4LF9Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf9Q00
2RHSB 1PV4A 2IY5B 2ZM6Q 1SRUA 2DUDA 4GKKL 1KXLA 1TWHH 1PFSA 4TVAB 3GTMH 1HJPA 4B3TQ 4LF7L 4IPGA 4P71A 5JEAJ 3Q8DA 2JE6I 5LMNL 4GOPC 4GLXA 2E5LQ 2MFIA 4OWXB 1YEZA 3ERSX 1YJWA 4HJ7A 4IJLA 1YVCA 4QY7A 3M85A 1TWFH 4DUYQ 1Q8KA 4GLAC 3M4QA 4L5SA 2HIVA 3LGJA 2ALYB 3KJOA 3GTJH 1S72A 2L15A 4AQYL 2IX1A 1IYJB 4OWWB 4PZ8A 1SMXA 3KLWA 3F2CA 4OX9Q 1Y1WG 1EQRA 2CWPA 1VQ5A 2JA8G 4JG2A 4IOCA 4R4IA 1N34Q 4PMWA 3CF5A 4DV7Q 3W1GA 1HZCA 4LF9L 2EXDA 3S2HH 3U58A 4LF6L 2VS1A 2VUMH 3HFZB 4DR4Q 4A3GG 5M5WH 1SROA 1N32Q 4X65L 2K50A 4DK3C 1XMOL 2R93G 3T1HQ 3NEMA 4POGA 2F4VQ 3D31A 2VQEQ 2HT1A 1VQGA 1VQEA 4YY3Q 1K83H 3KF6B 3HOWG 1HNXL 4IJHA 1C7YA 5LMUL 2UXBL 1LYLA 1RL2A 3KJPA 4P74A 5IP9G 4YHHL 1I6HH 5IP7G 4JBKA 1QUQA 5M3MG 5GAEC 2N49A 1D8LA 4XIGS 3I56A 2YTVA 1WFQA 4JOIA 4OXPA 3HOXG 2VQFL 3M7NA 3HKZE 3K8AA 5C44G 4A3MG 2KCTA 4DV5Q 4LFBL 1NE3A 4LF4Q 2JA6G 1IXRA 3MEFA 4BY7G 3I7FA 1PH4A 2VZAA 4WJ4A 5IYDH 1VQIA 4A4IA 3JAMi 1WYDA 3A5ZB 2ZJQA 4C3HH 4JOIC 4RMFA 1VQJA 4JI5L 3PF4A 3E9IA 1VQFA 4UPAA 3CCRA 4HJAA 3AEVA 2B63G 4C3IH 3CPFA 3PCOB 4DR7Q 4JI7L 2OTLA 3UDFA 1X9NA 1GD7A 1U5KA 2E2JH 2Q2UA 1EIYB 4LNQA 1E24A 2NVQH 4GKJL 3G48A 4WJ3M 1UE1A 1K73C 4DV0Q 3GTPH 1A62A 3AQQA 4DR5Q 1XPRA 4B3ML 1YZ6A 3S17H 3TS2A 1ASYA 4TQUS 4JI3Q 1J5EQ 2OQKA 4EX5A 1G51A 2Z6KC 3W5OA 3FP9A 3HOWH 2UXDL 3EBEA 2VNUD 1HR0W 3PGZA 4LFCL 1BBWA 5M3FG 5C3EH 4JI0L 4JI6Q 4ME3A 4APVA 4LF5Q 2R93H 3CAMA 2LXJA 3PV0A 4GN4B 4JYAQ 1EYGA 4JI4Q 4Y52H 1KC8C 5C3EG 4H02A 1PYSB 1SE8A 1OXXK 3UDXA 1HNZL 1E7ZA 2IT1A 4IFDJ 1S40A 4DKAC 1I50H 3S14H 2ZTCA 3TEHB 3J7A5 2UUCL 2PMZE 4QIWE 4DV4Q 3PUVA 3NBHB 1XNQL 3KF8B 1IZ6A 5EAYA 4YCUA 3ULLA 4AYBE 4DR1Q 3CPWA 4HIDA 4A3DG 2UXCL 1M90C 2NN6I 1JJCB 4R4TA 4LF8L 4KLKA 3KFUA 1VQ8A 2AHOB 5IWAQ 3HKZG 1XNRQ 2V1CC 3JAMc 4JCVE 4RG1A 3FHWA 1WCMH 4X66L 1C9OA 4DNIA 4HIMA 4A3JH 1X65A 3EN2A 3KOJA 1X54A 3ZJYC 4BA2I 4DR2L 3AYHB 1WJJA 2NVTH 1PYBA 1WCMG 5E7NA 2LXKA 4LWCA 5IWAL 4A3FG 4K0KL 4O2DA 2GN5A 4DR3Q 2N3SA 3TS0A 3J80c 1E22A 2OCEA 1YJ9A 4IO9A 3L0OA 3M4PA 4C2MH 4GNXA 1YHQA 1KIXA 2RHQB 1PH7A 4JC0A 1Q86C 2K75A 3M4OH 2JA5G 4JBWA 3CCMA 1HNZQ 1X6OA 3HOXH 2ES2A 4KHPQ 1XPUA 4JI8L 3DM3A 3L7ZC 3BU2A 2HIXA 2D62A 4UP7A 5M3MH 4JYAL 4GNXC 4GN5A 1BVSA 4A3CH 3I4MG 4YWMA 3OW2A 1NMGA 5AJ3L 2R92H 1GVPA 1YNXA 1VQHA 1YI2A 4JI1Q 3PO2H 2UXDQ 3CW2C 4JBJA 4ALPA 1HH2P 1QVGA 3FKIH 1CUKA 4PZ7A 5ELNA 1VQ4A 5GADC 1M1KC 1JJ2A 4AH6A 1FL0A 4HJ8A 4A3CG 4R1JA 4DV1Q 1CSPA 3H3VI 2Y0SE 4DR3L 2K5HA 4IPHA 1VQOA 4NXMQ 3GTOH 2K4KA 3S2DH 4DV3L 5IYCH 2MNAA 2EQSA 1W2BA 3BZCA 4DV3Q 4XTCS 3H0GH 1PVOA 2YV5A 2B63H 2RCNA 3T1YL 4AIMA 3S1RH 4YWKA 4JI5Q 1QZGA 3PIPA 3ICEA 2UXCQ 2NN6G 4DR1L 4IFDG 2ASBA 1B8AA 1N8RC 1PH2A 1K9MC 3S1MH 1UE5A 3J80i 4DV4L 4A76A 4DAMA 4JI1L 3K7AH 4DV5L 1K0RA 2Z0SA 1E1OA 4JI4L 2BA0A 1N36L 1CSQA 5C4XH 1N36Q 1NTGA 3E0EA 3VDYA 1AE3A 1JB7A 1YJNA 3H0GG 5C0XJ 2A8VA 2B3GA 1G291 3OYYA 5IYCG 1HZBA 4YY3L 3I4NH 1KRSA 3PSIA 1MJEA 1X3GA 4Y7NH 3B6YA 1JJGA 3T1HL 4A3IG 1XMOQ 4K0KQ 5IP7H 1N32L 3T1YQ 5LMNW 4DR4L 1UEBA 3CC4A 3JC66 4LF6Q 3CCLA 5IY0A 1OTCA 4LF9Q 4DR7L 3MXNB 3CCSA 1QVFA 4NXML 2BH8A 4P73A 1PH3A 1P16A 5FJ8H 3I4MH 3E9HA 2JA8H 1X3EA 1PH5A 3UE0A 3GDEA 3G71A 4DV1L 2AWOA 4A75A 1L1OB 2CWAA 4PG3A 3HOZH 2E2IH 1UWVA 3F8TA 3I4NG 4MZ9A 3HKSA 4OWTB 3I55A 2UUCQ 2CKZB 2JA5H 1EUJA 3PO2G 2F3IA 3GTGH 4FDBA 2D0PA 5AJ3Q 1YHAA 5GAGC 3GD7A 1LTLA 1T9HA 3S1QH 1U0LA 1PH8A 1KQSA 4LF5L 4BXXG 4JI8Q 4DAYB 1VQMA 4JI6L 4KHPL 1C0AA 4P75A 1NJIC 5K36G 2KHIA 1VQDA 5C0XI 4UY8C 2WAQE 5LMUQ 1GO3E 2NVYH 3RLFA 2JA6H 4UP8A 1KD1C 4A3LH 2R7ZG 3EIVA 2C35B 2R6GA 1KHIA 2N8NA 2VL6A 3H15A 3PUYA 1EOVA 1VQCA 2I5MX 4JI3L 2ZM6L 2VQEL 3F1ZA 1J5EL 4B3MQ 3HOUG 3RZDH 4BXXH 2XGTA 4DV0L 3CC2A 3W1BA 3NELA 4NB3A 3A0JA 4GKJQ 3K7UC 3TRZA 2MO0A 3AFQA 1FGUA 3PUXA 1Q12A 2YU9H 2JEAI 4DR2Q 3STBC 1P8LA 1S3OA 1Q81C 4X66Q 4DV7L 3CCQA 1XNRL 3UDGA 2JA7H 3GO5A 4LW1A 4IFDI 3HOYH 3CP0A 1PH6A 2LSSA 1Q1EA 4GLVB 1VQAA 4LF8Q 2A19A 2F52A 4A3EH 2OQ0A 2YTXA 4A3DH 2IHEA 1WOCA 5M3FH 2CQOA 4AQYQ 2NVXH 3FKIG 4A93H 1CKMA 4OONA 1XNQQ 1A0IA 4DUYL 3CMEA 2MO1A 3PUZA 4A93G 1DGSA 2VQFQ 3CCJA 4POFA 4QJFA 2MQHA 2E5LL 5IYBG 1ASZA 1KRTA 4YHHQ 4L5TA 4JI0Q 3CD6A 1NBWA 1OXTA 4LFCQ 2VUMG 1HNWQ 1YHBA 1HZAA 1VQ7A 3NENA 3CXCA 1HNXQ 4MTNA 1V43A 5FLMG 2Q2IA 4QL5A 1TXYA 3ER0A 1PH9A 1K8GA 4A3EG 4KHZA 1RIPA 2UU9Q 4DR5L 4A3BG 2JA9A 3A74A 1I94Q 2WFWA 5IYDG 3DLLA 3RN5A 1B70B 2KHJA 2ZTDA 2ATWA 3RNUA 3U4VA 4B3SQ 1V9PA 3UE1A 4DR6Q 4JV5L 3U50C 4A3LG 5HGQA 1E1TA 1WI5A 2B29A 2WB1E 3KDFA 5C0XG 1IBMQ 4JI7Q 1EFWA 1FJGL 4OO1G 1FVIA 4B3RQ 4AYBG 1JMCA 2R7FA 5BR8Q 1G6PA 4UP9A 1Q82C 4LUVA 1TWCH 1N34L 2Y0SG 1OXUA 1SLJA 2NZOA 5H1SE 1YITA 2OWOA 1L1OA 1W3SA 3A5UA 3G4SA 3ULPA 2UUAQ 4BBSH 2R7ZH 3M9BA 1EIFA 2AMCB 3TREA 3GTQH 4LF4L 4HJ5A 1Y14B 3PO3G 4MNOA 1X56A 1I5FA 1IL2A 5JEAG 4LFBQ 3F2BA 3CC7A 2PQAB 2D0OA 2WP8J 4DK6C 3K81C 4A3KH 5C4JH 2JEBI 2XTIA 3PIOA 2JK8A 5IP9H 4R4QA 1A63A 3CCUA 4JBMA 2UXBQ 1VQ9A 4B3TL 1NY4A 4YWLA 2IX0A 1L0WA 3TQYA 1N33L 4P72A 4GKKQ 3G6EA 1QUQB 4IPCA 3KYHC 2F4VL 4X62Q 3RLNA 4X65Q 4BY1H 1HZ9A 2GVAA 2CFMA 2Z6KA 4HJ9A 1X55A 3CMAA 1Q1BA 4A3GH 1JT8A 4GS3A 2FXQA 2HHHL 4JI2L 1VQNA 1Y1VG 1D7QA 4BBRG 1KL9A 2ZJRA 3J81j 1SN8A 2A1AA 4PZ6A 3CCEA 3S16H 1GKHA 1LUZA 2K5VA 1YBYA 2ZTEA 2JJQA 1X3FA 4A3KG 2Q2TA 4OX9L 2BH2A 3J81i 1E3PA 4BA1I 2PI2A 1IBKQ 3H3VH 2KENA 3S15H 3PO3H 4DV2Q 4DV6L 2YTYA 1N9WA 1QZHA 4J15A 2DGYA 5HY6A 4NXNL 1CKNB 5C4XG 2BA1A 5LMNQ 4A3BH 4A3FH 2AWNA 1HR0L 1K3RA 3GTKH 2IHFA 4BY7H 1PA6A 4LF7Q 5FLMH 4LUZA 3OTOL 4DUZQ 2JQOA 3J81c 3STBD 2E2HH 3GTLH 3PF5A 2PNHA 1QVCA 5DLQE 4BY1G 1VS0A 1MJCA 3U4ZA 4X62L 2I5LX 1XPOA 3WWVA 1LM0A 1MIUA 1A8VA 2NZHA 2YYZA 4LFAL 1Y1VH 3OTOQ 1YIJA 2OTJA 1XMQL 4YCWA 1UE6A 2ZJPA 2AKWB 2K5NA 1IBLQ 2HQLA 2RF4A 1VCIA 4NXNQ 2H5XA 1KAWA 1AE2A 4A3IH 4L5RC 1V1QA 1Q7YC 2JA7G 2ID0A 3IRBA 4GOPB 3D0FA 3HOUH 3S1NH 1SFOH 5JJIA 2WB1G 3F2DA 4DV6Q 1BKBA 4KI0A 1UE7A 2WAQG 3ULJA 4LUOA 4O0AA 1NMFA 2PQAA 1IBKL 2R92G 4YCVA 4BBSG 2I5HA 3J7ZC 2EIFA 1AH9A 4QQBX 4QGUA 2UUBQ 4GNXB 1IBLL 3PUWA 2VY3A 5J3BA 1VQ6A 2N78A 5GROA 4EQ5A 2GVBA 5FLXc 3SGIA 3CCVA 4IOAA 1K8AC 1IBML 3BJUA 4JI2Q 2CCZA 3HOVG 1PH1A 4DR6L 1VQBA 1L2FA 5C44H 4A3MH 4JV5Q 2R7DA 4A3JG 4X64L 1I94L 2E8GA 2K14A 1EWIA 1EQQA 2UU9L 4X64Q 4R4OA 3CQZH 3I2ZA 3RZOH 1H95A 4DUZL 1N33Q 3HOVH 3S24A 1SR3A 4BBRH 3KF6A 1VQKA 1HNWL 2VW9A 2KCMA 3M3YH 3HOZG 1BBUA 1HR0Q 2QEXA 3I4OA 3AFPA 2KBNA 1L1OC 2UUBL 1VQLA 2Q2HA 2I0QA 1OXVA 4X6AH 1VQPA 4GOPA 1TWGH 5FJ8G 1GM5A 4HIKA 5ELOA 5JJKA 4L5QA 1JE5A 1Q46A 4R4CA 4IPDA 1Z47A 5IT9c 1XTDA 4DV2L 1R9TH 3KDFB 1I3QH 3RR5A 4GN3B 5IE8A 2UUAL 4OO1I 1CKNA 3RLOA 5IYBH 1MKHA 1Y1WH 4NPSA 5GAHC 1OXSC 1B7YB 2PI2E 3BZKA 4DPGA 1PHJA 3HOYG 5M5YH 5BR8L 5M5XH 3K80C 3K0XA 5GQOA 1CKOA 4B3RL 2QGQA 1XMQQ 1FJGQ 1XJVA 4LFAQ 4HIOA 3L2PA 4C3JH 2HHHQ 4B3SL 3RN2A 1J6QA 1TWAH 2K52A 5JJLA 1Z9FA 2QA4A 1O7IA 3UDIA
chains in the Genus database with same CATH superfamily
1VDZA 3SHLA 2RHSB 1XXGA 2DUDA 2K01A 4K8JA 4CKEA 2B2WC 1HJPA 4B3TQ 4LF7L 3BVGA 1ZYRC 2WACA 3AMUA 4DFAA 3Q8DA 2JE6I 4GLXA 1PZJD 2E5LQ 2MFIA 3I73A 2A6HC 1BR9A 1KAAA 4QY7A 1TWFH 1Q8KA 4S3SA 1JB3A 3KJOA 2ALYB 1F2MA 1E0BA 4A3KB 3KF8A 3F2CA 4OX9Q 1AEXA 5D3DA 5E4WC 2JA8G 3L9AX 1U4RA 2EVBA 3GTLB 1HZCA 3S2HH 4LF6L 2VUMH 2EY2A 3IAYA 1IL8A 3VR6A 3S17B 3HZXA 4B9WA 2F4VQ 2VQEQ 1C48A 1PFMA 2QCPX 4UHVA 4QCLA 1ML0D 1PTOH 3J80L 5IP9G 4YHHL 3J80E 5M3MG 4A3IB 1WFQA 4JOIA 4IUQA 1PRTB 1S4ZA 1M8AA 1IXRA 3MEFA 3NBHA 4WJ4A 3MFYA 1PH4A 3LWEA 4A4IA 2LFNA 2RDGA 4IALA 1LTTD 4JI5L 1I4RA 3I90A 4C3IH 4KHVA 4EQPA 1H9SA 4JI7L 3R2TA 1ESRA 1H9RA 1GD7A 2PMZB 1I6VC 1EIYB 2EY6A 1A62A 4B3ML 2NTTA 4JI3Q 1SNPA 4EX5A 1LTRD 3HOWH 1F2YA 3DXJC 2VNUD 4LFCL 4HCEA 1RD9D 4JI6Q 2FMMA 4LF5Q 3NWTA 4JYAQ 4Y52H 4H02A 1I4GA 3UDXA 3CRKC 1JICA 3M4YA 1S40A 3S14H 2Z8LA 3TEHB 2J7ZA 2SNMA 4C2MB 2B63B 4ZQ3A 3NBHB 3NE5B 1HRJA 5EAYA 4HIDA 3C1EA 5HURA 2NN6I 4R4TA 4LF8L 2NZ1D 4KLKA 2F0SA 1QWYA 2G9HD 5IWAQ 1XNRQ 4JCVE 4A3JH 1WCMH 1C9OA 4DNIA 4RGNA 4X3TA 4BA2I 2F4IA 4OO1H 1WCMG 1TY0A 2YU9B 5IWAL 4K0KL 2GN5A 4A3FB 2N3SA 4U68A 2PW7A 2I07B 3VR2A 4IO9A 2F1MA 2ZT9C 2DY7A 3M4PA 4KKTA 5KNCA 1KIXA 5CV7A 5C4HA 1PH7A 5C0XH 1VF5C 1D5MC 1X6OA 3HOXH 2CH4W 3BU2A 4QB4A 1B1ZA 5M3MH 4JYAL 4GNXC 3GP7A 4NP5A 5AJ3L 2A74C 4O1NA 4H0LC 4K5WA 5CV9A 4PMCA 3CW2C 1JQYD 5CYUA 1VQ4A 2O5JC 1HA6A 1LO5D 3QOJA 4AH6A 2AUKA 3GTKB 4BY7B 1FL0A 1XYIA 4RH6A 4WORA 1PRTF 5I6YA 3GTOH 3S2DH 4DV3L 2A6EC 5IYCH 2EYLA 1W2BA 3H0GH 3TSSA 5IGGA 3QG1A 3T1YL 4JI5Q 1EWHA 2HDMA 3ICEA 2NN6G 4DR1L 5IIFA 5IGCA 1N8RC 4EQNA 3S1MH 1JWUD 4DV4L 2EXZA 5ELCA 3K7AH 1KDAA 1JWSD 3MXUA 5CV8A 5CBEE 3OHXC 1H9JA 4KD3A 1E1OA 1N36L 1CSQA 5C4XH 1N36Q 4CHTB 3VDYA 3A8JE 2XWJB 2FJ2A 1KABA 1YJNA 3GTMB 2B3GA 1WTRA 4YY3L 3K5LA 3I4NH 1KRSA 1X3GA 1XMOQ 1Y8PB 5D65A 1ET6A 5IP7H 1GHKA 3T1YQ 5LMNW 4DR4L 1UUPA 1O7YA 4LF6Q 1OTCA 4MIUA 2BH8A 4P73A 1WD0A 5FJ8H 1GJXA 2JA8H 1PH5A 5CGKA 2EYOA 2EYFA 1A15A 3F8TA 3HKSA 2JA5H 1EUJA 4HMJA 4FDBA 5AJ3Q 3GTQB 2K5DA 3GD7A 1Y8NB 1U0LA 1KQSA 4BXXG 4JI8Q 2XVSA 1FR3A 1Q90A 2NBFA 4ME5A 4HR7B 5FLXL 3RLFA 2JA6H 3V05A 3H15A 2N8NA 3PUYA 1EOVA 2ZM6L 2IWHA 4IFDH 1PLFA 4C3HG 3W1BA 3A0JA 4GKJQ 2OEOA 3TMEA 4ABNA 5DNFA 3H6MA 3STBC 2EOTA 1S3OA 2ICIA 1SYCA 3AB9A 1AN8A 2X69A 1XNRL 1LT4D 