2DJFC

Crystal structure of human dipeptidyl peptidase i (cathepsin c) in complex with the inhibitor gly-phe-chn2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Dipeptidyl-peptidase 1
publication title The crystal structure of human dipeptidyl peptidase I (cathepsin C) in complex with the inhibitor Gly-Phe-CHN2
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 68
sequence length 68
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2006-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 2djfC00
1MHWC 4CDEC 4CDFC 1K3BC 4CDCC 1ICFB 4OEMB 2DJFC 4CDDC 4OELB 2DJGC
chains in the Genus database with same CATH superfamily
4QIWE 4XIGS 5KYIA 1JOQA 4GLXA 3FVQA 4LF5Q 2K5QA 2MO1A 5IYCG 1XPUA 1IBLQ 1E22A 4KTAA 3JAMc 4X65L 2K14A 4I65A 3ULLA 3PV0A 1KAAA 1ENAA 1QZGA 4G57A 4JI3L 1SNQA 4DR5Q 1B8AA 1EWHA 2RHSB 4AYBG 2M9VA 4F8MA 3PUYA 1VQDA 2Y0SB 4R8NA 5J39A 1H9SB 1ML0D 3KLRA 3R2IA 1B9NA 4DPGA 3CRKC 1X9NA 4LAAA 1WI5A 4C3IH 1LTID 1H9SA 4NKLA 4ABNA 2ASBA 2AQ1B 5IOCA 4JK1C 1R9TH 3TREA 5C4XG 3OW2A 3ITPA 1C9OA 5HGTA 4NXNQ 4UPAA 5IYDG 2KUMA 1NJIC 3GV3A 5M3MG 1V1QA 3NHHA 1PZJD 4JOIA 1L1OC 4FXGC 5TSSA 2RA4A 2NVYH 3HOUB 2EJFC 4C2MH 2UXDQ 4CGYB 1WCMH 2KHSA 4HCEA 5IT9E 4K0KQ 3S1NH 4P72A 1VQJA 4R1JA 4N8FA 4RAUC 2F0GA 5JEAH 1VQPA 1SMYD 5DM63 4NXMQ 1M90C 2A73B 4A3MH 1P8LA 2LY7A 1J5EL 5C3WA 1MJCA 4JW0A 5GADC 1KDBA 1Q86C 3Q8DA 1S5FD 1W6KA 4LUZA 2R3ZA 3URYA 1YBYA 1EZ6A 1DXMA 4CDCC 3NQIA 3TZDA 1E24A 2IPKD 3CAMA 1CKNB 2EDGA 3KLSA 4DV7L 3A8IE 1II3A 3A5ZB 4A3GG 1B70B 3DLLA 4HIDA 2E2IH 1B2TA 1Y8PB 5E4XA 1JICA 1CKNA 5C3EG 3BDLA 4DFAA 3CC4A 1SSOA 2JXMB 2K5NA 4FYDA 3K81C 1SEBD 3KDFB 1K8MA 3DM3A 3RN5A 4A93H 1QB5D 1TWHB 3GTQB 5KIXA 1AW7A 3HOXB 4B3SQ 2K4KA 4KKTA 5FO7B 3HKZG 2JEBI 1PLFA 5FK9C 1C8CA 2R93G 1SNDA 3KDFA 4A4IA 5I6YA 1X3PA 5IGFA 2Z6BA 3H3VI 1G91A 3BVMA 5JJIA 1WD0A 1M4VA 1SYCA 4R4QA 4R8IA 5KYLA 1YIJA 4UY8C 4X3SA 5LL6S 3D6WA 3MFYA 5JPMC 5CBAE 1TWGH 1WTQA 2EOTA 3RN2A 2XTIA 2B8GA 5DM73 1F2LA 1PYBA 2QGQA 3NWTA 3TP6A 5BR8L 2K5DA 3SE0A 1H95A 2EPBA 5C6AA 1IBKQ 2HCIA 4BWGB 1BKBA 1Y14B 2AWNA 5E1FA 3CD6A 3WOEA 4C3IB 5FO9B 4DR2L 1TU2B 3OMGA 1V1OA 3T13A 4YHHL 4IUTA 3T56B 1XNRQ 1LTSD 3HOYB 1PH7A 2E76C 5ELEA 3GO5A 1ICFB 2K7VA 3GTJB 1C0AA 4A3BG 3ERQA 1CHQD 4YY3Q 2EQSA 2JA8H 4DR7Q 1ILQA 2NVYB 1IL8A 4IPGA 1FNWA 4C2MB 4HJ5A 1TVXA 4O1NA 5ELBA 1WCMB 1IL2A 3S1NB 2QDBA 1KHIA 2RDGA 5LMNL 3S14B 2KCTA 5FO8B 4DV6Q 3A56A 3GTOH 1E2ZA 3D8GA 3HOVB 4LFBQ 5E7NA 4JI4L 4DN4M 4KHZA 2PMZE 1T5XD 1JE5A 1IYUA 2B2VC 4V0BA 3NP8A 4B3RQ 1RIPA 1M1KC 3EJIA 3DHQA 3J81c 1Y1WB 1MGSA 1EYGA 1T9HA 2EY5A 1V9PA 1F9RA 1OTCA 3FRPB 2RKSA 3D6CA 2A19A 1T5EA 4FNFA 4BY1G 1VMCA 4DR1L 4LNQA 2CVRA 4WORA 4GS3A 2XRSD 5D65A 2E2IB 5C4HA 2KJXA 1STYA 1V8QA 4ALPA 4YWMA 4FF4A 3M3YB 1A62A 1BUVT 3W3AA 1U4PA 3PF5A 4RKBA 4TKOB 3WWVA 5ISRA 3UDXA 3QR8A 4MNOA 4IFDH 4PZ6A 3U4ZA 3P1HA 4A93B 3CXCA 4DUZQ 2MJ8A 5KNDA 4TQUS 3A55A 3CCLA 4A3DH 4GKKQ 1SR3A 3RZDH 4KHPL 4DV0Q 1UWVA 2PO4A 3BG3A 5HGQA 5KEEA 3U50C 2E8GA 1IBMQ 4L6TB 4DAYB 2NYZD 1E1OA 3E0EA 2DJFC 2EIFA 1MBYA 3NTHA 3C1EA 3PQIA 4JYAL 5FKAC 2JJQA 1FNVA 2UUAL 4DAYA 2F1MA 2YTXA 4B3MQ 5CBEE 2WB1B 3DEOA 2UXCL 1FL0A 1LACA 5M5YH 2KA7A 2F0LA 2KBNA 1TKWB 3E6ZX 1SAPA 2FXQA 2IWHA 1Q1EA 3HOWG 3TEHB 4IJLA 3UDIA 2XWJB 2PZWA 4Z9CB 1I50H 2I5LX 4WRDA 1EU3A 3DUZA 1SE2A 2BOSA 3D3RA 1BO0A 1XMQL 3PUWA 1STHA 2JA8B 1Q90A 1E2VA 2X6GA 4JI5Q 3FKIB 3VA7A 1LT3D 4JV5L 4RGOS 4GOPC 2ZTCA 1Z47A 4JI8L 3ER0A 3HRZC 2F0JA 2K5HA 2IHEA 1H9JA 1SNOA 3CF5A 1NR2A 1GHKA 4DUYL 4X66Q 4CDFC 4JI0L 5LHY1 3PCOB 1TXYA 1HZCA 3S1RB 1F9QA 2ZXRA 2OT2A 3I8ZA 5AFWA 4OONA 2OCEA 4DV1Q 1PRTD 1MIUA 4OELB 1HR0Q 2KOLA 1G6PA 3KF8B 3PO3B 1PH8A 2IT1A 3TRZA 1RL2A 4F88A 4RWSC 4HJ9A 1EIGA 1LTLA 4UP8A 1FJGL 3PF4A 1K8OA 5FLXL 1Y69U 4QB4A 3G71A 2R92G 1LTTD 3M85A 1ZYRD 4OIJA 4P74A 3KF8A 1VQLA 3TP5A 1D8LA 3QOJA 2B2YC 2PCFB 1QOHA 4J6HA 4K5WA 2P5ZX 3F2BA 4DNRB 2B2VA 1PFSA 3BZDB 1WYDA 4K8IA 3I4NG 1SN8A 5T1GA 2DY8A 3AFQA 2Q2HA 2Z6KA 1JT8A 1CKOA 4X3KA 4LFAL 3I56A 1UEBA 1Q8IA 5A2QL 4A3DB 4KY6A 4DGZA 1MI2A 4X3UA 4BBSH 2ZM6L 5M5XH 3K7AB 4IO9A 4DR4L 4PG3A 1S5BD 3MC0B 2BH2A 4HTHA 4RH6A 4HJ8A 2AUJD 3H0GH 2E2JH 1SYDA 2EXDA 2LMCB 1HA6A 3RMHA 2PW5A 4LF8L 4G7HC 1Z7TA 3CQZH 4OL7A 2DUDA 1S5ED 1S5DD 1UE5A 5CORA 4ZYSA 2QDLA 4L5QA 3HS0C 1YHBA 3PIP3 3OWFA 3LWUA 1LT5D 2Q2IA 3QOLA 1F77A 3ZYYX 1DGSA 4LF5L 1IBLL 5EJWA 5LMUL 1I6HH 2KCCA 4MTKA 4X64L 4K14A 1LYLA 1S5CD 1EOVA 3H3VH 3S15B 4A3IH 1YNND 1X3QA 1TS5A 3QG1A 1VQFA 1EFID 5J22A 2DNCA 4GKJQ 2OQ0A 1BBUA 4DR5L 4EQPA 4C3JH 1UE7A 3MHBA 3E9IA 2E2HH 3J81j 4PQXA 2B29A 1Q7YC 3PUVA 2A5HA 5CMDA 2OTLA 4U68A 4UP9A 1NUCA 4HR7B 1DJRD 1C4QA 2NB0A 3CC2A 1ZYRC 1HUNA 5FLMH 3CCUA 1PV4A 3DEPA 2EY2A 1MSGA 1EY6A 4RFBA 3RLNA 3NELA 1HNWL 1I4GA 3E9HA 1K9MC 4OGQC 2JA9A 4GOPB 4NXNL 2VZAA 1PH9A 5FJ8H 5FLXE 4NB3A 1FNUA 1XTCD 4K2LA 3BDCA 3F1ZA 2NTSA 2O5IC 4DK0A 5ELNA 2UXDL 2TSSA 4A3FB 1A8VA 1U4RA 4GOPA 5EBCA 2MFIA 2NZHA 4TRDA 1I94Q 2RCNA 3G7LA 4J8QA 1AZPA 4A3EG 3I2ZA 4NXML 4J15A 5CR3A 3AB9A 3CCSA 3R2TA 2XRQD 5A2QE 5ELFA 4BY7B 1M8AA 1LV9A 2RSOA 3RZOB 1GUWA 3MTSA 4LF4Q 2SDFA 