2DJFC

Crystal structure of human dipeptidyl peptidase i (cathepsin c) in complex with the inhibitor gly-phe-chn2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of human dipeptidyl peptidase I (cathepsin C) in complex with the inhibitor Gly-Phe-CHN2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Dipeptidyl-peptidase 1
total genus 8
structure length 68
sequence length 68
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2006-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 2djfC00
4CDFC 4CDDC 2DJGC 4OELB 4CDCC 2DJFC 4OEMB 1MHWC 1K3BC 4CDEC 1ICFB
chains in the Genus database with same CATH superfamily
3W1GA 2B2VC 5BR8Q 2L11A 1OXUA 2EDGA 5IWAL 2DGYA 1LT6D 5IP9G 2GA4B 4BS9A 5E4WC 3EQLC 3M4YA 5D65A 4G7HC 4DAYB 1IXRA 4R4IA 1ICFB 2YTXA 3OPOA 3S2HH 1RCVD 4YCUA 2I0QA 4LF9L 4EX5A 1PH5A 5G3LF 2K28A 3N52A 1STGA 1VQDA 4DR5Q 2WAQE 1Q81C 4LF8Q 1KXLA 5I6WA 2SDFA 5D14A 5KRUA 1FNWA 2OWOA 2K03A 1GO3E 4GS3A 1HNXQ 4G7ZC 1F77A 1HNWQ 4IUPA 1EWHA 5A2QL 1TY2A 2MQHA 1JB3A 2D0PA 1PTOB 4KK7A 4PQXA 2CW0D 3ER0A 2E8GA 1EEFD 1SNOA 1Z7TA 3M9BA 3I4NG 3HG9A 4CJ2C 5EBDA 1F2LA 3H6MA 1J9OA 1GUTA 1T5EA 4XDXA 1K8GA 1PFMA 2Q2IA 1JCKB 3CHBD 1NUCA 4C3HH 1E24A 2F0OA 1I4PA 2K32A 2EJGC 1B44D 2L0CA 4DPGA 5C4ZA 2ZXPA 3D31A 1ICWA 3OWFA 2JA7G 3G6JB 4LF5L 1RDPD 1HXYD 1YNXA 1QVGA 1A63A 1X54A 3J80c 1II3A 1A3UA 1PYSB 1TVXA 1SNQA 1QJOA 2XSCA 4A3DB 1DCZA 4A3LH 4C2MB 1F9PA 2DJGC 3TZDA 2XTIA 1LUZA 1TWCH 1STAA 4C3IH 4A3LG 3H94A 3RR5A 1QZGA 1LACA 3PQIA 1SN8A 1E3PA 3WOEA 2ZJRA 2MPMA 2F0FA 4GOPA 1HR0L 3AFQA 1HNWL 5J3BA 1QZHA 4G57A 1O7IA 1HFGA 4AQYL 3VYUA 3HGBA 3U58A 3S17H 3L9AX 1H9SA 1VQIA 1FNVA 2KCTA 2KEEA 3SK8A 4WJ3M 4HMIA 3D8GA 4C3IB 1LABA 2Y0SB 1E2ZA 3G48A 2K1BA 4N8FA 3LNNA 1HZBA 3AYHB 4CDEC 5M5WB 1TIID 2RDGA 2JA6H 1A0IA 1GD7A 5JJKA 4JV5L 1GKHA 2UU9Q 1LLRD 4C56C 3S1MH 4DV1L 3A0JA 1RTNA 3CRLC 4HTHA 2B63H 3QB3A 3EA6A 2F0NA 4O0AA 4A93B 1HTPA 4KY5A 2NVTB 4A3KB 4UPAA 3NBHA 3MXPA 5JPMC 1CQVA 4DR1Q 2EE1A 3D6WA 3H09A 1BBXC 4BBSB 1K3RA 2EY5A 4N8X1 3T56B 2EY1A 4GKJQ 4GKKQ 2J4XA 3OMCA 1K83B 2NN6H 1WI5A 1YNJD 2KBNA 2B2UC 4U68A 3S1NB 2O5JC 1JMCA 4B3ML 3MVVA 3SDZA 4B3TQ 3PUYA 2NWGA 4K6LA 5C3EG 1S5ED 4QCLA 4PNYA 4YY3L 2A5HA 3RZDB 1KIXA 1MHWC 1BCPC 1JQYD 1X55A 3I8ZA 4RWSC 2HDMA 4DUZQ 1XNRL 4JYAQ 5JAVA 3K5OA 3KJOA 3EFXD 4P2CB 1WTHA 3PGZA 1A2TA 3A54A 4V190 3TREA 1FR3A 1YBYA 3KK7A 3J7YW 4A3DG 4A3JH 5GADC 2UU9L 4ZQ3A 1VQ7A 2C5CA 2ENBA 2I5LX 1U0LA 3PO3H 3CXCA 1GOZA 1KDCA 4RKBA 4GN3B 4AIMA 3ITPA 3H15A 4IN3A 2MNAA 5IGCA 4A3IG 1CKNB 1E1TA 4ZKCB 2A1AA 2E74C 3I4MG 2JJQA 1EY5A 1FL0A 4KY6A 3J80i 1SR3A 4FF1A 2K52A 4B3SQ 2FFKB 3UDGA 2YYZA 2FMCA 1JE5A 4CKEA 5FLMG 2Q2TA 4KMUC 2RVLA 3K6OA 5FJ8G 4QGUA 1WVLA 3ND9A 3S1MB 2ZJQA 3OWEB 4RCOA 3A8JE 2Z8LA 4DV2Q 2VB2X 1STNA 2NVQB 2NVTH 1HTLD 4R4QA 2ZXRA 3QO2A 1C48A 4DK0A 3MAQA 3T1HQ 4LNQA 4A3FB 1PZJD 4YCWA 1CZGA 1IHZA 2OXPA 4OL7A 2F3WA 5IYCH 4HSPA 2B39A 5L37A 1KLGD 2PZTA 1I5FA 1KNEA 3MFYA 4P73A 4XIGS 3K58A 3T16A 4XQQA 3GTKH 4A3JG 3JAME 1I6HH 2LXKA 3HOUB 3J81E 3PMFA 1F9QA 2R7ZB 4IJLA 3KLWA 3EROA 3PCOB 4ALPA 3D4RA 1L0YB 5ELCA 3RZOH 1VQBA 1X56A 3RNUA 4H02A 3I56A 2XIWA 4PG3A 1DGSA 1Q46A 1NSNS 3IFTA 1RF2D 2OF1A 5EKIA 5FJ8H 3R8BA 5IGGA 2K5QA 2K50A 1Y69U 1QE6A 5IYDH 5HY6A 1G2TA 5M5WH 4ME5A 1HUNA 1FYCA 3FDTA 1MBYA 3QOJA 2DY7A 1EQVA 3DWPA 1A8VA 1PRTF 4DXGA 3JC66 1E7ZA 2VW9A 1EIFA 2RSNA 2EXDA 3KYHC 2WAQG 4JI1L 2IL8A 3HRZC 3QWNA 1Y8NB 4GNXA 1IW7D 5IYBG 4ABNA 5JVG3 1UNSA 3J7ZC 2IY5B 2HHHL 5EKKA 5KEEA 2Q2UA 2JA8H 4G4KA 1KRTA 1ILQA 4EQOA 3HOYH 3K7AH 1PH1A 2G5DA 4BA1I 3I4LA 2CCZA 3Q8DA 2F4VL 1LTSD 2KVMA 4P74A 4O42A 2NZ1D 4DV6Q 1PFBA 1M90C 1SFOB 2AWNA 1SYDA 3CQZH 2F0SA 4BY1G 1QILA 1FGBD 3S14B 1CA6A 4A3GB 4AH6A 2L55A 3HKZG 3A5ZB 5EQ0A 3IFDA 2VNUD 1PH3A 3ERSX 2I07B 1XX8A 1LTGD 2E75C 1Q1EA 4B9XA 1SYCA 2SNSA 5LMNW 2CHBD 4HEDA 4ILWA 2HIXA 3EIVA 3TP7A 4KHZA 2UXCL 1DM0B 5FLXc 1DONA 2A73B 1XMQL 3BVZA 5C3XA 5I9OA 2N88A 2AKWB 2O2LD 2NTTA 3TS2A 4DNTB 3GTGB 4QB4A 4MHEA 5M5YB 4KV6A 2DY8A 4Q5VA 3U4VA 5K36G 1AE3A 2KCCA 3K80C 4N9TA 4KN7C 1SNPA 2PO4A 3CU7A 4M1UB 3T13A 2ZT9C 5CMDA 1TY0A 4BXXH 2NZHA 1BCPF 3GTLB 2PI2A 1CHPD 4EVOA 3BDLA 1MJCA 2BH8A 3IAYA 5IT9c 4CHTB 3HOWB 1HNZQ 1I94Q 3PF4A 1J8IA 3GTOB 2O5IC 2CFMA 4L63B 4FVMA 4NXML 2R61A 4ULLA 4ZLTF 1VS0A 3MEHA 3VA7A 3SK6A 5C6AA 4GKKL 3DLLA 2PNHA 2JN4A 2Q8RE 4NMZA 5LMNQ 1D5MC 5LL6X 2X69A 4IUNA 2M9VA 4WRDA 5NUCA 4C3IG 1O7LA 3J80E 1VQ4A 3T1YL 1L1OB 1U4LA 5FK9C 3J80L 2XRQD 3W2DA 4K8JA 2OT2A 2FXQA 4CKBA 2E2IB 1I6HB 4TKOB 2ID0A 1EFWA 2Z1CA 2R93H 2L15A 1ZXTA 3BG3A 1WJJA 1B9NA 4DAVA 1PHJA 1GUGA 4XQJA 1V1PA 5JVH3 1PTOD 3PIP3 2NVXB 2Y0SE 3GO5A 1PTOF 1IYUA 4OWWB 3A56A 4PZ7A 4UY8C 4FO2A 1PMRA 1R4QB 3NEMA 3VR6A 2QEJC 4GLXA 1IL8A 1EEID 1VF5C 3S1NH 3OIQA 1BNZA 1N32Q 2B2WA 1X3FA 2VB3X 3HOZB 1B3QA 1E22A 3HS0C 3I4OA 3PV0A 2KHSA 3F8TA 4OIJA 5C0XJ 5J22A 3TQYA 4JBKA 2UUBL 1PRTC 3Q0AA 1PH2A 3WDNA 5EJWA 4BXXG 1J6QA 2AMCB 3E6ZX 1DJRD 4DGZA 4NP5A 4HN7A 3I4MB 4DUZL 3KBGA 1IZ6A 4LF7L 1JJ2A 2Z6KC 3F2BA 3NP8A 3DEPA 1IL2A 3GTQH 4MZ9A 4A75A 1NCVA 2D2CC 4OEMB 1EU3A 4BY1H 1WYDA 3HKSA 5A35A 