3ULPA

Plasmodium falciparum ssb complex with ssdna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
118
structure length
114
Chain Sequence
MNEKSLNKIMLIGRVGCEPDIKILNGGDKVATFSLATNEFWRDRNTNELKSKTDWHRIVVYDQNIVDLIDKYLRKGRRVYVQGSLHTRKWHTSQPKQITEIILSYNKGDLIFLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Single-strand binding protein
publication title Plasmodium falciparum SSB Tetramer Wraps Single-Stranded DNA with Similar Topology but Opposite Polarity to E. coli SSB.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 19
structure length 114
sequence length 118
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ulpA00
3J81c 1K73C 1J6QA 3TEHB 4LUVA 4JI7L 3JAMi 4JI7Q 2B29A 2XGTA 4APVA 2NVYH 1L1OB 3EIVA 5JJLA 1B8AA 3CMAA 1PH1A 4JBMA 1JMCA 2MQHA 4OWXB 2JA9A 4GNXA 2WFWA 1Q8KA 1VQ4A 1PHJA 4JI4L 1JB7A 4KLKA 1CKMA 2AKWB 5IYDG 3GTKH 1TXYA 1CKOA 1O7IA 2BA0A 2JE6I 1NE3A 3GO5A 3MXNB 3U4VA 1E24A 4BA1I 5AJ3L 4DR2Q 4A3IH 5IYDH 4BBRG 2AHOB 3GTQH 4GLXA 1VQ7A 1VQNA 4POFA 2K5NA 1NMGA 2MO1A 2Z6KC 3T1HQ 4NXML 1EQRA 5IE8A 4NXMQ 4A3MH 4BBRH 3GTPH 2Q2IA 3MEFA 1Y1VG 4A3CH 1BBUA 3HKZE 1UE1A 3J80c 3G71A 4AQYL 2BA1A 4OONA 4AQYQ 3ICEA 2ZJRA 2K52A 3I7FA 1Y1VH 1XNQL 4GLVB 3RR5A 1XNQQ 3K81C 3K8AA 4HIDA 1MJCA 3UDXA 4IFDG 3S14H 4GS3A 3UE1A 5C0XG 1OXVA 3KLWA 1XPRA 1M90C 2I0QA 3CC2A 3U50C 5FLXc 3CF5A 3J7ZC 1YZ6A 2PI2A 1GKHA 4JOIA 4X62L 4X62Q 3ER0A 4X66L 1VQMA 1CKNA 4OXPA 4X66Q 3RN2A 4B3RQ 3G6EA 1WI5A 1VQCA 1KAWA 3UDFA 1PH9A 1UE5A 2EIFA 1XPOA 4DK6C 1LM0A 2ALYB 1GO3E 2N78A 4LWCA 2QEXA 3HOZH 1A0IA 1QUQB 1N9WA 2MFIA 3W5OA 2ZJPA 1K83H 2OWOA 2UU9L 2F4VQ 3CCQA 2UU9Q 3BZKA 1XMOL 1X3FA 1XMOQ 4POGA 4MNOA 3PGZA 3RLFA 3HOWH 1SRUA 1V43A 1CUKA 3NENA 1WYDA 4QJFA 1Q82C 4LNQA 3K80C 3WWVA 3M85A 2JK8A 4MTNA 4IO9A 2K50A 4GKKL 4GKKQ 3CCEA 1OXUA 4A93H 1VQ8A 4WJ3M 3L2PA 1IYJB 2VQEL 1JE5A 2VQEQ 3I4NH 3I4MH 1L1OC 1VQGA 1EYGA 1EWIA 4L5QA 4A76A 4L5SA 1EFWA 2NVXH 1LYLA 4LFAL 4LFAQ 4BY1G 1NY4A 1AE3A 2YYZA 4XIGS 1QZGA 1EIYB 4B3ML 4B3MQ 3PSIA 4X64L 4X64Q 1UEBA 2R6GA 2JA5G 1T9HA 5H1SE 1FGUA 5M3MH 3S1MH 5C4XG 2JA6G 4C3JH 1YITA 4DV3L 2JA5H 4DV3Q 1E1TA 1OTCA 4PMWA 2K4KA 1I94L 3KOJA 2GVBA 2Z6KA 1VQOA 1S72A 4OWWB 1E1OA 3S1QH 3PUZA 4OO1I 1Q12A 1VQBA 3GTOH 4A3KH 3H3VH 4JI6Q 1Y14B 3HOYH 2OTJA 4YWLA 1XJVA 2KHJA 2NVQH 5EAYA 5JJKA 1EIFA 1A8VA 2PMZE 3J81i 1B70B 3AFQA 3STBD 1D7QA 2YU9H 1X56A 1P8LA 3PO2H 2KHIA 3KJOA 4KHPL 4A3JH 2CQOA 5C44G 1HZCA 4DNIA 4UY8C 2MNAA 5JJIA 4AYBG 1JT8A 3CCVA 2R7DA 3UDGA 3S16H 3S15H 2HT1A 2PQAA 1ASZA 2VW9A 3DLLA 1NMFA 4JI8L 1C0AA 2YTYA 5FJ8H 1YJ9A 1B7YB 2YV5A 2VL6A 1PYSB 2LXKA 2K75A 3FKIG 3D31A 3J81j 4OWTB 4GN5A 2UUBL 2OTLA 2E2IH 1A63A 2K14A 2WB1E 4DAYB 4RMFA 2ZJQA 3FKIH 2GN5A 2IHEA 2KCMA 2OQ0A 4DR4L 1WCMH 3Q8DA 3HOXH 1LTLA 3CP0A 3GTJH 2NN6I 4GKJQ 2I5HA 2JQOA 1TWGH 4AIMA 4DUYL 4DUYQ 1IZ6A 1ASYA 3KF6B 4KHZA 3J80i 4JI5Q 1PH2A 5FLMG 4DR1L 4DR1Q 3TREA 4DV5L 1KRSA 4YCVA 4DV5Q 3KYHC 3F2BA 3U58A 5FLMH 1Y1WH 3GDEA 4LFBL 4LFBQ 4LF9L 4LF9Q 1L1OA 5GQOA 4A3IG 2DUDA 3W1GA 1I3QH 4ME3A 2RHSB 2E5LQ 2JA8G 3UDIA 2I5MX 2AWNA 4IPGA 1SFOH 2FXQA 1CSPA 2A19A 3KJPA 3RLOA 2VQFL 2VQFQ 1JJCB 1TWCH 3TS0A 4A3MG 2UUAQ 1KIXA 2N3SA 2UUAL 4R4QA 5M3FH 2JA8H 3M3YH 2Q2UA 1L2FA 5IYCH 4A3BG 3S24A 4A3CG 3T1HL 4X6AH 2IHFA 3I4OA 4JI2L 4JI2Q 3H15A 1PH8A 1KL9A 2XTIA 1N36L 3L0OA 3G4SA 1PH6A 1N36Q 4DV4Q 4GN4B 4GOPB 1EOVA 2EQSA 1VQ5A 3CW2C 1VQ9A 2CWAA 2VZAA 2WB1G 4NXNL 4NXNQ 5HGQA 2CKZB 4IJHA 1HZAA 3PF5A 5JEAJ 2NZHA 1Z9FA 1VQHA 1TWHH 2JJQA 2KENA 2R7ZH 1G6PA 3OW2A 3PUXA 1YJWA 4BY7G 4HJ7A 2Z0SA 1K0RA 1IBML 1IXRA 1KD1C 1IBMQ 3CC7A 1J5EL 2L15A 5BR8L 5BR8Q 1J5EQ 5GAGC 4BY7H 3CMEA 3NEMA 2WAQG 3M4PA 4B3RL 3CCLA 1QVCA 3G48A 1BKBA 1S3OA 1YHAA 2ZTCA 3E0EA 3HOZG 1N32L 1N32Q 4IPHA 5ELOA 1C9OA 1IBLL 1VQJA 4JBWA 1IBLQ 5K36G 2YTVA 4IOAA 3ULPA 2DGYA 4A3DH 2VS1A 2JEAI 3HOWG 2ZTDA 5IY0A 4O2DA 5M5YH 1VQPA 2JA7H 3HOUG 2OQKA 1SROA 1MIUA 1NTGA 4QY7A 1XMQQ 3I56A 1XMQL 4LF7L 1VQFA 1X9NA 4LF7Q 1QUQA 3TRZA 1VQ6A 3HOUH 3CCUA 4K0KQ 3I2ZA 4K0KL 1XTDA 2IT1A 3I4MG 3I4NG 4AYBE 2R92G 1E7ZA 1X65A 3PO3H 2CFMA 3OTOL 3OTOQ 1PH4A 1I50H 4HJ8A 2VUMH 2WP8J 2R92H 4UP7A 1LUZA 2LXJA 2RHQB 2ID0A 5M3MG 4A3LG 1UE6A 2C35B 3EBEA 5GAEC 1YEZA 2HIXA 4B3SL 4X65L 4B3SQ 4X65Q 4DR7L 1MKHA 3PUWA 3STBC 4EX5A 4DR7Q 4A3LH 3A74A 4JI3L 5C3EG 4JI3Q 4DK3C 2IY5B 4A3KG 3K0XA 4R4IA 4OO1G 1Z47A 1KXLA 3HOYG 3KDFB 1VQIA 3S17H 4Y52H 5C3EH 4IFDJ 5C0XJ 1K9MC 2A1AA 4YWKA 4JI6L 1X54A 4JG2A 1GD7A 3S1RH 4JBJA 3PO2G 3SGIA 1SR3A 4A3JG 4A3FH 2ES2A 3CC4A 4GN3B 5DLQE 1GM5A 4GOPC 2R93G 4WJ4A 5HY6A 3K7AH 1OXSC 2D62A 3CD6A 1HH2P 3FHWA 4JBKA 5LMNW 2KCTA 4L5TA 1TWFH 1H95A 1SE8A 2R93H 4H02A 3DM3A 2NZOA 1X6OA 1YI2A 4EQ5A 1K8AC 1I6HH 5FJ8G 3NELA 4BXXH 3PUVA 4LFCL 4LFCQ 3KF8B 2V1CC 4LF6Q 1YIJA 4OX9L 2A8VA 2F4VL 4KI0A 4A3GH 1RL2A 1WCMG 3M4QA 5C4JH 3HOXG 1K3RA 4BBSH 2RCNA 2UXBL 1PFSA 2OCEA 2UXBQ 3AEVA 3BU2A 3CCSA 3J7A5 3ERSX 1VQAA 3CCJA 1E22A 4JI0L 2NN6G 4HJAA 4JI0Q 1PH7A 4GKJL 4A93G 4DAMA 1UWVA 4IPDA 1G291 1HNWQ 4IOCA 1HNWL 1U0LA 3A0JA 1VS0A 2JEBI 4DR5L 3H0GH 3ZJYC 4DR5Q 1YJNA 1A62A 4QL5A 4R4TA 4JI5L 4OX9Q 3UE0A 1V9PA 3ULJA 4DV2Q 3JC66 1Y1WG 2CCZA 3F2CA 1FJGL 1FJGQ 1QZHA 2BH8A 3GD7A 4JC0A 1QVGA 2WAQE 4C2MH 3PCOB 1PYBA 1HJPA 4MZ9A 4HIKA 1VQKA 4PZ8A 3CCMA 4P72A 3KF6A 2B3GA 4L5RC 3HOVH 4C3IH 4XTCS 2E5LL 4R4OA 4J15A 4NPSA 1VQDA 1X55A 5M3FG 1N34L 1N34Q 2EXDA 5IYCG 1TWAH 1Q46A 4DPGA 1WJJA 2MO0A 3AYHB 4GNXB 2B63H 2PI2E 4JV5Q 3M7NA 1L0WA 5GROA 5IYBH 1R9TH 1YHBA 1Q81C 3TS2A 3CCRA 4YCWA 4PZ7A 4DV4L 1RIPA 4DR3L 3CQZH 4DR3Q 2R7ZG 1KHIA 2E2HH 4JI4Q 4LF5L 3CPWA 2E8GA 4LF5Q 5LMNL 1W2BA 5LMNQ 4RG1A 4YHHL 3A5ZB 4YHHQ 2R7FA 3D0FA 3AFPA 4HIOA 1NBWA 1SMXA 4PG3A 2D0PA 3M4OH 4HJ5A 3T1YL 4GOPA 3T1YQ 2Y0SE 5IP7G 1I5FA 4IPCA 1WFQA 1DGSA 2AMCB 4LW1A 5AJ3Q 1GVPA 3HFZB 1FL0A 4A3BH 4LUZA 5LMUL 5IP7H 3K7UC 5LMUQ 2N8NA 3KFUA 4UPAA 5GADC 1IL2A 3E9IA 1VQEA 3ULLA 1WOCA 4UP9A 4BA2I 4A3DG 1YBYA 3CXCA 3JAMc 1Q86C 1QVFA 2PNHA 3RN5A 4LUOA 4B3TL 4B3TQ 1UE7A 2JA7G 3I55A 4A4IA 3M9BA 3HKSA 1PA6A 1NJIC 4DV1L 1U5KA 2YTXA 4DV1Q 1KC8C 1G51A 3S2DH 1EUJA 1CKNB 1YVCA 3PIOA 5IP9G 1VCIA 4IFDI 1HZ9A 1FVIA 3F2DA 5C0XI 2QA4A 1YHQA 3PO3G 2IX0A 1M1KC 1X3EA 4R1JA 2D0OA 4GLAC 4O0AA 4DKAC 5IP9H 1SLJA 3RLNA 4Y7NH 2ATWA 2HQLA 3GTGH 2VUMG 4JYAL 2QGQA 4YY3L 4YY3Q 1N8RC 1C7YA 4JYAQ 1PH5A 5J3BA 5E7NA 4FDBA 2VNUD 2F3IA 3RZOH 4QIWE 2K5HA 1Q1EA 2K5VA 2HHHL 4P75A 2HHHQ 1HR0W 3GTLH 1PVOA 2Y0SG 2LSSA 3LGJA 1V1QA 1PH3A 4P74A 2UUCL 2UUCQ 1CSQA 3PV0A 3W1BA 4R4CA 4DUZL 4LF8L 4DUZQ 4LF8Q 1SN8A 1OXXK 4P73A 4DV7L 2ZM6L 4DV7Q 2ZM6Q 3CAMA 3TQYA 3BZCA 4QGUA 3HKZG 5M5XH 3EN2A 4GNXC 1AE2A 1Q1BA 2AWOA 2ZTEA 2Q2TA 1N33L 1N33Q 4A3EG 3PUYA 4A3FG 1HNXL 2ASBA 1HNXQ 1D8LA 1OXTA 5ELNA 4AH6A 5IT9c 4DR2L 2E2JH 3S1NH 4NB3A 2VY3A 1EQQA 4LF4L 4LF4Q 1AH9A 4A3EH 3KDFA 4QQBX 3PIPA 2UXCL 4JCVE 2UXCQ 4IJLA 3S2HH 3NBHB 4HIMA 1JJGA 4TQUS 2I5LX 4YWMA 1BVSA 4BY1H 4ALPA 1K8GA 4BXXG 2UXDL 2UXDQ 3A5UA 2N49A 1X3GA 1XNRL 5C4XH 1PV4A 1XNRQ 1I94Q 4HJ9A 3H3VI 1P16A 2BH2A 3OYYA 2JA6H 3BJUA 4TVAB 4A3GG 4BBSG 2NVTH 4LF6L 4PZ6A 3IRBA 1Q7YC 1IBKL 4DV0L 1IBKQ 4DV0Q 2F52A 4P71A 3GTMH 3F8TA 4A75A 2PQAB 3H0GG 2IX1A 1E3PA 3U4ZA 2GVAA 4DR6L 4DR6Q 1YNXA 3VDYA 1S40A 4KHPQ 4YCUA 5IWAL 1MJEA 3AQQA 3FP9A 4JOIC 5IWAQ 3PF4A 1XPUA 2KBNA 5JEAG 5C44H 1BBWA 4DV2L 1JJ2A 2RF4A 4C3HH 3RNUA 3RZDH 1HZBA 1KRTA 3CPFA 4JI8Q 2H5XA 5GAHC 1HR0L 1HR0Q 3HOVG 4DV6L 3B6YA 4DV6Q 3L7ZC 4UP8A 5M5WH 3E9HA 2Q2HA 1HNZL 2UUBQ 1HNZQ 1W3SA 4JI1L 4JI1Q 2B63G 2CWPA 4DR4Q 5IYBG 3F1ZA 1VQLA 2HIVA 1KQSA 4JV5L
chains in the Genus database with same CATH superfamily
3CQZB 1K73C 2OT2A 4JI7L 1HFNA 2E2HB 2B29A 2XGTA 4APVA 3EIVA 5EJWA 3CMAA 2XRQD 4JBMA 1JMCA 3I8ZA 2L0CA 4K8JA 1PHJA 1JB7A 2O5JC 1GJXA 1SNOA 5IYDG 1O7IA 4DR2Q 5AJ3L 4A3IH 3J7AV 5IYDH 1VQ7A 3T1HQ 1EYAA 2DY7A 1STNA 1DD2A 4A3MH 3DUZA 3GTPH 3MEFA 1PXUA 1RJTA 5I6YA 1HHVA 3SEBA 4AQYL 4OONA 3Q24A 3ICEA 2HUGA 3OPOA 3RR5A 3K8AA 2F0NA 4Y7NB 3UDXA 3V96A 3QOJA 3KLWA 1XPRA 5FLXc 1YZ6A 2AUJD 4K2KA 5I2XA 4JOIA 4X62L 3IL8A 1B44D 2FHTA 4NMZA 1ILPA 2EIFA 1LM0A 4LWCA 1GO3E 1SYGA 1N9WA 2AUKA 2F4VQ 3TS2A 1QWYA 4C1NI 5M9OA 3BZKA 3I90A 5I6WA 1GUGA 5COYA 2K33A 5KYLA 1I6VC 3WWVA 4MTNA 1Z6HA 4L8JA 3RUZA 3CCEA 1OXUA 2F0MA 2VQEL 3K6OA 2E75C 4A76A 1PLFA 4L5SA 4LFAL 4XIGS 1EIYB 1D5MC 1HFGA 2LS01 4C3JG 4X64Q 4ZCKA 1T9HA 2F0WA 1FGUA 2KQ3A 3V05A 1EY4A 4C3JH 4IUUA 4DV3Q 4TKOB 1IKMA 3GTMB 4OWWB 1S72A 1M8AA 4FYDA 1Q12A 5KYIA 3OIPA 1Y14B 3Q6SA 1B2TA 3SXHA 1G2SA 1KNEA 5EAYA 1EIFA 1A8VA 1A3TA 1R4PB 5C44B 2KHIA 3KJOA 3QO2A 1GUSA 1B1ZA 3RZDB 2JSOA 5C44G 1SNDA 2MNAA 4YIJA 5ELBA 1CT1D 5M5WB 2HT1A 1S5ED 4TRDA 4RGOS 3DLLA 2RVLA 5FJ8H 1B7YB 1HUNA 2K75A 4UDUC 3J81j 1SNPA 2OTLA 3J81L 2EYFA 3D6WA 3ONAB 5AFWA 3AMUA 2WB1E 1CHQD 2ZJQA 1D5ZC 3HOXH 1LTLA 3CP0A 3GTJH 5CORA 4AIMA 5CV4A 4DUYL 1IZ6A 1ZEQX 1ASYA 2BE5C 2KVMA 4KHZA 1NSNS 1PH2A 1Y8NB 3TREA 4DV5L 4LJZC 4YCVA 3U58A 1CA6A 1UEAB 1Y1WH 3GDEA 1WTVA 4LFBQ 4RAUC 4LF9Q 1DOLA 2MP1A 1L1OA 3GTQB 4RCNA 1STHA 5FLXE 1A15A 1I3QH 4ID6A 2JA8G 3UDIA 2AWNA 2K03A 4RKLA 1SFOH 2A19A 3RLOA 3T53B 2UUAL 4KKSA 1KIXA 3E5SA 2JA8H 1L2FA 3I4OA 3PIP3 3C2PA 4XQQA 3HZXA 1N36Q 3G4SA 3S14B 1TY2A 2RDGA 3EFXD 4HSPA 3MVVA 2K01A 3PF5A 2NZHA 1Z9FA 1FNUA 1TWHH 3U9SA 3P1HA 1YJWA 1LACA 2Z0SA 1F77A 3CC7A 5BR8L 1YNND 5GAGC 1F2YA 5JAVA 3FPPA 2PO4A 3M4PA 4B3RL 3CCLA 1QVCA 1K83B 1N32L 2E74C 3NP8A 1O7ZA 1IBLL 