4LF9Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf9Q00
1Q1EA 3EIVA 3RZOH 4XIGS 3RLNA 3ZJYC 2L15A 2ZTCA 1GM5A 4JI4L 2CWAA 1EOVA 1A8VA 3CW2C 2D0OA 1J6QA 1VQIA 4APVA 1TWAH 2HT1A 1V1QA 1YHBA 4JI0Q 1N8RC 1IZ6A 4A3CH 2PMZE 1RIPA 3M4QA 1IBML 3HFZB 2UUCQ 2Q2TA 4QIWE 3KFUA 4JI3L 4DV1Q 2ASBA 1CSQA 2Z0SA 2C35B 4P73A 4AQYQ 3B6YA 5M3MH 2OQ0A 1YI2A 4OX9Q 2OWOA 3I7FA 4DR3Q 2JE6I 4A4IA 3UDIA 1CKOA 4FDBA 5HGQA 3I4NG 1X3FA 4DV5L 2VQEL 3K80C 4YCVA 3STBD 1N36Q 1IBLL 1FJGQ 4GKKQ 4J15A 1I94L 4L5RC 1UE1A 1PFSA 4DAMA 3CPFA 3D0FA 4C3JH 1OXXK 1N34Q 3AFPA 3KLWA 2N49A 4DR5Q 1X6OA 4PMWA 2YV5A 4DV0Q 1G291 3GD7A 2NVQH 4PZ6A 4KLKA 2VNUD 4UP7A 3U4VA 4WJ4A 1FL0A 1AE2A 2MQHA 3KF8B 1HNWQ 2ZTEA 4A3LG 5JJLA 5M5YH 3CCJA 3KOJA 4JOIA 4MZ9A 4A3IG 2F4VL 4HIOA 3GTKH 2LXKA 3CMAA 1CKNB 1EWIA 2JA9A 3H3VI 3UDXA 1KRSA 5FLMG 3I4NH 4QQBX 5IWAL 1AH9A 3M85A 1XMQL 4KHPL 2XGTA 3G4SA 3PO3G 5IYBG 4GN3B 3I4OA 2MFIA 5AJ3L 1L1OB 2JA8G 1NJIC 1OTCA 2DUDA 4DR4Q 2YTYA 4B3ML 3GTOH 1HNZQ 4X66Q 2VS1A 1QUQA 5GAGC 1RL2A 1CKMA 5M5WH 2EIFA 5C44G 3AFQA 3KDFA 4JG2A 1E1OA 4QY7A 1NMFA 2A19A 5JEAG 3BZKA 2K50A 4A3LH 3PUZA 1V43A 4B3RL 2KCTA 1X9NA 2OTJA 4TQUS 2UXBQ 4A3IH 4DV6Q 1A62A 4NXNQ 4DKAC 5IYCG 3ER0A 1N33L 4JV5Q 4X62L 1ASYA 1VQ8A 1WYDA 5J3BA 4X64Q 1Y1VG 5FLMH 1XMOQ 4OWXB 4X65L 1BBUA 3S1QH 2UXDQ 1V9PA 4AYBE 1YJWA 3RLOA 4LF9Q 1VQGA 1WOCA 1HNXQ 3HOWG 1B70B 1KIXA 3PO3H 5IYBH 1HR0L 4B3TL 1OXTA 1VQOA 1R9TH 4DUZQ 2Q2HA 1PA6A 4JI2L 1M90C 4NXMQ 3HOUH 4GLAC 2JEBI 4DNIA 3PIPA 2R93G 1YHQA 2Y0SG 4IPCA 1AE3A 1VCIA 5C44H 1W2BA 2XTIA 3AYHB 1YJ9A 4LF6L 1SFOH 2WP8J 2E5LQ 1PH4A 3J7ZC 2VUMG 2UUAL 2PNHA 3RLFA 4DR2L 2KHJA 1XNQL 3NENA 2ZM6Q 5IYCH 1GVPA 1U5KA 3UDFA 5IE8A 4DV7L 4DR1Q 4YHHQ 4JBMA 1Y1VH 4AIMA 1TXYA 1QVCA 3NBHB 3PIOA 4IOCA 3JAMc 1VQPA 1YIJA 4K0KL 1D8LA 4IPGA 2KHIA 4KI0A 3EBEA 3L0OA 4LUOA 5GAHC 1M1KC 4LF5L 3HOWH 2RHSB 4LUZA 2IHEA 2UU9L 1T9HA 3CF5A 3KF6A 2WB1E 3CXCA 4DV3Q 1K83H 1G51A 1PYSB 3HKZE 3CAMA 2R93H 1VQLA 2QA4A 3PSIA 2JA6G 4TVAB 2F3IA 4LFCL 1PH9A 1K8AC 4LFAL 2GVAA 4IFDJ 1WJJA 1E3PA 2R7FA 3G48A 3CQZH 2VUMH 5ELOA 3T1HL 3GTLH 1K0RA 1VS0A 1N32Q 5GADC 2KCMA 3BJUA 1HZ9A 4GN4B 3ULJA 4DUYQ 1OXSC 4BBSG 2A1AA 3PUWA 2LXJA 3E9HA 2WAQE 4LW1A 2VQFL 4BY1G 2OTLA 1HZBA 4JYAQ 2UXCL 2Z6KC 2HHHL 3U4ZA 2JQOA 1X54A 3TRZA 1MJCA 2VY3A 1YHAA 1LYLA 2PI2E 5C0XI 3CCSA 4GNXC 5GAEC 3RNUA 2K4KA 2JA5G 2JA6H 2MO0A 2E8GA 1YEZA 1NE3A 3DM3A 4JI4Q 3UE0A 4YY3Q 3CP0A 2RF4A 4DV2Q 2ATWA 4YCUA 3RR5A 2VL6A 4KHZA 1P16A 2CKZB 2N3SA 4BBSH 2CCZA 3U58A 4XTCS 3U50C 2HQLA 2UUCL 1I50H 2ZJRA 1S3OA 3J80c 4DV1L 3JAMi 2MNAA 1B7YB 3G6EA 4BY1H 4JI3Q 1PVOA 4B3TQ 1K8GA 4AQYL 3CMEA 1X3EA 1L0WA 4DAYB 3CCEA 4DV4Q 3RN5A 3S16H 4DR3L 1PH6A 4JI5Q 4JBWA 2AMCB 2JA5H 3FP9A 3GDEA 3S1NH 3SGIA 1N36L 4GKKL 4DV5Q 4A75A 2VQEQ 1FJGL 4GS3A 3GTJH 3OYYA 1VQNA 1WI5A 3MXNB 1JJ2A 1Z47A 4P75A 4DR7Q 1N34L 1D7QA 1SROA 1SN8A 1A63A 1TWCH 2B29A 4LWCA 1VQJA 2K52A 1I6HH 5IYDG 3F2DA 1J5EQ 2N8NA 3F2BA 1HJPA 3W1BA 4DK3C 1VQCA 2F4VQ 1CKNA 4DR6Q 3W5OA 4JI1Q 5JEAJ 1BKBA 2EQSA 3T1YL 4EQ5A 1XPOA 4Y7NH 4IJLA 3S14H 4A3JG 5IWAQ 1E7ZA 2R7DA 1EIFA 4KHPQ 5LMNW 2NZOA 5LMNQ 3J81c 1OXUA 2D0PA 1XNRL 3TS0A 4HJ5A 1L1OA 2JEAI 4BBRG 4MTNA 4GNXB 1TWFH 4DR4L 3CD6A 3I55A 2Q2UA 3PUVA 1HNZL 4X66L 3S1RH 2H5XA 4C3HH 3S2DH 2Z6KA 3G71A 5IYDH 1VQEA 3H3VH 4A3FG 2PQAB 1JB7A 3TQYA 1TWHH 2Q2IA 3I2ZA 3PV0A 3CCUA 1E22A 3S15H 1LTLA 2UXBL 4B3RQ 4UPAA 4DV6L 4LF8Q 4NXNL 2DGYA 4NXML 4JV5L 3S17H 1N33Q 2I5LX 4GOPC 4A3EG 4X62Q 2JA8H 1IBKQ 5IT9c 3GTMH 3GO5A 3JC66 1K73C 3TS2A 2UXDL 1KXLA 1Q86C 1MIUA 1FVIA 4A3JH 1S72A 3ULPA 3W1GA 4L5SA 4MNOA 1Q46A 4PZ8A 3H15A 3F2CA 4IPDA 1LUZA 4DUZL 1SMXA 1HR0W 3PF5A 1HR0Q 3K8AA 3A5ZB 4BBRH 3OTOL 4JI2Q 3DLLA 1SLJA 2NVXH 1UWVA 1UEBA 2CWPA 1VQHA 4UY8C 3PF4A 2UUBQ 3GTPH 4QJFA 5K36G 1XPUA 1WCMG 2YYZA 4JI7Q 2AHOB 3WWVA 1PH7A 2RHQB 4A3FH 5LMUL 1JMCA 1HZCA 1A0IA 4LF6Q 4DPGA 5C4JH 5BR8Q 2PI2A 4O0AA 4JI8Q 1K9MC 4A3DG 2I0QA 1YVCA 4LF7Q 4B3SL 1GKHA 3H0GG 4GN5A 5M5XH 1PV4A 4LF4L 1XNQQ 4RG1A 3K7UC 5IP7G 4YHHL 4HJ9A 1MKHA 4A3EH 4DV7Q 5E7NA 5IY0A 2QEXA 3CCQA 4YWLA 2VZAA 4K0KQ 4OO1I 2D62A 1LM0A 3S2HH 1Z9FA 1P8LA 1E24A 3M3YH 1YBYA 5GROA 1HZAA 4DV3L 2NZHA 4A3KG 1IYJB 1QZGA 4GKJQ 1X3GA 1B8AA 2GN5A 2ID0A 3K7AH 1PH5A 2WFWA 4IO9A 4GLVB 4LFBL 1WCMH 1Q12A 4LFAQ 2BH2A 3NELA 1TWGH 4NB3A 3RZDH 1PH2A 2IT1A 4OWTB 3L2PA 3M4OH 5JJIA 3BZCA 4A3DH 5C0XJ 4JI6L 1IXRA 2B3GA 3M9BA 1NTGA 2IHFA 3H0GH 4DK6C 5IP7H 4DUYL 4ME3A 4A3GG 2WAQG 2MO1A 2NN6I 5C0XG 3GTQH 2I5MX 3ERSX 5FLXc 2NN6G 2VQFQ 2BH8A 3J81j 1VQKA 4A3KH 4JYAL 1L2FA 5ELNA 1SR3A 4GOPB 2UXCQ 3F1ZA 4HIKA 4LF7L 2OCEA 4WJ3M 1YJNA 2AWOA 3LGJA 1PH8A 1DGSA 1NMGA 5FJ8G 2E2JH 3PO2G 2K14A 4JI0L 2KBNA 1BVSA 3VDYA 4GOPA 1IBMQ 3HOYG 1X56A 1YZ6A 2HIXA 4DV2L 4YY3L 1VQMA 2I5HA 1YNXA 4R1JA 4IPHA 1VQBA 3STBC 1EYGA 3ICEA 3A74A 2R6GA 4X6AH 4OX9L 1EFWA 4A3GH 3UE1A 1OXVA 2N78A 3A0JA 3EN2A 1O7IA 3L7ZC 3CC4A 3CC7A 4GLXA 3S24A 4L5TA 4POGA 1BBWA 3K81C 2F52A 2GVBA 3M4PA 4H02A 1IBLQ 5EAYA 4Y52H 4DV4L 2B63G 4JI5L 1XTDA 4OXPA 1CUKA 2FXQA 3E9IA 3K0XA 5FJ8H 4DR5L 3HOZG 4A3BG 4P74A 2IY5B 4PZ7A 3MEFA 3PO2H 1W3SA 4DV0L 2YU9H 4P72A 3HOYH 1QZHA 4PG3A 4DR7L 1KQSA 4IJHA 2ZJQA 1HNWL 3IRBA 2IX0A 1IL2A 4C2MH 1VQ5A 3BU2A 3S1MH 1MJEA 2OQKA 1VQ9A 1QVFA 2E2HH 1X65A 1FGUA 3TEHB 2E2IH 1KL9A 1J5EL 4R4TA 1XMQQ 4LUVA 4BY7G 3M7NA 1JT8A 2B63H 4R4OA 4DR6L 4A3MG 4JI1L 4BA1I 3PUYA 3HOZH 1Q82C 2R92G 1I3QH 5AJ3Q 1PHJA 4A3BH 4HIDA 4BA2I 3T1YQ 1EUJA 1JJGA 4B3MQ 5H1SE 4JBKA 1QUQB 4OONA 3UDGA 5LMNL 1Y14B 2YTXA 4LNQA 1JE5A 1XNRQ 3KDFB 4GNXA 3PGZA 1U0LA 3J80i 5IP9G 5M3FG 2BA1A 2NVYH 2ZJPA 1Y1WG 3FKIG 4QL5A 2ES2A 4X64L 2K5VA 2PQAA 3HKSA 4AYBG 1XMOL 2V1CC 1PYBA 4R4CA 3F8TA 4X65Q 3KJOA 1VQ4A 1HNXL 4LF9L 4O2DA 3AEVA 3E0EA 4OWWB 2R7ZG 4HIMA 2NVTH 4BY7H 4LF8L 4C3IH 4A3MH 1X55A 1PH3A 2R92H 1IBKL 3Q8DA 1KC8C 1PH1A 3CCLA 1C9OA 1VQDA 3HOVG 1UE5A 4A93G 1N9WA 2ALYB 3ULLA 2Y0SE 2EXDA 1UE7A 3NEMA 3HOXG 2KENA 4RMFA 3I4MG 1Q81C 3J7A5 4HJ7A 2E5LL 4HJAA 4BXXG 5JJKA 5M3FH 5IP9H 3OTOQ 1G6PA 2UUAQ 2UUBL 1Y1WH 4DR2Q 4UP8A 1VQAA 3FKIH 3KJPA 2VW9A 2ZM6L 1XPRA 1VQ6A 3CCVA 4DR1L 1KAWA 4JI7L 3PUXA 1I94Q 4L5QA 5LMUQ 2RCNA 3CCMA 4OO1G 4EX5A 4GKJL 5BR8L 1KD1C 2HIVA 1SE8A 4JI8L 2R7ZH 4LF5Q 3AQQA 2WB1G 4JCVE 5C3EG 3OW2A 1Q7YC 1C7YA 3CC2A 1JJCB 2LSSA 2YTVA 1NY4A 4YWKA 3I56A 2UU9Q 1ASZA 4B3SQ 2K75A 3HKZG 3KF6B 3PCOB 1K3RA 3J81i 1S40A 4LF4Q 2JA7G 4A93H 5C4XG 3HOVH 1XJVA 2K5NA 1GO3E 3HOUG 3CCRA 1C0AA 4LFCQ 1SRUA 3HOXH 3I4MH 3FHWA 1I5FA 4JOIC 1EQQA 1WFQA 4JBJA 2JK8A 1NBWA 4BXXH 5DLQE 1KHIA 3RN2A 4IOAA 1N32L 1VQ7A 3GTGH 4HJ8A 3T1HQ 4AH6A 2A8VA 2CQOA 2JJQA 3KYHC 1H95A 2CFMA 2IX1A 4LFBQ 4QGUA 2BA0A 4NPSA 1KRTA 3TREA 4A76A 1UE6A 2K5HA 1Q1BA 1QVGA 4R4QA 4A3CG 2AKWB 1YITA 2AWNA 3D31A 4POFA 5C3EH 1HH2P 4R4IA 4JI6Q 4IFDI 4YWMA 1EIYB 1CSPA 2ZTDA 4YCWA 5C4XH 1EQRA 5M3MG 5GQOA 2HHHQ 4ALPA 2JA7H 4IFDG 4UP9A 3A5UA 2QGQA 1E1TA 1Q8KA 3CPWA 4P71A 1VQFA 1L1OC 5HY6A 4JC0A 1GD7A
chains in the Genus database with same CATH superfamily
4IURA 3EIVA 4KKTA 3CHBD 2HQEA 3RLNA 3ZJYC 1GM5A 2ZTCA 2CWAA 2OEOA 1A8VA 1D6EC 2KCNA 1VQIA 1VF7A 2MHVA 1RJTA 1IW7D 2HT1A 4OELB 1XXGA 2K5WA 4MTKA 1NSNS 2HD3A 4DV1Q 1CSQA 2C35B 3IKJA 4AQYQ 4IFDH 2F0UA 1PDQA 1A3UA 1LTID 4WORA 1CKOA 3OIPA 3I4NG 1X3FA 1N36Q 3K80C 1IBLL 2ZXOA 2EYJA 4J15A 3MEHA 1WTPA 3CPFA 2IPKD 3ITPA 2N49A 1SNOA 2O2LD 1Y8PB 4BS9A 2F0FA 1FL0A 2KECA 1WTHA 1HNWQ 3AB9A 3CCJA 2F4VL 5IGDA 4A3IG 4HIOA 2LXKA 3H3VI 3HGBA 1KRSA 5E4WC 5FLMG 4QQBX 1PZID 5IT9L 3D3RA 5HGTA 1PZJD 3CRLC 3H0GB 3I4OA 4CJ2C 5AJ3L 2Z4IA 1OTCA 5GAGC 2EYFA 2NTSA 4Q5VA 1HA5A 2XVSA 2F4IA 3MHBA 2K50A 2KCTA 1X9NA 5DEHA 3H09A 2XWBB 4IUUA 4JV5Q 2E2JB 1VQ8A 4CDFC 4X64Q 1S5DD 4OWXB 1XX8A 1V9PA 3RLOA 3NWTA 5ELBA 1MSGA 3HOWG 2PZWA 2L55A 1RKNA 3PO3H 4MN3A 5JJZA 1R9TH 2Q2HA 3PIPA 1KABA 2WAQB 2Y0SG 2K28A 5TSSA 5C44H 2RDFA 1W2BA 3OOCA 1WTXA 5JEAH 2ZXPA 2UUAL 3T16A 5T1GA 2ZM6Q 1U5KA 4HSVA 4YHHQ 1TXYA 1QVCA 3NBHB 2KOLA 4K0KL 1O7YA 3TZDA 2KHIA 3EBEA 5GAHC 1G2SA 1SNDA 3MA2B 2RHSB 5E3FA 2IHEA 2UU9L 3DHQA 4DV3Q 4HAEA 1RF2D 1CT1D 1G51A 2R93H 1VQLA 2E75C 3TSSA 2IW3A 2R7FA 1ESFA 1LT4D 3OHXC 4A3BB 1TU2B 1YNJC 5GADC 2B39A 3ULJA 4KN4C 2F0VA 2WAQE 2VQFL 4RKBA 1Q90A 4JYAQ 3I73A 1K28A 2Z6KC 4JK1C 1G91A 1X54A 5DAUA 2B8FA 2JA5G 4C56C 3HP3A 2MO0A 2E8GA 1JWUD 4Z9CB 1YEZA 4FP5D 4FF4A 1CA5A 3UE0A 1DD2A 2K5QA 2RVLA 3RR5A 2R92B 2L9HA 2X69A 4TKOB 4KHZA 5C5MA 2N3SA 4BBSH 2CCZA 3U58A 3BZDB 4XTCS 5IODA 2HQLA 5CV6A 2UUCL 2ZJRA 1S3OA 3J80c 1R9TB 1B7YB 2A69D 2EY6A 2KUMA 1PVOA 5FK9C 3MVVA 4ID6A 1U4MA 4RCOA 2CH4A 3A54A 4AYBB 1F9RA 2WKDA 4DV5Q 1PRTF 1FJGL 4GS3A 1VQNA 3I4LA 1LV9A 4PNYA 4DR7Q 4P75A 1D7QA 1SROA 1SN8A 1A63A 1VQJA 1I4HA 4C3HG 1RCVD 1EY5A 3SK8A 1PRTC 2EE1A 4IN3A 2D9UA 3W1BA 3GQBA 4DXGA 4F87A 2QDBA 3T1YL 4OIKA 1SMYD 5IWAQ 5C3EB 2WB1B 1LTRD 2K33A 5C4XB 2JEAI 4X3UA 1H9MA 4GNXB 1TWFH 5EKLA 1HTLD 5CBAE 2Q2UA 4DR4L 3PUVA 3L9AX 4X66L 3HOUB 2Z6KA 5IYDH 3PIP3 3TQYA 3QO2A 1TWHH 2PZTA 4H0LC 3PV0A 1CTMA 4B3RQ 3DM1A 3ONAB 1MHWC 4X62Q 3G7LA 1BCPD 1FVIA 1STNA 4XT3B 4L8JA 3H94A 3K59A 4XYQA 2J0TD 3Q22A 2E2DC 4IPDA 1HR0W 1SMXA 1HR0Q 3A5ZB 2QKIC 3DLLA 2NVXH 4N9PA 4UY8C 1UWVA 1UEBA 3PF4A 5K36G 1XPUA 3WWVA 2C9OA 1HZCA 1H9RA 1IKLA 4LJZC 5BR8Q 2EZVA 1K9MC 4FF1A 1LTAD 1GKHA 3H0GG 4GN5A 5M5XH 4GKJL 4RG1A 4LAAA 4A3EH 2A6HD 5E7NA 1T5XD 4YWLA 