4X3KA

Crystal structure of chromobox homolog 7 (cbx7) chromodomain with h3k27me3 peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
64
structure length
64
Chain Sequence
GSHMGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small-Molecule Modulators of Methyl-Lysine Binding for the CBX7 Chromodomain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Chromobox protein homolog 7
total genus 15
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4x3kA00
2RSNA 1CA6A 2X6GA 4HCSA 1ILQA 1HRJA 2KECA 4XDXA 1M8AA 2JP1A 1B50A 4RA8A 4CJ1B 1EL0A 3DEOA 2J7ZA 2JYOA 1RTNA 1AZQA 1CA5A 1DOKA 1BBXC 2B2TA 1SAPA 1SDFA 2HUGA 2L1BA 4ZLTF 1WVLA 2MP1A 2MGSA 3MWYW 3H91A 2B2TC 4OIJA 4UAIA 1O7ZA 5CBAE 2B2WA 1B4OA 2RA4A 2K28A 3IL8A 1DOMA 5D65A 3MTSA 1JE4A 2X6LA 1HA6A 2Q8RE 1MSGA 1X3PA 2SDFA 1EOTA 5DNFA 5EPJA 1B2TA 1DONA 1AZPA 1GUWA 2VXWA 3N52A 2N88A 5CBEE 1PFMA 1BO0A 2L11A 1BNZA 3I8ZA 2B2UA 5D14A 2MPMA 1F9RA 2L9HA 5EPKA 5T1IA 1G2TA 2B2UC 4OIKA 1BF4A 1EQTA 2KUMA 1IL8A 2N55A 1CM9A 1F9SA 2FJ2A 1WD1A 1Q3LA 1MSHA 2B2VA 2B2YA 4R8IA 1O7YA 4CJ0B 1DOLA 1DZ1A 2KEDA 4IUPA 1NR2A 4IUUA 5EPLA 1J8IA 2L4NA 1X32A 5E4XA 4X3TA 1WTXA 1C8CA 1MI2A 4NW2A 2XIWA 4IUTA 1G2SA 2HCCA 1G6ZA 2M2LA 4HAEA 1AP0A 1J9OA 1VMCA 4X3KA 3GV6A 4CJ2C 4QUCA 4MHEA 2EE1A 1PLFA 1S4ZA 3R93A 3Q6SA 1HHVA 3DEPA 3IFDA 4X3UA 2DY7A 1U4LA 2HDLA 1U4RA 1WTVA 1O80A 3SVMA 2NZ1D 4LMQD 3I90A 1U4PA 4X3SA 4HEDA 4IUQA 4DN4M 1PDQA 1IKLA 2K03A 1HFGA 1SSOA 2H1EA 1F2LA 3D6WA 2K01A 2K04A 2NYZD 3P7JA 3UI2A 2KVMA 2Q8TA 3HP3A 3TN2A 2FMMA 5EKIA 4XT1B 1X3QA 1NAPA 2HCIA 3KBXA 1RJTA 2BDNA 1RTOA 1QE6A 5EQ0A 1ICWA 5CMDA 4HSVA 1HFNA 3KUPA 2EOTA 2FHTA 1U4MA 1WTQA 1JICA 1B53A 1PFNA 4IUVA 1WTOA 1B3AA 5JJZA 1LV9A 4XT3B 4ZKCB 2X69A 3DM1A 3I3CA 1EIGA 2L12A 1MGSA 4U68A 4QUFA 1WD0A 1ILPA 3G7LA 5E4WC 4RAUC 2HDMA 4R9WA 2DY8A 1KNEA 1HUMA 3I91A 1NCVA 1XYIA 1KNAA 2B2VC 1EIHA 1RHPA 3ONAB 1HUNA 1RODA 2RVLA 5AFWA 1QG7A 2B2WC 5CORA 1F9PA 4ZKBB 4IURA 1WTPA 2R3ZA 1WTWA 5COYA 5EJWA 1G91A 1QNKA 2RSOA 1E0BA 3F2UA 3QO2A 1ESRA 3GV3A 2EPBA 4RWSC 1A15A 2MJ8A 2B2YC 2FFKB 2IL8A 2KOLA 2FINB 3FDTA 1PFBA 3FPUB 5T1GA 1F9QA 2KEEA 1TVXA 2D9UA 1NR4A 1XX8A 2CVRA 3LWEA 3TZDA 4ZK9B 4ZAIA 1ZXTA 4MN3A 4O42A 1WTRA 1IKMA 2K05A 2NWGA 1VMPA 2K1BA 1ML0D
chains in the Genus database with same CATH superfamily
4PNYA 1RD9D 1Z47A 1K0SA 1ILQA 2VUMH 4IPCA 4DXGA 1EL0A 2F0DA 4RHSA 1KABA 2WB1E 3MHBA 1TQOA 3CAMA 5FOBB 2Q2IA 1EY6A 1NBWA 1JR0D 5DM73 5M9OA 1VQMA 4JVZA 3JC66 3T16A 2R7FA 1A62A 2RDHA 2BDOA 5DNFA 5NUCA 4BBRH 1Q12A 4M1UB 1EQTA 1RL2A 1F9SA 3A8IE 1KTKA 1V8QA 4DV5Q 3OW7A 2F0JA 4CBVA 1M4VA 4AQYQ 1A2UA 1Z7TA 5CYUA 3T1YQ 2M00A 1VQ8A 1E2WA 1TWFB 5TSSA 3NWTA 2B63B 3TP7A 4H44C 1VMCA 3BYYB 2UUBQ 2CH4W 1V1QA 2A6EC 4X64L 1LTGD 4R4TA 2EVBA 1STBA 1Q1EA 1E24A 2WKCA 4XQNA 3OMGA 2R7DA 3BVZA 3CCVA 3C1FA 3F1ZA 2GVBA 2MNAA 3BZKA 2Q8TA 1SXTA 1GHKA 4XT1B 5M3FG 1GOZA 3FP9A 4MTNA 4MNOA 2Z0SA 3J81L 5EAYA 3PO3H 4EGVA 2PCFB 1TS5A 3T56B 4A93H 3S2DH 1EIYB 1EEID 3NQIA 4OGQC 4A3EB 4FDBA 2FXQA 2Z4HA 5JJZA 4EX5A 4A3EH 3I4NB 2PMZB 4JI2Q 3MC0B 4A3MB 4EQPA 4A3MG 1DYQA 2Z9HA 1Q82C 3I91A 3PUYA 3HFZB 2H4OA 1X9NA 1EIHA 1HUNA 5ELOA 4JBKA 4R4QA 4C2MH 2A68C 3E6ZX 2JK8A 4ODGA 2OCEA 2KOLA 3I56A 3N6RA 2O4XA 3S1NH 1XX8A 4UP9A 4AH6A 2EDGA 4ZK9B 4DR1L 4DNRB 4MN3A 1Y14B 2EJFC 1SN8A 3KF6A 3NBHA 1ML0D 2EY6A 3NPPA 3UE1A 1LM0A 2MFIA 4IUNA 4KTAA 5M5YH 1CFMA 1ESFA 4JYAQ 2N3SA 2IPKD 5FO7B 4DV6Q 1D5XC 1L0YB 4YY3L 2L1BA 3KLSA 4X6AH 4A75A 2MGSA 4DV4L 3K0YA 5FLMG 2B8FA 5BR8L 2NZHA 2PZWA 2Y0SG 2RCNA 1IBKL 1CZWA 1X3PA 4N9TA 3EBEA 2EQSA 2N88A 1PFMA 3RLNA 1T5EA 5JJLA 2L9HA 3CQZH 5I2YA 4DR6Q 4DUZQ 1ASZA 3OMCA 4M8AA 4F88A 2Z6KA 2VNUD 2Z8LA 1SROA 4JI4Q 3PIO3 5KEEA 4FXDA 5FJ8H 2JA7G 2A73B 3TMEA 1SRUA 4FF3A 2VQEQ 4A3LG 1C8CA 1STEA 4F87A 3D8GA 4HIMA 3H3VH 3M4OH 2OF1A 2EE1A 4E6IA 1GUGA 3KDFA 3Q6SA 4DA2A 2Z6BA 3NELA 4JW0A 3J7ZC 4LF5L 4JI8Q 1Y1WG 4LMQD 4DUYL 2B8GA 1UEAB 1MJCA 2F0EA 5M3FH 4C56C 4K2KA 2VQEL 3LNNA 2OQKA 2KVMA 3D3RA 3KF8B 1H9SB 1E2ZA 3ER0A 2LSSA 3RMHA 5JAVA 3AEVA 3GTPH 2RBMA 2NVXH 3HEJA 4K6DA 1ICWA 4L5SA 4JI3Q 1U4MA 1OXVA 4YCWA 4QCLA 2KA7A 2E74C 3NQTA 1STNA 2EY1A 1P8LA 3EFXD 4U68A 5HURA 1I4GA 4B3TL 2F0WA 5E4WC 1C0AA 4OHJA 2BH2A 1TKWB 3F8TA 1QG7A 3S15B 3BG3A 4RKLA 4J15A 4DV4Q 1JMCA 5CV9A 1G91A 1CK1A 1QNKA 3F2UA 1HZCA 3GV3A 1XMOQ 1VQLA 1FNVA 2EPBA 3H94A 2O2LD 3STBD 2HQEA 2PQAB 3HOVH 3Q8DA 2D9UA 1NR4A 3NENA 5IP7H 3SK4A 2ZXPA 1S5CD 2KHJA 4F8MA 2LXJA 4I7AA 4GKJL 2F0HA 3I4NG 2PQAA 4B3SQ 1L1OC 1OO9B 2HQLA 5KIXA 4B3TQ 3I55A 1YNJD 3EN2A 1HQRD 4GLVB 4KHZA 1BUVT 4PQXA 4G4KA 2F0FA 2B2WA 2K4KA 2MUYA 3ITPA 1PMRA 4GN3B 2MHVA 3RZOB 3CMEA 1AZPA 4YWLA 3OTOL 3SK5A 3NBHB 4C3JH 3P20A 3I4MG 1BBUA 3LWUA 4DV0L 3A54A 4R8IA 2PNRC 2KEDA 4IUUA 5CV6A 1A63A 1B3QA 5GADC 4GN5A 2JN4A 3KF8A 5E4XA 1STGA 2VY3A 1EUJA 1YHQA 1K8OA 1PH5A 5ISRA 3V96A 4PMCA 1A3UA 2FMCA 5JVG3 3E9IA 4GLAC 1EQRA 2A8VA 2DGYA 4HJ9A 4LF6L 2A6HC 1QJOA 4O0AA 4GNXC 5GQOA 3ZYYX 3OW2A 1JOQA 1PH3A 3TRZA 1L1OB 2XRSD 5IWAQ 2NYZD 2EIFA 4ZUIA 2FMMA 1UE1A 1SYEA 5ELBA 1DCZA 2F0TA 4UHVA 1JB7A 1JQYD 4APVA 5LMUQ 4LF9Q 1SLJA 4K8JA 5C0XG 1CI3M 3FRPB 3CXCA 3BYTB 3H15A 2JEAI 2UXBL 1J5EL 4QUFA 1WD0A 1X54A 3UDGA 1IBML 1VQHA 2HDMA 1KNEA 1TWGB 4LF4Q 3HOXB 4JI0L 3ONAB 3J81c 3DMUA 2QW7A 4QY7A 3RD4A 4NXNQ 3PO2B 1BQQT 5E1FA 3TEHB 1E0BA 2WIIB 3OWEB 3ERSX 3VYTA 1CKNB 4DR5L 1W6JA 4KKTA 2FFKB 4XIGS 1VF5C 2FINB 5CC4A 4A4IA 5GAEC 2K50A 1AW7A 3VYUA 3J7AV 1T5XD 4HCSA 1D2BA 1HPCA 4KY5A 3K5MA 2K6AA 5I9PA 3W1GA 1FD7D 1J6QA 5C3EB 1TWGH 4HIOA 1Y8OB 2R6GA 3Q23A 1EY5A 3M3YB 4ILWA 1S5DD 5C6AA 2DN8A 1PZID 3CCMA 1JWMD 4LK1C 3OWFA 2K28A 2JA5G 1JE4A 2X6LA 1TWHB 2C5CA 3DWQA 5J22A 1S72A 3OTOQ 4C3JG 3DUZA 4A3JB 2R7ZH 2L11A 1LTRD 4K0KQ 1TS2A 2EYFA 3TSSA 2R92G 3HOYG 1MD2D 1JC7A 3W3AA 2A5HA 3A5ZB 3MAQA 2QGQA 1PV4A 3D31A 1J8IA 3FPPA 3GTLB 4X3TA 1LTAD 1Y69U 2UUBL 1SMXA 3S2DB 1MI2A 3R2TA 1YBYA 5DAUA 4FF2A 4X64Q 4DAVA 2EXZA 3MA2B 1XMQQ 5K5PA 4QUCA 2PW7A 1JE5A 2ZTDA 2RKSA 2KHIA 4HMIA 2DY7A 3OSOA 1AEXA 3K0XA 4DN4M 2YU9H 4RCOA 3H09A 4A3IH 4UP7A 1EY7A 3BU2A 4DR3Q 1F2LA 1UUPA 2Q2UA 3TN2A 3HP3A 3TP8A 4GOPA 4X66Q 1PRTB 2R93H 4DV1L 1QVFA 1WJJA 1L1OA 3PF4A 3G6EA 2B29A 2LMCB 3DHQA 1UNSA 1WCMG 1A8VA 1FGUA 4DR5Q 3S2HB 2L0CA 4JI3L 1FGBD 4XTCS 2JQOA 1MGSA 4X65L 3H6MA 2AWNA 3ZJYC 1PH8A 4IOAA 4JPBW 2KCCA 4ZQ3A 4DR7Q 3HOZB 4LF9L 4CHTB 1K83B 4DPGA 1FVIA 1PFBA 1VQKA 2KEEA 1EU4A 1S3OA 3FKIG 3LWEA 1YI2A 4O42A 4JOIA 1X3GA 3HKZE 2X6GA 2HHHQ 1E2VA 4YY3Q 1N8RC 4DV6L 1EZ8A 1PFSA 1FNWA 4L5QA 1I4RA 2JJQA 1MHWC 2JYOA 1AZQA 1K3RA 5C0XH 2B2TA 1SJHD 2HUGA 5IGGA 2UUAQ 2MO0A 2E8GA 2MO1A 4DR1Q 4KHPL 4DV3L 4OO1G 3D0FA 4KKSA 4WJ4A 3GDEA 5EPJA 3FEWX 1H9RA 1K3BC 3NWSA 3M4PA 3SEBA 1D6EC 4YWKA 1FJGQ 1BDOA 1SYGA 2D62A 1EOVA 2YTYA 1KD1C 1GO3E 4P75A 4X62L 4CKCA 2VS1A 3A55A 1FNUA 3GTOB 3OYYA 5KRUA 1X32A 4KJNA 1LT6D 1B9NA 3CCEA 4BXXG 2O5IC 3RZOH 4G7ZC 2N8NA 1PTOC 5IGCA 4X3KA 4B08A 4CJ2C 2ENBA 3R93A 2QKIC 1TY0A 4X3UA 4LF7L 4C3HH 3GTJB 4A3BB 3U9SA 1SMYD 2Z1CA 3I2ZA 1K83H 5KNBA 2NZOA 4UY8C 1HCZA 3CHBD 4JBJA 2OTLA 4OELB 2HCIA 3CRLC 4LWCA 1QZGA 1YVCA 5FK9C 1SFOB 4A3CG 1I6VC 1PH6A 3U9OA 4K5VA 3KLSX 1JCKB 5KYLA 4ULLA 1H9SA 5IODA 1KAAA 4LF4L 4JI6L 4XYOA 4ZKCB 1I94Q 3X3NA 4FP5D 3VYRA 1IBMQ 3NTHA 4HJ7A 2UXBQ 2TSSA 3I4MH 5AFWA 4K2LA 1E1OA 1LTSD 1VQDA 3GD7A 1XNRL 4JCVE 1RCVD 5M3MB 4L63B 1XXGA 3PMFA 2E75C 3ULLA 3KBGA 3FPUB 1YHBA 4RGOS 3HKSA 4ZAIA 4BY7G 2ALYB 4K5XA 3S2HH 4DV3Q 1F2MA 3TREA 3Q22A 2WB1B 4QGUA 2C9OA 4A3GB 2I5LX 1YITA 5BN5A 4JI5Q 1M90C 2BCOA 1NMFA 1JOOA 1KDAA 2YV5A 2WACA 2CKZB 1X3FA 5DM63 3J80E 1B7YB 3VDYA 1AE2A 3VA5A 4BA2I 5EBCA 3I4NH 1DGSA 1DXMA 1EFWA 3RN5A 2B2TC 4XYQA 1O7ZA 2UUCL 1D8LA 4G57A 3IL8A 1HA6A 4DR7L 4DU9A 2K5HA 3KOJA 3MEFA 5D3DA 5IYDG 1K8GA 4Q5VA 1X3EA 3I8ZA 1PH9A 4LUVA 4IPHA 2F0PA 1LT5D 4RKBA 4N9PA 4IZ8A 5JPNC 1IYUA 2B2YA 2XRQD 2KHSA 2BH8A 1STHA 2LFNA 2QILA 4AIMA 1CKMA 2UU9Q 3NHHA 2A68D 2E2JH 3M7GA 2VB3X 3CCRA 2F0MA 3B6YA 2EYJA 2ES2A 3Q24A 2EJGC 4R4CA 2RDFA 1R9TB 3K81C 1LTID 2Y0SB 3DEPA 3W1BA 2D0PA 2CQAA 1O80A 4BBRG 2N78A 1NSNS 4PZ7A 4JV5L 2ZM6Q 1GXDC 5KYIA 5C0XI 4YWMA 1ASYA 1LTTD 1QVCA 3S1MB 3QOJA 4HSVA 1BCPB 3BZCA 2UXCL 5FLXL 4QIWE 4R8NA 3IRBA 5JEAH 2EJMA 4RCNA 1HTPA 3DM1A 2F4VQ 2WINB 1VQJA 3M4QA 3OIQA 4PZ6A 1PTOD 1UEBA 1Y8PB 2IX3A 1F9PA 1PRTD 4R4IA 1TWAH 2L15A 2D0OA 3GTQH 1FL0A 3F2BA 2B63G 4LFAQ 4FVMA 3AMUA 1K28A 4OWXB 3PQIA 5EKKA 2AUJD 2VQFQ 3PO3B 1U5KA 4QJFA 2OXPA 4XXEA 4DR2Q 2IWHA 2PZTA 4KHPQ 3G4SA 1GHJA 1CA6A 1HRJA 