4DA2A 5K36G 2YTVA 2CW0C 3X3NA 4CDFC 2DGYA 4A3DH 2F0VA 2ZXOA 4K14A 3D4WA 4O2DA 1D6EC 2EE1A 1SROA 1MIUA 3H91A 1XMQQ 4A93G 3I56A 4LF7Q 3A7LA 4ZKCB 4K0KQ 4CKBA 2IT1A 3I4NG 1E7ZA 2A6HC 5J22A 1WTRA 1GUNA 1I50H 2WP8J 4KY6A 1RODA 2NZ1D 2LXJA 1PTOH 1I4XA 2JA5B 4CJ1B 3TZUA 3S1QB 1X3QA 4X65Q 3PUWA 3NQIA 1B9NA 4EX5A 5C3EG 2K5WA 4DK3C 1LT3D 4R4IA 2DNEA 4Y52H 3KDFB 5C3EH 3PO2B 4YWKA 2B8GA 1NR2A 1BUVT 1GD7A 4JG2A 3S1RH 3CHBD 4G57A 3PO2G 4QCLA 2ES2A 1EEID 3QJYA 4IURA 2KCNA 3S15B 4CJ2C 1OXSC 3CD6A 3FHWA 4JBKA 1TWFH 2QW7A 1SE8A 4H02A 3DM3A 1X6OA 1YI2A 1K8AC 3NELA 1VMPA 3T56B 2ICIA 5I9PA 4QMGA 3PUVA 3FKIB 1YIJA 1OO9B 3K5LA 5DM63 3M4QA 3D3RA 5A2QL 2UXBQ 3BU2A 2K32A 4UHVA 3J7A5 4ME5A 3CCJA 5I9OA 1TVXA 4HJAA 4DAMA 2K04A 1UWVA 4IOCA 1E2ZA 4DR5L 5C4HA 4OX9Q 1UUPA 1A62A 4FVMA 4R4TA 4JI5L 1V9PA 1B53A 3GD7A 4K8IA 1QVGA 2WAQE 3PCOB 1VQKA 4I65A 1AN8A 3KF6A 1TS3A 1BCPD 5M3FB 3M3YB 4C3IH 2E5LL 1BO0A 2ZXRA 1N34L 1VQDA 2F4IA 5M3FG 4K2LA 4DPGA 2MO0A 4GNXB 1J9OA 2IWHA 2B2WA 1L0WA 1EZ8A 1YHBA 4KKTA 1PTOD 3H3VC 4XXEA 4YCWA 4RA8A 2R7ZB 4DV4L 2E76C 1RIPA 2L12A 4DR3L 2R7ZG 1SNCA 2EOTA 1STAA 5LMNQ 4YHHQ 2NTSA 4BY7B 3VYTA 3AFPA 4O1NA 3M4OH 2D0PA 4GOPA 1B4OA 2RSNA 4LW1A 1GVPA 3HFZB 4ZRZA 1NR4A 3IAYA 1SNQA 3E9IA 4UP9A 4RKBA 1SYBA 5M5YB 2A73B 3K59A 3CXCA 3JAMc 1H9MA 2F0IA 1KDBA 4B3TQ 4HAEA 1Q8IA 4DV1Q 1G51A 3EQLC 1EUJA 5E4WC 3E0JA 3F2DA 4CDDC 5JPNC 3BVGA 4CGYB 2IX0A 4R1JA 4GLAC 2Z6BA 4O0AA 4DKAC 5I2YA 3GTGH 3A8JE 2L9HA 4JYAQ 2QEJC 3BYTB 2EDGA 2I46A 5J3BA 5HGTA 5JPMC 1PH5A 3SVMA 2F3IA 5IIFA 3RZOH 4QIWE 1HQMC 2K5HA 4Q5VA 3GTLH 3LGJA 3URYA 2UUCQ 5EPLA 3ND8A 4N8X1 4XDXA 2HCCA 3S17B 1LTRD 4DUZL 4P73A 4DV7Q 2ZM6Q 2EY2A 2K28A 4A3FB 5M5XH 3DXJC 4GNXC 1N33L 4K5VA 3BS1A 4A3EG 4A3FG 1HNXL 3S1NH 2E2JH 4KMUC 2VY3A 4LF4L 4A3EH 2UXCL 4OIKA 5G3LD 3NBHB 1I4HA 3DWQA 4HIMA 4S3SA 2I5LX 1JJGA 4WFN3 1Q3LA 4V0BA 4HCEA 4BY1H 2MPMA 3ERQA 2UXDL 2XWJB 5CV9A 5C4JB 5C4XH 2RDFA 2B2YC 1I94Q 3KLRA 4TVAB 3MA2B 2CVRA 3IRBA 1EWCA 4B08A 3D4RA 3LNNA 2J4XA 1BF4A 2PQAB 1EEFD 1E3PA 4OL7A 3U4ZA 4KHPQ 1S5CD 5IGDA 1K28A 3PF4A 3TZDA 1WVLA 2RF4A 3HOVB 1HZBA 3NTIA 1GUWA 1KRTA 2BDNA 1ENCA 2H5XA 3HOVG 5C5LA 1HR0Q 4DV6L 1TU2B 2B63B 2Q2HA 1HNZL 2UUBQ 4JI1Q 2B63G 4OEMB 5IYBG 3F1ZA 3KBXA 5CV6A 4JV5L 5IGCA 1U9RA 3JAMi 3KLSX 3JAME 2NVYH 3R3OA 2WACA 4OWXB 1WTOA 2JA9A 1PMRA 1ESRA 1PTOF 4KLKA 3HGBA 4DGZA 1WTQA 4A3BB 1TXYA 1CKOA 3U4VA 4DR2L 4A3BG 3U9OA 4ZK9B 5K5PA 4BBRG 4WJWA 2SEBD 1VQNA 2KOLA 4POFA 4NXMQ 1EQRA 1H9RA 3NPPA 4BBRH 2Q2IA 3DM1A 1Y1VG 4A3CH 2B39A 3S2DB 1UE1A 4DN4M 2B2UA 3J80c 5BN5A 2ZJRA 1LTID 4N9PA 5FLXL 1Y1VH 1ZYRD 1JC7A 4IUQA 2A6ED 2OF1A 1HA6A 4GS3A 3UE1A 1OXVA 1M90C 1TIID 2I07B 3PQIA 2J7ZA 3DWPA 1ZXTA 1U4RA 1GKHA 3VR6A 3RMHA 3A8IE 1VQMA 3RN2A 3G6EA 1VQCA 2RCFA 1XPOA 3AU7A 5A35A 3HOZH 1HPCA 1A0IA 2ZJPA 2F4VL 4HTHA 1X32A 2R61A 1E2WA 2UU9Q 3VR2A 3L9AX 3N52A 3PGZA 3HOWH 1SRUA 1PZKD 3K80C 1S4ZA 3HKZB 2JK8A 5IT9L 2K50A 1A2UA 4GKKQ 1WD1A 4WJ3M 1D1IA 1IL8A 1JE5A 1SBBB 2IX3A 4L5QA 5C5MA 1EFWA 2B2VA 4F87A 4QF4A 1X3PA 1QZGA 2XVSA 1IYUA 1NNXA 4X64L 1UNSA 1H9KA 2R6GA 4DFAA 4FXGC 1FNVA 5M3MH 5G3LF 4R8NA 3MFYA 1YITA 4DV3L 2ENBA 2F0TA 2K4KA 1PFMA 2Z6KA 1VQOA 3H09A 1BQQT 1HCZA 1STBA 3GTOH 2F0KA 1D2BA 1QJOA 4JI6Q 5D65A 2ZT9C 5C3WA 2CH4A 2NVQH 2MUYA 1C4QA 3STBD 4H0LC 2YU9H 1X56A 4C3HB 2CQOA 2B2TC 3I4LA 4C3HG 3FMCA 4AYBG 3CCVA 1PFBA 4M8AA 4LAAA 4N9TA 3FPUB 1Y8OB 1NMFA 1RDPD 1CZGA 2VL6A 1SMYD 2F0GA 2LXKA 3OWEB 3NK9A 4GN5A 1G6ZA 2E2IH 2K14A 1JB3A 4RMFA 1DONA 4PMBA 2KCMA 3FRPB 4J1MA 1WCMH 4DR4L 1V8QA 1D1KA 2I5HA 2JQOA 2AQ3B 3KLSA 3CKIB 5EKLA 2H4OA 3J80i 3J80E 3W3AA 5FLMG 4DAVA 4FF3A 3QB3A 3WDNA 2HQEA 4PNYA 1KRSA 2PMZB 3F2BA 5FLMH 5FOBB 4A3IB 4LFBL 3NUCA 1BNZA 4LF9L 5J1ZA 4A3IG 5DAUA 4ME3A 4L63B 4ABNA 3TN2A 4IPGA 2FXQA 3A8KE 5ELCA 4A3MB 1CSPA 4NW2A 5C6AA 3GTPB 2VQFQ 3TS0A 1JJCB 4A3MG 2N88A 4R4QA 1SJHD 5IYCH 1ONLA 3MXNA 1KL9A 2B8FA 1N36L 1PH6A 2BOSA 4N8FA 5KNDA 4GN4B 1EOVA 1VQ9A 2VZAA 4NXNQ 1F9PA 5HGQA 2CKZB 2QILA 2PZUA 1VQHA 1VMCA 2JJQA 3OW2A 3W2DA 1IBMQ 2X69A 2SNSA 4XQNA 2JN4A 4JK1C 4ZUJA 1YHAA 5EBCA 1F9QA 4JBWA 2ZXPA 4U673 2EYLA 4Q0FA 3ULPA 1JR0D 1U4MA 1LLRD 2JA7H 3HOUG 2OQKA 1XMQL 4LF7L 1X9NA 4K0KL 1QUQA 3LWEA 4BWGB 3CCUA 3HOUH 5HURA 1XTDA 4EVOA 2XN9C 2Z8LA 1BBXC 2C5CA 1HUMA 2VUMH 4UP7A 1LUZA 3EVQA 5D14A 4C3JB 2RHQB 2ID0A 1J8IA 1FYCA 2F0UA 1XXGA 1UE6A 2C35B 3EBEA 4X65L 4B3SQ 4MHEA 1NUCA 1Z47A 1VQIA 2E2DC 1SEBD 3GV6A 1JOKA 1E0BA 5CGKA 2XNAC 1II3A 1A3VA 1SR3A 1HXYD 3CC4A 4GN3B 1GM5A 2D62A 4L5TA 1H95A 1IKLA 2NZOA 4ZYSA 4X3TA 1H9JA 5FJ8G 4HSVA 1RKNA 2K5QA 1SYEA 4BXXH 1BXTA 3KF8B 2V1CC 3DMUA 4DF7A 3HOXB 3GTJB 4KI0A 4KJOA 3HOXG 2UXBL 1PFSA 1TKWB 1Z7TA 1VQAA 2DNCA 5T1IA 1KDCA 4JI0Q 4GKJL 1SYDA 4OX9L 3H0GH 3ZJYC 1Y1WB 4DAYA 3ULJA 1Y1WG 4KN7C 1QZHA 1LTBD 1I3QB 4C2MH 1SFOB 5JEAH 4EQPA 1PYBA 4MZ9A 2TSSA 4P72A 4F7XA 1KABA 1LTAD 2JA8B 5FO8B 4KK7A 1F9RA 4Z9CB 1ZKOA 4J15A 1H9SA 3BZDB 1G8ZD 2EPBA 1WJJA 2PI2E 2K05A 1JQYD 3Q23A 1R9TH 3WOFA 1CFMA 1Q81C 3TBIB 1YNNC 1TWHB 2EY6A 1PRTD 4RHSA 2EJFC 2LMCB 4LF5Q 5LMNL 1W2BA 4YHHL 2R7FA 1DCZA 4L6TB 1EU4A 2KHSA 3T1YQ 5AJ3Q 4EGVA 1FL0A 4QUFA 1VF5C 2G9HD 4LUZA 3TMEA 3VA7A 4GZYC 3KFUA 1STGA 3MZ5A 3T13A 4A3DB 2RKSA 1WOCA 2K6AA 1YBYA 4A3DG 1LT5D 4P2CB 1Q86C 1K8OA 2L5TA 4B3TL 4LUOA 1BCPB 2C9OA 1UE7A 2LY7A 3BVZA 3D4DA 1DJRD 4DV1L 3P75A 1KC8C 5EQ0A 4A93B 3PIOA 1GOZA 2G9DA 2QA4A 1YHQA 3I4NB 3MAQA 4IFDH 1I50B 1X3EA 5C0XH 2DN8A 2MGSA 3RLNA 2HQLA 1PTOB 2EYOA 4JYAL 3FVQA 1C7YA 1EU3A 4NDXA 1GHJA 4OELB 5KGUA 1Q1EA 5IGFA 4P75A 2HHHQ 1QOHA 3BYYB 1MI2A 5CBEE 1V1QA 1PH3A 2UUCL 4OGQC 1EY6A 4H13C 3VR4A 5C3EB 4R4CA 4LF8Q 4DV7L 2F0LA 2ZM6L 2A74C 3S1RB 4IQZA 3CAMA 3TQYA 4QGUA 1JWUD 2Q2TA 2CW0D 2HD3A 2ASBA 3OSOA 1OXTA 1TWFB 5J39A 1V1PA 2EJGC 2EY5A 3CRLC 4IJLA 3S2HH 4TQUS 4I7ZC 4KY5A 4CKEA 2EYPA 4ALPA 1K8GA 3A5UA 3K5NA 3OMGA 3TP6A 2JA6H 3OYYA 2NVTH 4LF6L 1A3UA 1IBKQ 4DV0Q 1RHPA 3F8TA 3G7LA 5EPKA 5JVG3 4RH6A 1BCPC 3NHHA 2IX1A 2GVAA 1MJEA 5IWAQ 4JOIC 4DV2L 4C3IB 3RNUA 1I4RA 3CPFA 3HRZC 4CKCA 1HR0L 4C3IG 1VF7A 5FO7B 1GXDC 1PTOC 1PFNA 4JI1L 2L11A 5IGBA 1MSHA 1AP0A 2CWPA 3MWYW 3MFGA 3J81c 3TEHB 4LUVA 1L1OB 5JJLA 1B8AA 1PH1A 2MQHA 3R8BA 5JJZA 1TS5A 4IUTA 3F2UA 3M4OB 2M9VA 4JI4L 1GUOA 1CKMA 2AKWB 3GTKH 1PRTF 4CDCC 2BA0A 3GO5A 1NE3A 1E24A 2O5IC 1DOKA 3J80L 4GLXA 2KEDA 2DY8A 2K5NA 1NMGA 2MO1A 4NXML 2KCCA 2EVBA 5IE8A 1YNJD 4PMCA 2D9UA 3NTKA 3QIAA 5CC4A 3HKZE 1S5DD 1SJED 3G71A 4FF2A 4K5XA 2R3ZA 3KK7A 2K52A 2F0FA 1XNQQ 3MXUA 4HIDA 1MJCA 4KJNA 4MN3A 3GTGB 1WTWA 3DWAA 3QWNA 3J7ZC 2ICEC 3ER0A 4B3RQ 3GTLB 1CKNA 4X66Q 3KUPA 1WI5A 2QDBA 1KAWA 1PH9A 1UE5A 3CRKC 4DK6C 2FFKB 4IN3A 2QEXA 1JORA 2OWOA 2UU9L 3CCQA 1X3FA 1XMOQ 4MNOA 5M5XB 4LNQA 1WYDA 4QJFA 2QDLA 1Q82C 3OIQA 3M85A 3LWUA 3S1NB 2E2JB 2AQ1B 4GKKL 4A3EB 4OIJA 3NXWA 5D3DA 1IYJB 3I4MH 3HEJA 1L1OC 1VQGA 1BDOA 1EYGA 4BY1B 1EWIA 1ET9A 1QE6A 2NVXH 1LYLA 3BG3A 4BY1G 1I6HB 4B3MQ 2XSCA 1Y69U 1RD9D 5C4XB 1UEBA 2F0JA 2A69D 5H1SE 1AEXA 3S1MH 5C4XG 3NWTA 2FMMA 5CMDA 2GA4B 2RBMA 1E1TA 4R8IA 1OTCA 4KD3A 2GVBA 3NSWA 4K6LA 1LV9A 4A3KH 1GHKA 5NUCA 2CHBD 3HOYH 5JJKA 2PMZE 4FNFA 1B70B 3T4AC 3J81i 3J81E 4A3JH 4CJ0B 4DNIA 4UY8C 2PZTA 5JJIA 3S16H 3UDGA 1U4PA 4FXDA 5L37A 1E2VA 1ASZA 4IALA 5ELFA 2VW9A 2L55A 4JI8L 3PIO3 2YV5A 1PYSB 5LL6S 3SK6A 1SNMA 3D31A 2OXPA 2FINB 1ILQA 3FEWX 2GN5A 2IHEA 2NVYB 4KKUA 2NN6I 1TWGH 1HTPA 3NBIA 2NYZD 2DJFC 3KF6B 4JI5Q 1EY8A 4RWSC 4DR1Q 4B9XA 2Z4HA 3KYHC 5GQOA 2DUDA 1SE2A 4K6DA 2E5LQ 1MBYA 4BBRB 1EQTA 1LT6D 4IUVA 3KJPA 2VQFL 1TWCH 1QG7A 1F9SA 4A3CG 4X6AH 2A68D 3T1HL 2K7VA 4JI2Q 1Y1VB 4KHVA 3DEOA 1ICFB 4EQNA 4CBVA 4DV4Q 4ODGA 1M4VA 4GOPB 2EQSA 3CW2C 2V4DA 2CWAA 4NXNL 1SYCA 1HZAA 2CH4W 1ML0D 5JEAJ 2KENA 1G6PA 3PUXA 5FO9B 5IOCA 3DEPA 4HJ7A 1K0RA 4G7HC 1IBML 1IXRA 1RCVD 2MHVA 2L15A 4QB4A 1J5EQ 3H6MA 3HOZB 2WAQG 5IODA 1S3OA 3E0EA 3HOZG 1L0XB 2CQAA 1I4PA 2BCOA 4DK1A 4IPHA 1VQJA 2DJGC 2M2LA 2TMPA 3VYUA 3HOWB 4ZQ3A 4IOAA 3LX0A 2QCPX 2JEAI 3HOWG 2ZTDA 3NE5B 1EYCA 3P7JA 4KV6A 2KJXA 4K5WA 3ZYYX 3M7GA 4QY7A 1VQFA 2A5HA 1VQ6A 4HCSA 3TP5A 2P5ZX 3D8GA 3SK4A 1RF2D 3H94A 2R92G 1X65A 4H44C 3PO3H 2CFMA 1C8CA 3OTOQ 3V2TA 2R92H 5M3MB 2OEOA 5M3MG 4A3LG 4HN7A 1YEZA 4B3SL 2B2WC 3GTOB 3STBC 2QKIC 4DR7Q 1QILA 4A3LH 2IY5B 4JI3Q 3K0XA 1SAPA 4ILWA 1MGSA 1KXLA 2NVQB 2SNMA 2RDHA 4IFDJ 4RGTA 2YU9B 1IW7C 5C0XJ 4ZLTF 1X54A 1JOOA 3SE0A 2RA4A 4ZAIA 1S5FD 4BS9A 1SMYC 3HP3A 3ND9A 1K3BC 4GOPC 2R93G 5A2QE 3K7AH 2EYHA 1HH2P 2VB2X 2KCTA 4AYBB 2FJ2A 1TQOA 2R93H 2L1BA 3R93A 1QNKA 3C3LA 4EQ5A 4ULLA 4XYOA 2E2IB 5CV7A 1U4LA 1CZWA 2HDMA 4LFCQ 1WCMB 2F0HA 5CR3A 4U68A 4A3GH 1RL2A 1WCMG 4BBSH 1K3RA 2Z4IA 3G6JB 3ERSX 4JVZA 1E22A 4JI0L 2NN6G 3MHBA 1PH7A 1CQVA 2PQEA 4IPDA 1HNWQ 1U0LA 3A0JA 1EZ6A 2JEBI 1YJNA 3BVMA 2NN6H 2Z1CA 3JC66 1FJGQ 4JC0A 1NCVA 4DXGA 1HJPA 3NQTA 3T51B 1HRJA 3CCMA 3Q0AA 1XX8A 2JP1A 4DXFA 1TS2A 5IYCG 1TWAH 3AYHB 4JV5Q 3EA6A 5E4XA 1DYQA 3M7NA 5GROA 1V1OA 1SYFA 3KBGA 2O2LD 4B9WA 3CQZH 1KHIA 1PDQA 2E2HH 4LF5L 2IL8A 2E8GA 1RTOA 3R2TA 3CPWA 4RG1A 4RFBA 5E3FA 1B50A 1G2TA 1C48A 4HIOA 1SMXA 3T1YL 5IP7G 4LK1C 1WFQA 3IKJA 2PNRC 5IP7H 3K7UC 1KTKA 5LMUQ 1CA5A 4DAPA 4UPAA 4FXKC 5GADC 1IL2A 4O42A 3ULLA 1VQEA 4BA2I 2JA7B 3E6ZX 1FNWA 3RN5A 2JA7G 1SSOA 4RCOA 3HKSA 3HOUB 1PA6A 1NJIC 3IFTA 3RD4A 2YTXA 3N6RA 2XWBB 5IP9G 1VCIA 4IFDI 1HZ9A 5C0XI 2F3WA 5CYUA 3I91A 1M1KC 1AZQA 5IP9H 2ATWA 2VUMB 4PQXA 4Y7NH 