3OIQA 2QW7A 1PTOC 4OO1I 1K8OA 2D62A 1LM0A 1P8LA 1E24A 3R93A 3M3YH 5GROA 5M5YB 1IYJB 1QCBD 2EJMA 1PH5A 1H9SA 1T5EA 4KJNA 2A5HA 1Q12A 4OGQC 1TWGH 5JAVA 2WIIB 1WTQA 4OWTB 3URYA 5JJIA 3M9BA 1NTGA 1CA6A 3NE5B 3GTOB 4UAIA 1U4PA 4HSPA 2WAQG 1EL0A 2RQXA 1VQKA 4RCNA 5ELNA 2TMPA 1SR3A 1Q8IA 3DXJC 4HIKA 4CJ1B 4TSSA 2L0CA 5FJ8G 2SOBA 3CKIB 3S1QB 2KBNA 1WD1A 3MXUA 2F0HA 1X56A 2IX3A 4YY3L 2I5HA 4IPHA 3ICEA 3X3NA 2VB2X 1I4GA 4A3GH 2N78A 1O7IA 2AUKA 5C0XH 2DJGC 4GLXA 2NN6H 4L5TA 1GJXA 1W6KA 2NVXB 1IBLQ 5EAYA 4OEMB 2KVMA 4DV4L 1XTDA 1G2TA 3WOEA 2FXQA 1EY0A 4KN7C 4A3BG 1IL8A 1W3SA 2MP1A 3A7AB 1QZHA 3LX0A 4PG3A 1HNWL 3IRBA 1U9RA 2IX0A 1IL2A 2A73B 1STEA 3S1MH 1O80A 4CDEC 1MJEA 1QVFA 2K04A 1SNPA 1FGUA 2PQEA 4R4TA 5IGBA 4LUVA 1HQMC 2K6AA 2L1BA 4JI1L 1ENFA 1SYEA 2R92G 5AJ3Q 1STGA 1JJGA 2FMCA 5I4DA 3UDGA 2YTXA 4E6IA 2I07B 1JE5A 1HCZA 1STYA 2EYMA 2TSSA 1EQVA 3K57A 2JA6B 4KHVA 1B44D 4X64L 2PQAA 3HKSA 4AYBG 1ICWA 1PYBA 5M9OA 3KJOA 2EYHA 5C3WA 3AEVA 3JAML 4OWWB 4BY7H 4LF8L 2MPMA 1KLUD 4A3MH 1X55A 1IBKL 5E4XA 3CCLA 1TS4A 1UE5A 1C48A 1PXUA 3TMEA 1TQOA 2EXDA 2KENA 1EY6A 1I4RA 3VYTA 5KRUA 3SVMA 1Q81C 5JJKA 3BYYB 4A3GB 2LMCB 2UUAQ 3KLSA 3P75A 2UUBL 2ZM6L 3Q24A 3FKIH 1VQ6A 4F88A 4JI7L 1Y69U 5DM63 1BXTA 1CFMA 2RCNA 1DJRD 4OO1G 1SE8A 4YIJA 5CV9A 5C3EG 2WB1G 2XN9C 2G5DA 2LSSA 2UU9Q 4YWKA 5C3XA 4B3SQ 2K75A 5CGKA 5C4XG 5A2QL 2PMZB 3HOVH 1I6HB 3KUPA 1SJED 3A8IE 3HOUG 3BS1A 2QF7A 4JOIC 1EQQA 2RDHA 3DUZA 2JK8A 2BE5D 5DLQE 1U4LA 4B08A 3TZUA 1SE3A 4EQOA 2F0OA 2A8VA 1SE2A 2CQOA 4QGUA 1RODA 1QE6A 2BA0A 4NPSA 2B2TA 1UE6A 1QVGA 4A3CG 1G6ZA 1H9KA 1CZGA 3D6WA 5T1IA 5GQOA 3PMFA 4ALPA 3QG1A 4UP9A 1QJOA 2QGQA 1Q8KA 5I6YA 4ABNA 1PH6A 4JC0A 3K0YA 5CYUA 5JVH3 4ZLTF 2OT2A 3RZOH 1VMPA 3S15B 4KV6A 2L15A 3CU7A 3DMUA 3S17B 3CW2C 3NUCA 4B9XA 3W2DA 4J6HA 1YHBA 3U9SA 4JI0Q 4BY7B 2PMZE 3K6OA 3M4QA 2UUCQ 4K2LA 3M7GA 3KFUA 1BDOA 1F2ZA 3SK5A 2Z0SA 3I3CA 2JYOA 3B6YA 2QEJC 1VF5C 4A4IA 1MI2A 3FDTA 4DV5L 4XQQA 3SR1A 5C4JB 3STBD 1FJGQ 1UE1A 5D14A 5C6AA 4V190 4C3JH 4NMZA 4EQNA 1HUMA 1EZ8A 3KLWA 1JE4A 4PZ6A 2VNUD 1B50A 4HMIA 4WJ4A 4I65A 2ZTEA 3GTKH 4JOIA 1EU4A 5CBEE 2JA9A 2JSOA 4HR7B 5IWAL 1TKWB 3KF8A 3M4OB 1XMQL 2Q8TA 1E0BA 2XGTA 4DNTB 5IYBG 4CKCA 1STBA 4P2CB 1AW7A 1NJIC 4DR4Q 2DUDA 3KBGA 1EYAA 3QB3A 1TS5A 4X66Q 2VS1A 3GTQB 2XRQD 5M5WH 2EIFA 1ET6A 3KDFA 4QY7A 1E1OA 4A3KB 1NMFA 2A19A 3U9OA 1BCPC 3VR6A 1E2ZA 2NBFA 4A3LH 1NAPA 4B3RL 3ER0A 4X62L 2F0PA 5J3BA 4C1NK 1CK1A 3RZOB 1VQGA 5CV7A 1HNXQ 2O4XA 1HR0L 3WDNA 4G7OC 2N55A 2H4OA 1MD2D 4IPCA 1VCIA 1EYDA 2PNRC 3NBIA 4F8MA 2E5LQ 3J7ZC 1LTGD 3SHLA 4IUTA 3RLFA 3I70A 5IYCH 1GVPA 1B9NA 2E76C 1PTOH 2YU9B 1Y1VH 4AIMA 2KEDA 1I4XA 1YIJA 3O13A 4KI0A 3HOYB 1M1KC 3L0OA 4LUOA 1JC7A 3PQIA 2B2VC 2XWJB 4LF5L 1JICA 1F9PA 4RHRA 1PYSB 3HEJA 3SXHA 4DXFA 3DEOA 3NTHA 1IYUA 3NK9A 3PSIA 1PRTB 4R9WA 2JA6G 1H9SB 2GVAA 1E3PA 1KAAA 3G48A 3VR3A 1EY9A 2VUMH 2ZT9C 1K0RA 1I3QB 2KCMA 4K8IA 1NCVA 3VYUA 3OWFA 1A2TA 1OXSC 4QF4A 2A1AA 4IUVA 4LW1A 1GUNA 4MHEA 2OTLA 2JQOA 1PFMA 4WJWA 5F2DA 2ZXRA 4FO2A 2I46A 4HMJA 2NVTB 4QCLA 1LTBD 4C3IB 4JI4Q 4YY3Q 2ATWA 1A2UA 4YCUA 1UUPA 4WRDA 1CZWA 3F2UA 3BYTB 4K2KA 1QNUA 2MNAA 5EPLA 4BY1H 4JI3Q 1D5XC 3CMEA 1X3EA 1Y1WB 4DV4Q 3S16H 2N88A 3J81L 1SBBB 5D65A 2KA7A 3SGIA 1PMRA 5ELFA 4A75A 4DAYA 2BOSA 5NUCA 1WI5A 1Z47A 4A93B 4RA8A 1TWCH 1B9MA 2XNAC 5CV8A 1M8AA 4G7HC 1LT6D 3F2BA 3GTGB 1VQCA 3BDLA 4EGVA 4JI1Q 5JOBA 2DJFC 4Y7NH 1EEFD 4IUPA 2R7DA 2CW0C 1EIFA 2NZOA 1SYFA 5I2YA 4KD3A 4HJ5A 1L1OA 4IALA 4DAPA 1S5ED 3CD6A 3I55A 4V0BA 4ZRZA 2IL8A 1A6XA 2H5XA 4XYOA 5CV5A 1FYCA 1VQEA 3VYRA 2PQAB 1GUWA 2BCOA 3D4DA 3I2ZA 4K8JA 2NUCA 1HXYD 4IUNA 1PFNA 2UXBL 4LF8Q 1FGBD 1CQVA 1N33Q 2I5LX 2JA8H 1IBKQ 3GTMH 3TS2A 4IQZA 4A3JH 1RTOA 4L5SA 2XSCA 1Q46A 1AH9A 4B3TQ 2FFKB 4NXML 4BBRH 5IOCA 3C3LA 1SLJA 1ML0D 1VQHA 4DK1A 1WD0A 2UUBQ 3GTPH 4QJFA 3OW7A 4ILWA 2YYZA 3AMUA 5DM73 4JI7Q 1PH7A 4A3FH 1JMCA 1KNEA 4LF6Q 4DPGA 3QJYA 2PI2A 4O0AA 1L0XB 4B3SL 1XNQQ 4RGTA 5IP7G 3K7UC 3TBIB 4FYDA 2VZAA 5C4ZA 1UAPA 4ZKCB 3S2HH 1V1PA 1SEBD 1ONLA 1HZAA 1RTNA 1YNND 2NZHA 4A3KG 1QZGA 3K7AH 3FMCA 4IO9A 4GLVB 1LO5D 1WCMH 2BH2A 2NWGA 2DN8A 3RZDH 3RMHA 4A3DH 3EA6A 4CBVA 1WTVA 4RFBA 1JORA 4ME3A 2H1EA 2KEEA 2MO1A 4K5VA 5FLXc 2BH8A 4CHTB 1TY0A 5EPJA 4GOPB 2UXCQ 1K0SA 1TIID 3F1ZA 5E1FA 4CKEA 2QILA 5C5LA 4H13C 4JI0L 3VDYA 3PO3B 4DA2A 1E2WA 3T13A 3HOYG 4O1NA 4DV2L 1EYGA 3STBC 2JA8B 3GTMB 1FNWA 2R6GA 2J4XA 4X6AH 3QWNA 5BN3A 1EFWA 5C44B 3EN2A 3A0JA 4K6DA 4Q0FA 3CC4A 3CC7A 4POGA 3M4PA 2GVBA 2ICEC 3K81C 4RGOS 4Y52H 2A68D 3SE0A 3K0XA 2D5DA 3A8KE 2DNCA 1RDPD 3PO2H 1Z6HA 1EOTA 4RH6A 4P72A 4O42A 3MXNA 1KQSA 2ZJQA 2R93B 3K5MA 2Z6BA 1EZ6A 1X65A 3R3OA 2K03A 2E2IH 3GV6A 1XMQQ 2B63H 1DM0B 4DR6L 4C3IG 3HOZH 4HIDA 1QWYA 1EUJA 5EJWA 1JWMD 4JBKA 3G6JB 5FLXE 5LMNL 5EGTA 4A3DB 1AN8A 3KDFB 3J80i 3D4RA 1RD9D 2NVYH 2ZJPA 1Y1WG 2SDFA 4QL5A 3N52A 1BUVT 3MC0B 2V1CC 2BDNA 3F8TA 1VQ4A 1HNXL 3H3VC 3J80E 2AQ3B 4U68A 1DYQA 1E2VA 2F0GA 2LFNA 1SXTA 1PH3A 4BBSB 2F0QA 2SNMA 5CR3A 4A93G 3MZ5A 1PTOF 5DNFA 1N9WA 2F0KA 3ULLA 4CGYB 5FOBB 4RMFA 4ZQ3A 3K5NA 4HJ7A 2E5LL 5EBDA 4HJAA 5IGGA 5IP9H 5M3FH 2F0MA 2A6ED 4UP8A 1VQAA 3DWQA 1TT2A 5LMUQ 1KD1C 2HIVA 4JI8L 2EVBA 2R7ZH 3KLRA 4LF5Q 4S3SA 5C4HA 1ASZA 4LF4Q 1JCKB 1K3RA 5KNDA 1F9SA 3RUZA 4QIWB 2PYKA 3I4MH 3HOXH 2F0IA 4JBJA 5EPKA 4BXXH 2CH4W 1VQ7A 2PPBC 3KYHC 2CFMA 2IX1A 5EQ0A 1KDCA 2K5HA 2B8GA 4F7XA 4R4QA 2AKWB 3DEPA 1IW7C 4POFA 2FHTA 3GV3A 4JI6Q 1TWFB 4YWMA 1KDAA 4YCWA 4IFDG 1SNMA 3NQTA 2JA7H 3CPWA 1FR3A 1TWHB 4JI4L 1EOVA 1J6QA 1QG7A 4ZUJA 1TWAH 1JWSD 1V1QA 3OSOA 3Q0AA 1N8RC 4MIUA 4QIWE 2HDMA 4JI3L 2AQ1B 2ASBA 4P73A 1SNQA 4FNFA 5KIXA 2L11A 2OQ0A 5M3MH 1WTRA 3I7FA 2JE6I 2IWHA 2DY7A 5CV4A 1R4PB 4YCVA 5I9PA 4L5RC 4ZAIA 4DAMA 5M5XB 3X3MA 4KY7A 4A3EB 3IFTA 3NHHA 5IGCA 4DR5Q 1EQTA 2YV5A 1SJHD 4DV0Q 2NVQH 3GD7A 4KLKA 1JOOA 3M3YB 4HCSA 2PW7A 4UP7A 3U4VA 1AE2A 2MQHA 4ZCKA 3NPPA 5JJLA 4MZ9A 3VYSA 2RBMA 1TWGB 5KGUA 3UDXA 3I4NH 3G4SA 3PO3G 4EVOA 4GN3B 2K01A 2M2LA 1WTWA 1LT5D 2MFIA 3T56B 1L1OB 4X3TA 2JA8G 2YTYA 4IZ8A 4B3ML 1AP0A 1Y8NB 1CKMA 5KYIA 5C44G 1X3QA 3AFQA 4JG2A 1V1OA 5JEAG 1EWHA 3PUZA 1V43A 4KMUC 2OTJA 4TQUS 5JPNC 4A3IH 2UXBQ 1A62A 2AQ2B 4DKAC 4M1UB 1N33L 5FLMH 1XMOQ 4X65L 1BBUA 3ND8A 4LF9Q 1RHPA 3QOLA 1WOCA 4CDDC 1KIXA 1XWEA 4RHSA 4B3TL 5KNCA 2LS01 1TWAB 4NXMQ 3FPPA 4LMQD 4GLAC 5IGEA 2R93G 2F0DA 5ELCA 1YJ9A 4LF6L 1MGSA 3C1EA 1SFOH 2WP8J 4I7ZC 3ND9A 2PCFB 2PNHA 4DR2L 2KHJA 1XNQL 4OHJA 1YNNC 3UDFA 3NXWA 3I91A 4JBMA 1JQYD 2KJXA 1VQPA 1TS2A 3PIOA 4L6TB 3HOWH 2L4NA 1V1PB 4LUZA 2E74C 3KF6A 3V05A 3S1MB 1K83H 3HKZE 3CAMA 4I7AA 2D2CC 5CMDA 2DNEA 5A35A 4G57A 4X3SA 3CQZH 4RGNA 1F2LA 3GTLH 1VS0A 4G4KA 1N32Q 2RDGA 3FPUB 3BJUA 1HZ9A 4BBSG 4KK7A 1NR4A 2LXJA 3E9HA 1HFNA 1IKMA 2UXCL 2KHSA 3U4ZA 1AZPA 2A69C 3MAQA 2VY3A 1BF4A 1YHAA 1LYLA 2PI2E 5C0XI 3UI2A 4GNXC 2EY2A 1STHA 2G9HD 2OXPA 4HN7A 3P7JA 3DM3A 4H44C 3W3AA 4A3MB 4DV2Q 3CP0A 1EU3A 1P16A 3E6ZX 2CKZB 2IJ0A 4KD4A 3U50C 4QMGA 1I50H 4ULLA 2C5CA 5KNBA 3G6EA 2EOTA 1K8GA 2NB0A 1L0WA 4XXEA 3FKIB 3CCEA 4DR3L 4JBWA 2AMCB 2JA5H 3S1NH 3TDQA 4GKKL 2VQEQ 1GXDC 1R4QB 3GTJH 3OYYA 1SMYC 2P5ZX 3MXNB 1JJ2A 1N34L 1QOHA 3HOVB 3J7AV 5IYDG 2B2UC 3F2DA 4HCEA 1BCPF 1K83B 1HJPA 4DK3C 1CKNA 4DR6Q 1BR9A 1TS3A 3MFGA 1BKBA 4EQ5A 1XPOA 1D1KA 3S14H 3ERQA 1J8IA 1A3VA 1E7ZA 1Y8OB 4KHPQ 5LMNW 5LMNQ 3GTLB 3J81c 2D0PA 1BOSA 4MTNA 3A8JE 3P20A 5LHY1 3QR8A 3SK4A 1HNZL 2ENBA 4NP5A 4C1NI 3S1RH 2Z4HA 1B1ZA 1PRTD 2X6GA 4C3HH 3S2DH 3H3VH 1SNCA 2Q2IA 1HQRD 4M8AA 1LTLA 1QB5D 4UPAA 4DV6L 4NXNL 1SE4A 2V4DA 1TR5A 4A3EG 3MXGA 5IT9c 2UXDL 3C2PA 3JC66 1K73C 2F3WA 2A6EC 1KXLA 4B9WA 1MIUA 2HCIA 1S72A 1CQFA 3ULPA 2AUJD 2A6HC 4MNOA 3F2CA 4DUZL 2K32A 3PF5A 3TP5A 3K8AA 4JI2Q 2CWPA 1ESRA 3IFDA 2B2YC 4LK1C 4FXDA 4ZUIA 2EYLA 5I6WA 2AHOB 2RHQB 5LMUL 1A0IA 3KBXA 2LKVA 4JI8Q 4C3JB 1B53A 2F3VA 2I0QA 2O5JC 3VA5A 1PV4A 1ZKOA 1EEID 4LF4L 4TRDA 1MKHA 2G9DA 4DV7Q 5IY0A 4H7BA 1B2TA 2SEBD 4PV1C 4JW0A 3GTKB 2B2UA 2GN5A 2ID0A 5KEEA 5K36H 4PMBA 5IIFA 3HG9A 4LFAQ 2XIWA 1PH2A 2IT1A 2MUYA 4XDXA 2RKSA 3BZCA 2JP1A 5C0XJ 4JI6L 1IXRA 5I2XA 3H0GH 4DUYL 1F2MA 3K5OA 5M5WB 2RSNA 4A3GG 5D3IB 2NZ1D 5C0XG 3ERSX 4RGMA 2NN6G 2A74C 4G7ZC 3J81j 3WOFA 4EQPA 1O78A 1YJNA 2AWOA 3LGJA 1PH8A 1DGSA 1BBXC 3S2DB 1NMGA 3Q23A 5IT9E 2E2JH 3HS0C 4N9TA 2K14A 4BWGB 1BVSA 3ZYYX 1B3QA 1G8ZD 1YZ6A 2EYOA 1VQMA 1D1IA 3MTSA 2GA4B 3UE1A 4J1MA 1OO9B 1S5CD 2HUGA 5G3LD 3VR2A 2B2YA 3S24A 2F03A 2WACA 2F52A 4H02A 3I72A 1LLRD 3QOJA 4JI5L 3SK6A 1CUKA 1PTOB 1Y1VB 4RKLA 5FJ8H 2B2VA 4DR5L 3MFYA 2IY5B 4PZ7A 4DV0L 1HHVA 4DN4M 5J1ZA 1WVLA 1Q3LA 1JOKA 3D6CA 4C2MH 2OQKA 1ZYRD 1EY4A 2E2HH 3NQIA 1HFGA 4NKLA 2DY8A 1KL9A 1B4OA 1J5EL 3S9WA 2VUMB 1FNUA 1SYDA 4BY7G 1JT8A 3LWUA 4DGZA 3M7NA 4FXKC 4R4OA 1HA6A 1QNKA 4A3MG 3PUYA 3QIAA 1Q82C 2F0EA 4A3BH 1STAA 4OL7A 4B3MQ 4RWSC 3P1HA 2SNSA 4LNQA 1XNRQ 5EKIA 2O5IC 2BA1A 2FMMA 4DU9A 3FKIG 1W6JA 1XMOL 3H6MA 4R4CA 4ZKBB 4X65Q 4LF9L 4O2DA 3Q6SA 3E0EA 1HRJA 3RD4A 2PW5A 5HURA 1KNAA 4XT1B 2R92H 4JPBW 3Q8DA 2EY5A 1C9OA 1VQDA 3HOVG 2ALYB 5FKAC 3NP8A 1II3A 4BY1B 2R61A 1HPCA 3S16B 3OTOQ 1PFBA 3OWEB 4DR2Q 3KJPA 2K7VA 2L12A 2VW9A 2BE5C 3CCVA 1KAWA 4L5QA 4R8NA 3CCMA 2EPBA 4EX5A 3AQQA 4JCVE 3J7YW 3OW2A 3CC2A 4LF7L 2M9VA 2YTVA 1NY4A 3I56A 1TWCB 1MBYA 3KF6B 3PCOB 2CQAA 1S40A 1DOMA 