2DJFC

Crystal structure of human dipeptidyl peptidase i (cathepsin c) in complex with the inhibitor gly-phe-chn2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dipeptidyl-peptidase 1
publication title The crystal structure of human dipeptidyl peptidase I (cathepsin C) in complex with the inhibitor Gly-Phe-CHN2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 8
structure length 68
sequence length 68
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2006-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 2djfC00
2DJFC 4CDFC 4CDEC 4OELB 4CDCC 4CDDC 1MHWC 1K3BC 2DJGC 1ICFB 4OEMB
chains in the Genus database with same CATH superfamily
3DM3A 5CV7A 2Q8TA 5IP7G 2ENBA 1BBXC 4A3DG 1STHA 5FO8B 2HT1A 3A54A 1BF4A 2DNCA 4A3IH 1LTBD 1ENCA 2KCNA 2F4VL 4OL7A 2E2JH 3L7ZC 2JEAI 3CPFA 3GTPH 1PH3A 5IODA 2F0MA 1NJIC 2R7ZG 4A3MB 1N36Q 2EY1A 3GQBA 1EYGA 3STBD 1JR0D 2B2VA 3UDXA 4K0KQ 2XIWA 4RGOS 3G71A 3TSSA 1JC7A 4AQYQ 4K0KL 4NXNQ 4AQYL 2ZJRA 1Q3LA 1H9JA 4NXNL 4IUTA 5ISRA 2JA5G 2F0TA 4CBVA 1D5MC 5BR8L 4B9WA 2HCIA 3W3AA 4DNIA 1WCMG 1CK1A 1IW7D 2JA9A 2NTSA 3DWQA 5K36H 1ONLA 2G9HD 3SR1A 3CRKC 1X3GA 3I8ZA 1PYSB 4XXEA 3T1YQ 1HZCA 3HOUB 4DR6L 3A74A 2MPMA 3BS1A 3HKZG 4KHZA 1SDFA 1BOSA 4BBSH 1B8AA 3DMUA 2NVXH 4WJ4A 1SMYC 4AYBG 2Q2HA 4JV5L 1WI5A 1I6VC 3PGZA 4A3EH 2ZJQA 4MN3A 1D5XC 3BZCA 4OEMB 1PMRA 3D0FA 4KN4C 4JYAL 3TQYA 4LFAQ 3HS0C 1S5FD 2HD3A 2E5LQ 3UDIA 4LFAL 1B2TA 2E5LL 3J81i 4H0LC 3QWNA 4JI3Q 1STEA 2A5HA 3S16H 4B3RQ 4JI3L 2F0IA 2MNAA 1HH2P 4ZYSA 4B3RL 1H9MA 2NZ1D 4WFN3 1IHZA 1TWGB 3FRPB 4IOAA 3E3XA 3OMCA 3I4MG 4FXKC 4HJ5A 5ELOA 3J7AF 2V1CC 4YWKA 5L37A 1EQQA 2RA4A 4JI2Q 2M9VA 2GA4B 1E2ZA 5J3BA 4X64L 1EZ6A 1K28A 2B39A 5C6AA 4MNOA 1I94Q 1QJOA 5KYIA 3E0EA 3HOXG 3U58A 1QZGA 1I94L 3W2DA 1HQMC 1VQ6A 1CKMA 1WTOA 1GHKA 1C8CA 5FLXc 4YCVA 2K05A 2FJ2A 1DOKA 4ZKCB 1E2WA 2A68D 4C3JH 2OQ0A 4DUYL 2CFMA 1WTQA 3CPWA 5CV4A 4G7ZC 3VR3A 3WWVA 4DN4M 3GD7A 1UNSA 1ZXTA 4A3BB 1YJWA 4DK1A 5JEAJ 1AEXA 1E22A 4DAYA 1E2VA 2JQOA 3UI2A 2Q8RE 2F0PA 4GOPB 1AP0A 5M3FH 4RHSA 5IYDH 4A3KH 3HOYH 3E9IA 2VQFQ 3NQTA 4DNTB 5FLXL 1CQVA 3ZJYC 4O2DA 3OPOA 1VQ9A 4QIWE 3NBHB 4CDEC 1PLFA 3MXUA 5I9OA 1QB5D 1A3UA 1JICA 4PZ7A 2GVBA 4NDXA 2KEDA 5M5YH 3EQLC 1D1IA 5AFWA 5EGTA 1J8IA 2KENA 3EBEA 3A8JE 2B2UA 5HURA 1GOZA 1SAPA 4RGMA 3HOUG 2XVSA 4AYBE 2ASBA 3PO3H 2F0OA 5ELFA 3T4AC 2EY5A 3BG3A 1ESFA 2OQKA 4KK7A 2D9UA 3JAMc 1BUVT 5KNCA 1N32L 3ND8A 4RHRA 3SK8A 4B3ML 1WVLA 5J22A 4X3SA 4R9WA 3BZKA 5C3EH 3KDFB 1HR0W 1VQAA 3Q22A 1Q86C 1AW7A 1CA6A 2H5XA 3I56A 2KOLA 3K7UC 4BY7B 1WJJA 4IPCA 5KGUA 2VUMH 4H44C 3M7GA 4HAEA 1P16A 4U68A 1MKHA 4NW2A 3S9WA 2ES2A 1JCKB 3J7AV 1PHJA 3DHQA 4LF6Q 3L0OA 1HHVA 1LTSD 1BQQT 1TWCB 3GTGB 2R7FA 3J7ZC 4DA2A 2R92H 3CCEA 5I4DA 2AMCB 2CW0C 3K57A 1TWHB 3JAML 4LAAA 1STBA 1FYCA 3S2HB 2GVAA 1VF7A 2X6GA 5C0XH 3TP8A 1B44D 4DR4Q 4C3IB 2DGYA 1P8LA 1R4QB 3BVZA 4DR4L 2EQSA 1PRTC 3SDZA 2VY3A 2RDFA 3J80i 1AZQA 2NN6G 2O5IC 2A6HC 4QCLA 4CJ0B 2I46A 2UUAQ 1VDZA 1IKLA 1SYDA 1SYEA 2F0EA 4K14A 2UUAL 1K8MA 3RLFA 1VCIA 2B3GA 3TZUA 1DOLA 2QCPX 3I4LA 5IYCG 3MEFA 3VYSA 1JQYD 4L5RC 4QMGA 1CM9A 4HSPA 1JWSD 1W2BA 4A3CG 4GN4B 2FMCA 1EU3A 2F0LA 4A3LH 5JJIA 4R4OA 3OIQA 3A0JA 1EY8A 5ELEA 4HIMA 3RNUA 4XQNA 4DV1Q 1D5ZC 5IWAL 5DM63 4DV1L 4BBRG 1JWMD 4C56C 1Q8KA 4X6AH 2AWOA 1L0YB 2RF4A 3HGBA 4IO9A 4GNXC 2IY5B 4FDBA 2NN6I 5I2YA 2ZJPA 5J39A 4GOPA 4B3TQ 2B2WC 2JA7B 1X3FA 1G6PA 4C2MB 4B3TL 2DY8A 4MIUA 2K5HA 4EX5A 3CCSA 2F0UA 3WOFA 5KNBA 3BU2A 4RCNA 1WTRA 3CCJA 4DPGA 1F2ZA 2E8GA 3PUVA 1FL0A 5GAEC 2F0SA 2R3ZA 3I55A 1WTWA 1VQJA 1YVCA 3TS2A 3NTKA 1DXMA 1I6HB 2NVQH 4FNFA 5FO7B 1ASZA 1HJPA 1ET6A 1KC8C 1C0AA 1LV9A 4APVA 3T1HQ 4IALA 3GTQB 1D2BA 3D4DA 2F0HA 1GD7A 2R6GA 1EYCA 3TP7A 3W5OA 4I7AA 1O7ZA 4XQQA 5G3LF 2M00A 3RMHA 3BVGA 4DV7L 4KY5A 1XNRQ 4YCWA 4DR5L 1Q8IA 5IOCA 4BY1B 5C4XH 1XNRL 2CH4W 4NXML 3NWTA 4ULLA 4KJNA 1MHWC 1W6JA 3ER0A 5LMNQ 1K83B 1LTAD 2C9OA 1H9SB 3AMUA 3U50C 3GTMH 1YJ9A 2AQ3B 1LABA 4BY7G 1NSNS 3ULPA 2R7ZH 1VQNA 1WD1A 1QOHA 2HDLA 3K7AH 2AHOB 3HOWH 1YHQA 3UDGA 4JBKA 4TSSA 1A8VA 4A3GB 1RHPA 1YNND 3QB3A 1Q82C 3SK6A 2QF7A 1V9PA 1K3BC 5IGBA 1SXTA 3RN2A 4HEDA 5JPMC 3T51B 3GP7A 1B3AA 1WD0A 1EOTA 2MGSA 5KNDA 4ILWA 2CQAA 1K73C 5C0XJ 3R2TA 4C3IG 4JBMA 1Q12A 5AJ3L 1SNMA 1TS4A 4HIDA 2X69A 5CYUA 4JBWA 5D3IB 4JI1L 3BYYB 1SR3A 3MC0B 1Q7YC 2MO1A 2J7ZA 4N8X1 3NHHA 3IKJA 2KJXA 5KRUA 5HY6A 1JORA 4HCSA 4X66Q 4XTCS 2DJFC 3FHWA 5M5WB 1E3PA 1FNVA 1HNWQ 2PMZE 2MFIA 1HNWL 3K5NA 1ESRA 1JOQA 1L1OA 2Z4HA 2Z9HA 1EUJA 1XMOQ 2EJGC 3O13A 1CTMA 5G3LD 1B4OA 1XMOL 1MI2A 4DV3L 5H1SE 4UP7A 3M9BA 1Y1VB 4DR1L 4IJLA 2A1AA 1EQRA 4ZLTF 3I4NG 1CA5A 1UWVA 1FR3A 1PH5A 3HG9A 3WDNA 5E7NA 3MEHA 4DGZA 2AWNA 4NB3A 2CKZB 5C4HA 3T56B 1CUKA 1F2YA 1VQHA 2I5HA 5I6YA 2Z8LA 3VA7A 4CKEA 2L12A 4YHHQ 1EY7A 2Y0SB 4WORA 4YHHL 1GO3E 2JA5B 5M3MH 1PFBA 2A6EC 3U9SA 5IT9c 1BCPC 4IFDG 4YWMA 2PZUA 1PRTB 1IL8A 1YEZA 3NXWA 4F7XA 1GUSA 3Q0AA 4J15A 1UAPA 3NENA 3D6CA 4KN7C 3LWEA 1VQDA 2B63B 2CQOA 4GLVB 2MP1A 1QVFA 2CCZA 2XGTA 4UP9A 1CFMA 4LFCQ 1EQVA 4LFCL 3PO2B 4CDDC 2H4OA 4BS9A 3A5UA 3S1RB 4HMJA 1UEAB 