2O4XA 1WTXA 2VUMG 2QGQA 4YY3Q 4FDBA 1PRTB 2Y0SB 2WIIB 4LMQD 2HHHL 3IFDA 1PVOA 2Y0SG 5KNBA 4P74A 4HEDA 3PV0A 3W1BA 2J0TD 4OHJA 4LF8L 3BZCA 3EN2A 1AE2A 1Q1BA 3I72A 4HMIA 2H1EA 5FK9C 1I4GA 2PCFB 1D8LA 2Q8RE 5JOBA 5ELNA 1JWSD 5IT9c 4NB3A 1PYWD 3KDFA 1EWHA 4QQBX 2BDOA 3MTSA 1AZPA 3C1EA 1ICWA 4YWMA 1A6XA 4BXXG 2N49A 1QCBD 1PV4A 1XNRQ 3H3VI 4HJ9A 4WRDA 2BH2A 2B2UC 3P20A 3OWFA 4XQJA 4DV0L 1GUTA 1IBKL 2F52A 3DHQA 5DNFA 2JXMB 3GTMH 1FD7D 3H0GB 1JE4A 1BOSA 3H0GG 4DR6Q 1YNXA 1JICA 3A54A 4YCUA 4C2MB 5IWAL 3QOLA 3AQQA 2SOBA 1DZ1A 1XPUA 2KBNA 5JEAG 4NP5A 5C44H 4J8QA 3HS0C 3RZDH 2QF7A 5GAHC 4MIUA 3B6YA 4JPBW 5M5WH 3E9HA 4FO2A 5CV5A 4DNRB 1W3SA 1PRTC 1R9TB 1PZID 1LABA 4V190 4DR4Q 1KAAA 1VQLA 2HIVA 1J6QA 4JI7Q 2VXWA 1B9MA 3VR3A 1KLUD 4GNXA 2WFWA 1Q8KA 2WINB 1VQ4A 4IZ8A 5TSSA 2B2VC 1MHWC 2PZWA 3I3CA 2JE6I 4BA1I 3MXNB 2BE5D 1F2LA 2AHOB 3JAML 3GTQH 3K0YA 2Z6KC 4POGA 2AQ2B 5I4DA 2FMCA 5BN3A 2B2YA 1BBUA 1TR5A 1CK1A 2BA1A 4AQYQ 1IYVA 3I7FA 1XNQL 4GLVB 3K81C 2HCIA 4XT3B 1IHZA 2F1MA 3A56A 4IFDG 3S14H 3E3XA 3CC2A 5C0XG 2I0QA 3U50C 1I4QA 2VB3X 3CF5A 2PI2A 4WORA 1CM9A 4X62Q 2XIWA 4X66L 5IT9E 4OXPA 3ITPA 3UDFA 2EYMA 5ELEA 2ALYB 2N78A 1K8MA 3W5OA 1QUQB 4E6IA 2MFIA 1K83H 2WKCA 5K36H 1XMOL 3RLFA 3WOEA 4KY7A 1V43A 1CUKA 3NENA 1ENFA 4IO9A 3S9WA 4F8MA 4A93H 1VQ8A 3GQBA 2PW5A 3L2PA 1CTMA 3S2HB 2VQEQ 1ESFA 3I4NH 1WTPA 3EJIA 1R4QB 1D5XC 4LFAQ 1NY4A 1AE3A 2YYZA 2NTTA 4B3ML 1O78A 3PSIA 1NAPA 4G4KA 2JA5G 4C1NK 2JA6B 2IW3A 2NVTB 2JA6G 2F0QA 3L3OC 1KNAA 3NTHA 2JA5H 1PZJD 4PMWA 1SDFA 2A6HD 1EY5A 3KOJA 3NBHA 1I94L 3S1QH 4OO1I 1E1OA 3PUZA 1KDAA 1VQBA 3PMFA 3SR1A 3H3VH 1T5EA 5DM73 2OTJA 4QUCA 4YWLA 1XJVA 2KHJA 3AFQA 1D7QA 1A2TA 2D2CC 1P8LA 3PO2H 3QG1A 4KHPL 3BDLA 1STEA 1TT2A 1HZCA 3MXPA 4CDEC 2PW7A 1JT8A 2R7DA 1O80A 3S15H 2PQAA 5KNCA 1C0AA 1TS4A 2YTYA 1YJ9A 2X6GA 1AFPA 4RGMA 3OOCA 3FKIG 4HR7B 4DNTB 4OWTB 1LO5D 2UUBL 2M00A 1A63A 5BN4A 1SXTA 4RHRA 4DAYB 4FF4A 3FKIH 2OQ0A 3Q8DA 1L0YB 1EIHA 4GKJQ 1EY7A 2KEEA 4DUYQ 4J6HA 1QNUA 4DR1L 3GTKB 3T16A 4DV5Q 3CU7A 1H9SB 1YNJC 2EYJA 3R2IA 1XYIA 2X6LA 3W1GA 2RHSB 4FF1A 2I5MX 2KECA 1EIGA 5IGGA 4XT1B 2UUAQ 2N3SA 5M3FH 3M3YH 2Q2UA 3S24A 4M1UB 1EFID 2IHFA 3FDTA 2Q8IB 4JI2L 3H15A 1PH8A 2XTIA 3K58A 4X3UA 3L0OA 2WB1B 1VQ5A 1Q90A 1B3QA 2WB1G 4IJHA 2R7ZH 4JW0A 4BY7G 4CHTB 1KD1C 1J5EL 4I7AA 5BR8Q 2B2TA 3D6CA 4IUPA 4BY7H 3CMEA 3NEMA 3RZOB 3OMCA 3O13A 1EL0A 4RGNA 4HMJA 2K1BA 3G48A 1DXMA 1BKBA 2ZTCA 5EKKA 5C4ZA 1N32Q 2PYKA 3BDCA 5ELOA 1C9OA 3HG9A 1IBLQ 1UAPA 2F0PA 4KN4C 3OW7A 4NKLA 5EBDA 4XYQA 2VS1A 2XRSD 5IY0A 4ZUIA 2IPKD 3SK8A 5M5YH 4ZKBB 3VYSA 1VQPA 3TSSA 1NTGA 2F03A 5F2DA 3TRZA 1DOMA 3I4MB 3I2ZA 1O7LA 1MSGA 2A69C 1ET6A 4H7BA 3I4MG 2NVXB 4AYBE 1F2MA 5LL6X 3OTOL 1PH4A 4KD4A 4R9WA 5E1FA 4HJ8A 3QR8A 4X3KA 5CV8A 3S1MB 1EYDA 2NBFA 1JOQA 2Z9HA 1STYA 5GAEC 2HIXA 4DR7L 1MKHA 4A3KB 4G7OC 3A74A 4JI3L 3HOYB 4A3KG 1V1PB 4OO1G 2K5DA 3HOYG 3S17H 3AB9A 5JVH3 5CBAE 2NB0A 1K9MC 2A1AA 5KIXA 4JI6L 4OO1H 4A3JB 3I70A 4JBJA 3SGIA 3NWSA 4A3JG 4A3FH 3C1FA 3S16B 5DLQE 3K57A 4WJ4A 5HY6A 2MJ8A 5LMNW 2F0OA 1B3AA 1XTCD 1I6HH 1W6KA 2SDFA 2NUCA 4LFCL 2HDLA 4LF6Q 5KRUA 2A8VA 3I73A 5C4JH 1TWGB 4IUNA 5DEHA 3X3MA 2RCNA 2OCEA 3AEVA 1ENAA 2LFNA 3CCSA 1AW7A 4KTAA 3A7AB 1HNWL 1G291 1VS0A 4DR5Q 4QL5A 2EXZA 3UE0A 3VYRA 1Y8PB 4DV2Q 2CCZA 3F2CA 1FJGL 2BH8A 2A68C 5IGEA 1K0SA 1WTHA 4HIKA 2EZVA 4PZ8A 2B3GA 1TWCB 4FP5D 4L5RC 3HOVH 2G5DA 4XTCS 3A55A 4R4OA 1LTSD 2D5DA 1X55A 4NPSA 3SK5A 1N34Q 2EXDA 1BCPF 1CQFA 1Q46A 1ZYRC 2A6EC 2B63H 5IYBH 1S5BD 2NWGA 3SDZA 1CHPD 4X3SA 3MC0B 3VR5A 3CCRA 1EQVA 4PZ7A 4DR3Q 3GV3A 3MEHA 4DK0A 1BR9A 4JI4Q 1VDZA 3A5ZB 5ELDA 3D0FA 1NBWA 4PG3A 2LKVA 4HJ5A 1CI3M 2Y0SE 1I5FA 4IPCA 1LT4D 1DGSA 2AMCB 2EY1A 1HQRD 1FGBD 3K5OA 4UAIA 4A3BH 2IJ0A 2WAQB 3BDOA 5LMUL 3UI2A 2N8NA 1DM0B 1QVFA 1JCKB 1KLGD 2PNHA 3I55A 4A4IA 3M9BA 3GP7A 3TDQA 1U5KA 5D3IB 3S2DH 1CKNB 1YVCA 3M4YA 2EJMA 1FVIA 3PO3B 4TSSA 1EY9A 5EPJA 3PO3G 2L4NA 2KA7A 3TP8A 2D0OA 2R92B 1SLJA 5C3XA 1W6JA 4YY3L 1N8RC 5KEEA 5E7NA 5EGTA 2VNUD 4DU9A 3VA5A 2K5VA 3OHXC 1HR0W 2LSSA 1JWMD 1WD0A 2N55A 1CSQA 3K5MA 3EROA 1QB5D 4DUZQ 1SN8A 1OXXK 5T1GA 3HKZG 1MD2D 2AWOA 2ZTEA 1N33Q 1RTNA 3PUYA 3K7AB 1HNXQ 4AH6A 5FKAC 1EQQA 4LF4Q 2RSOA 2R93B 1AH9A 4MTKA 3PIPA 4JCVE 2UXCQ 2JYOA 4G7ZC 1EY0A 1T5XD 1BVSA 4F88A 2Q8TA 2KUMA 2UXDQ 4EQOA 1X3GA 1SE4A 4A3GB 1XNRL 4QIWB 4BBSB 2F0DA 1P16A 4C56C 3BJUA 4A3GG 2RQXA 5EKIA 4BBSG 3TP7A 3J7YW 1LTGD 4PZ6A 1Q7YC 1TY0A 4P71A 2F0SA 2F0EA 2PPBC 1SE3A 1FR3A 1XWEA 4A75A 3KF8A 4DR6L 3VDYA 1S40A 3MXGA 1LTTD 3FP9A 1G91A 1EOTA 3Q22A 4PV1C 1IW7D 1BBWA 5LHY1 1JJ2A 4C3HH 2F3VA 5ISRA 1HA5A 4JI8Q 3SHLA 2WV6D 4DV6Q 1TWAB 3L7ZC 4UP8A 1O7YA 1HNZQ 1F2ZA 3J7AF 2WKDA 1HTLD 3C46A 1KQSA
chains in the Genus database with same CATH topology
3J81c 1K73C 1J6QA 3TEHB 4LUVA 4JI7L 3JAMi 4JI7Q 2B29A 2XGTA 4APVA 2NVYH 1L1OB 3EIVA 5JJLA 1B8AA 3CMAA 1PH1A 4JBMA 1JMCA 2MQHA 4OWXB 2JA9A 4GNXA 2WFWA 1Q8KA 1VQ4A 1PHJA 4JI4L 1JB7A 4KLKA 1CKMA 2AKWB 5IYDG 3GTKH 1TXYA 1CKOA 1O7IA 2BA0A 2JE6I 1NE3A 3GO5A 3MXNB 3U4VA 1E24A 4BA1I 5AJ3L 4DR2Q 4A3IH 5IYDH 4BBRG 2AHOB 3GTQH 4GLXA 1VQ7A 1VQNA 4POFA 2K5NA 1NMGA 2MO1A 2Z6KC 3T1HQ 4NXML 1EQRA 5IE8A 4NXMQ 4A3MH 4BBRH 3GTPH 2Q2IA 3MEFA 1Y1VG 4A3CH 1BBUA 3HKZE 1UE1A 3J80c 3G71A 4AQYL 2BA1A 4OONA 4AQYQ 3ICEA 2ZJRA 2K52A 3I7FA 1Y1VH 1XNQL 4GLVB 3RR5A 1XNQQ 3K81C 3K8AA 4HIDA 1MJCA 3UDXA 4IFDG 3S14H 4GS3A 3UE1A 5C0XG 1OXVA 3KLWA 1XPRA 1M90C 2I0QA 3CC2A 3U50C 5FLXc 3CF5A 3J7ZC 1YZ6A 2PI2A 1GKHA 4JOIA 4X62L 4X62Q 3ER0A 4X66L 1VQMA 1CKNA 4OXPA 4X66Q 3RN2A 4B3RQ 3G6EA 1WI5A 1VQCA 1KAWA 3UDFA 1PH9A 1UE5A 2EIFA 1XPOA 4DK6C 1LM0A 2ALYB 1GO3E 2N78A 4LWCA 2QEXA 3HOZH 1A0IA 1QUQB 1N9WA 2MFIA 3W5OA 2ZJPA 1K83H 2OWOA 2UU9L 2F4VQ 3CCQA 2UU9Q 3BZKA 1XMOL 1X3FA 1XMOQ 4POGA 4MNOA 3PGZA 3RLFA 3HOWH 1SRUA 1V43A 1CUKA 3NENA 1WYDA 4QJFA 1Q82C 4LNQA 3K80C 3WWVA 3M85A 2JK8A 4MTNA 4IO9A 2K50A 4GKKL 4GKKQ 3CCEA 1OXUA 4A93H 1VQ8A 4WJ3M 3L2PA 1IYJB 2VQEL 1JE5A 2VQEQ 3I4NH 3I4MH 1L1OC 1VQGA 1EYGA 1EWIA 4L5QA 4A76A 4L5SA 1EFWA 2NVXH 1LYLA 4LFAL 4LFAQ 4BY1G 1NY4A 1AE3A 2YYZA 4XIGS 1QZGA 1EIYB 4B3ML 4B3MQ 3PSIA 4X64L 4X64Q 1UEBA 2R6GA 2JA5G 1T9HA 5H1SE 1FGUA 5M3MH 3S1MH 5C4XG 2JA6G 4C3JH 1YITA 4DV3L 2JA5H 4DV3Q 1E1TA 1OTCA 4PMWA 2K4KA 1I94L 3KOJA 2GVBA 2Z6KA 1VQOA 1S72A 4OWWB 1E1OA 3S1QH 3PUZA 4OO1I 1Q12A 1VQBA 3GTOH 4A3KH 3H3VH 4JI6Q 1Y14B 3HOYH 2OTJA 4YWLA 1XJVA 2KHJA 2NVQH 5EAYA 5JJKA 1EIFA 1A8VA 2PMZE 3J81i 1B70B 3AFQA 3STBD 1D7QA 2YU9H 1X56A 1P8LA 3PO2H 2KHIA 3KJOA 4KHPL 4A3JH 2CQOA 5C44G 1HZCA 4DNIA 4UY8C 2MNAA 5JJIA 4AYBG 1JT8A 3CCVA 2R7DA 3UDGA 3S16H 3S15H 2HT1A 2PQAA 1ASZA 2VW9A 3DLLA 1NMFA 4JI8L 1C0AA 2YTYA 5FJ8H 1YJ9A 1B7YB 2YV5A 2VL6A 1PYSB 2LXKA 2K75A 3FKIG 3D31A 3J81j 4OWTB 4GN5A 2UUBL 2OTLA 2E2IH 1A63A 2K14A 2WB1E 4DAYB 4RMFA 2ZJQA 3FKIH 2GN5A 2IHEA 2KCMA 2OQ0A 4DR4L 1WCMH 3Q8DA 3HOXH 1LTLA 3CP0A 3GTJH 2NN6I 4GKJQ 2I5HA 2JQOA 1TWGH 4AIMA 4DUYL 4DUYQ 1IZ6A 1ASYA 3KF6B 4KHZA 3J80i 4JI5Q 1PH2A 5FLMG 4DR1L 4DR1Q 3TREA 4DV5L 1KRSA 4YCVA 4DV5Q 3KYHC 3F2BA 3U58A 5FLMH 1Y1WH 3GDEA 4LFBL 4LFBQ 4LF9L 4LF9Q 1L1OA 5GQOA 4A3IG 2DUDA 3W1GA 1I3QH 4ME3A 2RHSB 2E5LQ 2JA8G 3UDIA 2I5MX 2AWNA 4IPGA 1SFOH 2FXQA 1CSPA 2A19A 3KJPA 3RLOA 2VQFL 2VQFQ 1JJCB 1TWCH 3TS0A 4A3MG 2UUAQ 1KIXA 2N3SA 2UUAL 4R4QA 5M3FH 2JA8H 3M3YH 2Q2UA 1L2FA 5IYCH 4A3BG 3S24A 4A3CG 3T1HL 4X6AH 2IHFA 3I4OA 4JI2L 4JI2Q 3H15A 1PH8A 1KL9A 2XTIA 1N36L 3L0OA 3G4SA 1PH6A 1N36Q 4DV4Q 4GN4B 4GOPB 1EOVA 2EQSA 1VQ5A 3CW2C 1VQ9A 2CWAA 2VZAA 2WB1G 4NXNL 4NXNQ 5HGQA 2CKZB 4IJHA 1HZAA 3PF5A 5JEAJ 2NZHA 1Z9FA 1VQHA 1TWHH 2JJQA 2KENA 2R7ZH 1G6PA 3OW2A 3PUXA 1YJWA 4BY7G 4HJ7A 2Z0SA 1K0RA 1IBML 1IXRA 1KD1C 1IBMQ 3CC7A 1J5EL 2L15A 5BR8L 5BR8Q 1J5EQ 5GAGC 4BY7H 3CMEA 3NEMA 2WAQG 3M4PA 4B3RL 3CCLA 1QVCA 3G48A 1BKBA 1S3OA 1YHAA 2ZTCA 3E0EA 3HOZG 1N32L 1N32Q 4IPHA 5ELOA 1C9OA 1IBLL 1VQJA 4JBWA 1IBLQ 5K36G 2YTVA 4IOAA 3ULPA 2DGYA 4A3DH 2VS1A 2JEAI 3HOWG 2ZTDA 5IY0A 4O2DA 5M5YH 1VQPA 2JA7H 3HOUG 2OQKA 1SROA 1MIUA 1NTGA 4QY7A 1XMQQ 3I56A 1XMQL 4LF7L 1VQFA 1X9NA 4LF7Q 1QUQA 3TRZA 1VQ6A 3HOUH 3CCUA 4K0KQ 3I2ZA 4K0KL 1XTDA 2IT1A 3I4MG 3I4NG 4AYBE 2R92G 1E7ZA 1X65A 3PO3H 2CFMA 3OTOL 3OTOQ 1PH4A 1I50H 4HJ8A 2VUMH 2WP8J 2R92H 4UP7A 1LUZA 2LXJA 2RHQB 2ID0A 5M3MG 4A3LG 1UE6A 2C35B 3EBEA 5GAEC 1YEZA 2HIXA 4B3SL 4X65L 4B3SQ 4X65Q 4DR7L 1MKHA 3PUWA 3STBC 4EX5A 4DR7Q 4A3LH 3A74A 4JI3L 5C3EG 4JI3Q 4DK3C 2IY5B 4A3KG 3K0XA 4R4IA 4OO1G 1Z47A 1KXLA 3HOYG 3KDFB 1VQIA 3S17H 4Y52H 5C3EH 4IFDJ 5C0XJ 1K9MC 2A1AA 4YWKA 4JI6L 1X54A 4JG2A 1GD7A 3S1RH 4JBJA 3PO2G 3SGIA 1SR3A 4A3JG 4A3FH 2ES2A 3CC4A 4GN3B 5DLQE 1GM5A 4GOPC 2R93G 4WJ4A 5HY6A 3K7AH 1OXSC 2D62A 3CD6A 1HH2P 3FHWA 4JBKA 5LMNW 2KCTA 4L5TA 1TWFH 1H95A 1SE8A 2R93H 4H02A 3DM3A 2NZOA 1X6OA 1YI2A 4EQ5A 1K8AC 1I6HH 5FJ8G 3NELA 4BXXH 3PUVA 4LFCL 4LFCQ 3KF8B 2V1CC 4LF6Q 1YIJA 4OX9L 2A8VA 2F4VL 4KI0A 4A3GH 1RL2A 1WCMG 3M4QA 5C4JH 3HOXG 1K3RA 4BBSH 2RCNA 2UXBL 1PFSA 2OCEA 2UXBQ 3AEVA 3BU2A 3CCSA 3J7A5 3ERSX 1VQAA 3CCJA 1E22A 4JI0L 2NN6G 4HJAA 4JI0Q 1PH7A 4GKJL 4A93G 4DAMA 1UWVA 4IPDA 1G291 1HNWQ 4IOCA 1HNWL 1U0LA 3A0JA 1VS0A 2JEBI 4DR5L 3H0GH 3ZJYC 4DR5Q 1YJNA 1A62A 4QL5A 4R4TA 4JI5L 4OX9Q 3UE0A 1V9PA 3ULJA 4DV2Q 3JC66 1Y1WG 2CCZA 3F2CA 1FJGL 1FJGQ 1QZHA 2BH8A 3GD7A 4JC0A 1QVGA 2WAQE 4C2MH 3PCOB 1PYBA 1HJPA 4MZ9A 4HIKA 1VQKA 4PZ8A 3CCMA 