4LF9Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf9Q00
1WI5A 1BVSA 4B3ML 4B3TL 3W1BA 3CAMA 5C0XJ 5IWAL 1HNZL 4PMWA 1N36L 4YCUA 5GQOA 1I94Q 3LGJA 4ME3A 1YEZA 2NN6I 1W2BA 3W1GA 1VQKA 1U5KA 4LUOA 3H3VI 4KHPQ 4OX9L 4DR6Q 1E3PA 3K0XA 1VQPA 2WB1G 3PUYA 2LSSA 4LF6L 1VQ6A 4HIKA 4DR5Q 2LXJA 2R7ZG 4NPSA 3G6EA 4LFAQ 3BZCA 4JI0L 3GTGH 1XMQQ 1UEBA 1TWHH 2Y0SE 4P72A 2K52A 1WOCA 4APVA 3B6YA 4B3RL 2E2HH 4DV4Q 2UXCQ 3J81c 1EFWA 4X6AH 2F4VQ 2A19A 1VQ9A 1CKNB 4BXXG 1JJGA 3OYYA 3GTLH 3KFUA 3E9HA 3CCEA 3FKIG 3GO5A 1Y1VG 3PUZA 1VQLA 2ZM6Q 1J5EL 2RCNA 5ELOA 1XNRL 4K0KL 2E2JH 1IL2A 5FJ8H 2ES2A 4BBRH 2JA6G 1Y1WG 4TQUS 5FLMG 2A1AA 4QY7A 4GKKQ 5IYBG 5LMNL 1Q1BA 4JI7L 4L5RC 4LFCQ 5E7NA 4BY7H 1K83H 1O7IA 2RHQB 5JEAG 1PH2A 4POGA 3AEVA 4DR2L 1EYGA 4LW1A 4YCWA 4WJ3M 2YV5A 2GVAA 4GNXB 2OTLA 2WB1E 4JYAQ 1JJ2A 4JI5L 1K0RA 1NE3A 4J15A 1I94L 5GROA 2E5LL 4A93G 1XNQQ 4KHPL 1U0LA 3TREA 5GAHC 2R92H 1EUJA 5GADC 5C4JH 5IYCH 4WJ4A 4JI6Q 2IY5B 4DR5L 4X66Q 4KLKA 3PIPA 2KCTA 4JOIA 3MXNB 4LFAL 4JI4L 1XMQL 2CQOA 2GVBA 4P74A 4IPCA 4JI1Q 3CD6A 1KHIA 4LUZA 1A0IA 3PUWA 4LUVA 4AH6A 2F4VL 4GNXC 2UXCL 2EQSA 3RLNA 3I7FA 5ELNA 4DR3Q 2C35B 3AFPA 3U58A 3F8TA 5IP9H 3L7ZC 4DAYB 1EQQA 4A3IG 1CSQA 1K8AC 3STBC 2KENA 3H0GG 4BA1I 2JK8A 2VY3A 1KL9A 2JA9A 4NXNQ 1WCMG 1YIJA 1HH2P 1PH7A 4B3SQ 1B8AA 1XJVA 2OWOA 3RN5A 4BBSG 4GKKL 2R6GA 1SN8A 3HOXG 4LNQA 4P73A 4DV0Q 1SFOH 2IT1A 3OTOQ 1X65A 2CCZA 3PF5A 3DLLA 1PFSA 1QUQB 1E1TA 1YNXA 4R4QA 2I5MX 1Z47A 3KJOA 1KRTA 1NMGA 1E7ZA 5M5WH 2BH2A 3E9IA 4HJ5A 4A3JG 1XNQL 4A3GH 1CKOA 4QIWE 4C2MH 2CWAA 4L5QA 4JI2Q 1TWAH 2R7DA 4JI6L 1C0AA 1I3QH 3IRBA 4IPGA 4IOAA 4GLAC 1ASYA 1CKNA 1X56A 4JI1L 3PV0A 3M9BA 1P8LA 1VQMA 5IYDH 4UP7A 4AYBG 1HNXQ 1N9WA 3ERSX 3F2DA 4IOCA 4QL5A 1GM5A 2AWOA 4DR3L 3I4OA 4MNOA 4HIDA 1IBKQ 2VZAA 1VQBA 4H02A 3G48A 1UE6A 1NMFA 3ULPA 2E8GA 4LF9L 4LF5L 1HNWQ 1D7QA 3S1QH 4NXNL 4YCVA 3U4ZA 2PQAB 3F1ZA 1XMOQ 4B3SL 4A3FH 4LFBQ 4IJHA 2ZJPA 2JQOA 2NVQH 1VQAA 4DV0L 4GNXA 5M3FG 2JEBI 4X64Q 5FJ8G 4BBRG 5C4XH 3HKZE 3PGZA 2NVYH 4XTCS 4BY7G 4QGUA 3J80i 1Q82C 2CFMA 1IBLL 5M5YH 3CCVA 3K7AH 2NN6G 3ULJA 4C3HH 4FDBA 1K9MC 1N34L 1JMCA 5M5XH 4JI2L 4JI8L 4P71A 1YJWA 1Q7YC 2KHIA 2HT1A 1EOVA 4LF7Q 1KC8C 4R4OA 3G4SA 3T1YQ 2I5LX 1PA6A 2PNHA 1VS0A 3NEMA 2R92G 1S40A 1XTDA 3UDGA 4A3MH 3KJPA 3TS2A 2MFIA 2F52A 2HIXA 1IZ6A 2NZHA 4IJLA 3OW2A 2EXDA 5HY6A 3F2CA 1OTCA 2UXBQ 4IPDA 3PIOA 5DLQE 1IBKL 4DV2Q 1H95A 2AWNA 2ZTEA 4DK6C 1VQHA 4R4TA 1HNWL 3WWVA 1OXVA 1PVOA 3SGIA 3UDIA 1XMOL 5IP9G 2JA5H 1VQNA 1VQEA 4YWMA 3S15H 4YY3Q 4A3CH 4QQBX 3NENA 2AKWB 1QUQA 5EAYA 5LMUQ 1PV4A 3U50C 1VCIA 2K75A 3KOJA 3L0OA 4DV1Q 2N78A 2I0QA 4A3LG 3UE1A 1V43A 3S2HH 2EIFA 2UUBQ 3KYHC 4UPAA 1L0WA 3MEFA 4A3GG 2ZJRA 2V1CC 1CSPA 3PSIA 4LF7L 4AQYL 1B7YB 2YTYA 2MO0A 1WFQA 2K4KA 3D31A 2ATWA 1TWGH 4O0AA 3GTKH 3PF4A 1YHAA 5C3EH 5IT9c 4RMFA 3RLOA 2IX1A 4A4IA 3HOUH 4HIMA 2UXBL 3S1MH 1MJCA 3CCMA 1JT8A 3AFQA 3KLWA 1X3GA 5IYDG 5FLXc 4AIMA 4DV2L 2ID0A 2CKZB 4DR6L 2PQAA 3JC66 1VQGA 1X9NA 1Q12A 2N49A 3T1HQ 3RN2A 1IXRA 1N33Q 2NVXH 1OXUA 3EBEA 1PYBA 4YY3L 1ASZA 3PO3G 2BA0A 5LMUL 1E1OA 2Q2TA 4DV4L 1FJGQ 3E0EA 4OWTB 4A3FG 1J6QA 1HZAA 1A62A 3EIVA 3J81j 4A3DH 5K36G 3F2BA 1OXSC 3EN2A 4IFDG 1B70B 2B3GA 3HOWG 4JV5Q 5C4XG 4XIGS 3W5OA 2IHEA 2YTVA 1BKBA 2KHJA 3A0JA 2ZM6L 2I5HA 2L15A 1TWCH 1YHQA 1AE2A 3S17H 1UE1A 3I4MH 2ALYB 4X62Q 5J3BA 4LFCL 3RLFA 2BH8A 4DR2Q 3J7A5 3HOVH 2H5XA 1SMXA 1BBWA 1NTGA 4UP9A 3JAMi 4JBJA 4JBKA 2JA8H 4YWLA 1SLJA 4JI3Q 3AQQA 4JYAL 4IFDI 4L5TA 1KRSA 3M4PA 3J7ZC 1E24A 1EIFA 2JA7H 3HOYH 4A3MG 2N8NA 3HKZG 3I56A 4EQ5A 2R7ZH 3A5UA 1HR0W 1XPOA 3CPWA 3VDYA 2QEXA 3PO2H 2OTJA 1MIUA 1VQOA 1N33L 5JEAJ 4X66L 3BU2A 4LF8Q 3L2PA 3A74A 1UWVA 3TQYA 1S72A 5IE8A 4IPHA 2HHHQ 4BXXH 4C3JH 3RR5A 4A75A 1LM0A 1QVCA 4DR4Q 1BBUA 2JA5G 4A3CG 1S3OA 1LUZA 2VNUD 2WAQE 3HOZH 4YHHQ 1M1KC 2WP8J 2F3IA 1X6OA 2D62A 2GN5A 2CWPA 3J80c 1L2FA 2MQHA 1Q86C 1JJCB 4JV5L 5FLMH 2UU9Q 1DGSA 3PUVA 3G71A 3PCOB 3CC7A 3H15A 4HJ8A 1Z9FA 3ZJYC 4NB3A 2BA1A 1RL2A 4JG2A 2B63H 3RNUA 3OTOL 4GOPB 4DR7Q 5JJKA 1OXTA 4DV6Q 1XPUA 4MTNA 4OO1G 4B3MQ 3D0FA 3GDEA 4JI3L 4NXMQ 1D8LA 1FL0A 1HNZQ 2VQEQ 5C0XI 2K5NA 5IP7H 2ZTCA 2JEAI 2UUCQ 4KI0A 2R7FA 3CCLA 1I50H 3S1NH 4HIOA 3CCSA 4HJ7A 2K14A 2KBNA 4LF8L 3GTPH 4DK3C 2HHHL 3U4VA 2B29A 2VUMH 3S16H 5IYCG 4GOPC 4DR4L 2E2IH 4OO1I 1KXLA 4KHZA 1SE8A 1HNXL 4BY1H 1PH8A 2DUDA 4GLVB 1X55A 3STBD 4YHHL 4IO9A 5JJLA 1G291 1Q8KA 2N3SA 4A3BH 3K8AA 1PH1A 2HIVA 2Z0SA 2LXKA 4PZ6A 4LF4Q 4A3DG 1HR0Q 1J5EQ 1FGUA 1XNRQ 4DUYQ 1OXXK 3CF5A 1W3SA 4LFBL 4DKAC 2ZTDA 2D0OA 5IY0A 2PI2E 1V1QA 2Z6KC 3M4QA 4X64L 3M3YH 4DR7L 3I4MG 1AE3A 4NXML 4YWKA 4Y7NH 1L1OB 2NZOA 5H1SE 2VQEL 1XPRA 4JI5Q 3CW2C 2NVTH 4EX5A 3HOVG 2E5LQ 3NELA 4O2DA 1X3FA 2UUCL 2JA8G 2OQKA 3KF8B 3KF6B 2UUAQ 1QZGA 1EIYB 4TVAB 2IHFA 2JA7G 2AMCB 3HOYG 2VL6A 2R93H 1N32Q 3I2ZA 3T1YL 1QZHA 5BR8Q 3Q8DA 4JI4Q 3PO2G 4JC0A 1P16A 4R1JA 4GLXA 1VQ4A 2YU9H 1YJ9A 4PZ8A 4GKJQ 1G6PA 1GVPA 3CCJA 5GAEC 3RZDH 1L1OC 1HZ9A 3KDFB 1MKHA 4DV5Q 4HJAA 4LWCA 3I4NH 3GTQH 5C44H 4LF4L 3HOZG 1SR3A 2RF4A 1K8GA 1HR0L 3S24A 4DUYL 2A8VA 5M3FH 3CC2A 4POFA 1A8VA 4A3KH 1YITA 4GOPA 1NJIC 3UDXA 3CPFA 1VQIA 2UXDQ 1YZ6A 3CQZH 2PI2A 3J81i 3JAMc 1HJPA 3AYHB 4R4CA 2OQ0A 4RG1A 1KAWA 5M3MH 3H3VH 4DV1L 2B63G 1LYLA 3ULLA 1QVFA 4GN3B 3I55A 4DR1Q 3BJUA 4A3EH 3CCQA 4OWWB 4X65Q 1SRUA 1VQDA 2UUBL 2D0PA 2WAQG 1LTLA 1X54A 1EQRA 1Q46A 4PZ7A 1WYDA 3CMAA 2UUAL 2JJQA 1PHJA 3M7NA 1Q81C 2K5VA 2K5HA 5IP7G 4Y52H 2Z6KA 2Q2HA 3GD7A 2XGTA 3PUXA 3TEHB 1KIXA 1JE5A 1N32L 1UE5A 1VQJA 5BR8L 2YYZA 4C3IH 1HZBA 2KCMA 3NBHB 1NY4A 2VQFQ 4GKJL 4DNIA 2PMZE 2Q2IA 3DM3A 4OONA 2VUMG 1CKMA 2MO1A 4R4IA 1SROA 1NBWA 3S1RH 4DAMA 1K3RA 4DV5L 1JB7A 4L5SA 1Q1EA 1V9PA 2OCEA 3BZKA 4UP8A 1M90C 4BY1G 4MZ9A 3T1HL 4LF9Q 4LF5Q 2IX0A 2QGQA 1IYJB 2FXQA 1VQCA 5LMNW 1PH4A 3GTOH 3HKSA 3RZOH 4A3BG 2AHOB 4DUZQ 1TWFH 1FJGL 2UXDL 4HJ9A 1YVCA 4A3LH 2YTXA 3FKIH 1L1OA 1Y1VH 1K73C 1RIPA 1YBYA 2XTIA 1PH9A 4DV7Q 1I6HH 1IBLQ 2HQLA 3CP0A 4DR1L 5C0XG 1GD7A 2JA6H 1Y1WH 3KF6A 1IBMQ 5HGQA 1AH9A 3GTJH 4X65L 5IYBH 5AJ3Q 2QA4A 2K50A 4GS3A 1N34Q 2VW9A 4QJFA 1E22A 4JI8Q 3TS0A 3TRZA 4X62L 1PH3A 2ZJQA 1YHBA 3CCUA 5JJIA 2WFWA 4DV3Q 2ASBA 2JE6I 1R9TH 1N8RC 4A93H 2MNAA 3GTMH 1TXYA 4IFDJ 4B3TQ 2R93G 2VQFL 3KDFA 1C9OA 5IWAQ 1PYSB 1EWIA 1PH5A 1N36Q 1MJEA 3K7UC 1YI2A 1VQ7A 3S14H 1T9HA 4P75A 4OWXB 3UE0A 3A5ZB 4PG3A 3FHWA 4GN4B 5C3EG 4OX9Q 4UY8C 3HOUG 1I5FA 3PO3H 1GKHA 3ER0A 4ALPA 1UE7A 4LF6Q 1G51A 2DGYA 3I4NG 4DUZL 3FP9A 4GN5A 5C44G 1KQSA 2VS1A 4JI0Q 3K81C 1C7YA 1VQFA 3CCRA 3CMEA 2Q2UA 3M4OH 3S2DH 4B3RQ 4A76A 1VQ5A 1FVIA 4A3KG 4A3IH 3HOWH 3H0GH 1Y14B 4DPGA 4DV7L 3UDFA 4JBWA 5GAGC 1QVGA 1PH6A 1CUKA 1HZCA 2Y0SG 1WCMH 4OXPA 1X3EA 1YJNA 1IBML 1GO3E 3CXCA 1A63A 2UU9L 4BBSH 1VQ8A 3ICEA 4BA2I 2RHSB 5M3MG 5AJ3L 3HOXH 3CC4A 4K0KQ 3HFZB 4JCVE 4JBMA 4AYBE 3M85A 4A3EG 1KD1C 5LMNQ 4JI7Q 3K80C 1WJJA 4DV3L 4AQYQ 4DV6L 4JOIC 4A3JH
chains in the Genus database with same CATH superfamily
1WI5A 2D9UA 4DK0A 3W1BA 5J39A 3SK8A 2PZUA 3MAQA 2AQ1B 5EQ0A 4MHEA 3P75A 5IGEA 3H3VC 4RGTA 2EJMA 4HR7B 3H3VI 4KHPQ 4DR6Q 1E3PA 3K0XA 4K6DA 2WB1G 3PUYA 2L5TA 2X69A 5LL6X 2LXJA 2R7ZG 3E5SA 1KAAA 3TP5A 2L11A 1XMQQ 1AFPA 1H9KA 2K52A 3GTOB 3RZOB 1DOLA 3V96A 1EFWA 2F4VQ 2A19A 1VQ9A 1BDOA 1SFOB 5EPLA 1JJGA 1PYWD 1X3QA 3CCEA 1Y1VG 2ZM6Q 1J5EL 3H94A 4A3GB 3HEJA 1Y1WG 4ME5A 4L5RC 1Q1BA 4JI7L 4BY7H 2CW0C 1K83H 2RHQB 5JEAG 1PH2A 2GVAA 2RCFA 2EYFA 3Q0AA 5JOBA 1K0RA 1NE3A 4HAEA 5ELCA 3W3AA 2E5LL 5LHY1 2B2VA 2R92H 4WJ4A 4QIWB 4L8JA 3I4LA 4KLKA 2KCTA 2KQ3A 4JOIA 4WFN3 1XWEA 2GVBA 4M8AA 2K01A 2NBFA 2UXCL 3SDZA 1PFMA 5M9OA 1CTMA 2H4OA 4OL7A 5CR3A 3AFPA 3F8TA 2NVYB 5IP9H 1PTOH 3H0GG 2IL8A 2G5DA 5M5YB 1KL9A 3K7AB 3SR1A 1WCMG 1YIJA 4OHJA 4C3HB 4B3SQ 5KRUA 1XJVA 2SOBA 3MWYW 4BBSG 4OEMB 4GKKL 4FXGC 3SE0A 4P73A 1WVLA 2IT1A 1X65A 4DV7L 1PFSA 3A55A 2B39A 4J1MA 4CBVA 1T5XD 1KRTA 4DU9A 1HA6A 3HKZB 1CKOA 5A35A 4U673 4JPBW 2R7DA 1TR5A 1C0AA 3VYSA 4K8IA 3IRBA 3OMCA 4GLAC 1CKNA 3PV0A 5IGGA 3M9BA 1P8LA 4AYBG 4ZCKA 1N9WA 3F2DA 5CGKA 1Y8NB 3A56A 1GM5A 1V1PA 4MNOA 3G48A 2E8GA 1WD0A 3S1QH 4A3FH 4B9XA 4LFBQ 4IJHA 1EWCA 4UDUC 1VQAA 3T16A 1BQQT 4ZAIA 5D65A 2NVQH 4DV0L 4GNXA 4IFDH 2A68C 2RKSA 3NSWA 4ZUIA 5M3FG 4X64Q 4BBRG 3PGZA 2WKDA 4J6HA 5BN4A 2F1MA 1Q82C 2CFMA 3GTKB 1TWGB 2NN6G 2Q8RE 1Y8PB 2KOLA 1YJWA 3MXNA 1Q7YC 2GA4B 1KNAA 3T1YQ 2RVLA 5D14A 5JPNC 5I6WA 2F52A 1U4PA 1IZ6A 3IL8A 4IJLA 4DAYA 1OTCA 1MD2D 2UXBQ 2BE5C 4IPDA 4TSSA 1ZYRD 1H95A 2AWNA 3IAYA 1HNWL 3WWVA 1KLUD 4EGVA 1EEFD 1PVOA 3SGIA 4YY3Q 1RTNA 4RWSC 3I4MB 3BYYB 1GJXA 4CHTB 4DAVA 5KNBA 3J81L 2QDBA 5FO9B 1NR2A 1F9RA 3L0OA 1SYGA 1PRTD 4A3LG 1V43A 3S2HH 3MTSA 1YNJC 3KYHC 2PYKA 4BWGB 2RDFA 1L0WA 3MEFA 4A3GG 2B2TA 1HUMA 1F9QA 5EKLA 2ATWA 3JAML 2QF7A 3MXGA 1I4RA 1BOSA 4RMFA 2F0DA 3RLOA 2IX1A 3SEBA 4A4IA 4HIMA 2DNEA 2X6LA 3S1MH 3AFQA 3KLWA 1X3GA 3FRPB 5FLXc 4AIMA 5C5LA 4DV2L 4DR6L 2PQAA 1IKMA 1Z7TA 4LAAA 3J7AV 1IXRA 3DEOA 2EY5A 1A3TA 1SXTA 2IWHA 3KLSX 2BA0A 5LMUL 2Q2TA 3BG3A 1PZJD 3E0EA 1J6QA 2KA7A 4ZKBB 3J81j 4A3DH 3A7LA 3F2BA 5EPJA 1B70B 2F0SA 4JV5Q 3W5OA 2ZM6L 2KHJA 2I5HA 2L15A 3S17H 1EQTA 1SNOA 3T13A 4C3HG 3RLFA 2BH8A 5M5XB 2PO4A 3HOVH 4OIJA 4UP9A 1SMXA 4CKEA 4KHVA 2NB0A 2KCNA 5CBEE 3M4PA 2N8NA 3HKZG 3I56A 2R7ZH 1HR0W 1KDCA 1B2TA 4Q0FA 