2YU9H 3KDFB 2PMZB 4C1NK 1K28A 1PH4A 4CJ0B 5IOCA 3GTOH 1HRJA 4PZ8A 1L2FA 4A3BB 3NE5B 2UXBQ 1PXUA 2KECA 1N32L 2GVAA 3PUXA 4JI5Q 4RGMA 1BQQT 1PH7A 1HA6A 4A3CG 1BOSA 1IBLL 2L9HA 5C44G 1B53A 1K83H 2A6HD 2WAQB 4OO1I 4N9PA 4DV5Q 1L0XB 1UEAB 2A6ED 4J6HA 1TKWB 4C3JG 1EOTA 2NVYH 2NN6I 1TWFH 4X3TA 1MSGA 1M8AA 2E2HH 2UUCL 1JOOA 3M4OB 1ML0D 4R8NA 2VUMG 4FXGC 3S1QB 4DK3C 1ESFA 4A3EG 4QL5A 3CC2A 1XPOA 4RGOS 2PQAA 1KD1C 5IYBH 1TS2A 4BBRG 1CFMA 2VUMB 1KTKA 1HJPA 1BCPD 3F1ZA 5IYDG 1ZYRD 2VZAA 5IP7H 3BS1A 5DM73 1LTLA 1SRUA 1ONLA 1Y8OB 1VQFA 1Q8IA 4K6DA 1HZ9A 2WKDA 4IUVA 4XT1B 4IUQA 2RCFA 3TRZA 3NBHB 2BH2A 2F0GA 5ELFA 3NWSA 2EYPA 4JI3Q 3E0JA 4A3IH 5K5PA 5M3FG 5G3LD 3T53B 2DJFC 2JK8A 5IWAQ 3I91A 1TT2A 1YEZA 3CCSA 1Y1VB 2A6EC 4WORA 4B9WA 1XPRA 3T51B 2EIFA 3HOVH 4AYBB 1C9OA 1SROA 1E2VA 1N36Q 4NXNL 1WTRA 2LY7A 4LFCQ 3I3CA 4HCEA 1KAWA 1W6JA 1BDOA 3DXJC 4HJ8A 1AZQA 2NB0A 2KQ3A 5T1GA 2K75A 2A69D 2UUCQ 4O2DA 1SYGA 2CQAA 2LS01 2KHJA 3E9IA 2KCMA 3F2UA 4DV4Q 2MJ8A 3Q22A 3CF5A 4GOPB 3X3MA 4GOPC 1EIYB 5I9PA 1SE4A 4PV1C 4RGNA 5D3IB 1VQLA 1G291 2IJ0A 3PF5A 1RL2A 1BCPB 3CMAA 3A7AB 4JBMA 4K8IA 4LMQD 3CP0A 1QG7A 1PH8A 4CDDC 4L5RC 3HOWG 3P75A 1TR5A 4V0BA 2V4DA 1L1OA 3CAMA 3DHQA 1WCMH 1G51A 2WACA 1ENCA 1P8LA 2KHIA 3CQZB 2G9HD 4XTCS 2B2WC 1LYLA 4K5WA 1JWUD 1EYCA 4DV7L 1IW7C 2F0TA 1BBWA 2Q8IB 1UAPA 2ZXOA 3VDYA 1EWIA 2X6LA 2K33A 1RHPA 2FJ2A 2K01A 4JI2L 3CPWA 3S15B 1U4PA 3DWQA 3CW2C 4X62L 3I7FA 2PZWA 1I4HA 1B8AA 1AP0A 1I4RA 3UDFA 3VYSA 4XXEA 1Y14B 2C9OA 2K4KA 2MO0A 3LGJA 2L12A 5LMUL 3DEOA 2YU9B 3OMGA 2G9DA 1D7QA 1T9HA 2GN5A 2ZM6Q 3GTQB 1IKLA 2UUAL 2F52A 1LTBD 3QG1A 4Y7NB 1I94L 5M3MB 4YWKA 3U9OA 1CSPA 4JOIC 4BY1B 2NN6G 1VQ6A 1JOQA 5IIFA 1EY6A 1PYBA 3GTPH 5J39A 2K14A 2DNCA 2EYHA 3CCJA 2UUBQ 1F2YA 1H9JA 1ENAA 1X9NA 2J0TD 3B6YA 4H44C 4J8QA 5E7NA 1FGUA 3GD7A 3TN2A 2ASBA 1IKMA 2KEDA 1U4RA 1H9KA 1VQJA 2B2YA 3RLFA 4FYDA 2JA6B 4KKUA 4X3UA 1KC8C 1PLFA 4R4OA 1C8CA 4DV3Q 1M1KC 1MGSA 1M4VA 3QJYA 5CGKA 3FKIH 2JA6G 4A3MG 4JW0A 5I2XA 5IT9E 4OO1H 5BN4A 1Y1WH 3NUCA 1GVPA 3MXNA 4IOAA 2A68D 5KIXA 4EQPA 5C4XG 5HGQA 1CM9A 1VDZA 2EZVA 4U673 1NMGA 1PVOA 4IPCA 2EQSA 3MWYW 2R7FA 3V2TA 5IY0A 2A74C 3TS0A 3M7GA 4HJ9A 1XNRQ 1TWGH 3F2CA 1PYWD 4NKLA 3C46A 1U4MA 5CV7A 1XNQL 3I70A 5FOBB 2ZJPA 4DAMA 2FINB 2WKCA 3A74A 4YIJA 3OHXC 3RN5A 2UXDL 3CCVA 2EYJA 3KLRA 4E6IA 1V9PA 3RN2A 3I55A 2F3VA 4RGTA 1MD2D 3S17B 1LTAD 5EGTA 5EBCA 1Q1BA 4A93G 5KYLA 4BY7B 2RA4A 1WOCA 4IFDG 2D5DA 3J81i 1LTID 2HQLA 3HP3A 1JT8A 2RHQB 2VQEQ 4FDBA 1K9MC 4JYAL 4NDXA 4LWCA 1QOHA 3HOUG 1WD0A 4QIWB 4DV0L 1GUWA 2KENA 5AJ3Q 5DEHA 5M3MH 4X64L 1B70B 1N9WA 4B3TL 3MXGA 3KFUA 1S72A 1TS5A 3GTPB 3RLOA 4BY7H 2R6GA 3G6EA 1ZKOA 3NPPA 4GNXC 4DR6Q 2I5MX 2HIVA 3S2DH 2ZTEA 1FJGL 1EOVA 4F7XA 5C4XH 1Q8KA 1B7YB 4RA8A 2WB1E 3NXWA 4UP9A 1Y1WG 1TWCB 1B2TA 2WIIB 2XGTA 4UP8A 5FLXL 1EIHA 1Q7YC 4ID6A 4YWMA 3SK4A 1DOKA 4A76A 4NXNQ 2YV5A 1BUVT 1HNZL 3MTSA 5M5YH 1EQQA 3S15H 2E2JH 3WWVA 4ZUJA 4O1NA 4JI4Q 1EY7A 2A6HC 3HOVB 4YHHL 2XWJB 2K5HA 3UDIA 3L2PA 3G7LA 3PO3B 3QR8A 2R7ZG 1UE6A 5CV8A 4RMFA 1YJ9A 2NTSA 5COYA 3BYYB 4IFDH 4GZYC 3UE0A 4A3MB 1SXTA 4OIKA 1HH2P 1EYDA 2OQKA 2KUMA 5CORA 1SJHD 3Q6SA 5T1IA 1J5EL 4DN4M 1CI3M 1DXMA 1SNCA 2F0WA 4DFAA 4FNFA 4KI0A 3OOCA 2PNRC 3MC0B 1SEBD 3U9SA 1I50B 2DUDA 3VR2A 4GLVB 5ELBA 4LFBQ 5IGFA 1PZKD 2NBFA 2RDHA 3S2HB 1VQHA 4A4IA 1YI2A 1S5DD 1FNUA 2B2UA 3RZDH 3D4DA 4K14A 2JA8G 1NJIC 4K0KL 5H1SE 4LFCL 3T4AC 2WP8J 3T1YQ 1P16A 1LT4D 1Y1VH 5KNBA 1QVFA 1O7ZA 1XWEA 5E3FA 4YHHQ 5IGDA 1KNAA 3VR3A 3H3VH 3W5OA 1WCMG 1XJVA 4JBWA 3PO2H 4OO1G 3KLSX 3K0XA 3W3AA 3FKIG 1AEXA 5M5XH 3HOZH 1Z9FA 1D5ZC 4DR3L 1VMPA 1E1OA 4JOIA 4QF4A 1PFNA 3TMEA 1JE4A 5IODA 1S5FD 4QUCA 4X66L 5M3FB 1MSHA 1S40A 2WB1G 4HIOA 1FJGQ 4X62Q 2CKZB 4LF7Q 4DV4L 3S1QH 1SAPA 3UDXA 1B9MA 1SMXA 2UXCQ 4NB3A 2XNAC 1EU4A 1OXSC 5EAYA 3QOLA 4J15A 4B3MQ 2ZTDA 1EWCA 1TS3A 3C3LA 4IOCA 4X3SA 3KF8A 3HOVG 1TWAB 5I2YA 5CV4A 1SYBA 1T5XD 1TU2B 3P20A 4BBSG 4H0LC 4JI4L 1RJTA 3OTOQ 2BDOA 5M3FH 4A3FH 2DN8A 4RG1A 1G2SA 2JA5H 3BVGA 3OW2A 2KJXA 1NY4A 1A3TA 4DV1Q 1SYEA 2NVQH 2VY3A 1F9SA 5C5LA 1HCZA 2ZM6L 3U50C 1SMYD 1LTTD 1RTOA 1R4PB 3CC7A 1AE2A 4OX9Q 5C5MA 1VQ9A 4X66Q 2ALYB 4DR1L 3AQQA 4L5QA 5ELOA 1AW7A 2Z9HA 5FLMH 1ZYRC 1YHAA 1K0RA 1Y1VG 3ULPA 4BBRH 2BDNA 3HOZG 3FPUB 4A3EH 4JK1C 1VMCA 2MO1A 1A15A 1SE3A 3PO2G 1MJEA 1HNXL 1LM0A 3BYTB 2H4OA 4BWGB 1OXTA 4GN4B 3U4ZA 4DAPA 1CKMA 1H9RA 1EUJA 1BF4A 3K7UC 1HFNA 3K8AA 2IPKD 4DU9A 1LV9A 1WFQA 5LHY1 2WV6D 3EBEA 3UE1A 4KHVA 3I2ZA 3TP6A 1UUPA 4DR2Q 4EQ5A 2VUMH 3H3VI 4LFAL 1IBML 5CR3A 2AUJD 3CD6A 5J1ZA 1SYFA 4HJAA 1JICA 3T1HL 1YHBA 4A3EB 1CKOA 4DR7L 4DA2A 2A69C 4IUUA 5AFWA 5CV5A 3D0FA 4L5TA 4IO9A 2PQEA 1EY9A 2QDBA 1ASZA 1HHVA 4OX9L 5E4XA 4NPSA 4DUYQ 4DAYA 2K05A 4L6TB 1EQRA 1X65A 1YJWA 2CWPA 2A19A 2K6AA 1PTOC 4Q0FA 1PA6A 1XTDA 1ET9A 5E1FA 4FF4A 2YTYA 1OTCA 4LF5Q 4X64Q 1OXVA 1TQOA 4OWTB 1JB7A 2LXJA 1QUQB 4RKLA 5JOBA 1BO0A 1I4GA 3FMCA 3NTKA 3NWTA 4A3KH 1YZ6A 5IP7G 1EFID 2VQEL 3M3YH 1X6OA 3NQIA 2B63B 2VQFQ 4POGA 3STBD 1JWSD 2F0JA 1ILPA 3PUWA 3FRPB 3M85A 3GQBA 4WJWA 4MTNA 3A8KE 1KAAA 1U5KA 2HCCA 4K5XA 