2DJFC

Crystal structure of human dipeptidyl peptidase i (cathepsin c) in complex with the inhibitor gly-phe-chn2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dipeptidyl-peptidase 1
publication title The crystal structure of human dipeptidyl peptidase I (cathepsin C) in complex with the inhibitor Gly-Phe-CHN2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 8
structure length 68
sequence length 68
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2006-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 2djfC00
1ICFB 4OELB 4CDCC 4CDDC 1K3BC 2DJFC 1MHWC 2DJGC 4OEMB 4CDEC 4CDFC
chains in the Genus database with same CATH superfamily
4ID6A 5J3BA 2KEEA 3GQBA 1LTTD 2WFWA 1SJHD 3IKJA 5ELNA 2IX3A 5JJKA 5JJZA 2R93G 4QUCA 2A68D 3HKZG 4OX9L 1QZGA 1TWFB 2F0IA 1ET9A 3R93A 1X55A 5JAVA 4U673 3S1QH 1IBKQ 2C9OA 1C0AA 1B9NA 1EIGA 1DOMA 3VYUA 2RF4A 5LMNQ 1XMQL 1SR3A 3KUPA 1UAPA 1ZEQX 1LTGD 5GROA 1TY0A 4RHRA 2IL8A 5DLQE 2RA4A 1EFID 2XWJB 2D0OA 2VS1A 1I4QA 4RGTA 2XNAC 2QEJC 4APVA 2OCEA 4HSPA 5IP7H 4DUZQ 4LAAA 2UUBL 1BCPB 4XT1B 1SNPA 3ULLA 5CMDA 2BE5D 1BVSA 2PZTA 4A3IB 1I4XA 3D8GA 4KJOA 3NQIA 1SDFA 1K0SA 1YBYA 5EQ0A 3L9AX 5FLMH 4YCWA 4KTAA 2G9HD 1XNQQ 5KYLA 3I73A 3UI2A 1TS5A 4FNFA 2F3IA 3IFDA 4HIOA 4YWKA 1IBKL 5G3LF 3MXNB 2NVTH 2NN6I 4YY3Q 4A3MH 1SBBB 2QF7A 4IUPA 2ICEC 1NAPA 4K8IA 4YCUA 3DMUA 2EPBA 5M5WB 1QVFA 5LMNL 4A3CH 1S5FD 3TP7A 1NNXA 4FXDA 5LMNW 3PO3H 1PA6A 1MHWC 3FDTA 2Z6KA 1PDQA 4KN4C 1S3OA 4B3MQ 4UY8C 1N36Q 2XSCA 3G6EA 2XTIA 1HZAA 1DONA 4BY1H 4G7HC 3E5SA 4DUZL 3JAMi 1LTLA 4DV5Q 1P8LA 2NN6G 4FXKC 3H0GG 2VNUD 1AH9A 1L1OA 2ZTCA 1I5FA 3GTLB 1VQCA 3OHXC 3V05A 4EGVA 3S1RB 3RLFA 2JA7H 3NQTA 2F0VA 4WJWA 2AWOA 2KEDA 4DV3Q 4JI4Q 2PZWA 4IJLA 4Y7NH 3GTGB 1Q86C 4JW0A 2F0GA 1B3AA 3M9BA 3PCOB 4J6HA 1SE4A 5DM73 2UXCQ 4IFDI 1EY8A 5AFWA 3UE1A 1PTOC 4YY3L 1E22A 4MIUA 1FYCA 3K5OA 3HOVG 3OWFA 5IWAQ 1LT4D 4O42A 1UE6A 3CCJA 2L11A 3PUWA 4F7XA 1G2TA 2A8VA 1EQVA 4J1MA 3NELA 4B3ML 1BOSA 3EJIA 2JA6B 1N36L 5JPMC 2YV5A 3TP8A 1CK1A 4K2KA 2WB1G 1PFMA 4A3FH 2FINB 3T13A 4DR1Q 1I3QH 4IFDG 5JVH3 4DV5L 4DR2L 2HIVA 3H3VH 3SEBA 4JPBW 4O0AA 4JG2A 1TWCH 1WD0A 1RDPD 5D14A 2WACA 4QIWB 5C4JH 1JR0D 4C3JH 4BA1I 4DV3L 1FNUA 3RZDB 4JI4L 3SVMA 1Z9FA 1H9JA 2ES2A 3MHBA 1PH4A 3S1QB 1O7LA 4DU9A 4DFAA 2CH4W 2UXCL 5LL6S 3J7A5 1X3PA 3CW2C 1Q81C 1M90C 3MVVA 5IWAL 1FGUA 2IT1A 1OXTA 5DEHA 5IIFA 2Q2HA 5IP9H 1VMPA 1I4HA 2MPMA 1JJGA 1XMOQ 3QOLA 1AP0A 5IT9c 4DK3C 1XYIA 2NVQH 5H1SE 2RVLA 5CV5A 1HUNA 3S1MH 2IX1A 1Y1VG 3HKZE 3NE5B 4A3GG 2VQFQ 1U4LA 2JA5H 3H91A 3G4SA 4P75A 3GP7A 1CKOA 2E75C 4EX5A 1B4OA 3E3XA 2R7FA 5CC4A 1SFOH 1STHA 1EY7A 1GO3E 2NVYH 4AQYQ 2SEBD 1CFMA 1TWHH 3HRZC 3A74A 4GKJQ 3MEHA 3J81L 3URYA 3IAYA 1PH1A 2DN8A 5C0XI 1YJWA 5C3EH 2FFKB 3QG1A 2A73B 3VR3A 2NVTB 1Y1WB 5COYA 3HOYH 4BY7H 4A3MB 1JB3A 1BCPC 2Q2TA 3NBIA 4K14A 5IT9E 5CV9A 2A69C 1F2LA 2R92G 3T1YL 4FF1A 1L1OB 1HA6A 3PO3B 2B2VC 3M85A 2JQOA 3U9OA 1XMOL 1KXLA 2IJ0A 2XIWA 3M4QA 4BY1B 5C0XG 4FXGC 5A35A 4HIDA 4DPGA 1HJPA 2EJMA 5IYBG 2Q8RE 3OIPA 2VQFL 1KC8C 2JSOA 2PMZB 2LXJA 1YNNC 4LFCQ 4JI0L 1DOKA 1WTOA 5I6YA 2QW7A 4I65A 2JA7B 3VR2A 3D31A 3DXJC 4QJFA 2WV6D 4GKJL 2F0DA 4Y7NB 4OO1H 3SDZA 5HY6A 1G8ZD 4DXGA 4J15A 3TRZA 3NUCA 4R9WA 5ELEA 1PRTC 1UEBA 2SNSA 5TSSA 4FF4A 2PYKA 3AFQA 3BDOA 4CHTB 2UUAQ 4UHVA 1Z47A 4Y52H 4IOAA 3D6CA 3QWNA 4CDDC 5EKKA 4LF6L 3TS0A 1JWMD 2EZVA 2ASBA 1XPRA 3RLNA 5C4XG 1YZ6A 1ILQA 1TU2B 4ABNA 2VL6A 5EPJA 3O13A 5JEAG 4LF8Q 3KOJA 3PF4A 1ZKOA 3CC4A 1A2TA 4DNTB 2K5QA 2E8GA 1AEXA 2VB3X 4O1NA 1LO5D 2MGSA 4A3FB 2HQEA 2F0OA 4IPDA 1GUOA 1I3QB 2LXKA 1BBWA 1EL0A 1PFNA 2EY2A 4OONA 4LFCL 3S16H 2N55A 3ZYYX 2MP1A 3L0OA 4WFN3 3CAMA 3RD4A 4MN3A 3SXHA 4GZYC 5IYCG 2WIIB 2BOSA 1VMCA 5EBDA 2CKZB 4DK0A 4KY5A 4R4OA 3RZOH 1GUSA 1CHPD 2KCMA 4OL7A 4GNXC 1NJIC 1JQYD 1UE7A 4M1UB 2FMMA 3M4PA 1VQEA 2WB1E 3BZKA 4TKOB 2N49A 3A5ZB 2I0QA 4DR4Q 3HFZB 4LF8L 3A54A 5EPLA 4XQNA 4HJ8A 4BA2I 4DV1Q 4G4KA 1IKMA 2F0NA 4XQJA 4C3HH 2UXDQ 1KDBA 1JWUD 3BJUA 4DV7Q 3S1MB 3R2IA 4B3SL 3WDNA 2ZJRA 2DUDA 2JA5B 2K50A 3I4OA 2CFMA 4DN4M 2R3ZA 3HOXH 1SFOB 4GLVB 4PMBA 4NMZA 4A3IG 3MC0B 3KBXA 2NVYB 1OXXK 1J5EQ 1SRUA 1TWHB 2ENBA 1EU3A 3IRBA 2GVAA 4LFBQ 3ND9A 4NDXA 5C3EB 3AU7A 5GADC 1PZKD 4RKBA 3HOYB 2K28A 2K03A 4BY7B 3PGZA 1EUJA 2F3WA 1QE6A 4K8JA 3J81j 4IPGA 1N33L 2FJ2A 4HAEA 4OEMB 1PTOH 4DR4L 3OPOA 1GUNA 1NCVA 3G7LA 4OIJA 1I94Q 2Z6KC 1S40A 3NWSA 4A3DB 3FRPB 1D1IA 1OXVA 1X54A 4DV1L 5K36G 3WOFA 5ELCA 5M9OA 2UXDL 5JVG3 4G7OC 4NB3A 5BR8Q 4DV7L 4A76A 2WAQB 4IURA 1A62A 4RHSA 2K7VA 3GO5A 5FLXc 1U0LA 3K59A 3OMCA 3R2TA 5IOCA 1L1OC 1R9TH 1UE5A 1L0YB 4A3LH 1J5EL 2WINB 4OELB 4Z9CB 1GXDC 3F2UA 4LFBL 2HQLA 1ZYRD 3I8ZA 2KOLA 2NUCA 1HRJA 4X3SA 5J22A 2GN5A 4ZLTF 1SE3A 5EKLA 1SE2A 3ERSX 1KNAA 4IFDJ 1VQHA 4IUQA 4KK7A 2P5ZX 3ITPA 1PLFA 3QJYA 2DGYA 5IGFA 1DXMA 2E2IB 2VB2X 1I94L 3CD6A 2UUCQ 2I5MX 5FLXE 4JI6Q 1Q46A 4X65Q 1DOLA 4TSSA 2K5WA 4KHVA 4HR7B 2KECA 2RKSA 4P73A 4ZKCB 2O5JC 1C8CA 2R7ZH 3S16B 3V96A 1K8AC 1KL9A 1KIXA 4B9WA 1G291 2EE1A 1VS0A 2X6LA 3JC66 1X3QA 3J80L 5KRUA 5C44H 2V1CC 2TMPA 5EPKA 2ZM6L 1PZID 