4LF9Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf9Q00
4MNOA 2CKZB 1Q12A 4R4IA 1JMCA 1IBLQ 1CKMA 3GTPH 4XTCS 2EXDA 4GN4B 2JA8G 4ALPA 1QUQA 2VQEL 3BZCA 4APVA 4DV0L 3S1QH 3RN5A 3G4SA 4LFBL 5JJLA 5C4XH 4AQYQ 1UE1A 3CCQA 3DLLA 4NXML 1HR0L 1WFQA 1EFWA 1D7QA 3CMEA 3U4VA 5C0XI 4GNXC 1YJNA 1OXTA 3AFPA 1N36L 2N3SA 3K80C 3AEVA 4JI3Q 1YZ6A 2B29A 2I5MX 1N33L 1E7ZA 1LYLA 1TWHH 2PI2E 4PMWA 3BU2A 2ZJQA 1XMQL 1C9OA 3GTLH 1G51A 5C0XJ 3W1BA 3OTOL 2RCNA 1WYDA 1QZGA 4JI5Q 3PUXA 2R7ZH 1YEZA 3CP0A 1GKHA 1X6OA 1WCMG 1L0WA 1N32L 2OTJA 4JYAQ 4DV2L 1XNRQ 4DR2Q 4A93G 1Z47A 4A4IA 3RZOH 3CCVA 3UDFA 1SMXA 5IYCH 5C4JH 4LF5L 2JA5G 3PV0A 1YI2A 3GTMH 2UU9L 4JI7L 1NBWA 3CXCA 1PH4A 4HJ5A 4YHHL 2JK8A 4LF7Q 4JOIA 3S24A 3H0GH 1HZ9A 1S3OA 4C3HH 4OONA 1K3RA 3UDIA 3HKZE 5JEAG 1NE3A 3M85A 1Y1WH 2E5LQ 2HHHL 3I4OA 3Q8DA 5GQOA 1JB7A 1E22A 1VQIA 2HIXA 4BBSG 2VQEQ 4DV0Q 5FJ8H 4DR3Q 1NTGA 1HZBA 1X3GA 4BY1G 1CSQA 2E8GA 2I5LX 2B63H 4IPGA 4P74A 3U4ZA 2ALYB 2F4VQ 4A3LG 1J5EL 2AKWB 1EIFA 2IT1A 3S14H 2E2IH 5C44G 2NVXH 1CUKA 4A3MG 1B7YB 1AE3A 3AFQA 3RLFA 1XMQQ 4BXXH 5M3FG 1NY4A 4DV6L 2XGTA 2OQKA 4POGA 4X64L 1NMGA 4IPCA 1N32Q 2YTYA 1N34L 2AMCB 3FP9A 3MXNB 3G6EA 5IYBH 3S1RH 4A3DG 2RF4A 2ZM6Q 2UUBL 4LF5Q 4KHPL 2KCMA 5JJKA 1KL9A 1PA6A 1GO3E 1VQOA 2UU9Q 4JI7Q 2ZJPA 3I4MG 5JJIA 1YVCA 5IE8A 4YHHQ 4DV1L 2JA9A 1I50H 1CSPA 3NENA 3HOVG 2QGQA 2MFIA 1Q1EA 4TVAB 3CC2A 1PYSB 2OCEA 4DR1L 1Q8KA 4GOPC 3I4NH 4X62L 1CKOA 4L5TA 4JI4Q 2R92G 1I3QH 2Z0SA 1VQ9A 5HY6A 1Q1BA 1NJIC 1G6PA 1K8AC 5IP9H 3U50C 4IJLA 4JBMA 4JCVE 5IWAL 1KRTA 3AQQA 4EQ5A 4IJHA 4QQBX 1PH5A 3RLOA 4P72A 4DV7L 1EQQA 2IHFA 2CWAA 4DNIA 2BA1A 4A3MH 2CWPA 4XIGS 1E24A 1VQAA 4B3ML 1L1OB 4DR5L 4K0KQ 4JI8Q 1VCIA 5LMUL 4DV6Q 2OWOA 3L0OA 2KCTA 4JV5L 4X64Q 1M90C 2PMZE 3GDEA 5C3EG 3I2ZA 3OYYA 4A3CG 1VQFA 3RN2A 4C3IH 1FJGL 2UUBQ 4A3GG 4JI1L 3HKZG 1UE7A 4P71A 3HFZB 3J80c 4A3KH 3HOWG 4R4OA 4A3FG 3TRZA 3RLNA 1KRSA 2PQAB 3UDGA 4DV1Q 3DM3A 3F2BA 4DR1Q 3HOVH 1UWVA 2VY3A 1VQ5A 1CKNA 4GLXA 1GD7A 2KHJA 3KDFA 4GNXA 4GKKQ 1EOVA 5AJ3Q 3HOYG 4GN5A 3EBEA 3PF4A 2JEBI 2K75A 3FHWA 4QIWE 1XJVA 3H3VH 4BY7H 1R9TH 1QVGA 1TWFH 4IPDA 4OXPA 4UPAA 4BBRH 1PH2A 3FKIH 5IWAQ 2HIVA 2XTIA 2JQOA 4R4QA 1UE6A 3GTQH 1HNWL 4IFDG 4YY3L 1WI5A 5IYDH 1E1TA 1K0RA 1OXUA 2GN5A 3CAMA 3IRBA 2R93G 4B3MQ 1V9PA 4DR5Q 3CPFA 3SGIA 1XNQL 1N9WA 2CQOA 2R7FA 4R4CA 3J81i 2K5NA 3HOUG 2K5VA 4AYBE 3NEMA 3I55A 4B3SQ 1FJGQ 4NXNQ 4JI1Q 2PI2A 3ERSX 2K4KA 1LTLA 1P8LA 1N8RC 1IYJB 4OX9L 4DR6Q 5JEAJ 3JAMc 1GM5A 1IBMQ 3RNUA 1BVSA 4O0AA 3CD6A 2GVBA 5FLXc 2IHEA 3CCJA 4LFCL 1U0LA 5ELNA 2ZJRA 2UUCL 4ME3A 4JI2Q 1A8VA 3CW2C 1VQPA 4QL5A 2NVTH 5IP7H 5BR8L 1X56A 2CFMA 3F1ZA 1IXRA 3J7A5 1Y1VG 1HZCA 1HNWQ 4Y7NH 3ULLA 2EIFA 4LUVA 4YY3Q 1Q46A 2IX0A 2NVYH 4GLAC 1PH1A 1IBKL 2YTXA 2Y0SE 5GROA 4LWCA 5HGQA 2JA8H 4LFBQ 2JA7G 4AIMA 2QA4A 3PUVA 2FXQA 1QUQB 5M3MG 4X65L 4A3EG 1XPRA 4NXMQ 1HR0Q 2VNUD 4DK6C 3CQZH 1V43A 4FDBA 4LF9L 1SR3A 1N36Q 3PUWA 4J15A 1A62A 2MNAA 1LUZA 2VQFL 3KF8B 1NMFA 1MIUA 2ES2A 1N33Q 2HT1A 5C0XG 5M5YH 4GLVB 1YHQA 1VQ6A 4GOPA 1MJCA 3H3VI 2H5XA 4OX9Q 1HZAA 1PFSA 2K5HA 3GD7A 1KXLA 1JJGA 4UP9A 3TS2A 1OXSC 4DUZL 4DV2Q 1QZHA 1PH8A 1M1KC 4B3RL 2UUAL 1WCMH 3GTKH 2ID0A 3PSIA 3KOJA 4KLKA 4LFCQ 4A93H 5EAYA 2UUCQ 4JI6L 3LGJA 4DV4L 1I94L 3M7NA 4NPSA 4A3IG 2I5HA 3TREA 3UE1A 2JA5H 1IL2A 1PH7A 3K0XA 4A76A 2NN6I 2JA6G 2R6GA 1D8LA 3OTOQ 4QGUA 4JV5Q 2L15A 2UXDL 1TWGH 1Y14B 5GAGC 1SLJA 1X65A 2HHHQ 4IOCA 1TWCH 1FL0A 3KLWA 3WWVA 4DUYL 2NVQH 1PV4A 3UE0A 3CF5A 4BBSH 2D62A 3HOXG 4A3BG 4HJ7A 1JJ2A 4BY1H 3M4PA 4Y52H 4MZ9A 4LNQA 4AYBG 1J5EQ 1V1QA 5E7NA 5M3MH 3D31A 4A3LH 3F2CA 1QVFA 2R7DA 3J7ZC 3CCRA 1VQMA 2VZAA 1KC8C 2VUMG 2UXBL 1KQSA 1L1OC 2BA0A 5C44H 1TXYA 3T1YL 1EIYB 2I0QA 4L5QA 1K73C 1RL2A 3A5ZB 4O2DA 4PG3A 4GN3B 5FLMG 3E0EA 1S72A 4UP7A 5M3FH 5DLQE 2JE6I 4X66L 1WJJA 4DR4L 2Z6KC 1XMOL 1B70B 3G48A 4B3TL 4YCUA 4YWMA 3E9HA 1N34Q 4DUZQ 1Q7YC 4LF8L 4B3RQ 1EUJA 2K50A 1PH9A 1KAWA 2CCZA 1HNXL 3PO3G 1HR0W 4PZ7A 4DV4Q 1VQNA 4WJ4A 4JBKA 4A3DH 3CCUA 4KHPQ 4EX5A 4OO1G 1IBLL 1VQCA 4R4TA 3I4MH 4A3IH 2F52A 3ULJA 2Y0SG 5C4XG 5J3BA 1OXVA 1OXXK 1VQ8A 4HJ9A 2UXDQ 4AQYL 4POFA 4X62Q 3TS0A 1FVIA 4JC0A 4L5RC 2IY5B 3PUYA 2R92H 1AH9A 3KJOA 1JT8A 4JG2A 4P73A 3HOZG 5H1SE 1X9NA 4X6AH 3PGZA 2E2JH 3CCSA 1JE5A 3K7AH 3CPWA 1VQHA 3GTOH 4NB3A 4DAMA 4DV5L 1KD1C 4LW1A 4OWWB 2DUDA 2WAQG 2ASBA 3S16H 2R7ZG 4YCVA 4DV7Q 2UXBQ 1C7YA 4JI5L 3F8TA 3KF6A 4BA2I 4P75A 1I5FA 4HIKA 5GAHC 3EN2A 4RMFA 1XNRL 3J80i 5IYCG 3W5OA 3CCEA 5LMUQ 1B8AA 3GTJH 1XMOQ 3OW2A 1DGSA 2WB1G 1SFOH 3E9IA 4L5SA 4DR7L 5C3EH 3PIOA 4LF8Q 3H0GG 1YHAA 4A3CH 4GKJL 1PH6A 2E5LL 4GS3A 1G291 2Q2IA 3KYHC 3ZJYC 4HIOA 3PO3H 4DPGA 4AH6A 4A3GH 1MKHA 4KHZA 5IT9c 1AE2A 4JI0L 5FJ8G 2BH2A 3HOWH 4A3FH 1VQEA 1VQKA 4DR3L 2B63G 1EQRA 3S2HH 5ELOA 1KHIA 3PO2G 3A5UA 3GO5A 3M9BA 4A3JG 2QEXA 2Q2UA 3ULPA 2F4VL 2MO1A 5GAEC 1VQ4A 2KENA 1YBYA 1PVOA 2ZTEA 1ASZA 2AWOA 1A0IA 1CKNB 2WP8J 3D0FA 2K14A 3CC7A 1K8GA 3A74A 1VQGA 4BXXG 3KDFB 1QVCA 4GNXB 3AYHB 3HOYH 3HOZH 3RZDH 2KHIA 5IY0A 4DV5Q 2EQSA 2UXCL 1UEBA 4IO9A 4LFAL 3K81C 3ICEA 1YIJA 4YWKA 3J81j 1YJWA 2MO0A 3BJUA 5IYBG 5LMNL 3M3YH 3HKSA 4C3JH 3KF6B 1XNQQ 2R93H 1XPUA 1H95A 2ZM6L 3F2DA 3PUZA 3JAMi 1EWIA 3STBD 2V1CC 2VW9A 3G71A 4UY8C 4DR7Q 2OQ0A 2Q2HA 3I7FA 1FGUA 3NELA 4TQUS 1VQLA 3I4NG 2HQLA 2AHOB 4GKJQ 4C2MH 2WAQE 3HOUH 1GVPA 2RHSB 4JI4L 4MTNA 4LF4L 4JI0Q 2NZHA 1VS0A 3S17H 2N49A 2JJQA 5IP9G 1IZ6A 1T9HA 2VS1A 2GVAA 1VQBA 1L2FA 1W3SA 3EIVA 3I56A 4HJAA 4IOAA 1C0AA 1Q86C 2LXKA 2WB1E 4DK3C 3CC4A 4LUOA 3PO2H 2RHQB 4R1JA 4A3JH 1J6QA 4DAYB 1SRUA 5BR8Q 1HJPA 4JBWA 3NBHB 1L1OA 2ATWA 3A0JA 4JOIC 1SE8A 1VQ7A 1RIPA 1ASYA 3ER0A 3PCOB 4LUZA 4QY7A 3S2DH 2N8NA 2YYZA 1JJCB 1K83H 2UXCQ 4K0KL 1Y1VH 4LFAQ 1P16A 4JI8L 1IBKQ 1Z9FA 4HIMA 3M4QA 2WFWA 4BA1I 2Z6KA 2VL6A 1PH3A 1KIXA 2IX1A 1BBWA 1O7IA 1X55A 3T1HL 3PF5A 2D0OA 4HIDA 4QJFA 3CMAA 1YNXA 5LMNQ 4X65Q 2JA7H 2LXJA 2A19A 1LM0A 4IPHA 4LF6L 2KBNA 2D0PA 3TEHB 4A3EH 4LF9Q 4OO1I 4A3KG 1OTCA 2PQAA 1PYBA 4DV3L 1SROA 5GADC 2VQFQ 2ZTDA 3JC66 4HJ8A 2B3GA 1HNZL 2JEAI 3L7ZC 4OWTB 3L2PA 2C35B 4LF4Q 2ZTCA 1BBUA 2YV5A 4GOPB 3S1MH 1W2BA 3TQYA 3KFUA 4GKKL 4DKAC 4BY7G 3K7UC 5M5XH 3M4OH 5AJ3L 1E1OA 3B6YA 4BBRG 2UUAQ 1A63A 1XPOA 4WJ3M 3FKIG 4IFDI 3S15H 4JI6Q 2LSSA 1X3EA 3K8AA 3PIPA 4H02A 1I94Q 5IYDG 1S40A 1U5KA 2OTLA 2PNHA 4YCWA 4YWLA 1PHJA 3S1NH 3RR5A 1VQJA 4PZ6A 2JA6H 1K9MC 1X54A 4IFDJ 2NN6G 4KI0A 3KJPA 1YITA 2NZOA 5M5WH 1XTDA 2K52A 4DUYQ 2F3IA 3UDXA 1VQDA 2AWNA 3T1HQ 4A75A 1Q81C 2E2HH 3H15A 4JI3L 3BZKA 2YU9H 2BH8A 4PZ8A 3HOXH 1Q82C 4LF6Q 1I6HH 3MEFA 4A3BH 4JBJA 3STBC 2YTVA 4B3SL 4NXNL 1X3FA 4DV3Q 1WOCA 2A8VA 1HH2P 1SN8A 4DR6L 2MQHA 2DGYA 3T1YQ 1HNZQ 1UE5A 1IBML 4RG1A 2VUMH 4OWXB 3GTGH 4JYAL 3J81c 4DR2L 3CCMA 1MJEA 4X66Q 5FLMH 3U58A 4DR4Q 3CCLA 1BKBA 4B3TQ 4JI2L 1YHBA 1TWAH 1E3PA 5IP7G 4UP8A 2Q2TA 5K36G 5LMNW 2N78A 1YJ9A 1Y1WG 1HNXQ 4LF7L 3W1GA 1EYGA 2A1AA 3VDYA
chains in the Genus database with same CATH superfamily
1EYCA 1PRTC 1IBLQ 3PIO3 4MTKA 3W2DA 4A3EB 4DV0L 2F0HA 1WTPA 4LFBL 1EWCA 1EZ6A 3CCQA 1F2LA 2EY2A 2EYFA 3FEWX 4KMUC 3CMEA 3U4VA 1YJNA 4GNXC 2K5DA 5FO8B 1E7ZA 2JP1A 4H13C 3BU2A 1G51A 1QZGA 4JI5Q 2P5ZX 2R7ZH 4EQPA 1X6OA 1L0WA 2LY7A 1VF5C 1RDPD 4DR2Q 3S1NB 1AFPA 3SE0A 2JA5G 3PV0A 4JI7L 3BDOA 1NBWA 4MN3A 3CXCA 2M00A 4ZKCB 2JK8A 5KYIA 5JEAG 2EY6A 4OONA 3M85A 5IT9L 1Y8NB 3I4OA 4CKBA 3K57A 1VF7A 5I9OA 4A3BB 4HEDA 1Q90A 2HIXA 1TT2A 4DV0Q 4BY1G 1HZBA 3BZDB 1R4PB 4P74A 3U4ZA 3GTGB 3K0YA 2PW5A 2F4VQ 3I72A 1EIFA 3HEJA 4RGMA 1GXDC 2E2IH 1AZPA 4BXXH 2EDGA 5M3FG 1NY4A 5JVG3 3D4WA 4NDXA 2OQKA 4K2KA 5IGBA 4KV6A 1NMGA 2YTYA 3KBGA 3FP9A 3MXNB 4ZYSA 3NTIA 1KLGD 2C9OA 2Y0SB 5C4XB 1KL9A 1HUMA 4JI7Q 5TSSA 1VQOA 3TZDA 4DV1L 3HOVG 1MI2A 4TVAB 1ENAA 3CC2A 1PYSB 4GOPC 5JEAH 1TWHB 2F0TA 4EQNA 3OSOA 4O42A 1SNOA 5HY6A 2H4OA 1G6PA 5IP9H 3T51B 4JCVE 1S5DD 3DEOA 4FXGC 3BDCA 3RZOB 4QQBX 2E76C 1LTBD 3BVMA 3RLOA 4RFBA 3GTMB 5FO9B 2CWAA 4J6HA 3PIP3 5EJWA 2CWPA 1VQAA 3H0GB 2MJ8A 1EZ8A 3L0OA 5KNBA 1Y1WB 5J22A 1PZJD 1JQYD 4A3CG 1VQFA 1SE2A 3I8ZA 4A3GG 4JI1L 3HKZG 3J80c 2B63B 1WTXA 3HOWG 4PV1C 4A3FG 4BS9A 1LT5D 3M7GA 1O7YA 4DV1Q 3J80E 1LTSD 4OIKA 3F2BA 2OEOA 3HOVH 2NVXB 1UWVA 2SEBD 1JB3A 4GLXA 4GKKQ 4K2LA 1EOVA 1R4QB 3HOYG 3PF4A 2JEBI 3H3VH 3CRLC 4IPDA 4OXPA 1Q3LA 4FXKC 3KLRA 3MVVA 2JQOA 3S1RB 4IFDG 4YY3L 4HSVA 1NR4A 2GN5A 5JVH3 2QILA 3IRBA 2F0JA 3H94A 2QKIC 1KAAA 4WRDA 3U9SA 4R4CA 3BYYB 2RBMA 3S9WA 3HOUG 3J80L 1K28A 3ONAB 2PI2A 4JI1Q 3ERSX 1QG7A 3EFXD 1IYJB 3BVGA 3JAMc 1GM5A 1JR0D 1PRTB 1S5FD 5D65A 4M8AA 2IHEA 3CCJA 2F0MA 3JAME 2UUCL 3E3XA 4DAYA 1A8VA 4L8JA 4QL5A 2MPMA 4XYQA 3J7A5 2IW3A 1Y1VG 4LUVA 3SDZA 4CDFC 4YY3Q 3Q23A 4GLAC 3QB3A 2Y0SE 4LJZC 1B9MA 2QA4A 3NBIA 1RD9D 4FDBA 3FMCA 3SR1A 1IL8A 5J1ZA 1LUZA 2HT1A 2ES2A 1EYAA 5DAUA 4Q0FA 1SE3A 3I91A 4EGVA 5I9PA 3J7AF 1R9TB 4ZUJA 3JAML 2F0FA 3GD7A 1JJGA 1FR3A 1OXSC 1TS5A 5EKIA 2A68D 4ZLTF 1QZHA 1PH8A 2O4XA 2EYHA 3WDNA 2LFNA 2UUCQ 2KOLA 3LGJA 5EPKA 1I94L 4A3IG 3TREA 2L5TA 1PTOD 3OTOQ 1UEAB 4QGUA 2F0DA 3TZUA 2UXDL 1TWGH 2HHHQ 1SLJA 5JAVA 2M9VA 4IOCA 1FL0A 3KLWA 5DEHA 5ELFA 4DUYL 3HOXG 1JJ2A 4Y52H 4QB4A 1CTMA 3EA6A 1GJXA 4A3LH 4RKBA 5D3IB 1QVFA 4RGNA 3P7JA 5C44H 3T1YL 2NVTB 4PG3A 5FLMG 1KDAA 4UP7A 5DLQE 2JE6I 3AMUA 1WJJA 2TSSA 1B70B 3G48A 4YWMA 1EUJA 