2WFWA 1PHJA 1DJRD 2XGTA 4V190 1M8AA 1SYFA 3L0OA 5G3LF 1PTOB 1S5ED 1NNXA 3NEMA 5C4JB 2JA9A 1KLGD 1ZKOA 4IOCA 1HZAA 1I3QH 4OEMB 4RH6A 5LMNQ 5D3IB 1OTCA 1K8MA 3GP7A 2OWOA 4A3EG 3NBIA 5KGUA 1DONA 1Y1VG 5CBEE 4BS9A 5CGKA 3GTLH 4DV0Q 3HOVG 1IL8A 2K5DA 4DV5L 4DUZL 3GQBA 4CJ0B 1P16A 3HGBA 4A3MH 5ELFA 1LUZA 4C3HG 1WI5A 4J8QA 3CU7A 4ME3A 1PA6A 4IPDA 3RUZA 3C46A 1Q81C 4ZYSA 2NN6G 4QF4A 2V1CC 4DV7Q 5C4XG 1AP0A 3I73A 3K58A 4JI6Q 5C4XB 4A3KH 3GTOH 5IYDH 1U4RA 4QB4A 1WTVA 1Z6HA 4ZRZA 3M85A 1JOKA 1PDQA 1QUQB 1IKLA 2YTVA 1SNQA 5M5XH 3J7A5 1EYAA 2JA6G 3ND9A 1BKBA 2EYHA 5JEAJ 5JOBA 4LFCL 3NUCA 5IOCA 1VQ6A 1LV9A 4J1MA 3Q0AA 4XT3B 1GUTA 4OO1I 1G8ZD 2RHSB 4CDDC 3R3OA 2CW0C 2BE5D 2SEBD 3P1HA 1HUMA 2B2VC 1CKOA 4JI1Q 1I94L 2RVLA 4RGMA 3SXHA 2NVXB 4JI1L 2A69D 1XJVA 3QO2A 2ICEC 4IN3A 1ONLA 3HOZG 5IP9G 4P74A 4GKKL 2F52A 2PO4A 2A69C 2RHQB 1LO5D 4KKUA 1EWCA 1EZ6A 4KLKA 5IGFA 4A3FH 4B3SL 1FJGL 2ZT9C 5C3WA 2IHEA 4P2CB 4KV6A 1CQFA 1N33L 2M9VA 1VQ7A 2PI2A 4FF4A 2Q8IB 2VUMB 1PXUA 3L7ZC 1TT2A 5FKAC 1F2ZA 4L8JA 1O7IA 5IYBH 3S17H 5CBAE 3M7NA 3NXWA 2KCTA 2UUAL 5D65A 1XMOL 4YIJA 5M5YB 1GKHA 4AYBE 3A5UA 2VXWA 1PRTC 4KI0A 4A3FB 3FHWA 5EPKA 2R7ZB 1G2TA 2IT1A 3UE0A 3M4OB 1BF4A 1EFID 5JJKA 1CHPD 3WWVA 1WD1A 4DAMA 3U4ZA 2A6HD 2LS01 1JJCB 2I46A 1C7YA 2ICIA 1IBKQ 4A3KB 1B8AA 1A3TA 2K5QA 3J7YW 4NB3A 1XTCD 2UU9L 4TKOB 3D4DA 1G2SA 3QIAA 2JA8B 1J9OA 3HOWB 2L55A 1EYGA 1CZGA 1PLFA 3K7AB 4Y52H 3MZ5A 1G6PA 4IFDI 4UP8A 4KD4A 2BA1A 1B9MA 1SYBA 4IUQA 1PH7A 2JEBI 2K03A 1GJXA 2IJ0A 4RGTA 3HOUH 3TBIB 4C2MB 3GTKB 4LAAA 4IJHA 4Y7NH 3E0EA 4DV1Q 4KY6A 4X66L 4JI7L 2V4DA 1RIPA 1N32L 4MZ9A 5M3MH 2J0TD 3I4LA 5C4XH 1ZYRD 3ULJA 2ZXOA 5CV7A 3CCJA 4FNFA 1KNAA 3BDLA 1RHPA 4A3DG 4UPAA 3PUVA 2IY5B 5LL6X 4LFAL 4NP5A 4V0BA 3PUWA 1RF2D 2NVTH 1M1KC 4POFA 3J81j 1PYWD 2CFMA 2QCPX 3K59A 1VMPA 2K5NA 5E3FA 3KK7A 1UWVA 3JAMc 3VR2A 1NJIC 3O13A 4F7XA 3BVGA 3D4WA 1ET9A 2RCFA 4YHHQ 3VR5A 1YJWA 1TWFH 4ZLTF 1U0LA 5C4HA 3EJIA 4DV2Q 3UDFA 1LABA 1KIXA 3MWYW 3PF5A 1I5FA 3HOVB 4Z9CB 4GZYC 1VQBA 1QCBD 3T1YL 4B9WA 4TQUS 2G9HD 2EXDA 4GLXA 1IW7C 1BNZA 3PUXA 1H9KA 5T1IA 5EKLA 2QEXA 2ZJQA 2WP8J 1VF7A 3HKZB 3S14B 1OXUA 2Z4IA 3MFYA 3R2IA 1KAWA 1VQFA 3GTMB 1EWIA 1SNPA 1NR2A 1VQGA 1CKNA 5I4DA 3VR6A 5EBDA 5CR3A 1STYA 4JI4L 3PO2H 4S3SA 1QNUA 5IYCH 1QUQA 1SE4A 3HS0C 1Q7YC 1G6ZA 2E2IH 5GAHC 1V1PA 3U4VA 3ULPA 1SR3A 1QWYA 2B3GA 2BOSA 2HT1A 2IX0A 1KDCA 4HR7B 4X65Q 4GOPC 3IFDA 3TZUA 3J80i 2F03A 3DM3A 2R7ZG 3SVMA 2NZ1D 3S14H 1KDBA 4B3ML 4BBSG 1WCMB 2K04A 1E22A 5EGTA 3C3LA 2I5MX 1BBWA 1AFPA 2MQHA 3EVQA 1EWHA 1HNZQ 1LACA 3S1NB 5HGQA 3S17B 5C44H 1HNZL 4IUVA 1BVSA 2JA8G 4A3CH 5IYCG 2CW0D 2QDLA 1EIFA 4OL7A 3J81E 3I3CA 2F0KA 3SR1A 3J7AF 4RAUC 1VS0A 2DY8A 4KN4C 5KNCA 3CPWA 3HOYH 1RODA 3CMAA 1OXTA 4OWWB 1JWUD 4LFBL 1WTWA 3HKZG 2CWAA 1B1ZA 4RWSC 3LX0A 4JBMA 3FDTA 3V05A 4BY1B 3EROA 5T1GA 3UDIA 4LW1A 4QL5A 1D1KA 2K05A 4HJ5A 5K36G 2ATWA 1B50A 1VQEA 3S1MH 4KJOA 1TXYA 2J7ZA 4UDUC 4KD3A 2WAQE 1DOKA 4RMFA 4JC0A 3CRKC 5CV8A 4OO1H 1IYJB 2E76C 4NXML 1EQVA 2Q8RE 3K8AA 4LUZA 1B2TA 3BZDB 5ELEA 4OX9L 4A3GH 1EYDA 3TS2A 4K5WA 4CGYB 5M3FB 2F0UA 2UXDQ 1EY4A 5A2QE 2RF4A 3HOWG 3S16H 1LTLA 3U50C 4AQYL 2CWPA 4KY7A 4P72A 5CV5A 4C3IH 1EEFD 1BCPC 2EY2A 2YTXA 1CSQA 2K52A 3RZDH 2KQ3A 4B9XA 3SK6A 1I4QA 3T4AC 1W3SA 3T1HQ 4LFCQ 4HCEA 3M3YH 1ENAA 1UAPA 2GA4B 4P71A 3I90A 1HJPA 4L6TB 1PZKD 2AUKA 3PCOB 4BY1H 4KK7A 1ILPA 2K01A 4A76A 5C5LA 1NAPA 3S1RH 3VA7A 4DK6C 4A3JH 5IIFA 1K0RA 2PMZE 1I4PA 4A3FG 2EOTA 3MFGA 3R8BA 1YNNC 1Q90A 4C3IG 1VQ4A 2HIVA 1TY2A 1NMGA 4HJ8A 1KC8C 4L5RC 1EY8A 3FMCA 1HNWQ 2GVAA 2XSCA 4IPGA 4LF6Q 2A19A 5BN4A 1PTOH 1YNND 4TRDA 1XYIA 1KQSA 1HNXQ 3ND8A 4CKEA 4WJWA 4BXXH 2PI2E 1BXTA 1Z9FA 2NN6I 3A8JE 2F0LA 3MEHA 4ZKBB 1LT4D 1IW7D 4KMUC 5COYA 4R4OA 3T13A 1QZHA 2B2YC 2WKDA 2OEOA 5HGTA 1S40A 5IGBA 1TVXA 1VCIA 1IKMA 3RLOA 4A3JG 3K7AH 3X3MA 4IJLA 2K1BA 2WAQB 4C1NK 4RGNA 4QIWB 3CW2C 3D4RA 4TSSA 2R92B 3DEOA 5LL6S 5LMNL 3GTKH 4XQQA 3DXJC 3RZDB 5LHY1 4FXKC 1H9MA 4DNIA 2NUCA 2SDFA 3CF5A 1F77A 1BO0A 1YNJC 4GKJQ 5D14A 1BOSA 1IL2A 3S1RB 3CD6A 1UE6A 2SNSA 4B3RL 2JA8H 4NPSA 4WJ3M 2CQOA 2YU9B 5H1SE 4GS3A 4H02A 1HQMC 4EQOA 3L2PA 3KJOA 4NKLA 1XWEA 2B39A 1PZJD 5DLQE 1SJED 2XIWA 3HOUG 3G48A 4HAEA 1C48A 3RR5A 1S4ZA 4OWTB 1Y1WH 1A2TA 4K0KL 1U4LA 1V1OA 3MXNA 4A93B 3BS1A 2YYZA 3GTGH 2ZTCA 1I50H 5I6WA 1JJ2A 1CHQD 1HXYD 2G9DA 3KFUA 2A74C 2QDBA 5FLMH 3CC7A 1O7LA 2PPBC 5C0XJ 3SGIA 1VQOA 2ZM6L 3JAMi 1QE6A 4JI7Q 1EYCA 2IW3A 3BJUA 1Q8IA 1TU2B 2FHTA 3BDCA 1SYCA 5AJ3L 3T53B 3PIP3 3FKIB 1H9JA 2PW5A 3LGJA 2F0OA 1B3AA 1H95A 3TP6A 1PTOF 2GN5A 3I4OA 1CT1D 1EIGA 2KJXA 4RHRA 1V1PB 5ELNA 2BA0A 2ZJRA 2D2CC 1MBYA 2VUMG 4IURA 2R3ZA 5EJWA 4RG1A 2RSOA 1ESRA 1D1IA 4LUOA 2DJGC 2IL8A 1I50B 5A2QL 3TZDA 4FXGC 2CH4A 1JB3A 1SNMA 2HD3A 4LF8Q 1TWAB 4XDXA 1YJNA 2XVSA 1K9MC 4RA8A 4RFBA 5A35A 4FF1A 1CA5A 1WOCA 3I72A 5IYBG 2KENA 1BCPD 4JYAL 5M5WH 2DNEA 1GVPA 1A6XA 5I6YA 3NTIA 2QA4A 1K73C 2E2IB 1WFQA 3VYSA 1YNXA 3AFQA 3GTPB 3SDZA 2JA5H 3A7AB 2AMCB 3DLLA 3K6OA 4JI8L 2EYOA 3QR8A 4AYBG 1XMQL 3C1EA 2FJ2A 3K7UC 2WAQG 1Q3LA 1MSHA 5GAGC 1WYDA 3GTJH 1DOLA 2F0GA 4FO2A 4IFDH 2F3IA 3S1QH 1CSPA 2IX1A 5FLXE 1X55A 4BA1I 1D5MC 5L37A 1WTXA 2AQ2B 4NW2A 5JVH3 3HOXH 2M2LA 3MXUA 1JT8A 4A3DH 2K75A 3H0GH 3TS0A 1X65A 3HG9A 1S5FD 1TWHH 4BWGB 1D7QA 4DR6L 1Q86C 1FYCA 4HEDA 4JBWA 1B44D 3P7JA 2NVQH 3D6WA 3UI2A 2NN6H 1HA5A 4IQZA 3CCLA 2QF7A 2BDNA 1OXXK 3U58A 3CPFA 1XTDA 1WTQA 5FO8B 4JK1C 4I7ZC 2F4VL 3MXNB 1N9WA 3KLRA 3AB9A 3I7FA 5C44G 2DNCA 1IBLL 1WTHA 2XN9C 1D5ZC 4ALPA 1SEBD 4DV2L 2OTJA 2E2JB 2B2WC 5C4ZA 4G7HC 1W6KA 1WTPA 2R93B 5ELDA 2NVQB 2SNMA 1A15A 4IFDJ 1SNDA 1Y8NB 2F3VA 1ZEQX 2EYLA 4DR4L 4CDFC 2E2HB 1LLRD 1LTBD 2CVRA 2RQXA 1L0WA 4K8IA 3RLFA 3E0JA 2NWGA 3PGZA 1HR0Q 3QOLA 4EQ5A 5J3BA 2Q2TA 2JP1A 3CP0A 1EY0A 1BBXC 5IP9H 3A74A 3AU7A 2K32A 2UXDL 2WV6D 2XWJB 1F2YA 4OIJA 1ENFA 4UAIA 2XNAC 2AQ3B 4KHVA 3BDOA 3NP8A 1DOMA 4H7BA 2OT2A 2AHOB 1HR0W 3WDNA 5M5XB 4MTKA 1XPOA 2HHHL 1I6HH 4H0LC 3J81i 3IAYA 3WOEA 2ASBA 5C3EG 1L2FA 4OIKA 2G5DA 2KUMA 2NTTA 1EU3A 1ZYRC 2K5VA 2E2HH 1SYDA 4NDXA 4BY7B 1YIJA 1TS4A 3E5SA 1SNCA 1DZ1A 3K5NA 5I9OA 4DF7A 3T51B 4PMBA 2LXKA 2Z6KC 3EQLC 2PYKA 3QWNA 2B63H 2NVYH 1Q8KA 1YZ6A 3GV6A 2SOBA 4MHEA 3CKIB 3SK8A 1HHVA 1X56A 3KLWA 2LKVA 4B3MQ 3QJYA 1MJEA 2ID0A 1EQQA 3MXGA 2NVTB 5JEAG 3T1HL 1VQNA 4LFBQ 1L0XB 2Y0SE 1X6OA 1IHZA 3HOXG 3GTQB 1S5BD 2JSOA 3I70A 4DR3L 2UXCQ 5IT9E 5EQ0A 3URYA 1MIUA 1NE3A 1JJGA 1SBBB 2NB0A 1JICA 1B53A 3PO3G 1V9PA 1PH1A 1E3PA 5IT9L 1VQ5A 1Q1BA 5FLXc 1HNXL 1N33Q 3NSWA 3PIOA 5CORA 2A1AA 1VQPA 1TIID 3M9BA 3HOUB 1PH4A 1AH9A 4K14A 4BBRB 3S1QB 1TWCB 3M4YA 4DXFA 3L3OC 5F2DA 3OOCA 3TDQA 3NE5B 1Y1VB 3J80L 2XWBB 3MVVA 5AJ3Q 2ZXRA 4GKKQ 1R4PB 3E3XA 2J4XA 4YHHL 1SFOH 1KLUD 5FJ8G 2JA7H 3HOYB 1ENCA 2VB2X 2JA7B 3DWPA 1I4HA 4GNXA 4JI0Q 4J6HA 3V2TA 1CUKA 4IALA 1XNQL 4X62Q 1QILA 2RA4A 4EVOA 2Q2HA 4DK1A 2JXMB 2F4IA 4PMWA 4A3BH 1TWCH 2UUCQ 3N52A 4DR4Q 2CCZA 3WOFA 2B2UA 2MPMA 4BY1G 3FVQA 2B2UC 1WCMH 4DK0A 3C2PA 1I4XA 2I07B 4KN7C 1KRTA 5IE8A 4OXPA 2B2VA 5IWAL 4B3RQ 1HZ9A 1B70B 2KCNA 4G7OC 3K5OA 1UE7A 1G291 3OHXC 1KXLA 4A3IG 3H3VC 4JV5Q 3AQQA 3CC2A 2R92H 3EIVA 2F0SA 4HMJA 4O2DA 1E7ZA 4YCVA 3F2CA 4K6LA 4BBSB 2E2DC 4DV7L 1GUSA 3PV0A 2CHBD 1N36Q 1IZ6A 2HDLA 1TS3A 1ET6A 1GM5A 2IHFA 4LJZC 2I0QA 5CV4A 5IY0A 4L5TA 1TR5A 1HFGA 1SSOA 2H1EA 1SNOA 5M5WB 3KDFB 2EZVA 2E5LQ 3KBXA 3EA6A 1RTOA 2WB1G 4XQJA 2E5LL 5CMDA 2F3WA 3KUPA 3OPOA 4WFN3 1N36L 2JA6H 5E7NA 4GOPB 3A0JA 3A7LA 4O1NA 1QOHA 3FKIH 4R9WA 4N8FA 1SE2A 1NCVA 1FR3A 5IGDA 4WORA 1K8AC 2KBNA 4DFAA 3K5LA 2VL6A 4YCUA 2O5JC 4DR2L 5IP7G 4PV1C 3CCUA 1T9HA 2F1MA 3GTGB 1F9QA 4JI5L 4GN4B 1WTRA 1N34Q 5GROA 2RSNA 4DAYA 4DAYB 4DKAC 2VQFL 2JA6B 2NVYB 3KF6B 4JOIC 3VR4A 1G51A 4CJ1B 1A0IA 4JG2A 2R61A 1HR0L 4C3IB 2HIXA 4ID6A 2N49A 1SAPA 1KHIA 5BR8Q 2EY5A 1PH2A 1WVLA 4CDCC 1U9RA 3GO5A 2KCMA 4BY7H 5JPMC 1B4OA 4GNXB 3E9HA 1XNQQ 1PVOA 1PYBA 4A3KG 3AFPA 3MTSA 1ICFB 5J1ZA 1EOTA 4LNQA 3D6CA 1HZBA 1Q46A 1F9RA 1R4QB 4OONA 4HN7A 4AYBB 1V43A 2R93G 1YHAA 4QMGA 5BN3A 1XPUA 4Q0FA 2K33A 5ELCA 1I3QB 3IFTA 4IO9A 3STBC 3K57A 5C4JH 2AQ1B 2K7VA 4HTHA 5C3EH 4NXMQ 4OX9Q 2HCCA 3H3VI 3HZXA 5FO9B 1EY9A 4CKBA 4LF7Q 4N8X1 2NTSA 1OXSC 3P75A 1YEZA 3QB3A 2PNHA 2D5DA 3RNUA 1BCPF 1SE8A 3G6JB 3PO2G 3CCQA 4X3SA 4NXNL 3F2DA 1E1TA 3OIPA 3S24A 4U673 4A3DB 5EKIA 1KL9A 1R9TH 1RJTA 1AE3A 2C35B 2DUDA 1JWSD 2AWOA 1GUNA 1RKNA 1J5EQ 5DEHA 4LF5Q 3MXPA 1WTOA 4TVAB 3S9WA 3IKJA 1STAA 4HSPA 5IGEA 2X69A 4PZ8A 3GTMH 1UE5A 2L12A 1CTMA 3NTKA 4P73A 4A3GG 1VQCA 3SHLA 2F0NA 3AYHB 2OQ0A 4ME5A 2PZUA 4H13C 4ZUJA 3UDXA 4HJAA 2ZJPA 2JA5B 4A93G 3W5OA 1NY4A 1N32Q 2L5TA 4DGZA 5G3LD 1GUOA 1PRTF 5C5MA 2H5XA 1BR9A 4C1NI 5IT9c 1W2BA 1IXRA 2NBFA 3HOZH 3VR3A 1ZXTA 2TMPA 4Y7NB 4HIDA 4NMZA 3CC4A 2F0IA 1SE3A 3SE0A 2KECA 1I6HB 2VW9A 4IFDG 2JE6I 3S15H 3KYHC 4LF8L 4DNTB 1XNRQ 1RTNA 4I65A 1VQ9A 1GD7A 1JORA 3JAML 1SDFA 2A6ED 2I5HA 4ABNA 2DJFC 2VZAA 2MP1A 2F0QA 1Y1WB 2F0VA 3W2DA 3J80c 3BVMA 1HH2P 3H91A 5HY6A 1KRSA 3S16B 3PUZA 2XTIA 3ERQA 3HOWH 3H0GG 1DD2A 1C9OA 1MSGA 1GUWA 1MKHA 4DAPA 3G71A 2BE5C 3I4MB 5KNDA 2N55A 4A3IB 1CM9A 1LYLA 5C3XA 1VDZA 1HTLD 4PG3A 1O7YA 3TP5A 4IUPA 1VQAA 5I2XA 5EPLA 2L4NA 2LY7A 4HIKA 2QEJC 3K80C 5M3MG 4CDEC 1CQVA 4MIUA 4IUTA 2AKWB 2P5ZX 4C3JB 4JI2L 3RN2A 5LMNW 3PIPA 3A8KE 2K14A 5C44B 5K36H 3ICEA 4FYDA 3PSIA 1AN8A 3DWAA 1U4PA 1XPRA 4A3LH 3QG1A 2EYPA 4C3HB 4POGA 1O78A 1NUCA 2PQEA 3L9AX 1X3QA 4BBSH 4A3BG 3TQYA 1DM0B 2K5WA 1Y1VH 5LMUL 1IYVA 1VQIA 3A56A 1HFNA 2EYMA 1RDPD 1QVGA 1PFNA 4ZCKA 3H0GB 1A3VA 1SMYC 1LT3D 1PYSB 3G7LA 1N34L 1NTGA 2RDGA 1IBLQ 1YJ9A 4DUYQ 3HRZC 5JJIA 2MJ8A 1II3A 4QQBX 3CCSA 1QB5D 4EQNA 5J39A 3JAME 2ZTEA 4WRDA 1C4QA 4DK3C 1HNWL 3KJPA 4R1JA 3NK9A 3CQZB