5DM73 3BJUA 1F2LA 3MVVA 3HKZB 4QUCA 3A7LA 4RGTA 3UE0A 1LTRD 1XWEA 3OYYA 2Z4IA 1F9QA 5IT9L 3STBC 2FMMA 3M4PA 3D4WA 2DNEA 1RIPA 4WRDA 4A3FH 3K8AA 2NZHA 1K8OA 3GV3A 1A0IA 4L5TA 3DEOA 5HGTA 1E7ZA 4IFDI 5KIXA 4GNXB 4TVAB 3T13A 1GUWA 5JJLA 4A3MH 3K0YA 4K6DA 3TS0A 3R8BA 5C3WA 4A3GG 4A93B 2M2LA 1SE8A 1EFWA 1WTHA 2LXKA 5C4JB 2JA8G 1PFMA 2J0TD 1IW7C 2BH8A 3H3VI 2QW7A 4QL5A 1B70B 3M4QA 4K2KA 2F1MA 4OX9Q 4DK0A 5FOBB 2K03A 1PXUA 4R4TA 4OX9L 3BYTB 2JA6G 4DR2Q 4IPGA 1YIJA 5IYBG 1RCVD 3I4MB 4DR2L 2VNUD 1EY6A 4LF4Q 1KXLA 1PH9A 4B3SL 1PTOH 4LF4L 4RKBA 1SMXA 2NWGA 1BBUA 3AEVA 4I65A 1WTXA 4RGNA 1CZWA 4K8IA 4LNQA 3RZDB 1SE4A 2YYZA 3HOXB 1SE3A 3OW2A 3SXHA 2JK8A 2NYZD 1K0SA 1BNZA 1JJ2A 1IBMQ 4L6TB 1LYLA 1DGSA 2IHFA 1PA6A 3FPPA 1IBML 1TY2A 3MZ5A 4IURA 3CKIB 2ZXPA 2B2TA 5CR3A 5EKIA 3R93A 1K8GA 1EIHA 3QO2A 3NK9A 1PH7A 1TU2B 2UXCQ 4R4CA 2F4VQ 1Y1VG 3R3OA 4GKKL 3CAMA 1Y8NB 4C3HG 3J7A5 2UXCL 1QNKA 2IL8A 2AQ2B 1OXUA 5JEAH 3IAYA 1HNXQ 1HFNA 1U4RA 4BA1I 1Z47A 5D3DA 2EYFA 2F0NA 1HNXL 2HQEA 1CKNA 4F8MA 2VXWA 3M85A 4XT1B 1LO5D 1XX8A 1FGBD 1AE3A 1TWGH 2Y0SG 5LL6S 5BR8Q 2ZM6L 1I4XA 2A19A 2RCFA 3OOCA 2ZTEA 1IZ6A 3HZXA 2ID0A 5C44B 2B63G 2EYHA 4CJ2C 2I07B 2HHHQ 2A68C 4HIKA 3DXJC 4PQXA 1X3QA 1SROA 2HHHL 3F2BA 4PMCA 1MSHA 2BCOA 4A75A 3PO2G 1GHJA 1G6ZA 3S14B 1RDPD 4DR6Q 3NTIA 1PV4A 1U4MA 4LF9Q 3U4VA 4NP5A 4WJ3M 4JI7Q 3UDFA 4LF9L 3OWEB 2E76C 4JPBW 2HDMA 4R8NA 4JI0L 2PPBC 3ZYYX 4JI7L 2WAQB 1V1PA 4Z9CB 3AYHB 3C3LA 3CD6A 4JV5Q 3M3YB 2IHEA 4WJWA 5E1FA 5LMUQ 2RQXA 3VYTA 1MD2D 1VQOA 2BH2A 1LLRD 5LMUL 4A3BH 1G291 2WIIB 4G4KA 3V2TA 1E24A 4MZ9A 5JJKA 2R7DA 2R93B 4JYAQ 3VYRA 4A93G 3TP5A 2ICIA 4NPSA 4K6LA 3MXNB 3CMAA 2K01A 3KK7A 1TKWB 1ASYA 4PV1C 3FKIH 3IL8A 1G91A 2I5LX 3PQIA 1BCPB 1VMCA 1HXYD 5EPKA 4RMFA 3IFTA 1EIGA 3PIPA 3GTPB 5IGEA 4LK1C 4JI6Q 1L2FA 1RTOA 3PUXA 3D31A 4GKJL 3K81C 4JI6L 1PZJD 1NMGA 2K5QA 4X64Q 4CJ1B 1Y69U 1B50A 1CHPD 3P7JA 3HOVG 1SFOB 4LF8L 1DONA 5DAUA 4DV6L 2NVTB 4DFAA 4DR3Q 3JAMi 2R61A 3H3VC 1VQFA 1RF2D 1C48A 4DR3L 3M4OH 2C5CA 2HCCA 4OWXB 2LFNA 3OTOL 1XMQQ 5E4XA 2UXDL 3H0GH 2XRQD 1CKOA 4DUYQ 1XMQL 3C1FA 4L63B 2AKWB 1EWCA 4FXGC 3M4YA 4BXXH 1GXDC 2ZXOA 1PZKD 1MJEA 1OTCA 4BBRB 3CP0A 3DEPA 1AN8A 4XT3B 2EZVA 2B2YC 1U5KA 1NR2A 1V1OA 3HOZH 4FO2A 2K14A 4PMBA 2WKCA 1SE2A 2UUCQ 4KKUA 2PI2E 2V4DA 1TWCH 1RL2A 1FGUA 1PDQA 2YTYA 3GTGH 2UUCL 1G2SA 2UU9L 3KBXA 1FJGL 4OWTB 2E2HH 4BBSB 3S2HH 1KRSA 3URYA 2EXDA 3CRLC 1AE2A 2JSOA 3KLRA 1HFGA 3S1MH 3GTJB 2K6AA 1I4PA 5LHY1 2OTLA 2F0DA 2I5MX 3CW2C 4K8JA 5C44G 1EEFD 5C3XA 3X3NA 2Q2UA 1X3PA 1NY4A 1SNQA 1F9SA 1YBYA 1YHBA 5A2QL 3RR5A 3BDOA 1F77A 1S5BD 4R4IA 4N8FA 3H09A 1B1ZA 1QUQB 3S16B 3HKZE 4DUZQ 1WYDA 1C7YA 2KCMA 1JJGA 4DF7A 3MA2B 4DUZL 1QVCA 1QWYA 4JC0A 5F2DA 1N32Q 5EJWA 3FP9A 1QNUA 2K5DA 1HRJA 3D6WA 2WAQG 4B3MQ 5KYLA 1NAPA 1HZBA 1LTID 3I72A 3ULLA 4ZAIA 1YI2A 1Y1WG 1N9WA 4MHEA 1YNJD 2QEJC 2K50A 5BN3A 1HQRD 3CHBD 2MQHA 3FMCA 3VDYA 5A2QE 3EFXD 2R93G 4ME5A 5KEEA 2JA7H 4OO1G 2D2CC 3RN5A 2IX0A 2EPBA 2K32A 3KJPA 3MFYA 1N8RC 2HQLA 4P71A 4DR7L 1KNAA 3TEHB 4FF1A 3KOJA 3K59A 4JBJA 2B29A 1VMPA 2MJ8A 4DV2L 2CHBD 1EY5A 4XDXA 3KLWA 4L5QA 4NKLA 3HKSA 3HRZC 4LJZC 4QGUA 1I6HH 2VB3X 4A4IA 1YJNA 3NPPA 5CV9A 3DUZA 3SVMA 2Z6KA 4DK3C 5IP9H 3GTLH 4DV4L 1KNEA 1I50H 3CU7A 1KLGD 3GTQH 3I3CA 4KY7A 4POFA 3QOJA 3SHLA 2ZXRA 3SK5A 4A3KB 3MXGA 3J81E 1TWFB 2K4KA 1VS0A 3AQQA 4QY7A 5LL6X 3Q8DA 4K2LA 2WFWA 1TY0A 5DNFA 1Q1EA 3E6ZX 4OO1I 1YHAA 4BY1H 3I90A 1H9RA 5IGGA 1GVPA 4KKTA 1XTDA 1YNNC 1K83H 3NWSA 3ONAB 4NMZA 5JPNC 1YITA 5M5XB 1RJTA 3PMFA 1X3EA 1TXYA 5IWAQ 1MGSA 1EY0A 3RUZA 5K36G 2ALYB 4LUZA 4IN3A 2L1BA 2MUYA 3I4NB 3KUPA 3D4RA 2WINB 3PO3B 2CVRA 4LF7L 2L55A 2CH4A 1XPUA 1QZHA 4BBSG 1A6XA 1SYFA 2E2IH 4F87A 5C3EB 1EZ8A 3K6OA 4A3EG 1EY9A 3NBHA 1JE5A 1X55A 1PFSA 5E3FA 5C5MA 3N6RA 1Z9FA 4A3JH 2VUMB 5EKLA 2K7VA 5LMNW 4J8QA 1EFID 2Z6BA 3Q6SA 3VR5A 2K5VA 4RG1A 5HGQA 4PZ8A 3RZOH 2DUDA 2F0GA 1E1OA 3GO5A 4Y52H 1R9TH 2OEOA 3TRZA 2F0QA 3G6EA 1IBKQ 5ELDA 3OIPA 2RSNA 1XTCD 2R92B 1IBKL 2PNHA 3KF8B 4LF5Q 2WAQE 1NCVA 2BOSA 1EL0A 4DV7Q 4LF5L 2IX3A 3S17H 2EE1A 4DR5Q 2EYJA 4K5WA 4HMIA 4NXMQ 1SNPA 1U9RA 2PQAB 4KMUC 5FO9B 2DY7A 5IP7H 1VQ4A 4KI0A 4A3DH 4H02A 3A5ZB 3MHBA 2G5DA 1VQMA 3KDFA 1KIXA 4GZYC 2JN4A 2MO0A 1UE6A 1Z6HA 5IY0A 2OXPA 4LUVA 4KLKA 2K5NA 3M7NA 2VZAA 4DXGA 4IUUA 3K5LA 2QGQA 2NBFA 4K5VA 2Z1CA 2JA8B 4KD4A 4IOCA 4Y7NB 3GTOB 3CCMA 1CSQA 4L8JA 1STYA 1JWUD 2JA5H 2JJQA 1X56A 5GAHC 4IFDJ 1IKMA 2QKIC 1JE4A 1PH4A 4JI8Q 2L11A 5AJ3Q 3NBIA 2JA6B 2J4XA 1N33Q 2UUBQ 4JI8L 3S1QH 1WCMH 4LW1A 4FYDA 3J81j 1N33L 2UUBL 4JI1Q 3GTKH 5CMDA 2OTJA 5T1GA 2PQEA 2WB1B 4IUQA 4M8AA 1LUZA 2RHSB 4O42A 5IYDG 4ZRZA 5ELBA 4A3KG 3HOYG 5JOBA 4H13C 4X62Q 2EIFA 2NTTA 2OCEA 3ITPA 1KD1C 3I2ZA 1D6EC 4ALPA 3S15B 1S40A 4X62L 2XWBB 1F9PA 2L9HA 4PMWA 2YTVA 3GV6A 4QJFA 4ZK9B 3AB9A 5CORA 4KV6A 2YU9B 4V190 3J80E 1M4VA 2K33A 4EQ5A 2NVQB 3CC2A 3K5MA 3DLLA 4DV3Q 1Q90A 3EIVA 3TMEA 3NELA 4DR1Q 1JJCB 1KABA 4FF3A 5CGKA 4C3HB 3G6JB 3F2DA 1TQOA 2RCNA 3W1GA 1JB3A 3EN2A 1F2MA 3PO3G 1W3SA 1PTOF 2VL6A 4KY6A 1VF5C 4MTKA 1HZAA 4EVOA 1BDOA 5E4WC 1K8AC 1FNUA 1KL9A 