2KCMA

Solution nmr structure of the n-terminal ob-domain of so_1732 from shewanella oneidensis. northeast structural genomics consortium target sor210a.
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
MKGKVVSYLAAKKYGFIQGDDGESYFLHFSELLDKKDEGKLVKGSMVHFDPTPTPKGLAAKAISLPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold shock domain family protein
publication title Solution NMR structure of the N-terminal OB-domain of SO_1732 from Shewanella oneidensis. Northeast Structural Genomics Consortium Target SoR210A.
rcsb
source organism Shewanella oneidensis
molecule tags Nucleic acid binding protein
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2kcmA00
4OO1I 2D0PA 3S2HH 5JEAG 4A3JG 1I94L 1P16A 3L0OA 1V1QA 2CWAA 2Q2IA 2I0QA 2KHJA 5JJLA 4QL5A 1Y1WG 4OONA 2BH8A 1HNWQ 4LF8L 1Q81C 2E2IH 1KAWA 1X6OA 3HOWG 3PO3G 3RN2A 4GKJQ 1D7QA 2OQ0A 4DK6C 1A62A 3ERSX 4LWCA 1SROA 2N8NA 4GLAC 3KF6B 1A8VA 1N33L 2VUMH 4X6AH 1EYGA 3BZCA 2FXQA 2Q2HA 3PIPA 2ES2A 2Z0SA 1NMGA 1NMFA 3K8AA 4P74A 3K80C 4DV7Q 2F3IA 1V9PA 1N36L 3HOVH 1NBWA 5E7NA 4JI1L 5AJ3L 4DR6Q 1EOVA 2YTXA 1VQIA 4NPSA 4X65Q 1IXRA 1HNZL 4KHPQ 4PZ8A 3I4MG 2JEBI 3WWVA 4DV1L 3S24A 1M1KC 1FL0A 4TQUS 2VQEL 1GKHA 3FKIG 4LF7Q 2UUCL 2BH2A 2L15A 3HOXH 4LF9L 3G48A 4AQYQ 1JE5A 3W1GA 4DV0Q 2NVQH 2ASBA 4A3CG 5ELOA 1Q1BA 2E5LQ 1KRTA 5C4XG 4OWXB 2Y0SE 1XPOA 2Z6KA 2HQLA 4A3BG 4PZ7A 3S1MH 1DGSA 3BU2A 1JJ2A 4JI4L 5BR8Q 2JQOA 2PMZE 3F2BA 4OO1G 1ASZA 4A3IH 5IP9H 2ZJPA 4JI8Q 4DV6Q 1TXYA 2AKWB 4A75A 1A63A 3CCVA 4L5TA 1KL9A 5LMNW 4GOPC 2HT1A 5C3EH 3KJPA 4DR1Q 4DV4Q 3HOYG 1X65A 4QY7A 4BBSH 4K0KL 1OXVA 2ALYB 2WAQE 1N8RC 4DR2L 4A3DH 3W1BA 3S15H 3S16H 4NXNL 1HZCA 3U4VA 4BY1G 5DLQE 3CCJA 2YTVA 2VY3A 4HIMA 1N34Q 4DR5L 2I5HA 1CKMA 4KHZA 3E9HA 4YCUA 2KCTA 3U4ZA 2WB1E 1L1OA 4JI2Q 3W5OA 4DNIA 4HJ9A 1AH9A 2N3SA 4PZ6A 3A74A 1VQOA 1SE8A 3GTMH 3CCLA 4C3IH 2LSSA 3J7A5 3ULJA 1VQPA 2XTIA 3B6YA 1YITA 1YJWA 4A3MG 1FJGQ 1Q46A 4POGA 1CSQA 4B3RL 3PUVA 3NENA 4BA1I 4JI5Q 1K8AC 4KI0A 3S2DH 5IYBH 1IBKQ 3M4PA 4A3KG 5LMNL 1E7ZA 2PI2A 1VQLA 4FDBA 2JA5H 1WCMH 3PV0A 1HH2P 5M5YH 4YHHL 4X62Q 2QGQA 4BA2I 5JJKA 2DUDA 3HKZE 4LF5L 1I3QH 5FLMG 3AEVA 4LFAL 2ID0A 4B3SL 1NTGA 2HIVA 1XMQL 4LF4L 4DPGA 1JB7A 3HKSA 5M3FG 2GVBA 4JI3L 5IP7H 3J81c 1XTDA 4P73A 1HNXL 4GS3A 4DR4Q 2NZHA 2UXCL 2OTJA 4RG1A 4X66L 2Q2TA 1C7YA 1SN8A 3UE0A 4LNQA 2EQSA 3I2ZA 1HR0W 3CC7A 4A4IA 4YWKA 4LFCQ 1XNRL 4GNXC 4R1JA 2CQOA 3EIVA 4MZ9A 2A1AA 4HIKA 4JI6L 1I94Q 4IPDA 3TRZA 1QZGA 4A3GG 1PVOA 2RHQB 1Z9FA 2Q2UA 3GTLH 2CCZA 5LMUQ 2R7FA 3RZOH 3J80c 4MNOA 1SFOH 3KFUA 1Y1VH 3UDIA 1N33Q 2NVYH 2VZAA 5GAGC 1SRUA 3CCUA 3HOUH 4JV5L 4YWMA 1OXXK 2UU9L 3PUYA 4YCVA 1IL2A 2IX1A 3U50C 2KHIA 5M5WH 2BA0A 5C0XI 1N36Q 2ZJRA 5AJ3Q 4DV5L 2R7DA 2ZM6L 5GQOA 5IYDG 4H02A 4JOIA 4A3JH 1HR0L 4DR3L 2QA4A 2JA6G 3K7AH 1C0AA 1Y1WH 1UE5A 3KJOA 1CKOA 1N32L 3T1HL 4NXMQ 3HOWH 2BA1A 4IPHA 1E3PA 4YWLA 1PA6A 3PO3H 2UXBQ 4DUZQ 2E2HH 4DAMA 2VQEQ 4YY3L 3KLWA 2VQFL 4UP7A 1YHAA 2AWOA 3U58A 4HIDA 2ATWA 2V1CC 1BKBA 2ZTDA 1S40A 1V43A 3UDXA 3M85A 2E2JH 4ALPA 1S3OA 4X64L 3G4SA 1VQCA 1YHBA 4OWTB 3CCRA 3OTOQ 4JI4Q 4GKKL 3I4MH 3GO5A 1AE3A 1T9HA 3HKZG 4IOAA 4JYAL 3CCSA 1NJIC 2K52A 1X3GA 3ZJYC 1J5EL 1EQQA 1HZ9A 3T1YL 1MJCA 4JBJA 3FKIH 4LF6Q 2D62A 1WJJA 4DV2L 1PYSB 1HZBA 4P72A 1TWCH 4A3EG 4QQBX 1K8GA 4L5QA 4A3FG 1VS0A 1R9TH 1VQBA 4A3CH 1X56A 3CMAA 4DAYB 1TWFH 1YIJA 5C4XH 1VQHA 4EQ5A 3AYHB 3S17H 3LGJA 3A0JA 2OWOA 3G71A 4A3BH 1X54A 4JC0A 5C0XG 3J81i 3A5UA 1XMOL 3GD7A 3BZKA 3SGIA 1IBMQ 2NVTH 3NEMA 4BY7G 1B70B 4R4OA 4B3TQ 5C0XJ 1PHJA 3F2CA 2YTYA 3M4QA 4QIWE 5IY0A 5H1SE 1YEZA 1XPRA 3H0GG 4JI0Q 3HOYH 2UUBL 2K75A 3GTGH 4IOCA 4R4TA 1Y14B 1O7IA 2JA8G 4LUVA 3M9BA 1KD1C 3HOZG 4XIGS 4AYBG 3I4NG 4O2DA 4BY1H 2I5MX 2K50A 4GKJL 2PNHA 3I4OA 1MKHA 1QVCA 1VQKA 4L5SA 2XGTA 2B63G 5C4JH 3RR5A 3H3VI 4LFAQ 1PH1A 2JA7G 1L1OB 2UXDQ 2ZTEA 4QGUA 1VQ4A 3KF8B 2RCNA 4A76A 4Y52H 3CP0A 2EXDA 3GTOH 3PCOB 2VL6A 3K0XA 5GAEC 3PF5A 1GM5A 1HJPA 4A3MH 4DR6L 2R6GA 1XNQL 4GN5A 2F4VL 4X65L 3AFPA 3CQZH 1VQ8A 1Q82C 3MEFA 4JI7Q 1QVGA 1U0LA 4UP8A 4DUYL 4A3KH 1YI2A 3AFQA 1X3EA 4NB3A 4J15A 1G51A 1VQDA 4IPGA 3GDEA 4JI6Q 3KYHC 2A8VA 3UE1A 3JC66 5FLMH 1M90C 2ZJQA 2IY5B 4AQYL 1PV4A 4IFDJ 4PMWA 2NZOA 2MQHA 4DV0L 5M3FH 4JCVE 2JJQA 1WFQA 2E5LL 1LM0A 3RLNA 2WP8J 1YJNA 2UUAQ 1E22A 1VCIA 2PI2E 5IWAQ 5ELNA 3PIOA 3M4OH 4JV5Q 4A93G 2UU9Q 5IE8A 5BR8L 3MXNB 4LFBQ 2HHHL 1GD7A 1W3SA 2LXJA 2MO0A 2IHFA 3EBEA 4JBKA 3S1NH 4QJFA 2CFMA 4JI8L 5J3BA 3I7FA 2F52A 4HJAA 3PO2G 4A3LG 1K0RA 4A3GH 2R93G 2K14A 2KBNA 2VS1A 3PUWA 4DR1L 4DV4L 4JBMA 3I56A 1LUZA 1HZAA 1IBLL 4R4CA 4GN3B 3ICEA 1E24A 1CUKA 4AIMA 2HIXA 2Y0SG 5IYCH 1X55A 1YNXA 1OTCA 3CPFA 3L7ZC 4YY3Q 4LF8Q 3DLLA 1KXLA 1BVSA 3NBHB 4APVA 4DKAC 1KQSA 1UE1A 2K5VA 1N34L 3Q8DA 4JI2L 1UE7A 3PSIA 3D0FA 1RL2A 4BXXG 1PH5A 3S1QH 3IRBA 2IHEA 2JA6H 5IYDH 1K73C 1SR3A 3CMEA 4BBRG 3GTJH 1FJGL 1GO3E 4PG3A 2WAQG 4JI1Q 4JI5L 3I55A 3CD6A 4JYAQ 1VQ5A 4DV3L 2GVAA 1PYBA 5M3MG 1J5EQ 1IBKL 4OX9L 3H15A 1HNZQ 2R92G 2R7ZG 3JAMc 3E9IA 1LYLA 3G6EA 2K4KA 1QVFA 4DV1Q 5M5XH 3A5ZB 1KRSA 4R4IA 3ULPA 2WB1G 4POFA 1EWIA 2CKZB 2VNUD 2UUCQ 1JJCB 1I5FA 4LF9Q 2KCMA 1ASYA 1CKNB 2NN6I 3CW2C 1QUQA 3ULLA 1PH8A 4DR7L 3J7ZC 3AQQA 1TWAH 5FJ8G 1CKNA 1JMCA 1B7YB 1Q1EA 1D8LA 2VW9A 1OXUA 1Q8KA 1X3FA 2QEXA 1VQNA 3TS2A 1PH4A 3NELA 2K5NA 1BBUA 2N49A 5C44G 1G6PA 4A3EH 2B3GA 1I50H 2UUBQ 3GTKH 4WJ3M 1XPUA 2OCEA 1B8AA 4A3FH 5LMUL 2OTLA 2B29A 4LW1A 2YV5A 4IFDI 4K0KQ 5JEAJ 2KENA 2JEAI 3STBC 4DK3C 4HJ5A 4DR2Q 1EUJA 4NXNQ 2ZTCA 1JT8A 4B3ML 4IO9A 1L2FA 3KF6A 2VUMG 4DR5Q 3GTPH 4BY7H 1CSPA 3M3YH 3KDFB 1L0WA 4HIOA 3RN5A 1E1TA 4UPAA 4LUOA 2Z6KC 4JBWA 1XNQQ 3H0GH 2F4VQ 1FGUA 4DUZL 3HOVG 4XTCS 2CWPA 3DM3A 3KDFA 2H5XA 2JA8H 4DUYQ 1NE3A 1BBWA 2MFIA 3CF5A 3KOJA 4NXML 1PFSA 2UXBL 1X9NA 1SLJA 3HOZH 3I4NH 4B3RQ 1LTLA 1HNWL 3CAMA 3J81j 3PUXA 1EIYB 2NVXH 1N9WA 1U5KA 5LMNQ 4OWWB 2B63H 3D31A 1P8LA 2NN6G 4YHHQ 2JA7H 3J80i 4LF5Q 2JE6I 4C3JH 3HOXG 4P75A 4B3SQ 4GLXA 3PF4A 3S1RH 4LF4Q 1XMQQ 3RLOA 3RZDH 4OXPA 1G291 4JI3Q 4DV7L 3OTOL 1HNXQ 4GOPB 2UXCQ 1I6HH 4X66Q 1PH9A 2HHHQ 1IZ6A 1C9OA 3HFZB 1L1OC 3OYYA 3EN2A 2RHSB 4O0AA 4P71A 1E1OA 3CPWA 1VQGA 4KHPL 5GROA 5K36G 4GOPA 2I5LX 1MIUA 4KLKA 3CCQA 4A3IG 1VQ7A 4LF6L 4IPCA 1XNRQ 2DGYA 5IP9G 3GTQH 4IFDG 2MO1A 2IX0A 3JAMi 1PH3A 4GN4B 1IBLQ 1PH2A 4LF7L 4YCWA 1PH6A 5C3EG 2IT1A 4C3HH 3BJUA 3RNUA 4IJLA 5IT9c 1YVCA 4BBSG 4TVAB 1OXTA 4GLVB 3UDFA 1Q12A 1XJVA 4A93H 3CXCA 2YU9H 3K7UC 5GADC 4A3DG 3E0EA 5FLXc 1IBML 3F8TA 5HGQA 2C35B 1YHQA 4IJHA 3PO2H 2JA9A 1KC8C 4A3LH 1Z47A 4B3TL 2E8GA 2R93H 1JJGA 1GVPA 4C2MH 4DV6L 4JI0L 2OQKA 1VQ6A 4DV5Q 1HR0Q 2ZM6Q 1EFWA 3H3VH 1IYJB 1YZ6A 4DR3Q 4DV3Q 1EIFA 4OX9Q 3RLFA 2EIFA 2AHOB 3L2PA 3F1ZA 1N32Q 3T1HQ 2K5HA 5IYBG 2MNAA 2JA5G 4EX5A 3CCEA 1WCMG 2VQFQ 2UXDL 1VQAA 3PGZA 1UEBA 4BXXH 3FP9A 1YBYA 1J6QA 1VQEA 4GNXB 1VQFA 2AMCB 4BBRH 4HJ7A 4UP9A 3TREA 2LXKA 2RF4A 1FVIA 3M7NA 4DR7Q 5IP7G 1VQMA 1Q7YC 1WI5A 4JG2A 3CC4A 2PQAB 4Y7NH 4X64Q 4GNXA 4JI7L 1K83H 2R92H 5M3MH 1KIXA 5HY6A 2R7ZH 4HJ8A 3TS0A 1A0IA 3UDGA 4GKKQ 2GN5A 3STBD 3CC2A 2PQAA 3OW2A 1OXSC 1UWVA 3K81C 4MTNA 1H95A 4JOIC 1W2BA 1VQ9A 5JJIA 5GAHC 3FHWA 3T1YQ 1K3RA 5EAYA 3S14H 4L5RC 4ME3A 4X62L 3VDYA 2N78A 4RMFA 1NY4A 4DV2Q 2JK8A 3PUZA 5IYCG 1QZHA 3TEHB 1K9MC 2UUAL 1QUQB 1AE2A 5IWAL 1S72A 1PH7A 3TQYA 2D0OA 3ER0A 1RIPA 4DR4L 4R4QA 1Y1VG 2YYZA 5FJ8H 3F2DA 1KHIA 4AYBE 1SMXA 4B3MQ 4LFBL 1YJ9A 1XMOQ 2AWNA 1MJEA 3HOUG 4AH6A 4UY8C 1EQRA 1WYDA 4LFCL 1Q86C 5C44H 4WJ4A 4LUZA 1VQJA 1WOCA 1UE6A 1TWHH 2A19A 2WFWA 1TWGH 3CCMA
chains in the Genus database with same CATH superfamily
3S2HH 3BZDB 5FLXL 2I0QA 1LO5D 3F2UA 2B2WC 4QL5A 1J9OA 1HNWQ 2BH8A 3GP7A 4JVZA 3HOWG 4RKLA 3PO3G 3RN2A 3ZYYX 3OHXC 3JAME 1A62A 1N33L 2N8NA 2IW3A 4GLAC 2B8FA 2F0NA 4C3IB 3K8AA 5IGCA 1SYFA 4XQJA 4JI1L 1ENCA 4RCOA 4DR6Q 1EOVA 2YTXA 4X65Q 1IXRA 2JEBI 1PRTB 1BNZA 3QOJA 3S24A 2KUMA 1XWEA 3VYUA 1SNPA 1IYUA 3FKIG 2UUCL 2L15A 3HOXH 4LF9L 4N9PA 3G48A 1WTPA 3TBIB 2IPKD 1KRTA 2Z4IA 5IGGA 4OWXB 2Y0SE 4XYQA 1BCPF 1ML0D 2EJMA 2OEOA 5BR8Q 2PMZE 2TMPA 5I9OA 1ASZA 1IW7C 4IFDH 1EWCA 3CRLC 3EA6A 4A75A 3CCVA 2MPMA 1ILPA 1STEA 5C3EH 2O5IC 4QY7A 4BBSH 5ISRA 1SFOB 2B2YA 2BCOA 4IALA 4DR2L 2OT2A 4B9XA 1HZCA 2K03A 2YTVA 4BS9A 4HIMA 2I5HA 3U4ZA 5M5WB 1C48A 3BDLA 3W5OA 1L1OA 2CH4W 1AH9A 4PZ6A 3H91A 1VQOA 3CCLA 3ULJA 1F9PA 2F0EA 1CSQA 1SEBD 5CMDA 3GQBA 1K8AC 4KI0A 3S2DH 5LMNL 4FDBA 4YHHL 5JJKA 2QGQA 2L55A 1I3QH 5FLMG 3VYTA 4LFAL 1I4RA 4L8JA 4LF4L 2E2JB 4OELB 5M3FG 1EIHA 4GS3A 1CQFA 2NZHA 2VXWA 5IT9E 1SN8A 4UHVA 4LNQA 1WD0A 1DZ1A 1LTBD 1K28A 1H9RA 3KLSX 2A1AA 4JI6L 5DM63 3LNNA 3RD4A 1Z9FA 5A2QE 5LMUQ 3K58A 1NUCA 3J80c 3I90A 4A3BB 1HPCA 1Y1VH 3UDIA 1N33Q 1RTNA 5CBAE 4MIUA 4CKBA 4JV5L 2UU9L 4ODGA 2IX1A 3U50C 2K04A 3SE0A 5C3XA 5GQOA 4A3JH 3HOYB 4CBVA 3NPPA 4DR3L 3GTGB 1C0AA 1UE5A 1N32L 2RDGA 4OIJA 5T1GA 2KJXA 4IPHA 1E3PA 4MTKA 1YHAA 2F1MA 4WJWA 3U58A 1GOZA 2FMMA 2V1CC 1BKBA 1S40A 5FOBB 4DNTB 1W6KA 3I91A 3OTOQ 1SBBB 4A3KB 2Q8IB 4JYAL 3CCSA 1J5EL 2CW0D 1HZ9A 2E75C 3AMUA 5M5YB 1R9TH 4K2LA 2HQEA 4DAYB 1TWFH 4FXDA 3S17H 1EQTA 2KVMA 1X54A 3DWAA 4JC0A 3J81i 3A5UA 1PTOF 1EY6A 1DJRD 3J80L 3SDZA 3KBXA 4R4OA 1BCPC 1QWYA 2FFKB 1PHJA 1KDBA 4QIWE 3OMCA 4CKCA 2XNAC 2BDOA 2UUBL 1NNXA 4JW0A 3LWUA 1Q90A 4R4TA 3QWNA 5K5PA 4FXGC 3M9BA 3DHQA 3RZOB 4BY1H 4GKJL 2I5MX 3I4OA 2B63G 3D4DA 2XGTA 