chains in the Genus database with same CATH topology
4PNYA 1RD9D 1Z47A 1ILQA 4DXGA 1EL0A 2F0DA 4RHSA 1KABA 3MHBA 1TQOA 5FOBB 1EY6A 1JR0D 5DM73 5M9OA 3T16A 2RDHA 2BDOA 5DNFA 5NUCA 1Q12A 4M1UB 1EQTA 1F9SA 3A8IE 1KTKA 1V8QA 3OW7A 2F0JA 4CBVA 1M4VA 1A2UA 1Z7TA 5CYUA 2M00A 1E2WA 1TWFB 5TSSA 3NWTA 2B63B 3TP7A 4H44C 1VMCA 3BYYB 2A6EC 1LTGD 2EVBA 1STBA 1Q1EA 2WKCA 4XQNA 3OMGA 3BVZA 3C1FA 2Q8TA 1SXTA 1GHKA 4XT1B 1GOZA 3J81L 4EGVA 2PCFB 1TS5A 3T56B 1EEID 3NQIA 4OGQC 4A3EB 2Z4HA 5JJZA 3I4NB 2PMZB 3MC0B 4A3MB 4EQPA 1DYQA 3I91A 3PUYA 1EIHA 2H4OA 1HUNA 2A68C 3E6ZX 4ODGA 2KOLA 3N6RA 2O4XA 1XX8A 4ZK9B 2EDGA 4DNRB 4MN3A 2EJFC 3NBHA 1ML0D 2EY6A 3NPPA 4IUNA 4KTAA 1CFMA 1ESFA 2IPKD 5FO7B 1D5XC 1L0YB 2L1BA 3KLSA 2MGSA 3K0YA 2B8FA 2PZWA 1CZWA 1X3PA 4N9TA 2N88A 1PFMA 1T5EA 2L9HA 5I2YA 3OMCA 4M8AA 4F88A 2VNUD 2Z8LA 3PIO3 5KEEA 4FXDA 2A73B 3TMEA 4FF3A 1C8CA 1STEA 4F87A 3D8GA 2OF1A 2EE1A 4E6IA 1GUGA 3Q6SA 4DA2A 4LMQD 2B8GA 1UEAB 2F0EA 4C56C 4K2KA 3LNNA 2KVMA 3D3RA 1H9SB 1E2ZA 3RMHA 5JAVA 2RBMA 3HEJA 1ICWA 4K6DA 1U4MA 1OXVA 4QCLA 2KA7A 2E74C 3NQTA 1STNA 2EY1A 3EFXD 4U68A 5HURA 1I4GA 2F0WA 5E4WC 4OHJA 1TKWB 1QG7A 3S15B 3BG3A 4RKLA 5CV9A 1G91A 1CK1A 1QNKA 3F2UA 3GV3A 1FNVA 2EPBA 3H94A 2O2LD 2HQEA 2D9UA 1NR4A 3SK4A 2ZXPA 1S5CD 4F8MA 2F0HA 5KIXA 1OO9B 1YNJD 1HQRD 4KHZA 1BUVT 4PQXA 2F0FA 4G4KA 2B2WA 2MUYA 3ITPA 1PMRA 2MHVA 3RZOB 1AZPA 3SK5A 3P20A 3LWUA 3A54A 4R8IA 2PNRC 2KEDA 4IUUA 5CV6A 3KF8A 5E4XA 1STGA 1K8OA 5ISRA 3V96A 4PMCA 1A3UA 2FMCA 5JVG3 2A6HC 1QJOA 3ZYYX 1JOQA 2XRSD 2NYZD 4ZUIA 2FMMA 1SYEA 5ELBA 1DCZA 2F0TA 1JQYD 4K8JA 5C0XG 1CI3M 3FRPB 2JEAI 3BYTB 4QUFA 1WD0A 2HDMA 1KNEA 1TWGB 3HOXB 3ONAB 3DMUA 3RD4A 3PO2B 1BQQT 5E1FA 1E0BA 2WIIB 3OWEB 3VYTA 1W6JA 4KKTA 4XIGS 2FFKB 1VF5C 2FINB 5CC4A 1AW7A 3VYUA 3J7AV 1T5XD 4HCSA 1D2BA 1HPCA 4KY5A 3K5MA 2K6AA 5I9PA 1FD7D 5C3EB 1Y8OB 2R6GA 3Q23A 1EY5A 3M3YB 4ILWA 1S5DD 5C6AA 2DN8A 1PZID 1JWMD 4LK1C 3OWFA 2K28A 1JE4A 2X6LA 1TWHB 2C5CA 3DWQA 5J22A 4C3JG 3DUZA 4A3JB 2L11A 1LTRD 1TS2A 2EYFA 3TSSA 1MD2D 1JC7A 3W3AA 2A5HA 3MAQA 3D31A 1J8IA 3FPPA 3GTLB 4X3TA 1LTAD 1Y69U 3S2DB 1MI2A 3R2TA 5DAUA 4FF2A 4DAVA 2EXZA 3MA2B 5K5PA 4QUCA 2PW7A 2RKSA 4HMIA 2DY7A 3OSOA 1AEXA 4DN4M 4RCOA 3H09A 1EY7A 1F2LA 1UUPA 3TN2A 3HP3A 3TP8A 1PRTB 2LMCB 3DHQA 1UNSA 3S2HB 2L0CA 1FGBD 4XTCS 1MGSA 3H6MA 2AWNA 2KCCA 4ZQ3A 3HOZB 4CHTB 1K83B 1PFBA 2KEEA 1EU4A 3LWEA 4O42A 2X6GA 1E2VA 1EZ8A 1FNWA 1I4RA 2JYOA 1AZQA 5C0XH 2B2TA 1SJHD 2HUGA 5IGGA 4OO1G 4KKSA 5EPJA 3FEWX 1H9RA 3NWSA 3SEBA 1D6EC 1BDOA 1SYGA 2D62A 4CKCA 3A55A 1FNUA 3GTOB 5KRUA 1X32A 4KJNA 1LT6D 1B9NA 2O5IC 4G7ZC 1PTOC 5IGCA 4X3KA 4B08A 4CJ2C 2ENBA 3R93A 2QKIC 1TY0A 4X3UA 3GTJB 4A3BB 3U9SA 1SMYD 2Z1CA 5KNBA 1HCZA 3CHBD 2HCIA 3CRLC 5FK9C 1SFOB 1I6VC 3U9OA 4K5VA 3KLSX 1JCKB 5KYLA 4ULLA 1H9SA 5IODA 1KAAA 4XYOA 4ZKCB 3X3NA 4FP5D 3VYRA 3NTHA 2TSSA 5AFWA 4K2LA 1LTSD 3GD7A 1RCVD 5M3MB 4L63B 1XXGA 3PMFA 2E75C 3KBGA 3FPUB 4RGOS 4ZAIA 4K5XA 1F2MA 3Q22A 4A3GB 2WB1B 2C9OA 5BN5A 2BCOA 1JOOA 1KDAA 2WACA 5DM63 3J80E 3VA5A 4BA2I 5EBCA 1DXMA 2B2TC 4XYQA 1O7ZA 4G57A 3IL8A 1HA6A 4DU9A 5D3DA 4Q5VA 3I8ZA 2F0PA 1LT5D 4RKBA 4N9PA 4IZ8A 5JPNC 1IYUA 2B2YA 2XRQD 2KHSA 1STHA 2LFNA 2QILA 3NHHA 2A68D 3M7GA 2VB3X 2F0MA 2EYJA 3Q24A 2EJGC 2RDFA 1R9TB 1LTID 2Y0SB 3DEPA 2CQAA 1O80A 1NSNS 1GXDC 5KYIA 5C0XI 1LTTD 3S1MB 3QOJA 4HSVA 1BCPB 5FLXL 4R8NA 5JEAH 2EJMA 4RCNA 1HTPA 3DM1A 2WINB 3OIQA 1PTOD 1Y8PB 2IX3A 1F9PA 1PRTD 4FVMA 3AMUA 5EKKA 2AUJD 3PO3B 2OXPA 4XXEA 2IWHA 2PZTA 1GHJA 1CA6A 1HRJA 1DJRD 4V190 1M8AA 1SYFA 5G3LF 1PTOB 1S5ED 5C4JB 1KLGD 1ZKOA 4RH6A 5D3IB 1K8MA 3GP7A 3NBIA 5KGUA 1DONA 5CBEE 4BS9A 5CGKA 1IL8A 2K5DA 3GQBA 4CJ0B 3HGBA 5ELFA 4C3HG 4J8QA 3CU7A 3RUZA 3C46A 4ZYSA 2NN6G 4QF4A 1AP0A 3I73A 3K58A 5C4XB 1U4RA 4QB4A 1WTVA 1Z6HA 4ZRZA 3M85A 1JOKA 1PDQA 1IKLA 1SNQA 1EYAA 3ND9A 5JEAJ 2EYHA 5JOBA 3NUCA 5IOCA 1LV9A 4J1MA 3Q0AA 4XT3B 1GUTA 4OO1I 1G8ZD 3R3OA 2CW0C 2BE5D 2SEBD 3P1HA 1HUMA 2B2VC 2RVLA 4RGMA 3SXHA 2NVXB 2A69D 3QO2A 2ICEC 4IN3A 1ONLA 2PO4A 2A69C 1LO5D 4KKUA 1EWCA 1EZ6A 5IGFA 2ZT9C 5C3WA 4P2CB 4KV6A 1CQFA 2M9VA 4FF4A 2Q8IB 2VUMB 1PXUA 3L7ZC 1TT2A 5FKAC 1F2ZA 4L8JA 5CBAE 3M7NA 3NXWA 5D65A 4YIJA 5M5YB 2VXWA 1PRTC 4KI0A 4A3FB 5EPKA 2R7ZB 1G2TA 2IT1A 3M4OB 1BF4A 1EFID 1CHPD 1WD1A 2A6HD 2LS01 2I46A 2ICIA 4A3KB 1A3TA 2K5QA 3J7YW 1XTCD 2JA8B 4TKOB 3D4DA 1G2SA 3QIAA 1J9OA 3HOWB 2L55A 1CZGA 1PLFA 3K7AB 3MZ5A 4IFDI 4KD4A 2BA1A 1B9MA 1SYBA 4IUQA 2JEBI 2K03A 1GJXA 2IJ0A 4RGTA 3TBIB 4C2MB 3GTKB 4LAAA 4KY6A 2V4DA 2J0TD 3I4LA 1ZYRD 2ZXOA 5CV7A 4FNFA 1KNAA 3BDLA 1RHPA 3PUVA 5LL6X 4NP5A 4V0BA 3PUWA 1RF2D 1PYWD 2QCPX 3K59A 1VMPA 5E3FA 3KK7A 3VR2A 3O13A 4F7XA 3BVGA 3D4WA 1ET9A 3VR5A 4ZLTF 5C4HA 3EJIA 1LABA 3MWYW 3HOVB 4Z9CB 4GZYC 1QCBD 4B9WA 4TQUS 2G9HD 1IW7C 1BNZA 3PUXA 1H9KA 5T1IA 5EKLA 2WP8J 1VF7A 3HKZB 3S14B 1OXUA 2Z4IA 3MFYA 3R2IA 3GTMB 1SNPA 1NR2A 5I4DA 3VR6A 5EBDA 5CR3A 1STYA 4S3SA 1QNUA 1SE4A 3HS0C 1G6ZA 1V1PA 1QWYA 2BOSA 2IX0A 1KDCA 4HR7B 3IFDA 3TZUA 2F03A 3SVMA 2NZ1D 1KDBA 1WCMB 2K04A 5EGTA 3C3LA 1AFPA 3EVQA 1EWHA 1LACA 3S1NB 3S17B 4IUVA 2CW0D 4OL7A 3J81E 3I3CA 2F0KA 3SR1A 3J7AF 4RAUC 2DY8A 4KN4C 5KNCA 1RODA 1OXTA 1JWUD 1WTWA 1B1ZA 4RWSC 3LX0A 3FDTA 3V05A 4BY1B 3EROA 5T1GA 1D1KA 2K05A 5K36G 1B50A 4KJOA 2J7ZA 4UDUC 4KD3A 1DOKA 3CRKC 5CV8A 4OO1H 2E76C 1EQVA 2Q8RE 1B2TA 3BZDB 5ELEA 1EYDA 4K5WA 4CGYB 5M3FB 2F0UA 1EY4A 5A2QE 4KY7A 5CV5A 1EEFD 1BCPC 2EY2A 2KQ3A 4B9XA 3SK6A 1I4QA 3T4AC 4HCEA 1ENAA 1UAPA 2GA4B 3I90A 4L6TB 1PZKD 2AUKA 4KK7A 1ILPA 2K01A 5C5LA 1NAPA 3VA7A 5IIFA 1I4PA 2EOTA 3MFGA 3R8BA 1YNNC 1Q90A 4C3IG 1TY2A 1EY8A 3FMCA 2XSCA 5BN4A 1PTOH 1YNND 4TRDA 1XYIA 3ND8A 4CKEA 4WJWA 1BXTA 2NN6I 3A8JE 3MEHA 2F0LA 4ZKBB 1LT4D 1IW7D 4KMUC 5COYA 3T13A 2B2YC 2WKDA 2OEOA 5HGTA 5IGBA 1TVXA 1VCIA 1IKMA 3X3MA 2K1BA 2WAQB 4C1NK 4RGNA 4QIWB 3D4RA 4TSSA 2R92B 3DEOA 5LL6S 4XQQA 3DXJC 3RZDB 5LHY1 4FXKC 1H9MA 2NUCA 2SDFA 1F77A 1BO0A 1YNJC 5D14A 1BOSA 3S1RB 2SNSA 2YU9B 1HQMC 4EQOA 4NKLA 1XWEA 2B39A 1PZJD 1SJED 2XIWA 4HAEA 1C48A 1S4ZA 1A2TA 1U4LA 1V1OA 3MXNA 4A93B 3BS1A 2YYZA 5I6WA 1CHQD 1HXYD 2G9DA 2A74C 2QDBA 1O7LA 2PPBC 5C0XJ 1QE6A 1EYCA 2IW3A 1Q8IA 1TU2B 2FHTA 3BDCA 1SYCA 3T53B 3PIP3 3FKIB 1H9JA 2PW5A 2F0OA 1B3AA 3TP6A 1PTOF 1CT1D 1EIGA 2KJXA 4RHRA 1V1PB 2BA0A 2D2CC 1MBYA 4IURA 2R3ZA 5EJWA 2RSOA 1ESRA 1D1IA 2IL8A 1I50B 5A2QL 3TZDA 4FXGC 1JB3A 1SNMA 1TWAB 4XDXA 2XVSA 4RA8A 5A35A 4RFBA 4FF1A 1CA5A 3I72A 1BCPD 2DNEA 1A6XA 5I6YA 3NTIA 2E2IB 3VYSA 3GTPB 3SDZA 3A7AB 3K6OA 2EYOA 3C1EA 2FJ2A 1Q3LA 1MSHA 1DOLA 2F0GA 4FO2A 4IFDH 2IX1A 5FLXE 4BA1I 1D5MC 1WTXA 2AQ2B 4NW2A 5JVH3 2M2LA 3MXUA 3HG9A 1S5FD 4BWGB 1FYCA 4HEDA 4JBWA 1B44D 3P7JA 3D6WA 3UI2A 2NN6H 1HA5A 4IQZA 2QF7A 2BDNA 1OXXK 1WTQA 5FO8B 4JK1C 4I7ZC 3KLRA 3AB9A 2DNCA 2XN9C 1D5ZC 1SEBD 2E2JB 2B2WC 5C4ZA 4G7HC 1W6KA 1WTPA 2R93B 5ELDA 2NVQB 2SNMA 1A15A 4IFDJ 1SNDA 1Y8NB 2F3VA 1ZEQX 2EYLA 2E2HB 1LLRD 1LTBD 2CVRA 2RQXA 4K8IA 3RLFA 3E0JA 2NWGA 3QOLA 2JP1A 1EY0A 1BBXC 3AU7A 2K32A 2WV6D 2XWJB 1F2YA 4OIJA 1ENFA 4UAIA 2XNAC 2AQ3B 4KHVA 3BDOA 3NP8A 1DOMA 4H7BA 2OT2A 3WDNA 5M5XB 4H0LC 3IAYA 3WOEA 4OIKA 2KUMA 2NTTA 1EU3A 1ZYRC 1SYDA 4NDXA 4BY7B 1TS4A 3E5SA 1SNCA 1DZ1A 3K5NA 5I9OA 4DF7A 3T51B 4PMBA 3EQLC 2PYKA 3QWNA 