4LF9Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf9Q00
1K83H 4NPSA 4GNXB 3F2CA 1EQRA 2YV5A 3RLOA 4JG2A 4BXXG 1X54A 2LXJA 3S1NH 3HOXG 4OO1I 4KHPL 3TEHB 1HH2P 4UP8A 1PH4A 3H3VH 1X3GA 3GTLH 1PH5A 2C35B 1XJVA 4LF7L 1H95A 4B3ML 1N34Q 1VQHA 5K36G 4GLAC 4R4CA 1G291 5GAEC 2MNAA 3OTOQ 2ZTEA 1UE6A 1X55A 1Z47A 5LMNW 4GLXA 4YCWA 5IE8A 1IBLQ 3HKZG 4A93G 3KDFB 5M3MH 2PQAA 4DKAC 3U58A 3S1MH 4HJ7A 2QGQA 1WCMH 4JYAL 4GLVB 2GVAA 4A3LH 2KHJA 1Q46A 2ZTDA 3J80c 1IBKQ 2JEBI 1JB7A 4HJAA 3NBHB 2D0PA 2UUCQ 4B3SL 1I3QH 3DM3A 4GNXA 2NVXH 4R4QA 1N32L 2B3GA 1Y1VH 2NN6I 1PA6A 3S16H 1XMOL 4LW1A 2JEAI 3TQYA 3EN2A 1VQPA 2E8GA 4TVAB 4DR7Q 3KF6A 1Q81C 2UUAL 3A5UA 1WI5A 3HOWH 4QGUA 4OONA 4POFA 5IY0A 3PO2H 3CC4A 2ATWA 1I94Q 3KDFA 1L1OB 1Z9FA 5IYDG 2E5LQ 3GTOH 4JV5L 4YCUA 3CPFA 3CP0A 3NEMA 4JOIC 3U50C 4OWWB 2JA8H 1JJCB 4BA1I 4Y7NH 1NJIC 3AFQA 1JJGA 5E7NA 1X9NA 2KCMA 2JQOA 5GAHC 2EQSA 3A5ZB 2OQ0A 3HOZH 3TRZA 4KI0A 1XNQL 3GTQH 2KCTA 5GQOA 2I5MX 4NXNL 4DAMA 1E7ZA 4DV0L 3GTPH 1PHJA 1IXRA 1EFWA 2OWOA 1N36Q 1UEBA 2HHHL 5AJ3L 2NZHA 1B70B 1RL2A 3NENA 4LUOA 4IFDI 2JA5G 3M4OH 2JJQA 3PUVA 2Q2HA 2PI2A 3GDEA 5C3EG 4TQUS 1QVCA 2Q2UA 5EAYA 1HJPA 3F2BA 4LF7Q 3KLWA 2QEXA 4JI8Q 2DGYA 3OTOL 4A76A 4NXMQ 1OXTA 4BBRH 4GOPB 1B8AA 2RHSB 4PMWA 1EWIA 2K5VA 1PH6A 5C4XG 2CWPA 1YVCA 4PZ7A 4JI1Q 4LF8L 4HIDA 2UXCQ 4XTCS 1EIFA 1IBKL 1P8LA 1HNZQ 3AEVA 2VW9A 1CUKA 1MJEA 3RZOH 1OXVA 3CC2A 2JA6G 1EYGA 3DLLA 1TWCH 2N3SA 2A19A 5JEAG 4A3IH 5LMUL 4A3JH 1YIJA 1E24A 2HT1A 1D8LA 1OXSC 1IYJB 2KBNA 1CKNB 3VDYA 3AYHB 3S2HH 4K0KL 1BBUA 1KRTA 1M1KC 4KHZA 1HR0Q 1ASZA 4A3EH 1UWVA 1YJNA 2FXQA 3L7ZC 1QZHA 1HNZL 4QJFA 1HNWQ 1BVSA 1VQBA 4GN4B 2VUMH 3I55A 3G71A 1VQLA 2VZAA 4C3HH 1VQJA 5HGQA 4DV5L 5M5WH 1EIYB 4JOIA 1A62A 1TWFH 2Q2IA 3JAMi 1SRUA 5IYCG 1XPUA 3B6YA 3KYHC 2ES2A 3H0GG 1SMXA 2H5XA 2HIXA 4R4IA 5IYBH 1YHAA 2IX0A 1VQDA 4DV2L 3PO3H 4BXXH 3S17H 4A3MG 4LF4Q 4DR3Q 2R7FA 3PUWA 3W1GA 1IBML 1HNWL 1Q1BA 2NVQH 4RG1A 5LMNQ 1T9HA 3HOVH 3I4NH 1WFQA 5JEAJ 3MEFA 1ASYA 3K7AH 5HY6A 1XNQQ 3TREA 1X56A 1FVIA 2NVYH 4DV0Q 5FLXc 2JA7G 4XIGS 1VQ6A 2WB1G 3PSIA 4IJLA 4O2DA 4LF9L 2UXDQ 2Z0SA 1N8RC 3WWVA 1WCMG 5DLQE 3ERSX 4DV6L 1CSQA 1GO3E 4DV4L 1IL2A 1IBMQ 1SE8A 4AYBG 1A0IA 3I7FA 1Q7YC 3CF5A 3TS2A 4FDBA 3CCMA 4J15A 4WJ4A 5C44H 3FKIG 2YTXA 3W1BA 4A4IA 4NXML 2N8NA 4JI2L 1OTCA 4X62Q 3A74A 4HJ9A 4DV1Q 4JI6L 4LFCQ 4A3BH 1V1QA 1SR3A 5ELOA 4LFBL 1YHQA 2VQEQ 4LF8Q 2BA1A 2OTJA 5H1SE 2PI2E 4H02A 3K80C 1AH9A 4IFDG 3AFPA 3T1YL 1VQGA 3G48A 3CPWA 4B3RQ 5FJ8H 2GN5A 2PNHA 1UE7A 1VQCA 4DR4Q 5LMUQ 1E3PA 1Q86C 4HIKA 2CKZB 4DV7Q 2Z6KA 3CCEA 1SROA 4JI4Q 3T1HQ 4K0KQ 4DR6Q 5IWAL 4IPHA 2UU9Q 4GKKQ 4OWXB 1IBLL 1VQ4A 2ID0A 1NY4A 3I2ZA 1Q12A 3ULLA 1R9TH 2YTVA 1PH3A 1PH8A 1MJCA 4L5RC 3HOZG 1NE3A 3A0JA 1VQ8A 2YTYA 4YWMA 2E2JH 4OX9Q 3BZKA 3RNUA 4QQBX 4MTNA 2CQOA 4UY8C 1PH1A 1N33Q 3ER0A 2CFMA 3RR5A 2F4VQ 2IHFA 3RN5A 3W5OA 1IZ6A 4C3JH 4HJ5A 1XMOQ 2E2HH 4IFDJ 3GTMH 2WB1E 2YU9H 2F52A 1EUJA 2JA5H 4LF5Q 1OXXK 4JI3Q 4L5QA 3UDGA 3CC7A 2UUAQ 4DR2L 3J7A5 3BJUA 1K73C 1AE2A 1P16A 4A3GG 3M9BA 1PYSB 2R6GA 3CQZH 5IP7G 2OTLA 4R4OA 5GAGC 1J5EL 4WJ3M 2UXBQ 3CMAA 2EXDA 4IJHA 1VQ5A 3FHWA 4X66Q 2VQFQ 2B63G 1PFSA 5FLMG 3STBD 1SLJA 3J81i 2VL6A 4LF5L 4A3KG 2K5NA 3CCVA 2JA6H 3I4MG 3BZCA 4JI5Q 1A63A 5M3FH 4KHPQ 3F8TA 1Y1WG 1K9MC 4GN5A 3UDFA 4YWLA 2R92G 3KJOA 1HNXL 3HKZE 4JI2Q 2A8VA 4X62L 3K8AA 2EIFA 4B3MQ 1X6OA 3H3VI 3HOYG 3J7ZC 2VQEL 3U4VA 3HOXH 2DUDA 1XTDA 4BY1G 4BBSH 1E1TA 1S72A 1N36L 3CCQA 5M5YH 2HHHQ 2VY3A 4DUYQ 4JI5L 4AH6A 2R7ZH 2ZJQA 1LM0A 1FJGQ 1PV4A 3CW2C 1K0RA 4RMFA 4R4TA 2ZM6Q 1I50H 4GS3A 4DV7L 1YJWA 5IYBG 2IY5B 1K3RA 1N32Q 1XPOA 4EX5A 3T1HL 2BH2A 4DR6L 3TS0A 2CWAA 4QL5A 4IO9A 4A3CH 4A3LG 1QUQB 5JJIA 4UPAA 3HOVG 3I4NG 2F3IA 4P74A 1QZGA 3HOUG 2K14A 1YEZA 2RCNA 1JJ2A 3PIPA 1YJ9A 4B3TL 1GVPA 3K7UC 4P72A 4GN3B 5M3MG 4O0AA 4UP9A 1VQOA 5IP9H 3OYYA 3L2PA 1O7IA 1N33L 4JV5Q 1L1OA 4A3DH 4LUZA 4A3FH 1KIXA 3K0XA 4DV3Q 2A1AA 3HOWG 2JK8A 2YYZA 1LYLA 4BY7G 1QVFA 1MIUA 3E9HA 3PF5A 3FKIH 4IOCA 3U4ZA 1GKHA 1W2BA 2ZTCA 4X64L 3PUZA 4LNQA 4JCVE 2UXBL 1TWAH 3CD6A 1QUQA 4Y52H 1SFOH 4A3BG 3K81C 3PO2G 1XMQQ 4X65Q 1C0AA 1I6HH 1CKMA 3MXNB 4QY7A 3I56A 1KAWA 4JBMA 4LF4L 3PCOB 1KXLA 2PQAB 2JE6I 2JA8G 5FJ8G 2LXKA 2OQKA 5LMNL 3GTKH 1K8AC 1Q8KA 5BR8L 2ZJRA 1VQ7A 1HNXQ 2V1CC 5M5XH 1I94L 3CCUA 3LGJA 1I5FA 5GADC 2E5LL 1EQQA 2AWNA 2D0OA 1L1OC 1E1OA 4IPCA 2XGTA 2AKWB 3J81j 1M90C 1GM5A 1MKHA 1A8VA 1YZ6A 3HFZB 1HZAA 1VQEA 5C3EH 4DV6Q 4DV4Q 1KD1C 2MO0A 1PVOA 1YITA 4MZ9A 3JC66 2BA0A 4DK3C 1VS0A 2HIVA 4JI0L 2ALYB 2ZM6L 1VQNA 1YHBA 3IRBA 3H15A 2CCZA 4NXNQ 4HIOA 3UDIA 2R93H 4OXPA 5GROA 2ZJPA 1NMGA 1FGUA 4IPDA 3CMEA 2Z6KC 2UUBL 3GTJH 2OCEA 1Q82C 4UP7A 4LFAQ 4POGA 2D62A 5IT9c 4PZ8A 4LWCA 2I5LX 4QIWE 4HJ8A 4JI7Q 1XNRL 4JYAQ 5JJKA 4BBRG 1LTLA 3L0OA 4B3TQ 5C4XH 2VS1A 4GOPA 4A3IG 1JT8A 1DGSA 2B29A 1PH2A 1Y14B 2Y0SG 3S14H 3T1YQ 1EOVA 3M4PA 3PV0A 4DR1L 3AQQA 4A3JG 3S15H 4JI8L 1VQMA 4DV5Q 4YY3L 3S1RH 4C3IH 3PGZA 3HKSA 1C7YA 4A3EG 4JC0A 4MNOA 3RZDH 4LFAL 5C0XJ 4JI4L 1B7YB 4DR7L 5IWAQ 4GKKL 1G51A 2UU9L 3KOJA 3UDXA 1NMFA 2NN6G 3PIOA 1VQIA 1X3FA 2NVTH 3G4SA 4HIMA 2I0QA 3S2DH 1KC8C 4YHHQ 1TWGH 3GD7A 1XMQL 3CCJA 2VUMG 4DR5Q 1AE3A 3D31A 4AYBE 1XPRA 4BA2I 4LF9Q 1VCIA 5C4JH 4BBSG 4L5TA 2QA4A 2Y0SE 3OW2A 2UXDL 2ASBA 2E2IH 3EIVA 5IYCH 2WAQG 2R7ZG 1YBYA 3EBEA 3H0GH 1HZ9A 2IT1A 4AQYL 4A93H 3M7NA 3PO3G 3E0EA 4JI3L 4A3MH 4L5SA 2JA7H 1N9WA 4PG3A 4DR2Q 1HR0W 2BH8A 3ICEA 3PF4A 1D7QA 4YHHL 4ALPA 1Q1EA 1UE5A 3M3YH 4A3CG 3UE1A 2VNUD 3ULPA 1CSPA 4OO1G 4GOPC 4DV2Q 3HOUH 1CKOA 2WAQE 4X66L 5AJ3Q 1Y1VG 1TXYA 3BU2A 3I4OA 4DAYB 4AQYQ 3RLNA 1S3OA 4ME3A 3SGIA 2GVBA 4C2MH 2XTIA 2K50A 5IP9G 4JI0Q 1JE5A 4APVA 4YWKA 3ULJA 2HQLA 3CCSA 1HZBA 2N78A 3RN2A 4A3DG 4DR4L 4B3RL 4A3FG 3KF8B 4X6AH 1J6QA 2UUBQ 2K5HA 1CKNA 5C44G 1PYBA 2MFIA 3PUYA 3CAMA 1U5KA 4DUZQ 4GNXC 4GKJL 4BY7H 3KFUA 4JI1L 2LSSA 1U0LA 2KENA 5ELNA 3G6EA 4DV3L 2WP8J 3NELA 4JI7L 1XNRQ 2UXCL 4AIMA 1VQKA 4P73A 3GO5A 3STBC 4OWTB 4IPGA 4P75A 1KHIA 4DUYL 4DR1Q 1KQSA 1K8GA 1FL0A 1LUZA 4P71A 1BBWA 2AWOA 1L0WA 2AHOB 4YY3Q 1WJJA 1TWHH 1WOCA 1NBWA 1N34L 1V43A 4LFCL 4DV1L 4JI6Q 1W3SA 4DUZL 2K75A 2F4VL 4LFBQ 1V9PA 3S1QH 2NZOA 3M4QA 3Q8DA 2N49A 1HR0L 1C9OA 2WFWA 3E9IA 3ZJYC 4DNIA 5C0XG 4JBWA 2IX1A 1YI2A 3D0FA 4NB3A 3FP9A 4JBKA 1S40A 4R1JA 1VQFA 2UUCL 1NTGA 1RIPA 4B3SQ 3J80i 1J5EQ 4DR5L 2AMCB 3F2DA 5J3BA 2MO1A 4EQ5A 3GTGH 4DR3L 3UE0A 2L15A 3CXCA 4LF6Q 4YCVA 4A3GH 3JAMc 1GD7A 2K4KA 4LUVA 1PH9A 3KJPA 1KRSA 4OX9L 2R93G 1JMCA 2JA9A 5JJLA 1UE1A 4X64Q 3RLFA 2Q2TA 2B63H 1E22A 1WYDA 2R7DA 2I5HA 3KF6B 4A75A 5IP7H 1X65A 4X65L 5IYDH 4DK6C 3I4MH 1BKBA 4LF6L 4DPGA 2RHQB 1Y1WH 1QVGA 1OXUA 2KHIA 5FLMH 3F1ZA 1PH7A 3M85A 4A3KH 2RF4A 2MQHA 3PUXA 4JBJA 1VQ9A 3CCRA 1YNXA 5BR8Q 3CCLA 1FJGL 3HOYH 3S24A 2PMZE 1KL9A 4KLKA 5M3FG 4PZ6A 2IHEA 5C0XI 1SN8A 4BY1H 1VQAA 1L2FA 4GKJQ 1X3EA 1G6PA 2R92H 1HZCA 2VQFL 2K52A 4IOAA 3J81c
chains in the Genus database with same CATH superfamily
4DAVA 1K83H 2EVBA 2RCFA 1GUNA 1BCPB 1Y8OB 1HH2P 1I4PA 1ZKOA 3H3VH 2WV6D 4LF7L 1XJVA 4B3ML 1N34Q 4EQNA 4GLAC 1F9RA 1HUNA 1EY5A 3GP7A 3OTOQ 2O5JC 1NAPA 5LMNW 1K8OA 1Q90A 1U4MA 3KDFB 5DNFA 2H1EA 3R8BA 3WOEA 5M3MH 3M4OB 2QGQA 4RGOS 4GLVB 4A3LH 3J80c 1V1PB 4RGNA 2B2VC 4B3SL 1BR9A 3DM3A 5LL6X 5BN4A 4RA8A 1XMOL 2TMPA 2L12A 3NE5B 3TQYA 3QJYA 2E8GA 4TVAB 1WI5A 3S15B 2NVQB 4POFA 5IY0A 3PO2H 2ATWA 1I94Q 4ZYSA 3KDFA 1L1OB 2XWBB 2EOTA 5IYDG 3GTOH 4O42A 2Q8RE 3NEMA 1MSHA 1XWEA 2EYHA 1NJIC 1JJGA 1K83B 5E7NA 3T13A 1CA5A 2VB3X 1C48A 3A5ZB 2RQXA 5C4HA 4KI0A 1B9NA 4UAIA 4DAMA 3GTPH 3VR2A 1U4RA 4I7ZC 1PHJA 1PYWD 1N36Q 2F0SA 1UEBA 4HEDA 2NZHA 2CHBD 3NENA 1IW7C 2NVTH 2ICIA 4TQUS 1A2UA 2Q2UA 1F9SA 4LF7Q 2G5DA 2FMMA 1W6JA 1IL8A 4BBRH 4DXGA 2IW3A 2K5VA 2CWPA 1E2VA 1CM9A 4ULLA 1K3BC 2O4XA 1CUKA 2A6ED 1DOMA 2JA6G 3FPUB 1I4RA 2EYMA 4KMUC 5JEAG 4A3IH 4ZQ3A 5LMUL 1HFGA 4FP5D 2PPBC 1BBUA 1ASZA 1M1KC 4KHZA 4A3EH 1JWMD 1F2YA 1QZHA 3BYTB 1BVSA 2JSOA 2VUMH 1EIGA 1EU4A 2VZAA 1EIYB 3SK8A 4JOIA 1H9RA 1XPUA 3B6YA 3MFGA 1CK1A 2F0VA 4DV2L 2IX0A 2F0HA 4DR3Q 1HNWL 4RG1A 5EBCA 1T9HA 1WFQA 3MEFA 1ASYA 2KECA 5FOBB 3GTLB 3I4LA 5D65A 2LY7A 5JPMC 4A3JB 4YIJA 4IUPA 1N8RC 3FMCA 5DLQE 4BBRB 1CSQA 1CTMA 3W3AA 4AYBG 4HAEA 1EEFD 3CF5A 1WTPA 1I4XA 4J15A 2F3WA 1PMRA 1S5DD 3W1BA 4NXML 4X62Q 2DNCA 4JVZA 1SR3A 2ZXPA 4LF8Q 3D8GA 2X69A 2B2WC 4CKEA 2CQAA 1VQGA 1LTBD 1UE7A 2Y0SB 4F7XA 3S2DB 3DXJC 2NB0A 1B4OA 2R92B 4DV7Q 2EYJA 4KTAA 2FHTA 4JI4Q 4DR6Q 1LO5D 4K0KQ 4OWXB 3JAME 1T5EA 3I2ZA 1R9TH 3PO3B 1S5FD 1RDPD 3LWEA 3BDLA 3W2DA 1F9PA 2PZUA 2EYFA 3Q24A 3RNUA 4QQBX 2CQOA 5JJZA 1BQQT 2LFNA 1C4QA 4MHEA 4IFDJ 1ONLA 1XMOQ 2E2HH 1EY7A 2F3VA 3UDGA 3J7A5 3BJUA 1K73C 5KNBA 1ET9A 1PYSB 2R6GA 1K28A 5K5PA 1J5EL 4WJ3M 1ZEQX 1PXUA 4X66Q 1K0SA 2VQFQ 3STBD 1A2TA 3J81i 2QEJC 4LF5L 2JA6H 3I4MG 1H9JA 3M4YA 1EQVA 3F8TA 1Y1WG 1TIID 3UDFA 4CJ2C 1HNXL 2A8VA 4JI2Q 4C3HB 1MHWC 2BDNA 2RSNA 3J7ZC 4FF1A 3K5LA 1HUMA 2XSCA 1S72A 3CCQA 5M5YH 2K03A 4CJ0B 2ZJQA 3H6MA 3RZOB 1LM0A 1FJGQ 3NPPA 1PV4A 1LACA 4RMFA 2ZM6Q 4L8JA 2OEOA 4GS3A 4DV7L 1SYCA 4CGYB 2JA8B 4A3LG 4UPAA 1QZGA 3Q0AA 2EE1A 2WKCA 1YEZA 2FJ2A 5ELCA 1YJ9A 1JJ2A 2K33A 3K7UC 3WDNA 4GN3B 4UP9A 5IP9H 3OOCA 1O7IA 1SNOA 4LUZA 2PZTA 3HOWG 3MXNA 5IGFA 1MIUA 2DY7A 1PTOH 2XRSD 4KD3A 3U4ZA 1GKHA 4HR7B 4OIKA 