3WOEA 1X3PA 4KHPQ 4OO1G 4IUNA 5BN4A 4A3IH 3ULJA 2UXDQ 4AQYL 4DU9A 3A55A 2A6HC 1JCKB 4JC0A 4R8IA 3PUYA 2R92H 5G3LF 1HCZA 2F3VA 5EPJA 1IW7C 3PGZA 4ZRZA 1CHPD 4I65A 3TRZA 1VQHA 2QF7A 4NB3A 2ASBA 3GTOH 3GTKB 1EL0A 4KY7A 4QMGA 3D4RA 1C7YA 1SMYC 3F8TA 3KF6A 4P75A 2JA5B 1SEBD 4PQXA 5LMUQ 1AN8A 1BUVT 4CDEC 1DGSA 3OW2A 1WTRA 1SFOH 3MZ5A 4L5SA 2NVQB 5CV9A 4C3HG 5CV6A 1GUSA 4GKJL 1JWSD 4F8MA 2E5LL 3ZJYC 2Q2IA 3KYHC 2EYPA 4BY1B 4DPGA 1T5XD 4AH6A 1B2TA 2PZTA 2BH2A 2RDFA 3DMUA 2E2DC 4DR3L 1VQKA 1I4HA 3PO2G 3M9BA 4HSPA 4WJWA 1VQ4A 5M3FB 2AWOA 1K8GA 1VQGA 2X6LA 3AYHB 2BE5D 2KHIA 2EQSA 1UEBA 4IO9A 3T13A 3ICEA 1YIJA 3MEHA 1YJWA 5IYBG 2ZXPA 3M3YH 3HKSA 3KLSX 1XNQQ 2R93H 2ZM6L 2VW9A 1EWIA 3G71A 4UY8C 1WTQA 3PQIA 1FGUA 4QF4A 1LT4D 3I4NG 4GKJQ 4C2MH 1T5EA 2WAQE 2E2JB 4QUCA 4JI4L 1DD2A 1FGBD 1HQMC 2HDLA 3DUZA 3S16B 4AYBB 1GUGA 3EIVA 4IOAA 2HQEA 1Z7TA 3PO2H 2G9DA 2F0SA 1PZKD 4R1JA 1BCPD 4DAYB 1E2ZA 1L1OA 1SE8A 1RIPA 3A8JE 1ASYA 4QY7A 3S2DH 1B53A 1D6EC 5D14A 3MXPA 2CW0D 4HIMA 3M4QA 1IBKQ 3C1FA 2Z6KA 1KIXA 1S4ZA 1BBWA 3T1HL 4A3GB 2D0OA 3HOWB 4C3IG 4A3FB 1EY5A 2LXJA 4IPHA 4LF6L 1E0BA 2D0PA 2KBNA 3TEHB 4A3EH 1QWYA 3VA5A 1F2MA 3S2HB 4XQQA 2ZTDA 1HNZL 2CH4A 2A73B 4U68A 3FDTA 3HOYB 1DXMA 3I3CA 1BBUA 2YV5A 1DJRD 1W2BA 1NCVA 2KCCA 4BY7G 4H7BA 1HFGA 2F0QA 4BBRG 1STHA 1XPOA 4WJ3M 1W6KA 5CV5A 3NWSA 2RA4A 1U5KA 3S1NH 4PZ6A 1PRTF 1X54A 2NN6G 3KJPA 1YITA 2NZOA 5A2QE 1IYVA 1JOKA 3HOUB 2F3IA 5EKLA 4PNYA 2AWNA 3T1HQ 3NTKA 4JI3L 4KD4A 3C3LA 4LF6Q 3MEFA 4E6IA 4A3BH 3STBC 2YTVA 4B3SL 2F0PA 1X3FA 1WOCA 2EZVA 3L3OC 1TY0A 3CHBD 1HNZQ 3TP7A 3GTGH 2B2YA 4JYAL 3HGBA 4DR4Q 4XQNA 1Y69U 4JI2L 4OEMB 5IP7G 1Y1VB 2A74C 2SOBA 2KEEA 1K8OA 4LF7L 1YJ9A 1Y1WG 1HNXQ 4EVOA 2A1AA 3VDYA 4MNOA 1JMCA 4R4IA 1CKMA 1DOKA 4XTCS 5A2QL 4K14A 2JA8G 3K59A 2VQEL 5C4XH 1EY6A 5DM63 4NXML 3LX0A 2K6AA 1D7QA 3KF8A 5C0XI 3D4DA 2EYJA 3K80C 3M4YA 4JI3Q 2LS01 5FK9C 1F9PA 4K5XA 1N33L 1LYLA 1TWHH 2KUMA 2PI2E 1HPCA 1EU3A 1S5BD 1V1PB 3S15B 5T1IA 2F0UA 4RHRA 2XRQD 1WCMG 1SNDA 2F0IA 4JYAQ 4A93G 1SYDA 1B9NA 3RZOH 2DY7A 3CCVA 3UDFA 1SMXA 5IYCH 2L55A 3GTMH 2UU9L 5M5WB 4G7OC 4LF7Q 3H0GH 1RJTA 1S3OA 4JV5L 1K3RA 3UDIA 3HKZE 4I7ZC 3HOXB 1Y1WH 2L1BA 3Q8DA 5GQOA 2VQEQ 2B2WA 1G6ZA 1JWUD 1X3GA 2B2TA 1CSQA 2B63H 4IPGA 2ALYB 2EYLA 1J5EL 1XTCD 1F2YA 2NVXH 1CUKA 3RLFA 1TY2A 3DHQA 4K8JA 4POGA 4X64L 1LT3D 4IPCA 1MBYA 1N34L 3RD4A 1HQRD 3S1RH 4A3DG 2RF4A 2UUBL 4X3SA 1RODA 2UU9Q 5JJIA 1GO3E 4DXGA 4X3UA 5IE8A 5ELCA 5EGTA 4CJ0B 1H9MA 4FNFA 5C3XA 2OCEA 4DR1L 1CKOA 3GTLB 1Q1BA 1NJIC 3OWEB 3L9AX 4ZAIA 3U50C 4IJLA 3SK8A 2RDGA 2L4NA 3AQQA 4IJHA 1A3TA 4NKLA 4DV7L 2R3ZA 4ILWA 2FJ2A 2BA1A 4DNIA 1L1OB 4K0KQ 4DF7A 4C3HB 1VCIA 4FF2A 1U4MA 4X64Q 3FPPA 2PMZE 5CYUA 2K7VA 1SE4A 2UUBQ 4HN7A 1UE7A 3HFZB 4DAPA 3RLNA 5D3DA 4KY5A 3S14B 1VMCA 1SXTA 4DR1Q 4X3KA 1ESRA 2VY3A 1KLUD 3BDLA 1GD7A 3KDFA 4GNXA 5AJ3Q 3FHWA 1R9TH 1QVGA 2XWBB 3TP6A 4OL7A 2G9HD 2KCNA 4R4QA 1UE6A 1A2TA 5JPNC 3VR5A 4DK1A 5IYDH 2DNCA 5C4ZA 1K0RA 2J7ZA 1V9PA 4K6DA 5CBEE 3CPFA 3SGIA 3I4NB 3DWPA 1I3QB 2R7FA 2SNSA 5FO7B 3J81i 3NEMA 4HAEA 1DCZA 4NXNQ 3GV6A 4OHJA 4V190 2NUCA 1LTLA 1P8LA 4OX9L 4KKUA 3TBIB 1IBMQ 4XYOA 4CDCC 5FLXc 1NR2A 4LFCL 1U0LA 2ZXRA 5NUCA 1CT1D 5E4XA 1VQPA 4QUFA 3MFYA 4OGQC 5FLXE 2NVTH 5BR8L 1X56A 2ZT9C 5K36H 3F1ZA 3QOJA 4IURA 4C3IB 1Q46A 1CM9A 5K5PA 2YTXA 4LWCA 3K58A 4LFBQ 1SYCA 4IALA 4LF9L 2VB3X 1NSNS 4IUUA 3RMHA 2MNAA 3KF8B 1W6JA 3H91A 2JSOA 1BOSA 1F77A 1YHQA 4GOPA 4BY7B 3BG3A 3H3VI 5CV7A 1TWFB 2H5XA 2ICEC 4BBRB 4OX9Q 1HZAA 1AEXA 1KXLA 2F0EA 2A69C 3GTQB 3TSSA 5FLXL 2F0WA 4DUZL 1M1KC 2UUAL 3GTKH 2ID0A 4KLKA 4LFCQ 1F9QA 4DV4L 2VXWA 4NPSA 2I5HA 3UE1A 2JA5H 1PH7A 4LK1C 1LV9A 1Y14B 1STBA 1I4QA 5G3LD 2NVQH 1PV4A 1ET9A 1PZID 5IGGA 3GV3A 4BY1H 3M4PA 1RTOA 4AYBG 2FFKB 3D31A 1MHWC 2BCOA 2N88A 3DM1A 3CCRA 4G57A 4KJOA 2BA0A 3ERQA 1EIYB 1NAPA 1C48A 2B8FA 4O2DA 3E0EA 5M3FH 4X66L 3QOLA 1K3BC 2WACA 5IGEA 1PDQA 4Y7NB 4B3TL 1HFNA 4YCUA 4DUZQ 4LF8L 3IFDA 3ZYYX 5HGTA 2AQ2B 2JA8B 4WJ4A 5FKAC 1VQNA 4DV4Q 3CCUA 2BE5C 3SK6A 2F3WA 1MSHA 5J3BA 1OXVA 1VQ8A 1RKNA 4ZCKA 3HZXA 4L5RC 2IY5B 5M9OA 1BO0A 3VR4A 3H09A 5COYA 2L12A 2E2JH 3E5SA 1BR9A 2WKCA 4OELB 1WCMB 2DUDA 3S16H 4A93B 4ODGA 1G2SA 1FNWA 5ELEA 5GAHC 3EN2A 3OOCA 1XNRL 1BF4A 1PXUA 2WB1G 1TWCB 4DR7L 4LF8Q 3R8BA 4A3CH 3NK9A 4N9PA 1ILPA 1BCPC 3TDQA 4A3GH 3HOWH 4KHZA 5T1GA 1AE2A 5M3MB 5FJ8G 1KTKA 4JI0L 4A3FH 5ELDA 4L6TB 3Q24A 5C5LA 1EY8A 1ZXTA 3S2HH 2E74C 3A5UA 1Z6HA 4CKCA 1HHVA 4XDXA 3Q22A 1YBYA 1PVOA 1A0IA 2K14A 5JPMC 3KDFB 4GNXB 3HOYH 5KEEA 4XXEA 1SNPA 2UXCL 4R9WA 3C1EA 3K81C 4IFDH 4A3DB 4YWKA 3MAQA 2AUKA 1HUNA 1YNND 1O7ZA 5KNCA 1XPUA 1H9SA 3A54A 3PUZA 5IGCA 4DR7Q 3H3VC 4TQUS 5CMDA 2LMCB 3ITPA 1KNAA 2Q8TA 3G6JB 1WVLA 3HS0C 3HOUH 3OIQA 1GVPA 2RHSB 4HTHA 2V4DA 4LF4L 3V2TA 4JI0Q 2NZHA 1SSOA 1TU2B 3CKIB 1IZ6A 1T9HA 2VS1A 2GVAA 1W3SA 1Q86C 3CC4A 1SJED 4LUOA 1DOLA 1J6QA 3GTJB 1PRTD 1HJPA 1I4RA 1UUPA 4JOIC 2F0KA 4LMQD 3ER0A 4LUZA 2UXCQ 2N8NA 2YYZA 1EQVA 3NP8A 1Y1VH 3X3MA 4JI8L 1WTHA 4ULLA 3MFGA 3VYTA 1PH3A 1EEID 2O2LD 2IX1A 3PO3B 1O7IA 1X55A 4TKOB 4G7HC 4QJFA 1WTWA 1YNXA 2WKDA 1LM0A 4OO1I 4A3KG 1OTCA 2PQAA 1QCBD 5GADC 3JC66 3X3NA 2HD3A 2B3GA 1G8ZD 2SDFA 2JEAI 2XIWA 3IFTA 2JXMB 3R93A 3RZDB 1ZYRD 4LF4Q 3HP3A 4GOPB 1CZWA 3TQYA 1Y8OB 4ZK9B 3KFUA 3K7UC 3B6YA 4JVZA 5I6YA 3FKIG 4FVMA 3S15H 1I94Q 3NTHA 4YWLA 2NTTA 1PHJA 3RR5A 1CZGA 3KK7A 2D9UA 2MP1A 4KI0A 5M5WH 1XTDA 4DUYQ 3NXWA 1RHPA 1ILQA 2BH8A 1V1PA 3LWEA 3HOXH 2D5DA 3ND8A 1D1KA 4JBJA 1WTOA 1SN8A 4DR6L 2MQHA 5BN5A 3T1YQ 3EROA 4A3JB 4OWXB 4I7AA 4H0LC 3Q6SA 5FLMH 1F9SA 2DY8A 3IL8A 1KDBA 1E3PA 2FMCA 4NP5A 2Z4HA 2K03A 2N78A 2CKZB 1Q12A 1LLRD 2QEJC 2XSCA 1BBXC 2K5QA 4GN4B 4OO1H 1O80A 4APVA 3G4SA 1EIGA 2K32A 1PMRA 1RCVD 3SK4A 4B9WA 4AQYQ 3DLLA 1HR0L 1EFWA 2ENBA 3I70A 1OXTA 1N36L 2N3SA 1TIID 1YZ6A 3S1MB 1QB5D 2ZJQA 3M4OB 1IHZA 3MTSA 3GTLH 2L0CA 4QIWB 5C0XJ 2RCNA 3PUXA 3TMEA 3CP0A 1GKHA 4DV2L 3FVQA 1ESFA 4LAAA 4LF5L 1PLFA 2H1EA 3T16A 1RTNA 5J39A 4HJ5A 4OIJA 1LTRD 2YU9B 2E2HB 1HZ9A 2KVMA 4C3HH 2E5LQ 2QW7A 4K5VA 1JB7A 1I6HB 1E22A 4BBSG 1QILA 4DR3Q 1NTGA 2I5LX 5KNDA 1U4PA 1YNJD 3VR3A 2IT1A 3S14H 1IYUA 1GUNA 1LT6D 4ZKBB 2O5JC 3AFQA 1AE3A 3ND9A 5CV4A 2TMPA 5DNFA 4DV6L 1ICWA 3MXUA 3GTPB 3D8GA 2AMCB 1CA5A 5IYBH 3S1QB 1STEA 2ZM6Q 1A2UA 4LF5Q 2KCMA 1PA6A 3I4MG 3LNNA 1H9SB 3NENA 1Q1EA 3I4NH 1GUWA 1Q8KA 4X62L 3DXJC 4JI4Q 1I3QH 2J4XA 2Z0SA 2B2VC 1VQ9A 2PPBC 4F88A 1NNXA 2IX3A 1KRTA 4TSSA 5C4JB 3IAYA 4P72A 1EQQA 2IHFA 1TS2A 4FF3A 2WB1B 2Q8IB 4XIGS 1ENFA 4DR5L 4DV6Q 1D5MC 1M90C 5C3EG 4BWGB 4H44C 4FF1A 1I4GA 4C3IH 1FJGL 3TP8A 4FF4A 1KRSA 2PQAB 2VB2X 3UDGA 4NW2A 5C4HA 4PMCA 3Q0AA 2SNMA 4HCSA 1EY9A 4KK7A 3TP5A 2PQEA 2AQ3B 3EBEA 4GN5A 1XJVA 4QIWE 4BY7H 3DWAA 1TWFH 4UPAA 4BBRH 5I4DA 1A15A 2Z4IA 4O1NA 3GTQH 1SAPA 1H9KA 2G5DA 1DYQA 2Z9HA 2KA7A 4C3JG 3CAMA 1VMPA 1V8QA 5EBCA 4DR5Q 1I50B 2NN6H 3T56B 1N9WA 2Z6BA 2MHVA 4N8X1 3DEPA 2HCCA 2K5NA 5CC4A 2K5VA 4AYBE 4B3SQ 3IKJA 1FJGQ 1G91A 1N8RC 3F2UA 5JEAJ 3R2IA 1EEFD 1BVSA 4O0AA 4V0BA 3VA7A 3CD6A 2GVBA 5I2YA 5ELNA 3N6RA 4A3MB 4JI2Q 4DK0A 3NBHA 5IP7H 4G7ZC 2XN9C 4Y7NH 3ULLA 1JWMD 2QDLA 4ZQ3A 1PH1A 4CJ2C 5GROA 2A6ED 4A3KB 2JA8H 2JA7G 4AIMA 1SNCA 2OF1A 1FNUA 2FXQA 3PUVA 5M3MG 4X65L 1XPRA 4NXMQ 2ZXOA 1IW7D 4KTAA 3PUWA 4J15A 1A62A 1ML0D 2OT2A 2VQFL 1BNZA 1N33Q 1NMFA 1MIUA 5C0XG 5ISRA 1LO5D 1VQ6A 1SMYD 1MJCA 4FP5D 2J0TD 1PFSA 2K5HA 3FKIB 5IIFA 3TS2A 3NQIA 4B3RL 1WCMH 4A93H 4JI6L 2CVRA 2GA4B 1IL2A 1VDZA 4A76A 2JA6G 4ME5A 3K5LA 1D8LA 1TS4A 5KGUA 4JV5Q 1X65A 2K5WA 1TWCH 3OHXC 4RH6A 3WWVA 2IPKD 3UE0A 3EVQA 4MIUA 3V05A 2D62A 1S5ED 4HJ7A 4IUTA 4WFN3 3SEBA 1MGSA 3HRZC 1J5EQ 5M3MH 2B8GA 4Q5VA 1SNMA 2XNAC 2R7DA 2DJGC 3J7ZC 1VQMA 2VUMG 2K28A 3C2PA 4CDDC 2I0QA 3W3AA 4L5QA 4UHVA 5CORA 1K73C 4GN3B 1S72A 2EY1A 1XMOL 4KJNA 3D6WA 1N34Q 2NVYB 1HA6A 1Q7YC 4B3RQ 2K50A 1KAWA 2E75C 1F2ZA 2CCZA 1JOOA 2K05A 3PO3G 1QJOA 4A3DH 1RF2D 4EX5A 1G2TA 1IBLL 1VQCA 1BDOA 3CQZB 4R4TA 1Q8IA 3TS0A 3C46A 1FVIA 5EPLA 1A3VA 2B2UC 5M5YB 5CBAE 3O13A 1YNNC 3KJOA 2I46A 1FYCA 5H1SE 4X6AH 1J9OA 1JE5A 3CPWA 3M7NA 4DAMA 1KD1C 1SYBA 2WAQG 2R7ZG 3OMGA 4YCVA 4DV7Q 3QJYA 2M2LA 5BN3A 4JI5L 4BA2I 1I5FA 4HIKA 1I4XA 3J80i 3GTJH 1XMOQ 2A68C 3E9IA 4DXFA 2RSNA 4UAIA 1YHAA 4P2CB 4ABNA 4BBSB 1JICA 2WV6D 4GS3A 1XXGA 1G291 4RCOA 4HIOA 3PO3H 1O78A 5IT9c 1PTOC 2RCFA 1CK1A 2F0OA 1AW7A 3NQTA 5KYLA 5IT9E 1QNUA 1KHIA 2F1MA 1B50A 3GO5A 4A3JG 2F4VL 2PZUA 2KENA 1ASZA 1EOTA 3D0FA 3CC7A 3R2TA 4BXXG 1QVCA 3RZDH 2I07B 5IY0A 4ID6A 5HURA 1HTPA 5KIXA 2MO0A 3I90A 3I4MB 5LMNL 1ZYRC 2NWGA 4G4KA 1NUCA 3F2DA 3JAMi 3STBD 2V1CC 3I7FA 3NELA 1C4QA 1CQFA 2AHOB 3J7AV 2PO4A 3K7AB 4MTNA 5IODA 1SDFA 5KRUA 3P1HA 3NHHA 4FYDA 2N49A 2JJQA 5IP9G 3K5NA 2Q8RE 1L2FA 5IOCA 5LHY1 1C0AA 4HR7B 1II3A 2ICIA 2LXKA 4A3JH 1HXYD 1EY0A 1SRUA 4JBWA 5BR8Q 2K1BA 3NBHB 4XQJA 3A0JA 4S3SA 5C3EB 4K8IA 3T53B 4DFAA 1JJCB 3K5MA 1P16A 1WD0A 1CI3M 2VL6A 3PF5A 1Y8PB 1U4LA 2MUYA 3P75A 5LMNQ 1GUTA 2A19A 3LWUA 2RDHA 2LKVA 4LF9Q 4C1NK 4CHTB 1PYBA 1SROA 1EY7A 1GUOA 5F2DA 5AFWA 4UDUC 4XT3B 3L7ZC 3HOZB 4B08A 2WINB 4Z9CB 2C35B 3L2PA 1TQOA 3S1MH 5L37A 4GKKL 3M4OH 2UUAQ 1EYDA 1ONLA 4IFDI 2L9HA 3QIAA 3AB9A 4TRDA 1X3EA 3K8AA 5EQ0A 4C3JB 1S40A 2OTLA 2PNHA 4YCWA 1CA6A 2DJFC 1B44D 1S5CD 1K9MC 1DM0B 1X32A 2K52A 5FOBB 3UDXA 4L63B 1VQDA 