1KD1C 5IODA 3RZOB 1SMXA 2QGQA 1SSOA 2OQKA 3K7UC 1T9HA 1TIID 2PNRC 4CKCA 2E5LQ 4K5WA 3A8JE 5I2XA 2AHOB 4QB4A 3KBGA 5E1FA 3NHHA 1ENFA 1S5ED 4RMFA 4LW1A 4GN5A 3MTSA 1IZ6A 2UUCL 2LY7A 4BBSH 2K04A 3EA6A 3PIP3 2ZJQA 2VY3A 4PZ8A 4JI6L 1LTID 2BH2A 5KEEA 4RA8A 4N8X1 4YWMA 4C56C 1WFQA 3SE0A 4H7BA 5FK9C 5IP7G 2MUYA 5E7NA 1JCKB 5GAHC 4LUVA 1L0WA 3EFXD 1TQOA 3FPPA 3GTKH 3EROA 2GVBA 1K3BC 3EQLC 3HOXB 1EYDA 1KNEA 4ZUIA 2A5HA 3A7LA 2F0LA 3CCEA 4LF7Q 2KCNA 4N9TA 1DJRD 1GKHA 4L5QA 4FYDA 5FLMG 1E2ZA 1MGSA 2MO1A 2CWPA 4BXXH 1RCVD 2BDOA 5C0XJ 4CKEA 4B08A 1N8RC 2FMCA 4NW2A 1E1OA 1Y1WG 1HQRD 1HQMC 2DY8A 3K81C 5IGEA 2E5LL 4A3MG 3I4NH 2CVRA 4A3CG 2PPBC 1STEA 2N78A 5IGCA 1WOCA 2JA8H 2EY1A 2AUJD 4KLKA 3PO3G 1TT2A 3TQYA 3W2DA 4GKKL 1V8QA 3K80C 3GTPH 1AFPA 3D0FA 1SYDA 1LTAD 1QVCA 4P71A 3VR4A 2PI2E 2A19A 2ICIA 4FO2A 1XX8A 2IWHA 4BY1G 1Y69U 3NTIA 2Y0SB 2EY6A 3N52A 2ZTEA 1E3PA 3UDFA 1EFWA 3GTGH 4GLAC 5JPNC 1PYSB 5C3WA 3KJOA 1A63A 1O7IA 1R9TB 4CDFC 4C1NI 4LJZC 1X65A 4K6DA 3D6WA 1TWAH 2NVXB 5JEAJ 1FR3A 1NR4A 1TS3A 2JA7G 4NXNQ 1H9RA 3FP9A 1RF2D 1EEID 4NKLA 2B8GA 1PV4A 4AYBB 3TREA 1LABA 3PUZA 2VUMB 2JA6H 1E2WA 2E74C 2NZHA 1DZ1A 1RHPA 1YHBA 2PNHA 3H3VI 5EGTA 1EY4A 1TKWB 2K5NA 2NYZD 4DA2A 1RTOA 1SYCA 3MA2B 4OXPA 1IBML 1B44D 2KVMA 4QCLA 3CU7A 5K5PA 1D6EC 1K8MA 4QL5A 1S5CD 3S9WA 3RZDH 3W1GA 4A3FG 4DGZA 1M4VA 4OWXB 1O7YA 1CT1D 2R7ZB 4GNXA 2XRSD 5CGKA 4ME3A 1NR2A 3S2DH 3VR5A 4WJ4A 2JXMB 3QO2A 3GDEA 3MFGA 1XPUA 2A1AA 5C44B 3J7AV 4C3JG 5T1GA 1SYEA 4JI5Q 2Z8LA 4LK1C 2EVBA 4DAMA 1J6QA 1IBLQ 1I6VC 2B2UA 2HD3A 1D5ZC 1PTOD 4PQXA 4QMGA 4GOPC 1HZBA 1JWSD 1CA5A 2L9HA 4H44C 3NBHA 3AYHB 3PV0A 4IPHA 4A3EB 5IP9G 3MXGA 1VQBA 1EYCA 1ONLA 3OMGA 5C5LA 4BBSB 2J4XA 5IE8A 1I50H 1KABA 2F0SA 5A2QL 5F2DA 1MI2A 3QR8A 1FL0A 3K0YA 4L5SA 1H9SA 4PZ6A 2AWNA 4QIWE 2EXZA 3LGJA 1CHQD 2JA5G 3AEVA 3GTKB 1HTLD 3A55A 5I2YA 1Y1WH 2G5DA 5FKAC 2IHEA 1L2FA 1SNQA 2F0WA 1EZ6A 4DAYA 2HHHQ 3E0EA 1DM0B 1SN8A 1IW7C 1EQRA 5D65A 5C5MA 4JI5L 1YITA 2EJGC 1L0XB 5C3EG 1IBLL 1PXUA 3B6YA 3J7YW 3HOYG 3EVQA 1QVGA 3NP8A 2IY5B 1PRTB 4HMJA 4KKTA 3I4NB 4BY7G 3QOJA 1D7QA 1X56A 1FNWA 5IGBA 2JA8B 1JOKA 2NWGA 2K33A 1SNCA 1VF5C 1ASYA 2OEOA 3GTPB 3T51B 3D3RA 4OO1I 1X9NA 1A3UA 4A3DG 1MSGA 3I2ZA 5L37A 1BKBA 2E2HH 1XNQL 3KJPA 2A6HC 2XRQD 4H13C 3KFUA 1K8OA 5EKIA 3QIAA 4RGNA 4IPCA 1TWAB 1TWGH 3KLSA 2HCIA 1CQVA 2HHHL 3PUVA 3J81c 2E2DC 3NSWA 4KJNA 1N9WA 1RODA 5E4WC 4OO1G 3W5OA 4LUZA 4X3KA 4JI1Q 3TZUA 2F0KA 3I91A 2RDFA 5AJ3Q 1BCPD 2A69D 5CBEE 5JJIA 4X62Q 1I4PA 3QB3A 3HP3A 4GNXB 3MFYA 4MHEA 1HA5A 4DUYQ 4UP8A 2Q8TA 1V9PA 3E9HA 4P2CB 1JOOA 2AQ1B 4LNQA 1GD7A 2K5DA 4F8MA 2M9VA 1RKNA 2EDGA 2GA4B 4CKBA 3CCRA 2LKVA 3J81E 1LT3D 4IOCA 3A0JA 2L12A 3KDFA 1YNND 3I55A 3E9IA 3TMEA 2N8NA 1PHJA 3S2DB 5M3MH 3NBHB 3OYYA 2CHBD 2K5VA 4YHHQ 1GHJA 1PRTD 3SK6A 2IHFA 3S2HH 1RJTA 1YI2A 4JI1L 1H9SB 5AJ3L 4IZ8A 5ELFA 2JYOA 3OWEB 1C7YA 2PZUA 4X62L 2K1BA 3MWYW 4OWTB 4DR1L 2KENA 3T1HQ 4POFA 1WVLA 1PFBA 1I4RA 1DYQA 1I50B 4DAYB 4OWWB 3H09A 3BZDB 1ENAA 1M8AA 2D0PA 2LS01 3GD7A 4C3HG 2EYHA 4X66Q 3S17H 1HUMA 5CBAE 1HNWQ 1NBWA 1EY5A 2WP8J 4PZ7A 4N8FA 1N34Q 3I4MH 1KQSA 3P1HA 1JE4A 4H02A 1PH2A 3CCLA 3K58A 4JBJA 4DAVA 3FVQA 1D2BA 3HOZH 3HOXG 3JAML 1VQKA 3U4VA 1STBA 4FDBA 1EYAA 4K6LA 4YHHL 3A8KE 3CHBD 1WTRA 3F2CA 3NEMA 4H0LC 4A3DH 1JT8A 4IUUA 3T56B 4JVZA 4MZ9A 4DR6Q 1F9SA 2K5HA 3NK9A 2M2LA 3T1HL 1BUVT 3K5LA 1UNSA 1B8AA 3MEFA 1QCBD 2MNAA 1AN8A 3IFTA 1CKMA 4L5TA 2FHTA 3SK5A 3A7AB 4XIGS 4XTCS 4AQYL 1CKNA 1HZ9A 1KAAA 2NZ1D 1Q90A 1MJEA 4LF9Q 2O5IC 4ZQ3A 4X66L 2E2HB 5HURA 2F03A 4CDCC 2Y0SG 3GTMH 5FJ8H 5M5YH 1OXUA 2B2TC 3UDGA 1TWGB 1TS2A 3CCSA 1GVPA 2HCCA 5CR3A 1RD9D 4A3LG 1X3EA 3K5MA 3SHLA 4XXEA 2E2JB 1V1PA 1PYWD 1N32Q 3PO2H 4V0BA 2E2IH 4FF2A 4AYBG 1SLJA 2RHQB 4AIMA 2H5XA 4RAUC 1GUTA 2JEAI 4DR6L 1FGBD 3KDFB 2XWBB 1SE8A 3F8TA 1STYA 4ME5A 5I9OA 2KCCA 3TN2A 2PO4A 1NMGA 1VQ7A 2KA7A 4LFAQ 4LWCA 3MZ5A 3UDIA 2R93B 2EYFA 5JJLA 4LF9L 3Q23A 1VQNA 3PIOA 1KDCA 4DAPA 1OO9B 1ZXTA 3OIQA 2DJGC 1J8IA 2Z1CA 3CCMA 1A6XA 1ILPA 1EIYB 4GOPA 2UUAL 2R7ZG 5M3MB 1AZPA 5FO7B 4IUVA 2WKDA 2BCOA 1SMYC 2MQHA 1BQQT 4IALA 4X64Q 5C44G 4JBMA 3ER0A 3HZXA 1N32L 3S2HB 2NB0A 2ZXOA 2N88A 2J7ZA 1JOQA 2B2UC 1F9PA 5DNFA 4DV0Q 1GM5A 2B2YC 1HNXQ 3V2TA 2F3VA 1V1QA 4KHZA 1LLRD 1YIJA 3DWQA 4LFAL 1YEZA 4BBSG 4L8JA 2RHSB 2PQEA 1LM0A 2ZJPA 3S17B 3CCQA 4KY7A 3PF5A 1HCZA 1VQ8A 3I4MB 4B3TQ 2K32A 4V190 1D1KA 1ICFB 2EYPA 3W1BA 2H4OA 4R4TA 2IPKD 1EYGA 3HOZB 3I90A 3J80c 1WTXA 4DKAC 2A74C 4YWLA 2BDNA 2V4DA 1X32A 2A6EC 2IX0A 4K5VA 1S72A 4LF4Q 1SEBD 3Q22A 2C5CA 1LTRD 2F0MA 2UU9Q 2B3GA 4U68A 1F2MA 3HGBA 3K7AH 1XJVA 1G6ZA 1IL8A 4BXXG 1CKNB 1YHAA 3S24A 4XT3B 4RFBA 1P16A 3GTOH 4DV6Q 1BO0A 4C1NK 3I4NG 4DV0L 3CCVA 4A3JH 1FD7D 2EOTA 2I46A 1HNXL 2JA8G 1STAA 4EQNA 3TP5A 3PQIA 2L5TA 4DF7A 2OTJA 1AW7A 3M7GA 4QUFA 2NVXH 1KRSA 4HTHA 1V1PB 1WJJA 1YVCA 2F0TA 3J80E 2PW7A 4X3TA 3KLSX 3GTMB 1VQ5A 4B3TL 2RQXA 3FKIH 3DLLA 3BYTB 5M5YB 1G51A 2NZOA 4ODGA 2VUMH 5J39A 1IKLA 4JBKA 4UP9A 5HGQA 1VQ6A 2Z9HA 1RIPA 1PH5A 4LF4L 4DNIA 3RLOA 1QNUA 4JBWA 2UU9L 1F9QA 3PO2B 1BR9A 1Q8KA 1HR0Q 1OXSC 3RN2A 