3OWFA 4FP5D 2TMPA 5C3EG 1UEBA 1ML0D 5I6WA 1N34Q 4XIGS 1J5EL 3GTMB 3I4MH 3J7YW 1N34L 4DV0Q 1MJCA 1I3QB 2FFKB 4OIJA 4DV0L 1L0XB 2VUMG 3LGJA 4UY8C 2WKDA 2C35B 4DU9A 1XNQL 4F88A 4LFBQ 4V0BA 3HOXH 4J6HA 5C4ZA 2QDBA 4LFBL 2SEBD 1HA6A 2PCFB 2L0CA 2R92G 3I91A 3KF6B 1AFPA 1TR5A 1TWAB 1EWIA 1GUGA 2F52A 2AUJD 4S3SA 1ENFA 2E75C 2RBMA 3SGIA 2IX1A 4R1JA 4BA2I 1NE3A 5ELCA 5EKKA 1A3TA 2QEXA 2VB2X 3D3RA 1NBWA 3F2UA 1H9SA 4XYOA 2PO4A 1SNDA 5GQOA 2A69D 3EVQA 4KHPL 3D8GA 1OXSC 3PV0A 3OSOA 2SOBA 1DD2A 5GADC 5J1ZA 2SNMA 3VA5A 1ZYRD 4HJ8A 1EYDA 3PIP3 3S2DB 1XPOA 2F0VA 1B3QA 2PZTA 1STNA 5EQ0A 2B8GA 4A3LG 4X3KA 1RTNA 3DWAA 5D65A 1KRTA 1PTOD 1LT6D 4YIJA 1UUPA 4H7BA 1BVSA 2A73B 5IGCA 2OWOA 3PIOA 1PH1A 4TKOB 5FK9C 3FEWX 4B3SQ 3QJYA 4XQJA 3CCVA 1JB7A 2WB1G 1NMFA 4DKAC 1LACA 1RD9D 4JVZA 3HOVB 4YWLA 3VR6A 5FJ8G 3CCQA 3HOUH 1O80A 4RA8A 1Q1BA 5EAYA 4L5SA 3A8KE 3MTSA 5M3MB 1HTPA 1ZEQX 3TZDA 3K5OA 1KDCA 1SNCA 3N52A 4UHVA 2K04A 3L9AX 4GKKQ 2BE5D 2A6ED 4C1NI 2XSCA 2Q2TA 1EIYB 2NVYB 1Y14B 1PH8A 1STGA 2EY6A 1GUNA 1B7YB 1BBWA 4JCVE 2DJGC 1SNOA 4A76A 4GS3A 2RSOA 3ERQA 1VQLA 1K9MC 1TS5A 1H95A 1CQFA 3IFDA 3MWYW 5C4XG 2PI2A 4ZCKA 5CV6A 2JEBI 2O5JC 4P72A 3VR4A 4A3FB 3BVMA 5FKAC 2ZM6Q 3QIAA 3LNNA 1BKBA 2F4IA 1NTGA 1QG7A 3E9HA 2NN6H 4DAYB 1FNWA 2JXMB 3HOWG 3S1NB 4UPAA 3WOEA 3HEJA 1IYUA 1SFOH 1N36L 5TSSA 3AFQA 5JVH3 5I9PA 2WACA 2NVTH 1BO0A 5CBAE 2VS1A 4CDFC 5IYCH 4M1UB 2P5ZX 3KF6A 2EJFC 1NUCA 3K80C 1GM5A 2N3SA 4A3CH 5A35A 3LX0A 4P2CB 4JI0Q 3FPUB 3B6YA 1PZID 3L2PA 3V96A 1GKHA 2RHQB 2EJMA 1Q81C 2KEEA 4B08A 2XN9C 3OW7A 1KLUD 1G2TA 3ND9A 1PTOB 1H9KA 4BBRH 1Y1WB 4PNYA 3NE5B 3CMEA 1ICWA 4GNXA 4OGQC 4DAVA 3MXPA 2BA1A 2Q8IB 5JJZA 3T1YL 1WFQA 2B2WA 2ZTCA 4YCUA 4KTAA 3HFZB 4QB4A 3KFUA 3SE0A 3MFGA 1GUOA 3CQZB 3GTJH 1U0LA 1L1OC 2IW3A 1SJHD 4P75A 1EWHA 2ZT9C 4AH6A 1EQTA 2WB1E 4A3IB 1M90C 1KQSA 1BR9A 3E5SA 1A62A 1F9RA 4GKJQ 2E2JB 1CHQD 2F0FA 4HR7B 4JOIC 1WTVA 3F1ZA 3I70A 4IUVA 4QQBX 4HIOA 1B9MA 1AH9A 3SEBA 4LUOA 2KUMA 4B9XA 4LF8Q 1X32A 4FVMA 2E2DC 3BDCA 1PFNA 4DV6Q 2D0PA 2EOTA 1I5FA 1YNJC 1YZ6A 3FDTA 2F03A 3I4OA 1VQEA 5ELNA 1PVOA 1MIUA 5M3MG 1AZPA 1NNXA 2N55A 3OTOQ 2UXDQ 4X3UA 1A3VA 4HJAA 4GLXA 4OIKA 1OO9B 2JP1A 4JI2L 4FF4A 2YV5A 2PZWA 4DAMA 2L15A 2PYKA 2IT1A 4BY7H 4EGVA 5JAVA 2FINB 1VQKA 3JC66 2D5DA 5EBDA 1UE7A 4UP8A 3PF4A 2A8VA 4FXDA 1EIFA 3T16A 5FLMG 2UU9Q 1FJGQ 2F3WA 4BWGB 2HIXA 1TS2A 3R2IA 4RKLA 2Y0SE 3HP3A 1O7LA 5BN4A 4JW0A 1TWHH 4DAPA 2PMZB 2NVXB 1I4QA 4LWCA 3SK4A 4A3FG 4C3IH 5IIFA 2KCCA 3A8IE 4A3EB 4ODGA 5K5PA 1OXXK 1DYQA 3A56A 4IPHA 3K0XA 5EPLA 1DZ1A 4A3MG 4ZQ3A 2CWPA 1SMYD 4RCOA 1EU4A 1TWFH 2K75A 3P1HA 1T5XD 2JE6I 3F8TA 1LT5D 3G7LA 4Q5VA 2VQFL 4GN5A 4CDCC 3X3MA 1WTPA 2N88A 2EXZA 5C5LA 1KDBA 3FKIB 1SEBD 4ID6A 3J81c 2A74C 4JI4Q 5DEHA 1X9NA 4JI4L 3EJIA 5M5XH 4O1NA 2O2LD 1Q46A 3NQIA 4TRDA 1A2UA 1HPCA 1X6OA 1VQ8A 3OHXC 2LY7A 4CKCA 4G7HC 3Q23A 1QVGA 2IWHA 4C1NK 3KLSX 4DK6C 3CXCA 2X6LA 1V43A 3NTHA 3I4NH 1QCBD 5FLXE 2ICEC 2L5TA 1I4RA 4C2MH 3NUCA 4ME3A 4G57A 3M4OB 3Q24A 4DR7Q 1D1KA 3A55A 3PCOB 2F0WA 3UE1A 4GLAC 3J81L 1DCZA 4P74A 4EQOA 2XNAC 3MXNA 2EYMA 3L3OC 4DV2Q 1YNXA 3PSIA 2B2TC 3H0GB 3ULJA 1ENAA 1DJRD 1CZGA 3U4ZA 1K3RA 4IFDH 4C3JB 1EY4A 1Z7TA 3QG1A 3NEMA 3T53B 4A3IG 1XPRA 3F2CA 4QUFA 2EYLA 4R8IA 1CT1D 1HA5A 4DV4Q 3RLNA 2AUKA 2RDGA 3HOZB 5JEAG 5JVG3 4U673 2KCTA 1V8QA 4HCEA 2D0OA 2G9DA 4LF6L 3H3VH 4P73A 1UE1A 2SDFA 5M3FB 2UXBQ 3S24A 2B2VC 3GDEA 2UXBL 2N49A 2Z0SA 3HOYB 2E2HB 2K28A 1TVXA 2NB0A 2XWJB 1HR0Q 3S1MB 1LTTD 1C9OA 1HR0L 1LTLA 3IRBA 2F0KA 3ERSX 1KTKA 4OXPA 3RD4A 2GN5A 1DM0B 4IPDA 5M5YB 1Y8OB 2CWAA 3DM1A 1KAAA 2KHSA 3H6MA 3CF5A 1IL2A 2XTIA 2SNSA 3BZDB 4LMQD 1PRTF 4G7OC 4RWSC 1KAWA 4IUNA 2LXJA 3KYHC 4A3GH 2JYOA 2KVMA 3JAME 1S5DD 5IE8A 1O78A 2JA8H 1I4HA 4LF7Q 2KQ3A 4PZ6A 4Y7NH 3GTOH 2EYOA 1L1OB 2KA7A 1SYGA 1X65A 5BN5A 1EEID 1VQBA 1M8AA 1LTGD 1XYIA 3FVQA 2XRSD 2JA6H 5GROA 1B53A 5IYBH 5DLQE 4A3BG 2VW9A 2HUGA 1S5ED 2WP8J 3LWUA 2D62A 1X54A 1MSGA 3KBGA 3VR2A 1KHIA 2RKSA 2WV6D 2ATWA 4OELB 5FJ8H 4X65Q 3S15H 1O7IA 1G8ZD 5EBCA 5EPJA 1LM0A 3TN2A 4X65L 1QUQA 5M5WH 1D8LA 1DOMA 3FKIG 1HUNA 5CV8A 3G4SA 1CI3M 2YU9H 2LS01 1HCZA 2N8NA 3MAQA 3GTLB 1JMCA 1PYWD 1I50B 1LT3D 1C4QA 1Y1VH 2CW0D 3T1HL 2BDOA 5I2XA 4C3HH 2PW5A 3J80c 1PH2A 2OF1A 1SLJA 4JK1C 4X3TA 1SYCA 1VQGA 1PRTD 3EROA 3PIO3 3CCUA 3C1EA 2A6HD 5IGFA 4HSVA 1ILPA 1SYBA 1OXVA 1EYAA 1HZ9A 3U9OA 1V1QA 1T5EA 3H0GG 4N9TA 5LMNL 1FD7D 2KHIA 2TSSA 4C3JG 1A63A 4RAUC 5M9OA 1I3QH 4I7ZC 4RH6A 4BXXG 2L4NA 2Q2IA 2B63H 2F3IA 4EQNA 3J80L 3HOZG 1HUMA 2LMCB 1CSPA 5M3FG 2F3VA 3PO2H 1HNZQ 1JOKA 2K5WA 3KJOA 1TWAH 3S1RH 1D7QA 4CHTB 1HNZL 3NSWA 4IUPA 2A69C 4KJOA 1SSOA 4ZUIA 4AIMA 2E2IB 1O7YA 3C46A 3H94A 1ZYRC 2KBNA 1SRUA 4IJHA 1J6QA 5COYA 3CC4A 1RKNA 4A3JB 4KKSA 1B9NA 1I4GA 3RZOB 4CKBA 1R9TB 1PTOC 2NZOA 1PYBA 3RLOA 2OT2A 2B2UC 3V05A 1Y8PB 1U4LA 4YY3Q 4X66L 4HJ7A 4A93H 3DWPA 5CBEE 3S2DH 1A15A 3EA6A 3I7FA 5GAGC 4YY3L 4FF2A 5C4JH 1TIID 1M1KC 2FHTA 4CGYB 1OXTA 2RDHA 3S17B 1IXRA 1SBBB 1R4PB 1J9OA 1II3A 2RVLA 2EY2A 2IPKD 3BDLA 1JOOA 5C4XB 1S4ZA 2K52A 4A3DB 1VQIA 3G48A 4OONA 2QILA 2F0JA 1J5EQ 