3GV6A 2UXBL 3PIP3 1SFOH 1HCZA 1QG7A 3T4AC 2B2UA 1XMQQ 4X65Q 3MXNB 1X3QA 3MHBA 3NBIA 1KAWA 3I56A 4LF4L 2PQAB 2JE6I 5FLXL 2VUMB 4PV1C 2LXKA 2E75C 4V0BA 1Q8KA 1VQ7A 2F0OA 1HNXQ 1CQVA 5M5XH 1SYFA 3LGJA 5GADC 3K58A 2CVRA 1EQQA 2D0OA 3NWTA 1L1OC 1M90C 3J81j 1GM5A 2EPBA 4KV6A 1MKHA 1EZ8A 2X6GA 1A8VA 1IKLA 3L3OC 4DNRB 1HZAA 1HRJA 2KEEA 1KD1C 1AP0A 1BCPD 2FFKB 4DK3C 1NCVA 1YHBA 2PZWA 3HEJA 2VB2X 2B2YA 2ZJPA 4IPDA 5NUCA 1I3QB 1O80A 3C1EA 5C6AA 1TQOA 2OCEA 4OEMB 2D62A 4LWCA 2DJFC 4HJ8A 3L0OA 3NTIA 2B29A 3CKIB 1Y14B 3HOZB 3M4PA 5IODA 2MGSA 3S15H 5M3FB 1VQMA 4DV5Q 3S1RH 4C3IH 2A6HD 3NTHA 1JQYD 2NYZD 4JC0A 3SR1A 4LFAL 1ZXTA 5IGGA 5CV4A 4K8JA 5IWAQ 4GKKL 3UDXA 3VR3A 1I4QA 2NN6G 2IX3A 1X3FA 1RTOA 1B3AA 2I0QA 3S2DH 4ZAIA 1TWGH 4RGMA 5ISRA 3A8JE 1RTNA 1AE3A 3D31A 1SYDA 4LF9Q 2QA4A 2Y0SE 2ASBA 5IYCH 2R7ZG 1O7LA 1K8MA 1YBYA 2HD3A 4ZKBB 4AQYL 3BVMA 3NWSA 1HR0W 1RODA 1BCPC 5G3LD 5KRUA 5EKIA 5JVH3 1CSPA 4CHTB 4GOPC 4IALA 3ERQA 3MA2B 4DNTB 3HOUH 4X66L 1QNUA 4IUQA 4DK0A 1YNND 1JWUD 2B2TA 4HSPA 3SGIA 2WKDA 5IP9G 1S5CD 1J6QA 1EEID 1CKNA 4ZUJA 2MFIA 1U5KA 1H9SA 4BY7H 4K6DA 1U0LA 5ELNA 4IZ8A 2UXCL 3QWNA 4P73A 3STBC 2K01A 4DR1Q 1KQSA 2F0LA 2KHSA 1LUZA 2N88A 2AHOB 1EY9A 2WB1B 1PZID 1N34L 1W3SA 3C1FA 3GQBA 1J9OA 1V9PA 3J80L 3Q8DA 5DM63 4DNIA 2K05A 2A5HA 1Z7TA 1KABA 2IX1A 1YI2A 3D0FA 3DMUA 1JICA 4JBKA 3PMFA 1S40A 4R1JA 1JOKA 5CV7A 3J80i 1SYEA 1LTSD 4FVMA 4C3JG 3VYUA 4U68A 1KAAA 4OX9L 1JMCA 3O13A 5M5XB 1E22A 1WYDA 2R7DA 2QF7A 1HFNA 3VA7A 1PTOD 3E3XA 3J7AV 1Y1WH 3ZYYX 5FLMH 1ENCA 1PH7A 3H94A 1VQ9A 4NP5A 4JBJA 3CCRA 1TWGB 1SN8A 2GA4B 1VQAA 1L2FA 1SE3A 4GKJQ 1L0XB 2R92H 1PH3A 3GTJB 1V8QA 4IOAA 3SK6A 1SXTA 1PZJD 5C4JB 1EQRA 2NN6H 4JG2A 4KKUA 4DN4M 4KHPL 4KKSA 4UP8A 1PH4A 1X3GA 5K36G 1VQHA 5E4WC 1G291 1LV9A 5GAEC 2MNAA 1X55A 4GLXA 5I6WA 1IBLQ 3HKZG 1G2TA 3HKZB 2C5CA 4N8FA 3ITPA 3U58A 4HJ7A 1WCMH 1D5XC 1IBKQ 4HJAA 2D0PA 2UUCQ 1GHJA 4GNXA 1N32L 1Y1VH 2NN6I 1PA6A 3S16H 4PMCA 1FNUA 1VQPA 3KF6A 2UUAL 1ZYRD 2HCCA 2PMZB 3CC4A 3FPPA 4JV5L 3CPFA 3MTSA 5FKAC 2XN9C 3CP0A 2L4NA 3U50C 2JA8H 3KBXA 1HQMC 4Y7NH 2KCMA 3SK5A 1H9MA 1XNQL 3GTQH 5GQOA 2I5MX 4DV0L 4PMBA 2B2YC 2HHHL 5AJ3L 3JAML 4LUOA 2JA5G 3M4OH 2JJQA 2PI2A 3GDEA 5C3EG 1SNQA 1JC7A 4JI8Q 1XYIA 3IFTA 2DGYA 3GTOB 5FO7B 3KLSA 4FO2A 1LTRD 2KQ3A 3OIQA 1EWIA 4R9WA 2CH4A 4PMWA 4PZ7A 4JI1Q 4ME5A 4LF8L 2FMCA 2E2IB 1KNEA 4HIDA 1HTLD 4QCLA 1P8LA 1MJEA 2B2UC 1Q8IA 1OXVA 3CC2A 4K2LA 1I50B 2A19A 1BF4A 2A68C 1OXSC 2K28A 4CKCA 1D1KA 1QOHA 4K0KL 1QJOA 2IWHA 3KBGA 4GN4B 5E4XA 3I55A 3G71A 3T56B 4C3HH 1TWFH 5E1FA 5IYCG 3A7AB 2ES2A 1EZ6A 4X3UA 1JE4A 1IYVA 4MN3A 2WIIB 1R9TB 3PO3H 5D14A 3TZUA 2NVQH 3I4NH 1A6XA 1TVXA 3J80E 3OIPA 5I9PA 5HY6A 1EY6A 5FLXc 2JA7G 1VQ6A 4ZUIA 3Q6SA 2UXDQ 2Z0SA 3WWVA 1WCMG 2EYPA 2KOLA 5T1IA 1IBMQ 3URYA 1SE8A 4QMGA 3IKJA 1NUCA 2D5DA 5C44H 2K32A 3QB3A 4A4IA 1WTRA 3T51B 1GUOA 3EA6A 4LFCQ 4JK1C 4LFBL 2VQEQ 5FLXE 1EWCA 2ZT9C 4OIJA 4TRDA 4H02A 3K80C 4K8IA 1SMYD 3T1YL 4A3MB 1VF7A 3Q23A 3SK4A 3CPWA 5FJ8H 2GN5A 2PNHA 4DR4Q 5J22A 4K5WA 1E3PA 1Z6HA 2BCOA 3HOXB 5IIFA 1SROA 1B50A 5IWAL 2F4IA 4IPHA 2UU9Q 4GKKQ 1VQ4A 1NY4A 3QIAA 2F0KA 2K1BA 2F0FA 1VQ8A 4MIUA 1CI3M 5C0XH 5CV9A 1IHZA 4IUNA 4MTNA 4G7ZC 2SNMA 3R2TA 1PH1A 5KNDA 2CFMA 3OSOA 1JOQA 1IZ6A 4IUTA 4HJ5A 2F52A 2JA5H 1FD7D 1B2TA 2MHVA 4L5QA 3CC7A 2UUAQ 4FYDA 5JOBA 4R8IA 1GUWA 4HTHA 3CQZH 5GAGC 2X6LA 1E2WA 2EXDA 1VQ5A 1CZWA 4NMZA 5FLMG 2K5NA 3HOVB 3CCVA 1RF2D 4JI5Q 1IKMA 1BBXC 5M3FH 4KHPQ 1YNJD 3OHXC 4YWLA 3KJOA 5EPKA 1EFID 1SEBD 1JOOA 3K8AA 4B3MQ 1U4LA 1X6OA 1F2ZA 4HCSA 2ZXOA 2VQEL 3U4VA 1XTDA 5I6YA 4BY1G 2HDLA 3NP8A 1N36L 2R7ZH 5C4XB 2K6AA 4OGQC 2F0QA 2F0PA 5LHY1 3CW2C 3I90A 1PFBA 4G57A 1I50H 1YJWA 1F77A 5G3LF 1KTKA 1N32Q 1HPCA 1XPOA 1HA6A 4DR6L 1MGSA 4RHSA 5JAVA 1QUQB 3NXWA 3I4NG 2F3IA 3DUZA 4P74A 5EQ0A 3HOUG 4C3JB 3C46A 3PIPA 2V4DA 3K7AB 4B3TL 2B2TC 1ESFA 3A56A 5IT9E 1VQOA 1N33L 1JR0D 4JV5Q 1L1OA 1KIXA 2KEDA 2JK8A 1LYLA 4BY7G 3PF5A 2E2JB 2JYOA 2ZTCA 5FK9C 2F0IA 1G6ZA 4LNQA 2EXZA 4PNYA 4A3BG 1DM0B 2WAQB 1NSNS 5IT9L 4QY7A 1V1PA 3S1QB 1B1ZA 4JBMA 1A3VA 4GZYC 5FJ8G 1BDOA 5LMNL 4K14A 3HRZC 1I5FA 1DONA 2EY5A 4A3BB 3BZDB 1TY0A 4NDXA 1QE6A 1JB3A 1VQEA 3VYTA 4DV4Q 2MO0A 1YITA 2F0UA 3HOYB 1VS0A 1XTCD 2ALYB 3D4WA 3IRBA 4NXNQ 5AFWA 3UDIA 4HIOA 2R93H 2UUBL 1EYCA 2Z6KC 2E2DC 4LFAQ 4IQZA 2I5LX 3MC0B 2B2VA 4JI7Q 3L9AX 4DFAA 1LTLA 4B3TQ 5JEAH 4XT1B 4A3IG 1DGSA 1JT8A 1PH2A 2Y0SG 4QF4A 2B63B 2JP1A 5HURA 2L1BA 3F2UA 2DY8A 3HKSA 1C7YA 4A3EG 2MPMA 5TSSA 2AQ1B 3N6RA 2KA7A 5C0XJ 1B7YB 4DAPA 1G51A 1LTID 1RHPA 1GHKA 3I8ZA 4C3HG 3EFXD 1VQIA 5CBEE 4TKOB 3FRPB 4LK1C 3QG1A 4L63B 4ZRZA 1XMQL 3NBHA 2BE5C 4DR5Q 1XPRA 5K36H 4BA2I 1VCIA 5C4JH 5EPLA 2WAQG 3H0GH 1HA5A 4MTKA 1HZ9A 3E0EA 4A3MH 4DR2Q 3FEWX 2BH8A 1Q1EA 3M3YH 1QWYA 3ULPA 4FF3A 1ML0D 4A3DB 1CKOA 2WAQE 1FR3A 1Y1VG 1ENAA 1TT2A 3BU2A 4DAYB 4C2MH 5CBAE 4ME3A 4DF7A 3RN2A 4A3DG 3GTQB 4A3FG 1DZ1A 2DNEA 1PYBA 1R4QB 1KDAA 1BCPF 2IY5B 1PRTF 4ILWA 1Y1WB 2LSSA 3KFUA 2KENA 2WP8J 1I6HB 1SNMA 4C56C 1VQKA 1PTOF 4IPGA 3LX0A 4P75A 4DUYL 2RDHA 3OWFA 4P71A 1BBWA 1D6EC 4XQJA 1WJJA 5ELFA 3G6JB 3SE0A 1NBWA 3D4RA 3UI2A 1GUSA 4DV1L 4JI6Q 2BE5D 2NZOA 5CYUA 2N49A 2WFWA 3ZJYC 5C3WA 3BDOA 1MBYA 2JA6B 3H0GB 2Q8TA 3K0YA 3OW7A 1CFMA 1CZGA 1VQFA 2F0DA 4B08A 3PIO3 4RKBA 4DR5L 1EU3A 4LMQD 1WCMB 3J7AF 2L15A 4K6LA 5EKKA 1E2ZA 4YCVA 1PTOC 3CXCA 3JAMc 1RJTA 3TP6A 2K4KA 1PH9A 1RCVD 4F87A 1PRTC 1WD0A 3QOLA 1KRSA 4U673 2R93G 2JA9A 5JJLA 4X64Q 3RLFA 2A69D 2I5HA 5KYLA 4A75A 4X3KA 5IP7H 1O7YA 4X65L 1SBBB 4DK6C 3I4MH 4CBVA 3D6CA 5CGKA 1BKBA 2RHQB 1O7ZA 1OXUA 2J4XA 5I4DA 3QR8A 4PZ6A 4BY1H 4N8X1 1X3EA 1G6PA 1HZCA 2VQFL 3TP5A 4NPSA 5I2YA 1X54A 2LXJA 1ILQA 2NUCA 3HOXG 4IURA 3X3NA 5JPNC 2RBMA 1H95A 4XDXA 1S5BD 5C5MA 1S4ZA 1XX8A 2ZTEA 4ZKCB 2L55A 4YCWA 2Z9HA 4EQPA 4DKAC 2A68D 3GTGB 1Y8NB 2I07B 3ONAB 2GVAA 1G2SA 3H3VC 2KHJA 1Q46A 1M8AA 4CDFC 3KF8A 1DXMA 3MXUA 5DM73 1F2LA 4V190 2EYOA 1DYQA 2NVXH 4J6HA 1H9SB 1XXGA 4X3TA 4CDCC 5C3EB 3EROA 3A5UA 4B9WA 4OONA 4QGUA 2E5LQ 4YCUA 3SDZA 5T1GA 4JOIC 1PZKD 2ZXRA 3DWPA 4E6IA 4Q5VA 1JJCB 1SYGA 4BA1I 1SNDA 1RKNA 2M9VA 3HOZH 3TRZA 1UUPA 1GOZA 2KCTA 5E3FA 3NUCA 1CHPD 2QW7A 3MEHA 1IXRA 1V1OA 2AQ3B 1E0BA 5CC4A 1EFWA 2OWOA 3GTMB 2YU9B 1RL2A 3I70A 4IFDI 3S1MB 3PUVA 1WTWA 1HJPA 4ODGA 4DA2A 3KLWA 5A35A 1ZYRC 3J81E 1OXTA 4GOPB 1BO0A 1PH6A 5EPJA 1II3A 3MXPA 4XTCS 3AEVA 1IBKL 1HNZQ 2VW9A 4C3IG 4IUUA 3BG3A 3DLLA 2N3SA 2HCIA 1STBA 1BOSA 4A3JH 1E24A 2HT1A 5CV8A 1IYJB 1CHQD 3AYHB 3S2HH 3V05A 4P2CB 1UWVA 4HN7A 3L7ZC 1LT5D 2AUJD 1VQBA 1TWHB 4DV5L 1VQJA 3E5SA 4RFBA 5M5WH 3BYYB 3P7JA 2Q2IA 3JAMi 3KYHC 3M7GA 4H7BA 4R4IA 2HIXA 5C3XA 1STGA 4BXXH 1VQDA 2QDLA 2NZ1D 4A3MG 1IW7D 1DOKA 1SAPA 1QB5D 2R7FA 1TS3A 2PO4A 3LNNA 1Q1BA 1IBML 3HOVH 3HOWB 5JEAJ 4J8QA 3QO2A 1H9KA 3TREA 1X56A 3CRKC 1SFOB 1D1IA 1FGBD 4XIGS 2NWGA 3PSIA 4IJLA 2NVXB 2F1MA 3BVGA 2EY1A 4KD4A 4WRDA 3HP3A 2L5TA 4DV6L 1GO3E 3P75A 1IL2A 4BBSB 1ICWA 3I7FA 3D6WA 3TS2A 2XIWA 4FDBA 5IGDA 1DJRD 2KJXA 2YTXA 3A8KE 2PYKA 4ZLTF 1VDZA 4A3FB 3LWUA 1RD9D 3A74A 5CR3A 4DV1Q 4HJ9A 4JI6L 4A3BH 5ELOA 5FO9B 1YHQA 2BA1A 2OTJA 4HCEA 3DWQA 1AH9A 4IFDG 3X3MA 3AFPA 3G48A 4B3RQ 2NVYB 1VQCA 1U4PA 2PQEA 5HGTA 1Q86C 4HIKA 4K5VA 3TP7A 5L37A 2ID0A 3ULLA 2CW0C 1PH8A 3HOZG 3GTKB 3A0JA 3VYSA 2YTYA 5EKLA 2E2JH 4OX9Q 2L9HA 3BZKA 3K57A 4UY8C 3IFDA 1Y8PB 3RR5A 2F4VQ 4ZCKA 3W5OA 4C3JH 2WB1E 2YU9H 4LF5Q 3S1NB 4OELB 4A3GG 4C1NK 3M9BA 4F8MA 2R93B 5J1ZA 1Y1VB 3BVZA 3QOJA 4IJHA 3TN2A 3FHWA 2B63G 1CQFA 1VMPA 1JORA 3TZDA 3J7YW 5CV6A 3I4NB 1F9QA 5CV5A 3PO2B 2O5IC 1A63A 1I6VC 3EQLC 4GN5A 3J81L 2R92G 4XXEA 1SJHD 4X62L 2EIFA 3HOYG 4RAUC 2K5QA 2EY6A 4M1UB 1UNSA 2I46A 2HHHQ 2VY3A 4DUYQ 4JI5L 2PNRC 4AH6A 1KDCA 3KUPA 1K0RA 3AU7A 4DXFA 2EDGA 5IOCA 1GUTA 2K04A 1K3RA 3TS0A 2CWAA 4QL5A 4BWGB 4IO9A 1NNXA 1YNJC 4FXDA 5JJIA 2RSOA 3HOVG 2NTSA 3BS1A 2K14A 2SDFA 1J8IA 2RCNA 4P72A 5M3MG 3OYYA 3N52A 4M8AA 1UAPA 5LL6S 4B9XA 4A3DH 4A3FH 2B8FA 2A1AA 2YYZA 1GUGA 4XYOA 4KKTA 1CT1D 5C4ZA 1KNAA 2JN4A 1SJED 3NK9A 2QKIC 2NVTB 4JCVE 1TWAH 2KCNA 1QUQA 4Y52H 4FNFA 3K81C 4Z9CB 3PO2G 1C0AA 3SVMA 2EJFC 1I6HH 2DJGC 4R8NA 1TS4A 4EQOA 1KXLA 2OT2A 2PW5A 1K8AC 5BR8L 2ZJRA 1O78A 1TWFB 2BDOA 2V1CC 3HS0C 4S3SA 5C44B 1I94L 3SHLA 3HZXA 2AWNA 1E1OA 2AKWB 2H4OA 1I4GA 3HFZB 4G7OC 4A3EB 1SNPA 5C3EH 1G8ZD 5IGCA 3JC66 1AEXA 4ABNA 4JI0L 5DAUA 5DEHA 3H15A 2CCZA 4QUCA 3CQZB 4OXPA 5GROA 1FGUA 1NMGA 3GTJH 1Q82C 3RMHA 4POGA 2SNSA 1XNRL 4JYAQ 2OXPA 5C4XH 4DAYA 4GOPA 1PFMA 3MVVA 3T1YQ 3PV0A 3TP8A 3K59A 4YY3L 1TS5A 2F0JA 4MNOA 1EY8A 3KLSX 4DR7L 4KY6A 3CRLC 3KOJA 2MJ8A 2P5ZX 1AFPA 3G4SA 2A74C 5JVG3 1KC8C 1STNA 4YHHQ 4BY1B 3GD7A 1TR5A 3CCJA 2VUMG 2K7VA 3CU7A 4BBSG 3CHBD 2UXDL 3H91A 1FNWA 4L5TA 3V2TA 1SE4A 4KK7A 3I3CA 5KEEA 2IT1A 1WTXA 1C8CA 4A93H 3M7NA 4OL7A 2JA7H 3H09A 1N9WA 4PG3A 3S14B 4YHHL 1HTPA 4ALPA 1UE5A 3E6ZX 4A3CG 3UE1A 2VNUD 3FVQA 4OO1G 4FF2A 1MSGA 5AJ3Q 1TXYA 4AQYQ 2RKSA 3RLNA 1S3OA 2GVBA 2Z6BA 5IGBA 1SNCA 4APVA 2SOBA 4YWKA 3ULJA 2HQLA 5CMDA 3CCSA 1HZBA 1YNNC 4B3RL 1LT6D 5I9OA 1BUVT 1AZQA 3KF8B 4DR4L 2UUBQ 1EY0A 3MXGA 2K5HA 4GNXC 4JI1L 1XNRQ 3S17B 2E2HB 1WTVA 2AUKA 1EQTA 4AIMA 4FXGC 3GO5A 3R3OA 4H13C 4OWTB 1KDBA 1KHIA 1PRTB 1D5MC 1FL0A 1L0WA 4YY3Q 4KJNA 1TU2B 1WOCA 4XQNA 2E74C 4LFCL 2FINB 2K75A 2F4VL 3S1QH 3M4QA 