3ULPA

Plasmodium falciparum ssb complex with ssdna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
118
structure length
114
Chain Sequence
b'MNEKSLNKIMLIGRVGCEPDIKILNGGDKVATFSLATNEFWRDRNTNELKSKTDWHRIVVYDQNIVDLIDKYLRKGRRVYVQGSLHTRKWHTSQPKQITEIILSYNKGDLIFLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-strand binding protein
publication title Plasmodium falciparum SSB Tetramer Wraps Single-Stranded DNA with Similar Topology but Opposite Polarity to E. coli SSB.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Dna binding protein/dna
total genus 19
structure length 114
sequence length 118
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ulpA00
1C0AA 1VQ9A 4YHHQ 4Y52H 2KHJA 2MQHA 4TVAB 3G6EA 2GN5A 5FJ8H 4X66L 4QGUA 4A3LG 3HFZB 4JI6Q 1J5EL 2D0PA 4JCVE 5IYDG 4GNXC 4JI5Q 5IYBH 1A63A 3H0GH 4IFDI 4UP8A 1UWVA 4GOPC 1TWFH 4DUZL 2LXKA 2F4VL 2AMCB 5GAEC 4JBJA 4A76A 4JI3Q 1I3QH 3J80c 4DV6Q 1KC8C 1L1OB 1YEZA 3ZJYC 1WI5A 3HOZG 4IOAA 4APVA 4IJLA 2JA5H 4RG1A 4LF6L 1XNQL 1HZCA 5GQOA 5C44G 4GLVB 1BVSA 2RHSB 2ZTEA 3F2DA 4HIOA 1Q8KA 2E5LQ 1VQDA 5GADC 4DR2Q 3GDEA 3S15H 4DR5L 4DV1Q 3AFPA 2B3GA 1EQQA 1QUQA 4GLXA 5LMNL 1IBKQ 4B3ML 4JI4Q 4BY1H 1N32Q 2NVYH 1EIYB 3T1YQ 3GTLH 4YCUA 2H5XA 4LF4Q 3U4VA 4OX9Q 2ATWA 4A3EH 4X64L 2K5HA 3K8AA 1PA6A 1HNXL 1L0WA 2Q2UA 3HOWH 4DAYB 1QVGA 4OO1I 2JE6I 3SGIA 2E2JH 4GN5A 3CCLA 1X3EA 4YY3L 5AJ3Q 4IPCA 2B63H 5C3EG 3PO3H 1AH9A 1P16A 4WJ4A 1N33Q 1NTGA 1WCMH 2D0OA 3RR5A 5FJ8G 1L1OC 4A3KH 5ELNA 1VCIA 3F2CA 1XPRA 1LM0A 4QQBX 3PO2H 3HKZG 5IYBG 4A3JH 3H0GG 4KHPQ 1E1OA 1I94Q 1CKNB 4JI6L 4KHZA 3FHWA 5JJLA 4A93H 1NMFA 1Y1WH 1YITA 5FLXc 5M3FH 4X65L 1CSQA 2PQAB 1K8AC 1G6PA 1HJPA 2JEBI 1JE5A 2V1CC 1E22A 3CP0A 4DV4Q 1SN8A 4JI3L 3CPFA 1X3GA 1TXYA 4NPSA 3GTJH 2ZJPA 2R92H 5M5WH 3I55A 4DR3L 3M4OH 3HKZE 4JYAL 4HJAA 1JJGA 1Q46A 3CCSA 3ULJA 3I56A 3CD6A 1NBWA 1KAWA 5FLMH 1WOCA 4EQ5A 4JC0A 4GS3A 4DR2L 5C0XI 4DV1L 4A3IH 1PHJA 4C3HH 4LFAL 1WFQA 1W3SA 1P8LA 4GN4B 3GTMH 3I2ZA 2WAQG 4B3SQ 3KF6A 1FVIA 4JI4L 1N32L 1D7QA 3T1YL 2K75A 3HOYH 4UY8C 1T9HA 1GM5A 3PUWA 3B6YA 4LF4L 2RHQB 2XGTA 3BJUA 1VQLA 2NVXH 3HOWG 2R7DA 3AFQA 3NBHB 2I5HA 4IOCA 2YTXA 2JJQA 1LYLA 1O7IA 1C9OA 1X56A 3BZCA 4JI0Q 2JA6H 4L5TA 4DKAC 3CCJA 3HOVG 2K14A 1MIUA 2WAQE 1WCMG 3UDXA 5AJ3L 4R4OA 2JK8A 3ULLA 3KOJA 2ZTCA 4A3KG 1XJVA 1EYGA 3S1QH 3UDFA 2I5LX 2RCNA 4MZ9A 5JJKA 5BR8Q 1WJJA 4FDBA 3PO2G 1PYBA 2VQEQ 1J6QA 4A3JG 2E2HH 1HNWQ 3CF5A 3CW2C 2I0QA 2YTYA 1LTLA 2PI2A 5M3FG 1EWIA 4MNOA 1VQ4A 4A3DH 4GOPB 4JV5Q 4KI0A 4P74A 1K0RA 2JA9A 4HJ7A 2YTVA 3OTOQ 1QZGA 2E2IH 1G291 2AWNA 3MEFA 4DR7Q 1FJGQ 3EIVA 3S14H 3K7AH 4DK6C 4OXPA 5M3MH 1N34Q 1HR0Q 3DLLA 3UE1A 1VQ5A 4DR6L 1Y1VG 3JAMi 3I4OA 3FKIH 4LFCL 1S40A 1KXLA 3PF5A 1PH1A 2OQ0A 5DLQE 4R4QA 3S1RH 4JBMA 2UXDQ 4JI8L 1A62A 4A3IG 3ER0A 1KRTA 4L5RC 1XMQL 1E24A 1OXXK 2ES2A 5J3BA 2K4KA 3A74A 3CMAA 4JI2L 4DR4Q 2I5MX 1BBWA 1VQBA 3M7NA 1DGSA 4L5SA 3HOYG 3CC4A 4GN3B 2Z6KC 5IP9H 3FP9A 2FXQA 4HIKA 1D8LA 4DR1Q 5M5XH 2VNUD 1E1TA 3U58A 1VQGA 1QVFA 1Y14B 4BBSH 4A3BH 4GKKL 4DV2Q 2A8VA 2ZM6L 3NELA 2JA6G 1B7YB 1EUJA 1PH7A 2CFMA 4B3TQ 3STBC 3A5ZB 3PF4A 2Q2TA 4X6AH 2IT1A 4NXMQ 1FL0A 1TWGH 1YI2A 1GD7A 2VUMG 3S16H 2ID0A 5LMUL 5BR8L 4DV7Q 5IT9c 1X55A 2VQEL 4RMFA 4YWMA 2UXBL 1TWCH 2K5VA 1A0IA 1EIFA 2F3IA 3S1NH 3JAMc 5E7NA 3S2HH 4IPHA 4EX5A 1VQ7A 1MKHA 3EN2A 3HOUH 4BXXH 1YHAA 1QZHA 4R4IA 1XNRQ 3A0JA 4BY7G 4JV5L 1GKHA 2PMZE 2D62A 4HJ9A 1SFOH 1E7ZA 3OTOL 4DR7L 1IBML 2OTJA 1OXVA 2AKWB 4TQUS 1KHIA 2VL6A 2CWPA 4DK3C 4DV5Q 3FKIG 1GO3E 1HR0L 3E9HA 2GVBA 2ASBA 3F1ZA 4H02A 4A3CH 4XTCS 1IBLQ 3NEMA 1MJEA 4HIMA 2VQFL 1XMOL 1BBUA 1Q86C 1JT8A 2HT1A 1OTCA 2PNHA 1PH8A 1XTDA 3PUYA 3LGJA 4AQYQ 4LWCA 4IPGA 4LFBQ 5LMNW 3OW2A 2IHEA 4YHHL 4LF5Q 3G71A 3L2PA 1K73C 2KBNA 1YJNA 3KF6B 4DR1L 2NVTH 3TS2A 1JJCB 1YVCA 4DPGA 2R93H 2N49A 3S24A 1K83H 3GTKH 4JI5L 4C2MH 3KDFB 3GTPH 1VQEA 3KYHC 4DV2L 3D31A 1XPOA 1KL9A 3E9IA 5JJIA 4OWWB 5IYCH 3WWVA 2HHHQ 3HKSA 3S2DH 1RIPA 2B29A 3TREA 4R4CA 2JA5G 4NXML 3J7A5 1L1OA 2OCEA 4DV6L 1C7YA 3IRBA 1YNXA 1PH2A 2N78A 1NJIC 3BU2A 1NY4A 2YU9H 4Y7NH 1A8VA 3NENA 1JB7A 4NXNQ 3M3YH 2LSSA 3AEVA 1UE7A 3K80C 2Q2HA 2AHOB 3CCMA 2E5LL 5HY6A 2QGQA 4B3RQ 1VQCA 1L2FA 2NN6G 2YV5A 4BY1G 4A3MH 1XNRL 4PG3A 1X9NA 1IBKL 1UE6A 3CQZH 4C3JH 3M85A 5K36G 3DM3A 4L5QA 5C4XH 1G51A 3J81i 4A3CG 5JEAG 4A3EG 1VS0A 2YYZA 3OYYA 4OX9L 2C35B 4DV3Q 1HNZQ 1IBLL 4KLKA 2NVQH 1QVCA 2WP8J 1X54A 4PZ8A 1FGUA 1YJ9A 1VQMA 1R9TH 2B63G 1ASZA 3PO3G 2Z0SA 4AQYL 1IL2A 1HZ9A 3PUVA 4C3IH 3RZDH 1N8RC 4POGA 1NE3A 1N33L 2IY5B 1WYDA 3TQYA 1Q82C 4LFBL 1SROA 4LF5L 4WJ3M 1EQRA 2Y0SG 1PFSA 3F8TA 4X66Q 2JA7H 1Y1WG 4A93G 1IZ6A 1YHBA 4KHPL 1CKNA 1B8AA 1J5EQ 1I94L 2MNAA 2BA1A 1RL2A 3CAMA 4A3LH 2PQAA 1CKMA 5IYDH 2KENA 1W2BA 4JI7Q 3I4MH 1PH5A 2EQSA 2HHHL 4XIGS 1VQJA 5HGQA 5IWAQ 1Z9FA 4DV4L 2R92G 1V9PA 5EAYA 3T1HQ 4NB3A 4A3FH 2Y0SE 1KD1C 2XTIA 4A4IA 4GKJQ 4LF9Q 1OXTA 1UEBA 4OWXB 3J81c 4LF8Q 3HOZH 2NZHA 1VQAA 3H3VI 1SMXA 2IX0A 3K7UC 4NXNL 5FLMG 4JOIC 2OQKA 1UE5A 5C44H 1EOVA 4IPDA 2VW9A 4DR5Q 4QIWE 2QEXA 4A3GH 5JEAJ 3JC66 2GVAA 1NMGA 3HOXH 1QUQB 4B3SL 4MTNA 3PUXA 4ALPA 1N36Q 1I5FA 3K0XA 4QY7A 4YCWA 5H1SE 2UUAQ 2E8GA 1CKOA 3UDIA 1Z47A 4JI1Q 4HJ8A 2VS1A 1K3RA 3U50C 2UXCQ 4UP7A 4DV3L 2A19A 1PH9A 3PIPA 4IFDG 2ZJQA 1Q12A 4QL5A 3CCVA 4JI0L 4DV0Q 2VY3A 1X6OA 1YHQA 2N8NA 4PZ6A 5C3EH 1HNWL 1PVOA 4GNXA 1Q1BA 2A1AA 1VQHA 4BA1I 1OXSC 4A3DG 4DNIA 5IY0A 1X65A 1VQNA 2PI2E 3RZOH 4GOPA 3W1BA 3I4MG 3KLWA 3CPWA 4X65Q 4YCVA 1YIJA 2HIXA 2BH2A 3W5OA 4JI7L 3K81C 2DGYA 3PV0A 4DUYQ 5GAGC 5M3MG 1AE2A 3RLNA 1Q1EA 4AH6A 5IWAL 2BH8A 4A3FG 1PV4A 1FJGL 3T1HL 1N34L 1U0LA 2K52A 2OWOA 4DR3Q 4GKJL 1PH4A 2F52A 2HIVA 4LF9L 4X62Q 3UDGA 3U4ZA 2WFWA 3RLFA 4LF8L 2UXDL 2RF4A 4R4TA 1KIXA 2EXDA 1GVPA 1MJCA 1PH6A 4JYAQ 5C4JH 4OO1G 2IHFA 1I50H 4A3GG 1V1QA 1AE3A 2AWOA 1HZAA 4P75A 3HOXG 3TS0A 2ZTDA 4LFAQ 4DR4L 3E0EA 5IP9G 2JEAI 2LXJA 3D0FA 1U5KA 4O2DA 4LF7Q 3GTOH 1IYJB 1CSPA 2L15A 4P72A 4ME3A 3STBD 1SRUA 1N36L 4BBSG 4DAMA 1N9WA 2UUAL 4A3BG 4IFDJ 4JI1L 3GO5A 1HR0W 1VQPA 2JA8H 3PIOA 2UXCL 1LUZA 3CCQA 3KJOA 2OTLA 2IX1A 2N3SA 3MXNB 4LUOA 4P71A 1PH3A 4B3TL 3BZKA 4DV0L 4K0KQ 3M9BA 1KRSA 1I6HH 3PUZA 1YZ6A 4O0AA 4P73A 1CUKA 2QA4A 1VQKA 3HOVH 3H15A 4DV7L 3ULPA 1JJ2A 3Q8DA 3KFUA 4BXXG 3HOUG 1S3OA 1YBYA 1VQFA 3W1GA 2KHIA 1ASYA 4IJHA 1PYSB 1V43A 2UUCQ 1YJWA 3H3VH 1VQ6A 5C0XG 3UE0A 1Q81C 1SR3A 3G48A 2NZOA 1XPUA 4DUYL 1BKBA 4BBRH 1H95A 2MO1A 2VZAA 2WB1G 4R1JA 4JBWA 1IXRA 2UUBQ 3CCRA 4DV5L 1EFWA 2BA0A 2R7FA 4DR6Q 3M4QA 1TWAH 2ZJRA 4QJFA 5GAHC 3L7ZC 2R7ZH 4LFCQ 3GTQH 4X62L 4BA2I 1Y1VH 3F2BA 3I7FA 4YWKA 4JI8Q 1S72A 2UU9Q 1TWHH 1KQSA 4J15A 4GLAC 1SLJA 3RN5A 5IE8A 1XMQQ 2NN6I 5IP7H 2KCTA 2Q2IA 4JI2Q 4IO9A 3I4NH 2MO0A 2WB1E 4LUZA 3GTGH 3ERSX 2R93G 4LF7L 3VDYA 2JA8G 1M1KC 3GD7A 4HJ5A 4AYBG 4OONA 3KDFA 4PZ7A 5IYCG 1B70B 3TEHB 2CKZB 1K9MC 1E3PA 4GKKQ 1VQ8A 2ZM6Q 2EIFA 4UPAA 4LNQA 3RLOA 3EBEA 3G4SA 1JMCA 3M4PA 4DUZQ 3A5UA 2F4VQ 3CCUA 3CC7A 2MFIA 4K0KL 4HIDA 2CCZA 3RNUA 2CQOA 4PMWA 2JQOA 4LF6Q 3ICEA 1XNQQ 2K5NA 4AYBE 5LMUQ 2KCMA 3J7ZC 3S17H 2UXBQ 4A75A 5C0XJ 2VUMH 1VQIA 4GNXB 4A3MG 4UP9A 5M5YH 4POFA 4LW1A 3TRZA 2K50A 4B3RL 2UUCL 1M90C 3PCOB 3L0OA 5LMNQ 4BBRG 3CXCA 3J80i 3KF8B 5GROA 3CC2A 1VQOA 1OXUA 4B3MQ 4BY7H 5C4XG 5ELOA 3PSIA 2CWAA 2ALYB 1K8GA 4LUVA 1IBMQ 4JG2A 1SE8A 2UUBL 3S1MH 2R7ZG 3KJPA 2R6GA 2HQLA 4X64Q 2DUDA 1X3FA 4YWLA 1HNXQ 1HNZL 4JOIA 3J81j 2VQFQ 1XMOQ 4OWTB 5IP7G 3AQQA 3AYHB 3CMEA 3I4NG 2UU9L 1Q7YC 1UE1A 4YY3Q 3PGZA 1HZBA 4AIMA 4JBKA 1HH2P 2Z6KA 3RN2A 3CCEA 2JA7G
chains in the Genus database with same CATH superfamily
2RSNA 1OO9B 2KHJA 4X66L 1K3BC 1ENCA 4JI6Q 5IYDG 1LTSD 4JCVE 4JI5Q 3H0GH 1ILPA 3A7AB 4HN7A 4IFDI 1UWVA 2CH4W 2LXKA 3GTOB 5GAEC 4JBJA 4KJOA 3J80c 1EU3A 3GTLB 4JVZA 1ICWA 4G7HC 4APVA 4IJLA 2JA5H 2QEJC 2F0LA 2RHSB 2K5WA 3HOWB 4HIOA 3SK4A 1EY4A 2HD3A 1G8ZD 2B3GA 1BO0A 2RSOA 4A3KB 2SNMA 4A3JB 4OX9Q 5C5LA 4KTAA 4A3EH 1CI3M 1HQMC 4ID6A 1HNXL 1L0WA 2Q2UA 2K05A 3VA5A 1JICA 3SGIA 1WTOA 2B63H 4WJ4A 1B44D 3GTQB 4IUQA 1EWHA 3H0GG 1E1OA 1TWHB 3OOCA 5KRUA 4DA2A 5JPNC 5DM63 1V1PA 1YITA 5FLXc 4FXDA 3ND8A 1CSQA 2PQAB 3HP3A 5IGGA 1Q8IA 1PRTF 2JEBI 3GTGB 1JE5A 2D5DA 1F2MA 3CP0A 2A69D 3NTIA 4TKOB 2CQAA 1EY5A 3CPFA 2A73B 2O2LD 5CV8A 3QB3A 2DJFC 3KUPA 4JYAL 1JJGA 1Q46A 3I56A 3H91A 1NBWA 4DR2L 4JC0A 4GS3A 5C0XI 4DV1L 4LFAL 1EOTA 4ABNA 2EZVA 5E4WC 4FXGC 3GTMH 2WAQG 3BYYB 1N32L 3DWPA 3T1YL 2K75A 2EVBA 2KECA 5KNBA 4P2CB 1K0SA 4UY8C 2VUMB 3O13A 3PUWA 4LF4L 2RHQB 3BDCA 1KDBA 2OF1A 2R7DA 4KHVA 3NBHB 5CMDA 4IOCA 1AZPA 2KVMA 3N6RA 1R4PB 1S5BD 1X56A 3SR1A 4JI0Q 3D4RA 4DKAC 3CCJA 3HOVG 3OMGA 1XJVA 2ZTCA 3T16A 3DMUA 4ZQ3A 1Y8NB 2I5LX 5JJKA 1J6QA 1PZJD 4K5WA 1TS4A 4KK7A 3CW2C 2I0QA 3PQIA 1LTLA 1SE2A 1O80A 3W2DA 2LKVA 4GOPB 3EJIA 4HSVA 1K0RA 1QZGA 1G291 3MEFA 2L12A 1C8CA 1IKLA 4KY5A 5ELDA 1VQ5A 3V05A 4QCLA 3MFYA 1QNKA 1B4OA 1ZKOA 2OQ0A 3ND9A 1F9RA 5DAUA 2UXDQ 1TWFB 2L0CA 3ER0A 4L5RC 2K4KA 2PQEA 2I5MX 2EY5A 1BBWA 3T56B 2J4XA 1DGSA 3QR8A 5D3DA 3CC4A 4HIKA 4QF4A 1VQGA 4DV2Q 3S15B 3HS0C 1B7YB 2B2TA 1STEA 4F7XA 1FL0A 1R4QB 4NP5A 5BR8L 2VQEL 4IUNA 2XWJB 1YHAA 3VR6A 1QZHA 1XNRQ 4BY7G 4ZYSA 2F0FA 1V1PB 2D62A 1SFOH 1E7ZA 3A55A 4ZCKA 1H9RA 1OXVA 2EYHA 2EY1A 3E9HA 1IBLQ 1HFGA 4IN3A 1EY7A 5LL6S 1LT4D 1OTCA 1FD7D 2PNHA 3M7GA 3IFDA 1H9SA 2MP1A 2K04A 1KTKA 4WJWA 1RCVD 4LMQD 4OELB 3OW2A 