1G91A 3D4DA 2F52A 1F77A 4CGYB 2Z0SA 1JC7A 1II3A 4X3UA 2JA6G 4FP5D 3L3OC 3TBIB 3G48A 5BR8L 1QILA 2WB1B 2JN4A 1HNZQ 4GOPB 3TS2A 1VQJA 2B8FA 3F1ZA 1J9OA 3M4OB 1SYBA 2ATWA 2ZTDA 4NPSA 1C48A 3GTQH 1NSNS 4RGMA 3CKIB 4I7AA 3K8AA 3OOCA 3EBEA 4R4IA 1I6HH 4IUTA 4DR5Q 3FMCA 4UPAA 1CTMA 4C3IH 5ELBA 4KD4A 4AYBE 3Q0AA 3G6JB 1YNJC 1NE3A 2O2LD 2NBFA 1K28A 1B9MA 1H9MA 5E3FA 2K4KA 4A3EH 1PH3A 5IYDH 5GAGC 1HR0L 1LT5D 4RCOA 1EU4A 3IL8A 2HDLA 5C4ZA 4X65L 4K2LA 3C1EA 2KHJA 3VA7A 1KAWA 1KDAA 1CQFA 3PUXA 3ULJA 1HNZL 4B3RQ 4A3GB 5FO8B 3H6MA 1NUCA 4LUOA 1VQLA 1E2VA 2CW0C 3I7FA 3STBC 3U58A 3L7ZC 2N3SA 1XPOA 1TXYA 1S4ZA 1KRTA 4R8NA 4ZRZA 2KQ3A 2PCFB 4CJ1B 4DR5L 3A5UA 3VYSA 3ULPA 4BBRH 2XVSA 3SK8A 1C9OA 3D4RA 1VQPA 3S15H 4A4IA 1CSQA 2MO0A 2B63H 2SNMA 3K7AB 3A56A 2G9DA 1H9KA 4P74A 1SYGA 2ZXPA 5HGTA 3GTOB 1MKHA 4HEDA 1PH7A 2XGTA 1LT6D 4B9XA 2KJXA 5M5XH 4A3JB 4B3RL 2B2TA 1B2TA 3LX0A 2Q2UA 1IL2A 2VXWA 3P75A 1G6PA 1STGA 5KIXA 1RL2A 2QDBA 4XYOA 4LF7L 1GHKA 5KNDA 4ULLA 5D3IB 2LMCB 3M4YA 4POGA 4F88A 3TP6A 3FKIB 3G71A 5NUCA 3J7ZC 2ZXRA 1FVIA 3S14H 2AQ3B 3CCUA 2F0HA 3RR5A 2R6GA 5ISRA 3CF5A 4R1JA 4RCNA 1MD2D 1WTHA 1IW7D 3NTKA 4HJ5A 1BXTA 1HFNA 1U9RA 3K6OA 3DEOA 1VQ9A 1GUWA 2QCPX 2NTTA 4G57A 2C35B 1EWIA 2SOBA 1QZHA 5FOBB 4OHJA 2UUBQ 1CZGA 1M1KC 1X3GA 3R3OA 4R4CA 3GTQB 1EY0A 1IHZA 1TR5A 1LUZA 4NXNL 3EIVA 2MHVA 2A6HD 2F0EA 1EOTA 3Q8DA 1VF7A 1EWHA 3K5NA 1UEAB 3M3YB 3BG3A 4PMWA 1I6HB 4A3BH 3UDXA 4C3IB 5FO9B 1A3VA 4JV5Q 1K73C 2EJFC 5G3LD 5M3MG 4A93H 4JK1C 3HOUH 2B2YA 1LTBD 1SROA 4DXFA 2CCZA 3AFPA 1UWVA 4CBVA 4KD3A 2EYLA 1VQOA 3BVZA 4XYQA 3I4LA 3KLRA 5DM63 1WCMH 3SK4A 4RG1A 3EN2A 1RTNA 3J7AF 1B70B 2DY7A 3HS0C 2SDFA 3C2PA 3RMHA 2OQ0A 1YJNA 3HEJA 1K0RA 1PMRA 1W6KA 1FJGQ 1WTPA 1Y8OB 4UAIA 3I4MG 2JEBI 1JE5A 1PTOF 4BBRB 3NWTA 1ASZA 5EJWA 4ALPA 5CV8A 1Q82C 4JV5L 1EQTA 4RGOS 3X3NA 3HOZG 5GAEC 2K14A 3S15B 3R8BA 2F0JA 4RWSC 1VQFA 2B63B 1VDZA 1W2BA 1PYBA 2CH4A 1KLGD 3J81i 3HOWH 4HJ7A 4E6IA 5IY0A 4QF4A 3S1NH 4QGUA 4EVOA 5D3DA 2JK8A 4DNRB 5M5XB 2WAQG 2A68C 4J8QA 3I70A 5EBCA 1V1OA 5IGGA 1NY4A 3BZCA 3VYTA 2B29A 3CC7A 5M3FH 1E0BA 4DR2Q 2HDMA 4HIMA 3ZJYC 3HKSA 5CORA 2L1BA 3DEPA 1SNOA 4JOIA 1XXGA 4CJ0B 4JI2Q 2BA1A 1QB5D 1XTCD 3AB9A 4PNYA 5IGDA 2YU9H 1Y8NB 4A3KH 2E2JH 2PQAA 1FJGL 5FJ8G 3S14B 1KTKA 3RNUA 3JAMc 2L55A 3CPFA 4CDEC 4GN3B 4JI3Q 1BBXC 3Q6SA 4S3SA 2QEXA 2I5LX 3NPPA 2RCNA 1O80A 4HJ9A 4DK1A 1K83H 3LWEA 2QILA 3PO2G 3CC2A 1Z6HA 4RH6A 1A0IA 3L2PA 2PMZE 3VA5A 2BE5C 3VDYA 2OWOA 4XQQA 4JC0A 2R93H 5JOBA 4WORA 3H94A 4IQZA 1XWEA 2BA0A 4QY7A 3OW2A 3TZDA 2B2WC 1D5XC 1G2SA 1B53A 3BDCA 3JAME 3PUYA 5CV7A 2FXQA 4JI2L 3NXWA 5ELDA 1CA6A 3N6RA 2EXDA 3LWUA 3ICEA 4A3BB 2RSNA 1BCPF 3VYRA 3DM1A 4HN7A 4F87A 4FF3A 4DV4Q 4JI3L 1EY6A 2X69A 4Q0FA 5BN4A 1LACA 3FEWX 4HJAA 3HOUB 2QKIC 4DR3Q 4A93B 2DJFC 3A8IE 1VQ4A 5C3XA 4KV6A 2QA4A 3ND8A 3ONAB 5BN3A 3T1YQ 1W6JA 4DUYL 3KLWA 5CYUA 3NENA 2UXBQ 4HCEA 2TSSA 5KNBA 4PV1C 3CRLC 1VQAA 3C46A 1WCMB 1KLUD 4LMQD 3M7NA 1E24A 1K3RA 1MBYA 2F0FA 2LFNA 3CMEA 2NTSA 1QUQA 1S5DD 1Y8PB 3C3LA 3T4AC 4DV2Q 1Q1EA 1IYUA 3VR6A 4JI0Q 4BS9A 4M8AA 2VZAA 1JJ2A 4WRDA 1PRTF 1EIFA 3CXCA 2Z4HA 4PG3A 4AH6A 2R7DA 3WOEA 4ZYSA 4R4QA 2JP1A 2KHIA 4DV4L 1EZ8A 4C2MH 4JI8Q 1YJ9A 4DR3L 1SMYD 3MXPA 4LF6Q 3AMUA 4ZKBB 2NN6H 3H0GH 3PMFA 2UXBL 2CQAA 4N9PA 3HOWB 4EQPA 3S1NB 3MAQA 4UP7A 2EY5A 1IXRA 1T5EA 2EYJA 3CRKC 1U5KA 4JCVE 2PQAB 1K8GA 1HNWL 4KMUC 1CZWA 4KY6A 3WWVA 1N34L 4I7ZC 4A3JG 5M3FB 2D9UA 4DV2L 3U9SA 3F2BA 1SJED 2Z6BA 1PVOA 2EYMA 2I07B 2OF1A 3HOVH 3LNNA 1FNVA 1LYLA 1SAPA 3DWPA 1AE3A 2E76C 4TVAB 1ENCA 4A3KB 2YU9B 4L63B 2ZT9C 4K5XA 2KUMA 3Q24A 3FKIG 1EOVA 3HG9A 3W3AA 2DNEA 3F2DA 2VUMG 3K0XA 4TRDA 3TEHB 4JI8L 1A8VA 1IYJB 2O4XA 3SR1A 5IT9L 2J0TD 2A6ED 1Q1BA 1SNMA 3CQZH 3GTJH 1Y14B 4PMCA 1CUKA 4IFDH 2WAQE 1K83B 1H95A 3M4OH 2JE6I 1SYFA 1R4PB 3T53B 4UDUC 3TDQA 2F4IA 2Q2IA 2RDHA 1S5BD 4XDXA 2RBMA 3HKZB 3CMAA 4P72A 3X3MA 2HUGA 5E4XA 4Q5VA 1A2UA 4OIKA 1PFSA 4B3SQ 2K52A 2PW5A 2RDGA 1I4GA 4FVMA 1XTDA 5T1IA 1TWCB 2L0CA 3I72A 5LMUQ 5C4JB 4ZK9B 4C3JB 2JJQA 3DUZA 2EQSA 5BN5A 3U4ZA 1EY9A 4ILWA 4C3IG 1Q8IA 2DNCA 2K6AA 1PH8A 2ALYB 1D8LA 2MJ8A 4NXMQ 2H1EA 5GQOA 1EIHA 4BWGB 1PH9A 1DD2A 1QUQB 1EQQA 2HIXA 1MIUA 1Y1VH 4A3GH 1B7YB 1N33Q 2Z4IA 4A3EG 1TY2A 4A75A 5IYDG 2F1MA 2AQ2B 3J80i 2F0UA 3KK7A 1B50A 2HT1A 2K05A 3U50C 2L15A 1QOHA 4KI0A 2NVQB 3KF6A 3E0JA 3DHQA 1XNRQ 1MJCA 2YTVA 4IN3A 5ELOA 1EEFD 4ZUJA 5KGUA 1LTSD 1T5XD 3OSOA 2BH8A 2R92H 5LMUL 1F2YA 3BU2A 1LV9A 3E6ZX 3T16A 4X64L 1O7ZA 3KF8A 1E7ZA 1Q3LA 2L4NA 3PIO3 1KHIA 1YNJD 4BBRG 4C2MB 2VQEQ 4NXML 5C0XH 1DGSA 5IYBH 3GV6A 4EQOA 3H0GB 2B63G 3BVGA 1ESFA 1ICWA 2ID0A 1U4RA 2CQOA 5CV4A 2JA9A 1Q7YC 1STNA 2AUKA 1WD1A 1UUPA 4MNOA 2Q8IB 3RN5A 4MTNA 1B1ZA 4L5RC 2YTYA 4X6AH 4IJHA 5KNCA 4L6TB 3TSSA 1XNRL 1ET6A 3DWAA 1IYVA 2CW0D 1K9MC 1WYDA 3CP0A 3NTHA 3STBD 1AZQA 1U4MA 3HOVB 3OW7A 5C6AA 3BVMA 4DR7Q 5C4XH 4JOIC 4KHPQ 5LHY1 3PIPA 5JEAH 3I56A 2YTXA 1VCIA 2AKWB 1WTQA 4GN4B 2ZM6Q 1CI3M 3AQQA 3I3CA 4GLXA 1Q12A 1D5MC 4EQ5A 4KKSA 1E1TA 2VQEL 3K57A 4DV6L 5I6WA 1YNXA 4HIKA 4O2DA 2YYZA 3CQZB 1BBUA 1SXTA 1PZJD 3C1FA 3GTJB 1VQGA 