3CP0A 4GLVB 1VQAA 4PQXA 3KLSA 2F52A 4A3DH 1S5FD 2YTXA 3G6JB 4AQYQ 1SJHD 1A0IA 2AQ3B 2PW5A 4DUYL 3CMEA 1MSGA 2MO1A 4A93G 3CCJA 1I50B 5M5WB 5IYBG 3ITPA 1ASZA 5D3IB 3CD6A 4L5TA 1B50A 1CHQD 3NK9A 1YHBA 4DXFA 3NENA 1HNXQ 4FVMA 4MTNA 1XWEA 1PDQA 3HRZC 4KHZA 2UU9Q 2TMPA 2VB3X 2WFWA 3E5SA 3I91A 1QB5D 3DLLA 2ATWA 4I7AA 3VYSA 4DR6Q 3NP8A 5HGQA 1IBMQ 2B29A 4JI7Q 2WB1E 5ELDA 1DXMA 2DNEA 1EFWA 1FVIA 3EA6A 5BR8Q 1E2ZA 1N34L 1Q82C 4LUVA 3D4DA 4MHEA 5H1SE 1PYWD 5L37A 1L1OA 3G4SA 4BBSH 3D8GA 3M9BA 3GTQH 2RBMA 1Y14B 2Z6BA 2B2WA 5JEAG 4K5VA 4A3KH 5C4JH 2JEBI 3PIOA 3Q24A 3FVQA 5IP9H 4HTHA 5NUCA 4IURA 1VQ9A 2ICEC 3TQYA 4FYDA 2R93B 1QUQB 3W2DA 2F0HA 1I4HA 1CQVA 2CFMA 4GS3A 2HHHL 3SR1A 4JI2L 1KL9A 4FP5D 3J81j 2Q8RE 1RODA 3SXHA 2F3VA 2K5VA 4OX9L 2Q2TA 1D1KA 1LTID 2BDOA 2PI2A 2RSNA 4LMQD 2ENBA 1VMPA 4DV6L 2F0EA 3K5OA 2DGYA 2BA1A 5CV6A 5KNDA 3GTPB 2BE5D 1PA6A 1DD2A 2M9VA 4FNFA 4LF7Q 4OELB 5FLMH 2E2HB 1GUOA 2DJFC 3GTLH 3STBD 1BCPB 2Z9HA 3VR4A 2SNSA 4X62L 4ULLA 3WWVA 3HOVB 3V96A 4WFN3 3FDTA 1YIJA 2OTJA 1XMQL 2K5NA 2LMCB 1IBLQ 4HEDA 4IQZA 1VCIA 2H5XA 5DAUA 3D0FA 4DNTB 1SFOH 4TKOB 1DJRD 2PQAA 1IBKL 1TVXA 3MXNA 4NKLA 1D5XC 4BWGB 2I5HA 1ZEQX 4IUPA 4N9TA 3S9WA 3J7ZC 1LTAD 3A7LA 2EJMA 4QGUA 2B2YC 4KV6A 2KHSA 1V8QA 2N78A 2EDGA 5E1FA 2CCZA 4JV5Q 1VQBA 1L2FA 4EVOA 5C44H 2QEJC 2R7DA 3BG3A 5AFWA 3A8IE 5M3FB 1D5ZC 4X64L 1I94L 3S1NB 4XDXA 1UNSA 3CQZB 1CQFA 4X64Q 4TRDA 4PV1C 3CHBD 4KTAA 3H0GB 1CA6A 3HOVH 3EQLC 1I4PA 3LX0A 1LLRD 2A6HD 4G7ZC 2Q2HA 1OXVA 3RUZA 3Q22A 1EEID 1EY8A 1JOOA 3J7YW 5JJKA 1R9TH 3HP3A 2L4NA 1IYUA 2M00A 3KDFB 1CHPD 1I3QH 4FF4A 4GN3B 3MVVA 3CRLC 5IE8A 2B2YA 5EBDA 1GUWA 5GAHC 3O13A 4DPGA 2HDLA 5M5XH 4B3RL 3K0XA 1LT5D 3GTOB 2K1BA 4CGYB 4C3JB 4LFAQ 2B2TA 3RN2A 1UAPA 1Z9FA 5I9OA 3UDIA 4KJNA 5CR3A 2VB2X 1PV4A 1WTXA 4XT1B 2SEBD 4GKKL 1TWHH 1PFNA 4TVAB 1EY4A 2B8FA 2QDLA 5I2XA 1LT6D 4P71A 1PFBA 1YEZA 1YJWA 1J8IA 4HJ7A 1HTPA 1B3QA 2WKCA 2A68D 4BBRB 3GTJH 1S72A 2IX1A 4OWWB 4PZ8A 1SMXA 1Y1WG 1EQRA 3DWQA 1PZID 2RCFA 4PMWA 3CF5A 4DV7Q 2CHBD 1JOQA 3NPPA 2K03A 3U58A 1WTPA 1V1PB 1N32Q 3T51B 2K28A 5JVH3 4DK3C 2R93G 3T1HQ 3DWPA 4O42A 3D31A 1MGSA 1X32A 4KKUA 2IL8A 2E2IB 4IJHA 5LMUL 2UXBL 1LABA 4C3IG 4P74A 5IP7G 1XTCD 2IX3A 2TSSA 2N49A 2EY5A 3HS0C 3I56A 3M7NA 3K8AA 5FOBB 2JA6G 5C4ZA 3MXGA 4BY7G 3I7FA 1SE4A 2ZJQA 4C3HH 5CC4A 4RMFA 3PF4A 1EQTA 3CCRA 3AEVA 2B63G 5ELFA 3CPFA 3PCOB 3I8ZA 2CH4A 2ZXRA 1TWFB 1X9NA 5J39A 1ILQA 1E2WA 1E24A 5T1IA 3G48A 5C3XA 4WJ3M 1UE1A 1K73C 3AQQA 3FKIB 1J5EQ 4U673 3W5OA 3K5NA 2EYPA 5M5YB 4M8AA 1VF7A 2EPBA 3OW7A 4ME3A 4APVA 3PV0A 3MFGA 1EYGA 1X3QA 1SE8A 3GTJB 1E7ZA 2IT1A 3BVZA 4IUUA 4XQNA 3RD4A 1K0SA 4WRDA 3CPWA 5T1GA 3HOZB 1Y1WB 4CDFC 3H3VC 2UXCL 3NTIA 3KFUA 4OHJA 2V1CC 3FHWA 2EYHA 2PYKA 1D2BA 1X54A 4XQQA 3AYHB 3S15B 1WJJA 2F0NA 2LXKA 4LWCA 1B3AA 2FHTA 3TS0A 1II3A 3J80c 1E22A 2OCEA 4IZ8A 1U4LA 3L0OA 1W6KA 4J1MA 2KUMA 2OXPA 3M4OB 2RHQB 1H9MA 1Q86C 2D5DA 1QNKA 4JI8L 3DM3A 3L7ZC 3I3CA 4OL7A 3MZ5A 4CBVA 5IGDA 2F0FA 3I4MG 4YWMA 3OW2A 3IFTA 5ELBA 5EPKA 2JYOA 1YNXA 1NAPA 3NTKA 1YI2A 3PO2H 3HEJA 2UXDQ 1QVGA 3FKIH 3KK7A 4PZ7A 1JJ2A 5GADC 4G57A 1PZKD 3T56B 1CSPA 3H3VI 3I70A 1VQOA 4C1NK 3PO3B 5BN3A 2YV5A 1WVLA 4RGTA 4AIMA 2F0JA 2QKIC 3S1RH 1DONA 1NR4A 3D4RA 5DEHA 3BS1A 2HD3A 2ASBA 1PH2A 1K9MC 3ERQA 3FPUB 3J80i 4DAMA 2QW7A 4DV5L 2Z0SA 1EYAA 5A2QE 4JI4L 2VUMB 1NTGA 5A2QL 1AE3A 3DEOA 1JB7A 1EIHA 5IYCG 1HZBA 3K58A 4Y7NH 3B6YA 1G8ZD 3CKIB 4A3IG 4K0KQ 1EYCA 3BZDB 2F0LA 3CC4A 2DY8A 3CCLA 4DR7L 5LL6S 3E9HA 4FF3A 3UE0A 4A75A 1L1OB 2CWAA 1UWVA 4MZ9A 2CKZB 4IUNA 3PO2G 3OOCA 1H9SB 3GTGH 2D0PA 1SAPA 1LTLA 3QR8A 4OGQC 1RTOA 2CQAA 1BCPD 4LF5L 4JI6L 5K36G 3P75A 1FNVA 3U9SA 2KHIA 4UY8C 2RKSA 5LMUQ 1GO3E 2NVYH 1SNDA 3OMCA 3EIVA 1J5EL 1VQCA 2K33A 3RZDH 4AYBB 4RAUC 3AFQA 5FO9B 1IKMA 2YU9H 5CBAE 4DR2Q 2PNRC 4A3BB 1STAA 3OPOA 5C6AA 4IFDI 4LW1A 3HOYH 1PH6A 4LF8Q 2A19A 5I4DA 3OSOA 2OQ0A 4A3EH 2IHEA 3HGBA 4EGVA 4R8NA 2NVXH 3NHHA 2J4XA 5C5LA 3U9OA 3PUZA 1DGSA 4POFA 4QJFA 2MJ8A 3V2TA 1BO0A 2MQHA 4K2KA 1BCPF 3TP5A 1MBYA 1STBA 4YHHQ 5IT9L 1HNWQ 4LFCQ 4PNYA 1VQ7A 3CXCA 1B2TA 1V43A 3ER0A 1PH9A 1AFPA 1B53A 2A5HA 4K6LA 3OMGA 2IW3A 2JA9A 5C44B 3S1QB 2ZTDA 2KHJA 3U4VA 4DXGA 1MI2A 1E1TA 1B9MA 1EQVA 1JE4A 2JA6B 1JMCA 2F0OA 1OXUA 2NZOA 1BOSA 1ESFA 1W3SA 4P2CB 3A5UA 1SMYC 2R7ZH 1EIFA 2AMCB 3SK6A 3PO3G 1Y69U 4MNOA 1X56A 1F2ZA 1I5FA 4LFBQ 3F2BA 2PQAB 4KY5A 2RSOA 2B2UA 1IW7D 4JBMA 4B3TL 3GQBA 3QIAA 5EJWA 4P72A 2JN4A 3SDZA 2F0KA 4GKKQ 3G6EA 4IPCA 1HTLD 2F4VL 5C3EB 3E6ZX 2WKDA 1HZ9A 3DWAA 2GVAA 1ZKOA 3QWNA 4QF4A 3BDLA 2OF1A 4A3GH 4CKBA 3NQIA 2PQEA 2C9OA 1Y1VG 1VQNA 4BBRG 1K8OA 1SN8A 1B9NA 3CCEA 3A54A 2A73B 1CA5A 2BOSA 1NUCA 1FD7D 2ZTEA 5KYLA 4A3KG 4HMIA 4RHRA 4ZKBB 4BA1I 4XQJA 3J81i 1IBKQ 1HHVA 3H3VH 4F88A 3S15H 2O5IC 4ZLTF 5FLXE 5KGUA 3SE0A 1V1PA 2WINB 1N9WA 2LKVA 1RCVD 2AWNA 5EKLA 2B2VC 3P20A 1Q8IA 1QJOA 1K3RA 1SNQA 3PIP3 1F9QA 1G2TA 4ZK9B 5CMDA 1RDPD 4LUZA 2F3WA 4DA2A 4DUZQ 2JQOA 1EZ6A 1HFNA 4OEMB 1MJCA 4RCNA 2N88A 1STGA 2B39A 2RVLA 1XPOA 4DAYA 1MIUA 4XYQA 4K5XA 1BDOA 5LL6X 1TR5A 2DN8A 3HKZB 2AQ2B 1UE6A 5HGTA 2ZJPA 2AKWB 3GV6A 1ILPA 1KAWA 4L5RC 1V1QA 3OIQA 3F2DA 4ZCKA 1AZQA 2HCCA 1UE7A 4ZKCB 1VMCA 1NCVA 4K8IA 4O0AA 1CK1A 1PMRA 2E74C 4HAEA 2EIFA 2UUBQ 1IBLL 1VQ6A 2L55A 1K8AC 3HOVG 4JI2Q 3HG9A 1R9TB 3ND8A 4KY7A 2E8GA 2K14A 1EWIA 2FFKB 2K6AA 3MA2B 1SYFA 2CVRA 4E6IA 3CQZH 2NVTB 3RZOH 1SR3A 4BBRH 3K57A 3IL8A 2KCMA 3A55A 3SEBA 2QEXA 1A3TA 3AFPA 1L1OC 1GM5A 1TWGH 1X3PA 5FJ8G 1I6HB 1Z6HA 4LK1C 3D6CA 3BDCA 3TZDA 1JE5A 2BE5C 3D6WA 3RR5A 3H91A 4OO1I 1CKNA 4K6DA 3RMHA 1KDCA 2PI2E 3BZKA 1CKOA 2QGQA 1T5EA 3X3MA 1SYDA 1DOMA 2HHHQ 4C3JH 5EPJA 4C3IB 3NBIA 2F0WA 2SDFA 2QILA 5C0XJ 1G6ZA 3K6OA 2IY5B 4DNRB 1DYQA 1BQQT 1KXLA 2IPKD 3D4WA 3M7GA 2K7VA 4JPBW 4C3HB 5LMNL 1HPCA 4OWXB 2HQEA 1JORA 2EZVA 1SYBA 1YVCA 3GV3A 4KN7C 4GLAC 1RJTA 1Y1VB 2R92B 1HUNA 4AQYL 4RKBA 1K83B 2WAQB 3RZOB 3VR5A 2CWPA 4JG2A 4R4IA 1N34Q 1STYA 4LF9L 2EXDA 3S2DB 1EYDA 2VS1A 4CDDC 3HFZB 1SROA 2G9DA 1SMYD 1GUNA 1LT3D 2K50A 4POGA 2HT1A 3ONAB 5EGTA 1VQGA 1VQEA 4OIJA 2PPBC 4CJ0B 4KN4C 2JSOA 1HNXL 1ET9A 5K5PA 2L0CA 3KJPA 1I6HH 4JBKA 2Q8TA 5GAEC 4XIGS 3HOXB 2YTVA 4G4KA 5DM73 3HOXG 2VQFL 2RA4A 2PO4A 4A3MG 4DV5Q 3BYYB 4LF4Q 2FMCA 5J1ZA 2VZAA 1Z7TA 5IYDH 1VQIA 3JAMi 1WYDA 3BYTB 4DF7A 4JOIC 1VQJA 3R93A 4UPAA 4HJAA 1CZGA 4DR7Q 3A7AB 3UDFA 1FGBD 2Q2UA 2QF7A 4LNQA 4GKJL 3QO2A 3GTPH 3S17H 1XPRA 1ASYA 2A69C 1CFMA 3FEWX 3FP9A 4A93B 2UXDL 1O7LA 5J22A 3EBEA 1HR0W 5M3FG 5C3EH 4JI0L 2KECA 4EQOA 2R93H 4GN4B 4JI4Q 1KC8C 5C3EG 1KLGD 1PYSB 1OXXK 1HNZL 4IUTA 4IFDJ 1I50H 4X3UA 3TP7A 3J7A5 2NVQB 2UUCL 1F9SA 4QIWE 3PUVA 1F2LA 4FXKC 3MWYW 4L63B 4DR1Q 4A3DG 1WTVA 1CM9A 1VQ8A 2PCFB 2AHOB 1XX8A 3JAMc 3J81E 3HOUH 4RG1A 4XT3B 1SE2A 1X65A 2NVTH 1PYBA 2E2DC 4CDCC 3DMUA 4CJ2C 4FXDA 4CJ1B 1GUSA 4A3FG 4O2DA 2F0MA 5E4XA 4GNXA 1M4VA 1YHQA 3QB3A 4N9PA 2V4DA 4JC0A 2K75A 3M4OH 1IW7C 4MTKA 4JBWA 3JAML 3CCMA 1HNZQ 2ES2A 1XPUA 3DUZA 3SK8A 1HUMA 1LV9A 5FO8B 3G7LA 4GN5A 1GVPA 2CW0C 1VQHA 5KEEA 1TY2A 5IGEA 4ALPA 5KNBA 1HH2P 1NSNS 5ELNA 1M1KC 1SDFA 4RGOS 4H13C 5G3LD 4A3CG 4R1JA 4DV1Q 4RWSC 1MD2D 2Y0SE 4IPHA 4KJOA 2Z4IA 3S2HB 2MNAA 2JXMB 3P7JA 5EPLA 3BZCA 3VYUA 4DV3Q 4XTCS 2RCNA 3ND9A 1BXTA 1D1IA 1A2UA 3PIPA 3IFDA 2UXCQ 4IFDG 2KCCA 3R8BA 2RDFA 2A6ED 1UE5A 3NUCA 4HSVA 4KK7A 2PZUA 1K0RA 2R7ZB 4Z9CB 4A3GB 1TT2A 1SNOA 4KY6A 2O4XA 1ICFB 2RDHA 3TZUA 4K14A 2A8VA 3URYA 2F0VA 1G291 3OYYA 1O7ZA 4LJZC 2LY7A 4DK1A 4RGMA 5IY0A 1STEA 4LF9Q 1TS2A 3MXNB 3CCSA 4NXML 1PH3A 1P16A 3I4MH 1GUGA 1X3EA 1HXYD 3GDEA 1DM0B 2XSCA 3K5MA 4PG3A 3WOEA 2E2IH 4LAAA 3I4NG 2RQXA 4F7XA 3I55A 2L12A 3P1HA 4B08A 2DJGC 4BY1B 1T9HA 3S1QH 1TS3A 1PH8A 3WOFA 4DAYB 4KHPL 1C0AA 3H94A 1NJIC 1VQDA 2WAQE 2F0UA 2B2TC 5COYA 4UP8A 4A3LH 2C35B 2R6GA 2VL6A 3X3NA 1IL2A 2VQEL 4JI3L 3F1ZA 4B3MQ 2D2CC 2XGTA 4DV0L 1A2TA 5EKKA 3NELA 4NB3A 3VA5A 1RHPA 3K7UC 4JK1C 1ENFA 1FGUA 1Q12A 1P8LA 5JVG3 3KLRA 4NDXA 1TU2B 4X66Q 4DV7L 1KNAA 3CCQA 3UDGA 2JA7H 1PTOD 2LSSA 1Q1EA 2L11A 2JA8B 5CV4A 2CQOA 1XNQQ 1SFOB 5EKIA 2Z4HA 1LTBD 2M2LA 2E5LL 2LS01 1JR0D 1KRTA 3I4NB 2B2UC 1HZAA 3FRPB 1HFGA 1G91A 1TXYA 4A3EB 1KLUD 3C1FA 1RIPA 4DR5L 4A3BG 3I4LA 2F0DA 1BCPC 1EU4A 4A3MB 1I94Q 2F0IA 3RN5A 1B70B 4I7ZC 2IJ0A 3NTHA 3OWFA 1V9PA 3UE1A 3U50C 1NR2A 1WI5A 4OO1G 5C0XG 2MGSA 1SYGA 2EY1A 3DHQA 4HCSA 4K2LA 1F77A 4AYBG 4B3RQ 1G6PA 4UP9A 3K59A 1TWCH 1EY9A 2Y0SG 2EE1A 1YITA 2OWOA 1YNNC 3TREA 3K7AB 1GHJA 4F8MA 4HJ5A 1CI3M 2KA7A 1I4QA 3CC7A 5CORA 2D0OA 2XRSD 4DK6C 3K81C 4WJWA 1S5CD 1QG7A 3S1RB 3VYRA 3I4MB 5M5XB 2X6GA 1NY4A 5F2DA 1L0WA 3BVMA 1KDBA 4ZUJA 3KYHC 4X62Q 4ID6A 3FPPA 3RLNA 4X65Q 4BY1H 2BCOA 4HJ9A 3CMAA 1JT8A 4MN3A 1C8CA 4DAVA 2ZJRA 5KIXA 3N52A 1GKHA 1LUZA 3NQTA 4ILWA 3S16B 1YBYA 1X3FA 2BH2A 3SVMA 2O2LD 2KOLA 5LHY1 2KENA 2K5QA 3PO3H 4DV2Q 4BS9A 1UEAB 2NYZD 1QZHA 4J15A 4DU9A 4NXNL 2JA7B 1CKNB 5C4XG 5LMNQ 2XWBB 4JVZA 5IGFA 1HR0L 2IHFA 3D3RA 5D14A 3JAME 2E75C 3J81c 1Y8OB 3PF5A 1EU3A 1VS0A 1EOTA 4YIJA 1PTOC 1SEBD 1A8VA 2NZHA 4YCWA 3MC0B 5IGBA 1AE2A 1Q7YC 5IODA 3IRBA 2KCNA 4GOPB 5JJIA 3PQIA 4DV6Q 1ONLA 4KI0A 3ULJA 1EZ8A 4LUOA 1NMFA 4I65A 4J6HA 1AH9A 3QOLA 4QQBX 1QOHA 1DOKA 3PUWA 4RFBA 4DN4M 5FLXc 3SGIA 3VYTA 4RKLA 1PH1A 2NVXB 2MHVA 1ZXTA 1EQQA 2UU9L 3T53B 1STNA 4OIKA 4R4OA 4UDUC 3I2ZA 