1I4QA 1C0AA 1SRUA 1UNSA 1AZQA 3FHWA 1I5FA 4C2MB 4ZK9B 1F2YA 3EROA 3RN2A 1N32L 3KLSX 2E2HB 4HJ8A 2WV6D 1ICFB 2JJQA 1H95A 4Y7NB 1HUNA 4LFBQ 4A76A 4R8IA 5BN4A 1Q1BA 4OO1H 2VXWA 3D31A 2K05A 5J39A 5C3EH 1QILA 1D2BA 1TVXA 5JPMC 4R4IA 4IFDI 1CSPA 5C4XH 4ZYSA 4QUFA 3T4AC 3A5UA 5EBCA 1E1TA 4P71A 3HOUH 1NUCA 2MGSA 5LL6X 1Q1EA 4XIGS 3K5LA 1GUSA 2D0OA 4C3JG 4APVA 4A3JB 2QDLA 1IZ6A 1A15A 4A3CH 1RIPA 1IBML 3HFZB 2R3ZA 2Q2TA 3J7AF 3VR4A 1EY7A 2RA4A 4BBRB 4JVZA 4DK0A 5FO8B 3GTPB 1S5BD 1YI2A 4OX9Q 4XQJA 2OWOA 4DR3Q 1ET9A 3UDIA 5HGQA 4FDBA 4A3FB 1EFID 2VQEL 4GKKQ 2LY7A 5BN5A 1PFSA 5ISRA 1UEAB 3D0FA 1OXXK 1JR0D 1N34Q 2KQ3A 3AFPA 1GUOA 1X32A 1X6OA 4PMWA 3S2HB 1G291 1A3TA 2F0WA 2ICIA 4HEDA 4KY5A 3TP8A 3K7AB 1IHZA 3KF8B 4A3LG 5M5YH 3KOJA 1WCMB 1DCZA 1CKNB 1EWIA 3CMAA 3E3XA 3RZDB 2NTTA 3M85A 4KHPL 4RAUC 3V96A 2PZUA 5I9OA 3OPOA 3GTOH 1HNZQ 1QUQA 3V2TA 1RL2A 3R2TA 4DFAA 3FEWX 3BZKA 2F0SA 4DV6Q 4NXNQ 1EIGA 3DWPA 5IYCG 1ASYA 1WYDA 1Y1VG 2UXDQ 3S1QH 4IUQA 4AYBE 1YJWA 5K5PA 4J8QA 3I8ZA 1B70B 5LL6S 5IYBH 1OXTA 1VQOA 1PA6A 1B3AA 3CRKC 4DUZQ 4JI2L 1M90C 2JEBI 4ODGA 1ILQA 4DNIA 1HTPA 1CI3M 1LABA 1YHQA 2PO4A 1AE3A 1MSHA 2FJ2A 2XTIA 3AYHB 1PH4A 2VUMG 3NENA 1C4QA 5IE8A 4DV7L 4DR1Q 3PO2B 2EJGC 5IGFA 1I94L 4IOCA 4GZYC 3JAMc 4DAVA 1D8LA 1F9QA 4IPGA 3VA7A 2RSOA 1ENAA 3E0JA 1JB3A 1T9HA 5FLXL 3CF5A 2WB1E 3CXCA 5AFWA 1CHPD 3R8BA 1VDZA 2QA4A 2E2IB 5J22A 4TVAB 2F3IA 4LFCL 1PH9A 1K8AC 4LFAL 2L5TA 4IFDJ 1WJJA 4K14A 2B63B 4HTHA 1KTKA 5ELOA 4U673 3T1HL 3J80L 3HOZB 1JOQA 4GN4B 4DUYQ 1BCPB 3PUWA 4X3KA 5G3LF 1PYWD 3BG3A 4BY1G 4FXGC 1HZBA 2NVYB 2HHHL 1CM9A 3TRZA 1MJCA 3MWYW 3VR5A 3CCSA 2JA6H 1ZEQX 5GAEC 2K4KA 3RNUA 3BVMA 2EY1A 3M4YA 1NE3A 1GHJA 2RF4A 1DOKA 2VL6A 5L37A 4L63B 4DV1L 1SDFA 2FINB 3JAMi 5M3FB 4AQYL 1ZXTA 4DAYB 3RN5A 4UDUC 4JI5Q 1SYBA 2WINB 3HZXA 1D5MC 3FP9A 3GDEA 3JAME 2XRSD 4UHVA 1N36L 1ZYRC 5JVG3 2R7ZB 2OF1A 2F0TA 2B29A 1DOLA 4LWCA 2K52A 4XQNA 3I4MB 3HOXB 1I6HH 2F0NA 5KYLA 5D3DA 3EQLC 4QUCA 3FVQA 1D5ZC 1J5EQ 1O7LA 2N8NA 1X3PA 4KJOA 4ME5A 2F4VQ 1F77A 3W5OA 5JEAJ 2EQSA 4IJLA 3A7LA 4A3JG 3A56A 3L3OC 1OXUA 1XNRL 2HDLA 5A2QE 2X6LA 3D4WA 2B2TC 3HKZB 3TS0A 4BBRG 2JA7B 4CJ0B 2F0LA 3G71A 3A55A 4A3FG 1JB7A 2M00A 1DONA 1AFPA 1GOZA 3CCUA 3E5SA 1E22A 4CDCC 3GP7A 3AU7A 3S15H 1XYIA 1BQQT 4K5XA 2DGYA 4JV5L 3BVZA 4OIJA 3S17H 4GOPC 2CW0D 2KCCA 3I90A 4DNRB 3GO5A 3IL8A 1Q86C 5FO9B 5EKKA 3W1GA 4PZ8A 3H15A 1EIHA 1LUZA 5M3MB 2EXZA 2K1BA 3OTOL 4KTAA 1FNVA 1WCMG 3LWEA 5C4JH 1I4PA 4A3DG 3SDZA 1YVCA 3IAYA 4KKSA 4LF7Q 1ILPA 2MJ8A 4YHHL 3NBHA 4HJ9A 5ELEA 1C8CA 2NVQB 2QEXA 3CCQA 2Q8IB 4K0KQ 1SAPA 1EWCA 1Z9FA 1YBYA 1EY8A 1GUGA 4DV3L 1SYCA 1X3GA 1B8AA 2WFWA 1GUTA 3NWSA 4LFBL 3I4NB 1K8MA 2JXMB 3NELA 1PLFA 4NB3A 3TP6A 1BNZA 3L2PA 3M4OH 2NYZD 1IYVA 2B3GA 2IHFA 2EYPA 4DK6C 5IP7H 3SEBA 3C46A 2NN6I 3GTQH 1SYGA 2I5MX 2VQFQ 3OMCA 1O7ZA 1SSOA 4A3KH 4JYAL 1L2FA 1YNJD 4A3IB 2F1MA 3LNNA 2OCEA 2Z1CA 4WJ3M 1U4RA 5FO7B 2A68C 1WTOA 3BDCA 3PO2G 4NW2A 4FVMA 1KDBA 4N8FA 4GOPA 4FF3A 1IBMQ 2HIXA 4R1JA 1YNXA 1VQBA 3A74A 4K5WA 4OX9L 1OXVA 3L7ZC 3K58A 2WKCA 1K3BC 1SFOB 1BBWA 2HCCA 3H91A 1FD7D 2B63G 3N6RA 3DWAA 4OXPA 3HOZG 3E9IA 1XTCD 3EFXD 1VMCA 4P74A 3C1FA 3MEFA 3KK7A 2YU9H 3HOWB 3HOYH 4DR7L 4IJHA 3HRZC 3MXPA 2Y0SB 1VQ5A 3BU2A 1VQ9A 1TY2A 3T51B 2BDOA 4WFN3 3TEHB 1DZ1A 1AEXA 3CQZB 4QB4A 2K5DA 4BA1I 1S5FD 1I3QH 1PHJA 1L0YB 4BA2I 3T1YQ 3NSWA 3NTIA 5H1SE 4N8X1 1QUQB 4OONA 1ENCA 1Y14B 4NDXA 2CHBD 1GHKA 3R2IA 5CORA 4GNXA 3PGZA 1U0LA 5M3FG 2B2WC 5IP9G 1BO0A 1M4VA 3BVGA 4DF7A 4KY6A 2ES2A 4PMCA 2K5VA 1CHQD 1NR2A 2Z9HA 1DXMA 4FF2A 3EVQA 4HIMA 2NVTH 3PIO3 2R7ZG 3T53B 4C3IH 1LACA 1Z7TA 1H9JA 1KC8C 1PH1A 3BDOA 1I50B 2Y0SE 1PZKD 1UE7A 3NEMA 3HOXG 2QCPX 3I4MG 5CC4A 3J7A5 2EDGA 2VB3X 3OMGA 4BXXG 1G6PA 1LTTD 2Q8RE 1Y1WH 1XPRA 2JA5B 4KKUA 3D8GA 5COYA 4DR1L 3S1NB 5ELDA 2JN4A 3PUXA 1I94Q 3GTJB 5BR8L 3EJIA 1Q7YC 1C7YA 1JJCB 3NTKA 4GKJQ 3TP7A 3HKZG 3J81i 2JA7G 4A93H 2RCFA 1XJVA 2K5NA 1GO3E 3FRPB 3CCRA 4LFCQ 1I6VC 4CKBA 1LT3D 1KLGD 1WFQA 1NBWA 3J81E 1KHIA 1S4ZA 4PQXA 4IOAA 3GTGH 3T1HQ 4AH6A 1PTOD 3S14B 4K6LA 1NNXA 2EJFC 1KRTA 3TREA 1J9OA 1YITA 3TN2A 2AWNA 1V8QA 1HH2P 2Z8LA 1EYCA 1EIYB 2CVRA 2ZTDA 5M3MG 1EQRA 3S1RB 2F0JA 2HHHQ 2J7ZA 4C3HB 1LTSD 2B2WA 1VQFA 1L1OC 5HY6A 1GD7A
chains in the Genus database with same CATH topology
1Q1EA 3EIVA 3RZOH 4XIGS 3RLNA 3ZJYC 2L15A 2ZTCA 1GM5A 4JI4L 2CWAA 1EOVA 1A8VA 3CW2C 2D0OA 1J6QA 1VQIA 4APVA 1TWAH 2HT1A 1V1QA 1YHBA 4JI0Q 1N8RC 1IZ6A 4A3CH 2PMZE 1RIPA 3M4QA 1IBML 3HFZB 2UUCQ 2Q2TA 4QIWE 3KFUA 4JI3L 4DV1Q 2ASBA 1CSQA 2Z0SA 2C35B 4P73A 4AQYQ 3B6YA 5M3MH 2OQ0A 1YI2A 4OX9Q 2OWOA 3I7FA 4DR3Q 2JE6I 4A4IA 3UDIA 1CKOA 4FDBA 5HGQA 3I4NG 1X3FA 4DV5L 2VQEL 3K80C 4YCVA 3STBD 1N36Q 1IBLL 1FJGQ 4GKKQ 4J15A 1I94L 4L5RC 1UE1A 1PFSA 4DAMA 3CPFA 3D0FA 4C3JH 1OXXK 1N34Q 3AFPA 3KLWA 2N49A 4DR5Q 1X6OA 4PMWA 2YV5A 4DV0Q 1G291 3GD7A 2NVQH 4PZ6A 4KLKA 2VNUD 4UP7A 3U4VA 4WJ4A 1FL0A 1AE2A 2MQHA 3KF8B 1HNWQ 2ZTEA 4A3LG 5JJLA 5M5YH 3CCJA 3KOJA 4JOIA 4MZ9A 4A3IG 2F4VL 4HIOA 3GTKH 2LXKA 3CMAA 1CKNB 1EWIA 2JA9A 3H3VI 3UDXA 1KRSA 5FLMG 3I4NH 4QQBX 5IWAL 1AH9A 3M85A 1XMQL 4KHPL 2XGTA 3G4SA 3PO3G 5IYBG 4GN3B 3I4OA 2MFIA 5AJ3L 1L1OB 2JA8G 1NJIC 1OTCA 2DUDA 4DR4Q 2YTYA 4B3ML 3GTOH 1HNZQ 4X66Q 2VS1A 1QUQA 5GAGC 1RL2A 1CKMA 5M5WH 2EIFA 5C44G 3AFQA 3KDFA 4JG2A 1E1OA 4QY7A 1NMFA 2A19A 5JEAG 3BZKA 2K50A 4A3LH 3PUZA 1V43A 4B3RL 2KCTA 1X9NA 2OTJA 4TQUS 2UXBQ 4A3IH 4DV6Q 1A62A 4NXNQ 4DKAC 5IYCG 3ER0A 1N33L 4JV5Q 4X62L 1ASYA 1VQ8A 1WYDA 5J3BA 4X64Q 1Y1VG 5FLMH 1XMOQ 4OWXB 4X65L 1BBUA 3S1QH 2UXDQ 1V9PA 4AYBE 1YJWA 3RLOA 4LF9Q 1VQGA 1WOCA 1HNXQ 3HOWG 1B70B 1KIXA 3PO3H 5IYBH 1HR0L 4B3TL 1OXTA 1VQOA 1R9TH 4DUZQ 2Q2HA 1PA6A 4JI2L 1M90C 4NXMQ 3HOUH 4GLAC 2JEBI 4DNIA 3PIPA 2R93G 1YHQA 2Y0SG 4IPCA 1AE3A 1VCIA 5C44H 1W2BA 2XTIA 3AYHB 1YJ9A 4LF6L 1SFOH 2WP8J 2E5LQ 1PH4A 3J7ZC 2VUMG 2UUAL 2PNHA 3RLFA 4DR2L 2KHJA 1XNQL 3NENA 2ZM6Q 5IYCH 1GVPA 1U5KA 3UDFA 5IE8A 4DV7L 4DR1Q 4YHHQ 4JBMA 1Y1VH 4AIMA 1TXYA 1QVCA 3NBHB 3PIOA 4IOCA 3JAMc 1VQPA 1YIJA 4K0KL 1D8LA 4IPGA 2KHIA 4KI0A 3EBEA 3L0OA 4LUOA 5GAHC 1M1KC 4LF5L 3HOWH 2RHSB 4LUZA 2IHEA 2UU9L 1T9HA 3CF5A 3KF6A 2WB1E 3CXCA 4DV3Q 1K83H 1G51A 1PYSB 3HKZE 3CAMA 2R93H 1VQLA 2QA4A 3PSIA 2JA6G 4TVAB 2F3IA 4LFCL 1PH9A 1K8AC 4LFAL 2GVAA 4IFDJ 1WJJA 1E3PA 2R7FA 3G48A 3CQZH 2VUMH 5ELOA 3T1HL 3GTLH 1K0RA 1VS0A 1N32Q 5GADC 2KCMA 3BJUA 1HZ9A 4GN4B 3ULJA 4DUYQ 1OXSC 4BBSG 2A1AA 3PUWA 2LXJA 3E9HA 2WAQE 4LW1A 2VQFL 4BY1G 2OTLA 1HZBA 4JYAQ 2UXCL 2Z6KC 2HHHL 3U4ZA 2JQOA 1X54A 3TRZA 1MJCA 2VY3A 1YHAA 1LYLA 2PI2E 5C0XI 3CCSA 4GNXC 5GAEC 3RNUA 2K4KA 2JA5G 2JA6H 2MO0A 2E8GA 1YEZA 1NE3A 3DM3A 4JI4Q 3UE0A 4YY3Q 3CP0A 2RF4A 4DV2Q 2ATWA 4YCUA 3RR5A 2VL6A 4KHZA 1P16A 2CKZB 2N3SA 4BBSH 2CCZA 3U58A 4XTCS 3U50C 2HQLA 2UUCL 1I50H 2ZJRA 1S3OA 3J80c 4DV1L 3JAMi 2MNAA 1B7YB 3G6EA 4BY1H 4JI3Q 1PVOA 4B3TQ 1K8GA 4AQYL 3CMEA 1X3EA 1L0WA 4DAYB 3CCEA 4DV4Q 3RN5A 3S16H 4DR3L 1PH6A 4JI5Q 4JBWA 2AMCB 2JA5H 3FP9A 3GDEA 3S1NH 3SGIA 1N36L 4GKKL 4DV5Q 4A75A 2VQEQ 1FJGL 4GS3A 3GTJH 3OYYA 1VQNA 1WI5A 3MXNB 1JJ2A 1Z47A 4P75A 4DR7Q 1N34L 1D7QA 1SROA 1SN8A 1A63A 1TWCH 2B29A 4LWCA 1VQJA 2K52A 1I6HH 5IYDG 3F2DA 1J5EQ 2N8NA 3F2BA 1HJPA 3W1BA 4DK3C 1VQCA 2F4VQ 1CKNA 4DR6Q 3W5OA 4JI1Q 5JEAJ 1BKBA 2EQSA 3T1YL 4EQ5A 1XPOA 4Y7NH 4IJLA 3S14H 4A3JG 5IWAQ 1E7ZA 2R7DA 1EIFA 4KHPQ 5LMNW 2NZOA 5LMNQ 3J81c 1OXUA 2D0PA 1XNRL 3TS0A 4HJ5A 1L1OA 2JEAI 4BBRG 4MTNA 4GNXB 1TWFH 4DR4L 3CD6A 3I55A 2Q2UA 3PUVA 1HNZL 4X66L 3S1RH 2H5XA 4C3HH 3S2DH 2Z6KA 3G71A 5IYDH 1VQEA 3H3VH 4A3FG 2PQAB 1JB7A 3TQYA 1TWHH 2Q2IA 3I2ZA 3PV0A 3CCUA 1E22A 3S15H 1LTLA 2UXBL 4B3RQ 4UPAA 4DV6L 4LF8Q 4NXNL 2DGYA 4NXML 4JV5L 3S17H 1N33Q 2I5LX 4GOPC 4A3EG 4X62Q 2JA8H 1IBKQ 5IT9c 3GTMH 3GO5A 3JC66 1K73C 3TS2A 2UXDL 1KXLA 1Q86C 1MIUA 1FVIA 4A3JH 1S72A 3ULPA 3W1GA 4L5SA 4MNOA 1Q46A 4PZ8A 3H15A 3F2CA 4IPDA 1LUZA 4DUZL 1SMXA 1HR0W 3PF5A 1HR0Q 3K8AA 3A5ZB 4BBRH 3OTOL 4JI2Q 3DLLA 1SLJA 2NVXH 1UWVA 1UEBA 2CWPA 1VQHA 4UY8C 3PF4A 2UUBQ 3GTPH 4QJFA 5K36G 1XPUA 1WCMG 2YYZA 4JI7Q 2AHOB 3WWVA 1PH7A 2RHQB 4A3FH 5LMUL 1JMCA 1HZCA 1A0IA 4LF6Q 4DPGA 5C4JH 5BR8Q 2PI2A 4O0AA 4JI8Q 1K9MC 4A3DG 2I0QA 1YVCA 4LF7Q 4B3SL 1GKHA 3H0GG 4GN5A 5M5XH 1PV4A 4LF4L 1XNQQ 4RG1A 3K7UC 5IP7G 4YHHL 4HJ9A 1MKHA 4A3EH 4DV7Q 5E7NA 5IY0A 2QEXA 3CCQA 4YWLA 2VZAA 4K0KQ 4OO1I 2D62A 1LM0A 3S2HH 1Z9FA 1P8LA 1E24A 3M3YH 1YBYA 5GROA 1HZAA 4DV3L 2NZHA 4A3KG 1IYJB 1QZGA 4GKJQ 1X3GA 1B8AA 2GN5A 2ID0A 3K7AH 1PH5A 2WFWA 4IO9A 4GLVB 4LFBL 1WCMH 1Q12A 4LFAQ 2BH2A 3NELA 1TWGH 4NB3A 3RZDH 1PH2A 2IT1A 4OWTB 3L2PA 3M4OH 5JJIA 3BZCA 4A3DH 5C0XJ 4JI6L 1IXRA 2B3GA 3M9BA 1NTGA 2IHFA 3H0GH 4DK6C 5IP7H 4DUYL 4ME3A 4A3GG 2WAQG 2MO1A 2NN6I 5C0XG 3GTQH 2I5MX 3ERSX 5FLXc 2NN6G 2VQFQ 2BH8A 3J81j 1VQKA 4A3KH 4JYAL 1L2FA 5ELNA 1SR3A 4GOPB 2UXCQ 3F1ZA 4HIKA 4LF7L 2OCEA 4WJ3M 1YJNA 2AWOA 3LGJA 1PH8A 1DGSA 1NMGA 5FJ8G 2E2JH 3PO2G 2K14A 4JI0L 2KBNA 1BVSA 3VDYA 4GOPA 1IBMQ 3HOYG 1X56A 1YZ6A 2HIXA 4DV2L 4YY3L 1VQMA 2I5HA 1YNXA 4R1JA 4IPHA 1VQBA 3STBC 1EYGA 3ICEA 3A74A 2R6GA 4X6AH 4OX9L 1EFWA 4A3GH 3UE1A 1OXVA 2N78A 3A0JA 3EN2A 1O7IA 3L7ZC 3CC4A 3CC7A 4GLXA 3S24A 4L5TA 4POGA 1BBWA 3K81C 2F52A 2GVBA 3M4PA 4H02A 1IBLQ 5EAYA 4Y52H 4DV4L 2B63G 4JI5L 1XTDA 4OXPA 1CUKA 2FXQA 3E9IA 3K0XA 