2KHSA 2R92B 3NWSA 4LF5Q 2EE1A 2KBNA 5I6YA 4DR1L 4DPGA 2R93H 2TSSA 3GTKH 1JWUD 2B29A 4NXML 2OCEA 1PH2A 2N78A 1NJIC 5KIXA 1PTOF 4ODGA 2AHOB 2XNAC 1K8MA 3DXJC 4PG3A 3S1QB 2RBMA 1JOOA 3DM3A 3I3CA 3NBIA 5JEAG 2K28A 2X6LA 1MSGA 3MEHA 4G57A 2NVQH 2WP8J 3C46A 3RD4A 4AQYL 4QUFA 1IL2A 3PUVA 4RAUC 1N33L 2A68C 5M3MB 1CK1A 4A3FB 1SROA 4WJ3M 1EQRA 1PFSA 2CW0D 3F8TA 3AMUA 4A93G 1F9SA 3HOZB 1F2YA 4KHPL 1J5EQ 4M8AA 4X3TA 2MNAA 3CAMA 2KENA 4RKLA 4JI7Q 2EQSA 2E2DC 5IWAQ 3HOXB 1Z9FA 2FHTA 4QMGA 4E6IA 4DV4L 5EAYA 2Y0SE 1XTCD 4GKJQ 1OXTA 4BBSB 2NWGA 2IX0A 4JOIC 1EOVA 1M4VA 2RDHA 5I4DA 2QEXA 1JCKB 4JPBW 4N9TA 4B3SL 4FF3A 2E8GA 1Z47A 1K3RA 3S2HB 3RZOB 1LTBD 3K0YA 2A19A 3WDNA 2Z4HA 3R2TA 5ISRA 1QB5D 1HNWL 1A3VA 1OXSC 1FGBD 1KLGD 1BDOA 5E4XA 2BH2A 3PV0A 2DGYA 2F0IA 2VB2X 4DUYQ 1WTWA 3RLNA 1Q1EA 5CV7A 2BH8A 3MXUA 1WD0A 1K83B 2HCIA 4BWGB 4C2MB 4DR3Q 1PH4A 2F52A 3SK5A 5C4JH 1I50H 4DR4L 2A69C 2ZTDA 4XT3B 4YIJA 1A6XA 2JEAI 1CSPA 4P72A 3STBD 2IPKD 1N36L 2EY2A 2UUAL 4A3BG 4IFDJ 4CGYB 3M3YB 4JI1L 3GO5A 4F88A 2A74C 2KEEA 2K33A 5E1FA 4DFAA 4LUOA 3MXNB 2WKCA 1PH3A 4B3TL 1L0XB 5CBEE 4DV0L 4K0KQ 3M9BA 1HTPA 4BBRB 3IAYA 5F2DA 1VDZA 2EOTA 3KFUA 4BXXG 1S3OA 1YBYA 1VQFA 1XXGA 3W1GA 1ASYA 2NTSA 1PYSB 2UUCQ 3ZYYX 4C3IB 3SK8A 3UE0A 1SR3A 2NZOA 4GZYC 2MO1A 3K5OA 1IXRA 2K6AA 1WTPA 3CCRA 3FPPA 2R7FA 4HAEA 3M4QA 3A54A 3I8ZA 2L4NA 1DCZA 1SE4A 1NUCA 4BA2I 1Y1VH 3I7FA 1S72A 1HRJA 2UU9Q 1KQSA 1FNVA 5T1GA 4GLAC 1SLJA 3ERQA 1JWSD 4K5VA 3I4NH 3J81L 4V0BA 4HTHA 4FF1A 2WB1E 4LUZA 3URYA 2AQ2B 1DJRD 5DM73 4HJ5A 4AYBG 3KDFA 4PZ7A 1B70B 2CKZB 4GKKQ 4OIJA 2K5QA 4UPAA 4LNQA 2R3ZA 3G4SA 1STBA 1JMCA 1RTOA 4RCOA 1Y8OB 1A15A 3OIQA 1RD9D 3V2TA 2KCMA 2UXBQ 5C0XJ 2IX3A 1VQIA 5A2QL 1PFMA 1RJTA 1M90C 2VXWA 3J81E 2E76C 3CXCA 5CV6A 1LLRD 2CWAA 1K8GA 1IBMQ 4JG2A 1MGSA 3KJPA 4H7BA 4X64Q 2DUDA 1X3FA 1HNZL 3J81j 4LK1C 3H0GB 1RDPD 3CMEA 3I4NG 4C1NI 1UE1A 3PGZA 2B2TC 4AIMA 2E74C 4K2KA 1BCPD 1DM0B 2BE5D 1PDQA 4Y52H 3G6EA 2JA5B 3KLSA 4A3LG 3SXHA 4KN4C 5IYBH 3I73A 3D4WA 4UP8A 2KCNA 5HGTA 2AMCB 3NPPA 4K6DA 4OL7A 5EJWA 3P1HA 2F4VL 4JI3Q 1B9MA 1I3QH 2WAQB 5HURA 3HOZG 5C4ZA 4LF6L 4RG1A 1HZCA 4A3EB 4DK1A 3KBGA 3F2DA 4PV1C 1VQDA 1HFNA 2P5ZX 3GDEA 2EYPA 1T5XD 2C9OA 3TP8A 1QUQA 2FINB 1IBKQ 4CJ0B 4B3ML 3HOVB 3KK7A 2QDBA 3U4VA 2ATWA 2NUCA 1PRTB 1PA6A 4DAYB 1QVGA 2B2UC 2E2JH 5D14A 4ZKBB 1CM9A 3CCLA 1X3EA 4YY3L 5AJ3Q 4ZRZA 3PO3H 1P16A 1NTGA 1KDAA 5ELNA 1VCIA 3F2CA 1XPRA 1LM0A 1LT3D 4QQBX 1I4QA 3PO2H 1H9JA 5IYBG 4Z9CB 1I94Q 4JI6L 1AW7A 1JWMD 3BDLA 2DY8A 5M3FH 4X65L 1DOLA 1K8AC 1WTRA 1STHA 3GTMB 1E22A 1SN8A 2CW0C 3HGBA 5CBAE 1X3GA 1TXYA 4NPSA 3K5LA 1SNDA 1F9QA 3M4OH 3HKZE 4IUVA 2I46A 3OPOA 1TU2B 3CCSA 4X3KA 2K1BA 1F9PA 5FLMH 1WOCA 1MHWC 4EQ5A 1PHJA 1WTHA 4C3HH 1WFQA 1W3SA 3I2ZA 2L1BA 3KF6A 3HOYH 1T9HA 1O7ZA 2SOBA 2XGTA 3SEBA 5KNDA 3AFQA 3F2UA 2F0QA 2YTXA 2JJQA 1TS5A 1I6VC 4KKSA 3EFXD 4BY7B 2EJFC 4L5TA 1JB3A 3UDXA 3K59A 1EYGA 5C4HA 3UDFA 3K5MA 2VB3X 1WJJA 3PO2G 2E2HH 4TSSA 2HQEA 2YTYA 2PI2A 5M3FG 1LV9A 4KI0A 1CT1D 4HJ7A 3OTOQ 4X3SA 4DR7Q 1FJGQ 1HR0Q 3DLLA 4DR6L 1EEFD 2XIWA 1STNA 1QJOA 3I4OA 3FKIH 1S40A 1PH1A 2C5CA 5ELBA 3BVGA 4JI8L 1KRTA 1XMQL 2BCOA 5J3BA 2CH4A 3A74A 3CMAA 1SMYD 4OO1H 4S3SA 1VQBA 3M7NA 3HOYG 2WIIB 1D8LA 1X3PA 5M5XH 2VNUD 1NNXA 4HR7B 1E1TA 3U58A 3I72A 2ZM6L 3NELA 1PH7A 1G91A 2CFMA 1QE6A 3STBC 3A5ZB 1SFOB 5E3FA 4X6AH 2IT1A 1GUSA 1D6EC 2Q8RE 1LO5D 5LMUL 4DV7Q 5IT9c 1X55A 1A0IA 1EIFA 1LTTD 3MAQA 3TZDA 5C3WA 4CJ1B 3HOUH 4R4IA 1EIGA 2D2CC 5KNCA 3KF8A 1GKHA 1EZ8A 2PMZE 5COYA 3DWQA 5DNFA 1IW7D 5EPJA 5K36H 2AKWB 4TQUS 1JORA 1EY0A 3SE0A 4DV5Q 3FKIG 1GO3E 2ASBA 2GVBA 3F1ZA 3NEMA 4A93B 3NE5B 2VQFL 4HIMA 1BBUA 1Q86C 3U9SA 1PH8A 3QOLA 4M1UB 1EYDA 4F87A 1ESRA 4CDFC 4PNYA 5M5WB 3UI2A 4YHHL 1JC7A 1PTOB 3L2PA 1K73C 1I4XA 3KF6B 2NVTH 1SYEA 3Q24A 2N49A 2M9VA 1VQEA 4DV2L 1XPOA 5JJIA 3DEOA 2HHHQ 1X32A 3S2DH 2F0UA 1EFID 3EVQA 5FO7B 3TREA 4ILWA 4I65A 2JA5G 3J7A5 1L1OA 4DV6L 1BOSA 1C7YA 1HA6A 2YU9H 4Y7NH 2F0PA 3NENA 2NVQB 1UE7A 3K80C 2ZXRA 2E5LL 1BQQT 5HY6A 2QGQA 3ONAB 4B3RQ 1VQCA 4A3MH 1XNRL 4OIKA 1X9NA 4C3JH 4L6TB 3M85A 5K36G 4L5QA 5C4XH 3J81i 4A3EG 3OYYA 2C35B 4DV3Q 1IBLL 4CHTB 2NB0A 1QVCA 1X54A 1VQMA 1R9TH 2F0EA 2B63G 5JJZA 2E2IB 1LTID 1HZ9A 2EDGA 2F0VA 2RDFA 1N8RC 3S14B 1QILA 1NE3A 2OXPA 3K7AB 1RHPA 2K03A 4LF5L 2Y0SG 4X66Q 2JA7H 2EJMA 3S1RB 1IZ6A 1CKNA 1WVLA 1EYCA 2A6HD 4I7AA 1RTNA 2BA1A 2F1MA 1RL2A 1ZEQX 1CKMA 1BCPC 3W3AA 1W2BA 2BE5C 1V9PA 3PIP3 1YNJC 3T1HQ 3C1EA 2L55A 1KD1C 4LF9Q 1UEBA 1EIHA 4A3BB 1LTAD 4LF8Q 1A2TA 3H3VI 3K7UC 1Q3LA 2OQKA 5C44H 1HA5A 2VW9A 3K5NA 4PMBA 4QIWE 4LJZC 1TWGB 5JEAJ 4A3GH 2G5DA 1RODA 2G9DA 3JC66 3JAML 2HDLA 4Q5VA 3S16B 1I5FA 3K0XA 5H1SE 4FYDA 1JOQA 4HJ8A 3S1NB 3CRKC 4UP7A 1PH9A 2L9HA 3CCVA 3TP5A 1ZYRD 2KEDA 5JVH3 1O7LA 2N8NA 5C3EH 2KUMA 2K5DA 2A1AA 1PYWD 2F0HA 1MBYA 4DNIA 1VQNA 2PW7A 1NCVA 5C4JB 1I50B 3D6CA 4YCVA 3EA6A 4B9XA 3W5OA 1O78A 4JI7L 3K81C 5GAGC 5IWAL 2L11A 3JAME 1TVXA 2NBFA 1N34L 1G6ZA 4GKJL 1B9NA 2WACA 4X62Q 1DOKA 1TKWB 3SK6A 4AYBB 2RF4A 4R4TA 3NXWA 4JYAQ 1MJCA 2PZTA 3BVMA 4IUPA 4A3GG 3TZUA 4B9WA 1STGA 3TS0A 2AWOA 4LFAQ 4MHEA 1PZKD 2LXJA 3D0FA 4O2DA 3GTOH 2L15A 4ME3A 1SRUA 1ENFA 1TY0A 2JA8H 1L0YB 2B2UA 1WD1A 1LUZA 1NAPA 2OTLA 5IGFA 2K01A 3G6JB 3CQZB 5EBDA 5FOBB 1NSNS 3NK9A 4DNTB 3Q22A 2MJ8A 5JAVA 3H15A 4DU9A 4RGMA 1LT5D 4ZAIA 4IJHA 1V43A 4UAIA 1YJWA 4DAPA 3I4NB 3J7AV 4HEDA 1MSHA 2FMMA 4DUYL 4X3UA 2WB1G 2HUGA 2UUBQ 2BA0A 2ZJRA 1D5MC 3GTQH 2RCFA 4YWKA 1B1ZA 1TWHH 2ZT9C 1SYBA 3NWTA 5IP7H 2Q2IA 5C3XA 1CA6A 3DEPA 5JPMC 3GTGH 4I7ZC 2R93G 3VDYA 2JA8G 1M1KC 2EYFA 4OONA 2K32A 1AFPA 1SMYC 2QDLA 4DUZQ 1CHQD 2JP1A 5IGBA 3SHLA 5C6AA 4K0KL 3RMHA 2AUKA 2JQOA 1XNQQ 3J7ZC 1SAPA 3I91A 1FYCA 2VUMH 3QIAA 1KABA 1SYDA 2OT2A 2PYKA 5CYUA 4FNFA 4LW1A 3TRZA 2K50A 1XYIA 2UUCL 1PMRA 5LMNQ 1VQOA 2NZ1D 5ELOA 3GV6A 4LUVA 2EY6A 4N9PA 4EQNA 2R6GA 2HQLA 2ICIA 4YWLA 4K5XA 5IP7G 1V1OA 2B2WA 2UU9L 2XVSA 4HSPA 1IW7C 4JBKA 1H9SB 5EBCA 1I3QB 3RN2A 4DAVA 4ZKCB 1C0AA 1VQ9A 2MQHA 4TVAB 4N8FA 5FJ8H 1LTRD 4QGUA 2D0PA 1CHPD 3PMFA 1IYVA 4GOPC 1TWFH 1AZQA 3FVQA 5J22A 1E2VA 1KC8C 1YEZA 3GV3A 3ZJYC 1WI5A 1B2TA 4K8JA 2B2VC 2F3WA 2D9UA 3MA2B 4GLVB 1W6KA 5GQOA 2ZTEA 5G3LD 3K58A 1Q8KA 5KGUA 3S15H 4DR5L 2RKSA 3GQBA 1I6HB 4GLXA 3A8KE 3IL8A 2NN6H 4BY1H 4JI4Q 2NVYH 1EIYB 2DJGC 2H5XA 4NKLA 2O5JC 3PO2B 1B50A 3N52A 4X64L 2K5HA 3IFTA 5M3FB 4RGNA 1EWCA 4GN5A 1TIID 4DNRB 1YNND 4IPCA 1CQFA 2PPBC 1AH9A 1LABA 2DY7A 1N33Q 1WCMH 3RR5A 5FJ8G 2FFKB 1L1OC 1TWAB 3VR5A 2F0DA 3HKZG 4KHPQ 5JJLA 1NMFA 1Y1WH 1G6PA 3WOFA 1HJPA 3LWUA 5NUCA 4DV4Q 4JI3L 2ZJPA 3HOYB 2A6HC 3GTJH 2R92H 1SEBD 4IUUA 2A6EC 1IL8A 4HJAA 4MTKA 3CD6A 1KAWA 2H4OA 3NSWA 4A3IH 5CV4A 1HUMA 4XDXA 2E75C 4B3SQ 3Q23A 1AN8A 1D7QA 3NP8A 1CZWA 2F0JA 2E2HB 2NVXH 5M5YB 1IHZA 1S5DD 3DHQA 1U4RA 1O7IA 3KLSX 2JA6H 4RH6A 3AU7A 5D3IB 5EKKA 2K14A 1MIUA 4IFDH 1WCMG 5AJ3L 4R4OA 3ULLA 3KOJA 3S1QH 3MXPA 3S1MB 2RCNA 4FDBA 1HNWQ 1PYBA 2RA4A 1O7YA 3CF5A 3FKIB 5EKIA 1UUPA 2F0NA 1S5FD 5L37A 1I4RA 4A3DH 1SJHD 1ZYRC 1NR2A 4JV5Q 4P74A 1PRTD 2KJXA 5C5MA 2AWNA 3T4AC 1HXYD 2LY7A 1XWEA 3EIVA 4QB4A 4DK6C 4OXPA 5M3MH 1U4LA 3UE1A 3BZDB 1Y1VG 5FO9B 3JAMi 4LFCL 1KXLA 2B39A 3PF5A 5DLQE 3MXGA 3J80L 1HPCA 1A62A 4A3IG 1B53A 2ES2A 1SYFA 3E0JA 4DR4Q 4JI2L 1E2WA 3LNNA 4L5SA 4UDUC 3K6OA 4GN3B 2Z6KC 5IP9H 3FP9A 1YNJD 5A2QE 3HRZC 3OIPA 4BBSH 1Y14B 4O42A 2A8VA 4Q0FA 1ML0D 5EPKA 1B3QA 4CDDC 2JA6G 4CBVA 1ET9A 2LMCB 4B3TQ 3P7JA 4UHVA 1YI2A 1GD7A 4WRDA 1KDCA 4EGVA 4RMFA 4YWMA 5KYIA 1TWCH 2K5VA 1IYUA 2F3IA 5A35A 3S2HH 4IPHA 1MKHA 1J9OA 4K6LA 2B63B 4HJ9A 1VF7A 5FK9C 3OTOL 5C0XH 2XRQD 4DR7L 2OTJA 5FLXL 2CWPA 3QJYA 2IJ0A 1HR0L 2Y0SB 1LACA 4HCSA 1PLFA 1XMOL 1JOKA 1XTDA 3LGJA 2K7VA 3S2DB 2Z1CA 4IPGA 4ZLTF 2AUJD 4LFBQ 1C48A 4U68A 5I9PA 2EYJA 4CKBA 3G71A 1YJNA 1SSOA 3TS2A 3CRLC 1YVCA 1F77A 2MHVA 1U4MA 1K83H 4JI5L 4C2MH 4EVOA 3KDFB 3L9AX 5AFWA 3GTPH 3D31A 1KL9A 1A3TA 3I90A 5IYCH 4OWWB 2EPBA 2XN9C 4FF2A 1VMCA 3VYSA 4WORA 4R4CA 3IRBA 5FLXE 1Q90A 1I4GA 1DD2A 3NHHA 1NY4A 1GUWA 3K57A 1JB7A 4NXNQ 3M3YH 2LSSA 4ZK9B 1TR5A 3AEVA 4KY7A 1PZID 1R9TB 4R9WA 1L2FA 2YV5A 5KYLA 4F8MA 1UE6A 1BF4A 3I4LA 5CGKA 3L3OC 2YYZA 4OX9L 4QUCA 3BVZA 1HNZQ 1UAPA 3TP7A 4ME5A 1PXUA 4PZ8A 3PO3G 1ASZA 3OSOA 5I2YA 4C3IH 3RZDH 4POGA 3MZ5A 1QNUA 1F2LA 1ENAA 2F3VA 1YHBA 1CTMA 1VF5C 1EL0A 1FNUA 2PQAA 5IYDH 1IKMA 3I4MH 1PH5A 1GXDC 3A56A 2HHHL 4A3GB 2PCFB 1VQJA 4TRDA 5HGQA 1ICFB 2XTIA 2TMPA 3J81c 1VQAA 4RCNA 1SMXA 5FLMG 4J1MA 1UE5A 4C3HG 2SEBD 2B2WC 4U673 2X6GA 1QUQB 1G2SA 3PUXA 4ALPA 1CA5A 4JK1C 4QY7A 4YCWA 2O4XA 3UDIA 1TS2A 4XQQA 3U50C 2UXCQ 4DV3L 3U9OA 1F2ZA 4BS9A 3P20A 3PIPA 2ZJQA 5CV9A 4JI0L 1S5ED 5M9OA 3C2PA 4KJNA 3CU7A 1X6OA 1YHQA 2CVRA 2ZXPA 3Q0AA 2HDMA 4KV6A 2WB1B 4C1NK 1Q1BA 5IGCA 1W6JA 3DWAA 1X65A 4NMZA 2QILA 2WV6D 4GOPA 1YNNC 3W1BA 5FO8B 3KLWA 2IW3A 3I4MG 4X65Q 4XQJA 1TS3A 3PIO3 5K5PA 1AE2A 4XXEA 4K2LA 2B2VA 2M2LA 3FMCA 5IGDA 3T1HL 2R93B 2K52A 2OWOA 1J8IA 3T53B 3GTKB 4ZUJA 2JA8B 4LF9L 2HIVA 2XSCA 3UDGA 2UXDL 2WFWA 1SE3A 2Z8LA 4LF8L 3OWEB 1GVPA 1PH6A 4OO1G 2R61A 1AE3A 1V1QA 1HZAA 3VYUA 1II3A 4LF7Q 1IYJB 1SNOA 4DAMA 1N9WA 4KD4A 3T13A 1HR0W 1K28A 1X3QA 2H1EA 4OEMB 3P75A 3KJOA 5JVG3 4IURA 3D4DA 3BZKA 3FPUB 3C3LA 3PUZA 4P73A 1VQKA 1STYA 4R8IA 3HOVH 2JXMB 4KD3A 3ULPA 1JJ2A 2B8FA 3HOUG 2FMCA 1H9KA 3OWFA 2KQ3A 4IZ8A 1WTXA 1Q81C 3G48A 3BG3A 4PQXA 1XPUA 5CC4A 