4G7OC 5JOBA 3TDQA 5C4JB 1H9KA 2A68C 4XYOA 1VQKA 1HNWL 3HOZG 3QJYA 1BBUA 3I4OA 1WTQA 2UUBL 1VQLA 4QUCA 2I0QA 4X6AH 2R61A 5G3LF 4GOPA 5ELOA 4DV2L 1Q46A 5IT9c 4FF2A 1XTDA 4CDEC 3Q23A 1CTMA 4X3SA 3RLOA 5IYBH 1Y1WH 4NPSA 3HOYG 1PHJA 5M5YH 5BR8L 2Q8IB 5GQOA 3M3YB 1FJGQ 1XJVA 4ZAIA 3SK5A 3L2PA 1J6QA 4UAIA 5JJLA 3LNNA 2QA4A 1O7IA 4KD4A 2MUYA 2ZM6Q 1SRUA 4ZYSA 4C56C 1PTOF 1PFSA 3GTMH 4J8QA 4IPGA 2EJFC 1FNUA 4RA8A 5JEAJ 4DK0A 4GOPC 1MSHA 3MAQA 3ERSX 4RCOA 1LTSD 1QE6A 4IJLA 3M85A 4QMGA 4DUYQ 1S5ED 5KYIA 3M4QA 4L5SA 3J7AF 2HIVA 3LGJA 2QDBA 2L15A 2KVMA 1IYJB 3KLWA 3NWSA 4H44C 1VQ5A 1PTOB 4IOCA 2NB0A 4NW2A 4R9WA 5I9PA 3W1GA 1HQRD 2ZXPA 4DGZA 2MPMA 5A35A 2PZTA 4DR4Q 4A3GG 5M5WH 4V190 1YNND 4X65L 5JAVA 1XMOL 3NEMA 1S5DD 1AZPA 2OT2A 4YY3Q 1K83H 3KF6B 3HOWG 1C7YA 1T5XD 1LYLA 1RL2A 3PMFA 2VXWA 1L0YB 5ELEA 3VR3A 1QUQA 1D8LA 4OXPA 1W6JA 3Q6SA 3HKZE 4LFBL 5C44G 2KCTA 3TP6A 3J81L 1NE3A 1A3VA 1DCZA 1FYCA 1ENAA 3T16A 4KMUC 3A5ZB 1TQOA 3FMCA 3E9IA 1VQFA 4GZYC 5EBCA 2OTLA 2K5WA 2L5TA 2XRQD 1U5KA 1U4PA 1YNJD 4QIWB 4XXEA 2E2JH 2NVQH 4DV0Q 4DR5Q 1YZ6A 3TS2A 2X6LA 4TQUS 2OQKA 1G51A 2WV6D 2Z6KC 5TSSA 3E0JA 3TN2A 1K28A 2F0QA 3PGZA 4A3JB 1BBWA 3L3OC 3CAMA 2LXJA 1F9PA 4C1NI 1G2SA 3KBXA 4DKAC 2ZTCA 5IT9E 4G7HC 3S14B 2PMZE 4DV4Q 2DNCA 1XNQL 1RKNA 3KF8B 1IZ6A 4YCUA 3ULLA 4AYBE 1QNUA 1M90C 1JJCB 3HKZG 4X66L 4HIMA 3KOJA 3EN2A 1EY5A 1WCMB 3ZJYC 4DR2L 4NMZA 5E7NA 5JPNC 1WD1A 2XN9C 4DR3Q 3TP8A 1Q3LA 2G5DA 1YJ9A 4C2MH 3BDOA 1I4XA 3Q0AA 2D9UA 2JA5G 1DZ1A 4KHPQ 1SYEA 1GUTA 2D62A 2HIXA 4UP7A 1BVSA 4A3CH 3MXPA 1D6EC 1PRTC 1TWAB 1NMGA 2R92H 2L1BA 3I72A 1HCZA 4JI1Q 1ZYRD 4JBJA 3EROA 1CUKA 1SSOA 1LTGD 3PIO3 4HJ8A 4DR3L 2K5HA 2E76C 2K05A 4NXMQ 2F0PA 2K4KA 1JOKA 1MHWC 2EQSA 4M1UB 1KNEA 1PVOA 2B63H 1EFID 4YWKA 3H09A 1QZGA 2K32A 3WDNA 1B8AA 4L8JA 2F0GA 4A76A 1SE3A 4JI1L 1TWGB 1B4OA 1JC7A 4N8X1 3NSWA 2BA0A 3OWEB 3E0EA 2HCIA 2K04A 3DM1A 1A6XA 3H0GG 3W3AA 5BN4A 5BN5A 3R2IA 1MJEA 3PSIA 5KRUA 2F03A 1RTNA 3T1HL 1JJGA 3N6RA 3EFXD 1CZWA 4IUVA 1N32L 2ZXOA 1UEBA 3JC66 5I2YA 4QUFA 1QVFA 5C5MA 3G71A 4DV1L 2AWOA 3K0YA 2XNAC 3HOZH 2J0TD 2SOBA 4OWTB 2UUCQ 2F3IA 2JA5B 1GOZA 2NWGA 1V1OA 1YHAA 5GAGC 5CV5A 2KEDA 1TIID 1R4PB 2KEEA 4V0BA 4B9XA 1VQMA 5EQ0A 1A3UA 1O78A 4P75A 1I3QB 3C46A 2B2VA 1BBXC 5C0XI 5ISRA 1KD1C 2R7ZG 1KHIA 2WIIB 2I5MX 4IN3A 3HOUG 1U4MA 4BXXH 1ICWA 3CC2A 2NTSA 3CU7A 3TRZA 2MO0A 3PUXA 2JEAI 1TS4A 1Q81C 3GO5A 4H7BA 4PMBA 4A3DB 1YNJC 1FNWA 1WOCA 5M3FH 4A93H 3FKIG 5FKAC 1CKMA 4OONA 2P5ZX 4TSSA 1WTWA 2Y0SB 2VQFQ 2I46A 3T4AC 5M9OA 3VA7A 4JI0Q 1NBWA 1NNXA 1OXTA 2AQ1B 2Z1CA 4FXGC 4Q0FA 2VUMG 1BNZA 1TWHB 3EVQA 5FLMG 1EY7A 2Q2IA 2NVYB 4QL5A 1LACA 1K8GA 4A3EG 2EYJA 1BF4A 3MEHA 3KBGA 1SXTA 3A74A 3DEPA 5IYDG 4HSPA 2FINB 3RNUA 2JP1A 4B3SQ 4JV5L 2N55A 1BUVT 4A3LG 5IOCA 3KDFA 1DOLA 1FJGL 1K3BC 3MTSA 5I6WA 2R7FA 1SLJA 3HOYB 1SBBB 1EY0A 1GXDC 3ULPA 2UUAQ 1O80A 4C3JG 4BBSB 4LF4L 3A8KE 3PO2B 2WP8J 2BDNA 1WTHA 2XTIA 3LWUA 2MP1A 4CKCA 2JK8A 2NUCA 4R4QA 1EEFD 1RF2D 3CCUA 5C3WA 3C3LA 2UXBQ 1A63A 4YWLA 2IX0A 3OIPA 1N33L 1CT1D 1S5BD 2Z6KA 1X55A 1Q1BA 1HQMC 2FXQA 5JEAH 2E2JB 1D7QA 1IYVA 5DM63 3C2PA 5E3FA 2A1AA 4ZRZA 1STHA 1IHZA 4PZ6A 3S16H 4RHSA 4FF1A 5JPMC 1SJED 2B8GA 2JJQA 3E3XA 1E3PA 5FK9C 4F87A 1PXUA 3EJIA 4ODGA 4X3KA 1L0XB 5K36H 2YTYA 5C4XB 2NN6H 2L9HA 5HY6A 1TWCB 4A3BH 4A3FH 1B44D 3GTKH 4BY7H 2KJXA 1TS5A 1ENCA 5JJZA 3KUPA 4HN7A 3OTOL 2A69D 1EWCA 3A56A 2E2HH 1JCKB 2CW0D 3RZDB 2PNHA 1QVCA 5DLQE 4ZUIA 2PZWA 3R3OA 4BY1G 1JWMD 3U4ZA 5M3MB 2I5LX 5FO7B 4R8IA 1QCBD 1LM0A 2YYZA 4LFAL 1Y1VH 3OTOQ 3UI2A 3S1MB 3NXWA 1F9RA 1KTKA 2HQLA 2RF4A 4NXNQ 3GTGB 4A3IH 2JA7G 2ID0A 3S1NH 3TBIB 2WB1G 1BKBA 2WAQG 3J7AV 2R92G 1EIGA 4YCVA 4BBSG 4N8FA 4DAPA 1SNMA 1TKWB 1QILA 2C5CA 4GNXB 2VY3A 5J3BA 2EYMA 5GROA 4EQ5A 1SNCA 4KKSA 2GVBA 1J9OA 3CCVA 1AP0A 4IOAA 1IBML 2F0TA 3BJUA 1WTOA 4DR6L 1PRTD 4A3MH 4A3JG 3HOUB 3AU7A 4Q5VA 2XIWA 2GA4B 3F2UA 1H95A 2AUJD 4DUZL 1N33Q 3KLSX 3S24A 4L6TB 3SK4A 3HOWB 3KF6A 1EL0A 2WB1B 2VW9A 3M3YH 1HA5A 1HR0Q 2KQ3A 2KBNA 2R3ZA 1R4QB 1E2VA 3MHBA 1VQPA 4HIKA 4L5QA 3IKJA 2HUGA 4R4CA 4IPDA 1Z47A 1EY6A 3T13A 2EJGC 4JW0A 2H4OA 2UUAL 1IKLA 1MKHA 4FO2A 1K8MA 1OXSC 1B7YB 1U9RA 2H1EA 1C4QA 3K80C 1XMQQ 1AW7A 3ZYYX 4Y7NB 4HIOA 4B3SL 1TWAH 2K52A 1OO9B
chains in the Genus database with same CATH topology
2RHSB 1PV4A 2IY5B 2ZM6Q 1SRUA 2DUDA 4GKKL 1KXLA 1TWHH 1PFSA 4TVAB 3GTMH 1HJPA 4B3TQ 4LF7L 4IPGA 4P71A 5JEAJ 3Q8DA 2JE6I 5LMNL 4GOPC 4GLXA 2E5LQ 2MFIA 4OWXB 1YEZA 3ERSX 1YJWA 4HJ7A 4IJLA 1YVCA 4QY7A 3M85A 1TWFH 4DUYQ 1Q8KA 4GLAC 3M4QA 4L5SA 2HIVA 3LGJA 2ALYB 3KJOA 3GTJH 1S72A 2L15A 4AQYL 2IX1A 1IYJB 4OWWB 4PZ8A 1SMXA 3KLWA 3F2CA 4OX9Q 1Y1WG 1EQRA 2CWPA 1VQ5A 2JA8G 4JG2A 4IOCA 4R4IA 1N34Q 4PMWA 3CF5A 4DV7Q 3W1GA 1HZCA 4LF9L 2EXDA 3S2HH 3U58A 4LF6L 2VS1A 2VUMH 3HFZB 4DR4Q 4A3GG 5M5WH 1SROA 1N32Q 4X65L 2K50A 4DK3C 1XMOL 2R93G 3T1HQ 3NEMA 4POGA 2F4VQ 3D31A 2VQEQ 2HT1A 1VQGA 1VQEA 4YY3Q 1K83H 3KF6B 3HOWG 1HNXL 4IJHA 1C7YA 5LMUL 2UXBL 1LYLA 1RL2A 3KJPA 4P74A 5IP9G 4YHHL 1I6HH 5IP7G 4JBKA 1QUQA 5M3MG 5GAEC 2N49A 1D8LA 4XIGS 3I56A 2YTVA 1WFQA 4JOIA 4OXPA 3HOXG 2VQFL 3M7NA 3HKZE 3K8AA 5C44G 4A3MG 2KCTA 4DV5Q 4LFBL 1NE3A 4LF4Q 2JA6G 1IXRA 3MEFA 4BY7G 3I7FA 1PH4A 2VZAA 4WJ4A 5IYDH 1VQIA 4A4IA 3JAMi 1WYDA 3A5ZB 2ZJQA 4C3HH 4JOIC 4RMFA 1VQJA 4JI5L 3PF4A 3E9IA 1VQFA 4UPAA 3CCRA 4HJAA 3AEVA 2B63G 4C3IH 3CPFA 3PCOB 4DR7Q 4JI7L 2OTLA 3UDFA 1X9NA 1GD7A 1U5KA 2E2JH 2Q2UA 1EIYB 4LNQA 1E24A 2NVQH 4GKJL 3G48A 4WJ3M 1UE1A 1K73C 4DV0Q 3GTPH 1A62A 3AQQA 4DR5Q 1XPRA 4B3ML 1YZ6A 3S17H 3TS2A 1ASYA 4TQUS 4JI3Q 1J5EQ 2OQKA 4EX5A 1G51A 2Z6KC 3W5OA 3FP9A 3HOWH 2UXDL 3EBEA 2VNUD 1HR0W 3PGZA 4LFCL 1BBWA 5M3FG 5C3EH 4JI0L 4JI6Q 4ME3A 4APVA 4LF5Q 2R93H 3CAMA 2LXJA 3PV0A 4GN4B 4JYAQ 1EYGA 4JI4Q 4Y52H 1KC8C 5C3EG 4H02A 1PYSB 1SE8A 1OXXK 3UDXA 1HNZL 1E7ZA 2IT1A 4IFDJ 1S40A 4DKAC 1I50H 3S14H 2ZTCA 3TEHB 3J7A5 2UUCL 2PMZE 4QIWE 4DV4Q 3PUVA 3NBHB 1XNQL 3KF8B 1IZ6A 5EAYA 4YCUA 3ULLA 4AYBE 4DR1Q 3CPWA 4HIDA 4A3DG 2UXCL 1M90C 2NN6I 1JJCB 4R4TA 4LF8L 4KLKA 3KFUA 1VQ8A 2AHOB 5IWAQ 3HKZG 1XNRQ 2V1CC 3JAMc 4JCVE 4RG1A 3FHWA 1WCMH 4X66L 1C9OA 4DNIA 4HIMA 4A3JH 1X65A 3EN2A 3KOJA 1X54A 3ZJYC 4BA2I 4DR2L 3AYHB 1WJJA 2NVTH 1PYBA 1WCMG 5E7NA 2LXKA 4LWCA 5IWAL 4A3FG 4K0KL 4O2DA 2GN5A 4DR3Q 2N3SA 3TS0A 3J80c 1E22A 2OCEA 1YJ9A 4IO9A 3L0OA 3M4PA 4C2MH 4GNXA 1YHQA 1KIXA 2RHQB 1PH7A 4JC0A 1Q86C 2K75A 3M4OH 2JA5G 4JBWA 3CCMA 1HNZQ 1X6OA 3HOXH 2ES2A 4KHPQ 1XPUA 4JI8L 3DM3A 3L7ZC 3BU2A 2HIXA 2D62A 4UP7A 5M3MH 4JYAL 4GNXC 4GN5A 1BVSA 4A3CH 3I4MG 4YWMA 3OW2A 1NMGA 5AJ3L 2R92H 1GVPA 1YNXA 1VQHA 1YI2A 4JI1Q 3PO2H 2UXDQ 3CW2C 4JBJA 4ALPA 1HH2P 1QVGA 3FKIH 1CUKA 4PZ7A 5ELNA 1VQ4A 5GADC 1M1KC 1JJ2A 4AH6A 1FL0A 4HJ8A 4A3CG 4R1JA 4DV1Q 1CSPA 3H3VI 2Y0SE 4DR3L 2K5HA 4IPHA 1VQOA 4NXMQ 3GTOH 2K4KA 3S2DH 4DV3L 5IYCH 2MNAA 2EQSA 1W2BA 3BZCA 4DV3Q 4XTCS 3H0GH 1PVOA 2YV5A 2B63H 2RCNA 3T1YL 4AIMA 3S1RH 4YWKA 4JI5Q 1QZGA 3PIPA 3ICEA 2UXCQ 2NN6G 4DR1L 4IFDG 2ASBA 1B8AA 1N8RC 1PH2A 1K9MC 3S1MH 1UE5A 3J80i 4DV4L 4A76A 4DAMA 4JI1L 3K7AH 4DV5L 1K0RA 2Z0SA 1E1OA 4JI4L 2BA0A 1N36L 1CSQA 5C4XH 1N36Q 1NTGA 3E0EA 3VDYA 1AE3A 1JB7A 1YJNA 3H0GG 5C0XJ 2A8VA 2B3GA 1G291 3OYYA 5IYCG 1HZBA 4YY3L 3I4NH 1KRSA 3PSIA 1MJEA 1X3GA 4Y7NH 3B6YA 1JJGA 3T1HL 4A3IG 1XMOQ 4K0KQ 5IP7H 1N32L 3T1YQ 5LMNW 4DR4L 1UEBA 3CC4A 3JC66 4LF6Q 3CCLA 5IY0A 1OTCA 4LF9Q 4DR7L 3MXNB 3CCSA 1QVFA 4NXML 2BH8A 4P73A 1PH3A 1P16A 5FJ8H 3I4MH 3E9HA 2JA8H 1X3EA 1PH5A 3UE0A 3GDEA 3G71A 4DV1L 2AWOA 4A75A 1L1OB 2CWAA 4PG3A 3HOZH 2E2IH 1UWVA 3F8TA 3I4NG 4MZ9A 3HKSA 4OWTB 3I55A 2UUCQ 2CKZB 2JA5H 1EUJA 3PO2G 2F3IA 3GTGH 4FDBA 2D0PA 5AJ3Q 1YHAA 5GAGC 3GD7A 1LTLA 1T9HA 3S1QH 1U0LA 1PH8A 1KQSA 4LF5L 4BXXG 4JI8Q 4DAYB 1VQMA 4JI6L 4KHPL 1C0AA 4P75A 1NJIC 5K36G 2KHIA 1VQDA 5C0XI 4UY8C 2WAQE 5LMUQ 1GO3E 2NVYH 3RLFA 2JA6H 4UP8A 1KD1C 4A3LH 2R7ZG 3EIVA 2C35B 2R6GA 1KHIA 2N8NA 2VL6A 3H15A 3PUYA 1EOVA 1VQCA 2I5MX 4JI3L 2ZM6L 2VQEL 3F1ZA 1J5EL 4B3MQ 3HOUG 3RZDH 4BXXH 2XGTA 4DV0L 3CC2A 3W1BA 3NELA 4NB3A 3A0JA 4GKJQ 3K7UC 3TRZA 2MO0A 3AFQA 1FGUA 3PUXA 1Q12A 2YU9H 2JEAI 4DR2Q 3STBC 1P8LA 1S3OA 1Q81C 4X66Q 4DV7L 3CCQA 1XNRL 3UDGA 2JA7H 3GO5A 4LW1A 4IFDI 3HOYH 3CP0A 1PH6A 2LSSA 1Q1EA 4GLVB 1VQAA 4LF8Q 2A19A 2F52A 4A3EH 2OQ0A 2YTXA 4A3DH 2IHEA 1WOCA 5M3FH 2CQOA 4AQYQ 2NVXH 3FKIG 4A93H 1CKMA 4OONA 1XNQQ 1A0IA 4DUYL 3CMEA 2MO1A 3PUZA 4A93G 1DGSA 2VQFQ 3CCJA 4POFA 4QJFA 2MQHA 2E5LL 5IYBG 1ASZA 1KRTA 4YHHQ 4L5TA 4JI0Q 3CD6A 1NBWA 1OXTA 4LFCQ 2VUMG 1HNWQ 1YHBA 1HZAA 1VQ7A 3NENA 3CXCA 1HNXQ 4MTNA 1V43A 5FLMG 2Q2IA 4QL5A 1TXYA 3ER0A 1PH9A 1K8GA 4A3EG 4KHZA 1RIPA 2UU9Q 4DR5L 4A3BG 2JA9A 3A74A 1I94Q 2WFWA 5IYDG 3DLLA 3RN5A 1B70B 2KHJA 2ZTDA 2ATWA 3RNUA 3U4VA 4B3SQ 1V9PA 3UE1A 4DR6Q 4JV5L 3U50C 4A3LG 5HGQA 1E1TA 1WI5A 2B29A 2WB1E 3KDFA 5C0XG 1IBMQ 4JI7Q 1EFWA 1FJGL 4OO1G 1FVIA 4B3RQ 4AYBG 1JMCA 2R7FA 5BR8Q 1G6PA 4UP9A 1Q82C 4LUVA 1TWCH 1N34L 2Y0SG 1OXUA 1SLJA 2NZOA 5H1SE 1YITA 2OWOA 1L1OA 1W3SA 3A5UA 3G4SA 3ULPA 2UUAQ 4BBSH 2R7ZH 3M9BA 1EIFA 2AMCB 3TREA 3GTQH 4LF4L 4HJ5A 1Y14B 3PO3G 4MNOA 1X56A 1I5FA 1IL2A 5JEAG 4LFBQ 3F2BA 3CC7A 2PQAB 2D0OA 2WP8J 4DK6C 3K81C 4A3KH 5C4JH 2JEBI 2XTIA 3PIOA 2JK8A 5IP9H 4R4QA 1A63A 3CCUA 4JBMA 2UXBQ 1VQ9A 4B3TL 1NY4A 4YWLA 2IX0A 1L0WA 3TQYA 