2Y0SE 2B2WA 3BS1A 3D4WA 2F4VQ 1QNKA 1Z7TA 2RCFA 1HTPA 2M00A 5I9PA 1SNDA 4HSVA 1CSPA 5EAYA 1BDOA 5CV6A 1WI5A 3P20A 1F2ZA 1QWYA 4HMIA 3M3YH 1YHQA 2AMCB 4CJ2C 5IYCH 1TWFH 3DM3A 4YIJA 4JYAQ 2I5HA 4YCVA 1BNZA 1A15A 1F9RA 2VW9A 1WTWA 4K0KQ 4R8IA 1VQMA 5C4HA 2D62A 4DR7L 1X3FA 4KHPL 1GJXA 1PH6A 4QQBX 4DK6C 4A3BG 2D5DA 1HR0W 1VQIA 3KF6B 1DCZA 4WJ3M 1CM9A 1GOZA 2OXPA 1GUGA 3H15A 4A93G 3HOUG 1Y1VB 1MSHA 3H3VC 1QG7A 1QJOA 2F4VL 4GKKQ 5I4DA 1EWCA 5FLXL 4A3IH 3KF8B 1JJCB 4C3HB 1OTCA 2KHSA 1WCMG 3KYHC 3GV3A 4TQUS 1TS4A 1ZYRC 5KYIA 2F0PA 4JYAL 1HHVA 2QDLA 1UE1A 4MTKA 3RUZA 3OTOQ 2MFIA 4K0KL 3MXUA 5J1ZA 2R92B 2K75A 2EIFA 2PI2A 1JMCA 5M5WH 4IUNA 2IW3A 1B3QA 4LF5Q 2B2VA 2EYOA 1A3TA 1HFGA 3FPUB 2XN9C 1ESRA 5K36H 2R61A 1HXYD 2CWAA 4JI7Q 4OGQC 1TVXA 3MXNA 3ERQA 1NTGA 4G7ZC 3UE0A 1WTVA 4GS3A 2LSSA 4HCSA 1PTOB 4KN7C 2K01A 2KBNA 1ML0D 1O78A 2F0QA 3SGIA 3HOWG 1IBMQ 3BDLA 3GTLH 3PSIA 3BYYB 4ZCKA 3S1RH 5LL6X 1C4QA 2OTLA 4OX9Q 3P7JA 4NP5A 1VQDA 3FHWA 1BF4A 5M3FG 2OT2A 1R4QB 3OTOL 2D2CC 2X6GA 1U4PA 2B39A 5C4XB 5DAUA 1XMQQ 4KKUA 4LF5L 1AE2A 4ZAIA 4IO9A 4A3KG 2WKCA 1JORA 1NMFA 1JICA 2KCTA 1V43A 1HPCA 2RSOA 5A2QE 1HH2P 4JI7L 1X6OA 1JB7A 1W3SA 3CPWA 1HZCA 4RKLA
chains in the Genus database with same CATH topology
1ICFB 4OELB 4CDCC 4CDDC 1K3BC 2DJFC 1MHWC 2DJGC 4OEMB 4CDEC 4CDFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICF B;  4OEL B;  4CDC C;  4CDD C;  1K3B C;  2DJF C;  1MHW C;  2DJG C;  4OEM B;  4CDE C;  4CDF C; 
#chains in the Genus database with same CATH topology
 4ID6 A;  5J3B A;  2KEE A;  3GQB A;  1LTT D;  2WFW A;  1SJH D;  3IKJ A;  5ELN A;  2IX3 A;  5JJK A;  5JJZ A;  2R93 G;  4QUC A;  2A68 D;  3HKZ G;  4OX9 L;  1QZG A;  1TWF B;  2F0I A;  1ET9 A;  3R93 A;  1X55 A;  5JAV A;  4U67 3;  3S1Q H;  1IBK Q;  2C9O A;  1C0A A;  1B9N A;  1EIG A;  1DOM A;  3VYU A;  2RF4 A;  5LMN Q;  1XMQ L;  1SR3 A;  3KUP A;  1UAP A;  1ZEQ X;  1LTG D;  5GRO A;  1TY0 A;  4RHR A;  2IL8 A;  5DLQ E;  2RA4 A;  1EFI D;  2XWJ B;  2D0O A;  2VS1 A;  1I4Q A;  4RGT A;  2XNA C;  2QEJ C;  4APV A;  2OCE A;  4HSP A;  5IP7 H;  4DUZ Q;  4LAA A;  2UUB L;  1BCP B;  4XT1 B;  1SNP A;  3ULL A;  5CMD A;  2BE5 D;  1BVS A;  2PZT A;  4A3I B;  1I4X A;  3D8G A;  4KJO A;  3NQI A;  1SDF A;  1K0S A;  1YBY A;  5EQ0 A;  3L9A X;  5FLM H;  4YCW A;  4KTA A;  2G9H D;  1XNQ Q;  5KYL A;  3I73 A;  3UI2 A;  1TS5 A;  4FNF A;  2F3I A;  3IFD A;  4HIO A;  4YWK A;  1IBK L;  5G3L F;  3MXN B;  2NVT H;  2NN6 I;  4YY3 Q;  4A3M H;  1SBB B;  2QF7 A;  4IUP A;  2ICE C;  1NAP A;  4K8I A;  4YCU A;  3DMU A;  2EPB A;  5M5W B;  1QVF A;  5LMN L;  4A3C H;  1S5F D;  3TP7 A;  1NNX A;  4FXD A;  5LMN W;  3PO3 H;  1PA6 A;  1MHW C;  3FDT A;  2Z6K A;  1PDQ A;  4KN4 C;  1S3O A;  4B3M Q;  4UY8 C;  1N36 Q;  2XSC A;  3G6E A;  2XTI A;  1HZA A;  1DON A;  4BY1 H;  4G7H C;  3E5S A;  4DUZ L;  3JAM i;  1LTL A;  4DV5 Q;  1P8L A;  2NN6 G;  4FXK C;  3H0G G;  2VNU D;  1AH9 A;  1L1O A;  2ZTC A;  1I5F A;  3GTL B;  1VQC A;  3OHX C;  3V05 A;  4EGV A;  3S1R B;  3RLF A;  2JA7 H;  3NQT A;  2F0V A;  4WJW A;  2AWO A;  2KED A;  4DV3 Q;  4JI4 Q;  2PZW A;  4IJL A;  4Y7N H;  3GTG B;  1Q86 C;  4JW0 A;  2F0G A;  1B3A A;  3M9B A;  3PCO B;  4J6H A;  1SE4 A;  5DM7 3;  2UXC Q;  4IFD I;  1EY8 A;  5AFW A;  3UE1 A;  1PTO C;  4YY3 L;  1E22 A;  4MIU A;  1FYC A;  3K5O A;  3HOV G;  3OWF A;  5IWA Q;  1LT4 D;  4O42 A;  1UE6 A;  3CCJ A;  2L11 A;  3PUW A;  4F7X A;  1G2T A;  2A8V A;  1EQV A;  4J1M A;  3NEL A;  4B3M L;  1BOS A;  3EJI A;  2JA6 B;  1N36 L;  5JPM C;  2YV5 A;  3TP8 A;  1CK1 A;  4K2K A;  2WB1 G;  1PFM A;  4A3F H;  2FIN B;  3T13 A;  4DR1 Q;  1I3Q H;  4IFD G;  5JVH 3;  4DV5 L;  4DR2 L;  2HIV A;  3H3V H;  3SEB A;  4JPB W;  4O0A A;  4JG2 A;  1TWC H;  1WD0 A;  1RDP D;  5D14 A;  2WAC A;  4QIW B;  5C4J H;  1JR0 D;  4C3J H;  4BA1 I;  4DV3 L;  1FNU A;  3RZD B;  4JI4 L;  3SVM A;  1Z9F A;  1H9J A;  2ES2 A;  3MHB A;  1PH4 A;  3S1Q B;  1O7L A;  4DU9 A;  4DFA A;  2CH4 W;  2UXC L;  5LL6 S;  3J7A 5;  1X3P A;  3CW2 C;  1Q81 C;  1M90 C;  3MVV A;  5IWA L;  1FGU A;  2IT1 A;  1OXT A;  5DEH A;  5IIF A;  2Q2H A;  5IP9 H;  1VMP A;  1I4H A;  2MPM A;  1JJG A;  1XMO Q;  3QOL A;  1AP0 A;  5IT9 c;  4DK3 C;  1XYI A;  2NVQ H;  5H1S E;  2RVL A;  5CV5 A;  1HUN A;  3S1M H;  2IX1 A;  1Y1V G;  3HKZ E;  3NE5 B;  4A3G G;  2VQF Q;  1U4L A;  2JA5 H;  3H91 A;  3G4S A;  4P75 A;  3GP7 A;  1CKO A;  2E75 C;  4EX5 A;  1B4O A;  3E3X A;  2R7F A;  5CC4 A;  1SFO H;  1STH A;  1EY7 A;  1GO3 E;  2NVY H;  4AQY Q;  2SEB D;  1CFM A;  1TWH H;  3HRZ C;  3A74 A;  4GKJ Q;  3MEH A;  3J81 L;  3URY A;  3IAY A;  1PH1 A;  2DN8 A;  5C0X I;  1YJW A;  5C3E H;  2FFK B;  3QG1 A;  2A73 B;  3VR3 A;  2NVT B;  1Y1W B;  5COY A;  3HOY H;  4BY7 H;  4A3M B;  1JB3 A;  1BCP C;  2Q2T A;  3NBI A;  4K14 A;  5IT9 E;  5CV9 A;  2A69 C;  1F2L A;  2R92 G;  3T1Y L;  4FF1 A;  1L1O B;  1HA6 A;  3PO3 B;  2B2V C;  3M85 A;  2JQO A;  3U9O A;  1XMO L;  1KXL A;  2IJ0 A;  2XIW A;  3M4Q A;  4BY1 B;  5C0X G;  4FXG C;  5A35 A;  4HID A;  4DPG A;  1HJP A;  2EJM A;  5IYB G;  2Q8R E;  3OIP A;  