2B2YC 3RR5A 4JK1C 4LFAQ 1PH1A 2UXDQ 1SYDA 2ZTEA 4QGUA 1DD2A 3MTSA 1Y8OB 2FHTA 3CP0A 1CTMA 1MI2A 2WACA 4DAPA 1GM5A 1HJPA 1B3AA 1XNQL 4GN5A 2F4VL 2HD3A 3CQZH 1AEXA 1IHZA 1BDOA 3MEFA 1YI2A 1X3EA 5KYLA 2QDLA 4JI6Q 2ZJQA 4FYDA 4U673 4PMWA 1HQRD 2E5LL 1I4HA 2WP8J 5FK9C 3PIOA 5EPJA 4ABNA 2AQ2B 4JV5Q 2UU9Q 3TDQA 4LFBQ 1W3SA 1TQOA 3P7JA 4JBKA 3D8GA 5E3FA 3SEBA 3I7FA 1K0RA 4KN7C 4A3GH 2R93G 1SMYC 2KBNA 2VS1A 4DR1L 1TS4A 1TWCB 2Z8LA 1EYCA 1CUKA 1E2VA 3NXWA 1X55A 1KXLA 4LF8Q 3DLLA 5C4XB 1JCKB 1UE1A 2K5VA 3D0FA 4ZRZA 1RL2A 4BXXG 1PH5A 3S1QH 1A15A 5EPLA 2F0JA 3H0GB 4ME5A 2JA6H 1LV9A 1FJGL 2NWGA 4RWSC 4R8IA 3J81E 4JYAQ 2EYMA 2SNMA 4DV3L 1J5EQ 3I4NB 5M3MG 3U9OA 1HNZQ 2R7ZG 2NVXB 1E0BA 4DV1Q 1TY0A 2K5WA 3A5ZB 4XDXA 2VNUD 3VA7A 2KCMA 3K57A 2F0KA 1CKNB 3CW2C 3CRKC 5A35A 5IODA 2A6EC 5FJ8G 2I07B 1OXUA 1H9JA 1PH4A 1XXGA 2K5NA 2M9VA 2FMCA 2B3GA 1I50H 2B2UA 3WOEA 2UUBQ 1YNJC 4A3FH 3RMHA 1LTGD 4N8FA 3R93A 2YV5A 3J7AV 1VMCA 4K0KQ 4IUVA 3OWFA 3STBC 5FKAC 3R8BA 1EUJA 4NXNQ 3NE5B 2NBFA 4IO9A 1JQYD 1BQQT 4DR5Q 4HIOA 3RN5A 3ONAB 1E1TA 2XWBB 4LUOA 4UPAA 4C2MB 4JBWA 1XNQQ 1QOHA 4XQNA 2F4VQ 1PTOC 1EEFD 3DM3A 2H5XA 3CF5A 1BBWA 4NXML 3KOJA 3MWYW 5KNDA 2UXBL 2F0HA 2X6LA 1D5MC 4WFN3 1U5KA 5KEEA 2EYOA 3D31A 1PFBA 2NN6G 2JA7H 4NP5A 2AUJD 4FF3A 3W2DA 1L0YB 1AW7A 4C3JH 4PQXA 2MUYA 2WAQB 1HNXQ 4GOPB 1I6HH 3K0YA 4QMGA 3QO2A 4P71A 3VA5A 1TKWB 1ZYRD 5E4WC 5CV5A 2I5LX 1MIUA 3OW7A 3PIO3 4IPCA 3C1EA 2MO1A 2IX0A 2Q8TA 1DOMA 1VMPA 3I4LA 3OIQA 5CBEE 4C3HH 3BJUA 5JOBA 2KOLA 2WKDA 1JORA 1OXTA 1NCVA 3CXCA 3E0EA 5IOCA 2DY8A 2BOSA 2PW7A 1IBML 1KABA 1TWAB 2EDGA 1YHQA 1S5ED 4GZYC 1EYAA 1Z47A 3TMEA 1TWHB 2E8GA 1JJGA 3S2HB 3T56B 5CR3A 4DV5Q 1HR0Q 1EFWA 1IL8A 1CZWA 1BOSA 1IYJB 1HFGA 1SYGA 1YZ6A 2L12A 4DV3Q 3RLFA 3FDTA 3SVMA 3T53B 1EU4A 2JA5G 1STAA 3FEWX 4HN7A 2OF1A 1YBYA 2WINB 1SE3A 1VQEA 4GNXB 4BBRH 2EY2A 2LXKA 2RF4A 3TREA 4FF1A 3KLSA 1VQMA 4DGZA 1EZ6A 2R92H 2RDFA 1KIXA 1VDZA 3CC2A 1OXSC 1UWVA 4MTNA 1H95A 2C5CA 5GAHC 3G6JB 4DFAA 4ME3A 4X62L 3VDYA 2N78A 3HOXB 1LT4D 4DV2Q 5CYUA 2EYPA 1CA5A 1K9MC 2UUAL 1QUQB 5IWAL 3S1RB 3ER0A 2MJ8A 1KHIA 2B2TA 5KNCA 2EVBA 1XMOQ 2O4XA 1MJEA 3WOFA 2GA4B 1RTOA 5C44H 3GV3A 5HGTA 3UE1A 2WFWA 5C3EB 4CJ1B 4C1NK 2O5JC 1P16A 3D6CA 1V1QA 2CWAA 2Q2IA 3N52A 3BS1A 4BBSB 5JJLA 4PMBA 1Y1WG 2B2UC 1BBXC 2RSNA 4LJZC 4DK6C 1MSGA 3KF6B 1F2YA 3TP8A 3BZCA 2FXQA 2Q2HA 1NMFA 3PO2B 3K80C 3AB9A 1N36L 1K3BC 5AJ3L 3S9WA 5TSSA 2AQ3B 4NPSA 3S2DB 4PZ8A 3I4MG 2LKVA 1FL0A 4TQUS 1I3QB 3H3VC 1GKHA 3R2TA 1PRTC 4WORA 2BH2A 1AP0A 3BDOA 4G4KA 4AQYQ 1JE5A 4DV0Q 2NVQH 4A3CG 3HGBA 3T16A 4NMZA 2EYFA 3AU7A 5C4XG 2Z6KA 1H9SA 3S1MH 3BU2A 1V8QA 2JQOA 5CV9A 5IP9H 3TN2A 4JI8Q 1TXYA 2AKWB 4L5TA 3MFYA 4RGOS 2Z1CA 1KNAA 1X65A 1ET9A 4X3KA 1N8RC 1EYDA 1Y1VB 4A3DH 3W1BA 4DNRB 2F0OA 3CCJA 2VY3A 3IAYA 1CQVA 4KHZA 4YCUA 2KCTA 3A8KE 4DNIA 3OMGA 2N3SA 2RKSA 3GTMH 4A3JB 2LSSA 3J7A5 1VQPA 1YITA 4B3RL 3PUVA 3NENA 4JI5Q 4XXEA 4MHEA 2D5DA 5IYBH 3M4PA 1Q3LA 2PI2A 1WCMH 2F0PA 4BA2I 4X62Q 2DUDA 3HKZE 4CDDC 4RGMA 4LF5L 1JB3A 1EY4A 4DA2A 2HIVA 3NQTA 4DPGA 4Q5VA 2GVBA 1SJHD 5IP7H 4P73A 3QIAA 4ULLA 2UXCL 3BVZA 1C7YA 3UE0A 3I2ZA 2PO4A 3MFGA 1HR0W 1B50A 1B9NA 1HA5A 2MGSA 1PFMA 4YWKA 3VR5A 4N9TA 1NSNS 5FLXE 2M2LA 2PCFB 2A73B 4HIKA 1PMRA 1QZGA 1FGBD 1R9TB 2Q2UA 3GTLH 4MNOA 3S17B 2KECA 2VZAA 3CCUA 1OXXK 1KLUD 1QB5D 3PUYA 4YCVA 1WTXA 1IL2A 1ENFA 2B2TC 2XIWA 1N36Q 2ZJRA 3K5LA 3NSWA 5AJ3Q 2ZM6L 4JOIA 3K7AH 2BE5D 1CKOA 1G2SA 1LTID 3T1HL 3HOWH 3PO3H 4BY1B 2E2HH 4KK7A 4YY3L 1CHPD 2JP1A 1AN8A 2WV6D 4RH6A 4ALPA 1S3OA 2VB2X 1C4QA 3CQZB 1ICWA 2OXPA 4R9WA 4IOAA 1NJIC 3ZJYC 2DNCA 3FKIH 4LF6Q 1PYSB 3K5OA 4A3EG 4QQBX 2L1BA 2E74C 3L9AX 1VS0A 1X56A 3CMAA 4QB4A 4EQ5A 1D2BA 1F2ZA 2OWOA 1RCVD 5C0XG 2SEBD 3VYSA 3GD7A 5I6YA 1YNND 3SGIA 1B3QA 1DYQA 3NEMA 3C1FA 4A3GB 3EROA 3K6OA 4B3TQ 3F2CA 1XPRA 3M4QA 1YEZA 4M1UB 2A5HA 1PDQA 4K5XA 1O7IA 2JA8G 4O42A 1LT5D 3HOZG 4AYBG 2K50A 1DONA 5D3IB 1MKHA 4L5SA 3H3VI 2XRSD 5C4JH 3HOUB 3S1QB 2TSSA 2RCNA 4RAUC 2Z9HA 4KN4C 2JA6B 1B2TA 2NYZD 1LTTD 3K0XA 5GAEC 3PF5A 2PZUA 4RKBA 1II3A 4JI7Q 1VQ8A 4KD3A 3D4RA 3AFQA 1NR2A 4NB3A 4J15A 1G51A 1LTRD 3BDCA 3GDEA 3KYHC 4IQZA 1ILQA 1BR9A 5FLMH 3Q23A 1JOKA 3HG9A 1PV4A 5M3FH 1AZPA 1WFQA 1D1IA 3SK8A 1YJNA 2J4XA 2PI2E 3EFXD 5ELNA 4F87A 4A93G 1PTOH 3MXNB 2LXJA 2D9UA 3A8IE 3S1NH 2CFMA 2L11A 2A6HC 5EGTA 4HJAA 2IL8A 3PO2G 4A3LG 1UAPA 1I50B 4KTAA 1B4OA 4A3FB 4DV4L 4JBMA 1IBLL 1CK1A 4R4CA 5I2XA 1E24A 4AIMA 1T5EA 1OTCA 4YY3Q 1BVSA 3NBHB 4DKAC 1N34L 4JI2L 1SDFA 3ND8A 3IRBA 3VR6A 2RVLA 1SNQA 2NVTB 4HAEA 1K73C 1SR3A 3CMEA 3A8JE 4PG3A 2EYHA 2I46A 4HEDA 4JI1Q 1IBKL 2GVAA 1PYBA 3T51B 3H15A 1WTOA 3DEPA 4F7XA 3KLRA 2RCFA 1LACA 5M5XH 2JA7B 2X69A 1KRSA 4K14A 4ZQ3A 3ULPA 2WB1G 1B9MA 4B9WA 1B1ZA 1G2TA 1EWIA 4CDCC 1HHVA 1EEID 5LL6S 2UUCQ 1GJXA 4DK1A 1O78A 4LF9Q 1BCPD 2NN6I 4H0LC 2NZ1D 1QUQA 3ULLA 1I6HB 3J80E 3DWQA 4A3MB 1Q8KA 1S5DD 2K01A 1H9KA 1V1PB 2DJGC 3GTKH 2OCEA 1SNOA 2J7ZA 1GUNA 2OTLA 1GHJA 1FYCA 2HDLA 1QJOA 5JEAJ 4K5WA 2JEAI 2F0VA 4DR2Q 2EJFC 5C4HA 3M4OB 4QCLA 1STHA 1L2FA 3KF6A 5FO8B 2VUMG 1QILA 5D14A 3M3YH 1L0WA 1WTRA 2P5ZX 2RQXA 1L0XB 5EPKA 3HOVG 4XTCS 3A7LA 3KDFA 2Y0SB 2MP1A 1EY5A 1PFSA 2F0QA 1SLJA 1X9NA 1WTQA 1LTLA 1EIGA 3CAMA 1F9QA 2PMZB 2B63H 5LMNQ 1I4QA 1P8LA 2KA7A 4YHHQ 3NTHA 2K7VA 2L9HA 3I8ZA 1HQMC 2JE6I 4BBRB 2A68D 4LF4Q 3HP3A 2ZT9C 5DEHA 4DV7L 2R92B 1PH9A 1IZ6A 1C9OA 3HFZB 1L1OC 3EN2A 2LMCB 1E1OA 5K36G 4KLKA 3CCQA 2F0IA 4CJ2C 4A3IG 1PYWD 1SAPA 3LWEA 4GN4B 3I3CA 2H1EA 4HSPA 1IBLQ 2G9DA 4LF7L 1PH6A 4FVMA 3RNUA 1F2MA 1G91A 4S3SA 3UDFA 2N55A 1D6EC 1O7ZA 1S5BD 1XJVA 1RDPD 3K7UC 4OL7A 4KY7A 3F8TA 2MHVA 5C44B 3X3NA 2B39A 2R93H 4NKLA 3TP6A 2JYOA 4RGTA 1VQ6A 4JI0L 4C3IG 3H3VH 3P20A 4DR3Q 1PFNA 1WTVA 1DM0B 1CI3M 3NTIA 2EIFA 2PZTA 3F1ZA 1N32Q 5L37A 1EU3A 2MNAA 2A6ED 4CDEC 3PGZA 2EY1A 1UEBA 4OHJA 4BXXH 1J6QA 2BDNA 2E76C 4ZKCB 1VQFA 3NTKA 4BY7B 1RODA 3P1HA 1MSHA 3RUZA 4Y7NH 1K83H 5M3MH 5HY6A 2WIIB 2R7ZH 3TS0A 1A0IA 4IN3A 3STBD 2PQAA 1HCZA 4PMCA 1NY4A 1TS5A 4KY5A 4RA8A 2NVQB 3QG1A 5KYIA 4QUFA 3CKIB 1S72A 1PTOD 2D0OA 4DR4L 1RIPA 3S1MB 4R4QA 4K5VA 5FJ8H 1U4LA 4K8JA 4AYBE 3F2DA 3KK7A 3HRZC 3HOUG 4AH6A 4UY8C 1EQRA 4V0BA 1TS2A 4TSSA 3SK4A 2EZVA 1STYA 5JEAG 2PYKA 3PMFA 3L0OA 5G3LF 2KHJA 3K5MA 4I7ZC 4OONA 4KY6A 4A3DB 1Q81C 1QE6A 2K6AA 1X6OA 2E2IH 1HXYD 1E2ZA 1Q8IA 4J6HA 4GKJQ 1S5CD 2OQ0A 2YU9B 4LWCA 1SROA 2RA4A 4X6AH 1EYGA 3OSOA 1T5XD 1TIID 3G7LA 4EQNA 1PZID 2Z0SA 2ES2A 1X32A 5JAVA 3A55A 4DV7Q 2F0TA 5E7NA 4H7BA 1ESFA 4ZUIA 3FRPB 1VQIA 2M00A 3WWVA 1M1KC 1PRTF 2XN9C 2NN6H 3V96A 4LF7Q 2SDFA 2LY7A 4QIWB 4ZKBB 2ASBA 1EY9A 1Y8NB 1XYIA 1Q1BA 2E5LQ 1BCPB 4A3BG 1GUGA 2HQLA 2RBMA 4PZ7A 1DGSA 4IUPA 4JI4L 5J1ZA 4OO1G 3F2BA 1X3PA 1C8CA 1IKMA 3TP7A 2QF7A 4ILWA 1IYVA 5LMNW 3S14B 2HT1A 3GTLB 4DR1Q 4IUTA 1MBYA 3C3LA 3HOYG 1OXVA 1CHQD 5C4ZA 3S16H 3ERQA 3S15H 4G57A 1O7LA 3U4VA 1HA6A 5DLQE 4OGQC 1EZ8A 3URYA 1CKMA 3E9HA 4HJ9A 2WB1E 1SJED 2DNEA 1SE8A 2XTIA 3B6YA 3K7AB 3QJYA 4A3MG 1FJGQ 1Q46A 3HOWB 2EYJA 3TZDA 1FNWA 1D5ZC 4A3KG 1E7ZA 3Q22A 2JA5H 2RDHA 1G8ZD 3PV0A 5M5YH 1HH2P 3DMUA 3AEVA 4H13C 4ZYSA 4B3SL 1NTGA 1XMQL 1JB7A 3NUCA 2EXZA 1M8AA 4JI3L 4DR4Q 2XSCA 2QCPX 4O1NA 4X66L 2EQSA 1E2WA 4A4IA 3MXNA 4N8X1 1XNRL 2F0MA 3MC0B 3FKIB 3TP5A 3EIVA 5I6WA 3TRZA 3A56A 1PVOA 2RHQB 2QDBA 2CCZA 4KKSA 3RZOH 1R4PB 1HRJA 3KFUA 1ONLA 2KCNA 2NVYH 5GAGC 1SRUA 4M8AA 4YWMA 3FPPA 4G7HC 5CV4A 2BA0A 5C0XI 1ZKOA 5IGEA 1FD7D 2ATWA 2R7DA 5IYDG 4H02A 1Y8PB 1Y1WH 3KJOA 2CHBD 1JE4A 5DM73 1JWUD 1NR4A 4NXMQ 4XT3B 2BA1A 4YWLA 1PA6A 3T13A 2UXBQ 4EVOA 2VQFL 3KLWA 3HS0C 4HMJA 2AWOA 4HIDA 4LAAA 4CHTB 3C46A 2CQAA 4L6TB 1V43A 2B2VA 3UDXA 1CFMA 3M85A 1A6XA 2SNSA 4X64L 1VQCA 4JI4Q 4GKKL 2G9HD 3I4MH 3GO5A 1AE3A 3TZUA 3MXUA 1X3GA 1EQQA 2KHSA 3T1YL 3SHLA 2D62A 2AUKA 3HZXA 1TWCH 1K8GA 5M3FB 1CT1D 1BO0A 4A3CH 5C4XH 1VQHA 5IGFA 3A0JA 1PTOB 4DAYA 3S1NB 5CV6A 2JXMB 4G7OC 1IBMQ 4UAIA 4CKEA 4BY7G 1U9RA 3EVQA 1F9SA 2LFNA 1KAAA 2YTYA 5H1SE 5C0XJ 5IY0A 3H0GG 5EBDA 2EE1A 3I4NG 5BN3A 1VQKA 4KJNA 2E2DC 3H6MA 1UUPA 4UDUC 3KF8B 2K05A 4A76A 4Y52H 3GTOH 1SE2A 2N88A 2VL6A 4DR6L 2R6GA 4X65L 1U0LA 3M4YA 1VQDA 5M5XB 4IPGA 4K6LA 3JC66 3QOLA 5JPNC 4IFDJ 2MQHA 3SK6A 2F0GA 4NDXA 1LM0A 4H44C 2UUAQ 1E22A 5IWAQ 4J1MA 1KDAA 2CVRA 1MGSA 5BR8L 1PZKD 1GD7A 2MO0A 1H9MA 3EBEA 1Y69U 4QJFA 4KV6A 2NB0A 1EY0A 5J3BA 3Q24A 3GTKB 1B44D 3PUWA 1X3QA 4J8QA 4GN3B 5IYCH 2HIXA 1HTLD 4ID6A 1TWFB 4APVA 1KQSA 4X3TA 1SXTA 1F9RA 5LL6X 3OIPA 3V2TA 1UEAB 4PV1C 1I6VC 2F0DA 4RHRA 3GTJH 2QKIC 2Z6BA 2WAQG 5IGBA 3I55A 3CD6A 4EQPA 1VQ5A 2A69C 1JWSD 3JAMc 3E9IA 1PXUA 1QVFA 5J39A 2R61A 1CM9A 4R4IA 4HMIA 1TY2A 2CKZB 3MVVA 1JJCB 4TKOB 1CZGA 5ELEA 1IW7D 3E6ZX 1AZQA 2LS01 5EQ0A 3Q0AA 4DR7L 1GXDC 3AQQA 1TWAH 1CKNA 1JMCA 1B7YB 1Q1EA 1D8LA 2QEXA 1X3FA 3NELA 2N49A 2XWJB 4RGNA 1G6PA 4A3EH 2F0SA 4WJ3M 4QF4A 5LMUL 3A7AB 1OO9B 2F03A 2B29A 4LW1A 4RFBA 2KENA 5C0XH 4HJ5A 1I4XA 1U4RA 2QILA 3EJIA 3SK5A 4B3ML 1JT8A 4RHSA 3GTPH 1CSPA 2R93B 3QR8A 4U68A 3VR2A 1D5XC 1JWMD 2Z6KC 1FGUA 4DUZL 2CWPA 2JA8H 2MFIA 1LABA 3FMCA 5M9OA 1STGA 3HOZH 4B3RQ 3J81j 3MXGA 3DEOA 5KGUA 1EIYB 1N9WA 4OWWB 3OWEB 2BE5C 3J80i 4LF5Q 1TR5A 2A6HD 1Z6HA 3NWTA 3IL8A 3HOXG 4P75A 3JAML 3A54A 4GLXA 3S1RH 3RZDH 1WTWA 4Y7NB 3OTOL 1F2LA 1K83B 1R4QB 1SE4A 5M3MB 2UXCQ 2SOBA 2R7ZB 1KLGD 4O0AA 3CPWA 4Q0FA 1VQGA 3ITPA 5DAUA 5GROA 4KHPL 4GOPA 1VQ7A 3L3OC 3GTQH 