1BKBA 1H95A 3TN2A 2PZUA 1FNWA 4JBWA 5I2XA 1EFWA 2B2YC 1FR3A 4DR6Q 1Z7TA 2PNRC 3CHBD 4QJFA 5J39A 5GAHC 2R7ZH 4HMIA 5BN4A 4X62L 3F2BA 1PRTC 4JI8Q 1TY2A 4J15A 3RN5A 1XMQQ 1BCPF 1U4PA 4PMCA 2J7ZA 2JN4A 4G7ZC 5J1ZA 2F0WA 3AB9A 3GD7A 3R8BA 1E0BA 1AP0A 1EEID 2WKDA 4DF7A 1VQ8A 2A6ED 4KY6A 5FKAC 2ZM6Q 4XYQA 3RLOA 3EBEA 4B08A 4HIDA 3RNUA 3Q6SA 4PMWA 3MTSA 3ICEA 5LMUQ 3G7LA 2ICEC 1I4PA 3S17H 2SNSA 4A75A 4K8IA 1QOHA 4A3MG 4UP9A 4POFA 1SNPA 4C3JG 3HG9A 3CC2A 5C4XG 3J80i 3KF8B 4BY7H 3X3MA 2O5IC 2UUBL 2R7ZG 3WOEA 1ET6A 5I6WA 1HNXQ 3HKZB 2VQFQ 1HTLD 2MUYA 4OWTB 1SBBB 3AQQA 1Q7YC 1ZXTA 1DXMA 1HZBA 4KKUA 2BDNA 2GA4B 1KAAA 1NR4A 2Z6KA 3CCEA 2JA7G 4YHHQ 4RWSC 1ESFA 2GN5A 3BDOA 3J7YW 3DM1A 1T5EA 3HFZB 1J5EL 1K8OA 4GNXC 1A63A 5ELEA 1EU4A 4DUZL 4WFN3 3BYTB 2NVYB 4CKCA 1UNSA 4A76A 1D1KA 4BY1B 4DV6Q 1A3UA 1L1OB 4IOAA 4H0LC 3VYRA 1EZ6A 1XNQL 1Z6HA 5C44G 1ONLA 1BVSA 4EQOA 4G4KA 4NDXA 2E5LQ 4FP5D 4KN7C 5GADC 4DR2Q 2JSOA 4DV1Q 3AFPA 3NQIA 1EQQA 5LMNL 1N32Q 1WCMB 1EYAA 3T1YQ 3GTLH 4YCUA 4LF4Q 5JEAH 3K8AA 1Y1WB 3HOWH 4OO1I 2JE6I 4CJ2C 1SNQA 1PFBA 3GP7A 2RQXA 2F4IA 3VR4A 5C3EG 1CZGA 2D0OA 2NYZD 4A3KH 4CDCC 3GTJB 1RF2D 4JW0A 4MIUA 4A3JH 1Y1VB 1WTQA 2IWHA 1CKNB 4KHZA 3FHWA 4A93H 3E5SA 4A3IB 4CKEA 2V1CC 2QW7A 2QKIC 1LTGD 2KA7A 4ZUIA 4L8JA 5M5WH 3I55A 4DR3L 1PTOH 2NVXB 2RDGA 2JYOA 3ULJA 2JA6B 3VA7A 3QG1A 3TSSA 1P8LA 4GN4B 2PMZB 4JI4L 1FVIA 1AEXA 3EQLC 1PTOC 1GM5A 1PFNA 3B6YA 1SYCA 3BJUA 1VQLA 3HOWG 1HUNA 2DN8A 2I5HA 2PZWA 3MXNA 5EGTA 4A3DB 1LYLA 1VMPA 1XX8A 1C9OA 3BZCA 1BR9A 4IUTA 2WAQE 1E2ZA 1M8AA 4A3KG 2JK8A 4DXGA 3CKIB 4MZ9A 5BR8Q 1TQOA 5CORA 2VQEQ 5IOCA 4A3JG 2OEOA 2F0GA 1EWIA 1SNMA 1Y69U 4MNOA 1VQ4A 4DK0A 1CFMA 2JA9A 2YTVA 2E2IH 3OHXC 3TMEA 3S14H 3K7AH 1BXTA 1S4ZA 3H6MA 1N34Q 2Z6BA 5DEHA 2Q8TA 2EYOA 1KLUD 2F0TA 3S1RH 4R4QA 4JBMA 4LAAA 1E24A 1OXXK 4ULLA 1GUGA 3BS1A 4R8NA 2DNCA 1STAA 2Z4IA 4DR1Q 1DONA 2FXQA 4NW2A 2HCCA 1TWCB 3OMCA 1QVFA 1EQVA 4A3BH 4GKKL 4FF4A 4FXKC 1EUJA 1A2UA 3PF4A 2Q2TA 1U9RA 4NXMQ 1TWGH 1CQVA 3HZXA 3M4YA 3TP6A 2VUMG 3KBXA 3S16H 2ID0A 4HCEA 2Z9HA 2UXBL 3QWNA 3S1NH 3JAMc 3A7LA 5E7NA 2E2JB 4EX5A 1VQ7A 4BXXH 3EN2A 4OGQC 5EQ0A 4JV5L 3A0JA 3LWEA 3PO3B 4MN3A 1EY6A 4J6HA 1IBML 1KHIA 2VL6A 4DK3C 5IODA 1EY9A 4RKBA 4A3CH 4H02A 4XTCS 1MJEA 2L5TA 3GTPB 4KKTA 1JT8A 2HT1A 3PUYA 4IQZA 4AQYQ 5BN3A 3TBIB 4LWCA 2F0OA 1D5XC 4QIWB 5T1IA 5LMNW 2IHEA 2IL8A 1DZ1A 3M4OB 1GOZA 3FEWX 1GUTA 1JJCB 3S24A 2G9HD 3KYHC 3E9IA 2EYLA 4C3HB 3WWVA 3HKSA 1KNAA 1RIPA 1JR0D 1YNXA 1GHKA 1UEAB 3BU2A 4N8X1 1DYQA 3NTKA 1A8VA 2PW5A 2SDFA 1QG7A 1ILQA 3CCMA 2Q2HA 2NN6G 2V4DA 4BY1G 3RZDB 1IBKL 3CQZH 2MPMA 2B2YA 1KNEA 2ENBA 3MWYW 3S9WA 1H9MA 1G51A 4A3CG 3FRPB 1VS0A 3J7AF 4KLKA 4DAYA 3R3OA 2RVLA 5CV5A 1FGUA 1GHJA 3D6WA 1YJ9A 3I4MB 2B8GA 2Z0SA 3MC0B 2DNEA 2IY5B 4FO2A 1WYDA 3R93A 3TQYA 1GUOA 1Q82C 4LFBL 3OW7A 1BNZA 5LL6X 1BUVT 1Y1WG 2LFNA 1B8AA 1I94L 4OHJA 5I9OA 4A3LH 3VYTA 2EJGC 1HCZA 5JOBA 1SNCA 4XIGS 4DGZA 1SXTA 1LT6D 3LX0A 2R92G 3T51B 4RFBA 4NB3A 4XT1B 5M5XB 4A3FH 4A4IA 4OWXB 1D2BA 3MFGA 1GJXA 3HOZH 2XRSD 2NZHA 2PO4A 4NXNL 2X69A 1WTVA 4IPDA 4DR5Q 5IT9L 1G2TA 1S5CD 2QF7A 2GVAA 1NMGA 3HOXH 4MTNA 1N36Q 4XYOA 3RUZA 4H44C 2UUAQ 1CKOA 1C4QA 4JI1Q 2VS1A 3MVVA 3HOUB 4J8QA 1V8QA 4IFDG 1Q12A 4QL5A 4HMJA 4DV0Q 4RGTA 2VY3A 2WINB 3EROA 2ZXOA 3C1FA 4DN4M 3NTHA 4PZ6A 3VR2A 4EQPA 4GNXA 1PVOA 1VQHA 4BA1I 4A3DG 1TT2A 3J80E 4RGOS 5IY0A 2CHBD 2PI2E 2Q8IB 3RZOH 3CPWA 2F0KA 3QO2A 4IALA 5IT9E 2HIXA 1YIJA 1HQRD 3SDZA 2M00A 5M3MG 3MHBA 4AH6A 2AQ3B 3TDQA 4A3FG 1PV4A 1FJGL 1MI2A 3I70A 2NVTB 4H13C 4K14A 5KEEA 1U0LA 3H09A 3U4ZA 3RLFA 5EPLA 5TSSA 1KIXA 2EXDA 5IIFA 2IHFA 2KCCA 4P75A 3HOXG 1BBXC 3E0EA 5IP9G 3SVMA 2J0TD 2F0MA 1U5KA 3VR3A 2YU9B 4BBSG 4Y7NB 1QWYA 3NQTA 1VQPA 3PIOA 2MGSA 2BDOA 1HHVA 2UXCL 3CCQA 4KMUC 4V190 2IX1A 4A3MB 2N3SA 4P71A 4C3JB 2EYMA 1KRSA 1I6HH 1SYGA 1YZ6A 5C4XB 4O0AA 1CUKA 2QA4A 2KOLA 4DV7L 2R7ZB 3A8JE 3D3RA 3Q8DA 2KHIA 1BCPB 4FVMA 3H3VH 1VQ6A 5CR3A 5C0XG 1QCBD 2EXZA 5IGEA 4G7OC 2N88A 1D1IA 4BBRH 2VZAA 2F0SA 4R1JA 2JA7B 4DV5L 1SDFA 1TWAH 3ITPA 3H94A 3L7ZC 1B3AA 4LFCQ 1RKNA 2FJ2A 3H3VC 5IE8A 2NN6I 5D65A 2KCTA 3HEJA 4IO9A 4JI2Q 2MO0A 4RA8A 1Y8PB 3ERSX 2N55A 4LF7L 3S17B 2A5HA 1D5ZC 5IYCG 3TEHB 5C44B 1K9MC 1E3PA 2I07B 2EIFA 3A8IE 3QOJA 3M4PA 4L63B 3A5UA 2F4VQ 3E6ZX 3CCUA 3CC7A 2MFIA 4XQNA 2CCZA 2CQOA 4C56C 2QCPX 4LF6Q 2K5NA 4AYBE 1DOMA 4RHSA 1EQTA 5ELCA 5G3LF 2F03A 1PTOD 4GNXB 2XWBB 2BOSA 5M5YH 3E3XA 1JE4A 4B3RL 4CDEC 1JQYD 3PCOB 3L0OA 4BBRG 2NTTA 4B3MQ 5GROA 3X3NA 1OXUA 5BN5A 3NUCA 3V96A 5LHY1 4O1NA 3D8GA 3PSIA 5C3EB 2ALYB 1SJED 1SE8A 3S1MH 2A68D 3KLRA 3FDTA 3NBHA 4RHRA 4JOIA 1GUNA 1EY8A 1XMOQ 4C3IG 1MD2D 3AYHB 3DUZA 4YY3Q 1I4HA 4DXFA 2LS01 5ELFA 2AQ1B 1HH2P 5EKLA 3R2IA 3IKJA
chains in the Genus database with same CATH topology
1C0AA 1VQ9A 4YHHQ 4Y52H 2KHJA 2MQHA 4TVAB 3G6EA 2GN5A 5FJ8H 4X66L 4QGUA 4A3LG 3HFZB 4JI6Q 1J5EL 2D0PA 4JCVE 5IYDG 4GNXC 4JI5Q 5IYBH 1A63A 3H0GH 4IFDI 4UP8A 1UWVA 4GOPC 1TWFH 4DUZL 2LXKA 2F4VL 2AMCB 5GAEC 4JBJA 4A76A 4JI3Q 1I3QH 3J80c 4DV6Q 1KC8C 1L1OB 1YEZA 3ZJYC 1WI5A 3HOZG 4IOAA 4APVA 4IJLA 2JA5H 4RG1A 4LF6L 1XNQL 1HZCA 5GQOA 5C44G 4GLVB 1BVSA 2RHSB 2ZTEA 3F2DA 4HIOA 1Q8KA 2E5LQ 1VQDA 5GADC 4DR2Q 3GDEA 3S15H 4DR5L 4DV1Q 3AFPA 2B3GA 1EQQA 1QUQA 4GLXA 5LMNL 1IBKQ 4B3ML 4JI4Q 4BY1H 1N32Q 2NVYH 1EIYB 3T1YQ 3GTLH 4YCUA 2H5XA 4LF4Q 3U4VA 4OX9Q 2ATWA 4A3EH 4X64L 2K5HA 3K8AA 1PA6A 1HNXL 1L0WA 2Q2UA 3HOWH 4DAYB 1QVGA 4OO1I 2JE6I 3SGIA 2E2JH 4GN5A 3CCLA 1X3EA 4YY3L 5AJ3Q 4IPCA 2B63H 5C3EG 3PO3H 1AH9A 1P16A 4WJ4A 1N33Q 1NTGA 1WCMH 2D0OA 3RR5A 5FJ8G 1L1OC 4A3KH 5ELNA 1VCIA 3F2CA 1XPRA 1LM0A 4QQBX 3PO2H 3HKZG 5IYBG 4A3JH 3H0GG 4KHPQ 1E1OA 1I94Q 1CKNB 4JI6L 4KHZA 3FHWA 5JJLA 4A93H 1NMFA 1Y1WH 1YITA 5FLXc 5M3FH 4X65L 1CSQA 2PQAB 1K8AC 1G6PA 1HJPA 2JEBI 1JE5A 2V1CC 1E22A 3CP0A 4DV4Q 1SN8A 4JI3L 3CPFA 1X3GA 1TXYA 4NPSA 3GTJH 2ZJPA 2R92H 5M5WH 3I55A 4DR3L 3M4OH 3HKZE 4JYAL 4HJAA 1JJGA 1Q46A 3CCSA 3ULJA 3I56A 3CD6A 1NBWA 1KAWA 5FLMH 1WOCA 4EQ5A 4JC0A 4GS3A 4DR2L 5C0XI 4DV1L 4A3IH 1PHJA 4C3HH 4LFAL 1WFQA 1W3SA 1P8LA 4GN4B 3GTMH 3I2ZA 2WAQG 4B3SQ 3KF6A 1FVIA 4JI4L 1N32L 1D7QA 3T1YL 2K75A 3HOYH 4UY8C 1T9HA 1GM5A 3PUWA 3B6YA 4LF4L 2RHQB 2XGTA 3BJUA 1VQLA 2NVXH 3HOWG 2R7DA 3AFQA 3NBHB 2I5HA 4IOCA 2YTXA 2JJQA 1LYLA 1O7IA 1C9OA 1X56A 3BZCA 4JI0Q 2JA6H 4L5TA 4DKAC 3CCJA 3HOVG 2K14A 1MIUA 2WAQE 1WCMG 3UDXA 5AJ3L 4R4OA 2JK8A 3ULLA 3KOJA 2ZTCA 4A3KG 1XJVA 1EYGA 3S1QH 3UDFA 2I5LX 2RCNA 4MZ9A 5JJKA 5BR8Q 1WJJA 4FDBA 3PO2G 1PYBA 2VQEQ 1J6QA 4A3JG 2E2HH 1HNWQ 3CF5A 3CW2C 2I0QA 2YTYA 1LTLA 2PI2A 5M3FG 1EWIA 4MNOA 1VQ4A 4A3DH 4GOPB 4JV5Q 4KI0A 4P74A 1K0RA 2JA9A 4HJ7A 2YTVA 3OTOQ 1QZGA 2E2IH 1G291 2AWNA 3MEFA 4DR7Q 1FJGQ 3EIVA 3S14H 3K7AH 4DK6C 4OXPA 5M3MH 1N34Q 1HR0Q 3DLLA 3UE1A 1VQ5A 4DR6L 1Y1VG 3JAMi 3I4OA 3FKIH 4LFCL 1S40A 1KXLA 3PF5A 1PH1A 2OQ0A 5DLQE 4R4QA 3S1RH 4JBMA 2UXDQ 4JI8L 1A62A 4A3IG 3ER0A 1KRTA 4L5RC 1XMQL 1E24A 1OXXK 2ES2A 5J3BA 2K4KA 3A74A 3CMAA 4JI2L 4DR4Q 2I5MX 1BBWA 1VQBA 3M7NA 1DGSA 4L5SA 3HOYG 3CC4A 4GN3B 2Z6KC 5IP9H 3FP9A 2FXQA 4HIKA 1D8LA 4DR1Q 5M5XH 2VNUD 1E1TA 3U58A 1VQGA 1QVFA 1Y14B 4BBSH 4A3BH 4GKKL 4DV2Q 2A8VA 2ZM6L 3NELA 2JA6G 1B7YB 1EUJA 1PH7A 2CFMA 4B3TQ 3STBC 3A5ZB 3PF4A 2Q2TA 4X6AH 2IT1A 4NXMQ 1FL0A 1TWGH 1YI2A 1GD7A 2VUMG 3S16H 2ID0A 5LMUL 5BR8L 4DV7Q 5IT9c 1X55A 2VQEL 4RMFA 4YWMA 2UXBL 1TWCH 2K5VA 1A0IA 1EIFA 2F3IA 3S1NH 3JAMc 5E7NA 3S2HH 4IPHA 4EX5A 1VQ7A 1MKHA 3EN2A 3HOUH 4BXXH 1YHAA 1QZHA 4R4IA 1XNRQ 3A0JA 4BY7G 4JV5L 1GKHA 2PMZE 2D62A 4HJ9A 1SFOH 1E7ZA 3OTOL 4DR7L 1IBML 2OTJA 1OXVA 2AKWB 4TQUS 1KHIA 2VL6A 2CWPA 4DK3C 4DV5Q 3FKIG 1GO3E 1HR0L 3E9HA 2GVBA 2ASBA 3F1ZA 4H02A 4A3CH 4XTCS 1IBLQ 3NEMA 1MJEA 4HIMA 2VQFL 1XMOL 1BBUA 1Q86C 1JT8A 2HT1A 1OTCA 2PNHA 1PH8A 1XTDA 3PUYA 3LGJA 4AQYQ 4LWCA 4IPGA 4LFBQ 5LMNW 3OW2A 2IHEA 4YHHL 4LF5Q 3G71A 3L2PA 1K73C 2KBNA 1YJNA 3KF6B 4DR1L 2NVTH 3TS2A 1JJCB 1YVCA 4DPGA 2R93H 2N49A 3S24A 1K83H 3GTKH 4JI5L 4C2MH 3KDFB 3GTPH 1VQEA 3KYHC 4DV2L 3D31A 1XPOA 1KL9A 3E9IA 5JJIA 4OWWB 5IYCH 3WWVA 2HHHQ 3HKSA 3S2DH 1RIPA 2B29A 3TREA 4R4CA 2JA5G 4NXML 3J7A5 1L1OA 2OCEA 4DV6L 1C7YA 3IRBA 1YNXA 1PH2A 2N78A 1NJIC 3BU2A 1NY4A 2YU9H 4Y7NH 1A8VA 3NENA 1JB7A 4NXNQ 3M3YH 2LSSA 3AEVA 1UE7A 3K80C 2Q2HA 2AHOB 3CCMA 2E5LL 5HY6A 2QGQA 4B3RQ 1VQCA 1L2FA 2NN6G 2YV5A 4BY1G 4A3MH 1XNRL 4PG3A 1X9NA 1IBKL 1UE6A 3CQZH 4C3JH 3M85A 5K36G 3DM3A 4L5QA 5C4XH 1G51A 3J81i 4A3CG 5JEAG 4A3EG 1VS0A 2YYZA 3OYYA 4OX9L 2C35B 4DV3Q 1HNZQ 1IBLL 4KLKA 2NVQH 1QVCA 2WP8J 1X54A 4PZ8A 1FGUA 1YJ9A 1VQMA 1R9TH 2B63G 1ASZA 3PO3G 2Z0SA 4AQYL 1IL2A 1HZ9A 3PUVA 4C3IH 3RZDH 1N8RC 4POGA 1NE3A 1N33L 2IY5B 1WYDA 3TQYA 1Q82C 4LFBL 1SROA 4LF5L 4WJ3M 1EQRA 2Y0SG 1PFSA 3F8TA 4X66Q 2JA7H 1Y1WG 4A93G 1IZ6A 1YHBA 4KHPL 1CKNA 1B8AA 1J5EQ 1I94L 2MNAA 2BA1A 1RL2A 3CAMA 4A3LH 2PQAA 1CKMA 5IYDH 2KENA 1W2BA 4JI7Q 3I4MH 1PH5A 2EQSA 2HHHL 4XIGS 1VQJA 5HGQA 5IWAQ 1Z9FA 4DV4L 2R92G 1V9PA 5EAYA 3T1HQ 4NB3A 4A3FH 2Y0SE 1KD1C 2XTIA 4A4IA 4GKJQ 4LF9Q 1OXTA 1UEBA 4OWXB 3J81c 4LF8Q 3HOZH 2NZHA 1VQAA 3H3VI 1SMXA 2IX0A 3K7UC 4NXNL 5FLMG 4JOIC 2OQKA 1UE5A 5C44H 1EOVA 4IPDA 2VW9A 4DR5Q 4QIWE 2QEXA 4A3GH 5JEAJ 3JC66 2GVAA 1NMGA 3HOXH 1QUQB 4B3SL 4MTNA 3PUXA 4ALPA 1N36Q 1I5FA 3K0XA 4QY7A 4YCWA 5H1SE 2UUAQ 2E8GA 1CKOA 3UDIA 1Z47A 4JI1Q 4HJ8A 2VS1A 1K3RA 3U50C 2UXCQ 4UP7A 4DV3L 2A19A 1PH9A 