4LF4L 1IYVA 4P75A 1U9RA 1Q3LA 3EJIA 2N8NA 2E76C 3E0EA 2K5VA 2K7VA 2EY6A 2QKIC 4DR4L 5GAEC 2J7ZA 3HZXA 1H9MA 4F88A 3SHLA 3CKIB 3PUVA 4BY7G 2P5ZX 1HUMA 3BVMA 2NVXH 4FF2A 1ZEQX 2R92H 3NENA 1LTRD 4DKAC 2AQ2B 3NTHA 3MHBA 3JAMi 2JA7B 1CSQA 4XT3B 3H0GG 3HOXG 3M3YB 3HOUH 4JI8L 4B3RQ 4S3SA 3K59A 3GTLH 2WFWA 2JE6I 3P7JA 5KGUA 2IX0A 5TSSA 1WTPA 2SEBD 3TDQA 4OXPA 3G4SA 1AN8A 1KQSA 4KD3A 5C3WA 1EZ8A 3AB9A 2M2LA 3MFGA 3R3OA 4JBJA 4LUZA 2RCNA 2OEOA 1FD7D 5LL6S 2R92G 4R1JA 3URYA 3S1RH 4F87A 2EJMA 3FPPA 3CC4A 2R92B 1CTMA 3NQTA 1DZ1A 2CQOA 4ZUIA 2RQXA 2F0KA 5JJIA 2F0LA 4H7BA 1CA5A 3R2IA 2HUGA 3I72A 2OCEA 4RHSA 5I6YA 1C4QA 2B3GA 3E5SA 4M8AA 1BVSA 1LO5D 1SE2A 2A68C 2FHTA 1EQTA 2XVSA 4FXKC 4A3MH 1VQOA 4QQBX 1GUSA 4X3KA 2TSSA 1AZPA 4ZYSA 3AU7A 2AHOB 3KOJA 2MHVA 3D3RA 5IT9L 2HT1A 4XYOA 1QNKA 4TRDA 5IGEA 1K73C 3HKZE 1V1QA 2E5LQ 1GUNA 1IYJB 1I50H 2LFNA 3MEFA 3NTIA 3SVMA 3KF6A 4F8MA 1J5EQ 3AEVA 3S16H 3M7NA 3HKZB 2PPBC 3KDFA 1X3PA 3KF6B 5C4XB 3H0GH 2L4NA 3HOXH 2D62A 3R2TA 3J81c 4MTKA 1Q90A 3IRBA 4A93H 1FVIA 5M9OA 1W2BA 4LFBL 2GVBA 4ME3A 5IP9H 4P71A 2HQEA 1GJXA 1S5CD 4H13C 5BN3A 4KKSA 4RAUC 5JEAJ 2F0DA 1R9TB 1SE8A 1I4XA 1PH6A 2Y0SG 4IZ8A 1KDBA 2EXZA 2KCNA 3GTMH 1UEBA 1VQEA 1XYIA 3F2DA 1N8RC 3K57A 4IPGA 4TVAB 4DV2L 3GV6A 5KNCA 3M4PA 1D2BA 3FEWX 1I4QA 3MXNB 3N6RA 5BR8L 1LT3D 5I4DA 3A7LA 1ESRA 2KOLA 4PMBA 1MKHA 3SEBA 4JI7Q 4LUOA 1A62A 2B2TA 3L0OA 2E5LL 3CCLA 1C0AA 3QIAA 3FKIB 2D0OA 1HZCA 3ULLA 1F2ZA 4LF9Q 2LSSA 1JR0D 4JI3L 3OIPA 3A5UA 3CCQA 3HOYG 3J7AF 2JSOA 4JI6Q 1SSOA 3CCUA 4A3JB 3HOYB 1BBUA 3HOWH 2F0UA 3PIOA 4KTAA 1KL9A 1MI2A 5F2DA 4LW1A 1GM5A 1VQ8A 1YITA 1I3QH 2AUKA 4AQYQ 1XMOQ 4DNRB 1DOMA 1D8LA 3ICEA 4HSVA 4LJZC 3L7ZC 2L1BA 4IQZA 2F0VA 4L5SA 1JOKA 5C4JB 4GKJL 2NUCA 2PYKA 5C4HA 1YJNA 4LFAQ 2JEAI 1C7YA 2IHEA 4HMJA 1STHA 4DK1A 5LMUQ 3PO2B 4BBSH 2Z0SA 4HR7B 2QW7A 1IBKL 2F0IA 4JI7L 2B2TC 4FXDA 1H9SB 4YY3Q 5DAUA 4IPDA 4IFDJ 3NELA 3MZ5A 3E9HA 3BZCA 3K81C 4JI5L 5JPNC 1EL0A 2PW5A 4HJ7A 4A3IB 3SE0A 4JI6L 2R93B 1X3QA 1YNJC 3W1BA 2EPBA 4ZCKA 5JJZA 4JCVE 2PZUA 2HCIA 3VA5A 3BZDB 2CVRA 4CGYB 5ISRA 4DV5L 4K5VA 3CPFA 1VQCA 5EPLA 4DV7Q 1CT1D 1TWHB 1YVCA 2O4XA 1TXYA 4B08A 4GLAC 4R4CA 2Z6BA 4X65L 2F0EA 1F9RA 4QMGA 1SNDA 3GV3A 5A2QE 1X3EA 3K7AB 4KJNA 3TZUA 1QWYA 2A8VA 2PMZE 1WTOA 4CJ1B 4Y52H 3Q24A 1MIUA 2VQFL 1JORA 4PMCA 4HCSA 4TSSA 4C3JH 1IBMQ 2C35B 3K5MA 1X3GA 4DNIA 2M00A 1DD2A 2JA5B 1SLJA 4L8JA 1N34L 1A3VA 1G8ZD 1K0SA 2PI2E 2RBMA 1PH9A 4K0KQ 4R4TA 3X3NA 3AMUA 3P1HA 3PO3G 4A3DH 1K8OA 3KBXA 3ND8A 1SBBB 4JI0Q 3OW7A 2H1EA 3WOFA 3I73A 3J81j 2BE5C 3K5NA 4DR5L 5DM63 4K2LA 5AJ3L 3BDOA 3TSSA 2Z4HA 5C44H 2HDLA 1IBKQ 3J7A5 1G6ZA 5EPKA 5JEAG 4UHVA 4A3CH 1RIPA 3H3VC 5C3EH 1K8AC 4IURA 5FO9B 1XMQQ 2QF7A 1DYQA 5FO8B 2QEXA 3GP7A 2EVBA 1EY4A 4JPBW 4DF7A 1ET6A 1STEA 4KLKA 5CC4A 1HA5A 2IT1A 5ELNA 2MUYA 1NAPA 3GDEA 1Q82C 1PDQA 1HPCA 2R3ZA 4RHRA 4RH6A 5D3DA 1D6EC 1SFOH 4XQNA 1EYAA 2UXDQ 4LF8L 3PIPA 4IALA 1K8MA 3TP8A 5FO7B 4JI8Q 1TWGB 4ZRZA 1YNNC 4QY7A 3V96A 3M4OH 2E2JB 2MGSA 1UWVA 4LF6L 4BA2I 1PRTD 1ASYA 3VR4A 4IPHA 4JI0L 5CBAE 4PMWA 4DV0Q 2N49A 3VYRA 3CCMA 1NNXA 2E2DC 3JAML 3HEJA 5GAHC 1O78A 2JXMB 1N34Q 3VR5A 1B3AA 1GXDC 2CH4A 1HR0W 3SK5A 1HQMC 4QJFA 2ATWA 1O7YA 3HFZB 4DR6L 4B3RL 3IKJA 2RHSB 1Y1WB 2CWAA 3ONAB 1W3SA 1SDFA 3RUZA 3S24A 3C1EA 2FMMA 2RF4A 4LK1C 3A55A 1I6VC 4MNOA 2CW0C 3C1FA 1CUKA 4WFN3 2IHFA 2ICIA 2JQOA 1TS4A 3M4QA 1VQKA 3STBC 3CCEA 2R93G 2VL6A 2TMPA 2E2HB 4RCNA 1KLUD 3O13A 1F2MA 4RFBA 3ERQA 2NVYB 4JI2Q 4CDCC 4CKCA 2UXBL 2OQ0A 2HHHQ 5ELEA 1A2UA 5C44B 5FKAC 2R7ZH 1S5BD 1YHQA 1WTXA 2QGQA 1XTCD 1UE7A 5C3EB 1XXGA 5HURA 3S16B 1CQFA 2HD3A 2B8FA 2ES2A 1CKNA 2D9UA 4DR3Q 3I4NH 1VQAA 1S3OA 1CK1A 2QILA 1KDAA 4GN5A 2SOBA 2NZOA 4K2KA 3DM1A 1QNUA 2WINB 2JP1A 4C3HG 4WJ4A 1Q86C 3K0YA 3NHHA 4JVZA 1V1PB 3AFPA 3GTGH 1BKBA 3H91A 3MXUA 3RLNA 5M3MG 4IFDI 1VF7A 2VXWA 4OELB 1PTOH 5K36H 2F3IA 4MN3A 4GNXB 4DV3L 1PZID 2K5NA 1LT5D 2VS1A 1UE5A 4NXMQ 4Z9CB 4KD4A 1CHQD 3ZYYX 1AFPA 1TWAH 2IW3A 2BOSA 5HGTA 4TQUS 2SNMA 3J81L 1IBLQ 2AWOA 3EN2A 4A3GH 3CRKC 4LUVA 1KRSA 2WB1B 1NE3A 2F4IA 1HQRD 3KJPA 3JAMc 1PV4A 3EVQA 3D6CA 1X32A 4EQNA 4UP7A 1STYA 2RDFA 1TWHH 5CV9A 1RD9D 2IX3A 2Z4IA 1VQPA 2JA7H 1VQGA 2Z6KA 3FP9A 3LWEA 3PSIA 3S9WA 1N33Q 2E2IH 1L0WA 4YCVA 4QIWE 4KN4C 4A3KG 1WTQA 1YIJA 3NSWA 1I3QB 3V05A 4HAEA 3G71A 2LMCB 1SJED 1SNMA 1PFSA 2I46A 5C0XH 3GTJB 2AQ3B 2R7DA 3S1RB 1HZAA 2JEBI 1XMOL 3DWAA 4LAAA 3J7AV 2X6GA 1XPUA 4KHPQ 4R8IA 4POFA 3SGIA 2F03A 3GTKB 2LKVA 3BJUA 5IGBA 5LMNL 4DR7Q 2BE5D 3CMEA 2B29A 1BXTA 2AQ1B 1TWFB 2JYOA 1JC7A 4C3HB 1KHIA 3L3OC 1S4ZA 1V1OA 1G91A 4OHJA 1B1ZA 4NW2A 4Y7NH 1YNND 4HIKA 3LX0A 3R93A 4R9WA 3OTOL 2K04A 5JEAH 1Z6HA 1EYGA 2EYOA 1EY0A 1ENFA 2BA1A 1Y8PB 2KA7A 3Q23A 4HIDA 5BN5A 2K5WA 3RD4A 4JG2A 5CYUA 2BCOA 4MIUA 4A3BG 1E2WA 4DXFA 4CBVA 3OSOA 1QCBD 3H0GB 3HOXB 4UAIA 1STBA 4QUFA 2QCPX 2UUAQ 5M5XB 4HIMA 4BBRB 1WTVA 2OTJA 1WD1A 1R9TH 2F0QA 4DR2L 3TP5A 1Z47A 2H5XA 3BU2A 3KF8B 2PW7A 5FLXE 3TBIB 3KLSA 2QDLA 1NMFA 3I4NB 4YWLA 4C3JB 3S2DB 1OXXK 4ZKBB 1EY8A 4DV6L 5JJLA 5EKLA 1QB5D 4LF4Q 2EY2A 1EZ6A 2MFIA 4G7OC 4IUTA 4X6AH 