2JYOA 1PTOC 5BN3A 3GQBA 2V1CC 4BBSB 5EKLA 2WIIB 5M5XB 1STNA 2AQ3B 3CW2C 2G9DA 4KD4A 4MIUA 1HQRD 1G8ZD 4JC0A 3MA2B 4IOAA 1CZWA 1YNNC 5K36G 3H0GB 2I5HA 4KJNA 3DMUA 3X3MA 3K6OA 1RKNA 1MD2D 2B3GA 3MWYW 3I70A 3CMAA 1VQGA 3J7YW 1XMOL 4HSPA 2AMCB 1PH6A 4IN3A 2ZJRA 1WJJA 2GN5A 3IFTA 1KTKA 5LMNW 3I4MH 4B3SL 5EPLA 1N32Q 2Y0SG 4UAIA 3AMUA 1HTLD 4EQOA 5M3FB 3T1YQ 3J7AF 1Y1VH 2VUMB 4PMBA 3OW7A 1VMPA 3PO2H 1SYGA 2F0VA 3GD7A 1K0RA 1EQRA 3KBXA 2L0CA 2B63B 4C3HH 4KK7A 4B9XA 2JA5H 3DXJC 3K5NA 2WAQE 1GXDC 5CV5A 1F9SA 1HPCA 1HZBA 1K0SA 2IL8A 4ODGA 2EYJA 5C44B 4ZCKA 2JEAI 1PH1A 4ZRZA 5IYBG 3T1HQ 4OO1H 2R7ZH 4FVMA 3AU7A 2R61A 3BDOA 1PRTB 2LKVA 5IP7H 3BVGA 3UDGA 3S16H 1B1ZA 2UUBQ 3HOUG 4B08A 2GA4B 3D4DA 4QGUA 1XNRL 4CJ1B 2B2UA 4YWLA 1O78A 1XJVA 2QF7A 2YU9H 3PUZA 2FINB 4DR7L 1AE2A 1UNSA 1VQEA 2K01A 1CSQA 3J80L 2G5DA 2VB2X 2NVXH 1RCVD 4OX9Q 1PFBA 4GZYC 2F0IA 2A74C 1OO9B 1TY2A 3TBIB 4DV6L 3K59A 1JWUD 2RDHA 4LFBL 4M1UB 3D31A 4E6IA 3M7GA 4MN3A 2EVBA 1ESRA 2M00A 3FDTA 3W1GA 2KQ3A 4B3RL 2NN6G 4QCLA 1VQBA 2WKCA 4O2DA 3GTGB 2OWOA 4QUFA 1EIFA 5C4XH 1STAA 2TMPA 4DAMA 1RTNA 2JQOA 3OMCA 3J7ZC 5IYDH 1SXTA 3S9WA 5M3MH 1VS0A 1XWEA 1N34L 5EKKA 4BXXG 3HOXG 1HNZQ 4HJ7A 1EYCA 4CKBA 3PIPA 2F0HA 2CFMA 1JR0D 1B44D 4CKEA 5EGTA 1F2YA 4R9WA 3MZ5A 1Q1BA 3L7ZC 3FEWX 4P71A 2A69C 3RR5A 2PQAB 3I3CA 1X65A 4ME5A 5C0XG 3NSWA 5CC4A 4GKKL 2RBMA 4BBRB 1ASZA 3C2PA 1EU4A 3TS2A 4DV0L 3GV6A 1IBML 3LWEA 2KHJA 4GLAC 5BN4A 2XGTA 3K80C 2PQAA 1EZ8A 1HQMC 2XNAC 3PO2B 1DD2A 1GD7A 1V43A 3J80i 3ULJA 4A3GH 4C3IG 3GTMB 4C3HB 3P20A 2JA5B 1EY4A 3C1FA 2YYZA 1O7LA 1XYIA 2MQHA 3HOYG 4LMQD 1P16A 4WJ3M 5C3EH 3M4OH 4B3ML 1MKHA 2C35B 3VA5A 2J0TD 2R7ZB 1SYBA 1FR3A 4QY7A 3F2DA 1VQMA 3I72A 3HOZB 1PVOA 1KIXA 4WJWA 4JCVE 3GTKH 1WCMG 4DV4Q 5IGGA 1AEXA 1VQ6A 4JBMA 1YHAA 1H9MA 2B2TC 3J80E 3T51B 1ONLA 2R93H 2F0EA 3EA6A 1NNXA 3T4AC 3HOVG 3I4OA 3N52A 2YU9B 3BVZA 4DR3Q 1HJPA 2AWOA 4OWXB 1EIHA 3S17B 1K83H 5C0XJ 1I3QH 2B2WC 1Y1WG 2YTVA 1K28A 4EQNA 3L0OA 3DM1A 1STEA 5DNFA 1G2SA 3TN2A 1UAPA 2EYHA 5KGUA 3CPFA 2Q8IB 2LXJA 3S1QH 5F2DA 3CC7A 4DV2Q 1RF2D 4LUOA 3QO2A 2F0UA 2OQKA 3EN2A 1LLRD 4DV1L 3OIPA 4R4OA 1TY0A 1HR0L 5C4XB 2BCOA 1VQOA 4YCWA 3EFXD 4HEDA 1VCIA 2SOBA 5M3MB 2VY3A 4A3BH 1TWCH 3FP9A 4KN7C 3NWSA 2I46A 1LT4D 1PH4A 3F2CA 1R9TB 1KNEA 1F2MA 4A3LG 2AHOB 4CDDC 5JEAJ 1BCPD 1GUNA 2UXBQ 2JE6I 1L0WA 1EY9A 1WFQA 3HKSA 2MNAA 2FHTA 4RCNA 4IUNA 1I6VC 4KKSA 1D5MC 1PA6A 2O2LD 4Y7NH 3K5LA 3TZUA 2ES2A 4O0AA 2EY6A 3CCJA 3SR1A 2KEEA 3LX0A 1L1OB 2ZTEA 4JPBW 4A3MB 3H94A 1XPOA 4BY1H 5JJKA 1Z6HA 2Z4IA 1R4PB 1G51A 1PHJA 3BZKA 3E3XA 3S1MH 4R4IA 1AN8A 2PI2E 4KJOA 1X3FA 4N8X1 3A54A 3GTLH 1BVSA 1E7ZA 1L1OA 3MEHA 3GP7A 4UP7A 1D1IA 2RDFA 3KFUA 3M4OB 4X65Q 4A3KG 3U9OA 1JOOA 3IRBA 2PZUA 1EL0A 1LTGD 4BA1I 1E2WA 1UUPA 2CKZB 4ZUIA 2Q8RE 3KBGA 4APVA 1RJTA 4DNTB 1N36L 3M4YA 3FKIG 4X3TA 4QQBX 1SNMA 3BJUA 2F0SA 5CV9A 3I7FA 5IE8A 1EY7A 1SYEA 2AKWB 4JG2A 4QMGA 4F7XA 2Z8LA 2LS01 1CZGA 1LTAD 4NW2A 3KJOA 4AQYL 4RKLA 2AUKA 4A75A 3NBHB 2LFNA 3ND9A 4LFCQ 1D2BA 2EJMA 3VYTA 3RNUA 4LF7L 1B3AA 5G3LD 1I3QB 1STGA 3I73A 2SNSA 1A3VA 1PFNA 2XVSA 2DY7A 1XXGA 1SDFA 3PO3G 1NCVA 2WFWA 3NBHA 2L5TA 2EYLA 3MFGA 2F0OA 1TWFH 4B3TQ 4ID6A 1ESFA 1BCPC 3T16A 3S1QB 3N6RA 1TWGB 2QCPX 2CWPA 2EE1A 1HNXQ 2FMMA 3HOWH 1QNKA 2PW7A 5I6WA 2JA6H 2Y0SE 2C9OA 2F0PA 3BZCA 5M5WH 3Q0AA 2BA1A 4OO1I 4J1MA 4EQ5A 3I90A 1N33Q 1N8RC 4A3BB 1SJHD 3LGJA 3S2HH 1I94L 3VYUA 5JPNC 1TR5A 1EQQA 1XX8A 4U673 1DOLA 1BF4A 2EJGC 1X3EA 3K57A 3ULPA 2HCCA 4DR6Q 3Q24A 4HJAA 1HXYD 2B39A 3KYHC 4LF4L 1IZ6A 4DV5L 1WVLA 2HDLA 2SNMA 1KQSA 2FMCA 4RHSA 5DLQE 4DV3Q 1BQQT 4POFA 2PPBC 1NSNS 4Y7NB 1EYAA 3CPWA 2K05A 1PYWD 2NN6I 2F0MA 2JN4A 4RHRA 1CI3M 1S72A 3GTOB 3R3OA 2JA7H 3NENA 4XXEA 2WAQB 4OIKA 1K73C 2VB3X 1CA6A 4RGNA 4K5XA 4CHTB 1HTPA 2R92H 3S1MB 4FXKC 5D3IB 1ENFA 4IUUA 1CA5A 4H02A 1PZID 1YNJD 4XDXA 4X62Q 3PMFA 4LF9L 1W6JA 3RLOA 4RCOA 2PNRC 4IOCA 3EROA 4A76A 1NBWA 1Y8NB 1FGUA 4JI1Q 5GAHC 3I4NH 4IFDJ 2VQFL 4LF6L 3CRLC 3K0XA 4M8AA 4P2CB 3U58A 1DZ1A 1KAWA 3HP3A 5ELCA 5IT9c 1TWAH 4ZK9B 4AYBE 2QILA 1SBBB 3A7LA 5CV7A 2D5DA 4KLKA 1L0YB 4QIWB 3NTKA 1C48A 1NR4A 3R8BA 1VQ4A 1WOCA 3GTPH 1O7ZA 3G6EA 2K28A 5DAUA 4HIKA 5ELDA 4NDXA 1OXUA 3S2DH 3RZDB 3FPUB 4DXFA 3SEBA 4YHHQ 1W2BA 3KUPA 2CHBD 2K32A 1FVIA 2VL6A 3SVMA 4KD3A 1RODA 4CDEC 1TWFB 4A3FG 2KENA 4YWKA 3VYRA 1YNXA 3R93A 1FYCA 2I07B 1IHZA 3W1BA 1I4RA 4JVZA 2CW0D 2A1AA 1EWIA 2F0WA 3VR5A 4K6LA 2JA6B 4P75A 3J80c 2Q8TA 3CCEA 4BY7G 4LUVA 1E3PA 5GROA 5LMNQ 1PTOD 2XIWA 1K8AC 4HIOA 5AJ3Q 5M5YB 1I4PA 4OX9L 2WINB 2HHHQ 4BBSG 1B7YB 3F2UA 3TSSA 1AH9A 2F0NA 4HMIA 1I50B 1YNJC 5IIFA 3OSOA 3TP8A 4QJFA 4C1NI 2F0TA 4DR1Q 1CUKA 1JOKA 1SFOH 1A63A 3EQLC 4C1NK 2J4XA 2X6LA 1D1KA 1GHJA 2A6ED 1JCKB 1Q8KA 3AYHB 1VQ7A 2K1BA 5COYA 1QCBD 2JA7B 2OTJA 1MSHA 3Q22A 5IP9G 1EWCA 3HEJA 5GAEC 1KC8C 1OXXK 1EFWA 2E5LQ 5M3FG 3QIAA 1QVGA 2MPMA 2VUMG 1VF7A 1A15A 4CBVA 2N49A 1KL9A 2VS1A 5CV4A 4A3EH 1JJGA 5KNBA 3L2PA 3KK7A 1KRSA 3PIO3 2CH4W 5L37A 3HKZE 1YHQA 3OWEB 4HSVA 3AEVA 4KN4C 4KY7A 2B63G 1WD1A 1JC7A 1STBA 3W5OA 4WFN3 4K0KL 4JYAQ 4FF1A 4DK6C 4IPDA 5C44G 