3PIPA 4IFDG 2ZJQA 1Q12A 4QL5A 3CCVA 4JI0L 4DV0Q 2VY3A 1X6OA 1YHQA 2N8NA 4PZ6A 5C3EH 1HNWL 1PVOA 4GNXA 1Q1BA 2A1AA 1VQHA 4BA1I 1OXSC 4A3DG 4DNIA 5IY0A 1X65A 1VQNA 2PI2E 3RZOH 4GOPA 3W1BA 3I4MG 3KLWA 3CPWA 4X65Q 4YCVA 1YIJA 2HIXA 2BH2A 3W5OA 4JI7L 3K81C 2DGYA 3PV0A 4DUYQ 5GAGC 5M3MG 1AE2A 3RLNA 1Q1EA 4AH6A 5IWAL 2BH8A 4A3FG 1PV4A 1FJGL 3T1HL 1N34L 1U0LA 2K52A 2OWOA 4DR3Q 4GKJL 1PH4A 2F52A 2HIVA 4LF9L 4X62Q 3UDGA 3U4ZA 2WFWA 3RLFA 4LF8L 2UXDL 2RF4A 4R4TA 1KIXA 2EXDA 1GVPA 1MJCA 1PH6A 4JYAQ 5C4JH 4OO1G 2IHFA 1I50H 4A3GG 1V1QA 1AE3A 2AWOA 1HZAA 4P75A 3HOXG 3TS0A 2ZTDA 4LFAQ 4DR4L 3E0EA 5IP9G 2JEAI 2LXJA 3D0FA 1U5KA 4O2DA 4LF7Q 3GTOH 1IYJB 1CSPA 2L15A 4P72A 4ME3A 3STBD 1SRUA 1N36L 4BBSG 4DAMA 1N9WA 2UUAL 4A3BG 4IFDJ 4JI1L 3GO5A 1HR0W 1VQPA 2JA8H 3PIOA 2UXCL 1LUZA 3CCQA 3KJOA 2OTLA 2IX1A 2N3SA 3MXNB 4LUOA 4P71A 1PH3A 4B3TL 3BZKA 4DV0L 4K0KQ 3M9BA 1KRSA 1I6HH 3PUZA 1YZ6A 4O0AA 4P73A 1CUKA 2QA4A 1VQKA 3HOVH 3H15A 4DV7L 3ULPA 1JJ2A 3Q8DA 3KFUA 4BXXG 3HOUG 1S3OA 1YBYA 1VQFA 3W1GA 2KHIA 1ASYA 4IJHA 1PYSB 1V43A 2UUCQ 1YJWA 3H3VH 1VQ6A 5C0XG 3UE0A 1Q81C 1SR3A 3G48A 2NZOA 1XPUA 4DUYL 1BKBA 4BBRH 1H95A 2MO1A 2VZAA 2WB1G 4R1JA 4JBWA 1IXRA 2UUBQ 3CCRA 4DV5L 1EFWA 2BA0A 2R7FA 4DR6Q 3M4QA 1TWAH 2ZJRA 4QJFA 5GAHC 3L7ZC 2R7ZH 4LFCQ 3GTQH 4X62L 4BA2I 1Y1VH 3F2BA 3I7FA 4YWKA 4JI8Q 1S72A 2UU9Q 1TWHH 1KQSA 4J15A 4GLAC 1SLJA 3RN5A 5IE8A 1XMQQ 2NN6I 5IP7H 2KCTA 2Q2IA 4JI2Q 4IO9A 3I4NH 2MO0A 2WB1E 4LUZA 3GTGH 3ERSX 2R93G 4LF7L 3VDYA 2JA8G 1M1KC 3GD7A 4HJ5A 4AYBG 4OONA 3KDFA 4PZ7A 5IYCG 1B70B 3TEHB 2CKZB 1K9MC 1E3PA 4GKKQ 1VQ8A 2ZM6Q 2EIFA 4UPAA 4LNQA 3RLOA 3EBEA 3G4SA 1JMCA 3M4PA 4DUZQ 3A5UA 2F4VQ 3CCUA 3CC7A 2MFIA 4K0KL 4HIDA 2CCZA 3RNUA 2CQOA 4PMWA 2JQOA 4LF6Q 3ICEA 1XNQQ 2K5NA 4AYBE 5LMUQ 2KCMA 3J7ZC 3S17H 2UXBQ 4A75A 5C0XJ 2VUMH 1VQIA 4GNXB 4A3MG 4UP9A 5M5YH 4POFA 4LW1A 3TRZA 2K50A 4B3RL 2UUCL 1M90C 3PCOB 3L0OA 5LMNQ 4BBRG 3CXCA 3J80i 3KF8B 5GROA 3CC2A 1VQOA 1OXUA 4B3MQ 4BY7H 5C4XG 5ELOA 3PSIA 2CWAA 2ALYB 1K8GA 4LUVA 1IBMQ 4JG2A 1SE8A 2UUBL 3S1MH 2R7ZG 3KJPA 2R6GA 2HQLA 4X64Q 2DUDA 1X3FA 4YWLA 1HNXQ 1HNZL 4JOIA 3J81j 2VQFQ 1XMOQ 4OWTB 5IP7G 3AQQA 3AYHB 3CMEA 3I4NG 2UU9L 1Q7YC 1UE1A 4YY3Q 3PGZA 1HZBA 4AIMA 4JBKA 1HH2P 2Z6KA 3RN2A 3CCEA 2JA7G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C0A A;  1VQ9 A;  4YHH Q;  4Y52 H;  2KHJ A;  2MQH A;  4TVA B;  3G6E A;  2GN5 A;  5FJ8 H;  4X66 L;  4QGU A;  4A3L G;  3HFZ B;  4JI6 Q;  1J5E L;  2D0P A;  4JCV E;  5IYD G;  4GNX C;  4JI5 Q;  5IYB H;  1A63 A;  3H0G H;  4IFD I;  4UP8 A;  1UWV A;  4GOP C;  1TWF H;  4DUZ L;  2LXK A;  2F4V L;  2AMC B;  5GAE C;  4JBJ A;  4A76 A;  4JI3 Q;  1I3Q H;  3J80 c;  4DV6 Q;  1KC8 C;  1L1O B;  1YEZ A;  3ZJY C;  1WI5 A;  3HOZ G;  4IOA A;  4APV A;  4IJL A;  2JA5 H;  4RG1 A;  4LF6 L;  1XNQ L;  1HZC A;  5GQO A;  5C44 G;  4GLV B;  1BVS A;  2RHS B;  2ZTE A;  3F2D A;  4HIO A;  1Q8K A;  2E5L Q;  1VQD A;  5GAD C;  4DR2 Q;  3GDE A;  3S15 H;  4DR5 L;  4DV1 Q;  3AFP A;  2B3G A;  1EQQ A;  1QUQ A;  4GLX A;  5LMN L;  1IBK Q;  4B3M L;  4JI4 Q;  4BY1 H;  1N32 Q;  2NVY H;  1EIY B;  3T1Y Q;  3GTL H;  4YCU A;  2H5X A;  4LF4 Q;  3U4V A;  4OX9 Q;  2ATW A;  4A3E H;  4X64 L;  2K5H A;  3K8A A;  1PA6 A;  1HNX L;  1L0W A;  2Q2U A;  3HOW H;  4DAY B;  1QVG A;  4OO1 I;  2JE6 I;  3SGI A;  2E2J H;  4GN5 A;  3CCL A;  1X3E A;  4YY3 L;  5AJ3 Q;  4IPC A;  2B63 H;  5C3E G;  3PO3 H;  1AH9 A;  1P16 A;  4WJ4 A;  1N33 Q;  1NTG A;  1WCM H;  2D0O A;  3RR5 A;  5FJ8 G;  1L1O C;  4A3K H;  5ELN A;  1VCI A;  3F2C A;  1XPR A;  1LM0 A;  4QQB X;  3PO2 H;  3HKZ G;  5IYB G;  4A3J H;  3H0G G;  4KHP Q;  1E1O A;  1I94 Q;  1CKN B;  4JI6 L;  4KHZ A;  3FHW A;  5JJL A;  4A93 H;  1NMF A;  1Y1W H;  1YIT A;  5FLX c;  5M3F H;  4X65 L;  1CSQ A;  2PQA B;  1K8A C;  1G6P A;  1HJP A;  2JEB I;  1JE5 A;  2V1C C;  1E22 A;  3CP0 A;  4DV4 Q;  1SN8 A;  4JI3 L;  3CPF A;  1X3G A;  1TXY A;  4NPS A;  3GTJ H;  2ZJP A;  2R92 H;  5M5W H;  3I55 A;  4DR3 L;  3M4O H;  3HKZ E;  4JYA L;  4HJA A;  1JJG A;  1Q46 A;  3CCS A;  3ULJ A;  3I56 A;  3CD6 A;  1NBW A;  1KAW A;  5FLM H;  1WOC A;  4EQ5 A;  4JC0 A;  4GS3 A;  4DR2 L;  5C0X I;  4DV1 L;  4A3I H;  1PHJ A;  4C3H H;  4LFA L;  1WFQ A;  1W3S A;  1P8L A;  4GN4 B;  3GTM H;  3I2Z A;  2WAQ G;  4B3S Q;  3KF6 A;  1FVI A;  4JI4 L;  1N32 L;  1D7Q A;  3T1Y L;  2K75 A;  3HOY H;  4UY8 C;  1T9H A;  1GM5 A;  3PUW A;  3B6Y A;  4LF4 L;  2RHQ B;  2XGT A;  3BJU A;  1VQL A;  2NVX H;  3HOW G;  2R7D A;  3AFQ A;  3NBH B;  2I5H A;  4IOC A;  2YTX A;  2JJQ A;  1LYL A;  1O7I A;  1C9O A;  1X56 A;  3BZC A;  4JI0 Q;  2JA6 H;  4L5T A;  4DKA C;  3CCJ A;  3HOV G;  2K14 A;  1MIU A;  2WAQ E;  1WCM G;  3UDX A;  5AJ3 L;  4R4O A;  2JK8 A;  3ULL A;  3KOJ A;  2ZTC A;  4A3K G;  1XJV A;  1EYG A;  3S1Q H;  3UDF A;  2I5L X;  2RCN A;  4MZ9 A;  5JJK A;  5BR8 Q;  1WJJ A;  4FDB A;  3PO2 G;  1PYB A;  2VQE Q;  1J6Q A;  4A3J G;  2E2H H;  1HNW Q;  3CF5 A;  3CW2 C;  2I0Q A;  2YTY A;  1LTL A;  2PI2 A;  5M3F G;  1EWI A;  4MNO A;  1VQ4 A;  4A3D H;  4GOP B;  4JV5 Q;  4KI0 A;  4P74 A;  1K0R A;  2JA9 A;  4HJ7 A;  2YTV A;  3OTO Q;  1QZG A;  2E2I H;  1G29 1;  2AWN A;  3MEF A;  4DR7 Q;  1FJG Q;  3EIV A;  3S14 H;  3K7A H;  4DK6 C;  4OXP A;  5M3M H;  1N34 Q;  1HR0 Q;  3DLL A;  3UE1 A;  1VQ5 A;  4DR6 L;  1Y1V G;  3JAM i;  3I4O A;  3FKI H;  4LFC L;  1S40 A;  1KXL A;  3PF5 A;  1PH1 A;  2OQ0 A;  5DLQ E;  4R4Q A;  3S1R H;  4JBM A;  2UXD Q;  4JI8 L;  1A62 A;  4A3I G;  3ER0 A;  1KRT A;  4L5R C;  1XMQ L;  1E24 A;  1OXX K;  2ES2 A;  5J3B A;  2K4K A;  3A74 A;  3CMA A;  4JI2 L;  4DR4 Q;  2I5M X;  1BBW A;  1VQB A;  3M7N A;  1DGS A;  4L5S A;  3HOY G;  3CC4 A;  4GN3 B;  2Z6K C;  5IP9 H;  3FP9 A;  2FXQ A;  4HIK A;  1D8L A;  4DR1 Q;  5M5X H;  2VNU D;  1E1T A;  3U58 A;  1VQG A;  1QVF A;  1Y14 B;  4BBS H;  4A3B H;  4GKK L;  4DV2 Q;  2A8V A;  2ZM6 L;  3NEL A;  2JA6 G;  1B7Y B;  1EUJ A;  1PH7 A;  2CFM A;  4B3T Q;  3STB C;  3A5Z B;  3PF4 A;  2Q2T A;  4X6A H;  2IT1 A;  4NXM Q;  1FL0 A;  1TWG H;  1YI2 A;  1GD7 A;  2VUM G;  3S16 H;  2ID0 A;  5LMU L;  5BR8 L;  4DV7 Q;  5IT9 c;  1X55 A;  2VQE L;  4RMF A;  4YWM A;  2UXB L;  1TWC H;  2K5V A;  1A0I A;  1EIF A;  2F3I A;  3S1N H;  3JAM c;  5E7N A;  3S2H H;  4IPH A;  4EX5 A;  1VQ7 A;  1MKH A;  3EN2 A;  3HOU H;  4BXX H;  1YHA A;  1QZH A;  4R4I A;  1XNR Q;  3A0J A;  4BY7 G;  4JV5 L;  1GKH A;  2PMZ E;  2D62 A;  4HJ9 A;  1SFO H;  1E7Z A;  3OTO L;  4DR7 L;  1IBM L;  2OTJ A;  1OXV A;  2AKW B;  4TQU S;  1KHI A;  2VL6 A;  2CWP A;  4DK3 C;  4DV5 Q;  3FKI G;  1GO3 E;  1HR0 L;  3E9H A;  2GVB A;  2ASB A;  3F1Z A;  4H02 A;  4A3C H;  4XTC S;  1IBL Q;  3NEM A;  1MJE A;  4HIM A;  2VQF L;  1XMO L;  1BBU A;  1Q86 C;  1JT8 A;  2HT1 A;  1OTC A;  2PNH A;  1PH8 A;  1XTD A;  3PUY A;  3LGJ A;  4AQY Q;  4LWC A;  4IPG A;  4LFB Q;  5LMN W;  3OW2 A;  2IHE A;  4YHH L;  4LF5 Q;  3G71 A;  3L2P A;  1K73 C;  2KBN A;  1YJN A;  3KF6 B;  4DR1 L;  2NVT H;  3TS2 A;  1JJC B;  1YVC A;  4DPG A;  2R93 H;  2N49 A;  3S24 A;  1K83 H;  3GTK H;  4JI5 L;  4C2M H;  3KDF B;  3GTP H;  1VQE A;  3KYH C;  4DV2 L;  3D31 A;  1XPO A;  1KL9 A;  3E9I A;  5JJI A;  4OWW B;  5IYC H;  3WWV A;  2HHH Q;  3HKS A;  3S2D H;  1RIP A;  2B29 A;  3TRE A;  4R4C A;  2JA5 G;  4NXM L;  3J7A 5;  1L1O A;  2OCE A;  4DV6 L;  1C7Y A;  3IRB A;  1YNX A;  1PH2 A;  2N78 A;  1NJI C;  3BU2 A;  1NY4 A;  2YU9 H;  4Y7N H;  1A8V A;  3NEN A;  1JB7 A;  4NXN Q;  3M3Y H;  2LSS A;  3AEV A;  1UE7 A;  3K80 C;  2Q2H A;  2AHO B;  3CCM A;  2E5L L;  5HY6 A;  2QGQ A;  4B3R Q;  1VQC A;  1L2F A;  2NN6 G;  2YV5 A;  4BY1 G;  4A3M H;  1XNR L;  4PG3 A;  1X9N A;  1IBK L;  1UE6 A;  3CQZ H;  4C3J H;  3M85 A;  5K36 G;  3DM3 A;  4L5Q A;  5C4X H;  1G51 A;  3J81 i;  4A3C G;  5JEA G;  4A3E G;  1VS0 A;  2YYZ A;  3OYY A;  4OX9 L;  2C35 B;  4DV3 Q;  1HNZ Q;  1IBL L;  4KLK A;  2NVQ H;  1QVC A;  2WP8 J;  1X54 A;  4PZ8 A;  1FGU A;  1YJ9 A;  1VQM A;  1R9T H;  2B63 G;  1ASZ A;  3PO3 G;  2Z0S A;  4AQY L;  1IL2 A;  1HZ9 A;  3PUV A;  4C3I H;  3RZD H;  1N8R C;  4POG A;  1NE3 A;  1N33 L;  2IY5 B;  1WYD A;  3TQY A;  1Q82 C;  4LFB L;  1SRO A;  4LF5 L;  4WJ3 M;  1EQR A;  2Y0S G;  1PFS A;  3F8T A;  4X66 Q;  2JA7 H;  1Y1W G;  4A93 G;  1IZ6 A;  1YHB A;  4KHP L;  1CKN A;  1B8A A;  1J5E Q;  1I94 L;  2MNA A;  2BA1 A;  1RL2 A;  3CAM A;  4A3L H;  2PQA A;  1CKM A;  5IYD H;  2KEN A;  1W2B A;  4JI7 Q;  3I4M H;  1PH5 A;  2EQS A;  2HHH L;  4XIG S;  1VQJ A;  5HGQ A;  5IWA Q;  1Z9F A;  4DV4 L;  2R92 G;  1V9P A;  5EAY A;  3T1H Q;  4NB3 A;  4A3F H;  2Y0S E;  1KD1 C;  2XTI A;  4A4I A;  4GKJ Q;  4LF9 Q;  1OXT A;  1UEB A;  4OWX B;  3J81 c;  4LF8 Q;  3HOZ H;  2NZH A;  1VQA A;  3H3V I;  1SMX A;  2IX0 A;  3K7U C;  4NXN L;  5FLM G;  4JOI C;  2OQK A;  1UE5 A;  5C44 H;  1EOV A;  4IPD A;  2VW9 A;  4DR5 Q;  4QIW E;  2QEX A;  4A3G H;  5JEA J;  3JC6 6;  2GVA A;  1NMG A;  3HOX H;  1QUQ B;  4B3S L;  4MTN A;  3PUX A;  4ALP A;  1N36 Q;  1I5F A;  3K0X A;  4QY7 A;  4YCW A;  5H1S E;  2UUA Q;  2E8G A;  1CKO A;  3UDI A;  1Z47 A;  4JI1 Q;  4HJ8 A;  2VS1 A;  1K3R A;  3U50 C;  2UXC Q;  4UP7 A;  4DV3 L;  2A19 A;  1PH9 A;  3PIP A;  4IFD G;  2ZJQ A;  1Q12 A;  4QL5 A;  3CCV A;  4JI0 L;  4DV0 Q;  2VY3 A;  1X6O A;  1YHQ A;  2N8N A;  4PZ6 A;  5C3E H;  1HNW L;  1PVO A;  4GNX A;  1Q1B A;  2A1A A;  1VQH A;  