1RKNA 4IFDG 1SYCA 3BYYB 3P75A 5EBCA 3IKJA 4YCWA 5C3EG 1EOTA 5IT9c 1YVCA 4BBSG 3CHBD 4GLVB 1Q12A 3X3MA 3K59A 4A93H 3MXPA 3HKZB 5HGQA 4A3LH 1SNDA 3PO2H 1KC8C 3J7YW 4L63B 3O13A 2DJFC 4DV6L 2OQKA 2ZM6Q 2J0TD 1YNNC 1J8IA 1DOKA 2E2IB 3T1HQ 3OOCA 3TSSA 1LTAD 3U9SA 4EX5A 4WRDA 1HUNA 2UXDL 5CGKA 2EJGC 1VQAA 1JC7A 1S5FD 3LX0A 2AMCB 1A2UA 4HJ7A 4DR7Q 1Q7YC 5C5MA 1WI5A 4YIJA 3CC4A 2K32A 4GNXA 1GHKA 3UDGA 2GN5A 3SR1A 1HFNA 4ZUJA 4JOIC 5JJIA 4KD4A 3FHWA 3Q6SA 1XTCD 5JJZA 2ICIA 4RMFA 2L4NA 2JK8A 3PUZA 2F3VA 4FNFA 5FO7B 4DXFA 4LK1C 4C3JB 2G5DA 3VR4A 1JOQA 4LMQD 5C6AA 3TQYA 1Y1VG 2YYZA 4K6DA 5C5LA 1SMXA 4B3MQ 4LFBL 3D3RA 2AWNA 1K8MA 5IT9L 1I4GA 1WYDA 4LFCL 4WJ4A 1VQJA 1WOCA 2VB3X 4DUZQ 3NK9A 1TWGH 4OO1I 2D0PA 1EWHA 4A3JG 1I94L 2IWHA 5JPMC 1VF7A 1GUTA 3DUZA 4C3HB 4LF8L 3S16B 3M7GA 3S15B 1KAWA 5AFWA 5A2QL 2EPBA 1D7QA 4ZLTF 5JVH3 3ERSX 3H09A 4TRDA 1A8VA 3KBGA 1IKLA 2VUMH 1B53A 1BUVT 2EOTA 3PIPA 1JICA 1NMGA 4P74A 3OPOA 4ZCKA 2F3IA 1V9PA 3MAQA 3HOVH 1NBWA 1SNCA 3E5SA 1U4MA 1HNZL 4KHPQ 2C9OA 2K5QA 2JA5B 4DV1L 2KCCA 4XQQA 4FF2A 2X6GA 2VQEL 3I70A 3W1GA 1H9SB 1FR3A 5ELOA 2Z4HA 1XPOA 1LT6D 1QCBD 1SMYD 4KJOA 2A74C 1A2TA 1JJ2A 4IUQA 5K36H 2Q8RE 4A3IH 2ZJPA 5FO9B 4DV6Q 1QG7A 3PQIA 3KUPA 4Z9CB 2ICEC 1A63A 4BWGB 1KL9A 1TT2A 5EJWA 4GOPC 3KJPA 1EQVA 4ZK9B 4DV4Q 4K0KL 2CH4A 2ALYB 2WAQE 3MZ5A 5EKKA 1F77A 2KEEA 2CW0C 2NVYB 3J7AF 4NXNL 4EQOA 5IIFA 1EY8A 4BY1G 1WD1A 1FNVA 2FINB 1N34Q 4DR5L 1ASYA 4JI2Q 4PNYA 4IURA 4I65A 3KF8A 3A74A 5KNBA 4V190 4C3IH 1U4PA 1YJWA 1Y1WB 4POGA 4BA1I 1EL0A 4IZ8A 2NUCA 1LT3D 1IBKQ 1K8OA 1VQLA 3VR3A 1A3TA 2KEDA 1K0SA 1TU2B 3VYRA 3IFTA 2ID0A 3CU7A 3HKSA 3J81c 2RSOA 1XTDA 1HNXL 3FPUB 1O80A 2OTJA 4RG1A 2Q2TA 3I4MB 4R8NA 1YNJD 1STBA 3CC7A 4LFCQ 2A68C 4GNXC 4R1JA 2CQOA 2DY7A 2NTTA 4MZ9A 1I94Q 4IPDA 4A3GG 3E0JA 1Z7TA 2R7FA 1SFOH 1M4VA 4ZAIA 2R3ZA 3HOUH 2DN8A 3ND9A 5ELDA 2KHIA 5M5WH 3QB3A 1ENAA 5E4XA 4DV5L 1HR0L 4DK0A 5JEAH 2JA6G 2QA4A 3PIP3 5IGDA 4KMUC 1KTKA 5D3DA 4DAMA 2VQEQ 4UP7A 1RF2D 2ZTDA 3MHBA 3GTOB 2E2JH 4K2KA 2QW7A 5BN4A 3GTMB 5E1FA 3G4SA 5HURA 4OWTB 1YHBA 3CCRA 2PZWA 3BVMA 4NW2A 4B08A 3HKZG 1T9HA 1QNKA 2K52A 3J81L 1MJCA 4JBJA 3V05A 3NP8A 1WCMB 1WJJA 4DV2L 1AFPA 4DF7A 1HZBA 4P72A 3H94A 2ZXRA 4L5QA 4A3FG 1VQBA 3I73A 3NBIA 5I4DA 1YIJA 1PLFA 3SXHA 3AYHB 3LGJA 4A3BH 3G71A 2IJ0A 3NQIA 1XMOL 3BG3A 5J22A 4OO1H 3BZKA 1QNUA 2NVTH 1DCZA 3DM1A 2L5TA 1B70B 3R3OA 5I9PA 1ZEQX 2F3WA 1W6JA 1GUWA 4IUNA 4JI0Q 3HOYH 2K75A 3GTGH 5F2DA 4IOCA 1Y14B 4LUVA 5NUCA 1KD1C 2NTSA 4XIGS 4HSVA 1ZXTA 4O2DA 1SSOA 2V4DA 2PNHA 2KQ3A 1QVCA 4XYOA 4C1NI 1G6ZA 3W3AA 3D6WA 2JA7G 1L1OB 1VQ4A 2K1BA 5CV8A 4C3JG 5CC4A 3GTJB 2EXDA 2PNRC 3PCOB 4A3MH 1D1KA 1GUSA 4KKTA 3EQLC 3AFPA 3D4WA 1Q82C 1QVGA 1ET6A 4UP8A 4DUYL 4A3KH 3K5NA 2JSOA 4X3SA 3PO3B 4K8IA 2A8VA 2E2HB 1M90C 2PPBC 2IY5B 3GV6A 4AQYL 4DV0L 2NZOA 4JCVE 2JJQA 4C3HG 4FF4A 3RLNA 5CORA 1VCIA 3M4OH 1V1OA 5BN5A 2ZXOA 5EKIA 5IE8A 4P2CB 2HHHL 5EKLA 2IHFA 1I4PA 4JI8L 2F52A 5G3LD 4A3EB 1ESRA 2EY6A 1HUMA 2K14A 5T1IA 3I56A 1LUZA 1HZAA 1DXMA 3DXJC 4MN3A 3ICEA 1WTHA 2Y0SG 1YNXA 1ZYRC 3CPFA 3L7ZC 2HCCA 3WDNA 2EYLA 3Q8DA 1EFID 3NWSA 1DOLA 3N6RA 1UE7A 3GTPB 2O2LD 3PSIA 3NBHA 1ICFB 3R2IA 3NHHA 1XX8A 2IX3A 2IHEA 2H4OA 1KDCA 5IYDH 4BBRG 2F0WA 1GO3E 2JA8B 4DAVA 4JI5L 3DWPA 4CJ0B 1JOOA 1PRTD 3HOZB 4AYBB 4OX9L 2R92G 1LYLA 4JPBW 2K4KA 3G6EA 1WVLA 3E3XA 2F0FA 4G7ZC 4POFA 2WKCA 5C4JB 1I5FA 2F0UA 5CV7A 3RZDB 5ELCA 1HTPA 1PH8A 3J7ZC 5ELFA 1RHPA 2AQ1B 2VW9A 4HR7B 1TS3A 4EGVA 1VQNA 3GTQB 1A3VA 3TS2A 4KKUA 2PQEA 2HUGA 1RJTA 1BBUA 2B2WA 5C44G 1XPUA 1EY7A 1B8AA 2L0CA 1V1PA 4FXKC 4I7AA 4IFDI 1GUOA 5ELBA 2ZXPA 4A93B 2B8GA 2F0LA 4DK3C 3HEJA 2ZTCA 2HDMA 5C3WA 2ENBA 3IFDA 5JVG3 4BY7H 3BVGA 3KDFB 1LLRD 3H0GH 3C2PA 4DUYQ 1NE3A 3I4NH 1HNWL 4F8MA 1O7YA 3PUXA 2NVXH 4XT1B 1TVXA 4FO2A 5LHY1 4X3UA 4B3SQ 3PF4A 4DN4M 1XMQQ 3RLOA 4OXPA 1G291 4JI3Q 2K28A 5KIXA 4X66Q 2HHHQ 4F88A 1MHWC 3OYYA 2RHSB 4OEMB 4LF6L 4CGYB 1XNRQ 2WB1B 2DGYA 5IP9G 1RD9D 4DXGA 3JAMi 1PH3A 2PW5A 1PH2A 1BXTA 2IT1A 2JN4A 2FJ2A 4RCNA 4IJLA 4CDFC 2XVSA 1VF5C 4TVAB 2F4IA 2YU9H 5GADC 4HCEA 4A3DG 4DU9A 5FLXc 2A69D 2C35B 4IJHA 4OIKA 2JA9A 3MEHA 2QEJC 5D65A 3UI2A 4B3TL 1SYEA 1TWGB 2HCIA 1GVPA 2D2CC 4C2MH 1JR0D 1NAPA 4OX9Q 1EIFA 4QUCA 1PZJD 2AHOB 3L2PA 2K5HA 4IUUA 5IYBG 3CCEA 1WCMG 2VQFQ 2VUMB 1BF4A 5KRUA 5COYA 3FP9A 3MA2B 3I72A 1MD2D 3HOVB 1UNSA 1CA6A 3M3YB 4UP9A 2EY5A 1FVIA 1LTSD 3M7NA 1SNMA 5IP7G 4JG2A 4JI7L 2PQAB 1S4ZA 4X64Q 4C56C 5I2YA 4HJ8A 4GKKQ 2XRQD 4E6IA 3OW2A 3K81C 3BYTB 1FNUA 1W2BA 1VQ9A 3S14H 3T1YQ 1K3RA 1A3UA 5EAYA 4L5RC 2B63B 3T4AC 1SYBA 5IYCG 1QZHA 4HCSA 3TEHB 4HTHA 1AE2A 1PH7A 1KNEA 4KHVA 1YJ9A 4FP5D 1STNA 4A3IB 2B2VC 5DNFA 1Q86C 2K33A 4LUZA 1UE6A 3FVQA 1TWHH 2A19A 3CCMA 2K5DA
chains in the Genus database with same CATH topology
4OO1I 2D0PA 3S2HH 5JEAG 4A3JG 1I94L 1P16A 3L0OA 1V1QA 2CWAA 2Q2IA 2I0QA 2KHJA 5JJLA 4QL5A 1Y1WG 4OONA 2BH8A 1HNWQ 4LF8L 1Q81C 2E2IH 1KAWA 1X6OA 3HOWG 3PO3G 3RN2A 4GKJQ 1D7QA 2OQ0A 4DK6C 1A62A 3ERSX 4LWCA 1SROA 2N8NA 4GLAC 3KF6B 1A8VA 1N33L 2VUMH 4X6AH 1EYGA 3BZCA 2FXQA 2Q2HA 3PIPA 2ES2A 2Z0SA 1NMGA 1NMFA 3K8AA 4P74A 3K80C 4DV7Q 2F3IA 1V9PA 1N36L 3HOVH 1NBWA 5E7NA 4JI1L 5AJ3L 4DR6Q 1EOVA 2YTXA 1VQIA 4NPSA 4X65Q 1IXRA 1HNZL 4KHPQ 4PZ8A 3I4MG 2JEBI 3WWVA 4DV1L 3S24A 1M1KC 1FL0A 4TQUS 2VQEL 1GKHA 3FKIG 4LF7Q 2UUCL 2BH2A 2L15A 3HOXH 4LF9L 3G48A 4AQYQ 1JE5A 3W1GA 4DV0Q 2NVQH 2ASBA 4A3CG 5ELOA 1Q1BA 2E5LQ 1KRTA 5C4XG 4OWXB 2Y0SE 1XPOA 2Z6KA 2HQLA 4A3BG 4PZ7A 3S1MH 1DGSA 3BU2A 1JJ2A 4JI4L 5BR8Q 2JQOA 2PMZE 3F2BA 4OO1G 1ASZA 4A3IH 5IP9H 2ZJPA 4JI8Q 4DV6Q 1TXYA 2AKWB 4A75A 1A63A 3CCVA 4L5TA 1KL9A 5LMNW 4GOPC 2HT1A 5C3EH 3KJPA 4DR1Q 4DV4Q 3HOYG 1X65A 4QY7A 4BBSH 4K0KL 1OXVA 2ALYB 2WAQE 1N8RC 4DR2L 4A3DH 3W1BA 3S15H 3S16H 4NXNL 1HZCA 3U4VA 4BY1G 5DLQE 3CCJA 2YTVA 2VY3A 4HIMA 1N34Q 4DR5L 2I5HA 1CKMA 4KHZA 3E9HA 4YCUA 2KCTA 3U4ZA 2WB1E 1L1OA 4JI2Q 3W5OA 4DNIA 4HJ9A 1AH9A 2N3SA 4PZ6A 3A74A 1VQOA 1SE8A 3GTMH 3CCLA 4C3IH 2LSSA 3J7A5 3ULJA 1VQPA 2XTIA 3B6YA 1YITA 1YJWA 4A3MG 1FJGQ 1Q46A 4POGA 1CSQA 4B3RL 3PUVA 3NENA 4BA1I 4JI5Q 1K8AC 4KI0A 3S2DH 5IYBH 1IBKQ 3M4PA 4A3KG 5LMNL 1E7ZA 2PI2A 1VQLA 4FDBA 2JA5H 1WCMH 3PV0A 1HH2P 5M5YH 4YHHL 4X62Q 2QGQA 4BA2I 5JJKA 2DUDA 3HKZE 4LF5L 1I3QH 5FLMG 3AEVA 4LFAL 2ID0A 4B3SL 1NTGA 2HIVA 1XMQL 4LF4L 4DPGA 1JB7A 3HKSA 5M3FG 2GVBA 4JI3L 5IP7H 3J81c 1XTDA 4P73A 1HNXL 4GS3A 4DR4Q 2NZHA 2UXCL 2OTJA 4RG1A 4X66L 2Q2TA 1C7YA 1SN8A 3UE0A 4LNQA 2EQSA 3I2ZA 1HR0W 3CC7A 4A4IA 4YWKA 4LFCQ 1XNRL 4GNXC 4R1JA 2CQOA 3EIVA 4MZ9A 2A1AA 4HIKA 4JI6L 1I94Q 4IPDA 3TRZA 1QZGA 4A3GG 1PVOA 2RHQB 1Z9FA 2Q2UA 3GTLH 2CCZA 5LMUQ 2R7FA 3RZOH 3J80c 4MNOA 1SFOH 3KFUA 1Y1VH 3UDIA 1N33Q 2NVYH 2VZAA 5GAGC 1SRUA 3CCUA 3HOUH 4JV5L 4YWMA 1OXXK 2UU9L 3PUYA 4YCVA 1IL2A 2IX1A 3U50C 2KHIA 5M5WH 2BA0A 5C0XI 1N36Q 2ZJRA 5AJ3Q 4DV5L 2R7DA 2ZM6L 5GQOA 5IYDG 4H02A 4JOIA 4A3JH 1HR0L 4DR3L 2QA4A 2JA6G 3K7AH 1C0AA 1Y1WH 1UE5A 3KJOA 1CKOA 1N32L 3T1HL 4NXMQ 3HOWH 2BA1A 4IPHA 1E3PA 4YWLA 1PA6A 3PO3H 2UXBQ 4DUZQ 2E2HH 4DAMA 2VQEQ 4YY3L 3KLWA 2VQFL 4UP7A 1YHAA 2AWOA 3U58A 4HIDA 2ATWA 2V1CC 1BKBA 2ZTDA 1S40A 1V43A 3UDXA 3M85A 2E2JH 4ALPA 1S3OA 4X64L 3G4SA 1VQCA 1YHBA 4OWTB 3CCRA 3OTOQ 4JI4Q 4GKKL 3I4MH 3GO5A 1AE3A 1T9HA 3HKZG 4IOAA 4JYAL 3CCSA 1NJIC 2K52A 1X3GA 3ZJYC 1J5EL 1EQQA 1HZ9A 3T1YL 1MJCA 4JBJA 3FKIH 4LF6Q 2D62A 1WJJA 4DV2L 1PYSB 1HZBA 4P72A 1TWCH 4A3EG 4QQBX 1K8GA 4L5QA 4A3FG 1VS0A 1R9TH 1VQBA 4A3CH 1X56A 3CMAA 4DAYB 1TWFH 1YIJA 5C4XH 1VQHA 4EQ5A 3AYHB 3S17H 3LGJA 3A0JA 2OWOA 3G71A 4A3BH 1X54A 4JC0A 5C0XG 3J81i 3A5UA 1XMOL 3GD7A 3BZKA 3SGIA 1IBMQ 2NVTH 3NEMA 4BY7G 1B70B 4R4OA 4B3TQ 5C0XJ 1PHJA 3F2CA 2YTYA 3M4QA 4QIWE 5IY0A 5H1SE 1YEZA 1XPRA 3H0GG 4JI0Q 3HOYH 2UUBL 2K75A 3GTGH 4IOCA 4R4TA 1Y14B 1O7IA 2JA8G 4LUVA 3M9BA 1KD1C 3HOZG 4XIGS 4AYBG 3I4NG 4O2DA 4BY1H 2I5MX 2K50A 4GKJL 2PNHA 3I4OA 1MKHA 1QVCA 1VQKA 4L5SA 2XGTA 2B63G 5C4JH 3RR5A 3H3VI 4LFAQ 1PH1A 2JA7G 1L1OB 2UXDQ 2ZTEA 4QGUA 1VQ4A 3KF8B 2RCNA 4A76A 4Y52H 3CP0A 2EXDA 3GTOH 3PCOB 2VL6A 3K0XA 5GAEC 3PF5A 1GM5A 1HJPA 4A3MH 4DR6L 2R6GA 1XNQL 4GN5A 2F4VL 4X65L 3AFPA 3CQZH 1VQ8A 1Q82C 3MEFA 4JI7Q 1QVGA 1U0LA 4UP8A 4DUYL 4A3KH 1YI2A 3AFQA 1X3EA 4NB3A 4J15A 1G51A 1VQDA 4IPGA 3GDEA 4JI6Q 3KYHC 2A8VA 3UE1A 3JC66 5FLMH 1M90C 2ZJQA 2IY5B 4AQYL 1PV4A 4IFDJ 4PMWA 2NZOA 2MQHA 4DV0L 5M3FH 4JCVE 2JJQA 1WFQA 2E5LL 1LM0A 3RLNA 2WP8J 1YJNA 2UUAQ 1E22A 1VCIA 2PI2E 5IWAQ 5ELNA 3PIOA 3M4OH 4JV5Q 4A93G 2UU9Q 5IE8A 5BR8L 3MXNB 4LFBQ 2HHHL 1GD7A 1W3SA 2LXJA 2MO0A 2IHFA 3EBEA 4JBKA 3S1NH 4QJFA 2CFMA 4JI8L 5J3BA 3I7FA 2F52A 4HJAA 3PO2G 4A3LG 1K0RA 4A3GH 2R93G 2K14A 2KBNA 2VS1A 3PUWA 4DR1L 4DV4L 4JBMA 3I56A 1LUZA 1HZAA 1IBLL 4R4CA 4GN3B 3ICEA 1E24A 1CUKA 4AIMA 2HIXA 2Y0SG 5IYCH 1X55A 1YNXA 1OTCA 3CPFA 3L7ZC 4YY3Q 4LF8Q 3DLLA 1KXLA 1BVSA 3NBHB 4APVA 4DKAC 1KQSA 1UE1A 2K5VA 1N34L 3Q8DA 4JI2L 1UE7A 3PSIA 3D0FA 1RL2A 4BXXG 1PH5A 3S1QH 3IRBA 2IHEA 2JA6H 5IYDH 1K73C 1SR3A 3CMEA 4BBRG 3GTJH 1FJGL 1GO3E 4PG3A 2WAQG 4JI1Q 4JI5L 3I55A 3CD6A 4JYAQ 1VQ5A 4DV3L 2GVAA 1PYBA 5M3MG 1J5EQ 1IBKL 4OX9L 3H15A 1HNZQ 2R92G 2R7ZG 3JAMc 3E9IA 1LYLA 3G6EA 2K4KA 1QVFA 4DV1Q 5M5XH 3A5ZB 1KRSA 4R4IA 3ULPA 2WB1G 4POFA 1EWIA 2CKZB 2VNUD 2UUCQ 1JJCB 1I5FA 4LF9Q 2KCMA 1ASYA 1CKNB 2NN6I 3CW2C 1QUQA 3ULLA 1PH8A 4DR7L 3J7ZC 3AQQA 1TWAH 5FJ8G 1CKNA 1JMCA 1B7YB 1Q1EA 1D8LA 