3TEHB 5DNFA 2Q2HA 2N55A 4CDFC 4LF6Q 2N3SA 3RMHA 3ULJA 2XRSD 2QA4A 4DUYL 4OGQC 4KHPL 4A3FG 2YTVA 4C1NI 3CCRA 1D1IA 4AYBG 3S14H 1O80A 1N33L 2EYMA 3VYTA 3FVQA 1JJGA 2B2VA 2F4VQ 4XYQA 3PIO3 4JV5Q 3I90A 3I4MH 2PCFB 4I65A 1NBWA 1RODA 5CV6A 2F0PA 3E3XA 2BA0A 1L1OC 1W6KA 2DNEA 5ELDA 2IWHA 2JA5G 4FF3A 1GHKA 1NR4A 2F0HA 4DR4Q 4C2MH 4JC0A 1V43A 3FHWA 3C2PA 4EGVA 4PZ6A 4I7AA 5IYCG 1H95A 2EOTA 1VQ5A 5CBEE 3DM3A 5IE8A 3UI2A 5GAGC 1B50A 3DUZA 1KABA 5EPJA 1NTGA 2F0MA 3LWUA 1VCIA 1E0BA 1UE1A 2JA9A 5C4JH 1D1KA 3SXHA 1D5XC 1GHJA 1B4OA 2F1MA 2JA8B 4DK6C 3PUZA 5KYIA 1SMYC 4FP5D 2NYZD 4ZAIA 1RKNA 2V1CC 1DOLA 3K5LA 3BZKA 1V8QA 1GUOA 2XWBB 5DLQE 2L5TA 2XN9C 3MA2B 1AH9A 2PQAB 4OWXB 3SR1A 2B63G 5C0XI 2CH4W 1PRTB 4KKTA 3RZOB 1VQNA 5GQOA 1G6PA 2ZTCA 5C0XG 2K5DA 4I7ZC 3A8IE 2EYFA 1A6XA 1OO9B 1K3BC 4OONA 3GTJH 1BR9A 4AYBE 1EIGA 4KJOA 2N78A 1JWMD 3NBIA 4UDUC 1JJCB 1VQMA 1XNQQ 3NK9A 2Q8TA 2EJFC 4KY7A 2RSOA 1WTWA 3IL8A 4P72A 2B2YC 4JI1Q 1WCMB 2B8GA 1HR0Q 4APVA 2OTLA 4B3SL 2I5HA 4ODGA 3KUPA 3BDCA 1N36L 1CZWA 4IJHA 2ICEC 4J1MA 4X65Q 1QUQA 4ZK9B 3GTMB 4A3GG 2MP1A 2EYLA 5KNDA 1NR2A 4A3BH 3OYYA 1QVCA 5GROA 1Q12A 3ZJYC 2RKSA 3D4WA 4HJ5A 2IX1A 3DMUA
chains in the Genus database with same CATH topology
4CDFC 4CDDC 2DJGC 4OELB 4CDCC 2DJFC 4OEMB 1MHWC 1K3BC 4CDEC 1ICFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDF C;  4CDD C;  2DJG C;  4OEL B;  4CDC C;  2DJF C;  4OEM B;  1MHW C;  1K3B C;  4CDE C;  1ICF B; 
#chains in the Genus database with same CATH topology
 3W1G A;  2B2V C;  5BR8 Q;  2L11 A;  1OXU A;  2EDG A;  5IWA L;  2DGY A;  1LT6 D;  5IP9 G;  2GA4 B;  4BS9 A;  5E4W C;  3EQL C;  3M4Y A;  5D65 A;  4G7H C;  4DAY B;  1IXR A;  4R4I A;  1ICF B;  2YTX A;  3OPO A;  3S2H H;  1RCV D;  4YCU A;  2I0Q A;  4LF9 L;  4EX5 A;  1PH5 A;  5G3L F;  2K28 A;  3N52 A;  1STG A;  1VQD A;  4DR5 Q;  2WAQ E;  1Q81 C;  4LF8 Q;  1KXL A;  5I6W A;  2SDF A;  5D14 A;  5KRU A;  1FNW A;  2OWO A;  2K03 A;  1GO3 E;  4GS3 A;  1HNX Q;  4G7Z C;  1F77 A;  1HNW Q;  4IUP A;  1EWH A;  5A2Q L;  1TY2 A;  2MQH A;  1JB3 A;  2D0P A;  1PTO B;  4KK7 A;  4PQX A;  2CW0 D;  3ER0 A;  2E8G A;  1EEF D;  1SNO A;  1Z7T A;  3M9B A;  3I4N G;  3HG9 A;  4CJ2 C;  5EBD A;  1F2L A;  3H6M A;  1J9O A;  1GUT A;  1T5E A;  4XDX A;  1K8G A;  1PFM A;  2Q2I A;  1JCK B;  3CHB D;  1NUC A;  4C3H H;  1E24 A;  2F0O A;  1I4P A;  2K32 A;  2EJG C;  1B44 D;  2L0C A;  4DPG A;  5C4Z A;  2ZXP A;  3D31 A;  1ICW A;  3OWF A;  2JA7 G;  3G6J B;  4LF5 L;  1RDP D;  1HXY D;  1YNX A;  1QVG A;  1A63 A;  1X54 A;  3J80 c;  1II3 A;  1A3U A;  1PYS B;  1TVX A;  1SNQ A;  1QJO A;  2XSC A;  4A3D B;  1DCZ A;  4A3L H;  4C2M B;  1F9P A;  2DJG C;  3TZD A;  2XTI A;  1LUZ A;  1TWC H;  1STA A;  4C3I H;  4A3L G;  3H94 A;  3RR5 A;  1QZG A;  1LAC A;  3PQI A;  1SN8 A;  1E3P A;  3WOE A;  2ZJR A;  2MPM A;  2F0F A;  4GOP A;  1HR0 L;  3AFQ A;  1HNW L;  5J3B A;  1QZH A;  4G57 A;  1O7I A;  1HFG A;  4AQY L;  3VYU A;  3HGB A;  3U58 A;  3S17 H;  3L9A X;  1H9S A;  1VQI A;  1FNV A;  2KCT A;  2KEE A;  3SK8 A;  4WJ3 M;  4HMI A;  3D8G A;  4C3I B;  1LAB A;  2Y0S B;  1E2Z A;  3G48 A;  2K1B A;  4N8F A;  3LNN A;  1HZB A;  3AYH B;  4CDE C;  5M5W B;  1TII D;  2RDG A;  2JA6 H;  1A0I A;  1GD7 A;  5JJK A;  4JV5 L;  1GKH A;  2UU9 Q;  1LLR D;  4C56 C;  3S1M H;  4DV1 L;  3A0J A;  1RTN A;  3CRL C;  4HTH A;  2B63 H;  3QB3 A;  3EA6 A;  2F0N A;  4O0A A;  4A93 B;  1HTP A;  4KY5 A;  2NVT B;  4A3K B;  4UPA A;  3NBH A;  3MXP A;  5JPM C;  1CQV A;  4DR1 Q;  2EE1 A;  3D6W A;  3H09 A;  1BBX C;  4BBS B;  1K3R A;  2EY5 A;  4N8X 1;  3T56 B;  2EY1 A;  4GKJ Q;  4GKK Q;  2J4X A;  3OMC A;  1K83 B;  2NN6 H;  1WI5 A;  1YNJ D;  2KBN A;  2B2U C;  4U68 A;  3S1N B;  2O5J C;  1JMC A;  4B3M L;  3MVV A;  3SDZ A;  4B3T Q;  3PUY A;  2NWG A;  4K6L A;  5C3E G;  1S5E D;  4QCL A;  4PNY A;  4YY3 L;  2A5H A;  3RZD B;  1KIX A;  1MHW C;  1BCP C;  1JQY D;  1X55 A;  3I8Z A;  4RWS C;  2HDM A;  4DUZ Q;  1XNR L;  4JYA Q;  5JAV A;  3K5O A;  3KJO A;  3EFX D;  4P2C B;  1WTH A;  3PGZ A;  1A2T A;  3A54 A;  4V19 0;  3TRE A;  1FR3 A;  1YBY A;  3KK7 A;  3J7Y W;  4A3D G;  4A3J H;  5GAD C;  2UU9 L;  4ZQ3 A;  1VQ7 A;  2C5C A;  2ENB A;  2I5L X;  1U0L A;  3PO3 H;  3CXC A;  1GOZ A;  1KDC A;  4RKB A;  4GN3 B;  4AIM A;  3ITP A;  3H15 A;  4IN3 A;  2MNA A;  5IGC A;  4A3I G;  1CKN B;  1E1T A;  4ZKC B;  2A1A A;  2E74 C;  3I4M G;  2JJQ A;  1EY5 A;  1FL0 A;  4KY6 A;  3J80 i;  1SR3 A;  4FF1 A;  2K52 A;  4B3S Q;  2FFK B;  3UDG A;  2YYZ A;  2FMC A;  1JE5 A;  4CKE A;  5FLM G;  2Q2T A;  4KMU C;  2RVL A;  3K6O A;  5FJ8 G;  4QGU A;  1WVL A;  3ND9 A;  3S1M B;  2ZJQ A;  3OWE B;  4RCO A;  3A8J E;  2Z8L A;  4DV2 Q;  2VB2 X;  1STN A;  2NVQ B;  2NVT H;  1HTL D;  4R4Q A;  2ZXR A;  3QO2 A;  1C48 A;  4DK0 A;  3MAQ A;  3T1H Q;  4LNQ A;  4A3F B;  1PZJ D;  4YCW A;  1CZG A;  1IHZ A;  2OXP A;  4OL7 A;  2F3W A;  5IYC H;  4HSP A;  2B39 A;  5L37 A;  1KLG D;  2PZT A;  1I5F A;  1KNE A;  3MFY A;  4P73 A;  4XIG S;  3K58 A;  3T16 A;  4XQQ A;  3GTK H;  4A3J G;  3JAM E;  1I6H H;  2LXK A;  3HOU B;  3J81 