4P72A 3KF6A 2B3GA 4L5RC 3HOVH 4C3IH 4XTCS 2E5LL 4R4OA 4J15A 4NPSA 1VQDA 1X55A 5M3FG 1N34L 1N34Q 2EXDA 5IYCG 1TWAH 1Q46A 4DPGA 1WJJA 2MO0A 3AYHB 4GNXB 2B63H 2PI2E 4JV5Q 3M7NA 1L0WA 5GROA 5IYBH 1R9TH 1YHBA 1Q81C 3TS2A 3CCRA 4YCWA 4PZ7A 4DV4L 1RIPA 4DR3L 3CQZH 4DR3Q 2R7ZG 1KHIA 2E2HH 4JI4Q 4LF5L 3CPWA 2E8GA 4LF5Q 5LMNL 1W2BA 5LMNQ 4RG1A 4YHHL 3A5ZB 4YHHQ 2R7FA 3D0FA 3AFPA 4HIOA 1NBWA 1SMXA 4PG3A 2D0PA 3M4OH 4HJ5A 3T1YL 4GOPA 3T1YQ 2Y0SE 5IP7G 1I5FA 4IPCA 1WFQA 1DGSA 2AMCB 4LW1A 5AJ3Q 1GVPA 3HFZB 1FL0A 4A3BH 4LUZA 5LMUL 5IP7H 3K7UC 5LMUQ 2N8NA 3KFUA 4UPAA 5GADC 1IL2A 3E9IA 1VQEA 3ULLA 1WOCA 4UP9A 4BA2I 4A3DG 1YBYA 3CXCA 3JAMc 1Q86C 1QVFA 2PNHA 3RN5A 4LUOA 4B3TL 4B3TQ 1UE7A 2JA7G 3I55A 4A4IA 3M9BA 3HKSA 1PA6A 1NJIC 4DV1L 1U5KA 2YTXA 4DV1Q 1KC8C 1G51A 3S2DH 1EUJA 1CKNB 1YVCA 3PIOA 5IP9G 1VCIA 4IFDI 1HZ9A 1FVIA 3F2DA 5C0XI 2QA4A 1YHQA 3PO3G 2IX0A 1M1KC 1X3EA 4R1JA 2D0OA 4GLAC 4O0AA 4DKAC 5IP9H 1SLJA 3RLNA 4Y7NH 2ATWA 2HQLA 3GTGH 2VUMG 4JYAL 2QGQA 4YY3L 4YY3Q 1N8RC 1C7YA 4JYAQ 1PH5A 5J3BA 5E7NA 4FDBA 2VNUD 2F3IA 3RZOH 4QIWE 2K5HA 1Q1EA 2K5VA 2HHHL 4P75A 2HHHQ 1HR0W 3GTLH 1PVOA 2Y0SG 2LSSA 3LGJA 1V1QA 1PH3A 4P74A 2UUCL 2UUCQ 1CSQA 3PV0A 3W1BA 4R4CA 4DUZL 4LF8L 4DUZQ 4LF8Q 1SN8A 1OXXK 4P73A 4DV7L 2ZM6L 4DV7Q 2ZM6Q 3CAMA 3TQYA 3BZCA 4QGUA 3HKZG 5M5XH 3EN2A 4GNXC 1AE2A 1Q1BA 2AWOA 2ZTEA 2Q2TA 1N33L 1N33Q 4A3EG 3PUYA 4A3FG 1HNXL 2ASBA 1HNXQ 1D8LA 1OXTA 5ELNA 4AH6A 5IT9c 4DR2L 2E2JH 3S1NH 4NB3A 2VY3A 1EQQA 4LF4L 4LF4Q 1AH9A 4A3EH 3KDFA 4QQBX 3PIPA 2UXCL 4JCVE 2UXCQ 4IJLA 3S2HH 3NBHB 4HIMA 1JJGA 4TQUS 2I5LX 4YWMA 1BVSA 4BY1H 4ALPA 1K8GA 4BXXG 2UXDL 2UXDQ 3A5UA 2N49A 1X3GA 1XNRL 5C4XH 1PV4A 1XNRQ 1I94Q 4HJ9A 3H3VI 1P16A 2BH2A 3OYYA 2JA6H 3BJUA 4TVAB 4A3GG 4BBSG 2NVTH 4LF6L 4PZ6A 3IRBA 1Q7YC 1IBKL 4DV0L 1IBKQ 4DV0Q 2F52A 4P71A 3GTMH 3F8TA 4A75A 2PQAB 3H0GG 2IX1A 1E3PA 3U4ZA 2GVAA 4DR6L 4DR6Q 1YNXA 3VDYA 1S40A 4KHPQ 4YCUA 5IWAL 1MJEA 3AQQA 3FP9A 4JOIC 5IWAQ 3PF4A 1XPUA 2KBNA 5JEAG 5C44H 1BBWA 4DV2L 1JJ2A 2RF4A 4C3HH 3RNUA 3RZDH 1HZBA 1KRTA 3CPFA 4JI8Q 2H5XA 5GAHC 1HR0L 1HR0Q 3HOVG 4DV6L 3B6YA 4DV6Q 3L7ZC 4UP8A 5M5WH 3E9HA 2Q2HA 1HNZL 2UUBQ 1HNZQ 1W3SA 4JI1L 4JI1Q 2B63G 2CWPA 4DR4Q 5IYBG 3F1ZA 1VQLA 2HIVA 1KQSA 4JV5L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 c;  1K73 C;  1J6Q A;  3TEH B;  4LUV A;  4JI7 L;  3JAM i;  4JI7 Q;  2B29 A;  2XGT A;  4APV A;  2NVY H;  1L1O B;  3EIV A;  5JJL A;  1B8A A;  3CMA A;  1PH1 A;  4JBM A;  1JMC A;  2MQH A;  4OWX B;  2JA9 A;  4GNX A;  2WFW A;  1Q8K A;  1VQ4 A;  1PHJ A;  4JI4 L;  1JB7 A;  4KLK A;  1CKM A;  2AKW B;  5IYD G;  3GTK H;  1TXY A;  1CKO A;  1O7I A;  2BA0 A;  2JE6 I;  1NE3 A;  3GO5 A;  3MXN B;  3U4V A;  1E24 A;  4BA1 I;  5AJ3 L;  4DR2 Q;  4A3I H;  5IYD H;  4BBR G;  2AHO B;  3GTQ H;  4GLX A;  1VQ7 A;  1VQN A;  4POF A;  2K5N A;  1NMG A;  2MO1 A;  2Z6K C;  3T1H Q;  4NXM L;  1EQR A;  5IE8 A;  4NXM Q;  4A3M H;  4BBR H;  3GTP H;  2Q2I A;  3MEF A;  1Y1V G;  4A3C H;  1BBU A;  3HKZ E;  1UE1 A;  3J80 c;  3G71 A;  4AQY L;  2BA1 A;  4OON A;  4AQY Q;  3ICE A;  2ZJR A;  2K52 A;  3I7F A;  1Y1V H;  1XNQ L;  4GLV B;  3RR5 A;  1XNQ Q;  3K81 C;  3K8A A;  4HID A;  1MJC A;  3UDX A;  4IFD G;  3S14 H;  4GS3 A;  3UE1 A;  5C0X G;  1OXV A;  3KLW A;  1XPR A;  1M90 C;  2I0Q A;  3CC2 A;  3U50 C;  5FLX c;  3CF5 A;  3J7Z C;  1YZ6 A;  2PI2 A;  1GKH A;  4JOI A;  4X62 L;  4X62 Q;  3ER0 A;  4X66 L;  1VQM A;  1CKN A;  4OXP A;  4X66 Q;  3RN2 A;  4B3R Q;  3G6E A;  1WI5 A;  1VQC A;  1KAW A;  3UDF A;  1PH9 A;  1UE5 A;  2EIF A;  1XPO A;  4DK6 C;  1LM0 A;  2ALY B;  1GO3 E;  2N78 A;  4LWC A;  2QEX A;  3HOZ H;  1A0I A;  1QUQ B;  1N9W A;  2MFI A;  3W5O A;  2ZJP A;  1K83 H;  2OWO A;  2UU9 L;  2F4V Q;  3CCQ A;  2UU9 Q;  3BZK A;  1XMO L;  1X3F A;  1XMO Q;  4POG A;  4MNO A;  3PGZ A;  3RLF A;  3HOW H;  1SRU A;  1V43 A;  1CUK A;  3NEN A;  1WYD A;  4QJF A;  1Q82 C;  4LNQ A;  3K80 C;  3WWV A;  3M85 A;  2JK8 A;  4MTN A;  4IO9 A;  2K50 A;  4GKK L;  4GKK Q;  3CCE A;  1OXU A;  4A93 H;  1VQ8 A;  4WJ3 M;  3L2P A;  1IYJ B;  2VQE L;  1JE5 A;  2VQE Q;  3I4N H;  3I4M H;  1L1O C;  1VQG A;  1EYG A;  1EWI A;  4L5Q A;  4A76 A;  4L5S A;  1EFW A;  2NVX H;  1LYL A;  4LFA L;  4LFA Q;  4BY1 G;  1NY4 A;  1AE3 A;  2YYZ A;  4XIG S;  1QZG A;  1EIY B;  4B3M L;  4B3M Q;  3PSI A;  4X64 L;  4X64 Q;  1UEB A;  2R6G A;  2JA5 G;  1T9H A;  5H1S E;  1FGU A;  5M3M H;  3S1M H;  5C4X G;  2JA6 G;  4C3J H;  1YIT A;  4DV3 L;  2JA5 H;  4DV3 Q;  1E1T A;  1OTC A;  4PMW A;  2K4K A;  1I94 L;  3KOJ A;  2GVB A;  2Z6K A;  1VQO A;  1S72 A;  4OWW B;  1E1O A;  3S1Q H;  3PUZ A;  4OO1 I;  1Q12 A;  1VQB A;  3GTO H;  4A3K H;  3H3V H;  4JI6 Q;  1Y14 B;  3HOY H;  2OTJ A;  4YWL A;  1XJV A;  2KHJ A;  2NVQ H;  5EAY A;  5JJK A;  1EIF A;  1A8V A;  2PMZ E;  3J81 i;  1B70 B;  3AFQ A;  3STB D;  1D7Q A;  2YU9 H;  1X56 A;  1P8L A;  3PO2 H;  2KHI A;  3KJO A;  4KHP L;  4A3J H;  2CQO A;  5C44 G;  1HZC A;  4DNI A;  4UY8 C;  2MNA A;  5JJI A;  4AYB G;  1JT8 A;  3CCV A;  2R7D A;  3UDG A;  3S16 H;  3S15 H;  2HT1 A;  2PQA A;  1ASZ A;  2VW9 A;  3DLL A;  1NMF A;  4JI8 L;  1C0A A;  2YTY A;  5FJ8 H;  1YJ9 A;  1B7Y B;  2YV5 A;  2VL6 A;  1PYS B;  2LXK A;  2K75 A;  3FKI G;  3D31 A;  3J81 j;  4OWT B;  4GN5 A;  2UUB L;  2OTL A;  2E2I H;  1A63 A;  2K14 A;  2WB1 E;  4DAY B;  4RMF A;  2ZJQ A;  3FKI H;  2GN5 A;  2IHE A;  2KCM A;  2OQ0 A;  4DR4 L;  1WCM H;  3Q8D A;  3HOX H;  1LTL A;  3CP0 A;  3GTJ H;  2NN6 I;  4GKJ Q;  2I5H A;  2JQO A;  1TWG H;  4AIM A;  4DUY L;  4DUY Q;  1IZ6 A;  1ASY A;  3KF6 B;  4KHZ A;  3J80 i;  4JI5 Q;  1PH2 A;  5FLM G;  4DR1 L;  4DR1 Q;  3TRE A;  4DV5 L;  1KRS A;  4YCV A;  4DV5 Q;  3KYH C;  3F2B A;  3U58 A;  5FLM H;  1Y1W H;  3GDE A;  4LFB L;  4LFB Q;  4LF9 L;  4LF9 Q;  1L1O A;  5GQO A;  4A3I G;  2DUD A;  3W1G A;  1I3Q H;  4ME3 A;  2RHS B;  2E5L Q;  2JA8 G;  3UDI A;  2I5M X;  2AWN A;  4IPG A;  1SFO H;  2FXQ A;  1CSP A;  2A19 A;  3KJP A;  3RLO A;  2VQF L;  2VQF Q;  1JJC B;  1TWC H;  3TS0 A;  4A3M G;  2UUA Q;  1KIX A;  2N3S A;  2UUA L;  4R4Q A;  5M3F H;  2JA8 H;  3M3Y H;  2Q2U A;  1L2F A;  5IYC H;  4A3B G;  3S24 A;  4A3C G;  3T1H L;  4X6A H;  2IHF A;  3I4O A;  4JI2 L;  4JI2 Q;  3H15 A;  1PH8 A;  1KL9 A;  2XTI A;  1N36 L;  3L0O A;  3G4S A;  1PH6 A;  1N36 Q;  4DV4 Q;  4GN4 B;  4GOP B;  1EOV A;  2EQS A;  1VQ5 A;  3CW2 C;  1VQ9 A;  2CWA A;  2VZA A;  2WB1 G;  4NXN L;  4NXN Q;  5HGQ A;  2CKZ B;  4IJH A;  1HZA A;  3PF5 A;  5JEA J;  2NZH A;  1Z9F A;  1VQH A;  1TWH H;  2JJQ A;  2KEN A;  2R7Z H;  1G6P A;  3OW2 A;  3PUX A;  1YJW A;  4BY7 G;  4HJ7 A;  2Z0S A;  1K0R A;  1IBM L;  1IXR A;  1KD1 C;  1IBM Q;  3CC7 A;  1J5E L;  2L15 A;  5BR8 L;  5BR8 Q;  1J5E Q;  5GAG C;  4BY7 H;  3CME A;  3NEM A;  2WAQ G;  3M4P A;  4B3R L;  3CCL A;  1QVC A;  3G48 A;  1BKB A;  1S3O A;  1YHA A;  2ZTC A;  3E0E A;  3HOZ G;  1N32 L;  1N32 Q;  4IPH A;  5ELO A;  1C9O A;  1IBL L;  1VQJ A;  4JBW A;  1IBL Q;  5K36 G;  2YTV A;  4IOA A;  3ULP A;  2DGY A;  4A3D H;  2VS1 A;  2JEA I;  3HOW G;  2ZTD A;  5IY0 A;  4O2D A;  5M5Y H;  1VQP A;  2JA7 H;  3HOU G;  2OQK A;  1SRO A;  1MIU A;  1NTG A;  4QY7 A;  1XMQ Q;  3I56 A;  1XMQ L;  4LF7 L;  1VQF A;  1X9N A;  4LF7 Q;  1QUQ A;  3TRZ A;  1VQ6 A;  3HOU H;  3CCU A;  4K0K Q;  3I2Z A;  4K0K L;  1XTD A;  2IT1 A;  3I4M G;  3I4N G;  4AYB E;  2R92 G;  1E7Z A;  1X65 A;  3PO3 H;  2CFM A;  3OTO L;  3OTO Q;  1PH4 A;  1I50 H;  4HJ8 A;  2VUM H;  2WP8 J;  2R92 H;  4UP7 A;  1LUZ A;  2LXJ A;  2RHQ B;  2ID0 A;  5M3M G;  4A3L G;  1UE6 A;  2C35 B;  3EBE A;  5GAE C;  1YEZ A;  2HIX A;  4B3S L;  4X65 L;  4B3S Q;  4X65 Q;  4DR7 L;  1MKH A;  3PUW A;  3STB C;  4EX5 A;  4DR7 Q;  4A3L H;  3A74 A;  4JI3 L;  5C3E G;  4JI3 Q;  4DK3 C;  2IY5 B;  4A3K G;  3K0X A;  4R4I A;  4OO1 G;  1Z47 A;  1KXL A;  3HOY G;  3KDF B;  1VQI A;  3S17 H;  4Y52 H;  5C3E H;  4IFD J;  5C0X J;  1K9M C;  2A1A A;  4YWK A;  4JI6 L;  1X54 A;  4JG2 A;  1GD7 A;  3S1R H;  4JBJ A;  3PO2 G;  3SGI A;  1SR3 A;  4A3J G;  4A3F H;  2ES2 A;  3CC4 A;  4GN3 B;  5DLQ E;  1GM5 A;  4GOP C;  2R93 G;  4WJ4 A;  5HY6 A;  3K7A H;  1OXS C;  2D62 A;  3CD6 A;  1HH2 P;  3FHW A;  4JBK A;  5LMN W;  2KCT A;  4L5T A;  1TWF H;  1H95 A;  1SE8 A;  2R93 H;  4H02 A;  3DM3 A;  2NZO A;  1X6O A;  1YI2 A;  4EQ5 A;  1K8A C;  1I6H H;  5FJ8 G;  3NEL A;  4BXX H;  3PUV A;  4LFC L;  4LFC Q;  3KF8 B;  2V1C C;  4LF6 Q;  1YIJ A;  4OX9 L;  2A8V A;  2F4V L;  4KI0 A;  4A3G H;  1RL2 A;  1WCM G;  3M4Q A;  5C4J H;  3HOX G;  1K3R A;  4BBS H;  2RCN A;  2UXB L;  1PFS A;  2OCE A;  2UXB Q;  3AEV A;  3BU2 A;  3CCS A;  3J7A 5;  3ERS X;  1VQA A;  3CCJ A;  1E22 A;  4JI0 L;  2NN6 G;  4HJA A;  4JI0 Q;  1PH7 A;  4GKJ L;  4A93 G;  4DAM A;  1UWV A;  4IPD A;  1G29 1;  1HNW Q;  4IOC A;  1HNW L;  1U0L A;  3A0J A;  1VS0 A;  2JEB I;  4DR5 L;  3H0G H;  3ZJY C;  4DR5 Q;  1YJN A;  1A62 A;  4QL5 A;  4R4T A;  4JI5 L;  4OX9 Q;  3UE0 A;  1V9P A;  3ULJ A;  4DV2 Q;  3JC6 6;  1Y1W G;  2CCZ A;  3F2C A;  1FJG L;  1FJG Q;  1QZH A;  2BH8 A;  3GD7 A;  4JC0 A;  1QVG A;  2WAQ E;  4C2M H;  3PCO B;  1PYB A;  1HJP A;  4MZ9 A;  4HIK A;  1VQK A;  4PZ8 A;  3CCM A;  4P72 A;  3KF6 A;  2B3G A;  4L5R C;  3HOV H;  4C3I H;  4XTC S;  2E5L L;  4R4O A;  4J15 A;  4NPS A;  1VQD A;  1X55 A;  5M3F G;  1N34 L;  1N34 Q;  2EXD A;  5IYC G;  1TWA H;  