2VW9A 1OXUA 1Q8KA 1X3FA 2QEXA 1VQNA 3TS2A 1PH4A 3NELA 2K5NA 1BBUA 2N49A 5C44G 1G6PA 4A3EH 2B3GA 1I50H 2UUBQ 3GTKH 4WJ3M 1XPUA 2OCEA 1B8AA 4A3FH 5LMUL 2OTLA 2B29A 4LW1A 2YV5A 4IFDI 4K0KQ 5JEAJ 2KENA 2JEAI 3STBC 4DK3C 4HJ5A 4DR2Q 1EUJA 4NXNQ 2ZTCA 1JT8A 4B3ML 4IO9A 1L2FA 3KF6A 2VUMG 4DR5Q 3GTPH 4BY7H 1CSPA 3M3YH 3KDFB 1L0WA 4HIOA 3RN5A 1E1TA 4UPAA 4LUOA 2Z6KC 4JBWA 1XNQQ 3H0GH 2F4VQ 1FGUA 4DUZL 3HOVG 4XTCS 2CWPA 3DM3A 3KDFA 2H5XA 2JA8H 4DUYQ 1NE3A 1BBWA 2MFIA 3CF5A 3KOJA 4NXML 1PFSA 2UXBL 1X9NA 1SLJA 3HOZH 3I4NH 4B3RQ 1LTLA 1HNWL 3CAMA 3J81j 3PUXA 1EIYB 2NVXH 1N9WA 1U5KA 5LMNQ 4OWWB 2B63H 3D31A 1P8LA 2NN6G 4YHHQ 2JA7H 3J80i 4LF5Q 2JE6I 4C3JH 3HOXG 4P75A 4B3SQ 4GLXA 3PF4A 3S1RH 4LF4Q 1XMQQ 3RLOA 3RZDH 4OXPA 1G291 4JI3Q 4DV7L 3OTOL 1HNXQ 4GOPB 2UXCQ 1I6HH 4X66Q 1PH9A 2HHHQ 1IZ6A 1C9OA 3HFZB 1L1OC 3OYYA 3EN2A 2RHSB 4O0AA 4P71A 1E1OA 3CPWA 1VQGA 4KHPL 5GROA 5K36G 4GOPA 2I5LX 1MIUA 4KLKA 3CCQA 4A3IG 1VQ7A 4LF6L 4IPCA 1XNRQ 2DGYA 5IP9G 3GTQH 4IFDG 2MO1A 2IX0A 3JAMi 1PH3A 4GN4B 1IBLQ 1PH2A 4LF7L 4YCWA 1PH6A 5C3EG 2IT1A 4C3HH 3BJUA 3RNUA 4IJLA 5IT9c 1YVCA 4BBSG 4TVAB 1OXTA 4GLVB 3UDFA 1Q12A 1XJVA 4A93H 3CXCA 2YU9H 3K7UC 5GADC 4A3DG 3E0EA 5FLXc 1IBML 3F8TA 5HGQA 2C35B 1YHQA 4IJHA 3PO2H 2JA9A 1KC8C 4A3LH 1Z47A 4B3TL 2E8GA 2R93H 1JJGA 1GVPA 4C2MH 4DV6L 4JI0L 2OQKA 1VQ6A 4DV5Q 1HR0Q 2ZM6Q 1EFWA 3H3VH 1IYJB 1YZ6A 4DR3Q 4DV3Q 1EIFA 4OX9Q 3RLFA 2EIFA 2AHOB 3L2PA 3F1ZA 1N32Q 3T1HQ 2K5HA 5IYBG 2MNAA 2JA5G 4EX5A 3CCEA 1WCMG 2VQFQ 2UXDL 1VQAA 3PGZA 1UEBA 4BXXH 3FP9A 1YBYA 1J6QA 1VQEA 4GNXB 1VQFA 2AMCB 4BBRH 4HJ7A 4UP9A 3TREA 2LXKA 2RF4A 1FVIA 3M7NA 4DR7Q 5IP7G 1VQMA 1Q7YC 1WI5A 4JG2A 3CC4A 2PQAB 4Y7NH 4X64Q 4GNXA 4JI7L 1K83H 2R92H 5M3MH 1KIXA 5HY6A 2R7ZH 4HJ8A 3TS0A 1A0IA 3UDGA 4GKKQ 2GN5A 3STBD 3CC2A 2PQAA 3OW2A 1OXSC 1UWVA 3K81C 4MTNA 1H95A 4JOIC 1W2BA 1VQ9A 5JJIA 5GAHC 3FHWA 3T1YQ 1K3RA 5EAYA 3S14H 4L5RC 4ME3A 4X62L 3VDYA 2N78A 4RMFA 1NY4A 4DV2Q 2JK8A 3PUZA 5IYCG 1QZHA 3TEHB 1K9MC 2UUAL 1QUQB 1AE2A 5IWAL 1S72A 1PH7A 3TQYA 2D0OA 3ER0A 1RIPA 4DR4L 4R4QA 1Y1VG 2YYZA 5FJ8H 3F2DA 1KHIA 4AYBE 1SMXA 4B3MQ 4LFBL 1YJ9A 1XMOQ 2AWNA 1MJEA 3HOUG 4AH6A 4UY8C 1EQRA 1WYDA 4LFCL 1Q86C 5C44H 4WJ4A 4LUZA 1VQJA 1WOCA 1UE6A 1TWHH 2A19A 2WFWA 1TWGH 3CCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 I;  2D0P A;  3S2H H;  5JEA G;  4A3J G;  1I94 L;  1P16 A;  3L0O A;  1V1Q A;  2CWA A;  2Q2I A;  2I0Q A;  2KHJ A;  5JJL A;  4QL5 A;  1Y1W G;  4OON A;  2BH8 A;  1HNW Q;  4LF8 L;  1Q81 C;  2E2I H;  1KAW A;  1X6O A;  3HOW G;  3PO3 G;  3RN2 A;  4GKJ Q;  1D7Q A;  2OQ0 A;  4DK6 C;  1A62 A;  3ERS X;  4LWC A;  1SRO A;  2N8N A;  4GLA C;  3KF6 B;  1A8V A;  1N33 L;  2VUM H;  4X6A H;  1EYG A;  3BZC A;  2FXQ A;  2Q2H A;  3PIP A;  2ES2 A;  2Z0S A;  1NMG A;  1NMF A;  3K8A A;  4P74 A;  3K80 C;  4DV7 Q;  2F3I A;  1V9P A;  1N36 L;  3HOV H;  1NBW A;  5E7N A;  4JI1 L;  5AJ3 L;  4DR6 Q;  1EOV A;  2YTX A;  1VQI A;  4NPS A;  4X65 Q;  1IXR A;  1HNZ L;  4KHP Q;  4PZ8 A;  3I4M G;  2JEB I;  3WWV A;  4DV1 L;  3S24 A;  1M1K C;  1FL0 A;  4TQU S;  2VQE L;  1GKH A;  3FKI G;  4LF7 Q;  2UUC L;  2BH2 A;  2L15 A;  3HOX H;  4LF9 L;  3G48 A;  4AQY Q;  1JE5 A;  3W1G A;  4DV0 Q;  2NVQ H;  2ASB A;  4A3C G;  5ELO A;  1Q1B A;  2E5L Q;  1KRT A;  5C4X G;  4OWX B;  2Y0S E;  1XPO A;  2Z6K A;  2HQL A;  4A3B G;  4PZ7 A;  3S1M H;  1DGS A;  3BU2 A;  1JJ2 A;  4JI4 L;  5BR8 Q;  2JQO A;  2PMZ E;  3F2B A;  4OO1 G;  1ASZ A;  4A3I H;  5IP9 H;  2ZJP A;  4JI8 Q;  4DV6 Q;  1TXY A;  2AKW B;  4A75 A;  1A63 A;  3CCV A;  4L5T A;  1KL9 A;  5LMN W;  4GOP C;  2HT1 A;  5C3E H;  3KJP A;  4DR1 Q;  4DV4 Q;  3HOY G;  1X65 A;  4QY7 A;  4BBS H;  4K0K L;  1OXV A;  2ALY B;  2WAQ E;  1N8R C;  4DR2 L;  4A3D H;  3W1B A;  3S15 H;  3S16 H;  4NXN L;  1HZC A;  3U4V A;  4BY1 G;  5DLQ E;  3CCJ A;  2YTV A;  2VY3 A;  4HIM A;  1N34 Q;  4DR5 L;  2I5H A;  1CKM A;  4KHZ A;  3E9H A;  4YCU A;  2KCT A;  3U4Z A;  2WB1 E;  1L1O A;  4JI2 Q;  3W5O A;  4DNI A;  4HJ9 A;  1AH9 A;  2N3S A;  4PZ6 A;  3A74 A;  1VQO A;  1SE8 A;  3GTM H;  3CCL A;  4C3I H;  2LSS A;  3J7A 5;  3ULJ A;  1VQP A;  2XTI A;  3B6Y A;  1YIT A;  1YJW A;  4A3M G;  1FJG Q;  1Q46 A;  4POG A;  1CSQ A;  4B3R L;  3PUV A;  3NEN A;  4BA1 I;  4JI5 Q;  1K8A C;  4KI0 A;  3S2D H;  5IYB H;  1IBK Q;  3M4P A;  4A3K G;  5LMN L;  1E7Z A;  2PI2 A;  1VQL A;  4FDB A;  2JA5 H;  1WCM H;  3PV0 A;  1HH2 P;  5M5Y H;  4YHH L;  4X62 Q;  2QGQ A;  4BA2 I;  5JJK A;  2DUD A;  3HKZ E;  4LF5 L;  1I3Q H;  5FLM G;  3AEV A;  4LFA L;  2ID0 A;  4B3S L;  1NTG A;  2HIV A;  1XMQ L;  4LF4 L;  4DPG A;  1JB7 A;  3HKS A;  5M3F G;  2GVB A;  4JI3 L;  5IP7 H;  3J81 c;  1XTD A;  4P73 A;  1HNX L;  4GS3 A;  4DR4 Q;  2NZH A;  2UXC L;  2OTJ A;  4RG1 A;  4X66 L;  2Q2T A;  1C7Y A;  1SN8 A;  3UE0 A;  4LNQ A;  2EQS A;  3I2Z A;  1HR0 W;  3CC7 A;  4A4I A;  4YWK A;  4LFC Q;  1XNR L;  4GNX C;  4R1J A;  2CQO A;  3EIV A;  4MZ9 A;  2A1A A;  4HIK A;  4JI6 L;  1I94 Q;  4IPD A;  3TRZ A;  1QZG A;  4A3G G;  1PVO A;  2RHQ B;  1Z9F A;  2Q2U A;  3GTL H;  2CCZ A;  5LMU Q;  2R7F A;  3RZO H;  3J80 c;  4MNO A;  1SFO H;  3KFU A;  1Y1V H;  3UDI A;  1N33 Q;  2NVY H;  2VZA A;  5GAG C;  1SRU A;  3CCU A;  3HOU H;  4JV5 L;  4YWM A;  1OXX K;  2UU9 L;  3PUY A;  4YCV A;  1IL2 A;  2IX1 A;  3U50 C;  2KHI A;  5M5W H;  2BA0 A;  5C0X I;  1N36 Q;  2ZJR A;  5AJ3 Q;  4DV5 L;  2R7D A;  2ZM6 L;  5GQO A;  5IYD G;  4H02 A;  4JOI A;  4A3J H;  1HR0 L;  4DR3 L;  2QA4 A;  2JA6 G;  3K7A H;  1C0A A;  1Y1W H;  1UE5 A;  3KJO A;  1CKO A;  1N32 L;  3T1H L;  4NXM Q;  3HOW H;  2BA1 A;  4IPH A;  1E3P A;  4YWL A;  1PA6 A;  3PO3 H;  2UXB Q;  4DUZ Q;  2E2H H;  4DAM A;  2VQE Q;  4YY3 L;  3KLW A;  2VQF L;  4UP7 A;  1YHA A;  2AWO A;  3U58 A;  4HID A;  2ATW A;  2V1C C;  1BKB A;  2ZTD A;  1S40 A;  1V43 A;  3UDX A;  3M85 A;  2E2J H;  4ALP A;  1S3O A;  4X64 L;  3G4S A;  1VQC A;  1YHB A;  4OWT B;  3CCR A;  3OTO Q;  4JI4 Q;  4GKK L;  3I4M H;  3GO5 A;  1AE3 A;  1T9H A;  3HKZ G;  4IOA A;  4JYA L;  3CCS A;  1NJI C;  2K52 A;  1X3G A;  3ZJY C;  1J5E L;  1EQQ A;  1HZ9 A;  3T1Y L;  1MJC A;  4JBJ A;  3FKI H;  4LF6 Q;  2D62 A;  1WJJ A;  4DV2 L;  1PYS B;  1HZB A;  4P72 A;  1TWC H;  4A3E G;  4QQB X;  1K8G A;  4L5Q A;  4A3F G;  1VS0 A;  1R9T H;  1VQB A;  4A3C H;  1X56 A;  3CMA A;  4DAY B;  1TWF H;  1YIJ A;  5C4X H;  1VQH A;  4EQ5 A;  3AYH B;  3S17 H;  3LGJ A;  3A0J A;  2OWO A;  3G71 A;  4A3B H;  1X54 A;  4JC0 A;  5C0X G;  3J81 i;  3A5U A;  1XMO L;  3GD7 A;  3BZK A;  3SGI A;  1IBM Q;  2NVT H;  3NEM A;  4BY7 G;  1B70 B;  4R4O A;  4B3T Q;  5C0X J;  1PHJ A;  3F2C A;  2YTY A;  3M4Q A;  4QIW E;  5IY0 A;  5H1S E;  1YEZ A;  1XPR A;  3H0G G;  4JI0 Q;  3HOY H;  2UUB L;  2K75 A;  3GTG H;  4IOC A;  4R4T A;  1Y14 B;  1O7I A;  2JA8 G;  4LUV A;  3M9B A;  1KD1 C;  3HOZ G;  4XIG S;  4AYB G;  3I4N G;  4O2D A;  4BY1 H;  2I5M X;  2K50 A;  4GKJ L;  2PNH A;  3I4O A;  1MKH A;  1QVC A;  1VQK A;  4L5S A;  2XGT A;  2B63 G;  5C4J H;  3RR5 A;  3H3V I;  4LFA Q;  1PH1 A;  2JA7 G;  1L1O B;  2UXD Q;  2ZTE A;  4QGU A;  1VQ4 A;  3KF8 B;  2RCN A;  4A76 A;  4Y52 H;  3CP0 A;  2EXD A;  3GTO H;  3PCO B;  2VL6 A;  3K0X A;  5GAE C;  3PF5 A;  1GM5 A;  1HJP A;  4A3M H;  4DR6 L;  2R6G A;  1XNQ L;  4GN5 A;  2F4V L;  4X65 L;  3AFP A;  3CQZ H;  1VQ8 A;  1Q82 C;  3MEF A;  4JI7 Q;  1QVG A;  1U0L A;  4UP8 A;  4DUY L;  4A3K H;  1YI2 A;  3AFQ A;  1X3E A;  4NB3 A;  4J15 A;  1G51 A;  1VQD A;  4IPG A;  3GDE A;  4JI6 Q;  3KYH C;  2A8V A;  3UE1 A;  3JC6 6;  5FLM H;  1M90 C;  2ZJQ A;  2IY5 B;  4AQY L;  1PV4 A;  4IFD J;  4PMW A;  2NZO A;  2MQH A;  4DV0 L;  5M3F H;  4JCV E;  2JJQ A;  1WFQ A;  2E5L L;  1LM0 A;  3RLN A;  2WP8 J;  1YJN A;  2UUA Q;  1E22 A;  1VCI A;  2PI2 E;  5IWA Q;  5ELN A;  3PIO A;  3M4O H;  4JV5 Q;  4A93 G;  2UU9 Q;  5IE8 A;  5BR8 L;  3MXN B;  4LFB Q;  2HHH L;  1GD7 A;  1W3S A;  2LXJ A;  2MO0 A;  2IHF A;  3EBE A;  4JBK A;  3S1N H;  4QJF A;  2CFM A;  4JI8 L;  5J3B A;  3I7F A;  2F52 A;  4HJA A;  3PO2 G;  4A3L G;  1K0R A;  4A3G H;  2R93 G;  2K14 A;  2KBN A;  2VS1 A;  3PUW A;  4DR1 L;  4DV4 L;  4JBM A;  3I56 A;  1LUZ A;  1HZA A;  1IBL L;  4R4C A;  4GN3 B;  3ICE A;  1E24 A;  1CUK A;  4AIM A;  2HIX A;  2Y0S G;  5IYC H;  1X55 A;  1YNX A;  1OTC A;  3CPF A;  3L7Z C;  4YY3 Q;  4LF8 Q;  3DLL A;  1KXL A;  1BVS A;  3NBH B;  4APV A;  4DKA C;  1KQS A;  1UE1 A;  2K5V A;  1N34 L;  3Q8D A;  4JI2 L;  1UE7 A;  3PSI A;  3D0F A;  1RL2 A;  4BXX G;  1PH5 A;  3S1Q H;  3IRB A;  2IHE A;  2JA6 H;  5IYD H;  1K73 C;  1SR3 A;  3CME A;  4BBR G;  3GTJ H;  1FJG L;  1GO3 E;  4PG3 A;  2WAQ G;  4JI1 Q;  4JI5 L;  3I55 A;  3CD6 A;  4JYA Q;  1VQ5 A;  4DV3 L;  2GVA A;  1PYB A;  5M3M G;  1J5E Q;  1IBK L;  4OX9 L;  3H15 A;  1HNZ Q;  2R92 G;  2R7Z G;  3JAM c;  3E9I A;  1LYL A;  3G6E A;  2K4K A;  1QVF A;  4DV1 Q;  5M5X H;  3A5Z B;  1KRS A;  4R4I A;  3ULP A;  2WB1 G;  4POF A;  1EWI A;  2CKZ B;  2VNU D;  2UUC Q;  1JJC B;  1I5F A;  4LF9 Q;  2KCM A;  1ASY A;  1CKN B;  2NN6 I;  3CW2 C;  1QUQ A;  3ULL A;  1PH8 A;  4DR7 L;  3J7Z C;  3AQQ A;  1TWA H;  5FJ8 G;  1CKN A;  1JMC A;  1B7Y B;  1Q1E A;  1D8L A;  2VW9 A;  1OXU A;  1Q8K A;  1X3F A;  2QEX A;  1VQN A;  3TS2 A;  1PH4 A;  3NEL A;  2K5N A;  1BBU A;  2N49 A;  5C44 G;  1G6P A;  4A3E H;  2B3G A;  1I50 H;  2UUB Q;  3GTK H;  4WJ3 M;  