3GV6A 2SOBA 4MHEA 3CKIB 3SK8A 1HHVA 2LKVA 3QJYA 2ID0A 3MXGA 2NVTB 5JEAG 1L0XB 1IHZA 3GTQB 1S5BD 2JSOA 3I70A 5IT9E 5EQ0A 3URYA 1SBBB 2NB0A 1JICA 1B53A 5IT9L 1Q1BA 3NSWA 5CORA 1TIID 3HOUB 4K14A 4BBRB 3S1QB 1TWCB 3M4YA 4DXFA 3L3OC 5F2DA 3OOCA 3TDQA 3NE5B 1Y1VB 3J80L 2XWBB 3MVVA 2ZXRA 1R4PB 2J4XA 1KLUD 3HOYB 1ENCA 2VB2X 2JA7B 3DWPA 1I4HA 4J6HA 3V2TA 4IALA 1QILA 2RA4A 4EVOA 4DK1A 2JXMB 2F4IA 4PMWA 3N52A 3WOFA 2B2UA 2MPMA 3FVQA 2B2UC 4DK0A 3C2PA 1I4XA 2I07B 4KN7C 2B2VA 2KCNA 4G7OC 3K5OA 1G291 3OHXC 3H3VC 2F0SA 4HMJA 4K6LA 4BBSB 2E2DC 1GUSA 3PV0A 2CHBD 2HDLA 1TS3A 1ET6A 4LJZC 5CV4A 1TR5A 1SSOA 1HFGA 2H1EA 1SNOA 5M5WB 2EZVA 3KBXA 3EA6A 1RTOA 4XQJA 5CMDA 2F3WA 3KUPA 3OPOA 4WFN3 3A7LA 4O1NA 1QOHA 4R9WA 1SE2A 1NCVA 1FR3A 5IGDA 4WORA 4DFAA 3K5LA 2O5JC 4PV1C 2F1MA 3GTGB 1F9QA 1WTRA 2RSNA 4DAYA 2JA6B 2NVYB 3VR4A 4CJ1B 2R61A 4C3IB 4ID6A 1SAPA 2EY5A 1WVLA 1U9RA 3GO5A 5JPMC 1B4OA 3MTSA 5J1ZA 1EOTA 3D6CA 1F9RA 1R4QB 4HN7A 4AYBB 1V43A 5BN3A 4QMGA 4Q0FA 2K33A 5ELCA 1I3QB 3IFTA 3K57A 2AQ1B 2K7VA 4HTHA 2HCCA 3HZXA 5FO9B 1EY9A 4CKBA 2NTSA 1OXSC 3P75A 3QB3A 2D5DA 1BCPF 3G6JB 4X3SA 3OIPA 4U673 4A3DB 5EKIA 1RJTA 1JWSD 2AWOA 1GUNA 1RKNA 5DEHA 3MXPA 1WTOA 3S9WA 3IKJA 1STAA 5IGEA 4HSPA 2X69A 2L12A 1CTMA 3NTKA 3SHLA 2F0NA 4ME5A 2PZUA 4H13C 4ZUJA 2JA5B 2L5TA 4DGZA 5G3LD 1GUOA 1PRTF 5C5MA 4C1NI 1BR9A 2NBFA 3VR3A 1ZXTA 2TMPA 4Y7NB 4NMZA 2F0IA 1SE3A 3SE0A 2KECA 1I6HB 4IFDG 2JE6I 4DNTB 1RTNA 4I65A 1JORA 3JAML 1SDFA 2A6ED 4ABNA 2MP1A 2F0QA 1Y1WB 2F0VA 3W2DA 3BVMA 3H91A 3S16B 3PUZA 3ERQA 1DD2A 1MSGA 1GUWA 4DAPA 2BE5C 3I4MB 5KNDA 2N55A 4A3IB 1CM9A 5C3XA 1VDZA 1HTLD 1O7YA 3TP5A 4IUPA 5I2XA 5EPLA 2L4NA 2LY7A 2QEJC 1CQVA 4MIUA 4IUTA 4C3JB 3A8KE 5C44B 5K36H 4FYDA 1AN8A 3DWAA 1U4PA 3QG1A 4C3HB 2EYPA 1O78A 1NUCA 2PQEA 3L9AX 1X3QA 1DM0B 2K5WA 1IYVA 1HFNA 3A56A 2EYMA 1RDPD 1PFNA 3H0GB 1A3VA 1SMYC 1LT3D 3G7LA 2RDGA 3HRZC 2MJ8A 1II3A 1QB5D 4EQNA 5J39A 3JAME 4WRDA 1C4QA 3NK9A 3CQZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSN A;  1CA6 A;  2X6G A;  4HCS A;  1ILQ A;  1HRJ A;  2KEC A;  4XDX A;  1M8A A;  2JP1 A;  1B50 A;  4RA8 A;  4CJ1 B;  1EL0 A;  3DEO A;  2J7Z A;  2JYO A;  1RTN A;  1AZQ A;  1CA5 A;  1DOK A;  1BBX C;  2B2T A;  1SAP A;  1SDF A;  2HUG A;  2L1B A;  4ZLT F;  1WVL A;  2MP1 A;  2MGS A;  3MWY W;  3H91 A;  2B2T C;  4OIJ A;  4UAI A;  1O7Z A;  5CBA E;  2B2W A;  1B4O A;  2RA4 A;  2K28 A;  3IL8 A;  1DOM A;  5D65 A;  3MTS A;  1JE4 A;  2X6L A;  1HA6 A;  2Q8R E;  1MSG A;  1X3P A;  2SDF A;  1EOT A;  5DNF A;  5EPJ A;  1B2T A;  1DON A;  1AZP A;  1GUW A;  2VXW A;  3N52 A;  2N88 A;  5CBE E;  1PFM A;  1BO0 A;  2L11 A;  1BNZ A;  3I8Z A;  2B2U A;  5D14 A;  2MPM A;  1F9R A;  2L9H A;  5EPK A;  5T1I A;  1G2T A;  2B2U C;  4OIK A;  1BF4 A;  1EQT A;  2KUM A;  1IL8 A;  2N55 A;  1CM9 A;  1F9S A;  2FJ2 A;  1WD1 A;  1Q3L A;  1MSH A;  2B2V A;  2B2Y A;  4R8I A;  1O7Y A;  4CJ0 B;  1DOL A;  1DZ1 A;  2KED A;  4IUP A;  1NR2 A;  4IUU A;  5EPL A;  1J8I A;  2L4N A;  1X32 A;  5E4X A;  4X3T A;  1WTX A;  1C8C A;  1MI2 A;  4NW2 A;  2XIW A;  4IUT A;  1G2S A;  2HCC A;  1G6Z A;  2M2L A;  4HAE A;  1AP0 A;  1J9O A;  1VMC A;  4X3K A;  3GV6 A;  4CJ2 C;  4QUC A;  4MHE A;  2EE1 A;  1PLF A;  1S4Z A;  3R93 A;  3Q6S A;  1HHV A;  3DEP A;  3IFD A;  4X3U A;  2DY7 A;  1U4L A;  2HDL A;  1U4R A;  1WTV A;  1O80 A;  3SVM A;  2NZ1 D;  4LMQ D;  3I90 A;  1U4P A;  4X3S A;  4HED A;  4IUQ A;  4DN4 M;  1PDQ A;  1IKL A;  2K03 A;  1HFG A;  1SSO A;  2H1E A;  1F2L A;  3D6W A;  2K01 A;  2K04 A;  2NYZ D;  3P7J A;  3UI2 A;  2KVM A;  2Q8T A;  3HP3 A;  3TN2 A;  2FMM A;  5EKI A;  4XT1 B;  1X3Q A;  1NAP A;  2HCI A;  3KBX A;  1RJT A;  2BDN A;  1RTO A;  1QE6 A;  5EQ0 A;  1ICW A;  5CMD A;  4HSV A;  1HFN A;  3KUP A;  2EOT A;  2FHT A;  1U4M A;  1WTQ A;  1JIC A;  1B53 A;  1PFN A;  4IUV A;  1WTO A;  1B3A A;  5JJZ A;  1LV9 A;  4XT3 B;  4ZKC B;  2X69 A;  3DM1 A;  3I3C A;  1EIG A;  2L12 A;  1MGS A;  4U68 A;  4QUF A;  1WD0 A;  1ILP A;  3G7L A;  5E4W C;  4RAU C;  2HDM A;  4R9W A;  2DY8 A;  1KNE A;  1HUM A;  3I91 A;  1NCV A;  1XYI A;  1KNA A;  2B2V C;  1EIH A;  1RHP A;  3ONA B;  1HUN A;  1ROD A;  2RVL A;  5AFW A;  1QG7 A;  2B2W C;  5COR A;  1F9P A;  4ZKB B;  4IUR A;  1WTP A;  2R3Z A;  1WTW A;  5COY A;  5EJW A;  1G91 A;  1QNK A;  2RSO A;  1E0B A;  3F2U A;  3QO2 A;  1ESR A;  3GV3 A;  2EPB A;  4RWS C;  1A15 A;  2MJ8 A;  2B2Y C;  2FFK B;  2IL8 A;  2KOL A;  2FIN B;  3FDT A;  1PFB A;  3FPU B;  5T1G A;  1F9Q A;  2KEE A;  1TVX A;  2D9U A;  1NR4 A;  1XX8 A;  2CVR A;  3LWE A;  3TZD A;  4ZK9 B;  4ZAI A;  1ZXT A;  4MN3 A;  4O42 A;  1WTR A;  1IKM A;  2K05 A;  2NWG A;  1VMP A;  2K1B A;  1ML0 D; 
#chains in the Genus database with same CATH topology
 4PNY A;  1RD9 D;  1Z47 A;  1K0S A;  1ILQ A;  2VUM H;  4IPC A;  4DXG A;  1EL0 A;  2F0D A;  4RHS A;  1KAB A;  2WB1 E;  3MHB A;  1TQO A;  3CAM A;  5FOB B;  2Q2I A;  1EY6 A;  1NBW A;  1JR0 D;  5DM7 3;  5M9O A;  1VQM A;  4JVZ A;  3JC6 6;  3T16 A;  2R7F A;  1A62 A;  2RDH A;  2BDO A;  5DNF A;  5NUC A;  4BBR H;  1Q12 A;  4M1U B;  1EQT A;  1RL2 A;  1F9S A;  3A8I E;  1KTK A;  1V8Q A;  4DV5 Q;  3OW7 A;  2F0J A;  4CBV A;  1M4V A;  4AQY Q;  1A2U A;  1Z7T A;  5CYU A;  3T1Y Q;  2M00 A;  1VQ8 A;  1E2W A;  1TWF B;  5TSS A;  3NWT A;  2B63 B;  3TP7 A;  4H44 C;  1VMC A;  3BYY B;  2UUB Q;  2CH4 W;  1V1Q A;  2A6E C;  4X64 L;  1LTG D;  4R4T A;  2EVB A;  1STB A;  1Q1E A;  1E24 A;  2WKC A;  4XQN A;  3OMG A;  2R7D A;  3BVZ A;  3CCV A;  3C1F A;  3F1Z A;  2GVB A;  2MNA A;  3BZK A;  2Q8T A;  1SXT A;  1GHK A;  4XT1 B;  5M3F G;  1GOZ A;  3FP9 A;  4MTN A;  4MNO A;  2Z0S A;  3J81 L;  5EAY A;  3PO3 H;  4EGV A;  2PCF B;  1TS5 A;  3T56 B;  4A93 H;  3S2D H;  1EIY B;  1EEI D;  3NQI A;  4OGQ C;  4A3E B;  4FDB A;  2FXQ A;  2Z4H A;  5JJZ A;  4EX5 A;  4A3E H;  3I4N B;  2PMZ B;  4JI2 Q;  3MC0 B;  4A3M B;  4EQP A;  4A3M G;  1DYQ A;  2Z9H A;  1Q82 C;  3I91 A;  3PUY A;  3HFZ B;  2H4O A;  1X9N A;  1EIH A;  1HUN A;  5ELO A;  4JBK A;  4R4Q A;  4C2M H;  2A68 C;  3E6Z X;  2JK8 A;  4ODG A;  2OCE A;  2KOL A;  3I56 A;  3N6R A;  2O4X A;  3S1N H;  1XX8 A;  4UP9 A;  4AH6 A;  2EDG A;  4ZK9 B;  4DR1 L;  4DNR B;  4MN3 A;  1Y14 B;  2EJF C;  1SN8 A;  3KF6 A;  3NBH A;  1ML0 D;  2EY6 A;  3NPP A;  3UE1 A;  1LM0 A;  2MFI A;  4IUN A;  4KTA A;  5M5Y H;  1CFM A;  1ESF A;  4JYA Q;  2N3S A;  2IPK D;  5FO7 B;  4DV6 Q;  1D5X C;  1L0Y B;  4YY3 L;  2L1B A;  3KLS A;  4X6A H;  4A75 A;  2MGS A;  4DV4 L;  3K0Y A;  5FLM G;  2B8F A;  5BR8 L;  2NZH A;  2PZW A;  2Y0S G;  2RCN A;  1IBK L;  1CZW A;  1X3P A;  4N9T A;  3EBE A;  2EQS A;  2N88 A;  1PFM A;  3RLN A;  1T5E A;  5JJL A;  2L9H A;  3CQZ H;  5I2Y A;  4DR6 Q;  4DUZ Q;  1ASZ A;  3OMC A;  4M8A A;  4F88 A;  2Z6K A;  2VNU D;  2Z8L A;  1SRO A;  4JI4 Q;  3PIO 3;  5KEE A;  4FXD A;  5FJ8 H;  2JA7 G;  2A73 B;  3TME A;  1SRU A;  4FF3 A;  2VQE Q;  4A3L G;  1C8C A;  1STE A;  4F87 A;  3D8G A;  4HIM A;  3H3V H;  3M4O H;  2OF1 A;  2EE1 A;  4E6I A;  1GUG A;  3KDF A;  3Q6S A;  4DA2 A;  2Z6B A;  3NEL A;  4JW0 A;  3J7Z C;  4LF5 L;  4JI8 Q;  1Y1W G;  4LMQ D;  4DUY L;  2B8G A;  1UEA B;  1MJC A;  2F0E A;  5M3F H;  4C56 C;  4K2K A;  2VQE L;  3LNN A;  2OQK A;  2KVM A;  3D3R A;  3KF8 B;  1H9S B;  1E2Z A;  3ER0 A;  2LSS A;  3RMH A;  5JAV A;  3AEV A;  3GTP H;  2RBM A;  2NVX H;  3HEJ A;  4K6D A;  1ICW A;  4L5S A;  4JI3 Q;  1U4M A;  1OXV A;  4YCW A;  4QCL A;  2KA7 A;  2E74 C;  3NQT A;  1STN A;  2EY1 A;  1P8L A;  3EFX D;  4U68 A;  5HUR A;  1I4G A;  4B3T L;  2F0W A;  5E4W C;  1C0A A;  4OHJ A;  2BH2 A;  1TKW B;  3F8T A;  1QG7 A;  3S15 B;  3BG3 A;  4RKL A;  4J15 A;  4DV4 Q;  1JMC A;  5CV9 A;  1G91 A;  1CK1 A;  1QNK A;  3F2U A;  1HZC A;  3GV3 A;  1XMO Q;  1VQL A;  1FNV A;  2EPB A;  3H94 A;  2O2L D;  3STB D;  2HQE A;  2PQA B;  3HOV H;  3Q8D A;  2D9U A;  1NR4 A;  3NEN A;  5IP7 H;  3SK4 A;  2ZXP A;  1S5C D;  2KHJ A;  4F8M A;  2LXJ A;  4I7A A;  4GKJ L;  2F0H A;  3I4N G;  2PQA A;  4B3S Q;  1L1O C;  1OO9 B;  2HQL A;  5KIX A;  4B3T Q;  3I55 A;  1YNJ D;  3EN2 A;  1HQR D;  4GLV B;  4KHZ A;  1BUV T;  4PQX A;  4G4K A;  2F0F A;  2B2W A;  2K4K A;  2MUY A;  3ITP A;  1PMR A;  4GN3 B;  2MHV A;  3RZO B;  3CME A;  1AZP A;  4YWL A;  3OTO L;  3SK5 A;  3NBH B;  4C3J H;  3P20 A;  3I4M G;  1BBU A;  3LWU A;  4DV0 L;  3A54 A;  4R8I A;  2PNR C;  2KED A;  4IUU A;  5CV6 A;  1A63 A;  1B3Q A;  5GAD C;  4GN5 A;  2JN4 A;  3KF8 A;  5E4X A;  1STG A;  2VY3 