1Q46 A;  4DPG A;  1WJJ A;  2MO0 A;  3AYH B;  4GNX B;  2B63 H;  2PI2 E;  4JV5 Q;  3M7N A;  1L0W A;  5GRO A;  5IYB H;  1R9T H;  1YHB A;  1Q81 C;  3TS2 A;  3CCR A;  4YCW A;  4PZ7 A;  4DV4 L;  1RIP A;  4DR3 L;  3CQZ H;  4DR3 Q;  2R7Z G;  1KHI A;  2E2H H;  4JI4 Q;  4LF5 L;  3CPW A;  2E8G A;  4LF5 Q;  5LMN L;  1W2B A;  5LMN Q;  4RG1 A;  4YHH L;  3A5Z B;  4YHH Q;  2R7F A;  3D0F A;  3AFP A;  4HIO A;  1NBW A;  1SMX A;  4PG3 A;  2D0P A;  3M4O H;  4HJ5 A;  3T1Y L;  4GOP A;  3T1Y Q;  2Y0S E;  5IP7 G;  1I5F A;  4IPC A;  1WFQ A;  1DGS A;  2AMC B;  4LW1 A;  5AJ3 Q;  1GVP A;  3HFZ B;  1FL0 A;  4A3B H;  4LUZ A;  5LMU L;  5IP7 H;  3K7U C;  5LMU Q;  2N8N A;  3KFU A;  4UPA A;  5GAD C;  1IL2 A;  3E9I A;  1VQE A;  3ULL A;  1WOC A;  4UP9 A;  4BA2 I;  4A3D G;  1YBY A;  3CXC A;  3JAM c;  1Q86 C;  1QVF A;  2PNH A;  3RN5 A;  4LUO A;  4B3T L;  4B3T Q;  1UE7 A;  2JA7 G;  3I55 A;  4A4I A;  3M9B A;  3HKS A;  1PA6 A;  1NJI C;  4DV1 L;  1U5K A;  2YTX A;  4DV1 Q;  1KC8 C;  1G51 A;  3S2D H;  1EUJ A;  1CKN B;  1YVC A;  3PIO A;  5IP9 G;  1VCI A;  4IFD I;  1HZ9 A;  1FVI A;  3F2D A;  5C0X I;  2QA4 A;  1YHQ A;  3PO3 G;  2IX0 A;  1M1K C;  1X3E A;  4R1J A;  2D0O A;  4GLA C;  4O0A A;  4DKA C;  5IP9 H;  1SLJ A;  3RLN A;  4Y7N H;  2ATW A;  2HQL A;  3GTG H;  2VUM G;  4JYA L;  2QGQ A;  4YY3 L;  4YY3 Q;  1N8R C;  1C7Y A;  4JYA Q;  1PH5 A;  5J3B A;  5E7N A;  4FDB A;  2VNU D;  2F3I A;  3RZO H;  4QIW E;  2K5H A;  1Q1E A;  2K5V A;  2HHH L;  4P75 A;  2HHH Q;  1HR0 W;  3GTL H;  1PVO A;  2Y0S G;  2LSS A;  3LGJ A;  1V1Q A;  1PH3 A;  4P74 A;  2UUC L;  2UUC Q;  1CSQ A;  3PV0 A;  3W1B A;  4R4C A;  4DUZ L;  4LF8 L;  4DUZ Q;  4LF8 Q;  1SN8 A;  1OXX K;  4P73 A;  4DV7 L;  2ZM6 L;  4DV7 Q;  2ZM6 Q;  3CAM A;  3TQY A;  3BZC A;  4QGU A;  3HKZ G;  5M5X H;  3EN2 A;  4GNX C;  1AE2 A;  1Q1B A;  2AWO A;  2ZTE A;  2Q2T A;  1N33 L;  1N33 Q;  4A3E G;  3PUY A;  4A3F G;  1HNX L;  2ASB A;  1HNX Q;  1D8L A;  1OXT A;  5ELN A;  4AH6 A;  5IT9 c;  4DR2 L;  2E2J H;  3S1N H;  4NB3 A;  2VY3 A;  1EQQ A;  4LF4 L;  4LF4 Q;  1AH9 A;  4A3E H;  3KDF A;  4QQB X;  3PIP A;  2UXC L;  4JCV E;  2UXC Q;  4IJL A;  3S2H H;  3NBH B;  4HIM A;  1JJG A;  4TQU S;  2I5L X;  4YWM A;  1BVS A;  4BY1 H;  4ALP A;  1K8G A;  4BXX G;  2UXD L;  2UXD Q;  3A5U A;  2N49 A;  1X3G A;  1XNR L;  5C4X H;  1PV4 A;  1XNR Q;  1I94 Q;  4HJ9 A;  3H3V I;  1P16 A;  2BH2 A;  3OYY A;  2JA6 H;  3BJU A;  4TVA B;  4A3G G;  4BBS G;  2NVT H;  4LF6 L;  4PZ6 A;  3IRB A;  1Q7Y C;  1IBK L;  4DV0 L;  1IBK Q;  4DV0 Q;  2F52 A;  4P71 A;  3GTM H;  3F8T A;  4A75 A;  2PQA B;  3H0G G;  2IX1 A;  1E3P A;  3U4Z A;  2GVA A;  4DR6 L;  4DR6 Q;  1YNX A;  3VDY A;  1S40 A;  4KHP Q;  4YCU A;  5IWA L;  1MJE A;  3AQQ A;  3FP9 A;  4JOI C;  5IWA Q;  3PF4 A;  1XPU A;  2KBN A;  5JEA G;  5C44 H;  1BBW A;  4DV2 L;  1JJ2 A;  2RF4 A;  4C3H H;  3RNU A;  3RZD H;  1HZB A;  1KRT A;  3CPF A;  4JI8 Q;  2H5X A;  5GAH C;  1HR0 L;  1HR0 Q;  3HOV G;  4DV6 L;  3B6Y A;  4DV6 Q;  3L7Z C;  4UP8 A;  5M5W H;  3E9H A;  2Q2H A;  1HNZ L;  2UUB Q;  1HNZ Q;  1W3S A;  4JI1 L;  4JI1 Q;  2B63 G;  2CWP A;  4DR4 Q;  5IYB G;  3F1Z A;  1VQL A;  2HIV A;  1KQS A;  4JV5 L; 
#chains in the Genus database with same CATH topology
 3CQZ B;  1K73 C;  2OT2 A;  4JI7 L;  1HFN A;  2E2H B;  2B29 A;  2XGT A;  4APV A;  3EIV A;  5EJW A;  3CMA A;  2XRQ D;  4JBM A;  1JMC A;  3I8Z A;  2L0C A;  4K8J A;  1PHJ A;  1JB7 A;  2O5J C;  1GJX A;  1SNO A;  5IYD G;  1O7I A;  4DR2 Q;  5AJ3 L;  4A3I H;  3J7A V;  5IYD H;  1VQ7 A;  3T1H Q;  1EYA A;  2DY7 A;  1STN A;  1DD2 A;  4A3M H;  3DUZ A;  3GTP H;  3MEF A;  1PXU A;  1RJT A;  5I6Y A;  1HHV A;  3SEB A;  4AQY L;  4OON A;  3Q24 A;  3ICE A;  2HUG A;  3OPO A;  3RR5 A;  3K8A A;  2F0N A;  4Y7N B;  3UDX A;  3V96 A;  3QOJ A;  3KLW A;  1XPR A;  5FLX c;  1YZ6 A;  2AUJ D;  4K2K A;  5I2X A;  4JOI A;  4X62 L;  3IL8 A;  1B44 D;  2FHT A;  4NMZ A;  1ILP A;  2EIF A;  1LM0 A;  4LWC A;  1GO3 E;  1SYG A;  1N9W A;  2AUK A;  2F4V Q;  3TS2 A;  1QWY A;  4C1N I;  5M9O A;  3BZK A;  3I90 A;  5I6W A;  1GUG A;  5COY A;  2K33 A;  5KYL A;  1I6V C;  3WWV A;  4MTN A;  1Z6H A;  4L8J A;  3RUZ A;  3CCE A;  1OXU A;  2F0M A;  2VQE L;  3K6O A;  2E75 C;  4A76 A;  1PLF A;  4L5S A;  4LFA L;  4XIG S;  1EIY B;  1D5M C;  1HFG A;  2LS0 1;  4C3J G;  4X64 Q;  4ZCK A;  1T9H A;  2F0W A;  1FGU A;  2KQ3 A;  3V05 A;  1EY4 A;  4C3J H;  4IUU A;  4DV3 Q;  4TKO B;  1IKM A;  3GTM B;  4OWW B;  1S72 A;  1M8A A;  4FYD A;  1Q12 A;  5KYI A;  3OIP A;  1Y14 B;  3Q6S A;  1B2T A;  3SXH A;  1G2S A;  1KNE A;  5EAY A;  1EIF A;  1A8V A;  1A3T A;  1R4P B;  5C44 B;  2KHI A;  3KJO A;  3QO2 A;  1GUS A;  1B1Z A;  3RZD B;  2JSO A;  5C44 G;  1SND A;  2MNA A;  4YIJ A;  5ELB A;  1CT1 D;  5M5W B;  2HT1 A;  1S5E D;  4TRD A;  4RGO S;  3DLL A;  2RVL A;  5FJ8 H;  1B7Y B;  1HUN A;  2K75 A;  4UDU C;  3J81 j;  1SNP A;  2OTL A;  3J81 L;  2EYF A;  3D6W A;  3ONA B;  5AFW A;  3AMU A;  2WB1 E;  1CHQ D;  2ZJQ A;  1D5Z C;  3HOX H;  1LTL A;  3CP0 A;  3GTJ H;  5COR A;  4AIM A;  5CV4 A;  4DUY L;  1IZ6 A;  1ZEQ X;  1ASY A;  2BE5 C;  2KVM A;  4KHZ A;  1NSN S;  1PH2 A;  1Y8N B;  3TRE A;  4DV5 L;  4LJZ C;  4YCV A;  3U58 A;  1CA6 A;  1UEA B;  1Y1W H;  3GDE A;  1WTV A;  4LFB Q;  4RAU C;  4LF9 Q;  1DOL A;  2MP1 A;  1L1O A;  3GTQ B;  4RCN A;  1STH A;  5FLX E;  1A15 A;  1I3Q H;  4ID6 A;  2JA8 G;  3UDI A;  2AWN A;  2K03 A;  4RKL A;  1SFO H;  2A19 A;  3RLO A;  3T53 B;  2UUA L;  4KKS A;  1KIX A;  3E5S A;  2JA8 H;  1L2F A;  3I4O A;  3PIP 3;  3C2P A;  4XQQ A;  3HZX A;  1N36 Q;  3G4S A;  3S14 B;  1TY2 A;  2RDG A;  3EFX D;  4HSP A;  3MVV A;  2K01 A;  3PF5 A;  2NZH A;  1Z9F A;  1FNU A;  1TWH H;  3U9S A;  3P1H A;  1YJW A;  1LAC A;  2Z0S A;  1F77 A;  3CC7 A;  5BR8 L;  1YNN D;  5GAG C;  1F2Y A;  5JAV A;  3FPP A;  2PO4 A;  3M4P A;  4B3R L;  3CCL A;  1QVC A;  1K83 B;  1N32 L;  2E74 C;  3NP8 A;  1O7Z A;  1IBL L;  4DA2 A;  5K36 G;  2YTV A;  2CW0 C;  3X3N A;  4CDF C;  2DGY A;  4A3D H;  2F0V A;  2ZXO A;  4K14 A;  3D4W A;  4O2D A;  1D6E C;  2EE1 A;  1SRO A;  1MIU A;  3H91 A;  1XMQ Q;  4A93 G;  3I56 A;  4LF7 Q;  3A7L A;  4ZKC B;  4K0K Q;  4CKB A;  2IT1 A;  3I4N G;  1E7Z A;  2A6H C;  5J22 A;  1WTR A;  1GUN A;  1I50 H;  2WP8 J;  4KY6 A;  1ROD A;  2NZ1 D;  2LXJ A;  1PTO H;  1I4X A;  2JA5 B;  4CJ1 B;  3TZU A;  3S1Q B;  1X3Q A;  4X65 Q;  3PUW A;  3NQI A;  1B9N A;  4EX5 A;  5C3E G;  2K5W A;  4DK3 C;  1LT3 D;  4R4I A;  2DNE A;  4Y52 H;  3KDF B;  5C3E H;  3PO2 B;  4YWK A;  2B8G A;  1NR2 A;  1BUV T;  1GD7 A;  4JG2 A;  3S1R H;  3CHB D;  4G57 A;  3PO2 G;  4QCL A;  2ES2 A;  1EEI D;  3QJY A;  4IUR A;  2KCN A;  3S15 B;  4CJ2 C;  1OXS C;  3CD6 A;  3FHW A;  4JBK A;  1TWF H;  2QW7 A;  1SE8 A;  4H02 A;  3DM3 A;  1X6O A;  1YI2 A;  1K8A C;  3NEL A;  1VMP A;  3T56 B;  2ICI A;  5I9P A;  4QMG A;  3PUV A;  3FKI B;  1YIJ A;  1OO9 B;  3K5L A;  5DM6 3;  3M4Q A;  3D3R A;  5A2Q L;  2UXB Q;  3BU2 A;  2K32 A;  4UHV A;  3J7A 5;  4ME5 A;  3CCJ A;  5I9O A;  1TVX A;  4HJA A;  4DAM A;  2K04 A;  1UWV A;  4IOC A;  1E2Z A;  4DR5 L;  5C4H A;  4OX9 Q;  1UUP A;  1A62 A;  4FVM A;  4R4T A;  4JI5 L;  1V9P A;  1B53 A;  3GD7 A;  4K8I A;  1QVG A;  2WAQ E;  3PCO B;  1VQK A;  4I65 A;  1AN8 A;  3KF6 A;  1TS3 A;  1BCP D;  5M3F B;  3M3Y B;  4C3I H;  2E5L L;  1BO0 A;  2ZXR A;  1N34 L;  1VQD A;  2F4I A;  5M3F G;  4K2L A;  4DPG A;  2MO0 A;  4GNX B;  1J9O A;  2IWH A;  2B2W A;  1L0W A;  1EZ8 A;  1YHB A;  4KKT A;  1PTO D;  3H3V C;  4XXE A;  4YCW A;  4RA8 A;  2R7Z B;  4DV4 L;  2E76 C;  1RIP A;  2L12 A;  4DR3 L;  2R7Z G;  1SNC A;  2EOT A;  1STA A;  5LMN Q;  4YHH Q;  2NTS A;  4BY7 B;  3VYT A;  3AFP A;  4O1N A;  3M4O H;  2D0P A;  4GOP A;  1B4O A;  2RSN A;  4LW1 A;  1GVP A;  3HFZ B;  4ZRZ A;  1NR4 A;  3IAY A;  1SNQ A;  3E9I A;  4UP9 A;  4RKB A;  1SYB A;  5M5Y B;  2A73 B;  3K59 A;  3CXC A;  3JAM c;  1H9M A;  2F0I A;  1KDB A;  4B3T Q;  4HAE A;  1Q8I A;  4DV1 Q;  1G51 A;  3EQL C;  1EUJ A;  5E4W C;  3E0J A;  3F2D A;  4CDD C;  5JPN C;  3BVG A;  4CGY B;  2IX0 A;  4R1J A;  4GLA C;  2Z6B A;  4O0A A;  4DKA C;  5I2Y A;  3GTG H;  3A8J E;  2L9H A;  4JYA Q;  2QEJ C;  3BYT B;  2EDG A;  2I46 A;  5J3B A;  5HGT A;  5JPM C;  1PH5 A;  3SVM A;  2F3I A;  5IIF A;  3RZO H;  4QIW E;  1HQM C;  2K5H A;  4Q5V A;  3GTL H;  3LGJ A;  3URY A;  2UUC Q;  5EPL A;  3ND8 A;  4N8X 1;  4XDX A;  2HCC A;  3S17 B;  1LTR D;  4DUZ L;  4P73 A;  4DV7 Q;  2ZM6 Q;  2EY2 A;  2K28 A;  4A3F B;  5M5X H;  3DXJ C;  4GNX C;  1N33 L;  4K5V A;  3BS1 A;  4A3E G;  4A3F G;  1HNX L;  3S1N H;  2E2J H;  4KMU C;  2VY3 A;  4LF4 L;  4A3E H;  2UXC L;  4OIK A;  5G3L D;  3NBH B;  1I4H A;  3DWQ A;  4HIM A;  4S3S A;  2I5L X;  1JJG A;  4WFN 3;  1Q3L A;  4V0B A;  4HCE A;  4BY1 H;  2MPM A;  3ERQ A;  2UXD L;  2XWJ B;  5CV9 A;  5C4J B;  5C4X H;  2RDF A;  2B2Y C;  1I94 Q;  3KLR A;  4TVA B;  3MA2 B;  2CVR A;  3IRB A;  1EWC A;  4B08 A;  3D4R A;  3LNN A;  2J4X A;  1BF4 A;  2PQA B;  1EEF D;  1E3P A;  4OL7 A;  3U4Z A;  4KHP Q;  1S5C D;  5IGD A;  1K28 A;  3PF4 A;  3TZD A;  1WVL A;  2RF4 A;  3HOV B;  1HZB A;  3NTI A;  1GUW A;  1KRT A;  2BDN A;  1ENC A;  2H5X A;  3HOV G;  5C5L A;  1HR0 Q;  4DV6 L;  1TU2 B;  2B63 B;  2Q2H A;  1HNZ L;  2UUB Q;  4JI1 Q;  2B63 G;  4OEM B;  5IYB G;  3F1Z A;  3KBX A;  5CV6 A;  4JV5 L;  5IGC A;  1U9R