1XPU A;  2OCE A;  1B8A A;  4A3F H;  5LMU L;  2OTL A;  2B29 A;  4LW1 A;  2YV5 A;  4IFD I;  4K0K Q;  5JEA J;  2KEN A;  2JEA I;  3STB C;  4DK3 C;  4HJ5 A;  4DR2 Q;  1EUJ A;  4NXN Q;  2ZTC A;  1JT8 A;  4B3M L;  4IO9 A;  1L2F A;  3KF6 A;  2VUM G;  4DR5 Q;  3GTP H;  4BY7 H;  1CSP A;  3M3Y H;  3KDF B;  1L0W A;  4HIO A;  3RN5 A;  1E1T A;  4UPA A;  4LUO A;  2Z6K C;  4JBW A;  1XNQ Q;  3H0G H;  2F4V Q;  1FGU A;  4DUZ L;  3HOV G;  4XTC S;  2CWP A;  3DM3 A;  3KDF A;  2H5X A;  2JA8 H;  4DUY Q;  1NE3 A;  1BBW A;  2MFI A;  3CF5 A;  3KOJ A;  4NXM L;  1PFS A;  2UXB L;  1X9N A;  1SLJ A;  3HOZ H;  3I4N H;  4B3R Q;  1LTL A;  1HNW L;  3CAM A;  3J81 j;  3PUX A;  1EIY B;  2NVX H;  1N9W A;  1U5K A;  5LMN Q;  4OWW B;  2B63 H;  3D31 A;  1P8L A;  2NN6 G;  4YHH Q;  2JA7 H;  3J80 i;  4LF5 Q;  2JE6 I;  4C3J H;  3HOX G;  4P75 A;  4B3S Q;  4GLX A;  3PF4 A;  3S1R H;  4LF4 Q;  1XMQ Q;  3RLO A;  3RZD H;  4OXP A;  1G29 1;  4JI3 Q;  4DV7 L;  3OTO L;  1HNX Q;  4GOP B;  2UXC Q;  1I6H H;  4X66 Q;  1PH9 A;  2HHH Q;  1IZ6 A;  1C9O A;  3HFZ B;  1L1O C;  3OYY A;  3EN2 A;  2RHS B;  4O0A A;  4P71 A;  1E1O A;  3CPW A;  1VQG A;  4KHP L;  5GRO A;  5K36 G;  4GOP A;  2I5L X;  1MIU A;  4KLK A;  3CCQ A;  4A3I G;  1VQ7 A;  4LF6 L;  4IPC A;  1XNR Q;  2DGY A;  5IP9 G;  3GTQ H;  4IFD G;  2MO1 A;  2IX0 A;  3JAM i;  1PH3 A;  4GN4 B;  1IBL Q;  1PH2 A;  4LF7 L;  4YCW A;  1PH6 A;  5C3E G;  2IT1 A;  4C3H H;  3BJU A;  3RNU A;  4IJL A;  5IT9 c;  1YVC A;  4BBS G;  4TVA B;  1OXT A;  4GLV B;  3UDF A;  1Q12 A;  1XJV A;  4A93 H;  3CXC A;  2YU9 H;  3K7U C;  5GAD C;  4A3D G;  3E0E A;  5FLX c;  1IBM L;  3F8T A;  5HGQ A;  2C35 B;  1YHQ A;  4IJH A;  3PO2 H;  2JA9 A;  1KC8 C;  4A3L H;  1Z47 A;  4B3T L;  2E8G A;  2R93 H;  1JJG A;  1GVP A;  4C2M H;  4DV6 L;  4JI0 L;  2OQK A;  1VQ6 A;  4DV5 Q;  1HR0 Q;  2ZM6 Q;  1EFW A;  3H3V H;  1IYJ B;  1YZ6 A;  4DR3 Q;  4DV3 Q;  1EIF A;  4OX9 Q;  3RLF A;  2EIF A;  2AHO B;  3L2P A;  3F1Z A;  1N32 Q;  3T1H Q;  2K5H A;  5IYB G;  2MNA A;  2JA5 G;  4EX5 A;  3CCE A;  1WCM G;  2VQF Q;  2UXD L;  1VQA A;  3PGZ A;  1UEB A;  4BXX H;  3FP9 A;  1YBY A;  1J6Q A;  1VQE A;  4GNX B;  1VQF A;  2AMC B;  4BBR H;  4HJ7 A;  4UP9 A;  3TRE A;  2LXK A;  2RF4 A;  1FVI A;  3M7N A;  4DR7 Q;  5IP7 G;  1VQM A;  1Q7Y C;  1WI5 A;  4JG2 A;  3CC4 A;  2PQA B;  4Y7N H;  4X64 Q;  4GNX A;  4JI7 L;  1K83 H;  2R92 H;  5M3M H;  1KIX A;  5HY6 A;  2R7Z H;  4HJ8 A;  3TS0 A;  1A0I A;  3UDG A;  4GKK Q;  2GN5 A;  3STB D;  3CC2 A;  2PQA A;  3OW2 A;  1OXS C;  1UWV A;  3K81 C;  4MTN A;  1H95 A;  4JOI C;  1W2B A;  1VQ9 A;  5JJI A;  5GAH C;  3FHW A;  3T1Y Q;  1K3R A;  5EAY A;  3S14 H;  4L5R C;  4ME3 A;  4X62 L;  3VDY A;  2N78 A;  4RMF A;  1NY4 A;  4DV2 Q;  2JK8 A;  3PUZ A;  5IYC G;  1QZH A;  3TEH B;  1K9M C;  2UUA L;  1QUQ B;  1AE2 A;  5IWA L;  1S72 A;  1PH7 A;  3TQY A;  2D0O A;  3ER0 A;  1RIP A;  4DR4 L;  4R4Q A;  1Y1V G;  2YYZ A;  5FJ8 H;  3F2D A;  1KHI A;  4AYB E;  1SMX A;  4B3M Q;  4LFB L;  1YJ9 A;  1XMO Q;  2AWN A;  1MJE A;  3HOU G;  4AH6 A;  4UY8 C;  1EQR A;  1WYD A;  4LFC L;  1Q86 C;  5C44 H;  4WJ4 A;  4LUZ A;  1VQJ A;  1WOC A;  1UE6 A;  1TWH H;  2A19 A;  2WFW A;  1TWG H;  3CCM A; 
#chains in the Genus database with same CATH topology
 3S2H H;  3BZD B;  5FLX L;  2I0Q A;  1LO5 D;  3F2U A;  2B2W C;  4QL5 A;  1J9O A;  1HNW Q;  2BH8 A;  3GP7 A;  4JVZ A;  3HOW G;  4RKL A;  3PO3 G;  3RN2 A;  3ZYY X;  3OHX C;  3JAM E;  1A62 A;  1N33 L;  2N8N A;  2IW3 A;  4GLA C;  2B8F A;  2F0N A;  4C3I B;  3K8A A;  5IGC A;  1SYF A;  4XQJ A;  4JI1 L;  1ENC A;  4RCO A;  4DR6 Q;  1EOV A;  2YTX A;  4X65 Q;  1IXR A;  2JEB I;  1PRT B;  1BNZ A;  3QOJ A;  3S24 A;  2KUM A;  1XWE A;  3VYU A;  1SNP A;  1IYU A;  3FKI G;  2UUC L;  2L15 A;  3HOX H;  4LF9 L;  4N9P A;  3G48 A;  1WTP A;  3TBI B;  2IPK D;  1KRT A;  2Z4I A;  5IGG A;  4OWX B;  2Y0S E;  4XYQ A;  1BCP F;  1ML0 D;  2EJM A;  2OEO A;  5BR8 Q;  2PMZ E;  2TMP A;  5I9O A;  1ASZ A;  1IW7 C;  4IFD H;  1EWC A;  3CRL C;  3EA6 A;  4A75 A;  3CCV A;  2MPM A;  1ILP A;  1STE A;  5C3E H;  2O5I C;  4QY7 A;  4BBS H;  5ISR A;  1SFO B;  2B2Y A;  2BCO A;  4IAL A;  4DR2 L;  2OT2 A;  4B9X A;  1HZC A;  2K03 A;  2YTV A;  4BS9 A;  4HIM A;  2I5H A;  3U4Z A;  5M5W B;  1C48 A;  3BDL A;  3W5O A;  1L1O A;  2CH4 W;  1AH9 A;  4PZ6 A;  3H91 A;  1VQO A;  3CCL A;  3ULJ A;  1F9P A;  2F0E A;  1CSQ A;  1SEB D;  5CMD A;  3GQB A;  1K8A C;  4KI0 A;  3S2D H;  5LMN L;  4FDB A;  4YHH L;  5JJK A;  2QGQ A;  2L55 A;  1I3Q H;  5FLM G;  3VYT A;  4LFA L;  1I4R A;  4L8J A;  4LF4 L;  2E2J B;  4OEL B;  5M3F G;  1EIH A;  4GS3 A;  1CQF A;  2NZH A;  2VXW A;  5IT9 E;  1SN8 A;  4UHV A;  4LNQ A;  1WD0 A;  1DZ1 A;  1LTB D;  1K28 A;  1H9R A;  3KLS X;  2A1A A;  4JI6 L;  5DM6 3;  3LNN A;  3RD4 A;  1Z9F A;  5A2Q E;  5LMU Q;  3K58 A;  1NUC A;  3J80 c;  3I90 A;  4A3B B;  1HPC A;  1Y1V H;  3UDI A;  1N33 Q;  1RTN A;  5CBA E;  4MIU A;  4CKB A;  4JV5 L;  2UU9 L;  4ODG A;  2IX1 A;  3U50 C;  2K04 A;  3SE0 A;  5C3X A;  5GQO A;  4A3J H;  3HOY B;  4CBV A;  3NPP A;  4DR3 L;  3GTG B;  1C0A A;  1UE5 A;  1N32 L;  2RDG A;  4OIJ A;  5T1G A;  2KJX A;  4IPH A;  1E3P A;  4MTK A;  1YHA A;  2F1M A;  4WJW A;  3U58 A;  1GOZ A;  2FMM A;  2V1C C;  1BKB A;  1S40 A;  5FOB B;  4DNT B;  1W6K A;  3I91 A;  3OTO Q;  1SBB B;  4A3K B;  2Q8I B;  4JYA L;  3CCS A;  1J5E L;  2CW0 D;  1HZ9 A;  2E75 C;  3AMU A;  5M5Y B;  1R9T H;  4K2L A;  2HQE A;  4DAY B;  1TWF H;  4FXD A;  3S17 H;  1EQT A;  2KVM A;  1X54 A;  3DWA A;  4JC0 A;  3J81 i;  3A5U A;  1PTO F;  1EY6 A;  1DJR D;  3J80 L;  3SDZ A;  3KBX A;  4R4O A;  1BCP C;  1QWY A;  2FFK B;  1PHJ A;  1KDB A;  4QIW E;  3OMC A;  4CKC A;  2XNA C;  2BDO A;  2UUB L;  1NNX A;  4JW0 A;  3LWU A;  1Q90 A;  4R4T A;  3QWN A;  5K5P A;  4FXG C;  3M9B A;  3DHQ A;  3RZO B;  4BY1 H;  4GKJ L;  2I5M X;  3I4O A;  2B63 G;  3D4D A;  2XGT A;  2B2Y C;  3RR5 A;  4JK1 C;  4LFA Q;  1PH1 A;  2UXD Q;  1SYD A;  2ZTE A;  4QGU A;  1DD2 A;  3MTS A;  1Y8O B;  2FHT A;  3CP0 A;  1CTM A;  1MI2 A;  2WAC A;  4DAP A;  1GM5 A;  1HJP A;  1B3A A;  1XNQ L;  4GN5 A;  2F4V L;  2HD3 A;  3CQZ H;  1AEX A;  1IHZ A;  1BDO A;  3MEF A;  1YI2 A;  1X3E A;  5KYL A;  2QDL A;  4JI6 Q;  2ZJQ A;  4FYD A;  4U67 3;  4PMW A;  1HQR D;  2E5L L;  1I4H A;  2WP8 J;  5FK9 C;  3PIO A;  5EPJ A;  4ABN A;  2AQ2 B;  4JV5 Q;  2UU9 Q;  3TDQ A;  4LFB Q;  1W3S A;  1TQO A;  3P7J A;  4JBK A;  3D8G A;  5E3F A;  3SEB A;  3I7F A;  1K0R A;  4KN7 C;  4A3G H;  2R93 G;  1SMY C;  2KBN A;  2VS1 A;  4DR1 L;  1TS4 A;  1TWC B;  2Z8L A;  1EYC A;  1CUK A;  1E2V A;  3NXW A;  1X55 A;  1KXL A;  4LF8 Q;  3DLL A;  5C4X B;  1JCK B;  1UE1 A;  2K5V A;  3D0F A;  4ZRZ A;  1RL2 A;  4BXX G;  1PH5 A;  3S1Q H;  1A15 A;  5EPL A;  2F0J A;  3H0G B;  4ME5 A;  2JA6 H;  1LV9 A;  1FJG L;  2NWG A;  4RWS C;  4R8I A;  3J81 E;  4JYA Q;  2EYM A;  2SNM A;  4DV3 L;  1J5E Q;  3I4N B;  5M3M G;  3U9O A;  1HNZ Q;  2R7Z G;  2NVX B;  1E0B A;  4DV1 Q;  1TY0 A;  2K5W A;  3A5Z B;  4XDX A;  2VNU D;  3VA7 A;  2KCM A;  3K57 A;  2F0K A;  1CKN B;  3CW2 C;  3CRK C;  5A35 A;  5IOD A;  2A6E C;  5FJ8 G;  2I07 B;  1OXU A;  1H9J A;  1PH4 A;  1XXG A;  2K5N A;  2M9V A;  2FMC A;  2B3G A;  1I50 H;  2B2U A;  3WOE A;  2UUB Q;  1YNJ C;  4A3F H;  3RMH A;  1LTG D;  4N8F A;  3R93 A;  2YV5 A;  3J7A V;  1VMC A;  4K0K Q;  4IUV A;  3OWF A;  3STB C;  5FKA C;  3R8B A;  1EUJ A;  4NXN Q;  3NE5 B;  2NBF A;  4IO9 A;  1JQY D;  1BQQ T;  4DR5 Q;  4HIO A;  3RN5 A;  3ONA B;  1E1T A;  2XWB B;  4LUO A;  4UPA A;  4C2M B;  4JBW A;  1XNQ Q;  1QOH A;  4XQN A;  2F4V Q;  1PTO C;  1EEF D;  3DM3 A;  2H5X A;  3CF5 A;  1BBW A;  4NXM L;  3KOJ A;  3MWY W;  5KND A;  2UXB L;  2F0H A;  2X6L A;  1D5M C;  4WFN 3;  1U5K A;  5KEE A;  2EYO A;  3D31 A;  1PFB A;  2NN6 G;  2JA7 H;  4NP5 A;  2AUJ D;  4FF3 A;  3W2D A;  1L0Y B;  1AW7 A;  4C3J H;  4PQX A;  2MUY A;  2WAQ B;  1HNX Q;  4GOP B;  1I6H H;  3K0Y A;  4QMG A;  3QO2 A;  4P71 A;  3VA5 A;  1TKW B;  1ZYR D;  5E4W C;  5CV5 A;  2I5L X;  1MIU A;  3OW7 A;  3PIO 3;  4IPC A;  3C1E A;  2MO1 A;  2IX0 A;  2Q8T A;  1DOM A;  1VMP A;  3I4L A;  3OIQ A;  5CBE E;  4C3H H;  3BJU A;  5JOB A;  2KOL A;  2WKD A;  1JOR A;  1OXT A;  1NCV A;  3CXC A;  3E0E A;  5IOC A;  2DY8 A;  2BOS A;  2PW7 A;  1IBM L;  1KAB A;  1TWA B;  2EDG A;  1YHQ A;  1S5E D;  4GZY C;  1EYA A;  1Z47 A;  3TME A;  1TWH B;  2E8G A;  1JJG A;  3S2H B;  3T56 B;  5CR3 A;  4DV5 Q;  1HR0 Q;  1EFW A;  1IL8 A;  1CZW A;  1BOS A;  1IYJ B;  1HFG A;  1SYG A;  1YZ6 A;  2L12 A;  4DV3 Q;  3RLF A;  3FDT A;  3SVM A;  3T53 B;  1EU4 A;  2JA5 G;  1STA A;  3FEW X;  4HN7 A;  2OF1 A;  1YBY A;  2WIN B;  1SE3 A;  1VQE A;  4GNX B;  4BBR H;  2EY2 A;  2LXK A;  2RF4 A;  3TRE A;  4FF1 A;  3KLS A;  1VQM A;  4DGZ A;  1EZ6 A;  2R92 H;  2RDF A;  1KIX A;  1VDZ A;  3CC2 A;  1OXS C;  1UWV A;  4MTN A;  1H95 A;  2C5C A;  5GAH C;  3G6J B;  4DFA A;  4ME3 A;  4X62 L;  3VDY A;  2N78 A;  3HOX B;  1LT4 D;  4DV2 Q;  5CYU A;  2EYP A;  1CA5 A;  1K9M C;  2UUA L;  1QUQ B;  5IWA L;  3S1R B;  3ER0 A;  2MJ8 A;  1KHI A;  2B2T A;  5KNC A;  2EVB A;  1XMO Q;  2O4X A;  1MJE A;  3WOF A;  2GA4 B;  1RTO A;  5C44 H;  3GV3 A;  5HGT A;  3UE1 A;  2WFW A;  5C3E B;  4CJ1 B;  4C1N K;  2O5J C;  1P16 A;  3D6C A;  1V1Q A;  2CWA A;  2Q2I A;  3N52 A;  3BS1 A;  4BBS B;  5JJL A;  