1EY7A 1TKWB 1N33L 3BS1A 5JEAJ 4CKBA 3TQYA 1S72A 5IE8A 3RD4A 4ZRZA 3VR2A 3RR5A 3CRLC 4K6LA 1IYVA 1QVCA 4JW0A 2K28A 1S3OA 4YHHQ 4DNTB 1B50A 2D62A 2C5CA 2F0TA 2MQHA 1Q86C 2UU9Q 2NTTA 3G71A 3CRKC 5IT9E 1HUNA 5NUCA 5JEAH 1IYUA 3QG1A 4NB3A 1A2TA 2B63H 1CM9A 3RNUA 4GOPB 5IIFA 3VYUA 3D0FA 3HRZC 4JI3L 3D6WA 3QOLA 5C0XI 3ND8A 4KI0A 3HOUB 1SJED 2R7FA 1I50H 5C5MA 3CCSA 2EYJA 2FFKB 5IYCG 1I4GA 1BCPF 2I07B 3RMHA 4OO1I 1SE8A 1AZQA 4ILWA 4CDDC 1X55A 3DMUA 2FHTA 1Q8KA 2N3SA 2E75C 3K8AA 2C9OA 1PH1A 1D1IA 3VR4A 1OXXK 3CF5A 4A3EB 2F03A 4LFBL 4M1UB 2NZ1D 1WTVA 3QB3A 1BBXC 3C3LA 2PI2E 1V1QA 2Z6KC 3M4QA 4X64L 3M3YH 4DR7L 3I4MG 1JC7A 1AE3A 3G6JB 2NZOA 1ONLA 4Q5VA 3NELA 4O2DA 2UUCL 1NCVA 3KF8B 3S1RB 2NUCA 1I4QA 3J80E 2DY8A 2ENBA 5C6AA 1N32Q 4XQQA 3I2ZA 4FO2A 1DYQA 3T1YL 2OT2A 3K5LA 4GLXA 1L1OC 4FF3A 3FKIB 1UUPA 4DV5Q 2PMZB 5JJZA 3I4NH 5C44H 1WD1A 4LF4L 2RF4A 2WINB 1K8GA 3S24A 1HR0L 1LABA 5M3FH 1IW7D 1A8VA 1YITA 1EY9A 3NTHA 1PFNA 2MHVA 1NJIC 4HEDA 4WRDA 1KABA 2PI2A 3NP8A 1HJPA 2NN6H 3AYHB 1KAWA 5ELDA 1JWSD 3I55A 3BJUA 4OWWB 4X65Q 1SRUA 3V05A 1SNQA 3TN2A 3CHBD 1Q81C 2K5HA 5IP7G 2Z8LA 4Y52H 2IPKD 3TSSA 5ELBA 1EFID 1QJOA 1STGA 4IN3A 5C4ZA 4C3IH 4KV6A 2A73B 1ESFA 1F9SA 1CKMA 2EY2A 1LV9A 2MO1A 3GQBA 3M4OB 1JB7A 4XXEA 2JSOA 5J22A 4PMCA 4K2LA 4MZ9A 3L3OC 5I2XA 4LF5Q 3TP8A 5LMNW 3OIPA 3GTOH 1EZ6A 3RZOH 4DUZQ 1AW7A 1TWFH 2OF1A 2F0HA 2UXDL 2E74C 2XRSD 4A3LH 1YBYA 3ZYYX 1U4MA 2LMCB 4DV7Q 1I6HH 5E1FA 1IBLQ 2K7VA 4DR1L 1AH9A 5HGQA 3GTJH 2QA4A 1EYCA 2K50A 4GS3A 3QR8A 2VW9A 1TIID 4MIUA 4QJFA 3K59A 1S5CD 3CCUA 2KEEA 2F0FA 3OHXC 2WFWA 1N8RC 4A93H 4KKSA 2PNRC 1TWHB 5KIXA 2O4XA 3K7UC 4P75A 2L12A 1WTHA 3UE0A 3JAME 3NPPA 5G3LD 3HOUG 3GTLB 3I70A 3ER0A 4ALPA 1JQYD 2E2JB 2HQEA 2VS1A 4RHRA 1VQFA 1TS5A 3CCRA 1RTOA 1LACA 4A3IH 4OIKA 5L37A 4JBWA 2EYHA 1X3EA 1IBML 2UU9L 2HCIA 1VQ8A 3ICEA 2RHSB 3HOXH 1IL8A 1MI2A 2B2VC 4AYBE 3M85A 4A3EG 3BYTB 1KD1C 1PRTF 4EQOA 4JI7Q 1WJJA 4AQYQ 4JOIC 4A3JH 1BVSA 4B3TL 1LTBD 1N36L 2SNMA 3W1GA 1VQKA 4LUOA 1FNVA 2CHBD 2HD3A 1VQPA 5C3XA 1XYIA 1STBA 1ICFB 3TBIB 1VQ6A 2EE1A 4S3SA 4NPSA 1D5MC 3GTGH 1UEBA 4OELB 2E2HH 2UXCQ 3J81c 4KMUC 2K1BA 4BXXG 1K3BC 1QB5D 1U4LA 3FKIG 2RCNA 1IL2A 3NBIA 5FJ8H 2ES2A 4TQUS 4C2MB 2A1AA 3NXWA 4QY7A 4GKKQ 5LMNL 4LFCQ 4N8X1 1K8OA 4FNFA 4IQZA 5E7NA 1O7IA 3AEVA 4YCWA 5KYLA 4RH6A 5CBAE 1QWYA 1CA5A 3DWQA 4J15A 5GROA 2FINB 2Q8TA 2I46A 3QO2A 1U0LA 3TREA 5GAHC 3C1FA 5IYCH 4DGZA 2IY5B 2K33A 4DR5L 4X66Q 2AUJD 4LFAL 2EYOA 3A7AB 2CQOA 1PLFA 1KHIA 4LUZA 1A0IA 2F4IA 4GNXC 2EQSA 3RLNA 1D5XC 5ELNA 3T56B 3HOWB 2L0CA 5C4XB 1LLRD 2JYOA 1BF4A 4XYOA 3L7ZC 1LTSD 5I9OA 4BA1I 2JK8A 1O7ZA 1SBBB 1HH2P 1PH7A 1B8AA 1VMCA 2OWOA 3RN5A 4CDEC 2R6GA 4LNQA 2B2UC 4DV0Q 1KDAA 4CJ0B 1M4VA 3DLLA 1QUQB 1GUTA 1YNXA 1Z47A 1NMGA 1E7ZA 3NWSA 5M5WH 5DM73 4HJ5A 4HTHA 1XNQL 4QIWE 4L5QA 1TWAH 2Z9HA 1AN8A 4FP5D 1I3QH 3BVZA 4IPGA 5E4WC 3S15B 5IYDH 1S5ED 1SYBA 2R61A 4F7XA 4C1NI 4DR3L 2B2WC 1QCBD 3BVMA 1EQVA 4H02A 1C8CA 1UE6A 1HNWQ 4LF5L 3TP6A 1D7QA 4NXNL 2F0VA 3F1ZA 4IUTA 3U9SA 2ZJPA 2E76C 2JQOA 2L4NA 5T1IA 3HKZE 1HTPA 4XTCS 1D5ZC 4MN3A 3SK5A 1R4PB 3J80i 1IBLL 3I8ZA 1JMCA 5M5XH 5JVH3 4JI2L 4P71A 4QCLA 2KHIA 2K6AA 2HT1A 1DOMA 2O5IC 1V1OA 2FJ2A 5KNCA 1WTPA 4G7OC 2CQAA 4G7ZC 1ET9A 4A3MH 4IALA 2HIXA 3T4AC 4HMJA 3LWEA 4X3KA 3OW2A 2EXDA 1HXYD 3PIOA 4DV2Q 1STHA 4DK6C 2ZTEA 1VQHA 4YIJA 2K5DA 2JA5H 1VQNA 3NENA 5LMUQ 1JICA 1L0XB 2MUYA 1VCIA 5IGBA 2I0QA 3MXUA 1LT4D 5FO8B 3UE1A 2JA8B 2EOTA 1SMYD 3CU7A 1PTOC 2JA7B 1E2ZA 1ESRA 1H9SA 3VYTA 1BNZA 1CSPA 3PSIA 4LF7L 3PO2B 1VF7A 1HCZA 2QKIC 4AQYL 2MO0A 2DN8A 4FXKC 1WFQA 3D31A 1WTOA 3PF4A 4O0AA 2EXZA 1YHAA 1XTCD 3HOUH 2PPBC 3HOZB 2ID0A 1U9RA 1JWMD 1CI3M 1Q12A 1VQGA 2N49A 1X9NA 2F0UA 1N33Q 2NVXH 1OXUA 2XIWA 1E1OA 5CV8A 4OWTB 2A6ED 2IW3A 1HZAA 4L63B 1A15A 2A74C 5K36G 3EN2A 1EY5A 3HOWG 2WAQB 5C4XG 2YTVA 1BKBA 1QOHA 3A0JA 1YHQA 2XNAC 1UE1A 2M2LA 2ALYB 3H91A 4LFCL 4O1NA 1NTGA 3JAMi 4H13C 5ELFA 3LWUA 3QWNA 4JBJA 5CV5A 4JI3Q 3S16B 4L5TA 4IFDI 3J7ZC 2Z6BA 3HOYH 1TS2A 3CPWA 2QEXA 5IGCA 4KK7A 1MIUA 4CJ1B 4X66L 4BXXH 4A75A 1RJTA 4CGYB 1BBUA 4A3CG 1LUZA 5C4HA 1AZPA 2NVTB 3PUVA 3CC7A 3H15A 4HJ8A 2CW0D 2MPMA 5CORA 3T51B 5FLXE 3TP7A 2KVMA 1ZXTA 3SK6A 5CV6A 4CDCC 4DR7Q 2R93B 1OXTA 4DV6Q 1XPUA 2QEJC 4OO1G 1HNZQ 1K28A 2YU9B 2K5NA 3QOJA 2ZTCA 2UUCQ 3U9OA 3RZDB 3CCLA 1EU4A 3S1NH 4HJ7A 4LF8L 2HHHL 3U4VA 2VUMH 1KTKA 4DR4L 1CFMA 4KHZA 3DWAA 2F0MA 3MVVA 4BY1H 2ZXRA 4GLVB 3CQZB 4BS9A 4IO9A 5JJLA 3TZDA 4A3BH 2RDHA 5M3MB 1O80A 2ZXPA 4LF4Q 2F0KA 2XVSA 3A54A 3D4WA 4NP5A 1FGUA 1HR0Q 1XNRQ 3R2TA 3D8GA 1DZ1A 4DKAC 5KNDA 5IY0A 1TWCB 3DEPA 1E2VA 1ENCA 2EVBA 4NXML 4Y7NH 4H44C 4DA2A 5H1SE 4JI5Q 4EX5A 4RKLA 2EZVA 5EKIA 2JA8G 3KF6B 4TVAB 2JA7G 2AMCB 2D2CC 5EKKA 1B9NA 4I7ZC 2OXPA 3HGBA 1WTXA 4JI4Q 4LJZC 3PO2G 1P16A 4FXDA 1M8AA 1YJ9A 4PZ8A 4C3JB 1GVPA 3R2IA 2XN9C 2RDGA 5JPMC 1HZ9A 3SK4A 1ENAA 5FK9C 3HOZG 3VYRA 4E6IA 4XT3B 1WTRA 2JA6B 3MFGA 1G8ZD 4POFA 2A68D 4A3KH 2EYLA 4GOPA 1ILQA 5FKAC 1XX8A 3CPFA 1VQIA 2UXDQ 1MSHA 3NQIA 4KKUA 3AB9A 4I65A 5T1GA 3C1EA 3VR3A 1K8MA 1R9TB 1RCVD 2KUMA 5EBCA 1QVFA 4GN3B 4DR1Q 2O5JC 3OWEB 4IUNA 3CCQA 1VQDA 2WAQG 3S14B 1EQRA 1Q46A 2UUAL 2JJQA 4RA8A 4TKOB 4IUPA 4RCOA 3TEHB 2Q2HA 1KIXA 1JE5A 2FMCA 2YYZA 1AP0A 1CZGA 1NY4A 2BE5D 4DNIA 2PMZE 2J0TD 4R4IA 4B08A 1NBWA 1Q1EA 2OCEA 1M90C 1SNDA 2IX0A 1IYJB 1S5DD 5DEHA 1VQCA 4ZK9B 5EJWA 4HJ9A 2YTXA 1Y1VH 1SNMA 1RIPA 2F3WA 4DF7A 1EY0A 3P7JA 1YNJD 1ZEQX 3KF8A 3CP0A 2WACA 1II3A 2ZT9C 4ABNA 1Y1WH 1IBMQ 1N34Q 3DWPA 1EYDA 3IFTA 1PH3A 2ZJQA 1HA5A 2F0GA 2G9HD 3GV6A 4U68A 2MNAA 1STAA 3GTMH 4B3TQ 2R93G 1I4XA 1C9OA 1N36Q 1VQ7A 3FPUB 1YI2A 4PG3A 3FHWA 5E3FA 2EPBA 1Q90A 4UY8C 3NK9A 4NDXA 3GTQB 1G51A 2DGYA 4N8FA 4GN5A 1KQSA 3KUPA 2F0NA 4UAIA 3CMEA 1VQ5A 3HOWH 4BY7B 4FF2A 1CA6A 3H0GH 1Y14B 1K83B 1PH6A 5CV9A 3K58A 1CUKA 1WCMH 3FEWX 1WTWA 5EGTA 4NKLA 4BBSH 4XDXA 5M3MG 5AJ3L 2RSOA 3K0YA 3MZ5A 4JCVE 2IX3A 4JBMA 5LMNQ 2R92B 2K32A 4X3SA 4DXGA 5KEEA 4DV3L 4DV6L 1MHWC 3CAMA 5C0XJ 4X3UA 1HNZL 4PMWA 5GQOA 3I91A 3LGJA 4ME3A 1YEZA 2NN6I 1W2BA 2XSCA 1B3QA 1SYCA 2LSSA 2DY7A 3N52A 4UHVA 3A8IE 4DR5Q 4LF6L 3G6EA 4LFAQ 3BDOA 2Y0SE 4APVA 4B3RL 3OOCA 2AUKA 3H09A 3S9WA 4NW2A 1F9PA 1U4RA 4C3JG 3IFDA 1BXTA 5I9PA 1RODA 5DAUA 3KFUA 4HCSA 3GO5A 4IURA 3PUZA 1VQLA 1XNRL 5ELOA 4K0KL 2DNCA 4X3TA 2JA6G 4BBRH 5FLMG 2K03A 3DXJC 5IYBG 2B2YC 4POGA 1EYGA 4LW1A 4WJWA 4WJ3M 2YV5A 2WB1E 1JJ2A 4JI5L 1I94L 1Z6HA 1XNQQ 2EYPA 4KTAA 1EUJA 1PZID 3E6ZX 5GADC 5C4JH 3LNNA 1JWUD 1NAPA 1H9MA 3PIPA 4JI4L 3S1QB 3DUZA 1NNXA 4IPCA 4RKBA 4A3FB 1JCKB 5JAVA 4ODGA 1FNWA 3SHLA 3I7FA 3S2DB 3OIQA 4DR3Q 1FNUA 2N88A 3U58A 4FF4A 3STBC 2VY3A 3K5NA 4NXNQ 1QG7A 1HPCA 1TY0A 3K5MA 1SFOH 2CCZA 3OTOQ 4NMZA 1E1TA 1PZKD 2I5MX 3KJOA 3VR6A 1EYAA 2ICIA 5IGDA 3E9IA 4RGOS 4A3GH 3J81E 2EY6A 1CHPD 2KCCA 5D3IB 4JI2Q 2TSSA 4B9WA 4JI6L 1B3AA 4GZYC 1ASYA 4JI1L 1VQMA 1STYA 4UP7A 1ML0D 4IOCA 4QL5A 2AWOA 4HIDA 2SNSA 4O42A 2MP1A 3KBXA 4YCVA 3U4ZA 3S2HB 5CV4A 3FDTA 1DM0B 1GXDC 1PMRA 2JEBI 2CH4W 2NVYH 4BY7G 1Q8IA 5M5YH 3CCVA 3K7AH 3ULJA 4C3HH 1STNA 3FMCA 4FDBA 3X3MA 1LT5D 1N34L 3S1MB 4PV1C 1EOVA 2SDFA 3BZDB 3G7LA 5EBDA 4LF7Q 4R4OA 3G4SA 2EJFC 2I5LX 2R92G 1VS0A 1S40A 1XTDA 3UDGA 3TS2A 2MFIA 4Z9CB 1A6XA 3F2CA 2VB2X 5DLQE 1IBKL 4A3DB 1EY4A 3K5OA 4RCNA 1OXVA 3UDIA 1XMOL 5IP9G 1VQEA 4QQBX 2HDMA 3V2TA 4CJ2C 1QUQA 5EAYA 3S17B 3EVQA 3C46A 3KBGA 4K5WA 4DNRB 1UEAB 1PV4A 1A3UA 4DAPA 4QMGA 2K75A 4WORA 3HOVB 3KOJA 2N78A 3MHBA 4ZYSA 4J8QA 2F0WA 3I72A 3PQIA 1TT2A 2R3ZA 2V1CC 3PMFA 4HMIA 5HGTA 1B7YB 1RD9D 2WIIB 3D6CA 3GTKH 1TWGH 2X6GA 1LT6D 1MJCA 1JT8A 4HN7A 2DJGC 1G2TA 3F2UA 3JC66 4ULLA 1FD7D 3T1HQ 1O7YA 3RN2A 1Y8OB 1PYBA 1X32A 2JXMB 1YNNC 1ASZA 4XQNA 1PXUA 4A3FG 4IZ8A 1V8QA 3EIVA 2B63B 4IFDG 2A69C 3Q24A 5A2QL 5C3WA 1TWCH 3I4MH 5J3BA 3Q22A 3J7A5 1PDQA 5I6YA 2VXWA 4KY5A 1SLJA 4YWLA 1KRSA 1E24A 1J9OA 3LX0A 4EQ5A 3TDQA 3A5UA 1XPOA 3EA6A 3A8JE 2D5DA 1LT3D 1BCPC 5JVG3 2EDGA 4LF8Q 1UWVA 2HHHQ 4IPHA 4C3JH 1LM0A 4DR4Q 4F8MA 1VMPA 5J1ZA 1VDZA 2VNUD 2WAQE 1J8IA 1F2MA 1M1KC 1SE3A 2WP8J 2M00A 2CWPA 3R8BA 1L2FA 5FLMH 5IOCA 1DGSA 1XXGA 1Z9FA 1RHPA 2Z4HA 2BA1A 4JG2A 2B2TC 3OTOL 5JJKA 1LTID 1LTTD 4B3MQ 3GDEA 4NXMQ 1D8LA 1W6KA 1KLGD 5IP7H 5C3EB 1A2UA 3I4NB 2KBNA 5C44B 2F0OA 2XWBB 2B29A 4DFAA 1GHKA 4F88A 1F2YA 3E0JA 4GOPC 2V4DA 3FVQA 1B9MA 1QE6A 3VA5A 2HIVA 2Z0SA 4A3DG 4PZ6A 2A6HC 2ZTDA 1SYEA 4R8IA 2D0OA 4JVZA 3EFXD 1EOTA 1JE4A 4ZLTF 4K2KA 1JOOA 2M9VA 4CDFC 2QDLA 1L1OB 2B8GA 2VQEL 1CT1D 1XPRA 4KD4A 4C3IB 3HOVG 2LFNA 2E2DC 1BCPD 2UUAQ 1QZGA 4G7HC 2KECA 1EIYB 2IHFA 1JORA 3PIO3 1QZHA 4JC0A 1SAPA 2H1EA 3A8KE 1KNEA 1VQ4A 1G6PA 1TS3A 1TWFB 2KEDA 2MJ8A 3CCJA 5GAEC 5IT9L 3KDFB 1MKHA 1QNKA 3GTQH 1I6HB 4IUQA 2N55A 4DUYL 2A8VA 1EL0A 3GTJB 3WOFA 3UDXA 1A3VA 1UAPA 3J81i 1ILPA 4RG1A 3I90A 3H3VH 5DM63 3P20A 4P2CB 4V0BA 1WTQA 2B63G 1LYLA 4A93B 1S5BD 4A3EH 2D0PA 2PZTA 5KYIA 1LTLA 4PZ7A 1PHJA 1LTGD 3GV3A 2K5VA 1DOKA 1NR4A 1QVGA 1VQJA 4ID6A 5BR8L 3WDNA 1DONA 1K0SA 2RSNA 3GTPB 3URYA 1HZBA 3NBHB 4GKJL 2P5ZX 1EZ8A 2VB3X 2Q2IA 3DM3A 4OONA 2E2IB 3S1RH 4DAMA 1K3RA 4A3IB 1GUGA 2F0LA 3HZXA 4K5XA 1D1KA 2A6HD 3T1HL 4LF9Q 1ZYRC 1HFGA 2FXQA 1PH4A 3HOXB 1C4QA 5LL6S 2A5HA 3P1HA 2BOSA 5G3LF 3FKIH 1K73C 1PH9A 2XTIA 2B8FA 5E4XA 4A3JB 2HQLA 5C0XG 1GD7A 3J80L 1PTOD 3KF6A 4HCEA 2NWGA 