1U4PA 3PUYA 2E74C 1TT2A 3H15A 1GUTA 3P20A 1E0BA 2PW7A 4JOIA 1VQPA 2R7ZB 1XXGA 3K7AB 2JA7G 3HOWB 1XNQQ 2EDGA 1MBYA 3HOVH 4KHVA 1CKNB 3KLSA 3RZDH 3OMGA 2EVBA 2VQEQ 1GJXA 1XJVA 2I0QA 2BE5C 2VQEL 1HTLD 3KF8A 4KD3A 4MTNA 4HTHA 2B8FA 1ICFB 3C2PA 4EQPA 4POGA 3CC7A 4OHJA 2FXQA 2MHVA 2LKVA 4ABNA 5C0XG 4JI5Q 3K58A 4QIWB 2PQAA 1A2TA 4JI5L 4IQZA 1WCMB 2Z6KC 4ZKBB 3S1QB 3CCLA 5CC4A 1SJED 5IP9G 1FVIA 2LSSA 3GTKB 1BCPF 1IYJB 4K5XA 4KHPQ 4R4QA 2NVYH 2B2YA 1K0RA 2KECA 1ET9A 1W6KA 1IBLQ 4TQUS 3P75A 5IGDA 1PH6A 1LT4D 3AFPA 2HIVA 3A7AB 4E6IA 1QE6A 5FLMH 1IBLL 4QF4A 3PUWA 4IZ8A 2BA0A 4BY1G 2DN8A 1V1PB 3E0JA 4DNRB 2YTXA 3TDQA 3TP6A 2BDNA 5T1IA 1VQ5A 4AYBB 1ILQA 1T9HA 4N9PA 2QDLA 1JT8A 1TS3A 5CV5A 2IJ0A 4Q0FA 4ZUJA 5NUCA 4J1MA 1VQCA 4XYQA 2EYPA 4HJ9A 5C0XI 3S1NH 5C44H 4DV5Q 2ZTDA 1BXTA 2PNRC 1ZKOA 4DV5L 1L0WA 2N78A 4GOPC 1S3OA 1SN8A 3QR8A 3VYUA 3PUZA 1IYVA 5IT9E 3S14H 3W1BA 1S72A 4HN7A 4DXFA 1E1TA 2H1EA 1UE5A 1G51A 4JG2A 1WOCA 3CCRA 3NP8A 4RFBA 3M3YH 1RODA 1STAA 4A3JG 1Y1WH 1KDAA 2AQ1B 2NUCA 2K1BA 3ICEA 4O0AA 5D14A 2QA4A 1VQ7A 4UAIA 3TREA 2R93H 4UDUC 4GN3B 4OWWB 4OO1H 1BCPD 1NR4A 1QILA 2KHJA 3CQZH 3AU7A 1EOVA 4PG3A 3H91A 2O4XA 3PF5A 3I73A 1S5CD 3TBIB 3QOLA
chains in the Genus database with same CATH topology
2DJFC 4CDFC 4CDEC 4OELB 4CDCC 4CDDC 1MHWC 1K3BC 2DJGC 1ICFB 4OEMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJF C;  4CDF C;  4CDE C;  4OEL B;  4CDC C;  4CDD C;  1MHW C;  1K3B C;  2DJG C;  1ICF B;  4OEM B; 
#chains in the Genus database with same CATH topology
 3DM3 A;  5CV7 A;  2Q8T A;  5IP7 G;  2ENB A;  1BBX C;  4A3D G;  1STH A;  5FO8 B;  2HT1 A;  3A54 A;  1BF4 A;  2DNC A;  4A3I H;  1LTB D;  1ENC A;  2KCN A;  2F4V L;  4OL7 A;  2E2J H;  3L7Z C;  2JEA I;  3CPF A;  3GTP H;  1PH3 A;  5IOD A;  2F0M A;  1NJI C;  2R7Z G;  4A3M B;  1N36 Q;  2EY1 A;  3GQB A;  1EYG A;  3STB D;  1JR0 D;  2B2V A;  3UDX A;  4K0K Q;  2XIW A;  4RGO S;  3G71 A;  3TSS A;  1JC7 A;  4AQY Q;  4K0K L;  4NXN Q;  4AQY L;  2ZJR A;  1Q3L A;  1H9J A;  4NXN L;  4IUT A;  5ISR A;  2JA5 G;  2F0T A;  4CBV A;  1D5M C;  5BR8 L;  4B9W A;  2HCI A;  3W3A A;  4DNI A;  1WCM G;  1CK1 A;  1IW7 D;  2JA9 A;  2NTS A;  3DWQ A;  5K36 H;  1ONL A;  2G9H D;  3SR1 A;  3CRK C;  1X3G A;  3I8Z A;  1PYS B;  4XXE A;  3T1Y Q;  1HZC A;  3HOU B;  4DR6 L;  3A74 A;  2MPM A;  3BS1 A;  3HKZ G;  4KHZ A;  1SDF A;  1BOS A;  4BBS H;  1B8A A;  3DMU A;  2NVX H;  4WJ4 A;  1SMY C;  4AYB G;  2Q2H A;  4JV5 L;  1WI5 A;  1I6V C;  3PGZ A;  4A3E H;  2ZJQ A;  4MN3 A;  1D5X C;  3BZC A;  4OEM B;  1PMR A;  3D0F A;  4KN4 C;  4JYA L;  3TQY A;  4LFA Q;  3HS0 C;  1S5F D;  2HD3 A;  2E5L Q;  3UDI A;  4LFA L;  1B2T A;  2E5L L;  3J81 i;  4H0L C;  3QWN A;  4JI3 Q;  1STE A;  2A5H A;  3S16 H;  4B3R Q;  4JI3 L;  2F0I A;  2MNA A;  1HH2 P;  4ZYS A;  4B3R L;  1H9M A;  2NZ1 D;  4WFN 3;  1IHZ A;  1TWG B;  3FRP B;  4IOA A;  3E3X A;  3OMC A;  3I4M G;  4FXK C;  4HJ5 A;  5ELO A;  3J7A F;  2V1C C;  4YWK A;  5L37 A;  1EQQ A;  2RA4 A;  4JI2 Q;  2M9V A;  2GA4 B;  1E2Z A;  5J3B A;  4X64 L;  1EZ6 A;  1K28 A;  2B39 A;  5C6A A;  4MNO A;  1I94 Q;  1QJO A;  5KYI A;  3E0E A;  3HOX G;  3U58 A;  1QZG A;  1I94 L;  3W2D A;  1HQM C;  1VQ6 A;  1CKM A;  1WTO A;  1GHK A;  1C8C A;  5FLX c;  4YCV A;  2K05 A;  2FJ2 A;  1DOK A;  4ZKC B;  1E2W A;  2A68 D;  4C3J H;  2OQ0 A;  4DUY L;  2CFM A;  1WTQ A;  3CPW A;  5CV4 A;  4G7Z C;  3VR3 A;  3WWV A;  4DN4 M;  3GD7 A;  1UNS A;  1ZXT A;  4A3B B;  1YJW A;  4DK1 A;  5JEA J;  1AEX A;  1E22 A;  4DAY A;  1E2V A;  2JQO A;  3UI2 A;  2Q8R E;  2F0P A;  4GOP B;  1AP0 A;  5M3F H;  4RHS A;  5IYD H;  4A3K H;  3HOY H;  3E9I A;  2VQF Q;  3NQT A;  4DNT B;  5FLX L;  1CQV A;  3ZJY C;  4O2D A;  3OPO A;  1VQ9 A;  4QIW E;  3NBH B;  4CDE C;  1PLF A;  3MXU A;  5I9O A;  1QB5 D;  1A3U A;  1JIC A;  4PZ7 A;  2GVB A;  4NDX A;  2KED A;  5M5Y H;  3EQL C;  1D1I A;  5AFW A;  5EGT A;  1J8I A;  2KEN A;  3EBE A;  3A8J E;  2B2U A;  5HUR A;  1GOZ A;  1SAP A;  4RGM A;  3HOU G;  2XVS A;  4AYB E;  2ASB A;  3PO3 H;  2F0O A;  5ELF A;  3T4A C;  2EY5 A;  3BG3 A;  1ESF A;  2OQK A;  4KK7 A;  2D9U A;  3JAM c;  1BUV T;  5KNC A;  1N32 L;  3ND8 A;  4RHR A;  3SK8 A;  4B3M L;  1WVL A;  5J22 A;  4X3S A;  4R9W A;  3BZK A;  5C3E H;  3KDF B;  1HR0 W;  1VQA A;  3Q22 A;  1Q86 C;  1AW7 A;  1CA6 A;  2H5X A;  3I56 A;  2KOL A;  3K7U C;  4BY7 B;  1WJJ A;  4IPC A;  5KGU A;  2VUM H;  4H44 C;  3M7G A;  4HAE A;  1P16 A;  4U68 A;  1MKH A;  4NW2 A;  3S9W A;  2ES2 A;  1JCK B;  3J7A V;  1PHJ A;  3DHQ A;  4LF6 Q;  3L0O A;  1HHV A;  1LTS D;  1BQQ T;  1TWC B;  3GTG B;  2R7F A;  3J7Z C;  4DA2 A;  2R92 H;  3CCE A;  5I4D A;  2AMC B;  2CW0 C;  3K57 A;  1TWH B;  3JAM L;  4LAA A;  1STB A;  1FYC A;  3S2H B;  2GVA A;  1VF7 A;  2X6G A;  5C0X H;  3TP8 A;  1B44 D;  4DR4 Q;  4C3I B;  2DGY A;  1P8L A;  1R4Q B;  3BVZ A;  4DR4 L;  2EQS A;  1PRT C;  3SDZ A;  2VY3 A;  2RDF A;  3J80 i;  1AZQ A;  2NN6 G;  2O5I C;  2A6H C;  4QCL A;  4CJ0 B;  2I46 A;  2UUA Q;  1VDZ A;  1IKL A;  1SYD A;  1SYE A;  2F0E A;  4K14 A;  2UUA L;  1K8M A;  3RLF A;  1VCI A;  2B3G A;  3TZU A;  1DOL A;  2QCP X;  3I4L A;  5IYC G;  3MEF A;  3VYS A;  1JQY D;  4L5R C;  4QMG A;  1CM9 A;  4HSP A;  1JWS D;  1W2B A;  4A3C G;  4GN4 B;  2FMC A;  1EU3 A;  2F0L A;  4A3L H;  5JJI A;  4R4O A;  3OIQ A;  3A0J A;  1EY8 A;  5ELE A;  4HIM A;  3RNU A;  4XQN A;  4DV1 Q;  1D5Z C;  5IWA L;  5DM6 3;  4DV1 L;  4BBR G;  1JWM D;  4C56 C;  1Q8K A;  4X6A H;  2AWO A;  1L0Y B;  2RF4 A;  3HGB A;  4IO9 A;  4GNX C;  2IY5 B;  4FDB A;  2NN6 I;  5I2Y A;  2ZJP A;  5J39 A;  4GOP A;  4B3T Q;  2B2W C;  2JA7 B;  1X3F A;  1G6P A;  4C2M B;  4B3T L;  2DY8 A;  4MIU A;  2K5H A;  4EX5 A;  3CCS A;  2F0U A;  3WOF A;  5KNB A;  3BU2 A;  4RCN A;  1WTR A;  3CCJ A;  4DPG A;  1F2Z A;  2E8G A;  3PUV A;  1FL0 A;  5GAE C;  2F0S A;  2R3Z A;  3I55 A;  1WTW A;  1VQJ A;  1YVC A;  3TS2 A;  3NTK A;  1DXM A;  1I6H B;  2NVQ H;  4FNF A;  5FO7 B;  1ASZ A;  1HJP A;  1ET6 A;  1KC8 C;  1C0A A;  1LV9 A;  4APV A;  3T1H Q;  4IAL A;  3GTQ B;  1D2B A;  3D4D A;  2F0H A;  1GD7 A;  2R6G A;  1EYC A;  3TP7 A;  3W5O A;  4I7A A;  1O7Z A;  4XQQ A;  5G3L F;  2M00 A;  3RMH A;  3BVG A;  4DV7 L;  4KY5 A;  1XNR Q;  4YCW A;  4DR5 L;  1Q8I A;  5IOC A;  4BY1 B;  5C4X H;  1XNR L;  2CH4 W;  4NXM L;  3NWT A;  4ULL A;  4KJN A;  1MHW C;  1W6J A;  3ER0 A;  5LMN Q;  1K83 B;  1LTA D;  2C9O A;  1H9S B;  3AMU A;  3U50 C;  3GTM H;  1YJ9 A;  2AQ3 B;  1LAB A;  4BY7 G;  1NSN S;  3ULP A;  2R7Z H;  1VQN A;  1WD1 A;  1QOH A;  2HDL A;  3K7A H;  2AHO B;  3HOW H;  1YHQ A;  3UDG A;  4JBK A;  4TSS A;  1A8V A;  4A3G B;  1RHP A;  1YNN D;  3QB3 A;  1Q82 C;  3SK6 A;  2QF7 A;  1V9P A;  1K3B C;  5IGB A;  1SXT A;  3RN2 A;  4HED A;  5JPM C;  3T51 B;  3GP7 A;  1B3A A;  1WD0 A;  1EOT A;  2MGS A;  5KND A;  4ILW A;  2CQA A;  1K73 C;  5C0X J;  3R2T A;  4C3I G;  4JBM A;  1Q12 A;  5AJ3 L;  1SNM A;  1TS4 A;  4HID A;  2X69 A;  5CYU A;  4JBW A;  5D3I B;  4JI1 L;  3BYY B;  1SR3 A;  3MC0 B;  1Q7Y C;  2MO1 A;  2J7Z A;  4N8X 1;  3NHH A;  3IKJ A;  2KJX A;  5KRU A;  5HY6 A;  1JOR A;  4HCS A;  4X66 Q;  4XTC S;  2DJF C;  3FHW A;  5M5W B;  1E3P A;  1FNV A;  1HNW Q;  2PMZ E;  2MFI A;  1HNW L;  3K5N A;  1ESR A;  1JOQ A;  1L1O A;  2Z4H A;  2Z9H A;  1EUJ A;  1XMO Q;  2EJG C;  3O13 A;  1CTM A;  5G3L D;  1B4O A;  1XMO L;  1MI2 A;  4DV3 L;  5H1S E;  4UP7 A;  3M9B A;  1Y1V B;  4DR1 L;  4IJL A;  2A1A A;  1EQR A;  4ZLT F;  3I4N G;  1CA5 A;  1UWV A;  1FR3 A;  1PH5 A;  3HG9 A;  3WDN A;  5E7N A;  3MEH A;  4DGZ A;  2AWN A;  4NB3 A;  2CKZ B;  5C4H A;  3T56 B;  1CUK A;  1F2Y A;  1VQH A;  2I5H A;  5I6Y A;  2Z8L A;  3VA7 A;  4CKE A;  2L12 A;  4YHH Q;  1EY7 A;  2Y0S B;  4WOR A;  4YHH L;  1GO3 E;  2JA5 B;  5M3M H;  1PFB A;  2A6E C;  3U9S A;  5IT9 c;  1BCP C;  4IFD G;  4YWM A;  2PZU A;  1PRT B;  1IL8 A;  1YEZ A;  3NXW A;  4F7X A;  1GUS A;  3Q0A A;  4J15 A;  1UAP A;  3NEN A;  3D6C A;  4KN7 C;  3LWE A;  1VQD A;  2B63 B;  2CQO A;  4GLV B;  2MP1 A;  1QVF A;  2CCZ A;  2XGT A;  4UP9 A;  1CFM A;  4LFC Q;  1EQV A;  4LFC L;  3PO2 B;  4CDD C;  2H4O A;  4BS9 A;  3A5U A;  3S1R B;  4HMJ A;  1UEA B;  5DM7 3;  3BJU A;  1F2L A;  3MVV A;  3HKZ B;  4QUC A;  3A7L A;  4RGT A;  3UE0 A;  1LTR D;  1XWE A;  3OYY A;  2Z4I A;  1F9Q A;  5IT9 L;  3STB C;  2FMM A;  3M4P A;  3D4W A;  2DNE A;  1RIP A;  4WRD A;  4A3F H;  3K8A A;  2NZH A;  1K8O A;  3GV3 A;  1A0I A;  4L5T A;  3DEO A;  5HGT A;  1E7Z A;  4IFD I;  5KIX A;  4GNX B;  4TVA B;  3T13 A;  1GUW A;  5JJL A;  4A3M H;  3K0Y A;  4K6D A;  3TS0 A;  3R8B A;  5C3W A;  4A3G G;  4A93 B;  2M2L A;  1SE8 A;  1EFW A;  1WTH A;  2LXK A;  5C4J B;  2JA8 G;  1PFM A;  2J0T D;  1IW7 C;  2BH8 A;  3H3V I;  2QW7 A;  4QL5 A;  1B70 B;  3M4Q A;  4K2K A;  2F1M A;  4OX9 Q;  4DK0 A;  5FOB B;  2K03 A;  1PXU A;  4R4T A;  4OX9 L;  3BYT B;  2JA6 G;  4DR2 Q;  4IPG A;  1YIJ A;  5IYB G;  1RCV D;  3I4M B;  4DR2 L;  2VNU D;  1EY6 A;  4LF4 Q;  1KXL A;  1PH9 A;  4B3S L;  1PTO H;  4LF4 L;  4RKB A;  1SMX A;  2NWG A;  1BBU A;  3AEV A;  4I65 A;  1WTX A;  4RGN A;  1CZW A;  4K8I A;  4LNQ A;  3RZD B;  1SE4 A;  2YYZ A;  3HOX B;  1SE3 A;  3OW2 A;  3SXH A;  2JK8 A;  2NYZ D;  1K0S A;  1BNZ A;  1JJ2 A;  1IBM Q;  4L6T B;  1LYL A;  1DGS A;  2IHF A;  1PA6 A;  3FPP A;  1IBM L;  1TY2 A;  3MZ5 A;  4IUR A;  3CKI B;  2ZXP A;  2B2T A;  5CR3 A;  5EKI A;  3R93 A;  1K8G A;  1EIH A;  3QO2 A;  3NK9 A;  1PH7 A;  1TU2 B;  2UXC Q;  4R4C A;  2F4V Q;  1Y1V G;  3R3O A;  4GKK L;  3CAM A;  1Y8N B;  4C3H G;  3J7A 5;  2UXC L;  1QNK A;  2IL8 A;  2AQ2 B;  1OXU A;  5JEA H;  3IAY A;  1HNX Q;  1HFN A;  1U4R A;  4BA1 I;  1Z47 A;  5D3D A;  2EYF A;  2F0N A;  1HNX L;  2HQE A;  1CKN A;  4F8M A;  2VXW A;  3M85 A;  4XT1 B;  1LO5 D;  1XX8 A;  1FGB D;  1AE3 A;  1TWG H;  2Y0S G;  5LL6 S;  5BR8 Q;  2ZM6 L;  1I4X A;  2A19 A;  2RCF A;  3OOC A;  2ZTE A;  1IZ6 A;  3HZX A;  2ID0 A;  5C44 B;  2B63 G;  2EYH A;  4CJ2 C;  2I07 B;  2HHH Q;  2A68 C;  4HIK A;  3DXJ C;  4PQX A;  1X3Q A;  1SRO A;  2HHH L;  3F2B A;  4PMC A;  1MSH A;  2BCO A;  4A75 A;  3PO2 G;  1GHJ A;  1G6Z A;  3S14 B;  1RDP D;  4DR6 Q;  3NTI A;  1PV4 A;  1U4M A;  4LF9 Q;  3U4V A;  4NP5 A;  4WJ3 