  2AWN A;  3LGJ A;  2OWO A;  1QUQ A;  4A3J G;  4PMW A;  5C44 H;  5IP9 G;  3TRE A;  1Y1W G;  1QVC A;  2Y0S G;  3GTQ H;  3HOU G;  1K3R A;  1Q12 A;  2ID0 A;  4GLV B;  4DR5 Q;  4LFC L;  4O0A A;  3OTO Q;  2JA5 G;  3OYY A;  1BBW A;  3CXC A;  2E2H H;  3PIO A;  1I6H H;  2BA1 A;  5IYB H;  2LXJ A;  4X64 L;  4HJ7 A;  1IBM L;  4YCV A;  1JT8 A;  4A3L H;  4DR3 Q;  3RN2 A;  2VQE L;  2GN5 A;  2HQL A;  1YJW A;  4X62 L;  4POG A;  1IZ6 A;  1Y14 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...