4FF1A 4R9WA 5AJ3Q 1PRTC 1E22A 3D4RA 4JI8Q 3TS0A 3DM1A 3TRZA 1YHBA 1AEXA 2PCFB 3ITPA 4H0LC 2RA4A 3QIAA 4DV3Q 1EY8A 1H9SB 1HQRD 4IFDJ 1RDPD 2VQFL 3GTGB 1PH5A 2E2HB 4OWXB 3BDCA 2K05A 5C3EG 4K14A 1I5FA 3VR5A 4LF6Q 1UE7A 4EVOA 3I4NG 5C44G 4IUVA 3K81C 1C7YA 4B3RQ 3M4OH 2Q2UA 3S2DH 2JP1A 4DPGA 3DHQA 1HZCA 1SYDA 5TSSA 1GO3E 3CXCA 1A63A 2WV6D 3MC0B 3TZUA 3CC4A 4K0KQ 2AQ2B 3HFZB 3D3RA 5FOBB 3M7GA 2B2UA 5A2QE 1SSOA 4H7BA 4B3ML 1B44D 1X3PA 5IWAL 4YCUA 3K57A 1I94Q 1ENFA 2ZXOA 4N9TA 4C3IG 1NUCA 1SE4A 1U5KA 4OX9L 1F2LA 4K8JA 1CQFA 3TMEA 4HIKA 5KGUA 3T53B 3KLSA 3BZCA 4JI0L 5CV7A 4P72A 1TWHH 1EU3A 1WOCA 3B6YA 4DV4Q 2JN4A 4X6AH 1CKNB 2B2WA 1GHJA 3OYYA 3GTLH 2IJ0A 3E9HA 5ELEA 1TS4A 3W2DA 1EIGA 1V1PB 4QUFA 5M5WB 3EJIA 2E2JH 1CQVA 1DJRD 1TWAB 3NTKA 2Q8IB 1I3QB 4DR2L 1SJHD 4ZUJA 3MFYA 4GNXB 2OTLA 2F3VA 4JYAQ 1HQMC 4A93G 4KHPL 2CH4A 4JI6Q 1JR0D 2XRQD 3PO3B 1TVXA 3MXNB 5BN3A 1XMQL 1SDFA 4P74A 5K5PA 2CVRA 4JI1Q 3CD6A 2G9DA 4LUVA 3PUWA 4AH6A 2F4VL 4QF4A 2C35B 4DAYB 1EQQA 4A3IG 1CSQA 1K8AC 2KENA 2JA9A 2J4XA 1BCPB 4PMBA 1R4QB 1SN8A 3HOXG 3PF5A 1G2SA 1EY6A 3NQTA 4DN4M 4R4QA 4RFBA 4PQXA 4CKCA 4A3MB 1JOKA 2BH2A 1GUSA 4A3JG 1QILA 4RGNA 4C2MH 2CWAA 3K6OA 5AFWA 1MGSA 3BDLA 4IOAA 1HRJA 1X56A 2SEBD 2JA5B 4KN4C 1PFBA 3KK7A 1HNXQ 2Z1CA 3ERSX 1G6ZA 1HFNA 5CC4A 3I4OA 1IBKQ 2VZAA 1VQBA 3HS0C 1NMFA 5D3DA 3ULPA 4LF9L 2F0EA 4R8NA 2BDNA 1CZWA 1FGBD 1MBYA 4FVMA 2PQAB 1XMOQ 4B3SL 4KKTA 3N6RA 5K36H 1IW7C 2K5WA 5FJ8G 5C4XH 1FR3A 4G4KA 4QGUA 2HDLA 5BN5A 2XWJB 4G57A 1K9MC 4JI8L 1VF5C 5IODA 2HCCA 4JK1C 1KC8C 1PA6A 2K5QA 2PNHA 1ET6A 3NEMA 2NVXB 3KJPA 2NZHA 2EY1A 4KD3A 5HY6A 4C56C 3C2PA 4XQJA 4R4TA 1G91A 5F2DA 2NTSA 1PTOB 3UI2A 4LMQD 1LO5D 2QILA 3S15H 4A3CH 4YWMA 3O13A 4I7AA 2AKWB 4KJNA 1JB3A 4N9PA 5C0XH 3U50C 3OSOA 4DV1Q 4LK1C 2EIFA 3AU7A 2UUBQ 2FMMA 3HOYB 4UPAA 1BR9A 4OO1H 2ZJRA 2KHSA 1DD2A 2YTYA 2K4KA 1B4OA 3EQLC 3OW7A 2AQ3B 2BCOA 5C3EH 5IT9c 1STEA 1SYFA 2UXBL 3CCMA 5IYDG 4KJOA 2QCPX 2CKZB 3Q23A 1TY2A 4ZKCB 3EBEA 4YY3L 1GUWA 3PO3G 1GUOA 1CK1A 1EWHA 1O7LA 1SNCA 4DV4L 1FJGQ 3SVMA 2NVQB 1I4HA 3J7YW 1A62A 3ONAB 1L0YB 4KN7C 1OXSC 1FYCA 1BUVT 2B3GA 3NHHA 2WKCA 4XIGS 2IHEA 4L6TB 1D2BA 5EPKA 1HTLD 3I73A 1AE2A 2QW7A 2L9HA 4X62Q 2F0PA 1JOQA 3S1NB 4DR2Q 1PTOF 2H5XA 1BBWA 1RKNA 1CHQD 4RHSA 4JBKA 2JA8H 2VUMB 4JYAL 3AQQA 3PIP3 1EEID 4DXFA 2O2LD 1EIFA 2JA7H 4A3MG 4BY1B 4HSVA 3I3CA 3VDYA 1PRTB 3PO2H 2OTJA 2RQXA 4DK1A 1VQOA 4A3BB 3BU2A 3L2PA 3A74A 2BDOA 2HUGA 4V190 2JA5G 3BVGA 2RBMA 1D6EC 3HOZH 4FYDA 2F3IA 1T5EA 1UNSA 1X6OA 2GN5A 2KJXA 3J80c 1JJCB 4JV5L 4Y7NB 3PCOB 3ZJYC 3OMGA 5IGFA 1C48A 1RL2A 2TMPA 3M4YA 1TQOA 3X3NA 3IKJA 1IHZA 4MTNA 3NE5B 1GOZA 1FL0A 4RGMA 2VQEQ 2EJGC 1I6VC 2LKVA 5COYA 2JEAI 4HSPA 5HURA 4HIOA 2K14A 3VA7A 3GTPH 4DK3C 1TU2B 3S16H 4A3KB 3KLRA 2E2IH 1KXLA 1I4PA 1HNXL 3EROA 1PH8A 2Y0SB 2DUDA 4YHHL 3STBD 1O78A 1G291 1B1ZA 3MEHA 1H9JA 2LXKA 1S5FD 1J5EQ 4DUYQ 4KY7A 1ICWA 3FPPA 5FO7B 1W3SA 3GP7A 2PW7A 1E0BA 4EQNA 4YWKA 2NVTH 3CW2C 2E5LQ 1X3FA 2WB1B 2OQKA 2R7ZB 3J7AF 1W6JA 3HOYG 5CMDA 2R93H 2VL6A 1Q3LA 3CKIB 5BR8Q 3Q8DA 4R1JA 2LS01 2YU9H 4GKJQ 4XT1B 3RZDH 1NSNS 1RF2D 1Y1VB 1H9RA 4HJAA 4LWCA 3NWTA 1F2ZA 5FLXL 1SR3A 1Y1WB 3CC2A 3ERQA 2PQEA 2PZWA 1DXMA 1YZ6A 2MGSA 3AMUA 1KDBA 3CQZH 4EQPA 2DJFC 3JAMc 4R4CA 2OQ0A 3Q6SA 3SXHA 5M3MH 4DV1L 3ULLA 1SEBD 3GTMB 2EYMA 2F0QA 2K04A 1GUNA 2UUBL 3MA2B 1X54A 1WYDA 3CMAA 3M7NA 3MXPA 1I50B 3PUXA 2Z6KA 2XGTA 3GD7A 4QB4A 1N32L 1UE5A 3D4DA 1EIHA 2KCMA 2VQFQ 1HHVA 1E2WA 1QNUA 2VUMG 1IKLA 1SROA 4DV5L 1SNPA 4L5SA 4PNYA 4K5VA 3H0GB 1V9PA 3BZKA 4UP8A 3HG9A 4BY1G 1WCMB 2J7ZA 2QGQA 3R93A 4BBSB 4ZQ3A 4A3BG 3HKSA 1Y69U 2AHOB 2NYZD 5DNFA 1FJGL 1BO0A 2F0JA 1YVCA 1L1OA 1F77A 3M3YB 1ZKOA 1MSGA 3QJYA 2JA6H 2OEOA 4X65L 5IYBH 3RUZA 4X62L 1SMYC 4TRDA 5ISRA 2B2YA 5JJIA 2ASBA 1B53A 2JE6I 5I2YA 4AYBB 1R9TH 3NUCA 1TXYA 2F0IA 3KDFA 5IWAQ 1PYSB 1EWIA 1MJEA 3NTIA 3S14H 1T9HA 4KY6A 3A5ZB 4GN4B 4OX9Q 4OGQC 1LTAD 3PO3H 1YNND 1GKHA 1SE2A 4XYQA 3R3OA 3OPOA 5CYUA 3FP9A 4DUZL 5M3FB 4JI0Q 2ICEC 4BBRB 2A69D 2PW5A 1FVIA 4A76A 3WOEA 1DCZA 4A3KG 2LY7A 3E3XA 2L55A 3UDFA 2L1BA 3H6MA 4C1NK 4MTKA 5GAGC 2Y0SG 1S4ZA 2A6EC 4OXPA 3ND9A 3OWFA 1YJNA 4IUUA 1LTRD 4BA2I 4QUCA 1OO9B 4F87A 3HP3A 3K80C 3NBHA 5C4JB 2Z4IA 5I4DA 4RAUC 3L9AX
chains in the Genus database with same CATH topology
1WI5A 1BVSA 4B3ML 4B3TL 3W1BA 3CAMA 5C0XJ 5IWAL 1HNZL 4PMWA 1N36L 4YCUA 5GQOA 1I94Q 3LGJA 4ME3A 1YEZA 2NN6I 1W2BA 3W1GA 1VQKA 1U5KA 4LUOA 3H3VI 4KHPQ 4OX9L 4DR6Q 1E3PA 3K0XA 1VQPA 2WB1G 3PUYA 2LSSA 4LF6L 1VQ6A 4HIKA 4DR5Q 2LXJA 2R7ZG 4NPSA 3G6EA 4LFAQ 3BZCA 4JI0L 3GTGH 1XMQQ 1UEBA 1TWHH 2Y0SE 4P72A 2K52A 1WOCA 4APVA 3B6YA 4B3RL 2E2HH 4DV4Q 2UXCQ 3J81c 1EFWA 4X6AH 2F4VQ 2A19A 1VQ9A 1CKNB 4BXXG 1JJGA 3OYYA 3GTLH 3KFUA 3E9HA 3CCEA 3FKIG 3GO5A 1Y1VG 3PUZA 1VQLA 2ZM6Q 1J5EL 2RCNA 5ELOA 1XNRL 4K0KL 2E2JH 1IL2A 5FJ8H 2ES2A 4BBRH 2JA6G 1Y1WG 4TQUS 5FLMG 2A1AA 4QY7A 4GKKQ 5IYBG 5LMNL 1Q1BA 4JI7L 4L5RC 4LFCQ 5E7NA 4BY7H 1K83H 1O7IA 2RHQB 5JEAG 1PH2A 4POGA 3AEVA 4DR2L 1EYGA 4LW1A 4YCWA 4WJ3M 2YV5A 2GVAA 4GNXB 2OTLA 2WB1E 4JYAQ 1JJ2A 4JI5L 1K0RA 1NE3A 4J15A 1I94L 5GROA 2E5LL 4A93G 1XNQQ 4KHPL 1U0LA 3TREA 5GAHC 2R92H 1EUJA 5GADC 5C4JH 5IYCH 4WJ4A 4JI6Q 2IY5B 4DR5L 4X66Q 4KLKA 3PIPA 2KCTA 4JOIA 3MXNB 4LFAL 4JI4L 1XMQL 2CQOA 2GVBA 4P74A 4IPCA 4JI1Q 3CD6A 1KHIA 4LUZA 1A0IA 3PUWA 4LUVA 4AH6A 2F4VL 4GNXC 2UXCL 2EQSA 3RLNA 3I7FA 5ELNA 4DR3Q 2C35B 3AFPA 3U58A 3F8TA 5IP9H 3L7ZC 4DAYB 1EQQA 4A3IG 1CSQA 1K8AC 3STBC 2KENA 3H0GG 4BA1I 2JK8A 2VY3A 1KL9A 2JA9A 4NXNQ 1WCMG 1YIJA 1HH2P 1PH7A 4B3SQ 1B8AA 1XJVA 2OWOA 3RN5A 4BBSG 4GKKL 2R6GA 1SN8A 3HOXG 4LNQA 4P73A 4DV0Q 1SFOH 2IT1A 3OTOQ 1X65A 2CCZA 3PF5A 3DLLA 1PFSA 1QUQB 1E1TA 1YNXA 4R4QA 2I5MX 1Z47A 3KJOA 1KRTA 1NMGA 1E7ZA 5M5WH 2BH2A 3E9IA 4HJ5A 4A3JG 1XNQL 4A3GH 1CKOA 4QIWE 4C2MH 2CWAA 4L5QA 4JI2Q 1TWAH 2R7DA 4JI6L 1C0AA 1I3QH 3IRBA 4IPGA 4IOAA 4GLAC 1ASYA 1CKNA 1X56A 4JI1L 3PV0A 3M9BA 1P8LA 1VQMA 5IYDH 4UP7A 4AYBG 1HNXQ 1N9WA 3ERSX 3F2DA 4IOCA 4QL5A 1GM5A 2AWOA 4DR3L 3I4OA 4MNOA 4HIDA 1IBKQ 2VZAA 1VQBA 4H02A 3G48A 1UE6A 1NMFA 3ULPA 2E8GA 4LF9L 4LF5L 1HNWQ 1D7QA 3S1QH 4NXNL 4YCVA 3U4ZA 2PQAB 3F1ZA 1XMOQ 4B3SL 4A3FH 4LFBQ 4IJHA 2ZJPA 2JQOA 2NVQH 1VQAA 4DV0L 4GNXA 5M3FG 2JEBI 4X64Q 5FJ8G 4BBRG 5C4XH 3HKZE 3PGZA 2NVYH 4XTCS 4BY7G 4QGUA 3J80i 1Q82C 2CFMA 1IBLL 5M5YH 3CCVA 3K7AH 2NN6G 3ULJA 4C3HH 4FDBA 1K9MC 1N34L 1JMCA 5M5XH 4JI2L 4JI8L 4P71A 1YJWA 1Q7YC 2KHIA 2HT1A 1EOVA 4LF7Q 1KC8C 4R4OA 3G4SA 3T1YQ 2I5LX 1PA6A 2PNHA 1VS0A 3NEMA 2R92G 1S40A 1XTDA 3UDGA 4A3MH 3KJPA 3TS2A 2MFIA 2F52A 2HIXA 1IZ6A 2NZHA 4IJLA 3OW2A 2EXDA 5HY6A 3F2CA 1OTCA 2UXBQ 4IPDA 3PIOA 5DLQE 1IBKL 4DV2Q 1H95A 2AWNA 2ZTEA 4DK6C 1VQHA 4R4TA 1HNWL 3WWVA 1OXVA 1PVOA 3SGIA 3UDIA 1XMOL 5IP9G 2JA5H 1VQNA 1VQEA 4YWMA 3S15H 4YY3Q 4A3CH 4QQBX 3NENA 2AKWB 1QUQA 5EAYA 5LMUQ 1PV4A 3U50C 1VCIA 2K75A 3KOJA 3L0OA 4DV1Q 2N78A 2I0QA 4A3LG 3UE1A 1V43A 3S2HH 2EIFA 2UUBQ 3KYHC 4UPAA 1L0WA 3MEFA 4A3GG 2ZJRA 2V1CC 1CSPA 3PSIA 4LF7L 4AQYL 1B7YB 2YTYA 2MO0A 1WFQA 2K4KA 3D31A 2ATWA 1TWGH 4O0AA 3GTKH 3PF4A 1YHAA 5C3EH 5IT9c 4RMFA 3RLOA 2IX1A 4A4IA 3HOUH 4HIMA 2UXBL 3S1MH 1MJCA 3CCMA 1JT8A 3AFQA 3KLWA 1X3GA 5IYDG 5FLXc 4AIMA 4DV2L 2ID0A 2CKZB 4DR6L 2PQAA 3JC66 1VQGA 1X9NA 1Q12A 2N49A 3T1HQ 3RN2A 1IXRA 1N33Q 2NVXH 1OXUA 3EBEA 1PYBA 4YY3L 1ASZA 3PO3G 2BA0A 5LMUL 1E1OA 2Q2TA 4DV4L 1FJGQ 3E0EA 4OWTB 4A3FG 1J6QA 1HZAA 1A62A 3EIVA 3J81j 4A3DH 5K36G 3F2BA 1OXSC 3EN2A 4IFDG 1B70B 2B3GA 3HOWG 4JV5Q 5C4XG 4XIGS 3W5OA 2IHEA 2YTVA 1BKBA 2KHJA 3A0JA 2ZM6L 2I5HA 2L15A 1TWCH 1YHQA 1AE2A 3S17H 1UE1A 3I4MH 2ALYB 4X62Q 5J3BA 4LFCL 3RLFA 2BH8A 4DR2Q 3J7A5 3HOVH 2H5XA 1SMXA 1BBWA 1NTGA 4UP9A 3JAMi 4JBJA 4JBKA 2JA8H 4YWLA 1SLJA 4JI3Q 3AQQA 4JYAL 4IFDI 4L5TA 1KRSA 3M4PA 3J7ZC 1E24A 1EIFA 2JA7H 3HOYH 4A3MG 2N8NA 3HKZG 3I56A 4EQ5A 2R7ZH 3A5UA 1HR0W 1XPOA 3CPWA 3VDYA 2QEXA 3PO2H 2OTJA 1MIUA 1VQOA 1N33L 5JEAJ 4X66L 3BU2A 4LF8Q 3L2PA 3A74A 1UWVA 3TQYA 1S72A 5IE8A 4IPHA 2HHHQ 4BXXH 4C3JH 3RR5A 4A75A 1LM0A 1QVCA 4DR4Q 1BBUA 2JA5G 4A3CG 1S3OA 1LUZA 2VNUD 2WAQE 3HOZH 4YHHQ 1M1KC 2WP8J 2F3IA 1X6OA 2D62A 2GN5A 2CWPA 3J80c 1L2FA 2MQHA 1Q86C 1JJCB 4JV5L 5FLMH 2UU9Q 1DGSA 3PUVA 3G71A 3PCOB 3CC7A 3H15A 4HJ8A 1Z9FA 3ZJYC 4NB3A 2BA1A 1RL2A 4JG2A 2B63H 3RNUA 3OTOL 4GOPB 4DR7Q 5JJKA 1OXTA 4DV6Q 1XPUA 4MTNA 4OO1G 4B3MQ 3D0FA 3GDEA 4JI3L 4NXMQ 1D8LA 1FL0A 1HNZQ 2VQEQ 5C0XI 2K5NA 5IP7H 2ZTCA 2JEAI 2UUCQ 4KI0A 2R7FA 3CCLA 1I50H 3S1NH 4HIOA 3CCSA 4HJ7A 2K14A 2KBNA 4LF8L 3GTPH 4DK3C 2HHHL 3U4VA 2B29A 2VUMH 3S16H 5IYCG 4GOPC 4DR4L 2E2IH 4OO1I 1KXLA 4KHZA 1SE8A 1HNXL 4BY1H 1PH8A 2DUDA 4GLVB 1X55A 3STBD 4YHHL 4IO9A 5JJLA 1G291 1Q8KA 2N3SA 4A3BH 3K8AA 1PH1A 2HIVA 2Z0SA 2LXKA 4PZ6A 4LF4Q 4A3DG 1HR0Q 1J5EQ 1FGUA 1XNRQ 4DUYQ 1OXXK 3CF5A 1W3SA 4LFBL 4DKAC 2ZTDA 2D0OA 5IY0A 2PI2E 1V1QA 2Z6KC 3M4QA 4X64L 3M3YH 4DR7L 3I4MG 1AE3A 4NXML 4YWKA 4Y7NH 1L1OB 2NZOA 5H1SE 2VQEL 1XPRA 4JI5Q 3CW2C 2NVTH 4EX5A 3HOVG 2E5LQ 3NELA 4O2DA 1X3FA 2UUCL 2JA8G 2OQKA 3KF8B 3KF6B 2UUAQ 1QZGA 1EIYB 4TVAB 2IHFA 2JA7G 2AMCB 3HOYG 2VL6A 2R93H 1N32Q 3I2ZA 3T1YL 1QZHA 5BR8Q 3Q8DA 4JI4Q 3PO2G 4JC0A 1P16A 4R1JA 4GLXA 1VQ4A 2YU9H 1YJ9A 4PZ8A 4GKJQ 1G6PA 1GVPA 3CCJA 5GAEC 3RZDH 1L1OC 1HZ9A 3KDFB 1MKHA 4DV5Q 4HJAA 4LWCA 3I4NH 3GTQH 