A;  3JAM i;  3KLS X;  3JAM E;  2NVY H;  3R3O A;  2WAC A;  4OWX B;  1WTO A;  2JA9 A;  1PMR A;  1ESR A;  1PTO F;  4KLK A;  3HGB A;  4DGZ A;  1WTQ A;  4A3B B;  1TXY A;  1CKO A;  3U4V A;  4DR2 L;  4A3B G;  3U9O A;  4ZK9 B;  5K5P A;  4BBR G;  4WJW A;  2SEB D;  1VQN A;  2KOL A;  4POF A;  4NXM Q;  1EQR A;  1H9R A;  3NPP A;  4BBR H;  2Q2I A;  3DM1 A;  1Y1V G;  4A3C H;  2B39 A;  3S2D B;  1UE1 A;  4DN4 M;  2B2U A;  3J80 c;  5BN5 A;  2ZJR A;  1LTI D;  4N9P A;  5FLX L;  1Y1V H;  1ZYR D;  1JC7 A;  4IUQ A;  2A6E D;  2OF1 A;  1HA6 A;  4GS3 A;  3UE1 A;  1OXV A;  1M90 C;  1TII D;  2I07 B;  3PQI A;  2J7Z A;  3DWP A;  1ZXT A;  1U4R A;  1GKH A;  3VR6 A;  3RMH A;  3A8I E;  1VQM A;  3RN2 A;  3G6E A;  1VQC A;  2RCF A;  1XPO A;  3AU7 A;  5A35 A;  3HOZ H;  1HPC A;  1A0I A;  2ZJP A;  2F4V L;  4HTH A;  1X32 A;  2R61 A;  1E2W A;  2UU9 Q;  3VR2 A;  3L9A X;  3N52 A;  3PGZ A;  3HOW H;  1SRU A;  1PZK D;  3K80 C;  1S4Z A;  3HKZ B;  2JK8 A;  5IT9 L;  2K50 A;  1A2U A;  4GKK Q;  1WD1 A;  4WJ3 M;  1D1I A;  1IL8 A;  1JE5 A;  1SBB B;  2IX3 A;  4L5Q A;  5C5M A;  1EFW A;  2B2V A;  4F87 A;  4QF4 A;  1X3P A;  1QZG A;  2XVS A;  1IYU A;  1NNX A;  4X64 L;  1UNS A;  1H9K A;  2R6G A;  4DFA A;  4FXG C;  1FNV A;  5M3M H;  5G3L F;  4R8N A;  3MFY A;  1YIT A;  4DV3 L;  2ENB A;  2F0T A;  2K4K A;  1PFM A;  2Z6K A;  1VQO A;  3H09 A;  1BQQ T;  1HCZ A;  1STB A;  3GTO H;  2F0K A;  1D2B A;  1QJO A;  4JI6 Q;  5D65 A;  2ZT9 C;  5C3W A;  2CH4 A;  2NVQ H;  2MUY A;  1C4Q A;  3STB D;  4H0L C;  2YU9 H;  1X56 A;  4C3H B;  2CQO A;  2B2T C;  3I4L A;  4C3H G;  3FMC A;  4AYB G;  3CCV A;  1PFB A;  4M8A A;  4LAA A;  4N9T A;  3FPU B;  1Y8O B;  1NMF A;  1RDP D;  1CZG A;  2VL6 A;  1SMY D;  2F0G A;  2LXK A;  3OWE B;  3NK9 A;  4GN5 A;  1G6Z A;  2E2I H;  2K14 A;  1JB3 A;  4RMF A;  1DON A;  4PMB A;  2KCM A;  3FRP B;  4J1M A;  1WCM H;  4DR4 L;  1V8Q A;  1D1K A;  2I5H A;  2JQO A;  2AQ3 B;  3KLS A;  3CKI B;  5EKL A;  2H4O A;  3J80 i;  3J80 E;  3W3A A;  5FLM G;  4DAV A;  4FF3 A;  3QB3 A;  3WDN A;  2HQE A;  4PNY A;  1KRS A;  2PMZ B;  3F2B A;  5FLM H;  5FOB B;  4A3I B;  4LFB L;  3NUC A;  1BNZ A;  4LF9 L;  5J1Z A;  4A3I G;  5DAU A;  4ME3 A;  4L63 B;  4ABN A;  3TN2 A;  4IPG A;  2FXQ A;  3A8K E;  5ELC A;  4A3M B;  1CSP A;  4NW2 A;  5C6A A;  3GTP B;  2VQF Q;  3TS0 A;  1JJC B;  4A3M G;  2N88 A;  4R4Q A;  1SJH D;  5IYC H;  1ONL A;  3MXN A;  1KL9 A;  2B8F A;  1N36 L;  1PH6 A;  2BOS A;  4N8F A;  5KND A;  4GN4 B;  1EOV A;  1VQ9 A;  2VZA A;  4NXN Q;  1F9P A;  5HGQ A;  2CKZ B;  2QIL A;  2PZU A;  1VQH A;  1VMC A;  2JJQ A;  3OW2 A;  3W2D A;  1IBM Q;  2X69 A;  2SNS A;  4XQN A;  2JN4 A;  4JK1 C;  4ZUJ A;  1YHA A;  5EBC A;  1F9Q A;  4JBW A;  2ZXP A;  4U67 3;  2EYL A;  4Q0F A;  3ULP A;  1JR0 D;  1U4M A;  1LLR D;  2JA7 H;  3HOU G;  2OQK A;  1XMQ L;  4LF7 L;  1X9N A;  4K0K L;  1QUQ A;  3LWE A;  4BWG B;  3CCU A;  3HOU H;  5HUR A;  1XTD A;  4EVO A;  2XN9 C;  2Z8L A;  1BBX C;  2C5C A;  1HUM A;  2VUM H;  4UP7 A;  1LUZ A;  3EVQ A;  5D14 A;  4C3J B;  2RHQ B;  2ID0 A;  1J8I A;  1FYC A;  2F0U A;  1XXG A;  1UE6 A;  2C35 B;  3EBE A;  4X65 L;  4B3S Q;  4MHE A;  1NUC A;  1Z47 A;  1VQI A;  2E2D C;  1SEB D;  3GV6 A;  1JOK A;  1E0B A;  5CGK A;  2XNA C;  1II3 A;  1A3V A;  1SR3 A;  1HXY D;  3CC4 A;  4GN3 B;  1GM5 A;  2D62 A;  4L5T A;  1H95 A;  1IKL A;  2NZO A;  4ZYS A;  4X3T A;  1H9J A;  5FJ8 G;  4HSV A;  1RKN A;  2K5Q A;  1SYE A;  4BXX H;  1BXT A;  3KF8 B;  2V1C C;  3DMU A;  4DF7 A;  3HOX B;  3GTJ B;  4KI0 A;  4KJO A;  3HOX G;  2UXB L;  1PFS A;  1TKW B;  1Z7T A;  1VQA A;  2DNC A;  5T1I A;  1KDC A;  4JI0 Q;  4GKJ L;  1SYD A;  4OX9 L;  3H0G H;  3ZJY C;  1Y1W B;  4DAY A;  3ULJ A;  1Y1W G;  4KN7 C;  1QZH A;  1LTB D;  1I3Q B;  4C2M H;  1SFO B;  5JEA H;  4EQP A;  1PYB A;  4MZ9 A;  2TSS A;  4P72 A;  4F7X A;  1KAB A;  1LTA D;  2JA8 B;  5FO8 B;  4KK7 A;  1F9R A;  4Z9C B;  1ZKO A;  4J15 A;  1H9S A;  3BZD B;  1G8Z D;  2EPB A;  1WJJ A;  2PI2 E;  2K05 A;  1JQY D;  3Q23 A;  1R9T H;  3WOF A;  1CFM A;  1Q81 C;  3TBI B;  1YNN C;  1TWH B;  2EY6 A;  1PRT D;  4RHS A;  2EJF C;  2LMC B;  4LF5 Q;  5LMN L;  1W2B A;  4YHH L;  2R7F A;  1DCZ A;  4L6T B;  1EU4 A;  2KHS A;  3T1Y Q;  5AJ3 Q;  4EGV A;  1FL0 A;  4QUF A;  1VF5 C;  2G9H D;  4LUZ A;  3TME A;  3VA7 A;  4GZY C;  3KFU A;  1STG A;  3MZ5 A;  3T13 A;  4A3D B;  2RKS A;  1WOC A;  2K6A A;  1YBY A;  4A3D G;  1LT5 D;  4P2C B;  1Q86 C;  1K8O A;  2L5T A;  4B3T L;  4LUO A;  1BCP B;  2C9O A;  1UE7 A;  2LY7 A;  3BVZ A;  3D4D A;  1DJR D;  4DV1 L;  3P75 A;  1KC8 C;  5EQ0 A;  4A93 B;  3PIO A;  1GOZ A;  2G9D A;  2QA4 A;  1YHQ A;  3I4N B;  3MAQ A;  4IFD H;  1I50 B;  1X3E A;  5C0X H;  2DN8 A;  2MGS A;  3RLN A;  2HQL A;  1PTO B;  2EYO A;  4JYA L;  3FVQ A;  1C7Y A;  1EU3 A;  4NDX A;  1GHJ A;  4OEL B;  5KGU A;  1Q1E A;  5IGF A;  4P75 A;  2HHH Q;  1QOH A;  3BYY B;  1MI2 A;  5CBE E;  1V1Q A;  1PH3 A;  2UUC L;  4OGQ C;  1EY6 A;  4H13 C;  3VR4 A;  5C3E B;  4R4C A;  4LF8 Q;  4DV7 L;  2F0L A;  2ZM6 L;  2A74 C;  3S1R B;  4IQZ A;  3CAM A;  3TQY A;  4QGU A;  1JWU D;  2Q2T A;  2CW0 D;  2HD3 A;  2ASB A;  3OSO A;  1OXT A;  1TWF B;  5J39 A;  1V1P A;  2EJG C;  2EY5 A;  3CRL C;  4IJL A;  3S2H H;  4TQU S;  4I7Z C;  4KY5 A;  4CKE A;  2EYP A;  4ALP A;  1K8G A;  3A5U A;  3K5N A;  3OMG A;  3TP6 A;  2JA6 H;  3OYY A;  2NVT H;  4LF6 L;  1A3U A;  1IBK Q;  4DV0 Q;  1RHP A;  3F8T A;  3G7L A;  5EPK A;  5JVG 3;  4RH6 A;  1BCP C;  3NHH A;  2IX1 A;  2GVA A;  1MJE A;  5IWA Q;  4JOI C;  4DV2 L;  4C3I B;  3RNU A;  1I4R A;  3CPF A;  3HRZ C;  4CKC A;  1HR0 L;  4C3I G;  1VF7 A;  5FO7 B;  1GXD C;  1PTO C;  1PFN A;  4JI1 L;  2L11 A;  5IGB A;  1MSH A;  1AP0 A;  2CWP A;  3MWY W;  3MFG A;  3J81 c;  3TEH B;  4LUV A;  1L1O B;  5JJL A;  1B8A A;  1PH1 A;  2MQH A;  3R8B A;  5JJZ A;  1TS5 A;  4IUT A;  3F2U A;  3M4O B;  2M9V A;  4JI4 L;  1GUO A;  1CKM A;  2AKW B;  3GTK H;  1PRT F;  4CDC C;  2BA0 A;  3GO5 A;  1NE3 A;  1E24 A;  2O5I C;  1DOK A;  3J80 L;  4GLX A;  2KED A;  2DY8 A;  2K5N A;  1NMG A;  2MO1 A;  4NXM L;  2KCC A;  2EVB A;  5IE8 A;  1YNJ D;  4PMC A;  2D9U A;  3NTK A;  3QIA A;  5CC4 A;  3HKZ E;  1S5D D;  1SJE D;  3G71 A;  4FF2 A;  4K5X A;  2R3Z A;  3KK7 A;  2K52 A;  2F0F A;  1XNQ Q;  3MXU A;  4HID A;  1MJC A;  4KJN A;  4MN3 A;  3GTG B;  1WTW A;  3DWA A;  3QWN A;  3J7Z C;  2ICE C;  3ER0 A;  4B3R Q;  3GTL B;  1CKN A;  4X66 Q;  3KUP A;  1WI5 A;  2QDB A;  1KAW A;  1PH9 A;  1UE5 A;  3CRK C;  4DK6 C;  2FFK B;  4IN3 A;  2QEX A;  1JOR A;  2OWO A;  2UU9 L;  3CCQ A;  1X3F A;  1XMO Q;  4MNO A;  5M5X B;  4LNQ A;  1WYD A;  4QJF A;  2QDL A;  1Q82 C;  3OIQ A;  3M85 A;  3LWU A;  3S1N B;  2E2J B;  2AQ1 B;  4GKK L;  4A3E B;  4OIJ A;  3NXW A;  5D3D A;  1IYJ B;  3I4M H;  3HEJ A;  1L1O C;  1VQG A;  1BDO A;  1EYG A;  4BY1 B;  1EWI A;  1ET9 A;  1QE6 A;  2NVX H;  1LYL A;  3BG3 A;  4BY1 G;  1I6H B;  4B3M Q;  2XSC A;  1Y69 U;  1RD9 D;  5C4X B;  1UEB A;  2F0J A;  2A69 D;  5H1S E;  1AEX A;  3S1M H;  5C4X G;  3NWT A;  2FMM A;  5CMD A;  2GA4 B;  2RBM A;  1E1T A;  4R8I A;  1OTC A;  4KD3 A;  2GVB A;  3NSW A;  4K6L A;  1LV9 A;  4A3K H;  1GHK A;  5NUC A;  2CHB D;  3HOY H;  5JJK A;  2PMZ E;  4FNF A;  1B70 B;  3T4A C;  3J81 i;  3J81 E;  4A3J H;  4CJ0 B;  4DNI A;  4UY8 C;  2PZT A;  5JJI A;  3S16 H;  3UDG A;  1U4P A;  4FXD A;  5L37 A;  1E2V A;  1ASZ A;  4IAL A;  5ELF A;  2VW9 A;  2L55 A;  4JI8 L;  3PIO 3;  2YV5 A;  1PYS B;  5LL6 S;  3SK6 A;  1SNM A;  3D31 A;  2OXP A;  2FIN B;  1ILQ A;  3FEW X;  2GN5 A;  2IHE A;  2NVY B;  4KKU A;  2NN6 I;  1TWG H;  1HTP A;  3NBI A;  2NYZ D;  2DJF C;  3KF6 B;  4JI5 Q;  1EY8 A;  4RWS C;  4DR1 Q;  4B9X A;  2Z4H A;  3KYH C;  5GQO A;  2DUD A;  1SE2 A;  4K6D A;  2E5L Q;  1MBY A;  4BBR B;  1EQT A;  1LT6 D;  4IUV A;  3KJP A;  2VQF L;  1TWC H;  1QG7 A;  1F9S A;  4A3C G;  4X6A H;  2A68 D;  3T1H L;  2K7V A;  4JI2 Q;  1Y1V B;  4KHV A;  3DEO A;  1ICF B;  4EQN A;  4CBV A;  4DV4 Q;  4ODG A;  1M4V A;  4GOP B;  2EQS A;  3CW2 C;  2V4D A;  2CWA A;  4NXN L;  1SYC A;  1HZA A;  2CH4 W;  1ML0 D;  5JEA J;  2KEN A;  1G6P A;  3PUX A;  5FO9 B;  5IOC A;  3DEP A;  4HJ7 A;  1K0R A;  4G7H C;  1IBM L;  1IXR A;  1RCV D;  2MHV A;  2L15 A;  4QB4 A;  1J5E Q;  3H6M A;  3HOZ B;  2WAQ G;  5IOD A;  1S3O A;  3E0E A;  3HOZ G;  1L0X B;  2CQA A;  1I4P A;  2BCO A;  4DK1 A;  4IPH A;  1VQJ A;  2DJG C;  2M2L A;  2TMP A;  3VYU A;  3HOW B;  4ZQ3 A;  4IOA A;  3LX0 A;  2QCP X;  2JEA I;  3HOW G;  2ZTD A;  3NE5 B;  1EYC A;  3P7J A;  4KV6 A;  2KJX A;  4K5W A;  3ZYY X;  3M7G A;  4QY7 A;  1VQF A;  2A5H A;  1VQ6 A;  4HCS A;  3TP5 A;  2P5Z X;  3D8G A;  3SK4 A;  1RF2 D;  3H94 A;  2R92 G;  1X65 A;  4H44 C;  3PO3 H;  2CFM A;  1C8C A;  3OTO Q;  3V2T A;  2R92 H;  5M3M B;  2OEO A;  5M3M G;  4A3L G;  4HN7 A;  1YEZ A;  4B3S L;  2B2W C;  3GTO B;  3STB C;  2QKI C;  4DR7 Q;  1QIL A;  4A3L H;  2IY5 B;  4JI3 Q;  3K0X A;  1SAP A;  4ILW A;  1MGS A;  1KXL A;  2NVQ B;  2SNM A;  2RDH A;  4IFD J;  4RGT A;  2YU9 B;  1IW7 C;  5C0X J;  4ZLT F;  1X54 A;  1JOO A;  3SE0 A;  2RA4 A;  4ZAI A;  1S5F D;  4BS9 A;  1SMY C;  3HP3 A;  3ND9 A;  1K3B C;  4GOP C;  2R93 G;  5A2Q E;  3K7A H;  2EYH A;  1HH2 P;  2VB2 X;  2KCT A;  4AYB B;  2FJ2 A;  1TQO A;  2R93 H;  2L1B A;  3R93 A;  1QNK A;  3C3L A;  4EQ5 A;  4ULL A;  4XYO A;  2E2I B;  