1HR0L 5KGUA 1TS2A 3K5OA 3KLRA 5C0XG 1X3PA 3MZ5A 4N9PA 4JBWA 1B44D 3FDTA 3NTKA 4UHVA 4ID6A 3FKIB 3FP9A 3WOFA 1R4PB 1RIPA 2UUCL 4B3SQ 3F2DA 2EY2A 2ICEC 4EQ5A 3GTGH 3UE0A 2CW0D 3OPOA 2RA4A 1GD7A 4LUVA 5KNCA 4KN4C 2J7ZA 2Q2TA 2PW7A 2LKVA 3KF6B 4C3IB 1X65A 1WTOA 1MD2D 4WJWA 5EBDA 4DPGA 3MAQA 3DWAA 2KHIA 2KVMA 3T53B 1TWCB 4PQXA 1ET6A 4A3KH 2RF4A 2HDMA 3PUXA 3CCLA 1YNXA 5BR8Q 1KLGD 1ILPA 2PMZE 1KL9A 4KLKA 1SYBA 4H44C 2IHEA 1DOLA 5C5LA 3ICEA 2XWJB 4DV3Q 3C3LA 1LTAD 3VR4A 1HXYD 3K5MA 4GNXB 3F2CA 2YV5A 2JA5B 3RLOA 4BXXG 3S1NH 4JPBW 4OO1I 2E76C 2R3ZA 3TEHB 4DK1A 3GTLH 1PH5A 2C35B 3SEBA 4R4CA 3S1RB 1I4HA 3V96A 1UE6A 1Z47A 3NSWA 5IE8A 4A93G 4A93B 2PQAA 3BDCA 3S1MH 1EWHA 4JYAL 1Y69U 1WVLA 2ZTDA 2JEBI 1JB7A 1A3UA 2G9DA 3NBHB 1I3QH 4R4QA 2F03A 2B3GA 3I73A 4AYBB 1S5ED 4LW1A 4CDDC 4G7HC 2JEAI 1FYCA 3EN2A 4DR7Q 3AMUA 1Q81C 1EY4A 3HOWH 4A3IB 3U9SA 1STEA 1Z9FA 4NKLA 4OWWB 3VYRA 2HUGA 3AFQA 2F0EA 1X9NA 2JQOA 5J39A 5GAHC 2EQSA 2OQ0A 2F0TA 1DD2A 5FO8B 4NXNL 1E7ZA 4UDUC 5M9OA 3MFYA 1STYA 3NQIA 1NR4A 3VR6A 4K5XA 4CDEC 1B70B 2Q2HA 1KLUD 1QVCA 5EAYA 3F2BA 2QEXA 4XQQA 3VR5A 3OTOL 4A76A 4NXMQ 4N9TA 1B8AA 2RHSB 5KIXA 5C4XG 3TSSA 1YVCA 4CJ1B 2UXCQ 4KY7A 1EIFA 1GXDC 2QDBA 1EIHA 3RZOH 3DM1A 3A55A 1EYGA 3G7LA 1TWCH 2B8GA 1YIJA 1D8LA 2HQEA 2KBNA 1CKNB 3VDYA 3P20A 1KRTA 1HR0Q 1YJNA 2FXQA 1HNZL 4QJFA 1QILA 1HNWQ 5M5YB 2XVSA 4FXKC 2L11A 1EL0A 4QUFA 1VQLA 5HGQA 1A62A 1SRUA 1MI2A 3H0GG 1SMXA 2H5XA 5IYBH 1YHAA 2EJMA 1HQRD 3S17H 1SMYC 4LF4Q 3PUWA 3W1GA 1WTQA 3OMCA 5LMNQ 1HHVA 4RCOA 4XYQA 3K7AH 4RCNA 1XNQQ 1FVIA 1W6KA 2NVYH 4DV0Q 4WORA 3NQTA 1PLFA 2D9UA 4C1NI 2WB1G 4O2DA 4LF9L 2B2WA 4ZK9B 5M3MB 1DCZA 3ERSX 4Y7NB 4DV4L 3A7LA 2XRQD 3AB9A 1A0IA 1Q7YC 3CCMA 2WACA 4WJ4A 1G91A 2D2CC 3FKIG 5M5WB 2N8NA 4JI2L 1OTCA 1AW7A 2IL8A 1V1QA 3EJIA 5H1SE 2PI2E 1LT4D 4KY5A 5A2QL 2IJ0A 3I91A 2XNAC 5BN5A 3SXHA 5LMUQ 3T16A 1GJXA 2O2LD 2CKZB 4KJOA 2Z6KA 3CCEA 2TSSA 1PRTD 1ICFB 3T1HQ 1IBLL 1B9MA 2R7ZB 4L5RC 1Q12A 2YTVA 1MJCA 5EGTA 1NE3A 4YWMA 2J0TD 2JA7B 4KHVA 5D3DA 4O1NA 1N33Q 3DEPA 3ER0A 2IHFA 3RN5A 3S2HB 1JCKB 3GTMH 1EUJA 1OXXK 2B39A 4JI3Q 4DR2L 1F2MA 1AE2A 1P16A 4RKLA 5IP7G 2OTLA 1A15A 4R4OA 2UXBQ 3CMAA 2F0GA 2C9OA 4QB4A 1X32A 1PFSA 1SLJA 1PTOB 2VL6A 1SE2A 2RDGA 3NHHA 4A3KG 2ENBA 2CH4W 3BZCA 1AZPA 4HMIA 1K9MC 3M3YB 3HKZE 2VXWA 5ELDA 3H3VI 3HOXH 2DUDA 2A69C 2WINB 1E1TA 3Q22A 4BBSH 5A2QE 3R93A 3A54A 3OMGA 4R4TA 1LT3D 3RUZA 1SDFA 5IYBG 1LTGD 4EX5A 3T1HL 2BH2A 2A6HC 4A3CH 4J1MA 4OO1H 2OF1A 2A73B 2QCPX 1GVPA 4C2MB 4O0AA 4BS9A 3L2PA 3GV3A 4NW2A 2Z1CA 4RHRA 3K0XA 4RGTA 1L0YB 3K6OA 4BY7B 1T5XD 3E0JA 1ESRA 1QVFA 3E9HA 4RWSC 1EYAA 3FKIH 4IOCA 1W2BA 1STAA 2K5WA 3MWYW 4TSSA 3PUZA 4X64L 1BNZA 1CA6A 1LTTD 3CD6A 2Z8LA 1B3QA 2EYLA 1CKMA 2RDFA 1JWSD 2R61A 4IUVA 1FNVA 3PCOB 2DN8A 1TY2A 2JA8G 2OQKA 5F2DA 3GTKH 3CCUA 2E5LL 1QCBD 2BOSA 4X3SA 4IPCA 2XGTA 2Z4HA 1YZ6A 4Q0FA 4DV6Q 4A3GB 1PVOA 4MZ9A 3D3RA 2F0NA 2BA0A 2HIVA 2A6EC 2ZM6L 3R2IA 1VQNA 2JXMB 3ND9A 1UEAB 3S9WA 3CMEA 5ELBA 1Q3LA 4UP7A 5IT9c 3KK7A 1TKWB 4PZ8A 4QIWE 4JW0A 5JJKA 3I4MB 4BBRG 3RD4A 3DEOA 2VS1A 1VMCA 3D4DA 3S14H 1EOVA 4DR1L 4A3JG 1IYUA 3AQQA 2LMCB 4JI8L 5CORA 3IAYA 3PGZA 1OO9B 3DHQA 2N55A 3RZDH 1WD1A 4JI4L 2PCFB 4I65A 2UU9L 1M4VA 5COYA 1NMFA 3PIOA 4I7AA 4HIMA 1NR2A 4H0LC 2Z4IA 2K5DA 2L0CA 2M2LA 2QILA 3A8IE 4DGZA 3S16B 4AYBE 2LS01 3ND8A 3OW2A 2E2IH 3EIVA 3EBEA 3HGBA 3VA5A 1PDQA 1B53A 3PO3G 4JI3L 4L5SA 3PF4A 1D7QA 4A3KB 1AN8A 1VF5C 4QIWB 3K5NA 1D2BA 4DV2Q 5D3IB 4FF4A 1ENFA 1A3TA 3PQIA 2NBFA 3I4OA 2KCCA 2XTIA 2K50A 3I72A 4JI0Q 1JE5A 2F0WA 2N78A 2MP1A 4X6AH 2EZVA 4EGVA 1TWAB 1EOTA 5C44G 3PUYA 2EJGC 4DUZQ 3CAMA 5IYDH 4KN7C 4GKJL 4IFDH 3G6EA 4DV3L 4JI7L 4K2KA 3NELA 2SEBD 1U9RA 1PFNA 2Q8IB 4EVOA 3C2PA 1K8GA 1STHA 4HMJA 2AWOA 3TDQA 4RH6A 5KYIA 1TWHH 5BN3A 1V43A 1LABA 4DUZL 4LAAA 4LFBQ 2MUYA 4IN3A 3TBIB 1C9OA 3E9IA 3TMEA 1WTHA 4G4KA 4CKBA 4NB3A 4DU9A 3GTPB 1EYDA 1NTGA 2RVLA 1J5EQ 1SSOA 2AMCB 4LJZC 5J3BA 3RZDB 2MO1A 5ELEA 1BXTA 2M00A 4DR3L 4A3GH 4LF6Q 2NTTA 4L6TB 2IPKD 2G9HD 4OHJA 3EVQA 3KJPA 1LLRD 5IGEA 1UE1A 3U9OA 2B63H 4F88A 5EJWA 2AQ2B 4XT3B 2KUMA 4LF6L 3P1HA 1QVGA 3OWEB 5I2XA 2F0MA 3F1ZA 3HG9A 3M85A 3IL8A 4WFN3 2MQHA 1FJGL 3HOYH 3S24A 4HSVA 5C0XI 5M3FG 1QNKA 1D5ZC 3HOUB 2K52A 3J81c
chains in the Genus database with same CATH topology
1K83H 4NPSA 4GNXB 3F2CA 1EQRA 2YV5A 3RLOA 4JG2A 4BXXG 1X54A 2LXJA 3S1NH 3HOXG 4OO1I 4KHPL 3TEHB 1HH2P 4UP8A 1PH4A 3H3VH 1X3GA 3GTLH 1PH5A 2C35B 1XJVA 4LF7L 1H95A 4B3ML 1N34Q 1VQHA 5K36G 4GLAC 4R4CA 1G291 5GAEC 2MNAA 3OTOQ 2ZTEA 1UE6A 1X55A 1Z47A 5LMNW 4GLXA 4YCWA 5IE8A 1IBLQ 3HKZG 4A93G 3KDFB 5M3MH 2PQAA 4DKAC 3U58A 3S1MH 4HJ7A 2QGQA 1WCMH 4JYAL 4GLVB 2GVAA 4A3LH 2KHJA 1Q46A 2ZTDA 3J80c 1IBKQ 2JEBI 1JB7A 4HJAA 3NBHB 2D0PA 2UUCQ 4B3SL 1I3QH 3DM3A 4GNXA 2NVXH 4R4QA 1N32L 2B3GA 1Y1VH 2NN6I 1PA6A 3S16H 1XMOL 4LW1A 2JEAI 3TQYA 3EN2A 1VQPA 2E8GA 4TVAB 4DR7Q 3KF6A 1Q81C 2UUAL 3A5UA 1WI5A 3HOWH 4QGUA 4OONA 4POFA 5IY0A 3PO2H 3CC4A 2ATWA 1I94Q 3KDFA 1L1OB 1Z9FA 5IYDG 2E5LQ 3GTOH 4JV5L 4YCUA 3CPFA 3CP0A 3NEMA 4JOIC 3U50C 4OWWB 2JA8H 1JJCB 4BA1I 4Y7NH 1NJIC 3AFQA 1JJGA 5E7NA 1X9NA 2KCMA 2JQOA 5GAHC 2EQSA 3A5ZB 2OQ0A 3HOZH 3TRZA 4KI0A 1XNQL 3GTQH 2KCTA 5GQOA 2I5MX 4NXNL 4DAMA 1E7ZA 4DV0L 3GTPH 1PHJA 1IXRA 1EFWA 2OWOA 1N36Q 1UEBA 2HHHL 5AJ3L 2NZHA 1B70B 1RL2A 3NENA 4LUOA 4IFDI 2JA5G 3M4OH 2JJQA 3PUVA 2Q2HA 2PI2A 3GDEA 5C3EG 4TQUS 1QVCA 2Q2UA 5EAYA 1HJPA 3F2BA 4LF7Q 3KLWA 2QEXA 4JI8Q 2DGYA 3OTOL 4A76A 4NXMQ 1OXTA 4BBRH 4GOPB 1B8AA 2RHSB 4PMWA 1EWIA 2K5VA 1PH6A 5C4XG 2CWPA 1YVCA 4PZ7A 4JI1Q 4LF8L 4HIDA 2UXCQ 4XTCS 1EIFA 1IBKL 1P8LA 1HNZQ 3AEVA 2VW9A 1CUKA 1MJEA 3RZOH 1OXVA 3CC2A 2JA6G 1EYGA 3DLLA 1TWCH 2N3SA 2A19A 5JEAG 4A3IH 5LMUL 4A3JH 1YIJA 1E24A 2HT1A 1D8LA 1OXSC 1IYJB 2KBNA 1CKNB 3VDYA 3AYHB 3S2HH 4K0KL 1BBUA 1KRTA 1M1KC 4KHZA 1HR0Q 1ASZA 4A3EH 1UWVA 1YJNA 2FXQA 3L7ZC 1QZHA 1HNZL 4QJFA 1HNWQ 1BVSA 1VQBA 4GN4B 2VUMH 3I55A 3G71A 1VQLA 2VZAA 4C3HH 1VQJA 5HGQA 4DV5L 5M5WH 1EIYB 4JOIA 1A62A 1TWFH 2Q2IA 3JAMi 1SRUA 5IYCG 1XPUA 3B6YA 3KYHC 2ES2A 3H0GG 1SMXA 2H5XA 2HIXA 4R4IA 5IYBH 1YHAA 2IX0A 1VQDA 4DV2L 3PO3H 4BXXH 3S17H 4A3MG 4LF4Q 4DR3Q 2R7FA 3PUWA 3W1GA 1IBML 1HNWL 1Q1BA 2NVQH 4RG1A 5LMNQ 1T9HA 3HOVH 3I4NH 1WFQA 5JEAJ 3MEFA 1ASYA 3K7AH 5HY6A 1XNQQ 3TREA 1X56A 1FVIA 2NVYH 4DV0Q 5FLXc 2JA7G 4XIGS 1VQ6A 2WB1G 3PSIA 4IJLA 4O2DA 4LF9L 2UXDQ 2Z0SA 1N8RC 3WWVA 1WCMG 5DLQE 3ERSX 4DV6L 1CSQA 1GO3E 4DV4L 1IL2A 1IBMQ 1SE8A 4AYBG 1A0IA 3I7FA 1Q7YC 3CF5A 3TS2A 4FDBA 3CCMA 4J15A 4WJ4A 5C44H 3FKIG 2YTXA 3W1BA 4A4IA 4NXML 2N8NA 4JI2L 1OTCA 4X62Q 3A74A 4HJ9A 4DV1Q 4JI6L 4LFCQ 4A3BH 1V1QA 1SR3A 5ELOA 4LFBL 1YHQA 2VQEQ 4LF8Q 2BA1A 2OTJA 5H1SE 2PI2E 4H02A 3K80C 1AH9A 4IFDG 3AFPA 3T1YL 1VQGA 3G48A 3CPWA 4B3RQ 5FJ8H 2GN5A 2PNHA 1UE7A 1VQCA 4DR4Q 5LMUQ 1E3PA 1Q86C 4HIKA 2CKZB 4DV7Q 2Z6KA 3CCEA 1SROA 4JI4Q 3T1HQ 4K0KQ 4DR6Q 5IWAL 4IPHA 2UU9Q 4GKKQ 4OWXB 1IBLL 1VQ4A 2ID0A 1NY4A 3I2ZA 1Q12A 3ULLA 1R9TH 2YTVA 1PH3A 1PH8A 1MJCA 4L5RC 3HOZG 1NE3A 3A0JA 1VQ8A 2YTYA 4YWMA 2E2JH 4OX9Q 3BZKA 3RNUA 4QQBX 4MTNA 2CQOA 4UY8C 1PH1A 1N33Q 3ER0A 2CFMA 3RR5A 2F4VQ 2IHFA 3RN5A 3W5OA 1IZ6A 4C3JH 4HJ5A 1XMOQ 2E2HH 4IFDJ 3GTMH 2WB1E 2YU9H 2F52A 1EUJA 2JA5H 4LF5Q 1OXXK 4JI3Q 4L5QA 3UDGA 3CC7A 2UUAQ 4DR2L 3J7A5 3BJUA 1K73C 1AE2A 1P16A 4A3GG 3M9BA 1PYSB 2R6GA 3CQZH 5IP7G 2OTLA 4R4OA 5GAGC 1J5EL 4WJ3M 2UXBQ 3CMAA 2EXDA 4IJHA 1VQ5A 3FHWA 4X66Q 2VQFQ 2B63G 1PFSA 5FLMG 3STBD 1SLJA 3J81i 2VL6A 4LF5L 4A3KG 2K5NA 3CCVA 2JA6H 3I4MG 3BZCA 4JI5Q 1A63A 5M3FH 4KHPQ 3F8TA 1Y1WG 1K9MC 4GN5A 3UDFA 4YWLA 2R92G 3KJOA 1HNXL 3HKZE 4JI2Q 2A8VA 4X62L 3K8AA 2EIFA 4B3MQ 1X6OA 3H3VI 3HOYG 3J7ZC 2VQEL 3U4VA 3HOXH 2DUDA 1XTDA 4BY1G 4BBSH 1E1TA 1S72A 1N36L 3CCQA 5M5YH 2HHHQ 2VY3A 4DUYQ 4JI5L 4AH6A 2R7ZH 2ZJQA 1LM0A 1FJGQ 1PV4A 3CW2C 1K0RA 4RMFA 4R4TA 2ZM6Q 1I50H 4GS3A 4DV7L 1YJWA 5IYBG 2IY5B 1K3RA 1N32Q 1XPOA 4EX5A 3T1HL 2BH2A 4DR6L 3TS0A 2CWAA 4QL5A 4IO9A 4A3CH 4A3LG 1QUQB 5JJIA 4UPAA 3HOVG 3I4NG 2F3IA 4P74A 1QZGA 3HOUG 2K14A 1YEZA 2RCNA 1JJ2A 3PIPA 1YJ9A 4B3TL 1GVPA 3K7UC 4P72A 4GN3B 5M3MG 4O0AA 4UP9A 1VQOA 5IP9H 3OYYA 3L2PA 1O7IA 1N33L 4JV5Q 1L1OA 4A3DH 4LUZA 4A3FH 1KIXA 3K0XA 4DV3Q 2A1AA 3HOWG 2JK8A 2YYZA 1LYLA 4BY7G 1QVFA 1MIUA 3E9HA 3PF5A 3FKIH 4IOCA 3U4ZA 1GKHA 1W2BA 2ZTCA 4X64L 3PUZA 4LNQA 4JCVE 2UXBL 1TWAH 3CD6A 1QUQA 4Y52H 1SFOH 4A3BG 3K81C 3PO2G 1XMQQ 4X65Q 1C0AA 1I6HH 1CKMA 3MXNB 4QY7A 3I56A 1KAWA 4JBMA 4LF4L 3PCOB 1KXLA 2PQAB 2JE6I 2JA8G 5FJ8G 2LXKA 2OQKA 5LMNL 3GTKH 1K8AC 1Q8KA 5BR8L 2ZJRA 1VQ7A 1HNXQ 2V1CC 5M5XH 1I94L 3CCUA 3LGJA 1I5FA 5GADC 2E5LL 1EQQA 2AWNA 2D0OA 1L1OC 1E1OA 4IPCA 2XGTA 2AKWB 3J81j 1M90C 1GM5A 1MKHA 1A8VA 1YZ6A 3HFZB 1HZAA 1VQEA 5C3EH 4DV6Q 4DV4Q 1KD1C 2MO0A 1PVOA 1YITA 4MZ9A 3JC66 2BA0A 4DK3C 1VS0A 2HIVA 4JI0L 2ALYB 2ZM6L 1VQNA 1YHBA 3IRBA 3H15A 2CCZA 4NXNQ 4HIOA 3UDIA 2R93H 4OXPA 5GROA 2ZJPA 1NMGA 1FGUA 4IPDA 3CMEA 2Z6KC 2UUBL 3GTJH 2OCEA 1Q82C 4UP7A 4LFAQ 4POGA 2D62A 5IT9c 4PZ8A 4LWCA 2I5LX 4QIWE 4HJ8A 4JI7Q 1XNRL 4JYAQ 5JJKA 4BBRG 1LTLA 3L0OA 4B3TQ 5C4XH 2VS1A 4GOPA 4A3IG 1JT8A 1DGSA 2B29A 1PH2A 1Y14B 2Y0SG 3S14H 3T1YQ 1EOVA 3M4PA 3PV0A 4DR1L 3AQQA 4A3JG 3S15H 4JI8L 1VQMA 4DV5Q 4YY3L 3S1RH 4C3IH 3PGZA 3HKSA 1C7YA 4A3EG 4JC0A 4MNOA 3RZDH 4LFAL 5C0XJ 4JI4L 