2YU9H 1Q81C 2E2HH 1JE4A 3H15A 1STNA 4PZ8A 2HCIA 2F03A 3S17B 2K04A 1CFMA 1I6HH 4RWSC 1SYFA 2A8VA 1HH2P 4ZUIA 1UE5A 1H9JA 4RG1A 3J81c 3CCMA 1MD2D 5E1FA 1MJEA 1EIHA 1D1IA 4X66Q 3U58A 3CCLA 3J81E 4B3TQ 1K83B 1YHBA 2K01A 3D6CA 1YNJC 2F0NA 5LMNW 3W1GA 1X3QA 1LTGD 1EYGA 2JA7B 3GTPH 1SYGA 2EXDA 4ALPA 1QUQA 3BZCA 3S1QH 3RN5A 1L0YB 5JJLA 2CW0C 1UE1A 1WFQA 1EU4A 1WD1A 3AFPA 3AEVA 1D5ZC 2B29A 2I5MX 4PMWA 5M5XB 1XMQL 1C9OA 3MXGA 1A6XA 3K6OA 5E3FA 3W1BA 1WYDA 1B3QA 1YEZA 2D2CC 3J81L 1N32L 1B1ZA 4JK1C 2OTJA 1PTOB 1XNRQ 1AP0A 1Z47A 3CU7A 4A4IA 4DA2A 2JA6B 3D3RA 5C4JH 1YI2A 3URYA 1PH4A 2NZ1D 4YHHL 3R3OA 4RGOS 4JOIA 2FMMA 3S24A 1A3UA 3OTOL 4HJAA 2VNUD 2IWHA 1QOHA 1CQVA 1NE3A 2HHHL 1VQIA 5DM73 1JOQA 5FJ8H 4CKEA 2E8GA 2VUMB 4A3LG 3QO2A 3BS1A 2AKWB 3P20A 1O7LA 5C44G 4A3MG 1JC7A 1B7YB 1TWAB 3CRKC 4R8NA 1XMQQ 2L11A 2XGTA 3UI2A 1N32Q 1FNVA 2R61A 5EKKA 3G6EA 4CGYB 3VR2A 2RSOA 4MHEA 4KHPL 5JJKA 2ZJPA 1YVCA 4YHHQ 3WOFA 2JA9A 1I50H 1CSPA 2CH4W 3T4AC 2QGQA 2MFIA 2IJ0A 2EY5A 4L5TA 4HCEA 2R92G 5I6WA 3RUZA 1EY4A 3KUPA 1KNEA 1ENCA 2WAQB 3KLSA 1SJHD 1HRJA 2FHTA 1K8AC 2R7ZB 4JBMA 5IWAL 4EQ5A 1PH5A 1I6VC 3SHLA 5A35A 1LACA 4KHVA 4A3MH 1QE6A 1E24A 4B3ML 2EJFC 4JI8Q 1SYEA 2PYKA 4N9TA 5LMUL 2OWOA 2B39A 2KCTA 3GDEA 1IKLA 3I2ZA 3OYYA 3RN2A 2RVLA 3A8KE 4P71A 4IUVA 4A3KH 3MWYW 4R4OA 2WIIB 2AQ1B 3DM3A 2A69D 2E2IB 4B9XA 4C56C 4DN4M 3VYRA 1U4RA 1CKNA 1VQ5A 2A6EC 2EJGC 2KHJA 3V96A 2K75A 1PH2A 3FKIH 5IWAQ 2HIVA 3OPOA 2QCPX 2XTIA 1HNWL 3MA2B 1WI5A 1E1TA 4KY6A 1OXUA 4DGZA 1STAA 2R93G 4B3MQ 2EE1A 3KBXA 3E0JA 1XNQL 4EQOA 2CQOA 2F0GA 5LL6S 1QNKA 1TS3A 2A5HA 3MC0B 3I55A 2EPBA 2C5CA 2AUJD 2K4KA 2NBFA 4DR6Q 5CGKA 1BCPB 5JOBA 1PFMA 3RNUA 4M1UB 1GOZA 2CHBD 2EYOA 2ZJRA 2BOSA 1L0XB 4ME3A 3A8IE 3CW2C 3A7LA 1H9RA 5IGDA 1EWHA 2CFMA 3QG1A 1IXRA 2PCFB 1DONA 1HZCA 1HNWQ 2EIFA 2IX0A 2NVYH 4HMIA 4JW0A 1IBKL 3K5OA 4J1MA 2OXPA 5HGQA 3A7AB 4DAVA 5I2XA 4A3EG 1QUQB 2F0LA 1HR0Q 2XRSD 5C3WA 4DK6C 3CQZH 1V43A 3HOVB 1SR3A 1N36Q 1KDCA 1E2VA 1MSGA 4DNTB 5M5YH 4CBVA 4GLVB 1UNSA 3TN2A 1E2WA 2QDBA 5C5MA 4UP9A 3I4LA 3I73A 3NSWA 2B2VA 2CQAA 4DV2Q 3N52A 1XWEA 2IL8A 3PSIA 3KOJA 5EAYA 2JN4A 1TVXA 1D2BA 3K0XA 5ELBA 2NN6I 4XT1B 2R6GA 1DOMA 2L15A 5GAGC 3VYUA 3OW7A 2HDMA 5JJZA 4K6LA 2PW7A 3CF5A 4BBSH 3HKZB 3G7LA 4A3BG 3U9OA 4MZ9A 4LNQA 4IN3A 5CR3A 1V1QA 5E7NA 1JORA 3PMFA 3F2CA 2O5IC 3A56A 1LTAD 1KC8C 2VZAA 2UXBL 1KQSA 1L1OC 1TXYA 1RL2A 3A5ZB 3EQLC 3VYSA 1AZQA 4RAUC 1LTID 3GP7A 4DR4L 2Z6KC 3E9HA 3AU7A 4IZ8A 1ICFB 1PH9A 1HNXL 1HR0W 4PZ7A 4JBKA 1XYIA 4KN7C 1BQQT 3I4MH 2F52A 2Y0SG 5C4XG 1FD7D 1OXXK 4HJ9A 4POFA 4X62Q 1PTOF 1AH9A 1JT8A 4JG2A 4P73A 3HOZG 4GZYC 1X9NA 2PNRC 4K5WA 3CCSA 3K7AH 2F0VA 2XWJB 5EBDA 4OWWB 4DV5L 4LW1A 3OWFA 4RCNA 4PMBA 2UXBQ 3E6ZX 1C8CA 1TKWB 2EOTA 3BVZA 1ET6A 1K0SA 4RMFA 1LABA 5IYCG 1PYWD 3W5OA 3CCEA 1B8AA 1B3AA 5E4WC 1PFBA 1TWGB 2Z8LA 5C3EH 2BDOA 3PIOA 3H0GG 3NUCA 3QR8A 1GHJA 1PH6A 2PMZB 2X69A 3SVMA 3EJIA 1MKHA 1SBBB 1U9RA 1VQEA 2HUGA 5C6AA 2B2YC 2B63G 4F87A 1EQRA 2NYZD 5ELOA 5C44B 2EJMA 2Q2UA 2QEXA 3ULPA 2MO1A 5GAEC 1KABA 2ZTEA 3QWNA 3DWQA 1CKNB 2WP8J 1M8AA 3A74A 4IQZA 3HOZH 2KECA 1EFID 2NB0A 4DV5Q 3SK5A 3NWTA 4LFAL 5CV8A 1ZEQX 1DZ1A 2A6HD 3MXNA 3NE5B 3J81j 1HA5A 2N55A 3BJUA 4A3IB 4QCLA 4C3JH 3KF6B 4KD3A 1H95A 4N8FA 4RHSA 1STYA 4RGTA 2EVBA 2OQ0A 3GQBA 2Q2HA 2R92B 1VQLA 1XX8A 1LTTD 2HQLA 4U673 1CHQD 3OMCA 2KEDA 2JYOA 3GTOB 1VS0A 3S17H 1V1OA 4KKTA 2K33A 4JPBW 1HTLD 4RKLA 2KQ3A 1VQBA 3FRPB 4C1NI 3I56A 3OIPA 4NMZA 2WB1E 4DK3C 2RHQB 1PFNA 2PZWA 2NTSA 4X3TA 1SFOB 2ATWA 1VQ7A 4KN4C 1OO9B 3PCOB 1K83H 4K0KL 4LFAQ 4CJ1B 1Z9FA 2WFWA 4BA1I 1WTVA 2B2WC 2F4IA 2DN8A 2B2TC 3FPUB 4HIDA 2DNEA 3CMAA 5IGFA 4KKSA 4X65Q 2JA7H 4WORA 3H6MA 2EXZA 3BYTB 3J7YW 4DV3L 2FINB 2VQFQ 4DNRB 1IKMA 4HJ8A 5C0XH 1M4VA 3MHBA 1TR5A 2B2UA 4OWTB 3NPPA 2ZTCA 1K8MA 1D5XC 1J8IA 2Z1CA 4DKAC 5M5XH 5AJ3L 3SXHA 1E1OA 1A63A 2KJXA 4JI6Q 2LSSA 3PIPA 4H02A 3M3YB 3HG9A 5IYDG 2KHSA 2R93B 4IUPA 1PTOH 1VQJA 2JA6H 1BCPF 1UAPA 1GHKA 4IFDJ 1B4OA 2MGSA 4C2MB 4IUQA 4YIJA 5LL6X 1I4PA 1ZKOA 4A75A 3BZKA 4FO2A 3VR6A 1Q82C 1STGA 2BDNA 2RQXA 4NXNL 1EQTA 4J8QA 4F7XA 4DV3Q 2RKSA 3PO2B 1SNQA 2DGYA 2VUMH 1IBML 4RA8A 4DR2L 4HMJA 3S2DB 1BKBA 2XVSA 1TWAH 4UP8A 2Q2TA 5K36G 4FXDA 1BXTA 2EYMA 2X6GA 1F9RA
chains in the Genus database with same CATH topology
4MNOA 2CKZB 1Q12A 4R4IA 1JMCA 1IBLQ 1CKMA 3GTPH 4XTCS 2EXDA 4GN4B 2JA8G 4ALPA 1QUQA 2VQEL 3BZCA 4APVA 4DV0L 3S1QH 3RN5A 3G4SA 4LFBL 5JJLA 5C4XH 4AQYQ 1UE1A 3CCQA 3DLLA 4NXML 1HR0L 1WFQA 1EFWA 1D7QA 3CMEA 3U4VA 5C0XI 4GNXC 1YJNA 1OXTA 3AFPA 1N36L 2N3SA 3K80C 3AEVA 4JI3Q 1YZ6A 2B29A 2I5MX 1N33L 1E7ZA 1LYLA 1TWHH 2PI2E 4PMWA 3BU2A 2ZJQA 1XMQL 1C9OA 3GTLH 1G51A 5C0XJ 3W1BA 3OTOL 2RCNA 1WYDA 1QZGA 4JI5Q 3PUXA 2R7ZH 1YEZA 3CP0A 1GKHA 1X6OA 1WCMG 1L0WA 1N32L 2OTJA 4JYAQ 4DV2L 1XNRQ 4DR2Q 4A93G 1Z47A 4A4IA 3RZOH 3CCVA 3UDFA 1SMXA 5IYCH 5C4JH 4LF5L 2JA5G 3PV0A 1YI2A 3GTMH 2UU9L 4JI7L 1NBWA 3CXCA 1PH4A 4HJ5A 4YHHL 2JK8A 4LF7Q 4JOIA 3S24A 3H0GH 1HZ9A 1S3OA 4C3HH 4OONA 1K3RA 3UDIA 3HKZE 5JEAG 1NE3A 3M85A 1Y1WH 2E5LQ 2HHHL 3I4OA 3Q8DA 5GQOA 1JB7A 1E22A 1VQIA 2HIXA 4BBSG 2VQEQ 4DV0Q 5FJ8H 4DR3Q 1NTGA 1HZBA 1X3GA 4BY1G 1CSQA 2E8GA 2I5LX 2B63H 4IPGA 4P74A 3U4ZA 2ALYB 2F4VQ 4A3LG 1J5EL 2AKWB 1EIFA 2IT1A 3S14H 2E2IH 5C44G 2NVXH 1CUKA 4A3MG 1B7YB 1AE3A 3AFQA 3RLFA 1XMQQ 4BXXH 5M3FG 1NY4A 4DV6L 2XGTA 2OQKA 4POGA 4X64L 1NMGA 4IPCA 1N32Q 2YTYA 1N34L 2AMCB 3FP9A 3MXNB 3G6EA 5IYBH 3S1RH 4A3DG 2RF4A 2ZM6Q 2UUBL 4LF5Q 4KHPL 2KCMA 5JJKA 1KL9A 1PA6A 1GO3E 1VQOA 2UU9Q 4JI7Q 2ZJPA 3I4MG 5JJIA 1YVCA 5IE8A 4YHHQ 4DV1L 2JA9A 1I50H 1CSPA 3NENA 3HOVG 2QGQA 2MFIA 1Q1EA 4TVAB 3CC2A 1PYSB 2OCEA 4DR1L 1Q8KA 4GOPC 3I4NH 4X62L 1CKOA 4L5TA 4JI4Q 2R92G 1I3QH 2Z0SA 1VQ9A 5HY6A 1Q1BA 1NJIC 1G6PA 1K8AC 5IP9H 3U50C 4IJLA 4JBMA 4JCVE 5IWAL 1KRTA 3AQQA 4EQ5A 4IJHA 4QQBX 1PH5A 3RLOA 4P72A 4DV7L 1EQQA 2IHFA 2CWAA 4DNIA 2BA1A 4A3MH 2CWPA 4XIGS 1E24A 1VQAA 4B3ML 1L1OB 4DR5L 4K0KQ 4JI8Q 1VCIA 5LMUL 4DV6Q 2OWOA 3L0OA 2KCTA 4JV5L 4X64Q 1M90C 2PMZE 3GDEA 5C3EG 3I2ZA 3OYYA 4A3CG 1VQFA 3RN2A 4C3IH 1FJGL 2UUBQ 4A3GG 4JI1L 3HKZG 1UE7A 4P71A 3HFZB 3J80c 4A3KH 3HOWG 4R4OA 4A3FG 3TRZA 3RLNA 1KRSA 2PQAB 3UDGA 4DV1Q 3DM3A 3F2BA 4DR1Q 3HOVH 1UWVA 2VY3A 1VQ5A 1CKNA 4GLXA 1GD7A 2KHJA 3KDFA 4GNXA 4GKKQ 1EOVA 5AJ3Q 3HOYG 4GN5A 3EBEA 3PF4A 2JEBI 2K75A 3FHWA 4QIWE 1XJVA 3H3VH 4BY7H 1R9TH 1QVGA 1TWFH 4IPDA 4OXPA 4UPAA 4BBRH 1PH2A 3FKIH 5IWAQ 2HIVA 2XTIA 2JQOA 4R4QA 1UE6A 3GTQH 1HNWL 4IFDG 4YY3L 1WI5A 5IYDH 1E1TA 1K0RA 1OXUA 2GN5A 3CAMA 3IRBA 2R93G 4B3MQ 1V9PA 4DR5Q 3CPFA 3SGIA 1XNQL 1N9WA 2CQOA 2R7FA 4R4CA 3J81i 2K5NA 3HOUG 2K5VA 4AYBE 3NEMA 3I55A 4B3SQ 1FJGQ 4NXNQ 4JI1Q 2PI2A 3ERSX 2K4KA 1LTLA 1P8LA 1N8RC 1IYJB 4OX9L 4DR6Q 5JEAJ 3JAMc 1GM5A 1IBMQ 3RNUA 1BVSA 4O0AA 3CD6A 2GVBA 5FLXc 2IHEA 3CCJA 4LFCL 1U0LA 5ELNA 2ZJRA 2UUCL 4ME3A 4JI2Q 1A8VA 3CW2C 1VQPA 4QL5A 2NVTH 5IP7H 5BR8L 1X56A 2CFMA 3F1ZA 1IXRA 3J7A5 1Y1VG 1HZCA 1HNWQ 4Y7NH 3ULLA 2EIFA 4LUVA 4YY3Q 1Q46A 2IX0A 2NVYH 4GLAC 1PH1A 1IBKL 2YTXA 2Y0SE 5GROA 4LWCA 5HGQA 2JA8H 4LFBQ 2JA7G 4AIMA 2QA4A 3PUVA 2FXQA 1QUQB 5M3MG 4X65L 4A3EG 1XPRA 4NXMQ 1HR0Q 2VNUD 4DK6C 3CQZH 1V43A 4FDBA 4LF9L 1SR3A 1N36Q 3PUWA 4J15A 1A62A 2MNAA 1LUZA 2VQFL 3KF8B 1NMFA 1MIUA 2ES2A 1N33Q 2HT1A 5C0XG 5M5YH 4GLVB 1YHQA 1VQ6A 4GOPA 1MJCA 3H3VI 2H5XA 4OX9Q 1HZAA 1PFSA 2K5HA 3GD7A 1KXLA 1JJGA 4UP9A 3TS2A 1OXSC 4DUZL 4DV2Q 1QZHA 1PH8A 1M1KC 4B3RL 2UUAL 1WCMH 3GTKH 2ID0A 3PSIA 3KOJA 4KLKA 4LFCQ 4A93H 5EAYA 2UUCQ 4JI6L 3LGJA 4DV4L 1I94L 3M7NA 4NPSA 4A3IG 2I5HA 3TREA 3UE1A 2JA5H 1IL2A 1PH7A 3K0XA 4A76A 2NN6I 2JA6G 2R6GA 1D8LA 3OTOQ 4QGUA 4JV5Q 2L15A 2UXDL 1TWGH 1Y14B 5GAGC 1SLJA 1X65A 2HHHQ 4IOCA 1TWCH 1FL0A 3KLWA 3WWVA 4DUYL 2NVQH 1PV4A 3UE0A 3CF5A 4BBSH 2D62A 3HOXG 4A3BG 4HJ7A 1JJ2A 4BY1H 3M4PA 4Y52H 4MZ9A 4LNQA 4AYBG 1J5EQ 1V1QA 5E7NA 5M3MH 3D31A 4A3LH 3F2CA 1QVFA 2R7DA 3J7ZC 3CCRA 1VQMA 2VZAA 1KC8C 2VUMG 2UXBL 1KQSA 1L1OC 2BA0A 5C44H 1TXYA 3T1YL 1EIYB 2I0QA 4L5QA 1K73C 1RL2A 3A5ZB 4O2DA 4PG3A 4GN3B 5FLMG 3E0EA 1S72A 4UP7A 5M3FH 5DLQE 2JE6I 4X66L 1WJJA 4DR4L 2Z6KC 1XMOL 1B70B 3G48A 4B3TL 4YCUA 4YWMA 3E9HA 1N34Q 4DUZQ 1Q7YC 4LF8L 4B3RQ 1EUJA 2K50A 1PH9A 1KAWA 2CCZA 1HNXL 3PO3G 1HR0W 4PZ7A 4DV4Q 1VQNA 4WJ4A 4JBKA 4A3DH 3CCUA 4KHPQ 4EX5A 4OO1G 1IBLL 1VQCA 4R4TA 3I4MH 4A3IH 2F52A 3ULJA 2Y0SG 5C4XG 5J3BA 1OXVA 1OXXK 1VQ8A 4HJ9A 2UXDQ 4AQYL 4POFA 4X62Q 3TS0A 1FVIA 4JC0A 4L5RC 2IY5B 3PUYA 2R92H 1AH9A 3KJOA 1JT8A 4JG2A 4P73A 3HOZG 5H1SE 1X9NA 4X6AH 3PGZA 2E2JH 3CCSA 1JE5A 3K7AH 3CPWA 1VQHA 3GTOH 4NB3A 4DAMA 4DV5L 1KD1C 4LW1A 4OWWB 2DUDA 2WAQG 2ASBA 3S16H 2R7ZG 4YCVA 4DV7Q 2UXBQ 1C7YA 4JI5L 3F8TA 3KF6A 4BA2I 4P75A 1I5FA 4HIKA 5GAHC 3EN2A 4RMFA 1XNRL 3J80i 5IYCG 3W5OA 3CCEA 5LMUQ 1B8AA 3GTJH 1XMOQ 3OW2A 1DGSA 2WB1G 1SFOH 3E9IA 4L5SA 4DR7L 5C3EH 3PIOA 4LF8Q 3H0GG 1YHAA 4A3CH 4GKJL 1PH6A 2E5LL 4GS3A 1G291 2Q2IA 3KYHC 3ZJYC 4HIOA 3PO3H 4DPGA 4AH6A 4A3GH 1MKHA 4KHZA 5IT9c 1AE2A 4JI0L 5FJ8G 2BH2A 3HOWH 4A3FH 1VQEA 1VQKA 4DR3L 2B63G 1EQRA 3S2HH 5ELOA 1KHIA 3PO2G 3A5UA 3GO5A 3M9BA 4A3JG 2QEXA 2Q2UA 3ULPA 2F4VL 2MO1A 5GAEC 1VQ4A 2KENA 1YBYA 1PVOA 2ZTEA 1ASZA 2AWOA 1A0IA 1CKNB 2WP8J 3D0FA 2K14A 3CC7A 1K8GA 3A74A 1VQGA 4BXXG 3KDFB 1QVCA 4GNXB 3AYHB 3HOYH 3HOZH 3RZDH 2KHIA 5IY0A 