4BA1 I;  1OXS C;  4A3D G;  4DNI A;  5IY0 A;  1X65 A;  1VQN A;  2PI2 E;  3RZO H;  4GOP A;  3W1B A;  3I4M G;  3KLW A;  3CPW A;  4X65 Q;  4YCV A;  1YIJ A;  2HIX A;  2BH2 A;  3W5O A;  4JI7 L;  3K81 C;  2DGY A;  3PV0 A;  4DUY Q;  5GAG C;  5M3M G;  1AE2 A;  3RLN A;  1Q1E A;  4AH6 A;  5IWA L;  2BH8 A;  4A3F G;  1PV4 A;  1FJG L;  3T1H L;  1N34 L;  1U0L A;  2K52 A;  2OWO A;  4DR3 Q;  4GKJ L;  1PH4 A;  2F52 A;  2HIV A;  4LF9 L;  4X62 Q;  3UDG A;  3U4Z A;  2WFW A;  3RLF A;  4LF8 L;  2UXD L;  2RF4 A;  4R4T A;  1KIX A;  2EXD A;  1GVP A;  1MJC A;  1PH6 A;  4JYA Q;  5C4J H;  4OO1 G;  2IHF A;  1I50 H;  4A3G G;  1V1Q A;  1AE3 A;  2AWO A;  1HZA A;  4P75 A;  3HOX G;  3TS0 A;  2ZTD A;  4LFA Q;  4DR4 L;  3E0E A;  5IP9 G;  2JEA I;  2LXJ A;  3D0F A;  1U5K A;  4O2D A;  4LF7 Q;  3GTO H;  1IYJ B;  1CSP A;  2L15 A;  4P72 A;  4ME3 A;  3STB D;  1SRU A;  1N36 L;  4BBS G;  4DAM A;  1N9W A;  2UUA L;  4A3B G;  4IFD J;  4JI1 L;  3GO5 A;  1HR0 W;  1VQP A;  2JA8 H;  3PIO A;  2UXC L;  1LUZ A;  3CCQ A;  3KJO A;  2OTL A;  2IX1 A;  2N3S A;  3MXN B;  4LUO A;  4P71 A;  1PH3 A;  4B3T L;  3BZK A;  4DV0 L;  4K0K Q;  3M9B A;  1KRS A;  1I6H H;  3PUZ A;  1YZ6 A;  4O0A A;  4P73 A;  1CUK A;  2QA4 A;  1VQK A;  3HOV H;  3H15 A;  4DV7 L;  3ULP A;  1JJ2 A;  3Q8D A;  3KFU A;  4BXX G;  3HOU G;  1S3O A;  1YBY A;  1VQF A;  3W1G A;  2KHI A;  1ASY A;  4IJH A;  1PYS B;  1V43 A;  2UUC Q;  1YJW A;  3H3V H;  1VQ6 A;  5C0X G;  3UE0 A;  1Q81 C;  1SR3 A;  3G48 A;  2NZO A;  1XPU A;  4DUY L;  1BKB A;  4BBR H;  1H95 A;  2MO1 A;  2VZA A;  2WB1 G;  4R1J A;  4JBW A;  1IXR A;  2UUB Q;  3CCR A;  4DV5 L;  1EFW A;  2BA0 A;  2R7F A;  4DR6 Q;  3M4Q A;  1TWA H;  2ZJR A;  4QJF A;  5GAH C;  3L7Z C;  2R7Z H;  4LFC Q;  3GTQ H;  4X62 L;  4BA2 I;  1Y1V H;  3F2B A;  3I7F A;  4YWK A;  4JI8 Q;  1S72 A;  2UU9 Q;  1TWH H;  1KQS A;  4J15 A;  4GLA C;  1SLJ A;  3RN5 A;  5IE8 A;  1XMQ Q;  2NN6 I;  5IP7 H;  2KCT A;  2Q2I A;  4JI2 Q;  4IO9 A;  3I4N H;  2MO0 A;  2WB1 E;  4LUZ A;  3GTG H;  3ERS X;  2R93 G;  4LF7 L;  3VDY A;  2JA8 G;  1M1K C;  3GD7 A;  4HJ5 A;  4AYB G;  4OON A;  3KDF A;  4PZ7 A;  5IYC G;  1B70 B;  3TEH B;  2CKZ B;  1K9M C;  1E3P A;  4GKK Q;  1VQ8 A;  2ZM6 Q;  2EIF A;  4UPA A;  4LNQ A;  3RLO A;  3EBE A;  3G4S A;  1JMC A;  3M4P A;  4DUZ Q;  3A5U A;  2F4V Q;  3CCU A;  3CC7 A;  2MFI A;  4K0K L;  4HID A;  2CCZ A;  3RNU A;  2CQO A;  4PMW A;  2JQO A;  4LF6 Q;  3ICE A;  1XNQ Q;  2K5N A;  4AYB E;  5LMU Q;  2KCM A;  3J7Z C;  3S17 H;  2UXB Q;  4A75 A;  5C0X J;  2VUM H;  1VQI A;  4GNX B;  4A3M G;  4UP9 A;  5M5Y H;  4POF A;  4LW1 A;  3TRZ A;  2K50 A;  4B3R L;  2UUC L;  1M90 C;  3PCO B;  3L0O A;  5LMN Q;  4BBR G;  3CXC A;  3J80 i;  3KF8 B;  5GRO A;  3CC2 A;  1VQO A;  1OXU A;  4B3M Q;  4BY7 H;  5C4X G;  5ELO A;  3PSI A;  2CWA A;  2ALY B;  1K8G A;  4LUV A;  1IBM Q;  4JG2 A;  1SE8 A;  2UUB L;  3S1M H;  2R7Z G;  3KJP A;  2R6G A;  2HQL A;  4X64 Q;  2DUD A;  1X3F A;  4YWL A;  1HNX Q;  1HNZ L;  4JOI A;  3J81 j;  2VQF Q;  1XMO Q;  4OWT B;  5IP7 G;  3AQQ A;  3AYH B;  3CME A;  3I4N G;  2UU9 L;  1Q7Y C;  1UE1 A;  4YY3 Q;  3PGZ A;  1HZB A;  4AIM A;  4JBK A;  1HH2 P;  2Z6K A;  3RN2 A;  3CCE A;  2JA7 G; 
#chains in the Genus database with same CATH topology
 2RSN A;  1OO9 B;  2KHJ A;  4X66 L;  1K3B C;  1ENC A;  4JI6 Q;  5IYD G;  1LTS D;  4JCV E;  4JI5 Q;  3H0G H;  1ILP A;  3A7A B;  4HN7 A;  4IFD I;  1UWV A;  2CH4 W;  2LXK A;  3GTO B;  5GAE C;  4JBJ A;  4KJO A;  3J80 c;  1EU3 A;  3GTL B;  4JVZ A;  1ICW A;  4G7H C;  4APV A;  4IJL A;  2JA5 H;  2QEJ C;  2F0L A;  2RHS B;  2K5W A;  3HOW B;  4HIO A;  3SK4 A;  1EY4 A;  2HD3 A;  1G8Z D;  2B3G A;  1BO0 A;  2RSO A;  4A3K B;  2SNM A;  4A3J B;  4OX9 Q;  5C5L A;  4KTA A;  4A3E H;  1CI3 M;  1HQM C;  4ID6 A;  1HNX L;  1L0W A;  2Q2U A;  2K05 A;  3VA5 A;  1JIC A;  3SGI A;  1WTO A;  2B63 H;  4WJ4 A;  1B44 D;  3GTQ B;  4IUQ A;  1EWH A;  3H0G G;  1E1O A;  1TWH B;  3OOC A;  5KRU A;  4DA2 A;  5JPN C;  5DM6 3;  1V1P A;  1YIT A;  5FLX c;  4FXD A;  3ND8 A;  1CSQ A;  2PQA B;  3HP3 A;  5IGG A;  1Q8I A;  1PRT F;  2JEB I;  3GTG B;  1JE5 A;  2D5D A;  1F2M A;  3CP0 A;  2A69 D;  3NTI A;  4TKO B;  2CQA A;  1EY5 A;  3CPF A;  2A73 B;  2O2L D;  5CV8 A;  3QB3 A;  2DJF C;  3KUP A;  4JYA L;  1JJG A;  1Q46 A;  3I56 A;  3H91 A;  1NBW A;  4DR2 L;  4JC0 A;  4GS3 A;  5C0X I;  4DV1 L;  4LFA L;  1EOT A;  4ABN A;  2EZV A;  5E4W C;  4FXG C;  3GTM H;  2WAQ G;  3BYY B;  1N32 L;  3DWP A;  3T1Y L;  2K75 A;  2EVB A;  2KEC A;  5KNB A;  4P2C B;  1K0S A;  4UY8 C;  2VUM B;  3O13 A;  3PUW A;  4LF4 L;  2RHQ B;  3BDC A;  1KDB A;  2OF1 A;  2R7D A;  4KHV A;  3NBH B;  5CMD A;  4IOC A;  1AZP A;  2KVM A;  3N6R A;  1R4P B;  1S5B D;  1X56 A;  3SR1 A;  4JI0 Q;  3D4R A;  4DKA C;  3CCJ A;  3HOV G;  3OMG A;  1XJV A;  2ZTC A;  3T16 A;  3DMU A;  4ZQ3 A;  1Y8N B;  2I5L X;  5JJK A;  1J6Q A;  1PZJ D;  4K5W A;  1TS4 A;  4KK7 A;  3CW2 C;  2I0Q A;  3PQI A;  1LTL A;  1SE2 A;  1O80 A;  3W2D A;  2LKV A;  4GOP B;  3EJI A;  4HSV A;  1K0R A;  1QZG A;  1G29 1;  3MEF A;  2L12 A;  1C8C A;  1IKL A;  4KY5 A;  5ELD A;  1VQ5 A;  3V05 A;  4QCL A;  3MFY A;  1QNK A;  1B4O A;  1ZKO A;  2OQ0 A;  3ND9 A;  1F9R A;  5DAU A;  2UXD Q;  1TWF B;  2L0C A;  3ER0 A;  4L5R C;  2K4K A;  2PQE A;  2I5M X;  2EY5 A;  1BBW A;  3T56 B;  2J4X A;  1DGS A;  3QR8 A;  5D3D A;  3CC4 A;  4HIK A;  4QF4 A;  1VQG A;  4DV2 Q;  3S15 B;  3HS0 C;  1B7Y B;  2B2T A;  1STE A;  4F7X A;  1FL0 A;  1R4Q B;  4NP5 A;  5BR8 L;  2VQE L;  4IUN A;  2XWJ B;  1YHA A;  3VR6 A;  1QZH A;  1XNR Q;  4BY7 G;  4ZYS A;  2F0F A;  1V1P B;  2D62 A;  1SFO H;  1E7Z A;  3A55 A;  4ZCK A;  1H9R A;  1OXV A;  2EYH A;  2EY1 A;  3E9H A;  1IBL Q;  1HFG A;  4IN3 A;  1EY7 A;  5LL6 S;  1LT4 D;  1OTC A;  1FD7 D;  2PNH A;  3M7G A;  3IFD A;  1H9S A;  2MP1 A;  2K04 A;  1KTK A;  4WJW A;  1RCV D;  4LMQ D;  4OEL B;  3OW2 A;  2KHS A;  2R92 B;  3NWS A;  4LF5 Q;  2EE1 A;  2KBN A;  5I6Y A;  4DR1 L;  4DPG A;  2R93 H;  2TSS A;  3GTK H;  1JWU D;  2B29 A;  4NXM L;  2OCE A;  1PH2 A;  2N78 A;  1NJI C;  5KIX A;  1PTO F;  4ODG A;  2AHO B;  2XNA C;  1K8M A;  3DXJ C;  4PG3 A;  3S1Q B;  2RBM A;  1JOO A;  3DM3 A;  3I3C A;  3NBI A;  5JEA G;  2K28 A;  2X6L A;  1MSG A;  3MEH A;  4G57 A;  2NVQ H;  2WP8 J;  3C46 A;  3RD4 A;  4AQY L;  4QUF A;  1IL2 A;  3PUV A;  4RAU C;  1N33 L;  2A68 C;  5M3M B;  1CK1 A;  4A3F B;  1SRO A;  4WJ3 M;  1EQR A;  1PFS A;  2CW0 D;  3F8T A;  3AMU A;  4A93 G;  1F9S A;  3HOZ B;  1F2Y A;  4KHP L;  1J5E Q;  4M8A A;  4X3T A;  2MNA A;  3CAM A;  2KEN A;  4RKL A;  4JI7 Q;  2EQS A;  2E2D C;  5IWA Q;  3HOX B;  1Z9F A;  2FHT A;  4QMG A;  4E6I A;  4DV4 L;  5EAY A;  2Y0S E;  1XTC D;  4GKJ Q;  1OXT A;  4BBS B;  2NWG A;  2IX0 A;  4JOI C;  1EOV A;  1M4V A;  2RDH A;  5I4D A;  2QEX A;  1JCK B;  4JPB W;  4N9T A;  4B3S L;  4FF3 A;  2E8G A;  1Z47 A;  1K3R A;  3S2H B;  3RZO B;  1LTB D;  3K0Y A;  2A19 A;  3WDN A;  2Z4H A;  3R2T A;  5ISR A;  1QB5 D;  1HNW L;  1A3V A;  1OXS C;  1FGB D;  1KLG D;  1BDO A;  5E4X A;  2BH2 A;  3PV0 A;  2DGY A;  2F0I A;  2VB2 X;  4DUY Q;  1WTW A;  3RLN A;  1Q1E A;  5CV7 A;  2BH8 A;  3MXU A;  1WD0 A;  1K83 B;  2HCI A;  4BWG B;  4C2M B;  4DR3 Q;  1PH4 A;  2F52 A;  3SK5 A;  5C4J H;  1I50 H;  4DR4 L;  2A69 C;  2ZTD A;  4XT3 B;  4YIJ A;  1A6X A;  2JEA I;  1CSP A;  4P72 A;  3STB D;  2IPK D;  1N36 L;  2EY2 A;  2UUA L;  4A3B G;  4IFD J;  4CGY B;  3M3Y B;  4JI1 L;  3GO5 A;  4F88 A;  2A74 C;  2KEE A;  2K33 A;  5E1F A;  4DFA A;  4LUO A;  3MXN B;  2WKC A;  1PH3 A;  4B3T L;  1L0X B;  5CBE E;  4DV0 L;  4K0K Q;  3M9B A;  1HTP A;  4BBR B;  3IAY A;  5F2D A;  1VDZ A;  2EOT A;  3KFU A;  4BXX G;  1S3O A;  1YBY A;  1VQF A;  1XXG A;  3W1G A;  1ASY A;  2NTS A;  1PYS B;  2UUC Q;  3ZYY X;  4C3I B;  3SK8 A;  3UE0 A;  1SR3 A;  2NZO A;  4GZY C;  2MO1 A;  3K5O A;  1IXR A;  2K6A A;  1WTP A;  3CCR A;  3FPP A;  2R7F A;  4HAE A;  3M4Q A;  3A54 A;  3I8Z A;  2L4N A;  1DCZ A;  1SE4 A;  1NUC A;  4BA2 I;  1Y1V H;  3I7F A;  1S72 A;  1HRJ A;  2UU9 Q;  1KQS A;  1FNV A;  5T1G A;  4GLA C;  1SLJ A;  3ERQ A;  1JWS D;  4K5V A;  3I4N H;  3J81 L;  4V0B A;  4HTH A;  4FF1 A;  2WB1 E;  4LUZ A;  3URY A;  2AQ2 B;  1DJR D;  5DM7 3;  4HJ5 A;  4AYB G;  3KDF A;  4PZ7 A;  1B70 B;  2CKZ B;  4GKK Q;  4OIJ A;  2K5Q A;  4UPA A;  4LNQ A;  2R3Z A;  3G4S A;  1STB A;  1JMC A;  1RTO A;  4RCO A;  1Y8O B;  1A15 A;  3OIQ A;  1RD9 D;  3V2T A;  2KCM A;  2UXB Q;  5C0X J;  2IX3 A;  1VQI A;  5A2Q L;  1PFM A;  1RJT A;  1M90 C;  2VXW A;  3J81 E;  2E76 C;  3CXC A;  5CV6 A;  1LLR D;  2CWA A;  1K8G A;  1IBM Q;  4JG2 A;  1MGS A;  3KJP A;  4H7B A;  4X64 Q;  2DUD A;  1X3F A;  1HNZ L;  3J81 j;  4LK1 C;  3H0G B;  1RDP D;  3CME A;  3I4N G;  4C1N I;  1UE1 A;  3PGZ A;  2B2T C;  4AIM A;  2E74 C;  4K2K A;  1BCP D;  1DM0 B;  2BE5 D;  1PDQ A;  4Y52 H;  3G6E A;  2JA5 B;  3KLS A;  4A3L G;  3SXH A;  4KN4 C;  5IYB H;  3I73 A;  3D4W A;  4UP8 A;  2KCN A;  5HGT A;  2AMC B;  3NPP A;  4K6D A;  4OL7 A;  5EJW A;  3P1H A;  2F4V L;  4JI3 Q;  1B9M A;  1I3Q H;  2WAQ B;  5HUR A;  3HOZ G;  5C4Z A;  4LF6 L;  4RG1 A;  1HZC A;  4A3E B;  4DK1 A;  3KBG A;  3F2D A;  4PV1 C;  1VQD A;  1HFN A;  2P5Z X;  3GDE A;  2EYP A;  1T5X D;  2C9O A;  3TP8 A;  1QUQ A;  2FIN B;  1IBK Q;  4CJ0 B;  4B3M L;  3HOV B;  3KK7 A;  2QDB A;  3U4V A;  