5JVG3 1KDCA 1XPRA 5HY6A 1TWAB 5I9PA 5E3FA 5ELOA 5IGBA 2J7ZA 5FLMG 1WTWA 1BNZA 1U0LA 2CW0C 5IODA 3CP0A 3NPPA 1PH3A 1CKMA 4RMFA 4A3CH 5EBDA 4G4KA 1UEAB 4QF4A 5D14A 2BE5D 4GN5A 3S2DB 1GKHA 3P7JA 1GOZA 3V05A 1KXLA 1QVCA 1I4XA 1XNQQ 2G9HD 5IY0A 3WDNA 1A6XA 4H0LC 1HA5A 1PTOH 2E2JB 2B2YA 4DV4L 3BYTB 1J6QA 4XQNA 4JOIC 3AQQA 1HCZA 5K5PA 1RTOA 4DAPA 1A3TA 3CQZB 1X32A 3H15A 4JV5Q 4L5SA 2I0QA 2CCZA 4L5RC 1X6OA 2ZXPA 3DWQA 4HAEA 4YIJA 4DR3L 2A6EC 4DA2A 4S3SA 4CJ0B 3HZXA 1QILA 1CSPA 1S4ZA 3P75A 4UDUC 2H5XA 3UE1A 3UE0A 3TQYA 1I6HB 1TT2A 4XYOA 3J7AV 5NUCA 1A2UA 4NP5A 1BBWA 3NQTA 5DEHA 1PRTF 2EXZA 1NMGA 4A3IB 5IYBH 1QZHA 5C4JH 4DK3C 4IPCA 5CYUA 2F4VQ 2QA4A 4C3JB 1VQ9A 3HOUH 4XT1B 2E2HB 3STBD 4DU9A 2F3IA 1SFOB 1HZ9A 1J9OA 1FJGQ 3CKIB 2IJ0A 2A69D 2IW3A 3TDQA 3CCMA 1IBKL 2PMZB 5JVH3 1SE4A 1IKMA 5CV6A 4A3JH 2E74C 5I9OA 1EEFD 1L0XB 1F9PA 1YEZA 2NVQH 1YZ6A 4BBRG 4KMUC 2PNHA 1LT6D 1A0IA 5IYCH 1IYVA 3SK8A 1S3OA 1WTXA 5T1IA 4RG1A 2ZM6Q 2F0KA 2PI2A 2BE5C 4YY3L 4JI7Q 1D7QA 4DR4Q 2LXKA 5C5MA 1KDAA 1JB3A 2KECA 1OXVA 4EGVA 4JBJA 2K5VA 3GDEA 4OWTB 2JA5G 2Z9HA 3RD4A 2ZXOA 2NN6H 3PGZA 1JQYD 4LF8Q 4ME3A 1O7YA 1DYQA 2NZ1D 2L55A 2PZTA 4FP5D 2A8VA 2K75A 3HOZG 1TS2A 3NE5B 2JSOA 1TWHH 3NK9A 3KF6B 4BXXH 3V2TA 3HOXH 3TS0A 2ENBA 3D4WA 3K7UC 2CH4A 5LMUQ 3L9AX 2KVMA 1YJNA 3CU7A 2K52A 5IWAQ 4X64Q 1BBXC 1L2FA 1QG7A 4RGTA 4K5VA 2KHIA 3KF6A 1EQVA 1E1TA 1BXTA 2KEDA 1TQOA 4DNIA 2IY5B 5C0XH 1PTOB 1ET6A 3I91A 2CWAA 3STBC 2NWGA 4MHEA 3E0JA 4R4TA 3QWNA 3NBIA 2ZJQA 1B4OA 3EVQA 4LFCL 3H6MA 3OIQA 4DUZL 3I4MB 3QB3A 4JI6Q 2QEXA 2MUYA 1SJED 1U9RA 4DK1A 1HNWQ 2IX1A 5C4ZA 1V1PB 1Y1VB 3Q6SA 3M4PA 3HOYH 3KJPA 1JB7A 4MZ9A 2N3SA 3GTJH 5D3DA 5C4JB 4B3TL 2RCFA 2KCNA 3KLSX 3DWAA 2NVTH 3BS1A 2MGSA 4XQQA 1J8IA 3M4QA 2E75C 4IPHA 1HNXL 1V1PA 4JI2Q 3AFPA 4DKAC 1G291 2MP1A 4I7ZC 1PFMA 1EQTA 1QWYA 2L4NA 3MXPA 3OTOQ 4JBWA 2OXPA 2HIXA 3S14H 1QE6A 1RHPA 2UU9Q 1HH2P 4A3JB 3HOVH 1N33L 1BOSA 3S16B 2NVQB 2A6HC 1KLGD 4KI0A 3MVVA 1FD7D 1ET9A 3D4RA 1Y1WH 1RD9D 2D9UA 4BS9A 4ZUJA 3PIOA 2UUCQ 1NE3A 2OEOA 4GN4B 5I2XA 5JEAG 2IHFA 4DR6L 4OHJA 4Q5VA 4A3MG 1WTRA 2B8FA 5FOBB 1SMXA 3Q23A 3X3NA 3VR6A 2D0OA 5IGDA 4DV3L 4JI5L 5CGKA 4IQZA 1W3SA 3MXNB 1DCZA 4H44C 4AYBB 2M2LA 1WTVA 3PSIA 2NVXB 1CTMA 4F87A 2N78A 3M3YH 3DWPA 1ZKOA 4CJ2C 3CCQA 1XMOQ 1JE4A 4LK1C 4X66L 1U5KA 3MXNA 1DM0B 4DXGA 2XWBB 2N88A 1PMRA 2YV5A 3I4LA 2QKIC 3HGBA 2AQ2B 5IGCA 4X62L 3CMEA 1KABA 4A3LH 3SK6A 5FLXc 2HDMA 4N9PA 4JI1L 1HHVA 4A93G 1JWMD 1OXSC 1LABA 3PUXA 4DF7A 4IURA 2FJ2A 5J1ZA 1QVFA 1E0BA 1K3RA 5JOBA 5EPJA 1CQVA 3U4VA 3ICEA 2IX0A 1VQAA 1ENCA 2GVBA 3FHWA 2BDOA 2VQEQ 1VQ5A 1Q82C 1CHPD 1SMYC 2O4XA 2EYMA 3NXWA 5EQ0A 1IKLA 3IL8A 1HFNA 4UHVA 3CCRA 2K50A 1YJWA 1A2TA 2BA0A 2WB1G 3C46A 1B9MA 4A3KH 1PDQA 1PH5A 1YJ9A 2C5CA 4KY5A 4A3GB 1GM5A 2NVTB 5I2YA 5C3XA 1PZKD 1O80A 3FKIH 2BDNA 2ALYB 1RDPD 4L63B 1U4MA 4OXPA 5C3EB 3TP7A 1Z9FA 3RLFA 1WTOA 4GN3B 2E2DC 3K58A 3JAML 3ZJYC 2JA8G 1UE1A 4JI3Q 5AJ3L 1EY0A 1EY8A 2RQXA 4G7ZC 3S1RH 2HHHL 4ZKBB 3GTKB 5IGEA 1TIID 1ILPA 2Z6KC 3HKZB 1D6EC 4GKJL 2R93B 3BYYB 2HQEA 3PO3H 4POGA 2WAQG 2QEJC 4LW1A 5C5LA 1XTDA 4H13C 2Z0SA 1YVCA 3FPPA 1KNAA 1PXUA 1NAPA 4P73A 1NTGA 5E4WC 1K83B 2EY1A 4KV6A 1N34Q 3F8TA 3MAQA 1A3UA 1Y8OB 4IUPA 1JMCA 4FO2A 1G2TA 1MJEA 4QL5A 2E5LL 2VXWA 3FMCA 4H7BA 2B2TA 1GJXA 2NBFA 3SXHA 1H9RA 3NUCA 2K6AA 4OWWB 1IYJB 4K6DA 2O5JC 4OEMB 3H91A 2F03A 3K7AH 1F2ZA 3TMEA 4C56C 2B2WA 2BH8A 3VR3A 4FDBA 4IFDG 2RSNA 2K03A 2NTTA 1J5EQ 2D2CC 1TWCB 4A3DG 2R7DA 3UDFA 1B53A 4L5TA 4NMZA 4GNXC 1MHWC 1AFPA 3JAMi 2RHQB 4XYQA 5EKIA 4DV7Q 2ZTDA 4IJHA 2ATWA 3A7AB 3K0YA 5LL6X 4HCSA 2NZOA 4YCUA 1CFMA 1ZXTA 1I4QA 4PNYA 2YTYA 3S15H 3A8KE 2JA6G 1QUQB 3L3OC 1XNQL 1SNPA 4A3KB 2H4OA 1GUTA 5KRUA 1JJ2A 4R4CA 4BY1B 4KKUA 3SHLA 3G6JB 2D0PA 3JC66 1QUQA 3E5SA 3JAME 3VR2A 1S40A 5M9OA 3GTLB 2FFKB 2ZT9C 4MTNA 1ICWA 3A8JE 3SGIA 3O13A 4HMJA 1N32L 2VW9A 3I55A 2SEBD 2XSCA 2K04A 3K8AA 2ID0A 3T1YL 3OYYA 1EYDA 5C0XI 1KLUD 4KHVA 3HG9A 1H9KA 1LO5D 1EEID 3KOJA 3K5OA 5BR8Q 2F52A 1Q81C 2F4VL 4G7OC 2JA7G 1SROA 2L1BA 4A3FH 1Q3LA 1IW7D 4DR2Q 5JJZA 2L15A 4Y52H 3T1HL 4HIMA 1SYFA 3BU2A 1B50A 2H1EA 1BCPF 3OHXC 2UUBL 4XTCS 4BY7H 3A5UA 1HFGA 2WV6D 3RZOH 3EIVA 1O7IA 4PZ7A 4PMWA 2F4IA 4ULLA 4ZLTF 1AP0A 1SNCA 3HOWB 1ZEQX 2EZVA 2ICEC 1EOTA 4JI7L 1DOKA 1K8GA 5M5WB 4IUQA 1BCPB 1IXRA 1GUSA 1I4HA 2Q2TA 3M9BA 2F0FA 1SLJA 1EUJA 2CQOA 2I5MX 4JI4Q 1VQNA 3S2HB 4YCVA 4K2KA 3S24A 4FF2A 1DONA 1PH2A 3J81L 1YITA 3H3VC 4WJ4A 2EYOA 1VQCA 3H0GG 3ND8A 1X54A 4HN7A 3ERSX 3NTIA 1TS4A 5IP9H 2HQLA 2F3WA 2RF4A 2EYPA 5M3FH 1N36Q 5IWAL 2VUMH 2V4DA 3EBEA 3VDYA 3OOCA 4GNXB 3CHBD 3MXUA 4Q0FA 2MO0A 1DOMA 1BDOA 2EYFA 2Z4HA 2KCMA 4O42A 3T53B 1CQFA 2ICIA 2WP8J 3MEFA 1R4QB 5HURA 1PRTC 2B2UC 1QNUA 2PYKA 1HNZL 4AQYQ 1NMFA 2B63H 3SK4A 4K8JA 4QUCA 4LF7Q 4GNXA 5G3LF 1LUZA 3V96A 2R92B 2Z1CA 2HUGA 2NUCA 4LWCA 4PV1C 5C44H 2R6GA 1IW7C 4KHPQ 4A3IG 1OXTA 2A68D 1SE3A 4DAVA 2JP1A 2DGYA 2L12A 2WKDA 4C3JG 4I7AA 1LTBD 3VR4A 4JI6L 4FXDA 3I4NB 1GUOA 4IZ8A 1U4LA 3G4SA 2QW7A 4TSSA 3IFDA 4ZQ3A 2JK8A 4FF3A 1VQIA 2UUAQ 2MHVA 3RUZA 3IAYA 5JJLA 2DNEA 3QJYA 