2VQF L;  1KC8 C;  2JSO A;  2PMZ B;  2LXJ A;  1YNN C;  4LFC Q;  4JI0 L;  1DOK A;  1WTO A;  5I6Y A;  2QW7 A;  4I65 A;  2JA7 B;  3VR2 A;  3D31 A;  3DXJ C;  4QJF A;  2WV6 D;  4GKJ L;  2F0D A;  4Y7N B;  4OO1 H;  3SDZ A;  5HY6 A;  1G8Z D;  4DXG A;  4J15 A;  3TRZ A;  3NUC A;  4R9W A;  5ELE A;  1PRT C;  1UEB A;  2SNS A;  5TSS A;  4FF4 A;  2PYK A;  3AFQ A;  3BDO A;  4CHT B;  2UUA Q;  4UHV A;  1Z47 A;  4Y52 H;  4IOA A;  3D6C A;  3QWN A;  4CDD C;  5EKK A;  4LF6 L;  3TS0 A;  1JWM D;  2EZV A;  2ASB A;  1XPR A;  3RLN A;  5C4X G;  1YZ6 A;  1ILQ A;  1TU2 B;  4ABN A;  2VL6 A;  5EPJ A;  3O13 A;  5JEA G;  4LF8 Q;  3KOJ A;  3PF4 A;  1ZKO A;  3CC4 A;  1A2T A;  4DNT B;  2K5Q A;  2E8G A;  1AEX A;  2VB3 X;  4O1N A;  1LO5 D;  2MGS A;  4A3F B;  2HQE A;  2F0O A;  4IPD A;  1GUO A;  1I3Q B;  2LXK A;  1BBW A;  1EL0 A;  1PFN A;  2EY2 A;  4OON A;  4LFC L;  3S16 H;  2N55 A;  3ZYY X;  2MP1 A;  3L0O A;  4WFN 3;  3CAM A;  3RD4 A;  4MN3 A;  3SXH A;  4GZY C;  5IYC G;  2WII B;  2BOS A;  1VMC A;  5EBD A;  2CKZ B;  4DK0 A;  4KY5 A;  4R4O A;  3RZO H;  1GUS A;  1CHP D;  2KCM A;  4OL7 A;  4GNX C;  1NJI C;  1JQY D;  1UE7 A;  4M1U B;  2FMM A;  3M4P A;  1VQE A;  2WB1 E;  3BZK A;  4TKO B;  2N49 A;  3A5Z B;  2I0Q A;  4DR4 Q;  3HFZ B;  4LF8 L;  3A54 A;  5EPL A;  4XQN A;  4HJ8 A;  4BA2 I;  4DV1 Q;  4G4K A;  1IKM A;  2F0N A;  4XQJ A;  4C3H H;  2UXD Q;  1KDB A;  1JWU D;  3BJU A;  4DV7 Q;  3S1M B;  3R2I A;  4B3S L;  3WDN A;  2ZJR A;  2DUD A;  2JA5 B;  2K50 A;  3I4O A;  2CFM A;  4DN4 M;  2R3Z A;  3HOX H;  1SFO B;  4GLV B;  4PMB A;  4NMZ A;  4A3I G;  3MC0 B;  3KBX A;  2NVY B;  1OXX K;  1J5E Q;  1SRU A;  1TWH B;  2ENB A;  1EU3 A;  3IRB A;  2GVA A;  4LFB Q;  3ND9 A;  4NDX A;  5C3E B;  3AU7 A;  5GAD C;  1PZK D;  4RKB A;  3HOY B;  2K28 A;  2K03 A;  4BY7 B;  3PGZ A;  1EUJ A;  2F3W A;  1QE6 A;  4K8J A;  3J81 j;  4IPG A;  1N33 L;  2FJ2 A;  4HAE A;  4OEM B;  1PTO H;  4DR4 L;  3OPO A;  1GUN A;  1NCV A;  3G7L A;  4OIJ A;  1I94 Q;  2Z6K C;  1S40 A;  3NWS A;  4A3D B;  3FRP B;  1D1I A;  1OXV A;  1X54 A;  4DV1 L;  5K36 G;  3WOF A;  5ELC A;  5M9O A;  2UXD L;  5JVG 3;  4G7O C;  4NB3 A;  5BR8 Q;  4DV7 L;  4A76 A;  2WAQ B;  4IUR A;  1A62 A;  4RHS A;  2K7V A;  3GO5 A;  5FLX c;  1U0L A;  3K59 A;  3OMC A;  3R2T A;  5IOC A;  1L1O C;  1R9T H;  1UE5 A;  1L0Y B;  4A3L H;  1J5E L;  2WIN B;  4OEL B;  4Z9C B;  1GXD C;  3F2U A;  4LFB L;  2HQL A;  1ZYR D;  3I8Z A;  2KOL A;  2NUC A;  1HRJ A;  4X3S A;  5J22 A;  2GN5 A;  4ZLT F;  1SE3 A;  5EKL A;  1SE2 A;  3ERS X;  1KNA A;  4IFD J;  1VQH A;  4IUQ A;  4KK7 A;  2P5Z X;  3ITP A;  1PLF A;  3QJY A;  2DGY A;  5IGF A;  1DXM A;  2E2I B;  2VB2 X;  1I94 L;  3CD6 A;  2UUC Q;  2I5M X;  5FLX E;  4JI6 Q;  1Q46 A;  4X65 Q;  1DOL A;  4TSS A;  2K5W A;  4KHV A;  4HR7 B;  2KEC A;  2RKS A;  4P73 A;  4ZKC B;  2O5J C;  1C8C A;  2R7Z H;  3S16 B;  3V96 A;  1K8A C;  1KL9 A;  1KIX A;  4B9W A;  1G29 1;  2EE1 A;  1VS0 A;  2X6L A;  3JC6 6;  1X3Q A;  3J80 L;  5KRU A;  5C44 H;  2V1C C;  2TMP A;  5EPK A;  2ZM6 L;  1PZI D;  1KD1 C;  5IOD A;  3RZO B;  1SMX A;  2QGQ A;  1SSO A;  2OQK A;  3K7U C;  1T9H A;  1TII D;  2PNR C;  4CKC A;  2E5L Q;  4K5W A;  3A8J E;  5I2X A;  2AHO B;  4QB4 A;  3KBG A;  5E1F A;  3NHH A;  1ENF A;  1S5E D;  4RMF A;  4LW1 A;  4GN5 A;  3MTS A;  1IZ6 A;  2UUC L;  2LY7 A;  4BBS H;  2K04 A;  3EA6 A;  3PIP 3;  2ZJQ A;  2VY3 A;  4PZ8 A;  4JI6 L;  1LTI D;  2BH2 A;  5KEE A;  4RA8 A;  4N8X 1;  4YWM A;  4C56 C;  1WFQ A;  3SE0 A;  4H7B A;  5FK9 C;  5IP7 G;  2MUY A;  5E7N A;  1JCK B;  5GAH C;  4LUV A;  1L0W A;  3EFX D;  1TQO A;  3FPP A;  3GTK H;  3ERO A;  2GVB A;  1K3B C;  3EQL C;  3HOX B;  1EYD A;  1KNE A;  4ZUI A;  2A5H A;  3A7L A;  2F0L A;  3CCE A;  4LF7 Q;  2KCN A;  4N9T A;  1DJR D;  1GKH A;  4L5Q A;  4FYD A;  5FLM G;  1E2Z A;  1MGS A;  2MO1 A;  2CWP A;  4BXX H;  1RCV D;  2BDO A;  5C0X J;  4CKE A;  4B08 A;  1N8R C;  2FMC A;  4NW2 A;  1E1O A;  1Y1W G;  1HQR D;  1HQM C;  2DY8 A;  3K81 C;  5IGE A;  2E5L L;  4A3M G;  3I4N H;  2CVR A;  4A3C G;  2PPB C;  1STE A;  2N78 A;  5IGC A;  1WOC A;  2JA8 H;  2EY1 A;  2AUJ D;  4KLK A;  3PO3 G;  1TT2 A;  3TQY A;  3W2D A;  4GKK L;  1V8Q A;  3K80 C;  3GTP H;  1AFP A;  3D0F A;  1SYD A;  1LTA D;  1QVC A;  4P71 A;  3VR4 A;  2PI2 E;  2A19 A;  2ICI A;  4FO2 A;  1XX8 A;  2IWH A;  4BY1 G;  1Y69 U;  3NTI A;  2Y0S B;  2EY6 A;  3N52 A;  2ZTE A;  1E3P A;  3UDF A;  1EFW A;  3GTG H;  4GLA C;  5JPN C;  1PYS B;  5C3W A;  3KJO A;  1A63 A;  1O7I A;  1R9T B;  4CDF C;  4C1N I;  4LJZ C;  1X65 A;  4K6D A;  3D6W A;  1TWA H;  2NVX B;  5JEA J;  1FR3 A;  1NR4 A;  1TS3 A;  2JA7 G;  4NXN Q;  1H9R A;  3FP9 A;  1RF2 D;  1EEI D;  4NKL A;  2B8G A;  1PV4 A;  4AYB B;  3TRE A;  1LAB A;  3PUZ A;  2VUM B;  2JA6 H;  1E2W A;  2E74 C;  2NZH A;  1DZ1 A;  1RHP A;  1YHB A;  2PNH A;  3H3V I;  5EGT A;  1EY4 A;  1TKW B;  2K5N A;  2NYZ D;  4DA2 A;  1RTO A;  1SYC A;  3MA2 B;  4OXP A;  1IBM L;  1B44 D;  2KVM A;  4QCL A;  3CU7 A;  5K5P A;  1D6E C;  1K8M A;  4QL5 A;  1S5C D;  3S9W A;  3RZD H;  3W1G A;  4A3F G;  4DGZ A;  1M4V