A;  1EUJ A;  1YHQ A;  1K8O A;  1PH5 A;  5ISR A;  3V96 A;  4PMC A;  1A3U A;  2FMC A;  5JVG 3;  3E9I A;  4GLA C;  1EQR A;  2A8V A;  2DGY A;  4HJ9 A;  4LF6 L;  2A6H C;  1QJO A;  4O0A A;  4GNX C;  5GQO A;  3ZYY X;  3OW2 A;  1JOQ A;  1PH3 A;  3TRZ A;  1L1O B;  2XRS D;  5IWA Q;  2NYZ D;  2EIF A;  4ZUI A;  2FMM A;  1UE1 A;  1SYE A;  5ELB A;  1DCZ A;  2F0T A;  4UHV A;  1JB7 A;  1JQY D;  4APV A;  5LMU Q;  4LF9 Q;  1SLJ A;  4K8J A;  5C0X G;  1CI3 M;  3FRP B;  3CXC A;  3BYT B;  3H15 A;  2JEA I;  2UXB L;  1J5E L;  4QUF A;  1WD0 A;  1X54 A;  3UDG A;  1IBM L;  1VQH A;  2HDM A;  1KNE A;  1TWG B;  4LF4 Q;  3HOX B;  4JI0 L;  3ONA B;  3J81 c;  3DMU A;  2QW7 A;  4QY7 A;  3RD4 A;  4NXN Q;  3PO2 B;  1BQQ T;  5E1F A;  3TEH B;  1E0B A;  2WII B;  3OWE B;  3ERS X;  3VYT A;  1CKN B;  4DR5 L;  1W6J A;  4KKT A;  2FFK B;  4XIG S;  1VF5 C;  2FIN B;  5CC4 A;  4A4I A;  5GAE C;  2K50 A;  1AW7 A;  3VYU A;  3J7A V;  1T5X D;  4HCS A;  1D2B A;  1HPC A;  4KY5 A;  3K5M A;  2K6A A;  5I9P A;  3W1G A;  1FD7 D;  1J6Q A;  5C3E B;  1TWG H;  4HIO A;  1Y8O B;  2R6G A;  3Q23 A;  1EY5 A;  3M3Y B;  4ILW A;  1S5D D;  5C6A A;  2DN8 A;  1PZI D;  3CCM A;  1JWM D;  4LK1 C;  3OWF A;  2K28 A;  2JA5 G;  1JE4 A;  2X6L A;  1TWH B;  2C5C A;  3DWQ A;  5J22 A;  1S72 A;  3OTO Q;  4C3J G;  3DUZ A;  4A3J B;  2R7Z H;  2L11 A;  1LTR D;  4K0K Q;  1TS2 A;  2EYF A;  3TSS A;  2R92 G;  3HOY G;  1MD2 D;  1JC7 A;  3W3A A;  2A5H A;  3A5Z B;  3MAQ A;  2QGQ A;  1PV4 A;  3D31 A;  1J8I A;  3FPP A;  3GTL B;  4X3T A;  1LTA D;  1Y69 U;  2UUB L;  1SMX A;  3S2D B;  1MI2 A;  3R2T A;  1YBY A;  5DAU A;  4FF2 A;  4X64 Q;  4DAV A;  2EXZ A;  3MA2 B;  1XMQ Q;  5K5P A;  4QUC A;  2PW7 A;  1JE5 A;  2ZTD A;  2RKS A;  2KHI A;  4HMI A;  2DY7 A;  3OSO A;  1AEX A;  3K0X A;  4DN4 M;  2YU9 H;  4RCO A;  3H09 A;  4A3I H;  4UP7 A;  1EY7 A;  3BU2 A;  4DR3 Q;  1F2L A;  1UUP A;  2Q2U A;  3TN2 A;  3HP3 A;  3TP8 A;  4GOP A;  4X66 Q;  1PRT B;  2R93 H;  4DV1 L;  1QVF A;  1WJJ A;  1L1O A;  3PF4 A;  3G6E A;  2B29 A;  2LMC B;  3DHQ A;  1UNS A;  1WCM G;  1A8V A;  1FGU A;  4DR5 Q;  3S2H B;  2L0C A;  4JI3 L;  1FGB D;  4XTC S;  2JQO A;  1MGS A;  4X65 L;  3H6M A;  2AWN A;  3ZJY C;  1PH8 A;  4IOA A;  4JPB W;  2KCC A;  4ZQ3 A;  4DR7 Q;  3HOZ B;  4LF9 L;  4CHT B;  1K83 B;  4DPG A;  1FVI A;  1PFB A;  1VQK A;  2KEE A;  1EU4 A;  1S3O A;  3FKI G;  3LWE A;  1YI2 A;  4O42 A;  4JOI A;  1X3G A;  3HKZ E;  2X6G A;  2HHH Q;  1E2V A;  4YY3 Q;  1N8R C;  4DV6 L;  1EZ8 A;  1PFS A;  1FNW A;  4L5Q A;  1I4R A;  2JJQ A;  1MHW C;  2JYO A;  1AZQ A;  1K3R A;  5C0X H;  2B2T A;  1SJH D;  2HUG A;  5IGG A;  2UUA Q;  2MO0 A;  2E8G A;  2MO1 A;  4DR1 Q;  4KHP L;  4DV3 L;  4OO1 G;  3D0F A;  4KKS A;  4WJ4 A;  3GDE A;  5EPJ A;  3FEW X;  1H9R A;  1K3B C;  3NWS A;  3M4P A;  3SEB A;  1D6E C;  4YWK A;  1FJG Q;  1BDO A;  1SYG A;  2D62 A;  1EOV A;  2YTY A;  1KD1 C;  1GO3 E;  4P75 A;  4X62 L;  4CKC A;  2VS1 A;  3A55 A;  1FNU A;  3GTO B;  3OYY A;  5KRU A;  1X32 A;  4KJN A;  1LT6 D;  1B9N A;  3CCE A;  4BXX G;  2O5I C;  3RZO H;  4G7Z C;  2N8N A;  1PTO C;  5IGC A;  4X3K A;  4B08 A;  4CJ2 C;  2ENB A;  3R93 A;  2QKI C;  1TY0 A;  4X3U A;  4LF7 L;  4C3H H;  3GTJ B;  4A3B B;  3U9S A;  1SMY D;  2Z1C A;  3I2Z A;  1K83 H;  5KNB A;  2NZO A;  4UY8 C;  1HCZ A;  3CHB D;  4JBJ A;  2OTL A;  4OEL B;  2HCI A;  3CRL C;  4LWC A;  1QZG A;  1YVC A;  5FK9 C;  1SFO B;  4A3C G;  1I6V C;  1PH6 A;  3U9O A;  4K5V A;  3KLS X;  1JCK B;  5KYL A;  4ULL A;  1H9S A;  5IOD A;  1KAA A;  4LF4 L;  4JI6 L;  4XYO A;  4ZKC B;  1I94 Q;  3X3N A;  4FP5 D;  3VYR A;  1IBM Q;  3NTH A;  4HJ7 A;  2UXB Q;  2TSS A;  3I4M H;  5AFW A;  4K2L A;  1E1O A;  1LTS D;  1VQD A;  3GD7 A;  1XNR L;  4JCV E;  1RCV D;  5M3M B;  4L63 B;  1XXG A;  3PMF A;  2E75 C;  3ULL A;  3KBG A;  3FPU B;  1YHB A;  4RGO S;  3HKS A;  4ZAI A;  4BY7 G;  2ALY B;  4K5X A;  3S2H H;  4DV3 Q;  1F2M A;  3TRE A;  3Q22 A;  2WB1 B;  4QGU A;  2C9O A;  4A3G B;  2I5L X;  1YIT A;  5BN5 A;  4JI5 Q;  1M90 C;  2BCO A;  1NMF A;  1JOO A;  1KDA A;  2YV5 A;  2WAC A;  2CKZ B;  1X3F A;  5DM6 3;  3J80 E;  1B7Y B;  3VDY A;  1AE2 A;  3VA5 A;  4BA2 I;  5EBC A;  3I4N H;  1DGS A;  1DXM A;  1EFW A;  3RN5 A;  2B2T C;  4XYQ A;  1O7Z A;  2UUC L;  1D8L A;  4G57 A;  3IL8 A;  1HA6 A;  4DR7 L;  4DU9 A;  2K5H A;  3KOJ A;  3MEF A;  5D3D A;  5IYD G;  1K8G A;  4Q5V A;  1X3E A;  3I8Z A;  1PH9 A;  4LUV A;  4IPH A;  2F0P A;  1LT5 D;  4RKB A;  4N9P A;  4IZ8 A;  5JPN C;  1IYU A;  2B2Y A;  2XRQ D;  2KHS A;  2BH8 A;  1STH A;  2LFN A;  2QIL A;  4AIM A;  1CKM A;  2UU9 Q;  3NHH A;  2A68 D;  2E2J H;  3M7G A;  2VB3 X;  3CCR A;  2F0M A;  3B6Y A;  2EYJ A;  2ES2 A;  3Q24 A;  2EJG C;  4R4C A;  2RDF A;  1R9T B;  3K81 C;  1LTI D;  2Y0S B;  3DEP A;  3W1B A;  2D0P A;  2CQA A;  1O80 A;  4BBR G;  2N78 A;  1NSN S;  4PZ7 A;  4JV5 L;  2ZM6 Q;  1GXD C;  5KYI A;  5C0X I;  4YWM A;  1ASY A;  1LTT D;  1QVC A;  3S1M B;  3QOJ A;  4HSV A;  1BCP B;  3BZC A;  2UXC L;  5FLX L;  4QIW E;  4R8N A;  3IRB A;  5JEA H;  2EJM A;  4RCN A;  1HTP A;  3DM1 A;  2F4V Q;  2WIN B;  1VQJ A;  3M4Q A;  3OIQ A;  4PZ6 A;  1PTO D;  1UEB A;  1Y8P B;  2IX3 A;  1F9P A;  1PRT D;  4R4I A;  1TWA H;  2L15 A;  2D0O A;  3GTQ H;  1FL0 A;  3F2B A;  2B63 G;  4LFA Q;  4FVM A;  3AMU A;  1K28 A;  4OWX B;  3PQI A;  5EKK A;  2AUJ D;  2VQF Q;  3PO3 B;  1U5K A;  4QJF A;  2OXP A;  4XXE A;  4DR2 Q;  2IWH A;  2PZT A;  4KHP Q;  3G4S A;  1GHJ A;  1CA6 A;  1HRJ A;  2WFW A;  1PHJ A;  1DJR D;  2XGT A;  4V19 0;  1M8A A;  1SYF A;  3L0O A;  5G3L F;  1PTO B;  1S5E D;  1NNX A;  3NEM A;  5C4J B;  2JA9 A;  1KLG D;  1ZKO A;  4IOC A;  1HZA A;  1I3Q H;  4OEM B;  4RH6 A;  5LMN Q;  5D3I B;  1OTC A;  1K8M A;  3GP7 A;  2OWO A;  4A3E G;  3NBI A;  5KGU A;  1DON A;  1Y1V G;  5CBE E;  4BS9 A;  5CGK A;  3GTL H;  4DV0 Q;  3HOV G;  1IL8 A;  2K5D A;  4DV5 L;  4DUZ L;  3GQB A;  4CJ0 B;  1P16 A;  3HGB A;  4A3M H;  5ELF A;  1LUZ A;  4C3H G;  1WI5 A;  4J8Q A;  3CU7 A;  4ME3 A;  1PA6 A;  4IPD A;  3RUZ A;  3C46 A;  1Q81 C;  4ZYS A;  2NN6 G;  4QF4 A;  2V1C C;  4DV7 Q;  5C4X G;  1AP0 A;  3I73 A;  3K58 A;  4JI6 Q;  5C4X B;  4A3K H;  3GTO H;  5IYD H;  1U4R A;  4QB4 A;  1WTV A;  1Z6H A;  4ZRZ A;  3M85 A;  1JOK A;  1PDQ A;  1QUQ B;  1IKL A;  2YTV A;  1SNQ A;  5M5X H;  3J7A 5;  1EYA A;  2JA6 G;  3ND9 A;  1BKB A;  2EYH A;  5JEA J;  5JOB A;  4LFC L;  3NUC A;  5IOC A;  1VQ6 A;  1LV9 A;  4J1M A;  3Q0A A;  4XT3 B;  1GUT A;  4OO1 I;  1G8Z D;  2RHS B;  4CDD C;  3R3O A;  2CW0 C;  2BE5 D;  2SEB D;  3P1H A;  1HUM A;  2B2V C;  1CKO A;  4JI1 Q;  1I94 L;  2RVL A;  4RGM A;  3SXH A;  2NVX B;  4JI1 L;  2A69 D;  1XJV A;  3QO2 A;  2ICE C;  4IN3 A;  1ONL A;  3HOZ G;  5IP9 G;  4P74 A;  4GKK L;  2F52 A;  2PO4 A;  2A69 C;  2RHQ B;  1LO5 D;  4KKU A;  1EWC A;  1EZ6 A;  4KLK A;  5IGF A;  4A3F H;  4B3S L;  1FJG L;  2ZT9 C;  5C3W A;  2IHE A;  4P2C B;  4KV6 A;  1CQF A;  1N33 L;  2M9V A;  1VQ7 A;  2PI2 A;  4FF4 A;  2Q8I B;  2VUM B;  1PXU A;  3L7Z C;  1TT2 A;  5FKA C;  1F2Z A;  4L8J A;  1O7I A;  5IYB H;  3S17 H;  5CBA E;  3M7N A;  3NXW A;  2KCT A;  2UUA L;  5D65 A;  1XMO L;  4YIJ A;  5M5Y B;  1GKH A;  4AYB E;  3A5U A;  2VXW A;  1PRT C;  4KI0 A;  4A3F B;  3FHW A;  5EPK A;  2R7Z B;  1G2T A;  2IT1 A;  3UE0 A;  3M4O B;  1BF4 A;  1EFI D;  5JJK A;  1CHP D;  3WWV A;  1WD1 A;  4DAM A;  3U4Z A;  2A6H D;  2LS0 1;  1JJC B;  2I46 A;  1C7Y A;  2ICI A;  1IBK Q;  4A3K B;  1B8A A;  1A3T A;  2K5Q A;  3J7Y W;  4NB3 A;  1XTC D;  2UU9 L;  4TKO B;  3D4D A;  1G2S A;  3QIA A;  2JA8 B;  1J9O A;  3HOW B;  2L55 A;  1EYG A;  1CZG A;  1PLF A;  3K7A B;  4Y52 H;  3MZ5 A;  1G6P A;  4IFD I;  4UP8 A;  4KD4 A;  2BA1 A;  1B9M A;  1SYB A;  4IUQ A;  1PH7 A;  2JEB I;  2K03 A;  1GJX A;  2IJ0 A;  4RGT A;  3HOU H;  3TBI B;  4C2M B;  3GTK B;  4LAA A;  4IJH A;  4Y7N H;  3E0E A;  4DV1 Q;  4KY6 A;  4X66 L;  4JI7 L;  2V4D A;  1RIP A;  1N32 L;  4MZ9 A;  5M3M H;  2J0T D;  3I4L A;  5C4X H;  1ZYR D;  3ULJ A;  2ZXO A;  5CV7 A;  3CCJ A;  4FNF A;  1KNA A;  3BDL A;  1RHP A;  4A3D G;  4UPA A;  3PUV A;  2IY5 B;  5LL6 X;  4LFA L;  4NP5 A;  4V0B A;  3PUW A;  1RF2 D;  2NVT H;  1M1K C;  4POF A;  3J81 j;  1PYW D;  2CFM A;  2QCP X;  3K59 A;  1VMP A;  2K5N A;  5E3F A;  3KK7 A;  1UWV A;  3JAM c;  3VR2 A;  1NJI C;  3O13 A;  4F7X A;  3BVG A;  3D4W A;  1ET9 A;  2RCF A;  4YHH Q;  3VR5 A;  1YJW A;  1TWF H;  4ZLT F;  1U0L A;  5C4H A;  3EJI A;  4DV2 Q;  3UDF A;  1LAB A;  1KIX