M;  4JI7 Q;  3UDF A;  4LF9 L;  3OWE B;  2E76 C;  4JPB W;  2HDM A;  4R8N A;  4JI0 L;  2PPB C;  3ZYY X;  4JI7 L;  2WAQ B;  1V1P A;  4Z9C B;  3AYH B;  3C3L A;  3CD6 A;  4JV5 Q;  3M3Y B;  2IHE A;  4WJW A;  5E1F A;  5LMU Q;  2RQX A;  3VYT A;  1MD2 D;  1VQO A;  2BH2 A;  1LLR D;  5LMU L;  4A3B H;  1G29 1;  2WII B;  4G4K A;  3V2T A;  1E24 A;  4MZ9 A;  5JJK A;  2R7D A;  2R93 B;  4JYA Q;  3VYR A;  4A93 G;  3TP5 A;  2ICI A;  4NPS A;  4K6L A;  3MXN B;  3CMA A;  2K01 A;  3KK7 A;  1TKW B;  1ASY A;  4PV1 C;  3FKI H;  3IL8 A;  1G91 A;  2I5L X;  3PQI A;  1BCP B;  1VMC A;  1HXY D;  5EPK A;  4RMF A;  3IFT A;  1EIG A;  3PIP A;  3GTP B;  5IGE A;  4LK1 C;  4JI6 Q;  1L2F A;  1RTO A;  3PUX A;  3D31 A;  4GKJ L;  3K81 C;  4JI6 L;  1PZJ D;  1NMG A;  2K5Q A;  4X64 Q;  4CJ1 B;  1Y69 U;  1B50 A;  1CHP D;  3P7J A;  3HOV G;  1SFO B;  4LF8 L;  1DON A;  5DAU A;  4DV6 L;  2NVT B;  4DFA A;  4DR3 Q;  3JAM i;  2R61 A;  3H3V C;  1VQF A;  1RF2 D;  1C48 A;  4DR3 L;  3M4O H;  2C5C A;  2HCC A;  4OWX B;  2LFN A;  3OTO L;  1XMQ Q;  5E4X A;  2UXD L;  3H0G H;  2XRQ D;  1CKO A;  4DUY Q;  1XMQ L;  3C1F A;  4L63 B;  2AKW B;  1EWC A;  4FXG C;  3M4Y A;  4BXX H;  1GXD C;  2ZXO A;  1PZK D;  1MJE A;  1OTC A;  4BBR B;  3CP0 A;  3DEP A;  1AN8 A;  4XT3 B;  2EZV A;  2B2Y C;  1U5K A;  1NR2 A;  1V1O A;  3HOZ H;  4FO2 A;  2K14 A;  4PMB A;  2WKC A;  1SE2 A;  2UUC Q;  4KKU A;  2PI2 E;  2V4D A;  1TWC H;  1RL2 A;  1FGU A;  1PDQ A;  2YTY A;  3GTG H;  2UUC L;  1G2S A;  2UU9 L;  3KBX A;  1FJG L;  4OWT B;  2E2H H;  4BBS B;  3S2H H;  1KRS A;  3URY A;  2EXD A;  3CRL C;  1AE2 A;  2JSO A;  3KLR A;  1HFG A;  3S1M H;  3GTJ B;  2K6A A;  1I4P A;  5LHY 1;  2OTL A;  2F0D A;  2I5M X;  3CW2 C;  4K8J A;  5C44 G;  1EEF D;  5C3X A;  3X3N A;  2Q2U A;  1X3P A;  1NY4 A;  1SNQ A;  1F9S A;  1YBY A;  1YHB A;  5A2Q L;  3RR5 A;  3BDO A;  1F77 A;  1S5B D;  4R4I A;  4N8F A;  3H09 A;  1B1Z A;  1QUQ B;  3S16 B;  3HKZ E;  4DUZ Q;  1WYD A;  1C7Y A;  2KCM A;  1JJG A;  4DF7 A;  3MA2 B;  4DUZ L;  1QVC A;  1QWY A;  4JC0 A;  5F2D A;  1N32 Q;  5EJW A;  3FP9 A;  1QNU A;  2K5D A;  1HRJ A;  3D6W A;  2WAQ G;  4B3M Q;  5KYL A;  1NAP A;  1HZB A;  1LTI D;  3I72 A;  3ULL A;  4ZAI A;  1YI2 A;  1Y1W G;  1N9W A;  4MHE A;  1YNJ D;  2QEJ C;  2K50 A;  5BN3 A;  1HQR D;  3CHB D;  2MQH A;  3FMC A;  3VDY A;  5A2Q E;  3EFX D;  2R93 G;  4ME5 A;  5KEE A;  2JA7 H;  4OO1 G;  2D2C C;  3RN5 A;  2IX0 A;  2EPB A;  2K32 A;  3KJP A;  3MFY A;  1N8R C;  2HQL A;  4P71 A;  4DR7 L;  1KNA A;  3TEH B;  4FF1 A;  3KOJ A;  3K59 A;  4JBJ A;  2B29 A;  1VMP A;  2MJ8 A;  4DV2 L;  2CHB D;  1EY5 A;  4XDX A;  3KLW A;  4L5Q A;  4NKL A;  3HKS A;  3HRZ C;  4LJZ C;  4QGU A;  1I6H H;  2VB3 X;  4A4I A;  1YJN A;  3NPP A;  5CV9 A;  3DUZ A;  3SVM A;  2Z6K A;  4DK3 C;  5IP9 H;  3GTL H;  4DV4 L;  1KNE A;  1I50 H;  3CU7 A;  1KLG D;  3GTQ H;  3I3C A;  4KY7 A;  4POF A;  3QOJ A;  3SHL A;  2ZXR A;  3SK5 A;  4A3K B;  3MXG A;  3J81 E;  1TWF B;  2K4K A;  1VS0 A;  3AQQ A;  4QY7 A;  5LL6 X;  3Q8D A;  4K2L A;  2WFW A;  1TY0 A;  5DNF A;  1Q1E A;  3E6Z X;  4OO1 I;  1YHA A;  4BY1 H;  3I90 A;  1H9R A;  5IGG A;  1GVP A;  4KKT A;  1XTD A;  1YNN C;  1K83 H;  3NWS A;  3ONA B;  4NMZ A;  5JPN C;  1YIT A;  5M5X B;  1RJT A;  3PMF A;  1X3E A;  1TXY A;  5IWA Q;  1MGS A;  1EY0 A;  3RUZ A;  5K36 G;  2ALY B;  4LUZ A;  4IN3 A;  2L1B A;  2MUY A;  3I4N B;  3KUP A;  3D4R A;  2WIN B;  3PO3 B;  2CVR A;  4LF7 L;  2L55 A;  2CH4 A;  1XPU A;  1QZH A;  4BBS G;  1A6X A;  1SYF A;  2E2I H;  4F87 A;  5C3E B;  1EZ8 A;  3K6O A;  4A3E G;  1EY9 A;  3NBH A;  1JE5 A;  1X55 A;  1PFS A;  5E3F A;  5C5M A;  3N6R A;  1Z9F A;  4A3J H;  2VUM B;  5EKL A;  2K7V A;  5LMN W;  4J8Q A;  1EFI D;  2Z6B A;  3Q6S A;  3VR5 A;  2K5V A;  4RG1 A;  5HGQ A;  4PZ8 A;  3RZO H;  2DUD A;  2F0G A;  1E1O A;  3GO5 A;  4Y52 H;  1R9T H;  2OEO A;  3TRZ A;  2F0Q A;  3G6E A;  1IBK Q;  5ELD A;  3OIP A;  2RSN A;  1XTC D;  2R92 B;  1IBK L;  2PNH A;  3KF8 B;  4LF5 Q;  2WAQ E;  1NCV A;  2BOS A;  1EL0 A;  4DV7 Q;  4LF5 L;  2IX3 A;  3S17 H;  2EE1 A;  4DR5 Q;  2EYJ A;  4K5W A;  4HMI A;  4NXM Q;  1SNP A;  1U9R A;  2PQA B;  4KMU C;  5FO9 B;  2DY7 A;  5IP7 H;  1VQ4 A;  4KI0 A;  4A3D H;  4H02 A;  3A5Z B;  3MHB A;  2G5D A;  1VQM A;  3KDF A;  1KIX A;  4GZY C;  2JN4 A;  2MO0 A;  1UE6 A;  1Z6H A;  5IY0 A;  2OXP A;  4LUV A;  4KLK A;  2K5N A;  3M7N A;  2VZA A;  4DXG A;  4IUU A;  3K5L A;  2QGQ A;  2NBF A;  4K5V A;  2Z1C A;  2JA8 B;  4KD4 A;  4IOC A;  4Y7N B;  3GTO B;  3CCM A;  1CSQ A;  4L8J A;  1STY A;  1JWU D;  2JA5 H;  2JJQ A;  1X56 A;  5GAH C;  4IFD J;  1IKM A;  2QKI C;  1JE4 A;  1PH4 A;  4JI8 Q;  2L11 A;  5AJ3 Q;  3NBI A;  2JA6 B;  2J4X A;  1N33 Q;  2UUB Q;  4JI8 L;  3S1Q H;  1WCM H;  4LW1 A;  4FYD A;  3J81 j;  1N33 L;  2UUB L;  4JI1 Q;  3GTK H;  5CMD A;  2OTJ A;  5T1G A;  2PQE A;  2WB1 B;  4IUQ A;  4M8A A;  1LUZ A;  2RHS B;  4O42 A;  5IYD G;  4ZRZ A;  5ELB A;  4A3K G;  3HOY G;  5JOB A;  4H13 C;  4X62 Q;  2EIF A;  2NTT A;  2OCE A;  3ITP A;  1KD1 C;  3I2Z A;  1D6E C;  4ALP A;  3S15 B;  1S40 A;  4X62 L;  