5C44H 4LF4L 3HOZG 1SR3A 2RF4A 1K8GA 1HR0L 3S24A 4DUYL 2A8VA 5M3FH 3CC2A 4POFA 1A8VA 4A3KH 1YITA 4GOPA 1NJIC 3UDXA 3CPFA 1VQIA 2UXDQ 1YZ6A 3CQZH 2PI2A 3J81i 3JAMc 1HJPA 3AYHB 4R4CA 2OQ0A 4RG1A 1KAWA 5M3MH 3H3VH 4DV1L 2B63G 1LYLA 3ULLA 1QVFA 4GN3B 3I55A 4DR1Q 3BJUA 4A3EH 3CCQA 4OWWB 4X65Q 1SRUA 1VQDA 2UUBL 2D0PA 2WAQG 1LTLA 1X54A 1EQRA 1Q46A 4PZ7A 1WYDA 3CMAA 2UUAL 2JJQA 1PHJA 3M7NA 1Q81C 2K5VA 2K5HA 5IP7G 4Y52H 2Z6KA 2Q2HA 3GD7A 2XGTA 3PUXA 3TEHB 1KIXA 1JE5A 1N32L 1UE5A 1VQJA 5BR8L 2YYZA 4C3IH 1HZBA 2KCMA 3NBHB 1NY4A 2VQFQ 4GKJL 4DNIA 2PMZE 2Q2IA 3DM3A 4OONA 2VUMG 1CKMA 2MO1A 4R4IA 1SROA 1NBWA 3S1RH 4DAMA 1K3RA 4DV5L 1JB7A 4L5SA 1Q1EA 1V9PA 2OCEA 3BZKA 4UP8A 1M90C 4BY1G 4MZ9A 3T1HL 4LF9Q 4LF5Q 2IX0A 2QGQA 1IYJB 2FXQA 1VQCA 5LMNW 1PH4A 3GTOH 3HKSA 3RZOH 4A3BG 2AHOB 4DUZQ 1TWFH 1FJGL 2UXDL 4HJ9A 1YVCA 4A3LH 2YTXA 3FKIH 1L1OA 1Y1VH 1K73C 1RIPA 1YBYA 2XTIA 1PH9A 4DV7Q 1I6HH 1IBLQ 2HQLA 3CP0A 4DR1L 5C0XG 1GD7A 2JA6H 1Y1WH 3KF6A 1IBMQ 5HGQA 1AH9A 3GTJH 4X65L 5IYBH 5AJ3Q 2QA4A 2K50A 4GS3A 1N34Q 2VW9A 4QJFA 1E22A 4JI8Q 3TS0A 3TRZA 4X62L 1PH3A 2ZJQA 1YHBA 3CCUA 5JJIA 2WFWA 4DV3Q 2ASBA 2JE6I 1R9TH 1N8RC 4A93H 2MNAA 3GTMH 1TXYA 4IFDJ 4B3TQ 2R93G 2VQFL 3KDFA 1C9OA 5IWAQ 1PYSB 1EWIA 1PH5A 1N36Q 1MJEA 3K7UC 1YI2A 1VQ7A 3S14H 1T9HA 4P75A 4OWXB 3UE0A 3A5ZB 4PG3A 3FHWA 4GN4B 5C3EG 4OX9Q 4UY8C 3HOUG 1I5FA 3PO3H 1GKHA 3ER0A 4ALPA 1UE7A 4LF6Q 1G51A 2DGYA 3I4NG 4DUZL 3FP9A 4GN5A 5C44G 1KQSA 2VS1A 4JI0Q 3K81C 1C7YA 1VQFA 3CCRA 3CMEA 2Q2UA 3M4OH 3S2DH 4B3RQ 4A76A 1VQ5A 1FVIA 4A3KG 4A3IH 3HOWH 3H0GH 1Y14B 4DPGA 4DV7L 3UDFA 4JBWA 5GAGC 1QVGA 1PH6A 1CUKA 1HZCA 2Y0SG 1WCMH 4OXPA 1X3EA 1YJNA 1IBML 1GO3E 3CXCA 1A63A 2UU9L 4BBSH 1VQ8A 3ICEA 4BA2I 2RHSB 5M3MG 5AJ3L 3HOXH 3CC4A 4K0KQ 3HFZB 4JCVE 4JBMA 4AYBE 3M85A 4A3EG 1KD1C 5LMNQ 4JI7Q 3K80C 1WJJA 4DV3L 4AQYQ 4DV6L 4JOIC 4A3JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WI5 A;  1BVS A;  4B3M L;  4B3T L;  3W1B A;  3CAM A;  5C0X J;  5IWA L;  1HNZ L;  4PMW A;  1N36 L;  4YCU A;  5GQO A;  1I94 Q;  3LGJ A;  4ME3 A;  1YEZ A;  2NN6 I;  1W2B A;  3W1G A;  1VQK A;  1U5K A;  4LUO A;  3H3V I;  4KHP Q;  4OX9 L;  4DR6 Q;  1E3P A;  3K0X A;  1VQP A;  2WB1 G;  3PUY A;  2LSS A;  4LF6 L;  1VQ6 A;  4HIK A;  4DR5 Q;  2LXJ A;  2R7Z G;  4NPS A;  3G6E A;  4LFA Q;  3BZC A;  4JI0 L;  3GTG H;  1XMQ Q;  1UEB A;  1TWH H;  2Y0S E;  4P72 A;  2K52 A;  1WOC A;  4APV A;  3B6Y A;  4B3R L;  2E2H H;  4DV4 Q;  2UXC Q;  3J81 c;  1EFW A;  4X6A H;  2F4V Q;  2A19 A;  1VQ9 A;  1CKN B;  4BXX G;  1JJG A;  3OYY A;  3GTL H;  3KFU A;  3E9H A;  3CCE A;  3FKI G;  3GO5 A;  1Y1V G;  3PUZ A;  1VQL A;  2ZM6 Q;  1J5E L;  2RCN A;  5ELO A;  1XNR L;  4K0K L;  2E2J H;  1IL2 A;  5FJ8 H;  2ES2 A;  4BBR H;  2JA6 G;  1Y1W G;  4TQU S;  5FLM G;  2A1A A;  4QY7 A;  4GKK Q;  5IYB G;  5LMN L;  1Q1B A;  4JI7 L;  4L5R C;  4LFC Q;  5E7N A;  4BY7 H;  1K83 H;  1O7I A;  2RHQ B;  5JEA G;  1PH2 A;  4POG A;  3AEV A;  4DR2 L;  1EYG A;  4LW1 A;  4YCW A;  4WJ3 M;  2YV5 A;  2GVA A;  4GNX B;  2OTL A;  2WB1 E;  4JYA Q;  1JJ2 A;  4JI5 L;  1K0R A;  1NE3 A;  4J15 A;  1I94 L;  5GRO A;  2E5L L;  4A93 G;  1XNQ Q;  4KHP L;  1U0L A;  3TRE A;  5GAH C;  2R92 H;  1EUJ A;  5GAD C;  5C4J H;  5IYC H;  4WJ4 A;  4JI6 Q;  2IY5 B;  4DR5 L;  4X66 Q;  4KLK A;  3PIP A;  2KCT A;  4JOI A;  3MXN B;  4LFA L;  4JI4 L;  1XMQ L;  2CQO A;  2GVB A;  4P74 A;  4IPC A;  4JI1 Q;  3CD6 A;  1KHI A;  4LUZ A;  1A0I A;  3PUW A;  4LUV A;  4AH6 A;  2F4V L;  4GNX C;  2UXC L;  2EQS A;  3RLN A;  3I7F A;  5ELN A;  4DR3 Q;  2C35 B;  3AFP A;  3U58 A;  3F8T A;  5IP9 H;  3L7Z C;  4DAY B;  1EQQ A;  4A3I G;  1CSQ A;  1K8A C;  3STB C;  2KEN A;  3H0G G;  4BA1 I;  2JK8 A;  2VY3 A;  1KL9 A;  2JA9 A;  4NXN Q;  1WCM G;  1YIJ A;  1HH2 P;  1PH7 A;  4B3S Q;  1B8A A;  1XJV A;  2OWO A;  3RN5 A;  4BBS G;  4GKK L;  2R6G A;  1SN8 A;  3HOX G;  4LNQ A;  4P73 A;  4DV0 Q;  1SFO H;  2IT1 A;  3OTO Q;  1X65 A;  2CCZ A;  3PF5 A;  3DLL A;  1PFS A;  1QUQ B;  1E1T A;  1YNX A;  4R4Q A;  2I5M X;  1Z47 A;  3KJO A;  1KRT A;  1NMG A;  1E7Z A;  5M5W H;  2BH2 A;  3E9I A;  4HJ5 A;  4A3J G;  1XNQ L;  4A3G H;  1CKO A;  4QIW E;  4C2M H;  2CWA A;  4L5Q A;  4JI2 Q;  1TWA H;  2R7D A;  4JI6 L;  1C0A A;  1I3Q H;  3IRB A;  4IPG A;  4IOA A;  4GLA C;  1ASY A;  1CKN A;  1X56 A;  4JI1 L;  3PV0 A;  3M9B A;  1P8L A;  1VQM A;  5IYD H;  4UP7 A;  4AYB G;  1HNX Q;  1N9W A;  3ERS X;  3F2D A;  4IOC A;  4QL5 A;  1GM5 A;  2AWO A;  4DR3 L;  3I4O A;  4MNO A;  4HID A;  1IBK Q;  2VZA A;  1VQB A;  4H02 A;  3G48 A;  1UE6 A;  1NMF A;  3ULP A;  2E8G A;  4LF9 L;  4LF5 L;  1HNW Q;  1D7Q A;  3S1Q H;  4NXN L;  4YCV A;  3U4Z A;  2PQA B;  3F1Z A;  1XMO Q;  4B3S L;  4A3F H;  4LFB Q;  4IJH A;  2ZJP A;  2JQO A;  2NVQ H;  1VQA A;  4DV0 L;  4GNX A;  5M3F G;  2JEB I;  4X64 Q;  5FJ8 G;  4BBR G;  5C4X H;  3HKZ E;  3PGZ A;  2NVY H;  4XTC S;  4BY7 G;  4QGU A;  3J80 i;  1Q82 C;  2CFM A;  1IBL L;  5M5Y H;  3CCV A;  3K7A H;  2NN6 G;  3ULJ A;  4C3H H;  4FDB A;  1K9M C;  1N34 L;  1JMC A;  5M5X H;  4JI2 L;  4JI8 L;  4P71 A;  1YJW A;  1Q7Y C;  2KHI A;  2HT1 A;  1EOV A;  4LF7 Q;  1KC8 C;  4R4O A;  3G4S A;  3T1Y Q;  2I5L X;  1PA6 A;  2PNH A;  1VS0 A;  3NEM A;  2R92 G;  1S40 A;  1XTD A;  3UDG A;  4A3M H;  3KJP A;  3TS2 A;  2MFI A;  2F52 A;  2HIX A;  1IZ6 A;  2NZH A;  4IJL A;  3OW2 A;  2EXD A;  5HY6 A;  3F2C A;  1OTC A;  2UXB Q;  4IPD A;  3PIO A;  5DLQ E;  1IBK L;  4DV2 Q;  1H95 A;  2AWN A;  2ZTE A;  4DK6 C;  1VQH A;  4R4T A;  1HNW L;  3WWV A;  1OXV A;  1PVO A;  3SGI A;  3UDI A;  1XMO L;  5IP9 G;  2JA5 H;  1VQN A;  1VQE A;  4YWM A;  3S15 H;  4YY3 Q;  4A3C H;  4QQB X;  3NEN A;  2AKW B;  1QUQ A;  5EAY A;  5LMU Q;  1PV4 A;  3U50 C;  1VCI A;  2K75 A;  3KOJ A;  3L0O A;  4DV1 Q;  2N78 A;  2I0Q A;  4A3L G;  3UE1 A;  1V43 A;  3S2H H;  2EIF A;  2UUB Q;  3KYH C;  4UPA A;  1L0W A;  3MEF A;  4A3G G;  2ZJR A;  2V1C C;  1CSP A;  3PSI A;  4LF7 L;  4AQY L;  1B7Y B;  2YTY A;  2MO0 A;  1WFQ A;  2K4K A;  3D31 A;  2ATW A;  1TWG H;  4O0A A;  3GTK H;  3PF4 A;  1YHA A;  5C3E H;  5IT9 c;  4RMF A;  3RLO A;  2IX1 A;  4A4I A;  3HOU H;  4HIM A;  2UXB L;  3S1M H;  1MJC A;  3CCM A;  1JT8 A;  3AFQ A;  3KLW A;  1X3G A;  5IYD G;  5FLX c;  4AIM A;  4DV2 L;  2ID0 A;  2CKZ B;  4DR6 L;  2PQA A;  3JC6 6;  1VQG A;  1X9N A;  1Q12 A;  2N49 A;  3T1H Q;  3RN2 A;  1IXR A;  1N33 Q;  2NVX H;  1OXU A;  3EBE A;  1PYB A;  4YY3 L;  1ASZ A;  3PO3 G;  2BA0 A;  5LMU L;  1E1O A;  2Q2T A;  4DV4 L;  1FJG Q;  3E0E A;  4OWT B;  4A3F G;  1J6Q A;  1HZA A;  1A62 A;  3EIV A;  3J81 j;  4A3D H;  5K36 G;  3F2B A;  1OXS C;  3EN2 A;  4IFD G;  1B70 B;  2B3G A;  3HOW G;  4JV5 Q;  5C4X G;  4XIG S;  3W5O A;  2IHE A;  2YTV A;  1BKB A;  2KHJ A;  3A0J A;  2ZM6 L;  2I5H A;  2L15 A;  1TWC H;  1YHQ A;  1AE2 A;  3S17 H;  1UE1 A;  3I4M H;  2ALY B;  4X62 Q;  5J3B A;  4LFC L;  3RLF A;  2BH8 A;  4DR2 Q;  3J7A 5;  3HOV H;  2H5X A;  1SMX A;  1BBW A;  1NTG A;  4UP9 A;  3JAM i;  4JBJ A;  4JBK A;  2JA8 H;  4YWL A;  1SLJ A;  4JI3 Q;  3AQQ A;  4JYA L;  4IFD I;  4L5T A;  1KRS A;  3M4P A;  3J7Z C;  1E24 A;  1EIF A;  2JA7 H;  3HOY H;  4A3M G;  2N8N A;  3HKZ G;  3I56 A;  4EQ5 A;  2R7Z H;  3A5U A;  1HR0 W;  1XPO A;  3CPW A;  3VDY A;  2QEX A;  3PO2 H;  2OTJ A;  1MIU A;  1VQO A;  1N33 L;  5JEA J;  4X66 L;  3BU2 A;  4LF8 Q;  3L2P A;  3A74 A;  1UWV A;  3TQY A;  1S72 A;  5IE8 A;  4IPH A;  2HHH Q;  4BXX H;  4C3J H;  3RR5 A;  4A75 A;  1LM0 A;  1QVC A;  4DR4 Q;  1BBU A;  2JA5 G;  4A3C G;  1S3O A;  1LUZ A;  2VNU D;  2WAQ E;  3HOZ H;  4YHH Q;  1M1K C;  2WP8 J;  2F3I A;  1X6O A;  2D62 A;  2GN5 A;  2CWP A;  3J80 c;  1L2F A;  2MQH A;  1Q86 C;  1JJC B;  4JV5 L;  5FLM H;  2UU9 Q;  1DGS A;  3PUV A;  3G71 A;  3PCO B;  3CC7 A;  3H15 A;  4HJ8 A;  1Z9F A;  3ZJY C;  4NB3 A;  2BA1 A;  1RL2 A;  4JG2 A;  2B63 H;  3RNU A;  3OTO L;  4GOP B;  4DR7 Q;  5JJK A;  1OXT A;  4DV6 Q;  1XPU A;  4MTN A;  4OO1 G;  4B3M Q;  3D0F A;  3GDE A;  4JI3 L;  4NXM Q;  1D8L A;  1FL0 A;  1HNZ Q;  2VQE Q;  5C0X I;  2K5N A;  5IP7 H;  2ZTC A;  2JEA I;  2UUC Q;  4KI0 A;  2R7F A;  3CCL A;  1I50 H;  3S1N H;  4HIO A;  3CCS A;  4HJ7 A;  2K14 A;  2KBN A;  4LF8 L;  3GTP H;  4DK3 C;  2HHH L;  3U4V A;  2B29 A;  2VUM H;  3S16 H;  5IYC G;  4GOP C;  4DR4 L;  2E2I H;  4OO1 I;  1KXL A;  4KHZ A;  1SE8 A;  1HNX L;  4BY1 H;  1PH8 A;  2DUD A;  4GLV B;  1X55 A;  3STB D;  4YHH L;  4IO9 A;  5JJL A;  1G29 1;  1Q8K A;  2N3S A;  4A3B H;  3K8A A;  1PH1 A;  2HIV A;  2Z0S A;  2LXK A;  4PZ6 A;  4LF4 Q;  4A3D G;  1HR0 Q;  1J5E Q;  1FGU A;  1XNR Q;  4DUY Q;  1OXX K;  3CF5 A;  1W3S A;  4LFB L;  4DKA C;  2ZTD A;  2D0O A;  5IY0 A;  2PI2 E;  1V1Q A;  2Z6K C;  3M4Q A;  4X64 L;  3M3Y H;  4DR7 L;  3I4M G;  1AE3 A;  4NXM L;  4YWK A;  4Y7N H;  1L1O B;  2NZO A;  5H1S E;  2VQE L;  1XPR A;  4JI5 Q;  3CW2 C;  2NVT H;  4EX5 A;  3HOV G;  2E5L Q;  3NEL A;  4O2D A;  1X3F A;  2UUC L;  2JA8 G;  2OQK A;  3KF8 B;  3KF6 B;  2UUA Q;  1QZG A;  1EIY B;  4TVA B;  2IHF A;  2JA7 G;  2AMC B;  3HOY G;  2VL6 A;  2R93 H;  1N32 Q;  3I2Z A;  3T1Y L;  1QZH A;  5BR8 Q;  3Q8D A;  4JI4 Q;  3PO2 G;  4JC0 A;  1P16 A;  4R1J A;  4GLX A;  1VQ4 A;  2YU9 H;  1YJ9 A;  4PZ8 A;  4GKJ Q;  1G6P A;  1GVP A;  3CCJ A;  5GAE C;  3RZD