A;  3MWY W;  3PF5 A;  1I5F A;  3HOV B;  4Z9C B;  4GZY C;  1VQB A;  1QCB D;  3T1Y L;  4B9W A;  4TQU S;  2G9H D;  2EXD A;  4GLX A;  1IW7 C;  1BNZ A;  3PUX A;  1H9K A;  5T1I A;  5EKL A;  2QEX A;  2ZJQ A;  2WP8 J;  1VF7 A;  3HKZ B;  3S14 B;  1OXU A;  2Z4I A;  3MFY A;  3R2I A;  1KAW A;  1VQF A;  3GTM B;  1EWI A;  1SNP A;  1NR2 A;  1VQG A;  1CKN A;  5I4D A;  3VR6 A;  5EBD A;  5CR3 A;  1STY A;  4JI4 L;  3PO2 H;  4S3S A;  1QNU A;  5IYC H;  1QUQ A;  1SE4 A;  3HS0 C;  1Q7Y C;  1G6Z A;  2E2I H;  5GAH C;  1V1P A;  3U4V A;  3ULP A;  1SR3 A;  1QWY A;  2B3G A;  2BOS A;  2HT1 A;  2IX0 A;  1KDC A;  4HR7 B;  4X65 Q;  4GOP C;  3IFD A;  3TZU A;  3J80 i;  2F03 A;  3DM3 A;  2R7Z G;  3SVM A;  2NZ1 D;  3S14 H;  1KDB A;  4B3M L;  4BBS G;  1WCM B;  2K04 A;  1E22 A;  5EGT A;  3C3L A;  2I5M X;  1BBW A;  1AFP A;  2MQH A;  3EVQ A;  1EWH A;  1HNZ Q;  1LAC A;  3S1N B;  5HGQ A;  3S17 B;  5C44 H;  1HNZ L;  4IUV A;  1BVS A;  2JA8 G;  4A3C H;  5IYC G;  2CW0 D;  2QDL A;  1EIF A;  4OL7 A;  3J81 E;  3I3C A;  2F0K A;  3SR1 A;  3J7A F;  4RAU C;  1VS0 A;  2DY8 A;  4KN4 C;  5KNC A;  3CPW A;  3HOY H;  1ROD A;  3CMA A;  1OXT A;  4OWW B;  1JWU D;  4LFB L;  1WTW A;  3HKZ G;  2CWA A;  1B1Z A;  4RWS C;  3LX0 A;  4JBM A;  3FDT A;  3V05 A;  4BY1 B;  3ERO A;  5T1G A;  3UDI A;  4LW1 A;  4QL5 A;  1D1K A;  2K05 A;  4HJ5 A;  5K36 G;  2ATW A;  1B50 A;  1VQE A;  3S1M H;  4KJO A;  1TXY A;  2J7Z A;  4UDU C;  4KD3 A;  2WAQ E;  1DOK A;  4RMF A;  4JC0 A;  3CRK C;  5CV8 A;  4OO1 H;  1IYJ B;  2E76 C;  4NXM L;  1EQV A;  2Q8R E;  3K8A A;  4LUZ A;  1B2T A;  3BZD B;  5ELE A;  4OX9 L;  4A3G H;  1EYD A;  3TS2 A;  4K5W A;  4CGY B;  5M3F B;  2F0U A;  2UXD Q;  1EY4 A;  5A2Q E;  2RF4 A;  3HOW G;  3S16 H;  1LTL A;  3U50 C;  4AQY L;  2CWP A;  4KY7 A;  4P72 A;  5CV5 A;  4C3I H;  1EEF D;  1BCP C;  2EY2 A;  2YTX A;  1CSQ A;  2K52 A;  3RZD H;  2KQ3 A;  4B9X A;  3SK6 A;  1I4Q A;  3T4A C;  1W3S A;  3T1H Q;  4LFC Q;  4HCE A;  3M3Y H;  1ENA A;  1UAP A;  2GA4 B;  4P71 A;  3I90 A;  1HJP A;  4L6T B;  1PZK D;  2AUK A;  3PCO B;  4BY1 H;  4KK7 A;  1ILP A;  2K01 A;  4A76 A;  5C5L A;  1NAP A;  3S1R H;  3VA7 A;  4DK6 C;  4A3J H;  5IIF A;  1K0R A;  2PMZ E;  1I4P A;  4A3F G;  2EOT A;  3MFG A;  3R8B A;  1YNN C;  1Q90 A;  4C3I G;  1VQ4 A;  2HIV A;  1TY2 A;  1NMG A;  4HJ8 A;  1KC8 C;  4L5R C;  1EY8 A;  3FMC A;  1HNW Q;  2GVA A;  2XSC A;  4IPG A;  4LF6 Q;  2A19 A;  5BN4 A;  1PTO H;  1YNN D;  4TRD A;  1XYI A;  1KQS A;  1HNX Q;  3ND8 A;  4CKE A;  4WJW A;  4BXX H;  2PI2 E;  1BXT A;  1Z9F A;  2NN6 I;  3A8J E;  2F0L A;  3MEH A;  4ZKB B;  1LT4 D;  1IW7 D;  4KMU C;  5COY A;  4R4O A;  3T13 A;  1QZH A;  2B2Y C;  2WKD A;  2OEO A;  5HGT A;  1S40 A;  5IGB A;  1TVX A;  1VCI A;  1IKM A;  3RLO A;  4A3J G;  3K7A H;  3X3M A;  4IJL A;  2K1B A;  2WAQ B;  4C1N K;  4RGN A;  4QIW B;  3CW2 C;  3D4R A;  4TSS A;  2R92 B;  3DEO A;  5LL6 S;  5LMN L;  3GTK H;  4XQQ A;  3DXJ C;  3RZD B;  5LHY 1;  4FXK C;  1H9M A;  4DNI A;  2NUC A;  2SDF A;  3CF5 A;  1F77 A;  1BO0 A;  1YNJ C;  4GKJ Q;  5D14 A;  1BOS A;  1IL2 A;  3S1R B;  3CD6 A;  1UE6 A;  2SNS A;  4B3R L;  2JA8 H;  4NPS A;  4WJ3 M;  2CQO A;  2YU9 B;  5H1S E;  4GS3 A;  4H02 A;  1HQM C;  4EQO A;  3L2P A;  3KJO A;  4NKL A;  1XWE A;  2B39 A;  1PZJ D;  5DLQ E;  1SJE D;  2XIW A;  3HOU G;  3G48 A;  4HAE A;  1C48 A;  3RR5 A;  1S4Z A;  4OWT B;  1Y1W H;  1A2T A;  4K0K L;  1U4L A;  1V1O A;  3MXN A;  4A93 B;  3BS1 A;  2YYZ A;  3GTG H;  2ZTC A;  1I50 H;  5I6W A;  1JJ2 A;  1CHQ D;  1HXY D;  2G9D A;  3KFU A;  2A74 C;  2QDB A;  5FLM H;  3CC7 A;  1O7L A;  2PPB C;  5C0X J;  3SGI A;  1VQO A;  2ZM6 L;  3JAM i;  1QE6 A;  4JI7 Q;  1EYC A;  2IW3 A;  3BJU A;  1Q8I A;  1TU2 B;  2FHT A;  3BDC A;  1SYC A;  5AJ3 L;  3T53 B;  3PIP 3;  3FKI B;  1H9J A;  2PW5 A;  3LGJ A;  2F0O A;  1B3A A;  1H95 A;  3TP6 A;  1PTO F;  2GN5 A;  3I4O A;  1CT1 D;  1EIG A;  2KJX A;  4RHR A;  1V1P B;  5ELN A;  2BA0 A;  2ZJR A;  2D2C C;  1MBY A;  2VUM G;  4IUR A;  2R3Z A;  5EJW A;  4RG1 A;  2RSO A;  1ESR A;  1D1I A;  4LUO A;  2DJG C;  2IL8 A;  1I50 B;  5A2Q L;  3TZD A;  4FXG C;  2CH4 A;  1JB3 A;  1SNM A;  2HD3 A;  4LF8 Q;  1TWA B;  4XDX A;  1YJN A;  2XVS A;  1K9M C;  4RA8 A;  4RFB A;  5A35 A;  4FF1 A;  1CA5 A;  1WOC A;  3I72 A;  5IYB G;  2KEN A;  1BCP D;  4JYA L;  5M5W H;  2DNE A;  1GVP A;  1A6X A;  5I6Y A;  3NTI A;  2QA4 A;  1K73 C;  2E2I B;  1WFQ A;  3VYS A;  1YNX A;  3AFQ A;  3GTP B;  3SDZ A;  2JA5 H;  3A7A B;  2AMC B;  3DLL A;  3K6O A;  4JI8 L;  2EYO A;  3QR8 A;  4AYB G;  1XMQ L;  3C1E A;  2FJ2 A;  3K7U C;  2WAQ G;  1Q3L A;  1MSH A;  5GAG C;  1WYD A;  3GTJ H;  1DOL A;  2F0G A;  4FO2 A;  4IFD H;  2F3I A;  3S1Q H;  1CSP A;  2IX1 A;  5FLX E;  1X55 A;  4BA1 I;  1D5M C;  5L37 A;  1WTX A;  2AQ2 B;  4NW2 A;  5JVH 3;  3HOX H;  2M2L A;  3MXU A;  1JT8 A;  4A3D H;  2K75 A;  3H0G H;  3TS0 A;  1X65 A;  3HG9 A;  1S5F D;  1TWH H;  4BWG B;  1D7Q A;  4DR6 L;  1Q86 C;  1FYC A;  4HED A;  4JBW A;  1B44 D;  3P7J A;  2NVQ H;  3D6W A;  3UI2 A;  2NN6 H;  1HA5 A;  4IQZ A;  3CCL A;  2QF7 A;  2BDN A;  1OXX K;  3U58 A;  3CPF A;  1XTD A;  1WTQ A;  5FO8 B;  4JK1 C;  4I7Z C;  2F4V L;  3MXN B;  1N9W A;  3KLR A;  3AB9 A;  3I7F A;  5C44 G;  2DNC A;  1IBL L;  1WTH A;  2XN9 C;  1D5Z C;  4ALP A;  1SEB D;  4DV2 L;  2OTJ A;  2E2J B;  2B2W C;  5C4Z A;  4G7H C;  1W6K A;  1WTP A;  2R93 B;  5ELD A;  2NVQ B;  2SNM A;  1A15 A;  4IFD J;  1SND A;  1Y8N B;  2F3V A;  1ZEQ X;  2EYL A;  4DR4 L;  4CDF C;  2E2H B;  1LLR D;  1LTB D;  2CVR A;  2RQX A;  1L0W A;  4K8I A;  3RLF A;  3E0J A;  2NWG A;  3PGZ A;  1HR0 Q;  3QOL A;  4EQ5 A;  5J3B A;  2Q2T A;  2JP1 A;  3CP0 A;  1EY0 A;  1BBX C;  5IP9 H;  3A74 A;  3AU7 A;  2K32 A;  2UXD L;  2WV6 D;  2XWJ B;  1F2Y A;  4OIJ A;  1ENF A;  4UAI A;  2XNA C;  2AQ3 B;  4KHV A;  3BDO A;  3NP8 A;  1DOM A;  4H7B A;  2OT2 A;  2AHO B;  1HR0 W;  3WDN A;  5M5X B;  4MTK A;  1XPO A;  2HHH L;  1I6H H;  4H0L C;  3J81 i;  3IAY A;  3WOE A;  2ASB A;  5C3E G;  1L2F A;  4OIK A;  2G5D A;  2KUM A;  2NTT A;  1EU3 A;  1ZYR C;  2K5V A;  2E2H H;  1SYD A;  4NDX A;  4BY7 B;  1YIJ A;  1TS4 A;  3E5S A;  1SNC A;  1DZ1 A;  3K5N A;  5I9O A;  4DF7 A;  3T51 B;  4PMB A;  2LXK A;  2Z6K C;  3EQL C;  2PYK A;  3QWN A;  2B63 H;  2NVY H;  1Q8K A;  1YZ6 A;  3GV6 A;  2SOB A;  4MHE A;  3CKI B;  3SK8 A;  1HHV A;  1X56 A;  3KLW A;  2LKV A;  4B3M Q;  3QJY A;  1MJE A;  2ID0 A;  1EQQ A;  3MXG A;  2NVT B;  5JEA G;  3T1H L;  1VQN A;  4LFB Q;  1L0X B;  2Y0S E;  1X6O A;  1IHZ A;  3HOX G;  3GTQ B;  1S5B D;  2JSO A;  3I70 A;  4DR3 L;  2UXC Q;  5IT9 E;  5EQ0 A;  3URY A;  1MIU A;  1NE3 A;  1JJG A;  1SBB B;  2NB0 A;  1JIC A;  1B53 A;  3PO3 G;  1V9P A;  1PH1 A;  1E3P A;  5IT9 L;  1VQ5 A;  1Q1B A;  5FLX c;  1HNX L;  1N33 Q;  3NSW A;  3PIO A;  5COR A;  2A1A A;  1VQP A;  1TII D;  3M9B A;  3HOU B;  1PH4 A;  1AH9 A;  4K14 A;  4BBR B;  3S1Q B;  1TWC B;  3M4Y A;  4DXF A;  3L3O C;  5F2D A;  3OOC A;  3TDQ A;  3NE5 B;  1Y1V B;  3J80 L;  2XWB B;  3MVV A;  5AJ3 Q;  2ZXR A;  4GKK Q;  1R4P B;  3E3X A;  2J4X A;  4YHH L;  1SFO H;  1KLU D;  5FJ8 G;  2JA7 H;  3HOY B;  1ENC A;  2VB2 X;  2JA7 B;  3DWP A;  1I4H A;  4GNX A;  4JI0 Q;  4J6H A;  3V2T A;  1CUK A;  4IAL A;  1XNQ L;  4X62 Q;  1QIL A;  2RA4 A;  4EVO A;  2Q2H A;  4DK1 A;  2JXM B;  2F4I A;  4PMW A;  4A3B H;  1TWC H;  2UUC Q;  3N52 A;  4DR4 Q;  2CCZ A;  3WOF A;  2B2U A;  2MPM A;  4BY1 G;  3FVQ A;  2B2U C;  1WCM H;  4DK0 A;  3C2P A;  1I4X A;  2I07 B;  4KN7 C;  1KRT A;  5IE8 A;  4OXP A;  2B2V A;  5IWA L;  4B3R Q;  1HZ9 A;  1B70 B;  2KCN A;  4G7O C;  3K5O A;  1UE7 A;  1G29 1;  3OHX C;  1KXL A;  4A3I G;  3H3V C;  4JV5 Q;  3AQQ A;  3CC2 A;  2R92 H;  3EIV A;  2F0S A;  4HMJ A;  4O2D A;  1E7Z A;  4YCV A;  3F2C A;  4K6L A;  4BBS B;  2E2D C;  4DV7 L;  1GUS A;  3PV0 A;  2CHB D;  1N36 Q;  1IZ6 A;  2HDL A;  1TS3 A;  1ET6 A;  1GM5 A;  2IHF A;  4LJZ C;  2I0Q A;  5CV4 A;  5IY0 A;  4L5T A;  1TR5 A;  1HFG A;  1SSO A;  2H1E A;  1SNO A;  5M5W B;  3KDF B;  2EZV A;  2E5L Q;  3KBX A;  3EA6 A;  1RTO A;  2WB1 G;  4XQJ A;  2E5L L;  5CMD A;  2F3W A;  3KUP A;  3OPO A;  4WFN 3;  1N36 L;  2JA6 H;  5E7N A;  4GOP B;  3A0J A;  3A7L A;  4O1N A;  1QOH A;  3FKI H;  4R9W A;  4N8F A;  1SE2 A;  1NCV A;  1FR3 A;  5IGD A;  4WOR A;  1K8A C;  2KBN A;  4DFA A;  3K5L A;  2VL6 A;  4YCU A;  2O5J C;  4DR2 L;  5IP7 G;  4PV1 C;  3CCU A;  1T9H A;  2F1M A;  3GTG B;  1F9Q A;  4JI5 L;  4GN4 B;  