5CV7 A;  1U4L A;  1CZW A;  2HDM A;  4LFC Q;  1WCM B;  2F0H A;  5CR3 A;  4U68 A;  4A3G H;  1RL2 A;  1WCM G;  4BBS H;  1K3R A;  2Z4I A;  3G6J B;  3ERS X;  4JVZ A;  1E22 A;  4JI0 L;  2NN6 G;  3MHB A;  1PH7 A;  1CQV A;  2PQE A;  4IPD A;  1HNW Q;  1U0L A;  3A0J A;  1EZ6 A;  2JEB I;  1YJN A;  3BVM A;  2NN6 H;  2Z1C A;  3JC6 6;  1FJG Q;  4JC0 A;  1NCV A;  4DXG A;  1HJP A;  3NQT A;  3T51 B;  1HRJ A;  3CCM A;  3Q0A A;  1XX8 A;  2JP1 A;  4DXF A;  1TS2 A;  5IYC G;  1TWA H;  3AYH B;  4JV5 Q;  3EA6 A;  5E4X A;  1DYQ A;  3M7N A;  5GRO A;  1V1O A;  1SYF A;  3KBG A;  2O2L D;  4B9W A;  3CQZ H;  1KHI A;  1PDQ A;  2E2H H;  4LF5 L;  2IL8 A;  2E8G A;  1RTO A;  3R2T A;  3CPW A;  4RG1 A;  4RFB A;  5E3F A;  1B50 A;  1G2T A;  1C48 A;  4HIO A;  1SMX A;  3T1Y L;  5IP7 G;  4LK1 C;  1WFQ A;  3IKJ A;  2PNR C;  5IP7 H;  3K7U C;  1KTK A;  5LMU Q;  1CA5 A;  4DAP A;  4UPA A;  4FXK C;  5GAD C;  1IL2 A;  4O42 A;  3ULL A;  1VQE A;  4BA2 I;  2JA7 B;  3E6Z X;  1FNW A;  3RN5 A;  2JA7 G;  1SSO A;  4RCO A;  3HKS A;  3HOU B;  1PA6 A;  1NJI C;  3IFT A;  3RD4 A;  2YTX A;  3N6R A;  2XWB B;  5IP9 G;  1VCI A;  4IFD I;  1HZ9 A;  5C0X I;  2F3W A;  5CYU A;  3I91 A;  1M1K C;  1AZQ A;  5IP9 H;  2ATW A;  2VUM B;  4PQX A;  4Y7N H;  2O4X A;  1WTX A;  2VUM G;  2QGQ A;  4YY3 Q;  4FDB A;  1PRT B;  2Y0S B;  2WII B;  4LMQ D;  2HHH L;  3IFD A;  1PVO A;  2Y0S G;  5KNB A;  4P74 A;  4HED A;  3PV0 A;  3W1B A;  2J0T D;  4OHJ A;  4LF8 L;  3BZC A;  3EN2 A;  1AE2 A;  1Q1B A;  3I72 A;  4HMI A;  2H1E A;  5FK9 C;  1I4G A;  2PCF B;  1D8L A;  2Q8R E;  5JOB A;  5ELN A;  1JWS D;  5IT9 c;  4NB3 A;  1PYW D;  3KDF A;  1EWH A;  4QQB X;  2BDO A;  3MTS A;  1AZP A;  3C1E A;  1ICW A;  4YWM A;  1A6X A;  4BXX G;  2N49 A;  1QCB D;  1PV4 A;  1XNR Q;  3H3V I;  4HJ9 A;  4WRD A;  2BH2 A;  2B2U C;  3P20 A;  3OWF A;  4XQJ A;  4DV0 L;  1GUT A;  1IBK L;  2F52 A;  3DHQ A;  5DNF A;  2JXM B;  3GTM H;  1FD7 D;  3H0G B;  1JE4 A;  1BOS A;  3H0G G;  4DR6 Q;  1YNX A;  1JIC A;  3A54 A;  4YCU A;  4C2M B;  5IWA L;  3QOL A;  3AQQ A;  2SOB A;  1DZ1 A;  1XPU A;  2KBN A;  5JEA G;  4NP5 A;  5C44 H;  4J8Q A;  3HS0 C;  3RZD H;  2QF7 A;  5GAH C;  4MIU A;  3B6Y A;  4JPB W;  5M5W H;  3E9H A;  4FO2 A;  5CV5 A;  4DNR B;  1W3S A;  1PRT C;  1R9T B;  1PZI D;  1LAB A;  4V19 0;  4DR4 Q;  1KAA A;  1VQL A;  2HIV A;  1J6Q A;  4JI7 Q;  2VXW A;  1B9M A;  3VR3 A;  1KLU D;  4GNX A;  2WFW A;  1Q8K A;  2WIN B;  1VQ4 A;  4IZ8 A;  5TSS A;  2B2V C;  1MHW C;  2PZW A;  3I3C A;  2JE6 I;  4BA1 I;  3MXN B;  2BE5 D;  1F2L A;  2AHO B;  3JAM L;  3GTQ H;  3K0Y A;  2Z6K C;  4POG A;  2AQ2 B;  5I4D A;  2FMC A;  5BN3 A;  2B2Y A;  1BBU A;  1TR5 A;  1CK1 A;  2BA1 A;  4AQY Q;  1IYV A;  3I7F A;  1XNQ L;  4GLV B;  3K81 C;  2HCI A;  4XT3 B;  1IHZ A;  2F1M A;  3A56 A;  4IFD G;  3S14 H;  3E3X A;  3CC2 A;  5C0X G;  2I0Q A;  3U50 C;  1I4Q A;  2VB3 X;  3CF5 A;  2PI2 A;  4WOR A;  1CM9 A;  4X62 Q;  2XIW A;  4X66 L;  5IT9 E;  4OXP A;  3ITP A;  3UDF A;  2EYM A;  5ELE A;  2ALY B;  2N78 A;  1K8M A;  3W5O A;  1QUQ B;  4E6I A;  2MFI A;  1K83 H;  2WKC A;  5K36 H;  1XMO L;  3RLF A;  3WOE A;  4KY7 A;  1V43 A;  1CUK A;  3NEN A;  1ENF A;  4IO9 A;  3S9W A;  4F8M A;  4A93 H;  1VQ8 A;  3GQB A;  2PW5 A;  3L2P A;  1CTM A;  3S2H B;  2VQE Q;  1ESF A;  3I4N H;  1WTP A;  3EJI A;  1R4Q B;  1D5X C;  4LFA Q;  1NY4 A;  1AE3 A;  2YYZ A;  2NTT A;  4B3M L;  1O78 A;  3PSI A;  1NAP A;  4G4K A;  2JA5 G;  4C1N K;  2JA6 B;  2IW3 A;  2NVT B;  2JA6 G;  2F0Q A;  3L3O C;  1KNA A;  3NTH A;  2JA5 H;  1PZJ D;  4PMW A;  1SDF A;  2A6H D;  1EY5 A;  3KOJ A;  3NBH A;  1I94 L;  3S1Q H;  4OO1 I;  1E1O A;  3PUZ A;  1KDA A;  1VQB A;  3PMF A;  3SR1 A;  3H3V H;  1T5E A;  5DM7 3;  2OTJ A;  4QUC A;  4YWL A;  1XJV A;  2KHJ A;  3AFQ A;  1D7Q A;  1A2T A;  2D2C C;  1P8L A;  3PO2 H;  3QG1 A;  4KHP L;  3BDL A;  1STE A;  1TT2 A;  1HZC A;  3MXP A;  4CDE C;  2PW7 A;  1JT8 A;  2R7D A;  1O80 A;  3S15 H;  2PQA A;  5KNC A;  1C0A A;  1TS4 A;  2YTY A;  1YJ9 A;  2X6G A;  1AFP A;  4RGM A;  3OOC A;  3FKI G;  4HR7 B;  4DNT B;  4OWT B;  1LO5 D;  2UUB L;  2M00 A;  1A63 A;  5BN4 A;  1SXT A;  4RHR A;  4DAY B;  4FF4 A;  3FKI H;  2OQ0 A;  3Q8D A;  1L0Y B;  1EIH A;  4GKJ Q;  1EY7 A;  2KEE A;  4DUY Q;  4J6H A;  1QNU A;  4DR1 L;  3GTK B;  3T16 A;  4DV5 Q;  3CU7 A;  1H9S B;  1YNJ C;  2EYJ A;  3R2I A;  1XYI A;  2X6L A;  3W1G A;  2RHS B;  4FF1 A;  2I5M X;  2KEC A;  1EIG A;  5IGG A;  4XT1 B;  2UUA Q;  2N3S A;  5M3F H;  3M3Y H;  2Q2U A;  3S24 A;  4M1U B;  1EFI D;  2IHF A;  3FDT A;  2Q8I B;  4JI2 L;  3H15 A;  1PH8 A;  2XTI A;  3K58 A;  4X3U A;  3L0O A;  2WB1 B;  1VQ5 A;  1Q90 A;  1B3Q A;  2WB1 G;  4IJH A;  2R7Z H;  4JW0 A;  4BY7 G;  4CHT B;  1KD1 C;  1J5E L;  4I7A A;  5BR8 Q;  2B2T A;  3D6C A;  4IUP A;  4BY7 H;  3CME A;  3NEM A;  3RZO B;  3OMC A;  3O13 A;  1EL0 A;  4RGN A;  4HMJ A;  2K1B A;  3G48 A;  1DXM A;  1BKB A;  2ZTC A;  5EKK A;  5C4Z A;  1N32 Q;  2PYK A;  3BDC A;  5ELO A;  1C9O A;  3HG9 A;  1IBL Q;  1UAP A;  2F0P A;  4KN4 C;  3OW7 A;  4NKL A;  5EBD A;  4XYQ A;  2VS1 A;  2XRS D;  5IY0 A;  4ZUI A;  2IPK D;  3SK8 A;  5M5Y H;  4ZKB B;  3VYS A;  1VQP A;  3TSS A;  1NTG A;  2F03 A;  5F2D A;  3TRZ A;  1DOM A;  3I4M B;  3I2Z A;  1O7L A;  1MSG A;  2A69 C;  1ET6 A;  4H7B A;  3I4M G;  2NVX B;  4AYB E;  1F2M A;  5LL6 X;  3OTO L;  1PH4 A;  4KD4 A;  4R9W A;  5E1F A;  4HJ8 A;  3QR8 A;  4X3K A;  5CV8 A;  3S1M B;  1EYD A;  2NBF A;  1JOQ A;  2Z9H A;  1STY A;  5GAE C;  2HIX A;  4DR7 L;  1MKH A;  4A3K B;  4G7O C;  3A74 A;  4JI3 L;  3HOY B;  4A3K G;  1V1P B;  4OO1 G;  2K5D A;  3HOY G;  3S17 H;  3AB9 A;  5JVH 3;  5CBA E;  2NB0 A;  1K9M C;  2A1A A;  5KIX A;  4JI6 L;  4OO1 H;  4A3J B;  3I70 A;  4JBJ A;  3SGI A;  3NWS A;  4A3J G;  4A3F H;  3C1F A;  3S16 B;  5DLQ E;  3K57 A;  4WJ4 A;  5HY6 A;  2MJ8 A;  5LMN W;  2F0O A;  1B3A A;  1XTC D;  1I6H H;  1W6K A;  2SDF A;  2NUC A;  4LFC L;  2HDL A;  4LF6 Q;  5KRU A;  2A8V A;  3I73 A;  5C4J H;  1TWG B;  4IUN A;  5DEH A;  3X3M A;  2RCN A;  2OCE A;  3AEV A;  1ENA A;  2LFN A;  3CCS A;  1AW7 A;  4KTA A;  3A7A B;  1HNW L;  1G29 1;  1VS0 A;  4DR5 Q;  4QL5 A;  2EXZ A;  3UE0 A;  3VYR A;  1Y8P B;  4DV2 Q;  2CCZ A;  3F2C A;  1FJG L;  2BH8 A;  2A68 C;  5IGE A;  1K0S A;  1WTH A;  4HIK A;  2EZV A;  4PZ8 A;  2B3G A;  1TWC B;  4FP5 D;  4L5R C;  3HOV H;  2G5D A;  4XTC S;  3A55 A;  4R4O A;  1LTS D;  2D5D A;  1X55 A;  4NPS A;  3SK5 A;  1N34 Q;  2EXD A;  1BCP F;  1CQF A;  1Q46 A;  1ZYR C;  2A6E C;  2B63 H;  5IYB H;  1S5B D;  2NWG A;  3SDZ A;  1CHP D;  4X3S A;  3MC0 B;  3VR5 A;  3CCR A;  1EQV A;  4PZ7 A;  4DR3 Q;  3GV3 A;  3MEH A;  4DK0 A;  1BR9 A;  4JI4 Q;  1VDZ A;  3A5Z B;  5ELD A;  3D0F A;  1NBW A;  4PG3 A;  2LKV A;  4HJ5 A;  1CI3 M;  2Y0S E;  1I5F A;  4IPC A;  1LT4 D;  1DGS A;  2AMC B;  2EY1 A;  1HQR D;  1FGB D;  3K5O A;  4UAI A;  4A3B H;  2IJ0 A;  2WAQ B;  3BDO A;  5LMU L;  3UI2 A;  2N8N A;  1DM0 B;  1QVF A;  1JCK B;  1KLG D;  2PNH A;  3I55 A;  4A4I A;  3M9B A;  3GP7 A;  3TDQ A;  1U5K A;  5D3I B;  3S2D H;  1CKN B;  1YVC A;  3M4Y A;  2EJM A;  1FVI A;  3PO3 B;  4TSS A;  1EY9 A;  5EPJ A;  3PO3 G;  2L4N A;  2KA7 A;  3TP8 A;  2D0O A;  2R92 B;  1SLJ A;  5C3X A;  1W6J A;  4YY3 L;  1N8R C;  5KEE A;  5E7N A;  5EGT A;  2VNU D;  4DU9 A;  3VA5 A;  2K5V A;  3OHX C;  1HR0 W;  2LSS A;  1JWM D;  1WD0 A;  2N55 A;  1CSQ A;  3K5M A;  3ERO A;  1QB5 D;  4DUZ Q;  1SN8 A;  1OXX K;  5T1G A;  3HKZ G;  1MD2 D;  2AWO A;  2ZTE A;  1N33 Q;  1RTN A;  3PUY A;  3K7A B;  1HNX Q;  4AH6 A;  5FKA C;  1EQQ A;  4LF4 Q;  2RSO A;  2R93 B;  1AH9 A;  4MTK A;  3PIP A;  4JCV E;  2UXC Q;  2JYO A;  4G7Z C;  1EY0 A;  1T5X D;  1BVS A;  4F88 A;  2Q8T A;  2KUM A;  2UXD Q;  4EQO A;  1X3G A;  1SE4 A;  4A3G B;  1XNR L;  4QIW B;  4BBS B;  2F0D A;  1P16 A;  4C56 C;  3BJU A;  4A3G G;  2RQX A;  5EKI A;  4BBS G;  3TP7 A;  3J7Y W;  1LTG D;  4PZ6 A;  1Q7Y C;  1TY0 A;  4P71 A;  2F0S A;  2F0E A;  2PPB C;  1SE3 A;  1FR3 A;  1XWE A;  4A75 A;  3KF8 A;  4DR6 L;  3VDY A;  1S40 A;  3MXG A;  1LTT D;  3FP9 A;  1G91 A;  1EOT A;  3Q22 A;  4PV1 C;  1IW7 D;  1BBW A;  5LHY 1;  1JJ2 A;  4C3H H;  2F3V A;  5ISR A;  1HA5 A;  4JI8 Q;  3SHL A;  2WV6 D;  4DV6 Q;  1TWA B;  3L7Z C;  4UP8 A;  1O7Y A;  1HNZ Q;  1F2Z A;  3J7A F;  2WKD A;  1HTL D;  3C46 A;  1KQS A; 
#chains in the Genus database with same CATH homology