1N33L 4P72A 4GKKQ 3G6EA 1QUQB 4IPCA 3KYHC 2F4VL 4X62Q 3RLNA 4X65Q 4BY1H 1HZ9A 2GVAA 2CFMA 2Z6KA 4HJ9A 1X55A 3CMAA 1Q1BA 4A3GH 1JT8A 4GS3A 2FXQA 2HHHL 4JI2L 1VQNA 1Y1VG 1D7QA 4BBRG 1KL9A 2ZJRA 3J81j 1SN8A 2A1AA 4PZ6A 3CCEA 3S16H 1GKHA 1LUZA 2K5VA 1YBYA 2ZTEA 2JJQA 1X3FA 4A3KG 2Q2TA 4OX9L 2BH2A 3J81i 1E3PA 4BA1I 2PI2A 1IBKQ 3H3VH 2KENA 3S15H 3PO3H 4DV2Q 4DV6L 2YTYA 1N9WA 1QZHA 4J15A 2DGYA 5HY6A 4NXNL 1CKNB 5C4XG 2BA1A 5LMNQ 4A3BH 4A3FH 2AWNA 1HR0L 1K3RA 3GTKH 2IHFA 4BY7H 1PA6A 4LF7Q 5FLMH 4LUZA 3OTOL 4DUZQ 2JQOA 3J81c 3STBD 2E2HH 3GTLH 3PF5A 2PNHA 1QVCA 5DLQE 4BY1G 1VS0A 1MJCA 3U4ZA 4X62L 2I5LX 1XPOA 3WWVA 1LM0A 1MIUA 1A8VA 2NZHA 2YYZA 4LFAL 1Y1VH 3OTOQ 1YIJA 2OTJA 1XMQL 4YCWA 1UE6A 2ZJPA 2AKWB 2K5NA 1IBLQ 2HQLA 2RF4A 1VCIA 4NXNQ 2H5XA 1KAWA 1AE2A 4A3IH 4L5RC 1V1QA 1Q7YC 2JA7G 2ID0A 3IRBA 4GOPB 3D0FA 3HOUH 3S1NH 1SFOH 5JJIA 2WB1G 3F2DA 4DV6Q 1BKBA 4KI0A 1UE7A 2WAQG 3ULJA 4LUOA 4O0AA 1NMFA 2PQAA 1IBKL 2R92G 4YCVA 4BBSG 2I5HA 3J7ZC 2EIFA 1AH9A 4QQBX 4QGUA 2UUBQ 4GNXB 1IBLL 3PUWA 2VY3A 5J3BA 1VQ6A 2N78A 5GROA 4EQ5A 2GVBA 5FLXc 3SGIA 3CCVA 4IOAA 1K8AC 1IBML 3BJUA 4JI2Q 2CCZA 3HOVG 1PH1A 4DR6L 1VQBA 1L2FA 5C44H 4A3MH 4JV5Q 2R7DA 4A3JG 4X64L 1I94L 2E8GA 2K14A 1EWIA 1EQQA 2UU9L 4X64Q 4R4OA 3CQZH 3I2ZA 3RZOH 1H95A 4DUZL 1N33Q 3HOVH 3S24A 1SR3A 4BBRH 3KF6A 1VQKA 1HNWL 2VW9A 2KCMA 3M3YH 3HOZG 1BBUA 1HR0Q 2QEXA 3I4OA 3AFPA 2KBNA 1L1OC 2UUBL 1VQLA 2Q2HA 2I0QA 1OXVA 4X6AH 1VQPA 4GOPA 1TWGH 5FJ8G 1GM5A 4HIKA 5ELOA 5JJKA 4L5QA 1JE5A 1Q46A 4R4CA 4IPDA 1Z47A 5IT9c 1XTDA 4DV2L 1R9TH 3KDFB 1I3QH 3RR5A 4GN3B 5IE8A 2UUAL 4OO1I 1CKNA 3RLOA 5IYBH 1MKHA 1Y1WH 4NPSA 5GAHC 1OXSC 1B7YB 2PI2E 3BZKA 4DPGA 1PHJA 3HOYG 5M5YH 5BR8L 5M5XH 3K80C 3K0XA 5GQOA 1CKOA 4B3RL 2QGQA 1XMQQ 1FJGQ 1XJVA 4LFAQ 4HIOA 3L2PA 4C3JH 2HHHQ 4B3SL 3RN2A 1J6QA 1TWAH 2K52A 5JJLA 1Z9FA 2QA4A 1O7IA 3UDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHS B;  1PV4 A;  2IY5 B;  2ZM6 Q;  1SRU A;  2DUD A;  4GKK L;  1KXL A;  1TWH H;  1PFS A;  4TVA B;  3GTM H;  1HJP A;  4B3T Q;  4LF7 L;  4IPG A;  4P71 A;  5JEA J;  3Q8D A;  2JE6 I;  5LMN L;  4GOP C;  4GLX A;  2E5L Q;  2MFI A;  4OWX B;  1YEZ A;  3ERS X;  1YJW A;  4HJ7 A;  4IJL A;  1YVC A;  4QY7 A;  3M85 A;  1TWF H;  4DUY Q;  1Q8K A;  4GLA C;  3M4Q A;  4L5S A;  2HIV A;  3LGJ A;  2ALY B;  3KJO A;  3GTJ H;  1S72 A;  2L15 A;  4AQY L;  2IX1 A;  1IYJ B;  4OWW B;  4PZ8 A;  1SMX A;  3KLW A;  3F2C A;  4OX9 Q;  1Y1W G;  1EQR A;  2CWP A;  1VQ5 A;  2JA8 G;  4JG2 A;  4IOC A;  4R4I A;  1N34 Q;  4PMW A;  3CF5 A;  4DV7 Q;  3W1G A;  1HZC A;  4LF9 L;  2EXD A;  3S2H H;  3U58 A;  4LF6 L;  2VS1 A;  2VUM H;  3HFZ B;  4DR4 Q;  4A3G G;  5M5W H;  1SRO A;  1N32 Q;  4X65 L;  2K50 A;  4DK3 C;  1XMO L;  2R93 G;  3T1H Q;  3NEM A;  4POG A;  2F4V Q;  3D31 A;  2VQE Q;  2HT1 A;  1VQG A;  1VQE A;  4YY3 Q;  1K83 H;  3KF6 B;  3HOW G;  1HNX L;  4IJH A;  1C7Y A;  5LMU L;  2UXB L;  1LYL A;  1RL2 A;  3KJP A;  4P74 A;  5IP9 G;  4YHH L;  1I6H H;  5IP7 G;  4JBK A;  1QUQ A;  5M3M G;  5GAE C;  2N49 A;  1D8L A;  4XIG S;  3I56 A;  2YTV A;  1WFQ A;  4JOI A;  4OXP A;  3HOX G;  2VQF L;  3M7N A;  3HKZ E;  3K8A A;  5C44 G;  4A3M G;  2KCT A;  4DV5 Q;  4LFB L;  1NE3 A;  4LF4 Q;  2JA6 G;  1IXR A;  3MEF A;  4BY7 G;  3I7F A;  1PH4 A;  2VZA A;  4WJ4 A;  5IYD H;  1VQI A;  4A4I A;  3JAM i;  1WYD A;  3A5Z B;  2ZJQ A;  4C3H H;  4JOI C;  4RMF A;  1VQJ A;  4JI5 L;  3PF4 A;  3E9I A;  1VQF A;  4UPA A;  3CCR A;  4HJA A;  3AEV A;  2B63 G;  4C3I H;  3CPF A;  3PCO B;  4DR7 Q;  4JI7 L;  2OTL A;  3UDF A;  1X9N A;  1GD7 A;  1U5K A;  2E2J H;  2Q2U A;  1EIY B;  4LNQ A;  1E24 A;  2NVQ H;  4GKJ L;  3G48 A;  4WJ3 M;  1UE1 A;  1K73 C;  4DV0 Q;  3GTP H;  1A62 A;  3AQQ A;  4DR5 Q;  1XPR A;  4B3M L;  1YZ6 A;  3S17 H;  3TS2 A;  1ASY A;  4TQU S;  4JI3 Q;  1J5E Q;  2OQK A;  4EX5 A;  1G51 A;  2Z6K C;  3W5O A;  3FP9 A;  3HOW H;  2UXD L;  3EBE A;  2VNU D;  1HR0 W;  3PGZ A;  4LFC L;  1BBW A;  5M3F G;  5C3E H;  4JI0 L;  4JI6 Q;  4ME3 A;  4APV A;  4LF5 Q;  2R93 H;  3CAM A;  2LXJ A;  3PV0 A;  4GN4 B;  4JYA Q;  1EYG A;  4JI4 Q;  4Y52 H;  1KC8 C;  5C3E G;  4H02 A;  1PYS B;  1SE8 A;  1OXX K;  3UDX A;  1HNZ L;  1E7Z A;  2IT1 A;  4IFD J;  1S40 A;  4DKA C;  1I50 H;  3S14 H;  2ZTC A;  3TEH B;  3J7A 5;  2UUC L;  2PMZ E;  4QIW E;  4DV4 Q;  3PUV A;  3NBH B;  1XNQ L;  3KF8 B;  1IZ6 A;  5EAY A;  4YCU A;  3ULL A;  4AYB E;  4DR1 Q;  3CPW A;  4HID A;  4A3D G;  2UXC L;  1M90 C;  2NN6 I;  1JJC B;  4R4T A;  4LF8 L;  4KLK A;  3KFU A;  1VQ8 A;  2AHO B;  5IWA Q;  3HKZ G;  1XNR Q;  2V1C C;  3JAM c;  4JCV E;  4RG1 A;  3FHW A;  1WCM H;  4X66 L;  1C9O A;  4DNI A;  4HIM A;  4A3J H;  1X65 A;  3EN2 A;  3KOJ A;  1X54 A;  3ZJY C;  4BA2 I;  4DR2 L;  3AYH B;  1WJJ A;  2NVT H;  1PYB A;  1WCM G;  5E7N A;  2LXK A;  4LWC A;  5IWA L;  4A3F G;  4K0K L;  4O2D A;  2GN5 A;  4DR3 Q;  2N3S A;  3TS0 A;  3J80 c;  1E22 A;  2OCE A;  1YJ9 A;  4IO9 A;  3L0O A;  3M4P A;  4C2M H;  4GNX A;  1YHQ A;  1KIX A;  2RHQ B;  1PH7 A;  4JC0 A;  1Q86 C;  2K75 A;  3M4O H;  2JA5 G;  4JBW A;  3CCM A;  1HNZ Q;  1X6O A;  3HOX H;  2ES2 A;  4KHP Q;  1XPU A;  4JI8 L;  3DM3 A;  3L7Z C;  3BU2 A;  2HIX A;  2D62 A;  4UP7 A;  5M3M H;  4JYA L;  4GNX C;  4GN5 A;  1BVS A;  4A3C H;  3I4M G;  4YWM A;  3OW2 A;  1NMG A;  5AJ3 L;  2R92 H;  1GVP A;  1YNX A;  1VQH A;  1YI2 A;  4JI1 Q;  3PO2 H;  2UXD Q;  3CW2 C;  4JBJ A;  4ALP A;  1HH2 P;  1QVG A;  3FKI H;  1CUK A;  4PZ7 A;  5ELN A;  1VQ4 A;  5GAD C;  1M1K C;  1JJ2 A;  4AH6 A;  1FL0 A;  4HJ8 A;  4A3C G;  4R1J A;  4DV1 Q;  1CSP A;  3H3V I;  2Y0S E;  4DR3 L;  2K5H A;  4IPH A;  1VQO A;  4NXM Q;  3GTO H;  2K4K A;  3S2D H;  4DV3 L;  5IYC H;  2MNA A;  2EQS A;  1W2B A;  3BZC A;  4DV3 Q;  4XTC S;  3H0G H;  1PVO A;  2YV5 A;  2B63 H;  2RCN A;  3T1Y L;  4AIM A;  3S1R H;  4YWK A;  4JI5 Q;  1QZG A;  3PIP A;  3ICE A;  2UXC Q;  2NN6 G;  4DR1 L;  4IFD G;  2ASB A;  1B8A A;  1N8R C;  1PH2 A;  1K9M C;  3S1M H;  1UE5 A;  3J80 i;  4DV4 L;  4A76 A;  4DAM A;  4JI1 L;  3K7A H;  4DV5 L;  1K0R A;  2Z0S A;  1E1O A;  4JI4 L;  2BA0 A;  1N36 L;  1CSQ A;  5C4X H;  1N36 Q;  1NTG A;  3E0E A;  3VDY A;  1AE3 A;  1JB7 A;  1YJN A;  3H0G G;  5C0X J;  2A8V A;  2B3G A;  1G29 1;  3OYY A;  5IYC G;  1HZB A;  4YY3 L;  3I4N H;  1KRS A;  3PSI A;  1MJE A;  1X3G A;  4Y7N H;  3B6Y A;  1JJG A;  3T1H L;  4A3I G;  1XMO Q;  4K0K Q;  5IP7 H;  1N32 L;  3T1Y Q;  5LMN W;  4DR4 L;  1UEB A;  3CC4 A;  3JC6 6;  4LF6 Q;  3CCL A;  5IY0 A;  1OTC A;  4LF9 Q;  4DR7 L;  3MXN B;  3CCS A;  1QVF A;  4NXM L;  2BH8 A;  4P73 A;  1PH3 A;  1P16 A;  5FJ8 H;  3I4M H;  3E9H A;  2JA8 H;  1X3E A;  1PH5 A;  3UE0 A;  3GDE A;  3G71 A;  4DV1 L;  2AWO A;  4A75 A;  1L1O B;  2CWA A;  4PG3 A;  3HOZ H;  2E2I H;  1UWV A;  3F8T A;  3I4N G;  4MZ9 A;  3HKS A;  4OWT B;  3I55 A;  2UUC Q;  2CKZ B;  2JA5 H;  1EUJ A;  3PO2 G;  2F3I A;  3GTG H;  4FDB A;  2D0P A;  5AJ3 Q;  1YHA A;  5GAG C;  3GD7 A;  1LTL A;  1T9H A;  3S1Q H;  1U0L A;  1PH8 A;  1KQS A;  4LF5 L;  4BXX G;  4JI8 Q;  4DAY B;  1VQM A;  4JI6 L;  4KHP L;  1C0A A;  4P75 A;  1NJI C;  5K36 G;  2KHI A;  1VQD A;  5C0X I;  4UY8 C;  2WAQ E;  5LMU Q;  1GO3 E;  2NVY H;  3RLF A;  2JA6 H;  4UP8 A;  1KD1 C;  4A3L H;  2R7Z G;  3EIV A;  2C35 B;  2R6G A;  1KHI A;  2N8N A;  2VL6 A;  3H15 A;  3PUY A;  1EOV A;  1VQC A;  2I5M X;  4JI3 L;  2ZM6 L;  2VQE L;  3F1Z A;  1J5E L;  4B3M Q;  3HOU G;  3RZD H;  4BXX H;  2XGT A;  4DV0 L;  3CC2 A;  3W1B A;  3NEL A;  4NB3 A;  3A0J A;  4GKJ Q;  3K7U C;  3TRZ A;  2MO0 A;  3AFQ A;  1FGU A;  3PUX A;  1Q12 A;  2YU9 H;  2JEA I;  4DR2 Q;  3STB C;  1P8L A;  1S3O A;  1Q81 C;  4X66 Q;  4DV7 L;  3CCQ A;  1XNR L;  3UDG A;  2JA7 H;  3GO5 A;  4LW1 A;  4IFD I;  3HOY H;  3CP0 A;  1PH6 A;  2LSS A;  1Q1E A;  4GLV B;  1VQA A;  4LF8 Q;  2A19 A;  2F52 A;  4A3E H;  2OQ0 A;  2YTX A;  4A3D H;  2IHE A;  1WOC A;  5M3F H;  2CQO A;  4AQY Q;  2NVX H;  3FKI G;  4A93 H;  1CKM A;  4OON A;  1XNQ Q;  1A0I A;  4DUY L;  3CME A;  2MO1 A;  3PUZ A;  4A93 G;  1DGS A;  2VQF Q;  3CCJ A;  4POF A;  4QJF A;  2MQH A;  2E5L L;  5IYB G;  1ASZ A;  1KRT A;  4YHH Q;  4L5T A;  4JI0 Q;  3CD6 A;  1NBW A;  1OXT A;  4LFC Q;  2VUM G;  1HNW Q;  1YHB A;  1HZA A;  1VQ7 A;  3NEN A;  3CXC A;  1HNX Q;  4MTN A;  1V43 A;  5FLM G;  2Q2I A;  4QL5 A;  1TXY A;  3ER0 A;  1PH9 A;  1K8G A;  4A3E G;  4KHZ A;  1RIP A;  2UU9 Q;  4DR5 L;  4A3B G;  2JA9 A;  3A74 A;  1I94 Q;  2WFW A;  5IYD G;  3DLL A;  3RN5 A;  1B70 B;  2KHJ A;  2ZTD A;  2ATW A;  3RNU A;  3U4V A;  4B3S Q;  1V9P A;  3UE1 A;  4DR6 Q;  4JV5 L;  3U50 C;  4A3L G;  5HGQ A;  1E1T A;  1WI5 A;  2B29 A;  2WB1 E;  3KDF A;  5C0X G;  1IBM Q;  4JI7 Q;  1EFW A;  1FJG L;  4OO1 G;  1FVI A;  4B3R Q;  4AYB G;  1JMC A;  2R7F A;  5BR8 Q;  1G6P A;  4UP9 A;  1Q82 C;  4LUV A;  1TWC H;  1N34 L;  2Y0S G;  1OXU A;  1SLJ A;  2NZO A;  5H1S E;  1YIT A;  2OWO A;  1L1O A;  1W3S A;  3A5U A;  3G4S A;  3ULP A;  2UUA Q;  4BBS H;  2R7Z H;  3M9B A;  1EIF A;  2AMC B;  3TRE A;  3GTQ H;  4LF4 L;  4HJ5 A;  1Y14 B;  3PO3 G;  4MNO A;  1X56 A;  1I5F A;  1IL2 A;  5JEA G;  4LFB Q;  3F2B A;  3CC7 A;  2PQA B;  2D0O A;  2WP8 J;  4DK6 C;  3K81 C;  4A3K H;  5C4J H;  2JEB I;  2XTI A;  3PIO A;  2JK8 A;  5IP9 H;  4R4Q A;  1A63 A;  3CCU A;  