4DV5Q 2EQSA 2UXCL 1UEBA 4IO9A 4LFAL 3K81C 3ICEA 1YIJA 4YWKA 3J81j 1YJWA 2MO0A 3BJUA 5IYBG 5LMNL 3M3YH 3HKSA 4C3JH 3KF6B 1XNQQ 2R93H 1XPUA 1H95A 2ZM6L 3F2DA 3PUZA 3JAMi 1EWIA 3STBD 2V1CC 2VW9A 3G71A 4UY8C 4DR7Q 2OQ0A 2Q2HA 3I7FA 1FGUA 3NELA 4TQUS 1VQLA 3I4NG 2HQLA 2AHOB 4GKJQ 4C2MH 2WAQE 3HOUH 1GVPA 2RHSB 4JI4L 4MTNA 4LF4L 4JI0Q 2NZHA 1VS0A 3S17H 2N49A 2JJQA 5IP9G 1IZ6A 1T9HA 2VS1A 2GVAA 1VQBA 1L2FA 1W3SA 3EIVA 3I56A 4HJAA 4IOAA 1C0AA 1Q86C 2LXKA 2WB1E 4DK3C 3CC4A 4LUOA 3PO2H 2RHQB 4R1JA 4A3JH 1J6QA 4DAYB 1SRUA 5BR8Q 1HJPA 4JBWA 3NBHB 1L1OA 2ATWA 3A0JA 4JOIC 1SE8A 1VQ7A 1RIPA 1ASYA 3ER0A 3PCOB 4LUZA 4QY7A 3S2DH 2N8NA 2YYZA 1JJCB 1K83H 2UXCQ 4K0KL 1Y1VH 4LFAQ 1P16A 4JI8L 1IBKQ 1Z9FA 4HIMA 3M4QA 2WFWA 4BA1I 2Z6KA 2VL6A 1PH3A 1KIXA 2IX1A 1BBWA 1O7IA 1X55A 3T1HL 3PF5A 2D0OA 4HIDA 4QJFA 3CMAA 1YNXA 5LMNQ 4X65Q 2JA7H 2LXJA 2A19A 1LM0A 4IPHA 4LF6L 2KBNA 2D0PA 3TEHB 4A3EH 4LF9Q 4OO1I 4A3KG 1OTCA 2PQAA 1PYBA 4DV3L 1SROA 5GADC 2VQFQ 2ZTDA 3JC66 4HJ8A 2B3GA 1HNZL 2JEAI 3L7ZC 4OWTB 3L2PA 2C35B 4LF4Q 2ZTCA 1BBUA 2YV5A 4GOPB 3S1MH 1W2BA 3TQYA 3KFUA 4GKKL 4DKAC 4BY7G 3K7UC 5M5XH 3M4OH 5AJ3L 1E1OA 3B6YA 4BBRG 2UUAQ 1A63A 1XPOA 4WJ3M 3FKIG 4IFDI 3S15H 4JI6Q 2LSSA 1X3EA 3K8AA 3PIPA 4H02A 1I94Q 5IYDG 1S40A 1U5KA 2OTLA 2PNHA 4YCWA 4YWLA 1PHJA 3S1NH 3RR5A 1VQJA 4PZ6A 2JA6H 1K9MC 1X54A 4IFDJ 2NN6G 4KI0A 3KJPA 1YITA 2NZOA 5M5WH 1XTDA 2K52A 4DUYQ 2F3IA 3UDXA 1VQDA 2AWNA 3T1HQ 4A75A 1Q81C 2E2HH 3H15A 4JI3L 3BZKA 2YU9H 2BH8A 4PZ8A 3HOXH 1Q82C 4LF6Q 1I6HH 3MEFA 4A3BH 4JBJA 3STBC 2YTVA 4B3SL 4NXNL 1X3FA 4DV3Q 1WOCA 2A8VA 1HH2P 1SN8A 4DR6L 2MQHA 2DGYA 3T1YQ 1HNZQ 1UE5A 1IBML 4RG1A 2VUMH 4OWXB 3GTGH 4JYAL 3J81c 4DR2L 3CCMA 1MJEA 4X66Q 5FLMH 3U58A 4DR4Q 3CCLA 1BKBA 4B3TQ 4JI2L 1YHBA 1TWAH 1E3PA 5IP7G 4UP8A 2Q2TA 5K36G 5LMNW 2N78A 1YJ9A 1Y1WG 1HNXQ 4LF7L 3W1GA 1EYGA 2A1AA 3VDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MNO A;  2CKZ B;  1Q12 A;  4R4I A;  1JMC A;  1IBL Q;  1CKM A;  3GTP H;  4XTC S;  2EXD A;  4GN4 B;  2JA8 G;  4ALP A;  1QUQ A;  2VQE L;  3BZC A;  4APV A;  4DV0 L;  3S1Q H;  3RN5 A;  3G4S A;  4LFB L;  5JJL A;  5C4X H;  4AQY Q;  1UE1 A;  3CCQ A;  3DLL A;  4NXM L;  1HR0 L;  1WFQ A;  1EFW A;  1D7Q A;  3CME A;  3U4V A;  5C0X I;  4GNX C;  1YJN A;  1OXT A;  3AFP A;  1N36 L;  2N3S A;  3K80 C;  3AEV A;  4JI3 Q;  1YZ6 A;  2B29 A;  2I5M X;  1N33 L;  1E7Z A;  1LYL A;  1TWH H;  2PI2 E;  4PMW A;  3BU2 A;  2ZJQ A;  1XMQ L;  1C9O A;  3GTL H;  1G51 A;  5C0X J;  3W1B A;  3OTO L;  2RCN A;  1WYD A;  1QZG A;  4JI5 Q;  3PUX A;  2R7Z H;  1YEZ A;  3CP0 A;  1GKH A;  1X6O A;  1WCM G;  1L0W A;  1N32 L;  2OTJ A;  4JYA Q;  4DV2 L;  1XNR Q;  4DR2 Q;  4A93 G;  1Z47 A;  4A4I A;  3RZO H;  3CCV A;  3UDF A;  1SMX A;  5IYC H;  5C4J H;  4LF5 L;  2JA5 G;  3PV0 A;  1YI2 A;  3GTM H;  2UU9 L;  4JI7 L;  1NBW A;  3CXC A;  1PH4 A;  4HJ5 A;  4YHH L;  2JK8 A;  4LF7 Q;  4JOI A;  3S24 A;  3H0G H;  1HZ9 A;  1S3O A;  4C3H H;  4OON A;  1K3R A;  3UDI A;  3HKZ E;  5JEA G;  1NE3 A;  3M85 A;  1Y1W H;  2E5L Q;  2HHH L;  3I4O A;  3Q8D A;  5GQO A;  1JB7 A;  1E22 A;  1VQI A;  2HIX A;  4BBS G;  2VQE Q;  4DV0 Q;  5FJ8 H;  4DR3 Q;  1NTG A;  1HZB A;  1X3G A;  4BY1 G;  1CSQ A;  2E8G A;  2I5L X;  2B63 H;  4IPG A;  4P74 A;  3U4Z A;  2ALY B;  2F4V Q;  4A3L G;  1J5E L;  2AKW B;  1EIF A;  2IT1 A;  3S14 H;  2E2I H;  5C44 G;  2NVX H;  1CUK A;  4A3M G;  1B7Y B;  1AE3 A;  3AFQ A;  3RLF A;  1XMQ Q;  4BXX H;  5M3F G;  1NY4 A;  4DV6 L;  2XGT A;  2OQK A;  4POG A;  4X64 L;  1NMG A;  4IPC A;  1N32 Q;  2YTY A;  1N34 L;  2AMC B;  3FP9 A;  3MXN B;  3G6E A;  5IYB H;  3S1R H;  4A3D G;  2RF4 A;  2ZM6 Q;  2UUB L;  4LF5 Q;  4KHP L;  2KCM A;  5JJK A;  1KL9 A;  1PA6 A;  1GO3 E;  1VQO A;  2UU9 Q;  4JI7 Q;  2ZJP A;  3I4M G;  5JJI A;  1YVC A;  5IE8 A;  4YHH Q;  4DV1 L;  2JA9 A;  1I50 H;  1CSP A;  3NEN A;  3HOV G;  2QGQ A;  2MFI A;  1Q1E A;  4TVA B;  3CC2 A;  1PYS B;  2OCE A;  4DR1 L;  1Q8K A;  4GOP C;  3I4N H;  4X62 L;  1CKO A;  4L5T A;  4JI4 Q;  2R92 G;  1I3Q H;  2Z0S A;  1VQ9 A;  5HY6 A;  1Q1B A;  1NJI C;  1G6P A;  1K8A C;  5IP9 H;  3U50 C;  4IJL A;  4JBM A;  4JCV E;  5IWA L;  1KRT A;  3AQQ A;  4EQ5 A;  4IJH A;  4QQB X;  1PH5 A;  3RLO A;  4P72 A;  4DV7 L;  1EQQ A;  2IHF A;  2CWA A;  4DNI A;  2BA1 A;  4A3M H;  2CWP A;  4XIG S;  1E24 A;  1VQA A;  4B3M L;  1L1O B;  4DR5 L;  4K0K Q;  4JI8 Q;  1VCI A;  5LMU L;  4DV6 Q;  2OWO A;  3L0O A;  2KCT A;  4JV5 L;  4X64 Q;  1M90 C;  2PMZ E;  3GDE A;  5C3E G;  3I2Z A;  3OYY A;  4A3C G;  1VQF A;  3RN2 A;  4C3I H;  1FJG L;  2UUB Q;  4A3G G;  4JI1 L;  3HKZ G;  1UE7 A;  4P71 A;  3HFZ B;  3J80 c;  4A3K H;  3HOW G;  4R4O A;  4A3F G;  3TRZ A;  3RLN A;  1KRS A;  2PQA B;  3UDG A;  4DV1 Q;  3DM3 A;  3F2B A;  4DR1 Q;  3HOV H;  1UWV A;  2VY3 A;  1VQ5 A;  1CKN A;  4GLX A;  1GD7 A;  2KHJ A;  3KDF A;  4GNX A;  4GKK Q;  1EOV A;  5AJ3 Q;  3HOY G;  4GN5 A;  3EBE A;  3PF4 A;  2JEB I;  2K75 A;  3FHW A;  4QIW E;  1XJV A;  3H3V H;  4BY7 H;  1R9T H;  1QVG A;  1TWF H;  4IPD A;  4OXP A;  4UPA A;  4BBR H;  1PH2 A;  3FKI H;  5IWA Q;  2HIV A;  2XTI A;  2JQO A;  4R4Q A;  1UE6 A;  3GTQ H;  1HNW L;  4IFD G;  4YY3 L;  1WI5 A;  5IYD H;  1E1T A;  1K0R A;  1OXU A;  2GN5 A;  3CAM A;  3IRB A;  2R93 G;  4B3M Q;  1V9P A;  4DR5 Q;  3CPF A;  3SGI A;  1XNQ L;  1N9W A;  2CQO A;  2R7F A;  4R4C A;  3J81 i;  2K5N A;  3HOU G;  2K5V A;  4AYB E;  3NEM A;  3I55 A;  4B3S Q;  1FJG Q;  4NXN Q;  4JI1 Q;  2PI2 A;  3ERS X;  2K4K A;  1LTL A;  1P8L A;  1N8R C;  1IYJ B;  4OX9 L;  4DR6 Q;  5JEA J;  3JAM c;  1GM5 A;  1IBM Q;  3RNU A;  1BVS A;  4O0A A;  3CD6 A;  2GVB A;  5FLX c;  2IHE A;  3CCJ A;  4LFC L;  1U0L A;  5ELN A;  2ZJR A;  2UUC L;  4ME3 A;  4JI2 Q;  1A8V A;  3CW2 C;  1VQP A;  4QL5 A;  2NVT H;  5IP7 H;  5BR8 L;  1X56 A;  2CFM A;  3F1Z A;  1IXR A;  3J7A 5;  1Y1V G;  1HZC A;  1HNW Q;  4Y7N H;  3ULL A;  2EIF A;  4LUV A;  4YY3 Q;  1Q46 A;  2IX0 A;  2NVY H;  4GLA C;  1PH1 A;  1IBK L;  2YTX A;  2Y0S E;  5GRO A;  4LWC A;  5HGQ A;  2JA8 H;  4LFB Q;  2JA7 G;  4AIM A;  2QA4 A;  3PUV A;  2FXQ A;  1QUQ B;  5M3M G;  4X65 L;  4A3E G;  1XPR A;  4NXM Q;  1HR0 Q;  2VNU D;  4DK6 C;  3CQZ H;  1V43 A;  4FDB A;  4LF9 L;  1SR3 A;  1N36 Q;  3PUW A;  4J15 A;  1A62 A;  2MNA A;  1LUZ A;  2VQF L;  3KF8 B;  1NMF A;  1MIU A;  2ES2 A;  1N33 Q;  2HT1 A;  5C0X G;  5M5Y H;  4GLV B;  1YHQ A;  1VQ6 A;  4GOP A;  1MJC A;  3H3V I;  2H5X A;  4OX9 Q;  1HZA A;  1PFS A;  2K5H A;  3GD7 A;  1KXL A;  1JJG A;  4UP9 A;  3TS2 A;  1OXS C;  4DUZ L;  4DV2 Q;  1QZH A;  1PH8 A;  1M1K C;  4B3R L;  2UUA L;  1WCM H;  3GTK H;  2ID0 A;  3PSI A;  3KOJ A;  4KLK A;  4LFC Q;  4A93 H;  5EAY A;  2UUC Q;  4JI6 L;  3LGJ A;  4DV4 L;  1I94 L;  3M7N A;  4NPS A;  4A3I G;  2I5H A;  3TRE A;  3UE1 A;  2JA5 H;  1IL2 A;  1PH7 A;  3K0X A;  4A76 A;  2NN6 I;  2JA6 G;  2R6G A;  1D8L A;  3OTO Q;  4QGU A;  4JV5 Q;  2L15 A;  2UXD L;  1TWG H;  1Y14 B;  5GAG C;  1SLJ A;  1X65 A;  2HHH Q;  4IOC A;  1TWC H;  1FL0 A;  3KLW A;  3WWV A;  4DUY L;  2NVQ H;  1PV4 A;  3UE0 A;  3CF5 A;  4BBS H;  2D62 A;  3HOX G;  4A3B G;  4HJ7 A;  1JJ2 A;  4BY1 H;  3M4P A;  4Y52 H;  4MZ9 A;  4LNQ A;  4AYB G;  1J5E Q;  1V1Q A;  5E7N A;  5M3M H;  3D31 A;  4A3L H;  3F2C A;  1QVF A;  2R7D A;  3J7Z C;  3CCR A;  1VQM A;  2VZA A;  1KC8 C;  2VUM G;  2UXB L;  1KQS A;  1L1O C;  2BA0 A;  5C44 H;  1TXY A;  3T1Y L;  1EIY B;  2I0Q A;  4L5Q A;  1K73 C;  1RL2 A;  3A5Z B;  4O2D A;  4PG3 A;  4GN3 B;  5FLM G;  3E0E A;  1S72 A;  4UP7 A;  5M3F H;  5DLQ E;  2JE6 I;  4X66 L;  1WJJ A;  4DR4 L;  2Z6K C;  1XMO L;  1B70 B;  3G48 A;  4B3T L;  4YCU A;  4YWM A;  3E9H A;  1N34 Q;  4DUZ Q;  1Q7Y C;  4LF8 L;  4B3R Q;  1EUJ A;  2K50 A;  1PH9 A;  1KAW A;  2CCZ A;  1HNX L;  3PO3 G;  1HR0 W;  4PZ7 A;  4DV4 Q;  1VQN A;  4WJ4 A;  4JBK A;  4A3D H;  3CCU A;  4KHP Q;  4EX5 A;  4OO1 G;  1IBL L;  1VQC A;  4R4T A;  3I4M H;  4A3I H;  2F52 A;  3ULJ A;  2Y0S G;  5C4X G;  5J3B A;  1OXV A;  1OXX K;  1VQ8 A;  4HJ9 A;  2UXD Q;  4AQY L;  4POF A;  4X62 Q;  3TS0 A;  1FVI A;  4JC0 A;  4L5R C;  2IY5 B;  3PUY A;  2R92 H;  1AH9 A;  3KJO A;  1JT8 A;  4JG2 A;  4P73 A;  3HOZ G;  5H1S E;  1X9N A;  4X6A H;  3PGZ A;  2E2J H;  3CCS A;  1JE5 A;  3K7A H;  3CPW A;  1VQH A;  3GTO H;  4NB3 A;  4DAM A;  4DV5 L;  1KD1 C;  4LW1 A;  4OWW B;  2DUD A;  2WAQ G;  2ASB A;  3S16 H;  2R7Z G;  4YCV A;  4DV7 Q;  2UXB Q;  1C7Y A;  4JI5 L;  3F8T A;  3KF6 A;  4BA2 I;  4P75 A;  1I5F A;  4HIK A;  5GAH C;  3EN2 A;  4RMF A;  1XNR L;  3J80 i;  5IYC G;  3W5O A;  3CCE A;  5LMU Q;  1B8A A;  3GTJ H;  1XMO Q;  3OW2 A;  1DGS A;  2WB1 G;  1SFO H;  3E9I A;  4L5S A;  4DR7 L;  5C3E H;  3PIO A;  4LF8 Q;  3H0G G;  1YHA A;  4A3C H;  4GKJ L;  1PH6 A;  2E5L L;  4GS3 A;  1G29 1;  2Q2I A;  3KYH C;  3ZJY C;  4HIO A;  3PO3 H;  4DPG A;  4AH6 A;  4A3G H;  1MKH A;  4KHZ A;  5IT9 c;  1AE2 A;  4JI0 L;  5FJ8 G;  2BH2 A;  3HOW H;  4A3F H;  1VQE A;  1VQK A;  4DR3 L;  2B63 G;  1EQR A;  3S2H H;  5ELO A;  1KHI A;  3PO2 G;  3A5U A;  3GO5 A;  3M9B A;  4A3J G;  2QEX A;  2Q2U A;  3ULP A;  2F4V L;  2MO1 A;  5GAE C;  1VQ4 A;  2KEN A;  1YBY A;  1PVO A;  2ZTE A;  1ASZ A;  2AWO A;  1A0I A;  1CKN B;  2WP8 J;  3D0F A;  2K14 A;  3CC7 A;  1K8G A;  3A74 A;  1VQG A;  4BXX