1JWSD 1GO3E 1HR0W 2PQEA 3GTPB 1NY4A 2UXCQ 5K36H 4N9TA 1Q12A 2F0DA 4AIMA 4JI2L 1VQ8A 2HD3A 1VQHA 1JORA 4TVAB 3M7NA 5CV8A 4B9WA 1PYSB 3K5MA 5JAVA 3OTOL 4JBKA 3J81i 1D5ZC 5FJ8G 1EIYB 2UU9L 5GAGC 3B6YA 3CCVA 2N8NA 3G48A 1KD1C 2WACA 1VQKA 5GQOA 3J7A5 4AH6A 1LM0A 1GVPA 1N9WA 4DV5Q 1GUGA 1XMQQ 2UUCL 4IUVA 3ONAB 3GTGH 4PMCA 3U9SA 1WTPA 2Q2UA 4ZAIA 2DN8A 4XQJA 4JI8Q 4RGMA 3HFZB 5KNCA 1BR9A 2XN9C 4IALA 1CM9A 2HIVA 4A3CG 4DUYQ 2VNUD 1X55A 1ASYA 3IKJA 4JI0Q 2WB1E 4X6AH 3W2DA 3J81E 1B3QA 1KRTA 2N55A 1K3BC 5H1SE 1C7YA 2K5WA 1HUMA 3A74A 2HT1A 2DJGC 5BN5A 4LF9Q 2RVLA 2X69A 4V190 4DV2L 2A68C 2OF1A 2CQAA 1LTRD 1JJCB 3A0JA 3SK5A 4PZ8A 1Q46A 2L11A 3OPOA 4BBRH 2VQFQ 4LF6Q 1EY5A 5I4DA 2IX3A 2LSSA 1QJOA 1WTHA 3WOFA 3KLWA 5IT9L 4EVOA 1HZAA 1AE3A 1VF5C 3I4MG 4XT3B 1YI2A 1FGBD 2F0QA 4GLVB 5EAYA 4CKCA 3GTMH 3C3LA 4EX5A 4RA8A 4IFDI 1TS3A 1CK1A 1X3GA 1CT1D 1SE8A 2L9HA 4LFAQ 1Y1VG 2UXBL 1G6ZA 4NPSA 4A3EB 2VQEL 3PO2G 1AZQA 5A35A 1X56A 3HOZH 3D0FA 4C3HG 3VYSA 1I5FA 2D62A 1VDZA 2GVAA 1HRJA 5EPKA 4L8JA 3LNNA 4OO1G 3NEMA 1D5XC 3MXGA 2R7ZG 3H09A 5J3BA 4ILWA 4A3JG 2A6HD 5IP7G 3UI2A 1SRUA 3SDZA 4LJZC 4ZKCB 1PTOF 1UE6A 2F3VA 2K33A 3GTQH 3S17H 4BA2I 2ZJPA 2R7FA
chains in the Genus database with same CATH topology
1MHWC 4CDEC 4CDFC 1K3BC 4CDCC 1ICFB 4OEMB 2DJFC 4CDDC 4OELB 2DJGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHW C;  4CDE C;  4CDF C;  1K3B C;  4CDC C;  1ICF B;  4OEM B;  2DJF C;  4CDD C;  4OEL B;  2DJG C; 
#chains in the Genus database with same CATH topology
 4QIW E;  4XIG S;  5KYI A;  1JOQ A;  4GLX A;  3FVQ A;  4LF5 Q;  2K5Q A;  2MO1 A;  5IYC G;  1XPU A;  1IBL Q;  1E22 A;  4KTA A;  3JAM c;  4X65 L;  2K14 A;  4I65 A;  3ULL A;  3PV0 A;  1KAA A;  1ENA A;  1QZG A;  4G57 A;  4JI3 L;  1SNQ A;  4DR5 Q;  1B8A A;  1EWH A;  2RHS B;  4AYB G;  2M9V A;  4F8M A;  3PUY A;  1VQD A;  2Y0S B;  4R8N A;  5J39 A;  1H9S B;  1ML0 D;  3KLR A;  3R2I A;  1B9N A;  4DPG A;  3CRK C;  1X9N A;  4LAA A;  1WI5 A;  4C3I H;  1LTI D;  1H9S A;  4NKL A;  4ABN A;  2ASB A;  2AQ1 B;  5IOC A;  4JK1 C;  1R9T H;  3TRE A;  5C4X G;  3OW2 A;  3ITP A;  1C9O A;  5HGT A;  4NXN Q;  4UPA A;  5IYD G;  2KUM A;  1NJI C;  3GV3 A;  5M3M G;  1V1Q A;  3NHH A;  1PZJ D;  4JOI A;  1L1O C;  4FXG C;  5TSS A;  2RA4 A;  2NVY H;  3HOU B;  2EJF C;  4C2M H;  2UXD Q;  4CGY B;  1WCM H;  2KHS A;  4HCE A;  5IT9 E;  4K0K Q;  3S1N H;  4P72 A;  1VQJ A;  4R1J A;  4N8F A;  4RAU C;  2F0G A;  5JEA H;  1VQP A;  1SMY D;  5DM6 3;  4NXM Q;  1M90 C;  2A73 B;  4A3M H;  1P8L A;  2LY7 A;  1J5E L;  5C3W A;  1MJC A;  4JW0 A;  5GAD C;  1KDB A;  1Q86 C;  3Q8D A;  1S5F D;  1W6K A;  4LUZ A;  2R3Z A;  3URY A;  1YBY A;  1EZ6 A;  1DXM A;  4CDC C;  3NQI A;  3TZD A;  1E24 A;  2IPK D;  3CAM A;  1CKN B;  2EDG A;  3KLS A;  4DV7 L;  3A8I E;  1II3 A;  3A5Z B;  4A3G G;  1B70 B;  3DLL A;  4HID A;  2E2I H;  1B2T A;  1Y8P B;  5E4X A;  1JIC A;  1CKN A;  5C3E G;  3BDL A;  4DFA A;  3CC4 A;  1SSO A;  2JXM B;  2K5N A;  4FYD A;  3K81 C;  1SEB D;  3KDF B;  1K8M A;  3DM3 A;  3RN5 A;  4A93 H;  1QB5 D;  1TWH B;  3GTQ B;  5KIX A;  1AW7 A;  3HOX B;  4B3S Q;  2K4K A;  4KKT A;  5FO7 B;  3HKZ G;  2JEB I;  1PLF A;  5FK9 C;  1C8C A;  2R93 G;  1SND A;  3KDF A;  4A4I A;  5I6Y A;  1X3P A;  5IGF A;  2Z6B A;  3H3V I;  1G91 A;  3BVM A;  5JJI A;  1WD0 A;  1M4V A;  1SYC A;  4R4Q A;  4R8I A;  5KYL A;  1YIJ A;  4UY8 C;  4X3S A;  5LL6 S;  3D6W A;  3MFY A;  5JPM C;  5CBA E;  1TWG H;  1WTQ A;  2EOT A;  3RN2 A;  2XTI A;  2B8G A;  5DM7 3;  1F2L A;  1PYB A;  2QGQ A;  3NWT A;  3TP6 A;  5BR8 L;  2K5D A;  3SE0 A;  1H95 A;  2EPB A;  5C6A A;  1IBK Q;  2HCI A;  4BWG B;  1BKB A;  1Y14 B;  2AWN A;  5E1F A;  3CD6 A;  3WOE A;  4C3I B;  5FO9 B;  4DR2 L;  1TU2 B;  3OMG A;  1V1O A;  3T13 A;  4YHH L;  4IUT A;  3T56 B;  1XNR Q;  1LTS D;  3HOY B;  1PH7 A;  2E76 C;  5ELE A;  3GO5 A;  1ICF B;  2K7V A;  3GTJ B;  1C0A A;  4A3B G;  3ERQ A;  1CHQ D;  4YY3 Q;  2EQS A;  2JA8 H;  4DR7 Q;  1ILQ A;  2NVY B;  1IL8 A;  4IPG A;  1FNW A;  4C2M B;  4HJ5 A;  1TVX A;  4O1N A;  5ELB A;  1WCM B;  1IL2 A;  3S1N B;  2QDB A;  1KHI A;  2RDG A;  5LMN L;  3S14 B;  2KCT A;  5FO8 B;  4DV6 Q;  3A56 A;  3GTO H;  1E2Z A;  3D8G A;  3HOV B;  4LFB Q;  5E7N A;  4JI4 L;  4DN4 M;  4KHZ A;  2PMZ E;  1T5X D;  1JE5 A;  1IYU A;  2B2V C;  4V0B A;  3NP8 A;  4B3R Q;  1RIP A;  1M1K C;  3EJI A;  3DHQ A;  3J81 c;  1Y1W B;  1MGS A;  1EYG A;  1T9H A;  2EY5 A;  1V9P A;  1F9R A;  1OTC A;  3FRP B;  2RKS A;  3D6C A;  2A19 A;  1T5E A;  4FNF A;  4BY1 G;  1VMC A;  4DR1 L;  4LNQ A;  2CVR A;  4WOR A;  4GS3 A;  2XRS D;  5D65 A;  2E2I B;  5C4H A;  2KJX A;  1STY A;  1V8Q A;  4ALP A;  4YWM A;  4FF4 A;  3M3Y B;  1A62 A;  1BUV T;  3W3A A;  1U4P A;  3PF5 A;  4RKB A;  4TKO B;  3WWV A;  5ISR A;  3UDX A;  3QR8 A;  4MNO A;  4IFD H;  4PZ6 A;  3U4Z A;  3P1H A;  4A93 B;  3CXC A;  4DUZ Q;  2MJ8 A;  5KND A;  4TQU S;  3A55 A;  3CCL A;  4A3D H;  4GKK Q;  1SR3 A;  3RZD H;  4KHP L;  4DV0 Q;  1UWV A;  2PO4 A;  3BG3 A;  5HGQ A;  5KEE A;  3U50 C;  2E8G A;  1IBM Q;  4L6T B;  4DAY B;  2NYZ D;  1E1O A;  