H;  1L1O C;  1HZ9 A;  3KDF B;  1MKH A;  4DV5 Q;  4HJA A;  4LWC A;  3I4N H;  3GTQ H;  5C44 H;  4LF4 L;  3HOZ G;  1SR3 A;  2RF4 A;  1K8G A;  1HR0 L;  3S24 A;  4DUY L;  2A8V A;  5M3F H;  3CC2 A;  4POF A;  1A8V A;  4A3K H;  1YIT A;  4GOP A;  1NJI C;  3UDX A;  3CPF A;  1VQI A;  2UXD Q;  1YZ6 A;  3CQZ H;  2PI2 A;  3J81 i;  3JAM c;  1HJP A;  3AYH B;  4R4C A;  2OQ0 A;  4RG1 A;  1KAW A;  5M3M H;  3H3V H;  4DV1 L;  2B63 G;  1LYL A;  3ULL A;  1QVF A;  4GN3 B;  3I55 A;  4DR1 Q;  3BJU A;  4A3E H;  3CCQ A;  4OWW B;  4X65 Q;  1SRU A;  1VQD A;  2UUB L;  2D0P A;  2WAQ G;  1LTL A;  1X54 A;  1EQR A;  1Q46 A;  4PZ7 A;  1WYD A;  3CMA A;  2UUA L;  2JJQ A;  1PHJ A;  3M7N A;  1Q81 C;  2K5V A;  2K5H A;  5IP7 G;  4Y52 H;  2Z6K A;  2Q2H A;  3GD7 A;  2XGT A;  3PUX A;  3TEH B;  1KIX A;  1JE5 A;  1N32 L;  1UE5 A;  1VQJ A;  5BR8 L;  2YYZ A;  4C3I H;  1HZB A;  2KCM A;  3NBH B;  1NY4 A;  2VQF Q;  4GKJ L;  4DNI A;  2PMZ E;  2Q2I A;  3DM3 A;  4OON A;  2VUM G;  1CKM A;  2MO1 A;  4R4I A;  1SRO A;  1NBW A;  3S1R H;  4DAM A;  1K3R A;  4DV5 L;  1JB7 A;  4L5S A;  1Q1E A;  1V9P A;  2OCE A;  3BZK A;  4UP8 A;  1M90 C;  4BY1 G;  4MZ9 A;  3T1H L;  4LF9 Q;  4LF5 Q;  2IX0 A;  2QGQ A;  1IYJ B;  2FXQ A;  1VQC A;  5LMN W;  1PH4 A;  3GTO H;  3HKS A;  3RZO H;  4A3B G;  2AHO B;  4DUZ Q;  1TWF H;  1FJG L;  2UXD L;  4HJ9 A;  1YVC A;  4A3L H;  2YTX A;  3FKI H;  1L1O A;  1Y1V H;  1K73 C;  1RIP A;  1YBY A;  2XTI A;  1PH9 A;  4DV7 Q;  1I6H H;  1IBL Q;  2HQL A;  3CP0 A;  4DR1 L;  5C0X G;  1GD7 A;  2JA6 H;  1Y1W H;  3KF6 A;  1IBM Q;  5HGQ A;  1AH9 A;  3GTJ H;  4X65 L;  5IYB H;  5AJ3 Q;  2QA4 A;  2K50 A;  4GS3 A;  1N34 Q;  2VW9 A;  4QJF A;  1E22 A;  4JI8 Q;  3TS0 A;  3TRZ A;  4X62 L;  1PH3 A;  2ZJQ A;  1YHB A;  3CCU A;  5JJI A;  2WFW A;  4DV3 Q;  2ASB A;  2JE6 I;  1R9T H;  1N8R C;  4A93 H;  2MNA A;  3GTM H;  1TXY A;  4IFD J;  4B3T Q;  2R93 G;  2VQF L;  3KDF A;  1C9O A;  5IWA Q;  1PYS B;  1EWI A;  1PH5 A;  1N36 Q;  1MJE A;  3K7U C;  1YI2 A;  1VQ7 A;  3S14 H;  1T9H A;  4P75 A;  4OWX B;  3UE0 A;  3A5Z B;  4PG3 A;  3FHW A;  4GN4 B;  5C3E G;  4OX9 Q;  4UY8 C;  3HOU G;  1I5F A;  3PO3 H;  1GKH A;  3ER0 A;  4ALP A;  1UE7 A;  4LF6 Q;  1G51 A;  2DGY A;  3I4N G;  4DUZ L;  3FP9 A;  4GN5 A;  5C44 G;  1KQS A;  2VS1 A;  4JI0 Q;  3K81 C;  1C7Y A;  1VQF A;  3CCR A;  3CME A;  2Q2U A;  3M4O H;  3S2D H;  4B3R Q;  4A76 A;  1VQ5 A;  1FVI A;  4A3K G;  4A3I H;  3HOW H;  3H0G H;  1Y14 B;  4DPG A;  4DV7 L;  3UDF A;  4JBW A;  5GAG C;  1QVG A;  1PH6 A;  1CUK A;  1HZC A;  2Y0S G;  1WCM H;  4OXP A;  1X3E A;  1YJN A;  1IBM L;  1GO3 E;  3CXC A;  1A63 A;  2UU9 L;  4BBS H;  1VQ8 A;  3ICE A;  4BA2 I;  2RHS B;  5M3M G;  5AJ3 L;  3HOX H;  3CC4 A;  4K0K Q;  3HFZ B;  4JCV E;  4JBM A;  4AYB E;  3M85 A;  4A3E G;  1KD1 C;  5LMN Q;  4JI7 Q;  3K80 C;  1WJJ A;  4DV3 L;  4AQY Q;  4DV6 L;  4JOI C;  4A3J H; 
#chains in the Genus database with same CATH topology
 1WI5 A;  2D9U A;  4DK0 A;  3W1B A;  5J39 A;  3SK8 A;  2PZU A;  3MAQ A;  2AQ1 B;  5EQ0 A;  4MHE A;  3P75 A;  5IGE A;  3H3V C;  4RGT A;  2EJM A;  4HR7 B;  3H3V I;  4KHP Q;  4DR6 Q;  1E3P A;  3K0X A;  4K6D A;  2WB1 G;  3PUY A;  2L5T A;  2X69 A;  5LL6 X;  2LXJ A;  2R7Z G;  3E5S A;  1KAA A;  3TP5 A;  2L11 A;  1XMQ Q;  1AFP A;  1H9K A;  2K52 A;  3GTO B;  3RZO B;  1DOL A;  3V96 A;  1EFW A;  2F4V Q;  2A19 A;  1VQ9 A;  1BDO A;  1SFO B;  5EPL A;  1JJG A;  1PYW D;  1X3Q A;  3CCE A;  1Y1V G;  2ZM6 Q;  1J5E L;  3H94 A;  4A3G B;  3HEJ A;  1Y1W G;  4ME5 A;  4L5R C;  1Q1B A;  4JI7 L;  4BY7 H;  2CW0 C;  1K83 H;  2RHQ B;  5JEA G;  1PH2 A;  2GVA A;  2RCF A;  2EYF A;  3Q0A A;  5JOB A;  1K0R A;  1NE3 A;  4HAE A;  5ELC A;  3W3A A;  2E5L L;  5LHY 1;  2B2V A;  2R92 H;  4WJ4 A;  4QIW B;  4L8J A;  3I4L A;  4KLK A;  2KCT A;  2KQ3 A;  4JOI A;  4WFN 3;  1XWE A;  2GVB A;  4M8A A;  2K01 A;  2NBF A;  2UXC L;  3SDZ A;  1PFM A;  5M9O A;  1CTM A;  2H4O A;  4OL7 A;  5CR3 A;  3AFP A;  3F8T A;  2NVY B;  5IP9 H;  1PTO H;  3H0G G;  2IL8 A;  2G5D A;  5M5Y B;  1KL9 A;  3K7A B;  3SR1 A;  1WCM G;  1YIJ A;  4OHJ A;  4C3H B;  4B3S Q;  5KRU A;  1XJV A;  2SOB A;  3MWY W;  4BBS G;  4OEM B;  4GKK L;  4FXG C;  3SE0 A;  4P73 A;  1WVL A;  2IT1 A;  1X65 A;  4DV7 L;  1PFS A;  3A55 A;  2B39 A;  4J1M A;  4CBV A;  1T5X D;  1KRT A;  4DU9 A;  1HA6 A;  3HKZ B;  1CKO A;  5A35 A;  4U67 3;  4JPB W;  2R7D A;  1TR5 A;  1C0A A;  3VYS A;  4K8I A;  3IRB A;  3OMC A;  4GLA C;  1CKN A;  3PV0 A;  5IGG A;  3M9B A;  1P8L A;  4AYB G;  4ZCK A;  1N9W A;  3F2D A;  5CGK A;  1Y8N B;  3A56 A;  1GM5 A;  1V1P A;  4MNO A;  3G48 A;  2E8G A;  1WD0 A;  3S1Q H;  4A3F H;  4B9X A;  4LFB Q;  4IJH A;  1EWC A;  4UDU C;  1VQA A;  3T16 A;  1BQQ T;  4ZAI A;  5D65 A;  2NVQ H;  4DV0 L;  4GNX A;  4IFD H;  2A68 C;  2RKS A;  3NSW A;  4ZUI A;  5M3F G;  4X64 Q;  4BBR G;  3PGZ A;  2WKD A;  4J6H A;  5BN4 A;  2F1M A;  1Q82 C;  2CFM A;  3GTK B;  1TWG B;  2NN6 G;  2Q8R E;  1Y8P B;  2KOL A;  1YJW A;  3MXN A;  1Q7Y C;  2GA4 B;  1KNA A;  3T1Y Q;  2RVL A;  5D14 A;  5JPN C;  5I6W A;  2F52 A;  1U4P A;  1IZ6 A;  3IL8 A;  4IJL A;  4DAY A;  1OTC A;  1MD2 D;  2UXB Q;  2BE5 C;  4IPD A;  4TSS A;  1ZYR D;  1H95 A;  2AWN A;  3IAY A;  1HNW L;  3WWV A;  1KLU D;  4EGV A;  1EEF D;  1PVO A;  3SGI A;  4YY3 Q;  1RTN A;  4RWS C;  3I4M B;  3BYY B;  1GJX A;  4CHT B;  4DAV A;  5KNB A;  3J81 L;  2QDB A;  5FO9 B;  1NR2 A;  1F9R A;  3L0O A;  1SYG A;  1PRT D;  4A3L G;  1V43 A;  3S2H H;  3MTS A;  1YNJ C;  3KYH C;  2PYK A;  4BWG B;  2RDF A;  1L0W A;  3MEF A;  4A3G G;  2B2T A;  1HUM A;  1F9Q A;  5EKL A;  2ATW A;  3JAM L;  2QF7 A;  3MXG A;  1I4R A;  1BOS A;  4RMF A;  2F0D A;  3RLO A;  2IX1 A;  3SEB A;  4A4I A;  4HIM A;  2DNE A;  2X6L A;  3S1M H;  3AFQ A;  3KLW A;  1X3G A;  3FRP B;  5FLX c;  4AIM A;  5C5L A;  4DV2 L;  4DR6 L;  2PQA A;  1IKM A;  1Z7T A;  4LAA A;  3J7A V;  1IXR A;  3DEO A;  2EY5 A;  1A3T A;  1SXT A;  2IWH A;  3KLS X;  2BA0 A;  5LMU L;  2Q2T A;  3BG3 A;  1PZJ D;  3E0E A;  1J6Q A;  2KA7 A;  4ZKB B;  3J81 j;  4A3D H;  3A7L A;  3F2B A;  5EPJ A;  1B70 B;  2F0S A;  4JV5 Q;  3W5O A;  2ZM6 L;  2KHJ A;  2I5H A;  2L15 A;  3S17 H;  1EQT A;  1SNO A;  3T13 A;  4C3H G;  3RLF A;  2BH8 A;  5M5X B;  2PO4 A;  3HOV H;  4OIJ A;  4UP9 A;  1SMX A;  4CKE A;  4KHV A;  2NB0 A;  2KCN A;  5CBE E;  3M4P A;  2N8N A;  3HKZ G;  3I56 A;  2R7Z H;  1HR0 W;  1KDC A;  1B2T A;  4Q0F A;  1EY7 A;  1TKW B;  1N33 L;  3BS1 A;  5JEA J;  4CKB A;  3TQY A;  1S72 A;  5IE8 A;  3RD4 A;  4ZRZ A;  3VR2 A;  3RR5 A;  3CRL C;  4K6L A;  1IYV A;  1QVC A;  4JW0 A;  2K28 A;  1S3O A;  4YHH Q;  4DNT B;  1B50 A;  2D62 A;  2C5C A;  2F0T A;  2MQH A;  1Q86 C;  2UU9 Q;  2NTT A;  3G71 A;  3CRK C;  5IT9 E;  1HUN A;  5NUC A;  5JEA H;  1IYU A;  3QG1 A;  4NB3 A;  1A2T A;  2B63 H;  1CM9 A;  3RNU A;  4GOP B;  5IIF A;  3VYU A;  3D0F A;  3HRZ C;  4JI3 L;  3D6W A;  3QOL A;  5C0X I;  3ND8 A;  4KI0 A;  3HOU B;  1SJE D;  2R7F A;  1I50 H;  5C5M A;  3CCS A;  2EYJ A;  2FFK B;  5IYC G;  1I4G A;  1BCP F;  2I07 B;  3RMH A;  4OO1 I;  1SE8 A;  1AZQ A;  4ILW A;  4CDD C;  1X55 A;  3DMU A;  2FHT A;  1Q8K A;  2N3S A;  2E75 C;  3K8A A;  2C9O A;  1PH1 A;  1D1I A;  3VR4 A;  1OXX K;  3CF5 A;  4A3E B;  2F03 A;  4LFB L;  4M1U B;  2NZ1 D;  1WTV A;  3QB3 A;  1BBX C;  3C3L A;  2PI2 E;  1V1Q A;  2Z6K C;  3M4Q A;  4X64 L;  3M3Y H;  4DR7 L;  3I4M G;  1JC7 A;  1AE3 A;  3G6J B;  2NZO A;  1ONL A;  4Q5V A;  3NEL A;  4O2D A;  2UUC L;  1NCV A;  3KF8 B;  3S1R B;  2NUC A;  1I4Q A;  3J80 E;  2DY8 A;  2ENB A;  5C6A A;  1N32 Q;  4XQQ A;  3I2Z A;  4FO2 A;  1DYQ A;  3T1Y L;  2OT2 A;  3K5L A;  4GLX A;  1L1O C;  4FF3 A;  3FKI B;  1UUP A;  4DV5 Q;  2PMZ B;  5JJZ A;  3I4N H;  5C44 H;  1WD1 A;  4LF4 L;  2RF4 A;  2WIN B;  1K8G A;  3S24 A;  1HR0 L;  1LAB A;  5M3F H;  1IW7 D;  1A8V A;  1YIT A;  1EY9 A;  3NTH A;  1PFN A;  2MHV A;  1NJI C;  4HED A;  4WRD A;  1KAB A;  2PI2 A;  3NP8 A;  1HJP A;  2NN6 H;  3AYH B;  1KAW A;  5ELD A;  1JWS D;  3I55 A;  3BJU A;  4OWW B;  4X65 Q;  1SRU A;  3V05 A;  1SNQ A;  3TN2 A;  3CHB D;  1Q81 C;  2K5H A;  5IP7 G;  2Z8L A;  4Y52 H;  2IPK D;  3TSS A;  5ELB A;  1EFI D;  1QJO A;  1STG A;  4IN3 A;  5C4Z A;  4C3I H;  4KV6 A;  2A73 B;  1ESF A;  1F9S A;  1CKM A;  2EY2 A;  1LV9 A;  2MO1 A;  3GQB A;  3M4O B;  1JB7 A;  4XXE A;  2JSO A;  5J22 A;  4PMC A;  4K2L A;  4MZ9 A;  3L3O C;  5I2X A;  4LF5 Q;  3TP8 A;  5LMN W;  3OIP A;  3GTO H;  1EZ6 A;  3RZO H;  4DUZ Q;  1AW7 A;  1TWF H;  2OF1 A;  2F0H A;  2UXD L;  2E74 C;  2XRS D;  4A3L H;  1YBY A;  3ZYY X;  1U4M A;  2LMC B;  4DV7 Q;  1I6H H;  5E1F A;  1IBL Q;  2K7V A;  4DR1 L;  1AH9 A;  5HGQ A;  3GTJ H;  2QA4 A;  1EYC A;  2K50 A;  4GS3 A;  3QR8 A;  2VW9 A;  1TII D;  4MIU A;  4QJF A;  3K59 A;  1S5C D;  3CCU A;  2KEE A;  2F0F A;  3OHX C;  2WFW A;  1N8R C;  4A93 H;  4KKS A;  2PNR C;  1TWH B;  5KIX A;  2O4X A;  3K7U C;  4P75 A;  2L12 A;  1WTH A;  3UE0 A;  3JAM E;  3NPP A;  5G3L D;  3HOU G;  3GTL B;  3I70 A;  3ER0 A;  4ALP A;  1JQY D;  2E2J B;  2HQE A;  2VS1 A;  4RHR A;  1VQF A;  1TS5 A;  3CCR A;  1RTO A;  1LAC A;  4A3I H;  4OIK A;  5L37 A;  4JBW A;  2EYH A;  1X3E A;  1IBM L;  2UU9 L;  2HCI A;  1VQ8 A;  3ICE A;  2RHS B;  3HOX H;  1IL8 A;  1MI2 A;  2B2V C;  