E;  3PMF A;  1F9Q A;  2R7Z B;  4IJL A;  3KLW A;  3ERO A;  3PCO B;  4ALP A;  3D4R A;  1L0Y B;  5ELC A;  3RZO H;  1VQB A;  1X56 A;  3RNU A;  4H02 A;  3I56 A;  2XIW A;  4PG3 A;  1DGS A;  1Q46 A;  1NSN S;  3IFT A;  1RF2 D;  2OF1 A;  5EKI A;  5FJ8 H;  3R8B A;  5IGG A;  2K5Q A;  2K50 A;  1Y69 U;  1QE6 A;  5IYD H;  5HY6 A;  1G2T A;  5M5W H;  4ME5 A;  1HUN A;  1FYC A;  3FDT A;  1MBY A;  3QOJ A;  2DY7 A;  1EQV A;  3DWP A;  1A8V A;  1PRT F;  4DXG A;  3JC6 6;  1E7Z A;  2VW9 A;  1EIF A;  2RSN A;  2EXD A;  3KYH C;  2WAQ G;  4JI1 L;  2IL8 A;  3HRZ C;  3QWN A;  1Y8N B;  4GNX A;  1IW7 D;  5IYB G;  4ABN A;  5JVG 3;  1UNS A;  3J7Z C;  2IY5 B;  2HHH L;  5EKK A;  5KEE A;  2Q2U A;  2JA8 H;  4G4K A;  1KRT A;  1ILQ A;  4EQO A;  3HOY H;  3K7A H;  1PH1 A;  2G5D A;  4BA1 I;  3I4L A;  2CCZ A;  3Q8D A;  2F4V L;  1LTS D;  2KVM A;  4P74 A;  4O42 A;  2NZ1 D;  4DV6 Q;  1PFB A;  1M90 C;  1SFO B;  2AWN A;  1SYD A;  3CQZ H;  2F0S A;  4BY1 G;  1QIL A;  1FGB D;  3S14 B;  1CA6 A;  4A3G B;  4AH6 A;  2L55 A;  3HKZ G;  3A5Z B;  5EQ0 A;  3IFD A;  2VNU D;  1PH3 A;  3ERS X;  2I07 B;  1XX8 A;  1LTG D;  2E75 C;  1Q1E A;  4B9X A;  1SYC A;  2SNS A;  5LMN W;  2CHB D;  4HED A;  4ILW A;  2HIX A;  3EIV A;  3TP7 A;  4KHZ A;  2UXC L;  1DM0 B;  5FLX c;  1DON A;  2A73 B;  1XMQ L;  3BVZ A;  5C3X A;  5I9O A;  2N88 A;  2AKW B;  2O2L D;  2NTT A;  3TS2 A;  4DNT B;  3GTG B;  4QB4 A;  4MHE A;  5M5Y B;  4KV6 A;  2DY8 A;  4Q5V A;  3U4V A;  5K36 G;  1AE3 A;  2KCC A;  3K80 C;  4N9T A;  4KN7 C;  1SNP A;  2PO4 A;  3CU7 A;  4M1U B;  3T13 A;  2ZT9 C;  5CMD A;  1TY0 A;  4BXX H;  2NZH A;  1BCP F;  3GTL B;  2PI2 A;  1CHP D;  4EVO A;  3BDL A;  1MJC A;  2BH8 A;  3IAY A;  5IT9 c;  4CHT B;  3HOW B;  1HNZ Q;  1I94 Q;  3PF4 A;  1J8I A;  3GTO B;  2O5I C;  2CFM A;  4L63 B;  4FVM A;  4NXM L;  2R61 A;  4ULL A;  4ZLT F;  1VS0 A;  3MEH A;  3VA7 A;  3SK6 A;  5C6A A;  4GKK L;  3DLL A;  2PNH A;  2JN4 A;  2Q8R E;  4NMZ A;  5LMN Q;  1D5M C;  5LL6 X;  2X69 A;  4IUN A;  2M9V A;  4WRD A;  5NUC A;  4C3I G;  1O7L A;  3J80 E;  1VQ4 A;  3T1Y L;  1L1O B;  1U4L A;  5FK9 C;  3J80 L;  2XRQ D;  3W2D A;  4K8J A;  2OT2 A;  2FXQ A;  4CKB A;  2E2I B;  1I6H B;  4TKO B;  2ID0 A;  1EFW A;  2Z1C A;  2R93 H;  2L15 A;  1ZXT A;  3BG3 A;  1WJJ A;  1B9N A;  4DAV A;  1PHJ A;  1GUG A;  4XQJ A;  1V1P A;  5JVH 3;  1PTO D;  3PIP 3;  2NVX B;  2Y0S E;  3GO5 A;  1PTO F;  1IYU A;  4OWW B;  3A56 A;  4PZ7 A;  4UY8 C;  4FO2 A;  1PMR A;  1R4Q B;  3NEM A;  3VR6 A;  2QEJ C;  4GLX A;  1IL8 A;  1EEI D;  1VF5 C;  3S1N H;  3OIQ A;  1BNZ A;  1N32 Q;  2B2W A;  1X3F A;  2VB3 X;  3HOZ B;  1B3Q A;  1E22 A;  3HS0 C;  3I4O A;  3PV0 A;  2KHS A;  3F8T A;  4OIJ A;  5C0X J;  5J22 A;  3TQY A;  4JBK A;  2UUB L;  1PRT C;  3Q0A A;  1PH2 A;  3WDN A;  5EJW A;  4BXX G;  1J6Q A;  2AMC B;  3E6Z X;  1DJR D;  4DGZ A;  4NP5 A;  4HN7 A;  3I4M B;  4DUZ L;  3KBG A;  1IZ6 A;  4LF7 L;  1JJ2 A;  2Z6K C;  3F2B A;  3NP8 A;  3DEP A;  1IL2 A;  3GTQ H;  4MZ9 A;  4A75 A;  1NCV A;  2D2C C;  4OEM B;  1EU3 A;  4BY1 H;  1WYD A;  3HKS A;  5A35 A;  2YU9 H;  3KDF B;  2PMZ B;  4C1N K;  1K28 A;  1PH4 A;  4CJ0 B;  5IOC A;  3GTO H;  1HRJ A;  4PZ8 A;  1L2F A;  4A3B B;  3NE5 B;  2UXB Q;  1PXU A;  2KEC A;  1N32 L;  2GVA A;  3PUX A;  4JI5 Q;  4RGM A;  1BQQ T;  1PH7 A;  1HA6 A;  4A3C G;  1BOS A;  1IBL L;  2L9H A;  5C44 G;  1B53 A;  1K83 H;  2A6H D;  2WAQ B;  4OO1 I;  4N9P A;  4DV5 Q;  1L0X B;  1UEA B;  2A6E D;  4J6H A;  1TKW B;  4C3J G;  1EOT A;  2NVY H;  2NN6 I;  1TWF H;  4X3T A;  1MSG A;  1M8A A;  2E2H H;  2UUC L;  1JOO A;  3M4O B;  1ML0 D;  4R8N A;  2VUM G;  4FXG C;  3S1Q B;  4DK3 C;  1ESF A;  4A3E G;  4QL5 A;  3CC2 A;  1XPO A;  4RGO S;  2PQA A;  1KD1 C;  5IYB H;  1TS2 A;  4BBR G;  1CFM A;  2VUM B;  1KTK A;  1HJP A;  1BCP D;  3F1Z A;  5IYD G;  1ZYR D;  2VZA A;  5IP7 H;  3BS1 A;  5DM7 3;  1LTL A;  1SRU A;  1ONL A;  1Y8O B;  1VQF A;  1Q8I A;  4K6D A;  1HZ9 A;  2WKD A;  4IUV A;  4XT1 B;  4IUQ A;  2RCF A;  3TRZ A;  3NBH B;  2BH2 A;  2F0G A;  5ELF A;  3NWS A;  2EYP A;  4JI3 Q;  3E0J A;  4A3I H;  5K5P A;  5M3F G;  5G3L D;  3T53 B;  2DJF C;  2JK8 A;  5IWA Q;  3I91 A;  1TT2 A;  1YEZ A;  3CCS A;  1Y1V B;  2A6E C;  4WOR A;  4B9W A;  1XPR A;  3T51 B;  2EIF A;  3HOV H;  4AYB B;  1C9O A;  1SRO A;  1E2V A;  1N36 Q;  4NXN L;  1WTR A;  2LY7 A;  4LFC Q;  3I3C A;  4HCE A;  1KAW A;  1W6J A;  1BDO A;  3DXJ C;  4HJ8 A;  1AZQ A;  2NB0 A;  2KQ3 A;  5T1G A;  2K75 A;  2A69 D;  2UUC Q;  4O2D A;  1SYG A;  2CQA A;  2LS0 1;  2KHJ A;  3E9I A;  2KCM A;  3F2U A;  4DV4 Q;  2MJ8 A;  3Q22 A;  3CF5 A;  4GOP B;  3X3M A;  4GOP C;  1EIY B;  5I9P A;  1SE4 A;  4PV1 C;  4RGN A;  5D3I B;  1VQL A;  1G29 1;  2IJ0 A;  3PF5 A;  1RL2 A;  1BCP B;  3CMA A;  3A7A B;  4JBM A;  4K8I A;  4LMQ D;  3CP0 A;  1QG7 A;  1PH8 A;  4CDD C;  4L5R C;  3HOW G;  3P75 A;  1TR5 A;  4V0B A;  2V4D A;  1L1O A;  3CAM A;  3DHQ A;  1WCM H;  1G51 A;  2WAC A;  1ENC A;  1P8L A;  2KHI A;  3CQZ B;  2G9H D;  4XTC S;  2B2W C;  1LYL A;  4K5W A;  1JWU D;  1EYC A;  4DV7 L;  1IW7 C;  2F0T A;  1BBW A;  2Q8I