3E0E A;  2DJF C;  2EIF A;  1MBY A;  3NTH A;  3C1E A;  3PQI A;  4JYA L;  5FKA C;  2JJQ A;  1FNV A;  2UUA L;  4DAY A;  2F1M A;  2YTX A;  4B3M Q;  5CBE E;  2WB1 B;  3DEO A;  2UXC L;  1FL0 A;  1LAC A;  5M5Y H;  2KA7 A;  2F0L A;  2KBN A;  1TKW B;  3E6Z X;  1SAP A;  2FXQ A;  2IWH A;  1Q1E A;  3HOW G;  3TEH B;  4IJL A;  3UDI A;  2XWJ B;  2PZW A;  4Z9C B;  1I50 H;  2I5L X;  4WRD A;  1EU3 A;  3DUZ A;  1SE2 A;  2BOS A;  3D3R A;  1BO0 A;  1XMQ L;  3PUW A;  1STH A;  2JA8 B;  1Q90 A;  1E2V A;  2X6G A;  4JI5 Q;  3FKI B;  3VA7 A;  1LT3 D;  4JV5 L;  4RGO S;  4GOP C;  2ZTC A;  1Z47 A;  4JI8 L;  3ER0 A;  3HRZ C;  2F0J A;  2K5H A;  2IHE A;  1H9J A;  1SNO A;  3CF5 A;  1NR2 A;  1GHK A;  4DUY L;  4X66 Q;  4CDF C;  4JI0 L;  5LHY 1;  3PCO B;  1TXY A;  1HZC A;  3S1R B;  1F9Q A;  2ZXR A;  2OT2 A;  3I8Z A;  5AFW A;  4OON A;  2OCE A;  4DV1 Q;  1PRT D;  1MIU A;  4OEL B;  1HR0 Q;  2KOL A;  1G6P A;  3KF8 B;  3PO3 B;  1PH8 A;  2IT1 A;  3TRZ A;  1RL2 A;  4F88 A;  4RWS C;  4HJ9 A;  1EIG A;  1LTL A;  4UP8 A;  1FJG L;  3PF4 A;  1K8O A;  5FLX L;  1Y69 U;  4QB4 A;  3G71 A;  2R92 G;  1LTT D;  3M85 A;  1ZYR D;  4OIJ A;  4P74 A;  3KF8 A;  1VQL A;  3TP5 A;  1D8L A;  3QOJ A;  2B2Y C;  2PCF B;  1QOH A;  4J6H A;  4K5W A;  2P5Z X;  3F2B A;  4DNR B;  2B2V A;  1PFS A;  3BZD B;  1WYD A;  4K8I A;  3I4N G;  1SN8 A;  5T1G A;  2DY8 A;  3AFQ A;  2Q2H A;  2Z6K A;  1JT8 A;  1CKO A;  4X3K A;  4LFA L;  3I56 A;  1UEB A;  1Q8I A;  5A2Q L;  4A3D B;  4KY6 A;  4DGZ A;  1MI2 A;  4X3U A;  4BBS H;  2ZM6 L;  5M5X H;  3K7A B;  4IO9 A;  4DR4 L;  4PG3 A;  1S5B D;  3MC0 B;  2BH2 A;  4HTH A;  4RH6 A;  4HJ8 A;  2AUJ D;  3H0G H;  2E2J H;  1SYD A;  2EXD A;  2LMC B;  1HA6 A;  3RMH A;  2PW5 A;  4LF8 L;  4G7H C;  1Z7T A;  3CQZ H;  4OL7 A;  2DUD A;  1S5E D;  1S5D D;  1UE5 A;  5COR A;  4ZYS A;  2QDL A;  4L5Q A;  3HS0 C;  1YHB A;  3PIP 3;  3OWF A;  3LWU A;  1LT5 D;  2Q2I A;  3QOL A;  1F77 A;  3ZYY X;  1DGS A;  4LF5 L;  1IBL L;  5EJW A;  5LMU L;  1I6H H;  2KCC A;  4MTK A;  4X64 L;  4K14 A;  1LYL A;  1S5C D;  1EOV A;  3H3V H;  3S15 B;  4A3I H;  1YNN D;  1X3Q A;  1TS5 A;  3QG1 A;  1VQF A;  1EFI D;  5J22 A;  2DNC A;  4GKJ Q;  2OQ0 A;  1BBU A;  4DR5 L;  4EQP A;  4C3J H;  1UE7 A;  3MHB A;  3E9I A;  2E2H H;  3J81 j;  4PQX A;  2B29 A;  1Q7Y C;  3PUV A;  2A5H A;  5CMD A;  2OTL A;  4U68 A;  4UP9 A;  1NUC A;  4HR7 B;  1DJR D;  1C4Q A;  2NB0 A;  3CC2 A;  1ZYR C;  1HUN A;  5FLM H;  3CCU A;  1PV4 A;  3DEP A;  2EY2 A;  1MSG A;  1EY6 A;  4RFB A;  3RLN A;  3NEL A;  1HNW L;  1I4G A;  3E9H A;  1K9M C;  4OGQ C;  2JA9 A;  4GOP B;  4NXN L;  2VZA A;  1PH9 A;  5FJ8 H;  5FLX E;  4NB3 A;  1FNU A;  1XTC D;  4K2L A;  3BDC A;  3F1Z A;  2NTS A;  2O5I C;  4DK0 A;  5ELN A;  2UXD L;  2TSS A;  4A3F B;  1A8V A;  1U4R A;  4GOP A;  5EBC A;  2MFI A;  2NZH A;  4TRD A;  1I94 Q;  2RCN A;  3G7L A;  4J8Q A;  1AZP A;  4A3E G;  3I2Z A;  4NXM L;  4J15 A;  5CR3 A;  3AB9 A;  3CCS A;  3R2T A;  2XRQ D;  5A2Q E;  5ELF A;  4BY7 B;  1M8A A;  1LV9 A;  2RSO A;  3RZO B;  1GUW A;  3MTS A;  4LF4 Q;  2SDF A;  2JYO A;  1PTO C;  5BN3 A;  3GQB A;  2V1C C;  4BBS B;  5EKL A;  2WII B;  5M5X B;  1STN A;  2AQ3 B;  3CW2 C;  2G9D A;  4KD4 A;  4MIU A;  1HQR D;  1G8Z D;  4JC0 A;  3MA2 B;  4IOA A;  1CZW A;  1YNN C;  5K36 G;  3H0G B;  2I5H A;  4KJN A;  3DMU A;  3X3M A;  3K6O A;  1RKN A;  1MD2 D;  2B3G A;  3MWY W;  3I70 A;  3CMA A;  1VQG A;  3J7Y W;  1XMO L;  4HSP A;  2AMC B;  1PH6 A;  4IN3 A;  2ZJR A;  1WJJ A;  2GN5 A;  3IFT A;  1KTK A;  5LMN W;  3I4M H;  4B3S L;  5EPL A;  1N32 Q;  2Y0S G;  4UAI A;  3AMU A;  1HTL D;  4EQO A;  5M3F B;  3T1Y Q;  3J7A F;  1Y1V H;  2VUM B;  4PMB A;  3OW7 A;  1VMP A;  3PO2 H;  1SYG A;  2F0V A;  3GD7 A;  1K0R A;  1EQR A;  3KBX A;  2L0C A;  2B63 B;  4C3H H;  4KK7 A;  4B9X A;  2JA5 H;  3DXJ C;  3K5N A;  2WAQ E;  1GXD C;  5CV5 A;  1F9S A;  1HPC A;  1HZB A;  1K0S A;  2IL8 A;  4ODG A;  2EYJ A;  5C44 B;  4ZCK A;  2JEA I;  1PH1 A;  4ZRZ A;  5IYB G;  3T1H Q;  4OO1 H;  2R7Z H;  4FVM A;  3AU7 A;  2R61 A;  3BDO A;  1PRT B;  2LKV A;  5IP7 H;  3BVG A;  3UDG A;  3S16 H;  1B1Z A;  2UUB Q;  3HOU G;  4B08 A;  2GA4 B;  3D4D A;  4QGU A;  1XNR L;  4CJ1 B;  2B2U A;  4YWL A;  1O78 A;  1XJV A;  2QF7 A;  2YU9 H;  3PUZ A;  2FIN B;  4DR7 L;  1AE2 A;  1UNS A;  1VQE A;  2K01 A;  1CSQ A;  3J80 L;  2G5D A;  2VB2 X;  2NVX H;  1RCV D;  4OX9 Q;  1PFB A;  4GZY C;  2F0I A;  2A74 C;  1OO9 B;  1TY2 A;  3TBI B;  4DV6 L;  3K59 A;  1JWU D;  2RDH A;  4LFB L;  4M1U B;  3D31 A;  4E6I A;  3M7G A;  4MN3 A;  2EVB A;  1ESR A;  2M00 A;  3FDT A;  3W1G A;  2KQ3 A;  4B3R L;  2NN6 G;  4QCL A;  1VQB A;  2WKC A;  4O2D A;  3GTG B;  2OWO A;  4QUF A;  1EIF A;  5C4X H;  1STA A;  2TMP A;  4DAM A;  1RTN A;  2JQO A;  3OMC A;  3J7Z C;  5IYD H;  1SXT A;  3S9W A;  5M3M H;  1VS0 A;  1XWE A;  1N34 L;  5EKK A;  4BXX G;  3HOX G;  1HNZ Q;  4HJ7 A;  1EYC A;  4CKB A;  3PIP A;  2F0H A;  2CFM A;  1JR0 D;  1B44 D;  4CKE A;  5EGT A;  1F2Y A;  4R9W A;  3MZ5 A;  1Q1B A;  3L7Z C;  3FEW X;  4P71 A;  2A69 C;  3RR5 A;  2PQA B;  3I3C A;  1X65 A;  