 3J81 c;  1K73 C;  1J6Q A;  3TEH B;  4LUV A;  4JI7 L;  3JAM i;  4JI7 Q;  2B29 A;  2XGT A;  4APV A;  2NVY H;  1L1O B;  3EIV A;  5JJL A;  1B8A A;  3CMA A;  1PH1 A;  4JBM A;  1JMC A;  2MQH A;  4OWX B;  2JA9 A;  4GNX A;  2WFW A;  1Q8K A;  1VQ4 A;  1PHJ A;  4JI4 L;  1JB7 A;  4KLK A;  1CKM A;  2AKW B;  5IYD G;  3GTK H;  1TXY A;  1CKO A;  1O7I A;  2BA0 A;  2JE6 I;  1NE3 A;  3GO5 A;  3MXN B;  3U4V A;  1E24 A;  4BA1 I;  5AJ3 L;  4DR2 Q;  4A3I H;  5IYD H;  4BBR G;  2AHO B;  3GTQ H;  4GLX A;  1VQ7 A;  1VQN A;  4POF A;  2K5N A;  1NMG A;  2MO1 A;  2Z6K C;  3T1H Q;  4NXM L;  1EQR A;  5IE8 A;  4NXM Q;  4A3M H;  4BBR H;  3GTP H;  2Q2I A;  3MEF A;  1Y1V G;  4A3C H;  1BBU A;  3HKZ E;  1UE1 A;  3J80 c;  3G71 A;  4AQY L;  2BA1 A;  4OON A;  4AQY Q;  3ICE A;  2ZJR A;  2K52 A;  3I7F A;  1Y1V H;  1XNQ L;  4GLV B;  3RR5 A;  1XNQ Q;  3K81 C;  3K8A A;  4HID A;  1MJC A;  3UDX A;  4IFD G;  3S14 H;  4GS3 A;  3UE1 A;  5C0X G;  1OXV A;  3KLW A;  1XPR A;  1M90 C;  2I0Q A;  3CC2 A;  3U50 C;  5FLX c;  3CF5 A;  3J7Z C;  1YZ6 A;  2PI2 A;  1GKH A;  4JOI A;  4X62 L;  4X62 Q;  3ER0 A;  4X66 L;  1VQM A;  1CKN A;  4OXP A;  4X66 Q;  3RN2 A;  4B3R Q;  3G6E A;  1WI5 A;  1VQC A;  1KAW A;  3UDF A;  1PH9 A;  1UE5 A;  2EIF A;  1XPO A;  4DK6 C;  1LM0 A;  2ALY B;  1GO3 E;  2N78 A;  4LWC A;  2QEX A;  3HOZ H;  1A0I A;  1QUQ B;  1N9W A;  2MFI A;  3W5O A;  2ZJP A;  1K83 H;  2OWO A;  2UU9 L;  2F4V Q;  3CCQ A;  2UU9 Q;  3BZK A;  1XMO L;  1X3F A;  1XMO Q;  4POG A;  4MNO A;  3PGZ A;  3RLF A;  3HOW H;  1SRU A;  1V43 A;  1CUK A;  3NEN A;  1WYD A;  4QJF A;  1Q82 C;  4LNQ A;  3K80 C;  3WWV A;  3M85 A;  2JK8 A;  4MTN A;  4IO9 A;  2K50 A;  4GKK L;  4GKK Q;  3CCE A;  1OXU A;  4A93 H;  1VQ8 A;  4WJ3 M;  3L2P A;  1IYJ B;  2VQE L;  1JE5 A;  2VQE Q;  3I4N H;  3I4M H;  1L1O C;  1VQG A;  1EYG A;  1EWI A;  4L5Q A;  4A76 A;  4L5S A;  1EFW A;  2NVX H;  1LYL A;  4LFA L;  4LFA Q;  4BY1 G;  1NY4 A;  1AE3 A;  2YYZ A;  4XIG S;  1QZG A;  1EIY B;  4B3M L;  4B3M Q;  3PSI A;  4X64 L;  4X64 Q;  1UEB A;  2R6G A;  2JA5 G;  1T9H A;  5H1S E;  1FGU A;  5M3M H;  3S1M H;  5C4X G;  2JA6 G;  4C3J H;  1YIT A;  4DV3 L;  2JA5 H;  4DV3 Q;  1E1T A;  1OTC A;  4PMW A;  2K4K A;  1I94 L;  3KOJ A;  2GVB A;  2Z6K A;  1VQO A;  1S72 A;  4OWW B;  1E1O A;  3S1Q H;  3PUZ A;  4OO1 I;  1Q12 A;  1VQB A;  3GTO H;  4A3K H;  3H3V H;  4JI6 Q;  1Y14 B;  3HOY H;  2OTJ A;  4YWL A;  1XJV A;  2KHJ A;  2NVQ H;  5EAY A;  5JJK A;  1EIF A;  1A8V A;  2PMZ E;  3J81 i;  1B70 B;  3AFQ A;  3STB D;  1D7Q A;  2YU9 H;  1X56 A;  1P8L A;  3PO2 H;  2KHI A;  3KJO A;  4KHP L;  4A3J H;  2CQO A;  5C44 G;  1HZC A;  4DNI A;  4UY8 C;  2MNA A;  5JJI A;  4AYB G;  1JT8 A;  3CCV A;  2R7D A;  3UDG A;  3S16 H;  3S15 H;  2HT1 A;  2PQA A;  1ASZ A;  2VW9 A;  3DLL A;  1NMF A;  4JI8 L;  1C0A A;  2YTY A;  5FJ8 H;  1YJ9 A;  1B7Y B;  2YV5 A;  2VL6 A;  1PYS B;  2LXK A;  2K75 A;  3FKI G;  3D31 A;  3J81 j;  4OWT B;  4GN5 A;  2UUB L;  2OTL A;  2E2I H;  1A63 A;  2K14 A;  2WB1 E;  4DAY B;  4RMF A;  2ZJQ A;  3FKI H;  2GN5 A;  2IHE A;  2KCM A;  2OQ0 A;  4DR4 L;  1WCM H;  3Q8D A;  3HOX H;  1LTL A;  3CP0 A;  3GTJ H;  2NN6 I;  4GKJ Q;  2I5H A;  2JQO A;  1TWG H;  4AIM A;  4DUY L;  4DUY Q;  1IZ6 A;  1ASY A;  3KF6 B;  4KHZ A;  3J80 i;  4JI5 Q;  1PH2 A;  5FLM G;  4DR1 L;  4DR1 Q;  3TRE A;  4DV5 L;  1KRS A;  4YCV A;  4DV5 Q;  3KYH C;  3F2B A;  3U58 A;  5FLM H;  1Y1W H;  3GDE A;  4LFB L;  4LFB Q;  4LF9 L;  4LF9 Q;  1L1O A;  5GQO A;  4A3I G;  2DUD A;  3W1G A;  1I3Q H;  4ME3 A;  2RHS B;  2E5L Q;  2JA8 G;  3UDI A;  2I5M X;  2AWN A;  4IPG A;  1SFO H;  2FXQ A;  1CSP A;  2A19 A;  3KJP A;  3RLO A;  2VQF L;  2VQF Q;  1JJC B;  1TWC H;  3TS0 A;  4A3M G;  2UUA Q;  1KIX A;  2N3S A;  2UUA L;  4R4Q A;  5M3F H;  2JA8 H;  3M3Y H;  2Q2U A;  1L2F A;  5IYC H;  4A3B G;  3S24 A;  4A3C G;  3T1H L;  4X6A H;  2IHF A;  3I4O A;  4JI2 L;  4JI2 Q;  3H15 A;  1PH8 A;  1KL9 A;  2XTI A;  1N36 L;  3L0O A;  3G4S A;  1PH6 A;  1N36 Q;  4DV4 Q;  4GN4 B;  4GOP B;  1EOV A;  2EQS A;  1VQ5 A;  3CW2 C;  1VQ9 A;  2CWA A;  2VZA A;  2WB1 G;  4NXN L;  4NXN Q;  5HGQ A;  2CKZ B;  4IJH A;  1HZA A;  3PF5 A;  5JEA J;  2NZH A;  1Z9F A;  1VQH A;  1TWH H;  2JJQ A;  2KEN A;  2R7Z H;  1G6P A;  3OW2 A;  3PUX A;  1YJW A;  4BY7 G;  4HJ7 A;  2Z0S A;  1K0R A;  1IBM L;  1IXR A;  1KD1 C;  1IBM Q;  3CC7 A;  1J5E L;  2L15 A;  5BR8 L;  5BR8 Q;  1J5E Q;  5GAG C;  4BY7 H;  3CME A;  3NEM A;  2WAQ G;  3M4P A;  4B3R L;  3CCL A;  1QVC A;  3G48 A;  1BKB A;  1S3O A;  1YHA A;  2ZTC A;  3E0E A;  3HOZ G;  1N32 L;  1N32 Q;  4IPH A;  5ELO A;  1C9O A;  1IBL L;  1VQJ A;  4JBW A;  1IBL Q;  5K36 G;  2YTV A;  4IOA A;  3ULP A;  2DGY A;  4A3D H;  2VS1 A;  2JEA I;  3HOW G;  2ZTD A;  5IY0 A;  4O2D A;  5M5Y H;  1VQP A;  2JA7 H;  3HOU G;  2OQK A;  1SRO A;  1MIU A;  1NTG A;  4QY7 A;  1XMQ Q;  3I56 A;  1XMQ L;  4LF7 L;  1VQF A;  1X9N A;  4LF7 Q;  1QUQ A;  3TRZ A;  1VQ6 A;  3HOU H;  3CCU A;  4K0K Q;  3I2Z A;  4K0K L;  1XTD A;  2IT1 A;  3I4M G;  3I4N G;  4AYB E;  2R92 G;  1E7Z A;  1X65 A;  3PO3 H;  2CFM A;  3OTO L;  3OTO Q;  1PH4 A;  1I50 H;  4HJ8 A;  2VUM H;  2WP8 J;  2R92 H;  4UP7 A;  1LUZ A;  2LXJ A;  2RHQ B;  2ID0 A;  5M3M G;  4A3L G;  1UE6 A;  2C35 B;  3EBE A;  5GAE C;  1YEZ A;  2HIX A;  4B3S L;  4X65 L;  4B3S Q;  4X65 Q;  4DR7 L;  1MKH A;  3PUW A;  3STB C;  4EX5 A;  4DR7 Q;  4A3L H;  3A74 A;  4JI3 L;  5C3E G;  4JI3 Q;  4DK3 C;  2IY5 B;  4A3K G;  3K0X A;  4R4I A;  4OO1 G;  1Z47 A;  1KXL A;  3HOY G;  3KDF B;  1VQI A;  3S17 H;  4Y52 H;  5C3E H;  4IFD J;  5C0X J;  1K9M C;  2A1A A;  4YWK A;  4JI6 L;  1X54 A;  4JG2 A;  1GD7 A;  3S1R H;  4JBJ A;  3PO2 G;  3SGI A;  1SR3 A;  4A3J G;  4A3F H;  2ES2 A;  3CC4 A;  4GN3 B;  5DLQ E;  1GM5 A;  4GOP C;  2R93 G;  4WJ4 A;  5HY6 A;  3K7A H;  1OXS C;  2D62 A;  3CD6 A;  1HH2 P;  3FHW A;  4JBK A;  5LMN W;  2KCT A;  4L5T A;  1TWF H;  1H95 A;  1SE8 A;  2R93 H;  4H02 A;  3DM3 A;  2NZO A;  1X6O A;  1YI2 A;  4EQ5 A;  1K8A C;  1I6H H;  5FJ8 G;  3NEL A;  4BXX H;  3PUV A;  4LFC L;  4LFC Q;  3KF8 B;  2V1C C;  4LF6 Q;  1YIJ A;  4OX9 L;  2A8V A;  2F4V L;  4KI0 A;  4A3G H;  1RL2 A;  1WCM G;  3M4Q A;  5C4J H;  3HOX G;  1K3R A;  4BBS H;  2RCN A;  2UXB L;  1PFS A;  2OCE A;  2UXB Q;  3AEV A;  3BU2 A;  3CCS A;  3J7A 5;  3ERS X;  1VQA A;  3CCJ A;  1E22 A;  4JI0 L;  2NN6 G;  4HJA A;  4JI0 Q;  1PH7 A;  4GKJ L;  4A93 G;  4DAM A;  1UWV A;  4IPD A;  1G29 1;  1HNW Q;  4IOC A;  1HNW L;  1U0L A;  3A0J A;  1VS0 A;  2JEB I;  4DR5 L;  3H0G H;  3ZJY C;  4DR5 Q;  1YJN A;  1A62 A;  4QL5 A;  4R4T A;  4JI5 L;  4OX9 Q;  3UE0 A;  1V9P A;  3ULJ A;  4DV2 Q;  3JC6 6;  1Y1W G;  2CCZ A;  3F2C A;  1FJG L;  1FJG Q;  1QZH A;  2BH8 A;  3GD7 A;  4JC0 A;  1QVG A;  2WAQ E;  4C2M H;  3PCO B;  1PYB A;  1HJP A;  4MZ9 A;  4HIK A;  1VQK A;  4PZ8 A;  3CCM A;  4P72 A;  3KF6 A;  2B3G A;  4L5R C;  3HOV H;  4C3I H;  4XTC S;  2E5L L;  4R4O A;  4J15 A;  4NPS A;  1VQD A;  1X55 A;  5M3F G;  1N34 L;  1N34 Q;  2EXD A;  5IYC G;  1TWA H;  1Q46 A;  4DPG A;  1WJJ A;  2MO0 A;  3AYH B;  4GNX B;  2B63 H;  2PI2 E;  4JV5 Q;  3M7N A;  1L0W A;  5GRO A;  5IYB H;  1R9T H;  1YHB A;  1Q81 C;  3TS2 A;  3CCR A;  4YCW A;  4PZ7 A;  4DV4 L;  1RIP A;  4DR3 L;  3CQZ H;  4DR3 Q;  2R7Z G;  1KHI A;  2E2H H;  4JI4 Q;  4LF5 L;  3CPW A;  2E8G A;  4LF5 Q;  5LMN L;  1W2B A;  5LMN Q;  4RG1 A;  4YHH L;  3A5Z B;  4YHH Q;  2R7F A;  3D0F A;  3AFP A;  4HIO A;  1NBW A;  1SMX A;  4PG3 A;  2D0P A;  3M4O H;  4HJ5 A;  3T1Y L;  4GOP A;  3T1Y Q;  2Y0S E;  5IP7 G;  1I5F A;  4IPC A;  1WFQ A;  1DGS A;  2AMC B;  4LW1 A;  5AJ3 Q;  1GVP A;  3HFZ B;  1FL0 A;  4A3B H;  4LUZ A;  5LMU L;  5IP7 H;  3K7U C;  5LMU Q;  2N8N A;  3KFU A;  4UPA A;  5GAD C;  1IL2 A;  3E9I A;  1VQE A;  3ULL A;  1WOC A;  4UP9 A;  4BA2 I;  4A3D G;  1YBY A;  3CXC A;  3JAM c;  1Q86 C;  1QVF A;  2PNH A;  3RN5 A;  4LUO A;  4B3T L;  4B3T Q;  1UE7 A;  2JA7 G;  3I55 A;  4A4I A;  3M9B A;  3HKS A;  1PA6 A;  1NJI C;  4DV1 L;  1U5K A;  2YTX A;  4DV1 Q;  1KC8 C;  1G51 A;  3S2D H;  1EUJ A;  1CKN B;  1YVC A;  3PIO A;  5IP9 G;  1VCI A;  4IFD I;  1HZ9 A;  1FVI A;  3F2D A;  5C0X I;  2QA4 A;  1YHQ A;  3PO3 G;  2IX0 A;  1M1K C;  1X3E A;  4R1J A;  2D0O A;  4GLA C;  4O0A A;  4DKA C;  5IP9 H;  1SLJ A;  3RLN A;  4Y7N H;  2ATW A;  2HQL A;  3GTG H;  2VUM G;  4JYA L;  2QGQ A;  4YY3 L;  4YY3 Q;  1N8R C;  1C7Y A;  4JYA Q;  1PH5 A;  5J3B A;  5E7N A;  4FDB A;  2VNU D;  2F3I A;  3RZO H;  4QIW E;  2K5H A;  1Q1E A;  2K5V A;  2HHH L;  4P75 A;  2HHH Q;  1HR0 W;  3GTL H;  1PVO A;  2Y0S G;  2LSS A;  3LGJ A;  1V1Q A;  1PH3 A;  4P74 A;  2UUC L;  2UUC Q;  1CSQ A;  3PV0 A;  3W1B A;  4R4C A;  4DUZ L;  4LF8 L;  4DUZ Q;  4LF8 Q;  1SN8 A;  1OXX K;  4P73 A;  4DV7 L;  2ZM6 L;  4DV7 Q;  2ZM6 Q;  3CAM A;  3TQY A;  3BZC A;  4QGU A;  3HKZ G;  5M5X H;  3EN2 A;  4GNX C;  1AE2 A;  1Q1B A;  2AWO A;  2ZTE A;  2Q2T A;  1N33 L;  1N33 Q;  4A3E G;  3PUY A;  4A3F G;  1HNX L;  2ASB A;  1HNX Q;  1D8L A;  1OXT A;  5ELN A;  4AH6 A;  5IT9 c;  4DR2 L;  2E2J H;  3S1N H;  4NB3 A;  2VY3 A;  1EQQ A;  4LF4 L;  4LF4 Q;  1AH9 A;  4A3E H;  3KDF A;  4QQB X;  3PIP A;  2UXC L;  4JCV E;  2UXC Q;  4IJL A;  3S2H H;  3NBH B;  4HIM A;  1JJG A;  4TQU S;  2I5L X;  4YWM A;  1BVS A;  4BY1 H;  4ALP A;  1K8G A;  4BXX G;  2UXD L;  2UXD Q;  3A5U A;  2N49 A;  1X3G A;  1XNR L;  5C4X H;  1PV4 A;  1XNR Q;  1I94 Q;  4HJ9 A;  3H3V I;  1P16 A;  2BH2 A;  3OYY A;  2JA6 H;  3BJU A;  4TVA B;  4A3G G;  4BBS G;  2NVT H;  4LF6 L;  4PZ6 A;  3IRB A;  1Q7Y C;  1IBK L;  4DV0 L;  1IBK Q;  4DV0 Q;  2F52 A;  4P71 A;  3GTM H;  3F8T A;  4A75 A;  2PQA B;  3H0G G;  2IX1 A;  1E3P A;  3U4Z A;  2GVA A;  4DR6 L;  4DR6 Q;  1YNX A;  3VDY A;  1S40 A;  4KHP Q;  4YCU A;  5IWA L;  1MJE A;  3AQQ A;  3FP9 A;  4JOI C;  5IWA Q;  3PF4 A;  1XPU A;  2KBN A;  5JEA G;  5C44 H;  1BBW A;  4DV2 L;  1JJ2 A;  2RF4 A;  4C3H H;  3RNU A;  3RZD H;  1HZB A;  1KRT A;  3CPF A;  4JI8 Q;  2H5X A;  5GAH C;  1HR0 L;  1HR0 Q;  3HOV G;  4DV6 L;  3B6Y A;  4DV6 Q;  3L7Z C;  4UP8 A;  5M5W H;  3E9H A;  2Q2H A;  1HNZ L;  2UUB Q;  1HNZ Q;  1W3S A;  4JI1 L;  4JI1 Q;  2B63 G;  2CWP A;  4DR4 Q;  5IYB G;  3F1Z A;  1VQL A;  2HIV A;  1KQS A;  4JV5 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...