2ATW A;  2NUC A;  1PRT B;  1PA6 A;  4DAY B;  1QVG A;  2B2U C;  2E2J H;  5D14 A;  4ZKB B;  1CM9 A;  3CCL A;  1X3E A;  4YY3 L;  5AJ3 Q;  4ZRZ A;  3PO3 H;  1P16 A;  1NTG A;  1KDA A;  5ELN A;  1VCI A;  3F2C A;  1XPR A;  1LM0 A;  1LT3 D;  4QQB X;  1I4Q A;  3PO2 H;  1H9J A;  5IYB G;  4Z9C B;  1I94 Q;  4JI6 L;  1AW7 A;  1JWM D;  3BDL A;  2DY8 A;  5M3F H;  4X65 L;  1DOL A;  1K8A C;  1WTR A;  1STH A;  3GTM B;  1E22 A;  1SN8 A;  2CW0 C;  3HGB A;  5CBA E;  1X3G A;  1TXY A;  4NPS A;  3K5L A;  1SND A;  1F9Q A;  3M4O H;  3HKZ E;  4IUV A;  2I46 A;  3OPO A;  1TU2 B;  3CCS A;  4X3K A;  2K1B A;  1F9P A;  5FLM H;  1WOC A;  1MHW C;  4EQ5 A;  1PHJ A;  1WTH A;  4C3H H;  1WFQ A;  1W3S A;  3I2Z A;  2L1B A;  3KF6 A;  3HOY H;  1T9H A;  1O7Z A;  2SOB A;  2XGT A;  3SEB A;  5KND A;  3AFQ A;  3F2U A;  2F0Q A;  2YTX A;  2JJQ A;  1TS5 A;  1I6V C;  4KKS A;  3EFX D;  4BY7 B;  2EJF C;  4L5T A;  1JB3 A;  3UDX A;  3K59 A;  1EYG A;  5C4H A;  3UDF A;  3K5M A;  2VB3 X;  1WJJ A;  3PO2 G;  2E2H H;  4TSS A;  2HQE A;  2YTY A;  2PI2 A;  5M3F G;  1LV9 A;  4KI0 A;  1CT1 D;  4HJ7 A;  3OTO Q;  4X3S A;  4DR7 Q;  1FJG Q;  1HR0 Q;  3DLL A;  4DR6 L;  1EEF D;  2XIW A;  1STN A;  1QJO A;  3I4O A;  3FKI H;  1S40 A;  1PH1 A;  2C5C A;  5ELB A;  3BVG A;  4JI8 L;  1KRT A;  1XMQ L;  2BCO A;  5J3B A;  2CH4 A;  3A74 A;  3CMA A;  1SMY D;  4OO1 H;  4S3S A;  1VQB A;  3M7N A;  3HOY G;  2WII B;  1D8L A;  1X3P A;  5M5X H;  2VNU D;  1NNX A;  4HR7 B;  1E1T A;  3U58 A;  3I72 A;  2ZM6 L;  3NEL A;  1PH7 A;  1G91 A;  2CFM A;  1QE6 A;  3STB C;  3A5Z B;  1SFO B;  5E3F A;  4X6A H;  2IT1 A;  1GUS A;  1D6E C;  2Q8R E;  1LO5 D;  5LMU L;  4DV7 Q;  5IT9 c;  1X55 A;  1A0I A;  1EIF A;  1LTT D;  3MAQ A;  3TZD A;  5C3W A;  4CJ1 B;  3HOU H;  4R4I A;  1EIG A;  2D2C C;  5KNC A;  3KF8 A;  1GKH A;  1EZ8 A;  2PMZ E;  5COY A;  3DWQ A;  5DNF A;  1IW7 D;  5EPJ A;  5K36 H;  2AKW B;  4TQU S;  1JOR A;  1EY0 A;  3SE0 A;  4DV5 Q;  3FKI G;  1GO3 E;  2ASB A;  2GVB A;  3F1Z A;  3NEM A;  4A93 B;  3NE5 B;  2VQF L;  4HIM A;  1BBU A;  1Q86 C;  3U9S A;  1PH8 A;  3QOL A;  4M1U B;  1EYD A;  4F87 A;  1ESR A;  4CDF C;  4PNY A;  5M5W B;  3UI2 A;  4YHH L;  1JC7 A;  1PTO B;  3L2P A;  1K73 C;  1I4X A;  3KF6 B;  2NVT H;  1SYE A;  3Q24 A;  2N49 A;  2M9V A;  1VQE A;  4DV2 L;  1XPO A;  5JJI A;  3DEO A;  2HHH Q;  1X32 A;  3S2D H;  2F0U A;  1EFI D;  3EVQ A;  5FO7 B;  3TRE A;  4ILW A;  4I65 A;  2JA5 G;  3J7A 5;  1L1O A;  4DV6 L;  1BOS A;  1C7Y A;  1HA6 A;  2YU9 H;  4Y7N H;  2F0P A;  3NEN A;  2NVQ B;  1UE7 A;  3K80 C;  2ZXR A;  2E5L L;  1BQQ T;  5HY6 A;  2QGQ A;  3ONA B;  4B3R Q;  1VQC A;  4A3M H;  1XNR L;  4OIK A;  1X9N A;  4C3J H;  4L6T B;  3M85 A;  5K36 G;  4L5Q A;  5C4X H;  3J81 i;  4A3E G;  3OYY A;  2C35 B;  4DV3 Q;  1IBL L;  4CHT B;  2NB0 A;  1QVC A;  1X54 A;  1VQM A;  1R9T H;  2F0E A;  2B63 G;  5JJZ A;  2E2I B;  1LTI D;  1HZ9 A;  2EDG A;  2F0V A;  2RDF A;  1N8R C;  3S14 B;  1QIL A;  1NE3 A;  2OXP A;  3K7A B;  1RHP A;  2K03 A;  4LF5 L;  2Y0S G;  4X66 Q;  2JA7 H;  2EJM A;  3S1R B;  1IZ6 A;  1CKN A;  1WVL A;  1EYC A;  2A6H D;  4I7A A;  1RTN A;  2BA1 A;  2F1M A;  1RL2 A;  1ZEQ X;  1CKM A;  1BCP C;  3W3A A;  1W2B A;  2BE5 C;  1V9P A;  3PIP 3;  1YNJ C;  3T1H Q;  3C1E A;  2L55 A;  1KD1 C;  4LF9 Q;  1UEB A;  1EIH A;  4A3B B;  1LTA D;  4LF8 Q;  1A2T A;  3H3V I;  3K7U C;  1Q3L A;  2OQK A;  5C44 H;  1HA5 A;  2VW9 A;  3K5N A;  4PMB A;  4QIW E;  4LJZ C;  1TWG B;  5JEA J;  4A3G H;  2G5D A;  1ROD A;  2G9D A;  3JC6 6;  3JAM L;  2HDL A;  4Q5V A;  3S16 B;  1I5F A;  3K0X A;  5H1S E;  4FYD A;  1JOQ A;  4HJ8 A;  3S1N B;  3CRK C;  4UP7 A;  1PH9 A;  2L9H A;  3CCV A;  3TP5 A;  1ZYR D;  2KED A;  5JVH 3;  1O7L A;  2N8N A;  5C3E H;  2KUM A;  2K5D A;  2A1A A;  1PYW D;  2F0H A;  1MBY A;  4DNI A;  1VQN A;  2PW7 A;  1NCV A;  5C4J B;  1I50 B;  3D6C A;  4YCV A;  3EA6 A;  4B9X A;  3W5O A;  1O78 A;  4JI7 L;  3K81 C;  5GAG C;  5IWA L;  2L11 A;  3JAM E;  1TVX A;  2NBF A;  1N34 L;  1G6Z A;  4GKJ L;  1B9N A;  2WAC A;  4X62 Q;  1DOK A;  1TKW B;  3SK6 A;  4AYB B;  2RF4 A;  4R4T A;  3NXW A;  4JYA Q;  1MJC A;  2PZT A;  3BVM A;  4IUP A;  4A3G G;  3TZU A;  4B9W A;  1STG A;  3TS0 A;  2AWO A;  4LFA Q;  4MHE A;  1PZK D;  2LXJ A;  3D0F A;  4O2D A;  3GTO H;  2L15 A;  4ME3 A;  1SRU A;  1ENF A;  1TY0 A;  2JA8 H;  1L0Y B;  2B2U A;  1WD1 A;  1LUZ A;  1NAP A;  2OTL A;  5IGF A;  2K01 A;  3G6J B;  3CQZ B;  5EBD A;  5FOB B;  1NSN S;  3NK9 A;  4DNT B;  3Q22 A;  2MJ8 A;  5JAV A;  3H15 A;  4DU9 A;  4RGM A;  1LT5 D;  4ZAI A;  4IJH A;  1V43 A;  4UAI A;  1YJW A;  4DAP A;  3I4N B;  3J7A V;  4HED A;  1MSH A;  2FMM A;  4DUY L;  4X3U A;  2WB1 G;  2HUG A;  2UUB Q;  2BA0 A;  2ZJR A;  1D5M C;  3GTQ H;  2RCF A;  4YWK A;  1B1Z A;  1TWH H;  2ZT9 C;  1SYB A;  3NWT A;  5IP7 H;  2Q2I A;  5C3X A;  1CA6 A;  3DEP A;  5JPM C;  3GTG H;  4I7Z C;  2R93 G;  3VDY A;  2JA8 G;  1M1K C;  2EYF A;  4OON A;  2K32 A;  1AFP A;  1SMY C;  2QDL A;  4DUZ Q;  1CHQ D;  2JP1 A;  5IGB A;  3SHL A;  5C6A A;  4K0K L;  3RMH A;  2AUK A;  2JQO A;  1XNQ Q;  3J7Z C;  1SAP A;  3I91 A;  1FYC A;  2VUM H;  3QIA A;  1KAB A;  1SYD A;  2OT2 A;  2PYK A;  5CYU A;  4FNF A;  4LW1 A;  3TRZ A;  2K50 A;  1XYI A;  2UUC L;  1PMR A;  5LMN Q;  1VQO A;  2NZ1 D;  5ELO A;  3GV6 A;  4LUV A;  2EY6 A;  4N9P A;  4EQN A;  2R6G A;  2HQL A;  2ICI A;  4YWL A;  4K5X A;  5IP7 G;  1V1O A;  2B2W A;  2UU9 L;  2XVS A;  4HSP A;  1IW7 C;  4JBK A;  1H9S B;  5EBC A;  1I3Q B;  3RN2 A;  4DAV A;  4ZKC B;  1C0A A;  1VQ9 A;  2MQH A;  4TVA B;  4N8F A;  5FJ8 H;  1LTR D;  4QGU A;  2D0P A;  1CHP D;  3PMF A;  1IYV A;  4GOP C;  1TWF H;  1AZQ A;  3FVQ A;  5J22 A;  1E2V A;  1KC8 C;  1YEZ A;  3GV3 A;  3ZJY C;  1WI5 A;  1B2T A;  4K8J A;  2B2V C;  2F3W A;  2D9U A;  3MA2 B;  4GLV B;  1W6K A;  5GQO A;  2ZTE A;  5G3L D;  3K58 A;  1Q8K A;  5KGU A;  3S15 H;  4DR5 L;  2RKS A;  3GQB A;  1I6H B;  4GLX A;  3A8K E;  3IL8 A;  2NN6 H;  4BY1 H;  4JI4 Q;  2NVY H;  1EIY B;  2DJG C;  2H5X A;  4NKL A;  2O5J C;  3PO2 B;  1B50 A;  3N52 A;  4X64 L;  2K5H A;  3IFT A;  5M3F B;  4RGN A;  1EWC A;  4GN5 A;  1TII D;  4DNR B;  1YNN D;  4IPC A;  1CQF A;  2PPB C;  1AH9 A;  1LAB A;  2DY7 A;  1N33 Q;  1WCM H;  3RR5 A;  5FJ8 G;  2FFK B;  1L1O C;  1TWA B;  3VR5 A;  2F0D A;  3HKZ G;  4KHP Q;  5JJL A;  1NMF A;  1Y1W H;  1G6P A;  3WOF A;  1HJP A;  3LWU A;  5NUC A;  4DV4 Q;  4JI3 L;  2ZJP A;  3HOY B;  2A6H C;  3GTJ H;  2R92 H;  1SEB D;  4IUU A;  2A6E C;  1IL8 A;  4HJA A;  4MTK A;  3CD6 A;  1KAW A;  2H4O A;  3NSW A;  4A3I H;  5CV4 A;  1HUM A;  4XDX A;  2E75 C;  4B3S Q;  3Q23 A;  1AN8 A;  1D7Q A;  3NP8 A;  1CZW A;  2F0J A;  2E2H B;  2NVX H;  5M5Y B;  1IHZ A;  1S5D D;  3DHQ A;  1U4R A;  1O7I A;  3KLS X;  2JA6 H;  4RH6 A;  3AU7 A;  5D3I B;  5EKK A;  2K14 A;  1MIU A;  4IFD H;  1WCM G;  5AJ3 L;  4R4O A;  3ULL A;  3KOJ A;  3S1Q H;  3MXP A;  3S1M B;  2RCN A;  4FDB A;  1HNW Q;  1PYB A;  2RA4 A;  1O7Y A;  3CF5 A;  3FKI B;  5EKI A;  1UUP A;  2F0N A;  1S5F D;  5L37 A;  1I4R A;  4A3D H;  1SJH D;  1ZYR C;  1NR2 A;  4JV5 Q;  4P74 A;  1PRT D;  2KJX A;  5C5M A;  2AWN A;  3T4A C;  1HXY D;  2LY7 A;  1XWE A;  3EIV A;  4QB4 A;  4DK6 C;  4OXP A;  5M3M H;  1U4L A;  3UE1 A;  3BZD B;  1Y1V G;  5FO9 B;  3JAM i;  4LFC L;  1KXL A;  2B39 A;  3PF5 A;  5DLQ E;  3MXG A;  3J80 L;  1HPC A;  1A62 A;  4A3I G;  1B53 A;  2ES2 A;  1SYF A;  3E0J A;  4DR4 Q;  4JI2 L;  1E2W A;  3LNN A;  4L5S A;  4UDU C;  3K6O A;  4GN3 B;  2Z6K C;  5IP9 H;  3FP9 A;  1YNJ D;  5A2Q E;  3HRZ C;  3OIP A;  4BBS H;  1Y14 B;  4O42 A;  2A8V A;  4Q0F A;  1ML0 D;  5EPK A;  1B3Q A;  4CDD C;  2JA6 G;  4CBV A;  1ET9 A;  2LMC B;  4B3T Q;  3P7J A;  4UHV A;  1YI2 A;  1GD7 A;  4WRD A;  1KDC A;  4EGV A;  4RMF A;  4YWM A;  5KYI A;  1TWC H;  2K5V A;  1IYU A;  2F3I A;  5A35 A;  3S2H H;  4IPH A;  1MKH A;  1J9O A;  4K6L A;  2B63 B;  4HJ9 A;  1VF7 A;  5FK9 C;  3OTO L;  5C0X H;  2XRQ D;  4DR7 L;  2OTJ A;  5FLX L;  2CWP A;  3QJY A;  2IJ0 A;  1HR0 L;  2Y0S B;  1LAC A;  4HCS A;  1PLF A;  1XMO L;  1JOK A;  1XTD A;  3LGJ A;  2K7V A;  3S2D B;  2Z1C A;  4IPG A;  4ZLT F;  2AUJ D;  4LFB Q;  1C48 A;  4U68 A;  5I9P A;  2EYJ A;  4CKB A;  3G71 A;  1YJN A;  1SSO A;  3TS2 A;  3CRL C;  1YVC A;  1F77 A;  2MHV A;  1U4M A;  1K83 H;  4JI5 L;  4C2M H;  4EVO A;  3KDF B;  3L9A X;  5AFW A;  3GTP H;  3D31 A;  1KL9 A;  1A3T A;  3I90 A;  5IYC H;  4OWW B;  2EPB A;  2XN9 C;  4FF2 A;  1VMC A;  3VYS A;  4WOR A;  4R4C A;  3IRB A;  5FLX E;  1Q90 A;  1I4G A;  1DD2 A;  3NHH A;  1NY4 A;  1GUW A;  3K57 A;  1JB7 A;  4NXN Q;  3M3Y H;  2LSS A;  4ZK9 B;  1TR5 A;  3AEV A;  4KY7 A;  1PZI D;  1R9T B;  4R9W A;  1L2F A;  2YV5 A;  5KYL A;  4F8M A;  1UE6 A;  1BF4 A;  3I4L A;  5CGK A;  3L3O C;  2YYZ A;  4OX9 L;  4QUC A;  3BVZ A;  1HNZ Q;  1UAP A;  3TP7 A;  4ME5 A;  1PXU A;  4PZ8 A;  3PO3 G;  1ASZ A;  3OSO A;  5I2Y A;  4C3I H;  3RZD H;  4POG A;  3MZ5 A;  1QNU A;  1F2L A;  1ENA A;  2F3V A;  1YHB A;  1CTM A;  1VF5 C;  1EL0 A;  1FNU A;  2PQA A;  5IYD H;  1IKM A;  3I4M H;  1PH5 A;  1GXD C;  3A56 A;  2HHH L;  4A3G B;  2PCF B;  1VQJ A;  4TRD A;  5HGQ A;  1ICF B;  2XTI A;  2TMP A;  3J81 c;  1VQA A;  4RCN A;  1SMX A;  5FLM G;  4J1M A;  1UE5 A;  4C3H G;  2SEB D;  2B2W C;  4U67 3;  2X6G A;  1QUQ B;  1G2S A;  3PUX A;  4ALP A;  1CA5 A;  4JK1 C;  