1B7YB 4DR7L 5IWAQ 4GKKL 1G51A 2UU9L 3KOJA 3UDXA 1NMFA 2NN6G 3PIOA 1VQIA 1X3FA 2NVTH 3G4SA 4HIMA 2I0QA 3S2DH 1KC8C 4YHHQ 1TWGH 3GD7A 1XMQL 3CCJA 2VUMG 4DR5Q 1AE3A 3D31A 4AYBE 1XPRA 4BA2I 4LF9Q 1VCIA 5C4JH 4BBSG 4L5TA 2QA4A 2Y0SE 3OW2A 2UXDL 2ASBA 2E2IH 3EIVA 5IYCH 2WAQG 2R7ZG 1YBYA 3EBEA 3H0GH 1HZ9A 2IT1A 4AQYL 4A93H 3M7NA 3PO3G 3E0EA 4JI3L 4A3MH 4L5SA 2JA7H 1N9WA 4PG3A 4DR2Q 1HR0W 2BH8A 3ICEA 3PF4A 1D7QA 4YHHL 4ALPA 1Q1EA 1UE5A 3M3YH 4A3CG 3UE1A 2VNUD 3ULPA 1CSPA 4OO1G 4GOPC 4DV2Q 3HOUH 1CKOA 2WAQE 4X66L 5AJ3Q 1Y1VG 1TXYA 3BU2A 3I4OA 4DAYB 4AQYQ 3RLNA 1S3OA 4ME3A 3SGIA 2GVBA 4C2MH 2XTIA 2K50A 5IP9G 4JI0Q 1JE5A 4APVA 4YWKA 3ULJA 2HQLA 3CCSA 1HZBA 2N78A 3RN2A 4A3DG 4DR4L 4B3RL 4A3FG 3KF8B 4X6AH 1J6QA 2UUBQ 2K5HA 1CKNA 5C44G 1PYBA 2MFIA 3PUYA 3CAMA 1U5KA 4DUZQ 4GNXC 4GKJL 4BY7H 3KFUA 4JI1L 2LSSA 1U0LA 2KENA 5ELNA 3G6EA 4DV3L 2WP8J 3NELA 4JI7L 1XNRQ 2UXCL 4AIMA 1VQKA 4P73A 3GO5A 3STBC 4OWTB 4IPGA 4P75A 1KHIA 4DUYL 4DR1Q 1KQSA 1K8GA 1FL0A 1LUZA 4P71A 1BBWA 2AWOA 1L0WA 2AHOB 4YY3Q 1WJJA 1TWHH 1WOCA 1NBWA 1N34L 1V43A 4LFCL 4DV1L 4JI6Q 1W3SA 4DUZL 2K75A 2F4VL 4LFBQ 1V9PA 3S1QH 2NZOA 3M4QA 3Q8DA 2N49A 1HR0L 1C9OA 2WFWA 3E9IA 3ZJYC 4DNIA 5C0XG 4JBWA 2IX1A 1YI2A 3D0FA 4NB3A 3FP9A 4JBKA 1S40A 4R1JA 1VQFA 2UUCL 1NTGA 1RIPA 4B3SQ 3J80i 1J5EQ 4DR5L 2AMCB 3F2DA 5J3BA 2MO1A 4EQ5A 3GTGH 4DR3L 3UE0A 2L15A 3CXCA 4LF6Q 4YCVA 4A3GH 3JAMc 1GD7A 2K4KA 4LUVA 1PH9A 3KJPA 1KRSA 4OX9L 2R93G 1JMCA 2JA9A 5JJLA 1UE1A 4X64Q 3RLFA 2Q2TA 2B63H 1E22A 1WYDA 2R7DA 2I5HA 3KF6B 4A75A 5IP7H 1X65A 4X65L 5IYDH 4DK6C 3I4MH 1BKBA 4LF6L 4DPGA 2RHQB 1Y1WH 1QVGA 1OXUA 2KHIA 5FLMH 3F1ZA 1PH7A 3M85A 4A3KH 2RF4A 2MQHA 3PUXA 4JBJA 1VQ9A 3CCRA 1YNXA 5BR8Q 3CCLA 1FJGL 3HOYH 3S24A 2PMZE 1KL9A 4KLKA 5M3FG 4PZ6A 2IHEA 5C0XI 1SN8A 4BY1H 1VQAA 1L2FA 4GKJQ 1X3EA 1G6PA 2R92H 1HZCA 2VQFL 2K52A 4IOAA 3J81c
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K83 H;  4NPS A;  4GNX B;  3F2C A;  1EQR A;  2YV5 A;  3RLO A;  4JG2 A;  4BXX G;  1X54 A;  2LXJ A;  3S1N H;  3HOX G;  4OO1 I;  4KHP L;  3TEH B;  1HH2 P;  4UP8 A;  1PH4 A;  3H3V H;  1X3G A;  3GTL H;  1PH5 A;  2C35 B;  1XJV A;  4LF7 L;  1H95 A;  4B3M L;  1N34 Q;  1VQH A;  5K36 G;  4GLA C;  4R4C A;  1G29 1;  5GAE C;  2MNA A;  3OTO Q;  2ZTE A;  1UE6 A;  1X55 A;  1Z47 A;  5LMN W;  4GLX A;  4YCW A;  5IE8 A;  1IBL Q;  3HKZ G;  4A93 G;  3KDF B;  5M3M H;  2PQA A;  4DKA C;  3U58 A;  3S1M H;  4HJ7 A;  2QGQ A;  1WCM H;  4JYA L;  4GLV B;  2GVA A;  4A3L H;  2KHJ A;  1Q46 A;  2ZTD A;  3J80 c;  1IBK Q;  2JEB I;  1JB7 A;  4HJA A;  3NBH B;  2D0P A;  2UUC Q;  4B3S L;  1I3Q H;  3DM3 A;  4GNX A;  2NVX H;  4R4Q A;  1N32 L;  2B3G A;  1Y1V H;  2NN6 I;  1PA6 A;  3S16 H;  1XMO L;  4LW1 A;  2JEA I;  3TQY A;  3EN2 A;  1VQP A;  2E8G A;  4TVA B;  4DR7 Q;  3KF6 A;  1Q81 C;  2UUA L;  3A5U A;  1WI5 A;  3HOW H;  4QGU A;  4OON A;  4POF A;  5IY0 A;  3PO2 H;  3CC4 A;  2ATW A;  1I94 Q;  3KDF A;  1L1O B;  1Z9F A;  5IYD G;  2E5L Q;  3GTO H;  4JV5 L;  4YCU A;  3CPF A;  3CP0 A;  3NEM A;  4JOI C;  3U50 C;  4OWW B;  2JA8 H;  1JJC B;  4BA1 I;  4Y7N H;  1NJI C;  3AFQ A;  1JJG A;  5E7N A;  1X9N A;  2KCM A;  2JQO A;  5GAH C;  2EQS A;  3A5Z B;  2OQ0 A;  3HOZ H;  3TRZ A;  4KI0 A;  1XNQ L;  3GTQ H;  2KCT A;  5GQO A;  2I5M X;  4NXN L;  4DAM A;  1E7Z A;  4DV0 L;  3GTP H;  1PHJ A;  1IXR A;  1EFW A;  2OWO A;  1N36 Q;  1UEB A;  2HHH L;  5AJ3 L;  2NZH A;  1B70 B;  1RL2 A;  3NEN A;  4LUO A;  4IFD I;  2JA5 G;  3M4O H;  2JJQ A;  3PUV A;  2Q2H A;  2PI2 A;  3GDE A;  5C3E G;  4TQU S;  1QVC A;  2Q2U A;  5EAY A;  1HJP A;  3F2B A;  4LF7 Q;  3KLW A;  2QEX A;  4JI8 Q;  2DGY A;  3OTO L;  4A76 A;  4NXM Q;  1OXT A;  4BBR H;  4GOP B;  1B8A A;  2RHS B;  4PMW A;  1EWI A;  2K5V A;  1PH6 A;  5C4X G;  2CWP A;  1YVC A;  4PZ7 A;  4JI1 Q;  4LF8 L;  4HID A;  2UXC Q;  4XTC S;  1EIF A;  1IBK L;  1P8L A;  1HNZ Q;  3AEV A;  2VW9 A;  1CUK A;  1MJE A;  3RZO H;  1OXV A;  3CC2 A;  2JA6 G;  1EYG A;  3DLL A;  1TWC H;  2N3S A;  2A19 A;  5JEA G;  4A3I H;  5LMU L;  4A3J H;  1YIJ A;  1E24 A;  2HT1 A;  1D8L A;  1OXS C;  1IYJ B;  2KBN A;  1CKN B;  3VDY A;  3AYH B;  3S2H H;  4K0K L;  1BBU A;  1KRT A;  1M1K C;  4KHZ A;  1HR0 Q;  1ASZ A;  4A3E H;  1UWV A;  1YJN A;  2FXQ A;  3L7Z C;  1QZH A;  1HNZ L;  4QJF A;  1HNW Q;  1BVS A;  1VQB A;  4GN4 B;  2VUM H;  3I55 A;  3G71 A;  1VQL A;  2VZA A;  4C3H H;  1VQJ A;  5HGQ A;  4DV5 L;  5M5W H;  1EIY B;  4JOI A;  1A62 A;  1TWF H;  2Q2I A;  3JAM i;  1SRU A;  5IYC G;  1XPU A;  3B6Y A;  3KYH C;  2ES2 A;  3H0G G;  1SMX A;  2H5X A;  2HIX A;  4R4I A;  5IYB H;  1YHA A;  2IX0 A;  1VQD A;  4DV2 L;  3PO3 H;  4BXX H;  3S17 H;  4A3M G;  4LF4 Q;  4DR3 Q;  2R7F A;  3PUW A;  3W1G A;  1IBM L;  1HNW L;  1Q1B A;  2NVQ H;  4RG1 A;  5LMN Q;  1T9H A;  3HOV H;  3I4N H;  1WFQ A;  5JEA J;  3MEF A;  1ASY A;  3K7A H;  5HY6 A;  1XNQ Q;  3TRE A;  1X56 A;  1FVI A;  2NVY H;  4DV0 Q;  5FLX c;  2JA7 G;  4XIG S;  1VQ6 A;  2WB1 G;  3PSI A;  4IJL A;  4O2D A;  4LF9 L;  2UXD Q;  2Z0S A;  1N8R C;  3WWV A;  1WCM G;  5DLQ E;  3ERS X;  4DV6 L;  1CSQ A;  1GO3 E;  4DV4 L;  1IL2 A;  1IBM Q;  1SE8 A;  4AYB G;  1A0I A;  3I7F A;  1Q7Y C;  3CF5 A;  3TS2 A;  4FDB A;  3CCM A;  4J15 A;  4WJ4 A;  5C44 H;  3FKI G;  2YTX A;  3W1B A;  4A4I A;  4NXM L;  2N8N A;  4JI2 L;  1OTC A;  4X62 Q;  3A74 A;  4HJ9 A;  4DV1 Q;  4JI6 L;  4LFC Q;  4A3B H;  1V1Q A;  1SR3 A;  5ELO A;  4LFB L;  1YHQ A;  2VQE Q;  4LF8 Q;  2BA1 A;  2OTJ A;  5H1S E;  2PI2 E;  4H02 A;  3K80 C;  1AH9 A;  4IFD G;  3AFP A;  3T1Y L;  1VQG A;  3G48 A;  3CPW A;  4B3R Q;  5FJ8 H;  2GN5 A;  2PNH A;  1UE7 A;  1VQC A;  4DR4 Q;  5LMU Q;  1E3P A;  1Q86 C;  4HIK A;  2CKZ B;  4DV7 Q;  2Z6K A;  3CCE A;  1SRO A;  4JI4 Q;  3T1H Q;  4K0K Q;  4DR6 Q;  5IWA L;  4IPH A;  2UU9 Q;  4GKK Q;  4OWX B;  1IBL L;  1VQ4 A;  2ID0 A;  1NY4 A;  3I2Z A;  1Q12 A;  3ULL A;  1R9T H;  2YTV A;  1PH3 A;  1PH8 A;  1MJC A;  4L5R C;  3HOZ G;  1NE3 A;  3A0J A;  1VQ8 A;  2YTY A;  4YWM A;  2E2J H;  4OX9 Q;  3BZK A;  3RNU A;  4QQB X;  4MTN A;  2CQO A;  4UY8 C;  1PH1 A;  1N33 Q;  3ER0 A;  2CFM A;  3RR5 A;  2F4V Q;  2IHF A;  3RN5 A;  3W5O A;  1IZ6 A;  4C3J H;  4HJ5 A;  1XMO Q;  2E2H H;  4IFD J;  3GTM H;  2WB1 E;  2YU9 H;  2F52 A;  1EUJ A;  2JA5 H;  4LF5 Q;  1OXX K;  4JI3 Q;  4L5Q A;  3UDG A;  3CC7 A;  2UUA Q;  4DR2 L;  3J7A 5;  3BJU A;  1K73 C;  1AE2 A;  1P16 A;  4A3G G;  3M9B A;  1PYS B;  2R6G A;  3CQZ H;  5IP7 G;  2OTL A;  4R4O A;  5GAG C;  1J5E L;  4WJ3 M;  2UXB Q;  3CMA A;  2EXD A;  4IJH A;  1VQ5 A;  3FHW A;  4X66 Q;  2VQF Q;  2B63 G;  1PFS A;  5FLM G;  3STB D;  1SLJ A;  3J81 i;  2VL6 A;  4LF5 L;  4A3K G;  2K5N A;  3CCV A;  2JA6 H;  3I4M G;  3BZC A;  4JI5 Q;  1A63 A;  5M3F H;  4KHP Q;  3F8T A;  1Y1W G;  1K9M C;  4GN5 A;  3UDF A;  4YWL A;  2R92 G;  3KJO A;  1HNX L;  3HKZ E;  4JI2 Q;  2A8V A;  4X62 L;  3K8A A;  2EIF A;  4B3M Q;  1X6O A;  3H3V I;  3HOY G;  3J7Z C;  2VQE L;  3U4V A;  3HOX H;  2DUD A;  1XTD A;  4BY1 G;  4BBS H;  1E1T A;  1S72 A;  1N36 L;  3CCQ A;  5M5Y H;  2HHH Q;  2VY3 A;  4DUY Q;  4JI5 L;  4AH6 A;  2R7Z H;  2ZJQ A;  1LM0 A;  1FJG Q;  1PV4 A;  3CW2 C;  1K0R A;  4RMF A;  4R4T A;  2ZM6 Q;  1I50 H;  4GS3 A;  4DV7 L;  1YJW A;  5IYB G;  2IY5 B;  1K3R A;  1N32 Q;  1XPO A;  4EX5 A;  3T1H L;  2BH2 A;  4DR6 L;  3TS0 A;  2CWA A;  4QL5 A;  4IO9 A;  4A3C H;  4A3L G;  1QUQ B;  5JJI A;  4UPA A;  3HOV G;  3I4N G;  2F3I A;  4P74 A;  1QZG A;  3HOU G;  2K14 A;  1YEZ A;  2RCN A;  1JJ2 A;  3PIP A;  1YJ9 A;  4B3T L;  1GVP A;  3K7U C;  4P72 A;  4GN3 B;  5M3M G;  4O0A A;  4UP9 A;  1VQO A;  5IP9 H;  3OYY A;  3L2P A;  1O7I A;  1N33 L;  4JV5 Q;  1L1O A;  4A3D H;  4LUZ A;  4A3F H;  1KIX A;  3K0X A;  4DV3 Q;  2A1A A;  3HOW G;  2JK8 A;  2YYZ A;  1LYL A;  4BY7 G;  1QVF A;  1MIU A;  3E9H A;  3PF5 A;  3FKI H;  4IOC A;  3U4Z A;  1GKH A;  1W2B A;  2ZTC A;  4X64 L;  3PUZ A;  4LNQ A;  4JCV E;  2UXB L;  1TWA H;  3CD6 A;  1QUQ A;  4Y52 H;  1SFO H;  4A3B G;  3K81 C;  3PO2 G;  1XMQ Q;  4X65 Q;  1C0A A;  1I6H H;  1CKM A;  3MXN B;  4QY7 A;  3I56 A;  1KAW A;  4JBM A;  4LF4 L;  3PCO B;  1KXL A;  2PQA B;  2JE6 I;  2JA8 G;  5FJ8 G;  2LXK A;  2OQK A;  5LMN L;  3GTK H;  1K8A C;  1Q8K A;  5BR8 L;  2ZJR A;  1VQ7 A;  1HNX Q;  2V1C C;  5M5X H;  1I94 L;  3CCU A;  3LGJ A;  1I5F A;  5GAD C;  2E5L L;  1EQQ A;  2AWN A;  2D0O A;  1L1O C;  1E1O A;  4IPC A;  2XGT A;  2AKW B;  3J81 j;  1M90 C;  1GM5 A;  1MKH A;  1A8V A;  1YZ6 A;  3HFZ B;  1HZA A;  1VQE A;  5C3E H;  4DV6 Q;  4DV4 Q;  1KD1 C;  2MO0 A;  1PVO A;  1YIT A;  4MZ9 A;  3JC6 6;  2BA0 A;  4DK3 C;  1VS0 A;  2HIV A;  4JI0 L;  2ALY B;  2ZM6 L;  1VQN A;  1YHB A;  3IRB A;  3H15 A;  2CCZ A;  4NXN Q;  4HIO A;  3UDI A;  2R93 H;  4OXP A;  5GRO A;  2ZJP A;  1NMG A;  1FGU A;  4IPD A;  3CME A;  2Z6K C;  2UUB L;  3GTJ H;  2OCE A;  1Q82 C;  4UP7 A;  4LFA Q;  4POG A;  2D62 A;  5IT9 c;  4PZ8 A;  4LWC A;  2I5L X;  4QIW E;  4HJ8 A;  4JI7 Q;  1XNR L;  4JYA Q;  5JJK A;  4BBR G;  1LTL A;  3L0O A;  4B3T Q;  5C4X H;  2VS1 A;  4GOP A;  4A3I G;  1JT8 A;  1DGS A;  2B29 A;  1PH2 A;  1Y14 B;  2Y0S G;  3S14 H;  3T1Y Q;  1EOV A;  3M4P A;  3PV0 A;  4DR1 L;  3AQQ A;  4A3J G;  3S15 H;  4JI8 L;  1VQM A;  4DV5 Q;  4YY3 L;  3S1R H;  4C3I H;  3PGZ A;  3HKS A;  1C7Y A;  4A3E G;  4JC0 A;  4MNO A;  3RZD H;  4LFA L;  5C0X J;  4JI4 L;  1B7Y B;  4DR7 L;  5IWA Q;  4GKK L;  1G51 A;  2UU9 L;  3KOJ A;  3UDX A;  1NMF A;  2NN6 G;  3PIO A;  1VQI A;  1X3F A;  2NVT H;  3G4S A;  4HIM A;  2I0Q A;  3S2D H;  1KC8 C;  4YHH Q;  1TWG H;  3GD7 A;  1XMQ L;  3CCJ A;  2VUM G;  4DR5 Q;  1AE3 A;  3D31 A;  4AYB E;  1XPR A;  4BA2 I;  4LF9 Q;  1VCI A;  5C4J H;  4BBS G;  4L5T A;  2QA4 A;  2Y0S E;  3OW2 A;  2UXD L;  2ASB A;  2E2I H;  3EIV A;  5IYC H;  2WAQ G;  2R7Z G;  1YBY A;  3EBE A;  3H0G H;  1HZ9 A;  2IT1 A;  4AQY L;  4A93 H;  3M7N A;  3PO3 G;  3E0E A;  4JI3 L;  4A3M H;  4L5S A;  2JA7 H;  1N9W A;  4PG3 A;  4DR2 Q;  1HR0 W;  2BH8 A;  3ICE A;  3PF4 A;  1D7Q A;  4YHH L;  4ALP A;  1Q1E A;  1UE5 A;  3M3Y H;  4A3C G;  3UE1 A;  2VNU D;  3ULP A;  1CSP A;  4OO1 G;  4GOP C;  4DV2 Q;  3HOU H;  1CKO A;  2WAQ E;  4X66 L;  5AJ3 Q;  1Y1V G;  1TXY A;  3BU2 A;  3I4O A;  4DAY B;  4AQY Q;  3RLN A;  1S3O A;  4ME3 A;  3SGI A;  2GVB A;  4C2M H;  2XTI A;  2K50 A;  5IP9 G;  4JI0 Q;  1JE5 A;  4APV A;  4YWK A;  3ULJ A;  2HQL A;  3CCS A;  1HZB A;  2N78 A;  3RN2 A;  4A3D G;  4DR4 L;  4B3R L;  4A3F G;  3KF8 B;  4X6A H;  1J6Q A;  2UUB Q;  2K5H A;  1CKN A;  5C44 G;  1PYB A;  2MFI A;  3PUY A;  3CAM A;  1U5K A;  4DUZ Q;  4GNX C;  4GKJ L;  4BY7 H;  3KFU A;  4JI1 L;  2LSS A;  1U0L A;  2KEN A;  5ELN A;  3G6E A;  4DV3 L;  2WP8 J;  3NEL A;  4JI7 L;  1XNR Q;  2UXC L;  4AIM A;  1VQK A;  4P73 A;  3GO5 A;  3STB C;  4OWT B;  4IPG A;  4P75 A;  1KHI A;  4DUY L;  4DR1 Q;  1KQS A;  1K8G A;  1FL0 A;  1LUZ A;  4P71 A;  1BBW A;  2AWO A;  1L0W A;  2AHO B;  4YY3 Q;  1WJJ A;  1TWH H;  1WOC A;  1NBW A;  1N34 L;  1V43 A;  4LFC L;  4DV1 L;  4JI6 Q;  1W3S A;  4DUZ L;  2K75 A;  2F4V L;  4LFB Q;  1V9P A;  3S1Q H;  2NZO A;  3M4Q A;  3Q8D A;  2N49 A;  1HR0 L;  1C9O A;  2WFW A;  3E9I A;  3ZJY C;  4DNI A;  5C0X G;  4JBW A;  2IX1 A;  1YI2 A;  3D0F A;  4NB3 A;  3FP9 A;  4JBK A;  1S40 A;  4R1J A;  1VQF A;  2UUC L;  1NTG A;  1RIP A;  4B3S Q;  3J80 i;  1J5E Q;  4DR5 L;  2AMC B;  3F2D A;  5J3B A;  2MO1 A;  4EQ5 A;  3GTG H;  4DR3 L;  3UE0 A;  2L15 A;  3CXC A;  4LF6 Q;  4YCV A;  4A3G H;  3JAM c;  1GD7 A;  2K4K A;  4LUV A;  1PH9 A;  3KJP A;  1KRS A;  4OX9 L;  2R93 G;  1JMC A;  2JA9 A;  5JJL A;  1UE1 A;  4X64 Q;  3RLF A;  2Q2T A;  2B63 H;  1E22 A;  1WYD A;  2R7D A;  2I5H A;  3KF6 B;  4A75 A;  5IP7 H;  1X65 A;  4X65 L;  5IYD H;  4DK6 C;  3I4M H;  1BKB A;  4LF6 L;  4DPG A;  2RHQ B;  1Y1W H;  1QVG A;  1OXU A;  2KHI A;  5FLM H;  3F1Z A;  1PH7 A;  3M85 A;  4A3K H;  2RF4 A;  2MQH A;  3PUX A;  4JBJ A;  1VQ9 A;  3CCR A;  1YNX A;  5BR8 Q;  3CCL A;  1FJG L;  3HOY H;  3S24 A;  2PMZ E;  1KL9 A;  4KLK A;  5M3F G;  4PZ6 A;  2IHE A;  5C0X I;  1SN8 A;  4BY1 H;  1VQA A;  1L2F A;  4GKJ Q;  1X3E A;  1G6P A;  2R92 H;  1HZC A;  2VQF L;  2K52 A;  4IOA A;  3J81 c; 
#chains in the Genus database with same CATH topology
 4DAV A;  1K83 H;  2EVB A;  2RCF A;  1GUN A;  1BCP B;  1Y8O B;  1HH2 P;  1I4P A;  1ZKO A;  3H3V H;  2WV6 D;  4LF7 L;  1XJV A;  4B3M L;  1N34 Q;  4EQN A;  4GLA C;  1F9R A;  1HUN A;  1EY5 A;  3GP7 A;  3OTO Q;  2O5J C;  1NAP A;  5LMN W;  1K8O A;  1Q90 A;  1U4M A;  3KDF B;  5DNF A;  2H1E A;  3R8B A;  3WOE A;  5M3M H;  3M4O B;  2QGQ A;  4RGO S;  4GLV B;  4A3L H;  3J80 c;  1V1P B;  4RGN A;  2B2V C;  4B3S L;  1BR9 A;  3DM3 A;  5LL6 X;  5BN4 A;  4RA8 A;  1XMO L;  2TMP A;  2L12 A;  3NE5 B;  3TQY A;  3QJY A;  2E8G A;  4TVA B;  1WI5 A;  3S15 B;  2NVQ B;  4POF A;  5IY0 A;  3PO2 H;  2ATW A;  1I94 Q;  4ZYS A;  3KDF A;  1L1O B;  2XWB B;  2EOT A;  5IYD G;  3GTO H;  4O42 A;  2Q8R E;  3NEM A;  1MSH A;  1XWE A;  2EYH A;  1NJI C;  1JJG A;  1K83 B;  5E7N A;  3T13 A;  1CA5 A;  2VB3 X;  1C48 A;  3A5Z B;  2RQX A;  5C4H A;  4KI0 A;  1B9N A;  4UAI A;  4DAM A;  3GTP H;  3VR2 A;  1U4R A;  4I7Z C;  1PHJ A;  1PYW D;  1N36 Q;  2F0S A;  1UEB A;  4HED A;  2NZH A;  2CHB D;  3NEN A;  1IW7 C;  2NVT H;  2ICI A;  4TQU S;  1A2U A;  2Q2U A;  1F9S A;  4LF7 Q;  2G5D A;  2FMM A;  1W6J A;  1IL8 A;  4BBR H;  4DXG A;  2IW3 A;  2K5V A;  2CWP A;  1E2V A;  1CM9 A;  4ULL A;  1K3B C;  2O4X A;  1CUK A;  2A6E D;  1DOM A;  2JA6 G;  3FPU B;  1I4R A;  2EYM A;  4KMU C;  5JEA G;  4A3I H;  4ZQ3 A;  5LMU L;  1HFG A;  4FP5 D;  2PPB C;  1BBU A;  1ASZ A;  1M1K C;  4KHZ A;  4A3E H;  1JWM D;  1F2Y A;  1QZH A;  3BYT B;  1BVS A;  2JSO A;  2VUM H;  1EIG A;  1EU4 A;  2VZA A;  1EIY B;  3SK8 A;  4JOI A;  1H9R A;  1XPU A;  3B6Y A;  3MFG A;  1CK1 A;  2F0V A;  4DV2 L;  2IX0 A;  2F0H A;  4DR3 Q;  1HNW L;  4RG1 A;  5EBC A;  1T9H A;  1WFQ A;  3MEF A;  1ASY A;  2KEC A;  5FOB B;  3GTL B;  3I4L A;  5D65 A;  2LY7 A;  5JPM C;  4A3J B;  4YIJ A;  4IUP A;  1N8R C;  3FMC A;  5DLQ E;  4BBR B;  1CSQ A;  1CTM A;  3W3A A;  4AYB G;  4HAE A;  1EEF D;  3CF5 A;  1WTP A;  1I4X A;  4J15 A;  2F3W A;  1PMR A;  1S5D D;  3W1B A;  4NXM L;  4X62 Q;  2DNC A;  4JVZ A;  1SR3 A;  2ZXP A;  4LF8 Q;  3D8G A;  2X69 A;  2B2W C;  4CKE A;  2CQA A;  1VQG A;  1LTB D;  1UE7 A;  2Y0S B;  4F7X A;  3S2D B;  3DXJ C;  2NB0 A;  1B4O A;  2R92 B;  4DV7 Q;  2EYJ A;  4KTA A;  2FHT A;  4JI4 Q;  4DR6 Q;  1LO5 D;  4K0K Q;  4OWX B;  3JAM E;  1T5E A;  3I2Z A;  1R9T H;  3PO3 B;  1S5F D;  1RDP D;  3LWE A;  3BDL A;  3W2D A;  1F9P A;  2PZU A;  2EYF A;  3Q24 A;  3RNU A;  4QQB X;  2CQO A;  5JJZ A;  1BQQ T;  2LFN A;  1C4Q A;  4MHE A;  4IFD J;  1ONL A;  1XMO Q;  2E2H H;  1EY7 A;  2F3V A;  3UDG A;  3J7A 5;  3BJU A;  1K73 C;  5KNB A;  1ET9 A;  1PYS B;  2R6G A;  1K28 A;  5K5P A;  1J5E L;  4WJ3 M;  1ZEQ X;  1PXU A;  4X66 Q;  1K0S A;  2VQF Q;  3STB D;  1A2T A;  3J81 i;  2QEJ C;  4LF5 L;  2JA6 H;  3I4M G;  1H9J A;  3M4Y A;  1EQV A;  3F8T A;  1Y1W G;  1TII D;  3UDF A;  4CJ2 C;  1HNX L;  2A8V A;  4JI2 Q;  4C3H B;  1MHW C;  2BDN A;  2RSN A;  3J7Z C;  4FF1 A;  3K5L A;  1HUM A;  2XSC A;  1S72 A;  3CCQ A;  5M5Y H;  2K03 A;  4CJ0 B;  2ZJQ A;  3H6M A;  3RZO B;  1LM0 A;  1FJG Q;  3NPP A;  1PV4 A;  1LAC A;  4RMF A;  2ZM6 Q;  4L8J A;  2OEO A;  4GS3 A;  4DV7 L;  1SYC A;  4CGY B;  2JA8 B;  4A3L G;  4UPA A;  1QZG A;  3Q0A A;  2EE1 A;  2WKC A;  1YEZ A;  2FJ2 A;  5ELC A;  1YJ9 A;  1JJ2 A;  2K33 A;  3K7U C;  3WDN A;  4GN3 B;  4UP9 A;  5IP9 H;  3OOC A;  1O7I A;  1SNO A;  4LUZ A;  2PZT A;  3HOW G;  3MXN A;  5IGF A;  1MIU A;  2DY7 A;  1PTO H;  2XRS D;  4KD3 A;  3U4Z A;  1GKH A;  4HR7 B;  4OIK A;  3GV6 A;  2UXB L;  3PIP 3;  1SFO H;  1HCZ A;  1QG7 A;  3T4A C;  2B2U A;  1XMQ Q;  4X65 Q;  3MXN B;  1X3Q A;  3MHB A;  3NBI A;  1KAW A;  3I56 A;  4LF4 L;  2PQA B;  2JE6 I;  5FLX L;  2VUM B;  4PV1 C;  2LXK A;  2E75 C;  4V0B A;  1Q8K A;  1VQ7 A;  2F0O A;  1HNX Q;  1CQV A;  5M5X H;  1SYF A;  3LGJ A;  5GAD C;  3K58 A;  2CVR A;  1EQQ A;  2D0O A;  3NWT A;  1L1O C;  1M90 C;  3J81 j;  1GM5 A;  2EPB A;  4KV6 A;  1MKH A;  1EZ8 A;  2X6G A;  1A8V A;  1IKL A;  3L3O C;  4DNR B;  1HZA A;  1HRJ A;  2KEE A;  1KD1 C;  1AP0 A;  1BCP D;  2FFK B;  4DK3 C;  1NCV A;  1YHB A;  2PZW A;  3HEJ A;  2VB2 X;  2B2Y A;  2ZJP A;  4IPD A;  5NUC A;  1I3Q B;  1O80 A;  3C1E A;  5C6A A;  1TQO A;  2OCE A;  4OEM B;  2D62 A;  4LWC A;  2DJF C;  4HJ8 A;  3L0O A;  3NTI A;  2B29 A;  3CKI B;  1Y14 B;  3HOZ B;  3M4P A;  5IOD A;  2MGS A;  3S15 H;  5M3F B;  1VQM A;  4DV5 Q;  3S1R H;  4C3I H;  2A6H D;  3NTH A;  1JQY D;  2NYZ D;  4JC0 A;  3SR1 A;  4LFA L;  1ZXT A;  5IGG A;  5CV4 A;  4K8J A;  5IWA Q;  4GKK L;  3UDX A;  3VR3 A;  1I4Q A;  2NN6 G;  2IX3 A;  1X3F A;  1RTO A;  1B3A A;  2I0Q A;  3S2D H;  4ZAI A;  1TWG H;  4RGM A;  5ISR A;  3A8J E;  1RTN A;  1AE3 A;  3D31 A;  1SYD A;  4LF9 Q;  2QA4 A;  2Y0S E;  2ASB A;  5IYC H;  2R7Z G;  1O7L A;  1K8M A;  1YBY A;  2HD3 A;  4ZKB B;  4AQY L;  3BVM A;  3NWS A;  1HR0 W;  1ROD A;  1BCP C;  5G3L D;  5KRU A;  5EKI A;  5JVH 3;  1CSP A;  4CHT B;  4GOP C;  4IAL A;  3ERQ A;  3MA2 B;  4DNT B;  3HOU H;  4X66 L;  1QNU A;  4IUQ A;  4DK0 A;  1YNN D;  1JWU D;  2B2T A;  4HSP A;  3SGI A;  2WKD A;  5IP9 G;  1S5C D;  1J6Q A;  1EEI D;  1CKN A;  4ZUJ A;  2MFI A;  1U5K A;  1H9S A;  4BY7 H;  4K6D A;  1U0L A;  5ELN A;  4IZ8 A;  2UXC L;  3QWN A;  4P73 A;  3STB C;  2K01 A;  4DR1 Q;  1KQS A;  2F0L A;  2KHS A;  1LUZ A;  2N88 A;  2AHO B;  1EY9 A;  2WB1 B;  1PZI D;  1N34 L;  1W3S A;  3C1F A;  3GQB A;  1J9O A;  1V9P A;  3J80 L;  3Q8D A;  5DM6 3;  4DNI A;  2K05 A;  2A5H A;  1Z7T A;  1KAB A;  2IX1 A;  1YI2 A;  3D0F A;  3DMU A;  1JIC A;  4JBK A;  3PMF A;  1S40 A;  4R1J A;  1JOK A;  5CV7 A;  3J80 i;  1SYE A;  1LTS D;  4FVM A;  4C3J G;  3VYU A;  4U68 A;  1KAA A;  4OX9 L;  1JMC A;  3O13 A;  5M5X B;  1E22 A;  1WYD A;  2R7D A;  2QF7 A;  1HFN A;  3VA7 A;  1PTO D;  3E3X A;  3J7A V;  1Y1W H;  3ZYY X;  5FLM H;  1ENC A;  1PH7 A;  3H94 A;  1VQ9 A;  4NP5 A;  4JBJ A;  3CCR A;  1TWG B;  1SN8 A;  2GA4 B;  1VQA A;  1L2F A;  1SE3 A;  4GKJ Q;  1L0X B;  2R92 H;  1PH3 A;  3GTJ B;  1V8Q A;  4IOA A;  3SK6 A;  1SXT A;  1PZJ D;  5C4J B;  1EQR A;  2NN6 H;  4JG2 A;  4KKU A;  4DN4 M;  4KHP L;  4KKS A;  4UP8 A;  1PH4 A;  1X3G A;  5K36 G;  1VQH A;  5E4W C;  1G29 1;  1LV9 A;  5GAE C;  2MNA A;  1X55 A;  4GLX A;  5I6W A;  1IBL Q;  3HKZ G;  1G2T A;  3HKZ B;  2C5C A;  4N8F A;  3ITP A;  3U58 A;  4HJ7 A;  1WCM H;  