4AYB E;  3M85 A;  4A3E G;  3BYT B;  1KD1 C;  1PRT F;  4EQO A;  4JI7 Q;  1WJJ A;  4AQY Q;  4JOI C;  4A3J H;  1BVS A;  4B3T L;  1LTB D;  1N36 L;  2SNM A;  3W1G A;  1VQK A;  4LUO A;  1FNV A;  2CHB D;  2HD3 A;  1VQP A;  5C3X A;  1XYI A;  1STB A;  1ICF B;  3TBI B;  1VQ6 A;  2EE1 A;  4S3S A;  4NPS A;  1D5M C;  3GTG H;  1UEB A;  4OEL B;  2E2H H;  2UXC Q;  3J81 c;  4KMU C;  2K1B A;  4BXX G;  1K3B C;  1QB5 D;  1U4L A;  3FKI G;  2RCN A;  1IL2 A;  3NBI A;  5FJ8 H;  2ES2 A;  4TQU S;  4C2M B;  2A1A A;  3NXW A;  4QY7 A;  4GKK Q;  5LMN L;  4LFC Q;  4N8X 1;  1K8O A;  4FNF A;  4IQZ A;  5E7N A;  1O7I A;  3AEV A;  4YCW A;  5KYL A;  4RH6 A;  5CBA E;  1QWY A;  1CA5 A;  3DWQ A;  4J15 A;  5GRO A;  2FIN B;  2Q8T A;  2I46 A;  3QO2 A;  1U0L A;  3TRE A;  5GAH C;  3C1F A;  5IYC H;  4DGZ A;  2IY5 B;  2K33 A;  4DR5 L;  4X66 Q;  2AUJ D;  4LFA L;  2EYO A;  3A7A B;  2CQO A;  1PLF A;  1KHI A;  4LUZ A;  1A0I A;  2F4I A;  4GNX C;  2EQS A;  3RLN A;  1D5X C;  5ELN A;  3T56 B;  3HOW B;  2L0C A;  5C4X B;  1LLR D;  2JYO A;  1BF4 A;  4XYO A;  3L7Z C;  1LTS D;  5I9O A;  4BA1 I;  2JK8 A;  1O7Z A;  1SBB B;  1HH2 P;  1PH7 A;  1B8A A;  1VMC A;  2OWO A;  3RN5 A;  4CDE C;  2R6G A;  4LNQ A;  2B2U C;  4DV0 Q;  1KDA A;  4CJ0 B;  1M4V A;  3DLL A;  1QUQ B;  1GUT A;  1YNX A;  1Z47 A;  1NMG A;  1E7Z A;  3NWS A;  5M5W H;  5DM7 3;  4HJ5 A;  4HTH A;  1XNQ L;  4QIW E;  4L5Q A;  1TWA H;  2Z9H A;  1AN8 A;  4FP5 D;  1I3Q H;  3BVZ A;  4IPG A;  5E4W C;  3S15 B;  5IYD H;  1S5E D;  1SYB A;  2R61 A;  4F7X A;  4C1N I;  4DR3 L;  2B2W C;  1QCB D;  3BVM A;  1EQV A;  4H02 A;  1C8C A;  1UE6 A;  1HNW Q;  4LF5 L;  3TP6 A;  1D7Q A;  4NXN L;  2F0V A;  3F1Z A;  4IUT A;  3U9S A;  2ZJP A;  2E76 C;  2JQO A;  2L4N A;  5T1I A;  3HKZ E;  1HTP A;  4XTC S;  1D5Z C;  4MN3 A;  3SK5 A;  1R4P B;  3J80 i;  1IBL L;  3I8Z A;  1JMC A;  5M5X H;  5JVH 3;  4JI2 L;  4P71 A;  4QCL A;  2KHI A;  2K6A A;  2HT1 A;  1DOM A;  2O5I C;  1V1O A;  2FJ2 A;  5KNC A;  1WTP A;  4G7O C;  2CQA A;  4G7Z C;  1ET9 A;  4A3M H;  4IAL A;  2HIX A;  3T4A C;  4HMJ A;  3LWE A;  4X3K A;  3OW2 A;  2EXD A;  1HXY D;  3PIO A;  4DV2 Q;  1STH A;  4DK6 C;  2ZTE A;  1VQH A;  4YIJ A;  2K5D A;  2JA5 H;  1VQN A;  3NEN A;  5LMU Q;  1JIC A;  1L0X B;  2MUY A;  1VCI A;  5IGB A;  2I0Q A;  3MXU A;  1LT4 D;  5FO8 B;  3UE1 A;  2JA8 B;  2EOT A;  1SMY D;  3CU7 A;  1PTO C;  2JA7 B;  1E2Z A;  1ESR A;  1H9S A;  3VYT A;  1BNZ A;  1CSP A;  3PSI A;  4LF7 L;  3PO2 B;  1VF7 A;  1HCZ A;  2QKI C;  4AQY L;  2MO0 A;  2DN8 A;  4FXK C;  1WFQ A;  3D31 A;  1WTO A;  3PF4 A;  4O0A A;  2EXZ A;  1YHA A;  1XTC D;  3HOU H;  2PPB C;  3HOZ B;  2ID0 A;  1U9R A;  1JWM D;  1CI3 M;  1Q12 A;  1VQG A;  2N49 A;  1X9N A;  2F0U A;  1N33 Q;  2NVX H;  1OXU A;  2XIW A;  1E1O A;  5CV8 A;  4OWT B;  2A6E D;  2IW3 A;  1HZA A;  4L63 B;  1A15 A;  2A74 C;  5K36 G;  3EN2 A;  1EY5 A;  3HOW G;  2WAQ B;  5C4X G;  2YTV A;  1BKB A;  1QOH A;  3A0J A;  1YHQ A;  2XNA C;  1UE1 A;  2M2L A;  2ALY B;  3H91 A;  4LFC L;  4O1N A;  1NTG A;  3JAM i;  4H13 C;  5ELF A;  3LWU A;  3QWN A;  4JBJ A;  5CV5 A;  4JI3 Q;  3S16 B;  4L5T A;  4IFD I;  3J7Z C;  2Z6B A;  3HOY H;  1TS2 A;  3CPW A;  2QEX A;  5IGC A;  4KK7 A;  1MIU A;  4CJ1 B;  4X66 L;  4BXX H;  4A75 A;  1RJT A;  4CGY B;  1BBU A;  4A3C G;  1LUZ A;  5C4H A;  1AZP A;  2NVT B;  3PUV A;  3CC7 A;  3H15 A;  4HJ8 A;  2CW0 D;  2MPM A;  5COR A;  3T51 B;  5FLX E;  3TP7 A;  2KVM A;  1ZXT A;  3SK6 A;  5CV6 A;  4CDC C;  4DR7 Q;  2R93 B;  1OXT A;  4DV6 Q;  1XPU A;  2QEJ C;  4OO1 G;  1HNZ Q;  1K28 A;  2YU9 B;  2K5N A;  3QOJ A;  2ZTC A;  2UUC Q;  3U9O A;  3RZD B;  3CCL A;  1EU4 A;  3S1N H;  4HJ7 A;  4LF8 L;  2HHH L;  3U4V A;  2VUM H;  1KTK A;  4DR4 L;  1CFM A;  4KHZ A;  3DWA A;  2F0M A;  3MVV A;  4BY1 H;  2ZXR A;  4GLV B;  3CQZ B;  4BS9 A;  4IO9 A;  5JJL A;  3TZD A;  4A3B H;  2RDH A;  5M3M B;  1O80 A;  2ZXP A;  4LF4 Q;  2F0K A;  2XVS A;  3A54 A;  3D4W A;  4NP5 A;  1FGU A;  1HR0 Q;  1XNR Q;  3R2T A;  3D8G A;  1DZ1 A;  4DKA C;  5KND A;  5IY0 A;  1TWC B;  3DEP A;  1E2V A;  1ENC A;  2EVB A;  4NXM L;  4Y7N H;  4H44 C;  4DA2 A;  5H1S E;  4JI5 Q;  4EX5 A;  4RKL A;  2EZV A;  5EKI A;  2JA8 G;  3KF6 B;  4TVA B;  2JA7 G;  2AMC B;  2D2C C;  5EKK A;  1B9N A;  4I7Z C;  2OXP A;  3HGB A;  1WTX A;  4JI4 Q;  4LJZ C;  3PO2 G;  1P16 A;  4FXD A;  1M8A A;  1YJ9 A;  4PZ8 A;  4C3J B;  1GVP A;  3R2I A;  2XN9 C;  2RDG A;  5JPM C;  1HZ9 A;  3SK4 A;  1ENA A;  5FK9 C;  3HOZ G;  3VYR A;  4E6I A;  4XT3 B;  1WTR A;  2JA6 B;  3MFG A;  1G8Z D;  4POF A;  2A68 D;  4A3K H;  2EYL A;  4GOP A;  1ILQ A;  5FKA C;  1XX8 A;  3CPF A;  1VQI A;  2UXD Q;  1MSH A;  3NQI A;  4KKU A;  3AB9 A;  4I65 A;  5T1G A;  3C1E A;  3VR3 A;  1K8M A;  1R9T B;  1RCV D;  2KUM A;  5EBC A;  1QVF A;  4GN3 B;  4DR1 Q;  2O5J C;  3OWE B;  4IUN A;  3CCQ A;  1VQD A;  2WAQ G;  3S14 B;  1EQR A;  1Q46 A;  2UUA L;  2JJQ A;  4RA8 A;  4TKO B;  4IUP A;  4RCO A;  3TEH B;  2Q2H A;  1KIX A;  1JE5 A;  2FMC A;  2YYZ A;  1AP0 A;  1CZG A;  1NY4 A;  2BE5 D;  4DNI A;  2PMZ E;  2J0T D;  4R4I A;  4B08 A;  1NBW A;  1Q1E A;  2OCE A;  1M90 C;  1SND A;  2IX0 A;  1IYJ B;  1S5D D;  5DEH A;  1VQC A;  4ZK9 B;  5EJW A;  4HJ9 A;  2YTX A;  1Y1V H;  1SNM A;  1RIP A;  2F3W A;  4DF7 A;  1EY0 A;  3P7J A;  1YNJ D;  1ZEQ X;  3KF8 A;  3CP0 A;  2WAC A;  1II3 A;  2ZT9 C;  4ABN A;  1Y1W H;  1IBM Q;  1N34 Q;  3DWP A;  1EYD A;  3IFT A;  1PH3 A;  2ZJQ A;  1HA5 A;  2F0G A;  2G9H D;  3GV6 A;  4U68 A;  2MNA A;  1STA A;  3GTM H;  4B3T Q;  2R93 G;  1I4X A;  1C9O A;  1N36 Q;  1VQ7 A;  3FPU B;  1YI2 A;  4PG3 A;  3FHW A;  5E3F A;  2EPB A;  1Q90 A;  4UY8 C;  3NK9 A;  4NDX A;  3GTQ B;  1G51 A;  2DGY A;  4N8F A;  4GN5 A;  1KQS A;  3KUP A;  2F0N A;  4UAI A;  3CME A;  1VQ5 A;  3HOW H;  4BY7 B;  4FF2 A;  1CA6 A;  3H0G H;  1Y14 B;  1K83 B;  1PH6 A;  5CV9 A;  3K58 A;  1CUK A;  1WCM H;  3FEW X;  1WTW A;  5EGT A;  4NKL A;  4BBS H;  4XDX A;  5M3M G;  5AJ3 L;  2RSO A;  3K0Y A;  3MZ5 A;  4JCV E;  2IX3 A;  4JBM A;  5LMN Q;  2R92 B;  2K32 A;  4X3S A;  4DXG A;  5KEE A;  4DV3 L;  4DV6 L;  1MHW C;  3CAM A;  5C0X J;  4X3U A;  1HNZ L;  4PMW A;  5GQO A;  3I91 A;  3LGJ A;  4ME3 A;  1YEZ A;  2NN6 I;  1W2B A;  2XSC A;  1B3Q A;  1SYC A;  2LSS A;  2DY7 A;  3N52 A;  4UHV A;  3A8I E;  4DR5 Q;  4LF6 L;  3G6E A;  4LFA Q;  3BDO A;  2Y0S E;  4APV A;  4B3R L;  3OOC A;  2AUK A;  3H09 A;  3S9W A;  4NW2 A;  1F9P A;  1U4R A;  4C3J G;  3IFD A;  1BXT A;  5I9P A;  1ROD A;  5DAU A;  3KFU A;  4HCS A;  3GO5 A;  4IUR A;  3PUZ A;  1VQL A;  1XNR L;  5ELO A;  4K0K L;  2DNC A;  4X3T A;  2JA6 G;  4BBR H;  5FLM G;  2K03 A;  3DXJ C;  5IYB G;  2B2Y C;  4POG A;  1EYG A;  4LW1 A;  4WJW A;  4WJ3 M;  2YV5 A;  2WB1 E;  1JJ2 A;  4JI5 L;  1I94 L;  1Z6H A;  1XNQ Q;  2EYP A;  4KTA A;  1EUJ A;  1PZI D;  3E6Z X;  5GAD C;  5C4J H;  3LNN A;  1JWU D;  1NAP A;  1H9M A;  3PIP A;  4JI4 L;  3S1Q B;  3DUZ A;  1NNX A;  4IPC A;  4RKB A;  4A3F B;  1JCK B;  5JAV A;  4ODG A;  1FNW A;  3SHL A;  3I7F A;  3S2D B;  3OIQ A;  4DR3 Q;  1FNU A;  2N88 A;  3U58 A;  4FF4 A;  3STB C;  2VY3 A;  3K5N A;  4NXN Q;  1QG7 A;  1HPC A;  1TY0 A;  3K5M A;  1SFO H;  2CCZ A;  3OTO Q;  4NMZ A;  1E1T A;  1PZK D;  2I5M X;  3KJO A;  3VR6 A;  1EYA A;  2ICI A;  5IGD A;  3E9I A;  4RGO S;  4A3G H;  3J81 E;  2EY6 A;  1CHP D;  2KCC A;  5D3I B;  4JI2 Q;  2TSS A;  4B9W A;  4JI6 L;  1B3A A;  4GZY C;  1ASY A;  4JI1 L;  1VQM A;  1STY A;  4UP7 A;  1ML0 D;  4IOC A;  4QL5 A;  2AWO A;  4HID A;  2SNS A;  4O42 A;  2MP1 A;  3KBX A;  4YCV A;  3U4Z A;  3S2H B;  5CV4 A;  3FDT A;  1DM0 B;  1GXD C;  1PMR A;  2JEB I;  2CH4 W;  2NVY H;  4BY7 G;  1Q8I A;  5M5Y H;  3CCV A;  3K7A H;  3ULJ A;  4C3H H;  1STN A;  3FMC A;  4FDB A;  3X3M A;  1LT5 D;  1N34 L;  3S1M B;  4PV1 C;  1EOV A;  2SDF A;  3BZD B;  3G7L A;  5EBD A;  4LF7 Q;  4R4O A;  3G4S A;  2EJF C;  2I5L X;  2R92 G;  1VS0 A;  1S40 A;  1XTD A;  3UDG A;  3TS2 A;  2MFI A;  4Z9C B;  1A6X A;  3F2C A;  2VB2 X;  5DLQ E;  1IBK L;  4A3D B;  1EY4 A;  3K5O A;  4RCN A;  1OXV A;  3UDI A;  1XMO L;  5IP9 G;  1VQE A;  4QQB X;  2HDM A;  3V2T A;  4CJ2 C;  1QUQ A;  5EAY A;  3S17 B;  3EVQ A;  3C46 A;  3KBG A;  4K5W A;  4DNR B;  1UEA B;  1PV4 A;  1A3U A;  4DAP A;  4QMG A;  2K75 A;  4WOR A;  3HOV B;  3KOJ A;  2N78 A;  3MHB A;  4ZYS A;  4J8Q A;  2F0W A;  3I72 A;  3PQI A;  1TT2 A;  2R3Z A;  2V1C C;  3PMF A;  4HMI A;  5HGT A;  1B7Y B;  1RD9 D;  2WII B;  3D6C A;  3GTK H;  1TWG H;  2X6G A;  1LT6 D;  1MJC A;  1JT8 A;  4HN7 A;  2DJG C;  1G2T A;  3F2U A;  3JC6 6;  4ULL A;  1FD7 D;  3T1H Q;  1O7Y A;  3RN2 A;  1Y8O B;  1PYB A;  1X32 A;  2JXM B;  1YNN C;  1ASZ A;  4XQN A;  1PXU A;  4A3F G;  4IZ8 A;  1V8Q A;  3EIV A;  2B63 B;  4IFD G;  2A69 C;  3Q24 A;  5A2Q L;  5C3W A;  1TWC H;  3I4M H;  5J3B A;  3Q22 A;  3J7A 5;  1PDQ A;  5I6Y A;  2VXW A;  4KY5 A;  1SLJ A;  4YWL A;  1KRS A;  1E24 A;  1J9O A;  3LX0 A;  4EQ5 A;  3TDQ A;  3A5U A;  1XPO A;  3EA6 A;  3A8J E;  2D5D A;  1LT3 D;  1BCP C;  5JVG 3;  2EDG A;  4LF8 Q;  1UWV A;  2HHH Q;  4IPH A;  4C3J H;  1LM0 A;  4DR4 Q;  4F8M A;  1VMP A;  5J1Z A;  1VDZ A;  2VNU D;  2WAQ E;  1J8I A;  1F2M A;  1M1K C;  1SE3 A;  2WP8 J;  2M00 A;  2CWP A;  3R8B A;  1L2F A;  5FLM H;  5IOC A;  1DGS