A;  4OWX B;  1O7Y A;  1CT1 D;  2R7Z B;  4GNX A;  2XRS D;  5CGK A;  4ME3 A;  1NR2 A;  3S2D H;  3VR5 A;  4WJ4 A;  2JXM B;  3QO2 A;  3GDE A;  3MFG A;  1XPU A;  2A1A A;  5C44 B;  3J7A V;  4C3J G;  5T1G A;  1SYE A;  4JI5 Q;  2Z8L A;  4LK1 C;  2EVB A;  4DAM A;  1J6Q A;  1IBL Q;  1I6V C;  2B2U A;  2HD3 A;  1D5Z C;  1PTO D;  4PQX A;  4QMG A;  4GOP C;  1HZB A;  1JWS D;  1CA5 A;  2L9H A;  4H44 C;  3NBH A;  3AYH B;  3PV0 A;  4IPH A;  4A3E B;  5IP9 G;  3MXG A;  1VQB A;  1EYC A;  1ONL A;  3OMG A;  5C5L A;  4BBS B;  2J4X A;  5IE8 A;  1I50 H;  1KAB A;  2F0S A;  5A2Q L;  5F2D A;  1MI2 A;  3QR8 A;  1FL0 A;  3K0Y A;  4L5S A;  1H9S A;  4PZ6 A;  2AWN A;  4QIW E;  2EXZ A;  3LGJ A;  1CHQ D;  2JA5 G;  3AEV A;  3GTK B;  1HTL D;  3A55 A;  5I2Y A;  1Y1W H;  2G5D A;  5FKA C;  2IHE A;  1L2F A;  1SNQ A;  2F0W A;  1EZ6 A;  4DAY A;  2HHH Q;  3E0E A;  1DM0 B;  1SN8 A;  1IW7 C;  1EQR A;  5D65 A;  5C5M A;  4JI5 L;  1YIT A;  2EJG C;  1L0X B;  5C3E G;  1IBL L;  1PXU A;  3B6Y A;  3J7Y W;  3HOY G;  3EVQ A;  1QVG A;  3NP8 A;  2IY5 B;  1PRT B;  4HMJ A;  4KKT A;  3I4N B;  4BY7 G;  3QOJ A;  1D7Q A;  1X56 A;  1FNW A;  5IGB A;  2JA8 B;  1JOK A;  2NWG A;  2K33 A;  1SNC A;  1VF5 C;  1ASY A;  2OEO A;  3GTP B;  3T51 B;  3D3R A;  4OO1 I;  1X9N A;  1A3U A;  4A3D G;  1MSG A;  3I2Z A;  5L37 A;  1BKB A;  2E2H H;  1XNQ L;  3KJP A;  2A6H C;  2XRQ D;  4H13 C;  3KFU A;  1K8O A;  5EKI A;  3QIA A;  4RGN A;  4IPC A;  1TWA B;  1TWG H;  3KLS A;  2HCI A;  1CQV A;  2HHH L;  3PUV A;  3J81 c;  2E2D C;  3NSW A;  4KJN A;  1N9W A;  1ROD A;  5E4W C;  4OO1 G;  3W5O A;  4LUZ A;  4X3K A;  4JI1 Q;  3TZU A;  2F0K A;  3I91 A;  2RDF A;  5AJ3 Q;  1BCP D;  2A69 D;  5CBE E;  5JJI A;  4X62 Q;  1I4P A;  3QB3 A;  3HP3 A;  4GNX B;  3MFY A;  4MHE A;  1HA5 A;  4DUY Q;  4UP8 A;  2Q8T A;  1V9P A;  3E9H A;  4P2C B;  1JOO A;  2AQ1 B;  4LNQ A;  1GD7 A;  2K5D A;  4F8M A;  2M9V A;  1RKN A;  2EDG A;  2GA4 B;  4CKB A;  3CCR A;  2LKV A;  3J81 E;  1LT3 D;  4IOC A;  3A0J A;  2L12 A;  3KDF A;  1YNN D;  3I55 A;  3E9I A;  3TME A;  2N8N A;  1PHJ A;  3S2D B;  5M3M H;  3NBH B;  3OYY A;  2CHB D;  2K5V A;  4YHH Q;  1GHJ A;  1PRT D;  3SK6 A;  2IHF A;  3S2H H;  1RJT A;  1YI2 A;  4JI1 L;  1H9S B;  5AJ3 L;  4IZ8 A;  5ELF A;  2JYO A;  3OWE B;  1C7Y A;  2PZU A;  4X62 L;  2K1B A;  3MWY W;  4OWT B;  4DR1 L;  2KEN A;  3T1H Q;  4POF A;  1WVL A;  1PFB A;  1I4R A;  1DYQ A;  1I50 B;  4DAY B;  4OWW B;  3H09 A;  3BZD B;  1ENA A;  1M8A A;  2D0P A;  2LS0 1;  3GD7 A;  4C3H G;  2EYH A;  4X66 Q;  3S17 H;  1HUM A;  5CBA E;  1HNW Q;  1NBW A;  1EY5 A;  2WP8 J;  4PZ7 A;  4N8F A;  1N34 Q;  3I4M H;  1KQS A;  3P1H A;  1JE4 A;  4H02 A;  1PH2 A;  3CCL A;  3K58 A;  4JBJ A;  4DAV A;  3FVQ A;  1D2B A;  3HOZ H;  3HOX G;  3JAM L;  1VQK A;  3U4V A;  1STB A;  4FDB A;  1EYA A;  4K6L A;  4YHH L;  3A8K E;  3CHB D;  1WTR A;  3F2C A;  3NEM A;  4H0L C;  4A3D H;  1JT8 A;  4IUU A;  3T56 B;  4JVZ A;  4MZ9 A;  4DR6 Q;  1F9S A;  2K5H A;  3NK9 A;  2M2L A;  3T1H L;  1BUV T;  3K5L A;  1UNS A;  1B8A A;  3MEF A;  1QCB D;  2MNA A;  1AN8 A;  3IFT A;  1CKM A;  4L5T A;  2FHT A;  3SK5 A;  3A7A B;  4XIG S;  4XTC S;  4AQY L;  1CKN A;  1HZ9 A;  1KAA A;  2NZ1 D;  1Q90 A;  1MJE A;  4LF9 Q;  2O5I C;  4ZQ3 A;  4X66 L;  2E2H B;  5HUR A;  2F03 A;  4CDC C;  2Y0S G;  3GTM H;  5FJ8 H;  5M5Y H;  1OXU A;  2B2T C;  3UDG A;  1TWG B;  1TS2 A;  3CCS A;  1GVP A;  2HCC A;  5CR3 A;  1RD9 D;  4A3L G;  1X3E A;  3K5M A;  3SHL A;  4XXE A;  2E2J B;  1V1P A;  1PYW D;  1N32 Q;  3PO2 H;  4V0B A;  2E2I H;  4FF2 A;  4AYB G;  1SLJ A;  2RHQ B;  4AIM A;  2H5X A;  4RAU C;  1GUT A;  2JEA I;  4DR6 L;  1FGB D;  3KDF B;  2XWB B;  1SE8 A;  3F8T A;  1STY A;  4ME5 A;  5I9O A;  2KCC A;  3TN2 A;  2PO4 A;  1NMG A;  1VQ7 A;  2KA7 A;  4LFA Q;  4LWC A;  3MZ5 A;  3UDI A;  2R93 B;  2EYF A;  5JJL A;  4LF9 L;  3Q23 A;  1VQN A;  3PIO A;  1KDC A;  4DAP A;  1OO9 B;  1ZXT A;  3OIQ A;  2DJG C;  1J8I A;  2Z1C A;  3CCM A;  1A6X A;  1ILP A;  1EIY B;  4GOP A;  2UUA L;  2R7Z G;  5M3M B;  1AZP A;  5FO7 B;  4IUV A;  2WKD A;  2BCO A;  1SMY C;  2MQH A;  1BQQ T;  4IAL A;  4X64 Q;  5C44 G;  4JBM A;  3ER0 A;  3HZX A;  1N32 L;  3S2H B;  2NB0 A;  2ZXO A;  2N88 A;  2J7Z A;  1JOQ A;  2B2U C;  1F9P A;  5DNF A;  4DV0 Q;  1GM5 A;  2B2Y C;  1HNX Q;  3V2T A;  2F3V A;  1V1Q A;  4KHZ A;  1LLR D;  1YIJ A;  3DWQ A;  4LFA L;  1YEZ A;  4BBS G;  4L8J A;  2RHS B;  2PQE A;  1LM0 A;  2ZJP A;  3S17 B;  3CCQ A;  4KY7 A;  3PF5 A;  1HCZ A;  1VQ8 A;  3I4M B;  4B3T Q;  2K32 A;  4V19 0;  1D1K A;  1ICF B;  2EYP A;  3W1B A;  2H4O A;  4R4T A;  2IPK D;  1EYG A;  3HOZ B;  3I90 A;  3J80 c;  1WTX A;  4DKA C;  2A74 C;  4YWL A;  2BDN A;  2V4D A;  1X32 A;  2A6E C;  2IX0 A;  4K5V A;  1S72 A;  4LF4 Q;  1SEB D;  3Q22 A;  2C5C A;  1LTR D;  2F0M A;  2UU9 Q;  2B3G A;  4U68 A;  1F2M A;  3HGB A;  3K7A H;  1XJV A;  1G6Z A;  1IL8 A;  4BXX G;  1CKN B;  1YHA A;  3S24 A;  4XT3 B;  4RFB A;  1P16 A;  3GTO H;  4DV6 Q;  1BO0 A;  4C1N K;  3I4N G;  4DV0 L;  3CCV A;  4A3J H;  1FD7 D;  2EOT A;  2I46 A;  1HNX L;  2JA8 G;  1STA A;  