1WTR A;  1N34 Q;  5GRO A;  2RSN A;  4DAY A;  4DAY B;  4DKA C;  2VQF L;  2JA6 B;  2NVY B;  3KF6 B;  4JOI C;  3VR4 A;  1G51 A;  4CJ1 B;  1A0I A;  4JG2 A;  2R61 A;  1HR0 L;  4C3I B;  2HIX A;  4ID6 A;  2N49 A;  1SAP A;  1KHI A;  5BR8 Q;  2EY5 A;  1PH2 A;  1WVL A;  4CDC C;  1U9R A;  3GO5 A;  2KCM A;  4BY7 H;  5JPM C;  1B4O A;  4GNX B;  3E9H A;  1XNQ Q;  1PVO A;  1PYB A;  4A3K G;  3AFP A;  3MTS A;  1ICF B;  5J1Z A;  1EOT A;  4LNQ A;  3D6C A;  1HZB A;  1Q46 A;  1F9R A;  1R4Q B;  4OON A;  4HN7 A;  4AYB B;  1V43 A;  2R93 G;  1YHA A;  4QMG A;  5BN3 A;  1XPU A;  4Q0F A;  2K33 A;  5ELC A;  1I3Q B;  3IFT A;  4IO9 A;  3STB C;  3K57 A;  5C4J H;  2AQ1 B;  2K7V A;  4HTH A;  5C3E H;  4NXM Q;  4OX9 Q;  2HCC A;  3H3V I;  3HZX A;  5FO9 B;  1EY9 A;  4CKB A;  4LF7 Q;  4N8X 1;  2NTS A;  1OXS C;  3P75 A;  1YEZ A;  3QB3 A;  2PNH A;  2D5D A;  3RNU A;  1BCP F;  1SE8 A;  3G6J B;  3PO2 G;  3CCQ A;  4X3S A;  4NXN L;  3F2D A;  1E1T A;  3OIP A;  3S24 A;  4U67 3;  4A3D B;  5EKI A;  1KL9 A;  1R9T H;  1RJT A;  1AE3 A;  2C35 B;  2DUD A;  1JWS D;  2AWO A;  1GUN A;  1RKN A;  1J5E Q;  5DEH A;  4LF5 Q;  3MXP A;  1WTO A;  4TVA B;  3S9W A;  3IKJ A;  1STA A;  4HSP A;  5IGE A;  2X69 A;  4PZ8 A;  3GTM H;  1UE5 A;  2L12 A;  1CTM A;  3NTK A;  4P73 A;  4A3G G;  1VQC A;  3SHL A;  2F0N A;  3AYH B;  2OQ0 A;  4ME5 A;  2PZU A;  4H13 C;  4ZUJ A;  3UDX A;  4HJA A;  2ZJP A;  2JA5 B;  4A93 G;  3W5O A;  1NY4 A;  1N32 Q;  2L5T A;  4DGZ A;  5G3L D;  1GUO A;  1PRT F;  5C5M A;  2H5X A;  1BR9 A;  4C1N I;  5IT9 c;  1W2B A;  1IXR A;  2NBF A;  3HOZ H;  3VR3 A;  1ZXT A;  2TMP A;  4Y7N B;  4HID A;  4NMZ A;  3CC4 A;  2F0I A;  1SE3 A;  3SE0 A;  2KEC A;  1I6H B;  2VW9 A;  4IFD G;  2JE6 I;  3S15 H;  3KYH C;  4LF8 L;  4DNT B;  1XNR Q;  1RTN A;  4I65 A;  1VQ9 A;  1GD7 A;  1JOR A;  3JAM L;  1SDF A;  2A6E D;  2I5H A;  4ABN A;  2DJF C;  2VZA A;  2MP1 A;  2F0Q A;  1Y1W B;  2F0V A;  3W2D A;  3J80 c;  3BVM A;  1HH2 P;  3H91 A;  5HY6 A;  1KRS A;  3S16 B;  3PUZ A;  2XTI A;  3ERQ A;  3HOW H;  3H0G G;  1DD2 A;  1C9O A;  1MSG A;  1GUW A;  1MKH A;  4DAP A;  3G71 A;  2BE5 C;  3I4M B;  5KND A;  2N55 A;  4A3I B;  1CM9 A;  1LYL A;  5C3X A;  1VDZ A;  1HTL D;  4PG3 A;  1O7Y A;  3TP5 A;  4IUP A;  1VQA A;  5I2X A;  5EPL A;  2L4N A;  2LY7 A;  4HIK A;  2QEJ C;  3K80 C;  5M3M G;  4CDE C;  1CQV A;  4MIU A;  4IUT A;  2AKW B;  2P5Z X;  4C3J B;  4JI2 L;  3RN2 A;  5LMN W;  3PIP A;  3A8K E;  2K14 A;  5C44 B;  5K36 H;  3ICE A;  4FYD A;  3PSI A;  1AN8 A;  3DWA A;  1U4P A;  1XPR A;  4A3L H;  3QG1 A;  2EYP A;  4C3H B;  4POG A;  1O78 A;  1NUC A;  2PQE A;  3L9A X;  1X3Q A;  4BBS H;  4A3B G;  3TQY A;  1DM0 B;  2K5W A;  1Y1V H;  5LMU L;  1IYV A;  1VQI A;  3A56 A;  1HFN A;  2EYM A;  1RDP D;  1QVG A;  1PFN A;  4ZCK A;  3H0G B;  1A3V A;  1SMY C;  1LT3 D;  1PYS B;  3G7L A;  1N34 L;  1NTG A;  2RDG A;  1IBL Q;  1YJ9 A;  4DUY Q;  3HRZ C;  5JJI A;  2MJ8 A;  1II3 A;  4QQB X;  3CCS A;  1QB5 D;  4EQN A;  5J39 A;  3JAM E;  2ZTE A;  4WRD A;  1C4Q A;  4DK3 C;  1HNW L;  3KJP A;  4R1J A;  3NK9 A;  3CQZ B; 
#chains in the Genus database with same CATH homology
 4PNY A;  1RD9 D;  1Z47 A;  1ILQ A;  4DXG A;  1EL0 A;  2F0D A;  4RHS A;  1KAB A;  3MHB A;  1TQO A;  5FOB B;  1EY6 A;  1JR0 D;  5DM7 3;  5M9O A;  3T16 A;  2RDH A;  2BDO A;  5DNF A;  5NUC A;  1Q12 A;  4M1U B;  1EQT A;  1F9S A;  3A8I E;  1KTK A;  1V8Q A;  3OW7 A;  2F0J A;  4CBV A;  1M4V A;  1A2U A;  1Z7T A;  5CYU A;  2M00 A;  1E2W A;  1TWF B;  5TSS A;  3NWT A;  2B63 B;  3TP7 A;  4H44 C;  1VMC A;  3BYY B;  2A6E C;  1LTG D;  2EVB A;  1STB A;  1Q1E A;  2WKC A;  4XQN A;  3OMG A;  3BVZ A;  3C1F A;  2Q8T A;  1SXT A;  1GHK A;  4XT1 B;  1GOZ A;  3J81 L;  4EGV A;  2PCF B;  1TS5 A;  3T56 B;  1EEI D;  3NQI A;  4OGQ C;  4A3E B;  2Z4H A;  5JJZ A;  3I4N B;  2PMZ B;  3MC0 B;  4A3M B;  4EQP A;  1DYQ A;  3I91 A;  3PUY A;  1EIH A;  2H4O A;  1HUN A;  2A68 C;  3E6Z X;  4ODG A;  2KOL A;  3N6R A;  2O4X A;  1XX8 A;  4ZK9 B;  2EDG A;  4DNR B;  4MN3 A;  2EJF C;  3NBH A;  1ML0 D;  2EY6 A;  3NPP A;  4IUN A;  4KTA A;  1CFM A;  1ESF A;  2IPK D;  5FO7 B;  1D5X C;  1L0Y B;  2L1B A;  3KLS A;  2MGS A;  3K0Y A;  2B8F A;  2PZW A;  1CZW A;  1X3P A;  4N9T A;  2N88 A;  1PFM A;  1T5E A;  2L9H A;  5I2Y A;  3OMC A;  4M8A A;  4F88 A;  2VNU D;  2Z8L A;  3PIO 3;  5KEE A;  4FXD A;  2A73 B;  3TME A;  4FF3 A;  1C8C A;  1STE A;  4F87 A;  3D8G A;  2OF1 A;  2EE1 A;  4E6I A;  1GUG A;  3Q6S A;  4DA2 A;  4LMQ D;  2B8G A;  1UEA B;  2F0E A;  4C56 C;  4K2K A;  3LNN A;  2KVM A;  3D3R A;  1H9S B;  1E2Z A;  3RMH A;  5JAV A;  2RBM A;  3HEJ A;  1ICW A;  4K6D A;  1U4M A;  1OXV A;  4QCL A;  2KA7 A;  2E74 C;  3NQT A;  1STN A;  2EY1 A;  3EFX D;  4U68 A;  5HUR A;  1I4G A;  2F0W A;  5E4W C;  4OHJ A;  1TKW B;  1QG7 A;  3S15 B;  3BG3 A;  4RKL A;  5CV9 A;  1G91 A;  1CK1 A;  1QNK A;  3F2U A;  3GV3 A;  1FNV A;  2EPB A;  3H94 A;  2O2L D;  2HQE A;  2D9U A;  1NR4 A;  3SK4 A;  2ZXP A;  1S5C D;  4F8M A;  2F0H A;  5KIX A;  1OO9 B;  1YNJ D;  1HQR D;  4KHZ A;  1BUV T;  4PQX A;  2F0F A;  4G4K A;  2B2W A;  2MUY A;  3ITP A;  1PMR A;  2MHV A;  3RZO B;  1AZP A;  3SK5 A;  3P20 A;  3LWU A;  3A54 A;  4R8I A;  2PNR C;  2KED A;  4IUU A;  5CV6 A;  3KF8 A;  5E4X A;  1STG A;  1K8O A;  5ISR A;  3V96 A;  4PMC A;  1A3U A;  2FMC A;  5JVG 3;  2A6H C;  1QJO A;  3ZYY X;  1JOQ A;  2XRS D;  2NYZ D;  4ZUI A;  2FMM A;  1SYE A;  5ELB A;  1DCZ A;  2F0T A;  1JQY D;  4K8J A;  5C0X G;  1CI3 M;  3FRP B;  2JEA I;  3BYT B;  4QUF A;  1WD0 A;  2HDM A;  1KNE A;  1TWG B;  3HOX B;  3ONA B;  3DMU A;  3RD4 A;  3PO2 B;  1BQQ T;  5E1F A;  1E0B A;  2WII B;  3OWE B;  3VYT A;  1W6J A;  4KKT A;  4XIG S;  2FFK B;  1VF5 C;  2FIN B;  5CC4 A;  1AW7 A;  3VYU A;  3J7A V;  1T5X D;  4HCS A;  1D2B A;  1HPC A;  4KY5 A;  3K5M A;  2K6A A;  5I9P A;  1FD7 D;  5C3E B;  1Y8O B;  2R6G A;  3Q23 A;  1EY5 A;  3M3Y B;  4ILW A;  1S5D D;  5C6A A;  2DN8 A;  1PZI D;  1JWM D;  4LK1 C;  3OWF A;  2K28 A;  1JE4 A;  2X6L A;  1TWH B;  2C5C A;  3DWQ A;  5J22 A;  4C3J G;  3DUZ A;  4A3J B;  2L11 A;  1LTR D;  1TS2 A;  2EYF A;  3TSS A;  1MD2 D;  1JC7 A;  3W3A A;  2A5H A;  3MAQ A;  3D31 A;  1J8I A;  3FPP A;  3GTL B;  4X3T A;  1LTA D;  1Y69 U;  3S2D B;  1MI2 A;  3R2T A;  5DAU A;  4FF2 A;  4DAV A;  2EXZ A;  3MA2 B;  5K5P A;  4QUC A;  2PW7 A;  2RKS A;  4HMI A;  2DY7 A;  3OSO A;  1AEX A;  4DN4 M;  4RCO A;  3H09 A;  1EY7 A;  1F2L A;  1UUP A;  3TN2 A;  3HP3 A;  3TP8 A;  1PRT B;  2LMC B;  3DHQ A;  1UNS A;  3S2H B;  2L0C A;  1FGB D;  4XTC S;  1MGS A;  3H6M A;  2AWN A;  2KCC A;  4ZQ3 A;  3HOZ B;  4CHT B;  1K83 B;  1PFB A;  2KEE A;  1EU4 A;  3LWE A;  4O42 A;  2X6G A;  1E2V A;  1EZ8 A;  1FNW A;  1I4R A;  2JYO A;  1AZQ A;  5C0X H;  2B2T A;  1SJH D;  2HUG A;  5IGG A;  4OO1 G;  4KKS A;  5EPJ A;  3FEW X;  1H9R A;  3NWS A;  3SEB A;  1D6E C;  1BDO A;  1SYG A;  2D62 A;  4CKC A;  3A55 A;  1FNU A;  3GTO B;  5KRU A;  1X32 A;  4KJN A;  1LT6 D;  1B9N A;  2O5I C;  4G7Z C;  1PTO C;  5IGC A;  4X3K A;  4B08 A;  4CJ2 C;  2ENB A;  3R93 A;  2QKI C;  1TY0 A;  4X3U A;  3GTJ B;  4A3B B;  3U9S A;  1SMY D;  2Z1C A;  5KNB A;  1HCZ A;  3CHB D;  2HCI A;  3CRL C;  5FK9 C;  1SFO B;  1I6V C;  3U9O A;  4K5V A;  3KLS X;  1JCK B;  5KYL A;  4ULL A;  1H9S A;  5IOD A;  1KAA A;  4XYO A;  4ZKC B;  3X3N A;  4FP5 D;  3VYR A;  3NTH A;  2TSS A;  5AFW A;  4K2L A;  1LTS D;  3GD7 A;  1RCV D;  5M3M B;  4L63 B;  1XXG A;  3PMF A;  2E75 C;  3KBG A;  3FPU B;  4RGO S;  4ZAI A;  4K5X A;  1F2M A;  3Q22 A;  4A3G B;  2WB1 B;  2C9O A;  5BN5 A;  2BCO A;  1JOO A;  1KDA A;  2WAC A;  5DM6 3;  3J80 E;  3VA5 A;  4BA2 I;  5EBC A;  1DXM A;  2B2T C;  4XYQ A;  1O7Z A;  4G57 A;  3IL8 A;  1HA6 A;  4DU9 A;  5D3D A;  4Q5V A;  3I8Z A;  2F0P A;  1LT5 D;  4RKB A;  4N9P A;  4IZ8 A;  5JPN C;  1IYU A;  2B2Y A;  2XRQ D;  2KHS A;  1STH A;  2LFN A;  2QIL A;  3NHH A;  2A68 D;  3M7G A;  2VB3 X;  2F0M A;  2EYJ A;  3Q24 A;  2EJG C;  2RDF A;  1R9T B;  1LTI D;  2Y0S B;  3DEP A;  2CQA A;  1O80 A;  1NSN S;  1GXD C;  5KYI A;  5C0X I;  1LTT D;  3S1M B;  3QOJ A;  4HSV A;  1BCP B;  5FLX L;  4R8N A;  5JEA H;  2EJM A;  4RCN A;  1HTP A;  3DM1 A;  2WIN B;  3OIQ A;  1PTO D;  1Y8P B;  2IX3 A;  1F9P A;  1PRT D;  4FVM A;  3AMU A;  5EKK A;  2AUJ D;  3PO3 B;  2OXP A;  4XXE A;  2IWH A;  2PZT A;  1GHJ A;  1CA6 A;  1HRJ A;  1DJR D;  4V19 0;  1M8A A;  1SYF A;  5G3L F;  1PTO B;  1S5E D;  5C4J B;  1KLG D;  1ZKO A;  4RH6 A;  