A;  1XXG A;  1Z9F A;  1RHP A;  2Z4H A;  2BA1 A;  4JG2 A;  2B2T C;  3OTO L;  5JJK A;  1LTI D;  1LTT D;  4B3M Q;  3GDE A;  4NXM Q;  1D8L A;  1W6K A;  1KLG D;  5IP7 H;  5C3E B;  1A2U A;  3I4N B;  2KBN A;  5C44 B;  2F0O A;  2XWB B;  2B29 A;  4DFA A;  1GHK A;  4F88 A;  1F2Y A;  3E0J A;  4GOP C;  2V4D A;  3FVQ A;  1B9M A;  1QE6 A;  3VA5 A;  2HIV A;  2Z0S A;  4A3D G;  4PZ6 A;  2A6H C;  2ZTD A;  1SYE A;  4R8I A;  2D0O A;  4JVZ A;  3EFX D;  1EOT A;  1JE4 A;  4ZLT F;  4K2K A;  1JOO A;  2M9V A;  4CDF C;  2QDL A;  1L1O B;  2B8G A;  2VQE L;  1CT1 D;  1XPR A;  4KD4 A;  4C3I B;  3HOV G;  2LFN A;  2E2D C;  1BCP D;  2UUA Q;  1QZG A;  4G7H C;  2KEC A;  1EIY B;  2IHF A;  1JOR A;  3PIO 3;  1QZH A;  4JC0 A;  1SAP A;  2H1E A;  3A8K E;  1KNE A;  1VQ4 A;  1G6P A;  1TS3 A;  1TWF B;  2KED A;  2MJ8 A;  3CCJ A;  5GAE C;  5IT9 L;  3KDF B;  1MKH A;  1QNK A;  3GTQ H;  1I6H B;  4IUQ A;  2N55 A;  4DUY L;  2A8V A;  1EL0 A;  3GTJ B;  3WOF A;  3UDX A;  1A3V A;  1UAP A;  3J81 i;  1ILP A;  4RG1 A;  3I90 A;  3H3V H;  5DM6 3;  3P20 A;  4P2C B;  4V0B A;  1WTQ A;  2B63 G;  1LYL A;  4A93 B;  1S5B D;  4A3E H;  2D0P A;  2PZT A;  5KYI A;  1LTL A;  4PZ7 A;  1PHJ A;  1LTG D;  3GV3 A;  2K5V A;  1DOK A;  1NR4 A;  1QVG A;  1VQJ A;  4ID6 A;  5BR8 L;  3WDN A;  1DON A;  1K0S A;  2RSN A;  3GTP B;  3URY A;  1HZB A;  3NBH B;  4GKJ L;  2P5Z X;  1EZ8 A;  2VB3 X;  2Q2I A;  3DM3 A;  4OON A;  2E2I B;  3S1R H;  4DAM A;  1K3R A;  4A3I B;  1GUG A;  2F0L A;  3HZX A;  4K5X A;  1D1K A;  2A6H D;  3T1H L;  4LF9 Q;  1ZYR C;  1HFG A;  2FXQ A;  1PH4 A;  3HOX B;  1C4Q A;  5LL6 S;  2A5H A;  3P1H A;  2BOS A;  5G3L F;  3FKI H;  1K73 C;  1PH9 A;  2XTI A;  2B8F A;  5E4X A;  4A3J B;  2HQL A;  5C0X G;  1GD7 A;  3J80 L;  1PTO D;  3KF6 A;  4HCE A;  2NWG A;  4FF1 A;  4R9W A;  5AJ3 Q;  1PRT C;  1E22 A;  3D4R A;  4JI8 Q;  3TS0 A;  3DM1 A;  3TRZ A;  1YHB A;  1AEX A;  2PCF B;  3ITP A;  4H0L C;  2RA4 A;  3QIA A;  4DV3 Q;  1EY8 A;  1H9S B;  1HQR D;  4IFD J;  1RDP D;  2VQF L;  3GTG B;  1PH5 A;  2E2H B;  4OWX B;  3BDC A;  2K05 A;  5C3E G;  4K14 A;  1I5F A;  3VR5 A;  4LF6 Q;  1UE7 A;  4EVO A;  3I4N G;  5C44 G;  4IUV A;  3K81 C;  1C7Y A;  4B3R Q;  3M4O H;  2Q2U A;  3S2D H;  2JP1 A;  4DPG A;  3DHQ A;  1HZC A;  1SYD A;  5TSS A;  1GO3 E;  3CXC A;  1A63 A;  2WV6 D;  3MC0 B;  3TZU A;  3CC4 A;  4K0K Q;  2AQ2 B;  3HFZ B;  3D3R A;  5FOB B;  3M7G A;  2B2U A;  5A2Q E;  1SSO A;  4H7B A;  4B3M L;  1B44 D;  1X3P A;  5IWA L;  4YCU A;  3K57 A;  1I94 Q;  1ENF A;  2ZXO A;  4N9T A;  4C3I G;  1NUC A;  1SE4 A;  1U5K A;  4OX9 L;  1F2L A;  4K8J A;  1CQF A;  3TME A;  4HIK A;  5KGU A;  3T53 B;  3KLS A;  3BZC A;  4JI0 L;  5CV7 A;  4P72 A;  1TWH H;  1EU3 A;  1WOC A;  3B6Y A;  4DV4 Q;  2JN4 A;  4X6A H;  1CKN B;  2B2W A;  1GHJ A;  3OYY A;  3GTL H;  2IJ0 A;  3E9H A;  5ELE A;  1TS4 A;  3W2D A;  1EIG A;  1V1P B;  4QUF A;  5M5W B;  3EJI A;  2E2J H;  1CQV A;  1DJR D;  1TWA B;  3NTK A;  2Q8I B;  1I3Q B;  4DR2 L;  1SJH D;  4ZUJ A;  3MFY A;  4GNX B;  2OTL A;  2F3V A;  4JYA Q;  1HQM C;  4A93 G;  4KHP L;  2CH4 A;  4JI6 Q;  1JR0 D;  2XRQ D;  3PO3 B;  1TVX A;  3MXN B;  5BN3 A;  1XMQ L;  1SDF A;  4P74 A;  5K5P A;  2CVR A;  4JI1 Q;  3CD6 A;  2G9D A;  4LUV A;  3PUW A;  4AH6 A;  2F4V L;  4QF4 A;  2C35 B;  4DAY B;  1EQQ A;  4A3I G;  1CSQ A;  1K8A C;  2KEN A;  2JA9 A;  2J4X A;  1BCP B;  4PMB A;  1R4Q B;  1SN8 A;  3HOX G;  3PF5 A;  1G2S A;  1EY6 A;  3NQT A;  4DN4 M;  4R4Q A;  4RFB A;  4PQX A;  4CKC A;  4A3M B;  1JOK A;  2BH2 A;  1GUS A;  4A3J G;  1QIL A;  4RGN A;  4C2M H;  2CWA A;  3K6O A;  5AFW A;  1MGS A;  3BDL A;  4IOA A;  1HRJ A;  1X56 A;  2SEB D;  2JA5 B;  4KN4 C;  1PFB A;  3KK7 A;  1HNX Q;  2Z1C A;  3ERS X;  1G6Z A;  1HFN A;  5CC4 A;  3I4O A;  1IBK Q;  2VZA A;  1VQB A;  3HS0 C;  1NMF A;  5D3D A;  3ULP A;  4LF9 L;  2F0E A;  4R8N A;  2BDN A;  1CZW A;  1FGB D;  1MBY A;  4FVM A;  2PQA B;  1XMO Q;  4B3S L;  4KKT A;  3N6R A;  5K36 H;  1IW7 C;  2K5W A;  5FJ8 G;  5C4X H;  1FR3 A;  4G4K A;  4QGU A;  2HDL A;  5BN5 A;  2XWJ B;  4G57 A;  1K9M C;  4JI8 L;  1VF5 C;  5IOD A;  2HCC A;  4JK1 C;  1KC8 C;  1PA6 A;  2K5Q A;  2PNH A;  1ET6 A;  3NEM A;  2NVX B;  3KJP A;  2NZH A;  2EY1 A;  4KD3 A;  5HY6 A;  4C56 C;  3C2P A;  4XQJ A;  4R4T A;  1G91 A;  5F2D A;  2NTS A;  1PTO B;  3UI2 A;  4LMQ D;  1LO5 D;  2QIL A;  3S15 H;  4A3C H;  4YWM A;  3O13 A;  4I7A A;  2AKW B;  4KJN A;  1JB3 A;  4N9P A;  5C0X H;  3U50 C;  3OSO A;  4DV1 Q;  4LK1 C;  2EIF A;  3AU7 A;  2UUB Q;  2FMM A;  3HOY B;  4UPA A;  1BR9 A;  4OO1 H;  2ZJR A;  2KHS A;  1DD2 A;  2YTY A;  2K4K A;  1B4O A;  3EQL C;  3OW7 A;  2AQ3 B;  2BCO A;  5C3E H;  5IT9 c;  1STE A;  1SYF A;  2UXB L;  3CCM A;  5IYD G;  4KJO A;  2QCP X;  2CKZ B;  3Q23 A;  1TY2 A;  4ZKC B;  3EBE A;  4YY3 L;  1GUW A;  3PO3 G;  1GUO A;  1CK1 A;  1EWH A;  1O7L A;  1SNC A;  4DV4 L;  1FJG Q;  3SVM A;  2NVQ B;  1I4H A;  3J7Y W;  1A62 A;  3ONA B;  1L0Y B;  4KN7 C;  1OXS C;  1FYC A;  1BUV T;  2B3G A;  3NHH A;  2WKC A;  4XIG S;  2IHE A;  4L6T B;  1D2B A;  5EPK A;  1HTL D;  3I73 A;  1AE2 A;  2QW7 A;  2L9H A;  4X62 Q;  2F0P A;  1JOQ A;  3S1N B;  4DR2 Q;  1PTO F;  2H5X A;  1BBW A;  1RKN A;  1CHQ D;  4RHS A;  4JBK A;  2JA8 H;  2VUM B;  4JYA L;  3AQQ A;  3PIP 3;  1EEI D;  4DXF A;  2O2L D;  1EIF A;  2JA7 H;  4A3M G;  4BY1 B;  4HSV A;  3I3C A;  3VDY A;  1PRT B;  3PO2 H;  2OTJ A;  2RQX A;  4DK1 A;  1VQO A;  4A3B B;  3BU2 A;  3L2P A;  3A74 A;  2BDO A;  2HUG A;  4V19 0;  2JA5 G;  3BVG A;  2RBM A;  1D6E C;  3HOZ H;  4FYD A;  2F3I A;  1T5E A;  1UNS A;  1X6O A;  2GN5 A;  2KJX A;  3J80 c;  1JJC B;  4JV5 L;  4Y7N B;  3PCO B;  3ZJY C;  3OMG A;  5IGF A;  1C48 A;  1RL2 A;  2TMP A;  3M4Y A;  1TQO A;  3X3N A;  3IKJ A;  1IHZ A;  4MTN A;  3NE5 B;  1GOZ A;  1FL0 A;  4RGM A;  2VQE Q;  2EJG C;  1I6V C;  2LKV A;  5COY A;  2JEA I;  4HSP A;  5HUR A;  4HIO A;  2K14 A;  3VA7 A;  3GTP H;  4DK3 C;  1TU2 B;  3S16 H;  4A3K B;  3KLR A;  2E2I H;  1KXL A;  1I4P A;  1HNX L;  3ERO A;  1PH8 A;  2Y0S B;  2DUD A;  4YHH L;  3STB D;  1O78 A;  1G29 1;  1B1Z A;  3MEH A;  1H9J A;  2LXK A;  1S5F D;  1J5E Q;  4DUY Q;  4KY7 A;  1ICW A;  3FPP A;  5FO7 B;  1W3S A;  3GP7 A;  2PW7 A;  1E0B A;  4EQN A;  4YWK A;  2NVT H;  3CW2 C;  2E5L Q;  1X3F A;  2WB1 B;  2OQK A;  2R7Z B;  3J7A F;  1W6J A;  3HOY G;  5CMD A;  2R93 H;  2VL6 A;  1Q3L A;  3CKI B;  5BR8 Q;  3Q8D A;  4R1J A;  2LS0 1;  2YU9 H;  4GKJ Q;  4XT1 B;  3RZD H;  1NSN S;  1RF2 D;  1Y1V B;  1H9R A;  4HJA A;  4LWC A;  3NWT A;  1F2Z A;  5FLX L;  1SR3 A;  1Y1W B;  3CC2 A;  3ERQ A;  2PQE A;  2PZW A;  1DXM A;  1YZ6 A;  2MGS A;  3AMU A;  1KDB A;  3CQZ H;  4EQP A;  2DJF C;  3JAM c;  4R4C A;  2OQ0 A;  3Q6S A;  3SXH A;  5M3M H;  4DV1 L;  3ULL A;  1SEB D;  3GTM B;  2EYM A;  2F0Q A;  2K04 A;  1GUN A;  2UUB L;  3MA2 B;  1X54 A;  1WYD A;  3CMA A;  3M7N A;  3MXP A;  1I50 B;  3PUX A;  2Z6K A;  2XGT A;  3GD7 A;  4QB4 A;  1N32 L;  1UE5 A;  3D4D A;  1EIH A;  2KCM A;  2VQF Q;  1HHV A;  1E2W A;  1QNU A;  2VUM G;  1IKL A;  1SRO A;  4DV5 L;  1SNP A;  4L5S A;  4PNY A;  4K5V A;  3H0G B;  1V9P A;  3BZK A;  4UP8 A;  3HG9 A;  4BY1 G;  1WCM B;  2J7Z A;  2QGQ A;  3R93 A;  4BBS B;  4ZQ3 A;  4A3B G;  3HKS A;  1Y69 U;  2AHO B;  2NYZ D;  5DNF A;  1FJG L;  1BO0 A;  2F0J A;  1YVC A;  1L1O A;  1F77 A;  3M3Y B;  1ZKO A;  1MSG A;  3QJY A;  2JA6 H;  2OEO A;  4X65 L;  5IYB H;  3RUZ A;  4X62 L;  1SMY C;  4TRD A;  5ISR A;  2B2Y A;  5JJI A;  2ASB A;  1B53 A;  2JE6 I;  5I2Y A;  4AYB B;  1R9T H;  3NUC A;  1TXY A;  2F0I A;  3KDF A;  5IWA Q;  1PYS B;  1EWI A;  1MJE A;  3NTI A;  3S14 H;  1T9H A;  4KY6 A;  3A5Z B;  4GN4 B;  4OX9 Q;  4OGQ C;  1LTA D;  3PO3 H;  1YNN D;  1GKH A;  1SE2 A;  4XYQ A;  3R3O A;  3OPO A;  5CYU A;  3FP9 A;  4DUZ L;  5M3F B;  4JI0 Q;  2ICE C;  4BBR B;  2A69 D;  2PW5 A;  1FVI A;  4A76 A;  3WOE A;  1DCZ A;  4A3K G;  2LY7 A;  3E3X A;  2L55 A;  3UDF A;  2L1B A;  3H6M A;  4C1N K;  4MTK A;  5GAG C;  2Y0S G;  1S4Z A;  2A6E C;  4OXP A;  3ND9 A;  3OWF A;  1YJN A;  4IUU A;  1LTR D;  4BA2 I;  4QUC A;  1OO9 B;  4F87 A;  3HP3 A;  3K80 C;  3NBH A;  5C4J B;  2Z4I A;  5I4D A;  4RAU C;  3L9A X; 
#chains in the Genus database with same CATH homology