4EQN A;  3TP5 A;  3PQI A;  2L5T A;  4DF7 A;  2OTJ A;  1AW7 A;  3M7G A;  4QUF A;  2NVX H;  1KRS A;  4HTH A;  1V1P B;  1WJJ A;  1YVC A;  2F0T A;  3J80 E;  2PW7 A;  4X3T A;  3KLS X;  3GTM B;  1VQ5 A;  4B3T L;  2RQX A;  3FKI H;  3DLL A;  3BYT B;  5M5Y B;  1G51 A;  2NZO A;  4ODG A;  2VUM H;  5J39 A;  1IKL A;  4JBK A;  4UP9 A;  5HGQ A;  1VQ6 A;  2Z9H A;  1RIP A;  1PH5 A;  4LF4 L;  4DNI A;  3RLO A;  1QNU A;  4JBW A;  2UU9 L;  1F9Q A;  3PO2 B;  1BR9 A;  1Q8K A;  1HR0 Q;  1OXS C;  3RN2 A;  1G91 A;  3D4D A;  2F52 A;  1F77 A;  4CGY B;  2Z0S A;  1JC7 A;  1II3 A;  4X3U A;  2JA6 G;  4FP5 D;  3L3O C;  3TBI B;  3G48 A;  5BR8 L;  1QIL A;  2WB1 B;  2JN4 A;  1HNZ Q;  4GOP B;  3TS2 A;  1VQJ A;  2B8F A;  3F1Z A;  1J9O A;  3M4O B;  1SYB A;  2ATW A;  2ZTD A;  4NPS A;  1C48 A;  3GTQ H;  1NSN S;  4RGM A;  3CKI B;  4I7A A;  3K8A A;  3OOC A;  3EBE A;  4R4I A;  1I6H H;  4IUT A;  4DR5 Q;  3FMC A;  4UPA A;  1CTM A;  4C3I H;  5ELB A;  4KD4 A;  4AYB E;  3Q0A A;  3G6J B;  1YNJ C;  1NE3 A;  2O2L D;  2NBF A;  1K28 A;  1B9M A;  1H9M A;  5E3F A;  2K4K A;  4A3E H;  1PH3 A;  5IYD H;  5GAG C;  1HR0 L;  1LT5 D;  4RCO A;  1EU4 A;  3IL8 A;  2HDL A;  5C4Z A;  4X65 L;  4K2L A;  3C1E A;  2KHJ A;  3VA7 A;  1KAW A;  1KDA A;  1CQF A;  3PUX A;  3ULJ A;  1HNZ L;  4B3R Q;  4A3G B;  5FO8 B;  3H6M A;  1NUC A;  4LUO A;  1VQL A;  1E2V A;  2CW0 C;  3I7F A;  3STB C;  3U58 A;  3L7Z C;  2N3S A;  1XPO A;  1TXY A;  1S4Z A;  1KRT A;  4R8N A;  4ZRZ A;  2KQ3 A;  2PCF B;  4CJ1 B;  4DR5 L;  3A5U A;  3VYS A;  3ULP A;  4BBR H;  2XVS A;  3SK8 A;  1C9O A;  3D4R A;  1VQP A;  3S15 H;  4A4I A;  1CSQ A;  2MO0 A;  2B63 H;  2SNM A;  3K7A B;  3A56 A;  2G9D A;  1H9K A;  4P74 A;  1SYG A;  2ZXP A;  5HGT A;  3GTO B;  1MKH A;  4HED A;  1PH7 A;  2XGT A;  1LT6 D;  4B9X A;  2KJX A;  5M5X H;  4A3J B;  4B3R L;  2B2T A;  1B2T A;  3LX0 A;  2Q2U A;  1IL2 A;  2VXW A;  3P75 A;  1G6P A;  1STG A;  5KIX A;  1RL2 A;  2QDB A;  4XYO A;  4LF7 L;  1GHK A;  5KND A;  4ULL A;  5D3I B;  2LMC B;  3M4Y A;  4POG A;  4F88 A;  3TP6 A;  3FKI B;  3G71 A;  5NUC A;  3J7Z C;  2ZXR A;  1FVI A;  3S14 H;  2AQ3 B;  3CCU A;  2F0H A;  3RR5 A;  2R6G A;  5ISR A;  3CF5 A;  4R1J A;  4RCN A;  1MD2 D;  1WTH A;  1IW7 D;  3NTK A;  4HJ5 A;  1BXT A;  1HFN A;  1U9R A;  3K6O A;  3DEO A;  1VQ9 A;  1GUW A;  2QCP X;  2NTT A;  4G57 A;  2C35 B;  1EWI A;  2SOB A;  1QZH A;  5FOB B;  4OHJ A;  2UUB Q;  1CZG A;  1M1K C;  1X3G A;  3R3O A;  4R4C A;  3GTQ B;  1EY0 A;  1IHZ A;  1TR5 A;  1LUZ A;  4NXN L;  3EIV A;  2MHV A;  2A6H D;  2F0E A;  1EOT A;  3Q8D A;  1VF7 A;  1EWH A;  3K5N A;  1UEA B;  3M3Y B;  3BG3 A;  4PMW A;  1I6H B;  4A3B H;  3UDX A;  4C3I B;  5FO9 B;  1A3V A;  4JV5 Q;  1K73 C;  2EJF C;  5G3L D;  5M3M G;  4A93 H;  4JK1 C;  3HOU H;  2B2Y A;  1LTB D;  1SRO A;  4DXF A;  2CCZ A;  3AFP A;  1UWV A;  4CBV A;  4KD3 A;  2EYL A;  1VQO A;  3BVZ A;  4XYQ A;  3I4L A;  3KLR A;  5DM6 3;  1WCM H;  3SK4 A;  4RG1 A;  3EN2 A;  1RTN A;  3J7A F;  1B70 B;  2DY7 A;  3HS0 C;  2SDF A;  3C2P A;  3RMH A;  2OQ0 A;  1YJN A;  3HEJ A;  1K0R A;  1PMR A;  1W6K A;  1FJG Q;  1WTP A;  1Y8O B;  4UAI A;  3I4M G;  2JEB I;  1JE5 A;  1PTO F;  4BBR B;  3NWT A;  1ASZ A;  5EJW A;  4ALP A;  5CV8 A;  1Q82 C;  4JV5 L;  1EQT A;  4RGO S;  3X3N A;  3HOZ G;  5GAE C;  2K14 A;  3S15 B;  3R8B A;  2F0J A;  4RWS C;  1VQF A;  2B63 B;  1VDZ A;  1W2B A;  1PYB A;  2CH4 A;  1KLG D;  3J81 i;  3HOW H;  4HJ7 A;  4E6I A;  5IY0 A;  4QF4 A;  3S1N H;  4QGU A;  4EVO A;  5D3D A;  2JK8 A;  4DNR B;  5M5X B;  2WAQ G;  2A68 C;  4J8Q A;  3I70 A;  5EBC A;  1V1O A;  5IGG A;  1NY4 A;  3BZC A;  3VYT A;  2B29 A;  3CC7 A;  5M3F H;  1E0B A;  4DR2 Q;  2HDM A;  4HIM A;  3ZJY C;  3HKS A;  5COR A;  2L1B A;  3DEP A;  1SNO A;  4JOI A;  1XXG A;  4CJ0 B;  4JI2 Q;  2BA1 A;  1QB5 D;  1XTC D;  3AB9 A;  4PNY A;  5IGD A;  2YU9 H;  1Y8N B;  4A3K H;  2E2J H;  2PQA A;  1FJG L;  5FJ8 G;  3S14 B;  1KTK A;  3RNU A;  3JAM c;  2L55 A;  3CPF A;  4CDE C;  4GN3 B;  4JI3 Q;  1BBX C;  3Q6S A;  4S3S A;  2QEX A;  2I5L X;  3NPP A;  2RCN A;  1O80 A;  4HJ9 A;  4DK1 A;  1K83 H;  3LWE A;  2QIL A;  3PO2 G;  3CC2 A;  1Z6H A;  4RH6 A;  1A0I A;  3L2P A;  2PMZ E;  3VA5 A;  2BE5 C;  3VDY A;  2OWO A;  4XQQ A;  4JC0 A;  2R93 H;  5JOB A;  4WOR A;  3H94 A;  4IQZ A;  1XWE A;  2BA0 A;  4QY7 A;  3OW2 A;  3TZD A;  2B2W C;  1D5X C;  1G2S A;  1B53 A;  3BDC A;  3JAM E;  3PUY A;  5CV7 A;  2FXQ A;  4JI2 L;  3NXW A;  5ELD A;  1CA6 A;  3N6R A;  2EXD A;  3LWU A;  3ICE A;  4A3B B;  2RSN A;  1BCP F;  3VYR A;  3DM1 A;  4HN7 A;  4F87 A;  4FF3 A;  4DV4 Q;  4JI3 L;  1EY6 A;  2X69 A;  4Q0F A;  5BN4 A;  1LAC A;  3FEW X;  4HJA A;  3HOU B;  2QKI C;  4DR3 Q;  4A93 B;  2DJF C;  3A8I E;  1VQ4 A;  5C3X A;  4KV6 A;  2QA4 A;  3ND8 A;  3ONA B;  5BN3 A;  3T1Y Q;  1W6J A;  4DUY L;  3KLW A;  5CYU A;  3NEN A;  2UXB Q;  4HCE A;  2TSS A;  5KNB A;  4PV1 C;  3CRL C;  1VQA A;  3C46 A;  1WCM B;  1KLU D;  4LMQ D;  3M7N A;  1E24 A;  1K3R A;  1MBY A;  2F0F A;  2LFN A;  3CME A;  2NTS A;  1QUQ A;  1S5D D;  1Y8P B;  3C3L A;  3T4A C;  4DV2 Q;  1Q1E