5FJ8H 4DR5L 3HOZG 4A3BG 4P74A 2IY5B 4PZ7A 3MEFA 3PO2H 1W3SA 4DV0L 2YU9H 4P72A 3HOYH 1QZHA 4PG3A 4DR7L 1KQSA 4IJHA 2ZJQA 1HNWL 3IRBA 2IX0A 1IL2A 4C2MH 1VQ5A 3BU2A 3S1MH 1MJEA 2OQKA 1VQ9A 1QVFA 2E2HH 1X65A 1FGUA 3TEHB 2E2IH 1KL9A 1J5EL 4R4TA 1XMQQ 4LUVA 4BY7G 3M7NA 1JT8A 2B63H 4R4OA 4DR6L 4A3MG 4JI1L 4BA1I 3PUYA 3HOZH 1Q82C 2R92G 1I3QH 5AJ3Q 1PHJA 4A3BH 4HIDA 4BA2I 3T1YQ 1EUJA 1JJGA 4B3MQ 5H1SE 4JBKA 1QUQB 4OONA 3UDGA 5LMNL 1Y14B 2YTXA 4LNQA 1JE5A 1XNRQ 3KDFB 4GNXA 3PGZA 1U0LA 3J80i 5IP9G 5M3FG 2BA1A 2NVYH 2ZJPA 1Y1WG 3FKIG 4QL5A 2ES2A 4X64L 2K5VA 2PQAA 3HKSA 4AYBG 1XMOL 2V1CC 1PYBA 4R4CA 3F8TA 4X65Q 3KJOA 1VQ4A 1HNXL 4LF9L 4O2DA 3AEVA 3E0EA 4OWWB 2R7ZG 4HIMA 2NVTH 4BY7H 4LF8L 4C3IH 4A3MH 1X55A 1PH3A 2R92H 1IBKL 3Q8DA 1KC8C 1PH1A 3CCLA 1C9OA 1VQDA 3HOVG 1UE5A 4A93G 1N9WA 2ALYB 3ULLA 2Y0SE 2EXDA 1UE7A 3NEMA 3HOXG 2KENA 4RMFA 3I4MG 1Q81C 3J7A5 4HJ7A 2E5LL 4HJAA 4BXXG 5JJKA 5M3FH 5IP9H 3OTOQ 1G6PA 2UUAQ 2UUBL 1Y1WH 4DR2Q 4UP8A 1VQAA 3FKIH 3KJPA 2VW9A 2ZM6L 1XPRA 1VQ6A 3CCVA 4DR1L 1KAWA 4JI7L 3PUXA 1I94Q 4L5QA 5LMUQ 2RCNA 3CCMA 4OO1G 4EX5A 4GKJL 5BR8L 1KD1C 2HIVA 1SE8A 4JI8L 2R7ZH 4LF5Q 3AQQA 2WB1G 4JCVE 5C3EG 3OW2A 1Q7YC 1C7YA 3CC2A 1JJCB 2LSSA 2YTVA 1NY4A 4YWKA 3I56A 2UU9Q 1ASZA 4B3SQ 2K75A 3HKZG 3KF6B 3PCOB 1K3RA 3J81i 1S40A 4LF4Q 2JA7G 4A93H 5C4XG 3HOVH 1XJVA 2K5NA 1GO3E 3HOUG 3CCRA 1C0AA 4LFCQ 1SRUA 3HOXH 3I4MH 3FHWA 1I5FA 4JOIC 1EQQA 1WFQA 4JBJA 2JK8A 1NBWA 4BXXH 5DLQE 1KHIA 3RN2A 4IOAA 1N32L 1VQ7A 3GTGH 4HJ8A 3T1HQ 4AH6A 2A8VA 2CQOA 2JJQA 3KYHC 1H95A 2CFMA 2IX1A 4LFBQ 4QGUA 2BA0A 4NPSA 1KRTA 3TREA 4A76A 1UE6A 2K5HA 1Q1BA 1QVGA 4R4QA 4A3CG 2AKWB 1YITA 2AWNA 3D31A 4POFA 5C3EH 1HH2P 4R4IA 4JI6Q 4IFDI 4YWMA 1EIYB 1CSPA 2ZTDA 4YCWA 5C4XH 1EQRA 5M3MG 5GQOA 2HHHQ 4ALPA 2JA7H 4IFDG 4UP9A 3A5UA 2QGQA 1E1TA 1Q8KA 3CPWA 4P71A 1VQFA 1L1OC 5HY6A 4JC0A 1GD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q1E A;  3EIV A;  3RZO H;  4XIG S;  3RLN A;  3ZJY C;  2L15 A;  2ZTC A;  1GM5 A;  4JI4 L;  2CWA A;  1EOV A;  1A8V A;  3CW2 C;  2D0O A;  1J6Q A;  1VQI A;  4APV A;  1TWA H;  2HT1 A;  1V1Q A;  1YHB A;  4JI0 Q;  1N8R C;  1IZ6 A;  4A3C H;  2PMZ E;  1RIP A;  3M4Q A;  1IBM L;  3HFZ B;  2UUC Q;  2Q2T A;  4QIW E;  3KFU A;  4JI3 L;  4DV1 Q;  2ASB A;  1CSQ A;  2Z0S A;  2C35 B;  4P73 A;  4AQY Q;  3B6Y A;  5M3M H;  2OQ0 A;  1YI2 A;  4OX9 Q;  2OWO A;  3I7F A;  4DR3 Q;  2JE6 I;  4A4I A;  3UDI A;  1CKO A;  4FDB A;  5HGQ A;  3I4N G;  1X3F A;  4DV5 L;  2VQE L;  3K80 C;  4YCV A;  3STB D;  1N36 Q;  1IBL L;  1FJG Q;  4GKK Q;  4J15 A;  1I94 L;  4L5R C;  1UE1 A;  1PFS A;  4DAM A;  3CPF A;  3D0F A;  4C3J H;  1OXX K;  1N34 Q;  3AFP A;  3KLW A;  2N49 A;  4DR5 Q;  1X6O A;  4PMW A;  2YV5 A;  4DV0 Q;  1G29 1;  3GD7 A;  2NVQ H;  4PZ6 A;  4KLK A;  2VNU D;  4UP7 A;  3U4V A;  4WJ4 A;  1FL0 A;  1AE2 A;  2MQH A;  3KF8 B;  1HNW Q;  2ZTE A;  4A3L G;  5JJL A;  5M5Y H;  3CCJ A;  3KOJ A;  4JOI A;  4MZ9 A;  4A3I G;  2F4V L;  4HIO A;  3GTK H;  2LXK A;  3CMA A;  1CKN B;  1EWI A;  2JA9 A;  3H3V I;  3UDX A;  1KRS A;  5FLM G;  3I4N H;  4QQB X;  5IWA L;  1AH9 A;  3M85 A;  1XMQ L;  4KHP L;  2XGT A;  3G4S A;  3PO3 G;  5IYB G;  4GN3 B;  3I4O A;  2MFI A;  5AJ3 L;  1L1O B;  2JA8 G;  1NJI C;  1OTC A;  2DUD A;  4DR4 Q;  2YTY A;  4B3M L;  3GTO H;  1HNZ Q;  4X66 Q;  2VS1 A;  1QUQ A;  5GAG C;  1RL2 A;  1CKM A;  5M5W H;  2EIF A;  5C44 G;  3AFQ A;  3KDF A;  4JG2 A;  1E1O A;  4QY7 A;  1NMF A;  2A19 A;  5JEA G;  3BZK A;  2K50 A;  4A3L H;  3PUZ A;  1V43 A;  4B3R L;  2KCT A;  1X9N A;  2OTJ A;  4TQU S;  2UXB Q;  4A3I H;  4DV6 Q;  1A62 A;  4NXN Q;  4DKA C;  5IYC G;  3ER0 A;  1N33 L;  4JV5 Q;  4X62 L;  1ASY A;  1VQ8 A;  1WYD A;  5J3B A;  4X64 Q;  1Y1V G;  5FLM H;  1XMO Q;  4OWX B;  4X65 L;  1BBU A;  3S1Q H;  2UXD Q;  1V9P A;  4AYB E;  1YJW A;  3RLO A;  4LF9 Q;  1VQG A;  1WOC A;  1HNX Q;  3HOW G;  1B70 B;  1KIX A;  3PO3 H;  5IYB H;  1HR0 L;  4B3T L;  1OXT A;  1VQO A;  1R9T H;  4DUZ Q;  2Q2H A;  1PA6 A;  4JI2 L;  1M90 C;  4NXM Q;  3HOU H;  4GLA C;  2JEB I;  4DNI A;  3PIP A;  2R93 G;  1YHQ A;  2Y0S G;  4IPC A;  1AE3 A;  1VCI A;  5C44 H;  1W2B A;  2XTI A;  3AYH B;  1YJ9 A;  4LF6 L;  1SFO H;  2WP8 J;  2E5L Q;  1PH4 A;  3J7Z C;  2VUM G;  2UUA L;  2PNH A;  3RLF A;  4DR2 L;  2KHJ A;  1XNQ L;  3NEN A;  2ZM6 Q;  5IYC H;  1GVP A;  1U5K A;  3UDF A;  5IE8 A;  4DV7 L;  4DR1 Q;  4YHH Q;  4JBM A;  1Y1V H;  4AIM A;  1TXY A;  1QVC A;  3NBH B;  3PIO A;  4IOC A;  3JAM c;  1VQP A;  1YIJ A;  4K0K L;  1D8L A;  4IPG A;  2KHI A;  4KI0 A;  3EBE A;  3L0O A;  4LUO A;  5GAH C;  1M1K C;  4LF5 L;  3HOW H;  2RHS B;  4LUZ A;  2IHE A;  2UU9 L;  1T9H A;  3CF5 A;  3KF6 A;  2WB1 E;  3CXC A;  4DV3 Q;  1K83 H;  1G51 A;  1PYS B;  3HKZ E;  3CAM A;  2R93 H;  1VQL A;  2QA4 A;  3PSI A;  2JA6 G;  4TVA B;  2F3I A;  4LFC L;  1PH9 A;  1K8A C;  4LFA L;  2GVA A;  4IFD J;  1WJJ A;  1E3P A;  2R7F A;  3G48 A;  3CQZ H;  2VUM H;  5ELO A;  3T1H L;  3GTL H;  1K0R A;  1VS0 A;  1N32 Q;  5GAD C;  2KCM A;  3BJU A;  1HZ9 A;  4GN4 B;  3ULJ A;  4DUY Q;  1OXS C;  4BBS G;  2A1A A;  3PUW A;  2LXJ A;  3E9H A;  2WAQ E;  4LW1 A;  2VQF L;  4BY1 G;  2OTL A;  1HZB A;  4JYA Q;  2UXC L;  2Z6K C;  2HHH L;  3U4Z A;  2JQO A;  1X54 A;  3TRZ A;  1MJC A;  2VY3 A;  1YHA A;  1LYL A;  2PI2 E;  5C0X I;  3CCS A;  4GNX C;  5GAE C;  3RNU A;  2K4K A;  2JA5 G;  2JA6 H;  2MO0 A;  2E8G A;  1YEZ A;  1NE3 A;  3DM3 A;  4JI4 Q;  3UE0 A;  4YY3 Q;  3CP0 A;  2RF4 A;  4DV2 Q;  2ATW A;  4YCU A;  3RR5 A;  2VL6 A;  4KHZ A;  1P16 A;  2CKZ B;  2N3S A;  4BBS H;  2CCZ A;  3U58 A;  4XTC S;  3U50 C;  2HQL A;  2UUC L;  1I50 H;  2ZJR A;  1S3O A;  3J80 c;  4DV1 L;  3JAM i;  2MNA A;  1B7Y B;  3G6E A;  4BY1 H;  4JI3 Q;  1PVO A;  4B3T Q;  1K8G A;  4AQY L;  3CME A;  1X3E A;  1L0W A;  4DAY B;  3CCE A;  4DV4 Q;  3RN5 A;  3S16 H;  4DR3 L;  1PH6 A;  4JI5 Q;  4JBW A;  2AMC B;  2JA5 H;  3FP9 A;  3GDE A;  3S1N H;  3SGI A;  1N36 L;  4GKK L;  4DV5 Q;  4A75 A;  2VQE Q;  1FJG L;  4GS3 A;  3GTJ H;  3OYY A;  1VQN A;  1WI5 A;  3MXN B;  1JJ2 A;  1Z47 A;  4P75 A;  4DR7 Q;  1N34 L;  1D7Q A;  1SRO A;  1SN8 A;  1A63 A;  1TWC H;  2B29 A;  4LWC A;  1VQJ A;  2K52 A;  1I6H H;  5IYD G;  3F2D A;  1J5E Q;  2N8N A;  3F2B A;  1HJP A;  3W1B A;  4DK3 C;  1VQC A;  2F4V Q;  1CKN A;  4DR6 Q;  3W5O A;  4JI1 Q;  5JEA J;  1BKB A;  2EQS A;  3T1Y L;  4EQ5 A;  1XPO A;  4Y7N H;  4IJL A;  3S14 H;  4A3J G;  5IWA Q;  1E7Z A;  2R7D A;  1EIF A;  4KHP Q;  5LMN W;  2NZO A;  5LMN Q;  3J81 c;  1OXU A;  2D0P A;  1XNR L;  3TS0 A;  4HJ5 A;  1L1O A;  2JEA I;  4BBR G;  4MTN A;  4GNX B;  1TWF H;  4DR4 L;  3CD6 A;  3I55 A;  2Q2U A;  3PUV A;  1HNZ L;  4X66 L;  3S1R H;  2H5X A;  4C3H H;  3S2D H;  2Z6K A;  3G71 A;  5IYD H;  1VQE A;  3H3V H;  4A3F G;  2PQA B;  1JB7 A;  3TQY A;  1TWH H;  2Q2I A;  3I2Z A;  3PV0 A;  3CCU A;  1E22 A;  3S15 H;  1LTL A;  2UXB L;  4B3R Q;  4UPA A;  4DV6 L;  4LF8 Q;  4NXN L;  2DGY A;  4NXM L;  4JV5 L;  3S17 H;  1N33 Q;  2I5L X;  4GOP C;  4A3E G;  4X62 Q;  2JA8 H;  1IBK Q;  5IT9 c;  3GTM H;  3GO5 A;  3JC6 6;  1K73 C;  3TS2 A;  2UXD L;  1KXL A;  1Q86 C;  1MIU A;  1FVI A;  4A3J H;  1S72 A;  3ULP A;  3W1G A;  4L5S A;  4MNO A;  1Q46 A;  4PZ8 A;  3H15 A;  3F2C A;  4IPD A;  1LUZ A;  4DUZ L;  1SMX A;  1HR0 W;  3PF5 A;  1HR0 Q;  3K8A A;  3A5Z B;  4BBR H;  3OTO L;  4JI2 Q;  3DLL A;  1SLJ A;  2NVX H;  1UWV A;  1UEB A;  2CWP A;  1VQH A;  4UY8 C;  3PF4 A;  2UUB Q;  3GTP H;  4QJF A;  5K36 G;  1XPU A;  1WCM G;  2YYZ A;  4JI7 Q;  2AHO B;  3WWV A;  1PH7 A;  2RHQ B;  4A3F H;  5LMU L;  1JMC A;  1HZC A;  1A0I A;  4LF6 Q;  4DPG A;  5C4J H;  5BR8 Q;  2PI2 A;  4O0A A;  4JI8 Q;  1K9M C;  4A3D G;  2I0Q A;  1YVC A;  4LF7 Q;  4B3S L;  1GKH A;  3H0G G;  4GN5 A;  5M5X H;  1PV4 A;  4LF4 L;  1XNQ Q;  4RG1 A;  3K7U C;  5IP7 G;  4YHH L;  4HJ9 A;  1MKH A;  4A3E H;  4DV7 Q;  5E7N A;  5IY0 A;  2QEX A;  3CCQ A;  4YWL A;  2VZA A;  4K0K Q;  4OO1 I;  2D62 A;  1LM0 A;  3S2H H;  1Z9F A;  1P8L A;  1E24 A;  3M3Y H;  1YBY A;  5GRO A;  1HZA A;  4DV3 L;  2NZH A;  4A3K G;  1IYJ B;  1QZG A;  4GKJ Q;  1X3G A;  1B8A A;  2GN5 A;  2ID0 A;  3K7A H;  1PH5 A;  2WFW A;  4IO9 A;  4GLV B;  4LFB L;  1WCM H;  1Q12 A;  4LFA Q;  2BH2 A;  3NEL A;  1TWG H;  4NB3 A;  3RZD H;  1PH2 A;  2IT1 A;  4OWT B;  3L2P A;  3M4O H;  5JJI A;  3BZC A;  4A3D H;  5C0X J;  4JI6 L;  1IXR A;  2B3G A;  3M9B A;  1NTG A;  2IHF A;  3H0G H;  4DK6 C;  5IP7 H;  4DUY L;  4ME3 A;  4A3G G;  2WAQ G;  2MO1 A;  2NN6 I;  5C0X G;  3GTQ H;  2I5M X;  3ERS X;  5FLX c;  2NN6 G;  2VQF Q;  2BH8 A;  3J81 j;  1VQK A;  4A3K H;  4JYA L;  1L2F A;  5ELN A;  1SR3 A;  4GOP B;  2UXC Q;  3F1Z A;  4HIK A;  4LF7 L;  2OCE A;  4WJ3 M;  1YJN A;  2AWO A;  3LGJ A;  1PH8 A;  1DGS A;  1NMG A;  5FJ8 G;  2E2J H;  3PO2 G;  2K14 A;  4JI0 L;  2KBN A;  1BVS A;  3VDY A;  4GOP A;  1IBM Q;  3HOY G;  1X56 A;  1YZ6 A;  2HIX A;  4DV2 L;  4YY3 L;  1VQM A;  2I5H A;  1YNX A;  4R1J A;  4IPH A;  1VQB A;  3STB C;  1EYG A;  3ICE A;  3A74 A;  2R6G A;  4X6A H;  4OX9 L;  1EFW A;  4A3G H;  3UE1 A;  1OXV A;  2N78 A;  3A0J A;  3EN2 A;  1O7I A;  3L7Z C;  3CC4 A;  3CC7 A;  4GLX A;  3S24 A;  4L5T A;  4POG A;  1BBW A;  3K81 C;  2F52 A;  2GVB A;  3M4P A;  4H02 A;  1IBL Q;  5EAY A;  4Y52 