5D3I B;  1K8M A;  3GP7 A;  3NBI A;  5KGU A;  1DON A;  5CBE E;  4BS9 A;  5CGK A;  1IL8 A;  2K5D A;  3GQB A;  4CJ0 B;  3HGB A;  5ELF A;  4C3H G;  4J8Q A;  3CU7 A;  3RUZ A;  3C46 A;  4ZYS A;  2NN6 G;  4QF4 A;  1AP0 A;  3I73 A;  3K58 A;  5C4X B;  1U4R A;  4QB4 A;  1WTV A;  1Z6H A;  4ZRZ A;  3M85 A;  1JOK A;  1PDQ A;  1IKL A;  1SNQ A;  1EYA A;  3ND9 A;  5JEA J;  2EYH A;  5JOB A;  3NUC A;  5IOC A;  1LV9 A;  4J1M A;  3Q0A A;  4XT3 B;  1GUT A;  4OO1 I;  1G8Z D;  3R3O A;  2CW0 C;  2BE5 D;  2SEB D;  3P1H A;  1HUM A;  2B2V C;  2RVL A;  4RGM A;  3SXH A;  2NVX B;  2A69 D;  3QO2 A;  2ICE C;  4IN3 A;  1ONL A;  2PO4 A;  2A69 C;  1LO5 D;  4KKU A;  1EWC A;  1EZ6 A;  5IGF A;  2ZT9 C;  5C3W A;  4P2C B;  4KV6 A;  1CQF A;  2M9V A;  4FF4 A;  2Q8I B;  2VUM B;  1PXU A;  3L7Z C;  1TT2 A;  5FKA C;  1F2Z A;  4L8J A;  5CBA E;  3M7N A;  3NXW A;  5D65 A;  4YIJ A;  5M5Y B;  2VXW A;  1PRT C;  4KI0 A;  4A3F B;  5EPK A;  2R7Z B;  1G2T A;  2IT1 A;  3M4O B;  1BF4 A;  1EFI D;  1CHP D;  1WD1 A;  2A6H D;  2LS0 1;  2I46 A;  2ICI A;  4A3K B;  1A3T A;  2K5Q A;  3J7Y W;  1XTC D;  2JA8 B;  4TKO B;  3D4D A;  1G2S A;  3QIA A;  1J9O A;  3HOW B;  2L55 A;  1CZG A;  1PLF A;  3K7A B;  3MZ5 A;  4IFD I;  4KD4 A;  2BA1 A;  1B9M A;  1SYB A;  4IUQ A;  2JEB I;  2K03 A;  1GJX A;  2IJ0 A;  4RGT A;  3TBI B;  4C2M B;  3GTK B;  4LAA A;  4KY6 A;  2V4D A;  2J0T D;  3I4L A;  1ZYR D;  2ZXO A;  5CV7 A;  4FNF A;  1KNA A;  3BDL A;  1RHP A;  3PUV A;  5LL6 X;  4NP5 A;  4V0B A;  3PUW A;  1RF2 D;  1PYW D;  2QCP X;  3K59 A;  1VMP A;  5E3F A;  3KK7 A;  3VR2 A;  3O13 A;  4F7X A;  3BVG A;  3D4W A;  1ET9 A;  3VR5 A;  4ZLT F;  5C4H A;  3EJI A;  1LAB A;  3MWY W;  3HOV B;  4Z9C B;  4GZY C;  1QCB D;  4B9W A;  4TQU S;  2G9H D;  1IW7 C;  1BNZ A;  3PUX A;  1H9K A;  5T1I A;  5EKL A;  2WP8 J;  1VF7 A;  3HKZ B;  3S14 B;  1OXU A;  2Z4I A;  3MFY A;  3R2I A;  3GTM B;  1SNP A;  1NR2 A;  5I4D A;  3VR6 A;  5EBD A;  5CR3 A;  1STY A;  4S3S A;  1QNU A;  1SE4 A;  3HS0 C;  1G6Z A;  1V1P A;  1QWY A;  2BOS A;  2IX0 A;  1KDC A;  4HR7 B;  3IFD A;  3TZU A;  2F03 A;  3SVM A;  2NZ1 D;  1KDB A;  1WCM B;  2K04 A;  5EGT A;  3C3L A;  1AFP A;  3EVQ A;  1EWH A;  1LAC A;  3S1N B;  3S17 B;  4IUV A;  2CW0 D;  4OL7 A;  3J81 E;  3I3C A;  2F0K A;  3SR1 A;  3J7A F;  4RAU C;  2DY8 A;  4KN4 C;  5KNC A;  1ROD A;  1OXT A;  1JWU D;  1WTW A;  1B1Z A;  4RWS C;  3LX0 A;  3FDT A;  3V05 A;  4BY1 B;  3ERO A;  5T1G A;  1D1K A;  2K05 A;  5K36 G;  1B50 A;  4KJO A;  2J7Z A;  4UDU C;  4KD3 A;  1DOK A;  3CRK C;  5CV8 A;  4OO1 H;  2E76 C;  1EQV A;  2Q8R E;  1B2T A;  3BZD B;  5ELE A;  1EYD A;  4K5W A;  4CGY B;  5M3F B;  2F0U A;  1EY4 A;  5A2Q E;  4KY7 A;  5CV5 A;  1EEF D;  1BCP C;  2EY2 A;  2KQ3 A;  4B9X A;  3SK6 A;  1I4Q A;  3T4A C;  4HCE A;  1ENA A;  1UAP A;  2GA4 B;  3I90 A;  4L6T B;  1PZK D;  2AUK A;  4KK7 A;  1ILP A;  2K01 A;  5C5L A;  1NAP A;  3VA7 A;  5IIF A;  1I4P A;  2EOT A;  3MFG A;  3R8B A;  1YNN C;  1Q90 A;  4C3I G;  1TY2 A;  1EY8 A;  3FMC A;  2XSC A;  5BN4 A;  1PTO H;  1YNN D;  4TRD A;  1XYI A;  3ND8 A;  4CKE A;  4WJW A;  1BXT A;  2NN6 I;  3A8J E;  3MEH A;  2F0L A;  4ZKB B;  1LT4 D;  1IW7 D;  4KMU C;  5COY A;  3T13 A;  2B2Y C;  2WKD A;  2OEO A;  5HGT A;  5IGB A;  1TVX A;  1VCI A;  1IKM A;  3X3M A;  2K1B A;  2WAQ B;  4C1N K;  4RGN A;  4QIW B;  3D4R A;  4TSS A;  2R92 B;  3DEO A;  5LL6 S;  4XQQ A;  3DXJ C;  3RZD B;  5LHY 1;  4FXK C;  1H9M A;  2NUC A;  2SDF A;  1F77 A;  1BO0 A;  1YNJ C;  5D14 A;  1BOS A;  3S1R B;  2SNS A;  2YU9 B;  1HQM C;  4EQO A;  4NKL A;  1XWE A;  2B39 A;  1PZJ D;  1SJE D;  2XIW A;  4HAE A;  1C48 A;  1S4Z A;  1A2T A;  1U4L A;  1V1O A;  3MXN A;  4A93 B;  3BS1 A;  2YYZ A;  5I6W A;  1CHQ D;  1HXY D;  2G9D A;  2A74 C;  2QDB A;  1O7L A;  2PPB C;  5C0X J;  1QE6 A;  1EYC A;  2IW3 A;  1Q8I A;  1TU2 B;  2FHT A;  3BDC A;  1SYC A;  3T53 B;  3PIP 3;  3FKI B;  1H9J A;  2PW5 A;  2F0O A;  1B3A A;  3TP6 A;  1PTO F;  1CT1 D;  1EIG A;  2KJX A;  4RHR A;  1V1P B;  2BA0 A;  2D2C C;  1MBY A;  4IUR A;  2R3Z A;  5EJW A;  2RSO A;  1ESR A;  1D1I A;  2IL8 A;  1I50 B;  5A2Q L;  3TZD A;  4FXG C;  1JB3 A;  1SNM A;  1TWA B;  4XDX A;  2XVS A;  4RA8 A;  5A35 A;  4RFB A;  4FF1 A;  1CA5 A;  3I72 A;  1BCP D;  2DNE A;  1A6X A;  5I6Y A;  3NTI A;  2E2I B;  3VYS A;  3GTP B;  3SDZ A;  3A7A B;  3K6O A;  2EYO A;  3C1E A;  2FJ2 A;  1Q3L A;  1MSH A;  1DOL A;  2F0G A;  4FO2 A;  4IFD H;  2IX1 A;  5FLX E;  4BA1 I;  1D5M C;  1WTX A;  2AQ2 B;  4NW2 A;  5JVH 3;  2M2L A;  3MXU A;  3HG9 A;  1S5F D;  4BWG B;  1FYC A;  4HED A;  4JBW A;  1B44 D;  3P7J A;  3D6W A;  3UI2 A;  2NN6 H;  1HA5 A;  4IQZ A;  2QF7 A;  2BDN A;  1OXX K;  1WTQ A;  5FO8 B;  4JK1 C;  4I7Z C;  3KLR A;  3AB9 A;  2DNC A;  2XN9 C;  1D5Z C;  1SEB D;  2E2J B;  2B2W C;  5C4Z A;  4G7H C;  1W6K A;  1WTP A;  2R93 B;  5ELD A;  2NVQ B;  2SNM A;  1A15 A;  4IFD J;  1SND A;  1Y8N B;  2F3V A;  1ZEQ X;  2EYL A;  2E2H B;  1LLR D;  1LTB D;  2CVR A;  2RQX A;  4K8I A;  3RLF A;  3E0J A;  2NWG A;  3QOL A;  2JP1 A;  1EY0 A;  1BBX C;  3AU7 A;  2K32 A;  2WV6 D;  2XWJ B;  1F2Y A;  4OIJ A;  1ENF A;  4UAI A;  2XNA C;  2AQ3 B;  4KHV A;  3BDO A;  3NP8 A;  1DOM A;  4H7B A;  2OT2 A;  3WDN A;  5M5X B;  4H0L C;  3IAY A;  3WOE A;  4OIK A;  2KUM A;  2NTT A;  1EU3 A;  1ZYR C;  1SYD A;  4NDX A;  4BY7 B;  1TS4 A;  3E5S A;  1SNC A;  1DZ1 A;  3K5N A;  5I9O A;  4DF7 A;  3T51 B;  4PMB A;  3EQL C;  2PYK A;  3QWN A;  3GV6 A;  2SOB A;  4MHE A;  3CKI B;  3SK8 A;  1HHV A;  2LKV A;  3QJY A;  2ID0 A;  3MXG A;  2NVT B;  5JEA G;  1L0X B;  1IHZ A;  3GTQ B;  1S5B D;  2JSO A;  3I70 A;  5IT9 E;  5EQ0 A;  3URY A;  1SBB B;  2NB0 A;  1JIC A;  1B53 A;  5IT9 L;  1Q1B A;  3NSW A;  5COR A;  1TII D;  3HOU B;  4K14 A;  4BBR B;  3S1Q B;  1TWC B;  3M4Y A;  4DXF A;  3L3O C;  5F2D A;  3OOC A;  3TDQ A;  3NE5 B;  1Y1V B;  3J80 L;  2XWB B;  3MVV A;  2ZXR A;  1R4P B;  2J4X A;  1KLU D;  3HOY B;  1ENC A;  2VB2 X;  2JA7 B;  3DWP A;  1I4H A;  4J6H A;  3V2T A;  4IAL A;  1QIL A;  2RA4 A;  4EVO A;  4DK1 A;  2JXM B;  2F4I A;  4PMW A;  3N52 A;  3WOF A;  2B2U A;  2MPM A;  3FVQ A;  2B2U C;  4DK0 A;  3C2P A;  1I4X A;  2I07 B;  4KN7 C;  2B2V A;  2KCN A;  4G7O C;  3K5O A;  1G29 1;  3OHX C;  3H3V C;  2F0S A;  4HMJ A;  4K6L A;  4BBS B;  2E2D C;  1GUS A;  3PV0 A;  2CHB D;  2HDL A;  1TS3 A;  1ET6 A;  4LJZ C;  5CV4 A;  1TR5 A;  1SSO A;  1HFG A;  2H1E A;  1SNO A;  5M5W B;  2EZV A;  3KBX A;  3EA6 A;  1RTO A;  4XQJ A;  5CMD A;  2F3W A;  3KUP A;  3OPO A;  4WFN 3;  3A7L A;  4O1N A;  1QOH A;  4R9W A;  1SE2 A;  1NCV A;  1FR3 A;  5IGD A;  4WOR A;  4DFA A;  3K5L A;  2O5J C;  4PV1 C;  2F1M A;  3GTG B;  1F9Q A;  1WTR A;  2RSN A;  4DAY A;  2JA6 B;  2NVY B;  3VR4 A;  4CJ1 B;  2R61 A;  4C3I B;  4ID6 A;  1SAP A;  2EY5 A;  1WVL A;  1U9R A;  3GO5 A;  5JPM C;  1B4O A;  3MTS A;  5J1Z A;  1EOT A;  3D6C A;  1F9R A;  1R4Q B;  4HN7 A;  4AYB B;  1V43 A;  5BN3 A;  4QMG A;  4Q0F A;  2K33 A;  5ELC A;  1I3Q B;  3IFT A;  3K57 A;  2AQ1 B;  2K7V A;  4HTH A;  2HCC A;  3HZX A;  5FO9 B;  1EY9 A;  4CKB A;  2NTS A;  1OXS C;  3P75 A;  3QB3 A;  2D5D A;  1BCP F;  3G6J B;  4X3S A;  3OIP A;  4U67 3;  4A3D B;  5EKI A;  1RJT A;  1JWS D;  2AWO A;  1GUN A;  1RKN A;  5DEH A;  3MXP A;  1WTO A;  3S9W A;  3IKJ A;  1STA A;  5IGE A;  4HSP A;  2X69 A;  2L12 A;  1CTM A;  3NTK A;  3SHL A;  2F0N A;  4ME5 A;  2PZU A;  4H13 C;  4ZUJ A;  2JA5 B;  2L5T A;  4DGZ A;  5G3L D;  1GUO A;  1PRT F;  5C5M A;  4C1N I;  1BR9 A;  2NBF A;  3VR3 A;  1ZXT A;  2TMP A;  4Y7N B;  4NMZ A;  2F0I A;  1SE3 A;  3SE0 A;  2KEC A;  1I6H B;  4IFD G;  2JE6 I;  4DNT B;  1RTN A;  4I65 A;  1JOR A;  3JAM L;  1SDF A;  2A6E D;  4ABN A;  2MP1 A;  2F0Q A;  1Y1W B;  2F0V A;  3W2D A;  3BVM A;  3H91 A;  3S16 B;  3PUZ A;  3ERQ A;  1DD2 A;  1MSG A;  1GUW A;  4DAP A;  2BE5 C;  3I4M B;  5KND A;  2N55 A;  4A3I B;  1CM9 A;  5C3X A;  1VDZ A;  1HTL D;  1O7Y A;  3TP5 A;  4IUP A;  5I2X A;  5EPL A;  2L4N A;  2LY7 A;  2QEJ C;  1CQV A;  4MIU A;  4IUT A;  4C3J B;  3A8K E;  5C44 B;  5K36 H;  4FYD A;  1AN8 A;  3DWA A;  1U4P A;  3QG1 A;  4C3H B;  2EYP A;  1O78 A;  1NUC A;  2PQE A;  3L9A X;  1X3Q A;  1DM0 B;  2K5W A;  1IYV A;  1HFN A;  3A56 A;  2EYM A;  1RDP D;  1PFN A;  3H0G B;  1A3V A;  1SMY C;  1LT3 D;  3G7L A;  2RDG A;  3HRZ C;  2MJ8 A;  1II3 A;  1QB5 D;  4EQN A;  5J39 A;  3JAM E;  4WRD A;  1C4Q A;  3NK9 A;  3CQZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...