4ME5 A;  5C0X G;  3NSW A;  5CC4 A;  4GKK L;  2RBM A;  4BBR B;  1ASZ A;  3C2P A;  1EU4 A;  3TS2 A;  4DV0 L;  3GV6 A;  1IBM L;  3LWE A;  2KHJ A;  4GLA C;  5BN4 A;  2XGT A;  3K80 C;  2PQA A;  1EZ8 A;  1HQM C;  2XNA C;  3PO2 B;  1DD2 A;  1GD7 A;  1V43 A;  3J80 i;  3ULJ A;  4A3G H;  4C3I G;  3GTM B;  4C3H B;  3P20 A;  2JA5 B;  1EY4 A;  3C1F A;  2YYZ A;  1O7L A;  1XYI A;  2MQH A;  3HOY G;  4LMQ D;  1P16 A;  4WJ3 M;  5C3E H;  3M4O H;  4B3M L;  1MKH A;  2C35 B;  3VA5 A;  2J0T D;  2R7Z B;  1SYB A;  1FR3 A;  4QY7 A;  3F2D A;  1VQM A;  3I72 A;  3HOZ B;  1PVO A;  1KIX A;  4WJW A;  4JCV E;  3GTK H;  1WCM G;  4DV4 Q;  5IGG A;  1AEX A;  1VQ6 A;  4JBM A;  1YHA A;  1H9M A;  2B2T C;  3J80 E;  3T51 B;  1ONL A;  2R93 H;  2F0E A;  3EA6 A;  1NNX A;  3T4A C;  3HOV G;  3I4O A;  3N52 A;  2YU9 B;  3BVZ A;  4DR3 Q;  1HJP A;  2AWO A;  4OWX B;  1EIH A;  3S17 B;  1K83 H;  5C0X J;  1I3Q H;  2B2W C;  1Y1W G;  2YTV A;  1K28 A;  4EQN A;  3L0O A;  3DM1 A;  1STE A;  5DNF A;  1G2S A;  3TN2 A;  1UAP A;  2EYH A;  5KGU A;  3CPF A;  2Q8I B;  2LXJ A;  3S1Q H;  5F2D A;  3CC7 A;  4DV2 Q;  1RF2 D;  4LUO A;  3QO2 A;  2F0U A;  2OQK A;  3EN2 A;  1LLR D;  4DV1 L;  3OIP A;  4R4O A;  1TY0 A;  1HR0 L;  5C4X B;  2BCO A;  1VQO A;  4YCW A;  3EFX D;  4HED A;  1VCI A;  2SOB A;  5M3M B;  2VY3 A;  4A3B H;  1TWC H;  3FP9 A;  4KN7 C;  3NWS A;  2I46 A;  1LT4 D;  1PH4 A;  3F2C A;  1R9T B;  1KNE A;  1F2M A;  4A3L G;  2AHO B;  4CDD C;  5JEA J;  1BCP D;  1GUN A;  2UXB Q;  2JE6 I;  1L0W A;  1EY9 A;  1WFQ A;  3HKS A;  2MNA A;  2FHT A;  4RCN A;  4IUN A;  1I6V C;  4KKS A;  1D5M C;  1PA6 A;  2O2L D;  4Y7N H;  3K5L A;  3TZU A;  2ES2 A;  4O0A A;  2EY6 A;  3CCJ A;  3SR1 A;  2KEE A;  3LX0 A;  1L1O B;  2ZTE A;  4JPB W;  4A3M B;  3H94 A;  1XPO A;  4BY1 H;  5JJK A;  1Z6H A;  2Z4I A;  1R4P B;  1G51 A;  1PHJ A;  3BZK A;  3E3X A;  3S1M H;  4R4I A;  1AN8 A;  2PI2 E;  4KJO A;  1X3F A;  4N8X 1;  3A54 A;  3GTL H;  1BVS A;  1E7Z A;  1L1O A;  3MEH A;  3GP7 A;  4UP7 A;  1D1I A;  2RDF A;  3KFU A;  3M4O B;  4X65 Q;  4A3K G;  3U9O A;  1JOO A;  3IRB A;  2PZU A;  1EL0 A;  1LTG D;  4BA1 I;  1E2W A;  1UUP A;  2CKZ B;  4ZUI A;  2Q8R E;  3KBG A;  4APV A;  1RJT A;  4DNT B;  1N36 L;  3M4Y A;  3FKI G;  4X3T A;  4QQB X;  1SNM A;  3BJU A;  2F0S A;  5CV9 A;  3I7F A;  5IE8 A;  1EY7 A;  1SYE A;  2AKW B;  4JG2 A;  4QMG A;  4F7X A;  2Z8L A;  2LS0 1;  1CZG A;  1LTA D;  4NW2 A;  3KJO A;  4AQY L;  4RKL A;  2AUK A;  4A75 A;  3NBH B;  2LFN A;  3ND9 A;  4LFC Q;  1D2B A;  2EJM A;  3VYT A;  3RNU A;  4LF7 L;  1B3A A;  5G3L D;  1I3Q B;  1STG A;  3I73 A;  2SNS A;  1A3V A;  1PFN A;  2XVS A;  2DY7 A;  1XXG A;  1SDF A;  3PO3 G;  1NCV A;  2WFW A;  3NBH A;  2L5T A;  2EYL A;  3MFG A;  2F0O A;  1TWF H;  4B3T Q;  4ID6 A;  1ESF A;  1BCP C;  3T16 A;  3S1Q B;  3N6R A;  1TWG B;  2QCP X;  2CWP A;  2EE1 A;  1HNX Q;  2FMM A;  3HOW H;  1QNK A;  2PW7 A;  5I6W A;  2JA6 H;  2Y0S E;  2C9O A;  2F0P A;  3BZC A;  5M5W H;  3Q0A A;  2BA1 A;  4OO1 I;  4J1M A;  4EQ5 A;  3I90 A;  1N33 Q;  1N8R C;  4A3B B;  1SJH D;  3LGJ A;  3S2H H;  1I94 L;  3VYU A;  5JPN C;  1TR5 A;  1EQQ A;  1XX8 A;  4U67 3;  1DOL A;  1BF4 A;  2EJG C;  1X3E A;  3K57 A;  3ULP A;  2HCC A;  4DR6 Q;  3Q24 A;  4HJA A;  1HXY D;  2B39 A;  3KYH C;  4LF4 L;  1IZ6 A;  4DV5 L;  1WVL A;  2HDL A;  2SNM A;  1KQS A;  2FMC A;  4RHS A;  5DLQ E;  4DV3 Q;  1BQQ T;  4POF A;  2PPB C;  1NSN S;  4Y7N B;  1EYA A;  3CPW A;  2K05 A;  1PYW D;  2NN6 I;  2F0M A;  2JN4 A;  4RHR A;  1CI3 M;  1S72 A;  3GTO B;  3R3O A;  2JA7 H;  3NEN A;  4XXE A;  2WAQ B;  4OIK A;  1K73 C;  2VB3 X;  1CA6 A;  4RGN A;  4K5X A;  4CHT B;  1HTP A;  2R92 H;  3S1M B;  4FXK C;  5D3I B;  1ENF A;  4IUU A;  1CA5 A;  4H02 A;  1PZI D;  1YNJ D;  4XDX A;  4X62 Q;  3PMF A;  4LF9 L;  1W6J A;  3RLO A;  4RCO A;  2PNR C;  4IOC A;  3ERO A;  4A76 A;  1NBW A;  1Y8N B;  1FGU A;  4JI1 Q;  5GAH C;  3I4N H;  4IFD J;  2VQF L;  4LF6 L;  3CRL C;  3K0X A;  4M8A A;  4P2C B;  3U58 A;  1DZ1 A;  1KAW A;  3HP3 A;  5ELC A;  5IT9 c;  1TWA H;  4ZK9 B;  4AYB E;  2QIL A;  1SBB B;  3A7L A;  5CV7 A;  2D5D A;  4KLK A;  1L0Y B;  4QIW B;  3NTK A;  1C48 A;  1NR4 A;  3R8B A;  1VQ4 A;  1WOC A;  3GTP H;  1O7Z A;  3G6E A;  2K28 A;  5DAU A;  4HIK A;  5ELD A;  4NDX A;  1OXU A;  3S2D H;  3RZD B;  3FPU B;  4DXF A;  3SEB A;  4YHH Q;  1W2B A;  3KUP A;  2CHB D;  2K32 A;  1FVI A;  2VL6 A;  3SVM A;  4KD3 A;  1ROD A;  4CDE C;  1TWF B;  4A3F G;  2KEN A;  4YWK A;  3VYR A;  1YNX A;  3R93 A;  1FYC A;  2I07 B;  1IHZ A;  3W1B A;  1I4R A;  4JVZ A;  2CW0 D;  2A1A A;  1EWI A;  2F0W A;  3VR5 A;  4K6L A;  2JA6 B;  4P75 A;  3J80 c;  2Q8T A;  3CCE A;  4BY7 G;  4LUV A;  1E3P A;  5GRO A;  5LMN Q;  1PTO D;  2XIW A;  1K8A C;  4HIO A;  5AJ3 Q;  5M5Y B;  1I4P A;  4OX9 L;  2WIN B;  2HHH Q;  4BBS G;  1B7Y B;  3F2U A;  3TSS A;  1AH9 A;  2F0N A;  4HMI A;  1I50 B;  1YNJ C;  5IIF A;  3OSO A;  3TP8 A;  4QJF A;  4C1N I;  2F0T A;  4DR1 Q;  1CUK A;  1JOK A;  1SFO H;  1A63 A;  3EQL C;  4C1N K;  2J4X A;  2X6L A;  1D1K A;  1GHJ A;  2A6E D;  1JCK B;  1Q8K A;  3AYH