4JBM A;  2UXB Q;  1VQ9 A;  4B3T L;  1NY4 A;  4YWL A;  2IX0 A;  1L0W A;  3TQY A;  1N33 L;  4P72 A;  4GKK Q;  3G6E A;  1QUQ B;  4IPC A;  3KYH C;  2F4V L;  4X62 Q;  3RLN A;  4X65 Q;  4BY1 H;  1HZ9 A;  2GVA A;  2CFM A;  2Z6K A;  4HJ9 A;  1X55 A;  3CMA A;  1Q1B A;  4A3G H;  1JT8 A;  4GS3 A;  2FXQ A;  2HHH L;  4JI2 L;  1VQN A;  1Y1V G;  1D7Q A;  4BBR G;  1KL9 A;  2ZJR A;  3J81 j;  1SN8 A;  2A1A A;  4PZ6 A;  3CCE A;  3S16 H;  1GKH A;  1LUZ A;  2K5V A;  1YBY A;  2ZTE A;  2JJQ A;  1X3F A;  4A3K G;  2Q2T A;  4OX9 L;  2BH2 A;  3J81 i;  1E3P A;  4BA1 I;  2PI2 A;  1IBK Q;  3H3V H;  2KEN A;  3S15 H;  3PO3 H;  4DV2 Q;  4DV6 L;  2YTY A;  1N9W A;  1QZH A;  4J15 A;  2DGY A;  5HY6 A;  4NXN L;  1CKN B;  5C4X G;  2BA1 A;  5LMN Q;  4A3B H;  4A3F H;  2AWN A;  1HR0 L;  1K3R A;  3GTK H;  2IHF A;  4BY7 H;  1PA6 A;  4LF7 Q;  5FLM H;  4LUZ A;  3OTO L;  4DUZ Q;  2JQO A;  3J81 c;  3STB D;  2E2H H;  3GTL H;  3PF5 A;  2PNH A;  1QVC A;  5DLQ E;  4BY1 G;  1VS0 A;  1MJC A;  3U4Z A;  4X62 L;  2I5L X;  1XPO A;  3WWV A;  1LM0 A;  1MIU A;  1A8V A;  2NZH A;  2YYZ A;  4LFA L;  1Y1V H;  3OTO Q;  1YIJ A;  2OTJ A;  1XMQ L;  4YCW A;  1UE6 A;  2ZJP A;  2AKW B;  2K5N A;  1IBL Q;  2HQL A;  2RF4 A;  1VCI A;  4NXN Q;  2H5X A;  1KAW A;  1AE2 A;  4A3I H;  4L5R C;  1V1Q A;  1Q7Y C;  2JA7 G;  2ID0 A;  3IRB A;  4GOP B;  3D0F A;  3HOU H;  3S1N H;  1SFO H;  5JJI A;  2WB1 G;  3F2D A;  4DV6 Q;  1BKB A;  4KI0 A;  1UE7 A;  2WAQ G;  3ULJ A;  4LUO A;  4O0A A;  1NMF A;  2PQA A;  1IBK L;  2R92 G;  4YCV A;  4BBS G;  2I5H A;  3J7Z C;  2EIF A;  1AH9 A;  4QQB X;  4QGU A;  2UUB Q;  4GNX B;  1IBL L;  3PUW A;  2VY3 A;  5J3B A;  1VQ6 A;  2N78 A;  5GRO A;  4EQ5 A;  2GVB A;  5FLX c;  3SGI A;  3CCV A;  4IOA A;  1K8A C;  1IBM L;  3BJU A;  4JI2 Q;  2CCZ A;  3HOV G;  1PH1 A;  4DR6 L;  1VQB A;  1L2F A;  5C44 H;  4A3M H;  4JV5 Q;  2R7D A;  4A3J G;  4X64 L;  1I94 L;  2E8G A;  2K14 A;  1EWI A;  1EQQ A;  2UU9 L;  4X64 Q;  4R4O A;  3CQZ H;  3I2Z A;  3RZO H;  1H95 A;  4DUZ L;  1N33 Q;  3HOV H;  3S24 A;  1SR3 A;  4BBR H;  3KF6 A;  1VQK A;  1HNW L;  2VW9 A;  2KCM A;  3M3Y H;  3HOZ G;  1BBU A;  1HR0 Q;  2QEX A;  3I4O A;  3AFP A;  2KBN A;  1L1O C;  2UUB L;  1VQL A;  2Q2H A;  2I0Q A;  1OXV A;  4X6A H;  1VQP A;  4GOP A;  1TWG H;  5FJ8 G;  1GM5 A;  4HIK A;  5ELO A;  5JJK A;  4L5Q A;  1JE5 A;  1Q46 A;  4R4C A;  4IPD A;  1Z47 A;  5IT9 c;  1XTD A;  4DV2 L;  1R9T H;  3KDF B;  1I3Q H;  3RR5 A;  4GN3 B;  5IE8 A;  2UUA L;  4OO1 I;  1CKN A;  3RLO A;  5IYB H;  1MKH A;  1Y1W H;  4NPS A;  5GAH C;  1OXS C;  1B7Y B;  2PI2 E;  3BZK A;  4DPG A;  1PHJ A;  3HOY G;  5M5Y H;  5BR8 L;  5M5X H;  3K80 C;  3K0X A;  5GQO A;  1CKO A;  4B3R L;  2QGQ A;  1XMQ Q;  1FJG Q;  1XJV A;  4LFA Q;  4HIO A;  3L2P A;  4C3J H;  2HHH Q;  4B3S L;  3RN2 A;  1J6Q A;  1TWA H;  2K52 A;  5JJL A;  1Z9F A;  2QA4 A;  1O7I A;  3UDI A; 
#chains in the Genus database with same CATH topology
 1VDZ A;  3SHL A;  2RHS B;  1XXG A;  2DUD A;  2K01 A;  4K8J A;  4CKE A;  2B2W C;  1HJP A;  4B3T Q;  4LF7 L;  3BVG A;  1ZYR C;  2WAC A;  3AMU A;  4DFA A;  3Q8D A;  2JE6 I;  4GLX A;  1PZJ D;  2E5L Q;  2MFI A;  3I73 A;  2A6H C;  1BR9 A;  1KAA A;  4QY7 A;  1TWF H;  1Q8K A;  4S3S A;  1JB3 A;  3KJO A;  2ALY B;  1F2M A;  1E0B A;  4A3K B;  3KF8 A;  3F2C A;  4OX9 Q;  1AEX A;  5D3D A;  5E4W C;  2JA8 G;  3L9A X;  1U4R A;  2EVB A;  3GTL B;  1HZC A;  3S2H H;  4LF6 L;  2VUM H;  2EY2 A;  3IAY A;  1IL8 A;  3VR6 A;  3S17 B;  3HZX A;  4B9W A;  2F4V Q;  2VQE Q;  1C48 A;  1PFM A;  2QCP X;  4UHV A;  4QCL A;  1ML0 D;  1PTO H;  3J80 L;  5IP9 G;  4YHH L;  3J80 E;  5M3M G;  4A3I B;  1WFQ A;  4JOI A;  4IUQ A;  1PRT B;  1S4Z A;  1M8A A;  1IXR A;  3MEF A;  3NBH A;  4WJ4 A;  3MFY A;  1PH4 A;  3LWE A;  4A4I A;  2LFN A;  2RDG A;  4IAL A;  1LTT D;  4JI5 L;  1I4R A;  3I90 A;  4C3I H;  4KHV A;  4EQP A;  1H9S A;  4JI7 L;  3R2T A;  1ESR A;  1H9R A;  1GD7 A;  2PMZ B;  1I6V C;  1EIY B;  2EY6 A;  1A62 A;  4B3M L;  2NTT A;  4JI3 Q;  1SNP A;  4EX5 A;  1LTR D;  3HOW H;  1F2Y A;  3DXJ C;  2VNU D;  4LFC L;  4HCE A;  1RD9 D;  4JI6 Q;  2FMM A;  4LF5 Q;  3NWT A;  4JYA Q;  4Y52 H;  4H02 A;  1I4G A;  3UDX A;  3CRK C;  1JIC A;  3M4Y A;  1S40 A;  3S14 H;  2Z8L A;  3TEH B;  2J7Z A;  2SNM A;  4C2M B;  2B63 B;  4ZQ3 A;  3NBH B;  3NE5 B;  1HRJ A;  5EAY A;  4HID A;  3C1E A;  5HUR A;  2NN6 I;  4R4T A;  4LF8 L;  2NZ1 D;  4KLK A;  2F0S A;  1QWY A;  2G9H D;  5IWA Q;  1XNR Q;  4JCV E;  4A3J H;  1WCM H;  1C9O A;  4DNI A;  4RGN A;  4X3T A;  4BA2 I;  2F4I A;  4OO1 H;  1WCM G;  1TY0 A;  2YU9 B;  5IWA L;  4K0K L;  2GN5 A;  4A3F B;  2N3S A;  4U68 A;  2PW7 A;  2I07 B;  3VR2 A;  4IO9 A;  2F1M A;  2ZT9 C;  2DY7 A;  3M4P A;  4KKT A;  5KNC A;  1KIX A;  5CV7 A;  5C4H A;  1PH7 A;  5C0X H;  1VF5 C;  1D5M C;  1X6O A;  3HOX H;  2CH4 W;  3BU2 A;  4QB4 A;  1B1Z A;  5M3M H;  4JYA L;  4GNX C;  3GP7 A;  4NP5 A;  5AJ3 L;  2A74 C;  4O1N A;  4H0L C;  4K5W A;  5CV9 A;  4PMC A;  3CW2 C;  1JQY D;  5CYU A;  1VQ4 A;  2O5J C;  1HA6 A;  1LO5 D;  3QOJ A;  4AH6 A;  2AUK A;  3GTK B;  4BY7 B;  1FL0 A;  1XYI A;  4RH6 A;  4WOR A;  1PRT F;  5I6Y A;  3GTO H;  3S2D H;  4DV3 L;  2A6E C;  5IYC H;  2EYL A;  1W2B A;  3H0G H;  3TSS A;  5IGG A;  3QG1 A;  3T1Y L;  4JI5 Q;  1EWH A;  2HDM A;  3ICE A;  2NN6 G;  4DR1 L;  5IIF A;  5IGC A;  1N8R C;  4EQN A;  3S1M H;  1JWU D;  4DV4 L;  2EXZ A;  5ELC A;  3K7A H;  1KDA A;  1JWS D;  3MXU A;  5CV8 A;  5CBE E;  3OHX C;  1H9J A;  4KD3 A;  1E1O A;  1N36 L;  1CSQ A;  5C4X H;  1N36 Q;  4CHT B;  3VDY A;  3A8J E;  2XWJ B;  2FJ2 A;  1KAB A;  1YJN A;  3GTM B;  2B3G A;  1WTR A;  4YY3 L;  3K5L A;  3I4N H;  1KRS A;  1X3G A;  1XMO Q;  1Y8P B;  5D65 A;  1ET6 A;  5IP7 H;  1GHK A;  3T1Y Q;  5LMN W;  4DR4 L;  1UUP A;  1O7Y A;  4LF6 Q;  1OTC A;  4MIU A;  2BH8 A;  4P73 A;  1WD0 A;  5FJ8 H;  1GJX A;  2JA8 H;  1PH5 A;  5CGK A;  2EYO A;  2EYF A;  1A15 A;  3F8T A;  3HKS A;  2JA5 H;  1EUJ A;  4HMJ A;  4FDB A;  5AJ3 Q;  3GTQ B;  2K5D A;  3GD7 A;  1Y8N B;  1U0L A;  1KQS A;  4BXX G;  4JI8 Q;  2XVS A;  1FR3 A;  1Q90 A;  2NBF A;  4ME5 A;  4HR7 B;  5FLX L;  3RLF A;  2JA6 H;  3V05 A;  3H15 A;  2N8N A;  3PUY A;  1EOV A;  2ZM6 L;  2IWH A;  4IFD H;  1PLF A;  4C3H G;  3W1B A;  3A0J A;  4GKJ Q;  2OEO A;  3TME A;  4ABN A;  5DNF A;  3H6M A;  3STB C;  2EOT A;  1S3O A;  2ICI A;  1SYC A;  3AB9 A;  1AN8 A;  2X69 A;  1XNR L;  1LT4 D;  3CP0 A;  4GLV B;  1VQA A;  4PQX A;  3KLS A;  2F52 A;  4A3D H;  1S5F D;  2YTX A;  3G6J B;  4AQY Q;  1SJH D;  1A0I A;  2AQ3 B;  2PW5 A;  4DUY L;  3CME A;  1MSG A;  2MO1 A;  4A93 G;  3CCJ A;  1I50 B;  5M5W B;  5IYB G;  3ITP A;  1ASZ A;  5D3I B;  3CD6 A;  4L5T A;  1B50 A;  1CHQ D;  3NK9 A;  1YHB A;  4DXF A;  3NEN A;  1HNX Q;  4FVM A;  4MTN A;  1XWE A;  1PDQ A;  3HRZ C;  4KHZ A;  2UU9 Q;  2TMP A;  2VB3 X;  2WFW A;  3E5S A;  3I91 A;  1QB5 D;  3DLL A;  2ATW A;  4I7A A;  3VYS A;  4DR6 Q;  3NP8 A;  5HGQ A;  1IBM Q;  2B29 A;  4JI7 Q;  2WB1 E;  5ELD A;  1DXM A;  2DNE A;  1EFW A;  1FVI A;  3EA6 A;  5BR8 Q;  1E2Z A;  1N34 L;  1Q82 C;  4LUV A;  3D4D A;  4MHE A;  5H1S E;  1PYW D;  5L37 A;  1L1O A;  3G4S A;  4BBS H;  3D8G A;  3M9B A;  3GTQ H;  2RBM A;  1Y14 B;  2Z6B A;  2B2W A;  5JEA G;  4K5V A;  4A3K H;  5C4J H;  2JEB I;  3PIO A;  3Q24 A;  3FVQ A;  5IP9 H;  4HTH A;  5NUC A;  4IUR A;  1VQ9 A;  2ICE C;  3TQY A;  4FYD A;  2R93 B;  1QUQ B;  3W2D A;  2F0H A;  1I4H A;  1CQV A;  2CFM A;  4GS3 A;  2HHH L;  3SR1 A;  4JI2 L;  1KL9 A;  4FP5 D;  3J81 j;  2Q8R E;  1ROD A;  3SXH A;  2F3V A;  2K5V A;  4OX9 L;  2Q2T A;  1D1K A;  1LTI D;  2BDO A;  2PI2 A;  2RSN A;  4LMQ D;  2ENB A;  1VMP A;  4DV6 L;  2F0E A;  3K5O A;  2DGY A;  2BA1 A;  5CV6 A;  5KND A;  3GTP B;  2BE5 D;  1PA6 A;  1DD2 A;  2M9V A;  4FNF A;  4LF7 Q;  4OEL B;  5FLM H;  2E2H B;  1GUO A;  2DJF C;  3GTL H;  3STB D;  1BCP B;  2Z9H A;  3VR4 A;  2SNS A;  4X62 L;  4ULL A;  3WWV A;  3HOV B;  3V96 A;  4WFN 3;  3FDT A;  1YIJ A;  2OTJ A;  1XMQ L;  2K5N A;  2LMC B;  1IBL Q;  4HED A;  4IQZ A;  1VCI A;  2H5X A;  5DAU A;  3D0F A;  4DNT B;  1SFO H;  4TKO B;  1DJR D;  2PQA A;  1IBK L;  1TVX A;  3MXN A;  4NKL A;  1D5X C;  4BWG B;  2I5H A;  1ZEQ X;  4IUP A;  4N9T A;  3S9W A;  3J7Z C;  1LTA D;  3A7L A;  2EJM A;  4QGU A;  2B2Y C;  4KV6 A;  2KHS A;  1V8Q A;  2N78 A;  2EDG A;  5E1F A;  2CCZ A;  4JV5 Q;  1VQB A;  1L2F A;  4EVO A;  5C44 H;  2QEJ C;  2R7D A;  3BG3 A;  5AFW A;  3A8I E;  5M3F B;  1D5Z C;  4X64 L;  1I94 L;  3S1N B;  4XDX A;  1UNS A;  3CQZ B;  1CQF A;  4X64 Q;  4TRD A;  4PV1 C;  3CHB D;  4KTA A;  3H0G B;  1CA6 A;  3HOV H;  3EQL C;  1I4P A;  3LX0 A;  1LLR D;  2A6H D;  4G7Z C;  2Q2H A;  1OXV A;  3RUZ A;  3Q22 A;  1EEI D;  1EY8 A;  1JOO A;  3J7Y W;  5JJK A;  1R9T H;  3HP3 A;  2L4N A;  1IYU A;  2M00 A;  3KDF B;  1CHP D;  1I3Q H;  4FF4 A;  4GN3 B;  3MVV A;  3CRL C;  5IE8 A;  2B2Y A;  5EBD A;  1GUW A;  5GAH C;  3O13 A;  4DPG A;  2HDL A;  5M5X H;  4B3R L;  3K0X A;  1LT5 D;  3GTO B;  2K1B A;  4CGY B;  4C3J B;  4LFA Q;  2B2T A;  3RN2 A;  1UAP A;  1Z9F A;  5I9O A;  3UDI A;  4KJN A;  5CR3 A;  2VB2 X;  1PV4 A;  1WTX A;  4XT1 B;  2SEB D;  4GKK L;  1TWH H;  1PFN A;  4TVA B;  1EY4 A;  2B8F A;  2QDL A;  5I2X A;  1LT6 D;  4P71 A;  1PFB A;  