B;  1UAP A;  2ZXO A;  3VDY A;  1EWI A;  2X6L A;  2K33 A;  1RHP A;  2FJ2 A;  2K01 A;  4JI2 L;  3CPW A;  3S15 B;  1U4P A;  3DWQ A;  3CW2 C;  4X62 L;  3I7F A;  2PZW A;  1I4H A;  1B8A A;  1AP0 A;  1I4R A;  3UDF A;  3VYS A;  4XXE A;  1Y14 B;  2C9O A;  2K4K A;  2MO0 A;  3LGJ A;  2L12 A;  5LMU L;  3DEO A;  2YU9 B;  3OMG A;  2G9D A;  1D7Q A;  1T9H A;  2GN5 A;  2ZM6 Q;  3GTQ B;  1IKL A;  2UUA L;  2F52 A;  1LTB D;  3QG1 A;  4Y7N B;  1I94 L;  5M3M B;  4YWK A;  3U9O A;  1CSP A;  4JOI C;  4BY1 B;  2NN6 G;  1VQ6 A;  1JOQ A;  5IIF A;  1EY6 A;  1PYB A;  3GTP H;  5J39 A;  2K14 A;  2DNC A;  2EYH A;  3CCJ A;  2UUB Q;  1F2Y A;  1H9J A;  1ENA A;  1X9N A;  2J0T D;  3B6Y A;  4H44 C;  4J8Q A;  5E7N A;  1FGU A;  3GD7 A;  3TN2 A;  2ASB A;  1IKM A;  2KED A;  1U4R A;  1H9K A;  1VQJ A;  2B2Y A;  3RLF A;  4FYD A;  2JA6 B;  4KKU A;  4X3U A;  1KC8 C;  1PLF A;  4R4O A;  1C8C A;  4DV3 Q;  1M1K C;  1MGS A;  1M4V A;  3QJY A;  5CGK A;  3FKI H;  2JA6 G;  4A3M G;  4JW0 A;  5I2X A;  5IT9 E;  4OO1 H;  5BN4 A;  1Y1W H;  3NUC A;  1GVP A;  3MXN A;  4IOA A;  2A68 D;  5KIX A;  4EQP A;  5C4X G;  5HGQ A;  1CM9 A;  1VDZ A;  2EZV A;  4U67 3;  1NMG A;  1PVO A;  4IPC A;  2EQS A;  3MWY W;  2R7F A;  3V2T A;  5IY0 A;  2A74 C;  3TS0 A;  3M7G A;  4HJ9 A;  1XNR Q;  1TWG H;  3F2C A;  1PYW D;  4NKL A;  3C46 A;  1U4M A;  5CV7 A;  1XNQ L;  3I70 A;  5FOB B;  2ZJP A;  4DAM A;  2FIN B;  2WKC A;  3A74 A;  4YIJ A;  3OHX C;  3RN5 A;  2UXD L;  3CCV A;  2EYJ A;  3KLR A;  4E6I A;  1V9P A;  3RN2 A;  3I55 A;  2F3V A;  4RGT A;  1MD2 D;  3S17 B;  1LTA D;  5EGT A;  5EBC A;  1Q1B A;  4A93 G;  5KYL A;  4BY7 B;  2RA4 A;  1WOC A;  4IFD G;  2D5D A;  3J81 i;  1LTI D;  2HQL A;  3HP3 A;  1JT8 A;  2RHQ B;  2VQE Q;  4FDB A;  1K9M C;  4JYA L;  4NDX A;  4LWC A;  1QOH A;  3HOU G;  1WD0 A;  4QIW B;  4DV0 L;  1GUW A;  2KEN A;  5AJ3 Q;  5DEH A;  5M3M H;  4X64 L;  1B70 B;  1N9W A;  4B3T L;  3MXG A;  3KFU A;  1S72 A;  1TS5 A;  3GTP B;  3RLO A;  4BY7 H;  2R6G A;  3G6E A;  1ZKO A;  3NPP A;  4GNX C;  4DR6 Q;  2I5M X;  2HIV A;  3S2D H;  2ZTE A;  1FJG L;  1EOV A;  4F7X A;  5C4X H;  1Q8K A;  1B7Y B;  4RA8 A;  2WB1 E;  3NXW A;  4UP9 A;  1Y1W G;  1TWC B;  1B2T A;  2WII B;  2XGT A;  4UP8 A;  5FLX L;  1EIH A;  1Q7Y C;  4ID6 A;  4YWM A;  3SK4 A;  1DOK A;  4A76 A;  4NXN Q;  2YV5 A;  1BUV T;  1HNZ L;  3MTS A;  5M5Y H;  1EQQ A;  3S15 H;  2E2J H;  3WWV A;  4ZUJ A;  4O1N A;  4JI4 Q;  1EY7 A;  2A6H C;  3HOV B;  4YHH L;  2XWJ B;  2K5H A;  3UDI A;  3L2P A;  3G7L A;  3PO3 B;  3QR8 A;  2R7Z G;  1UE6 A;  5CV8 A;  4RMF A;  1YJ9 A;  2NTS A;  5COY A;  3BYY B;  4IFD H;  4GZY C;  3UE0 A;  4A3M B;  1SXT A;  4OIK A;  1HH2 P;  1EYD A;  2OQK A;  2KUM A;  5COR A;  1SJH D;  3Q6S A;  5T1I A;  1J5E L;  4DN4 M;  1CI3 M;  1DXM A;  1SNC A;  2F0W A;  4DFA A;  4FNF A;  4KI0 A;  3OOC A;  2PNR C;  3MC0 B;  1SEB D;  3U9S A;  1I50 B;  2DUD A;  3VR2 A;  4GLV B;  5ELB A;  4LFB Q;  5IGF A;  1PZK D;  2NBF A;  2RDH A;  3S2H B;  1VQH A;  4A4I A;  1YI2 A;  1S5D D;  1FNU A;  2B2U A;  3RZD H;  3D4D A;  4K14 A;  2JA8 G;  1NJI C;  4K0K L;  5H1S E;  4LFC L;  3T4A C;  2WP8 J;  3T1Y Q;  1P16 A;  1LT4 D;  1Y1V H;  5KNB A;  1QVF A;  1O7Z A;  1XWE A;  5E3F A;  4YHH Q;  5IGD A;  1KNA A;  3VR3 A;  3H3V H;  3W5O A;  1WCM G;  1XJV A;  4JBW A;  3PO2 H;  4OO1 G;  3KLS X;  3K0X A;  3W3A A;  3FKI G;  1AEX A;  5M5X H;  3HOZ H;  1Z9F A;  1D5Z C;  4DR3 L;  1VMP A;  1E1O A;  4JOI A;  4QF4 A;  1PFN A;  3TME A;  1JE4 A;  5IOD A;  1S5F D;  4QUC A;  4X66 L;  5M3F B;  1MSH A;  1S40 A;  2WB1 G;  4HIO A;  1FJG Q;  4X62 Q;  2CKZ B;  4LF7 Q;  4DV4 L;  3S1Q H;  1SAP A;  3UDX A;  1B9M A;  1SMX A;  2UXC Q;  4NB3 A;  2XNA C;  1EU4 A;  1OXS C;  5EAY A;  3QOL A;  4J15 A;  4B3M Q;  2ZTD A;  1EWC A;  1TS3 A;  3C3L A;  4IOC A;  4X3S A;  3KF8 A;  3HOV G;  1TWA B;  5I2Y A;  5CV4 A;  1SYB A;  1T5X D;  1TU2 B;  3P20 A;  4BBS G;  4H0L C;  4JI4 L;  1RJT A;  3OTO Q;  2BDO A;  5M3F H;  4A3F H;  2DN8 A;  4RG1 A;  1G2S A;  2JA5 H;  3BVG A;  3OW2 A;  2KJX A;  1NY4 A;  1A3T A;  4DV1 Q;  1SYE A;  2NVQ H;  2VY3 A;  1F9S A;  5C5L A;  1HCZ A;  2ZM6 L;  3U50 C;  1SMY D;  1LTT D;  1RTO A;  1R4P B;  3CC7 A;  1AE2 A;  4OX9 Q;  5C5M A;  1VQ9 A;  4X66 Q;  2ALY B;  4DR1 L;  3AQQ A;  4L5Q A;  5ELO A;  1AW7 A;  2Z9H A;  5FLM H;  1ZYR C;  1YHA A;  1K0R A;  1Y1V G;  3ULP A;  4BBR H;  2BDN A;  3HOZ G;  3FPU B;  4A3E H;  4JK1 C;  1VMC A;  2MO1 A;  1A15 A;  1SE3 A;  3PO2 G;  1MJE A;  1HNX L;  1LM0 A;  3BYT B;  2H4O A;  4BWG B;  1OXT A;  4GN4 B;  3U4Z A;  4DAP A;  1CKM A;  1H9R A;  1EUJ A;  1BF4 A;  3K7U C;  1HFN A;  3K8A A;  2IPK D;  4DU9 A;  1LV9 A;  1WFQ A;  5LHY 1;  2WV6 D;  3EBE A;  3UE1 A;  4KHV A;  3I2Z A;  3TP6 A;  1UUP A;  4DR2 Q;  4EQ5 A;  2VUM H;  3H3V I;  4LFA L;  1IBM L;  5CR3 A;  2AUJ D;  3CD6 A;  5J1Z A;  1SYF A;  4HJA A;  1JIC A;  3T1H L;  1YHB A;  4A3E B;  1CKO A;  4DR7 L;  4DA2 A;  2A69 C;  4IUU A;  5AFW A;  5CV5 A;  3D0F A;  4L5T A;  4IO9 A;  2PQE A;  1EY9 A;  2QDB A;  1ASZ A;  1HHV A;  4OX9 L;  5E4X A;  4NPS A;  4DUY Q;  4DAY A;  2K05 