G;  3KDF B;  1QVC A;  4GNX B;  3AYH B;  3HOY H;  3HOZ H;  3RZD H;  2KHI A;  5IY0 A;  4DV5 Q;  2EQS A;  2UXC L;  1UEB A;  4IO9 A;  4LFA L;  3K81 C;  3ICE A;  1YIJ A;  4YWK A;  3J81 j;  1YJW A;  2MO0 A;  3BJU A;  5IYB G;  5LMN L;  3M3Y H;  3HKS A;  4C3J H;  3KF6 B;  1XNQ Q;  2R93 H;  1XPU A;  1H95 A;  2ZM6 L;  3F2D A;  3PUZ A;  3JAM i;  1EWI A;  3STB D;  2V1C C;  2VW9 A;  3G71 A;  4UY8 C;  4DR7 Q;  2OQ0 A;  2Q2H A;  3I7F A;  1FGU A;  3NEL A;  4TQU S;  1VQL A;  3I4N G;  2HQL A;  2AHO B;  4GKJ Q;  4C2M H;  2WAQ E;  3HOU H;  1GVP A;  2RHS B;  4JI4 L;  4MTN A;  4LF4 L;  4JI0 Q;  2NZH A;  1VS0 A;  3S17 H;  2N49 A;  2JJQ A;  5IP9 G;  1IZ6 A;  1T9H A;  2VS1 A;  2GVA A;  1VQB A;  1L2F A;  1W3S A;  3EIV A;  3I56 A;  4HJA A;  4IOA A;  1C0A A;  1Q86 C;  2LXK A;  2WB1 E;  4DK3 C;  3CC4 A;  4LUO A;  3PO2 H;  2RHQ B;  4R1J A;  4A3J H;  1J6Q A;  4DAY B;  1SRU A;  5BR8 Q;  1HJP A;  4JBW A;  3NBH B;  1L1O A;  2ATW A;  3A0J A;  4JOI C;  1SE8 A;  1VQ7 A;  1RIP A;  1ASY A;  3ER0 A;  3PCO B;  4LUZ A;  4QY7 A;  3S2D H;  2N8N A;  2YYZ A;  1JJC B;  1K83 H;  2UXC Q;  4K0K L;  1Y1V H;  4LFA Q;  1P16 A;  4JI8 L;  1IBK Q;  1Z9F A;  4HIM A;  3M4Q A;  2WFW A;  4BA1 I;  2Z6K A;  2VL6 A;  1PH3 A;  1KIX A;  2IX1 A;  1BBW A;  1O7I A;  1X55 A;  3T1H L;  3PF5 A;  2D0O A;  4HID A;  4QJF A;  3CMA A;  1YNX A;  5LMN Q;  4X65 Q;  2JA7 H;  2LXJ A;  2A19 A;  1LM0 A;  4IPH A;  4LF6 L;  2KBN A;  2D0P A;  3TEH B;  4A3E H;  4LF9 Q;  4OO1 I;  4A3K G;  1OTC A;  2PQA A;  1PYB A;  4DV3 L;  1SRO A;  5GAD C;  2VQF Q;  2ZTD A;  3JC6 6;  4HJ8 A;  2B3G A;  1HNZ L;  2JEA I;  3L7Z C;  4OWT B;  3L2P A;  2C35 B;  4LF4 Q;  2ZTC A;  1BBU A;  2YV5 A;  4GOP B;  3S1M H;  1W2B A;  3TQY A;  3KFU A;  4GKK L;  4DKA C;  4BY7 G;  3K7U C;  5M5X H;  3M4O H;  5AJ3 L;  1E1O A;  3B6Y A;  4BBR G;  2UUA Q;  1A63 A;  1XPO A;  4WJ3 M;  3FKI G;  4IFD I;  3S15 H;  4JI6 Q;  2LSS A;  1X3E A;  3K8A A;  3PIP A;  4H02 A;  1I94 Q;  5IYD G;  1S40 A;  1U5K A;  2OTL A;  2PNH A;  4YCW A;  4YWL A;  1PHJ A;  3S1N H;  3RR5 A;  1VQJ A;  4PZ6 A;  2JA6 H;  1K9M C;  1X54 A;  4IFD J;  2NN6 G;  4KI0 A;  3KJP A;  1YIT A;  2NZO A;  5M5W H;  1XTD A;  2K52 A;  4DUY Q;  2F3I A;  3UDX A;  1VQD A;  2AWN A;  3T1H Q;  4A75 A;  1Q81 C;  2E2H H;  3H15 A;  4JI3 L;  3BZK A;  2YU9 H;  2BH8 A;  4PZ8 A;  3HOX H;  1Q82 C;  4LF6 Q;  1I6H H;  3MEF A;  4A3B H;  4JBJ A;  3STB C;  2YTV A;  4B3S L;  4NXN L;  1X3F A;  4DV3 Q;  1WOC A;  2A8V A;  1HH2 P;  1SN8 A;  4DR6 L;  2MQH A;  2DGY A;  3T1Y Q;  1HNZ Q;  1UE5 A;  1IBM L;  4RG1 A;  2VUM H;  4OWX B;  3GTG H;  4JYA L;  3J81 c;  4DR2 L;  3CCM A;  1MJE A;  4X66 Q;  5FLM H;  3U58 A;  4DR4 Q;  3CCL A;  1BKB A;  4B3T Q;  4JI2 L;  1YHB A;  1TWA H;  1E3P A;  5IP7 G;  4UP8 A;  2Q2T A;  5K36 G;  5LMN W;  2N78 A;  1YJ9 A;  1Y1W G;  1HNX Q;  4LF7 L;  3W1G A;  1EYG A;  2A1A A;  3VDY A; 
#chains in the Genus database with same CATH topology
 1EYC A;  1PRT C;  1IBL Q;  3PIO 3;  4MTK A;  3W2D A;  4A3E B;  4DV0 L;  2F0H A;  1WTP A;  4LFB L;  1EWC A;  1EZ6 A;  3CCQ A;  1F2L A;  2EY2 A;  2EYF A;  3FEW X;  4KMU C;  3CME A;  3U4V A;  1YJN A;  4GNX C;  2K5D A;  5FO8 B;  1E7Z A;  2JP1 A;  4H13 C;  3BU2 A;  1G51 A;  1QZG A;  4JI5 Q;  2P5Z X;  2R7Z H;  4EQP A;  1X6O A;  1L0W A;  2LY7 A;  1VF5 C;  1RDP D;  4DR2 Q;  3S1N B;  1AFP A;  3SE0 A;  2JA5 G;  3PV0 A;  4JI7 L;  3BDO A;  1NBW A;  4MN3 A;  3CXC A;  2M00 A;  4ZKC B;  2JK8 A;  5KYI A;  5JEA G;  2EY6 A;  4OON A;  3M85 A;  5IT9 L;  1Y8N B;  3I4O A;  4CKB A;  3K57 A;  1VF7 A;  5I9O A;  4A3B B;  4HED A;  1Q90 A;  2HIX A;  1TT2 A;  4DV0 Q;  4BY1 G;  1HZB A;  3BZD B;  1R4P B;  4P74 A;  3U4Z A;  3GTG B;  3K0Y A;  2PW5 A;  2F4V Q;  3I72 A;  1EIF A;  3HEJ A;  4RGM A;  1GXD C;  2E2I H;  1AZP A;  4BXX H;  2EDG A;  5M3F G;  1NY4 A;  5JVG 3;  3D4W A;  4NDX A;  2OQK A;  4K2K A;  5IGB A;  4KV6 A;  1NMG A;  2YTY A;  3KBG A;  3FP9 A;  3MXN B;  4ZYS A;  3NTI A;  1KLG D;  2C9O A;  2Y0S B;  5C4X B;  1KL9 A;  1HUM A;  4JI7 Q;  5TSS A;  1VQO A;  3TZD A;  4DV1 L;  3HOV G;  1MI2 A;  4TVA B;  1ENA A;  3CC2 A;  1PYS B;  4GOP C;  5JEA H;  1TWH B;  2F0T A;  4EQN A;  3OSO A;  4O42 A;  1SNO A;  5HY6 A;  2H4O A;  1G6P A;  5IP9 H;  3T51 B;  4JCV E;  1S5D D;  3DEO A;  4FXG C;  3BDC A;  3RZO B;  4QQB X;  2E76 C;  1LTB D;  3BVM A;  3RLO A;  4RFB A;  3GTM B;  5FO9 B;  2CWA A;  4J6H A;  3PIP 3;  5EJW A;  2CWP A;  1VQA A;  3H0G B;  2MJ8 A;  1EZ8 A;  3L0O A;  5KNB A;  1Y1W B;  5J22 A;  1PZJ D;  1JQY D;  4A3C G;  1VQF A;  1SE2 A;  3I8Z A;  4A3G G;  4JI1 L;  3HKZ G;  3J80 c;  2B63 B;  1WTX A;  3HOW G;  4PV1 C;  4A3F G;  4BS9 A;  1LT5 D;  3M7G A;  1O7Y A;  4DV1 Q;  3J80 E;  1LTS D;  4OIK A;  3F2B A;  2OEO A;  3HOV H;  2NVX B;  1UWV A;  2SEB D;  1JB3 A;  4GLX A;  4GKK Q;  4K2L A;  1EOV A;  1R4Q B;  3HOY G;  3PF4 A;  2JEB I;  3H3V H;  3CRL C;  4IPD A;  4OXP A;  1Q3L A;  4FXK C;  3KLR A;  3MVV A;  2JQO A;  3S1R B;  4IFD G;  4YY3 L;  4HSV A;  1NR4 A;  2GN5 A;  5JVH 3;  2QIL A;  3IRB A;  2F0J A;  3H94 A;  2QKI C;  1KAA A;  4WRD A;  3U9S A;  4R4C A;  3BYY B;  2RBM A;  3S9W A;  3HOU G;  3J80 L;  1K28 A;  3ONA B;  2PI2 A;  4JI1 Q;  3ERS X;  1QG7 A;  3EFX D;  1IYJ B;  3BVG A;  3JAM c;  1GM5 A;  1JR0 D;  1PRT B;  1S5F D;  5D65 A;  4M8A A;  2IHE A;  3CCJ A;  2F0M A;  3JAM E;  2UUC L;  3E3X A;  4DAY A;  1A8V A;  4L8J A;  4QL5 A;  2MPM A;  4XYQ A;  3J7A 5;  2IW3 A;  1Y1V G;  4LUV A;  3SDZ A;  4CDF C;  4YY3 Q;  3Q23 A;  4GLA C;  3QB3 A;  2Y0S E;  4LJZ C;  1B9M A;  2QA4 A;  3NBI A;  1RD9 D;  4FDB A;  3FMC A;  3SR1 A;  1IL8 A;  5J1Z A;  1LUZ A;  2HT1 A;  2ES2 A;  1EYA A;  5DAU A;  4Q0F A;  1SE3 A;  3I91 A;  4EGV A;  5I9P A;  3J7A F;  1R9T B;  4ZUJ A;  3JAM L;  2F0F A;  3GD7 A;  1JJG A;  1FR3 A;  1OXS C;  1TS5 A;  5EKI A;  2A68 D;  4ZLT F;  1QZH A;  1PH8 A;  2O4X A;  2EYH A;  3WDN A;  2LFN A;  2UUC Q;  2KOL A;  3LGJ A;  5EPK A;  1I94 L;  4A3I G;  3TRE A;  2L5T A;  1PTO D;  3OTO Q;  1UEA B;  4QGU A;  2F0D A;  3TZU A;  2UXD L;  1TWG H;  2HHH Q;  1SLJ A;  5JAV A;  2M9V A;  4IOC A;  1FL0 A;  3KLW A;  5DEH A;  5ELF A;  4DUY L;  3HOX G;  1JJ2 A;  4Y52 H;  4QB4 A;  1CTM A;  3EA6 A;  1GJX A;  4A3L H;  4RKB A;  5D3I B;  1QVF A;  4RGN A;  3P7J A;  5C44 H;  3T1Y L;  2NVT B;  4PG3 A;  5FLM G;  1KDA A;  4UP7 A;  5DLQ E;  2JE6 I;  3AMU A;  1WJJ A;  2TSS A;  1B70 B;  3G48 A;  4YWM A;  1EUJ A;  3WOE A;  1X3P A;  4KHP Q;  4OO1 G;  4IUN A;  5BN4 A;  4A3I H;  3ULJ A;  2UXD Q;  4AQY L;  4DU9 A;  3A55 A;  2A6H C;  1JCK B;  4JC0 A;  4R8I A;  3PUY A;  2R92 H;  5G3L F;  1HCZ A;  2F3V A;  5EPJ A;  1IW7 C;  3PGZ A;  4ZRZ A;  1CHP D;  4I65 A;  3TRZ A;  1VQH A;  2QF7 A;  4NB3 A;  2ASB A;  3GTO H;  3GTK B;  1EL0 A;  4KY7 A;  4QMG A;  3D4R A;  1C7Y A;  1SMY C;  3F8T A;  3KF6 A;  4P75 A;  2JA5 B;  1SEB D;  4PQX A;  5LMU Q;  1AN8 A;  1BUV T;  4CDE C;  1DGS A;  3OW2 A;  1WTR A;  1SFO H;  3MZ5 A;  4L5S A;  2NVQ B;  5CV9 A;  4C3H G;  5CV6 A;  1GUS A;  4GKJ L;  1JWS D;  4F8M A;  2E5L L;  3ZJY C;  2Q2I A;  3KYH C;  2EYP A;  4BY1 B;  4DPG A;  1T5X D;  4AH6 A;  1B2T A;  2PZT A;  2BH2 A;  2RDF A;  3DMU A;  2E2D C;  4DR3 L;  1VQK A;  1I4H A;  3PO2 G;  3M9B A;  4HSP A;  4WJW A;  1VQ4 A;  5M3F B;  2AWO A;  1K8G A;  1VQG A;  2X6L A;  3AYH B;  2BE5 D;  2KHI A;  2EQS A;  1UEB A;  4IO9 A;  3T13 A;  3ICE A;  1YIJ A;  3MEH A;  1YJW A;  5IYB G;  2ZXP A;  3M3Y H;  3HKS A;  3KLS X;  1XNQ Q;  2R93 H;  2ZM6 L;  2VW9 A;  1EWI A;  3G71 A;  4UY8 C;  1WTQ A;  3PQI A;  1FGU A;  4QF4 A;  1LT4 D;  3I4N G;  4GKJ Q;  4C2M H;  1T5E A;  2WAQ E;  2E2J B;  4QUC A;  4JI4 L;  1DD2 A;  1FGB D;  1HQM C;  2HDL A;  3DUZ A;  3S16 B;  4AYB B;  1GUG A;  3EIV A;  4IOA A;  2HQE A;  1Z7T A;  3PO2 H;  2G9D A;  2F0S A;  1PZK D;  4R1J A;  1BCP D;  4DAY B;  1E2Z A;  1L1O A;  1SE8 A;  1RIP A;  3A8J E;  1ASY A;  4QY7 A;  3S2D H;  1B53 A;  1D6E C;  5D14 A;  3MXP A;  2CW0 D;  4HIM A;  3M4Q A;  1IBK Q;  3C1F A;  2Z6K A;  1KIX A;  1S4Z A;  1BBW A;  3T1H L;  4A3G B;  2D0O A;  3HOW B;  4C3I G;  4A3F B;  1EY5 A;  2LXJ A;  4IPH A;  4LF6 L;  1E0B A;  2D0P A;  2KBN A;  3TEH B;  4A3E H;  1QWY A;  3VA5 A;  1F2M A;  3S2H B;  4XQQ A;  2ZTD A;  1HNZ L;  2CH4 A;  2A73 B;  4U68 A;  3FDT A;  3HOY B;  1DXM A;  3I3C A;  1BBU A;  2YV5 A;  1DJR D;  1W2B A;  1NCV A;  2KCC A;  4BY7 G;  4H7B A;  1HFG A;  2F0Q A;  4BBR G;  1STH A;  1XPO A;  4WJ3 M;  1W6K A;  5CV5 A;  3NWS A;  2RA4 A;  1U5K A;  3S1N H;  4PZ6 A;  1PRT F;  1X54 A;  2NN6 G;  3KJP A;  1YIT A;  2NZO A;  5A2Q E;  1IYV A;  1JOK A;  3HOU B;  2F3I A;  5EKL A;  4PNY A;  2AWN A;  3T1H Q;  3NTK A;  4JI3 L;  4KD4 A;  3C3L A;  4LF6 Q;  3MEF A;  4E6I A;  4A3B H;  3STB C;  2YTV A;  4B3S L;  2F0P A;  1X3F A;  1WOC A;  2EZV A;  3L3O C;  1TY0 A;  3CHB D;  1HNZ Q;  3TP7 A;  3GTG H;  2B2Y A;  4JYA L;  3HGB A;  4DR4 Q;  4XQN A;  1Y69 U;  4JI2 L;  4OEM B;  5IP7 G;  1Y1V B;  2A74 C;  2SOB A;  2KEE A;  1K8O A;  4LF7 L;  1YJ9 A;  1Y1W G;  1HNX Q;  4EVO A;  2A1A A;  3VDY A;  4MNO A;  1JMC A;  4R4I A;  1CKM A;  1DOK A;  4XTC S;  5A2Q L;  4K14 A;  2JA8 G;  3K59 A;  2VQE L;  5C4X H;  1EY6 A;  5DM6 3;  4NXM L;  3LX0 A;  2K6A A;  1D7Q A;  3KF8 A;  5C0X I;  3D4D A;  2EYJ A;  3K80 C;  3M4Y A;  