2XWB B;  1F9P A;  2L9H A;  4PMW A;  2YTV A;  3GV6 A;  4QJF A;  4ZK9 B;  3AB9 A;  5COR A;  4KV6 A;  2YU9 B;  4V19 0;  3J80 E;  1M4V A;  2K33 A;  4EQ5 A;  2NVQ B;  3CC2 A;  3K5M A;  3DLL A;  4DV3 Q;  1Q90 A;  3EIV A;  3TME A;  3NEL A;  4DR1 Q;  1JJC B;  1KAB A;  4FF3 A;  5CGK A;  4C3H B;  3G6J B;  3F2D A;  1TQO A;  2RCN A;  3W1G A;  1JB3 A;  3EN2 A;  1F2M A;  3PO3 G;  1W3S A;  1PTO F;  2VL6 A;  4KY6 A;  1VF5 C;  4MTK A;  1HZA A;  4EVO A;  1BDO A;  5E4W C;  1K8A C;  1FNU A;  1KL9 A;  3OWF A;  4FP5 D;  2TMP A;  5C3E G;  1UEB A;  1ML0 D;  5I6W A;  1N34 Q;  4XIG S;  1J5E L;  3GTM B;  3I4M H;  3J7Y W;  1N34 L;  4DV0 Q;  1MJC A;  1I3Q B;  2FFK B;  4OIJ A;  4DV0 L;  1L0X B;  2VUM G;  3LGJ A;  4UY8 C;  2WKD A;  2C35 B;  4DU9 A;  1XNQ L;  4F88 A;  4LFB Q;  4V0B A;  3HOX H;  4J6H A;  5C4Z A;  2QDB A;  4LFB L;  2SEB D;  1HA6 A;  2PCF B;  2L0C A;  2R92 G;  3I91 A;  3KF6 B;  1AFP A;  1TR5 A;  1TWA B;  1EWI A;  1GUG A;  2F52 A;  2AUJ D;  4S3S A;  1ENF A;  2E75 C;  2RBM A;  3SGI A;  2IX1 A;  4R1J A;  4BA2 I;  1NE3 A;  5ELC A;  5EKK A;  1A3T A;  2QEX A;  2VB2 X;  3D3R A;  1NBW A;  3F2U A;  1H9S A;  4XYO A;  2PO4 A;  1SND A;  5GQO A;  2A69 D;  3EVQ A;  4KHP L;  3D8G A;  1OXS C;  3PV0 A;  3OSO A;  2SOB A;  1DD2 A;  5GAD C;  5J1Z A;  2SNM A;  3VA5 A;  1ZYR D;  4HJ8 A;  1EYD A;  3PIP 3;  3S2D B;  1XPO A;  2F0V A;  1B3Q A;  2PZT A;  1STN A;  5EQ0 A;  2B8G A;  4A3L G;  4X3K A;  1RTN A;  3DWA A;  5D65 A;  1KRT A;  1PTO D;  1LT6 D;  4YIJ A;  1UUP A;  4H7B A;  1BVS A;  2A73 B;  5IGC A;  2OWO A;  3PIO A;  1PH1 A;  4TKO B;  5FK9 C;  3FEW X;  4B3S Q;  3QJY A;  4XQJ A;  3CCV A;  1JB7 A;  2WB1 G;  1NMF A;  4DKA C;  1LAC A;  1RD9 D;  4JVZ A;  3HOV B;  4YWL A;  3VR6 A;  5FJ8 G;  3CCQ A;  3HOU H;  1O80 A;  4RA8 A;  1Q1B A;  5EAY A;  4L5S A;  3A8K E;  3MTS A;  5M3M B;  1HTP A;  1ZEQ X;  3TZD A;  3K5O A;  1KDC A;  1SNC A;  3N52 A;  4UHV A;  2K04 A;  3L9A X;  4GKK Q;  2BE5 D;  2A6E D;  4C1N I;  2XSC A;  2Q2T A;  1EIY B;  2NVY B;  1Y14 B;  1PH8 A;  1STG A;  2EY6 A;  1GUN A;  1B7Y B;  1BBW A;  4JCV E;  2DJG C;  1SNO A;  4A76 A;  4GS3 A;  2RSO A;  3ERQ A;  1VQL A;  1K9M C;  1TS5 A;  1H95 A;  1CQF A;  3IFD A;  3MWY W;  5C4X G;  2PI2 A;  4ZCK A;  5CV6 A;  2JEB I;  2O5J C;  4P72 A;  3VR4 A;  4A3F B;  3BVM A;  5FKA C;  2ZM6 Q;  3QIA A;  3LNN A;  1BKB A;  2F4I A;  1NTG A;  1QG7 A;  3E9H A;  2NN6 H;  4DAY B;  1FNW A;  2JXM B;  3HOW G;  3S1N B;  4UPA A;  3WOE A;  3HEJ A;  1IYU A;  1SFO H;  1N36 L;  5TSS A;  3AFQ A;  5JVH 3;  5I9P A;  2WAC A;  2NVT H;  1BO0 A;  5CBA E;  2VS1 A;  4CDF C;  5IYC H;  4M1U B;  2P5Z X;  3KF6 A;  2EJF C;  1NUC A;  3K80 C;  1GM5 A;  2N3S A;  4A3C H;  5A35 A;  3LX0 A;  4P2C B;  4JI0 Q;  3FPU B;  3B6Y A;  1PZI D;  3L2P A;  3V96 A;  1GKH A;  2RHQ B;  2EJM A;  1Q81 C;  2KEE A;  4B08 A;  2XN9 C;  3OW7 A;  1KLU D;  1G2T A;  3ND9 A;  1PTO B;  1H9K A;  4BBR H;  1Y1W B;  4PNY A;  3NE5 B;  3CME A;  1ICW A;  4GNX A;  4OGQ C;  4DAV A;  3MXP A;  2BA1 A;  2Q8I B;  5JJZ A;  3T1Y L;  1WFQ A;  2B2W A;  2ZTC A;  4YCU A;  4KTA A;  3HFZ B;  4QB4 A;  3KFU A;  3SE0 A;  3MFG A;  1GUO A;  3CQZ B;  3GTJ H;  1U0L A;  1L1O C;  2IW3 A;  1SJH D;  4P75 A;  1EWH A;  2ZT9 C;  4AH6 A;  1EQT A;  2WB1 E;  4A3I B;  1M90 C;  1KQS A;  1BR9 A;  3E5S A;  1A62 A;  1F9R A;  4GKJ Q;  2E2J B;  1CHQ D;  2F0F A;  4HR7 B;  4JOI C;  1WTV A;  3F1Z A;  3I70 A;  4IUV A;  4QQB X;  4HIO A;  1B9M A;  1AH9 A;  3SEB A;  4LUO A;  2KUM A;  4B9X A;  4LF8 Q;  1X32 A;  4FVM A;  2E2D C;  3BDC A;  1PFN A;  4DV6 Q;  2D0P A;  2EOT A;  1I5F A;  1YNJ C;  1YZ6 A;  3FDT A;  2F03 A;  3I4O A;  1VQE A;  5ELN A;  1PVO A;  1MIU A;  5M3M G;  1AZP A;  1NNX A;  2N55 A;  3OTO Q;  2UXD Q;  4X3U A;  1A3V A;  4HJA A;  4GLX A;  4OIK A;  1OO9 B;  2JP1 A;  4JI2 L;  4FF4 A;  2YV5 A;  2PZW A;  4DAM A;  2L15 A;  2PYK A;  2IT1 A;  4BY7 H;  4EGV A;  5JAV A;  2FIN B;  1VQK A;  3JC6 6;  2D5D A;  5EBD A;  1UE7 A;  4UP8 A;  3PF4 A;  2A8V A;  4FXD A;  1EIF A;  3T16 A;  5FLM G;  2UU9 Q;  1FJG Q;  2F3W A;  4BWG B;  2HIX A;  1TS2 A;  3R2I A;  4RKL A;  2Y0S E;  3HP3 A;  1O7L A;  5BN4 A;  4JW0 A;  1TWH H;  4DAP A;  2PMZ B;  2NVX B;  1I4Q A;  4LWC A;  3SK4 A;  4A3F G;  4C3I H;  5IIF A;  2KCC A;  3A8I E;  4A3E B;  4ODG A;  5K5P A;  1OXX K;  1DYQ A;  3A56 A;  4IPH A;  3K0X A;  5EPL A;  1DZ1 A;  4A3M G;  4ZQ3 A;  2CWP A;  1SMY D;  4RCO A;  1EU4 A;  1TWF H;  2K75 A;  3P1H A;  1T5X D;  2JE6 I;  3F8T A;  1LT5 D;  3G7L A;  4Q5V A;  2VQF L;  4GN5 A;  4CDC C;  3X3M A;  1WTP A;  2N88 A;  2EXZ A;  5C5L A;  1KDB A;  3FKI B;  1SEB D;  4ID6 A;  3J81 c;  2A74 C;  4JI4 Q;  5DEH A;  1X9N A;  4JI4 L;  3EJI A;  5M5X H;  4O1N A;  2O2L D;  1Q46 A;  3NQI A;  4TRD A;  1A2U A;  1HPC A;  1X6O A;  1VQ8 A;  3OHX C;  2LY7 A;  4CKC A;  4G7H C;  3Q23 A;  1QVG A;  2IWH A;  4C1N K;  3KLS X;  4DK6 C;  3CXC A;  2X6L A;  1V43 A;  3NTH A;  3I4N H;  1QCB D;  5FLX E;  2ICE C;  2L5T A;  1I4R A;  4C2M H;  3NUC A;  4ME3 A;  4G57 A;  3M4O B;  3Q24 A;  4DR7 Q;  1D1K A;  3A55 A;  3PCO B;  2F0W A;  3UE1 A;  4GLA