A;  1IYU A;  3VR6 A;  4JI0 Q;  4BS9 A;  4M8A A;  2VZA A;  1JJ2 A;  4WRD A;  1PRT F;  1EIF A;  3CXC A;  2Z4H A;  4PG3 A;  4AH6 A;  2R7D A;  3WOE A;  4ZYS A;  4R4Q A;  2JP1 A;  2KHI A;  4DV4 L;  1EZ8 A;  4C2M H;  4JI8 Q;  1YJ9 A;  4DR3 L;  1SMY D;  3MXP A;  4LF6 Q;  3AMU A;  4ZKB B;  2NN6 H;  3H0G H;  3PMF A;  2UXB L;  2CQA A;  4N9P A;  3HOW B;  4EQP A;  3S1N B;  3MAQ A;  4UP7 A;  2EY5 A;  1IXR A;  1T5E A;  2EYJ A;  3CRK C;  1U5K A;  4JCV E;  2PQA B;  1K8G A;  1HNW L;  4KMU C;  1CZW A;  4KY6 A;  3WWV A;  1N34 L;  4I7Z C;  4A3J G;  5M3F B;  2D9U A;  4DV2 L;  3U9S A;  3F2B A;  1SJE D;  2Z6B A;  1PVO A;  2EYM A;  2I07 B;  2OF1 A;  3HOV H;  3LNN A;  1FNV A;  1LYL A;  1SAP A;  3DWP A;  1AE3 A;  2E76 C;  4TVA B;  1ENC A;  4A3K B;  2YU9 B;  4L63 B;  2ZT9 C;  4K5X A;  2KUM A;  3Q24 A;  3FKI G;  1EOV A;  3HG9 A;  3W3A A;  2DNE A;  3F2D A;  2VUM G;  3K0X A;  4TRD A;  3TEH B;  4JI8 L;  1A8V A;  1IYJ B;  2O4X A;  3SR1 A;  5IT9 L;  2J0T D;  2A6E D;  1Q1B A;  1SNM A;  3CQZ H;  3GTJ H;  1Y14 B;  4PMC A;  1CUK A;  4IFD H;  2WAQ E;  1K83 B;  1H95 A;  3M4O H;  2JE6 I;  1SYF A;  1R4P B;  3T53 B;  4UDU C;  3TDQ A;  2F4I A;  2Q2I A;  2RDH A;  1S5B D;  4XDX A;  2RBM A;  3HKZ B;  3CMA A;  4P72 A;  3X3M A;  2HUG A;  5E4X A;  4Q5V A;  1A2U A;  4OIK A;  1PFS A;  4B3S Q;  2K52 A;  2PW5 A;  2RDG A;  1I4G A;  4FVM A;  1XTD A;  5T1I A;  1TWC B;  2L0C A;  3I72 A;  5LMU Q;  5C4J B;  4ZK9 B;  4C3J B;  2JJQ A;  3DUZ A;  2EQS A;  5BN5 A;  3U4Z A;  1EY9 A;  4ILW A;  4C3I G;  1Q8I A;  2DNC A;  2K6A A;  1PH8 A;  2ALY B;  1D8L A;  2MJ8 A;  4NXM Q;  2H1E A;  5GQO A;  1EIH A;  4BWG B;  1PH9 A;  1DD2 A;  1QUQ B;  1EQQ A;  2HIX A;  1MIU A;  1Y1V H;  4A3G H;  1B7Y B;  1N33 Q;  2Z4I A;  4A3E G;  1TY2 A;  4A75 A;  5IYD G;  2F1M A;  2AQ2 B;  3J80 i;  2F0U A;  3KK7 A;  1B50 A;  2HT1 A;  2K05 A;  3U50 C;  2L15 A;  1QOH A;  4KI0 A;  2NVQ B;  3KF6 A;  3E0J A;  3DHQ A;  1XNR Q;  1MJC A;  2YTV A;  4IN3 A;  5ELO A;  1EEF D;  4ZUJ A;  5KGU A;  1LTS D;  1T5X D;  3OSO A;  2BH8 A;  2R92 H;  5LMU L;  1F2Y A;  3BU2 A;  1LV9 A;  3E6Z X;  3T16 A;  4X64 L;  1O7Z A;  3KF8 A;  1E7Z A;  1Q3L A;  2L4N A;  3PIO 3;  1KHI A;  1YNJ D;  4BBR G;  4C2M B;  2VQE Q;  4NXM L;  5C0X H;  1DGS A;  5IYB H;  3GV6 A;  4EQO A;  3H0G B;  2B63 G;  3BVG A;  1ESF A;  1ICW A;  2ID0 A;  1U4R A;  2CQO A;  5CV4 A;  2JA9 A;  1Q7Y C;  1STN A;  2AUK A;  1WD1 A;  1UUP A;  4MNO A;  2Q8I B;  3RN5 A;  4MTN A;  1B1Z A;  4L5R C;  2YTY A;  4X6A H;  4IJH A;  5KNC A;  4L6T B;  3TSS A;  1XNR L;  1ET6 A;  3DWA A;  1IYV A;  2CW0 D;  1K9M C;  1WYD A;  3CP0 A;  3NTH A;  3STB D;  1AZQ A;  1U4M A;  3HOV B;  3OW7 A;  5C6A A;  3BVM A;  4DR7 Q;  5C4X H;  4JOI C;  4KHP Q;  5LHY 1;  3PIP A;  5JEA H;  3I56 A;  2YTX A;  1VCI A;  2AKW B;  1WTQ A;  4GN4 B;  2ZM6 Q;  1CI3 M;  3AQQ A;  3I3C A;  4GLX A;  1Q12 A;  1D5M C;  4EQ5 A;  4KKS A;  1E1T A;  2VQE L;  3K57 A;  4DV6 L;  5I6W A;  1YNX A;  4HIK A;  4O2D A;  2YYZ A;  3CQZ B;  1BBU A;  1SXT A;  1PZJ D;  3C1F A;  3GTJ B;  1VQG A;  2Y0S E;  2B2W A;  3BS1 A;  3D4W A;  2F4V Q;  1QNK A;  1Z7T A;  2RCF A;  1HTP A;  2M00 A;  5I9P A;  1SND A;  4HSV A;  1CSP A;  5EAY A;  1BDO A;  5CV6 A;  1WI5 A;  3P20 A;  1F2Z A;  1QWY A;  4HMI A;  3M3Y H;  1YHQ A;  2AMC B;  4CJ2 C;  5IYC H;  1TWF H;  3DM3 A;  4YIJ A;  4JYA Q;  2I5H A;  4YCV A;  1BNZ A;  1A15 A;  1F9R A;  2VW9 A;  1WTW A;  4K0K Q;  4R8I A;  1VQM A;  5C4H A;  2D62 A;  4DR7 L;  1X3F A;  4KHP L;  1GJX A;  1PH6 A;  4QQB X;  4DK6 C;  4A3B G;  2D5D A;  1HR0 W;  1VQI A;  3KF6 B;  1DCZ A;  4WJ3 M;  1CM9 A;  1GOZ A;  2OXP A;  1GUG A;  3H15 A;  4A93 G;  3HOU G;  1Y1V B;  1MSH A;  3H3V C;  1QG7 A;  1QJO A;  2F4V L;  4GKK Q;  5I4D A;  1EWC A;  5FLX L;  4A3I H;  3KF8 B;  1JJC B;  4C3H B;  1OTC A;  2KHS A;  1WCM G;  3KYH C;  3GV3 A;  4TQU S;  1TS4 A;  1ZYR C;  5KYI A;  2F0P A;  4JYA L;  1HHV A;  2QDL A;  1UE1 A;  4MTK A;  3RUZ A;  3OTO Q;  2MFI A;  4K0K L;  3MXU A;  5J1Z A;  2R92 B;  2K75 A;  2EIF A;  2PI2 A;  1JMC A;  5M5W H;  4IUN A;  2IW3 A;  1B3Q A;  4LF5 Q;  2B2V A;  2EYO A;  1A3T A;  1HFG A;  3FPU B;  2XN9 C;  1ESR A;  5K36 H;  2R61 A;  1HXY D;  2CWA A;  4JI7 Q;  4OGQ C;  1TVX A;  3MXN A;  3ERQ A;  1NTG A;  4G7Z C;  3UE0 A;  1WTV A;  4GS3 A;  2LSS A;  4HCS A;  1PTO B;  4KN7 C;  2K01 A;  2KBN A;  1ML0 D;  1O78 A;  2F0Q A;  3SGI A;  3HOW G;  1IBM Q;  3BDL A;  3GTL H;  3PSI A;  3BYY B;  4ZCK A;  3S1R H;  5LL6 X;  1C4Q A;  2OTL A;  4OX9 Q;  3P7J A;  4NP5 A;  1VQD A;  3FHW A;  1BF4 A;  5M3F G;  2OT2 A;  1R4Q B;  3OTO L;  2D2C C;  2X6G A;  1U4P A;  2B39 A;  5C4X B;  5DAU A;  1XMQ Q;  4KKU A;  4LF5 L;  1AE2 A;  4ZAI A;  4IO9 A;  4A3K G;  2WKC A;  1JOR A;  1NMF A;  1JIC A;  2KCT A;  1V43 A;  1HPC A;  2RSO A;  5A2Q E;  1HH2 P;  4JI7 L;  1X6O A;  1JB7 A;  1W3S A;  3CPW A;  1HZC A;  4RKL A; 
#chains in the Genus database with same CATH homology
 1ICF B;  4OEL B;  4CDC C;  4CDD C;  1K3B C;  2DJF C;  1MHW C;  2DJG C;  4OEM B;  4CDE C;  4CDF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...