A;  4L6T B;  1EQR A;  1X65 A;  1YJW A;  2CWP A;  2A19 A;  2K6A A;  1PTO C;  4Q0F A;  1PA6 A;  1XTD A;  1ET9 A;  5E1F A;  4FF4 A;  2YTY A;  1OTC A;  4LF5 Q;  4X64 Q;  1OXV A;  1TQO A;  4OWT B;  1JB7 A;  2LXJ A;  1QUQ B;  4RKL A;  5JOB A;  1BO0 A;  1I4G A;  3FMC A;  3NTK A;  3NWT A;  4A3K H;  1YZ6 A;  5IP7 G;  1EFI D;  2VQE L;  3M3Y H;  1X6O A;  3NQI A;  2B63 B;  2VQF Q;  4POG A;  3STB D;  1JWS D;  2F0J A;  1ILP A;  3PUW A;  3FRP B;  3M85 A;  3GQB A;  4WJW A;  4MTN A;  3A8K E;  1KAA A;  1U5K A;  2HCC A;  4K5X A;  4LF4 L;  1IYV A;  4P75 A;  1U9R A;  1Q3L A;  3EJI A;  2N8N A;  2E76 C;  3E0E A;  2K5V A;  2K7V A;  2EY6 A;  2QKI C;  4DR4 L;  5GAE C;  2J7Z A;  3HZX A;  1H9M A;  4F88 A;  3SHL A;  3CKI B;  3PUV A;  4BY7 G;  2P5Z X;  1HUM A;  3BVM A;  2NVX H;  4FF2 A;  1ZEQ X;  2R92 H;  3NEN A;  1LTR D;  4DKA C;  2AQ2 B;  3NTH A;  3MHB A;  3JAM i;  2JA7 B;  1CSQ A;  4XT3 B;  3H0G G;  3HOX G;  3M3Y B;  3HOU H;  4JI8 L;  4B3R Q;  4S3S A;  3K59 A;  3GTL H;  2WFW A;  2JE6 I;  3P7J A;  5KGU A;  2IX0 A;  5TSS A;  1WTP A;  2SEB D;  3TDQ A;  4OXP A;  3G4S A;  1AN8 A;  1KQS A;  4KD3 A;  5C3W A;  1EZ8 A;  3AB9 A;  2M2L A;  3MFG A;  3R3O A;  4JBJ A;  4LUZ A;  2RCN A;  2OEO A;  1FD7 D;  5LL6 S;  2R92 G;  4R1J A;  3URY A;  3S1R H;  4F87 A;  2EJM A;  3FPP A;  3CC4 A;  2R92 B;  1CTM A;  3NQT A;  1DZ1 A;  2CQO A;  4ZUI A;  2RQX A;  2F0K A;  5JJI A;  2F0L A;  4H7B A;  1CA5 A;  3R2I A;  2HUG A;  3I72 A;  2OCE A;  4RHS A;  5I6Y A;  1C4Q A;  2B3G A;  3E5S A;  4M8A A;  1BVS A;  1LO5 D;  1SE2 A;  2A68 C;  2FHT A;  1EQT A;  2XVS A;  4FXK C;  4A3M H;  1VQO A;  4QQB X;  1GUS A;  4X3K A;  2TSS A;  1AZP A;  4ZYS A;  3AU7 A;  2AHO B;  3KOJ A;  2MHV A;  3D3R A;  5IT9 L;  2HT1 A;  4XYO A;  1QNK A;  4TRD A;  5IGE A;  1K73 C;  3HKZ E;  1V1Q A;  2E5L Q;  1GUN A;  1IYJ B;  1I50 H;  2LFN A;  3MEF A;  3NTI A;  3SVM A;  3KF6 A;  4F8M A;  1J5E Q;  3AEV A;  3S16 H;  3M7N A;  3HKZ B;  2PPB C;  3KDF A;  1X3P A;  3KF6 B;  5C4X B;  3H0G H;  2L4N A;  3HOX H;  2D62 A;  3R2T A;  3J81 c;  4MTK A;  1Q90 A;  3IRB A;  4A93 H;  1FVI A;  5M9O A;  1W2B A;  4LFB L;  2GVB A;  4ME3 A;  5IP9 H;  4P71 A;  2HQE A;  1GJX A;  1S5C D;  4H13 C;  5BN3 A;  4KKS A;  4RAU C;  5JEA J;  2F0D A;  1R9T B;  1SE8 A;  1I4X A;  1PH6 A;  2Y0S G;  4IZ8 A;  1KDB A;  2EXZ A;  2KCN A;  3GTM H;  1UEB A;  1VQE A;  1XYI A;  3F2D A;  1N8R C;  3K57 A;  4IPG A;  4TVA B;  4DV2 L;  3GV6 A;  5KNC A;  3M4P A;  1D2B A;  3FEW X;  1I4Q A;  3MXN B;  3N6R A;  5BR8 L;  1LT3 D;  5I4D A;  3A7L A;  1ESR A;  2KOL A;  4PMB A;  1MKH A;  3SEB A;  4JI7 Q;  4LUO A;  1A62 A;  2B2T A;  3L0O A;  2E5L L;  3CCL A;  1C0A A;  3QIA A;  3FKI B;  2D0O A;  1HZC A;  3ULL A;  1F2Z A;  4LF9 Q;  2LSS A;  1JR0 D;  4JI3 L;  3OIP A;  3A5U A;  3CCQ A;  3HOY G;  3J7A F;  2JSO A;  4JI6 Q;  1SSO A;  3CCU A;  4A3J B;  3HOY B;  1BBU A;  3HOW H;  2F0U A;  3PIO A;  4KTA A;  1KL9 A;  1MI2 A;  5F2D A;  4LW1 A;  1GM5 A;  1VQ8 A;  1YIT A;  1I3Q H;  2AUK A;  4AQY Q;  1XMO Q;  4DNR B;  1DOM A;  1D8L A;  3ICE A;  4HSV A;  4LJZ C;  3L7Z C;  2L1B A;  4IQZ A;  2F0V A;  4L5S A;  1JOK A;  5C4J B;  4GKJ L;  2NUC A;  2PYK A;  5C4H A;  1YJN A;  4LFA Q;  2JEA I;  1C7Y A;  2IHE A;  4HMJ A;  1STH A;  4DK1 A;  5LMU Q;  3PO2 B;  4BBS H;  2Z0S A;  4HR7 B;  2QW7 A;  1IBK L;  2F0I A;  4JI7 L;  2B2T C;  4FXD A;  1H9S B;  4YY3 Q;  5DAU A;  4IPD A;  4IFD J;  3NEL A;  3MZ5 A;  3E9H A;  3BZC A;  3K81 C;  4JI5 L;  5JPN C;  1EL0 A;  2PW5 A;  4HJ7 A;  4A3I B;  3SE0 A;  4JI6 L;  2R93 B;  1X3Q A;  1YNJ C;  3W1B A;  2EPB A;  4ZCK A;  5JJZ A;  4JCV E;  2PZU A;  2HCI A;  3VA5 A;  3BZD B;  2CVR A;  4CGY B;  5ISR A;  4DV5 L;  4K5V A;  3CPF A;  1VQC A;  5EPL A;  4DV7 Q;  1CT1 D;  1TWH B;  1YVC A;  2O4X A;  1TXY A;  4B08 A;  4GLA C;  4R4C A;  2Z6B A;  4X65 L;  2F0E A;  1F9R A;  4QMG A;  1SND A;  3GV3 A;  5A2Q E;  1X3E A;  3K7A B;  4KJN A;  3TZU A;  1QWY A;  2A8V A;  2PMZ E;  1WTO A;  4CJ1 B;  4Y52 H;  3Q24 A;  1MIU A;  2VQF L;  1JOR A;  4PMC A;  4HCS A;  4TSS A;  4C3J H;  1IBM Q;  2C35 B;  3K5M A;  1X3G A;  4DNI A;  2M00 A;  1DD2 A;  2JA5 B;  1SLJ A;  4L8J A;  1N34 L;  1A3V A;  1G8Z D;  1K0S A;  2PI2 E;  2RBM A;  1PH9 A;  4K0K Q;  4R4T A;  3X3N A;  3AMU A;  3P1H A;  3PO3 G;  4A3D H;  1K8O A;  3KBX A;  3ND8 A;  1SBB B;  4JI0 Q;  3OW7 A;  2H1E A;  3WOF A;  3I73 A;  3J81 j;  2BE5 C;  3K5N A;  4DR5 L;  5DM6 3;  4K2L A;  5AJ3 L;  3BDO A;  3TSS A;  2Z4H A;  5C44 H;  2HDL A;  1IBK Q;  3J7A 5;  1G6Z A;  5EPK A;  5JEA G;  4UHV A;  4A3C H;  1RIP A;  3H3V C;  5C3E H;  1K8A C;  4IUR A;  5FO9 B;  1XMQ Q;  2QF7 A;  1DYQ A;  5FO8 B;  2QEX A;  3GP7 A;  2EVB A;  1EY4 A;  4JPB W;  4DF7 A;  1ET6 A;  1STE A;  4KLK A;  5CC4 A;  1HA5 A;  2IT1 A;  5ELN A;  2MUY A;  1NAP A;  3GDE A;  1Q82 C;  1PDQ A;  1HPC A;  2R3Z A;  4RHR A;  4RH6 A;  5D3D A;  1D6E C;  1SFO H;  4XQN A;  1EYA A;  2UXD Q;  4LF8 L;  3PIP A;  4IAL A;  1K8M A;  3TP8 A;  5FO7 B;  4JI8 Q;  1TWG B;  4ZRZ A;  1YNN C;  4QY7 A;  3V96 A;  3M4O H;  2E2J B;  2MGS A;  1UWV A;  4LF6 L;  4BA2 