1YEZ A;  1YJW A;  1J8I A;  4HJ7 A;  1HTP A;  1B3Q A;  2WKC A;  2A68 D;  4BBR B;  3GTJ H;  1S72 A;  2IX1 A;  4OWW B;  4PZ8 A;  1SMX A;  1Y1W G;  1EQR A;  3DWQ A;  1PZI D;  2RCF A;  4PMW A;  3CF5 A;  4DV7 Q;  2CHB D;  1JOQ A;  3NPP A;  2K03 A;  3U58 A;  1WTP A;  1V1P B;  1N32 Q;  3T51 B;  2K28 A;  5JVH 3;  4DK3 C;  2R93 G;  3T1H Q;  3DWP A;  4O42 A;  3D31 A;  1MGS A;  1X32 A;  4KKU A;  2IL8 A;  2E2I B;  4IJH A;  5LMU L;  2UXB L;  1LAB A;  4C3I G;  4P74 A;  5IP7 G;  1XTC D;  2IX3 A;  2TSS A;  2N49 A;  2EY5 A;  3HS0 C;  3I56 A;  3M7N A;  3K8A A;  5FOB B;  2JA6 G;  5C4Z A;  3MXG A;  4BY7 G;  3I7F A;  1SE4 A;  2ZJQ A;  4C3H H;  5CC4 A;  4RMF A;  3PF4 A;  1EQT A;  3CCR A;  3AEV A;  2B63 G;  5ELF A;  3CPF A;  3PCO B;  3I8Z A;  2CH4 A;  2ZXR A;  1TWF B;  1X9N A;  5J39 A;  1ILQ A;  1E2W A;  1E24 A;  5T1I A;  3G48 A;  5C3X A;  4WJ3 M;  1UE1 A;  1K73 C;  3AQQ A;  3FKI B;  1J5E Q;  4U67 3;  3W5O A;  3K5N A;  2EYP A;  5M5Y B;  4M8A A;  1VF7 A;  2EPB A;  3OW7 A;  4ME3 A;  4APV A;  3PV0 A;  3MFG A;  1EYG A;  1X3Q A;  1SE8 A;  3GTJ B;  1E7Z A;  2IT1 A;  3BVZ A;  4IUU A;  4XQN A;  3RD4 A;  1K0S A;  4WRD A;  3CPW A;  5T1G A;  3HOZ B;  1Y1W B;  4CDF C;  3H3V C;  2UXC L;  3NTI A;  3KFU A;  4OHJ A;  2V1C C;  3FHW A;  2EYH A;  2PYK A;  1D2B A;  1X54 A;  4XQQ A;  3AYH B;  3S15 B;  1WJJ A;  2F0N A;  2LXK A;  4LWC A;  1B3A A;  2FHT A;  3TS0 A;  1II3 A;  3J80 c;  1E22 A;  2OCE A;  4IZ8 A;  1U4L A;  3L0O A;  1W6K A;  4J1M A;  2KUM A;  2OXP A;  3M4O B;  2RHQ B;  1H9M A;  1Q86 C;  2D5D A;  1QNK A;  4JI8 L;  3DM3 A;  3L7Z C;  3I3C A;  4OL7 A;  3MZ5 A;  4CBV A;  5IGD A;  2F0F A;  3I4M G;  4YWM A;  3OW2 A;  3IFT A;  5ELB A;  5EPK A;  2JYO A;  1YNX A;  1NAP A;  3NTK A;  1YI2 A;  3PO2 H;  3HEJ A;  2UXD Q;  1QVG A;  3FKI H;  3KK7 A;  4PZ7 A;  1JJ2 A;  5GAD C;  4G57 A;  1PZK D;  3T56 B;  1CSP A;  3H3V I;  3I70 A;  1VQO A;  4C1N K;  3PO3 B;  5BN3 A;  2YV5 A;  1WVL A;  4RGT A;  4AIM A;  2F0J A;  2QKI C;  3S1R H;  1DON A;  1NR4 A;  3D4R A;  5DEH A;  3BS1 A;  2HD3 A;  2ASB A;  1PH2 A;  1K9M C;  3ERQ A;  3FPU B;  3J80 i;  4DAM A;  2QW7 A;  4DV5 L;  2Z0S A;  1EYA A;  5A2Q E;  4JI4 L;  2VUM B;  1NTG A;  5A2Q L;  1AE3 A;  3DEO A;  1JB7 A;  1EIH A;  5IYC G;  1HZB A;  3K58 A;  4Y7N H;  3B6Y A;  1G8Z D;  3CKI B;  4A3I G;  4K0K Q;  1EYC A;  3BZD B;  2F0L A;  3CC4 A;  2DY8 A;  3CCL A;  4DR7 L;  5LL6 S;  3E9H A;  4FF3 A;  3UE0 A;  4A75 A;  1L1O B;  2CWA A;  1UWV A;  4MZ9 A;  2CKZ B;  4IUN A;  3PO2 G;  3OOC A;  1H9S B;  3GTG H;  2D0P A;  1SAP A;  1LTL A;  3QR8 A;  4OGQ C;  1RTO A;  2CQA A;  1BCP D;  4LF5 L;  4JI6 L;  5K36 G;  3P75 A;  1FNV A;  3U9S A;  2KHI A;  4UY8 C;  2RKS A;  5LMU Q;  1GO3 E;  2NVY H;  1SND A;  3OMC A;  3EIV A;  1J5E L;  1VQC A;  2K33 A;  3RZD H;  4AYB B;  4RAU C;  3AFQ A;  5FO9 B;  1IKM A;  2YU9 H;  5CBA E;  4DR2 Q;  2PNR C;  4A3B B;  1STA A;  3OPO A;  5C6A A;  4IFD I;  4LW1 A;  3HOY H;  1PH6 A;  4LF8 Q;  2A19 A;  5I4D A;  3OSO A;  2OQ0 A;  4A3E H;  2IHE A;  3HGB A;  4EGV A;  4R8N A;  2NVX H;  3NHH A;  2J4X A;  5C5L A;  3U9O A;  3PUZ A;  1DGS A;  4POF A;  4QJF A;  2MJ8 A;  3V2T A;  1BO0 A;  2MQH A;  4K2K A;  1BCP F;  3TP5 A;  1MBY A;  1STB A;  4YHH Q;  5IT9 L;  1HNW Q;  4LFC Q;  4PNY A;  1VQ7 A;  3CXC A;  1B2T A;  1V43 A;  3ER0 A;  1PH9 A;  1AFP A;  1B53 A;  2A5H A;  4K6L A;  3OMG A;  2IW3 A;  2JA9 A;  5C44 B;  3S1Q B;  2ZTD A;  2KHJ A;  3U4V A;  4DXG A;  1MI2 A;  1E1T A;  1B9M A;  1EQV A;  1JE4 A;  2JA6 B;  1JMC A;  2F0O A;  1OXU A;  2NZO A;  1BOS A;  1ESF A;  1W3S A;  4P2C B;  3A5U A;  1SMY C;  2R7Z H;  1EIF A;  2AMC B;  3SK6 A;  3PO3 G;  1Y69 U;  4MNO A;  1X56 A;  1F2Z A;  1I5F A;  4LFB Q;  3F2B A;  2PQA B;  4KY5 A;  2RSO A;  2B2U A;  1IW7 D;  4JBM A;  4B3T L;  3GQB A;  3QIA A;  5EJW A;  4P72 A;  2JN4 A;  3SDZ A;  2F0K A;  4GKK Q;  3G6E A;  4IPC A;  1HTL D;  2F4V L;  5C3E B;  3E6Z X;  2WKD A;  1HZ9 A;  3DWA A;  2GVA A;  1ZKO A;  3QWN A;  4QF4 A;  3BDL A;  2OF1 A;  4A3G H;  4CKB A;  3NQI A;  2PQE A;  2C9O A;  1Y1V G;  1VQN A;  4BBR G;  1K8O A;  1SN8 A;  1B9N A;  3CCE A;  3A54 A;  2A73 B;  1CA5 A;  2BOS A;  1NUC A;  1FD7 D;  2ZTE A;  5KYL A;  4A3K G;  4HMI A;  4RHR A;  4ZKB B;  4BA1 I;  4XQJ A;  3J81 i;  1IBK Q;  1HHV A;  3H3V H;  4F88 A;  3S15 H;  2O5I C;  4ZLT F;  5FLX E;  5KGU A;  3SE0 A;  1V1P A;  2WIN B;  1N9W A;  2LKV A;  1RCV D;  2AWN A;  5EKL A;  2B2V C;  3P20 A;  1Q8I A;  1QJO A;  1K3R A;  1SNQ A;  3PIP 3;  1F9Q A;  1G2T A;  4ZK9 B;  5CMD A;  1RDP D;  4LUZ A;  2F3W A;  4DA2 A;  4DUZ Q;  2JQO A;  1EZ6 A;  1HFN A;  4OEM B;  1MJC A;  4RCN A;  2N88 A;  1STG A;  2B39 A;  2RVL A;  1XPO A;  4DAY A;  1MIU A;  4XYQ A;  4K5X A;  1BDO A;  5LL6 X;  1TR5 A;  2DN8 A;  3HKZ B;  2AQ2 B;  1UE6 A;  5HGT A;  2ZJP A;  2AKW B;  3GV6 A;  1ILP A;  1KAW A;  4L5R C;  1V1Q A;  3OIQ A;  3F2D A;  4ZCK A;  1AZQ A;  2HCC A;  1UE7 A;  4ZKC B;  1VMC A;  1NCV A;  4K8I A;  4O0A A;  1CK1 A;  1PMR A;  2E74 C;  4HAE A;  2EIF A;  2UUB Q;  1IBL L;  1VQ6 A;  2L55 A;  1K8A C;  3HOV G;  4JI2 Q;  3HG9 A;  1R9T B;  3ND8 A;  4KY7 A;  2E8G A;  2K14 A;  1EWI A;  2FFK B;  2K6A A;  3MA2 B;  1SYF A;  2CVR A;  4E6I A;  3CQZ H;  2NVT B;  3RZO H;  1SR3 A;  4BBR H;  3K57 A;  3IL8 A;  2KCM A;  3A55 A;  3SEB A;  2QEX A;  1A3T A;  3AFP A;  1L1O C;  1GM5 A;  1TWG H;  1X3P A;  5FJ8 G;  1I6H B;  1Z6H A;  4LK1 C;  3D6C A;  3BDC A;  3TZD A;  1JE5 A;  2BE5 C;  3D6W A;  3RR5 A;  3H91 A;  4OO1 I;  1CKN A;  4K6D A;  3RMH A;  1KDC A;  2PI2 E;  3BZK A;  1CKO A;  2QGQ A;  1T5E A;  3X3M A;  1SYD A;  1DOM A;  2HHH Q;  4C3J H;  5EPJ A;  4C3I B;  3NBI A;  2F0W A;  2SDF A;  2QIL A;  5C0X J;  1G6Z A;  3K6O A;  2IY5 B;  4DNR B;  1DYQ A;  1BQQ T;  1KXL A;  2IPK D;  3D4W A;  3M7G A;  2K7V A;  4JPB W;  4C3H B;  5LMN L;  1HPC A;  4OWX B;  2HQE A;  1JOR A;  2EZV A;  1SYB A;  1YVC A;  3GV3 A;  4KN7 C;  4GLA C;  1RJT A;  1Y1V B;  2R92 B;  1HUN A;  4AQY L;  4RKB A;  1K83 B;  2WAQ B;  3RZO B;  3VR5 A;  2CWP A;  4JG2 A;  4R4I A;  1N34 Q;  1STY A;  4LF9 L;  2EXD A;  3S2D B;  1EYD A;  2VS1 A;  4CDD C;  3HFZ B;  1SRO A;  2G9D A;  1SMY D;  1GUN A;  1LT3 D;  2K50 A;  4POG A;  2HT1 A;  3ONA B;  5EGT A;  1VQG A;  1VQE A;  4OIJ A;  2PPB C;  4CJ0 B;  4KN4 C;  2JSO A;  1HNX L;  1ET9 A;  5K5P A;  2L0C A;  3KJP A;  1I6H H;  4JBK A;  2Q8T A;  5GAE C;  4XIG S;  3HOX B;  2YTV A;  4G4K A;  5DM7 3;  3HOX G;  2VQF L;  2RA4 A;  2PO4 A;  4A3M G;  4DV5 Q;  3BYY B;  4LF4 Q;  2FMC A;  5J1Z A;  2VZA A;  1Z7T A;  5IYD H;  1VQI A;  3JAM i;  1WYD A;  3BYT B;  4DF7 A;  4JOI C;  1VQJ A;  3R93 A;  4UPA A;  4HJA A;  1CZG A;  4DR7 Q;  3A7A B;  3UDF A;  1FGB D;  2Q2U A;  2QF7 A;  4LNQ A;  4GKJ L;  3QO2 A;  3GTP H;  3S17 H;  1XPR A;  1ASY A;  2A69 C;  1CFM A;  3FEW X;  3FP9 A;  4A93 B;  2UXD L;  1O7L A;  5J22 A;  3EBE A;  1HR0 W;  5M3F G;  5C3E H;  4JI0 L;  2KEC A;  4EQO A;  2R93 H;  4GN4 B;  4JI4 Q;  1KC8 C;  5C3E G;  1KLG D;  1PYS B;  1OXX K;  1HNZ L;  4IUT A;  4IFD J;  1I50 H;  4X3U A;  3TP7 A;  3J7A 5;  2NVQ B;  2UUC L;  1F9S A;  4QIW E;  3PUV A;  1F2L A;  4FXK C;  3MWY W;  4L63 B;  4DR1 Q;  4A3D G;  1WTV A;  1CM9 A;  1VQ8 A;  2PCF B;  2AHO B;  1XX8 A;  3JAM c;  3J81 E;  3HOU H;  4RG1 A;  4XT3 B;  1SE2 A;  1X65 A;  2NVT H;  1PYB A;  2E2D C;  4CDC C;  3DMU A;  4CJ2 C;  4FXD A;  4CJ1 B;  1GUS A;  4A3F G;  4O2D A;  2F0M A;  5E4X A;  4GNX A;  1M4V A;  1YHQ A;  3QB3 A;  4N9P A;  2V4D A;  4JC0 A;  2K75 A;  3M4O H;  1IW7 C;  4MTK A;  4JBW A;  3JAM L;  3CCM A;  1HNZ Q;  2ES2 A;  1XPU A;  3DUZ A;  3SK8 A;  1HUM A;  1LV9 A;  5FO8 B;  3G7L A;  4GN5 A;  1GVP A;  2CW0 C;  1VQH A;  5KEE A;  1TY2 A;  5IGE A;  4ALP A;  5KNB A;  1HH2 P;  1NSN S;  5ELN A;  1M1K C;  1SDF A;  4RGO S;  4H13 C;  5G3L D;  4A3C G;  4R1J A;  4DV1 Q;  4RWS C;  1MD2 D;  2Y0S E;  4IPH A;  4KJO A;  2Z4I A;  3S2H B;  2MNA A;  2JXM B;  3P7J A;  5EPL A;  3BZC A;  3VYU A;  4DV3 Q;  4XTC S;  2RCN A;  3ND9 A;  1BXT A;  1D1I A;  1A2U A;  3PIP A;  3IFD A;  2UXC Q;  4IFD G;  2KCC A;  3R8B A;  2RDF A;  2A6E D;  1UE5 A;  3NUC A;  4HSV A;  4KK7 A;  2PZU A;  1K0R A;  2R7Z B;  4Z9C B;  4A3G B;  1TT2 A;  1SNO A;  4KY6 A;  2O4X A;  1ICF B;  2RDH A;  3TZU A;  4K14 A;  2A8V A;  3URY A;  2F0V A;  1G29 1;  3OYY A;  1O7Z A;  4LJZ C;  2LY7 A;  4DK1 A;  4RGM A;  5IY0 A;  1STE A;  4LF9 Q;  1TS2 A;  3MXN B;  3CCS A;  4NXM L;  1PH3 A;  1P16 A;  3I4M H;  1GUG A;  1X3E A;  1HXY D;  3GDE A;  1DM0 B;  2XSC A;  3K5M A;  4PG3 A;  3WOE A;  2E2I H;  4LAA A;  3I4N G;  2RQX A;  4F7X A;  3I55 A;  2L12 A;  3P1H A;  4B08 A;  2DJG C;  4BY1 B;  1T9H A;  3S1Q H;  1TS3 A;  1PH8 A;  3WOF A;  4DAY B;  4KHP L;  1C0A A;  3H94 A;  1NJI C;  1VQD A;  2WAQ E;  2F0U A;  2B2T C;  5COY A;  4UP8 A;  4A3L H;  2C35 B;  2R6G A;  2VL6 A;  3X3N A;  1IL2 A;  2VQE L;  4JI3 L;  3F1Z A;  4B3M Q;  2D2C C;  2XGT A;  4DV0 L;  1A2T A;  5EKK A;  3NEL A;  4NB3 A;  3VA5 A;  1RHP A;  3K7U C;  4JK1 C;  1ENF A;  1FGU A;  1Q12 A;  1P8L A;  5JVG 3;  3KLR A;  4NDX A;  1TU2 B;  4X66 Q;  4DV7 L;  1KNA A;  3CCQ A;  3UDG A;  2JA7 H;  1PTO D;  2LSS A;  1Q1E A;  2L11 A;  2JA8 B;  5CV4 A;  2CQO A;  1XNQ Q;  1SFO B;  5EKI A;  2Z4H A;  1LTB D;  2M2L A;  2E5L L;  2LS0 1;  1JR0 D;  1KRT A;  3I4N B;  2B2U C;  1HZA A;  3FRP B;  1HFG A;  1G91 A;  1TXY A;  4A3E B;  1KLU D;  3C1F A;  1RIP A;  4DR5 L;  4A3B G;  3I4L A;  2F0D A;  1BCP C;  1EU4 A;  4A3M B;  1I94 Q;  2F0I A;  3RN5 A;  1B70 B;  4I7Z C;  2IJ0 A;  3NTH A;  3OWF A;  1V9P A;  3UE1 A;  3U50 C;  1NR2 A;  1WI5 A;  4OO1 G;  5C0X G;  2MGS A;  1SYG A;  2EY1 A;  3DHQ A;  4HCS A;  4K2L A;  1F77 A;  4AYB G;  4B3R Q;  1G6P A;  4UP9 A;  3K59 A;  1TWC H;  1EY9 A;  2Y0S G;  2EE1 A;  1YIT A;  2OWO A;  1YNN C;  3TRE A;  3K7A B;  1GHJ A;  4F8M A;  4HJ5 A;  1CI3 M;  2KA7 A;  1I4Q A;  3CC7 A;  5COR A;  2D0O A;  2XRS D;  4DK6 C;  3K81 C;  4WJW A;  1S5C D;  1QG7 A;  3S1R B;  3VYR A;  3I4M B;  5M5X B;  2X6G A;  1NY4 A;  5F2D A;  1L0W A;  3BVM A;  1KDB A;  4ZUJ A;  3KYH C;  4X62 Q;  4ID6 A;  3FPP A;  3RLN A;  4X65 Q;  4BY1 H;  2BCO A;  4HJ9 A;  3CMA A;  1JT8 A;  4MN3 A;  1C8C A;  4DAV A;  2ZJR A;  5KIX A;  3N52 A;  1GKH A;  1LUZ A;  3NQT A;  4ILW A;  3S16 B;  1YBY A;  1X3F A;  2BH2 A;  3SVM A;  2O2L D;  2KOL A;  5LHY 1;  2KEN A;  2K5Q A;  3PO3 H;  4DV2 Q;  4BS9 A;  1UEA B;  2NYZ D;  1QZH A;  4J15 A;  4DU9 A;  4NXN L;  2JA7 B;  1CKN B;  5C4X G;  5LMN Q;  2XWB B;  4JVZ A;  5IGF A;  1HR0 L;  2IHF A;  3D3R A;  5D14 A;  3JAM E;  2E75 C;  3J81 c;  1Y8O B;  3PF5 A;  1EU3 A;  1VS0 A;  1EOT A;  4YIJ A;  1PTO C;  1SEB D;  1A8V A;  2NZH A;  4YCW A;  3MC0 B;  5IGB A;  1AE2 A;  1Q7Y C;  5IOD A;  3IRB A;  2KCN A;  4GOP B;  5JJI A;  3PQI A;  4DV6 Q;  1ONL A;  4KI0 A;  3ULJ A;  1EZ8 A;  4LUO A;  1NMF A;  4I65 A;  4J6H A;  1AH9 A;  3QOL A;  4QQB X;  1QOH A;  1DOK A;  3PUW A;  4RFB A;  4DN4 M;  5FLX c;  3SGI A;  3VYT A;  4RKL A;  1PH1 A;  2NVX B;  2MHV A;  1ZXT A;  1EQQ A;  2UU9 L;  3T53 B;  1STN A;  4OIK A;  4R4O A;  4UDU C;  3I2Z A;  4G7O C;  5JOB A;  3TDQ A;  5C4J B;  1H9K A;  2A68 C;  4XYO A;  1VQK A;  1HNW L;  3HOZ G;  3QJY A;  1BBU A;  3I4O A;  1WTQ A;  2UUB L;  1VQL A;  4QUC A;  2I0Q A;  4X6A H;  2R61 A;  5G3L F;  4GOP A;  5ELO A;  4DV2 L;  1Q46 A;  5IT9 c;  4FF2 A;  1XTD A;  4CDE C;  3Q23 A;  1CTM A;  4X3S A;  3RLO A;  5IYB H;  1Y1W H;  4NPS A;  3HOY G;  1PHJ A;  5M5Y H;  5BR8 L;  2Q8I B;  5GQO A;  3M3Y B;  1FJG Q;  1XJV A;  4ZAI A;  3SK5 A;  3L2P A;  1J6Q A;  4UAI A;  5JJL A;  3LNN A;  2QA4 A;  1O7I A;  4KD4 A;  2MUY A;  2ZM6 Q;  1SRU A;  4ZYS A;  4C56 C;  1PTO F;  1PFS A;  3GTM H;  4J8Q A;  4IPG A;  2EJF C;  1FNU A;  4RA8 A;  5JEA J;  4DK0 A;  4GOP C;  1MSH A;  3MAQ A;  3ERS X;  4RCO A;  1LTS D;  1QE6 A;  4IJL A;  3M85 A;  4QMG A;  4DUY Q;  1S5E D;  5KYI A;  3M4Q A;  4L5S A;  3J7A F;  2HIV A;  3LGJ A;  2QDB A;  2L15 A;  2KVM A;  1IYJ B;  3KLW A;  3NWS A;  4H44 C;  1VQ5 A;  1PTO B;  4IOC A;  2NB0 A;  4NW2 A;  4R9W A;  5I9P A;  3W1G A;  1HQR D;  2ZXP A;  4DGZ A;  2MPM A;  5A35 A;  2PZT A;  4DR4 Q;  4A3G G;  5M5W H;  4V19 0;  1YNN D;  4X65 L;  5JAV A;  1XMO L;  3NEM A;  1S5D D;  1AZP A;  2OT2 A;  4YY3 Q;  1K83 H;  3KF6 B;  3HOW G;  1C7Y A;  1T5X D;  1LYL A;  1RL2 A;  3PMF A;  2VXW A;  1L0Y B;  5ELE A;  3VR3 A;  1QUQ A;  1D8L A;  4OXP A;  1W6J A;  3Q6S A;  3HKZ E;  4LFB L;  5C44 G;  2KCT A;  3TP6 A;  3J81 L;  1NE3 A;  1A3V A;  1DCZ A;  1FYC A;  1ENA A;  3T16 A;  4KMU C;  3A5Z B;  1TQO A;  3FMC A;  3E9I A;  1VQF A;  4GZY C;  5EBC A;  2OTL A;  2K5W A;  2L5T A;  2XRQ D;  1U5K A;  1U4P A;  1YNJ D;  4QIW B;  4XXE A;  2E2J H;  2NVQ H;  4DV0 Q;  4DR5 Q;  1YZ6 A;  3TS2 A;  2X6L A;  4TQU S;  2OQK A;  1G51 A;  2WV6 D;  2Z6K C;  5TSS A;  3E0J A;  3TN2 A;  1K28 A;  2F0Q A;  3PGZ A;  4A3J B;  1BBW A;  3L3O C;  3CAM A;  2LXJ A;  1F9P A;  4C1N I;  1G2S A;  3KBX A;  4DKA C;  2ZTC A;  5IT9 E;  4G7H C;  3S14 B;  2PMZ E;  4DV4 Q;  2DNC A;  1XNQ L;  1RKN A;  3KF8 B;  1IZ6 A;  4YCU A;  3ULL A;  4AYB E;  1QNU A;  1M90 C;  1JJC B;  3HKZ G;  4X66 L;  4HIM A;  3KOJ A;  3EN2 A;  1EY5 A;  1WCM B;  3ZJY C;  4DR2 L;  4NMZ A;  5E7N A;  5JPN C;  1WD1 A;  2XN9 C;  4DR3 Q;  3TP8 A;  1Q3L A;  2G5D A;  1YJ9 A;  4C2M H;  3BDO A;  1I4X A;  3Q0A A;  2D9U A;  2JA5 G;  1DZ1 A;  4KHP Q;  1SYE A;  1GUT A;  2D62 A;  2HIX A;  4UP7 A;  1BVS A;  4A3C H;  3MXP A;  1D6E C;  1PRT C;  1TWA B;  1NMG A;  2R92 H;  2L1B A;  3I72 A;  1HCZ A;  4JI1 Q;  1ZYR D;  4JBJ A;  3ERO A;  1CUK A;  1SSO A;  1LTG D;  3PIO 3;  4HJ8 A;  4DR3 L;  2K5H A;  2E76 C;  2K05 A;  4NXM Q;  2F0P A;  2K4K A;  1JOK A;  1MHW C;  2EQS A;  4M1U B;  1KNE A;  1PVO A;  2B63 H;  1EFI D;  4YWK A;  3H09 A;  1QZG A;  2K32 A;  3WDN A;  1B8A A;  4L8J A;  2F0G A;  4A76 A;  1SE3 A;  4JI1 L;  1TWG B;  1B4O A;  1JC7 A;  4N8X 1;  3NSW A;  2BA0 A;  3OWE B;  3E0E A;  2HCI A;  2K04 A;  3DM1 A;  1A6X A;  3H0G G;  3W3A A;  5BN4 A;  5BN5 A;  3R2I A;  1MJE A;  3PSI A;  5KRU A;  2F03 A;  1RTN A;  3T1H L;  1JJG A;  3N6R A;  3EFX D;  1CZW A;  4IUV A;  1N32 L;  2ZXO A;  1UEB A;  3JC6 6;  5I2Y A;  4QUF A;  1QVF A;  5C5M A;  3G71 A;  4DV1 L;  2AWO A;  3K0Y A;  2XNA C;  3HOZ H;  2J0T D;  2SOB A;  4OWT B;  2UUC Q;  2F3I A;  2JA5 B;  1GOZ A;  2NWG A;  1V1O A;  1YHA A;  5GAG C;  5CV5 A;  2KED A;  1TII D;  1R4P B;  2KEE A;  4V0B A;  4B9X A;  1VQM A;  5EQ0 A;  1A3U A;  1O78 A;  4P75 A;  1I3Q B;  3C46 A;  2B2V A;  1BBX C;  5C0X I;  5ISR A;  1KD1 C;  2R7Z G;  1KHI A;  2WII B;  2I5M X;  4IN3 A;  3HOU G;  1U4M A;  4BXX H;  1ICW A;  3CC2 A;  2NTS A;  3CU7 A;  3TRZ A;  2MO0 A;  3PUX A;  2JEA I;  1TS4 A;  1Q81 C;  3GO5 A;  4H7B A;  4PMB A;  4A3D B;  1YNJ C;  1FNW A;  1WOC A;  5M3F H;  4A93 H;  3FKI G;  5FKA C;  1CKM A;  4OON A;  2P5Z X;  4TSS A;  1WTW A;  2Y0S B;  2VQF Q;  2I46 A;  3T4A C;  5M9O A;  3VA7 A;  4JI0 Q;  1NBW A;  1NNX A;  1OXT A;  2AQ1 B;  2Z1C A;  4FXG C;  4Q0F A;  2VUM G;  1BNZ A;  1TWH B;  3EVQ A;  5FLM G;  1EY7 A;  2Q2I A;  2NVY B;  4QL5 A;  1LAC A;  1K8G A;  4A3E G;  2EYJ A;  1BF4 A;  3MEH A;  3KBG A;  1SXT A;  3A74 A;  3DEP A;  5IYD G;  4HSP A;  2FIN B;  3RNU A;  2JP1 A;  4B3S Q;  4JV5 L;  2N55 A;  1BUV T;  4A3L G;  5IOC A;  3KDF A;  1DOL A;  1FJG L;  1K3B C;  3MTS A;  5I6W A;  2R7F A;  1SLJ A;  3HOY B;  1SBB B;  1EY0 A;  1GXD C;  3ULP A;  2UUA Q;  1O80 A;  4C3J G;  4BBS B;  4LF4 L;  3A8K E;  3PO2 B;  2WP8 J;  2BDN A;  1WTH A;  2XTI A;  3LWU A;  2MP1 A;  4CKC A;  2JK8 A;  2NUC A;  4R4Q A;  1EEF D;  1RF2 D;  3CCU A;  5C3W A;  3C3L A;  2UXB Q;  1A63 A;  4YWL A;  2IX0 A;  3OIP A;  1N33 L;  1CT1 D;  1S5B D;  2Z6K A;  1X55 A;  1Q1B A;  1HQM C;  2FXQ A;  5JEA H;  2E2J B;  1D7Q A;  1IYV A;  5DM6 3;  3C2P A;  5E3F A;  2A1A A;  4ZRZ A;  1STH A;  1IHZ A;  4PZ6 A;  3S16 H;  4RHS A;  4FF1 A;  5JPM C;  1SJE D;  2B8G A;  2JJQ A;  3E3X A;  1E3P A;  5FK9 C;  4F87 A;  1PXU A;  3EJI A;  4ODG A;  4X3K A;  1L0X B;  5K36 H;  2YTY A;  5C4X B;  2NN6 H;  2L9H A;  5HY6 A;  1TWC B;  4A3B H;  4A3F H;  1B44 D;  3GTK H;  4BY7 H;  2KJX A;  1TS5 A;  1ENC A;  5JJZ A;  3KUP A;  4HN7 A;  3OTO L;  2A69 D;  1EWC A;  3A56 A;  2E2H H;  1JCK B;  2CW0 D;  3RZD B;  2PNH A;  1QVC A;  5DLQ E;  4ZUI A;  2PZW A;  3R3O A;  4BY1 G;  1JWM D;  3U4Z A;  5M3M B;  2I5L X;  5FO7 B;  4R8I A;  1QCB D;  1LM0 A;  2YYZ A;  4LFA L;  1Y1V H;  3OTO Q;  3UI2 A;  3S1M B;  3NXW A;  1F9R A;  1KTK A;  2HQL A;  2RF4 A;  4NXN Q;  3GTG B;  4A3I H;  2JA7 G;  2ID0 A;  3S1N H;  3TBI B;  2WB1 G;  1BKB A;  2WAQ G;  3J7A V;  2R92 G;  1EIG A;  4YCV A;  4BBS G;  4N8F A;  4DAP A;  1SNM A;  1TKW B;  1QIL A;  2C5C A;  4GNX B;  2VY3 A;  5J3B A;  2EYM A;  5GRO A;  4EQ5 A;  1SNC A;  4KKS A;  2GVB A;  1J9O A;  3CCV A;  1AP0 A;  4IOA A;  1IBM L;  2F0T A;  3BJU A;  1WTO A;  4DR6 L;  1PRT D;  4A3M H;  4A3J G;  3HOU B;  3AU7 A;  4Q5V A;  2XIW A;  2GA4 B;  3F2U A;  1H95 A;  2AUJ D;  4DUZ L;  1N33 Q;  3KLS X;  3S24 A;  4L6T B;  3SK4 A;  3HOW B;  3KF6 A;  1EL0 A;  2WB1 B;  2VW9 A;  3M3Y H;  1HA5 A;  1HR0 Q;  2KQ3 A;  2KBN A;  2R3Z A;  1R4Q B;  1E2V A;  3MHB A;  1VQP A;  4HIK A;  4L5Q A;  3IKJ A;  2HUG A;  4R4C A;  4IPD A;  1Z47 A;  1EY6 A;  3T13 A;  2EJG C;  4JW0 A;  2H4O A;  2UUA L;  1IKL A;  1MKH A;  4FO2 A;  1K8M A;  1OXS C;  1B7Y B;  1U9R A;  2H1E A;  1C4Q A;  3K80 C;  1XMQ Q;  1AW7 A;  3ZYY X;  4Y7N B;  4HIO A;  4B3S L;  1TWA H;  2K52 A;  1OO9 B; 
#chains in the Genus database with same CATH homology