1D5X C;  1IBK Q;  4HJA A;  2D0P A;  2UUC Q;  1GHJ A;  4GNX A;  1N32 L;  1Y1V H;  2NN6 I;  1PA6 A;  3S16 H;  4PMC A;  1FNU A;  1VQP A;  3KF6 A;  2UUA L;  1ZYR D;  2HCC A;  2PMZ B;  3CC4 A;  3FPP A;  4JV5 L;  3CPF A;  3MTS A;  5FKA C;  2XN9 C;  3CP0 A;  2L4N A;  3U50 C;  2JA8 H;  3KBX A;  1HQM C;  4Y7N H;  2KCM A;  3SK5 A;  1H9M A;  1XNQ L;  3GTQ H;  5GQO A;  2I5M X;  4DV0 L;  4PMB A;  2B2Y C;  2HHH L;  5AJ3 L;  3JAM L;  4LUO A;  2JA5 G;  3M4O H;  2JJQ A;  2PI2 A;  3GDE A;  5C3E G;  1SNQ A;  1JC7 A;  4JI8 Q;  1XYI A;  3IFT A;  2DGY A;  3GTO B;  5FO7 B;  3KLS A;  4FO2 A;  1LTR D;  2KQ3 A;  3OIQ A;  1EWI A;  4R9W A;  2CH4 A;  4PMW A;  4PZ7 A;  4JI1 Q;  4ME5 A;  4LF8 L;  2FMC A;  2E2I B;  1KNE A;  4HID A;  1HTL D;  4QCL A;  1P8L A;  1MJE A;  2B2U C;  1Q8I A;  1OXV A;  3CC2 A;  4K2L A;  1I50 B;  2A19 A;  1BF4 A;  2A68 C;  1OXS C;  2K28 A;  4CKC A;  1D1K A;  1QOH A;  4K0K L;  1QJO A;  2IWH A;  3KBG A;  4GN4 B;  5E4X A;  3I55 A;  3G71 A;  3T56 B;  4C3H H;  1TWF H;  5E1F A;  5IYC G;  3A7A B;  2ES2 A;  1EZ6 A;  4X3U A;  1JE4 A;  1IYV A;  4MN3 A;  2WII B;  1R9T B;  3PO3 H;  5D14 A;  3TZU A;  2NVQ H;  3I4N H;  1A6X A;  1TVX A;  3J80 E;  3OIP A;  5I9P A;  5HY6 A;  1EY6 A;  5FLX c;  2JA7 G;  1VQ6 A;  4ZUI A;  3Q6S A;  2UXD Q;  2Z0S A;  3WWV A;  1WCM G;  2EYP A;  2KOL A;  5T1I A;  1IBM Q;  3URY A;  1SE8 A;  4QMG A;  3IKJ A;  1NUC A;  2D5D A;  5C44 H;  2K32 A;  3QB3 A;  4A4I A;  1WTR A;  3T51 B;  1GUO A;  3EA6 A;  4LFC Q;  4JK1 C;  4LFB L;  2VQE Q;  5FLX E;  1EWC A;  2ZT9 C;  4OIJ A;  4TRD A;  4H02 A;  3K80 C;  4K8I A;  1SMY D;  3T1Y L;  4A3M B;  1VF7 A;  3Q23 A;  3SK4 A;  3CPW A;  5FJ8 H;  2GN5 A;  2PNH A;  4DR4 Q;  5J22 A;  4K5W A;  1E3P A;  1Z6H A;  2BCO A;  3HOX B;  5IIF A;  1SRO A;  1B50 A;  5IWA L;  2F4I A;  4IPH A;  2UU9 Q;  4GKK Q;  1VQ4 A;  1NY4 A;  3QIA A;  2F0K A;  2K1B A;  2F0F A;  1VQ8 A;  4MIU A;  1CI3 M;  5C0X H;  5CV9 A;  1IHZ A;  4IUN A;  4MTN A;  4G7Z C;  2SNM A;  3R2T A;  1PH1 A;  5KND A;  2CFM A;  3OSO A;  1JOQ A;  1IZ6 A;  4IUT A;  4HJ5 A;  2F52 A;  2JA5 H;  1FD7 D;  1B2T A;  2MHV A;  4L5Q A;  3CC7 A;  2UUA Q;  4FYD A;  5JOB A;  4R8I A;  1GUW A;  4HTH A;  3CQZ H;  5GAG C;  2X6L A;  1E2W A;  2EXD A;  1VQ5 A;  1CZW A;  4NMZ A;  5FLM G;  2K5N A;  3HOV B;  3CCV A;  1RF2 D;  4JI5 Q;  1IKM A;  1BBX C;  5M3F H;  4KHP Q;  1YNJ D;  3OHX C;  4YWL A;  3KJO A;  5EPK A;  1EFI D;  1SEB D;  1JOO A;  3K8A A;  4B3M Q;  1U4L A;  1X6O A;  1F2Z A;  4HCS A;  2ZXO A;  2VQE L;  3U4V A;  1XTD A;  5I6Y A;  4BY1 G;  2HDL A;  3NP8 A;  1N36 L;  2R7Z H;  5C4X B;  2K6A A;  4OGQ C;  2F0Q A;  2F0P A;  5LHY 1;  3CW2 C;  3I90 A;  1PFB A;  4G57 A;  1I50 H;  1YJW A;  1F77 A;  5G3L F;  1KTK A;  1N32 Q;  1HPC A;  1XPO A;  1HA6 A;  4DR6 L;  1MGS A;  4RHS A;  5JAV A;  1QUQ B;  3NXW A;  3I4N G;  2F3I A;  3DUZ A;  4P74 A;  5EQ0 A;  3HOU G;  4C3J B;  3C46 A;  3PIP A;  2V4D A;  3K7A B;  4B3T L;  2B2T C;  1ESF A;  3A56 A;  5IT9 E;  1VQO A;  1N33 L;  1JR0 D;  4JV5 Q;  1L1O A;  1KIX A;  2KED A;  2JK8 A;  1LYL A;  4BY7 G;  3PF5 A;  2E2J B;  2JYO A;  2ZTC A;  5FK9 C;  2F0I A;  1G6Z A;  4LNQ A;  2EXZ A;  4PNY A;  4A3B G;  1DM0 B;  2WAQ B;  1NSN S;  5IT9 L;  4QY7 A;  1V1P A;  3S1Q B;  1B1Z A;  4JBM A;  1A3V A;  4GZY C;  5FJ8 G;  1BDO A;  5LMN L;  4K14 A;  3HRZ C;  1I5F A;  1DON A;  2EY5 A;  4A3B B;  3BZD B;  1TY0 A;  4NDX A;  1QE6 A;  1JB3 A;  1VQE A;  3VYT A;  4DV4 Q;  2MO0 A;  1YIT A;  2F0U A;  3HOY B;  1VS0 A;  1XTC D;  2ALY B;  3D4W A;  3IRB A;  4NXN Q;  5AFW A;  3UDI A;  4HIO A;  2R93 H;  2UUB L;  1EYC A;  2Z6K C;  2E2D C;  4LFA Q;  4IQZ A;  2I5L X;  3MC0 B;  2B2V A;  4JI7 Q;  3L9A X;  4DFA A;  1LTL A;  4B3T Q;  5JEA H;  4XT1 B;  4A3I G;  1DGS A;  1JT8 A;  1PH2 A;  2Y0S G;  4QF4 A;  2B63 B;  2JP1 A;  5HUR A;  2L1B A;  3F2U A;  2DY8 A;  3HKS A;  1C7Y A;  4A3E G;  2MPM A;  5TSS A;  2AQ1 B;  3N6R A;  2KA7 A;  5C0X J;  1B7Y B;  4DAP A;  1G51 A;  1LTI D;  1RHP A;  1GHK A;  3I8Z A;  4C3H G;  3EFX D;  1VQI A;  5CBE E;  4TKO B;  3FRP B;  4LK1 C;  3QG1 A;  4L63 B;  4ZRZ A;  1XMQ L;  3NBH A;  2BE5 C;  4DR5 Q;  1XPR A;  5K36 H;  4BA2 I;  1VCI A;  5C4J H;  5EPL A;  2WAQ G;  3H0G H;  1HA5 A;  4MTK A;  1HZ9 A;  3E0E A;  4A3M H;  4DR2 Q;  3FEW X;  2BH8 A;  1Q1E A;  3M3Y H;  1QWY A;  3ULP A;  4FF3 A;  1ML0 D;  4A3D B;  1CKO A;  2WAQ E;  1FR3 A;  1Y1V G;  1ENA A;  1TT2 A;  3BU2 A;  4DAY B;  4C2M H;  5CBA E;  4ME3 A;  4DF7 A;  3RN2 A;  4A3D G;  3GTQ B;  4A3F G;  1DZ1 A;  2DNE A;  1PYB A;  1R4Q B;  1KDA A;  1BCP F;  2IY5 B;  1PRT F;  4ILW A;  1Y1W B;  2LSS A;  3KFU A;  2KEN A;  2WP8 J;  1I6H B;  1SNM A;  4C56 C;  1VQK A;  1PTO F;  4IPG A;  3LX0 A;  4P75 A;  4DUY L;  2RDH A;  3OWF A;  4P71 A;  1BBW A;  1D6E C;  4XQJ A;  1WJJ A;  5ELF A;  3G6J B;  3SE0 A;  1NBW A;  3D4R A;  3UI2 A;  1GUS A;  4DV1 L;  4JI6 Q;  2BE5 D;  2NZO A;  5CYU A;  2N49 A;  2WFW A;  3ZJY C;  5C3W A;  3BDO A;  1MBY A;  2JA6 B;  3H0G B;  2Q8T A;  3K0Y A;  3OW7 A;  1CFM A;  1CZG A;  1VQF A;  2F0D A;  4B08 A;  3PIO 3;  4RKB A;  4DR5 L;  1EU3 A;  4LMQ D;  1WCM B;  3J7A F;  2L15 A;  4K6L A;  5EKK A;  1E2Z A;  4YCV A;  1PTO C;  3CXC A;  3JAM c;  1RJT A;  3TP6 A;  2K4K A;  1PH9 A;  1RCV D;  4F87 A;  1PRT C;  1WD0 A;  3QOL A;  1KRS A;  4U67 3;  2R93 G;  2JA9 A;  5JJL A;  4X64 Q;  3RLF A;  2A69 D;  2I5H A;  5KYL A;  4A75 A;  4X3K A;  5IP7 H;  1O7Y A;  4X65 L;  1SBB B;  4DK6 C;  3I4M H;  4CBV A;  3D6C A;  5CGK A;  1BKB A;  2RHQ B;  1O7Z A;  1OXU A;  2J4X A;  5I4D A;  3QR8 A;  4PZ6 A;  4BY1 H;  4N8X 1;  1X3E A;  1G6P A;  1HZC A;  2VQF L;  3TP5 A;  4NPS A;  5I2Y A;  1X54 A;  2LXJ A;  1ILQ A;  2NUC A;  3HOX G;  4IUR A;  3X3N A;  5JPN C;  2RBM A;  1H95 A;  4XDX A;  1S5B D;  5C5M A;  1S4Z A;  1XX8 A;  2ZTE A;  4ZKC B;  2L55 A;  4YCW A;  2Z9H A;  4EQP A;  4DKA C;  2A68 D;  3GTG B;  1Y8N B;  2I07 B;  3ONA B;  2GVA A;  1G2S A;  3H3V C;  2KHJ A;  1Q46 A;  1M8A A;  4CDF C;  3KF8 A;  1DXM A;  3MXU A;  5DM7 3;  1F2L A;  4V19 0;  2EYO A;  1DYQ A;  2NVX H;  4J6H A;  1H9S B;  1XXG A;  4X3T A;  4CDC C;  5C3E B;  3ERO A;  3A5U A;  4B9W A;  4OON A;  4QGU A;  2E5L Q;  4YCU A;  3SDZ A;  5T1G A;  4JOI C;  1PZK D;  2ZXR A;  3DWP A;  4E6I A;  4Q5V A;  1JJC B;  1SYG A;  4BA1 I;  1SND A;  1RKN A;  2M9V A;  3HOZ H;  3TRZ A;  1UUP A;  1GOZ A;  2KCT A;  5E3F A;  3NUC A;  1CHP D;  2QW7 A;  3MEH A;  1IXR A;  1V1O A;  2AQ3 B;  1E0B A;  5CC4 A;  1EFW A;  2OWO A;  3GTM B;  2YU9 B;  1RL2 A;  3I70 A;  4IFD I;  3S1M B;  3PUV A;  1WTW A;  1HJP A;  4ODG A;  4DA2 A;  3KLW A;  5A35 A;  1ZYR C;  3J81 E;  1OXT A;  4GOP B;  1BO0 A;  1PH6 A;  5EPJ A;  1II3 A;  3MXP A;  4XTC S;  3AEV A;  1IBK L;  1HNZ Q;  2VW9 A;  4C3I G;  4IUU A;  3BG3 A;  3DLL A;  2N3S A;  2HCI A;  1STB A;  1BOS A;  4A3J H;  1E24 A;  2HT1 A;  5CV8 A;  1IYJ B;  1CHQ D;  3AYH B;  3S2H H;  3V05 A;  4P2C B;  1UWV A;  4HN7 A;  3L7Z C;  1LT5 D;  2AUJ D;  1VQB A;  1TWH B;  4DV5 L;  1VQJ A;  3E5S A;  4RFB A;  5M5W H;  3BYY B;  3P7J A;  2Q2I A;  3JAM i;  3KYH C;  3M7G A;  4H7B A;  4R4I A;  2HIX A;  5C3X A;  1STG A;  4BXX H;  1VQD A;  2QDL A;  2NZ1 D;  4A3M G;  1IW7 D;  1DOK A;  1SAP A;  1QB5 D;  2R7F A;  1TS3 A;  2PO4 A;  3LNN A;  1Q1B A;  1IBM L;  3HOV H;  3HOW B;  5JEA J;  4J8Q A;  3QO2 A;  1H9K A;  3TRE A;  1X56 A;  3CRK C;  1SFO B;  1D1I A;  1FGB D;  4XIG S;  2NWG A;  3PSI A;  4IJL A;  2NVX B;  2F1M A;  3BVG A;  2EY1 A;  4KD4 A;  4WRD A;  3HP3 A;  2L5T A;  4DV6 L;  1GO3 E;  3P75 A;  1IL2 A;  4BBS B;  1ICW A;  3I7F A;  3D6W A;  3TS2 A;  2XIW A;  4FDB A;  5IGD A;  1DJR D;  2KJX A;  2YTX A;  3A8K E;  2PYK A;  4ZLT F;  1VDZ A;  4A3F B;  3LWU A;  1RD9 D;  3A74 A;  5CR3 A;  4DV1 Q;  4HJ9 A;  4JI6 L;  4A3B H;  5ELO A;  5FO9 B;  1YHQ A;  2BA1 A;  2OTJ A;  4HCE A;  3DWQ A;  1AH9 A;  4IFD G;  3X3M A;  3AFP A;  3G48 A;  4B3R Q;  2NVY B;  1VQC A;  1U4P A;  2PQE A;  5HGT A;  1Q86 C;  4HIK A;  4K5V A;  3TP7 A;  5L37 A;  2ID0 A;  3ULL A;  2CW0 C;  1PH8 A;  3HOZ G;  3GTK B;  3A0J A;  3VYS A;  2YTY A;  5EKL A;  2E2J H;  4OX9 Q;  2L9H A;  3BZK A;  3K57 A;  4UY8 C;  3IFD A;  1Y8P B;  3RR5 A;  2F4V Q;  4ZCK A;  3W5O A;  4C3J H;  2WB1 E;  2YU9 H;  4LF5 Q;  3S1N B;  4OEL B;  4A3G G;  4C1N K;  3M9B A;  4F8M A;  2R93 B;  5J1Z A;  1Y1V B;  3BVZ A;  3QOJ A;  4IJH A;  3TN2 A;  3FHW A;  2B63 G;  1CQF A;  1VMP A;  1JOR A;  3TZD A;  3J7Y W;  5CV6 A;  3I4N B;  1F9Q A;  5CV5 A;  3PO2 B;  2O5I C;  1A63 A;  1I6V C;  3EQL C;  4GN5 A;  3J81 L;  2R92 G;  4XXE A;  1SJH D;  4X62 L;  2EIF A;  3HOY G;  4RAU C;  2K5Q A;  2EY6 A;  4M1U B;  1UNS A;  2I46 A;  2HHH Q;  2VY3 A;  4DUY Q;  4JI5 L;  2PNR C;  4AH6 A;  1KDC A;  3KUP A;  1K0R A;  3AU7 A;  4DXF A;  2EDG A;  5IOC A;  1GUT A;  2K04 A;  1K3R A;  3TS0 A;  2CWA A;  4QL5 A;  4BWG B;  4IO9 A;  1NNX A;  1YNJ C;  4FXD A;  5JJI A;  2RSO A;  3HOV G;  2NTS A;  3BS1 A;  2K14 A;  2SDF A;  1J8I A;  2RCN A;  4P72 A;  5M3M G;  3OYY A;  3N52 A;  4M8A A;  1UAP A;  5LL6 S;  4B9X A;  4A3D H;  4A3F H;  2B8F A;  2A1A A;  2YYZ A;  1GUG A;  4XYO A;  4KKT A;  1CT1 D;  5C4Z A;  1KNA A;  2JN4 A;  1SJE D;  3NK9 A;  2QKI C;  2NVT B;  4JCV E;  1TWA H;  2KCN A;  1QUQ A;  4Y52 H;  4FNF A;  3K81 C;  4Z9C B;  3PO2 G;  