4QY7 A;  4YCW A;  2O4X A;  3UDI A;  1TS2 A;  4XQQ A;  3U50 C;  2UXC Q;  4DV3 L;  3U9O A;  1F2Z A;  4BS9 A;  3P20 A;  3PIP A;  2ZJQ A;  5CV9 A;  4JI0 L;  1S5E D;  5M9O A;  3C2P A;  4KJN A;  3CU7 A;  1X6O A;  1YHQ A;  2CVR A;  2ZXP A;  3Q0A A;  2HDM A;  4KV6 A;  2WB1 B;  4C1N K;  1Q1B A;  5IGC A;  1W6J A;  3DWA A;  1X65 A;  4NMZ A;  2QIL A;  2WV6 D;  4GOP A;  1YNN C;  3W1B A;  5FO8 B;  3KLW A;  2IW3 A;  3I4M G;  4X65 Q;  4XQJ A;  1TS3 A;  3PIO 3;  5K5P A;  1AE2 A;  4XXE A;  4K2L A;  2B2V A;  2M2L A;  3FMC A;  5IGD A;  3T1H L;  2R93 B;  2K52 A;  2OWO A;  1J8I A;  3T53 B;  3GTK B;  4ZUJ A;  2JA8 B;  4LF9 L;  2HIV A;  2XSC A;  3UDG A;  2UXD L;  2WFW A;  1SE3 A;  2Z8L A;  4LF8 L;  3OWE B;  1GVP A;  1PH6 A;  4OO1 G;  2R61 A;  1AE3 A;  1V1Q A;  1HZA A;  3VYU A;  1II3 A;  4LF7 Q;  1IYJ B;  1SNO A;  4DAM A;  1N9W A;  4KD4 A;  3T13 A;  1HR0 W;  1K28 A;  1X3Q A;  2H1E A;  4OEM B;  3P75 A;  3KJO A;  5JVG 3;  4IUR A;  3D4D A;  3BZK A;  3FPU B;  3C3L A;  3PUZ A;  4P73 A;  1VQK A;  1STY A;  4R8I A;  3HOV H;  2JXM B;  4KD3 A;  3ULP A;  1JJ2 A;  2B8F A;  3HOU G;  2FMC A;  1H9K A;  3OWF A;  2KQ3 A;  4IZ8 A;  1WTX A;  1Q81 C;  3G48 A;  3BG3 A;  4PQX A;  1XPU A;  5CC4 A;  1BKB A;  1H95 A;  3TN2 A;  2PZU A;  1FNW A;  4JBW A;  5I2X A;  1EFW A;  2B2Y C;  1FR3 A;  4DR6 Q;  1Z7T A;  2PNR C;  3CHB D;  4QJF A;  5J39 A;  5GAH C;  2R7Z H;  4HMI A;  5BN4 A;  4X62 L;  3F2B A;  1PRT C;  4JI8 Q;  1TY2 A;  4J15 A;  3RN5 A;  1XMQ Q;  1BCP F;  1U4P A;  4PMC A;  2J7Z A;  2JN4 A;  4G7Z C;  5J1Z A;  2F0W A;  3AB9 A;  3GD7 A;  3R8B A;  1E0B A;  1AP0 A;  1EEI D;  2WKD A;  4DF7 A;  1VQ8 A;  2A6E D;  4KY6 A;  5FKA C;  2ZM6 Q;  4XYQ A;  3RLO A;  3EBE A;  4B08 A;  4HID A;  3RNU A;  3Q6S A;  4PMW A;  3MTS A;  3ICE A;  5LMU Q;  3G7L A;  2ICE C;  1I4P A;  3S17 H;  2SNS A;  4A75 A;  4K8I A;  1QOH A;  4A3M G;  4UP9 A;  4POF A;  1SNP A;  4C3J G;  3HG9 A;  3CC2 A;  5C4X G;  3J80 i;  3KF8 B;  4BY7 H;  3X3M A;  2O5I C;  2UUB L;  2R7Z G;  3WOE A;  1ET6 A;  5I6W A;  1HNX Q;  3HKZ B;  2VQF Q;  1HTL D;  2MUY A;  4OWT B;  1SBB B;  3AQQ A;  1Q7Y C;  1ZXT A;  1DXM A;  1HZB A;  4KKU A;  2BDN A;  2GA4 B;  1KAA A;  1NR4 A;  2Z6K A;  3CCE A;  2JA7 G;  4YHH Q;  4RWS C;  1ESF A;  2GN5 A;  3BDO A;  3J7Y W;  3DM1 A;  1T5E A;  3HFZ B;  1J5E L;  1K8O A;  4GNX C;  1A63 A;  5ELE A;  1EU4 A;  4DUZ L;  4WFN 3;  3BYT B;  2NVY B;  4CKC A;  1UNS A;  4A76 A;  1D1K A;  4BY1 B;  4DV6 Q;  1A3U A;  1L1O B;  4IOA A;  4H0L C;  3VYR A;  1EZ6 A;  1XNQ L;  1Z6H A;  5C44 G;  1ONL A;  1BVS A;  4EQO A;  4G4K A;  4NDX A;  2E5L Q;  4FP5 D;  4KN7 C;  5GAD C;  4DR2 Q;  2JSO A;  4DV1 Q;  3AFP A;  3NQI A;  1EQQ A;  5LMN L;  1N32 Q;  1WCM B;  1EYA A;  3T1Y Q;  3GTL H;  4YCU A;  4LF4 Q;  5JEA H;  3K8A A;  1Y1W B;  3HOW H;  4OO1 I;  2JE6 I;  4CJ2 C;  1SNQ A;  1PFB A;  3GP7 A;  2RQX A;  2F4I A;  3VR4 A;  5C3E G;  1CZG A;  2D0O A;  2NYZ D;  4A3K H;  4CDC C;  3GTJ B;  1RF2 D;  4JW0 A;  4MIU A;  4A3J H;  1Y1V B;  1WTQ A;  2IWH A;  1CKN B;  4KHZ A;  3FHW A;  4A93 H;  3E5S A;  4A3I B;  4CKE A;  2V1C C;  2QW7 A;  2QKI C;  1LTG D;  2KA7 A;  4ZUI A;  4L8J A;  5M5W H;  3I55 A;  4DR3 L;  1PTO H;  2NVX B;  2RDG A;  2JYO A;  3ULJ A;  2JA6 B;  3VA7 A;  3QG1 A;  3TSS A;  1P8L A;  4GN4 B;  2PMZ B;  4JI4 L;  1FVI A;  1AEX A;  3EQL C;  1PTO C;  1GM5 A;  1PFN A;  3B6Y A;  1SYC A;  3BJU A;  1VQL A;  3HOW G;  1HUN A;  2DN8 A;  2I5H A;  2PZW A;  3MXN A;  5EGT A;  4A3D B;  1LYL A;  1VMP A;  1XX8 A;  1C9O A;  3BZC A;  1BR9 A;  4IUT A;  2WAQ E;  1E2Z A;  1M8A A;  4A3K G;  2JK8 A;  4DXG A;  3CKI B;  4MZ9 A;  5BR8 Q;  1TQO A;  5COR A;  2VQE Q;  5IOC A;  4A3J G;  2OEO A;  2F0G A;  1EWI A;  1SNM A;  1Y69 U;  4MNO A;  1VQ4 A;  4DK0 A;  1CFM A;  2JA9 A;  2YTV A;  2E2I H;  3OHX C;  3TME A;  3S14 H;  3K7A H;  1BXT A;  1S4Z A;  3H6M A;  1N34 Q;  2Z6B A;  5DEH A;  2Q8T A;  2EYO A;  1KLU D;  2F0T A;  3S1R H;  4R4Q A;  4JBM A;  4LAA A;  1E24 A;  1OXX K;  4ULL A;  1GUG A;  3BS1 A;  4R8N A;  2DNC A;  1STA A;  2Z4I A;  4DR1 Q;  1DON A;  2FXQ A;  4NW2 A;  2HCC A;  1TWC B;  3OMC A;  1QVF A;  1EQV A;  4A3B H;  4GKK L;  4FF4 A;  4FXK C;  1EUJ A;  1A2U A;  3PF4 A;  2Q2T A;  1U9R A;  4NXM Q;  1TWG H;  1CQV A;  3HZX A;  3M4Y A;  3TP6 A;  2VUM G;  3KBX A;  3S16 H;  2ID0 A;  4HCE A;  2Z9H A;  2UXB L;  3QWN A;  3S1N H;  3JAM c;  3A7L A;  5E7N A;  2E2J B;  4EX5 A;  1VQ7 A;  4BXX H;  3EN2 A;  4OGQ C;  5EQ0 A;  4JV5 L;  3A0J A;  3LWE A;  3PO3 B;  4MN3 A;  1EY6 A;  4J6H A;  1IBM L;  1KHI A;  2VL6 A;  4DK3 C;  5IOD A;  1EY9 A;  4RKB A;  4A3C H;  4H02 A;  4XTC S;  1MJE A;  2L5T A;  3GTP B;  4KKT A;  1JT8 A;  2HT1 A;  3PUY A;  4IQZ A;  4AQY Q;  5BN3 A;  3TBI B;  4LWC A;  2F0O A;  1D5X C;  4QIW B;  5T1I A;  5LMN W;  2IHE A;  2IL8 A;  1DZ1 A;  3M4O B;  1GOZ A;  3FEW X;  1GUT A;  1JJC B;  3S24 A;  2G9H D;  3KYH C;  3E9I A;  2EYL A;  4C3H B;  3WWV A;  3HKS A;  1KNA A;  1RIP A;  1JR0 D;  1YNX A;  1GHK A;  1UEA B;  3BU2 A;  4N8X 1;  1DYQ A;  3NTK A;  1A8V A;  2PW5 A;  2SDF A;  1QG7 A;  1ILQ A;  3CCM A;  2Q2H A;  2NN6 G;  2V4D A;  4BY1 G;  3RZD B;  1IBK L;  3CQZ H;  2MPM A;  2B2Y A;  1KNE A;  2ENB A;  3MWY W;  3S9W A;  1H9M A;  1G51 A;  4A3C G;  3FRP B;  1VS0 A;  3J7A F;  4KLK A;  4DAY A;  3R3O A;  2RVL A;  5CV5 A;  1FGU A;  1GHJ A;  3D6W A;  1YJ9 A;  3I4M B;  2B8G A;  2Z0S A;  3MC0 B;  2DNE A;  2IY5 B;  4FO2 A;  1WYD A;  3R93 A;  3TQY A;  1GUO A;  1Q82 C;  4LFB L;  3OW7 A;  1BNZ A;  5LL6 X;  1BUV T;  1Y1W G;  2LFN A;  1B8A A;  1I94 L;  4OHJ A;  5I9O A;  4A3L H;  3VYT A;  2EJG C;  1HCZ A;  5JOB A;  1SNC A;  4XIG S;  4DGZ A;  1SXT A;  1LT6 D;  3LX0 A;  2R92 G;  3T51 B;  4RFB A;  4NB3 A;  4XT1 B;  5M5X B;  4A3F H;  4A4I A;  4OWX B;  1D2B A;  3MFG A;  1GJX A;  3HOZ H;  2XRS D;  2NZH A;  2PO4 A;  4NXN L;  2X69 A;  1WTV A;  4IPD A;  4DR5 Q;  5IT9 L;  1G2T A;  1S5C D;  2QF7 A;  2GVA A;  1NMG A;  3HOX H;  4MTN A;  1N36 Q;  4XYO A;  3RUZ A;  4H44 C;  2UUA Q;  1CKO A;  1C4Q A;  4JI1 Q;  2VS1 A;  3MVV A;  3HOU B;  4J8Q A;  1V8Q A;  4IFD G;  1Q12 A;  4QL5 A;  4HMJ A;  4DV0 Q;  4RGT A;  2VY3 A;  2WIN B;  3ERO A;  2ZXO A;  3C1F A;  4DN4 M;  3NTH A;  4PZ6 A;  3VR2 A;  4EQP A;  4GNX A;  1PVO A;  1VQH A;  4BA1 I;  4A3D G;  1TT2 A;  3J80 E;  4RGO S;  5IY0 A;  2CHB D;  2PI2 E;  2Q8I B;  3RZO H;  3CPW A;  2F0K A;  3QO2 A;  4IAL A;  5IT9 E;  2HIX A;  1YIJ A;  1HQR D;  3SDZ A;  2M00 A;  5M3M G;  3MHB A;  4AH6 A;  2AQ3 B;  3TDQ A;  4A3F G;  1PV4 A;  1FJG L;  1MI2 A;  3I70 A;  2NVT B;  4H13 C;  4K14 A;  5KEE A;  1U0L A;  3H09 A;  3U4Z A;  3RLF A;  5EPL A;  5TSS A;  1KIX A;  2EXD A;  5IIF A;  2IHF A;  2KCC A;  4P75 A;  3HOX G;  1BBX C;  3E0E A;  5IP9 G;  3SVM A;  2J0T D;  2F0M A;  1U5K A;  3VR3 A;  2YU9 B;  4BBS G;  4Y7N B;  1QWY A;  3NQT A;  1VQP A;  3PIO A;  2MGS A;  2BDO A;  1HHV A;  2UXC L;  3CCQ A;  4KMU C;  4V19 0;  2IX1 A;  4A3M B;  2N3S A;  4P71 A;  4C3J B;  2EYM A;  1KRS A;  1I6H H;  1SYG A;  1YZ6 A;  5C4X B;  4O0A A;  1CUK A;  2QA4 A;  2KOL A;  4DV7 L;  2R7Z B;  3A8J E;  3D3R A;  3Q8D A;  2KHI A;  1BCP B;  4FVM A;  3H3V H;  1VQ6 A;  5CR3 A;  5C0X G;  1QCB D;  2EXZ A;  5IGE A;  4G7O C;  2N88 A;  1D1I A;  4BBR H;  2VZA A;  2F0S A;  4R1J A;  2JA7 B;  4DV5 L;  1SDF A;  1TWA H;  3ITP A;  3H94 A;  3L7Z C;  1B3A A;  4LFC Q;  1RKN A;  2FJ2 A;  3H3V C;  5IE8 A;  2NN6 I;  5D65 A;  2KCT A;  3HEJ A;  4IO9 A;  4JI2 Q;  2MO0 A;  4RA8 A;  1Y8P B;  3ERS X;  2N55 A;  4LF7 L;  3S17 B;  2A5H A;  1D5Z C;  5IYC G;  3TEH B;  5C44 B;  1K9M C;  1E3P A;  2I07 B;  2EIF A;  3A8I E;  3QOJ A;  3M4P A;  4L63 B;  3A5U A;  2F4V Q;  3E6Z X;  3CCU A;  3CC7 A;  2MFI A;  4XQN A;  2CCZ A;  2CQO A;  4C56 C;  2QCP X;  4LF6 Q;  2K5N A;  4AYB E;  1DOM A;  4RHS A;  1EQT A;  5ELC A;  5G3L F;  2F03 A;  1PTO D;  4GNX B;  2XWB B;  2BOS A;  5M5Y H;  3E3X A;  1JE4 A;  4B3R L;  4CDE C;  1JQY D;  3PCO B;  3L0O A;  4BBR G;  2NTT A;  4B3M Q;  5GRO A;  3X3N A;  1OXU A;  5BN5 A;  3NUC A;  3V96 A;  5LHY 1;  4O1N A;  3D8G A;  3PSI A;  5C3E B;  2ALY B;  1SJE D;  1SE8 A;  3S1M H;  2A68 D;  3KLR A;  3FDT A;  3NBH A;  4RHR A;  4JOI A;  1GUN A;  1EY8 A;  1XMO Q;  4C3I G;  1MD2 D;  3AYH B;  3DUZ A;  4YY3 Q;  1I4H A;  4DXF A;  2LS0 1;  5ELF A;  2AQ1 B;  1HH2 P;  5EKL A;  3R2I A;  3IKJ A; 
#chains in the Genus database with same CATH homology