B;  1VQ7 A;  2K1B A;  5COY A;  1QCB D;  2JA7 B;  2OTJ A;  1MSH A;  3Q22 A;  5IP9 G;  1EWC A;  3HEJ A;  5GAE C;  1KC8 C;  1OXX K;  1EFW A;  2E5L Q;  5M3F G;  3QIA A;  1QVG A;  2MPM A;  2VUM G;  1VF7 A;  1A15 A;  4CBV A;  2N49 A;  1KL9 A;  2VS1 A;  5CV4 A;  4A3E H;  1JJG A;  5KNB A;  3L2P A;  3KK7 A;  1KRS A;  3PIO 3;  2CH4 W;  5L37 A;  3HKZ E;  1YHQ A;  3OWE B;  4HSV A;  3AEV A;  4KN4 C;  4KY7 A;  2B63 G;  1WD1 A;  1JC7 A;  1STB A;  3W5O A;  4WFN 3;  4K0K L;  4JYA Q;  4FF1 A;  4DK6 C;  4IPD A;  5C44 G;  5JVG 3;  1KDC A;  1XPR A;  5HY6 A;  1TWA B;  5I9P A;  5E3F A;  5ELO A;  5IGB A;  2J7Z A;  5FLM G;  1WTW A;  1BNZ A;  1U0L A;  2CW0 C;  5IOD A;  3CP0 A;  3NPP A;  1PH3 A;  1CKM A;  4RMF A;  4A3C H;  5EBD A;  4G4K A;  1UEA B;  4QF4 A;  5D14 A;  2BE5 D;  4GN5 A;  3S2D B;  1GKH A;  3P7J A;  1GOZ A;  3V05 A;  1KXL A;  1QVC A;  1I4X A;  1XNQ Q;  2G9H D;  5IY0 A;  3WDN A;  1A6X A;  4H0L C;  1HA5 A;  1PTO H;  2E2J B;  2B2Y A;  4DV4 L;  3BYT B;  1J6Q A;  4XQN A;  4JOI C;  3AQQ A;  1HCZ A;  5K5P A;  1RTO A;  4DAP A;  1A3T A;  3CQZ B;  1X32 A;  3H15 A;  4JV5 Q;  4L5S A;  2I0Q A;  2CCZ A;  4L5R C;  1X6O A;  2ZXP A;  3DWQ A;  4HAE A;  4YIJ A;  4DR3 L;  2A6E C;  4DA2 A;  4S3S A;  4CJ0 B;  3HZX A;  1QIL A;  1CSP A;  1S4Z A;  3P75 A;  4UDU C;  2H5X A;  3UE1 A;  3UE0 A;  3TQY A;  1I6H B;  1TT2 A;  4XYO A;  3J7A V;  5NUC A;  1A2U A;  4NP5 A;  1BBW A;  3NQT A;  5DEH A;  1PRT F;  2EXZ A;  1NMG A;  4A3I B;  5IYB H;  1QZH A;  5C4J H;  4DK3 C;  4IPC A;  5CYU A;  2F4V Q;  2QA4 A;  4C3J B;  1VQ9 A;  3HOU H;  4XT1 B;  2E2H B;  3STB D;  4DU9 A;  2F3I A;  1SFO B;  1HZ9 A;  1J9O A;  1FJG Q;  3CKI B;  2IJ0 A;  2A69 D;  2IW3 A;  3TDQ A;  3CCM A;  1IBK L;  2PMZ B;  5JVH 3;  1SE4 A;  1IKM A;  5CV6 A;  4A3J H;  2E74 C;  5I9O A;  1EEF D;  1L0X B;  1F9P A;  1YEZ A;  2NVQ H;  1YZ6 A;  4BBR G;  4KMU C;  2PNH A;  1LT6 D;  1A0I A;  5IYC H;  1IYV A;  3SK8 A;  1S3O A;  1WTX A;  5T1I A;  4RG1 A;  2ZM6 Q;  2F0K A;  2PI2 A;  2BE5 C;  4YY3 L;  4JI7 Q;  1D7Q A;  4DR4 Q;  2LXK A;  5C5M A;  1KDA A;  1JB3 A;  2KEC A;  1OXV A;  4EGV A;  4JBJ A;  2K5V A;  3GDE A;  4OWT B;  2JA5 G;  2Z9H A;  3RD4 A;  2ZXO A;  2NN6 H;  3PGZ A;  1JQY D;  4LF8 Q;  4ME3 A;  1O7Y A;  1DYQ A;  2NZ1 D;  2L55 A;  2PZT A;  4FP5 D;  2A8V A;  2K75 A;  3HOZ G;  1TS2 A;  3NE5 B;  2JSO A;  1TWH H;  3NK9 A;  3KF6 B;  4BXX H;  3V2T A;  3HOX H;  3TS0 A;  2ENB A;  3D4W A;  3K7U C;  2CH4 A;  5LMU Q;  3L9A X;  2KVM A;  1YJN A;  3CU7 A;  2K52 A;  5IWA Q;  4X64 Q;  1BBX C;  1L2F A;  1QG7 A;  4RGT A;  4K5V A;  2KHI A;  3KF6 A;  1EQV A;  1E1T A;  1BXT A;  2KED A;  1TQO A;  4DNI A;  2IY5 B;  5C0X H;  1PTO B;  1ET6 A;  3I91 A;  2CWA A;  3STB C;  2NWG A;  4MHE A;  3E0J A;  4R4T A;  3QWN A;  3NBI A;  2ZJQ A;  1B4O A;  3EVQ A;  4LFC L;  3H6M A;  3OIQ A;  4DUZ L;  3I4M B;  3QB3 A;  4JI6 Q;  2QEX A;  2MUY A;  1SJE D;  1U9R A;  4DK1 A;  1HNW Q;  2IX1 A;  5C4Z A;  1V1P B;  1Y1V B;  3Q6S A;  3M4P A;  3HOY H;  3KJP A;  1JB7 A;  4MZ9 A;  2N3S A;  3GTJ H;  5D3D A;  5C4J B;  4B3T L;  2RCF A;  2KCN A;  3KLS X;  3DWA A;  2NVT H;  3BS1 A;  2MGS A;  4XQQ A;  1J8I A;  3M4Q A;  2E75 C;  4IPH A;  1HNX L;  1V1P A;  4JI2 Q;  3AFP A;  4DKA C;  1G29 1;  2MP1 A;  4I7Z C;  1PFM A;  1EQT A;  1QWY A;  2L4N A;  3MXP A;  3OTO Q;  4JBW A;  2OXP A;  2HIX A;  3S14 H;  1QE6 A;  1RHP A;  2UU9 Q;  1HH2 P;  4A3J B;  3HOV H;  1N33 L;  1BOS A;  3S16 B;  2NVQ B;  2A6H C;  1KLG D;  4KI0 A;  3MVV A;  1FD7 D;  1ET9 A;  3D4R A;  1Y1W H;  1RD9 D;  2D9U A;  4BS9 A;  4ZUJ A;  3PIO A;  2UUC Q;  1NE3 A;  2OEO A;  4GN4 B;  5I2X A;  5JEA G;  2IHF A;  4DR6 L;  4OHJ A;  4Q5V A;  4A3M G;  1WTR A;  2B8F A;  5FOB B;  1SMX A;  3Q23 A;  3X3N A;  3VR6 A;  2D0O A;  5IGD A;  4DV3 L;  4JI5 L;  5CGK A;  4IQZ A;  1W3S A;  3MXN B;  1DCZ A;  4H44 C;  4AYB B;  2M2L A;  1WTV A;  3PSI A;  2NVX B;  1CTM A;  4F87 A;  2N78 A;  3M3Y H;  3DWP A;  1ZKO A;  4CJ2 C;  3CCQ A;  1XMO Q;  1JE4 A;  4LK1 C;  4X66 L;  1U5K A;  3MXN A;  1DM0 B;  4DXG A;  2XWB B;  2N88 A;  1PMR A;  2YV5 A;  3I4L A;  2QKI C;  3HGB A;  2AQ2 B;  5IGC A;  4X62 L;  3CME A;  1KAB A;  4A3L H;  3SK6 A;  5FLX c;  2HDM A;  4N9P A;  4JI1 L;  1HHV A;  4A93 G;  1JWM D;  1OXS C;  1LAB A;  3PUX A;  4DF7 A;  4IUR A;  2FJ2 A;  5J1Z A;  1QVF A;  1E0B A;  1K3R A;  5JOB A;  5EPJ A;  1CQV A;  3U4V A;  3ICE A;  2IX0 A;  1VQA A;  1ENC A;  2GVB A;  3FHW A;  2BDO A;  2VQE Q;  1VQ5 A;  1Q82 C;  1CHP D;  1SMY C;  2O4X A;  2EYM A;  3NXW A;  5EQ0 A;  1IKL A;  3IL8 A;  1HFN A;  4UHV A;  3CCR A;  2K50 A;  1YJW A;  1A2T A;  2BA0 A;  2WB1 G;  3C46 A;  1B9M A;  4A3K H;  1PDQ A;  1PH5 A;  1YJ9 A;  2C5C A;  4KY5 A;  4A3G B;  1GM5 A;  2NVT B;  5I2Y A;  5C3X A;  1PZK D;  1O80 A;  3FKI H;  2BDN A;  2ALY B;  1RDP D;  4L63 B;  1U4M A;  4OXP A;  5C3E B;  3TP7 A;  1Z9F A;  3RLF A;  1WTO A;  4GN3 B;  2E2D C;  3K58 A;  3JAM L;  3ZJY C;  2JA8 G;  1UE1 A;  4JI3 Q;  5AJ3 L;  1EY0 A;  1EY8 A;  2RQX A;  4G7Z C;  3S1R H;  2HHH L;  4ZKB B;  3GTK B;  5IGE A;  1TII D;  1ILP A;  2Z6K C;  3HKZ B;  1D6E C;  4GKJ L;  2R93 B;  3BYY B;  2HQE A;  3PO3 H;  4POG A;  2WAQ G;  2QEJ C;  4LW1 A;  5C5L A;  1XTD A;  4H13 C;  2Z0S A;  1YVC A;  3FPP A;  1KNA A;  1PXU A;  1NAP A;  4P73 A;  1NTG A;  5E4W C;  1K83 B;  2EY1 A;  4KV6 A;  1N34 Q;  3F8T A;  3MAQ A;  1A3U A;  1Y8O B;  4IUP A;  1JMC A;  4FO2 A;  1G2T A;  1MJE A;  4QL5 A;  2E5L L;  2VXW A;  3FMC A;  4H7B A;  2B2T A;  1GJX A;  2NBF A;  3SXH A;  1H9R A;  3NUC A;  2K6A A;  4OWW B;  1IYJ B;  4K6D A;  2O5J C;  4OEM B;  3H91 A;  2F03 A;  3K7A H;  1F2Z A;  3TME A;  4C56 C;  2B2W A;  2BH8 A;  3VR3 A;  4FDB A;  4IFD G;  2RSN A;  2K03 A;  2NTT A;  1J5E Q;  2D2C C;  1TWC B;  4A3D G;  2R7D A;  3UDF A;  1B53 A;  4L5T A;  4NMZ A;  4GNX C;  1MHW C;  1AFP A;  3JAM i;  2RHQ B;  4XYQ A;  5EKI A;  4DV7 Q;  2ZTD A;  4IJH A;  2ATW A;  3A7A B;  3K0Y A;  5LL6 X;  4HCS A;  2NZO A;  4YCU A;  1CFM A;  1ZXT A;  1I4Q A;  4PNY A;  2YTY A;  3S15 H;  3A8K E;  2JA6 G;  1QUQ B;  3L3O C;  1XNQ L;  1SNP A;  4A3K B;  2H4O A;  1GUT A;  5KRU A;  1JJ2 A;  4R4C A;  4BY1 B;  4KKU A;  3SHL A;  3G6J B;  2D0P A;  3JC6 6;  1QUQ A;  3E5S A;  3JAM E;  3VR2 A;  1S40 A;  5M9O A;  3GTL B;  2FFK B;  2ZT9 C;  4MTN A;  1ICW A;  3A8J E;  3SGI A;  3O13 A;  4HMJ A;  1N32 L;  2VW9 A;  3I55 A;  2SEB D;  2XSC A;  2K04 A;  3K8A A;  2ID0 A;  3T1Y L;  3OYY A;  1EYD A;  5C0X I;  1KLU D;  4KHV A;  3HG9 A;  1H9K A;  1LO5 D;  1EEI D;  3KOJ A;  3K5O A;  5BR8 Q;  2F52 A;  1Q81 C;  2F4V L;  4G7O C;  2JA7 G;  1SRO A;  2L1B A;  4A3F H;  1Q3L A;  1IW7 D;  4DR2 Q;  5JJZ A;  2L15 A;  4Y52 H;  3T1H L;  4HIM A;  1SYF A;  3BU2 A;  1B50 A;  2H1E A;  1BCP F;  3OHX C;  2UUB L;  4XTC S;  4BY7 H;  3A5U A;  1HFG A;  2WV6 D;  3RZO H;  3EIV A;  1O7I A;  4PZ7 A;  4PMW A;  2F4I A;  4ULL A;  4ZLT F;  1AP0 A;  1SNC A;  3HOW B;  1ZEQ X;  2EZV A;  2ICE C;  1EOT A;  4JI7 L;  1DOK A;  1K8G A;  5M5W B;  4IUQ A;  1BCP B;  1IXR A;  1GUS A;  1I4H A;  2Q2T A;  3M9B A;  2F0F A;  1SLJ A;  1EUJ A;  2CQO A;  2I5M X;  4JI4 Q;  1VQN A;  3S2H B;  4YCV A;  4K2K A;  3S24 A;  4FF2 A;  1DON A;  1PH2 A;  3J81 L;  1YIT A;  3H3V C;  4WJ4 A;  2EYO A;  1VQC A;  3H0G G;  3ND8 A;  1X54 A;  4HN7 A;  3ERS X;  3NTI A;  1TS4 A;  5IP9 H;  2HQL A;  2F3W A;  2RF4 A;  2EYP A;  5M3F H;  1N36 Q;  5IWA L;  2VUM H;  2V4D A;  3EBE A;  3VDY A;  3OOC A;  4GNX B;  3CHB D;  3MXU A;  4Q0F A;  2MO0 A;  1DOM A;  1BDO A;  2EYF A;  2Z4H A;  2KCM A;  4O42 A;  3T53 B;  1CQF A;  2ICI A;  2WP8 J;  3MEF A;  1R4Q B;  5HUR A;  1PRT C;  2B2U C;  1QNU A;  2PYK A;  1HNZ L;  4AQY Q;  1NMF A;  2B63 H;  3SK4 A;  4K8J A;  4QUC A;  4LF7 Q;  4GNX A;  5G3L F;  1LUZ A;  3V96 A;  2R92 B;  2Z1C A;  2HUG A;  2NUC A;  4LWC A;  4PV1 C;  5C44 H;  2R6G A;  1IW7 C;  4KHP Q;  4A3I G;  1OXT A;  2A68 D;  1SE3 A;  4DAV A;  2JP1 A;  2DGY A;  2L12 A;  2WKD A;  4C3J G;  4I7A A;  1LTB D;  3VR4 A;  4JI6 L;  4FXD A;  3I4N B;  1GUO A;  4IZ8 A;  1U4L A;  3G4S A;  2QW7 A;  4TSS A;  3IFD A;  4ZQ3 A;  2JK8 A;  4FF3 A;  1VQI A;  2UUA Q;  2MHV A;  3RUZ A;  3IAY A;  5JJL A;  2DNE A;  3QJY A;  1JWS D;  1GO3 E;  1HR0 W;  2PQE A;  3GTP B;  1NY4 A;  2UXC Q;  5K36 H;  4N9T A;  1Q12 A;  2F0D A;  4AIM A;  4JI2 L;  1VQ8 A;  2HD3 A;  1VQH A;  1JOR A;  4TVA B;  3M7N A;  5CV8 A;  4B9W A;  1PYS B;  3K5M A;  5JAV A;  3OTO L;  4JBK A;  3J81 i;  1D5Z C;  5FJ8 G;  1EIY B;  2UU9 L;  5GAG C;  3B6Y A;  3CCV A;  2N8N A;  3G48 A;  1KD1 C;  2WAC A;  1VQK A;  5GQO A;  3J7A 5;  4AH6 A;  1LM0 A;  1GVP A;  1N9W A;  4DV5 Q;  1GUG A;  1XMQ Q;  2UUC L;  4IUV A;  3ONA B;  3GTG H;  4PMC A;  3U9S A;  1WTP A;  2Q2U A;  4ZAI A;  2DN8 A;  4XQJ A;  4JI8 Q;  4RGM A;  3HFZ B;  5KNC A;  1BR9 A;  2XN9 C;  4IAL A;  1CM9 A;  2HIV A;  4A3C G;  4DUY Q;  2VNU D;  1X55 A;  1ASY A;  3IKJ A;  4JI0 Q;  2WB1 E;  4X6A H;  3W2D A;  3J81 E;  1B3Q A;  1KRT A;  2N55 A;  1K3B C;  5H1S E;  1C7Y A;  2K5W A;  1HUM A;  3A74 A;  2HT1 A;  2DJG C;  5BN5 A;  4LF9 Q;  2RVL A;  2X69 A;  4V19 0;  4DV2 L;  2A68 C;  2OF1 A;  2CQA A;  1LTR D;  1JJC B;  3A0J A;  3SK5 A;  4PZ8 A;  1Q46 A;  2L11 A;  3OPO A;  4BBR H;  2VQF Q;  4LF6 Q;  1EY5 A;  5I4D A;  2IX3 A;  2LSS A;  1QJO A;  1WTH A;  3WOF A;  3KLW A;  5IT9 L;  4EVO A;  1HZA A;  1AE3 A;  1VF5 C;  3I4M G;  4XT3 B;  1YI2 A;  1FGB D;  2F0Q A;  4GLV B;  5EAY A;  4CKC A;  3GTM H;  3C3L A;  4EX5 A;  4RA8 A;  4IFD I;  1TS3 A;  1CK1 A;  1X3G A;  1CT1 D;  1SE8 A;  2L9H A;  4LFA Q;  1Y1V G;  2UXB L;  1G6Z A;  4NPS A;  4A3E B;  2VQE L;  3PO2 G;  1AZQ A;  5A35 A;  1X56 A;  3HOZ H;  3D0F A;  4C3H G;  3VYS A;  1I5F A;  2D62 A;  1VDZ A;  2GVA A;  1HRJ A;  5EPK A;  4L8J A;  3LNN A;  4OO1 G;  3NEM A;  1D5X C;  3MXG A;  2R7Z G;  3H09 A;  5J3B A;  4ILW A;  4A3J G;  2A6H D;  5IP7 G;  3UI2 A;  1SRU A;  3SDZ A;  4LJZ C;  4ZKC B;  1PTO F;  1UE6 A;  2F3V A;  2K33 A;  3GTQ H;  3S17 H;  4BA2 I;  2ZJP A;  2R7F A; 
#chains in the Genus database with same CATH homology
 1MHW C;  4CDE C;  4CDF C;  1K3B C;  4CDC C;  1ICF B;  4OEM B;  2DJF C;  4CDD C;  4OEL B;  2DJG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...