C;  3J81 L;  1DCZ A;  4P74 A;  4EQO A;  2XNA C;  3MXN A;  2EYM A;  3L3O C;  4DV2 Q;  1YNX A;  3PSI A;  2B2T C;  3H0G B;  3ULJ A;  1ENA A;  1DJR D;  1CZG A;  3U4Z A;  1K3R A;  4IFD H;  4C3J B;  1EY4 A;  1Z7T A;  3QG1 A;  3NEM A;  3T53 B;  4A3I G;  1XPR A;  3F2C A;  4QUF A;  2EYL A;  4R8I A;  1CT1 D;  1HA5 A;  4DV4 Q;  3RLN A;  2AUK A;  2RDG A;  3HOZ B;  5JEA G;  5JVG 3;  4U67 3;  2KCT A;  1V8Q A;  4HCE A;  2D0O A;  2G9D A;  4LF6 L;  3H3V H;  4P73 A;  1UE1 A;  2SDF A;  5M3F B;  2UXB Q;  3S24 A;  2B2V C;  3GDE A;  2UXB L;  2N49 A;  2Z0S A;  3HOY B;  2E2H B;  2K28 A;  1TVX A;  2NB0 A;  2XWJ B;  1HR0 Q;  3S1M B;  1LTT D;  1C9O A;  1HR0 L;  1LTL A;  3IRB A;  2F0K A;  3ERS X;  1KTK A;  4OXP A;  3RD4 A;  2GN5 A;  1DM0 B;  4IPD A;  5M5Y B;  1Y8O B;  2CWA A;  3DM1 A;  1KAA A;  2KHS A;  3H6M A;  3CF5 A;  1IL2 A;  2XTI A;  2SNS A;  3BZD B;  4LMQ D;  1PRT F;  4G7O C;  4RWS C;  1KAW A;  4IUN A;  2LXJ A;  3KYH C;  4A3G H;  2JYO A;  2KVM A;  3JAM E;  1S5D D;  5IE8 A;  1O78 A;  2JA8 H;  1I4H A;  4LF7 Q;  2KQ3 A;  4PZ6 A;  4Y7N H;  3GTO H;  2EYO A;  1L1O B;  2KA7 A;  1SYG A;  1X65 A;  5BN5 A;  1EEI D;  1VQB A;  1M8A A;  1LTG D;  1XYI A;  3FVQ A;  2XRS D;  2JA6 H;  5GRO A;  1B53 A;  5IYB H;  5DLQ E;  4A3B G;  2VW9 A;  2HUG A;  1S5E D;  2WP8 J;  3LWU A;  2D62 A;  1X54 A;  1MSG A;  3KBG A;  3VR2 A;  1KHI A;  2RKS A;  2WV6 D;  2ATW A;  4OEL B;  5FJ8 H;  4X65 Q;  3S15 H;  1O7I A;  1G8Z D;  5EBC A;  5EPJ A;  1LM0 A;  3TN2 A;  4X65 L;  1QUQ A;  5M5W H;  1D8L A;  1DOM A;  3FKI G;  1HUN A;  5CV8 A;  3G4S A;  1CI3 M;  2YU9 H;  2LS0 1;  1HCZ A;  2N8N A;  3MAQ A;  3GTL B;  1JMC A;  1PYW D;  1I50 B;  1LT3 D;  1C4Q A;  1Y1V H;  2CW0 D;  3T1H L;  2BDO A;  5I2X A;  4C3H H;  2PW5 A;  3J80 c;  1PH2 A;  2OF1 A;  1SLJ A;  4JK1 C;  4X3T A;  1SYC A;  1VQG A;  1PRT D;  3ERO A;  3PIO 3;  3CCU A;  3C1E A;  2A6H D;  5IGF A;  4HSV A;  1ILP A;  1SYB A;  1OXV A;  1EYA A;  1HZ9 A;  3U9O A;  1V1Q A;  1T5E A;  3H0G G;  4N9T A;  5LMN L;  1FD7 D;  2KHI A;  2TSS A;  4C3J G;  1A63 A;  4RAU C;  5M9O A;  1I3Q H;  4I7Z C;  4RH6 A;  4BXX G;  2L4N A;  2Q2I A;  2B63 H;  2F3I A;  4EQN A;  3J80 L;  3HOZ G;  1HUM A;  2LMC B;  1CSP A;  5M3F G;  2F3V A;  3PO2 H;  1HNZ Q;  1JOK A;  2K5W A;  3KJO A;  1TWA H;  3S1R H;  1D7Q A;  4CHT B;  1HNZ L;  3NSW A;  4IUP A;  2A69 C;  4KJO A;  1SSO A;  4ZUI A;  4AIM A;  2E2I B;  1O7Y A;  3C46 A;  3H94 A;  1ZYR C;  2KBN A;  1SRU A;  4IJH A;  1J6Q A;  5COY A;  3CC4 A;  1RKN A;  4A3J B;  4KKS A;  1B9N A;  1I4G A;  3RZO B;  4CKB A;  1R9T B;  1PTO C;  2NZO A;  1PYB A;  3RLO A;  2OT2 A;  2B2U C;  3V05 A;  1Y8P B;  1U4L A;  4YY3 Q;  4X66 L;  4HJ7 A;  4A93 H;  3DWP A;  5CBE E;  3S2D H;  1A15 A;  3EA6 A;  3I7F A;  5GAG C;  4YY3 L;  4FF2 A;  5C4J H;  1TII D;  1M1K C;  2FHT A;  4CGY B;  1OXT A;  2RDH A;  3S17 B;  1IXR A;  1SBB B;  1R4P B;  1J9O A;  1II3 A;  2RVL A;  2EY2 A;  2IPK D;  3BDL A;  1JOO A;  5C4X B;  1S4Z A;  2K52 A;  4A3D B;  1VQI A;  3G48 A;  4OON A;  2QIL A;  2F0J A;  1J5E Q;  1U4P A;  3PUY A;  2E74 C;  1TT2 A;  3H15 A;  1GUT A;  3P20 A;  1E0B A;  2PW7 A;  4JOI A;  1VQP A;  2R7Z B;  1XXG A;  3K7A B;  2JA7 G;  3HOW B;  1XNQ Q;  2EDG A;  1MBY A;  3HOV H;  4KHV A;  1CKN B;  3KLS A;  3RZD H;  3OMG A;  2EVB A;  2VQE Q;  1GJX A;  1XJV A;  2I0Q A;  2BE5 C;  2VQE L;  1HTL D;  3KF8 A;  4KD3 A;  4MTN A;  4HTH A;  2B8F A;  1ICF B;  3C2P A;  4EQP A;  4POG A;  3CC7 A;  4OHJ A;  2FXQ A;  2MHV A;  2LKV A;  4ABN A;  5C0X G;  4JI5 Q;  3K58 A;  4QIW B;  2PQA A;  1A2T A;  4JI5 L;  4IQZ A;  1WCM B;  2Z6K C;  4ZKB B;  3S1Q B;  3CCL A;  5CC4 A;  1SJE D;  5IP9 G;  1FVI A;  2LSS A;  3GTK B;  1BCP F;  1IYJ B;  4K5X A;  4KHP Q;  4R4Q A;  2NVY H;  2B2Y A;  1K0R A;  2KEC A;  1ET9 A;  1W6K A;  1IBL Q;  4TQU S;  3P75 A;  5IGD A;  1PH6 A;  1LT4 D;  3AFP A;  2HIV A;  3A7A B;  4E6I A;  1QE6 A;  5FLM H;  1IBL L;  4QF4 A;  3PUW A;  4IZ8 A;  2BA0 A;  4BY1 G;  2DN8 A;  1V1P B;  3E0J A;  4DNR B;  2YTX A;  3TDQ A;  3TP6 A;  2BDN A;  5T1I A;  1VQ5 A;  4AYB B;  1ILQ A;  1T9H A;  4N9P A;  2QDL A;  1JT8 A;  1TS3 A;  5CV5 A;  2IJ0 A;  4Q0F A;  4ZUJ A;  5NUC A;  4J1M A;  1VQC A;  4XYQ A;  2EYP A;  4HJ9 A;  5C0X I;  3S1N H;  5C44 H;  4DV5 Q;  2ZTD A;  1BXT A;  2PNR C;  1ZKO A;  4DV5 L;  1L0W A;  2N78 A;  4GOP C;  1S3O A;  1SN8 A;  3QR8 A;  3VYU A;  3PUZ A;  1IYV A;  5IT9 E;  3S14 H;  3W1B A;  1S72 A;  4HN7 A;  4DXF A;  1E1T A;  2H1E A;  1UE5 A;  1G51 A;  4JG2 A;  1WOC A;  3CCR A;  3NP8 A;  4RFB A;  3M3Y H;  1ROD A;  1STA A;  4A3J G;  1Y1W H;  1KDA A;  2AQ1 B;  2NUC A;  2K1B A;  3ICE A;  4O0A A;  5D14 A;  2QA4 A;  1VQ7 A;  4UAI A;  3TRE A;  2R93 H;  4UDU C;  4GN3 B;  4OWW B;  4OO1 H;  1BCP D;  1NR4 A;  1QIL A;  2KHJ A;  3CQZ H;  3AU7 A;  1EOV A;  4PG3 A;  3H91 A;  2O4X A;  3PF5 A;  3I73 A;  1S5C D;  3TBI B;  3QOL A; 
#chains in the Genus database with same CATH homology
 2DJF C;  4CDF C;  4CDE C;  4OEL B;  4CDC C;  4CDD C;  1MHW C;  1K3B C;  2DJG C;  1ICF B;  4OEM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...