4PMB A;  1Y1W G;  2B2U C;  1BBX C;  2RSN A;  4LJZ C;  4DK6 C;  1MSG A;  3KF6 B;  1F2Y A;  3TP8 A;  3BZC A;  2FXQ A;  2Q2H A;  1NMF A;  3PO2 B;  3K80 C;  3AB9 A;  1N36 L;  1K3B C;  5AJ3 L;  3S9W A;  5TSS A;  2AQ3 B;  4NPS A;  3S2D B;  4PZ8 A;  3I4M G;  2LKV A;  1FL0 A;  4TQU S;  1I3Q B;  3H3V C;  1GKH A;  3R2T A;  1PRT C;  4WOR A;  2BH2 A;  1AP0 A;  3BDO A;  4G4K A;  4AQY Q;  1JE5 A;  4DV0 Q;  2NVQ H;  4A3C G;  3HGB A;  3T16 A;  4NMZ A;  2EYF A;  3AU7 A;  5C4X G;  2Z6K A;  1H9S A;  3S1M H;  3BU2 A;  1V8Q A;  2JQO A;  5CV9 A;  5IP9 H;  3TN2 A;  4JI8 Q;  1TXY A;  2AKW B;  4L5T A;  3MFY A;  4RGO S;  2Z1C A;  1KNA A;  1X65 A;  1ET9 A;  4X3K A;  1N8R C;  1EYD A;  1Y1V B;  4A3D H;  3W1B A;  4DNR B;  2F0O A;  3CCJ A;  2VY3 A;  3IAY A;  1CQV A;  4KHZ A;  4YCU A;  2KCT A;  3A8K E;  4DNI A;  3OMG A;  2N3S A;  2RKS A;  3GTM H;  4A3J B;  2LSS A;  3J7A 5;  1VQP A;  1YIT A;  4B3R L;  3PUV A;  3NEN A;  4JI5 Q;  4XXE A;  4MHE A;  2D5D A;  5IYB H;  3M4P A;  1Q3L A;  2PI2 A;  1WCM H;  2F0P A;  4BA2 I;  4X62 Q;  2DUD A;  3HKZ E;  4CDD C;  4RGM A;  4LF5 L;  1JB3 A;  1EY4 A;  4DA2 A;  2HIV A;  3NQT A;  4DPG A;  4Q5V A;  2GVB A;  1SJH D;  5IP7 H;  4P73 A;  3QIA A;  4ULL A;  2UXC L;  3BVZ A;  1C7Y A;  3UE0 A;  3I2Z A;  2PO4 A;  3MFG A;  1HR0 W;  1B50 A;  1B9N A;  1HA5 A;  2MGS A;  1PFM A;  4YWK A;  3VR5 A;  4N9T A;  1NSN S;  5FLX E;  2M2L A;  2PCF B;  2A73 B;  4HIK A;  1PMR A;  1QZG A;  1FGB D;  1R9T B;  2Q2U A;  3GTL H;  4MNO A;  3S17 B;  2KEC A;  2VZA A;  3CCU A;  1OXX K;  1KLU D;  1QB5 D;  3PUY A;  4YCV A;  1WTX A;  1IL2 A;  1ENF A;  2B2T C;  2XIW A;  1N36 Q;  2ZJR A;  3K5L A;  3NSW A;  5AJ3 Q;  2ZM6 L;  4JOI A;  3K7A H;  2BE5 D;  1CKO A;  1G2S A;  1LTI D;  3T1H L;  3HOW H;  3PO3 H;  4BY1 B;  2E2H H;  4KK7 A;  4YY3 L;  1CHP D;  2JP1 A;  1AN8 A;  2WV6 D;  4RH6 A;  4ALP A;  1S3O A;  2VB2 X;  1C4Q A;  3CQZ B;  1ICW A;  2OXP A;  4R9W A;  4IOA A;  1NJI C;  3ZJY C;  2DNC A;  3FKI H;  4LF6 Q;  1PYS B;  3K5O A;  4A3E G;  4QQB X;  2L1B A;  2E74 C;  3L9A X;  1VS0 A;  1X56 A;  3CMA A;  4QB4 A;  4EQ5 A;  1D2B A;  1F2Z A;  2OWO A;  1RCV D;  5C0X G;  2SEB D;  3VYS A;  3GD7 A;  5I6Y A;  1YNN D;  3SGI A;  1B3Q A;  1DYQ A;  3NEM A;  3C1F A;  4A3G B;  3ERO A;  3K6O A;  4B3T Q;  3F2C A;  1XPR A;  3M4Q A;  1YEZ A;  4M1U B;  2A5H A;  1PDQ A;  4K5X A;  1O7I A;  2JA8 G;  4O42 A;  1LT5 D;  3HOZ G;  4AYB G;  2K50 A;  1DON A;  5D3I B;  1MKH A;  4L5S A;  3H3V I;  2XRS D;  5C4J H;  3HOU B;  3S1Q B;  2TSS A;  2RCN A;  4RAU C;  2Z9H A;  4KN4 C;  2JA6 B;  1B2T A;  2NYZ D;  1LTT D;  3K0X A;  5GAE C;  3PF5 A;  2PZU A;  4RKB A;  1II3 A;  4JI7 Q;  1VQ8 A;  4KD3 A;  3D4R A;  3AFQ A;  1NR2 A;  4NB3 A;  4J15 A;  1G51 A;  1LTR D;  3BDC A;  3GDE A;  3KYH C;  4IQZ A;  1ILQ A;  1BR9 A;  5FLM H;  3Q23 A;  1JOK A;  3HG9 A;  1PV4 A;  5M3F H;  1AZP A;  1WFQ A;  1D1I A;  3SK8 A;  1YJN A;  2J4X A;  2PI2 E;  3EFX D;  5ELN A;  4F87 A;  4A93 G;  1PTO H;  3MXN B;  2LXJ A;  2D9U A;  3A8I E;  3S1N H;  2CFM A;  2L11 A;  2A6H C;  5EGT A;  4HJA A;  2IL8 A;  3PO2 G;  4A3L G;  1UAP A;  1I50 B;  4KTA A;  1B4O A;  4A3F B;  4DV4 L;  4JBM A;  1IBL L;  1CK1 A;  4R4C A;  5I2X A;  1E24 A;  4AIM A;  1T5E A;  1OTC A;  4YY3 Q;  1BVS A;  3NBH B;  4DKA C;  1N34 L;  4JI2 L;  1SDF A;  3ND8 A;  3IRB A;  3VR6 A;  2RVL A;  1SNQ A;  2NVT B;  4HAE A;  1K73 C;  1SR3 A;  3CME A;  3A8J E;  4PG3 A;  2EYH A;  2I46 A;  4HED A;  4JI1 Q;  1IBK L;  2GVA A;  1PYB A;  3T51 B;  3H15 A;  1WTO A;  3DEP A;  4F7X A;  3KLR A;  2RCF A;  1LAC A;  5M5X H;  2JA7 B;  2X69 A;  1KRS A;  4K14 A;  4ZQ3 A;  3ULP A;  2WB1 G;  1B9M A;  4B9W A;  1B1Z A;  1G2T A;  1EWI A;  4CDC C;  1HHV A;  1EEI D;  5LL6 S;  2UUC Q;  1GJX A;  4DK1 A;  1O78 A;  4LF9 Q;  1BCP D;  2NN6 I;  4H0L C;  2NZ1 D;  1QUQ A;  3ULL A;  1I6H B;  3J80 E;  3DWQ A;  4A3M B;  1Q8K A;  1S5D D;  2K01 A;  1H9K A;  1V1P B;  2DJG C;  3GTK H;  2OCE A;  1SNO A;  2J7Z A;  1GUN A;  2OTL A;  1GHJ A;  1FYC A;  2HDL A;  1QJO A;  5JEA J;  4K5W A;  2JEA I;  2F0V A;  4DR2 Q;  2EJF C;  5C4H A;  3M4O B;  4QCL A;  1STH A;  1L2F A;  3KF6 A;  5FO8 B;  2VUM G;  1QIL A;  5D14 A;  3M3Y H;  1L0W A;  1WTR A;  2P5Z X;  2RQX A;  1L0X B;  5EPK A;  3HOV G;  4XTC S;  3A7L A;  3KDF A;  2Y0S B;  2MP1 A;  1EY5 A;  1PFS A;  2F0Q A;  1SLJ A;  1X9N A;  1WTQ A;  1LTL A;  1EIG A;  3CAM A;  1F9Q A;  2PMZ B;  2B63 H;  5LMN Q;  1I4Q A;  1P8L A;  2KA7 A;  4YHH Q;  3NTH A;  2K7V A;  2L9H A;  3I8Z A;  1HQM C;  2JE6 I;  4BBR B;  2A68 D;  4LF4 Q;  3HP3 A;  2ZT9 C;  5DEH A;  4DV7 L;  2R92 B;  1PH9 A;  1IZ6 A;  1C9O A;  3HFZ B;  1L1O C;  3EN2 A;  2LMC B;  1E1O A;  5K36 G;  4KLK A;  3CCQ A;  2F0I A;  4CJ2 C;  4A3I G;  1PYW D;  1SAP A;  3LWE A;  4GN4 B;  3I3C A;  2H1E A;  4HSP A;  1IBL Q;  2G9D A;  4LF7 L;  1PH6 A;  4FVM A;  3RNU A;  1F2M A;  1G91 A;  4S3S A;  3UDF A;  2N55 A;  1D6E C;  1O7Z A;  1S5B D;  1XJV A;  1RDP D;  3K7U C;  4OL7 A;  4KY7 A;  3F8T A;  2MHV A;  5C44 B;  3X3N A;  2B39 A;  2R93 H;  4NKL A;  3TP6 A;  2JYO A;  4RGT A;  1VQ6 A;  4JI0 L;  4C3I G;  3H3V H;  3P20 A;  4DR3 Q;  1PFN A;  1WTV A;  1DM0 B;  1CI3 M;  3NTI A;  2EIF A;  2PZT A;  3F1Z A;  1N32 Q;  5L37 A;  1EU3 A;  2MNA A;  2A6E D;  4CDE C;  3PGZ A;  2EY1 A;  1UEB A;  4OHJ A;  4BXX H;  1J6Q A;  2BDN A;  2E76 C;  4ZKC B;  1VQF A;  3NTK A;  4BY7 B;  1ROD A;  3P1H A;  1MSH A;  3RUZ A;  4Y7N H;  1K83 H;  5M3M H;  5HY6 A;  2WII B;  2R7Z H;  3TS0 A;  1A0I A;  4IN3 A;  3STB D;  2PQA A;  1HCZ A;  4PMC A;  1NY4 A;  1TS5 A;  4KY5 A;  4RA8 A;  2NVQ B;  3QG1 A;  5KYI A;  4QUF A;  3CKI B;  1S72 A;  1PTO D;  2D0O A;  4DR4 L;  1RIP A;  3S1M B;  4R4Q A;  4K5V A;  5FJ8 H;  1U4L A;  4K8J A;  4AYB E;  3F2D A;  3KK7 A;  3HRZ C;  3HOU G;  4AH6 A;  4UY8 C;  1EQR A;  4V0B A;  1TS2 A;  4TSS A;  3SK4 A;  2EZV A;  1STY A;  5JEA G;  2PYK A;  3PMF A;  3L0O A;  5G3L F;  2KHJ A;  3K5M A;  4I7Z C;  4OON A;  4KY6 A;  4A3D B;  1Q81 C;  1QE6 A;  2K6A A;  1X6O A;  2E2I H;  1HXY D;  1E2Z A;  1Q8I A;  4J6H A;  4GKJ Q;  1S5C D;  2OQ0 A;  2YU9 B;  4LWC A;  1SRO A;  2RA4 A;  4X6A H;  1EYG A;  3OSO A;  1T5X D;  1TII D;  3G7L A;  4EQN A;  1PZI D;  2Z0S A;  2ES2 A;  1X32 A;  5JAV A;  3A55 A;  4DV7 Q;  2F0T A;  5E7N A;  4H7B A;  1ESF A;  4ZUI A;  3FRP B;  1VQI A;  2M00 A;  3WWV A;  1M1K C;  1PRT F;  2XN9 C;  2NN6 H;  3V96 A;  4LF7 Q;  2SDF A;  2LY7 A;  4QIW B;  4ZKB B;  2ASB A;  1EY9 A;  1Y8N B;  1XYI A;  1Q1B A;  2E5L Q;  1BCP B;  4A3B G;  1GUG A;  2HQL A;  2RBM A;  4PZ7 A;  1DGS A;  4IUP A;  4JI4 L;  5J1Z A;  4OO1 G;  3F2B A;  1X3P A;  1C8C A;  1IKM A;  3TP7 A;  2QF7 A;  4ILW A;  1IYV A;  5LMN W;  3S14 B;  2HT1 A;  3GTL B;  4DR1 Q;  4IUT A;  1MBY A;  3C3L A;  3HOY G;  1OXV A;  1CHQ D;  5C4Z A;  3S16 H;  3ERQ A;  3S15 H;  4G57 A;  1O7L A;  3U4V A;  1HA6 A;  5DLQ E;  4OGQ C;  1EZ8 A;  3URY A;  1CKM A;  3E9H A;  4HJ9 A;  2WB1 E;  1SJE D;  2DNE A;  1SE8 A;  2XTI A;  3B6Y A;  3K7A B;  3QJY A;  4A3M G;  1FJG Q;  1Q46 A;  3HOW B;  2EYJ A;  3TZD A;  1FNW A;  1D5Z C;  4A3K G;  1E7Z A;  3Q22 A;  2JA5 H;  2RDH A;  1G8Z D;  3PV0 A;  5M5Y H;  1HH2 P;  3DMU A;  3AEV A;  4H13 C;  4ZYS A;  4B3S L;  1NTG A;  1XMQ L;  1JB7 A;  3NUC A;  2EXZ A;  1M8A A;  4JI3 L;  4DR4 Q;  2XSC A;  2QCP X;  4O1N A;  4X66 L;  2EQS A;  1E2W A;  4A4I A;  3MXN A;  4N8X 1;  1XNR L;  2F0M A;  3MC0 B;  3FKI B;  3TP5 A;  3EIV A;  5I6W A;  3TRZ A;  3A56 A;  1PVO A;  2RHQ B;  2QDB A;  2CCZ A;  4KKS A;  3RZO H;  1R4P B;  1HRJ A;  3KFU A;  1ONL A;  2KCN A;  2NVY H;  5GAG C;  1SRU A;  4M8A A;  4YWM A;  3FPP A;  4G7H C;  5CV4 A;  2BA0 A;  5C0X I;  1ZKO A;  5IGE A;  1FD7 D;  2ATW A;  2R7D A;  5IYD G;  4H02 A;  1Y8P B;  1Y1W H;  3KJO A;  2CHB D;  1JE4 A;  5DM7 3;  1JWU D;  1NR4 A;  4NXM Q;  4XT3 B;  2BA1 A;  4YWL A;  1PA6 A;  3T13 A;  2UXB Q;  4EVO A;  2VQF L;  3KLW A;  3HS0 C;  4HMJ A;  2AWO A;  4HID A;  4LAA A;  4CHT B;  3C46 A;  2CQA A;  4L6T B;  1V43 A;  2B2V A;  3UDX A;  1CFM A;  3M85 A;  1A6X A;  2SNS A;  4X64 L;  1VQC A;  4JI4 Q;  4GKK L;  2G9H D;  3I4M H;  3GO5 A;  1AE3 A;  3TZU A;  3MXU A;  1X3G A;  1EQQ A;  2KHS A;  3T1Y L;  3SHL A;  2D62 A;  2AUK A;  3HZX A;  1TWC H;  1K8G A;  5M3F B;  1CT1 D;  1BO0 A;  4A3C H;  5C4X H;  1VQH A;  5IGF A;  3A0J A;  1PTO B;  4DAY A;  3S1N B;  5CV6 A;  2JXM B;  4G7O C;  1IBM Q;  4UAI A;  4CKE A;  4BY7 G;  1U9R A;  3EVQ A;  1F9S A;  2LFN A;  1KAA A;  2YTY A;  5H1S E;  5C0X J;  5IY0 A;  3H0G G;  5EBD A;  2EE1 A;  3I4N G;  5BN3 A;  1VQK A;  4KJN A;  2E2D C;  3H6M A;  1UUP A;  4UDU C;  3KF8 B;  2K05 A;  4A76 A;  4Y52 H;  3GTO H;  1SE2 A;  2N88 A;  2VL6 A;  4DR6 L;  2R6G A;  4X65 L;  1U0L A;  3M4Y A;  1VQD A;  5M5X B;  4IPG A;  4K6L A;  3JC6 6;  3QOL A;  5JPN C;  4IFD J;  2MQH A;  3SK6 A;  2F0G A;  4NDX A;  1LM0 A;  4H44 C;  2UUA Q;  1E22 A;  5IWA Q;  4J1M A;  1KDA A;  2CVR A;  1MGS A;  5BR8 L;  1PZK D;  1GD7 A;  2MO0 A;  1H9M A;  3EBE A;  1Y69 U;  4QJF A;  4KV6 A;  2NB0 A;  1EY0 A;  5J3B A;  3Q24 A;  3GTK B;  1B44 D;  3PUW A;  1X3Q A;  4J8Q A;  4GN3 B;  5IYC H;  2HIX A;  1HTL D;  4ID6 A;  1TWF B;  4APV A;  1KQS A;  4X3T A;  1SXT A;  1F9R A;  5LL6 X;  3OIP A;  3V2T A;  1UEA B;  4PV1 C;  1I6V C;  2F0D A;  4RHR A;  3GTJ H;  2QKI C;  2Z6B A;  2WAQ G;  5IGB A;  3I55 A;  3CD6 A;  4EQP A;  