 2RHS B;  1PV4 A;  2IY5 B;  2ZM6 Q;  1SRU A;  2DUD A;  4GKK L;  1KXL A;  1TWH H;  1PFS A;  4TVA B;  3GTM H;  1HJP A;  4B3T Q;  4LF7 L;  4IPG A;  4P71 A;  5JEA J;  3Q8D A;  2JE6 I;  5LMN L;  4GOP C;  4GLX A;  2E5L Q;  2MFI A;  4OWX B;  1YEZ A;  3ERS X;  1YJW A;  4HJ7 A;  4IJL A;  1YVC A;  4QY7 A;  3M85 A;  1TWF H;  4DUY Q;  1Q8K A;  4GLA C;  3M4Q A;  4L5S A;  2HIV A;  3LGJ A;  2ALY B;  3KJO A;  3GTJ H;  1S72 A;  2L15 A;  4AQY L;  2IX1 A;  1IYJ B;  4OWW B;  4PZ8 A;  1SMX A;  3KLW A;  3F2C A;  4OX9 Q;  1Y1W G;  1EQR A;  2CWP A;  1VQ5 A;  2JA8 G;  4JG2 A;  4IOC A;  4R4I A;  1N34 Q;  4PMW A;  3CF5 A;  4DV7 Q;  3W1G A;  1HZC A;  4LF9 L;  2EXD A;  3S2H H;  3U58 A;  4LF6 L;  2VS1 A;  2VUM H;  3HFZ B;  4DR4 Q;  4A3G G;  5M5W H;  1SRO A;  1N32 Q;  4X65 L;  2K50 A;  4DK3 C;  1XMO L;  2R93 G;  3T1H Q;  3NEM A;  4POG A;  2F4V Q;  3D31 A;  2VQE Q;  2HT1 A;  1VQG A;  1VQE A;  4YY3 Q;  1K83 H;  3KF6 B;  3HOW G;  1HNX L;  4IJH A;  1C7Y A;  5LMU L;  2UXB L;  1LYL A;  1RL2 A;  3KJP A;  4P74 A;  5IP9 G;  4YHH L;  1I6H H;  5IP7 G;  4JBK A;  1QUQ A;  5M3M G;  5GAE C;  2N49 A;  1D8L A;  4XIG S;  3I56 A;  2YTV A;  1WFQ A;  4JOI A;  4OXP A;  3HOX G;  2VQF L;  3M7N A;  3HKZ E;  3K8A A;  5C44 G;  4A3M G;  2KCT A;  4DV5 Q;  4LFB L;  1NE3 A;  4LF4 Q;  2JA6 G;  1IXR A;  3MEF A;  4BY7 G;  3I7F A;  1PH4 A;  2VZA A;  4WJ4 A;  5IYD H;  1VQI A;  4A4I A;  3JAM i;  1WYD A;  3A5Z B;  2ZJQ A;  4C3H H;  4JOI C;  4RMF A;  1VQJ A;  4JI5 L;  3PF4 A;  3E9I A;  1VQF A;  4UPA A;  3CCR A;  4HJA A;  3AEV A;  2B63 G;  4C3I H;  3CPF A;  3PCO B;  4DR7 Q;  4JI7 L;  2OTL A;  3UDF A;  1X9N A;  1GD7 A;  1U5K A;  2E2J H;  2Q2U A;  1EIY B;  4LNQ A;  1E24 A;  2NVQ H;  4GKJ L;  3G48 A;  4WJ3 M;  1UE1 A;  1K73 C;  4DV0 Q;  3GTP H;  1A62 A;  3AQQ A;  4DR5 Q;  1XPR A;  4B3M L;  1YZ6 A;  3S17 H;  3TS2 A;  1ASY A;  4TQU S;  4JI3 Q;  1J5E Q;  2OQK A;  4EX5 A;  1G51 A;  2Z6K C;  3W5O A;  3FP9 A;  3HOW H;  2UXD L;  3EBE A;  2VNU D;  1HR0 W;  3PGZ A;  4LFC L;  1BBW A;  5M3F G;  5C3E H;  4JI0 L;  4JI6 Q;  4ME3 A;  4APV A;  4LF5 Q;  2R93 H;  3CAM A;  2LXJ A;  3PV0 A;  4GN4 B;  4JYA Q;  1EYG A;  4JI4 Q;  4Y52 H;  1KC8 C;  5C3E G;  4H02 A;  1PYS B;  1SE8 A;  1OXX K;  3UDX A;  1HNZ L;  1E7Z A;  2IT1 A;  4IFD J;  1S40 A;  4DKA C;  1I50 H;  3S14 H;  2ZTC A;  3TEH B;  3J7A 5;  2UUC L;  2PMZ E;  4QIW E;  4DV4 Q;  3PUV A;  3NBH B;  1XNQ L;  3KF8 B;  1IZ6 A;  5EAY A;  4YCU A;  3ULL A;  4AYB E;  4DR1 Q;  3CPW A;  4HID A;  4A3D G;  2UXC L;  1M90 C;  2NN6 I;  1JJC B;  4R4T A;  4LF8 L;  4KLK A;  3KFU A;  1VQ8 A;  2AHO B;  5IWA Q;  3HKZ G;  1XNR Q;  2V1C C;  3JAM c;  4JCV E;  4RG1 A;  3FHW A;  1WCM H;  4X66 L;  1C9O A;  4DNI A;  4HIM A;  4A3J H;  1X65 A;  3EN2 A;  3KOJ A;  1X54 A;  3ZJY C;  4BA2 I;  4DR2 L;  3AYH B;  1WJJ A;  2NVT H;  1PYB A;  1WCM G;  5E7N A;  2LXK A;  4LWC A;  5IWA L;  4A3F G;  4K0K L;  4O2D A;  2GN5 A;  4DR3 Q;  2N3S A;  3TS0 A;  3J80 c;  1E22 A;  2OCE A;  1YJ9 A;  4IO9 A;  3L0O A;  3M4P A;  4C2M H;  4GNX A;  1YHQ A;  1KIX A;  2RHQ B;  1PH7 A;  4JC0 A;  1Q86 C;  2K75 A;  3M4O H;  2JA5 G;  4JBW A;  3CCM A;  1HNZ Q;  1X6O A;  3HOX H;  2ES2 A;  4KHP Q;  1XPU A;  4JI8 L;  3DM3 A;  3L7Z C;  3BU2 A;  2HIX A;  2D62 A;  4UP7 A;  5M3M H;  4JYA L;  4GNX C;  4GN5 A;  1BVS A;  4A3C H;  3I4M G;  4YWM A;  3OW2 A;  1NMG A;  5AJ3 L;  2R92 H;  1GVP A;  1YNX A;  1VQH A;  1YI2 A;  4JI1 Q;  3PO2 H;  2UXD Q;  3CW2 C;  4JBJ A;  4ALP A;  1HH2 P;  1QVG A;  3FKI H;  1CUK A;  4PZ7 A;  5ELN A;  1VQ4 A;  5GAD C;  1M1K C;  1JJ2 A;  4AH6 A;  1FL0 A;  4HJ8 A;  4A3C G;  4R1J A;  4DV1 Q;  1CSP A;  3H3V I;  2Y0S E;  4DR3 L;  2K5H A;  4IPH A;  1VQO A;  4NXM Q;  3GTO H;  2K4K A;  3S2D H;  4DV3 L;  5IYC H;  2MNA A;  2EQS A;  1W2B A;  3BZC A;  4DV3 Q;  4XTC S;  3H0G H;  1PVO A;  2YV5 A;  2B63 H;  2RCN A;  3T1Y L;  4AIM A;  3S1R H;  4YWK A;  4JI5 Q;  1QZG A;  3PIP A;  3ICE A;  2UXC Q;  2NN6 G;  4DR1 L;  4IFD G;  2ASB A;  1B8A A;  1N8R C;  1PH2 A;  1K9M C;  3S1M H;  1UE5 A;  3J80 i;  4DV4 L;  4A76 A;  4DAM A;  4JI1 L;  3K7A H;  4DV5 L;  1K0R A;  2Z0S A;  1E1O A;  4JI4 L;  2BA0 A;  1N36 L;  1CSQ A;  5C4X H;  1N36 Q;  1NTG A;  3E0E A;  3VDY A;  1AE3 A;  1JB7 A;  1YJN A;  3H0G G;  5C0X J;  2A8V A;  2B3G A;  1G29 1;  3OYY A;  5IYC G;  1HZB A;  4YY3 L;  3I4N H;  1KRS A;  3PSI A;  1MJE A;  1X3G A;  4Y7N H;  3B6Y A;  1JJG A;  3T1H L;  4A3I G;  1XMO Q;  4K0K Q;  5IP7 H;  1N32 L;  3T1Y Q;  5LMN W;  4DR4 L;  1UEB A;  3CC4 A;  3JC6 6;  4LF6 Q;  3CCL A;  5IY0 A;  1OTC A;  4LF9 Q;  4DR7 L;  3MXN B;  3CCS A;  1QVF A;  4NXM L;  2BH8 A;  4P73 A;  1PH3 A;  1P16 A;  5FJ8 H;  3I4M H;  3E9H A;  2JA8 H;  1X3E A;  1PH5 A;  3UE0 A;  3GDE A;  3G71 A;  4DV1 L;  2AWO A;  4A75 A;  1L1O B;  2CWA A;  4PG3 A;  3HOZ H;  2E2I H;  1UWV A;  3F8T A;  3I4N G;  4MZ9 A;  3HKS A;  4OWT B;  3I55 A;  2UUC Q;  2CKZ B;  2JA5 H;  1EUJ A;  3PO2 G;  2F3I A;  3GTG H;  4FDB A;  2D0P A;  5AJ3 Q;  1YHA A;  5GAG C;  3GD7 A;  1LTL A;  1T9H A;  3S1Q H;  1U0L A;  1PH8 A;  1KQS A;  4LF5 L;  4BXX G;  4JI8 Q;  4DAY B;  1VQM A;  4JI6 L;  4KHP L;  1C0A A;  4P75 A;  1NJI C;  5K36 G;  2KHI A;  1VQD A;  5C0X I;  4UY8 C;  2WAQ E;  5LMU Q;  1GO3 E;  2NVY H;  3RLF A;  2JA6 H;  4UP8 A;  1KD1 C;  4A3L H;  2R7Z G;  3EIV A;  2C35 B;  2R6G A;  1KHI A;  2N8N A;  2VL6 A;  3H15 A;  3PUY A;  1EOV A;  1VQC A;  2I5M X;  4JI3 L;  2ZM6 L;  2VQE L;  3F1Z A;  1J5E L;  4B3M Q;  3HOU G;  3RZD H;  4BXX H;  2XGT A;  4DV0 L;  3CC2 A;  3W1B A;  3NEL A;  4NB3 A;  3A0J A;  4GKJ Q;  3K7U C;  3TRZ A;  2MO0 A;  3AFQ A;  1FGU A;  3PUX A;  1Q12 A;  2YU9 H;  2JEA I;  4DR2 Q;  3STB C;  1P8L A;  1S3O A;  1Q81 C;  4X66 Q;  4DV7 L;  3CCQ A;  1XNR L;  3UDG A;  2JA7 H;  3GO5 A;  4LW1 A;  4IFD I;  3HOY H;  3CP0 A;  1PH6 A;  2LSS A;  1Q1E A;  4GLV B;  1VQA A;  4LF8 Q;  2A19 A;  2F52 A;  4A3E H;  2OQ0 A;  2YTX A;  4A3D H;  2IHE A;  1WOC A;  5M3F H;  2CQO A;  4AQY Q;  2NVX H;  3FKI G;  4A93 H;  1CKM A;  4OON A;  1XNQ Q;  1A0I A;  4DUY L;  3CME A;  2MO1 A;  3PUZ A;  4A93 G;  1DGS A;  2VQF Q;  3CCJ A;  4POF A;  4QJF A;  2MQH A;  2E5L L;  5IYB G;  1ASZ A;  1KRT A;  4YHH Q;  4L5T A;  4JI0 Q;  3CD6 A;  1NBW A;  1OXT A;  4LFC Q;  2VUM G;  1HNW Q;  1YHB A;  1HZA A;  1VQ7 A;  3NEN A;  3CXC A;  1HNX Q;  4MTN A;  1V43 A;  5FLM G;  2Q2I A;  4QL5 A;  1TXY A;  3ER0 A;  1PH9 A;  1K8G A;  4A3E G;  4KHZ A;  1RIP A;  2UU9 Q;  4DR5 L;  4A3B G;  2JA9 A;  3A74 A;  1I94 Q;  2WFW A;  5IYD G;  3DLL A;  3RN5 A;  1B70 B;  2KHJ A;  2ZTD A;  2ATW A;  3RNU A;  3U4V A;  4B3S Q;  1V9P A;  3UE1 A;  4DR6 Q;  4JV5 L;  3U50 C;  4A3L G;  5HGQ A;  1E1T A;  1WI5 A;  2B29 A;  2WB1 E;  3KDF A;  5C0X G;  1IBM Q;  4JI7 Q;  1EFW A;  1FJG L;  4OO1 G;  1FVI A;  4B3R Q;  4AYB G;  1JMC A;  2R7F A;  5BR8 Q;  1G6P A;  4UP9 A;  1Q82 C;  4LUV A;  1TWC H;  1N34 L;  2Y0S G;  1OXU A;  1SLJ A;  2NZO A;  5H1S E;  1YIT A;  2OWO A;  1L1O A;  1W3S A;  3A5U A;  3G4S A;  3ULP A;  2UUA Q;  4BBS H;  2R7Z H;  3M9B A;  1EIF A;  2AMC B;  3TRE A;  3GTQ H;  4LF4 L;  4HJ5 A;  1Y14 B;  3PO3 G;  4MNO A;  1X56 A;  1I5F A;  1IL2 A;  5JEA G;  4LFB Q;  3F2B A;  3CC7 A;  2PQA B;  2D0O A;  2WP8 J;  4DK6 C;  3K81 C;  4A3K H;  5C4J H;  2JEB I;  2XTI A;  3PIO A;  2JK8 A;  5IP9 H;  4R4Q A;  1A63 A;  3CCU A;  4JBM A;  2UXB Q;  1VQ9 A;  4B3T L;  1NY4 A;  4YWL A;  2IX0 A;  1L0W A;  3TQY A;  1N33 L;  4P72 A;  4GKK Q;  3G6E A;  1QUQ B;  4IPC A;  3KYH C;  2F4V L;  4X62 Q;  3RLN A;  4X65 Q;  4BY1 H;  1HZ9 A;  2GVA A;  2CFM A;  2Z6K A;  4HJ9 A;  1X55 A;  3CMA A;  1Q1B A;  4A3G H;  1JT8 A;  4GS3 A;  2FXQ A;  2HHH L;  4JI2 L;  1VQN A;  1Y1V G;  1D7Q A;  4BBR G;  1KL9 A;  2ZJR A;  3J81 j;  1SN8 A;  2A1A A;  4PZ6 A;  3CCE A;  3S16 H;  1GKH A;  1LUZ A;  2K5V A;  1YBY A;  2ZTE A;  2JJQ A;  1X3F A;  4A3K G;  2Q2T A;  4OX9 L;  2BH2 A;  3J81 i;  1E3P A;  4BA1 I;  2PI2 A;  1IBK Q;  3H3V H;  2KEN A;  3S15 H;  3PO3 H;  4DV2 Q;  4DV6 L;  2YTY A;  1N9W A;  1QZH A;  4J15 A;  2DGY A;  5HY6 A;  4NXN L;  1CKN B;  5C4X G;  2BA1 A;  5LMN Q;  4A3B H;  4A3F H;  2AWN A;  1HR0 L;  1K3R A;  3GTK H;  2IHF A;  4BY7 H;  1PA6 A;  4LF7 Q;  5FLM H;  4LUZ A;  3OTO L;  4DUZ Q;  2JQO A;  3J81 c;  3STB D;  2E2H H;  3GTL H;  3PF5 A;  2PNH A;  1QVC A;  5DLQ E;  4BY1 G;  1VS0 A;  1MJC A;  3U4Z A;  4X62 L;  2I5L X;  1XPO A;  3WWV A;  1LM0 A;  1MIU A;  1A8V A;  2NZH A;  2YYZ A;  4LFA L;  1Y1V H;  3OTO Q;  1YIJ A;  2OTJ A;  1XMQ L;  4YCW A;  1UE6 A;  2ZJP A;  2AKW B;  2K5N A;  1IBL Q;  2HQL A;  2RF4 A;  1VCI A;  4NXN Q;  2H5X A;  1KAW A;  1AE2 A;  4A3I H;  4L5R C;  1V1Q A;  1Q7Y C;  2JA7 G;  2ID0 A;  3IRB A;  4GOP B;  3D0F A;  3HOU H;  3S1N H;  1SFO H;  5JJI A;  2WB1 G;  3F2D A;  4DV6 Q;  1BKB A;  4KI0 A;  1UE7 A;  2WAQ G;  3ULJ A;  4LUO A;  4O0A A;  1NMF A;  2PQA A;  1IBK L;  2R92 G;  4YCV A;  4BBS G;  2I5H A;  3J7Z C;  2EIF A;  1AH9 A;  4QQB X;  4QGU A;  2UUB Q;  4GNX B;  1IBL L;  3PUW A;  2VY3 A;  5J3B A;  1VQ6 A;  2N78 A;  5GRO A;  4EQ5 A;  2GVB A;  5FLX c;  3SGI A;  3CCV A;  4IOA A;  1K8A C;  1IBM L;  3BJU A;  4JI2 Q;  2CCZ A;  3HOV G;  1PH1 A;  4DR6 L;  1VQB A;  1L2F A;  5C44 H;  4A3M H;  4JV5 Q;  2R7D A;  4A3J G;  4X64 L;  1I94 L;  2E8G A;  2K14 A;  1EWI A;  1EQQ A;  2UU9 L;  4X64 Q;  4R4O A;  3CQZ H;  3I2Z A;  3RZO H;  1H95 A;  4DUZ L;  1N33 Q;  3HOV H;  3S24 A;  1SR3 A;  4BBR H;  3KF6 A;  1VQK A;  1HNW L;  2VW9 A;  2KCM A;  3M3Y H;  3HOZ G;  1BBU A;  1HR0 Q;  2QEX A;  3I4O A;  3AFP A;  2KBN A;  1L1O C;  2UUB L;  1VQL A;  2Q2H A;  2I0Q A;  1OXV A;  4X6A H;  1VQP A;  4GOP A;  1TWG H;  5FJ8 G;  1GM5 A;  4HIK A;  5ELO A;  5JJK A;  4L5Q A;  1JE5 A;  1Q46 A;  4R4C A;  4IPD A;  1Z47 A;  5IT9 c;  1XTD A;  4DV2 L;  1R9T H;  3KDF B;  1I3Q H;  3RR5 A;  4GN3 B;  5IE8 A;  2UUA L;  4OO1 I;  1CKN A;  3RLO A;  5IYB H;  1MKH A;  1Y1W H;  4NPS A;  5GAH C;  1OXS C;  1B7Y B;  2PI2 E;  3BZK A;  4DPG A;  1PHJ A;  3HOY G;  5M5Y H;  5BR8 L;  5M5X H;  3K80 C;  3K0X A;  5GQO A;  1CKO A;  4B3R L;  2QGQ A;  1XMQ Q;  1FJG Q;  1XJV A;  4LFA Q;  4HIO A;  3L2P A;  4C3J H;  2HHH Q;  4B3S L;  3RN2 A;  1J6Q A;  1TWA H;  2K52 A;  5JJL A;  1Z9F A;  2QA4 A;  1O7I A;  3UDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...