4JI3 Q;  2LS0 1;  5FK9 C;  1F9P A;  4K5X A;  1N33 L;  1LYL A;  1TWH H;  2KUM A;  2PI2 E;  1HPC A;  1EU3 A;  1S5B D;  1V1P B;  3S15 B;  5T1I A;  2F0U A;  4RHR A;  2XRQ D;  1WCM G;  1SND A;  2F0I A;  4JYA Q;  4A93 G;  1SYD A;  1B9N A;  3RZO H;  2DY7 A;  3CCV A;  3UDF A;  1SMX A;  5IYC H;  2L55 A;  3GTM H;  2UU9 L;  5M5W B;  4G7O C;  4LF7 Q;  3H0G H;  1RJT A;  1S3O A;  4JV5 L;  1K3R A;  3UDI A;  3HKZ E;  4I7Z C;  3HOX B;  1Y1W H;  2L1B A;  3Q8D A;  5GQO A;  2VQE Q;  2B2W A;  1G6Z A;  1JWU D;  1X3G A;  2B2T A;  1CSQ A;  2B63 H;  4IPG A;  2ALY B;  2EYL A;  1J5E L;  1XTC D;  1F2Y A;  2NVX H;  1CUK A;  3RLF A;  1TY2 A;  3DHQ A;  4K8J A;  4POG A;  4X64 L;  1LT3 D;  4IPC A;  1MBY A;  1N34 L;  3RD4 A;  1HQR D;  3S1R H;  4A3D G;  2RF4 A;  2UUB L;  4X3S A;  1ROD A;  2UU9 Q;  5JJI A;  1GO3 E;  4DXG A;  4X3U A;  5IE8 A;  5ELC A;  5EGT A;  4CJ0 B;  1H9M A;  4FNF A;  5C3X A;  2OCE A;  4DR1 L;  1CKO A;  3GTL B;  1Q1B A;  1NJI C;  3OWE B;  3L9A X;  4ZAI A;  3U50 C;  4IJL A;  3SK8 A;  2RDG A;  2L4N A;  3AQQ A;  4IJH A;  1A3T A;  4NKL A;  4DV7 L;  2R3Z A;  4ILW A;  2FJ2 A;  2BA1 A;  4DNI A;  1L1O B;  4K0K Q;  4DF7 A;  4C3H B;  1VCI A;  4FF2 A;  1U4M A;  4X64 Q;  3FPP A;  2PMZ E;  5CYU A;  2K7V A;  1SE4 A;  2UUB Q;  4HN7 A;  1UE7 A;  3HFZ B;  4DAP A;  3RLN A;  5D3D A;  4KY5 A;  3S14 B;  1VMC A;  1SXT A;  4DR1 Q;  4X3K A;  1ESR A;  2VY3 A;  1KLU D;  3BDL A;  1GD7 A;  3KDF A;  4GNX A;  5AJ3 Q;  3FHW A;  1R9T H;  1QVG A;  2XWB B;  3TP6 A;  4OL7 A;  2G9H D;  2KCN A;  4R4Q A;  1UE6 A;  1A2T A;  5JPN C;  3VR5 A;  4DK1 A;  5IYD H;  2DNC A;  5C4Z A;  1K0R A;  2J7Z A;  1V9P A;  4K6D A;  5CBE E;  3CPF A;  3SGI A;  3I4N B;  3DWP A;  1I3Q B;  2R7F A;  2SNS A;  5FO7 B;  3J81 i;  3NEM A;  4HAE A;  1DCZ A;  4NXN Q;  3GV6 A;  4OHJ A;  4V19 0;  2NUC A;  1LTL A;  1P8L A;  4OX9 L;  4KKU A;  3TBI B;  1IBM Q;  4XYO A;  4CDC C;  5FLX c;  1NR2 A;  4LFC L;  1U0L A;  2ZXR A;  5NUC A;  1CT1 D;  5E4X A;  1VQP A;  4QUF A;  3MFY A;  4OGQ C;  5FLX E;  2NVT H;  5BR8 L;  1X56 A;  2ZT9 C;  5K36 H;  3F1Z A;  3QOJ A;  4IUR A;  4C3I B;  1Q46 A;  1CM9 A;  5K5P A;  2YTX A;  4LWC A;  3K58 A;  4LFB Q;  1SYC A;  4IAL A;  4LF9 L;  2VB3 X;  1NSN S;  4IUU A;  3RMH A;  2MNA A;  3KF8 B;  1W6J A;  3H91 A;  2JSO A;  1BOS A;  1F77 A;  1YHQ A;  4GOP A;  4BY7 B;  3BG3 A;  3H3V I;  5CV7 A;  1TWF B;  2H5X A;  2ICE C;  4BBR B;  4OX9 Q;  1HZA A;  1AEX A;  1KXL A;  2F0E A;  2A69 C;  3GTQ B;  3TSS A;  5FLX L;  2F0W A;  4DUZ L;  1M1K C;  2UUA L;  3GTK H;  2ID0 A;  4KLK A;  4LFC Q;  1F9Q A;  4DV4 L;  2VXW A;  4NPS A;  2I5H A;  3UE1 A;  2JA5 H;  1PH7 A;  4LK1 C;  1LV9 A;  1Y14 B;  1STB A;  1I4Q A;  5G3L D;  2NVQ H;  1PV4 A;  1ET9 A;  1PZI D;  5IGG A;  3GV3 A;  4BY1 H;  3M4P A;  1RTO A;  4AYB G;  2FFK B;  3D31 A;  1MHW C;  2BCO A;  2N88 A;  3DM1 A;  3CCR A;  4G57 A;  4KJO A;  2BA0 A;  3ERQ A;  1EIY B;  1NAP A;  1C48 A;  2B8F A;  4O2D A;  3E0E A;  5M3F H;  4X66 L;  3QOL A;  1K3B C;  2WAC A;  5IGE A;  1PDQ A;  4Y7N B;  4B3T L;  1HFN A;  4YCU A;  4DUZ Q;  4LF8 L;  3IFD A;  3ZYY X;  5HGT A;  2AQ2 B;  2JA8 B;  4WJ4 A;  5FKA C;  1VQN A;  4DV4 Q;  3CCU A;  2BE5 C;  3SK6 A;  2F3W A;  1MSH A;  5J3B A;  1OXV A;  1VQ8 A;  1RKN A;  4ZCK A;  3HZX A;  4L5R C;  2IY5 B;  5M9O A;  1BO0 A;  3VR4 A;  3H09 A;  5COY A;  2L12 A;  2E2J H;  3E5S A;  1BR9 A;  2WKC A;  4OEL B;  1WCM B;  2DUD A;  3S16 H;  4A93 B;  4ODG A;  1G2S A;  1FNW A;  5ELE A;  5GAH C;  3EN2 A;  3OOC A;  1XNR L;  1BF4 A;  1PXU A;  2WB1 G;  1TWC B;  4DR7 L;  4LF8 Q;  3R8B A;  4A3C H;  3NK9 A;  4N9P A;  1ILP A;  1BCP C;  3TDQ A;  4A3G H;  3HOW H;  4KHZ A;  5T1G A;  1AE2 A;  5M3M B;  5FJ8 G;  1KTK A;  4JI0 L;  4A3F H;  5ELD A;  4L6T B;  3Q24 A;  5C5L A;  1EY8 A;  1ZXT A;  3S2H H;  2E74 C;  3A5U A;  1Z6H A;  4CKC A;  1HHV A;  4XDX A;  3Q22 A;  1YBY A;  1PVO A;  1A0I A;  2K14 A;  5JPM C;  3KDF B;  4GNX B;  3HOY H;  5KEE A;  4XXE A;  1SNP A;  2UXC L;  4R9W A;  3C1E A;  3K81 C;  4IFD H;  4A3D B;  4YWK A;  3MAQ A;  2AUK A;  1HUN A;  1YNN D;  1O7Z A;  5KNC A;  1XPU A;  1H9S A;  3A54 A;  3PUZ A;  5IGC A;  4DR7 Q;  3H3V C;  4TQU S;  5CMD A;  2LMC B;  3ITP A;  1KNA A;  2Q8T A;  3G6J B;  1WVL A;  3HS0 C;  3HOU H;  3OIQ A;  1GVP A;  2RHS B;  4HTH A;  2V4D A;  4LF4 L;  3V2T A;  4JI0 Q;  2NZH A;  1SSO A;  1TU2 B;  3CKI B;  1IZ6 A;  1T9H A;  2VS1 A;  2GVA A;  1W3S A;  1Q86 C;  3CC4 A;  1SJE D;  4LUO A;  1DOL A;  1J6Q A;  3GTJ B;  1PRT D;  1HJP A;  1I4R A;  1UUP A;  4JOI C;  2F0K A;  4LMQ D;  3ER0 A;  4LUZ A;  2UXC Q;  2N8N A;  2YYZ A;  1EQV A;  3NP8 A;  1Y1V H;  3X3M A;  4JI8 L;  1WTH A;  4ULL A;  3MFG A;  3VYT A;  1PH3 A;  1EEI D;  2O2L D;  2IX1 A;  3PO3 B;  1O7I A;  1X55 A;  4TKO B;  4G7H C;  4QJF A;  1WTW A;  1YNX A;  2WKD A;  1LM0 A;  4OO1 I;  4A3K G;  1OTC A;  2PQA A;  1QCB D;  5GAD C;  3JC6 6;  3X3N A;  2HD3 A;  2B3G A;  1G8Z D;  2SDF A;  2JEA I;  2XIW A;  3IFT A;  2JXM B;  3R93 A;  3RZD B;  1ZYR D;  4LF4 Q;  3HP3 A;  4GOP B;  1CZW A;  3TQY A;  1Y8O B;  4ZK9 B;  3KFU A;  3K7U C;  3B6Y A;  4JVZ A;  5I6Y A;  3FKI G;  4FVM A;  3S15 H;  1I94 Q;  3NTH A;  4YWL A;  2NTT A;  1PHJ A;  3RR5 A;  1CZG A;  3KK7 A;  2D9U A;  2MP1 A;  4KI0 A;  5M5W H;  1XTD A;  4DUY Q;  3NXW A;  1RHP A;  1ILQ A;  2BH8 A;  1V1P A;  3LWE A;  3HOX H;  2D5D A;  3ND8 A;  1D1K A;  4JBJ A;  1WTO A;  1SN8 A;  4DR6 L;  2MQH A;  5BN5 A;  3T1Y Q;  3ERO A;  4A3J B;  4OWX B;  4I7A A;  4H0L C;  3Q6S A;  5FLM H;  1F9S A;  2DY8 A;  3IL8 A;  1KDB A;  1E3P A;  2FMC A;  4NP5 A;  2Z4H A;  2K03 A;  2N78 A;  2CKZ B;  1Q12 A;  1LLR D;  2QEJ C;  2XSC A;  1BBX C;  2K5Q A;  4GN4 B;  4OO1 H;  1O80 A;  4APV A;  3G4S A;  1EIG A;  2K32 A;  1PMR A;  1RCV D;  3SK4 A;  4B9W A;  4AQY Q;  3DLL A;  1HR0 L;  1EFW A;  2ENB A;  3I70 A;  1OXT A;  1N36 L;  2N3S A;  1TII D;  1YZ6 A;  3S1M B;  1QB5 D;  2ZJQ A;  3M4O B;  1IHZ A;  3MTS A;  3GTL H;  2L0C A;  4QIW B;  5C0X J;  2RCN A;  3PUX A;  3TME A;  3CP0 A;  1GKH A;  4DV2 L;  3FVQ A;  1ESF A;  4LAA A;  4LF5 L;  1PLF A;  2H1E A;  3T16 A;  1RTN A;  5J39 A;  4HJ5 A;  4OIJ A;  1LTR D;  2YU9 B;  2E2H B;  1HZ9 A;  2KVM A;  4C3H H;  2E5L Q;  2QW7 A;  4K5V A;  1JB7 A;  1I6H B;  1E22 A;  4BBS G;  1QIL A;  4DR3 Q;  1NTG A;  2I5L X;  5KND A;  1U4P A;  1YNJ D;  3VR3 A;  2IT1 A;  3S14 H;  1IYU A;  1GUN A;  1LT6 D;  4ZKB B;  2O5J C;  3AFQ A;  1AE3 A;  3ND9 A;  5CV4 A;  2TMP A;  5DNF A;  4DV6 L;  1ICW A;  3MXU A;  3GTP B;  3D8G A;  2AMC B;  1CA5 A;  5IYB H;  3S1Q B;  1STE A;  2ZM6 Q;  1A2U A;  4LF5 Q;  2KCM A;  1PA6 A;  3I4M G;  3LNN A;  1H9S B;  3NEN A;  1Q1E A;  3I4N H;  1GUW A;  1Q8K A;  4X62 L;  3DXJ C;  4JI4 Q;  1I3Q H;  2J4X A;  2Z0S A;  2B2V C;  1VQ9 A;  2PPB C;  4F88 A;  1NNX A;  2IX3 A;  1KRT A;  4TSS A;  5C4J B;  3IAY A;  4P72 A;  1EQQ A;  2IHF A;  1TS2 A;  4FF3 A;  2WB1 B;  2Q8I B;  4XIG S;  1ENF A;  4DR5 L;  4DV6 Q;  1D5M C;  1M90 C;  5C3E G;  4BWG B;  4H44 C;  4FF1 A;  1I4G A;  4C3I H;  1FJG L;  3TP8 A;  4FF4 A;  1KRS A;  2PQA B;  2VB2 X;  3UDG A;  4NW2 A;  5C4H A;  4PMC A;  3Q0A A;  2SNM A;  4HCS A;  1EY9 A;  4KK7 A;  3TP5 A;  2PQE A;  2AQ3 B;  3EBE A;  4GN5 A;  1XJV A;  4QIW E;  4BY7 H;  3DWA A;  1TWF H;  4UPA A;  4BBR H;  5I4D A;  1A15 A;  2Z4I A;  4O1N A;  3GTQ H;  1SAP A;  1H9K A;  2G5D A;  1DYQ A;  2Z9H A;  2KA7 A;  4C3J G;  3CAM A;  1VMP A;  1V8Q A;  5EBC A;  4DR5 Q;  1I50 B;  2NN6 H;  3T56 B;  1N9W A;  2Z6B A;  2MHV A;  4N8X 1;  3DEP A;  2HCC A;  2K5N A;  5CC4 A;  2K5V A;  4AYB E;  4B3S Q;  3IKJ A;  1FJG Q;  1G91 A;  1N8R C;  3F2U A;  5JEA J;  3R2I A;  1EEF D;  1BVS A;  4O0A A;  4V0B A;  3VA7 A;  3CD6 A;  2GVB A;  5I2Y A;  5ELN A;  3N6R A;  4A3M B;  4JI2 Q;  4DK0 A;  3NBH A;  5IP7 H;  4G7Z C;  2XN9 C;  4Y7N H;  3ULL A;  1JWM D;  2QDL A;  4ZQ3 A;  1PH1 A;  4CJ2 C;  5GRO A;  2A6E D;  4A3K B;  2JA8 H;  2JA7 G;  4AIM A;  1SNC A;  2OF1 A;  1FNU A;  2FXQ A;  3PUV A;  5M3M G;  4X65 L;  1XPR A;  4NXM Q;  2ZXO A;  1IW7 D;  4KTA A;  3PUW A;  4J15 A;  1A62 A;  1ML0 D;  2OT2 A;  2VQF L;  1BNZ A;  1N33 Q;  1NMF A;  1MIU A;  5C0X G;  5ISR A;  1LO5 D;  1VQ6 A;  1SMY D;  1MJC A;  4FP5 D;  2J0T D;  1PFS A;  2K5H A;  3FKI B;  5IIF A;  3TS2 A;  3NQI A;  4B3R L;  1WCM H;  4A93 H;  4JI6 L;  2CVR A;  2GA4 B;  1IL2 A;  1VDZ A;  4A76 A;  2JA6 G;  4ME5 A;  3K5L A;  1D8L A;  1TS4 A;  5KGU A;  4JV5 Q;  1X65 A;  2K5W A;  1TWC H;  3OHX C;  4RH6 A;  3WWV A;  2IPK D;  3UE0 A;  3EVQ A;  4MIU A;  3V05 A;  2D62 A;  1S5E D;  4HJ7 A;  4IUT A;  4WFN 3;  3SEB A;  1MGS A;  3HRZ C;  1J5E Q;  5M3M H;  2B8G A;  4Q5V A;  1SNM A;  2XNA C;  2R7D A;  2DJG C;  3J7Z C;  1VQM A;  2VUM G;  2K28 A;  3C2P A;  4CDD C;  2I0Q A;  3W3A A;  4L5Q A;  4UHV A;  5COR A;  1K73 C;  4GN3 B;  1S72 A;  2EY1 A;  1XMO L;  4KJN A;  3D6W A;  1N34 Q;  2NVY B;  1HA6 A;  1Q7Y C;  4B3R Q;  2K50 A;  1KAW A;  2E75 C;  1F2Z A;  2CCZ A;  1JOO A;  2K05 A;  3PO3 G;  1QJO A;  4A3D H;  1RF2 D;  4EX5 A;  1G2T A;  1IBL L;  1VQC A;  1BDO A;  3CQZ B;  4R4T A;  1Q8I A;  3TS0 A;  3C46 A;  1FVI A;  5EPL A;  1A3V A;  2B2U C;  5M5Y B;  5CBA E;  3O13 A;  1YNN C;  3KJO A;  2I46 A;  1FYC A;  5H1S E;  4X6A H;  1J9O A;  1JE5 A;  3CPW A;  3M7N A;  4DAM A;  1KD1 C;  1SYB