H;  4DV4 L;  2B63 G;  4JI5 L;  1XTD A;  4OXP A;  1CUK A;  2FXQ A;  3E9I A;  3K0X A;  5FJ8 H;  4DR5 L;  3HOZ G;  4A3B G;  4P74 A;  2IY5 B;  4PZ7 A;  3MEF A;  3PO2 H;  1W3S A;  4DV0 L;  2YU9 H;  4P72 A;  3HOY H;  1QZH A;  4PG3 A;  4DR7 L;  1KQS A;  4IJH A;  2ZJQ A;  1HNW L;  3IRB A;  2IX0 A;  1IL2 A;  4C2M H;  1VQ5 A;  3BU2 A;  3S1M H;  1MJE A;  2OQK A;  1VQ9 A;  1QVF A;  2E2H H;  1X65 A;  1FGU A;  3TEH B;  2E2I H;  1KL9 A;  1J5E L;  4R4T A;  1XMQ Q;  4LUV A;  4BY7 G;  3M7N A;  1JT8 A;  2B63 H;  4R4O A;  4DR6 L;  4A3M G;  4JI1 L;  4BA1 I;  3PUY A;  3HOZ H;  1Q82 C;  2R92 G;  1I3Q H;  5AJ3 Q;  1PHJ A;  4A3B H;  4HID A;  4BA2 I;  3T1Y Q;  1EUJ A;  1JJG A;  4B3M Q;  5H1S E;  4JBK A;  1QUQ B;  4OON A;  3UDG A;  5LMN L;  1Y14 B;  2YTX A;  4LNQ A;  1JE5 A;  1XNR Q;  3KDF B;  4GNX A;  3PGZ A;  1U0L A;  3J80 i;  5IP9 G;  5M3F G;  2BA1 A;  2NVY H;  2ZJP A;  1Y1W G;  3FKI G;  4QL5 A;  2ES2 A;  4X64 L;  2K5V A;  2PQA A;  3HKS A;  4AYB G;  1XMO L;  2V1C C;  1PYB A;  4R4C A;  3F8T A;  4X65 Q;  3KJO A;  1VQ4 A;  1HNX L;  4LF9 L;  4O2D A;  3AEV A;  3E0E A;  4OWW B;  2R7Z G;  4HIM A;  2NVT H;  4BY7 H;  4LF8 L;  4C3I H;  4A3M H;  1X55 A;  1PH3 A;  2R92 H;  1IBK L;  3Q8D A;  1KC8 C;  1PH1 A;  3CCL A;  1C9O A;  1VQD A;  3HOV G;  1UE5 A;  4A93 G;  1N9W A;  2ALY B;  3ULL A;  2Y0S E;  2EXD A;  1UE7 A;  3NEM A;  3HOX G;  2KEN A;  4RMF A;  3I4M G;  1Q81 C;  3J7A 5;  4HJ7 A;  2E5L L;  4HJA A;  4BXX G;  5JJK A;  5M3F H;  5IP9 H;  3OTO Q;  1G6P A;  2UUA Q;  2UUB L;  1Y1W H;  4DR2 Q;  4UP8 A;  1VQA A;  3FKI H;  3KJP A;  2VW9 A;  2ZM6 L;  1XPR A;  1VQ6 A;  3CCV A;  4DR1 L;  1KAW A;  4JI7 L;  3PUX A;  1I94 Q;  4L5Q A;  5LMU Q;  2RCN A;  3CCM A;  4OO1 G;  4EX5 A;  4GKJ L;  5BR8 L;  1KD1 C;  2HIV A;  1SE8 A;  4JI8 L;  2R7Z H;  4LF5 Q;  3AQQ A;  2WB1 G;  4JCV E;  5C3E G;  3OW2 A;  1Q7Y C;  1C7Y A;  3CC2 A;  1JJC B;  2LSS A;  2YTV A;  1NY4 A;  4YWK A;  3I56 A;  2UU9 Q;  1ASZ A;  4B3S Q;  2K75 A;  3HKZ G;  3KF6 B;  3PCO B;  1K3R A;  3J81 i;  1S40 A;  4LF4 Q;  2JA7 G;  4A93 H;  5C4X G;  3HOV H;  1XJV A;  2K5N A;  1GO3 E;  3HOU G;  3CCR A;  1C0A A;  4LFC Q;  1SRU A;  3HOX H;  3I4M H;  3FHW A;  1I5F A;  4JOI C;  1EQQ A;  1WFQ A;  4JBJ A;  2JK8 A;  1NBW A;  4BXX H;  5DLQ E;  1KHI A;  3RN2 A;  4IOA A;  1N32 L;  1VQ7 A;  3GTG H;  4HJ8 A;  3T1H Q;  4AH6 A;  2A8V A;  2CQO A;  2JJQ A;  3KYH C;  1H95 A;  2CFM A;  2IX1 A;  4LFB Q;  4QGU A;  2BA0 A;  4NPS A;  1KRT A;  3TRE A;  4A76 A;  1UE6 A;  2K5H A;  1Q1B A;  1QVG A;  4R4Q A;  4A3C G;  2AKW B;  1YIT A;  2AWN A;  3D31 A;  4POF A;  5C3E H;  1HH2 P;  4R4I A;  4JI6 Q;  4IFD I;  4YWM A;  1EIY B;  1CSP A;  2ZTD A;  4YCW A;  5C4X H;  1EQR A;  5M3M G;  5GQO A;  2HHH Q;  4ALP A;  2JA7 H;  4IFD G;  4UP9 A;  3A5U A;  2QGQ A;  1E1T A;  1Q8K A;  3CPW A;  4P71 A;  1VQF A;  1L1O C;  5HY6 A;  4JC0 A;  1GD7 A; 
#chains in the Genus database with same CATH topology
 4IUR A;  3EIV A;  4KKT A;  3CHB D;  2HQE A;  3RLN A;  3ZJY C;  1GM5 A;  2ZTC A;  2CWA A;  2OEO A;  1A8V A;  1D6E C;  2KCN A;  1VQI A;  1VF7 A;  2MHV A;  1RJT A;  1IW7 D;  2HT1 A;  4OEL B;  1XXG A;  2K5W A;  4MTK A;  1NSN S;  2HD3 A;  4DV1 Q;  1CSQ A;  2C35 B;  3IKJ A;  4AQY Q;  4IFD H;  2F0U A;  1PDQ A;  1A3U A;  1LTI D;  4WOR A;  1CKO A;  3OIP A;  3I4N G;  1X3F A;  1N36 Q;  3K80 C;  1IBL L;  2ZXO A;  2EYJ A;  4J15 A;  3MEH A;  1WTP A;  3CPF A;  2IPK D;  3ITP A;  2N49 A;  1SNO A;  2O2L D;  1Y8P B;  4BS9 A;  2F0F A;  1FL0 A;  2KEC A;  1WTH A;  1HNW Q;  3AB9 A;  3CCJ A;  2F4V L;  5IGD A;  4A3I G;  4HIO A;  2LXK A;  3H3V I;  3HGB A;  1KRS A;  5E4W C;  5FLM G;  4QQB X;  1PZI D;  5IT9 L;  3D3R A;  5HGT A;  1PZJ D;  3CRL C;  3H0G B;  3I4O A;  4CJ2 C;  5AJ3 L;  2Z4I A;  1OTC A;  5GAG C;  2EYF A;  2NTS A;  4Q5V A;  1HA5 A;  2XVS A;  2F4I A;  3MHB A;  2K50 A;  2KCT A;  1X9N A;  5DEH A;  3H09 A;  2XWB B;  4IUU A;  4JV5 Q;  2E2J B;  1VQ8 A;  4CDF C;  4X64 Q;  1S5D D;  4OWX B;  1XX8 A;  1V9P A;  3RLO A;  3NWT A;  5ELB A;  1MSG A;  3HOW G;  2PZW A;  2L55 A;  1RKN A;  3PO3 H;  4MN3 A;  5JJZ A;  1R9T H;  2Q2H A;  3PIP A;  1KAB A;  2WAQ B;  2Y0S G;  2K28 A;  5TSS A;  5C44 H;  2RDF A;  1W2B A;  3OOC A;  1WTX A;  5JEA H;  2ZXP A;  2UUA L;  3T16 A;  5T1G A;  2ZM6 Q;  1U5K A;  4HSV A;  4YHH Q;  1TXY A;  1QVC A;  3NBH B;  2KOL A;  4K0K L;  1O7Y A;  3TZD A;  2KHI A;  3EBE A;  5GAH C;  1G2S A;  1SND A;  3MA2 B;  2RHS B;  5E3F A;  2IHE A;  2UU9 L;  3DHQ A;  4DV3 Q;  4HAE A;  1RF2 D;  1CT1 D;  1G51 A;  2R93 H;  1VQL A;  2E75 C;  3TSS A;  2IW3 A;  2R7F A;  1ESF A;  1LT4 D;  3OHX C;  4A3B B;  1TU2 B;  1YNJ C;  5GAD C;  2B39 A;  3ULJ A;  4KN4 C;  2F0V A;  2WAQ E;  2VQF L;  4RKB A;  1Q90 A;  4JYA Q;  3I73 A;  1K28 A;  2Z6K C;  4JK1 C;  1G91 A;  1X54 A;  5DAU A;  2B8F A;  2JA5 G;  4C56 C;  3HP3 A;  2MO0 A;  2E8G A;  1JWU D;  4Z9C B;  1YEZ A;  4FP5 D;  4FF4 A;  1CA5 A;  3UE0 A;  1DD2 A;  2K5Q A;  2RVL A;  3RR5 A;  2R92 B;  2L9H A;  2X69 A;  4TKO B;  4KHZ A;  5C5M A;  2N3S A;  4BBS H;  2CCZ A;  3U58 A;  3BZD B;  4XTC S;  5IOD A;  2HQL A;  5CV6 A;  2UUC L;  2ZJR A;  1S3O A;  3J80 c;  1R9T B;  1B7Y B;  2A69 D;  2EY6 A;  2KUM A;  1PVO A;  5FK9 C;  3MVV A;  4ID6 A;  1U4M A;  4RCO A;  2CH4 A;  3A54 A;  4AYB B;  1F9R A;  2WKD A;  4DV5 Q;  1PRT F;  1FJG L;  4GS3 A;  1VQN A;  3I4L A;  1LV9 A;  4PNY A;  4DR7 Q;  4P75 A;  1D7Q A;  1SRO A;  1SN8 A;  1A63 A;  1VQJ A;  1I4H A;  4C3H G;  1RCV D;  1EY5 A;  3SK8 A;  1PRT C;  2EE1 A;  4IN3 A;  2D9U A;  3W1B A;  3GQB A;  4DXG A;  4F87 A;  2QDB A;  3T1Y L;  4OIK A;  1SMY D;  5IWA Q;  5C3E B;  2WB1 B;  1LTR D;  2K33 A;  5C4X B;  2JEA I;  4X3U A;  1H9M A;  4GNX B;  1TWF H;  5EKL A;  1HTL D;  5CBA E;  2Q2U A;  4DR4 L;  3PUV A;  3L9A X;  4X66 L;  3HOU B;  2Z6K A;  5IYD H;  3PIP 3;  3TQY A;  3QO2 A;  1TWH H;  2PZT A;  4H0L C;  3PV0 A;  1CTM A;  4B3R Q;  3DM1 A;  3ONA B;  1MHW C;  4X62 Q;  3G7L A;  1BCP D;  1FVI A;  1STN A;  4XT3 B;  4L8J A;  3H94 A;  3K59 A;  4XYQ A;  2J0T D;  3Q22 A;  2E2D C;  4IPD A;  1HR0 W;  1SMX A;  1HR0 Q;  3A5Z B;  2QKI C;  3DLL A;  2NVX H;  4N9P A;  4UY8 C;  1UWV A;  1UEB A;  3PF4 A;  5K36 G;  1XPU A;  3WWV A;  2C9O A;  1HZC A;  1H9R A;  1IKL A;  4LJZ C;  5BR8 Q;  2EZV A;  1K9M C;  4FF1 A;  1LTA D;  1GKH A;  3H0G G;  4GN5 A;  5M5X H;  4GKJ L;  4RG1 A;  4LAA A;  4A3E H;  2A6H D;  5E7N A;  1T5X D;  4YWL A;  3OIQ A;  2QW7 A;  1PTO C;  4OO1 I;  1K8O A;  2D62 A;  1LM0 A;  1P8L A;  1E24 A;  3R93 A;  3M3Y H;  5GRO A;  5M5Y B;  1IYJ B;  1QCB D;  2EJM A;  1PH5 A;  1H9S A;  1T5E A;  4KJN A;  2A5H A;  1Q12 A;  4OGQ C;  1TWG H;  5JAV A;  2WII B;  1WTQ A;  4OWT B;  3URY A;  5JJI A;  3M9B A;  1NTG A;  1CA6 A;  3NE5 B;  3GTO B;  4UAI A;  1U4P A;  4HSP A;  2WAQ G;  1EL0 A;  2RQX A;  1VQK A;  4RCN A;  5ELN A;  2TMP A;  1SR3 A;  1Q8I A;  3DXJ C;  4HIK A;  4CJ1 B;  4TSS A;  2L0C A;  5FJ8 G;  2SOB A;  3CKI B;  3S1Q B;  2KBN A;  1WD1 A;  3MXU A;  2F0H A;  1X56 A;  2IX3 A;  4YY3 L;  2I5H A;  4IPH A;  3ICE A;  3X3N A;  2VB2 X;  1I4G A;  4A3G H;  2N78 A;  1O7I A;  2AUK A;  5C0X H;  2DJG C;  4GLX A;  2NN6 H;  4L5T A;  1GJX A;  1W6K A;  2NVX B;  1IBL Q;  5EAY A;  4OEM B;  2KVM A;  4DV4 L;  1XTD A;  1G2T A;  3WOE A;  2FXQ A;  1EY0 A;  4KN7 C;  4A3B G;  1IL8 A;  1W3S A;  2MP1 A;  3A7A B;  1QZH A;  3LX0 A;  4PG3 A;  1HNW L;  3IRB A;  1U9R A;  2IX0 A;  1IL2 A;  2A73 B;  1STE A;  3S1M H;  1O80 A;  4CDE C;  1MJE A;  1QVF A;  2K04 A;  1SNP A;  1FGU A;  2PQE A;  4R4T A;  5IGB A;  4LUV A;  1HQM C;  2K6A A;  2L1B A;  4JI1 L;  1ENF A;  1SYE A;  2R92 G;  5AJ3 Q;  1STG A;  1JJG A;  2FMC A;  5I4D A;  3UDG A;  2YTX A;  4E6I A;  2I07 B;  1JE5 A;  1HCZ A;  1STY A;  2EYM A;  2TSS A;  1EQV A;  3K57 A;  2JA6 B;  4KHV A;  1B44 D;  4X64 L;  2PQA A;  3HKS A;  4AYB G;  1ICW A;  1PYB A;  5M9O A;  3KJO A;  2EYH A;  5C3W A;  3AEV A;  3JAM L;  4OWW B;  4BY7 H;  4LF8 L;  2MPM A;  1KLU D;  4A3M H;  1X55 A;  1IBK L;  5E4X A;  3CCL A;  1TS4 A;  1UE5 A;  1C48 A;  1PXU A;  3TME A;  1TQO A;  2EXD A;  2KEN A;  1EY6 A;  1I4R A;  3VYT A;  5KRU A;  3SVM A;  1Q81 C;  5JJK A;  3BYY B;  4A3G B;  2LMC B;  2UUA Q;  3KLS A;  3P75 A;  2UUB L;  2ZM6 L;  3Q24 A;  3FKI H;  1VQ6 A;  4F88 A;  4JI7 L;  1Y69 U;  5DM6 3;  1BXT A;  1CFM A;  2RCN A;  1DJR D;  4OO1 G;  1SE8 A;  4YIJ A;  5CV9 A;  5C3E G;  2WB1 G;  2XN9 C;  2G5D A;  2LSS A;  2UU9 Q;  4YWK A;  5C3X A;  4B3S Q;  2K75 A;  5CGK A;  5C4X G;  5A2Q L;  2PMZ B;  3HOV H;  1I6H B;  3KUP A;  1SJE D;  3A8I E;  3HOU G;  3BS1 A;  2QF7 A;  4JOI C;  1EQQ A;  2RDH A;  3DUZ A;  2JK8 A;  2BE5 D;  5DLQ E;  1U4L A;  4B08 A;  3TZU A;  1SE3 A;  4EQO A;  2F0O A;  2A8V A;  1SE2 A;  2CQO A;  4QGU A;  1ROD A;  1QE6 A;  2BA0 A;  4NPS A;  2B2T A;  1UE6 A;  1QVG A;  4A3C G;  1G6Z A;  1H9K A;  1CZG A;  3D6W A;  5T1I A;  5GQO A;  3PMF A;  4ALP A;  3QG1 A;  4UP9 A;  1QJO A;  2QGQ A;  1Q8K A;  5I6Y A;  4ABN A;  1PH6 A;  4JC0 A;  3K0Y A;  5CYU A;  5JVH 3;  4ZLT F;  2OT2 A;  3RZO H;  1VMP A;  3S15 B;  4KV6 A;  2L15 A;  3CU7 A;  3DMU A;  3S17 B;  3CW2 C;  3NUC A;  4B9X A;  3W2D A;  4J6H A;  1YHB A;  3U9S A;  4JI0 Q;  4BY7 B;  2PMZ E;  3K6O A;  3M4Q A;  2UUC Q;  4K2L A;  3M7G A;  3KFU A;  1BDO A;  