I;  1PRT D;  1ASY A;  3VR4 A;  4IPH A;  4JI0 L;  5CBA E;  4PMW A;  4DV0 Q;  2N49 A;  3VYR A;  3CCM A;  1NNX A;  2E2D C;  3JAM L;  3HEJ A;  5GAH C;  1O78 A;  2JXM B;  1N34 Q;  3VR5 A;  1B3A A;  1GXD C;  2CH4 A;  1HR0 W;  3SK5 A;  1HQM C;  4QJF A;  2ATW A;  1O7Y A;  3HFZ B;  4DR6 L;  4B3R L;  3IKJ A;  2RHS B;  1Y1W B;  2CWA A;  3ONA B;  1W3S A;  1SDF A;  3RUZ A;  3S24 A;  3C1E A;  2FMM A;  2RF4 A;  4LK1 C;  3A55 A;  1I6V C;  4MNO A;  2CW0 C;  3C1F A;  1CUK A;  4WFN 3;  2IHF A;  2ICI A;  2JQO A;  1TS4 A;  3M4Q A;  1VQK A;  3STB C;  3CCE A;  2R93 G;  2VL6 A;  2TMP A;  2E2H B;  4RCN A;  1KLU D;  3O13 A;  1F2M A;  4RFB A;  3ERQ A;  2NVY B;  4JI2 Q;  4CDC C;  4CKC A;  2UXB L;  2OQ0 A;  2HHH Q;  5ELE A;  1A2U A;  5C44 B;  5FKA C;  2R7Z H;  1S5B D;  1YHQ A;  1WTX A;  2QGQ A;  1XTC D;  1UE7 A;  5C3E B;  1XXG A;  5HUR A;  3S16 B;  1CQF A;  2HD3 A;  2B8F A;  2ES2 A;  1CKN A;  2D9U A;  4DR3 Q;  3I4N H;  1VQA A;  1S3O A;  1CK1 A;  2QIL A;  1KDA A;  4GN5 A;  2SOB A;  2NZO A;  4K2K A;  3DM1 A;  1QNU A;  2WIN B;  2JP1 A;  4C3H G;  4WJ4 A;  1Q86 C;  3K0Y A;  3NHH A;  4JVZ A;  1V1P B;  3AFP A;  3GTG H;  1BKB A;  3H91 A;  3MXU A;  3RLN A;  5M3M G;  4IFD I;  1VF7 A;  2VXW A;  4OEL B;  1PTO H;  5K36 H;  2F3I A;  4MN3 A;  4GNX B;  4DV3 L;  1PZI D;  2K5N A;  1LT5 D;  2VS1 A;  1UE5 A;  4NXM Q;  4Z9C B;  4KD4 A;  1CHQ D;  3ZYY X;  1AFP A;  1TWA H;  2IW3 A;  2BOS A;  5HGT A;  4TQU S;  2SNM A;  3J81 L;  1IBL Q;  2AWO A;  3EN2 A;  4A3G H;  3CRK C;  4LUV A;  1KRS A;  2WB1 B;  1NE3 A;  2F4I A;  1HQR D;  3KJP A;  3JAM c;  1PV4 A;  3EVQ A;  3D6C A;  1X32 A;  4EQN A;  4UP7 A;  1STY A;  2RDF A;  1TWH H;  5CV9 A;  1RD9 D;  2IX3 A;  2Z4I A;  1VQP A;  2JA7 H;  1VQG A;  2Z6K A;  3FP9 A;  3LWE A;  3PSI A;  3S9W A;  1N33 Q;  2E2I H;  1L0W A;  4YCV A;  4QIW E;  4KN4 C;  4A3K G;  1WTQ A;  1YIJ A;  3NSW A;  1I3Q B;  3V05 A;  4HAE A;  3G71 A;  2LMC B;  1SJE D;  1SNM A;  1PFS A;  2I46 A;  5C0X H;  3GTJ B;  2AQ3 B;  2R7D A;  3S1R B;  1HZA A;  2JEB I;  1XMO L;  3DWA A;  4LAA A;  3J7A V;  2X6G A;  1XPU A;  4KHP Q;  4R8I A;  4POF A;  3SGI A;  2F03 A;  3GTK B;  2LKV A;  3BJU A;  5IGB A;  5LMN L;  4DR7 Q;  2BE5 D;  3CME A;  2B29 A;  1BXT A;  2AQ1 B;  1TWF B;  2JYO A;  1JC7 A;  4C3H B;  1KHI A;  3L3O C;  1S4Z A;  1V1O A;  1G91 A;  4OHJ A;  1B1Z A;  4NW2 A;  4Y7N H;  1YNN D;  4HIK A;  3LX0 A;  3R93 A;  4R9W A;  3OTO L;  2K04 A;  5JEA H;  1Z6H A;  1EYG A;  2EYO A;  1EY0 A;  1ENF A;  2BA1 A;  1Y8P B;  2KA7 A;  3Q23 A;  4HID A;  5BN5 A;  2K5W A;  3RD4 A;  4JG2 A;  5CYU A;  2BCO A;  4MIU A;  4A3B G;  1E2W A;  4DXF A;  4CBV A;  3OSO A;  1QCB D;  3H0G B;  3HOX B;  4UAI A;  1STB A;  4QUF A;  2QCP X;  2UUA Q;  5M5X B;  4HIM A;  4BBR B;  1WTV A;  2OTJ A;  1WD1 A;  1R9T H;  2F0Q A;  4DR2 L;  3TP5 A;  1Z47 A;  2H5X A;  3BU2 A;  3KF8 B;  2PW7 A;  5FLX E;  3TBI B;  3KLS A;  2QDL A;  1NMF A;  3I4N B;  4YWL A;  4C3J B;  3S2D B;  1OXX K;  4ZKB B;  1EY8 A;  4DV6 L;  5JJL A;  5EKL A;  1QB5 D;  4LF4 Q;  2EY2 A;  1EZ6 A;  2MFI A;  4G7O C;  4IUT A;  4X6A H;  3TEH B;  5DNF A;  2Q2H A;  2N55 A;  4CDF C;  4LF6 Q;  2N3S A;  3RMH A;  3ULJ A;  2XRS D;  2QA4 A;  4DUY L;  4OGQ C;  4KHP L;  4A3F G;  2YTV A;  4C1N I;  3CCR A;  1D1I A;  4AYB G;  3S14 H;  1O80 A;  1N33 L;  2EYM A;  3VYT A;  3FVQ A;  1JJG A;  2B2V A;  2F4V Q;  4XYQ A;  3PIO 3;  4JV5 Q;  3I90 A;  3I4M H;  2PCF B;  4I65 A;  1NBW A;  1ROD A;  5CV6 A;  2F0P A;  3E3X A;  2BA0 A;  1L1O C;  1W6K A;  2DNE A;  5ELD A;  2IWH A;  2JA5 G;  4FF3 A;  1GHK A;  1NR4 A;  2F0H A;  4DR4 Q;  4C2M H;  4JC0 A;  1V43 A;  3FHW A;  3C2P A;  4EGV A;  4PZ6 A;  4I7A A;  5IYC G;  1H95 A;  2EOT A;  1VQ5 A;  5CBE E;  3DM3 A;  5IE8 A;  3UI2 A;  5GAG C;  1B50 A;  3DUZ A;  1KAB A;  5EPJ A;  1NTG A;  2F0M A;  3LWU A;  1VCI A;  1E0B A;  1UE1 A;  2JA9 A;  5C4J H;  1D1K A;  3SXH A;  1D5X C;  1GHJ A;  1B4O A;  2F1M A;  2JA8 B;  4DK6 C;  3PUZ A;  5KYI A;  1SMY C;  4FP5 D;  2NYZ D;  4ZAI A;  1RKN A;  2V1C C;  1DOL A;  3K5L A;  3BZK A;  1V8Q A;  1GUO A;  2XWB B;  5DLQ E;  2L5T A;  2XN9 C;  3MA2 B;  1AH9 A;  2PQA B;  4OWX B;  3SR1 A;  2B63 G;  5C0X I;  2CH4 W;  1PRT B;  4KKT A;  3RZO B;  1VQN A;  5GQO A;  1G6P A;  2ZTC A;  5C0X G;  2K5D A;  4I7Z C;  3A8I E;  2EYF A;  1A6X A;  1OO9 B;  1K3B C;  4OON A;  3GTJ H;  1BR9 A;  4AYB E;  1EIG A;  4KJO A;  2N78 A;  1JWM D;  3NBI A;  4UDU C;  1JJC B;  1VQM A;  1XNQ Q;  3NK9 A;  2Q8T A;  2EJF C;  4KY7 A;  2RSO A;  1WTW A;  3IL8 A;  4P72 A;  2B2Y C;  4JI1 Q;  1WCM B;  2B8G A;  1HR0 Q;  4APV A;  2OTL A;  4B3S L;  2I5H A;  4ODG A;  3KUP A;  3BDC A;  1N36 L;  1CZW A;  4IJH A;  2ICE C;  4J1M A;  4X65 Q;  1QUQ A;  4ZK9 B;  3GTM B;  4A3G G;  2MP1 A;  2EYL A;  5KND A;  1NR2 A;  4A3B H;  3OYY A;  1QVC A;  5GRO A;  1Q12 A;  3ZJY C;  2RKS A;  3D4W A;  4HJ5 A;  2IX1 A;  3DMU A; 
#chains in the Genus database with same CATH homology
 4CDF C;  4CDD C;  2DJG C;  4OEL B;  4CDC C;  2DJF C;  4OEM B;  1MHW C;  1K3B C;  4CDE C;  1ICF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...