1VQ5 A;  2A69 C;  1JWS D;  3JAM c;  3E9I A;  1PXU A;  1QVF A;  5J39 A;  2R61 A;  1CM9 A;  4R4I A;  4HMI A;  1TY2 A;  2CKZ B;  3MVV A;  1JJC B;  4TKO B;  1CZG A;  5ELE A;  1IW7 D;  3E6Z X;  1AZQ A;  2LS0 1;  5EQ0 A;  3Q0A A;  4DR7 L;  1GXD C;  3AQQ A;  1TWA H;  1CKN A;  1JMC A;  1B7Y B;  1Q1E A;  1D8L A;  2QEX A;  1X3F A;  3NEL A;  2N49 A;  2XWJ B;  4RGN A;  1G6P A;  4A3E H;  2F0S A;  4WJ3 M;  4QF4 A;  5LMU L;  3A7A B;  1OO9 B;  2F03 A;  2B29 A;  4LW1 A;  4RFB A;  2KEN A;  5C0X H;  4HJ5 A;  1I4X A;  1U4R A;  2QIL A;  3EJI A;  3SK5 A;  4B3M L;  1JT8 A;  4RHS A;  3GTP H;  1CSP A;  2R93 B;  3QR8 A;  4U68 A;  3VR2 A;  1D5X C;  1JWM D;  2Z6K C;  1FGU A;  4DUZ L;  2CWP A;  2JA8 H;  2MFI A;  1LAB A;  3FMC A;  5M9O A;  1STG A;  3HOZ H;  4B3R Q;  3J81 j;  3MXG A;  3DEO A;  5KGU A;  1EIY B;  1N9W A;  4OWW B;  3OWE B;  2BE5 C;  3J80 i;  4LF5 Q;  1TR5 A;  2A6H D;  1Z6H A;  3NWT A;  3IL8 A;  3HOX G;  4P75 A;  3JAM L;  3A54 A;  4GLX A;  3S1R H;  3RZD H;  1WTW A;  4Y7N B;  3OTO L;  1F2L A;  1K83 B;  1R4Q B;  1SE4 A;  5M3M B;  2UXC Q;  2SOB A;  2R7Z B;  1KLG D;  4O0A A;  3CPW A;  4Q0F A;  1VQG A;  3ITP A;  5DAU A;  5GRO A;  4KHP L;  4GOP A;  1VQ7 A;  3L3O C;  3GTQ H;  1RKN A;  4IFD G;  1SYC A;  3BYY B;  3P75 A;  5EBC A;  3IKJ A;  4YCW A;  5C3E G;  1EOT A;  5IT9 c;  1YVC A;  4BBS G;  3CHB D;  4GLV B;  1Q12 A;  3X3M A;  3K59 A;  4A93 H;  3MXP A;  3HKZ B;  5HGQ A;  4A3L H;  1SND A;  3PO2 H;  1KC8 C;  3J7Y W;  4L63 B;  3O13 A;  2DJF C;  4DV6 L;  2OQK A;  2ZM6 Q;  2J0T D;  1YNN C;  1J8I A;  1DOK A;  2E2I B;  3T1H Q;  3OOC A;  3TSS A;  1LTA D;  3U9S A;  4EX5 A;  4WRD A;  1HUN A;  2UXD L;  5CGK A;  2EJG C;  1VQA A;  1JC7 A;  1S5F D;  3LX0 A;  2AMC B;  1A2U A;  4HJ7 A;  4DR7 Q;  1Q7Y C;  5C5M A;  1WI5 A;  4YIJ A;  3CC4 A;  2K32 A;  4GNX A;  1GHK A;  3UDG A;  2GN5 A;  3SR1 A;  1HFN A;  4ZUJ A;  4JOI C;  5JJI A;  4KD4 A;  3FHW A;  3Q6S A;  1XTC D;  5JJZ A;  2ICI A;  4RMF A;  2L4N A;  2JK8 A;  3PUZ A;  2F3V A;  4FNF A;  5FO7 B;  4DXF A;  4LK1 C;  4C3J B;  2G5D A;  3VR4 A;  1JOQ A;  4LMQ D;  5C6A A;  3TQY A;  1Y1V G;  2YYZ A;  4K6D A;  5C5L A;  1SMX A;  4B3M Q;  4LFB L;  3D3R A;  2AWN A;  1K8M A;  5IT9 L;  1I4G A;  1WYD A;  4LFC L;  4WJ4 A;  1VQJ A;  1WOC A;  2VB3 X;  4DUZ Q;  3NK9 A;  1TWG H;  4OO1 I;  2D0P A;  1EWH A;  4A3J G;  1I94 L;  2IWH A;  5JPM C;  1VF7 A;  1GUT A;  3DUZ A;  4C3H B;  4LF8 L;  3S16 B;  3M7G A;  3S15 B;  1KAW A;  5AFW A;  5A2Q L;  2EPB A;  1D7Q A;  4ZLT F;  5JVH 3;  3ERS X;  3H09 A;  4TRD A;  1A8V A;  3KBG A;  1IKL A;  2VUM H;  1B53 A;  1BUV T;  2EOT A;  3PIP A;  1JIC A;  1NMG A;  4P74 A;  3OPO A;  4ZCK A;  2F3I A;  1V9P A;  3MAQ A;  3HOV H;  1NBW A;  1SNC A;  3E5S A;  1U4M A;  1HNZ L;  4KHP Q;  2C9O A;  2K5Q A;  2JA5 B;  4DV1 L;  2KCC A;  4XQQ A;  4FF2 A;  2X6G A;  2VQE L;  3I70 A;  3W1G A;  1H9S B;  1FR3 A;  5ELO A;  2Z4H A;  1XPO A;  1LT6 D;  1QCB D;  1SMY D;  4KJO A;  2A74 C;  1A2T A;  1JJ2 A;  4IUQ A;  5K36 H;  2Q8R E;  4A3I H;  2ZJP A;  5FO9 B;  4DV6 Q;  1QG7 A;  3PQI A;  3KUP A;  4Z9C B;  2ICE C;  1A63 A;  4BWG B;  1KL9 A;  1TT2 A;  5EJW A;  4GOP C;  3KJP A;  1EQV A;  4ZK9 B;  4DV4 Q;  4K0K L;  2CH4 A;  2ALY B;  2WAQ E;  3MZ5 A;  5EKK A;  1F77 A;  2KEE A;  2CW0 C;  2NVY B;  3J7A F;  4NXN L;  4EQO A;  5IIF A;  1EY8 A;  4BY1 G;  1WD1 A;  1FNV A;  2FIN B;  1N34 Q;  4DR5 L;  1ASY A;  4JI2 Q;  4PNY A;  4IUR A;  4I65 A;  3KF8 A;  3A74 A;  5KNB A;  4V19 0;  4C3I H;  1U4P A;  1YJW A;  1Y1W B;  4POG A;  4BA1 I;  1EL0 A;  4IZ8 A;  2NUC A;  1LT3 D;  1IBK Q;  1K8O A;  1VQL A;  3VR3 A;  1A3T A;  2KED A;  1K0S A;  1TU2 B;  3VYR A;  3IFT A;  2ID0 A;  3CU7 A;  3HKS A;  3J81 c;  2RSO A;  1XTD A;  1HNX L;  3FPU B;  1O80 A;  2OTJ A;  4RG1 A;  2Q2T A;  3I4M B;  4R8N A;  1YNJ D;  1STB A;  3CC7 A;  4LFC Q;  2A68 C;  4GNX C;  4R1J A;  2CQO A;  2DY7 A;  2NTT A;  4MZ9 A;  1I94 Q;  4IPD A;  4A3G G;  3E0J A;  1Z7T A;  2R7F A;  1SFO H;  1M4V A;  4ZAI A;  2R3Z A;  3HOU H;  2DN8 A;  3ND9 A;  5ELD A;  2KHI A;  5M5W H;  3QB3 A;  1ENA A;  5E4X A;  4DV5 L;  1HR0 L;  4DK0 A;  5JEA H;  2JA6 G;  2QA4 A;  3PIP 3;  5IGD A;  4KMU C;  1KTK A;  5D3D A;  4DAM A;  2VQE Q;  4UP7 A;  1RF2 D;  2ZTD A;  3MHB A;  3GTO B;  2E2J H;  4K2K A;  2QW7 A;  5BN4 A;  3GTM B;  5E1F A;  3G4S A;  5HUR A;  4OWT B;  1YHB A;  3CCR A;  2PZW A;  3BVM A;  4NW2 A;  4B08 A;  3HKZ G;  1T9H A;  1QNK A;  2K52 A;  3J81 L;  1MJC A;  4JBJ A;  3V05 A;  3NP8 A;  1WCM B;  1WJJ A;  4DV2 L;  1AFP A;  4DF7 A;  1HZB A;  4P72 A;  3H94 A;  2ZXR A;  4L5Q A;  4A3F G;  1VQB A;  3I73 A;  3NBI A;  5I4D A;  1YIJ A;  1PLF A;  3SXH A;  3AYH B;  3LGJ A;  4A3B H;  3G71 A;  2IJ0 A;  3NQI A;  1XMO L;  3BG3 A;  5J22 A;  4OO1 H;  3BZK A;  1QNU A;  2NVT H;  1DCZ A;  3DM1 A;  2L5T A;  1B70 B;  3R3O A;  5I9P A;  1ZEQ X;  2F3W A;  1W6J A;  1GUW A;  4IUN A;  4JI0 Q;  3HOY H;  2K75 A;  3GTG H;  5F2D A;  4IOC A;  1Y14 B;  4LUV A;  5NUC A;  1KD1 C;  2NTS A;  4XIG S;  4HSV A;  1ZXT A;  4O2D A;  1SSO A;  2V4D A;  2PNH A;  2KQ3 A;  1QVC A;  4XYO A;  4C1N I;  1G6Z A;  3W3A A;  3D6W A;  2JA7 G;  1L1O B;  1VQ4 A;  2K1B A;  5CV8 A;  4C3J G;  5CC4 A;  3GTJ B;  2EXD A;  2PNR C;  3PCO B;  4A3M H;  1D1K A;  1GUS A;  4KKT A;  3EQL C;  3AFP A;  3D4W A;  1Q82 C;  1QVG A;  1ET6 A;  4UP8 A;  4DUY L;  4A3K H;  3K5N A;  2JSO A;  4X3S A;  3PO3 B;  4K8I A;  2A8V A;  2E2H B;  1M90 C;  2PPB C;  2IY5 B;  3GV6 A;  4AQY L;  4DV0 L;  2NZO A;  4JCV E;  2JJQ A;  4C3H G;  4FF4 A;  3RLN A;  5COR A;  1VCI A;  3M4O H;  1V1O A;  5BN5 A;  2ZXO A;  5EKI A;  5IE8 A;  4P2C B;  2HHH L;  5EKL A;  2IHF A;  1I4P A;  4JI8 L;  2F52 A;  5G3L D;  4A3E B;  1ESR A;  2EY6 A;  1HUM A;  2K14 A;  5T1I A;  3I56 A;  1LUZ A;  1HZA A;  1DXM A;  3DXJ C;  4MN3 A;  3ICE A;  1WTH A;  2Y0S G;  1YNX A;  1ZYR C;  3CPF A;  3L7Z C;  2HCC A;  3WDN A;  2EYL A;  3Q8D A;  1EFI D;  3NWS A;  1DOL A;  3N6R A;  1UE7 A;  3GTP B;  2O2L D;  3PSI A;  3NBH A;  1ICF B;  3R2I A;  3NHH A;  1XX8 A;  2IX3 A;  2IHE A;  2H4O A;  1KDC A;  5IYD H;  4BBR G;  2F0W A;  1GO3 E;  2JA8 B;  4DAV A;  4JI5 L;  3DWP A;  4CJ0 B;  1JOO A;  1PRT D;  3HOZ B;  4AYB B;  4OX9 L;  2R92 G;  1LYL A;  4JPB W;  2K4K A;  3G6E A;  1WVL A;  3E3X A;  2F0F A;  4G7Z C;  4POF A;  2WKC A;  5C4J B;  1I5F A;  2F0U A;  5CV7 A;  3RZD B;  5ELC A;  1HTP A;  1PH8 A;  3J7Z C;  5ELF A;  1RHP A;  2AQ1 B;  2VW9 A;  4HR7 B;  1TS3 A;  4EGV A;  1VQN A;  3GTQ B;  1A3V A;  3TS2 A;  4KKU A;  2PQE A;  2HUG A;  1RJT A;  1BBU A;  2B2W A;  5C44 G;  1XPU A;  1EY7 A;  1B8A A;  2L0C A;  1V1P A;  4FXK C;  4I7A A;  4IFD I;  1GUO A;  5ELB A;  2ZXP A;  4A93 B;  2B8G A;  2F0L A;  4DK3 C;  3HEJ A;  2ZTC A;  2HDM A;  5C3W A;  2ENB A;  3IFD A;  5JVG 3;  4BY7 H;  3BVG A;  3KDF B;  1LLR D;  3H0G H;  3C2P A;  4DUY Q;  1NE3 A;  3I4N H;  1HNW L;  4F8M A;  1O7Y A;  3PUX A;  2NVX H;  4XT1 B;  1TVX A;  4FO2 A;  5LHY 1;  4X3U A;  4B3S Q;  3PF4 A;  4DN4 M;  1XMQ Q;  3RLO A;  4OXP A;  1G29 1;  4JI3 Q;  2K28 A;  5KIX A;  4X66 Q;  2HHH Q;  4F88 A;  1MHW C;  3OYY A;  2RHS B;  4OEM B;  4LF6 L;  4CGY B;  1XNR Q;  2WB1 B;  2DGY A;  5IP9 G;  1RD9 D;  4DXG A;  3JAM i;  1PH3 A;  2PW5 A;  1PH2 A;  1BXT A;  2IT1 A;  2JN4 A;  2FJ2 A;  4RCN A;  4IJL A;  4CDF C;  2XVS A;  1VF5 C;  4TVA B;  2F4I A;  2YU9 H;  5GAD C;  4HCE A;  4A3D G;  4DU9 A;  5FLX c;  2A69 D;  2C35 B;  4IJH A;  4OIK A;  2JA9 A;  3MEH A;  2QEJ C;  5D65 A;  3UI2 A;  4B3T L;  1SYE A;  1TWG B;  2HCI A;  1GVP A;  2D2C C;  4C2M H;  1JR0 D;  1NAP A;  4OX9 Q;  1EIF A;  4QUC A;  1PZJ D;  2AHO B;  3L2P A;  2K5H A;  4IUU A;  5IYB G;  3CCE A;  1WCM G;  2VQF Q;  2VUM B;  1BF4 A;  5KRU A;  5COY A;  3FP9 A;  3MA2 B;  3I72 A;  1MD2 D;  3HOV B;  1UNS A;  1CA6 A;  3M3Y B;  4UP9 A;  2EY5 A;  1FVI A;  1LTS D;  3M7N A;  1SNM A;  5IP7 G;  4JG2 A;  4JI7 L;  2PQA B;  1S4Z A;  4X64 Q;  4C56 C;  5I2Y A;  4HJ8 A;  4GKK Q;  2XRQ D;  4E6I A;  3OW2 A;  3K81 C;  3BYT B;  1FNU A;  1W2B A;  1VQ9 A;  3S14 H;  3T1Y Q;  1K3R A;  1A3U A;  5EAY A;  4L5R C;  2B63 B;  3T4A C;  1SYB A;  5IYC G;  1QZH A;  4HCS A;  3TEH B;  4HTH A;  1AE2 A;  1PH7 A;  1KNE A;  4KHV A;  1YJ9 A;  4FP5 D;  1STN A;  4A3I B;  2B2V C;  5DNF A;  1Q86 C;  2K33 A;  4LUZ A;  1UE6 A;  3FVQ A;  1TWH H;  2A19 A;  3CCM A;  2K5D A; 
#chains in the Genus database with same CATH homology