1F2Z A;  3SK5 A;  2Z0S A;  3I3C A;  2JYO A;  3B6Y A;  2QEJ C;  1VF5 C;  4A4I A;  1MI2 A;  3FDT A;  4DV5 L;  4XQQ A;  3SR1 A;  5C4J B;  3STB D;  1FJG Q;  1UE1 A;  5D14 A;  5C6A A;  4V19 0;  4C3J H;  4NMZ A;  4EQN A;  1HUM A;  1EZ8 A;  3KLW A;  1JE4 A;  4PZ6 A;  2VNU D;  1B50 A;  4HMI A;  4WJ4 A;  4I65 A;  2ZTE A;  3GTK H;  4JOI A;  1EU4 A;  5CBE E;  2JA9 A;  2JSO A;  4HR7 B;  5IWA L;  1TKW B;  3KF8 A;  3M4O B;  1XMQ L;  2Q8T A;  1E0B A;  2XGT A;  4DNT B;  5IYB G;  4CKC A;  1STB A;  4P2C B;  1AW7 A;  1NJI C;  4DR4 Q;  2DUD A;  3KBG A;  1EYA A;  3QB3 A;  1TS5 A;  4X66 Q;  2VS1 A;  3GTQ B;  2XRQ D;  5M5W H;  2EIF A;  1ET6 A;  3KDF A;  4QY7 A;  1E1O A;  4A3K B;  1NMF A;  2A19 A;  3U9O A;  1BCP C;  3VR6 A;  1E2Z A;  2NBF A;  4A3L H;  1NAP A;  4B3R L;  3ER0 A;  4X62 L;  2F0P A;  5J3B A;  4C1N K;  1CK1 A;  3RZO B;  1VQG A;  5CV7 A;  1HNX Q;  2O4X A;  1HR0 L;  3WDN A;  4G7O C;  2N55 A;  2H4O A;  1MD2 D;  4IPC A;  1VCI A;  1EYD A;  2PNR C;  3NBI A;  4F8M A;  2E5L Q;  3J7Z C;  1LTG D;  3SHL A;  4IUT A;  3RLF A;  3I70 A;  5IYC H;  1GVP A;  1B9N A;  2E76 C;  1PTO H;  2YU9 B;  1Y1V H;  4AIM A;  2KED A;  1I4X A;  1YIJ A;  3O13 A;  4KI0 A;  3HOY B;  1M1K C;  3L0O A;  4LUO A;  1JC7 A;  3PQI A;  2B2V C;  2XWJ B;  4LF5 L;  1JIC A;  1F9P A;  4RHR A;  1PYS B;  3HEJ A;  3SXH A;  4DXF A;  3DEO A;  3NTH A;  1IYU A;  3NK9 A;  3PSI A;  1PRT B;  4R9W A;  2JA6 G;  1H9S B;  2GVA A;  1E3P A;  1KAA A;  3G48 A;  3VR3 A;  1EY9 A;  2VUM H;  2ZT9 C;  1K0R A;  1I3Q B;  2KCM A;  4K8I A;  1NCV A;  3VYU A;  3OWF A;  1A2T A;  1OXS C;  4QF4 A;  2A1A A;  4IUV A;  4LW1 A;  1GUN A;  4MHE A;  2OTL A;  2JQO A;  1PFM A;  4WJW A;  5F2D A;  2ZXR A;  4FO2 A;  2I46 A;  4HMJ A;  2NVT B;  4QCL A;  1LTB D;  4C3I B;  4JI4 Q;  4YY3 Q;  2ATW A;  1A2U A;  4YCU A;  1UUP A;  4WRD A;  1CZW A;  3F2U A;  3BYT B;  4K2K A;  1QNU A;  2MNA A;  5EPL A;  4BY1 H;  4JI3 Q;  1D5X C;  3CME A;  1X3E A;  1Y1W B;  4DV4 Q;  3S16 H;  2N88 A;  3J81 L;  1SBB B;  5D65 A;  2KA7 A;  3SGI A;  1PMR A;  5ELF A;  4A75 A;  4DAY A;  2BOS A;  5NUC A;  1WI5 A;  1Z47 A;  4A93 B;  4RA8 A;  1TWC H;  1B9M A;  2XNA C;  5CV8 A;  1M8A A;  4G7H C;  1LT6 D;  3F2B A;  3GTG B;  1VQC A;  3BDL A;  4EGV A;  4JI1 Q;  5JOB A;  2DJF C;  4Y7N H;  1EEF D;  4IUP A;  2R7D A;  2CW0 C;  1EIF A;  2NZO A;  1SYF A;  5I2Y A;  4KD3 A;  4HJ5 A;  1L1O A;  4IAL A;  4DAP A;  1S5E D;  3CD6 A;  3I55 A;  4V0B A;  4ZRZ A;  2IL8 A;  1A6X A;  2H5X A;  4XYO A;  5CV5 A;  1FYC A;  1VQE A;  3VYR A;  2PQA B;  1GUW A;  2BCO A;  3D4D A;  3I2Z A;  4K8J A;  2NUC A;  1HXY D;  4IUN A;  1PFN A;  2UXB L;  4LF8 Q;  1FGB D;  1CQV A;  1N33 Q;  2I5L X;  2JA8 H;  1IBK Q;  3GTM H;  3TS2 A;  4IQZ A;  4A3J H;  1RTO A;  4L5S A;  2XSC A;  1Q46 A;  1AH9 A;  4B3T Q;  2FFK B;  4NXM L;  4BBR H;  5IOC A;  3C3L A;  1SLJ A;  1ML0 D;  1VQH A;  4DK1 A;  1WD0 A;  2UUB Q;  3GTP H;  4QJF A;  3OW7 A;  4ILW A;  2YYZ A;  3AMU A;  5DM7 3;  4JI7 Q;  1PH7 A;  4A3F H;  1JMC A;  1KNE A;  4LF6 Q;  4DPG A;  3QJY A;  2PI2 A;  4O0A A;  1L0X B;  4B3S L;  1XNQ Q;  4RGT A;  5IP7 G;  3K7U C;  3TBI B;  4FYD A;  2VZA A;  5C4Z A;  1UAP A;  4ZKC B;  3S2H H;  1V1P A;  1SEB D;  1ONL A;  1HZA A;  1RTN A;  1YNN D;  2NZH A;  4A3K G;  1QZG A;  3K7A H;  3FMC A;  4IO9 A;  4GLV B;  1LO5 D;  1WCM H;  2BH2 A;  2NWG A;  2DN8 A;  3RZD H;  3RMH A;  4A3D H;  3EA6 A;  4CBV A;  1WTV A;  4RFB A;  1JOR A;  4ME3 A;  2H1E A;  2KEE A;  2MO1 A;  4K5V A;  5FLX c;  2BH8 A;  4CHT B;  1TY0 A;  5EPJ A;  4GOP B;  2UXC Q;  1K0S A;  1TII D;  3F1Z A;  5E1F A;  4CKE A;  2QIL A;  5C5L A;  4H13 C;  4JI0 L;  3VDY A;  3PO3 B;  4DA2 A;  1E2W A;  3T13 A;  3HOY G;  4O1N A;  4DV2 L;  1EYG A;  3STB C;  2JA8 B;  3GTM B;  1FNW A;  2R6G A;  2J4X A;  4X6A H;  3QWN A;  5BN3 A;  1EFW A;  5C44 B;  3EN2 A;  3A0J A;  4K6D A;  4Q0F A;  3CC4 A;  3CC7 A;  4POG A;  3M4P A;  2GVB A;  2ICE C;  3K81 C;  4RGO S;  4Y52 H;  2A68 D;  3SE0 A;  3K0X A;  2D5D A;  3A8K E;  2DNC A;  1RDP D;  3PO2 H;  1Z6H A;  1EOT A;  4RH6 A;  4P72 A;  4O42 A;  3MXN A;  1KQS A;  2ZJQ A;  2R93 B;  3K5M A;  2Z6B A;  1EZ6 A;  1X65 A;  3R3O A;  2K03 A;  2E2I H;  3GV6 A;  1XMQ Q;  2B63 H;  1DM0 B;  4DR6 L;  4C3I G;  3HOZ H;  4HID A;  1QWY A;  1EUJ A;  5EJW A;  1JWM D;  4JBK A;  3G6J B;  5FLX E;  5LMN L;  5EGT A;  4A3D B;  1AN8 A;  3KDF B;  3J80 i;  3D4R A;  1RD9 D;  2NVY H;  2ZJP A;  1Y1W G;  2SDF A;  4QL5 A;  3N52 A;  1BUV T;  3MC0 B;  2V1C C;  2BDN A;  3F8T A;  1VQ4 A;  1HNX L;  3H3V C;  3J80 E;  2AQ3 B;  4U68 A;  1DYQ A;  1E2V A;  2F0G A;  2LFN A;  1SXT A;  1PH3 A;  4BBS B;  2F0Q A;  2SNM A;  5CR3 A;  4A93 G;  3MZ5 A;  1PTO F;  5DNF A;  1N9W A;  2F0K A;  3ULL A;  4CGY B;  5FOB B;  4RMF A;  4ZQ3 A;  3K5N A;  4HJ7 A;  2E5L L;  5EBD A;  4HJA A;  5IGG A;  5IP9 H;  5M3F H;  2F0M A;  2A6E D;  4UP8 A;  1VQA A;  3DWQ A;  1TT2 A;  5LMU Q;  1KD1 C;  2HIV A;  4JI8 L;  2EVB A;  2R7Z H;  3KLR A;  4LF5 Q;  4S3S A;  5C4H A;  1ASZ A;  4LF4 Q;  1JCK B;  1K3R A;  5KND A;  1F9S A;  3RUZ A;  4QIW B;  2PYK A;  3I4M H;  3HOX H;  2F0I A;  4JBJ A;  5EPK A;  4BXX H;  2CH4 W;  1VQ7 A;  2PPB C;  3KYH C;  2CFM A;  2IX1 A;  5EQ0 A;  1KDC A;  2K5H A;  2B8G A;  4F7X A;  4R4Q A;  2AKW B;  3DEP A;  1IW7 C;  4POF A;  2FHT A;  3GV3 A;  4JI6 Q;  1TWF B;  4YWM A;  1KDA A;  4YCW A;  4IFD G;  1SNM A;  3NQT A;  2JA7 H;  3CPW A;  1FR3 A;  1TWH B;  4JI4 L;  1EOV A;  1J6Q A;  1QG7 A;  4ZUJ A;  1TWA H;  1JWS D;  1V1Q A;  3OSO A;  3Q0A A;  1N8R C;  4MIU A;  4QIW E;  2HDM A;  4JI3 L;  2AQ1 B;  2ASB A;  4P73 A;  1SNQ A;  4FNF A;  5KIX A;  2L11 A;  2OQ0 A;  5M3M H;  1WTR A;  3I7F A;  2JE6 I;  2IWH A;  2DY7 A;  5CV4 A;  1R4P B;  4YCV A;  5I9P A;  4L5R C;  4ZAI A;  4DAM A;  5M5X B;  3X3M A;  4KY7 A;  4A3E B;  3IFT A;  3NHH A;  5IGC A;  4DR5 Q;  1EQT A;  2YV5 A;  1SJH D;  4DV0 Q;  2NVQ H;  3GD7 A;  4KLK A;  1JOO A;  3M3Y B;  4HCS A;  2PW7 A;  4UP7 A;  3U4V A;  1AE2 A;  2MQH A;  4ZCK A;  3NPP A;  5JJL A;  4MZ9 A;  3VYS A;  2RBM A;  1TWG B;  5KGU A;  3UDX A;  3I4N H;  3G4S A;  3PO3 G;  4EVO A;  4GN3 B;  2K01 A;  2M2L A;  1WTW A;  1LT5 D;  2MFI A;  3T56 B;  1L1O B;  4X3T A;  2JA8 G;  2YTY A;  4IZ8 A;  4B3M L;  1AP0 A;  1Y8N B;  1CKM A;  5KYI A;  5C44 G;  1X3Q A;  3AFQ A;  4JG2 A;  1V1O A;  5JEA G;  1EWH A;  3PUZ A;  1V43 A;  4KMU C;  2OTJ A;  4TQU S;  5JPN C;  4A3I H;  2UXB Q;  1A62 A;  2AQ2 B;  4DKA C;  4M1U B;  1N33 L;  5FLM H;  1XMO Q;  4X65 L;  1BBU A;  3ND8 A;  4LF9 Q;  1RHP A;  3QOL A;  1WOC A;  4CDD C;  1KIX A;  1XWE A;  4RHS A;  4B3T L;  5KNC A;  2LS0 1;  1TWA B;  4NXM Q;  3FPP A;  4LMQ D;  4GLA C;  5IGE A;  2R93 G;  2F0D A;  5ELC A;  1YJ9 A;  4LF6 L;  1MGS A;  3C1E A;  1SFO H;  2WP8 J;  4I7Z C;  3ND9 A;  2PCF B;  2PNH A;  4DR2 L;  2KHJ A;  1XNQ L;  4OHJ A;  1YNN C;  3UDF A;  3NXW A;  3I91 A;  4JBM A;  1JQY D;  2KJX A;  1VQP A;  1TS2 A;  3PIO A;  4L6T B;  3HOW H;  2L4N A;  1V1P B;  4LUZ A;  2E74 C;  3KF6 A;  3V05 A;  3S1M B;  1K83 H;  3HKZ E;  3CAM A;  4I7A A;  2D2C C;  5CMD A;  2DNE A;  5A35 A;  4G57 A;  4X3S A;  3CQZ H;  4RGN A;  1F2L A;  3GTL H;  1VS0 A;  4G4K A;  1N32 Q;  2RDG A;  3FPU B;  3BJU A;  1HZ9 A;  4BBS G;  4KK7 A;  1NR4 A;  2LXJ A;  3E9H A;  1HFN A;  1IKM A;  2UXC L;  2KHS A;  3U4Z A;  1AZP A;  2A69 C;  3MAQ A;  2VY3 A;  1BF4 A;  1YHA A;  1LYL A;  2PI2 E;  5C0X I;  3UI2 A;  4GNX C;  2EY2 A;  1STH A;  2G9H D;  2OXP A;  4HN7 A;  3P7J A;  3DM3 A;  4H44 C;  3W3A A;  4A3M B;  4DV2 Q;  3CP0 A;  1EU3 A;  1P16 A;  3E6Z X;  2CKZ B;  2IJ0 A;  4KD4 A;  3U50 C;  4QMG A;  1I50 H;  4ULL A;  2C5C A;  5KNB A;  3G6E A;  2EOT A;  1K8G A;  2NB0 A;  1L0W A;  4XXE A;  3FKI B;  3CCE A;  4DR3 L;  4JBW A;  2AMC B;  2JA5 H;  3S1N H;  3TDQ A;  4GKK L;  2VQE Q;  1GXD C;  1R4Q B;  3GTJ H;  3OYY A;  1SMY C;  2P5Z X;  3MXN B;  1JJ2 A;  1N34 L;  1QOH A;  3HOV B;  3J7A V;  5IYD G;  2B2U C;  3F2D A;  4HCE A;  1BCP F;  1K83 B;  1HJP A;  4DK3 C;  1CKN A;  4DR6 Q;  1BR9 A;  1TS3 A;  3MFG A;  1BKB A;  4EQ5 A;  1XPO A;  1D1K A;  3S14 H;  3ERQ A;  1J8I A;  1A3V A;  1E7Z A;  1Y8O B;  4KHP Q;  5LMN W;  5LMN Q;  3GTL B;  3J81 c;  2D0P A;  1BOS A;  4MTN A;  3A8J E;  3P20 A;  5LHY 1;  3QR8 A;  3SK4 A;  1HNZ L;  2ENB A;  4NP5 A;  4C1N I;  3S1R H;  2Z4H A;  1B1Z A;  1PRT D;  2X6G A;  4C3H H;  3S2D H;  3H3V H;  1SNC A;  2Q2I A;  1HQR D;  4M8A A;  1LTL A;  1QB5 D;  4UPA A;  4DV6 L;  4NXN L;  1SE4 A;  2V4D A;  1TR5 A;  4A3E G;  3MXG A;  5IT9 c;  2UXD L;  3C2P A;  3JC6 6;  1K73 C;  2F3W A;  2A6E C;  1KXL A;  4B9W A;  1MIU A;  2HCI A;  1S72 A;  1CQF A;  3ULP A;  2AUJ D;  2A6H C;  4MNO A;  3F2C A;  4DUZ L;  2K32 A;  3PF5 A;  3TP5 A;  3K8A A;  4JI2 Q;  2CWP A;  1ESR A;  3IFD A;  2B2Y C;  4LK1 C;  4FXD A;  4ZUI A;  2EYL A;  5I6W A;  2AHO B;  2RHQ B;  5LMU L;  1A0I A;  3KBX A;  2LKV A;  4JI8 Q;  4C3J B;  1B53 A;  2F3V A;  2I0Q A;  2O5J C;  3VA5 A;  1PV4 A;  1ZKO A;  1EEI D;  4LF4 L;  4TRD A;  1MKH A;  2G9D A;  4DV7 Q;  5IY0 A;  4H7B A;  1B2T A;  2SEB D;  4PV1 C;  4JW0 A;  3GTK B;  2B2U A;  2GN5 A;  2ID0 A;  5KEE A;  5K36 H;  4PMB A;  5IIF A;  3HG9 A;  4LFA Q;  2XIW A;  1PH2 A;  2IT1 A;  2MUY A;  4XDX A;  2RKS A;  3BZC A;  2JP1 A;  5C0X J;  4JI6 L;  1IXR A;  5I2X