 1C0A A;  1VQ9 A;  4YHH Q;  4Y52 H;  2KHJ A;  2MQH A;  4TVA B;  3G6E A;  2GN5 A;  5FJ8 H;  4X66 L;  4QGU A;  4A3L G;  3HFZ B;  4JI6 Q;  1J5E L;  2D0P A;  4JCV E;  5IYD G;  4GNX C;  4JI5 Q;  5IYB H;  1A63 A;  3H0G H;  4IFD I;  4UP8 A;  1UWV A;  4GOP C;  1TWF H;  4DUZ L;  2LXK A;  2F4V L;  2AMC B;  5GAE C;  4JBJ A;  4A76 A;  4JI3 Q;  1I3Q H;  3J80 c;  4DV6 Q;  1KC8 C;  1L1O B;  1YEZ A;  3ZJY C;  1WI5 A;  3HOZ G;  4IOA A;  4APV A;  4IJL A;  2JA5 H;  4RG1 A;  4LF6 L;  1XNQ L;  1HZC A;  5GQO A;  5C44 G;  4GLV B;  1BVS A;  2RHS B;  2ZTE A;  3F2D A;  4HIO A;  1Q8K A;  2E5L Q;  1VQD A;  5GAD C;  4DR2 Q;  3GDE A;  3S15 H;  4DR5 L;  4DV1 Q;  3AFP A;  2B3G A;  1EQQ A;  1QUQ A;  4GLX A;  5LMN L;  1IBK Q;  4B3M L;  4JI4 Q;  4BY1 H;  1N32 Q;  2NVY H;  1EIY B;  3T1Y Q;  3GTL H;  4YCU A;  2H5X A;  4LF4 Q;  3U4V A;  4OX9 Q;  2ATW A;  4A3E H;  4X64 L;  2K5H A;  3K8A A;  1PA6 A;  1HNX L;  1L0W A;  2Q2U A;  3HOW H;  4DAY B;  1QVG A;  4OO1 I;  2JE6 I;  3SGI A;  2E2J H;  4GN5 A;  3CCL A;  1X3E A;  4YY3 L;  5AJ3 Q;  4IPC A;  2B63 H;  5C3E G;  3PO3 H;  1AH9 A;  1P16 A;  4WJ4 A;  1N33 Q;  1NTG A;  1WCM H;  2D0O A;  3RR5 A;  5FJ8 G;  1L1O C;  4A3K H;  5ELN A;  1VCI A;  3F2C A;  1XPR A;  1LM0 A;  4QQB X;  3PO2 H;  3HKZ G;  5IYB G;  4A3J H;  3H0G G;  4KHP Q;  1E1O A;  1I94 Q;  1CKN B;  4JI6 L;  4KHZ A;  3FHW A;  5JJL A;  4A93 H;  1NMF A;  1Y1W H;  1YIT A;  5FLX c;  5M3F H;  4X65 L;  1CSQ A;  2PQA B;  1K8A C;  1G6P A;  1HJP A;  2JEB I;  1JE5 A;  2V1C C;  1E22 A;  3CP0 A;  4DV4 Q;  1SN8 A;  4JI3 L;  3CPF A;  1X3G A;  1TXY A;  4NPS A;  3GTJ H;  2ZJP A;  2R92 H;  5M5W H;  3I55 A;  4DR3 L;  3M4O H;  3HKZ E;  4JYA L;  4HJA A;  1JJG A;  1Q46 A;  3CCS A;  3ULJ A;  3I56 A;  3CD6 A;  1NBW A;  1KAW A;  5FLM H;  1WOC A;  4EQ5 A;  4JC0 A;  4GS3 A;  4DR2 L;  5C0X I;  4DV1 L;  4A3I H;  1PHJ A;  4C3H H;  4LFA L;  1WFQ A;  1W3S A;  1P8L A;  4GN4 B;  3GTM H;  3I2Z A;  2WAQ G;  4B3S Q;  3KF6 A;  1FVI A;  4JI4 L;  1N32 L;  1D7Q A;  3T1Y L;  2K75 A;  3HOY H;  4UY8 C;  1T9H A;  1GM5 A;  3PUW A;  3B6Y A;  4LF4 L;  2RHQ B;  2XGT A;  3BJU A;  1VQL A;  2NVX H;  3HOW G;  2R7D A;  3AFQ A;  3NBH B;  2I5H A;  4IOC A;  2YTX A;  2JJQ A;  1LYL A;  1O7I A;  1C9O A;  1X56 A;  3BZC A;  4JI0 Q;  2JA6 H;  4L5T A;  4DKA C;  3CCJ A;  3HOV G;  2K14 A;  1MIU A;  2WAQ E;  1WCM G;  3UDX A;  5AJ3 L;  4R4O A;  2JK8 A;  3ULL A;  3KOJ A;  2ZTC A;  4A3K G;  1XJV A;  1EYG A;  3S1Q H;  3UDF A;  2I5L X;  2RCN A;  4MZ9 A;  5JJK A;  5BR8 Q;  1WJJ A;  4FDB A;  3PO2 G;  1PYB A;  2VQE Q;  1J6Q A;  4A3J G;  2E2H H;  1HNW Q;  3CF5 A;  3CW2 C;  2I0Q A;  2YTY A;  1LTL A;  2PI2 A;  5M3F G;  1EWI A;  4MNO A;  1VQ4 A;  4A3D H;  4GOP B;  4JV5 Q;  4KI0 A;  4P74 A;  1K0R A;  2JA9 A;  4HJ7 A;  2YTV A;  3OTO Q;  1QZG A;  2E2I H;  1G29 1;  2AWN A;  3MEF A;  4DR7 Q;  1FJG Q;  3EIV A;  3S14 H;  3K7A H;  4DK6 C;  4OXP A;  5M3M H;  1N34 Q;  1HR0 Q;  3DLL A;  3UE1 A;  1VQ5 A;  4DR6 L;  1Y1V G;  3JAM i;  3I4O A;  3FKI H;  4LFC L;  1S40 A;  1KXL A;  3PF5 A;  1PH1 A;  2OQ0 A;  5DLQ E;  4R4Q A;  3S1R H;  4JBM A;  2UXD Q;  4JI8 L;  1A62 A;  4A3I G;  3ER0 A;  1KRT A;  4L5R C;  1XMQ L;  1E24 A;  1OXX K;  2ES2 A;  5J3B A;  2K4K A;  3A74 A;  3CMA A;  4JI2 L;  4DR4 Q;  2I5M X;  1BBW A;  1VQB A;  3M7N A;  1DGS A;  4L5S A;  3HOY G;  3CC4 A;  4GN3 B;  2Z6K C;  5IP9 H;  3FP9 A;  2FXQ A;  4HIK A;  1D8L A;  4DR1 Q;  5M5X H;  2VNU D;  1E1T A;  3U58 A;  1VQG A;  1QVF A;  1Y14 B;  4BBS H;  4A3B H;  4GKK L;  4DV2 Q;  2A8V A;  2ZM6 L;  3NEL A;  2JA6 G;  1B7Y B;  1EUJ A;  1PH7 A;  2CFM A;  4B3T Q;  3STB C;  3A5Z B;  3PF4 A;  2Q2T A;  4X6A H;  2IT1 A;  4NXM Q;  1FL0 A;  1TWG H;  1YI2 A;  1GD7 A;  2VUM G;  3S16 H;  2ID0 A;  5LMU L;  5BR8 L;  4DV7 Q;  5IT9 c;  1X55 A;  2VQE L;  4RMF A;  4YWM A;  2UXB L;  1TWC H;  2K5V A;  1A0I A;  1EIF A;  2F3I A;  3S1N H;  3JAM c;  5E7N A;  3S2H H;  4IPH A;  4EX5 A;  1VQ7 A;  1MKH A;  3EN2 A;  3HOU H;  4BXX H;  1YHA A;  1QZH A;  4R4I A;  1XNR Q;  3A0J A;  4BY7 G;  4JV5 L;  1GKH A;  2PMZ E;  2D62 A;  4HJ9 A;  1SFO H;  1E7Z A;  3OTO L;  4DR7 L;  1IBM L;  2OTJ A;  1OXV A;  2AKW B;  4TQU S;  1KHI A;  2VL6 A;  2CWP A;  4DK3 C;  4DV5 Q;  3FKI G;  1GO3 E;  1HR0 L;  3E9H A;  2GVB A;  2ASB A;  3F1Z A;  4H02 A;  4A3C H;  4XTC S;  1IBL Q;  3NEM A;  1MJE A;  4HIM A;  2VQF L;  1XMO L;  1BBU A;  1Q86 C;  1JT8 A;  2HT1 A;  1OTC A;  2PNH A;  1PH8 A;  1XTD A;  3PUY A;  3LGJ A;  4AQY Q;  4LWC A;  4IPG A;  4LFB Q;  5LMN W;  3OW2 A;  2IHE A;  4YHH L;  4LF5 Q;  3G71 A;  3L2P A;  1K73 C;  2KBN A;  1YJN A;  3KF6 B;  4DR1 L;  2NVT H;  3TS2 A;  1JJC B;  1YVC A;  4DPG A;  2R93 H;  2N49 A;  3S24 A;  1K83 H;  3GTK H;  4JI5 L;  4C2M H;  3KDF B;  3GTP H;  1VQE A;  3KYH C;  4DV2 L;  3D31 A;  1XPO A;  1KL9 A;  3E9I A;  5JJI A;  4OWW B;  5IYC H;  3WWV A;  2HHH Q;  3HKS A;  3S2D H;  1RIP A;  2B29 A;  3TRE A;  4R4C A;  2JA5 G;  4NXM L;  3J7A 5;  1L1O A;  2OCE A;  4DV6 L;  1C7Y A;  3IRB A;  1YNX A;  1PH2 A;  2N78 A;  1NJI C;  3BU2 A;  1NY4 A;  2YU9 H;  4Y7N H;  1A8V A;  3NEN A;  1JB7 A;  4NXN Q;  3M3Y H;  2LSS A;  3AEV A;  1UE7 A;  3K80 C;  2Q2H A;  2AHO B;  3CCM A;  2E5L L;  5HY6 A;  2QGQ A;  4B3R Q;  1VQC A;  1L2F A;  2NN6 G;  2YV5 A;  4BY1 G;  4A3M H;  1XNR L;  4PG3 A;  1X9N A;  1IBK L;  1UE6 A;  3CQZ H;  4C3J H;  3M85 A;  5K36 G;  3DM3 A;  4L5Q A;  5C4X H;  1G51 A;  3J81 i;  4A3C G;  5JEA G;  4A3E G;  1VS0 A;  2YYZ A;  3OYY A;  4OX9 L;  2C35 B;  4DV3 Q;  1HNZ Q;  1IBL L;  4KLK A;  2NVQ H;  1QVC A;  2WP8 J;  1X54 A;  4PZ8 A;  1FGU A;  1YJ9 A;  1VQM A;  1R9T H;  2B63 G;  1ASZ A;  3PO3 G;  2Z0S A;  4AQY L;  1IL2 A;  1HZ9 A;  3PUV A;  4C3I H;  3RZD H;  1N8R C;  4POG A;  1NE3 A;  1N33 L;  2IY5 B;  1WYD A;  3TQY A;  1Q82 C;  4LFB L;  1SRO A;  4LF5 L;  4WJ3 M;  1EQR A;  2Y0S G;  1PFS A;  3F8T A;  4X66 Q;  2JA7 H;  1Y1W G;  4A93 G;  1IZ6 A;  1YHB A;  4KHP L;  1CKN A;  1B8A A;  1J5E Q;  1I94 L;  2MNA A;  2BA1 A;  1RL2 A;  3CAM A;  4A3L H;  2PQA A;  1CKM A;  5IYD H;  2KEN A;  1W2B A;  4JI7 Q;  3I4M H;  1PH5 A;  2EQS A;  2HHH L;  4XIG S;  1VQJ A;  5HGQ A;  5IWA Q;  1Z9F A;  4DV4 L;  2R92 G;  1V9P A;  5EAY A;  3T1H Q;  4NB3 A;  4A3F H;  2Y0S E;  1KD1 C;  2XTI A;  4A4I A;  4GKJ Q;  4LF9 Q;  1OXT A;  1UEB A;  4OWX B;  3J81 c;  4LF8 Q;  3HOZ H;  2NZH A;  1VQA A;  3H3V I;  1SMX A;  2IX0 A;  3K7U C;  4NXN L;  5FLM G;  4JOI C;  2OQK A;  1UE5 A;  5C44 H;  1EOV A;  4IPD A;  2VW9 A;  4DR5 Q;  4QIW E;  2QEX A;  4A3G H;  5JEA J;  3JC6 6;  2GVA A;  1NMG A;  3HOX H;  1QUQ B;  4B3S L;  4MTN A;  3PUX A;  4ALP A;  1N36 Q;  1I5F A;  3K0X A;  4QY7 A;  4YCW A;  5H1S E;  2UUA Q;  2E8G A;  1CKO A;  3UDI A;  1Z47 A;  4JI1 Q;  4HJ8 A;  2VS1 A;  1K3R A;  3U50 C;  2UXC Q;  4UP7 A;  4DV3 L;  2A19 A;  1PH9 A;  3PIP A;  4IFD G;  2ZJQ A;  1Q12 A;  4QL5 A;  3CCV A;  4JI0 L;  4DV0 Q;  2VY3 A;  1X6O A;  1YHQ A;  2N8N A;  4PZ6 A;  5C3E H;  1HNW L;  1PVO A;  4GNX A;  1Q1B A;  2A1A A;  1VQH A;  4BA1 I;  1OXS C;  4A3D G;  4DNI A;  5IY0 A;  1X65 A;  1VQN A;  2PI2 E;  3RZO H;  4GOP A;  3W1B A;  3I4M G;  3KLW A;  3CPW A;  4X65 Q;  4YCV A;  1YIJ A;  2HIX A;  2BH2 A;  3W5O A;  4JI7 L;  3K81 C;  2DGY A;  3PV0 A;  4DUY Q;  5GAG C;  5M3M G;  1AE2 A;  3RLN A;  1Q1E A;  4AH6 A;  5IWA L;  2BH8 A;  4A3F G;  1PV4 A;  1FJG L;  3T1H L;  1N34 L;  1U0L A;  2K52 A;  2OWO A;  4DR3 Q;  4GKJ L;  1PH4 A;  2F52 A;  2HIV A;  4LF9 L;  4X62 Q;  3UDG A;  3U4Z A;  2WFW A;  3RLF A;  4LF8 L;  2UXD L;  2RF4 A;  4R4T A;  1KIX A;  2EXD A;  1GVP A;  1MJC A;  1PH6 A;  4JYA Q;  5C4J H;  4OO1 G;  2IHF A;  1I50 H;  4A3G G;  1V1Q A;  1AE3 A;  2AWO A;  1HZA A;  4P75 A;  3HOX G;  3TS0 A;  2ZTD A;  4LFA Q;  4DR4 L;  3E0E A;  5IP9 G;  2JEA I;  2LXJ A;  3D0F A;  1U5K A;  4O2D A;  4LF7 Q;  3GTO H;  1IYJ B;  1CSP A;  2L15 A;  4P72 A;  4ME3 A;  3STB D;  1SRU A;  1N36 L;  4BBS G;  4DAM A;  1N9W A;  2UUA L;  4A3B G;  4IFD J;  4JI1 L;  3GO5 A;  1HR0 W;  1VQP A;  2JA8 H;  3PIO A;  2UXC L;  1LUZ A;  3CCQ A;  3KJO A;  2OTL A;  2IX1 A;  2N3S A;  3MXN B;  4LUO A;  4P71 A;  1PH3 A;  4B3T L;  3BZK A;  4DV0 L;  4K0K Q;  3M9B A;  1KRS A;  1I6H H;  3PUZ A;  1YZ6 A;  4O0A A;  4P73 A;  1CUK A;  2QA4 A;  1VQK A;  3HOV H;  3H15 A;  4DV7 L;  3ULP A;  1JJ2 A;  3Q8D A;  3KFU A;  4BXX G;  3HOU G;  1S3O A;  1YBY A;  1VQF A;  3W1G A;  2KHI A;  1ASY A;  4IJH A;  1PYS B;  1V43 A;  2UUC Q;  1YJW A;  3H3V H;  1VQ6 A;  5C0X G;  3UE0 A;  1Q81 C;  1SR3 A;  3G48 A;  2NZO A;  1XPU A;  4DUY L;  1BKB A;  4BBR H;  1H95 A;  2MO1 A;  2VZA A;  2WB1 G;  4R1J A;  4JBW A;  1IXR A;  2UUB Q;  3CCR A;  4DV5 L;  1EFW A;  2BA0 A;  2R7F A;  4DR6 Q;  3M4Q A;  1TWA H;  2ZJR A;  4QJF A;  5GAH C;  3L7Z C;  2R7Z H;  4LFC Q;  3GTQ H;  4X62 L;  4BA2 I;  1Y1V H;  3F2B A;  3I7F A;  4YWK A;  4JI8 Q;  1S72 A;  2UU9 Q;  1TWH H;  1KQS A;  4J15 A;  4GLA C;  1SLJ A;  3RN5 A;  5IE8 A;  1XMQ Q;  2NN6 I;  5IP7 H;  2KCT A;  2Q2I A;  4JI2 Q;  4IO9 A;  3I4N H;  2MO0 A;  2WB1 E;  4LUZ A;  3GTG H;  3ERS X;  2R93 G;  4LF7 L;  3VDY A;  2JA8 G;  1M1K C;  3GD7 A;  4HJ5 A;  4AYB G;  4OON A;  3KDF A;  4PZ7 A;  5IYC G;  1B70 B;  3TEH B;  2CKZ B;  1K9M C;  1E3P A;  4GKK Q;  1VQ8 A;  2ZM6 Q;  2EIF A;  4UPA A;  4LNQ A;  3RLO A;  3EBE A;  3G4S A;  1JMC A;  3M4P A;  4DUZ Q;  3A5U A;  2F4V Q;  3CCU A;  3CC7 A;  2MFI A;  4K0K L;  4HID A;  2CCZ A;  3RNU A;  2CQO A;  4PMW A;  2JQO A;  4LF6 Q;  3ICE A;  1XNQ Q;  2K5N A;  4AYB E;  5LMU Q;  2KCM A;  3J7Z C;  3S17 H;  2UXB Q;  4A75 A;  5C0X J;  2VUM H;  1VQI A;  4GNX B;  4A3M G;  4UP9 A;  5M5Y H;  4POF A;  4LW1 A;  3TRZ A;  2K50 A;  4B3R L;  2UUC L;  1M90 C;  3PCO B;  3L0O A;  5LMN Q;  4BBR G;  3CXC A;  3J80 i;  3KF8 B;  5GRO A;  3CC2 A;  1VQO A;  1OXU A;  4B3M Q;  4BY7 H;  5C4X G;  5ELO A;  3PSI A;  2CWA A;  2ALY B;  1K8G A;  4LUV A;  1IBM Q;  4JG2 A;  1SE8 A;  2UUB L;  3S1M H;  2R7Z G;  3KJP A;  2R6G A;  2HQL A;  4X64 Q;  2DUD A;  1X3F A;  4YWL A;  1HNX Q;  1HNZ L;  4JOI A;  3J81 j;  2VQF Q;  1XMO Q;  4OWT B;  5IP7 G;  3AQQ A;  3AYH B;  3CME A;  3I4N G;  2UU9 L;  1Q7Y C;  1UE1 A;  4YY3 Q;  3PGZ A;  1HZB A;  4AIM A;  4JBK A;  1HH2 P;  2Z6K A;  3RN2 A;  3CCE A;  2JA7 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...