 4OO1 I;  2D0P A;  3S2H H;  5JEA G;  4A3J G;  1I94 L;  1P16 A;  3L0O A;  1V1Q A;  2CWA A;  2Q2I A;  2I0Q A;  2KHJ A;  5JJL A;  4QL5 A;  1Y1W G;  4OON A;  2BH8 A;  1HNW Q;  4LF8 L;  1Q81 C;  2E2I H;  1KAW A;  1X6O A;  3HOW G;  3PO3 G;  3RN2 A;  4GKJ Q;  1D7Q A;  2OQ0 A;  4DK6 C;  1A62 A;  3ERS X;  4LWC A;  1SRO A;  2N8N A;  4GLA C;  3KF6 B;  1A8V A;  1N33 L;  2VUM H;  4X6A H;  1EYG A;  3BZC A;  2FXQ A;  2Q2H A;  3PIP A;  2ES2 A;  2Z0S A;  1NMG A;  1NMF A;  3K8A A;  4P74 A;  3K80 C;  4DV7 Q;  2F3I A;  1V9P A;  1N36 L;  3HOV H;  1NBW A;  5E7N A;  4JI1 L;  5AJ3 L;  4DR6 Q;  1EOV A;  2YTX A;  1VQI A;  4NPS A;  4X65 Q;  1IXR A;  1HNZ L;  4KHP Q;  4PZ8 A;  3I4M G;  2JEB I;  3WWV A;  4DV1 L;  3S24 A;  1M1K C;  1FL0 A;  4TQU S;  2VQE L;  1GKH A;  3FKI G;  4LF7 Q;  2UUC L;  2BH2 A;  2L15 A;  3HOX H;  4LF9 L;  3G48 A;  4AQY Q;  1JE5 A;  3W1G A;  4DV0 Q;  2NVQ H;  2ASB A;  4A3C G;  5ELO A;  1Q1B A;  2E5L Q;  1KRT A;  5C4X G;  4OWX B;  2Y0S E;  1XPO A;  2Z6K A;  2HQL A;  4A3B G;  4PZ7 A;  3S1M H;  1DGS A;  3BU2 A;  1JJ2 A;  4JI4 L;  5BR8 Q;  2JQO A;  2PMZ E;  3F2B A;  4OO1 G;  1ASZ A;  4A3I H;  5IP9 H;  2ZJP A;  4JI8 Q;  4DV6 Q;  1TXY A;  2AKW B;  4A75 A;  1A63 A;  3CCV A;  4L5T A;  1KL9 A;  5LMN W;  4GOP C;  2HT1 A;  5C3E H;  3KJP A;  4DR1 Q;  4DV4 Q;  3HOY G;  1X65 A;  4QY7 A;  4BBS H;  4K0K L;  1OXV A;  2ALY B;  2WAQ E;  1N8R C;  4DR2 L;  4A3D H;  3W1B A;  3S15 H;  3S16 H;  4NXN L;  1HZC A;  3U4V A;  4BY1 G;  5DLQ E;  3CCJ A;  2YTV A;  2VY3 A;  4HIM A;  1N34 Q;  4DR5 L;  2I5H A;  1CKM A;  4KHZ A;  3E9H A;  4YCU A;  2KCT A;  3U4Z A;  2WB1 E;  1L1O A;  4JI2 Q;  3W5O A;  4DNI A;  4HJ9 A;  1AH9 A;  2N3S A;  4PZ6 A;  3A74 A;  1VQO A;  1SE8 A;  3GTM H;  3CCL A;  4C3I H;  2LSS A;  3J7A 5;  3ULJ A;  1VQP A;  2XTI A;  3B6Y A;  1YIT A;  1YJW A;  4A3M G;  1FJG Q;  1Q46 A;  4POG A;  1CSQ A;  4B3R L;  3PUV A;  3NEN A;  4BA1 I;  4JI5 Q;  1K8A C;  4KI0 A;  3S2D H;  5IYB H;  1IBK Q;  3M4P A;  4A3K G;  5LMN L;  1E7Z A;  2PI2 A;  1VQL A;  4FDB A;  2JA5 H;  1WCM H;  3PV0 A;  1HH2 P;  5M5Y H;  4YHH L;  4X62 Q;  2QGQ A;  4BA2 I;  5JJK A;  2DUD A;  3HKZ E;  4LF5 L;  1I3Q H;  5FLM G;  3AEV A;  4LFA L;  2ID0 A;  4B3S L;  1NTG A;  2HIV A;  1XMQ L;  4LF4 L;  4DPG A;  1JB7 A;  3HKS A;  5M3F G;  2GVB A;  4JI3 L;  5IP7 H;  3J81 c;  1XTD A;  4P73 A;  1HNX L;  4GS3 A;  4DR4 Q;  2NZH A;  2UXC L;  2OTJ A;  4RG1 A;  4X66 L;  2Q2T A;  1C7Y A;  1SN8 A;  3UE0 A;  4LNQ A;  2EQS A;  3I2Z A;  1HR0 W;  3CC7 A;  4A4I A;  4YWK A;  4LFC Q;  1XNR L;  4GNX C;  4R1J A;  2CQO A;  3EIV A;  4MZ9 A;  2A1A A;  4HIK A;  4JI6 L;  1I94 Q;  4IPD A;  3TRZ A;  1QZG A;  4A3G G;  1PVO A;  2RHQ B;  1Z9F A;  2Q2U A;  3GTL H;  2CCZ A;  5LMU Q;  2R7F A;  3RZO H;  3J80 c;  4MNO A;  1SFO H;  3KFU A;  1Y1V H;  3UDI A;  1N33 Q;  2NVY H;  2VZA A;  5GAG C;  1SRU A;  3CCU A;  3HOU H;  4JV5 L;  4YWM A;  1OXX K;  2UU9 L;  3PUY A;  4YCV A;  1IL2 A;  2IX1 A;  3U50 C;  2KHI A;  5M5W H;  2BA0 A;  5C0X I;  1N36 Q;  2ZJR A;  5AJ3 Q;  4DV5 L;  2R7D A;  2ZM6 L;  5GQO A;  5IYD G;  4H02 A;  4JOI A;  4A3J H;  1HR0 L;  4DR3 L;  2QA4 A;  2JA6 G;  3K7A H;  1C0A A;  1Y1W H;  1UE5 A;  3KJO A;  1CKO A;  1N32 L;  3T1H L;  4NXM Q;  3HOW H;  2BA1 A;  4IPH A;  1E3P A;  4YWL A;  1PA6 A;  3PO3 H;  2UXB Q;  4DUZ Q;  2E2H H;  4DAM A;  2VQE Q;  4YY3 L;  3KLW A;  2VQF L;  4UP7 A;  1YHA A;  2AWO A;  3U58 A;  4HID A;  2ATW A;  2V1C C;  1BKB A;  2ZTD A;  1S40 A;  1V43 A;  3UDX A;  3M85 A;  2E2J H;  4ALP A;  1S3O A;  4X64 L;  3G4S A;  1VQC A;  1YHB A;  4OWT B;  3CCR A;  3OTO Q;  4JI4 Q;  4GKK L;  3I4M H;  3GO5 A;  1AE3 A;  1T9H A;  3HKZ G;  4IOA A;  4JYA L;  3CCS A;  1NJI C;  2K52 A;  1X3G A;  3ZJY C;  1J5E L;  1EQQ A;  1HZ9 A;  3T1Y L;  1MJC A;  4JBJ A;  3FKI H;  4LF6 Q;  2D62 A;  1WJJ A;  4DV2 L;  1PYS B;  1HZB A;  4P72 A;  1TWC H;  4A3E G;  4QQB X;  1K8G A;  4L5Q A;  4A3F G;  1VS0 A;  1R9T H;  1VQB A;  4A3C H;  1X56 A;  3CMA A;  4DAY B;  1TWF H;  1YIJ A;  5C4X H;  1VQH A;  4EQ5 A;  3AYH B;  3S17 H;  3LGJ A;  3A0J A;  2OWO A;  3G71 A;  4A3B H;  1X54 A;  4JC0 A;  5C0X G;  3J81 i;  3A5U A;  1XMO L;  3GD7 A;  3BZK A;  3SGI A;  1IBM Q;  2NVT H;  3NEM A;  4BY7 G;  1B70 B;  4R4O A;  4B3T Q;  5C0X J;  1PHJ A;  3F2C A;  2YTY A;  3M4Q A;  4QIW E;  5IY0 A;  5H1S E;  1YEZ A;  1XPR A;  3H0G G;  4JI0 Q;  3HOY H;  2UUB L;  2K75 A;  3GTG H;  4IOC A;  4R4T A;  1Y14 B;  1O7I A;  2JA8 G;  4LUV A;  3M9B A;  1KD1 C;  3HOZ G;  4XIG S;  4AYB G;  3I4N G;  4O2D A;  4BY1 H;  2I5M X;  2K50 A;  4GKJ L;  2PNH A;  3I4O A;  1MKH A;  1QVC A;  1VQK A;  4L5S A;  2XGT A;  2B63 G;  5C4J H;  3RR5 A;  3H3V I;  4LFA Q;  1PH1 A;  2JA7 G;  1L1O B;  2UXD Q;  2ZTE A;  4QGU A;  1VQ4 A;  3KF8 B;  2RCN A;  4A76 A;  4Y52 H;  3CP0 A;  2EXD A;  3GTO H;  3PCO B;  2VL6 A;  3K0X A;  5GAE C;  3PF5 A;  1GM5 A;  1HJP A;  4A3M H;  4DR6 L;  2R6G A;  1XNQ L;  4GN5 A;  2F4V L;  4X65 L;  3AFP A;  3CQZ H;  1VQ8 A;  1Q82 C;  3MEF A;  4JI7 Q;  1QVG A;  1U0L A;  4UP8 A;  4DUY L;  4A3K H;  1YI2 A;  3AFQ A;  1X3E A;  4NB3 A;  4J15 A;  1G51 A;  1VQD A;  4IPG A;  3GDE A;  4JI6 Q;  3KYH C;  2A8V A;  3UE1 A;  3JC6 6;  5FLM H;  1M90 C;  2ZJQ A;  2IY5 B;  4AQY L;  1PV4 A;  4IFD J;  4PMW A;  2NZO A;  2MQH A;  4DV0 L;  5M3F H;  4JCV E;  2JJQ A;  1WFQ A;  2E5L L;  1LM0 A;  3RLN A;  2WP8 J;  1YJN A;  2UUA Q;  1E22 A;  1VCI A;  2PI2 E;  5IWA Q;  5ELN A;  3PIO A;  3M4O H;  4JV5 Q;  4A93 G;  2UU9 Q;  5IE8 A;  5BR8 L;  3MXN B;  4LFB Q;  2HHH L;  1GD7 A;  1W3S A;  2LXJ A;  2MO0 A;  2IHF A;  3EBE A;  4JBK A;  3S1N H;  4QJF A;  2CFM A;  4JI8 L;  5J3B A;  3I7F A;  2F52 A;  4HJA A;  3PO2 G;  4A3L G;  1K0R A;  4A3G H;  2R93 G;  2K14 A;  2KBN A;  2VS1 A;  3PUW A;  4DR1 L;  4DV4 L;  4JBM A;  3I56 A;  1LUZ A;  1HZA A;  1IBL L;  4R4C A;  4GN3 B;  3ICE A;  1E24 A;  1CUK A;  4AIM A;  2HIX A;  2Y0S G;  5IYC H;  1X55 A;  1YNX A;  1OTC A;  3CPF A;  3L7Z C;  4YY3 Q;  4LF8 Q;  3DLL A;  1KXL A;  1BVS A;  3NBH B;  4APV A;  4DKA C;  1KQS A;  1UE1 A;  2K5V A;  1N34 L;  3Q8D A;  4JI2 L;  1UE7 A;  3PSI A;  3D0F A;  1RL2 A;  4BXX G;  1PH5 A;  3S1Q H;  3IRB A;  2IHE A;  2JA6 H;  5IYD H;  1K73 C;  1SR3 A;  3CME A;  4BBR G;  3GTJ H;  1FJG L;  1GO3 E;  4PG3 A;  2WAQ G;  4JI1 Q;  4JI5 L;  3I55 A;  3CD6 A;  4JYA Q;  1VQ5 A;  4DV3 L;  2GVA A;  1PYB A;  5M3M G;  1J5E Q;  1IBK L;  4OX9 L;  3H15 A;  1HNZ Q;  2R92 G;  2R7Z G;  3JAM c;  3E9I A;  1LYL A;  3G6E A;  2K4K A;  1QVF A;  4DV1 Q;  5M5X H;  3A5Z B;  1KRS A;  4R4I A;  3ULP A;  2WB1 G;  4POF A;  1EWI A;  2CKZ B;  2VNU D;  2UUC Q;  1JJC B;  1I5F A;  4LF9 Q;  2KCM A;  1ASY A;  1CKN B;  2NN6 I;  3CW2 C;  1QUQ A;  3ULL A;  1PH8 A;  4DR7 L;  3J7Z C;  3AQQ A;  1TWA H;  5FJ8 G;  1CKN A;  1JMC A;  1B7Y B;  1Q1E A;  1D8L A;  2VW9 A;  1OXU A;  1Q8K A;  1X3F A;  2QEX A;  1VQN A;  3TS2 A;  1PH4 A;  3NEL A;  2K5N A;  1BBU A;  2N49 A;  5C44 G;  1G6P A;  4A3E H;  2B3G A;  1I50 H;  2UUB Q;  3GTK H;  4WJ3 M;  1XPU A;  2OCE A;  1B8A A;  4A3F H;  5LMU L;  2OTL A;  2B29 A;  4LW1 A;  2YV5 A;  4IFD I;  4K0K Q;  5JEA J;  2KEN A;  2JEA I;  3STB C;  4DK3 C;  4HJ5 A;  4DR2 Q;  1EUJ A;  4NXN Q;  2ZTC A;  1JT8 A;  4B3M L;  4IO9 A;  1L2F A;  3KF6 A;  2VUM G;  4DR5 Q;  3GTP H;  4BY7 H;  1CSP A;  3M3Y H;  3KDF B;  1L0W A;  4HIO A;  3RN5 A;  1E1T A;  4UPA A;  4LUO A;  2Z6K C;  4JBW A;  1XNQ Q;  3H0G H;  2F4V Q;  1FGU A;  4DUZ L;  3HOV G;  4XTC S;  2CWP A;  3DM3 A;  3KDF A;  2H5X A;  2JA8 H;  4DUY Q;  1NE3 A;  1BBW A;  2MFI A;  3CF5 A;  3KOJ A;  4NXM L;  1PFS A;  2UXB L;  1X9N A;  1SLJ A;  3HOZ H;  3I4N H;  4B3R Q;  1LTL A;  1HNW L;  3CAM A;  3J81 j;  3PUX A;  1EIY B;  2NVX H;  1N9W A;  1U5K A;  5LMN Q;  4OWW B;  2B63 H;  3D31 A;  1P8L A;  2NN6 G;  4YHH Q;  2JA7 H;  3J80 i;  4LF5 Q;  2JE6 I;  4C3J H;  3HOX G;  4P75 A;  4B3S Q;  4GLX A;  3PF4 A;  3S1R H;  4LF4 Q;  1XMQ Q;  3RLO A;  3RZD H;  4OXP A;  1G29 1;  4JI3 Q;  4DV7 L;  3OTO L;  1HNX Q;  4GOP B;  2UXC Q;  1I6H H;  4X66 Q;  1PH9 A;  2HHH Q;  1IZ6 A;  1C9O A;  3HFZ B;  1L1O C;  3OYY A;  3EN2 A;  2RHS B;  4O0A A;  4P71 A;  1E1O A;  3CPW A;  1VQG A;  4KHP L;  5GRO A;  5K36 G;  4GOP A;  2I5L X;  1MIU A;  4KLK A;  3CCQ A;  4A3I G;  1VQ7 A;  4LF6 L;  4IPC A;  1XNR Q;  2DGY A;  5IP9 G;  3GTQ H;  4IFD G;  2MO1 A;  2IX0 A;  3JAM i;  1PH3 A;  4GN4 B;  1IBL Q;  1PH2 A;  4LF7 L;  4YCW A;  1PH6 A;  5C3E G;  2IT1 A;  4C3H H;  3BJU A;  3RNU A;  4IJL A;  5IT9 c;  1YVC A;  4BBS G;  4TVA B;  1OXT A;  4GLV B;  3UDF A;  1Q12 A;  1XJV A;  4A93 H;  3CXC A;  2YU9 H;  3K7U C;  5GAD C;  4A3D G;  3E0E A;  5FLX c;  1IBM L;  3F8T A;  5HGQ A;  2C35 B;  1YHQ A;  4IJH A;  3PO2 H;  2JA9 A;  1KC8 C;  4A3L H;  1Z47 A;  4B3T L;  2E8G A;  2R93 H;  1JJG A;  1GVP A;  4C2M H;  4DV6 L;  4JI0 L;  2OQK A;  1VQ6 A;  4DV5 Q;  1HR0 Q;  2ZM6 Q;  1EFW A;  3H3V H;  1IYJ B;  1YZ6 A;  4DR3 Q;  4DV3 Q;  1EIF A;  4OX9 Q;  3RLF A;  2EIF A;  2AHO B;  3L2P A;  3F1Z A;  1N32 Q;  3T1H Q;  2K5H A;  5IYB G;  2MNA A;  2JA5 G;  4EX5 A;  3CCE A;  1WCM G;  2VQF Q;  2UXD L;  1VQA A;  3PGZ A;  1UEB A;  4BXX H;  3FP9 A;  1YBY A;  1J6Q A;  1VQE A;  4GNX B;  1VQF A;  2AMC B;  4BBR H;  4HJ7 A;  4UP9 A;  3TRE A;  2LXK A;  2RF4 A;  1FVI A;  3M7N A;  4DR7 Q;  5IP7 G;  1VQM A;  1Q7Y C;  1WI5 A;  4JG2 A;  3CC4 A;  2PQA B;  4Y7N H;  4X64 Q;  4GNX A;  4JI7 L;  1K83 H;  2R92 H;  5M3M H;  1KIX A;  5HY6 A;  2R7Z H;  4HJ8 A;  3TS0 A;  1A0I A;  3UDG A;  4GKK Q;  2GN5 A;  3STB D;  3CC2 A;  2PQA A;  3OW2 A;  1OXS C;  1UWV A;  3K81 C;  4MTN A;  1H95 A;  4JOI C;  1W2B A;  1VQ9 A;  5JJI A;  5GAH C;  3FHW A;  3T1Y Q;  1K3R A;  5EAY A;  3S14 H;  4L5R C;  4ME3 A;  4X62 L;  3VDY A;  2N78 A;  4RMF A;  1NY4 A;  4DV2 Q;  2JK8 A;  3PUZ A;  5IYC G;  1QZH A;  3TEH B;  1K9M C;  2UUA L;  1QUQ B;  1AE2 A;  5IWA L;  1S72 A;  1PH7 A;  3TQY A;  2D0O A;  3ER0 A;  1RIP A;  4DR4 L;  4R4Q A;  1Y1V G;  2YYZ A;  5FJ8 H;  3F2D A;  1KHI A;  4AYB E;  1SMX A;  4B3M Q;  4LFB L;  1YJ9 A;  1XMO Q;  2AWN A;  1MJE A;  3HOU G;  4AH6 A;  4UY8 C;  1EQR A;  1WYD A;  4LFC L;  1Q86 C;  5C44 H;  4WJ4 A;  4LUZ A;  1VQJ A;  1WOC A;  1UE6 A;  1TWH H;  2A19 A;  2WFW A;  1TWG H;  3CCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...