1C0A A;  3SVM A;  2EJF C;  1I6H H;  2DJG C;  4R8N A;  1TS4 A;  4EQO A;  1KXL A;  2OT2 A;  2PW5 A;  1K8A C;  5BR8 L;  2ZJR A;  1O78 A;  1TWF B;  2BDO A;  2V1C C;  3HS0 C;  4S3S A;  5C44 B;  1I94 L;  3SHL A;  3HZX A;  2AWN A;  1E1O A;  2AKW B;  2H4O A;  1I4G A;  3HFZ B;  4G7O C;  4A3E B;  1SNP A;  5C3E H;  1G8Z D;  5IGC A;  3JC6 6;  1AEX A;  4ABN A;  4JI0 L;  5DAU A;  5DEH A;  3H15 A;  2CCZ A;  4QUC A;  3CQZ B;  4OXP A;  5GRO A;  1FGU A;  1NMG A;  3GTJ H;  1Q82 C;  3RMH A;  4POG A;  2SNS A;  1XNR L;  4JYA Q;  2OXP A;  5C4X H;  4DAY A;  4GOP A;  1PFM A;  3MVV A;  3T1Y Q;  3PV0 A;  3TP8 A;  3K59 A;  4YY3 L;  1TS5 A;  2F0J A;  4MNO A;  1EY8 A;  3KLS X;  4DR7 L;  4KY6 A;  3CRL C;  3KOJ A;  2MJ8 A;  2P5Z X;  1AFP A;  3G4S A;  2A74 C;  5JVG 3;  1KC8 C;  1STN A;  4YHH Q;  4BY1 B;  3GD7 A;  1TR5 A;  3CCJ A;  2VUM G;  2K7V A;  3CU7 A;  4BBS G;  3CHB D;  2UXD L;  3H91 A;  1FNW A;  4L5T A;  3V2T A;  1SE4 A;  4KK7 A;  3I3C A;  5KEE A;  2IT1 A;  1WTX A;  1C8C A;  4A93 H;  3M7N A;  4OL7 A;  2JA7 H;  3H09 A;  1N9W A;  4PG3 A;  3S14 B;  4YHH L;  1HTP A;  4ALP A;  1UE5 A;  3E6Z X;  4A3C G;  3UE1 A;  2VNU D;  3FVQ A;  4OO1 G;  4FF2 A;  1MSG A;  5AJ3 Q;  1TXY A;  4AQY Q;  2RKS A;  3RLN A;  1S3O A;  2GVB A;  2Z6B A;  5IGB A;  1SNC A;  4APV A;  2SOB A;  4YWK A;  3ULJ A;  2HQL A;  5CMD A;  3CCS A;  1HZB A;  1YNN C;  4B3R L;  1LT6 D;  5I9O A;  1BUV T;  1AZQ A;  3KF8 B;  4DR4 L;  2UUB Q;  1EY0 A;  3MXG A;  2K5H A;  4GNX C;  4JI1 L;  1XNR Q;  3S17 B;  2E2H B;  1WTV A;  2AUK A;  1EQT A;  4AIM A;  4FXG C;  3GO5 A;  3R3O A;  4H13 C;  4OWT B;  1KDB A;  1KHI A;  1PRT B;  1D5M C;  1FL0 A;  1L0W A;  4YY3 Q;  4KJN A;  1TU2 B;  1WOC A;  4XQN A;  2E74 C;  4LFC L;  2FIN B;  2K75 A;  2F4V L;  3S1Q H;  3M4Q A;  1HR0 L;  5KGU A;  1TS2 A;  3K5O A;  3KLR A;  5C0X G;  1X3P A;  3MZ5 A;  4N9P A;  4JBW A;  1B44 D;  3FDT A;  3NTK A;  4UHV A;  4ID6 A;  3FKI B;  3FP9 A;  3WOF A;  1R4P B;  1RIP A;  2UUC L;  4B3S Q;  3F2D A;  2EY2 A;  2ICE C;  4EQ5 A;  3GTG H;  3UE0 A;  2CW0 D;  3OPO A;  2RA4 A;  1GD7 A;  4LUV A;  5KNC A;  4KN4 C;  2J7Z A;  2Q2T A;  2PW7 A;  2LKV A;  3KF6 B;  4C3I B;  1X65 A;  1WTO A;  1MD2 D;  4WJW A;  5EBD A;  4DPG A;  3MAQ A;  3DWA A;  2KHI A;  2KVM A;  3T53 B;  1TWC B;  4PQX A;  1ET6 A;  4A3K H;  2RF4 A;  2HDM A;  3PUX A;  3CCL A;  1YNX A;  5BR8 Q;  1KLG D;  1ILP A;  2PMZ E;  1KL9 A;  4KLK A;  1SYB A;  4H44 C;  2IHE A;  1DOL A;  5C5L A;  3ICE A;  2XWJ B;  4DV3 Q;  3C3L A;  1LTA D;  3VR4 A;  1HXY D;  3K5M A;  4GNX B;  3F2C A;  2YV5 A;  2JA5 B;  3RLO A;  4BXX G;  3S1N H;  4JPB W;  4OO1 I;  2E76 C;  2R3Z A;  3TEH B;  4DK1 A;  3GTL H;  1PH5 A;  2C35 B;  3SEB A;  4R4C A;  3S1R B;  1I4H A;  3V96 A;  1UE6 A;  1Z47 A;  3NSW A;  5IE8 A;  4A93 G;  4A93 B;  2PQA A;  3BDC A;  3S1M H;  1EWH A;  4JYA L;  1Y69 U;  1WVL A;  2ZTD A;  2JEB I;  1JB7 A;  1A3U A;  2G9D A;  3NBH B;  1I3Q H;  4R4Q A;  2F03 A;  2B3G A;  3I73 A;  4AYB B;  1S5E D;  4LW1 A;  4CDD C;  4G7H C;  2JEA I;  1FYC A;  3EN2 A;  4DR7 Q;  3AMU A;  1Q81 C;  1EY4 A;  3HOW H;  4A3I B;  3U9S A;  1STE A;  1Z9F A;  4NKL A;  4OWW B;  3VYR A;  2HUG A;  3AFQ A;  2F0E A;  1X9N A;  2JQO A;  5J39 A;  5GAH C;  2EQS A;  2OQ0 A;  2F0T A;  1DD2 A;  5FO8 B;  4NXN L;  1E7Z A;  4UDU C;  5M9O A;  3MFY A;  1STY A;  3NQI A;  1NR4 A;  3VR6 A;  4K5X A;  4CDE C;  1B70 B;  2Q2H A;  1KLU D;  1QVC A;  5EAY A;  3F2B A;  2QEX A;  4XQQ A;  3VR5 A;  3OTO L;  4A76 A;  4NXM Q;  4N9T A;  1B8A A;  2RHS B;  5KIX A;  5C4X G;  3TSS A;  1YVC A;  4CJ1 B;  2UXC Q;  4KY7 A;  1EIF A;  1GXD C;  2QDB A;  1EIH A;  3RZO H;  3DM1 A;  3A55 A;  1EYG A;  3G7L A;  1TWC H;  2B8G A;  1YIJ A;  1D8L A;  2HQE A;  2KBN A;  1CKN B;  3VDY A;  3P20 A;  1KRT A;  1HR0 Q;  1YJN A;  2FXQ A;  1HNZ L;  4QJF A;  1QIL A;  1HNW Q;  5M5Y B;  2XVS A;  4FXK C;  2L11 A;  1EL0 A;  4QUF A;  1VQL A;  5HGQ A;  1A62 A;  1SRU A;  1MI2 A;  3H0G G;  1SMX A;  2H5X A;  5IYB H;  1YHA A;  2EJM A;  1HQR D;  3S17 H;  1SMY C;  4LF4 Q;  3PUW A;  3W1G A;  1WTQ A;  3OMC A;  5LMN Q;  1HHV A;  4RCO A;  4XYQ A;  3K7A H;  4RCN A;  1XNQ Q;  1FVI A;  1W6K A;  2NVY H;  4DV0 Q;  4WOR A;  3NQT A;  1PLF A;  2D9U A;  4C1N I;  2WB1 G;  4O2D A;  4LF9 L;  2B2W A;  4ZK9 B;  5M3M B;  1DCZ A;  3ERS X;  4Y7N B;  4DV4 L;  3A7L A;  2XRQ D;  3AB9 A;  1A0I A;  1Q7Y C;  3CCM A;  2WAC A;  4WJ4 A;  1G91 A;  2D2C C;  3FKI G;  5M5W B;  2N8N A;  4JI2 L;  1OTC A;  1AW7 A;  2IL8 A;  1V1Q A;  3EJI A;  5H1S E;  2PI2 E;  1LT4 D;  4KY5 A;  5A2Q L;  2IJ0 A;  3I91 A;  2XNA C;  5BN5 A;  3SXH A;  5LMU Q;  3T16 A;  1GJX A;  2O2L D;  2CKZ B;  4KJO A;  2Z6K A;  3CCE A;  2TSS A;  1PRT D;  1ICF B;  3T1H Q;  1IBL L;  1B9M A;  2R7Z B;  4L5R C;  1Q12 A;  2YTV A;  1MJC A;  5EGT A;  1NE3 A;  4YWM A;  2J0T D;  2JA7 B;  4KHV A;  5D3D A;  4O1N A;  1N33 Q;  3DEP A;  3ER0 A;  2IHF A;  3RN5 A;  3S2H B;  1JCK B;  3GTM H;  1EUJ A;  1OXX K;  2B39 A;  4JI3 Q;  4DR2 L;  1F2M A;  1AE2 A;  1P16 A;  4RKL A;  5IP7 G;  2OTL A;  1A15 A;  4R4O A;  2UXB Q;  3CMA A;  2F0G A;  2C9O A;  4QB4 A;  1X32 A;  1PFS A;  1SLJ A;  1PTO B;  2VL6 A;  1SE2 A;  2RDG A;  3NHH A;  4A3K G;  2ENB A;  2CH4 W;  3BZC A;  1AZP A;  4HMI A;  1K9M C;  3M3Y B;  3HKZ E;  2VXW A;  5ELD A;  3H3V I;  3HOX H;  2DUD A;  2A69 C;  2WIN B;  1E1T A;  3Q22 A;  4BBS H;  5A2Q E;  3R93 A;  3A54 A;  3OMG A;  4R4T A;  1LT3 D;  3RUZ A;  1SDF A;  5IYB G;  1LTG D;  4EX5 A;  3T1H L;  2BH2 A;  2A6H C;  4A3C H;  4J1M A;  4OO1 H;  2OF1 A;  2A73 B;  2QCP X;  1GVP A;  4C2M B;  4O0A A;  4BS9 A;  3L2P A;  3GV3 A;  4NW2 A;  2Z1C A;  4RHR A;  3K0X A;  4RGT A;  1L0Y B;  3K6O A;  4BY7 B;  1T5X D;  3E0J A;  1ESR A;  1QVF A;  3E9H A;  4RWS C;  1EYA A;  3FKI H;  4IOC A;  1W2B A;  1STA A;  2K5W A;  3MWY W;  4TSS A;  3PUZ A;  4X64 L;  1BNZ A;  1CA6 A;  1LTT D;  3CD6 A;  2Z8L A;  1B3Q A;  2EYL A;  1CKM A;  2RDF A;  1JWS D;  2R61 A;  4IUV A;  1FNV A;  3PCO B;  2DN8 A;  1TY2 A;  2JA8 G;  2OQK A;  5F2D A;  3GTK H;  3CCU A;  2E5L L;  1QCB D;  2BOS A;  4X3S A;  4IPC A;  2XGT A;  2Z4H A;  1YZ6 A;  4Q0F A;  4DV6 Q;  4A3G B;  1PVO A;  4MZ9 A;  3D3R A;  2F0N A;  2BA0 A;  2HIV A;  2A6E C;  2ZM6 L;  3R2I A;  1VQN A;  2JXM B;  3ND9 A;  1UEA B;  3S9W A;  3CME A;  5ELB A;  1Q3L A;  4UP7 A;  5IT9 c;  3KK7 A;  1TKW B;  4PZ8 A;  4QIW E;  4JW0 A;  5JJK A;  3I4M B;  4BBR G;  3RD4 A;  3DEO A;  2VS1 A;  1VMC A;  3D4D A;  3S14 H;  1EOV A;  4DR1 L;  4A3J G;  1IYU A;  3AQQ A;  2LMC B;  4JI8 L;  5COR A;  3IAY A;  3PGZ A;  1OO9 B;  3DHQ A;  2N55 A;  3RZD H;  1WD1 A;  4JI4 L;  2PCF B;  4I65 A;  2UU9 L;  1M4V A;  5COY A;  1NMF A;  3PIO A;  4I7A A;  4HIM A;  1NR2 A;  4H0L C;  2Z4I A;  2K5D A;  2L0C A;  2M2L A;  2QIL A;  3A8I E;  4DGZ A;  3S16 B;  4AYB E;  2LS0 1;  3ND8 A;  3OW2 A;  2E2I H;  3EIV A;  3EBE A;  3HGB A;  3VA5 A;  1PDQ A;  1B53 A;  3PO3 G;  4JI3 L;  4L5S A;  3PF4 A;  1D7Q A;  4A3K B;  1AN8 A;  1VF5 C;  4QIW B;  3K5N A;  1D2B A;  4DV2 Q;  5D3I B;  4FF4 A;  1ENF A;  1A3T A;  3PQI A;  2NBF A;  3I4O A;  2KCC A;  2XTI A;  2K50 A;  3I72 A;  4JI0 Q;  1JE5 A;  2F0W A;  2N78 A;  2MP1 A;  4X6A H;  2EZV A;  4EGV A;  1TWA B;  1EOT A;  5C44 G;  3PUY A;  2EJG C;  4DUZ Q;  3CAM A;  5IYD H;  4KN7 C;  4GKJ L;  4IFD H;  3G6E A;  4DV3 L;  4JI7 L;  4K2K A;  3NEL A;  2SEB D;  1U9R A;  1PFN A;  2Q8I B;  4EVO A;  3C2P A;  1K8G A;  1STH A;  4HMJ A;  2AWO A;  3TDQ A;  4RH6 A;  5KYI A;  1TWH H;  5BN3 A;  1V43 A;  1LAB A;  4DUZ L;  4LAA A;  4LFB Q;  2MUY A;  4IN3 A;  3TBI B;  1C9O A;  3E9I A;  3TME A;  1WTH A;  4G4K A;  4CKB A;  4NB3 A;  4DU9 A;  3GTP B;  1EYD A;  1NTG A;  2RVL A;  1J5E Q;  1SSO A;  2AMC B;  4LJZ C;  5J3B A;  3RZD B;  2MO1 A;  5ELE A;  1BXT A;  2M00 A;  4DR3 L;  4A3G H;  4LF6 Q;  2NTT A;  4L6T B;  2IPK D;  2G9H D;  4OHJ A;  3EVQ A;  3KJP A;  1LLR D;  5IGE A;  1UE1 A;  3U9O A;  2B63 H;  4F88 A;  5EJW A;  2AQ2 B;  4XT3 B;  2KUM A;  4LF6 L;  3P1H A;  1QVG A;  3OWE B;  5I2X A;  2F0M A;  3F1Z A;  3HG9 A;  3M85 A;  3IL8 A;  4WFN 3;  2MQH A;  1FJG L;  3HOY H;  3S24 A;  4HSV A;  5C0X I;  5M3F G;  1QNK A;  1D5Z C;  3HOU B;  2K52 A;  3J81 c; 
#chains in the Genus database with same CATH homology