 1WI5 A;  1BVS A;  4B3M L;  4B3T L;  3W1B A;  3CAM A;  5C0X J;  5IWA L;  1HNZ L;  4PMW A;  1N36 L;  4YCU A;  5GQO A;  1I94 Q;  3LGJ A;  4ME3 A;  1YEZ A;  2NN6 I;  1W2B A;  3W1G A;  1VQK A;  1U5K A;  4LUO A;  3H3V I;  4KHP Q;  4OX9 L;  4DR6 Q;  1E3P A;  3K0X A;  1VQP A;  2WB1 G;  3PUY A;  2LSS A;  4LF6 L;  1VQ6 A;  4HIK A;  4DR5 Q;  2LXJ A;  2R7Z G;  4NPS A;  3G6E A;  4LFA Q;  3BZC A;  4JI0 L;  3GTG H;  1XMQ Q;  1UEB A;  1TWH H;  2Y0S E;  4P72 A;  2K52 A;  1WOC A;  4APV A;  3B6Y A;  4B3R L;  2E2H H;  4DV4 Q;  2UXC Q;  3J81 c;  1EFW A;  4X6A H;  2F4V Q;  2A19 A;  1VQ9 A;  1CKN B;  4BXX G;  1JJG A;  3OYY A;  3GTL H;  3KFU A;  3E9H A;  3CCE A;  3FKI G;  3GO5 A;  1Y1V G;  3PUZ A;  1VQL A;  2ZM6 Q;  1J5E L;  2RCN A;  5ELO A;  1XNR L;  4K0K L;  2E2J H;  1IL2 A;  5FJ8 H;  2ES2 A;  4BBR H;  2JA6 G;  1Y1W G;  4TQU S;  5FLM G;  2A1A A;  4QY7 A;  4GKK Q;  5IYB G;  5LMN L;  1Q1B A;  4JI7 L;  4L5R C;  4LFC Q;  5E7N A;  4BY7 H;  1K83 H;  1O7I A;  2RHQ B;  5JEA G;  1PH2 A;  4POG A;  3AEV A;  4DR2 L;  1EYG A;  4LW1 A;  4YCW A;  4WJ3 M;  2YV5 A;  2GVA A;  4GNX B;  2OTL A;  2WB1 E;  4JYA Q;  1JJ2 A;  4JI5 L;  1K0R A;  1NE3 A;  4J15 A;  1I94 L;  5GRO A;  2E5L L;  4A93 G;  1XNQ Q;  4KHP L;  1U0L A;  3TRE A;  5GAH C;  2R92 H;  1EUJ A;  5GAD C;  5C4J H;  5IYC H;  4WJ4 A;  4JI6 Q;  2IY5 B;  4DR5 L;  4X66 Q;  4KLK A;  3PIP A;  2KCT A;  4JOI A;  3MXN B;  4LFA L;  4JI4 L;  1XMQ L;  2CQO A;  2GVB A;  4P74 A;  4IPC A;  4JI1 Q;  3CD6 A;  1KHI A;  4LUZ A;  1A0I A;  3PUW A;  4LUV A;  4AH6 A;  2F4V L;  4GNX C;  2UXC L;  2EQS A;  3RLN A;  3I7F A;  5ELN A;  4DR3 Q;  2C35 B;  3AFP A;  3U58 A;  3F8T A;  5IP9 H;  3L7Z C;  4DAY B;  1EQQ A;  4A3I G;  1CSQ A;  1K8A C;  3STB C;  2KEN A;  3H0G G;  4BA1 I;  2JK8 A;  2VY3 A;  1KL9 A;  2JA9 A;  4NXN Q;  1WCM G;  1YIJ A;  1HH2 P;  1PH7 A;  4B3S Q;  1B8A A;  1XJV A;  2OWO A;  3RN5 A;  4BBS G;  4GKK L;  2R6G A;  1SN8 A;  3HOX G;  4LNQ A;  4P73 A;  4DV0 Q;  1SFO H;  2IT1 A;  3OTO Q;  1X65 A;  2CCZ A;  3PF5 A;  3DLL A;  1PFS A;  1QUQ B;  1E1T A;  1YNX A;  4R4Q A;  2I5M X;  1Z47 A;  3KJO A;  1KRT A;  1NMG A;  1E7Z A;  5M5W H;  2BH2 A;  3E9I A;  4HJ5 A;  4A3J G;  1XNQ L;  4A3G H;  1CKO A;  4QIW E;  4C2M H;  2CWA A;  4L5Q A;  4JI2 Q;  1TWA H;  2R7D A;  4JI6 L;  1C0A A;  1I3Q H;  3IRB A;  4IPG A;  4IOA A;  4GLA C;  1ASY A;  1CKN A;  1X56 A;  4JI1 L;  3PV0 A;  3M9B A;  1P8L A;  1VQM A;  5IYD H;  4UP7 A;  4AYB G;  1HNX Q;  1N9W A;  3ERS X;  3F2D A;  4IOC A;  4QL5 A;  1GM5 A;  2AWO A;  4DR3 L;  3I4O A;  4MNO A;  4HID A;  1IBK Q;  2VZA A;  1VQB A;  4H02 A;  3G48 A;  1UE6 A;  1NMF A;  3ULP A;  2E8G A;  4LF9 L;  4LF5 L;  1HNW Q;  1D7Q A;  3S1Q H;  4NXN L;  4YCV A;  3U4Z A;  2PQA B;  3F1Z A;  1XMO Q;  4B3S L;  4A3F H;  4LFB Q;  4IJH A;  2ZJP A;  2JQO A;  2NVQ H;  1VQA A;  4DV0 L;  4GNX A;  5M3F G;  2JEB I;  4X64 Q;  5FJ8 G;  4BBR G;  5C4X H;  3HKZ E;  3PGZ A;  2NVY H;  4XTC S;  4BY7 G;  4QGU A;  3J80 i;  1Q82 C;  2CFM A;  1IBL L;  5M5Y H;  3CCV A;  3K7A H;  2NN6 G;  3ULJ A;  4C3H H;  4FDB A;  1K9M C;  1N34 L;  1JMC A;  5M5X H;  4JI2 L;  4JI8 L;  4P71 A;  1YJW A;  1Q7Y C;  2KHI A;  2HT1 A;  1EOV A;  4LF7 Q;  1KC8 C;  4R4O A;  3G4S A;  3T1Y Q;  2I5L X;  1PA6 A;  2PNH A;  1VS0 A;  3NEM A;  2R92 G;  1S40 A;  1XTD A;  3UDG A;  4A3M H;  3KJP A;  3TS2 A;  2MFI A;  2F52 A;  2HIX A;  1IZ6 A;  2NZH A;  4IJL A;  3OW2 A;  2EXD A;  5HY6 A;  3F2C A;  1OTC A;  2UXB Q;  4IPD A;  3PIO A;  5DLQ E;  1IBK L;  4DV2 Q;  1H95 A;  2AWN A;  2ZTE A;  4DK6 C;  1VQH A;  4R4T A;  1HNW L;  3WWV A;  1OXV A;  1PVO A;  3SGI A;  3UDI A;  1XMO L;  5IP9 G;  2JA5 H;  1VQN A;  1VQE A;  4YWM A;  3S15 H;  4YY3 Q;  4A3C H;  4QQB X;  3NEN A;  2AKW B;  1QUQ A;  5EAY A;  5LMU Q;  1PV4 A;  3U50 C;  1VCI A;  2K75 A;  3KOJ A;  3L0O A;  4DV1 Q;  2N78 A;  2I0Q A;  4A3L G;  3UE1 A;  1V43 A;  3S2H H;  2EIF A;  2UUB Q;  3KYH C;  4UPA A;  1L0W A;  3MEF A;  4A3G G;  2ZJR A;  2V1C C;  1CSP A;  3PSI A;  4LF7 L;  4AQY L;  1B7Y B;  2YTY A;  2MO0 A;  1WFQ A;  2K4K A;  3D31 A;  2ATW A;  1TWG H;  4O0A A;  3GTK H;  3PF4 A;  1YHA A;  5C3E H;  5IT9 c;  4RMF A;  3RLO A;  2IX1 A;  4A4I A;  3HOU H;  4HIM A;  2UXB L;  3S1M H;  1MJC A;  3CCM A;  1JT8 A;  3AFQ A;  3KLW A;  1X3G A;  5IYD G;  5FLX c;  4AIM A;  4DV2 L;  2ID0 A;  2CKZ B;  4DR6 L;  2PQA A;  3JC6 6;  1VQG A;  1X9N A;  1Q12 A;  2N49 A;  3T1H Q;  3RN2 A;  1IXR A;  1N33 Q;  2NVX H;  1OXU A;  3EBE A;  1PYB A;  4YY3 L;  1ASZ A;  3PO3 G;  2BA0 A;  5LMU L;  1E1O A;  2Q2T A;  4DV4 L;  1FJG Q;  3E0E A;  4OWT B;  4A3F G;  1J6Q A;  1HZA A;  1A62 A;  3EIV A;  3J81 j;  4A3D H;  5K36 G;  3F2B A;  1OXS C;  3EN2 A;  4IFD G;  1B70 B;  2B3G A;  3HOW G;  4JV5 Q;  5C4X G;  4XIG S;  3W5O A;  2IHE A;  2YTV A;  1BKB A;  2KHJ A;  3A0J A;  2ZM6 L;  2I5H A;  2L15 A;  1TWC H;  1YHQ A;  1AE2 A;  3S17 H;  1UE1 A;  3I4M H;  2ALY B;  4X62 Q;  5J3B A;  4LFC L;  3RLF A;  2BH8 A;  4DR2 Q;  3J7A 5;  3HOV H;  2H5X A;  1SMX A;  1BBW A;  1NTG A;  4UP9 A;  3JAM i;  4JBJ A;  4JBK A;  2JA8 H;  4YWL A;  1SLJ A;  4JI3 Q;  3AQQ A;  4JYA L;  4IFD I;  4L5T A;  1KRS A;  3M4P A;  3J7Z C;  1E24 A;  1EIF A;  2JA7 H;  3HOY H;  4A3M G;  2N8N A;  3HKZ G;  3I56 A;  4EQ5 A;  2R7Z H;  3A5U A;  1HR0 W;  1XPO A;  3CPW A;  3VDY A;  2QEX A;  3PO2 H;  2OTJ A;  1MIU A;  1VQO A;  1N33 L;  5JEA J;  4X66 L;  3BU2 A;  4LF8 Q;  3L2P A;  3A74 A;  1UWV A;  3TQY A;  1S72 A;  5IE8 A;  4IPH A;  2HHH Q;  4BXX H;  4C3J H;  3RR5 A;  4A75 A;  1LM0 A;  1QVC A;  4DR4 Q;  1BBU A;  2JA5 G;  4A3C G;  1S3O A;  1LUZ A;  2VNU D;  2WAQ E;  3HOZ H;  4YHH Q;  1M1K C;  2WP8 J;  2F3I A;  1X6O A;  2D62 A;  2GN5 A;  2CWP A;  3J80 c;  1L2F A;  2MQH A;  1Q86 C;  1JJC B;  4JV5 L;  5FLM H;  2UU9 Q;  1DGS A;  3PUV A;  3G71 A;  3PCO B;  3CC7 A;  3H15 A;  4HJ8 A;  1Z9F A;  3ZJY C;  4NB3 A;  2BA1 A;  1RL2 A;  4JG2 A;  2B63 H;  3RNU A;  3OTO L;  4GOP B;  4DR7 Q;  5JJK A;  1OXT A;  4DV6 Q;  1XPU A;  4MTN A;  4OO1 G;  4B3M Q;  3D0F A;  3GDE A;  4JI3 L;  4NXM Q;  1D8L A;  1FL0 A;  1HNZ Q;  2VQE Q;  5C0X I;  2K5N A;  5IP7 H;  2ZTC A;  2JEA I;  2UUC Q;  4KI0 A;  2R7F A;  3CCL A;  1I50 H;  3S1N H;  4HIO A;  3CCS A;  4HJ7 A;  2K14 A;  2KBN A;  4LF8 L;  3GTP H;  4DK3 C;  2HHH L;  3U4V A;  2B29 A;  2VUM H;  3S16 H;  5IYC G;  4GOP C;  4DR4 L;  2E2I H;  4OO1 I;  1KXL A;  4KHZ A;  1SE8 A;  1HNX L;  4BY1 H;  1PH8 A;  2DUD A;  4GLV B;  1X55 A;  3STB D;  4YHH L;  4IO9 A;  5JJL A;  1G29 1;  1Q8K A;  2N3S A;  4A3B H;  3K8A A;  1PH1 A;  2HIV A;  2Z0S A;  2LXK A;  4PZ6 A;  4LF4 Q;  4A3D G;  1HR0 Q;  1J5E Q;  1FGU A;  1XNR Q;  4DUY Q;  1OXX K;  3CF5 A;  1W3S A;  4LFB L;  4DKA C;  2ZTD A;  2D0O A;  5IY0 A;  2PI2 E;  1V1Q A;  2Z6K C;  3M4Q A;  4X64 L;  3M3Y H;  4DR7 L;  3I4M G;  1AE3 A;  4NXM L;  4YWK A;  4Y7N H;  1L1O B;  2NZO A;  5H1S E;  2VQE L;  1XPR A;  4JI5 Q;  3CW2 C;  2NVT H;  4EX5 A;  3HOV G;  2E5L Q;  3NEL A;  4O2D A;  1X3F A;  2UUC L;  2JA8 G;  2OQK A;  3KF8 B;  3KF6 B;  2UUA Q;  1QZG A;  1EIY B;  4TVA B;  2IHF A;  2JA7 G;  2AMC B;  3HOY G;  2VL6 A;  2R93 H;  1N32 Q;  3I2Z A;  3T1Y L;  1QZH A;  5BR8 Q;  3Q8D A;  4JI4 Q;  3PO2 G;  4JC0 A;  1P16 A;  4R1J A;  4GLX A;  1VQ4 A;  2YU9 H;  1YJ9 A;  4PZ8 A;  4GKJ Q;  1G6P A;  1GVP A;  3CCJ A;  5GAE C;  3RZD H;  1L1O C;  1HZ9 A;  3KDF B;  1MKH A;  4DV5 Q;  4HJA A;  4LWC A;  3I4N H;  3GTQ H;  5C44 H;  4LF4 L;  3HOZ G;  1SR3 A;  2RF4 A;  1K8G A;  1HR0 L;  3S24 A;  4DUY L;  2A8V A;  5M3F H;  3CC2 A;  4POF A;  1A8V A;  4A3K H;  1YIT A;  4GOP A;  1NJI C;  3UDX A;  3CPF A;  1VQI A;  2UXD Q;  1YZ6 A;  3CQZ H;  2PI2 A;  3J81 i;  3JAM c;  1HJP A;  3AYH B;  4R4C A;  2OQ0 A;  4RG1 A;  1KAW A;  5M3M H;  3H3V H;  4DV1 L;  2B63 G;  1LYL A;  3ULL A;  1QVF A;  4GN3 B;  3I55 A;  4DR1 Q;  3BJU A;  4A3E H;  3CCQ A;  4OWW B;  4X65 Q;  1SRU A;  1VQD A;  2UUB L;  2D0P A;  2WAQ G;  1LTL A;  1X54 A;  1EQR A;  1Q46 A;  4PZ7 A;  1WYD A;  3CMA A;  2UUA L;  2JJQ A;  1PHJ A;  3M7N A;  1Q81 C;  2K5V A;  2K5H A;  5IP7 G;  4Y52 H;  2Z6K A;  2Q2H A;  3GD7 A;  2XGT A;  3PUX A;  3TEH B;  1KIX A;  1JE5 A;  1N32 L;  1UE5 A;  1VQJ A;  5BR8 L;  2YYZ A;  4C3I H;  1HZB A;  2KCM A;  3NBH B;  1NY4 A;  2VQF Q;  4GKJ L;  4DNI A;  2PMZ E;  2Q2I A;  3DM3 A;  4OON A;  2VUM G;  1CKM A;  2MO1 A;  4R4I A;  1SRO A;  1NBW A;  3S1R H;  4DAM A;  1K3R A;  4DV5 L;  1JB7 A;  4L5S A;  1Q1E A;  1V9P A;  2OCE A;  3BZK A;  4UP8 A;  1M90 C;  4BY1 G;  4MZ9 A;  3T1H L;  4LF9 Q;  4LF5 Q;  2IX0 A;  2QGQ A;  1IYJ B;  2FXQ A;  1VQC A;  5LMN W;  1PH4 A;  3GTO H;  3HKS A;  3RZO H;  4A3B G;  2AHO B;  4DUZ Q;  1TWF H;  1FJG L;  2UXD L;  4HJ9 A;  1YVC A;  4A3L H;  2YTX A;  3FKI H;  1L1O A;  1Y1V H;  1K73 C;  1RIP A;  1YBY A;  2XTI A;  1PH9 A;  4DV7 Q;  1I6H H;  1IBL Q;  2HQL A;  3CP0 A;  4DR1 L;  5C0X G;  1GD7 A;  2JA6 H;  1Y1W H;  3KF6 A;  1IBM Q;  5HGQ A;  1AH9 A;  3GTJ H;  4X65 L;  5IYB H;  5AJ3 Q;  2QA4 A;  2K50 A;  4GS3 A;  1N34 Q;  2VW9 A;  4QJF A;  1E22 A;  4JI8 Q;  3TS0 A;  3TRZ A;  4X62 L;  1PH3 A;  2ZJQ A;  1YHB A;  3CCU A;  5JJI A;  2WFW A;  4DV3 Q;  2ASB A;  2JE6 I;  1R9T H;  1N8R C;  4A93 H;  2MNA A;  3GTM H;  1TXY A;  4IFD J;  4B3T Q;  2R93 G;  2VQF L;  3KDF A;  1C9O A;  5IWA Q;  1PYS B;  1EWI A;  1PH5 A;  1N36 Q;  1MJE A;  3K7U C;  1YI2 A;  1VQ7 A;  3S14 H;  1T9H A;  4P75 A;  4OWX B;  3UE0 A;  3A5Z B;  4PG3 A;  3FHW A;  4GN4 B;  5C3E G;  4OX9 Q;  4UY8 C;  3HOU G;  1I5F A;  3PO3 H;  1GKH A;  3ER0 A;  4ALP A;  1UE7 A;  4LF6 Q;  1G51 A;  2DGY A;  3I4N G;  4DUZ L;  3FP9 A;  4GN5 A;  5C44 G;  1KQS A;  2VS1 A;  4JI0 Q;  3K81 C;  1C7Y A;  1VQF A;  3CCR A;  3CME A;  2Q2U A;  3M4O H;  3S2D H;  4B3R Q;  4A76 A;  1VQ5 A;  1FVI A;  4A3K G;  4A3I H;  3HOW H;  3H0G H;  1Y14 B;  4DPG A;  4DV7 L;  3UDF A;  4JBW A;  5GAG C;  1QVG A;  1PH6 A;  1CUK A;  1HZC A;  2Y0S G;  1WCM H;  4OXP A;  1X3E A;  1YJN A;  1IBM L;  1GO3 E;  3CXC A;  1A63 A;  2UU9 L;  4BBS H;  1VQ8 A;  3ICE A;  4BA2 I;  2RHS B;  5M3M G;  5AJ3 L;  3HOX H;  3CC4 A;  4K0K Q;  3HFZ B;  4JCV E;  4JBM A;  4AYB E;  3M85 A;  4A3E G;  1KD1 C;  5LMN Q;  4JI7 Q;  3K80 C;  1WJJ A;  4DV3 L;  4AQY Q;  4DV6 L;  4JOI C;  4A3J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...