A;  2WAQ G;  2R7Z G;  3OMG A;  4YCV A;  4DV7 Q;  3QJY A;  2M2L A;  5BN3 A;  4JI5 L;  4BA2 I;  1I5F A;  4HIK A;  1I4X A;  3J80 i;  3GTJ H;  1XMO Q;  2A68 C;  3E9I A;  4DXF A;  2RSN A;  4UAI A;  1YHA A;  4P2C B;  4ABN A;  4BBS B;  1JIC A;  2WV6 D;  4GS3 A;  1XXG A;  1G29 1;  4RCO A;  4HIO A;  3PO3 H;  1O78 A;  5IT9 c;  1PTO C;  2RCF A;  1CK1 A;  2F0O A;  1AW7 A;  3NQT A;  5KYL A;  5IT9 E;  1QNU A;  1KHI A;  2F1M A;  1B50 A;  3GO5 A;  4A3J G;  2F4V L;  2PZU A;  2KEN A;  1ASZ A;  1EOT A;  3D0F A;  3CC7 A;  3R2T A;  4BXX G;  1QVC A;  3RZD H;  2I07 B;  5IY0 A;  4ID6 A;  5HUR A;  1HTP A;  5KIX A;  2MO0 A;  3I90 A;  3I4M B;  5LMN L;  1ZYR C;  2NWG A;  4G4K A;  1NUC A;  3F2D A;  3JAM i;  3STB D;  2V1C C;  3I7F A;  3NEL A;  1C4Q A;  1CQF A;  2AHO B;  3J7A V;  2PO4 A;  3K7A B;  4MTN A;  5IOD A;  1SDF A;  5KRU A;  3P1H A;  3NHH A;  4FYD A;  2N49 A;  2JJQ A;  5IP9 G;  3K5N A;  2Q8R E;  1L2F A;  5IOC A;  5LHY 1;  1C0A A;  4HR7 B;  1II3 A;  2ICI A;  2LXK A;  4A3J H;  1HXY D;  1EY0 A;  1SRU A;  4JBW A;  5BR8 Q;  2K1B A;  3NBH B;  4XQJ A;  3A0J A;  4S3S A;  5C3E B;  4K8I A;  3T53 B;  4DFA A;  1JJC B;  3K5M A;  1P16 A;  1WD0 A;  1CI3 M;  2VL6 A;  3PF5 A;  1Y8P B;  1U4L A;  2MUY A;  3P75 A;  5LMN Q;  1GUT A;  2A19 A;  3LWU A;  2RDH A;  2LKV A;  4LF9 Q;  4C1N K;  4CHT B;  1PYB A;  1SRO A;  1EY7 A;  1GUO A;  5F2D A;  5AFW A;  4UDU C;  4XT3 B;  3L7Z C;  3HOZ B;  4B08 A;  2WIN B;  4Z9C B;  2C35 B;  3L2P A;  1TQO A;  3S1M H;  5L37 A;  4GKK L;  3M4O H;  2UUA Q;  1EYD A;  1ONL A;  4IFD I;  2L9H A;  3QIA A;  3AB9 A;  4TRD A;  1X3E A;  3K8A A;  5EQ0 A;  4C3J B;  1S40 A;  2OTL A;  2PNH A;  4YCW A;  1CA6 A;  2DJF C;  1B44 D;  1S5C D;  1K9M C;  1DM0 B;  1X32 A;  2K52 A;  5FOB B;  3UDX A;  4L63 B;  1VQD A;  2YU9 H;  1Q81 C;  2E2H H;  1JE4 A;  3H15 A;  1STN A;  4PZ8 A;  2HCI A;  2F03 A;  3S17 B;  2K04 A;  1CFM A;  1I6H H;  4RWS C;  1SYF A;  2A8V A;  1HH2 P;  4ZUI A;  1UE5 A;  1H9J A;  4RG1 A;  3J81 c;  3CCM A;  1MD2 D;  5E1F A;  1MJE A;  1EIH A;  1D1I A;  4X66 Q;  3U58 A;  3CCL A;  3J81 E;  4B3T Q;  1K83 B;  1YHB A;  2K01 A;  3D6C A;  1YNJ C;  2F0N A;  5LMN W;  3W1G A;  1X3Q A;  1LTG D;  1EYG A;  2JA7 B;  3GTP H;  1SYG A;  2EXD A;  4ALP A;  1QUQ A;  3BZC A;  3S1Q H;  3RN5 A;  1L0Y B;  5JJL A;  2CW0 C;  1UE1 A;  1WFQ A;  1EU4 A;  1WD1 A;  3AFP A;  3AEV A;  1D5Z C;  2B29 A;  2I5M X;  4PMW A;  5M5X B;  1XMQ L;  1C9O A;  3MXG A;  1A6X A;  3K6O A;  5E3F A;  3W1B A;  1WYD A;  1B3Q A;  1YEZ A;  2D2C C;  3J81 L;  1N32 L;  1B1Z A;  4JK1 C;  2OTJ A;  1PTO B;  1XNR Q;  1AP0 A;  1Z47 A;  3CU7 A;  4A4I A;  4DA2 A;  2JA6 B;  3D3R A;  5C4J H;  1YI2 A;  3URY A;  1PH4 A;  2NZ1 D;  4YHH L;  3R3O A;  4RGO S;  4JOI A;  2FMM A;  3S24 A;  1A3U A;  3OTO L;  4HJA A;  2VNU D;  2IWH A;  1QOH A;  1CQV A;  1NE3 A;  2HHH L;  1VQI A;  5DM7 3;  1JOQ A;  5FJ8 H;  4CKE A;  2E8G A;  2VUM B;  4A3L G;  3QO2 A;  3BS1 A;  2AKW B;  3P20 A;  1O7L A;  5C44 G;  4A3M G;  1JC7 A;  1B7Y B;  1TWA B;  3CRK C;  4R8N A;  1XMQ Q;  2L11 A;  2XGT A;  3UI2 A;  1N32 Q;  1FNV A;  2R61 A;  5EKK A;  3G6E A;  4CGY B;  3VR2 A;  2RSO A;  4MHE A;  4KHP L;  5JJK A;  2ZJP A;  1YVC A;  4YHH Q;  3WOF A;  2JA9 A;  1I50 H;  1CSP A;  2CH4 W;  3T4A C;  2QGQ A;  2MFI A;  2IJ0 A;  2EY5 A;  4L5T A;  4HCE A;  2R92 G;  5I6W A;  3RUZ A;  1EY4 A;  3KUP A;  1KNE A;  1ENC A;  2WAQ B;  3KLS A;  1SJH D;  1HRJ A;  2FHT A;  1K8A C;  2R7Z B;  4JBM A;  5IWA L;  4EQ5 A;  1PH5 A;  1I6V C;  3SHL A;  5A35 A;  1LAC A;  4KHV A;  4A3M H;  1QE6 A;  1E24 A;  4B3M L;  2EJF C;  4JI8 Q;  1SYE A;  2PYK A;  4N9T A;  5LMU L;  2OWO A;  2B39 A;  2KCT A;  3GDE A;  1IKL A;  3I2Z A;  3OYY A;  3RN2 A;  2RVL A;  3A8K E;  4P71 A;  4IUV A;  4A3K H;  3MWY W;  4R4O A;  2WII B;  2AQ1 B;  3DM3 A;  2A69 D;  2E2I B;  4B9X A;  4C56 C;  4DN4 M;  3VYR A;  1U4R A;  1CKN A;  1VQ5 A;  2A6E C;  2EJG C;  2KHJ A;  3V96 A;  2K75 A;  1PH2 A;  3FKI H;  5IWA Q;  2HIV A;  3OPO A;  2QCP X;  2XTI A;  1HNW L;  3MA2 B;  1WI5 A;  1E1T A;  4KY6 A;  1OXU A;  4DGZ A;  1STA A;  2R93 G;  4B3M Q;  2EE1 A;  3KBX A;  3E0J A;  1XNQ L;  4EQO A;  2CQO A;  2F0G A;  5LL6 S;  1QNK A;  1TS3 A;  2A5H A;  3MC0 B;  3I55 A;  2EPB A;  2C5C A;  2AUJ D;  2K4K A;  2NBF A;  4DR6 Q;  5CGK A;  1BCP B;  5JOB A;  1PFM A;  3RNU A;  4M1U B;  1GOZ A;  2CHB D;  2EYO A;  2ZJR A;  2BOS A;  1L0X B;  4ME3 A;  3A8I E;  3CW2 C;  3A7L A;  1H9R A;  5IGD A;  1EWH A;  2CFM A;  3QG1 A;  1IXR A;  2PCF B;  1DON A;  1HZC A;  1HNW Q;  2EIF A;  2IX0 A;  2NVY H;  4HMI A;  4JW0 A;  1IBK L;  3K5O A;  4J1M A;  2OXP A;  5HGQ A;  3A7A B;  4DAV A;  5I2X A;  4A3E G;  1QUQ B;  2F0L A;  1HR0 Q;  2XRS D;  5C3W A;  4DK6 C;  3CQZ H;  1V43 A;  3HOV B;  1SR3 A;  1N36 Q;  1KDC A;  1E2V A;  1MSG A;  4DNT B;  5M5Y H;  4CBV A;  4GLV B;  1UNS A;  3TN2 A;  1E2W A;  2QDB A;  5C5M A;  4UP9 A;  3I4L A;  3I73 A;  3NSW A;  2B2V A;  2CQA A;  4DV2 Q;  3N52 A;  1XWE A;  2IL8 A;  3PSI A;  3KOJ A;  5EAY A;  2JN4 A;  1TVX A;  1D2B A;  3K0X A;  5ELB A;  2NN6 I;  4XT1 B;  2R6G A;  1DOM A;  2L15 A;  5GAG C;  3VYU A;  3OW7 A;  2HDM A;  5JJZ A;  4K6L A;  2PW7 A;  3CF5 A;  4BBS H;  3HKZ B;  3G7L A;  4A3B G;  3U9O A;  4MZ9 A;  4LNQ A;  4IN3 A;  5CR3 A;  1V1Q A;  5E7N A;  1JOR A;  3PMF A;  3F2C A;  2O5I C;  3A56 A;  1LTA D;  1KC8 C;  2VZA A;  2UXB L;  1KQS A;  1L1O C;  1TXY A;  1RL2 A;  3A5Z B;  3EQL C;  3VYS A;  1AZQ A;  4RAU C;  1LTI D;  3GP7 A;  4DR4 L;  2Z6K C;  3E9H A;  3AU7 A;  4IZ8 A;  1ICF B;  1PH9 A;  1HNX L;  1HR0 W;  4PZ7 A;  4JBK A;  1XYI A;  4KN7 C;  1BQQ T;  3I4M H;  2F52 A;  2Y0S G;  5C4X G;  1FD7 D;  1OXX K;  4HJ9 A;  4POF A;  4X62 Q;  1PTO F;  1AH9 A;  1JT8 A;  4JG2 A;  4P73 A;  3HOZ G;  4GZY C;  1X9N A;  2PNR C;  4K5W A;  3CCS A;  3K7A H;  2F0V A;  2XWJ B;  5EBD A;  4OWW B;  4DV5 L;  4LW1 A;  3OWF A;  4RCN A;  4PMB A;  2UXB Q;  3E6Z X;  1C8C A;  1TKW B;  2EOT A;  3BVZ A;  1ET6 A;  1K0S A;  4RMF A;  1LAB A;  5IYC G;  1PYW D;  3W5O A;  3CCE A;  1B8A A;  1B3A A;  5E4W C;  1PFB A;  1TWG B;  2Z8L A;  5C3E H;  2BDO A;  3PIO A;  3H0G G;  3NUC A;  3QR8 A;  1GHJ A;  1PH6 A;  2PMZ B;  2X69 A;  3SVM A;  3EJI A;  1MKH A;  1SBB B;  1U9R A;  1VQE A;  2HUG A;  5C6A A;  2B2Y C;  2B63 G;  4F87 A;  1EQR A;  2NYZ D;  5ELO A;  5C44 B;  2EJM A;  2Q2U A;  2QEX A;  3ULP A;  2MO1 A;  5GAE C;  1KAB A;  2ZTE A;  3QWN A;  3DWQ A;  1CKN B;  2WP8 J;  1M8A A;  3A74 A;  4IQZ A;  3HOZ H;  2KEC A;  1EFI D;  2NB0 A;  4DV5 Q;  3SK5 A;  3NWT A;  4LFA L;  5CV8 A;  1ZEQ X;  1DZ1 A;  2A6H D;  3MXN A;  3NE5 B;  3J81 j;  1HA5 A;  2N55 A;  3BJU A;  4A3I B;  4QCL A;  4C3J H;  3KF6 B;  4KD3 A;  1H95 A;  4N8F A;  4RHS A;  1STY A;  4RGT A;  2EVB A;  2OQ0 A;  3GQB A;  2Q2H A;  2R92 B;  1VQL A;  1XX8 A;  1LTT D;  2HQL A;  4U67 3;  1CHQ D;  3OMC A;  2KED A;  2JYO A;  3GTO B;  1VS0 A;  3S17 H;  1V1O A;  4KKT A;  2K33 A;  4JPB W;  1HTL D;  4RKL A;  2KQ3 A;  1VQB A;  3FRP B;  4C1N I;  3I56 A;  3OIP A;  4NMZ A;  2WB1 E;  4DK3 C;  2RHQ B;  1PFN A;  2PZW A;  2NTS A;  4X3T A;  1SFO B;  2ATW A;  1VQ7 A;  4KN4 C;  1OO9 B;  3PCO B;  1K83 H;  4K0K L;  4LFA Q;  4CJ1 B;  1Z9F A;  2WFW A;  4BA1 I;  1WTV A;  2B2W C;  2F4I A;  2DN8 A;  2B2T C;  3FPU B;  4HID A;  2DNE A;  3CMA A;  5IGF A;  4KKS A;  4X65 Q;  2JA7 H;  4WOR A;  3H6M A;  2EXZ A;  3BYT B;  3J7Y W;  4DV3 L;  2FIN B;  2VQF Q;  4DNR B;  1IKM A;  4HJ8 A;  5C0X H;  1M4V A;  3MHB A;  1TR5 A;  2B2U A;  4OWT B;  3NPP A;  2ZTC A;  1K8M A;  1D5X C;  1J8I A;  2Z1C A;  4DKA C;  5M5X H;  5AJ3 L;  3SXH A;  1E1O A;  1A63 A;  2KJX A;  4JI6 Q;  2LSS A;  3PIP A;  4H02 A;  3M3Y B;  3HG9 A;  5IYD G;  2KHS A;  2R93 B;  4IUP A;  1PTO H;  1VQJ A;  2JA6 H;  1BCP F;  1UAP A;  1GHK A;  4IFD J;  1B4O A;  2MGS A;  4C2M B;  4IUQ A;  4YIJ A;  5LL6 X;  1I4P A;  1ZKO A;  4A75 A;  3BZK A;  4FO2 A;  3VR6 A;  1Q82 C;  1STG A;  2BDN A;  2RQX A;  4NXN L;  1EQT A;  4J8Q A;  4F7X A;  4DV3 Q;  2RKS A;  3PO2 B;  1SNQ A;  2DGY A;  2VUM H;  1IBM L;  4RA8 A;  4DR2 L;  4HMJ A;  3S2D B;  1BKB A;  2XVS A;  1TWA H;  4UP8 A;  2Q2T A;  5K36 G;  4FXD A;  1BXT A;  2EYM A;  2X6G A;  1F9R A; 
#chains in the Genus database with same CATH homology