 1K83 H;  4NPS A;  4GNX B;  3F2C A;  1EQR A;  2YV5 A;  3RLO A;  4JG2 A;  4BXX G;  1X54 A;  2LXJ A;  3S1N H;  3HOX G;  4OO1 I;  4KHP L;  3TEH B;  1HH2 P;  4UP8 A;  1PH4 A;  3H3V H;  1X3G A;  3GTL H;  1PH5 A;  2C35 B;  1XJV A;  4LF7 L;  1H95 A;  4B3M L;  1N34 Q;  1VQH A;  5K36 G;  4GLA C;  4R4C A;  1G29 1;  5GAE C;  2MNA A;  3OTO Q;  2ZTE A;  1UE6 A;  1X55 A;  1Z47 A;  5LMN W;  4GLX A;  4YCW A;  5IE8 A;  1IBL Q;  3HKZ G;  4A93 G;  3KDF B;  5M3M H;  2PQA A;  4DKA C;  3U58 A;  3S1M H;  4HJ7 A;  2QGQ A;  1WCM H;  4JYA L;  4GLV B;  2GVA A;  4A3L H;  2KHJ A;  1Q46 A;  2ZTD A;  3J80 c;  1IBK Q;  2JEB I;  1JB7 A;  4HJA A;  3NBH B;  2D0P A;  2UUC Q;  4B3S L;  1I3Q H;  3DM3 A;  4GNX A;  2NVX H;  4R4Q A;  1N32 L;  2B3G A;  1Y1V H;  2NN6 I;  1PA6 A;  3S16 H;  1XMO L;  4LW1 A;  2JEA I;  3TQY A;  3EN2 A;  1VQP A;  2E8G A;  4TVA B;  4DR7 Q;  3KF6 A;  1Q81 C;  2UUA L;  3A5U A;  1WI5 A;  3HOW H;  4QGU A;  4OON A;  4POF A;  5IY0 A;  3PO2 H;  3CC4 A;  2ATW A;  1I94 Q;  3KDF A;  1L1O B;  1Z9F A;  5IYD G;  2E5L Q;  3GTO H;  4JV5 L;  4YCU A;  3CPF A;  3CP0 A;  3NEM A;  4JOI C;  3U50 C;  4OWW B;  2JA8 H;  1JJC B;  4BA1 I;  4Y7N H;  1NJI C;  3AFQ A;  1JJG A;  5E7N A;  1X9N A;  2KCM A;  2JQO A;  5GAH C;  2EQS A;  3A5Z B;  2OQ0 A;  3HOZ H;  3TRZ A;  4KI0 A;  1XNQ L;  3GTQ H;  2KCT A;  5GQO A;  2I5M X;  4NXN L;  4DAM A;  1E7Z A;  4DV0 L;  3GTP H;  1PHJ A;  1IXR A;  1EFW A;  2OWO A;  1N36 Q;  1UEB A;  2HHH L;  5AJ3 L;  2NZH A;  1B70 B;  1RL2 A;  3NEN A;  4LUO A;  4IFD I;  2JA5 G;  3M4O H;  2JJQ A;  3PUV A;  2Q2H A;  2PI2 A;  3GDE A;  5C3E G;  4TQU S;  1QVC A;  2Q2U A;  5EAY A;  1HJP A;  3F2B A;  4LF7 Q;  3KLW A;  2QEX A;  4JI8 Q;  2DGY A;  3OTO L;  4A76 A;  4NXM Q;  1OXT A;  4BBR H;  4GOP B;  1B8A A;  2RHS B;  4PMW A;  1EWI A;  2K5V A;  1PH6 A;  5C4X G;  2CWP A;  1YVC A;  4PZ7 A;  4JI1 Q;  4LF8 L;  4HID A;  2UXC Q;  4XTC S;  1EIF A;  1IBK L;  1P8L A;  1HNZ Q;  3AEV A;  2VW9 A;  1CUK A;  1MJE A;  3RZO H;  1OXV A;  3CC2 A;  2JA6 G;  1EYG A;  3DLL A;  1TWC H;  2N3S A;  2A19 A;  5JEA G;  4A3I H;  5LMU L;  4A3J H;  1YIJ A;  1E24 A;  2HT1 A;  1D8L A;  1OXS C;  1IYJ B;  2KBN A;  1CKN B;  3VDY A;  3AYH B;  3S2H H;  4K0K L;  1BBU A;  1KRT A;  1M1K C;  4KHZ A;  1HR0 Q;  1ASZ A;  4A3E H;  1UWV A;  1YJN A;  2FXQ A;  3L7Z C;  1QZH A;  1HNZ L;  4QJF A;  1HNW Q;  1BVS A;  1VQB A;  4GN4 B;  2VUM H;  3I55 A;  3G71 A;  1VQL A;  2VZA A;  4C3H H;  1VQJ A;  5HGQ A;  4DV5 L;  5M5W H;  1EIY B;  4JOI A;  1A62 A;  1TWF H;  2Q2I A;  3JAM i;  1SRU A;  5IYC G;  1XPU A;  3B6Y A;  3KYH C;  2ES2 A;  3H0G G;  1SMX A;  2H5X A;  2HIX A;  4R4I A;  5IYB H;  1YHA A;  2IX0 A;  1VQD A;  4DV2 L;  3PO3 H;  4BXX H;  3S17 H;  4A3M G;  4LF4 Q;  4DR3 Q;  2R7F A;  3PUW A;  3W1G A;  1IBM L;  1HNW L;  1Q1B A;  2NVQ H;  4RG1 A;  5LMN Q;  1T9H A;  3HOV H;  3I4N H;  1WFQ A;  5JEA J;  3MEF A;  1ASY A;  3K7A H;  5HY6 A;  1XNQ Q;  3TRE A;  1X56 A;  1FVI A;  2NVY H;  4DV0 Q;  5FLX c;  2JA7 G;  4XIG S;  1VQ6 A;  2WB1 G;  3PSI A;  4IJL A;  4O2D A;  4LF9 L;  2UXD Q;  2Z0S A;  1N8R C;  3WWV A;  1WCM G;  5DLQ E;  3ERS X;  4DV6 L;  1CSQ A;  1GO3 E;  4DV4 L;  1IL2 A;  1IBM Q;  1SE8 A;  4AYB G;  1A0I A;  3I7F A;  1Q7Y C;  3CF5 A;  3TS2 A;  4FDB A;  3CCM A;  4J15 A;  4WJ4 A;  5C44 H;  3FKI G;  2YTX A;  3W1B A;  4A4I A;  4NXM L;  2N8N A;  4JI2 L;  1OTC A;  4X62 Q;  3A74 A;  4HJ9 A;  4DV1 Q;  4JI6 L;  4LFC Q;  4A3B H;  1V1Q A;  1SR3 A;  5ELO A;  4LFB L;  1YHQ A;  2VQE Q;  4LF8 Q;  2BA1 A;  2OTJ A;  5H1S E;  2PI2 E;  4H02 A;  3K80 C;  1AH9 A;  4IFD G;  3AFP A;  3T1Y L;  1VQG A;  3G48 A;  3CPW A;  4B3R Q;  5FJ8 H;  2GN5 A;  2PNH A;  1UE7 A;  1VQC A;  4DR4 Q;  5LMU Q;  1E3P A;  1Q86 C;  4HIK A;  2CKZ B;  4DV7 Q;  2Z6K A;  3CCE A;  1SRO A;  4JI4 Q;  3T1H Q;  4K0K Q;  4DR6 Q;  5IWA L;  4IPH A;  2UU9 Q;  4GKK Q;  4OWX B;  1IBL L;  1VQ4 A;  2ID0 A;  1NY4 A;  3I2Z A;  1Q12 A;  3ULL A;  1R9T H;  2YTV A;  1PH3 A;  1PH8 A;  1MJC A;  4L5R C;  3HOZ G;  1NE3 A;  3A0J A;  1VQ8 A;  2YTY A;  4YWM A;  2E2J H;  4OX9 Q;  3BZK A;  3RNU A;  4QQB X;  4MTN A;  2CQO A;  4UY8 C;  1PH1 A;  1N33 Q;  3ER0 A;  2CFM A;  3RR5 A;  2F4V Q;  2IHF A;  3RN5 A;  3W5O A;  1IZ6 A;  4C3J H;  4HJ5 A;  1XMO Q;  2E2H H;  4IFD J;  3GTM H;  2WB1 E;  2YU9 H;  2F52 A;  1EUJ A;  2JA5 H;  4LF5 Q;  1OXX K;  4JI3 Q;  4L5Q A;  3UDG A;  3CC7 A;  2UUA Q;  4DR2 L;  3J7A 5;  3BJU A;  1K73 C;  1AE2 A;  1P16 A;  4A3G G;  3M9B A;  1PYS B;  2R6G A;  3CQZ H;  5IP7 G;  2OTL A;  4R4O A;  5GAG C;  1J5E L;  4WJ3 M;  2UXB Q;  3CMA A;  2EXD A;  4IJH A;  1VQ5 A;  3FHW A;  4X66 Q;  2VQF Q;  2B63 G;  1PFS A;  5FLM G;  3STB D;  1SLJ A;  3J81 i;  2VL6 A;  4LF5 L;  4A3K G;  2K5N A;  3CCV A;  2JA6 H;  3I4M G;  3BZC A;  4JI5 Q;  1A63 A;  5M3F H;  4KHP Q;  3F8T A;  1Y1W G;  1K9M C;  4GN5 A;  3UDF A;  4YWL A;  2R92 G;  3KJO A;  1HNX L;  3HKZ E;  4JI2 Q;  2A8V A;  4X62 L;  3K8A A;  2EIF A;  4B3M Q;  1X6O A;  3H3V I;  3HOY G;  3J7Z C;  2VQE L;  3U4V A;  3HOX H;  2DUD A;  1XTD A;  4BY1 G;  4BBS H;  1E1T A;  1S72 A;  1N36 L;  3CCQ A;  5M5Y H;  2HHH Q;  2VY3 A;  4DUY Q;  4JI5 L;  4AH6 A;  2R7Z H;  2ZJQ A;  1LM0 A;  1FJG Q;  1PV4 A;  3CW2 C;  1K0R A;  4RMF A;  4R4T A;  2ZM6 Q;  1I50 H;  4GS3 A;  4DV7 L;  1YJW A;  5IYB G;  2IY5 B;  1K3R A;  1N32 Q;  1XPO A;  4EX5 A;  3T1H L;  2BH2 A;  4DR6 L;  3TS0 A;  2CWA A;  4QL5 A;  4IO9 A;  4A3C H;  4A3L G;  1QUQ B;  5JJI A;  4UPA A;  3HOV G;  3I4N G;  2F3I A;  4P74 A;  1QZG A;  3HOU G;  2K14 A;  1YEZ A;  2RCN A;  1JJ2 A;  3PIP A;  1YJ9 A;  4B3T L;  1GVP A;  3K7U C;  4P72 A;  4GN3 B;  5M3M G;  4O0A A;  4UP9 A;  1VQO A;  5IP9 H;  3OYY A;  3L2P A;  1O7I A;  1N33 L;  4JV5 Q;  1L1O A;  4A3D H;  4LUZ A;  4A3F H;  1KIX A;  3K0X A;  4DV3 Q;  2A1A A;  3HOW G;  2JK8 A;  2YYZ A;  1LYL A;  4BY7 G;  1QVF A;  1MIU A;  3E9H A;  3PF5 A;  3FKI H;  4IOC A;  3U4Z A;  1GKH A;  1W2B A;  2ZTC A;  4X64 L;  3PUZ A;  4LNQ A;  4JCV E;  2UXB L;  1TWA H;  3CD6 A;  1QUQ A;  4Y52 H;  1SFO H;  4A3B G;  3K81 C;  3PO2 G;  1XMQ Q;  4X65 Q;  1C0A A;  1I6H H;  1CKM A;  3MXN B;  4QY7 A;  3I56 A;  1KAW A;  4JBM A;  4LF4 L;  3PCO B;  1KXL A;  2PQA B;  2JE6 I;  2JA8 G;  5FJ8 G;  2LXK A;  2OQK A;  5LMN L;  3GTK H;  1K8A C;  1Q8K A;  5BR8 L;  2ZJR A;  1VQ7 A;  1HNX Q;  2V1C C;  5M5X H;  1I94 L;  3CCU A;  3LGJ A;  1I5F A;  5GAD C;  2E5L L;  1EQQ A;  2AWN A;  2D0O A;  1L1O C;  1E1O A;  4IPC A;  2XGT A;  2AKW B;  3J81 j;  1M90 C;  1GM5 A;  1MKH A;  1A8V A;  1YZ6 A;  3HFZ B;  1HZA A;  1VQE A;  5C3E H;  4DV6 Q;  4DV4 Q;  1KD1 C;  2MO0 A;  1PVO A;  1YIT A;  4MZ9 A;  3JC6 6;  2BA0 A;  4DK3 C;  1VS0 A;  2HIV A;  4JI0 L;  2ALY B;  2ZM6 L;  1VQN A;  1YHB A;  3IRB A;  3H15 A;  2CCZ A;  4NXN Q;  4HIO A;  3UDI A;  2R93 H;  4OXP A;  5GRO A;  2ZJP A;  1NMG A;  1FGU A;  4IPD A;  3CME A;  2Z6K C;  2UUB L;  3GTJ H;  2OCE A;  1Q82 C;  4UP7 A;  4LFA Q;  4POG A;  2D62 A;  5IT9 c;  4PZ8 A;  4LWC A;  2I5L X;  4QIW E;  4HJ8 A;  4JI7 Q;  1XNR L;  4JYA Q;  5JJK A;  4BBR G;  1LTL A;  3L0O A;  4B3T Q;  5C4X H;  2VS1 A;  4GOP A;  4A3I G;  1JT8 A;  1DGS A;  2B29 A;  1PH2 A;  1Y14 B;  2Y0S G;  3S14 H;  3T1Y Q;  1EOV A;  3M4P A;  3PV0 A;  4DR1 L;  3AQQ A;  4A3J G;  3S15 H;  4JI8 L;  1VQM A;  4DV5 Q;  4YY3 L;  3S1R H;  4C3I H;  3PGZ A;  3HKS A;  1C7Y A;  4A3E G;  4JC0 A;  4MNO A;  3RZD H;  4LFA L;  5C0X J;  4JI4 L;  1B7Y B;  4DR7 L;  5IWA Q;  4GKK L;  1G51 A;  2UU9 L;  3KOJ A;  3UDX A;  1NMF A;  2NN6 G;  3PIO A;  1VQI A;  1X3F A;  2NVT H;  3G4S A;  4HIM A;  2I0Q A;  3S2D H;  1KC8 C;  4YHH Q;  1TWG H;  3GD7 A;  1XMQ L;  3CCJ A;  2VUM G;  4DR5 Q;  1AE3 A;  3D31 A;  4AYB E;  1XPR A;  4BA2 I;  4LF9 Q;  1VCI A;  5C4J H;  4BBS G;  4L5T A;  2QA4 A;  2Y0S E;  3OW2 A;  2UXD L;  2ASB A;  2E2I H;  3EIV A;  5IYC H;  2WAQ G;  2R7Z G;  1YBY A;  3EBE A;  3H0G H;  1HZ9 A;  2IT1 A;  4AQY L;  4A93 H;  3M7N A;  3PO3 G;  3E0E A;  4JI3 L;  4A3M H;  4L5S A;  2JA7 H;  1N9W A;  4PG3 A;  4DR2 Q;  1HR0 W;  2BH8 A;  3ICE A;  3PF4 A;  1D7Q A;  4YHH L;  4ALP A;  1Q1E A;  1UE5 A;  3M3Y H;  4A3C G;  3UE1 A;  2VNU D;  3ULP A;  1CSP A;  4OO1 G;  4GOP C;  4DV2 Q;  3HOU H;  1CKO A;  2WAQ E;  4X66 L;  5AJ3 Q;  1Y1V G;  1TXY A;  3BU2 A;  3I4O A;  4DAY B;  4AQY Q;  3RLN A;  1S3O A;  4ME3 A;  3SGI A;  2GVB A;  4C2M H;  2XTI A;  2K50 A;  5IP9 G;  4JI0 Q;  1JE5 A;  4APV A;  4YWK A;  3ULJ A;  2HQL A;  3CCS A;  1HZB A;  2N78 A;  3RN2 A;  4A3D G;  4DR4 L;  4B3R L;  4A3F G;  3KF8 B;  4X6A H;  1J6Q A;  2UUB Q;  2K5H A;  1CKN A;  5C44 G;  1PYB A;  2MFI A;  3PUY A;  3CAM A;  1U5K A;  4DUZ Q;  4GNX C;  4GKJ L;  4BY7 H;  3KFU A;  4JI1 L;  2LSS A;  1U0L A;  2KEN A;  5ELN A;  3G6E A;  4DV3 L;  2WP8 J;  3NEL A;  4JI7 L;  1XNR Q;  2UXC L;  4AIM A;  1VQK A;  4P73 A;  3GO5 A;  3STB C;  4OWT B;  4IPG A;  4P75 A;  1KHI A;  4DUY L;  4DR1 Q;  1KQS A;  1K8G A;  1FL0 A;  1LUZ A;  4P71 A;  1BBW A;  2AWO A;  1L0W A;  2AHO B;  4YY3 Q;  1WJJ A;  1TWH H;  1WOC A;  1NBW A;  1N34 L;  1V43 A;  4LFC L;  4DV1 L;  4JI6 Q;  1W3S A;  4DUZ L;  2K75 A;  2F4V L;  4LFB Q;  1V9P A;  3S1Q H;  2NZO A;  3M4Q A;  3Q8D A;  2N49 A;  1HR0 L;  1C9O A;  2WFW A;  3E9I A;  3ZJY C;  4DNI A;  5C0X G;  4JBW A;  2IX1 A;  1YI2 A;  3D0F A;  4NB3 A;  3FP9 A;  4JBK A;  1S40 A;  4R1J A;  1VQF A;  2UUC L;  1NTG A;  1RIP A;  4B3S Q;  3J80 i;  1J5E Q;  4DR5 L;  2AMC B;  3F2D A;  5J3B A;  2MO1 A;  4EQ5 A;  3GTG H;  4DR3 L;  3UE0 A;  2L15 A;  3CXC A;  4LF6 Q;  4YCV A;  4A3G H;  3JAM c;  1GD7 A;  2K4K A;  4LUV A;  1PH9 A;  3KJP A;  1KRS A;  4OX9 L;  2R93 G;  1JMC A;  2JA9 A;  5JJL A;  1UE1 A;  4X64 Q;  3RLF A;  2Q2T A;  2B63 H;  1E22 A;  1WYD A;  2R7D A;  2I5H A;  3KF6 B;  4A75 A;  5IP7 H;  1X65 A;  4X65 L;  5IYD H;  4DK6 C;  3I4M H;  1BKB A;  4LF6 L;  4DPG A;  2RHQ B;  1Y1W H;  1QVG A;  1OXU A;  2KHI A;  5FLM H;  3F1Z A;  1PH7 A;  3M85 A;  4A3K H;  2RF4 A;  2MQH A;  3PUX A;  4JBJ A;  1VQ9 A;  3CCR A;  1YNX A;  5BR8 Q;  3CCL A;  1FJG L;  3HOY H;  3S24 A;  2PMZ E;  1KL9 A;  4KLK A;  5M3F G;  4PZ6 A;  2IHE A;  5C0X I;  1SN8 A;  4BY1 H;  1VQA A;  1L2F A;  4GKJ Q;  1X3E A;  1G6P A;  2R92 H;  1HZC A;  2VQF L;  2K52 A;  4IOA A;  3J81 c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...