A;  3H0G H;  4DUY L;  1F2M A;  3K5O A;  5M5W B;  2RSN A;  4A3G G;  5D3I B;  2NZ1 D;  5C0X G;  3ERS X;  4RGM A;  2NN6 G;  2A74 C;  4G7Z C;  3J81 j;  3WOF A;  4EQP A;  1O78 A;  1YJN A;  2AWO A;  3LGJ A;  1PH8 A;  1DGS A;  1BBX C;  3S2D B;  1NMG A;  3Q23 A;  5IT9 E;  2E2J H;  3HS0 C;  4N9T A;  2K14 A;  4BWG B;  1BVS A;  3ZYY X;  1B3Q A;  1G8Z D;  1YZ6 A;  2EYO A;  1VQM A;  1D1I A;  3MTS A;  2GA4 B;  3UE1 A;  4J1M A;  1OO9 B;  1S5C D;  2HUG A;  5G3L D;  3VR2 A;  2B2Y A;  3S24 A;  2F03 A;  2WAC A;  2F52 A;  4H02 A;  3I72 A;  1LLR D;  3QOJ A;  4JI5 L;  3SK6 A;  1CUK A;  1PTO B;  1Y1V B;  4RKL A;  5FJ8 H;  2B2V A;  4DR5 L;  3MFY A;  2IY5 B;  4PZ7 A;  4DV0 L;  1HHV A;  4DN4 M;  5J1Z A;  1WVL A;  1Q3L A;  1JOK A;  3D6C A;  4C2M H;  2OQK A;  1ZYR D;  1EY4 A;  2E2H H;  3NQI A;  1HFG A;  4NKL A;  2DY8 A;  1KL9 A;  1B4O A;  1J5E L;  3S9W A;  2VUM B;  1FNU A;  1SYD A;  4BY7 G;  1JT8 A;  3LWU A;  4DGZ A;  3M7N A;  4FXK C;  4R4O A;  1HA6 A;  1QNK A;  4A3M G;  3PUY A;  3QIA A;  1Q82 C;  2F0E A;  4A3B H;  1STA A;  4OL7 A;  4B3M Q;  4RWS C;  3P1H A;  2SNS A;  4LNQ A;  1XNR Q;  5EKI A;  2O5I C;  2BA1 A;  2FMM A;  4DU9 A;  3FKI G;  1W6J A;  1XMO L;  3H6M A;  4R4C A;  4ZKB B;  4X65 Q;  4LF9 L;  4O2D A;  3Q6S A;  3E0E A;  1HRJ A;  3RD4 A;  2PW5 A;  5HUR A;  1KNA A;  4XT1 B;  2R92 H;  4JPB W;  3Q8D A;  2EY5 A;  1C9O A;  1VQD A;  3HOV G;  2ALY B;  5FKA C;  3NP8 A;  1II3 A;  4BY1 B;  2R61 A;  1HPC A;  3S16 B;  3OTO Q;  1PFB A;  3OWE B;  4DR2 Q;  3KJP A;  2K7V A;  2L12 A;  2VW9 A;  2BE5 C;  3CCV A;  1KAW A;  4L5Q A;  4R8N A;  3CCM A;  2EPB A;  4EX5 A;  3AQQ A;  4JCV E;  3J7Y W;  3OW2 A;  3CC2 A;  4LF7 L;  2M9V A;  2YTV A;  1NY4 A;  3I56 A;  1TWC B;  1MBY A;  3KF6 B;  3PCO B;  2CQA A;  1S40 A;  1DOM A;  1I4Q A;  1C0A A;  1SRU A;  1UNS A;  1AZQ A;  3FHW A;  1I5F A;  4C2M B;  4ZK9 B;  1F2Y A;  3ERO A;  3RN2 A;  1N32 L;  3KLS X;  2E2H B;  4HJ8 A;  2WV6 D;  1ICF B;  2JJQ A;  1H95 A;  4Y7N B;  1HUN A;  4LFB Q;  4A76 A;  4R8I A;  5BN4 A;  1Q1B A;  4OO1 H;  2VXW A;  3D31 A;  2K05 A;  5J39 A;  5C3E H;  1QIL A;  1D2B A;  1TVX A;  5JPM C;  4R4I A;  4IFD I;  1CSP A;  5C4X H;  4ZYS A;  4QUF A;  3T4A C;  3A5U A;  5EBC A;  1E1T A;  4P71 A;  3HOU H;  1NUC A;  2MGS A;  5LL6 X;  1Q1E A;  4XIG S;  3K5L A;  1GUS A;  2D0O A;  4C3J G;  4APV A;  4A3J B;  2QDL A;  1IZ6 A;  1A15 A;  4A3C H;  1RIP A;  1IBM L;  3HFZ B;  2R3Z A;  2Q2T A;  3J7A F;  3VR4 A;  1EY7 A;  2RA4 A;  4BBR B;  4JVZ A;  4DK0 A;  5FO8 B;  3GTP B;  1S5B D;  1YI2 A;  4OX9 Q;  4XQJ A;  2OWO A;  4DR3 Q;  1ET9 A;  3UDI A;  5HGQ A;  4FDB A;  4A3F B;  1EFI D;  2VQE L;  4GKK Q;  2LY7 A;  5BN5 A;  1PFS A;  5ISR A;  1UEA B;  3D0F A;  1OXX K;  1JR0 D;  1N34 Q;  2KQ3 A;  3AFP A;  1GUO A;  1X32 A;  1X6O A;  4PMW A;  3S2H B;  1G29 1;  1A3T A;  2F0W A;  2ICI A;  4HED A;  4KY5 A;  3TP8 A;  3K7A B;  1IHZ A;  3KF8 B;  4A3L G;  5M5Y H;  3KOJ A;  1WCM B;  1DCZ A;  1CKN B;  1EWI A;  3CMA A;  3E3X A;  3RZD B;  2NTT A;  3M85 A;  4KHP L;  4RAU C;  3V96 A;  2PZU A;  5I9O A;  3OPO A;  3GTO H;  1HNZ Q;  1QUQ A;  3V2T A;  1RL2 A;  3R2T A;  4DFA A;  3FEW X;  3BZK A;  2F0S A;  4DV6 Q;  4NXN Q;  1EIG A;  3DWP A;  5IYC G;  1ASY A;  1WYD A;  1Y1V G;  2UXD Q;  3S1Q H;  4IUQ A;  4AYB E;  1YJW A;  5K5P A;  4J8Q A;  3I8Z A;  1B70 B;  5LL6 S;  5IYB H;  1OXT A;  1VQO A;  1PA6 A;  1B3A A;  3CRK C;  4DUZ Q;  4JI2 L;  1M90 C;  2JEB I;  4ODG A;  1ILQ A;  4DNI A;  1HTP A;  1CI3 M;  1LAB A;  1YHQ A;  2PO4 A;  1AE3 A;  1MSH A;  2FJ2 A;  2XTI A;  3AYH B;  1PH4 A;  2VUM G;  3NEN A;  1C4Q A;  5IE8 A;  4DV7 L;  4DR1 Q;  3PO2 B;  2EJG C;  5IGF A;  1I94 L;  4IOC A;  4GZY C;  3JAM c;  4DAV A;  1D8L A;  1F9Q A;  4IPG A;  3VA7 A;  2RSO A;  1ENA A;  3E0J A;  1JB3 A;  1T9H A;  5FLX L;  3CF5 A;  2WB1 E;  3CXC A;  5AFW A;  1CHP D;  3R8B A;  1VDZ A;  2QA4 A;  2E2I B;  5J22 A;  4TVA B;  2F3I A;  4LFC L;  1PH9 A;  1K8A C;  4LFA L;  2L5T A;  4IFD J;  1WJJ A;  4K14 A;  2B63 B;  4HTH A;  1KTK A;  5ELO A;  4U67 3;  3T1H L;  3J80 L;  3HOZ B;  1JOQ A;  4GN4 B;  4DUY Q;  1BCP B;  3PUW A;  4X3K A;  5G3L F;  1PYW D;  3BG3 A;  4BY1 G;  4FXG C;  1HZB A;  2NVY B;  2HHH L;  1CM9 A;  3TRZ A;  1MJC A;  3MWY W;  3VR5 A;  3CCS A;  2JA6 H;  1ZEQ X;  5GAE C;  2K4K A;  3RNU A;  3BVM A;  2EY1 A;  3M4Y A;  1NE3 A;  1GHJ A;  2RF4 A;  1DOK A;  2VL6 A;  5L37 A;  4L63 B;  4DV1 L;  1SDF A;  2FIN B;  3JAM i;  5M3F B;  4AQY L;  1ZXT A;  4DAY B;  3RN5 A;  4UDU C;  4JI5 Q;  1SYB A;  2WIN B;  3HZX A;  1D5M C;  3FP9 A;  3GDE A;  3JAM E;  2XRS D;  4UHV A;  1N36 L;  1ZYR C;  5JVG 3;  2R7Z B;  2OF1 A;  2F0T A;  2B29 A;  1DOL A;  4LWC A;  2K52 A;  4XQN A;  3I4M B;  3HOX B;  1I6H H;  2F0N A;  5KYL A;  5D3D A;  3EQL C;  4QUC A;  3FVQ A;  1D5Z C;  1J5E Q;  1O7L A;  2N8N A;  1X3P A;  4KJO A;  4ME5 A;  2F4V Q;  1F77 A;  3W5O A;  5JEA J;  2EQS A;  4IJL A;  3A7L A;  4A3J G;  3A56 A;  3L3O C;  1OXU A;  1XNR L;  2HDL A;  5A2Q E;  2X6L A;  3D4W A;  2B2T C;  3HKZ B;  3TS0 A;  4BBR G;  2JA7 B;  4CJ0 B;  2F0L A;  3G71 A;  3A55 A;  4A3F G;  1JB7 A;  2M00 A;  1DON A;  1AFP A;  1GOZ A;  3CCU A;  3E5S A;  1E22 A;  4CDC C;  3GP7 A;  3AU7 A;  3S15 H;  1XYI A;  1BQQ T;  4K5X A;  2DGY A;  4JV5 L;  3BVZ A;  4OIJ A;  3S17 H;  4GOP C;  2CW0 D;  2KCC A;  3I90 A;  4DNR B;  3GO5 A;  3IL8 A;  1Q86 C;  5FO9 B;  5EKK A;  3W1G A;  4PZ8 A;  3H15 A;  1EIH A;  1LUZ A;  5M3M B;  2EXZ A;  2K1B A;  3OTO L;  4KTA A;  1FNV A;  1WCM G;  3LWE A;  5C4J H;  1I4P A;  4A3D G;  3SDZ A;  1YVC A;  3IAY A;  4KKS A;  4LF7 Q;  1ILP A;  2MJ8 A;  4YHH L;  3NBH A;  4HJ9 A;  5ELE A;  1C8C A;  2NVQ B;  2QEX A;  3CCQ A;  2Q8I B;  4K0K Q;  1SAP A;  1EWC A;  1Z9F A;  1YBY A;  1EY8 A;  1GUG A;  4DV3 L;  1SYC A;  1X3G A;  1B8A A;  2WFW A;  1GUT A;  3NWS A;  4LFB L;  3I4N B;  1K8M A;  2JXM B;  3NEL A;  1PLF A;  4NB3 A;  3TP6 A;  1BNZ A;  3L2P A;  3M4O H;  2NYZ D;  1IYV A;  2B3G A;  2IHF A;  2EYP A;  4DK6 C;  5IP7 H;  3SEB A;  3C46 A;  2NN6 I;  3GTQ H;  1SYG A;  2I5M X;  2VQF Q;  3OMC A;  1O7Z A;  1SSO A;  4A3K H;  4JYA L;  1L2F A;  1YNJ D;  4A3I B;  2F1M A;  3LNN A;  2OCE A;  2Z1C A;  4WJ3 M;  1U4R A;  5FO7 B;  2A68 C;  1WTO A;  3BDC A;  3PO2 G;  4NW2 A;  4FVM A;  1KDB A;  4N8F A;  4GOP A;  4FF3 A;  1IBM Q;  2HIX A;  4R1J A;  1YNX A;  1VQB A;  3A74 A;  4K5W A;  4OX9 L;  1OXV A;  3L7Z C;  3K58 A;  2WKC A;  1K3B C;  1SFO B;  1BBW A;  2HCC A;  3H91 A;  1FD7 D;  2B63 G;  3N6R A;  3DWA A;  4OXP A;  3HOZ G;  3E9I A;  1XTC D;  3EFX D;  1VMC A;  4P74 A;  3C1F A;  3MEF A;  3KK7 A;  2YU9 H;  3HOW B;  3HOY H;  4DR7 L;  4IJH A;  3HRZ C;  3MXP A;  2Y0S B;  1VQ5 A;  3BU2 A;  1VQ9 A;  1TY2 A;  3T51 B;  2BDO A;  4WFN 3;  3TEH B;  1DZ1 A;  1AEX A;  3CQZ B;  4QB4 A;  2K5D A;  4BA1 I;  1S5F D;  1I3Q H;  1PHJ A;  1L0Y B;  4BA2 I;  3T1Y Q;  3NSW A;  3NTI A;  5H1S E;  4N8X 1;  1QUQ B;  4OON A;  1ENC A;  1Y14 B;  4NDX A;  2CHB D;  1GHK A;  3R2I A;  5COR A;  4GNX A;  3PGZ A;  1U0L A;  5M3F G;  2B2W C;  5IP9 G;  1BO0 A;  1M4V A;  3BVG A;  4DF7 A;  4KY6 A;  2ES2 A;  4PMC A;  2K5V A;  1CHQ D;  1NR2 A;  2Z9H A;  1DXM A;  4FF2 A;  3EVQ A;  4HIM A;  2NVT H;  3PIO 3;  2R7Z G;  3T53 B;  4C3I H;  1LAC A;  1Z7T A;  1H9J A;  1KC8 C;  1PH1 A;  3BDO A;  1I50 B;  2Y0S E;  1PZK D;  1UE7 A;  3NEM A;  3HOX G;  2QCP X;  3I4M G;  5CC4 A;  3J7A 5;  2EDG A;  2VB3 X;  3OMG A;  4BXX G;  1G6P A;  1LTT D;  2Q8R E;  1Y1W H;  1XPR A;  2JA5 B;  4KKU A;  3D8G A;  5COY A;  4DR1 L;  3S1N B;  5ELD A;  2JN4 A;  3PUX A;  1I94 Q;  3GTJ B;  5BR8 L;  3EJI A;  1Q7Y C;  1C7Y A;  1JJC B;  3NTK A;  4GKJ Q;  3TP7 A;  3HKZ G;  3J81 i;  2JA7 G;  4A93 H;  2RCF A;  1XJV A;  2K5N A;  1GO3 E;  3FRP B;  3CCR A;  4LFC Q;  1I6V C;  4CKB A;  1LT3 D;  1KLG D;  1WFQ A;  1NBW A;  3J81 E;  1KHI A;  1S4Z A;  4PQX A;  4IOA A;  3GTG H;  3T1H Q;  4AH6 A;  1PTO D;  3S14 B;  4K6L A;  1NNX A;  2EJF C;  1KRT A;  3TRE A;  1J9O A;  1YIT A;  3TN2 A;  2AWN A;  1V8Q A;  1HH2 P;  2Z8L A;  1EYC A;  1EIY B;  2CVR A;  2ZTD A;  5M3M G;  1EQR A;  3S1R B;  2F0J A;  2HHH Q;  2J7Z A;  4C3H B;  1LTS D;  2B2W A;  1VQF A;  1L1O C;  5HY6 A;  1GD7 A; 
#chains in the Genus database with same CATH homology