 4MNO A;  2CKZ B;  1Q12 A;  4R4I A;  1JMC A;  1IBL Q;  1CKM A;  3GTP H;  4XTC S;  2EXD A;  4GN4 B;  2JA8 G;  4ALP A;  1QUQ A;  2VQE L;  3BZC A;  4APV A;  4DV0 L;  3S1Q H;  3RN5 A;  3G4S A;  4LFB L;  5JJL A;  5C4X H;  4AQY Q;  1UE1 A;  3CCQ A;  3DLL A;  4NXM L;  1HR0 L;  1WFQ A;  1EFW A;  1D7Q A;  3CME A;  3U4V A;  5C0X I;  4GNX C;  1YJN A;  1OXT A;  3AFP A;  1N36 L;  2N3S A;  3K80 C;  3AEV A;  4JI3 Q;  1YZ6 A;  2B29 A;  2I5M X;  1N33 L;  1E7Z A;  1LYL A;  1TWH H;  2PI2 E;  4PMW A;  3BU2 A;  2ZJQ A;  1XMQ L;  1C9O A;  3GTL H;  1G51 A;  5C0X J;  3W1B A;  3OTO L;  2RCN A;  1WYD A;  1QZG A;  4JI5 Q;  3PUX A;  2R7Z H;  1YEZ A;  3CP0 A;  1GKH A;  1X6O A;  1WCM G;  1L0W A;  1N32 L;  2OTJ A;  4JYA Q;  4DV2 L;  1XNR Q;  4DR2 Q;  4A93 G;  1Z47 A;  4A4I A;  3RZO H;  3CCV A;  3UDF A;  1SMX A;  5IYC H;  5C4J H;  4LF5 L;  2JA5 G;  3PV0 A;  1YI2 A;  3GTM H;  2UU9 L;  4JI7 L;  1NBW A;  3CXC A;  1PH4 A;  4HJ5 A;  4YHH L;  2JK8 A;  4LF7 Q;  4JOI A;  3S24 A;  3H0G H;  1HZ9 A;  1S3O A;  4C3H H;  4OON A;  1K3R A;  3UDI A;  3HKZ E;  5JEA G;  1NE3 A;  3M85 A;  1Y1W H;  2E5L Q;  2HHH L;  3I4O A;  3Q8D A;  5GQO A;  1JB7 A;  1E22 A;  1VQI A;  2HIX A;  4BBS G;  2VQE Q;  4DV0 Q;  5FJ8 H;  4DR3 Q;  1NTG A;  1HZB A;  1X3G A;  4BY1 G;  1CSQ A;  2E8G A;  2I5L X;  2B63 H;  4IPG A;  4P74 A;  3U4Z A;  2ALY B;  2F4V Q;  4A3L G;  1J5E L;  2AKW B;  1EIF A;  2IT1 A;  3S14 H;  2E2I H;  5C44 G;  2NVX H;  1CUK A;  4A3M G;  1B7Y B;  1AE3 A;  3AFQ A;  3RLF A;  1XMQ Q;  4BXX H;  5M3F G;  1NY4 A;  4DV6 L;  2XGT A;  2OQK A;  4POG A;  4X64 L;  1NMG A;  4IPC A;  1N32 Q;  2YTY A;  1N34 L;  2AMC B;  3FP9 A;  3MXN B;  3G6E A;  5IYB H;  3S1R H;  4A3D G;  2RF4 A;  2ZM6 Q;  2UUB L;  4LF5 Q;  4KHP L;  2KCM A;  5JJK A;  1KL9 A;  1PA6 A;  1GO3 E;  1VQO A;  2UU9 Q;  4JI7 Q;  2ZJP A;  3I4M G;  5JJI A;  1YVC A;  5IE8 A;  4YHH Q;  4DV1 L;  2JA9 A;  1I50 H;  1CSP A;  3NEN A;  3HOV G;  2QGQ A;  2MFI A;  1Q1E A;  4TVA B;  3CC2 A;  1PYS B;  2OCE A;  4DR1 L;  1Q8K A;  4GOP C;  3I4N H;  4X62 L;  1CKO A;  4L5T A;  4JI4 Q;  2R92 G;  1I3Q H;  2Z0S A;  1VQ9 A;  5HY6 A;  1Q1B A;  1NJI C;  1G6P A;  1K8A C;  5IP9 H;  3U50 C;  4IJL A;  4JBM A;  4JCV E;  5IWA L;  1KRT A;  3AQQ A;  4EQ5 A;  4IJH A;  4QQB X;  1PH5 A;  3RLO A;  4P72 A;  4DV7 L;  1EQQ A;  2IHF A;  2CWA A;  4DNI A;  2BA1 A;  4A3M H;  2CWP A;  4XIG S;  1E24 A;  1VQA A;  4B3M L;  1L1O B;  4DR5 L;  4K0K Q;  4JI8 Q;  1VCI A;  5LMU L;  4DV6 Q;  2OWO A;  3L0O A;  2KCT A;  4JV5 L;  4X64 Q;  1M90 C;  2PMZ E;  3GDE A;  5C3E G;  3I2Z A;  3OYY A;  4A3C G;  1VQF A;  3RN2 A;  4C3I H;  1FJG L;  2UUB Q;  4A3G G;  4JI1 L;  3HKZ G;  1UE7 A;  4P71 A;  3HFZ B;  3J80 c;  4A3K H;  3HOW G;  4R4O A;  4A3F G;  3TRZ A;  3RLN A;  1KRS A;  2PQA B;  3UDG A;  4DV1 Q;  3DM3 A;  3F2B A;  4DR1 Q;  3HOV H;  1UWV A;  2VY3 A;  1VQ5 A;  1CKN A;  4GLX A;  1GD7 A;  2KHJ A;  3KDF A;  4GNX A;  4GKK Q;  1EOV A;  5AJ3 Q;  3HOY G;  4GN5 A;  3EBE A;  3PF4 A;  2JEB I;  2K75 A;  3FHW A;  4QIW E;  1XJV A;  3H3V H;  4BY7 H;  1R9T H;  1QVG A;  1TWF H;  4IPD A;  4OXP A;  4UPA A;  4BBR H;  1PH2 A;  3FKI H;  5IWA Q;  2HIV A;  2XTI A;  2JQO A;  4R4Q A;  1UE6 A;  3GTQ H;  1HNW L;  4IFD G;  4YY3 L;  1WI5 A;  5IYD H;  1E1T A;  1K0R A;  1OXU A;  2GN5 A;  3CAM A;  3IRB A;  2R93 G;  4B3M Q;  1V9P A;  4DR5 Q;  3CPF A;  3SGI A;  1XNQ L;  1N9W A;  2CQO A;  2R7F A;  4R4C A;  3J81 i;  2K5N A;  3HOU G;  2K5V A;  4AYB E;  3NEM A;  3I55 A;  4B3S Q;  1FJG Q;  4NXN Q;  4JI1 Q;  2PI2 A;  3ERS X;  2K4K A;  1LTL A;  1P8L A;  1N8R C;  1IYJ B;  4OX9 L;  4DR6 Q;  5JEA J;  3JAM c;  1GM5 A;  1IBM Q;  3RNU A;  1BVS A;  4O0A A;  3CD6 A;  2GVB A;  5FLX c;  2IHE A;  3CCJ A;  4LFC L;  1U0L A;  5ELN A;  2ZJR A;  2UUC L;  4ME3 A;  4JI2 Q;  1A8V A;  3CW2 C;  1VQP A;  4QL5 A;  2NVT H;  5IP7 H;  5BR8 L;  1X56 A;  2CFM A;  3F1Z A;  1IXR A;  3J7A 5;  1Y1V G;  1HZC A;  1HNW Q;  4Y7N H;  3ULL A;  2EIF A;  4LUV A;  4YY3 Q;  1Q46 A;  2IX0 A;  2NVY H;  4GLA C;  1PH1 A;  1IBK L;  2YTX A;  2Y0S E;  5GRO A;  4LWC A;  5HGQ A;  2JA8 H;  4LFB Q;  2JA7 G;  4AIM A;  2QA4 A;  3PUV A;  2FXQ A;  1QUQ B;  5M3M G;  4X65 L;  4A3E G;  1XPR A;  4NXM Q;  1HR0 Q;  2VNU D;  4DK6 C;  3CQZ H;  1V43 A;  4FDB A;  4LF9 L;  1SR3 A;  1N36 Q;  3PUW A;  4J15 A;  1A62 A;  2MNA A;  1LUZ A;  2VQF L;  3KF8 B;  1NMF A;  1MIU A;  2ES2 A;  1N33 Q;  2HT1 A;  5C0X G;  5M5Y H;  4GLV B;  1YHQ A;  1VQ6 A;  4GOP A;  1MJC A;  3H3V I;  2H5X A;  4OX9 Q;  1HZA A;  1PFS A;  2K5H A;  3GD7 A;  1KXL A;  1JJG A;  4UP9 A;  3TS2 A;  1OXS C;  4DUZ L;  4DV2 Q;  1QZH A;  1PH8 A;  1M1K C;  4B3R L;  2UUA L;  1WCM H;  3GTK H;  2ID0 A;  3PSI A;  3KOJ A;  4KLK A;  4LFC Q;  4A93 H;  5EAY A;  2UUC Q;  4JI6 L;  3LGJ A;  4DV4 L;  1I94 L;  3M7N A;  4NPS A;  4A3I G;  2I5H A;  3TRE A;  3UE1 A;  2JA5 H;  1IL2 A;  1PH7 A;  3K0X A;  4A76 A;  2NN6 I;  2JA6 G;  2R6G A;  1D8L A;  3OTO Q;  4QGU A;  4JV5 Q;  2L15 A;  2UXD L;  1TWG H;  1Y14 B;  5GAG C;  1SLJ A;  1X65 A;  2HHH Q;  4IOC A;  1TWC H;  1FL0 A;  3KLW A;  3WWV A;  4DUY L;  2NVQ H;  1PV4 A;  3UE0 A;  3CF5 A;  4BBS H;  2D62 A;  3HOX G;  4A3B G;  4HJ7 A;  1JJ2 A;  4BY1 H;  3M4P A;  4Y52 H;  4MZ9 A;  4LNQ A;  4AYB G;  1J5E Q;  1V1Q A;  5E7N A;  5M3M H;  3D31 A;  4A3L H;  3F2C A;  1QVF A;  2R7D A;  3J7Z C;  3CCR A;  1VQM A;  2VZA A;  1KC8 C;  2VUM G;  2UXB L;  1KQS A;  1L1O C;  2BA0 A;  5C44 H;  1TXY A;  3T1Y L;  1EIY B;  2I0Q A;  4L5Q A;  1K73 C;  1RL2 A;  3A5Z B;  4O2D A;  4PG3 A;  4GN3 B;  5FLM G;  3E0E A;  1S72 A;  4UP7 A;  5M3F H;  5DLQ E;  2JE6 I;  4X66 L;  1WJJ A;  4DR4 L;  2Z6K C;  1XMO L;  1B70 B;  3G48 A;  4B3T L;  4YCU A;  4YWM A;  3E9H A;  1N34 Q;  4DUZ Q;  1Q7Y C;  4LF8 L;  4B3R Q;  1EUJ A;  2K50 A;  1PH9 A;  1KAW A;  2CCZ A;  1HNX L;  3PO3 G;  1HR0 W;  4PZ7 A;  4DV4 Q;  1VQN A;  4WJ4 A;  4JBK A;  4A3D H;  3CCU A;  4KHP Q;  4EX5 A;  4OO1 G;  1IBL L;  1VQC A;  4R4T A;  3I4M H;  4A3I H;  2F52 A;  3ULJ A;  2Y0S G;  5C4X G;  5J3B A;  1OXV A;  1OXX K;  1VQ8 A;  4HJ9 A;  2UXD Q;  4AQY L;  4POF A;  4X62 Q;  3TS0 A;  1FVI A;  4JC0 A;  4L5R C;  2IY5 B;  3PUY A;  2R92 H;  1AH9 A;  3KJO A;  1JT8 A;  4JG2 A;  4P73 A;  3HOZ G;  5H1S E;  1X9N A;  4X6A H;  3PGZ A;  2E2J H;  3CCS A;  1JE5 A;  3K7A H;  3CPW A;  1VQH A;  3GTO H;  4NB3 A;  4DAM A;  4DV5 L;  1KD1 C;  4LW1 A;  4OWW B;  2DUD A;  2WAQ G;  2ASB A;  3S16 H;  2R7Z G;  4YCV A;  4DV7 Q;  2UXB Q;  1C7Y A;  4JI5 L;  3F8T A;  3KF6 A;  4BA2 I;  4P75 A;  1I5F A;  4HIK A;  5GAH C;  3EN2 A;  4RMF A;  1XNR L;  3J80 i;  5IYC G;  3W5O A;  3CCE A;  5LMU Q;  1B8A A;  3GTJ H;  1XMO Q;  3OW2 A;  1DGS A;  2WB1 G;  1SFO H;  3E9I A;  4L5S A;  4DR7 L;  5C3E H;  3PIO A;  4LF8 Q;  3H0G G;  1YHA A;  4A3C H;  4GKJ L;  1PH6 A;  2E5L L;  4GS3 A;  1G29 1;  2Q2I A;  3KYH C;  3ZJY C;  4HIO A;  3PO3 H;  4DPG A;  4AH6 A;  4A3G H;  1MKH A;  4KHZ A;  5IT9 c;  1AE2 A;  4JI0 L;  5FJ8 G;  2BH2 A;  3HOW H;  4A3F H;  1VQE A;  1VQK A;  4DR3 L;  2B63 G;  1EQR A;  3S2H H;  5ELO A;  1KHI A;  3PO2 G;  3A5U A;  3GO5 A;  3M9B A;  4A3J G;  2QEX A;  2Q2U A;  3ULP A;  2F4V L;  2MO1 A;  5GAE C;  1VQ4 A;  2KEN A;  1YBY A;  1PVO A;  2ZTE A;  1ASZ A;  2AWO A;  1A0I A;  1CKN B;  2WP8 J;  3D0F A;  2K14 A;  3CC7 A;  1K8G A;  3A74 A;  1VQG A;  4BXX G;  3KDF B;  1QVC A;  4GNX B;  3AYH B;  3HOY H;  3HOZ H;  3RZD H;  2KHI A;  5IY0 A;  4DV5 Q;  2EQS A;  2UXC L;  1UEB A;  4IO9 A;  4LFA L;  3K81 C;  3ICE A;  1YIJ A;  4YWK A;  3J81 j;  1YJW A;  2MO0 A;  3BJU A;  5IYB G;  5LMN L;  3M3Y H;  3HKS A;  4C3J H;  3KF6 B;  1XNQ Q;  2R93 H;  1XPU A;  1H95 A;  2ZM6 L;  3F2D A;  3PUZ A;  3JAM i;  1EWI A;  3STB D;  2V1C C;  2VW9 A;  3G71 A;  4UY8 C;  4DR7 Q;  2OQ0 A;  2Q2H A;  3I7F A;  1FGU A;  3NEL A;  4TQU S;  1VQL A;  3I4N G;  2HQL A;  2AHO B;  4GKJ Q;  4C2M H;  2WAQ E;  3HOU H;  1GVP A;  2RHS B;  4JI4 L;  4MTN A;  4LF4 L;  4JI0 Q;  2NZH A;  1VS0 A;  3S17 H;  2N49 A;  2JJQ A;  5IP9 G;  1IZ6 A;  1T9H A;  2VS1 A;  2GVA A;  1VQB A;  1L2F A;  1W3S A;  3EIV A;  3I56 A;  4HJA A;  4IOA A;  1C0A A;  1Q86 C;  2LXK A;  2WB1 E;  4DK3 C;  3CC4 A;  4LUO A;  3PO2 H;  2RHQ B;  4R1J A;  4A3J H;  1J6Q A;  4DAY B;  1SRU A;  5BR8 Q;  1HJP A;  4JBW A;  3NBH B;  1L1O A;  2ATW A;  3A0J A;  4JOI C;  1SE8 A;  1VQ7 A;  1RIP A;  1ASY A;  3ER0 A;  3PCO B;  4LUZ A;  4QY7 A;  3S2D H;  2N8N A;  2YYZ A;  1JJC B;  1K83 H;  2UXC Q;  4K0K L;  1Y1V H;  4LFA Q;  1P16 A;  4JI8 L;  1IBK Q;  1Z9F A;  4HIM A;  3M4Q A;  2WFW A;  4BA1 I;  2Z6K A;  2VL6 A;  1PH3 A;  1KIX A;  2IX1 A;  1BBW A;  1O7I A;  1X55 A;  3T1H L;  3PF5 A;  2D0O A;  4HID A;  4QJF A;  3CMA A;  1YNX A;  5LMN Q;  4X65 Q;  2JA7 H;  2LXJ A;  2A19 A;  1LM0 A;  4IPH A;  4LF6 L;  2KBN A;  2D0P A;  3TEH B;  4A3E H;  4LF9 Q;  4OO1 I;  4A3K G;  1OTC A;  2PQA A;  1PYB A;  4DV3 L;  1SRO A;  5GAD C;  2VQF Q;  2ZTD A;  3JC6 6;  4HJ8 A;  2B3G A;  1HNZ L;  2JEA I;  3L7Z C;  4OWT B;  3L2P A;  2C35 B;  4LF4 Q;  2ZTC A;  1BBU A;  2YV5 A;  4GOP B;  3S1M H;  1W2B A;  3TQY A;  3KFU A;  4GKK L;  4DKA C;  4BY7 G;  3K7U C;  5M5X H;  3M4O H;  5AJ3 L;  1E1O A;  3B6Y A;  4BBR G;  2UUA Q;  1A63 A;  1XPO A;  4WJ3 M;  3FKI G;  4IFD I;  3S15 H;  4JI6 Q;  2LSS A;  1X3E A;  3K8A A;  3PIP A;  4H02 A;  1I94 Q;  5IYD G;  1S40 A;  1U5K A;  2OTL A;  2PNH A;  4YCW A;  4YWL A;  1PHJ A;  3S1N H;  3RR5 A;  1VQJ A;  4PZ6 A;  2JA6 H;  1K9M C;  1X54 A;  4IFD J;  2NN6 G;  4KI0 A;  3KJP A;  1YIT A;  2NZO A;  5M5W H;  1XTD A;  2K52 A;  4DUY Q;  2F3I A;  3UDX A;  1VQD A;  2AWN A;  3T1H Q;  4A75 A;  1Q81 C;  2E2H H;  3H15 A;  4JI3 L;  3BZK A;  2YU9 H;  2BH8 A;  4PZ8 A;  3HOX H;  1Q82 C;  4LF6 Q;  1I6H H;  3MEF A;  4A3B H;  4JBJ A;  3STB C;  2YTV A;  4B3S L;  4NXN L;  1X3F A;  4DV3 Q;  1WOC A;  2A8V A;  1HH2 P;  1SN8 A;  4DR6 L;  2MQH A;  2DGY A;  3T1Y Q;  1HNZ Q;  1UE5 A;  1IBM L;  4RG1 A;  2VUM H;  4OWX B;  3GTG H;  4JYA L;  3J81 c;  4DR2 L;  3CCM A;  1MJE A;  4X66 Q;  5FLM H;  3U58 A;  4DR4 Q;  3CCL A;  1BKB A;  4B3T Q;  4JI2 L;  1YHB A;  1TWA H;  1E3P A;  5IP7 G;  4UP8 A;  2Q2T A;  5K36 G;  5LMN W;  2N78 A;  1YJ9 A;  1Y1W G;  1HNX Q;  4LF7 L;  3W1G A;  1EYG A;  2A1A A;  3VDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...