 1Q1E A;  3EIV A;  3RZO H;  4XIG S;  3RLN A;  3ZJY C;  2L15 A;  2ZTC A;  1GM5 A;  4JI4 L;  2CWA A;  1EOV A;  1A8V A;  3CW2 C;  2D0O A;  1J6Q A;  1VQI A;  4APV A;  1TWA H;  2HT1 A;  1V1Q A;  1YHB A;  4JI0 Q;  1N8R C;  1IZ6 A;  4A3C H;  2PMZ E;  1RIP A;  3M4Q A;  1IBM L;  3HFZ B;  2UUC Q;  2Q2T A;  4QIW E;  3KFU A;  4JI3 L;  4DV1 Q;  2ASB A;  1CSQ A;  2Z0S A;  2C35 B;  4P73 A;  4AQY Q;  3B6Y A;  5M3M H;  2OQ0 A;  1YI2 A;  4OX9 Q;  2OWO A;  3I7F A;  4DR3 Q;  2JE6 I;  4A4I A;  3UDI A;  1CKO A;  4FDB A;  5HGQ A;  3I4N G;  1X3F A;  4DV5 L;  2VQE L;  3K80 C;  4YCV A;  3STB D;  1N36 Q;  1IBL L;  1FJG Q;  4GKK Q;  4J15 A;  1I94 L;  4L5R C;  1UE1 A;  1PFS A;  4DAM A;  3CPF A;  3D0F A;  4C3J H;  1OXX K;  1N34 Q;  3AFP A;  3KLW A;  2N49 A;  4DR5 Q;  1X6O A;  4PMW A;  2YV5 A;  4DV0 Q;  1G29 1;  3GD7 A;  2NVQ H;  4PZ6 A;  4KLK A;  2VNU D;  4UP7 A;  3U4V A;  4WJ4 A;  1FL0 A;  1AE2 A;  2MQH A;  3KF8 B;  1HNW Q;  2ZTE A;  4A3L G;  5JJL A;  5M5Y H;  3CCJ A;  3KOJ A;  4JOI A;  4MZ9 A;  4A3I G;  2F4V L;  4HIO A;  3GTK H;  2LXK A;  3CMA A;  1CKN B;  1EWI A;  2JA9 A;  3H3V I;  3UDX A;  1KRS A;  5FLM G;  3I4N H;  4QQB X;  5IWA L;  1AH9 A;  3M85 A;  1XMQ L;  4KHP L;  2XGT A;  3G4S A;  3PO3 G;  5IYB G;  4GN3 B;  3I4O A;  2MFI A;  5AJ3 L;  1L1O B;  2JA8 G;  1NJI C;  1OTC A;  2DUD A;  4DR4 Q;  2YTY A;  4B3M L;  3GTO H;  1HNZ Q;  4X66 Q;  2VS1 A;  1QUQ A;  5GAG C;  1RL2 A;  1CKM A;  5M5W H;  2EIF A;  5C44 G;  3AFQ A;  3KDF A;  4JG2 A;  1E1O A;  4QY7 A;  1NMF A;  2A19 A;  5JEA G;  3BZK A;  2K50 A;  4A3L H;  3PUZ A;  1V43 A;  4B3R L;  2KCT A;  1X9N A;  2OTJ A;  4TQU S;  2UXB Q;  4A3I H;  4DV6 Q;  1A62 A;  4NXN Q;  4DKA C;  5IYC G;  3ER0 A;  1N33 L;  4JV5 Q;  4X62 L;  1ASY A;  1VQ8 A;  1WYD A;  5J3B A;  4X64 Q;  1Y1V G;  5FLM H;  1XMO Q;  4OWX B;  4X65 L;  1BBU A;  3S1Q H;  2UXD Q;  1V9P A;  4AYB E;  1YJW A;  3RLO A;  4LF9 Q;  1VQG A;  1WOC A;  1HNX Q;  3HOW G;  1B70 B;  1KIX A;  3PO3 H;  5IYB H;  1HR0 L;  4B3T L;  1OXT A;  1VQO A;  1R9T H;  4DUZ Q;  2Q2H A;  1PA6 A;  4JI2 L;  1M90 C;  4NXM Q;  3HOU H;  4GLA C;  2JEB I;  4DNI A;  3PIP A;  2R93 G;  1YHQ A;  2Y0S G;  4IPC A;  1AE3 A;  1VCI A;  5C44 H;  1W2B A;  2XTI A;  3AYH B;  1YJ9 A;  4LF6 L;  1SFO H;  2WP8 J;  2E5L Q;  1PH4 A;  3J7Z C;  2VUM G;  2UUA L;  2PNH A;  3RLF A;  4DR2 L;  2KHJ A;  1XNQ L;  3NEN A;  2ZM6 Q;  5IYC H;  1GVP A;  1U5K A;  3UDF A;  5IE8 A;  4DV7 L;  4DR1 Q;  4YHH Q;  4JBM A;  1Y1V H;  4AIM A;  1TXY A;  1QVC A;  3NBH B;  3PIO A;  4IOC A;  3JAM c;  1VQP A;  1YIJ A;  4K0K L;  1D8L A;  4IPG A;  2KHI A;  4KI0 A;  3EBE A;  3L0O A;  4LUO A;  5GAH C;  1M1K C;  4LF5 L;  3HOW H;  2RHS B;  4LUZ A;  2IHE A;  2UU9 L;  1T9H A;  3CF5 A;  3KF6 A;  2WB1 E;  3CXC A;  4DV3 Q;  1K83 H;  1G51 A;  1PYS B;  3HKZ E;  3CAM A;  2R93 H;  1VQL A;  2QA4 A;  3PSI A;  2JA6 G;  4TVA B;  2F3I A;  4LFC L;  1PH9 A;  1K8A C;  4LFA L;  2GVA A;  4IFD J;  1WJJ A;  1E3P A;  2R7F A;  3G48 A;  3CQZ H;  2VUM H;  5ELO A;  3T1H L;  3GTL H;  1K0R A;  1VS0 A;  1N32 Q;  5GAD C;  2KCM A;  3BJU A;  1HZ9 A;  4GN4 B;  3ULJ A;  4DUY Q;  1OXS C;  4BBS G;  2A1A A;  3PUW A;  2LXJ A;  3E9H A;  2WAQ E;  4LW1 A;  2VQF L;  4BY1 G;  2OTL A;  1HZB A;  4JYA Q;  2UXC L;  2Z6K C;  2HHH L;  3U4Z A;  2JQO A;  1X54 A;  3TRZ A;  1MJC A;  2VY3 A;  1YHA A;  1LYL A;  2PI2 E;  5C0X I;  3CCS A;  4GNX C;  5GAE C;  3RNU A;  2K4K A;  2JA5 G;  2JA6 H;  2MO0 A;  2E8G A;  1YEZ A;  1NE3 A;  3DM3 A;  4JI4 Q;  3UE0 A;  4YY3 Q;  3CP0 A;  2RF4 A;  4DV2 Q;  2ATW A;  4YCU A;  3RR5 A;  2VL6 A;  4KHZ A;  1P16 A;  2CKZ B;  2N3S A;  4BBS H;  2CCZ A;  3U58 A;  4XTC S;  3U50 C;  2HQL A;  2UUC L;  1I50 H;  2ZJR A;  1S3O A;  3J80 c;  4DV1 L;  3JAM i;  2MNA A;  1B7Y B;  3G6E A;  4BY1 H;  4JI3 Q;  1PVO A;  4B3T Q;  1K8G A;  4AQY L;  3CME A;  1X3E A;  1L0W A;  4DAY B;  3CCE A;  4DV4 Q;  3RN5 A;  3S16 H;  4DR3 L;  1PH6 A;  4JI5 Q;  4JBW A;  2AMC B;  2JA5 H;  3FP9 A;  3GDE A;  3S1N H;  3SGI A;  1N36 L;  4GKK L;  4DV5 Q;  4A75 A;  2VQE Q;  1FJG L;  4GS3 A;  3GTJ H;  3OYY A;  1VQN A;  1WI5 A;  3MXN B;  1JJ2 A;  1Z47 A;  4P75 A;  4DR7 Q;  1N34 L;  1D7Q A;  1SRO A;  1SN8 A;  1A63 A;  1TWC H;  2B29 A;  4LWC A;  1VQJ A;  2K52 A;  1I6H H;  5IYD G;  3F2D A;  1J5E Q;  2N8N A;  3F2B A;  1HJP A;  3W1B A;  4DK3 C;  1VQC A;  2F4V Q;  1CKN A;  4DR6 Q;  3W5O A;  4JI1 Q;  5JEA J;  1BKB A;  2EQS A;  3T1Y L;  4EQ5 A;  1XPO A;  4Y7N H;  4IJL A;  3S14 H;  4A3J G;  5IWA Q;  1E7Z A;  2R7D A;  1EIF A;  4KHP Q;  5LMN W;  2NZO A;  5LMN Q;  3J81 c;  1OXU A;  2D0P A;  1XNR L;  3TS0 A;  4HJ5 A;  1L1O A;  2JEA I;  4BBR G;  4MTN A;  4GNX B;  1TWF H;  4DR4 L;  3CD6 A;  3I55 A;  2Q2U A;  3PUV A;  1HNZ L;  4X66 L;  3S1R H;  2H5X A;  4C3H H;  3S2D H;  2Z6K A;  3G71 A;  5IYD H;  1VQE A;  3H3V H;  4A3F G;  2PQA B;  1JB7 A;  3TQY A;  1TWH H;  2Q2I A;  3I2Z A;  3PV0 A;  3CCU A;  1E22 A;  3S15 H;  1LTL A;  2UXB L;  4B3R Q;  4UPA A;  4DV6 L;  4LF8 Q;  4NXN L;  2DGY A;  4NXM L;  4JV5 L;  3S17 H;  1N33 Q;  2I5L X;  4GOP C;  4A3E G;  4X62 Q;  2JA8 H;  1IBK Q;  5IT9 c;  3GTM H;  3GO5 A;  3JC6 6;  1K73 C;  3TS2 A;  2UXD L;  1KXL A;  1Q86 C;  1MIU A;  1FVI A;  4A3J H;  1S72 A;  3ULP A;  3W1G A;  4L5S A;  4MNO A;  1Q46 A;  4PZ8 A;  3H15 A;  3F2C A;  4IPD A;  1LUZ A;  4DUZ L;  1SMX A;  1HR0 W;  3PF5 A;  1HR0 Q;  3K8A A;  3A5Z B;  4BBR H;  3OTO L;  4JI2 Q;  3DLL A;  1SLJ A;  2NVX H;  1UWV A;  1UEB A;  2CWP A;  1VQH A;  4UY8 C;  3PF4 A;  2UUB Q;  3GTP H;  4QJF A;  5K36 G;  1XPU A;  1WCM G;  2YYZ A;  4JI7 Q;  2AHO B;  3WWV A;  1PH7 A;  2RHQ B;  4A3F H;  5LMU L;  1JMC A;  1HZC A;  1A0I A;  4LF6 Q;  4DPG A;  5C4J H;  5BR8 Q;  2PI2 A;  4O0A A;  4JI8 Q;  1K9M C;  4A3D G;  2I0Q A;  1YVC A;  4LF7 Q;  4B3S L;  1GKH A;  3H0G G;  4GN5 A;  5M5X H;  1PV4 A;  4LF4 L;  1XNQ Q;  4RG1 A;  3K7U C;  5IP7 G;  4YHH L;  4HJ9 A;  1MKH A;  4A3E H;  4DV7 Q;  5E7N A;  5IY0 A;  2QEX A;  3CCQ A;  4YWL A;  2VZA A;  4K0K Q;  4OO1 I;  2D62 A;  1LM0 A;  3S2H H;  1Z9F A;  1P8L A;  1E24 A;  3M3Y H;  1YBY A;  5GRO A;  1HZA A;  4DV3 L;  2NZH A;  4A3K G;  1IYJ B;  1QZG A;  4GKJ Q;  1X3G A;  1B8A A;  2GN5 A;  2ID0 A;  3K7A H;  1PH5 A;  2WFW A;  4IO9 A;  4GLV B;  4LFB L;  1WCM H;  1Q12 A;  4LFA Q;  2BH2 A;  3NEL A;  1TWG H;  4NB3 A;  3RZD H;  1PH2 A;  2IT1 A;  4OWT B;  3L2P A;  3M4O H;  5JJI A;  3BZC A;  4A3D H;  5C0X J;  4JI6 L;  1IXR A;  2B3G A;  3M9B A;  1NTG A;  2IHF A;  3H0G H;  4DK6 C;  5IP7 H;  4DUY L;  4ME3 A;  4A3G G;  2WAQ G;  2MO1 A;  2NN6 I;  5C0X G;  3GTQ H;  2I5M X;  3ERS X;  5FLX c;  2NN6 G;  2VQF Q;  2BH8 A;  3J81 j;  1VQK A;  4A3K H;  4JYA L;  1L2F A;  5ELN A;  1SR3 A;  4GOP B;  2UXC Q;  3F1Z A;  4HIK A;  4LF7 L;  2OCE A;  4WJ3 M;  1YJN A;  2AWO A;  3LGJ A;  1PH8 A;  1DGS A;  1NMG A;  5FJ8 G;  2E2J H;  3PO2 G;  2K14 A;  4JI0 L;  2KBN A;  1BVS A;  3VDY A;  4GOP A;  1IBM Q;  3HOY G;  1X56 A;  1YZ6 A;  2HIX A;  4DV2 L;  4YY3 L;  1VQM A;  2I5H A;  1YNX A;  4R1J A;  4IPH A;  1VQB A;  3STB C;  1EYG A;  3ICE A;  3A74 A;  2R6G A;  4X6A H;  4OX9 L;  1EFW A;  4A3G H;  3UE1 A;  1OXV A;  2N78 A;  3A0J A;  3EN2 A;  1O7I A;  3L7Z C;  3CC4 A;  3CC7 A;  4GLX A;  3S24 A;  4L5T A;  4POG A;  1BBW A;  3K81 C;  2F52 A;  2GVB A;  3M4P A;  4H02 A;  1IBL Q;  5EAY A;  4Y52 H;  4DV4 L;  2B63 G;  4JI5 L;  1XTD A;  4OXP A;  1CUK A;  2FXQ A;  3E9I A;  3K0X A;  5FJ8 H;  4DR5 L;  3HOZ G;  4A3B G;  4P74 A;  2IY5 B;  4PZ7 A;  3MEF A;  3PO2 H;  1W3S A;  4DV0 L;  2YU9 H;  4P72 A;  3HOY H;  1QZH A;  4PG3 A;  4DR7 L;  1KQS A;  4IJH A;  2ZJQ A;  1HNW L;  3IRB A;  2IX0 A;  1IL2 A;  4C2M H;  1VQ5 A;  3BU2 A;  3S1M H;  1MJE A;  2OQK A;  1VQ9 A;  1QVF A;  2E2H H;  1X65 A;  1FGU A;  3TEH B;  2E2I H;  1KL9 A;  1J5E L;  4R4T A;  1XMQ Q;  4LUV A;  4BY7 G;  3M7N A;  1JT8 A;  2B63 H;  4R4O A;  4DR6 L;  4A3M G;  4JI1 L;  4BA1 I;  3PUY A;  3HOZ H;  1Q82 C;  2R92 G;  1I3Q H;  5AJ3 Q;  1PHJ A;  4A3B H;  4HID A;  4BA2 I;  3T1Y Q;  1EUJ A;  1JJG A;  4B3M Q;  5H1S E;  4JBK A;  1QUQ B;  4OON A;  3UDG A;  5LMN L;  1Y14 B;  2YTX A;  4LNQ A;  1JE5 A;  1XNR Q;  3KDF B;  4GNX A;  3PGZ A;  1U0L A;  3J80 i;  5IP9 G;  5M3F G;  2BA1 A;  2NVY H;  2ZJP A;  1Y1W G;  3FKI G;  4QL5 A;  2ES2 A;  4X64 L;  2K5V A;  2PQA A;  3HKS A;  4AYB G;  1XMO L;  2V1C C;  1PYB A;  4R4C A;  3F8T A;  4X65 Q;  3KJO A;  1VQ4 A;  1HNX L;  4LF9 L;  4O2D A;  3AEV A;  3E0E A;  4OWW B;  2R7Z G;  4HIM A;  2NVT H;  4BY7 H;  4LF8 L;  4C3I H;  4A3M H;  1X55 A;  1PH3 A;  2R92 H;  1IBK L;  3Q8D A;  1KC8 C;  1PH1 A;  3CCL A;  1C9O A;  1VQD A;  3HOV G;  1UE5 A;  4A93 G;  1N9W A;  2ALY B;  3ULL A;  2Y0S E;  2EXD A;  1UE7 A;  3NEM A;  3HOX G;  2KEN A;  4RMF A;  3I4M G;  1Q81 C;  3J7A 5;  4HJ7 A;  2E5L L;  4HJA A;  4BXX G;  5JJK A;  5M3F H;  5IP9 H;  3OTO Q;  1G6P A;  2UUA Q;  2UUB L;  1Y1W H;  4DR2 Q;  4UP8 A;  1VQA A;  3FKI H;  3KJP A;  2VW9 A;  2ZM6 L;  1XPR A;  1VQ6 A;  3CCV A;  4DR1 L;  1KAW A;  4JI7 L;  3PUX A;  1I94 Q;  4L5Q A;  5LMU Q;  2RCN A;  3CCM A;  4OO1 G;  4EX5 A;  4GKJ L;  5BR8 L;  1KD1 C;  2HIV A;  1SE8 A;  4JI8 L;  2R7Z H;  4LF5 Q;  3AQQ A;  2WB1 G;  4JCV E;  5C3E G;  3OW2 A;  1Q7Y C;  1C7Y A;  3CC2 A;  1JJC B;  2LSS A;  2YTV A;  1NY4 A;  4YWK A;  3I56 A;  2UU9 Q;  1ASZ A;  4B3S Q;  2K75 A;  3HKZ G;  3KF6 B;  3PCO B;  1K3R A;  3J81 i;  1S40 A;  4LF4 Q;  2JA7 G;  4A93 H;  5C4X G;  3HOV H;  1XJV A;  2K5N A;  1GO3 E;  3HOU G;  3CCR A;  1C0A A;  4LFC Q;  1SRU A;  3HOX H;  3I4M H;  3FHW A;  1I5F A;  4JOI C;  1EQQ A;  1WFQ A;  4JBJ A;  2JK8 A;  1NBW A;  4BXX H;  5DLQ E;  1KHI A;  3RN2 A;  4IOA A;  1N32 L;  1VQ7 A;  3GTG H;  4HJ8 A;  3T1H Q;  4AH6 A;  2A8V A;  2CQO A;  2JJQ A;  3KYH C;  1H95 A;  2CFM A;  2IX1 A;  4LFB Q;  4QGU A;  2BA0 A;  4NPS A;  1KRT A;  3TRE A;  4A76 A;  1UE6 A;  2K5H A;  1Q1B A;  1QVG A;  4R4Q A;  4A3C G;  2AKW B;  1YIT A;  2AWN A;  3D31 A;  4POF A;  5C3E H;  1HH2 P;  4R4I A;  4JI6 Q;  4IFD I;  4YWM A;  1EIY B;  1CSP A;  2ZTD A;  4YCW A;  5C4X H;  1EQR A;  5M3M G;  5GQO A;  2HHH Q;  4ALP A;  2JA7 H;  4IFD G;  4UP9 A;  3A5U A;  2QGQ A;  1E1T A;  1Q8K A;  3CPW A;  4P71 A;  1VQF A;  1L1O C;  5HY6 A;  4JC0 A;  1GD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...